1YJNQ

Crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1yjnQ00
3CCQQ 1VQLQ 3CCMQ 3G71Q 2QEXQ 1VQOQ 1K8AR 3G6EQ 3CCLQ 1VQMQ 1YHQQ 1Q82R 1KC8R 1KD1R 1K9MR 1VQ7Q 3I55Q 1YJNQ 1K73R 2OTJQ 3G4SQ 3OW2P 3CXCP 1YITQ 3I56Q 1VQ5Q 1M1KR 3CMAQ 1VQKQ 3CCEQ 3CCRQ 1QVGP 3CCUQ 3CC7Q 1VQ6Q 3CD6Q 1VQ8Q 1VQ9Q 1Q7YR 2OTLQ 1JJ2P 3CCSQ 1M90R 1VQ4Q 3CC2Q 3CC4Q 1Q86R 2QA4Q 1YI2Q 3CPWP 1VQNQ 3CCJQ 1KQSP 1N8RR 1S72Q 3CCVQ 1W2BP 1Q81R 1YIJQ 1NJIR 1YJ9Q 1VQPQ 3CMEQ 1QVFP 1YJWQ
chains in the Genus database with same CATH superfamily
2A28A 1ACMB 2JN0A 3CCLA 5LL6S 3Q1JA 1R0CB 4J6XA 4LUDA 3EGXA 3VS1A 2DYIA 3M57A 5KYYA 2QASA 1HK9A 2K57A 1VQ4Q 1R77A 2P0QA 3EG1A 1QVPA 5FU6B 3JCMW 1M27C 2A0FB 1C0MA 4Y92A 1IGUA 2AZVA 4C8QB 1K0XA 3MP6A 5KYWA 3SWNB 3OW2A 2FEIA 1HSQA 4OMFB 2V8JA 4RTVA 2COYA 2DO3A 2DF6A 1YJ9A 2WSEE 4IIMA 1IB8A 3META 1VQPQ 3X20B 1WI7A 1VQMA 3FDRA 4XTWA 4WTOB 3I56A 4D6WA 3NTKA 4QQDA 1VQ7A 4R0KA 4J9FA 1D1AA 1KG1A 3OYHA 1WHLA 3C94A 3M5AA 2E1HA 3VS0A 1Q86C 3V8KA 2P0KA 4C8QE 1UGPB 3G4ST 2YDLA 3CCEA 1BIBA 1FMWA 3HTRA 1MNEA 2D8HA 1M2OA 1U3OA 1Y7XA 3QKJA 2HL3A 1Y07A 2DAQA 3GNFB 4RCCA 2FRWA 1LVKA 2BTTA 1WJSA 3P8HA 3C95A 4IUUA 4AG2C 4E7JA 4ZTJA 2CSIA 4C92F 3P8DA 3TVTA 2FL7A 1KC8R 1H92A 3PMTA 4PJNA 3OW2P 1JO8A 3CXCA 2L3PA 2E64A 4PJOF 3QZ9B 2DD4A 4HVUA 2DRKA 4P5NA 1EZZB 2BZ8A 2H3EB 5FLXE 2X4YA 3CCST 1QVFA 3OYLA 3UWNA 2K3BA 1VIFA 3CCVQ 1YWOA 2DK3A 1M2VA 2E6NA 3NTHA 2EIFA 4J7IA 4AT1B 2EQIA 4R56A 2YT6A 4B6MA 2RI3A 1G5VA 3JCMJ 2OAUA 1YWPA 5A0LA 3HP9A 3CC4Q 3E9FA 4V2SA 1P92A 4PJOD 1N8RR 4M78A 2RHUA 3E2UA 2YRDA 4CI0C 1MHNA 4HT9A 4PJOC 2BZYA 3VYHB 3FJ5A 3I55Q 2HDAA 4JLGA 3M0UA 2Y90A 1W2BS 2CGHA 4RTYA 3CCRQ 1K73C 2YSQA 3QWYA 1ZSZA 4LDYA 5FW9A 1S72A 3JCMe 3M4GA 2PTKA 5CAIA 2OTJA 3JB9H 3QJ6A 1YJ9T 2M9UA 2DL3A 3JCMh 4C8QG 4CC3A 1VA7A 4O6JA 1YJNQ 4NL2A 4JJNK 2J6KA 4HVWA 2MK5A 2IVWA 3URGA 5D6XA 3UT1A 4HXJA 2PVGB 4N0AA 3EHRA 1ZA1B 5C0MA 1X43A 1YITA 1QKWA 4CC4B 2KRNA 5GAMh 2RMOA 2LZ6B 2HBPA 2B8AA 3MEAA 2CP2A 4QKUA 1VQ5Q 1RL2A 2HBWA 5CR2A 1UB4A 1SKUB 1N27A 3GIBA 2DEQA 3A5ZB 3JB9F 1AZEA 1Y71A 5GAN5 1WQ7A 3X28B 5GAN3 2DYBA 1UEBA 4K11A 4M7AB 2OAWA 5KYYB 2EQJA 3HRUA 3I56Q 4XU0A 4M77F 4M7DE 4E7KA 2AKKA 2JOYA 2PU9B 4OMLA 2E41A 2DFUA 2EGAA 3M56A 1GBRA 1X6GA 4CC7A 3CPWP 5GANd 2DJQA 2XIDA 3KFVA 3MEVA 1KQSS 3M4YA 3LLRA 4IUTA 1VQ7T 3JB9D 2RD1A 2FB7A 4R55A 1ABOA 1QCFA 2EW3A 1C6VX 4AG1C 4Y91A 3E9GA 4X1VA 1WQWA 4B9WA 2MIOA 4JS5A 4E7HA 2LQ8A 1KFZA 1VQNA 1AEYA 4J9EA 2DVJA 4JRPA 4A4FA 3BE3A 4HCCA 3JCMV 1UHFA 3CCMQ 3L42A 2L3SA 4JZ4A 2DJZA 1RADB 5D7UA 4M4ZA 2M1HA 1X2KA 2DMOA 1C1AA 5IN1A 4B9XA 1RAFB 3CCUQ 1WX6A 2CP6A 2KDSA 3M0SA 2EVRA 3L2WA 1Q86R 3UA7A 3JCMb 1PM3A 2C0IA 2NWMA 1G3WA 4FT4A 4JUVA 3L2ZA 1QW1A 1RACB 3I35A 1ZSGA 1FYNA 1B3QA 1YITT 2EWNA 4C0DB 3OYDA 1VQ8T 2ZGWA 1WNLA 3CC7Q 1K9MU 1JXMA 9ATCB 2DPPB 4MDWA 3DB4A 2X35A 3JCMc 1W70A 3MJXA 3I9QA 1WDXA 4BE2A 4Z02A 4E7ZA 1KC8C 2DRMA 3H0FA 5DLOA 1IO6A 3C4SA 1SRMA 2CZ7B 4J9GA 2MPXC 3QHSA 1NBEB 4KUDK 4RTXA 3FRNA 3RERA 4M7DB 4EMKB 3CCJT 1YI2Q 4M7AE 1KIKA 1PC0A 3PVQA 2K5IA 2YUOA 2X51A 4EPCA 1Y0MA 4ME7A 1JB0E 2LT1A 5J3BA 4OB2B 2EQMA 3M9QA 1MGQA 3G7ZA 2ATCB 1VQOA 3PTAA 3SDZA 1RI9A 2COWA 1Q82U 4OP0A 2QA4A 1QMCA 5LJ5d 3RMQA 5CKFA 5CIUA 4DEXA 1TG0A 2RJFA 2HKNA 1QCNA 1WLPB 4OMOA 1GCPA 1VQKQ 2F2WA 4XU2A 3OS5A 2AK5A 3CD6Q 3QWXX 2BE9B 2QYZA 1JJ2A 2OTLQ 1HD3A 2VB6A 3CC2Q 2RA2A 2XKOC 1ZHIA 1VUBA 4LE9A 4YTLA 2SEMA 1SG5A 4N4IA 2IG0A 4TVRA 1K8AC 1AWOA 2YWWA 2DL5A 3KBGA 2EJFA 1OEBA 5KYUB 5GJVB 3VS2A 4F7UB 2MWOA 4FYXB 2XI9A 2RI5A 1ZBXA 4A53A 2CH4A 1Q81C 1VQLT 3HFOA 1JEGA 1H3HA 2R5AA 4KRTA 1K8AR 4C8QF 5LJ3d 3G71T 4MDXA 4L59A 2D6FA 3JCMQ 1K76A 1KC8U 2GFUA 1I8FA 2VWFA 3GLXA 4GLMA 4M78C 1LJOA 4C5GA 2O88A 1PRMC 1I5LA 2KROA 2LTOA 1ZSZB 2DXCA 5GAMe 3VV0A 1W6XA 2E5KA 4BI8B 1B34A 4C5IA 1PCXA 1DJ7B 1K8AU 4C0GA 5I22A 3IQLA 1QVFS 2SRCA 1OZ2A 1YFNA 3I5SA 3OYAA 2MWPA 1QVGP 2LCSA 2EJ9A 2K5LA 4PL6A 4QVDA 3JCMd 8ATCB 2RHYA 5KCOA 1X27A 1QQJA 4FSSA 3VU3C 2LNVA 3VS7A 2V26A 2D9TA 2HZYA 1Q82C 5DM7R 3H6ZA 2NUTB 2PUKB 1KQSA 1O9SA 2M02A 2XK0A 2MAMA 1OULA 1VQ6Q 5HY6A 1O75A 2RJCA 3OY9A 1B34B 3CCUA 1AWJA 3RMSA 2IIMA 3PT9A 2O4XA 1M5Q1 2XU8A 1G2BA 3VS3A 2QEXA 1GCQA 3NHNA 4F7UF 4LDXA 2DBMA 1BI0A 2LNHB 4FT2A 3EG9B 1M90C 2HSEB 5GAOl 3AT1B 2JS0A 1OPLA 3HPWA 3M0QA 1B7TA 4X9DA 5L8RE 4NOYA 4C92A 3DLLA 3OYGA 5LJ3h 3RIRA 4HCZA 2I0NA 1M1KU 1ZSZC 3M0PA 3EG9A 3EFOB 1T3SA 3G4SQ 2HQHA 2DA9A 4N4HA 4C8QC 2HAXA 3OB9A 4RKUE 1YCYA 1OI1A 3X25B 2DTOA 5KE3A 3V8LA 3A8MB 2EYQA 1YHQA 4LXCA 4FW1A 5LJ3f 2M51A 2HMAA 2QA4Q 1UGQB 4OB0B 2ROLA 2XICA 4KH1B 3MO8A 1NZ9A 4M77A 1SHGA 4A4KA 3SB2A 2KRMA 3V8JA 2EPDA 2AKLA 3SFMA 2VXEA 1IREB 4DA4A 3THKA 2LJ0A 1GBQA 2PZ1A 2H8HA 3NPFA 2HQXA 2RK2A 4J6WA 4F7UG 4PJLA 1ZUYA 2X3XD 3DB3A 1M2VB 4M7AG 1G83A 1YJWT 3MP1A 4LNPA 1YIJQ 2RHZA 2YRCA 3OYCA 2RJDA 2WACA 3VRZA 1N8RU 3EGUA 5HKCA 3GP8A 3NTIA 2HD0A 2QG9B 3JCMP 1WGSA 4M77E 4PKCC 4BE0A 1YCSB 2L5QA 2HQEA 2VUBA 4GBQA 2J05A 4F17A 4M77C 1VQ9T 2KT1A 8AT1B 2RO0A 3UF4A 2FHDA 4FIBA 4LDUA 5GANh 1M3AA 4ZNXA 1VQNT 3TSZA 2GTJA 3R6OA 3WVDB 4JRIA 3LH0A 4BE1A 1VQPA 2FVUA 1RUWA 2EJGA 1E7OA 1T0JA 2EKOA 1OYXA 4M75B 2J06A 1XTDA 1NM7A 1SEMA 2ZZDA 4DBHA 1MNDA 2AIRB 1KK7A 1M90U 1A0NB 1H8KA 1KD1C 3AHUA 1BKBA 2CH4W 3PNWC 3RKXA 5GAN7 2K3XA 1WXUA 1VQMQ 4NS5A 1MMAA 4PK4A 2ZCFB 1PG5B 4FM4B 2K7AA 4M78F 2LRQA 1UE9A 2NUPA 2COZA 1BCOA 3OBYA 1UGSB 1LCKA 4C0FA 4J9CA 1KQSP 5GAMf 3LH5A 1WZOA 1YHQT 2BZXA 1KHIA 2NUPB 3QDFA 2KQWA 1JJ2S 2CZ1B 3ER0A 2RQWA 5GAOr 1M8MA 3ZFJA 2QQAA 4QVZA 2MOXA 3PGGA 5LJ5h 1VQ5T 3FB9A 2FPDA 5LJ5e 1K9MC 3LGFA 1TH7A 2MMPA 5M9OA 4KGVB 3H0IA 2VV5A 5CVIA 4M75A 1NJIR 3GPLA 4PFOA 1Q81U 1BYMA 2G3RA 1AZGB 3G6EQ 3A8GB 2CSQA 5D6YA 4C0ZA 3EH2A 3VUBA 4FYWB 1X01A 2OJ2A 2OX7A 4M7AD 3M54A 2KY9A 3OA6A 5CQYA 3OYJA 2QQ9A 3TSWA 2RHIA 4MZPA 5GAN4 4RTTA 3S6WA 5IHKA 1VQLA 1D0YA 4E7LA 2A7YA 4BY6B 4EMKA 2WSFE 2R58A 4PFPA 1SPKA 1QKXA 4FYYB 1R0BG 2O01E 4EDUA 4J9HA 3VS6A 3M58A 2WSCE 2L3QA 2GTOA 5GAOm 2V1QA 3CCMA 2LCCA 3QYGB 1JJ2P 5KE2A 2NLUA 2EYYA 4J6YA 1RAEB 4UC4A 4MZTA 1IZ6A 2HNIA 3RESA 2O2OA 4A63B 2DTIA 1Q81R 4XTVA 1OX8A 3CMEQ 3CQTA 2YUQA 2D0NA 4D8KA 3S3MA 1EFNA 4PJOA 4XTYA 4M78B 1M8VA 2OTJQ 1CSKA 3LW5E 2G6FX 3GBQA 1KD1U 1WHMA 1M1GA 3NMZC 3EH1A 1TU0B 2XG8D 1Q7YR 2D8JA 1YJWA 4KUIA 3CMAA 4J8OA 1X6OA 4XTXA 1RAAB 3QBYA 2K6DA 3MEWA 2F1LA 3SHWA 1TTHB 2E10A 2FYKA 3TEEA 1X75C 2CREA 1UJYA 1Z9QA 2W0ZA 4PJOE 5KH6A 4HVVA 3CC7T 3HKSA 3OS2A 2O31A 3M0TA 2KXCA 1N9SA 4OMQA 1NLOC 4J5YA 5GMKj 3EAEA 4OMPA 4MZMA 1WJQA 1NE8A 3EFRA 1TOVA 3CMAQ 5KYUA 3PIPA 5CCAA 1ZX6A 3TCJA 2ZPHB 2DBKA 2X4JA 1M9SA 4OVAA 5GANg 1VOMA 3CCJQ 1M4ZA 4DBFA 4RTZA 2IPOB 3CBPA 1VQ8A 1K9AA 1VQOQ 1KD1R 1IXDA 1MV3A 1D0ZA 5J39A 4CRIA 2BKDN 4BB7A 5GAOn 2DLPA 2YHTA 3CCET 1R8OB 4M75G 2YLBA 3CCSQ 4OMMA 3WVEB 3SEMA 3CCVT 3MP8A 4C92B 5GAOq 1WHKA 3L1AA 2PUOB 3A8LB 2EFIA 3I55A 2H3JA 2DD5A 1VYUA 3TQ7P 3M59A 2J7IA 2RK1A 4IUQA 3X26B 3ZL7C 2EYWA 2K9GA 5CK9A 4XQ3A 2CUBA 2OTLT 2CP7A 2O4XB 1X69A 5IHIA 2F69A 3V7SA 4BUGA 2Y4YA 5LJ3j 1PWTA 3OSSC 2P4RA 1BBZA 2RF0A 3G6EA 3I55T 1VQ7Q 2DERA 4WCIA 1B07A 4BI3A 1KQ1A 4LD6A 4M7DG 1H641 1D0XA 3OYBA 1D1CA 1N5ZA 4M7AA 2L3RA 4BY6C 4AMCA 1ZBJA 5GANj 5GMKm 1YJ9Q 2DIGA 2XD0A 1PKSA 2E5QA 1PD0A 3OQ5A 1HJDA 1U5SA 2CS7A 3JAME 2ED0A 1G8XA 2L2PA 5CKEA 4AFZC 4A4EA 4IIOA 2YRVA 4A4HA 1N6AA 1Q95G 3D7SB 3UA6A 4IURA 3R6NA 3EG3A 5A0DA 2K2VA 4A54A 1VQPT 1JRIA 2JM8A 3V7CA 4OMNA 4Z88A 1S72T 1E6GA 4KBMB 5C6SA 3CPFA 1VQ4A 2Y4XA 2R5MA 3RBBB 4DQ2A 4ZN1A 4RMOA 2X4XA 1QLYA 3LX7A 4C8QA 3EHQA 4N4GA 3V7RA 1VQ8Q 2QGGA 2I2LA 1VIEA 2Z0WA 4E2FB 4EIKA 1W1FA 3A8OB 1V1CA 2JXBA 3EFSA 3OYKA 3I56T 3NGPA 3REAB 1W2BA 4XU1A 5LJ5j 4OB1B 3ZBDA 1UGVA 2DX1A 2E6ZA 3CBMA 4DOVA 5GMKi 4M7AC 1GCQC 2KR3A 4QQ6A 2LQKA 5FRMA 3GOXA 2X9HA 4M75E 5GAN8 1OZ3A 1X6BA 2OTLA 1PD1A 2EGCA 5L23A 4EMGA 1QCOA 1NYGA 3CC7A 2XMFA 5GAMg 2XDDA 3QZ5B 2NYSA 2GF7A 1NPRA 2EGEA 4E7IA 2A3LA 1WFWA 1TUGB 2YUNA 3DLMA 3TREA 3RDVA 2FZKB 1JBMA 1G3TA 2DIQA 1YJNA 2DEUA 4OGEA 3CCQQ 4M7DD 5LJ5g 5LJ3g 4M77B 3BY7A 5CKHA 3BFMA 2DXBA 3CCLQ 2A08A 4M78E 4ZTFA 2FG0A 2ZPEB 3E1SA 3CXCS 3CCUT 3RKYA 4PLIA 1TXQA 2ED1A 1IRXA 4LDWA 2CP5A 2EQKA 2X4WA 3TU4K 4HCBA 1TSFA 2CT4A 3CC2T 1AOJA 3S3OA 1M1FA 1U1SA 1HXDA 2KE9A 3RR6A 2E12A 2BIVA 3SWNA 3VUZA 3JB9G 1WIEA 3A1PA 3OYIA 2DXUA 1EX4A 2K4YA 2KYBA 3L2VA 3NFCA 4ESRA 4BDZA 1BI1A 3CC4A 4E6RA 3HHTB 1VQ4T 3M55A 1M3BA 4FL6A 4ORZA 3BW1A 5I21A 3J80E 1KSWA 4JJCA 5I2SA 1VQLQ 5GANf 1MMNA 1K4US 1YN8A 2QTVA 1QP3A 3L2QA 5IT9E 1ZUKA 4WF2A 1UHCA 3G1JA 2EYZA 4AFQC 5EC7A 2KBTA 4FU6A 3OBWA 2DKGA 4KGZB 2V1RA 3JCMf 2KXDA 2RQUA 5GJWB 2DL4A 3MHXA 1LPLA 1J3TA 5CKBA 1UECA 2P4TA 2HL5C 1NG2A 3CCRT 5ECAA 2LX9A 2RI2A 4X9CA 4JRKA 2GFAA 2JTFA 4L6V5 3PMIA 4O5VA 2FO0A 5FU7B 1UG1A 3PE0A 3F70A 2QEXT 7AT1B 3HFNA 4EMHA 2B86A 2LX7A 1PSEA 1KJWA 2KRSA 2KT8A 3MPUB 5EG2A 1YJNT 3CD6T 4C5EA 3CPWS 2O9VA 2JZ2A 1VYVA 2KGTA 2JUFA 2ZAEA 2PNIA 1K73U 2C0OA 4RG8A 1XNIA 2LMJA 3MCAB 2VVKA 1S1NA 2FPFA 1VQKA 3JRZA 1W2BP 1M1KC 3QXEB 2XDPA 1OPKA 1YP5A 2CKKA 2HKQB 2RQTA 3OMCA 1K9MR 1YHQQ 3E19A 4GLKA 1K73R 3PFSA 3UDCA 5KCHA 4XK8E 2ZPIB 3QDRB 1XQHA 5GAMj 4LDVA 2JJ9A 4FSXA 2DILA 1M3CA 3FIFA 1Q7YU 1IHWA 5LJ3e 4E7SA 2QDLA 3MEUA 3JB9I 2KEAA 1RI0A 5GAOp 2AZSA 4KT0E 4RTWA 5AYFA 1BCMA 2OI3A 2KK4A 4NL3A 1PNJA 2R57A 4RCBA 3JB9J 3C12A 3CC4T 1QVGS 5DY9A 1U8RA 2LDMA 4RUGA 5FU6C 2RM4A 5KYXA 1AVZC 4OGCA 1QVFP 1PHTA 2YLCA 2DL7A 2VYTA 3JCMX 4JS4A 4F7UE 4QQGA 5GANe 1YITQ 2JW4A 3OYNA 1AWXA 1TUCA 3H41A 4DBQA 1XOVA 3VKIA 1OU8A 3OS1A 1Q7YC 4IKFA 3LWIA 3HL8A 2PVDB 3CCQA 2MI6A 2W10A 1I5OB 4KGXB 4ELZC 4AFSC 3CMET 1RAGB 1UUEA 2RPNA 1Q82R 1V29B 1MMGA 2YXYA 2GQIA 1QP2A 3UATA 4FYVB 4J9DA 2OTJT 3EGXB 1GL5A 3EGDA 4IUVA 3CC2A 4M7DF 3WXMB 1E6HA 3OW2S 2L0AA 4MMLA 2P0PA 2QK0A 2QGFB 3CD6A 1W4SA 2RHXA 2J6OA 2VKNA 4HT8A 1WA7A 4ZGJB 1I1JA 2A37A 2C0TA 2GCXA 1F1BB 3CBOA 4M78G 1LNXA 3LWHA 3M53A 4F14A 2VGNA 2FZCB 1K1ZA 1AWWA 2RNAA 4LN2A 1NLPC 2ABLA 2DZ9A 4ZGEB 5KYNA 4RG2A 3QJYA 3QG1A 1I4K1 4J7FA 2JMCA 2RQRA 5AT1B 3OYFA 2CUDA 4EMKC 4M7DC 3FC3A 5FROA 3CCJA 3OS0A 2RJEA 3CMAT 1I81A 3G71A 1ARKA 2E3HA 1WHJA 4Z89A 2E4HA 4QVCA 1WXBA 3OMGA 1JU5C 4X34A 2DM1A 1T3LA 5IHNA 1JXOA 2M0OA 2QDYB 3INZA 2QXFA 1TWBA 1VQOT 4BI4A 2LT4A 3QSUA 5GAN6 1TUDA 3O5ZA 4XU3A 4C0DC 2LJ1A 2K2MA 2JT4A 4OB3B 1EIFA 2LJ3A 2ZPGB 3OYMA 5A0GA 2RN8A 3OYEA 2V8IA 3LYIA 1YIJT 3ME9A 5GMKl 4JLIA 1BK2A 2F2VA 3G71Q 4D8DA 4JJDA 1VQ6A 3G6ET 2YUPA 3C0CA 3RKWA 1OX9A 3GNGA 2MYSA 2AT1B 3VS4A 1VQKT 4VUBA 1OOTA 2M0YA 4PFZA 4M7AF 2VC8A 2JM9A 3VRYA 2ZPBB 4Q5WA 4M75F 2DVEA 1WHHA 4PLLA 1VQ9A 2P84A 2KI7A 1Y57A 1GXIE 3ULRB 1YNZA 2K3YA 1T0HA 1N8RC 1SF9A 1BB9A 5I11A 1M30A 1MMDA 3FEOA 3GF5A 3OSVA 4BDYA 1G3YA 5IXBA 2QQBA 1YJWQ 1AHJB 3H0HA 4GY5A 1SSFA 3REBB 3BDUA 2DXTA 2O9SA 1LOJA 2PVOB 4C92D 1D09B 3HSBA 1OQKA 3LGLA 1D1BA 1YI2T 2HCKA 3VJPA 3ZEHA 4HA8A 1ZQ1A 3DKMA 1RAHB 3RNJA 1WHGA 4C92C 3X24B 1WPYA 2GQVA 4MMKA 4XAXB 2QI2A 2E3IA 4C92E 5GAMd 1NEBA 4FW2A 1BIAA 4DEYA 4N0AC 2RB6A 3FLGA 2NUTA 2JS2A 1IGQA 3EGDB 3HRSA 1WXTA 1RLPC 2E70A 1YBYA 3CMEA 3QYHB 2CZ6B 4FCYA 1PRLC 4ZN3A 1YI2A 4J9IA 2KVQG 3N5BB 2A36A 2ROTA 2K5FA 2BUDA 4II1A 1VQMT 1UGRB 3CXCP 5A2QE 1RLQC 2E65A 2ECZA 2RH2A 3RUXA 3L2UA 2X3WD 1UDLA 4PJOG 2QQSA 4KH0B 3J7AF 3CCSA 5LJ5f 1VQ6T 3BDLA 4JZ3A 1NPPA 2JMAA 1ABQA 3JV3A 5KYWB 4DOWA 3KUFA 3EG2A 5KYXB 2AHJB 3PVLA 1QVGA 4BD3A 1FMKA 3FJPA 4LUEA 2KAFA 1ZA2B 1N9RA 4PJOB 1SSHA 1KQ2A 2FRYA 2LCLA 4C8QD 1D3BA 3M0RA 3OYYA 3A98A 3A8HB 5J26A 3CPWA 3CCMT 4XTZA 3QPHA 2VASA 5CQXA 4AFUC 3CCLT 4F7UA 2JTMA 1UFFA 2CP3A 4L5GA 2RQVA 5IAYA 4PJMA 1GFDA 1D3BB 2HSPA 1CKAA 3I5RA 4C5HA 1I07A 2XHCA 1U06A 1ZLMA 1YIJA 2CDTA 4ATOA 4HCKA 1VQNQ 1I0CA 2C06A 4BACA 3CEYA 2LP5A 3VS5A 1VQ5A 1BI2A 1K0SA 4JDSA 1GRIA 1X2QA 2LC4A 2F5TX 1VYTA 5HK0A 2VXFA 4IUPA 4PNOA 1IHVA 5GMKe 4JJBA 3JSCA 3JCMg 2CYZB 3SD4A 4KULA 1ZUUA 5GMKh 2PQWA 4ANJA 1UJ0A 2DL8A 2KMTA 5HCKA 5HK3A 2F5KA 4XTUA 2EYXA 1FXXA 5FRNA 1QWFA 4QT7A 2KYMA 4F04B 5CKDA 1HYOA 4J83A 1UTIA 2MF2A 1WYXA 2L89A 1NEGA 1BU1A 4J9BA 1OU9A 3QUIA 1MV0B 1MUZA 3KXTA 2XDBA 3H9NA 1RABB 4LD9K 1U1TA 1BI3A 1Z9ZA 1KHCA 2EQUA 3MKDA 2CZ0B 2FPEA 5FU7C 4DBRA 3UPUA 2VGMA 1RAIB 1FMVA 2GGRA 4E47A 1G3SA 1OV3A 1V76A 3HRTA 3CCEQ 4QW2A 2JVVA 3L2RA 2D0QB 2DE0X 4CC2A 4OF1A 1GFCA 4PJJA 1SRLA 4A4GA 5GAN2 2EKHA 5D6WA 2D1XA 3H8ZA 1CKBA 1NJIU 4HKEA 3J81E 3EFOA 2QEXQ 3P8BB 1AT1B 3CCVA 3SWNC 1TS9A 4F16A 2V8KA 5FWCA 5IH2A 1M1KR 3O8VA 5DLQE 3S3NA 1WJRA 1H3ZA 1Y96A 2QA4T 2LQNA 4JRQA 2L8DA 3EG0A 2CT3A 2ENMA 2HEQA 2BE7D 3G4SA 1NYFA 3CCRA 3ASKA 2GBQA 2F2XA 4M75C 4ZGDB 1XJWB 1FX7A 4M7DA 4RTUA 1Y96B 1FWZA 2LVMA 2QTXA 1JQQA 3T9NA 1Q86U 4M75D 4M78D 1M90R 3QIIA 2LQWA 4Z8AA 2FZGB 1PSFA 2JTEA 4M77D 2CP0A 2DZCA 6AT1B 1NJIC 2EAYA 2EBPA 4M77G 3PIOA 1SHFA 2ZPFB 3CCQT 5I2MA 1QWEA 4C92G 2ESWA 2GNCA 4Y28E 2NUZA 2DETA 2QAZA 2KNBB 2DNUA 2K79A 2M16A 2DTHA 5FWBA 4JPBW 3U23A 2QQRA 1VQ9Q 1PKTA 2MCNA 3VYGA 5CO7A 4ELYC 2JNGA 3QO3A 1S72Q 2J6FA 5IXFA 2KSSA 1AD5A
chains in the Genus database with same CATH topology
3CCQQ 1VQLQ 3CCMQ 3G71Q 2QEXQ 1VQOQ 1K8AR 3G6EQ 3CCLQ 1VQMQ 1YHQQ 1Q82R 1KC8R 1KD1R 1K9MR 1VQ7Q 3I55Q 1YJNQ 1K73R 2OTJQ 3G4SQ 3OW2P 3CXCP 1YITQ 3I56Q 1VQ5Q 1M1KR 3CMAQ 1VQKQ 3CCEQ 3CCRQ 1QVGP 3CCUQ 3CC7Q 1VQ6Q 3CD6Q 1VQ8Q 1VQ9Q 1Q7YR 2OTLQ 1JJ2P 3CCSQ 1M90R 1VQ4Q 3CC2Q 3CC4Q 1Q86R 2QA4Q 1YI2Q 3CPWP 1VQNQ 3CCJQ 1KQSP 1N8RR 1S72Q 3CCVQ 1W2BP 1Q81R 1YIJQ 1NJIR 1YJ9Q 1VQPQ 3CMEQ 1QVFP 1YJWQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCQ Q;  1VQL Q;  3CCM Q;  3G71 Q;  2QEX Q;  1VQO Q;  1K8A R;  3G6E Q;  3CCL Q;  1VQM Q;  1YHQ Q;  1Q82 R;  1KC8 R;  1KD1 R;  1K9M R;  1VQ7 Q;  3I55 Q;  1YJN Q;  1K73 R;  2OTJ Q;  3G4S Q;  3OW2 P;  3CXC P;  1YIT Q;  3I56 Q;  1VQ5 Q;  1M1K R;  3CMA Q;  1VQK Q;  3CCE Q;  3CCR Q;  1QVG P;  3CCU Q;  3CC7 Q;  1VQ6 Q;  3CD6 Q;  1VQ8 Q;  1VQ9 Q;  1Q7Y R;  2OTL Q;  1JJ2 P;  3CCS Q;  1M90 R;  1VQ4 Q;  3CC2 Q;  3CC4 Q;  1Q86 R;  2QA4 Q;  1YI2 Q;  3CPW P;  1VQN Q;  3CCJ Q;  1KQS P;  1N8R R;  1S72 Q;  3CCV Q;  1W2B P;  1Q81 R;  1YIJ Q;  1NJI R;  1YJ9 Q;  1VQP Q;  3CME Q;  1QVF P;  1YJW Q; 
#chains in the Genus database with same CATH topology
 2A28 A;  1ACM B;  2JN0 A;  3CCL A;  5LL6 S;  3Q1J A;  1R0C B;  4J6X A;  4LUD A;  3EGX A;  3VS1 A;  2DYI A;  3M57 A;  5KYY A;  2QAS A;  1HK9 A;  2K57 A;  1VQ4 Q;  1R77 A;  2P0Q A;  3EG1 A;  1QVP A;  5FU6 B;  3JCM W;  1M27 C;  2A0F B;  1C0M A;  4Y92 A;  1IGU A;  2AZV A;  4C8Q B;  1K0X A;  3MP6 A;  5KYW A;  3SWN B;  3OW2 A;  2FEI A;  1HSQ A;  4OMF B;  2V8J A;  4RTV A;  2COY A;  2DO3 A;  2DF6 A;  1YJ9 A;  2WSE E;  4IIM A;  1IB8 A;  3MET A;  1VQP Q;  3X20 B;  1WI7 A;  1VQM A;  3FDR A;  4XTW A;  4WTO B;  3I56 A;  4D6W A;  3NTK A;  4QQD A;  1VQ7 A;  4R0K A;  4J9F A;  1D1A A;  1KG1 A;  3OYH A;  1WHL A;  3C94 A;  3M5A A;  2E1H A;  3VS0 A;  1Q86 C;  3V8K A;  2P0K A;  4C8Q E;  1UGP B;  3G4S T;  2YDL A;  3CCE A;  1BIB A;  1FMW A;  3HTR A;  1MNE A;  2D8H A;  1M2O A;  1U3O A;  1Y7X A;  3QKJ A;  2HL3 A;  1Y07 A;  2DAQ A;  3GNF B;  4RCC A;  2FRW A;  1LVK A;  2BTT A;  1WJS A;  3P8H A;  3C95 A;  4IUU A;  4AG2 C;  4E7J A;  4ZTJ A;  2CSI A;  4C92 F;  3P8D A;  3TVT A;  2FL7 A;  1KC8 R;  1H92 A;  3PMT A;  4PJN A;  3OW2 P;  1JO8 A;  3CXC A;  2L3P A;  2E64 A;  4PJO F;  3QZ9 B;  2DD4 A;  4HVU A;  2DRK A;  4P5N A;  1EZZ B;  2BZ8 A;  2H3E B;  5FLX E;  2X4Y A;  3CCS T;  1QVF A;  3OYL A;  3UWN A;  2K3B A;  1VIF A;  3CCV Q;  1YWO A;  2DK3 A;  1M2V A;  2E6N A;  3NTH A;  2EIF A;  4J7I A;  4AT1 B;  2EQI A;  4R56 A;  2YT6 A;  4B6M A;  2RI3 A;  1G5V A;  3JCM J;  2OAU A;  1YWP A;  5A0L A;  3HP9 A;  3CC4 Q;  3E9F A;  4V2S A;  1P92 A;  4PJO D;  1N8R R;  4M78 A;  2RHU A;  3E2U A;  2YRD A;  4CI0 C;  1MHN A;  4HT9 A;  4PJO C;  2BZY A;  3VYH B;  3FJ5 A;  3I55 Q;  2HDA A;  4JLG A;  3M0U A;  2Y90 A;  1W2B S;  2CGH A;  4RTY A;  3CCR Q;  1K73 C;  2YSQ A;  3QWY A;  1ZSZ A;  4LDY A;  5FW9 A;  1S72 A;  3JCM e;  3M4G A;  2PTK A;  5CAI A;  2OTJ A;  3JB9 H;  3QJ6 A;  1YJ9 T;  2M9U A;  2DL3 A;  3JCM h;  4C8Q G;  4CC3 A;  1VA7 A;  4O6J A;  1YJN Q;  4NL2 A;  4JJN K;  2J6K A;  4HVW A;  2MK5 A;  2IVW A;  3URG A;  5D6X A;  3UT1 A;  4HXJ A;  2PVG B;  4N0A A;  3EHR A;  1ZA1 B;  5C0M A;  1X43 A;  1YIT A;  1QKW A;  4CC4 B;  2KRN A;  5GAM h;  2RMO A;  2LZ6 B;  2HBP A;  2B8A A;  3MEA A;  2CP2 A;  4QKU A;  1VQ5 Q;  1RL2 A;  2HBW A;  5CR2 A;  1UB4 A;  1SKU B;  1N27 A;  3GIB A;  2DEQ A;  3A5Z B;  3JB9 F;  1AZE A;  1Y71 A;  5GAN 5;  1WQ7 A;  3X28 B;  5GAN 3;  2DYB A;  1UEB A;  4K11 A;  4M7A B;  2OAW A;  5KYY B;  2EQJ A;  3HRU A;  3I56 Q;  4XU0 A;  4M77 F;  4M7D E;  4E7K A;  2AKK A;  2JOY A;  2PU9 B;  4OML A;  2E41 A;  2DFU A;  2EGA A;  3M56 A;  1GBR A;  1X6G A;  4CC7 A;  3CPW P;  5GAN d;  2DJQ A;  2XID A;  3KFV A;  3MEV A;  1KQS S;  3M4Y A;  3LLR A;  4IUT A;  1VQ7 T;  3JB9 D;  2RD1 A;  2FB7 A;  4R55 A;  1ABO A;  1QCF A;  2EW3 A;  1C6V X;  4AG1 C;  4Y91 A;  3E9G A;  4X1V A;  1WQW A;  4B9W A;  2MIO A;  4JS5 A;  4E7H A;  2LQ8 A;  1KFZ A;  1VQN A;  1AEY A;  4J9E A;  2DVJ A;  4JRP A;  4A4F A;  3BE3 A;  4HCC A;  3JCM V;  1UHF A;  3CCM Q;  3L42 A;  2L3S A;  4JZ4 A;  2DJZ A;  1RAD B;  5D7U A;  4M4Z A;  2M1H A;  1X2K A;  2DMO A;  1C1A A;  5IN1 A;  4B9X A;  1RAF B;  3CCU Q;  1WX6 A;  2CP6 A;  2KDS A;  3M0S A;  2EVR A;  3L2W A;  1Q86 R;  3UA7 A;  3JCM b;  1PM3 A;  2C0I A;  2NWM A;  1G3W A;  4FT4 A;  4JUV A;  3L2Z A;  1QW1 A;  1RAC B;  3I35 A;  1ZSG A;  1FYN A;  1B3Q A;  1YIT T;  2EWN A;  4C0D B;  3OYD A;  1VQ8 T;  2ZGW A;  1WNL A;  3CC7 Q;  1K9M U;  1JXM A;  9ATC B;  2DPP B;  4MDW A;  3DB4 A;  2X35 A;  3JCM c;  1W70 A;  3MJX A;  3I9Q A;  1WDX A;  4BE2 A;  4Z02 A;  4E7Z A;  1KC8 C;  2DRM A;  3H0F A;  5DLO A;  1IO6 A;  3C4S A;  1SRM A;  2CZ7 B;  4J9G A;  2MPX C;  3QHS A;  1NBE B;  4KUD K;  4RTX A;  3FRN A;  3RER A;  4M7D B;  4EMK B;  3CCJ T;  1YI2 Q;  4M7A E;  1KIK A;  1PC0 A;  3PVQ A;  2K5I A;  2YUO A;  2X51 A;  4EPC A;  1Y0M A;  4ME7 A;  1JB0 E;  2LT1 A;  5J3B A;  4OB2 B;  2EQM A;  3M9Q A;  1MGQ A;  3G7Z A;  2ATC B;  1VQO A;  3PTA A;  3SDZ A;  1RI9 A;  2COW A;  1Q82 U;  4OP0 A;  2QA4 A;  1QMC A;  5LJ5 d;  3RMQ A;  5CKF A;  5CIU A;  4DEX A;  1TG0 A;  2RJF A;  2HKN A;  1QCN A;  1WLP B;  4OMO A;  1GCP A;  1VQK Q;  2F2W A;  4XU2 A;  3OS5 A;  2AK5 A;  3CD6 Q;  3QWX X;  2BE9 B;  2QYZ A;  1JJ2 A;  2OTL Q;  1HD3 A;  2VB6 A;  3CC2 Q;  2RA2 A;  2XKO C;  1ZHI A;  1VUB A;  4LE9 A;  4YTL A;  2SEM A;  1SG5 A;  4N4I A;  2IG0 A;  4TVR A;  1K8A C;  1AWO A;  2YWW A;  2DL5 A;  3KBG A;  2EJF A;  1OEB A;  5KYU B;  5GJV B;  3VS2 A;  4F7U B;  2MWO A;  4FYX B;  2XI9 A;  2RI5 A;  1ZBX A;  4A53 A;  2CH4 A;  1Q81 C;  1VQL T;  3HFO A;  1JEG A;  1H3H A;  2R5A A;  4KRT A;  1K8A R;  4C8Q F;  5LJ3 d;  3G71 T;  4MDX A;  4L59 A;  2D6F A;  3JCM Q;  1K76 A;  1KC8 U;  2GFU A;  1I8F A;  2VWF A;  3GLX A;  4GLM A;  4M78 C;  1LJO A;  4C5G A;  2O88 A;  1PRM C;  1I5L A;  2KRO A;  2LTO A;  1ZSZ B;  2DXC A;  5GAM e;  3VV0 A;  1W6X A;  2E5K A;  4BI8 B;  1B34 A;  4C5I A;  1PCX A;  1DJ7 B;  1K8A U;  4C0G A;  5I22 A;  3IQL A;  1QVF S;  2SRC A;  1OZ2 A;  1YFN A;  3I5S A;  3OYA A;  2MWP A;  1QVG P;  2LCS A;  2EJ9 A;  2K5L A;  4PL6 A;  4QVD A;  3JCM d;  8ATC B;  2RHY A;  5KCO A;  1X27 A;  1QQJ A;  4FSS A;  3VU3 C;  2LNV A;  3VS7 A;  2V26 A;  2D9T A;  2HZY A;  1Q82 C;  5DM7 R;  3H6Z A;  2NUT B;  2PUK B;  1KQS A;  1O9S A;  2M02 A;  2XK0 A;  2MAM A;  1OUL A;  1VQ6 Q;  5HY6 A;  1O75 A;  2RJC A;  3OY9 A;  1B34 B;  3CCU A;  1AWJ A;  3RMS A;  2IIM A;  3PT9 A;  2O4X A;  1M5Q 1;  2XU8 A;  1G2B A;  3VS3 A;  2QEX A;  1GCQ A;  3NHN A;  4F7U F;  4LDX A;  2DBM A;  1BI0 A;  2LNH B;  4FT2 A;  3EG9 B;  1M90 C;  2HSE B;  5GAO l;  3AT1 B;  2JS0 A;  1OPL A;  3HPW A;  3M0Q A;  1B7T A;  4X9D A;  5L8R E;  4NOY A;  4C92 A;  3DLL A;  3OYG A;  5LJ3 h;  3RIR A;  4HCZ A;  2I0N A;  1M1K U;  1ZSZ C;  3M0P A;  3EG9 A;  3EFO B;  1T3S A;  3G4S Q;  2HQH A;  2DA9 A;  4N4H A;  4C8Q C;  2HAX A;  3OB9 A;  4RKU E;  1YCY A;  1OI1 A;  3X25 B;  2DTO A;  5KE3 A;  3V8L A;  3A8M B;  2EYQ A;  1YHQ A;  4LXC A;  4FW1 A;  5LJ3 f;  2M51 A;  2HMA A;  2QA4 Q;  1UGQ B;  4OB0 B;  2ROL A;  2XIC A;  4KH1 B;  3MO8 A;  1NZ9 A;  4M77 A;  1SHG A;  4A4K A;  3SB2 A;  2KRM A;  3V8J A;  2EPD A;  2AKL A;  3SFM A;  2VXE A;  1IRE B;  4DA4 A;  3THK A;  2LJ0 A;  1GBQ A;  2PZ1 A;  2H8H A;  3NPF A;  2HQX A;  2RK2 A;  4J6W A;  4F7U G;  4PJL A;  1ZUY A;  2X3X D;  3DB3 A;  1M2V B;  4M7A G;  1G83 A;  1YJW T;  3MP1 A;  4LNP A;  1YIJ Q;  2RHZ A;  2YRC A;  3OYC A;  2RJD A;  2WAC A;  3VRZ A;  1N8R U;  3EGU A;  5HKC A;  3GP8 A;  3NTI A;  2HD0 A;  2QG9 B;  3JCM P;  1WGS A;  4M77 E;  4PKC C;  4BE0 A;  1YCS B;  2L5Q A;  2HQE A;  2VUB A;  4GBQ A;  2J05 A;  4F17 A;  4M77 C;  1VQ9 T;  2KT1 A;  8AT1 B;  2RO0 A;  3UF4 A;  2FHD A;  4FIB A;  4LDU A;  5GAN h;  1M3A A;  4ZNX A;  1VQN T;  3TSZ A;  2GTJ A;  3R6O A;  3WVD B;  4JRI A;  3LH0 A;  4BE1 A;  1VQP A;  2FVU A;  1RUW A;  2EJG A;  1E7O A;  1T0J A;  2EKO A;  1OYX A;  4M75 B;  2J06 A;  1XTD A;  1NM7 A;  1SEM A;  2ZZD A;  4DBH A;  1MND A;  2AIR B;  1KK7 A;  1M90 U;  1A0N B;  1H8K A;  1KD1 C;  3AHU A;  1BKB A;  2CH4 W;  3PNW C;  3RKX A;  5GAN 7;  2K3X A;  1WXU A;  1VQM Q;  4NS5 A;  1MMA A;  4PK4 A;  2ZCF B;  1PG5 B;  4FM4 B;  2K7A A;  4M78 F;  2LRQ A;  1UE9 A;  2NUP A;  2COZ A;  1BCO A;  3OBY A;  1UGS B;  1LCK A;  4C0F A;  4J9C A;  1KQS P;  5GAM f;  3LH5 A;  1WZO A;  1YHQ T;  2BZX A;  1KHI A;  2NUP B;  3QDF A;  2KQW A;  1JJ2 S;  2CZ1 B;  3ER0 A;  2RQW A;  5GAO r;  1M8M A;  3ZFJ A;  2QQA A;  4QVZ A;  2MOX A;  3PGG A;  5LJ5 h;  1VQ5 T;  3FB9 A;  2FPD A;  5LJ5 e;  1K9M C;  3LGF A;  1TH7 A;  2MMP A;  5M9O A;  4KGV B;  3H0I A;  2VV5 A;  5CVI A;  4M75 A;  1NJI R;  3GPL A;  4PFO A;  1Q81 U;  1BYM A;  2G3R A;  1AZG B;  3G6E Q;  3A8G B;  2CSQ A;  5D6Y A;  4C0Z A;  3EH2 A;  3VUB A;  4FYW B;  1X01 A;  2OJ2 A;  2OX7 A;  4M7A D;  3M54 A;  2KY9 A;  3OA6 A;  5CQY A;  3OYJ A;  2QQ9 A;  3TSW A;  2RHI A;  4MZP A;  5GAN 4;  4RTT A;  3S6W A;  5IHK A;  1VQL A;  1D0Y A;  4E7L A;  2A7Y A;  4BY6 B;  4EMK A;  2WSF E;  2R58 A;  4PFP A;  1SPK A;  1QKX A;  4FYY B;  1R0B G;  2O01 E;  4EDU A;  4J9H A;  3VS6 A;  3M58 A;  2WSC E;  2L3Q A;  2GTO A;  5GAO m;  2V1Q A;  3CCM A;  2LCC A;  3QYG B;  1JJ2 P;  5KE2 A;  2NLU A;  2EYY A;  4J6Y A;  1RAE B;  4UC4 A;  4MZT A;  1IZ6 A;  2HNI A;  3RES A;  2O2O A;  4A63 B;  2DTI A;  1Q81 R;  4XTV A;  1OX8 A;  3CME Q;  3CQT A;  2YUQ A;  2D0N A;  4D8K A;  3S3M A;  1EFN A;  4PJO A;  4XTY A;  4M78 B;  1M8V A;  2OTJ Q;  1CSK A;  3LW5 E;  2G6F X;  3GBQ A;  1KD1 U;  1WHM A;  1M1G A;  3NMZ C;  3EH1 A;  1TU0 B;  2XG8 D;  1Q7Y R;  2D8J A;  1YJW A;  4KUI A;  3CMA A;  4J8O A;  1X6O A;  4XTX A;  1RAA B;  3QBY A;  2K6D A;  3MEW A;  2F1L A;  3SHW A;  1TTH B;  2E10 A;  2FYK A;  3TEE A;  1X75 C;  2CRE A;  1UJY A;  1Z9Q A;  2W0Z A;  4PJO E;  5KH6 A;  4HVV A;  3CC7 T;  3HKS A;  3OS2 A;  2O31 A;  3M0T A;  2KXC A;  1N9S A;  4OMQ A;  1NLO C;  4J5Y A;  5GMK j;  3EAE A;  4OMP A;  4MZM A;  1WJQ A;  1NE8 A;  3EFR A;  1TOV A;  3CMA Q;  5KYU A;  3PIP A;  5CCA A;  1ZX6 A;  3TCJ A;  2ZPH B;  2DBK A;  2X4J A;  1M9S A;  4OVA A;  5GAN g;  1VOM A;  3CCJ Q;  1M4Z A;  4DBF A;  4RTZ A;  2IPO B;  3CBP A;  1VQ8 A;  1K9A A;  1VQO Q;  1KD1 R;  1IXD A;  1MV3 A;  1D0Z A;  5J39 A;  4CRI A;  2BKD N;  4BB7 A;  5GAO n;  2DLP A;  2YHT A;  3CCE T;  1R8O B;  4M75 G;  2YLB A;  3CCS Q;  4OMM A;  3WVE B;  3SEM A;  3CCV T;  3MP8 A;  4C92 B;  5GAO q;  1WHK A;  3L1A A;  2PUO B;  3A8L B;  2EFI A;  3I55 A;  2H3J A;  2DD5 A;  1VYU A;  3TQ7 P;  3M59 A;  2J7I A;  2RK1 A;  4IUQ A;  3X26 B;  3ZL7 C;  2EYW A;  2K9G A;  5CK9 A;  4XQ3 A;  2CUB A;  2OTL T;  2CP7 A;  2O4X B;  1X69 A;  5IHI A;  2F69 A;  3V7S A;  4BUG A;  2Y4Y A;  5LJ3 j;  1PWT A;  3OSS C;  2P4R A;  1BBZ A;  2RF0 A;  3G6E A;  3I55 T;  1VQ7 Q;  2DER A;  4WCI A;  1B07 A;  4BI3 A;  1KQ1 A;  4LD6 A;  4M7D G;  1H64 1;  1D0X A;  3OYB A;  1D1C A;  1N5Z A;  4M7A A;  2L3R A;  4BY6 C;  4AMC A;  1ZBJ A;  5GAN j;  5GMK m;  1YJ9 Q;  2DIG A;  2XD0 A;  1PKS A;  2E5Q A;  1PD0 A;  3OQ5 A;  1HJD A;  1U5S A;  2CS7 A;  3JAM E;  2ED0 A;  1G8X A;  2L2P A;  5CKE A;  4AFZ C;  4A4E A;  4IIO A;  2YRV A;  4A4H A;  1N6A A;  1Q95 G;  3D7S B;  3UA6 A;  4IUR A;  3R6N A;  3EG3 A;  5A0D A;  2K2V A;  4A54 A;  1VQP T;  1JRI A;  2JM8 A;  3V7C A;  4OMN A;  4Z88 A;  1S72 T;  1E6G A;  4KBM B;  5C6S A;  3CPF A;  1VQ4 A;  2Y4X A;  2R5M A;  3RBB B;  4DQ2 A;  4ZN1 A;  4RMO A;  2X4X A;  1QLY A;  3LX7 A;  4C8Q A;  3EHQ A;  4N4G A;  3V7R A;  1VQ8 Q;  2QGG A;  2I2L A;  1VIE A;  2Z0W A;  4E2F B;  4EIK A;  1W1F A;  3A8O B;  1V1C A;  2JXB A;  3EFS A;  3OYK A;  3I56 T;  3NGP A;  3REA B;  1W2B A;  4XU1 A;  5LJ5 j;  4OB1 B;  3ZBD A;  1UGV A;  2DX1 A;  2E6Z A;  3CBM A;  4DOV A;  5GMK i;  4M7A C;  1GCQ C;  2KR3 A;  4QQ6 A;  2LQK A;  5FRM A;  3GOX A;  2X9H A;  4M75 E;  5GAN 8;  1OZ3 A;  1X6B A;  2OTL A;  1PD1 A;  2EGC A;  5L23 A;  4EMG A;  1QCO A;  1NYG A;  3CC7 A;  2XMF A;  5GAM g;  2XDD A;  3QZ5 B;  2NYS A;  2GF7 A;  1NPR A;  2EGE A;  4E7I A;  2A3L A;  1WFW A;  1TUG B;  2YUN A;  3DLM A;  3TRE A;  3RDV A;  2FZK B;  1JBM A;  1G3T A;  2DIQ A;  1YJN A;  2DEU A;  4OGE A;  3CCQ Q;  4M7D D;  5LJ5 g;  5LJ3 g;  4M77 B;  3BY7 A;  5CKH A;  3BFM A;  2DXB A;  3CCL Q;  2A08 A;  4M78 E;  4ZTF A;  2FG0 A;  2ZPE B;  3E1S A;  3CXC S;  3CCU T;  3RKY A;  4PLI A;  1TXQ A;  2ED1 A;  1IRX A;  4LDW A;  2CP5 A;  2EQK A;  2X4W A;  3TU4 K;  4HCB A;  1TSF A;  2CT4 A;  3CC2 T;  1AOJ A;  3S3O A;  1M1F A;  1U1S A;  1HXD A;  2KE9 A;  3RR6 A;  2E12 A;  2BIV A;  3SWN A;  3VUZ A;  3JB9 G;  1WIE A;  3A1P A;  3OYI A;  2DXU A;  1EX4 A;  2K4Y A;  2KYB A;  3L2V A;  3NFC A;  4ESR A;  4BDZ A;  1BI1 A;  3CC4 A;  4E6R A;  3HHT B;  1VQ4 T;  3M55 A;  1M3B A;  4FL6 A;  4ORZ A;  3BW1 A;  5I21 A;  3J80 E;  1KSW A;  4JJC A;  5I2S A;  1VQL Q;  5GAN f;  1MMN A;  1K4U S;  1YN8 A;  2QTV A;  1QP3 A;  3L2Q A;  5IT9 E;  1ZUK A;  4WF2 A;  1UHC A;  3G1J A;  2EYZ A;  4AFQ C;  5EC7 A;  2KBT A;  4FU6 A;  3OBW A;  2DKG A;  4KGZ B;  2V1R A;  3JCM f;  2KXD A;  2RQU A;  5GJW B;  2DL4 A;  3MHX A;  1LPL A;  1J3T A;  5CKB A;  1UEC A;  2P4T A;  2HL5 C;  1NG2 A;  3CCR T;  5ECA A;  2LX9 A;  2RI2 A;  4X9C A;  4JRK A;  2GFA A;  2JTF A;  4L6V 5;  3PMI A;  4O5V A;  2FO0 A;  5FU7 B;  1UG1 A;  3PE0 A;  3F70 A;  2QEX T;  7AT1 B;  3HFN A;  4EMH A;  2B86 A;  2LX7 A;  1PSE A;  1KJW A;  2KRS A;  2KT8 A;  3MPU B;  5EG2 A;  1YJN T;  3CD6 T;  4C5E A;  3CPW S;  2O9V A;  2JZ2 A;  1VYV A;  2KGT A;  2JUF A;  2ZAE A;  2PNI A;  1K73 U;  2C0O A;  4RG8 A;  1XNI A;  2LMJ A;  3MCA B;  2VVK A;  1S1N A;  2FPF A;  1VQK A;  3JRZ A;  1W2B P;  1M1K C;  3QXE B;  2XDP A;  1OPK A;  1YP5 A;  2CKK A;  2HKQ B;  2RQT A;  3OMC A;  1K9M R;  1YHQ Q;  3E19 A;  4GLK A;  1K73 R;  3PFS A;  3UDC A;  5KCH A;  4XK8 E;  2ZPI B;  3QDR B;  1XQH A;  5GAM j;  4LDV A;  2JJ9 A;  4FSX A;  2DIL A;  1M3C A;  3FIF A;  1Q7Y U;  1IHW A;  5LJ3 e;  4E7S A;  2QDL A;  3MEU A;  3JB9 I;  2KEA A;  1RI0 A;  5GAO p;  2AZS A;  4KT0 E;  4RTW A;  5AYF A;  1BCM A;  2OI3 A;  2KK4 A;  4NL3 A;  1PNJ A;  2R57 A;  4RCB A;  3JB9 J;  3C12 A;  3CC4 T;  1QVG S;  5DY9 A;  1U8R A;  2LDM A;  4RUG A;  5FU6 C;  2RM4 A;  5KYX A;  1AVZ C;  4OGC A;  1QVF P;  1PHT A;  2YLC A;  2DL7 A;  2VYT A;  3JCM X;  4JS4 A;  4F7U E;  4QQG A;  5GAN e;  1YIT Q;  2JW4 A;  3OYN A;  1AWX A;  1TUC A;  3H41 A;  4DBQ A;  1XOV A;  3VKI A;  1OU8 A;  3OS1 A;  1Q7Y C;  4IKF A;  3LWI A;  3HL8 A;  2PVD B;  3CCQ A;  2MI6 A;  2W10 A;  1I5O B;  4KGX B;  4ELZ C;  4AFS C;  3CME T;  1RAG B;  1UUE A;  2RPN A;  1Q82 R;  1V29 B;  1MMG A;  2YXY A;  2GQI A;  1QP2 A;  3UAT A;  4FYV B;  4J9D A;  2OTJ T;  3EGX B;  1GL5 A;  3EGD A;  4IUV A;  3CC2 A;  4M7D F;  3WXM B;  1E6H A;  3OW2 S;  2L0A A;  4MML A;  2P0P A;  2QK0 A;  2QGF B;  3CD6 A;  1W4S A;  2RHX A;  2J6O A;  2VKN A;  4HT8 A;  1WA7 A;  4ZGJ B;  1I1J A;  2A37 A;  2C0T A;  2GCX A;  1F1B B;  3CBO A;  4M78 G;  1LNX A;  3LWH A;  3M53 A;  4F14 A;  2VGN A;  2FZC B;  1K1Z A;  1AWW A;  2RNA A;  4LN2 A;  1NLP C;  2ABL A;  2DZ9 A;  4ZGE B;  5KYN A;  4RG2 A;  3QJY A;  3QG1 A;  1I4K 1;  4J7F A;  2JMC A;  2RQR A;  5AT1 B;  3OYF A;  2CUD A;  4EMK C;  4M7D C;  3FC3 A;  5FRO A;  3CCJ A;  3OS0 A;  2RJE A;  3CMA T;  1I81 A;  3G71 A;  1ARK A;  2E3H A;  1WHJ A;  4Z89 A;  2E4H A;  4QVC A;  1WXB A;  3OMG A;  1JU5 C;  4X34 A;  2DM1 A;  1T3L A;  5IHN A;  1JXO A;  2M0O A;  2QDY B;  3INZ A;  2QXF A;  1TWB A;  1VQO T;  4BI4 A;  2LT4 A;  3QSU A;  5GAN 6;  1TUD A;  3O5Z A;  4XU3 A;  4C0D C;  2LJ1 A;  2K2M A;  2JT4 A;  4OB3 B;  1EIF A;  2LJ3 A;  2ZPG B;  3OYM A;  5A0G A;  2RN8 A;  3OYE A;  2V8I A;  3LYI A;  1YIJ T;  3ME9 A;  5GMK l;  4JLI A;  1BK2 A;  2F2V A;  3G71 Q;  4D8D A;  4JJD A;  1VQ6 A;  3G6E T;  2YUP A;  3C0C A;  3RKW A;  1OX9 A;  3GNG A;  2MYS A;  2AT1 B;  3VS4 A;  1VQK T;  4VUB A;  1OOT A;  2M0Y A;  4PFZ A;  4M7A F;  2VC8 A;  2JM9 A;  3VRY A;  2ZPB B;  4Q5W A;  4M75 F;  2DVE A;  1WHH A;  4PLL A;  1VQ9 A;  2P84 A;  2KI7 A;  1Y57 A;  1GXI E;  3ULR B;  1YNZ A;  2K3Y A;  1T0H A;  1N8R C;  1SF9 A;  1BB9 A;  5I11 A;  1M30 A;  1MMD A;  3FEO A;  3GF5 A;  3OSV A;  4BDY A;  1G3Y A;  5IXB A;  2QQB A;  1YJW Q;  1AHJ B;  3H0H A;  4GY5 A;  1SSF A;  3REB B;  3BDU A;  2DXT A;  2O9S A;  1LOJ A;  2PVO B;  4C92 D;  1D09 B;  3HSB A;  1OQK A;  3LGL A;  1D1B A;  1YI2 T;  2HCK A;  3VJP A;  3ZEH A;  4HA8 A;  1ZQ1 A;  3DKM A;  1RAH B;  3RNJ A;  1WHG A;  4C92 C;  3X24 B;  1WPY A;  2GQV A;  4MMK A;  4XAX B;  2QI2 A;  2E3I A;  4C92 E;  5GAM d;  1NEB A;  4FW2 A;  1BIA A;  4DEY A;  4N0A C;  2RB6 A;  3FLG A;  2NUT A;  2JS2 A;  1IGQ A;  3EGD B;  3HRS A;  1WXT A;  1RLP C;  2E70 A;  1YBY A;  3CME A;  3QYH B;  2CZ6 B;  4FCY A;  1PRL C;  4ZN3 A;  1YI2 A;  4J9I A;  2KVQ G;  3N5B B;  2A36 A;  2ROT A;  2K5F A;  2BUD A;  4II1 A;  1VQM T;  1UGR B;  3CXC P;  5A2Q E;  1RLQ C;  2E65 A;  2ECZ A;  2RH2 A;  3RUX A;  3L2U A;  2X3W D;  1UDL A;  4PJO G;  2QQS A;  4KH0 B;  3J7A F;  3CCS A;  5LJ5 f;  1VQ6 T;  3BDL A;  4JZ3 A;  1NPP A;  2JMA A;  1ABQ A;  3JV3 A;  5KYW B;  4DOW A;  3KUF A;  3EG2 A;  5KYX B;  2AHJ B;  3PVL A;  1QVG A;  4BD3 A;  1FMK A;  3FJP A;  4LUE A;  2KAF A;  1ZA2 B;  1N9R A;  4PJO B;  1SSH A;  1KQ2 A;  2FRY A;  2LCL A;  4C8Q D;  1D3B A;  3M0R A;  3OYY A;  3A98 A;  3A8H B;  5J26 A;  3CPW A;  3CCM T;  4XTZ A;  3QPH A;  2VAS A;  5CQX A;  4AFU C;  3CCL T;  4F7U A;  2JTM A;  1UFF A;  2CP3 A;  4L5G A;  2RQV A;  5IAY A;  4PJM A;  1GFD A;  1D3B B;  2HSP A;  1CKA A;  3I5R A;  4C5H A;  1I07 A;  2XHC A;  1U06 A;  1ZLM A;  1YIJ A;  2CDT A;  4ATO A;  4HCK A;  1VQN Q;  1I0C A;  2C06 A;  4BAC A;  3CEY A;  2LP5 A;  3VS5 A;  1VQ5 A;  1BI2 A;  1K0S A;  4JDS A;  1GRI A;  1X2Q A;  2LC4 A;  2F5T X;  1VYT A;  5HK0 A;  2VXF A;  4IUP A;  4PNO A;  1IHV A;  5GMK e;  4JJB A;  3JSC A;  3JCM g;  2CYZ B;  3SD4 A;  4KUL A;  1ZUU A;  5GMK h;  2PQW A;  4ANJ A;  1UJ0 A;  2DL8 A;  2KMT A;  5HCK A;  5HK3 A;  2F5K A;  4XTU A;  2EYX A;  1FXX A;  5FRN A;  1QWF A;  4QT7 A;  2KYM A;  4F04 B;  5CKD A;  1HYO A;  4J83 A;  1UTI A;  2MF2 A;  1WYX A;  2L89 A;  1NEG A;  1BU1 A;  4J9B A;  1OU9 A;  3QUI A;  1MV0 B;  1MUZ A;  3KXT A;  2XDB A;  3H9N A;  1RAB B;  4LD9 K;  1U1T A;  1BI3 A;  1Z9Z A;  1KHC A;  2EQU A;  3MKD A;  2CZ0 B;  2FPE A;  5FU7 C;  4DBR A;  3UPU A;  2VGM A;  1RAI B;  1FMV A;  2GGR A;  4E47 A;  1G3S A;  1OV3 A;  1V76 A;  3HRT A;  3CCE Q;  4QW2 A;  2JVV A;  3L2R A;  2D0Q B;  2DE0 X;  4CC2 A;  4OF1 A;  1GFC A;  4PJJ A;  1SRL A;  4A4G A;  5GAN 2;  2EKH A;  5D6W A;  2D1X A;  3H8Z A;  1CKB A;  1NJI U;  4HKE A;  3J81 E;  3EFO A;  2QEX Q;  3P8B B;  1AT1 B;  3CCV A;  3SWN C;  1TS9 A;  4F16 A;  2V8K A;  5FWC A;  5IH2 A;  1M1K R;  3O8V A;  5DLQ E;  3S3N A;  1WJR A;  1H3Z A;  1Y96 A;  2QA4 T;  2LQN A;  4JRQ A;  2L8D A;  3EG0 A;  2CT3 A;  2ENM A;  2HEQ A;  2BE7 D;  3G4S A;  1NYF A;  3CCR A;  3ASK A;  2GBQ A;  2F2X A;  4M75 C;  4ZGD B;  1XJW B;  1FX7 A;  4M7D A;  4RTU A;  1Y96 B;  1FWZ A;  2LVM A;  2QTX A;  1JQQ A;  3T9N A;  1Q86 U;  4M75 D;  4M78 D;  1M90 R;  3QII A;  2LQW A;  4Z8A A;  2FZG B;  1PSF A;  2JTE A;  4M77 D;  2CP0 A;  2DZC A;  6AT1 B;  1NJI C;  2EAY A;  2EBP A;  4M77 G;  3PIO A;  1SHF A;  2ZPF B;  3CCQ T;  5I2M A;  1QWE A;  4C92 G;  2ESW A;  2GNC A;  4Y28 E;  2NUZ A;  2DET A;  2QAZ A;  2KNB B;  2DNU A;  2K79 A;  2M16 A;  2DTH A;  5FWB A;  4JPB W;  3U23 A;  2QQR A;  1VQ9 Q;  1PKT A;  2MCN A;  3VYG A;  5CO7 A;  4ELY C;  2JNG A;  3QO3 A;  1S72 Q;  2J6F A;  5IXF A;  2KSS A;  1AD5 A; 
#chains in the Genus database with same CATH homology
 3CCQ Q;  1VQL Q;  3CCM Q;  3G71 Q;  2QEX Q;  1VQO Q;  1K8A R;  3G6E Q;  3CCL Q;  1VQM Q;  1YHQ Q;  1Q82 R;  1KC8 R;  1KD1 R;  1K9M R;  1VQ7 Q;  3I55 Q;  1YJN Q;  1K73 R;  2OTJ Q;  3G4S Q;  3OW2 P;  3CXC P;  1YIT Q;  3I56 Q;  1VQ5 Q;  1M1K R;  3CMA Q;  1VQK Q;  3CCE Q;  3CCR Q;  1QVG P;  3CCU Q;  3CC7 Q;  1VQ6 Q;  3CD6 Q;  1VQ8 Q;  1VQ9 Q;  1Q7Y R;  2OTL Q;  1JJ2 P;  3CCS Q;  1M90 R;  1VQ4 Q;  3CC2 Q;  3CC4 Q;  1Q86 R;  2QA4 Q;  1YI2 Q;  3CPW P;  1VQN Q;  3CCJ Q;  1KQS P;  1N8R R;  1S72 Q;  3CCV Q;  1W2B P;  1Q81 R;  1YIJ Q;  1NJI R;  1YJ9 Q;  1VQP Q;  3CME Q;  1QVF P;  1YJW Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...