1BBZA

Crystal structure of the abl-sh3 domain complexed with a designed high-affinity peptide ligand: implications for sh3-ligand interactions
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABL TYROSINE KINASE
publication title Crystal structure of the abl-SH3 domain complexed with a designed high-affinity peptide ligand: implications for SH3-ligand interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (transferase/peptide)
total genus 10
structure length 58
sequence length 58
chains with identical sequence C, E, G
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1998-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1bbzA00
1VYUA 2LMJA 2DRMA 3NMZC 2ROTA 2K79A 2RMOA 2DL4A 2OAWA 3QWXX 1KFZA 4Y92A 1OV3A 3CQTA 3ZL7C 5GJWB 2MOXA 2HDAA 4HVVA 4D8DA 5L23A 2D8HA 1AWOA 2PZ1A 4HCKA 3H0IA 2EGAA 1NYGA 2RQTA 1JXOA 2DL7A 1W70A 2F2VA 2FRWA 2K9GA 2JM8A 1WYXA 4F16A 1HD3A 4CC3A 3O5ZA 2CH4A 3FJ5A 4JZ4A 1ZLMA 1ZBJA 3M0UA 1ZX6A 3GBQA 3A98A 4IIMA 2L0AA 2AZVA 2KR3A 4RTYA 3NPFA 2EQIA 1I07A 3REBB 1AZEA 1WA7A 2LP5A 4ZNXA 3VS6A 1JO8A 1YWOA 2DL8A 1T3LA 1LCKA 5ECAA 2VVKA 1QLYA 1FMKA 4F17A 2RQUA 4DEXA 1T0HA 1AWWA 3PE0A 2AKKA 1IO6A 3M0RA 3UF4A 1UHCA 1CKBA 4LE9A 4JJDA 1GCQC 5I22A 1SPKA 2EGCA 2HCKA 4CC2A 4AFZC 1NM7A 2I0NA 1ARKA 1X27A 3EGUA 4K11A 1X43A 1X69A 2DBKA 2DILA 3EHRA 1ZUUA 2LZ6B 2A36A 2CH4W 2GGRA 2FEIA 1YCSB 1PRLC 1AEYA 1X6GA 2V1RA 4A63B 4OMOA 2DRKA 1ABOA 1W1FA 2J7IA 4CC4B 2YUNA 1YWPA 2J6FA 1OPLA 1GL5A 3VRYA 4GBQA 1KIKA 2JS2A 3R6NA 1FYNA 2EPDA 2JW4A 4GLMA 2NWMA 3VS1A 1GFDA 3KFVA 2L3QA 2D8JA 1TUCA 1AVZC 1U3OA 1OPKA 1UJ0A 1KSWA 2EVRA 2FG0A 3U23A 1WX6A 1AD5A 2KRMA 3SHWA 1WFWA 2ABLA 1VYVA 4J9FA 5IHIA 1SRMA 3I35A 2X3XD 2DX1A 4Z88A 4AFUC 2L3SA 1K4US 1UUEA 4KRTA 1UGVA 1BK2A 2KT8A 3TSWA 1WXUA 2FRYA 2BZ8A 4Z89A 1PRMC 2ESWA 5FWCA 4FSSA 1SRLA 1K0XA 4RTWA 2KNBB 1GFCA 1UG1A 2LCSA 2YUQA 1VYTA 2YSQA 2RNAA 4IIOA 1ZUKA 1JEGA 2KT1A 2FO0A 2DL3A 2FPFA 4AG2C 2J6KA 1NG2A 2AK5A 1U5SA 2D0NA 3VS2A 5EC7A 4E6RA 2ENMA 1GCQA 2A37A 2NUZA 3VS4A 1YNZA 2LNHB 5GJVB 4LN2A 1H8KA 4AFQC 2JMCA 3THKA 4OMPA 3UA7A 2FPEA 2EBPA 1CSKA 5IXBA 1NEGA 1RLQC 2LJ3A 2RQRA 3M0PA 2JM9A 4J9HA 4J9EA 1G2BA 4OMQA 2JS0A 3RNJA 1K1ZA 4HVUA 2P4RA 4F14A 1K76A 2YT6A 1AZGB 1WXTA 2B86A 1GBRA 5FW9A 1AOJA 1QWEA 4OMNA 2C0OA 2RQVA 1CKAA 3EG0A 3I9QA 2O9SA 1OOTA 1M27C 2IIMA 2LQNA 1PKTA 1A0NB 2W0ZA 2K6DA 1S1NA 1B3QA 1JQQA 4ESRA 2X3WD 2RPNA 2DBMA 1M3BA 4J9CA 4AG1C 1WI7A 2JXBA 1BBZA 2DNUA 1M3AA 1UDLA 3M0TA 3ULRB 2JMAA 1UHFA 2K3BA 3EG2A 2KXCA 2DMOA 1ZUYA 3I5SA 5IXFA 2GNCA 1X2QA 2OI3A 2W10A 1MUZA 4RTTA 4RTZA 4HVWA 2K2MA 1N5ZA 2MIOA 3H0HA 2OJ2A 3UA6A 4CC7A 2GQIA 1MV3A 1GCPA 1I1JA 3M0QA 1B07A 1RUWA 2EYZA 4Z8AA 1H92A 3VS5A 5IHKA 1E6GA 1M30A 3TSZA 5I11A 1H3HA 2EYYA 2J6OA 1SEMA 2G6FX 1PNJA 1SHFA 2PTKA 2CSIA 1YN8A 4JJCA 1SSHA 2F2WA 2L3PA 2LX7A 4RTVA 2LJ1A 4RTUA 2XMFA 2KBTA 2JT4A 1NLOC 1GBQA 1AWXA 3M0SA 2SRCA 1I0CA 1MV0B 1ABQA 1UE9A 2CDTA 1JU5C 2LQWA 1HSQA 3IQLA 2GTJA 1AWJA 1W6XA 2DA9A 1BB9A 1T3SA 2DE0X 1TUDA 5IH2A 1VA7A 3NHNA 1Y57A 2CT4A 4EIKA 2VWFA 2YUOA 4R0KA 2ROLA 2DYBA 2H8HA 4OMMA 2O88A 2HBWA 2RQWA 1UJYA 5FWBA 2EGEA 1PKSA 2O2OA 1M8MA 1J3TA 1YP5A 1X6BA 4ORZA 3C0CA 3TVTA 2V1QA 2CREA 2GTOA 2J05A 1E7OA 3PVLA 4JPBW 2ED1A 2RN8A 4J9IA 2AZSA 2EYWA 2YUPA 1V1CA 2BZYA 5IHNA 1T0JA 1NEBA 2HEQA 1XOVA 2K7AA 2A08A 3LH5A 4JJBA 2E5KA 1TG0A 1Z9QA 3VS3A 2CUBA 2ED0A 2KRNA 3H0FA 3I5RA 2L2PA 3JV3A 3SEMA 1GRIA 2DL5A 2ECZA 4LNPA 1NLPC 4LUDA 1RI9A 4JZ3A 4QT7A 2KE9A 1RLPC 1EFNA 2D1XA 1Z9ZA 2EW3A 2DLPA 1OEBA 2M0YA 4LUEA 2CT3A 3REAB 4HXJA 3EG3A 1Y0MA 2CSQA 3EHQA 2M51A 3PVQA 4OMLA 1PWTA 2EKHA 2KYMA 2PNIA 3VS7A 1HJDA 1NYFA 2KROA 4J9GA 2KEAA 2BZXA 2RF0A 3UATA 1WLPB 1SHGA 2J06A 1ZSGA 2JTEA 4J9DA 1QWFA 1K0SA 2KXDA 4RUGA 2AKLA 4X1VA 2O9VA 2QDLA 1UECA 1UTIA 1WDXA 5HCKA 4RTXA 1WIEA 1M3CA 3VS0A 3NGPA 2A28A 2O31A 2DJQA 3H41A 4AFSC 2KRSA 2VKNA 1KJWA 4DEYA 1WXBA 2FPDA 2C0IA 4WCIA 2SEMA 4M4ZA 1K9AA 2GBQA 1PHTA 2DM1A 2F2XA 2LJ0A 1QCFA 2KGTA 2DVJA 4D8KA 2EYXA 1G83A 2MCNA 2CUDA 3VRZA 2DF6A 1UFFA 1QKWA 2C0TA 1X2KA 3EG1A 1QKXA 2BTTA 2HSPA 3QWYA 3RBBB 2YDLA 1E6HA 1BU1A 1JXMA 1U06A 4J9BA 2KYBA
chains in the Genus database with same CATH superfamily
3NMZC 3CCEA 2PVDB 5FU7B 4R55A 4M77F 1RABB 3QKJA 5LJ5f 4XTUA 4J6WA 2VYTA 1BI3A 3EFOA 3ZL7C 2LC4A 2MOXA 3EGDB 4HCCA 3HFOA 4IUQA 4LDXA 2DZ9A 5IN1A 2FRWA 2K9GA 4OVAA 3CCJA 3UPUA 2QQ9A 3OBWA 3FJ5A 1WJSA 3HHTB 3ME9A 3M0UA 1Y71A 1ZX6A 4IIMA 2D6FA 4IUVA 4RTYA 4JDSA 1MNEA 2EQIA 1B34A 1D1CA 2MYSA 4A4HA 1VQKA 4F7UE 5HK3A 3INZA 4E7HA 5AYFA 1FMKA 4IKFA 1QVFP 2COZA 4DOWA 1YIJT 1T0HA 4RMOA 2QG9B 3M0RA 4E7SA 1CKBA 1M2VA 1VQOA 5I22A 1Q81U 4K11A 1UGQB 2E4HA 2FB7A 5KE3A 2LZ6B 3GP8A 2FEIA 1WQWA 3P8HA 3CCET 3CPWS 1GXIE 2L8DA 1QW1A 4PJMA 1TSFA 1GL5A 1X01A 3LWHA 4GBQA 3RIRA 3CCRA 2HBPA 1NZ9A 2F1LA 2NWMA 3JB9H 4XTWA 3TCJA 5FRMA 4M7AG 4KH1B 1YIJQ 1U3OA 4EMKB 3OYLA 3WVDB 2FG0A 3E9FA 4N4HA 4PNOA 3U23A 1WX6A 1SRMA 3V8JA 2DX1A 2CP6A 1K4US 1LVKA 2KT8A 2FRYA 3CCJT 4ZTFA 2O4XB 1PM3A 1OQKA 4OB2B 4Z89A 1BYMA 3QDFA 4FYYB 2ESWA 5FWCA 4PJOG 1K0XA 3KUFA 3JSCA 1GFCA 1UG1A 1KD1C 2YUQA 4OMFB 4IIOA 1JEGA 3CCEQ 1KK7A 1O75A 1QCNA 1VQKT 5GAN3 5D6WA 4J8OA 2QQRA 2J6KA 3VKIA 2AK5A 1QQJA 1NPPA 5EC7A 3EH2A 3MEUA 3VS4A 2A37A 2NUZA 2DEQA 2FL7A 4M77A 3JCMe 4C5IA 1AHJB 2DZCA 2ZZDA 2WSCE 2EBPA 4C5EA 2WSEE 5IXBA 1VQ7A 2RQRA 3M0PA 2E3IA 5GAOq 4J9HA 4MDXA 4OMQA 2V8IA 3CCJQ 3VYHB 1ZQ1A 2I2LA 2JTFA 1K1ZA 4F14A 3JB9G 3M54A 3QHSA 4M77E 3VU3C 4ELZC 1GBRA 1OI1A 1NJIC 2RHUA 3L1AA 3CMAA 1JJ2P 2AIRB 2C0OA 1Q7YU 1VQKQ 4M75B 3EG0A 3I9QA 2O9SA 2IIMA 3CCRT 3URGA 2X4YA 1PKTA 4OF1A 1A0NB 3OBYA 3NTHA 2EQKA 3P8BB 1VIFA 1S1NA 2X3WD 1QVGS 3KXTA 1M3BA 4M78B 4C8QB 1VQ6A 2DJZA 4FYXB 1KHIA 1WI7A 4A4KA 3JCMP 2JXBA 2VGNA 4LD6A 2DXTA 1M3AA 2P4TA 3X20B 2JMAA 1UHFA 3QSUA 4A4FA 2DTOA 1OX9A 1X2QA 2GNCA 1I5LA 4KGVB 2W10A 4BI4A 3V8KA 2K2MA 4ME7A 1VQ5Q 3UA6A 3M4GA 4CC7A 1MV3A 1B07A 1RUWA 2KMTA 3CCRQ 3H6ZA 3A5ZB 5IAYA 4FU6A 3TSZA 4XU2A 1DJ7B 2CP0A 2QGFB 1SHFA 2E41A 3QBYA 3NFCA 3RERA 1YN8A 1JRIA 4JJCA 1WJQA 2L3PA 3QYGB 4BDYA 4M7DA 4RTVA 3G1JA 2P0KA 4Y91A 2XMFA 3JB9I 3EGXA 2FZGB 3QJYA 5GAN7 5GANd 2CDTA 1JU5C 2LQWA 3JCMJ 3CMAT 4F7UB 1W2BP 2HNIA 4P5NA 2EFIA 4C0GA 4LXCA 4M7DE 5KH6A 3J81E 1RACB 2OTJA 3BE3A 4OMMA 2JUFA 2HBWA 3C12A 1FWZA 5FWBA 2LRQA 2CKKA 4BE2A 3I56A 1J3TA 2E6ZA 4ORZA 2RA2A 2J05A 1NJIR 1E7OA 1Q82R 4J6XA 4XK8E 4JPBW 2ED1A 1UB4A 2RN8A 2EYWA 5GANe 5IHNA 5L8RE 4M7DC 2HEQA 3EGDA 3TEEA 2JJ9A 3GPLA 3CMAQ 4IUPA 1D1AA 2XDPA 1BI2A 2EYQA 2L2PA 4XAXB 1KHCA 3OS2A 4XTYA 2ECZA 3QYHB 4IUUA 3OW2S 4BE1A 1RLPC 1Z9ZA 5GAN4 4M75F 2DLPA 2M0YA 2XI9A 3CCUA 3EG3A 2X4JA 3OB9A 1Y0MA 3EHQA 1VQMA 5CKBA 4HT9A 2KYMA 5FU7C 4FYVB 2QGGA 3VS7A 3VUZA 1HJDA 1SKUB 4LDWA 2ZPFB 4PJJA 5FLXE 5A0GA 2J06A 3PT9A 1BKBA 2X4WA 1Y96B 3QZ5B 1UEBA 4OP0A 3JCMc 5LJ3f 1Q86C 2OTJT 1WIEA 2LX9A 1G8XA 1N9RA 3HRTA 5GAN8 3I56T 1ZA1B 2YXYA 1N6AA 2HQHA 2L3RA 4DEYA 1WXBA 4MZMA 2FZKB 2F2XA 5FROA 2KGTA 3HP9A 2Y4YA 3RMSA 1KQSA 1G83A 4C0FA 1M1KC 4XQ3A 1PG5B 2PQWA 2DD4A 1IHWA 5KYWB 1K9MC 4EMKA 3EFSA 2C0TA 3E2UA 1NBEB 4M77D 1OU8A 2C06A 4J9BA 1VYUA 2FVUA 2LMJA 4OGCA 3OSSC 2K79A 2RMOA 2O4XA 4V2SA 2OAWA 2OTJQ 1KFZA 1OV3A 4XU1A 4FW2A 4L59A 5HY6A 4F7UF 4PJLA 3CQTA 4PFPA 2XKOC 2DVEA 3CCUT 2HDAA 5A2QE 2PZ1A 1N27A 2EGAA 1NYGA 1UGSB 4EDUA 1JXOA 2DL7A 1W70A 1VQMT 1YI2T 2DETA 1QP3A 1WQ7A 4M7AC 2QEXA 1HD3A 5LJ5d 1OZ2A 3L2ZA 4RG8A 4CC3A 2M0OA 3O5ZA 5KE2A 3GBQA 2DIQA 2IG0A 2RHXA 2GQVA 2RHZA 1I07A 1F1BB 4KGZB 3FDRA 1AZEA 3RR6A 2LP5A 2X9HA 3VS6A 4PJOC 1YWOA 3OS5A 1LCKA 5ECAA 3WXMB 4NL2A 1QVFS 3CCUQ 2XG8D 1AWWA 1M4ZA 3QUIA 4M75A 1VQLA 3UF4A 5I2SA 1VQ4T 3META 1TUGB 2E12A 5LJ5e 4CC2A 2HCKA 1ZHIA 4OGEA 1VQMQ 3E19A 4ATOA 5GANj 1ARKA 1YI2Q 3OQ5A 5LJ3j 2DBKA 2DILA 4M78A 4C8QA 2A36A 2CH4W 1VUBA 2QQBA 3M55A 1Q86R 4X9CA 3H9NA 4JRKA 2AHJB 1AEYA 1X6GA 5AT1B 4OMOA 4QVZA 4A4GA 4FL6A 1W1FA 2RJDA 2YUNA 3LWIA 1B7TA 3OS1A 3VRYA 2YRCA 2RJFA 1M2OA 3GLXA 3M9QA 4C92B 3HSBA 3EG9B 3JCMX 3VS1A 4M7DD 2O01E 3X25B 4HKEA 4LDVA 4QW2A 4M78E 4C8QE 1M1KR 2X35A 4PJNA 2LVMA 1KSWA 5GAN2 3VJPA 2CP3A 2PVGB 1K9MR 5KYUA 4XTZA 3CXCA 1VQ4Q 3V7RA 4AFUC 1WHKA 1UUEA 4KRTA 1BK2A 3TSWA 1WXUA 4JLGA 3BDUA 2QEXT 2DPPB 2QYZA 3CCQA 4FIBA 4C5GA 2GCXA 2MWOA 2VGMA 1VYTA 2RNAA 2QI2A 3HL8A 2DTHA 2KT1A 2R58A 3V8LA 2LCLA 4M78C 4C8QC 2VASA 1X75C 4AG2C 5J26A 4KBMB 1VQPA 2QQSA 5KYYB 2D0NA 1QCOA 3ER0A 1I81A 2COYA 2Y4XA 2F5TX 1BIBA 5GJVB 1H8KA 1IREB 2JMCA 4OMPA 3THKA 4F7UA 2FPEA 4PLLA 1KQ1A 3MJXA 2LJ3A 3CC4A 1V76A 1FMVA 3LH0A 1FX7A 3OMCA 1K8AU 1G2BA 3KBGA 3VYGA 2QEXQ 3RNJA 2KSSA 3A8HB 1WHHA 1K76A 5CIUA 5GAOp 2M1HA 5FW9A 4NL3A 4RCBA 4L6V5 2YLBA 1QWEA 3PTAA 4DQ2A 3CMEA 2RQVA 2V8JA 3NTIA 5GAMf 2K6DA 2A3LA 2P0QA 1B3QA 2HAXA 2KY9A 4RKUE 2DBMA 4GY5A 1V29B 4J9CA 4AG1C 3EAEA 5D6YA 2CP2A 1BBZA 1JBMA 3DLLA 5DLQE 4DBHA 2Z0WA 2DK3A 2HKQB 3MEWA 2HMAA 2DXBA 3E1SA 4QQ6A 3CCQT 5IXFA 4XTVA 4RTTA 1MUZA 2E65A 4M7AB 1O9SA 3H0HA 3S3MA 3RDVA 3S6WA 5HKCA 2LNVA 3OYEA 1TH7A 1VQPT 2HQXA 5DLOA 3SWNC 1VQ9A 2EYYA 3JCMd 1M9SA 1SEMA 3CCSA 4PJOB 1PNJA 4M7DF 4EMHA 3OYCA 2XHCA 5DY9A 2JZ2A 1EX4A 3CC4T 4FT4A 1Y96A 3OA6A 2JVVA 5CKEA 5LJ5j 2LJ1A 2KBTA 3UWNA 2IPOB 5LJ5g 1GBQA 1AWXA 4ELYC 2SRCA 1FMWA 3CCQQ 1I0CA 2JOYA 2B8AA 3OYMA 3A8MB 3IQLA 1HSQA 2AT1B 2RJEA 2GTJA 1UGPB 2H3JA 2MK5A 1W6XA 2DA9A 3CMET 1BB9A 1QVPA 2DE0X 5IH2A 3NHNA 1Y57A 4X34A 3LX7A 1VQPQ 1W2BS 4LDUA 3CD6A 3H8ZA 2RB6A 3QPHA 2ROLA 3DLMA 5KYWA 5D6XA 3ZEHA 1VQOT 1X6OA 3CC4Q 1HXDA 2DXUA 3TVTA 4EMGA 3OYDA 2GTOA 3JCMh 3PVLA 3LGLA 4YTLA 5GAMj 4BY6C 1V1CA 2RHYA 3FB9A 4E7IA 4D6WA 2RK1A 2X51A 2VXEA 2K7AA 3LH5A 4JJBA 3CMEQ 3M56A 4Y28E 1TG0A 3UT1A 3VS3A 2CUBA 2KRNA 2YWWA 5A0LA 1VQ9T 3I5RA 3SEMA 4M75D 1GRIA 3CCVA 4QQGA 1RI9A 3CCST 4II1A 4KULA 4BB7A 1VQOQ 4EPCA 3FRNA 1OEBA 2CYZB 2CT3A 1YFNA 4M78D 4C8QD 1RAEB 4HXJA 3DB3A 5D7UA 1OZ3A 4JRIA 5KYXB 2QTXA 2OTLA 5CO7A 3PVQA 3LGFA 4M75G 4FSXA 1XJWB 1PWTA 3OYHA 2QA4A 3HFNA 2E70A 4J9GA 5GMKl 4QKUA 5KYNA 3UATA 1RAAB 1WLPB 2HSEB 3CC2A 2XU8A 1SHGA 2ZPHB 3OSVA 3OY9A 1ZSGA 3CD6T 1YJWA 4J9DA 3TQ7P 2EJFA 4RUGA 2QDLA 1ZBXA 2EQUA 1VQ9Q 1UTIA 1IRXA 4RTXA 1M3CA 5CKHA 2E1HA 4M7AF 1R0BG 3CCSQ 2QDYB 1VQ7T 3PFSA 1KD1R 1FXXA 4E7ZA 1RAGB 4OB3B 2C0IA 3MHXA 3M5AA 4WCIA 1K9AA 2DM1A 2HD0A 4C92A 1R0CB 1U1TA 3EG9A 3J80E 2RH2A 5LJ3d 4PJOF 2CUDA 2EQMA 4L5GA 3G7ZA 1QKWA 2MI6A 3GOXA 3EG1A 3QXEB 2HSPA 3V7SA 3RBBB 4BUGA 4PL6A 1BU1A 1U06A 5CKFA 1KC8U 8AT1B 2DRMA 4AMCA 5FU6B 2DERA 2OX7A 1VIEA 5CCAA 3CCVT 3CPWA 1VQ6T 2DL4A 4FM4B 4C92E 1BI0A 4Y92A 2E10A 1VQ7Q 3SWNB 5GJWB 1Q82U 1HK9A 3G4SA 1K73C 4HVVA 5J39A 3BW1A 2D8HA 2OTLT 3H0IA 2RJCA 5LJ3e 3TREA 1N8RU 1VQ8A 5KYYA 1OULA 3GF5A 3HRSA 3FJPA 2JM8A 1WYXA 3M53A 3CCMA 1RAFB 1SSFA 2QA4T 2R57A 2CH4A 3MEVA 1G3WA 3L2UA 1NPRA 1ZLMA 4C92C 1ZBJA 1YITA 3CC2T 2GFAA 2KR3A 2L5QA 1MMAA 5GANh 4CI0C 1C1AA 1XNIA 1I8FA 2K5LA 1TWBA 5GAOm 3CCVQ 4BD3A 1WA7A 1VQ6Q 2VC8A 2DL8A 3JCMg 4VUBA 2RM4A 1PC0A 1PSEA 1RAHB 2QQAA 4QVDA 3G6EA 1QLYA 2V26A 1C0MA 4F17A 2XIDA 4JRPA 3MP6A 1KQSP 2GF7A 2NUPB 2KAFA 2OTLQ 4N4GA 1S72A 4O6JA 4LE9A 5GAOn 4M78F 4C8QF 4JJDA 5I2MA 1GCQC 1Y07A 4AFZC 1X27A 3EGUA 3HRUA 1X43A 2ZGWA 4Q5WA 1X69A 3PMIA 1ZUUA 4RG2A 2QA4Q 1BI1A 2GGRA 3BY7A 4BY6B 1YCSB 3CC2Q 1D09B 4J6YA 1MGQA 4A63B 2XD0A 1WHMA 2J7IA 2VUBA 4PKCC 9ATCB 4ZN1A 3UDCA 2J6FA 2JN0A 3D7SB 2JS2A 3R6NA 1FYNA 2EPDA 2EQJA 2JW4A 3KFVA 2L3QA 4M7AA 3G4ST 1TUCA 1W4SA 3M4YA 1OPKA 3FC3A 1QVGA 1WHGA 2EVRA 4OB1B 4XTXA 3EFRA 3GIBA 2KRMA 3SHWA 1WFWA 1VYVA 4J9FA 1VQ8T 4DBFA 2X3XD 4Z88A 2K4YA 2L3SA 3OYBA 1UGVA 4DOVA 3PIPA 4JJNK 3CCMT 1WHJA 1EIFA 2BZ8A 1BCMA 2Y90A 4FSSA 4PJOA 4HCZA 2DIGA 1SRLA 2E6NA 1YITT 3C95A 4RTWA 2KNBB 2BIVA 4M7AE 2DO3A 2P84A 2EKOA 2FO0A 5C6SA 1G3YA 2FPFA 1K73R 1C6VX 4DBQA 1U5SA 3VS2A 1ZSZB 4E6RA 3G6ET 3I56Q 3RKXA 1YNZA 2LNHB 4M77G 1IHVA 4LN2A 2CZ0B 3M59A 4PJOE 3G4SQ 2LT1A 2NLUA 1TTHB 1S72T 1CSKA 3RESA 1NEGA 1RLQC 1I4K1 1VQ8Q 1M90U 2JM9A 8ATCB 4ZTJA 3VV0A 1UGRB 1WJRA 3BFMA 4J9EA 3JCMW 3CCMQ 4MMLA 3CBOA 1TS9A 1XQHA 1WXTA 2B86A 3OYJA 5J3BA 2CZ1B 1BCOA 4AT1B 5KCHA 3HKSA 2RK2A 3ZBDA 1TXQA 2CZ7B 4ESRA 3OYFA 1JQQA 2RPNA 1K8AC 3CXCP 4X9DA 3OW2P 1S72Q 1N9SA 3Q1JA 5HK0A 2DNUA 3X26B 1M1FA 5GANg 3PIOA 5LJ3g 4HCBA 5GAMd 2G3RA 2BKDN 2KXCA 3ZFJA 2VV5A 2DMOA 2DD5A 3I5SA 2DYIA 3V7CA 4RTZA 4HT8A 2KI7A 4PFOA 1N5ZA 2MIOA 3HTRA 5LJ5h 5KYXA 1GCPA 1I1JA 2EYZA 3JCMb 5CK9A 1JB0E 3VS5A 4J5YA 1M1KU 1E6GA 1Q81C 5I11A 1K9MU 4E7JA 4DBRA 3J7AF 4C92D 2K3YA 2YLCA 5CQXA 2PTKA 3MEAA 3OW2A 2D9TA 3CC7A 1SSHA 4ZGJB 3CBPA 4PK4A 1RL2A 5GAMe 1YIJA 2LX7A 4M7DG 4RTUA 4WTOB 2JT4A 1NLOC 4KUDK 4E7KA 3G71A 3RKYA 1ABQA 4TVRA 2LQKA 4E47A 1SG5A 5GMKi 1T3SA 1MMNA 1TUDA 2JNGA 3JAME 2CT4A 4EIKA 4BACA 2VWFA 1KQ2A 1IB8A 4R0KA 3QJ6A 3M57A 3MKDA 2DYBA 4ZGEB 1VQLT 2H8HA 2A7YA 1U1SA 2RQWA 4ANJA 3AT1B 3L2QA 2O2OA 1YP5A 2PVOB 1X6BA 4KUIA 3C0CA 3JCMV 2CREA 1Y7XA 3RUXA 1YCYA 2EJ9A 2X4XA 3SWNA 2NUTB 1WNLA 2RI3A 1T0JA 1JJ2S 4BI3A 5GAN5 2A08A 1PSFA 1IGUA 2CP5A 4FCYA 1K8AR 1VOMA 2ED0A 4JS4A 3H0FA 2FHDA 4RCCA 2BE9B 4LNPA 4LUDA 1VQLQ 4QT7A 2KE9A 4IURA 2K5IA 2YRVA 4OB0B 3CC7T 2P0PA 2LCCA 4LUEA 5CR2A 3REAB 3VUBA 3L42A 2CSQA 1Q7YC 2M51A 3ASKA 1EZZB 2PUKB 3G71T 3OMGA 2EKHA 5FU6C 2PNIA 2OAUA 2LTOA 1M1GA 2LDMA 1Q81R 2NUPA 2RF0A 2EIFA 4M7AD 2MAMA 2JTEA 2XDDA 1VQ5A 1LOJA 4A4EA 1WDXA 2MPXC 5EG2A 3VS0A 3NGPA 1M5Q1 2A28A 2O31A 2XICA 1P92A 3H41A 1R77A 4AFSC 6AT1B 3CC7Q 2KRSA 4C92F 1KJWA 3C4SA 3GNGA 4PJOD 2FPDA 1QVFA 2LJ0A 3S3OA 1PHTA 3WVEB 1QCFA 4F04B 5C0MA 2A0FB 2DVJA 3FIFA 2EYXA 2MCNA 3G71Q 2RD1A 3VRZA 2DF6A 3LW5E 2KDSA 1MNDA 1OU9A 4KGXB 2HKNA 2YDLA 1E6HA 1JXMA 1NE8A 2KYBA 2J6OA 3P8DA 2ROTA 3LLRA 3CBMA 3LYIA 2XDBA 2M9UA 1XTDA 1D0XA 2K2VA 3QWXX 3FEOA 4PLIA 5DM7R 5A0DA 5CAIA 4C0DC 3RMQA 4D8DA 5L23A 2LQ8A 1AWOA 4JLIA 3JB9D 5LL6S 4HCKA 5GMKj 1WPYA 2RQTA 5GAMg 2MWPA 2QTVA 1ZSZA 1MMDA 5GAOr 4FYWB 3OYNA 3L2RA 2F2VA 1KC8C 2DXCA 4F16A 1ZA2B 3MCAB 4JZ4A 1D3BB 3A98A 3JRZA 3QIIA 2L0AA 2AZVA 1U8RA 1WGSA 3NPFA 4A54A 1VQ5T 3REBB 1Q82C 4ZNXA 1JO8A 1T3LA 3L2WA 1Q7YR 5M9OA 2VVKA 1N8RC 1IXDA 2RQUA 4DEXA 1D0ZA 3PE0A 3SDZA 2AKKA 1IO6A 2M02A 1KQSS 1UHCA 3R6OA 2R5AA 3QO3A 1SPKA 2EGCA 4QVCA 1NM7A 2I0NA 4M77C 1LJOA 4BI8B 3I55A 2DEUA 3EHRA 4M78G 2CP7A 4C8QG 4ZN3A 1RADB 2E3HA 4QQDA 2ATCB 3DB4A 3QZ9B 4UC4A 1ZSZC 5CVIA 3JCMf 1G3SA 1PRLC 1D0YA 3CPWP 2V1RA 2DRKA 1ABOA 2MF2A 1YJ9A 2LT4A 4CC4B 3PNWC 1YWPA 1OPLA 1JJ2A 1KIKA 1KD1U 1KG1A 4GLMA 1QMCA 5KYUB 1GFDA 3CEYA 3MP1A 1LPLA 2EAYA 2D8JA 3C94A 1AVZC 5IT9E 1UJ0A 3T9NA 4J7FA 1AD5A 2KK4A 2ABLA 5IHIA 1PD0A 3I35A 1H641 3GNFB 2RO0A 1PRMC 1YBYA 2FZCB 3CD6Q 1Q95G 3EFOB 2DKGA 2LCSA 2YSQA 2ZAEA 1ZUKA 4E2FB 2QK0A 4B6MA 2DL3A 5GMKm 5GAOl 1NG2A 2K5FA 2K3XA 1NJIU 4J83A 2ENMA 1GCQA 1M8VA 2QAZA 1G3TA 4Z02A 4AFQC 2ZPGB 3UA7A 4F7UG 4KT0E 2E64A 1KC8R 4XU0A 2WSFE 1BIAA 3L2VA 4C5HA 4JRQA 4BDZA 4O5VA 1ACMB 3JB9F 1B34B 4IUTA 3A8LB 3MPUB 2JS0A 2PUOB 3EH1A 2QXFA 3I55T 2CZ6B 1QP2A 2GFUA 2RI5A 4HVUA 2P4RA 3BDLA 1WHLA 2YT6A 1AZGB 4JUVA 1YJWT 2KVQG 3A8OB 4MZPA 4A53A 4LD9K 5LJ3h 2V8KA 1TOVA 1AOJA 1YJ9T 1VQNA 1N8RR 4OMNA 1CKAA 3MP8A 3X24B 1OOTA 1M27C 2DFUA 2LQNA 1M2VB 2W0ZA 1PCXA 2NUTA 1W2BA 1QVGP 3OYYA 1M90C 4FT2A 1G5VA 3A1PA 3CXCS 4PFZA 3X28B 4N0AA 2HL5C 7AT1B 5GAN6 4C0DB 5FRNA 1UDLA 4GLKA 3M0TA 3ULRB 2H3EB 2F69A 3I55Q 2K3BA 3EG2A 2ZPBB 4R56A 2WACA 4ZGDB 1ZUYA 3PGGA 1YJWQ 4MMKA 2OI3A 3CCLA 4BE0A 4HVWA 1YI2A 2OJ2A 5CKDA 1YJ9Q 2PU9B 2GQIA 5I21A 1SF9A 3M0QA 2DTIA 4Z8AA 1H92A 4MDWA 5IHKA 1M30A 3OS0A 3HPWA 3QG1A 1H3HA 4JS5A 3M58A 5GANf 1YJNA 2G6FX 1YHQA 2CSIA 2F2WA 2E5QA 3F70A 3A8GB 2DAQA 4HA8A 3JCMQ 2HQEA 4N0AC 3M0SA 1MHNA 3TU4K 1VQ4A 1MV0B 3OYIA 1UE9A 1HYOA 4M77B 1K73U 2HZYA 2COWA 3OYAA 1VQNT 3E9GA 2M16A 1AWJA 1RI0A 2VB6A 1VA7A 4LDYA 2YUOA 3N5BB 2HL3A 2BE7D 2RI2A 2ZPIB 1R8OB 2O88A 4C0ZA 1D1BA 1UJYA 2EGEA 2L89A 4B9WA 2BUDA 1PKSA 2CS7A 1M8MA 2V1QA 1AT1B 1TU0B 2MMPA 1YITQ 4J9IA 4NS5A 2AZSA 2YUPA 3SB2A 2VXFA 4J7IA 2BZYA 3CCLT 4NOYA 1NEBA 1XOVA 1OX8A 1VQNQ 1H3ZA 2E5KA 1M90R 1WZOA 1Z9QA 3OYGA 3JB9J 3G6EQ 3NTKA 3JV3A 2DL5A 2K57A 4EMKC 1NLPC 1YJNT 4JZ3A 1YHQT 1D3BA 1I5OB 3QDRB 1EFNA 2D1XA 2R5MA 3OYKA 2QASA 2EW3A 2XK0A 1Q86U 2YHTA 4B9XA 2F5KA 1PD1A 4OMLA 4XU3A 2YRDA 3S3NA 3DKMA 1IZ6A 3AHUA 3O8VA 2RHIA 4DA4A 3CCLQ 1RAIB 1NYFA 4E7LA 4CRIA 2KROA 3PMTA 2KEAA 2BZXA 5CQYA 1LNXA 1QWFA 1K0SA 2KXDA 2AKLA 4X1VA 2O9VA 1UECA 4N4IA 4M7DB 5HCKA 4M75E 3EGXB 2IVWA 1YJNQ 1IGQA 2DJQA 2ZPEB 1YHQQ 3SFMA 2JTMA 5GMKe 2VKNA 2CGHA 2EJGA 3FLGA 3CPFA 4FW1A 2FYKA 3SD4A 2SEMA 4M4ZA 2GBQA 2NYSA 4MZTA 4C92G 1OYXA 4KH0B 4D8KA 5KCOA 2KQWA 4WF2A 2D0QB 1UFFA 2EWNA 1MMGA 3MO8A 2ZCFB 1X2KA 5GMKh 1QKXA 4M75C 5GAMh 2BTTA 3QWYA 3RKWA
chains in the Genus database with same CATH topology
1VYUA 2LMJA 2DRMA 3NMZC 2ROTA 2K79A 2RMOA 2DL4A 2OAWA 3QWXX 1KFZA 4Y92A 1OV3A 3CQTA 3ZL7C 5GJWB 2MOXA 2HDAA 4HVVA 4D8DA 5L23A 2D8HA 1AWOA 2PZ1A 4HCKA 3H0IA 2EGAA 1NYGA 2RQTA 1JXOA 2DL7A 1W70A 2F2VA 2FRWA 2K9GA 2JM8A 1WYXA 4F16A 1HD3A 4CC3A 3O5ZA 2CH4A 3FJ5A 4JZ4A 1ZLMA 1ZBJA 3M0UA 1ZX6A 3GBQA 3A98A 4IIMA 2L0AA 2AZVA 2KR3A 4RTYA 3NPFA 2EQIA 1I07A 3REBB 1AZEA 1WA7A 2LP5A 4ZNXA 3VS6A 1JO8A 1YWOA 2DL8A 1T3LA 1LCKA 5ECAA 2VVKA 1QLYA 1FMKA 4F17A 2RQUA 4DEXA 1T0HA 1AWWA 3PE0A 2AKKA 1IO6A 3M0RA 3UF4A 1UHCA 1CKBA 4LE9A 4JJDA 1GCQC 5I22A 1SPKA 2EGCA 2HCKA 4CC2A 4AFZC 1NM7A 2I0NA 1ARKA 1X27A 3EGUA 4K11A 1X43A 1X69A 2DBKA 2DILA 3EHRA 1ZUUA 2LZ6B 2A36A 2CH4W 2GGRA 2FEIA 1YCSB 1PRLC 1AEYA 1X6GA 2V1RA 4A63B 4OMOA 2DRKA 1ABOA 1W1FA 2J7IA 4CC4B 2YUNA 1YWPA 2J6FA 1OPLA 1GL5A 3VRYA 4GBQA 1KIKA 2JS2A 3R6NA 1FYNA 2EPDA 2JW4A 4GLMA 2NWMA 3VS1A 1GFDA 3KFVA 2L3QA 2D8JA 1TUCA 1AVZC 1U3OA 1OPKA 1UJ0A 1KSWA 2EVRA 2FG0A 3U23A 1WX6A 1AD5A 2KRMA 3SHWA 1WFWA 2ABLA 1VYVA 4J9FA 5IHIA 1SRMA 3I35A 2X3XD 2DX1A 4Z88A 4AFUC 2L3SA 1K4US 1UUEA 4KRTA 1UGVA 1BK2A 2KT8A 3TSWA 1WXUA 2FRYA 2BZ8A 4Z89A 1PRMC 2ESWA 5FWCA 4FSSA 1SRLA 1K0XA 4RTWA 2KNBB 1GFCA 1UG1A 2LCSA 2YUQA 1VYTA 2YSQA 2RNAA 4IIOA 1ZUKA 1JEGA 2KT1A 2FO0A 2DL3A 2FPFA 4AG2C 2J6KA 1NG2A 2AK5A 1U5SA 2D0NA 3VS2A 5EC7A 4E6RA 2ENMA 1GCQA 2A37A 2NUZA 3VS4A 1YNZA 2LNHB 5GJVB 4LN2A 1H8KA 4AFQC 2JMCA 3THKA 4OMPA 3UA7A 2FPEA 2EBPA 1CSKA 5IXBA 1NEGA 1RLQC 2LJ3A 2RQRA 3M0PA 2JM9A 4J9HA 4J9EA 1G2BA 4OMQA 2JS0A 3RNJA 1K1ZA 4HVUA 2P4RA 4F14A 1K76A 2YT6A 1AZGB 1WXTA 2B86A 1GBRA 5FW9A 1AOJA 1QWEA 4OMNA 2C0OA 2RQVA 1CKAA 3EG0A 3I9QA 2O9SA 1OOTA 1M27C 2IIMA 2LQNA 1PKTA 1A0NB 2W0ZA 2K6DA 1S1NA 1B3QA 1JQQA 4ESRA 2X3WD 2RPNA 2DBMA 1M3BA 4J9CA 4AG1C 1WI7A 2JXBA 1BBZA 2DNUA 1M3AA 1UDLA 3M0TA 3ULRB 2JMAA 1UHFA 2K3BA 3EG2A 2KXCA 2DMOA 1ZUYA 3I5SA 5IXFA 2GNCA 1X2QA 2OI3A 2W10A 1MUZA 4RTTA 4RTZA 4HVWA 2K2MA 1N5ZA 2MIOA 3H0HA 2OJ2A 3UA6A 4CC7A 2GQIA 1MV3A 1GCPA 1I1JA 3M0QA 1B07A 1RUWA 2EYZA 4Z8AA 1H92A 3VS5A 5IHKA 1E6GA 1M30A 3TSZA 5I11A 1H3HA 2EYYA 2J6OA 1SEMA 2G6FX 1PNJA 1SHFA 2PTKA 2CSIA 1YN8A 4JJCA 1SSHA 2F2WA 2L3PA 2LX7A 4RTVA 2LJ1A 4RTUA 2XMFA 2KBTA 2JT4A 1NLOC 1GBQA 1AWXA 3M0SA 2SRCA 1I0CA 1MV0B 1ABQA 1UE9A 2CDTA 1JU5C 2LQWA 1HSQA 3IQLA 2GTJA 1AWJA 1W6XA 2DA9A 1BB9A 1T3SA 2DE0X 1TUDA 5IH2A 1VA7A 3NHNA 1Y57A 2CT4A 4EIKA 2VWFA 2YUOA 4R0KA 2ROLA 2DYBA 2H8HA 4OMMA 2O88A 2HBWA 2RQWA 1UJYA 5FWBA 2EGEA 1PKSA 2O2OA 1M8MA 1J3TA 1YP5A 1X6BA 4ORZA 3C0CA 3TVTA 2V1QA 2CREA 2GTOA 2J05A 1E7OA 3PVLA 4JPBW 2ED1A 2RN8A 4J9IA 2AZSA 2EYWA 2YUPA 1V1CA 2BZYA 5IHNA 1T0JA 1NEBA 2HEQA 1XOVA 2K7AA 2A08A 3LH5A 4JJBA 2E5KA 1TG0A 1Z9QA 3VS3A 2CUBA 2ED0A 2KRNA 3H0FA 3I5RA 2L2PA 3JV3A 3SEMA 1GRIA 2DL5A 2ECZA 4LNPA 1NLPC 4LUDA 1RI9A 4JZ3A 4QT7A 2KE9A 1RLPC 1EFNA 2D1XA 1Z9ZA 2EW3A 2DLPA 1OEBA 2M0YA 4LUEA 2CT3A 3REAB 4HXJA 3EG3A 1Y0MA 2CSQA 3EHQA 2M51A 3PVQA 4OMLA 1PWTA 2EKHA 2KYMA 2PNIA 3VS7A 1HJDA 1NYFA 2KROA 4J9GA 2KEAA 2BZXA 2RF0A 3UATA 1WLPB 1SHGA 2J06A 1ZSGA 2JTEA 4J9DA 1QWFA 1K0SA 2KXDA 4RUGA 2AKLA 4X1VA 2O9VA 2QDLA 1UECA 1UTIA 1WDXA 5HCKA 4RTXA 1WIEA 1M3CA 3VS0A 3NGPA 2A28A 2O31A 2DJQA 3H41A 4AFSC 2KRSA 2VKNA 1KJWA 4DEYA 1WXBA 2FPDA 2C0IA 4WCIA 2SEMA 4M4ZA 1K9AA 2GBQA 1PHTA 2DM1A 2F2XA 2LJ0A 1QCFA 2KGTA 2DVJA 4D8KA 2EYXA 1G83A 2MCNA 2CUDA 3VRZA 2DF6A 1UFFA 1QKWA 2C0TA 1X2KA 3EG1A 1QKXA 2BTTA 2HSPA 3QWYA 3RBBB 2YDLA 1E6HA 1BU1A 1JXMA 1U06A 4J9BA 2KYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYU A;  2LMJ A;  2DRM A;  3NMZ C;  2ROT A;  2K79 A;  2RMO A;  2DL4 A;  2OAW A;  3QWX X;  1KFZ A;  4Y92 A;  1OV3 A;  3CQT A;  3ZL7 C;  5GJW B;  2MOX A;  2HDA A;  4HVV A;  4D8D A;  5L23 A;  2D8H A;  1AWO A;  2PZ1 A;  4HCK A;  3H0I A;  2EGA A;  1NYG A;  2RQT A;  1JXO A;  2DL7 A;  1W70 A;  2F2V A;  2FRW A;  2K9G A;  2JM8 A;  1WYX A;  4F16 A;  1HD3 A;  4CC3 A;  3O5Z A;  2CH4 A;  3FJ5 A;  4JZ4 A;  1ZLM A;  1ZBJ A;  3M0U A;  1ZX6 A;  3GBQ A;  3A98 A;  4IIM A;  2L0A A;  2AZV A;  2KR3 A;  4RTY A;  3NPF A;  2EQI A;  1I07 A;  3REB B;  1AZE A;  1WA7 A;  2LP5 A;  4ZNX A;  3VS6 A;  1JO8 A;  1YWO A;  2DL8 A;  1T3L A;  1LCK A;  5ECA A;  2VVK A;  1QLY A;  1FMK A;  4F17 A;  2RQU A;  4DEX A;  1T0H A;  1AWW A;  3PE0 A;  2AKK A;  1IO6 A;  3M0R A;  3UF4 A;  1UHC A;  1CKB A;  4LE9 A;  4JJD A;  1GCQ C;  5I22 A;  1SPK A;  2EGC A;  2HCK A;  4CC2 A;  4AFZ C;  1NM7 A;  2I0N A;  1ARK A;  1X27 A;  3EGU A;  4K11 A;  1X43 A;  1X69 A;  2DBK A;  2DIL A;  3EHR A;  1ZUU A;  2LZ6 B;  2A36 A;  2CH4 W;  2GGR A;  2FEI A;  1YCS B;  1PRL C;  1AEY A;  1X6G A;  2V1R A;  4A63 B;  4OMO A;  2DRK A;  1ABO A;  1W1F A;  2J7I A;  4CC4 B;  2YUN A;  1YWP A;  2J6F A;  1OPL A;  1GL5 A;  3VRY A;  4GBQ A;  1KIK A;  2JS2 A;  3R6N A;  1FYN A;  2EPD A;  2JW4 A;  4GLM A;  2NWM A;  3VS1 A;  1GFD A;  3KFV A;  2L3Q A;  2D8J A;  1TUC A;  1AVZ C;  1U3O A;  1OPK A;  1UJ0 A;  1KSW A;  2EVR A;  2FG0 A;  3U23 A;  1WX6 A;  1AD5 A;  2KRM A;  3SHW A;  1WFW A;  2ABL A;  1VYV A;  4J9F A;  5IHI A;  1SRM A;  3I35 A;  2X3X D;  2DX1 A;  4Z88 A;  4AFU C;  2L3S A;  1K4U S;  1UUE A;  4KRT A;  1UGV A;  1BK2 A;  2KT8 A;  3TSW A;  1WXU A;  2FRY A;  2BZ8 A;  4Z89 A;  1PRM C;  2ESW A;  5FWC A;  4FSS A;  1SRL A;  1K0X A;  4RTW A;  2KNB B;  1GFC A;  1UG1 A;  2LCS A;  2YUQ A;  1VYT A;  2YSQ A;  2RNA A;  4IIO A;  1ZUK A;  1JEG A;  2KT1 A;  2FO0 A;  2DL3 A;  2FPF A;  4AG2 C;  2J6K A;  1NG2 A;  2AK5 A;  1U5S A;  2D0N A;  3VS2 A;  5EC7 A;  4E6R A;  2ENM A;  1GCQ A;  2A37 A;  2NUZ A;  3VS4 A;  1YNZ A;  2LNH B;  5GJV B;  4LN2 A;  1H8K A;  4AFQ C;  2JMC A;  3THK A;  4OMP A;  3UA7 A;  2FPE A;  2EBP A;  1CSK A;  5IXB A;  1NEG A;  1RLQ C;  2LJ3 A;  2RQR A;  3M0P A;  2JM9 A;  4J9H A;  4J9E A;  1G2B A;  4OMQ A;  2JS0 A;  3RNJ A;  1K1Z A;  4HVU A;  2P4R A;  4F14 A;  1K76 A;  2YT6 A;  1AZG B;  1WXT A;  2B86 A;  1GBR A;  5FW9 A;  1AOJ A;  1QWE A;  4OMN A;  2C0O A;  2RQV A;  1CKA A;  3EG0 A;  3I9Q A;  2O9S A;  1OOT A;  1M27 C;  2IIM A;  2LQN A;  1PKT A;  1A0N B;  2W0Z A;  2K6D A;  1S1N A;  1B3Q A;  1JQQ A;  4ESR A;  2X3W D;  2RPN A;  2DBM A;  1M3B A;  4J9C A;  4AG1 C;  1WI7 A;  2JXB A;  1BBZ A;  2DNU A;  1M3A A;  1UDL A;  3M0T A;  3ULR B;  2JMA A;  1UHF A;  2K3B A;  3EG2 A;  2KXC A;  2DMO A;  1ZUY A;  3I5S A;  5IXF A;  2GNC A;  1X2Q A;  2OI3 A;  2W10 A;  1MUZ A;  4RTT A;  4RTZ A;  4HVW A;  2K2M A;  1N5Z A;  2MIO A;  3H0H A;  2OJ2 A;  3UA6 A;  4CC7 A;  2GQI A;  1MV3 A;  1GCP A;  1I1J A;  3M0Q A;  1B07 A;  1RUW A;  2EYZ A;  4Z8A A;  1H92 A;  3VS5 A;  5IHK A;  1E6G A;  1M30 A;  3TSZ A;  5I11 A;  1H3H A;  2EYY A;  2J6O A;  1SEM A;  2G6F X;  1PNJ A;  1SHF A;  2PTK A;  2CSI A;  1YN8 A;  4JJC A;  1SSH A;  2F2W A;  2L3P A;  2LX7 A;  4RTV A;  2LJ1 A;  4RTU A;  2XMF A;  2KBT A;  2JT4 A;  1NLO C;  1GBQ A;  1AWX A;  3M0S A;  2SRC A;  1I0C A;  1MV0 B;  1ABQ A;  1UE9 A;  2CDT A;  1JU5 C;  2LQW A;  1HSQ A;  3IQL A;  2GTJ A;  1AWJ A;  1W6X A;  2DA9 A;  1BB9 A;  1T3S A;  2DE0 X;  1TUD A;  5IH2 A;  1VA7 A;  3NHN A;  1Y57 A;  2CT4 A;  4EIK A;  2VWF A;  2YUO A;  4R0K A;  2ROL A;  2DYB A;  2H8H A;  4OMM A;  2O88 A;  2HBW A;  2RQW A;  1UJY A;  5FWB A;  2EGE A;  1PKS A;  2O2O A;  1M8M A;  1J3T A;  1YP5 A;  1X6B A;  4ORZ A;  3C0C A;  3TVT A;  2V1Q A;  2CRE A;  2GTO A;  2J05 A;  1E7O A;  3PVL A;  4JPB W;  2ED1 A;  2RN8 A;  4J9I A;  2AZS A;  2EYW A;  2YUP A;  1V1C A;  2BZY A;  5IHN A;  1T0J A;  1NEB A;  2HEQ A;  1XOV A;  2K7A A;  2A08 A;  3LH5 A;  4JJB A;  2E5K A;  1TG0 A;  1Z9Q A;  3VS3 A;  2CUB A;  2ED0 A;  2KRN A;  3H0F A;  3I5R A;  2L2P A;  3JV3 A;  3SEM A;  1GRI A;  2DL5 A;  2ECZ A;  4LNP A;  1NLP C;  4LUD A;  1RI9 A;  4JZ3 A;  4QT7 A;  2KE9 A;  1RLP C;  1EFN A;  2D1X A;  1Z9Z A;  2EW3 A;  2DLP A;  1OEB A;  2M0Y A;  4LUE A;  2CT3 A;  3REA B;  4HXJ A;  3EG3 A;  1Y0M A;  2CSQ A;  3EHQ A;  2M51 A;  3PVQ A;  4OML A;  1PWT A;  2EKH A;  2KYM A;  2PNI A;  3VS7 A;  1HJD A;  1NYF A;  2KRO A;  4J9G A;  2KEA A;  2BZX A;  2RF0 A;  3UAT A;  1WLP B;  1SHG A;  2J06 A;  1ZSG A;  2JTE A;  4J9D A;  1QWF A;  1K0S A;  2KXD A;  4RUG A;  2AKL A;  4X1V A;  2O9V A;  2QDL A;  1UEC A;  1UTI A;  1WDX A;  5HCK A;  4RTX A;  1WIE A;  1M3C A;  3VS0 A;  3NGP A;  2A28 A;  2O31 A;  2DJQ A;  3H41 A;  4AFS C;  2KRS A;  2VKN A;  1KJW A;  4DEY A;  1WXB A;  2FPD A;  2C0I A;  4WCI A;  2SEM A;  4M4Z A;  1K9A A;  2GBQ A;  1PHT A;  2DM1 A;  2F2X A;  2LJ0 A;  1QCF A;  2KGT A;  2DVJ A;  4D8K A;  2EYX A;  1G83 A;  2MCN A;  2CUD A;  3VRZ A;  2DF6 A;  1UFF A;  1QKW A;  2C0T A;  1X2K A;  3EG1 A;  1QKX A;  2BTT A;  2HSP A;  3QWY A;  3RBB B;  2YDL A;  1E6H A;  1BU1 A;  1JXM A;  1U06 A;  4J9B A;  2KYB A; 
#chains in the Genus database with same CATH topology
 3NMZ C;  3CCE A;  2PVD B;  5FU7 B;  4R55 A;  4M77 F;  1RAB B;  3QKJ A;  5LJ5 f;  4XTU A;  4J6W A;  2VYT A;  1BI3 A;  3EFO A;  3ZL7 C;  2LC4 A;  2MOX A;  3EGD B;  4HCC A;  3HFO A;  4IUQ A;  4LDX A;  2DZ9 A;  5IN1 A;  2FRW A;  2K9G A;  4OVA A;  3CCJ A;  3UPU A;  2QQ9 A;  3OBW A;  3FJ5 A;  1WJS A;  3HHT B;  3ME9 A;  3M0U A;  1Y71 A;  1ZX6 A;  4IIM A;  2D6F A;  4IUV A;  4RTY A;  4JDS A;  1MNE A;  2EQI A;  1B34 A;  1D1C A;  2MYS A;  4A4H A;  1VQK A;  4F7U E;  5HK3 A;  3INZ A;  4E7H A;  5AYF A;  1FMK A;  4IKF A;  1QVF P;  2COZ A;  4DOW A;  1YIJ T;  1T0H A;  4RMO A;  2QG9 B;  3M0R A;  4E7S A;  1CKB A;  1M2V A;  1VQO A;  5I22 A;  1Q81 U;  4K11 A;  1UGQ B;  2E4H A;  2FB7 A;  5KE3 A;  2LZ6 B;  3GP8 A;  2FEI A;  1WQW A;  3P8H A;  3CCE T;  3CPW S;  1GXI E;  2L8D A;  1QW1 A;  4PJM A;  1TSF A;  1GL5 A;  1X01 A;  3LWH A;  4GBQ A;  3RIR A;  3CCR A;  2HBP A;  1NZ9 A;  2F1L A;  2NWM A;  3JB9 H;  4XTW A;  3TCJ A;  5FRM A;  4M7A G;  4KH1 B;  1YIJ Q;  1U3O A;  4EMK B;  3OYL A;  3WVD B;  2FG0 A;  3E9F A;  4N4H A;  4PNO A;  3U23 A;  1WX6 A;  1SRM A;  3V8J A;  2DX1 A;  2CP6 A;  1K4U S;  1LVK A;  2KT8 A;  2FRY A;  3CCJ T;  4ZTF A;  2O4X B;  1PM3 A;  1OQK A;  4OB2 B;  4Z89 A;  1BYM A;  3QDF A;  4FYY B;  2ESW A;  5FWC A;  4PJO G;  1K0X A;  3KUF A;  3JSC A;  1GFC A;  1UG1 A;  1KD1 C;  2YUQ A;  4OMF B;  4IIO A;  1JEG A;  3CCE Q;  1KK7 A;  1O75 A;  1QCN A;  1VQK T;  5GAN 3;  5D6W A;  4J8O A;  2QQR A;  2J6K A;  3VKI A;  2AK5 A;  1QQJ A;  1NPP A;  5EC7 A;  3EH2 A;  3MEU A;  3VS4 A;  2A37 A;  2NUZ A;  2DEQ A;  2FL7 A;  4M77 A;  3JCM e;  4C5I A;  1AHJ B;  2DZC A;  2ZZD A;  2WSC E;  2EBP A;  4C5E A;  2WSE E;  5IXB A;  1VQ7 A;  2RQR A;  3M0P A;  2E3I A;  5GAO q;  4J9H A;  4MDX A;  4OMQ A;  2V8I A;  3CCJ Q;  3VYH B;  1ZQ1 A;  2I2L A;  2JTF A;  1K1Z A;  4F14 A;  3JB9 G;  3M54 A;  3QHS A;  4M77 E;  3VU3 C;  4ELZ C;  1GBR A;  1OI1 A;  1NJI C;  2RHU A;  3L1A A;  3CMA A;  1JJ2 P;  2AIR B;  2C0O A;  1Q7Y U;  1VQK Q;  4M75 B;  3EG0 A;  3I9Q A;  2O9S A;  2IIM A;  3CCR T;  3URG A;  2X4Y A;  1PKT A;  4OF1 A;  1A0N B;  3OBY A;  3NTH A;  2EQK A;  3P8B B;  1VIF A;  1S1N A;  2X3W D;  1QVG S;  3KXT A;  1M3B A;  4M78 B;  4C8Q B;  1VQ6 A;  2DJZ A;  4FYX B;  1KHI A;  1WI7 A;  4A4K A;  3JCM P;  2JXB A;  2VGN A;  4LD6 A;  2DXT A;  1M3A A;  2P4T A;  3X20 B;  2JMA A;  1UHF A;  3QSU A;  4A4F A;  2DTO A;  1OX9 A;  1X2Q A;  2GNC A;  1I5L A;  4KGV B;  2W10 A;  4BI4 A;  3V8K A;  2K2M A;  4ME7 A;  1VQ5 Q;  3UA6 A;  3M4G A;  4CC7 A;  1MV3 A;  1B07 A;  1RUW A;  2KMT A;  3CCR Q;  3H6Z A;  3A5Z B;  5IAY A;  4FU6 A;  3TSZ A;  4XU2 A;  1DJ7 B;  2CP0 A;  2QGF B;  1SHF A;  2E41 A;  3QBY A;  3NFC A;  3RER A;  1YN8 A;  1JRI A;  4JJC A;  1WJQ A;  2L3P A;  3QYG B;  4BDY A;  4M7D A;  4RTV A;  3G1J A;  2P0K A;  4Y91 A;  2XMF A;  3JB9 I;  3EGX A;  2FZG B;  3QJY A;  5GAN 7;  5GAN d;  2CDT A;  1JU5 C;  2LQW A;  3JCM J;  3CMA T;  4F7U B;  1W2B P;  2HNI A;  4P5N A;  2EFI A;  4C0G A;  4LXC A;  4M7D E;  5KH6 A;  3J81 E;  1RAC B;  2OTJ A;  3BE3 A;  4OMM A;  2JUF A;  2HBW A;  3C12 A;  1FWZ A;  5FWB A;  2LRQ A;  2CKK A;  4BE2 A;  3I56 A;  1J3T A;  2E6Z A;  4ORZ A;  2RA2 A;  2J05 A;  1NJI R;  1E7O A;  1Q82 R;  4J6X A;  4XK8 E;  4JPB W;  2ED1 A;  1UB4 A;  2RN8 A;  2EYW A;  5GAN e;  5IHN A;  5L8R E;  4M7D C;  2HEQ A;  3EGD A;  3TEE A;  2JJ9 A;  3GPL A;  3CMA Q;  4IUP A;  1D1A A;  2XDP A;  1BI2 A;  2EYQ A;  2L2P A;  4XAX B;  1KHC A;  3OS2 A;  4XTY A;  2ECZ A;  3QYH B;  4IUU A;  3OW2 S;  4BE1 A;  1RLP C;  1Z9Z A;  5GAN 4;  4M75 F;  2DLP A;  2M0Y A;  2XI9 A;  3CCU A;  3EG3 A;  2X4J A;  3OB9 A;  1Y0M A;  3EHQ A;  1VQM A;  5CKB A;  4HT9 A;  2KYM A;  5FU7 C;  4FYV B;  2QGG A;  3VS7 A;  3VUZ A;  1HJD A;  1SKU B;  4LDW A;  2ZPF B;  4PJJ A;  5FLX E;  5A0G A;  2J06 A;  3PT9 A;  1BKB A;  2X4W A;  1Y96 B;  3QZ5 B;  1UEB A;  4OP0 A;  3JCM c;  5LJ3 f;  1Q86 C;  2OTJ T;  1WIE A;  2LX9 A;  1G8X A;  1N9R A;  3HRT A;  5GAN 8;  3I56 T;  1ZA1 B;  2YXY A;  1N6A A;  2HQH A;  2L3R A;  4DEY A;  1WXB A;  4MZM A;  2FZK B;  2F2X A;  5FRO A;  2KGT A;  3HP9 A;  2Y4Y A;  3RMS A;  1KQS A;  1G83 A;  4C0F A;  1M1K C;  4XQ3 A;  1PG5 B;  2PQW A;  2DD4 A;  1IHW A;  5KYW B;  1K9M C;  4EMK A;  3EFS A;  2C0T A;  3E2U A;  1NBE B;  4M77 D;  1OU8 A;  2C06 A;  4J9B A;  1VYU A;  2FVU A;  2LMJ A;  4OGC A;  3OSS C;  2K79 A;  2RMO A;  2O4X A;  4V2S A;  2OAW A;  2OTJ Q;  1KFZ A;  1OV3 A;  4XU1 A;  4FW2 A;  4L59 A;  5HY6 A;  4F7U F;  4PJL A;  3CQT A;  4PFP A;  2XKO C;  2DVE A;  3CCU T;  2HDA A;  5A2Q E;  2PZ1 A;  1N27 A;  2EGA A;  1NYG A;  1UGS B;  4EDU A;  1JXO A;  2DL7 A;  1W70 A;  1VQM T;  1YI2 T;  2DET A;  1QP3 A;  1WQ7 A;  4M7A C;  2QEX A;  1HD3 A;  5LJ5 d;  1OZ2 A;  3L2Z A;  4RG8 A;  4CC3 A;  2M0O A;  3O5Z A;  5KE2 A;  3GBQ A;  2DIQ A;  2IG0 A;  2RHX A;  2GQV A;  2RHZ A;  1I07 A;  1F1B B;  4KGZ B;  3FDR A;  1AZE A;  3RR6 A;  2LP5 A;  2X9H A;  3VS6 A;  4PJO C;  1YWO A;  3OS5 A;  1LCK A;  5ECA A;  3WXM B;  4NL2 A;  1QVF S;  3CCU Q;  2XG8 D;  1AWW A;  1M4Z A;  3QUI A;  4M75 A;  1VQL A;  3UF4 A;  5I2S A;  1VQ4 T;  3MET A;  1TUG B;  2E12 A;  5LJ5 e;  4CC2 A;  2HCK A;  1ZHI A;  4OGE A;  1VQM Q;  3E19 A;  4ATO A;  5GAN j;  1ARK A;  1YI2 Q;  3OQ5 A;  5LJ3 j;  2DBK A;  2DIL A;  4M78 A;  4C8Q A;  2A36 A;  2CH4 W;  1VUB A;  2QQB A;  3M55 A;  1Q86 R;  4X9C A;  3H9N A;  4JRK A;  2AHJ B;  1AEY A;  1X6G A;  5AT1 B;  4OMO A;  4QVZ A;  4A4G A;  4FL6 A;  1W1F A;  2RJD A;  2YUN A;  3LWI A;  1B7T A;  3OS1 A;  3VRY A;  2YRC A;  2RJF A;  1M2O A;  3GLX A;  3M9Q A;  4C92 B;  3HSB A;  3EG9 B;  3JCM X;  3VS1 A;  4M7D D;  2O01 E;  3X25 B;  4HKE A;  4LDV A;  4QW2 A;  4M78 E;  4C8Q E;  1M1K R;  2X35 A;  4PJN A;  2LVM A;  1KSW A;  5GAN 2;  3VJP A;  2CP3 A;  2PVG B;  1K9M R;  5KYU A;  4XTZ A;  3CXC A;  1VQ4 Q;  3V7R A;  4AFU C;  1WHK A;  1UUE A;  4KRT A;  1BK2 A;  3TSW A;  1WXU A;  4JLG A;  3BDU A;  2QEX T;  2DPP B;  2QYZ A;  3CCQ A;  4FIB A;  4C5G A;  2GCX A;  2MWO A;  2VGM A;  1VYT A;  2RNA A;  2QI2 A;  3HL8 A;  2DTH A;  2KT1 A;  2R58 A;  3V8L A;  2LCL A;  4M78 C;  4C8Q C;  2VAS A;  1X75 C;  4AG2 C;  5J26 A;  4KBM B;  1VQP A;  2QQS A;  5KYY B;  2D0N A;  1QCO A;  3ER0 A;  1I81 A;  2COY A;  2Y4X A;  2F5T X;  1BIB A;  5GJV B;  1H8K A;  1IRE B;  2JMC A;  4OMP A;  3THK A;  4F7U A;  2FPE A;  4PLL A;  1KQ1 A;  3MJX A;  2LJ3 A;  3CC4 A;  1V76 A;  1FMV A;  3LH0 A;  1FX7 A;  3OMC A;  1K8A U;  1G2B A;  3KBG A;  3VYG A;  2QEX Q;  3RNJ A;  2KSS A;  3A8H B;  1WHH A;  1K76 A;  5CIU A;  5GAO p;  2M1H A;  5FW9 A;  4NL3 A;  4RCB A;  4L6V 5;  2YLB A;  1QWE A;  3PTA A;  4DQ2 A;  3CME A;  2RQV A;  2V8J A;  3NTI A;  5GAM f;  2K6D A;  2A3L A;  2P0Q A;  1B3Q A;  2HAX A;  2KY9 A;  4RKU E;  2DBM A;  4GY5 A;  1V29 B;  4J9C A;  4AG1 C;  3EAE A;  5D6Y A;  2CP2 A;  1BBZ A;  1JBM A;  3DLL A;  5DLQ E;  4DBH A;  2Z0W A;  2DK3 A;  2HKQ B;  3MEW A;  2HMA A;  2DXB A;  3E1S A;  4QQ6 A;  3CCQ T;  5IXF A;  4XTV A;  4RTT A;  1MUZ A;  2E65 A;  4M7A B;  1O9S A;  3H0H A;  3S3M A;  3RDV A;  3S6W A;  5HKC A;  2LNV A;  3OYE A;  1TH7 A;  1VQP T;  2HQX A;  5DLO A;  3SWN C;  1VQ9 A;  2EYY A;  3JCM d;  1M9S A;  1SEM A;  3CCS A;  4PJO B;  1PNJ A;  4M7D F;  4EMH A;  3OYC A;  2XHC A;  5DY9 A;  2JZ2 A;  1EX4 A;  3CC4 T;  4FT4 A;  1Y96 A;  3OA6 A;  2JVV A;  5CKE A;  5LJ5 j;  2LJ1 A;  2KBT A;  3UWN A;  2IPO B;  5LJ5 g;  1GBQ A;  1AWX A;  4ELY C;  2SRC A;  1FMW A;  3CCQ Q;  1I0C A;  2JOY A;  2B8A A;  3OYM A;  3A8M B;  3IQL A;  1HSQ A;  2AT1 B;  2RJE A;  2GTJ A;  1UGP B;  2H3J A;  2MK5 A;  1W6X A;  2DA9 A;  3CME T;  1BB9 A;  1QVP A;  2DE0 X;  5IH2 A;  3NHN A;  1Y57 A;  4X34 A;  3LX7 A;  1VQP Q;  1W2B S;  4LDU A;  3CD6 A;  3H8Z A;  2RB6 A;  3QPH A;  2ROL A;  3DLM A;  5KYW A;  5D6X A;  3ZEH A;  1VQO T;  1X6O A;  3CC4 Q;  1HXD A;  2DXU A;  3TVT A;  4EMG A;  3OYD A;  2GTO A;  3JCM h;  3PVL A;  3LGL A;  4YTL A;  5GAM j;  4BY6 C;  1V1C A;  2RHY A;  3FB9 A;  4E7I A;  4D6W A;  2RK1 A;  2X51 A;  2VXE A;  2K7A A;  3LH5 A;  4JJB A;  3CME Q;  3M56 A;  4Y28 E;  1TG0 A;  3UT1 A;  3VS3 A;  2CUB A;  2KRN A;  2YWW A;  5A0L A;  1VQ9 T;  3I5R A;  3SEM A;  4M75 D;  1GRI A;  3CCV A;  4QQG A;  1RI9 A;  3CCS T;  4II1 A;  4KUL A;  4BB7 A;  1VQO Q;  4EPC A;  3FRN A;  1OEB A;  2CYZ B;  2CT3 A;  1YFN A;  4M78 D;  4C8Q D;  1RAE B;  4HXJ A;  3DB3 A;  5D7U A;  1OZ3 A;  4JRI A;  5KYX B;  2QTX A;  2OTL A;  5CO7 A;  3PVQ A;  3LGF A;  4M75 G;  4FSX A;  1XJW B;  1PWT A;  3OYH A;  2QA4 A;  3HFN A;  2E70 A;  4J9G A;  5GMK l;  4QKU A;  5KYN A;  3UAT A;  1RAA B;  1WLP B;  2HSE B;  3CC2 A;  2XU8 A;  1SHG A;  2ZPH B;  3OSV A;  3OY9 A;  1ZSG A;  3CD6 T;  1YJW A;  4J9D A;  3TQ7 P;  2EJF A;  4RUG A;  2QDL A;  1ZBX A;  2EQU A;  1VQ9 Q;  1UTI A;  1IRX A;  4RTX A;  1M3C A;  5CKH A;  2E1H A;  4M7A F;  1R0B G;  3CCS Q;  2QDY B;  1VQ7 T;  3PFS A;  1KD1 R;  1FXX A;  4E7Z A;  1RAG B;  4OB3 B;  2C0I A;  3MHX A;  3M5A A;  4WCI A;  1K9A A;  2DM1 A;  2HD0 A;  4C92 A;  1R0C B;  1U1T A;  3EG9 A;  3J80 E;  2RH2 A;  5LJ3 d;  4PJO F;  2CUD A;  2EQM A;  4L5G A;  3G7Z A;  1QKW A;  2MI6 A;  3GOX A;  3EG1 A;  3QXE B;  2HSP A;  3V7S A;  3RBB B;  4BUG A;  4PL6 A;  1BU1 A;  1U06 A;  5CKF A;  1KC8 U;  8AT1 B;  2DRM A;  4AMC A;  5FU6 B;  2DER A;  2OX7 A;  1VIE A;  5CCA A;  3CCV T;  3CPW A;  1VQ6 T;  2DL4 A;  4FM4 B;  4C92 E;  1BI0 A;  4Y92 A;  2E10 A;  1VQ7 Q;  3SWN B;  5GJW B;  1Q82 U;  1HK9 A;  3G4S A;  1K73 C;  4HVV A;  5J39 A;  3BW1 A;  2D8H A;  2OTL T;  3H0I A;  2RJC A;  5LJ3 e;  3TRE A;  1N8R U;  1VQ8 A;  5KYY A;  1OUL A;  3GF5 A;  3HRS A;  3FJP A;  2JM8 A;  1WYX A;  3M53 A;  3CCM A;  1RAF B;  1SSF A;  2QA4 T;  2R57 A;  2CH4 A;  3MEV A;  1G3W A;  3L2U A;  1NPR A;  1ZLM A;  4C92 C;  1ZBJ A;  1YIT A;  3CC2 T;  2GFA A;  2KR3 A;  2L5Q A;  1MMA A;  5GAN h;  4CI0 C;  1C1A A;  1XNI A;  1I8F A;  2K5L A;  1TWB A;  5GAO m;  3CCV Q;  4BD3 A;  1WA7 A;  1VQ6 Q;  2VC8 A;  2DL8 A;  3JCM g;  4VUB A;  2RM4 A;  1PC0 A;  1PSE A;  1RAH B;  2QQA A;  4QVD A;  3G6E A;  1QLY A;  2V26 A;  1C0M A;  4F17 A;  2XID A;  4JRP A;  3MP6 A;  1KQS P;  2GF7 A;  2NUP B;  2KAF A;  2OTL Q;  4N4G A;  1S72 A;  4O6J A;  4LE9 A;  5GAO n;  4M78 F;  4C8Q F;  4JJD A;  5I2M A;  1GCQ C;  1Y07 A;  4AFZ C;  1X27 A;  3EGU A;  3HRU A;  1X43 A;  2ZGW A;  4Q5W A;  1X69 A;  3PMI A;  1ZUU A;  4RG2 A;  2QA4 Q;  1BI1 A;  2GGR A;  3BY7 A;  4BY6 B;  1YCS B;  3CC2 Q;  1D09 B;  4J6Y A;  1MGQ A;  4A63 B;  2XD0 A;  1WHM A;  2J7I A;  2VUB A;  4PKC C;  9ATC B;  4ZN1 A;  3UDC A;  2J6F A;  2JN0 A;  3D7S B;  2JS2 A;  3R6N A;  1FYN A;  2EPD A;  2EQJ A;  2JW4 A;  3KFV A;  2L3Q A;  4M7A A;  3G4S T;  1TUC A;  1W4S A;  3M4Y A;  1OPK A;  3FC3 A;  1QVG A;  1WHG A;  2EVR A;  4OB1 B;  4XTX A;  3EFR A;  3GIB A;  2KRM A;  3SHW A;  1WFW A;  1VYV A;  4J9F A;  1VQ8 T;  4DBF A;  2X3X D;  4Z88 A;  2K4Y A;  2L3S A;  3OYB A;  1UGV A;  4DOV A;  3PIP A;  4JJN K;  3CCM T;  1WHJ A;  1EIF A;  2BZ8 A;  1BCM A;  2Y90 A;  4FSS A;  4PJO A;  4HCZ A;  2DIG A;  1SRL A;  2E6N A;  1YIT T;  3C95 A;  4RTW A;  2KNB B;  2BIV A;  4M7A E;  2DO3 A;  2P84 A;  2EKO A;  2FO0 A;  5C6S A;  1G3Y A;  2FPF A;  1K73 R;  1C6V X;  4DBQ A;  1U5S A;  3VS2 A;  1ZSZ B;  4E6R A;  3G6E T;  3I56 Q;  3RKX A;  1YNZ A;  2LNH B;  4M77 G;  1IHV A;  4LN2 A;  2CZ0 B;  3M59 A;  4PJO E;  3G4S Q;  2LT1 A;  2NLU A;  1TTH B;  1S72 T;  1CSK A;  3RES A;  1NEG A;  1RLQ C;  1I4K 1;  1VQ8 Q;  1M90 U;  2JM9 A;  8ATC B;  4ZTJ A;  3VV0 A;  1UGR B;  1WJR A;  3BFM A;  4J9E A;  3JCM W;  3CCM Q;  4MML A;  3CBO A;  1TS9 A;  1XQH A;  1WXT A;  2B86 A;  3OYJ A;  5J3B A;  2CZ1 B;  1BCO A;  4AT1 B;  5KCH A;  3HKS A;  2RK2 A;  3ZBD A;  1TXQ A;  2CZ7 B;  4ESR A;  3OYF A;  1JQQ A;  2RPN A;  1K8A C;  3CXC P;  4X9D A;  3OW2 P;  1S72 Q;  1N9S A;  3Q1J A;  5HK0 A;  2DNU A;  3X26 B;  1M1F A;  5GAN g;  3PIO A;  5LJ3 g;  4HCB A;  5GAM d;  2G3R A;  2BKD N;  2KXC A;  3ZFJ A;  2VV5 A;  2DMO A;  2DD5 A;  3I5S A;  2DYI A;  3V7C A;  4RTZ A;  4HT8 A;  2KI7 A;  4PFO A;  1N5Z A;  2MIO A;  3HTR A;  5LJ5 h;  5KYX A;  1GCP A;  1I1J A;  2EYZ A;  3JCM b;  5CK9 A;  1JB0 E;  3VS5 A;  4J5Y A;  1M1K U;  1E6G A;  1Q81 C;  5I11 A;  1K9M U;  4E7J A;  4DBR A;  3J7A F;  4C92 D;  2K3Y A;  2YLC A;  5CQX A;  2PTK A;  3MEA A;  3OW2 A;  2D9T A;  3CC7 A;  1SSH A;  4ZGJ B;  3CBP A;  4PK4 A;  1RL2 A;  5GAM e;  1YIJ A;  2LX7 A;  4M7D G;  4RTU A;  4WTO B;  2JT4 A;  1NLO C;  4KUD K;  4E7K A;  3G71 A;  3RKY A;  1ABQ A;  4TVR A;  2LQK A;  4E47 A;  1SG5 A;  5GMK i;  1T3S A;  1MMN A;  1TUD A;  2JNG A;  3JAM E;  2CT4 A;  4EIK A;  4BAC A;  2VWF A;  1KQ2 A;  1IB8 A;  4R0K A;  3QJ6 A;  3M57 A;  3MKD A;  2DYB A;  4ZGE B;  1VQL T;  2H8H A;  2A7Y A;  1U1S A;  2RQW A;  4ANJ A;  3AT1 B;  3L2Q A;  2O2O A;  1YP5 A;  2PVO B;  1X6B A;  4KUI A;  3C0C A;  3JCM V;  2CRE A;  1Y7X A;  3RUX A;  1YCY A;  2EJ9 A;  2X4X A;  3SWN A;  2NUT B;  1WNL A;  2RI3 A;  1T0J A;  1JJ2 S;  4BI3 A;  5GAN 5;  2A08 A;  1PSF A;  1IGU A;  2CP5 A;  4FCY A;  1K8A R;  1VOM A;  2ED0 A;  4JS4 A;  3H0F A;  2FHD A;  4RCC A;  2BE9 B;  4LNP A;  4LUD A;  1VQL Q;  4QT7 A;  2KE9 A;  4IUR A;  2K5I A;  2YRV A;  4OB0 B;  3CC7 T;  2P0P A;  2LCC A;  4LUE A;  5CR2 A;  3REA B;  3VUB A;  3L42 A;  2CSQ A;  1Q7Y C;  2M51 A;  3ASK A;  1EZZ B;  2PUK B;  3G71 T;  3OMG A;  2EKH A;  5FU6 C;  2PNI A;  2OAU A;  2LTO A;  1M1G A;  2LDM A;  1Q81 R;  2NUP A;  2RF0 A;  2EIF A;  4M7A D;  2MAM A;  2JTE A;  2XDD A;  1VQ5 A;  1LOJ A;  4A4E A;  1WDX A;  2MPX C;  5EG2 A;  3VS0 A;  3NGP A;  1M5Q 1;  2A28 A;  2O31 A;  2XIC A;  1P92 A;  3H41 A;  1R77 A;  4AFS C;  6AT1 B;  3CC7 Q;  2KRS A;  4C92 F;  1KJW A;  3C4S A;  3GNG A;  4PJO D;  2FPD A;  1QVF A;  2LJ0 A;  3S3O A;  1PHT A;  3WVE B;  1QCF A;  4F04 B;  5C0M A;  2A0F B;  2DVJ A;  3FIF A;  2EYX A;  2MCN A;  3G71 Q;  2RD1 A;  3VRZ A;  2DF6 A;  3LW5 E;  2KDS A;  1MND A;  1OU9 A;  4KGX B;  2HKN A;  2YDL A;  1E6H A;  1JXM A;  1NE8 A;  2KYB A;  2J6O A;  3P8D A;  2ROT A;  3LLR A;  3CBM A;  3LYI A;  2XDB A;  2M9U A;  1XTD A;  1D0X A;  2K2V A;  3QWX X;  3FEO A;  4PLI A;  5DM7 R;  5A0D A;  5CAI A;  4C0D C;  3RMQ A;  4D8D A;  5L23 A;  2LQ8 A;  1AWO A;  4JLI A;  3JB9 D;  5LL6 S;  4HCK A;  5GMK j;  1WPY A;  2RQT A;  5GAM g;  2MWP A;  2QTV A;  1ZSZ A;  1MMD A;  5GAO r;  4FYW B;  3OYN A;  3L2R A;  2F2V A;  1KC8 C;  2DXC A;  4F16 A;  1ZA2 B;  3MCA B;  4JZ4 A;  1D3B B;  3A98 A;  3JRZ A;  3QII A;  2L0A A;  2AZV A;  1U8R A;  1WGS A;  3NPF A;  4A54 A;  1VQ5 T;  3REB B;  1Q82 C;  4ZNX A;  1JO8 A;  1T3L A;  3L2W A;  1Q7Y R;  5M9O A;  2VVK A;  1N8R C;  1IXD A;  2RQU A;  4DEX A;  1D0Z A;  3PE0 A;  3SDZ A;  2AKK A;  1IO6 A;  2M02 A;  1KQS S;  1UHC A;  3R6O A;  2R5A A;  3QO3 A;  1SPK A;  2EGC A;  4QVC A;  1NM7 A;  2I0N A;  4M77 C;  1LJO A;  4BI8 B;  3I55 A;  2DEU A;  3EHR A;  4M78 G;  2CP7 A;  4C8Q G;  4ZN3 A;  1RAD B;  2E3H A;  4QQD A;  2ATC B;  3DB4 A;  3QZ9 B;  4UC4 A;  1ZSZ C;  5CVI A;  3JCM f;  1G3S A;  1PRL C;  1D0Y A;  3CPW P;  2V1R A;  2DRK A;  1ABO A;  2MF2 A;  1YJ9 A;  2LT4 A;  4CC4 B;  3PNW C;  1YWP A;  1OPL A;  1JJ2 A;  1KIK A;  1KD1 U;  1KG1 A;  4GLM A;  1QMC A;  5KYU B;  1GFD A;  3CEY A;  3MP1 A;  1LPL A;  2EAY A;  2D8J A;  3C94 A;  1AVZ C;  5IT9 E;  1UJ0 A;  3T9N A;  4J7F A;  1AD5 A;  2KK4 A;  2ABL A;  5IHI A;  1PD0 A;  3I35 A;  1H64 1;  3GNF B;  2RO0 A;  1PRM C;  1YBY A;  2FZC B;  3CD6 Q;  1Q95 G;  3EFO B;  2DKG A;  2LCS A;  2YSQ A;  2ZAE A;  1ZUK A;  4E2F B;  2QK0 A;  4B6M A;  2DL3 A;  5GMK m;  5GAO l;  1NG2 A;  2K5F A;  2K3X A;  1NJI U;  4J83 A;  2ENM A;  1GCQ A;  1M8V A;  2QAZ A;  1G3T A;  4Z02 A;  4AFQ C;  2ZPG B;  3UA7 A;  4F7U G;  4KT0 E;  2E64 A;  1KC8 R;  4XU0 A;  2WSF E;  1BIA A;  3L2V A;  4C5H A;  4JRQ A;  4BDZ A;  4O5V A;  1ACM B;  3JB9 F;  1B34 B;  4IUT A;  3A8L B;  3MPU B;  2JS0 A;  2PUO B;  3EH1 A;  2QXF A;  3I55 T;  2CZ6 B;  1QP2 A;  2GFU A;  2RI5 A;  4HVU A;  2P4R A;  3BDL A;  1WHL A;  2YT6 A;  1AZG B;  4JUV A;  1YJW T;  2KVQ G;  3A8O B;  4MZP A;  4A53 A;  4LD9 K;  5LJ3 h;  2V8K A;  1TOV A;  1AOJ A;  1YJ9 T;  1VQN A;  1N8R R;  4OMN A;  1CKA A;  3MP8 A;  3X24 B;  1OOT A;  1M27 C;  2DFU A;  2LQN A;  1M2V B;  2W0Z A;  1PCX A;  2NUT A;  1W2B A;  1QVG P;  3OYY A;  1M90 C;  4FT2 A;  1G5V A;  3A1P A;  3CXC S;  4PFZ A;  3X28 B;  4N0A A;  2HL5 C;  7AT1 B;  5GAN 6;  4C0D B;  5FRN A;  1UDL A;  4GLK A;  3M0T A;  3ULR B;  2H3E B;  2F69 A;  3I55 Q;  2K3B A;  3EG2 A;  2ZPB B;  4R56 A;  2WAC A;  4ZGD B;  1ZUY A;  3PGG A;  1YJW Q;  4MMK A;  2OI3 A;  3CCL A;  4BE0 A;  4HVW A;  1YI2 A;  2OJ2 A;  5CKD A;  1YJ9 Q;  2PU9 B;  2GQI A;  5I21 A;  1SF9 A;  3M0Q A;  2DTI A;  4Z8A A;  1H92 A;  4MDW A;  5IHK A;  1M30 A;  3OS0 A;  3HPW A;  3QG1 A;  1H3H A;  4JS5 A;  3M58 A;  5GAN f;  1YJN A;  2G6F X;  1YHQ A;  2CSI A;  2F2W A;  2E5Q A;  3F70 A;  3A8G B;  2DAQ A;  4HA8 A;  3JCM Q;  2HQE A;  4N0A C;  3M0S A;  1MHN A;  3TU4 K;  1VQ4 A;  1MV0 B;  3OYI A;  1UE9 A;  1HYO A;  4M77 B;  1K73 U;  2HZY A;  2COW A;  3OYA A;  1VQN T;  3E9G A;  2M16 A;  1AWJ A;  1RI0 A;  2VB6 A;  1VA7 A;  4LDY A;  2YUO A;  3N5B B;  2HL3 A;  2BE7 D;  2RI2 A;  2ZPI B;  1R8O B;  2O88 A;  4C0Z A;  1D1B A;  1UJY A;  2EGE A;  2L89 A;  4B9W A;  2BUD A;  1PKS A;  2CS7 A;  1M8M A;  2V1Q A;  1AT1 B;  1TU0 B;  2MMP A;  1YIT Q;  4J9I A;  4NS5 A;  2AZS A;  2YUP A;  3SB2 A;  2VXF A;  4J7I A;  2BZY A;  3CCL T;  4NOY A;  1NEB A;  1XOV A;  1OX8 A;  1VQN Q;  1H3Z A;  2E5K A;  1M90 R;  1WZO A;  1Z9Q A;  3OYG A;  3JB9 J;  3G6E Q;  3NTK A;  3JV3 A;  2DL5 A;  2K57 A;  4EMK C;  1NLP C;  1YJN T;  4JZ3 A;  1YHQ T;  1D3B A;  1I5O B;  3QDR B;  1EFN A;  2D1X A;  2R5M A;  3OYK A;  2QAS A;  2EW3 A;  2XK0 A;  1Q86 U;  2YHT A;  4B9X A;  2F5K A;  1PD1 A;  4OML A;  4XU3 A;  2YRD A;  3S3N A;  3DKM A;  1IZ6 A;  3AHU A;  3O8V A;  2RHI A;  4DA4 A;  3CCL Q;  1RAI B;  1NYF A;  4E7L A;  4CRI A;  2KRO A;  3PMT A;  2KEA A;  2BZX A;  5CQY A;  1LNX A;  1QWF A;  1K0S A;  2KXD A;  2AKL A;  4X1V A;  2O9V A;  1UEC A;  4N4I A;  4M7D B;  5HCK A;  4M75 E;  3EGX B;  2IVW A;  1YJN Q;  1IGQ A;  2DJQ A;  2ZPE B;  1YHQ Q;  3SFM A;  2JTM A;  5GMK e;  2VKN A;  2CGH A;  2EJG A;  3FLG A;  3CPF A;  4FW1 A;  2FYK A;  3SD4 A;  2SEM A;  4M4Z A;  2GBQ A;  2NYS A;  4MZT A;  4C92 G;  1OYX A;  4KH0 B;  4D8K A;  5KCO A;  2KQW A;  4WF2 A;  2D0Q B;  1UFF A;  2EWN A;  1MMG A;  3MO8 A;  2ZCF B;  1X2K A;  5GMK h;  1QKX A;  4M75 C;  5GAM h;  2BTT A;  3QWY A;  3RKW A; 
#chains in the Genus database with same CATH homology
 1VYU A;  2LMJ A;  2DRM A;  3NMZ C;  2ROT A;  2K79 A;  2RMO A;  2DL4 A;  2OAW A;  3QWX X;  1KFZ A;  4Y92 A;  1OV3 A;  3CQT A;  3ZL7 C;  5GJW B;  2MOX A;  2HDA A;  4HVV A;  4D8D A;  5L23 A;  2D8H A;  1AWO A;  2PZ1 A;  4HCK A;  3H0I A;  2EGA A;  1NYG A;  2RQT A;  1JXO A;  2DL7 A;  1W70 A;  2F2V A;  2FRW A;  2K9G A;  2JM8 A;  1WYX A;  4F16 A;  1HD3 A;  4CC3 A;  3O5Z A;  2CH4 A;  3FJ5 A;  4JZ4 A;  1ZLM A;  1ZBJ A;  3M0U A;  1ZX6 A;  3GBQ A;  3A98 A;  4IIM A;  2L0A A;  2AZV A;  2KR3 A;  4RTY A;  3NPF A;  2EQI A;  1I07 A;  3REB B;  1AZE A;  1WA7 A;  2LP5 A;  4ZNX A;  3VS6 A;  1JO8 A;  1YWO A;  2DL8 A;  1T3L A;  1LCK A;  5ECA A;  2VVK A;  1QLY A;  1FMK A;  4F17 A;  2RQU A;  4DEX A;  1T0H A;  1AWW A;  3PE0 A;  2AKK A;  1IO6 A;  3M0R A;  3UF4 A;  1UHC A;  1CKB A;  4LE9 A;  4JJD A;  1GCQ C;  5I22 A;  1SPK A;  2EGC A;  2HCK A;  4CC2 A;  4AFZ C;  1NM7 A;  2I0N A;  1ARK A;  1X27 A;  3EGU A;  4K11 A;  1X43 A;  1X69 A;  2DBK A;  2DIL A;  3EHR A;  1ZUU A;  2LZ6 B;  2A36 A;  2CH4 W;  2GGR A;  2FEI A;  1YCS B;  1PRL C;  1AEY A;  1X6G A;  2V1R A;  4A63 B;  4OMO A;  2DRK A;  1ABO A;  1W1F A;  2J7I A;  4CC4 B;  2YUN A;  1YWP A;  2J6F A;  1OPL A;  1GL5 A;  3VRY A;  4GBQ A;  1KIK A;  2JS2 A;  3R6N A;  1FYN A;  2EPD A;  2JW4 A;  4GLM A;  2NWM A;  3VS1 A;  1GFD A;  3KFV A;  2L3Q A;  2D8J A;  1TUC A;  1AVZ C;  1U3O A;  1OPK A;  1UJ0 A;  1KSW A;  2EVR A;  2FG0 A;  3U23 A;  1WX6 A;  1AD5 A;  2KRM A;  3SHW A;  1WFW A;  2ABL A;  1VYV A;  4J9F A;  5IHI A;  1SRM A;  3I35 A;  2X3X D;  2DX1 A;  4Z88 A;  4AFU C;  2L3S A;  1K4U S;  1UUE A;  4KRT A;  1UGV A;  1BK2 A;  2KT8 A;  3TSW A;  1WXU A;  2FRY A;  2BZ8 A;  4Z89 A;  1PRM C;  2ESW A;  5FWC A;  4FSS A;  1SRL A;  1K0X A;  4RTW A;  2KNB B;  1GFC A;  1UG1 A;  2LCS A;  2YUQ A;  1VYT A;  2YSQ A;  2RNA A;  4IIO A;  1ZUK A;  1JEG A;  2KT1 A;  2FO0 A;  2DL3 A;  2FPF A;  4AG2 C;  2J6K A;  1NG2 A;  2AK5 A;  1U5S A;  2D0N A;  3VS2 A;  5EC7 A;  4E6R A;  2ENM A;  1GCQ A;  2A37 A;  2NUZ A;  3VS4 A;  1YNZ A;  2LNH B;  5GJV B;  4LN2 A;  1H8K A;  4AFQ C;  2JMC A;  3THK A;  4OMP A;  3UA7 A;  2FPE A;  2EBP A;  1CSK A;  5IXB A;  1NEG A;  1RLQ C;  2LJ3 A;  2RQR A;  3M0P A;  2JM9 A;  4J9H A;  4J9E A;  1G2B A;  4OMQ A;  2JS0 A;  3RNJ A;  1K1Z A;  4HVU A;  2P4R A;  4F14 A;  1K76 A;  2YT6 A;  1AZG B;  1WXT A;  2B86 A;  1GBR A;  5FW9 A;  1AOJ A;  1QWE A;  4OMN A;  2C0O A;  2RQV A;  1CKA A;  3EG0 A;  3I9Q A;  2O9S A;  1OOT A;  1M27 C;  2IIM A;  2LQN A;  1PKT A;  1A0N B;  2W0Z A;  2K6D A;  1S1N A;  1B3Q A;  1JQQ A;  4ESR A;  2X3W D;  2RPN A;  2DBM A;  1M3B A;  4J9C A;  4AG1 C;  1WI7 A;  2JXB A;  1BBZ A;  2DNU A;  1M3A A;  1UDL A;  3M0T A;  3ULR B;  2JMA A;  1UHF A;  2K3B A;  3EG2 A;  2KXC A;  2DMO A;  1ZUY A;  3I5S A;  5IXF A;  2GNC A;  1X2Q A;  2OI3 A;  2W10 A;  1MUZ A;  4RTT A;  4RTZ A;  4HVW A;  2K2M A;  1N5Z A;  2MIO A;  3H0H A;  2OJ2 A;  3UA6 A;  4CC7 A;  2GQI A;  1MV3 A;  1GCP A;  1I1J A;  3M0Q A;  1B07 A;  1RUW A;  2EYZ A;  4Z8A A;  1H92 A;  3VS5 A;  5IHK A;  1E6G A;  1M30 A;  3TSZ A;  5I11 A;  1H3H A;  2EYY A;  2J6O A;  1SEM A;  2G6F X;  1PNJ A;  1SHF A;  2PTK A;  2CSI A;  1YN8 A;  4JJC A;  1SSH A;  2F2W A;  2L3P A;  2LX7 A;  4RTV A;  2LJ1 A;  4RTU A;  2XMF A;  2KBT A;  2JT4 A;  1NLO C;  1GBQ A;  1AWX A;  3M0S A;  2SRC A;  1I0C A;  1MV0 B;  1ABQ A;  1UE9 A;  2CDT A;  1JU5 C;  2LQW A;  1HSQ A;  3IQL A;  2GTJ A;  1AWJ A;  1W6X A;  2DA9 A;  1BB9 A;  1T3S A;  2DE0 X;  1TUD A;  5IH2 A;  1VA7 A;  3NHN A;  1Y57 A;  2CT4 A;  4EIK A;  2VWF A;  2YUO A;  4R0K A;  2ROL A;  2DYB A;  2H8H A;  4OMM A;  2O88 A;  2HBW A;  2RQW A;  1UJY A;  5FWB A;  2EGE A;  1PKS A;  2O2O A;  1M8M A;  1J3T A;  1YP5 A;  1X6B A;  4ORZ A;  3C0C A;  3TVT A;  2V1Q A;  2CRE A;  2GTO A;  2J05 A;  1E7O A;  3PVL A;  4JPB W;  2ED1 A;  2RN8 A;  4J9I A;  2AZS A;  2EYW A;  2YUP A;  1V1C A;  2BZY A;  5IHN A;  1T0J A;  1NEB A;  2HEQ A;  1XOV A;  2K7A A;  2A08 A;  3LH5 A;  4JJB A;  2E5K A;  1TG0 A;  1Z9Q A;  3VS3 A;  2CUB A;  2ED0 A;  2KRN A;  3H0F A;  3I5R A;  2L2P A;  3JV3 A;  3SEM A;  1GRI A;  2DL5 A;  2ECZ A;  4LNP A;  1NLP C;  4LUD A;  1RI9 A;  4JZ3 A;  4QT7 A;  2KE9 A;  1RLP C;  1EFN A;  2D1X A;  1Z9Z A;  2EW3 A;  2DLP A;  1OEB A;  2M0Y A;  4LUE A;  2CT3 A;  3REA B;  4HXJ A;  3EG3 A;  1Y0M A;  2CSQ A;  3EHQ A;  2M51 A;  3PVQ A;  4OML A;  1PWT A;  2EKH A;  2KYM A;  2PNI A;  3VS7 A;  1HJD A;  1NYF A;  2KRO A;  4J9G A;  2KEA A;  2BZX A;  2RF0 A;  3UAT A;  1WLP B;  1SHG A;  2J06 A;  1ZSG A;  2JTE A;  4J9D A;  1QWF A;  1K0S A;  2KXD A;  4RUG A;  2AKL A;  4X1V A;  2O9V A;  2QDL A;  1UEC A;  1UTI A;  1WDX A;  5HCK A;  4RTX A;  1WIE A;  1M3C A;  3VS0 A;  3NGP A;  2A28 A;  2O31 A;  2DJQ A;  3H41 A;  4AFS C;  2KRS A;  2VKN A;  1KJW A;  4DEY A;  1WXB A;  2FPD A;  2C0I A;  4WCI A;  2SEM A;  4M4Z A;  1K9A A;  2GBQ A;  1PHT A;  2DM1 A;  2F2X A;  2LJ0 A;  1QCF A;  2KGT A;  2DVJ A;  4D8K A;  2EYX A;  1G83 A;  2MCN A;  2CUD A;  3VRZ A;  2DF6 A;  1UFF A;  1QKW A;  2C0T A;  1X2K A;  3EG1 A;  1QKX A;  2BTT A;  2HSP A;  3QWY A;  3RBB B;  2YDL A;  1E6H A;  1BU1 A;  1JXM A;  1U06 A;  4J9B A;  2KYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...