2BKDN

Structure of the n-terminal domain of fragile x mental retardation protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
134
structure length
131
Chain Sequence
MEELVVEVRGSNGAFYKAFVKDVEDSITVAFENNWQPDRQIPFDVRFPPPVGYNKDINESDEVEVYSRANEKEPCCWWLAKVRMIKGEFYVIEYAACDATYNEIVTIERLRSVNPNKPATKDTFKIKLDVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FRAGILE X MENTAL RETARDATION 1 PROTEIN
publication title The structure of the N-terminal domain of the fragile X mental retardation protein: a platform for protein-protein interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 17
structure length 131
sequence length 134
ec nomenclature
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF05641 Agenet Agenet domain
N PF18336 Tudor_FRX1 Fragile X mental retardation Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2bkdN01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2bkdN02
2LCCA 2R58A 1KHCA 2GF7A 5C6SA 3OS1A 4N4HA 2MWPA 3OYGA 4FL6A 2IG0A 3L2WA 1WJRA 3LYIA 3MP6A 3QKJA 2G3RA 3OYKA 1G5VA 3EAEA 3OYEA 3LGFA 3OYFA 1H3ZA 5FRMA 3NTKA 2XDPA 1N27A 4A4GA 3ME9A 4ZTJA 4IURA 2R5AA 3L2VA 4A4EA 2X4XA 2NLUA 5FRNA 2RJEA 4II1A 1OZ2A 2FHDA 3PMIA 4BDYA 2L8DA 2RI3A 2LDMA 4IUPA 3LLRA 4LD6A 1XNIA 1OYXA 3OMCA 5KH6A 4L59A 2VYTA 3OYCA 2HQXA 2O4XA 3META 2L3RA 3F70A 3L42A 2RJCA 1RI0A 4C5IA 3S3NA 3PFSA 2M0OA 4QQGA 4A4HA 4IKFA 4HCZA 2RHYA 2JTFA 3OYHA 3MEWA 3NTIA 3QBYA 3FDRA 2D9TA 4BDZA 2DIQA 2HQEA 4E7KA 2EQUA 4UC4A 2RHUA 2RHZA 4A4FA 2RJFA 3E9FA 3FEOA 5KE3A 3S3MA 2LRQA 4B9WA 3OS0A 3FLGA 4IUTA 2E5QA 2LVMA 2MWOA 3DB3A 5D6YA 3UT1A 3SD4A 3OYNA 2E6NA 1SSFA 3MEVA 3OYLA 5J26A 1WGSA 4E7JA 2DIGA 4Z02A 4C5EA 3NTHA 4C5HA 4EDUA 4IUUA 2M1HA 4X34A 2QQSA 4QVZA 4B9XA 3ASKA 2DAQA 3S6WA 5C0MA 4ZTFA 2RHXA 2X4WA 2BKDN 3OS2A 5IN1A 2M16A 3MP1A 2L89A 2R57A 2EKOA 5D6WA 2EQJA 4E7HA 3S3OA 2XK0A 2P0KA 3H8ZA 3FC3A 2K3YA 2QQRA 3DB4A 3PNWC 4IUVA 4N4GA 2RO0A 2X4YA 4FU6A 2CKKA 3MP8A 4RG2A 3ZEHA 3GOXA 3LH0A 2GFAA 4E7LA 2LTOA 2BIVA 2GFUA 4BD3A 3LGLA 3LX7A 2WACA 2X35A 5M9OA 3O8VA 3OYMA 2EQMA 5FROA 3C4SA 3OYAA 2YRVA 4N4IA 4BE1A 3KUFA 2JZ2A 3QJ6A 3MEUA 4BE2A 3OA6A 4QQ6A 3L2UA 4BE0A 4QW2A 4GY5A 3E9GA 4PLLA 3P8HA 5KE2A 2BUDA 3OYBA 1OZ3A 3OYDA 3P8DA 4PL6A 3MEAA 4C5GA 3OB9A 4NS5A 4CRIA 3L2QA 3OYIA 3BDLA 3PMTA 3H6ZA 2O4XB 2RJDA 2EQKA 5D6XA 2RI5A 4OVAA 2K3XA 4IUQA 3UWNA 3Q1JA 3CEYA 1WJSA 3OMGA 5IAYA 5J39A 4BACA 3L2RA 2RHIA 4QQDA 4E7IA 2F5KA 3QIIA 2PQWA 2EFIA 4PLIA 3DLMA 3OYJA 3OQ5A 5KCHA 3MO8A 4Q5WA 3OY9A 5CIUA 1WJQA 2B8AA 1MHNA 2R5MA 1OI1A 2RI2A 3M9QA 5KCOA
chains in the Genus database with same CATH superfamily
1FX7A 1VUBA 3CCRQ 1PNJA 4RTUA 3OYEA 1M8MA 2L3PA 4M7DE 3ER0A 3I55A 2CZ1B 4IURA 2EYWA 1YHQT 2CP3A 2FZKB 4C8QB 4JJDA 4N0AC 3CD6A 1WHJA 2MK5A 2K57A 1KC8C 3HRSA 3A1PA 4NL2A 3CCVT 4PFPA 2CDTA 3TREA 1YHQA 3KFVA 4JS5A 3UA7A 2OTJT 2CSIA 2MI6A 3CCJT 2D8HA 1KQ1A 1QW1A 3M54A 2F69A 4WCIA 4EMGA 5GJVB 1ZUKA 3HRTA 5LJ5h 3QWXX 3TQ7P 2DFUA 4ELZC 1SRLA 2E3IA 2M16A 1HXDA 4JRPA 2ZPFB 2OTJA 2X4YA 3EGDA 2DBKA 3JCMd 3CCJA 3UPUA 1FXXA 4BI3A 4FYVB 4F16A 4PNOA 1IHWA 2LTOA 5CK9A 4PJMA 1M1KR 2YRCA 4M7AF 2L2PA 4HVUA 3CMEA 4BE1A 2YRVA 5A0LA 4J9HA 1QLYA 3CCET 2CZ0B 3L2UA 2OTLT 2DA9A 5GJWB 5GANe 3MEAA 5GAN2 4PJOG 2JT4A 3CCMT 1IRXA 3M58A 3VS5A 3BDLA 1K76A 1IXDA 4M78G 1PHTA 1X75C 1ZSZA 3L2RA 1KQSA 2FO0A 1K73U 2K2VA 2JNGA 4Y92A 1WPYA 1UE9A 4E7SA 1Q7YR 2XU8A 3OBWA 2IG0A 1H3ZA 4M4ZA 5IXFA 4A4GA 4BI4A 3CPWP 3JB9I 2V8IA 4ORZA 1H92A 1SHGA 1BI0A 2CP0A 3RR6A 2KEAA 1FMVA 2VGNA 4LD6A 1K9MU 3PGGA 5J3BA 3I56Q 1BBZA 8ATCB 4MDWA 3JCMg 3G71A 3X28B 4M75F 4HXJA 4AG2C 1VQ4Q 3UATA 2FG0A 2YLCA 1EIFA 4HT9A 4JUVA 3SEMA 4HCBA 2RB6A 2FZGB 3VRZA 4B9WA 3GPLA 2DZCA 4RTWA 2DIGA 1S1NA 1U06A 1D1CA 1D3BA 1Y0MA 2DXCA 3G1JA 4AFUC 5GAOp 1I4K1 3CBOA 1RACB 2HCKA 2HKQB 3OS2A 2HDAA 2HSEB 4QVDA 4ZGEB 1B34A 4HT8A 4RG2A 1R0CB 3GOXA 3LH0A 2GFAA 1ACMB 1RAHB 2CGHA 2K9GA 3NPFA 2DJQA 2A3LA 2EJFA 2MCNA 5LJ3j 5FROA 4P5NA 4AG1C 4JDSA 1U3OA 2NWMA 4J6YA 4MDXA 3QYGB 5GAMd 1WXUA 3E9GA 3CXCA 2J06A 1ZHIA 4PFOA 4RTTA 5LJ3d 4AMCA 1X27A 2DLPA 4C8QE 1ARKA 4MZPA 2ESWA 2RJDA 4OVAA 1UUEA 3V7SA 1GFCA 4EMKC 1HJDA 2RQUA 3G4ST 4XK8E 2J7IA 1CSKA 3MO8A 1OU8A 2AZVA 2CZ6B 2HBWA 2LCCA 1Q82R 3OS1A 3PT9A 1PD1A 3CPWA 4KULA 1GCPA 1VQNT 2KBTA 1G3SA 4RTYA 5IHNA 3ME9A 3JCMQ 1S72T 5FRNA 2KQWA 3BFMA 5FU6B 4M78C 4C92F 1SG5A 2QQ9A 2LDMA 1QVGA 3M5AA 5KH6A 2AZSA 2QA4Q 1JU5C 2JOYA 4AT1B 1TU0B 2C0TA 2LZ6B 5I2MA 4HCZA 4XU0A 1Q86U 1E6GA 4BUGA 3GNGA 2DTHA 2KYMA 3VS6A 2RHZA 5GAMg 2O2OA 2RJFA 3A98A 3MCAB 4IIMA 2DTOA 4C0DC 2DPPB 5KYNA 5LJ3g 2MOXA 2DL3A 1BI1A 3VS1A 3OYNA 3FJPA 1W2BS 1WI7A 3RERA 2CUBA 3U23A 3EHQA 2BKDN 3RIRA 3DKMA 5I21A 2C0IA 2LJ3A 3HSBA 1RUWA 1GFDA 3DB4A 1M90R 7AT1B 1UG1A 2X51A 5IH2A 3FRNA 2EVRA 1I81A 2LJ0A 2EQMA 4R0KA 3VS0A 3C4SA 1OX9A 2A37A 3QJ6A 2COZA 1VQ7T 4BE0A 2DNUA 3CC4T 1QP2A 1YCSB 1YIJT 4J9IA 1KK7A 3Q1JA 5CKHA 1VQ5A 4E7ZA 2CREA 2GTJA 3BW1A 5D7UA 2A0FB 1RAEB 4E7IA 4ZGJB 3OYJA 2CUDA 2L5QA 1QCOA 3FIFA 2V8KA 4BY6B 1RABB 5GANd 1VQ7A 2RI2A 1K73R 1KHCA 1JO8A 1WHGA 2LQWA 3LGFA 2PUKB 2Y90A 4JS4A 2QXFA 2I0NA 2ATCB 4CI0C 3CQTA 4M77F 3C95A 2Y4XA 4J8OA 3REBB 2D0NA 2FRYA 4J7IA 1WDXA 3E1SA 2HNIA 4N0AA 2E70A 3CC2Q 2PVDB 3ZFJA 3G6ET 3S3NA 1WZOA 3ZBDA 1K9MR 1Z9QA 3G7ZA 2LJ1A 2OJ2A 2KAFA 2M51A 3A5ZB 1YBYA 4OGCA 1VQKT 2J6FA 3P8BB 3S3MA 2LRQA 3OS0A 3DB3A 3NHNA 1FMKA 3WVEB 4MMKA 2J05A 4C5HA 2YDLA 2M1HA 4C8QA 4JZ3A 1UJYA 5GMKl 5HK3A 4FYWB 1D0YA 5GANg 3THKA 3H8ZA 2YHTA 2DMOA 3X20B 4DBFA 2QGGA 2CP7A 2LT4A 2LX9A 1V29B 1E6HA 4HKEA 4M7DB 2B86A 3V7CA 3LX7A 4M7AB 2ZPHB 2GQIA 2QTVA 5KYYB 5A0DA 2AK5A 2WSCE 3KXTA 1B07A 1NM7A 1M1GA 1OOTA 3P8HA 2BUDA 3OYDA 1RADB 2KVQG 1YJ9T 4C5GA 4JLGA 1N8RC 2YXYA 3EFSA 2FRWA 4FM4B 1I1JA 3E2UA 1GL5A 4CC7A 2B8AA 4XTWA 3JCMh 1NJIC 1I0CA 1T3SA 3OS5A 2CT4A 5CKDA 1GCQC 3I35A 4N4HA 3QKJA 2W0ZA 2ED0A 1FMWA 1TUCA 1VQ6Q 4GLKA 4L5GA 4E47A 3RDVA 2M0YA 2VWFA 4OGEA 2L8DA 2RI3A 2DEUA 3LLRA 2EIFA 4KRTA 3OW2S 2DF6A 2HQXA 3QXEB 4M75B 3CC7A 4C5IA 4PJOF 4KGVB 1K8AC 1PRLC 1PWTA 2JMCA 4M78F 1ZBXA 1JBMA 2E5KA 3EHRA 4C8QG 2HAXA 1NEBA 5FU7B 1KD1U 2MMPA 2Z0WA 1VQLQ 2EQIA 1AWJA 3C12A 2QASA 4J83A 1X6OA 3VS3A 3RMQA 3M0SA 4Z02A 1YJNQ 1MUZA 1TXQA 2P4RA 4XTYA 3RMSA 2X4WA 1E7OA 4F7UA 3O5ZA 2R57A 2EQJA 4E7HA 3S3OA 3QZ5B 1GXIE 1EFNA 2NUPB 2E1HA 4FU6A 4OF1A 3MP8A 2P84A 1G3YA 4BD3A 3LGLA 1A0NB 3BDUA 1QVPA 2FEIA 3SWNB 2Y4YA 1X6GA 1M5Q1 1N9RA 1VYUA 2K5LA 1IREB 4GY5A 1OZ3A 4OMMA 3I5RA 5FWCA 1R77A 1G83A 4RCBA 5LJ3e 4V2SA 3VUBA 1O75A 1QWFA 3TSWA 2CT3A 3CPFA 4FW1A 3AT1B 2DO3A 1OPKA 3CCUT 4HVVA 5HKCA 2MF2A 1TS9A 4Z89A 2JM8A 1WHMA 2O01E 5GAOn 5GMKi 1TUDA 3EG9B 3CCLQ 4C0ZA 4J5YA 3OYYA 1UB4A 4C92B 5GAMh 1YITA 4GBQA 2CSQA 9ATCB 1JJ2A 2ZGWA 1Q82U 1XNIA 4VUBA 1MV3A 3LW5E 2QG9B 1UGVA 2HZYA 1RLQC 4R56A 2MAMA 3EGXA 4IKFA 3CCQT 2A28A 4LUEA 3HFNA 2EPDA 1BB9A 2EQUA 2RHUA 3FB9A 2DKGA 3JCMX 1EX4A 4M7AE 3EFOB 2J6KA 4IUTA 3CMAA 3UT1A 4F7UG 1SSFA 3EG2A 1TTHB 3NTHA 2L3QA 5KYXA 3CCQA 1RAAB 5GAN8 3QWYA 4ZTFA 3BY7A 3I56T 1IGUA 1QVFS 2KR3A 2QGFB 4N4GA 4OB1B 1VQ4T 1OEBA 2NUTB 1CKAA 2E4HA 3JRZA 4AFSC 2QK0A 1VQ8Q 4C8QC 4JPBW 1MMGA 5GAN3 1PC0A 2HMAA 3TCJA 2KK4A 1VQOQ 1MGQA 2GNCA 3CCVA 2H3JA 3ZL7C 1M90U 3M59A 1NYFA 4NL3A 3RKXA 2EGEA 2ZAEA 3M0QA 2VVKA 2VASA 4LDVA 1I8FA 1Y96B 3DLMA 3M4GA 2LQNA 5GAN5 4M75E 4JJBA 1VQMQ 2HQHA 1VQ9T 1QWEA 2KDSA 1RAFB 4FL6A 1ZQ1A 2K3BA 4PJNA 1G5VA 3V8JA 1N27A 1FWZA 4M77B 4EMHA 5GAOm 1WNLA 4IUPA 3H0HA 1U1TA 1KC8U 2HL5C 1VQ9A 1AWOA 2NUZA 3CCEA 3I55Q 2OTLA 3TU4K 3CD6Q 2QI2A 3T9NA 3CCMA 4A53A 1PKSA 5CCAA 2ZPGB 1WQWA 2LT1A 5GANh 2C0OA 1AOJA 1VQPT 1SSHA 1G3TA 3I9QA 1XJWB 1YHQQ 2A7YA 1KD1R 2QQSA 2DAQA 4KH0B 5FWBA 2KRNA 2QEXT 2EJGA 3MP1A 2XDDA 2CH4A 3A8MB 4M7DD 2VC8A 1Y07A 4J6XA 3M0RA 4TVRA 1VQPA 3EG1A 4Y91A 2HD0A 5HK0A 1KQSS 1UGPB 3KUFA 2JZ2A 2DTIA 1I07A 5CO7A 6AT1B 2OTJQ 3CCJQ 4JJCA 2QEXA 4CRIA 1BIBA 2O4XB 4XTZA 4C92E 2RI5A 2NYSA 1Z9ZA 3X26B 3CMEQ 2D8JA 2P0PA 2HSPA 1M3BA 1C6VX 2XG8D 4DQ2A 1VIEA 2PQWA 2D6FA 2OAWA 2BTTA 4RUGA 1AT1B 4XU1A 1Q86C 5C6SA 3M57A 5HY6A 2E65A 4M7DA 3LYIA 1QQJA 3V8LA 2FL7A 2G3RA 2AKLA 2LX7A 3NGPA 3RBBB 3VU3C 3OYFA 3NTKA 5IT9E 1WX6A 1C0MA 1GCQA 5KYYA 5CQYA 5DY9A 1WHKA 5AYFA 4BDYA 5CR2A 1RLPC 4K11A 1Q81C 2KRSA 2BZXA 3LWHA 2L3RA 4PJOB 2KGTA 2M0OA 4J9GA 4F17A 1ZX6A 4M78B 1BYMA 2DIQA 4UC4A 1LOJA 3G71Q 4FYYB 1IB8A 2CZ7B 1D1AA 5KE3A 3G4SA 1LPLA 2PU9B 5CKBA 1PKTA 3J81E 5GMKm 1ABQA 3OSVA 4EDUA 2W10A 4X34A 4A54A 2F2VA 2RHXA 1IHVA 2GCXA 2LNHB 3CC2T 3M0TA 1VQNA 2CYZB 1T0HA 2XHCA 3CXCS 1S72A 4MZMA 4M75A 4OMPA 2QDYB 4DEYA 2O88A 1PCXA 1QMCA 1RL2A 4QVCA 5FU6C 1BI3A 5LJ5j 3HTRA 1R8OB 3MEUA 3OA6A 2RM4A 4PL6A 3EH2A 3CCST 2PNIA 4OMOA 2XDBA 1H8KA 1BKBA 2VXFA 4M77E 3A8HB 3L2ZA 5LJ5d 4XTUA 1UGRB 3CEYA 3M56A 4YTLA 5J39A 1NBEB 2J6OA 2F5KA 3M0UA 2JMAA 4M7DG 2KY9A 4OMQA 3A8LB 3HHTB 1N9SA 3EGDB 2A08A 4J9DA 1KFZA 1YJWT 5KCOA 2VKNA 2NUPA 1UGQB 2JW4A 5EC7A 2JJ9A 1QVGS 1PM3A 2PVOB 3CCSA 2DE0X 4HVWA 2SEMA 2XD0A 3SWNA 1I5LA 2JS2A 2BZ8A 3OW2P 3WVDB 5CAIA 3OMCA 4DBRA 2AKKA 4X9CA 2IPOB 1ZSZB 1YJWA 1ZSGA 1ZBJA 1TSFA 1AEYA 2KI7A 5I2SA 3CC4A 1KC8R 3TVTA 3JCMW 1NEGA 3A8OB 1YIJA 1D1BA 4C8QD 3JB9D 1PRMC 4A4FA 3OSSC 2LQ8A 2V8JA 1VA7A 2DL5A 3EG9A 2X4JA 5LJ5f 5LJ5g 1M2VA 2JN0A 3LH5A 4LDWA 3OYLA 4E7JA 2YLBA 5DLOA 2KXDA 3GF5A 3PVLA 2JS0A 1H3HA 4IIOA 4M75G 4C92A 4BY6C 2CP2A 1Y71A 3URGA 1M1KC 2YUPA 2FB7A 2F2WA 2DL4A 1UDLA 2HEQA 3N5BB 5FW9A 2DILA 2BIVA 1M3CA 2VGMA 3O8VA 1UHCA 3GP8A 3C94A 3G6EA 3M55A 3M0PA 2COYA 2QQAA 1X01A 2GGRA 4J6WA 2K4YA 1YJNT 1D3BB 4ME7A 1WQ7A 2EGCA 5IAYA 4DBHA 1Q7YC 1VQKA 2RK1A 4QQDA 4F7UF 3AHUA 1YI2T 2IIMA 3PE0A 5GAN7 1SKUB 4PJOE 2ECZA 4ELYC 3UA6A 1WFWA 1VQ5Q 2GBQA 4FYXB 4M78E 1WJRA 3D7SB 1BCOA 2DRKA 3OYKA 5FLXE 2XDPA 1HD3A 2RH2A 4ZTJA 4PK4A 2R5AA 3L2VA 1DJ7B 3OW2A 2P0QA 1HK9A 4II1A 1VQ7Q 1OZ2A 2CS7A 1YI2A 2OX7A 1AWXA 2DYBA 3VJPA 1JXMA 4FT4A 4M7DC 4JRKA 4EPCA 2IVWA 4CC3A 4M7AC 2LCLA 1YJ9A 1T3LA 2E41A 3MEWA 1IGQA 3FDRA 3RKWA 1Y96A 2EBPA 1X2QA 2X9HA 2ENMA 2M9UA 5KYWB 3CCLT 2F5TX 4C92G 3QPHA 3JCMb 1WGSA 5CQXA 2SRCA 4C5EA 3VYGA 2QTXA 5GAOq 1QVFP 1M27C 4M77A 1HSQA 5DLQE 2VV5A 2MIOA 3ULRB 4OB2B 4DA4A 3R6OA 1WIEA 3CCRT 2ZPBB 4WF2A 2RPNA 2OI3A 3JB9G 3LWIA 3RESA 2WACA 2X35A 2HBPA 4Z8AA 1X6BA 1KHIA 2D0QB 2DZ9A 4QW2A 1MMDA 4PLLA 2K6DA 4JJNK 3P8DA 3VKIA 2DVEA 4NS5A 2FYKA 4M75C 1KIKA 4LD9K 2EGAA 3MHXA 3JB9H 3H6ZA 3QJYA 5ECAA 1MNDA 1X2KA 1Q82C 8AT1B 2K79A 1AZGB 2LMJA 3JAME 2AHJB 1QKWA 1D0XA 5FU7C 1WJQA 4B6MA 4DOWA 3M9QA 1VQ8T 1NJIU 2GQVA 3GLXA 3VYHB 1ABOA 3VRYA 1VQOT 1BCMA 4A4EA 2X4XA 2YUQA 1YP5A 3GIBA 1GBRA 1YWPA 3EG3A 4QKUA 2VB6A 1NZ9A 2JM9A 3JSCA 2JTMA 2O4XA 4ZGDB 3F70A 2KROA 4OB3B 2OAUA 1VYVA 1B3QA 3SWNC 3TSZA 4PKCC 1VQMT 3NTIA 5CKEA 1IO6A 3WXMB 3REAB 1KJWA 1K8AU 1RAIB 3QYHB 4MMLA 5IHIA 3CC7Q 2DEQA 2P4TA 4M77G 2QDLA 4KUDK 3CCUA 3SD4A 1NG2A 5LJ3h 2E6NA 4LDUA 2I2LA 4A63B 2XIDA 4DOVA 1M90C 4J9EA 2DYIA 4DBQA 3JCMc 1BIAA 4E2FB 1RAGB 2L89A 4X9DA 4QT7A 3I55T 2A36A 2RO0A 3CD6T 2XMFA 2RQVA 2DD5A 2KXCA 5M9OA 3OYMA 4KUIA 4C92C 1MV0B 2AIRB 1M4ZA 2FPDA 1LJOA 1UGSB 3PIOA 2ZCFB 4XTVA 2F2XA 4KBMB 1SPKA 2LC4A 1CKBA 2QQBA 5LJ5e 1K73C 2JUFA 1V76A 5GAN6 1EZZB 3RUXA 2M02A 3OY9A 5CIUA 4OMFB 3NMZC 3JCMP 1JJ2S 5CVIA 2R58A 3M4YA 2MWPA 3JB9J 2L0AA 3I56A 5FRMA 2EWNA 2VUBA 1JEGA 1BK2A 5L23A 3FJ5A 1OULA 4KGXB 1VQ4A 1K9MC 4FT2A 1F1BB 4RTXA 4MZTA 1SRMA 3MJXA 2FPFA 3CMET 4LXCA 1QCNA 1OU9A 2EYQA 2MPXC 2HKNA 4A4HA 2WSFE 3GNFB 1YITQ 3OYHA 3CCUQ 2O9VA 2RK2A 4EIKA 2EYYA 2CP6A 3QO3A 4M7DF 3E9FA 2XKOC 1GBQA 4JRIA 2LNVA 2MWOA 2YUNA 3HP9A 1K4US 4GLMA 5C0MA 3S6WA 3H41A 3KBGA 2DETA 3CXCP 2DERA 2PUOB 2O31A 5D6WA 3CMAQ 4O6JA 3PTAA 2P0KA 1M1FA 2K3YA 2QQRA 4FW2A 2RQTA 4E7LA 2LCSA 1OX8A 2DXBA 3CCQQ 1W2BP 2EKHA 4M77C 3HFOA 1W6XA 3A8GB 4DEXA 4N4IA 3G71T 1J3TA 1U8RA 1LNXA 2ABLA 2PZ1A 4BB7A 1NPPA 4BI8B 2BE9B 3VV0A 2EYZA 3OYIA 2QA4T 2H3EB 1ZA2B 2EQKA 2K3XA 1D09B 2E3HA 2RQWA 4F7UB 3M53A 5L8RE 2K5FA 4M7AD 3CCVQ 3SFMA 1G3WA 4PLIA 1IZ6A 1QVGP 3JCMf 3UF4A 1N8RR 2YT6A 2LQKA 3CBMA 2WSEE 4KT0E 1KG1A 4LUDA 3JCMV 2QA4A 1RI9A 1XTDA 3E19A 2ZPIB 4C0GA 1NJIR 4J9FA 2RA2A 1Y57A 2KRMA 4JRQA 4PJLA 4KH1B 1PSEA 5IXBA 2X3WD 2K7AA 2BE7D 4L59A 3JV3A 5GMKj 5KYUB 3VS2A 1WLPB 2DL8A 1LCKA 3RNJA 2DXTA 2JTFA 4EMKB 1AVZC 2D9TA 4M7AA 2DBMA 4XTXA 3J7AF 1M2OA 4NOYA 1VQ9Q 4X1VA 3CCEQ 5GAMj 2OTLQ 3FLGA 2E5QA 4RKUE 1K8AR 1VIFA 4M75D 3CCMQ 1X43A 5I11A 1ZUYA 3VUZA 1G2BA 4QVZA 5IN1A 1HYOA 2FZCB 1ZA1B 3HPWA 4RTVA 4L6V5 3EGXB 3FC3A 3QDRB 3DLLA 1W2BA 3HKSA 1MMNA 3QG1A 2K2MA 2GFUA 2RQRA 2JXBA 4F04B 3X24B 2DVJA 3EFRA 4E6RA 5A0GA 4Z88A 1U1SA 5KE2A 1WYXA 5KYWA 1SF9A 2JVVA 2ED1A 3L2QA 1VQPQ 4PJOC 2RNAA 4C0DB 1PD0A 5KYXB 4IUQA 4HCKA 1YN8A 3OMGA 3TEEA 2YWWA 3QIIA 2QEXQ 5GAOl 1P92A 4LDXA 4FCYA 5D6XA 2DL7A 2QYZA 1JRIA 1JXOA 3L2WA 2PVGB 3MP6A 3EAEA 3CC2A 4ZN3A 2H8HA 5GAMf 4FSSA 4C8QF 3JB9F 1N6AA 5LJ3f 4A4KA 2FHDA 3CPWS 4OMLA 1OYXA 2C06A 1KSWA 1NE8A 1X69A 4LDYA 1GRIA 4J9BA 3OYCA 1Q81U 3META 3MKDA 4M7AG 4O5VA 1NLPC 2RJCA 1RI0A 4HA8A 1XQHA 1M30A 1M9SA 4BDZA 1M3AA 4C92D 1VQ5T 1WXBA 1V1CA 3R6NA 1JQQA 2PTKA 3H0FA 3L1AA 2LVMA 3CBPA 3H0IA 2G6FX 1SEMA 4LNPA 2KYBA 3RKYA 3OBYA 4FSXA 3BE3A 3MPUB 2DX1A 1YFNA 2RN8A 3G4SQ 1NLOC 4F7UE 1VOMA 5GANj 1H641 1ZUUA 5GAN4 5HCKA 3ZEHA 2CH4W 2RF0A 1VQ6T 5A2QE 1OQKA 2FPEA 4OP0A 1UFFA 3V8KA 1FYNA 1VQNQ 4BE2A 2DD4A 4JLIA 1VYTA 3GBQA 3QHSA 1WA7A 1S72Q 3OYBA 1ZSZC 3SB2A 3VS4A 2EJ9A 4ESRA 2ZZDA 4AFZC 4BACA 4RG8A 1M8VA 1Q95G 1T0JA 2EFIA 1VQ6A 4ZNXA 3OQ5A 5CKFA 5KCHA 4Q5WA 4ATOA 3PIPA 2R5MA 1WHLA 1TUGB 1JB0E 1YWOA 2F1LA 2XI9A 3OYGA 5EG2A 1VQLT 1AHJB 3EFOA 1K0SA 3QDFA 2KNBB 2NLUA 4RCCA 2RJEA 2E64A 2RMOA 5LL6S 2E10A 1D0ZA 2XICA 3CCSQ 3JCMJ 1B7TA 1B34B 3L42A 1TG0A 4WTOB 1OPLA 3C0CA 1SHFA 1VQLA 4FIBA 2NUTA 5DM7R 2RHYA 4D6WA 5GANf 1YJNA 4M77D 1KD1C 1YJWQ 3FEOA 3JCMe 3CC4Q 4JZ4A 1K0XA 5D6YA 2MYSA 1YNZA 4PFZA 2KT8A 3MEVA 2V1QA 1YIJQ 1MNEA 4RTZA 2E6ZA 4KGZB 3SHWA 3PVQA 4IUUA 2X3XD 4B9XA 3ASKA 1BI2A 3VS7A 2JTEA 2EAYA 2D1XA 4D8DA 2QAZA 3QSUA 1WHHA 2CP5A 4IUVA 1M1KU 1TWBA 2EW3A 1R0BG 2YSQA 1PSFA 1K1ZA 1W4SA 2LP5A 4XU2A 4CC4B 4J7FA 3OYAA 3CC7T 1N5ZA 2YUOA 3SDZA 3OB9A 1AD5A 2BZYA 4C0FA 1UHFA 4F14A 3QUIA 3UWNA 3I5SA 1KQ2A 3HRUA 2FVUA 1NYGA 2YRDA 1UEBA 2L3SA 3G6EQ 3CCLA 1PG5B 2COWA 2DXUA 1Q7YU 1YCYA 1JJ2P 2HL3A 1C1AA 2RD1A 4CC2A 1MHNA 4J9CA 4XAXB 1QKXA 1UJ0A 4ANJA 4D8KA 2GF7A 1G8XA 5IHKA 1VQKQ 1UTIA 3EG0A 1Q86R 3CCRA 2KMTA 1N8RU 1TH7A 3PMIA 2ROTA 3NFCA 3H9NA 5AT1B 2DJZA 1UECA 2VYTA 1W70A 5I22A 3EGUA 1NPRA 3PFSA 4QQGA 3V7RA 1W1FA 2VXEA 1YI2Q 1LVKA 3QBYA 3J80E 1Q81R 3IQLA 2HQEA 4Y28E 4E7KA 5GMKe 1MMAA 2ZPEB 2DRMA 1YJ9Q 1QCFA 1AWWA 2V26A 3QZ9B 4PJOD 1K9AA 2E12A 3X25B 1VQ8A 1XOVA 1Y7XA 4M78D 5GAMe 1O9SA 4OB0B 1ZLMA 4LN2A 4XU3A 2EKOA 2V1RA 2XK0A 1VQOA 2GTOA 3PNWC 5GAOr 5KYUA 4RMOA 4PJJA 2CKKA 4R55A 1YITT 3EH1A 2AT1B 4HCCA 1AZEA 4AFQC 4EMKA 5GMKh 1QVFA 1I5OB 4QQ6A 2K5IA 4XQ3A 1QP3A 2KE9A 3HL8A 1M2VB 3UDCA 1VQMA 4OMNA 3PMTA 2EYXA 2ROLA 2KT1A 2KSSA 1WJSA 1OV3A 1BU1A 2RHIA 4LE9A 1WXTA 2O9SA 4PJOA 4ZN1A 3CMAT 1KQSP 1U5SA 3INZA 2DK3A 1TOVA 4M78A 2DM1A 1OI1A 5J26A
chains in the Genus database with same CATH topology
1FX7A 1VUBA 1UGQB 1QVGS 2WSEE 4N4HA 2PVOB 3QKJA 4KT0E 1KG1A 3CCSA 3JCMV 3OYEA 2QA4A 1XTDA 1NJIC 4M7DE 3E19A 3ER0A 3I55A 2CZ1B 4IURA 2ZPIB 4GLKA 1YHQT 4C0GA 4C8QB 2XD0A 4L5GA 3SWNA 4N0AC 2RA2A 4E47A 1I5LA 3CD6A 2K57A 4JRQA 4OGEA 2L8DA 2RI3A 1KC8C 3WVDB 3HRSA 3LLRA 5CAIA 1PSEA 3OMCA 2EIFA 4L59A 4X9CA 3OW2S 5GMKj 2HQXA 3QXEB 1YJWA 4M75B 4NL2A 3CC7A 4C5IA 3CCVT 5I2SA 4PJOF 3CC4A 2DXTA 3JCMW 3A8OB 2JTFA 4EMKB 1YIJA 1K8AC 2D9TA 3TREA 4C8QD 4M78F 3JB9D 1YHQA 1ZBXA 4JS5A 4M7AA 1JBMA 4XTXA 3J7AF 4NOYA 2OTJT 4A4FA 2MI6A 3OSSC 3CCJT 1KQ1A 5GAMj 4C8QG 1QW1A 2LQ8A 5FU7B 2V8JA 2HAXA 1KD1U 2MMPA 3M54A 2F69A 3FLGA 2E5QA 4RKUE 2X4JA 3C12A 5LJ5f 4EMGA 5LJ5g 1VIFA 2JN0A 4J83A 4LDWA 1X6OA 4M75D 3OYLA 3RMQA 3HRTA 4E7JA 5LJ5h 2YLBA 4Z02A 5DLOA 3GF5A 3VUZA 4QVZA 4XTYA 4ELZC 1Q86U 4M75G 4C92A 3RMSA 2X4WA 4F7UA 5IN1A 2M16A 1HXDA 4BY6C 1Y71A 2R57A 3URGA 1M1KC 3HPWA 2EQJA 4JRPA 4L6V5 4E7HA 3S3OA 2ZPFB 3QZ5B 3FC3A 1GXIE 2OTJA 2X4YA 3JCMd 2E1HA 2FB7A 3QDRB 3DLLA 4FU6A 1FXXA 4OF1A 3HKSA 3MP8A 3N5BB 4PNOA 4BI3A 3QG1A 1W2BA 1G3YA 2LTOA 2BIVA 2GFUA 4BD3A 3LGLA 2VGMA 3X24B 5CK9A 3O8VA 3BDUA 3EFRA 1QVPA 4M7AF 3CMEA 4BE1A 2YRVA 5A0LA 3SWNB 2Y4YA 1M5Q1 3CCET 3GP8A 1N9RA 3C94A 3G6EA 2CZ0B 3M55A 3L2UA 2K5LA 5A0GA 2OTLT 5GANe 1U1SA 1IREB 4GY5A 5KE2A 1OZ3A 2QQAA 1X01A 3MEAA 4PJOG 2JVVA 5GAN2 3CCMT 3L2QA 4PJOC 4J6WA 3M58A 2K4YA 3BDLA 4C0DB 1YJNT 1D3BB 4ME7A 4RCBA 5LJ3e 4IUQA 4V2SA 3VUBA 1WQ7A 4M78G 1O75A 3OMGA 5IAYA 1X75C 1VQKA 3L2RA 1Q7YC 1KQSA 2RK1A 4QQDA 4F7UF 3CPFA 3TEEA 1K73U 3AHUA 2K2VA 2JNGA 3QIIA 1YI2T 2DO3A 5GAN7 3CCUT 5HKCA 4PJOE 5GAOl 1WPYA 1P92A 2MF2A 4ELYC 4LDXA 5D6XA 2XU8A 1JRIA 2O01E 3OBWA 4M78E 3L2WA 2IG0A 5GAOn 1WJRA 2PVGB 3MP6A 5GMKi 3OYKA 3EAEA 5FLXE 3CC2A 4ZN3A 1H3ZA 2XDPA 4A4GA 4C0ZA 2RH2A 4BI4A 4J5YA 4ZTJA 3JB9I 5GAMf 2R5AA 3OYYA 3L2VA 1DJ7B 1UB4A 2V8IA 2P0QA 4C8QF 3OW2A 3JB9F 4C92B 1BI0A 1HK9A 1N6AA 4II1A 5LJ3f 4A4KA 1OZ2A 2CS7A 2FHDA 5GAMh 2VGNA 3CPWS 1YI2A 1JJ2A 2ZGWA 4LD6A 1Q82U 1K9MU 1XNIA 4VUBA 1OYXA 3PGGA 5J3BA 3VJPA 3LW5E 4FT4A 2C06A 1NE8A 4M7DC 4MDWA 4LDYA 3OYCA 4JRKA 3JCMg 3META 4EPCA 3G71A 4R56A 1Q81U 2IVWA 4M7AG 4O5VA 2MAMA 3X28B 2RJCA 1RI0A 4M75F 4M7AC 4HA8A 4IKFA 3CCQT 2LCLA 1XQHA 1YJ9A 1M9SA 2YLCA 3HFNA 2E41A 1EIFA 3MEWA 3FDRA 3RKWA 1Y96A 4HT9A 4JUVA 4BDZA 2EQUA 4C92D 2RHUA 1VQ5T 3FB9A 2DKGA 4HCBA 2RB6A 3JCMX 2M9UA 4M7AE 3L1AA 3CCLT 2F5TX 4B9WA 4C92G 4IUTA 2LVMA 3GPLA 3QPHA 3UT1A 4F7UG 3CBPA 3CMAA 2DZCA 3JCMb 1SSFA 1WGSA 5CQXA 2DIGA 4C5EA 3VYGA 3NTHA 2QTXA 5GAOq 1D3BA 3CCQA 3RKYA 5GAN8 3OBYA 2DXCA 4M77A 4ZTFA 5GAOp 4FSXA 1I4K1 3BY7A 3CBOA 5DLQE 3I56T 2VV5A 3OS2A 1QVFS 4QVDA 4ZGEB 4OB2B 4DA4A 4F7UE 3R6OA 4N4GA 5GANj 3CCRT 2ZPBB 4OB1B 1H641 4WF2A 5GAN4 1B34A 3CCJA 1VQ4T 4HT8A 4RG2A 3ZEHA 3GOXA 3JRZA 2GFAA 3LH0A 2CGHA 3JB9G 3LWIA 3RESA 4C8QC 2A3LA 2EJFA 2WACA 2HBPA 2X35A 1VQ6T 5LJ3j 5A2QE 5FROA 4OP0A 3V8KA 5GAN3 4P5NA 1KHIA 2D0QB 2DZ9A 3TCJA 4JDSA 2KK4A 4BE2A 4J6YA 2DD4A 4JLIA 4MDXA 1MGQA 3QHSA 3CCVA 2H3JA 3QYGB 4QW2A 5GAMd 3E9GA 4PLLA 3OYBA 3CXCA 4JJNK 3M59A 1ZHIA 3P8DA 1M90U 3VKIA 3SB2A 2DVEA 4NS5A 4NL3A 2FYKA 4M75C 5LJ3d 4C8QE 4LD9K 4MZPA 3MHXA 3JB9H 3H6ZA 2EJ9A 2RJDA 3QJYA 3RKXA 4OVAA 3V7SA 2ZZDA 4EMKC 4BACA 1Q82C 4RG8A 1M8VA 4LDVA 3G4ST 1I8FA 1Y96B 2EFIA 3DLMA 3M4GA 4XK8E 1VQ6A 3OQ5A 4M75E 5CKFA 5GAN5 3JAME 2AHJB 5KCHA 3MO8A 4Q5WA 5FU7C 4ATOA 1WJQA 1VQ9T 3PIPA 2R5MA 4DOWA 3M9QA 2CZ6B 2LCCA 1JB0E 1VQ8T 2XI9A 3OS1A 3OYGA 5EG2A 2KDSA 4FL6A 1NJIU 1ZQ1A 1VQLT 2GQVA 3PT9A 3GLXA 3VYHB 3CPWA 1G5VA 4KULA 1AHJB 3V8JA 1VQNT 1G3SA 1N27A 3JCMh 3ME9A 1VQOT 3JCMQ 1FWZA 1S72T 4A4EA 2X4XA 2NLUA 4RCCA 2KQWA 3BFMA 2RJEA 4M77B 5FRNA 3GIBA 5FU6B 4M78C 4C92F 2E64A 4EMHA 5GAOm 2QQ9A 2LDMA 1WNLA 4IUPA 5LL6S 1QVGA 2E10A 1U1TA 3M5AA 1KC8U 5KH6A 1NZ9A 2XICA 3JCMJ 3JSCA 1VQ9A 2JTMA 2O4XA 4ZGDB 1B34B 3F70A 3CCEA 2JOYA 3L42A 4OB3B 2OTLA 2OAUA 1VQLA 3TU4K 5I2MA 4FIBA 2QI2A 4HCZA 4XU0A 3SWNC 3T9NA 2RHYA 4PKCC 5DM7R 1VQMT 4BUGA 3GNGA 3NTIA 4D6WA 3CCMA 2DTHA 5CKEA 5GANf 3WXMB 4A53A 5CCAA 1YJNA 1K8AU 4M77D 2ZPGB 1WQWA 2LT1A 5GANh 2RHZA 5GAMg 3QYHB 2RJFA 3MCAB 1KD1C 4MMLA 2DTOA 3FEOA 4C0DC 3JCMe 2DPPB 2DEQA 2P4TA 4M77G 5LJ3g 1VQPT 4KUDK 5D6YA 1G3TA 3CCUA 1BI1A 3SD4A 5LJ3h 3OYNA 2E6NA 3FJPA 3MEVA 4LDUA 2I2LA 1W2BS 2E6ZA 3RERA 2XIDA 4DOVA 1M90C 4IUUA 2A7YA 2QQSA 3JCMc 3ASKA 2DAQA 4B9XA 1VQ7A 1BI2A 1BIAA 2BKDN 3RIRA 2QEXT 2EJGA 3DKMA 3MP1A 2EAYA 2L89A 5I21A 4X9DA 3QSUA 3I55T 2XDDA 3HSBA 3A8MB 4M7DD 2VC8A 3DB4A 4IUVA 1M1KU 1Y07A 2RO0A 4J6XA 3CD6T 2DD5A 1PSFA 4TVRA 1VQPA 1W4SA 3FRNA 4Y91A 1I81A 2HD0A 5M9OA 3OYMA 4KUIA 5HK0A 2EQMA 4C92C 4XU2A 3C4SA 4J7FA 3OYAA 1KQSS 1UGPB 3KUFA 2JZ2A 3QJ6A 2DTIA 1M4ZA 5CO7A 1VQ7T 4BE0A 3CC7T 3CC4T 1LJOA 1UGSB 3PIOA 3SDZA 1QP2A 2ZCFB 2QEXA 3OB9A 4XTVA 4CRIA 1YIJT 4C0FA 4KBMB 1BIBA 2LC4A 2O4XB 4XTZA 4C92E 2RI5A 3QUIA 3UWNA 3Q1JA 5CKHA 3X26B 1VQ5A 3HRUA 1KQ2A 2FVUA 2QQBA 5LJ5e 1K73C 2P0PA 3BW1A 1UEBA 2JUFA 4E7IA 3CCLA 2DXUA 4ZGJB 2XG8D 1Q7YU 4DQ2A 1VIEA 1YCYA 2PQWA 5GAN6 3OYJA 2D6FA 3RUXA 2L5QA 3OY9A 3FIFA 5CIUA 2RD1A 4XU1A 2V8KA 1MHNA 4OMFB 4XAXB 4BY6B 2RI2A 5GANd 3JCMP 5CVIA 1Q86C 1JJ2S 2R58A 1KHCA 2GF7A 3M4YA 5C6SA 3M57A 2MWPA 3JB9J 5HY6A 2E65A 4M7DA 3LYIA 3V8LA 3I56A 2FL7A 2G3RA 3VU3C 3LGFA 3OYFA 5FRMA 3NTKA 2EWNA 2PUKB 2VUBA 5IT9E 2Y90A 4JS4A 5CKDA 2QXFA 5CQYA 5DY9A 3CCRA 1VQ4A 2KMTA 4CI0C 1TH7A 1N8RU 4M77F 3C95A 2Y4XA 5AYFA 3PMIA 4BDYA 1K9MC 4J8OA 4FT2A 5CR2A 4MZTA 3NFCA 4J7IA 2DJZA 3E1SA 1Q81C 2HNIA 3CMET 4N0AA 2E70A 2VYTA 1YJWT 2PVDB 3LWHA 2L3RA 2EYQA 3ZFJA 3G6ET 4PJOB 3S3NA 1NPRA 2M0OA 3PFSA 4QQGA 2WSFE 4A4HA 3ZBDA 3V7RA 3GNFB 3OYHA 2VXEA 3G7ZA 3QBYA 4M78B 3J80E 1BYMA 2DIQA 2KAFA 3A5ZB 2HQEA 4Y28E 2RK2A 4E7KA 1YITA 1YBYA 4UC4A 3QO3A 4OGCA 5GMKe 1LOJA 1VQKT 4M7DF 2CZ7B 3E9FA 3P8BB 5KE3A 3S3MA 2ZPEB 2LRQA 2XKOC 3OS0A 4JRIA 2LNVA 2MWOA 3G4SA 2PU9B 3DB3A 3HP9A 5CKBA 3WVEB 3QZ9B 3J81E 4PJOD 4MMKA 2E12A 4C5HA 5GMKm 3OSVA 4EDUA 2M1HA 4C8QA 4X34A 5C0MA 4A54A 3S6WA 3KBGA 3X25B 2RHXA 1VQ8A 1XOVA 1Y7XA 2GCXA 4M78D 5GAMe 1O9SA 5GMKl 4OB0B 2PUOB 5HK3A 3CC2T 4XU3A 2EKOA 5D6WA 1VQNA 2CYZB 4O6JA 2XK0A 5GANg 2P0KA 3PTAA 1VQOA 1M1FA 2XHCA 2K3YA 2QQRA 2YHTA 3H8ZA 3PNWC 3CXCS 5GAOr 3X20B 3UPUA 4MZMA 1S72A 4RMOA 2LT4A 2LX9A 1V29B 2CKKA 4M75A 4HKEA 4R55A 4E7LA 1YITT 4M7DB 2QDYB 3V7CA 2DXBA 3LX7A 4HCCA 4M7AB 2ZPHB 4M77C 4EMKA 1RL2A 4QVCA 3HFOA 5GMKh 3A8GB 5FU6C 4N4IA 5A0DA 3G71T 1BI3A 5LJ5j 1QVFA 1R8OB 3MEUA 2WSCE 3OA6A 4QQ6A 3KXTA 2K5IA 1LNXA 4XQ3A 1U8RA 1QP3A 4BB7A 1M1GA 2RM4A 3P8HA 1NPPA 2BUDA 3OYDA 2KVQG 1YJ9T 3HL8A 4PL6A 4BI8B 4C5GA 3UDCA 1VQMA 3VV0A 3CCST 2XDBA 3OYIA 2QA4T 4JLGA 1BKBA 2VXFA 4M77E 3A8HB 3L2ZA 3PMTA 5LJ5d 2EQKA 1N8RC 4XTUA 2K3XA 1UGRB 2KSSA 1WJSA 3CEYA 3EFSA 3M56A 4YTLA 5J39A 4F7UB 2RHIA 3M53A 5L8RE 2K5FA 2F5KA 4FM4B 4M7AD 4PJOA 4ZN1A 3SFMA 3CMAT 4M7DG 2KY9A 1G3WA 4PLIA 3A8LB 1IZ6A 3HHTB 1N9SA 2DK3A 3INZA 3JCMf 4M78A 2LQKA 2B8AA 4XTWA 1OI1A 5J26A 3CBMA 3OS5A 5KCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LCC A;  2R58 A;  1KHC A;  2GF7 A;  5C6S A;  3OS1 A;  4N4H A;  2MWP A;  3OYG A;  4FL6 A;  2IG0 A;  3L2W A;  1WJR A;  3LYI A;  3MP6 A;  3QKJ A;  2G3R A;  3OYK A;  1G5V A;  3EAE A;  3OYE A;  3LGF A;  3OYF A;  1H3Z A;  5FRM A;  3NTK A;  2XDP A;  1N27 A;  4A4G A;  3ME9 A;  4ZTJ A;  4IUR A;  2R5A A;  3L2V A;  4A4E A;  2X4X A;  2NLU A;  5FRN A;  2RJE A;  4II1 A;  1OZ2 A;  2FHD A;  3PMI A;  4BDY A;  2L8D A;  2RI3 A;  2LDM A;  4IUP A;  3LLR A;  4LD6 A;  1XNI A;  1OYX A;  3OMC A;  5KH6 A;  4L59 A;  2VYT A;  3OYC A;  2HQX A;  2O4X A;  3MET A;  2L3R A;  3F70 A;  3L42 A;  2RJC A;  1RI0 A;  4C5I A;  3S3N A;  3PFS A;  2M0O A;  4QQG A;  4A4H A;  4IKF A;  4HCZ A;  2RHY A;  2JTF A;  3OYH A;  3MEW A;  3NTI A;  3QBY A;  3FDR A;  2D9T A;  4BDZ A;  2DIQ A;  2HQE A;  4E7K A;  2EQU A;  4UC4 A;  2RHU A;  2RHZ A;  4A4F A;  2RJF A;  3E9F A;  3FEO A;  5KE3 A;  3S3M A;  2LRQ A;  4B9W A;  3OS0 A;  3FLG A;  4IUT A;  2E5Q A;  2LVM A;  2MWO A;  3DB3 A;  5D6Y A;  3UT1 A;  3SD4 A;  3OYN A;  2E6N A;  1SSF A;  3MEV A;  3OYL A;  5J26 A;  1WGS A;  4E7J A;  2DIG A;  4Z02 A;  4C5E A;  3NTH A;  4C5H A;  4EDU A;  4IUU A;  2M1H A;  4X34 A;  2QQS A;  4QVZ A;  4B9X A;  3ASK A;  2DAQ A;  3S6W A;  5C0M A;  4ZTF A;  2RHX A;  2X4W A;  2BKD N;  3OS2 A;  5IN1 A;  2M16 A;  3MP1 A;  2L89 A;  2R57 A;  2EKO A;  5D6W A;  2EQJ A;  4E7H A;  3S3O A;  2XK0 A;  2P0K A;  3H8Z A;  3FC3 A;  2K3Y A;  2QQR A;  3DB4 A;  3PNW C;  4IUV A;  4N4G A;  2RO0 A;  2X4Y A;  4FU6 A;  2CKK A;  3MP8 A;  4RG2 A;  3ZEH A;  3GOX A;  3LH0 A;  2GFA A;  4E7L A;  2LTO A;  2BIV A;  2GFU A;  4BD3 A;  3LGL A;  3LX7 A;  2WAC A;  2X35 A;  5M9O A;  3O8V A;  3OYM A;  2EQM A;  5FRO A;  3C4S A;  3OYA A;  2YRV A;  4N4I A;  4BE1 A;  3KUF A;  2JZ2 A;  3QJ6 A;  3MEU A;  4BE2 A;  3OA6 A;  4QQ6 A;  3L2U A;  4BE0 A;  4QW2 A;  4GY5 A;  3E9G A;  4PLL A;  3P8H A;  5KE2 A;  2BUD A;  3OYB A;  1OZ3 A;  3OYD A;  3P8D A;  4PL6 A;  3MEA A;  4C5G A;  3OB9 A;  4NS5 A;  4CRI A;  3L2Q A;  3OYI A;  3BDL A;  3PMT A;  3H6Z A;  2O4X B;  2RJD A;  2EQK A;  5D6X A;  2RI5 A;  4OVA A;  2K3X A;  4IUQ A;  3UWN A;  3Q1J A;  3CEY A;  1WJS A;  3OMG A;  5IAY A;  5J39 A;  4BAC A;  3L2R A;  2RHI A;  4QQD A;  4E7I A;  2F5K A;  3QII A;  2PQW A;  2EFI A;  4PLI A;  3DLM A;  3OYJ A;  3OQ5 A;  5KCH A;  3MO8 A;  4Q5W A;  3OY9 A;  5CIU A;  1WJQ A;  2B8A A;  1MHN A;  2R5M A;  1OI1 A;  2RI2 A;  3M9Q A;  5KCO A; 
#chains in the Genus database with same CATH topology
 1FX7 A;  1VUB A;  3CCR Q;  1PNJ A;  4RTU A;  3OYE A;  1M8M A;  2L3P A;  4M7D E;  3ER0 A;  3I55 A;  2CZ1 B;  4IUR A;  2EYW A;  1YHQ T;  2CP3 A;  2FZK B;  4C8Q B;  4JJD A;  4N0A C;  3CD6 A;  1WHJ A;  2MK5 A;  2K57 A;  1KC8 C;  3HRS A;  3A1P A;  4NL2 A;  3CCV T;  4PFP A;  2CDT A;  3TRE A;  1YHQ A;  3KFV A;  4JS5 A;  3UA7 A;  2OTJ T;  2CSI A;  2MI6 A;  3CCJ T;  2D8H A;  1KQ1 A;  1QW1 A;  3M54 A;  2F69 A;  4WCI A;  4EMG A;  5GJV B;  1ZUK A;  3HRT A;  5LJ5 h;  3QWX X;  3TQ7 P;  2DFU A;  4ELZ C;  1SRL A;  2E3I A;  2M16 A;  1HXD A;  4JRP A;  2ZPF B;  2OTJ A;  2X4Y A;  3EGD A;  2DBK A;  3JCM d;  3CCJ A;  3UPU A;  1FXX A;  4BI3 A;  4FYV B;  4F16 A;  4PNO A;  1IHW A;  2LTO A;  5CK9 A;  4PJM A;  1M1K R;  2YRC A;  4M7A F;  2L2P A;  4HVU A;  3CME A;  4BE1 A;  2YRV A;  5A0L A;  4J9H A;  1QLY A;  3CCE T;  2CZ0 B;  3L2U A;  2OTL T;  2DA9 A;  5GJW B;  5GAN e;  3MEA A;  5GAN 2;  4PJO G;  2JT4 A;  3CCM T;  1IRX A;  3M58 A;  3VS5 A;  3BDL A;  1K76 A;  1IXD A;  4M78 G;  1PHT A;  1X75 C;  1ZSZ A;  3L2R A;  1KQS A;  2FO0 A;  1K73 U;  2K2V A;  2JNG A;  4Y92 A;  1WPY A;  1UE9 A;  4E7S A;  1Q7Y R;  2XU8 A;  3OBW A;  2IG0 A;  1H3Z A;  4M4Z A;  5IXF A;  4A4G A;  4BI4 A;  3CPW P;  3JB9 I;  2V8I A;  4ORZ A;  1H92 A;  1SHG A;  1BI0 A;  2CP0 A;  3RR6 A;  2KEA A;  1FMV A;  2VGN A;  4LD6 A;  1K9M U;  3PGG A;  5J3B A;  3I56 Q;  1BBZ A;  8ATC B;  4MDW A;  3JCM g;  3G71 A;  3X28 B;  4M75 F;  4HXJ A;  4AG2 C;  1VQ4 Q;  3UAT A;  2FG0 A;  2YLC A;  1EIF A;  4HT9 A;  4JUV A;  3SEM A;  4HCB A;  2RB6 A;  2FZG B;  3VRZ A;  4B9W A;  3GPL A;  2DZC A;  4RTW A;  2DIG A;  1S1N A;  1U06 A;  1D1C A;  1D3B A;  1Y0M A;  2DXC A;  3G1J A;  4AFU C;  5GAO p;  1I4K 1;  3CBO A;  1RAC B;  2HCK A;  2HKQ B;  3OS2 A;  2HDA A;  2HSE B;  4QVD A;  4ZGE B;  1B34 A;  4HT8 A;  4RG2 A;  1R0C B;  3GOX A;  3LH0 A;  2GFA A;  1ACM B;  1RAH B;  2CGH A;  2K9G A;  3NPF A;  2DJQ A;  2A3L A;  2EJF A;  2MCN A;  5LJ3 j;  5FRO A;  4P5N A;  4AG1 C;  4JDS A;  1U3O A;  2NWM A;  4J6Y A;  4MDX A;  3QYG B;  5GAM d;  1WXU A;  3E9G A;  3CXC A;  2J06 A;  1ZHI A;  4PFO A;  4RTT A;  5LJ3 d;  4AMC A;  1X27 A;  2DLP A;  4C8Q E;  1ARK A;  4MZP A;  2ESW A;  2RJD A;  4OVA A;  1UUE A;  3V7S A;  1GFC A;  4EMK C;  1HJD A;  2RQU A;  3G4S T;  4XK8 E;  2J7I A;  1CSK A;  3MO8 A;  1OU8 A;  2AZV A;  2CZ6 B;  2HBW A;  2LCC A;  1Q82 R;  3OS1 A;  3PT9 A;  1PD1 A;  3CPW A;  4KUL A;  1GCP A;  1VQN T;  2KBT A;  1G3S A;  4RTY A;  5IHN A;  3ME9 A;  3JCM Q;  1S72 T;  5FRN A;  2KQW A;  3BFM A;  5FU6 B;  4M78 C;  4C92 F;  1SG5 A;  2QQ9 A;  2LDM A;  1QVG A;  3M5A A;  5KH6 A;  2AZS A;  2QA4 Q;  1JU5 C;  2JOY A;  4AT1 B;  1TU0 B;  2C0T A;  2LZ6 B;  5I2M A;  4HCZ A;  4XU0 A;  1Q86 U;  1E6G A;  4BUG A;  3GNG A;  2DTH A;  2KYM A;  3VS6 A;  2RHZ A;  5GAM g;  2O2O A;  2RJF A;  3A98 A;  3MCA B;  4IIM A;  2DTO A;  4C0D C;  2DPP B;  5KYN A;  5LJ3 g;  2MOX A;  2DL3 A;  1BI1 A;  3VS1 A;  3OYN A;  3FJP A;  1W2B S;  1WI7 A;  3RER A;  2CUB A;  3U23 A;  3EHQ A;  2BKD N;  3RIR A;  3DKM A;  5I21 A;  2C0I A;  2LJ3 A;  3HSB A;  1RUW A;  1GFD A;  3DB4 A;  1M90 R;  7AT1 B;  1UG1 A;  2X51 A;  5IH2 A;  3FRN A;  2EVR A;  1I81 A;  2LJ0 A;  2EQM A;  4R0K A;  3VS0 A;  3C4S A;  1OX9 A;  2A37 A;  3QJ6 A;  2COZ A;  1VQ7 T;  4BE0 A;  2DNU A;  3CC4 T;  1QP2 A;  1YCS B;  1YIJ T;  4J9I A;  1KK7 A;  3Q1J A;  5CKH A;  1VQ5 A;  4E7Z A;  2CRE A;  2GTJ A;  3BW1 A;  5D7U A;  2A0F B;  1RAE B;  4E7I A;  4ZGJ B;  3OYJ A;  2CUD A;  2L5Q A;  1QCO A;  3FIF A;  2V8K A;  4BY6 B;  1RAB B;  5GAN d;  1VQ7 A;  2RI2 A;  1K73 R;  1KHC A;  1JO8 A;  1WHG A;  2LQW A;  3LGF A;  2PUK B;  2Y90 A;  4JS4 A;  2QXF A;  2I0N A;  2ATC B;  4CI0 C;  3CQT A;  4M77 F;  3C95 A;  2Y4X A;  4J8O A;  3REB B;  2D0N A;  2FRY A;  4J7I A;  1WDX A;  3E1S A;  2HNI A;  4N0A A;  2E70 A;  3CC2 Q;  2PVD B;  3ZFJ A;  3G6E T;  3S3N A;  1WZO A;  3ZBD A;  1K9M R;  1Z9Q A;  3G7Z A;  2LJ1 A;  2OJ2 A;  2KAF A;  2M51 A;  3A5Z B;  1YBY A;  4OGC A;  1VQK T;  2J6F A;  3P8B B;  3S3M A;  2LRQ A;  3OS0 A;  3DB3 A;  3NHN A;  1FMK A;  3WVE B;  4MMK A;  2J05 A;  4C5H A;  2YDL A;  2M1H A;  4C8Q A;  4JZ3 A;  1UJY A;  5GMK l;  5HK3 A;  4FYW B;  1D0Y A;  5GAN g;  3THK A;  3H8Z A;  2YHT A;  2DMO A;  3X20 B;  4DBF A;  2QGG A;  2CP7 A;  2LT4 A;  2LX9 A;  1V29 B;  1E6H A;  4HKE A;  4M7D B;  2B86 A;  3V7C A;  3LX7 A;  4M7A B;  2ZPH B;  2GQI A;  2QTV A;  5KYY B;  5A0D A;  2AK5 A;  2WSC E;  3KXT A;  1B07 A;  1NM7 A;  1M1G A;  1OOT A;  3P8H A;  2BUD A;  3OYD A;  1RAD B;  2KVQ G;  1YJ9 T;  4C5G A;  4JLG A;  1N8R C;  2YXY A;  3EFS A;  2FRW A;  4FM4 B;  1I1J A;  3E2U A;  1GL5 A;  4CC7 A;  2B8A A;  4XTW A;  3JCM h;  1NJI C;  1I0C A;  1T3S A;  3OS5 A;  2CT4 A;  5CKD A;  1GCQ C;  3I35 A;  4N4H A;  3QKJ A;  2W0Z A;  2ED0 A;  1FMW A;  1TUC A;  1VQ6 Q;  4GLK A;  4L5G A;  4E47 A;  3RDV A;  2M0Y A;  2VWF A;  4OGE A;  2L8D A;  2RI3 A;  2DEU A;  3LLR A;  2EIF A;  4KRT A;  3OW2 S;  2DF6 A;  2HQX A;  3QXE B;  4M75 B;  3CC7 A;  4C5I A;  4PJO F;  4KGV B;  1K8A C;  1PRL C;  1PWT A;  2JMC A;  4M78 F;  1ZBX A;  1JBM A;  2E5K A;  3EHR A;  4C8Q G;  2HAX A;  1NEB A;  5FU7 B;  1KD1 U;  2MMP A;  2Z0W A;  1VQL Q;  2EQI A;  1AWJ A;  3C12 A;  2QAS A;  4J83 A;  1X6O A;  3VS3 A;  3RMQ A;  3M0S A;  4Z02 A;  1YJN Q;  1MUZ A;  1TXQ A;  2P4R A;  4XTY A;  3RMS A;  2X4W A;  1E7O A;  4F7U A;  3O5Z A;  2R57 A;  2EQJ A;  4E7H A;  3S3O A;  3QZ5 B;  1GXI E;  1EFN A;  2NUP B;  2E1H A;  4FU6 A;  4OF1 A;  3MP8 A;  2P84 A;  1G3Y A;  4BD3 A;  3LGL A;  1A0N B;  3BDU A;  1QVP A;  2FEI A;  3SWN B;  2Y4Y A;  1X6G A;  1M5Q 1;  1N9R A;  1VYU A;  2K5L A;  1IRE B;  4GY5 A;  1OZ3 A;  4OMM A;  3I5R A;  5FWC A;  1R77 A;  1G83 A;  4RCB A;  5LJ3 e;  4V2S A;  3VUB A;  1O75 A;  1QWF A;  3TSW A;  2CT3 A;  3CPF A;  4FW1 A;  3AT1 B;  2DO3 A;  1OPK A;  3CCU T;  4HVV A;  5HKC A;  2MF2 A;  1TS9 A;  4Z89 A;  2JM8 A;  1WHM A;  2O01 E;  5GAO n;  5GMK i;  1TUD A;  3EG9 B;  3CCL Q;  4C0Z A;  4J5Y A;  3OYY A;  1UB4 A;  4C92 B;  5GAM h;  1YIT A;  4GBQ A;  2CSQ A;  9ATC B;  1JJ2 A;  2ZGW A;  1Q82 U;  1XNI A;  4VUB A;  1MV3 A;  3LW5 E;  2QG9 B;  1UGV A;  2HZY A;  1RLQ C;  4R56 A;  2MAM A;  3EGX A;  4IKF A;  3CCQ T;  2A28 A;  4LUE A;  3HFN A;  2EPD A;  1BB9 A;  2EQU A;  2RHU A;  3FB9 A;  2DKG A;  3JCM X;  1EX4 A;  4M7A E;  3EFO B;  2J6K A;  4IUT A;  3CMA A;  3UT1 A;  4F7U G;  1SSF A;  3EG2 A;  1TTH B;  3NTH A;  2L3Q A;  5KYX A;  3CCQ A;  1RAA B;  5GAN 8;  3QWY A;  4ZTF A;  3BY7 A;  3I56 T;  1IGU A;  1QVF S;  2KR3 A;  2QGF B;  4N4G A;  4OB1 B;  1VQ4 T;  1OEB A;  2NUT B;  1CKA A;  2E4H A;  3JRZ A;  4AFS C;  2QK0 A;  1VQ8 Q;  4C8Q C;  4JPB W;  1MMG A;  5GAN 3;  1PC0 A;  2HMA A;  3TCJ A;  2KK4 A;  1VQO Q;  1MGQ A;  2GNC A;  3CCV A;  2H3J A;  3ZL7 C;  1M90 U;  3M59 A;  1NYF A;  4NL3 A;  3RKX A;  2EGE A;  2ZAE A;  3M0Q A;  2VVK A;  2VAS A;  4LDV A;  1I8F A;  1Y96 B;  3DLM A;  3M4G A;  2LQN A;  5GAN 5;  4M75 E;  4JJB A;  1VQM Q;  2HQH A;  1VQ9 T;  1QWE A;  2KDS A;  1RAF B;  4FL6 A;  1ZQ1 A;  2K3B A;  4PJN A;  1G5V A;  3V8J A;  1N27 A;  1FWZ A;  4M77 B;  4EMH A;  5GAO m;  1WNL A;  4IUP A;  3H0H A;  1U1T A;  1KC8 U;  2HL5 C;  1VQ9 A;  1AWO A;  2NUZ A;  3CCE A;  3I55 Q;  2OTL A;  3TU4 K;  3CD6 Q;  2QI2 A;  3T9N A;  3CCM A;  4A53 A;  1PKS A;  5CCA A;  2ZPG B;  1WQW A;  2LT1 A;  5GAN h;  2C0O A;  1AOJ A;  1VQP T;  1SSH A;  1G3T A;  3I9Q A;  1XJW B;  1YHQ Q;  2A7Y A;  1KD1 R;  2QQS A;  2DAQ A;  4KH0 B;  5FWB A;  2KRN A;  2QEX T;  2EJG A;  3MP1 A;  2XDD A;  2CH4 A;  3A8M B;  4M7D D;  2VC8 A;  1Y07 A;  4J6X A;  3M0R A;  4TVR A;  1VQP A;  3EG1 A;  4Y91 A;  2HD0 A;  5HK0 A;  1KQS S;  1UGP B;  3KUF A;  2JZ2 A;  2DTI A;  1I07 A;  5CO7 A;  6AT1 B;  2OTJ Q;  3CCJ Q;  4JJC A;  2QEX A;  4CRI A;  1BIB A;  2O4X B;  4XTZ A;  4C92 E;  2RI5 A;  2NYS A;  1Z9Z A;  3X26 B;  3CME Q;  2D8J A;  2P0P A;  2HSP A;  1M3B A;  1C6V X;  2XG8 D;  4DQ2 A;  1VIE A;  2PQW A;  2D6F A;  2OAW A;  2BTT A;  4RUG A;  1AT1 B;  4XU1 A;  1Q86 C;  5C6S A;  3M57 A;  5HY6 A;  2E65 A;  4M7D A;  3LYI A;  1QQJ A;  3V8L A;  2FL7 A;  2G3R A;  2AKL A;  2LX7 A;  3NGP A;  3RBB B;  3VU3 C;  3OYF A;  3NTK A;  5IT9 E;  1WX6 A;  1C0M A;  1GCQ A;  5KYY A;  5CQY A;  5DY9 A;  1WHK A;  5AYF A;  4BDY A;  5CR2 A;  1RLP C;  4K11 A;  1Q81 C;  2KRS A;  2BZX A;  3LWH A;  2L3R A;  4PJO B;  2KGT A;  2M0O A;  4J9G A;  4F17 A;  1ZX6 A;  4M78 B;  1BYM A;  2DIQ A;  4UC4 A;  1LOJ A;  3G71 Q;  4FYY B;  1IB8 A;  2CZ7 B;  1D1A A;  5KE3 A;  3G4S A;  1LPL A;  2PU9 B;  5CKB A;  1PKT A;  3J81 E;  5GMK m;  1ABQ A;  3OSV A;  4EDU A;  2W10 A;  4X34 A;  4A54 A;  2F2V A;  2RHX A;  1IHV A;  2GCX A;  2LNH B;  3CC2 T;  3M0T A;  1VQN A;  2CYZ B;  1T0H A;  2XHC A;  3CXC S;  1S72 A;  4MZM A;  4M75 A;  4OMP A;  2QDY B;  4DEY A;  2O88 A;  1PCX A;  1QMC A;  1RL2 A;  4QVC A;  5FU6 C;  1BI3 A;  5LJ5 j;  3HTR A;  1R8O B;  3MEU A;  3OA6 A;  2RM4 A;  4PL6 A;  3EH2 A;  3CCS T;  2PNI A;  4OMO A;  2XDB A;  1H8K A;  1BKB A;  2VXF A;  4M77 E;  3A8H B;  3L2Z A;  5LJ5 d;  4XTU A;  1UGR B;  3CEY A;  3M56 A;  4YTL A;  5J39 A;  1NBE B;  2J6O A;  2F5K A;  3M0U A;  2JMA A;  4M7D G;  2KY9 A;  4OMQ A;  3A8L B;  3HHT B;  1N9S A;  3EGD B;  2A08 A;  4J9D A;  1KFZ A;  1YJW T;  5KCO A;  2VKN A;  2NUP A;  1UGQ B;  2JW4 A;  5EC7 A;  2JJ9 A;  1QVG S;  1PM3 A;  2PVO B;  3CCS A;  2DE0 X;  4HVW A;  2SEM A;  2XD0 A;  3SWN A;  1I5L A;  2JS2 A;  2BZ8 A;  3OW2 P;  3WVD B;  5CAI A;  3OMC A;  4DBR A;  2AKK A;  4X9C A;  2IPO B;  1ZSZ B;  1YJW A;  1ZSG A;  1ZBJ A;  1TSF A;  1AEY A;  2KI7 A;  5I2S A;  3CC4 A;  1KC8 R;  3TVT A;  3JCM W;  1NEG A;  3A8O B;  1YIJ A;  1D1B A;  4C8Q D;  3JB9 D;  1PRM C;  4A4F A;  3OSS C;  2LQ8 A;  2V8J A;  1VA7 A;  2DL5 A;  3EG9 A;  2X4J A;  5LJ5 f;  5LJ5 g;  1M2V A;  2JN0 A;  3LH5 A;  4LDW A;  3OYL A;  4E7J A;  2YLB A;  5DLO A;  2KXD A;  3GF5 A;  3PVL A;  2JS0 A;  1H3H A;  4IIO A;  4M75 G;  4C92 A;  4BY6 C;  2CP2 A;  1Y71 A;  3URG A;  1M1K C;  2YUP A;  2FB7 A;  2F2W A;  2DL4 A;  1UDL A;  2HEQ A;  3N5B B;  5FW9 A;  2DIL A;  2BIV A;  1M3C A;  2VGM A;  3O8V A;  1UHC A;  3GP8 A;  3C94 A;  3G6E A;  3M55 A;  3M0P A;  2COY A;  2QQA A;  1X01 A;  2GGR A;  4J6W A;  2K4Y A;  1YJN T;  1D3B B;  4ME7 A;  1WQ7 A;  2EGC A;  5IAY A;  4DBH A;  1Q7Y C;  1VQK A;  2RK1 A;  4QQD A;  4F7U F;  3AHU A;  1YI2 T;  2IIM A;  3PE0 A;  5GAN 7;  1SKU B;  4PJO E;  2ECZ A;  4ELY C;  3UA6 A;  1WFW A;  1VQ5 Q;  2GBQ A;  4FYX B;  4M78 E;  1WJR A;  3D7S B;  1BCO A;  2DRK A;  3OYK A;  5FLX E;  2XDP A;  1HD3 A;  2RH2 A;  4ZTJ A;  4PK4 A;  2R5A A;  3L2V A;  1DJ7 B;  3OW2 A;  2P0Q A;  1HK9 A;  4II1 A;  1VQ7 Q;  1OZ2 A;  2CS7 A;  1YI2 A;  2OX7 A;  1AWX A;  2DYB A;  3VJP A;  1JXM A;  4FT4 A;  4M7D C;  4JRK A;  4EPC A;  2IVW A;  4CC3 A;  4M7A C;  2LCL A;  1YJ9 A;  1T3L A;  2E41 A;  3MEW A;  1IGQ A;  3FDR A;  3RKW A;  1Y96 A;  2EBP A;  1X2Q A;  2X9H A;  2ENM A;  2M9U A;  5KYW B;  3CCL T;  2F5T X;  4C92 G;  3QPH A;  3JCM b;  1WGS A;  5CQX A;  2SRC A;  4C5E A;  3VYG A;  2QTX A;  5GAO q;  1QVF P;  1M27 C;  4M77 A;  1HSQ A;  5DLQ E;  2VV5 A;  2MIO A;  3ULR B;  4OB2 B;  4DA4 A;  3R6O A;  1WIE A;  3CCR T;  2ZPB B;  4WF2 A;  2RPN A;  2OI3 A;  3JB9 G;  3LWI A;  3RES A;  2WAC A;  2X35 A;  2HBP A;  4Z8A A;  1X6B A;  1KHI A;  2D0Q B;  2DZ9 A;  4QW2 A;  1MMD A;  4PLL A;  2K6D A;  4JJN K;  3P8D A;  3VKI A;  2DVE A;  4NS5 A;  2FYK A;  4M75 C;  1KIK A;  4LD9 K;  2EGA A;  3MHX A;  3JB9 H;  3H6Z A;  3QJY A;  5ECA A;  1MND A;  1X2K A;  1Q82 C;  8AT1 B;  2K79 A;  1AZG B;  2LMJ A;  3JAM E;  2AHJ B;  1QKW A;  1D0X A;  5FU7 C;  1WJQ A;  4B6M A;  4DOW A;  3M9Q A;  1VQ8 T;  1NJI U;  2GQV A;  3GLX A;  3VYH B;  1ABO A;  3VRY A;  1VQO T;  1BCM A;  4A4E A;  2X4X A;  2YUQ A;  1YP5 A;  3GIB A;  1GBR A;  1YWP A;  3EG3 A;  4QKU A;  2VB6 A;  1NZ9 A;  2JM9 A;  3JSC A;  2JTM A;  2O4X A;  4ZGD B;  3F70 A;  2KRO A;  4OB3 B;  2OAU A;  1VYV A;  1B3Q A;  3SWN C;  3TSZ A;  4PKC C;  1VQM T;  3NTI A;  5CKE A;  1IO6 A;  3WXM B;  3REA B;  1KJW A;  1K8A U;  1RAI B;  3QYH B;  4MML A;  5IHI A;  3CC7 Q;  2DEQ A;  2P4T A;  4M77 G;  2QDL A;  4KUD K;  3CCU A;  3SD4 A;  1NG2 A;  5LJ3 h;  2E6N A;  4LDU A;  2I2L A;  4A63 B;  2XID A;  4DOV A;  1M90 C;  4J9E A;  2DYI A;  4DBQ A;  3JCM c;  1BIA A;  4E2F B;  1RAG B;  2L89 A;  4X9D A;  4QT7 A;  3I55 T;  2A36 A;  2RO0 A;  3CD6 T;  2XMF A;  2RQV A;  2DD5 A;  2KXC A;  5M9O A;  3OYM A;  4KUI A;  4C92 C;  1MV0 B;  2AIR B;  1M4Z A;  2FPD A;  1LJO A;  1UGS B;  3PIO A;  2ZCF B;  4XTV A;  2F2X A;  4KBM B;  1SPK A;  2LC4 A;  1CKB A;  2QQB A;  5LJ5 e;  1K73 C;  2JUF A;  1V76 A;  5GAN 6;  1EZZ B;  3RUX A;  2M02 A;  3OY9 A;  5CIU A;  4OMF B;  3NMZ C;  3JCM P;  1JJ2 S;  5CVI A;  2R58 A;  3M4Y A;  2MWP A;  3JB9 J;  2L0A A;  3I56 A;  5FRM A;  2EWN A;  2VUB A;  1JEG A;  1BK2 A;  5L23 A;  3FJ5 A;  1OUL A;  4KGX B;  1VQ4 A;  1K9M C;  4FT2 A;  1F1B B;  4RTX A;  4MZT A;  1SRM A;  3MJX A;  2FPF A;  3CME T;  4LXC A;  1QCN A;  1OU9 A;  2EYQ A;  2MPX C;  2HKN A;  4A4H A;  2WSF E;  3GNF B;  1YIT Q;  3OYH A;  3CCU Q;  2O9V A;  2RK2 A;  4EIK A;  2EYY A;  2CP6 A;  3QO3 A;  4M7D F;  3E9F A;  2XKO C;  1GBQ A;  4JRI A;  2LNV A;  2MWO A;  2YUN A;  3HP9 A;  1K4U S;  4GLM A;  5C0M A;  3S6W A;  3H41 A;  3KBG A;  2DET A;  3CXC P;  2DER A;  2PUO B;  2O31 A;  5D6W A;  3CMA Q;  4O6J A;  3PTA A;  2P0K A;  1M1F A;  2K3Y A;  2QQR A;  4FW2 A;  2RQT A;  4E7L A;  2LCS A;  1OX8 A;  2DXB A;  3CCQ Q;  1W2B P;  2EKH A;  4M77 C;  3HFO A;  1W6X A;  3A8G B;  4DEX A;  4N4I A;  3G71 T;  1J3T A;  1U8R A;  1LNX A;  2ABL A;  2PZ1 A;  4BB7 A;  1NPP A;  4BI8 B;  2BE9 B;  3VV0 A;  2EYZ A;  3OYI A;  2QA4 T;  2H3E B;  1ZA2 B;  2EQK A;  2K3X A;  1D09 B;  2E3H A;  2RQW A;  4F7U B;  3M53 A;  5L8R E;  2K5F A;  4M7A D;  3CCV Q;  3SFM A;  1G3W A;  4PLI A;  1IZ6 A;  1QVG P;  3JCM f;  3UF4 A;  1N8R R;  2YT6 A;  2LQK A;  3CBM A;  2WSE E;  4KT0 E;  1KG1 A;  4LUD A;  3JCM V;  2QA4 A;  1RI9 A;  1XTD A;  3E19 A;  2ZPI B;  4C0G A;  1NJI R;  4J9F A;  2RA2 A;  1Y57 A;  2KRM A;  4JRQ A;  4PJL A;  4KH1 B;  1PSE A;  5IXB A;  2X3W D;  2K7A A;  2BE7 D;  4L59 A;  3JV3 A;  5GMK j;  5KYU B;  3VS2 A;  1WLP B;  2DL8 A;  1LCK A;  3RNJ A;  2DXT A;  2JTF A;  4EMK B;  1AVZ C;  2D9T A;  4M7A A;  2DBM A;  4XTX A;  3J7A F;  1M2O A;  4NOY A;  1VQ9 Q;  4X1V A;  3CCE Q;  5GAM j;  2OTL Q;  3FLG A;  2E5Q A;  4RKU E;  1K8A R;  1VIF A;  4M75 D;  3CCM Q;  1X43 A;  5I11 A;  1ZUY A;  3VUZ A;  1G2B A;  4QVZ A;  5IN1 A;  1HYO A;  2FZC B;  1ZA1 B;  3HPW A;  4RTV A;  4L6V 5;  3EGX B;  3FC3 A;  3QDR B;  3DLL A;  1W2B A;  3HKS A;  1MMN A;  3QG1 A;  2K2M A;  2GFU A;  2RQR A;  2JXB A;  4F04 B;  3X24 B;  2DVJ A;  3EFR A;  4E6R A;  5A0G A;  4Z88 A;  1U1S A;  5KE2 A;  1WYX A;  5KYW A;  1SF9 A;  2JVV A;  2ED1 A;  3L2Q A;  1VQP Q;  4PJO C;  2RNA A;  4C0D B;  1PD0 A;  5KYX B;  4IUQ A;  4HCK A;  1YN8 A;  3OMG A;  3TEE A;  2YWW A;  3QII A;  2QEX Q;  5GAO l;  1P92 A;  4LDX A;  4FCY A;  5D6X A;  2DL7 A;  2QYZ A;  1JRI A;  1JXO A;  3L2W A;  2PVG B;  3MP6 A;  3EAE A;  3CC2 A;  4ZN3 A;  2H8H A;  5GAM f;  4FSS A;  4C8Q F;  3JB9 F;  1N6A A;  5LJ3 f;  4A4K A;  2FHD A;  3CPW S;  4OML A;  1OYX A;  2C06 A;  1KSW A;  1NE8 A;  1X69 A;  4LDY A;  1GRI A;  4J9B A;  3OYC A;  1Q81 U;  3MET A;  3MKD A;  4M7A G;  4O5V A;  1NLP C;  2RJC A;  1RI0 A;  4HA8 A;  1XQH A;  1M30 A;  1M9S A;  4BDZ A;  1M3A A;  4C92 D;  1VQ5 T;  1WXB A;  1V1C A;  3R6N A;  1JQQ A;  2PTK A;  3H0F A;  3L1A A;  2LVM A;  3CBP A;  3H0I A;  2G6F X;  1SEM A;  4LNP A;  2KYB A;  3RKY A;  3OBY A;  4FSX A;  3BE3 A;  3MPU B;  2DX1 A;  1YFN A;  2RN8 A;  3G4S Q;  1NLO C;  4F7U E;  1VOM A;  5GAN j;  1H64 1;  1ZUU A;  5GAN 4;  5HCK A;  3ZEH A;  2CH4 W;  2RF0 A;  1VQ6 T;  5A2Q E;  1OQK A;  2FPE A;  4OP0 A;  1UFF A;  3V8K A;  1FYN A;  1VQN Q;  4BE2 A;  2DD4 A;  4JLI A;  1VYT A;  3GBQ A;  3QHS A;  1WA7 A;  1S72 Q;  3OYB A;  1ZSZ C;  3SB2 A;  3VS4 A;  2EJ9 A;  4ESR A;  2ZZD A;  4AFZ C;  4BAC A;  4RG8 A;  1M8V A;  1Q95 G;  1T0J A;  2EFI A;  1VQ6 A;  4ZNX A;  3OQ5 A;  5CKF A;  5KCH A;  4Q5W A;  4ATO A;  3PIP A;  2R5M A;  1WHL A;  1TUG B;  1JB0 E;  1YWO A;  2F1L A;  2XI9 A;  3OYG A;  5EG2 A;  1VQL T;  1AHJ B;  3EFO A;  1K0S A;  3QDF A;  2KNB B;  2NLU A;  4RCC A;  2RJE A;  2E64 A;  2RMO A;  5LL6 S;  2E10 A;  1D0Z A;  2XIC A;  3CCS Q;  3JCM J;  1B7T A;  1B34 B;  3L42 A;  1TG0 A;  4WTO B;  1OPL A;  3C0C A;  1SHF A;  1VQL A;  4FIB A;  2NUT A;  5DM7 R;  2RHY A;  4D6W A;  5GAN f;  1YJN A;  4M77 D;  1KD1 C;  1YJW Q;  3FEO A;  3JCM e;  3CC4 Q;  4JZ4 A;  1K0X A;  5D6Y A;  2MYS A;  1YNZ A;  4PFZ A;  2KT8 A;  3MEV A;  2V1Q A;  1YIJ Q;  1MNE A;  4RTZ A;  2E6Z A;  4KGZ B;  3SHW A;  3PVQ A;  4IUU A;  2X3X D;  4B9X A;  3ASK A;  1BI2 A;  3VS7 A;  2JTE A;  2EAY A;  2D1X A;  4D8D A;  2QAZ A;  3QSU A;  1WHH A;  2CP5 A;  4IUV A;  1M1K U;  1TWB A;  2EW3 A;  1R0B G;  2YSQ A;  1PSF A;  1K1Z A;  1W4S A;  2LP5 A;  4XU2 A;  4CC4 B;  4J7F A;  3OYA A;  3CC7 T;  1N5Z A;  2YUO A;  3SDZ A;  3OB9 A;  1AD5 A;  2BZY A;  4C0F A;  1UHF A;  4F14 A;  3QUI A;  3UWN A;  3I5S A;  1KQ2 A;  3HRU A;  2FVU A;  1NYG A;  2YRD A;  1UEB A;  2L3S A;  3G6E Q;  3CCL A;  1PG5 B;  2COW A;  2DXU A;  1Q7Y U;  1YCY A;  1JJ2 P;  2HL3 A;  1C1A A;  2RD1 A;  4CC2 A;  1MHN A;  4J9C A;  4XAX B;  1QKX A;  1UJ0 A;  4ANJ A;  4D8K A;  2GF7 A;  1G8X A;  5IHK A;  1VQK Q;  1UTI A;  3EG0 A;  1Q86 R;  3CCR A;  2KMT A;  1N8R U;  1TH7 A;  3PMI A;  2ROT A;  3NFC A;  3H9N A;  5AT1 B;  2DJZ A;  1UEC A;  2VYT A;  1W70 A;  5I22 A;  3EGU A;  1NPR A;  3PFS A;  4QQG A;  3V7R A;  1W1F A;  2VXE A;  1YI2 Q;  1LVK A;  3QBY A;  3J80 E;  1Q81 R;  3IQL A;  2HQE A;  4Y28 E;  4E7K A;  5GMK e;  1MMA A;  2ZPE B;  2DRM A;  1YJ9 Q;  1QCF A;  1AWW A;  2V26 A;  3QZ9 B;  4PJO D;  1K9A A;  2E12 A;  3X25 B;  1VQ8 A;  1XOV A;  1Y7X A;  4M78 D;  5GAM e;  1O9S A;  4OB0 B;  1ZLM A;  4LN2 A;  4XU3 A;  2EKO A;  2V1R A;  2XK0 A;  1VQO A;  2GTO A;  3PNW C;  5GAO r;  5KYU A;  4RMO A;  4PJJ A;  2CKK A;  4R55 A;  1YIT T;  3EH1 A;  2AT1 B;  4HCC A;  1AZE A;  4AFQ C;  4EMK A;  5GMK h;  1QVF A;  1I5O B;  4QQ6 A;  2K5I A;  4XQ3 A;  1QP3 A;  2KE9 A;  3HL8 A;  1M2V B;  3UDC A;  1VQM A;  4OMN A;  3PMT A;  2EYX A;  2ROL A;  2KT1 A;  2KSS A;  1WJS A;  1OV3 A;  1BU1 A;  2RHI A;  4LE9 A;  1WXT A;  2O9S A;  4PJO A;  4ZN1 A;  3CMA T;  1KQS P;  1U5S A;  3INZ A;  2DK3 A;  1TOV A;  4M78 A;  2DM1 A;  1OI1 A;  5J26 A; 
#chains in the Genus database with same CATH homology
 1FX7 A;  1VUB A;  1UGQ B;  1QVG S;  2WSE E;  4N4H A;  2PVO B;  3QKJ A;  4KT0 E;  1KG1 A;  3CCS A;  3JCM V;  3OYE A;  2QA4 A;  1XTD A;  1NJI C;  4M7D E;  3E19 A;  3ER0 A;  3I55 A;  2CZ1 B;  4IUR A;  2ZPI B;  4GLK A;  1YHQ T;  4C0G A;  4C8Q B;  2XD0 A;  4L5G A;  3SWN A;  4N0A C;  2RA2 A;  4E47 A;  1I5L A;  3CD6 A;  2K57 A;  4JRQ A;  4OGE A;  2L8D A;  2RI3 A;  1KC8 C;  3WVD B;  3HRS A;  3LLR A;  5CAI A;  1PSE A;  3OMC A;  2EIF A;  4L59 A;  4X9C A;  3OW2 S;  5GMK j;  2HQX A;  3QXE B;  1YJW A;  4M75 B;  4NL2 A;  3CC7 A;  4C5I A;  3CCV T;  5I2S A;  4PJO F;  3CC4 A;  2DXT A;  3JCM W;  3A8O B;  2JTF A;  4EMK B;  1YIJ A;  1K8A C;  2D9T A;  3TRE A;  4C8Q D;  4M78 F;  3JB9 D;  1YHQ A;  1ZBX A;  4JS5 A;  4M7A A;  1JBM A;  4XTX A;  3J7A F;  4NOY A;  2OTJ T;  4A4F A;  2MI6 A;  3OSS C;  3CCJ T;  1KQ1 A;  5GAM j;  4C8Q G;  1QW1 A;  2LQ8 A;  5FU7 B;  2V8J A;  2HAX A;  1KD1 U;  2MMP A;  3M54 A;  2F69 A;  3FLG A;  2E5Q A;  4RKU E;  2X4J A;  3C12 A;  5LJ5 f;  4EMG A;  5LJ5 g;  1VIF A;  2JN0 A;  4J83 A;  4LDW A;  1X6O A;  4M75 D;  3OYL A;  3RMQ A;  3HRT A;  4E7J A;  5LJ5 h;  2YLB A;  4Z02 A;  5DLO A;  3GF5 A;  3VUZ A;  4QVZ A;  4XTY A;  4ELZ C;  1Q86 U;  4M75 G;  4C92 A;  3RMS A;  2X4W A;  4F7U A;  5IN1 A;  2M16 A;  1HXD A;  4BY6 C;  1Y71 A;  2R57 A;  3URG A;  1M1K C;  3HPW A;  2EQJ A;  4JRP A;  4L6V 5;  4E7H A;  3S3O A;  2ZPF B;  3QZ5 B;  3FC3 A;  1GXI E;  2OTJ A;  2X4Y A;  3JCM d;  2E1H A;  2FB7 A;  3QDR B;  3DLL A;  4FU6 A;  1FXX A;  4OF1 A;  3HKS A;  3MP8 A;  3N5B B;  4PNO A;  4BI3 A;  3QG1 A;  1W2B A;  1G3Y A;  2LTO A;  2BIV A;  2GFU A;  4BD3 A;  3LGL A;  2VGM A;  3X24 B;  5CK9 A;  3O8V A;  3BDU A;  3EFR A;  1QVP A;  4M7A F;  3CME A;  4BE1 A;  2YRV A;  5A0L A;  3SWN B;  2Y4Y A;  1M5Q 1;  3CCE T;  3GP8 A;  1N9R A;  3C94 A;  3G6E A;  2CZ0 B;  3M55 A;  3L2U A;  2K5L A;  5A0G A;  2OTL T;  5GAN e;  1U1S A;  1IRE B;  4GY5 A;  5KE2 A;  1OZ3 A;  2QQA A;  1X01 A;  3MEA A;  4PJO G;  2JVV A;  5GAN 2;  3CCM T;  3L2Q A;  4PJO C;  4J6W A;  3M58 A;  2K4Y A;  3BDL A;  4C0D B;  1YJN T;  1D3B B;  4ME7 A;  4RCB A;  5LJ3 e;  4IUQ A;  4V2S A;  3VUB A;  1WQ7 A;  4M78 G;  1O75 A;  3OMG A;  5IAY A;  1X75 C;  1VQK A;  3L2R A;  1Q7Y C;  1KQS A;  2RK1 A;  4QQD A;  4F7U F;  3CPF A;  3TEE A;  1K73 U;  3AHU A;  2K2V A;  2JNG A;  3QII A;  1YI2 T;  2DO3 A;  5GAN 7;  3CCU T;  5HKC A;  4PJO E;  5GAO l;  1WPY A;  1P92 A;  2MF2 A;  4ELY C;  4LDX A;  5D6X A;  2XU8 A;  1JRI A;  2O01 E;  3OBW A;  4M78 E;  3L2W A;  2IG0 A;  5GAO n;  1WJR A;  2PVG B;  3MP6 A;  5GMK i;  3OYK A;  3EAE A;  5FLX E;  3CC2 A;  4ZN3 A;  1H3Z A;  2XDP A;  4A4G A;  4C0Z A;  2RH2 A;  4BI4 A;  4J5Y A;  4ZTJ A;  3JB9 I;  5GAM f;  2R5A A;  3OYY A;  3L2V A;  1DJ7 B;  1UB4 A;  2V8I A;  2P0Q A;  4C8Q F;  3OW2 A;  3JB9 F;  4C92 B;  1BI0 A;  1HK9 A;  1N6A A;  4II1 A;  5LJ3 f;  4A4K A;  1OZ2 A;  2CS7 A;  2FHD A;  5GAM h;  2VGN A;  3CPW S;  1YI2 A;  1JJ2 A;  2ZGW A;  4LD6 A;  1Q82 U;  1K9M U;  1XNI A;  4VUB A;  1OYX A;  3PGG A;  5J3B A;  3VJP A;  3LW5 E;  4FT4 A;  2C06 A;  1NE8 A;  4M7D C;  4MDW A;  4LDY A;  3OYC A;  4JRK A;  3JCM g;  3MET A;  4EPC A;  3G71 A;  4R56 A;  1Q81 U;  2IVW A;  4M7A G;  4O5V A;  2MAM A;  3X28 B;  2RJC A;  1RI0 A;  4M75 F;  4M7A C;  4HA8 A;  4IKF A;  3CCQ T;  2LCL A;  1XQH A;  1YJ9 A;  1M9S A;  2YLC A;  3HFN A;  2E41 A;  1EIF A;  3MEW A;  3FDR A;  3RKW A;  1Y96 A;  4HT9 A;  4JUV A;  4BDZ A;  2EQU A;  4C92 D;  2RHU A;  1VQ5 T;  3FB9 A;  2DKG A;  4HCB A;  2RB6 A;  3JCM X;  2M9U A;  4M7A E;  3L1A A;  3CCL T;  2F5T X;  4B9W A;  4C92 G;  4IUT A;  2LVM A;  3GPL A;  3QPH A;  3UT1 A;  4F7U G;  3CBP A;  3CMA A;  2DZC A;  3JCM b;  1SSF A;  1WGS A;  5CQX A;  2DIG A;  4C5E A;  3VYG A;  3NTH A;  2QTX A;  5GAO q;  1D3B A;  3CCQ A;  3RKY A;  5GAN 8;  3OBY A;  2DXC A;  4M77 A;  4ZTF A;  5GAO p;  4FSX A;  1I4K 1;  3BY7 A;  3CBO A;  5DLQ E;  3I56 T;  2VV5 A;  3OS2 A;  1QVF S;  4QVD A;  4ZGE B;  4OB2 B;  4DA4 A;  4F7U E;  3R6O A;  4N4G A;  5GAN j;  3CCR T;  2ZPB B;  4OB1 B;  1H64 1;  4WF2 A;  5GAN 4;  1B34 A;  3CCJ A;  1VQ4 T;  4HT8 A;  4RG2 A;  3ZEH A;  3GOX A;  3JRZ A;  2GFA A;  3LH0 A;  2CGH A;  3JB9 G;  3LWI A;  3RES A;  4C8Q C;  2A3L A;  2EJF A;  2WAC A;  2HBP A;  2X35 A;  1VQ6 T;  5LJ3 j;  5A2Q E;  5FRO A;  4OP0 A;  3V8K A;  5GAN 3;  4P5N A;  1KHI A;  2D0Q B;  2DZ9 A;  3TCJ A;  4JDS A;  2KK4 A;  4BE2 A;  4J6Y A;  2DD4 A;  4JLI A;  4MDX A;  1MGQ A;  3QHS A;  3CCV A;  2H3J A;  3QYG B;  4QW2 A;  5GAM d;  3E9G A;  4PLL A;  3OYB A;  3CXC A;  4JJN K;  3M59 A;  1ZHI A;  3P8D A;  1M90 U;  3VKI A;  3SB2 A;  2DVE A;  4NS5 A;  4NL3 A;  2FYK A;  4M75 C;  5LJ3 d;  4C8Q E;  4LD9 K;  4MZP A;  3MHX A;  3JB9 H;  3H6Z A;  2EJ9 A;  2RJD A;  3QJY A;  3RKX A;  4OVA A;  3V7S A;  2ZZD A;  4EMK C;  4BAC A;  1Q82 C;  4RG8 A;  1M8V A;  4LDV A;  3G4S T;  1I8F A;  1Y96 B;  2EFI A;  3DLM A;  3M4G A;  4XK8 E;  1VQ6 A;  3OQ5 A;  4M75 E;  5CKF A;  5GAN 5;  3JAM E;  2AHJ B;  5KCH A;  3MO8 A;  4Q5W A;  5FU7 C;  4ATO A;  1WJQ A;  1VQ9 T;  3PIP A;  2R5M A;  4DOW A;  3M9Q A;  2CZ6 B;  2LCC A;  1JB0 E;  1VQ8 T;  2XI9 A;  3OS1 A;  3OYG A;  5EG2 A;  2KDS A;  4FL6 A;  1NJI U;  1ZQ1 A;  1VQL T;  2GQV A;  3PT9 A;  3GLX A;  3VYH B;  3CPW A;  1G5V A;  4KUL A;  1AHJ B;  3V8J A;  1VQN T;  1G3S A;  1N27 A;  3JCM h;  3ME9 A;  1VQO T;  3JCM Q;  1FWZ A;  1S72 T;  4A4E A;  2X4X A;  2NLU A;  4RCC A;  2KQW A;  3BFM A;  2RJE A;  4M77 B;  5FRN A;  3GIB A;  5FU6 B;  4M78 C;  4C92 F;  2E64 A;  4EMH A;  5GAO m;  2QQ9 A;  2LDM A;  1WNL A;  4IUP A;  5LL6 S;  1QVG A;  2E10 A;  1U1T A;  3M5A A;  1KC8 U;  5KH6 A;  1NZ9 A;  2XIC A;  3JCM J;  3JSC A;  1VQ9 A;  2JTM A;  2O4X A;  4ZGD B;  1B34 B;  3F70 A;  3CCE A;  2JOY A;  3L42 A;  4OB3 B;  2OTL A;  2OAU A;  1VQL A;  3TU4 K;  5I2M A;  4FIB A;  2QI2 A;  4HCZ A;  4XU0 A;  3SWN C;  3T9N A;  2RHY A;  4PKC C;  5DM7 R;  1VQM T;  4BUG A;  3GNG A;  3NTI A;  4D6W A;  3CCM A;  2DTH A;  5CKE A;  5GAN f;  3WXM B;  4A53 A;  5CCA A;  1YJN A;  1K8A U;  4M77 D;  2ZPG B;  1WQW A;  2LT1 A;  5GAN h;  2RHZ A;  5GAM g;  3QYH B;  2RJF A;  3MCA B;  1KD1 C;  4MML A;  2DTO A;  3FEO A;  4C0D C;  3JCM e;  2DPP B;  2DEQ A;  2P4T A;  4M77 G;  5LJ3 g;  1VQP T;  4KUD K;  5D6Y A;  1G3T A;  3CCU A;  1BI1 A;  3SD4 A;  5LJ3 h;  3OYN A;  2E6N A;  3FJP A;  3MEV A;  4LDU A;  2I2L A;  1W2B S;  2E6Z A;  3RER A;  2XID A;  4DOV A;  1M90 C;  4IUU A;  2A7Y A;  2QQS A;  3JCM c;  3ASK A;  2DAQ A;  4B9X A;  1VQ7 A;  1BI2 A;  1BIA A;  2BKD N;  3RIR A;  2QEX T;  2EJG A;  3DKM A;  3MP1 A;  2EAY A;  2L89 A;  5I21 A;  4X9D A;  3QSU A;  3I55 T;  2XDD A;  3HSB A;  3A8M B;  4M7D D;  2VC8 A;  3DB4 A;  4IUV A;  1M1K U;  1Y07 A;  2RO0 A;  4J6X A;  3CD6 T;  2DD5 A;  1PSF A;  4TVR A;  1VQP A;  1W4S A;  3FRN A;  4Y91 A;  1I81 A;  2HD0 A;  5M9O A;  3OYM A;  4KUI A;  5HK0 A;  2EQM A;  4C92 C;  4XU2 A;  3C4S A;  4J7F A;  3OYA A;  1KQS S;  1UGP B;  3KUF A;  2JZ2 A;  3QJ6 A;  2DTI A;  1M4Z A;  5CO7 A;  1VQ7 T;  4BE0 A;  3CC7 T;  3CC4 T;  1LJO A;  1UGS B;  3PIO A;  3SDZ A;  1QP2 A;  2ZCF B;  2QEX A;  3OB9 A;  4XTV A;  4CRI A;  1YIJ T;  4C0F A;  4KBM B;  1BIB A;  2LC4 A;  2O4X B;  4XTZ A;  4C92 E;  2RI5 A;  3QUI A;  3UWN A;  3Q1J A;  5CKH A;  3X26 B;  1VQ5 A;  3HRU A;  1KQ2 A;  2FVU A;  2QQB A;  5LJ5 e;  1K73 C;  2P0P A;  3BW1 A;  1UEB A;  2JUF A;  4E7I A;  3CCL A;  2DXU A;  4ZGJ B;  2XG8 D;  1Q7Y U;  4DQ2 A;  1VIE A;  1YCY A;  2PQW A;  5GAN 6;  3OYJ A;  2D6F A;  3RUX A;  2L5Q A;  3OY9 A;  3FIF A;  5CIU A;  2RD1 A;  4XU1 A;  2V8K A;  1MHN A;  4OMF B;  4XAX B;  4BY6 B;  2RI2 A;  5GAN d;  3JCM P;  5CVI A;  1Q86 C;  1JJ2 S;  2R58 A;  1KHC A;  2GF7 A;  3M4Y A;  5C6S A;  3M57 A;  2MWP A;  3JB9 J;  5HY6 A;  2E65 A;  4M7D A;  3LYI A;  3V8L A;  3I56 A;  2FL7 A;  2G3R A;  3VU3 C;  3LGF A;  3OYF A;  5FRM A;  3NTK A;  2EWN A;  2PUK B;  2VUB A;  5IT9 E;  2Y90 A;  4JS4 A;  5CKD A;  2QXF A;  5CQY A;  5DY9 A;  3CCR A;  1VQ4 A;  2KMT A;  4CI0 C;  1TH7 A;  1N8R U;  4M77 F;  3C95 A;  2Y4X A;  5AYF A;  3PMI A;  4BDY A;  1K9M C;  4J8O A;  4FT2 A;  5CR2 A;  4MZT A;  3NFC A;  4J7I A;  2DJZ A;  3E1S A;  1Q81 C;  2HNI A;  3CME T;  4N0A A;  2E70 A;  2VYT A;  1YJW T;  2PVD B;  3LWH A;  2L3R A;  2EYQ A;  3ZFJ A;  3G6E T;  4PJO B;  3S3N A;  1NPR A;  2M0O A;  3PFS A;  4QQG A;  2WSF E;  4A4H A;  3ZBD A;  3V7R A;  3GNF B;  3OYH A;  2VXE A;  3G7Z A;  3QBY A;  4M78 B;  3J80 E;  1BYM A;  2DIQ A;  2KAF A;  3A5Z B;  2HQE A;  4Y28 E;  2RK2 A;  4E7K A;  1YIT A;  1YBY A;  4UC4 A;  3QO3 A;  4OGC A;  5GMK e;  1LOJ A;  1VQK T;  4M7D F;  2CZ7 B;  3E9F A;  3P8B B;  5KE3 A;  3S3M A;  2ZPE B;  2LRQ A;  2XKO C;  3OS0 A;  4JRI A;  2LNV A;  2MWO A;  3G4S A;  2PU9 B;  3DB3 A;  3HP9 A;  5CKB A;  3WVE B;  3QZ9 B;  3J81 E;  4PJO D;  4MMK A;  2E12 A;  4C5H A;  5GMK m;  3OSV A;  4EDU A;  2M1H A;  4C8Q A;  4X34 A;  5C0M A;  4A54 A;  3S6W A;  3KBG A;  3X25 B;  2RHX A;  1VQ8 A;  1XOV A;  1Y7X A;  2GCX A;  4M78 D;  5GAM e;  1O9S A;  5GMK l;  4OB0 B;  2PUO B;  5HK3 A;  3CC2 T;  4XU3 A;  2EKO A;  5D6W A;  1VQN A;  2CYZ B;  4O6J A;  2XK0 A;  5GAN g;  2P0K A;  3PTA A;  1VQO A;  1M1F A;  2XHC A;  2K3Y A;  2QQR A;  2YHT A;  3H8Z A;  3PNW C;  3CXC S;  5GAO r;  3X20 B;  3UPU A;  4MZM A;  1S72 A;  4RMO A;  2LT4 A;  2LX9 A;  1V29 B;  2CKK A;  4M75 A;  4HKE A;  4R55 A;  4E7L A;  1YIT T;  4M7D B;  2QDY B;  3V7C A;  2DXB A;  3LX7 A;  4HCC A;  4M7A B;  2ZPH B;  4M77 C;  4EMK A;  1RL2 A;  4QVC A;  3HFO A;  5GMK h;  3A8G B;  5FU6 C;  4N4I A;  5A0D A;  3G71 T;  1BI3 A;  5LJ5 j;  1QVF A;  1R8O B;  3MEU A;  2WSC E;  3OA6 A;  4QQ6 A;  3KXT A;  2K5I A;  1LNX A;  4XQ3 A;  1U8R A;  1QP3 A;  4BB7 A;  1M1G A;  2RM4 A;  3P8H A;  1NPP A;  2BUD A;  3OYD A;  2KVQ G;  1YJ9 T;  3HL8 A;  4PL6 A;  4BI8 B;  4C5G A;  3UDC A;  1VQM A;  3VV0 A;  3CCS T;  2XDB A;  3OYI A;  2QA4 T;  4JLG A;  1BKB A;  2VXF A;  4M77 E;  3A8H B;  3L2Z A;  3PMT A;  5LJ5 d;  2EQK A;  1N8R C;  4XTU A;  2K3X A;  1UGR B;  2KSS A;  1WJS A;  3CEY A;  3EFS A;  3M56 A;  4YTL A;  5J39 A;  4F7U B;  2RHI A;  3M53 A;  5L8R E;  2K5F A;  2F5K A;  4FM4 B;  4M7A D;  4PJO A;  4ZN1 A;  3SFM A;  3CMA T;  4M7D G;  2KY9 A;  1G3W A;  4PLI A;  3A8L B;  1IZ6 A;  3HHT B;  1N9S A;  2DK3 A;  3INZ A;  3JCM f;  4M78 A;  2LQK A;  2B8A A;  4XTW A;  1OI1 A;  5J26 A;  3CBM A;  3OS5 A;  5KCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...