1BBZA

Crystal structure of the abl-sh3 domain complexed with a designed high-affinity peptide ligand: implications for sh3-ligand interactions
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the abl-SH3 domain complexed with a designed high-affinity peptide ligand: implications for SH3-ligand interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (transferase/peptide)
molecule keywords ABL TYROSINE KINASE
total genus 10
structure length 58
sequence length 58
chains with identical sequence C, E, G
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1998-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1bbzA00
4D8DA 2X3XD 2YUNA 3C0CA 5IXFA 1FYNA 1K0XA 2JS0A 1Z9QA 4CC4B 2HCKA 1I07A 2JS2A 1AVZC 1SHGA 1AD5A 4J9CA 1GBRA 4J9HA 2F2WA 2OI3A 4Z88A 2EGAA 1YNZA 1PKTA 1H3HA 3H0FA 2MCNA 3REAB 2CSQA 3R6NA 4ZNXA 5IXBA 3THKA 3UA6A 2YDLA 1I1JA 5I11A 2ED1A 1QKXA 1FMKA 2DL4A 4AFQC 4HXJA 2YSQA 2DYBA 1AEYA 2FRYA 1GFCA 3EHRA 2AKLA 2A28A 2CSIA 4K11A 5ECAA 4OMOA 1AWOA 1WI7A 2MOXA 2JMAA 2CH4A 1K1ZA 2H8HA 1UECA 2EQIA 2LP5A 3EG0A 1CKAA 2IIMA 3TSWA 1M8MA 1VYVA 2A08A 1OV3A 2SEMA 3NPFA 1E6GA 1GFDA 1WDXA 4J9IA 2DRMA 2DA9A 2JM8A 1G83A 2RNAA 1TG0A 1NYGA 1JXMA 1HSQA 4HVVA 1VA7A 2DL5A 3ZL7C 1JQQA 2V1QA 1ABQA 1OPLA 4JJCA 5EC7A 4RTVA 1YWPA 2EYYA 3VS6A 1WLPB 1WX6A 2C0TA 2EYZA 4HCKA 1A0NB 4OMPA 1QWFA 1UJ0A 4RUGA 2ROTA 2L2PA 1T0JA 2FPFA 2FRWA 1PNJA 2EVRA 1YP5A 2RQTA 3EG1A 1JEGA 4F16A 1K4US 4AFSC 2GNCA 1E6HA 1M3CA 2KT8A 1WXUA 2C0OA 1ZX6A 3I5SA 1MV0B 3ULRB 1T3SA 2E5KA 3LH5A 4OMQA 2BTTA 2KEAA 1V1CA 2DL7A 1MV3A 2YUOA 1EFNA 5L23A 1W1FA 3TVTA 2FG0A 1S1NA 2KT1A 2ED0A 1X69A 3CQTA 1NYFA 2AZVA 2GTOA 2DBKA 2K3BA 3NHNA 2JTEA 2LQNA 4Z8AA 1GCQC 4AFUC 1QKWA 2LZ6B 1KFZA 2JXBA 2CUBA 2DM1A 3M0UA 2K7AA 4R0KA 3PE0A 1UHCA 1B3QA 1UTIA 2L3PA 1N5ZA 2J06A 1UHFA 4EIKA 3I35A 1WXTA 3REBB 4JZ3A 2GBQA 2GGRA 4LUEA 2KE9A 1YCSB 2C0IA 2L0AA 4RTYA 3VS5A 2O9VA 4Z89A 3M0TA 1BBZA 2DMOA 4OMLA 3FJ5A 2G6FX 1K0SA 1W70A 1ZLMA 1AOJA 1YWOA 2AK5A 4J9DA 1H8KA 1Y57A 4RTZA 4JZ4A 2PTKA 3VS2A 5IHIA 1W6XA 5FWBA 3TSZA 4AG2C 2CUDA 4CC3A 1SEMA 2F2VA 2DF6A 2J7IA 2D1XA 1WIEA 2XMFA 1PRMC 4IIOA 2CDTA 4HVWA 2LJ3A 1UJYA 1RLQC 2LQWA 1QCFA 1UDLA 2DBMA 1XOVA 1ZUKA 1WXBA 1NM7A 3VRZA 2JW4A 1QLYA 1NG2A 3SHWA 1UE9A 1CKBA 1GBQA 2W10A 2DL8A 3SEMA 2RQVA 1U06A 2DLPA 2AZSA 2PNIA 3VRYA 3VS4A 1E7OA 2KRSA 1HJDA 2KXDA 1X2QA 4LUDA 3QWXX 2LJ0A 1M30A 3H0IA 4J9FA 2YUPA 2GTJA 4RTUA 1YN8A 3U23A 2KGTA 4ORZA 2K9GA 2DRKA 1JO8A 2DILA 3EG3A 3NGPA 2O31A 2FPEA 1K76A 2V1RA 4LE9A 4CC7A 3RNJA 1X6BA 2I0NA 2KR3A 3QWYA 4IIMA 2ROLA 1ARKA 2DNUA 1K9AA 1WFWA 4A63B 2HBWA 3UATA 2O2OA 1PHTA 3A98A 1RUWA 2YT6A 5I22A 1AWJA 2J05A 2DE0X 3VS0A 4J9GA 2HSPA 4JJDA 1NEGA 4WCIA 2ESWA 4E6RA 2ABLA 1SRLA 4DEYA 3VS7A 2EBPA 1KIKA 2JMCA 1Y0MA 1PRLC 2M0YA 1UUEA 1U3OA 5GJWB 1AWXA 1GRIA 3JV3A 1SRMA 2ECZA 1B07A 2A37A 1MUZA 1ZSGA 3EGUA 1ZUUA 3O5ZA 1UFFA 1I0CA 2PZ1A 1UGVA 1M3AA 1OPKA 2P4RA 2F2XA 1VYTA 2RF0A 4AG1C 2KXCA 2DJQA 2JM9A 1U5SA 2K2MA 1M3BA 2RQUA 2KROA 2LX7A 3EG2A 2B86A 1LCKA 2K79A 3M0RA 4DEXA 2EYWA 2A36A 4X1VA 1UG1A 2KRNA 2OAWA 2RN8A 2BZYA 1VYUA 2LJ1A 2MIOA 4RTWA 1TUCA 4RTXA 4F14A 1BU1A 1JXOA 2D8HA 2JT4A 2KYMA 3UF4A 4GLMA 1CSKA 1NEBA 1HD3A 2O9SA 1GCPA 2GQIA 3H0HA 2DVJA 2CH4W 4FSSA 2EPDA 2QDLA 2DX1A 3M0SA 2FEIA 2M51A 1H92A 1Z9ZA 2J6OA 1G2BA 2LMJA 3NMZC 1M27C 1QWEA 2KNBB 4J9EA 2D0NA 2EGCA 1T0HA 2W0ZA 1PKSA 4JJBA 2J6FA 1T3LA 1PWTA 4QT7A 3PVQA 3GBQA 2SRCA 1BK2A 3M0QA 4Y92A 2HDAA 3H41A 1AZGB 2L3SA 5IH2A 4ESRA 1NLOC 5IHKA 3VS1A 3UA7A 3EHQA 1GCQA 2OJ2A 1WYXA 2VVKA 1IO6A 3I5RA 4OMNA 3RBBB 4LNPA 4AFZC 1ZBJA 2D8JA 2HEQA 4GBQA 1SSHA 2KRMA 3IQLA 2RQRA 1RI9A 2LNHB 2L3QA 2EGEA 2BZ8A 2CT4A 2BZXA 1OEBA 3VS3A 1NLPC 2NUZA 2KYBA 1J3TA 1AWWA 1X6GA 2EYXA 4HVUA 1SPKA 1ABOA 2NWMA 2RMOA 1JU5C 3PVLA 1TUDA 4CC2A 4JPBW 1KJWA 1WA7A 1ZUYA 4OMMA 2EKHA 2YUQA 2LCSA 2RQWA 1X43A 4RTTA 2CT3A 2FPDA 1X2KA 2X3WD 4KRTA 3I9QA 1RLPC 2K6DA 2J6KA 4M4ZA 5FWCA 4LN2A 2CREA 4J9BA 1KSWA 1SHFA 2VWFA 2RPNA 1X27A 3KFVA 3M0PA 5GJVB 2O88A 5IHNA 2VKNA 1GL5A 1BB9A 2ENMA 2FO0A 1OOTA 2DL3A 1AZEA 2EW3A 2AKKA 5FW9A 5HCKA 4F17A 2KBTA 4D8KA
chains in the Genus database with same CATH superfamily
4D8DA 1WJRA 5IXFA 2JS0A 3QIIA 2HCKA 4M78A 1K73C 2VGMA 1SHGA 1AD5A 5AYFA 4ELYC 4J9HA 1PKTA 4E7LA 2PVOB 4QVCA 2P4TA 3UA6A 2YDLA 4OMFB 4HKEA 4OB0B 4HXJA 2DYBA 3OBWA 1GFCA 3EHRA 4E7IA 1UGQB 1IXDA 1VQ9T 5IN1A 2MYSA 5KE3A 1NPPA 1RL2A 1KQ1A 4JDSA 4M78C 1WI7A 2QEXQ 1PSFA 4IUPA 1TU0B 3CCJA 2JMAA 4EMKB 1K1ZA 2VXEA 3CBMA 1CKAA 2E3HA 3VYHB 3EFOA 4A4EA 2HZYA 1M8MA 3NPFA 2PUOB 1U8RA 2HBPA 1ZSZC 3OS0A 2JM8A 5GMKi 2V8JA 1TG0A 1NYGA 2P0KA 4BI4A 3ZL7C 3QYGB 1ABQA 3PMTA 1OPLA 5LJ5g 1NJIC 4HA8A 4GY5A 4RTVA 1YWPA 4HCKA 2EAYA 2XI9A 2CS7A 4LDXA 2HAXA 2R5AA 4WTOB 1I5OB 4FYWB 3EFRA 5GMKm 1M90R 1WJSA 2FRWA 5GAMh 4MZTA 2RQTA 1YJ9Q 3MEWA 1BI1A 4F16A 2K5FA 3CCEQ 1D09B 2KT8A 3JCMX 5LJ3h 1ZA1B 2BKDN 3I5SA 4L59A 1T3SA 2E5KA 3CCVA 2BTTA 1MV3A 2RH2A 2AHJB 4PJOC 1S1NA 2ED0A 1X69A 5KCHA 2AZVA 3S6WA 4N0AA 3CCMA 4LD9K 4Z8AA 5A0GA 1YJWT 1QKWA 1KFZA 2JXBA 8AT1B 3MJXA 3PE0A 2L8DA 1M5Q1 1UTIA 5DLQE 3HRSA 5HKCA 2L3PA 1Y96A 3E9GA 4EIKA 1RAAB 3I35A 3OMCA 1WXTA 4JZ3A 5HK3A 3CC2A 1KC8R 3RIRA 4P5NA 5GANj 1YITQ 2L0AA 2DZCA 4A4FA 3M0TA 3OYGA 3BDLA 5KCOA 2DMOA 4XU0A 3RKXA 1Q81C 3CD6A 1VQ4T 2DZ9A 1B34B 4XU3A 3MHXA 2QTVA 5IHIA 1OQKA 4M7AG 2QXFA 3TSZA 4JRQA 4BE2A 1LOJA 4M7DB 5I21A 3I55T 2IG0A 5GAN4 1C6VX 2D1XA 4BDZA 1Y7XA 2CDTA 2OTLT 2HQEA 1WHMA 4FT2A 5GAMd 3X20B 2VGNA 1WXBA 2EYQA 3VRZA 2JW4A 2VYTA 1K8AR 4OB2B 1N9RA 3VYGA 1YBYA 2DLPA 4M7AA 3SDZA 1W4SA 5LJ3d 2PNIA 3EGDB 1S72A 3VRYA 3J80E 1E7OA 4PLLA 4HT8A 1X2QA 3QWXX 4RMOA 1YI2Q 4FW1A 2QEXT 1PD0A 3PTAA 2MF2A 5LJ3f 3H0IA 4RTUA 5GMKe 4C5HA 3QDRB 2M0OA 1VQPA 3OA6A 2KGTA 4M77C 3EG3A 1QMCA 4CC7A 5FRNA 3FRNA 2KR3A 4C0DC 3NFCA 4OGCA 3OSSC 2DTHA 1ARKA 3QZ5B 2P0PA 3QXEB 4R56A 4C5IA 2DNUA 1K9AA 2VC8A 3RUXA 2V8KA 2HBWA 3UATA 4R55A 2O2OA 1PHTA 3A98A 1RUWA 5I22A 4OVAA 3FJPA 2J05A 2EJ9A 3CCVQ 1VUBA 4J9GA 1IGQA 1WHGA 4PJOD 4DEYA 5C0MA 1VQ8T 2E12A 1BCOA 1N8RC 3QHSA 3OMGA 1QVGP 1Y0MA 4DOVA 1PRLC 5GJWB 5L8RE 3JV3A 1ZUUA 1M2OA 1I0CA 2QQRA 1OPKA 2F2XA 2RF0A 3OBYA 3DLLA 4AG1C 4EDUA 2ZPIB 4LDUA 2DJQA 1U5SA 1M3BA 2KROA 2QQBA 4Q5WA 5CVIA 1OZ2A 2EYWA 4IUTA 4OB1B 4O5VA 1OYXA 2A36A 2RHZA 4OF1A 4ZTFA 2DTOA 1UG1A 1TOVA 2X4YA 3I55A 4M75C 4C92F 1BI2A 1TSFA 2COYA 4C5GA 2MIOA 2MWOA 4XTXA 1TUCA 4F14A 4J6YA 2KYMA 4GLMA 1CSKA 1NEBA 3HPWA 1YITA 1M8VA 2GQIA 2MAMA 2EQUA 2QDLA 3E9FA 5GAN5 2DX1A 2FEIA 1VQKQ 4BE0A 3A5ZB 2Z0WA 4C8QA 5GMKl 3OYYA 1QVFA 1RAGB 3CCLT 2EGCA 3VJPA 4VUBA 4JJBA 5LL6S 3C94A 1Q86R 2E4HA 4QQDA 2IPOB 4M7AE 3LH0A 4DOWA 3CCEA 2SRCA 4EMGA 1WHHA 3META 2X35A 2EFIA 3H41A 4MMKA 3CCMT 2CZ6B 3PIOA 5IHKA 1RADB 1VQ6Q 3EAEA 2XICA 3EHQA 1IO6A 2O01E 4LNPA 1TXQA 4GBQA 3IQLA 4M78B 4IURA 2LCLA 1RI9A 2LNHB 3GPLA 2CT4A 4FM4B 1Y71A 3VS3A 2D9TA 2NUZA 5CKBA 1VQ4A 5D6YA 4KH1B 4PNOA 1R77A 1NZ9A 5DM7R 3A8OB 3A8GB 2K3XA 2NWMA 5A0LA 1G3YA 4ATOA 5KYXA 3RDVA 1TUDA 5LJ5f 2RK2A 2EKHA 2LCSA 1MGQA 3CCSQ 2XU8A 2FPDA 4JRKA 2CZ1B 3ER0A 5LJ5d 1R0CB 5IAYA 1RLPC 3CD6Q 3LW5E 4MZPA 2CREA 4J9BA 3CXCP 4C8QD 5GJVB 3GNGA 2VKNA 4B9XA 1JRIA 2FO0A 1OOTA 8ATCB 5J26A 4JS4A 4F17A 1W2BP 5LJ3j 2WACA 3X25B 2K5LA 4FYVB 3OW2S 1VQ7T 2JTMA 1Q81U 1KHIA 3VUBA 2XHCA 4CC4B 3L2WA 2JS2A 1G3WA 1FMVA 3QG1A 3CPFA 4J9CA 1XTDA 1GBRA 2F2WA 2OTJQ 2R5MA 2DXBA 1G5VA 2RJDA 3H0FA 1YCYA 3R6NA 4ZNXA 5I11A 5A0DA 1LPLA 3BFMA 1VQKT 2YSQA 2RJEA 1AEYA 3HRUA 2BE9B 3JB9I 3DB4A 2AKLA 2LT4A 4KBMB 4LDVA 4B9WA 2A28A 5ECAA 2JTFA 3WVEB 2VXFA 1LVKA 2YWWA 2Y90A 1NJIU 2EQJA 3TSWA 1VYVA 2SEMA 1E6GA 1VQ4Q 3CCJT 4PJOA 3V7RA 2HNIA 4JJNK 1D1CA 1VQ9A 4C8QG 1HSQA 1M1KU 2QGGA 1MMNA 5CK9A 1JQQA 5FU7C 4N4IA 2V1QA 3CCMQ 2DVEA 4QVDA 3INZA 4M7DG 4N4HA 3SFMA 3MP6A 4C92G 2C0TA 2EYZA 1KD1U 1FXXA 1EZZB 4MDXA 4OGEA 2RA2A 2L2PA 1T0JA 4PFPA 1YITT 3MP1A 3G6EQ 2YRVA 3BY7A 4RG2A 2QEXA 3CC7Q 1JEGA 3MEUA 1KQSA 4QQGA 2RK1A 1OU8A 3M58A 4XAXB 5GMKj 3CC7T 2LQKA 4PJMA 1WQWA 4PJLA 5CAIA 3ULRB 2GCXA 1K73R 4OMQA 2KEAA 2DL7A 1C0MA 3HKSA 3BE3A 3CPWP 4HCBA 2YUOA 1EFNA 6AT1B 2ZPFB 1PCXA 2FG0A 3CQTA 1NYFA 2CP0A 3HSBA 1GCQC 3CC4T 1D0XA 2DM1A 3E1SA 2K7AA 3EGDA 3L2ZA 1X6OA 2CP6A 1YIJT 1PSEA 2FZCB 1N5ZA 3GF5A 2K5IA 3JCMc 4ANJA 3CPWA 2QAZA 4O6JA 4E2FB 2H3EB 1Q7YU 2GGRA 4LUEA 2K57A 2KE9A 2QQAA 1YCSB 3GNFB 1ZQ1A 1BIBA 4F04B 4DQ2A 3QDFA 4RCCA 3JCMh 1BBZA 3OYKA 5LJ3g 3FJ5A 4HCZA 2I2LA 1ZLMA 4F7UB 3CCQT 1C1AA 1TUGB 3I56T 2ZCFB 1AOJA 3QKJA 1Y57A 4RTZA 2PTKA 3VS2A 2L89A 3SWNC 1FWZA 3L42A 3TEEA 2DXCA 3Q1JA 2RJCA 4XTUA 2CUDA 5LJ5e 3CBOA 2LDMA 2CP7A 4C92B 1WHJA 1FMWA 1PRMC 5GANe 1IREB 1Y07A 3RKWA 1O9SA 3P8HA 3PT9A 1RLQC 1QP3A 2DBMA 1ZUKA 4M78G 3CMAA 1NM7A 2DK3A 1HXDA 2HKNA 2FVUA 3CPWS 2HQXA 3ASKA 3N5BB 1MHNA 2DJZA 1U06A 2RQVA 4BB7A 1VQNT 2AZSA 3RERA 2E1HA 5CQXA 3OQ5A 2F5KA 3DB3A 2KRSA 2PVGB 3AT1B 3QPHA 3OW2A 3A8HB 4J9FA 2WSEE 2YUPA 2NLUA 1YN8A 1JJ2S 2QYZA 3LGFA 3CCET 1M4ZA 2LT1A 2F5TX 2EWNA 3LX7A 4ZN1A 4ORZA 2V8IA 2K9GA 2DILA 3LGLA 1SF9A 2FPEA 2QA4Q 3OYAA 4LE9A 3RNJA 1X6BA 3KUFA 2X4WA 2H3JA 2I0NA 1U1SA 3QWYA 4XU1A 4IIMA 5D6XA 2QGFB 2DTIA 2XDPA 4A63B 5KYXB 4M7DD 3EH1A 4PL6A 3VS0A 4BY6B 4E7SA 5I2MA 2JJ9A 2HSPA 2DKGA 4WCIA 2ABLA 1Q82U 1SRLA 4BDYA 2VV5A 4B6MA 1KIKA 1SSFA 1UGPB 4RKUE 3I56Q 1U3OA 1RI0A 2ECZA 1N9SA 1XQHA 3CC4Q 3JSCA 1P92A 3O5ZA 1UFFA 3UDCA 2LQ8A 1UGVA 4J6WA 3CCQA 2KXCA 1IHWA 4NOYA 2GQVA 2JM9A 4II1A 2KMTA 2D6FA 2OTLQ 2B86A 3H9NA 4BI3A 3OYLA 4E47A 4X1VA 1SKUB 2BZYA 2ZPBB 1M9SA 2RI5A 2HL3A 2LJ1A 5C6SA 1M2VB 4RTXA 1S72Q 1JXOA 3UF4A 1TWBA 1YHQQ 3JB9H 3OYJA 3OW2P 2O9SA 1OULA 3WXMB 5GAN2 2OTJA 1VQ5Q 4CRIA 4XK8E 4N0AC 2CH4W 4FSSA 3JCMP 3M55A 5KYYA 1H92A 2RHYA 5KE2A 2J6OA 3KXTA 2LMJA 4BACA 3JB9G 2KNBB 4J9EA 2E6ZA 4AT1B 2W0ZA 1PKSA 3OYDA 2E65A 3GP8A 4XTWA 4FCYA 3PVQA 4J6XA 1O75A 1VQ8Q 2YXYA 4BY6C 3M0QA 4Y92A 2BIVA 1TTHB 3JB9J 4ESRA 2B8AA 3UA7A 3FDRA 1IRXA 1WYXA 3I5RA 4OMNA 4AFZC 1ZBJA 2HEQA 2LTOA 3QSUA 2DFUA 2RO0A 2RQRA 1PG5B 3QJ6A 4M77D 4IUQA 2QA4A 2L3QA 3FB9A 3OYHA 3G4ST 3RMQA 1VQPQ 2KYBA 3P8BB 3CEYA 3CCRA 3M54A 1AWWA 1BCMA 2MK5A 1X6GA 1Y96B 1NPRA 2GF7A 1SPKA 1PM3A 5GANf 2D0QB 3PVLA 2E41A 4CC2A 4JPBW 3OY9A 2YUQA 1QW1A 1GXIE 5CO7A 2LCCA 3CXCS 4RTTA 2CT3A 2M02A 1X2KA 4KRTA 1VQNA 4MDWA 5A2QE 1XNIA 4M7AF 4D6WA 2J6KA 4M75E 3JB9D 5GAMe 3L2RA 1SHFA 3D7SB 2M1HA 3M0PA 1ZSZA 1RAIB 2O88A 3MEAA 5IHNA 4M7DA 2DL3A 2AKKA 1RABB 2OTLA 2CP2A 3MEVA 4YTLA 1MMDA 3OYMA 4D8KA 7AT1B 3DKMA 2X3XD 4X9DA 1X01A 3VU3C 3C0CA 2DXTA 1FYNA 1RAHB 1K0XA 1Q81R 3G1JA 1AVZC 4KH0B 3A1PA 3QYHB 4OB3B 2OI3A 2EGAA 2E64A 1YNZA 2CSQA 1ZSZB 1B7TA 3THKA 5IXBA 1YFNA 4J5YA 2ED1A 4ZGDB 3SWNB 2G3RA 2FB7A 1QVFS 2DL4A 4AFQC 1KHCA 4BI8B 2OX7A 3FIFA 3X26B 1MMGA 2E10A 3CMAQ 5GANg 3H8ZA 4OMOA 3DLMA 3M5AA 4XU2A 2CH4A 1KK7A 1UECA 4A54A 2RHXA 4KULA 1VQ6A 2VUBA 2IIMA 5GMKh 1N6AA 1OV3A 3RR6A 4TVRA 1WDXA 3HRTA 4J9IA 1VQLT 2F1LA 2DA9A 2LRQA 2RNAA 3MCAB 3G71A 1JXMA 3CCVT 2QA4T 4HVVA 1VA7A 2DL5A 3PMIA 4ZGJB 3JCMf 3OSVA 1M90C 1K9MU 3VS6A 1A0NB 1WLPB 5GAMg 4OMPA 4FT4A 1QWFA 4F7UF 3C95A 4RUGA 3A8MB 3JRZA 2ROTA 1VQ5A 5FRMA 3CCRQ 4C8QE 2HMAA 1WNLA 2FPFA 3F70A 1HK9A 2R57A 3OYNA 1PNJA 2Y4YA 2LX9A 1YP5A 2IVWA 1K4US 1YJNQ 4AFSC 3OS1A 2GNCA 1E6HA 4KT0E 3TU4K 3GOXA 5DY9A 1D0ZA 1ZX6A 3T9NA 2MI6A 3M53A 3CCQQ 3CCLA 1KD1C 2MWPA 2E6NA 3PGGA 3JCMQ 3LH5A 4M7DC 5CIUA 3LYIA 3RMSA 3TVTA 3HHTB 2KT1A 2COZA 1WHLA 2JN0A 2GTOA 2AT1B 3V8JA 2DBKA 2CP3A 3OYFA 2XDBA 3NHNA 1PC0A 2LQNA 4AFUC 4DBQA 2LZ6B 1YI2A 3QO3A 2CUBA 4R0KA 4Z02A 4QQ6A 4PFZA 1B3QA 4M77B 2EJFA 4A4HA 4E7KA 1UHFA 3REBB 3G6EA 1QQJA 2RD1A 1YIJA 2CKKA 4ELZC 1VQ8A 1V29B 1VQNQ 4RTYA 2O9VA 4Z89A 1YI2T 4Y91A 2KAFA 2HQHA 2G6FX 5HY6A 1K0SA 3J7AF 1JBMA 1ZHIA 4PKCC 1H8KA 3TREA 4JZ4A 5CKFA 1XJWB 4AMCA 4KUDK 4AG2C 2DO3A 3HL8A 1UEBA 4M78F 4CC3A 3TCJA 2DF6A 4M75F 2J7IA 2RI3A 3JCMb 1WIEA 2P84A 2XMFA 4HVWA 3S3MA 1UJYA 5EG2A 4A53A 5KYYB 2LQWA 1QCFA 4JS5A 4DBFA 1UDLA 1XOVA 2QG9B 3M4YA 3QZ9B 1QLYA 3SHWA 1CKBA 5FROA 3ZBDA 1VQLQ 1N8RU 1D0YA 4OP0A 3CCUQ 4KUIA 3HTRA 2DIQA 4C0FA 2FZGB 2KK4A 3E2UA 1U1TA 4FW2A 3CCUA 1HJDA 1YJNA 2XKOC 4BD3A 4JUVA 1M30A 5KYWB 1NE8A 2EJGA 2P0QA 4QVZA 2MMPA 5J3BA 1VQ5T 4CI0C 4F7UG 3WVDB 4M78D 1BI0A 3M59A 1UGSB 3NGPA 2V26A 1D3BB 5GAOn 2JUFA 1S72T 3LWIA 2PQWA 1R0BG 3G71T 2ROLA 1VQKA 2QASA 1H641 2XD0A 1H3ZA 2YLCA 2YT6A 1AWJA 2ZPEB 2DE0X 3CMET 1EIFA 2CP5A 1LJOA 4RG8A 3JCMe 1YJ9T 1IB8A 1OU9A 3OYBA 2ESWA 2XG8D 3VS7A 3CCSA 2COWA 4MZMA 1OX9A 2EBPA 3EG9A 2JMCA 1QP2A 1D3BA 5LJ3e 2GFUA 1YJNT 3QUIA 3EH2A 3MO8A 2M0YA 1UUEA 1K73U 4QW2A 1AWXA 1GRIA 4DA4A 4V2SA 1SRMA 1B07A 1I8FA 2A37A 4JLGA 4IKFA 1ZSGA 3EGUA 3M9QA 1X75C 4C8QC 4C92E 2ATCB 1WHKA 4EMKC 1VYTA 1QVGA 4JRIA 2K2MA 2RQUA 3EG2A 1WPYA 2K79A 3V7SA 4DBHA 1RAFB 3V8KA 2X9HA 2L5QA 1D1BA 3EG9B 2OAWA 4MMLA 4JRPA 1KQ2A 1BIAA 2F69A 2HL5C 4E7ZA 4RTWA 4ZGEB 1JJ2A 1BU1A 2JT4A 1M1FA 3PIPA 3LWHA 3SWNA 4J8OA 2PU9B 1GCPA 1I5LA 1ACMB 2FZKB 2X51A 1NJIR 4J7FA 4PJJA 4X9CA 4LD6A 2K3YA 2A0FB 3M0SA 1VOMA 5GAOr 2DD5A 2M51A 1Z9ZA 4FSXA 2FHDA 2QTXA 3G6ET 1T0HA 1M1KR 2J6FA 1T3LA 1Q82C 5GAOp 1Q86U 4A4KA 3QJYA 2ZAEA 3UT1A 4QT7A 3CC4A 3VKIA 3HFOA 1AZGB 3L2QA 2L3SA 3RKYA 5IH2A 1NLOC 3CCLQ 1M90U 3VS1A 3CMEQ 5D6WA 2OJ2A 3R6OA 5GAMj 2VVKA 3RBBB 1R8OB 5CKDA 1VQMA 4C0DB 2KRMA 4LXCA 3OB9A 4C92C 1BI3A 2EGEA 3G71Q 1VQOQ 2KQWA 2BZXA 1OEBA 3JCMJ 5KYNA 2ZGWA 4C92D 1J3TA 5D7UA 2RHIA 2JVVA 4FYYB 2EYXA 2OTJT 2PUKB 3GIBA 4C0ZA 2DPPB 2RMOA 2E70A 3JAME 1SG5A 3NTIA 3HFNA 2DEQA 1JJ2P 3I9QA 4F7UA 1HYOA 4XTVA 4PK4A 4M4ZA 1MMAA 4XQ3A 3EFSA 4ME7A 1KSWA 2BE7D 4KGVB 1YHQA 2RB6A 4PJNA 4M7AD 3ZFJA 3G4SQ 1YHQT 1VQ6T 1GL5A 1BB9A 2ENMA 1BKBA 4C92A 5CR2A 1AZEA 4NL3A 3GLXA 2KBTA 4E7JA 2C06A 4L5GA 2YUNA 2RJFA 4EMHA 1Z9QA 2LNVA 1I07A 3BW1A 2LVMA 3URGA 5GANh 5J39A 1I4K1 3JCMW 4Z88A 4M7AC 1H3HA 2MCNA 3REAB 3PFSA 5HK0A 1I1JA 2CGHA 1QKXA 1FMKA 1K8AU 4E7HA 2FRYA 2CZ7B 4C5EA 1EX4A 1W2BA 2CSIA 4K11A 1AWOA 2MOXA 4M75G 5GAOm 1M1KC 2H8HA 2EQIA 2LP5A 3EG0A 1KQSS 1YJWA 2YRDA 3SD4A 3BDUA 2A08A 1GFDA 2DRMA 1G83A 4M7DF 4IUUA 4PJOG 2DAQA 2VB6A 3LLRA 5GAMf 4PJOF 2KSSA 5KYWA 2RHUA 4M75D 4JJCA 3H6ZA 5EC7A 1KD1R 2EYYA 1WX6A 2QQ9A 3OS5A 1UJ0A 2O4XB 4C8QB 1RACB 5CCAA 1VQOA 2EVRA 3EG1A 5GAOq 1JB0E 1M3CA 3V8LA 1WXUA 3L1AA 2C0OA 1AHJB 3G4SA 1WJQA 3CCUT 2KY9A 1M1GA 1MV0B 2FL7A 1TH7A 2Y4XA 2KVQG 1V1CA 4C0GA 1ZA2B 5L23A 1QCOA 1W1FA 3S3NA 1OX8A 2O4XA 2DETA 2DYIA 2KDSA 4M77G 2K3BA 2DEUA 4EMKA 5KYUA 2JTEA 3AHUA 1VIFA 1M2VA 9ATCB 2GFAA 3M0UA 2QDYB 1AT1B 1UHCA 2E3IA 3MKDA 2YLBA 4FL6A 2J06A 2QK0A 4M77E 2GBQA 2M9UA 1KC8U 1Q7YR 3J81E 4WF2A 5KH6A 3SB2A 2HD0A 3M57A 2C0IA 3C12A 3VS5A 2PVDB 1WQ7A 4OMLA 1VQMQ 3CMEA 3JCMd 1VQ9Q 3JCMV 1W70A 1ZBXA 4BUGA 4XTYA 2X4JA 1YWOA 2AK5A 4J9DA 4ZN3A 1F1BB 1TS9A 3KBGA 5LJ5h 1W6XA 2JZ2A 5FWBA 1SEMA 2F2VA 1Q86C 1OI1A 2L3RA 3C4SA 4M7DE 2K2VA 3UPUA 4IIOA 5CKHA 2LJ3A 2X4XA 2R58A 5CQYA 4PJOE 5IT9E 4M77F 4X34A 4HCCA 1VIEA 3CCRT 1NG2A 1UE9A 1V76A 1GBQA 3EFOB 2W10A 3FEOA 1YJWQ 2DL8A 3SEMA 3CCJQ 4KGZB 4EPCA 1N8RR 4HT9A 3CC7A 3VS4A 1VQMT 3P8DA 1K9MC 5GANd 2KXDA 4LUDA 2LC4A 1WGSA 2FYKA 3CBPA 3FC3A 2XK0A 3E19A 3HP9A 2LJ0A 2GTJA 2CYZB 5FLXE 2E5QA 3OS2A 3U23A 3X24B 2RM4A 2DRKA 1JO8A 2O31A 4UC4A 1K76A 2M16A 2V1RA 3V7CA 1IGUA 1D1AA 1B34A 2QI2A 4Y28E 3M56A 4J7IA 4C8QF 1K9MR 1BYMA 1VQLA 1WFWA 2NYSA 4IUVA 4PJOB 2EIFA 4JLIA 3MPUB 5GAN8 3VV0A 3I55Q 2HKQB 4JJDA 1NEGA 1Q82R 5FU6C 4E6RA 3NTHA 2OAUA 3OYEA 3L2VA 4XTZA 1PD1A 3UWNA 3CC2Q 2EKOA 5GAN7 4M75A 1YIJQ 1K8AC 1LNXA 2WSFE 1I81A 1VQ7A 1MUZA 4L6V5 1QVFP 4J83A 1W2BS 2PZ1A 1M3AA 5GAN3 2P4RA 3CD6T 2EQKA 3CMAT 1IZ6A 1QVPA 2LX7A 2A3LA 2JOYA 1LCKA 4LDWA 3M0RA 5GAOl 4DEXA 3FLGA 2RI2A 4FIBA 4NS5A 2KRNA 3VUZA 2RN8A 2ZPGB 4M75B 1VYUA 2YRCA 1Q95G 2D8HA 3CCST 3MP8A 1Q7YC 1KG1A 1VQPT 3QBYA 1HD3A 4DBRA 3EGXB 2QQSA 3H0HA 1UB4A 1VQOT 2DERA 1DJ7B 4A4GA 4M78E 2DVJA 3PNWC 5DLOA 2EPDA 4ZTJA 1NBEB 4F7UE 1G3SA 1G2BA 3NMZC 1M27C 1QWEA 2D0NA 1MNDA 5FU7B 4RCBA 2DD4A 1WZOA 4M7AB 2DIGA 3A8LB 2VASA 4BE1A 1PWTA 5FU6B 2ZPHB 1QVGS 2JNGA 3G7ZA 3GBQA 3EGXA 4FYXB 1IHVA 1BK2A 3NTKA 1YJ9A 4KGXB 2HDAA 5LJ5j 3L2UA 2YHTA 5I2SA 2ZZDA 2NUPA 2NUTB 4FU6A 1GCQA 1N27A 2D8JA 3M4GA 5AT1B 1SSHA 5GAN6 3ZEHA 3S3OA 2KI7A 2WSCE 3OYIA 2A7YA 2BZ8A 2K4YA 5CKEA 2HSEB 1NLPC 1KC8C 1UGRB 3ME9A 3O8VA 3OYCA 1G8XA 1MNEA 2EQMA 3X28B 1RAEB 4M77A 4GLKA 4HVUA 1VQ7Q 1ABOA 1JU5C 4N4GA 4QKUA 3TQ7P 2NUPB 2NUTA 1KJWA 1G3TA 1WA7A 4PLIA 4LDYA 1ZUYA 4OMMA 3JCMg 2RQWA 1X43A 3CC2T 5M9OA 1KQSP 1FX7A 2DXUA 2X3WD 3RESA 4NL2A 4PFOA 1QCNA 2K6DA 2XIDA 5KYUB 2BUDA 3I56A 5FWCA 4LN2A 2VWFA 3CXCA 1OZ3A 2RPNA 1X27A 3KFVA 2AIRB 2MPXC 2CZ0B 2EW3A 5FW9A 5HCKA 3JB9F 2XDDA
chains in the Genus database with same CATH topology
4D8DA 2X3XD 2YUNA 3C0CA 5IXFA 1FYNA 1K0XA 2JS0A 1Z9QA 4CC4B 2HCKA 1I07A 2JS2A 1AVZC 1SHGA 1AD5A 4J9CA 1GBRA 4J9HA 2F2WA 2OI3A 4Z88A 2EGAA 1YNZA 1PKTA 1H3HA 3H0FA 2MCNA 3REAB 2CSQA 3R6NA 4ZNXA 5IXBA 3THKA 3UA6A 2YDLA 1I1JA 5I11A 2ED1A 1QKXA 1FMKA 2DL4A 4AFQC 4HXJA 2YSQA 2DYBA 1AEYA 2FRYA 1GFCA 3EHRA 2AKLA 2A28A 2CSIA 4K11A 5ECAA 4OMOA 1AWOA 1WI7A 2MOXA 2JMAA 2CH4A 1K1ZA 2H8HA 1UECA 2EQIA 2LP5A 3EG0A 1CKAA 2IIMA 3TSWA 1M8MA 1VYVA 2A08A 1OV3A 2SEMA 3NPFA 1E6GA 1GFDA 1WDXA 4J9IA 2DRMA 2DA9A 2JM8A 1G83A 2RNAA 1TG0A 1NYGA 1JXMA 1HSQA 4HVVA 1VA7A 2DL5A 3ZL7C 1JQQA 2V1QA 1ABQA 1OPLA 4JJCA 5EC7A 4RTVA 1YWPA 2EYYA 3VS6A 1WLPB 1WX6A 2C0TA 2EYZA 4HCKA 1A0NB 4OMPA 1QWFA 1UJ0A 4RUGA 2ROTA 2L2PA 1T0JA 2FPFA 2FRWA 1PNJA 2EVRA 1YP5A 2RQTA 3EG1A 1JEGA 4F16A 1K4US 4AFSC 2GNCA 1E6HA 1M3CA 2KT8A 1WXUA 2C0OA 1ZX6A 3I5SA 1MV0B 3ULRB 1T3SA 2E5KA 3LH5A 4OMQA 2BTTA 2KEAA 1V1CA 2DL7A 1MV3A 2YUOA 1EFNA 5L23A 1W1FA 3TVTA 2FG0A 1S1NA 2KT1A 2ED0A 1X69A 3CQTA 1NYFA 2AZVA 2GTOA 2DBKA 2K3BA 3NHNA 2JTEA 2LQNA 4Z8AA 1GCQC 4AFUC 1QKWA 2LZ6B 1KFZA 2JXBA 2CUBA 2DM1A 3M0UA 2K7AA 4R0KA 3PE0A 1UHCA 1B3QA 1UTIA 2L3PA 1N5ZA 2J06A 1UHFA 4EIKA 3I35A 1WXTA 3REBB 4JZ3A 2GBQA 2GGRA 4LUEA 2KE9A 1YCSB 2C0IA 2L0AA 4RTYA 3VS5A 2O9VA 4Z89A 3M0TA 1BBZA 2DMOA 4OMLA 3FJ5A 2G6FX 1K0SA 1W70A 1ZLMA 1AOJA 1YWOA 2AK5A 4J9DA 1H8KA 1Y57A 4RTZA 4JZ4A 2PTKA 3VS2A 5IHIA 1W6XA 5FWBA 3TSZA 4AG2C 2CUDA 4CC3A 1SEMA 2F2VA 2DF6A 2J7IA 2D1XA 1WIEA 2XMFA 1PRMC 4IIOA 2CDTA 4HVWA 2LJ3A 1UJYA 1RLQC 2LQWA 1QCFA 1UDLA 2DBMA 1XOVA 1ZUKA 1WXBA 1NM7A 3VRZA 2JW4A 1QLYA 1NG2A 3SHWA 1UE9A 1CKBA 1GBQA 2W10A 2DL8A 3SEMA 2RQVA 1U06A 2DLPA 2AZSA 2PNIA 3VRYA 3VS4A 1E7OA 2KRSA 1HJDA 2KXDA 1X2QA 4LUDA 3QWXX 2LJ0A 1M30A 3H0IA 4J9FA 2YUPA 2GTJA 4RTUA 1YN8A 3U23A 2KGTA 4ORZA 2K9GA 2DRKA 1JO8A 2DILA 3EG3A 3NGPA 2O31A 2FPEA 1K76A 2V1RA 4LE9A 4CC7A 3RNJA 1X6BA 2I0NA 2KR3A 3QWYA 4IIMA 2ROLA 1ARKA 2DNUA 1K9AA 1WFWA 4A63B 2HBWA 3UATA 2O2OA 1PHTA 3A98A 1RUWA 2YT6A 5I22A 1AWJA 2J05A 2DE0X 3VS0A 4J9GA 2HSPA 4JJDA 1NEGA 4WCIA 2ESWA 4E6RA 2ABLA 1SRLA 4DEYA 3VS7A 2EBPA 1KIKA 2JMCA 1Y0MA 1PRLC 2M0YA 1UUEA 1U3OA 5GJWB 1AWXA 1GRIA 3JV3A 1SRMA 2ECZA 1B07A 2A37A 1MUZA 1ZSGA 3EGUA 1ZUUA 3O5ZA 1UFFA 1I0CA 2PZ1A 1UGVA 1M3AA 1OPKA 2P4RA 2F2XA 1VYTA 2RF0A 4AG1C 2KXCA 2DJQA 2JM9A 1U5SA 2K2MA 1M3BA 2RQUA 2KROA 2LX7A 3EG2A 2B86A 1LCKA 2K79A 3M0RA 4DEXA 2EYWA 2A36A 4X1VA 1UG1A 2KRNA 2OAWA 2RN8A 2BZYA 1VYUA 2LJ1A 2MIOA 4RTWA 1TUCA 4RTXA 4F14A 1BU1A 1JXOA 2D8HA 2JT4A 2KYMA 3UF4A 4GLMA 1CSKA 1NEBA 1HD3A 2O9SA 1GCPA 2GQIA 3H0HA 2DVJA 2CH4W 4FSSA 2EPDA 2QDLA 2DX1A 3M0SA 2FEIA 2M51A 1H92A 1Z9ZA 2J6OA 1G2BA 2LMJA 3NMZC 1M27C 1QWEA 2KNBB 4J9EA 2D0NA 2EGCA 1T0HA 2W0ZA 1PKSA 4JJBA 2J6FA 1T3LA 1PWTA 4QT7A 3PVQA 3GBQA 2SRCA 1BK2A 3M0QA 4Y92A 2HDAA 3H41A 1AZGB 2L3SA 5IH2A 4ESRA 1NLOC 5IHKA 3VS1A 3UA7A 3EHQA 1GCQA 2OJ2A 1WYXA 2VVKA 1IO6A 3I5RA 4OMNA 3RBBB 4LNPA 4AFZC 1ZBJA 2D8JA 2HEQA 4GBQA 1SSHA 2KRMA 3IQLA 2RQRA 1RI9A 2LNHB 2L3QA 2EGEA 2BZ8A 2CT4A 2BZXA 1OEBA 3VS3A 1NLPC 2NUZA 2KYBA 1J3TA 1AWWA 1X6GA 2EYXA 4HVUA 1SPKA 1ABOA 2NWMA 2RMOA 1JU5C 3PVLA 1TUDA 4CC2A 4JPBW 1KJWA 1WA7A 1ZUYA 4OMMA 2EKHA 2YUQA 2LCSA 2RQWA 1X43A 4RTTA 2CT3A 2FPDA 1X2KA 2X3WD 4KRTA 3I9QA 1RLPC 2K6DA 2J6KA 4M4ZA 5FWCA 4LN2A 2CREA 4J9BA 1KSWA 1SHFA 2VWFA 2RPNA 1X27A 3KFVA 3M0PA 5GJVB 2O88A 5IHNA 2VKNA 1GL5A 1BB9A 2ENMA 2FO0A 1OOTA 2DL3A 1AZEA 2EW3A 2AKKA 5FW9A 5HCKA 4F17A 2KBTA 4D8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D8D A;  2X3X D;  2YUN A;  3C0C A;  5IXF A;  1FYN A;  1K0X A;  2JS0 A;  1Z9Q A;  4CC4 B;  2HCK A;  1I07 A;  2JS2 A;  1AVZ C;  1SHG A;  1AD5 A;  4J9C A;  1GBR A;  4J9H A;  2F2W A;  2OI3 A;  4Z88 A;  2EGA A;  1YNZ A;  1PKT A;  1H3H A;  3H0F A;  2MCN A;  3REA B;  2CSQ A;  3R6N A;  4ZNX A;  5IXB A;  3THK A;  3UA6 A;  2YDL A;  1I1J A;  5I11 A;  2ED1 A;  1QKX A;  1FMK A;  2DL4 A;  4AFQ C;  4HXJ A;  2YSQ A;  2DYB A;  1AEY A;  2FRY A;  1GFC A;  3EHR A;  2AKL A;  2A28 A;  2CSI A;  4K11 A;  5ECA A;  4OMO A;  1AWO A;  1WI7 A;  2MOX A;  2JMA A;  2CH4 A;  1K1Z A;  2H8H A;  1UEC A;  2EQI A;  2LP5 A;  3EG0 A;  1CKA A;  2IIM A;  3TSW A;  1M8M A;  1VYV A;  2A08 A;  1OV3 A;  2SEM A;  3NPF A;  1E6G A;  1GFD A;  1WDX A;  4J9I A;  2DRM A;  2DA9 A;  2JM8 A;  1G83 A;  2RNA A;  1TG0 A;  1NYG A;  1JXM A;  1HSQ A;  4HVV A;  1VA7 A;  2DL5 A;  3ZL7 C;  1JQQ A;  2V1Q A;  1ABQ A;  1OPL A;  4JJC A;  5EC7 A;  4RTV A;  1YWP A;  2EYY A;  3VS6 A;  1WLP B;  1WX6 A;  2C0T A;  2EYZ A;  4HCK A;  1A0N B;  4OMP A;  1QWF A;  1UJ0 A;  4RUG A;  2ROT A;  2L2P A;  1T0J A;  2FPF A;  2FRW A;  1PNJ A;  2EVR A;  1YP5 A;  2RQT A;  3EG1 A;  1JEG A;  4F16 A;  1K4U S;  4AFS C;  2GNC A;  1E6H A;  1M3C A;  2KT8 A;  1WXU A;  2C0O A;  1ZX6 A;  3I5S A;  1MV0 B;  3ULR B;  1T3S A;  2E5K A;  3LH5 A;  4OMQ A;  2BTT A;  2KEA A;  1V1C A;  2DL7 A;  1MV3 A;  2YUO A;  1EFN A;  5L23 A;  1W1F A;  3TVT A;  2FG0 A;  1S1N A;  2KT1 A;  2ED0 A;  1X69 A;  3CQT A;  1NYF A;  2AZV A;  2GTO A;  2DBK A;  2K3B A;  3NHN A;  2JTE A;  2LQN A;  4Z8A A;  1GCQ C;  4AFU C;  1QKW A;  2LZ6 B;  1KFZ A;  2JXB A;  2CUB A;  2DM1 A;  3M0U A;  2K7A A;  4R0K A;  3PE0 A;  1UHC A;  1B3Q A;  1UTI A;  2L3P A;  1N5Z A;  2J06 A;  1UHF A;  4EIK A;  3I35 A;  1WXT A;  3REB B;  4JZ3 A;  2GBQ A;  2GGR A;  4LUE A;  2KE9 A;  1YCS B;  2C0I A;  2L0A A;  4RTY A;  3VS5 A;  2O9V A;  4Z89 A;  3M0T A;  1BBZ A;  2DMO A;  4OML A;  3FJ5 A;  2G6F X;  1K0S A;  1W70 A;  1ZLM A;  1AOJ A;  1YWO A;  2AK5 A;  4J9D A;  1H8K A;  1Y57 A;  4RTZ A;  4JZ4 A;  2PTK A;  3VS2 A;  5IHI A;  1W6X A;  5FWB A;  3TSZ A;  4AG2 C;  2CUD A;  4CC3 A;  1SEM A;  2F2V A;  2DF6 A;  2J7I A;  2D1X A;  1WIE A;  2XMF A;  1PRM C;  4IIO A;  2CDT A;  4HVW A;  2LJ3 A;  1UJY A;  1RLQ C;  2LQW A;  1QCF A;  1UDL A;  2DBM A;  1XOV A;  1ZUK A;  1WXB A;  1NM7 A;  3VRZ A;  2JW4 A;  1QLY A;  1NG2 A;  3SHW A;  1UE9 A;  1CKB A;  1GBQ A;  2W10 A;  2DL8 A;  3SEM A;  2RQV A;  1U06 A;  2DLP A;  2AZS A;  2PNI A;  3VRY A;  3VS4 A;  1E7O A;  2KRS A;  1HJD A;  2KXD A;  1X2Q A;  4LUD A;  3QWX X;  2LJ0 A;  1M30 A;  3H0I A;  4J9F A;  2YUP A;  2GTJ A;  4RTU A;  1YN8 A;  3U23 A;  2KGT A;  4ORZ A;  2K9G A;  2DRK A;  1JO8 A;  2DIL A;  3EG3 A;  3NGP A;  2O31 A;  2FPE A;  1K76 A;  2V1R A;  4LE9 A;  4CC7 A;  3RNJ A;  1X6B A;  2I0N A;  2KR3 A;  3QWY A;  4IIM A;  2ROL A;  1ARK A;  2DNU A;  1K9A A;  1WFW A;  4A63 B;  2HBW A;  3UAT A;  2O2O A;  1PHT A;  3A98 A;  1RUW A;  2YT6 A;  5I22 A;  1AWJ A;  2J05 A;  2DE0 X;  3VS0 A;  4J9G A;  2HSP A;  4JJD A;  1NEG A;  4WCI A;  2ESW A;  4E6R A;  2ABL A;  1SRL A;  4DEY A;  3VS7 A;  2EBP A;  1KIK A;  2JMC A;  1Y0M A;  1PRL C;  2M0Y A;  1UUE A;  1U3O A;  5GJW B;  1AWX A;  1GRI A;  3JV3 A;  1SRM A;  2ECZ A;  1B07 A;  2A37 A;  1MUZ A;  1ZSG A;  3EGU A;  1ZUU A;  3O5Z A;  1UFF A;  1I0C A;  2PZ1 A;  1UGV A;  1M3A A;  1OPK A;  2P4R A;  2F2X A;  1VYT A;  2RF0 A;  4AG1 C;  2KXC A;  2DJQ A;  2JM9 A;  1U5S A;  2K2M A;  1M3B A;  2RQU A;  2KRO A;  2LX7 A;  3EG2 A;  2B86 A;  1LCK A;  2K79 A;  3M0R A;  4DEX A;  2EYW A;  2A36 A;  4X1V A;  1UG1 A;  2KRN A;  2OAW A;  2RN8 A;  2BZY A;  1VYU A;  2LJ1 A;  2MIO A;  4RTW A;  1TUC A;  4RTX A;  4F14 A;  1BU1 A;  1JXO A;  2D8H A;  2JT4 A;  2KYM A;  3UF4 A;  4GLM A;  1CSK A;  1NEB A;  1HD3 A;  2O9S A;  1GCP A;  2GQI A;  3H0H A;  2DVJ A;  2CH4 W;  4FSS A;  2EPD A;  2QDL A;  2DX1 A;  3M0S A;  2FEI A;  2M51 A;  1H92 A;  1Z9Z A;  2J6O A;  1G2B A;  2LMJ A;  3NMZ C;  1M27 C;  1QWE A;  2KNB B;  4J9E A;  2D0N A;  2EGC A;  1T0H A;  2W0Z A;  1PKS A;  4JJB A;  2J6F A;  1T3L A;  1PWT A;  4QT7 A;  3PVQ A;  3GBQ A;  2SRC A;  1BK2 A;  3M0Q A;  4Y92 A;  2HDA A;  3H41 A;  1AZG B;  2L3S A;  5IH2 A;  4ESR A;  1NLO C;  5IHK A;  3VS1 A;  3UA7 A;  3EHQ A;  1GCQ A;  2OJ2 A;  1WYX A;  2VVK A;  1IO6 A;  3I5R A;  4OMN A;  3RBB B;  4LNP A;  4AFZ C;  1ZBJ A;  2D8J A;  2HEQ A;  4GBQ A;  1SSH A;  2KRM A;  3IQL A;  2RQR A;  1RI9 A;  2LNH B;  2L3Q A;  2EGE A;  2BZ8 A;  2CT4 A;  2BZX A;  1OEB A;  3VS3 A;  1NLP C;  2NUZ A;  2KYB A;  1J3T A;  1AWW A;  1X6G A;  2EYX A;  4HVU A;  1SPK A;  1ABO A;  2NWM A;  2RMO A;  1JU5 C;  3PVL A;  1TUD A;  4CC2 A;  4JPB W;  1KJW A;  1WA7 A;  1ZUY A;  4OMM A;  2EKH A;  2YUQ A;  2LCS A;  2RQW A;  1X43 A;  4RTT A;  2CT3 A;  2FPD A;  1X2K A;  2X3W D;  4KRT A;  3I9Q A;  1RLP C;  2K6D A;  2J6K A;  4M4Z A;  5FWC A;  4LN2 A;  2CRE A;  4J9B A;  1KSW A;  1SHF A;  2VWF A;  2RPN A;  1X27 A;  3KFV A;  3M0P A;  5GJV B;  2O88 A;  5IHN A;  2VKN A;  1GL5 A;  1BB9 A;  2ENM A;  2FO0 A;  1OOT A;  2DL3 A;  1AZE A;  2EW3 A;  2AKK A;  5FW9 A;  5HCK A;  4F17 A;  2KBT A;  4D8K A; 
#chains in the Genus database with same CATH topology
 4D8D A;  1WJR A;  5IXF A;  2JS0 A;  3QII A;  2HCK A;  4M78 A;  1K73 C;  2VGM A;  1SHG A;  1AD5 A;  5AYF A;  4ELY C;  4J9H A;  1PKT A;  4E7L A;  2PVO B;  4QVC A;  2P4T A;  3UA6 A;  2YDL A;  4OMF B;  4HKE A;  4OB0 B;  4HXJ A;  2DYB A;  3OBW A;  1GFC A;  3EHR A;  4E7I A;  1UGQ B;  1IXD A;  1VQ9 T;  5IN1 A;  2MYS A;  5KE3 A;  1NPP A;  1RL2 A;  1KQ1 A;  4JDS A;  4M78 C;  1WI7 A;  2QEX Q;  1PSF A;  4IUP A;  1TU0 B;  3CCJ A;  2JMA A;  4EMK B;  1K1Z A;  2VXE A;  3CBM A;  1CKA A;  2E3H A;  3VYH B;  3EFO A;  4A4E A;  2HZY A;  1M8M A;  3NPF A;  2PUO B;  1U8R A;  2HBP A;  1ZSZ C;  3OS0 A;  2JM8 A;  5GMK i;  2V8J A;  1TG0 A;  1NYG A;  2P0K A;  4BI4 A;  3ZL7 C;  3QYG B;  1ABQ A;  3PMT A;  1OPL A;  5LJ5 g;  1NJI C;  4HA8 A;  4GY5 A;  4RTV A;  1YWP A;  4HCK A;  2EAY A;  2XI9 A;  2CS7 A;  4LDX A;  2HAX A;  2R5A A;  4WTO B;  1I5O B;  4FYW B;  3EFR A;  5GMK m;  1M90 R;  1WJS A;  2FRW A;  5GAM h;  4MZT A;  2RQT A;  1YJ9 Q;  3MEW A;  1BI1 A;  4F16 A;  2K5F A;  3CCE Q;  1D09 B;  2KT8 A;  3JCM X;  5LJ3 h;  1ZA1 B;  2BKD N;  3I5S A;  4L59 A;  1T3S A;  2E5K A;  3CCV A;  2BTT A;  1MV3 A;  2RH2 A;  2AHJ B;  4PJO C;  1S1N A;  2ED0 A;  1X69 A;  5KCH A;  2AZV A;  3S6W A;  4N0A A;  3CCM A;  4LD9 K;  4Z8A A;  5A0G A;  1YJW T;  1QKW A;  1KFZ A;  2JXB A;  8AT1 B;  3MJX A;  3PE0 A;  2L8D A;  1M5Q 1;  1UTI A;  5DLQ E;  3HRS A;  5HKC A;  2L3P A;  1Y96 A;  3E9G A;  4EIK A;  1RAA B;  3I35 A;  3OMC A;  1WXT A;  4JZ3 A;  5HK3 A;  3CC2 A;  1KC8 R;  3RIR A;  4P5N A;  5GAN j;  1YIT Q;  2L0A A;  2DZC A;  4A4F A;  3M0T A;  3OYG A;  3BDL A;  5KCO A;  2DMO A;  4XU0 A;  3RKX A;  1Q81 C;  3CD6 A;  1VQ4 T;  2DZ9 A;  1B34 B;  4XU3 A;  3MHX A;  2QTV A;  5IHI A;  1OQK A;  4M7A G;  2QXF A;  3TSZ A;  4JRQ A;  4BE2 A;  1LOJ A;  4M7D B;  5I21 A;  3I55 T;  2IG0 A;  5GAN 4;  1C6V X;  2D1X A;  4BDZ A;  1Y7X A;  2CDT A;  2OTL T;  2HQE A;  1WHM A;  4FT2 A;  5GAM d;  3X20 B;  2VGN A;  1WXB A;  2EYQ A;  3VRZ A;  2JW4 A;  2VYT A;  1K8A R;  4OB2 B;  1N9R A;  3VYG A;  1YBY A;  2DLP A;  4M7A A;  3SDZ A;  1W4S A;  5LJ3 d;  2PNI A;  3EGD B;  1S72 A;  3VRY A;  3J80 E;  1E7O A;  4PLL A;  4HT8 A;  1X2Q A;  3QWX X;  4RMO A;  1YI2 Q;  4FW1 A;  2QEX T;  1PD0 A;  3PTA A;  2MF2 A;  5LJ3 f;  3H0I A;  4RTU A;  5GMK e;  4C5H A;  3QDR B;  2M0O A;  1VQP A;  3OA6 A;  2KGT A;  4M77 C;  3EG3 A;  1QMC A;  4CC7 A;  5FRN A;  3FRN A;  2KR3 A;  4C0D C;  3NFC A;  4OGC A;  3OSS C;  2DTH A;  1ARK A;  3QZ5 B;  2P0P A;  3QXE B;  4R56 A;  4C5I A;  2DNU A;  1K9A A;  2VC8 A;  3RUX A;  2V8K A;  2HBW A;  3UAT A;  4R55 A;  2O2O A;  1PHT A;  3A98 A;  1RUW A;  5I22 A;  4OVA A;  3FJP A;  2J05 A;  2EJ9 A;  3CCV Q;  1VUB A;  4J9G A;  1IGQ A;  1WHG A;  4PJO D;  4DEY A;  5C0M A;  1VQ8 T;  2E12 A;  1BCO A;  1N8R C;  3QHS A;  3OMG A;  1QVG P;  1Y0M A;  4DOV A;  1PRL C;  5GJW B;  5L8R E;  3JV3 A;  1ZUU A;  1M2O A;  1I0C A;  2QQR A;  1OPK A;  2F2X A;  2RF0 A;  3OBY A;  3DLL A;  4AG1 C;  4EDU A;  2ZPI B;  4LDU A;  2DJQ A;  1U5S A;  1M3B A;  2KRO A;  2QQB A;  4Q5W A;  5CVI A;  1OZ2 A;  2EYW A;  4IUT A;  4OB1 B;  4O5V A;  1OYX A;  2A36 A;  2RHZ A;  4OF1 A;  4ZTF A;  2DTO A;  1UG1 A;  1TOV A;  2X4Y A;  3I55 A;  4M75 C;  4C92 F;  1BI2 A;  1TSF A;  2COY A;  4C5G A;  2MIO A;  2MWO A;  4XTX A;  1TUC A;  4F14 A;  4J6Y A;  2KYM A;  4GLM A;  1CSK A;  1NEB A;  3HPW A;  1YIT A;  1M8V A;  2GQI A;  2MAM A;  2EQU A;  2QDL A;  3E9F A;  5GAN 5;  2DX1 A;  2FEI A;  1VQK Q;  4BE0 A;  3A5Z B;  2Z0W A;  4C8Q A;  5GMK l;  3OYY A;  1QVF A;  1RAG B;  3CCL T;  2EGC A;  3VJP A;  4VUB A;  4JJB A;  5LL6 S;  3C94 A;  1Q86 R;  2E4H A;  4QQD A;  2IPO B;  4M7A E;  3LH0 A;  4DOW A;  3CCE A;  2SRC A;  4EMG A;  1WHH A;  3MET A;  2X35 A;  2EFI A;  3H41 A;  4MMK A;  3CCM T;  2CZ6 B;  3PIO A;  5IHK A;  1RAD B;  1VQ6 Q;  3EAE A;  2XIC A;  3EHQ A;  1IO6 A;  2O01 E;  4LNP A;  1TXQ A;  4GBQ A;  3IQL A;  4M78 B;  4IUR A;  2LCL A;  1RI9 A;  2LNH B;  3GPL A;  2CT4 A;  4FM4 B;  1Y71 A;  3VS3 A;  2D9T A;  2NUZ A;  5CKB A;  1VQ4 A;  5D6Y A;  4KH1 B;  4PNO A;  1R77 A;  1NZ9 A;  5DM7 R;  3A8O B;  3A8G B;  2K3X A;  2NWM A;  5A0L A;  1G3Y A;  4ATO A;  5KYX A;  3RDV A;  1TUD A;  5LJ5 f;  2RK2 A;  2EKH A;  2LCS A;  1MGQ A;  3CCS Q;  2XU8 A;  2FPD A;  4JRK A;  2CZ1 B;  3ER0 A;  5LJ5 d;  1R0C B;  5IAY A;  1RLP C;  3CD6 Q;  3LW5 E;  4MZP A;  2CRE A;  4J9B A;  3CXC P;  4C8Q D;  5GJV B;  3GNG A;  2VKN A;  4B9X A;  1JRI A;  2FO0 A;  1OOT A;  8ATC B;  5J26 A;  4JS4 A;  4F17 A;  1W2B P;  5LJ3 j;  2WAC A;  3X25 B;  2K5L A;  4FYV B;  3OW2 S;  1VQ7 T;  2JTM A;  1Q81 U;  1KHI A;  3VUB A;  2XHC A;  4CC4 B;  3L2W A;  2JS2 A;  1G3W A;  1FMV A;  3QG1 A;  3CPF A;  4J9C A;  1XTD A;  1GBR A;  2F2W A;  2OTJ Q;  2R5M A;  2DXB A;  1G5V A;  2RJD A;  3H0F A;  1YCY A;  3R6N A;  4ZNX A;  5I11 A;  5A0D A;  1LPL A;  3BFM A;  1VQK T;  2YSQ A;  2RJE A;  1AEY A;  3HRU A;  2BE9 B;  3JB9 I;  3DB4 A;  2AKL A;  2LT4 A;  4KBM B;  4LDV A;  4B9W A;  2A28 A;  5ECA A;  2JTF A;  3WVE B;  2VXF A;  1LVK A;  2YWW A;  2Y90 A;  1NJI U;  2EQJ A;  3TSW A;  1VYV A;  2SEM A;  1E6G A;  1VQ4 Q;  3CCJ T;  4PJO A;  3V7R A;  2HNI A;  4JJN K;  1D1C A;  1VQ9 A;  4C8Q G;  1HSQ A;  1M1K U;  2QGG A;  1MMN A;  5CK9 A;  1JQQ A;  5FU7 C;  4N4I A;  2V1Q A;  3CCM Q;  2DVE A;  4QVD A;  3INZ A;  4M7D G;  4N4H A;  3SFM A;  3MP6 A;  4C92 G;  2C0T A;  2EYZ A;  1KD1 U;  1FXX A;  1EZZ B;  4MDX A;  4OGE A;  2RA2 A;  2L2P A;  1T0J A;  4PFP A;  1YIT T;  3MP1 A;  3G6E Q;  2YRV A;  3BY7 A;  4RG2 A;  2QEX A;  3CC7 Q;  1JEG A;  3MEU A;  1KQS A;  4QQG A;  2RK1 A;  1OU8 A;  3M58 A;  4XAX B;  5GMK j;  3CC7 T;  2LQK A;  4PJM A;  1WQW A;  4PJL A;  5CAI A;  3ULR B;  2GCX A;  1K73 R;  4OMQ A;  2KEA A;  2DL7 A;  1C0M A;  3HKS A;  3BE3 A;  3CPW P;  4HCB A;  2YUO A;  1EFN A;  6AT1 B;  2ZPF B;  1PCX A;  2FG0 A;  3CQT A;  1NYF A;  2CP0 A;  3HSB A;  1GCQ C;  3CC4 T;  1D0X A;  2DM1 A;  3E1S A;  2K7A A;  3EGD A;  3L2Z A;  1X6O A;  2CP6 A;  1YIJ T;  1PSE A;  2FZC B;  1N5Z A;  3GF5 A;  2K5I A;  3JCM c;  4ANJ A;  3CPW A;  2QAZ A;  4O6J A;  4E2F B;  2H3E B;  1Q7Y U;  2GGR A;  4LUE A;  2K57 A;  2KE9 A;  2QQA A;  1YCS B;  3GNF B;  1ZQ1 A;  1BIB A;  4F04 B;  4DQ2 A;  3QDF A;  4RCC A;  3JCM h;  1BBZ A;  3OYK A;  5LJ3 g;  3FJ5 A;  4HCZ A;  2I2L A;  1ZLM A;  4F7U B;  3CCQ T;  1C1A A;  1TUG B;  3I56 T;  2ZCF B;  1AOJ A;  3QKJ A;  1Y57 A;  4RTZ A;  2PTK A;  3VS2 A;  2L89 A;  3SWN C;  1FWZ A;  3L42 A;  3TEE A;  2DXC A;  3Q1J A;  2RJC A;  4XTU A;  2CUD A;  5LJ5 e;  3CBO A;  2LDM A;  2CP7 A;  4C92 B;  1WHJ A;  1FMW A;  1PRM C;  5GAN e;  1IRE B;  1Y07 A;  3RKW A;  1O9S A;  3P8H A;  3PT9 A;  1RLQ C;  1QP3 A;  2DBM A;  1ZUK A;  4M78 G;  3CMA A;  1NM7 A;  2DK3 A;  1HXD A;  2HKN A;  2FVU A;  3CPW S;  2HQX A;  3ASK A;  3N5B B;  1MHN A;  2DJZ A;  1U06 A;  2RQV A;  4BB7 A;  1VQN T;  2AZS A;  3RER A;  2E1H A;  5CQX A;  3OQ5 A;  2F5K A;  3DB3 A;  2KRS A;  2PVG B;  3AT1 B;  3QPH A;  3OW2 A;  3A8H B;  4J9F A;  2WSE E;  2YUP A;  2NLU A;  1YN8 A;  1JJ2 S;  2QYZ A;  3LGF A;  3CCE T;  1M4Z A;  2LT1 A;  2F5T X;  2EWN A;  3LX7 A;  4ZN1 A;  4ORZ A;  2V8I A;  2K9G A;  2DIL A;  3LGL A;  1SF9 A;  2FPE A;  2QA4 Q;  3OYA A;  4LE9 A;  3RNJ A;  1X6B A;  3KUF A;  2X4W A;  2H3J A;  2I0N A;  1U1S A;  3QWY A;  4XU1 A;  4IIM A;  5D6X A;  2QGF B;  2DTI A;  2XDP A;  4A63 B;  5KYX B;  4M7D D;  3EH1 A;  4PL6 A;  3VS0 A;  4BY6 B;  4E7S A;  5I2M A;  2JJ9 A;  2HSP A;  2DKG A;  4WCI A;  2ABL A;  1Q82 U;  1SRL A;  4BDY A;  2VV5 A;  4B6M A;  1KIK A;  1SSF A;  1UGP B;  4RKU E;  3I56 Q;  1U3O A;  1RI0 A;  2ECZ A;  1N9S A;  1XQH A;  3CC4 Q;  3JSC A;  1P92 A;  3O5Z A;  1UFF A;  3UDC A;  2LQ8 A;  1UGV A;  4J6W A;  3CCQ A;  2KXC A;  1IHW A;  4NOY A;  2GQV A;  2JM9 A;  4II1 A;  2KMT A;  2D6F A;  2OTL Q;  2B86 A;  3H9N A;  4BI3 A;  3OYL A;  4E47 A;  4X1V A;  1SKU B;  2BZY A;  2ZPB B;  1M9S A;  2RI5 A;  2HL3 A;  2LJ1 A;  5C6S A;  1M2V B;  4RTX A;  1S72 Q;  1JXO A;  3UF4 A;  1TWB A;  1YHQ Q;  3JB9 H;  3OYJ A;  3OW2 P;  2O9S A;  1OUL A;  3WXM B;  5GAN 2;  2OTJ A;  1VQ5 Q;  4CRI A;  4XK8 E;  4N0A C;  2CH4 W;  4FSS A;  3JCM P;  3M55 A;  5KYY A;  1H92 A;  2RHY A;  5KE2 A;  2J6O A;  3KXT A;  2LMJ A;  4BAC A;  3JB9 G;  2KNB B;  4J9E A;  2E6Z A;  4AT1 B;  2W0Z A;  1PKS A;  3OYD A;  2E65 A;  3GP8 A;  4XTW A;  4FCY A;  3PVQ A;  4J6X A;  1O75 A;  1VQ8 Q;  2YXY A;  4BY6 C;  3M0Q A;  4Y92 A;  2BIV A;  1TTH B;  3JB9 J;  4ESR A;  2B8A A;  3UA7 A;  3FDR A;  1IRX A;  1WYX A;  3I5R A;  4OMN A;  4AFZ C;  1ZBJ A;  2HEQ A;  2LTO A;  3QSU A;  2DFU A;  2RO0 A;  2RQR A;  1PG5 B;  3QJ6 A;  4M77 D;  4IUQ A;  2QA4 A;  2L3Q A;  3FB9 A;  3OYH A;  3G4S T;  3RMQ A;  1VQP Q;  2KYB A;  3P8B B;  3CEY A;  3CCR A;  3M54 A;  1AWW A;  1BCM A;  2MK5 A;  1X6G A;  1Y96 B;  1NPR A;  2GF7 A;  1SPK A;  1PM3 A;  5GAN f;  2D0Q B;  3PVL A;  2E41 A;  4CC2 A;  4JPB W;  3OY9 A;  2YUQ A;  1QW1 A;  1GXI E;  5CO7 A;  2LCC A;  3CXC S;  4RTT A;  2CT3 A;  2M02 A;  1X2K A;  4KRT A;  1VQN A;  4MDW A;  5A2Q E;  1XNI A;  4M7A F;  4D6W A;  2J6K A;  4M75 E;  3JB9 D;  5GAM e;  3L2R A;  1SHF A;  3D7S B;  2M1H A;  3M0P A;  1ZSZ A;  1RAI B;  2O88 A;  3MEA A;  5IHN A;  4M7D A;  2DL3 A;  2AKK A;  1RAB B;  2OTL A;  2CP2 A;  3MEV A;  4YTL A;  1MMD A;  3OYM A;  4D8K A;  7AT1 B;  3DKM A;  2X3X D;  4X9D A;  1X01 A;  3VU3 C;  3C0C A;  2DXT A;  1FYN A;  1RAH B;  1K0X A;  1Q81 R;  3G1J A;  1AVZ C;  4KH0 B;  3A1P A;  3QYH B;  4OB3 B;  2OI3 A;  2EGA A;  2E64 A;  1YNZ A;  2CSQ A;  1ZSZ B;  1B7T A;  3THK A;  5IXB A;  1YFN A;  4J5Y A;  2ED1 A;  4ZGD B;  3SWN B;  2G3R A;  2FB7 A;  1QVF S;  2DL4 A;  4AFQ C;  1KHC A;  4BI8 B;  2OX7 A;  3FIF A;  3X26 B;  1MMG A;  2E10 A;  3CMA Q;  5GAN g;  3H8Z A;  4OMO A;  3DLM A;  3M5A A;  4XU2 A;  2CH4 A;  1KK7 A;  1UEC A;  4A54 A;  2RHX A;  4KUL A;  1VQ6 A;  2VUB A;  2IIM A;  5GMK h;  1N6A A;  1OV3 A;  3RR6 A;  4TVR A;  1WDX A;  3HRT A;  4J9I A;  1VQL T;  2F1L A;  2DA9 A;  2LRQ A;  2RNA A;  3MCA B;  3G71 A;  1JXM A;  3CCV T;  2QA4 T;  4HVV A;  1VA7 A;  2DL5 A;  3PMI A;  4ZGJ B;  3JCM f;  3OSV A;  1M90 C;  1K9M U;  3VS6 A;  1A0N B;  1WLP B;  5GAM g;  4OMP A;  4FT4 A;  1QWF A;  4F7U F;  3C95 A;  4RUG A;  3A8M B;  3JRZ A;  2ROT A;  1VQ5 A;  5FRM A;  3CCR Q;  4C8Q E;  2HMA A;  1WNL A;  2FPF A;  3F70 A;  1HK9 A;  2R57 A;  3OYN A;  1PNJ A;  2Y4Y A;  2LX9 A;  1YP5 A;  2IVW A;  1K4U S;  1YJN Q;  4AFS C;  3OS1 A;  2GNC A;  1E6H A;  4KT0 E;  3TU4 K;  3GOX A;  5DY9 A;  1D0Z A;  1ZX6 A;  3T9N A;  2MI6 A;  3M53 A;  3CCQ Q;  3CCL A;  1KD1 C;  2MWP A;  2E6N A;  3PGG A;  3JCM Q;  3LH5 A;  4M7D C;  5CIU A;  3LYI A;  3RMS A;  3TVT A;  3HHT B;  2KT1 A;  2COZ A;  1WHL A;  2JN0 A;  2GTO A;  2AT1 B;  3V8J A;  2DBK A;  2CP3 A;  3OYF A;  2XDB A;  3NHN A;  1PC0 A;  2LQN A;  4AFU C;  4DBQ A;  2LZ6 B;  1YI2 A;  3QO3 A;  2CUB A;  4R0K A;  4Z02 A;  4QQ6 A;  4PFZ A;  1B3Q A;  4M77 B;  2EJF A;  4A4H A;  4E7K A;  1UHF A;  3REB B;  3G6E A;  1QQJ A;  2RD1 A;  1YIJ A;  2CKK A;  4ELZ C;  1VQ8 A;  1V29 B;  1VQN Q;  4RTY A;  2O9V A;  4Z89 A;  1YI2 T;  4Y91 A;  2KAF A;  2HQH A;  2G6F X;  5HY6 A;  1K0S A;  3J7A F;  1JBM A;  1ZHI A;  4PKC C;  1H8K A;  3TRE A;  4JZ4 A;  5CKF A;  1XJW B;  4AMC A;  4KUD K;  4AG2 C;  2DO3 A;  3HL8 A;  1UEB A;  4M78 F;  4CC3 A;  3TCJ A;  2DF6 A;  4M75 F;  2J7I A;  2RI3 A;  3JCM b;  1WIE A;  2P84 A;  2XMF A;  4HVW A;  3S3M A;  1UJY A;  5EG2 A;  4A53 A;  5KYY B;  2LQW A;  1QCF A;  4JS5 A;  4DBF A;  1UDL A;  1XOV A;  2QG9 B;  3M4Y A;  3QZ9 B;  1QLY A;  3SHW A;  1CKB A;  5FRO A;  3ZBD A;  1VQL Q;  1N8R U;  1D0Y A;  4OP0 A;  3CCU Q;  4KUI A;  3HTR A;  2DIQ A;  4C0F A;  2FZG B;  2KK4 A;  3E2U A;  1U1T A;  4FW2 A;  3CCU A;  1HJD A;  1YJN A;  2XKO C;  4BD3 A;  4JUV A;  1M30 A;  5KYW B;  1NE8 A;  2EJG A;  2P0Q A;  4QVZ A;  2MMP A;  5J3B A;  1VQ5 T;  4CI0 C;  4F7U G;  3WVD B;  4M78 D;  1BI0 A;  3M59 A;  1UGS B;  3NGP A;  2V26 A;  1D3B B;  5GAO n;  2JUF A;  1S72 T;  3LWI A;  2PQW A;  1R0B G;  3G71 T;  2ROL A;  1VQK A;  2QAS A;  1H64 1;  2XD0 A;  1H3Z A;  2YLC A;  2YT6 A;  1AWJ A;  2ZPE B;  2DE0 X;  3CME T;  1EIF A;  2CP5 A;  1LJO A;  4RG8 A;  3JCM e;  1YJ9 T;  1IB8 A;  1OU9 A;  3OYB A;  2ESW A;  2XG8 D;  3VS7 A;  3CCS A;  2COW A;  4MZM A;  1OX9 A;  2EBP A;  3EG9 A;  2JMC A;  1QP2 A;  1D3B A;  5LJ3 e;  2GFU A;  1YJN T;  3QUI A;  3EH2 A;  3MO8 A;  2M0Y A;  1UUE A;  1K73 U;  4QW2 A;  1AWX A;  1GRI A;  4DA4 A;  4V2S A;  1SRM A;  1B07 A;  1I8F A;  2A37 A;  4JLG A;  4IKF A;  1ZSG A;  3EGU A;  3M9Q A;  1X75 C;  4C8Q C;  4C92 E;  2ATC B;  1WHK A;  4EMK C;  1VYT A;  1QVG A;  4JRI A;  2K2M A;  2RQU A;  3EG2 A;  1WPY A;  2K79 A;  3V7S A;  4DBH A;  1RAF B;  3V8K A;  2X9H A;  2L5Q A;  1D1B A;  3EG9 B;  2OAW A;  4MML A;  4JRP A;  1KQ2 A;  1BIA A;  2F69 A;  2HL5 C;  4E7Z A;  4RTW A;  4ZGE B;  1JJ2 A;  1BU1 A;  2JT4 A;  1M1F A;  3PIP A;  3LWH A;  3SWN A;  4J8O A;  2PU9 B;  1GCP A;  1I5L A;  1ACM B;  2FZK B;  2X51 A;  1NJI R;  4J7F A;  4PJJ A;  4X9C A;  4LD6 A;  2K3Y A;  2A0F B;  3M0S A;  1VOM A;  5GAO r;  2DD5 A;  2M51 A;  1Z9Z A;  4FSX A;  2FHD A;  2QTX A;  3G6E T;  1T0H A;  1M1K R;  2J6F A;  1T3L A;  1Q82 C;  5GAO p;  1Q86 U;  4A4K A;  3QJY A;  2ZAE A;  3UT1 A;  4QT7 A;  3CC4 A;  3VKI A;  3HFO A;  1AZG B;  3L2Q A;  2L3S A;  3RKY A;  5IH2 A;  1NLO C;  3CCL Q;  1M90 U;  3VS1 A;  3CME Q;  5D6W A;  2OJ2 A;  3R6O A;  5GAM j;  2VVK A;  3RBB B;  1R8O B;  5CKD A;  1VQM A;  4C0D B;  2KRM A;  4LXC A;  3OB9 A;  4C92 C;  1BI3 A;  2EGE A;  3G71 Q;  1VQO Q;  2KQW A;  2BZX A;  1OEB A;  3JCM J;  5KYN A;  2ZGW A;  4C92 D;  1J3T A;  5D7U A;  2RHI A;  2JVV A;  4FYY B;  2EYX A;  2OTJ T;  2PUK B;  3GIB A;  4C0Z A;  2DPP B;  2RMO A;  2E70 A;  3JAM E;  1SG5 A;  3NTI A;  3HFN A;  2DEQ A;  1JJ2 P;  3I9Q A;  4F7U A;  1HYO A;  4XTV A;  4PK4 A;  4M4Z A;  1MMA A;  4XQ3 A;  3EFS A;  4ME7 A;  1KSW A;  2BE7 D;  4KGV B;  1YHQ A;  2RB6 A;  4PJN A;  4M7A D;  3ZFJ A;  3G4S Q;  1YHQ T;  1VQ6 T;  1GL5 A;  1BB9 A;  2ENM A;  1BKB A;  4C92 A;  5CR2 A;  1AZE A;  4NL3 A;  3GLX A;  2KBT A;  4E7J A;  2C06 A;  4L5G A;  2YUN A;  2RJF A;  4EMH A;  1Z9Q A;  2LNV A;  1I07 A;  3BW1 A;  2LVM A;  3URG A;  5GAN h;  5J39 A;  1I4K 1;  3JCM W;  4Z88 A;  4M7A C;  1H3H A;  2MCN A;  3REA B;  3PFS A;  5HK0 A;  1I1J A;  2CGH A;  1QKX A;  1FMK A;  1K8A U;  4E7H A;  2FRY A;  2CZ7 B;  4C5E A;  1EX4 A;  1W2B A;  2CSI A;  4K11 A;  1AWO A;  2MOX A;  4M75 G;  5GAO m;  1M1K C;  2H8H A;  2EQI A;  2LP5 A;  3EG0 A;  1KQS S;  1YJW A;  2YRD A;  3SD4 A;  3BDU A;  2A08 A;  1GFD A;  2DRM A;  1G83 A;  4M7D F;  4IUU A;  4PJO G;  2DAQ A;  2VB6 A;  3LLR A;  5GAM f;  4PJO F;  2KSS A;  5KYW A;  2RHU A;  4M75 D;  4JJC A;  3H6Z A;  5EC7 A;  1KD1 R;  2EYY A;  1WX6 A;  2QQ9 A;  3OS5 A;  1UJ0 A;  2O4X B;  4C8Q B;  1RAC B;  5CCA A;  1VQO A;  2EVR A;  3EG1 A;  5GAO q;  1JB0 E;  1M3C A;  3V8L A;  1WXU A;  3L1A A;  2C0O A;  1AHJ B;  3G4S A;  1WJQ A;  3CCU T;  2KY9 A;  1M1G A;  1MV0 B;  2FL7 A;  1TH7 A;  2Y4X A;  2KVQ G;  1V1C A;  4C0G A;  1ZA2 B;  5L23 A;  1QCO A;  1W1F A;  3S3N A;  1OX8 A;  2O4X A;  2DET A;  2DYI A;  2KDS A;  4M77 G;  2K3B A;  2DEU A;  4EMK A;  5KYU A;  2JTE A;  3AHU A;  1VIF A;  1M2V A;  9ATC B;  2GFA A;  3M0U A;  2QDY B;  1AT1 B;  1UHC A;  2E3I A;  3MKD A;  2YLB A;  4FL6 A;  2J06 A;  2QK0 A;  4M77 E;  2GBQ A;  2M9U A;  1KC8 U;  1Q7Y R;  3J81 E;  4WF2 A;  5KH6 A;  3SB2 A;  2HD0 A;  3M57 A;  2C0I A;  3C12 A;  3VS5 A;  2PVD B;  1WQ7 A;  4OML A;  1VQM Q;  3CME A;  3JCM d;  1VQ9 Q;  3JCM V;  1W70 A;  1ZBX A;  4BUG A;  4XTY A;  2X4J A;  1YWO A;  2AK5 A;  4J9D A;  4ZN3 A;  1F1B B;  1TS9 A;  3KBG A;  5LJ5 h;  1W6X A;  2JZ2 A;  5FWB A;  1SEM A;  2F2V A;  1Q86 C;  1OI1 A;  2L3R A;  3C4S A;  4M7D E;  2K2V A;  3UPU A;  4IIO A;  5CKH A;  2LJ3 A;  2X4X A;  2R58 A;  5CQY A;  4PJO E;  5IT9 E;  4M77 F;  4X34 A;  4HCC A;  1VIE A;  3CCR T;  1NG2 A;  1UE9 A;  1V76 A;  1GBQ A;  3EFO B;  2W10 A;  3FEO A;  1YJW Q;  2DL8 A;  3SEM A;  3CCJ Q;  4KGZ B;  4EPC A;  1N8R R;  4HT9 A;  3CC7 A;  3VS4 A;  1VQM T;  3P8D A;  1K9M C;  5GAN d;  2KXD A;  4LUD A;  2LC4 A;  1WGS A;  2FYK A;  3CBP A;  3FC3 A;  2XK0 A;  3E19 A;  3HP9 A;  2LJ0 A;  2GTJ A;  2CYZ B;  5FLX E;  2E5Q A;  3OS2 A;  3U23 A;  3X24 B;  2RM4 A;  2DRK A;  1JO8 A;  2O31 A;  4UC4 A;  1K76 A;  2M16 A;  2V1R A;  3V7C A;  1IGU A;  1D1A A;  1B34 A;  2QI2 A;  4Y28 E;  3M56 A;  4J7I A;  4C8Q F;  1K9M R;  1BYM A;  1VQL A;  1WFW A;  2NYS A;  4IUV A;  4PJO B;  2EIF A;  4JLI A;  3MPU B;  5GAN 8;  3VV0 A;  3I55 Q;  2HKQ B;  4JJD A;  1NEG A;  1Q82 R;  5FU6 C;  4E6R A;  3NTH A;  2OAU A;  3OYE A;  3L2V A;  4XTZ A;  1PD1 A;  3UWN A;  3CC2 Q;  2EKO A;  5GAN 7;  4M75 A;  1YIJ Q;  1K8A C;  1LNX A;  2WSF E;  1I81 A;  1VQ7 A;  1MUZ A;  4L6V 5;  1QVF P;  4J83 A;  1W2B S;  2PZ1 A;  1M3A A;  5GAN 3;  2P4R A;  3CD6 T;  2EQK A;  3CMA T;  1IZ6 A;  1QVP A;  2LX7 A;  2A3L A;  2JOY A;  1LCK A;  4LDW A;  3M0R A;  5GAO l;  4DEX A;  3FLG A;  2RI2 A;  4FIB A;  4NS5 A;  2KRN A;  3VUZ A;  2RN8 A;  2ZPG B;  4M75 B;  1VYU A;  2YRC A;  1Q95 G;  2D8H A;  3CCS T;  3MP8 A;  1Q7Y C;  1KG1 A;  1VQP T;  3QBY A;  1HD3 A;  4DBR A;  3EGX B;  2QQS A;  3H0H A;  1UB4 A;  1VQO T;  2DER A;  1DJ7 B;  4A4G A;  4M78 E;  2DVJ A;  3PNW C;  5DLO A;  2EPD A;  4ZTJ A;  1NBE B;  4F7U E;  1G3S A;  1G2B A;  3NMZ C;  1M27 C;  1QWE A;  2D0N A;  1MND A;  5FU7 B;  4RCB A;  2DD4 A;  1WZO A;  4M7A B;  2DIG A;  3A8L B;  2VAS A;  4BE1 A;  1PWT A;  5FU6 B;  2ZPH B;  1QVG S;  2JNG A;  3G7Z A;  3GBQ A;  3EGX A;  4FYX B;  1IHV A;  1BK2 A;  3NTK A;  1YJ9 A;  4KGX B;  2HDA A;  5LJ5 j;  3L2U A;  2YHT A;  5I2S A;  2ZZD A;  2NUP A;  2NUT B;  4FU6 A;  1GCQ A;  1N27 A;  2D8J A;  3M4G A;  5AT1 B;  1SSH A;  5GAN 6;  3ZEH A;  3S3O A;  2KI7 A;  2WSC E;  3OYI A;  2A7Y A;  2BZ8 A;  2K4Y A;  5CKE A;  2HSE B;  1NLP C;  1KC8 C;  1UGR B;  3ME9 A;  3O8V A;  3OYC A;  1G8X A;  1MNE A;  2EQM A;  3X28 B;  1RAE B;  4M77 A;  4GLK A;  4HVU A;  1VQ7 Q;  1ABO A;  1JU5 C;  4N4G A;  4QKU A;  3TQ7 P;  2NUP B;  2NUT A;  1KJW A;  1G3T A;  1WA7 A;  4PLI A;  4LDY A;  1ZUY A;  4OMM A;  3JCM g;  2RQW A;  1X43 A;  3CC2 T;  5M9O A;  1KQS P;  1FX7 A;  2DXU A;  2X3W D;  3RES A;  4NL2 A;  4PFO A;  1QCN A;  2K6D A;  2XID A;  5KYU B;  2BUD A;  3I56 A;  5FWC A;  4LN2 A;  2VWF A;  3CXC A;  1OZ3 A;  2RPN A;  1X27 A;  3KFV A;  2AIR B;  2MPX C;  2CZ0 B;  2EW3 A;  5FW9 A;  5HCK A;  3JB9 F;  2XDD A; 
#chains in the Genus database with same CATH homology
 4D8D A;  2X3X D;  2YUN A;  3C0C A;  5IXF A;  1FYN A;  1K0X A;  2JS0 A;  1Z9Q A;  4CC4 B;  2HCK A;  1I07 A;  2JS2 A;  1AVZ C;  1SHG A;  1AD5 A;  4J9C A;  1GBR A;  4J9H A;  2F2W A;  2OI3 A;  4Z88 A;  2EGA A;  1YNZ A;  1PKT A;  1H3H A;  3H0F A;  2MCN A;  3REA B;  2CSQ A;  3R6N A;  4ZNX A;  5IXB A;  3THK A;  3UA6 A;  2YDL A;  1I1J A;  5I11 A;  2ED1 A;  1QKX A;  1FMK A;  2DL4 A;  4AFQ C;  4HXJ A;  2YSQ A;  2DYB A;  1AEY A;  2FRY A;  1GFC A;  3EHR A;  2AKL A;  2A28 A;  2CSI A;  4K11 A;  5ECA A;  4OMO A;  1AWO A;  1WI7 A;  2MOX A;  2JMA A;  2CH4 A;  1K1Z A;  2H8H A;  1UEC A;  2EQI A;  2LP5 A;  3EG0 A;  1CKA A;  2IIM A;  3TSW A;  1M8M A;  1VYV A;  2A08 A;  1OV3 A;  2SEM A;  3NPF A;  1E6G A;  1GFD A;  1WDX A;  4J9I A;  2DRM A;  2DA9 A;  2JM8 A;  1G83 A;  2RNA A;  1TG0 A;  1NYG A;  1JXM A;  1HSQ A;  4HVV A;  1VA7 A;  2DL5 A;  3ZL7 C;  1JQQ A;  2V1Q A;  1ABQ A;  1OPL A;  4JJC A;  5EC7 A;  4RTV A;  1YWP A;  2EYY A;  3VS6 A;  1WLP B;  1WX6 A;  2C0T A;  2EYZ A;  4HCK A;  1A0N B;  4OMP A;  1QWF A;  1UJ0 A;  4RUG A;  2ROT A;  2L2P A;  1T0J A;  2FPF A;  2FRW A;  1PNJ A;  2EVR A;  1YP5 A;  2RQT A;  3EG1 A;  1JEG A;  4F16 A;  1K4U S;  4AFS C;  2GNC A;  1E6H A;  1M3C A;  2KT8 A;  1WXU A;  2C0O A;  1ZX6 A;  3I5S A;  1MV0 B;  3ULR B;  1T3S A;  2E5K A;  3LH5 A;  4OMQ A;  2BTT A;  2KEA A;  1V1C A;  2DL7 A;  1MV3 A;  2YUO A;  1EFN A;  5L23 A;  1W1F A;  3TVT A;  2FG0 A;  1S1N A;  2KT1 A;  2ED0 A;  1X69 A;  3CQT A;  1NYF A;  2AZV A;  2GTO A;  2DBK A;  2K3B A;  3NHN A;  2JTE A;  2LQN A;  4Z8A A;  1GCQ C;  4AFU C;  1QKW A;  2LZ6 B;  1KFZ A;  2JXB A;  2CUB A;  2DM1 A;  3M0U A;  2K7A A;  4R0K A;  3PE0 A;  1UHC A;  1B3Q A;  1UTI A;  2L3P A;  1N5Z A;  2J06 A;  1UHF A;  4EIK A;  3I35 A;  1WXT A;  3REB B;  4JZ3 A;  2GBQ A;  2GGR A;  4LUE A;  2KE9 A;  1YCS B;  2C0I A;  2L0A A;  4RTY A;  3VS5 A;  2O9V A;  4Z89 A;  3M0T A;  1BBZ A;  2DMO A;  4OML A;  3FJ5 A;  2G6F X;  1K0S A;  1W70 A;  1ZLM A;  1AOJ A;  1YWO A;  2AK5 A;  4J9D A;  1H8K A;  1Y57 A;  4RTZ A;  4JZ4 A;  2PTK A;  3VS2 A;  5IHI A;  1W6X A;  5FWB A;  3TSZ A;  4AG2 C;  2CUD A;  4CC3 A;  1SEM A;  2F2V A;  2DF6 A;  2J7I A;  2D1X A;  1WIE A;  2XMF A;  1PRM C;  4IIO A;  2CDT A;  4HVW A;  2LJ3 A;  1UJY A;  1RLQ C;  2LQW A;  1QCF A;  1UDL A;  2DBM A;  1XOV A;  1ZUK A;  1WXB A;  1NM7 A;  3VRZ A;  2JW4 A;  1QLY A;  1NG2 A;  3SHW A;  1UE9 A;  1CKB A;  1GBQ A;  2W10 A;  2DL8 A;  3SEM A;  2RQV A;  1U06 A;  2DLP A;  2AZS A;  2PNI A;  3VRY A;  3VS4 A;  1E7O A;  2KRS A;  1HJD A;  2KXD A;  1X2Q A;  4LUD A;  3QWX X;  2LJ0 A;  1M30 A;  3H0I A;  4J9F A;  2YUP A;  2GTJ A;  4RTU A;  1YN8 A;  3U23 A;  2KGT A;  4ORZ A;  2K9G A;  2DRK A;  1JO8 A;  2DIL A;  3EG3 A;  3NGP A;  2O31 A;  2FPE A;  1K76 A;  2V1R A;  4LE9 A;  4CC7 A;  3RNJ A;  1X6B A;  2I0N A;  2KR3 A;  3QWY A;  4IIM A;  2ROL A;  1ARK A;  2DNU A;  1K9A A;  1WFW A;  4A63 B;  2HBW A;  3UAT A;  2O2O A;  1PHT A;  3A98 A;  1RUW A;  2YT6 A;  5I22 A;  1AWJ A;  2J05 A;  2DE0 X;  3VS0 A;  4J9G A;  2HSP A;  4JJD A;  1NEG A;  4WCI A;  2ESW A;  4E6R A;  2ABL A;  1SRL A;  4DEY A;  3VS7 A;  2EBP A;  1KIK A;  2JMC A;  1Y0M A;  1PRL C;  2M0Y A;  1UUE A;  1U3O A;  5GJW B;  1AWX A;  1GRI A;  3JV3 A;  1SRM A;  2ECZ A;  1B07 A;  2A37 A;  1MUZ A;  1ZSG A;  3EGU A;  1ZUU A;  3O5Z A;  1UFF A;  1I0C A;  2PZ1 A;  1UGV A;  1M3A A;  1OPK A;  2P4R A;  2F2X A;  1VYT A;  2RF0 A;  4AG1 C;  2KXC A;  2DJQ A;  2JM9 A;  1U5S A;  2K2M A;  1M3B A;  2RQU A;  2KRO A;  2LX7 A;  3EG2 A;  2B86 A;  1LCK A;  2K79 A;  3M0R A;  4DEX A;  2EYW A;  2A36 A;  4X1V A;  1UG1 A;  2KRN A;  2OAW A;  2RN8 A;  2BZY A;  1VYU A;  2LJ1 A;  2MIO A;  4RTW A;  1TUC A;  4RTX A;  4F14 A;  1BU1 A;  1JXO A;  2D8H A;  2JT4 A;  2KYM A;  3UF4 A;  4GLM A;  1CSK A;  1NEB A;  1HD3 A;  2O9S A;  1GCP A;  2GQI A;  3H0H A;  2DVJ A;  2CH4 W;  4FSS A;  2EPD A;  2QDL A;  2DX1 A;  3M0S A;  2FEI A;  2M51 A;  1H92 A;  1Z9Z A;  2J6O A;  1G2B A;  2LMJ A;  3NMZ C;  1M27 C;  1QWE A;  2KNB B;  4J9E A;  2D0N A;  2EGC A;  1T0H A;  2W0Z A;  1PKS A;  4JJB A;  2J6F A;  1T3L A;  1PWT A;  4QT7 A;  3PVQ A;  3GBQ A;  2SRC A;  1BK2 A;  3M0Q A;  4Y92 A;  2HDA A;  3H41 A;  1AZG B;  2L3S A;  5IH2 A;  4ESR A;  1NLO C;  5IHK A;  3VS1 A;  3UA7 A;  3EHQ A;  1GCQ A;  2OJ2 A;  1WYX A;  2VVK A;  1IO6 A;  3I5R A;  4OMN A;  3RBB B;  4LNP A;  4AFZ C;  1ZBJ A;  2D8J A;  2HEQ A;  4GBQ A;  1SSH A;  2KRM A;  3IQL A;  2RQR A;  1RI9 A;  2LNH B;  2L3Q A;  2EGE A;  2BZ8 A;  2CT4 A;  2BZX A;  1OEB A;  3VS3 A;  1NLP C;  2NUZ A;  2KYB A;  1J3T A;  1AWW A;  1X6G A;  2EYX A;  4HVU A;  1SPK A;  1ABO A;  2NWM A;  2RMO A;  1JU5 C;  3PVL A;  1TUD A;  4CC2 A;  4JPB W;  1KJW A;  1WA7 A;  1ZUY A;  4OMM A;  2EKH A;  2YUQ A;  2LCS A;  2RQW A;  1X43 A;  4RTT A;  2CT3 A;  2FPD A;  1X2K A;  2X3W D;  4KRT A;  3I9Q A;  1RLP C;  2K6D A;  2J6K A;  4M4Z A;  5FWC A;  4LN2 A;  2CRE A;  4J9B A;  1KSW A;  1SHF A;  2VWF A;  2RPN A;  1X27 A;  3KFV A;  3M0P A;  5GJV B;  2O88 A;  5IHN A;  2VKN A;  1GL5 A;  1BB9 A;  2ENM A;  2FO0 A;  1OOT A;  2DL3 A;  1AZE A;  2EW3 A;  2AKK A;  5FW9 A;  5HCK A;  4F17 A;  2KBT A;  4D8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...