1KHIA

Crystal structure of hex1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
147
structure length
147
Chain Sequence
GSASQTVTIPCHHIRLGDILILQGRPCQVIRISTSAATGQHRYLGVDLFTKQLHEESSFVSNPAPSVVVQTMLGPVFKQYRVLDMQDGSIVAMTETGDVKQNLPVIDQSSLWNRLQKAFESGRGSVRVLVVSDHGREMAVDMKVVHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Hex1
publication title A HEX-1 crystal lattice required for Woronin body function in Neurospora crassa
pubmed doi rcsb
source organism Neurospora crassa
total genus 25
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2001-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1khiA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1khiA02
1WCMH 1TWFH 1KC8C 2F52A 3CW2C 3KBGA 3NEMA 5C4JH 1HR0L 4A3DG 3UDXA 4JYAQ 1UE6A 3I4OA 4A3CG 1K83H 2IX0A 1E22A 2E2IH 1IBLL 4A3BG 2XTIA 2YYZA 1Q82C 4K0KL 4H02A 1QVGS 1M1KU 2OTLT 1QVGA 4JI2Q 4DUYQ 1O7IA 4GN4B 4DV4Q 4RG1A 1L1OC 2I5LX 4C3HH 4Y52H 1Q86U 1JJGA 3CPFA 4DV3L 4YTLA 1QUQB 4GKKL 2QEXT 1N34L 1L1OB 2CKZB 1QVFA 2I5HA 3GTOH 1YJ9A 2ALYB 3S1NH 2K75A 1X65A 2RF4A 2AWOA 5M5WH 1PH9A 5DLQE 5A2QE 1VQKA 3TEHB 1HNZL 4O0AA 1VQ6A 3Q8DA 1SN8A 1YITT 4YCUA 2ZTDA 1PFSA 4NB3A 4A3FH 2Y0SE 4EX5A 4YWKA 1PH7A 1L0WA 2ASBA 3T1HQ 2LQ8A 4A76A 1PHJA 2OQKA 3S1QH 5IT9c 3F1ZA 3TREA 4R4CA 5IYDG 5C0XI 2ZJQA 2R7ZH 4TVRA 1HH2P 3KJOA 5LMNL 1K9MC 4JI6L 4LF6Q 4LNQA 1CKOA 1SROA 5IYCH 5DM7R 5GROA 3T1YL 3I4NH 4AQYL 1NTGA 3AFQA 2BA1A 3L7ZC 5FLMH 4GNXC 1W2BS 2B3GA 2Q2UA 1W2BA 3CC2T 2F3IA 3SGIA 4AYBG 3MEFA 3PUVA 1Y1VH 1FJGQ 1VS0A 1YNXA 1YBYA 1PA6A 2UXDL 4DV5Q 4OX9Q 4GNXB 1Q81C 1H95A 1HZ9A 1OXSC 1VQAA 2KCTA 2VQFL 4NXMQ 2IG0A 1X55A 4LFCQ 3PCOB 1C7YA 1YHQT 2R6GA 1GM5A 1VQOT 1HNXL 1P16A 3J7ZC 2OWOA 4HJ8A 4A3FG 5IAYA 1E3PA 5HY6A 1EFWA 4GLVB 3EN2A 3JAME 4DR7L 3G48A 4IFDI 3I56A 3K7AH 3CCET 3I2ZA 4TQUS 1NBWA 1YIJA 1YEZA 1Z9FA 2UXCL 4C2MH 3UDGA 2R7ZG 4RG2A 2JUFA 1Q1EA 4XTCS 4GOPA 4QIWE 3I4NG 1KD1U 1KHIA 4R4OA 5IP7H 1HNWQ 1N33L 2VY3A 4QQBX 1N32L 3CMEA 5FLMG 2JEAI 1VQ9A 1AE2A 4JI5L 3RR5A 3U4VA 2OQ0A 1QVCA 1HJPA 2CWPA 1PV4A 2N3SA 1FL0A 1LUZA 4UP9A 2ZM6Q 3HKSA 3GTPH 1I94Q 2IHEA 3CC4T 1NJIU 2JJQA 1SSFA 2K4KA 1FVIA 2L3RA 1X3FA 3LH0A 3AQQA 3CCJA 1PH6A 1PH5A 2MWPA 4LFAL 4JI8L 1XNRQ 4DPGA 2JNGA 2KHJA 3GTJH 3OTOQ 4JCVE 3CXCS 4J15A 3CP0A 3ERSX 2LCLA 3CXCA 3CD6A 3KDFA 4LUZA 3HOVG 2D62A 2R93G 4DV0L 1CKMA 2YTXA 4HIOA 4IPDA 2KENA 1NPPA 4YWMA 1CUKA 1EYGA 4X34A 4DR2L 1SLJA 1QZHA 4JYAL 2XHCA 4WJ4A 3S2HH 5IP7G 3J7A5 2Z6KC 5M3FG 3CCVT 1Q7YC 4BA1I 4UPAA 1VQ5T 3G71T 1I50H 1WFQA 3CC7A 1SMXA 3KYHC 4DUYL 1HR0W 1Q12A 1C9OA 4JI2L 4GKJL 1JE5A 4BY7H 1VQPT 1S3OA 5AJ3L 4LF5Q 4B3ML 1WJJA 3HOXG 3BJUA 4QGUA 4DR1Q 3CCMT 3S14H 3CCQA 4NXNL 1AH9A 1VQMT 1M1KC 2VW9A 4A3CH 3NENA 2R92G 1V43A 4A3BH 4YY3L 1PH4A 1N9WA 4A93H 2AKWB 4BBRG 3KJPA 3PSIA 1YJNT 3FKIG 3KOJA 3JAMi 2HT1A 4JI7Q 3RZDH 1BBUA 3GD7A 4MZ9A 3T1HL 1U0LA 3RNUA 2PNHA 3G4ST 2OTJA 1K3RA 1DGSA 1TWCH 2PI2E 1A63A 1VQFA 1KIXA 1S72A 3E9IA 4OWXB 4OO1I 1B70B 1HZBA 3A5UA 4DV6Q 1IBKQ 1XNQL 3PGZA 3GTKH 3ER0A 5LMNW 1YHAA 4ALPA 4OWTB 4OO1G 1KL9A 1KXLA 4DV5L 5GQOA 4OX9L 5IT9E 5BR8L 1GO3E 4GNXA 3CCLT 5IYDH 4JV5L 2ATWA 3CCRA 4A93G 2YV5A 4B3SL 2MFIA 3S15H 4DR4Q 4DV7Q 4B3RQ 2EQSA 4GS3A 4LF8Q 4EQ5A 3J81c 2VZAA 1XTDA 1Q1BA 2LXJA 1D7QA 1OXUA 1VQCA 1C0AA 1VQJA 2JA9A 1XMQL 4KHZA 3F2DA 4A3KG 5J3BA 1I6HH 3K0XA 4IJLA 3LGJA 2BH2A 4PG3A 4IO9A 1PH2A 5GAHC 1HNWL 4BBSG 4HJAA 1JJCB 1N36L 1Y1WH 3GDEA 1V1QA 3GTMH 5LMUQ 1EWIA 2E2HH 4IJHA 1BVSA 3TS2A 2D0PA 1KRTA 1YJ9T 4DKAC 1HZCA 3DB3A 2ZM6L 1VQKT 1NZ9A 1KD1C 1NMFA 2D0OA 5EAYA 1VQ6T 2IX1A 3U4ZA 3KLWA 1VQ4A 1X56A 1A0IA 2OCEA 4IPGA 4JI0Q 3I4MH 2E70A 2ID0A 3OYYA 1VQLA 4MNOA 1IZ6A 1UE5A 2N8NA 1SFOH 4WJ3M 1U5KA 1OXXK 3D31A 4L5TA 3OTOL 1S40A 1AE3A 2K14A 3PUXA 2ZJPA 1T9HA 2E8GA 5IP9H 1VQ8A 2K52A 1EQQA 1EIYB 2ZTCA 4LF9Q 2F4VL 2VQEQ 2JEBI 2JK8A 4LWCA 1M90U 3HOYG 4HJ7A 2MNAA 1MIUA 4JBJA 2K50A 1NPRA 1X3GA 4HJ9A 4JOIC 3CC2A 1Y1WG 4DR6Q 4HJ5A 2C35B 1KC8U 4X66Q 2JVVA 1A8VA 2WFWA 5C3EH 1RIPA 2QGQA 4R1JA 3ZJYC 2VS1A 3KF8B 3K7UC 2LXKA 5ELOA 3RN5A 4B3TL 2MWOA 3K81C 4P74A 1YHBA 2KHIA 4X65Q 4DV1Q 1JMCA 4DR1L 2RHQB 5IYBH 4DK6C 4OXPA 5C4XG 3M4PA 5H1SE 3I4MG 1PH1A 1SRUA 1YI2A 1HR0Q 2AHOB 4UY8C 2QA4A 5M3FH 2B63G 4OONA 5ELNA 3I56T 1N8RC 1CKNA 2HIVA 2N78A 3RLOA 1XNIA 5J26A 3WWVA 3S16H 1YIJT 1KRSA 3E9HA 3M9BA 5IP9G 2V1CC 3M4OH 3S24A 2PQAA 1J5EQ 5M5YH 3ICEA 1IBMQ 1ASZA 1LM0A 3HOXH 4JI7L 1QZGA 2JA8H 3HOWH 2JQOA 5K36G 3M4QA 4YCWA 1K8GA 4KHPQ 4X64L 2CWAA 2UUBQ 4X62Q 3CF5A 3CMET 4OWWB 1PH8A 1IXRA 4APVA 2LVMA 1VQ9T 1VQBA 4P75A 5GAEC 2ZJRA 4PZ8A 2E5LQ 3LGFA 1OXVA 5FLXE 1VCIA 2KBNA 4DUZQ 2JA5G 2R92H 4PMWA 1N36Q 1X6OA 5M3MH 4BY1H 3PF4A 4R4TA 5C3EG 4BBRH 1HNZQ 4A3MH 3CC4A 3FKIH 1L2FA 1XPRA 2WAQG 1IBKL 3CCJT 3L0OA 5IYBG 4DNIA 2NVQH 2R7DA 1K9MU 3I55A 4QQDA 3UDFA 4POGA 3FHWA 3CMAA 4YHHQ 3RZOH 1VQ7A 1P8LA 2CCZA 4DV2Q 2JA7H 1Q8KA 1PH3A 5LMNQ 2MO0A 3CCUA 2AWNA 3L2PA 3BU2A 4DV4L 4DV7L 3CQZH 1X54A 4B3RL 1Q81U 4AQYQ 2JA8G 4QJFA 1ASYA 2K5HA 3HOWG 1UEBA 3PUZA 4NPSA 4X6AH 1QUQA 4UP7A 5LL6S 2UU9Q 1L1OA 5FLXc 4DR3Q 3CC7T 1GKHA 2NN6I 3BZCA 2WB1G 3H15A 2A19A 1Q86C 1YJWA 4R4IA 4BY1G 5M3MG 2VQFQ 2HHHQ 3PO3H 4JBKA 1VQGA 4A3MG 3KF6B 4L5QA 3D0FA 1VQNA 1GD7A 2NN6G 3CCQT 3PO2H 3G6EA 3I7FA 4UP8A 4A3JG 5FJ8G 3J81E 1VQHA 2UUAQ 1IL2A 1TWGH 1XPUA 4MTNA 5HGQA 4GOPC 3DM3A 4JI6Q 3B6YA 4DR5Q 4A3KH 3P8BB 2GVBA 2JA7G 4XIGS 4LF6L 1J6QA 1XMOQ 1JT8A 4GOPB 1UE7A 3PUWA 1PYSB 3UE0A 1K8AU 3UE1A 4JI0L 2YTYA 4LF7Q 4BBSH 4A3LH 3CCSA 1PYBA 4POFA 4A3GG 3A5ZB 2MI6A 1N32Q 2IY5B 2R7FA 2ZTEA 1SE8A 3AFPA 3G4SA 2OTJT 1JJ2S 2BA0A 5IWAQ 2YTVA 1FJGL 1JJ2A 2CFMA 3GO5A 1R9TH 4CRIA 4LFBQ 3KFUA 1K0RA 2PI2A 2VQEL 3HKZE 1S72T 4NXML 2N49A 4KLKA 4QL5A 1E1OA 4LFCL 2WAQE 1Z47A 3MXNB 5IE8A 3PO3G 1PVOA 3HOZG 2NZHA 2UXBQ 4LFAQ 1EIFA 3A74A 4JI8Q 3HOVH 3PO2G 4LUOA 3KDFB 1I5FA 1NY4A 1M90C 1M1GA 3FP9A 3RLFA 4BXXG 2EIFA 3CCLA 4DV0Q 4DV1L 2JE6I 5E7NA 2MO1A 3CCRT 4X65L 2VL6A 2OTLA 2B29A 3S1MH 4HIDA 3BZKA 3VDYA 4DAYB 2IHFA 3HOYH 1VQDA 1EQRA 1LTLA 4JI4Q 4DR2Q 4A3LG 1CSPA 2DUDA 2KDSA 2QEXA 3GTGH 1B8AA 2VNUD 4L5SA 4LW1A 4Y7NH 4A3EH 3TQYA 2WB1E 4RMFA 3U50C 3AEVA 1IYJB 1A62A 1V9PA 2NZOA 2E2JH 4GKJQ 1J5EL 1IBML 5AJ3Q 4B3MQ 1I94L 1MJEA 1YITA 4BY7G 1W3SA 5C4XH 4KHPL 2UUBL 4X62L 4LF4Q 3NELA 1EOVA 4GLAC 2RHSB 4NXNQ 1QVFS 3F2CA 2UUCQ 2E5LL 1XNRL 2B63H 4DUZL 3DB4A 3ULLA 4YY3Q 1NJIC 1BBWA 1UE1A 2IT1A 3AYHB 4A4IA 1VQ4T 3HFZB 2I0QA 3J81i 3EIVA 4JI1Q 3J80E 1VQLT 1WCMG 2A1AA 2I5MX 4AIMA 2A8VA 5JJKA 1K73U 1TXYA 2CQOA 2Q2IA 4HIMA 3H3VH 1E24A 4YHHL 1WI5A 1FGUA 2JA5H 4DV2L 1VQ8T 1EUJA 3PUYA 2E6ZA 4JC0A 4A3EG 3W1GA 2HQLA 4A3IH 2JA6H 1E7ZA 3PF5A 1VQIA 4LF5L 2K5NA 4GN3B 3UDIA 2Z6KA 1YHQA 5IY0A 4JI3Q 1VQOA 5C0XG 1Q82U 2GN5A 4FDBA 1XNQQ 1I3QH 3S2DH 4IOAA 4IOCA 4HIKA 1Q46A 4IPCA 3STBD 4PZ7A 3F8TA 5JEAG 4DR3L 2K5VA 2UU9L 1MJCA 3A0JA 5BR8Q 1IBLQ 3CCEA 1XJVA 2EXDA 2HHHL 4K0KQ 1HZAA 2R93H 2RCNA 3H3VI 4B3SQ 2NVTH 1MKHA 2Z0SA 3KF6A 2NVXH 3J80c 4R4QA 3U58A 1YI2T 2DO3A 2UUAL 2NVYH 4YWLA 4DV3Q 2VUMH 2QA4T 3JC66 3NBHB 3W1BA 4C3IH 3F2BA 2MQHA 1N34Q 2BH8A 4GKKQ 1XMQQ 3GTLH 4DR5L 2XGTA 3PIPA 5M5XH 5C0XJ 3TS0A 1XMOL 3RN2A 4IFDG 4A3IG 2KVQG 3LGLA 1G51A 2FXQA 3HKZG 5IYCG 4LF7L 2JA6G 5GAGC 5JEAJ 2Q2HA 4DV6L 1BKBA 1RL2A 4A3JH 5FJ8H 5IWAL 2CKKA 3IRBA 4JBMA 4LFBL 1Y1VG 3RLNA 1D8LA 1K8AC 4ZN1A 3CD6T 4ME3A 2HIXA 3K8AA 3ULJA 1G6PA 3H0GH 1G291 3S1RH 3M85A 1WYDA 3M7NA 1UWVA 5JJIA 3OW2S 1WOCA 4DR4L 2UXBL 1NMGA 3OW2A 3T1YQ 4LF8L 4A3GH 3I55T 3CAMA 3TRZA 3EBEA 4GLXA 1SR3A 3JAMc 2VUMG 3CMAT 1CSQA 1VQ7T 3DLLA 1TWAH 1NE3A 3CCVA 4AH6A 4IFDJ 1VQ5A 3G71A 3E0EA 3J80i 2UXDQ 2Q2TA 3CCUT 2F4VQ 3S17H 4O2DA 1VQPA 3ULPA 2ES2A 1VQEA 4JI4L 5C44H 3HOZH 2L15A 3J81j 1HNXQ 3CCMA 4JV5Q 3STBC 4AYBE 2DGYA 5LMUL 5GADC 1VQMA 3HOUH 1LYLA 1Y14B 4DAMA 4DR7Q 4BXXH 1TWHH 1JB7A 2GVAA 1OXTA 3J7AF 1OTCA 1YJWT 4B3TQ 2AMCB 3K80C 1YVCA 4A75A 1N8RU 1X9NA 3GTQH 4YCVA 2UXCQ 3H0GG 3M3YH 1YJNA 4L5RC 1VQNT 4LF4L 4JBWA 4A3DH 3G6ET 4IPHA 2Y0SG 3W5OA 2UUCL 1N33Q 1CKNB 4PZ6A 1XPOA 1GVPA 4LUVA 2H5XA 2LSSA 4BA2I 4ZN3A 4JI5Q 1KQSS 1KQSA 2PQAB 2PMZE 1YZ6A 4JG2A 4TVAB 2WP8J 4LF9L 3CPWS 4JI1L 3CPWA 1B7YB 4KI0A 3CCST 2JOYA 4X64Q 2KCMA 4C3JH 4DK3C 4GN5A 3PV0A 5C44G 4DR6L 5JJLA 4P71A 2G3RA 3HOUG 4P72A 4QY7A 3PIOA 4X66L 1E1TA 2YU9H 1KAWA 1K73C 4P73A 4JOIA 1Q7YU 4JI3L 1X3EA
chains in the Genus database with same CATH superfamily
3J80L 1WCMH 2NUPB 3M4GA 2EY5A 3CW2C 3NEMA 2RDFA 3BDUA 3RUZA 1VMCA 3I4OA 5EKKA 2E2IB 1O80A 2IVWA 2B2WC 4PV1C 2E2IH 2XTIA 4PJOC 1MNDA 1BIBA 2QYZA 4FCYA 4H02A 1QVGS 4JI2Q 2OTLT 1SYGA 1KDAA 2C0IA 3MFYA 4GN4B 4RG1A 1L1OC 4C3HH 4M1UB 4PJOB 3CPFA 4DV3L 1WXBA 4GKKL 2WSCE 2X69A 2QEXT 2Y4XA 1L1OB 3M7GA 1OQKA 2I5HA 1N36L 3CCLQ 4LUEA 2LCSA 5CR2A 3TEHB 1PH9A 4RHSA 1VQ6A 4BB7A 1VDZA 3K6OA 4C92B 4TRDA 4EVOA 5IXBA 3OYLA 1JICA 5KYUA 1KQ1A 3FC3A 3HP3A 2F0PA 2LKVA 4JUVA 2Y0SE 3P7JA 4EMKC 2ASBA 1VYVA 4JRPA 2Y4YA 2LQ8A 2EYHA 4R4CA 3BW1A 2VYTA 1BDOA 4EMKB 3PMFA 3P1HA 3EHQA 4TVRA 1HH2P 1N9RA 2SNSA 1K9MC 4I65A 4JI6L 4IFDH 1CKOA 3G7LA 2EGCA 3T1YL 2YUNA 1YITQ 4RTYA 4G7ZC 1JXOA 2M2LA 1II3A 2VB6A 2BA1A 3L7ZC 1WPYA 3CRLC 5FLMH 4PJOG 2F3IA 3PUVA 2MF2A 2DL3A 1R0CB 3T16A 1CQVA 2DAQA 1O78A 2UXDL 2ZCFB 2JS0A 2KGTA 3QIIA 1GBQA 3EAEA 5GAMe 4NL3A 1PTOH 1VQAA 2XSCA 5CGKA 2H3EB 1VQOT 4ANJA 2CP2A 1P16A 3J7ZC 3GBQA 1GCQC 1ET9A 3F70A 5IAYA 1E3PA 4M78D 5HY6A 3MP1A 4D6WA 3JAME 2DETA 3TU4K 1HQMC 4IFDI 1NLOC 3I56A 3K7AH 3I2ZA 5CCAA 5IGGA 1YIJA 2J6OA 4C2MB 3S9WA 3FDTA 4C2MH 3UDGA 2TMPA 2K3YA 1Q1EA 2GFAA 4EPCA 1F77A 2WKCA 4XTCS 3MAQA 1XYIA 5M3FB 4RKBA 3T4AC 1N33L 4KGZB 4QQBX 1YNND 1QJOA 1JOOA 2KI7A 5FLMG 2JP1A 1I4K1 1VQ9A 5FRNA 1AE2A 1T3SA 3RR5A 1IW7D 3EG9A 3EROA 3U4VA 1PZJD 4LD9K 1QVCA 2KRNA 3P75A 1PV4A 3JCMc 2N3SA 1QP2A 1BCMA 1E7OA 1FL0A 4HCSA 4UAIA 4J9DA 2ZM6Q 1DD2A 3O8VA 3FEOA 3CC4T 1NJIU 3H91A 1UGRB 1SSFA 1YP5A 4DXFA 1I94Q 1RD9D 2DNEA 2XIDA 1B53A 2LS01 3AQQA 4R56A 4JI8L 3C1EA 4DPGA 3OTOQ 1RADB 3I56Q 2JS2A 3ERSX 4BBRB 3CXCA 3KDFA 3SVMA 3DXJC 1RACB 1YIJQ 4DV0L 2YTXA 1TVXA 4ZAIA 5CV8A 1U4RA 4J8QA 1E6GA 2KENA 2EQIA 1TS2A 2O2LD 2O9VA 1JC7A 4M77E 5CKEA 1LT4D 1SLJA 4MTKA 4PMCA 2XHCA 1Q86R 3MEVA 2QTXA 5HKCA 4PJOE 4H7BA 5A0DA 3J7A5 4FYVB 3M9QA 3A7LA 5M3FG 4M7AC 1Q7YC 2KBTA 1WFQA 1TS3A 3SWNC 1SMXA 2YUOA 2HD3A 1Q12A 3CQZB 4JI2L 1JE5A 4MZPA 5AJ3L 1X6GA 4M7AB 3A55A 2DY8A 2DVJA 3BJUA 1NSNS 1WXUA 4M78C 3SWNB 4C92E 4AMCA 2PPBC 4KULA 4HKEA 2NYSA 1H9SB 5IT9L 1BU1A 1V43A 3J7YW 4FYWB 3MVVA 3E2UA 4A93B 2IJ0A 4RFBA 3G71Q 1N9WA 1T0HA 3SDZA 4BBRG 4A93H 1ENAA 1C8CA 2RDGA 3PO2B 2FMCA 4QQ6A 1EIHA 4JI7Q 1ZSZC 2PVOB 3GD7A 1VOMA 1IW7C 1IKMA 4RTXA 4A3KB 3RIRA 3EFRA 2OTJA 1YWPA 1ZSZB 3MFGA 1ARKA 1DXMA 2PI2E 4EMKA 4M7DD 1T5XD 3JRZA 4OWXB 2EQKA 4CJ0B 4RCCA 4M7AG 1AWOA 2EYZA 2GTJA 1IBKQ 1B3QA 4X9DA 5EJWA 2QDBA 2EWNA 4L6TB 4OWTB 2LNVA 3I91A 1MGQA 2VB3X 5GQOA 1GUNA 5BR8L 1N34Q 3H41A 4M78G 2ATWA 1PSEA 4QVDA 5A0LA 1SRLA 2R5AA 5GAN7 4A93G 1D5MC 3HPWA 3THKA 1ML0D 2EY1A 2RN8A 4EQ5A 3M0PA 1WJSA 2QQBA 5KYNA 2KYBA 4J6XA 2LXJA 2O5IC 2B86A 4WCIA 2JA9A 2MPXC 3JCMJ 4KHZA 3M0TA 3EQLC 2MIOA 4A3KG 4ZGJB 3K0XA 2BH2A 2DF6A 4HA8A 1H641 4PG3A 2L3SA 4J6YA 4ZKBB 3REAB 2I2LA 3E9FA 4E47A 4HJAA 3FVQA 4HVUA 4MDWA 1PC0A 1TIID 1M8VA 3NBIA 1EWIA 3GTMH 4IJHA 3TS2A 3I5SA 1H9RA 2X3XD 2ZM6L 5EAYA 2E5KA 2L0CA 2K3BA 2IX1A 1IYVA 1AVZC 1VQ4A 4KKSA 4QT7A 1A0IA 4P2CB 3EGXA 1MHWC 3OYYA 5HK3A 1EFID 4WJ3M 1K9MR 1U5KA 3OTOL 4OMLA 2GTOA 3DEPA 4M7DC 1YJ9Q 2F03A 2QDYB 3VUBA 1VQKQ 2JEBI 4KRTA 5KIXA 5K36H 4M77F 5IHNA 2H1EA 3KK7A 4HJ7A 4G7OC 2DZCA 4PJOF 4AG1C 5CC4A 4M7AE 1ACMB 3FB9A 3JV3A 2HQEA 1VUBA 2K50A 4DR6Q 4E7JA 2PUKB 3CC2A 4HJ5A 2OAUA 5C3EB 1G3SA 1A8VA 3HOVH 5C3EH 4Y91A 1RIPA 3MEHA 3ND9A 3X3MA 3ZJYC 3K7UC 2C0TA 1HFGA 5ELOA 4B3TL 4J9CA 1YHBA 4DV1Q 4X65Q 2QAZA 4C92F 5EPLA 1JMCA 3NWTA 1MMNA 4OXPA 3M4PA 4DBFA 3SWNA 1M3CA 1CZWA 5I9OA 1QMCA 4UY8C 2FPDA 5ELNA 5AFWA 1H9SA 1UECA 4M78A 2YHTA 1NEBA 2DN8A 2NVTB 3N5BB 2XMFA 2NVXB 2JA8B 5C6SA 3R93A 1LM0A 4C8QD 2FMMA 4JI7L 2JA8H 5K36G 3MXUA 2BOSA 4WJ4A 1Y69U 5GANh 2VKNA 4OWWB 3CMET 4M7DG 5GAEC 1KHCA 2M0OA 4IALA 4PZ8A 1OXVA 3FJPA 5LJ5j 4BY1B 2ROLA 4BY1H 4A3MB 2IPOB 5C3EG 1I81A 3TSSA 4A3MH 3K58A 5JVH3 3Q0AA 4IUNA 2RBMA 1J3TA 4BI4A 1IBKL 2EGEA 4DNIA 3CBOA 4R8IA 2KEEA 1BCPD 2LRQA 3J81L 1JORA 4YHHQ 4PJLA 1VQ7A 1NUCA 1P8LA 2ZPIB 4FF1A 1AT1B 1QVFP 1LPLA 4KBMB 2XDDA 1I6VC 3QZ9B 1M5Q1 2N88A 1HUMA 2X9HA 1Q81U 3JB9F 4AQYQ 2JA8G 2E3IA 2X51A 2SDFA 5EPKA 1V1PA 1QUQA 4C56C 3QDFA 4RMOA 4X6AH 3UF4A 2Z9HA 4DR3Q 3LX7A 3CC7T 1NR4A 3H15A 4O6JA 3OS2A 4PFPA 3M57A 4BY1G 2R5MA 2HHHQ 5BN3A 3VA5A 4A3MG 3KF6B 2FYKA 4L5QA 2HUGA 3L42A 1VQNA 2ED0A 1GD7A 4GBQA 4V0BA 4UP8A 2UUAQ 3R2IA 3HRSA 2HKQB 1PKSA 3V8KA 2FJ2A 4C1NK 5FJ8G 1ZUUA 4L5GA 2SOBA 5CMDA 3JCMg 3MA2B 3R6NA 5COYA 3E1SA 4Z9CB 5GANf 1SE3A 4C8QC 4XIGS 4LF6L 1NE8A 1RAIB 3QSUA 1XMOQ 1G91A 4A54A 1PYSB 3UE0A 3WXMB 1YN8A 4B9WA 3QOLA 5LHY1 1BNZA 4BBSH 1K1ZA 1NG2A 1SHGA 2HCKA 3V8LA 4C8QB 2IY5B 3CCQQ 5C4ZA 2F69A 4HCKA 5JAVA 1WTRA 3G4SA 2P0QA 3URGA 4ATOA 1JJ2A 2CFMA 2YTVA 2DZ9A 1R9TH 1AZQA 1SF9A 1K0RA 4RCNA 2V26A 2VXFA 1KC8R 3L2VA 2QQRA 5LJ5e 4NXML 4M7AF 5IE8A 2O4XA 1BO0A 3DUZA 3PQIA 4JJDA 2JTEA 4M7DA 3FPPA 1EIFA 3EG0A 4XTVA 1TG0A 3OYJA 3L2QA 3A74A 4UHVA 1SYFA 3K5OA 1I5FA 2A5HA 3FP9A 4BE0A 4ESRA 2EIFA 4JW0A 2ZXRA 4DV1L 4X65L 2DL8A 3S1MH 2OTLA 2A08A 3BZKA 1S72Q 4DAYB 1EQRA 1M1FA 1HFNA 4RAUC 1X6BA 3JSCA 2DUDA 3OW7A 2PTKA 2QEXA 1X32A 3GTGH 2DVEA 4A3EB 4C8QG 1EYAA 4Y7NH 4A3EH 3ZEHA 4LDYA 2LY7A 4ABNA 4GKJQ 2BCOA 5F2DA 3V8JA 2KQWA 1D5XC 5ELFA 2KT8A 3OY9A 5C4XH 3NELA 1VIFA 2HDLA 1GUTA 2RHSB 2G5DA 1GFCA 1XNRL 3GTOB 5M5WB 4XQNA 1GUOA 1ZBJA 1BBWA 1UE1A 2IT1A 4A4IA 1EL0A 5LJ3d 1QW1A 1B7TA 3J81i 4JI1Q 4FF2A 2X4YA 1VQLT 2A1AA 4IZ8A 1XOVA 3LWIA 1RCVD 3S1QB 5GAOp 1PMRA 1E24A 4YHHL 3E19A 2A3LA 2JA5H 1A6XA 2YXYA 2W10A 4A3EG 2JA6B 1JWUD 1U1SA 3NWSA 3VYUA 2JA6H 1B9NA 3MC0B 1E7ZA 3MXGA 3H8ZA 2MPMA 3VYSA 4QVCA 1VQOA 2F0LA 2OF1A 2AIRB 3OYHA 1Q46A 3JCMb 1BK2A 4DR3L 3ZL7C 4GY5A 4N4HA 2EXDA 2HHHL 4K0KQ 4FW2A 1W6JA 1MKHA 1JEGA 3KF6A 3C95A 4R4QA 3J80c 3BS1A 4L8JA 3U58A 2UUAL 4C0FA 1HTPA 3BY7A 1RABB 1EEFD 2CP3A 5M5XB 1Z7TA 3KFVA 4LK1C 2YWWA 5M5XH 1XMOL 3RN2A 3A1PA 4Q0FA 3HSBA 2FXQA 2JA6G 3HKZG 2V8JA 3QIAA 2V8IA 2JM8A 4BDYA 5T1IA 4DV6L 4HTHA 5DM73 4ZYSA 5KNCA 4C8QA 3A8LB 1OI1A 2CKKA 2QA4Q 2KXCA 2OT2A 4N8X1 2NB0A 2ZPBB 4ME3A 3H0GB 3K8AA 1G6PA 3H0GH 1G291 3S1RH 3ME9A 4CI0C 3M85A 1WOCA 1NMGA 3OW2A 4A4HA 4Y92A 2IPKD 4A3GH 4ZK9B 1QCOA 3I55T 5EKLA 1OZ2A 2EYPA 3DLLA 2O2OA 1NE3A 3RMSA 2V8KA 2Q2TA 1K28A 4DNRB 1SSHA 2ZT9C 2LP5A 3CC4Q 2ES2A 3RERA 3S2HB 3VS3A 1V76A 1TT2A 5HK0A 3I70A 1QWYA 2J06A 4DBHA 3LWHA 1I50B 2B8GA 3META 3CMAQ 1D1CA 2JXBA 1WXTA 1W2BP 3QR8A 2GVAA 4PMBA 1YJWT 3K80C 5I22A 3RKXA 2ECZA 2FO0A 2UXCQ 2JSOA 3CCUQ 3H0GG 9ATCB 5I2XA 4L5RC 4A3DB 1IL8A 2C9OA 4M75C 2Q8TA 3S3OA 3SK8A 4A3DH 3BYTB 5KGUA 2F1MA 3NHHA 4F8MA 1WD0A 4PZ6A 1XPOA 1FMVA 2H5XA 2D6FA 2LSSA 4M75B 4JI5Q 4ZTFA 1KQSA 4XYOA 3H0FA 2KROA 3CPWS 2H8HA 1B4OA 2ABLA 1B7YB 4JI1L 2K32A 2E4HA 4L63B 1HPCA 3OMCA 1GJXA 3EFXD 1GBRA 1PDQA 3D3RA 1G6ZA 2KCMA 4DK3C 1SEMA 4GKKQ 1KLGD 3G6EQ 1D1KA 4KK7A 4DA4A 4QY7A 4RH6A 4X66L 1ABQA 2FRWA 1ZA2B 2EQJA 1JOQA 1I5LA 2O01E 5GAN4 2BTTA 1PSFA 1NEGA 3OYIA 4RKUE 3GTKB 2KYMA 1MMDA 3CCSQ 4X1VA 1TWFH 5G3LF 4WORA 1N5ZA 1RAFB 3A54A 5C4JH 2L55A 4A3DG 2A74C 1RKNA 1UE6A 1PRMC 1K83H 4JJBA 1D3BB 1ILQA 1E22A 4OELB 2E1HA 4QQGA 4JZ3A 2YYZA 4K0KL 1M1KU 1Z9ZA 3OMGA 4DV4Q 1MGSA 3QYGB 1Q86U 5C0XH 2F0SA 3CBMA 4BACA 1B50A 3PGGA 1KD1R 2KEDA 5IH2A 3A8HB 3VYRA 2MK5A 1I6HB 5CKHA 3VR5A 1X65A 5IGDA 3NUCA 1HNZL 4NOYA 4O0AA 3VR3A 1SN8A 2DXBA 2PZ1A 4MZTA 3O5ZA 4YCUA 5CV7A 4CKBA 5C4HA 1PFSA 4NB3A 4A3FB 4A3FH 4EX5A 1NYGA 5BN5A 2BE9B 1PHJA 2JT4A 1K0XA 1SNCA 2X6GA 5IT9c 2R7ZB 5IYDG 5C0XI 4BE1A 2ZJQA 4XAXB 2R7ZH 4I7AA 4NP5A 5KYYB 5GROA 1NAPA 2J6KA 1SFOB 1UGSB 2QEJC 1U5SA 2A6HC 4PFZA 2FHDA 1ZUKA 3CC2T 2L89A 5EQ0A 1Y1VH 1FJGQ 1VS0A 1YNXA 3EG1A 2FFKB 2G9HD 4QB4A 4DV5Q 1H95A 1HZ9A 1OXSC 4G4KA 4LFCQ 3PCOB 1EX4A 1GM5A 2L0AA 3UT1A 1YFNA 4MMKA 2K05A 2OWOA 4D8KA 2AUJD 1M4VA 2KCCA 4A3FG 1Y0MA 1EFWA 3EN2A 3VV0A 1JCKB 3CCET 4LAAA 1LNXA 4M75E 2UXCL 2R7ZG 2R61A 3GQBA 4KT0E 2JUFA 2K2MA 1BI3A 1YHQQ 1WHHA 2WSFE 4J1MA 4QIWE 4IUQA 2RKSA 1HNWQ 2RO0A 2VY3A 3CMEA 1BQQT 1ZBXA 4XK8E 2JEAI 1MV3A 4JI5L 1WDXA 2RA2A 2E2DC 1HJPA 1STYA 5M5YB 3HOXB 4J5YA 2EJMA 3NQIA 2TSSA 2DTIA 2JJQA 1Z6HA 1FVIA 1KNEA 1X3FA 3LH0A 1DOMA 2B2TC 2ZZDA 3MXNA 1PH6A 1AW7A 5GJWB 2DD5A 4RHRA 2R92B 1IKLA 1YCSB 2JNGA 2KHJA 4JCVE 3CXCS 1KABA 4J15A 1E2VA 1ET6A 1QNUA 2QW7A 1CKMA 2K7VA 3RD4A 3P8DA 4M77D 3D6CA 4PJOD 2K5DA 1NPPA 1WTXA 2SEBD 1T0JA 4FF4A 4IN3A 4II1A 1CUKA 3DHQA 1EYGA 3MXPA 3DEOA 4DR2L 1QZHA 1MSHA 8ATCB 2FPFA 3VRZA 1UEAB 2Z6KC 3CCVT 1D3BA 4AG2C 2D5DA 3FPUB 3EFOB 3CC7A 1RI9A 2XG8D 4C92D 1VQPT 2L12A 4B3ML 2BE7D 1WJJA 3HOXG 4DR1Q 3E9GA 2DXCA 3MO8A 3OYCA 1RUWA 2ENMA 1SHFA 2HEQA 3SB2A 2E2JH 3S14H 1AH9A 1QE6A 1VQMT 1M1KC 1LTGD 4NDXA 3V7RA 3M59A 4CC3A 2R92G 2RHYA 4LMQD 4M8AA 1NCVA 4F17A 1VQ5Q 1AZGB 2F0GA 5IODA 3KJPA 5KYWA 4OB1B 3PSIA 3KOJA 1PM3A 1W4SA 1CQFA 3I3CA 3RZDH 1VYUA 2D1XA 1Y8NB 4DAPA 2EJGA 4MZ9A 4XQ3A 1SEBD 1D1BA 2QK0A 2VWFA 3OSVA 4LUDA 4PK4A 3G4ST 1JWSD 1K3RA 1U4PA 2A69C 5GANg 1TWCB 2D0QB 3E6ZX 1TWCH 2GQVA 2ICIA 3K59A 1KIXA 3M0RA 4QUFA 3NTKA 4KTAA 5FKAC 5GAN3 5KYYA 1M90R 1YJNQ 2EY2A 1SYBA 3PGZA 2XI9A 3I9QA 2E3HA 2CSIA 1RDPD 5FROA 1IREB 2X6LA 1KXLA 3VYGA 2ZPGB 4DV5L 5IT9E 4M77C 1OU9A 2RHZA 2VGMA 1FXXA 5DLOA 3JB9D 3S15B 2YV5A 3MCAB 4B3SL 1AWWA 4PJMA 3N52A 3S15H 4LDWA 3VUZA 4M77B 2P4RA 4X9CA 1RJTA 5GMKh 4R8NA 2VZAA 3J81c 1D7QA 1C0AA 1VQCA 1D0YA 1VQJA 2EOTA 3KLSX 3M56A 4M75F 1X27A 4J7IA 3NBHA 5KYXA 4C92C 1O7LA 2EKHA 1EY5A 2AUKA 3HOYB 5J3BA 5T1GA 2P0PA 3QJ6A 2DK3A 3GPLA 2K5QA 5GAHC 1HNWL 5KYLA 2GFUA 2GA4B 3GDEA 1CFMA 1V1QA 4N9PA 2F0VA 1M27C 3EGUA 1BVSA 2E2JB 4XTYA 4XQQA 1HZCA 2D0OA 4JS5A 2FB7A 1TY2A 4RCOA 2F0IA 3I4MB 4AFQC 4OIKA 2OCEA 4JI0Q 3BVGA 3I4MH 4C0ZA 1VQLA 1TUDA 2N8NA 4M77G 2O88A 3PUXA 2ZJPA 1T9HA 2E8GA 2CYZB 3H3VC 4E6RA 2YSQA 4N4GA 4M7AD 3H09A 2L8DA 2VQEQ 2CW0D 4LF9Q 4OL7A 1VQ6Q 4R0KA 3HOYG 5KCOA 4RGMA 4QKUA 3M55A 1AWJA 4FP5D 3IFDA 2RHUA 4C92G 4HCBA 1ENCA 1X3GA 2J7IA 2HBPA 2FHTA 2I0NA 4JOIC 5GAMd 5D14A 5FOBB 1KC8U 4A3IB 3RUXA 1YNJD 2QGQA 2JA5B 4G57A 2LJ1A 3M0UA 3NFCA 2WAQB 3A8KE 4H44C 4P74A 1S1NA 5JOBA 4DR1L 1FMKA 2RHQB 1KDBA 2LFNA 1RODA 5H1SE 3I4MG 2RSOA 4HAEA 1HR0Q 2DJFC 3JB9H 2AHOB 2JMCA 3D6WA 3JCMX 2K3XA 1LACA 3S16B 5M3FH 1N8RC 3VU3C 4OMNA 2N78A 3CKIB 3S16H 1XNIA 5J26A 2R93B 1WIEA 4ELYC 3E9HA 3OYAA 3PTAA 5C3WA 3VS6A 1N9SA 1PD1A 1IBMQ 2C06A 1ASZA 1DJ7B 1GFDA 4Z8AA 1K8AR 5KCHA 1L0YB 1CA5A 4X64L 2M9UA 4LF5L 4X62Q 3CF5A 2RI5A 1EZZB 4APVA 2ZJRA 1VQBA 5FO9B 1NM7A 3LGFA 2KBNA 3X25B 5GAOr 5M3MB 1QWEA 2EJ9A 3L2UA 1B3AA 2EPBA 2RK2A 4CJ1B 5M3MH 2BIVA 2DKGA 3D4WA 4BBRH 3JB9I 2XU8A 2AQ1B 5C3XA 2NN6H 1XPRA 2WAQG 3CCJT 1X3QA 1LTAD 3I55A 2MJ8A 2NUPA 2CSQA 2CT3A 3SFMA 3RZOB 3JB9G 2AHJB 3FHWA 1VQ9Q 2GQIA 3RZOH 2CCZA 4DV2Q 2CW0C 1WX6A 2A68D 3H6MA 5KEEA 5LMNQ 1K0SA 2DPPB 4MHEA 3HP9A 2R93G 3CQZH 3MEWA 1X54A 3QBYA 2KHSA 4EIKA 4M77A 2B2WA 2K79A 4QJFA 2K5HA 3D8GA 1UEBA 4PJOA 3PUZA 4BS9A 1PFMA 3FIFA 1YNJC 4UP7A 3VYTA 1LOJA 5FWBA 3LX0A 3WOEA 2UU9Q 1L1OA 2E65A 2JN0A 2LX9A 4IUTA 2QASA 2A19A 2NN6I 1YJWA 3BZCA 1HXDA 4R4IA 5M3MG 2VQFQ 2BZ8A 3QWXX 1VQGA 1ZUYA 1LTRD 3JB9J 1X3PA 4C92A 2LC4A 2NN6G 4KGXB 3OYKA 4DN4M 3PO2H 3VRYA 4OHJA 3J81E 1TWHB 1KTKA 4ZKCB 3DMUA 3VA7A 4MTNA 5HGQA 4GOPC 3SR1A 3GIBA 2AZSA 2MP1A 4N4IA 3B6YA 4A3KH 2D9TA 2FZCB 5IHIA 2QCPX 2WSEE 4FIBA 4GOPB 4JI0L 1KAAA 5GAOn 2KA7A 5IIFA 2YTYA 4UC4A 3I73A 4A63B 1HA5A 4X3UA 4A3LH 1ZYRD 1N32Q 2XRSD 1RI0A 2ZTEA 2CZ7B 3SD4A 5J1ZA 1DZ1A 5GMKm 1JJ2S 2BA0A 5IWAQ 3GO5A 3QHSA 4U673 3KFUA 2PI2A 2F0FA 2VQEL 4XU3A 1IGUA 1C4QA 3KLSA 4KLKA 2WAQE 4C3JB 4RCBA 2OAWA 4ULLA 1SMYD 5TSSA 1K8OA 1C0MA 4XT3B 2UXBQ 4LFAQ 1AOJA 4KJNA 5I2SA 3ZBDA 3PO2G 4C0DC 1M3AA 2DJZA 4FVMA 2F0JA 3RLFA 1M1GA 2OTJQ 2A68C 4J7FA 4BXXG 1GCQA 2JE6I 4C0DB 2VL6A 5CKBA 2F2WA 4HIDA 2IHFA 1ZX6A 1UDLA 4A3LG 1LT6D 1PXUA 1B8AA 2VNUD 1ONLA 1ICWA 1AP0A 1SYDA 3U50C 3PFSA 2DBMA 1IYJB 1A62A 2NZOA 2HKNA 1IBML 1I94L 3BFMA 1MJEA 4X62L 4C3JG 4KH0B 1I5OB 4K6DA 1EOVA 4GLAC 4NXNQ 1BIAA 3KUFA 2PZWA 3S1NB 3ULLA 1SBBB 4YY3Q 4JS4A 1K3BC 1NJIC 1STHA 4XU0A 3E0JA 1WLPB 2L3QA 2RVLA 3CHBD 4K5VA 4YIJA 3HFZB 1ZYRC 1O7ZA 2XWJB 5CV4A 4ZNXA 2EYMA 2I5MX 1K73U 1TXYA 2VC8A 1QCFA 1VMPA 2AQ2B 4DV2L 1VQ8T 4HCCA 5I6WA 1EUJA 2CHBD 1B34B 1K9AA 1TTHB 2CT4A 4FL6A 1KIKA 3W1GA 3I4NB 4FYDA 1IHVA 1SMYC 1VQ4Q 2K5NA 4GN3B 3UDIA 2LJ0A 3G1JA 1W6KA 4M7AA 3EHRA 1Q82U 5G3LD 2XWBB 2EJFC 4JI3Q 1XNQQ 2PVGB 3T13A 4S3SA 4IOAA 1HYOA 3S3MA 2J05A 2K5WA 4BY6C 1LV9A 3STBD 2NWGA 2UU9L 5ISRA 1U4MA 1LTSD 2PZUA 1SDFA 3CCEA 1IBLQ 1B2TA 3RESA 4JDSA 4BY6B 3H0IA 3M0QA 2F0KA 2NVTH 4JVZA 4FSXA 4DAVA 2NVXH 2VUMB 1VYTA 4F04B 4U68A 4C3IB 3C12A 4YWLA 2VUMH 3JC66 4C3IH 4PQXA 4JLIA 3CC2Q 2MQHA 4J9HA 1XMQQ 3NGPA 4OGCA 3PIO3 3JCMQ 4FU6A 1ZSZA 4B9XA 3C2PA 1I8FA 1H3HA 2HZYA 4C5HA 1GL5A 5EBDA 1I0CA 1CHPD 5IYCG 1QVGP 3I4LA 2JN4A 5GAGC 3K57A 5KYIA 5FJ8H 1O75A 1KDCA 4FT2A 2ENBA 3TEEA 1QG7A 5IWAL 1G83A 2OI3A 4WF2A 3ULJA 3JCMe 3BYYB 4KHVA 3M7NA 5FU7C 3OW2S 2UXBL 1Q7YR 4DQ2A 3GTJB 1SR3A 2VUMG 2OXPA 5E1FA 5FU7B 1EY4A 4JRQA 4C3IG 3VS0A 3J7AV 1JO8A 3CCVA 4KKUA 4AH6A 1D1AA 4FW1A 3TCJA 2DMOA 5GAN6 4IIOA 4E7HA 3E0EA 4X3KA 1FNVA 1SE4A 2DTOA 2F4VQ 1XX8A 1VQPA 1H3ZA 5C44B 1VQEA 5C44H 4E2FB 4OMPA 3STBC 4AYBE 2Z6BA 1TS5A 3TBIB 3I72A 5IGBA 2O5JC 1VQMA 2E12A 2M9VA 1G3YA 4DR7Q 1VQ7Q 1JB7A 2AKKA 4OB0B 1OXTA 2XVSA 2AMCB 1YVCA 3OHXC 1SKUB 1I4HA 2F0MA 3N6RA 1KFZA 1DCZA 2L5TA 4G7HC 3HRUA 1HQRD 1UGVA 2QXFA 2LT1A 4CC2A 4IPHA 4DK0A 4LN2A 1KG1A 3IFTA 4TSSA 2F5KA 3P20A 4A3BB 1CKNB 3OIQA 1D2BA 1M2VB 3A8OB 4RUGA 3OS5A 2OJ2A 4ZN3A 5GAN2 1KQSS 3HGBA 4F87A 2PQAB 1YZ6A 1EQTA 4J9GA 2JOYA 1VQNQ 2DYIA 5C44G 2F3VA 4DR6L 1VQMQ 3SEMA 4P71A 2DNUA 2LDMA 2FPEA 4P72A 4E6IA 4F88A 4HT8A 5E4WC 2YU9B 1E1TA 5LJ5d 2YU9H 2K03A 5A2QL 4F7UB 1OZ3A 1K73C 1JQYD 4P73A 4XXEA 1PNJA 2I46A 4JI3L 3VDYA 1Y07A 2KXDA 2F52A 4V2SA 3K5NA 3KBGA 4RTVA 4K2KA 1F9QA 1CKBA 5D7UA 2K1BA 4A3CG 3G4SQ 2IX0A 2COZA 1OU8A 1ZSGA 1IBLL 4A3BG 2EJFA 3PE0A 1Q82C 1GHKA 4DUYQ 1J9OA 1HTLD 1O7IA 2I5LX 1SAPA 1Y71A 2EQUA 1K4US 1MSGA 4RTWA 3A8IE 1AWXA 3FRNA 4MMLA 1VF7A 2CKZB 1P92A 1S5BD 2LTOA 3GTOH 2ALYB 1RLQC 2K75A 2RF4A 2AWOA 5M5WH 2RDHA 1WHJA 2OTLQ 1JE4A 1YITT 1QCBD 2ZTDA 5GAMh 3Q8DA 2AZVA 2X4XA 2E2HB 5CVIA 1L0WA 1RLPC 1UGQB 2QGGA 3H94A 3LWEA 4J6HA 3T1HQ 2QEXQ 4A76A 3S1QH 2OQKA 3TREA 2KEAA 4O42A 5GMKe 4J6WA 3KJOA 4LNQA 4Y28E 3TZUA 1Y7XA 1SROA 5DM7R 2RJFA 2J7ZA 2KOLA 4AQYL 3AFQA 3QWNA 5M9OA 2ZPEB 2Q2UA 1W2BA 3SGIA 3GF5A 1YBYA 1PA6A 2NUCA 3L3OC 1Q81C 4KY6A 1WJRA 2AKLA 3EVQA 4L59A 4JV5Q 2IG0A 1QLYA 2R6GA 3VS4A 5FK9C 2EY6A 2RI2A 1D6EC 4HJ8A 4E7LA 4PL6A 2CZ0B 5I21A 1FR3A 4M75D 4GLVB 2SNMA 4DR7L 4N0AC 4DU9A 4Q5VA 2DXUA 5IGCA 4R9WA 5ELBA 4TQUS 2DEUA 2NWMA 5LJ3g 4H13C 4J83A 3CU7A 3FEWX 2J6FA 4ME7A 1TOVA 4RG2A 1A3UA 3SK6A 2HD0A 2HMAA 1VQOQ 2J0TD 4R4OA 5IP7H 5E3FA 2KCNA 4PKCC 1PRLC 3OS1A 1L0XB 1D09B 1EY6A 5I2YA 1M2VA 2YRDA 5GAMf 1QNKA 4ZUJA 5CKDA 2B2UC 1LO5D 4UP9A 1S4ZA 2DX1A 2X3WD 2IHEA 1S5DD 4F7UE 1XQHA 1CTMA 2L3RA 3ERQA 3TSZA 2COYA 2O9SA 3CCJA 1VA7A 2B8AA 2ROTA 4JRIA 3LNNA 2PVDB 3A98A 2LCLA 5L23A 1BI1A 3PT9A 3CD6A 3CP0A 1MMGA 2D62A 3QKJA 4K8JA 4LUZA 3FKIB 2A28A 2Q8IB 4HIOA 4IPDA 4YWMA 4DAYA 2RI3A 5GAOl 3RDVA 3NTHA 3S2HH 1EFNA 3OQ5A 4PJJA 5IP7G 3CBPA 3OS0A 2KQ3A 1AFPA 2DRMA 1TU2B 3NK9A 3GV3A 4BA1I 1HA6A 3G71T 1I50H 1HR0W 4DUYL 1A0NB 4GKJL 1C9OA 3MEAA 1S3OA 3R3OA 4LF5Q 1LABA 2BUDA 3ULRB 1MBYA 2EYOA 4QGUA 3CCMT 3CCJQ 2DY7A 5IGFA 2EYQA 1CA6A 4DGZA 1H9KA 2QDLA 4A4KA 4RA8A 2VW9A 3NPPA 4RG8A 1U9RA 2F0OA 3NENA 2IWHA 2VB2X 2L4NA 4J8OA 3K0YA 1MMAA 4HMIA 3P8HA 4J9BA 4HCZA 1MNEA 4C5IA 1I4XA 3FKIG 1E2ZA 5CQXA 1F9RA 4QIWB 2DRKA 3A56A 5LL6X 1TWGB 5GJVB 3T1HL 3JCMV 1WTVA 4DA2A 3TQ7P 1ESFA 2A6HD 2EGAA 3MKDA 1AD5A 2R57A 2X4WA 2YT6A 4ELZC 2F0EA 3CQTA 4BI8B 3E9IA 3AMUA 2DEQA 4JZ4A 1B70B 4B08A 1HZBA 1U3OA 3A5UA 3NSWA 3QO2A 3ER0A 3GTKH 3V2TA 5LMNW 1YHAA 1IRXA 3L9AX 4MIUA 2AK5A 1KK7A 4N9TA 4EGVA 1GO3E 5IYDH 4E7IA 2YRVA 4JV5L 4O5VA 3TN2A 2Z4IA 4M75G 2PQWA 1KQ2A 1STAA 2A73B 2MFIA 4DV7Q 4DR4Q 1G8XA 4LF8Q 4TKOB 1XTDA 1EOTA 1OEBA 2PU9B 2PYKA 4XT1B 1QWFA 1EIGA 1F2MA 2K7AA 3BE3A 1QP3A 3Q22A 1I6HH 1UUPA 3LGJA 2MUYA 4EQOA 1WHGA 3OYGA 4N0AA 2YLBA 1ZEQX 3R2TA 2RD1A 4IO9A 1PH2A 2LQWA 1MUZA 1JJCB 4HEDA 3RBBB 4E7KA 2BE5C 5GMKl 3OWEB 5LMUQ 4FXKC 2D0PA 4DKAC 3C4SA 1YJ9T 4KKTA 2L1BA 3MZ5A 1HK9A 3DB3A 2K6DA 3I35A 1VQKT 1NMFA 4F7UF 3U4ZA 3KLWA 1EWCA 2E70A 2NUZA 4MNOA 2B63B 1IZ6A 1UE5A 1WA7A 1F1BB 3E5SA 3D31A 5EPJA 4L5TA 2L5QA 3SHLA 1SFOH 4LD6A 1AE3A 4IQZA 1GUGA 5GANj 1D5ZC 1VQ8A 2MMPA 2DE0X 1SNMA 5IP9H 2A7YA 1RAGB 2B2YC 2JK8A 1R4QB 1X2QA 3OA6A 5EKIA 1WZOA 2RHIA 1Q81R 1MIUA 1TH7A 4J9FA 2HBWA 1I4PA 2F0QA 4JBJA 2WV6D 3V7SA 2B2VC 4OP0A 5I6YA 3K5MA 3T9NA 3QJYA 4K5XA 1UB4A 2JVVA 2WFWA 3BVZA 4R1JA 3RN5A 4A4GA 1EWHA 2VS1A 3KF8B 3INZA 1SPKA 2KHIA 1R0BG 4A53A 1I3QB 2CP0A 5IYBH 3S2DB 1Y57A 1HUNA 1PH1A 1SRUA 1PYWD 4RKLA 1U06A 2E5QA 5D6YA 5AT1B 2B63G 4OVAA 1SNDA 2K9GA 1UTIA 3TSWA 1T5EA 2EYLA 3IL8A 4E7ZA 3MPUB 3M4OB 4M75A 4OMFB 5IP9G 2A69D 2V1CC 1U8RA 1PZID 3S24A 3M4OH 3VS2A 4WFN3 1J5EQ 5M5YH 2F2VA 4M4ZA 2NVYB 3HOXH 3OB9A 1QKXA 1UJYA 2JM9A 2RMOA 1FYCA 3M4QA 4YCWA 1MV0B 4AFZC 2EPDA 1PH8A 2EQMA 2LVMA 4P75A 1XTCD 5D65A 1PD0A 1XXGA 3Q1JA 2WB1B 5CIUA 2R92H 5FLXE 1VCIA 4EQNA 4PMWA 1N36Q 1U1TA 1UG1A 1IHZA 2GF7A 1GOZA 1QKWA 4MZMA 2KSSA 1L2FA 1PHTA 2PQEA 4HCEA 4A3JB 2VXEA 4J9EA 3L0OA 4NMZA 1SG5A 5IYBG 3C0CA 5IHKA 1K9MU 2R7DA 3ZYYX 1XJWB 3GNFB 4QQDA 2HSEB 1A3VA 1S5CD 3CMEQ 4POGA 2JMAA 2XK0A 2JA7B 2RA4A 5EGTA 1QOHA 2JA7H 4FNFA 2EYYA 1FWZA 4DNTB 1PH3A 4JI6Q 4Z02A 2MO0A 2AWNA 5GANe 2KVMA 3BU2A 3L2PA 4DV4L 2K57A 1BB9A 2XD0A 4DV7L 2JTMA 1BBXC 3EH1A 1ASYA 4NPSA 4JPBW 2CVRA 3KBXA 1C1AA 2Z8LA 3DLMA 4K2LA 3M0SA 2ZPFB 2VUBA 3QZ5B 1GKHA 4MDXA 3OYFA 2WB1G 3D4RA 3MHBA 1Q86C 4KD3A 3HOZB 4JBKA 3HOWB 2HL3A 4GLKA 3D0FA 2Y90A 2DERA 1UNSA 2MYSA 1FX7A 1PFNA 5LJ5h 2E75C 3CCQT 3I7FA 4A3JG 1IL2A 1HD3A 1XPUA 1VQHA 2GGRA 4BI3A 1EY8A 3C1FA 1X43A 1AHJB 1TU0B 4CDCC 5KNBA 2C0OA 3P8BB 3CC7Q 3M3YB 2JA7G 1UE7A 3NPFA 3PUWA 3UE1A 4HSVA 3K5LA 4LF7Q 2K28A 2MI6A 2R7FA 5GAN5 1SE8A 4FSSA 1NLPC 3EG9B 3AFPA 4MN3A 1FJGL 1LJOA 2MAMA 3QYHB 1S72T 3W2DA 4F14A 1B1ZA 2N49A 2RK1A 4QL5A 4LFCL 5JPMC 2L3PA 1PVOA 3HOZG 1KJWA 2HCCA 2H3JA 5ECAA 4JI8Q 3PMIA 2PCFB 1RAAB 2LX7A 3ND8A 3VR4A 1IHWA 4CKCA 4LUOA 1HJDA 1D1IA 2VXWA 5LJ3h 4E7SA 1NY4A 3KDFB 3FMCA 1EY0A 4DK1A 3CCLA 4DV0Q 3H0HA 2A0FB 3CCRT 4X3TA 1WCMB 2NUTB 4ILWA 3HOYH 1OPLA 1VQDA 2L2PA 3L2WA 1SJHD 5IGEA 1UGPB 4JI4Q 1M3BA 2RJEA 1UFFA 3RR6A 1UUEA 1QCNA 2KDSA 4L5SA 1M9SA 2P84A 3M53A 3D7SB 4LW1A 3TQYA 4OB2B 1GHJA 2EYXA 2LZ6B 2WB1E 4RMFA 3AEVA 2D9UA 2QG9B 5LJ5f 1U4LA 2NYZD 1D0ZA 2JTFA 2XDBA 4C3HB 3O13A 1J5EL 5AJ3Q 4K8IA 3C94A 1YITA 4LF4Q 3TVTA 3DWAA 1GRIA 1QVFS 4FO2A 4C5GA 3F2CA 2M0YA 1GUSA 3QUIA 5J22A 2B2TA 2QILA 1EEID 2KR3A 2M00A 4ORZA 2F3WA 5FU6C 4XQJA 2AT1B 1STEA 4ME5A 2I0QA 4UDUC 2HNIA 1IGQA 1DJRD 1WCMG 2A8VA 1N27A 5KRUA 1BUVT 2CQOA 5FU6B 1JR0D 3H3VH 5JJKA 1WI5A 4OB3B 4HXJA 5GAN8 5FLXL 4X3SA 3V96A 3AT1B 2LMJA 4ZGDB 4FYYB 4JC0A 4ZRZA 3EFOA 4KGVB 3H6ZA 4A3IH 4LNPA 2GNCA 2CDTA 4CDFC 3ITPA 3RKWA 2Z6KA 5LJ3f 5CKFA 4C3HG 1PTOC 4KV6A 2F0UA 3CPWP 2WACA 4DOWA 1VQLQ 3HTRA 4IOCA 4WRDA 5GAOm 4PJNA 4PZ7A 3F8TA 1SJED 1PTOB 1W70A 5BR8Q 2MOXA 5I9PA 1PWTA 1QQJA 2PW7A 3KUPA 2JJ9A 2E74C 4BUGA 2RCNA 3H3VI 5DNFA 2R93H 2FINB 1Y8PB 5ELDA 2Z0SA 4FT4A 4EMHA 1PLFA 1YI2T 2DO3A 1WHMA 1SNPA 5I2MA 2QA4T 3HRTA 3K7AB 6AT1B 2WIIB 2F1LA 2BH8A 2DIGA 1UJ0A 1STNA 1X69A 3RMQA 2B39A 4HR7B 2QTVA 1PFBA 3PIPA 2P0KA 2RF0A 3IAYA 3UPUA 3TS0A 2ZAEA 4IFDG 1SXTA 2KY9A 2KVQG 1G51A 4A3IG 1RAHB 4LF7L 3VS5A 1A2UA 1Z9QA 1BKBA 5D6WA 2DLPA 5GAMg 4JBMA 4DOVA 1D8LA 2QKIC 4ZQ3A 3CD6T 1JWMD 2ZXPA 1M4ZA 5FO7B 1FNWA 1SNQA 1AN8A 2EFIA 3MTSA 4ZCKA 1WYDA 1T3LA 3EGXB 5JJIA 1YNZA 1ZKOA 1TWBA 3AB9A 2CP6A 3U9SA 2P5ZX 3TRZA 3EBEA 1EU4A 1TY0A 5CBEE 3VKIA 4GLXA 2SEMA 3CMAT 1CSQA 4HMJA 1TWAB 2EDGA 1ZQ1A 1B9MA 1CK1A 1TWAH 3VR6A 2EE1A 1AZPA 4HVVA 4IFDJ 3OIPA 2ESWA 3G71A 1G2BA 1UHCA 2RPNA 2A6ED 3H9NA 3AU7A 3J80i 3CCUT 4ID6A 4XTWA 1QVPA 1BXTA 3PVQA 1M1KR 2NUTA 3OYEA 4O2DA 5JJZA 4JI4L 2AQ3B 3J81j 1HNXQ 3CCMA 4JJNK 1H9JA 4CBVA 3NTIA 3HOUB 4IURA 3I55Q 3Q6SA 2DGYA 1ICFB 3HOUH 4Z88A 1Y14B 3EG3A 4DAMA 2E41A 4BXXH 1TWHH 3J7AF 3OOCA 4B3TQ 1JBMA 4A75A 1X9NA 4YCVA 3HS0C 3BG3A 4JRKA 5I4DA 4LF4L 1I4QA 3G6ET 3HFOA 3CRKC 3W5OA 5EG2A 1LT5D 4M78B 3TMEA 2HQHA 3LLRA 4OEMB 2OEOA 2QF7A 1X01A 2ED1A 4XTXA 3UDCA 1YJWQ 1UAPA 3X3NA 1E0BA 3T51B 4LF9L 2DBKA 1YNNC 1MD2D 3CCST 3CCMQ 3MP8A 2FZKB 5CV5A 4C3JH 4GN5A 3PV0A 2QQSA 1SRMA 4QW2A 4LDUA 3SEBA 5JJLA 2RM4A 2E76C 3HOUG 3PIOA 1C6VX 4OIJA 1W1FA 1STGA 5DY9A 2IIMA 2KRSA 2D2CC 3GV6A 2F0TA 1AZEA 3PIP3 4JOIA 4RTZA 2K5FA 1H8KA 2DD4A 4JLGA 5C6AA 5IN1A 1HR0L 1KC8C 3A8MB 4JYAQ 2XNAC 3BVMA 3TP5A 3UDXA 4LXCA 3MEUA 2A6EC 3F2UA 4OMOA 1GUWA 3L2ZA 4PLLA 4BWGB 2K6AA 3CXCP 1QVGA 4NW2A 1FD7D 4Y52H 1JJGA 3QDRB 4AYBB 4YTLA 3M4YA 5HCKA 1V1PB 1QUQB 4QVZA 1N34L 1HSQA 4IUVA 4K14A 2HDMA 3L1AA 4BE2A 1QVFA 2DJQA 1PRTF 2BDOA 1YJ9A 3S1NH 1JB3A 3HFNA 3FDRA 3M58A 5DLQE 5A2QE 1VQKA 5CR3A 2F2XA 2FVUA 3MHXA 4VUBA 2DNCA 1MI2A 4LJZC 2X4JA 5CBAE 3GTMB 2F4IA 2R3ZA 1UHFA 4YWKA 1PH7A 1WTWA 3JAML 4ZTJA 2KECA 4DEXA 2HL5C 3F1ZA 3DM1A 5E4XA 2ZXOA 1OO9B 1Y1WG 1G2TA 4LF6Q 2RJDA 3ASKA 1OV3A 4A4EA 1RTOA 1IXDA 2BZXA 5LMNL 2CZ1B 2FG0A 1GCPA 3OYNA 5CV6A 5IYCH 3I4NH 1BI2A 1BBZA 3SHWA 2RHXA 1NTGA 4GNXC 4HN7A 1W2BS 1ZXTA 2QGFB 2B3GA 3VR2A 2DL5A 4ZUIA 4AYBG 3MEFA 3C3LA 2LQNA 2E10A 4V190 5KNDA 4OX9Q 4GNXB 4CKEA 2KCTA 2O4XB 2VQFL 4NXMQ 1X55A 2IL8A 1C7YA 1YHQT 2X35A 4M7DB 1HNXL 1N8RR 3A8GB 5KE3A 4ZLTF 3EG2A 4H0LC 2YLCA 5J39A 3TZDA 4QCLA 4HT9A 3HOVB 2RQVA 4IIMA 2FRYA 3G48A 4DF7A 3NE5B 2NLUA 4JJCA 4M78E 1NBWA 3CEYA 1YEZA 3C46A 1Z9FA 2CGHA 4DBRA 3RKYA 2HSPA 3WOFA 2EYWA 4GOPA 3NP8A 1KD1U 1KHIA 4ODGA 3I4NG 3KXTA 1N32L 4OMQA 2BZYA 4AFSC 1JRIA 4FYXB 2RH2A 1RF2D 2M02A 1BR9A 2OQ0A 1NNXA 1MHNA 3LW5E 1QILA 2CWPA 3CCEQ 2IX3A 3GTPB 1LUZA 3G7ZA 4XU2A 3HKSA 3GTPH 1CHQD 2FEIA 2CH4W 3FLGA 1WGSA 2K4KA 3MWYW 3MP6A 4KN7C 1PH5A 4LFAL 2MWPA 2HQXA 3X24B 3V7CA 3QO3A 3VS1A 1Q8IA 1XNRQ 2COWA 2LT4A 3GTJH 3OWFA 1WQ7A 1PTOF 1A3TA 3HOVG 3JCMd 1EY9A 4KD4A 2PNRC 3U23A 2Z1CA 3WDNA 3HL8A 1M8MA 4HSPA 3OYBA 3URYA 5C5LA 4RGNA 4KUDK 5DEHA 3TP8A 4X34A 4JYAL 4WJWA 4J9IA 1D0XA 4XTZA 3M5AA 3OSOA 4FXDA 3I90A 1WVLA 4UPAA 1VQ5T 3KYHC 1JU5C 1NYFA 1Y96B 1DONA 2V4DA 4F7XA 4KH1B 4XTUA 2E64A 4RGTA 2CP7A 1JXMA 4B6MA 4LDVA 4RTUA 2XN9C 4DEYA 5JVG3 1E6HA 3CCQA 4NXNL 3SK5A 2SRCA 4OO1H 2XKOC 2PW5A 4A3CH 2KT1A 4A3BH 3D4DA 5GMKj 3CCVQ 4IKFA 1JOKA 4YY3L 5DM63 3GOXA 1PH4A 2K4YA 2V1RA 5LJ3j 2AKWB 3EJIA 2PNIA 3JCMP 1YJNT 1VQPQ 3JAMi 1AEXA 2HT1A 2EBPA 1BBUA 4CC7A 2P4TA 1U0LA 3RNUA 2PNHA 1DGSA 1X2KA 4IUPA 1CKAA 3MJXA 1A63A 1VQFA 1B34A 4BBSB 3OYMA 1S72A 1PCXA 4OO1I 2RQTA 3PNWC 2Z4HA 3DWPA 5D3DA 4QF4A 4M7DE 4DV6Q 1XNQL 2EKOA 1YCYA 2LQKA 4ALPA 1R9TB 1CI3M 4NL2A 4OO1G 1KL9A 4C0GA 2VGNA 1F9PA 4OX9L 2K2VA 2ZPHB 3CCLT 4GNXA 2XRQD 3CCRA 1BCPC 2NZ1D 3GP7A 4B3RQ 2DXTA 2O31A 2EQSA 3R6OA 1TS9A 4GS3A 1Q3LA 4D8DA 1M8AA 1IB8A 1R4PB 2H4OA 1Q1BA 2MHVA 1OXUA 1BCPB 4C5EA 4M78F 1XMQL 3F2DA 3S1MB 3I8ZA 2RQXA 1EYDA 2RCFA 2DJGC 4IJLA 3VS7A 1M30A 5FW9A 1G3WA 3OBYA 5NUCA 1Y1WB 4BBSG 4F7UG 1NJIR 1Y1WH 3GTGB 1EQVA 4KUIA 1LTBD 4AFUC 4NS5A 2G6FX 1WJQA 3QG1A 4Y7NB 2E2HH 2KUMA 1KRTA 5LJ5g 4DXGA 1DYQA 1NZ9A 3FJ5A 5CK9A 1KD1C 3CCRQ 1VQ6T 4KY5A 5C4XB 2M1HA 1X56A 3NXWA 3WVEB 4IPGA 5LJ3e 4DFAA 1BF4A 2ID0A 1I1JA 1BI0A 3IQLA 4CJ2C 1OXXK 2PO4A 1S40A 2K14A 4R55A 2JZ2A 2L11A 1EQQA 1EIYB 2K52A 1OX9A 3IKJA 2ZTCA 2F4VL 2V1QA 4LWCA 1J8IA 1M90U 4Z89A 2MNAA 1R77A 1FMWA 1FNUA 5FO8B 2DM1A 1BCOA 1IO6A 2EYFA 5ELCA 1NPRA 3EA6A 5ELEA 2D0NA 1H9MA 2QI2A 2B8FA 4FXGC 3SK4A 5A35A 5HGTA 4HJ9A 2C35B 3HZXA 4X66Q 2E6NA 2RNAA 1OPKA 1I4RA 2F0NA 3HKZB 1TUCA 1WYXA 4WTOB 1JJ2P 1O9SA 1Y96A 2MWOA 2LXKA 3K81C 4GZYC 1LT3D 1TQOA 3L2RA 2PUOB 1BYMA 1WNLA 1XWEA 4DK6C 5C4XG 2XDPA 1G8ZD 1YI2A 1LVKA 2QA4A 2CS7A 2L9HA 3I56T 1KLUD 1CKNA 1ZLMA 2HIVA 2VVKA 4OONA 3RLOA 3WWVA 1YIJT 1KRSA 3M9BA 3AHUA 4FF3A 2PQAA 1OX8A 2CREA 3R8BA 3ICEA 4OMMA 3RNJA 2EAYA 1K76A 1DOKA 2F0DA 2JQOA 1QZGA 3HOWH 2KAFA 3A8JE 1K8GA 4KHPQ 3DKMA 2CWAA 2UUBQ 3OPOA 4OF1A 1IXRA 4C8QE 3HEJA 1VQ9T 3A7AB 4PNYA 2E5LQ 5BN4A 4DUZQ 1B07A 2CUBA 4XU1A 2JA5G 3PF4A 3HRZC 1X6OA 4R4TA 3UATA 1HNZQ 5CORA 3CC4A 4F7UA 4M7DF 1M2OA 3FKIH 1HXYD 2NVQB 1LLRD 1YI2Q 2NVQH 2F0WA 2D8HA 1EZ6A 3UDFA 3M54A 3CMAA 4KY7A 1BOSA 3X26B 3S1RB 1SYEA 1F2YA 2DFUA 3KLRA 3Q24A 2EZVA 2CUDA 1Q8KA 3I5RA 3CCUA 4A3GB 1JB0E 4B3RL 5DAUA 1TXQA 2GBQA 2ZGWA 3VJPA 5CYUA 2CP5A 1WTPA 4EQPA 4CC4B 3HOWG 4LDXA 4PFOA 3GNGA 4CDDC 1TUGB 4QUCA 2JW4A 5LL6S 2BE5D 2MCNA 5FLXc 3CD6Q 2HDAA 1NR2A 4KJOA 2ATCB 5IOCA 3PO3B 4JK1C 1LCKA 3PO3H 1GXDC 2D8JA 5CQYA 4K6LA 2QQ9A 3G6EA 4XYQA 2C5CA 2DL4A 1WTQA 1TWGH 3EGDB 2HCIA 3DM3A 3V05A 1F2LA 4DR5Q 2GVBA 3GP8A 5HURA 5D3IB 4N8FA 2KE9A 1HCZA 1J6QA 1JT8A 4EMGA 3LYIA 3QOJA 1K8AU 3CCSA 1EZ8A 1PYBA 1Q90A 2NTSA 4POFA 3A5ZB 1S5FD 4A3GG 1CM9A 1K73R 1YWOA 2BDNA 4PNOA 2OTJT 3GLXA 4LFBQ 4CRIA 2WKDA 1E2WA 4BY7B 5AYFA 3HKZE 3ZFJA 4BY7H 2VV5A 4A4FA 1E1OA 1Z47A 3MXNB 3PO3G 2OX7A 2NZHA 1OOTA 4RTTA 4DBQA 5FRMA 2K5IA 1F2ZA 1Q82R 2J4XA 2Q8RE 3EFSA 1G2SA 3UI2A 1S5ED 1M90C 1WD1A 3E3XA 3OYDA 1KNAA 5E7NA 2MO1A 1V29B 2B29A 3FRPB 2JXMB 1RTNA 2M16A 1TWFB 1WHLA 2DL7A 2QQAA 4F16A 1LTLA 3BZDB 1I4GA 3U9OA 1A2TA 4AT1B 4RWSC 5C4JB 4DR2Q 2I07B 1CSPA 1K83B 3OW2P 2A36A 1OULA 4NKLA 1EYCA 4LE9A 2RJCA 2Z0WA 1RAEB 3NHNA 1V9PA 3QB3A 1RHPA 3VYHB 1B44D 4B3MQ 3T56B 1LTTD 4BY7G 1W3SA 4KHPL 4O1NA 2UUBL 1NBEB 4P5NA 4C8QF 3NMZC 2KMTA 3UWNA 1SYCA 2CH4A 2B2UA 5JEAH 1WTOA 4RGOS 2E5LL 2UUCQ 1WI7A 3WVDB 2XICA 2EVBA 4DUZL 2B63H 4CGYB 3DB4A 5FWCA 1HRJA 2EJGC 1Q95G 5KYWB 3AYHB 1VQ4T 1ZHIA 5I11A 1ZA1B 1AEYA 3EIVA 3J80E 1ILPA 1SNOA 5C0MA 2LCCA 8AT1B 4AIMA 1DM0B 3DWQA 2KK4A 3PMTA 4HIMA 2Q2IA 3EH2A 3S6WA 1WFWA 1BCPF 1W6XA 3TP7A 1FGUA 1FYNA 4IUUA 2PMZB 4PLIA 1WQWA 5L8RE 3PUYA 2E6ZA 4OGQC 4K11A 1STBA 2HQLA 3ONAB 2ICEC 2R58A 4L6V5 1KQSP 1LTID 1PKTA 1VQIA 2XIWA 3PF5A 1YHQA 5IY0A 1OYXA 5C0XG 2HAXA 2NBFA 2CZ6B 2GN5A 3OSSC 4FDBA 1I3QH 4XDXA 1QB5D 1Y1VB 3S2DH 2K04A 5EC7A 5L37A 1UE9A 5GMKi 4HIKA 4IPCA 1G3TA 5JEAG 2K5VA 5CV9A 1MJCA 3A0JA 4KN4C 3BDOA 3PVLA 1VQ8Q 5C5MA 3T53B 1XJVA 3LH5A 1HZAA 5GAOq 2LNHB 2IW3A 4B3SQ 4GLMA 3RMHA 2F0HA 3UA7A 1V8QA 2YUPA 3JCMh 2FL7A 2EXZA 2NVYH 4DV3Q 4EDUA 1ESRA 2JYOA 4BD3A 3NBHB 3F2BA 1G5VA 1I07A 1TSFA 1GXIE 3W1BA 3GTLB 5KYXB 2LJ3A 1PRTD 3GTLH 3EGDA 4DR5L 2XGTA 2KRMA 3HHTB 2K01A 5C0XJ 1IYUA 7AT1B 1O7YA 3LGLA 2LMCB 1EY7A 2DYBA 5KYUB 5JEAJ 2Q2HA 2DIQA 1RL2A 4A3JH 1DOLA 4HVWA 2WINB 4K5WA 1JQQA 1CT1D 3IRBA 4CDEC 4Q5WA 1Y1VG 3RLNA 2GCXA 3TDQA 1K8AC 4ZN1A 1CZGA 4LFBL 3X28B 4ZGEB 2HIXA 2W0ZA 1FGBD 4CHTB 5EBCA 1EU3A 5A0GA 2CQAA 1UWVA 1K8MA 2K5LA 2Y0SB 2YRCA 5CAIA 1TR5A 3T1YQ 2RB6A 4LF8L 3OBWA 4DR4L 1X75C 3CAMA 3BDLA 2K33A 3LWUA 2MGSA 3JAMc 3QPHA 2EVRA 1V1CA 5KH6A 4KMUC 3QXEB 2FZGB 2RQWA 5KE2A 1VQ7T 1VQ5A 2UXDQ 5GANd 4QMGA 3S17B 3TP6A 4C1NI 1ABOA 2N55A 2DTHA 3S17H 3SE0A 3ULPA 3UA6A 1WHKA 3HOZH 2L15A 2PZTA 3REBB 1C48A 1R8OB 2DA9A 3JCMW 1SSOA 3HG9A 3Q23A 5LMUL 5GADC 4FM4B 1H92A 1LYLA 1KSWA 1PG5B 1VF5C 3W3AA 1F9SA 2RSNA 1OTCA 3GTQB 3JCMf 2VASA 1V1OA 1N8RU 3GTQH 1VIEA 3M3YH 5K5PA 3S14B 1YJNA 2EYJA 4I7ZC 1VQNT 5IXFA 4JBWA 2A37A 3SXHA 2KJXA 2NTTA 1HHVA 2KNBB 2RQUA 1PRTC 2Y0SG 2UUCL 1N33Q 1GVPA 4LUVA 1PZKD 3S3NA 1SE2A 5JPNC 4BA2I 2BKDN 2M51A 1PRTB 2G9DA 4OGEA 4BDZA 2PMZE 4JG2A 2WP8J 5D6XA 4TVAB 3CPWA 1ENFA 4KI0A 3X20B 3RZDB 3BDCA 4X64Q 2YUQA 2RQRA 5CO7A 2DILA 3QWYA 2B2YA 3NQTA 5GAMj 1PTOD 3G6JB 2EW3A 1N6AA 2G3RA 1CSKA 2YDLA 1TKWB 1KAWA 1A15A 1WTHA 3KF8A 2B2VA 2F5TX 1Q7YU 1Y8OB 1X3EA 1TS4A
chains in the Genus database with same CATH topology
1WCMH 3M4GA 3CW2C 3NEMA 3BDUA 3I4OA 2IVWA 2E2IH 2XTIA 4PJOC 1BIBA 4H02A 1QVGS 4JI2Q 2OTLT 4GN4B 4RG1A 1L1OC 4C3HH 4PJOB 3CPFA 4DV3L 4GKKL 2WSCE 2QEXT 2Y4XA 1L1OB 2I5HA 1N36L 1PH9A 5CR2A 3TEHB 1VQ6A 4BB7A 4C92B 3OYLA 3FC3A 1KQ1A 2Y0SE 4JUVA 4EMKC 2ASBA 4JRPA 2Y4YA 2LQ8A 4R4CA 3BW1A 2VYTA 4EMKB 4TVRA 1HH2P 1N9RA 4JI6L 1K9MC 1CKOA 3T1YL 2BA1A 3L7ZC 5FLMH 1WPYA 4PJOG 2F3IA 3PUVA 2MF2A 2DAQA 2UXDL 2ZCFB 5GAMe 3QIIA 4NL3A 3EAEA 1VQAA 1VQOT 1P16A 3J7ZC 3F70A 5IAYA 1E3PA 4M78D 5HY6A 3MP1A 4D6WA 3JAME 3TU4K 4IFDI 3I56A 3K7AH 3I2ZA 5CCAA 1YIJA 4C2MH 3UDGA 2K3YA 1Q1EA 2GFAA 4EPCA 4XTCS 1N33L 4QQBX 5FLMG 1I4K1 1VQ9A 5FRNA 1AE2A 3RR5A 3U4VA 1QVCA 4LD9K 1PV4A 3JCMc 2N3SA 1QP2A 1FL0A 2ZM6Q 3O8VA 3FEOA 3CC4T 1NJIU 1I94Q 1UGRB 1SSFA 3AQQA 2XIDA 4R56A 4JI8L 4DPGA 3OTOQ 3ERSX 3CXCA 3KDFA 4DV0L 2YTXA 2KENA 4M77E 5CKEA 1SLJA 4WJ4A 2XHCA 4PJOE 3MEVA 2QTXA 5HKCA 3J7A5 5A0DA 3M9QA 5M3FG 4M7AC 1Q7YC 1WFQA 3SWNC 1SMXA 4JI2L 1Q12A 1JE5A 4MZPA 5AJ3L 4M7AB 3BJUA 4M78C 3SWNB 4C92E 4KULA 4HKEA 1V43A 1N9WA 3SDZA 4A93H 4BBRG 4QQ6A 4JI7Q 2PVOB 3GD7A 3RIRA 3EFRA 2OTJA 2PI2E 4EMKA 4M7DD 3JRZA 4OWXB 2EQKA 4RCCA 4M7AG 1IBKQ 4X9DA 2EWNA 4OWTB 2LNVA 5GQOA 1MGQA 5BR8L 4M78G 2ATWA 1PSEA 4QVDA 5A0LA 2R5AA 5GAN7 4A93G 3HPWA 4EQ5A 1WJSA 2QQBA 4J6XA 2LXJA 2JA9A 4KHZA 3JCMJ 4A3KG 4ZGJB 3K0XA 2BH2A 4HA8A 1H641 4PG3A 4J6YA 2I2LA 3E9FA 4E47A 4HJAA 4MDWA 1M8VA 3GTMH 1EWIA 4IJHA 3TS2A 2ZM6L 5EAYA 2IX1A 1VQ4A 1A0IA 3OYYA 5HK3A 4WJ3M 1U5KA 3OTOL 4M7DC 2QDYB 3VUBA 2JEBI 4M77F 4HJ7A 2DZCA 4PJOF 4M7AE 3FB9A 2HQEA 1VUBA 2K50A 4DR6Q 4E7JA 2PUKB 3CC2A 4HJ5A 2OAUA 1G3SA 1A8VA 3HOVH 5C3EH 4Y91A 1RIPA 3ZJYC 4B3TL 3K7UC 5ELOA 4DV1Q 1YHBA 4X65Q 1JMCA 4C92F 4OXPA 3M4PA 3SWNA 4UY8C 5ELNA 4M78A 2YHTA 3N5BB 5C6SA 1LM0A 4C8QD 4JI7L 2JA8H 5K36G 5GANh 4OWWB 3CMET 4M7DG 5GAEC 1KHCA 2M0OA 4PZ8A 1OXVA 3FJPA 5LJ5j 4BY1H 5C3EG 1I81A 4A3MH 4BI4A 1IBKL 4DNIA 3CBOA 2LRQA 4YHHQ 1VQ7A 1P8LA 2ZPIB 4KBMB 2XDDA 3QZ9B 1M5Q1 1Q81U 3JB9F 4AQYQ 2JA8G 4X6AH 1QUQA 4RMOA 4DR3Q 3LX7A 3CC7T 3H15A 4O6JA 3OS2A 3M57A 4BY1G 2R5MA 2HHHQ 4A3MG 3KF6B 2FYKA 4L5QA 3L42A 1VQNA 1GD7A 4UP8A 2UUAQ 3HRSA 5FJ8G 3V8KA 4L5GA 3JCMg 3E1SA 5GANf 4C8QC 4XIGS 4LF6L 1NE8A 1XMOQ 3QSUA 4A54A 1PYSB 3UE0A 3WXMB 4B9WA 4BBSH 3V8LA 4C8QB 2IY5B 2F69A 3G4SA 2P0QA 3URGA 4ATOA 1JJ2A 2CFMA 2YTVA 2DZ9A 1R9TH 1K0RA 2VXFA 3L2VA 2QQRA 5LJ5e 4NXML 4M7AF 5IE8A 2O4XA 4M7DA 1EIFA 4XTVA 3OYJA 3L2QA 3A74A 1I5FA 3FP9A 4BE0A 2EIFA 4DV1L 4X65L 3S1MH 2OTLA 3BZKA 4DAYB 1EQRA 1M1FA 3JSCA 2DUDA 2QEXA 3GTGH 2DVEA 4C8QG 4Y7NH 4A3EH 3ZEHA 4LDYA 4GKJQ 3V8JA 2KQWA 3OY9A 5C4XH 3NELA 1VIFA 2RHSB 1XNRL 1BBWA 1UE1A 2IT1A 4A4IA 5LJ3d 1QW1A 3J81i 4JI1Q 2X4YA 1VQLT 2A1AA 1XOVA 3LWIA 5GAOp 1E24A 4YHHL 3E19A 2A3LA 2JA5H 4A3EG 1U1SA 2JA6H 1E7ZA 3H8ZA 4QVCA 1VQOA 3OYHA 1Q46A 3JCMb 4DR3L 4GY5A 4N4HA 2EXDA 2HHHL 4K0KQ 1MKHA 3KF6A 3C95A 4R4QA 3J80c 3U58A 2UUAL 4C0FA 3BY7A 5M5XH 1XMOL 3RN2A 3HSBA 2FXQA 2JA6G 3HKZG 2V8JA 2V8IA 4BDYA 4DV6L 4C8QA 3A8LB 1OI1A 2CKKA 2ZPBB 4ME3A 3K8AA 1G6PA 3H0GH 1G291 3S1RH 3ME9A 4CI0C 3M85A 1WOCA 1NMGA 3OW2A 4A4HA 4A3GH 3I55T 1OZ2A 3DLLA 1NE3A 3RMSA 2V8KA 2Q2TA 2ES2A 3RERA 5HK0A 3LWHA 3META 2GVAA 1YJWT 3K80C 3RKXA 2UXCQ 3H0GG 4L5RC 4M75C 3S3OA 4A3DH 4PZ6A 1XPOA 2H5XA 2D6FA 2LSSA 4M75B 4JI5Q 4ZTFA 1KQSA 3CPWS 4JI1L 1B7YB 3OMCA 2KCMA 4DK3C 4DA4A 4QY7A 4X66L 2EQJA 1I5LA 2O01E 5GAN4 1PSFA 3OYIA 4RKUE 1TWFH 4A3DG 5C4JH 1UE6A 1K83H 1D3BB 1E22A 2E1HA 4QQGA 2YYZA 4K0KL 1M1KU 3OMGA 4DV4Q 3QYGB 1Q86U 3CBMA 4BACA 3PGGA 3A8HB 5CKHA 1X65A 1HNZL 4NOYA 4O0AA 1SN8A 2DXBA 4YCUA 4MZTA 1PFSA 4NB3A 4A3FH 4EX5A 1PHJA 5IT9c 5IYDG 5C0XI 4BE1A 2ZJQA 4XAXB 2R7ZH 5GROA 1UGSB 2FHDA 3CC2T 2L89A 1Y1VH 1FJGQ 1VS0A 1YNXA 4DV5Q 1H95A 1HZ9A 1OXSC 4LFCQ 3PCOB 1GM5A 3UT1A 4MMKA 2OWOA 4A3FG 1EFWA 3EN2A 3VV0A 3CCET 1LNXA 4M75E 2UXCL 2R7ZG 4KT0E 2JUFA 1BI3A 2WSFE 4QIWE 1HNWQ 4IUQA 2RO0A 2VY3A 3CMEA 1ZBXA 4XK8E 2JEAI 4JI5L 2RA2A 1HJPA 4J5YA 2DTIA 2JJQA 1FVIA 1X3FA 1PH6A 3LH0A 2ZZDA 2DD5A 2JNGA 2KHJA 4JCVE 3CXCS 4J15A 1CKMA 3P8DA 4M77D 4PJOD 1NPPA 4II1A 1CUKA 1EYGA 4DR2L 1QZHA 2Z6KC 3CCVT 1D3BA 3CC7A 2XG8D 4C92D 1VQPT 4B3ML 1WJJA 3HOXG 4DR1Q 3E9GA 2DXCA 3MO8A 3OYCA 3S14H 3SB2A 1AH9A 1VQMT 1M1KC 3V7RA 3M59A 2R92G 2RHYA 3KJPA 4OB1B 3PSIA 3KOJA 1W4SA 3RZDH 2EJGA 4MZ9A 4XQ3A 3OSVA 3G4ST 1K3RA 5GANg 2D0QB 1TWCH 2GQVA 1KIXA 3NTKA 5GAN3 3PGZA 2XI9A 5FROA 1IREB 1KXLA 3VYGA 2ZPGB 4DV5L 5IT9E 4M77C 2RHZA 2VGMA 1FXXA 5DLOA 3JB9D 2YV5A 3MCAB 4B3SL 3S15H 4LDWA 3VUZA 4M77B 4X9CA 5GMKh 3J81c 2VZAA 1D7QA 1C0AA 1VQCA 1VQJA 3M56A 4M75F 4J7IA 4C92C 5J3BA 2P0PA 3QJ6A 2DK3A 3GPLA 5GAHC 1HNWL 2GFUA 3GDEA 1V1QA 1BVSA 4XTYA 1HZCA 2D0OA 4JS5A 2FB7A 2OCEA 4JI0Q 3I4MH 4C0ZA 1VQLA 2N8NA 4M77G 3PUXA 2ZJPA 1T9HA 2E8GA 2CYZB 4M7AD 4N4GA 4LF9Q 2L8DA 2VQEQ 3HOYG 5KCOA 3M55A 2RHUA 4C92G 4HCBA 1X3GA 4JOIC 2HBPA 5GAMd 1KC8U 3RUXA 2QGQA 3NFCA 4P74A 4DR1L 2RHQB 5H1SE 3I4MG 1HR0Q 3JB9H 2AHOB 3JCMX 2K3XA 5M3FH 1N8RC 3VU3C 3S16H 2N78A 1XNIA 5J26A 4ELYC 3E9HA 3OYAA 3PTAA 1N9SA 1IBMQ 2C06A 1ASZA 1DJ7B 5KCHA 4X64L 2M9UA 4X62Q