2BKDN

Structure of the n-terminal domain of fragile x mental retardation protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
134
structure length
131
Chain Sequence
MEELVVEVRGSNGAFYKAFVKDVEDSITVAFENNWQPDRQIPFDVRFPPPVGYNKDINESDEVEVYSRANEKEPCCWWLAKVRMIKGEFYVIEYAACDATYNEIVTIERLRSVNPNKPATKDTFKIKLDVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords FRAGILE X MENTAL RETARDATION 1 PROTEIN
publication title The structure of the N-terminal domain of the fragile X mental retardation protein: a platform for protein-protein interaction.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 131
sequence length 134
ec nomenclature
pdb deposition date 2005-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF05641 Agenet Agenet domain
N PF18336 Tudor_FRX1 Fragile X mental retardation Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2bkdN01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2bkdN02
5CIUA 5KE3A 2WACA 3CEYA 3OYCA 2QQRA 1WJRA 3C4SA 4X34A 3OYFA 4N4IA 3DB4A 3META 2L3RA 4FL6A 2PQWA 3L2RA 2DAQA 2EQMA 2LCCA 2M16A 3OMGA 3OS0A 2EFIA 5C0MA 2RHUA 4NS5A 2BUDA 2L89A 4QQGA 3FEOA 3O8VA 2HQEA 2X4YA 2X4XA 2CKKA 3M9QA 3L2VA 3H8ZA 2L8DA 3OYKA 2LVMA 2R57A 2LRQA 2RI2A 1WJQA 2LDMA 3OYAA 2X4WA 4IUTA 3DB3A 3OYEA 3LGFA 1OZ3A 4L59A 5IAYA 5C6SA 4BDZA 3OYDA 2RO0A 3NTKA 2E5QA 3KUFA 3QBYA 3OYGA 4QQDA 3LGLA 3L2UA 5FROA 4FU6A 5D6WA 4IUVA 4A4EA 2EQUA 2FHDA 2JTFA 3PFSA 2E6NA 2XDPA 3P8HA 3PNWC 3QKJA 4GY5A 3OYBA 3E9FA 3Q1JA 4C5HA 2R5AA 3S3OA 4B9XA 3UWNA 4RG2A 4BACA 2RHIA 4PLLA 1WJSA 3MEVA 2RJEA 4II1A 5FRNA 3L2WA 3OMCA 4HCZA 4C5EA 2P0KA 2QQSA 4EDUA 3H6ZA 5KH6A 3NTIA 3MEAA 5D6XA 3E9GA 3OS2A 2MWOA 4BE1A 3OB9A 3EAEA 2RI5A 4PL6A 4A4GA 4E7KA 4B9WA 4E7LA 3FDRA 2EQKA 3OYIA 4E7IA 3DLMA 2GFUA 4IUUA 2O4XB 3ASKA 5FRMA 2EKOA 2F5KA 3OA6A 2JZ2A 2GFAA 4C5GA 4PLIA 5KCHA 4BDYA 2BIVA 3FLGA 3P8DA 3FC3A 3OYNA 4QQ6A 2GF7A 2NLUA 3F70A 2DIQA 3MP6A 4UC4A 3OQ5A 1RI0A 2M1HA 3S3MA 2LTOA 2RJFA 2RJCA 4IUPA 2MWPA 3OS1A 4E7JA 5D6YA 3UT1A 1H3ZA 3LLRA 2B8AA 3QIIA 4IUQA 3SD4A 2X35A 4A4FA 4BE2A 3BDLA 2DIGA 4C5IA 4BE0A 3PMIA 4QW2A 4Q5WA 1OZ2A 2D9TA 3MP1A 1SSFA 1WGSA 4QVZA 3MP8A 3OY9A 4Z02A 3LYIA 3S6WA 2BKDN 3NTHA 5KE2A 4E7HA 4ZTFA 3ZEHA 2HQXA 2RHYA 3MO8A 2R5MA 3L42A 1G5VA 2RHZA 2K3YA 2R58A 2VYTA 3L2QA 5J26A 1XNIA 5J39A 4CRIA 3ME9A 4OVAA 5KCOA 5M9OA 3OYLA 2RJDA 1OYXA 3LX7A 1OI1A 3MEUA 1KHCA 2RHXA 4N4GA 2K3XA 1N27A 4BD3A 3LH0A 1MHNA 4N4HA 3OYJA 2O4XA 5IN1A 4IKFA 3QJ6A 4LD6A 4ZTJA 3OYMA 2M0OA 2XK0A 2YRVA 2EQJA 4A4HA 3PMTA 3OYHA 2RI3A 3GOXA 2IG0A 4IURA 3MEWA 3S3NA 2G3RA
chains in the Genus database with same CATH superfamily
4HVWA 3VS2A 2X51A 1FMKA 2FL7A 5GAOn 3VUZA 1SEMA 5DLQE 3CCUQ 3EG2A 3M55A 4KUDK 3CC7A 2KAFA 2V26A 1WI7A 3CCLA 1YITT 2F69A 5GANf 1NZ9A 3MKDA 2LDMA 4IUTA 4M77A 3NTKA 1VQ8Q 4M77E 1B34B 5IXFA 4XTZA 1UB4A 3OSSC 4JZ3A 3QKJA 2RB6A 2COZA 1ZX6A 3E9FA 4C5HA 2JVVA 3S3OA 2QGFB 3CPWS 1WJSA 1YJ9T 1VQ5A 4II1A 3UPUA 1PKTA 4RTYA 1YWOA 2Z0WA 4JDSA 5D6XA 5FU7C 2DJZA 4E7KA 2FRYA 4E7IA 4E47A 4M77C 3HFNA 2JZ2A 1VQLQ 4AG1C 3E2UA 2ZPEB 3JRZA 1UGSB 1G3WA 4M78D 2KSSA 3KXTA 3HSBA 1VQKQ 1WHKA 1BI3A 1LNXA 2VASA 2RM4A 2GNCA 1HD3A 3A8LB 4QVZA 1I07A 2EYWA 4C92F 1ZSZA 1CKAA 3TCJA 3REBB 9ATCB 1MV0B 5GAOp 1QCNA 1U06A 2R58A 3CMAQ 3M4GA 5J26A 2VXEA 4F7UB 4CRIA 5KCOA 1VQ7Q 1VQMA 4DBFA 3MEUA 3QJYA 1CSKA 2KROA 5KYNA 4HVVA 4O6JA 1OV3A 4ZTJA 1FYNA 3PMTA 1IXDA 2WSCE 4M78G 3URGA 2CP0A 2DLPA 1NM7A 2AZSA 4LUEA 1ZSZC 3QYHB 1BK2A 4JRQA 2PQWA 2YT6A 1UUEA 4OF1A 4C0DB 2RHUA 5GAOr 2D0QB 4PJLA 4C8QB 1JXOA 1V29B 4EIKA 4D6WA 1QVFP 2L8DA 3VS0A 3G71T 4RTWA 4ZGDB 2L3QA 1GFCA 3DB3A 1U5SA 4DBQA 1JJ2A 1G3SA 2PVDB 2EWNA 3VYHB 1GRIA 2DE0X 1RL2A 1X6BA 1D1AA 1T3LA 5A0GA 2KVQG 1ZBJA 3RMQA 2DL4A 2CREA 2DERA 2O31A 3OMCA 4X1VA 3QO3A 4XU0A 1JEGA 2OI3A 1WQWA 3EH1A 3G6EQ 4B9WA 1BI2A 1D1CA 2H8HA 1FX7A 1IGUA 4C92A 2XDDA 2KGTA 1TUCA 4C92E 3CD6Q 1RABB 1TS9A 4J7FA 5KYYB 4KGVB 3CPWP 2LJ1A 3S3MA 1M3CA 2QQAA 3WVEB 3CCUA 1VQNT 1WHJA 3LWHA 3L1AA 4PJJA 2XKOC 3BDLA 4OB0B 2KK4A 1OOTA 5GAMf 1K1ZA 5I22A 2HAXA 5GMKi 3JCMh 3I9QA 2K2MA 4C92C 3CC2T 3GBQA 1VQ8A 3CBOA 4RCBA 3RKWA 3M57A 1VQ4Q 4C0ZA 1M2VA 3L2QA 2DL5A 4V2SA 3OYLA 1AEYA 1ACMB 2OAUA 2QDLA 3OBWA 3OYJA 2L2PA 4M75B 4FW1A 2QQ9A 1G8XA 2PVGB 3OYCA 3CXCS 1VQLA 1WHLA 4LE9A 2M16A 2CYZB 2DXCA 3OMGA 4MZPA 2P84A 1I81A 1B07A 1PNJA 3EG9B 1VQKA 3P8BB 2R57A 2A28A 2DRKA 1TG0A 3OYAA 1K73C 3VUBA 2DFUA 4M7AB 2DNUA 1AOJA 4J8OA 2EYYA 4PJOF 3CCJT 3X24B 2YUPA 2HCKA 2XIDA 4B9XA 3UWNA 4RG2A 3I56Q 4RTVA 1YHQQ 3CMAA 4EDUA 3H6ZA 3M0SA 1W70A 3V7SA 3JV3A 2ED1A 1M3BA 2DK3A 1VQ7A 2MPXC 3GIBA 3QSUA 2GFUA 4LDWA 2YWWA 2COYA 3CCMQ 2OTJT 2V8JA 4KGZB 2DXBA 3JCMe 3G1JA 1T0HA 3A5ZB 5CKDA 2MWPA 1RI9A 2FZCB 1HXDA 4BE2A 2DEQA 3EHRA 2SRCA 3SFMA 4QW2A 4HCKA 1K9MU 4FSXA 1YI2T 4FW2A 3EFOB 5I2MA 2KXDA 1BB9A 2HQXA 2WSFE 1IRXA 1WA7A 1X6OA 5J39A 4OVAA 1R0BG 1H3HA 1UFFA 4J9DA 5IT9E 1KHCA 1U8RA 1LVKA 1VQ9T 2XU8A 1NBEB 2KBTA 1VQOQ 1WZOA 2K5IA 2M0OA 3RKXA 3G6EA 5GAOl 1X43A 1UG1A 4CC4B 3OYFA 3SB2A 3CCET 4X9DA 1HSQA 3UA7A 3CD6A 2EQMA 2HBWA 4PJNA 1H8KA 2PU9B 1JBMA 1WNLA 5IHIA 2LQ8A 4RKUE 1KQSA 1YJNQ 5IAYA 3O5ZA 3RERA 2V1QA 4Y92A 1X6GA 1J3TA 4GY5A 3CXCP 5A0LA 3HRSA 4KT0E 4J9IA 2E4HA 2JMCA 3WVDB 1VQ4A 3RIRA 2L5QA 1TH7A 1K73R 3VS6A 2RI5A 1BCMA 1YIJQ 2LCSA 3EFRA 2FG0A 4J9HA 2GFAA 2EPDA 2HKQB 2DTOA 2EQIA 3EFSA 3VJPA 5LJ3j 3MP6A 1RI0A 1MNDA 4JLIA 5GMKe 1VQ6Q 1ABQA 2K57A 3ULRB 3QIIA 3A8GB 4O5VA 4JRPA 4NL2A 3VV0A 2VVKA 1W4SA 3MP8A 6AT1B 3S6WA 2J06A 4DOWA 3ZBDA 2CZ6B 5CO7A 3CC7T 1VYVA 2PVOB 2LNVA 2SEMA 5GAN7 3CCLT 2VC8A 1K0SA 1QWEA 3GLXA 2EVRA 4AMCA 5GAN2 2D6FA 3I56A 1W2BA 3JB9D 2L3SA 2VB6A 1YJWQ 1YHQA 2M51A 4N4GA 3LH0A 3X20B 4ELYC 4J9FA 2XK0A 2EQJA 3PGGA 2RQVA 1TU0B 1YFNA 3MEWA 4GLKA 1VQ5T 3CCMA 1CKBA 4N4IA 2YXYA 4MDXA 2JS2A 2V8KA 3V8JA 4JJBA 1C1AA 1YCSB 4NS5A 2BUDA 1KC8U 4LDYA 2HMAA 1QVPA 1BYMA 1LPLA 2X4WA 3QHSA 3OYEA 2EKHA 2RO0A 2E5QA 3QZ9B 4Z89A 3JB9G 1AWOA 2P4TA 2EQUA 1JJ2S 3OYBA 1G2BA 3N5BB 1SRMA 5GMKl 4ZGJB 2OX7A 4F7UA 1Q81U 2ZZDA 4F7UE 1M8MA 2J7IA 3SDZA 4C5EA 2QQSA 3HL8A 4L6V5 1M4ZA 1PC0A 4M75G 1M1FA 3TQ7P 1VQOA 2FYKA 2OTLQ 4EMKB 3FLGA 5HKCA 1W1FA 2MAMA 1VQMT 3OQ5A 3I55Q 4MDWA 4C8QA 1R0CB 2W10A 2HDAA 4C8QE 3HKSA 3SD4A 1YBYA 2RQUA 4M7AG 4AT1B 2KI7A 5CQXA 4A63B 5AT1B 4NL3A 1M2OA 1KC8C 1YJNA 3LYIA 2CUDA 2MOXA 1A0NB 4LUDA 4C0DC 1UJYA 1IHVA 4C8QC 3ME9A 1B7TA 3G7ZA 1NE8A 4FYYB 1MHNA 3QDRB 5IN1A 2F2XA 1AZGB 5LJ3g 1YIJA 4IIMA 1HK9A 3PE0A 1UHCA 3AHUA 5KYYA 2WACA 1FMVA 1WJRA 3META 3M0RA 1SKUB 2DAQA 3OS0A 2W0ZA 3BW1A 5GANe 1VQ6A 5LJ5j 2MI6A 2BTTA 4PFZA 1QVFS 1WJQA 2KY9A 4J6WA 3EHQA 4JLGA 4JJCA 4QQDA 1SG5A 1OU8A 3CCUT 2K5FA 3P8HA 1N6AA 4PLLA 1F1BB 3LW5E 5ECAA 1PRMC 4OMQA 2VKNA 4OP0A 1UJ0A 3E9GA 1KFZA 4M75A 1X2QA 1YJWA 2DL8A 4PL6A 3QUIA 4M75E 1VQ8T 3RKYA 1ZUYA 3OA6A 3R6OA 4BDYA 1JJ2P 1WLPB 4BI8B 3X28B 2NLUA 3F70A 2FB7A 5FWCA 1ZLMA 4E7JA 1H3ZA 1EIFA 2DD4A 4OMNA 3J7AF 1QMCA 1EFNA 2LJ0A 4M7AA 2ZGWA 3NPFA 4M75C 1PG5B 4M7AE 3V7RA 1AT1B 1VQLT 1BI1A 3HRUA 3JCMQ 1GL5A 1K8AU 4ZTFA 5CKFA 1UGVA 1VUBA 4BY6B 1VQKT 3NMZC 3HP9A 1VQPQ 2YLCA 3OW2A 4HT8A 5GAMh 2FZGB 5LJ5h 1PCXA 4VUBA 4M7AC 3L2ZA 1WIEA 3OYMA 2JUFA 1M90U 1KC8R 2CDTA 1FMWA 3JB9I 4M7DB 1PSFA 4XQ3A 2G6FX 2OTLA 1VIEA 4KGXB 4FM4B 2DF6A 3CMAT 4EPCA 3UDCA 3J81E 2LCCA 1BBZA 1VQ7T 2NUZA 3C12A 4KH0B 2HL5C 4HVUA 3I55A 2HL3A 1Q7YU 2L3PA 2DPPB 2HQHA 4FSSA 2YHTA 2E3HA 5FW9A 5LJ3d 2LRQA 3QXEB 3NGPA 1UHFA 4R56A 4L59A 3EFOA 1IHWA 3VS4A 3CCSQ 2FPFA 3QBYA 1M3AA 1Y0MA 1KQSS 5GAOq 2ENMA 2YRDA 3PNWC 5HCKA 1TOVA 2GQIA 3JCMP 1M27C 1HJDA 7AT1B 2HEQA 1MMDA 1K8AC 4PFOA 3M4YA 4LN2A 1KIKA 3G4SQ 3OB9A 4PFPA 4A4GA 3OYIA 1IO6A 1OULA 3ASKA 4Z88A 2EKOA 2F5KA 4M78F 2HSEB 4DEXA 3VRYA 1D1BA 4IUPA 3OS1A 5GAN6 3PTAA 3TSZA 2DJQA 1OEBA 4JRIA 4F14A 3G6ET 5FU6C 4F04B 1NLPC 5GAMe 5LJ5e 3PMIA 4AFSC 1QKXA 1WGSA 2JW4A 1X75C 2KEAA 1Q7YC 3CD6T 4BB7A 2ZPFB 3OS5A 5KE2A 4JJDA 1B3QA 2KT8A 3PVLA 2CP7A 1OPLA 3VU3C 1W2BS 4HCCA 4XU1A 3RBBB 3QJ6A 1M1KU 4LD6A 2EJGA 1AHJB 3JCMc 3LH5A 4PKCC 2CUBA 2FO0A 1VQ4T 4QT7A 4PJOD 2PTKA 2AKKA 4FL6A 3L2RA 2O9VA 3JCMW 2K7AA 1QVGA 3O8VA 2FPDA 4DEYA 4XTUA 2EIFA 1UEBA 2RI2A 2DYIA 1YNZA 3OYGA 2F5TX 4M78A 1RAEB 2NWMA 4M78E 3CMEQ 3PVQA 5GMKj 1QP2A 3M53A 4OMPA 1WQ7A 4Z8AA 3M0QA 2RH2A 1OPKA 1VQPA 1X01A 2DBKA 3H0FA 2XMFA 3FIFA 1QW1A 4M77B 1KQSP 1G3YA 3JCMJ 3P8DA 4M78C 3I56T 3QG1A 2E12A 2E10A 2VUBA 1YHQT 1M1KC 2DIQA 4J9BA 2VGMA 2QYZA 4ESRA 1K8AR 1AWXA 1OU9A 1VYUA 3EG3A 1C6VX 2AK5A 2QK0A 1VYTA 1QLYA 3JCMg 3CCMT 1KD1U 5CK9A 3I35A 1JRIA 2K6DA 1H92A 2Y90A 4NOYA 4FIBA 1Q86U 3CCSA 5LL6S 1N8RU 2VGNA 4P5NA 2RHYA 3M5AA 3CCRQ 1QKWA 3L42A 2O01E 2K4YA 2RHZA 3RR6A 2JJ9A 2ROLA 2DXUA 1M9SA 2YUNA 4QKUA 3RDVA 2BZ8A 3HRTA 3G4SA 2RI3A 1O75A 4J83A 4KBMB 2AIRB 1M1GA 3M59A 2X3WD 2FEIA 4M7DD 2QEXQ 4RUGA 3VS3A 3QPHA 5GMKh 1YWPA 2V8IA 4XAXB 5IHNA 2FVUA 2X4XA 3SWNB 2DMOA 1RAFB 2J6OA 1W2BP 2CT3A 3NHNA 2CZ0B 3LGFA 1OX8A 4LDVA 2EGAA 3G71A 3MCAB 2IVWA 5I2SA 3PFSA 2DKGA 2YDLA 2P4RA 1KD1C 2EGEA 3E1SA 4BACA 4JJNK 5FRNA 4HCZA 3VS5A 2P0KA 2QA4Q 1YJNT 3EAEA 4M7DG 2CT4A 3QWYA 2O4XB 4QVCA 2DL7A 1OX9A 8AT1B 1PWTA 4C5GA 1VOMA 3OSVA 1ZHIA 3PIOA 1M30A 1K9MC 2ESWA 1U1TA 1YIJT 4XTVA 5D7UA 2LQWA 2PUKB 4PK4A 1JXMA 1TWBA 3TU4K 1ZA2B 1K0XA 3GP8A 1D3BB 1RLQC 4C92B 3FRNA 1WHMA 1M1KR 1BIBA 2EGCA 5IHKA 1RUWA 2EYZA 2M9UA 3MO8A 2XD0A 1VQ6T 3CMEA 4ME7A 4F7UF 2DA9A 2VV5A 5GANj 2DD5A 3HFOA 4C0GA 1QCOA 3JCMd 1PRLC 3LX7A 3V8KA 2RHXA 1D09B 4IKFA 3OW2S 1MV3A 1B34A 1T0JA 3GOXA 2HZYA 2FRWA 3QWXX 3WXMB 2NUTB 2NUPB 4BUGA 4BI4A 5KE3A 1GFDA 2JM8A 4L5GA 4X34A 3SHWA 3DB4A 3BE3A 2DETA 1RLPC 3A98A 2DZ9A 4C8QF 2D1XA 1AWWA 1C0MA 1UE9A 2HQEA 2CKKA 1WHHA 4GLMA 3T9NA 3BFMA 3CCVQ 5FWBA 3KUFA 4F17A 2RMOA 4XTYA 3JB9H 1PHTA 5L23A 2RHIA 1D0ZA 1H641 3CQTA 3CCRA 3TREA 2LMJA 3GPLA 2C0TA 1K4US 2D8JA 4R0KA 3FB9A 2AZVA 1MGQA 4XK8E 4EMHA 2M0YA 1KK7A 4OB3B 4M7DA 2DILA 3TVTA 4FCYA 2C0IA 4M7DE 1BI0A 4HA8A 4D8DA 1IGQA 5KCHA 2QQBA 2YRCA 3MPUB 8ATCB 4M77D 3OYNA 3VS1A 1KD1R 3QDFA 2OTJA 2E3IA 2KRSA 4FT2A 2KRNA 2QEXA 2CP6A 5GANh 2LQKA 4AFUC 2CGHA 4RG8A 3VS7A 1VIFA 2QASA 4ZN1A 4C5IA 2H3EB 2PZ1A 3NFCA 2OTLT 2JT4A 3TEEA 3CCQQ 3OY9A 4Z02A 1Y7XA 2OAWA 4E7HA 3I55T 3DKMA 3OYYA 1S72Q 2CP3A 3JB9F 1K9AA 1GBQA 2DXTA 2K3YA 1G5VA 2EBPA 1K9MR 1NG2A 1QP3A 1SHGA 1U3OA 4GBQA 2C06A 3RMSA 1PSEA 1NLOC 4M77G 4M75F 2ROTA 2QA4A 2LT1A 3OYHA 3V7CA 2XICA 1IZ6A 4OGEA 3CC4Q 1RAAB 1T3SA 1TTHB 1JU5C 2CP2A 2RD1A 3I5SA 2ZAEA 5IH2A 5C0MA 4KUIA 1KJWA 2L89A 4J9EA 2C0OA 3FJ5A 2X4YA 2KYMA 2GTOA 3M9QA 1JB0E 4M7AF 3UA6A 3OW2P 1QVGS 1RAGB 4XU3A 1Q81C 1Q82U 1ZQ1A 4LDXA 2E5KA 4YTLA 2A3LA 3RESA 2GTJA 4PJOB 4IUVA 2FHDA 2JN0A 1RADB 2JOYA 5GANg 4A54A 2V1RA 4AFQC 3L2WA 5KH6A 3MEAA 5GAMj 4KH1B 3VRZA 2COWA 3A8MB 2MIOA 2D8HA 1W6XA 2EQKA 3GF5A 1E7OA 2JM9A 2ZPHB 4E7SA 2L0AA 4F16A 1KG1A 1VA7A 1WYXA 1ZUUA 3FC3A 1WXUA 2O9SA 5CVIA 2XG8D 3M56A 5CKEA 3LLRA 1N5ZA 1GXIE 1M8VA 3JCMb 1YCYA 2ZPGB 2NYSA 3JAME 2EJFA 4OB2B 4RMOA 2ATCB 2KYBA 3CCVA 2LP5A 3JB9J 4IIOA 4HCBA 2GGRA 2K3BA 2CH4W 5J3BA 3THKA 2ECZA 4OMLA 4C92D 3E19A 2R5MA 1Q82C 3U23A 2VYTA 5LJ3f 1ZUKA 3EG1A 3EG9A 3A8HB 1XOVA 1YITQ 4PJMA 2CH4A 1OQKA 2QTVA 2PUOB 4FYVB 2K2VA 5CIUA 2QGGA 5EG2A 5KYUB 1I1JA 2L3RA 2E64A 1Q95G 1VQPT 1RACB 3M0UA 3SEMA 5GJWB 1YJ9Q 2O2OA 4ZN3A 1TXQA 2CS7A 4C92G 3M0PA 2RPNA 5A0DA 4FU6A 1ZBXA 4RTUA 3CCQA 2XDPA 3EGDB 2R5AA 2LC4A 1S72A 2RK2A 3EH2A 4DBRA 2RQRA 4LNPA 1V76A 3OS2A 2FPEA 2HKNA 3CCST 2QXFA 2MCNA 1QVGP 1Q81R 2XDBA 1X69A 4M4ZA 5GANd 4A53A 3CBPA 2K5LA 4OMMA 3HHTB 3CC4A 4PNOA 4UC4A 4FT4A 3CBMA 3BDUA 2DEUA 2QI2A 3SWNA 2DX1A 2BZXA 3INZA 1KQ1A 4R55A 3DLLA 3G4ST 1ZA1B 4A4FA 4TVRA 2JTMA 3ZL7C 3H9NA 5L8RE 4BE0A 5GAN4 5KYWB 2X4JA 4OMFB 4WCIA 1WDXA 4KRTA 4ZNXA 5KYXB 5HK3A 1NYGA 1M90C 5GAMg 5LJ5g 3SWNC 4CI0C 4N4HA 2O4XA 4OB1B 2F2WA 2YRVA 3G71Q 2CZ1B 1WFWA 3S3NA 5GAOm 4J5YA 4QVDA 3CEYA 3BY7A 4JRKA 3C4SA 2IPOB 1Q82R 1NJIU 2H3JA 3VYGA 5CR2A 4FYXB 1NEGA 1SF9A 1XQHA 4QQGA 3FEOA 2J6FA 1GCQA 1TUGB 3L2VA 3A1PA 2DO3A 1WX6A 1UGPB 1Y07A 3EGXB 1D3BA 2DZCA 1OZ3A 4E7ZA 4BDZA 3OYDA 4ORZA 4OMOA 1TUDA 2MF2A 4AFZC 2E6NA 2P0QA 5HK0A 3Q1JA 4Y91A 3KFVA 5GAN3 1K73U 1PM3A 3MEVA 4ANJA 1Z9ZA 2KQWA 3ZFJA 2LCLA 2RF0A 4J6XA 1VQNQ 3X26B 1GCQC 1Y96B 4E7LA 3FDRA 5LJ5f 2RQWA 4LDUA 4J9CA 2NUTA 4IUUA 2NUPA 1YITA 3R6NA 2Y4YA 2JMAA 3PT9A 3CMET 2A0FB 4MMLA 4XTWA 3H0HA 4EMGA 1V1CA 5GAN5 2LZ6B 1BCOA 4XU2A 3CC2Q 1I4K1 1WXTA 3FJPA 4ELZC 1BKBA 2VWFA 3EGUA 1KHIA 5HY6A 1E6GA 1X27A 2Y4XA 1NJIC 1YJ9A 4MMKA 2DIGA 1SSHA 2AT1B 2KT1A 5FU7B 4PJOG 2K79A 1SRLA 2CP5A 4Q5WA 2D9TA 4JZ4A 3RUXA 2KDSA 2O88A 2X3XD 3JCMV 2QDYB 2BE9B 1PKSA 5AYFA 1KQ2A 3UF4A 1Y57A 2YSQA 1XNIA 3MHXA 1QVFA 2KE9A 3CPFA 2WSEE 1N27A 2QG9B 5DY9A 4MZTA 1JQQA 4IURA 1G83A 3QYGB 4LXCA 1KSWA 2LQNA 3CCRT 3M54A 3CCJQ 5GAMd 2IIMA 5LJ5d 4A4KA 1M90R 3H41A 1RAIB 3MJXA 3HPWA 4RCCA 2LVMA 3OYKA 2BZYA 1AD5A 2CZ7B 1ARKA 2ZCFB 5C6SA 4EMKA 1WPYA 1D0XA 1PD1A 4DQ2A 2X9HA 4N0AA 1Q7YR 2DVEA 1ABOA 2RA2A 2QEXT 3CPWA 2OTJQ 1ZSZB 1NYFA 1K76A 1MUZA 5GMKm 2RJEA 3I5RA 1G3TA 1N9SA 1AWJA 4OGCA 1VQOT 2M02A 3V8LA 2E41A 5EC7A 1BU1A 3REAB 4EMKC 4N0AC 4E2FB 4PLIA 1YI2Q 4RTXA 3JCMf 4X9CA 2GF7A 1I5OB 4CC2A 2RQTA 1I8FA 1Y71A 2DM1A 1IB8A 2B86A 2M1HA 3JCMX 3JSCA 2QA4T 2VXFA 4IUQA 3M58A 1Q86C 1N8RC 5FU6B 2J6KA 2A37A 2LX7A 2ZPBB 5I11A 3RNJA 2GCXA 1VQ9Q 2MYSA 2XHCA 4PJOA 3MP1A 5CAIA 2RNAA 4PJOE 2GBQA 2ABLA 3UATA 2MMPA 3HTRA 1FXXA 2LT4A 1GCPA 4XTXA 1PD0A 3LWIA 1EX4A 3CCEQ 2JS0A 5CCAA 5M9OA 4LD9K 1OI1A 2LX9A 2MK5A 4C8QD 1NJIR 1QQJA 1AVZC 1VQNA 1XTDA 4DA4A 4A4HA 4BI3A 4M7DF 4PJOC 3OBYA 2LNHB 2G3RA 1MNEA 4F7UG 1R8OB 3H0IA 3CC2A 3D7SB 2J05A 2ZPIB 2CSIA 3AT1B 4HXJA 5IXBA 5FROA 2XI9A 3M0TA 2BE7D 5D6WA 2JTFA 2ED0A 1WXBA 4C8QG 3GNFB 3J80E 2EJ9A 1WHGA 1M2VB 1YP5A 1YJWT 1NEBA 5A2QE 3CCVT 2RN8A 2GQVA 2EYXA 5CQYA 1HYOA 1QCFA 2DTHA 4DBHA 2K9GA 5DLOA 4J7IA 1O9SA 5CKBA 5KYUA 2E65A 2KR3A 4M78B 2HD0A 4QQ6A 2JXBA 3CCJA 3C95A 1SPKA 3CC7Q 1QWFA 2RJFA 2RJCA 3CCLQ 1S1NA 1U1SA 3UT1A 2LJ3A 1SHFA 3GNGA 4C0FA 5GJVB 1Z9QA 1FWZA 2PNIA 2KRMA 2DYBA 1P92A 1UECA 5I21A 1UTIA 4M75D 3EGDA 3NTHA 3ZEHA 1VQ5Q 4BY6C 4CC3A 5CKHA 3A8OB 1Q86R 1OYXA 1N8RR 2K3XA 1AZEA 2E6ZA 3CCQT 1IREB 1LJOA 2P0PA 1N9RA 1EZZB 2IG0A 3KBGA 4J9GA 3CXCA 4M7DC 5DM7R 4M7AD 2A08A 1S72T 5LJ3h 2QQRA 2DVJA 4WTOB 1MMNA 4D8KA 1YI2A 3TSWA 2YUQA 2EFIA 2DBMA 3EG0A 2OJ2A 4CC7A 2AKLA 3H8ZA 4RTZA 5KYWA 1UDLA 3C94A 4RTTA 1NPRA 1XJWB 3CC4T 2F2VA 2HBPA 2EYQA 3VKIA 5KYXA 3LGLA 3L2UA 1VQ9A 2A36A 2I2LA 4A4EA 1I0CA 1MMGA 2EAYA 3X25B 4AG2C 2JTEA 1VQMQ 3C0CA 4HKEA 3CCEA 1D0YA 3NTIA 4JS5A 2MWOA 2QAZA 4BE1A 2DRMA 2KNBB 4JS4A 3DLMA 2A7YA 1E6HA 4M77F 2HNIA 5FRMA 4FYWB 2DTIA 2BIVA 2KMTA 2D0NA 4B6MA 3QZ5B 2E70A 1X2KA 3PIPA 2FZKB 1LCKA 1M5Q1 2LTOA 2KXCA 5D6YA 4K11A 4ZGEB 1ZSGA 2B8AA 1I5LA 2AHJB 4JPBW 2X35A 3EGXA 1JO8A 2QTXA 4ATOA 2RK1A 1YN8A 1BIAA 5FLXE 4MZMA 1GBRA 1R77A 1OZ2A 2YLBA 1SSFA 4E6RA 1RAHB 4KULA 1UGQB 2BKDN 2HSPA 4HT9A 2F1LA 2DL3A 4J6YA 5GAN8 1DJ7B 4JUVA 5LJ3e 2YUOA 1NPPA 3IQLA 1TSFA 1UGRB 1LOJA 2JNGA 2RJDA 1Y96A 4Y28E 4BD3A 2E1HA 2EW3A 4DOVA 4WF2A 3ER0A 2CSQA 2I0NA 1MMAA
chains in the Genus database with same CATH topology
4J5YA 1VQ5T 4QVDA 3CEYA 5GAOn 2FL7A 3BY7A 3CCMA 4M7DD 4JRKA 3C4SA 3VUZA 4N4IA 5DLQE 1NJIU 2H3JA 4MDXA 3QPHA 2V8KA 3VYGA 5GMKh 5CR2A 2V8IA 3V8JA 4XAXB 3M55A 2FVUA 4NS5A 4KUDK 3CC7A 2BUDA 1XQHA 2KAFA 4QQGA 3FEOA 1KC8U 3CCLA 1YITT 2X4XA 3SWNB 2F69A 5GANf 4LDYA 3L2VA 1NZ9A 1QVPA 2DO3A 1UGPB 1Y07A 2LDMA 1BYMA 2X4WA 3QHSA 4IUTA 3OYEA 1D3BA 2CZ0B 1OZ3A 2DZCA 3LGFA 4M77A 3OYDA 4LDVA 2RO0A 4BDZA 3NTKA 2E5QA 3G71A 4M77E 1B34B 3MCAB 4XTZA 2IVWA 3QZ9B 3JB9G 1UB4A 2MF2A 3OSSC 2P4TA 2EQUA 3PFSA 5I2SA 2DKGA 2E6NA 3QKJA 3OYBA 2RB6A 2P0QA 3N5BB 3E9FA 3Q1JA 4C5HA 2JVVA 5HK0A 4Y91A 5GAN3 3S3OA 5GMKl 1K73U 1KD1C 3E1SA 4BACA 4ZGJB 4F7UA 1Q81U 3CPWS 1WJSA 2ZZDA 4JJNK 3MEVA 4F7UE 1YJ9T 1VQ5A 4II1A 3UPUA 5FRNA 2KQWA 4HCZA 3ZFJA 3SDZA 4C5EA 2P0KA 2QQSA 3HL8A 2LCLA 4J6XA 4L6V5 1M4ZA 4M75G 4JDSA 5D6XA 5FU7C 3X26B 1YJNT 1M1FA 3EAEA 4M7DG 2DJZA 1Y96B 4E7KA 4E7LA 1JJ2S 3FDRA 5LJ5f 4E7IA 4E47A 4LDUA 1VQOA 4IUUA 2O4XB 1YITA 2FYKA 4M77C 4QVCA 2Y4YA 3CMET 3PT9A 3HFNA 4EMKB 2JZ2A 4MMLA 4C5GA 3FLGA 4XTWA 4EMGA 2ZPEB 5HKCA 5GAN5 3JRZA 4XU2A 3OSVA 2MAMA 1VQMT 1I4K1 1UGSB 1ZHIA 1G3WA 3FJPA 3OQ5A 4M78D 4ELZC 3PIOA 4MDWA 2KSSA 1BKBA 4C8QA 3KXTA 1K9MC 4C8QE 3HKSA 3HSBA 1U1TA 1KHIA 3SD4A 1BI3A 5HY6A 1YBYA 1LNXA 1YIJT 4M7AG 2Y4XA 4XTVA 1NJIC 2PUKB 1YJ9A 4MMKA 2DIGA 5CQXA 5FU7B 2RM4A 4PJOG 3TU4K 4Q5WA 2D9TA 4NL3A 3RUXA 3A8LB 2KDSA 3GP8A 4QVZA 1KC8C 1D3BB 4C92F 1YJNA 3LYIA 3TCJA 3JCMV 2QDYB 4C92B 3FRNA 5GAOp 1BIBA 2M9UA 2XD0A 3MO8A 5AYFA 1VQ6T 1KQ2A 3CMEA 4ME7A 4C0DC 2R58A 3M4GA 4F7UF 2VV5A 5J26A 1XNIA 2DD5A 4C8QC 5GANj 2VXEA 3HFOA 3MHXA 1QVFA 4C0GA 4CRIA 3ME9A 4F7UB 5KCOA 3CPFA 3JCMd 1VQMA 3LX7A 3MEUA 3QJYA 3V8KA 2RHXA 2WSEE 1N27A 1NE8A 3G7ZA 1MHNA 5DY9A 3QDRB 4O6JA 4MZTA 5IN1A 4IKFA 4ZTJA 3OW2S 3PMTA 1B34A 2WSCE 4M78G 3GOXA 3URGA 1YIJA 5LJ3g 4IURA 3QYGB 1HK9A 3WXMB 4BUGA 4BI4A 5KE3A 3M54A 2WACA 3CCRT 3AHUA 4L5GA 1WJRA 3QYHB 4X34A 5GAMd 3DB4A 5LJ5d 3META 4A4KA 4JRQA 2PQWA 2DAQA 4OF1A 2DZ9A 4C0DB 4C8QF 3OS0A 2RHUA 3BW1A 5GAOr 2D0QB 4C8QB 5GANe 2HQEA 1VQ6A 3HPWA 1V29B 5LJ5j 2CKKA 4D6WA 2L8DA 2MI6A 4RCCA 2LVMA 3OYKA 3G71T 4ZGDB 1QVFS 1WJQA 3T9NA 3BFMA 2CZ7B 3DB3A 2ZCFB 1JJ2A 2KY9A 4EMKA 4J6WA 1WPYA 5C6SA 1G3SA 2PVDB 2EWNA 3KUFA 4DQ2A 4JLGA 4QQDA 4N0AA 3VYHB 2DVEA 2RA2A 4XTYA 2QEXT 3CCUT 3CPWA 2K5FA 3P8HA 1RL2A 3JB9H 5A0GA 2KVQG 3RMQA 1N6AA 2RHIA 4PLLA 5GMKm 1H641 2RJEA 3CCRA 3TREA 3LW5E 3OMCA 1G3TA 1N9SA 4OP0A 3QO3A 4XU0A 3GPLA 4OGCA 1VQOT 3E9GA 3FB9A 1WQWA 4M75A 1YJWA 1MGQA 4XK8E 4PL6A 4EMHA 3QUIA 4M75E 3V8LA 1BI2A 4B9WA 3RKYA 2E41A 4OB3B 1VQ8T 4M7DA 4M7DE 1FX7A 4EMKC 1BI0A 4HA8A 4C92A 2XDDA 3OA6A 4N0AC 3R6OA 4PLIA 4C92E 5KCHA 2QQBA 4BDYA 4BI8B 4M77D 3OYNA 3X28B 3JCMf 4X9CA 2GF7A 4J7FA 2NLUA 3F70A 2OTJA 1I8FA 1Y71A 2FB7A 2M1HA 4FT2A 3S3MA 3JCMX 2QQAA 3WVEB 2QEXA 3CCUA 4E7JA 1VQNT 5GAN7 5GANh 3JSCA 2QA4T 2VXFA 1H3ZA 1EIFA 2DD4A 4IUQA 3M58A 3LWHA 1Q86C 2LQKA 3J7AF 2CGHA 1N8RC 4RG8A 3L1AA 5FU6B 2XKOC 2ZGWA 1VIFA 3BDLA 4M75C 4OB0B 4ZN1A 4C5IA 4M7AA 2KK4A 4M7AE 5GAMf 2ZPBB 3NFCA 2OTLT 2GCXA 3V7RA 1VQLT 2HAXA 2XHCA 4PJOA 3MP1A 3TEEA 5CAIA 5GMKi 3JCMh 1BI1A 3OY9A 3HRUA 4Z02A 4PJOE 3JCMQ 1Y7XA 4C92C 3CC2T 2MMPA 1K8AU 4E7HA 4ZTFA 1VQ8A 3CBOA 4RCBA 3I55T 5CKFA 1FXXA 2LT4A 3DKMA 3M57A 3OYYA 4XTXA 3RKWA 3JB9F 4C0ZA 3LWIA 1VUBA 2DXTA 2K3YA 4BY6B 1G5VA 3L2QA 1VQKT 1QP3A 4V2SA 3HP9A 5CCAA 5M9OA 3OYLA 4LD9K 2YLCA 1OI1A 2LX9A 3OW2A 5GAMh 2OAUA 3RMSA 2C06A 4C8QD 4HT8A 5LJ5h 1PSEA 3OBWA 3OYJA 4M77G 4M75F 4VUBA 1VQNA 4M7AC 3L2ZA 2QA4A 3OYMA 1XTDA 2LT1A 2JUFA 4A4HA 4M75B 3V7CA 3OYHA 2XICA 4BI3A 4DA4A 1M90U 4M7DF 1IZ6A 4PJOC 3JB9I 3OBYA 4OGEA 2QQ9A 4M7DB 1PSFA 4XQ3A 2G3RA 2PVGB 3OYCA 2OTLA 1VIEA 4F7UG 4FM4B 3CXCS 1VQLA 3CMAT 2RD1A 4EPCA 3UDCA 1R8OB 2LCCA 3J81E 2M16A 1VQ7T 2CYZB 2DXCA 3OMGA 3C12A 3CCLT 3CC2A 5C0MA 4MZPA 3I55A 1I81A 4KUIA 2L89A 2ZPIB 1Q7YU 2X4YA 2DPPB 3M9QA 2YHTA 1JB0E 1VQKA 3P8BB 5LJ3d 2R57A 2LRQA 1K73C 4M7AF 3QXEB 4R56A 3OYAA 3VUBA 1QVGS 4XU3A 4L59A 1Q81C 1Q82U 1ZQ1A 4M7AB 4J8OA 4LDXA 3QBYA 4PJOF 3CCJT 4YTLA 5FROA 2A3LA 2XI9A 3RESA 5D6WA 3X24B 5GAOq 4IUVA 1KQSS 2FHDA 2JN0A 2JTFA 4PJOB 3PNWC 2JOYA 5GANg 4A54A 2XIDA 4C8QG 3GNFB 3UWNA 4RG2A 4B9XA 3JCMP 3J80E 2EJ9A 1YJWT 3L2WA 3CMAA 4EDUA 1K8AC 3H6ZA 3M4YA 5KH6A 3MEAA 3V7SA 5GAMj 2DK3A 5A2QE 3CCVT 1VQ7A 3OB9A 2GQVA 5CQYA 4A4GA 3A8MB 2EQKA 2DTHA 3OYIA 3GIBA 3QSUA 2GFUA 3GF5A 4LDWA 2ZPHB 3ASKA 4J7IA 1O9SA 5CKBA 5DLOA 2EKOA 2OTJT 2F5KA 1KG1A 2E65A 4M78F 2V8JA 2DXBA 3JCMe 4M78B 3FC3A 2HD0A 4QQ6A 5CVIA 3A5ZB 5CKDA 3CCJA 3C95A 2RJFA 2RJCA 2XG8D 4IUPA 2MWPA 3M56A 5GAN6 1U1SA 3OS1A 3UT1A 3PTAA 5CKEA 1HXDA 3LLRA 4JRIA 1GXIE 3GNGA 3G6ET 4BE2A 1M8VA 5FU6C 4C0FA 3JCMb 1FWZA 1YCYA 2DEQA 2ZPGB 5GAMe 1P92A 3SFMA 3JAME 5LJ5e 3PMIA 2EJFA 4QW2A 4OB2B 5I21A 1K9MU 1WGSA 4M75D 4RMOA 1X75C 4FSXA 3CCVA 1YI2T 1Q7YC 3CD6T 3NTHA 4BB7A 2ZPFB 3OS5A 3JB9J 4HCBA 5I2MA 5KE2A 5J3BA 3ZEHA 2HQXA 2WSFE 4C92D 4BY6C 3E19A 2R5MA 5CKHA 1Q82C 2VYTA 5LJ3f 1X6OA 5J39A 3A8OB 4OVAA 1OYXA 5IT9E 1KHCA 2K3XA 1U8RA 3A8HB 2XU8A 2E6ZA 3VU3C 1XOVA 1VQ9T 1W2BS 4HCCA 4XU1A 3QJ6A 1M1KU 3CCQT 4LD6A 2K5IA 2M0OA 1IREB 1LJOA 2P0PA 1N9RA 2EJGA 3RKXA 2IG0A 1AHJB 2PUOB 3KBGA 3JCMc 5GAOl 5DM7R 3CXCA 3G6EA 4M7DC 4PKCC 4M7AD 1S72T 1VQ4T 2K2VA 5CIUA 5EG2A 5LJ3h 2QQRA 4PJOD 3OYFA 3SB2A 3CCET 4X9DA 2L3RA 4FL6A 3L2RA 2E64A 1YI2A 3CD6A 2EQMA 1VQPT 2EFIA 2PU9B 1JBMA 3JCMW 1WNLA 1QVGA 3O8VA 4XTUA 2EIFA 2LQ8A 3H8ZA 4ZN3A 1UEBA 2RI2A 4RKUE 1KQSA 3C94A 2CS7A 1NPRA 4C92G 5IAYA 3CC4T 3RERA 2HBPA 2EYQA 3VKIA 3OYGA 2F5TX 3LGLA 5A0DA 3L2UA 1VQ9A 4FU6A 4M78A 1ZBXA 2I2LA 4A4EA 3CCQA 4M78E 2XDPA 4GY5A 2EAYA 5A0LA 2R5AA 3X25B 2LC4A 5GMKj 1QP2A 3M53A 3HRSA 4KT0E 1S72A 1VQ4A 3WVDB 1WQ7A 2RK2A 4HKEA 3RIRA 2L5QA 3CCEA 1TH7A 2RH2A 3NTIA 4JS5A 3OS2A 2MWOA 4BE1A 1VQPA 2RI5A 3CCST 2QXFA 4JS4A 2XDBA 1X01A 3DLMA 2A7YA 4M77F 2HNIA 5FRMA 3FIFA 3EFRA 1QW1A 5GANd 4A53A 3CBPA 2GFAA 4M77B 1G3YA 2DTIA 2DTOA 2K5LA 3JCMJ 2BIVA 3P8DA 2KMTA 4M78C 3I56T 3EFSA 3QZ5B 3VJPA 5LJ3j 2E70A 2E12A 3QG1A 3HHTB 2E10A 2VUBA 1YHQT 3CC4A 1M1KC 4PNOA 2DIQA 3MP6A 4UC4A 4FT4A 3CBMA 3PIPA 1RI0A 2VGMA 3BDUA 1M5Q1 2LTOA 2QI2A 4JLIA 5GMKe 3SWNA 5D6YA 2K57A 3INZA 4ZGEB 1KQ1A 4R55A 2B8AA 3QIIA 3DLLA 1I5LA 3G4ST 2AHJB 3A8GB 2X35A 4O5VA 4A4FA 4TVRA 2QTXA 2JTMA 4ATOA 2RK1A 5L8RE 4JRPA 4NL2A 3JCMg 1BIAA 3VV0A 5FLXE 3CCMT 4MZMA 4BE0A 5GAN4 1KD1U 1OZ2A 5CK9A 1JRIA 2X4JA 2YLBA 1SSFA 1W4SA 4OMFB 3MP8A 4KULA 2Y90A 4NOYA 3S6WA 1UGQB 4FIBA 2BKDN 1Q86U 3CCSA 4DOWA 3ZBDA 2CZ6B 4HT9A 5LL6S 5CO7A 2VGNA 4P5NA 5HK3A 1N8RU 3CC7T 2RHYA 2PVOB 1DJ7B 2LNVA 3M5AA 4J6YA 5GAN8 2VC8A 3L42A 2O01E 4JUVA 2K4YA 2RHZA 3GLXA 5LJ3e 1NPPA 5GAN2 1M90C 5GAMg 1UGRB 3I56A 2D6FA 1LOJA 5LJ5g 3JB9D 1W2BA 3SWNC 4CI0C 2JNGA 2RJDA 1YHQA 2DXUA 1Y96A 4N4GA 4Y28E 4BD3A 2E1HA 1M9SA 3LH0A 4DOVA 4N4HA 4WF2A 3X20B 2O4XA 4OB1B 4ELYC 3ER0A 3HRTA 2YRVA 2XK0A 2EQJA 3G4SA 2CZ1B 3PGGA 2RI3A 1O75A 4J83A 4KBMB 1M1GA 3MEWA 3S3NA 3M59A 4GLKA 5GAOm
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CIU A;  5KE3 A;  2WAC A;  3CEY A;  3OYC A;  2QQR A;  1WJR A;  3C4S A;  4X34 A;  3OYF A;  4N4I A;  3DB4 A;  3MET A;  2L3R A;  4FL6 A;  2PQW A;  3L2R A;  2DAQ A;  2EQM A;  2LCC A;  2M16 A;  3OMG A;  3OS0 A;  2EFI A;  5C0M A;  2RHU A;  4NS5 A;  2BUD A;  2L89 A;  4QQG A;  3FEO A;  3O8V A;  2HQE A;  2X4Y A;  2X4X A;  2CKK A;  3M9Q A;  3L2V A;  3H8Z A;  2L8D A;  3OYK A;  2LVM A;  2R57 A;  2LRQ A;  2RI2 A;  1WJQ A;  2LDM A;  3OYA A;  2X4W A;  4IUT A;  3DB3 A;  3OYE A;  3LGF A;  1OZ3 A;  4L59 A;  5IAY A;  5C6S A;  4BDZ A;  3OYD A;  2RO0 A;  3NTK A;  2E5Q A;  3KUF A;  3QBY A;  3OYG A;  4QQD A;  3LGL A;  3L2U A;  5FRO A;  4FU6 A;  5D6W A;  4IUV A;  4A4E A;  2EQU A;  2FHD A;  2JTF A;  3PFS A;  2E6N A;  2XDP A;  3P8H A;  3PNW C;  3QKJ A;  4GY5 A;  3OYB A;  3E9F A;  3Q1J A;  4C5H A;  2R5A A;  3S3O A;  4B9X A;  3UWN A;  4RG2 A;  4BAC A;  2RHI A;  4PLL A;  1WJS A;  3MEV A;  2RJE A;  4II1 A;  5FRN A;  3L2W A;  3OMC A;  4HCZ A;  4C5E A;  2P0K A;  2QQS A;  4EDU A;  3H6Z A;  5KH6 A;  3NTI A;  3MEA A;  5D6X A;  3E9G A;  3OS2 A;  2MWO A;  4BE1 A;  3OB9 A;  3EAE A;  2RI5 A;  4PL6 A;  4A4G A;  4E7K A;  4B9W A;  4E7L A;  3FDR A;  2EQK A;  3OYI A;  4E7I A;  3DLM A;  2GFU A;  4IUU A;  2O4X B;  3ASK A;  5FRM A;  2EKO A;  2F5K A;  3OA6 A;  2JZ2 A;  2GFA A;  4C5G A;  4PLI A;  5KCH A;  4BDY A;  2BIV A;  3FLG A;  3P8D A;  3FC3 A;  3OYN A;  4QQ6 A;  2GF7 A;  2NLU A;  3F70 A;  2DIQ A;  3MP6 A;  4UC4 A;  3OQ5 A;  1RI0 A;  2M1H A;  3S3M A;  2LTO A;  2RJF A;  2RJC A;  4IUP A;  2MWP A;  3OS1 A;  4E7J A;  5D6Y A;  3UT1 A;  1H3Z A;  3LLR A;  2B8A A;  3QII A;  4IUQ A;  3SD4 A;  2X35 A;  4A4F A;  4BE2 A;  3BDL A;  2DIG A;  4C5I A;  4BE0 A;  3PMI A;  4QW2 A;  4Q5W A;  1OZ2 A;  2D9T A;  3MP1 A;  1SSF A;  1WGS A;  4QVZ A;  3MP8 A;  3OY9 A;  4Z02 A;  3LYI A;  3S6W A;  2BKD N;  3NTH A;  5KE2 A;  4E7H A;  4ZTF A;  3ZEH A;  2HQX A;  2RHY A;  3MO8 A;  2R5M A;  3L42 A;  1G5V A;  2RHZ A;  2K3Y A;  2R58 A;  2VYT A;  3L2Q A;  5J26 A;  1XNI A;  5J39 A;  4CRI A;  3ME9 A;  4OVA A;  5KCO A;  5M9O A;  3OYL A;  2RJD A;  1OYX A;  3LX7 A;  1OI1 A;  3MEU A;  1KHC A;  2RHX A;  4N4G A;  2K3X A;  1N27 A;  4BD3 A;  3LH0 A;  1MHN A;  4N4H A;  3OYJ A;  2O4X A;  5IN1 A;  4IKF A;  3QJ6 A;  4LD6 A;  4ZTJ A;  3OYM A;  2M0O A;  2XK0 A;  2YRV A;  2EQJ A;  4A4H A;  3PMT A;  3OYH A;  2RI3 A;  3GOX A;  2IG0 A;  4IUR A;  3MEW A;  3S3N A;  2G3R A; 
#chains in the Genus database with same CATH topology
 4HVW A;  3VS2 A;  2X51 A;  1FMK A;  2FL7 A;  5GAO n;  3VUZ A;  1SEM A;  5DLQ E;  3CCU Q;  3EG2 A;  3M55 A;  4KUD K;  3CC7 A;  2KAF A;  2V26 A;  1WI7 A;  3CCL A;  1YIT T;  2F69 A;  5GAN f;  1NZ9 A;  3MKD A;  2LDM A;  4IUT A;  4M77 A;  3NTK A;  1VQ8 Q;  4M77 E;  1B34 B;  5IXF A;  4XTZ A;  1UB4 A;  3OSS C;  4JZ3 A;  3QKJ A;  2RB6 A;  2COZ A;  1ZX6 A;  3E9F A;  4C5H A;  2JVV A;  3S3O A;  2QGF B;  3CPW S;  1WJS A;  1YJ9 T;  1VQ5 A;  4II1 A;  3UPU A;  1PKT A;  4RTY A;  1YWO A;  2Z0W A;  4JDS A;  5D6X A;  5FU7 C;  2DJZ A;  4E7K A;  2FRY A;  4E7I A;  4E47 A;  4M77 C;  3HFN A;  2JZ2 A;  1VQL Q;  4AG1 C;  3E2U A;  2ZPE B;  3JRZ A;  1UGS B;  1G3W A;  4M78 D;  2KSS A;  3KXT A;  3HSB A;  1VQK Q;  1WHK A;  1BI3 A;  1LNX A;  2VAS A;  2RM4 A;  2GNC A;  1HD3 A;  3A8L B;  4QVZ A;  1I07 A;  2EYW A;  4C92 F;  1ZSZ A;  1CKA A;  3TCJ A;  3REB B;  9ATC B;  1MV0 B;  5GAO p;  1QCN A;  1U06 A;  2R58 A;  3CMA Q;  3M4G A;  5J26 A;  2VXE A;  4F7U B;  4CRI A;  5KCO A;  1VQ7 Q;  1VQM A;  4DBF A;  3MEU A;  3QJY A;  1CSK A;  2KRO A;  5KYN A;  4HVV A;  4O6J A;  1OV3 A;  4ZTJ A;  1FYN A;  3PMT A;  1IXD A;  2WSC E;  4M78 G;  3URG A;  2CP0 A;  2DLP A;  1NM7 A;  2AZS A;  4LUE A;  1ZSZ C;  3QYH B;  1BK2 A;  4JRQ A;  2PQW A;  2YT6 A;  1UUE A;  4OF1 A;  4C0D B;  2RHU A;  5GAO r;  2D0Q B;  4PJL A;  4C8Q B;  1JXO A;  1V29 B;  4EIK A;  4D6W A;  1QVF P;  2L8D A;  3VS0 A;  3G71 T;  4RTW A;  4ZGD B;  2L3Q A;  1GFC A;  3DB3 A;  1U5S A;  4DBQ A;  1JJ2 A;  1G3S A;  2PVD B;  2EWN A;  3VYH B;  1GRI A;  2DE0 X;  1RL2 A;  1X6B A;  1D1A A;  1T3L A;  5A0G A;  2KVQ G;  1ZBJ A;  3RMQ A;  2DL4 A;  2CRE A;  2DER A;  2O31 A;  3OMC A;  4X1V A;  3QO3 A;  4XU0 A;  1JEG A;  2OI3 A;  1WQW A;  3EH1 A;  3G6E Q;  4B9W A;  1BI2 A;  1D1C A;  2H8H A;  1FX7 A;  1IGU A;  4C92 A;  2XDD A;  2KGT A;  1TUC A;  4C92 E;  3CD6 Q;  1RAB B;  1TS9 A;  4J7F A;  5KYY B;  4KGV B;  3CPW P;  2LJ1 A;  3S3M A;  1M3C A;  2QQA A;  3WVE B;  3CCU A;  1VQN T;  1WHJ A;  3LWH A;  3L1A A;  4PJJ A;  2XKO C;  3BDL A;  4OB0 B;  2KK4 A;  1OOT A;  5GAM f;  1K1Z A;  5I22 A;  2HAX A;  5GMK i;  3JCM h;  3I9Q A;  2K2M A;  4C92 C;  3CC2 T;  3GBQ A;  1VQ8 A;  3CBO A;  4RCB A;  3RKW A;  3M57 A;  1VQ4 Q;  4C0Z A;  1M2V A;  3L2Q A;  2DL5 A;  4V2S A;  3OYL A;  1AEY A;  1ACM B;  2OAU A;  2QDL A;  3OBW A;  3OYJ A;  2L2P A;  4M75 B;  4FW1 A;  2QQ9 A;  1G8X A;  2PVG B;  3OYC A;  3CXC S;  1VQL A;  1WHL A;  4LE9 A;  2M16 A;  2CYZ B;  2DXC A;  3OMG A;  4MZP A;  2P84 A;  1I81 A;  1B07 A;  1PNJ A;  3EG9 B;  1VQK A;  3P8B B;  2R57 A;  2A28 A;  2DRK A;  1TG0 A;  3OYA A;  1K73 C;  3VUB A;  2DFU A;  4M7A B;  2DNU A;  1AOJ A;  4J8O A;  2EYY A;  4PJO F;  3CCJ T;  3X24 B;  2YUP A;  2HCK A;  2XID A;  4B9X A;  3UWN A;  4RG2 A;  3I56 Q;  4RTV A;  1YHQ Q;  3CMA A;  4EDU A;  3H6Z A;  3M0S A;  1W70 A;  3V7S A;  3JV3 A;  2ED1 A;  1M3B A;  2DK3 A;  1VQ7 A;  2MPX C;  3GIB A;  3QSU A;  2GFU A;  4LDW A;  2YWW A;  2COY A;  3CCM Q;  2OTJ T;  2V8J A;  4KGZ B;  2DXB A;  3JCM e;  3G1J A;  1T0H A;  3A5Z B;  5CKD A;  2MWP A;  1RI9 A;  2FZC B;  1HXD A;  4BE2 A;  2DEQ A;  3EHR A;  2SRC A;  3SFM A;  4QW2 A;  4HCK A;  1K9M U;  4FSX A;  1YI2 T;  4FW2 A;  3EFO B;  5I2M A;  2KXD A;  1BB9 A;  2HQX A;  2WSF E;  1IRX A;  1WA7 A;  1X6O A;  5J39 A;  4OVA A;  1R0B G;  1H3H A;  1UFF A;  4J9D A;  5IT9 E;  1KHC A;  1U8R A;  1LVK A;  1VQ9 T;  2XU8 A;  1NBE B;  2KBT A;  1VQO Q;  1WZO A;  2K5I A;  2M0O A;  3RKX A;  3G6E A;  5GAO l;  1X43 A;  1UG1 A;  4CC4 B;  3OYF A;  3SB2 A;  3CCE T;  4X9D A;  1HSQ A;  3UA7 A;  3CD6 A;  2EQM A;  2HBW A;  4PJN A;  1H8K A;  2PU9 B;  1JBM A;  1WNL A;  5IHI A;  2LQ8 A;  4RKU E;  1KQS A;  1YJN Q;  5IAY A;  3O5Z A;  3RER A;  2V1Q A;  4Y92 A;  1X6G A;  1J3T A;  4GY5 A;  3CXC P;  5A0L A;  3HRS A;  4KT0 E;  4J9I A;  2E4H A;  2JMC A;  3WVD B;  1VQ4 A;  3RIR A;  2L5Q A;  1TH7 A;  1K73 R;  3VS6 A;  2RI5 A;  1BCM A;  1YIJ Q;  2LCS A;  3EFR A;  2FG0 A;  4J9H A;  2GFA A;  2EPD A;  2HKQ B;  2DTO A;  2EQI A;  3EFS A;  3VJP A;  5LJ3 j;  3MP6 A;  1RI0 A;  1MND A;  4JLI A;  5GMK e;  1VQ6 Q;  1ABQ A;  2K57 A;  3ULR B;  3QII A;  3A8G B;  4O5V A;  4JRP A;  4NL2 A;  3VV0 A;  2VVK A;  1W4S A;  3MP8 A;  6AT1 B;  3S6W A;  2J06 A;  4DOW A;  3ZBD A;  2CZ6 B;  5CO7 A;  3CC7 T;  1VYV A;  2PVO B;  2LNV A;  2SEM A;  5GAN 7;  3CCL T;  2VC8 A;  1K0S A;  1QWE A;  3GLX A;  2EVR A;  4AMC A;  5GAN 2;  2D6F A;  3I56 A;  1W2B A;  3JB9 D;  2L3S A;  2VB6 A;  1YJW Q;  1YHQ A;  2M51 A;  4N4G A;  3LH0 A;  3X20 B;  4ELY C;  4J9F A;  2XK0 A;  2EQJ A;  3PGG A;  2RQV A;  1TU0 B;  1YFN A;  3MEW A;  4GLK A;  1VQ5 T;  3CCM A;  1CKB A;  4N4I A;  2YXY A;  4MDX A;  2JS2 A;  2V8K A;  3V8J A;  4JJB A;  1C1A A;  1YCS B;  4NS5 A;  2BUD A;  1KC8 U;  4LDY A;  2HMA A;  1QVP A;  1BYM A;  1LPL A;  2X4W A;  3QHS A;  3OYE A;  2EKH A;  2RO0 A;  2E5Q A;  3QZ9 B;  4Z89 A;  3JB9 G;  1AWO A;  2P4T A;  2EQU A;  1JJ2 S;  3OYB A;  1G2B A;  3N5B B;  1SRM A;  5GMK l;  4ZGJ B;  2OX7 A;  4F7U A;  1Q81 U;  2ZZD A;  4F7U E;  1M8M A;  2J7I A;  3SDZ A;  4C5E A;  2QQS A;  3HL8 A;  4L6V 5;  1M4Z A;  1PC0 A;  4M75 G;  1M1F A;  3TQ7 P;  1VQO A;  2FYK A;  2OTL Q;  4EMK B;  3FLG A;  5HKC A;  1W1F A;  2MAM A;  1VQM T;  3OQ5 A;  3I55 Q;  4MDW A;  4C8Q A;  1R0C B;  2W10 A;  2HDA A;  4C8Q E;  3HKS A;  3SD4 A;  1YBY A;  2RQU A;  4M7A G;  4AT1 B;  2KI7 A;  5CQX A;  4A63 B;  5AT1 B;  4NL3 A;  1M2O A;  1KC8 C;  1YJN A;  3LYI A;  2CUD A;  2MOX A;  1A0N B;  4LUD A;  4C0D C;  1UJY A;  1IHV A;  4C8Q C;  3ME9 A;  1B7T A;  3G7Z A;  1NE8 A;  4FYY B;  1MHN A;  3QDR B;  5IN1 A;  2F2X A;  1AZG B;  5LJ3 g;  1YIJ A;  4IIM A;  1HK9 A;  3PE0 A;  1UHC A;  3AHU A;  5KYY A;  2WAC A;  1FMV A;  1WJR A;  3MET A;  3M0R A;  1SKU B;  2DAQ A;  3OS0 A;  2W0Z A;  3BW1 A;  5GAN e;  1VQ6 A;  5LJ5 j;  2MI6 A;  2BTT A;  4PFZ A;  1QVF S;  1WJQ A;  2KY9 A;  4J6W A;  3EHQ A;  4JLG A;  4JJC A;  4QQD A;  1SG5 A;  1OU8 A;  3CCU T;  2K5F A;  3P8H A;  1N6A A;  4PLL A;  1F1B B;  3LW5 E;  5ECA A;  1PRM C;  4OMQ A;  2VKN A;  4OP0 A;  1UJ0 A;  3E9G A;  1KFZ A;  4M75 A;  1X2Q A;  1YJW A;  2DL8 A;  4PL6 A;  3QUI A;  4M75 E;  1VQ8 T;  3RKY A;  1ZUY A;  3OA6 A;  3R6O A;  4BDY A;  1JJ2 P;  1WLP B;  4BI8 B;  3X28 B;  2NLU A;  3F70 A;  2FB7 A;  5FWC A;  1ZLM A;  4E7J A;  1H3Z A;  1EIF A;  2DD4 A;  4OMN A;  3J7A F;  1QMC A;  1EFN A;  2LJ0 A;  4M7A A;  2ZGW A;  3NPF A;  4M75 C;  1PG5 B;  4M7A E;  3V7R A;  1AT1 B;  1VQL T;  1BI1 A;  3HRU A;  3JCM Q;  1GL5 A;  1K8A U;  4ZTF A;  5CKF A;  1UGV A;  1VUB A;  4BY6 B;  1VQK T;  3NMZ C;  3HP9 A;  1VQP Q;  2YLC A;  3OW2 A;  4HT8 A;  5GAM h;  2FZG B;  5LJ5 h;  1PCX A;  4VUB A;  4M7A C;  3L2Z A;  1WIE A;  3OYM A;  2JUF A;  1M90 U;  1KC8 R;  2CDT A;  1FMW A;  3JB9 I;  4M7D B;  1PSF A;  4XQ3 A;  2G6F X;  2OTL A;  1VIE A;  4KGX B;  4FM4 B;  2DF6 A;  3CMA T;  4EPC A;  3UDC A;  3J81 E;  2LCC A;  1BBZ A;  1VQ7 T;  2NUZ A;  3C12 A;  4KH0 B;  2HL5 C;  4HVU A;  3I55 A;  2HL3 A;  1Q7Y U;  2L3P A;  2DPP B;  2HQH A;  4FSS A;  2YHT A;  2E3H A;  5FW9 A;  5LJ3 d;  2LRQ A;  3QXE B;  3NGP A;  1UHF A;  4R56 A;  4L59 A;  3EFO A;  1IHW A;  3VS4 A;  3CCS Q;  2FPF A;  3QBY A;  1M3A A;  1Y0M A;  1KQS S;  5GAO q;  2ENM A;  2YRD A;  3PNW C;  5HCK A;  1TOV A;  2GQI A;  3JCM P;  1M27 C;  1HJD A;  7AT1 B;  2HEQ A;  1MMD A;  1K8A C;  4PFO A;  3M4Y A;  4LN2 A;  1KIK A;  3G4S Q;  3OB9 A;  4PFP A;  4A4G A;  3OYI A;  1IO6 A;  1OUL A;  3ASK A;  4Z88 A;  2EKO A;  2F5K A;  4M78 F;  2HSE B;  4DEX A;  3VRY A;  1D1B A;  4IUP A;  3OS1 A;  5GAN 6;  3PTA A;  3TSZ A;  2DJQ A;  1OEB A;  4JRI A;  4F14 A;  3G6E T;  5FU6 C;  4F04 B;  1NLP C;  5GAM e;  5LJ5 e;  3PMI A;  4AFS C;  1QKX A;  1WGS A;  2JW4 A;  1X75 C;  2KEA A;  1Q7Y C;  3CD6 T;  4BB7 A;  2ZPF B;  3OS5 A;  5KE2 A;  4JJD A;  1B3Q A;  2KT8 A;  3PVL A;  2CP7 A;  1OPL A;  3VU3 C;  1W2B S;  4HCC A;  4XU1 A;  3RBB B;  3QJ6 A;  1M1K U;  4LD6 A;  2EJG A;  1AHJ B;  3JCM c;  3LH5 A;  4PKC C;  2CUB A;  2FO0 A;  1VQ4 T;  4QT7 A;  4PJO D;  2PTK A;  2AKK A;  4FL6 A;  3L2R A;  2O9V A;  3JCM W;  2K7A A;  1QVG A;  3O8V A;  2FPD A;  4DEY A;  4XTU A;  2EIF A;  1UEB A;  2RI2 A;  2DYI A;  1YNZ A;  3OYG A;  2F5T X;  4M78 A;  1RAE B;  2NWM A;  4M78 E;  3CME Q;  3PVQ A;  5GMK j;  1QP2 A;  3M53 A;  4OMP A;  1WQ7 A;  4Z8A A;  3M0Q A;  2RH2 A;  1OPK A;  1VQP A;  1X01 A;  2DBK A;  3H0F A;  2XMF A;  3FIF A;  1QW1 A;  4M77 B;  1KQS P;  1G3Y A;  3JCM J;  3P8D A;  4M78 C;  3I56 T;  3QG1 A;  2E12 A;  2E10 A;  2VUB A;  1YHQ T;  1M1K C;  2DIQ A;  4J9B A;  2VGM A;  2QYZ A;  4ESR A;  1K8A R;  1AWX A;  1OU9 A;  1VYU A;  3EG3 A;  1C6V X;  2AK5 A;  2QK0 A;  1VYT A;  1QLY A;  3JCM g;  3CCM T;  1KD1 U;  5CK9 A;  3I35 A;  1JRI A;  2K6D A;  1H92 A;  2Y90 A;  4NOY A;  4FIB A;  1Q86 U;  3CCS A;  5LL6 S;  1N8R U;  2VGN A;  4P5N A;  2RHY A;  3M5A A;  3CCR Q;  1QKW A;  3L42 A;  2O01 E;  2K4Y A;  2RHZ A;  3RR6 A;  2JJ9 A;  2ROL A;  2DXU A;  1M9S A;  2YUN A;  4QKU A;  3RDV A;  2BZ8 A;  3HRT A;  3G4S A;  2RI3 A;  1O75 A;  4J83 A;  4KBM B;  2AIR B;  1M1G A;  3M59 A;  2X3W D;  2FEI A;  4M7D D;  2QEX Q;  4RUG A;  3VS3 A;  3QPH A;  5GMK h;  1YWP A;  2V8I A;  4XAX B;  5IHN A;  2FVU A;  2X4X A;  3SWN B;  2DMO A;  1RAF B;  2J6O A;  1W2B P;  2CT3 A;  3NHN A;  2CZ0 B;  3LGF A;  1OX8 A;  4LDV A;  2EGA A;  3G71 A;  3MCA B;  2IVW A;  5I2S A;  3PFS A;  2DKG A;  2YDL A;  2P4R A;  1KD1 C;  2EGE A;  3E1S A;  4BAC A;  4JJN K;  5FRN A;  4HCZ A;  3VS5 A;  2P0K A;  2QA4 Q;  1YJN T;  3EAE A;  4M7D G;  2CT4 A;  3QWY A;  2O4X B;  4QVC A;  2DL7 A;  1OX9 A;  8AT1 B;  1PWT A;  4C5G A;  1VOM A;  3OSV A;  1ZHI A;  3PIO A;  1M30 A;  1K9M C;  2ESW A;  1U1T A;  1YIJ T;  4XTV A;  5D7U A;  2LQW A;  2PUK B;  4PK4 A;  1JXM A;  1TWB A;  3TU4 K;  1ZA2 B;  1K0X A;  3GP8 A;  1D3B B;  1RLQ C;  4C92 B;  3FRN A;  1WHM A;  1M1K R;  1BIB A;  2EGC A;  5IHK A;  1RUW A;  2EYZ A;  2M9U A;  3MO8 A;  2XD0 A;  1VQ6 T;  3CME A;  4ME7 A;  4F7U F;  2DA9 A;  2VV5 A;  5GAN j;  2DD5 A;  3HFO A;  4C0G A;  1QCO A;  3JCM d;  1PRL C;  3LX7 A;  3V8K A;  2RHX A;  1D09 B;  4IKF A;  3OW2 S;  1MV3 A;  1B34 A;  1T0J A;  3GOX A;  2HZY A;  2FRW A;  3QWX X;  3WXM B;  2NUT B;  2NUP B;  4BUG A;  4BI4 A;  5KE3 A;  1GFD A;  2JM8 A;  4L5G A;  4X34 A;  3SHW A;  3DB4 A;  3BE3 A;  2DET A;  1RLP C;  3A98 A;  2DZ9 A;  4C8Q F;  2D1X A;  1AWW A;  1C0M A;  1UE9 A;  2HQE A;  2CKK A;  1WHH A;  4GLM A;  3T9N A;  3BFM A;  3CCV Q;  5FWB A;  3KUF A;  4F17 A;  2RMO A;  4XTY A;  3JB9 H;  1PHT A;  5L23 A;  2RHI A;  1D0Z A;  1H64 1;  3CQT A;  3CCR A;  3TRE A;  2LMJ A;  3GPL A;  2C0T A;  1K4U S;  2D8J A;  4R0K A;  3FB9 A;  2AZV A;  1MGQ A;  4XK8 E;  4EMH A;  2M0Y A;  1KK7 A;  4OB3 B;  4M7D A;  2DIL A;  3TVT A;  4FCY A;  2C0I A;  4M7D E;  1BI0 A;  4HA8 A;  4D8D A;  1IGQ A;  5KCH A;  2QQB A;  2YRC A;  3MPU B;  8ATC B;  4M77 D;  3OYN A;  3VS1 A;  1KD1 R;  3QDF A;  2OTJ A;  2E3I A;  2KRS A;  4FT2 A;  2KRN A;  2QEX A;  2CP6 A;  5GAN h;  2LQK A;  4AFU C;  2CGH A;  4RG8 A;  3VS7 A;  1VIF A;  2QAS A;  4ZN1 A;  4C5I A;  2H3E B;  2PZ1 A;  3NFC A;  2OTL T;  2JT4 A;  3TEE A;  3CCQ Q;  3OY9 A;  4Z02 A;  1Y7X A;  2OAW A;  4E7H A;  3I55 T;  3DKM A;  3OYY A;  1S72 Q;  2CP3 A;  3JB9 F;  1K9A A;  1GBQ A;  2DXT A;  2K3Y A;  1G5V A;  2EBP A;  1K9M R;  1NG2 A;  1QP3 A;  1SHG A;  1U3O A;  4GBQ A;  2C06 A;  3RMS A;  1PSE A;  1NLO C;  4M77 G;  4M75 F;  2ROT A;  2QA4 A;  2LT1 A;  3OYH A;  3V7C A;  2XIC A;  1IZ6 A;  4OGE A;  3CC4 Q;  1RAA B;  1T3S A;  1TTH B;  1JU5 C;  2CP2 A;  2RD1 A;  3I5S A;  2ZAE A;  5IH2 A;  5C0M A;  4KUI A;  1KJW A;  2L89 A;  4J9E A;  2C0O A;  3FJ5 A;  2X4Y A;  2KYM A;  2GTO A;  3M9Q A;  1JB0 E;  4M7A F;  3UA6 A;  3OW2 P;  1QVG S;  1RAG B;  4XU3 A;  1Q81 C;  1Q82 U;  1ZQ1 A;  4LDX A;  2E5K A;  4YTL A;  2A3L A;  3RES A;  2GTJ A;  4PJO B;  4IUV A;  2FHD A;  2JN0 A;  1RAD B;  2JOY A;  5GAN g;  4A54 A;  2V1R A;  4AFQ C;  3L2W A;  5KH6 A;  3MEA A;  5GAM j;  4KH1 B;  3VRZ A;  2COW A;  3A8M B;  2MIO A;  2D8H A;  1W6X A;  2EQK A;  3GF5 A;  1E7O A;  2JM9 A;  2ZPH B;  4E7S A;  2L0A A;  4F16 A;  1KG1 A;  1VA7 A;  1WYX A;  1ZUU A;  3FC3 A;  1WXU A;  2O9S A;  5CVI A;  2XG8 D;  3M56 A;  5CKE A;  3LLR A;  1N5Z A;  1GXI E;  1M8V A;  3JCM b;  1YCY A;  2ZPG B;  2NYS A;  3JAM E;  2EJF A;  4OB2 B;  4RMO A;  2ATC B;  2KYB A;  3CCV A;  2LP5 A;  3JB9 J;  4IIO A;  4HCB A;  2GGR A;  2K3B A;  2CH4 W;  5J3B A;  3THK A;  2ECZ A;  4OML A;  4C92 D;  3E19 A;  2R5M A;  1Q82 C;  3U23 A;  2VYT A;  5LJ3 f;  1ZUK A;  3EG1 A;  3EG9 A;  3A8H B;  1XOV A;  1YIT Q;  4PJM A;  2CH4 A;  1OQK A;  2QTV A;  2PUO B;  4FYV B;  2K2V A;  5CIU A;  2QGG A;  5EG2 A;  5KYU B;  1I1J A;  2L3R A;  2E64 A;  1Q95 G;  1VQP T;  1RAC B;  3M0U A;  3SEM A;  5GJW B;  1YJ9 Q;  2O2O A;  4ZN3 A;  1TXQ A;  2CS7 A;  4C92 G;  3M0P A;  2RPN A;  5A0D A;  4FU6 A;  1ZBX A;  4RTU A;  3CCQ A;  2XDP A;  3EGD B;  2R5A A;  2LC4 A;  1S72 A;  2RK2 A;  3EH2 A;  4DBR A;  2RQR A;  4LNP A;  1V76 A;  3OS2 A;  2FPE A;  2HKN A;  3CCS T;  2QXF A;  2MCN A;  1QVG P;  1Q81 R;  2XDB A;  1X69 A;  4M4Z A;  5GAN d;  4A53 A;  3CBP A;  2K5L A;  4OMM A;  3HHT B;  3CC4 A;  4PNO A;  4UC4 A;  4FT4 A;  3CBM A;  3BDU A;  2DEU A;  2QI2 A;  3SWN A;  2DX1 A;  2BZX A;  3INZ A;  1KQ1 A;  4R55 A;  3DLL A;  3G4S T;  1ZA1 B;  4A4F A;  4TVR A;  2JTM A;  3ZL7 C;  3H9N A;  5L8R E;  4BE0 A;  5GAN 4;  5KYW B;  2X4J A;  4OMF B;  4WCI A;  1WDX A;  4KRT A;  4ZNX A;  5KYX B;  5HK3 A;  1NYG A;  1M90 C;  5GAM g;  5LJ5 g;  3SWN C;  4CI0 C;  4N4H A;  2O4X A;  4OB1 B;  2F2W A;  2YRV A;  3G71 Q;  2CZ1 B;  1WFW A;  3S3N A;  5GAO m;  4J5Y A;  4QVD A;  3CEY A;  3BY7 A;  4JRK A;  3C4S A;  2IPO B;  1Q82 R;  1NJI U;  2H3J A;  3VYG A;  5CR2 A;  4FYX B;  1NEG A;  1SF9 A;  1XQH A;  4QQG A;  3FEO A;  2J6F A;  1GCQ A;  1TUG B;  3L2V A;  3A1P A;  2DO3 A;  1WX6 A;  1UGP B;  1Y07 A;  3EGX B;  1D3B A;  2DZC A;  1OZ3 A;  4E7Z A;  4BDZ A;  3OYD A;  4ORZ A;  4OMO A;  1TUD A;  2MF2 A;  4AFZ C;  2E6N A;  2P0Q A;  5HK0 A;  3Q1J A;  4Y91 A;  3KFV A;  5GAN 3;  1K73 U;  1PM3 A;  3MEV A;  4ANJ A;  1Z9Z A;  2KQW A;  3ZFJ A;  2LCL A;  2RF0 A;  4J6X A;  1VQN Q;  3X26 B;  1GCQ C;  1Y96 B;  4E7L A;  3FDR A;  5LJ5 f;  2RQW A;  4LDU A;  4J9C A;  2NUT A;  4IUU A;  2NUP A;  1YIT A;  3R6N A;  2Y4Y A;  2JMA A;  3PT9 A;  3CME T;  2A0F B;  4MML A;  4XTW A;  3H0H A;  4EMG A;  1V1C A;  5GAN 5;  2LZ6 B;  1BCO A;  4XU2 A;  3CC2 Q;  1I4K 1;  1WXT A;  3FJP A;  4ELZ C;  1BKB A;  2VWF A;  3EGU A;  1KHI A;  5HY6 A;  1E6G A;  1X27 A;  2Y4X A;  1NJI C;  1YJ9 A;  4MMK A;  2DIG A;  1SSH A;  2AT1 B;  2KT1 A;  5FU7 B;  4PJO G;  2K79 A;  1SRL A;  2CP5 A;  4Q5W A;  2D9T A;  4JZ4 A;  3RUX A;  2KDS A;  2O88 A;  2X3X D;  3JCM V;  2QDY B;  2BE9 B;  1PKS A;  5AYF A;  1KQ2 A;  3UF4 A;  1Y57 A;  2YSQ A;  1XNI A;  3MHX A;  1QVF A;  2KE9 A;  3CPF A;  2WSE E;  1N27 A;  2QG9 B;  5DY9 A;  4MZT A;  1JQQ A;  4IUR A;  1G83 A;  3QYG B;  4LXC A;  1KSW A;  2LQN A;  3CCR T;  3M54 A;  3CCJ Q;  5GAM d;  2IIM A;  5LJ5 d;  4A4K A;  1M90 R;  3H41 A;  1RAI B;  3MJX A;  3HPW A;  4RCC A;  2LVM A;  3OYK A;  2BZY A;  1AD5 A;  2CZ7 B;  1ARK A;  2ZCF B;  5C6S A;  4EMK A;  1WPY A;  1D0X A;  1PD1 A;  4DQ2 A;  2X9H A;  4N0A A;  1Q7Y R;  2DVE A;  1ABO A;  2RA2 A;  2QEX T;  3CPW A;  2OTJ Q;  1ZSZ B;  1NYF A;  1K76 A;  1MUZ A;  5GMK m;  2RJE A;  3I5R A;  1G3T A;  1N9S A;  1AWJ A;  4OGC A;  1VQO T;  2M02 A;  3V8L A;  2E41 A;  5EC7 A;  1BU1 A;  3REA B;  4EMK C;  4N0A C;  4E2F B;  4PLI A;  1YI2 Q;  4RTX A;  3JCM f;  4X9C A;  2GF7 A;  1I5O B;  4CC2 A;  2RQT A;  1I8F A;  1Y71 A;  2DM1 A;  1IB8 A;  2B86 A;  2M1H A;  3JCM X;  3JSC A;  2QA4 T;  2VXF A;  4IUQ A;  3M58 A;  1Q86 C;  1N8R C;  5FU6 B;  2J6K A;  2A37 A;  2LX7 A;  2ZPB B;  5I11 A;  3RNJ A;  2GCX A;  1VQ9 Q;  2MYS A;  2XHC A;  4PJO A;  3MP1 A;  5CAI A;  2RNA A;  4PJO E;  2GBQ A;  2ABL A;  3UAT A;  2MMP A;  3HTR A;  1FXX A;  2LT4 A;  1GCP A;  4XTX A;  1PD0 A;  3LWI A;  1EX4 A;  3CCE Q;  2JS0 A;  5CCA A;  5M9O A;  4LD9 K;  1OI1 A;  2LX9 A;  2MK5 A;  4C8Q D;  1NJI R;  1QQJ A;  1AVZ C;  1VQN A;  1XTD A;  4DA4 A;  4A4H A;  4BI3 A;  4M7D F;  4PJO C;  3OBY A;  2LNH B;  2G3R A;  1MNE A;  4F7U G;  1R8O B;  3H0I A;  3CC2 A;  3D7S B;  2J05 A;  2ZPI B;  2CSI A;  3AT1 B;  4HXJ A;  5IXB A;  5FRO A;  2XI9 A;  3M0T A;  2BE7 D;  5D6W A;  2JTF A;  2ED0 A;  1WXB A;  4C8Q G;  3GNF B;  3J80 E;  2EJ9 A;  1WHG A;  1M2V B;  1YP5 A;  1YJW T;  1NEB A;  5A2Q E;  3CCV T;  2RN8 A;  2GQV A;  2EYX A;  5CQY A;  1HYO A;  1QCF A;  2DTH A;  4DBH A;  2K9G A;  5DLO A;  4J7I A;  1O9S A;  5CKB A;  5KYU A;  2E65 A;  2KR3 A;  4M78 B;  2HD0 A;  4QQ6 A;  2JXB A;  3CCJ A;  3C95 A;  1SPK A;  3CC7 Q;  1QWF A;  2RJF A;  2RJC A;  3CCL Q;  1S1N A;  1U1S A;  3UT1 A;  2LJ3 A;  1SHF A;  3GNG A;  4C0F A;  5GJV B;  1Z9Q A;  1FWZ A;  2PNI A;  2KRM A;  2DYB A;  1P92 A;  1UEC A;  5I21 A;  1UTI A;  4M75 D;  3EGD A;  3NTH A;  3ZEH A;  1VQ5 Q;  4BY6 C;  4CC3 A;  5CKH A;  3A8O B;  1Q86 R;  1OYX A;  1N8R R;  2K3X A;  1AZE A;  2E6Z A;  3CCQ T;  1IRE B;  1LJO A;  2P0P A;  1N9R A;  1EZZ B;  2IG0 A;  3KBG A;  4J9G A;  3CXC A;  4M7D C;  5DM7 R;  4M7A D;  2A08 A;  1S72 T;  5LJ3 h;  2QQR A;  2DVJ A;  4WTO B;  1MMN A;  4D8K A;  1YI2 A;  3TSW A;  2YUQ A;  2EFI A;  2DBM A;  3EG0 A;  2OJ2 A;  4CC7 A;  2AKL A;  3H8Z A;  4RTZ A;  5KYW A;  1UDL A;  3C94 A;  4RTT A;  1NPR A;  1XJW B;  3CC4 T;  2F2V A;  2HBP A;  2EYQ A;  3VKI A;  5KYX A;  3LGL A;  3L2U A;  1VQ9 A;  2A36 A;  2I2L A;  4A4E A;  1I0C A;  1MMG A;  2EAY A;  3X25 B;  4AG2 C;  2JTE A;  1VQM Q;  3C0C A;  4HKE A;  3CCE A;  1D0Y A;  3NTI A;  4JS5 A;  2MWO A;  2QAZ A;  4BE1 A;  2DRM A;  2KNB B;  4JS4 A;  3DLM A;  2A7Y A;  1E6H A;  4M77 F;  2HNI A;  5FRM A;  4FYW B;  2DTI A;  2BIV A;  2KMT A;  2D0N A;  4B6M A;  3QZ5 B;  2E70 A;  1X2K A;  3PIP A;  2FZK B;  1LCK A;  1M5Q 1;  2LTO A;  2KXC A;  5D6Y A;  4K11 A;  4ZGE B;  1ZSG A;  2B8A A;  1I5L A;  2AHJ B;  4JPB W;  2X35 A;  3EGX A;  1JO8 A;  2QTX A;  4ATO A;  2RK1 A;  1YN8 A;  1BIA A;  5FLX E;  4MZM A;  1GBR A;  1R77 A;  1OZ2 A;  2YLB A;  1SSF A;  4E6R A;  1RAH B;  4KUL A;  1UGQ B;  2BKD N;  2HSP A;  4HT9 A;  2F1L A;  2DL3 A;  4J6Y A;  5GAN 8;  1DJ7 B;  4JUV A;  5LJ3 e;  2YUO A;  1NPP A;  3IQL A;  1TSF A;  1UGR B;  1LOJ A;  2JNG A;  2RJD A;  1Y96 A;  4Y28 E;  4BD3 A;  2E1H A;  2EW3 A;  4DOV A;  4WF2 A;  3ER0 A;  2CSQ A;  2I0N A;  1MMA A; 
#chains in the Genus database with same CATH homology
 4J5Y A;  1VQ5 T;  4QVD A;  3CEY A;  5GAO n;  2FL7 A;  3BY7 A;  3CCM A;  4M7D D;  4JRK A;  3C4S A;  3VUZ A;  4N4I A;  5DLQ E;  1NJI U;  2H3J A;  4MDX A;  3QPH A;  2V8K A;  3VYG A;  5GMK h;  5CR2 A;  2V8I A;  3V8J A;  4XAX B;  3M55 A;  2FVU A;  4NS5 A;  4KUD K;  3CC7 A;  2BUD A;  1XQH A;  2KAF A;  4QQG A;  3FEO A;  1KC8 U;  3CCL A;  1YIT T;  2X4X A;  3SWN B;  2F69 A;  5GAN f;  4LDY A;  3L2V A;  1NZ9 A;  1QVP A;  2DO3 A;  1UGP B;  1Y07 A;  2LDM A;  1BYM A;  2X4W A;  3QHS A;  4IUT A;  3OYE A;  1D3B A;  2CZ0 B;  1OZ3 A;  2DZC A;  3LGF A;  4M77 A;  3OYD A;  4LDV A;  2RO0 A;  4BDZ A;  3NTK A;  2E5Q A;  3G71 A;  4M77 E;  1B34 B;  3MCA B;  4XTZ A;  2IVW A;  3QZ9 B;  3JB9 G;  1UB4 A;  2MF2 A;  3OSS C;  2P4T A;  2EQU A;  3PFS A;  5I2S A;  2DKG A;  2E6N A;  3QKJ A;  3OYB A;  2RB6 A;  2P0Q A;  3N5B B;  3E9F A;  3Q1J A;  4C5H A;  2JVV A;  5HK0 A;  4Y91 A;  5GAN 3;  3S3O A;  5GMK l;  1K73 U;  1KD1 C;  3E1S A;  4BAC A;  4ZGJ B;  4F7U A;  1Q81 U;  3CPW S;  1WJS A;  2ZZD A;  4JJN K;  3MEV A;  4F7U E;  1YJ9 T;  1VQ5 A;  4II1 A;  3UPU A;  5FRN A;  2KQW A;  4HCZ A;  3ZFJ A;  3SDZ A;  4C5E A;  2P0K A;  2QQS A;  3HL8 A;  2LCL A;  4J6X A;  4L6V 5;  1M4Z A;  4M75 G;  4JDS A;  5D6X A;  5FU7 C;  3X26 B;  1YJN T;  1M1F A;  3EAE A;  4M7D G;  2DJZ A;  1Y96 B;  4E7K A;  4E7L A;  1JJ2 S;  3FDR A;  5LJ5 f;  4E7I A;  4E47 A;  4LDU A;  1VQO A;  4IUU A;  2O4X B;  1YIT A;  2FYK A;  4M77 C;  4QVC A;  2Y4Y A;  3CME T;  3PT9 A;  3HFN A;  4EMK B;  2JZ2 A;  4MML A;  4C5G A;  3FLG A;  4XTW A;  4EMG A;  2ZPE B;  5HKC A;  5GAN 5;  3JRZ A;  4XU2 A;  3OSV A;  2MAM A;  1VQM T;  1I4K 1;  1UGS B;  1ZHI A;  1G3W A;  3FJP A;  3OQ5 A;  4M78 D;  4ELZ C;  3PIO A;  4MDW A;  2KSS A;  1BKB A;  4C8Q A;  3KXT A;  1K9M C;  4C8Q E;  3HKS A;  3HSB A;  1U1T A;  1KHI A;  3SD4 A;  1BI3 A;  5HY6 A;  1YBY A;  1LNX A;  1YIJ T;  4M7A G;  2Y4X A;  4XTV A;  1NJI C;  2PUK B;  1YJ9 A;  4MMK A;  2DIG A;  5CQX A;  5FU7 B;  2RM4 A;  4PJO G;  3TU4 K;  4Q5W A;  2D9T A;  4NL3 A;  3RUX A;  3A8L B;  2KDS A;  3GP8 A;  4QVZ A;  1KC8 C;  1D3B B;  4C92 F;  1YJN A;  3LYI A;  3TCJ A;  3JCM V;  2QDY B;  4C92 B;  3FRN A;  5GAO p;  1BIB A;  2M9U A;  2XD0 A;  3MO8 A;  5AYF A;  1VQ6 T;  1KQ2 A;  3CME A;  4ME7 A;  4C0D C;  2R58 A;  3M4G A;  4F7U F;  2VV5 A;  5J26 A;  1XNI A;  2DD5 A;  4C8Q C;  5GAN j;  2VXE A;  3HFO A;  3MHX A;  1QVF A;  4C0G A;  4CRI A;  3ME9 A;  4F7U B;  5KCO A;  3CPF A;  3JCM d;  1VQM A;  3LX7 A;  3MEU A;  3QJY A;  3V8K A;  2RHX A;  2WSE E;  1N27 A;  1NE8 A;  3G7Z A;  1MHN A;  5DY9 A;  3QDR B;  4O6J A;  4MZT A;  5IN1 A;  4IKF A;  4ZTJ A;  3OW2 S;  3PMT A;  1B34 A;  2WSC E;  4M78 G;  3GOX A;  3URG A;  1YIJ A;  5LJ3 g;  4IUR A;  3QYG B;  1HK9 A;  3WXM B;  4BUG A;  4BI4 A;  5KE3 A;  3M54 A;  2WAC A;  3CCR T;  3AHU A;  4L5G A;  1WJR A;  3QYH B;  4X34 A;  5GAM d;  3DB4 A;  5LJ5 d;  3MET A;  4A4K A;  4JRQ A;  2PQW A;  2DAQ A;  4OF1 A;  2DZ9 A;  4C0D B;  4C8Q F;  3OS0 A;  2RHU A;  3BW1 A;  5GAO r;  2D0Q B;  4C8Q B;  5GAN e;  2HQE A;  1VQ6 A;  3HPW A;  1V29 B;  5LJ5 j;  2CKK A;  4D6W A;  2L8D A;  2MI6 A;  4RCC A;  2LVM A;  3OYK A;  3G71 T;  4ZGD B;  1QVF S;  1WJQ A;  3T9N A;  3BFM A;  2CZ7 B;  3DB3 A;  2ZCF B;  1JJ2 A;  2KY9 A;  4EMK A;  4J6W A;  1WPY A;  5C6S A;  1G3S A;  2PVD B;  2EWN A;  3KUF A;  4DQ2 A;  4JLG A;  4QQD A;  4N0A A;  3VYH B;  2DVE A;  2RA2 A;  4XTY A;  2QEX T;  3CCU T;  3CPW A;  2K5F A;  3P8H A;  1RL2 A;  3JB9 H;  5A0G A;  2KVQ G;  3RMQ A;  1N6A A;  2RHI A;  4PLL A;  5GMK m;  1H64 1;  2RJE A;  3CCR A;  3TRE A;  3LW5 E;  3OMC A;  1G3T A;  1N9S A;  4OP0 A;  3QO3 A;  4XU0 A;  3GPL A;  4OGC A;  1VQO T;  3E9G A;  3FB9 A;  1WQW A;  4M75 A;  1YJW A;  1MGQ A;  4XK8 E;  4PL6 A;  4EMH A;  3QUI A;  4M75 E;  3V8L A;  1BI2 A;  4B9W A;  3RKY A;  2E41 A;  4OB3 B;  1VQ8 T;  4M7D A;  4M7D E;  1FX7 A;  4EMK C;  1BI0 A;  4HA8 A;  4C92 A;  2XDD A;  3OA6 A;  4N0A C;  3R6O A;  4PLI A;  4C92 E;  5KCH A;  2QQB A;  4BDY A;  4BI8 B;  4M77 D;  3OYN A;  3X28 B;  3JCM f;  4X9C A;  2GF7 A;  4J7F A;  2NLU A;  3F70 A;  2OTJ A;  1I8F A;  1Y71 A;  2FB7 A;  2M1H A;  4FT2 A;  3S3M A;  3JCM X;  2QQA A;  3WVE B;  2QEX A;  3CCU A;  4E7J A;  1VQN T;  5GAN 7;  5GAN h;  3JSC A;  2QA4 T;  2VXF A;  1H3Z A;  1EIF A;  2DD4 A;  4IUQ A;  3M58 A;  3LWH A;  1Q86 C;  2LQK A;  3J7A F;  2CGH A;  1N8R C;  4RG8 A;  3L1A A;  5FU6 B;  2XKO C;  2ZGW A;  1VIF A;  3BDL A;  4M75 C;  4OB0 B;  4ZN1 A;  4C5I A;  4M7A A;  2KK4 A;  4M7A E;  5GAM f;  2ZPB B;  3NFC A;  2OTL T;  2GCX A;  3V7R A;  1VQL T;  2HAX A;  2XHC A;  4PJO A;  3MP1 A;  3TEE A;  5CAI A;  5GMK i;  3JCM h;  1BI1 A;  3OY9 A;  3HRU A;  4Z02 A;  4PJO E;  3JCM Q;  1Y7X A;  4C92 C;  3CC2 T;  2MMP A;  1K8A U;  4E7H A;  4ZTF A;  1VQ8 A;  3CBO A;  4RCB A;  3I55 T;  5CKF A;  1FXX A;  2LT4 A;  3DKM A;  3M57 A;  3OYY A;  4XTX A;  3RKW A;  3JB9 F;  4C0Z A;  3LWI A;  1VUB A;  2DXT A;  2K3Y A;  4BY6 B;  1G5V A;  3L2Q A;  1VQK T;  1QP3 A;  4V2S A;  3HP9 A;  5CCA A;  5M9O A;  3OYL A;  4LD9 K;  2YLC A;  1OI1 A;  2LX9 A;  3OW2 A;  5GAM h;  2OAU A;  3RMS A;  2C06 A;  4C8Q D;  4HT8 A;  5LJ5 h;  1PSE A;  3OBW A;  3OYJ A;  4M77 G;  4M75 F;  4VUB A;  1VQN A;  4M7A C;  3L2Z A;  2QA4 A;  3OYM A;  1XTD A;  2LT1 A;  2JUF A;  4A4H A;  4M75 B;  3V7C A;  3OYH A;  2XIC A;  4BI3 A;  4DA4 A;  1M90 U;  4M7D F;  1IZ6 A;  4PJO C;  3JB9 I;  3OBY A;  4OGE A;  2QQ9 A;  4M7D B;  1PSF A;  4XQ3 A;  2G3R A;  2PVG B;  3OYC A;  2OTL A;  1VIE A;  4F7U G;  4FM4 B;  3CXC S;  1VQL A;  3CMA T;  2RD1 A;  4EPC A;  3UDC A;  1R8O B;  2LCC A;  3J81 E;  2M16 A;  1VQ7 T;  2CYZ B;  2DXC A;  3OMG A;  3C12 A;  3CCL T;  3CC2 A;  5C0M A;  4MZP A;  3I55 A;  1I81 A;  4KUI A;  2L89 A;  2ZPI B;  1Q7Y U;  2X4Y A;  2DPP B;  3M9Q A;  2YHT A;  1JB0 E;  1VQK A;  3P8B B;  5LJ3 d;  2R57 A;  2LRQ A;  1K73 C;  4M7A F;  3QXE B;  4R56 A;  3OYA A;  3VUB A;  1QVG S;  4XU3 A;  4L59 A;  1Q81 C;  1Q82 U;  1ZQ1 A;  4M7A B;  4J8O A;  4LDX A;  3QBY A;  4PJO F;  3CCJ T;  4YTL A;  5FRO A;  2A3L A;  2XI9 A;  3RES A;  5D6W A;  3X24 B;  5GAO q;  4IUV A;  1KQS S;  2FHD A;  2JN0 A;  2JTF A;  4PJO B;  3PNW C;  2JOY A;  5GAN g;  4A54 A;  2XID A;  4C8Q G;  3GNF B;  3UWN A;  4RG2 A;  4B9X A;  3JCM P;  3J80 E;  2EJ9 A;  1YJW T;  3L2W A;  3CMA A;  4EDU A;  1K8A C;  3H6Z A;  3M4Y A;  5KH6 A;  3MEA A;  3V7S A;  5GAM j;  2DK3 A;  5A2Q E;  3CCV T;  1VQ7 A;  3OB9 A;  2GQV A;  5CQY A;  4A4G A;  3A8M B;  2EQK A;  2DTH A;  3OYI A;  3GIB A;  3QSU A;  2GFU A;  3GF5 A;  4LDW A;  2ZPH B;  3ASK A;  4J7I A;  1O9S A;  5CKB A;  5DLO A;  2EKO A;  2OTJ T;  2F5K A;  1KG1 A;  2E65 A;  4M78 F;  2V8J A;  2DXB A;  3JCM e;  4M78 B;  3FC3 A;  2HD0 A;  4QQ6 A;  5CVI A;  3A5Z B;  5CKD A;  3CCJ A;  3C95 A;  2RJF A;  2RJC A;  2XG8 D;  4IUP A;  2MWP A;  3M56 A;  5GAN 6;  1U1S A;  3OS1 A;  3UT1 A;  3PTA A;  5CKE A;  1HXD A;  3LLR A;  4JRI A;  1GXI E;  3GNG A;  3G6E T;  4BE2 A;  1M8V A;  5FU6 C;  4C0F A;  3JCM b;  1FWZ A;  1YCY A;  2DEQ A;  2ZPG B;  5GAM e;  1P92 A;  3SFM A;  3JAM E;  5LJ5 e;  3PMI A;  2EJF A;  4QW2 A;  4OB2 B;  5I21 A;  1K9M U;  1WGS A;  4M75 D;  4RMO A;  1X75 C;  4FSX A;  3CCV A;  1YI2 T;  1Q7Y C;  3CD6 T;  3NTH A;  4BB7 A;  2ZPF B;  3OS5 A;  3JB9 J;  4HCB A;  5I2M A;  5KE2 A;  5J3B A;  3ZEH A;  2HQX A;  2WSF E;  4C92 D;  4BY6 C;  3E19 A;  2R5M A;  5CKH A;  1Q82 C;  2VYT A;  5LJ3 f;  1X6O A;  5J39 A;  3A8O B;  4OVA A;  1OYX A;  5IT9 E;  1KHC A;  2K3X A;  1U8R A;  3A8H B;  2XU8 A;  2E6Z A;  3VU3 C;  1XOV A;  1VQ9 T;  1W2B S;  4HCC A;  4XU1 A;  3QJ6 A;  1M1K U;  3CCQ T;  4LD6 A;  2K5I A;  2M0O A;  1IRE B;  1LJO A;  2P0P A;  1N9R A;  2EJG A;  3RKX A;  2IG0 A;  1AHJ B;  2PUO B;  3KBG A;  3JCM c;  5GAO l;  5DM7 R;  3CXC A;  3G6E A;  4M7D C;  4PKC C;  4M7A D;  1S72 T;  1VQ4 T;  2K2V A;  5CIU A;  5EG2 A;  5LJ3 h;  2QQR A;  4PJO D;  3OYF A;  3SB2 A;  3CCE T;  4X9D A;  2L3R A;  4FL6 A;  3L2R A;  2E64 A;  1YI2 A;  3CD6 A;  2EQM A;  1VQP T;  2EFI A;  2PU9 B;  1JBM A;  3JCM W;  1WNL A;  1QVG A;  3O8V A;  4XTU A;  2EIF A;  2LQ8 A;  3H8Z A;  4ZN3 A;  1UEB A;  2RI2 A;  4RKU E;  1KQS A;  3C94 A;  2CS7 A;  1NPR A;  4C92 G;  5IAY A;  3CC4 T;  3RER A;  2HBP A;  2EYQ A;  3VKI A;  3OYG A;  2F5T X;  3LGL A;  5A0D A;  3L2U A;  1VQ9 A;  4FU6 A;  4M78 A;  1ZBX A;  2I2L A;  4A4E A;  3CCQ A;  4M78 E;  2XDP A;  4GY5 A;  2EAY A;  5A0L A;  2R5A A;  3X25 B;  2LC4 A;  5GMK j;  1QP2 A;  3M53 A;  3HRS A;  4KT0 E;  1S72 A;  1VQ4 A;  3WVD B;  1WQ7 A;  2RK2 A;  4HKE A;  3RIR A;  2L5Q A;  3CCE A;  1TH7 A;  2RH2 A;  3NTI A;  4JS5 A;  3OS2 A;  2MWO A;  4BE1 A;  1VQP A;  2RI5 A;  3CCS T;  2QXF A;  4JS4 A;  2XDB A;  1X01 A;  3DLM A;  2A7Y A;  4M77 F;  2HNI A;  5FRM A;  3FIF A;  3EFR A;  1QW1 A;  5GAN d;  4A53 A;  3CBP A;  2GFA A;  4M77 B;  1G3Y A;  2DTI A;  2DTO A;  2K5L A;  3JCM J;  2BIV A;  3P8D A;  2KMT A;  4M78 C;  3I56 T;  3EFS A;  3QZ5 B;  3VJP A;  5LJ3 j;  2E70 A;  2E12 A;  3QG1 A;  3HHT B;  2E10 A;  2VUB A;  1YHQ T;  3CC4 A;  1M1K C;  4PNO A;  2DIQ A;  3MP6 A;  4UC4 A;  4FT4 A;  3CBM A;  3PIP A;  1RI0 A;  2VGM A;  3BDU A;  1M5Q 1;  2LTO A;  2QI2 A;  4JLI A;  5GMK e;  3SWN A;  5D6Y A;  2K57 A;  3INZ A;  4ZGE B;  1KQ1 A;  4R55 A;  2B8A A;  3QII A;  3DLL A;  1I5L A;  3G4S T;  2AHJ B;  3A8G B;  2X35 A;  4O5V A;  4A4F A;  4TVR A;  2QTX A;  2JTM A;  4ATO A;  2RK1 A;  5L8R E;  4JRP A;  4NL2 A;  3JCM g;  1BIA A;  3VV0 A;  5FLX E;  3CCM T;  4MZM A;  4BE0 A;  5GAN 4;  1KD1 U;  1OZ2 A;  5CK9 A;  1JRI A;  2X4J A;  2YLB A;  1SSF A;  1W4S A;  4OMF B;  3MP8 A;  4KUL A;  2Y90 A;  4NOY A;  3S6W A;  1UGQ B;  4FIB A;  2BKD N;  1Q86 U;  3CCS A;  4DOW A;  3ZBD A;  2CZ6 B;  4HT9 A;  5LL6 S;  5CO7 A;  2VGN A;  4P5N A;  5HK3 A;  1N8R U;  3CC7 T;  2RHY A;  2PVO B;  1DJ7 B;  2LNV A;  3M5A A;  4J6Y A;  5GAN 8;  2VC8 A;  3L42 A;  2O01 E;  4JUV A;  2K4Y A;  2RHZ A;  3GLX A;  5LJ3 e;  1NPP A;  5GAN 2;  1M90 C;  5GAM g;  1UGR B;  3I56 A;  2D6F A;  1LOJ A;  5LJ5 g;  3JB9 D;  1W2B A;  3SWN C;  4CI0 C;  2JNG A;  2RJD A;  1YHQ A;  2DXU A;  1Y96 A;  4N4G A;  4Y28 E;  4BD3 A;  2E1H A;  1M9S A;  3LH0 A;  4DOV A;  4N4H A;  4WF2 A;  3X20 B;  2O4X A;  4OB1 B;  4ELY C;  3ER0 A;  3HRT A;  2YRV A;  2XK0 A;  2EQJ A;  3G4S A;  2CZ1 B;  3PGG A;  2RI3 A;  1O75 A;  4J83 A;  4KBM B;  1M1G A;  3MEW A;  3S3N A;  3M59 A;  4GLK A;  5GAO m; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...