1YJNQ

Crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1yjnQ00
3I56Q 2QEXQ 1QVFP 3CMAQ 3G4SQ 3OW2P 1M90R 1VQPQ 3CCMQ 1M1KR 1VQ4Q 1Q7YR 3CCSQ 1VQ5Q 3G6EQ 3CCRQ 3CC4Q 3CCLQ 1YI2Q 3CPWP 1YJWQ 1YHQQ 1VQNQ 3I55Q 2OTJQ 3CD6Q 3G71Q 1VQOQ 1VQMQ 3CCVQ 1N8RR 2OTLQ 1QVGP 1VQ7Q 1KC8R 3CC7Q 1KD1R 1YITQ 1W2BP 1NJIR 1JJ2P 1YJNQ 3CXCP 2QA4Q 3CCJQ 3CCUQ 3CC2Q 1S72Q 1VQ8Q 1YIJQ 1VQKQ 3CMEQ 1Q81R 1VQLQ 1YJ9Q 1KQSP 1K9MR 1K8AR 1VQ6Q 3CCQQ 3CCEQ 1Q82R 1K73R 1Q86R 1VQ9Q
chains in the Genus database with same CATH superfamily
2JNGA 1M90R 3DB4A 2X4JA 2QGFB 2YUOA 1PM3A 2HDAA 1TUDA 2OTLQ 3CCMA 5I21A 3OMGA 3CD6A 2KMTA 2D0NA 3A8LB 3WVDB 1N9RA 1B34B 2JTFA 1FMVA 1TOVA 3P8BB 3CCET 1UTIA 2YUPA 4OVAA 2DERA 3OA6A 3P8DA 2WSFE 1ZLMA 1KQSA 4PL6A 1OULA 4XK8E 1YWPA 3REBB 2QEXA 1Q7YC 3UWNA 2BUDA 4M77C 1OEBA 4C5GA 2XI9A 3U23A 1VQOT 1X2KA 2O9VA 1KD1U 1NZ9A 1B3QA 1IGUA 4OB0B 4PJOB 4JDSA 2GQIA 3L1AA 2E70A 2A0FB 3M0SA 4XTUA 1VQLT 1MV0B 3E9GA 1K8AC 4PJOD 1FXXA 1ZA1B 2K2MA 3SDZA 1PC0A 3CCMT 2K5FA 3CD6T 3GF5A 1UJYA 1TH7A 2K3YA 3JCMJ 3OYBA 1VQKT 1ACMB 2JMAA 2KYBA 3RUXA 5FRMA 1RAIB 1OX9A 1K9MC 5LJ5f 5FWBA 5GAN2 3EGXB 2QEXT 3S3NA 3JCMg 1PD1A 2EKOA 1B34A 2LNVA 3CC4A 5EG2A 1KK7A 1XNIA 5GAMf 1VQNA 3OS2A 3LH5A 4M75G 2R5AA 2RQUA 1RADB 5I22A 2CGHA 4KGVB 1AT1B 4X9DA 2PZ1A 1IZ6A 4PJOA 2YRDA 1UHFA 2RM4A 2QQBA 2PVOB 4J5YA 1QVFA 4NL2A 3VUZA 2X3WD 3CCRA 1WQWA 1NJIR 3QZ9B 1YJNQ 1M4ZA 1YJ9Q 5CCAA 1M30A 2HNIA 1YCYA 2O88A 2LQKA 2XG8D 1I5LA 3RIRA 1U8RA 2LQ8A 1VQ4Q 4RCBA 3C4SA 1WFWA 1MGQA 2EQIA 2X9HA 1IGQA 4DBHA 1VQMQ 1VQNT 3RR6A 6AT1B 1H92A 4M75B 1IRXA 5FROA 3EGXA 4OB2B 1KC8C 1E6HA 2COYA 2P4RA 2RJFA 4PFZA 4C8QG 3SHWA 1Y07A 4M78G 1PRMC 1Q7YU 3QSUA 3CCRT 3OBYA 4BE2A 3I9QA 2AZSA 4JJCA 3JB9G 2FO0A 3INZA 4L5GA 2K5LA 4C0DC 2HQEA 3J7AF 2KXDA 2RD1A 2I2LA 2QQ9A 1K8AU 1Q82R 4OMFB 5GANd 4ZN3A 1X69A 5A0DA 3OYGA 3OYYA 1X2QA 2JM9A 2OTJQ 2RQTA 2VXFA 3JAME 3FDRA 5GAN3 4C8QB 5KYUB 4GLMA 4A4FA 2HL3A 5KYNA 1ZA2B 3EG0A 4C92F 3M58A 5A2QE 3EH2A 1KSWA 3FIFA 1X43A 1K9MU 3CMEA 4E7LA 4M78B 3A5ZB 3I56Q 4M75A 4KGZB 3CEYA 2GTOA 3CCSQ 2RO0A 1BBZA 2HBWA 4II1A 4ORZA 3E19A 4EMKC 5CKHA 1NLOC 1OYXA 1YITQ 1W2BP 4IURA 4X34A 2KXCA 3JB9D 1BI2A 1S72T 2LQNA 4M7DG 4LUDA 2QASA 2RI3A 4LDXA 2WSCE 2YXYA 3DLMA 2B8AA 2F2WA 3R6OA 2E3IA 2RPNA 1OOTA 2V8KA 4XAXB 4JJDA 3G6ET 1QVGP 1BKBA 2RJCA 3QO3A 1OQKA 4LUEA 3V8LA 3C12A 2OAWA 1SSFA 2OTLA 1YFNA 3CMET 1MNDA 2DD5A 1G5VA 4J9HA 3T9NA 4HT8A 3SFMA 3BY7A 3A8OB 4C92E 4C8QA 2RQRA 1NPRA 5KYUA 2HD0A 2ED0A 1X01A 4F7UE 4M78A 2CYZB 3A98A 2F2VA 3URGA 1A0NB 1KC8U 1KD1R 2RI2A 5J39A 2MIOA 1D3BB 2CZ0B 1D1BA 3X26B 4DOWA 5L8RE 4J9BA 2DL4A 2CH4A 1VQ5A 2G3RA 5IT9E 1GCPA 4M7DD 3LW5E 3JRZA 2DO3A 1Y96B 2RJDA 2KRMA 3MP8A 4J6YA 3TSWA 4J9EA 1YI2Q 3E2UA 1CSKA 4BB7A 1RL2A 2E65A 5GAN4 3CCVQ 1M27C 1JJ2S 3V7SA 2OTLT 5LJ5h 1VYUA 2DXBA 1AOJA 1YIJQ 1X6GA 2E41A 3OSSC 4OP0A 1Y0MA 4F04B 5LJ3d 2PU9B 3VS6A 1JU5C 1PSEA 1BI0A 5IHKA 2HZYA 1T3LA 2K7AA 3GNFB 3DKMA 2MOXA 3I5SA 1N6AA 2DTIA 2L3PA 4R0KA 4OF1A 2CZ1B 3LH0A 1MV3A 2J05A 3OW2A 3OYEA 3QIIA 4HCZA 1KJWA 2DBMA 1UFFA 1VQ5T 4FU6A 2QQSA 2ZGWA 3JCMb 2KBTA 4B9XA 4X1VA 3QJ6A 4QVCA 2DL7A 2X4XA 2JM8A 1D3BA 1QKXA 2XICA 3THKA 1I4K1 2NUPB 3SWNC 4N4GA 2XDDA 2L3QA 5CKBA 1Y96A 3G71A 2GF7A 1YJNA 2MK5A 4C5IA 2YDLA 1NBEB 3V8JA 3MEVA 2XMFA 3NFCA 4D8KA 4ATOA 1ABOA 3UDCA 3ZFJA 5FU6B 1MNEA 3LYIA 4E7IA 4MDWA 2O4XB 3X20B 1D0ZA 5ECAA 2MPXC 2L8DA 2WACA 3L2WA 2J6FA 3TVTA 2IG0A 3QPHA 3SEMA 1VQMA 3RMSA 3UT1A 2D1XA 2E5KA 4M7AD 2RHIA 2EBPA 2OJ2A 4DBQA 3FEOA 4QQ6A 4F17A 1M2VB 5GJWB 3V8KA 2BZXA 2M0YA 3TREA 2CSIA 2HQXA 3CCLQ 4EMGA 5CKEA 1M1KC 4C0ZA 2EKHA 5KYYB 1G3TA 3WVEB 5LJ3e 3G71T 3M0UA 2HMAA 3CPWA 1SSHA 3PVQA 1YJNT 2QK0A 2A37A 2HKQB 2NUPA 4M4ZA 2ROTA 1K8AR 4XU3A 2DXCA 4XTVA 1GL5A 2F1LA 4CC3A 2YLCA 3OW2S 3GNGA 5FRNA 2D0QB 1OZ2A 2DVEA 5FW9A 2LRQA 2QYZA 4J6WA 2OTJA 4ZGDB 1VQ8Q 1SF9A 4DA4A 4FW1A 1TTHB 4A4KA 2RN8A 1K9MR 3HRUA 2O4XA 2EWNA 5LJ5g 4KUDK 4YTLA 1RAGB 1TXQA 4HVVA 1RAAB 2CH4W 1QCOA 4FSSA 2DIQA 2JTMA 2BIVA 3VS0A 2AHJB 5FU7B 1M2VA 4PJJA 3FJ5A 1VQ7A 3CCJT 1YITA 2J7IA 4GLKA 5KYYA 3E9FA 4ANJA 4C92C 3EHQA 4M7DF 5GAOm 3J80E 4QW2A 4DEYA 1ZUKA 2H8HA 3L2UA 1YHQQ 2P0KA 2EJ9A 4FYYB 3LGLA 2RI5A 3I55T 1TG0A 2ABLA 1NYFA 3CXCP 2H3EB 3CC2Q 4QVZA 2A08A 1UEBA 2IPOB 4FSXA 3EG9B 3HL8A 2CP2A 3PE0A 4MMLA 2B86A 1HSQA 3HFNA 4B6MA 4RG8A 2L5QA 3HSBA 1WLPB 2A36A 1VQ9Q 1CKAA 5GAOp 1ZSZB 4Y92A 2EYQA 4Y28E 1KC8R 2DFUA 5CVIA 1VQ7T 2COWA 3V7RA 3UA7A 1AVZC 1ZUUA 4C0GA 1G83A 1D1CA 1K0SA 2AK5A 4LDYA 2DPPB 1VUBA 1YBYA 1M1KU 1WHLA 4HCBA 5LL6S 1VQPT 2FZGB 1ZX6A 3H0FA 4BD3A 3OB9A 2KROA 5J26A 2ATCB 2DJQA 1LCKA 1N27A 1ZUYA 2DNUA 4D6WA 2YLBA 1VIEA 3MPUB 1V1CA 4RKUE 3CMAT 1Q95G 1VYTA 3EG9A 3G4SA 4Z88A 4E7HA 2CUDA 3AT1B 2O2OA 1D0YA 2E3HA 2CP7A 2FG0A 1ZSZA 1PD0A 4M7AF 4WCIA 1SHGA 1KFZA 2EFIA 3HRTA 3FLGA 4KBMB 1WHGA 3I5RA 3M9QA 2IIMA 2W10A 2F69A 2DBKA 4IUTA 3CBOA 1QLYA 1C1AA 2FYKA 2EGAA 2XU8A 2QXFA 5KYXB 2VV5A 3C94A 3JB9H 1WXBA 1BI3A 1YN8A 1E7OA 2K4YA 3CCQA 2VGNA 3G4ST 4QKUA 1FYNA 1U5SA 1OU9A 5GMKe 5I2MA 1WXTA 3M4GA 1WHKA 2MMPA 4VUBA 2DEUA 4ZN1A 4OGEA 2DZCA 1OU8A 2DAQA 4E7JA 2X51A 3CQTA 3QYGB 2XK0A 4LD6A 4HCKA 2K57A 4M7AE 3H6ZA 5I11A 4OMPA 1QWFA 2X4YA 1SRLA 2DL5A 2J06A 2JJ9A 2YT6A 2KVQG 4OMNA 3QBYA 2BE9B 4XTXA 3GLXA 3L2RA 5GAOn 1N8RR 3OSVA 3CCLA 3OY9A 1NEBA 3OYCA 1IXDA 3CC7Q 1NYGA 2LVMA 4ZNXA 3JCMd 3MCAB 3PMIA 1E6GA 1JEGA 4RTXA 2EJGA 3H0IA 4ELYC 4M77G 3CCQT 4UC4A 5FLXE 5KYXA 4O5VA 4JLGA 1OI1A 3MEUA 2HSPA 2FZCB 2FRYA 2K6DA 3X28B 4J7IA 5IN1A 3QWXX 2GBQA 2FL7A 2YWWA 1Y57A 2M16A 1PCXA 1UGPB 2QQAA 5GAOq 4E7KA 2SRCA 2VWFA 1SHFA 1K73C 1T3SA 4MMKA 3QKJA 2YSQA 1PG5B 2HBPA 3PGGA 3CC4T 2M02A 3QHSA 2G6FX 5C6SA 2JVVA 2QA4Q 1AD5A 3QJYA 1X27A 3UATA 4M77B 2HCKA 2ZPIB 4M75D 1U1TA 2AKLA 2DE0X 5HKCA 4M77D 5IHIA 1M8MA 3M5AA 4BE1A 1W2BS 1YJWA 2LC4A 1OPKA 3EG2A 2LJ1A 3CC2A 4C0FA 4NS5A 2PVGB 5IH2A 2L2PA 2ZCFB 1WHHA 2K5IA 2DVJA 4M7DC 1V76A 5GMKl 1Z9QA 2LTOA 2LCCA 4HT9A 1LVKA 3RNJA 1XOVA 1QVGS 3JCMe 1VQ9A 3QG1A 3TU4K 4AFQC 2K3BA 4QT7A 3DB3A 5AYFA 4BY6C 2ZZDA 3M55A 2VC8A 1KQSP 1YCSB 1JJ2A 1G3SA 4C8QD 2DM1A 3EFOB 1C0MA 5GANj 2FVUA 1M1KR 4M77A 2CZ6B 4M78D 2FZKB 5HY6A 1YJWT 4F14A 1IHVA 1IO6A 4A4EA 2XKOC 4MZTA 2NUTB 4FL6A 3BDUA 3VV0A 1VQ6Q 3TEEA 1GRIA 3S3OA 1FWZA 2KEAA 4HVUA 4HCCA 4FT4A 1I5OB 4N0AC 4PJOF 1MUZA 2YUNA 2D8HA 2P4TA 3RESA 1U3OA 1VQ9T 1M1GA 1WXUA 3EG1A 3CPFA 4XU1A 2JW4A 2QTVA 5DLOA 1EFNA 1RI0A 1G3YA 2FHDA 2ZPHB 1HXDA 2AKKA 2EQKA 2RHYA 4ZGJB 2KRSA 4RCCA 4J8OA 4ESRA 1K73U 3V7CA 2KE9A 1GXIE 4ZTFA 1BB9A 3HRSA 2V1QA 3JCMc 2RQWA 4KGXB 3TQ7P 2QI2A 4JLIA 1W6XA 3EFOA 5C0MA 2CP3A 2DEQA 5GANe 1LNXA 2R57A 4PLLA 2A3LA 3M53A 3PVLA 2HSEB 4M7AC 4XU2A 2OI3A 1G8XA 3IQLA 5CKFA 4C0DB 1QVFP 4FM4B 2NUTA 2PVDB 4OB1B 2FPEA 1WNLA 4PJOE 1LPLA 3GIBA 2W0ZA 1AEYA 2F5KA 2EYYA 4IUQA 1W4SA 4IUUA 3OYLA 2RH2A 2LMJA 1T0JA 2PUOB 4IUVA 1M8VA 1GCQC 1WZOA 3CCEQ 3OYFA 1R0BG 4PLIA 2DL8A 2ED1A 1H3HA 2EJFA 2ZPFB 2RA2A 4RUGA 4KH0B 3JCMW 2VYTA 2EGEA 1VQOQ 5CR2A 3OYMA 2AT1B 3UPUA 1XTDA 2FRWA 1NJIC 2YHTA 1VQLQ 4RTYA 4EMKB 1QCFA 1U1SA 4BUGA 2EAYA 3VS5A 4M75F 5LJ3j 3LWHA 4BE0A 4JPBW 3M0TA 4WTOB 3SD4A 3NGPA 3AHUA 4M77F 3ULRB 3CCMQ 3RKWA 3PIPA 2XDPA 3CD6Q 5HCKA 4JRPA 3M4YA 3NTHA 1R8OB 2E4HA 2FPFA 4LN2A 3G1JA 5IXFA 2EQUA 1XJWB 4OMMA 1VQKQ 1JRIA 2ESWA 3L2QA 2CT4A 3RMQA 3A1PA 2BZYA 3ZEHA 1RAHB 2EVRA 4PK4A 2QEXQ 1YJ9A 2HAXA 2RK1A 2RF0A 4DBFA 1HD3A 2P0PA 2VASA 1M2OA 4OMOA 1VQ4A 4AMCA 3PNWC 5GANf 4AFUC 1VOMA 4X9CA 1B7TA 1YWOA 5GMKh 2M51A 3JCMX 2QDLA 5D6XA 1QCNA 4AG1C 4V2SA 1UECA 4C8QF 1UGVA 3VUBA 4M75E 3H41A 3OYNA 1Q7YR 5J3BA 4WF2A 2NUZA 4EMKA 3VU3C 2KDSA 4M78F 4BI4A 2CP6A 2KT1A 2KY9A 1ABQA 2KR3A 2GFUA 3VS2A 4XTZA 1QQJA 1SPKA 2ZPBB 3GPLA 3JB9F 4AFZC 2CKKA 3F70A 1YJ9T 1VIFA 1FX7A 5KCOA 2D9TA 1MMNA 5L23A 4ELZC 5CO7A 4Z89A 1UHCA 1RLQC 1W70A 5A0GA 1VQNQ 2EYZA 1VQ4T 3L2ZA 3CXCS 2OX7A 1VQMT 3OMCA 1JB0E 3FB9A 3MKDA 1AZEA 4J9DA 2E6ZA 3MP1A 3MEAA 3OYHA 3PT9A 5CIUA 1AWXA 2VXEA 2J6KA 5GAN7 4C8QE 3H8ZA 2LZ6B 3I56A 3CCRQ 4HVWA 1O9SA 1TSFA 2DILA 5LJ5d 1WIEA 3CCSA 1NJIU 4M78E 2YRCA 4PFOA 4FT2A 3SWNB 2RHXA 2DRMA 3S3MA 3X25B 3H0HA 5I2SA 4D8DA 2KT8A 5GAMd 1VQ6A 3OS5A 1QP3A 1NG2A 3VYHB 4MDXA 3L42A 4O6JA 4JRQA 2QDYB 1GFDA 1QW1A 3QDRB 4PNOA 2OTJT 5GMKi 3HFOA 3KBGA 1T0HA 1H8KA 2HKNA 1OX8A 1R77A 4LE9A 1K73R 2ZPGB 5D6WA 2QTXA 1EX4A 3OS1A 3I56T 2BTTA 3BFMA 5GAMj 4R55A 4PJOC 1WA7A 5LJ3f 3RKYA 3L2VA 3CCST 1UGRB 3QYHB 1S72Q 4AT1B 2JS0A 1YITT 1NPPA 2RNAA 1WQ7A 1VQ6T 1M5Q1 2DRKA 1UDLA 1UUEA 5D7UA 3OYJA 2EQMA 2C06A 3SWNA 4M7DE 1Y71A 3G6EQ 3QUIA 1ZQ1A 1SKUB 1HYOA 4PFPA 4NL3A 3MP6A 3NMZC 3MEWA 2E5QA 2O9SA 1YI2A 4C92G 3BE3A 2LQWA 3JSCA 3CCVA 1SEMA 5IAYA 2AZVA 4RTUA 5EC7A 1NM7A 3TCJA 1Q81C 5GMKj 1YIJA 3BDLA 2KRNA 3QDFA 4F7UG 2QQRA 3RKXA 5HK3A 1PSFA 5LJ5e 4DBRA 1WYXA 4CI0C 2M9UA 4JRIA 5KCHA 2LX9A 2ZPEB 3KUFA 2GNCA 2V26A 3MHXA 5GAMe 2KSSA 3ASKA 1VQLA 2DXUA 1W1FA 3OBWA 4LD9K 1JQQA 2CUBA 1K0XA 2GTJA 3PMTA 2ECZA 2M0OA 4QQGA 3CPWP 1QMCA 3E1SA 1WGSA 4C92B 3JV3A 1YI2T 2COZA 4JS5A 3CCVT 3EG3A 3O8VA 1RI9A 2PUKB 2NWMA 4C92D 1M3CA 4PKCC 2X3XD 4F7UB 1YIJT 4N4HA 4LXCA 3RDVA 1VQKA 3OQ5A 4LDWA 2FB7A 4RTWA 1RUWA 1KQ1A 2K3XA 2L0AA 2JT4A 5GANh 4M75C 2JUFA 3GP8A 2L89A 3EGDB 5AT1B 1EZZB 1KHIA 4TVRA 1K76A 4A53A 5HK0A 4AG2C 3UF4A 4ZGEB 1VQ5Q 1K4US 3CCUQ 1ARKA 3VS3A 4L59A 2MI6A 2CT3A 2M1HA 1W2BA 2RK2A 1FMKA 2JS2A 2EGCA 4KH1B 2C0OA 1BI1A 2EYXA 3QWYA 2E10A 1M3BA 1AWJA 1LOJA 4MZMA 2MCNA 1Z9ZA 2LDMA 2GQVA 4JRKA 7AT1B 2LT4A 1QVGA 4C92A 3NPFA 1KQ2A 4CRIA 1KIKA 4FIBA 2KQWA 4C8QC 5GAN8 2DL3A 4F7UA 3M57A 4XQ3A 2BE7D 5IHNA 1OZ3A 4Z8AA 4A4GA 4M78C 4FW2A 2ROLA 3EGDA 4QQDA 1VA7A 1Q81U 2RB6A 3PIOA 1VQ8A 4IIMA 2DKGA 1MHNA 2C0TA 5CAIA 3RERA 4RTZA 5A0LA 1FMWA 3G71Q 3CCLT 3ZBDA 1BU1A 3A8MB 3HPWA 4ME7A 1N9SA 1S1NA 3SB2A 4LDVA 1KQSS 3EHRA 2NYSA 3M0QA 2BZ8A 3CBMA 4IKFA 1H3ZA 4BI8B 5GAOl 3UA6A 4EMHA 2D6FA 4OMQA 2OAUA 2V8IA 2ENMA 1G3WA 4A63B 5GAOr 9ATCB 4FCYA 1Y7XA 1AHJB 4GBQA 1C6VX 1YHQA 5D6YA 1WI7A 1HJDA 2PNIA 3M0RA 8ATCB 1VQ8T 2YUQA 1R0CB 3GOXA 1BCMA 3C0CA 5LJ3h 2RMOA 4XTYA 4J83A 2XD0A 3MJXA 2L3RA 1GFCA 1I1JA 2QG9B 2Y90A 2JN0A 2V8JA 2VKNA 4JZ3A 4KRTA 5CKDA 5GANg 3M56A 1GBQA 1WHJA 3CCJQ 2DIGA 2VB6A 1PKTA 4BI3A 1RACB 5CK9A 4K11A 2EPDA 3QXEB 1DJ7B 1S72A 4Q5WA 1MMAA 2RHUA 1Q86C 4FYWB 2XHCA 2K2VA 4EDUA 4BDYA 3FRNA 2Y4XA 1M90C 1ZBJA 3I55Q 1CKBA 2CDTA 2JZ2A 5DLQE 4E47A 1YHQT 2MWPA 3G6EA 1O75A 1H641 2GCXA 4JZ4A 2JXBA 1ZHIA 4A54A 3RBBB 3CC2T 1PKSA 3O5ZA 3JB9J 4L6V5 3NTIA 4J9GA 2MYSA 1QVFS 2R5MA 3LGFA 2VUBA 4F7UF 2F2XA 2HEQA 3G7ZA 1I07A 3PTAA 1VQ7Q 4HKEA 1BIAA 2XDBA 2KK4A 2O01E 3ER0A 3JB9I 4DOVA 5DM7R 1AWWA 1X75C 2D8JA 1QWEA 1QVPA 2R58A 4OGCA 2AIRB 4JUVA 2P0QA 1VQPQ 1NLPC 3HP9A 4QVDA 4KULA 2E6NA 5GAN5 2IVWA 4RG2A 5GJVB 4OMLA 3HKSA 1BCOA 2LNHB 3EFSA 4PJLA 1MMGA 2CZ7B 2DLPA 2DF6A 2QGGA 5FU6C 2Z0WA 3VRYA 3X24B 2DD4A 4EIKA 2DA9A 2XIDA 1P92A 1RABB 3CMAQ 3OYIA 4C5HA 3A8GB 2Y4YA 3JCMf 4KT0E 2DJZA 4B9WA 2KYMA 3R6NA 1N8RC 2A7YA 4M7DB 1XQHA 1RAFB 2WSEE 5CQYA 4PJMA 1IB8A 1U06A 3P8HA 2DTHA 3CCUA 2QAZA 1LJOA 4JS4A 3NHNA 4J6XA 4KUIA 3BW1A 4MZPA 4BY6B 5LJ3g 1ZSGA 3JCMP 5GAN6 3GBQA 1MMDA 2E64A 4A4HA 2DZ9A 3EH1A 1AZGB 3EAEA 3HHTB 1IHWA 2EYWA 2X35A 2RQVA 2EQJA 3CC7A 3I35A 3CXCA 3N5BB 2KGTA 1Q86U 1IREB 4RMOA 1TS9A 5KYWB 5GAMh 5IXBA 4DQ2A 3G4SQ 3TSZA 1M1FA 2F5TX 1M90U 1JO8A 1QP2A 2JMCA 1I81A 3OYAA 2MAMA 2FPDA 2JOYA 4M7AG 1BYMA 2I0NA 3PFSA 3VJPA 3CCUT 3H9NA 1Q81R 3EGUA 1NEGA 2E12A 2BKDN 1SG5A 4M7DA 5FU7C 1WJRA 4J9FA 4FYXB 2YRVA 3FC3A 5FWCA 1RAEB 1BK2A 2LJ3A 2PTKA 5KH6A 2DK3A 1JJ2P 1BIBA 2E1HA 3CC7T 1JXOA 3VRZA 2DTOA 2MWOA 2DETA 1K9AA 3JCMV 2QA4A 1TU0B 3CCQQ 1RLPC 4C5EA 3HTRA 1Q82C 1UGQB 3OYKA 4XU0A 4NOYA 4M77E 4M7AB 3A8HB 2KNBB 4LNPA 3EFRA 1M9SA 2VGMA 5KYWA 3D7SB 4RTTA 4HA8A 1UG1A 1ZSZC 2J6OA 3LLRA 4IIOA 4AFSC 4N0AA 5KE2A 3ME9A 2HL5C 1X6OA 2RJEA 1B07A 3CC4Q 4P5NA 2V1RA 3C95A 3KXTA 1N8RU 2P84A 4GY5A 2CSQA 4HXJA 1N5ZA 4F16A 4CC2A 1JBMA 1UB4A 1D1AA 3FJPA 2QA4T 4EPCA 3CCJA 1K1ZA 5CQXA 1UJ0A 4N4IA 4LDUA 1JXMA 4Y91A 2LT1A 4R56A 1WJQA 4E2FB 4ZTJA 3OS0A 4CC4B 4E7SA 2LJ0A 2RHZA 1QKWA 1D0XA 3I55A 2X4WA 4OB3B 2K79A 1HK9A 2EIFA 2L3SA 1TUCA 4M7AA 1TWBA 4PJNA 2ZAEA 2FEIA 2DX1A 1V29B 2NLUA 4CC7A 1NE8A 2LX7A 3VS1A 1WHMA 1VYVA 3VS7A 3LWIA 2O31A 2SEMA 2DXTA 3MO8A 3JCMQ 5GAMg 1AWOA 3ZL7C 1F1BB 2C0IA 1PWTA 4J9IA 2KI7A 2CREA 5LJ5j 1KD1C 4JJNK 3WXMB 1PRLC 1GCQA 1PNJA 4E6RA 5M9OA 2DYIA 4Z02A 2K9GA 3M0PA 1ZBXA 1X6BA 5KE3A 2LCLA 3OW2P 3NTKA 2MF2A 1YJWQ 2H3JA 2LP5A 3DLLA 8AT1B 1VQPA 2CP5A 1PHTA 1D09B 2GGRA 5DY9A 3M59A 3J81E 3QZ5B 1WPYA 3JCMh 2GFAA 4J7FA 1Q82U 3CBPA 1UGSB 3META 3Q1JA 1SRMA 3CPWS 5GMKm 3OYDA 3CMAA 4E7ZA 1GBRA 2CP0A 1WX6A 4FYVB 1EIFA 4DEXA 2CS7A 2VVKA 3VYGA 1YP5A 2DYBA 1UE9A 3CMEQ 3S6WA 2DMOA 3VS4A 4BDZA 1YNZA 1WDXA 4BACA 1J3TA 4J9CA 3CCEA 1I0CA 1WJSA 1KG1A 3KFVA 1M3AA 3LX7A 4RTVA 4XTWA 1TUGB 1G2BA 2EW3A 2PQWA 2A28A 2KAFA 1OV3A 1I8FA 1VQOA 2LCSA 3REAB 2HQHA 1KHCA 3VKIA 4IUPA 3M54A 2JTEA 4PJOG 4JJBA 1Q86R 1OPLA
chains in the Genus database with same CATH topology
3I56Q 2QEXQ 1QVFP 3CMAQ 3G4SQ 3OW2P 1M90R 1VQPQ 3CCMQ 1M1KR 1VQ4Q 1Q7YR 3CCSQ 1VQ5Q 3G6EQ 3CCRQ 3CC4Q 3CCLQ 1YI2Q 3CPWP 1YJWQ 1YHQQ 1VQNQ 3I55Q 2OTJQ 3CD6Q 3G71Q 1VQOQ 1VQMQ 3CCVQ 1N8RR 2OTLQ 1QVGP 1VQ7Q 1KC8R 3CC7Q 1KD1R 1YITQ 1W2BP 1NJIR 1JJ2P 1YJNQ 3CXCP 2QA4Q 3CCJQ 3CCUQ 3CC2Q 1S72Q 1VQ8Q 1YIJQ 1VQKQ 3CMEQ 1Q81R 1VQLQ 1YJ9Q 1KQSP 1K9MR 1K8AR 1VQ6Q 3CCQQ 3CCEQ 1Q82R 1K73R 1Q86R 1VQ9Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 Q;  2QEX Q;  1QVF P;  3CMA Q;  3G4S Q;  3OW2 P;  1M90 R;  1VQP Q;  3CCM Q;  1M1K R;  1VQ4 Q;  1Q7Y R;  3CCS Q;  1VQ5 Q;  3G6E Q;  3CCR Q;  3CC4 Q;  3CCL Q;  1YI2 Q;  3CPW P;  1YJW Q;  1YHQ Q;  1VQN Q;  3I55 Q;  2OTJ Q;  3CD6 Q;  3G71 Q;  1VQO Q;  1VQM Q;  3CCV Q;  1N8R R;  2OTL Q;  1QVG P;  1VQ7 Q;  1KC8 R;  3CC7 Q;  1KD1 R;  1YIT Q;  1W2B P;  1NJI R;  1JJ2 P;  1YJN Q;  3CXC P;  2QA4 Q;  3CCJ Q;  3CCU Q;  3CC2 Q;  1S72 Q;  1VQ8 Q;  1YIJ Q;  1VQK Q;  3CME Q;  1Q81 R;  1VQL Q;  1YJ9 Q;  1KQS P;  1K9M R;  1K8A R;  1VQ6 Q;  3CCQ Q;  3CCE Q;  1Q82 R;  1K73 R;  1Q86 R;  1VQ9 Q; 
#chains in the Genus database with same CATH topology
 2JNG A;  1M90 R;  3DB4 A;  2X4J A;  2QGF B;  2YUO A;  1PM3 A;  2HDA A;  1TUD A;  2OTL Q;  3CCM A;  5I21 A;  3OMG A;  3CD6 A;  2KMT A;  2D0N A;  3A8L B;  3WVD B;  1N9R A;  1B34 B;  2JTF A;  1FMV A;  1TOV A;  3P8B B;  3CCE T;  1UTI A;  2YUP A;  4OVA A;  2DER A;  3OA6 A;  3P8D A;  2WSF E;  1ZLM A;  1KQS A;  4PL6 A;  1OUL A;  4XK8 E;  1YWP A;  3REB B;  2QEX A;  1Q7Y C;  3UWN A;  2BUD A;  4M77 C;  1OEB A;  4C5G A;  2XI9 A;  3U23 A;  1VQO T;  1X2K A;  2O9V A;  1KD1 U;  1NZ9 A;  1B3Q A;  1IGU A;  4OB0 B;  4PJO B;  4JDS A;  2GQI A;  3L1A A;  2E70 A;  2A0F B;  3M0S A;  4XTU A;  1VQL T;  1MV0 B;  3E9G A;  1K8A C;  4PJO D;  1FXX A;  1ZA1 B;  2K2M A;  3SDZ A;  1PC0 A;  3CCM T;  2K5F A;  3CD6 T;  3GF5 A;  1UJY A;  1TH7 A;  2K3Y A;  3JCM J;  3OYB A;  1VQK T;  1ACM B;  2JMA A;  2KYB A;  3RUX A;  5FRM A;  1RAI B;  1OX9 A;  1K9M C;  5LJ5 f;  5FWB A;  5GAN 2;  3EGX B;  2QEX T;  3S3N A;  3JCM g;  1PD1 A;  2EKO A;  1B34 A;  2LNV A;  3CC4 A;  5EG2 A;  1KK7 A;  1XNI A;  5GAM f;  1VQN A;  3OS2 A;  3LH5 A;  4M75 G;  2R5A A;  2RQU A;  1RAD B;  5I22 A;  2CGH A;  4KGV B;  1AT1 B;  4X9D A;  2PZ1 A;  1IZ6 A;  4PJO A;  2YRD A;  1UHF A;  2RM4 A;  2QQB A;  2PVO B;  4J5Y A;  1QVF A;  4NL2 A;  3VUZ A;  2X3W D;  3CCR A;  1WQW A;  1NJI R;  3QZ9 B;  1YJN Q;  1M4Z A;  1YJ9 Q;  5CCA A;  1M30 A;  2HNI A;  1YCY A;  2O88 A;  2LQK A;  2XG8 D;  1I5L A;  3RIR A;  1U8R A;  2LQ8 A;  1VQ4 Q;  4RCB A;  3C4S A;  1WFW A;  1MGQ A;  2EQI A;  2X9H A;  1IGQ A;  4DBH A;  1VQM Q;  1VQN T;  3RR6 A;  6AT1 B;  1H92 A;  4M75 B;  1IRX A;  5FRO A;  3EGX A;  4OB2 B;  1KC8 C;  1E6H A;  2COY A;  2P4R A;  2RJF A;  4PFZ A;  4C8Q G;  3SHW A;  1Y07 A;  4M78 G;  1PRM C;  1Q7Y U;  3QSU A;  3CCR T;  3OBY A;  4BE2 A;  3I9Q A;  2AZS A;  4JJC A;  3JB9 G;  2FO0 A;  3INZ A;  4L5G A;  2K5L A;  4C0D C;  2HQE A;  3J7A F;  2KXD A;  2RD1 A;  2I2L A;  2QQ9 A;  1K8A U;  1Q82 R;  4OMF B;  5GAN d;  4ZN3 A;  1X69 A;  5A0D A;  3OYG A;  3OYY A;  1X2Q A;  2JM9 A;  2OTJ Q;  2RQT A;  2VXF A;  3JAM E;  3FDR A;  5GAN 3;  4C8Q B;  5KYU B;  4GLM A;  4A4F A;  2HL3 A;  5KYN A;  1ZA2 B;  3EG0 A;  4C92 F;  3M58 A;  5A2Q E;  3EH2 A;  1KSW A;  3FIF A;  1X43 A;  1K9M U;  3CME A;  4E7L A;  4M78 B;  3A5Z B;  3I56 Q;  4M75 A;  4KGZ B;  3CEY A;  2GTO A;  3CCS Q;  2RO0 A;  1BBZ A;  2HBW A;  4II1 A;  4ORZ A;  3E19 A;  4EMK C;  5CKH A;  1NLO C;  1OYX A;  1YIT Q;  1W2B P;  4IUR A;  4X34 A;  2KXC A;  3JB9 D;  1BI2 A;  1S72 T;  2LQN A;  4M7D G;  4LUD A;  2QAS A;  2RI3 A;  4LDX A;  2WSC E;  2YXY A;  3DLM A;  2B8A A;  2F2W A;  3R6O A;  2E3I A;  2RPN A;  1OOT A;  2V8K A;  4XAX B;  4JJD A;  3G6E T;  1QVG P;  1BKB A;  2RJC A;  3QO3 A;  1OQK A;  4LUE A;  3V8L A;  3C12 A;  2OAW A;  1SSF A;  2OTL A;  1YFN A;  3CME T;  1MND A;  2DD5 A;  1G5V A;  4J9H A;  3T9N A;  4HT8 A;  3SFM A;  3BY7 A;  3A8O B;  4C92 E;  4C8Q A;  2RQR A;  1NPR A;  5KYU A;  2HD0 A;  2ED0 A;  1X01 A;  4F7U E;  4M78 A;  2CYZ B;  3A98 A;  2F2V A;  3URG A;  1A0N B;  1KC8 U;  1KD1 R;  2RI2 A;  5J39 A;  2MIO A;  1D3B B;  2CZ0 B;  1D1B A;  3X26 B;  4DOW A;  5L8R E;  4J9B A;  2DL4 A;  2CH4 A;  1VQ5 A;  2G3R A;  5IT9 E;  1GCP A;  4M7D D;  3LW5 E;  3JRZ A;  2DO3 A;  1Y96 B;  2RJD A;  2KRM A;  3MP8 A;  4J6Y A;  3TSW A;  4J9E A;  1YI2 Q;  3E2U A;  1CSK A;  4BB7 A;  1RL2 A;  2E65 A;  5GAN 4;  3CCV Q;  1M27 C;  1JJ2 S;  3V7S A;  2OTL T;  5LJ5 h;  1VYU A;  2DXB A;  1AOJ A;  1YIJ Q;  1X6G A;  2E41 A;  3OSS C;  4OP0 A;  1Y0M A;  4F04 B;  5LJ3 d;  2PU9 B;  3VS6 A;  1JU5 C;  1PSE A;  1BI0 A;  5IHK A;  2HZY A;  1T3L A;  2K7A A;  3GNF B;  3DKM A;  2MOX A;  3I5S A;  1N6A A;  2DTI A;  2L3P A;  4R0K A;  4OF1 A;  2CZ1 B;  3LH0 A;  1MV3 A;  2J05 A;  3OW2 A;  3OYE A;  3QII A;  4HCZ A;  1KJW A;  2DBM A;  1UFF A;  1VQ5 T;  4FU6 A;  2QQS A;  2ZGW A;  3JCM b;  2KBT A;  4B9X A;  4X1V A;  3QJ6 A;  4QVC A;  2DL7 A;  2X4X A;  2JM8 A;  1D3B A;  1QKX A;  2XIC A;  3THK A;  1I4K 1;  2NUP B;  3SWN C;  4N4G A;  2XDD A;  2L3Q A;  5CKB A;  1Y96 A;  3G71 A;  2GF7 A;  1YJN A;  2MK5 A;  4C5I A;  2YDL A;  1NBE B;  3V8J A;  3MEV A;  2XMF A;  3NFC A;  4D8K A;  4ATO A;  1ABO A;  3UDC A;  3ZFJ A;  5FU6 B;  1MNE A;  3LYI A;  4E7I A;  4MDW A;  2O4X B;  3X20 B;  1D0Z A;  5ECA A;  2MPX C;  2L8D A;  2WAC A;  3L2W A;  2J6F A;  3TVT A;  2IG0 A;  3QPH A;  3SEM A;  1VQM A;  3RMS A;  3UT1 A;  2D1X A;  2E5K A;  4M7A D;  2RHI A;  2EBP A;  2OJ2 A;  4DBQ A;  3FEO A;  4QQ6 A;  4F17 A;  1M2V B;  5GJW B;  3V8K A;  2BZX A;  2M0Y A;  3TRE A;  2CSI A;  2HQX A;  3CCL Q;  4EMG A;  5CKE A;  1M1K C;  4C0Z A;  2EKH A;  5KYY B;  1G3T A;  3WVE B;  5LJ3 e;  3G71 T;  3M0U A;  2HMA A;  3CPW A;  1SSH A;  3PVQ A;  1YJN T;  2QK0 A;  2A37 A;  2HKQ B;  2NUP A;  4M4Z A;  2ROT A;  1K8A R;  4XU3 A;  2DXC A;  4XTV A;  1GL5 A;  2F1L A;  4CC3 A;  2YLC A;  3OW2 S;  3GNG A;  5FRN A;  2D0Q B;  1OZ2 A;  2DVE A;  5FW9 A;  2LRQ A;  2QYZ A;  4J6W A;  2OTJ A;  4ZGD B;  1VQ8 Q;  1SF9 A;  4DA4 A;  4FW1 A;  1TTH B;  4A4K A;  2RN8 A;  1K9M R;  3HRU A;  2O4X A;  2EWN A;  5LJ5 g;  4KUD K;  4YTL A;  1RAG B;  1TXQ A;  4HVV A;  1RAA B;  2CH4 W;  1QCO A;  4FSS A;  2DIQ A;  2JTM A;  2BIV A;  3VS0 A;  2AHJ B;  5FU7 B;  1M2V A;  4PJJ A;  3FJ5 A;  1VQ7 A;  3CCJ T;  1YIT A;  2J7I A;  4GLK A;  5KYY A;  3E9F A;  4ANJ A;  4C92 C;  3EHQ A;  4M7D F;  5GAO m;  3J80 E;  4QW2 A;  4DEY A;  1ZUK A;  2H8H A;  3L2U A;  1YHQ Q;  2P0K A;  2EJ9 A;  4FYY B;  3LGL A;  2RI5 A;  3I55 T;  1TG0 A;  2ABL A;  1NYF A;  3CXC P;  2H3E B;  3CC2 Q;  4QVZ A;  2A08 A;  1UEB A;  2IPO B;  4FSX A;  3EG9 B;  3HL8 A;  2CP2 A;  3PE0 A;  4MML A;  2B86 A;  1HSQ A;  3HFN A;  4B6M A;  4RG8 A;  2L5Q A;  3HSB A;  1WLP B;  2A36 A;  1VQ9 Q;  1CKA A;  5GAO p;  1ZSZ B;  4Y92 A;  2EYQ A;  4Y28 E;  1KC8 R;  2DFU A;  5CVI A;  1VQ7 T;  2COW A;  3V7R A;  3UA7 A;  1AVZ C;  1ZUU A;  4C0G A;  1G83 A;  1D1C A;  1K0S A;  2AK5 A;  4LDY A;  2DPP B;  1VUB A;  1YBY A;  1M1K U;  1WHL A;  4HCB A;  5LL6 S;  1VQP T;  2FZG B;  1ZX6 A;  3H0F A;  4BD3 A;  3OB9 A;  2KRO A;  5J26 A;  2ATC B;  2DJQ A;  1LCK A;  1N27 A;  1ZUY A;  2DNU A;  4D6W A;  2YLB A;  1VIE A;  3MPU B;  1V1C A;  4RKU E;  3CMA T;  1Q95 G;  1VYT A;  3EG9 A;  3G4S A;  4Z88 A;  4E7H A;  2CUD A;  3AT1 B;  2O2O A;  1D0Y A;  2E3H A;  2CP7 A;  2FG0 A;  1ZSZ A;  1PD0 A;  4M7A F;  4WCI A;  1SHG A;  1KFZ A;  2EFI A;  3HRT A;  3FLG A;  4KBM B;  1WHG A;  3I5R A;  3M9Q A;  2IIM A;  2W10 A;  2F69 A;  2DBK A;  4IUT A;  3CBO A;  1QLY A;  1C1A A;  2FYK A;  2EGA A;  2XU8 A;  2QXF A;  5KYX B;  2VV5 A;  3C94 A;  3JB9 H;  1WXB A;  1BI3 A;  1YN8 A;  1E7O A;  2K4Y A;  3CCQ A;  2VGN A;  3G4S T;  4QKU A;  1FYN A;  1U5S A;  1OU9 A;  5GMK e;  5I2M A;  1WXT A;  3M4G A;  1WHK A;  2MMP A;  4VUB A;  2DEU A;  4ZN1 A;  4OGE A;  2DZC A;  1OU8 A;  2DAQ A;  4E7J A;  2X51 A;  3CQT A;  3QYG B;  2XK0 A;  4LD6 A;  4HCK A;  2K57 A;  4M7A E;  3H6Z A;  5I11 A;  4OMP A;  1QWF A;  2X4Y A;  1SRL A;  2DL5 A;  2J06 A;  2JJ9 A;  2YT6 A;  2KVQ G;  4OMN A;  3QBY A;  2BE9 B;  4XTX A;  3GLX A;  3L2R A;  5GAO n;  1N8R R;  3OSV A;  3CCL A;  3OY9 A;  1NEB A;  3OYC A;  1IXD A;  3CC7 Q;  1NYG A;  2LVM A;  4ZNX A;  3JCM d;  3MCA B;  3PMI A;  1E6G A;  1JEG A;  4RTX A;  2EJG A;  3H0I A;  4ELY C;  4M77 G;  3CCQ T;  4UC4 A;  5FLX E;  5KYX A;  4O5V A;  4JLG A;  1OI1 A;  3MEU A;  2HSP A;  2FZC B;  2FRY A;  2K6D A;  3X28 B;  4J7I A;  5IN1 A;  3QWX X;  2GBQ A;  2FL7 A;  2YWW A;  1Y57 A;  2M16 A;  1PCX A;  1UGP B;  2QQA A;  5GAO q;  4E7K A;  2SRC A;  2VWF A;  1SHF A;  1K73 C;  1T3S A;  4MMK A;  3QKJ A;  2YSQ A;  1PG5 B;  2HBP A;  3PGG A;  3CC4 T;  2M02 A;  3QHS A;  2G6F X;  5C6S A;  2JVV A;  2QA4 Q;  1AD5 A;  3QJY A;  1X27 A;  3UAT A;  4M77 B;  2HCK A;  2ZPI B;  4M75 D;  1U1T A;  2AKL A;  2DE0 X;  5HKC A;  4M77 D;  5IHI A;  1M8M A;  3M5A A;  4BE1 A;  1W2B S;  1YJW A;  2LC4 A;  1OPK A;  3EG2 A;  2LJ1 A;  3CC2 A;  4C0F A;  4NS5 A;  2PVG B;  5IH2 A;  2L2P A;  2ZCF B;  1WHH A;  2K5I A;  2DVJ A;  4M7D C;  1V76 A;  5GMK l;  1Z9Q A;  2LTO A;  2LCC A;  4HT9 A;  1LVK A;  3RNJ A;  1XOV A;  1QVG S;  3JCM e;  1VQ9 A;  3QG1 A;  3TU4 K;  4AFQ C;  2K3B A;  4QT7 A;  3DB3 A;  5AYF A;  4BY6 C;  2ZZD A;  3M55 A;  2VC8 A;  1KQS P;  1YCS B;  1JJ2 A;  1G3S A;  4C8Q D;  2DM1 A;  3EFO B;  1C0M A;  5GAN j;  2FVU A;  1M1K R;  4M77 A;  2CZ6 B;  4M78 D;  2FZK B;  5HY6 A;  1YJW T;  4F14 A;  1IHV A;  1IO6 A;  4A4E A;  2XKO C;  4MZT A;  2NUT B;  4FL6 A;  3BDU A;  3VV0 A;  1VQ6 Q;  3TEE A;  1GRI A;  3S3O A;  1FWZ A;  2KEA A;  4HVU A;  4HCC A;  4FT4 A;  1I5O B;  4N0A C;  4PJO F;  1MUZ A;  2YUN A;  2D8H A;  2P4T A;  3RES A;  1U3O A;  1VQ9 T;  1M1G A;  1WXU A;  3EG1 A;  3CPF A;  4XU1 A;  2JW4 A;  2QTV A;  5DLO A;  1EFN A;  1RI0 A;  1G3Y A;  2FHD A;  2ZPH B;  1HXD A;  2AKK A;  2EQK A;  2RHY A;  4ZGJ B;  2KRS A;  4RCC A;  4J8O A;  4ESR A;  1K73 U;  3V7C A;  2KE9 A;  1GXI E;  4ZTF A;  1BB9 A;  3HRS A;  2V1Q A;  3JCM c;  2RQW A;  4KGX B;  3TQ7 P;  2QI2 A;  4JLI A;  1W6X A;  3EFO A;  5C0M A;  2CP3 A;  2DEQ A;  5GAN e;  1LNX A;  2R57 A;  4PLL A;  2A3L A;  3M53 A;  3PVL A;  2HSE B;  4M7A C;  4XU2 A;  2OI3 A;  1G8X A;  3IQL A;  5CKF A;  4C0D B;  1QVF P;  4FM4 B;  2NUT A;  2PVD B;  4OB1 B;  2FPE A;  1WNL A;  4PJO E;  1LPL A;  3GIB A;  2W0Z A;  1AEY A;  2F5K A;  2EYY A;  4IUQ A;  1W4S A;  4IUU A;  3OYL A;  2RH2 A;  2LMJ A;  1T0J A;  2PUO B;  4IUV A;  1M8V A;  1GCQ C;  1WZO A;  3CCE Q;  3OYF A;  1R0B G;  4PLI A;  2DL8 A;  2ED1 A;  1H3H A;  2EJF A;  2ZPF B;  2RA2 A;  4RUG A;  4KH0 B;  3JCM W;  2VYT A;  2EGE A;  1VQO Q;  5CR2 A;  3OYM A;  2AT1 B;  3UPU A;  1XTD A;  2FRW A;  1NJI C;  2YHT A;  1VQL Q;  4RTY A;  4EMK B;  1QCF A;  1U1S A;  4BUG A;  2EAY A;  3VS5 A;  4M75 F;  5LJ3 j;  3LWH A;  4BE0 A;  4JPB W;  3M0T A;  4WTO B;  3SD4 A;  3NGP A;  3AHU A;  4M77 F;  3ULR B;  3CCM Q;  3RKW A;  3PIP A;  2XDP A;  3CD6 Q;  5HCK A;  4JRP A;  3M4Y A;  3NTH A;  1R8O B;  2E4H A;  2FPF A;  4LN2 A;  3G1J A;  5IXF A;  2EQU A;  1XJW B;  4OMM A;  1VQK Q;  1JRI A;  2ESW A;  3L2Q A;  2CT4 A;  3RMQ A;  3A1P A;  2BZY A;  3ZEH A;  1RAH B;  2EVR A;  4PK4 A;  2QEX Q;  1YJ9 A;  2HAX A;  2RK1 A;  2RF0 A;  4DBF A;  1HD3 A;  2P0P A;  2VAS A;  1M2O A;  4OMO A;  1VQ4 A;  4AMC A;  3PNW C;  5GAN f;  4AFU C;  1VOM A;  4X9C A;  1B7T A;  1YWO A;  5GMK h;  2M51 A;  3JCM X;  2QDL A;  5D6X A;  1QCN A;  4AG1 C;  4V2S A;  1UEC A;  4C8Q F;  1UGV A;  3VUB A;  4M75 E;  3H41 A;  3OYN A;  1Q7Y R;  5J3B A;  4WF2 A;  2NUZ A;  4EMK A;  3VU3 C;  2KDS A;  4M78 F;  4BI4 A;  2CP6 A;  2KT1 A;  2KY9 A;  1ABQ A;  2KR3 A;  2GFU A;  3VS2 A;  4XTZ A;  1QQJ A;  1SPK A;  2ZPB B;  3GPL A;  3JB9 F;  4AFZ C;  2CKK A;  3F70 A;  1YJ9 T;  1VIF A;  1FX7 A;  5KCO A;  2D9T A;  1MMN A;  5L23 A;  4ELZ C;  5CO7 A;  4Z89 A;  1UHC A;  1RLQ C;  1W70 A;  5A0G A;  1VQN Q;  2EYZ A;  1VQ4 T;  3L2Z A;  3CXC S;  2OX7 A;  1VQM T;  3OMC A;  1JB0 E;  3FB9 A;  3MKD A;  1AZE A;  4J9D A;  2E6Z A;  3MP1 A;  3MEA A;  3OYH A;  3PT9 A;  5CIU A;  1AWX A;  2VXE A;  2J6K A;  5GAN 7;  4C8Q E;  3H8Z A;  2LZ6 B;  3I56 A;  3CCR Q;  4HVW A;  1O9S A;  1TSF A;  2DIL A;  5LJ5 d;  1WIE A;  3CCS A;  1NJI U;  4M78 E;  2YRC A;  4PFO A;  4FT2 A;  3SWN B;  2RHX A;  2DRM A;  3S3M A;  3X25 B;  3H0H A;  5I2S A;  4D8D A;  2KT8 A;  5GAM d;  1VQ6 A;  3OS5 A;  1QP3 A;  1NG2 A;  3VYH B;  4MDX A;  3L42 A;  4O6J A;  4JRQ A;  2QDY B;  1GFD A;  1QW1 A;  3QDR B;  4PNO A;  2OTJ T;  5GMK i;  3HFO A;  3KBG A;  1T0H A;  1H8K A;  2HKN A;  1OX8 A;  1R77 A;  4LE9 A;  1K73 R;  2ZPG B;  5D6W A;  2QTX A;  1EX4 A;  3OS1 A;  3I56 T;  2BTT A;  3BFM A;  5GAM j;  4R55 A;  4PJO C;  1WA7 A;  5LJ3 f;  3RKY A;  3L2V A;  3CCS T;  1UGR B;  3QYH B;  1S72 Q;  4AT1 B;  2JS0 A;  1YIT T;  1NPP A;  2RNA A;  1WQ7 A;  1VQ6 T;  1M5Q 1;  2DRK A;  1UDL A;  1UUE A;  5D7U A;  3OYJ A;  2EQM A;  2C06 A;  3SWN A;  4M7D E;  1Y71 A;  3G6E Q;  3QUI A;  1ZQ1 A;  1SKU B;  1HYO A;  4PFP A;  4NL3 A;  3MP6 A;  3NMZ C;  3MEW A;  2E5Q A;  2O9S A;  1YI2 A;  4C92 G;  3BE3 A;  2LQW A;  3JSC A;  3CCV A;  1SEM A;  5IAY A;  2AZV A;  4RTU A;  5EC7 A;  1NM7 A;  3TCJ A;  1Q81 C;  5GMK j;  1YIJ A;  3BDL A;  2KRN A;  3QDF A;  4F7U G;  2QQR A;  3RKX A;  5HK3 A;  1PSF A;  5LJ5 e;  4DBR A;  1WYX A;  4CI0 C;  2M9U A;  4JRI A;  5KCH A;  2LX9 A;  2ZPE B;  3KUF A;  2GNC A;  2V26 A;  3MHX A;  5GAM e;  2KSS A;  3ASK A;  1VQL A;  2DXU A;  1W1F A;  3OBW A;  4LD9 K;  1JQQ A;  2CUB A;  1K0X A;  2GTJ A;  3PMT A;  2ECZ A;  2M0O A;  4QQG A;  3CPW P;  1QMC A;  3E1S A;  1WGS A;  4C92 B;  3JV3 A;  1YI2 T;  2COZ A;  4JS5 A;  3CCV T;  3EG3 A;  3O8V A;  1RI9 A;  2PUK B;  2NWM A;  4C92 D;  1M3C A;  4PKC C;  2X3X D;  4F7U B;  1YIJ T;  4N4H A;  4LXC A;  3RDV A;  1VQK A;  3OQ5 A;  4LDW A;  2FB7 A;  4RTW A;  1RUW A;  1KQ1 A;  2K3X A;  2L0A A;  2JT4 A;  5GAN h;  4M75 C;  2JUF A;  3GP8 A;  2L89 A;  3EGD B;  5AT1 B;  1EZZ B;  1KHI A;  4TVR A;  1K76 A;  4A53 A;  5HK0 A;  4AG2 C;  3UF4 A;  4ZGE B;  1VQ5 Q;  1K4U S;  3CCU Q;  1ARK A;  3VS3 A;  4L59 A;  2MI6 A;  2CT3 A;  2M1H A;  1W2B A;  2RK2 A;  1FMK A;  2JS2 A;  2EGC A;  4KH1 B;  2C0O A;  1BI1 A;  2EYX A;  3QWY A;  2E10 A;  1M3B A;  1AWJ A;  1LOJ A;  4MZM A;  2MCN A;  1Z9Z A;  2LDM A;  2GQV A;  4JRK A;  7AT1 B;  2LT4 A;  1QVG A;  4C92 A;  3NPF A;  1KQ2 A;  4CRI A;  1KIK A;  4FIB A;  2KQW A;  4C8Q C;  5GAN 8;  2DL3 A;  4F7U A;  3M57 A;  4XQ3 A;  2BE7 D;  5IHN A;  1OZ3 A;  4Z8A A;  4A4G A;  4M78 C;  4FW2 A;  2ROL A;  3EGD A;  4QQD A;  1VA7 A;  1Q81 U;  2RB6 A;  3PIO A;  1VQ8 A;  4IIM A;  2DKG A;  1MHN A;  2C0T A;  5CAI A;  3RER A;  4RTZ A;  5A0L A;  1FMW A;  3G71 Q;  3CCL T;  3ZBD A;  1BU1 A;  3A8M B;  3HPW A;  4ME7 A;  1N9S A;  1S1N A;  3SB2 A;  4LDV A;  1KQS S;  3EHR A;  2NYS A;  3M0Q A;  2BZ8 A;  3CBM A;  4IKF A;  1H3Z A;  4BI8 B;  5GAO l;  3UA6 A;  4EMH A;  2D6F A;  4OMQ A;  2OAU A;  2V8I A;  2ENM A;  1G3W A;  4A63 B;  5GAO r;  9ATC B;  4FCY A;  1Y7X A;  1AHJ B;  4GBQ A;  1C6V X;  1YHQ A;  5D6Y A;  1WI7 A;  1HJD A;  2PNI A;  3M0R A;  8ATC B;  1VQ8 T;  2YUQ A;  1R0C B;  3GOX A;  1BCM A;  3C0C A;  5LJ3 h;  2RMO A;  4XTY A;  4J83 A;  2XD0 A;  3MJX A;  2L3R A;  1GFC A;  1I1J A;  2QG9 B;  2Y90 A;  2JN0 A;  2V8J A;  2VKN A;  4JZ3 A;  4KRT A;  5CKD A;  5GAN g;  3M56 A;  1GBQ A;  1WHJ A;  3CCJ Q;  2DIG A;  2VB6 A;  1PKT A;  4BI3 A;  1RAC B;  5CK9 A;  4K11 A;  2EPD A;  3QXE B;  1DJ7 B;  1S72 A;  4Q5W A;  1MMA A;  2RHU A;  1Q86 C;  4FYW B;  2XHC A;  2K2V A;  4EDU A;  4BDY A;  3FRN A;  2Y4X A;  1M90 C;  1ZBJ A;  3I55 Q;  1CKB A;  2CDT A;  2JZ2 A;  5DLQ E;  4E47 A;  1YHQ T;  2MWP A;  3G6E A;  1O75 A;  1H64 1;  2GCX A;  4JZ4 A;  2JXB A;  1ZHI A;  4A54 A;  3RBB B;  3CC2 T;  1PKS A;  3O5Z A;  3JB9 J;  4L6V 5;  3NTI A;  4J9G A;  2MYS A;  1QVF S;  2R5M A;  3LGF A;  2VUB A;  4F7U F;  2F2X A;  2HEQ A;  3G7Z A;  1I07 A;  3PTA A;  1VQ7 Q;  4HKE A;  1BIA A;  2XDB A;  2KK4 A;  2O01 E;  3ER0 A;  3JB9 I;  4DOV A;  5DM7 R;  1AWW A;  1X75 C;  2D8J A;  1QWE A;  1QVP A;  2R58 A;  4OGC A;  2AIR B;  4JUV A;  2P0Q A;  1VQP Q;  1NLP C;  3HP9 A;  4QVD A;  4KUL A;  2E6N A;  5GAN 5;  2IVW A;  4RG2 A;  5GJV B;  4OML A;  3HKS A;  1BCO A;  2LNH B;  3EFS A;  4PJL A;  1MMG A;  2CZ7 B;  2DLP A;  2DF6 A;  2QGG A;  5FU6 C;  2Z0W A;  3VRY A;  3X24 B;  2DD4 A;  4EIK A;  2DA9 A;  2XID A;  1P92 A;  1RAB B;  3CMA Q;  3OYI A;  4C5H A;  3A8G B;  2Y4Y A;  3JCM f;  4KT0 E;  2DJZ A;  4B9W A;  2KYM A;  3R6N A;  1N8R C;  2A7Y A;  4M7D B;  1XQH A;  1RAF B;  2WSE E;  5CQY A;  4PJM A;  1IB8 A;  1U06 A;  3P8H A;  2DTH A;  3CCU A;  2QAZ A;  1LJO A;  4JS4 A;  3NHN A;  4J6X A;  4KUI A;  3BW1 A;  4MZP A;  4BY6 B;  5LJ3 g;  1ZSG A;  3JCM P;  5GAN 6;  3GBQ A;  1MMD A;  2E64 A;  4A4H A;  2DZ9 A;  3EH1 A;  1AZG B;  3EAE A;  3HHT B;  1IHW A;  2EYW A;  2X35 A;  2RQV A;  2EQJ A;  3CC7 A;  3I35 A;  3CXC A;  3N5B B;  2KGT A;  1Q86 U;  1IRE B;  4RMO A;  1TS9 A;  5KYW B;  5GAM h;  5IXB A;  4DQ2 A;  3G4S Q;  3TSZ A;  1M1F A;  2F5T X;  1M90 U;  1JO8 A;  1QP2 A;  2JMC A;  1I81 A;  3OYA A;  2MAM A;  2FPD A;  2JOY A;  4M7A G;  1BYM A;  2I0N A;  3PFS A;  3VJP A;  3CCU T;  3H9N A;  1Q81 R;  3EGU A;  1NEG A;  2E12 A;  2BKD N;  1SG5 A;  4M7D A;  5FU7 C;  1WJR A;  4J9F A;  4FYX B;  2YRV A;  3FC3 A;  5FWC A;  1RAE B;  1BK2 A;  2LJ3 A;  2PTK A;  5KH6 A;  2DK3 A;  1JJ2 P;  1BIB A;  2E1H A;  3CC7 T;  1JXO A;  3VRZ A;  2DTO A;  2MWO A;  2DET A;  1K9A A;  3JCM V;  2QA4 A;  1TU0 B;  3CCQ Q;  1RLP C;  4C5E A;  3HTR A;  1Q82 C;  1UGQ B;  3OYK A;  4XU0 A;  4NOY A;  4M77 E;  4M7A B;  3A8H B;  2KNB B;  4LNP A;  3EFR A;  1M9S A;  2VGM A;  5KYW A;  3D7S B;  4RTT A;  4HA8 A;  1UG1 A;  1ZSZ C;  2J6O A;  3LLR A;  4IIO A;  4AFS C;  4N0A A;  5KE2 A;  3ME9 A;  2HL5 C;  1X6O A;  2RJE A;  1B07 A;  3CC4 Q;  4P5N A;  2V1R A;  3C95 A;  3KXT A;  1N8R U;  2P84 A;  4GY5 A;  2CSQ A;  4HXJ A;  1N5Z A;  4F16 A;  4CC2 A;  1JBM A;  1UB4 A;  1D1A A;  3FJP A;  2QA4 T;  4EPC A;  3CCJ A;  1K1Z A;  5CQX A;  1UJ0 A;  4N4I A;  4LDU A;  1JXM A;  4Y91 A;  2LT1 A;  4R56 A;  1WJQ A;  4E2F B;  4ZTJ A;  3OS0 A;  4CC4 B;  4E7S A;  2LJ0 A;  2RHZ A;  1QKW A;  1D0X A;  3I55 A;  2X4W A;  4OB3 B;  2K79 A;  1HK9 A;  2EIF A;  2L3S A;  1TUC A;  4M7A A;  1TWB A;  4PJN A;  2ZAE A;  2FEI A;  2DX1 A;  1V29 B;  2NLU A;  4CC7 A;  1NE8 A;  2LX7 A;  3VS1 A;  1WHM A;  1VYV A;  3VS7 A;  3LWI A;  2O31 A;  2SEM A;  2DXT A;  3MO8 A;  3JCM Q;  5GAM g;  1AWO A;  3ZL7 C;  1F1B B;  2C0I A;  1PWT A;  4J9I A;  2KI7 A;  2CRE A;  5LJ5 j;  1KD1 C;  4JJN K;  3WXM B;  1PRL C;  1GCQ A;  1PNJ A;  4E6R A;  5M9O A;  2DYI A;  4Z02 A;  2K9G A;  3M0P A;  1ZBX A;  1X6B A;  5KE3 A;  2LCL A;  3OW2 P;  3NTK A;  2MF2 A;  1YJW Q;  2H3J A;  2LP5 A;  3DLL A;  8AT1 B;  1VQP A;  2CP5 A;  1PHT A;  1D09 B;  2GGR A;  5DY9 A;  3M59 A;  3J81 E;  3QZ5 B;  1WPY A;  3JCM h;  2GFA A;  4J7F A;  1Q82 U;  3CBP A;  1UGS B;  3MET A;  3Q1J A;  1SRM A;  3CPW S;  5GMK m;  3OYD A;  3CMA A;  4E7Z A;  1GBR A;  2CP0 A;  1WX6 A;  4FYV B;  1EIF A;  4DEX A;  2CS7 A;  2VVK A;  3VYG A;  1YP5 A;  2DYB A;  1UE9 A;  3CME Q;  3S6W A;  2DMO A;  3VS4 A;  4BDZ A;  1YNZ A;  1WDX A;  4BAC A;  1J3T A;  4J9C A;  3CCE A;  1I0C A;  1WJS A;  1KG1 A;  3KFV A;  1M3A A;  3LX7 A;  4RTV A;  4XTW A;  1TUG B;  1G2B A;  2EW3 A;  2PQW A;  2A28 A;  2KAF A;  1OV3 A;  1I8F A;  1VQO A;  2LCS A;  3REA B;  2HQH A;  1KHC A;  3VKI A;  4IUP A;  3M54 A;  2JTE A;  4PJO G;  4JJB A;  1Q86 R;  1OPL A; 
#chains in the Genus database with same CATH homology
 3I56 Q;  2QEX Q;  1QVF P;  3CMA Q;  3G4S Q;  3OW2 P;  1M90 R;  1VQP Q;  3CCM Q;  1M1K R;  1VQ4 Q;  1Q7Y R;  3CCS Q;  1VQ5 Q;  3G6E Q;  3CCR Q;  3CC4 Q;  3CCL Q;  1YI2 Q;  3CPW P;  1YJW Q;  1YHQ Q;  1VQN Q;  3I55 Q;  2OTJ Q;  3CD6 Q;  3G71 Q;  1VQO Q;  1VQM Q;  3CCV Q;  1N8R R;  2OTL Q;  1QVG P;  1VQ7 Q;  1KC8 R;  3CC7 Q;  1KD1 R;  1YIT Q;  1W2B P;  1NJI R;  1JJ2 P;  1YJN Q;  3CXC P;  2QA4 Q;  3CCJ Q;  3CCU Q;  3CC2 Q;  1S72 Q;  1VQ8 Q;  1YIJ Q;  1VQK Q;  3CME Q;  1Q81 R;  1VQL Q;  1YJ9 Q;  1KQS P;  1K9M R;  1K8A R;  1VQ6 Q;  3CCQ Q;  3CCE Q;  1Q82 R;  1K73 R;  1Q86 R;  1VQ9 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...