1YJNQ

Crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1yjnQ00
1K73R 1KC8R 3G6EQ 1VQLQ 1K9MR 3CMEQ 1YHQQ 3CD6Q 1VQ7Q 1Q82R 1QVFP 3CCUQ 3CC7Q 3CCMQ 1QVGP 1YJ9Q 1W2BP 3CPWP 1VQ4Q 3G71Q 3CMAQ 1VQOQ 1M1KR 1VQ6Q 1VQ8Q 2OTLQ 1VQ9Q 1VQPQ 3OW2P 1YI2Q 3CCEQ 1KD1R 1N8RR 1VQNQ 3CC2Q 3G4SQ 3CCLQ 1Q7YR 1JJ2P 1S72Q 3CCJQ 1VQMQ 1YIJQ 1M90R 1KQSP 1VQ5Q 1Q86R 2QA4Q 3CCRQ 2QEXQ 3I56Q 3CCSQ 3CCVQ 3CCQQ 1YITQ 1Q81R 1VQKQ 1NJIR 3CC4Q 1K8AR 2OTJQ 1YJNQ 3I55Q 1YJWQ 3CXCP
chains in the Genus database with same CATH superfamily
1M8MA 5CK9A 5KCHA 1X2KA 1HYOA 1N6AA 2WACA 4M7AD 1YWPA 1UE9A 2QA4T 4C5EA 3JCMQ 1YI2Q 3PVQA 3CCRA 1C6VX 5I21A 2RNAA 5GJWB 1QCNA 2VYTA 2ZPIB 2DAQA 2ROLA 3DLMA 4ZN3A 3CCQQ 1LPLA 2M02A 1RAHB 2CT4A 2LQ8A 4M75G 4XU3A 3N5BB 2VVKA 2J7IA 4LXCA 2A7YA 2OTLT 3URGA 3VS4A 4JRKA 3ASKA 3OYJA 3H8ZA 3M56A 4QVDA 2KT1A 4BI8B 3GBQA 1KD1R 1NEGA 1JRIA 2A08A 4C92A 1PD0A 3ZFJA 1KJWA 1ABOA 1ZLMA 2KY9A 2PUOB 2QTVA 2SRCA 2QGGA 4M77B 1OULA 1M9SA 4AG2C 3MP8A 2ZPBB 3FC3A 1I1JA 4XQ3A 2EJ9A 3A5ZB 3QJ6A 1S72T 5HCKA 1AZGB 2NUPA 1ZSGA 4A4GA 2E3IA 2KGTA 4C8QD 4PJOE 1JBMA 1ZA1B 3UA7A 3MEUA 3VU3C 3WVEB 1QWFA 1EX4A 5DLOA 1T3SA 1YHQA 2FZCB 2KAFA 1N5ZA 4IUTA 4M78C 1ZQ1A 3EHQA 1H8KA 4FIBA 2XDPA 2E70A 1K73U 1T0HA 1RAEB 2GQIA 3EG1A 3MEAA 4KGZB 4J6XA 1M3CA 1ZUYA 3UF4A 2K2VA 1BIAA 2MYSA 3F70A 4HA8A 1TWBA 3CCRQ 3HPWA 4F17A 1I0CA 3VYGA 3CXCP 1GFCA 3CMAA 3H9NA 1IXDA 1AD5A 3EGUA 2VXEA 1QCOA 1OPLA 4JRIA 1O9SA 5CKEA 1N9SA 4M75E 1KD1C 3SWNC 4RTUA 1JJ2A 4E7HA 1YJNA 5GANe 3CD6T 2GGRA 1D1CA 5GAMe 3DLLA 2VGNA 3CCUA 1N8RU 4J8OA 2XHCA 4A54A 1YI2T 1AVZC 1VQ5T 1N27A 2DFUA 1NLOC 5M9OA 1YIJA 1BB9A 3M0TA 2QTXA 3CCQT 1Y57A 2BTTA 2M51A 1Z9QA 2DRKA 5IHKA 3IQLA 2BKDN 2RHIA 4KGVB 1UHFA 2Z0WA 5GAOr 1OI1A 3EGXB 3TSWA 3X25B 1PCXA 2F69A 2DETA 4LE9A 3BE3A 5CQYA 3BDUA 3GF5A 4TVRA 3NPFA 3J81E 4PFOA 2JOYA 3E9FA 1B34A 4LD9K 1VQ4T 3M9QA 3CBMA 2L89A 2X4WA 2YLCA 4QT7A 4R56A 4J9DA 2V8KA 1RI9A 5LJ3h 3M4YA 3NMZC 5D6YA 2HNIA 2J06A 1YCYA 4RTVA 1VQNQ 3RESA 2RPNA 1M2OA 2FRWA 1RLPC 3I55A 3OYKA 3TSZA 3S3OA 2EIFA 1TUDA 3HP9A 1YJNQ 4PJOC 1X6GA 2EYQA 3CCUQ 5GANd 2KR3A 3HL8A 2DTIA 3C94A 4L5GA 1TG0A 3MCAB 2NWMA 2SEMA 3OS5A 1G3SA 5CVIA 1YIJQ 4X1VA 2LC4A 2RB6A 3CBOA 3CXCA 2NUTB 2RHZA 1M90U 1X43A 4PJLA 1WGSA 1QWEA 4J7IA 3DB4A 5KYNA 4Y28E 2M9UA 2CZ1B 2P84A 4F7UB 2ZPEB 2GNCA 3EG2A 5GAOn 4M75C 1WQ7A 4ANJA 2RK1A 5LL6S 3NTKA 2CS7A 4X34A 3UA6A 1V1CA 3PMIA 3JCMg 1M30A 1X6BA 1ZX6A 4JS4A 3MO8A 4BY6B 1WQWA 1UDLA 3CC2A 3C95A 2MIOA 5DM7R 2Y4YA 3FDRA 1KG1A 4J6YA 4ZNXA 1SPKA 1Q86R 3HRUA 4NS5A 2RF0A 3I55Q 3OYEA 1OPKA 4MZPA 2A37A 1YWOA 1OV3A 2H3JA 3OS1A 1RL2A 4AFUC 1A0NB 2MPXC 4QW2A 1AOJA 2K4YA 1WJSA 2AIRB 4M77D 2EJFA 2OTJT 1IREB 4KH1B 1QW1A 4M7AF 1G8XA 2HBWA 2AK5A 5KYUA 4M7AB 3V8LA 4ZGJB 3VS1A 1WXUA 4QKUA 4AMCA 1MMAA 4CC3A 2CZ6B 1VQNT 3V7SA 1VIFA 3OS0A 3SDZA 4N0AA 4HKEA 3QDFA 2JZ2A 1Y96B 1WX6A 2XIDA 2M1HA 3OMCA 2DF6A 3X26B 1MUZA 3CCVQ 1K8AR 4VUBA 4BE0A 1BBZA 3X24B 1JU5C 5GANf 3O8VA 3CCET 4GY5A 2LJ3A 2CP3A 3GOXA 5EG2A 2DTOA 3G7ZA 2RHXA 2QA4A 4IUUA 4QVCA 2X51A 2ECZA 4L59A 1WIEA 2YRDA 2DVJA 1YJ9T 1E6GA 4C8QF 3CCMQ 1RI0A 4A4EA 3QYHB 1UEBA 4C8QB 4PJOB 2OTLA 2B86A 1VYUA 2P4RA 4GBQA 5GAN2 1SG5A 1K9MU 2HQEA 4OGCA 2L8DA 2DXBA 3MEWA 2HCKA 1BCOA 1NPRA 4M7DD 1H3ZA 1YITQ 2LCSA 4C92G 2DD5A 2WSEE 1M1KU 1PRLC 2GFUA 2O4XA 1ZSZC 1LVKA 1YFNA 1MMGA 5CKHA 3ZEHA 2OI3A 3H0FA 4GLMA 1ABQA 4OGEA 3KUFA 5IH2A 1UGPB 3E19A 1S72A 4FT4A 5KYXB 3JCMW 2KRSA 1NE8A 2JNGA 2XK0A 1Q81C 1U3OA 3M0UA 5CQXA 2M0OA 3QUIA 4XU0A 5KYWB 5LJ3g 4RTYA 4NL2A 5CAIA 1M27C 2DO3A 1U1SA 1T3LA 2CP7A 2H3EB 4JZ4A 4ZN1A 1YCSB 1KFZA 1G3WA 1WA7A 2QA4Q 3PVLA 2IIMA 3BDLA 2P0PA 4M77A 2EYWA 2XMFA 1G5VA 2E65A 1O75A 4EPCA 2RHUA 1VQ8T 3LWIA 4BUGA 1OQKA 2A0FB 3FEOA 1WHJA 1Q82C 2MWPA 3EFOA 1GCQC 1UJ0A 2KT8A 2OTLQ 4OMQA 2VXFA 2V8JA 4ME7A 2IG0A 5C6SA 1S1NA 3A98A 5IHIA 4DEXA 2RI5A 3CD6A 2J6OA 3CQTA 1C1AA 3UDCA 2QGFB 2CDTA 2KRMA 4C92E 1NPPA 1YI2A 3VS7A 2CREA 3CPFA 2FYKA 1VQ5A 1TU0B 1BU1A 1IGUA 3CCQA 1S72Q 3CCMT 4HT8A 4O6JA 3MP6A 1IB8A 4M78D 2F5TX 2DEUA 2XKOC 2XD0A 1JEGA 2F1LA 2V1RA 3EG9A 2XI9A 5KYYB 1M2VA 3CPWA 2EWNA 4B6MA 3VS3A 3G71Q 2EAYA 1K0XA 4C0DC 3QO3A 1WJQA 1AZEA 1YITT 3JB9G 3C0CA 4A63B 3OW2S 1GXIE 1VQKQ 2EYYA 3HKSA 3VJPA 1JJ2S 3H6ZA 2L0AA 1VQ4A 1NYGA 1MV0B 1X2QA 2HKQB 2MMPA 3UPUA 4YTLA 2AKLA 1OOTA 3RKWA 2BE9B 2RO0A 2KRNA 2P0KA 1NYFA 4JJBA 1QCFA 4HCZA 5I2MA 5KCOA 2A36A 2RN8A 3REBB 1C0MA 5LJ5h 2RQVA 4XU2A 2HL5C 3EGXA 3TEEA 3L2ZA 3NGPA 1IHWA 2K5FA 1SEMA 3LLRA 5LJ3j 1MMDA 3CD6Q 4BACA 1PKSA 1AEYA 4BDYA 4EIKA 1UB4A 2RMOA 3CCST 2AHJB 5FWCA 1N9RA 3M0SA 4JZ3A 2DJQA 2E3HA 2FPEA 4FSSA 1VQ5Q 4JS5A 2O9SA 2CZ0B 3UT1A 4N4IA 3FRNA 1YBYA 1SSFA 2RH2A 1VQ7Q 1G2BA 1BIBA 3R6NA 1G83A 4E7KA 1WNLA 8AT1B 3JCMh 2LT1A 5HK0A 1QVGS 1PD1A 4J9GA 4R0KA 2X3XD 4N4GA 3WXMB 3MEVA 1VQLT 1VUBA 1GCPA 1G3YA 3X20B 2K6DA 4D6WA 4M77F 4FU6A 1BYMA 5A0DA 3UWNA 1TUCA 4B9XA 4BDZA 1AWXA 2K79A 3JRZA 1W2BA 2CT3A 2DMOA 2E6NA 1VQ4Q 1I5LA 1WHLA 3TU4K 7AT1B 2CP0A 1TS9A 4C92C 3RERA 4PJOD 1X75C 2DEQA 3L2RA 3S3NA 1ZHIA 1PKTA 2EVRA 5ECAA 3G71T 3VS6A 4RKUE 3PFSA 1DJ7B 2K5IA 1XNIA 1Q81U 4HCBA 2HAXA 3EHRA 2DBMA 1QVFS 4IURA 4EMKB 1VQKT 2EQIA 3EG0A 2D8HA 3RIRA 4AFSC 4C5IA 3M57A 4FSXA 2DYIA 2LVMA 2QI2A 5J26A 4ELYC 3AHUA 1HK9A 5IHNA 1M1KR 3PT9A 1VYVA 4DBFA 1VQNA 3OMGA 4E2FB 2LMJA 2DX1A 2L2PA 4D8DA 4M75D 1TUGB 2FEIA 3VUZA 4HXJA 2ENMA 1NJIR 3SB2A 1X27A 2F2VA 4OMOA 4M7DF 4KUIA 3META 5GMKh 3CCEA 4M7DB 4DA4A 2L3PA 2FVUA 1PRMC 2F2WA 5CKDA 1KC8U 3RBBB 4LDXA 1GL5A 4M7AA 2AZVA 1M4ZA 2FRYA 1VQ7T 4J9CA 3L2WA 4DEYA 4A4FA 3MJXA 3HSBA 1YJ9A 2V26A 1M1FA 3QWYA 4ELZC 4J9FA 2DZCA 4Y92A 2PVGB 6AT1B 4FYWB 3OS2A 4Z89A 4HVUA 2LQKA 1BI2A 1OEBA 2EYXA 3OYIA 1AWJA 2LNHB 5FU7C 5FW9A 3EH2A 4LD6A 2R58A 2KXDA 2OTJQ 4II1A 1G3TA 2YXYA 3BY7A 2CUDA 1Q7YU 2JTEA 3QPHA 2EQUA 1H92A 2GF7A 1UUEA 1MV3A 3TCJA 1UGRB 3I56T 2QEXT 4HVWA 1X01A 5GAN7 1BCMA 2CZ7B 3EFRA 5GMKi 1GRIA 1SF9A 5D6XA 3Q1JA 4RCBA 4DOWA 1NJIC 2LT4A 2EKOA 4RTZA 1I5OB 4C8QA 1PM3A 3MP1A 5GAMg 3RUXA 4QQGA 2ED1A 1W4SA 3QWXX 2XICA 3A8OB 3CCEQ 2I0NA 2KYMA 5LJ5g 4MDXA 2XG8D 4DBHA 2DL5A 3OYHA 2YSQA 4ZTFA 1HSQA 2YWWA 1FX7A 3CC7T 4M77G 2R5AA 3V7CA 1OX9A 2E4HA 2OAWA 2QQAA 4PJNA 2DIQA 4LUDA 2FPFA 3OYGA 2KDSA 1VQ8A 2YT6A 5IXFA 4M78F 1YJ9Q 2LCCA 3QG1A 5KYXA 4M78B 1K4US 4OF1A 1NEBA 2L3QA 2GTJA 4JJDA 3OYBA 3CCVA 1WXTA 2YHTA 1WHGA 3SHWA 4F7UF 3A8LB 1H641 3E9GA 2ATCB 3X28B 1R77A 3JCMJ 2DBKA 3SEMA 2KYBA 4KBMB 3H41A 3RMSA 3EGDA 5KYWA 3VRZA 4F16A 2ZAEA 3HRTA 2JS0A 4FW2A 5FU6C 5CIUA 4E7LA 2DIGA 3QBYA 5J39A 3CC4T 3L1AA 2H8HA 4WF2A 2I2LA 4DQ2A 2VV5A 3UATA 3VS0A 3CCMA 2DVEA 3SWNB 5I11A 3QKJA 4Z8AA 1KQSS 5GAN8 3GNGA 2O31A 3QIIA 1W1FA 2MWOA 1D3BB 3PNWC 2RHYA 4FCYA 2X35A 2QDLA 5J3BA 3KFVA 1SHGA 3CCJT 1VQMT 1UGQB 3JCMd 2ZPGB 1Y7XA 5C0MA 1BKBA 1YITA 2KROA 2FB7A 3C12A 3H0IA 1YNZA 1M5Q1 4ZGEB 1D09B 1QKXA 4BI4A 2KK4A 3QHSA 2MAMA 1VYTA 3KXTA 3PIOA 4MMLA 4Q5WA 4J83A 5DLQE 1M3AA 4OB2B 1M1GA 2RI3A 3LWHA 3V8JA 2FZKB 4M77E 1PG5B 3HTRA 1VQ6Q 2G3RA 3LH5A 3ULRB 1VQ8Q 1U06A 4HT9A 4BI3A 4IIOA 2AKKA 1P92A 2DD4A 2QASA 1WHKA 4KT0E 4XTZA 1OU8A 2FO0A 3JCMX 2R5MA 1Y07A 1M8VA 1KD1U 1KQ1A 5FROA 1IHVA 5HKCA 4J9HA 2DXUA 1D0YA 1SRMA 3GNFB 4N0AC 5LJ5j 2E12A 3EG3A 4XTWA 3CPWS 3CCSA 2KI7A 4LNPA 4J9EA 4J5YA 3OYFA 2BIVA 2MK5A 1RLQC 2Y4XA 2YRCA 5IN1A 3M4GA 1Q86C 4Z88A 4LN2A 5IAYA 5LJ3e 2D0QB 1K73R 2D6FA 1GBRA 1IO6A 4PJOF 3L42A 2CYZB 1F1BB 2KQWA 3PMTA 2CH4A 3M5AA 3SFMA 1VQPQ 5A0GA 2RJEA 4OP0A 2EQMA 1NBEB 3R6OA 1VQLA 4J9BA 1LOJA 4A4KA 4C0FA 1JXMA 5HK3A 1HXDA 2L5QA 2ROTA 2BE7D 2COZA 1W6XA 2DA9A 3LW5E 2RD1A 2EYZA 3G4ST 5FRMA 3C4SA 1PHTA 2K5LA 4JLGA 1N8RR 4OMFB 2KVQG 2COWA 2K9GA 1K8AC 4A4HA 2YUQA 4M75F 1QP3A 1B7TA 3G71A 4M75B 4M78G 3LGFA 3JCMf 1OZ2A 2EGAA 1TSFA 2FZGB 1SRLA 5FU6B 2O01E 1VQKA 3CBPA 4F7UG 4IIMA 4KRTA 3CCSQ 4AFZC 3I9QA 4XTXA 1K73C 2W10A 2GCXA 1VQ6T 1VQ9T 3A8MB 1JXOA 3RKYA 5AT1B 4F04B 2ESWA 2QQSA 4D8KA 5LJ3d 1NM7A 2HSPA 3L2VA 1W2BS 4RTXA 2LP5A 3TQ7P 5CO7A 4O5VA 1QLYA 5CKBA 4M77C 1CKBA 3OYYA 1I81A 4OMPA 4QVZA 3MPUB 5GAOp 1VQLQ 2BZ8A 1EZZB 3VS2A 2BZYA 4JDSA 3GP8A 4EMKA 1W70A 2RK2A 4C92D 3V8KA 1N8RC 1IRXA 2DL8A 2FL7A 4IUQA 4F14A 2LQNA 1PSFA 4JJCA 1U1TA 4M7AG 2NYSA 2C06A 4ESRA 5KYUB 5GMKj 2NUZA 1VQ7A 2EJGA 3FJPA 3JB9J 4NOYA 1VQPT 2DL7A 3CC2T 3DB3A 4XAXB 3QZ5B 3OYCA 1R0CB 3DKMA 5GAOm 3OQ5A 2JTMA 1WHHA 3M54A 2CGHA 2EQKA 1M90R 1XTDA 4CRIA 4P5NA 2F2XA 4XK8E 1HD3A 4N4HA 1M3BA 4M7DA 4KUDK 4RG8A 5GAMh 2MF2A 1JQQA 1RAAB 3I56A 2QEXA 2LCLA 3HFNA 1YJWT 3LH0A 2JUFA 3A8HB 1ZUUA 3NFCA 3L2QA 1WI7A 3RR6A 2WSFE 3VYHB 2C0TA 1KHCA 4C8QG 2R57A 3A8GB 4PJOG 2FHDA 2JTFA 3CMEQ 5L8RE 1ZSZB 1Y0MA 2HDAA 3LGLA 2GTOA 3ER0A 1MNEA 3OW2P 1K76A 3CEYA 3RMQA 1JJ2P 3CCLQ 2DM1A 2YLBA 1TXQA 2LRQA 4RCCA 2LX7A 2EGCA 2HKNA 4PJJA 4MMKA 4DBQA 3CC7A 2O4XB 3PTAA 2HBPA 2HMAA 1Q86U 2JM8A 1GBQA 4M7AE 1WLPB 2QYZA 5LJ3f 2YDLA 1FWZA 2EBPA 3M59A 3JB9I 4LDWA 3LYIA 5EC7A 5KH6A 1M90C 1WDXA 4RTWA 4FL6A 2D0NA 1ZBJA 1BI3A 2AZSA 3OSVA 1PWTA 4FYXB 4RTTA 3G6EQ 3JB9D 4WCIA 5GAN5 2ZCFB 3REAB 1KSWA 9ATCB 3CC4A 5GJVB 5GAN6 5FRNA 1XOVA 3I56Q 2QEXQ 2EQJA 3P8BB 2NUTA 2F5KA 5GMKl 1LNXA 1UFFA 4LDYA 2FPDA 2LX9A 1UGVA 1IGQA 1VOMA 3A1PA 2LQWA 3FIFA 1XJWB 4M78A 1QVGP 8ATCB 3CXCS 4ZTJA 1K8AU 1KIKA 2DKGA 2DTHA 1VIEA 5GMKm 1VQOQ 3EFOB 4JUVA 2Y90A 3CCJA 1VQMA 2QDYB 4C8QE 2E10A 4OB0B 4C5GA 2JXBA 4F7UA 3S6WA 4LDVA 2OTJA 2JS2A 2AT1B 2KBTA 3INZA 2CSIA 3ME9A 1K9MR 3VRYA 2D1XA 3CC7Q 1XQHA 2IVWA 4AG1C 1I8FA 4KGXB 2BUDA 1QP2A 2VGMA 4Y91A 3J80E 5D7UA 4C0DB 1Q82U 1MHNA 3SWNA 5I2SA 2YUPA 2PVDB 1RAFB 1MGQA 3CMET 2X9HA 1OZ3A 2JM9A 3TREA 4OVAA 1PNJA 3I5RA 4BY6C 1D3BA 2GFAA 2BZXA 2C0OA 3EG9B 4XTUA 3KBGA 1QVFP 2CP5A 5HY6A 1M2VB 1NG2A 3CCLT 3OW2A 2J6KA 1YP5A 1Q95G 4DBRA 5GAOq 1WXBA 2CSQA 4E7SA 3I5SA 1BI1A 1SSHA 3JCMc 4BB7A 3CC4Q 1GFDA 2ZPFB 2PZ1A 2VUBA 2HQXA 5KE2A 2J05A 2RM4A 3PIPA 4JRPA 2RQWA 3OYDA 2CUBA 5LJ5e 5GAN4 1ZBXA 1WZOA 2W0ZA 4J6WA 1PSEA 4J7FA 2P4TA 1Y96A 2CP6A 2YUOA 4OMNA 2DNUA 4M7AC 3CCJQ 4BE1A 1VQMQ 2DL4A 4JPBW 2ZGWA 3G6ET 1EIFA 1QVPA 3BW1A 1WPYA 5A0LA 2A3LA 1AHJB 1K9MC 2WSCE 1YHQQ 1ZUKA 3QYGB 4L6V5 4EMGA 1VA7A 1BK2A 3VKIA 4MZTA 1Z9ZA 3G4SA 1M1KC 2OJ2A 3QXEB 1UG1A 2HSEB 4CC4B 3RDVA 2DZ9A 2FG0A 2KE9A 3M58A 2HZYA 4JJNK 3QZ9B 3JCMe 2QQBA 2QXFA 3OA6A 1VQOT 4PJOA 1B07A 1SHFA 5GANg 3QJYA 3HHTB 1QVGA 1LCKA 2QQRA 3JCMV 3T9NA 3CMAQ 1X6OA 4MDWA 1QMCA 4MZMA 2LJ1A 4ZGDB 4LDUA 1OU9A 2DE0X 1HJDA 4C92F 2EGEA 2YRVA 1ZA2B 4C8QC 4C92B 1RUWA 3BFMA 4B9WA 1E6HA 3RNJA 2KEAA 3EFSA 1VQ6A 1VQ9A 1QKWA 2VWFA 3PE0A 2JMCA 2PU9B 5GAMd 1KQ2A 3FJ5A 3CCRT 1CSKA 2K3YA 2NUPB 4DOVA 3P8HA 3OSSC 1RAGB 1J3TA 4JRQA 2COYA 2LNVA 2LDMA 5A2QE 1FXXA 2C0IA 5LJ5d 3MKDA 2PQWA 2DRMA 1WFWA 4M75A 5CKFA 2LZ6B 1QVFA 3VV0A 1H3HA 4QQ6A 1NLPC 3RKXA 4C0ZA 5FLXE 2M0YA 2QK0A 5KE3A 1U5SA 5IT9E 1TH7A 2JW4A 2M16A 3G4SQ 4PK4A 2O9VA 3NTHA 3FLGA 4IUVA 4FW1A 4CC7A 1PC0A 2JT4A 4X9DA 1CKAA 2RJCA 1WYXA 1Y71A 3J7AF 2PNIA 2EW3A 3HRSA 3ZBDA 4JLIA 1VQPA 2XU8A 1FYNA 2LTOA 3M55A 2PUKB 5CCAA 3EAEA 2IPOB 1UHCA 1I4K1 2DL3A 2L3RA 4NL3A 2JMAA 4A53A 2CH4W 5GMKe 3AT1B 1K1ZA 1YHQT 4FYVB 3JSCA 3GPLA 3QSUA 4RUGA 1UTIA 4BE2A 2P0QA 4XTVA 3SD4A 4M7DG 1V29B 2A28A 3HFOA 4E47A 1VQ9Q 3TVTA 2VB6A 4R55A 3GIBA 1KQSP 3JB9H 1RAIB 1YJWA 2RA2A 2LJ0A 5FWBA 3THKA 5GANj 4J9IA 5FU7B 1UJYA 2DJZA 3U23A 3E2UA 3CMAT 5GAMj 2MCNA 2DK3A 5KYYA 2ABLA 2MOXA 2E5QA 2NLUA 1D1AA 1WHMA 2HL3A 4IKFA 3JB9F 2K2MA 3L2UA 1YJNT 4PFPA 2JJ9A 2X4XA 1Q81R 1V76A 1OYXA 3CCUT 2E64A 4CC2A 2KNBB 1YN8A 1B34B 1JB0E 5GAMf 1B3QA 3OYNA 3JCMP 1YIJT 3NHNA 2DYBA 2RJFA 1RABB 1SKUB 3OY9A 1RACB 4KH0B 1MMNA 3CC2Q 1TTHB 1TOVA 3P8DA 3NTIA 4FYYB 5LJ5f 1KK7A 1ARKA 3QDRB 2RQRA 3EH1A 2VC8A 1OX8A 4X9CA 1AT1B 4HCCA 1ZSZA 3PGGA 3OYLA 1Q82R 3ZL7C 3CPWP 4V2SA 4EDUA 2E6ZA 4M7DE 4OMMA 4AT1B 4ORZA 2KMTA 1MNDA 1IZ6A 2K3BA 4EMHA 5D6WA 2K3XA 5CR2A 2EKHA 1YJWQ 3M53A 1KC8R 4RG2A 2QG9B 3I35A 3OYMA 1NJIU 2CP2A 4AFQC 2RI2A 1UGSB 2RQUA 4PLIA 2J6FA 2DERA 3I55T 1D0ZA 2O2OA 2B8AA 4E7JA 1NZ9A 2QAZA 2QQ9A 2JVVA 3EGDB 1LJOA 2VASA 1U8RA 2MI6A 2X4YA 2ED0A 5AYFA 2VKNA 1GCQA 2EPDA 1KQSA 1Q7YR 4XTYA 4E7ZA 3OYAA 2YUNA 3CMEA 3H0HA 5IXBA 4Z02A 5I22A 1D0XA 2ZZDA 2ZPHB 4PJMA 1T0JA 4RMOA 1D1BA 2GQVA 4XU1A 3VS5A 4WTOB 3D7SB 1AWWA 4FM4B 1FMKA 1R0BG 3CCVT 3CCLA 2DXTA 4BD3A 3JV3A 2PTKA 2D9TA 4M4ZA 1WJRA 2XDBA 1KC8C 4IUPA 4GLKA 1R8OB 3M0RA 3VUBA 2RQTA 4EMKC 5GAOl 2PVOB 1RADB 1W2BP 5DY9A 3JAME 4QQDA 2GBQA 4PFZA 1K9AA 1FMWA 4C0GA 3WVDB 1JO8A 1QQJA 4UC4A 4KULA 2HQHA 1EFNA 4M78E 3M0QA 3OB9A 4E7IA 3G6EA 2HD0A 3M0PA 2X3WD 2K7AA 2E5KA 2G6FX 2OX7A 3O5ZA 1X69A 3S3MA 4F7UE 5GANh 4PKCC 4OB1B 4K11A 3OBYA 1K0SA 2O88A 4HVVA 1KHIA 1ACMB 2DLPA 2DPPB 4ATOA 3MHXA 1Q7YC 2X4JA 2KSSA 3V7RA 1UECA 2E1HA 3E1SA 1BI0A 2CKKA 2V8IA 4LUEA 4CI0C 1I07A 4OB3B 2V1QA 4M7DC 2JN0A 2DXCA 1VQOA 4E6RA 2HEQA 3JCMb 4OMLA 1AWOA 5GAN3 2E41A 2L3SA 3OBWA 2D8JA 2KXCA 3LX7A 4FT2A 2OAUA 2K57A 2RJDA 3FB9A 3G1JA 4PL6A 4PLLA 5L23A 1E7OA 2EFIA 4C5HA 4PNOA 2DILA 2XDDA 1FMVA 3GLXA 4HCKA
chains in the Genus database with same CATH topology
1K73R 1KC8R 3G6EQ 1VQLQ 1K9MR 3CMEQ 1YHQQ 3CD6Q 1VQ7Q 1Q82R 1QVFP 3CCUQ 3CC7Q 3CCMQ 1QVGP 1YJ9Q 1W2BP 3CPWP 1VQ4Q 3G71Q 3CMAQ 1VQOQ 1M1KR 1VQ6Q 1VQ8Q 2OTLQ 1VQ9Q 1VQPQ 3OW2P 1YI2Q 3CCEQ 1KD1R 1N8RR 1VQNQ 3CC2Q 3G4SQ 3CCLQ 1Q7YR 1JJ2P 1S72Q 3CCJQ 1VQMQ 1YIJQ 1M90R 1KQSP 1VQ5Q 1Q86R 2QA4Q 3CCRQ 2QEXQ 3I56Q 3CCSQ 3CCVQ 3CCQQ 1YITQ 1Q81R 1VQKQ 1NJIR 3CC4Q 1K8AR 2OTJQ 1YJNQ 3I55Q 1YJWQ 3CXCP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K73 R;  1KC8 R;  3G6E Q;  1VQL Q;  1K9M R;  3CME Q;  1YHQ Q;  3CD6 Q;  1VQ7 Q;  1Q82 R;  1QVF P;  3CCU Q;  3CC7 Q;  3CCM Q;  1QVG P;  1YJ9 Q;  1W2B P;  3CPW P;  1VQ4 Q;  3G71 Q;  3CMA Q;  1VQO Q;  1M1K R;  1VQ6 Q;  1VQ8 Q;  2OTL Q;  1VQ9 Q;  1VQP Q;  3OW2 P;  1YI2 Q;  3CCE Q;  1KD1 R;  1N8R R;  1VQN Q;  3CC2 Q;  3G4S Q;  3CCL Q;  1Q7Y R;  1JJ2 P;  1S72 Q;  3CCJ Q;  1VQM Q;  1YIJ Q;  1M90 R;  1KQS P;  1VQ5 Q;  1Q86 R;  2QA4 Q;  3CCR Q;  2QEX Q;  3I56 Q;  3CCS Q;  3CCV Q;  3CCQ Q;  1YIT Q;  1Q81 R;  1VQK Q;  1NJI R;  3CC4 Q;  1K8A R;  2OTJ Q;  1YJN Q;  3I55 Q;  1YJW Q;  3CXC P; 
#chains in the Genus database with same CATH topology
 1M8M A;  5CK9 A;  5KCH A;  1X2K A;  1HYO A;  1N6A A;  2WAC A;  4M7A D;  1YWP A;  1UE9 A;  2QA4 T;  4C5E A;  3JCM Q;  1YI2 Q;  3PVQ A;  3CCR A;  1C6V X;  5I21 A;  2RNA A;  5GJW B;  1QCN A;  2VYT A;  2ZPI B;  2DAQ A;  2ROL A;  3DLM A;  4ZN3 A;  3CCQ Q;  1LPL A;  2M02 A;  1RAH B;  2CT4 A;  2LQ8 A;  4M75 G;  4XU3 A;  3N5B B;  2VVK A;  2J7I A;  4LXC A;  2A7Y A;  2OTL T;  3URG A;  3VS4 A;  4JRK A;  3ASK A;  3OYJ A;  3H8Z A;  3M56 A;  4QVD A;  2KT1 A;  4BI8 B;  3GBQ A;  1KD1 R;  1NEG A;  1JRI A;  2A08 A;  4C92 A;  1PD0 A;  3ZFJ A;  1KJW A;  1ABO A;  1ZLM A;  2KY9 A;  2PUO B;  2QTV A;  2SRC A;  2QGG A;  4M77 B;  1OUL A;  1M9S A;  4AG2 C;  3MP8 A;  2ZPB B;  3FC3 A;  1I1J A;  4XQ3 A;  2EJ9 A;  3A5Z B;  3QJ6 A;  1S72 T;  5HCK A;  1AZG B;  2NUP A;  1ZSG A;  4A4G A;  2E3I A;  2KGT A;  4C8Q D;  4PJO E;  1JBM A;  1ZA1 B;  3UA7 A;  3MEU A;  3VU3 C;  3WVE B;  1QWF A;  1EX4 A;  5DLO A;  1T3S A;  1YHQ A;  2FZC B;  2KAF A;  1N5Z A;  4IUT A;  4M78 C;  1ZQ1 A;  3EHQ A;  1H8K A;  4FIB A;  2XDP A;  2E70 A;  1K73 U;  1T0H A;  1RAE B;  2GQI A;  3EG1 A;  3MEA A;  4KGZ B;  4J6X A;  1M3C A;  1ZUY A;  3UF4 A;  2K2V A;  1BIA A;  2MYS A;  3F70 A;  4HA8 A;  1TWB A;  3CCR Q;  3HPW A;  4F17 A;  1I0C A;  3VYG A;  3CXC P;  1GFC A;  3CMA A;  3H9N A;  1IXD A;  1AD5 A;  3EGU A;  2VXE A;  1QCO A;  1OPL A;  4JRI A;  1O9S A;  5CKE A;  1N9S A;  4M75 E;  1KD1 C;  3SWN C;  4RTU A;  1JJ2 A;  4E7H A;  1YJN A;  5GAN e;  3CD6 T;  2GGR A;  1D1C A;  5GAM e;  3DLL A;  2VGN A;  3CCU A;  1N8R U;  4J8O A;  2XHC A;  4A54 A;  1YI2 T;  1AVZ C;  1VQ5 T;  1N27 A;  2DFU A;  1NLO C;  5M9O A;  1YIJ A;  1BB9 A;  3M0T A;  2QTX A;  3CCQ T;  1Y57 A;  2BTT A;  2M51 A;  1Z9Q A;  2DRK A;  5IHK A;  3IQL A;  2BKD N;  2RHI A;  4KGV B;  1UHF A;  2Z0W A;  5GAO r;  1OI1 A;  3EGX B;  3TSW A;  3X25 B;  1PCX A;  2F69 A;  2DET A;  4LE9 A;  3BE3 A;  5CQY A;  3BDU A;  3GF5 A;  4TVR A;  3NPF A;  3J81 E;  4PFO A;  2JOY A;  3E9F A;  1B34 A;  4LD9 K;  1VQ4 T;  3M9Q A;  3CBM A;  2L89 A;  2X4W A;  2YLC A;  4QT7 A;  4R56 A;  4J9D A;  2V8K A;  1RI9 A;  5LJ3 h;  3M4Y A;  3NMZ C;  5D6Y A;  2HNI A;  2J06 A;  1YCY A;  4RTV A;  1VQN Q;  3RES A;  2RPN A;  1M2O A;  2FRW A;  1RLP C;  3I55 A;  3OYK A;  3TSZ A;  3S3O A;  2EIF A;  1TUD A;  3HP9 A;  1YJN Q;  4PJO C;  1X6G A;  2EYQ A;  3CCU Q;  5GAN d;  2KR3 A;  3HL8 A;  2DTI A;  3C94 A;  4L5G A;  1TG0 A;  3MCA B;  2NWM A;  2SEM A;  3OS5 A;  1G3S A;  5CVI A;  1YIJ Q;  4X1V A;  2LC4 A;  2RB6 A;  3CBO A;  3CXC A;  2NUT B;  2RHZ A;  1M90 U;  1X43 A;  4PJL A;  1WGS A;  1QWE A;  4J7I A;  3DB4 A;  5KYN A;  4Y28 E;  2M9U A;  2CZ1 B;  2P84 A;  4F7U B;  2ZPE B;  2GNC A;  3EG2 A;  5GAO n;  4M75 C;  1WQ7 A;  4ANJ A;  2RK1 A;  5LL6 S;  3NTK A;  2CS7 A;  4X34 A;  3UA6 A;  1V1C A;  3PMI A;  3JCM g;  1M30 A;  1X6B A;  1ZX6 A;  4JS4 A;  3MO8 A;  4BY6 B;  1WQW A;  1UDL A;  3CC2 A;  3C95 A;  2MIO A;  5DM7 R;  2Y4Y A;  3FDR A;  1KG1 A;  4J6Y A;  4ZNX A;  1SPK A;  1Q86 R;  3HRU A;  4NS5 A;  2RF0 A;  3I55 Q;  3OYE A;  1OPK A;  4MZP A;  2A37 A;  1YWO A;  1OV3 A;  2H3J A;  3OS1 A;  1RL2 A;  4AFU C;  1A0N B;  2MPX C;  4QW2 A;  1AOJ A;  2K4Y A;  1WJS A;  2AIR B;  4M77 D;  2EJF A;  2OTJ T;  1IRE B;  4KH1 B;  1QW1 A;  4M7A F;  1G8X A;  2HBW A;  2AK5 A;  5KYU A;  4M7A B;  3V8L A;  4ZGJ B;  3VS1 A;  1WXU A;  4QKU A;  4AMC A;  1MMA A;  4CC3 A;  2CZ6 B;  1VQN T;  3V7S A;  1VIF A;  3OS0 A;  3SDZ A;  4N0A A;  4HKE A;  3QDF A;  2JZ2 A;  1Y96 B;  1WX6 A;  2XID A;  2M1H A;  3OMC A;  2DF6 A;  3X26 B;  1MUZ A;  3CCV Q;  1K8A R;  4VUB A;  4BE0 A;  1BBZ A;  3X24 B;  1JU5 C;  5GAN f;  3O8V A;  3CCE T;  4GY5 A;  2LJ3 A;  2CP3 A;  3GOX A;  5EG2 A;  2DTO A;  3G7Z A;  2RHX A;  2QA4 A;  4IUU A;  4QVC A;  2X51 A;  2ECZ A;  4L59 A;  1WIE A;  2YRD A;  2DVJ A;  1YJ9 T;  1E6G A;  4C8Q F;  3CCM Q;  1RI0 A;  4A4E A;  3QYH B;  1UEB A;  4C8Q B;  4PJO B;  2OTL A;  2B86 A;  1VYU A;  2P4R A;  4GBQ A;  5GAN 2;  1SG5 A;  1K9M U;  2HQE A;  4OGC A;  2L8D A;  2DXB A;  3MEW A;  2HCK A;  1BCO A;  1NPR A;  4M7D D;  1H3Z A;  1YIT Q;  2LCS A;  4C92 G;  2DD5 A;  2WSE E;  1M1K U;  1PRL C;  2GFU A;  2O4X A;  1ZSZ C;  1LVK A;  1YFN A;  1MMG A;  5CKH A;  3ZEH A;  2OI3 A;  3H0F A;  4GLM A;  1ABQ A;  4OGE A;  3KUF A;  5IH2 A;  1UGP B;  3E19 A;  1S72 A;  4FT4 A;  5KYX B;  3JCM W;  2KRS A;  1NE8 A;  2JNG A;  2XK0 A;  1Q81 C;  1U3O A;  3M0U A;  5CQX A;  2M0O A;  3QUI A;  4XU0 A;  5KYW B;  5LJ3 g;  4RTY A;  4NL2 A;  5CAI A;  1M27 C;  2DO3 A;  1U1S A;  1T3L A;  2CP7 A;  2H3E B;  4JZ4 A;  4ZN1 A;  1YCS B;  1KFZ A;  1G3W A;  1WA7 A;  2QA4 Q;  3PVL A;  2IIM A;  3BDL A;  2P0P A;  4M77 A;  2EYW A;  2XMF A;  1G5V A;  2E65 A;  1O75 A;  4EPC A;  2RHU A;  1VQ8 T;  3LWI A;  4BUG A;  1OQK A;  2A0F B;  3FEO A;  1WHJ A;  1Q82 C;  2MWP A;  3EFO A;  1GCQ C;  1UJ0 A;  2KT8 A;  2OTL Q;  4OMQ A;  2VXF A;  2V8J A;  4ME7 A;  2IG0 A;  5C6S A;  1S1N A;  3A98 A;  5IHI A;  4DEX A;  2RI5 A;  3CD6 A;  2J6O A;  3CQT A;  1C1A A;  3UDC A;  2QGF B;  2CDT A;  2KRM A;  4C92 E;  1NPP A;  1YI2 A;  3VS7 A;  2CRE A;  3CPF A;  2FYK A;  1VQ5 A;  1TU0 B;  1BU1 A;  1IGU A;  3CCQ A;  1S72 Q;  3CCM T;  4HT8 A;  4O6J A;  3MP6 A;  1IB8 A;  4M78 D;  2F5T X;  2DEU A;  2XKO C;  2XD0 A;  1JEG A;  2F1L A;  2V1R A;  3EG9 A;  2XI9 A;  5KYY B;  1M2V A;  3CPW A;  2EWN A;  4B6M A;  3VS3 A;  3G71 Q;  2EAY A;  1K0X A;  4C0D C;  3QO3 A;  1WJQ A;  1AZE A;  1YIT T;  3JB9 G;  3C0C A;  4A63 B;  3OW2 S;  1GXI E;  1VQK Q;  2EYY A;  3HKS A;  3VJP A;  1JJ2 S;  3H6Z A;  2L0A A;  1VQ4 A;  1NYG A;  1MV0 B;  1X2Q A;  2HKQ B;  2MMP A;  3UPU A;  4YTL A;  2AKL A;  1OOT A;  3RKW A;  2BE9 B;  2RO0 A;  2KRN A;  2P0K A;  1NYF A;  4JJB A;  1QCF A;  4HCZ A;  5I2M A;  5KCO A;  2A36 A;  2RN8 A;  3REB B;  1C0M A;  5LJ5 h;  2RQV A;  4XU2 A;  2HL5 C;  3EGX A;  3TEE A;  3L2Z A;  3NGP A;  1IHW A;  2K5F A;  1SEM A;  3LLR A;  5LJ3 j;  1MMD A;  3CD6 Q;  4BAC A;  1PKS A;  1AEY A;  4BDY A;  4EIK A;  1UB4 A;  2RMO A;  3CCS T;  2AHJ B;  5FWC A;  1N9R A;  3M0S A;  4JZ3 A;  2DJQ A;  2E3H A;  2FPE A;  4FSS A;  1VQ5 Q;  4JS5 A;  2O9S A;  2CZ0 B;  3UT1 A;  4N4I A;  3FRN A;  1YBY A;  1SSF A;  2RH2 A;  1VQ7 Q;  1G2B A;  1BIB A;  3R6N A;  1G83 A;  4E7K A;  1WNL A;  8AT1 B;  3JCM h;  2LT1 A;  5HK0 A;  1QVG S;  1PD1 A;  4J9G A;  4R0K A;  2X3X D;  4N4G A;  3WXM B;  3MEV A;  1VQL T;  1VUB A;  1GCP A;  1G3Y A;  3X20 B;  2K6D A;  4D6W A;  4M77 F;  4FU6 A;  1BYM A;  5A0D A;  3UWN A;  1TUC A;  4B9X A;  4BDZ A;  1AWX A;  2K79 A;  3JRZ A;  1W2B A;  2CT3 A;  2DMO A;  2E6N A;  1VQ4 Q;  1I5L A;  1WHL A;  3TU4 K;  7AT1 B;  2CP0 A;  1TS9 A;  4C92 C;  3RER A;  4PJO D;  1X75 C;  2DEQ A;  3L2R A;  3S3N A;  1ZHI A;  1PKT A;  2EVR A;  5ECA A;  3G71 T;  3VS6 A;  4RKU E;  3PFS A;  1DJ7 B;  2K5I A;  1XNI A;  1Q81 U;  4HCB A;  2HAX A;  3EHR A;  2DBM A;  1QVF S;  4IUR A;  4EMK B;  1VQK T;  2EQI A;  3EG0 A;  2D8H A;  3RIR A;  4AFS C;  4C5I A;  3M57 A;  4FSX A;  2DYI A;  2LVM A;  2QI2 A;  5J26 A;  4ELY C;  3AHU A;  1HK9 A;  5IHN A;  1M1K R;  3PT9 A;  1VYV A;  4DBF A;  1VQN A;  3OMG A;  4E2F B;  2LMJ A;  2DX1 A;  2L2P A;  4D8D A;  4M75 D;  1TUG B;  2FEI A;  3VUZ A;  4HXJ A;  2ENM A;  1NJI R;  3SB2 A;  1X27 A;  2F2V A;  4OMO A;  4M7D F;  4KUI A;  3MET A;  5GMK h;  3CCE A;  4M7D B;  4DA4 A;  2L3P A;  2FVU A;  1PRM C;  2F2W A;  5CKD A;  1KC8 U;  3RBB B;  4LDX A;  1GL5 A;  4M7A A;  2AZV A;  1M4Z A;  2FRY A;  1VQ7 T;  4J9C A;  3L2W A;  4DEY A;  4A4F A;  3MJX A;  3HSB A;  1YJ9 A;  2V26 A;  1M1F A;  3QWY A;  4ELZ C;  4J9F A;  2DZC A;  4Y92 A;  2PVG B;  6AT1 B;  4FYW B;  3OS2 A;  4Z89 A;  4HVU A;  2LQK A;  1BI2 A;  1OEB A;  2EYX A;  3OYI A;  1AWJ A;  2LNH B;  5FU7 C;  5FW9 A;  3EH2 A;  4LD6 A;  2R58 A;  2KXD A;  2OTJ Q;  4II1 A;  1G3T A;  2YXY A;  3BY7 A;  2CUD A;  1Q7Y U;  2JTE A;  3QPH A;  2EQU A;  1H92 A;  2GF7 A;  1UUE A;  1MV3 A;  3TCJ A;  1UGR B;  3I56 T;  2QEX T;  4HVW A;  1X01 A;  5GAN 7;  1BCM A;  2CZ7 B;  3EFR A;  5GMK i;  1GRI A;  1SF9 A;  5D6X A;  3Q1J A;  4RCB A;  4DOW A;  1NJI C;  2LT4 A;  2EKO A;  4RTZ A;  1I5O B;  4C8Q A;  1PM3 A;  3MP1 A;  5GAM g;  3RUX A;  4QQG A;  2ED1 A;  1W4S A;  3QWX X;  2XIC A;  3A8O B;  3CCE Q;  2I0N A;  2KYM A;  5LJ5 g;  4MDX A;  2XG8 D;  4DBH A;  2DL5 A;  3OYH A;  2YSQ A;  4ZTF A;  1HSQ A;  2YWW A;  1FX7 A;  3CC7 T;  4M77 G;  2R5A A;  3V7C A;  1OX9 A;  2E4H A;  2OAW A;  2QQA A;  4PJN A;  2DIQ A;  4LUD A;  2FPF A;  3OYG A;  2KDS A;  1VQ8 A;  2YT6 A;  5IXF A;  4M78 F;  1YJ9 Q;  2LCC A;  3QG1 A;  5KYX A;  4M78 B;  1K4U S;  4OF1 A;  1NEB A;  2L3Q A;  2GTJ A;  4JJD A;  3OYB A;  3CCV A;  1WXT A;  2YHT A;  1WHG A;  3SHW A;  4F7U F;  3A8L B;  1H64 1;  3E9G A;  2ATC B;  3X28 B;  1R77 A;  3JCM J;  2DBK A;  3SEM A;  2KYB A;  4KBM B;  3H41 A;  3RMS A;  3EGD A;  5KYW A;  3VRZ A;  4F16 A;  2ZAE A;  3HRT A;  2JS0 A;  4FW2 A;  5FU6 C;  5CIU A;  4E7L A;  2DIG A;  3QBY A;  5J39 A;  3CC4 T;  3L1A A;  2H8H A;  4WF2 A;  2I2L A;  4DQ2 A;  2VV5 A;  3UAT A;  3VS0 A;  3CCM A;  2DVE A;  3SWN B;  5I11 A;  3QKJ A;  4Z8A A;  1KQS S;  5GAN 8;  3GNG A;  2O31 A;  3QII A;  1W1F A;  2MWO A;  1D3B B;  3PNW C;  2RHY A;  4FCY A;  2X35 A;  2QDL A;  5J3B A;  3KFV A;  1SHG A;  3CCJ T;  1VQM T;  1UGQ B;  3JCM d;  2ZPG B;  1Y7X A;  5C0M A;  1BKB A;  1YIT A;  2KRO A;  2FB7 A;  3C12 A;  3H0I A;  1YNZ A;  1M5Q 1;  4ZGE B;  1D09 B;  1QKX A;  4BI4 A;  2KK4 A;  3QHS A;  2MAM A;  1VYT A;  3KXT A;  3PIO A;  4MML A;  4Q5W A;  4J83 A;  5DLQ E;  1M3A A;  4OB2 B;  1M1G A;  2RI3 A;  3LWH A;  3V8J A;  2FZK B;  4M77 E;  1PG5 B;  3HTR A;  1VQ6 Q;  2G3R A;  3LH5 A;  3ULR B;  1VQ8 Q;  1U06 A;  4HT9 A;  4BI3 A;  4IIO A;  2AKK A;  1P92 A;  2DD4 A;  2QAS A;  1WHK A;  4KT0 E;  4XTZ A;  1OU8 A;  2FO0 A;  3JCM X;  2R5M A;  1Y07 A;  1M8V A;  1KD1 U;  1KQ1 A;  5FRO A;  1IHV A;  5HKC A;  4J9H A;  2DXU A;  1D0Y A;  1SRM A;  3GNF B;  4N0A C;  5LJ5 j;  2E12 A;  3EG3 A;  4XTW A;  3CPW S;  3CCS A;  2KI7 A;  4LNP A;  4J9E A;  4J5Y A;  3OYF A;  2BIV A;  2MK5 A;  1RLQ C;  2Y4X A;  2YRC A;  5IN1 A;  3M4G A;  1Q86 C;  4Z88 A;  4LN2 A;  5IAY A;  5LJ3 e;  2D0Q B;  1K73 R;  2D6F A;  1GBR A;  1IO6 A;  4PJO F;  3L42 A;  2CYZ B;  1F1B B;  2KQW A;  3PMT A;  2CH4 A;  3M5A A;  3SFM A;  1VQP Q;  5A0G A;  2RJE A;  4OP0 A;  2EQM A;  1NBE B;  3R6O A;  1VQL A;  4J9B A;  1LOJ A;  4A4K A;  4C0F A;  1JXM A;  5HK3 A;  1HXD A;  2L5Q A;  2ROT A;  2BE7 D;  2COZ A;  1W6X A;  2DA9 A;  3LW5 E;  2RD1 A;  2EYZ A;  3G4S T;  5FRM A;  3C4S A;  1PHT A;  2K5L A;  4JLG A;  1N8R R;  4OMF B;  2KVQ G;  2COW A;  2K9G A;  1K8A C;  4A4H A;  2YUQ A;  4M75 F;  1QP3 A;  1B7T A;  3G71 A;  4M75 B;  4M78 G;  3LGF A;  3JCM f;  1OZ2 A;  2EGA A;  1TSF A;  2FZG B;  1SRL A;  5FU6 B;  2O01 E;  1VQK A;  3CBP A;  4F7U G;  4IIM A;  4KRT A;  3CCS Q;  4AFZ C;  3I9Q A;  4XTX A;  1K73 C;  2W10 A;  2GCX A;  1VQ6 T;  1VQ9 T;  3A8M B;  1JXO A;  3RKY A;  5AT1 B;  4F04 B;  2ESW A;  2QQS A;  4D8K A;  5LJ3 d;  1NM7 A;  2HSP A;  3L2V A;  1W2B S;  4RTX A;  2LP5 A;  3TQ7 P;  5CO7 A;  4O5V A;  1QLY A;  5CKB A;  4M77 C;  1CKB A;  3OYY A;  1I81 A;  4OMP A;  4QVZ A;  3MPU B;  5GAO p;  1VQL Q;  2BZ8 A;  1EZZ B;  3VS2 A;  2BZY A;  4JDS A;  3GP8 A;  4EMK A;  1W70 A;  2RK2 A;  4C92 D;  3V8K A;  1N8R C;  1IRX A;  2DL8 A;  2FL7 A;  4IUQ A;  4F14 A;  2LQN A;  1PSF A;  4JJC A;  1U1T A;  4M7A G;  2NYS A;  2C06 A;  4ESR A;  5KYU B;  5GMK j;  2NUZ A;  1VQ7 A;  2EJG A;  3FJP A;  3JB9 J;  4NOY A;  1VQP T;  2DL7 A;  3CC2 T;  3DB3 A;  4XAX B;  3QZ5 B;  3OYC A;  1R0C B;  3DKM A;  5GAO m;  3OQ5 A;  2JTM A;  1WHH A;  3M54 A;  2CGH A;  2EQK A;  1M90 R;  1XTD A;  4CRI A;  4P5N A;  2F2X A;  4XK8 E;  1HD3 A;  4N4H A;  1M3B A;  4M7D A;  4KUD K;  4RG8 A;  5GAM h;  2MF2 A;  1JQQ A;  1RAA B;  3I56 A;  2QEX A;  2LCL A;  3HFN A;  1YJW T;  3LH0 A;  2JUF A;  3A8H B;  1ZUU A;  3NFC A;  3L2Q A;  1WI7 A;  3RR6 A;  2WSF E;  3VYH B;  2C0T A;  1KHC A;  4C8Q G;  2R57 A;  3A8G B;  4PJO G;  2FHD A;  2JTF A;  3CME Q;  5L8R E;  1ZSZ B;  1Y0M A;  2HDA A;  3LGL A;  2GTO A;  3ER0 A;  1MNE A;  3OW2 P;  1K76 A;  3CEY A;  3RMQ A;  1JJ2 P;  3CCL Q;  2DM1 A;  2YLB A;  1TXQ A;  2LRQ A;  4RCC A;  2LX7 A;  2EGC A;  2HKN A;  4PJJ A;  4MMK A;  4DBQ A;  3CC7 A;  2O4X B;  3PTA A;  2HBP A;  2HMA A;  1Q86 U;  2JM8 A;  1GBQ A;  4M7A E;  1WLP B;  2QYZ A;  5LJ3 f;  2YDL A;  1FWZ A;  2EBP A;  3M59 A;  3JB9 I;  4LDW A;  3LYI A;  5EC7 A;  5KH6 A;  1M90 C;  1WDX A;  4RTW A;  4FL6 A;  2D0N A;  1ZBJ A;  1BI3 A;  2AZS A;  3OSV A;  1PWT A;  4FYX B;  4RTT A;  3G6E Q;  3JB9 D;  4WCI A;  5GAN 5;  2ZCF B;  3REA B;  1KSW A;  9ATC B;  3CC4 A;  5GJV B;  5GAN 6;  5FRN A;  1XOV A;  3I56 Q;  2QEX Q;  2EQJ A;  3P8B B;  2NUT A;  2F5K A;  5GMK l;  1LNX A;  1UFF A;  4LDY A;  2FPD A;  2LX9 A;  1UGV A;  1IGQ A;  1VOM A;  3A1P A;  2LQW A;  3FIF A;  1XJW B;  4M78 A;  1QVG P;  8ATC B;  3CXC S;  4ZTJ A;  1K8A U;  1KIK A;  2DKG A;  2DTH A;  1VIE A;  5GMK m;  1VQO Q;  3EFO B;  4JUV A;  2Y90 A;  3CCJ A;  1VQM A;  2QDY B;  4C8Q E;  2E10 A;  4OB0 B;  4C5G A;  2JXB A;  4F7U A;  3S6W A;  4LDV A;  2OTJ A;  2JS2 A;  2AT1 B;  2KBT A;  3INZ A;  2CSI A;  3ME9 A;  1K9M R;  3VRY A;  2D1X A;  3CC7 Q;  1XQH A;  2IVW A;  4AG1 C;  1I8F A;  4KGX B;  2BUD A;  1QP2 A;  2VGM A;  4Y91 A;  3J80 E;  5D7U A;  4C0D B;  1Q82 U;  1MHN A;  3SWN A;  5I2S A;  2YUP A;  2PVD B;  1RAF B;  1MGQ A;  3CME T;  2X9H A;  1OZ3 A;  2JM9 A;  3TRE A;  4OVA A;  1PNJ A;  3I5R A;  4BY6 C;  1D3B A;  2GFA A;  2BZX A;  2C0O A;  3EG9 B;  4XTU A;  3KBG A;  1QVF P;  2CP5 A;  5HY6 A;  1M2V B;  1NG2 A;  3CCL T;  3OW2 A;  2J6K A;  1YP5 A;  1Q95 G;  4DBR A;  5GAO q;  1WXB A;  2CSQ A;  4E7S A;  3I5S A;  1BI1 A;  1SSH A;  3JCM c;  4BB7 A;  3CC4 Q;  1GFD A;  2ZPF B;  2PZ1 A;  2VUB A;  2HQX A;  5KE2 A;  2J05 A;  2RM4 A;  3PIP A;  4JRP A;  2RQW A;  3OYD A;  2CUB A;  5LJ5 e;  5GAN 4;  1ZBX A;  1WZO A;  2W0Z A;  4J6W A;  1PSE A;  4J7F A;  2P4T A;  1Y96 A;  2CP6 A;  2YUO A;  4OMN A;  2DNU A;  4M7A C;  3CCJ Q;  4BE1 A;  1VQM Q;  2DL4 A;  4JPB W;  2ZGW A;  3G6E T;  1EIF A;  1QVP A;  3BW1 A;  1WPY A;  5A0L A;  2A3L A;  1AHJ B;  1K9M C;  2WSC E;  1YHQ Q;  1ZUK A;  3QYG B;  4L6V 5;  4EMG A;  1VA7 A;  1BK2 A;  3VKI A;  4MZT A;  1Z9Z A;  3G4S A;  1M1K C;  2OJ2 A;  3QXE B;  1UG1 A;  2HSE B;  4CC4 B;  3RDV A;  2DZ9 A;  2FG0 A;  2KE9 A;  3M58 A;  2HZY A;  4JJN K;  3QZ9 B;  3JCM e;  2QQB A;  2QXF A;  3OA6 A;  1VQO T;  4PJO A;  1B07 A;  1SHF A;  5GAN g;  3QJY A;  3HHT B;  1QVG A;  1LCK A;  2QQR A;  3JCM V;  3T9N A;  3CMA Q;  1X6O A;  4MDW A;  1QMC A;  4MZM A;  2LJ1 A;  4ZGD B;  4LDU A;  1OU9 A;  2DE0 X;  1HJD A;  4C92 F;  2EGE A;  2YRV A;  1ZA2 B;  4C8Q C;  4C92 B;  1RUW A;  3BFM A;  4B9W A;  1E6H A;  3RNJ A;  2KEA A;  3EFS A;  1VQ6 A;  1VQ9 A;  1QKW A;  2VWF A;  3PE0 A;  2JMC A;  2PU9 B;  5GAM d;  1KQ2 A;  3FJ5 A;  3CCR T;  1CSK A;  2K3Y A;  2NUP B;  4DOV A;  3P8H A;  3OSS C;  1RAG B;  1J3T A;  4JRQ A;  2COY A;  2LNV A;  2LDM A;  5A2Q E;  1FXX A;  2C0I A;  5LJ5 d;  3MKD A;  2PQW A;  2DRM A;  1WFW A;  4M75 A;  5CKF A;  2LZ6 B;  1QVF A;  3VV0 A;  1H3H A;  4QQ6 A;  1NLP C;  3RKX A;  4C0Z A;  5FLX E;  2M0Y A;  2QK0 A;  5KE3 A;  1U5S A;  5IT9 E;  1TH7 A;  2JW4 A;  2M16 A;  3G4S Q;  4PK4 A;  2O9V A;  3NTH A;  3FLG A;  4IUV A;  4FW1 A;  4CC7 A;  1PC0 A;  2JT4 A;  4X9D A;  1CKA A;  2RJC A;  1WYX A;  1Y71 A;  3J7A F;  2PNI A;  2EW3 A;  3HRS A;  3ZBD A;  4JLI A;  1VQP A;  2XU8 A;  1FYN A;  2LTO A;  3M55 A;  2PUK B;  5CCA A;  3EAE A;  2IPO B;  1UHC A;  1I4K 1;  2DL3 A;  2L3R A;  4NL3 A;  2JMA A;  4A53 A;  2CH4 W;  5GMK e;  3AT1 B;  1K1Z A;  1YHQ T;  4FYV B;  3JSC A;  3GPL A;  3QSU A;  4RUG A;  1UTI A;  4BE2 A;  2P0Q A;  4XTV A;  3SD4 A;  4M7D G;  1V29 B;  2A28 A;  3HFO A;  4E47 A;  1VQ9 Q;  3TVT A;  2VB6 A;  4R55 A;  3GIB A;  1KQS P;  3JB9 H;  1RAI B;  1YJW A;  2RA2 A;  2LJ0 A;  5FWB A;  3THK A;  5GAN j;  4J9I A;  5FU7 B;  1UJY A;  2DJZ A;  3U23 A;  3E2U A;  3CMA T;  5GAM j;  2MCN A;  2DK3 A;  5KYY A;  2ABL A;  2MOX A;  2E5Q A;  2NLU A;  1D1A A;  1WHM A;  2HL3 A;  4IKF A;  3JB9 F;  2K2M A;  3L2U A;  1YJN T;  4PFP A;  2JJ9 A;  2X4X A;  1Q81 R;  1V76 A;  1OYX A;  3CCU T;  2E64 A;  4CC2 A;  2KNB B;  1YN8 A;  1B34 B;  1JB0 E;  5GAM f;  1B3Q A;  3OYN A;  3JCM P;  1YIJ T;  3NHN A;  2DYB A;  2RJF A;  1RAB B;  1SKU B;  3OY9 A;  1RAC B;  4KH0 B;  1MMN A;  3CC2 Q;  1TTH B;  1TOV A;  3P8D A;  3NTI A;  4FYY B;  5LJ5 f;  1KK7 A;  1ARK A;  3QDR B;  2RQR A;  3EH1 A;  2VC8 A;  1OX8 A;  4X9C A;  1AT1 B;  4HCC A;  1ZSZ A;  3PGG A;  3OYL A;  1Q82 R;  3ZL7 C;  3CPW P;  4V2S A;  4EDU A;  2E6Z A;  4M7D E;  4OMM A;  4AT1 B;  4ORZ A;  2KMT A;  1MND A;  1IZ6 A;  2K3B A;  4EMH A;  5D6W A;  2K3X A;  5CR2 A;  2EKH A;  1YJW Q;  3M53 A;  1KC8 R;  4RG2 A;  2QG9 B;  3I35 A;  3OYM A;  1NJI U;  2CP2 A;  4AFQ C;  2RI2 A;  1UGS B;  2RQU A;  4PLI A;  2J6F A;  2DER A;  3I55 T;  1D0Z A;  2O2O A;  2B8A A;  4E7J A;  1NZ9 A;  2QAZ A;  2QQ9 A;  2JVV A;  3EGD B;  1LJO A;  2VAS A;  1U8R A;  2MI6 A;  2X4Y A;  2ED0 A;  5AYF A;  2VKN A;  1GCQ A;  2EPD A;  1KQS A;  1Q7Y R;  4XTY A;  4E7Z A;  3OYA A;  2YUN A;  3CME A;  3H0H A;  5IXB A;  4Z02 A;  5I22 A;  1D0X A;  2ZZD A;  2ZPH B;  4PJM A;  1T0J A;  4RMO A;  1D1B A;  2GQV A;  4XU1 A;  3VS5 A;  4WTO B;  3D7S B;  1AWW A;  4FM4 B;  1FMK A;  1R0B G;  3CCV T;  3CCL A;  2DXT A;  4BD3 A;  3JV3 A;  2PTK A;  2D9T A;  4M4Z A;  1WJR A;  2XDB A;  1KC8 C;  4IUP A;  4GLK A;  1R8O B;  3M0R A;  3VUB A;  2RQT A;  4EMK C;  5GAO l;  2PVO B;  1RAD B;  1W2B P;  5DY9 A;  3JAM E;  4QQD A;  2GBQ A;  4PFZ A;  1K9A A;  1FMW A;  4C0G A;  3WVD B;  1JO8 A;  1QQJ A;  4UC4 A;  4KUL A;  2HQH A;  1EFN A;  4M78 E;  3M0Q A;  3OB9 A;  4E7I A;  3G6E A;  2HD0 A;  3M0P A;  2X3W D;  2K7A A;  2E5K A;  2G6F X;  2OX7 A;  3O5Z A;  1X69 A;  3S3M A;  4F7U E;  5GAN h;  4PKC C;  4OB1 B;  4K11 A;  3OBY A;  1K0S A;  2O88 A;  4HVV A;  1KHI A;  1ACM B;  2DLP A;  2DPP B;  4ATO A;  3MHX A;  1Q7Y C;  2X4J A;  2KSS A;  3V7R A;  1UEC A;  2E1H A;  3E1S A;  1BI0 A;  2CKK A;  2V8I A;  4LUE A;  4CI0 C;  1I07 A;  4OB3 B;  2V1Q A;  4M7D C;  2JN0 A;  2DXC A;  1VQO A;  4E6R A;  2HEQ A;  3JCM b;  4OML A;  1AWO A;  5GAN 3;  2E41 A;  2L3S A;  3OBW A;  2D8J A;  2KXC A;  3LX7 A;  4FT2 A;  2OAU A;  2K57 A;  2RJD A;  3FB9 A;  3G1J A;  4PL6 A;  4PLL A;  5L23 A;  1E7O A;  2EFI A;  4C5H A;  4PNO A;  2DIL A;  2XDD A;  1FMV A;  3GLX A;  4HCK A; 
#chains in the Genus database with same CATH homology
 1K73 R;  1KC8 R;  3G6E Q;  1VQL Q;  1K9M R;  3CME Q;  1YHQ Q;  3CD6 Q;  1VQ7 Q;  1Q82 R;  1QVF P;  3CCU Q;  3CC7 Q;  3CCM Q;  1QVG P;  1YJ9 Q;  1W2B P;  3CPW P;  1VQ4 Q;  3G71 Q;  3CMA Q;  1VQO Q;  1M1K R;  1VQ6 Q;  1VQ8 Q;  2OTL Q;  1VQ9 Q;  1VQP Q;  3OW2 P;  1YI2 Q;  3CCE Q;  1KD1 R;  1N8R R;  1VQN Q;  3CC2 Q;  3G4S Q;  3CCL Q;  1Q7Y R;  1JJ2 P;  1S72 Q;  3CCJ Q;  1VQM Q;  1YIJ Q;  1M90 R;  1KQS P;  1VQ5 Q;  1Q86 R;  2QA4 Q;  3CCR Q;  2QEX Q;  3I56 Q;  3CCS Q;  3CCV Q;  3CCQ Q;  1YIT Q;  1Q81 R;  1VQK Q;  1NJI R;  3CC4 Q;  1K8A R;  2OTJ Q;  1YJN Q;  3I55 Q;  1YJW Q;  3CXC P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...