1KHIA

Crystal structure of hex1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
147
structure length
147
Chain Sequence
GSASQTVTIPCHHIRLGDILILQGRPCQVIRISTSAATGQHRYLGVDLFTKQLHEESSFVSNPAPSVVVQTMLGPVFKQYRVLDMQDGSIVAMTETGDVKQNLPVIDQSSLWNRLQKAFESGRGSVRVLVVSDHGREMAVDMKVVHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hex1
publication title A HEX-1 crystal lattice required for Woronin body function in Neurospora crassa
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Structural protein
total genus 25
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2001-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1khiA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1khiA02
1QUQB 4JI2Q 2D62A 4JI8Q 1IBML 1EQQA 1WJJA 2PNHA 3I4NH 1E7ZA 1XNIA 1UEBA 2Y0SG 1Q12A 2QEXA 2OQ0A 1VQHA 2ZM6L 4B3RQ 1JT8A 1N9WA 1E3PA 3T1YQ 2VQEL 3HOVH 4BY7G 2B63H 1EWIA 4DR3Q 4A3GG 1C0AA 2V1CC 4WJ4A 1U0LA 3J80i 1VQIA 5M5YH 1M1GA 5M5WH 4DV3L 2JJQA 3H3VH 3CCSA 4A93G 1VQNA 4GN5A 1V1QA 3I55T 1I94Q 2NVTH 3EN2A 3TQYA 2CKKA 3KBGA 1YJWT 3VDYA 2WP8J 4JV5Q 4A3KG 1KQSA 1OXXK 2OQKA 1C7YA 1PH6A 4GLXA 1CUKA 1VQPA 1PA6A 4AIMA 2CFMA 3OTOL 4RG1A 1VQ4T 3Q8DA 4DV1L 4B3TQ 3S1QH 3CXCA 4POFA 1WCMG 4LFCL 4NXNL 2JK8A 1N33L 1NBWA 2AKWB 3T1HQ 1A0IA 1VQ9T 4EX5A 4YHHL 4C3IH 1L2FA 1K73C 2QA4T 3OYYA 3FKIG 4DV5Q 3S15H 3KF6A 1HZ9A 5IE8A 3CCEA 3F8TA 3S1RH 1YJNT 1XTDA 1QVFS 3KJOA 3CPWA 1K0RA 3PGZA 1CSQA 4DR2Q 5K36G 1NY4A 1J6QA 1N36L 1YHAA 4DV7Q 1YVCA 5C4JH 3TEHB 4A3BG 2VS1A 2VQFL 3M7NA 1HJPA 1HZCA 3DLLA 1YI2A 1Q81C 1Y14B 5E7NA 5C44H 1YIJA 3CW2C 1PH3A 1PH9A 1PV4A 4POGA 2JA7G 1OTCA 2ZTCA 2UXDQ 1WOCA 3A74A 2OTJA 4CRIA 2N8NA 4DUZQ 1P16A 4HIKA 4DV4L 2R7ZH 3F2DA 1NPRA 4IJLA 2IHFA 4L5RC 3ER0A 5M3FH 4LF5L 1M90C 5C3EG 4GN3B 1KD1C 2ZJRA 4DR6L 1XMQL 1LM0A 2R7DA 4A3IH 4YY3Q 3JAMc 3CF5A 4LFBQ 3EIVA 4A3JH 1PYSB 1EOVA 3CC7T 1G291 4QJFA 1X9NA 3GTMH 3ERSX 2BA0A 1K9MC 2OTLA 2E70A 2WB1G 3K7AH 3HOZG 2KBNA 1W2BA 1S3OA 3CCVA 1OXSC 1FJGQ 3L7ZC 2XGTA 4OXPA 4DV2L 4LFAQ 2LQ8A 3I4OA 4OX9L 2QEXT 1S40A 1SR3A 2B63G 4JI7Q 3HOVG 3M4OH 3I4MH 2NZOA 4P75A 4A3DH 3J80c 4LNQA 2K5VA 4FDBA 2UUCL 3PUXA 1KL9A 4DR1L 1VQ5A 3EBEA 5M3MH 1QVCA 1I5FA 2VL6A 3KF8B 2YU9H 3CCST 3PO3H 1VQNT 1VQ4A 2D0PA 2VZAA 3UDIA 4ZN3A 4OONA 4BXXG 4X65L 3I56A 3CCUA 4JBWA 5ELNA 4YCVA 3S2HH 3D31A 1VQ9A 5EAYA 1XMOL 2NVXH 3H3VI 1U5KA 1ASZA 1CSPA 2L3RA 4UP9A 3ULPA 3U58A 2IX0A 4X6AH 1LYLA 1Q7YC 1BKBA 3UDGA 1IBKQ 1XNRQ 4OWTB 3RLOA 5IYBH 1VQCA 3CCJA 2YTYA 3UDFA 4LF9Q 3K80C 1PFSA 2K5NA 5J26A 4R4IA 4R4TA 2UU9Q 2Y0SE 3L0OA 1PH5A 2DGYA 2MNAA 4PMWA 4LF8L 1M1KC 2E6ZA 1W3SA 5AJ3L 5FJ8H 2UUBQ 1VQKA 4DKAC 2F4VQ 4BY1H 2LSSA 4GKJQ 4HJ7A 3CCET 1VQBA 1PH2A 1C9OA 4JI3Q 4TVAB 1K73U 4DV6L 5LMUL 2AMCB 1KQSS 2BA1A 4JI8L 1HNZL 4JI2L 4B3MQ 3PIPA 3G4SA 1E1TA 2ID0A 3PF5A 4LW1A 3L2PA 1UE5A 4A3LH 4AQYQ 1TWFH 3M3YH 4B3RL 4NPSA 4RMFA 3T1YL 1IYJB 4BBRH 4DAMA 4JBMA 3J81i 2VUMH 3CXCS 4DR3L 2R7FA 1N8RC 1VQ6A 2RHQB 3MXNB 1YIJT 3F2BA 2N78A 1KAWA 2OTJT 1S72A 3ULJA 1SMXA 3JAMi 2MO1A 3CAMA 1I94L 2RHSB 2R7ZG 3S1NH 2PI2A 3LH0A 1BVSA 4LUZA 4ALPA 4QGUA 3WWVA 4JV5L 1TXYA 3PUVA 1SFOH 2JA5G 3CPWS 2A19A 1YITA 3J80E 1PH4A 4XTCS 3E9IA 3TS0A 4JOIA 4A3JG 4B3TL 2NN6I 4RG2A 4GNXB 2JEAI 2B3GA 1M90U 2A1AA 2ZTEA 1KD1U 4JI6Q 4YCUA 4R1JA 1MIUA 1VQGA 5H1SE 3T1HL 4L5TA 2GVBA 2OTLT 4QL5A 2JA8G 3PIOA 4KI0A 4GNXA 3TRZA 3CCVT 4TQUS 4YCWA 5IYCH 4DV5L 2K5HA 4JG2A 3H15A 4UY8C 1K9MU 3I4MG 1EQRA 2I5HA 2R6GA 3AFQA 3PCOB 4A4IA 4OO1I 2BH2A 3LGLA 3TREA 1OXTA 4NXMQ 3RN2A 4DR2L 4ZN1A 3NELA 1VQ8A 2JEBI 3PO3G 1VQ5T 4DV7L 3M4QA 3OW2A 1KRSA 4IO9A 3U4VA 3KF6B 3GTOH 3CMEA 1YHQT 1YJ9A 3I56T 3GDEA 3CCUT 3KFUA 2UXDL 1CKNB 5FLMH 4DUZL 2RF4A 1WFQA 4IPGA 4XIGS 1W2BS 2AWNA 3PF4A 4R4CA 4PZ6A 1VQEA 1PYBA 3CC2A 2KDSA 3HOWH 1X6OA 3PO2H 2VW9A 1KXLA 1NE3A 2UXBQ 1CKNA 2OCEA 1AE2A 2IHEA 3DB3A 3G71A 5IP9H 4B3SQ 3CCJT 4HJ8A 1EFWA 2E2HH 1VS0A 1Q7YU 3F2CA 4YY3L 1B8AA 3LGJA 4O2DA 1XPOA 3HOXH 1Q1EA 4A3MG 2HT1A 3E0EA 4JI4Q 1D7QA 1HNXQ 1VQKT 2DO3A 1M1KU 3STBC 1FJGL 4A3LG 1DGSA 3G4ST 1K83H 2KHIA 1GD7A 4LFAL 3D0FA 2JQOA 4BBRG 4X62Q 1PH8A 1RIPA 4JI7L 1BBWA 2CWAA 3J81c 3CMAT 5IAYA 1AE3A 4DK6C 1HNWQ 2BH8A 2EQSA 1VQ7A 2K14A 4R4OA 1NJIC 1Q82C 1VQ6T 4A3FH 2UXCQ 5JJLA 5C0XI 4IOAA 1HZBA 1MKHA 1HR0W 5ELOA 1S72T 5GAEC 3A5ZB 5FLXc 1Y1WG 4PG3A 1MJCA 4P73A 2R92H 1UWVA 4A3EH 1L1OA 3G48A 4MTNA 1Z9FA 3SGIA 1YBYA 5J3BA 3CQZH 2WAQG 1VQOA 1VQAA 2VY3A 3GTLH 3M4PA 1YITT 3GD7A 4Y52H 3HFZB 5GAHC 5C0XJ 1IBKL 1XNRL 4AH6A 2E8GA 4GKKQ 3AQQA 5HY6A 3H0GH 3NBHB 2N49A 5LMNW 4LUVA 2E5LQ 3E9HA 4P71A 4LF9L 1G6PA 2UU9L 1HR0Q 1JMCA 4KHPQ 1QVGA 3P8BB 2ASBA 4A3CH 2UUBL 2I5MX 2UUAQ 1Q46A 3CC4A 1VQFA 4IPHA 2F4VL 4GKJL 1YHQA 4LFBL 2PMZE 2WFWA 4OWXB 4JI3L 4BY7H 2ALYB 2VNUD 4A3GH 4B3ML 5C4XH 5IT9c 1NPPA 3NENA 2JA6H 1IXRA 1NMFA 2KVQG 1VQ8T 2Z6KA 4LWCA 4AQYL 1N34Q 4H02A 1B70B 2GVAA 4O0AA 2LCLA 2K75A 3RNUA 1MJEA 1EYGA 2Q2IA 3I2ZA 3CMET 1YJ9T 4L5QA 5LMNQ 1Y1VH 1LUZA 3CCMA 3J7AF 4R4QA 3DM3A 4LF7Q 3KJPA 1KRTA 1KHIA 3HOWG 3PO2G 2DUDA 4AYBG 3HOUH 1H95A 3CC2T 3HOYH 4GN4B 3CCRA 5IP9G 1WCMH 3J81E 4UP8A 5BR8Q 3B6YA 3G71T 1FGUA 1UE6A 1I50H 3HOXG 2MQHA 1PVOA 3OW2S 4JOIC 3W1GA 4QQBX 3CMAA 1E22A 4JI6L 3JAME 4X66Q 5C44G 3NEMA 2XHCA 3CCQA 3FHWA 4X64Q 4KLKA 1JB7A 2R93H 5GADC 2MFIA 1SRUA 5IP7H 1A8VA 2L15A 4X34A 1Q81U 4K0KQ 4GNXC 4DR4Q 1G51A 1OXVA 2NN6G 5M3FG 2MI6A 4A3BH 4A3FG 1N32Q 4NXML 1VQ7T 2GN5A 2HIXA 3M85A 4JI0Q 2Q2HA 4JBJA 4A3IG 2I0QA 3S1MH 4DUYQ 1RL2A 2FXQA 3A0JA 2A8VA 4DAYB 3J7A5 2R92G 2F3IA 4TVRA 1NJIU 5IWAQ 4A3EG 2ZJQA 1X55A 5DM7R 4OO1G 4LF4Q 1V9PA 4DV0Q 4DR5Q 4JI5Q 3LGFA 4JYAQ 1PH1A 1SE8A 2Q2TA 4BBSH 5C3EH 1VCIA 1VQOT 3UE1A 1VQMA 1Q86C 1JE5A 4IFDI 3KLWA 3H0GG 3KYHC 2UXBL 3BJUA 4LUOA 4A3DG 4QQDA 2NVYH 4GLVB 1HH2P 3ULLA 2QGQA 4J15A 2H5XA 1IBLQ 4B3SL 3UDXA 5M3MG 3ZJYC 2ZJPA 3S2DH 3HOZH 4A3CG 4OWWB 1X3FA 1VQLA 2Z0SA 3IRBA 4JI4L 2XTIA 3F1ZA 1X56A 3K81C 3CC4T 2LVMA 3MEFA 3PV0A 4HJ5A 2IG0A 2JUFA 1FVIA 4HIDA 1HNXL 1SN8A 5C4XG 2JVVA 1QUQA 4IFDJ 2K50A 4JBKA 4C3JH 2JA6G 5JJKA 1PH7A 4APVA 4UP7A 1UE1A 3K7UC 4X62L 1J5EQ 2ES2A 4Y7NH 2OWOA 2HHHQ 4DR7Q 1VQDA 4JI1Q 4QIWE 3CCLA 1V43A 4P74A 4IPDA 1SLJA 2KENA 2PQAB 4QY7A 5IYBG 2E2JH 4LF6Q 2UXCL 2JNGA 4BXXH 1NMGA 1Y1VG 2WB1E 4IPCA 1XNQQ 2NVQH 2WAQE 1Z47A 1A62A 2YTVA 1QVGS 3CCMT 3CD6A 5JEAJ 3U4ZA 1IBMQ 3HKZG 1E1OA 3W5OA 2NZHA 5FJ8G 1KIXA 2PQAA 3RLNA 2EIFA 2RCNA 2YYZA 4BY1G 2ZM6Q 3HOYG 1WYDA 1L1OC 3HOUG 3I4NG 2VQEQ 3CCRT 1YEZA 5C0XG 4DV3Q 1CKOA 2LXJA 2MWOA 1K8AC 2KCTA 3FP9A 3TS2A 5JJIA 4HIMA 4JC0A 4DPGA 2VUMG 5DLQE 1KC8C 3UE0A 4GKKL 2R93G 5GROA 1PHJA 3BU2A 4MZ9A 1L1OB 2D0OA 3CCQT 1JJ2A 1TWHH 2E5LL 1JJGA 1I3QH 5IP7G 1QZGA 3GTJH 1HR0L 1EIFA 4KHPL 1YZ6A 3G6EA 1B7YB 2CCZA 1X65A 4YTLA 1N8RU 2UUAL 3OTOQ 1R9TH 4DV1Q 4DK3C 1GVPA 3BZKA 1TWAH 4IJHA 4LFCQ 4NXNQ 1N33Q 3PUYA 2JE6I 1N34L 2Z6KC 4YHHQ 1IL2A 3DB4A 1NTGA 1UE7A 1BBUA 1OXUA 4ME3A 4MNOA 4AYBE 4EQ5A 5IY0A 1EIYB 4L5SA 3GTQH 5LMNL 3ICEA 3CPFA 2G3RA 4PZ8A 1O7IA 3GTPH 4BBSG 3RN5A 4LF7L 2JA5H 5IYCG 3W1BA 5A2QE 2HIVA 1N36Q 1SSFA 3GTGH 3J7ZC 1VQMT 1E24A 2VQFQ 2CQOA 4KHZA 1AH9A 1K3RA 1TWCH 5BR8L 1SROA 1L0WA 1GKHA 2KCMA 4NB3A 2PI2E 1Q86U 1P8LA 1TWGH 2ZTDA 2JA9A 3I55A 4A93H 5IYDG 4DV4Q 2JA8H 1WI5A 4X66L 2I5LX 3AFPA 1VQLT 4YWLA 1YJWA 4GS3A 4PZ7A 4X64L 1K8GA 2ATWA 3KDFB 2E2IH 4WJ3M 3K8AA 1HNWL 2CKZB 3PSIA 5FLMG 1QVFA 1I6HH 1EUJA 3K0XA 4LF5Q 2LXKA 4A3KH 3S14H 2YTXA 3S17H 4DR6Q 4K0KL 1XMQQ 4DR4L 3JC66 1YNXA 4A75A 3STBD 2IY5B 2KHJA 3KDFA 4C2MH 1IZ6A 3RZOH 3CCLT 1X54A 2C35B 1YHBA 4YWKA 3S24A 4HJAA 1N32L 3I7FA 1NZ9A 5LL6S 4JI0L 3U50C 2AWOA 2K4KA 2QA4A 1XPRA 4DUYL 4DR7L 2CWPA 4HIOA 4YWMA 1VQPT 3CD6T 5IWAL 2MWPA 4DV2Q 2IX1A 3J81j 4GOPC 1QZHA 3FKIH 4OX9Q 5FLXE 4LF4L 4DV0L 4DR5L 4JI5L 1YJNA 4JYAL 1LTLA 1X3EA 5GAGC 2Q2UA 1ASYA 1FL0A 2UUCQ 3RZDH 4DR1Q 3KOJA 3PUWA 4BA2I 2K52A 5HGQA 1GO3E 1CKMA 1Q1BA 2IT1A 2MO0A 4JCVE 3PUZA 4A3MH 2JOYA 4GOPB 1IBLL 2N3SA 4X65Q 1Q8KA 1X3GA 1K8AU 3BZCA 1D8LA 4GLAC 2JA7H 1XJVA 1XMOQ 3GTKH 1VQJA 5IYDH 1A63A 2B29A 1KC8U 4DNIA 3G6ET 2YV5A 3AEVA 2EXDA 1Q82U 4GOPA 4IFDG 1XPUA 3HKSA 4BA1I 2F52A 1HZAA 1YI2T 3S16H 2AHOB 3RR5A 4A76A 3M9BA 5M5XH 3RLFA 1J5EL 5IT9E 3HKZE 4UPAA 2HQLA 3CP0A 4HJ9A 4JI1L 1GM5A 2HHHL 5GQOA 1JJCB 4LF8Q 3CC7A 1Y1WH 5AJ3Q 4LF6L 3AYHB 4C3HH 4P72A 3GO5A 5JEAG 1JJ2S 3A5UA 1T9HA 1XNQL 4IOCA 1HNZQ 4DV6Q 5LMUQ
chains in the Genus database with same CATH superfamily
4Z89A 4JI8Q 1D09B 4A3GB 2FRYA 4EMHA 1SG5A 1Q12A 2CGHA 2D6FA 4GZYC 3VUZA 4BY7G 1C0AA 4A3GG 1V76A 1Z6HA 4OHJA 5M5YH 1M1GA 5M5WH 4DV3L 4HA8A 3SE0A 2B2UA 5LL6X 3H3VH 4RCCA 4A3KB 2NVTH 2DZ9A 3VA7A 3NK9A 4OMMA 4KH1B 3TQYA 7AT1B 3KBGA 5AFWA 2HQEA 4OMPA 2F0TA 3HFNA 4XTZA 5FU7B 4QVZA 1OXXK 4KY5A 5GANf 5T1GA 3HRZC 3V96A 4GLXA 4IIMA 1JICA 3S3MA 1PLFA 2K03A 2QF7A 2FHDA 2Q8IB 1PA6A 1II3A 4QVCA 2F0QA 1OEBA 3P20A 3Q8DA 2YLCA 3SWNC 1B9NA 2MGSA 2ENMA 2K3XA 2EYWA 4R9WA 3FKIB 3NWTA 3TP6A 2EYFA 3A54A 2F3WA 5LJ5f 2AZVA 1YCSB 3TZDA 2PW7A 2CS7A 1S5DD 1RADB 3FKIG 3KF6A 1HZ9A 1K8OA 3OSVA 3CCEA 2NBFA 1Y57A 2RK2A 2E2DC 3S1RH 1HQMC 1XTDA 4AMCA 1EQTA 3OYGA 1Y96A 1YHQQ 2O2LD 5K36G 1TKWB 1J9OA 2JA7B 1J6QA 2NUTA 5M9OA 3GTKB 4G7HC 4AT1B 2A37A 2VQFL 1X27A 1HZCA 2EQJA 1U4MA 2A68D 1Y8OB 2NUCA 1TS3A 3CHBD 4A4EA 1PV4A 1CQFA 3G7ZA 2JA7G 4C8QE 1WOCA 3A74A 2OTJA 3S16B 1P16A 3V8JA 4C92E 1AOJA 5M5XB 1HK9A 2LJ1A 1PNJA 2NLUA 2MYSA 4BI3A 5M3FH 1V1OA 1ONLA 5GAOn 1M90C 2KUMA 1I8FA 5CKFA 2XDBA 2R7DA 4A3IH 1WHJA 3CF5A 1NLPC 1PYSB 4M77F 5F2DA 3MHXA 2MJ8A 2LS01 3SEMA 2B2VA 2BA0A 1K9MC 2EYPA 2OTLA 3CMAQ 5EPKA 3QDFA 4HTHA 1TWBA 1FJGQ 5KCHA 3L7ZC 2XGTA 2F0LA 1X75C 5FOBB 2HKQB 4DV2L 2RPNA 1S40A 2PZWA 4JI7Q 3TU4K 3I4MH 1G8ZD 1Q3LA 3J80c 4LNQA 2K5VA 2E2JB 1KL9A 4DR1L 5M3MH 2M9VA 3KF8B 1CZWA 4FF2A 1VQNT 4OVAA 1WA7A 1SNMA 4M75B 5FU6B 1IGQA 3TVTA 4M7AC 2RSOA 3OSSC 3TMEA 2PU9B 5ELNA 4KJOA 2KT8A 1UB4A 1VQ9A 4M7DA 1ESRA 3N52A 1U5KA 4M75G 3SR1A 4AG1C 2L3RA 3VYTA 2GF7A 1ASZA 1S1NA 1E2ZA 2RHXA 2IX0A 3BDLA 3DM1A 5C3WA 3U58A 1S4ZA 1BKBA 3VYGA 1AWXA 2MIOA 2QAZA 4XAXB 2LKVA 1F2LA 1IBKQ 2J7ZA 1UE9A 1VQCA 1R4QB 1T5EA 4POGA 5J26A 4E7ZA 3INZA 4K11A 3D4DA 1PRTD 4XDXA 1W3SA 4PFOA 5AJ3L 2MNAA 2UUBQ 2J6FA 4JZ4A 3CRKC 4WJWA 2BE9B 1VQKA 4DKAC 1QQJA 4BY1H 4J5YA 2LSSA 4HJ7A 1H9JA 4PMBA 3K58A 2HZYA 1R9TB 1K73U 1VQLQ 1KQSS 3MXUA 2G9HD 1Y8NB 4L63B 3G4SA 1E1TA 2RSNA 5EBDA 5C0XH 3L2PA 1UE5A 1AVZC 4PNYA 4NPSA 3T1YL 1IYJB 4C8QD 4DAMA 1E2VA 2R7ZB 3I72A 1GBRA 4C92D 5IGFA 5GAMj 5IHKA 1G3SA 2QG9B 2X3WD 1QWYA 2DBKA 2N78A 2RBMA 3ONAB 3ULJA 1I94L 2R7ZG 2MO1A 3CAMA 1UNSA 4PJNA 1M9SA 2PI2A 1D1IA 4UAIA 2V1QA 4EIKA 4DBQA 1Q81R 1CHQD 2D9TA 3MHBA 3MXNA 4ALPA 2W10A 5FKAC 1W2BP 3A56A 3PUVA 3QO2A 4C5IA 4WORA 3VV0A 5EJWA 1YITA 3J80E 2QEJC 1PH4A 4F7UF 4R55A 2HSEB 3K7AB 5CVIA 3SHLA 3E5SA 2BZ8A 4IALA 4KD3A 4RG2A 1IXDA 1MV3A 4OMLA 2ZTEA 4JI6Q 5CV6A 4X3TA 4YCUA 2LNHB 4R1JA 1D1CA 5H1SE 2GCXA 3N5BB 2A36A 1VF7A 3JRZA 4QL5A 1W6KA 1I6HB 1TVXA 2QASA 3PVQA 3CCVT 1Q90A 2H3JA 4YCWA 2K5HA 4JG2A 4DV5L 2YT6A 3NTIA 2YU9B 1EY5A 1EQRA 2I5HA 2R6GA 3AFQA 4KN7C 1JWUD 4A4IA 3JB9F 1EY4A 4M77A 3TEEA 1TU2B 2Q8RE 5LJ5j 4NXMQ 1MUZA 4LDWA 3C0CA 2V4DA 4K14A 4CJ2C 2DM1A 2BCOA 5GMKl 4JJDA 1IHWA 2VGMA 1H641 3U4VA 2GFAA 3ASKA 4XU2A 3KF6B 2RQXA 3CMEA 1YHQT 3T16A 5HCKA 3KFUA 1B4OA 4DUZL 3AT1B 1NBEB 1W2BS 1YWOA 3BDUA 2NB0A 5CCAA 2NUTB 3OWEB 3BVZA 3CC2A 2KDSA 2FZGB 1PD1A 4J9BA 2UXBQ 3TBIB 4J9HA 4ZGDB 2RH2A 3OA6A 2IHEA 1CSKA 3CCJT 1LT4D 2SEBD 4XXEA 2E2HH 2C0IA 3O5ZA 1B8AA 4O2DA 2BOSA 3HOXH 2FG0A 3E0EA 4JI4Q 1ESFA 1M4VA 2YSQA 3R2IA 5C5LA 3I55Q 2VVKA 1KNEA 2QDBA 4BBRB 3MAQA 3EROA 4V0BA 5A2QL 4G7OC 3STBC 1DGSA 1G3YA 4LFAL 1ZSGA 1GD7A 4CKEA 2JQOA 2K5FA 4BBRG 2MPMA 3D6WA 3RMHA 3CMAT 5IAYA 2RQVA 3IQLA 4RA8A 2BH8A 4R4OA 2JJ9A 2XU8A 4XU1A 4E7KA 3CKIB 4CKBA 1HZBA 4MZTA 1HR0W 1UDLA 5ELOA 3H3VC 1S72T 2E74C 3QYGB 1C8CA 2CH4W 4P73A 2MOXA 1UWVA 1JWMD 1L1OA 1T3SA 3PIP3 1TG0A 1LLRD 3OYCA 3SGIA 5J3BA 3CQZH 2GNCA 1QNKA 2VY3A 4M7AE 1MD2D 3X3MA 4MHEA 2QDLA 2NWGA 5GAHC 1EX4A 5J22A 3T13A 1QKXA 2E8GA 1EOTA 1NNXA 5I21A 2N49A 5LMNW 4LUVA 4DNTB 3Q1JA 1K0SA 2DYBA 2KE9A 1TS5A 3QJ6A 2E1HA 2FO0A 5JEAH 1ZX6A 4L59A 4ELYC 4A3CH 5A0DA 1WGSA 1EIHA 1Q46A 5C4HA 1DJ7B 3A8LB 4DA4A 4NW2A 3OS1A 2F4VL 4GKJL 2EYMA 3NSWA 1A15A 3RUZA 2PMZE 4PJOA 4OWXB 2ATCB 2ED1A 2A5HA 2WIIB 2LQWA 3HTRA 3OS2A 5IT9c 2AHJB 4B3ML 3A8HB 4ZKBB 1NPPA 2RNAA 3GTOB 1AWWA 4F17A 3G6JB 2JA6H 3M4YA 2DEQA 5DLOA 2LZ6B 1CT1D 4QVDA 1K1ZA 1LOJA 5GAMe 3EGDA 2CW0D 3I2ZA 3HOWB 5G3LD 2SRCA 1Y1VH 2R3ZA 3CCMA 4QT7A 4R4QA 1SAPA 4XTWA 3DM3A 1D1KA 2RHIA 5CMDA 3KJPA 1R0BG 1MNDA 3W2DA 5JJIA 3HOWG 2H8HA 1H95A 1TUDA 3D6CA 4AFSC 2L4NA 5C44B 1FGUA 2M00A 2XVSA 1F9RA 2QCPX 1IKLA 5GANe 1CK1A 2JMAA 1TU0B 1K83B 1VYUA 1OI1A 5C44G 1K9AA 1X6GA 3TSWA 2L5TA 1ICFB 3LNNA 3TN2A 2B2TA 3DLMA 2MFIA 5EKKA 1GL5A 3D7SB 5IP7H 3NQTA 4ILWA 4K0KQ 2DNEA 4GNXC 3OHXC 2AQ3B 1LO5D 1STGA 1SMYC 2HDMA 5AYFA 2CP2A 1I4K1 4E7IA 4RCNA 2MI6A 5LJ5e 4ATOA 5KYXB 4A3BH 4LE9A 2TSSA 3NQIA 2R92B 2DLPA 4FL6A 5D6XA 1QP3A 1VQ7T 5CV5A 3GTMB 2I0QA 4RHSA 4UC4A 4BY6C 1QOHA 3DWQA 2EYOA 3ND8A 2FXQA 4DAYB 5GAN5 4J9IA 1M3AA 2R92G 1YFNA 3CQTA 1NJIU 5DAUA 5IWAQ 2RQUA 5JVG3 1MMNA 3QDRB 1Q82R 4OO1G 4C1NK 1QVGP 1K3BC 1LVKA 2K7VA 4M77B 1PH1A 4JYAQ 1PMRA 1D1BA 4KKTA 4TRDA 2FEIA 3CCEQ 4IKFA 3OIPA 1BCOA 1HUMA 3IKJA 3UE1A 1JXOA 1JE5A 3OYEA 4E2FB 4M77G 3KYHC 3BJUA 2TMPA 4GLVB 1BF4A 4J15A 4WF2A 4B3SL 4LDYA 3GOXA 1M2VA 3ZJYC 3S2HB 4OWWB 3IRBA 2E2IH 3CC4T 2LVMA 2OTJQ 1HNXL 4HIDA 5JPMC 2CSQA 1BB9A 2HEQA 2BIVA 2F69A 2JVVA 4IFDJ 1HUNA 1ZUKA 2K50A 4C3JH 3M58A 3V7SA 2F0DA 4APVA 2BTTA 3K7UC 1D0YA 4X62L 1QCOA 2F1MA 4Y7NH 5DM73 2RCFA 1XQHA 5CKBA 4DR7Q 1V43A 1HNWL 4P74A 4IPDA 1SLJA 2KENA 2PQAB 4LF6Q 2Z6BA 4CBVA 4BXXH 5D6WA 5FK9C 3OYNA 3I4NB 2ROTA 3HOYB 2WAQE 3VR4A 1OV3A 2MAMA 1QVGS 3CD6A 1IO6A 3GQBA 1E0BA 2HSPA 4M78F 2NZHA 1IHZA 2OTLQ 2A6ED 4ZRZA 4BI8B 3SK5A 2EIFA 3HOYG 3I4NG 1Q8IA 4ZK9B 2DTOA 2KRSA 1A0NB 1YEZA 1T5XD 4DV3Q 3LW5E 1WLPB 1CKOA 2JXMB 2MWOA 3EQLC 3FP9A 3SB2A 4N8FA 3TS2A 4KTAA 2DA9A 2EQUA 4K6DA 3VS4A 1FMWA 1WZOA 2VXWA 3HRTA 4GKKL 1OZ2A 3VS6A 3BY7A 1SNCA 4XT3B 4MZ9A 1L1OB 1JJ2A 2E5LL 1P92A 4DXFA 1X69A 1QZGA 1HR0L 1JQQA 4KT0E 1K28A 5EBCA 4OIKA 4KHVA 2CCZA 1X65A 4YTLA 1RAFB 2UUAL 2LC4A 1VQ9Q 3S1MB 3MJXA 2DD4A 1GXIE 2KHSA 1AW7A 2GQIA 5KYWB 5BN5A 4HR7B 2LCCA 3PNWC 5CQYA 2JE6I 1N34L 1IL2A 1BIAA 1ABQA 4BBSB 2A28A 1NTGA 1UE7A 3JCMc 1U1TA 4F7UB 5LMNL 3C4SA 2G3RA 3TP7A 3JCMg 3FIFA 4PZ8A 4BBSG 3IAYA 1VQKQ 1OX9A 2JA5H 2DTIA 1Y71A 4F7UG 2DX1A 3HL8A 2K04A 3S2DB 3V8LA 1JU5C 3G4SQ 1E24A 1FYCA 2C06A 2VQFQ 3L1AA 1ZBJA 3R6OA 5BR8L 1SROA 4RGTA 4KH0B 4NB3A 2NUPB 4Z88A 5C6SA 1P8LA 1CKAA 1TWGH 2RHYA 5IYDG 3SXHA 2BKDN 3L3OC 2ATWA 4R0KA 1VIEA 4WJ3M 5CR2A 1LTGD 3JB9G 3K8AA 1WYXA 1RLQC 3H0IA 2KT1A 4J6YA 3OYAA 3GP8A 2DZCA 1V1CA 2BE5D 3JAML 3STBD 2L0AA 3M9QA 3OIQA 1K4US 2KHJA 3KDFA 4C2MH 1IZ6A 2KECA 1AZPA 2CZ0B 1YITQ 2ZCFB 1NZ9A 1M1FA 3EGXA 4CJ1B 1XPRA 4HIOA 4YWMA 2PTKA 2XD0A 2MWPA 4DV2Q 2IX1A 2X69A 2EE1A 5FLXE 2IVWA 2LRQA 2EJ9A 4DR5L 1YJNA 3OYLA 1FNWA 1RKNA 5KYUA 1ASYA 3RZDH 3BDCA 4DR1Q 3PUWA 1T0HA 2P5ZX 1AHJB 2K33A 5HGQA 2R58A 5I2MA 1GO3E 2FZCB 3EFRA 2MO0A 5GAOp 4M78A 2RA2A 2N3SA 3EG9A 4KGVB 1X3GA 1D8LA 3NBIA 1XMOQ 2B29A 2EJGA 3CMEQ 5CV7A 4DNIA 3G6ET 4ZYSA 2K1BA 3A98A 1JOOA 4QW2A 5ELBA 1XPUA 4LN2A 4CI0C 3VYUA 4BA1I 2BE7D 2F52A 5EPJA 2AHOB 2QTVA 3RR5A 3AHUA 4CC3A 2A6HC 3M9BA 3CC2Q 1O7YA 1Y8PB 5I6WA 2DEUA 1ABOA 2DL7A 3CP0A 2A68C 3GV6A 4JI1L 2DL4A 2QILA 4ULLA 2LJ0A 5AJ3Q 4ZNXA 3NHHA 1B3QA 1SJED 1GXDC 1XNQL 3FJ5A 2B2WA 1JJGA 3JCMh 3I3CA 3VRYA 1D5XC 2D62A 1EYCA 1XNIA 2Y0SG 2QEXA 1VQHA 1H9KA 1B34A 1QVFP 1VF5C 2HDLA 3T1YQ 1JT8A 3HOVH 1EQVA 3EFOA 5ELFA 1U0LA 1KD1R 1I4HA 1SJHD 2JJQA 4IUPA 3MC0B 2WSEE 2WKDA 4GN5A 3S14B 4MDXA 1I94Q 5EC7A 3EN2A 1YJWT 4TKOB 1SE3A 3RESA 1ENCA 3OYHA 1KQSA 3VJPA 5FRMA 1CUKA 2FPFA 4LD6A 4AIMA 2O01E 4DBFA 3V2TA 5K5PA 3JCMX 1B1ZA 4DV1L 1PTOC 3DMUA 3HRSA 5T1IA 4POFA 2AKKA 1GHKA 4NXNL 2JK8A 2W0ZA 1NBWA 3EA6A 1VQ9T 4EX5A 2RMOA 5HK3A 2QA4T 1K73C 3PTAA 5CV9A 4FW2A 1E7OA 4DV5Q 2EBPA 2YRCA 2CP7A 2FFKB 1XJWB 1C1AA 3M53A 4DBHA 4BE1A 5DEHA 1QVFS 3EG1A 2EAYA 1K0RA 4KUIA 4Z9CB 5GAN4 2X4XA 2MMPA 4FYVB 4VUBA 1U5SA 1ZYRD 2VS1A 3D3RA 1HJPA 1Y14B 1Q81C 1YI2A 3R93A 3H09A 1YIJA 2ZXPA 1D5ZC 1S5BD 2ZTCA 2YRDA 5KE2A 1FR3A 1UECA 2DBMA 2GBQA 2D1XA 4E7JA 4DUZQ 1ML0D 4DV4L 1B2TA 3A7LA 1QCBD 2M2LA 3R3OA 3AU7A 3CCMQ 4JS4A 2IHFA 2SNMA 1WPYA 4C3HB 2NVYB 5C3EG 1TIID 3SEBA 5CBEE 4R8IA 1O80A 1XMQL 4M1UB 2GQVA 4PFPA 1FD7D 1STNA 3HOZB 2ZPHB 3EIVA 4JPBW 4A3JH 2RJEA 3FPPA 4C3HG 3CC7T 2DMOA 2O31A 1G291 4QJFA 1W70A 3ME9A 4OB3B 1AEXA 2DRMA 4M7DC 3HOZG 4NMZA 2CP6A 1W2BA 5M5YB 2X4WA 1OXSC 5IODA 4JW0A 4LFAQ 4OX9L 5GMKh 3OS5A 3M4OH 2NVTB 2EQIA 2HQXA 2XG8D 4P75A 4A3DH 2HHHL 3A8OB 2LT4A 3RBBB 1ZQ1A 1ZLMA 2GGRA 4I7ZC 2B8AA 3EBEA 3EGXB 2NVQB 1I5FA 3CXCP 2PPBC 3CCST 1QP2A 3T9NA 3EJIA 3PO3H 3H41A 5C0MA 1I0CA 3FJPA 1AZQA 1PXUA 2CT3A 4FT2A 3H3VI 3KF8A 1D0XA 2QQSA 4PK4A 1AEYA 2BZXA 4M75A 4JRPA 4X6AH 5EGTA 5GAOq 2ZPFB 4PJLA 1WI7A 3UDGA 1ZBXA 4M78B 6AT1B 1KDCA 4DK1A 2ICEC 2YTYA 1ZSZC 3TZUA 5I2XA 1TWHB 4LF9Q 3K80C 1I3QB 2K6DA 2K5NA 3L0OA 2PVGB 4M78G 1G2TA 2QXFA 1SYGA 1GCQC 5FJ8H 1F2YA 2F4VQ 4GKJQ 4C0DC 1VQBA 3VS2A 5A0GA 1C9OA 3HRUA 2E3HA 4TVAB 5LMUL 3S1NH 4B3MQ 2H1EA 3PIPA 1RUWA 1RAAB 4HSPA 1WQ7A 4QKUA 1W6XA 1FX7A 4RMFA 1MSGA 4OMFB 3QR8A 3CXCS 4WTOB 2EYQA 4N0AC 1KDAA 1WVLA 4ME7A 1VQ6A 4F88A 5GAN3 2QK0A 1R77A 3F2BA 2VV5A 2XIDA 5KH6A 1KAWA 2K28A 5FW9A 3JAMi 1GRIA 3TSZA 2CZ1B 1CI3M 2RHSB 4L5GA 4B08A 4HMJA 4RGMA 3GTGB 1VQPQ 3CD6Q 2K7AA 1BK2A 2O9SA 3VS0A 4LF9L 1UUEA 1QNUA 8ATCB 4B3TL 4GNXB 2JA8B 2A1AA 3I91A 5EKIA 3T1HL 2M51A 4ABNA 1PRTF 3I4MB 4OIJA 1L0XB 2JA8G 3PIOA 1XMOL 4KI0A 3S17B 5IYCH 4BY6B 1M27C 1UAPA 2YXYA 2PO4A 3I4MG 3V05A 3PCOB 4X9CA 1JB3A 2F0FA 2BH2A 2ICIA 4V2SA 1LTRD 1OXTA 4CGYB 4ZLTF 3UDCA 1VUBA 4C8QF 1QE6A 4DR2L 1VQ8A 3I90A 1VQ5T 4DV7L 3BG3A 4C92F 3TP5A 2KEAA 1NYFA 4LDUA 2F0VA 2LY7A 1DCZA 3I56T 2NTSA 3CCUT 4KJNA 2KROA 2UXDL 1CKNB 1NSNS 4PV1C 4CHTB 5KGUA 5FLMH 1KIKA 3BVMA 4D6WA 3PF4A 4R4CA 2DN8A 2P4TA 5C4ZA 4A4KA 3Q22A 4B3SQ 4LDXA 4MIUA 3SVMA 1Q7YU 3D8GA 2A3LA 2A6HD 1RACB 2VXFA 4PQXA 2LP5A 4YY3L 1Q7YR 2QGFB 3X20B 1XPOA 2COWA 3GLXA 3JCMd 1Q1EA 1Z7TA 2HT1A 2CW0C 2V8KA 4D8KA 1SEBD 1HNXQ 1KG1A 2DNUA 2F0NA 1M1KU 1EZZB 2GTJA 1WTQA 1M1KR 4NKLA 2B2YC 4X62Q 2HL3A 2J06A 1DOMA 1RIPA 2VWFA 3FDRA 4LUDA 1EY8A 1U06A 2CWAA 3J81c 1Y1WB 4M7DE 1HNWQ 4AFUC 5LJ3g 1UTIA 1A3TA 3C95A 2P0KA 4PKCC 1Q82C 1NJIC 3NPPA 5JJLA 4K5VA 5C0XI 3KXTA 2RQWA 1MKHA 5I22A 4C56C 4FSXA 4DN4M 5GAEC 1Y1WG 1FXXA 3JSCA 3SK8A 4PG3A 2EZVA 1MJCA 1N8RR 4WCIA 5FO9B 4IFDH 4RUGA 1KK7A 4FCYA 3G48A 1DONA 1Z9FA 1VOMA 2LTOA 1VQOA 3SK6A 4Y52H 1YJNQ 4L6V5 4DOVA 3GD7A 5CV4A 2D0NA 1KQSP 5KCOA 4AH6A 4GKKQ 1PTOD 5FO7B 5CBAE 5I2YA 1G83A 1R4PB 2E5LQ 2UU9L 1HR0Q 1QVGA 2FMMA 2ASBA 2HCIA 2UUAQ 4HXJA 4IPHA 2RQTA 4PMCA 5HURA 3Q6SA 1HA6A 3V7RA 4BY7H 4A3GH 3MEAA 1RI9A 3PT9A 2RDFA 3NENA 3Q23A 3MXGA 1IXRA 2KVQG 2XWJB 1N34Q 3H8ZA 1Q86R 4H02A 2YDLA 1IKMA 4NS5A 2YLBA 2KYBA 2K75A 4KN4C 2A69C 4ZGEB 1X3QA 1YCYA 1EYGA 2Q2IA 5LMNQ 4KD4A 1YJ9T 2KK4A 2B2TC 1GUTA 3QBYA 2CUDA 1GFCA 1DJRD 1WJSA 4PJMA 1SSOA 4G57A 1X43A 5JVH3 3LWEA 4K5WA 1KRTA 4B6MA 2KXCA 2NUZA 2YRVA 4ODGA 1NYGA 5GAOm 2DUDA 2KQWA 2E4HA 5C4JB 3HOXB 3HOUH 4J6WA 2OF1A 3CCRA 4GN4B 2RK1A 1SNOA 2FL7A 3VYHB 3J81E 2QEXQ 3MA2B 3G71T 4QMGA 1NLOC 5BR8Q 2Y4YA 3GIBA 3F2UA 2OEOA 3L9AX 3HOXG 1PVOA 2PNRC 1I81A 1SYDA 2AUKA 4JOIC 2X51A 4BUGA 1SRLA 4DNRB 3NEMA 2XHCA 3CCQA 3FHWA 4FF3A 1JB7A 2ZPBB 2R93H 5GADC 2JN4A 4A54A 1NCVA 3BZDB 3JB9J 2A6EC 4M7DD 4X34A 1Q81U 1PZKD 2L15A 4FT4A 1G51A 4DAVA 1ZKOA 2YUQA 1X01A 1OU9A 1KHCA 1EYDA 2EJFC 1J3TA 2EJMA 5LJ3h 1G8XA 3M85A 2Q2HA 1K8AR 1Y69U 4K2LA 3CU7A 4QCLA 3KLRA 4JRQA 2A8VA 2J7IA 1DM0B 1KC8R 2FPEA 5KYXA 2F3IA 5G3LF 2DXBA 2J05A 1X55A 5GANj 3VA5A 5DM7R 4DR5Q 2EYZA 3LGFA 2Q2TA 1SE8A 1H92A 2DY7A 2YUNA 4FF1A 4DAYA 2HL5C 1VCIA 2I2LA 5AT1B 3E9FA 1VQMA 3QG1A 3KLWA 4X3KA 2KY9A 4LUOA 1CA5A 3ND9A 3ULLA 3VS5A 2QGQA 5DM63 2FPDA 3JCMf 4JUVA 2AQ1B 2H5XA 4JRKA 1YI2Q 4A3CG 1QCNA 1YIJQ 2BDNA 1PDQA 2JA6B 1RTOA 4ZGJB 2M9UA 4JLGA 1X56A 1YNJD 3F1ZA 2VB2X 4HJ5A 2R5MA 3QOLA 1HPCA 3E1SA 1SN8A 4JLIA 2ABLA 4LD9K 3S9WA 2JA6G 2DERA 4O1NA 2E64A 1UE1A 1V29B 1EWCA 1WHKA 1SYEA 1Y1VB 2HHHQ 2DTHA 4JI1Q 4QIWE 3CCLA 1IW7D 4Z8AA 5IYBG 1EEFD 4FXGC 2E2JH 2UXCL 2OAWA 2JNGA 1EU3A 1S5FD 3X26B 4IPCA 1Y1VG 4RKLA 1SDFA 2NZ1D 2OXPA 1XNQQ 3M54A 3K0YA 2YTVA 1Z47A 3OSOA 1WIEA 3QZ5B 2K5DA 1A3VA 4M7AF 1E1OA 3W5OA 2FB7A 1YNNC 5I9PA 2PQAA 4N8X1 3RLNA 2YYZA 1TWFB 3M3YB 2MK5A 2RM4A 4HCEA 1MHWC 2F2VA 2DXCA 2VUMB 4IQZA 3I5SA 2EVRA 2BE5C 1W1FA 1KSWA 1QJOA 2L2PA 1S5CD 3MP1A 4JC0A 4DPGA 2VUMG 1NR4A 1PHJA 1Y0MA 1PFBA 3X25B 2K3BA 1RCVD 1KDBA 5IP7G 2WACA 1G91A 1ZA1B 1EIFA 4KHPL 3EHQA 4HVVA 2KEEA 4OL7A 2K05A 1WTPA 2K4YA 5EKLA 2PNIA 4XTYA 3I4LA 1R9TH 3URGA 2EY5A 4DV1Q 4DK3C 3HZXA 1M5Q1 3CBOA 1JWSD 3BZKA 1TWAH 4NXNQ 4BS9A 4LUEA 3I8ZA 1SYCA 3I9QA 3UPUA 2Z6KC 3MP6A 1BBXC 3DB4A 4ME3A 1OXUA 4AYBE 3GTQH 4ELZC 5GAN2 5KYWA 1M30A 2EQMA 1G3WA 2CZ7B 1O7IA 3GTPH 3A8IE 2KJXA 1CQVA 2RHUA 3EVQA 3W1BA 5A2QE 1PRTB 1MMGA 2HIVA 1SSFA 4F7UA 3J7ZC 2BUDA 2EPDA 1H9SB 1ET9A 1TWCH 2E2IB 4J7IA 1NR2A 1JRIA 1ZUYA 3TQ7P 2OAUA 4KK7A 4C1NI 3FVQA 3A8GB 1VQ6Q 4A93H 4C3JB 4DV4Q 5D3IB 4X66L 2I5LX 2ESWA 4C8QB 1VQLT 3AFPA 4PZ7A 4X64L 4C92B 3PIO3 1F1BB 1IGUA 2DKGA 3PSIA 4QUCA 2NUPA 1QVFA 1TUCA 1EUJA 3VU3C 3K0XA 2LXKA 4C3JG 1I6HH 4C8QG 2YTXA 1XMQQ 2V1RA 4DR4L 4JJNK 1GBQA 2JXBA 2KBTA 4C92G 5KYYB 1H9MA 4RGNA 4HJAA 2C35B 1AWJA 1YHBA 1QCFA 5LL6S 4OGQC 2P0QA 1UJ0A 3U50C 2AWOA 1JEGA 4RTXA 1Y7XA 1TH7A 3M0PA 3SFMA 2EKHA 2EQKA 1QZHA 2KQ3A 4OX9Q 5KYLA 4LF4L 3UATA 4CC4B 1LTLA 2F5KA 3D4RA 1X3EA 4PJOD 4E6IA 1XYIA 1QW1A 1FL0A 1HCZA 1PRLC 1OQKA 2JN0A 3U23A 2K52A 3K59A 1CKMA 1PTOH 3MO8A 1Q1BA 2IT1A 3ZEHA 4M7AA 2JOYA 1VQ8Q 1LT3D 4GOPB 1IBLL 1D2BA 2JTEA 3DXJC 1KFZA 1Q8KA 3BZCA 3HFOA 3MWYW 3TCJA 4EMKB 3P1HA 1XJVA 1M8VA 1UGRB 1ZSZB 3VYRA 1I4GA 1L0YB 3E0JA 4OB2B 2RJDA 1G2BA 1VYVA 2PQEA 2YV5A 3QB3A 1G3TA 3AEVA 3GTLB 1Q82U 1N27A 1STYA 3PQIA 1X32A 4RMOA 9ATCB 3LWIA 2LFNA 3NE5B 3T56B 1WD1A 1HZAA 2I0NA 1YI2T 2L8DA 2XI9A 3I73A 4FYDA 3A7AB 2O4XA 1BDOA 2IPOB 2L12A 3LX0A 1UFFA 5IT9E 1EY9A 1ZYRC 3HKZE 4UPAA 2KOLA 2Z0WA 3VRZA 4HJ9A 1GM5A 3L42A 1ENAA 3H0HA 4HKEA 2N88A 3AYHB 2K5LA 2HMAA 1RF2D 1D0ZA 2K5IA 3GO5A 3A5UA 2A69D 2BDOA 3URYA 3QWXX 2F2XA 5LMUQ 1D1AA 1IBML 3N6RA 1EQQA 1E7ZA 3HEJA 1RAGB 3MEHA 1TWGB 2OQ0A 5GAMh 3MZ5A 1N9WA 3VR3A 1G2SA 1TS2A 2VQEL 4Y28E 4DGZA 1EWIA 2B63H 3X28B 1M90R 2V1CC 3J80i 1VQIA 4RFBA 2DETA 2PZTA 3Q24A 3CBMA 4XTUA 2C5CA 2AK5A 1VQNA 2F0EA 3I55T 3H94A 4C0ZA 1D6EC 2O88A 1ACMB 2E5KA 1EFID 1I4RA 2X6GA 3VDYA 2EWNA 3P7JA 2WP8J 1K9MR 1RTNA 1STEA 1Z9ZA 1AP0A 4RTVA 5C3XA 1WCMB 1AT1B 3OMCA 1VQPA 1LPLA 3VS1A 3IL8A 1U3OA 1PKTA 5LJ3d 1CTMA 4H0LC 1I50B 2X35A 1MI2A 4RG1A 4B3TQ 3S1QH 2C0TA 5D7UA 3CXCA 1VQOQ 1WCMG 4LFCL 1ZEQX 2CP3A 1N33L 3UF4A 2AKWB 3T1HQ 2LCSA 3T53B 4YHHL 4C3IH 1L2FA 2GA4B 3RZDB 4FW1A 5C5MA 3S15H 5IE8A 4H7BA 1LACA 4ZQ3A 3SWNB 3F8TA 5KIXA 2COZA 2XRSD 1I5LA 4OGCA 3KJOA 2QI2A 4DR2Q 1N36L 4XTVA 4DV7Q 1YVCA 5CK9A 4A3KG 4GLKA 1M3CA 3DLLA 1CKBA 4HT8A 5C44H 3KLSA 1QG7A 2UXDQ 1MHNA 1HYOA 4HIKA 2M16A 3QHSA 2DE0X 1WHHA 5C6AA 1LT6D 4P5NA 4CC2A 1H9RA 1NPRA 1TS9A 2PUKB 3L2QA 3S3OA 2IPKD 5CV8A 1BNZA 2VYTA 4HN7A 2RVLA 3REBB 1RJTA 1SE4A 4GN3B 4QIWB 4DR6L 4PLLA 3EHRA 5ISRA 1Z9QA 2HAXA 1LM0A 3JCMV 3CCRQ 4YY3Q 3JAMc 1GCPA 2X4JA 2F0WA 1I1JA 2ZXRA 2HD3A 1SEMA 3GTMH 3ERSX 3PMIA 3HOVB 4OO1H 4HT9A 1CM9A 5I11A 1S3OA 3CCQQ 3CCVA 3EG3A 4OXPA 5FU6C 2RB6A 4FVMA 3GNGA 1GUNA 3I4OA 3HOVG 3RKWA 4E7LA 1SR3A 1YNND 2D2CC 4EQOA 3MTSA 4J6HA 3WOEA 1KLGD 4JDSA 3UA7A 3OYJA 1QVCA 2VL6A 5FLXL 2VZAA 1VQ4A 5I9OA 4BACA 5IGEA 1E6HA 4JBWA 3S2HH 3D31A 5EAYA 2M02A 2JP1A 1LABA 4UP9A 1KQ2A 3BDOA 1EYAA 2ZXOA 3RIRA 2KI7A 1I4XA 1Q7YC 1LYLA 4LMQD 5IXFA 4BDYA 3MP8A 1U4PA 4M7AB 4RHRA 3CPWP 2N55A 3A8KE 3RLOA 3CCJA 2F0HA 4Q5VA 3M55A 1VQMQ 2J4XA 2B86A 3QWYA 3ZFJA 4B9WA 3C12A 4JZ3A 1PFSA 1SBBB 2UU9Q 3T4AC 3GTJB 1PH5A 2K5QA 2LJ3A 4M7AG 3UI2A 2CHBD 4PMWA 1M1KC 4F87A 2F3VA 1SYBA 1BCPD 2O5IC 3CCET 2CQAA 1VMPA 4X3UA 4YIJA 5ELDA 1HNZL 3I4NH 4JI2L 2BA1A 5IGBA 5JJZA 1UHCA 2XRQD 2PMZB 2NTTA 2O4XB 4RTWA 4A3LH 4PL6A 2RD1A 2R5AA 4B3RL 2E3IA 2RJFA 1BI0A 4I7AA 4DR3L 2K6AA 2R7FA 1N8RC 2RHQB 1PSFA 3DWPA 4S3SA 4OP0A 1WTWA 1M8AA 3OQ5A 3REAB 3CCLQ 2B2UC 2K32A 2OTJT 1S72A 2PZUA 3MEUA 2EW3A 3LH0A 3E6ZX 3NGPA 4FIBA 4QGUA 3WWVA 2EDGA 4A3JB 5LJ3f 1CFMA 4JV5L 1SFOH 2CSIA 4XYOA 3CPWS 2RDGA 4J83A 1SKUB 1RAIB 2L9HA 4A3JG 3OMGA 2PVOB 2NN6I 2B3GA 4F8MA 2FJ2A 1KD1U 1SPKA 2COYA 4OMNA 2D0QB 4J9GA 1V1PA 3M4OB 4PNOA 1PWTA 1AZEA 2GVBA 2OTLT 4F14A 3O8VA 1NM7A 5D65A 3GBQA 5EPLA 4GNXA 4TQUS 3LWUA 3H15A 1YWPA 3FRNA 5EG2A 1CHPD 3PO3B 4J9DA 3H91A 3LGLA 1UEAB 3RZOB 1SHGA 1IYUA 4OEMB 1B07A 4ZN1A 1X2QA 3NELA 3PO3G 1PG5B 1QKWA 3DHQA 3M4QA 1KRSA 4IUVA 1XOVA 2D5DA 2EYHA 4G7ZC 3GDEA 4FU6A 3ZL7C 1D3BB 1K0XA 2RF4A 1WFQA 2HCCA 3NHNA 2V8IA 5KYIA 2AWNA 2JM8A 2ZPEB 3JCMb 4QF4A 3PO2H 1KXLA 5GMKe 2PZ1A 3LH5A 1CKNA 2OCEA 4A3MB 5IP9H 3NMZC 4A53A 2NYZD 4HJ8A 1VS0A 1EFWA 2K5WA 2DYIA 3C94A 3QXEB 4O5VA 3F2CA 3LGJA 4A3MG 2KNBB 2K01A 2LQKA 4KMUC 2JS2A 1VQKT 4MZPA 5GAMd 2B2VC 2G9DA 2X6LA 2DO3A 3KFVA 2EOTA 4KRTA 4ZUJA 4QUFA 2F5TX 3G4ST 2KHIA 1SF9A 1PH8A 1EZ6A 2SNSA 4HVUA 5ECAA 2NN6H 4DK6C 1AE3A 4RGOS 1RODA 1VQ7A 4A3FH 2EYLA 2UXCQ 1PFNA 4LK1C 4IOAA 4EMGA 1AD5A 4Y92A 1IREB 1DXMA 1R8OB 3A5ZB 1PD0A 5CIUA 2WAQB 1BUVT 4IIOA 2CREA 4A3EH 1F2MA 4MTNA 1KJWA 2DL3A 4J1MA 1C7YA 2WAQG 1RI0A 4OMQA 3BYTB 5M5WB 3M4PA 1QVPA 1YITT 2ZPIB 4N9TA 1WTVA 4V190 2E6NA 3EH2A 1XNRL 3H0GH 5IXBA 3NBHB 2RA4A 3L2ZA 2JM9A 3JV3A 4DQ2A 1U4RA 2KXDA 4ORZA 1G6PA 1EY0A 4KHPQ 2HQHA 2I5MX 3CC4A 3FMCA 3K5MA 4LFBL 5FRNA 2WFWA 4JI3L 2Z4HA 5IGCA 3DEPA 5C4XH 4UDUC 1E6GA 4RTZA 4AQYL 3H0FA 4RTYA 1STHA 1B70B 4O0AA 5TSSA 4OF1A 2XK0A 3E9GA 4ESRA 3ERQA 3RNUA 3WDNA 4IURA 3CMET 2KYMA 3DKMA 1ET6A 2KEDA 1PCXA 1PZID 3S1RB 2A7YA 3OOCA 1UGQB 3EGUA 2X4YA 2RI2A 1YNJC 3L2UA 1CZGA 2IL8A 1MMDA 2E5QA 1M4ZA 3CC2T 1AZGB 4Q0FA 2DPPB 1Y07A 2R57A 2JZ2A 1BXTA 3M0UA 1JCKB 5L23A 1TTHB 4N4HA 1SXTA 5A35A 1A6XA 3VKIA 1PTOF 4OMOA 3OW2S 2ROLA 1IW7C 3W1GA 1KAAA 3META 4X66Q 3HP9A 5E4WC 4X64Q 1VQNQ 1OO9B 4ME5A 3VS3A 1F9SA 5KRUA 5M3FB 1SRUA 3EG2A 2I07B 2C0OA 1BQQT 4DR4Q 3H9NA 2L55A 3HHTB 3S6WA 4A3IB 4M75D 1OXVA 3L2VA 5M3FG 1UJYA 4M77C 2O9VA 1V1PB 3RD4A 2EYXA 2KRMA 4A3IG 1QWFA 3GNFB 3DWAA 1RL2A 2LX9A 3S3NA 3A0JA 1MV0B 2LDMA 1UHFA 2P84A 2FMCA 2JSOA 1BI3A 2LNVA 3HGBA 2ZJQA 1O9SA 1WJRA 4BD3A 4LF4Q 3FLGA 4IN3A 1XXGA 2Y4XA 5C3EH 4QB4A 3QIIA 2IX3A 1OOTA 3E19A 5IHIA 1GFDA 5M3MB 3NPFA 4RTUA 4IFDI 1TSFA 2CP0A 4NL2A 3MFGA 4C5HA 1AN8A 4DBRA 4QQDA 2NVYH 1HSQA 1HH2P 1IBLQ 2JT4A 2E76C 1MSHA 3UDXA 2MCNA 5M3MG 2KRNA 3UWNA 3H6MA 3HOZH 2NVXB 1JO8A 5GAMf 1X3FA 2Z0SA 4X3SA 1IB8A 1B3AA 1WTHA 3PV0A 4ZCKA 1JORA 4E7SA 2JUFA 4M7DF 2MPXC 2LMJA 4ANJA 3QKJA 4XQ3A 1QUQA 4RKBA 5JJKA 1M2OA 1F2ZA 4UHVA 4UP7A 2A08A 2G6FX 5CQXA 5DY9A 1UGSB 2OWOA 4DXGA 1MMAA 1VQDA 4U68A 1U4LA 2NVXH 1ILPA 4QY7A 2E10A 2LT1A 2LX7A 1FMVA 1QWEA 1NMGA 2WB1E 5CC4A 4BY1B 2NVQH 3HOUB 2X9HA 2PQWA 2K9GA 4IUQA 2L3PA 3EH1A 3HPWA 3QPHA 3CCMT 2FINB 3U4ZA 1IBMQ 2PW5A 1GHJA 4BY1G 3HOUG 4CDCC 1I4PA 4A63B 1L1OC 1WYDA 3CCVQ 2VQEQ 2P4RA 2B8GA 1A2TA 2R93B 1JQYD 5C0XG 2ZPGB 2KCTA 2PCFB 4QQ6A 1WTRA 1EWHA 3UE0A 2R93G 2VUBA 4J6XA 2NWMA 1H3HA 2WV6D 1IHVA 4OELB 5GROA 3S1NB 4FXKC 2D0OA 2F03A 4DEYA 1VQ4Q 1TWHH 1XTCD 1I3QH 1IRXA 2DK3A 2PUOB 4MDWA 4GY5A 3VUBA 2J6OA 1TY2A 1YZ6A 4KKUA 4EQPA 3G6EA 1B7YB 1HA5A 1D5MC 1GUWA 5CKHA 1N8RU 5IOCA 4KGZB 3TSSA 2DL8A 3KUFA 5FROA 5I4DA 5CGKA 5COYA 4NOYA 4PJOC 2JTFA 2J6KA 3RMSA 1GVPA 3HSBA 3K5OA 2R61A 3U9SA 4LFCQ 5D6YA 1JE4A 1N33Q 1AFPA 1JOQA 1HFNA 3I5RA 5CR3A 2VC8A 2QTXA 4OGEA 4YHHQ 3IFTA 3CCJQ 5JOBA 2VXEA 5GJVB 2VASA 5IY0A 3VR5A 4MNOA 4KULA 4EQ5A 4L5SA 5E4XA 2F4IA 3MKDA 3C1FA 4LF7L 5GMKi 1SSHA 3WXMB 5KNBA 4IZ8A 4RWSC 1N36Q 3GTGH 2L89A 4M4ZA 3I70A 3JCMP 3OYKA 2B8FA 1K3RA 4KHZA 1AH9A 1OX8A 4C5GA 1GKHA 2DJGC 2CT4A 2PI2E 3LX7A 5LJ3e 1Q86U 2ZTDA 3M59A 2JA8H 3MVVA 3M57A 1WI5A 3MXPA 4YWLA 1YJWA 1K8GA 1H9SA 1DOKA 3J81L 4U673 1TY0A 1S72Q 3KUPA 5HGTA 2CKZB 4A4GA 4AFQC 3OWFA 4A3KH 2QYZA 3R8BA 2RI3A 3S17H 4DR6Q 3NFCA 3JC66 2E2HB 4C8QA 3G1JA 1PSEA 3LYIA 2L5QA 4C92A 2AUJD 1PYWD 2EXZA 1N32L 1IL8A 1Q95G 4HEDA 4DOWA 4HCCA 3S24A 5BN4A 4JI0L 5DNFA 3M4GA 1NE8A 3OYBA 5KYYA 4BI4A 2QA4A 2X3XD 1W6JA 2CWPA 4L8JA 1RABB 4DUYL 1VQPT 3CD6T 4M77E 3FKIH 4HCZA 4DV0L 4JI5L 4H44C 2FZKB 3J80L 1O75A 2EGEA 1LTAD 5GAGC 3Q0AA 4BWGB 2Q2UA 4A4HA 4BA2I 3HS0C 5K36H 5CAIA 4X1VA 2Z8LA 1HJDA 3OYMA 3G7LA 4B9XA 1KNAA 1PZJD 1RD9D 3PUZA 4JCVE 4K2KA 4KY7A 2B39A 5GJWB 5EQ0A 4DU9A 1K8AU 4GLAC 2DJZA 5I6YA 2JA7H 3FPUB 2NYSA 3M7GA 1K73R 1VQJA 1TWAB 1ZA2B 1KC8U 3GTKH 2D9UA 1A63A 3CQZB 2KCCA 4DK0A 4GOPA 2J0TD 1X2KA 4F7XA 3HKSA 3JCMQ 4QQGA 1LTBD 1BR9A 2F0SA 2AIRB 4EMKA 1X3PA 3GTQB 2EGAA 2KVMA 3S16H 1ZSZA 3FB9A 4A76A 1WXTA 3A8MB 5M5XH 1J5EL 3GTPB 3R2TA 2HQLA 4FYXB 3RMQA 1GCQA 3CC7A 2EVBA 1Y1WH 1CA6A 4HCBA 5JEAG 5J39A 1PFMA 3OBWA 3F70A 1HNZQ 2HDAA 1QUQB 1TWCB 4E7HA 1STBA 4JI2Q 1WD0A 1WJJA 2PNHA 1WQWA 1UEBA 2JS0A 5IN1A 2ZM6L 2KMTA 4B3RQ 4PJOF 4A93B 1E3PA 3TP8A 4EPCA 4N0AA 5I2SA 3RKYA 1QB5D 4DR3Q 3GV3A 4WJ4A 1FYNA 3MPUB 2DVEA 2DXTA 4A93G 3CCSA 2RDHA 1VQ7Q 1V1QA 2CUBA 3ULRB 5J1ZA 5NUCA 2CKKA 1FMKA 2QKIC 3CRLC 4JV5Q 1OPLA 4JVZA 2DVJA 4CJ0B 2OQKA 1C4QA 4PJJA 3VYSA 2JMCA 1BBZA 4JK1C 3ITPA 1HHVA 2CFMA 2JTMA 3OTOL 1HD3A 5IH2A 1VQ4T 1WFWA 4HSVA 1PM3A 2QW7A 2QQRA 4JJBA 5D3DA 5ELEA 4M77D 4LNPA 1A0IA 3VR2A 1MGQA 2PYKA 4F7UE 1A2UA 1Y96B 3OYYA 3P8DA 3K5LA 3SHWA 4PJOE 1PTOB 1U8RA 4A3BB 1YJNT 3CC4Q 2EYYA 3CPWA 3PGZA 1CSQA 1EY7A 2WSCE 3PGGA 3R6NA 1NY4A 1YHAA 4EVOA 5C4JH 3TEHB 5IIFA 4A3BG 3M7NA 3SWNA 2GFUA 1JC7A 5E7NA 2V26A 3CW2C 4KV6A 1PH3A 1PH9A 3WVEB 4LDVA 1OTCA 5IGGA 1HRJA 4CRIA 1FGBD 2N8NA 1C48A 4R56A 4JJCA 2JW4A 2R7ZH 1BCPC 3F2DA 2FRWA 4LXCA 4IJLA 1RAEB 4L5RC 2QGGA 3ER0A 5KE3A 1EY6A 4PLIA 4LF5L 2DFUA 1N5ZA 2ZGWA 1KD1C 1BOSA 1NUCA 2ZJRA 5GAMg 4JS5A 2EY6A 3BYYB 2HUGA 2WB1B 5KYNA 1W4SA 2EKOA 2XNAC 1EOVA 2SDFA 3M0TA 2VGNA 4EGVA 1HTLD 3HP3A 1X9NA 4CDFC 1J8IA 3QUIA 2E70A 1LV9A 2JYOA 2WB1G 3K7AH 2B63B 2XICA 2KBNA 4P2CB 4XYQA 1WXBA 2B2YA 2HCKA 4WFN3 2LQ8A 4ZAIA 3J7YW 2QEXT 2B63G 2L3QA 2L3SA 4Y7NB 2NZOA 3M0RA 2ENBA 5KNCA 2OI3A 4K8IA 3M5AA 5GANg 4FDBA 3PUXA 2UUCL 3EAEA 1VQ5A 3IFDA 4M7DB 4IUTA 4BDZA 1LNXA 1SE2A 5ELCA 3T51B 3NTHA 2YU9H 3UDIA 2D0PA 2XDPA 3QYHB 3V7CA 4ZN3A 2XIWA 4OONA 4M78C 1YN8A 3E2UA 4K5XA 4X65L 3I56A 4BXXG 3CCUA 4M7DG 3P75A 2QQAA 4IUNA 4YCVA 3S1QB 3UT1A 2K2MA 1U9RA 1CSPA 4FYWB 4KBMB 1B9MA 2EJGC 3A8JE 3ULPA 5LJ5g 4JRIA 1HFGA 4C3IB 1TOVA 3OS0A 1XNRQ 3JCMW 1XWEA 4OWTB 3S15B 5IYBH 3UDFA 1GUGA 2F0OA 1U1SA 1WNLA 2KSSA 1H3ZA 4R8NA 4C3IG 4R4IA 1K76A 2VB3X 4R4TA 4HMIA 4KUDK 4RG8A 2Y0SE 3BS1A 2DGYA 2XN9C 4LF8L 3L2WA 1WTXA 2E6ZA 2HD0A 4HCSA 4LFBQ 1PH2A 4XK8E 4JI3Q 4DV6L 2ZAEA 2AMCB 1OU8A 2B2WC 4JI8L 5IT9L 2CZ6B 4RCBA 2ID0A 1G5VA 3JB9D 3PF5A 3PMTA 4LW1A 2SOBA 2HKNA 4AG2C 3ZYYX 4AQYQ 1TWFH 3M3YH 2DRKA 5KNDA 1AWOA 4BBRH 4JBMA 3J81i 2VUMH 1WHLA 5GAN6 4C0DB 1YIJT 3MXNB 2A74C 1ENFA 5FWBA 2AT1B 1DOLA 3RERA 1SMXA 4IUUA 2JA5B 2CP5A 2LQNA 2PVDB 3PMFA 1BVSA 4II1A 4LUZA 1TXQA 4O42A 5E3FA 4DF7A 1WX6A 1TXYA 5JPNC 1ARKA 2JA5G 2G5DA 4RCOA 4X9DA 3PE0A 2A19A 1F9QA 1SYFA 3OY9A 4XTCS 3E9IA 3TS0A 1JOKA 4JOIA 1M90U 3MFYA 5FU7C 1NJIR 4M7AD 1MIUA 1VQGA 1LTSD 4MN3A 4N4IA 4FSSA 4L5TA 3C2PA 1KQ1A 1UGVA 3CEYA 2DJQA 3ZBDA 1PRMC 2EY2A 3LWHA 1BCPF 2K3YA 5GAN8 1HTPA 3FDTA 3TRZA 1G6ZA 3EFSA 3BW1A 4UY8C 1K9MU 5CKDA 2K57A 1BO0A 4NDXA 3G6EQ 4C2MB 4OO1I 3TREA 4FP5D 1NEGA 2EJFA 5CYUA 4F04B 3RN2A 2HBWA 3M0SA 5GANh 2JEBI 2YWWA 3E3XA 1EIGA 1PH6A 3OW2A 4IO9A 2OJ2A 2RF0A 3FEWX 1I4QA 2F0PA 1DD2A 2F1LA 4D8DA 4FYYB 1K8MA 1V8QA 3GTOH 1YJ9A 3NUCA 2V8JA 4IPGA 1T3LA 4XIGS 2WSFE 2EYJA 4PZ6A 4J9CA 5LJ5h 1VQEA 2DNCA 3HG9A 1PYBA 3HOWH 3P8HA 1X6OA 4K6LA 1QMCA 2D8JA 1NE3A 1D3BA 1N6AA 4LAAA 1KABA 1AE2A 2VW9A 3DB3A 4EDUA 3G71A 4C0GA 2ZT9C 4AFZC 4A4FA 2XDDA 5L8RE 1T0JA 3QZ9B 1D7QA 4ZKCB 1BI2A 3PFSA 3EFXD 4HVWA 3RR6A 1B7TA 1YJWQ 5CO7A 2ZZDA 1FJGL 3WOFA 4A3LG 1K83H 2DD5A 3JCMJ 3D0FA 4JI7L 1GUOA 1BBWA 2DAQA 3OYIA 3OB9A 3QSUA 3C1EA 1NEBA 2DJFC 2EQSA 4CDDC 5HK0A 2K14A 4BE0A 2YHTA 1VQ6T 2DY8A 3C46A 1DZ1A 5GMKj 3GP7A 2F0UA 3AB9A 3KLSX 2EFIA 2IIMA 4PFZA 2L11A 3BE3A 1SFOB 1HXYD 5FLXc 2IJ0A 2KCNA 3H6ZA 3D4WA 2XWBB 2R92H 4HCKA 2OT2A 2QA4Q 1JBMA 2RO0A 1EU4A 1RAHB 1UGPB 1HXDA 1YBYA 4HAEA 2F2WA 1VQAA 3GTLH 4M78E 4M75C 3HFZB 2CVRA 5C0XJ 1IBKL 4BB7A 2IWHA 5FO8B 4FO2A 3SD4A 4XU3A 3OBYA 5HY6A 1BYMA 1TR5A 3AQQA 5E1FA 1S5ED 4PJOB 3E9HA 4P71A 1GJXA 1JMCA 4CC7A 1LCKA 2EGCA 3P8BB 3SDZA 4J9EA 3QJYA 3QIAA 4LJZC 1VQFA 2UUBL 3J7AV 3NBHA 2A0FB 4N4GA 4PJOG 1YP5A 1YHQA 2F0GA 4E47A 2WINB 2F0IA 2ALYB 3EGDB 1X6BA 3X24B 1B44D 5LHY1 3NP8A 3JCMe 1NMFA 2Z6KA 1VQ8T 4LWCA 1E2WA 5FWCA 4ZUIA 1IYVA 2GVAA 4WRDA 2LCLA 4OB1B 1MJEA 3PO2B 3I35A 4L5QA 3CC7Q 4FM4B 1STAA 1LUZA 3LLRA 3QWNA 3J7AF 4AYBB 3AMUA 4LF7Q 4RAUC 5JAVA 4DA2A 1KHIA 5GAOl 3OYDA 1LTTD 2ECZA 4XQNA 1N9SA 3FRPB 5IHNA 3NWSA 3PO2G 2XSCA 4AYBG 3HOYH 3JB9I 1SNPA 5IP9G 1QLYA 1WCMH 4MMLA 4UP8A 3B6YA 1LT5D 1O7ZA 1UE6A 2FHTA 1I50H 2RHZA 2MQHA 2I46A 1FNUA 2L1BA 3CMAA 4QQBX 1E22A 1FNVA 3JAME 4JI6L 4GLMA 2RJCA 1C0MA 4C5EA 3CCSQ 4KLKA 5L37A 1JR0D 2Z4IA 1M3BA 1VMCA 2EPBA 1PKSA 1SNQA 4A3FB 3M56A 2F0KA 3TDQA 1A8VA 5KEEA 1SRMA 2NN6G 1QILA 3A55A 4A3FG 2D8HA 2DL5A 1N32Q 1R0CB 4NXML 2SEMA 1MGSA 1TQOA 2GN5A 2HIXA 1C6VX 2IW3A 4A3EB 2CH4A 2M1HA 4JBJA 3QO3A 4JI0Q 3S1MH 1I5OB 3GF5A 3KBXA 4DUYQ 2RN8A 3J7A5 1GUSA 4TVRA 4A3EG 4FXDA 1ZXTA 4KGXB 3OYFA 4M78D 1V9PA 4DV0Q 4JI5Q 3H0GB 4Q5WA 4BBSH 3GPLA 4A3DB 3NXWA 1M2VB 1VQOT 1RDPD 1B53A 1PHTA 1Q86C 2DF6A 3H0GG 3RKXA 2FVUA 4A3DG 3W3AA 2UXBL 2Y0SB 1JB0E 4NP5A 2KGTA 2MUYA 2F0MA 1PC0A 1ZHIA 4J8OA 2ZJPA 3S2DH 5C4XB 3RNJA 4EQNA 1EEID 1VQLA 1VA7A 5GMKm 4JI4L 2XTIA 2JEAI 3K81C 5IYDH 2RKSA 3MEFA 1BCMA 2IG0A 3KK7A 1FVIA 2VB6A 4NL3A 5C4XG 3JB9H 1TT2A 3MEWA 4DAPA 1GOZA 4JBKA 4M75F 1PH7A 3A1PA 3L2RA 2F0JA 4CKCA 2XMFA 8AT1B 1J5EQ 2YUPA 2ES2A 4RTTA 1RHPA 1ZUUA 3C3LA 2P0PA 3NTKA 2H3EB 3RDVA 4C0FA 3K6OA 3OW7A 4K8JA 5BN3A 3O13A 2K79A 3HKZB 2H4OA 2MF2A 2CDTA 1A62A 3WVDB 5JEAJ 3HKZG 4XU0A 5FJ8G 2E12A 1KIXA 4RH6A 2QQBA 2RCNA 2ZM6Q 4DFAA 2YUOA 1SMYD 2K2VA 3BVGA 1RLPC 1EL0A 4FF4A 3CCRT 2XKOC 2KA7A 4H13C 4ID6A 1NG2A 2QDYB 2LXJA 3VS7A 1K8AC 4M8AA 3MCAB 2O2OA 4HIMA 1DYQA 2KAFA 2C9OA 1F77A 4L6TB 5DLQE 1KC8C 1VQ5Q 1H8KA 1F9PA 3BU2A 4J8QA 4MZMA 3CCQT 4E6RA 1HQRD 4M75E 3GTJH 2MP1A 3X3NA 1FWZA 3K57A 3I56Q 2GTOA 3CCUQ 2HBPA 2L0CA 2HNIA 3OTOQ 5GANd 5GAN7 4IJHA 2DIGA 3MEVA 1UG1A 2M0OA 3PUYA 1KLUD 2E65A 2RI5A 1O7LA 1PRTC 5D14A 3OPOA 1I6VC 5C3EB 1OZ3A 3QOJA 1BBUA 2DXUA 1WXUA 3ICEA 3UA6A 1EIYB 3CPFA 5LJ5d 3SK4A 4Z02A 3DUZA 3OW2P 3RN5A 2AQ2B 5IYCG 1TUGB 4C8QC 1NAPA 2VKNA 2DILA 4C92C 4ZTFA 4J7FA 1SHFA 4DEXA 1VQMT 1BCPB 2CQOA 2DIQA 1EFNA 2WKCA 1L0WA 2KCMA 1LJOA 2FYKA 2O5JC 1LTID 3I55A 2JA9A 3VR6A 2AKLA 2KR3A 1OULA 1VIFA 1O78A 4GS3A 1YNZA 1B50A 4Y91A 3KDFB 1N9RA 4N9PA 3K5NA 2OX7A 4TSSA 5FLMG 1MNEA 2Z9HA 4KKSA 4LF5Q 3S14H 4K0KL 4BE2A 1OYXA 4A75A 1JXMA 1YNXA 2IY5B 3RZOH 3CCLT 1X54A 4YWKA 1KTKA 2QQ9A 3I7FA 2BZYA 2Y90A 2A73B 1WTOA 5KYUB 2K4KA 1ILQA 1BIBA 1OPKA 2ED0A 3EG0A 5LJ3j 1MBYA 1JJ2P 1EZ8A 1VDZA 5IWAL 4G4KA 3J81j 4GOPC 2RQRA 5HKCA 2EY1A 4EMKC 4JYAL 1BU1A 3EG9B 1XX8A 2UUCQ 1WHGA 2E41A 4J9FA 1TS4A 3KOJA 2E75C 1SNDA 1I07A 2CYZB 4A3MH 4MMKA 5CORA 1UUPA 2AZSA 4X65Q 2M0YA 4GBQA 4XQQA 3BFMA 3CBPA 4KY6A 4XQJA 4XTXA 3RUXA 5GAOr 1YJ9Q 1ICWA 4CDEC 2Z1CA 4XT1B 2EXDA 5CKEA 4IFDG 3DEOA 3V8KA 5A0LA 1BI1A 3U9OA 4OB0B 4O6JA 1A3UA 1M8MA 1VYTA 2LMCB 4MTKA 3RLFA 2MHVA 3FC3A 4DR7L 4RKUE 2VNUD 4ZTJA 3G71Q 3FEOA 1JJCB 5GQOA 4LF8Q 3THKA 4LF6L 4FNFA 1WHMA 4C3HH 1B34B 1WJQA 4I65A 3PVLA 5IGDA 4F16A 4P72A 1JJ2S 2Q8TA 1T9HA 3EFOB 1WDXA 4IOCA 3M0QA 4DV6Q 4BY7B
chains in the Genus database with same CATH topology
4JI8Q 4EMHA 1Q12A 2CGHA 2D6FA 3VUZA 4BY7G 1C0AA 4A3GG 5M5YH 1M1GA 5M5WH 4DV3L 4HA8A 3H3VH 4RCCA 2NVTH 2DZ9A 3TQYA 3KBGA 2HQEA 3HFNA 4XTZA 5FU7B 4QVZA 1OXXK 4A3KG 5GANf 1PH6A 4GLXA 1C7YA 3S3MA 1PA6A 2FHDA 4QVCA 3Q8DA 2YLCA 3SWNC 2K3XA 5LJ5f 2CS7A 3FKIG 3KF6A 1HZ9A 3OSVA 3CCEA 2RK2A 3S1RH 1XTDA 3OYGA 1Y96A 5K36G 1J6QA 5M9OA 2VQFL 1HZCA 2EQJA 4A4EA 1PV4A 3G7ZA 2JA7G 4C8QE 1WOCA 3A74A 2OTJA 1P16A 3V8JA 4C92E 1HK9A 2NLUA 4BI3A 5M3FH 5GAOn 1M90C 1I8FA 5CKFA 2XDBA 2R7DA 4A3IH 3CF5A 1PYSB 4M77F 3MHXA 2BA0A 1K9MC 2OTLA 1FJGQ 5KCHA 3L7ZC 2XGTA 4DV2L 1X75C 1S40A 4JI7Q 3TU4K 3I4MH 3J80c 4LNQA 2K5VA 1KL9A 4DR1L 5M3MH 3KF8B 1VQNT 4OVAA 4M75B 5FU6B 4M7AC 3OSSC 2PU9B 5ELNA 1VQ9A 1UB4A 1XMOL 4M7DA 2NVXH 1U5KA 4M75G 1ASZA 2L3RA 2GF7A 3U58A 2RHXA 2IX0A 3BDLA 1BKBA 3VYGA 4XAXB 1IBKQ 1VQCA 4POGA 5J26A 3INZA 2MNAA 1W3SA 5AJ3L 2UUBQ 1VQKA 4DKAC 4BY1H 4J5YA 2LSSA 4HJ7A 1K73U 1KQSS 3G4SA 1E1TA 3L2PA 1UE5A 4NPSA 3T1YL 1IYJB 4C8QD 4DAMA 4C92D 5GAMj 1G3SA 2N78A 3ULJA 1I94L 2R7ZG 2MO1A 3CAMA 1M9SA 2PI2A 3S1NH 2D9TA 4ALPA 3PUVA 4C5IA 3VV0A 1YITA 3J80E 1PH4A 4F7UF 4R55A 5CVIA 4RG2A 2ZTEA 4JI6Q 4YCUA 4R1JA 5H1SE 2GCXA 3N5BB 3JRZA 4QL5A 3CCVT 4YCWA 2H3JA 4DV5L 2K5HA 4JG2A 3NTIA 1EQRA 2I5HA 2R6GA 3AFQA 4A4IA 3JB9F 4M77A 3TEEA 5LJ5j 4NXMQ 4LDWA 5GMKl 2VGMA 1H641 3U4VA 2GFAA 3ASKA 4XU2A 3KF6B 3CMEA 1YHQT 3KFUA 4DUZL 1W2BS 3BDUA 5CCAA 3CC2A 2KDSA 2UXBQ 4ZGDB 2IHEA 2RH2A 3OA6A 3CCJT 2E2HH 1B8AA 4O2DA 3HOXH 3E0EA 4JI4Q 3STBC 1DGSA 1G3YA 4LFAL 1GD7A 2JQOA 2K5FA 4BBRG 3CMAT 5IAYA 2BH8A 4R4OA 2XU8A 4XU1A 4E7KA 1HZBA 4MZTA 1HR0W 5ELOA 1S72T 3QYGB 4P73A 1UWVA 1L1OA 3OYCA 3SGIA 5J3BA 3CQZH 2VY3A 4M7AE 5GAHC 2E8GA 5I21A 2N49A 5LMNW 4LUVA 4LF9L 3Q1JA 3QJ6A 2E1HA 4L59A 4ELYC 4A3CH 5A0DA 1WGSA 1Q46A 1DJ7B 3A8LB 4DA4A 2F4VL 3OS1A 4GKJL 2PMZE 4PJOA 4OWXB 3OS2A 4B3ML 5IT9c 2AHJB 3A8HB 1NPPA 2JA6H 3M4YA 2DEQA 5DLOA 4QVDA 1LOJA 5GAMe 3I2ZA 1Y1VH 3CCMA 4R4QA 3DM3A 4XTWA 3KJPA 2RHIA 3HOWG 1H95A 1FGUA 5GANe 1OI1A 5C44G 3DLMA 2MFIA 5IP7H 4K0KQ 4GNXC 5AYFA 1I4K1 4E7IA 2MI6A 5LJ5e 4ATOA 4A3BH 5D6XA 4FL6A 1QP3A 1VQ7T 2I0QA 4UC4A 4BY6C 2FXQA 4DAYB 5GAN5 2R92G 1NJIU 5IWAQ 3QDRB 4OO1G 4JYAQ 4M77B 1PH1A 4IKFA 3UE1A 1JE5A 3OYEA 3KYHC 4M77G 3BJUA 4GLVB 4J15A 4WF2A 4B3SL 4LDYA 3GOXA 3ZJYC 4OWWB 3IRBA 2E2IH 3CC4T 2LVMA 1HNXL 4HIDA 2BIVA 2F69A 2JVVA 4IFDJ 2K50A 4C3JH 3M58A 3V7SA 4APVA 3K7UC 4X62L 4Y7NH 4DR7Q 1XQHA 5CKBA 1V43A 1HNWL 4P74A 4IPDA 1SLJA 2KENA 2PQAB 4LF6Q 4BXXH 5D6WA 3OYNA 2WAQE 2MAMA 1QVGS 3CD6A 4M78F 2NZHA 4BI8B 2EIFA 3HOYG 3I4NG 2DTOA 1YEZA 4DV3Q 3LW5E 1CKOA 5JJIA 2MWOA 3FP9A 3TS2A 3SB2A 2EQUA 3HRTA 4GKKL 1OZ2A 3BY7A 4MZ9A 1L1OB 1JJ2A 2E5LL 1P92A 1QZGA 1HR0L 4KT0E 2CCZA 1X65A 4YTLA 2UUAL 2LC4A 2DD4A 1GXIE 2LCCA 3PNWC 5CQYA 2JE6I 1N34L 1IL2A 1BIAA 1NTGA 1UE7A 3JCMc 1U1TA 4F7UB 5LMNL 3C4SA 2G3RA 3JCMg 3FIFA 4PZ8A 4BBSG 2JA5H 2DTIA 1Y71A 4F7UG 3HL8A 3V8LA 1E24A 2VQFQ 2C06A 3L1AA 3R6OA 5BR8L 1SROA 4NB3A 5C6SA 1P8LA 1TWGH 2RHYA 5IYDG 2BKDN 2ATWA 1VIEA 4WJ3M 5CR2A 3JB9G 3K8AA 3OYAA 4J6YA 3GP8A 2DZCA 3STBD 3M9QA 2KHJA 3KDFA 4C2MH 1IZ6A 2CZ0B 2ZCFB 1NZ9A 1M1FA 1XPRA 4HIOA 4YWMA 2XD0A 2MWPA 4DV2Q 2IX1A 5FLXE 2IVWA 2LRQA 2EJ9A 4DR5L 1YJNA 3OYLA 1ASYA 3RZDH 4DR1Q 3PUWA 1AHJB 5HGQA 2R58A 5I2MA 1GO3E 3EFRA 2MO0A 5GAOp 4M78A 2RA2A 2N3SA 1X3GA 1D8LA 1XMOQ 2B29A 2EJGA 4DNIA 3G6ET 4QW2A 1XPUA 4CI0C 4BA1I 2F52A 2AHOB 3RR5A 3AHUA 3M9BA 3CP0A 2HHHL 4JI1L 5AJ3Q 1XNQL 1JJGA 3JCMh 2D62A 1XNIA 2Y0SG 2QEXA 1VQHA 1B34A 1JT8A 3T1YQ 3HOVH 1U0LA 2JJQA 4IUPA 2WSEE 4GN5A 4MDXA 1I94Q 3EN2A 1YJWT 3RESA 3OYHA 1KQSA 3VJPA 5FRMA 1CUKA 4LD6A 4AIMA 2O01E 3JCMX 4DV1L 3HRSA 4POFA 4NXNL 2JK8A 1NBWA 1VQ9T 4EX5A 5HK3A 2QA4T 1K73C 3PTAA 4DV5Q 3M53A 4BE1A 1QVFS 2EAYA 1K0RA 4KUIA 5GAN4 2X4XA 2MMPA 4VUBA 2VS1A 1HJPA 1Y14B 1Q81C 1YI2A 1YIJA 2ZTCA 5KE2A 4E7JA 4DUZQ 4DV4L 4JS4A 2IHFA 1WPYA 5C3EG 1XMQL 2GQVA 2ZPHB 3EIVA 4A3JH 2RJEA 3CC7T 1G291 4QJFA 3ME9A 4OB3B 4M7DC 3HOZG 1W2BA 2X4WA 1OXSC 4LFAQ 4OX9L 5GMKh 3OS5A 3M4OH 2HQXA 2XG8D 4P75A 4A3DH 3A8OB 2LT4A 1ZQ1A 2B8AA 3EBEA 1I5FA 3CCST 1QP2A 3T9NA 3PO3H 5C0MA 3FJPA 4FT2A 3H3VI 2QQSA 4M75A 4JRPA 4X6AH 5GAOq 2ZPFB 3UDGA 1ZBXA 4M78B 2YTYA 4LF9Q 3K80C 2K5NA 3L0OA 2PVGB 4M78G 2QXFA 5FJ8H 2F4VQ 4GKJQ 4C0DC 1VQBA 5A0GA 1C9OA 4TVAB 3HRUA 5LMUL 4B3MQ 3PIPA 1WQ7A 4RMFA 1FX7A 4OMFB 3CXCS 2EYQA 4N0AC 4ME7A 1VQ6A 5GAN3 3F2BA 2VV5A 2XIDA 5KH6A 1KAWA 3JAMi 2CZ1B 2RHSB 4L5GA 4B3TL 4GNXB 2A1AA 3T1HL 2JA8G 3PIOA 4KI0A 5IYCH 4BY6B 3I4MG 3PCOB 4X9CA 2BH2A 4V2SA 1OXTA 3UDCA 1VUBA 4C8QF 4DR2L 1VQ8A 1VQ5T 4DV7L 4C92F 4LDUA 3I56T 3CCUT 2UXDL 1CKNB 5FLMH 4D6WA 3PF4A 4R4CA 2P4TA 4A4KA 4B3SQ 4LDXA 1Q7YU 4YY3L 2A3LA 2VXFA 1XPOA 2HT1A 3X20B 3JCMd 3GLXA 1Q1EA 2V8KA 1HNXQ 1KG1A 1M1KU 4X62Q 1RIPA 3FDRA 2CWAA 3J81c 1HNWQ 4M7DE 5LJ3g 1NJIC 3C95A 2P0KA 4PKCC 1Q82C 5JJLA 5C0XI 3KXTA 1MKHA 4FSXA 5GAEC 1Y1WG 1FXXA 3JSCA 4PG3A 1MJCA 3G48A 1Z9FA 2LTOA 1VQOA 4Y52H 4L6V5 4DOVA 3GD7A 5KCOA 4AH6A 4GKKQ 2E5LQ 2UU9L 1HR0Q 1QVGA 2ASBA 2UUAQ 4IPHA 3V7RA 4BY7H 4A3GH 3MEAA 3PT9A 3NENA 1IXRA 2KVQG 1N34Q 3H8ZA 4H02A