1YJNQ

Crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1yjnQ00
3CCJQ 1VQMQ 3CCUQ 1VQ7Q 3CCLQ 2QA4Q 3G71Q 1S72Q 1NJIR 1K9MR 1VQ6Q 1YHQQ 1KD1R 3G6EQ 1VQ8Q 1YJWQ 3G4SQ 1YI2Q 1JJ2P 1KQSP 2QEXQ 1YIJQ 1VQKQ 2OTLQ 1VQPQ 3I55Q 3CPWP 1N8RR 3CXCP 3OW2P 3CD6Q 1M90R 3CC2Q 3CCRQ 3CCVQ 1Q7YR 3I56Q 3CC7Q 3CMEQ 1VQ4Q 1Q86R 1Q82R 1K73R 3CCEQ 1QVGP 1K8AR 1Q81R 1VQLQ 1VQ5Q 1W2BP 3CMAQ 1KC8R 1M1KR 1YJ9Q 1VQOQ 3CCQQ 3CC4Q 1VQNQ 2OTJQ 1YJNQ 1VQ9Q 1QVFP 1YITQ 3CCSQ 3CCMQ
chains in the Genus database with same CATH superfamily
3J81E 2CH4A 3JSCA 2PUKB 5GMKh 1C6VX 4BI3A 1UGRB 5IAYA 5GJWB 2SRCA 4RKUE 2YLCA 2YRCA 4Z88A 3L2WA 2EYZA 3QDFA 1LCKA 1VQLT 4Y28E 1LOJA 2DPPB 1VQ9A 3P8DA 5CKFA 2B86A 4M78E 2P4TA 3RESA 1YI2A 1VQ6T 4DOWA 2X4JA 1M8VA 2M02A 3N5BB 3I9QA 3ZFJA 1NBEB 5I2SA 1Y96A 3CC2A 1Z9ZA 1VQ4Q 4A4FA 2M1HA 4OMLA 3I56A 1I1JA 3DB3A 3HL8A 2LDMA 1YJ9Q 4J7IA 2HAXA 1UHCA 4R56A 1WHLA 2VVKA 4C92F 3M55A 3LGLA 1NE8A 3GOXA 3FDRA 2YRDA 4M78B 5I2MA 3CCST 1H8KA 1WX6A 2DXCA 1K4US 1YJWQ 1PD0A 4M7AC 3G6ET 3G4ST 3QJYA 3SEMA 2R5AA 4PJLA 2KE9A 2E6ZA 1EZZB 2GF7A 5HK3A 4CI0C 3I5RA 4L6V5 4F7UA 4LE9A 2ED0A 2EYXA 1UG1A 4OMFB 2OTJQ 2ZPHB 2J7IA 1GFDA 3CCJQ 1NPPA 3JB9D 4PLLA 3SWNA 5FU6C 1BKBA 3I5SA 1O9SA 4LD9K 2DIGA 3VJPA 2HL3A 2QEXA 1RACB 2QGFB 2HMAA 3OYHA 2ZPIB 3CD6A 2L5QA 4WF2A 3TSWA 5L23A 1VQLQ 4PNOA 1HSQA 3JCMh 1MV0B 2YUOA 1M1KR 3QO3A 1N6AA 1HXDA 5GAN8 2KT8A 3JB9G 2J06A 4X1VA 1B3QA 2LTOA 3CCUA 2DILA 1WZOA 1QVFS 4OF1A 1KQ2A 2D0NA 4M75B 2AKLA 2V1RA 2NUTB 3UPUA 3RKXA 2CYZB 3DLMA 1SRMA 3CPWS 3CMAT 1GFCA 4HT9A 4XQ3A 2YDLA 3RMSA 4N4HA 4OB1B 4C0DC 3S3MA 1KK7A 4ORZA 1GXIE 4E7KA 2ED1A 2P0PA 4IKFA 2A08A 3JCMg 5KYUA 1Y57A 3META 2EWNA 2RQTA 1H92A 1X69A 4N4IA 1UGSB 3A5ZB 1GRIA 2F1LA 2MMPA 2BKDN 2L3RA 1ZSZC 3NPFA 2FB7A 1S72Q 1GCQC 3OSVA 1ACMB 1VQ6A 1QP3A 1KFZA 4RCCA 2D1XA 3F70A 1KJWA 3A8LB 1TUCA 2LCLA 1UGPB 4FT2A 2KSSA 2ZGWA 3NTIA 4E7SA 4DA4A 5CKEA 2CUDA 1M3CA 1GL5A 2YWWA 1JEGA 2I2LA 5CKBA 1ZHIA 2DA9A 3X26B 4C92C 2FG0A 3CBPA 2XKOC 1RAIB 4JRPA 3EGXA 4P5NA 4KT0E 1KD1R 4X34A 1WJQA 3R6OA 4J9EA 5CKHA 3G4SA 1XOVA 2DEQA 3M0UA 2JNGA 1XTDA 1DJ7B 1WYXA 2LCCA 5GAOm 3VYHB 1ABQA 2QDLA 4LDUA 1KQSS 1JJ2S 4F7UF 3CMAQ 3OYGA 2DYIA 4N0AA 5I11A 2EQJA 3REBB 2O4XA 4MMKA 3OS5A 5LL6S 2JOYA 5FWBA 3E19A 3VU3C 1VQNT 2K9GA 4JDSA 2K3YA 2J05A 2PTKA 3ZL7C 1M2VB 5GAMe 3PIPA 1BU1A 2EJFA 2BZ8A 1TSFA 1UFFA 2O31A 3GNGA 5C0MA 4JRIA 4CC2A 4J5YA 2DNUA 3O5ZA 3UF4A 5CAIA 2JXBA 1TOVA 4BB7A 3OS1A 1BK2A 1JBMA 5LJ5e 1BYMA 1OQKA 2NLUA 1D09B 1QLYA 2GTJA 3HRSA 1VQ7T 1U8RA 3JB9J 2AK5A 2XHCA 3M0TA 3CQTA 2V8JA 1VYTA 1W70A 2VV5A 4A4EA 1KG1A 4CC4B 4ZN1A 2L3PA 3UATA 4BUGA 1QKXA 2YUNA 2COYA 1IZ6A 1QVFP 3EAEA 2PZ1A 2HKNA 2GFUA 2QA4Q 3MP8A 4M75F 2F5TX 5GAMd 1VQPQ 1HD3A 3CPWP 3VS4A 3S6WA 5LJ3h 4IURA 3WVEB 2KYBA 4HKEA 3JCMc 2JMCA 2ENMA 5KYWB 1PSFA 3PNWC 2LQWA 5D7UA 2DKGA 3UA7A 2FZKB 1F1BB 5LJ5d 3V8JA 4ZGJB 3CXCA 1C1AA 2LCSA 4OMQA 2AKKA 4F04B 2OTLQ 3X20B 4J9HA 2CH4W 1BBZA 3TSZA 4M7AD 3OSSC 2QQAA 2DK3A 1U3OA 4HXJA 1R8OB 5GAOr 3JAME 4DBRA 2NWMA 3OMCA 1K73C 1YCSB 1M4ZA 2DL7A 3L42A 3FLGA 3PVLA 4MDWA 3OYFA 1C0MA 2CS7A 4M7AG 3BDUA 1VQKT 5FWCA 1K1ZA 2RI2A 4PJOG 1QCOA 3V8KA 2RPNA 1G83A 4PJOE 1GCPA 5CCAA 3SWNC 1QVGS 4J9CA 3C0CA 1KHCA 3MO8A 2MPXC 2P84A 3ZBDA 1QWFA 3OYYA 1JJ2P 1XQHA 1KQSP 2R58A 2VXEA 2RQUA 4LUEA 2DRKA 3FEOA 4K11A 1Y7XA 3QZ9B 1ZX6A 5GAMh 3LLRA 4JJNK 1D1AA 1FYNA 3CCET 3V7SA 2A3LA 4NL3A 2C0TA 1K8AC 1AHJB 4LD6A 3L2RA 1K9AA 2YUQA 1VQ7A 4L59A 3JCMQ 3H0FA 2FRYA 4KGZB 1V1CA 2IVWA 3OYDA 2LX7A 5LJ5h 2CP3A 4AFQC 2C0IA 3CC7T 5IXBA 3EFSA 5GANd 1PRLC 1YNZA 3EG2A 4WCIA 3A8OB 5GANj 2O2OA 4PLIA 3CCQT 4M75C 5AYFA 2VASA 4IUPA 1Q82U 1K0XA 4EDUA 4C8QG 4AG1C 3X25B 3P8HA 5KCHA 3CCRQ 4C8QE 5GAMg 3RDVA 2OAWA 3MJXA 2HQXA 2DD4A 5DLOA 5FROA 3HFOA 1BB9A 3REAB 3H41A 4A63B 4WTOB 4KUDK 1WIEA 1M90U 3ZEHA 4C92D 1VQMT 3G71A 2COWA 2XMFA 1VQ8A 2WSEE 5LJ5g 5KYXB 3H6ZA 1OX9A 2I0NA 3BFMA 3H0IA 4A4GA 1TUDA 2JJ9A 3EFOB 3NTHA 2VGMA 3CC4Q 4AT1B 2IPOB 1IREB 2LJ1A 4OMNA 3CCMT 3HTRA 3D7SB 1MV3A 1MNDA 2MK5A 4ELZC 3VUZA 1YHQA 1Q81U 1GCQA 2JM8A 2X35A 1OZ2A 1QWEA 4M77B 2XDBA 1M9SA 4OVAA 3LW5E 1IXDA 1KSWA 1BCMA 1OEBA 4N0AC 3QYHB 3SDZA 2D9TA 3L2ZA 3TVTA 2EBPA 4C92A 2LC4A 2L0AA 3CCLA 2X4YA 1H3HA 2HL5C 2K6DA 2RQVA 4GY5A 3M5AA 4J7FA 2NUPB 1SF9A 1QVGP 3OYBA 3CCEA 1N8RC 2EVRA 1SHFA 4JJBA 4PFPA 3HFNA 1BI3A 1YWOA 2EQKA 1SPKA 1KC8C 2VC8A 1J3TA 3QKJA 2JMAA 1MMAA 3VS7A 3JB9I 2K79A 3M0RA 3OB9A 2EIFA 2JM9A 2F5KA 4PJJA 2VGNA 1IO6A 3CC7A 4HCKA 4X9CA 4B9XA 1K76A 1MUZA 3CMEA 5HCKA 1VQ4T 2DBMA 4LDYA 2EGEA 3I35A 1M3AA 5IHNA 1YJ9T 4JZ4A 4PFOA 2QG9B 2RHZA 3CCMQ 3CCQA 3H9NA 1UGQB 2L2PA 2W10A 1WHJA 1YJWT 5HKCA 4R55A 1G5VA 2MCNA 3H8ZA 2FZGB 1NLOC 4A4KA 2E1HA 5IH2A 2YUPA 5IHIA 5M9OA 5KYYA 4QQ6A 1UB4A 2FL7A 4A4HA 1M5Q1 2OTJT 3MEWA 1VQMA 3CCJT 2E64A 5HK0A 4ZGDB 2SEMA 3RMQA 3I56Q 2HSPA 2KROA 1V29B 4M7DB 2E6NA 3HKSA 1QVFA 2O9SA 2PU9B 1RAFB 2V26A 2LX9A 4JUVA 1JRIA 1BI1A 2AZVA 1YJNQ 2ZCFB 2DEUA 2KBTA 1B34B 3E2UA 3OBWA 5GAOl 3CPWA 1I8FA 4B9WA 4E7HA 4QQDA 2R5MA 2ECZA 1BIBA 5CIUA 4RUGA 4F7UG 4CRIA 2JVVA 1QW1A 1NLPC 3X28B 2J6OA 1R0BG 3DB4A 4M77F 3VS1A 1M27C 1S1NA 1HYOA 5GJVB 2F2XA 4IIOA 1WI7A 3M0PA 3I55T 3LGFA 2LJ0A 1MMGA 2CP0A 4DBHA 2CP2A 1YN8A 1OU9A 2DL3A 2M9UA 4OGEA 5J39A 1VQOQ 3OW2S 4MZPA 3T9NA 2RK2A 2DE0X 2QQSA 2EFIA 2RI3A 3C94A 4M78A 4OB3B 4PL6A 2DLPA 4DEXA 3VS5A 4CC7A 1WNLA 1Q86U 2O9VA 2V8IA 2KNBB 2M0YA 2QQRA 1S72T 4II1A 2JN0A 1FWZA 3OQ5A 2ZPFB 2KEAA 2ZPGB 2GBQA 4UC4A 4M75D 2K5LA 2EGCA 3TQ7P 1I4K1 2GFAA 4M4ZA 2KVQG 4XTYA 5EG2A 4RTUA 1NZ9A 4BI4A 1VUBA 1SG5A 4JZ3A 1OX8A 3HHTB 3BDLA 1E7OA 1KQSA 1JJ2A 1I07A 1G2BA 4IIMA 2VWFA 1YJWA 2CZ6B 1W1FA 1Q95G 1PHTA 2V1QA 1GBRA 1UTIA 3JCMP 3RR6A 6AT1B 1M30A 2LNHB 2RNAA 2WSCE 4FSXA 2IG0A 2OTJA 2EYYA 1W2BS 1D0XA 5GAN6 5J26A 3MHXA 4M75A 4V2SA 3I55Q 1NJIC 1N9SA 3EHQA 2NUTA 2QASA 2RHIA 4BY6C 2MI6A 4NOYA 2RHYA 1Q82R 3TREA 2COZA 1LVKA 2R57A 1VQLA 1NEGA 1ARKA 1OU8A 3OYJA 2KGTA 1X43A 4OB2B 2RHXA 4GLKA 4FW1A 4JS5A 2DVEA 3MP1A 3U23A 4E7JA 1WPYA 4M7DF 1ZLMA 2EQUA 2K5FA 3CEYA 1M90R 4BDZA 3RERA 1WHHA 4HT8A 5IN1A 3VRYA 2E3HA 3OY9A 5FU7C 4IUUA 2CP6A 4NL2A 1LPLA 3PMTA 5CQYA 1AEYA 1Q86C 3QBYA 3CCSA 4M77C 1D3BB 2RJEA 2BUDA 2K3BA 2QA4T 3G6EA 2EYQA 2WACA 2VKNA 2JW4A 1X27A 3MCAB 1QCFA 4QKUA 1VQPT 4OMOA 2FEIA 1T0HA 2HSEB 3EG9B 1Q81R 3QWYA 1RLQC 2PVDB 5GMKm 1EX4A 1SKUB 1UDLA 4M78F 1ZBXA 2E3IA 1S72A 2DO3A 1BIAA 1W4SA 1K73U 4L5GA 3OYCA 2EYWA 5GMKi 2X3XD 1ZUKA 3OW2P 3E9GA 1CSKA 2H8HA 3RNJA 2OTLT 1PKTA 4J6WA 1E6HA 1N5ZA 2AHJB 2RI5A 4C5EA 2CUBA 4AFSC 3GBQA 2A37A 2DRMA 1M2VA 5LJ3f 2XDDA 3IQLA 5I21A 5KE3A 2G6FX 2ZPEB 2HEQA 2LQKA 2DTHA 1QVGA 3JB9H 2DL5A 2DF6A 2YT6A 1KHIA 4D6WA 3LWHA 3OBYA 3QZ5B 3CMAA 4QVZA 4FYYB 3EG3A 1PCXA 3FJPA 2DL8A 3BY7A 4MZTA 4LXCA 4RG8A 1K8AU 1WXUA 4QVCA 2DJQA 2QXFA 2J6FA 2AZSA 2CP7A 5IHKA 5GAOn 2F2VA 1W2BP 2XK0A 3LYIA 1YITQ 3JV3A 3M0QA 3L2VA 2L8DA 1N27A 1ZA1B 5KE2A 3GP8A 3QHSA 1WXBA 2F69A 4M7DC 2RJDA 5KH6A 3C12A 3KXTA 2ROLA 3LWIA 1AVZC 3M4YA 2DZ9A 4VUBA 3R6NA 5KYWA 3URGA 2HD0A 2HCKA 2X4XA 4FIBA 4PFZA 3M53A 1IHWA 3ULRB 2MOXA 1Y0MA 4IUVA 1HJDA 1QKWA 2E5QA 2H3EB 2E4HA 2RF0A 3RIRA 2QTVA 2HKQB 2ATCB 2K2VA 4KH0B 1YIJQ 5FLXE 4DOVA 2KXDA 3J80E 3EGDB 3OYMA 5DLQE 3BW1A 3JCMX 4HVVA 3CCRT 2VB6A 2GCXA 4M7AE 1BI2A 2NUZA 5GANe 1AT1B 3AHUA 4M78C 3FJ5A 3DLLA 2DFUA 3E1SA 1VQNA 1BCOA 2KMTA 1Q7YU 4C5IA 4BACA 2PVOB 1D1CA 1SSHA 1X75C 1Y07A 2OTLA 2EJ9A 4XK8E 4M7AB 1U1SA 1KIKA 4BE0A 4Q5WA 4TVRA 2DXUA 3WVDB 2VYTA 4BDYA 2X3WD 3VKIA 2D6FA 1OPLA 2DM1A 4F17A 1IGQA 4PJOB 2QQ9A 1QCNA 3GIBA 1P92A 3CC4T 4N4GA 2RQWA 4AMCA 4DBFA 4XTVA 2YRVA 3HRUA 3A8MB 3OYEA 1A0NB 1FMVA 3VYGA 5FU6B 1TU0B 1VOMA 2ZAEA 1ZA2B 5GAN4 3QPHA 3O8VA 1WJSA 4C0GA 4QQGA 3QYGB 4LDWA 1HK9A 1N8RU 2QDYB 3LH0A 3G71Q 5GAOq 4OGCA 3SD4A 4A53A 4LDVA 1VQ8Q 3QSUA 1T0JA 2DVJA 1KC8U 4FT4A 1IGUA 1FXXA 2FPEA 2QQBA 2E70A 2ZZDA 2K2MA 2E41A 1VQ5T 4C0ZA 4OP0A 2V8KA 3PTAA 3SFMA 2DX1A 1YHQQ 5J3BA 4RTWA 1E6GA 4C0DB 2RM4A 4M77D 4C8QB 2AT1B 2CT4A 2JUFA 2KK4A 4FSSA 1WHGA 2CZ0B 1Q7YC 2GTOA 2Y4YA 1WJRA 2A0FB 1ZBJA 4BE1A 1XNIA 3CCLQ 4C92G 1NYGA 1AWJA 2CDTA 4HCCA 2KY9A 5KYXA 3A8GB 2QGGA 1ZSZB 1MNEA 4C92E 4EMKB 1RAHB 2CT3A 2W0ZA 1VQKA 3CCRA 1NG2A 3EFOA 3PT9A 2RJCA 2HNIA 1MHNA 1TWBA 1JO8A 3VRZA 1R0CB 1M1KC 3WXMB 4JLIA 1PM3A 5GANh 1N9RA 4M77A 4C5GA 3QWXX 2PVGB 2ABLA 1OOTA 1TUGB 3CMEQ 1YP5A 3QXEB 2CGHA 3I56T 2RN8A 1VQ5Q 3HSBA 1M3BA 3GPLA 3CC4A 4E7IA 5GMKj 1JU5C 1JXOA 2KQWA 1YJNT 5D6XA 2KI7A 2L89A 2YSQA 2RB6A 2NUPA 2BE7D 2YLBA 1RAGB 3SB2A 3CCVQ 4PJOF 4J9BA 4LUDA 2WSFE 5L8RE 1OV3A 1K73R 4IUQA 1UJ0A 2P0KA 4NS5A 4Z8AA 1M8MA 2JT4A 5GANg 2KAFA 1G3WA 2AIRB 3OW2A 4PJNA 1VYUA 2CZ7B 5AT1B 4FU6A 4QW2A 1U06A 1WXTA 4M7DD 3MKDA 2OJ2A 1RAAB 1TH7A 1X01A 4XU0A 1D0ZA 4ME7A 4QVDA 1XJWB 2FVUA 1VQOT 1YWPA 1VQ9Q 3V7RA 1KQ1A 3M57A 1X6OA 3A1PA 1ZUYA 2KYMA 2BE9B 3PE0A 3KBGA 3JRZA 4MZMA 3PVQA 5C6SA 1YI2Q 4ZNXA 3VS6A 2KR3A 2LQNA 3CBMA 1UEBA 3E9FA 1KD1C 3CC2Q 1QVPA 2X4WA 2KT1A 3A8HB 4BD3A 4ZTJA 1QMCA 1K8AR 1O75A 2PUOB 2RK1A 2OI3A 2JS2A 3NGPA 1T3SA 1IB8A 2B8AA 1VIEA 1PD1A 3THKA 2C06A 1WQ7A 3CCMA 1TXQA 4M78D 4C8QF 3JCMd 5GMKl 8ATCB 5IXFA 3RKWA 1W2BA 4M7DA 2MAMA 2DIQA 4GBQA 5FRMA 2EKOA 2FPDA 1Y96B 2CP5A 1NJIU 8AT1B 1RAEB 4JJDA 3S3NA 2MYSA 2FZCB 1B34A 1NPRA 4M78G 1G3SA 1I5OB 2L3QA 4F7UE 4HCBA 2GGRA 4GLMA 1PWTA 3MPUB 4RMOA 1VIFA 2JTMA 2QEXQ 1GBQA 2X51A 3MEUA 3JCMf 4E47A 3J7AF 4O6JA 3CD6Q 4J9IA 3EG0A 1WA7A 3GNFB 4JJCA 2XU8A 5CQXA 5GAN7 5HY6A 2GQIA 1K9MU 4PJMA 1IRXA 4F7UB 2CZ1B 1YJNA 4JS4A 2EAYA 3CCUQ 4J9DA 4HA8A 3Q1JA 5FW9A 3SWNB 3TCJA 4OB0B 1Y71A 1EFNA 3DKMA 5DM7R 1PC0A 3GF5A 4PJOC 2FRWA 2E10A 1Q7YR 2RMOA 2QK0A 3OYKA 3CPFA 4FYXB 1VQ4A 4J83A 5EC7A 2LT1A 1YJ9A 1M1FA 2DL4A 2M0OA 2D8JA 2F2WA 3PGGA 3M0SA 2NYSA 1AZGB 2DETA 1CKBA 1MMNA 1ZSGA 3OMGA 3CBOA 3OS0A 2CKKA 4M75G 2HQHA 1TS9A 3A98A 4EMGA 1LNXA 4M75E 3P8BB 2ZPBB 1RI0A 1TTHB 2EW3A 2XDPA 3EH2A 1VQOA 4KGVB 2EPDA 3ASKA 2Y4XA 2O01E 5I22A 3VV0A 2KDSA 2Y90A 4JRKA 3JCMV 3CCJA 1VQ6Q 2MWOA 2GNCA 4FL6A 3VUBA 3UDCA 1N8RR 1JQQA 1VYVA 2VUBA 2JTFA 5ECAA 2MF2A 1AWOA 4IUTA 5CO7A 2O88A 1RI9A 2HDAA 1KC8R 5KYUB 2RD1A 5LJ3e 3CCSQ 1AWXA 3NHNA 3FIFA 5GAN5 4HCZA 4MDXA 4C8QC 1QP2A 3G6EQ 2OAUA 3G4SQ 4BE2A 2CREA 4LNPA 1WFWA 2DAQA 2DZCA 2E12A 1K9MC 2MWPA 2LP5A 4D8KA 3EGUA 3JCMW 2PQWA 2IIMA 1SRLA 1RL2A 5D6WA 2Z0WA 2K7AA 1K0SA 5A0DA 3NMZC 3SHWA 2FYKA 4EMKC 1AWWA 5DY9A 1VA7A 3EGXB 2M16A 4KRTA 1WHKA 2FHDA 3KUFA 3I55A 4X9DA 2RHUA 3ME9A 1D1BA 3NTKA 2DXTA 1X2QA 3FB9A 2JZ2A 2K4YA 2A36A 4KH1B 2BIVA 5LJ3d 1D3BA 4XTWA 2O4XB 4RG2A 1YITT 2XG8D 4RTYA 2LZ6B 1IHVA 5LJ3j 4EMHA 2QAZA 3PIOA 3EG9A 3VS3A 2HBWA 2QYZA 2ESWA 1UGVA 3M59A 1WQWA 2ROTA 1ABOA 3UA6A 4DEYA 4KGXB 2M51A 1PNJA 3MEVA 1AD5A 1B7TA 4JLGA 1X2KA 4XU2A 3RBBB 1YIJT 2K5IA 3M4GA 3OYNA 1T3LA 1PG5B 1SHGA 5FRNA 1PKSA 3NFCA 3V8LA 1YCYA 4FYVB 2DJZA 2H3JA 3KFVA 4C0FA 3JCMb 1UJYA 5IT9E 4FM4B 4OMPA 3M9QA 3RUXA 2RQRA 2RJFA 4ATOA 2GQVA 2YXYA 4KUIA 2JTEA 3EH1A 1D0YA 2XIDA 2LQ8A 3JB9F 1NEBA 4DBQA 2D0QB 1BI0A 2BZYA 5A0GA 1M2OA 2XD0A 2KRMA 3OYLA 4ZN3A 1RUWA 1YFNA 5GAOp 1SEMA 1G3YA 5GAMj 3ER0A 3TU4K 5A2QE 2FPFA 1VQNQ 2BZXA 2XI9A 2LJ3A 3C95A 2RO0A 2KRNA 2E5KA 2FO0A 3HPWA 3BE3A 3LX7A 2QA4A 4J9GA 3G71T 4XAXB 4ZGEB 5LJ5j 1VQ8T 1WHMA 5GAMf 5A0LA 1SSFA 1VQPA 3FRNA 1UHFA 1U5SA 4J6YA 3H0HA 1EIFA 4PJOD 4DQ2A 2OX7A 1UE9A 2G3RA 1H641 3RKYA 1YITA 2KXCA 1VQ7Q 1WLPB 1M1GA 1NJIR 4E7ZA 5LJ5f 1U1TA 1W6XA 3M58A 5CKDA 5LJ3g 3X24B 1YHQT 2LNVA 3EGDA 3HRTA 2RA2A 4BI8B 4LN2A 3EG1A 2LT4A 1RABB 1UUEA 4OMMA 3S3OA 5GAN2 1RLPC 2DTIA 3QIIA 4Z02A 4Z89A 1K9MR 1CKAA 3OYIA 2L3SA 2XICA 3CCLT 4ESRA 2E65A 3TEEA 4E2FB 2EGAA 4M7AA 1YIJA 1M1KU 4ANJA 1Q86R 4PKCC 1FMWA 4PJOA 4QT7A 4J9FA 3GLXA 3VS2A 2VXFA 2DD5A 3QUIA 2DMOA 1H3ZA 1OPKA 4C5HA 2D8HA 4ELYC 4KBMB 2DXBA 4HVUA 4CC3A 3EHRA 1PSEA 4JPBW 4FYWB 3MEAA 1X6BA 7AT1B 4C8QD 1YBYA 1X6GA 4KULA 4XTUA 2DYBA 4Y92A 3L1AA 5GAN3 1UECA 3CMET 5D6YA 4EIKA 3CXCS 3C4SA 2HQEA 1OULA 2K3XA 5CVIA 4O5VA 3INZA 1VQKQ 1V76A 4PK4A 1Z9QA 5GMKe 4AFUC 1OZ3A 2LRQA 3G1JA 3CCVT 3FC3A 1OYXA 2LMJA 4BY6B 4F14A 3PMIA 4RTXA 2LVMA 5GANf 3EFRA 1NYFA 4MMLA 4RTVA 2KRSA 2HZYA 3QDRB 2DBKA 2EJGA 1AOJA 4AG2C 2P4RA 1G8XA 1WGSA 2JS0A 4R0KA 2CSIA 4M77G 4C8QA 2X9HA 2QI2A 4E7LA 4HVWA 5KCOA 2MIOA 4M77E 3CCEQ 4RCBA 2BTTA 2PNIA 1KD1U 3AT1B 4Y91A 5FU7B 4YTLA 3OYAA 3L2QA 4EPCA 5CR2A 1VQ9T 2DERA 1ZSZA 4XU1A 3LH5A 3HP9A 4C92B 4EMKA 2QTXA 1NM7A 1YI2T 4D8DA 3CC7Q 1FX7A 3CC2T 2EQIA 3G7ZA 4B6MA 3V7CA 4LDXA 5CK9A 4RTTA 9ATCB 3CCQQ 2A7YA 2K57A 3L2UA 1AZEA 1RADB 1I5LA 1FMKA 2A28A 1PRMC 4AFZC 4M7AF 1ZUUA 1WDXA 4A54A 4XTZA 1JXMA 2P0QA 4ZTFA 2J6KA 3PFSA 4XU3A 2DTOA 1Q82C 3UWNA 4J6XA 1VQMQ 1G3TA 4FW2A 3JCMe 3QJ6A 3QG1A 1MMDA 4J8OA 1TG0A 2QEXT 3UT1A 1ZQ1A 3JCMJ 1QQJA 1JB0E 3CD6T 3M56A 1VQ5A 1M90C 3MP6A 5KYNA 2EKHA 4JRQA 1MGQA 2CSQA 1I0CA 5KYYB 4XTXA 2RH2A 4E6RA 1B07A 3OS2A 1R77A 3CCUT 4RTZA 3VS0A 2EQMA 1LJOA 3OA6A 3CXCP 4M7DG 1OI1A 4FCYA 2C0OA 3CCVA 4F16A 1I81A 4M7DE 2YHTA 2HBPA 1Q81C 3M54A
chains in the Genus database with same CATH topology
3CCJQ 1VQMQ 3CCUQ 1VQ7Q 3CCLQ 2QA4Q 3G71Q 1S72Q 1NJIR 1K9MR 1VQ6Q 1YHQQ 1KD1R 3G6EQ 1VQ8Q 1YJWQ 3G4SQ 1YI2Q 1JJ2P 1KQSP 2QEXQ 1YIJQ 1VQKQ 2OTLQ 1VQPQ 3I55Q 3CPWP 1N8RR 3CXCP 3OW2P 3CD6Q 1M90R 3CC2Q 3CCRQ 3CCVQ 1Q7YR 3I56Q 3CC7Q 3CMEQ 1VQ4Q 1Q86R 1Q82R 1K73R 3CCEQ 1QVGP 1K8AR 1Q81R 1VQLQ 1VQ5Q 1W2BP 3CMAQ 1KC8R 1M1KR 1YJ9Q 1VQOQ 3CCQQ 3CC4Q 1VQNQ 2OTJQ 1YJNQ 1VQ9Q 1QVFP 1YITQ 3CCSQ 3CCMQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ Q;  1VQM Q;  3CCU Q;  1VQ7 Q;  3CCL Q;  2QA4 Q;  3G71 Q;  1S72 Q;  1NJI R;  1K9M R;  1VQ6 Q;  1YHQ Q;  1KD1 R;  3G6E Q;  1VQ8 Q;  1YJW Q;  3G4S Q;  1YI2 Q;  1JJ2 P;  1KQS P;  2QEX Q;  1YIJ Q;  1VQK Q;  2OTL Q;  1VQP Q;  3I55 Q;  3CPW P;  1N8R R;  3CXC P;  3OW2 P;  3CD6 Q;  1M90 R;  3CC2 Q;  3CCR Q;  3CCV Q;  1Q7Y R;  3I56 Q;  3CC7 Q;  3CME Q;  1VQ4 Q;  1Q86 R;  1Q82 R;  1K73 R;  3CCE Q;  1QVG P;  1K8A R;  1Q81 R;  1VQL Q;  1VQ5 Q;  1W2B P;  3CMA Q;  1KC8 R;  1M1K R;  1YJ9 Q;  1VQO Q;  3CCQ Q;  3CC4 Q;  1VQN Q;  2OTJ Q;  1YJN Q;  1VQ9 Q;  1QVF P;  1YIT Q;  3CCS Q;  3CCM Q; 
#chains in the Genus database with same CATH topology
 3J81 E;  2CH4 A;  3JSC A;  2PUK B;  5GMK h;  1C6V X;  4BI3 A;  1UGR B;  5IAY A;  5GJW B;  2SRC A;  4RKU E;  2YLC A;  2YRC A;  4Z88 A;  3L2W A;  2EYZ A;  3QDF A;  1LCK A;  1VQL T;  4Y28 E;  1LOJ A;  2DPP B;  1VQ9 A;  3P8D A;  5CKF A;  2B86 A;  4M78 E;  2P4T A;  3RES A;  1YI2 A;  1VQ6 T;  4DOW A;  2X4J A;  1M8V A;  2M02 A;  3N5B B;  3I9Q A;  3ZFJ A;  1NBE B;  5I2S A;  1Y96 A;  3CC2 A;  1Z9Z A;  1VQ4 Q;  4A4F A;  2M1H A;  4OML A;  3I56 A;  1I1J A;  3DB3 A;  3HL8 A;  2LDM A;  1YJ9 Q;  4J7I A;  2HAX A;  1UHC A;  4R56 A;  1WHL A;  2VVK A;  4C92 F;  3M55 A;  3LGL A;  1NE8 A;  3GOX A;  3FDR A;  2YRD A;  4M78 B;  5I2M A;  3CCS T;  1H8K A;  1WX6 A;  2DXC A;  1K4U S;  1YJW Q;  1PD0 A;  4M7A C;  3G6E T;  3G4S T;  3QJY A;  3SEM A;  2R5A A;  4PJL A;  2KE9 A;  2E6Z A;  1EZZ B;  2GF7 A;  5HK3 A;  4CI0 C;  3I5R A;  4L6V 5;  4F7U A;  4LE9 A;  2ED0 A;  2EYX A;  1UG1 A;  4OMF B;  2OTJ Q;  2ZPH B;  2J7I A;  1GFD A;  3CCJ Q;  1NPP A;  3JB9 D;  4PLL A;  3SWN A;  5FU6 C;  1BKB A;  3I5S A;  1O9S A;  4LD9 K;  2DIG A;  3VJP A;  2HL3 A;  2QEX A;  1RAC B;  2QGF B;  2HMA A;  3OYH A;  2ZPI B;  3CD6 A;  2L5Q A;  4WF2 A;  3TSW A;  5L23 A;  1VQL Q;  4PNO A;  1HSQ A;  3JCM h;  1MV0 B;  2YUO A;  1M1K R;  3QO3 A;  1N6A A;  1HXD A;  5GAN 8;  2KT8 A;  3JB9 G;  2J06 A;  4X1V A;  1B3Q A;  2LTO A;  3CCU A;  2DIL A;  1WZO A;  1QVF S;  4OF1 A;  1KQ2 A;  2D0N A;  4M75 B;  2AKL A;  2V1R A;  2NUT B;  3UPU A;  3RKX A;  2CYZ B;  3DLM A;  1SRM A;  3CPW S;  3CMA T;  1GFC A;  4HT9 A;  4XQ3 A;  2YDL A;  3RMS A;  4N4H A;  4OB1 B;  4C0D C;  3S3M A;  1KK7 A;  4ORZ A;  1GXI E;  4E7K A;  2ED1 A;  2P0P A;  4IKF A;  2A08 A;  3JCM g;  5KYU A;  1Y57 A;  3MET A;  2EWN A;  2RQT A;  1H92 A;  1X69 A;  4N4I A;  1UGS B;  3A5Z B;  1GRI A;  2F1L A;  2MMP A;  2BKD N;  2L3R A;  1ZSZ C;  3NPF A;  2FB7 A;  1S72 Q;  1GCQ C;  3OSV A;  1ACM B;  1VQ6 A;  1QP3 A;  1KFZ A;  4RCC A;  2D1X A;  3F70 A;  1KJW A;  3A8L B;  1TUC A;  2LCL A;  1UGP B;  4FT2 A;  2KSS A;  2ZGW A;  3NTI A;  4E7S A;  4DA4 A;  5CKE A;  2CUD A;  1M3C A;  1GL5 A;  2YWW A;  1JEG A;  2I2L A;  5CKB A;  1ZHI A;  2DA9 A;  3X26 B;  4C92 C;  2FG0 A;  3CBP A;  2XKO C;  1RAI B;  4JRP A;  3EGX A;  4P5N A;  4KT0 E;  1KD1 R;  4X34 A;  1WJQ A;  3R6O A;  4J9E A;  5CKH A;  3G4S A;  1XOV A;  2DEQ A;  3M0U A;  2JNG A;  1XTD A;  1DJ7 B;  1WYX A;  2LCC A;  5GAO m;  3VYH B;  1ABQ A;  2QDL A;  4LDU A;  1KQS S;  1JJ2 S;  4F7U F;  3CMA Q;  3OYG A;  2DYI A;  4N0A A;  5I11 A;  2EQJ A;  3REB B;  2O4X A;  4MMK A;  3OS5 A;  5LL6 S;  2JOY A;  5FWB A;  3E19 A;  3VU3 C;  1VQN T;  2K9G A;  4JDS A;  2K3Y A;  2J05 A;  2PTK A;  3ZL7 C;  1M2V B;  5GAM e;  3PIP A;  1BU1 A;  2EJF A;  2BZ8 A;  1TSF A;  1UFF A;  2O31 A;  3GNG A;  5C0M A;  4JRI A;  4CC2 A;  4J5Y A;  2DNU A;  3O5Z A;  3UF4 A;  5CAI A;  2JXB A;  1TOV A;  4BB7 A;  3OS1 A;  1BK2 A;  1JBM A;  5LJ5 e;  1BYM A;  1OQK A;  2NLU A;  1D09 B;  1QLY A;  2GTJ A;  3HRS A;  1VQ7 T;  1U8R A;  3JB9 J;  2AK5 A;  2XHC A;  3M0T A;  3CQT A;  2V8J A;  1VYT A;  1W70 A;  2VV5 A;  4A4E A;  1KG1 A;  4CC4 B;  4ZN1 A;  2L3P A;  3UAT A;  4BUG A;  1QKX A;  2YUN A;  2COY A;  1IZ6 A;  1QVF P;  3EAE A;  2PZ1 A;  2HKN A;  2GFU A;  2QA4 Q;  3MP8 A;  4M75 F;  2F5T X;  5GAM d;  1VQP Q;  1HD3 A;  3CPW P;  3VS4 A;  3S6W A;  5LJ3 h;  4IUR A;  3WVE B;  2KYB A;  4HKE A;  3JCM c;  2JMC A;  2ENM A;  5KYW B;  1PSF A;  3PNW C;  2LQW A;  5D7U A;  2DKG A;  3UA7 A;  2FZK B;  1F1B B;  5LJ5 d;  3V8J A;  4ZGJ B;  3CXC A;  1C1A A;  2LCS A;  4OMQ A;  2AKK A;  4F04 B;  2OTL Q;  3X20 B;  4J9H A;  2CH4 W;  1BBZ A;  3TSZ A;  4M7A D;  3OSS C;  2QQA A;  2DK3 A;  1U3O A;  4HXJ A;  1R8O B;  5GAO r;  3JAM E;  4DBR A;  2NWM A;  3OMC A;  1K73 C;  1YCS B;  1M4Z A;  2DL7 A;  3L42 A;  3FLG A;  3PVL A;  4MDW A;  3OYF A;  1C0M A;  2CS7 A;  4M7A G;  3BDU A;  1VQK T;  5FWC A;  1K1Z A;  2RI2 A;  4PJO G;  1QCO A;  3V8K A;  2RPN A;  1G83 A;  4PJO E;  1GCP A;  5CCA A;  3SWN C;  1QVG S;  4J9C A;  3C0C A;  1KHC A;  3MO8 A;  2MPX C;  2P84 A;  3ZBD A;  1QWF A;  3OYY A;  1JJ2 P;  1XQH A;  1KQS P;  2R58 A;  2VXE A;  2RQU A;  4LUE A;  2DRK A;  3FEO A;  4K11 A;  1Y7X A;  3QZ9 B;  1ZX6 A;  5GAM h;  3LLR A;  4JJN K;  1D1A A;  1FYN A;  3CCE T;  3V7S A;  2A3L A;  4NL3 A;  2C0T A;  1K8A C;  1AHJ B;  4LD6 A;  3L2R A;  1K9A A;  2YUQ A;  1VQ7 A;  4L59 A;  3JCM Q;  3H0F A;  2FRY A;  4KGZ B;  1V1C A;  2IVW A;  3OYD A;  2LX7 A;  5LJ5 h;  2CP3 A;  4AFQ C;  2C0I A;  3CC7 T;  5IXB A;  3EFS A;  5GAN d;  1PRL C;  1YNZ A;  3EG2 A;  4WCI A;  3A8O B;  5GAN j;  2O2O A;  4PLI A;  3CCQ T;  4M75 C;  5AYF A;  2VAS A;  4IUP A;  1Q82 U;  1K0X A;  4EDU A;  4C8Q G;  4AG1 C;  3X25 B;  3P8H A;  5KCH A;  3CCR Q;  4C8Q E;  5GAM g;  3RDV A;  2OAW A;  3MJX A;  2HQX A;  2DD4 A;  5DLO A;  5FRO A;  3HFO A;  1BB9 A;  3REA B;  3H41 A;  4A63 B;  4WTO B;  4KUD K;  1WIE A;  1M90 U;  3ZEH A;  4C92 D;  1VQM T;  3G71 A;  2COW A;  2XMF A;  1VQ8 A;  2WSE E;  5LJ5 g;  5KYX B;  3H6Z A;  1OX9 A;  2I0N A;  3BFM A;  3H0I A;  4A4G A;  1TUD A;  2JJ9 A;  3EFO B;  3NTH A;  2VGM A;  3CC4 Q;  4AT1 B;  2IPO B;  1IRE B;  2LJ1 A;  4OMN A;  3CCM T;  3HTR A;  3D7S B;  1MV3 A;  1MND A;  2MK5 A;  4ELZ C;  3VUZ A;  1YHQ A;  1Q81 U;  1GCQ A;  2JM8 A;  2X35 A;  1OZ2 A;  1QWE A;  4M77 B;  2XDB A;  1M9S A;  4OVA A;  3LW5 E;  1IXD A;  1KSW A;  1BCM A;  1OEB A;  4N0A C;  3QYH B;  3SDZ A;  2D9T A;  3L2Z A;  3TVT A;  2EBP A;  4C92 A;  2LC4 A;  2L0A A;  3CCL A;  2X4Y A;  1H3H A;  2HL5 C;  2K6D A;  2RQV A;  4GY5 A;  3M5A A;  4J7F A;  2NUP B;  1SF9 A;  1QVG P;  3OYB A;  3CCE A;  1N8R C;  2EVR A;  1SHF A;  4JJB A;  4PFP A;  3HFN A;  1BI3 A;  1YWO A;  2EQK A;  1SPK A;  1KC8 C;  2VC8 A;  1J3T A;  3QKJ A;  2JMA A;  1MMA A;  3VS7 A;  3JB9 I;  2K79 A;  3M0R A;  3OB9 A;  2EIF A;  2JM9 A;  2F5K A;  4PJJ A;  2VGN A;  1IO6 A;  3CC7 A;  4HCK A;  4X9C A;  4B9X A;  1K76 A;  1MUZ A;  3CME A;  5HCK A;  1VQ4 T;  2DBM A;  4LDY A;  2EGE A;  3I35 A;  1M3A A;  5IHN A;  1YJ9 T;  4JZ4 A;  4PFO A;  2QG9 B;  2RHZ A;  3CCM Q;  3CCQ A;  3H9N A;  1UGQ B;  2L2P A;  2W10 A;  1WHJ A;  1YJW T;  5HKC A;  4R55 A;  1G5V A;  2MCN A;  3H8Z A;  2FZG B;  1NLO C;  4A4K A;  2E1H A;  5IH2 A;  2YUP A;  5IHI A;  5M9O A;  5KYY A;  4QQ6 A;  1UB4 A;  2FL7 A;  4A4H A;  1M5Q 1;  2OTJ T;  3MEW A;  1VQM A;  3CCJ T;  2E64 A;  5HK0 A;  4ZGD B;  2SEM A;  3RMQ A;  3I56 Q;  2HSP A;  2KRO A;  1V29 B;  4M7D B;  2E6N A;  3HKS A;  1QVF A;  2O9S A;  2PU9 B;  1RAF B;  2V26 A;  2LX9 A;  4JUV A;  1JRI A;  1BI1 A;  2AZV A;  1YJN Q;  2ZCF B;  2DEU A;  2KBT A;  1B34 B;  3E2U A;  3OBW A;  5GAO l;  3CPW A;  1I8F A;  4B9W A;  4E7H A;  4QQD A;  2R5M A;  2ECZ A;  1BIB A;  5CIU A;  4RUG A;  4F7U G;  4CRI A;  2JVV A;  1QW1 A;  1NLP C;  3X28 B;  2J6O A;  1R0B G;  3DB4 A;  4M77 F;  3VS1 A;  1M27 C;  1S1N A;  1HYO A;  5GJV B;  2F2X A;  4IIO A;  1WI7 A;  3M0P A;  3I55 T;  3LGF A;  2LJ0 A;  1MMG A;  2CP0 A;  4DBH A;  2CP2 A;  1YN8 A;  1OU9 A;  2DL3 A;  2M9U A;  4OGE A;  5J39 A;  1VQO Q;  3OW2 S;  4MZP A;  3T9N A;  2RK2 A;  2DE0 X;  2QQS A;  2EFI A;  2RI3 A;  3C94 A;  4M78 A;  4OB3 B;  4PL6 A;  2DLP A;  4DEX A;  3VS5 A;  4CC7 A;  1WNL A;  1Q86 U;  2O9V A;  2V8I A;  2KNB B;  2M0Y A;  2QQR A;  1S72 T;  4II1 A;  2JN0 A;  1FWZ A;  3OQ5 A;  2ZPF B;  2KEA A;  2ZPG B;  2GBQ A;  4UC4 A;  4M75 D;  2K5L A;  2EGC A;  3TQ7 P;  1I4K 1;  2GFA A;  4M4Z A;  2KVQ G;  4XTY A;  5EG2 A;  4RTU A;  1NZ9 A;  4BI4 A;  1VUB A;  1SG5 A;  4JZ3 A;  1OX8 A;  3HHT B;  3BDL A;  1E7O A;  1KQS A;  1JJ2 A;  1I07 A;  1G2B A;  4IIM A;  2VWF A;  1YJW A;  2CZ6 B;  1W1F A;  1Q95 G;  1PHT A;  2V1Q A;  1GBR A;  1UTI A;  3JCM P;  3RR6 A;  6AT1 B;  1M30 A;  2LNH B;  2RNA A;  2WSC E;  4FSX A;  2IG0 A;  2OTJ A;  2EYY A;  1W2B S;  1D0X A;  5GAN 6;  5J26 A;  3MHX A;  4M75 A;  4V2S A;  3I55 Q;  1NJI C;  1N9S A;  3EHQ A;  2NUT A;  2QAS A;  2RHI A;  4BY6 C;  2MI6 A;  4NOY A;  2RHY A;  1Q82 R;  3TRE A;  2COZ A;  1LVK A;  2R57 A;  1VQL A;  1NEG A;  1ARK A;  1OU8 A;  3OYJ A;  2KGT A;  1X43 A;  4OB2 B;  2RHX A;  4GLK A;  4FW1 A;  4JS5 A;  2DVE A;  3MP1 A;  3U23 A;  4E7J A;  1WPY A;  4M7D F;  1ZLM A;  2EQU A;  2K5F A;  3CEY A;  1M90 R;  4BDZ A;  3RER A;  1WHH A;  4HT8 A;  5IN1 A;  3VRY A;  2E3H A;  3OY9 A;  5FU7 C;  4IUU A;  2CP6 A;  4NL2 A;  1LPL A;  3PMT A;  5CQY A;  1AEY A;  1Q86 C;  3QBY A;  3CCS A;  4M77 C;  1D3B B;  2RJE A;  2BUD A;  2K3B A;  2QA4 T;  3G6E A;  2EYQ A;  2WAC A;  2VKN A;  2JW4 A;  1X27 A;  3MCA B;  1QCF A;  4QKU A;  1VQP T;  4OMO A;  2FEI A;  1T0H A;  2HSE B;  3EG9 B;  1Q81 R;  3QWY A;  1RLQ C;  2PVD B;  5GMK m;  1EX4 A;  1SKU B;  1UDL A;  4M78 F;  1ZBX A;  2E3I A;  1S72 A;  2DO3 A;  1BIA A;  1W4S A;  1K73 U;  4L5G A;  3OYC A;  2EYW A;  5GMK i;  2X3X D;  1ZUK A;  3OW2 P;  3E9G A;  1CSK A;  2H8H A;  3RNJ A;  2OTL T;  1PKT A;  4J6W A;  1E6H A;  1N5Z A;  2AHJ B;  2RI5 A;  4C5E A;  2CUB A;  4AFS C;  3GBQ A;  2A37 A;  2DRM A;  1M2V A;  5LJ3 f;  2XDD A;  3IQL A;  5I21 A;  5KE3 A;  2G6F X;  2ZPE B;  2HEQ A;  2LQK A;  2DTH A;  1QVG A;  3JB9 H;  2DL5 A;  2DF6 A;  2YT6 A;  1KHI A;  4D6W A;  3LWH A;  3OBY A;  3QZ5 B;  3CMA A;  4QVZ A;  4FYY B;  3EG3 A;  1PCX A;  3FJP A;  2DL8 A;  3BY7 A;  4MZT A;  4LXC A;  4RG8 A;  1K8A U;  1WXU A;  4QVC A;  2DJQ A;  2QXF A;  2J6F A;  2AZS A;  2CP7 A;  5IHK A;  5GAO n;  2F2V A;  1W2B P;  2XK0 A;  3LYI A;  1YIT Q;  3JV3 A;  3M0Q A;  3L2V A;  2L8D A;  1N27 A;  1ZA1 B;  5KE2 A;  3GP8 A;  3QHS A;  1WXB A;  2F69 A;  4M7D C;  2RJD A;  5KH6 A;  3C12 A;  3KXT A;  2ROL A;  3LWI A;  1AVZ C;  3M4Y A;  2DZ9 A;  4VUB A;  3R6N A;  5KYW A;  3URG A;  2HD0 A;  2HCK A;  2X4X A;  4FIB A;  4PFZ A;  3M53 A;  1IHW A;  3ULR B;  2MOX A;  1Y0M A;  4IUV A;  1HJD A;  1QKW A;  2E5Q A;  2H3E B;  2E4H A;  2RF0 A;  3RIR A;  2QTV A;  2HKQ B;  2ATC B;  2K2V A;  4KH0 B;  1YIJ Q;  5FLX E;  4DOV A;  2KXD A;  3J80 E;  3EGD B;  3OYM A;  5DLQ E;  3BW1 A;  3JCM X;  4HVV A;  3CCR T;  2VB6 A;  2GCX A;  4M7A E;  1BI2 A;  2NUZ A;  5GAN e;  1AT1 B;  3AHU A;  4M78 C;  3FJ5 A;  3DLL A;  2DFU A;  3E1S A;  1VQN A;  1BCO A;  2KMT A;  1Q7Y U;  4C5I A;  4BAC A;  2PVO B;  1D1C A;  1SSH A;  1X75 C;  1Y07 A;  2OTL A;  2EJ9 A;  4XK8 E;  4M7A B;  1U1S A;  1KIK A;  4BE0 A;  4Q5W A;  4TVR A;  2DXU A;  3WVD B;  2VYT A;  4BDY A;  2X3W D;  3VKI A;  2D6F A;  1OPL A;  2DM1 A;  4F17 A;  1IGQ A;  4PJO B;  2QQ9 A;  1QCN A;  3GIB A;  1P92 A;  3CC4 T;  4N4G A;  2RQW A;  4AMC A;  4DBF A;  4XTV A;  2YRV A;  3HRU A;  3A8M B;  3OYE A;  1A0N B;  1FMV A;  3VYG A;  5FU6 B;  1TU0 B;  1VOM A;  2ZAE A;  1ZA2 B;  5GAN 4;  3QPH A;  3O8V A;  1WJS A;  4C0G A;  4QQG A;  3QYG B;  4LDW A;  1HK9 A;  1N8R U;  2QDY B;  3LH0 A;  3G71 Q;  5GAO q;  4OGC A;  3SD4 A;  4A53 A;  4LDV A;  1VQ8 Q;  3QSU A;  1T0J A;  2DVJ A;  1KC8 U;  4FT4 A;  1IGU A;  1FXX A;  2FPE A;  2QQB A;  2E70 A;  2ZZD A;  2K2M A;  2E41 A;  1VQ5 T;  4C0Z A;  4OP0 A;  2V8K A;  3PTA A;  3SFM A;  2DX1 A;  1YHQ Q;  5J3B A;  4RTW A;  1E6G A;  4C0D B;  2RM4 A;  4M77 D;  4C8Q B;  2AT1 B;  2CT4 A;  2JUF A;  2KK4 A;  4FSS A;  1WHG A;  2CZ0 B;  1Q7Y C;  2GTO A;  2Y4Y A;  1WJR A;  2A0F B;  1ZBJ A;  4BE1 A;  1XNI A;  3CCL Q;  4C92 G;  1NYG A;  1AWJ A;  2CDT A;  4HCC A;  2KY9 A;  5KYX A;  3A8G B;  2QGG A;  1ZSZ B;  1MNE A;  4C92 E;  4EMK B;  1RAH B;  2CT3 A;  2W0Z A;  1VQK A;  3CCR A;  1NG2 A;  3EFO A;  3PT9 A;  2RJC A;  2HNI A;  1MHN A;  1TWB A;  1JO8 A;  3VRZ A;  1R0C B;  1M1K C;  3WXM B;  4JLI A;  1PM3 A;  5GAN h;  1N9R A;  4M77 A;  4C5G A;  3QWX X;  2PVG B;  2ABL A;  1OOT A;  1TUG B;  3CME Q;  1YP5 A;  3QXE B;  2CGH A;  3I56 T;  2RN8 A;  1VQ5 Q;  3HSB A;  1M3B A;  3GPL A;  3CC4 A;  4E7I A;  5GMK j;  1JU5 C;  1JXO A;  2KQW A;  1YJN T;  5D6X A;  2KI7 A;  2L89 A;  2YSQ A;  2RB6 A;  2NUP A;  2BE7 D;  2YLB A;  1RAG B;  3SB2 A;  3CCV Q;  4PJO F;  4J9B A;  4LUD A;  2WSF E;  5L8R E;  1OV3 A;  1K73 R;  4IUQ A;  1UJ0 A;  2P0K A;  4NS5 A;  4Z8A A;  1M8M A;  2JT4 A;  5GAN g;  2KAF A;  1G3W A;  2AIR B;  3OW2 A;  4PJN A;  1VYU A;  2CZ7 B;  5AT1 B;  4FU6 A;  4QW2 A;  1U06 A;  1WXT A;  4M7D D;  3MKD A;  2OJ2 A;  1RAA B;  1TH7 A;  1X01 A;  4XU0 A;  1D0Z A;  4ME7 A;  4QVD A;  1XJW B;  2FVU A;  1VQO T;  1YWP A;  1VQ9 Q;  3V7R A;  1KQ1 A;  3M57 A;  1X6O A;  3A1P A;  1ZUY A;  2KYM A;  2BE9 B;  3PE0 A;  3KBG A;  3JRZ A;  4MZM A;  3PVQ A;  5C6S A;  1YI2 Q;  4ZNX A;  3VS6 A;  2KR3 A;  2LQN A;  3CBM A;  1UEB A;  3E9F A;  1KD1 C;  3CC2 Q;  1QVP A;  2X4W A;  2KT1 A;  3A8H B;  4BD3 A;  4ZTJ A;  1QMC A;  1K8A R;  1O75 A;  2PUO B;  2RK1 A;  2OI3 A;  2JS2 A;  3NGP A;  1T3S A;  1IB8 A;  2B8A A;  1VIE A;  1PD1 A;  3THK A;  2C06 A;  1WQ7 A;  3CCM A;  1TXQ A;  4M78 D;  4C8Q F;  3JCM d;  5GMK l;  8ATC B;  5IXF A;  3RKW A;  1W2B A;  4M7D A;  2MAM A;  2DIQ A;  4GBQ A;  5FRM A;  2EKO A;  2FPD A;  1Y96 B;  2CP5 A;  1NJI U;  8AT1 B;  1RAE B;  4JJD A;  3S3N A;  2MYS A;  2FZC B;  1B34 A;  1NPR A;  4M78 G;  1G3S A;  1I5O B;  2L3Q A;  4F7U E;  4HCB A;  2GGR A;  4GLM A;  1PWT A;  3MPU B;  4RMO A;  1VIF A;  2JTM A;  2QEX Q;  1GBQ A;  2X51 A;  3MEU A;  3JCM f;  4E47 A;  3J7A F;  4O6J A;  3CD6 Q;  4J9I A;  3EG0 A;  1WA7 A;  3GNF B;  4JJC A;  2XU8 A;  5CQX A;  5GAN 7;  5HY6 A;  2GQI A;  1K9M U;  4PJM A;  1IRX A;  4F7U B;  2CZ1 B;  1YJN A;  4JS4 A;  2EAY A;  3CCU Q;  4J9D A;  4HA8 A;  3Q1J A;  5FW9 A;  3SWN B;  3TCJ A;  4OB0 B;  1Y71 A;  1EFN A;  3DKM A;  5DM7 R;  1PC0 A;  3GF5 A;  4PJO C;  2FRW A;  2E10 A;  1Q7Y R;  2RMO A;  2QK0 A;  3OYK A;  3CPF A;  4FYX B;  1VQ4 A;  4J83 A;  5EC7 A;  2LT1 A;  1YJ9 A;  1M1F A;  2DL4 A;  2M0O A;  2D8J A;  2F2W A;  3PGG A;  3M0S A;  2NYS A;  1AZG B;  2DET A;  1CKB A;  1MMN A;  1ZSG A;  3OMG A;  3CBO A;  3OS0 A;  2CKK A;  4M75 G;  2HQH A;  1TS9 A;  3A98 A;  4EMG A;  1LNX A;  4M75 E;  3P8B B;  2ZPB B;  1RI0 A;  1TTH B;  2EW3 A;  2XDP A;  3EH2 A;  1VQO A;  4KGV B;  2EPD A;  3ASK A;  2Y4X A;  2O01 E;  5I22 A;  3VV0 A;  2KDS A;  2Y90 A;  4JRK A;  3JCM V;  3CCJ A;  1VQ6 Q;  2MWO A;  2GNC A;  4FL6 A;  3VUB A;  3UDC A;  1N8R R;  1JQQ A;  1VYV A;  2VUB A;  2JTF A;  5ECA A;  2MF2 A;  1AWO A;  4IUT A;  5CO7 A;  2O88 A;  1RI9 A;  2HDA A;  1KC8 R;  5KYU B;  2RD1 A;  5LJ3 e;  3CCS Q;  1AWX A;  3NHN A;  3FIF A;  5GAN 5;  4HCZ A;  4MDX A;  4C8Q C;  1QP2 A;  3G6E Q;  2OAU A;  3G4S Q;  4BE2 A;  2CRE A;  4LNP A;  1WFW A;  2DAQ A;  2DZC A;  2E12 A;  1K9M C;  2MWP A;  2LP5 A;  4D8K A;  3EGU A;  3JCM W;  2PQW A;  2IIM A;  1SRL A;  1RL2 A;  5D6W A;  2Z0W A;  2K7A A;  1K0S A;  5A0D A;  3NMZ C;  3SHW A;  2FYK A;  4EMK C;  1AWW A;  5DY9 A;  1VA7 A;  3EGX B;  2M16 A;  4KRT A;  1WHK A;  2FHD A;  3KUF A;  3I55 A;  4X9D A;  2RHU A;  3ME9 A;  1D1B A;  3NTK A;  2DXT A;  1X2Q A;  3FB9 A;  2JZ2 A;  2K4Y A;  2A36 A;  4KH1 B;  2BIV A;  5LJ3 d;  1D3B A;  4XTW A;  2O4X B;  4RG2 A;  1YIT T;  2XG8 D;  4RTY A;  2LZ6 B;  1IHV A;  5LJ3 j;  4EMH A;  2QAZ A;  3PIO A;  3EG9 A;  3VS3 A;  2HBW A;  2QYZ A;  2ESW A;  1UGV A;  3M59 A;  1WQW A;  2ROT A;  1ABO A;  3UA6 A;  4DEY A;  4KGX B;  2M51 A;  1PNJ A;  3MEV A;  1AD5 A;  1B7T A;  4JLG A;  1X2K A;  4XU2 A;  3RBB B;  1YIJ T;  2K5I A;  3M4G A;  3OYN A;  1T3L A;  1PG5 B;  1SHG A;  5FRN A;  1PKS A;  3NFC A;  3V8L A;  1YCY A;  4FYV B;  2DJZ A;  2H3J A;  3KFV A;  4C0F A;  3JCM b;  1UJY A;  5IT9 E;  4FM4 B;  4OMP A;  3M9Q A;  3RUX A;  2RQR A;  2RJF A;  4ATO A;  2GQV A;  2YXY A;  4KUI A;  2JTE A;  3EH1 A;  1D0Y A;  2XID A;  2LQ8 A;  3JB9 F;  1NEB A;  4DBQ A;  2D0Q B;  1BI0 A;  2BZY A;  5A0G A;  1M2O A;  2XD0 A;  2KRM A;  3OYL A;  4ZN3 A;  1RUW A;  1YFN A;  5GAO p;  1SEM A;  1G3Y A;  5GAM j;  3ER0 A;  3TU4 K;  5A2Q E;  2FPF A;  1VQN Q;  2BZX A;  2XI9 A;  2LJ3 A;  3C95 A;  2RO0 A;  2KRN A;  2E5K A;  2FO0 A;  3HPW A;  3BE3 A;  3LX7 A;  2QA4 A;  4J9G A;  3G71 T;  4XAX B;  4ZGE B;  5LJ5 j;  1VQ8 T;  1WHM A;  5GAM f;  5A0L A;  1SSF A;  1VQP A;  3FRN A;  1UHF A;  1U5S A;  4J6Y A;  3H0H A;  1EIF A;  4PJO D;  4DQ2 A;  2OX7 A;  1UE9 A;  2G3R A;  1H64 1;  3RKY A;  1YIT A;  2KXC A;  1VQ7 Q;  1WLP B;  1M1G A;  1NJI R;  4E7Z A;  5LJ5 f;  1U1T A;  1W6X A;  3M58 A;  5CKD A;  5LJ3 g;  3X24 B;  1YHQ T;  2LNV A;  3EGD A;  3HRT A;  2RA2 A;  4BI8 B;  4LN2 A;  3EG1 A;  2LT4 A;  1RAB B;  1UUE A;  4OMM A;  3S3O A;  5GAN 2;  1RLP C;  2DTI A;  3QII A;  4Z02 A;  4Z89 A;  1K9M R;  1CKA A;  3OYI A;  2L3S A;  2XIC A;  3CCL T;  4ESR A;  2E65 A;  3TEE A;  4E2F B;  2EGA A;  4M7A A;  1YIJ A;  1M1K U;  4ANJ A;  1Q86 R;  4PKC C;  1FMW A;  4PJO A;  4QT7 A;  4J9F A;  3GLX A;  3VS2 A;  2VXF A;  2DD5 A;  3QUI A;  2DMO A;  1H3Z A;  1OPK A;  4C5H A;  2D8H A;  4ELY C;  4KBM B;  2DXB A;  4HVU A;  4CC3 A;  3EHR A;  1PSE A;  4JPB W;  4FYW B;  3MEA A;  1X6B A;  7AT1 B;  4C8Q D;  1YBY A;  1X6G A;  4KUL A;  4XTU A;  2DYB A;  4Y92 A;  3L1A A;  5GAN 3;  1UEC A;  3CME T;  5D6Y A;  4EIK A;  3CXC S;  3C4S A;  2HQE A;  1OUL A;  2K3X A;  5CVI A;  4O5V A;  3INZ A;  1VQK Q;  1V76 A;  4PK4 A;  1Z9Q A;  5GMK e;  4AFU C;  1OZ3 A;  2LRQ A;  3G1J A;  3CCV T;  3FC3 A;  1OYX A;  2LMJ A;  4BY6 B;  4F14 A;  3PMI A;  4RTX A;  2LVM A;  5GAN f;  3EFR A;  1NYF A;  4MML A;  4RTV A;  2KRS A;  2HZY A;  3QDR B;  2DBK A;  2EJG A;  1AOJ A;  4AG2 C;  2P4R A;  1G8X A;  1WGS A;  2JS0 A;  4R0K A;  2CSI A;  4M77 G;  4C8Q A;  2X9H A;  2QI2 A;  4E7L A;  4HVW A;  5KCO A;  2MIO A;  4M77 E;  3CCE Q;  4RCB A;  2BTT A;  2PNI A;  1KD1 U;  3AT1 B;  4Y91 A;  5FU7 B;  4YTL A;  3OYA A;  3L2Q A;  4EPC A;  5CR2 A;  1VQ9 T;  2DER A;  1ZSZ A;  4XU1 A;  3LH5 A;  3HP9 A;  4C92 B;  4EMK A;  2QTX A;  1NM7 A;  1YI2 T;  4D8D A;  3CC7 Q;  1FX7 A;  3CC2 T;  2EQI A;  3G7Z A;  4B6M A;  3V7C A;  4LDX A;  5CK9 A;  4RTT A;  9ATC B;  3CCQ Q;  2A7Y A;  2K57 A;  3L2U A;  1AZE A;  1RAD B;  1I5L A;  1FMK A;  2A28 A;  1PRM C;  4AFZ C;  4M7A F;  1ZUU A;  1WDX A;  4A54 A;  4XTZ A;  1JXM A;  2P0Q A;  4ZTF A;  2J6K A;  3PFS A;  4XU3 A;  2DTO A;  1Q82 C;  3UWN A;  4J6X A;  1VQM Q;  1G3T A;  4FW2 A;  3JCM e;  3QJ6 A;  3QG1 A;  1MMD A;  4J8O A;  1TG0 A;  2QEX T;  3UT1 A;  1ZQ1 A;  3JCM J;  1QQJ A;  1JB0 E;  3CD6 T;  3M56 A;  1VQ5 A;  1M90 C;  3MP6 A;  5KYN A;  2EKH A;  4JRQ A;  1MGQ A;  2CSQ A;  1I0C A;  5KYY B;  4XTX A;  2RH2 A;  4E6R A;  1B07 A;  3OS2 A;  1R77 A;  3CCU T;  4RTZ A;  3VS0 A;  2EQM A;  1LJO A;  3OA6 A;  3CXC P;  4M7D G;  1OI1 A;  4FCY A;  2C0O A;  3CCV A;  4F16 A;  1I81 A;  4M7D E;  2YHT A;  2HBP A;  1Q81 C;  3M54 A; 
#chains in the Genus database with same CATH homology
 3CCJ Q;  1VQM Q;  3CCU Q;  1VQ7 Q;  3CCL Q;  2QA4 Q;  3G71 Q;  1S72 Q;  1NJI R;  1K9M R;  1VQ6 Q;  1YHQ Q;  1KD1 R;  3G6E Q;  1VQ8 Q;  1YJW Q;  3G4S Q;  1YI2 Q;  1JJ2 P;  1KQS P;  2QEX Q;  1YIJ Q;  1VQK Q;  2OTL Q;  1VQP Q;  3I55 Q;  3CPW P;  1N8R R;  3CXC P;  3OW2 P;  3CD6 Q;  1M90 R;  3CC2 Q;  3CCR Q;  3CCV Q;  1Q7Y R;  3I56 Q;  3CC7 Q;  3CME Q;  1VQ4 Q;  1Q86 R;  1Q82 R;  1K73 R;  3CCE Q;  1QVG P;  1K8A R;  1Q81 R;  1VQL Q;  1VQ5 Q;  1W2B P;  3CMA Q;  1KC8 R;  1M1K R;  1YJ9 Q;  1VQO Q;  3CCQ Q;  3CC4 Q;  1VQN Q;  2OTJ Q;  1YJN Q;  1VQ9 Q;  1QVF P;  1YIT Q;  3CCS Q;  3CCM Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...