1KHIA

Crystal structure of hex1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
147
structure length
147
Chain Sequence
b'GSASQTVTIPCHHIRLGDILILQGRPCQVIRISTSAATGQHRYLGVDLFTKQLHEESSFVSNPAPSVVVQTMLGPVFKQYRVLDMQDGSIVAMTETGDVKQNLPVIDQSSLWNRLQKAFESGRGSVRVLVVSDHGREMAVDMKVVHG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hex1
publication title A HEX-1 crystal lattice required for Woronin body function in Neurospora crassa
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Structural protein
total genus 25
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2001-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1khiA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1khiA02
1JJCB 2AMCB 4DUZQ 1MIUA 3PSIA 4CRIA 3FKIG 3W5OA 5GAEC 4B3ML 3CMAT 1QUQB 1VQ9A 2ZJQA 4B3RQ 2VZAA 3ULJA 1CUKA 4RG2A 5FLXc 4BBRG 1KQSS 1XTDA 4DAYB 4GNXB 4IFDI 1VQKA 4NXML 1YITT 4A3KG 3F1ZA 3F2DA 3J7ZC 3EIVA 4HIKA 1K9MU 2UUAQ 1VQAA 5BR8L 1PYBA 1B8AA 4DV6L 1Q81U 4GKKQ 1YI2T 4R4TA 1X56A 2K52A 1VQ5T 1VQDA 4C3JH 3OYYA 1PFSA 3U58A 3U50C 2Q2IA 3HKSA 2CCZA 3HOWG 1DGSA 2CWAA 2Q2TA 1A63A 1IYJB 3W1BA 2E2HH 1I94L 2JA7G 2Y0SG 4J15A 1C0AA 3J81c 2ZM6L 5AJ3L 3MXNB 3HOUG 3M4QA 2KCMA 2IX1A 2LXKA 1SRUA 4PZ7A 4LF9Q 2NVTH 1CSPA 1YJ9A 1WFQA 3NELA 3PUXA 2AWNA 5C0XG 4DK3C 1TWGH 1GM5A 3CMEA 2ATWA 2R93H 3L0OA 3UDFA 3PUZA 1YJWT 4JCVE 1QVGA 1HJPA 1N36L 4LF7Q 2WB1G 3G48A 5IWAQ 1JJ2A 1TWAH 1VQ4T 1K9MC 1VQGA 2XGTA 3P8BB 2ZJPA 1PYSB 1IXRA 2JJQA 3ULPA 1Q81C 2ASBA 4DR4Q 1JJGA 2KVQG 1S72A 1QVFA 1A0IA 1VQMA 1BBWA 1SLJA 1N9WA 1WI5A 4JI8L 1Q8KA 3OW2A 1VQNA 2XTIA 1NZ9A 1UE6A 5LMUQ 4LF5L 4POGA 4ALPA 3PF5A 1WCMH 4X66Q 4DR1L 4UP8A 1X6OA 5M3FG 1CSQA 1QVFS 2VL6A 2AKWB 4GOPC 3KF6A 3J81E 3OW2S 3HOYH 4WJ3M 1X3GA 2R92H 1IBKQ 4JI1L 1I6HH 2WP8J 1K8AU 1HNZL 1XNRQ 3GTOH 5BR8Q 1NBWA 4QJFA 3F2CA 1M1GA 4QQBX 5J3BA 1Y1VH 1VQPT 1I3QH 5JEAJ 4A3FH 1K8GA 3KYHC 1VQOA 4IPDA 3STBC 1EOVA 4LFCQ 2ES2A 3J80c 4JI0Q 3BJUA 3CCMT 2PNHA 1XMQQ 2ZM6Q 1SN8A 3K8AA 4YCWA 3G4ST 3CD6T 1LM0A 3ZJYC 1JMCA 2VUMH 1L0WA 1AE2A 4AYBG 1ASZA 4JI3Q 3S1NH 1QZHA 3CCVA 2MQHA 1VQ9T 1PH3A 3PUYA 4A3MH 2KBNA 1AH9A 3M4OH 4YWLA 3Q8DA 4QGUA 1VQKT 3EN2A 3HKZE 1KRTA 1AE3A 3T1YQ 4K0KQ 4LFBQ 4QY7A 4JOIA 4A93G 4LUVA 3CF5A 4YCVA 4EQ5A 4DV5Q 1K8AC 3JAMc 4AH6A 3F8TA 4X65Q 4HIOA 1WCMG 4BY1H 2JNGA 2L15A 2B3GA 1YJNA 4OXPA 4JI8Q 1PH4A 2HHHL 2B63H 2OCEA 2UXDQ 1VQEA 1YVCA 4LF5Q 1VQBA 4GN3B 1XNQL 1YZ6A 2R92G 2AWOA 2NN6I 4QIWE 3J80E 3CCJA 2F4VQ 2E5LL 2JA6G 4QQDA 1PHJA 1Y1VG 4DR3Q 4DR7Q 2ZTDA 4A3FG 5FJ8H 2JK8A 1YJ9T 2NVQH 2GVAA 2HIVA 3CMET 5K36G 1N34Q 4ZN3A 2UU9Q 3HOVH 4DV7L 1JT8A 4LF4L 2EQSA 1B70B 1QVCA 3CCSA 4UPAA 4TVAB 4A3KH 3M7NA 4DR6Q 2VUMG 3CP0A 3GTJH 2MWOA 4B3TQ 4A3GG 1B7YB 1SROA 1SSFA 4YY3L 4JC0A 4UP9A 1E3PA 3GTQH 4A3MG 1EUJA 1S72T 1VQMT 2UUCQ 1VQNT 4PG3A 5DM7R 4UY8C 1PH1A 5M3MH 2D0OA 1XPUA 4A4IA 4L5SA 2E70A 2ID0A 1G291 3HOUH 2DGYA 1J6QA 1C9OA 4BY1G 3LGJA 4OO1G 1WYDA 1N32Q 2B63G 1NE3A 2KHJA 4JI5L 1YBYA 2YTYA 4IJHA 1E7ZA 4ME3A 2BA0A 1GKHA 1VQOT 2HHHQ 1V9PA 3HOXH 2JEBI 2C35B 2F52A 3TS0A 4L5TA 1Q82U 4MZ9A 3KF6B 4NPSA 5J26A 5IAYA 3M4PA 5FJ8G 2L3RA 4AQYQ 4KHZA 1OXXK 1RL2A 5FLMG 1HR0Q 4A3BH 1NJIU 3CCUA 1SR3A 2OQ0A 1O7IA 1U5KA 2JA9A 4LUOA 5A2QE 1Z47A 1N33L 3HOVG 1IBLL 2UXCL 3M9BA 4GKJL 1P16A 1IBML 3CCVT 1X65A 2KENA 4JOIC 1MJEA 1UWVA 1YHBA 3AEVA 5HY6A 4OWWB 3GO5A 5M3FH 2JA8G 1Z9FA 3UDXA 4JI2Q 4A3LH 1E24A 1TWFH 1BVSA 3DM3A 2IHFA 1XPRA 5GADC 2QEXA 1N8RU 4DUYQ 1HNXL 2VY3A 1X3EA 2DO3A 3BZKA 1VQIA 5M3MG 4YY3Q 5LMNL 1FJGL 2N49A 3TS2A 1YJNT 2CFMA 3STBD 3S2DH 1VQJA 4JI7L 4LF6Q 4LF8L 5IYCH 3CQZH 4JI4L 2MWPA 3LH0A 1T9HA 5IYDG 3CCJT 3UDIA 1PH2A 4Y7NH 4TVRA 2VQFL 4X62Q 1JE5A 3PIPA 1V43A 1PVOA 2MO0A 1X54A 5FLXE 1W3SA 2NZHA 2JVVA 1OXUA 4JG2A 3HOXG 4X64L 4DKAC 2G3RA 4DV0L 3S15H 2UXBL 3J81i 1PH9A 1QZGA 2NZOA 1X9NA 4IFDG 3K80C 4OWTB 1SFOH 3GTLH 4R4CA 3CCST 3RZOH 1QVGS 5C3EH 4A3BG 4DV3L 3GTPH 3G6EA 2PQAB 5JJIA 1W2BA 1A62A 1E22A 4OX9L 1JJ2S 1YIJA 3I55A 4DV1L 4B3MQ 3G71A 1Q1EA 1FGUA 3TQYA 3T1HL 4BBSG 2E2IH 1W2BS 1SE8A 3UE0A 3D31A 2UUBL 3KBGA 1VQFA 1CKOA 1PH8A 4NXMQ 4A3LG 3S2HH 1I5FA 2K5HA 3NEMA 4A3DH 3CPWA 2IHEA 4O2DA 4DV6Q 3J7A5 2JA6H 2B29A 4DV4L 5IYBH 3OTOL 1LUZA 2R7ZG 3U4VA 5EAYA 3CPWS 1UE5A 3PCOB 1VQ7A 5IY0A 4DR2L 2YU9H 3KJOA 2FXQA 5IYCG 3KF8B 4A3EH 1FJGQ 1KRSA 3KFUA 1I94Q 2JQOA 2I5MX 4YWKA 3PF4A 5ELOA 3HOZH 5AJ3Q 3TRZA 4LF8Q 4AIMA 4IPHA 4A3GH 1KXLA 3S16H 3MEFA 2D62A 2I0QA 3CCUT 2ALYB 2CKZB 5GAGC 1KD1U 3S17H 3BU2A 4DR5L 1N36Q 1E1OA 4IOAA 1WOCA 5C3EG 3L7ZC 3J80i 1C7YA 3GTGH 4C3HH 3ERSX 3S1RH 2GN5A 4JV5L 4WJ4A 4BXXH 1PA6A 2QA4A 3CCRA 5C4JH 4KHPL 1VQHA 2QEXT 2DUDA 2VS1A 1HNWL 3HKZG 3K81C 3LGLA 2HIXA 1JB7A 4KI0A 4YHHL 4DR1Q 4A3DG 1BBUA 4JBJA 1NMGA 1V1QA 1YEZA 2CWPA 4P71A 4L5RC 4JYAL 4H02A 2PQAA 4JI6L 3NBHB 4JI1Q 5IYBG 3S1MH 1HNZQ 2R7DA 2NVYH 4A3JH 2WFWA 5FLMH 4XIGS 5IT9c 1LTLA 2LSSA 2JOYA 4LFAL 4A3EG 1Y1WH 1XMOL 2QGQA 4R4IA 2E6ZA 2HQLA 4OWXB 5IE8A 1GD7A 4B3SL 3HOZG 4YTLA 3UDGA 4BY7G 2MFIA 4NXNL 2JA8H 1U0LA 1VQLA 1K73U 3GD7A 5LMNW 1UE1A 1E1TA 5C44H 1NTGA 3JAME 3A5UA 4O0AA 3G6ET 4GLXA 1LYLA 1YIJT 3I55T 2IY5B 3G71T 3CC2A 3I4MG 2WAQE 2IT1A 4B3RL 3LGFA 5E7NA 3CC4A 4HJAA 3H3VI 2PI2A 4BXXG 4R4OA 3DB4A 2CKKA 3FHWA 3H0GG 2RCNA 3GTKH 4A3IH 4GLVB 2NN6G 4GKKL 5IYDH 2WAQG 1BKBA 2EIFA 1HZ9A 2BH8A 3M3YH 1IZ6A 4EX5A 1ASYA 1Q86U 2KDSA 2YYZA 4IPCA 3M85A 3CAMA 2JE6I 1VQ7T 3PGZA 2PI2E 4X6AH 1XNQQ 3B6YA 1PV4A 1P8LA 4P72A 4JBKA 2LVMA 4A3JG 1UE7A 3CC7A 3K0XA 3PO3H 1L2FA 2E5LQ 3VDYA 4DK6C 4LWCA 3GTMH 1Y1WG 3S14H 5H1SE 2IG0A 4A93H 2MNAA 1SMXA 4APVA 1IL2A 3PO2G 2H5XA 1NY4A 1VQ6A 4BBSH 2RHSB 4DV7Q 2ZJRA 4LF7L 1CKMA 2LCLA 4LF4Q 5C44G 3H15A 5IWAL 1G51A 4JBMA 2BA1A 4RMFA 2JUFA 3CCQA 1XJVA 5C4XG 1D8LA 5C0XI 2PMZE 1L1OB 5M5WH 2QA4T 3NENA 3CCRT 1OXSC 4DPGA 1X3FA 4PMWA 5IP9G 2NVXH 4DR4L 3I56A 1YNXA 2N3SA 1KQSA 1YHQA 5IP7H 5C0XJ 4LF9L 5LMUL 1OTCA 2R7ZH 1G6PA 3CCLA 1Q86C 4FDBA 5JJLA 4X66L 3I4NH 4A3IG 3CCEA 4UP7A 1Q82C 1FVIA 4YCUA 1IBKL 1XNIA 4IFDJ 1KL9A 1NJIC 1XNRL 5DLQE 2Z6KA 3RN5A 2R6GA 4A75A 1RIPA 2Y0SE 3CW2C 3CPFA 2OTLA 4PZ6A 4IJLA 4JI5Q 2K5VA 3A74A 2JA5G 3PIOA 3W1GA 4P74A 2Z0SA 3RLNA 5GROA 3RLOA 2V1CC 3S24A 3PO3G 1FL0A 4LFCL 2CQOA 1OXTA 1VQLT 4JI0L 2OWOA 1N8RC 1XMQL 1NMFA 1K83H 1Q46A 2N78A 1EIYB 2WB1E 3ICEA 3JC66 1S3OA 3AFQA 3ER0A 4JI3L 4HIMA 1S40A 1IBLQ 1N33Q 2UXCQ 3I2ZA 4GKJQ 3CC2T 1IBMQ 2E2JH 1M1KU 2I5HA 1D7QA 3A5ZB 4MNOA 1TXYA 4JBWA 5HGQA 4LNQA 5LL6S 3CC4T 3KDFB 2OTJA 4K0KL 4DAMA 3T1YL 1MKHA 2Q2HA 4LFBL 1EQRA 2K14A 1NPRA 1VQ8A 1EWIA 2RF4A 5M5YH 5IP7G 1EYGA 2ZTEA 4OONA 1CKNB 3GDEA 5GAHC 4DV5L 1PH7A 1HNXQ 4X65L 2RHQB 5LMNQ 3DB3A 3I4NG 4A3CH 3UE1A 3RZDH 3RN2A 4DNIA 2E8GA 2UXDL 2KCTA 1TWCH 4JI7Q 4P73A 1HR0W 4BY7H 4JI4Q 4IO9A 3D0FA 1HZCA 1L1OA 3TEHB 4HJ5A 3RLFA 1J5EL 1KC8U 1I50H 1XPOA 4GN5A 2F4VL 3CC7T 4RG1A 4A76A 3KLWA 4X34A 4POFA 1Q1BA 4L5QA 4Y52H 3I7FA 4DR3L 2VQFQ 2I5LX 1QUQA 1EQQA 4DR7L 2ZTCA 4P75A 1H95A 2A19A 4NB3A 3I4MH 4X64Q 4DV0Q 1N34L 1WJJA 2IX0A 5GQOA 2UU9L 2UXBQ 1M1KC 1VQ6T 1HZAA 5ELNA 3WWVA 4GNXA 2VNUD 4MTNA 4AYBE 1HZBA 4DR6L 2K50A 3H0GH 3KOJA 2K4KA 1K3RA 4DV3Q 4B3TL 4OX9Q 3CCQT 1NPPA 3CMAA 5JEAG 4DV1Q 2N8NA 1K0RA 2GVBA 1OXVA 3E9HA 3T1HQ 3I56T 1GO3E 1M90U 2R93G 1YHQT 4TQUS 2EXDA 2UUCL 4GOPB 1KIXA 3E0EA 3CCLT 1YITA 2Z6KC 2UUBQ 2VQEL 1VQCA 3CCET 1A8VA 3I4OA 4IPGA 3JAMi 4DV2L 4LUZA 3A0JA 3BZCA 1YI2A 3AFPA 2BH2A 4ZN1A 1KC8C 1VQ5A 3SGIA 4A3CG 4GN4B 3OTOQ 4DV4Q 1TWHH 3K7UC 1N32L 1KD1C 4LW1A 1Q12A 2OTLT 1PH6A 3PO2H 2R7FA 4DR2Q 3S1QH 1EIFA 3KDFA 1KAWA 2JEAI 1KHIA 1HH2P 2YV5A 3U4ZA 2KHIA 3TREA 3K7AH 3AQQA 3HOYG 4DUZL 4OO1I 1Q7YU 2F3IA 1CKNA 3EBEA 3IRBA 3J7AF 1YHAA 1VCIA 5C4XH 4IOCA 4AQYL 1HR0L 4KLKA 1J5EQ 3H3VH 3CXCA 3FP9A 4XTCS 5IP9H 2Q2UA 2LQ8A 3RR5A 5JJKA 4QL5A 1X55A 3FKIH 4C3IH 1YJWA 4DR5Q 1M90C 3HFZB 4GLAC 2A8VA 3CXCS 1R9TH 3PV0A 3KJPA 2UUAL 4BA2I 4BBRH 4JV5Q 1VQ4A 2OTJT 2D0PA 3E9IA 4JI2L 4HIDA 2VW9A 5M5XH 4HJ8A 2K5NA 1PH5A 5IT9E 4DUYL 1VQ8T 4KHPQ 1HNWQ 4BA1I 3F2BA 1L1OC 2MO1A 2JA5H 4YHHQ 4JYAQ 3HOWH 3J81j 1EFWA 1K73C 4LF6L 1VS0A 2AHOB 2YTVA 4JI6Q 2HT1A 2XHCA 1UEBA 3DLLA 1GVPA 4PZ8A 3PUWA 4YWMA 2VQEQ 4DV2Q 2JA7H 2A1AA 1Q7YC 4HJ7A 1Y14B 4GNXC 3RNUA 4R1JA 4X62L 1VQPA 1MJCA 3ULLA 4LFAQ 3L2PA 4HJ9A 4GOPA 3PUVA 2LXJA 1XMOQ 2K75A 4B3SQ 4C2MH 2MI6A 4GS3A 4NXNQ 2OQKA 2YTXA 3CCMA 4R4QA 3AYHB 3G4SA 3CD6A
chains in the Genus database with same CATH superfamily
4DUZQ 1MIUA 3E3XA 4E6IA 1SYGA 3R3OA 2C0TA 4JPBW 4XQ3A 1QMCA 4CGYB 4B3ML 3CMAT 1QUQB 3UATA 1VQ9A 2PTKA 1SNPA 1QB5D 3RZOB 3DHQA 5D6YA 2LDMA 3ULRB 5AT1B 3ULJA 1CUKA 4IFDI 1KIKA 2H4OA 4CDCC 1IKMA 5JPNC 1V1CA 4A3KG 4HN7A 3F2DA 1KG1A 3NQIA 3ZBDA 3OY9A 1K9MU 5JJZA 1PYBA 4DV6L 2ZPBB 4E7JA 4MIUA 2VV5A 3AHUA 5BN5A 1VQDA 5T1GA 1PFSA 3U58A 4E7ZA 2CCZA 2O31A 1JE4A 3NSWA 3HOWG 2DL3A 3RNJA 2JA6B 4J9CA 1JOOA 1Y8PB 4XU0A 5IT9L 2ZM6L 2FPEA 4F87A 5AJ3L 3VS7A 2DJZA 4E7SA 2YU9B 3A8JE 4PZ7A 1OPLA 1YJ9A 1WFQA 3NELA 2RHXA 4DA4A 4J83A 2AWNA 4IKFA 1JOQA 4J6YA 1O80A 4RTZA 3EVQA 4A3GB 3L0OA 4JUVA 4E7KA 3N6RA 4LF7Q 1N36L 4NS5A 1HJPA 5GANf 5LJ5d 2E3IA 3VA7A 2RQRA 2OX7A 5IWAQ 1JJ2A 1SYCA 4EVOA 2KT1A 3HL8A 4I7AA 3ULPA 1NUCA 4A93H 1IL2A 1Q8KA 3OW2A 1NZ9A 3OWEB 4LF5L 1HA6A 3HP9A 3AYHB 1AVZC 1U4PA 4MN3A 2VL6A 3W3AA 2DL5A 4ZRZA 2CZ1B 4WJ3M 2R92H 3R2IA 2WP8J 2OT2A 2IW3A 2K7VA 2ED1A 3RUXA 5I6YA 4L8JA 4XK8E 1BBZA 1D6EC 4QQBX 4ABNA 1U06A 1EEFD 3EG0A 1G8ZD 2EQMA 5KE3A 1OQKA 1I3QH 2B2VA 4II1A 5G3LD 2DIQA 1WVLA 2QCPX 3LWEA 1HJDA 4CC4B 1G3TA 2KEDA 3HOVB 5ELDA 3EFOA 1BB9A 2ZM6Q 1SN8A 3G4ST 3ZJYC 2VUMH 1E6GA 1KNEA 3CC4Q 3SVMA 1AE2A 4AYBG 2JA8B 3QWNA 1SG5A 1JJGA 4HCZA 3JCMe 2CGHA 2DERA 2MHVA 1EFNA 4OL7A 3HRZC 4KH1B 3E9FA 4F7UA 5EGTA 4M75A 3LWIA 4QGUA 3HKZE 4CC7A 2DZ9A 2DRMA 4FU6A 2E76C 4LFBQ 1E2ZA 4N4IA 3K5LA 1K8AC 3JAMc 3F8TA 2GF7A 2EVRA 1OV3A 4HIOA 2JNGA 3BDLA 1MNDA 4C92A 1YJNA 4M7DD 4OXPA 2D0NA 4Z9CB 2UXDQ 1WHGA 4C5GA 4LF5Q 2KR3A 2N55A 3BDOA 2AWOA 3EROA 3UWNA 4M77F 3VUZA 1W4SA 5EBCA 2JA6G 1PRTD 1JC7A 2GVAA 1B34B 3VYGA 2LT1A 4AFSC 2KRNA 4ZN3A 4DV7L 3VS5A 2E10A 1IL8A 2D5DA 1TUCA 4GNXA 3M7NA 4C56C 3I56Q 4A3GG 2LP5A 2MWOA 4BBSB 1XYIA 4C0GA 3CCLQ 1CK1A 1SROA 4YY3L 1Y0MA 3GTQH 3E1SA 1E3PA 4LNPA 1S72T 5JPMC 1VQMT 1IYVA 1WJRA 1W6JA 2A69C 2F0MA 4R8NA 2EYHA 2CT4A 1YCSB 5M3MH 2NVXB 1XPUA 4DXFA 5IHKA 3C95A 2RKSA 2B2VC 2CP7A 2DGYA 3HOUH 3THKA 4OO1G 1X69A 1N32Q 5C0XH 5C6AA 2B8GA 2BCOA 1ONLA 1RODA 2YTYA 1TKWB 2LCCA 4JJDA 1GKHA 4K6DA 3HOXH 2F69A 2C35B 2JEBI 4L5TA 3KF6B 3M4PA 3HFNA 2RK2A 1YJ9Q 4FYYB 3Q22A 1II3A 5FLMG 4A3BH 4WCIA 1MMGA 1RTNA 3CCUA 4M75C 1E2VA 3HOVG 5IGDA 1CA5A 3A54A 1EEID 1FGBD 2KENA 5KRUA 3J80L 3GP8A 3GO5A 5M3FH 3QOLA 2JA8G 1UUPA 1Z9FA 4IFDG 2VWFA 3HKZB 4OB1B 4C92C 2XIDA 2YUNA 2KT8A 5CV5A 3M54A 1BVSA 5BN3A 2K5LA 1N8RU 4QVDA 1X3EA 1ZUYA 3DXJC 2R61A 3BZKA 1Q82R 1VQIA 3BYYB 1LTRD 2RSNA 4YY3Q 4M4ZA 3TS2A 3O13A 4PL6A 2PQWA 4Y92A 4CHTB 4JI7L 1HHVA 1NJIR 2AHJB 1AOJA 2OI3A 1LTID 3FB9A 1T9HA 3CCJT 3HOZB 2XN9C 1NLPC 1ZX6A 5GAOn 2E3HA 5DNFA 4X62Q 1UUEA 3UA6A 1TOVA 2FB7A 1OXUA 1W3SA 3S15H 4X64L 2DEQA 2G3RA 3S16B 2D8HA 1PFMA 3SK6A 2UXBL 1PH9A 3LLRA 1JB3A 4OB2B 3S17B 4FXKC 2L3QA 2DN8A 2EJGA 3I4MB 1QVGS 4F8MA 3GTPH 3HZXA 3M7GA 5JJIA 4CKCA 5GMKe 3G71A 2DEUA 1YITQ 2E5QA 3H0GB 3TQYA 1WGSA 4BBSG 3EAEA 2E2IH 1W2BS 1V1PB 1A3TA 1FD7D 2WAQB 1I4K1 2UUBL 1VQ5Q 3JB9H 1I5FA 3A98A 4DQ2A 2IHEA 2COYA 4DF7A 5A2QL 1G2SA 3J7A5 2DZCA 2MAMA 4OIKA 5D65A 2YUPA 5L8RE 4I7ZC 4MZPA 2R57A 4KD3A 3S1MB 4A3JB 3QSUA 1WTWA 3V96A 4PJJA 2IWHA 1Y8OB 4FXDA 1O7LA 1BXTA 3KFUA 2JQOA 4YWKA 4NW2A 2Z0WA 4MZMA 2YUOA 4E6RA 3C0CA 2RCFA 3E0JA 1WPYA 5C44B 2ALYB 2A69D 4JRQA 1R0CB 4XTVA 1VQ4Q 4Z8AA 1EOTA 1Y57A 2DRKA 3BU2A 1WOCA 2DA9A 1M1FA 2M0YA 4C3HH 3ERSX 3S1RH 2NTSA 3D3RA 4JJBA 3RIRA 2QA4A 3CCRA 3MXUA 5COYA 5C4JH 4R8IA 1D1BA 4HT8A 2NN6H 2C06A 4C8QE 4YIJA 2WINB 3GP7A 3HKZG 3K81C 3OW2P 5CV4A 3DWAA 3M3YB 4HVWA 1B53A 4JBJA 5FOBB 5FROA 1V1QA 3VR2A 2K5DA 4JYAL 1B07A 2PVDB 1N6AA 1WJSA 3JCMV 2KHSA 3EH1A 4JI6L 5GANe 3NBHB 5CBAE 2EYMA 2NVYH 2ZGWA 4M75D 4XIGS 5IT9c 1TVXA 2DYBA 2EJGC 2RNAA 2HCIA 3EGDB 2JZ2A 4R4IA 5BN4A 5CMDA 3HOZG 1G6ZA 3R2TA 5CBEE 4YTLA 2DMOA 1EY8A 4B08A 1U0LA 2RQTA 2I07B 2EJ9A 3GD7A 5LMNW 2E65A 1TG0A 1TUDA 5GAMd 1H3ZA 2FO0A 4OVAA 1E0BA 3FIFA 4RTVA 5CQYA 1A3VA 1LYLA 1M27C 1YIJT 2A6EC 4LJZC 3KK7A 1VQKQ 1BCOA 1AN8A 5C3XA 3I4MG 2IY5B 1VMPA 4R56A 4B3RL 5IGCA 1KK7A 5C5MA 4BXXG 3DB4A 4J7FA 1TQOA 2CKKA 2EAYA 1QE6A 3H0GG 3D6WA 4OIJA 5CQXA 3EHQA 4GKKL 2WAQG 5KYYA 2EIFA 2QGFB 1W70A 3E6ZX 3MC0B 1ASYA 1YP5A 1LACA 2PUOB 2XKOC 2SEBD 1NCVA 3BDUA 1QLYA 1Q7YR 3B6YA 3VRYA 5I22A 1TY2A 1UE7A 4HSVA 4A3JG 3CBPA 3PO3H 2OAUA 4G4KA 3C3LA 2CREA 3QDRB 4IUTA 4APVA 4EMKB 1GUGA 1PZKD 1PKSA 2DY7A 3A8IE 5KNCA 2MYSA 5C44G 4CDFC 2E2JB 3H15A 2VKNA 3GF5A 4JBMA 1TSFA 1UGSB 3EG9B 2JUFA 1T0JA 1VQNQ 5C0XI 1WZOA 2PMZE 3NENA 4M7DF 3FPPA 2H8HA 1X3FA 4X3TA 5IP9G 2KJXA 1Y7XA 2RA4A 4NL2A 5IP7H 4PJLA 1RUWA 5C0XJ 1OTCA 3VYHB 1YFNA 1GUSA 4NMZA 4BI4A 1I4QA 4FDBA 4X66L 5DM63 5FU6B 3I4NH 3CCEA 2EJFA 2DNUA 3TP8A 2K6DA 3T16A 3RZDB 3M4GA 2O2OA 3PTAA 1TWCB 1FVIA 1XWEA 2DNCA 2PZ1A 3IQLA 1KL9A 1PFBA 1XNRL 3LX7A 2MF2A 3HSBA 2D9UA 2PNIA 2CP2A 3O8VA 4BE2A 3HOYB 3HPWA 1W1FA 2DYIA 1M8MA 2Z0SA 3TZDA 5I2XA 5GROA 1IGUA 4E7HA 2DF6A 4KKUA 1RCVD 2P0QA 2VUBA 4FYWB 1EIGA 1B9NA 4JI0L 1NMFA 1Q46A 1RACB 1R0BG 4GLKA 4J5YA 2F3WA 3D4DA 4QB4A 3QZ9B 3JC66 2Z9HA 3QIAA 1MSGA 4PLIA 3ER0A 2V8KA 4HMIA 3EFRA 4JI3L 5JEAH 2UXCQ 1LCKA 1IBMQ 3OQ5A 1HA5A 2I5HA 1D7QA 3A5ZB 4XTUA 4M7AE 2F0SA 3CC4T 3KDFB 2Z1CA 5J39A 5CR3A 2CDTA 2DXUA 4ZUJA 4K0KL 1LTAD 1MKHA 2Q2HA 4FVMA 1VQ8A 2O01E 1EWIA 3SR1A 1ILQA 1EQVA 1M8VA 1TR5A 2EDGA 2RSOA 3GDEA 1PH7A 3V8KA 4X65L 2RHQB 2K3YA 5LMNQ 1CQFA 1FNVA 2FHTA 5HURA 3BFMA 1I6VC 1QNKA 4A3CH 5ECAA 4DNIA 3FMCA 2HZYA 1WHMA 1CZWA 1SRLA 1RAGB 4BY7H 4R9WA 3D0FA 3TEHB 4HJ5A 2R58A 1U5SA 4FYVB 4G57A 5LJ5g 1I50H 2P4RA 4A76A 2GGRA 4POFA 4OMFB 1Q1BA 2EKHA 4WRDA 2VQFQ 5CV7A 1AZEA 1KSWA 2DXTA 1EY5A 4CC2A 4NB3A 3OYDA 1VF7A 2BE9B 2KNBB 1AZQA 1V1OA 4F14A 3BVGA 1KHCA 4MDXA 4RTYA 3JB9J 4EPCA 1KLUD 3VR6A 4B3TL 1TS3A 2K3BA 2NWGA 4DOWA 1WFWA 2PMZB 4BBRB 4PJOE 2EJFC 4DV1Q 3A56A 2O5IC 1OXVA 3I56T 3SHWA 1Z7TA 5EPLA 3GTJB 2HDLA 1D0XA 1ZXTA 1YNNC 3CCLT 3E0EA 5ELFA 4J6HA 2VQEL 4DNRB 4OMLA 1K3BC 1A8VA 2LS01 4BDZA 3NTIA 1SNQA 1YI2A 5GAOr 4A54A 3M0SA 4LK1C 1EY7A 1TWHH 1KD1C 4LW1A 4FT4A 3S3MA 1BCPB 4DR2Q 2K5FA 5CKHA 4BI3A 3BE3A 3JSCA 2C9OA 2FMCA 1HH2P 2YV5A 3U4ZA 4JJCA 5FW9A 3AQQA 1OX9A 5EKIA 3FRNA 4A53A 2V1RA 1ZUUA 1Q7YU 1H3HA 3V7CA 1M90R 1I5OB 1CKNA 1QG7A 2F3IA 4BWGB 5C4XH 3FC3A 1SF9A 2Q2UA 1U4MA 4BDYA 5KYWA 2SNMA 1HQMC 3OYAA 4K6LA 1TH7A 3URGA 1YJWA 2L2PA 4GLAC 4M7AB 3WDNA 2ROLA 3OW7A 4M1UB 2RDHA 3FRPB 2F0UA 1YWOA 4JI2L 3MP1A 2PZTA 4HIDA 1MHNA 4HJ8A 2CYZB 3M56A 1NEBA 1YN8A 2AUKA 4PV1C 1BR9A 4OMNA 1HNWQ 3F2BA 4K5WA 4RMOA 5LJ5f 3TU4K 3CCEQ 4K2LA 4FNFA 2L11A 4S3SA 3HOWH 1K73C 1PTOB 2FINB 1VS0A 2AHOB 2XDPA 2TSSA 2XHCA 2VQEQ 1CA6A 3V05A 3TP5A 1ABOA 2JXBA 3RNUA 4R1JA 1JU5C 1AWJA 2FRYA 5J1ZA 5GANj 1VQPA 1LPLA 2NVTB 5GAN7 3ASKA 4A4EA 2LXJA 4HCEA 1XMOQ 1U1SA 2FVUA 3OSVA 1I81A 1TWGB 3G6EQ 4XT1B 4MZTA 4PMBA 2K5IA 5HGTA 1RLPC 4RCCA 4F88A 1MMDA 5JAVA 3TN2A 2O5JC 3AT1B 1FMKA 5DEHA 3W5OA 2ZXOA 1GXIE 3T53B 4A63B 2P0KA 3QBYA 4BBRG 1KQSS 3NPPA 4F7UF 5IH2A 1YITT 4NXML 1LTTD 4M75F 3F1ZA 1VQ8Q 1HD3A 2DL7A 3TEEA 2P0PA 1FR3A 3I91A 3GNGA 1G3SA 3EFOB 1Q81U 4L6TB 1X56A 2CZ7B 2K52A 1VQ5T 4QVCA 1T3SA 2CP6A 4HT9A 1SNOA 1I6HB 3QUIA 2EQUA 3HKSA 4C92F 2SNSA 2CWAA 1NE8A 1A63A 1IYJB 2E2HH 4XQJA 1I94L 1C0AA 3MEWA 3BZDB 3J81c 1WQWA 4F7UB 3M55A 5GAOl 2B2WC 3MZ5A 4JRIA 2KQ3A 2QEJC 4DFAA 3DM1A 2GTJA 3CQTA 2LXKA 1HSQA 2PVGB 2E2DC 3DEOA 1QWYA 4QIWB 2KROA 1STEA 3VR4A 3K59A 4DK3C 3CMEA 2R5MA 1HPCA 2ATWA 1YNND 1PCXA 5KH6A 4JCVE 1QVGA 4XTZA 4C5IA 4C92B 1J9OA 2K2VA 3G48A 1U8RA 2F0WA 4J9BA 1VQ4T 2ASBA 4M7AG 2JJQA 4GY5A 3SWNA 4DR4Q 4A4FA 2KVQG 2LZ6B 1QVFA 1SLJA 1BBWA 2NZ1D 3HEJA 3QOJA 4LF9Q 5IXBA 5LMUQ 3CBMA 3Q6SA 1PZID 2X4WA 4POGA 1D1CA 5I2YA 4DR1L 4UP8A 2PO4A 1X6OA 4BY1B 1CSQA 2L0AA 1M3BA 2KYMA 2TMPA 3J81E 2DL4A 1X3GA 2VNUD 4JI1L 4C3JG 1HNZL 1V8QA 3GTOH 4LUEA 1HXYD 5CO7A 2IJ0A 3MTSA 4F7XA 1M1GA 4DNTB 3DLMA 4X9DA 3AU7A 1X43A 5J3BA 3LWUA 5JEAJ 4DAYA 1VQLQ 3HOYG 1K8GA 2KMTA 2A36A 2J06A 3A55A 3PMFA 4RHSA 2NVQB 4LDUA 2OXPA 4BE1A 3PGGA 1X32A 1W6XA 4M7DA 4FW2A 1BO0A 3BJUA 2PNHA 5HKCA 3BYTB 1XMQQ 4KMUC 3K8AA 1JMCA 2MUYA 3S1NH 3PNWC 3SE0A 3CCVA 2MQHA 2Z8LA 1QZHA 2DKGA 2J6KA 3PUYA 2I2LA 4ULLA 3CPWP 1HUNA 4YWLA 3Q8DA 2KECA 1VQKT 2WV6D 3NPFA 3VS2A 2RDGA 1KRTA 3T1YQ 2EOTA 4ELYC 1ENAA 1HK9A 3IKJA 4JOIA 2IPKD 1GRIA 3TDQA 4DV5Q 1WJQA 3QZ5B 5J22A 4OO1H 4M78A 2KK4A 3VYSA 4X9CA 4QQ6A 3OS1A 3EG1A 1YVCA 3NP8A 2NUTA 4DA2A 2EYOA 4HAEA 1M30A 2D0QB 1MI2A 4LD6A 2EGCA 4C1NI 2E5LL 3RKYA 4QQDA 1PHJA 5CVIA 4EGVA 2Y90A 4A3FG 2JK8A 1N27A 1G2BA 1NEGA 5GJWB 1DM0B 1FNWA 4RHRA 5CV9A 1EYDA 1B3AA 3SWNC 1BOSA 4LF4L 3S14B 4DR6Q 3CCSA 1GUNA 4UPAA 2O2LD 5KIXA 5CKBA 2JTMA 2B8FA 2QQRA 3F70A 4C92G 1QVPA 5C3WA 4AFQC 1VMCA 1HFNA 2UUCQ 1VQNT 3OMCA 2X4XA 1NNXA 4QVZA 4RGNA 4K11A 2LJ0A 2R7ZB 4L5SA 2LJ1A 5KYIA 1KDBA 1C9OA 1DZ1A 4BY1G 3REBB 5IGFA 5GAMg 1CFMA 1K1ZA 4ORZA 3V8JA 4JI5L 1YBYA 2E6NA 1HTLD 4Y7NB 2VXFA 2WSFE 1IGQA 1E7ZA 1VQOT 3N52A 3TS0A 4RCBA 3NHNA 2RD1A 5LJ3f 4OP0A 1SMYC 4LXCA 1NYGA 4C8QC 1PRTC 2SDFA 3L1AA 4KHZA 1RL2A 2IVWA 1HR0Q 3P75A 1VOMA 1TS4A 4XT3B 3EFXD 5LJ5h 4XDXA 3DKMA 2JA9A 3QB3A 4F17A 3VU3C 1Z47A 1TU0B 4RFBA 1IBLL 1U4RA 3M9BA 1N33L 1X65A 1MJEA 4JOIC 3TSSA 1SE4A 1UWVA 2F4VL 3AEVA 2JXMB 3OSOA 4PFPA 2K4YA 3FJ5A 2AK5A 2HUGA 4M78C 1WHLA 4IIOA 5FU7C 4PJMA 2IHFA 1XPRA 5GADC 2QEXA 4DUYQ 4J9IA 4A3DB 1HUMA 1PC0A 1HNXL 1LTBD 4J1MA 4TRDA 1GBQA 1DOMA 1SNDA 2VGMA 3INZA 1K4US 4LF6Q 4LF8L 3CQZH 4JI4L 1UNSA 1WTHA 4A3EB 3NBIA 1OEBA 2MWPA 2QQAA 5IYDG 4HMJA 2FPDA 1ENCA 3MEUA 1EYCA 1JE5A 3K6OA 2JVVA 2EY5A 4RH6A 4DV0L 3J81i 2HMAA 5LJ5e 1N8RR 2NZOA 1X9NA 3L42A 2B8AA 4M77E 3L2WA 3JCMJ 3K80C 2DXBA 4OWTB 1SFOH 3GTLH 1JRIA 2DJQA 4WFN3 3BVZA 4OX9L 1E22A 1STGA 4B3MQ 2RQWA 3I55A 1Q1EA 1YNZA 5K5PA 4H7BA 3PMTA 1KQ1A 2EYFA 2P5ZX 5EBDA 4C0FA 3UE0A 4AFZC 3OYBA 3D31A 4A3LG 1VQFA 1CKOA 5GAMf 1CHPD 1NYFA 4UAIA 4IUQA 1SSHA 4O2DA 4DV6Q 5NUCA 4XU1A 4IQZA 2FG0A 3K58A 4DV4L 2AZSA 3OTOL 3K57A 2R7ZG 1Y71A 3CPWS 1B9MA 1IB8A 3REAB 1KABA 1FYNA 1VQ7A 3PCOB 1G91A 3KJOA 1UHFA 4AG1C 2EKOA 2FXQA 2RQUA 2LMJA 1OU9A 2HDMA 3NE5B 1Y1WB 2I5MX 2CS7A 3VR5A 3HOZH 1S5CD 2H3JA 5AJ3Q 2BKDN 3EH2A 1K28A 4LF8Q 2FZGB 3TRZA 4J6XA 2LTOA 3W2DA 4KH0B 3PVLA 1ET6A 3VUBA 1KXLA 3S16H 2XI9A 1AZGB 3RESA 2D62A 3MEFA 3C1FA 1M1KR 3J7YW 2I0QA 5KYYB 3KXTA 2P4TA 3L2ZA 1KD1U 2CKZB 2XSCA 3S17H 4DR5L 1N36Q 3CCSQ 1PMRA 3GTGH 1CKAA 4WJ4A 1JCKB 2X6GA 3DUZA 4NL3A 4BXXH 3ZEHA 5FLXL 3GTKB 1RAHB 4OGEA 1M5Q1 4JW0A 2QQSA 2XDBA 5DM73 1PSEA 1C4QA 3JB9D 2F3VA 2JJ9A 4YHHL 2DXCA 2QTVA 5M5XB 1I0CA 4A3DG 3JCMd 2V8IA 2SEMA 3A1PA 4C0DB 2DVJA 3LYIA 2PQAA 4H02A 2ZPGB 1SMYD 1RTOA 2L3PA 1I8FA 1JXOA 1UHCA 4C8QD 2JA5B 5IYBG 3SEBA 2OF1A 3S1MH 2CP5A 4A3JH 5KYXB 2DBMA 3M0RA 1NLOC 2X6LA 2LSSA 2F1MA 4A3EG 5GJVB 4LFAL 3CCMQ 1TWBA 2QGQA 4OWXB 4B3SL 3CD6Q 4E7IA 2PUKB 3UDGA 2MFIA 4M78D 2H3EB 4M77B 4D8KA 1K73U 3KUPA 3RMQA 1VQ9Q 5C44H 3TSWA 1NTGA 3M58A 3JAME 2HD0A 3G6ET 4C2MB 2L89A 2NYSA 5GAOm 3CC2A 1N9SA 2WAQE 3LGFA 4KUIA 5E7NA 3QWXX 4HJAA 1AEYA 1TY0A 2PI2A 2YLBA 3FHWA 1IRXA 2AKKA 3JV3A 4GLVB 3M0PA 1SPKA 1BKBA 1ZUKA 5GMKi 1HZ9A 3S9WA 1Y69U 3M3YH 5ELEA 1Q86U 2ENMA 2DTIA 3M85A 1ML0D 2JE6I 1SDFA 3MEHA 2F2WA 1P8LA 1PV4A 2K6AA 2IIMA 4PJOC 5EJWA 4KY6A 3SDZA 1C48A 3R93A 5FKAC 4FXGC 4LWCA 1Y1WG 1VYTA 4AG2C 2IG0A 4FF1A 2ZPEB 1K83B 3ONAB 1HYOA 5CC4A 3I70A 4E2FB 1VQ6A 2RHSB 4XTWA 3D7SB 4DV7Q 4KRTA 3QWYA 1RI0A 3KUFA 3A8HB 1GFDA 2NBFA 2X4JA 1G51A 3CCQA 5ELBA 3I55Q 3EG2A 1D8LA 3X3MA 4OF1A 1OXSC 2GQIA 3OA6A 4QF4A 3FLGA 2N3SA 1KQSA 1WTPA 1BI2A 5M5YB 5JJLA 4DOVA 1Y96B 2V4DA 4UP7A 5LJ3h 5A0GA 1MV3A 1CI3M 2F0DA 4A93B 1SEBD 4YCUA 1IBKL 4H44C 2NLUA 5K36G 3A8OB 1LVKA 2SOBA 3CW2C 2OTLA 2Y4YA 2BUDA 1IHZA 1G83A 3A74A 2JA5G 2HQEA 3W1GA 3I3CA 5GMKl 3RLOA 3S24A 4PKCC 4DBRA 1QKXA 1FL0A 2L12A 2M16A 4I65A 1GCQA 4LFCL 1WTRA 1VQLT 3EGXA 3T56B 2WB1E 3ICEA 4WTOB 1S3OA 3AFQA 3P7JA 4M77G 4FCYA 1Q90A 2E2JH 2VC8A 2QDLA 3IFTA 1M1KU 2K79A 4MNOA 2VUMB 1RI9A 3F2UA 4JBWA 4LDYA 5E4WC 5LL6S 1AT1B 5E4XA 2OTJA 4PLLA 1F2MA 4X3SA 1EQRA 3GIBA 1ZBJA 3LH5A 1F9RA 1SXTA 1YJNQ 4B6MA 3OS0A 2RF4A 1I07A 1EYGA 5LJ3e 1CKNB 2JW4A 4OHJA 1EWCA 1HXDA 2HCCA 4KY5A 1PRMC 3I72A 3MHBA 1LJOA 4L63B 3RZDH 4KTAA 1MMNA 4KY7A 1M2OA 1STNA 1TWCH 2ICEC 1RAEB 2KCTA 4JI7Q 2AUJD 4P73A 3S1QB 3T51B 1K8OA 3BDCA 1J5EL 3GQBA 1LTGD 4N9TA 1YCYA 2RMOA 4BI8B 3CC7T 4RG1A 4TKOB 2K3XA 1OPKA 4X34A 4L5QA 3RUZA 4IUVA 3OYMA 4DR3L 2I5LX 1QUQA 2A37A 1EQQA 2ZTCA 4DR7L 2A19A 1WYXA 3MWYW 4X64Q 5GAMh 4FIBA 1N34L 2UXBQ 1JJ2P 2DJGC 3FKIB 5ELNA 3MO8A 2VB2X 1AWWA 2GNCA 3WWVA 4KUDK 3L2QA 1K3RA 3H0HA 4FSXA 1GXDC 1NPPA 3CMAA 1SYEA 1I4HA 4ME5A 1GO3E 1YHQT 1LT3D 3OYKA 4TQUS 2F0OA 5A0LA 4K5XA 3HRSA 1LABA 2UUBQ 3MFGA 2NYZD 3I4LA 3WVEB 2ZCFB 4B9XA 4ZTFA 4PJOD 2JYOA 3J7AV 3JAMi 2CH4A 1IREB 3OS5A 3TQ7P 1B3QA 4L5GA 1JICA 1KC8C 4KN7C 1ICFB 3SGIA 2JS0A 2JA7B 1GCQC 2JTFA 3X24B 1Q12A 3TP6A 2CHBD 3I73A 3PO2H 1EIFA 3HOUB 1KAWA 2JEAI 2DM1A 1KHIA 1F9QA 5EKLA 2XRSD 2KHIA 3WOEA 3K7AH 2EQJA 3CCUQ 2F5TX 5D7UA 2LFNA 3ZFJA 5TSSA 1WIEA 5GAMe 1BK2A 3IRBA 4IOCA 4AQYL 4L59A 4Q5VA 5GANd 2RN8A 4KGVB 3CXCA 1J5EQ 2QK0A 1JQQA 1KAAA 2WB1B 1EY6A 5CV6A 1S5FD 4FT2A 2XMFA 4FP5D 1L0XB 3VA5A 3HRTA 1M90C 2Q8TA 1DOKA 2HL3A 4A3BB 1SNCA 1MNEA 4BA2I 1G8XA 2M02A 4AMCA 3TBIB 2AQ3B 4BBRH 3H6MA 3E9IA 5G3LF 2K9GA 4FF3A 4ZUIA 5IT9E 4XXEA 5M3FB 4BY6B 2QQBA 2M51A 4C5EA 4MMLA 4KGXB 4ZK9B 3WXMB 5KYUA 2ZXRA 3KBXA 4JYAQ 2OAWA 3J81j 4JI6Q 3DLLA 1UEBA 2X3WD 5D14A 2ENBA 3PUWA 2LT4A 3RERA 4PZ8A 1DD2A 3DEPA 1JWMD 2L9HA 2NUCA 1SEMA 5CR2A 3SWNB 3L2PA 1E6HA 2A28A 3PUVA 4HJ9A 1SRMA 2J6FA 2QDYB 1QCOA 1K0SA 4X3KA 1VDZA 1UG1A 2CQAA 4GS3A 1R4PB 1QQJA 4JS5A 1DYQA 1UTIA 3G71Q 3C46A 2F2VA 3G4SA 3S15B 1JJCB 2AMCB 3M4YA 1VA7A 3JB9F 4CRIA 1H9SA 1BQQT 3FKIG 1TWAB 2E1HA 3PFSA 3H0FA 5IIFA 1J8IA 1IW7C 4B3RQ 2VZAA 5FLXc 4DAYB 2J7IA 4C8QF 2OTJQ 1PRTF 4GNXB 4FM4B 1ZHIA 1AFPA 3H41A 3M0QA 1WCMB 2NTTA 3MXGA 5KNBA 1VQAA 4GKKQ 4M7DB 2RK1A 1KJWA 2ICIA 1KFZA 2EGAA 3UDCA 2DIGA 3N5BB 4C3JH 3OYYA 3OIPA 1B34A 1LNXA 3U50C 1PTOH 4M78F 2Q8IB 2QYZA 2W10A 1LO5D 1Y1VB 1JQYD 1PRTB 4ESRA 1YNJC 1EZ8A 2KRSA 1RLQC 1TXQA 4HKEA 3ERQA 2JA7G 1M3CA 4C0ZA 3MXNB 3HOUG 2KCMA 2KXDA 2VXWA 1Q95G 1SRUA 2IX1A 2NVTH 1CSPA 5ISRA 5C0XG 2R5AA 1GM5A 1C8CA 1TWGH 2EXZA 2R93H 4FYDA 1I5LA 3FEOA 4UDUC 3UDFA 1Q81R 2QA4Q 4PFOA 3H0IA 3CCRQ 2YT6A 2WB1G 4RKLA 1N33Q 4A3MB 2NUTB 3CMAQ 4A4GA 4E47A 6AT1B 1K9MC 2CSIA 3P8BB 2BDNA 2K01A 1IXRA 2VB3X 2XGTA 3SK8A 4DK1A 1S72A 4JI8L 1A0IA 2COZA 1VQMA 1I4RA 4RGMA 5KEEA 1GHKA 4IUNA 1UE6A 2E74C 4J9DA 4ALPA 4FW1A 2F0QA 4X66Q 3LX0A 5M3FG 3H94A 1QCBD 1PLFA 2D2CC 2B63B 1BU1A 4AFUC 2GQVA 3OW2S 3KF6A 3VS3A 3OOCA 4RA8A 1I6HH 2VB6A 4OB0B 1K8AU 1SYDA 2JMCA 4EIKA 3NWSA 3GLXA 1XNRQ 4OMMA 1B44D 3F2CA 1JWUD 2E75C 3JB9I 4PFZA 4KJOA 4A3FH 1WTQA 3C94A 2AT1B 2LRQA 3MP6A 3NK9A 2EWNA 1GBRA 1WXTA 2JSOA 2NVYB 2DD4A 2LX7A 1NAPA 2ES2A 3J80c 3K5MA 4JI0Q 3CCMT 2PW7A 4YCWA 1LM0A 3CD6T 2RHIA 3I35A 2B2TA 5IGBA 1AP0A 2F0FA 3DWQA 1L0WA 4JI3Q 2FL7A 2FYKA 5GMKj 1RADB 1CM9A 4K5VA 3QIIA 3QG1A 1VQ9T 2EJMA 2QTXA 3OYEA 2QF7A 2KBNA 2ATCB 5KNDA 3RDVA 3M4OH 4PNOA 1P92A 3EN2A 4K0KQ 4KBMB 2COWA 5AFWA 4E7LA 4XU2A 2E41A 2KXCA 1JWSD 4QY7A 3CF5A 4YCVA 3VKIA 4EQ5A 1J3TA 4DBFA 1KLGD 3ZYYX 1CHQD 3TMEA 4X65Q 1WCMG 4BY1H 2L15A 2B3GA 4JI8Q 3RMHA 2FZCB 2HHHL 2OCEA 4M7DG 1TT2A 1VQEA 2KQWA 4F7UE 2RJFA 2B2YC 5T1IA 1PRLC 5IOCA 4M75E 2KOLA 4GN3B 1YZ6A 1XNQL 1X2KA 2NN6I 1KQ2A 3M53A 1R8OB 3V7RA 4QIWE 3J80E 3U9OA 3CCJA 1Z6HA 4J9EA 1HFGA 3HRUA 2RQXA 1Y1VG 2KCCA 1ZA2B 1ZBXA 2B2WA 3T4AC 1YJ9T 3RD4A 2NVQH 1WXBA 1IW7D 4C92E 2HIVA 2EZVA 1JT8A 2ROTA 1MUZA 2LCSA 2EQSA 2YHTA 1LOJA 1I1JA 2L1BA 3FEWX 4A3KH 3G4SQ 3CP0A 3JCMg 5GMKm 4B3TQ 2LJ3A 2LX9A 1X27A 3L2RA 1B7YB 3ITPA 3NFCA 3QKJA 1SSFA 3PT9A 2RM4A 2F0HA 2O4XA 4JC0A 4UP9A 4A3MG 1EUJA 5C4ZA 1HCZA 1D1AA 4KK7A 1PH1A 1YNJD 2ZT9C 4PJNA 3OYJA 3UT1A 4A4IA 2E70A 2ID0A 1G291 3EQLC 3S2DB 1S5DD 2Z4IA 1J6QA 2ZPHB 1M9SA 4ZNXA 1K0XA 4JS4A 2B63G 5AYFA 1SJED 3D4WA 2CUBA 2EY6A 3SK5A 3K5NA 4IJHA 4RGTA 2BIVA 3VJPA 2QGGA 4ME3A 2EYPA 2BA0A 2B2TC 2HHHQ 1V9PA 3A7LA 2F52A 2A3LA 3PQIA 4MZ9A 3I8ZA 1EY0A 3AB9A 1HQRD 2BZ8A 4IFDH 5FJ8G 1LT6D 1OXXK 5GAN4 3CXCP 5C3EB 2OQ0A 1O7IA 2M1HA 3MEVA 1SAPA 5A2QE 4LUOA 4BS9A 4XYQA 4GKJL 4PJOF 1STYA 1YHBA 3RBBB 4OGQC 3MFYA 4ZLTF 2EY1A 3UDXA 4JI2Q 1JR0D 3UF4A 4A3LH 2PCFB 1TWFH 3ME9A 4ME7A 2J0TD 3S2HB 1VQMQ 4JRPA 2HQHA 4WORA 2EYWA 1GJXA 2DO3A 1BIBA 1R4QB 1FJGL 1M4ZA 3DWPA 1WX6A 3M9QA 1YJNT 1ZSGA 3H6ZA 2HDAA 2PW5A 4M75B 3I90A 3UA7A 2PYKA 1M2VA 4O1NA 5E1FA 4IIMA 1QWFA 2YSQA 1PH2A 4Y7NH 3VYUA 4BY7B 1X01A 1IO6A 4N0AC 1GCPA 1QKWA 2MO0A 2PVOB 3JCMf 2EYZA 4JG2A 1I50B 4ZGDB 1CT1D 1PSFA 4M8AA 1QZGA 1PNJA 3G6JB 1DONA 3RZOH 3S3NA 4OB3B 1EY4A 3ND8A 3URYA 4DV3L 2PQAB 1PFNA 1W2BA 1JO8A 1A62A 1KNAA 1YIJA 2A6HD 2RHUA 1FGUA 1H9RA 1XTCD 3T1HL 3X25B 2FRWA 2IL8A 5I9PA 1GOZA 1SHGA 1YI2Q 3KBGA 4NXMQ 2LC4A 1NR2A 1RAIB 4XYOA 2K5HA 1PM3A 3NEMA 4V0BA 4A3DH 2KA7A 2K33A 2EBPA 4Q0FA 1JEGA 2JA6H 3MKDA 2XVSA 1FYCA 4R55A 2M9UA 3BVMA 2F0NA 1YWPA 1LUZA 5CV8A 3U4VA 5IYBH 1GUWA 2KY9A 2YU9H 5IYCG 4A3EH 1FJGQ 1I94Q 4JLGA 1VYVA 1U9RA 1TWHB 5ELOA 2A7YA 1I4PA 2RF0A 4CJ1B 3ND9A 4A3GH 4IPHA 1BCMA 2PQEA 1JORA 1NM7A 3QO3A 4RTXA 1YJWQ 1D5ZC 4A4HA 2EYJA 2L4NA 5I6WA 4XTYA 4C8QA 3CCUT 2F0LA 5GAGC 2RBMA 3HOVH 5C4XB 2XNAC 3H91A 1SJHD 3I5SA 1Z9ZA 3L3OC 1E1OA 3IAYA 5EQ0A 4IOAA 5C3EG 3J80i 4U673 1WHKA 2K2MA 2GN5A 4K2KA 4JV5L 2QASA 1PA6A 4QW2A 2V8JA 4J9HA 4KHPL 4A3IB 1VQHA 2DUDA 2F0TA 2VS1A 4Z02A 3JCMb 3MHXA 1E2WA 2FEIA 3HHTB 3IL8A 2WKCA 1PXUA 2RJEA 2A74C 1JB7A 2ECZA 3T9NA 4DR1Q 5FO9B 2F0KA 2HAXA 2CWPA 1TUGB 2FZKB 2JTEA 1VQPQ 2QQ9A 1KD1R 2CT3A 4ZAIA 4JI1Q 4Q5WA 1HNZQ 5IHNA 4IALA 4F7UG 1LT5D 5FLMH 1EY9A 4M75G 8ATCB 4EMGA 1IHVA 2JOYA 2E5KA 2CSQA 4ILWA 1Y1WH 3GTMB 1ESRA 5FO8B 4RCNA 1MD2D 1WD0A 1WHJA 2E6ZA 2HSPA 4LDXA 2HQLA 1OX8A 2MOXA 2QILA 4BY7G 4NXNL 2DTOA 2JA8H 4ZKCB 4L6V5 1UE1A 2E12A 2X4YA 3RKXA 3A8KE 1OU8A 1H8KA 4O0AA 1C0MA 4GLXA 1A0NB 1AD5A 3IFDA 1ZYRD 3G71T 4QUFA 5M5WB 3KF8A 3UI2A 4DN4M 2DVEA 1GUTA 3CC4A 1A6XA 5CORA 2F03A 4R4OA 1QNUA 4KHVA 1WA7A 1D0ZA 3GTKH 2EGEA 1VUBA 3RMSA 3TVTA 1ZSZA 4BD3A 2BH8A 4EX5A 3EGXB 4F16A 2RHZA 2EPBA 4CC3A 1K73R 5GANg 2YYZA 4IPCA 3OYLA 3CAMA 3Q24A 4OMPA 5CK9A 1EX4A 3PGZA 4ANJA 4IUUA 2DLPA 1M3AA 3OYCA 4P72A 4JBKA 3VV0A 2XU8A 1S1NA 4C5HA 3CMEQ 1STHA 2E5LQ 1STBA 5FU6C 4DK6C 1U1TA 2ZPIB 4JJNK 3CEYA 4FL6A 1PZJD 2K57A 4HCBA 1SMXA 2FFKB 4QCLA 5CKFA 1DCZA 4BBSH 4LF7L 2LCLA 2YLCA 4LF4Q 4RGOS 2P84A 2RVLA 5IWAL 2BA1A 3SXHA 5C4XG 1Q86R 4XQNA 2RDFA 2QA4T 3C4SA 3CCRT 2NVXH 4PMWA 2X51A 2YRDA 3I56A 4EDUA 1YNXA 3QO2A 4RKUE 2IX3A 1MMAA 1Y8NB 5I9OA 3CCLA 4XU3A 4A3IG 4WF2A 3E19A 1Q82C 3SK4A 1V76A 3NQTA 1O9SA 4KJNA 1R77A 2WACA 3PE0A 1XNIA 1AW7A 1D0YA 1U4LA 4IFDJ 1NJIC 2R6GA 5KYLA 1RIPA 2Y0SE 2YRVA 2GCXA 3CPFA 4OGCA 2XRQD 4JI5Q 1H92A 2RQVA 4P74A 3GTOB 4VUBA 4M7AA 1EU4A 2YXYA 2VYTA 1T3LA 2CP0A 8AT1B 3CCVQ 2K04A 1QW1A 3Q1JA 1K83H 3ZL7C 1X2QA 2EVBA 4DAVA 1S40A 5GAN6 5JVG3 2YWWA 2MIOA 2RB6A 4JZ4A 2B2UA 3I2ZA 4HIMA 1IBLQ 2F0PA 2CW0D 5A0DA 2RJDA 4GZYC 3TP7A 1ZSZC 1S5BD 1TXYA 4LNQA 3P8HA 4RAUC 2F1LA 4JLIA 3LNNA 4HA8A 3S1NB 1FWZA 3H3VC 2LNHB 4DAMA 2UU9Q 4LFBL 2K03A 2QAZA 1RD9D 4DGZA 5M5YH 5D6WA 1RAFB 4FSSA 4DEXA 2ZTEA 4OONA 3E2UA 3JCMh 5GAHC 1HNXQ 3QR8A 1BYMA 2X69A 2E64A 3DB3A 2LY7A 5HK0A 1Q3LA 3RN2A 3FVQA 2E8GA 2UXDL 4PNYA 2A68C 2K28A 4IO9A 1WTVA 4JI4Q 1L1OA 2G5DA 1OULA 4GN5A 5CAIA 4PJOA 3I7FA 3GPLA 1EZZB 3NHHA 2K32A 4P75A 2F0VA 3NTHA 3I4MH 1QVGP 1Q8IA 4X3UA 4AT1B 2D6FA 4DV0Q 1WJJA 5GQOA 4BB7A 4C3IB 1BI1A 2CZ0B 3R6NA 4MTNA 5KYUB 3H0GH 5FRNA 3KOJA 2D1XA 1BCPC 2K4KA 4LDVA 1ICWA 4KD4A 1Y07A 3OBYA 4BUGA 3OS2A 1W2BP 1QVFP 1R9TB 4OX9Q 3EHRA 3MPUB 2DD5A 1EYAA 1K0RA 3QXEB 3P8DA 3E9HA 1FNUA 3E9GA 1Z9QA 1X3PA 3L2UA 1H9MA 2EXDA 1KIXA 2ZZDA 1YITA 3UPUA 2NUPA 1E7OA 1SYFA 1DJ7B 5F2DA 4O6JA 3CCET 1VQCA 3I5RA 3I4OA 3CRKC 4IPGA 4DV2L 4LUZA 4N8X1 4CKBA 1BF4A 4ZN1A 4CI0C 1VQ5A 4M7AC 4PK4A 1PDQA 3L9AX 3OHXC 1TTHB 5KGUA 3OTOQ 4DV4Q 3K7UC 2Y0SB 2QDBA 4DR7Q 2GA4B 1H9SB 4LAAA 1N32L 4ID6A 3S1QH 2AQ1B 4DAPA 1I4XA 3OSSC 3CRLC 2WKDA 1GUOA 1EL0A 4ZGJB 3QYGB 2B2UC 2DAQA 3OYHA 1F9PA 4OO1I 3EBEA 3C2PA 2KI7A 3MAQA 3TCJA 4KLKA 4JRKA 1PTOC 3GV6A 5IP9H 4LUDA 5JJKA 4QL5A 4QUCA 3D6CA 1AWOA 3FKIH 5IXFA 3NUCA 4DR5Q 2G6FX 3OB9A 2XWJB 2QEXQ 3HP3A 3PV0A 3KJPA 2UUAL 2O9SA 2HNIA 2KBTA 3L2VA 1VQ4A 2E4HA 2D0PA 4J8QA 1QCNA 2EPDA 4FF4A 1UJ0A 1PH5A 2CZ6B 1VQ8T 4OELB 3JCMX 2C5CA 3KLSX 3RR6A 1G3WA 4BA1I 1L1OC 3OMGA 2MO1A 4YHHQ 4MHEA 4RUGA 1DOLA 2KE9A 1AEXA 4IN3A 1EFWA 2YTVA 1RJTA 3QDFA 3S3OA 2HL5C 4DV2Q 2JA7H 3H3VH 3OYNA 4N4HA 1Q7YC 1OYXA 4DBQA 2A1AA 5CYUA 4HJ7A 2CUDA 3QHSA 1MSHA 4X62L 1ILPA 2RO0A 3CQZB 4LFAQ 4CJ2C 4GOPA 3JRZA 1UEAB 4B3SQ 1ZQ1A 2QW7A 3U23A 5KYNA 5CIUA 1JOKA 5KCHA 2OQKA 2YTXA 3CHBD 2DTHA 2EQKA 4JK1C 1EU3A 4R4QA 5IODA 4N8FA 4ODGA 5I2MA 2ZAEA 2LQWA 4IURA 9ATCB 1KDCA 3PSIA 1JB0E 1AZPA 4C3IG 5GAEC 1SFOB 3GTLB 4QQGA 4JDSA 1HRJA 2ZJQA 1F2YA 2A08A 4RG2A 4UHVA 1XTDA 4G7HC 2RH2A 1VQKA 2A68D 3SHLA 4UC4A 5FO7B 2Y4XA 1DJRD 1D3BA 5GMKh 3EIVA 3J7ZC 4HIKA 2UUAQ 2Z4HA 5BR8L 1B8AA 1YI2T 5EG2A 1VQ7Q 4JVZA 4R4TA 4ELZC 3SD4A 2VVKA 4K14A 3FPUB 2R92B 2Q2IA 2GTOA 2L5QA 5GAN2 1DGSA 1UGVA 1STAA 2AQ2B 2Q2TA 1MBYA 3W1BA 1I3QB 1SE3A 2Y0SG 3P20A 5EC7A 1BCPD 3KLSA 4J15A 5GAOq 4CDEC 5I11A 1VF5C 3M4QA 3MA2B 3V8LA 2LKVA 2NWMA 1A3UA 4RTTA 1FMVA 3PUXA 1O7ZA 2K1BA 1S5ED 3PUZA 1YJWT 1ZEQX 1GFCA 2HEQA 1TWAH 1BNZA 4M7AD 1VQGA 2ZJPA 3H8ZA 2W0ZA 2EFIA 3JCMW 1PYSB 1Q81C 3SB2A 4B9WA 1WI5A 3GTGB 5KYWB 2HKNA 3OWFA 1N9WA 4Y52H 3EA6A 2MPXC 1VQNA 1EFID 2XTIA 3P1HA 2FMMA 4ZCKA 3PF5A 1WCMH 4O42A 1OZ2A 1QVFS 1D1IA 2AKWB 4GOPC 2JM9A 3HOYH 1PYWD 1AWXA 3S6WA 4EMHA 3VYRA 4U68A 1IBKQ 4ZKBB 4KULA 1BI3A 1PTOD 2BZYA 5BR8Q 1NBWA 1MGQA 1PWTA 2RA2A 4QJFA 1G2TA 2RHYA 5M9OA 5LJ3d 1Y1VH 1VQPT 4NKLA 2O4XB 3KYHC 1VQOA 1SBBB 4IPDA 1MHWC 5GANh 4G7ZC 3STBC 4O5VA 1EOVA 4LFCQ 5LJ5j 2JMAA 2EYQA 3CC2Q 3GNFB 2EY2A 1ASZA 1RAAB 1PH3A 3GTQB 4A3MH 2ESWA 1K8AR 1AH9A 2J6OA 4KT0E 1A2TA 4M7DE 1B1ZA 2PNRC 1AE3A 1U3OA 3X3NA 4JZ3A 3TSZA 4ZYSA 5M3MB 2EQIA 1EQTA 4A93G 3DMUA 1CQVA 1WXUA 4LUVA 2I0NA 4AH6A 1BUVT 2DBKA 1VIEA 4KKSA 5L37A 2KSSA 1QCFA 3HFOA 4HSPA 1PH4A 2B63H 1GL5A 2XDDA 2GBQA 1VQBA 2R92G 2DL8A 2AZVA 4P2CB 4LMQD 1ENFA 3HOXB 1K76A 2CH4W 2F4VQ 1LTSD 3BG3A 2XWBB 4RKBA 2B86A 1VQ6Q 2M9VA 2ZTDA 1TU2B 5FJ8H 4DR3Q 1CZGA 2BOSA 3MVVA 4M78E 2F4IA 2KEAA 4KGZB 5IGGA 1PD0A 3CMET 1N34Q 3J81L 3CCQQ 2V1QA 4NDXA 3VS0A 1B70B 1VIFA 1QVCA 1WD1A 3MEAA 4HTHA 1ABQA 4TVAB 2VUMG 3GV3A 1QOHA 3GTJH 2WIIB 4D8DA 4C92D 1SKUB 1ZA1B 2N88A 1M4VA 1M2VB 1C6VX 1UECA 3WOFA 5CCAA 3X26B 1RHPA 4PG3A 5DM7R 4UY8C 2YRCA 3A8LB 2D0OA 1D2BA 2RPNA 2EW3A 2OTLQ 2MPMA 1ARKA 2X35A 2A0FB 4HVVA 2PU9B 1G5VA 1PHTA 1WYDA 2F0GA 2XIWA 3LGJA 4RCOA 1NE3A 2KHJA 2G9DA 5KCOA 1N9RA 3VS6A 2FJ2A 2JS2A 4CDDC 3VRZA 5HK3A 3JCMQ 2MMPA 1D1KA 4RG8A 1Q82U 2MP1A 4KV6A 1TS5A 2JN4A 5J26A 2K5QA 5IAYA 4NPSA 2D8JA 4MTKA 4FO2A 1NSNS 2L3RA 3V2TA 4AQYQ 4FYXB 2F0IA 3R6OA 4LD9K 4MMKA 1NJIU 1SR3A 1U5KA 2IPOB 2F0JA 3GTPB 2UXCL 1MV0B 1OOTA 4ZTJA 3CCVT 5DLOA 1P16A 3C1EA 1WNLA 1RF2D 1IBML 4G7OC 5E3FA 5HY6A 4OWWB 2KCNA 2BZXA 1AHJB 2Z6BA 2E2IB 3BS1A 1E24A 1CTMA 3DM3A 3QPHA 4WJWA 5KYXA 2DETA 4ZGEB 3MP8A 1BBXC 2VY3A 2OJ2A 3Q23A 1UDLA 5EPJA 5M3MG 5LMNL 1HTPA 3LWHA 2N49A 2AKLA 4C8QB 2ZXPA 4HR7B 2CFMA 2QKIC 3STBD 1VQJA 2RJCA 3S2DH 2KUMA 5IYCH 4M77A 1FXXA 2XK0A 1I4GA 4H13C 2B2YA 1UGQB 3LH0A 2M0OA 3UDIA 3H9NA 4TVRA 1OO9B 1QJOA 4CKEA 2VQFL 5IGEA 3PIPA 1V43A 1PVOA 4F04B 1VQOQ 1X54A 1BIAA 4M78B 5FLXE 2NZHA 4K8IA 5FU7B 4EQNA 3HOXG 4DKAC 3H09A 2PPBC 2HBPA 4CJ0B 2DILA 4R4CA 3CCST 2EE1A 4RTUA 5C3EH 4A3BG 2LQNA 3G6EA 5C0MA 4C3HB 1KQSP 1JJ2S 3S1RB 4DV1L 1OI1A 5C4JB 2WSEE 1XOVA 1BI0A 2VGNA 1SE8A 1A15A 1K9AA 1T5EA 4XAXB 1PH8A 3S2HH 4IZ8A 3CPWA 2L8DA 1NR4A 1FMWA 2JT4A 7AT1B 1F2LA 1LT4D 2B29A 2RI5A 1SE2A 1UFFA 5FWCA 3PIP3 1CKBA 5EAYA 1UE5A 1QP3A 3CBOA 4HEDA 5D3DA 4P5NA 1F77A 3NTKA 5IY0A 4DR2L 2XICA 3KF8B 2C0IA 1KRSA 1G3YA 1XXGA 3PF4A 1X6GA 1H641 5GAOp 3JCMP 3VS4A 4A4KA 5GAN8 4RWSC 2FHDA 4AIMA 3PO2B 3CKIB 3M5AA 4C0DC 5GAN3 4V2SA 2CVRA 1ZSZB 3K7AB 5DY9A 3M57A 4J9FA 2A6ED 2GFAA 5I4DA 1NBEB 1FX7A 5GAN5 1Y96A 3G7LA 2NB0A 3MCAB 3L7ZC 1C7YA 1B2TA 4LDWA 1EWHA 2J05A 1W6KA 3KLRA 1UGPB 1V29B 3I9QA 2A6HC 2QEXT 2I46A 1HNWL 1WDXA 4M77C 5LJ3j 3FJPA 5I2SA 3LGLA 2HIXA 4HCKA 1BCPF 1EZ6A 4KI0A 3JB9G 2K5WA 1BBUA 1NMGA 4P71A 1YEZA 4L5RC 2HCKA 1KC8R 2HD3A 1WTOA 2BDOA 4HCCA 3NWTA 1RABB 2X9HA 2R3ZA 4C8QG 2R7DA 2WFWA 1SSOA 3PO3B 1LTLA 4QKUA 1V1PA 3GBQA 4DK0A 4QMGA 1XMOL 3CU7A 2CP3A 2DFUA 5IE8A 1GD7A 4N0AA 5I21A 5EPKA 5KE2A 2ZPFB 4M7AF 2DX1A 3SFMA 4N9PA 4NP5A 2A73B 3OBWA 1VQLA 3OPOA 4M78G 1E1TA 3MXPA 3A5UA 1VYUA 3WVDB 2L5TA 2LMCB 4R0KA 1WHHA 3I55T 3VS1A 2HQXA 1JXMA 2L3SA 4Z89A 4ZQ3A 2PZWA 2IT1A 1QWEA 1BDOA 4C3HG 2YUQA 3H3VI 1IYUA 1QP2A 1PTOF 4QT7A 2RCNA 4A3IH 3I4NB 2C0OA 4PQXA 2NN6G 2J4XA 5IYDH 3EFSA 1UE9A 1SHFA 1X75C 2X3XD 1IZ6A 3M0UA 3X28B 3META 4LN2A 2KDSA 4J7IA 2QXFA 4N4GA 1A2UA 4EQOA 1VQ7T 5LL6X 2PI2E 4X6AH 1XNQQ 2EYLA 4C3JB 2HSEB 2DY8A 2M2LA 1F9SA 2LVMA 3VR3A 3CC7A 3K0XA 5D6XA 1L2FA 5A35A 2YDLA 1IXDA 3VDYA 3GTMH 2KRMA 5GAMj 3K5OA 1WQ7A 5H1SE 3S14H 2DNEA 4OMQA 1WTXA 3D4RA 3PVQA 2MNAA 5CKEA 3X20B 2H5XA 1NY4A 3PO2G 2K7AA 3LW5E 2K05A 3A7AB 3KFVA 1CKMA 4C1NK 1S4ZA 2ZJRA 1MGSA 5FRMA 3NBHA 3FDTA 1TIID 1N5ZA 1S72Q 1D5XC 5FWBA 1UAPA 2R93B 4TSSA 4RMFA 1XJVA 2DJFC 5M5WH 1L1OB 4J8OA 1B50A 4DR4L 4DPGA 1EIHA 1ZYRC 2EYXA 3EGDA 2R7ZH 2JM8A 2A5HA 1YHQA 3T13A 4LF9L 4PJOB 5LMUL 1G6PA 3G1JA 1Q86C 5JVH3 4J9GA 2OEOA 2LQKA 4FF2A 3JAML 2EYYA 1X6BA 3JCMc 1RDPD 2VXEA 5DLQE 1WLPB 4GBQA 1O7YA 2Z6KA 4PZ6A 1SNMA 5JOBA 4A75A 3RN5A 2J7ZA 4IJLA 2F2XA 2K5VA 2QG9B 5HCKA 3PIOA 1TS9A 5CKDA 2KGTA 3O5ZA 3NXWA 3RLNA 2L55A 2V1CC 2MK5A 3PO3G 3MJXA 3E5SA 2CQOA 4HXJA 2NUPB 1OXTA 4DEYA 4A3FB 2OWOA 1F2ZA 1N8RC 1XMQL 2BE5C 4DXGA 3OYFA 2N78A 5DAUA 1EIYB 3PMIA 4M77D 3RKWA 1M8AA 2KEEA 3VYTA 3G7ZA 2D9TA 3HTRA 4GKJQ 3CC2T 1D5MC 1RKNA 5C6SA 2RI3A 4LE9A 4OEMB 5FK9C 5HGQA 1X3QA 1K9MR 1O78A 2G9HD 2PZUA 3T1YL 2K14A 1QILA 1NPRA 3M59A 4Z88A 3V7SA 5IP7G 2DE0X 3HGBA 4EMKA 3M4OB 4DV5L 3GOXA 4HVUA 3A8GB 1CSKA 1T5XD 3I4NG 5C5LA 3PIO3 1K8MA 2MJ8A 3UE1A 1B7TA 4BE0A 1KDAA 3CCJQ 2RI2A 4V190 3EG9A 3K0YA 2XG8D 1F1BB 1HR0W 1LV9A 1HZCA 3RLFA 2V26A 1KC8U 1XPOA 3KLWA 1WI7A 1H95A 5IN1A 1OZ3A 1O75A 4GLMA 2O88A 2XD0A 4ATOA 3A8MB 2M00A 2BTTA 2AIRB 1H9KA 1PD1A 2UU9L 2IX0A 4DU9A 3OYIA 5L23A 2JN0A 1M1KC 1C1AA 1VQ6T 1HZAA 1UB4A 3NMZC 1HZBA 2H1EA 4AYBE 2K50A 4DR6L 2FPFA 2VASA 4DV3Q 5LHY1 3CCQT 5JEAG 2WSCE 4K8JA 2ABLA 2N8NA 5CGKA 4A3KB 2Q8RE 3AMUA 2GVBA 3T1HQ 2NUZA 2HBWA 2CW0C 4IUPA 2GFUA 2MCNA 1M90U 3QJYA 4J6WA 3OIQA 2UUCL 2R93G 3U9SA 4GOPB 1PKTA 2QI2A 2Z6KC 5LJ3g 1ET9A 2JP1A 1L0YB 4PJOG 2KAFA 3A0JA 1UJYA 2KYBA 3BZCA 3MXNA 3AFPA 1B4OA 4NOYA 2BH2A 4DBHA 3HOWB 1JBMA 4CBVA 1D09B 3C12A 1IHWA 4A3CG 4GN4B 3HS0C 4PMCA 3R8BA 2OTLT 1PH6A 2R7FA 3KDFA 3Q0AA 1ACMB 1XJWB 2SRCA 4XTXA 4BY6C 3M0TA 3CC7Q 3TREA 2ED0A 2MGSA 4DUZL 4X1VA 2DK3A 1KTKA 1NG2A 2LNVA 3J7AF 1YHAA 1VCIA 1D3BB 1HR0L 1ESFA 2F0EA 3FP9A 1LLRD 4XTCS 1GHJA 2LQ8A 3RR5A 1X55A 3EJIA 4C3IH 3QYHB 4D6WA 1UGRB 3FDRA 3D8GA 3HFZB 3BW1A 2A8VA 4EMKC 3CXCS 5ELCA 4HCSA 1R9TH 4RTWA 1IKLA 4JV5Q 2OTJT 3HG9A 2O9VA 2VW9A 5M5XH 2K5NA 4KHPQ 4DUYL 5K36H 3NGPA 1YHQQ 4Y91A 2BE7D 5EKKA 2L0CA 4XQQA 1DXMA 4EQPA 4MDWA 2KVMA 2JA5H 3EG3A 1TWFB 1ZKOA 5D3IB 4OMOA 4KN4C 4LF6L 2HKQB 2F5KA 2HT1A 1XX8A 1SYBA 3EGUA 1GVPA 2BE5D 4YWMA 3TZUA 2E2HB 2DPPB 4KKTA 1PG5B 1T0HA 1ZLMA 1Y14B 3SEMA 4GNXC 1MJCA 3ULLA 3BY7A 3OYGA 3QJ6A 2K75A 1XQHA 4M7DC 1TS2A 4C2MH 2MI6A 4H0LC 5C4HA 4Y28E 2B39A 4NXNQ 1YIJQ 4AYBB 3CCMA 5IHIA 1H9JA 4BACA 3CD6A
chains in the Genus database with same CATH topology
4DUZQ 1MIUA 4XQ3A 4B3ML 3CMAT 1QUQB 1VQ9A 5D6YA 2LDMA 3ULJA 1CUKA 4IFDI 4A3KG 3F2DA 1KG1A 3ZBDA 3OY9A 1K9MU 1PYBA 4DV6L 2ZPBB 4E7JA 2VV5A 3AHUA 1VQDA 1PFSA 3U58A 2CCZA 3HOWG 4XU0A 2ZM6L 5AJ3L 2DJZA 4PZ7A 1YJ9A 1WFQA 3NELA 2RHXA 4DA4A 4J83A 2AWNA 4IKFA 4J6YA 3L0OA 4JUVA 4E7KA 4LF7Q 1N36L 4NS5A 1HJPA 5GANf 5LJ5d 5IWAQ 1JJ2A 3HL8A 3ULPA 4A93H 1IL2A 1Q8KA 3OW2A 1NZ9A 4LF5L 3HP9A 3AYHB 2VL6A 2CZ1B 4WJ3M 2R92H 2WP8J 3RUXA 4XK8E 4QQBX 1I3QH 2EQMA 5KE3A 4II1A 2DIQA 1G3TA 2ZM6Q 1SN8A 3G4ST 3ZJYC 2VUMH 1AE2A 4AYBG 4HCZA 3JCMe 2CGHA 3E9FA 4F7UA 4M75A 3LWIA 4QGUA 3HKZE 2DZ9A 4LFBQ 4FU6A 4N4IA 1K8AC 3JAMc 3F8TA 2GF7A 4HIOA 2JNGA 3BDLA 4C92A 1YJNA 4M7DD 4OXPA 2UXDQ 4C5GA 4LF5Q 2AWOA 3UWNA 4M77F 3VUZA 1W4SA 2JA6G 2GVAA 1B34B 3VYGA 2LT1A 4ZN3A 4DV7L 2E10A 3M7NA 4A3GG 2MWOA 4C0GA 1SROA 4YY3L 3GTQH 3E1SA 1E3PA 1S72T 1VQMT 1WJRA 5M3MH 1XPUA 3C95A 3HOUH 2DGYA 4OO1G 1N32Q 2YTYA 2LCCA 1GKHA 3HOXH 2F69A 2C35B 2JEBI 4L5TA 3KF6B 3M4PA 3HFNA 2RK2A 5FLMG 4A3BH 3CCUA 4M75C 3HOVG 2KENA 3GP8A 3GO5A 5M3FH 2JA8G 1Z9FA 4IFDG 4OB1B 4C92C 2XIDA 3M54A 1BVSA 2K5LA 1N8RU 4QVDA 1X3EA 3BZKA 1VQIA 4YY3Q 3TS2A 4PL6A 2PQWA 4JI7L 2AHJB 1T9HA 3FB9A 3CCJT 5GAOn 4X62Q 1W3SA 2FB7A 1OXUA 3S15H 4X64L 2DEQA 2G3RA 2UXBL 1PH9A 3LLRA 4OB2B 2EJGA 1QVGS 3GTPH 5JJIA 5GMKe 3G71A 2E5QA 3TQYA 1WGSA 4BBSG 3EAEA 2E2IH 1W2BS 1I4K1 2UUBL 3JB9H 1I5FA 4DQ2A 2IHEA 3J7A5 2DZCA 2MAMA 5L8RE 4MZPA 2R57A 3QSUA 3KFUA 2JQOA 4YWKA 4MZMA 1WPYA 2ALYB 4JRQA 4XTVA 3BU2A 1WOCA 1M1FA 4C3HH 3ERSX 3S1RH 3RIRA 2QA4A 3CCRA 5C4JH 4HT8A 2C06A 4C8QE 3HKZG 3K81C 4JBJA 5FROA 1V1QA 4JYAL 2PVDB 1N6AA 1WJSA 3JCMV 4JI6L 5GANe 3NBHB 2NVYH 2ZGWA 4M75D 4XIGS 5IT9c 2JZ2A 4R4IA 3HOZG 4YTLA 1U0LA 2EJ9A 3GD7A 5LMNW 2E65A 5GAMd 1H3ZA 4OVAA 3FIFA 5CQYA 1LYLA 1YIJT 2IY5B 3I4MG 4R56A 4B3RL 4BXXG 3DB4A 4J7FA 2CKKA 2EAYA 3H0GG 5CQXA 4GKKL 2WAQG 2EIFA 1ASYA 2PUOB 2XKOC 3BDUA 3B6YA 4A3JG 1UE7A 3CBPA 3PO3H 2OAUA 3QDRB 4IUTA 4APVA 4EMKB 5C44G 3H15A 3GF5A 4JBMA 1UGSB 2JUFA 5C0XI 2PMZE 3NENA 4M7DF 1X3FA 5IP9G 1Y7XA 4NL2A 5IP7H 5C0XJ 1OTCA 3VYHB 4BI4A 4FDBA 4X66L 3I4NH 5FU6B 3CCEA 2EJFA 3M4GA 3PTAA 1FVIA 1KL9A 1XNRL 3LX7A 2MF2A 3HSBA 4BE2A 3O8VA 3HPWA 2Z0SA 5GROA 4E7HA 2P0QA 2VUBA 4JI0L 1NMFA 1Q46A 4J5YA 4GLKA 3QZ9B 3JC66 4JI3L 3ER0A 2V8KA 4PLIA 2UXCQ 3EFRA 1IBMQ 3OQ5A 2I5HA 1D7QA 3A5ZB 4XTUA 4M7AE 3CC4T 3KDFB 5J39A 2DXUA 4K0KL 1MKHA 2Q2HA 1VQ8A 2O01E 1EWIA 1M8VA 3GDEA 1PH7A 3V8KA 4X65L 2RHQB 2K3YA 5LMNQ 4A3CH 3BFMA 4DNIA 4BY7H 3D0FA 3TEHB 4HJ5A 2R58A 5LJ5g 1I50H 4A76A 4POFA 4OMFB 1Q1BA 2VQFQ 2DXTA 4NB3A 3OYDA 1KHCA 4MDXA 3JB9J 4EPCA 4B3TL 4DOWA 4PJOE 4DV1Q 1OXVA 3I56T 3E0EA 3CCLT 2VQEL 1A8VA 4BDZA 3NTIA 1YI2A 5GAOr 4A54A 1TWHH 1KD1C 4LW1A 4FT4A 3S3MA 4DR2Q 2K5FA 5CKHA 4BI3A 3JSCA 1HH2P 2YV5A 3U4ZA 3AQQA 3HOYG 3FRNA 4A53A 1Q7YU 2F3IA 3V7CA 1CKNA 5C4XH 3FC3A 2Q2UA 4BDYA 3OYAA 1TH7A 3URGA 1YJWA 4GLAC 4M7AB 4JI2L 3MP1A 4HIDA 1MHNA 4HJ8A 2CYZB 3M56A 1HNWQ 3F2BA 4RMOA 5LJ5f 3TU4K 3HOWH 1K73C 1VS0A 2AHOB 2XDPA 2XHCA 2VQEQ 3RNUA 4R1JA 5GANj 1VQPA 5GAN7 3ASKA 4A4EA 2LXJA 1XMOQ 1U1SA 2FVUA 3OSVA 1I81A 4MZTA 2K5IA 4RCCA 3W5OA 1GXIE 2P0KA 3QBYA 4BBRG 1KQSS 4F7UF 4NXML 1YITT 3F1ZA 4M75F 3TEEA 2P0PA 3GNGA 1G3SA 1Q81U 1X56A 2CZ7B 2K52A 1VQ5T 4QVCA 4HT9A 3QUIA 2EQUA 3HKSA 4C92F 2CWAA 1NE8A 1A63A 1IYJB 2E2HH 1I94L 1C0AA 3MEWA 3J81c 1WQWA 4F7UB 3M55A 5GAOl 4JRIA 2LXKA 2PVGB 4DK3C 3CMEA 2R5MA 2ATWA 5KH6A 4JCVE 1QVGA 4XTZA 4C5IA 4C92B 2K2VA 3G48A 1U8RA 1VQ4T 2ASBA 4M7AG 2JJQA 4GY5A 3SWNA 4DR4Q 4A4FA 2KVQG 1QVFA 1SLJA 1JJGA 1BBWA 4LF9Q 5LMUQ 3CBMA 2X4WA 4POGA 4DR1L 4UP8A 1X6OA 1CSQA 3J81E 1X3GA 4JI1L 1HNZL 3GTOH 5CO7A 1M1GA 3DLMA 4X9DA 5J3BA 5JEAJ 1K8GA 2KMTA 4LDUA 4BE1A 3PGGA 4M7DA 3BJUA 2PNHA 5HKCA 1XMQQ 3K8AA 1JMCA 3S1NH 3PNWC 1QZHA 3CCVA 2MQHA 2DKGA 3PUYA 2I2LA 4YWLA 3Q8DA 1VQKT 1KRTA 3T1YQ 4ELYC 1HK9A 4JOIA 4DV5Q 1WJQA 3QZ5B 4M78A 2KK4A 4X9CA 4QQ6A 3OS1A 1YVCA 2D0QB 4LD6A 2E5LL 3RKYA 4QQDA 1PHJA 5CVIA 4A3FG 2Y90A 2JK8A 1N27A 2UU9Q 3HOVH 3SWNC 4LF4L 4DR6Q 3CCSA 4UPAA 5CKBA 2JTMA 2QQRA 3F70A 4C92G 1QVPA 2UUCQ 1VQNT 3OMCA 2X4XA 4QVZA 4L5SA 1C9OA 4BY1G 5GAMg 3V8JA 4JI5L 1YBYA 2E6NA 2VXFA 2WSFE 1E7ZA 1VQOT 3TS0A 4RCBA 2RD1A 5LJ3f 4OP0A 4C8QC 3L1AA 4KHZA 1RL2A 2IVWA 1HR0Q 5LJ5h 3DKMA 2JA9A 1Z47A 3VU3C 1N33L 1IBLL 3M9BA 1X65A 1MJEA 4JOIC 1UWVA 3AEVA 2K4YA 4M78C 5FU7C 2IHFA 1XPRA 5GADC 2QEXA 4DUYQ 1HNXL 4LF8L 2VGMA 3INZA 4LF6Q 3CQZH 4JI4L 2MWPA 2QQAA 5IYDG 3MEUA 1JE5A 2JVVA 4DV0L 3J81i 5LJ5e 2NZOA 1X9NA 3L42A 2B8AA 4M77E 3L2WA 3JCMJ 3K80C 2DXBA 4OWTB 1SFOH 3GTLH 1JRIA 4OX9L 1E22A 4B3MQ 3I55A 1Q1EA 3PMTA 1KQ1A 4C0FA 3UE0A 3OYBA 3D31A 4A3LG 1VQFA 1CKOA 5GAMf 4IUQA 4O2DA 4DV6Q 4XU1A 4DV4L 3OTOL 2R7ZG 1Y71A 3CPWS 3PCOB 1VQ7A 3KJOA 2FXQA 2EKOA 2I5MX 2CS7A 3HOZH 5AJ3Q 2H3JA 3TRZA 2BKDN 4LF8Q 4J6XA 2LTOA 3VUBA 1KXLA 3S16H 2XI9A 3RESA 2D62A 3MEFA 2I0QA 3KXTA 2P4TA 3L2ZA 1KD1U 2CKZB 3S17H 4DR5L 1N36Q 3GTGH 4WJ4A 4BXXH 4NL3A 3ZEHA 4OGEA 1M5Q1 2QQSA 2XDBA 1PSEA 3JB9D 4YHHL 2DXCA 4A3DG 3JCMd 2V8IA 4C0DB 3LYIA 4H02A 2PQAA 2ZPGB 4C8QD 1I8FA 5IYBG 3S1MH 4A3JH