1BBZA

Crystal structure of the abl-sh3 domain complexed with a designed high-affinity peptide ligand: implications for sh3-ligand interactions
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the abl-SH3 domain complexed with a designed high-affinity peptide ligand: implications for SH3-ligand interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (transferase/peptide)
molecule keywords ABL TYROSINE KINASE
total genus 10
structure length 58
sequence length 58
chains with identical sequence C, E, G
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1998-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1bbzA00
1WX6A 1UUEA 1BK2A 2V1QA 1I07A 2C0TA 2LQNA 1WXTA 1LCKA 1BU1A 3EG1A 1PKSA 1T3LA 1YCSB 3I5SA 1J3TA 4JJDA 1GL5A 4D8DA 4F16A 2C0OA 2FRYA 1SRLA 2PTKA 1I0CA 2DL5A 1M3BA 2DBKA 1K0SA 2HEQA 2K6DA 1B07A 1IO6A 2RQTA 3M0TA 1JXOA 3VS6A 4RTZA 2KRMA 1K4US 4GBQA 2GQIA 2YDLA 2JM8A 2ECZA 1QKXA 1VYUA 2J05A 2PZ1A 3VRYA 2RPNA 4HXJA 2W0ZA 4CC4B 4Y92A 1JU5C 1YNZA 1VA7A 1UDLA 2RQUA 2H8HA 1QWEA 4J9BA 1WLPB 1G83A 1ABQA 2EGAA 1UG1A 1I1JA 3O5ZA 5FWBA 4A63B 2DLPA 2B86A 2DM1A 2DRKA 2GNCA 2EYZA 4OMOA 3M0RA 3I35A 4IIOA 2GTJA 1KJWA 4J9CA 1MV0B 4RUGA 4HCKA 1AD5A 1NLOC 2KNBB 3VS0A 3VS3A 2ESWA 2F2VA 1WA7A 2F2XA 1VYTA 1SHGA 1PNJA 2CH4W 1FYNA 2BZXA 1M8MA 1N5ZA 3TSWA 1M27C 2D8JA 2DL7A 3KFVA 1RUWA 1UTIA 5L23A 2FPEA 1X6GA 2L0AA 2PNIA 2C0IA 2K3BA 1SRMA 1X6BA 4GLMA 4JZ4A 3REBB 3FJ5A 3VS7A 3IQLA 1U5SA 4J9IA 2KT8A 1AOJA 2GGRA 3THKA 5IXFA 2EPDA 1ZX6A 1X43A 2EYWA 2K7AA 2JM9A 4Z89A 2EKHA 2L3SA 2HBWA 1WIEA 3SEMA 1AWJA 2DL3A 1M3AA 1U3OA 2CUBA 2ABLA 1CKBA 1T0JA 2RQVA 4KRTA 1K9AA 4ZNXA 2A37A 1QLYA 3NPFA 1KIKA 1GCQA 4HVWA 1G2BA 1ZUYA 1OPKA 1UHFA 4QT7A 5HCKA 2HSPA 2YSQA 2YT6A 3VS5A 2O9SA 2KXDA 1S1NA 4EIKA 2A08A 2FO0A 2OI3A 1K0XA 2M0YA 2EVRA 2LJ3A 2CUDA 4IIMA 2DYBA 4AFZC 1JQQA 2JXBA 1MUZA 2X3XD 3H0IA 1YWOA 1SHFA 3SHWA 5I22A 2J6OA 4J9EA 4AG2C 2BZ8A 2JMCA 2O2OA 4JJBA 1E7OA 1NYFA 5ECAA 5IXBA 3EG3A 3H41A 1RI9A 1U06A 1X69A 3UF4A 1SSHA 3EHRA 1H3HA 1QWFA 1T0HA 1M30A 3CQTA 3PVLA 5IHNA 2JTEA 3M0PA 1UECA 1GBQA 1TUCA 2JW4A 2AZSA 2SRCA 2DMOA 1AWXA 1X2KA 4LN2A 2KYBA 2VKNA 4Z8AA 2AKLA 4ESRA 5EC7A 1NEGA 1OEBA 2CSIA 2EGEA 1H92A 2MOXA 2L3PA 4F14A 1WYXA 2A36A 4HVVA 4OMPA 1Z9ZA 2DBMA 1AEYA 1GRIA 3RBBB 3H0FA 2NUZA 4OMQA 2J7IA 1PKTA 5IHKA 3UATA 3M0SA 1ARKA 2K79A 4DEXA 5IHIA 2VVKA 2D0NA 2DA9A 2LJ0A 1MV3A 2J6KA 1HJDA 3NHNA 2FPDA 4ORZA 1E6GA 3M0QA 4K11A 2F2WA 2AK5A 1ZBJA 1ZLMA 2GBQA 2DL4A 2O9VA 2RNAA 2HCKA 3JV3A 2ED0A 1Z9QA 1Y0MA 1QKWA 4LE9A 3ULRB 1BBZA 1PWTA 2KE9A 1RLQC 1TG0A 2EQIA 2OAWA 3R6NA 4HVUA 2CSQA 2V1RA 2ENMA 2E5KA 1WFWA 1GCQC 2CH4A 4WCIA 2W10A 2DJQA 3TSZA 1AWOA 3GBQA 2LMJA 1UJ0A 2YUOA 1WXBA 2EGCA 2KRSA 1AZGB 4J9DA 1ZUUA 2EYXA 2MCNA 1W6XA 1NM7A 1GBRA 1B3QA 2CT4A 2EBPA 2LQWA 1NEBA 2KRNA 1PRLC 4AFSC 4X1VA 3VS1A 3ZL7C 2XMFA 1UHCA 5FWCA 2NWMA 5FW9A 1PHTA 1YN8A 2JT4A 2KGTA 2LNHB 3UA7A 2AKKA 4JJCA 2KXCA 3NMZC 4R0KA 2GTOA 2D8HA 2RQRA 1HD3A 1EFNA 2KBTA 2YUQA 2YUPA 4J9FA 4D8KA 2LP5A 3I5RA 1PRMC 2DX1A 1ABOA 2O88A 2YUNA 2LCSA 2A28A 4Z88A 2RF0A 2L3QA 2KR3A 3VRZA 2JMAA 1CSKA 2CDTA 2P4RA 4LNPA 1W1FA 4JPBW 3PE0A 2AZVA 3EGUA 4AFQC 2L2PA 3REAB 3VS4A 1FMKA 1AZEA 2DNUA 3EG0A 1WI7A 4J9GA 1ZUKA 1BB9A 1AVZC 4J9HA 4JZ3A 4OMLA 3I9QA 2I0NA 2SEMA 5IH2A 4M4ZA 2O31A 4RTWA 1K1ZA 4RTTA 2EYYA 2LZ6B 2KEAA 2D1XA 3UA6A 1OOTA 2OJ2A 2M51A 1WXUA 1JXMA 3RNJA 1T3SA 1YWPA 2RN8A 1KSWA 1SEMA 1M3CA 1OPLA 2ED1A 3EG2A 2KT1A 2BZYA 1YP5A 2J06A 3TVTA 2FPFA 2FEIA 2KROA 1XOVA 4CC7A 2K2MA 3U23A 1QCFA 2DL8A 1Y57A 4CC3A 2RMOA 2HDAA 4AG1C 5GJWB 3C0CA 2CREA 2EW3A 1NYGA 2K9GA 4E6RA 1GFDA 2JS0A 2QDLA 4LUEA 2BTTA 1UGVA 4FSSA 2DRMA 2J6FA 1UJYA 4RTVA 2RQWA 1X2QA 2DF6A 2JS2A 2DE0X 3EHQA 1UE9A 1SPKA 2CT3A 3QWXX 3H0HA 2ROTA 1NG2A 4DEYA 1KFZA 3QWYA 1WDXA 2DVJA 1X27A 1OV3A 2LX7A 2ROLA 2KYMA 4OMNA 1UFFA 4F17A 3M0UA 1AWWA 4CC2A 2X3WD 4AFUC 1ZSGA 1JO8A 2FRWA 1JEGA 2LJ1A 1HSQA 4LUDA 3LH5A 3PVQA 2VWFA 2DILA 4RTXA 1K76A 2IIMA 1V1CA 2G6FX 4RTUA 1W70A 5GJVB 1GCPA 2MIOA 1GFCA 1NLPC 3A98A 3VS2A 1TUDA 1VYVA 1CKAA 4RTYA 4OMMA 1RLPC 1E6HA 5I11A 1A0NB 1H8KA 2FG0A 3NGPA
chains in the Genus database with same CATH superfamily
2L8DA 5CK9A 1BK2A 2V1QA 3CMET 2LQNA 4PJOD 4C8QD 3EG1A 4MDWA 4PNOA 4J83A 3I5SA 1J3TA 3HHTB 2FRYA 2HKQB 3X20B 2DL5A 1M3BA 4E7JA 3FJPA 1HYOA 2QEXA 3EAEA 2RJCA 3OYEA 4RTZA 2KRMA 1Y71A 2CP7A 3ZBDA 2GQIA 1QVGP 2J05A 2DTIA 5GAMh 3PIPA 1JU5C 1BI2A 1VA7A 4Y28E 2NUTB 4J8OA 1RABB 3FRNA 1QWEA 1WHGA 1G83A 1ABQA 1BCOA 1UG1A 2RI3A 2E10A 2E41A 1N8RC 1VQ9Q 4L5GA 2DRKA 4JRIA 2EYZA 1Y7XA 4C92G 4OMOA 4TVRA 1VQ6T 1Q81U 2E5QA 4LDWA 4KH0B 1W2BS 4XTYA 4A53A 2IG0A 1YBYA 1VYTA 4AMCA 2CH4W 4NOYA 1FYNA 5FROA 5LJ5e 1M8MA 2MK5A 5GAN5 2E4HA 3TSWA 2R5AA 2D8JA 2DL7A 3KFVA 3RMSA 4MDXA 3CD6T 1X6GA 2C0IA 4C0DC 3MHXA 1SRMA 3REBB 4IUTA 1VQ6A 4ZTJA 3JCMd 2EYQA 1XQHA 2DPPB 1RI0A 4II1A 5CQXA 2GGRA 3CCUA 2EYWA 2K7AA 3OY9A 2JM9A 1D09B 2PVDB 3CCJQ 1AWJA 2VV5A 4KRTA 2YXYA 1K9AA 5DLOA 3QO3A 1ZQ1A 2JZ2A 5GANd 4X34A 3A5ZB 1QLYA 1WJQA 3M59A 1G8XA 4CI0C 1KIKA 1LJOA 4HVWA 4F7UE 3OBWA 3X26B 1UHFA 3LWIA 3VUBA 4KGZB 1QVFS 3VS5A 2KXDA 2KVQG 4WF2A 3RR6A 3ZEHA 4EIKA 3OS1A 4LDUA 1JJ2S 1HK9A 2M0YA 2LJ3A 4QKUA 1KD1C 4AFZC 1NBEB 3OYHA 1YWOA 1SHFA 3CXCS 4RG8A 1QCNA 1UGRB 1YHQQ 1BIAA 5GAMe 1WJRA 1E7OA 1N8RR 3CMAA 2K5FA 3PVLA 3C94A 3M0PA 2VGNA 1TUCA 4C5EA 2AZSA 1FMVA 2VYTA 3QKJA 6AT1B 4LN2A 4J6YA 3PIOA 2V8KA 2VKNA 2DD4A 2F1LA 1VQ6Q 4ESRA 4OMFB 3CCQA 1VQNA 2CSIA 2EGEA 3CXCA 1SF9A 3SFMA 2HSEB 3MEVA 1YHQT 4MZPA 2DBMA 2EQKA 3WVEB 3OYDA 2DETA 3JCMW 3L1AA 4PJOB 2NUZA 2J7IA 4DQ2A 2H3EB 2IVWA 2KK4A 2K79A 3SWNC 3BDLA 5IHIA 4L6V5 1BYMA 5FU6B 2LJ0A 3DB4A 3ER0A 3JB9F 4RCBA 2KY9A 1R0CB 1OX9A 1WQWA 1Q86C 3NHNA 3FLGA 1VQNT 3M0QA 3CPWP 3AT1B 4QVDA 2O9VA 3G4SQ 1KC8C 4DOWA 3J7AF 2CGHA 3ULRB 1M1KC 5C6SA 1TG0A 4HVUA 1K73C 2KQWA 1X75C 2V1RA 3E19A 3E9FA 4HKEA 2IPOB 2ENMA 3GF5A 1JB0E 4WCIA 5GMKl 3CBMA 2W10A 1I81A 3QJ6A 5D7UA 3TSZA 5D6YA 1AWOA 1UB4A 2LMJA 1WHJA 4LDVA 4R55A 1ZUUA 2DIGA 3MCAB 3BE3A 1U8RA 2MCNA 3SDZA 1NM7A 2AT1B 1OU8A 4HT8A 1NEBA 4C8QA 2KRNA 3QHSA 3ZL7C 2XMFA 4XTXA 2DXUA 5FWCA 3EH1A 1D3BA 1V76A 1Q7YR 4PJOF 1QW1A 1PG5B 1U1TA 2KGTA 3UA7A 1ACMB 4BACA 1SSFA 1BKBA 4R0KA 1OI1A 5LJ5h 1VQ4Q 2RQRA 2QA4A 4A4KA 4J9FA 1VQ9T 4D8KA 3OYJA 2P0KA 2O88A 1EX4A 2YUNA 2RHIA 1VQLQ 2LCCA 4KBMB 3F70A 5FU7B 3OB9A 2L3QA 2FYKA 1RADB 3CC7A 4LNPA 1W1FA 3EFOA 5L8RE 3EGUA 3VS4A 4EMHA 1FMKA 1AZEA 5KYWB 1UGQB 1UGSB 2M02A 2VC8A 1AVZC 4BUGA 2FHDA 2R57A 3CCEA 1ZHIA 4J6WA 3OS0A 2SEMA 5IH2A 5GMKj 3L2VA 2FZKB 5GANe 2EYYA 2VXFA 3CMEQ 1YCYA 2D1XA 3CBOA 3RKXA 1BI3A 3UA6A 3CC7T 2ZPEB 3I56Q 3CCRQ 2VGMA 2OJ2A 5GMKm 2E12A 2YRCA 1JXMA 2RJDA 2RN8A 2E70A 3CCUT 3RMQA 1H641 2KT1A 4M7DA 2YLCA 1UEBA 3TVTA 4CC7A 2K2MA 1QCFA 4C8QE 3QZ9B 5LJ5f 2RMOA 4AG1C 4UC4A 4M75G 3EFOB 2BUDA 2CREA 2HKNA 2K9GA 4E6RA 4ANJA 2YLBA 4FSSA 1M90U 1UJYA 2X4XA 2ZAEA 4A4GA 1C1AA 3EFSA 2GF7A 4FYVB 4M78A 1PD1A 3OYFA 2JS2A 4PFOA 4C8QF 2DE0X 3RESA 2E3HA 4M75B 2EJGA 2DYIA 1VQPA 3L2UA 2VASA 1RAEB 3V8JA 3DLMA 4FT4A 1OV3A 2LX7A 1JRIA 4BI3A 2YRDA 2JOYA 4LD6A 2EQMA 4CC2A 2DVEA 2QGGA 1JEGA 1D3BB 1YITQ 3LH5A 5J39A 3PVQA 4MZTA 2DK3A 2IIMA 2QG9B 2HAXA 2EIFA 1Q81R 1O9SA 1W70A 5GJVB 3CD6Q 5KYXB 2XK0A 1GFCA 1NLPC 1CKAA 1RLPC 4HCZA 3LLRA 1WZOA 3GPLA 5GAOm 3QXEB 3G6EA 5I11A 3OW2S 4PJOE 1H8KA 4F7UA 1MNDA 3LGFA 2DZ9A 1K8AR 1UUEA 2NLUA 1WXTA 1WJSA 1BU1A 3EGDA 1PKSA 1YCSB 2DD5A 5CO7A 1SRLA 1I0CA 4ZN3A 2OTLQ 2QASA 5J3BA 2DBKA 2O4XB 2HEQA 1YIJA 2MAMA 3M0TA 1QVPA 1JXOA 1K73U 2X51A 2YDLA 5LL6S 3HRUA 4QQGA 3JAME 4JJNK 2ECZA 3CCMA 2PZ1A 1VYUA 4BE2A 2EJFA 1S72Q 1D0YA 4CC4B 4Y92A 4XQ3A 2NUPB 2QEXQ 2MPXC 2XU8A 4B9WA 2Y90A 2H8HA 1M2OA 2EGAA 4HCBA 2WSCE 5GAN4 3MP6A 4E7IA 1I1JA 3QDFA 5GAN3 3PNWC 4M77F 3V8KA 3C12A 5LJ3g 2B86A 2DXCA 2DM1A 2QXFA 2GNCA 4N0AC 3I35A 1MV0B 4M7DB 2XIDA 3OYKA 3DLLA 1M2VA 2ZPFB 4HCKA 5CCAA 3VS0A 4ME7A 3UDCA 1SG5A 2M9UA 3OS5A 4QVZA 3CMAQ 2PUKB 1N5ZA 3CC4Q 1JBMA 3P8DA 4A4FA 1YJ9T 2PNIA 3CC4A 5GANj 4XTVA 4GY5A 5GAN6 2XDBA 3ASKA 3IQLA 1MMGA 2NUPA 4M7AA 5IXFA 1ZX6A 1NPRA 1X43A 2RD1A 3QZ5B 1KC8R 4R56A 2DEQA 2QA4T 2LTOA 2EKHA 1WIEA 2CZ7B 2HBWA 3OS2A 1NZ9A 5GANh 4N0AA 1T0JA 2K3XA 2GQVA 1YITA 2OX7A 5C0MA 4FIBA 2E65A 1IHVA 2PU9B 3LYIA 1XJWB 3M54A 5CQYA 1GCQA 1G2BA 2XG8D 2QDYB 4V2SA 3LGLA 2YSQA 1VQ4A 4KGXB 3JB9I 3OW2A 3VU3C 4BI4A 2CUDA 2DYBA 2RH2A 1KD1U 3OYYA 1VOMA 1JQQA 2X3XD 5CKBA 4J5YA 4J9EA 2BZ8A 4E47A 1X69A 2PVGB 1H3HA 3D7SB 2EQJA 1M30A 5KYUA 3CQTA 5IHNA 2WSEE 2CP3A 3A8GB 5HKCA 2PQWA 2SRCA 3O8VA 3HSBA 1QVGA 4M7DD 2KYBA 4M77D 1VQOQ 4JLGA 3G6EQ 2ZPHB 1M1KR 1VQOA 3QDRB 1K9MU 3P8BB 2HMAA 4M75E 1RACB 1Z9ZA 2OTLA 1AEYA 4RKUE 3V7SA 3RBBB 3S3MA 4FW2A 1PKTA 5IHKA 3UATA 3M0SA 3G71A 2LT1A 1NJIR 1YJ9A 4O5VA 1HXDA 2VVKA 3M58A 2D0NA 4WTOB 2COZA 2LCLA 4M7AD 4Z02A 1Q95G 1HJDA 2FPDA 3CCEQ 3CCVA 2F2WA 1RAAB 2AK5A 5GMKi 2XD0A 1TH7A 4PJOA 2HCKA 4ELZC 3JV3A 3URGA 1R77A 1G3TA 1Q81C 2DXBA 5CKEA 4C92E 1Y0MA 4DBQA 4OB3B 5I2SA 1BBZA 1RLQC 2EQIA 1D1AA 2ZGWA 3R6NA 4NL2A 4XTWA 4E7KA 2CH4A 2Y4YA 4EMKB 3L42A 3QBYA 1QQJA 1V29B 2DJQA 2E64A 3BW1A 1UJ0A 2EGCA 3META 1YI2Q 2KRSA 1AZGB 1PC0A 2O4XA 3PMTA 1B3QA 1I4K1 2EBPA 2LQWA 2EAYA 3EGDB 5LJ5d 1N9RA 2PUOB 3CD6A 4KUIA 4ATOA 5FW9A 3LWHA 3CCVQ 1YN8A 2RM4A 3I55T 1S72A 2HL5C 4PJNA 5FRMA 2K4YA 3TU4K 1Y96B 2D8HA 2YHTA 4E7ZA 2YUQA 2RA2A 3OYMA 1QVFP 1YHQA 2BIVA 3I56A 3CCRA 2LP5A 1ABOA 2CP2A 3RDVA 3JCMc 1YJWT 1BCMA 1AHJB 3VRZA 1MGQA 1CSKA 2CDTA 3S6WA 3MO8A 4JLIA 4JPBW 2AZVA 4A4EA 3MEAA 3J80E 2L2PA 4M78G 3REAB 4ZTFA 1MNEA 4HCCA 4BDZA 3VUZA 3PFSA 1ZUKA 3E1SA 1K73R 2A0FB 3JB9G 1PM3A 3H9NA 3I9QA 4OF1A 5LJ3j 2K2VA 4M4ZA 1XTDA 1K1ZA 1MMAA 1RL2A 3HRTA 2MWPA 3CXCP 1VQKQ 1OU9A 5GAOp 1IREB 1WXUA 3OQ5A 3RNJA 1T3SA 1YWPA 1SEMA 1OPLA 1TSFA 3EG2A 1W2BP 2BZYA 1XNIA 1YP5A 4F04B 2LQKA 2FPFA 2FEIA 1YJNQ 1VQ5Q 3WXMB 2DL8A 1Y57A 3M53A 2QYZA 3OYAA 1I5OB 3C0CA 3A8OB 1NYGA 1YIJQ 5M9OA 4L59A 1WHKA 2JS0A 2QDLA 2BTTA 1UGVA 3MEUA 3OMCA 1N8RU 2EQUA 1ZSZA 1KQSA 4IUUA 2RQWA 5KYYB 1RAFB 1X2QA 3CCMQ 2HL3A 3CPFA 2DF6A 3CC2A 2JN0A 1UE9A 3CCLA 1VQ7Q 2QQ9A 3H0HA 2ROTA 5GAN7 4DEYA 1KFZA 3QWYA 2DVJA 4XK8E 1X27A 5CKFA 3JCMb 3QUIA 4M7DG 4IUPA 2KYMA 3P8HA 3M0UA 1AWWA 1VQ8Q 4FW1A 2X3WD 1VQMT 2LJ1A 1KC8U 2L3RA 4N4HA 4LUDA 4M7AE 5AT1B 3GOXA 3C4SA 4M7DC 1K76A 4RTUA 3HKSA 3A8MB 3VS2A 4A4HA 1VYVA 4OMMA 4JS4A 3EG9B 4F7UG 1E6HA 1OQKA 1Q82C 2FG0A 1WX6A 3C95A 1K8AU 1VUBA 2C0TA 2OTJQ 1IGUA 1LCKA 2M1HA 1KQSP 4PJOC 2BE7D 1T3LA 1GL5A 3PTAA 2RJEA 3ME9A 2XI9A 1WPYA 4M7DF 1IZ6A 1PD0A 5A2QE 1K0SA 1B07A 5A0LA 1IO6A 2F69A 1IGQA 1K4US 4Y91A 3QJYA 3J81E 2ZPIB 1FMWA 3VRYA 1NE8A 4HXJA 4XTUA 1QVFA 3HFNA 3JCMf 3CCST 1YNZA 1UDLA 2RQUA 4IUVA 4J9BA 1OZ3A 2JNGA 5FWBA 2XDDA 1FX7A 3SB2A 3HTRA 1K9MR 5GAMj 1VQKA 2DLPA 1H3ZA 2CYZB 2MMPA 4C5GA 3RKYA 4IIOA 2GTJA 1KJWA 4J9CA 3QG1A 4QW2A 2P0PA 1AD5A 1NLOC 3M55A 3OYCA 2I2LA 3VS3A 1NJIU 2ESWA 3L2ZA 3CCLT 4DBFA 2MF2A 2GCXA 4JUVA 1WA7A 2F2XA 2OTJT 1SHGA 2CZ0B 3H6ZA 3S3OA 2X9HA 4QQ6A 4OB1B 1M27C 4FM4B 1VQMA 4FYXB 1I8FA 2E6NA 4E7LA 3HRSA 1X6BA 4JZ4A 3SD4A 2FZCB 1IRXA 1M1KU 4PJOG 4BE0A 4C8QG 1LNXA 1KG1A 4J9IA 1M2VB 2KT8A 4J6XA 1AOJA 2MI6A 1VIEA 4M7AB 2EPDA 4C0ZA 1KHCA 4A54A 3X24B 3QYHB 4N4GA 1ZSZB 2DL3A 1VQ8T 2CUBA 2ABLA 1CKBA 2X4JA 5GAN2 4E7SA 3JB9D 2RK2A 4ZNXA 5CKHA 3JSCA 4IURA 3G71Q 3NPFA 1VQ7T 1F1BB 1PSEA 2CP6A 2QI2A 3KBGA 2BE9B 1OPKA 3CCMT 3RKWA 3GNGA 9ATCB 5D6XA 4KULA 1YFNA 1VQPT 3OSSC 1YI2A 1K0XA 2EVRA 4IIMA 4PFPA 3OMGA 3M9QA 3CCQT 2PVOB 3SHWA 1LOJA 5I22A 2J6OA 3UT1A 4AG2C 2JMCA 2O2OA 1MMDA 1Q86R 3ZFJA 2ZZDA 3QYGB 1M90R 3H41A 1RI9A 3SWNB 2KMTA 4M77A 5IN1A 3PMIA 4OP0A 1P92A 5GAOq 1VQKT 1AWXA 1X2KA 1IB8A 2DERA 5DLQE 4E2FB 1RAHB 5KYXA 2AKLA 2V8IA 5GAOr 2QQSA 4DOVA 4CRIA 4C5HA 5CKDA 2R58A 3QSUA 3JCMJ 1TXQA 4PKCC 2A36A 4HVVA 4OMPA 5EG2A 3G7ZA 1X6OA 3CCQQ 1W4SA 3H0FA 5GANg 1DJ7B 1FXXA 2COWA 3CC2T 2M16A 3DB3A 4LXCA 4DEXA 1VQPQ 5GAN8 3RUXA 2RHXA 2O01E 5D6WA 4J7IA 5IT9E 1WHLA 4ZGJB 4M78B 4NS5A 1E6GA 4ORZA 4K11A 1M1FA 3CEYA 4OB0B 1ZLMA 5KCHA 1RAGB 2DL4A 2MWOA 2LX9A 3NTKA 1Z9QA 4PJLA 4FYWB 3Q1JA 5CAIA 1QKWA 1PWTA 2XDPA 3E2UA 1VQ7A 4C92F 3OYBA 1N9SA 2CSQA 4EMKA 3QIIA 2E5KA 2EFIA 3VYHB 1WFWA 1GCQC 2LVMA 3HL8A 2ZCFB 3GBQA 4M7AC 2YUOA 4BY6C 1YI2T 2D6FA 2FB7A 1VIFA 1W6XA 2P4TA 4M77E 4OB2B 2CT4A 5KE3A 1PRLC 1K9MC 4AFSC 4MZMA 2RHZA 4RCCA 3VS1A 1UHCA 2NWMA 5FRNA 3CCLQ 1PHTA 1JJ2A 2P84A 3OA6A 5I2MA 4M75D 2JT4A 2ZPBB 2QK0A 1B34B 1M1GA 1EFNA 2KBTA 1BI1A 2XKOC 2DKGA 3FDRA 1W2BA 3CCET 5GAMg 5KYUB 4FCYA 1PRMC 4J7FA 3CCJA 1TS9A 2H3JA 1G3SA 3CC2Q 2A28A 2RF0A 2DTHA 2KR3A 1C0MA 1NPPA 4C0FA 3CCSQ 2ATCB 1N6AA 4AFQC 5GMKh 5KYWA 2LQ8A 2RHYA 2YWWA 2E3IA 2JJ9A 1WI7A 3EG0A 4J9GA 4EMGA 1BB9A 1KK7A 2QQRA 5GMKe 5GANf 4ZGEB 4J9HA 4JZ3A 2DAQA 4M7DE 1VQ9A 2R5MA 2I0NA 3H8ZA 5CR2A 2O31A 4KT0E 4RTWA 3M56A 2LZ6B 1UGPB 2KEAA 1TTHB 3M5AA 2JTMA 1OOTA 4FT2A 2M51A 1SKUB 1M90C 1JJ2P 1WQ7A 1KSWA 2BKDN 2LNVA 4DA4A 2Z0WA 1M3CA 2DO3A 2RK1A 4KUDK 5KH6A 2QQAA 3WVDB 3V7CA 4PFZA 3U23A 3TQ7P 4DBHA 4M77B 4KH1B 2EKOA 3CCSA 5GJWB 1MHNA 1N27A 4BY6B 4C92A 3LW5E 4OVAA 2CKKA 5LJ3d 3UPUA 4HT9A 1GFDA 1Q82R 2HQEA 2LDMA 5GAMd 3TREA 1BI0A 1VQ5A 4PK4A 5CIUA 4JRKA 4PLLA 3G71T 4M75A 2CP5A 5FU7C 3AHUA 1SPKA 3L2QA 2CT3A 1B34A 2HQHA 1WDXA 4OGEA 4OMNA 4F17A 3I55Q 4D6WA 1KHIA 3CCVT 4C0GA 4FYYB 1JO8A 1M9SA 3GLXA 1GXIE 1OX8A 2NUTA 1D1CA 2DILA 3INZA 3LH0A 4M78E 2DIQA 2WACA 1VQ5T 1GCPA 2MIOA 1KQSS 3A98A 4C92C 3FB9A 7AT1B 5KYNA 2AIRB 3DKMA 2JVVA 3NGPA 2LRQA 1I07A 5LJ3f 4PJMA 4JJDA 2K5IA 4D8DA 4F16A 2C0OA 1X01A 2E1HA 2PTKA 3E9GA 1WNLA 1M4ZA 2FL7A 2K6DA 2K3YA 2RQTA 2CZ1B 1WHMA 3VS6A 4QVCA 4GBQA 2RHUA 4XU1A 2JM8A 4OGCA 1QKXA 4XU0A 2MYSA 2RPNA 2W0ZA 2V8JA 5HK0A 2COYA 3V7RA 3JB9H 5A0GA 1AT1B 2DZCA 1G3WA 2G3RA 2RJFA 4JDSA 1WLPB 4C0DB 4B6MA 3MP1A 3O5ZA 2QQBA 3VKIA 4A63B 4DBRA 1YJWA 3M57A 3M0RA 2FVUA 2Y4XA 1G5VA 3MJXA 1ZSZC 2KDSA 4RUGA 3GNFB 1VQOT 2KNBB 5IAYA 2A3LA 2F2VA 4HA8A 1Q86U 1PNJA 3X25B 1TWBA 3JCMX 2BZXA 2NYSA 4GLKA 1Q7YC 3SWNA 1RUWA 1UTIA 5L23A 2DTOA 2FPEA 2L0AA 4EDUA 5J26A 3FIFA 1QP2A 1RAIB 2K3BA 3MPUB 3RERA 4GLMA 3X28B 3FJ5A 3HP9A 3VS7A 1U5SA 2D9TA 1EIFA 4C5IA 3THKA 1VQMQ 3EGXA 3MKDA 3CPWA 4Z89A 2L3SA 3A8HB 1YJNA 1LVKA 3N5BB 4XAXB 3SEMA 3G1JA 1M3AA 3TEEA 1U3OA 2RQVA 4C8QC 4M75F 2P0QA 5GAMf 2A37A 2K57A 4M7AG 4BD3A 3BFMA 2DEUA 1ZUYA 1QVGS 3T9NA 4QT7A 3VJPA 5GAOn 4RMOA 3OYIA 4LDYA 3S3NA 2QA4Q 4M78F 5HCKA 2HSPA 2YT6A 3OBYA 1YIJT 1M5Q1 2O9SA 1S1NA 2A08A 2FO0A 1TUGB 2OI3A 3CPWS 3JCMP 1YJNT 4VUBA 1KQ2A 3JCMV 5CVIA 2JXBA 1MUZA 4ELYC 3H0IA 5KYYA 1BIBA 4BI8B 1YJ9Q 3TCJA 2X35A 3CCUQ 2GFAA 4JJBA 1NYFA 5ECAA 1TOVA 5IXBA 3EG3A 4XU2A 3OW2P 1U06A 3UF4A 1SSHA 3EHRA 1QWFA 1T0HA 1ZA1B 2QGFB 4BDYA 5GAOl 2JTEA 2LC4A 4M78C 1UECA 1GBQA 2JW4A 4O6JA 4M75C 3CC7Q 4MMKA 4EPCA 3G4SA 4JS5A 2DMOA 4PLIA 3OYNA 3FC3A 4Z8AA 3JCMg 1PSFA 5EC7A 1ZBXA 1NEGA 1OEBA 1H92A 4X9DA 2MOXA 2QTVA 5HK3A 3VYGA 2L3PA 4C92D 2JUFA 5FU6C 3CMEA 4F14A 1WYXA 4ZN1A 1QCOA 2KI7A 5DY9A 1GRIA 2DXTA 4P5NA 4C8QB 3RIRA 8AT1B 1OZ2A 4OMQA 1D0XA 1YJWQ 1ARKA 2QEXT 1C6VX 2LT4A 2DA9A 3PGGA 4RG2A 1VQLT 1MV3A 3M4GA 4BE1A 1VQ8A 2J6KA 5A0DA 3VV0A 4M77C 4F7UF 1TU0B 4IUQA 3NFCA 1D1BA 4JRQA 4LDXA 1OULA 1ZBJA 2GBQA 4N4IA 4FU6A 1NJIC 2RNAA 1I5LA 2OTLT 1QP3A 1ZA2B 4LD9K 2ED0A 4F7UB 4LE9A 2V26A 2KE9A 5KE2A 2JTFA 4XTZA 3L2WA 2OAWA 3R6OA 1VQLA 2HD0A 1Y96A 2F5TX 1WXBA 4MMLA 3HPWA 1PCXA 4J9DA 2EYXA 4FL6A 3FEOA 1GBRA 3CMAT 2C06A 2CP0A 4M77G 2QAZA 4FSXA 4X1VA 3OSVA 3JRZA 1WGSA 3GIBA 1FWZA 3OYGA 3A8LB 2K5LA 2HQXA 2KSSA 4JRPA 3JCMe 4PJJA 2LNHB 2HBPA 5FLXE 2AKKA 4JJCA 2KXCA 3NMZC 3G4ST 2GTOA 1M8VA 2X4YA 1HD3A 2OAUA 3KUFA 1K8AC 1Q82U 2YUPA 2A7YA 1QMCA 3QPHA 1VQNQ 3I5RA 4BB7A 2DX1A 2CZ6B 2DJZA 2E6ZA 2LCSA 3EFRA 4Z88A 3M4YA 5LJ5j 4M7AF 1WHHA 2JMAA 3MP8A 2P4RA 5LJ3h 4KGVB 1S72T 3PT9A 3PE0A 3L2RA 2RB6A 1R8OB 2M0OA 5LJ3e 2DNUA 1OYXA 4B9XA 2D0QB 1EZZB 4OMLA 5DM7R 2GFUA 3I56T 3CCRT 3G6ET 3V8LA 4PL6A 2L89A 1KQ1A 3BY7A 5AYFA 4RTTA 3EGXB 1LPLA 2RO0A 1G3YA 5LJ5g 2B8AA 2HZYA 3GP8A 3UWNA 2DFUA 1U1SA 2ED1A 4E7HA 2J06A 2VUBA 2QTXA 2KROA 1XOVA 4X9CA 4EMKC 1KD1R 2FZGB 2RI2A 4CC3A 5HY6A 2HDAA 2XHCA 2EW3A 1YITT 1D0ZA 2ZPGB 4ZGDB 3HFOA 4LUEA 4C92B 2DRMA 3OYLA 2J6FA 2L5QA 2RI5A 4RTVA 3NTIA 3EHQA 4AT1B 1O75A 3EG9A 1VQ4T 2YRVA 3QWXX 2OTJA 1NG2A 3I55A 2EJ9A 2ROLA 1MMNA 2CS7A 1UFFA 2VXEA 5I21A 3CCJT 4AFUC 3JCMh 2KAFA 1ZSGA 5KCOA 1Y07A 2AHJB 2FRWA 2XICA 4M78D 3JB9J 1HSQA 2HNIA 3KXTA 2EWNA 1Q7YU 2F5KA 2VWFA 4YTLA 3JCMQ 4RTXA 4QQDA 2VB6A 1IXDA 3BDUA 1R0BG 1IHWA 4NL3A 1V1CA 2G6FX 2X4WA 3LX7A 3CBPA 3EH2A 1B7TA 8ATCB 1TUDA 3CC4T 4RTYA 3A1PA 2WSFE 3NTHA 4IKFA 3MEWA 4XU3A 1A0NB 4Q5WA
chains in the Genus database with same CATH topology
1WX6A 1UUEA 1BK2A 2V1QA 1I07A 2C0TA 2LQNA 1WXTA 1LCKA 1BU1A 3EG1A 1PKSA 1T3LA 1YCSB 3I5SA 1J3TA 4JJDA 1GL5A 4D8DA 4F16A 2C0OA 2FRYA 1SRLA 2PTKA 1I0CA 2DL5A 1M3BA 2DBKA 1K0SA 2HEQA 2K6DA 1B07A 1IO6A 2RQTA 3M0TA 1JXOA 3VS6A 4RTZA 2KRMA 1K4US 4GBQA 2GQIA 2YDLA 2JM8A 2ECZA 1QKXA 1VYUA 2J05A 2PZ1A 3VRYA 2RPNA 4HXJA 2W0ZA 4CC4B 4Y92A 1JU5C 1YNZA 1VA7A 1UDLA 2RQUA 2H8HA 1QWEA 4J9BA 1WLPB 1G83A 1ABQA 2EGAA 1UG1A 1I1JA 3O5ZA 5FWBA 4A63B 2DLPA 2B86A 2DM1A 2DRKA 2GNCA 2EYZA 4OMOA 3M0RA 3I35A 4IIOA 2GTJA 1KJWA 4J9CA 1MV0B 4RUGA 4HCKA 1AD5A 1NLOC 2KNBB 3VS0A 3VS3A 2ESWA 2F2VA 1WA7A 2F2XA 1VYTA 1SHGA 1PNJA 2CH4W 1FYNA 2BZXA 1M8MA 1N5ZA 3TSWA 1M27C 2D8JA 2DL7A 3KFVA 1RUWA 1UTIA 5L23A 2FPEA 1X6GA 2L0AA 2PNIA 2C0IA 2K3BA 1SRMA 1X6BA 4GLMA 4JZ4A 3REBB 3FJ5A 3VS7A 3IQLA 1U5SA 4J9IA 2KT8A 1AOJA 2GGRA 3THKA 5IXFA 2EPDA 1ZX6A 1X43A 2EYWA 2K7AA 2JM9A 4Z89A 2EKHA 2L3SA 2HBWA 1WIEA 3SEMA 1AWJA 2DL3A 1M3AA 1U3OA 2CUBA 2ABLA 1CKBA 1T0JA 2RQVA 4KRTA 1K9AA 4ZNXA 2A37A 1QLYA 3NPFA 1KIKA 1GCQA 4HVWA 1G2BA 1ZUYA 1OPKA 1UHFA 4QT7A 5HCKA 2HSPA 2YSQA 2YT6A 3VS5A 2O9SA 2KXDA 1S1NA 4EIKA 2A08A 2FO0A 2OI3A 1K0XA 2M0YA 2EVRA 2LJ3A 2CUDA 4IIMA 2DYBA 4AFZC 1JQQA 2JXBA 1MUZA 2X3XD 3H0IA 1YWOA 1SHFA 3SHWA 5I22A 2J6OA 4J9EA 4AG2C 2BZ8A 2JMCA 2O2OA 4JJBA 1E7OA 1NYFA 5ECAA 5IXBA 3EG3A 3H41A 1RI9A 1U06A 1X69A 3UF4A 1SSHA 3EHRA 1H3HA 1QWFA 1T0HA 1M30A 3CQTA 3PVLA 5IHNA 2JTEA 3M0PA 1UECA 1GBQA 1TUCA 2JW4A 2AZSA 2SRCA 2DMOA 1AWXA 1X2KA 4LN2A 2KYBA 2VKNA 4Z8AA 2AKLA 4ESRA 5EC7A 1NEGA 1OEBA 2CSIA 2EGEA 1H92A 2MOXA 2L3PA 4F14A 1WYXA 2A36A 4HVVA 4OMPA 1Z9ZA 2DBMA 1AEYA 1GRIA 3RBBB 3H0FA 2NUZA 4OMQA 2J7IA 1PKTA 5IHKA 3UATA 3M0SA 1ARKA 2K79A 4DEXA 5IHIA 2VVKA 2D0NA 2DA9A 2LJ0A 1MV3A 2J6KA 1HJDA 3NHNA 2FPDA 4ORZA 1E6GA 3M0QA 4K11A 2F2WA 2AK5A 1ZBJA 1ZLMA 2GBQA 2DL4A 2O9VA 2RNAA 2HCKA 3JV3A 2ED0A 1Z9QA 1Y0MA 1QKWA 4LE9A 3ULRB 1BBZA 1PWTA 2KE9A 1RLQC 1TG0A 2EQIA 2OAWA 3R6NA 4HVUA 2CSQA 2V1RA 2ENMA 2E5KA 1WFWA 1GCQC 2CH4A 4WCIA 2W10A 2DJQA 3TSZA 1AWOA 3GBQA 2LMJA 1UJ0A 2YUOA 1WXBA 2EGCA 2KRSA 1AZGB 4J9DA 1ZUUA 2EYXA 2MCNA 1W6XA 1NM7A 1GBRA 1B3QA 2CT4A 2EBPA 2LQWA 1NEBA 2KRNA 1PRLC 4AFSC 4X1VA 3VS1A 3ZL7C 2XMFA 1UHCA 5FWCA 2NWMA 5FW9A 1PHTA 1YN8A 2JT4A 2KGTA 2LNHB 3UA7A 2AKKA 4JJCA 2KXCA 3NMZC 4R0KA 2GTOA 2D8HA 2RQRA 1HD3A 1EFNA 2KBTA 2YUQA 2YUPA 4J9FA 4D8KA 2LP5A 3I5RA 1PRMC 2DX1A 1ABOA 2O88A 2YUNA 2LCSA 2A28A 4Z88A 2RF0A 2L3QA 2KR3A 3VRZA 2JMAA 1CSKA 2CDTA 2P4RA 4LNPA 1W1FA 4JPBW 3PE0A 2AZVA 3EGUA 4AFQC 2L2PA 3REAB 3VS4A 1FMKA 1AZEA 2DNUA 3EG0A 1WI7A 4J9GA 1ZUKA 1BB9A 1AVZC 4J9HA 4JZ3A 4OMLA 3I9QA 2I0NA 2SEMA 5IH2A 4M4ZA 2O31A 4RTWA 1K1ZA 4RTTA 2EYYA 2LZ6B 2KEAA 2D1XA 3UA6A 1OOTA 2OJ2A 2M51A 1WXUA 1JXMA 3RNJA 1T3SA 1YWPA 2RN8A 1KSWA 1SEMA 1M3CA 1OPLA 2ED1A 3EG2A 2KT1A 2BZYA 1YP5A 2J06A 3TVTA 2FPFA 2FEIA 2KROA 1XOVA 4CC7A 2K2MA 3U23A 1QCFA 2DL8A 1Y57A 4CC3A 2RMOA 2HDAA 4AG1C 5GJWB 3C0CA 2CREA 2EW3A 1NYGA 2K9GA 4E6RA 1GFDA 2JS0A 2QDLA 4LUEA 2BTTA 1UGVA 4FSSA 2DRMA 2J6FA 1UJYA 4RTVA 2RQWA 1X2QA 2DF6A 2JS2A 2DE0X 3EHQA 1UE9A 1SPKA 2CT3A 3QWXX 3H0HA 2ROTA 1NG2A 4DEYA 1KFZA 3QWYA 1WDXA 2DVJA 1X27A 1OV3A 2LX7A 2ROLA 2KYMA 4OMNA 1UFFA 4F17A 3M0UA 1AWWA 4CC2A 2X3WD 4AFUC 1ZSGA 1JO8A 2FRWA 1JEGA 2LJ1A 1HSQA 4LUDA 3LH5A 3PVQA 2VWFA 2DILA 4RTXA 1K76A 2IIMA 1V1CA 2G6FX 4RTUA 1W70A 5GJVB 1GCPA 2MIOA 1GFCA 1NLPC 3A98A 3VS2A 1TUDA 1VYVA 1CKAA 4RTYA 4OMMA 1RLPC 1E6HA 5I11A 1A0NB 1H8KA 2FG0A 3NGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WX6 A;  1UUE A;  1BK2 A;  2V1Q A;  1I07 A;  2C0T A;  2LQN A;  1WXT A;  1LCK A;  1BU1 A;  3EG1 A;  1PKS A;  1T3L A;  1YCS B;  3I5S A;  1J3T A;  4JJD A;  1GL5 A;  4D8D A;  4F16 A;  2C0O A;  2FRY A;  1SRL A;  2PTK A;  1I0C A;  2DL5 A;  1M3B A;  2DBK A;  1K0S A;  2HEQ A;  2K6D A;  1B07 A;  1IO6 A;  2RQT A;  3M0T A;  1JXO A;  3VS6 A;  4RTZ A;  2KRM A;  1K4U S;  4GBQ A;  2GQI A;  2YDL A;  2JM8 A;  2ECZ A;  1QKX A;  1VYU A;  2J05 A;  2PZ1 A;  3VRY A;  2RPN A;  4HXJ A;  2W0Z A;  4CC4 B;  4Y92 A;  1JU5 C;  1YNZ A;  1VA7 A;  1UDL A;  2RQU A;  2H8H A;  1QWE A;  4J9B A;  1WLP B;  1G83 A;  1ABQ A;  2EGA A;  1UG1 A;  1I1J A;  3O5Z A;  5FWB A;  4A63 B;  2DLP A;  2B86 A;  2DM1 A;  2DRK A;  2GNC A;  2EYZ A;  4OMO A;  3M0R A;  3I35 A;  4IIO A;  2GTJ A;  1KJW A;  4J9C A;  1MV0 B;  4RUG A;  4HCK A;  1AD5 A;  1NLO C;  2KNB B;  3VS0 A;  3VS3 A;  2ESW A;  2F2V A;  1WA7 A;  2F2X A;  1VYT A;  1SHG A;  1PNJ A;  2CH4 W;  1FYN A;  2BZX A;  1M8M A;  1N5Z A;  3TSW A;  1M27 C;  2D8J A;  2DL7 A;  3KFV A;  1RUW A;  1UTI A;  5L23 A;  2FPE A;  1X6G A;  2L0A A;  2PNI A;  2C0I A;  2K3B A;  1SRM A;  1X6B A;  4GLM A;  4JZ4 A;  3REB B;  3FJ5 A;  3VS7 A;  3IQL A;  1U5S A;  4J9I A;  2KT8 A;  1AOJ A;  2GGR A;  3THK A;  5IXF A;  2EPD A;  1ZX6 A;  1X43 A;  2EYW A;  2K7A A;  2JM9 A;  4Z89 A;  2EKH A;  2L3S A;  2HBW A;  1WIE A;  3SEM A;  1AWJ A;  2DL3 A;  1M3A A;  1U3O A;  2CUB A;  2ABL A;  1CKB A;  1T0J A;  2RQV A;  4KRT A;  1K9A A;  4ZNX A;  2A37 A;  1QLY A;  3NPF A;  1KIK A;  1GCQ A;  4HVW A;  1G2B A;  1ZUY A;  1OPK A;  1UHF A;  4QT7 A;  5HCK A;  2HSP A;  2YSQ A;  2YT6 A;  3VS5 A;  2O9S A;  2KXD A;  1S1N A;  4EIK A;  2A08 A;  2FO0 A;  2OI3 A;  1K0X A;  2M0Y A;  2EVR A;  2LJ3 A;  2CUD A;  4IIM A;  2DYB A;  4AFZ C;  1JQQ A;  2JXB A;  1MUZ A;  2X3X D;  3H0I A;  1YWO A;  1SHF A;  3SHW A;  5I22 A;  2J6O A;  4J9E A;  4AG2 C;  2BZ8 A;  2JMC A;  2O2O A;  4JJB A;  1E7O A;  1NYF A;  5ECA A;  5IXB A;  3EG3 A;  3H41 A;  1RI9 A;  1U06 A;  1X69 A;  3UF4 A;  1SSH A;  3EHR A;  1H3H A;  1QWF A;  1T0H A;  1M30 A;  3CQT A;  3PVL A;  5IHN A;  2JTE A;  3M0P A;  1UEC A;  1GBQ A;  1TUC A;  2JW4 A;  2AZS A;  2SRC A;  2DMO A;  1AWX A;  1X2K A;  4LN2 A;  2KYB A;  2VKN A;  4Z8A A;  2AKL A;  4ESR A;  5EC7 A;  1NEG A;  1OEB A;  2CSI A;  2EGE A;  1H92 A;  2MOX A;  2L3P A;  4F14 A;  1WYX A;  2A36 A;  4HVV A;  4OMP A;  1Z9Z A;  2DBM A;  1AEY A;  1GRI A;  3RBB B;  3H0F A;  2NUZ A;  4OMQ A;  2J7I A;  1PKT A;  5IHK A;  3UAT A;  3M0S A;  1ARK A;  2K79 A;  4DEX A;  5IHI A;  2VVK A;  2D0N A;  2DA9 A;  2LJ0 A;  1MV3 A;  2J6K A;  1HJD A;  3NHN A;  2FPD A;  4ORZ A;  1E6G A;  3M0Q A;  4K11 A;  2F2W A;  2AK5 A;  1ZBJ A;  1ZLM A;  2GBQ A;  2DL4 A;  2O9V A;  2RNA A;  2HCK A;  3JV3 A;  2ED0 A;  1Z9Q A;  1Y0M A;  1QKW A;  4LE9 A;  3ULR B;  1BBZ A;  1PWT A;  2KE9 A;  1RLQ C;  1TG0 A;  2EQI A;  2OAW A;  3R6N A;  4HVU A;  2CSQ A;  2V1R A;  2ENM A;  2E5K A;  1WFW A;  1GCQ C;  2CH4 A;  4WCI A;  2W10 A;  2DJQ A;  3TSZ A;  1AWO A;  3GBQ A;  2LMJ A;  1UJ0 A;  2YUO A;  1WXB A;  2EGC A;  2KRS A;  1AZG B;  4J9D A;  1ZUU A;  2EYX A;  2MCN A;  1W6X A;  1NM7 A;  1GBR A;  1B3Q A;  2CT4 A;  2EBP A;  2LQW A;  1NEB A;  2KRN A;  1PRL C;  4AFS C;  4X1V A;  3VS1 A;  3ZL7 C;  2XMF A;  1UHC A;  5FWC A;  2NWM A;  5FW9 A;  1PHT A;  1YN8 A;  2JT4 A;  2KGT A;  2LNH B;  3UA7 A;  2AKK A;  4JJC A;  2KXC A;  3NMZ C;  4R0K A;  2GTO A;  2D8H A;  2RQR A;  1HD3 A;  1EFN A;  2KBT A;  2YUQ A;  2YUP A;  4J9F A;  4D8K A;  2LP5 A;  3I5R A;  1PRM C;  2DX1 A;  1ABO A;  2O88 A;  2YUN A;  2LCS A;  2A28 A;  4Z88 A;  2RF0 A;  2L3Q A;  2KR3 A;  3VRZ A;  2JMA A;  1CSK A;  2CDT A;  2P4R A;  4LNP A;  1W1F A;  4JPB W;  3PE0 A;  2AZV A;  3EGU A;  4AFQ C;  2L2P A;  3REA B;  3VS4 A;  1FMK A;  1AZE A;  2DNU A;  3EG0 A;  1WI7 A;  4J9G A;  1ZUK A;  1BB9 A;  1AVZ C;  4J9H A;  4JZ3 A;  4OML A;  3I9Q A;  2I0N A;  2SEM A;  5IH2 A;  4M4Z A;  2O31 A;  4RTW A;  1K1Z A;  4RTT A;  2EYY A;  2LZ6 B;  2KEA A;  2D1X A;  3UA6 A;  1OOT A;  2OJ2 A;  2M51 A;  1WXU A;  1JXM A;  3RNJ A;  1T3S A;  1YWP A;  2RN8 A;  1KSW A;  1SEM A;  1M3C A;  1OPL A;  2ED1 A;  3EG2 A;  2KT1 A;  2BZY A;  1YP5 A;  2J06 A;  3TVT A;  2FPF A;  2FEI A;  2KRO A;  1XOV A;  4CC7 A;  2K2M A;  3U23 A;  1QCF A;  2DL8 A;  1Y57 A;  4CC3 A;  2RMO A;  2HDA A;  4AG1 C;  5GJW B;  3C0C A;  2CRE A;  2EW3 A;  1NYG A;  2K9G A;  4E6R A;  1GFD A;  2JS0 A;  2QDL A;  4LUE A;  2BTT A;  1UGV A;  4FSS A;  2DRM A;  2J6F A;  1UJY A;  4RTV A;  2RQW A;  1X2Q A;  2DF6 A;  2JS2 A;  2DE0 X;  3EHQ A;  1UE9 A;  1SPK A;  2CT3 A;  3QWX X;  3H0H A;  2ROT A;  1NG2 A;  4DEY A;  1KFZ A;  3QWY A;  1WDX A;  2DVJ A;  1X27 A;  1OV3 A;  2LX7 A;  2ROL A;  2KYM A;  4OMN A;  1UFF A;  4F17 A;  3M0U A;  1AWW A;  4CC2 A;  2X3W D;  4AFU C;  1ZSG A;  1JO8 A;  2FRW A;  1JEG A;  2LJ1 A;  1HSQ A;  4LUD A;  3LH5 A;  3PVQ A;  2VWF A;  2DIL A;  4RTX A;  1K76 A;  2IIM A;  1V1C A;  2G6F X;  4RTU A;  1W70 A;  5GJV B;  1GCP A;  2MIO A;  1GFC A;  1NLP C;  3A98 A;  3VS2 A;  1TUD A;  1VYV A;  1CKA A;  4RTY A;  4OMM A;  1RLP C;  1E6H A;  5I11 A;  1A0N B;  1H8K A;  2FG0 A;  3NGP A; 
#chains in the Genus database with same CATH topology
 2L8D A;  5CK9 A;  1BK2 A;  2V1Q A;  3CME T;  2LQN A;  4PJO D;  4C8Q D;  3EG1 A;  4MDW A;  4PNO A;  4J83 A;  3I5S A;  1J3T A;  3HHT B;  2FRY A;  2HKQ B;  3X20 B;  2DL5 A;  1M3B A;  4E7J A;  3FJP A;  1HYO A;  2QEX A;  3EAE A;  2RJC A;  3OYE A;  4RTZ A;  2KRM A;  1Y71 A;  2CP7 A;  3ZBD A;  2GQI A;  1QVG P;  2J05 A;  2DTI A;  5GAM h;  3PIP A;  1JU5 C;  1BI2 A;  1VA7 A;  4Y28 E;  2NUT B;  4J8O A;  1RAB B;  3FRN A;  1QWE A;  1WHG A;  1G83 A;  1ABQ A;  1BCO A;  1UG1 A;  2RI3 A;  2E10 A;  2E41 A;  1N8R C;  1VQ9 Q;  4L5G A;  2DRK A;  4JRI A;  2EYZ A;  1Y7X A;  4C92 G;  4OMO A;  4TVR A;  1VQ6 T;  1Q81 U;  2E5Q A;  4LDW A;  4KH0 B;  1W2B S;  4XTY A;  4A53 A;  2IG0 A;  1YBY A;  1VYT A;  4AMC A;  2CH4 W;  4NOY A;  1FYN A;  5FRO A;  5LJ5 e;  1M8M A;  2MK5 A;  5GAN 5;  2E4H A;  3TSW A;  2R5A A;  2D8J A;  2DL7 A;  3KFV A;  3RMS A;  4MDX A;  3CD6 T;  1X6G A;  2C0I A;  4C0D C;  3MHX A;  1SRM A;  3REB B;  4IUT A;  1VQ6 A;  4ZTJ A;  3JCM d;  2EYQ A;  1XQH A;  2DPP B;  1RI0 A;  4II1 A;  5CQX A;  2GGR A;  3CCU A;  2EYW A;  2K7A A;  3OY9 A;  2JM9 A;  1D09 B;  2PVD B;  3CCJ Q;  1AWJ A;  2VV5 A;  4KRT A;  2YXY A;  1K9A A;  5DLO A;  3QO3 A;  1ZQ1 A;  2JZ2 A;  5GAN d;  4X34 A;  3A5Z B;  1QLY A;  1WJQ A;  3M59 A;  1G8X A;  4CI0 C;  1KIK A;  1LJO A;  4HVW A;  4F7U E;  3OBW A;  3X26 B;  1UHF A;  3LWI A;  3VUB A;  4KGZ B;  1QVF S;  3VS5 A;  2KXD A;  2KVQ G;  4WF2 A;  3RR6 A;  3ZEH A;  4EIK A;  3OS1 A;  4LDU A;  1JJ2 S;  1HK9 A;  2M0Y A;  2LJ3 A;  4QKU A;  1KD1 C;  4AFZ C;  1NBE B;  3OYH A;  1YWO A;  1SHF A;  3CXC S;  4RG8 A;  1QCN A;  1UGR B;  1YHQ Q;  1BIA A;  5GAM e;  1WJR A;  1E7O A;  1N8R R;  3CMA A;  2K5F A;  3PVL A;  3C94 A;  3M0P A;  2VGN A;  1TUC A;  4C5E A;  2AZS A;  1FMV A;  2VYT A;  3QKJ A;  6AT1 B;  4LN2 A;  4J6Y A;  3PIO A;  2V8K A;  2VKN A;  2DD4 A;  2F1L A;  1VQ6 Q;  4ESR A;  4OMF B;  3CCQ A;  1VQN A;  2CSI A;  2EGE A;  3CXC A;  1SF9 A;  3SFM A;  2HSE B;  3MEV A;  1YHQ T;  4MZP A;  2DBM A;  2EQK A;  3WVE B;  3OYD A;  2DET A;  3JCM W;  3L1A A;  4PJO B;  2NUZ A;  2J7I A;  4DQ2 A;  2H3E B;  2IVW A;  2KK4 A;  2K79 A;  3SWN C;  3BDL A;  5IHI A;  4L6V 5;  1BYM A;  5FU6 B;  2LJ0 A;  3DB4 A;  3ER0 A;  3JB9 F;  4RCB A;  2KY9 A;  1R0C B;  1OX9 A;  1WQW A;  1Q86 C;  3NHN A;  3FLG A;  1VQN T;  3M0Q A;  3CPW P;  3AT1 B;  4QVD A;  2O9V A;  3G4S Q;  1KC8 C;  4DOW A;  3J7A F;  2CGH A;  3ULR B;  1M1K C;  5C6S A;  1TG0 A;  4HVU A;  1K73 C;  2KQW A;  1X75 C;  2V1R A;  3E19 A;  3E9F A;  4HKE A;  2IPO B;  2ENM A;  3GF5 A;  1JB0 E;  4WCI A;  5GMK l;  3CBM A;  2W10 A;  1I81 A;  3QJ6 A;  5D7U A;  3TSZ A;  5D6Y A;  1AWO A;  1UB4 A;  2LMJ A;  1WHJ A;  4LDV A;  4R55 A;  1ZUU A;  2DIG A;  3MCA B;  3BE3 A;  1U8R A;  2MCN A;  3SDZ A;  1NM7 A;  2AT1 B;  1OU8 A;  4HT8 A;  1NEB A;  4C8Q A;  2KRN A;  3QHS A;  3ZL7 C;  2XMF A;  4XTX A;  2DXU A;  5FWC A;  3EH1 A;  1D3B A;  1V76 A;  1Q7Y R;  4PJO F;  1QW1 A;  1PG5 B;  1U1T A;  2KGT A;  3UA7 A;  1ACM B;  4BAC A;  1SSF A;  1BKB A;  4R0K A;  1OI1 A;  5LJ5 h;  1VQ4 Q;  2RQR A;  2QA4 A;  4A4K A;  4J9F A;  1VQ9 T;  4D8K A;  3OYJ A;  2P0K A;  2O88 A;  1EX4 A;  2YUN A;  2RHI A;  1VQL Q;  2LCC A;  4KBM B;  3F70 A;  5FU7 B;  3OB9 A;  2L3Q A;  2FYK A;  1RAD B;  3CC7 A;  4LNP A;  1W1F A;  3EFO A;  5L8R E;  3EGU A;  3VS4 A;  4EMH A;  1FMK A;  1AZE A;  5KYW B;  1UGQ B;  1UGS B;  2M02 A;  2VC8 A;  1AVZ C;  4BUG A;  2FHD A;  2R57 A;  3CCE A;  1ZHI A;  4J6W A;  3OS0 A;  2SEM A;  5IH2 A;  5GMK j;  3L2V A;  2FZK B;  5GAN e;  2EYY A;  2VXF A;  3CME Q;  1YCY A;  2D1X A;  3CBO A;  3RKX A;  1BI3 A;  3UA6 A;  3CC7 T;  2ZPE B;  3I56 Q;  3CCR Q;  2VGM A;  2OJ2 A;  5GMK m;  2E12 A;  2YRC A;  1JXM A;  2RJD A;  2RN8 A;  2E70 A;  3CCU T;  3RMQ A;  1H64 1;  2KT1 A;  4M7D A;  2YLC A;  1UEB A;  3TVT A;  4CC7 A;  2K2M A;  1QCF A;  4C8Q E;  3QZ9 B;  5LJ5 f;  2RMO A;  4AG1 C;  4UC4 A;  4M75 G;  3EFO B;  2BUD A;  2CRE A;  2HKN A;  2K9G A;  4E6R A;  4ANJ A;  2YLB A;  4FSS A;  1M90 U;  1UJY A;  2X4X A;  2ZAE A;  4A4G A;  1C1A A;  3EFS A;  2GF7 A;  4FYV B;  4M78 A;  1PD1 A;  3OYF A;  2JS2 A;  4PFO A;  4C8Q F;  2DE0 X;  3RES A;  2E3H A;  4M75 B;  2EJG A;  2DYI A;  1VQP A;  3L2U A;  2VAS A;  1RAE B;  3V8J A;  3DLM A;  4FT4 A;  1OV3 A;  2LX7 A;  1JRI A;  4BI3 A;  2YRD A;  2JOY A;  4LD6 A;  2EQM A;  4CC2 A;  2DVE A;  2QGG A;  1JEG A;  1D3B B;  1YIT Q;  3LH5 A;  5J39 A;  3PVQ A;  4MZT A;  2DK3 A;  2IIM A;  2QG9 B;  2HAX A;  2EIF A;  1Q81 R;  1O9S A;  1W70 A;  5GJV B;  3CD6 Q;  5KYX B;  2XK0 A;  1GFC A;  1NLP C;  1CKA A;  1RLP C;  4HCZ A;  3LLR A;  1WZO A;  3GPL A;  5GAO m;  3QXE B;  3G6E A;  5I11 A;  3OW2 S;  4PJO E;  1H8K A;  4F7U A;  1MND A;  3LGF A;  2DZ9 A;  1K8A R;  1UUE A;  2NLU A;  1WXT A;  1WJS A;  1BU1 A;  3EGD A;  1PKS A;  1YCS B;  2DD5 A;  5CO7 A;  1SRL A;  1I0C A;  4ZN3 A;  2OTL Q;  2QAS A;  5J3B A;  2DBK A;  2O4X B;  2HEQ A;  1YIJ A;  2MAM A;  3M0T A;  1QVP A;  1JXO A;  1K73 U;  2X51 A;  2YDL A;  5LL6 S;  3HRU A;  4QQG A;  3JAM E;  4JJN K;  2ECZ A;  3CCM A;  2PZ1 A;  1VYU A;  4BE2 A;  2EJF A;  1S72 Q;  1D0Y A;  4CC4 B;  4Y92 A;  4XQ3 A;  2NUP B;  2QEX Q;  2MPX C;  2XU8 A;  4B9W A;  2Y90 A;  2H8H A;  1M2O A;  2EGA A;  4HCB A;  2WSC E;  5GAN 4;  3MP6 A;  4E7I A;  1I1J A;  3QDF A;  5GAN 3;  3PNW C;  4M77 F;  3V8K A;  3C12 A;  5LJ3 g;  2B86 A;  2DXC A;  2DM1 A;  2QXF A;  2GNC A;  4N0A C;  3I35 A;  1MV0 B;  4M7D B;  2XID A;  3OYK A;  3DLL A;  1M2V A;  2ZPF B;  4HCK A;  5CCA A;  3VS0 A;  4ME7 A;  3UDC A;  1SG5 A;  2M9U A;  3OS5 A;  4QVZ A;  3CMA Q;  2PUK B;  1N5Z A;  3CC4 Q;  1JBM A;  3P8D A;  4A4F A;  1YJ9 T;  2PNI A;  3CC4 A;  5GAN j;  4XTV A;  4GY5 A;  5GAN 6;  2XDB A;  3ASK A;  3IQL A;  1MMG A;  2NUP A;  4M7A A;  5IXF A;  1ZX6 A;  1NPR A;  1X43 A;  2RD1 A;  3QZ5 B;  1KC8 R;  4R56 A;  2DEQ A;  2QA4 T;  2LTO A;  2EKH A;  1WIE A;  2CZ7 B;  2HBW A;  3OS2 A;  1NZ9 A;  5GAN h;  4N0A A;  1T0J A;  2K3X A;  2GQV A;  1YIT A;  2OX7 A;  5C0M A;  4FIB A;  2E65 A;  1IHV A;  2PU9 B;  3LYI A;  1XJW B;  3M54 A;  5CQY A;  1GCQ A;  1G2B A;  2XG8 D;  2QDY B;  4V2S A;  3LGL A;  2YSQ A;  1VQ4 A;  4KGX B;  3JB9 I;  3OW2 A;  3VU3 C;  4BI4 A;  2CUD A;  2DYB A;  2RH2 A;  1KD1 U;  3OYY A;  1VOM A;  1JQQ A;  2X3X D;  5CKB A;  4J5Y A;  4J9E A;  2BZ8 A;  4E47 A;  1X69 A;  2PVG B;  1H3H A;  3D7S B;  2EQJ A;  1M30 A;  5KYU A;  3CQT A;  5IHN A;  2WSE E;  2CP3 A;  3A8G B;  5HKC A;  2PQW A;  2SRC A;  3O8V A;  3HSB A;  1QVG A;  4M7D D;  2KYB A;  4M77 D;  1VQO Q;  4JLG A;  3G6E Q;  2ZPH B;  1M1K R;  1VQO A;  3QDR B;  1K9M U;  3P8B B;  2HMA A;  4M75 E;  1RAC B;  1Z9Z A;  2OTL A;  1AEY A;  4RKU E;  3V7S A;  3RBB B;  3S3M A;  4FW2 A;  1PKT A;  5IHK A;  3UAT A;  3M0S A;  3G71 A;  2LT1 A;  1NJI R;  1YJ9 A;  4O5V A;  1HXD A;  2VVK A;  3M58 A;  2D0N A;  4WTO B;  2COZ A;  2LCL A;  4M7A D;  4Z02 A;  1Q95 G;  1HJD A;  2FPD A;  3CCE Q;  3CCV A;  2F2W A;  1RAA B;  2AK5 A;  5GMK i;  2XD0 A;  1TH7 A;  4PJO A;  2HCK A;  4ELZ C;  3JV3 A;  3URG A;  1R77 A;  1G3T A;  1Q81 C;  2DXB A;  5CKE A;  4C92 E;  1Y0M A;  4DBQ A;  4OB3 B;  5I2S A;  1BBZ A;  1RLQ C;  2EQI A;  1D1A A;  2ZGW A;  3R6N A;  4NL2 A;  4XTW A;  4E7K A;  2CH4 A;  2Y4Y A;  4EMK B;  3L42 A;  3QBY A;  1QQJ A;  1V29 B;  2DJQ A;  2E64 A;  3BW1 A;  1UJ0 A;  2EGC A;  3MET A;  1YI2 Q;  2KRS A;  1AZG B;  1PC0 A;  2O4X A;  3PMT A;  1B3Q A;  1I4K 1;  2EBP A;  2LQW A;  2EAY A;  3EGD B;  5LJ5 d;  1N9R A;  2PUO B;  3CD6 A;  4KUI A;  4ATO A;  5FW9 A;  3LWH A;  3CCV Q;  1YN8 A;  2RM4 A;  3I55 T;  1S72 A;  2HL5 C;  4PJN A;  5FRM A;  2K4Y A;  3TU4 K;  1Y96 B;  2D8H A;  2YHT A;  4E7Z A;  2YUQ A;  2RA2 A;  3OYM A;  1QVF P;  1YHQ A;  2BIV A;  3I56 A;  3CCR A;  2LP5 A;  1ABO A;  2CP2 A;  3RDV A;  3JCM c;  1YJW T;  1BCM A;  1AHJ B;  3VRZ A;  1MGQ A;  1CSK A;  2CDT A;  3S6W A;  3MO8 A;  4JLI A;  4JPB W;  2AZV A;  4A4E A;  3MEA A;  3J80 E;  2L2P A;  4M78 G;  3REA B;  4ZTF A;  1MNE A;  4HCC A;  4BDZ A;  3VUZ A;  3PFS A;  1ZUK A;  3E1S A;  1K73 R;  2A0F B;  3JB9 G;  1PM3 A;  3H9N A;  3I9Q A;  4OF1 A;  5LJ3 j;  2K2V A;  4M4Z A;  1XTD A;  1K1Z A;  1MMA A;  1RL2 A;  3HRT A;  2MWP A;  3CXC P;  1VQK Q;  1OU9 A;  5GAO p;  1IRE B;  1WXU A;  3OQ5 A;  3RNJ A;  1T3S A;  1YWP A;  1SEM A;  1OPL A;  1TSF A;  3EG2 A;  1W2B P;  2BZY A;  1XNI A;  1YP5 A;  4F04 B;  2LQK A;  2FPF A;  2FEI A;  1YJN Q;  1VQ5 Q;  3WXM B;  2DL8 A;  1Y57 A;  3M53 A;  2QYZ A;  3OYA A;  1I5O B;  3C0C A;  3A8O B;  1NYG A;  1YIJ Q;  5M9O A;  4L59 A;  1WHK A;  2JS0 A;  2QDL A;  2BTT A;  1UGV A;  3MEU A;  3OMC A;  1N8R U;  2EQU A;  1ZSZ A;  1KQS A;  4IUU A;  2RQW A;  5KYY B;  1RAF B;  1X2Q A;  3CCM Q;  2HL3 A;  3CPF A;  2DF6 A;  3CC2 A;  2JN0 A;  1UE9 A;  3CCL A;  1VQ7 Q;  2QQ9 A;  3H0H A;  2ROT A;  5GAN 7;  4DEY A;  1KFZ A;  3QWY A;  2DVJ A;  4XK8 E;  1X27 A;  5CKF A;  3JCM b;  3QUI A;  4M7D G;  4IUP A;  2KYM A;  3P8H A;  3M0U A;  1AWW A;  1VQ8 Q;  4FW1 A;  2X3W D;  1VQM T;  2LJ1 A;  1KC8 U;  2L3R A;  4N4H A;  4LUD A;  4M7A E;  5AT1 B;  3GOX A;  3C4S A;  4M7D C;  1K76 A;  4RTU A;  3HKS A;  3A8M B;  3VS2 A;  4A4H A;  1VYV A;  4OMM A;  4JS4 A;  3EG9 B;  4F7U G;  1E6H A;  1OQK A;  1Q82 C;  2FG0 A;  1WX6 A;  3C95 A;  1K8A U;  1VUB A;  2C0T A;  2OTJ Q;  1IGU A;  1LCK A;  2M1H A;  1KQS P;  4PJO C;  2BE7 D;  1T3L A;  1GL5 A;  3PTA A;  2RJE A;  3ME9 A;  2XI9 A;  1WPY A;  4M7D F;  1IZ6 A;  1PD0 A;  5A2Q E;  1K0S A;  1B07 A;  5A0L A;  1IO6 A;  2F69 A;  1IGQ A;  1K4U S;  4Y91 A;  3QJY A;  3J81 E;  2ZPI B;  1FMW A;  3VRY A;  1NE8 A;  4HXJ A;  4XTU A;  1QVF A;  3HFN A;  3JCM f;  3CCS T;  1YNZ A;  1UDL A;  2RQU A;  4IUV A;  4J9B A;  1OZ3 A;  2JNG A;  5FWB A;  2XDD A;  1FX7 A;  3SB2 A;  3HTR A;  1K9M R;  5GAM j;  1VQK A;  2DLP A;  1H3Z A;  2CYZ B;  2MMP A;  4C5G A;  3RKY A;  4IIO A;  2GTJ A;  1KJW A;  4J9C A;  3QG1 A;  4QW2 A;  2P0P A;  1AD5 A;  1NLO C;  3M55 A;  3OYC A;  2I2L A;  3VS3 A;  1NJI U;  2ESW A;  3L2Z A;  3CCL T;  4DBF A;  2MF2 A;  2GCX A;  4JUV A;  1WA7 A;  2F2X A;  2OTJ T;  1SHG A;  2CZ0 B;  3H6Z A;  3S3O A;  2X9H A;  4QQ6 A;  4OB1 B;  1M27 C;  4FM4 B;  1VQM A;  4FYX B;  1I8F A;  2E6N A;  4E7L A;  3HRS A;  1X6B A;  4JZ4 A;  3SD4 A;  2FZC B;  1IRX A;  1M1K U;  4PJO G;  4BE0 A;  4C8Q G;  1LNX A;  1KG1 A;  4J9I A;  1M2V B;  2KT8 A;  4J6X A;  1AOJ A;  2MI6 A;  1VIE A;  4M7A B;  2EPD A;  4C0Z A;  1KHC A;  4A54 A;  3X24 B;  3QYH B;  4N4G A;  1ZSZ B;  2DL3 A;  1VQ8 T;  2CUB A;  2ABL A;  1CKB A;  2X4J A;  5GAN 2;  4E7S A;  3JB9 D;  2RK2 A;  4ZNX A;  5CKH A;  3JSC A;  4IUR A;  3G71 Q;  3NPF A;  1VQ7 T;  1F1B B;  1PSE A;  2CP6 A;  2QI2 A;  3KBG A;  2BE9 B;  1OPK A;  3CCM T;  3RKW A;  3GNG A;  9ATC B;  5D6X A;  4KUL A;  1YFN A;  1VQP T;  3OSS C;  1YI2 A;  1K0X A;  2EVR A;  4IIM A;  4PFP A;  3OMG A;  3M9Q A;  3CCQ T;  2PVO B;  3SHW A;  1LOJ A;  5I22 A;  2J6O A;  3UT1 A;  4AG2 C;  2JMC A;  2O2O A;  1MMD A;  1Q86 R;  3ZFJ A;  2ZZD A;  3QYG B;  1M90 R;  3H41 A;  1RI9 A;  3SWN B;  2KMT A;  4M77 A;  5IN1 A;  3PMI A;  4OP0 A;  1P92 A;  5GAO q;  1VQK T;  1AWX A;  1X2K A;  1IB8 A;  2DER A;  5DLQ E;  4E2F B;  1RAH B;  5KYX A;  2AKL A;  2V8I A;  5GAO r;  2QQS A;  4DOV A;  4CRI A;  4C5H A;  5CKD A;  2R58 A;  3QSU A;  3JCM J;  1TXQ A;  4PKC C;  2A36 A;  4HVV A;  4OMP A;  5EG2 A;  3G7Z A;  1X6O A;  3CCQ Q;  1W4S A;  3H0F A;  5GAN g;  1DJ7 B;  1FXX A;  2COW A;  3CC2 T;  2M16 A;  3DB3 A;  4LXC A;  4DEX A;  1VQP Q;  5GAN 8;  3RUX A;  2RHX A;  2O01 E;  5D6W A;  4J7I A;  5IT9 E;  1WHL A;  4ZGJ B;  4M78 B;  4NS5 A;  1E6G A;  4ORZ A;  4K11 A;  1M1F A;  3CEY A;  4OB0 B;  1ZLM A;  5KCH A;  1RAG B;  2DL4 A;  2MWO A;  2LX9 A;  3NTK A;  1Z9Q A;  4PJL A;  4FYW B;  3Q1J A;  5CAI A;  1QKW A;  1PWT A;  2XDP A;  3E2U A;  1VQ7 A;  4C92 F;  3OYB A;  1N9S A;  2CSQ A;  4EMK A;  3QII A;  2E5K A;  2EFI A;  3VYH B;  1WFW A;  1GCQ C;  2LVM A;  3HL8 A;  2ZCF B;  3GBQ A;  4M7A C;  2YUO A;  4BY6 C;  1YI2 T;  2D6F A;  2FB7 A;  1VIF A;  1W6X A;  2P4T A;  4M77 E;  4OB2 B;  2CT4 A;  5KE3 A;  1PRL C;  1K9M C;  4AFS C;  4MZM A;  2RHZ A;  4RCC A;  3VS1 A;  1UHC A;  2NWM A;  5FRN A;  3CCL Q;  1PHT A;  1JJ2 A;  2P84 A;  3OA6 A;  5I2M A;  4M75 D;  2JT4 A;  2ZPB B;  2QK0 A;  1B34 B;  1M1G A;  1EFN A;  2KBT A;  1BI1 A;  2XKO C;  2DKG A;  3FDR A;  1W2B A;  3CCE T;  5GAM g;  5KYU B;  4FCY A;  1PRM C;  4J7F A;  3CCJ A;  1TS9 A;  2H3J A;  1G3S A;  3CC2 Q;  2A28 A;  2RF0 A;  2DTH A;  2KR3 A;  1C0M A;  1NPP A;  4C0F A;  3CCS Q;  2ATC B;  1N6A A;  4AFQ C;  5GMK h;  5KYW A;  2LQ8 A;  2RHY A;  2YWW A;  2E3I A;  2JJ9 A;  1WI7 A;  3EG0 A;  4J9G A;  4EMG A;  1BB9 A;  1KK7 A;  2QQR A;  5GMK e;  5GAN f;  4ZGE B;  4J9H A;  4JZ3 A;  2DAQ A;  4M7D E;  1VQ9 A;  2R5M A;  2I0N A;  3H8Z A;  5CR2 A;  2O31 A;  4KT0 E;  4RTW A;  3M56 A;  2LZ6 B;  1UGP B;  2KEA A;  1TTH B;  3M5A A;  2JTM A;  1OOT A;  4FT2 A;  2M51 A;  1SKU B;  1M90 C;  1JJ2 P;  1WQ7 A;  1KSW A;  2BKD N;  2LNV A;  4DA4 A;  2Z0W A;  1M3C A;  2DO3 A;  2RK1 A;  4KUD K;  5KH6 A;  2QQA A;  3WVD B;  3V7C A;  4PFZ A;  3U23 A;  3TQ7 P;  4DBH A;  4M77 B;  4KH1 B;  2EKO A;  3CCS A;  5GJW B;  1MHN A;  1N27 A;  4BY6 B;  4C92 A;  3LW5 E;  4OVA A;  2CKK A;  5LJ3 d;  3UPU A;  4HT9 A;  1GFD A;  1Q82 R;  2HQE A;  2LDM A;  5GAM d;  3TRE A;  1BI0 A;  1VQ5 A;  4PK4 A;  5CIU A;  4JRK A;  4PLL A;  3G71 T;  4M75 A;  2CP5 A;  5FU7 C;  3AHU A;  1SPK A;  3L2Q A;  2CT3 A;  1B34 A;  2HQH A;  1WDX A;  4OGE A;  4OMN A;  4F17 A;  3I55 Q;  4D6W A;  1KHI A;  3CCV T;  4C0G A;  4FYY B;  1JO8 A;  1M9S A;  3GLX A;  1GXI E;  1OX8 A;  2NUT A;  1D1C A;  2DIL A;  3INZ A;  3LH0 A;  4M78 E;  2DIQ A;  2WAC A;  1VQ5 T;  1GCP A;  2MIO A;  1KQS S;  3A98 A;  4C92 C;  3FB9 A;  7AT1 B;  5KYN A;  2AIR B;  3DKM A;  2JVV A;  3NGP A;  2LRQ A;  1I07 A;  5LJ3 f;  4PJM A;  4JJD A;  2K5I A;  4D8D A;  4F16 A;  2C0O A;  1X01 A;  2E1H A;  2PTK A;  3E9G A;  1WNL A;  1M4Z A;  2FL7 A;  2K6D A;  2K3Y A;  2RQT A;  2CZ1 B;  1WHM A;  3VS6 A;  4QVC A;  4GBQ A;  2RHU A;  4XU1 A;  2JM8 A;  4OGC A;  1QKX A;  4XU0 A;  2MYS A;  2RPN A;  2W0Z A;  2V8J A;  5HK0 A;  2COY A;  3V7R A;  3JB9 H;  5A0G A;  1AT1 B;  2DZC A;  1G3W A;  2G3R A;  2RJF A;  4JDS A;  1WLP B;  4C0D B;  4B6M A;  3MP1 A;  3O5Z A;  2QQB A;  3VKI A;  4A63 B;  4DBR A;  1YJW A;  3M57 A;  3M0R A;  2FVU A;  2Y4X A;  1G5V A;  3MJX A;  1ZSZ C;  2KDS A;  4RUG A;  3GNF B;  1VQO T;  2KNB B;  5IAY A;  2A3L A;  2F2V A;  4HA8 A;  1Q86 U;  1PNJ A;  3X25 B;  1TWB A;  3JCM X;  2BZX A;  2NYS A;  4GLK A;  1Q7Y C;  3SWN A;  1RUW A;  1UTI A;  5L23 A;  2DTO A;  2FPE A;  2L0A A;  4EDU A;  5J26 A;  3FIF A;  1QP2 A;  1RAI B;  2K3B A;  3MPU B;  3RER A;  4GLM A;  3X28 B;  3FJ5 A;  3HP9 A;  3VS7 A;  1U5S A;  2D9T A;  1EIF A;  4C5I A;  3THK A;  1VQM Q;  3EGX A;  3MKD A;  3CPW A;  4Z89 A;  2L3S A;  3A8H B;  1YJN A;  1LVK A;  3N5B B;  4XAX B;  3SEM A;  3G1J A;  1M3A A;  3TEE A;  1U3O A;  2RQV A;  4C8Q C;  4M75 F;  2P0Q A;  5GAM f;  2A37 A;  2K57 A;  4M7A G;  4BD3 A;  3BFM A;  2DEU A;  1ZUY A;  1QVG S;  3T9N A;  4QT7 A;  3VJP A;  5GAO n;  4RMO A;  3OYI A;  4LDY A;  3S3N A;  2QA4 Q;  4M78 F;  5HCK A;  2HSP A;  2YT6 A;  3OBY A;  1YIJ T;  1M5Q 1;  2O9S A;  1S1N A;  2A08 A;  2FO0 A;  1TUG B;  2OI3 A;  3CPW S;  3JCM P;  1YJN T;  4VUB A;  1KQ2 A;  3JCM V;  5CVI A;  2JXB A;  1MUZ A;  4ELY C;  3H0I A;  5KYY A;  1BIB A;  4BI8 B;  1YJ9 Q;  3TCJ A;  2X35 A;  3CCU Q;  2GFA A;  4JJB A;  1NYF A;  5ECA A;  1TOV A;  5IXB A;  3EG3 A;  4XU2 A;  3OW2 P;  1U06 A;  3UF4 A;  1SSH A;  3EHR A;  1QWF A;  1T0H A;  1ZA1 B;  2QGF B;  4BDY A;  5GAO l;  2JTE A;  2LC4 A;  4M78 C;  1UEC A;  1GBQ A;  2JW4 A;  4O6J A;  4M75 C;  3CC7 Q;  4MMK A;  4EPC A;  3G4S A;  4JS5 A;  2DMO A;  4PLI A;  3OYN A;  3FC3 A;  4Z8A A;  3JCM g;  1PSF A;  5EC7 A;  1ZBX A;  1NEG A;  1OEB A;  1H92 A;  4X9D A;  2MOX A;  2QTV A;  5HK3 A;  3VYG A;  2L3P A;  4C92 D;  2JUF A;  5FU6 C;  3CME A;  4F14 A;  1WYX A;  4ZN1 A;  1QCO A;  2KI7 A;  5DY9 A;  1GRI A;  2DXT A;  4P5N A;  4C8Q B;  3RIR A;  8AT1 B;  1OZ2 A;  4OMQ A;  1D0X A;  1YJW Q;  1ARK A;  2QEX T;  1C6V X;  2LT4 A;  2DA9 A;  3PGG A;  4RG2 A;  1VQL T;  1MV3 A;  3M4G A;  4BE1 A;  1VQ8 A;  2J6K A;  5A0D A;  3VV0 A;  4M77 C;  4F7U F;  1TU0 B;  4IUQ A;  3NFC A;  1D1B A;  4JRQ A;  4LDX A;  1OUL A;  1ZBJ A;  2GBQ A;  4N4I A;  4FU6 A;  1NJI C;  2RNA A;  1I5L A;  2OTL T;  1QP3 A;  1ZA2 B;  4LD9 K;  2ED0 A;  4F7U B;  4LE9 A;  2V26 A;  2KE9 A;  5KE2 A;  2JTF A;  4XTZ A;  3L2W A;  2OAW A;  3R6O A;  1VQL A;  2HD0 A;  1Y96 A;  2F5T X;  1WXB A;  4MML A;  3HPW A;  1PCX A;  4J9D A;  2EYX A;  4FL6 A;  3FEO A;  1GBR A;  3CMA T;  2C06 A;  2CP0 A;  4M77 G;  2QAZ A;  4FSX A;  4X1V A;  3OSV A;  3JRZ A;  1WGS A;  3GIB A;  1FWZ A;  3OYG A;  3A8L B;  2K5L A;  2HQX A;  2KSS A;  4JRP A;  3JCM e;  4PJJ A;  2LNH B;  2HBP A;  5FLX E;  2AKK A;  4JJC A;  2KXC A;  3NMZ C;  3G4S T;  2GTO A;  1M8V A;  2X4Y A;  1HD3 A;  2OAU A;  3KUF A;  1K8A C;  1Q82 U;  2YUP A;  2A7Y A;  1QMC A;  3QPH A;  1VQN Q;  3I5R A;  4BB7 A;  2DX1 A;  2CZ6 B;  2DJZ A;  2E6Z A;  2LCS A;  3EFR A;  4Z88 A;  3M4Y A;  5LJ5 j;  4M7A F;  1WHH A;  2JMA A;  3MP8 A;  2P4R A;  5LJ3 h;  4KGV B;  1S72 T;  3PT9 A;  3PE0 A;  3L2R A;  2RB6 A;  1R8O B;  2M0O A;  5LJ3 e;  2DNU A;  1OYX A;  4B9X A;  2D0Q B;  1EZZ B;  4OML A;  5DM7 R;  2GFU A;  3I56 T;  3CCR T;  3G6E T;  3V8L A;  4PL6 A;  2L89 A;  1KQ1 A;  3BY7 A;  5AYF A;  4RTT A;  3EGX B;  1LPL A;  2RO0 A;  1G3Y A;  5LJ5 g;  2B8A A;  2HZY A;  3GP8 A;  3UWN A;  2DFU A;  1U1S A;  2ED1 A;  4E7H A;  2J06 A;  2VUB A;  2QTX A;  2KRO A;  1XOV A;  4X9C A;  4EMK C;  1KD1 R;  2FZG B;  2RI2 A;  4CC3 A;  5HY6 A;  2HDA A;  2XHC A;  2EW3 A;  1YIT T;  1D0Z A;  2ZPG B;  4ZGD B;  3HFO A;  4LUE A;  4C92 B;  2DRM A;  3OYL A;  2J6F A;  2L5Q A;  2RI5 A;  4RTV A;  3NTI A;  3EHQ A;  4AT1 B;  1O75 A;  3EG9 A;  1VQ4 T;  2YRV A;  3QWX X;  2OTJ A;  1NG2 A;  3I55 A;  2EJ9 A;  2ROL A;  1MMN A;  2CS7 A;  1UFF A;  2VXE A;  5I21 A;  3CCJ T;  4AFU C;  3JCM h;  2KAF A;  1ZSG A;  5KCO A;  1Y07 A;  2AHJ B;  2FRW A;  2XIC A;  4M78 D;  3JB9 J;  1HSQ A;  2HNI A;  3KXT A;  2EWN A;  1Q7Y U;  2F5K A;  2VWF A;  4YTL A;  3JCM Q;  4RTX A;  4QQD A;  2VB6 A;  1IXD A;  3BDU A;  1R0B G;  1IHW A;  4NL3 A;  1V1C A;  2G6F X;  2X4W A;  3LX7 A;  3CBP A;  3EH2 A;  1B7T A;  8ATC B;  1TUD A;  3CC4 T;  4RTY A;  3A1P A;  2WSF E;  3NTH A;  4IKF A;  3MEW A;  4XU3 A;  1A0N B;  4Q5W A; 
#chains in the Genus database with same CATH homology
 1WX6 A;  1UUE A;  1BK2 A;  2V1Q A;  1I07 A;  2C0T A;  2LQN A;  1WXT A;  1LCK A;  1BU1 A;  3EG1 A;  1PKS A;  1T3L A;  1YCS B;  3I5S A;  1J3T A;  4JJD A;  1GL5 A;  4D8D A;  4F16 A;  2C0O A;  2FRY A;  1SRL A;  2PTK A;  1I0C A;  2DL5 A;  1M3B A;  2DBK A;  1K0S A;  2HEQ A;  2K6D A;  1B07 A;  1IO6 A;  2RQT A;  3M0T A;  1JXO A;  3VS6 A;  4RTZ A;  2KRM A;  1K4U S;  4GBQ A;  2GQI A;  2YDL A;  2JM8 A;  2ECZ A;  1QKX A;  1VYU A;  2J05 A;  2PZ1 A;  3VRY A;  2RPN A;  4HXJ A;  2W0Z A;  4CC4 B;  4Y92 A;  1JU5 C;  1YNZ A;  1VA7 A;  1UDL A;  2RQU A;  2H8H A;  1QWE A;  4J9B A;  1WLP B;  1G83 A;  1ABQ A;  2EGA A;  1UG1 A;  1I1J A;  3O5Z A;  5FWB A;  4A63 B;  2DLP A;  2B86 A;  2DM1 A;  2DRK A;  2GNC A;  2EYZ A;  4OMO A;  3M0R A;  3I35 A;  4IIO A;  2GTJ A;  1KJW A;  4J9C A;  1MV0 B;  4RUG A;  4HCK A;  1AD5 A;  1NLO C;  2KNB B;  3VS0 A;  3VS3 A;  2ESW A;  2F2V A;  1WA7 A;  2F2X A;  1VYT A;  1SHG A;  1PNJ A;  2CH4 W;  1FYN A;  2BZX A;  1M8M A;  1N5Z A;  3TSW A;  1M27 C;  2D8J A;  2DL7 A;  3KFV A;  1RUW A;  1UTI A;  5L23 A;  2FPE A;  1X6G A;  2L0A A;  2PNI A;  2C0I A;  2K3B A;  1SRM A;  1X6B A;  4GLM A;  4JZ4 A;  3REB B;  3FJ5 A;  3VS7 A;  3IQL A;  1U5S A;  4J9I A;  2KT8 A;  1AOJ A;  2GGR A;  3THK A;  5IXF A;  2EPD A;  1ZX6 A;  1X43 A;  2EYW A;  2K7A A;  2JM9 A;  4Z89 A;  2EKH A;  2L3S A;  2HBW A;  1WIE A;  3SEM A;  1AWJ A;  2DL3 A;  1M3A A;  1U3O A;  2CUB A;  2ABL A;  1CKB A;  1T0J A;  2RQV A;  4KRT A;  1K9A A;  4ZNX A;  2A37 A;  1QLY A;  3NPF A;  1KIK A;  1GCQ A;  4HVW A;  1G2B A;  1ZUY A;  1OPK A;  1UHF A;  4QT7 A;  5HCK A;  2HSP A;  2YSQ A;  2YT6 A;  3VS5 A;  2O9S A;  2KXD A;  1S1N A;  4EIK A;  2A08 A;  2FO0 A;  2OI3 A;  1K0X A;  2M0Y A;  2EVR A;  2LJ3 A;  2CUD A;  4IIM A;  2DYB A;  4AFZ C;  1JQQ A;  2JXB A;  1MUZ A;  2X3X D;  3H0I A;  1YWO A;  1SHF A;  3SHW A;  5I22 A;  2J6O A;  4J9E A;  4AG2 C;  2BZ8 A;  2JMC A;  2O2O A;  4JJB A;  1E7O A;  1NYF A;  5ECA A;  5IXB A;  3EG3 A;  3H41 A;  1RI9 A;  1U06 A;  1X69 A;  3UF4 A;  1SSH A;  3EHR A;  1H3H A;  1QWF A;  1T0H A;  1M30 A;  3CQT A;  3PVL A;  5IHN A;  2JTE A;  3M0P A;  1UEC A;  1GBQ A;  1TUC A;  2JW4 A;  2AZS A;  2SRC A;  2DMO A;  1AWX A;  1X2K A;  4LN2 A;  2KYB A;  2VKN A;  4Z8A A;  2AKL A;  4ESR A;  5EC7 A;  1NEG A;  1OEB A;  2CSI A;  2EGE A;  1H92 A;  2MOX A;  2L3P A;  4F14 A;  1WYX A;  2A36 A;  4HVV A;  4OMP A;  1Z9Z A;  2DBM A;  1AEY A;  1GRI A;  3RBB B;  3H0F A;  2NUZ A;  4OMQ A;  2J7I A;  1PKT A;  5IHK A;  3UAT A;  3M0S A;  1ARK A;  2K79 A;  4DEX A;  5IHI A;  2VVK A;  2D0N A;  2DA9 A;  2LJ0 A;  1MV3 A;  2J6K A;  1HJD A;  3NHN A;  2FPD A;  4ORZ A;  1E6G A;  3M0Q A;  4K11 A;  2F2W A;  2AK5 A;  1ZBJ A;  1ZLM A;  2GBQ A;  2DL4 A;  2O9V A;  2RNA A;  2HCK A;  3JV3 A;  2ED0 A;  1Z9Q A;  1Y0M A;  1QKW A;  4LE9 A;  3ULR B;  1BBZ A;  1PWT A;  2KE9 A;  1RLQ C;  1TG0 A;  2EQI A;  2OAW A;  3R6N A;  4HVU A;  2CSQ A;  2V1R A;  2ENM A;  2E5K A;  1WFW A;  1GCQ C;  2CH4 A;  4WCI A;  2W10 A;  2DJQ A;  3TSZ A;  1AWO A;  3GBQ A;  2LMJ A;  1UJ0 A;  2YUO A;  1WXB A;  2EGC A;  2KRS A;  1AZG B;  4J9D A;  1ZUU A;  2EYX A;  2MCN A;  1W6X A;  1NM7 A;  1GBR A;  1B3Q A;  2CT4 A;  2EBP A;  2LQW A;  1NEB A;  2KRN A;  1PRL C;  4AFS C;  4X1V A;  3VS1 A;  3ZL7 C;  2XMF A;  1UHC A;  5FWC A;  2NWM A;  5FW9 A;  1PHT A;  1YN8 A;  2JT4 A;  2KGT A;  2LNH B;  3UA7 A;  2AKK A;  4JJC A;  2KXC A;  3NMZ C;  4R0K A;  2GTO A;  2D8H A;  2RQR A;  1HD3 A;  1EFN A;  2KBT A;  2YUQ A;  2YUP A;  4J9F A;  4D8K A;  2LP5 A;  3I5R A;  1PRM C;  2DX1 A;  1ABO A;  2O88 A;  2YUN A;  2LCS A;  2A28 A;  4Z88 A;  2RF0 A;  2L3Q A;  2KR3 A;  3VRZ A;  2JMA A;  1CSK A;  2CDT A;  2P4R A;  4LNP A;  1W1F A;  4JPB W;  3PE0 A;  2AZV A;  3EGU A;  4AFQ C;  2L2P A;  3REA B;  3VS4 A;  1FMK A;  1AZE A;  2DNU A;  3EG0 A;  1WI7 A;  4J9G A;  1ZUK A;  1BB9 A;  1AVZ C;  4J9H A;  4JZ3 A;  4OML A;  3I9Q A;  2I0N A;  2SEM A;  5IH2 A;  4M4Z A;  2O31 A;  4RTW A;  1K1Z A;  4RTT A;  2EYY A;  2LZ6 B;  2KEA A;  2D1X A;  3UA6 A;  1OOT A;  2OJ2 A;  2M51 A;  1WXU A;  1JXM A;  3RNJ A;  1T3S A;  1YWP A;  2RN8 A;  1KSW A;  1SEM A;  1M3C A;  1OPL A;  2ED1 A;  3EG2 A;  2KT1 A;  2BZY A;  1YP5 A;  2J06 A;  3TVT A;  2FPF A;  2FEI A;  2KRO A;  1XOV A;  4CC7 A;  2K2M A;  3U23 A;  1QCF A;  2DL8 A;  1Y57 A;  4CC3 A;  2RMO A;  2HDA A;  4AG1 C;  5GJW B;  3C0C A;  2CRE A;  2EW3 A;  1NYG A;  2K9G A;  4E6R A;  1GFD A;  2JS0 A;  2QDL A;  4LUE A;  2BTT A;  1UGV A;  4FSS A;  2DRM A;  2J6F A;  1UJY A;  4RTV A;  2RQW A;  1X2Q A;  2DF6 A;  2JS2 A;  2DE0 X;  3EHQ A;  1UE9 A;  1SPK A;  2CT3 A;  3QWX X;  3H0H A;  2ROT A;  1NG2 A;  4DEY A;  1KFZ A;  3QWY A;  1WDX A;  2DVJ A;  1X27 A;  1OV3 A;  2LX7 A;  2ROL A;  2KYM A;  4OMN A;  1UFF A;  4F17 A;  3M0U A;  1AWW A;  4CC2 A;  2X3W D;  4AFU C;  1ZSG A;  1JO8 A;  2FRW A;  1JEG A;  2LJ1 A;  1HSQ A;  4LUD A;  3LH5 A;  3PVQ A;  2VWF A;  2DIL A;  4RTX A;  1K76 A;  2IIM A;  1V1C A;  2G6F X;  4RTU A;  1W70 A;  5GJV B;  1GCP A;  2MIO A;  1GFC A;  1NLP C;  3A98 A;  3VS2 A;  1TUD A;  1VYV A;  1CKA A;  4RTY A;  4OMM A;  1RLP C;  1E6H A;  5I11 A;  1A0N B;  1H8K A;  2FG0 A;  3NGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...