1YJNQ

Crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1yjnQ00
1YJWQ 1YIJQ 3CC7Q 1K73R 1VQ5Q 1VQ4Q 1Q86R 1VQ9Q 3CCUQ 1YITQ 3CD6Q 1VQ6Q 1KQSP 2QA4Q 1Q7YR 1KC8R 1NJIR 3CCJQ 1K9MR 1M1KR 3CCRQ 1N8RR 1VQKQ 3G6EQ 1YI2Q 1VQPQ 1K8AR 3CCVQ 3CMEQ 3CCQQ 1VQMQ 1YHQQ 3CCEQ 3I56Q 1VQNQ 1Q81R 2OTLQ 2QEXQ 1YJNQ 1M90R 2OTJQ 3CCMQ 3CC2Q 3CCSQ 1YJ9Q 3CCLQ 3CPWP 1Q82R 1VQLQ 3CXCP 3G4SQ 1VQ8Q 1VQ7Q 1QVFP 3G71Q 1QVGP 3OW2P 1KD1R 3CC4Q 3I55Q 1W2BP 3CMAQ 1VQOQ 1JJ2P 1S72Q
chains in the Genus database with same CATH superfamily
3M9QA 4GBQA 4XTWA 2HAXA 5DLQE 1C1AA 4MDXA 4FW2A 2WACA 2FPDA 3FC3A 4GLKA 1Q95G 1M3AA 4DBRA 1WHKA 1TU0B 2EJFA 2F5TX 3QXEB 2K4YA 4OMPA 1WFWA 3CCMQ 3RUXA 2HL3A 1KHIA 3D7SB 4F7UG 4C8QD 4DEXA 3FLGA 2DXBA 2RI2A 3SEMA 4MZTA 1S1NA 4DA4A 3KFVA 2CZ7B 1K8AU 1VQ4A 2JXBA 2J6FA 3SD4A 3R6OA 1UGRB 3H9NA 1K0SA 3CC2A 1MMDA 1SF9A 4LUDA 2E12A 3JB9H 4ANJA 3CCEA 3QBYA 3EFOB 3QJ6A 3G6EA 5J26A 1N6AA 1B34A 3DLMA 3E2UA 1OYXA 1VQOT 5LJ3g 3MO8A 1Q82C 1HK9A 4M78D 2KK4A 5FU6B 1OU9A 2HSEB 3JB9D 2FB7A 2RI3A 2RHYA 1Z9ZA 3C95A 2JN0A 5KYUB 2KXDA 5KYYB 1YJ9Q 2NLUA 1IHVA 4RTYA 3CCLT 1VQLQ 2CZ1B 2KR3A 2V1RA 3QYGB 5LJ5j 2WSFE 2K5IA 1U06A 3QPHA 3CC7Q 1WJSA 5GANe 3OSSC 2LQNA 2F5KA 3TCJA 3OYYA 1QWEA 1XQHA 3FRNA 4Z02A 5GAN7 2MCNA 3HHTB 3KBGA 3T9NA 3PMIA 2W10A 3G71A 3QSUA 4C0DC 2SRCA 3HFNA 2BUDA 4KULA 4OGCA 1D0YA 5HK3A 2YUOA 3A98A 3TSZA 3OYCA 3DKMA 1ZA2B 3OYJA 3V7CA 2LX7A 2R58A 2JM9A 2KAFA 1VQKQ 2VGNA 3G6EQ 4C5GA 3CCVQ 4X9CA 3HRTA 1YHQT 3TEEA 2O4XB 3BFMA 4PJOG 2KYBA 1M3CA 3U23A 3C4SA 5HK0A 5KYXB 2O4XA 5GAMg 1F1BB 2RQWA 2X4XA 3OS5A 3HFOA 1Y96B 4V2SA 4X1VA 3CXCA 4IIMA 2R5MA 4EDUA 4M7AD 2CGHA 4QKUA 2HL5C 1ABOA 2LCLA 5AYFA 2E4HA 1M5Q1 1M9SA 4A4FA 4FT4A 4QT7A 5FU7B 4BE0A 3L2VA 3JCMW 3M0SA 3L42A 2F1LA 1KSWA 2QGGA 3RESA 4C92D 1UB4A 5KE3A 1K8AR 5GMKm 1M4ZA 1YJNT 1Q7YC 3AT1B 2M51A 2EQUA 2XG8D 3CBOA 5CK9A 2K7AA 4PNOA 3G4ST 1LNXA 2XI9A 4MDWA 3MEVA 1SHGA 1QQJA 4PJNA 4MZMA 5C6SA 2CUBA 1NM7A 2MWOA 2ECZA 2V8JA 2JTEA 1Y07A 5LJ5g 5CAIA 1OX9A 3TSWA 5LJ5h 1TUDA 2ZCFB 1ZHIA 2XMFA 1NJIC 2OTJT 4JRKA 4PK4A 1MV0B 2YLBA 4X9DA 1IB8A 2XHCA 2L0AA 2ZPEB 1UECA 2EAYA 3G71T 3NTIA 3M57A 4EMKA 4DBQA 3VJPA 2JOYA 4XTZA 4A4KA 2JTMA 2CDTA 3M54A 3OYKA 2QDYB 2XIDA 2JW4A 1VQ9A 1UHFA 4C5IA 4C8QE 3NGPA 4RCBA 1WHJA 2RQRA 4J9BA 3V7SA 3X20B 5CKDA 1NYFA 1RAIB 3MEWA 1PHTA 1S72T 2K3YA 2DXTA 3EAEA 4IUVA 3A8LB 2L3RA 4M78E 2J6OA 2CP7A 1ABQA 2ZAEA 1IHWA 5D6WA 4E7LA 2COZA 2X4YA 4OMNA 4KGXB 1B7TA 2QEXT 2M16A 1TUCA 5FRNA 2QQSA 1V29B 1KC8C 1TS9A 1IGUA 2B86A 1BKBA 2L89A 1N27A 2CZ0B 3CCUQ 5KYXA 4LD9K 5FWBA 1YJ9A 4B9WA 5FROA 3FIFA 3CCRT 1VYVA 4M7DF 2A36A 2JVVA 1KIKA 1RAHB 2C0TA 1O9SA 2J7IA 3M0RA 2FZGB 1BIAA 4FL6A 2R5AA 2EQJA 2EWNA 5CKBA 3PT9A 4A53A 1VQPA 4MZPA 1SHFA 2DXUA 3CMAT 1OPLA 4JPBW 3RMQA 3OW2A 3JV3A 2V1QA 2NUPA 3QJYA 5KH6A 4C5HA 3O5ZA 4ZGJB 2LCCA 2MMPA 4BE2A 1ZBXA 1UJYA 4QQDA 1VQNQ 3OYDA 1N9RA 3EGUA 3HSBA 3OYEA 1PC0A 4RTVA 1GBRA 1VQ7Q 3EG1A 1JXOA 2GBQA 1VQ5Q 1Q86R 2PTKA 2PVOB 4M7AF 5A0GA 1WZOA 3BY7A 4XK8E 1VQOA 5GAN3 2K3BA 4M77F 1KQ2A 4HCBA 3CCJA 2DZCA 4A4HA 1SSHA 3ZFJA 4D8KA 1SKUB 2O9VA 1ZSZC 4FSXA 2DA9A 1Q86U 2FPFA 4QW2A 4RTZA 4AT1B 4D6WA 1NLPC 1Y0MA 2ABLA 1D09B 1VYTA 2CSQA 3JCMJ 2OTLA 4PJOB 3REAB 1IREB 2KGTA 1TOVA 3A8HB 2PUOB 2ZZDA 2L2PA 4J9CA 3HKSA 4KGZB 1O75A 3ZBDA 3FJPA 2RHXA 2FYKA 3I5RA 4XU1A 3JCMX 5GANd 2ED1A 1E6GA 2LTOA 3FJ5A 4KGVB 3CCQT 4HVWA 1RI0A 2D0QB 1ZUYA 2DYBA 2GCXA 3OYFA 4JJCA 2HQEA 1BI2A 5CKFA 2G3RA 3I35A 1VQOQ 2FO0A 5LL6S 7AT1B 1R0CB 3HRUA 2QXFA 1KQSA 2KT1A 4M77E 3JCMg 4PFZA 4J8OA 2EBPA 5GJVB 2FL7A 5CO7A 5I2SA 2KXCA 3UT1A 1JRIA 3CCLQ 4X34A 1JEGA 2JM8A 3N5BB 2KT8A 3JRZA 1BU1A 4IUPA 2COWA 3META 1MMGA 4IKFA 5I2MA 1W1FA 1H8KA 1FMVA 2D8JA 1N8RR 3X26B 3RKXA 3CCEQ 1WYXA 2BZYA 1H3ZA 2EKOA 2K79A 4M7AA 1E7OA 1NLOC 4DQ2A 2E3IA 4M78C 1M1FA 4C0FA 2QDLA 2YRVA 1U3OA 1XOVA 1WHHA 1X75C 1WNLA 4KH0B 5J39A 1M8VA 4M7DE 1JBMA 5KYUA 1X2KA 1RLPC 1UG1A 2LQWA 2KVQG 3G1JA 2ROLA 3CCVT 2XICA 4A4EA 5IT9E 4C92A 2BZ8A 3VS7A 3MJXA 4JLIA 2AKKA 4E7IA 4OGEA 5HCKA 5CQXA 2HD0A 4ZNXA 1RADB 4B6MA 1KFZA 2MYSA 3FEOA 1B34B 3CPWS 1MV3A 3X24B 1G3TA 2Y90A 3AHUA 3RIRA 1OQKA 2CUDA 1VOMA 2FZCB 2HMAA 3CC2Q 2OAWA 2QQAA 1U1TA 1SG5A 2Z0WA 2CYZB 1UGPB 4C92B 4M75A 2YLCA 2VV5A 5GMKj 3HL8A 1BYMA 2DIGA 3C0CA 3EG3A 4Y28E 2CSIA 2KEAA 3CCVA 2LJ3A 4LD6A 5KCOA 1Q86C 3OW2S 1KK7A 4RKUE 3S3OA 2EQIA 4F04B 5A0DA 3CPWP 1Q82R 3PGGA 4M7DC 1ACMB 2KYMA 4PJOA 3WXMB 5GAN2 3QZ5B 4EPCA 1WXUA 3PTAA 4C0ZA 1YITQ 3V8KA 2RQTA 1A0NB 4Y91A 4J9GA 1HD3A 5CKEA 2ZPHB 2DZ9A 3RNJA 4LDYA 2FG0A 3EH2A 2XDPA 2OTJQ 1T0JA 2DNUA 3QO3A 1UFFA 5GAN8 2GTJA 4BI8B 1HYOA 1YJWA 4Z8AA 2CKKA 1YWPA 4BI3A 4A4GA 3RMSA 3WVDB 1YNZA 5IXFA 3Q1JA 4EMKC 2QG9B 4M75C 2MWPA 1K9MR 4J9EA 1M1KR 4XU2A 3ME9A 3ULRB 4M77G 1TUGB 2DIQA 2LJ1A 4E6RA 2C0OA 1ZA1B 2IIMA 1RAAB 1S72Q 3L2ZA 3CC7T 1KG1A 2YSQA 3VUZA 3RKWA 2NUPB 2DJZA 5GAMh 3CCJQ 5IHKA 4ATOA 2A08A 2EFIA 2DKGA 2EKHA 5IAYA 3OYLA 4JJNK 3HRSA 2AZSA 1YCYA 1YP5A 4BACA 4JZ4A 2LT1A 2PUKB 1YCSB 2ENMA 3JCMc 2DLPA 2X3XD 3HTRA 3E9FA 3HPWA 1D1CA 1NEBA 4RTXA 1QP2A 1XJWB 1I5OB 3EH1A 1VUBA 4FYYB 3CCUT 4XAXB 3GIBA 2L3QA 2EYXA 1Y96A 1I1JA 1VIFA 3O8VA 2CP0A 3OB9A 2DL5A 1ARKA 4C5EA 5LJ3j 2I0NA 2E65A 2YHTA 2JTFA 4IUTA 2H8HA 2LP5A 1VQ8T 5CVIA 2EGCA 3CD6A 4JRQA 4R0KA 4PFPA 2JMCA 1MMNA 1N8RU 1JJ2P 3NHNA 3J7AF 2EYWA 1M2VA 4D8DA 2XKOC 5GAMf 3QYHB 3EGXB 2DJQA 4KRTA 3JB9J 3CCST 1HXDA 5D6YA 4Y92A 3UF4A 4CRIA 4F16A 1MHNA 3JCMf 1YJWT 1GCQC 1MNDA 1OZ3A 4PLLA 1Q81U 1D3BA 5GAN5 5IN1A 1WHLA 2QTVA 4NL3A 3L2WA 3OQ5A 1TXQA 3PMTA 2DPPB 1YJNQ 5FRMA 2HZYA 2E5QA 1TG0A 2COYA 1H3HA 2DO3A 2KRMA 3G4SQ 3S3NA 1Y71A 5LJ5d 5GAOl 4C0GA 1K76A 2V8IA 1M2OA 1K73R 2HKNA 4ZGEB 4XTVA 1RAFB 2F2WA 2DK3A 2VUBA 2RHUA 4DOVA 1ZUUA 1SSFA 2DAQA 1Q7YU 2XDDA 3EG0A 4M75E 3CQTA 1QMCA 3REBB 3JCMb 4IURA 3I55T 2H3JA 3SWNA 3L1AA 4OB0B 3E9GA 1I0CA 3QG1A 4J7IA 2RF0A 3LWHA 2AKLA 4HCCA 4PL6A 4BY6C 3CCUA 2E64A 3BDLA 1XNIA 4OMLA 2X51A 2O9SA 1LVKA 1M2VB 2DVJA 2V26A 2K57A 2PNIA 4QVDA 2EGEA 4ZGDB 4R55A 1PKTA 2RJDA 4J9IA 1OOTA 1D0XA 3HP9A 2RM4A 1ZUKA 2ZPFB 2LDMA 3I55A 1RABB 4FCYA 1WLPB 3TVTA 1NZ9A 3LGFA 3NPFA 1VQ9T 4ESRA 1MMAA 4AFUC 4F17A 1VQ5A 4M7AG 1TWBA 4QVZA 2QQRA 1YI2T 2RNAA 2L3SA 1VYUA 2MOXA 2SEMA 1E6HA 2RK1A 1RAGB 3A8OB 3VS5A 2DEQA 2EYYA 1N5ZA 3QUIA 1UE9A 4A54A 2GQVA 3CMAQ 4KBMB 2FRYA 1VQ4T 1WX6A 2QEXA 3C94A 3VKIA 2JMAA 3M0UA 5FU6C 1WPYA 1QVGS 2KNBB 1QKXA 1W2BP 1J3TA 5IXBA 1VQ5T 4F14A 1EFNA 2F69A 2O01E 4UC4A 3OYNA 1VQPT 4HT9A 4KUDK 2RO0A 4J6YA 2KBTA 4C92F 2VKNA 2YT6A 1D3BB 3ZEHA 1FX7A 1IZ6A 1G83A 1JU5C 1HSQA 3CC4T 4J9HA 2CH4W 1KD1C 1T3LA 1FMKA 4PJLA 8ATCB 2YUQA 3CPWA 2I2LA 2QQBA 1RL2A 2K3XA 4ELYC 1BI0A 1YIJA 1K9AA 1VQMQ 4C8QB 1M90U 4ORZA 2DMOA 1X27A 3V8LA 2BE9B 2RH2A 1D0ZA 2HEQA 2K5FA 3L2RA 5HKCA 2CS7A 4AG2C 1I81A 2M0OA 3OMGA 1U5SA 2LRQA 1OI1A 4PJJA 5I11A 3M0PA 5GAMe 2QTXA 3L2QA 4PJOC 3EFRA 5CQYA 4PJOE 1W4SA 2M1HA 3CCQQ 2DERA 5GAOp 4P5NA 1U1SA 3SHWA 4C8QC 2EYQA 1PG5B 5A0LA 5KYYA 1BB9A 1N8RC 4M78B 1JJ2A 3VYHB 3ASKA 2DRMA 3VV0A 8AT1B 5FU7C 5GJWB 3OA6A 4JUVA 4K11A 1UTIA 2X35A 3QDRB 5GANj 5CKHA 1RLQC 2IPOB 1WJQA 1QVFP 1SRMA 3EG9B 2C06A 4M7AE 2X3WD 4LDWA 4DBFA 4FYVB 2FHDA 3I5SA 4IUUA 3R6NA 3VS0A 3CCJT 2ROTA 2A28A 3P8DA 4LDVA 2ZPIB 3GBQA 2ZGWA 5EG2A 1K73U 2K9GA 4E2FB 3G4SA 2AHJB 4J5YA 4PFOA 4XTXA 3CXCS 1KJWA 2BE7D 2CH4A 4AFQC 1QP3A 2DX1A 3J81E 3EGDB 2DTOA 3BW1A 3PNWC 4M7DG 2RJCA 1JQQA 3CEYA 2QQ9A 2DVEA 4M78A 4BE1A 3LWIA 2OTLT 6AT1B 4N4HA 2K5LA 3MCAB 3VU3C 5GAMj 4DOWA 2EPDA 1VQ8Q 4M77A 3FDRA 2LT4A 4WTOB 3OYAA 1AZGB 2RJFA 5GMKh 3CCRA 1VA7A 4M7DB 3V7RA 2MI6A 1QWFA 2L5QA 2P0PA 5GANf 4HVVA 1EZZB 2HBWA 3ZL7C 4N4GA 1OU8A 2A0FB 1VQLA 3GNFB 1UDLA 4M77D 1IXDA 3CCSQ 3KXTA 2DL4A 5FW9A 3V8JA 5GAOr 1JXMA 5I21A 1G8XA 2DILA 4XU3A 3UPUA 3CPFA 2KE9A 3WVEB 3QIIA 4F7UA 1YJWQ 1GBQA 1PM3A 2MPXC 2E70A 4JS4A 3MP8A 3GF5A 2P0KA 2A37A 1W70A 1AWJA 2JUFA 2CT4A 3UATA 2D1XA 2D8HA 3C12A 2E5KA 1WA7A 4C92C 1QW1A 4WCIA 3UA6A 3X28B 3MHXA 3NTHA 1VQKA 1ZBJA 2O31A 1I8FA 3TREA 2GQIA 1QVGA 1TH7A 5GAOq 2QAZA 1YITT 2GNCA 4FIBA 1RAEB 1UGQB 1W2BA 4LXCA 4C8QF 2EIFA 1LCKA 4XTUA 1UJ0A 1YHQA 1IO6A 4JS5A 1Z9QA 3OS2A 4N0AA 3A8GB 3OSVA 4HCZA 1WJRA 3FB9A 2DTIA 2RMOA 3BDUA 1YIJQ 5LJ5f 1UHCA 3M0TA 5CIUA 3CD6T 2PVGB 4RG8A 2RHIA 4GLMA 2ATCB 1Y57A 4MMKA 2QA4T 5D6XA 3OYBA 2RQUA 1AZEA 4E7HA 1BI1A 1I5LA 4AG1C 1R8OB 4EMKB 3JAME 2GGRA 1BCOA 3NMZC 3CCQA 1NPPA 1PSEA 2Y4YA 4DEYA 5D7UA 4R56A 1C6VX 1WXBA 4CC7A 3OBWA 4KH1B 1MNEA 4L59A 5DY9A 5KYWA 4AFZC 4E7JA 4HT8A 3UWNA 1X43A 1M90R 2LCSA 5GAMd 5GAN4 2D6FA 4LE9A 3OW2P 2Y4XA 1SPKA 4J6WA 1FYNA 3LH5A 2HBPA 1QCFA 4J6XA 1AWOA 3A1PA 4LUEA 4M78G 3CC4A 2G6FX 3M0QA 1BI3A 2W0ZA 4J9DA 3JB9G 3A5ZB 2LJ0A 1AD5A 3SDZA 4E7KA 3A8MB 2OJ2A 3CC7A 4J83A 2JS2A 5EC7A 1OV3A 1R77A 3KUFA 3E19A 3CBPA 1X6GA 1VQ4Q 4AFSC 2YUNA 2PQWA 2RN8A 3M58A 4C8QA 2CP6A 5KE2A 2DFUA 2O88A 3JB9I 1K73C 1NPRA 2EJ9A 1W6XA 3VS1A 2IG0A 3JCMQ 1FXXA 4EMHA 2HQHA 1S72A 4GY5A 4HA8A 2KDSA 5FLXE 3PIOA 2KROA 4KUIA 1VQ6Q 2EVRA 2RPNA 1KC8U 3OYMA 4IUQA 2MK5A 2CP5A 2QA4A 3I56Q 3UDCA 1FWZA 2J06A 2D0NA 4BDYA 2AZVA 1B07A 4FU6A 1JO8A 1QLYA 3H41A 3EGDA 3CC4Q 1M8MA 2OI3A 3JCMe 5DM7R 2DL7A 3M5AA 4NS5A 4NOYA 1AOJA 3CCSA 1K0XA 1RUWA 3BE3A 4WF2A 2BKDN 2D9TA 1QCNA 1VQMT 1PKSA 5IHIA 4YTLA 1AVZC 1TTHB 3CCMT 2P4RA 3NTKA 3TU4K 4M75G 2YRCA 4F7UE 1YI2A 2FRWA 3ER0A 2MIOA 5J3BA 3UA7A 3SB2A 3I55Q 1BIBA 3MP6A 2O2OA 1VQNA 2CZ6B 5I22A 3JSCA 3CMEA 1KQSS 3OY9A 1T3SA 4HKEA 1JJ2S 3VYGA 4FT2A 4RTUA 2GFAA 1VQ7A 1V76A 1NEGA 1NE8A 2ED0A 1VQ8A 4OMFB 1FMWA 4BB7A 3LH0A 5KYNA 2EGAA 3H0FA 5M9OA 5A2QE 1GCPA 2DEUA 3RDVA 2P4TA 1GCQA 4ZN3A 2VYTA 3M55A 3I56A 1QKWA 2CP2A 4A63B 3CCMA 2K6DA 2YXYA 3L2UA 2M02A 5LJ3d 1YJ9T 2E6ZA 1YJNA 2RJEA 5HY6A 2E3HA 1Y7XA 3DLLA 4Z89A 1PRLC 4XTYA 3TQ7P 2M9UA 4RG2A 1TSFA 1VQ9Q 1D1BA 2VVKA 1YI2Q 4N0AC 4RMOA 1AHJB 5KCHA 1WDXA 4MMLA 5GAN6 2DTHA 2QK0A 4PJOF 1BBZA 4F7UB 3GPLA 2LQ8A 1X69A 4M7DD 3IQLA 3URGA 1K9MU 1M1KU 1VQKT 3P8HA 4ME7A 4JZ3A 3S6WA 3G6ET 2YUPA 1HJDA 4LNPA 1RI9A 1YHQQ 3MEAA 1YITA 4M75B 4EMGA 1OULA 1PSFA 1VQMA 2K2VA 2HCKA 2NUZA 2RHZA 5L23A 2HKQB 2DF6A 1MGQA 1X6OA 3GLXA 5FWCA 2JNGA 2L3PA 2VXFA 3P8BB 3M59A 2P84A 4BD3A 4M77B 4KT0E 1R0BG 3INZA 1KQSP 2E6NA 5LJ3f 3CCLA 1VQPQ 3CMET 5GMKi 1AT1B 4C0DB 1CSKA 1UGSB 1PCXA 1GXIE 4O5VA 2GFUA 2ZPBB 1ZLMA 2A3LA 2HSPA 3LYIA 1QVGP 2P0QA 3H0IA 1H641 5CCAA 5GANg 4DBHA 1G2BA 2XD0A 4OB3B 1WQ7A 1K8AC 2YWWA 1QVPA 2WSEE 3LGLA 3QWYA 3CBMA 2DYIA 1WI7A 1ZSZA 4FM4B 4XU0A 2J05A 4M77C 5LJ3h 4CC2A 1V1CA 3VS3A 1NBEB 2XU8A 2DL8A 1P92A 5GAOn 4O6JA 3M4YA 4IIOA 1AWWA 3EHQA 3EGXA 1ZQ1A 2HDAA 5ECAA 4PLIA 2K2MA 4CC4B 1KD1R 1B3QA 3QWXX 1H92A 2NYSA 3EG9A 4B9XA 1GRIA 2DXCA 1N9SA 2MAMA 3OS1A 3RKYA 1DJ7B 1NJIR 3RBBB 3EFSA 2R57A 2M0YA 1JB0E 4ZTJA 3OYHA 2H3EB 2JT4A 2KI7A 2PVDB 3CXCP 1Q81C 2DM1A 3G71Q 5KYWB 4PJMA 2VGMA 4QQ6A 2KSSA 3CD6Q 3H6ZA 3PFSA 3EFOA 2EJGA 2JJ9A 4QQGA 2RQVA 2KRNA 2DBMA 2F2XA 4AMCA 1M30A 2DD4A 4RUGA 1YBYA 3H8ZA 4RCCA 4VUBA 1OEBA 4C8QG 2E41A 1WQWA 1VQLT 2C0IA 4HVUA 1PNJA 1VIEA 1G3YA 1XTDA 2LQKA 2VXEA 3X25B 3MEUA 1W2BS 2EQMA 2DE0X 1IRXA 1I07A 4C92G 1CKAA 2GTOA 1NYGA 2DETA 3CMAA 1K4US 1EIFA 2YRDA 4L5GA 1MUZA 5C0MA 3QZ9B 2QEXQ 3RR6A 3RERA 2AIRB 4RTTA 1QVFS 4M75F 4OMMA 2LC4A 5LJ3e 4EIKA 4ZTFA 3VRZA 1SRLA 2L8DA 3PIPA 2OTJA 1BCMA 1PRMC 1U8RA 3LX7A 2GF7A 1PD0A 2DRKA 5GMKe 4F7UF 2BIVA 2OTLQ 4OF1A 4BY6B 2RD1A 2CP3A 4PJOD 3MPUB 1M1KC 1K9MC 1OZ2A 1UUEA 5GANh 5LJ5e 2DBKA 2OAUA 1IGQA 4J9FA 3LLRA 3M53A 3PVLA 4XQ3A 3VS6A 2LNHB 4E7SA 1C0MA 4E7ZA 3EG2A 1LPLA 2A7YA 1KC8R 3OYGA 2JZ2A 3VRYA 2PZ1A 2RB6A 5DLOA 2VB6A 3VS2A 9ATCB 1WHGA 2HNIA 3I9QA 2NUTA 2KQWA 2OX7A 5GAOm 3PE0A 5AT1B 4QVCA 2FZKB 4OB2B 1NG2A 1AWXA 2CREA 2LNVA 2YDLA 3MKDA 1G3WA 5IH2A 1YFNA 2QYZA 2KMTA 3M56A 2CT3A 3I56T 1RACB 2LZ6B 1NJIU 4NL2A 1D1AA 1M1GA 1I4K1 2XDBA 3E1SA 3M4GA 3OYIA 3DB3A 1BK2A 4ELZC 2X4WA 2EQKA 5CR2A 1UGVA 4JRIA 1KD1U 2LVMA 3F70A 4HXJA 2VC8A 1X6BA 2BZXA 4FSSA 1Q82U 1X01A 1WHMA 4FYWB 2EYZA 2E10A 1KQ1A 3EHRA 1YN8A 3MP1A 3JCMd 2ESWA 4OP0A 2DD5A 3LW5E 1SEMA 3J80E 2F2VA 4TVRA 1VQ6A 1YIJT 4HCKA 3OBYA 4LDXA 2J6KA 2NUTB 1LJOA 2KRSA 2QA4Q 2LX9A 2FVUA 4Q5WA 2E1HA 4M78F 4CI0C 2FEIA 4FW1A 3JB9F 3S3MA 3VS4A 3SFMA 1ZSZB 1PD1A 1Q81R 3SWNB 4OB1B 4M4ZA 4C92E 4OMQA 1M27C 1T0HA 3G7ZA 2HQXA 4M7DA 1OPKA 4OVAA 5IHNA 1ZX6A 1QCOA 2AK5A 1M90C 4JJDA 3OMCA 4LDUA 3QKJA 1KHCA 3SWNC 2JS0A 2LMJA 2KY9A 3CCRQ 4II1A 1WIEA 2IVWA 4FYXB 1GL5A 3CCET 1GFDA 3THKA 1CKBA 1GFCA 2BTTA 1AEYA 4M75D 2X9HA 2B8AA 4RTWA 1X2QA 4BUGA 2EW3A 1K1ZA 4N4IA 1G5VA 1LOJA 3JCMh 4Z88A 2RA2A 2AT1B 1YWOA 2FPEA 3NFCA 1WXTA 2DL3A 5GMKl 3QHSA 3OS0A 1PWTA 4J7FA 2X4JA 3JCMP 4CC3A 1WGSA 4M7AB 1ZSGA 4JJBA 4JRPA 1VQNT 1M3BA 2V8KA 3PVQA 1OX8A 2WSCE 1QVFA 2RK2A 3H0HA 4LN2A 3GNGA 1G3SA 1VQ7T 4JLGA 2PU9B 4PKCC 2ZPGB 3DB4A 4E47A 4ZN1A 3VUBA 3GOXA 4JDSA 1VQ6T 1Q7YR 5L8RE 2RI5A 1EX4A 2QI2A 2QGFB 3CMEQ 1UEBA 4OMOA 2QASA 2MF2A 4M7AC 3GP8A 3CC2T 4L6V5 2VWFA 2XK0A 4BI4A 2VASA 2NWMA 3JCMV 4BDZA 3QDFA
chains in the Genus database with same CATH topology
1YJWQ 1YIJQ 3CC7Q 1K73R 1VQ5Q 1VQ4Q 1Q86R 1VQ9Q 3CCUQ 1YITQ 3CD6Q 1VQ6Q 1KQSP 2QA4Q 1Q7YR 1KC8R 1NJIR 3CCJQ 1K9MR 1M1KR 3CCRQ 1N8RR 1VQKQ 3G6EQ 1YI2Q 1VQPQ 1K8AR 3CCVQ 3CMEQ 3CCQQ 1VQMQ 1YHQQ 3CCEQ 3I56Q 1VQNQ 1Q81R 2OTLQ 2QEXQ 1YJNQ 1M90R 2OTJQ 3CCMQ 3CC2Q 3CCSQ 1YJ9Q 3CCLQ 3CPWP 1Q82R 1VQLQ 3CXCP 3G4SQ 1VQ8Q 1VQ7Q 1QVFP 3G71Q 1QVGP 3OW2P 1KD1R 3CC4Q 3I55Q 1W2BP 3CMAQ 1VQOQ 1JJ2P 1S72Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJW Q;  1YIJ Q;  3CC7 Q;  1K73 R;  1VQ5 Q;  1VQ4 Q;  1Q86 R;  1VQ9 Q;  3CCU Q;  1YIT Q;  3CD6 Q;  1VQ6 Q;  1KQS P;  2QA4 Q;  1Q7Y R;  1KC8 R;  1NJI R;  3CCJ Q;  1K9M R;  1M1K R;  3CCR Q;  1N8R R;  1VQK Q;  3G6E Q;  1YI2 Q;  1VQP Q;  1K8A R;  3CCV Q;  3CME Q;  3CCQ Q;  1VQM Q;  1YHQ Q;  3CCE Q;  3I56 Q;  1VQN Q;  1Q81 R;  2OTL Q;  2QEX Q;  1YJN Q;  1M90 R;  2OTJ Q;  3CCM Q;  3CC2 Q;  3CCS Q;  1YJ9 Q;  3CCL Q;  3CPW P;  1Q82 R;  1VQL Q;  3CXC P;  3G4S Q;  1VQ8 Q;  1VQ7 Q;  1QVF P;  3G71 Q;  1QVG P;  3OW2 P;  1KD1 R;  3CC4 Q;  3I55 Q;  1W2B P;  3CMA Q;  1VQO Q;  1JJ2 P;  1S72 Q; 
#chains in the Genus database with same CATH topology
 3M9Q A;  4GBQ A;  4XTW A;  2HAX A;  5DLQ E;  1C1A A;  4MDX A;  4FW2 A;  2WAC A;  2FPD A;  3FC3 A;  4GLK A;  1Q95 G;  1M3A A;  4DBR A;  1WHK A;  1TU0 B;  2EJF A;  2F5T X;  3QXE B;  2K4Y A;  4OMP A;  1WFW A;  3CCM Q;  3RUX A;  2HL3 A;  1KHI A;  3D7S B;  4F7U G;  4C8Q D;  4DEX A;  3FLG A;  2DXB A;  2RI2 A;  3SEM A;  4MZT A;  1S1N A;  4DA4 A;  3KFV A;  2CZ7 B;  1K8A U;  1VQ4 A;  2JXB A;  2J6F A;  3SD4 A;  3R6O A;  1UGR B;  3H9N A;  1K0S A;  3CC2 A;  1MMD A;  1SF9 A;  4LUD A;  2E12 A;  3JB9 H;  4ANJ A;  3CCE A;  3QBY A;  3EFO B;  3QJ6 A;  3G6E A;  5J26 A;  1N6A A;  1B34 A;  3DLM A;  3E2U A;  1OYX A;  1VQO T;  5LJ3 g;  3MO8 A;  1Q82 C;  1HK9 A;  4M78 D;  2KK4 A;  5FU6 B;  1OU9 A;  2HSE B;  3JB9 D;  2FB7 A;  2RI3 A;  2RHY A;  1Z9Z A;  3C95 A;  2JN0 A;  5KYU B;  2KXD A;  5KYY B;  1YJ9 Q;  2NLU A;  1IHV A;  4RTY A;  3CCL T;  1VQL Q;  2CZ1 B;  2KR3 A;  2V1R A;  3QYG B;  5LJ5 j;  2WSF E;  2K5I A;  1U06 A;  3QPH A;  3CC7 Q;  1WJS A;  5GAN e;  3OSS C;  2LQN A;  2F5K A;  3TCJ A;  3OYY A;  1QWE A;  1XQH A;  3FRN A;  4Z02 A;  5GAN 7;  2MCN A;  3HHT B;  3KBG A;  3T9N A;  3PMI A;  2W10 A;  3G71 A;  3QSU A;  4C0D C;  2SRC A;  3HFN A;  2BUD A;  4KUL A;  4OGC A;  1D0Y A;  5HK3 A;  2YUO A;  3A98 A;  3TSZ A;  3OYC A;  3DKM A;  1ZA2 B;  3OYJ A;  3V7C A;  2LX7 A;  2R58 A;  2JM9 A;  2KAF A;  1VQK Q;  2VGN A;  3G6E Q;  4C5G A;  3CCV Q;  4X9C A;  3HRT A;  1YHQ T;  3TEE A;  2O4X B;  3BFM A;  4PJO G;  2KYB A;  1M3C A;  3U23 A;  3C4S A;  5HK0 A;  5KYX B;  2O4X A;  5GAM g;  1F1B B;  2RQW A;  2X4X A;  3OS5 A;  3HFO A;  1Y96 B;  4V2S A;  4X1V A;  3CXC A;  4IIM A;  2R5M A;  4EDU A;  4M7A D;  2CGH A;  4QKU A;  2HL5 C;  1ABO A;  2LCL A;  5AYF A;  2E4H A;  1M5Q 1;  1M9S A;  4A4F A;  4FT4 A;  4QT7 A;  5FU7 B;  4BE0 A;  3L2V A;  3JCM W;  3M0S A;  3L42 A;  2F1L A;  1KSW A;  2QGG A;  3RES A;  4C92 D;  1UB4 A;  5KE3 A;  1K8A R;  5GMK m;  1M4Z A;  1YJN T;  1Q7Y C;  3AT1 B;  2M51 A;  2EQU A;  2XG8 D;  3CBO A;  5CK9 A;  2K7A A;  4PNO A;  3G4S T;  1LNX A;  2XI9 A;  4MDW A;  3MEV A;  1SHG A;  1QQJ A;  4PJN A;  4MZM A;  5C6S A;  2CUB A;  1NM7 A;  2MWO A;  2ECZ A;  2V8J A;  2JTE A;  1Y07 A;  5LJ5 g;  5CAI A;  1OX9 A;  3TSW A;  5LJ5 h;  1TUD A;  2ZCF B;  1ZHI A;  2XMF A;  1NJI C;  2OTJ T;  4JRK A;  4PK4 A;  1MV0 B;  2YLB A;  4X9D A;  1IB8 A;  2XHC A;  2L0A A;  2ZPE B;  1UEC A;  2EAY A;  3G71 T;  3NTI A;  3M57 A;  4EMK A;  4DBQ A;  3VJP A;  2JOY A;  4XTZ A;  4A4K A;  2JTM A;  2CDT A;  3M54 A;  3OYK A;  2QDY B;  2XID A;  2JW4 A;  1VQ9 A;  1UHF A;  4C5I A;  4C8Q E;  3NGP A;  4RCB A;  1WHJ A;  2RQR A;  4J9B A;  3V7S A;  3X20 B;  5CKD A;  1NYF A;  1RAI B;  3MEW A;  1PHT A;  1S72 T;  2K3Y A;  2DXT A;  3EAE A;  4IUV A;  3A8L B;  2L3R A;  4M78 E;  2J6O A;  2CP7 A;  1ABQ A;  2ZAE A;  1IHW A;  5D6W A;  4E7L A;  2COZ A;  2X4Y A;  4OMN A;  4KGX B;  1B7T A;  2QEX T;  2M16 A;  1TUC A;  5FRN A;  2QQS A;  1V29 B;  1KC8 C;  1TS9 A;  1IGU A;  2B86 A;  1BKB A;  2L89 A;  1N27 A;  2CZ0 B;  3CCU Q;  5KYX A;  4LD9 K;  5FWB A;  1YJ9 A;  4B9W A;  5FRO A;  3FIF A;  3CCR T;  1VYV A;  4M7D F;  2A36 A;  2JVV A;  1KIK A;  1RAH B;  2C0T A;  1O9S A;  2J7I A;  3M0R A;  2FZG B;  1BIA A;  4FL6 A;  2R5A A;  2EQJ A;  2EWN A;  5CKB A;  3PT9 A;  4A53 A;  1VQP A;  4MZP A;  1SHF A;  2DXU A;  3CMA T;  1OPL A;  4JPB W;  3RMQ A;  3OW2 A;  3JV3 A;  2V1Q A;  2NUP A;  3QJY A;  5KH6 A;  4C5H A;  3O5Z A;  4ZGJ B;  2LCC A;  2MMP A;  4BE2 A;  1ZBX A;  1UJY A;  4QQD A;  1VQN Q;  3OYD A;  1N9R A;  3EGU A;  3HSB A;  3OYE A;  1PC0 A;  4RTV A;  1GBR A;  1VQ7 Q;  3EG1 A;  1JXO A;  2GBQ A;  1VQ5 Q;  1Q86 R;  2PTK A;  2PVO B;  4M7A F;  5A0G A;  1WZO A;  3BY7 A;  4XK8 E;  1VQO A;  5GAN 3;  2K3B A;  4M77 F;  1KQ2 A;  4HCB A;  3CCJ A;  2DZC A;  4A4H A;  1SSH A;  3ZFJ A;  4D8K A;  1SKU B;  2O9V A;  1ZSZ C;  4FSX A;  2DA9 A;  1Q86 U;  2FPF A;  4QW2 A;  4RTZ A;  4AT1 B;  4D6W A;  1NLP C;  1Y0M A;  2ABL A;  1D09 B;  1VYT A;  2CSQ A;  3JCM J;  2OTL A;  4PJO B;  3REA B;  1IRE B;  2KGT A;  1TOV A;  3A8H B;  2PUO B;  2ZZD A;  2L2P A;  4J9C A;  3HKS A;  4KGZ B;  1O75 A;  3ZBD A;  3FJP A;  2RHX A;  2FYK A;  3I5R A;  4XU1 A;  3JCM X;  5GAN d;  2ED1 A;  1E6G A;  2LTO A;  3FJ5 A;  4KGV B;  3CCQ T;  4HVW A;  1RI0 A;  2D0Q B;  1ZUY A;  2DYB A;  2GCX A;  3OYF A;  4JJC A;  2HQE A;  1BI2 A;  5CKF A;  2G3R A;  3I35 A;  1VQO Q;  2FO0 A;  5LL6 S;  7AT1 B;  1R0C B;  3HRU A;  2QXF A;  1KQS A;  2KT1 A;  4M77 E;  3JCM g;  4PFZ A;  4J8O A;  2EBP A;  5GJV B;  2FL7 A;  5CO7 A;  5I2S A;  2KXC A;  3UT1 A;  1JRI A;  3CCL Q;  4X34 A;  1JEG A;  2JM8 A;  3N5B B;  2KT8 A;  3JRZ A;  1BU1 A;  4IUP A;  2COW A;  3MET A;  1MMG A;  4IKF A;  5I2M A;  1W1F A;  1H8K A;  1FMV A;  2D8J A;  1N8R R;  3X26 B;  3RKX A;  3CCE Q;  1WYX A;  2BZY A;  1H3Z A;  2EKO A;  2K79 A;  4M7A A;  1E7O A;  1NLO C;  4DQ2 A;  2E3I A;  4M78 C;  1M1F A;  4C0F A;  2QDL A;  2YRV A;  1U3O A;  1XOV A;  1WHH A;  1X75 C;  1WNL A;  4KH0 B;  5J39 A;  1M8V A;  4M7D E;  1JBM A;  5KYU A;  1X2K A;  1RLP C;  1UG1 A;  2LQW A;  2KVQ G;  3G1J A;  2ROL A;  3CCV T;  2XIC A;  4A4E A;  5IT9 E;  4C92 A;  2BZ8 A;  3VS7 A;  3MJX A;  4JLI A;  2AKK A;  4E7I A;  4OGE A;  5HCK A;  5CQX A;  2HD0 A;  4ZNX A;  1RAD B;  4B6M A;  1KFZ A;  2MYS A;  3FEO A;  1B34 B;  3CPW S;  1MV3 A;  3X24 B;  1G3T A;  2Y90 A;  3AHU A;  3RIR A;  1OQK A;  2CUD A;  1VOM A;  2FZC B;  2HMA A;  3CC2 Q;  2OAW A;  2QQA A;  1U1T A;  1SG5 A;  2Z0W A;  2CYZ B;  1UGP B;  4C92 B;  4M75 A;  2YLC A;  2VV5 A;  5GMK j;  3HL8 A;  1BYM A;  2DIG A;  3C0C A;  3EG3 A;  4Y28 E;  2CSI A;  2KEA A;  3CCV A;  2LJ3 A;  4LD6 A;  5KCO A;  1Q86 C;  3OW2 S;  1KK7 A;  4RKU E;  3S3O A;  2EQI A;  4F04 B;  5A0D A;  3CPW P;  1Q82 R;  3PGG A;  4M7D C;  1ACM B;  2KYM A;  4PJO A;  3WXM B;  5GAN 2;  3QZ5 B;  4EPC A;  1WXU A;  3PTA A;  4C0Z A;  1YIT Q;  3V8K A;  2RQT A;  1A0N B;  4Y91 A;  4J9G A;  1HD3 A;  5CKE A;  2ZPH B;  2DZ9 A;  3RNJ A;  4LDY A;  2FG0 A;  3EH2 A;  2XDP A;  2OTJ Q;  1T0J A;  2DNU A;  3QO3 A;  1UFF A;  5GAN 8;  2GTJ A;  4BI8 B;  1HYO A;  1YJW A;  4Z8A A;  2CKK A;  1YWP A;  4BI3 A;  4A4G A;  3RMS A;  3WVD B;  1YNZ A;  5IXF A;  3Q1J A;  4EMK C;  2QG9 B;  4M75 C;  2MWP A;  1K9M R;  4J9E A;  1M1K R;  4XU2 A;  3ME9 A;  3ULR B;  4M77 G;  1TUG B;  2DIQ A;  2LJ1 A;  4E6R A;  2C0O A;  1ZA1 B;  2IIM A;  1RAA B;  1S72 Q;  3L2Z A;  3CC7 T;  1KG1 A;  2YSQ A;  3VUZ A;  3RKW A;  2NUP B;  2DJZ A;  5GAM h;  3CCJ Q;  5IHK A;  4ATO A;  2A08 A;  2EFI A;  2DKG A;  2EKH A;  5IAY A;  3OYL A;  4JJN K;  3HRS A;  2AZS A;  1YCY A;  1YP5 A;  4BAC A;  4JZ4 A;  2LT1 A;  2PUK B;  1YCS B;  2ENM A;  3JCM c;  2DLP A;  2X3X D;  3HTR A;  3E9F A;  3HPW A;  1D1C A;  1NEB A;  4RTX A;  1QP2 A;  1XJW B;  1I5O B;  3EH1 A;  1VUB A;  4FYY B;  3CCU T;  4XAX B;  3GIB A;  2L3Q A;  2EYX A;  1Y96 A;  1I1J A;  1VIF A;  3O8V A;  2CP0 A;  3OB9 A;  2DL5 A;  1ARK A;  4C5E A;  5LJ3 j;  2I0N A;  2E65 A;  2YHT A;  2JTF A;  4IUT A;  2H8H A;  2LP5 A;  1VQ8 T;  5CVI A;  2EGC A;  3CD6 A;  4JRQ A;  4R0K A;  4PFP A;  2JMC A;  1MMN A;  1N8R U;  1JJ2 P;  3NHN A;  3J7A F;  2EYW A;  1M2V A;  4D8D A;  2XKO C;  5GAM f;  3QYH B;  3EGX B;  2DJQ A;  4KRT A;  3JB9 J;  3CCS T;  1HXD A;  5D6Y A;  4Y92 A;  3UF4 A;  4CRI A;  4F16 A;  1MHN A;  3JCM f;  1YJW T;  1GCQ C;  1MND A;  1OZ3 A;  4PLL A;  1Q81 U;  1D3B A;  5GAN 5;  5IN1 A;  1WHL A;  2QTV A;  4NL3 A;  3L2W A;  3OQ5 A;  1TXQ A;  3PMT A;  2DPP B;  1YJN Q;  5FRM A;  2HZY A;  2E5Q A;  1TG0 A;  2COY A;  1H3H A;  2DO3 A;  2KRM A;  3G4S Q;  3S3N A;  1Y71 A;  5LJ5 d;  5GAO l;  4C0G A;  1K76 A;  2V8I A;  1M2O A;  1K73 R;  2HKN A;  4ZGE B;  4XTV A;  1RAF B;  2F2W A;  2DK3 A;  2VUB A;  2RHU A;  4DOV A;  1ZUU A;  1SSF A;  2DAQ A;  1Q7Y U;  2XDD A;  3EG0 A;  4M75 E;  3CQT A;  1QMC A;  3REB B;  3JCM b;  4IUR A;  3I55 T;  2H3J A;  3SWN A;  3L1A A;  4OB0 B;  3E9G A;  1I0C A;  3QG1 A;  4J7I A;  2RF0 A;  3LWH A;  2AKL A;  4HCC A;  4PL6 A;  4BY6 C;  3CCU A;  2E64 A;  3BDL A;  1XNI A;  4OML A;  2X51 A;  2O9S A;  1LVK A;  1M2V B;  2DVJ A;  2V26 A;  2K57 A;  2PNI A;  4QVD A;  2EGE A;  4ZGD B;  4R55 A;  1PKT A;  2RJD A;  4J9I A;  1OOT A;  1D0X A;  3HP9 A;  2RM4 A;  1ZUK A;  2ZPF B;  2LDM A;  3I55 A;  1RAB B;  4FCY A;  1WLP B;  3TVT A;  1NZ9 A;  3LGF A;  3NPF A;  1VQ9 T;  4ESR A;  1MMA A;  4AFU C;  4F17 A;  1VQ5 A;  4M7A G;  1TWB A;  4QVZ A;  2QQR A;  1YI2 T;  2RNA A;  2L3S A;  1VYU A;  2MOX A;  2SEM A;  1E6H A;  2RK1 A;  1RAG B;  3A8O B;  3VS5 A;  2DEQ A;  2EYY A;  1N5Z A;  3QUI A;  1UE9 A;  4A54 A;  2GQV A;  3CMA Q;  4KBM B;  2FRY A;  1VQ4 T;  1WX6 A;  2QEX A;  3C94 A;  3VKI A;  2JMA A;  3M0U A;  5FU6 C;  1WPY A;  1QVG S;  2KNB B;  1QKX A;  1W2B P;  1J3T A;  5IXB A;  1VQ5 T;  4F14 A;  1EFN A;  2F69 A;  2O01 E;  4UC4 A;  3OYN A;  1VQP T;  4HT9 A;  4KUD K;  2RO0 A;  4J6Y A;  2KBT A;  4C92 F;  2VKN A;  2YT6 A;  1D3B B;  3ZEH A;  1FX7 A;  1IZ6 A;  1G83 A;  1JU5 C;  1HSQ A;  3CC4 T;  4J9H A;  2CH4 W;  1KD1 C;  1T3L A;  1FMK A;  4PJL A;  8ATC B;  2YUQ A;  3CPW A;  2I2L A;  2QQB A;  1RL2 A;  2K3X A;  4ELY C;  1BI0 A;  1YIJ A;  1K9A A;  1VQM Q;  4C8Q B;  1M90 U;  4ORZ A;  2DMO A;  1X27 A;  3V8L A;  2BE9 B;  2RH2 A;  1D0Z A;  2HEQ A;  2K5F A;  3L2R A;  5HKC A;  2CS7 A;  4AG2 C;  1I81 A;  2M0O A;  3OMG A;  1U5S A;  2LRQ A;  1OI1 A;  4PJJ A;  5I11 A;  3M0P A;  5GAM e;  2QTX A;  3L2Q A;  4PJO C;  3EFR A;  5CQY A;  4PJO E;  1W4S A;  2M1H A;  3CCQ Q;  2DER A;  5GAO p;  4P5N A;  1U1S A;  3SHW A;  4C8Q C;  2EYQ A;  1PG5 B;  5A0L A;  5KYY A;  1BB9 A;  1N8R C;  4M78 B;  1JJ2 A;  3VYH B;  3ASK A;  2DRM A;  3VV0 A;  8AT1 B;  5FU7 C;  5GJW B;  3OA6 A;  4JUV A;  4K11 A;  1UTI A;  2X35 A;  3QDR B;  5GAN j;  5CKH A;  1RLQ C;  2IPO B;  1WJQ A;  1QVF P;  1SRM A;  3EG9 B;  2C06 A;  4M7A E;  2X3W D;  4LDW A;  4DBF A;  4FYV B;  2FHD A;  3I5S A;  4IUU A;  3R6N A;  3VS0 A;  3CCJ T;  2ROT A;  2A28 A;  3P8D A;  4LDV A;  2ZPI B;  3GBQ A;  2ZGW A;  5EG2 A;  1K73 U;  2K9G A;  4E2F B;  3G4S A;  2AHJ B;  4J5Y A;  4PFO A;  4XTX A;  3CXC S;  1KJW A;  2BE7 D;  2CH4 A;  4AFQ C;  1QP3 A;  2DX1 A;  3J81 E;  3EGD B;  2DTO A;  3BW1 A;  3PNW C;  4M7D G;  2RJC A;  1JQQ A;  3CEY A;  2QQ9 A;  2DVE A;  4M78 A;  4BE1 A;  3LWI A;  2OTL T;  6AT1 B;  4N4H A;  2K5L A;  3MCA B;  3VU3 C;  5GAM j;  4DOW A;  2EPD A;  1VQ8 Q;  4M77 A;  3FDR A;  2LT4 A;  4WTO B;  3OYA A;  1AZG B;  2RJF A;  5GMK h;  3CCR A;  1VA7 A;  4M7D B;  3V7R A;  2MI6 A;  1QWF A;  2L5Q A;  2P0P A;  5GAN f;  4HVV A;  1EZZ B;  2HBW A;  3ZL7 C;  4N4G A;  1OU8 A;  2A0F B;  1VQL A;  3GNF B;  1UDL A;  4M77 D;  1IXD A;  3CCS Q;  3KXT A;  2DL4 A;  5FW9 A;  3V8J A;  5GAO r;  1JXM A;  5I21 A;  1G8X A;  2DIL A;  4XU3 A;  3UPU A;  3CPF A;  2KE9 A;  3WVE B;  3QII A;  4F7U A;  1YJW Q;  1GBQ A;  1PM3 A;  2MPX C;  2E70 A;  4JS4 A;  3MP8 A;  3GF5 A;  2P0K A;  2A37 A;  1W70 A;  1AWJ A;  2JUF A;  2CT4 A;  3UAT A;  2D1X A;  2D8H A;  3C12 A;  2E5K A;  1WA7 A;  4C92 C;  1QW1 A;  4WCI A;  3UA6 A;  3X28 B;  3MHX A;  3NTH A;  1VQK A;  1ZBJ A;  2O31 A;  1I8F A;  3TRE A;  2GQI A;  1QVG A;  1TH7 A;  5GAO q;  2QAZ A;  1YIT T;  2GNC A;  4FIB A;  1RAE B;  1UGQ B;  1W2B A;  4LXC A;  4C8Q F;  2EIF A;  1LCK A;  4XTU A;  1UJ0 A;  1YHQ A;  1IO6 A;  4JS5 A;  1Z9Q A;  3OS2 A;  4N0A A;  3A8G B;  3OSV A;  4HCZ A;  1WJR A;  3FB9 A;  2DTI A;  2RMO A;  3BDU A;  1YIJ Q;  5LJ5 f;  1UHC A;  3M0T A;  5CIU A;  3CD6 T;  2PVG B;  4RG8 A;  2RHI A;  4GLM A;  2ATC B;  1Y57 A;  4MMK A;  2QA4 T;  5D6X A;  3OYB A;  2RQU A;  1AZE A;  4E7H A;  1BI1 A;  1I5L A;  4AG1 C;  1R8O B;  4EMK B;  3JAM E;  2GGR A;  1BCO A;  3NMZ C;  3CCQ A;  1NPP A;  1PSE A;  2Y4Y A;  4DEY A;  5D7U A;  4R56 A;  1C6V X;  1WXB A;  4CC7 A;  3OBW A;  4KH1 B;  1MNE A;  4L59 A;  5DY9 A;  5KYW A;  4AFZ C;  4E7J A;  4HT8 A;  3UWN A;  1X43 A;  1M90 R;  2LCS A;  5GAM d;  5GAN 4;  2D6F A;  4LE9 A;  3OW2 P;  2Y4X A;  1SPK A;  4J6W A;  1FYN A;  3LH5 A;  2HBP A;  1QCF A;  4J6X A;  1AWO A;  3A1P A;  4LUE A;  4M78 G;  3CC4 A;  2G6F X;  3M0Q A;  1BI3 A;  2W0Z A;  4J9D A;  3JB9 G;  3A5Z B;  2LJ0 A;  1AD5 A;  3SDZ A;  4E7K A;  3A8M B;  2OJ2 A;  3CC7 A;  4J83 A;  2JS2 A;  5EC7 A;  1OV3 A;  1R77 A;  3KUF A;  3E19 A;  3CBP A;  1X6G A;  1VQ4 Q;  4AFS C;  2YUN A;  2PQW A;  2RN8 A;  3M58 A;  4C8Q A;  2CP6 A;  5KE2 A;  2DFU A;  2O88 A;  3JB9 I;  1K73 C;  1NPR A;  2EJ9 A;  1W6X A;  3VS1 A;  2IG0 A;  3JCM Q;  1FXX A;  4EMH A;  2HQH A;  1S72 A;  4GY5 A;  4HA8 A;  2KDS A;  5FLX E;  3PIO A;  2KRO A;  4KUI A;  1VQ6 Q;  2EVR A;  2RPN A;  1KC8 U;  3OYM A;  4IUQ A;  2MK5 A;  2CP5 A;  2QA4 A;  3I56 Q;  3UDC A;  1FWZ A;  2J06 A;  2D0N A;  4BDY A;  2AZV A;  1B07 A;  4FU6 A;  1JO8 A;  1QLY A;  3H41 A;  3EGD A;  3CC4 Q;  1M8M A;  2OI3 A;  3JCM e;  5DM7 R;  2DL7 A;  3M5A A;  4NS5 A;  4NOY A;  1AOJ A;  3CCS A;  1K0X A;  1RUW A;  3BE3 A;  4WF2 A;  2BKD N;  2D9T A;  1QCN A;  1VQM T;  1PKS A;  5IHI A;  4YTL A;  1AVZ C;  1TTH B;  3CCM T;  2P4R A;  3NTK A;  3TU4 K;  4M75 G;  2YRC A;  4F7U E;  1YI2 A;  2FRW A;  3ER0 A;  2MIO A;  5J3B A;  3UA7 A;  3SB2 A;  3I55 Q;  1BIB A;  3MP6 A;  2O2O A;  1VQN A;  2CZ6 B;  5I22 A;  3JSC A;  3CME A;  1KQS S;  3OY9 A;  1T3S A;  4HKE A;  1JJ2 S;  3VYG A;  4FT2 A;  4RTU A;  2GFA A;  1VQ7 A;  1V76 A;  1NEG A;  1NE8 A;  2ED0 A;  1VQ8 A;  4OMF B;  1FMW A;  4BB7 A;  3LH0 A;  5KYN A;  2EGA A;  3H0F A;  5M9O A;  5A2Q E;  1GCP A;  2DEU A;  3RDV A;  2P4T A;  1GCQ A;  4ZN3 A;  2VYT A;  3M55 A;  3I56 A;  1QKW A;  2CP2 A;  4A63 B;  3CCM A;  2K6D A;  2YXY A;  3L2U A;  2M02 A;  5LJ3 d;  1YJ9 T;  2E6Z A;  1YJN A;  2RJE A;  5HY6 A;  2E3H A;  1Y7X A;  3DLL A;  4Z89 A;  1PRL C;  4XTY A;  3TQ7 P;  2M9U A;  4RG2 A;  1TSF A;  1VQ9 Q;  1D1B A;  2VVK A;  1YI2 Q;  4N0A C;  4RMO A;  1AHJ B;  5KCH A;  1WDX A;  4MML A;  5GAN 6;  2DTH A;  2QK0 A;  4PJO F;  1BBZ A;  4F7U B;  3GPL A;  2LQ8 A;  1X69 A;  4M7D D;  3IQL A;  3URG A;  1K9M U;  1M1K U;  1VQK T;  3P8H A;  4ME7 A;  4JZ3 A;  3S6W A;  3G6E T;  2YUP A;  1HJD A;  4LNP A;  1RI9 A;  1YHQ Q;  3MEA A;  1YIT A;  4M75 B;  4EMG A;  1OUL A;  1PSF A;  1VQM A;  2K2V A;  2HCK A;  2NUZ A;  2RHZ A;  5L23 A;  2HKQ B;  2DF6 A;  1MGQ A;  1X6O A;  3GLX A;  5FWC A;  2JNG A;  2L3P A;  2VXF A;  3P8B B;  3M59 A;  2P84 A;  4BD3 A;  4M77 B;  4KT0 E;  1R0B G;  3INZ A;  1KQS P;  2E6N A;  5LJ3 f;  3CCL A;  1VQP Q;  3CME T;  5GMK i;  1AT1 B;  4C0D B;  1CSK A;  1UGS B;  1PCX A;  1GXI E;  4O5V A;  2GFU A;  2ZPB B;  1ZLM A;  2A3L A;  2HSP A;  3LYI A;  1QVG P;  2P0Q A;  3H0I A;  1H64 1;  5CCA A;  5GAN g;  4DBH A;  1G2B A;  2XD0 A;  4OB3 B;  1WQ7 A;  1K8A C;  2YWW A;  1QVP A;  2WSE E;  3LGL A;  3QWY A;  3CBM A;  2DYI A;  1WI7 A;  1ZSZ A;  4FM4 B;  4XU0 A;  2J05 A;  4M77 C;  5LJ3 h;  4CC2 A;  1V1C A;  3VS3 A;  1NBE B;  2XU8 A;  2DL8 A;  1P92 A;  5GAO n;  4O6J A;  3M4Y A;  4IIO A;  1AWW A;  3EHQ A;  3EGX A;  1ZQ1 A;  2HDA A;  5ECA A;  4PLI A;  2K2M A;  4CC4 B;  1KD1 R;  1B3Q A;  3QWX X;  1H92 A;  2NYS A;  3EG9 A;  4B9X A;  1GRI A;  2DXC A;  1N9S A;  2MAM A;  3OS1 A;  3RKY A;  1DJ7 B;  1NJI R;  3RBB B;  3EFS A;  2R57 A;  2M0Y A;  1JB0 E;  4ZTJ A;  3OYH A;  2H3E B;  2JT4 A;  2KI7 A;  2PVD B;  3CXC P;  1Q81 C;  2DM1 A;  3G71 Q;  5KYW B;  4PJM A;  2VGM A;  4QQ6 A;  2KSS A;  3CD6 Q;  3H6Z A;  3PFS A;  3EFO A;  2EJG A;  2JJ9 A;  4QQG A;  2RQV A;  2KRN A;  2DBM A;  2F2X A;  4AMC A;  1M30 A;  2DD4 A;  4RUG A;  1YBY A;  3H8Z A;  4RCC A;  4VUB A;  1OEB A;  4C8Q G;  2E41 A;  1WQW A;  1VQL T;  2C0I A;  4HVU A;  1PNJ A;  1VIE A;  1G3Y A;  1XTD A;  2LQK A;  2VXE A;  3X25 B;  3MEU A;  1W2B S;  2EQM A;  2DE0 X;  1IRX A;  1I07 A;  4C92 G;  1CKA A;  2GTO A;  1NYG A;  2DET A;  3CMA A;  1K4U S;  1EIF A;  2YRD A;  4L5G A;  1MUZ A;  5C0M A;  3QZ9 B;  2QEX Q;  3RR6 A;  3RER A;  2AIR B;  4RTT A;  1QVF S;  4M75 F;  4OMM A;  2LC4 A;  5LJ3 e;  4EIK A;  4ZTF A;  3VRZ A;  1SRL A;  2L8D A;  3PIP A;  2OTJ A;  1BCM A;  1PRM C;  1U8R A;  3LX7 A;  2GF7 A;  1PD0 A;  2DRK A;  5GMK e;  4F7U F;  2BIV A;  2OTL Q;  4OF1 A;  4BY6 B;  2RD1 A;  2CP3 A;  4PJO D;  3MPU B;  1M1K C;  1K9M C;  1OZ2 A;  1UUE A;  5GAN h;  5LJ5 e;  2DBK A;  2OAU A;  1IGQ A;  4J9F A;  3LLR A;  3M53 A;  3PVL A;  4XQ3 A;  3VS6 A;  2LNH B;  4E7S A;  1C0M A;  4E7Z A;  3EG2 A;  1LPL A;  2A7Y A;  1KC8 R;  3OYG A;  2JZ2 A;  3VRY A;  2PZ1 A;  2RB6 A;  5DLO A;  2VB6 A;  3VS2 A;  9ATC B;  1WHG A;  2HNI A;  3I9Q A;  2NUT A;  2KQW A;  2OX7 A;  5GAO m;  3PE0 A;  5AT1 B;  4QVC A;  2FZK B;  4OB2 B;  1NG2 A;  1AWX A;  2CRE A;  2LNV A;  2YDL A;  3MKD A;  1G3W A;  5IH2 A;  1YFN A;  2QYZ A;  2KMT A;  3M56 A;  2CT3 A;  3I56 T;  1RAC B;  2LZ6 B;  1NJI U;  4NL2 A;  1D1A A;  1M1G A;  1I4K 1;  2XDB A;  3E1S A;  3M4G A;  3OYI A;  3DB3 A;  1BK2 A;  4ELZ C;  2X4W A;  2EQK A;  5CR2 A;  1UGV A;  4JRI A;  1KD1 U;  2LVM A;  3F70 A;  4HXJ A;  2VC8 A;  1X6B A;  2BZX A;  4FSS A;  1Q82 U;  1X01 A;  1WHM A;  4FYW B;  2EYZ A;  2E10 A;  1KQ1 A;  3EHR A;  1YN8 A;  3MP1 A;  3JCM d;  2ESW A;  4OP0 A;  2DD5 A;  3LW5 E;  1SEM A;  3J80 E;  2F2V A;  4TVR A;  1VQ6 A;  1YIJ T;  4HCK A;  3OBY A;  4LDX A;  2J6K A;  2NUT B;  1LJO A;  2KRS A;  2QA4 Q;  2LX9 A;  2FVU A;  4Q5W A;  2E1H A;  4M78 F;  4CI0 C;  2FEI A;  4FW1 A;  3JB9 F;  3S3M A;  3VS4 A;  3SFM A;  1ZSZ B;  1PD1 A;  1Q81 R;  3SWN B;  4OB1 B;  4M4Z A;  4C92 E;  4OMQ A;  1M27 C;  1T0H A;  3G7Z A;  2HQX A;  4M7D A;  1OPK A;  4OVA A;  5IHN A;  1ZX6 A;  1QCO A;  2AK5 A;  1M90 C;  4JJD A;  3OMC A;  4LDU A;  3QKJ A;  1KHC A;  3SWN C;  2JS0 A;  2LMJ A;  2KY9 A;  3CCR Q;  4II1 A;  1WIE A;  2IVW A;  4FYX B;  1GL5 A;  3CCE T;  1GFD A;  3THK A;  1CKB A;  1GFC A;  2BTT A;  1AEY A;  4M75 D;  2X9H A;  2B8A A;  4RTW A;  1X2Q A;  4BUG A;  2EW3 A;  1K1Z A;  4N4I A;  1G5V A;  1LOJ A;  3JCM h;  4Z88 A;  2RA2 A;  2AT1 B;  1YWO A;  2FPE A;  3NFC A;  1WXT A;  2DL3 A;  5GMK l;  3QHS A;  3OS0 A;  1PWT A;  4J7F A;  2X4J A;  3JCM P;  4CC3 A;  1WGS A;  4M7A B;  1ZSG A;  4JJB A;  4JRP A;  1VQN T;  1M3B A;  2V8K A;  3PVQ A;  1OX8 A;  2WSC E;  1QVF A;  2RK2 A;  3H0H A;  4LN2 A;  3GNG A;  1G3S A;  1VQ7 T;  4JLG A;  2PU9 B;  4PKC C;  2ZPG B;  3DB4 A;  4E47 A;  4ZN1 A;  3VUB A;  3GOX A;  4JDS A;  1VQ6 T;  1Q7Y R;  5L8R E;  2RI5 A;  1EX4 A;  2QI2 A;  2QGF B;  3CME Q;  1UEB A;  4OMO A;  2QAS A;  2MF2 A;  4M7A C;  3GP8 A;  3CC2 T;  4L6V 5;  2VWF A;  2XK0 A;  4BI4 A;  2VAS A;  2NWM A;  3JCM V;  4BDZ A;  3QDF A; 
#chains in the Genus database with same CATH homology
 1YJW Q;  1YIJ Q;  3CC7 Q;  1K73 R;  1VQ5 Q;  1VQ4 Q;  1Q86 R;  1VQ9 Q;  3CCU Q;  1YIT Q;  3CD6 Q;  1VQ6 Q;  1KQS P;  2QA4 Q;  1Q7Y R;  1KC8 R;  1NJI R;  3CCJ Q;  1K9M R;  1M1K R;  3CCR Q;  1N8R R;  1VQK Q;  3G6E Q;  1YI2 Q;  1VQP Q;  1K8A R;  3CCV Q;  3CME Q;  3CCQ Q;  1VQM Q;  1YHQ Q;  3CCE Q;  3I56 Q;  1VQN Q;  1Q81 R;  2OTL Q;  2QEX Q;  1YJN Q;  1M90 R;  2OTJ Q;  3CCM Q;  3CC2 Q;  3CCS Q;  1YJ9 Q;  3CCL Q;  3CPW P;  1Q82 R;  1VQL Q;  3CXC P;  3G4S Q;  1VQ8 Q;  1VQ7 Q;  1QVF P;  3G71 Q;  1QVG P;  3OW2 P;  1KD1 R;  3CC4 Q;  3I55 Q;  1W2B P;  3CMA Q;  1VQO Q;  1JJ2 P;  1S72 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...