1BBZA

Crystal structure of the abl-sh3 domain complexed with a designed high-affinity peptide ligand: implications for sh3-ligand interactions
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
b'NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABL TYROSINE KINASE
molecule tags Complex (transferase/peptide)
source organism Homo sapiens
publication title Crystal structure of the abl-SH3 domain complexed with a designed high-affinity peptide ligand: implications for SH3-ligand interactions.
pubmed doi rcsb
total genus 10
structure length 58
sequence length 58
chains with identical sequence C, E, G
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1998-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1bbzA00
1S1NA 3ULRB 2V1QA 1AVZC 1ABOA 1CKAA 4OMOA 2X3WD 4JZ3A 1E6GA 2L3QA 3VRZA 2YUOA 5GJWB 2DJQA 1AD5A 2ED0A 1WXTA 2JMAA 4R0KA 1JEGA 2DMOA 4F14A 1OPLA 1BU1A 3LH5A 3FJ5A 1Y57A 2E5KA 2LMJA 4X1VA 5IXFA 2KXCA 4JJDA 4J9IA 4LE9A 4J9GA 4RTXA 2LJ1A 3SEMA 1K0XA 1B3QA 5IHKA 4OMPA 1WIEA 1JXMA 2DRMA 2RN8A 3VS4A 1WA7A 1YN8A 2CH4W 1GBRA 2YDLA 2JTEA 4Z88A 2ECZA 2EW3A 1UUEA 1WI7A 2CSQA 1M3AA 4J9HA 1YWPA 1RI9A 4ESRA 1TUCA 1NLPC 2B86A 2PTKA 2YT6A 3PE0A 4HCKA 1A0NB 1GBQA 2KT1A 1BB9A 1I1JA 2FPFA 1Z9QA 1GL5A 2EPDA 1KSWA 1LCKA 1BBZA 4RTWA 3M0SA 1NM7A 2BZYA 2EVRA 1M3BA 4CC3A 2KROA 1X69A 1KFZA 2CT3A 5FWBA 1V1CA 2F2WA 4D8DA 2ROLA 4WCIA 4JJCA 2GBQA 3GBQA 1FMKA 2RQTA 2O31A 1ABQA 3RNJA 4RTZA 2JM9A 2YUNA 1JQQA 2EYZA 3IQLA 2RQRA 3TSWA 1QWEA 2LJ3A 1AOJA 4LN2A 2PNIA 2CREA 2QDLA 3PVQA 1YWOA 2JXBA 1SRMA 2GQIA 1N5ZA 4OMMA 4OMQA 2L2PA 1T3SA 4DEXA 1NYGA 1ZUYA 3REAB 2AK5A 2CT4A 2AKLA 1K0SA 1HD3A 1GRIA 1UHFA 2VWFA 2DBKA 2IIMA 2O9VA 1QLYA 3M0RA 2KNBB 3EG2A 1ZX6A 3RBBB 3VS5A 2LQWA 2I0NA 2VKNA 1MUZA 2JS0A 2DA9A 2K9GA 4LNPA 2GNCA 1XOVA 1JU5C 1B07A 2EGEA 2V1RA 3H41A 2OJ2A 2OAWA 2AZSA 1NEGA 2CUDA 3M0QA 4J9FA 2M51A 3SHWA 3R6NA 3PVLA 1M3CA 1PWTA 2KT8A 2YUQA 4CC7A 3A98A 3UA7A 1NG2A 3VS3A 2MOXA 2J6KA 4LUEA 2L0AA 2HCKA 2ED1A 1T3LA 4HXJA 2LX7A 2L3SA 2FRYA 3NMZC 2A08A 1NEBA 2HDAA 2DILA 3EG0A 1UFFA 4K11A 2JM8A 3VS1A 1AZEA 1I07A 5ECAA 3EHRA 5L23A 1M30A 4ZNXA 2OI3A 1NLOC 2RQVA 1MV3A 5IH2A 2J6FA 1QKXA 2HEQA 4IIMA 3UA6A 4Z8AA 4HVVA 3VS2A 2GTOA 1E7OA 1OPKA 2EGAA 5IHNA 2EQIA 3NPFA 4A63B 2SRCA 1RLPC 2RPNA 1PKTA 2DL8A 1ZUKA 2GTJA 2DVJA 4RTTA 1UGVA 3VS6A 1YCSB 2DNUA 2FG0A 2K2MA 3I35A 2ENMA 1W6XA 2PZ1A 2KE9A 1IO6A 2O9SA 1U3OA 1K9AA 4M4ZA 2EBPA 3NGPA 1SHGA 3M0TA 1VYVA 4CC4B 1UJYA 5IXBA 2DLPA 2XMFA 3NHNA 2GGRA 1K4US 5HCKA 2O88A 2LNHB 2F2VA 4LUDA 2W10A 2D0NA 2LZ6B 2KBTA 2CDTA 1ZSGA 2J6OA 4J9DA 4JPBW 2ABLA 2HSPA 2G6FX 2F2XA 3I9QA 4JJBA 1UHCA 3UATA 1ZLMA 4FSSA 4F17A 3EG1A 2DBMA 1KJWA 4J9BA 2DL7A 1H92A 3THKA 2YUPA 1CKBA 1RUWA 1U5SA 2JMCA 1UJ0A 3EG3A 1H8KA 1UTIA 2ROTA 1PHTA 1T0JA 1UE9A 2EYWA 1X6GA 2YSQA 2KRMA 4J9EA 4OMNA 1SEMA 1RLQC 1AWJA 1HSQA 2MCNA 2EYXA 5FWCA 1JO8A 2L3PA 3CQTA 4AFZC 2C0TA 1PRLC 2KYMA 2D8JA 1G83A 1OV3A 1X43A 3VS0A 4D8KA 2SEMA 1WFWA 3I5SA 5GJVB 2LQNA 1SRLA 1W1FA 1YP5A 1EFNA 1X6BA 1WXBA 2CH4A 1QWFA 1X27A 2DL4A 2X3XD 2K7AA 1HJDA 1PRMC 2K79A 2LJ0A 2KGTA 1UG1A 1TG0A 4RTVA 1FYNA 1WXUA 3QWXX 1WLPB 1ARKA 3UF4A 2NUZA 2H8HA 1BK2A 3TSZA 1OEBA 3H0HA 1QCFA 1W70A 4F16A 2HBWA 2A37A 1SSHA 4RTUA 1ZBJA 4J9CA 2J05A 3VRYA 1X2KA 3EHQA 2EGCA 2NWMA 1T0HA 1OOTA 4IIOA 2W0ZA 1AWOA 2KXDA 2RF0A 4AG1C 2DE0X 1SHFA 2AZVA 2J7IA 2D1XA 5I11A 1J3TA 2BZXA 2DYBA 1ZUUA 2K6DA 4RUGA 2LCSA 2MIOA 1AEYA 5FW9A 4HVWA 4Y92A 1K1ZA 1SPKA 3O5ZA 4QT7A 2CSIA 5EC7A 4Z89A 2JW4A 1I0CA 1UDLA 1WDXA 3U23A 1MV0B 2BZ8A 2EYYA 4RTYA 1VA7A 1NYFA 4OMLA 2RNAA 4AG2C 1QKWA 3H0FA 3REBB 2DF6A 1GCQC 1PKSA 1VYTA 2ESWA 3EGUA 4E6RA 1AWWA 2JT4A 2RMOA 1AWXA 3I5RA 4EIKA 2BTTA 3JV3A 4KRTA 1JXOA 2DM1A 2CUBA 3QWYA 1TUDA 3KFVA 4CC2A 2A28A 2KR3A 4AFSC 2DRKA 3TVTA 2DX1A 1GCQA 3M0PA 1Y0MA 1U06A 1YNZA 1H3HA 1X2QA 1PNJA 1VYUA 5IHIA 2A36A 1M27C 2FEIA 1KIKA 2AKKA 3VS7A 1E6HA 4AFUC 4ORZA 4HVUA 2FPDA 2JS2A 3M0UA 2DL5A 2LP5A 1AZGB 1WYXA 5I22A 3H0IA 4GBQA 2FPEA 1K76A 2C0IA 4AFQC 1M8MA 1WX6A 1CSKA 2KYBA 4GLMA 2M0YA 2C0OA 2RQWA 2FRWA 2K3BA 2EKHA 1Z9ZA 1GFDA 2KRSA 4DEYA 2FO0A 2RQUA 2J06A 3ZL7C 2VVKA 4JZ4A 1G2BA 2D8HA 3C0CA 1GFCA 2KRNA 2KEAA 1GCPA 2DL3A 1UECA 2O2OA 2P4RA
chains in the Genus database with same CATH superfamily
3ULRB 4JRQA 5HY6A 2X3WD 2EFIA 2QQAA 2DXTA 2L3QA 4DBHA 2M16A 3VRZA 3CXCA 2YUOA 1WJQA 4IKFA 5CKDA 1WXTA 3FDRA 4HT8A 4XTUA 2RHUA 1QCNA 3L1AA 4E7IA 3FJ5A 5C6SA 1ZHIA 1UGQB 4E7LA 2F5KA 3OA6A 2CP5A 3LGLA 1TSFA 3LGFA 3CC4A 4DOVA 3CCRA 1V29B 3CPWS 1VQMQ 4PFPA 2DIQA 3CCUA 4JJDA 1I8FA 2IVWA 2NYSA 1QP3A 3R6OA 5I21A 1QVGA 1M90R 4BD3A 3JCMQ 4RTXA 2JTMA 1NBEB 2MAMA 2DRMA 2RN8A 4FCYA 3A8GB 4C0FA 1YJ9A 2EAYA 1GBRA 4XTWA 4J5YA 2ECZA 1PD1A 2RHYA 4C8QF 1WI7A 1KD1R 3CCVT 4J9HA 3G6EQ 1RI9A 4FL6A 4ESRA 3PMIA 1YI2Q 1MHNA 4ZN1A 5HK3A 1Y96B 4DA4A 2K5LA 1Z9QA 2EPDA 3NFCA 1KSWA 1LCKA 2K4YA 2RJCA 4E7HA 2BUDA 2EVRA 1VQLT 1X69A 1TTHB 2CT3A 4BACA 4A53A 2NUTB 4D8DA 2ROLA 2DFUA 4JJCA 4C8QG 2DJZA 4BY6B 4KH0B 3GBQA 1OQKA 1LVKA 2RQTA 4P5NA 3I56A 1ABQA 2RJFA 2XI9A 4E7JA 2YUNA 1VQOA 1G3WA 2RQRA 3TSWA 4M7DE 1YJ9T 4UC4A 4XTZA 3BDUA 3JCMX 1K73C 1G3SA 3SWNC 3J80E 2QDLA 4PNOA 1SRMA 2E41A 3JCMf 3RIRA 1OZ3A 1JJ2A 3REAB 2AK5A 1ZA1B 2CT4A 3QG1A 3VYHB 1UHFA 5GAN6 4N4GA 5GMKj 3CCEA 3M0RA 2KNBB 2VYTA 3EG2A 3RBBB 3VS5A 3OQ5A 2I0NA 1MUZA 2JS0A 4L6V5 5LJ5h 2K9GA 1YJ9Q 2DERA 1BCOA 5KYXB 1XOVA 2V1RA 3H41A 3EAEA 1VQNA 1QCOA 2OAWA 2CUDA 3M0QA 4KGVB 3CBMA 4J6YA 4M7AC 1SSFA 1VQ6A 1M3CA 3EFRA 2EQKA 3G71T 3FC3A 4M7DC 3A98A 3M54A 3UA7A 1WJRA 4PJOA 2H3JA 3AT1B 3OYFA 3L2ZA 2LX7A 3CCMT 3CCVA 3QJ6A 3NMZC 1NEBA 2DILA 1AZEA 4J6XA 1I07A 2ZPHB 1M30A 2PUKB 4ZNXA 2VV5A 3HFOA 1VIEA 3G4ST 4AMCA 5IH2A 4KUIA 3E2UA 3UA6A 4ATOA 4HVVA 5GAN4 3CMAQ 2GTOA 3CMAA 1PD0A 1O9SA 4A63B 2PUOB 2SRCA 1PKTA 2GTJA 3MHXA 2DVJA 3FB9A 2OTJQ 4RTTA 3RR6A 4PFZA 1YCSB 3WXMB 4OB2B 2K2MA 2ENMA 2MWOA 1C6VX 1W6XA 2AHJB 3HFNA 3V7CA 2B8AA 4PJNA 2VASA 1IZ6A 1YHQA 1K9AA 3FRNA 2EBPA 1SG5A 2WACA 1VQ7A 2VGNA 5IXBA 2DLPA 1HK9A 3NHNA 1ZSZC 5FU7B 5HCKA 3J7AF 2D0NA 2LZ6B 2WSFE 3UDCA 3L2RA 4M7DD 2XICA 4DOWA 2RH2A 3PTAA 2ZZDA 3OS2A 1BI0A 3S3NA 2HBPA 2O01E 3GOXA 3UATA 3VU3C 5KYYB 2DBMA 2EIFA 2CGHA 4MMLA 3G7ZA 2YUPA 1UGSB 2CP6A 1YJNT 3UPUA 2KRMA 1IB8A 1RAGB 1WQWA 4OMNA 1SEMA 3HSBA 2MCNA 5GMKi 1G3YA 1BIBA 3RKXA 2CZ7B 2BKDN 5FWCA 2DZ9A 4M78G 1NZ9A 2C0TA 1PRLC 4IUTA 2D8JA 2RHZA 2V26A 1YHQQ 3VS0A 1I4K1 3JSCA 3JB9D 3OYYA 5DLQE 1VQOQ 4HCZA 5LJ5d 5DY9A 1Q82R 1VIFA 1WXBA 2DYIA 2RJEA 1QWFA 2X3XD 1W2BP 1RAHB 2KGTA 1Q7YR 1ZSZA 4BY6C 1WLPB 3TREA 3UF4A 3OS1A 3S3OA 1OEBA 3H0HA 3CD6A 3INZA 3L2UA 3RERA 3CCJT 1VQ6T 4XU0A 1SKUB 3OYMA 3OYGA 1OOTA 2PVDB 2PVOB 2XD0A 1AWOA 1R0BG 4AG1C 1AT1B 1B34B 1VQ4A 1VQ5Q 5A0LA 1J3TA 2QGFB 2AT1B 5D6WA 4DQ2A 4RUGA 3NTKA 4MMKA 1AEYA 4Y92A 1LOJA 4QT7A 2XK0A 4Z89A 4F7UA 2JW4A 3U23A 1QP2A 6AT1B 2LDMA 1VQ6Q 1VA7A 2MF2A 1NYFA 2NLUA 3CCJQ 1VYTA 1KK7A 2ESWA 1M1KR 4C5IA 1BI3A 4EMHA 4EIKA 2MI6A 4O6JA 2DM1A 3QWYA 1TUDA 3KFVA 2JJ9A 4MZPA 2ZAEA 2E70A 3JCMV 1PCXA 1GCQA 2L89A 1VQOT 3N5BB 4XAXB 1N8RU 1BCMA 1X2QA 1Q82C 1M27C 1VQ4Q 1S72T 4M78B 1E6HA 4C92C 2JTFA 4M75A 2FPDA 2JS2A 4XK8E 1WHHA 2DVEA 5EG2A 3V7SA 4GBQA 1YITQ 2FPEA 3BE3A 2C0IA 1VQPA 4NOYA 3HL8A 2LRQA 1U1SA 1NPRA 2F5TX 2M0YA 2RQWA 2V8KA 4NL3A 3H6ZA 2RI3A 1OI1A 4KGXB 1Z9ZA 3M57A 3DLMA 3VJPA 1OZ2A 1Y71A 2F1LA 3MEAA 2J06A 3ZL7C 2EJGA 1G2BA 1KD1C 2D8HA 1UB4A 5KYWB 1WHGA 3P8DA 2DL3A 2JVVA 4IUVA 4ZN3A 2BE7D 3MEVA 3OBWA 2V8IA 4LDYA 4QVDA 1AVZC 4OMOA 1E6GA 5GAOm 2ZPEB 3OYCA 1IHVA 4M77B 2X9HA 2DJQA 2ED0A 1S72Q 4F14A 5GANh 2FZKB 3Q1JA 1BU1A 1VQ9A 1M2VB 2E5KA 1GXIE 2E6ZA 2LMJA 2DO3A 4BDZA 2KXCA 4N4HA 4XTYA 4J9IA 1IREB 2HL5C 1QQJA 3MKDA 4C92D 4J9GA 4B9XA 5LJ5j 2LQ8A 2LJ1A 2PU9B 3SEMA 1C1AA 1B3QA 5IHKA 4M77D 3M9QA 1WIEA 5FU6C 3KUFA 2EWNA 4ZGJB 1EIFA 3OYIA 3CCRQ 1W2BA 2JTEA 1U8RA 5GAMh 5FRMA 3G4SQ 2CSQA 4F7UB 1KHCA 4PJOG 1VQ7Q 2FZGB 3M4GA 1TUCA 1NLPC 3RKWA 3A8LB 4M77C 4WF2A 3CMET 3MEUA 3UT1A 3PE0A 4HCKA 1GBQA 2KT1A 1I1JA 3CCSA 2FPFA 2QGGA 1VQ5T 1NM7A 2HMAA 4M75F 1WHLA 3VUZA 1BI1A 1D1CA 1M4ZA 2KROA 1V1CA 2F2WA 5KE2A 1X75C 3V8KA 2CP0A 3E1SA 1D0XA 5LJ3j 4RG8A 3JCMd 3CD6T 3V7RA 3GP8A 3JCMb 4AT1B 2E12A 1JRIA 2O4XB 3I56T 3D7SB 2KSSA 2JM9A 2RD1A 3IQLA 3C95A 3E19A 5L8RE 4PL6A 1AOJA 2PNIA 2VXFA 4C0DC 2DETA 4M7DF 1BI2A 5A2QE 2JXBA 1NJIR 4LD6A 1K8AR 2QQRA 1OX9A 3A8OB 5DLOA 4J7FA 8ATCB 1SF9A 2COYA 4FYXB 3T9NA 2DIGA 4HCBA 3G4SA 1QVFA 2FZCB 5GAMe 4EPCA 2VWFA 4LDUA 3CCQQ 1PM3A 2DBKA 4HA8A 4OGEA 3ZBDA 1MGQA 2O9VA 1QLYA 2L3RA 4B9WA 1Q81R 5GAN3 2LQWA 4ANJA 4C0GA 1VQNQ 1TOVA 2QK0A 2X4XA 4IUUA 4C5GA 1EX4A 3HP9A 1JU5C 3QSUA 1MMNA 4OF1A 1NEGA 3FJPA 4FU6A 3SHWA 4QKUA 1Q95G 3PVLA 4CC7A 1N9RA 3VUBA 4GLKA 1VQLQ 1JB0E 1NG2A 3DB3A 1WZOA 2MOXA 4LUEA 2HCKA 2PQWA 4RCCA 4JRIA 2FRYA 1MMAA 3JCMg 2HDAA 4XU3A 3PGGA 4J8OA 5L23A 3TEEA 1I5OB 2KY9A 1MV3A 3OB9A 2J6FA 1VQKT 2HEQA 1XTDA 2K3YA 2YRCA 3NPFA 3FIFA 2RM4A 4F7UE 3VS6A 5D6YA 2FG0A 4M7DB 1TXQA 4X34A 5IT9E 2PZ1A 2A3LA 3M58A 3G1JA 4IUPA 1Q86R 1Y7XA 3NGPA 1K8AU 3M0TA 3CCMA 3M5AA 1UJYA 3BDLA 3CPWA 5HK0A 2CKKA 2GGRA 5KYNA 2O88A 3CMEA 3CCUT 4ELYC 2VB6A 3RKYA 2LVMA 4M7AG 4M75B 4ZTFA 2O4XA 3HHTB 4JPBW 2HKNA 3M59A 1Q82U 3I9QA 4C8QB 3C4SA 3M4YA 1ZLMA 4B6MA 3CXCP 3A8MB 4BE2A 1B34A 1N8RR 3I55Q 2DXBA 1JJ2S 1V76A 1RUWA 1U5SA 1UJ0A 2RI5A 2WSCE 1H8KA 1UTIA 1T0JA 5GMKh 4X9DA 2OTLQ 5D6XA 1JO8A 1TS9A 2L3PA 1LJOA 1G83A 5HKCA 1NJIU 1OV3A 1X43A 4YTLA 3CC7Q 2SEMA 4XQ3A 5GAOr 1WFWA 4N0AA 4CRIA 1SRLA 2DL4A 3JAME 2VUBA 4RKUE 1FYNA 4PJOC 1K8AC 3MP1A 4LDXA 3C94A 3JRZA 2VGMA 2F69A 4F16A 2ZPGB 3ME9A 3CC7T 5FRNA 3DKMA 2J05A 5GAMf 3C12A 1F1BB 2YLBA 2RK2A 2DTHA 1T0HA 2LCLA 3OYNA 3CC2A 2W0ZA 4J6WA 3LWHA 2KXDA 2RF0A 3MEWA 4PKCC 3QKJA 2AZVA 5CCAA 2JNGA 5CK9A 5I11A 3OYLA 1DJ7B 1VQ9T 1ZUUA 3L2QA 3P8HA 2MIOA 3CCLQ 1SPKA 5IN1A 2HQHA 2K5FA 4DBFA 4C8QD 3G6ET 3CPFA 1I0CA 1XQHA 3MJXA 1FMWA 3OMGA 4QQ6A 4RCBA 1LPLA 2AIRB 4OMLA 4HCCA 3SWNB 4AG2C 3REBB 4A54A 1YIJT 1GCQC 5FROA 3TU4K 2K3XA 4E7KA 3LYIA 1VQKA 2DD4A 1UGRB 3JV3A 3VKIA 4KRTA 2KK4A 1JXOA 2CUBA 4C8QA 2A28A 2KR3A 1KD1U 4M78C 3G71A 1M5Q1 2DX1A 3M53A 3M0PA 4MDWA 4CI0C 4ZGEB 3RMQA 2EJFA 2MWPA 4XTVA 2QTXA 4PJJA 1VYUA 5IHIA 2A36A 4PJOE 1K9MU 1BKBA 1S72A 4JS4A 4PK4A 2AKKA 5GAMj 1M2VA 1VUBA 4PJLA 3KBGA 1N6AA 2L8DA 4FT2A 3TCJA 3JCMc 1AZGB 3CC2Q 1D0YA 5I22A 3JCMe 3H0IA 1QMCA 4AFQC 1M8MA 1WX6A 1CSKA 1VQ8A 2K3BA 3URGA 3LX7A 3QUIA 3RUXA 3ZEHA 2E5QA 2KRSA 1ZSZB 5FU7C 2RQUA 3BW1A 2XDBA 1VQ8T 2FB7A 2VVKA 2YHTA 4JZ4A 4ELZC 2KRNA 2KDSA 1GCPA 2E6NA 5GAOp 5GAN2 2QXFA 3QIIA 1KQSP 5LJ5f 2V1QA 4KULA 3JB9G 4JLIA 5CKBA 4Z02A 3CC7A 3A8HB 3EFOA 4C92B 1D3BB 2KQWA 4IURA 1B7TA 4A4KA 1N9SA 4R0KA 1JEGA 2DMOA 4XU2A 1VQPT 3ASKA 4M7DA 4FYVB 1QVGP 4BI4A 2QQSA 3LH5A 5CAIA 1IGUA 4V2SA 2H3EB 4E7SA 5FU6B 1G3TA 4X1VA 1N8RC 3GNFB 1H641 4LE9A 3EG9A 2DXCA 1YBYA 1M8VA 4ZTJA 1KC8C 3CCJA 3LH0A 3VS4A 4BDYA 3M56A 3RMSA 4C8QE 1NJIC 4KBMB 2CH4W 2JOYA 1IXDA 3LW5E 2YDLA 4M7AA 1I5LA 2EW3A 3QZ9B 2R5AA 1YWPA 3E9GA 2K57A 1KG1A 3GPLA 2B86A 2PTKA 2YT6A 5CO7A 2YLCA 4DBRA 2MK5A 3JCMJ 1XNIA 4FIBA 1RL2A 1GL5A 1Q86C 3F70A 1BBZA 4RTWA 2ZPIB 1C0MA 3M0SA 5LJ5g 3QDRB 1X6OA 5CKHA 4CC3A 5FWBA 5M9OA 4LDVA 2XDDA 3I56Q 1RABB 4JRPA 1M90U 4FYYB 3CD6Q 1VOMA 5KYUB 2CZ1B 2P0KA 4M75G 4FW2A 5KE3A 1KQ2A 2EYZA 1RAIB 2D6FA 1RACB 4EMKA 3J81E 3OMCA 2CREA 1K73U 3PVQA 1WNLA 4RG2A 4M7AD 1FWZA 1IRXA 1N5ZA 4OMQA 2L2PA 1JBMA 4C92G 3GLXA 2D9TA 5KYUA 4DEXA 1VQ7T 3M55A 3G6EA 2R58A 1K0SA 4BI3A 3V8JA 4XTXA 1HD3A 2XHCA 3MPUB 2XKOC 2L5QA 1ZX6A 4JRKA 4M77A 1JJ2P 1WHKA 2X51A 2ZPFB 2GNCA 2EGEA 2A7YA 1K9MC 3QO3A 5GAN7 2GFUA 2OJ2A 2AZSA 3CC4Q 4J9FA 3QPHA 2M51A 1ZBXA 2E64A 4Y91A 3UWNA 4FM4B 3R6NA 1M9SA 1P92A 4M78E 5CQXA 4A4GA 3LLRA 1OYXA 3EH1A 3VS3A 2EYQA 5LL6S 4FYWB 2ED1A 1KC8R 4HXJA 4OB0B 5A0GA 2L3SA 1HXDA 1TUGB 1MMGA 3EG0A 4K11A 3VS1A 2JM8A 3H9NA 3EHRA 4OGCA 2OI3A 3L2VA 1OULA 2DKGA 2OX7A 4Z8AA 5LJ5e 3VS2A 1OPKA 1U1TA 2EGAA 1WQ7A 5IHNA 2XIDA 1VQNT 1G8XA 1RLPC 3OS5A 1UGVA 3HRSA 3PMTA 3S6WA 2EQJA 4FSXA 1RADB 2CP7A 3QZ5B 5GAMg 4NS5A 3V8LA 1SHGA 7AT1B 5GANg 4C92F 2XG8D 4CC4B 2XMFA 1UGPB 1K4US 2YRDA 5KYWA 2LNHB 4LUDA 4KGZB 2W10A 2HSEB 1YIJA 2KBTA 2M1HA 4BI8B 3QHSA 3CCST 4O5VA 1ZSGA 2QA4Q 2VXEA 3MP6A 2ABLA 3EFOB 2G6FX 4C92A 1OX8A 4DBQA 3CC4T 3X25B 2QDYB 1FXXA 4BB7A 4EMKC 4FSSA 2ZPBB 4QQGA 3EG1A 4FW1A 3MP8A 1KJWA 4J9BA 2DL7A 1W2BS 3THKA 3EG3A 1VQ9Q 2ROTA 1UE9A 2DXUA 3CC2T 2EYWA 3CCEQ 3PNWC 2JUFA 4J9EA 1D3BA 3CCLA 3OW2S 1RLQC 4QW2A 4F7UG 4GY5A 1RI0A 3CQTA 3HTRA 4OP0A 4AFZC 1M1FA 4D8KA 5GJVB 2R5MA 1X6BA 2Y90A 1PRMC 1QVPA 1TG0A 4RTVA 2CZ0B 2M0OA 2NUZA 3O8VA 3FEOA 2K2VA 1QCFA 3ER0A 1Q81U 2A37A 3H8ZA 4C0DB 5GANd 2X4YA 4LD9K 3OYHA 4RTUA 1VQPQ 2NUPB 4J9CA 4M78F 5KCHA 3VRYA 1X2KA 3EHQA 2KMTA 2DPPB 2EGCA 2MYSA 3GF5A 4M77G 3EH2A 4F7UF 2X4JA 3JCMh 2DE0X 3ZFJA 2ZCFB 4C0ZA 2J7IA 3CCLT 3OY9A 1WHMA 1NPPA 2C06A 1Q86U 4OB1B 5D7UA 5FW9A 3I55T 2RK1A 1K1ZA 4M7DG 3O5ZA 3OYBA 2CSIA 5EC7A 2YWWA 1UDLA 1WDXA 5LJ3e 3L42A 1YFNA 5LJ3g 2HD0A 4N0AC 4RTYA 1G5VA 5J39A 2RNAA 3A1PA 1QKWA 3H0FA 2DF6A 2QTVA 3EGUA 4E6RA 2A0FB 4HKEA 2CP3A 2RMOA 2COZA 2VC8A 1YITT 1MNDA 2LQKA 2XDPA 3CCUQ 1FMVA 1VQMA 4JUVA 3CCQA 4PLLA 1MMDA 1EZZB 3TVTA 1U06A 1YNZA 2MMPA 1H3HA 1Y96A 1H3ZA 1PNJA 1KIKA 1QVGS 5CQYA 5CIUA 2QASA 3VS7A 4KT0E 4AFUC 2EQMA 4ORZA 1Q81C 2LP5A 2JN0A 4R56A 1WYXA 2CP2A 2RA2A 1K76A 1RAEB 4PJMA 2EKOA 2KYBA 4GLMA 2Y4XA 2C0OA 3CMAT 2FRWA 4QVCA 1VQ8Q 2NUTA 8AT1B 3CXCS 2DEUA 2ATCB 3HRTA 1W4SA 3EGXA 2RB6A 1KC8U 4M7AF 4Y28E 3EFSA 3C0CA 1GFCA 1WJSA 4PFOA 1RAFB 2QA4T 1BYMA 1OU9A 2O2OA 2P4RA 1YJNA 3CCSQ 1S1NA 4M78A 1ABOA 1CKAA 4JZ3A 1HYOA 3AHUA 4HT9A 4C5HA 4OVAA 5LJ3d 1QW1A 3PIOA 5GJWB 1R77A 5GAOn 1AD5A 2JMAA 3WVEB 3SB2A 3G71Q 1OPLA 2HNIA 2GQVA 2RO0A 4M75C 2Y4YA 3PIPA 4IUQA 1PG5B 4M75E 1Y57A 4M78D 1WGSA 2K5IA 4A4HA 5IXFA 3EG9B 1YJWA 2E65A 3VYGA 2QYZA 2EJ9A 4E7ZA 2QA4A 5GANe 1K0XA 4OMPA 1JXMA 3L2WA 2DK3A 1YIJQ 1WA7A 1RAAB 3HKSA 1YN8A 1YHQT 2DEQA 4JDSA 4Z88A 1LNXA 3PT9A 1UUEA 3DB4A 2OTLT 3EGDA 1M3AA 4A4FA 1M90C 1PC0A 2EQUA 1WPYA 4PJOB 1A0NB 1BB9A 3OSSC 3P8BB 4J83A 3X26B 3HPWA 5C0MA 2HAXA 4NL2A 2BZYA 2QQBA 2CZ6B 1M3BA 1KFZA 2CYZB 4D6WA 2LT4A 4WCIA 3CBOA 2GBQA 2ZGWA 5LJ3h 4MDXA 1FMKA 4PJOD 5GAMd 2O31A 2KAFA 3RNJA 4RTZA 4II1A 1JQQA 3OYJA 3OSVA 1QWEA 2LJ3A 4LN2A 1NE8A 3FLGA 1ZA2B 1YWOA 4M7AE 2GQIA 2OTLA 4OMMA 3RESA 1T3SA 2DTOA 4BE1A 1YI2T 1NYGA 1ZUYA 2LX9A 1IGQA 1TU0B 2HKQB 4LDWA 3E9FA 5CVIA 3PFSA 3CCVQ 4WTOB 2AKLA 1M1KC 4QVZA 1GRIA 1K73R 4OB3B 4FT4A 4JS5A 3CCET 2IIMA 1IHWA 2LCCA 4TVRA 2VKNA 3SDZA 2DA9A 5KH6A 4LNPA 5KYYA 2XU8A 1QVFP 2FHDA 2LC4A 1B07A 1VQMT 1VQKQ 5FLXE 4JJNK 1D09B 5A0DA 3RDVA 3OBYA 1Q7YC 1N27A 2BE9B 2LNVA 5GAOq 2IPOB 3LWIA 2RJDA 1PSFA 2LT1A 3EGDB 1PWTA 2KT8A 2YUQA 4JLGA 1Y07A 4MZMA 1QVFS 3CCMQ 1D0ZA 3S3MA 1D1AA 2KI7A 1R0CB 2J6KA 2L0AA 1X01A 1T3LA 3OYDA 2DZCA 2FL7A 2A08A 5IAYA 5I2MA 1UFFA 5GAN8 3QDFA 4C5EA 5ECAA 9ATCB 1NLOC 2D0QB 2RQVA 2PVGB 3GNGA 3X24B 1QKXA 4IIMA 3OW2P 2P84A 3QBYA 2RI2A 1E7OA 1UEBA 3NTHA 2EQIA 2HL3A 2E1HA 2QG9B 2DL8A 2RPNA 5GAN5 1ZUKA 4J7IA 4EMKB 3X28B 1K9MR 4EDUA 2DNUA 3I35A 1O75A 1YITA 2QQ9A 2KE9A 1IO6A 5GMKm 2O9SA 1U3OA 2M9UA 3OYEA 3QXEB 4M77F 4M4ZA 3EGXB 1M1GA 2E4HA 1VYVA 1VQLA 2I2LA 1WHJA 3MO8A 1YI2A 2F2VA 1TWBA 4M75D 4QQDA 3JB9F 2KVQG 2CDTA 1ACMB 2G3RA 3I55A 2J6OA 4J9DA 2HSPA 2F2XA 3CPWP 5CR2A 4JJBA 2P4TA 4KUDK 2QEXT 5LJ3f 4PJOF 1KQSA 2FVUA 2QAZA 1Q7YU 1UHCA 1ZQ1A 4F17A 4E2FB 3JB9I 1MNEA 3SWNA 4MZTA 1H92A 1CKBA 4VUBA 2JMCA 4RMOA 2E3HA 3OS0A 5DM7R 1PHTA 4M7AB 3WVDB 3JB9H 2GFAA 1X6GA 2YSQA 3CMEQ 1KQ1A 3CCQT 4BE0A 3OYKA 3CBPA 2R57A 3X20B 1AWJA 1HSQA 2X35A 2EYXA 4EMGA 5GMKl 2KYMA 1VQ5A 2JZ2A 3TQ7P 2CS7A 3I5SA 4A4EA 2LQNA 1W1FA 1YP5A 1EFNA 2CH4A 4PLIA 3VV0A 4ZGDB 1X27A 4N4IA 2K7AA 1HJDA 2K79A 4C92E 2LJ0A 3KXTA 1UG1A 4R55A 1WXUA 3QWXX 1ARKA 3OYAA 2H8HA 2HQEA 1BK2A 3MCAB 3TSZA 4F04B 1W70A 3SD4A 2HBWA 3QYGB 2NUPA 1SSHA 2V8JA 1ZBJA 1PSEA 2NWMA 4IIOA 2HQXA 2E3IA 1YCYA 1SHFA 2P0PA 2COWA 2D1XA 2BZXA 1D1BA 1R8OB 2DYBA 3CEYA 1OU8A 3JCMW 2K6DA 2LCSA 5GAOl 2MPXC 5CKFA 5AT1B 1M1KU 4HVWA 4L5GA 2LTOA 2DD5A 5AYFA 1XJWB 5GMKe 5KCOA 1MV0B 2BZ8A 2EYYA 3QYHB 2QEXQ 1FX7A 3CCRT 1PKSA 4E47A 3QJYA 2RHIA 2P0QA 4ME7A 1AWWA 2JT4A 5CKEA 1AWXA 3I5RA 2BTTA 2BIVA 1YJWQ 4CC2A 3OW2A 2QEXA 1BIAA 4AFSC 2DRKA 2YXYA 2Z0WA 3HRUA 3JB9J 1Y0MA 3GIBA 1VQ4T 1AHJB 2OAUA 2GCXA 2FEIA 2RHXA 1I81A 2DAQA 1KHIA 2HZYA 3NTIA 3BY7A 4L59A 2IG0A 2DTIA 4HVUA 3M0UA 2DL5A 4X9CA 2FYKA 5GANf 4Q5WA 1TH7A 1YJWT 2YRVA 2WSEE 2OTJT 5J26A 1YJNQ 2GF7A 3DLLA 2QI2A 5KYXA 2OTJA 2EKHA 4LXCA 4XU1A 4M77E 1GFDA 3A5ZB 4DEYA 4OMFB 2FO0A 2X4WA 3SFMA 5I2SA 4BUGA 2M02A 3BFMA 5GANj 3JCMP 3META 2KEAA 1M2OA 2E10A 1UECA 4KH1B 1KQSS 4C8QC 5J3BA
chains in the Genus database with same CATH topology
1S1NA 3ULRB 2V1QA 1AVZC 1ABOA 1CKAA 4OMOA 2X3WD 4JZ3A 1E6GA 2L3QA 3VRZA 2YUOA 5GJWB 2DJQA 1AD5A 2ED0A 1WXTA 2JMAA 4R0KA 1JEGA 2DMOA 4F14A 1OPLA 1BU1A 3LH5A 3FJ5A 1Y57A 2E5KA 2LMJA 4X1VA 5IXFA 2KXCA 4JJDA 4J9IA 4LE9A 4J9GA 4RTXA 2LJ1A 3SEMA 1K0XA 1B3QA 5IHKA 4OMPA 1WIEA 1JXMA 2DRMA 2RN8A 3VS4A 1WA7A 1YN8A 2CH4W 1GBRA 2YDLA 2JTEA 4Z88A 2ECZA 2EW3A 1UUEA 1WI7A 2CSQA 1M3AA 4J9HA 1YWPA 1RI9A 4ESRA 1TUCA 1NLPC 2B86A 2PTKA 2YT6A 3PE0A 4HCKA 1A0NB 1GBQA 2KT1A 1BB9A 1I1JA 2FPFA 1Z9QA 1GL5A 2EPDA 1KSWA 1LCKA 1BBZA 4RTWA 3M0SA 1NM7A 2BZYA 2EVRA 1M3BA 4CC3A 2KROA 1X69A 1KFZA 2CT3A 5FWBA 1V1CA 2F2WA 4D8DA 2ROLA 4WCIA 4JJCA 2GBQA 3GBQA 1FMKA 2RQTA 2O31A 1ABQA 3RNJA 4RTZA 2JM9A 2YUNA 1JQQA 2EYZA 3IQLA 2RQRA 3TSWA 1QWEA 2LJ3A 1AOJA 4LN2A 2PNIA 2CREA 2QDLA 3PVQA 1YWOA 2JXBA 1SRMA 2GQIA 1N5ZA 4OMMA 4OMQA 2L2PA 1T3SA 4DEXA 1NYGA 1ZUYA 3REAB 2AK5A 2CT4A 2AKLA 1K0SA 1HD3A 1GRIA 1UHFA 2VWFA 2DBKA 2IIMA 2O9VA 1QLYA 3M0RA 2KNBB 3EG2A 1ZX6A 3RBBB 3VS5A 2LQWA 2I0NA 2VKNA 1MUZA 2JS0A 2DA9A 2K9GA 4LNPA 2GNCA 1XOVA 1JU5C 1B07A 2EGEA 2V1RA 3H41A 2OJ2A 2OAWA 2AZSA 1NEGA 2CUDA 3M0QA 4J9FA 2M51A 3SHWA 3R6NA 3PVLA 1M3CA 1PWTA 2KT8A 2YUQA 4CC7A 3A98A 3UA7A 1NG2A 3VS3A 2MOXA 2J6KA 4LUEA 2L0AA 2HCKA 2ED1A 1T3LA 4HXJA 2LX7A 2L3SA 2FRYA 3NMZC 2A08A 1NEBA 2HDAA 2DILA 3EG0A 1UFFA 4K11A 2JM8A 3VS1A 1AZEA 1I07A 5ECAA 3EHRA 5L23A 1M30A 4ZNXA 2OI3A 1NLOC 2RQVA 1MV3A 5IH2A 2J6FA 1QKXA 2HEQA 4IIMA 3UA6A 4Z8AA 4HVVA 3VS2A 2GTOA 1E7OA 1OPKA 2EGAA 5IHNA 2EQIA 3NPFA 4A63B 2SRCA 1RLPC 2RPNA 1PKTA 2DL8A 1ZUKA 2GTJA 2DVJA 4RTTA 1UGVA 3VS6A 1YCSB 2DNUA 2FG0A 2K2MA 3I35A 2ENMA 1W6XA 2PZ1A 2KE9A 1IO6A 2O9SA 1U3OA 1K9AA 4M4ZA 2EBPA 3NGPA 1SHGA 3M0TA 1VYVA 4CC4B 1UJYA 5IXBA 2DLPA 2XMFA 3NHNA 2GGRA 1K4US 5HCKA 2O88A 2LNHB 2F2VA 4LUDA 2W10A 2D0NA 2LZ6B 2KBTA 2CDTA 1ZSGA 2J6OA 4J9DA 4JPBW 2ABLA 2HSPA 2G6FX 2F2XA 3I9QA 4JJBA 1UHCA 3UATA 1ZLMA 4FSSA 4F17A 3EG1A 2DBMA 1KJWA 4J9BA 2DL7A 1H92A 3THKA 2YUPA 1CKBA 1RUWA 1U5SA 2JMCA 1UJ0A 3EG3A 1H8KA 1UTIA 2ROTA 1PHTA 1T0JA 1UE9A 2EYWA 1X6GA 2YSQA 2KRMA 4J9EA 4OMNA 1SEMA 1RLQC 1AWJA 1HSQA 2MCNA 2EYXA 5FWCA 1JO8A 2L3PA 3CQTA 4AFZC 2C0TA 1PRLC 2KYMA 2D8JA 1G83A 1OV3A 1X43A 3VS0A 4D8KA 2SEMA 1WFWA 3I5SA 5GJVB 2LQNA 1SRLA 1W1FA 1YP5A 1EFNA 1X6BA 1WXBA 2CH4A 1QWFA 1X27A 2DL4A 2X3XD 2K7AA 1HJDA 1PRMC 2K79A 2LJ0A 2KGTA 1UG1A 1TG0A 4RTVA 1FYNA 1WXUA 3QWXX 1WLPB 1ARKA 3UF4A 2NUZA 2H8HA 1BK2A 3TSZA 1OEBA 3H0HA 1QCFA 1W70A 4F16A 2HBWA 2A37A 1SSHA 4RTUA 1ZBJA 4J9CA 2J05A 3VRYA 1X2KA 3EHQA 2EGCA 2NWMA 1T0HA 1OOTA 4IIOA 2W0ZA 1AWOA 2KXDA 2RF0A 4AG1C 2DE0X 1SHFA 2AZVA 2J7IA 2D1XA 5I11A 1J3TA 2BZXA 2DYBA 1ZUUA 2K6DA 4RUGA 2LCSA 2MIOA 1AEYA 5FW9A 4HVWA 4Y92A 1K1ZA 1SPKA 3O5ZA 4QT7A 2CSIA 5EC7A 4Z89A 2JW4A 1I0CA 1UDLA 1WDXA 3U23A 1MV0B 2BZ8A 2EYYA 4RTYA 1VA7A 1NYFA 4OMLA 2RNAA 4AG2C 1QKWA 3H0FA 3REBB 2DF6A 1GCQC 1PKSA 1VYTA 2ESWA 3EGUA 4E6RA 1AWWA 2JT4A 2RMOA 1AWXA 3I5RA 4EIKA 2BTTA 3JV3A 4KRTA 1JXOA 2DM1A 2CUBA 3QWYA 1TUDA 3KFVA 4CC2A 2A28A 2KR3A 4AFSC 2DRKA 3TVTA 2DX1A 1GCQA 3M0PA 1Y0MA 1U06A 1YNZA 1H3HA 1X2QA 1PNJA 1VYUA 5IHIA 2A36A 1M27C 2FEIA 1KIKA 2AKKA 3VS7A 1E6HA 4AFUC 4ORZA 4HVUA 2FPDA 2JS2A 3M0UA 2DL5A 2LP5A 1AZGB 1WYXA 5I22A 3H0IA 4GBQA 2FPEA 1K76A 2C0IA 4AFQC 1M8MA 1WX6A 1CSKA 2KYBA 4GLMA 2M0YA 2C0OA 2RQWA 2FRWA 2K3BA 2EKHA 1Z9ZA 1GFDA 2KRSA 4DEYA 2FO0A 2RQUA 2J06A 3ZL7C 2VVKA 4JZ4A 1G2BA 2D8HA 3C0CA 1GFCA 2KRNA 2KEAA 1GCPA 2DL3A 1UECA 2O2OA 2P4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S1N A;  3ULR B;  2V1Q A;  1AVZ C;  1ABO A;  1CKA A;  4OMO A;  2X3W D;  4JZ3 A;  1E6G A;  2L3Q A;  3VRZ A;  2YUO A;  5GJW B;  2DJQ A;  1AD5 A;  2ED0 A;  1WXT A;  2JMA A;  4R0K A;  1JEG A;  2DMO A;  4F14 A;  1OPL A;  1BU1 A;  3LH5 A;  3FJ5 A;  1Y57 A;  2E5K A;  2LMJ A;  4X1V A;  5IXF A;  2KXC A;  4JJD A;  4J9I A;  4LE9 A;  4J9G A;  4RTX A;  2LJ1 A;  3SEM A;  1K0X A;  1B3Q A;  5IHK A;  4OMP A;  1WIE A;  1JXM A;  2DRM A;  2RN8 A;  3VS4 A;  1WA7 A;  1YN8 A;  2CH4 W;  1GBR A;  2YDL A;  2JTE A;  4Z88 A;  2ECZ A;  2EW3 A;  1UUE A;  1WI7 A;  2CSQ A;  1M3A A;  4J9H A;  1YWP A;  1RI9 A;  4ESR A;  1TUC A;  1NLP C;  2B86 A;  2PTK A;  2YT6 A;  3PE0 A;  4HCK A;  1A0N B;  1GBQ A;  2KT1 A;  1BB9 A;  1I1J A;  2FPF A;  1Z9Q A;  1GL5 A;  2EPD A;  1KSW A;  1LCK A;  1BBZ A;  4RTW A;  3M0S A;  1NM7 A;  2BZY A;  2EVR A;  1M3B A;  4CC3 A;  2KRO A;  1X69 A;  1KFZ A;  2CT3 A;  5FWB A;  1V1C A;  2F2W A;  4D8D A;  2ROL A;  4WCI A;  4JJC A;  2GBQ A;  3GBQ A;  1FMK A;  2RQT A;  2O31 A;  1ABQ A;  3RNJ A;  4RTZ A;  2JM9 A;  2YUN A;  1JQQ A;  2EYZ A;  3IQL A;  2RQR A;  3TSW A;  1QWE A;  2LJ3 A;  1AOJ A;  4LN2 A;  2PNI A;  2CRE A;  2QDL A;  3PVQ A;  1YWO A;  2JXB A;  1SRM A;  2GQI A;  1N5Z A;  4OMM A;  4OMQ A;  2L2P A;  1T3S A;  4DEX A;  1NYG A;  1ZUY A;  3REA B;  2AK5 A;  2CT4 A;  2AKL A;  1K0S A;  1HD3 A;  1GRI A;  1UHF A;  2VWF A;  2DBK A;  2IIM A;  2O9V A;  1QLY A;  3M0R A;  2KNB B;  3EG2 A;  1ZX6 A;  3RBB B;  3VS5 A;  2LQW A;  2I0N A;  2VKN A;  1MUZ A;  2JS0 A;  2DA9 A;  2K9G A;  4LNP A;  2GNC A;  1XOV A;  1JU5 C;  1B07 A;  2EGE A;  2V1R A;  3H41 A;  2OJ2 A;  2OAW A;  2AZS A;  1NEG A;  2CUD A;  3M0Q A;  4J9F A;  2M51 A;  3SHW A;  3R6N A;  3PVL A;  1M3C A;  1PWT A;  2KT8 A;  2YUQ A;  4CC7 A;  3A98 A;  3UA7 A;  1NG2 A;  3VS3 A;  2MOX A;  2J6K A;  4LUE A;  2L0A A;  2HCK A;  2ED1 A;  1T3L A;  4HXJ A;  2LX7 A;  2L3S A;  2FRY A;  3NMZ C;  2A08 A;  1NEB A;  2HDA A;  2DIL A;  3EG0 A;  1UFF A;  4K11 A;  2JM8 A;  3VS1 A;  1AZE A;  1I07 A;  5ECA A;  3EHR A;  5L23 A;  1M30 A;  4ZNX A;  2OI3 A;  1NLO C;  2RQV A;  1MV3 A;  5IH2 A;  2J6F A;  1QKX A;  2HEQ A;  4IIM A;  3UA6 A;  4Z8A A;  4HVV A;  3VS2 A;  2GTO A;  1E7O A;  1OPK A;  2EGA A;  5IHN A;  2EQI A;  3NPF A;  4A63 B;  2SRC A;  1RLP C;  2RPN A;  1PKT A;  2DL8 A;  1ZUK A;  2GTJ A;  2DVJ A;  4RTT A;  1UGV A;  3VS6 A;  1YCS B;  2DNU A;  2FG0 A;  2K2M A;  3I35 A;  2ENM A;  1W6X A;  2PZ1 A;  2KE9 A;  1IO6 A;  2O9S A;  1U3O A;  1K9A A;  4M4Z A;  2EBP A;  3NGP A;  1SHG A;  3M0T A;  1VYV A;  4CC4 B;  1UJY A;  5IXB A;  2DLP A;  2XMF A;  3NHN A;  2GGR A;  1K4U S;  5HCK A;  2O88 A;  2LNH B;  2F2V A;  4LUD A;  2W10 A;  2D0N A;  2LZ6 B;  2KBT A;  2CDT A;  1ZSG A;  2J6O A;  4J9D A;  4JPB W;  2ABL A;  2HSP A;  2G6F X;  2F2X A;  3I9Q A;  4JJB A;  1UHC A;  3UAT A;  1ZLM A;  4FSS A;  4F17 A;  3EG1 A;  2DBM A;  1KJW A;  4J9B A;  2DL7 A;  1H92 A;  3THK A;  2YUP A;  1CKB A;  1RUW A;  1U5S A;  2JMC A;  1UJ0 A;  3EG3 A;  1H8K A;  1UTI A;  2ROT A;  1PHT A;  1T0J A;  1UE9 A;  2EYW A;  1X6G A;  2YSQ A;  2KRM A;  4J9E A;  4OMN A;  1SEM A;  1RLQ C;  1AWJ A;  1HSQ A;  2MCN A;  2EYX A;  5FWC A;  1JO8 A;  2L3P A;  3CQT A;  4AFZ C;  2C0T A;  1PRL C;  2KYM A;  2D8J A;  1G83 A;  1OV3 A;  1X43 A;  3VS0 A;  4D8K A;  2SEM A;  1WFW A;  3I5S A;  5GJV B;  2LQN A;  1SRL A;  1W1F A;  1YP5 A;  1EFN A;  1X6B A;  1WXB A;  2CH4 A;  1QWF A;  1X27 A;  2DL4 A;  2X3X D;  2K7A A;  1HJD A;  1PRM C;  2K79 A;  2LJ0 A;  2KGT A;  1UG1 A;  1TG0 A;  4RTV A;  1FYN A;  1WXU A;  3QWX X;  1WLP B;  1ARK A;  3UF4 A;  2NUZ A;  2H8H A;  1BK2 A;  3TSZ A;  1OEB A;  3H0H A;  1QCF A;  1W70 A;  4F16 A;  2HBW A;  2A37 A;  1SSH A;  4RTU A;  1ZBJ A;  4J9C A;  2J05 A;  3VRY A;  1X2K A;  3EHQ A;  2EGC A;  2NWM A;  1T0H A;  1OOT A;  4IIO A;  2W0Z A;  1AWO A;  2KXD A;  2RF0 A;  4AG1 C;  2DE0 X;  1SHF A;  2AZV A;  2J7I A;  2D1X A;  5I11 A;  1J3T A;  2BZX A;  2DYB A;  1ZUU A;  2K6D A;  4RUG A;  2LCS A;  2MIO A;  1AEY A;  5FW9 A;  4HVW A;  4Y92 A;  1K1Z A;  1SPK A;  3O5Z A;  4QT7 A;  2CSI A;  5EC7 A;  4Z89 A;  2JW4 A;  1I0C A;  1UDL A;  1WDX A;  3U23 A;  1MV0 B;  2BZ8 A;  2EYY A;  4RTY A;  1VA7 A;  1NYF A;  4OML A;  2RNA A;  4AG2 C;  1QKW A;  3H0F A;  3REB B;  2DF6 A;  1GCQ C;  1PKS A;  1VYT A;  2ESW A;  3EGU A;  4E6R A;  1AWW A;  2JT4 A;  2RMO A;  1AWX A;  3I5R A;  4EIK A;  2BTT A;  3JV3 A;  4KRT A;  1JXO A;  2DM1 A;  2CUB A;  3QWY A;  1TUD A;  3KFV A;  4CC2 A;  2A28 A;  2KR3 A;  4AFS C;  2DRK A;  3TVT A;  2DX1 A;  1GCQ A;  3M0P A;  1Y0M A;  1U06 A;  1YNZ A;  1H3H A;  1X2Q A;  1PNJ A;  1VYU A;  5IHI A;  2A36 A;  1M27 C;  2FEI A;  1KIK A;  2AKK A;  3VS7 A;  1E6H A;  4AFU C;  4ORZ A;  4HVU A;  2FPD A;  2JS2 A;  3M0U A;  2DL5 A;  2LP5 A;  1AZG B;  1WYX A;  5I22 A;  3H0I A;  4GBQ A;  2FPE A;  1K76 A;  2C0I A;  4AFQ C;  1M8M A;  1WX6 A;  1CSK A;  2KYB A;  4GLM A;  2M0Y A;  2C0O A;  2RQW A;  2FRW A;  2K3B A;  2EKH A;  1Z9Z A;  1GFD A;  2KRS A;  4DEY A;  2FO0 A;  2RQU A;  2J06 A;  3ZL7 C;  2VVK A;  4JZ4 A;  1G2B A;  2D8H A;  3C0C A;  1GFC A;  2KRN A;  2KEA A;  1GCP A;  2DL3 A;  1UEC A;  2O2O A;  2P4R A; 
#chains in the Genus database with same CATH topology
 3ULR B;  4JRQ A;  5HY6 A;  2X3W D;  2EFI A;  2QQA A;  2DXT A;  2L3Q A;  4DBH A;  2M16 A;  3VRZ A;  3CXC A;  2YUO A;  1WJQ A;  4IKF A;  5CKD A;  1WXT A;  3FDR A;  4HT8 A;  4XTU A;  2RHU A;  1QCN A;  3L1A A;  4E7I A;  3FJ5 A;  5C6S A;  1ZHI A;  1UGQ B;  4E7L A;  2F5K A;  3OA6 A;  2CP5 A;  3LGL A;  1TSF A;  3LGF A;  3CC4 A;  4DOV A;  3CCR A;  1V29 B;  3CPW S;  1VQM Q;  4PFP A;  2DIQ A;  3CCU A;  4JJD A;  1I8F A;  2IVW A;  2NYS A;  1QP3 A;  3R6O A;  5I21 A;  1QVG A;  1M90 R;  4BD3 A;  3JCM Q;  4RTX A;  2JTM A;  1NBE B;  2MAM A;  2DRM A;  2RN8 A;  4FCY A;  3A8G B;  4C0F A;  1YJ9 A;  2EAY A;  1GBR A;  4XTW A;  4J5Y A;  2ECZ A;  1PD1 A;  2RHY A;  4C8Q F;  1WI7 A;  1KD1 R;  3CCV T;  4J9H A;  3G6E Q;  1RI9 A;  4FL6 A;  4ESR A;  3PMI A;  1YI2 Q;  1MHN A;  4ZN1 A;  5HK3 A;  1Y96 B;  4DA4 A;  2K5L A;  1Z9Q A;  2EPD A;  3NFC A;  1KSW A;  1LCK A;  2K4Y A;  2RJC A;  4E7H A;  2BUD A;  2EVR A;  1VQL T;  1X69 A;  1TTH B;  2CT3 A;  4BAC A;  4A53 A;  2NUT B;  4D8D A;  2ROL A;  2DFU A;  4JJC A;  4C8Q G;  2DJZ A;  4BY6 B;  4KH0 B;  3GBQ A;  1OQK A;  1LVK A;  2RQT A;  4P5N A;  3I56 A;  1ABQ A;  2RJF A;  2XI9 A;  4E7J A;  2YUN A;  1VQO A;  1G3W A;  2RQR A;  3TSW A;  4M7D E;  1YJ9 T;  4UC4 A;  4XTZ A;  3BDU A;  3JCM X;  1K73 C;  1G3S A;  3SWN C;  3J80 E;  2QDL A;  4PNO A;  1SRM A;  2E41 A;  3JCM f;  3RIR A;  1OZ3 A;  1JJ2 A;  3REA B;  2AK5 A;  1ZA1 B;  2CT4 A;  3QG1 A;  3VYH B;  1UHF A;  5GAN 6;  4N4G A;  5GMK j;  3CCE A;  3M0R A;  2KNB B;  2VYT A;  3EG2 A;  3RBB B;  3VS5 A;  3OQ5 A;  2I0N A;  1MUZ A;  2JS0 A;  4L6V 5;  5LJ5 h;  2K9G A;  1YJ9 Q;  2DER A;  1BCO A;  5KYX B;  1XOV A;  2V1R A;  3H41 A;  3EAE A;  1VQN A;  1QCO A;  2OAW A;  2CUD A;  3M0Q A;  4KGV B;  3CBM A;  4J6Y A;  4M7A C;  1SSF A;  1VQ6 A;  1M3C A;  3EFR A;  2EQK A;  3G71 T;  3FC3 A;  4M7D C;  3A98 A;  3M54 A;  3UA7 A;  1WJR A;  4PJO A;  2H3J A;  3AT1 B;  3OYF A;  3L2Z A;  2LX7 A;  3CCM T;  3CCV A;  3QJ6 A;  3NMZ C;  1NEB A;  2DIL A;  1AZE A;  4J6X A;  1I07 A;  2ZPH B;  1M30 A;  2PUK B;  4ZNX A;  2VV5 A;  3HFO A;  1VIE A;  3G4S T;  4AMC A;  5IH2 A;  4KUI A;  3E2U A;  3UA6 A;  4ATO A;  4HVV A;  5GAN 4;  3CMA Q;  2GTO A;  3CMA A;  1PD0 A;  1O9S A;  4A63 B;  2PUO B;  2SRC A;  1PKT A;  2GTJ A;  3MHX A;  2DVJ A;  3FB9 A;  2OTJ Q;  4RTT A;  3RR6 A;  4PFZ A;  1YCS B;  3WXM B;  4OB2 B;  2K2M A;  2ENM A;  2MWO A;  1C6V X;  1W6X A;  2AHJ B;  3HFN A;  3V7C A;  2B8A A;  4PJN A;  2VAS A;  1IZ6 A;  1YHQ A;  1K9A A;  3FRN A;  2EBP A;  1SG5 A;  2WAC A;  1VQ7 A;  2VGN A;  5IXB A;  2DLP A;  1HK9 A;  3NHN A;  1ZSZ C;  5FU7 B;  5HCK A;  3J7A F;  2D0N A;  2LZ6 B;  2WSF E;  3UDC A;  3L2R A;  4M7D D;  2XIC A;  4DOW A;  2RH2 A;  3PTA A;  2ZZD A;  3OS2 A;  1BI0 A;  3S3N A;  2HBP A;  2O01 E;  3GOX A;  3UAT A;  3VU3 C;  5KYY B;  2DBM A;  2EIF A;  2CGH A;  4MML A;  3G7Z A;  2YUP A;  1UGS B;  2CP6 A;  1YJN T;  3UPU A;  2KRM A;  1IB8 A;  1RAG B;  1WQW A;  4OMN A;  1SEM A;  3HSB A;  2MCN A;  5GMK i;  1G3Y A;  1BIB A;  3RKX A;  2CZ7 B;  2BKD N;  5FWC A;  2DZ9 A;  4M78 G;  1NZ9 A;  2C0T A;  1PRL C;  4IUT A;  2D8J A;  2RHZ A;  2V26 A;  1YHQ Q;  3VS0 A;  1I4K 1;  3JSC A;  3JB9 D;  3OYY A;  5DLQ E;  1VQO Q;  4HCZ A;  5LJ5 d;  5DY9 A;  1Q82 R;  1VIF A;  1WXB A;  2DYI A;  2RJE A;  1QWF A;  2X3X D;  1W2B P;  1RAH B;  2KGT A;  1Q7Y R;  1ZSZ A;  4BY6 C;  1WLP B;  3TRE A;  3UF4 A;  3OS1 A;  3S3O A;  1OEB A;  3H0H A;  3CD6 A;  3INZ A;  3L2U A;  3RER A;  3CCJ T;  1VQ6 T;  4XU0 A;  1SKU B;  3OYM A;  3OYG A;  1OOT A;  2PVD B;  2PVO B;  2XD0 A;  1AWO A;  1R0B G;  4AG1 C;  1AT1 B;  1B34 B;  1VQ4 A;  1VQ5 Q;  5A0L A;  1J3T A;  2QGF B;  2AT1 B;  5D6W A;  4DQ2 A;  4RUG A;  3NTK A;  4MMK A;  1AEY A;  4Y92 A;  1LOJ A;  4QT7 A;  2XK0 A;  4Z89 A;  4F7U A;  2JW4 A;  3U23 A;  1QP2 A;  6AT1 B;  2LDM A;  1VQ6 Q;  1VA7 A;  2MF2 A;  1NYF A;  2NLU A;  3CCJ Q;  1VYT A;  1KK7 A;  2ESW A;  1M1K R;  4C5I A;  1BI3 A;  4EMH A;  4EIK A;  2MI6 A;  4O6J A;  2DM1 A;  3QWY A;  1TUD A;  3KFV A;  2JJ9 A;  4MZP A;  2ZAE A;  2E70 A;  3JCM V;  1PCX A;  1GCQ A;  2L89 A;  1VQO T;  3N5B B;  4XAX B;  1N8R U;  1BCM A;  1X2Q A;  1Q82 C;  1M27 C;  1VQ4 Q;  1S72 T;  4M78 B;  1E6H A;  4C92 C;  2JTF A;  4M75 A;  2FPD A;  2JS2 A;  4XK8 E;  1WHH A;  2DVE A;  5EG2 A;  3V7S A;  4GBQ A;  1YIT Q;  2FPE A;  3BE3 A;  2C0I A;  1VQP A;  4NOY A;  3HL8 A;  2LRQ A;  1U1S A;  1NPR A;  2F5T X;  2M0Y A;  2RQW A;  2V8K A;  4NL3 A;  3H6Z A;  2RI3 A;  1OI1 A;  4KGX B;  1Z9Z A;  3M57 A;  3DLM A;  3VJP A;  1OZ2 A;  1Y71 A;  2F1L A;  3MEA A;  2J06 A;  3ZL7 C;  2EJG A;  1G2B A;  1KD1 C;  2D8H A;  1UB4 A;  5KYW B;  1WHG A;  3P8D A;  2DL3 A;  2JVV A;  4IUV A;  4ZN3 A;  2BE7 D;  3MEV A;  3OBW A;  2V8I A;  4LDY A;  4QVD A;  1AVZ C;  4OMO A;  1E6G A;  5GAO m;  2ZPE B;  3OYC A;  1IHV A;  4M77 B;  2X9H A;  2DJQ A;  2ED0 A;  1S72 Q;  4F14 A;  5GAN h;  2FZK B;  3Q1J A;  1BU1 A;  1VQ9 A;  1M2V B;  2E5K A;  1GXI E;  2E6Z A;  2LMJ A;  2DO3 A;  4BDZ A;  2KXC A;  4N4H A;  4XTY A;  4J9I A;  1IRE B;  2HL5 C;  1QQJ A;  3MKD A;  4C92 D;  4J9G A;  4B9X A;  5LJ5 j;  2LQ8 A;  2LJ1 A;  2PU9 B;  3SEM A;  1C1A A;  1B3Q A;  5IHK A;  4M77 D;  3M9Q A;  1WIE A;  5FU6 C;  3KUF A;  2EWN A;  4ZGJ B;  1EIF A;  3OYI A;  3CCR Q;  1W2B A;  2JTE A;  1U8R A;  5GAM h;  5FRM A;  3G4S Q;  2CSQ A;  4F7U B;  1KHC A;  4PJO G;  1VQ7 Q;  2FZG B;  3M4G A;  1TUC A;  1NLP C;  3RKW A;  3A8L B;  4M77 C;  4WF2 A;  3CME T;  3MEU A;  3UT1 A;  3PE0 A;  4HCK A;  1GBQ A;  2KT1 A;  1I1J A;  3CCS A;  2FPF A;  2QGG A;  1VQ5 T;  1NM7 A;  2HMA A;  4M75 F;  1WHL A;  3VUZ A;  1BI1 A;  1D1C A;  1M4Z A;  2KRO A;  1V1C A;  2F2W A;  5KE2 A;  1X75 C;  3V8K A;  2CP0 A;  3E1S A;  1D0X A;  5LJ3 j;  4RG8 A;  3JCM d;  3CD6 T;  3V7R A;  3GP8 A;  3JCM b;  4AT1 B;  2E12 A;  1JRI A;  2O4X B;  3I56 T;  3D7S B;  2KSS A;  2JM9 A;  2RD1 A;  3IQL A;  3C95 A;  3E19 A;  5L8R E;  4PL6 A;  1AOJ A;  2PNI A;  2VXF A;  4C0D C;  2DET A;  4M7D F;  1BI2 A;  5A2Q E;  2JXB A;  1NJI R;  4LD6 A;  1K8A R;  2QQR A;  1OX9 A;  3A8O B;  5DLO A;  4J7F A;  8ATC B;  1SF9 A;  2COY A;  4FYX B;  3T9N A;  2DIG A;  4HCB A;  3G4S A;  1QVF A;  2FZC B;  5GAM e;  4EPC A;  2VWF A;  4LDU A;  3CCQ Q;  1PM3 A;  2DBK A;  4HA8 A;  4OGE A;  3ZBD A;  1MGQ A;  2O9V A;  1QLY A;  2L3R A;  4B9W A;  1Q81 R;  5GAN 3;  2LQW A;  4ANJ A;  4C0G A;  1VQN Q;  1TOV A;  2QK0 A;  2X4X A;  4IUU A;  4C5G A;  1EX4 A;  3HP9 A;  1JU5 C;  3QSU A;  1MMN A;  4OF1 A;  1NEG A;  3FJP A;  4FU6 A;  3SHW A;  4QKU A;  1Q95 G;  3PVL A;  4CC7 A;  1N9R A;  3VUB A;  4GLK A;  1VQL Q;  1JB0 E;  1NG2 A;  3DB3 A;  1WZO A;  2MOX A;  4LUE A;  2HCK A;  2PQW A;  4RCC A;  4JRI A;  2FRY A;  1MMA A;  3JCM g;  2HDA A;  4XU3 A;  3PGG A;  4J8O A;  5L23 A;  3TEE A;  1I5O B;  2KY9 A;  1MV3 A;  3OB9 A;  2J6F A;  1VQK T;  2HEQ A;  1XTD A;  2K3Y A;  2YRC A;  3NPF A;  3FIF A;  2RM4 A;  4F7U E;  3VS6 A;  5D6Y A;  2FG0 A;  4M7D B;  1TXQ A;  4X34 A;  5IT9 E;  2PZ1 A;  2A3L A;  3M58 A;  3G1J A;  4IUP A;  1Q86 R;  1Y7X A;  3NGP A;  1K8A U;  3M0T A;  3CCM A;  3M5A A;  1UJY A;  3BDL A;  3CPW A;  5HK0 A;  2CKK A;  2GGR A;  5KYN A;  2O88 A;  3CME A;  3CCU T;  4ELY C;  2VB6 A;  3RKY A;  2LVM A;  4M7A G;  4M75 B;  4ZTF A;  2O4X A;  3HHT B;  4JPB W;  2HKN A;  3M59 A;  1Q82 U;  3I9Q A;  4C8Q B;  3C4S A;  3M4Y A;  1ZLM A;  4B6M A;  3CXC P;  3A8M B;  4BE2 A;  1B34 A;  1N8R R;  3I55 Q;  2DXB A;  1JJ2 S;  1V76 A;  1RUW A;  1U5S A;  1UJ0 A;  2RI5 A;  2WSC E;  1H8K A;  1UTI A;  1T0J A;  5GMK h;  4X9D A;  2OTL Q;  5D6X A;  1JO8 A;  1TS9 A;  2L3P A;  1LJO A;  1G83 A;  5HKC A;  1NJI U;  1OV3 A;  1X43 A;  4YTL A;  3CC7 Q;  2SEM A;  4XQ3 A;  5GAO r;  1WFW A;  4N0A A;  4CRI A;  1SRL A;  2DL4 A;  3JAM E;  2VUB A;  4RKU E;  1FYN A;  4PJO C;  1K8A C;  3MP1 A;  4LDX A;  3C94 A;  3JRZ A;  2VGM A;  2F69 A;  4F16 A;  2ZPG B;  3ME9 A;  3CC7 T;  5FRN A;  3DKM A;  2J05 A;  5GAM f;  3C12 A;  1F1B B;  2YLB A;  2RK2 A;  2DTH A;  1T0H A;  2LCL A;  3OYN A;  3CC2 A;  2W0Z A;  4J6W A;  3LWH A;  2KXD A;  2RF0 A;  3MEW A;  4PKC C;  3QKJ A;  2AZV A;  5CCA A;  2JNG A;  5CK9 A;  5I11 A;  3OYL A;  1DJ7 B;  1VQ9 T;  1ZUU A;  3L2Q A;  3P8H A;  2MIO A;  3CCL Q;  1SPK A;  5IN1 A;  2HQH A;  2K5F A;  4DBF A;  4C8Q D;  3G6E T;  3CPF A;  1I0C A;  1XQH A;  3MJX A;  1FMW A;  3OMG A;  4QQ6 A;  4RCB A;  1LPL A;  2AIR B;  4OML A;  4HCC A;  3SWN B;  4AG2 C;  3REB B;  4A54 A;  1YIJ T;  1GCQ C;  5FRO A;  3TU4 K;  2K3X A;  4E7K A;  3LYI A;  1VQK A;  2DD4 A;  1UGR B;  3JV3 A;  3VKI A;  4KRT A;  2KK4 A;  1JXO A;  2CUB A;  4C8Q A;  2A28 A;  2KR3 A;  1KD1 U;  4M78 C;  3G71 A;  1M5Q 1;  2DX1 A;  3M53 A;  3M0P A;  4MDW A;  4CI0 C;  4ZGE B;  3RMQ A;  2EJF A;  2MWP A;  4XTV A;  2QTX A;  4PJJ A;  1VYU A;  5IHI A;  2A36 A;  4PJO E;  1K9M U;  1BKB A;  1S72 A;  4JS4 A;  4PK4 A;  2AKK A;  5GAM j;  1M2V A;  1VUB A;  4PJL A;  3KBG A;  1N6A A;  2L8D A;  4FT2 A;  3TCJ A;  3JCM c;  1AZG B;  3CC2 Q;  1D0Y A;  5I22 A;  3JCM e;  3H0I A;  1QMC A;  4AFQ C;  1M8M A;  1WX6 A;  1CSK A;  1VQ8 A;  2K3B A;  3URG A;  3LX7 A;  3QUI A;  3RUX A;  3ZEH A;  2E5Q A;  2KRS A;  1ZSZ B;  5FU7 C;  2RQU A;  3BW1 A;  2XDB A;  1VQ8 T;  2FB7 A;  2VVK A;  2YHT A;  4JZ4 A;  4ELZ C;  2KRN A;  2KDS A;  1GCP A;  2E6N A;  5GAO p;  5GAN 2;  2QXF A;  3QII A;  1KQS P;  5LJ5 f;  2V1Q A;  4KUL A;  3JB9 G;  4JLI A;  5CKB A;  4Z02 A;  3CC7 A;  3A8H B;  3EFO A;  4C92 B;  1D3B B;  2KQW A;  4IUR A;  1B7T A;  4A4K A;  1N9S A;  4R0K A;  1JEG A;  2DMO A;  4XU2 A;  1VQP T;  3ASK A;  4M7D A;  4FYV B;  1QVG P;  4BI4 A;  2QQS A;  3LH5 A;  5CAI A;  1IGU A;  4V2S A;  2H3E B;  4E7S A;  5FU6 B;  1G3T A;  4X1V A;  1N8R C;  3GNF B;  1H64 1;  4LE9 A;  3EG9 A;  2DXC A;  1YBY A;  1M8V A;  4ZTJ A;  1KC8 C;  3CCJ A;  3LH0 A;  3VS4 A;  4BDY A;  3M56 A;  3RMS A;  4C8Q E;  1NJI C;  4KBM B;  2CH4 W;  2JOY A;  1IXD A;  3LW5 E;  2YDL A;  4M7A A;  1I5L A;  2EW3 A;  3QZ9 B;  2R5A A;  1YWP A;  3E9G A;  2K57 A;  1KG1 A;  3GPL A;  2B86 A;  2PTK A;  2YT6 A;  5CO7 A;  2YLC A;  4DBR A;  2MK5 A;  3JCM J;  1XNI A;  4FIB A;  1RL2 A;  1GL5 A;  1Q86 C;  3F70 A;  1BBZ A;  4RTW A;  2ZPI B;  1C0M A;  3M0S A;  5LJ5 g;  3QDR B;  1X6O A;  5CKH A;  4CC3 A;  5FWB A;  5M9O A;  4LDV A;  2XDD A;  3I56 Q;  1RAB B;  4JRP A;  1M90 U;  4FYY B;  3CD6 Q;  1VOM A;  5KYU B;  2CZ1 B;  2P0K A;  4M75 G;  4FW2 A;  5KE3 A;  1KQ2 A;  2EYZ A;  1RAI B;  2D6F A;  1RAC B;  4EMK A;  3J81 E;  3OMC A;  2CRE A;  1K73 U;  3PVQ A;  1WNL A;  4RG2 A;  4M7A D;  1FWZ A;  1IRX A;  1N5Z A;  4OMQ A;  2L2P A;  1JBM A;  4C92 G;  3GLX A;  2D9T A;  5KYU A;  4DEX A;  1VQ7 T;  3M55 A;  3G6E A;  2R58 A;  1K0S A;  4BI3 A;  3V8J A;  4XTX A;  1HD3 A;  2XHC A;  3MPU B;  2XKO C;  2L5Q A;  1ZX6 A;  4JRK A;  4M77 A;  1JJ2 P;  1WHK A;  2X51 A;  2ZPF B;  2GNC A;  2EGE A;  2A7Y A;  1K9M C;  3QO3 A;  5GAN 7;  2GFU A;  2OJ2 A;  2AZS A;  3CC4 Q;  4J9F A;  3QPH A;  2M51 A;  1ZBX A;  2E64 A;  4Y91 A;  3UWN A;  4FM4 B;  3R6N A;  1M9S A;  1P92 A;  4M78 E;  5CQX A;  4A4G A;  3LLR A;  1OYX A;  3EH1 A;  3VS3 A;  2EYQ A;  5LL6 S;  4FYW B;  2ED1 A;  1KC8 R;  4HXJ A;  4OB0 B;  5A0G A;  2L3S A;  1HXD A;  1TUG B;  1MMG A;  3EG0 A;  4K11 A;  3VS1 A;  2JM8 A;  3H9N A;  3EHR A;  4OGC A;  2OI3 A;  3L2V A;  1OUL A;  2DKG A;  2OX7 A;  4Z8A A;  5LJ5 e;  3VS2 A;  1OPK A;  1U1T A;  2EGA A;  1WQ7 A;  5IHN A;  2XID A;  1VQN T;  1G8X A;  1RLP C;  3OS5 A;  1UGV A;  3HRS A;  3PMT A;  3S6W A;  2EQJ A;  4FSX A;  1RAD B;  2CP7 A;  3QZ5 B;  5GAM g;  4NS5 A;  3V8L A;  1SHG A;  7AT1 B;  5GAN g;  4C92 F;  2XG8 D;  4CC4 B;  2XMF A;  1UGP B;  1K4U S;  2YRD A;  5KYW A;  2LNH B;  4LUD A;  4KGZ B;  2W10 A;  2HSE B;  1YIJ A;  2KBT A;  2M1H A;  4BI8 B;  3QHS A;  3CCS T;  4O5V A;  1ZSG A;  2QA4 Q;  2VXE A;  3MP6 A;  2ABL A;  3EFO B;  2G6F X;  4C92 A;  1OX8 A;  4DBQ A;  3CC4 T;  3X25 B;  2QDY B;  1FXX A;  4BB7 A;  4EMK C;  4FSS A;  2ZPB B;  4QQG A;  3EG1 A;  4FW1 A;  3MP8 A;  1KJW A;  4J9B A;  2DL7 A;  1W2B S;  3THK A;  3EG3 A;  1VQ9 Q;  2ROT A;  1UE9 A;  2DXU A;  3CC2 T;  2EYW A;  3CCE Q;  3PNW C;  2JUF A;  4J9E A;  1D3B A;  3CCL A;  3OW2 S;  1RLQ C;  4QW2 A;  4F7U G;  4GY5 A;  1RI0 A;  3CQT A;  3HTR A;  4OP0 A;  4AFZ C;  1M1F A;  4D8K A;  5GJV B;  2R5M A;  1X6B A;  2Y90 A;  1PRM C;  1QVP A;  1TG0 A;  4RTV A;  2CZ0 B;  2M0O A;  2NUZ A;  3O8V A;  3FEO A;  2K2V A;  1QCF A;  3ER0 A;  1Q81 U;  2A37 A;  3H8Z A;  4C0D B;  5GAN d;  2X4Y A;  4LD9 K;  3OYH A;  4RTU A;  1VQP Q;  2NUP B;  4J9C A;  4M78 F;  5KCH A;  3VRY A;  1X2K A;  3EHQ A;  2KMT A;  2DPP B;  2EGC A;  2MYS A;  3GF5 A;  4M77 G;  3EH2 A;  4F7U F;  2X4J A;  3JCM h;  2DE0 X;  3ZFJ A;  2ZCF B;  4C0Z A;  2J7I A;  3CCL T;  3OY9 A;  1WHM A;  1NPP A;  2C06 A;  1Q86 U;  4OB1 B;  5D7U A;  5FW9 A;  3I55 T;  2RK1 A;  1K1Z A;  4M7D G;  3O5Z A;  3OYB A;  2CSI A;  5EC7 A;  2YWW A;  1UDL A;  1WDX A;  5LJ3 e;  3L42 A;  1YFN A;  5LJ3 g;  2HD0 A;  4N0A C;  4RTY A;  1G5V A;  5J39 A;  2RNA A;  3A1P A;  1QKW A;  3H0F A;  2DF6 A;  2QTV A;  3EGU A;  4E6R A;  2A0F B;  4HKE A;  2CP3 A;  2RMO A;  2COZ A;  2VC8 A;  1YIT T;  1MND A;  2LQK A;  2XDP A;  3CCU Q;  1FMV A;  1VQM A;  4JUV A;  3CCQ A;  4PLL A;  1MMD A;  1EZZ B;  3TVT A;  1U06 A;  1YNZ A;  2MMP A;  1H3H A;  1Y96 A;  1H3Z A;  1PNJ A;  1KIK A;  1QVG S;  5CQY A;  5CIU A;  2QAS A;  3VS7 A;  4KT0 E;  4AFU C;  2EQM A;  4ORZ A;  1Q81 C;  2LP5 A;  2JN0 A;  4R56 A;  1WYX A;  2CP2 A;  2RA2 A;  1K76 A;  1RAE B;  4PJM A;  2EKO A;  2KYB A;  4GLM A;  2Y4X A;  2C0O A;  3CMA T;  2FRW A;  4QVC A;  1VQ8 Q;  2NUT A;  8AT1 B;  3CXC S;  2DEU A;  2ATC B;  3HRT A;  1W4S A;  3EGX A;  2RB6 A;  1KC8 U;  4M7A F;  4Y28 E;  3EFS A;  3C0C A;  1GFC A;  1WJS A;  4PFO A;  1RAF B;  2QA4 T;  1BYM A;  1OU9 A;  2O2O A;  2P4R A;  1YJN A;  3CCS Q;  1S1N A;  4M78 A;  1ABO A;  1CKA A;  4JZ3 A;  1HYO A;  3AHU A;  4HT9 A;  4C5H A;  4OVA A;  5LJ3 d;  1QW1 A;  3PIO A;  5GJW B;  1R77 A;  5GAO n;  1AD5 A;  2JMA A;  3WVE B;  3SB2 A;  3G71 Q;  1OPL A;  2HNI A;  2GQV A;  2RO0 A;  4M75 C;  2Y4Y A;  3PIP A;  4IUQ A;  1PG5 B;  4M75 E;  1Y57 A;  4M78 D;  1WGS A;  2K5I A;  4A4H A;  5IXF A;  3EG9 B;  1YJW A;  2E65 A;  3VYG A;  2QYZ A;  2EJ9 A;  4E7Z A;  2QA4 A;  5GAN e;  1K0X A;  4OMP A;  1JXM A;  3L2W A;  2DK3 A;  1YIJ Q;  1WA7 A;  1RAA B;  3HKS A;  1YN8 A;  1YHQ T;  2DEQ A;  4JDS A;  4Z88 A;  1LNX A;  3PT9 A;  1UUE A;  3DB4 A;  2OTL T;  3EGD A;  1M3A A;  4A4F A;  1M90 C;  1PC0 A;  2EQU A;  1WPY A;  4PJO B;  1A0N B;  1BB9 A;  3OSS C;  3P8B B;  4J83 A;  3X26 B;  3HPW A;  5C0M A;  2HAX A;  4NL2 A;  2BZY A;  2QQB A;  2CZ6 B;  1M3B A;  1KFZ A;  2CYZ B;  4D6W A;  2LT4 A;  4WCI A;  3CBO A;  2GBQ A;  2ZGW A;  5LJ3 h;  4MDX A;  1FMK A;  4PJO D;  5GAM d;  2O31 A;  2KAF A;  3RNJ A;  4RTZ A;  4II1 A;  1JQQ A;  3OYJ A;  3OSV A;  1QWE A;  2LJ3 A;  4LN2 A;  1NE8 A;  3FLG A;  1ZA2 B;  1YWO A;  4M7A E;  2GQI A;  2OTL A;  4OMM A;  3RES A;  1T3S A;  2DTO A;  4BE1 A;  1YI2 T;  1NYG A;  1ZUY A;  2LX9 A;  1IGQ A;  1TU0 B;  2HKQ B;  4LDW A;  3E9F A;  5CVI A;  3PFS A;  3CCV Q;  4WTO B;  2AKL A;  1M1K C;  4QVZ A;  1GRI A;  1K73 R;  4OB3 B;  4FT4 A;  4JS5 A;  3CCE T;  2IIM A;  1IHW A;  2LCC A;  4TVR A;  2VKN A;  3SDZ A;  2DA9 A;  5KH6 A;  4LNP A;  5KYY A;  2XU8 A;  1QVF P;  2FHD A;  2LC4 A;  1B07 A;  1VQM T;  1VQK Q;  5FLX E;  4JJN K;  1D09 B;  5A0D A;  3RDV A;  3OBY A;  1Q7Y C;  1N27 A;  2BE9 B;  2LNV A;  5GAO q;  2IPO B;  3LWI A;  2RJD A;  1PSF A;  2LT1 A;  3EGD B;  1PWT A;  2KT8 A;  2YUQ A;  4JLG A;  1Y07 A;  4MZM A;  1QVF S;  3CCM Q;  1D0Z A;  3S3M A;  1D1A A;  2KI7 A;  1R0C B;  2J6K A;  2L0A A;  1X01 A;  1T3L A;  3OYD A;  2DZC A;  2FL7 A;  2A08 A;  5IAY A;  5I2M A;  1UFF A;  5GAN 8;  3QDF A;  4C5E A;  5ECA A;  9ATC B;  1NLO C;  2D0Q B;  2RQV A;  2PVG B;  3GNG A;  3X24 B;  1QKX A;  4IIM A;  3OW2 P;  2P84 A;  3QBY A;  2RI2 A;  1E7O A;  1UEB A;  3NTH A;  2EQI A;  2HL3 A;  2E1H A;  2QG9 B;  2DL8 A;  2RPN A;  5GAN 5;  1ZUK A;  4J7I A;  4EMK B;  3X28 B;  1K9M R;  4EDU A;  2DNU A;  3I35 A;  1O75 A;  1YIT A;  2QQ9 A;  2KE9 A;  1IO6 A;  5GMK m;  2O9S A;  1U3O A;  2M9U A;  3OYE A;  3QXE B;  4M77 F;  4M4Z A;  3EGX B;  1M1G A;  2E4H A;  1VYV A;  1VQL A;  2I2L A;  1WHJ A;  3MO8 A;  1YI2 A;  2F2V A;  1TWB A;  4M75 D;  4QQD A;  3JB9 F;  2KVQ G;  2CDT A;  1ACM B;  2G3R A;  3I55 A;  2J6O A;  4J9D A;  2HSP A;  2F2X A;  3CPW P;  5CR2 A;  4JJB A;  2P4T A;  4KUD K;  2QEX T;  5LJ3 f;  4PJO F;  1KQS A;  2FVU A;  2QAZ A;  1Q7Y U;  1UHC A;  1ZQ1 A;  4F17 A;  4E2F B;  3JB9 I;  1MNE A;  3SWN A;  4MZT A;  1H92 A;  1CKB A;  4VUB A;  2JMC A;  4RMO A;  2E3H A;  3OS0 A;  5DM7 R;  1PHT A;  4M7A B;  3WVD B;  3JB9 H;  2GFA A;  1X6G A;  2YSQ A;  3CME Q;  1KQ1 A;  3CCQ T;  4BE0 A;  3OYK A;  3CBP A;  2R57 A;  3X20 B;  1AWJ A;  1HSQ A;  2X35 A;  2EYX A;  4EMG A;  5GMK l;  2KYM A;  1VQ5 A;  2JZ2 A;  3TQ7 P;  2CS7 A;  3I5S A;  4A4E A;  2LQN A;  1W1F A;  1YP5 A;  1EFN A;  2CH4 A;  4PLI A;  3VV0 A;  4ZGD B;  1X27 A;  4N4I A;  2K7A A;  1HJD A;  2K79 A;  4C92 E;  2LJ0 A;  3KXT A;  1UG1 A;  4R55 A;  1WXU A;  3QWX X;  1ARK A;  3OYA A;  2H8H A;  2HQE A;  1BK2 A;  3MCA B;  3TSZ A;  4F04 B;  1W70 A;  3SD4 A;  2HBW A;  3QYG B;  2NUP A;  1SSH A;  2V8J A;  1ZBJ A;  1PSE A;  2NWM A;  4IIO A;  2HQX A;  2E3I A;  1YCY A;  1SHF A;  2P0P A;  2COW A;  2D1X A;  2BZX A;  1D1B A;  1R8O B;  2DYB A;  3CEY A;  1OU8 A;  3JCM W;  2K6D A;  2LCS A;  5GAO l;  2MPX C;  5CKF A;  5AT1 B;  1M1K U;  4HVW A;  4L5G A;  2LTO A;  2DD5 A;  5AYF A;  1XJW B;  5GMK e;  5KCO A;  1MV0 B;  2BZ8 A;  2EYY A;  3QYH B;  2QEX Q;  1FX7 A;  3CCR T;  1PKS A;  4E47 A;  3QJY A;  2RHI A;  2P0Q A;  4ME7 A;  1AWW A;  2JT4 A;  5CKE A;  1AWX A;  3I5R A;  2BTT A;  2BIV A;  1YJW Q;  4CC2 A;  3OW2 A;  2QEX A;  1BIA A;  4AFS C;  2DRK A;  2YXY A;  2Z0W A;  3HRU A;  3JB9 J;  1Y0M A;  3GIB A;  1VQ4 T;  1AHJ B;  2OAU A;  2GCX A;  2FEI A;  2RHX A;  1I81 A;  2DAQ A;  1KHI A;  2HZY A;  3NTI A;  3BY7 A;  4L59 A;  2IG0 A;  2DTI A;  4HVU A;  3M0U A;  2DL5 A;  4X9C A;  2FYK A;  5GAN f;  4Q5W A;  1TH7 A;  1YJW T;  2YRV A;  2WSE E;  2OTJ T;  5J26 A;  1YJN Q;  2GF7 A;  3DLL A;  2QI2 A;  5KYX A;  2OTJ A;  2EKH A;  4LXC A;  4XU1 A;  4M77 E;  1GFD A;  3A5Z B;  4DEY A;  4OMF B;  2FO0 A;  2X4W A;  3SFM A;  5I2S A;  4BUG A;  2M02 A;  3BFM A;  5GAN j;  3JCM P;  3MET A;  2KEA A;  1M2O A;  2E10 A;  1UEC A;  4KH1 B;  1KQS S;  4C8Q C;  5J3B A; 
#chains in the Genus database with same CATH homology
 1S1N A;  3ULR B;  2V1Q A;  1AVZ C;  1ABO A;  1CKA A;  4OMO A;  2X3W D;  4JZ3 A;  1E6G A;  2L3Q A;  3VRZ A;  2YUO A;  5GJW B;  2DJQ A;  1AD5 A;  2ED0 A;  1WXT A;  2JMA A;  4R0K A;  1JEG A;  2DMO A;  4F14 A;  1OPL A;  1BU1 A;  3LH5 A;  3FJ5 A;  1Y57 A;  2E5K A;  2LMJ A;  4X1V A;  5IXF A;  2KXC A;  4JJD A;  4J9I A;  4LE9 A;  4J9G A;  4RTX A;  2LJ1 A;  3SEM A;  1K0X A;  1B3Q A;  5IHK A;  4OMP A;  1WIE A;  1JXM A;  2DRM A;  2RN8 A;  3VS4 A;  1WA7 A;  1YN8 A;  2CH4 W;  1GBR A;  2YDL A;  2JTE A;  4Z88 A;  2ECZ A;  2EW3 A;  1UUE A;  1WI7 A;  2CSQ A;  1M3A A;  4J9H A;  1YWP A;  1RI9 A;  4ESR A;  1TUC A;  1NLP C;  2B86 A;  2PTK A;  2YT6 A;  3PE0 A;  4HCK A;  1A0N B;  1GBQ A;  2KT1 A;  1BB9 A;  1I1J A;  2FPF A;  1Z9Q A;  1GL5 A;  2EPD A;  1KSW A;  1LCK A;  1BBZ A;  4RTW A;  3M0S A;  1NM7 A;  2BZY A;  2EVR A;  1M3B A;  4CC3 A;  2KRO A;  1X69 A;  1KFZ A;  2CT3 A;  5FWB A;  1V1C A;  2F2W A;  4D8D A;  2ROL A;  4WCI A;  4JJC A;  2GBQ A;  3GBQ A;  1FMK A;  2RQT A;  2O31 A;  1ABQ A;  3RNJ A;  4RTZ A;  2JM9 A;  2YUN A;  1JQQ A;  2EYZ A;  3IQL A;  2RQR A;  3TSW A;  1QWE A;  2LJ3 A;  1AOJ A;  4LN2 A;  2PNI A;  2CRE A;  2QDL A;  3PVQ A;  1YWO A;  2JXB A;  1SRM A;  2GQI A;  1N5Z A;  4OMM A;  4OMQ A;  2L2P A;  1T3S A;  4DEX A;  1NYG A;  1ZUY A;  3REA B;  2AK5 A;  2CT4 A;  2AKL A;  1K0S A;  1HD3 A;  1GRI A;  1UHF A;  2VWF A;  2DBK A;  2IIM A;  2O9V A;  1QLY A;  3M0R A;  2KNB B;  3EG2 A;  1ZX6 A;  3RBB B;  3VS5 A;  2LQW A;  2I0N A;  2VKN A;  1MUZ A;  2JS0 A;  2DA9 A;  2K9G A;  4LNP A;  2GNC A;  1XOV A;  1JU5 C;  1B07 A;  2EGE A;  2V1R A;  3H41 A;  2OJ2 A;  2OAW A;  2AZS A;  1NEG A;  2CUD A;  3M0Q A;  4J9F A;  2M51 A;  3SHW A;  3R6N A;  3PVL A;  1M3C A;  1PWT A;  2KT8 A;  2YUQ A;  4CC7 A;  3A98 A;  3UA7 A;  1NG2 A;  3VS3 A;  2MOX A;  2J6K A;  4LUE A;  2L0A A;  2HCK A;  2ED1 A;  1T3L A;  4HXJ A;  2LX7 A;  2L3S A;  2FRY A;  3NMZ C;  2A08 A;  1NEB A;  2HDA A;  2DIL A;  3EG0 A;  1UFF A;  4K11 A;  2JM8 A;  3VS1 A;  1AZE A;  1I07 A;  5ECA A;  3EHR A;  5L23 A;  1M30 A;  4ZNX A;  2OI3 A;  1NLO C;  2RQV A;  1MV3 A;  5IH2 A;  2J6F A;  1QKX A;  2HEQ A;  4IIM A;  3UA6 A;  4Z8A A;  4HVV A;  3VS2 A;  2GTO A;  1E7O A;  1OPK A;  2EGA A;  5IHN A;  2EQI A;  3NPF A;  4A63 B;  2SRC A;  1RLP C;  2RPN A;  1PKT A;  2DL8 A;  1ZUK A;  2GTJ A;  2DVJ A;  4RTT A;  1UGV A;  3VS6 A;  1YCS B;  2DNU A;  2FG0 A;  2K2M A;  3I35 A;  2ENM A;  1W6X A;  2PZ1 A;  2KE9 A;  1IO6 A;  2O9S A;  1U3O A;  1K9A A;  4M4Z A;  2EBP A;  3NGP A;  1SHG A;  3M0T A;  1VYV A;  4CC4 B;  1UJY A;  5IXB A;  2DLP A;  2XMF A;  3NHN A;  2GGR A;  1K4U S;  5HCK A;  2O88 A;  2LNH B;  2F2V A;  4LUD A;  2W10 A;  2D0N A;  2LZ6 B;  2KBT A;  2CDT A;  1ZSG A;  2J6O A;  4J9D A;  4JPB W;  2ABL A;  2HSP A;  2G6F X;  2F2X A;  3I9Q A;  4JJB A;  1UHC A;  3UAT A;  1ZLM A;  4FSS A;  4F17 A;  3EG1 A;  2DBM A;  1KJW A;  4J9B A;  2DL7 A;  1H92 A;  3THK A;  2YUP A;  1CKB A;  1RUW A;  1U5S A;  2JMC A;  1UJ0 A;  3EG3 A;  1H8K A;  1UTI A;  2ROT A;  1PHT A;  1T0J A;  1UE9 A;  2EYW A;  1X6G A;  2YSQ A;  2KRM A;  4J9E A;  4OMN A;  1SEM A;  1RLQ C;  1AWJ A;  1HSQ A;  2MCN A;  2EYX A;  5FWC A;  1JO8 A;  2L3P A;  3CQT A;  4AFZ C;  2C0T A;  1PRL C;  2KYM A;  2D8J A;  1G83 A;  1OV3 A;  1X43 A;  3VS0 A;  4D8K A;  2SEM A;  1WFW A;  3I5S A;  5GJV B;  2LQN A;  1SRL A;  1W1F A;  1YP5 A;  1EFN A;  1X6B A;  1WXB A;  2CH4 A;  1QWF A;  1X27 A;  2DL4 A;  2X3X D;  2K7A A;  1HJD A;  1PRM C;  2K79 A;  2LJ0 A;  2KGT A;  1UG1 A;  1TG0 A;  4RTV A;  1FYN A;  1WXU A;  3QWX X;  1WLP B;  1ARK A;  3UF4 A;  2NUZ A;  2H8H A;  1BK2 A;  3TSZ A;  1OEB A;  3H0H A;  1QCF A;  1W70 A;  4F16 A;  2HBW A;  2A37 A;  1SSH A;  4RTU A;  1ZBJ A;  4J9C A;  2J05 A;  3VRY A;  1X2K A;  3EHQ A;  2EGC A;  2NWM A;  1T0H A;  1OOT A;  4IIO A;  2W0Z A;  1AWO A;  2KXD A;  2RF0 A;  4AG1 C;  2DE0 X;  1SHF A;  2AZV A;  2J7I A;  2D1X A;  5I11 A;  1J3T A;  2BZX A;  2DYB A;  1ZUU A;  2K6D A;  4RUG A;  2LCS A;  2MIO A;  1AEY A;  5FW9 A;  4HVW A;  4Y92 A;  1K1Z A;  1SPK A;  3O5Z A;  4QT7 A;  2CSI A;  5EC7 A;  4Z89 A;  2JW4 A;  1I0C A;  1UDL A;  1WDX A;  3U23 A;  1MV0 B;  2BZ8 A;  2EYY A;  4RTY A;  1VA7 A;  1NYF A;  4OML A;  2RNA A;  4AG2 C;  1QKW A;  3H0F A;  3REB B;  2DF6 A;  1GCQ C;  1PKS A;  1VYT A;  2ESW A;  3EGU A;  4E6R A;  1AWW A;  2JT4 A;  2RMO A;  1AWX A;  3I5R A;  4EIK A;  2BTT A;  3JV3 A;  4KRT A;  1JXO A;  2DM1 A;  2CUB A;  3QWY A;  1TUD A;  3KFV A;  4CC2 A;  2A28 A;  2KR3 A;  4AFS C;  2DRK A;  3TVT A;  2DX1 A;  1GCQ A;  3M0P A;  1Y0M A;  1U06 A;  1YNZ A;  1H3H A;  1X2Q A;  1PNJ A;  1VYU A;  5IHI A;  2A36 A;  1M27 C;  2FEI A;  1KIK A;  2AKK A;  3VS7 A;  1E6H A;  4AFU C;  4ORZ A;  4HVU A;  2FPD A;  2JS2 A;  3M0U A;  2DL5 A;  2LP5 A;  1AZG B;  1WYX A;  5I22 A;  3H0I A;  4GBQ A;  2FPE A;  1K76 A;  2C0I A;  4AFQ C;  1M8M A;  1WX6 A;  1CSK A;  2KYB A;  4GLM A;  2M0Y A;  2C0O A;  2RQW A;  2FRW A;  2K3B A;  2EKH A;  1Z9Z A;  1GFD A;  2KRS A;  4DEY A;  2FO0 A;  2RQU A;  2J06 A;  3ZL7 C;  2VVK A;  4JZ4 A;  1G2B A;  2D8H A;  3C0C A;  1GFC A;  2KRN A;  2KEA A;  1GCP A;  2DL3 A;  1UEC A;  2O2O A;  2P4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...