1BBZA

Crystal structure of the abl-sh3 domain complexed with a designed high-affinity peptide ligand: implications for sh3-ligand interactions
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
b'NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABL TYROSINE KINASE
publication title Crystal structure of the abl-SH3 domain complexed with a designed high-affinity peptide ligand: implications for SH3-ligand interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (transferase/peptide)
total genus 10
structure length 58
sequence length 58
chains with identical sequence C, E, G
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1998-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1bbzA00
1HJDA 1YWOA 2KT8A 1ZX6A 2NWMA 2CREA 1XOVA 2EGAA 2HCKA 4J9DA 2AKKA 4DEYA 2X3WD 3LH5A 2FG0A 2DMOA 1BB9A 1UGVA 1WXTA 1X6BA 1QWFA 2AKLA 2G6FX 2PNIA 4JZ4A 2RN8A 1UJYA 3M0TA 2RQUA 2CH4W 1ZLMA 2YDLA 2ROLA 1GCQC 4F17A 4A63B 2A36A 1AWXA 2ABLA 4FSSA 1X2QA 4J9CA 4J9EA 2VKNA 2KR3A 2GGRA 2MCNA 3RBBB 2QDLA 2DILA 2JMAA 2LQWA 1RUWA 4ESRA 2DRKA 4KRTA 4OMOA 2KE9A 2EVRA 4M4ZA 2PZ1A 3NHNA 5IH2A 2YT6A 2OI3A 5HCKA 1B3QA 2YUOA 4J9IA 1FMKA 1UE9A 2DL4A 3IQLA 3JV3A 1UTIA 4WCIA 1NEBA 2D8HA 2LJ1A 2OAWA 4J9FA 3THKA 4OMLA 2RPNA 2DL3A 3PE0A 1M3BA 2J06A 1NM7A 4IIMA 3O5ZA 1LCKA 1KFZA 2DNUA 2LJ3A 1SHGA 2ED1A 1WI7A 5IHKA 1KIKA 5I22A 2DVJA 1WA7A 2O9VA 2RQTA 1PHTA 1Y57A 5GJVB 4JZ3A 1UJ0A 1SHFA 1VA7A 2EYZA 4K11A 1JXOA 4J9HA 1K0SA 1G2BA 2GTJA 3ULRB 3VS3A 1ZSGA 1X2KA 2C0TA 1T3LA 1SRLA 1VYVA 1T3SA 1YWPA 2FEIA 2CT4A 3NPFA 1B07A 4R0KA 1W70A 4CC3A 1HD3A 2RF0A 2EPDA 2DL5A 2KGTA 2KEAA 1K0XA 3U23A 2DJQA 2DBMA 1GBQA 1SSHA 2J6OA 2KT1A 1WIEA 2KRNA 2LP5A 2BZXA 3TSWA 1YNZA 1M27C 4LNPA 1OPKA 4JJDA 1UECA 1WDXA 1E6HA 2EYWA 4AFUC 1ZUYA 2FO0A 1GCQA 4JPBW 2A08A 1T0HA 2K6DA 2CSQA 2J6FA 1K1ZA 2J05A 2LCSA 1AOJA 2CH4A 2FPEA 1CKAA 1H8KA 1H3HA 2EGEA 1RI9A 1PRMC 1GBRA 1U3OA 1YP5A 4HXJA 4RTZA 1MV0B 1AEYA 3VS7A 1K76A 4AFQC 1ABOA 4X1VA 1PKTA 3A98A 2M51A 1KJWA 2AZSA 4OMMA 1GRIA 2CUDA 1QWEA 4RTUA 2LMJA 3VRYA 2ESWA 1GFCA 1Z9QA 2YSQA 2DRMA 1U5SA 2KBTA 1WYXA 1BK2A 1NEGA 4LE9A 4CC7A 1JEGA 1X27A 1N5ZA 2L3PA 1TUDA 1HSQA 2FRYA 1OOTA 3I35A 2KYMA 4JJBA 1W1FA 1KSWA 5ECAA 2DA9A 4CC4B 1AD5A 1SRMA 3C0CA 3UA7A 4Z88A 2FPDA 1GCPA 4LUEA 2KYBA 1RLPC 1K4US 2CSIA 4OMPA 2KROA 1TG0A 1IO6A 5EC7A 1WXBA 2F2XA 1MV3A 1UHCA 2K2MA 4J9BA 2LNHB 1PNJA 4LN2A 4ZNXA 1UHFA 2DYBA 2W10A 2GNCA 1YN8A 1X69A 2F2WA 2X3XD 5GJWB 2HEQA 1PWTA 4AFZC 4AFSC 1NG2A 4RUGA 3CQTA 2BZYA 3QWYA 3EG3A 1JO8A 1S1NA 2H8HA 2K9GA 1PRLC 2V1QA 2JW4A 1CSKA 2O88A 4EIKA 2K79A 2EYYA 2M0YA 5L23A 2RMOA 2JM9A 2LQNA 2GQIA 3H0HA 4OMNA 2ROTA 2FPFA 2HSPA 2DE0X 1G83A 2YUNA 2YUQA 2KRSA 1CKBA 4Y92A 1AWOA 2CT3A 2J6KA 4JJCA 2DL8A 3NMZC 1BBZA 1RLQC 1WFWA 4AG2C 2CDTA 2DBKA 2I0NA 1ARKA 1I07A 2YUPA 3VRZA 2SRCA 1NLPC 3SHWA 2C0OA 3FJ5A 1JXMA 3VS4A 2XMFA 2EQIA 2E5KA 2BZ8A 1QCFA 2JMCA 1NYFA 3M0SA 3VS5A 1X43A 2DL7A 3SEMA 2MOXA 3I5RA 3UA6A 2JT4A 1UG1A 2GBQA 4DEXA 1OEBA 2DX1A 4OMQA 2SEMA 1ZUKA 1W6XA 1AWJA 1UUEA 1AVZC 2DF6A 3RNJA 1QLYA 3EG1A 4IIOA 4D8DA 2KXCA 1JU5C 4Z89A 2L0AA 1WLPB 3M0PA 1PKSA 3H0IA 1U06A 3VS2A 2RNAA 5I11A 2A37A 4J9GA 2ENMA 2C0IA 2EW3A 4E6RA 1NLOC 5FWCA 2PTKA 2RQRA 1H92A 1E6GA 1AZEA 3M0QA 1AWWA 2D1XA 2AK5A 1E7OA 2RQVA 2KRMA 3I5SA 2JS2A 2ED0A 1VYTA 3UATA 3EGUA 1M8MA 1WXUA 2VVKA 4HVVA 2ECZA 4RTWA 3ZL7C 2FRWA 2MIOA 1EFNA 5IHIA 2F2VA 3NGPA 3TVTA 2V1RA 1A0NB 2EYXA 2L3QA 1GL5A 1M30A 1WX6A 1Y0MA 1T0JA 2L3SA 5FW9A 3R6NA 3EHQA 3H41A 1ZBJA 5IXBA 2D0NA 2O2OA 2LX7A 1QKWA 1K9AA 1VYUA 2L2PA 3QWXX 4HCKA 3I9QA 4LUDA 1Z9ZA 4ORZA 5IXFA 3VS6A 2BTTA 4RTTA 3REBB 2JM8A 2DM1A 2EGCA 1ABQA 2VWFA 1QKXA 2O31A 1M3AA 1UFFA 4D8KA 1YCSB 4HVUA 4F16A 3EHRA 3EG0A 1BU1A 2K3BA 3REAB 4CC2A 2KNBB 1V1CA 3VS0A 4RTVA 1I1JA 2EBPA 4F14A 2A28A 2GTOA 1X6GA 1OV3A 3M0RA 4GLMA 4RTYA 3H0FA 2HBWA 2JXBA 2D8JA 3VS1A 2AZVA 2EKHA 3GBQA 2IIMA 2KXDA 1J3TA 3EG2A 4Z8AA 4AG1C 1AZGB 3UF4A 5IHNA 1GFDA 4HVWA 2LJ0A 2OJ2A 1UDLA 2CUBA 1MUZA 1M3CA 2K7AA 1SPKA 1SEMA 5FWBA 1OPLA 3TSZA 4GBQA 2HDAA 3PVQA 2LZ6B 2DLPA 1FYNA 1I0CA 2JS0A 1TUCA 3M0UA 1ZUUA 3KFVA 3PVLA 4RTXA 2JTEA 2J7IA 2P4RA 2O9SA 2RQWA 2B86A 1JQQA 4QT7A 2W0ZA 2NUZA 1NYGA
chains in the Genus database with same CATH superfamily
1HJDA 3QSUA 1YWOA 1ZX6A 2QGGA 2CREA 1XOVA 2HCKA 2X3WD 2FG0A 2ZPBB 2H3JA 2AKLA 2G6FX 4F7UE 3I55T 1UJYA 4M75G 4QQGA 3PGGA 5CQYA 1VQ8A 4M7AG 1ZLMA 2YDLA 4M75F 1Q86C 3M4GA 2A36A 4JJNK 4M7AF 2MMPA 4J9CA 4FT4A 4MZMA 1VQ6Q 3MP8A 5LJ5h 2QDLA 2DILA 1K8AU 1TWBA 1UGPB 1RUWA 5FRMA 9ATCB 2COZA 3WXMB 4OMOA 2RH2A 1SG5A 1WJQA 1S72A 4PFPA 3E2UA 1I5LA 4BI8B 2OI3A 3MEVA 3OA6A 1GXIE 3CD6A 3QDFA 1PD1A 4IUTA 4HT8A 2OAWA 3THKA 1NJIU 4J6WA 4PKCC 2ZPHB 2DL3A 3FEOA 4BI3A 3PE0A 3JCMe 3CCSQ 2V26A 3R6OA 5GAN4 4A4FA 1Q82U 1KIKA 2E10A 1NBEB 2O9VA 3O8VA 3HFOA 1UJ0A 3EGXB 1YJNQ 1LPLA 2DZ9A 4K11A 5DLQE 3JCMQ 1G2BA 1KG1A 3VS3A 3OYFA 3JB9G 1Y96B 3M59A 1Q95G 1VYVA 1D09B 1YWPA 3NPFA 1RL2A 1B07A 3CCLT 2CZ1B 3PIPA 4R0KA 2R5AA 3CMAQ 3SWNA 2VXFA 1QP2A 4DA4A 2G3RA 5KYNA 2KGTA 3U23A 2O01E 4MMKA 1MNEA 2ZPIB 2RI3A 4MZTA 4FU6A 1WIEA 1VQPT 1ZSZC 1OPKA 2X51A 1WDXA 2WSEE 2QDYB 1ZUYA 2LDMA 1GCQA 1BI0A 4JUVA 1T0HA 2K6DA 2LCSA 2J05A 2JTMA 2CH4A 3GOXA 2PUKB 1U3OA 1FMWA 3VS7A 4AFQC 1ABOA 1VQNA 3QO3A 2EYQA 1QWEA 3HKSA 4QVDA 2E6ZA 1WHHA 1U5SA 5L8RE 3VV0A 2KBTA 1WYXA 2FZCB 1NPPA 3JB9D 3QZ5B 1G3TA 4J6YA 3PT9A 4CC7A 1D1BA 4WTOB 1TUDA 4FW1A 4EMGA 1VQ6T 1OOTA 3I35A 3CCQA 4JJBA 3G6EA 4HCZA 5ECAA 4C8QE 1VQ9Q 4F04B 4PJOE 4EMHA 2MI6A 5KE2A 2XDDA 4OMPA 2KROA 1TG0A 1OULA 4RCBA 2CZ6B 1MV3A 1UHCA 1G5VA 5A2QE 3A8GB 2L8DA 2F2WA 1KHCA 2JNGA 4HCBA 1VQKA 1ZQ1A 4GY5A 3A8OB 4QQ6A 1JO8A 1S1NA 2H8HA 3CCST 3QJ6A 1PRLC 2V1QA 4BDZA 2P4TA 2JW4A 3CCEQ 4E7IA 4MDWA 3CEYA 4LDVA 4RG2A 1KD1R 1RAEB 5L23A 3KUFA 3OW2S 1FMVA 2GQIA 1YJNT 4ATOA 4MZPA 2EJGA 3UPUA 1Q81R 2YUNA 2YUQA 1X75C 1M1KC 2KRSA 3C12A 3NMZC 1IHWA 1RLQC 3E9FA 4OB1B 2I0NA 1RAIB 3OYCA 1I07A 2NYSA 3RDVA 2OTLA 2EQKA 1MMDA 2SRCA 3CMAT 1YHQA 1NLPC 1TXQA 2ZGWA 3I56Q 2Y4XA 3BE3A 5IT9E 4KBMB 4BY6C 2E5KA 1ZSZB 2JMCA 3EH1A 3VS5A 1X43A 3SEMA 1N9RA 3UA6A 1UG1A 4DEXA 4C92G 2HL5C 4M78G 4OMQA 3HL8A 5FROA 1Q86R 2DTIA 4C92F 1YI2A 2HZYA 1UUEA 1AVZC 3VYHB 4RMOA 3RNJA 4C0FA 1EIFA 2JJ9A 1D0ZA 5HKCA 4Z89A 1WLPB 3L2QA 3H0IA 1U06A 2X4YA 1YIJQ 4F7UG 3CXCS 3CC2A 3C4SA 1K9MR 2GQVA 2KMTA 3CCVQ 3M0QA 1AWWA 3G4SQ 4C0DC 3CC7Q 3RUXA 3L2RA 3QHSA 2R57A 1OX9A 2RJFA 2DXBA 1N27A 3CPFA 1G3WA 3E9GA 1FXXA 3ZL7C 2RA2A 5IHIA 3PMTA 2DXUA 2DERA 2CS7A 1GL5A 1DJ7B 3QXEB 1VQ9T 4LDXA 3QG1A 2NUTB 2HQHA 1Y0MA 4M7DC 3EHQA 1ZBJA 3TCJA 5IXBA 2E6NA 1M2VB 4FT2A 3JCMb 1K9AA 4XU2A 4A4KA 2HSEB 4LUDA 4BE2A 1G3SA 4M7DD 3CBMA 4J7IA 1YCYA 2K4YA 3CXCA 1VQLQ 1R77A 5C6SA 2QQSA 1N8RC 4JRPA 1IGUA 5KYUB 1QKXA 1PM3A 1OI1A 1M3AA 1UFFA 3CCET 4HVUA 4F16A 1BU1A 5GAOn 8AT1B 1MMAA 1K73R 3PIOA 1V1CA 4RTVA 4F14A 2A28A 1X6GA 3LYIA 1OV3A 3EFOB 2FZGB 2HBWA 4PNOA 1VQMA 5GAMg 2AZVA 2IG0A 3JB9J 3GBQA 2IIMA 3CCUA 3EG2A 3QPHA 4J6XA 2KQWA 4M77A 1MUZA 2K7AA 5FWBA 3PMIA 3CCRQ 4GBQA 3I56T 5GAMd 4BY6B 2HKQB 2RJEA 3EFSA 1AHJB 3FIFA 5GANg 3M4YA 5LL6S 4ZN1A 1YITQ 2JS0A 2OTJQ 2VYTA 1ZUUA 3FDRA 5FU7C 2JTEA 4L5GA 2J7IA 5CO7A 1O75A 2P4RA 2QTVA 2DFUA 5CK9A 1M1KU 3HSBA 1BI2A 5KE3A 2JTFA 3L2WA 5GANd 2KT8A 2HAXA 1OX8A 4RG8A 2AKKA 1PSFA 4JRKA 1WXTA 3DKMA 1X6BA 4JZ4A 4E7KA 2RN8A 3M0TA 1YIJT 2RQUA 1QVFS 2CH4W 1NJIC 4R55A 3H9NA 4F17A 3CCVT 1OZ2A 2E12A 3QZ9B 4FW2A 3G4ST 1AWXA 4FSSA 4J9EA 1UGRB 2VKNA 3JCMf 2YXYA 1W2BS 5HK0A 3JSCA 2DXTA 1M2OA 3H8ZA 4KRTA 4A4EA 2DIQA 2EVRA 4PJOG 3J80E 1YJ9Q 4C8QF 5GAN7 4N0AA 5IH2A 2YT6A 4DBRA 2LRQA 4PJOF 3ASKA 4J5YA 4M7DB 3QUIA 1NEBA 3EGXA 3JCMh 3GIBA 1KQSS 2MYSA 2K5IA 1M3BA 3MEUA 1LCKA 1I5OB 1Y96A 4X9DA 1LOJA 1D0XA 1QVFA 5J26A 1P92A 2DXCA 2ED1A 6AT1B 1HYOA 5IHKA 5LJ5d 2VXEA 1WA7A 2RQTA 2LQ8A 3OW2P 4LXCA 5GJVB 4JZ3A 3UDCA 3CMEA 1VQ5Q 4E7SA 4J9HA 1K0SA 1W2BA 2RJCA 3OYDA 1ZSGA 2FZKB 1RAHB 2C0TA 3L2ZA 3CCJA 1T3LA 4HKEA 2JZ2A 1T3SA 2EQUA 4FSXA 3KXTA 1M90C 2L89A 2P0KA 4CC3A 1HD3A 2RF0A 3FC3A 1N8RU 4OB3B 4KUDK 1KC8R 3RIRA 3WVEB 1QVGS 1K0XA 1BI1A 2DBMA 3CCMQ 1GBQA 3V7RA 3CCRT 2YLBA 1NPRA 5CKHA 1KQSA 2FYKA 1YNZA 3G71T 1IHVA 4KT0E 4XTVA 5FU7B 4ANJA 1YITT 2COWA 2OTJT 1XNIA 2RB6A 3LW5E 4AFUC 3EGDB 4QKUA 2PVGB 4JPBW 3FLGA 4P5NA 3HP9A 2QQ9A 1MMNA 4L6V5 3GPLA 4OB2B 2CSQA 3SFMA 1CKAA 3J7AF 1RI9A 1FX7A 2QEXA 2BKDN 5KYWB 4HXJA 4RTZA 1G8XA 3CXCP 2HQXA 1Q7YC 3A98A 2M51A 4OVAA 1KJWA 2AZSA 2QI2A 4B6MA 1GRIA 1JJ2P 5GAN8 3VRYA 2ESWA 1GFCA 1Z9QA 2YSQA 3AT1B 3I55A 1PCXA 3BFMA 1QVGA 1PD0A 4OGEA 1X27A 3G6EQ 1N5ZA 3HRSA 2FRYA 2DJZA 3AHUA 4A4HA 4KH1B 4LD6A 3QDRB 3TQ7P 1TU0B 2DEUA 3OQ5A 4CC4B 4LDYA 1AD5A 1SRMA 5LJ3f 4HCCA 1YJ9T 1QVPA 4AMCA 2KYBA 5A0GA 5D7UA 2VB6A 5GAOq 2V8IA 2D6FA 2CSIA 3PNWC 1NE8A 3E19A 5HK3A 1MGQA 1WXBA 2F2XA 4A4GA 3KBGA 2DYBA 4GLKA 2GNCA 1YN8A 1X69A 2I2LA 2X3XD 5GJWB 4AFSC 3E1SA 3CQTA 4M75C 3EG3A 1RAGB 2K2VA 2VV5A 3M55A 1M4ZA 4Y28E 4M7AC 2K9GA 1G3YA 1X6OA 1CSKA 2HL3A 4NS5A 4JDSA 2M0YA 1YBYA 4M75D 2RMOA 4M77E 4MDXA 3D7SB 2AT1B 4M7AD 2C06A 3EAEA 1QW1A 1VQ5T 2DE0X 2DYIA 4IUUA 2QA4Q 1ZSZA 1YJWA 2VUBA 5J3BA 1VQOQ 2PVOB 1AWOA 1WJRA 5KYYB 3QYHB 4JJCA 2DTOA 3MKDA 2EFIA 1BBZA 3HRTA 4OP0A 3RR6A 2CYZB 2KK4A 1K8AR 2YUPA 3VRZA 2FHDA 3HRUA 4N4HA 2C0OA 3CCLA 1RAFB 3VS4A 2XMFA 1TTHB 3OS1A 1QCFA 4FL6A 3CCMT 1ZA1B 1OQKA 1NYFA 2DL7A 2LCLA 2MOXA 2JT4A 2GBQA 3NFCA 4JLGA 4VUBA 1VQPA 1NJIR 4IKFA 1W6XA 1M8VA 5LJ3j 1M90U 2DKGA 2CP2A 1BCOA 1QLYA 4FYXB 4XTYA 4IIOA 1RADB 3P8DA 2V8JA 4D8DA 2KXCA 1Q82R 3M5AA 3VS2A 2RNAA 2EW3A 1QVFP 3L2UA 2QK0A 1H92A 5CIUA 3S6WA 2M1HA 2XHCA 1E7OA 2NUTA 3TREA 4JS5A 4ELZC 1IGQA 1WGSA 2KRMA 3I5SA 1VIFA 3UATA 2B8AA 3EGUA 1C0MA 3MP1A 1M2VA 3CC4Q 4HVVA 5CKFA 3L2VA 1VQ7Q 4RTWA 3G6ET 2QG9B 2F2VA 2NUPB 3NGPA 3OY9A 3TVTA 3QKJA 1A0NB 4IUPA 1D0YA 1XTDA 2KAFA 2L3QA 4BACA 1Q7YU 1M30A 1VQ6A 1WX6A 5M9OA 1F1BB 5CAIA 3CPWP 1SF9A 5J39A 5KYUA 2D0NA 2O2OA 2XDPA 3HPWA 2L2PA 1VYUA 4C5IA 3I9QA 3OYIA 4BI4A 1Z9ZA 3EFOA 2KY9A 1U8RA 1KHIA 4M75B 1LVKA 2COYA 3OYLA 4X34A 4M7AB 3OYJA 4RTTA 1QMCA 3S3OA 4D6WA 5GAN2 5LJ3e 2JM8A 4BB7A 2DEQA 2DM1A 2EGCA 1ABQA 2ZAEA 1SSFA 3CCSA 5KCHA 1YCSB 1M1FA 5GAN5 2K3BA 2CKKA 3VS0A 1VQMQ 3JCMc 4GLMA 3EH2A 2JXBA 3VS1A 3VJPA 2QA4T 2EKHA 4KUIA 3LLRA 4PLIA 4Z8AA 1VQOT 3SD4A 1AZGB 2F5TX 5I2MA 2Z0WA 1QVGP 2P84A 1OPLA 1WHLA 2MPXC 3V8LA 2RHZA 2LT4A 1FYNA 4XU0A 3M0UA 4RTXA 3JCMV 4N4GA 3RERA 2LX9A 4O5VA 2B86A 1JQQA 4QT7A 3FJPA 1BCMA 1OU9A 1AT1B 3SDZA 4LDWA 4HA8A 2DMOA 2X4XA 1QWFA 4BUGA 4M7DF 3VUZA 3L42A 1R8OB 2EJFA 1EX4A 2YHTA 2WSCE 1NZ9A 1QP3A 2ABLA 1X2QA 4M7DA 1C6VX 1BKBA 1O9SA 2RO0A 3EFRA 3M58A 4E47A 3OSSC 1WHKA 3RBBB 3CC4T 2JMAA 2LQWA 2DIGA 2DRKA 1VQ7T 4HT9A 2KE9A 2GCXA 2P0PA 4C92C 4M78C 4M4ZA 3NHNA 4XU3A 1JBMA 4PLLA 4C5EA 1B3QA 2YUOA 4LDUA 2E1HA 1UE9A 2MK5A 1PSEA 2ZZDA 3FB9A 4C92D 1MNDA 3JV3A 3OYNA 4M78D 4WCIA 4J9FA 2FB7A 2K3YA 2EQMA 2RPNA 2XU8A 1IB8A 2KDSA 1NM7A 5IAYA 2CGHA 3L1AA 4IIMA 3GF5A 4XAXB 2IVWA 1KFZA 2DNUA 3OYGA 2CP6A 1WI7A 5I22A 2DVJA 3CMEQ 1WZOA 1Y57A 2RK1A 3BW1A 1SHFA 1VA7A 2EYZA 3OBYA 5DM7R 3JCMg 1B34B 4M77F 2E65A 3CCJQ 2PUOB 1BYMA 2YLCA 4LD9K 3CCEA 1X2KA 1MMGA 5CVIA 2FEIA 1I81A 2M0OA 5CCAA 5I21A 2QGFB 3ZBDA 3EGDA 3JCMd 2WSFE 3V7CA 3OYAA 2QQRA 4DOVA 2DJQA 2J6OA 2KT1A 1QCNA 1Y07A 2LP5A 1VQ4Q 5KYWA 2M02A 2BZXA 3NTHA 4C0GA 3I56A 1YFNA 1UECA 3C95A 2EYWA 5CQXA 4PJNA 3JB9H 2J6FA 3MEAA 2Y90A 3C94A 2DD5A 2FPEA 1H8KA 2F5KA 3G7ZA 2EGEA 4XQ3A 1VQ8Q 3EG9B 1PRMC 1I8FA 1AEYA 1YP5A 1MV0B 2O4XB 3M54A 1PC0A 3F70A 4X1VA 1PKTA 3RKWA 3H6ZA 3I55Q 3S3MA 3CC7T 4OMMA 4RTUA 2FL7A 3MHXA 4E7JA 3OB9A 2DRMA 2VGNA 1YIJA 5AT1B 2RI5A 1U1TA 1S72Q 1BK2A 4ME7A 4C8QG 3CCVA 3OMCA 3G4SA 2LC4A 3A8LB 2E3IA 2ZPFB 2VASA 4QW2A 3CD6Q 5GAN6 4A54A 4C92B 4M78B 1HXDA 4PFOA 1RI0A 3C0CA 3QJYA 4Z88A 4XTUA 1UGSB 5A0LA 1GCPA 3M9QA 3VU3C 4KGZB 3M57A 2AIRB 3A5ZB 2ATCB 3UT1A 4J9BA 2Y4YA 1PNJA 4LN2A 1UHFA 2X4WA 1M1KR 4F7UB 3JCMJ 4BE0A 1PWTA 4AFZC 4KGVB 2EAYA 5GANf 2BZYA 1VQLT 2RJDA 5KYYA 2DETA 3OYHA 2O88A 2QASA 2K79A 4X9CA 3VYGA 1IZ6A 3CMET 3BY7A 4PL6A 2JM9A 2LQNA 5GAOl 2JUFA 3H0HA 4OMNA 1WHMA 1YJWQ 3PTAA 3CCJT 3CBPA 4FYVB 1H641 2HSPA 4RCCA 4C8QC 1G83A 2CP3A 2LNVA 4Y92A 4PJOC 4L59A 3URGA 4KULA 2CT3A 3ME9A 1IRXA 3LWIA 2DL8A 5IN1A 4AG2C 5CKBA 2CDTA 5KCOA 3PFSA 1ARKA 1D1AA 4II1A 2EIFA 4C8QD 2HKNA 4FIBA 3SHWA 4PJOD 4QQDA 3ZEHA 3JCMW 2RI2A 2D9TA 3M0SA 2CP5A 1VQ4T 2L5QA 2GFAA 3CCRA 1PG5B 1Q81C 2SEMA 3G71A 2IPOB 1YITA 5GAMj 1OZ3A 2R5MA 1VQNQ 3EG1A 4EMKC 4M7DE 2LQKA 1JU5C 1TSFA 1PKSA 5LJ5f 1VQ8T 3OMGA 3RESA 4J9GA 5FU6C 2ENMA 2C0IA 2RK2A 2H3EB 2NUPA 2VC8A 2XIDA 4E6RA 4E7LA 1NLOC 5FWCA 2PTKA 4JRIA 4NL2A 5GANj 1E6GA 3LH0A 1AZEA 2D1XA 2K3XA 3GNFB 2E70A 2X4JA 3CCQQ 2RQVA 4Q5WA 4B9WA 2JS2A 2ED0A 1M8MA 4PJJA 4XK8E 5GMKj 1WXUA 1WNLA 1S72T 3X20B 4DBFA 2DPPB 2FRWA 1EFNA 4IURA 4IUQA 1N8RR 1WQ7A 1ACMB 4M75A 2V1RA 5A0DA 3CD6T 3FRNA 4M7AA 5DLOA 3OYMA 1K9MC 1VQKQ 1WPYA 5FW9A 3R6NA 3HTRA 1YJ9A 1RACB 4FM4B 4TVRA 1IREB 2QQBA 3TEEA 3RKXA 2KSSA 1D3BB 2E5QA 3X24B 5IXFA 3X25B 4FYWB 4BE1A 2DD4A 4DBQA 2MAMA 2RHIA 5LJ3h 3VS6A 2BTTA 2LTOA 3REBB 3DLMA 5CR2A 5GAMe 2X9HA 3G1JA 2BE9B 1TOVA 2QXFA 3OYBA 2A3LA 3MPUB 2VWFA 2O31A 3GP8A 4D8KA 3N5BB 4Y91A 3EG0A 3REAB 3J81E 3A8MB 1RAAB 1I1JA 3A1PA 2GTOA 1BIAA 1LNXA 4C8QB 5GAOr 1YJWT 2OTLQ 4RTYA 3H0FA 4JLIA 1YHQQ 5GMKl 2D8JA 4PJOB 5GANe 5LJ5j 2PU9B 2MWOA 1VQ5A 2KXDA 1J3TA 3OYKA 4AG1C 2PQWA 3HFNA 4HVWA 2LJ0A 2OJ2A 3JB9F 2LVMA 5GMKe 1M3CA 4XTZA 4KH0B 1M5Q1 2JOYA 4MMLA 3OYEA 2E4HA 2HDAA 2OAUA 3PVQA 1YI2Q 1K73C 1I0CA 4ZTJA 1N9SA 1TUCA 1QCOA 3DB4A 3V7SA 2O9SA 4QVCA 3CCMA 2E41A 1KK7A 5GAOm 1Y71A 3SWNC 3OYYA 2CZ0B 2XDBA 2NUZA 1ZBXA 2F69A 5KYXB 2EWNA 3CC2Q 2V8KA 4EMKB 2NWMA 5D6XA 2M16A 4PJMA 2EGAA 4J9DA 5FLXE 4DEYA 1VQNT 3LH5A 5D6WA 1V76A 2DAQA 1BB9A 3A8HB 2HQEA 1UGVA 2JVVA 5FU6B 1KD1U 2PNIA 2XI9A 8ATCB 1N6AA 2R58A 3M53A 4PK4A 2ROLA 1GCQC 1W2BP 1RABB 4A63B 1Q81U 1C1AA 3JRZA 1KQ1A 2DVEA 2ZPGB 3CCQT 2KR3A 2GGRA 2GF7A 2MCNA 5LJ5e 1QQJA 4ESRA 2DO3A 1WHGA 2KI7A 2PZ1A 4OF1A 5HY6A 3OS2A 5HCKA 4J9IA 2YWWA 1FMKA 2DL4A 3IQLA 1KQSP 3MCAB 2OX7A 1UTIA 1U1SA 4PJLA 2D8HA 2LJ1A 1VQKT 4OMLA 1B34A 2EQJA 1Q86U 1ZHIA 2J06A 1M90R 3O5ZA 2LJ3A 2KVQG 4C0ZA 1SHGA 4XTWA 2K57A 3M56A 4B9XA 1H3ZA 1PHTA 2YRCA 1KQ2A 3GNGA 1K9MU 3LX7A 3CCUQ 1JXOA 2GTJA 3ULRB 3P8HA 1YJNA 2EKOA 1SRLA 1JRIA 4IUVA 1VOMA 5GAN3 2MF2A 2OTLT 2CT4A 1YHQT 2QTXA 2HBPA 2BIVA 1W70A 3BDUA 2QA4A 2EPDA 3LGFA 4ZGDB 2DL5A 4UC4A 1VQOA 2KEAA 3CMAA 5DY9A 1Q7YR 1SSHA 2XG8D 1XJWB 2YRDA 3EG9A 5AYFA 3RMSA 3WVDB 2KRNA 4R56A 2VGMA 2E3HA 4JS4A 3TSWA 1D1CA 4OB0B 2O4XA 1EZZB 3META 3MEWA 1M27C 1YI2T 4LNPA 4JJDA 1MHNA 3ZFJA 1E6HA 2FO0A 4OMFB 5CKDA 3SWNB 3S3NA 4DQ2A 2A08A 3DB3A 3RKYA 4ZGJB 1K1ZA 1AOJA 4EDUA 4JRQA 4M7DG 1WQWA 4NOYA 4M78F 5C0MA 2XKOC 3BDLA 5GMKm 4FCYA 1H3HA 4N4IA 3CC2T 1GBRA 1KC8C 2FVUA 2QAZA 1K76A 3OW2A 2QYZA 4J7FA 1K73U 4C92A 1UGQB 4M78A 2CZ7B 4M75E 2D0QB 2CUDA 3OSVA 2A7YA 1V29B 3DLLA 2LMJA 4M7AE 5GAOp 4F7UF 4WF2A 3MJXA 1NEGA 4V2SA 4E7HA 4LE9A 1JJ2S 1JEGA 2L3PA 1HSQA 3OS5A 4OGCA 4F7UA 2KYMA 1W1FA 1KSWA 2DA9A 1VUBA 4FYYB 4J8OA 1SKUB 1TUGB 3LGLA 3CC4A 3UA7A 2FPDA 1VQ9A 1VQ7A 4LUEA 5KH6A 1RLPC 1K4US 2F1LA 1IO6A 5EC7A 2K2MA 2LNHB 4ZNXA 2W10A 3QBYA 2HEQA 1HK9A 1NG2A 4RUGA 3QWYA 2YRVA 4O6JA 4XU1A 3NTKA 4M77G 1TH7A 2LCCA 2DK3A 4EIKA 2RHXA 2EYYA 2K5FA 4KGXB 5EG2A 1VQMT 2XD0A 2X35A 2A0FB 1OYXA 2ROTA 1JJ2A 2RM4A 2FPFA 3CCUT 2BUDA 4BD3A 1XQHA 2E64A 2WACA 4J83A 4NL3A 2RHYA 1JB0E 1ZA2B 2RD1A 1CKBA 2J6KA 4ZGEB 7AT1B 1WFWA 4ZTFA 2DBKA 2ZPEB 3X28B 3V8JA 5I2SA 3UWNA 1UEBA 3FJ5A 2PVDB 1JXMA 2EQIA 2BZ8A 2M9UA 3QIIA 3I5RA 3G71Q 2AHJB 1OEBA 4A53A 2DX1A 2EJ9A 2QEXQ 1ZUKA 1BI3A 1AWJA 2DF6A 4M77C 3QYGB 1UB4A 1M9SA 1K8AC 3CBOA 3GLXA 3MP6A 2DZCA 4CRIA 2L0AA 4QVZA 3M0PA 1B7TA 2L3RA 4M77D 5I11A 2A37A 4YTLA 3TU4K 2HNIA 3OS0A 4E2FB 2RQRA 1X01A 2AK5A 3JCMX 4PFZA 1WHJA 3VKIA 1Y7XA 4C0DB 3CC7A 1VYTA 2CP0A 3NTIA 1R0CB 4E7ZA 2VVKA 3ER0A 1R0BG 3VUBA 3JCMP 2GFUA 2ECZA 2QQAA 4C5HA 2MIOA 2P0QA 2ZCFB 5GAMf 1D3BA 1VIEA 1KC8U 1Q82C 2HD0A 2EYXA 2HMAA 4AT1B 4ELYC 2NLUA 4BDYA 2DTHA 1T0JA 2L3SA 3T9NA 3H41A 4XTXA 4Z02A 2LX7A 2XK0A 1OU8A 1QKWA 3QWXX 3CPWS 4CI0C 4HCKA 3INZA 2LT1A 4ORZA 5LJ5g 1I4K1 4C8QA 4EPCA 3OBWA 5CKEA 4PJOA 2XICA 5GAMh 3JAME 4N0AC 1FWZA 4ZN3A 1WJSA 1VQLA 3RMQA 3HHTB 3EHRA 3LWHA 2CP7A 2BE7D 4RKUE 4CC2A 2KNBB 2EBPA 1W4SA 4DBHA 4C5GA 3M0RA 5GANh 3X26B 5LJ3g 2MWPA 2RHUA 3CCLQ 5D6YA 2K5LA 3SB2A 3UF4A 5IHNA 1GFDA 5GMKh 1UDLA 5FRNA 2CUBA 5KYXA 1KD1C 1SPKA 1SEMA 3TSZA 5GMKi 4EMKA 3MO8A 2JN0A 5LJ3d 1VQPQ 3Q1JA 3CPWA 2LZ6B 2DLPA 3JB9I 4DOWA 3KFVA 3PVLA 1M1GA 3P8BB 2OTJA 1LJOA 2RQWA 4C92E 3V8KA 4M78E 1TS9A 2W0ZA 1BIBA 1VQ4A 1IXDA 4M77B 2QEXT 1NYGA
chains in the Genus database with same CATH topology
1HJDA 1YWOA 2KT8A 1ZX6A 2NWMA 2CREA 1XOVA 2EGAA 2HCKA 4J9DA 2AKKA 4DEYA 2X3WD 3LH5A 2FG0A 2DMOA 1BB9A 1UGVA 1WXTA 1X6BA 1QWFA 2AKLA 2G6FX 2PNIA 4JZ4A 2RN8A 1UJYA 3M0TA 2RQUA 2CH4W 1ZLMA 2YDLA 2ROLA 1GCQC 4F17A 4A63B 2A36A 1AWXA 2ABLA 4FSSA 1X2QA 4J9CA 4J9EA 2VKNA 2KR3A 2GGRA 2MCNA 3RBBB 2QDLA 2DILA 2JMAA 2LQWA 1RUWA 4ESRA 2DRKA 4KRTA 4OMOA 2KE9A 2EVRA 4M4ZA 2PZ1A 3NHNA 5IH2A 2YT6A 2OI3A 5HCKA 1B3QA 2YUOA 4J9IA 1FMKA 1UE9A 2DL4A 3IQLA 3JV3A 1UTIA 4WCIA 1NEBA 2D8HA 2LJ1A 2OAWA 4J9FA 3THKA 4OMLA 2RPNA 2DL3A 3PE0A 1M3BA 2J06A 1NM7A 4IIMA 3O5ZA 1LCKA 1KFZA 2DNUA 2LJ3A 1SHGA 2ED1A 1WI7A 5IHKA 1KIKA 5I22A 2DVJA 1WA7A 2O9VA 2RQTA 1PHTA 1Y57A 5GJVB 4JZ3A 1UJ0A 1SHFA 1VA7A 2EYZA 4K11A 1JXOA 4J9HA 1K0SA 1G2BA 2GTJA 3ULRB 3VS3A 1ZSGA 1X2KA 2C0TA 1T3LA 1SRLA 1VYVA 1T3SA 1YWPA 2FEIA 2CT4A 3NPFA 1B07A 4R0KA 1W70A 4CC3A 1HD3A 2RF0A 2EPDA 2DL5A 2KGTA 2KEAA 1K0XA 3U23A 2DJQA 2DBMA 1GBQA 1SSHA 2J6OA 2KT1A 1WIEA 2KRNA 2LP5A 2BZXA 3TSWA 1YNZA 1M27C 4LNPA 1OPKA 4JJDA 1UECA 1WDXA 1E6HA 2EYWA 4AFUC 1ZUYA 2FO0A 1GCQA 4JPBW 2A08A 1T0HA 2K6DA 2CSQA 2J6FA 1K1ZA 2J05A 2LCSA 1AOJA 2CH4A 2FPEA 1CKAA 1H8KA 1H3HA 2EGEA 1RI9A 1PRMC 1GBRA 1U3OA 1YP5A 4HXJA 4RTZA 1MV0B 1AEYA 3VS7A 1K76A 4AFQC 1ABOA 4X1VA 1PKTA 3A98A 2M51A 1KJWA 2AZSA 4OMMA 1GRIA 2CUDA 1QWEA 4RTUA 2LMJA 3VRYA 2ESWA 1GFCA 1Z9QA 2YSQA 2DRMA 1U5SA 2KBTA 1WYXA 1BK2A 1NEGA 4LE9A 4CC7A 1JEGA 1X27A 1N5ZA 2L3PA 1TUDA 1HSQA 2FRYA 1OOTA 3I35A 2KYMA 4JJBA 1W1FA 1KSWA 5ECAA 2DA9A 4CC4B 1AD5A 1SRMA 3C0CA 3UA7A 4Z88A 2FPDA 1GCPA 4LUEA 2KYBA 1RLPC 1K4US 2CSIA 4OMPA 2KROA 1TG0A 1IO6A 5EC7A 1WXBA 2F2XA 1MV3A 1UHCA 2K2MA 4J9BA 2LNHB 1PNJA 4LN2A 4ZNXA 1UHFA 2DYBA 2W10A 2GNCA 1YN8A 1X69A 2F2WA 2X3XD 5GJWB 2HEQA 1PWTA 4AFZC 4AFSC 1NG2A 4RUGA 3CQTA 2BZYA 3QWYA 3EG3A 1JO8A 1S1NA 2H8HA 2K9GA 1PRLC 2V1QA 2JW4A 1CSKA 2O88A 4EIKA 2K79A 2EYYA 2M0YA 5L23A 2RMOA 2JM9A 2LQNA 2GQIA 3H0HA 4OMNA 2ROTA 2FPFA 2HSPA 2DE0X 1G83A 2YUNA 2YUQA 2KRSA 1CKBA 4Y92A 1AWOA 2CT3A 2J6KA 4JJCA 2DL8A 3NMZC 1BBZA 1RLQC 1WFWA 4AG2C 2CDTA 2DBKA 2I0NA 1ARKA 1I07A 2YUPA 3VRZA 2SRCA 1NLPC 3SHWA 2C0OA 3FJ5A 1JXMA 3VS4A 2XMFA 2EQIA 2E5KA 2BZ8A 1QCFA 2JMCA 1NYFA 3M0SA 3VS5A 1X43A 2DL7A 3SEMA 2MOXA 3I5RA 3UA6A 2JT4A 1UG1A 2GBQA 4DEXA 1OEBA 2DX1A 4OMQA 2SEMA 1ZUKA 1W6XA 1AWJA 1UUEA 1AVZC 2DF6A 3RNJA 1QLYA 3EG1A 4IIOA 4D8DA 2KXCA 1JU5C 4Z89A 2L0AA 1WLPB 3M0PA 1PKSA 3H0IA 1U06A 3VS2A 2RNAA 5I11A 2A37A 4J9GA 2ENMA 2C0IA 2EW3A 4E6RA 1NLOC 5FWCA 2PTKA 2RQRA 1H92A 1E6GA 1AZEA 3M0QA 1AWWA 2D1XA 2AK5A 1E7OA 2RQVA 2KRMA 3I5SA 2JS2A 2ED0A 1VYTA 3UATA 3EGUA 1M8MA 1WXUA 2VVKA 4HVVA 2ECZA 4RTWA 3ZL7C 2FRWA 2MIOA 1EFNA 5IHIA 2F2VA 3NGPA 3TVTA 2V1RA 1A0NB 2EYXA 2L3QA 1GL5A 1M30A 1WX6A 1Y0MA 1T0JA 2L3SA 5FW9A 3R6NA 3EHQA 3H41A 1ZBJA 5IXBA 2D0NA 2O2OA 2LX7A 1QKWA 1K9AA 1VYUA 2L2PA 3QWXX 4HCKA 3I9QA 4LUDA 1Z9ZA 4ORZA 5IXFA 3VS6A 2BTTA 4RTTA 3REBB 2JM8A 2DM1A 2EGCA 1ABQA 2VWFA 1QKXA 2O31A 1M3AA 1UFFA 4D8KA 1YCSB 4HVUA 4F16A 3EHRA 3EG0A 1BU1A 2K3BA 3REAB 4CC2A 2KNBB 1V1CA 3VS0A 4RTVA 1I1JA 2EBPA 4F14A 2A28A 2GTOA 1X6GA 1OV3A 3M0RA 4GLMA 4RTYA 3H0FA 2HBWA 2JXBA 2D8JA 3VS1A 2AZVA 2EKHA 3GBQA 2IIMA 2KXDA 1J3TA 3EG2A 4Z8AA 4AG1C 1AZGB 3UF4A 5IHNA 1GFDA 4HVWA 2LJ0A 2OJ2A 1UDLA 2CUBA 1MUZA 1M3CA 2K7AA 1SPKA 1SEMA 5FWBA 1OPLA 3TSZA 4GBQA 2HDAA 3PVQA 2LZ6B 2DLPA 1FYNA 1I0CA 2JS0A 1TUCA 3M0UA 1ZUUA 3KFVA 3PVLA 4RTXA 2JTEA 2J7IA 2P4RA 2O9SA 2RQWA 2B86A 1JQQA 4QT7A 2W0ZA 2NUZA 1NYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJD A;  1YWO A;  2KT8 A;  1ZX6 A;  2NWM A;  2CRE A;  1XOV A;  2EGA A;  2HCK A;  4J9D A;  2AKK A;  4DEY A;  2X3W D;  3LH5 A;  2FG0 A;  2DMO A;  1BB9 A;  1UGV A;  1WXT A;  1X6B A;  1QWF A;  2AKL A;  2G6F X;  2PNI A;  4JZ4 A;  2RN8 A;  1UJY A;  3M0T A;  2RQU A;  2CH4 W;  1ZLM A;  2YDL A;  2ROL A;  1GCQ C;  4F17 A;  4A63 B;  2A36 A;  1AWX A;  2ABL A;  4FSS A;  1X2Q A;  4J9C A;  4J9E A;  2VKN A;  2KR3 A;  2GGR A;  2MCN A;  3RBB B;  2QDL A;  2DIL A;  2JMA A;  2LQW A;  1RUW A;  4ESR A;  2DRK A;  4KRT A;  4OMO A;  2KE9 A;  2EVR A;  4M4Z A;  2PZ1 A;  3NHN A;  5IH2 A;  2YT6 A;  2OI3 A;  5HCK A;  1B3Q A;  2YUO A;  4J9I A;  1FMK A;  1UE9 A;  2DL4 A;  3IQL A;  3JV3 A;  1UTI A;  4WCI A;  1NEB A;  2D8H A;  2LJ1 A;  2OAW A;  4J9F A;  3THK A;  4OML A;  2RPN A;  2DL3 A;  3PE0 A;  1M3B A;  2J06 A;  1NM7 A;  4IIM A;  3O5Z A;  1LCK A;  1KFZ A;  2DNU A;  2LJ3 A;  1SHG A;  2ED1 A;  1WI7 A;  5IHK A;  1KIK A;  5I22 A;  2DVJ A;  1WA7 A;  2O9V A;  2RQT A;  1PHT A;  1Y57 A;  5GJV B;  4JZ3 A;  1UJ0 A;  1SHF A;  1VA7 A;  2EYZ A;  4K11 A;  1JXO A;  4J9H A;  1K0S A;  1G2B A;  2GTJ A;  3ULR B;  3VS3 A;  1ZSG A;  1X2K A;  2C0T A;  1T3L A;  1SRL A;  1VYV A;  1T3S A;  1YWP A;  2FEI A;  2CT4 A;  3NPF A;  1B07 A;  4R0K A;  1W70 A;  4CC3 A;  1HD3 A;  2RF0 A;  2EPD A;  2DL5 A;  2KGT A;  2KEA A;  1K0X A;  3U23 A;  2DJQ A;  2DBM A;  1GBQ A;  1SSH A;  2J6O A;  2KT1 A;  1WIE A;  2KRN A;  2LP5 A;  2BZX A;  3TSW A;  1YNZ A;  1M27 C;  4LNP A;  1OPK A;  4JJD A;  1UEC A;  1WDX A;  1E6H A;  2EYW A;  4AFU C;  1ZUY A;  2FO0 A;  1GCQ A;  4JPB W;  2A08 A;  1T0H A;  2K6D A;  2CSQ A;  2J6F A;  1K1Z A;  2J05 A;  2LCS A;  1AOJ A;  2CH4 A;  2FPE A;  1CKA A;  1H8K A;  1H3H A;  2EGE A;  1RI9 A;  1PRM C;  1GBR A;  1U3O A;  1YP5 A;  4HXJ A;  4RTZ A;  1MV0 B;  1AEY A;  3VS7 A;  1K76 A;  4AFQ C;  1ABO A;  4X1V A;  1PKT A;  3A98 A;  2M51 A;  1KJW A;  2AZS A;  4OMM A;  1GRI A;  2CUD A;  1QWE A;  4RTU A;  2LMJ A;  3VRY A;  2ESW A;  1GFC A;  1Z9Q A;  2YSQ A;  2DRM A;  1U5S A;  2KBT A;  1WYX A;  1BK2 A;  1NEG A;  4LE9 A;  4CC7 A;  1JEG A;  1X27 A;  1N5Z A;  2L3P A;  1TUD A;  1HSQ A;  2FRY A;  1OOT A;  3I35 A;  2KYM A;  4JJB A;  1W1F A;  1KSW A;  5ECA A;  2DA9 A;  4CC4 B;  1AD5 A;  1SRM A;  3C0C A;  3UA7 A;  4Z88 A;  2FPD A;  1GCP A;  4LUE A;  2KYB A;  1RLP C;  1K4U S;  2CSI A;  4OMP A;  2KRO A;  1TG0 A;  1IO6 A;  5EC7 A;  1WXB A;  2F2X A;  1MV3 A;  1UHC A;  2K2M A;  4J9B A;  2LNH B;  1PNJ A;  4LN2 A;  4ZNX A;  1UHF A;  2DYB A;  2W10 A;  2GNC A;  1YN8 A;  1X69 A;  2F2W A;  2X3X D;  5GJW B;  2HEQ A;  1PWT A;  4AFZ C;  4AFS C;  1NG2 A;  4RUG A;  3CQT A;  2BZY A;  3QWY A;  3EG3 A;  1JO8 A;  1S1N A;  2H8H A;  2K9G A;  1PRL C;  2V1Q A;  2JW4 A;  1CSK A;  2O88 A;  4EIK A;  2K79 A;  2EYY A;  2M0Y A;  5L23 A;  2RMO A;  2JM9 A;  2LQN A;  2GQI A;  3H0H A;  4OMN A;  2ROT A;  2FPF A;  2HSP A;  2DE0 X;  1G83 A;  2YUN A;  2YUQ A;  2KRS A;  1CKB A;  4Y92 A;  1AWO A;  2CT3 A;  2J6K A;  4JJC A;  2DL8 A;  3NMZ C;  1BBZ A;  1RLQ C;  1WFW A;  4AG2 C;  2CDT A;  2DBK A;  2I0N A;  1ARK A;  1I07 A;  2YUP A;  3VRZ A;  2SRC A;  1NLP C;  3SHW A;  2C0O A;  3FJ5 A;  1JXM A;  3VS4 A;  2XMF A;  2EQI A;  2E5K A;  2BZ8 A;  1QCF A;  2JMC A;  1NYF A;  3M0S A;  3VS5 A;  1X43 A;  2DL7 A;  3SEM A;  2MOX A;  3I5R A;  3UA6 A;  2JT4 A;  1UG1 A;  2GBQ A;  4DEX A;  1OEB A;  2DX1 A;  4OMQ A;  2SEM A;  1ZUK A;  1W6X A;  1AWJ A;  1UUE A;  1AVZ C;  2DF6 A;  3RNJ A;  1QLY A;  3EG1 A;  4IIO A;  4D8D A;  2KXC A;  1JU5 C;  4Z89 A;  2L0A A;  1WLP B;  3M0P A;  1PKS A;  3H0I A;  1U06 A;  3VS2 A;  2RNA A;  5I11 A;  2A37 A;  4J9G A;  2ENM A;  2C0I A;  2EW3 A;  4E6R A;  1NLO C;  5FWC A;  2PTK A;  2RQR A;  1H92 A;  1E6G A;  1AZE A;  3M0Q A;  1AWW A;  2D1X A;  2AK5 A;  1E7O A;  2RQV A;  2KRM A;  3I5S A;  2JS2 A;  2ED0 A;  1VYT A;  3UAT A;  3EGU A;  1M8M A;  1WXU A;  2VVK A;  4HVV A;  2ECZ A;  4RTW A;  3ZL7 C;  2FRW A;  2MIO A;  1EFN A;  5IHI A;  2F2V A;  3NGP A;  3TVT A;  2V1R A;  1A0N B;  2EYX A;  2L3Q A;  1GL5 A;  1M30 A;  1WX6 A;  1Y0M A;  1T0J A;  2L3S A;  5FW9 A;  3R6N A;  3EHQ A;  3H41 A;  1ZBJ A;  5IXB A;  2D0N A;  2O2O A;  2LX7 A;  1QKW A;  1K9A A;  1VYU A;  2L2P A;  3QWX X;  4HCK A;  3I9Q A;  4LUD A;  1Z9Z A;  4ORZ A;  5IXF A;  3VS6 A;  2BTT A;  4RTT A;  3REB B;  2JM8 A;  2DM1 A;  2EGC A;  1ABQ A;  2VWF A;  1QKX A;  2O31 A;  1M3A A;  1UFF A;  4D8K A;  1YCS B;  4HVU A;  4F16 A;  3EHR A;  3EG0 A;  1BU1 A;  2K3B A;  3REA B;  4CC2 A;  2KNB B;  1V1C A;  3VS0 A;  4RTV A;  1I1J A;  2EBP A;  4F14 A;  2A28 A;  2GTO A;  1X6G A;  1OV3 A;  3M0R A;  4GLM A;  4RTY A;  3H0F A;  2HBW A;  2JXB A;  2D8J A;  3VS1 A;  2AZV A;  2EKH A;  3GBQ A;  2IIM A;  2KXD A;  1J3T A;  3EG2 A;  4Z8A A;  4AG1 C;  1AZG B;  3UF4 A;  5IHN A;  1GFD A;  4HVW A;  2LJ0 A;  2OJ2 A;  1UDL A;  2CUB A;  1MUZ A;  1M3C A;  2K7A A;  1SPK A;  1SEM A;  5FWB A;  1OPL A;  3TSZ A;  4GBQ A;  2HDA A;  3PVQ A;  2LZ6 B;  2DLP A;  1FYN A;  1I0C A;  2JS0 A;  1TUC A;  3M0U A;  1ZUU A;  3KFV A;  3PVL A;  4RTX A;  2JTE A;  2J7I A;  2P4R A;  2O9S A;  2RQW A;  2B86 A;  1JQQ A;  4QT7 A;  2W0Z A;  2NUZ A;  1NYG A; 
#chains in the Genus database with same CATH topology
 1HJD A;  3QSU A;  1YWO A;  1ZX6 A;  2QGG A;  2CRE A;  1XOV A;  2HCK A;  2X3W D;  2FG0 A;  2ZPB B;  2H3J A;  2AKL A;  2G6F X;  4F7U E;  3I55 T;  1UJY A;  4M75 G;  4QQG A;  3PGG A;  5CQY A;  1VQ8 A;  4M7A G;  1ZLM A;  2YDL A;  4M75 F;  1Q86 C;  3M4G A;  2A36 A;  4JJN K;  4M7A F;  2MMP A;  4J9C A;  4FT4 A;  4MZM A;  1VQ6 Q;  3MP8 A;  5LJ5 h;  2QDL A;  2DIL A;  1K8A U;  1TWB A;  1UGP B;  1RUW A;  5FRM A;  9ATC B;  2COZ A;  3WXM B;  4OMO A;  2RH2 A;  1SG5 A;  1WJQ A;  1S72 A;  4PFP A;  3E2U A;  1I5L A;  4BI8 B;  2OI3 A;  3MEV A;  3OA6 A;  1GXI E;  3CD6 A;  3QDF A;  1PD1 A;  4IUT A;  4HT8 A;  2OAW A;  3THK A;  1NJI U;  4J6W A;  4PKC C;  2ZPH B;  2DL3 A;  3FEO A;  4BI3 A;  3PE0 A;  3JCM e;  3CCS Q;  2V26 A;  3R6O A;  5GAN 4;  4A4F A;  1Q82 U;  1KIK A;  2E10 A;  1NBE B;  2O9V A;  3O8V A;  3HFO A;  1UJ0 A;  3EGX B;  1YJN Q;  1LPL A;  2DZ9 A;  4K11 A;  5DLQ E;  3JCM Q;  1G2B A;  1KG1 A;  3VS3 A;  3OYF A;  3JB9 G;  1Y96 B;  3M59 A;  1Q95 G;  1VYV A;  1D09 B;  1YWP A;  3NPF A;  1RL2 A;  1B07 A;  3CCL T;  2CZ1 B;  3PIP A;  4R0K A;  2R5A A;  3CMA Q;  3SWN A;  2VXF A;  1QP2 A;  4DA4 A;  2G3R A;  5KYN A;  2KGT A;  3U23 A;  2O01 E;  4MMK A;  1MNE A;  2ZPI B;  2RI3 A;  4MZT A;  4FU6 A;  1WIE A;  1VQP T;  1ZSZ C;  1OPK A;  2X51 A;  1WDX A;  2WSE E;  2QDY B;  1ZUY A;  2LDM A;  1GCQ A;  1BI0 A;  4JUV A;  1T0H A;  2K6D A;  2LCS A;  2J05 A;  2JTM A;  2CH4 A;  3GOX A;  2PUK B;  1U3O A;  1FMW A;  3VS7 A;  4AFQ C;  1ABO A;  1VQN A;  3QO3 A;  2EYQ A;  1QWE A;  3HKS A;  4QVD A;  2E6Z A;  1WHH A;  1U5S A;  5L8R E;  3VV0 A;  2KBT A;  1WYX A;  2FZC B;  1NPP A;  3JB9 D;  3QZ5 B;  1G3T A;  4J6Y A;  3PT9 A;  4CC7 A;  1D1B A;  4WTO B;  1TUD A;  4FW1 A;  4EMG A;  1VQ6 T;  1OOT A;  3I35 A;  3CCQ A;  4JJB A;  3G6E A;  4HCZ A;  5ECA A;  4C8Q E;  1VQ9 Q;  4F04 B;  4PJO E;  4EMH A;  2MI6 A;  5KE2 A;  2XDD A;  4OMP A;  2KRO A;  1TG0 A;  1OUL A;  4RCB A;  2CZ6 B;  1MV3 A;  1UHC A;  1G5V A;  5A2Q E;  3A8G B;  2L8D A;  2F2W A;  1KHC A;  2JNG A;  4HCB A;  1VQK A;  1ZQ1 A;  4GY5 A;  3A8O B;  4QQ6 A;  1JO8 A;  1S1N A;  2H8H A;  3CCS T;  3QJ6 A;  1PRL C;  2V1Q A;  4BDZ A;  2P4T A;  2JW4 A;  3CCE Q;  4E7I A;  4MDW A;  3CEY A;  4LDV A;  4RG2 A;  1KD1 R;  1RAE B;  5L23 A;  3KUF A;  3OW2 S;  1FMV A;  2GQI A;  1YJN T;  4ATO A;  4MZP A;  2EJG A;  3UPU A;  1Q81 R;  2YUN A;  2YUQ A;  1X75 C;  1M1K C;  2KRS A;  3C12 A;  3NMZ C;  1IHW A;  1RLQ C;  3E9F A;  4OB1 B;  2I0N A;  1RAI B;  3OYC A;  1I07 A;  2NYS A;  3RDV A;  2OTL A;  2EQK A;  1MMD A;  2SRC A;  3CMA T;  1YHQ A;  1NLP C;  1TXQ A;  2ZGW A;  3I56 Q;  2Y4X A;  3BE3 A;  5IT9 E;  4KBM B;  4BY6 C;  2E5K A;  1ZSZ B;  2JMC A;  3EH1 A;  3VS5 A;  1X43 A;  3SEM A;  1N9R A;  3UA6 A;  1UG1 A;  4DEX A;  4C92 G;  2HL5 C;  4M78 G;  4OMQ A;  3HL8 A;  5FRO A;  1Q86 R;  2DTI A;  4C92 F;  1YI2 A;  2HZY A;  1UUE A;  1AVZ C;  3VYH B;  4RMO A;  3RNJ A;  4C0F A;  1EIF A;  2JJ9 A;  1D0Z A;  5HKC A;  4Z89 A;  1WLP B;  3L2Q A;  3H0I A;  1U06 A;  2X4Y A;  1YIJ Q;  4F7U G;  3CXC S;  3CC2 A;  3C4S A;  1K9M R;  2GQV A;  2KMT A;  3CCV Q;  3M0Q A;  1AWW A;  3G4S Q;  4C0D C;  3CC7 Q;  3RUX A;  3L2R A;  3QHS A;  2R57 A;  1OX9 A;  2RJF A;  2DXB A;  1N27 A;  3CPF A;  1G3W A;  3E9G A;  1FXX A;  3ZL7 C;  2RA2 A;  5IHI A;  3PMT A;  2DXU A;  2DER A;  2CS7 A;  1GL5 A;  1DJ7 B;  3QXE B;  1VQ9 T;  4LDX A;  3QG1 A;  2NUT B;  2HQH A;  1Y0M A;  4M7D C;  3EHQ A;  1ZBJ A;  3TCJ A;  5IXB A;  2E6N A;  1M2V B;  4FT2 A;  3JCM b;  1K9A A;  4XU2 A;  4A4K A;  2HSE B;  4LUD A;  4BE2 A;  1G3S A;  4M7D D;  3CBM A;  4J7I A;  1YCY A;  2K4Y A;  3CXC A;  1VQL Q;  1R77 A;  5C6S A;  2QQS A;  1N8R C;  4JRP A;  1IGU A;  5KYU B;  1QKX A;  1PM3 A;  1OI1 A;  1M3A A;  1UFF A;  3CCE T;  4HVU A;  4F16 A;  1BU1 A;  5GAO n;  8AT1 B;  1MMA A;  1K73 R;  3PIO A;  1V1C A;  4RTV A;  4F14 A;  2A28 A;  1X6G A;  3LYI A;  1OV3 A;  3EFO B;  2FZG B;  2HBW A;  4PNO A;  1VQM A;  5GAM g;  2AZV A;  2IG0 A;  3JB9 J;  3GBQ A;  2IIM A;  3CCU A;  3EG2 A;  3QPH A;  4J6X A;  2KQW A;  4M77 A;  1MUZ A;  2K7A A;  5FWB A;  3PMI A;  3CCR Q;  4GBQ A;  3I56 T;  5GAM d;  4BY6 B;  2HKQ B;  2RJE A;  3EFS A;  1AHJ B;  3FIF A;  5GAN g;  3M4Y A;  5LL6 S;  4ZN1 A;  1YIT Q;  2JS0 A;  2OTJ Q;  2VYT A;  1ZUU A;  3FDR A;  5FU7 C;  2JTE A;  4L5G A;  2J7I A;  5CO7 A;  1O75 A;  2P4R A;  2QTV A;  2DFU A;  5CK9 A;  1M1K U;  3HSB A;  1BI2 A;  5KE3 A;  2JTF A;  3L2W A;  5GAN d;  2KT8 A;  2HAX A;  1OX8 A;  4RG8 A;  2AKK A;  1PSF A;  4JRK A;  1WXT A;  3DKM A;  1X6B A;  4JZ4 A;  4E7K A;  2RN8 A;  3M0T A;  1YIJ T;  2RQU A;  1QVF S;  2CH4 W;  1NJI C;  4R55 A;  3H9N A;  4F17 A;  3CCV T;  1OZ2 A;  2E12 A;  3QZ9 B;  4FW2 A;  3G4S T;  1AWX A;  4FSS A;  4J9E A;  1UGR B;  2VKN A;  3JCM f;  2YXY A;  1W2B S;  5HK0 A;  3JSC A;  2DXT A;  1M2O A;  3H8Z A;  4KRT A;  4A4E A;  2DIQ A;  2EVR A;  4PJO G;  3J80 E;  1YJ9 Q;  4C8Q F;  5GAN 7;  4N0A A;  5IH2 A;  2YT6 A;  4DBR A;  2LRQ A;  4PJO F;  3ASK A;  4J5Y A;  4M7D B;  3QUI A;  1NEB A;  3EGX A;  3JCM h;  3GIB A;  1KQS S;  2MYS A;  2K5I A;  1M3B A;  3MEU A;  1LCK A;  1I5O B;  1Y96 A;  4X9D A;  1LOJ A;  1D0X A;  1QVF A;  5J26 A;  1P92 A;  2DXC A;  2ED1 A;  6AT1 B;  1HYO A;  5IHK A;  5LJ5 d;  2VXE A;  1WA7 A;  2RQT A;  2LQ8 A;  3OW2 P;  4LXC A;  5GJV B;  4JZ3 A;  3UDC A;  3CME A;  1VQ5 Q;  4E7S A;  4J9H A;  1K0S A;  1W2B A;  2RJC A;  3OYD A;  1ZSG A;  2FZK B;  1RAH B;  2C0T A;  3L2Z A;  3CCJ A;  1T3L A;  4HKE A;  2JZ2 A;  1T3S A;  2EQU A;  4FSX A;  3KXT A;  1M90 C;  2L89 A;  2P0K A;  4CC3 A;  1HD3 A;  2RF0 A;  3FC3 A;  1N8R U;  4OB3 B;  4KUD K;  1KC8 R;  3RIR A;  3WVE B;  1QVG S;  1K0X A;  1BI1 A;  2DBM A;  3CCM Q;  1GBQ A;  3V7R A;  3CCR T;  2YLB A;  1NPR A;  5CKH A;  1KQS A;  2FYK A;  1YNZ A;  3G71 T;  1IHV A;  4KT0 E;  4XTV A;  5FU7 B;  4ANJ A;  1YIT T;  2COW A;  2OTJ T;  1XNI A;  2RB6 A;  3LW5 E;  4AFU C;  3EGD B;  4QKU A;  2PVG B;  4JPB W;  3FLG A;  4P5N A;  3HP9 A;  2QQ9 A;  1MMN A;  4L6V 5;  3GPL A;  4OB2 B;  2CSQ A;  3SFM A;  1CKA A;  3J7A F;  1RI9 A;  1FX7 A;  2QEX A;  2BKD N;  5KYW B;  4HXJ A;  4RTZ A;  1G8X A;  3CXC P;  2HQX A;  1Q7Y C;  3A98 A;  2M51 A;  4OVA A;  1KJW A;  2AZS A;  2QI2 A;  4B6M A;  1GRI A;  1JJ2 P;  5GAN 8;  3VRY A;  2ESW A;  1GFC A;  1Z9Q A;  2YSQ A;  3AT1 B;  3I55 A;  1PCX A;  3BFM A;  1QVG A;  1PD0 A;  4OGE A;  1X27 A;  3G6E Q;  1N5Z A;  3HRS A;  2FRY A;  2DJZ A;  3AHU A;  4A4H A;  4KH1 B;  4LD6 A;  3QDR B;  3TQ7 P;  1TU0 B;  2DEU A;  3OQ5 A;  4CC4 B;  4LDY A;  1AD5 A;  1SRM A;  5LJ3 f;  4HCC A;  1YJ9 T;  1QVP A;  4AMC A;  2KYB A;  5A0G A;  5D7U A;  2VB6 A;  5GAO q;  2V8I A;  2D6F A;  2CSI A;  3PNW C;  1NE8 A;  3E19 A;  5HK3 A;  1MGQ A;  1WXB A;  2F2X A;  4A4G A;  3KBG A;  2DYB A;  4GLK A;  2GNC A;  1YN8 A;  1X69 A;  2I2L A;  2X3X D;  5GJW B;  4AFS C;  3E1S A;  3CQT A;  4M75 C;  3EG3 A;  1RAG B;  2K2V A;  2VV5 A;  3M55 A;  1M4Z A;  4Y28 E;  4M7A C;  2K9G A;  1G3Y A;  1X6O A;  1CSK A;  2HL3 A;  4NS5 A;  4JDS A;  2M0Y A;  1YBY A;  4M75 D;  2RMO A;  4M77 E;  4MDX A;  3D7S B;  2AT1 B;  4M7A D;  2C06 A;  3EAE A;  1QW1 A;  1VQ5 T;  2DE0 X;  2DYI A;  4IUU A;  2QA4 Q;  1ZSZ A;  1YJW A;  2VUB A;  5J3B A;  1VQO Q;  2PVO B;  1AWO A;  1WJR A;  5KYY B;  3QYH B;  4JJC A;  2DTO A;  3MKD A;  2EFI A;  1BBZ A;  3HRT A;  4OP0 A;  3RR6 A;  2CYZ B;  2KK4 A;  1K8A R;  2YUP A;  3VRZ A;  2FHD A;  3HRU A;  4N4H A;  2C0O A;  3CCL A;  1RAF B;  3VS4 A;  2XMF A;  1TTH B;  3OS1 A;  1QCF A;  4FL6 A;  3CCM T;  1ZA1 B;  1OQK A;  1NYF A;  2DL7 A;  2LCL A;  2MOX A;  2JT4 A;  2GBQ A;  3NFC A;  4JLG A;  4VUB A;  1VQP A;  1NJI R;  4IKF A;  1W6X A;  1M8V A;  5LJ3 j;  1M90 U;  2DKG A;  2CP2 A;  1BCO A;  1QLY A;  4FYX B;  4XTY A;  4IIO A;  1RAD B;  3P8D A;  2V8J A;  4D8D A;  2KXC A;  1Q82 R;  3M5A A;  3VS2 A;  2RNA A;  2EW3 A;  1QVF P;  3L2U A;  2QK0 A;  1H92 A;  5CIU A;  3S6W A;  2M1H A;  2XHC A;  1E7O A;  2NUT A;  3TRE A;  4JS5 A;  4ELZ C;  1IGQ A;  1WGS A;  2KRM A;  3I5S A;  1VIF A;  3UAT A;  2B8A A;  3EGU A;  1C0M A;  3MP1 A;  1M2V A;  3CC4 Q;  4HVV A;  5CKF A;  3L2V A;  1VQ7 Q;  4RTW A;  3G6E T;  2QG9 B;  2F2V A;  2NUP B;  3NGP A;  3OY9 A;  3TVT A;  3QKJ A;  1A0N B;  4IUP A;  1D0Y A;  1XTD A;  2KAF A;  2L3Q A;  4BAC A;  1Q7Y U;  1M30 A;  1VQ6 A;  1WX6 A;  5M9O A;  1F1B B;  5CAI A;  3CPW P;  1SF9 A;  5J39 A;  5KYU A;  2D0N A;  2O2O A;  2XDP A;  3HPW A;  2L2P A;  1VYU A;  4C5I A;  3I9Q A;  3OYI A;  4BI4 A;  1Z9Z A;  3EFO A;  2KY9 A;  1U8R A;  1KHI A;  4M75 B;  1LVK A;  2COY A;  3OYL A;  4X34 A;  4M7A B;  3OYJ A;  4RTT A;  1QMC A;  3S3O A;  4D6W A;  5GAN 2;  5LJ3 e;  2JM8 A;  4BB7 A;  2DEQ A;  2DM1 A;  2EGC A;  1ABQ A;  2ZAE A;  1SSF A;  3CCS A;  5KCH A;  1YCS B;  1M1F A;  5GAN 5;  2K3B A;  2CKK A;  3VS0 A;  1VQM Q;  3JCM c;  4GLM A;  3EH2 A;  2JXB A;  3VS1 A;  3VJP A;  2QA4 T;  2EKH A;  4KUI A;  3LLR A;  4PLI A;  4Z8A A;  1VQO T;  3SD4 A;  1AZG B;  2F5T X;  5I2M A;  2Z0W A;  1QVG P;  2P84 A;  1OPL A;  1WHL A;  2MPX C;  3V8L A;  2RHZ A;  2LT4 A;  1FYN A;  4XU0 A;  3M0U A;  4RTX A;  3JCM V;  4N4G A;  3RER A;  2LX9 A;  4O5V A;  2B86 A;  1JQQ A;  4QT7 A;  3FJP A;  1BCM A;  1OU9 A;  1AT1 B;  3SDZ A;  4LDW A;  4HA8 A;  2DMO A;  2X4X A;  1QWF A;  4BUG A;  4M7D F;  3VUZ A;  3L42 A;  1R8O B;  2EJF A;  1EX4 A;  2YHT A;  2WSC E;  1NZ9 A;  1QP3 A;  2ABL A;  1X2Q A;  4M7D A;  1C6V X;  1BKB A;  1O9S A;  2RO0 A;  3EFR A;  3M58 A;  4E47 A;  3OSS C;  1WHK A;  3RBB B;  3CC4 T;  2JMA A;  2LQW A;  2DIG A;  2DRK A;  1VQ7 T;  4HT9 A;  2KE9 A;  2GCX A;  2P0P A;  4C92 C;  4M78 C;  4M4Z A;  3NHN A;  4XU3 A;  1JBM A;  4PLL A;  4C5E A;  1B3Q A;  2YUO A;  4LDU A;  2E1H A;  1UE9 A;  2MK5 A;  1PSE A;  2ZZD A;  3FB9 A;  4C92 D;  1MND A;  3JV3 A;  3OYN A;  4M78 D;  4WCI A;  4J9F A;  2FB7 A;  2K3Y A;  2EQM A;  2RPN A;  2XU8 A;  1IB8 A;  2KDS A;  1NM7 A;  5IAY A;  2CGH A;  3L1A A;  4IIM A;  3GF5 A;  4XAX B;  2IVW A;  1KFZ A;  2DNU A;  3OYG A;  2CP6 A;  1WI7 A;  5I22 A;  2DVJ A;  3CME Q;  1WZO A;  1Y57 A;  2RK1 A;  3BW1 A;  1SHF A;  1VA7 A;  2EYZ A;  3OBY A;  5DM7 R;  3JCM g;  1B34 B;  4M77 F;  2E65 A;  3CCJ Q;  2PUO B;  1BYM A;  2YLC A;  4LD9 K;  3CCE A;  1X2K A;  1MMG A;  5CVI A;  2FEI A;  1I81 A;  2M0O A;  5CCA A;  5I21 A;  2QGF B;  3ZBD A;  3EGD A;  3JCM d;  2WSF E;  3V7C A;  3OYA A;  2QQR A;  4DOV A;  2DJQ A;  2J6O A;  2KT1 A;  1QCN A;  1Y07 A;  2LP5 A;  1VQ4 Q;  5KYW A;  2M02 A;  2BZX A;  3NTH A;  4C0G A;  3I56 A;  1YFN A;  1UEC A;  3C95 A;  2EYW A;  5CQX A;  4PJN A;  3JB9 H;  2J6F A;  3MEA A;  2Y90 A;  3C94 A;  2DD5 A;  2FPE A;  1H8K A;  2F5K A;  3G7Z A;  2EGE A;  4XQ3 A;  1VQ8 Q;  3EG9 B;  1PRM C;  1I8F A;  1AEY A;  1YP5 A;  1MV0 B;  2O4X B;  3M54 A;  1PC0 A;  3F70 A;  4X1V A;  1PKT A;  3RKW A;  3H6Z A;  3I55 Q;  3S3M A;  3CC7 T;  4OMM A;  4RTU A;  2FL7 A;  3MHX A;  4E7J A;  3OB9 A;  2DRM A;  2VGN A;  1YIJ A;  5AT1 B;  2RI5 A;  1U1T A;  1S72 Q;  1BK2 A;  4ME7 A;  4C8Q G;  3CCV A;  3OMC A;  3G4S A;  2LC4 A;  3A8L B;  2E3I A;  2ZPF B;  2VAS A;  4QW2 A;  3CD6 Q;  5GAN 6;  4A54 A;  4C92 B;  4M78 B;  1HXD A;  4PFO A;  1RI0 A;  3C0C A;  3QJY A;  4Z88 A;  4XTU A;  1UGS B;  5A0L A;  1GCP A;  3M9Q A;  3VU3 C;  4KGZ B;  3M57 A;  2AIR B;  3A5Z B;  2ATC B;  3UT1 A;  4J9B A;  2Y4Y A;  1PNJ A;  4LN2 A;  1UHF A;  2X4W A;  1M1K R;  4F7U B;  3JCM J;  4BE0 A;  1PWT A;  4AFZ C;  4KGV B;  2EAY A;  5GAN f;  2BZY A;  1VQL T;  2RJD A;  5KYY A;  2DET A;  3OYH A;  2O88 A;  2QAS A;  2K79 A;  4X9C A;  3VYG A;  1IZ6 A;  3CME T;  3BY7 A;  4PL6 A;  2JM9 A;  2LQN A;  5GAO l;  2JUF A;  3H0H A;  4OMN A;  1WHM A;  1YJW Q;  3PTA A;  3CCJ T;  3CBP A;  4FYV B;  1H64 1;  2HSP A;  4RCC A;  4C8Q C;  1G83 A;  2CP3 A;  2LNV A;  4Y92 A;  4PJO C;  4L59 A;  3URG A;  4KUL A;  2CT3 A;  3ME9 A;  1IRX A;  3LWI A;  2DL8 A;  5IN1 A;  4AG2 C;  5CKB A;  2CDT A;  5KCO A;  3PFS A;  1ARK A;  1D1A A;  4II1 A;  2EIF A;  4C8Q D;  2HKN A;  4FIB A;  3SHW A;  4PJO D;  4QQD A;  3ZEH A;  3JCM W;  2RI2 A;  2D9T A;  3M0S A;  2CP5 A;  1VQ4 T;  2L5Q A;  2GFA A;  3CCR A;  1PG5 B;  1Q81 C;  2SEM A;  3G71 A;  2IPO B;  1YIT A;  5GAM j;  1OZ3 A;  2R5M A;  1VQN Q;  3EG1 A;  4EMK C;  4M7D E;  2LQK A;  1JU5 C;  1TSF A;  1PKS A;  5LJ5 f;  1VQ8 T;  3OMG A;  3RES A;  4J9G A;  5FU6 C;  2ENM A;  2C0I A;  2RK2 A;  2H3E B;  2NUP A;  2VC8 A;  2XID A;  4E6R A;  4E7L A;  1NLO C;  5FWC A;  2PTK A;  4JRI A;  4NL2 A;  5GAN j;  1E6G A;  3LH0 A;  1AZE A;  2D1X A;  2K3X A;  3GNF B;  2E70 A;  2X4J A;  3CCQ Q;  2RQV A;  4Q5W A;  4B9W A;  2JS2 A;  2ED0 A;  1M8M A;  4PJJ A;  4XK8 E;  5GMK j;  1WXU A;  1WNL A;  1S72 T;  3X20 B;  4DBF A;  2DPP B;  2FRW A;  1EFN A;  4IUR A;  4IUQ A;  1N8R R;  1WQ7 A;  1ACM B;  4M75 A;  2V1R A;  5A0D A;  3CD6 T;  3FRN A;  4M7A A;  5DLO A;  3OYM A;  1K9M C;  1VQK Q;  1WPY A;  5FW9 A;  3R6N A;  3HTR A;  1YJ9 A;  1RAC B;  4FM4 B;  4TVR A;  1IRE B;  2QQB A;  3TEE A;  3RKX A;  2KSS A;  1D3B B;  2E5Q A;  3X24 B;  5IXF A;  3X25 B;  4FYW B;  4BE1 A;  2DD4 A;  4DBQ A;  2MAM A;  2RHI A;  5LJ3 h;  3VS6 A;  2BTT A;  2LTO A;  3REB B;  3DLM A;  5CR2 A;  5GAM e;  2X9H A;  3G1J A;  2BE9 B;  1TOV A;  2QXF A;  3OYB A;  2A3L A;  3MPU B;  2VWF A;  2O31 A;  3GP8 A;  4D8K A;  3N5B B;  4Y91 A;  3EG0 A;  3REA B;  3J81 E;  3A8M B;  1RAA B;  1I1J A;  3A1P A;  2GTO A;  1BIA A;  1LNX A;  4C8Q B;  5GAO r;  1YJW T;  2OTL Q;  4RTY A;  3H0F A;  4JLI A;  1YHQ Q;  5GMK l;  2D8J A;  4PJO B;  5GAN e;  5LJ5 j;  2PU9 B;  2MWO A;  1VQ5 A;  2KXD A;  1J3T A;  3OYK A;  4AG1 C;  2PQW A;  3HFN A;  4HVW A;  2LJ0 A;  2OJ2 A;  3JB9 F;  2LVM A;  5GMK e;  1M3C A;  4XTZ A;  4KH0 B;  1M5Q 1;  2JOY A;  4MML A;  3OYE A;  2E4H A;  2HDA A;  2OAU A;  3PVQ A;  1YI2 Q;  1K73 C;  1I0C A;  4ZTJ A;  1N9S A;  1TUC A;  1QCO A;  3DB4 A;  3V7S A;  2O9S A;  4QVC A;  3CCM A;  2E41 A;  1KK7 A;  5GAO m;  1Y71 A;  3SWN C;  3OYY A;  2CZ0 B;  2XDB A;  2NUZ A;  1ZBX A;  2F69 A;  5KYX B;  2EWN A;  3CC2 Q;  2V8K A;  4EMK B;  2NWM A;  5D6X A;  2M16 A;  4PJM A;  2EGA A;  4J9D A;  5FLX E;  4DEY A;  1VQN T;  3LH5 A;  5D6W A;  1V76 A;  2DAQ A;  1BB9 A;  3A8H B;  2HQE A;  1UGV A;  2JVV A;  5FU6 B;  1KD1 U;  2PNI A;  2XI9 A;  8ATC B;  1N6A A;  2R58 A;  3M53 A;  4PK4 A;  2ROL A;  1GCQ C;  1W2B P;  1RAB B;  4A63 B;  1Q81 U;  1C1A A;  3JRZ A;  1KQ1 A;  2DVE A;  2ZPG B;  3CCQ T;  2KR3 A;  2GGR A;  2GF7 A;  2MCN A;  5LJ5 e;  1QQJ A;  4ESR A;  2DO3 A;  1WHG A;  2KI7 A;  2PZ1 A;  4OF1 A;  5HY6 A;  3OS2 A;  5HCK A;  4J9I A;  2YWW A;  1FMK A;  2DL4 A;  3IQL A;  1KQS P;  3MCA B;  2OX7 A;  1UTI A;  1U1S A;  4PJL A;  2D8H A;  2LJ1 A;  1VQK T;  4OML A;  1B34 A;  2EQJ A;  1Q86 U;  1ZHI A;  2J06 A;  1M90 R;  3O5Z A;  2LJ3 A;  2KVQ G;  4C0Z A;  1SHG A;  4XTW A;  2K57 A;  3M56 A;  4B9X A;  1H3Z A;  1PHT A;  2YRC A;  1KQ2 A;  3GNG A;  1K9M U;  3LX7 A;  3CCU Q;  1JXO A;  2GTJ A;  3ULR B;  3P8H A;  1YJN A;  2EKO A;  1SRL A;  1JRI A;  4IUV A;  1VOM A;  5GAN 3;  2MF2 A;  2OTL T;  2CT4 A;  1YHQ T;  2QTX A;  2HBP A;  2BIV A;  1W70 A;  3BDU A;  2QA4 A;  2EPD A;  3LGF A;  4ZGD B;  2DL5 A;  4UC4 A;  1VQO A;  2KEA A;  3CMA A;  5DY9 A;  1Q7Y R;  1SSH A;  2XG8 D;  1XJW B;  2YRD A;  3EG9 A;  5AYF A;  3RMS A;  3WVD B;  2KRN A;  4R56 A;  2VGM A;  2E3H A;  4JS4 A;  3TSW A;  1D1C A;  4OB0 B;  2O4X A;  1EZZ B;  3MET A;  3MEW A;  1M27 C;  1YI2 T;  4LNP A;  4JJD A;  1MHN A;  3ZFJ A;  1E6H A;  2FO0 A;  4OMF B;  5CKD A;  3SWN B;  3S3N A;  4DQ2 A;  2A08 A;  3DB3 A;  3RKY A;  4ZGJ B;  1K1Z A;  1AOJ A;  4EDU A;  4JRQ A;  4M7D G;  1WQW A;  4NOY A;  4M78 F;  5C0M A;  2XKO C;  3BDL A;  5GMK m;  4FCY A;  1H3H A;  4N4I A;  3CC2 T;  1GBR A;  1KC8 C;  2FVU A;  2QAZ A;  1K76 A;  3OW2 A;  2QYZ A;  4J7F A;  1K73 U;  4C92 A;  1UGQ B;  4M78 A;  2CZ7 B;  4M75 E;  2D0Q B;  2CUD A;  3OSV A;  2A7Y A;  1V29 B;  3DLL A;  2LMJ A;  4M7A E;  5GAO p;  4F7U F;  4WF2 A;  3MJX A;  1NEG A;  4V2S A;  4E7H A;  4LE9 A;  1JJ2 S;  1JEG A;  2L3P A;  1HSQ A;  3OS5 A;  4OGC A;  4F7U A;  2KYM A;  1W1F A;  1KSW A;  2DA9 A;  1VUB A;  4FYY B;  4J8O A;  1SKU B;  1TUG B;  3LGL A;  3CC4 A;  3UA7 A;  2FPD A;  1VQ9 A;  1VQ7 A;  4LUE A;  5KH6 A;  1RLP C;  1K4U S;  2F1L A;  1IO6 A;  5EC7 A;  2K2M A;  2LNH B;  4ZNX A;  2W10 A;  3QBY A;  2HEQ A;  1HK9 A;  1NG2 A;  4RUG A;  3QWY A;  2YRV A;  4O6J A;  4XU1 A;  3NTK A;  4M77 G;  1TH7 A;  2LCC A;  2DK3 A;  4EIK A;  2RHX A;  2EYY A;  2K5F A;  4KGX B;  5EG2 A;  1VQM T;  2XD0 A;  2X35 A;  2A0F B;  1OYX A;  2ROT A;  1JJ2 A;  2RM4 A;  2FPF A;  3CCU T;  2BUD A;  4BD3 A;  1XQH A;  2E64 A;  2WAC A;  4J83 A;  4NL3 A;  2RHY A;  1JB0 E;  1ZA2 B;  2RD1 A;  1CKB A;  2J6K A;  4ZGE B;  7AT1 B;  1WFW A;  4ZTF A;  2DBK A;  2ZPE B;  3X28 B;  3V8J A;  5I2S A;  3UWN A;  1UEB A;  3FJ5 A;  2PVD B;  1JXM A;  2EQI A;  2BZ8 A;  2M9U A;  3QII A;  3I5R A;  3G71 Q;  2AHJ B;  1OEB A;  4A53 A;  2DX1 A;  2EJ9 A;  2QEX Q;  1ZUK A;  1BI3 A;  1AWJ A;  2DF6 A;  4M77 C;  3QYG B;  1UB4 A;  1M9S A;  1K8A C;  3CBO A;  3GLX A;  3MP6 A;  2DZC A;  4CRI A;  2L0A A;  4QVZ A;  3M0P A;  1B7T A;  2L3R A;  4M77 D;  5I11 A;  2A37 A;  4YTL A;  3TU4 K;  2HNI A;  3OS0 A;  4E2F B;  2RQR A;  1X01 A;  2AK5 A;  3JCM X;  4PFZ A;  1WHJ A;  3VKI A;  1Y7X A;  4C0D B;  3CC7 A;  1VYT A;  2CP0 A;  3NTI A;  1R0C B;  4E7Z A;  2VVK A;  3ER0 A;  1R0B G;  3VUB A;  3JCM P;  2GFU A;  2ECZ A;  2QQA A;  4C5H A;  2MIO A;  2P0Q A;  2ZCF B;  5GAM f;  1D3B A;  1VIE A;  1KC8 U;  1Q82 C;  2HD0 A;  2EYX A;  2HMA A;  4AT1 B;  4ELY C;  2NLU A;  4BDY A;  2DTH A;  1T0J A;  2L3S A;  3T9N A;  3H41 A;  4XTX A;  4Z02 A;  2LX7 A;  2XK0 A;  1OU8 A;  1QKW A;  3QWX X;  3CPW S;  4CI0 C;  4HCK A;  3INZ A;  2LT1 A;  4ORZ A;  5LJ5 g;  1I4K 1;  4C8Q A;  4EPC A;  3OBW A;  5CKE A;  4PJO A;  2XIC A;  5GAM h;  3JAM E;  4N0A C;  1FWZ A;  4ZN3 A;  1WJS A;  1VQL A;  3RMQ A;  3HHT B;  3EHR A;  3LWH A;  2CP7 A;  2BE7 D;  4RKU E;  4CC2 A;  2KNB B;  2EBP A;  1W4S A;  4DBH A;  4C5G A;  3M0R A;  5GAN h;  3X26 B;  5LJ3 g;  2MWP A;  2RHU A;  3CCL Q;  5D6Y A;  2K5L A;  3SB2 A;  3UF4 A;  5IHN A;  1GFD A;  5GMK h;  1UDL A;  5FRN A;  2CUB A;  5KYX A;  1KD1 C;  1SPK A;  1SEM A;  3TSZ A;  5GMK i;  4EMK A;  3MO8 A;  2JN0 A;  5LJ3 d;  1VQP Q;  3Q1J A;  3CPW A;  2LZ6 B;  2DLP A;  3JB9 I;  4DOW A;  3KFV A;  3PVL A;  1M1G A;  3P8B B;  2OTJ A;  1LJO A;  2RQW A;  4C92 E;  3V8K A;  4M78 E;  1TS9 A;  2W0Z A;  1BIB A;  1VQ4 A;  1IXD A;  4M77 B;  2QEX T;  1NYG A; 
#chains in the Genus database with same CATH homology
 1HJD A;  1YWO A;  2KT8 A;  1ZX6 A;  2NWM A;  2CRE A;  1XOV A;  2EGA A;  2HCK A;  4J9D A;  2AKK A;  4DEY A;  2X3W D;  3LH5 A;  2FG0 A;  2DMO A;  1BB9 A;  1UGV A;  1WXT A;  1X6B A;  1QWF A;  2AKL A;  2G6F X;  2PNI A;  4JZ4 A;  2RN8 A;  1UJY A;  3M0T A;  2RQU A;  2CH4 W;  1ZLM A;  2YDL A;  2ROL A;  1GCQ C;  4F17 A;  4A63 B;  2A36 A;  1AWX A;  2ABL A;  4FSS A;  1X2Q A;  4J9C A;  4J9E A;  2VKN A;  2KR3 A;  2GGR A;  2MCN A;  3RBB B;  2QDL A;  2DIL A;  2JMA A;  2LQW A;  1RUW A;  4ESR A;  2DRK A;  4KRT A;  4OMO A;  2KE9 A;  2EVR A;  4M4Z A;  2PZ1 A;  3NHN A;  5IH2 A;  2YT6 A;  2OI3 A;  5HCK A;  1B3Q A;  2YUO A;  4J9I A;  1FMK A;  1UE9 A;  2DL4 A;  3IQL A;  3JV3 A;  1UTI A;  4WCI A;  1NEB A;  2D8H A;  2LJ1 A;  2OAW A;  4J9F A;  3THK A;  4OML A;  2RPN A;  2DL3 A;  3PE0 A;  1M3B A;  2J06 A;  1NM7 A;  4IIM A;  3O5Z A;  1LCK A;  1KFZ A;  2DNU A;  2LJ3 A;  1SHG A;  2ED1 A;  1WI7 A;  5IHK A;  1KIK A;  5I22 A;  2DVJ A;  1WA7 A;  2O9V A;  2RQT A;  1PHT A;  1Y57 A;  5GJV B;  4JZ3 A;  1UJ0 A;  1SHF A;  1VA7 A;  2EYZ A;  4K11 A;  1JXO A;  4J9H A;  1K0S A;  1G2B A;  2GTJ A;  3ULR B;  3VS3 A;  1ZSG A;  1X2K A;  2C0T A;  1T3L A;  1SRL A;  1VYV A;  1T3S A;  1YWP A;  2FEI A;  2CT4 A;  3NPF A;  1B07 A;  4R0K A;  1W70 A;  4CC3 A;  1HD3 A;  2RF0 A;  2EPD A;  2DL5 A;  2KGT A;  2KEA A;  1K0X A;  3U23 A;  2DJQ A;  2DBM A;  1GBQ A;  1SSH A;  2J6O A;  2KT1 A;  1WIE A;  2KRN A;  2LP5 A;  2BZX A;  3TSW A;  1YNZ A;  1M27 C;  4LNP A;  1OPK A;  4JJD A;  1UEC A;  1WDX A;  1E6H A;  2EYW A;  4AFU C;  1ZUY A;  2FO0 A;  1GCQ A;  4JPB W;  2A08 A;  1T0H A;  2K6D A;  2CSQ A;  2J6F A;  1K1Z A;  2J05 A;  2LCS A;  1AOJ A;  2CH4 A;  2FPE A;  1CKA A;  1H8K A;  1H3H A;  2EGE A;  1RI9 A;  1PRM C;  1GBR A;  1U3O A;  1YP5 A;  4HXJ A;  4RTZ A;  1MV0 B;  1AEY A;  3VS7 A;  1K76 A;  4AFQ C;  1ABO A;  4X1V A;  1PKT A;  3A98 A;  2M51 A;  1KJW A;  2AZS A;  4OMM A;  1GRI A;  2CUD A;  1QWE A;  4RTU A;  2LMJ A;  3VRY A;  2ESW A;  1GFC A;  1Z9Q A;  2YSQ A;  2DRM A;  1U5S A;  2KBT A;  1WYX A;  1BK2 A;  1NEG A;  4LE9 A;  4CC7 A;  1JEG A;  1X27 A;  1N5Z A;  2L3P A;  1TUD A;  1HSQ A;  2FRY A;  1OOT A;  3I35 A;  2KYM A;  4JJB A;  1W1F A;  1KSW A;  5ECA A;  2DA9 A;  4CC4 B;  1AD5 A;  1SRM A;  3C0C A;  3UA7 A;  4Z88 A;  2FPD A;  1GCP A;  4LUE A;  2KYB A;  1RLP C;  1K4U S;  2CSI A;  4OMP A;  2KRO A;  1TG0 A;  1IO6 A;  5EC7 A;  1WXB A;  2F2X A;  1MV3 A;  1UHC A;  2K2M A;  4J9B A;  2LNH B;  1PNJ A;  4LN2 A;  4ZNX A;  1UHF A;  2DYB A;  2W10 A;  2GNC A;  1YN8 A;  1X69 A;  2F2W A;  2X3X D;  5GJW B;  2HEQ A;  1PWT A;  4AFZ C;  4AFS C;  1NG2 A;  4RUG A;  3CQT A;  2BZY A;  3QWY A;  3EG3 A;  1JO8 A;  1S1N A;  2H8H A;  2K9G A;  1PRL C;  2V1Q A;  2JW4 A;  1CSK A;  2O88 A;  4EIK A;  2K79 A;  2EYY A;  2M0Y A;  5L23 A;  2RMO A;  2JM9 A;  2LQN A;  2GQI A;  3H0H A;  4OMN A;  2ROT A;  2FPF A;  2HSP A;  2DE0 X;  1G83 A;  2YUN A;  2YUQ A;  2KRS A;  1CKB A;  4Y92 A;  1AWO A;  2CT3 A;  2J6K A;  4JJC A;  2DL8 A;  3NMZ C;  1BBZ A;  1RLQ C;  1WFW A;  4AG2 C;  2CDT A;  2DBK A;  2I0N A;  1ARK A;  1I07 A;  2YUP A;  3VRZ A;  2SRC A;  1NLP C;  3SHW A;  2C0O A;  3FJ5 A;  1JXM A;  3VS4 A;  2XMF A;  2EQI A;  2E5K A;  2BZ8 A;  1QCF A;  2JMC A;  1NYF A;  3M0S A;  3VS5 A;  1X43 A;  2DL7 A;  3SEM A;  2MOX A;  3I5R A;  3UA6 A;  2JT4 A;  1UG1 A;  2GBQ A;  4DEX A;  1OEB A;  2DX1 A;  4OMQ A;  2SEM A;  1ZUK A;  1W6X A;  1AWJ A;  1UUE A;  1AVZ C;  2DF6 A;  3RNJ A;  1QLY A;  3EG1 A;  4IIO A;  4D8D A;  2KXC A;  1JU5 C;  4Z89 A;  2L0A A;  1WLP B;  3M0P A;  1PKS A;  3H0I A;  1U06 A;  3VS2 A;  2RNA A;  5I11 A;  2A37 A;  4J9G A;  2ENM A;  2C0I A;  2EW3 A;  4E6R A;  1NLO C;  5FWC A;  2PTK A;  2RQR A;  1H92 A;  1E6G A;  1AZE A;  3M0Q A;  1AWW A;  2D1X A;  2AK5 A;  1E7O A;  2RQV A;  2KRM A;  3I5S A;  2JS2 A;  2ED0 A;  1VYT A;  3UAT A;  3EGU A;  1M8M A;  1WXU A;  2VVK A;  4HVV A;  2ECZ A;  4RTW A;  3ZL7 C;  2FRW A;  2MIO A;  1EFN A;  5IHI A;  2F2V A;  3NGP A;  3TVT A;  2V1R A;  1A0N B;  2EYX A;  2L3Q A;  1GL5 A;  1M30 A;  1WX6 A;  1Y0M A;  1T0J A;  2L3S A;  5FW9 A;  3R6N A;  3EHQ A;  3H41 A;  1ZBJ A;  5IXB A;  2D0N A;  2O2O A;  2LX7 A;  1QKW A;  1K9A A;  1VYU A;  2L2P A;  3QWX X;  4HCK A;  3I9Q A;  4LUD A;  1Z9Z A;  4ORZ A;  5IXF A;  3VS6 A;  2BTT A;  4RTT A;  3REB B;  2JM8 A;  2DM1 A;  2EGC A;  1ABQ A;  2VWF A;  1QKX A;  2O31 A;  1M3A A;  1UFF A;  4D8K A;  1YCS B;  4HVU A;  4F16 A;  3EHR A;  3EG0 A;  1BU1 A;  2K3B A;  3REA B;  4CC2 A;  2KNB B;  1V1C A;  3VS0 A;  4RTV A;  1I1J A;  2EBP A;  4F14 A;  2A28 A;  2GTO A;  1X6G A;  1OV3 A;  3M0R A;  4GLM A;  4RTY A;  3H0F A;  2HBW A;  2JXB A;  2D8J A;  3VS1 A;  2AZV A;  2EKH A;  3GBQ A;  2IIM A;  2KXD A;  1J3T A;  3EG2 A;  4Z8A A;  4AG1 C;  1AZG B;  3UF4 A;  5IHN A;  1GFD A;  4HVW A;  2LJ0 A;  2OJ2 A;  1UDL A;  2CUB A;  1MUZ A;  1M3C A;  2K7A A;  1SPK A;  1SEM A;  5FWB A;  1OPL A;  3TSZ A;  4GBQ A;  2HDA A;  3PVQ A;  2LZ6 B;  2DLP A;  1FYN A;  1I0C A;  2JS0 A;  1TUC A;  3M0U A;  1ZUU A;  3KFV A;  3PVL A;  4RTX A;  2JTE A;  2J7I A;  2P4R A;  2O9S A;  2RQW A;  2B86 A;  1JQQ A;  4QT7 A;  2W0Z A;  2NUZ A;  1NYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...