1KHIA

Crystal structure of hex1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
147
structure length
147
Chain Sequence
GSASQTVTIPCHHIRLGDILILQGRPCQVIRISTSAATGQHRYLGVDLFTKQLHEESSFVSNPAPSVVVQTMLGPVFKQYRVLDMQDGSIVAMTETGDVKQNLPVIDQSSLWNRLQKAFESGRGSVRVLVVSDHGREMAVDMKVVHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hex1
publication title A HEX-1 crystal lattice required for Woronin body function in Neurospora crassa
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Structural protein
total genus 25
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2001-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1khiA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1khiA02
5A2QE 1WJJA 3PF4A 2NVXH 3F2BA 2PMZE 4DR2L 1YJNT 1EFWA 4JI3Q 3CXCS 1V43A 1JJ2S 2ZM6L 5FLXc 2E6ZA 2H5XA 5DLQE 4LFCL 4C3JH 3L2PA 3U58A 1A0IA 4A3KH 4JBMA 4UP7A 2K5HA 4OX9L 1BBWA 3UE0A 2I0QA 2UUBQ 2CKKA 4B3SQ 3RNUA 2OTJT 1HH2P 4HJ5A 4JI4Q 2K50A 1KIXA 2G3RA 4X34A 4DUZL 1Z9FA 1E3PA 3LGLA 4DV2Q 1N36Q 1W3SA 1YI2A 3KLWA 3HOVH 5IP9G 4A93H 1VQPT 3PUYA 4GKKQ 1I6HH 1HNXQ 2K52A 2ALYB 3I56T 2GVAA 4PZ7A 4B3SL 1Z47A 4LFBL 1KXLA 4A4IA 1EOVA 3GD7A 2OTLA 4JI7Q 3CCQA 3CPWA 3NBHB 3S1MH 1K83H 3KDFB 3DB3A 1SSFA 4JV5Q 4AH6A 5GQOA 2NVQH 3FHWA 1UWVA 3I4MH 2K14A 2L15A 4DR7Q 1I50H 4LF4L 1N33Q 1Y1WG 4A3LG 2IHFA 2RCNA 4RMFA 1K73C 1L0WA 1TWCH 4GLVB 2Q2TA 2IX1A 4IOCA 4GOPB 3EN2A 3AFPA 3MXNB 3I4OA 4B3ML 4A3EH 2JA5G 1VQAA 4X65Q 1T9HA 5FLXE 1NJIC 3A5ZB 1KC8U 5GAHC 3GTKH 1A63A 3BZKA 5AJ3Q 3A5UA 3CPWS 2IT1A 3CC4A 3HOUG 4OXPA 5JJLA 3PUZA 1VQOT 4QL5A 2D0PA 1BVSA 2ID0A 3BZCA 4LWCA 4C2MH 2K4KA 4R4TA 1IBKQ 3H0GG 4GOPC 2MO1A 4LF6Q 1VQLT 3GTLH 1LYLA 1QVCA 5C0XI 2UUCQ 2ZJPA 2UXDQ 2WAQG 1VQ5A 1UEBA 4WJ4A 4IPGA 5LMNW 2KVQG 2JA9A 1IBKL 1VQBA 1XMQL 3H3VI 1Q81C 4A3BG 3CC7T 3U50C 3HOYH 1PA6A 2PQAA 1LUZA 4JOIC 4A76A 3M3YH 3EIVA 3T1HL 1WFQA 4JYAQ 5GADC 4DR5Q 4PMWA 1PVOA 3FKIG 2ASBA 5C0XJ 1HR0W 2R7ZG 1RIPA 4O2DA 4TVRA 3CCVA 2IY5B 2UUAQ 2ATWA 4RG2A 2Z0SA 3PUXA 3GTPH 1LM0A 4AQYL 4DV6L 5C4XH 1HZAA 2N8NA 5HY6A 3KJPA 1IL2A 1VQ5T 5IYDH 1KHIA 2WFWA 4HJ8A 2JA8G 1S72T 2MQHA 1QVFA 4JG2A 4QJFA 3RR5A 3T1YL 1VQ8A 1XNRQ 3S2HH 3CCUA 4JC0A 1PH5A 1C7YA 4IFDG 4BA1I 2E5LQ 1M90C 1Q7YC 3PSIA 1G51A 1UE6A 4PZ8A 2ZM6Q 1I3QH 3CMAA 3HOXH 3F2CA 5JEAG 4DR4Q 3HKZG 1LTLA 4A3CG 3G6EA 1KD1U 3CCVT 4QY7A 4MNOA 1YJ9T 3S14H 1FJGL 2EQSA 3HFZB 2N3SA 1XNQL 3P8BB 1YZ6A 2ZJRA 4JI5L 1NBWA 1YIJA 1TWFH 2D0OA 2EXDA 4GNXB 1K9MC 1L1OC 1QVFS 5HGQA 3PIOA 5C3EG 2R93H 1VQKT 1U5KA 3K7AH 2ZTEA 5IYCH 1OTCA 4JBKA 3J80E 1Q86U 4IPDA 1EQRA 3AFQA 3D0FA 3UDFA 4OWWB 1K3RA 1OXXK 4A3DG 3CCRT 4LUVA 5FJ8H 4X62L 3HOZG 4LUOA 2QEXA 3RZOH 2Z6KA 4R4QA 4LF5L 1AE3A 2K5VA 2HT1A 3PO3H 1BKBA 3OTOQ 1YJWA 1VQDA 3J81c 1N32Q 1I94L 3RN5A 3CCJT 4IOAA 1YJNA 4B3TL 3M4PA 4A3KG 3A0JA 2HIVA 4A3GG 5GAEC 3ULLA 1J5EQ 4JI6Q 4DV7Q 1X3FA 5C44H 5FLMH 2MFIA 5E7NA 1Q82C 4JI1Q 4R4OA 2KHIA 4BBSG 5IP7G 2OTJA 4X6AH 4JI4L 2Q2IA 1B70B 4DNIA 4NPSA 1UE7A 5M5WH 1YHQT 4J15A 5IT9c 4A3MG 4DR2Q 4IJLA 1VQPA 3TS0A 1IZ6A 4BBRG 4ALPA 3I56A 1YJWT 2MO0A 2WAQE 3W5OA 5BR8L 3G4SA 2ZJQA 4LFCQ 2JA7G 4BXXG 3PUWA 5IE8A 4OX9Q 2VNUD 3AQQA 1M1KC 4DUYL 4LF8Q 3M4OH 3STBD 5JJKA 3J80i 2AMCB 3PUVA 1E1OA 2VQEL 4OWTB 4DUZQ 3K0XA 3CMET 3KYHC 3S1NH 4LF8L 2VZAA 1TXYA 4L5QA 2KDSA 4ZN3A 2DGYA 2VW9A 5LMUL 4KHPL 4LFBQ 3JC66 4K0KL 3FP9A 4YWMA 3CF5A 1R9TH 1SROA 4A3JG 4A3FG 2BH2A 5M3MH 2D62A 1PH4A 1RL2A 1CSPA 1HJPA 3I2ZA 2R92G 3HOWG 4IFDI 2YU9H 3G4ST 1VQOA 1K8AU 1CKNB 1QUQB 2GVBA 3TREA 1N8RC 4LF4Q 3B6YA 4LF7L 1VQLA 4MZ9A 3ULJA 4APVA 5IYBH 3M4QA 1NMFA 1HNZL 2C35B 2OWOA 3S16H 4QQBX 5IY0A 2VUMG 3I4NG 4DV5L 4B3MQ 4A75A 1QZHA 1V9PA 1CKMA 2AWOA 2N49A 2VL6A 3HKZE 4IJHA 1YITT 4TQUS 3HOYG 3GTGH 3KFUA 2QGQA 3KF8B 4DR6L 3CC7A 4GLAC 3KBGA 3KOJA 1VQ7T 1NMGA 4BY7H 3UE1A 4YCUA 3CCMA 2IHEA 1VQCA 2JJQA 1OXSC 5H1SE 4QQDA 1P8LA 4FDBA 1PH3A 2NZHA 1A62A 1Q7YU 3IRBA 4NXNL 3PIPA 1C9OA 4JI8L 4JI6L 5IWAL 3I55T 5J26A 1VQIA 1VQJA 5C4XG 1XMQQ 4JBWA 1GD7A 3DB4A 5M5XH 3E9HA 3J81i 4GKKL 2PI2A 3ZJYC 3CPFA 5ELNA 2E2IH 1S72A 3T1HQ 1JJCB 2F52A 2ZTDA 4JI0L 1Y1VH 3TS2A 3VDYA 1QVGA 2I5LX 1AH9A 2BH8A 2JNGA 1NZ9A 4NXMQ 4RG1A 1KRTA 3F8TA 3CCMT 5C4JH 1TWGH 1Y14B 2XGTA 4DAMA 4R4CA 3PO2G 4AQYQ 1C0AA 4DV6Q 1PYBA 5IP9H 3MEFA 2RF4A 3K81C 4LW1A 3RZDH 1VQ4T 1YJ9A 4NXML 4O0AA 2K5NA 4BY1H 4GKJL 5JJIA 1IYJB 2V1CC 1S3OA 5ELOA 2N78A 3NENA 1PFSA 2I5MX 5J3BA 2QA4T 3T1YQ 1HZCA 3S15H 3K80C 2PQAB 5IYCG 3KF6B 1VQ6T 3CD6T 2CCZA 1QVGS 1VQKA 1GO3E 1U0LA 4LNQA 2R7DA 3J7ZC 4GN4B 3PGZA 3LGJA 3E0EA 1Y1WH 3TQYA 4A3LH 3CCRA 1AE2A 4OONA 4DR1L 2KBNA 4POGA 1FJGQ 1L1OB 2XTIA 1XNQQ 2B3GA 2JA5H 1HZBA 1MJEA 4JBJA 2ES2A 4JI5Q 4LUZA 1EUJA 4H02A 5M3FH 1JMCA 5K36G 1CSQA 1E7ZA 3HOUH 3CCJA 4QGUA 1OXTA 4DV4L 4Y7NH 4L5TA 3S2DH 1KL9A 3H0GH 4HJ9A 4X62Q 5C44G 1YNXA 2FXQA 1PV4A 1GM5A 1KC8C 1XJVA 3TRZA 4LF5Q 5M5YH 2B29A 1NE3A 2NN6G 2RHQB 2YTYA 2PNHA 4PZ6A 4GNXA 2NVTH 1Q46A 1YHBA 4DR3L 1VQHA 1PHJA 1I5FA 4A3BH 1I94Q 4OO1G 1YHQA 2MNAA 4KI0A 1IXRA 1SLJA 3M85A 1NPPA 1SR3A 4B3TQ 1XPUA 2UXBL 1D8LA 2F3IA 2YTVA 1PH6A 1V1QA 4HIKA 3FKIH 4EX5A 3RLOA 2R7ZH 2IG0A 2EIFA 3D31A 1MKHA 1DGSA 4XIGS 3JAMc 2UU9Q 2UXCL 1B8AA 4L5RC 4L5SA 1UE5A 1M1GA 1CKOA 2UU9L 2B63H 1JT8A 2BA0A 2JUFA 2KENA 1IBLL 1VQGA 3CMEA 4B3RL 1Q8KA 1JB7A 2KHJA 4IPHA 4QIWE 1WCMH 3DLLA 1MJCA 1VQMT 4YCVA 3K7UC 3HOVG 1X55A 5BR8Q 4A93G 1QZGA 3ICEA 1SN8A 1WI5A 4PG3A 4DV3L 2NZOA 1E1TA 4YHHQ 4EQ5A 2KCTA 3I7FA 2LXKA 4DUYQ 2HHHL 2Q2UA 1K73U 2Z6KC 1IBML 1BBUA 1NPRA 4UP8A 1Q1EA 2VQEQ 4A3CH 1WOCA 3GTJH 3CP0A 4YHHL 1PH7A 4HJAA 1NJIU 1FVIA 1PH2A 5GROA 4C3HH 5LMUQ 1ASYA 3I4MG 4KHPQ 1X3GA 4C3IH 1XMOL 4K0KQ 2E2JH 4X66L 3G71T 2LXJA 4IO9A 1N9WA 4GN5A 2E8GA 5LMNL 1XPRA 1N34Q 4YTLA 4DV1L 5C3EH 2HIXA 4GLXA 3J81E 1UE1A 1YITA 1NY4A 1JJGA 3LH0A 1KD1C 2F4VL 4A3EG 1P16A 2VQFL 2R6GA 3S1QH 1VQ7A 4A3DH 5IAYA 4A3IH 3M7NA 1N34L 3GTOH 4BA2I 1TWHH 5GAGC 3ERSX 3ER0A 4LF7Q 1HR0L 4LFAQ 1J6QA 1Q81U 1HNZQ 2AWNA 1W2BA 1X56A 2IX0A 4DV5Q 1Q86C 1VCIA 1SRUA 2WP8J 4DV0L 3BJUA 4YY3L 1HNWL 3I55A 4X64L 4R1JA 4LFAL 1O7IA 3RN2A 1YVCA 5IT9E 1GVPA 2BA1A 2YV5A 1X9NA 3CCLA 3H3VH 4R4IA 1YBYA 4DR6Q 3GDEA 1CKNA 1EQQA 1QUQA 1Y1VG 3WWVA 4HIOA 4A3GH 4GS3A 3F1ZA 2JA6H 3CW2C 3KDFA 4DK6C 4JI3L 2OQ0A 4IFDJ 2AKWB 3L7ZC 3NELA 3J7AF 3K8AA 5IP7H 4BBSH 4P72A 1MIUA 1E24A 4JI8Q 4NXNQ 2ZTCA 1W2BS 1Q12A 3PV0A 4YWLA 2UUBL 5IWAQ 2NN6I 3CCEA 5JEAJ 4A3MH 1B7YB 3UDIA 2JOYA 5DM7R 3M9BA 4BY1G 3RLFA 3RLNA 4BBRH 2XHCA 4GOPA 1VQ4A 2KCMA 4UP9A 1M90U 1VQEA 4DV2L 1N36L 2JA7H 3CC2A 4BXXH 3A74A 4TVAB 4ZN1A 3UDGA 1VQFA 1HNXL 4JI0Q 2QA4A 3CAMA 3TEHB 4LF9Q 3AEVA 4OO1I 4AYBG 1EYGA 1ASZA 1HZ9A 2K75A 3CQZH 3CCLT 3BU2A 5IYDG 1VQ6A 3CD6A 4JI7L 1X6OA 2Q2HA 3JAMi 2JVVA 2Y0SG 3U4ZA 2PI2E 4JV5L 4JOIA 3U4VA 4LF9L 3PF5A 1Q1BA 1K9MU 4DR7L 2CFMA 1OXUA 3HOXG 1N33L 1YI2T 1WYDA 4GKJQ 5M3FG 4HIDA 4A3JH 3STBC 3CCET 4POFA 4A3FH 2LSSA 2DO3A 3HOWH 2R92H 1X3EA 1XTDA 2WB1G 2OTLT 3L0OA 3CCQT 3UDXA 4X65L 3CC2T 2L3RA 5AJ3L 1KAWA 4HJ7A 2R93G 3KJOA 3OYYA 4DR1Q 2JEBI 4P71A 2VUMH 3I4NH 2I5HA 3PCOB 1GKHA 4P73A 1EWIA 5FJ8G 2AHOB 4LF6L 2HQLA 4YCWA 1K8AC 2UUCL 3LGFA 1K0RA 1FGUA 2UXDL 4UPAA 4Y52H 3KF6A 1H95A 1YHAA 3PO3G 1A8VA 1FL0A 4DV4Q 3Q8DA 1TWAH 2E2HH 1SFOH 1Q82U 2R7FA 2JEAI 4DKAC 3CC4T 1PYSB 2VY3A 4KHZA 3J80c 1VQNA 1KQSA 4DPGA 1L1OA 3E9IA 4JYAL 4DR5L 1X54A 3OW2A 2LCLA 2B63G 1K8GA 5FLMG 4DR3Q 2UUAL 1XPOA 2DUDA 1WCMG 4OWXB 2UXBQ 3ULPA 1M1KU 1X65A 1VQMA 2E70A 2NVYH 1VQ9A 4P75A 4HIMA 1NTGA 3J7A5 1EIYB 4JI2Q 4MTNA 1PH1A 4UY8C 2CWPA 2JK8A 2MI6A 2UXCQ 1EIFA 1KQSS 3HKSA 2OCEA 4GN3B 4ME3A 4AIMA 1XNRL 3PO2H 1VS0A 2JE6I 3EBEA 2E5LL 1S40A 1VQNT 4JI2L 3OW2S 1IBLQ 4B3RQ 2LVMA 3S17H 3GTQH 4DR4L 2A1AA 1YEZA 4CRIA 1L2FA 2MWOA 3G71A 2OQKA 4KLKA 4DV3Q 3F2DA 1PH8A 3CCSA 1N8RU 2JA8H 3GO5A 3G48A 1VQ8T 2HHHQ 1CUKA 2A19A 3CCUT 1PH9A 4A3IG 1VQ9T 3W1BA 3AYHB 1IBMQ 3NEMA 1KRSA 4DAYB 2CWAA 5M3MG 2MWPA 1G6PA 1OXVA 4AYBE 4GNXC 5LL6S 2LQ8A 3CMAT 2YTXA 1XNIA 4XTCS 5C0XG 1D7QA 3GTMH 3G6ET 1XMOQ 4WJ3M 4JCVE 2Y0SE 2YYZA 4NB3A 4YWKA 4X66Q 5LMNQ 3H15A 3S24A 4DV1Q 5EAYA 5IYBG 4IPCA 1YIJT 4P74A 3OTOL 2F4VQ 2VQFQ 1N32L 2JA6G 3CXCA 4DK3C 3SGIA 1SMXA 1JJ2A 3S1RH 3CCST 3DM3A 1E22A 1HR0Q 4BY7G 3JAME 2WB1E 2A8VA 2GN5A 1G291 1J5EL 2QEXT 3HOZH 4DV7L 3W1GA 2CKZB 4DV0Q 4JI1L 2CQOA 4YY3Q 2JQOA 3J81j 4X64Q 1HNWQ 2RHSB 1JE5A 2VS1A 1SE8A
chains in the Genus database with same CATH superfamily
1BCOA 4K5WA 2B8AA 1NNXA 2WB1B 3IL8A 3F2BA 4E7IA 3D8GA 4XT3B 3V8LA 1Y07A 3CXCS 2LFNA 1JJ2S 2E6ZA 5DLQE 5GMKi 4LFCL 1TU0B 2DEQA 3K7AB 3L2PA 3U58A 4JBMA 4UP7A 2CUBA 2K5HA 2FYKA 4R9WA 1WGSA 4Q5VA 2RPNA 2EQKA 2DX1A 1V8QA 1BI3A 1Q81R 3EGXA 2AK5A 3LGLA 1E3PA 1T5XD 4ZCKA 2E3IA 4GKKQ 1I6HH 1HNXQ 3JB9F 4LDVA 2K52A 2RQRA 1TS5A 2TSSA 3KF8A 1Z47A 2ZT9C 1IW7D 4HSVA 4A4IA 2PYKA 1V1OA 3GD7A 5FO9B 2KBTA 3CCQA 1TIID 1TQOA 3NBHB 4KKSA 4EIKA 2YT6A 3ME9A 3Q0AA 1ZSZB 1VA7A 1HSQA 5C44B 1Y7XA 4HCCA 3IKJA 3CCVQ 2DEUA 1I50H 4TSSA 5EJWA 3VR4A 2E6NA 3WOFA 4EQOA 4A3LG 4JJCA 1K73C 2IPKD 1OO9B 1L0WA 4GLVB 2IX1A 5CAIA 2EYPA 4ANJA 3EN2A 3AFPA 1WPYA 2DAQA 4FO2A 1PRTB 1KJWA 4DEXA 1A63A 2K6AA 2FZKB 4M7AD 3BZKA 3CC4A 4R8IA 3HOUG 4JRKA 1VQOT 2KEAA 1EU4A 4C2MH 2K4KA 3R2IA 1CTMA 1EY5A 4RAUC 4GOPC 4EDUA 1STHA 3M59A 1H9RA 2L0AA 1LYLA 2L3PA 1KABA 1CA6A 3GTLH 2RD1A 2KJXA 2UXDQ 2WAQG 1K9MR 4WJ4A 3BVGA 2KVQG 2JA9A 1JWUD 1R4PB 2BE5D 2Z6BA 2H3JA 1Q81C 1SJED 1WXTA 3CC7T 4PJOE 2HDMA 3VYGA 4WCIA 2D9UA 3U50C 2PQAA 1PA6A 3SHLA 3OIPA 4JOIC 3M3YH 2ENMA 3EIVA 1SHFA 4IUPA 1EFID 3W2DA 1I6HB 4RHSA 2IVWA 5C0XJ 2L8DA 4O2DA 4XQ3A 2QQSA 2UUAQ 5LJ5e 2ATWA 3D7SB 3RKXA 1M9SA 2EBPA 3JCMd 1BDOA 2LC4A 1GHKA 5GAOq 5BN3A 2VKNA 3QB3A 3MEVA 1I8FA 2CZ1B 5HY6A 1I50B 2N8NA 5C4XH 1VQ5T 5DAUA 5IYDH 1HRJA 4HJ8A 2E76C 2MQHA 3M0TA 1PRTF 3C1FA 3NTIA 3FVQA 5D65A 2CP0A 1XNRQ 3CCUA 4IN3A 4JC0A 1C7YA 4IFDG 3TZDA 1G51A 3IFDA 1D6EC 2YLCA 2CYZB 5KYIA 3HOXH 3IAYA 1M3AA 2F03A 1LTLA 4WJWA 1UDLA 3RD4A 1ARKA 4QY7A 4RGNA 3S14H 1FJGL 2N3SA 1PRLC 4C3HG 1XNQL 2KT8A 1YZ6A 1KLGD 2D0OA 1BOSA 1RHPA 2DRKA 1K9MC 1QVFS 5HGQA 3PIOA 4DA2A 2KR3A 2HKQB 2W10A 3EH2A 5EKIA 3D0FA 1DJRD 4HCSA 5FJ8H 1FMVA 1GCQA 4A4HA 1I94L 1SXTA 2QEXA 4M78G 5C4JB 2HAXA 3VR3A 3A1PA 4LF5L 2VB6A 3PO3H 4HKEA 1NYFA 2BDNA 3RN2A 4OMQA 3J81c 4BY1B 4FW1A 2KGTA 3VR5A 3D4DA 1Q8IA 1S4ZA 1ZBXA 5G3LF 3M0PA 4X9CA 4DNRB 4A3GG 2EJFA 1BCMA 2XI9A 1LTTD 3T4AC 1V1PB 2Y0SB 1JQYD 3RERA 2QXFA 4FT2A 1NEBA 2Q2IA 2ZPIB 1VQLQ 1B70B 2YWWA 1JWMD 5M5WH 1G3SA 1K9AA 1I4RA 1X32A 1RI9A 3R3OA 5IT9c 4C92G 1NLOC 3HOXB 1H95A 2MCNA 2DIGA 1D5ZC 2B2YA 1BIBA 5TSSA 4BBRG 4ALPA 2DY8A 1YJWT 2MO0A 4L8JA 4NP5A 4QVZA 3W5OA 5BR8L 5CKBA 1AWOA 2GTOA 3S14B 4XTUA 4OX9Q 2RO0A 2VNUD 4Y7NB 1H92A 5A0GA 3M4OH 2G6FX 1WTHA 5JJKA 2CSIA 2AMCB 2K9GA 2QTXA 1E1OA 2VQEL 3JCMX 3HSBA 1M8AA 2JMAA 2F0FA 3P20A 4PQXA 4ESRA 5CV8A 1TTHB 2PUOB 2KDSA 1TXYA 2CZ7B 2J05A 3BVZA 4LFBQ 1F9SA 3R6OA 1Y69U 2FMCA 3FP9A 4YWMA 3CXCP 3PO3B 2D62A 4J1MA 1QP2A 2LNHB 1RL2A 3I91A 1VMCA 3HOWG 2L89A 3NFCA 2R92G 3SXHA 4HVUA 2YU9H 2R7ZB 3EG9B 1VQOA 1K8AU 5C0XH 2EPBA 4ZYSA 1QLYA 1BI0A 1D3BA 3B6YA 3GV3A 2HD0A 2VQFL 2GBQA 3ULJA 3PIP3 5IYBH 4VUBA 2OWOA 3S16H 5IY0A 4D8DA 4B3MQ 2EXZA 4A75A 1YJ9Q 5CV4A 3HTRA 4IJHA 4CKCA 3KFUA 4FYDA 3CC7A 5F2DA 1HTLD 1HPCA 3SFMA 5GAN6 5GAN5 4RFBA 1QP3A 2X51A 1SE4A 2CT3A 1OXSC 3TSZA 4FDBA 1PH3A 4B08A 3JCMP 2NZHA 4ULLA 3H09A 1A62A 4IZ8A 3C46A 1U5SA 1LV9A 2E5KA 1WNLA 2L12A 2HCKA 1VQJA 1VQIA 5IWAL 1YNNC 5C4XG 1XMQQ 1GD7A 5M5XH 2RDGA 2Y4XA 2W0ZA 3ZJYC 5EC7A 1ZYRD 3K5NA 3T1HQ 3CCJQ 1KC8R 1Y1VH 3T51B 4DGZA 2QCPX 2I5LX 4CDDC 2BH8A 1M3CA 1BIAA 1K28A 1B3QA 3OPOA 3H0FA 1TWGH 1GJXA 4AQYQ 2L4NA 1NYGA 3VUZA 3EG2A 3MEFA 2RF4A 1W4SA 3SEBA 5IGEA 3RZDH 4AG2C 1VQ4T 4HEDA 3QYHB 4PL6A 5KYXB 5JJIA 3J7AV 2L2PA 4OB2B 5D6XA 1IYJB 4GKJL 1BI1A 2V26A 5GAMe 3NENA 4C1NK 5FOBB 1UJ0A 5LJ5d 3TZUA 3T1YQ 1A6XA 3S15H 1UGSB 2GNCA 4M78C 4KH0B 3MXGA 4JRIA 4G7ZC 1QVGS 1SEBD 2C06A 2CCZA 2CP5A 3HHTB 1U4RA 3HRTA 1TUGB 1EYAA 4DR1L 2PVGB 2KBNA 4POGA 4UC4A 2JA5H 4BI4A 3X26B 4H02A 3MWYW 4BBRH 1SYCA 1X01A 1RTNA 2I2LA 5GJWB 3VS6A 1F2YA 1M3BA 2SOBA 4DV4L 3T9NA 3I3CA 3I73A 3S2DH 2SEMA 4BS9A 1G2BA 2SNSA 4M77G 1XJWB 1GUWA 1YNXA 1GM5A 4C92C 3MP1A 1KC8C 1WX6A 2AQ2B 3C94A 1A2UA 1MGSA 5IIFA 3VS7A 3P75A 4E6IA 4GNXA 2NVTH 1H9SA 1KD1R 1Q46A 4C1NI 2OEOA 4C5HA 1E7OA 1CQVA 3BVMA 1JXMA 2GFUA 1TWGB 2C9OA 2HNIA 4A3FB 1SLJA 2CUDA 3EA6A 2I07B 2XRQD 3NTHA 1EY4A 1GUSA 3RZDB 2CW0D 1PH6A 2EYMA 3FKIH 4EGVA 1GOZA 2IG0A 4FP5D 2J7IA 4XAXB 1DGSA 3A54A 1VQ7Q 1I6VC 3RUZA 2GTJA 1KAAA 4DAYA 1B8AA 4FF2A 4IURA 4BE2A 4L5RC 3VU3C 2DIQA 1WHMA 3S15B 1AN8A 1UE5A 2BZ8A 1IHWA 2MJ8A 1JT8A 3S3NA 3I4NB 2BA0A 2JUFA 1NE8A 2XSCA 1Q8KA 4QIWE 1HFNA 1VQMT 2EY5A 3HOVG 1X55A 4F7UG 1QZGA 1WI5A 4JVZA 4N8X1 2K7AA 2PUKB 4CKEA 2JA5B 5CKHA 2NZOA 2EY2A 2RHYA 4EQ5A 2KCTA 4DUYQ 4MMKA 5KYWA 4A4EA 2JTMA 2RSOA 5LJ5f 1STAA 1BBUA 2E4HA 1IREB 4UP8A 4A3CH 1LCKA 2FZGB 1PH7A 2K6DA 1NJIU 4F14A 1GHJA 1K4US 5GROA 2RBMA 4MTKA 4KHPQ 1KSWA 3OYNA 4C3IH 1XMOL 1XPRA 3K5OA 4GN5A 1O78A 1BUVT 2KSSA 4DV1L 4XT1B 3J81E 1KDBA 1WXBA 2K3YA 1KD1C 1EY0A 1D0ZA 1QOHA 3BFMA 4A3EG 2RI3A 1BNZA 3M7NA 4A3IH 3JCMb 4F16A 2BZXA 1VQ6Q 4R8NA 2P4TA 4UAIA 5GAGC 3GTOH 2FMMA 1HR0L 2FPEA 2QTVA 1HNZQ 1W2BA 2JT4A 2IX0A 3TP6A 1OPKA 3VYUA 2K03A 4HN7A 4X64L 4R1JA 3HRUA 4LUDA 1YFNA 5IHKA 5IT9E 1O7IA 1N27A 1TWBA 4PFPA 3CCLA 3SDZA 1U4LA 3EGXB 3P1HA 3H3VH 1Y1VG 1WHHA 3WWVA 1ABOA 4GS3A 3I5SA 1KNAA 1OX8A 4JI3L 4K6LA 2KYMA 3L9AX 3UI2A 3M5AA 3L7ZC 1CFMA 3NELA 4M1UB 3K8AA 3TN2A 3QWXX 1FXXA 4G4KA 2DL8A 2LNVA 2UUBL 4JI6Q 4B9XA 5JEAJ 3FC3A 4J9IA 5DM7R 1SNPA 3M9BA 2CZ0B 5LJ3j 2BOSA 3UPUA 1F2ZA 1VQ4A 5D14A 1MMNA 1N36L 1PSFA 3FJ5A 3UDCA 1TU2B 4ZN1A 3META 2QK0A 5CQXA 4TVAB 4JI0Q 3C2PA 2L3QA 3AEVA 1EYGA 2K75A 2Q2HA 4DK1A 5IOCA 3A8MB 1UE9A 3U4ZA 5GAN4 2EQUA 4N4HA 3OYJA 4JUVA 3HOZB 3M53A 4DR7L 1OXUA 4FXKC 3I9QA 2FZCB 3OBYA 4M77C 1EIHA 2P84A 2NVXB 3RIRA 1XTDA 2V1QA 1P92A 2J6KA 4XU2A 2K28A 2HQXA 4X3KA 5ELCA 3K57A 2L3RA 3Q24A 2RJCA 3EHRA 1I4GA 4C3JB 4A3KB 1ILQA 4HJ7A 2YLBA 2Q8TA 2ZPEB 5GAMd 2V4DA 3SR1A 3E6ZX 3ZEHA 2RQUA 1JR0D 4ZK9B 4WF2A 1GRIA 2I5HA 1GKHA 1K0XA 3N6RA 3PCOB 4P73A 4EMGA 2PNIA 4B9WA 3LGFA 1G6ZA 1FGUA 2VGNA 4A93B 3KF6A 1YHAA 1EYDA 4CC3A 1K3BC 1SNDA 3VYRA 2YUNA 4OB1B 2E2HH 4N0AC 1PYSB 4M75G 2ZPFB 3L2ZA 1MHNA 2K33A 1RAFB 4DXFA 4HXJA 3L42A 3E9IA 3C0CA 1NR4A 5J39A 3CKIB 2SDFA 4QVCA 2LCLA 4RTYA 3S3MA 1K8GA 1E2VA 4KMUC 4WTOB 3QJ6A 3C95A 2LJ1A 2YXYA 1YCYA 4ABNA 1VQMA 4P75A 3NGPA 1VQ9A 5I2YA 1NTGA 1QCBD 1M8VA 1PH1A 3C12A 2CWPA 4CGYB 2EZVA 2E75C 2UXCQ 4RWSC 3PO2H 4AIMA 2LZ6B 5CV7A 4HA8A 5LJ3h 3K5LA 3VA5A 1VQNT 1YNJC 1DZ1A 2NYSA 1KLUD 2LVMA 4IQZA 4B3RQ 2BE5C 4C3IG 1TKWB 2AUJD 3GTQH 4DR4L 1YEZA 2VGMA 2DRMA 4C0DB 1I81A 1L2FA 2OQKA 4KLKA 4J5YA 4DV3Q 2HCIA 1N8RU 2ZGWA 5I11A 5C5MA 3GO5A 3OYDA 2HHHQ 2JA8H 3C1EA 4A3IG 1IBMQ 3W1BA 3AYHB 1TY2A 2KXCA 4I65A 1RD9D 3J7YW 4ZGJB 2EJ9A 1OXVA 5NUCA 2E2HB 5LL6S 1RI0A 2LQ8A 2KRMA 2XWJB 4XTCS 5CGKA 2FPDA 1D7QA 2NZ1D 5JEAH 3JCMQ 1DCZA 5HK3A 2YYZA 4YWKA 3JB9J 3BDOA 5GAMf 3EQLC 3BY7A 3H15A 3S24A 1UGQB 1K1ZA 1CKBA 5KYLA 1Y8NB 5CO7A 5I4DA 3OTOL 1D0XA 4C0ZA 1ZEQX 2NTSA 4NDXA 2O5IC 2A5HA 4DK3C 1FNVA 1SMXA 5K36G 2OTLQ 3DM3A 1HA6A 1WJRA 4ORZA 1E22A 1YNND 2WB1E 3NXWA 4UDUC 4OGEA 4RGOS 1UEAB 1DOLA 3W1GA 2GCXA 2CQOA 1TG0A 2JQOA 3PO2B 1MV3A 4CC2A 1AZQA 5A2QE 3PF4A 2EAYA 1B07A 3OW7A 2XDDA 3SWNA 1PKSA 1JOOA 4BDZA 2Z0WA 2A8VA 1DJ7B 2R93B 2RK1A 1BBWA 2DMOA 4QVDA 8AT1B 2CKKA 3VRZA 5JOBA 2PMZB 1HK9A 4B3SQ 1HH2P 4JJNK 1SYGA 3RZOB 3INZA 4M78D 4JI4Q 3HL8A 1D3BB 2DF6A 5IHNA 2X9HA 1JB3A 1QNKA 4XQQA 1LOJA 3CBMA 3V7RA 4B3SL 4FL6A 2EPDA 1VOMA 1EOVA 1FD7D 4QUFA 3S1MH 1SYFA 3CPWA 4XU3A 1ZSGA 3KDFB 1QWEA 2RSNA 4NKLA 5I2XA 4EMKA 2EY1A 4JV5Q 2COZA 4KN4C 5CR3A 5GQOA 2NVQH 1Y8OB 3I4MH 1W6XA 2EJGC 3K0YA 2L15A 3TP5A 2ZXPA 1EFNA 5AFWA 1Y1WG 2KK4A 5ISRA 4X3UA 1STEA 1J8IA 1PTOB 4MHEA 4M75C 4HCKA 3H6MA 4GOPB 3M0SA 3MP6A 5AYFA 3O5ZA 4C5EA 4BUGA 3E9FA 4C92D 1Q7YR 4OMOA 5FLXE 5EPKA 3R8BA 4X65Q 1AHJB 3GTKH 3A5UA 3NWTA 2RH2A 2DXUA 4BY6B 4QQGA 2IT1A 1PDQA 1VQ8Q 4OXPA 4QL5A 2AZVA 2D0NA 1VQ9Q 3BZCA 1O9SA 4CDCC 2ATCB 4GLMA 1T5EA 1IBKQ 2B2TA 3M58A 5IXBA 2MO1A 4LF6Q 1VQLT 2EYQA 2KHSA 3CMAQ 3ND9A 1SPKA 2WSEE 2F0MA 3G6EQ 3QZ9B 3M0RA 4IPGA 5LMNW 1IBKL 2VYTA 1MUZA 4PFOA 3EFSA 3MEUA 1TS4A 1R0BG 3E1SA 1JC7A 2KQWA 1PFBA 1R9TB 3HOYH 4QCLA 1LUZA 1YWPA 1SYBA 1OQKA 5CKFA 3PMFA 1WFQA 3QIAA 4JYAQ 5GADC 4Z02A 4PMWA 5DM63 4DR5Q 4R0KA 3GNFB 4E7SA 1PVOA 2VB3X 1RIPA 1T3LA 3RKWA 3CCVA 3JCMe 2IY5B 3X28B 1HCZA 2Z0SA 3PUXA 4PNYA 1LM0A 3JB9H 1RAIB 3PMTA 2NVQB 1MMGA 4M7AA 1A15A 1PTOF 1S5DD 2JA8G 3OB9A 3LWEA 4QJFA 4XTVA 3KLRA 3RR5A 2RHIA 5LHY1 3S2HH 1YJNQ 3T53B 1BBZA 1Q7YC 1M90C 3GTKB 2DK3A 1JO8A 5KEEA 4PZ8A 1RADB 2F0IA 3H3VC 3MTSA 1I3QH 5JEAG 1AT1B 1ZQ1A 5KNCA 3HKZG 5ELEA 3K59A 1BU1A 4J7FA 2DFUA 3VYTA 3VRYA 2OTJQ 1YJ9T 2DN8A 1JOQA 3HFZB 2O5JC 4XTWA 2ZJRA 4E47A 1NBWA 2J0TD 4GNXB 2QI2A 5A0LA 1H9SB 2BKDN 1L1OC 1G3WA 2PU9B 3TCJA 3I56Q 5C3EG 2A7YA 1UUEA 3G4SQ 5I21A 1H3ZA 2ZTEA 3A8JE 3K7AH 1Q86U 2ZPGB 1EQRA 3UDFA 5KRUA 4EPCA 1K3RA 1OXXK 4A3DG 2F0QA 2PZWA 4LUVA 2ESWA 2D0QB 4JLIA 4X62L 2K01A 2KROA 2YSQA 3PFSA 3NP8A 1AE3A 2XU8A 1OZ3A 2LS01 2JW4A 3ERQA 2HSEB 3GQBA 4ZAIA 1X43A 1NUCA 2F2WA 4KJNA 1BO0A 2QAZA 3CCJT 1IXDA 1S5FD 2K32A 2M00A 4WRDA 5I2SA 4B3TL 3JAML 3M4PA 1Q3LA 2E12A 3V8JA 2LCCA 1HTPA 5C44H 2JP1A 3PGGA 3WVEB 5E7NA 5KYWB 5CIUA 4R4OA 2KHIA 3MEWA 4XQNA 5IP7G 3OYCA 4BBSG 5IGBA 1NR2A 4NPSA 3CBPA 1UE7A 3H8ZA 1I3QB 5GANe 3U9SA 5M3FB 4Z9CB 3L2RA 4MZMA 2BE7D 3I4LA 2ZJQA 2JA7G 3GP7A 4LFCQ 3SHWA 2VB2X 4BXXG 1SYEA 3PUWA 1QWYA 3EHQA 3NHHA 3H6ZA 1M2VB 3PVQA 4EVOA 4JDSA 1M1KC 2EYYA 3CCMQ 3J80i 4M77D 3ITPA 3PUVA 4GZYC 3OSVA 4M7DG 1D5MC 1EQVA 2WAQB 3H0HA 3K0XA 3HFOA 3RMHA 5KNBA 1ET6A 1N6AA 2CW0C 3JC66 1PXUA 4K0KL 1T0JA 2JMCA 2L11A 3CF5A 1SROA 4MN3A 4A3JG 2HQEA 5M3MH 5CV9A 4PLLA 3I2ZA 1K0SA 1JBMA 1AEYA 1AZPA 4LDXA 1LT3D 5C6AA 5FO7B 4IFDI 3Q22A 2EYWA 3WDNA 3GV6A 4RKLA 1C4QA 2EYZA 1VQLA 2G9DA 4OGQC 2KVMA 1PKTA 4QQBX 4CJ0B 1MSHA 2F0LA 3TBIB 2VUMG 2K4YA 2DNUA 2KOLA 2VL6A 1CKMA 1WCMB 2AWOA 3O13A 5FU7C 3HOYG 1BR9A 3OYIA 1STGA 3KBGA 1VQ7T 3MHXA 1NMGA 4BY7H 4KD4A 3H41A 3OWFA 5DM73 2BZYA 1VQCA 2IHEA 3WXMB 1CK1A 1P8LA 5H1SE 2D2CC 5KIXA 2PVOB 2B2VC 2L1BA 3GTJB 1B44D 1Q7YU 3IRBA 5LJ3g 2B86A 3PIPA 1C9OA 4NXNL 4PKCC 3H91A 4C3HB 2MP1A 3FEWX 4IIOA 5JAVA 3LYIA 3DB4A 3E9HA 4BE1A 2D8JA 1LTGD 1O80A 1YNJD 4FVMA 2E2IH 4RKBA 4HT8A 2ZTDA 2XICA 4PLIA 3MO8A 2HL5C 1AH9A 4C8QG 2DBMA 1F9PA 4NXMQ 5M3MB 1TH7A 5C4JH 3SE0A 1WD1A 2QGGA 2XGTA 4AFUC 4R4CA 4DAMA 1A0NB 1C0AA 1PYBA 5IP9H 1IKLA 4FYXB 2IIMA 3HRSA 1YJ9A 4K8IA 2DYBA 4NXML 4BY1H 1RABB 1PFSA 4C5IA 2DJZA 2XD0A 4FF4A 2F0UA 2RDHA 2X4WA 3K80C 1Y96A 3Q1JA 4L6V5 4K11A 2LX9A 5DLOA 1AWJA 1QCOA 1VQ6T 1U0LA 3AHUA 1B9MA 2JA6B 3AMUA 4M7AE 4GN4B 3LGJA 1BQQT 4HT9A 3CRLC 4FW2A 4BY7B 2RM4A 5GAN2 4FSXA 3OYAA 5HK0A 3ND8A 1FJGQ 1SDFA 2XTIA 2YUPA 1YCSB 1XNQQ 2B3GA 2XK0A 4GLKA 1IHVA 3RLNA 4JBJA 3CMEQ 1MHWC 1F9RA 2NYZD 4LUZA 1JMCA 2XG8D 4RCOA 1W6JA 1G8XA 3CCJA 4QGUA 4QKUA 2B2WA 4Y7NH 2AKKA 4XTXA 3CQZB 4ZGDB 4L5TA 3H0GH 2KRNA 1NLPC 5C44G 3TQ7P 4QMGA 2E2IB 2FXQA 1GFDA 2O88A 1EWHA 3TRZA 4LF5Q 5M5YH 2NN6G 2B2UC 2YTYA 3EJIA 4PZ6A 1YHBA 4A3BH 1FMWA 3M4GA 1I5FA 1PHJA 2EYLA 4KGVB 1CQFA 4KI0A 2IL8A 4OHJA 5GMKj 2UXBL 5I22A 1JXOA 2VC8A 3HOWB 3UT1A 4M7DC 4HIKA 3RLOA 2R7ZH 2XDPA 2MGSA 2DETA 1EZZB 2K2VA 1X75C 1II3A 1R4QB 1M1GA 4EQNA 2HBPA 2KXDA 2KYBA 2AZSA 2WACA 3C4SA 4RTXA 1GUOA 2F2XA 4KGXB 4IPHA 4J9CA 3DLLA 4YCVA 3I55Q 5HKCA 3K7UC 5BR8Q 2B39A 2A08A 3ICEA 3CEYA 5FRNA 1TWAB 3VR6A 1RAHB 4M75D 3JCMf 1K73U 2Z6KC 1WTPA 4E2FB 5GANd 1U4PA 4FXDA 1TXQA 1NPRA 3BYYB 2VQEQ 1EX4A 2Z9HA 4IKFA 3R93A 2KI7A 5EKLA 3N5BB 1PH2A 3H0GB 3BZDB 4PFZA 2I0NA 1TR5A 1C8CA 3HRZC 2R57A 5M5YB 4N4GA 2A3LA 2EKHA 4CHTB 3CC2Q 1JJGA 2M2LA 2CVRA 4A3BB 2J4XA 3MFGA 2A0FB 3EFOA 4Z89A 3RESA 1B4OA 1VQ7A 1P16A 1RODA 5IAYA 2RK2A 2R6GA 3HPWA 3SWNB 3CD6Q 2C0TA 2GQIA 1Q81U 3SK5A 4FYVB 2YRCA 3ZBDA 2PZTA 4KJOA 2WP8J 2P0QA 4DV0L 3BJUA 1K76A 1PG5B 4C8QC 3K5MA 1SKUB 1A3TA 2DTHA 1CKNA 2A73B 2MHVA 1FGBD 1M4ZA 3KDFA 4DK6C 1NAPA 2F0NA 2PW5A 1AD5A 2AKWB 1UGRB 4BE0A 2IW3A 2ABLA 3SVMA 4P72A 2RB6A 5CCAA 5KE2A 4O6JA 1ONLA 4OELB 3OYBA 1IYUA 4EMKB 5GMKh 5IWAQ 4A3MH 3MPUB 2O9VA 3GTMB 2JOYA 3R2TA 4BY1G 4GOPA 2KCMA 2X4XA 2QDLA 4DV2L 1HQMC 1RJTA 4KTAA 3A74A 4WFN3 3UDGA 3X3NA 1V1CA 4P2CB 2V8JA 2EGEA 5GAN7 3CCLT 4KY6A 5IYDG 1W2BP 1VQ6A 1X3PA 3JAMi 4JI7L 4CI0C 4Y52H 2Y0SG 1Y8PB 1YVCA 4BI8B 1BCPC 4JOIA 3U4VA 3A8GB 1E0BA 1K9MU 5GANf 2FHTA 2CDTA 3MXUA 5C5LA 2P0KA 3HOXG 1N33L 1ZSZC 4GKJQ 4HIDA 2HDLA 3STBC 4LK1C 4POFA 4A3FH 4JW0A 4OMFB 2DO3A 4XTYA 2OTLT 2EYHA 1I4K1 1SBBB 5AJ3L 5KCOA 1KAWA 1PRTC 3QG1A 3DLMA 3OYYA 4DR1Q 3SK8A 5CV5A 1EIGA 3I4NH 5FJ8G 3ULRB 5D7UA 1OULA 1WZOA 4LAAA 2UUCL 2ENBA 2JM8A 2RQVA 3HP3A 3NSWA 2JJ9A 4F7UB 2CSQA 4UPAA 3M55A 4DBFA 1JEGA 2DD4A 1TUDA 3QYGB 3SEMA 3G71Q 1A8VA 1FL0A 2RCFA 4OEMB 2O01E 1RTOA 4DV4Q 1WHGA 4A3MB 3CCSQ 4M7AB 3J80c 3EROA 1KQSA 3NPPA 2DL4A 5L37A 4M77F 1BB9A 2L5QA 3G7ZA 4J6HA 2CQAA 3OW2A 1MGQA 2L5TA 4KUIA 2RHUA 2WSCE 3E19A 3X24B 2DUDA 1EY8A 1HJDA 2Z4IA 3T16A 1XPOA 4Y91A 2VASA 5DNFA 3SK4A 3KBXA 1ENFA 4RTUA 4A3EB 2E74C 1TS2A 4EQPA 2K57A 1TUCA 4AMCA 2PNRC 4ME3A 3A55A 2MIOA 1VS0A 2JE6I 2K04A 3EBEA 2E5LL 4CDEC 3EGDA 5LJ3d 3Q6SA 1SMYC 3OWEB 3PNWC 2DL7A 4LXCA 2KY9A 1HFGA 2MWOA 4RG8A 3VUBA 2ZPBB 4DQ2A 3FRPB 2AQ3B 1S5ED 4F7UF 2CP2A 2WINB 1U8RA 1VQ8T 1CUKA 1Z6HA 2A19A 5FWCA 1VQ9T 1E2ZA 3REAB 3NEMA 3FJPA 1LT4D 3E3XA 4J83A 1OU9A 2CWAA 4M7AF 4OB3B 4G7HC 5IH2A 1UGPB 4AYBE 4ILWA 3CMAT 1KHCA 2NWGA 2A74C 3NQTA 2J6FA 1EZ6A 5C0XG 3G6ET 2RF0A 1XMOQ 1WJQA 4LE9A 3FLGA 4A4GA 4PJOG 2XIWA 2GF7A 3J81L 2R3ZA 4ZKCB 4DV1Q 1DM0B 4QW2A 4FT4A 5IYBG 1WI7A 1YI2Q 2E41A 4IPCA 1AW7A 5ELBA 2H3EB 2K5QA 1N32L 2COYA 3MVVA 5I2MA 3CXCA 1QNUA 3SGIA 1JJ2A 1PLFA 1M2VA 2Y90A 1HR0Q 1QQJA 2E64A 1G291 4IALA 1D1IA 1J5EL 3HOZH 4DV7L 3BS1A 1BK2A 4JI1L 3CRKC 4CBVA 4J9HA 5IT9L 3QSUA 4X64Q 2RHSB 2JN0A 4K5VA 3NBIA 2E5QA 1WJJA 3TMEA 4MDXA 4A4FA 5JJZA 2H4OA 2B8FA 2NVXH 2PMZE 5LJ5j 4DR2L 3FPUB 1YJNT 1I5LA 2QG9B 2M02A 2QEJC 1BBXC 3BDCA 1EFWA 1JICA 4JI3Q 5FLXc 2H5XA 4C3JH 3NHNA 5ECAA 4A3KH 1XYIA 2PW7A 2HD3A 4Z8AA 2I0QA 2UUBQ 5FO8B 4PNOA 2OTJT 1KDAA 4HJ5A 2K50A 5C4ZA 2VV5A 2G3RA 4LJZC 4DUZL 1Z9FA 1N36Q 2EKOA 4Y92A 1KIXA 4J7IA 1W3SA 3KLWA 4A93H 4JZ4A 1VQ5Q 5FK9C 3EFXD 3LLRA 1MD2D 2ALYB 3I56T 2RQWA 2GVAA 3A8IE 1QWFA 1U06A 1B1ZA 1KXLA 4M75B 1TOVA 2OTLA 1G8ZD 1K83H 3AT1B 2LCSA 1N9SA 5GJVB 3EH1A 4OMLA 1GFCA 1G5VA 1WTRA 4DR7Q 2XVSA 2DY7A 4LF4L 3OY9A 2IHFA 2RCNA 5IGCA 1PMRA 3QOJA 4C5GA 2Q2TA 4IOCA 3MXNB 3NK9A 1UHFA 2CZ6B 1IKMA 3QXEB 2JA5G 1VQAA 1YWOA 1B53A 2X6GA 2JXBA 3A5ZB 3OYGA 2LT4A 1KC8U 2Q8IB 2DLPA 5JJLA 3PUZA 4A63B 4ELZC 4HVWA 1AZEA 1BVSA 2ID0A 4HVVA 2QW7A 5C4HA 1V29B 4M78A 2JN4A 4LDWA 5GAOn 1A3UA 3REBB 1QVCA 5EBCA 4M7DD 3JCMW 2G9HD 1UEBA 3E5SA 1SEMA 2RJFA 1PCXA 2LP5A 5CBAE 3H3VI 3MEAA 2M0YA 3QPHA 2CGHA 1DONA 1YIJQ 4LD9K 1C48A 4M75F 3OYEA 2AUKA 4HR7B 3M7GA 1I0CA 3FPPA 3FKIG 4JRPA 4KK7A 2ASBA 1Y96B 4TVRA 3PVLA 3L2WA 1GBQA 1K83B 3A7LA 2F69A 3D6WA 3GTPH 3A56A 4C92A 5CYUA 4DV6L 1TSFA 1YJWQ 3KJPA 2M16A 3DMUA 1KHIA 1PRMC 2WFWA 1O7ZA 3G7LA 2EWNA 2X35A 3CQTA 4I7AA 2IX3A 2CP6A 2FRYA 1QVFA 1B2TA 1VQ8A 2ROTA 1Q82R 4F17A 3BDUA 1PH5A 4PJOC 2WV6D 3PSIA 4V190 1WLPB 3TSSA 3F70A 3CMAA 5EG2A 2K5DA 4DR4Q 4QUCA 3G1JA 4K2LA 4A3CG 2QQ9A 1RLPC 3G6EA 3CCVT 1KD1U 3CHBD 3PO3G 4H0LC 4MNOA 1RACB 5E3FA 2J06A 3EG1A 2EQSA 2F5KA 3E2UA 3I5RA 4JI5L 4JS5A 1VQPQ 1FNWA 1STNA 1TWFH 3M9QA 2D5DA 1UUPA 2EXDA 3MZ5A 5CVIA 2R93H 1U5KA 4AFSC 2ZXRA 1OTCA 1GL5A 3J80E 1ICWA 4OWWB 3DHQA 4C8QD 3MXPA 3ONAB 3HOZG 3QR8A 2PVDB 5D6YA 4LNPA 1H641 4LUOA 3RZOH 2FPFA 4DNTB 2HT1A 2MPXC 3VR2A 1T3SA 1BKBA 2FFKB 3OTOQ 4YIJA 3I72A 2KNBB 3OHXC 7AT1B 2PCFB 3RN5A 1JQQA 3GTPB 3OS2A 3URGA 1YJNA 4IOAA 5AT1B 4C3JG 4A3KG 1YP5A 2HIVA 2K5LA 4AYBB 3KLSX 3OIQA 4OVAA 2R58A 3H94A 1ZUKA 5FLMH 1AWWA 5CKDA 1Y1WB 1Q82C 4LMQD 1VF5C 1Z9ZA 5A2QL 2OTJA 1PTOH 2FB7A 3U23A 2EVRA 1Y57A 2TMPA 4PJMA 4J15A 4IJLA 2EQIA 3VS1A 1IZ6A 1XQHA 2CP3A 1BCPD 3I56A 2WAQE 1K8OA 4OO1H 1R8OB 3G4SA 1LTBD 1WIEA 3DEPA 2DZ9A 2O2OA 1J3TA 2JXMB 4MZTA 2FHDA 4M8AA 3AQQA 1TWFB 4LF8Q 3STBD 4E7ZA 3EFOB 1RLQC 4OWTB 2A36A 4OIJA 1CHQD 4RTTA 1GXIE 3I70A 3CMET 1G3YA 1DOMA 3V05A 4LF8L 2VZAA 3NUCA 2VW9A 4ZN3A 5LMUL 1PRTD 1HUMA 1M4VA 2RQTA 2P4RA 1RAEB 2LDMA 1R9TH 2BH2A 1NBEB 1UJYA 1MBYA 3OMGA 1PWTA 1S72Q 2F0KA 2PTKA 5T1IA 3BW1A 3GF5A 3SB2A 2EYJA 1CKNB 2GVBA 5EQ0A 3TREA 1WFWA 1LACA 4F8MA 1UHCA 3JCMJ 2ROLA 4LF7L 3JCMg 4APVA 1DYQA 4B6MA 3L1AA 2B63B 2C35B 4C0GA 2DJQA 2CT4A 1L0XB 3LW5E 4DV5L 4R56A 1U1TA 1V9PA 2DZCA 4E7KA 2QGQA 4DR6L 4GLAC 5K5PA 3GLXA 1ACMB 3UE1A 4M77A 1W1FA 1M90R 1SF9A 5L23A 4RTZA 3CCMA 1VQKQ 5T1GA 5C3XA 4X9DA 1TT2A 4QF4A 2RVLA 3CCRQ 2C5CA 4V0BA 2RI2A 1RAAB 4JI8L 1I5OB 2EGCA 3I55T 1HD3A 5J26A 1KG1A 5CV6A 4EMHA 2D6FA 4JBWA 4M78E 1LTID 4KHVA 3J81i 1EZ8A 3R6NA 2PI2A 4JZ3A 4ZLTF 5G3LD 1U9RA 3M57A 1CT1D 5ELNA 1J9OA 3URYA 1JJCB 2LQNA 1E6GA 2F52A 1SMYD 5GAN3 1JE4A 3VDYA 3TS2A 1QVGA 5E4WC 4FF1A 3S1QB 1SNMA 4A3DB 3IQLA 1NZ9A 3OS5A 1D1KA 4S3SA 4CC4B 1PM3A 1L0YB 1PZJD 1TWHB 4N0AA 1KIKA 1WTOA 3PO2G 5C6SA 1A3VA 1WA7A 1MV0B 2HDAA 3MCAB 3MFYA 2JYOA 3L3OC 1AEXA 4LW1A 1AVZC 4F7UA 2HUGA 4FNFA 4PV1C 3NMZC 2V1CC 1YHQQ 2O4XA 2F5TX 3QDFA 3D4WA 2QQBA 3CD6T 4C92E 2F0EA 1GO3E 4LNQA 2KCNA 5I6WA 3VS5A 4K14A 2FINB 3E0EA 4A3LH 3TQYA 4UHVA 1PFNA 1GUTA 4BBSB 2Y4YA 1AE2A 1RCVD 1H3HA 1E2WA 2HSPA 2NB0A 4K8JA 3HEJA 4KH1B 4XXEA 3MC0B 5M3FH 2JTEA 3X25B 5FW9A 1WHLA 1CI3M 1CSQA 4A4KA 3HOUH 3L2VA 3TVTA 3VV0A 4ZNXA 1OXTA 5GMKm 4QB4A 1KL9A 1M1KR 4X62Q 1X69A 4DEYA 1WD0A 2WSFE 2NBFA 2HMAA 1MI2A 4LDYA 1JWSD 4DAPA 2FEIA 3RMQA 1NE3A 2KEDA 2RHQB 2PNHA 2FL7A 4N8FA 3HOVB 1B34A 3RDVA 2DNCA 3G6JB 3EGDB 4DR3L 1VQHA 1PSEA 2F0SA 1I94Q 1EEFD 4CKBA 2MNAA 4A3JB 1EU3A 2DJGC 1H9MA 4B3TQ 1D8LA 2F3IA 2NUZA 2YTVA 1OYXA 4KT0E 1YITQ 2A6ED 2F0TA 2J6OA 4EX5A 1MNDA 2UU9Q 2EIFA 3P8DA 4LUEA 4DOVA 1GUNA 3D31A 5ELDA 1QW1A 2EY6A 2MOXA 4L5SA 3V96A 2XIDA 2QQRA 1X6BA 1D1CA 1CKOA 3IFTA 2UU9L 2VUMB 1UB4A 2NUTA 3JB9I 3MA2B 1IBLL 3CMEA 2P5ZX 3W3AA 1JB7A 1OEBA 4DBHA 3TP8A 1ICFB 4NL2A 1WCMH 1MJCA 2RMOA 3M56A 2M1HA 4XQJA 4DXGA 1SN8A 4PG3A 1YN8A 4JRQA 2XKOC 4MIUA 2RA4A 4YHHQ 1GCQC 5GAOr 3I7FA 2Q2UA 3HOUB 3RKYA 4MDWA 1Q1EA 4U673 1KQ1A 3GP8A 1OV3A 3GTJH 4YHHL 5BN5A 3CBOA 5IGFA 4F7XA 1ASYA 4HCBA 3MKDA 1ENAA 2OT2A 5FKAC 4C3HH 3I4MG 3KUPA 4K0KQ 2E2JH 2BDOA 3G71T 4X66L 1N9WA 5LMNL 2YDLA 1B3AA 2E8GA 5M9OA 4YTLA 1UE1A 2EJFC 1NY4A 2F4VL 3OYKA 2QA4Q 4C8QB 2XWBB 5FU6C 2DJFC 2L0CA 3QWNA 1HA5A 4LD6A 3ERSX 3ER0A 2EGAA 3NPFA 1J6QA 1TS9A 2DE0X 1AOJA 1X56A 2FG0A 2B2YC 4KRTA 4Q5WA 2QILA 2EJGA 4N9PA 4YY3L 1HNWL 2SRCA 3I55A 1F2MA 1RKNA 1GBRA 5LJ5g 4E7JA 1GVPA 1NCVA 3HP9A 5KH6A 3BG3A 5EGTA 1YBYA 4M75A 1EQQA 3TU4K 1WHKA 4ELYC 1QUQA 4A3GH 2JA6H 3CW2C 2OQ0A 1O7LA 4H44C 2KA7A 3DXJC 1Y0MA 2FO0A 4RCNA 4IUQA 4J9GA 1K8AR 4X3TA 1MIUA 1LNXA 2IPOB 1ZXTA 4NXNQ 2EW3A 1W2BS 3DM1A 2KRSA 3PV0A 3S1NH 2NN6I 3CCEA 4M77E 1I4PA 2LTOA 5KYYA 3OBWA 3RLFA 2X3WD 2RJDA 3DKMA 4A54A 4PJOD 2R5MA 1BCPB 3MXNA 1M90U 1VQEA 3JB9G 4UP9A 4JJDA 3CC2A 1SHGA 2F2VA 5KGUA 1PD0A 4GKKL 2EYOA 4E7LA 1HNXL 4LF9Q 2OI3A 1ASZA 5IXFA 2E2JB 3CQZH 3BU2A 3CD6A 4FM4B 2A37A 1X6OA 5EPLA 4IUNA 2JVVA 1SE3A 3FB9A 4C8QF 1VQNQ 4ATOA 1SNOA 4ZQ3A 2PI2E 1UG1A 1ZKOA 3EGUA 3M0UA 3ZL7C 2ZPHB 4LF9L 2YV5A 3PF5A 1VUBA 1ZHIA 2B8GA 1G91A 5DEHA 4M78B 1YI2T 2OAWA 3A8OB 5M3FG 5KCHA 2MAMA 4ZGEB 1KQ2A 1JRIA 3RMSA 1KFZA 4J9FA 2FRWA 3UA6A 1RUWA 4XYQA 2R92H 3HOWH 2WB1G 1CM9A 1PHTA 1PTOC 4FSSA 3HZXA 3D3RA 1WHJA 4F7UE 1H8KA 1OZ2A 1H9JA 3EFRA 1FR3A 4DU9A 4KY7A 4NOYA 3VS0A 4BY6C 2A6HC 3A98A 2KCCA 4MMLA 2BUDA 1EWIA 3OYHA 2AHOB 2HQLA 4Q0FA 3DWQA 4YCWA 3VJPA 1K8AC 1K0RA 1IL8A 2UXDL 1SNCA 1QCFA 1OOTA 1U1SA 3S1NB 1KDCA 1HXDA 1BCPF 2ECZA 4C92B 4RTWA 1TWAH 2SEBD 3KK7A 2R7FA 1SFOH 2JEAI 1SE2A 4BBRB 4DKAC 4OGCA 4PMBA 3BE3A 2DXCA 2F0OA 4DPGA 4FCYA 4ZTJA 1L1OA 1MMDA 1X54A 1WJSA 2K5FA 2Q8RE 5GAOm 2QDYB 4HCEA 2KMTA 2F1LA 2UUAL 1OI1A 1LPLA 1U4MA 2KQ3A 2OAUA 1WCMG 4OWXB 1XX8A 4M78F 1NM7A 3PT9A 3DWPA 1AWXA 2HL3A 2JS0A 2E70A 1M1KU 2NVYH 1CZGA 1NG2A 4HIMA 3PQIA 4MTNA 2K5IA 1PYWD 1W6KA 2JK8A 2CREA 2MI6A 5CBEE 2WKDA 2OCEA 5LJ3e 3HKSA 4GN3B 1XNRL 2R92B 1JOKA 2K5WA 3GOXA 4C2MB 4C56C 1S40A 2HCCA 2V1RA 1ESRA 4K6DA 3A8HB 2QQAA 3HG9A 4RHRA 3GTLB 3N52A 9ATCB 4D8KA 4J8QA 3PTAA 1QKXA 4HMIA 2K7VA 3G71A 5JPMC 2AHJB 1KQSP 1PH8A 1BI2A 3CCSA 3TSWA 1HHVA 3G48A 2NLUA 1PH9A 3OW2P 4C92F 3M3YB 1KRSA 2QYZA 5D3IB 5M3MG 3K58A 3EVQA 2VUBA 4GNXC 1SFOB 4AFQC 4L6TB 1ZA1B 3GTMH 2WKCA 4J9DA 4WJ3M 4JCVE 3GIBA 1LT6D 2F1MA 1C1AA 3OSSC 3UF4A 3LWHA 3UWNA 5C4XB 1YIJT 4P74A 1AFPA 4GBQA 1EQTA 4CJ1B 3CCEQ 2VQFQ 2JA6G 1JB0E 1QVPA 3THKA 3S1RH 2Z8LA 3CCQQ 4AT1B 2NVYB 4BY7G 3MHBA 2GN5A 1K8MA 2A68C 1LTAD 4PJJA 2CKZB 4DV0Q 1WQ7A 1W70A 1ML0D 1NJIR 2PO4A 4H7BA 1JE5A 2IJ0A 4RMFA 2ZM6Q 1QKWA 3U9OA 1T0HA 3JV3A 4RTVA 2KEEA 3T56B 4F88A 5J22A 3MAQA 5EPJA 5CC4A 3HS0C 1V43A 4O1NA 2ZM6L 2ICIA 1PC0A 2KE9A 1A0IA 2F4IA 3CC4Q 5GAMg 4XYOA 5J1ZA 4OX9L 2DKGA 4OP0A 3UE0A 1VDZA 1CZWA 4M75E 2ZCFB 3RNUA 3X20B 2M0OA 3EG0A 2XN9C 2RNAA 4X34A 3S17H 5E4XA 3HOVH 2E2DC 4DV2Q 4X6AH 1YI2A 1JJ2P 2A69C 2E10A 1VQPT 2B2VA 3PUYA 5IP9G 1BF4A 1ESFA 1M8MA 1F1BB 4LFBL 4PZ7A 1D09B 4XK8E 4ME7A 4JI7Q 1C0MA 1DXMA 2YUQA 1SSFA 3DB3A 2DTOA 3BYTB 2DERA 4AH6A 2XDBA 1SAPA 3FHWA 1UWVA 4G57A 1X6GA 4M77B 2K14A 3S1RB 1N33Q 2EOTA 3QO2A 1TWCH 2QDBA 4L63B 1G2TA 2NUCA 5M5WB 2LRQA 3I4OA 2F0VA 3I35A 1CHPD 4OMMA 4A3EH 4B3ML 1T9HA 1NJIC 5GAHC 3E0JA 1B50A 5AJ3Q 4FU6A 3M54A 1CKAA 2RN8A 2YRVA 4E6RA 3CPWS 1TY0A 2BCOA 1ZUUA 5FRMA 1SYDA 4G7OC 3CCUQ 2D0PA 2AT1B 4LWCA 4X3SA 4R4TA 5A35A 2BE9B 3M4OB 3H0GG 1XXGA 2PZUA 2NUPA 4KUDK 5C0XI 4LN2A 3VS2A 2UUCQ 2ZJPA 4FIBA 2ED0A 1VQ5A 1HQRD 3VA7A 1QE6A 2R61A 3LWUA 4OMPA 3V8KA 2KECA 1VQBA 2K79A 1XMQL 3FDTA 4KN7C 4A3BG 3S17B 3QKJA 5IGDA 1F2LA 1FWZA 4A76A 2C0OA 4NW2A 3T1HL 2HZYA 1ABQA 2O4XB 4C0FA 3V7CA 5GANj 5ELFA 2YU9B 4K5XA 1HR0W 2R7ZG 2MYSA 4V2SA 2EYFA 3JCMh 4HMJA 4RG2A 4PJOB 2QEXQ 4L5GA 1A2TA 4AQYL 1HUNA 3S16B 4JLGA 5D6WA 1HZAA 4IUTA 2B2UA 2MPMA 2D1XA 1IL2A 5KNDA 1M30A 1E6HA 5FROA 1S72T 1GUGA 1QG7A 1Z7TA 1TWCB 1QCNA 2F0DA 4JG2A 3E9GA 3PIO3 3T1YL 4CJ2C 2A28A 4AG1C 4QQ6A 2OX7A 3RNJA 1WYXA 4RKUE 1QB5D 4H13C 3QUIA 4BA1I 2E5LQ 1MSGA 4M7DA 2X3XD 1UE6A 4F04B 1MMAA 1SRMA 2DVEA 1ZLMA 2SNMA 3F2CA 3OYFA 5D3DA 1AZGB 2GGRA 5JVG3 3S3OA 1N9RA 2COWA 3QHSA 1SSOA 1G2SA 1LLRD 2RJEA 2F0GA 3P8BB 5M5XB 1B34B 1YIJA 4KD3A 1VF7A 4O5VA 2EJMA 2DD5A 2L3SA 3GBQA 3X3MA 1VQKT 2PZ1A 5IYCH 1JU5C 4IUUA 1Y1VB 4PJNA 4IPDA 4JK1C 3OS0A 3AFQA 4JBKA 1RAGB 4OF1A 3CCRT 3QDRB 1ZX6A 2JTFA 4N4IA 2AQ1B 2F0WA 3SK6A 2HKNA 1WTWA 2G5DA 2Z6KA 4R4QA 4ZUJA 2K5VA 3VS3A 3V7SA 1QVFP 4PJOF 3OA6A 2EFIA 2GQVA 2E3HA 2LQWA 1YJWA 2DYIA 4L59A 1VQDA 3AB9A 2MK5A 5K36H 4OIKA 1N32Q 1PNJA 2NUTB 3MP8A 4RUGA 4RCCA 1N8RR 3LX7A 5IHIA 3JCMc 1BYMA 3A0JA 1EYCA 4KV6A 1DOKA 5GMKl 1VIEA 3ULLA 5GAEC 1J5EQ 4DV7Q 1X3FA 1NSNS 1VQOQ 1IGUA 2NTTA 4WORA 2MFIA 4JI1Q 5KYUA 4P5NA 2Z1CA 1KNEA 4DNIA 2K3XA 4TRDA 1YHQT 2L9HA 2OF1A 4A3MG 1WTQA 1EY7A 4DR2Q 1VQPA 2N55A 3TS0A 5GANh 1U3OA 1CSKA 3MJXA 4M7AG 4C8QA 2O31A 3CC7Q 1NEGA 4HSPA 5DY9A 2IWHA 5IE8A 3H0IA 1WTVA 1IYVA 1I4QA 3S2DB 4DUYL 3T13A 5EKKA 4NMZA 2CS7A 4AFZC 1FX7A 3P8HA 2RKSA 4BWGB 4DUZQ 4OMNA 1SRLA 2M9UA 1PTOD 3NTKA 2YHTA 1UECA 3AU7A 3KYHC 1B7TA 3V2TA 4KHPL 4L5QA 1I4XA 1IGQA 4J9EA 2A6EC 2DGYA 1C6VX 2NVTB 2LMCB 5CMDA 1D0YA 1SG5A 1TS3A 3I90A 4CDFC 4A3FG 2A6HD 1O75A 2V8KA 5LJ3f 4XDXA 3TDQA 1PH4A 2EDGA 1CSPA 1HJPA 2MMPA 2PQEA 3FKIB 1FYCA 1IRXA 3G4ST 4FYWB 1ET9A 1QUQB 3OSOA 4E7HA 1N8RC 2C0IA 1CA5A 3JSCA 4LF4Q 3L2QA 2F3WA 4MZ9A 3M4QA 3SWNC 4PJLA 1NMFA 2K05A 1HNZL 2XMFA 4HCZA 3I4NG 6AT1B 2E1HA 2J7ZA 1Y71A 2X4YA 3NBHA 1QZHA 2V8IA 3A7AB 2MUYA 2N49A 3HKZE 4TQUS 3VS4A 1YITT 2Z4HA 5KYYB 3GTGH 3KF8B 1OU8A 1ZSZA 2R5AA 2K1BA 3KOJA 4R55A 1OX9A 2OJ2A 2ZZDA 4YCUA 3O8VA 2BTTA 1R77A 3ASKA 1UNSA 3PMIA 5CORA 2D9TA 2JJQA 4QQDA 1S5CD 1O7YA 4XU0A 2QKIC 8ATCB 1WTXA 4JI6L 3S9WA 1MNEA 4C3IB 1X27A 2KT1A 1D5XC 3CPFA 3EG3A 4EMKC 1EY6A 2O2LD 1M2OA 5FWBA 3CPWP 2UXBQ 1S72A 4JI0L 2JM9A 1D1BA 4RH6A 5BN4A 2JNGA 4A3IB 1XWEA 3GPLA 3GTOB 2YRDA 4RG1A 2K3BA 2ZAEA 2RHXA 1KRTA 3F8TA 3CCMT 4DA4A 1Y14B 3QIIA 3VYHB 4DV6Q 5I6YA 4MZPA 1VYTA 5I9PA 3K81C 2LJ3A 2VXEA 4BB7A 2LQKA 2CP7A 1YNZA 4DBRA 2K5NA 4O0AA 5LJ5h 5ELOA 1PZID 4Z88A 1S3OA 2XRSD 1JORA 2I5MX 4FXGC 5J3BA 2QA4T 5I9OA 1OPLA 2H8HA 1HZCA 4ZUIA 1G3TA 2M51A 2PQAB 5IYCG 1DD2A 2B2TC 1VQKA 5HGTA 4KKUA 2R7DA 2OXPA 3J7ZC 3PGZA 3GTGB 4J6XA 1PFMA 5IODA 1WVLA 1Y1WH 1G83A 4ZTFA 2LT1A 4DOWA 3CCRA 2X6LA 1IW7C 3F2UA 4JS4A 4OONA 1R0CB 4N9TA 1L1OB 4DBQA 2EQJA 4J9BA 1HZBA 2WIIB 1MJEA 2ES2A 5L8RE 4JI5Q 1EUJA 1QVGP 2DTIA 2FVUA 2HQHA 4M7DE 2EE1A 2JSOA 3CU7A 4HAEA 3JB9D 2VXWA 1E7ZA 4HTHA 4OL7A 3J80L 1IB8A 2A68D 3RUXA 2CHBD 3FMCA 5KE3A 1ZUYA 2LMJA 4PK4A 4HJ9A 4DF7A 1EWCA 2F3VA 1EL0A 1JCKB 1PV4A 1LT5D 3JCMV 1XJVA 4J8OA 3FEOA 1F9QA 1ENCA 4M7AC 2B29A 1X2KA 3ZYYX 1QMCA 1F77A 1FYNA 2P0PA 1YHQA 3M85A 1IXRA 1GCPA 1PD1A 1NPPA 1SR3A 1XPUA 2VXFA 3C3LA 1M27C 1V1QA 2F0HA 1VYUA 1MKHA 5HCKA 4XIGS 3JAMc 1Q86R 2A69D 2UXCL 2RHZA 2QGFB 1GXDC 4RGTA 2B63H 1LVKA 5GAOl 2KENA 3FIFA 1VQGA 3D6CA 4KKTA 4B3RL 2KHJA 4O42A 5CR2A 4A93G 1WXUA 3M0QA 1N5ZA 4DV3L 3CCLQ 1E1TA 1TVXA 5IN1A 4BD3A 4ID6A 2ED1A 1V1PA 2LXKA 2HHHL 1IBML 4CC7A 1Q90A 3KF6B 3MEHA 4QIWB 4ZKBB 1WOCA 2LY7A 3CP0A 1XOVA 4C8QE 1FVIA 5FU6B 3WOEA 4HJAA 5LMUQ 3FRNA 3OQ5A 2E65A 5GAMj 2DPPB 1X3GA 2L55A 3DEOA 4K2KA 4BACA 5E1FA 2GA4B 4FYYB 2LXJA 4IO9A 1N34Q 1VQ4Q 5C3EH 2HIXA 4GLXA 1YITA 3VKIA 5JVH3 3LH0A 1X3QA 3S1QH 4A3DH 1ILPA 1N34L 4BA2I 1TWHH 2LX7A 4J6WA 3JRZA 1D2BA 4LF7Q 3Q23A 3PE0A 4LFAQ 5COYA 5FU7B 2AWNA 5GAN8 1LO5D 1Q86C 4M4ZA 1SRUA 1VCIA 4ODGA 4DV5Q 3GTQB 1SNQA 3TP7A 5KYNA 1LTRD 1QJOA 4LFAL 1I4HA 2BA1A 1STYA 4IUVA 4DR6Q 1X9NA 3QZ5B 4R4IA 3BDLA 3EG9A 3HGBA 2YUOA 3GDEA 5FLXL 4HIOA 4JJBA 2X69A 4KY5A 2JA8B 3F1ZA 4X1VA 1STBA 5GAOp 2ZXOA 3LNNA 2BIVA 2DM1A 1QILA 3QWYA 4IFDJ 3QJYA 3J7AF 5IP7H 1ZA2B 4BBSH 2KUMA 1E24A 5GMKe 4RMOA 4JI8Q 2ZTCA 4YWLA 1Q12A 1HXYD 2AKLA 3UATA 1B7YB 3UDIA 4XTZA 2JS2A 2VVKA 4A53A 3HKZB 4JI4L 2LJ0A 2XHCA 2JA7H 2N88A 1BXTA 4BXXH 1UFFA 1VQFA 2QA4A 3CAMA 3TEHB 4OO1I 4AYBG 1X2QA 1HZ9A 3DWAA 2RI5A 3EAEA 2DXBA 4RGMA 4A3GB 5C3EB 4XU1A 2X4JA 4JV5L 1EY9A 4DK0A 4RCBA 2EQMA 2KAFA 2M9VA 1Q1BA 2XNAC 1S1NA 2CFMA 4TKOB 1KTKA 3K6OA 1WYDA 4A3JH 2NUPB 3CCET 2LSSA 3NWSA 1M5Q1 1Z9QA 1VQMQ 1X3EA 3UDXA 3L0OA 3CCQT 4X65L 4ZRZA 3CC2T 2PPBC 3SD4A 2DXTA 1HYOA 4D6WA 3OYLA 3LWIA 5C0MA 2F0PA 4I7ZC 3RR6A 2DA9A 2AIRB 3M4YA 5GAMh 5HURA 4GY5A 2R93G 1UTIA 4J6YA 1H9KA 3KJOA 2RA2A 3S6WA 5KYXA 2JEBI 1LJOA 2MF2A 3FDRA 4PJOA 4P71A 4DFAA 2VUMH 4LF6L 4F87A 4DAVA 2VWFA 3UA7A 1IHZA 4BI3A 4ME5A 3NE5B 3VYSA 4DN4M 2O9SA 1UGVA 1VYVA 1S5BD 3ZFJA 4II1A 1VMPA 2RQXA 1I07A 2PQWA 2DNEA 3OOCA 3Q8DA 1Q82U 2ICEC 3CC4T 2VY3A 3NQIA 4KHZA 3S1MB 2HBWA 2JZ2A 5GANg 1VQNA 2JA7B 2I46A 1V76A 4JYAL 5JPNC 4DR5L 4FF3A 4JPBW 3L2UA 3I4MB 2LKVA 1AP0A 2B63G 2FJ2A 5FLMG 4DR3Q 2EVBA 1WQWA 4U68A 4M7DB 1UAPA 3H9NA 3DUZA 1I1JA 2CH4A 1LABA 4RA8A 3QOLA 1X65A 3ULPA 3J7A5 2NWMA 4JI2Q 1EIYB 1SSHA 2DBKA 1LTSD 2EYXA 4UY8C 5CQYA 5C3WA 3LX0A 3A8LB 5LL6X 1EIFA 4KULA 1KQSS 4OO1G 4NS5A 5A0DA 2F0JA 3D4RA 4JI2L 1ZYRC 3KXTA 3OW2S 1KK7A 1IBLQ 1IO6A 5CKEA 1FMKA 4IIMA 4PMCA 2A1AA 1D1AA 3QO3A 2DL3A 1B9NA 3WVDB 4CRIA 2B2WC 1RDPD 1EEID 3TEEA 3F2DA 1EOTA 1PZKD 3HOYB 3LH5A 3CCUT 3QBYA 4QT7A 3HFNA 3A8KE 4DAYB 5CK9A 4IFDH 2MWPA 2QASA 4KBMB 1G6PA 5IGGA 4C0DC 2YTXA 1XNIA 3I8ZA 3OYMA 4LDUA 2K2MA 2Y0SE 4X66Q 4NB3A 5LMNQ 5EAYA 5KYUB 2QF7A 4M7DF 2D8HA 2F4VQ 2CH4W 1XTCD 2H1EA 2DL5A 1RF2D 1Q95G 2GFAA 3S2HB 4KGZB 3GNGA 3CCST 3P7JA 3OMCA 3KFVA 4NL3A 3KLSA 2DVJA 2HEQA 3KUFA 1ZBJA 3RBBB 5EBDA 4OB0B 4Y28E 3JAME 1K73R 2NN6H 3OS1A 2QEXT 1SJHD 4BDYA 2RDFA 1VIFA 1FNUA 4YY3Q 3J81j 1HNWQ 2DILA 2N78A 2VS1A 1WDXA 1SE8A 1M1FA
chains in the Genus database with same CATH topology
2B8AA 3F2BA 4E7IA 3V8LA 1Y07A 3CXCS 1JJ2S 2E6ZA 5DLQE 5GMKi 4LFCL 2DEQA 3L2PA 3U58A 4JBMA 4UP7A 2K5HA 2FYKA 1WGSA 2EQKA 1BI3A 1E3PA 3LGLA 4GKKQ 1I6HH 1HNXQ 3JB9F 4LDVA 2K52A 1Z47A 4A4IA 3GD7A 3CCQA 3NBHB 3ME9A 1Y7XA 4HCCA 1I50H 2E6NA 4A3LG 1K73C 1L0WA 4GLVB 2IX1A 5CAIA 3EN2A 3AFPA 1WPYA 2DAQA 1A63A 4M7AD 3BZKA 3CC4A 3HOUG 4JRKA 1VQOT 4C2MH 2K4KA 4GOPC 4EDUA 3M59A 3GTLH 1LYLA 2RD1A 2UXDQ 2WAQG 4WJ4A 2KVQG 2JA9A 2H3JA 1Q81C 3CC7T 4PJOE 3U50C 3VYGA 1PA6A 2PQAA 4JOIC 3M3YH 3EIVA 4IUPA 2IVWA 5C0XJ 2L8DA 4O2DA 4XQ3A 2QQSA 2UUAQ 5LJ5e 2ATWA 3RKXA 1M9SA 3JCMd 2LC4A 5GAOq 5C4XH 3MEVA 1I8FA 2CZ1B 5HY6A 2N8NA 1VQ5T 5IYDH 4HJ8A 2MQHA 3NTIA 1XNRQ 3CCUA 4JC0A 4IFDG 1C7YA 1G51A 2YLCA 2CYZB 3HOXH 1LTLA 4QY7A 3S14H 1FJGL 2N3SA 1XNQL 1YZ6A 2D0OA 1K9MC 5HGQA 1QVFS 3PIOA 3D0FA 5FJ8H 4A4HA 2QEXA 4M78G 2HAXA 4LF5L 3PO3H 4HKEA 3J81c 1ZBXA 4X9CA 4A3GG 2EJFA 2XI9A 3RERA 2QXFA 4FT2A 2Q2IA 2ZPIB 1B70B 5M5WH 1G3SA 5IT9c 4C92G 2DIGA 1BIBA 4BBRG 4ALPA 2MO0A 1YJWT 4Y52H 3W5OA 4QVZA 5BR8L 5CKBA 4XTUA 4OX9Q 2RO0A 2VNUD 5A0GA 3M4OH 5JJKA 2AMCB 1E1OA 2QTXA 2VQEL 3JCMX 3HSBA 2PUOB 1TXYA 2KDSA 2CZ7B 4LFBQ 3R6OA 3FP9A 4YWMA 2D62A 1QP2A 1RL2A 3HOWG 2L89A 3NFCA 2R92G 2YU9H 1VQOA 1K8AU 1BI0A 1D3BA 3B6YA 2HD0A 3ULJA 5IYBH 4VUBA 2OWOA 3S16H 5IY0A 4B3MQ 4A75A 4IJHA 3KFUA 3CC7A 3SFMA 5GAN6 5GAN5 1QP3A 1OXSC 1PH3A 4FDBA 3JCMP 2NZHA 1A62A 1WNLA 5IWAL 1VQJA 1VQIA 5C4XG 1XMQQ 1GD7A 5M5XH 2Y4XA 3ZJYC 3T1HQ 1Y1VH 2I5LX 2BH8A 1BIAA 1TWGH 4AQYQ 3VUZA 3MEFA 2RF4A 1W4SA 3RZDH 1VQ4T 3QYHB 4PL6A 5JJIA 4GKJL 4OB2B 5D6XA 1IYJB 1BI1A 5GAMe 3NENA 5LJ5d 3T1YQ 3S15H 1UGSB 4M78C 4JRIA 2CCZA 1QVGS 2C06A 3HHTB 3HRTA 4DR1L 2PVGB 2KBNA 4POGA 4UC4A 2JA5H 4BI4A 3X26B 4H02A 1X01A 2I2LA 4DV4L 3T9NA 3S2DH 4M77G 1YNXA 1GM5A 4C92C 3MP1A 1KC8C 3C94A 4GNXA 2NVTH 1Q46A 4C5HA 2GFUA 2HNIA 1SLJA 3NTHA 1PH6A 3FKIH 2IG0A 4XAXB 1DGSA 1B8AA 4IURA 4BE2A 4L5RC 3VU3C 2DIQA 1UE5A 1JT8A 3S3NA 2BA0A 2JUFA 1NE8A 1Q8KA 4QIWE 1VQMT 3HOVG 1X55A 4F7UG 1QZGA 1WI5A 2PUKB 5CKHA 2NZOA 2RHYA 4EQ5A 2KCTA 4DUYQ 4MMKA 4A4EA 2JTMA 5LJ5f 1BBUA 1IREB 4UP8A 4A3CH 1PH7A 1NJIU 5GROA 4KHPQ 3OYNA 4C3IH 1XMOL 1XPRA 4GN5A 2KSSA 4DV1L 3J81E 2K3YA 1KD1C 4A3EG 3BFMA 2RI3A 3M7NA 4A3IH 3JCMb 3GTOH 2P4TA 5GAGC 1HR0L 1HNZQ 1W2BA 2IX0A 4X64L 4R1JA 1O7IA 3HRUA 1YVCA 5IT9E 2YV5A 3RN2A 1N27A 3CCLA 3H3VH 3SDZA 1Y1VG 3WWVA 4GS3A 4JI3L 3M5AA 3L7ZC 3NELA 3K8AA 1FXXA 2LNVA 2UUBL 4JI6Q 4B9XA 5JEAJ 3FC3A 5DM7R 3M9BA 2CZ0B 5LJ3j 3UPUA 1VQ4A 1N36L 1PSFA 3UDCA 4TVAB 4ZN1A 3META 5CQXA 4JI0Q 3AEVA 1EYGA 2K75A 2Q2HA 3A8MB 3U4ZA 5GAN4 2EQUA 4N4HA 3OYJA 4JUVA 3M53A 4DR7L 1OXUA 3OBYA 4M77C 3RIRA 1XTDA 1P92A 4XU2A 2HQXA 2L3RA 2RJCA 4HJ7A 2YLBA 2ZPEB 5GAMd 3ZEHA 4WF2A 2I5HA 3PCOB 1GKHA 4P73A 4EMGA 4B9WA 3LGFA 1FGUA 2VGNA 3KF6A 1YHAA 4OB1B 2E2HH 4N0AC 1PYSB 4M75G 2ZPFB 3L2ZA 1MHNA 3L42A 3E9IA 5J39A 4QVCA 2LCLA 3S3MA 1K8GA 3QJ6A 3C95A 1YCYA 1VQMA 4P75A 1VQ9A 1NTGA 1M8VA 1PH1A 3C12A 2CWPA 2UXCQ 3PO2H 4AIMA 4HA8A 5LJ3h 1VQNT 4B3RQ 2LVMA 4DR4L 3GTQH 1YEZA 2VGMA 4C0DB 1I81A 1L2FA 2OQKA 4KLKA 4J5YA 4DV3Q 1N8RU 2ZGWA 2JA8H 3GO5A 3OYDA 2HHHQ 4A3IG 1IBMQ 3W1BA 3AYHB 4ZGJB 2EJ9A 1OXVA 5LL6S 1RI0A 2LQ8A 4XTCS 1D7QA 3JCMQ 5HK3A 2YYZA 4YWKA 3JB9J 5GAMf 3BY7A 3H15A 3S24A 1UGQB 5CO7A 3OTOL 4C0ZA 4DK3C 1SMXA 3DM3A 1WJRA 1E22A 2WB1E 4OGEA 3W1GA 2GCXA 2CQOA 2JQOA 5A2QE 3PF4A 2EAYA 2XDDA 3SWNA 4BDZA 2A8VA 1DJ7B 2RK1A 1BBWA 4QVDA 2CKKA 1HK9A 4B3SQ 1HH2P 4JJNK 3INZA 4M78D 4JI4Q 3HL8A 1D3BB 1LOJA 3CBMA 3V7RA 4B3SL 4FL6A 1EOVA 3S1MH 3CPWA 4XU3A 3KDFB 4EMKA 4JV5Q 5GQOA 2NVQH 3I4MH 2L15A 1Y1WG 2KK4A 4M75C 4GOPB 3MP6A 5AYFA 4C5EA 4BUGA 3E9FA 4C92D 4X65Q 5FLXE 3GTKH 1AHJB 3A5UA 2RH2A 2DXUA 4BY6B 4QQGA 2IT1A 4OXPA 4QL5A 3BZCA 1O9SA 1IBKQ 3M58A 2MO1A 4LF6Q 1VQLT 2EYQA 2WSEE 3QZ9B 4IPGA 5LMNW 1IBKL 2VYTA 3EFSA 3MEUA 3E1SA 3HOYH 2KQWA 1LUZA 5CKFA 1WFQA 4JYAQ 5GADC 4Z02A 4PMWA 4DR5Q 3GNFB 1RIPA 3RKWA 3CCVA 3JCMe 2IY5B 3X28B 2Z0SA 3PUXA 1LM0A 3JB9H 3PMTA 4M7AA 2JA8G 3OB9A 4QJFA 4XTVA 3RR5A 3S2HH 2RHIA 1M90C 1Q7YC 2DK3A 4PZ8A 1I3QH 5JEAG 1ZQ1A 3HKZG 4J7FA 1YJ9T 3HFZB 4XTWA 2ZJRA 4E47A 1NBWA 4GNXB 2QI2A 5A0LA 2BKDN 1L1OC 1G3WA 2PU9B 3TCJA 5C3EG 2A7YA 5I21A 1H3ZA 2ZTEA 3K7AH 1Q86U 2ZPGB 1EQRA 3UDFA 4EPCA 1K3RA 1OXXK 4A3DG 4LUVA 4X62L 2D0QB 4JLIA 3PFSA 1AE3A 2XU8A 1OZ3A 1I94L 3CCJT 5I2SA 4B3TL 3M4PA 2E12A 3V8JA 2LCCA 5C44H 3PGGA 3WVEB 5E7NA 5CIUA 4R4OA 2KHIA 3MEWA 5IP7G 4BBSG 3OYCA 4NPSA 3CBPA 1UE7A 3H8ZA 5GANe 3L2RA 4MZMA 2ZJQA 2JA7G 4LFCQ 4BXXG 3PUWA 3H6ZA 4JDSA 1M1KC 3J80i 4M77D 3PUVA 3OSVA 4M7DG 3K0XA 3HFOA 1N6AA 3JC66 4K0KL 3CF5A 1SROA 4A3JG 2HQEA 5M3MH 4PLLA 3I2ZA 1JBMA 4LDXA 4IFDI 1VQLA 4QQBX 2VUMG 2K4YA 2VL6A 1CKMA 2AWOA 5FU7C 3HOYG 3OYIA 3KBGA 1VQ7T 3MHXA 1NMGA 4BY7H 2IHEA 1VQCA 3WXMB 5H1SE 1P8LA 2PVOB 1Q7YU 3IRBA 5LJ3g 3PIPA 1C9OA 4NXNL 4PKCC 3LYIA 3DB4A 3E9HA 4BE1A 2E2IH 4HT8A 2ZTDA 2XICA 4PLIA 3MO8A 1AH9A 4C8QG 4NXMQ 1TH7A 5C4JH 2XGTA 4DAMA 4R4CA 1C0AA 1PYBA 5IP9H 3HRSA 1YJ9A 4NXML 4BY1H 1PFSA 4C5IA 2DJZA 2XD0A 2X4WA 3K80C 1Y96A 3Q1JA 4L6V5 5DLOA 2LX9A 1VQ6T 3KF6B 1U0LA 3AHUA