2DILA

Solution structure of the sh3 domain of the human proline-serine-threonine phosphatase-interacting protein 1
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
69
structure length
69
Chain Sequence
GSSGSSGAQEYRALYDYTAQNPDELDLSAGDILEVILEGEDGWWTVERNGQRGFVPGSYLEKLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Proline-serine-threonine phosphatase-interacting protein 1
publication title Solution structure of the SH3 domain of the human Proline-serine-threonine phosphatase-interacting protein 1
rcsb
source organism Homo sapiens
total genus 5
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dilA00
2YT6A 1AWWA 1WDXA 2L2PA 1J3TA 1YCSB 3PVLA 2PNIA 2VVKA 1SHGA 1MV0B 2ESWA 1XOVA 4JPBW 2LMJA 4WCIA 4Z89A 2RQWA 5IHNA 2P4RA 2DVJA 1UFFA 1GL5A 1Y0MA 1QKWA 1ZUKA 2K3BA 1IO6A 2KROA 2YSQA 2L3QA 3EG2A 4JJCA 1PNJA 2AKKA 2EYYA 2DBMA 1PRMC 2AK5A 1T3LA 2FRYA 3O5ZA 2A08A 1HSQA 1W1FA 2LJ1A 2ROLA 1K0XA 4RTWA 1YP5A 2DL5A 2CUDA 4AFUC 1NG2A 2EW3A 2HCKA 3VRYA 4OMNA 5HCKA 2KXDA 3UF4A 2KR3A 2DL3A 2JM9A 4LNPA 4HVVA 4GLMA 4ORZA 4RTXA 3REBB 2EGAA 2K7AA 3I5SA 5EC7A 2DA9A 1N5ZA 2RNAA 5FWBA 1X69A 5IXFA 1YNZA 2AZSA 1PWTA 1EFNA 4HVWA 1MUZA 2JMAA 2EYZA 3A98A 1A0NB 2K6DA 2O88A 3I35A 1HJDA 3VS2A 1RUWA 2J6FA 3M0SA 2OI3A 1NEGA 2A36A 2YUNA 3M0UA 4Z8AA 2FEIA 2V1RA 1JU5C 1B07A 4ZNXA 2CH4A 1JXMA 4RTVA 2K9GA 4Z88A 2JS0A 3EG3A 4OMLA 2CH4W 2F2VA 1GFCA 2RMOA 4JZ3A 2C0OA 1I07A 2XMFA 2YUQA 3TSZA 2YDLA 1X6GA 2L0AA 2IIMA 4J9BA 1U5SA 3VS4A 1SPKA 1E6HA 1VYVA 2JXBA 3UA7A 2DL8A 3H0IA 2KRSA 4CC2A 2CREA 1GCQA 1LCKA 4R0KA 3REAB 4F14A 2BZYA 2JMCA 1K0SA 4AFZC 2X3XD 2ABLA 1UTIA 1NYFA 1UHFA 1WLPB 1ZUYA 2C0IA 4J9IA 1AVZC 1M3BA 2DMOA 1JXOA 4IIMA 1ZX6A 1KIKA 2CT3A 2A28A 2JW4A 1U3OA 1RI9A 1NM7A 1SSHA 1PKSA 2LCSA 2OAWA 1V1CA 3NHNA 1VYTA 2QDLA 1UHCA 1AD5A 4E6RA 2FPDA 1GCPA 1OOTA 2E5KA 1TUDA 3VS6A 1KFZA 1CSKA 3EG0A 1M30A 1X2QA 2GNCA 2GTOA 4OMMA 1OPKA 2CDTA 2O9SA 2EYXA 2JM8A 1YWPA 2D8HA 2MOXA 3VS3A 2AKLA 1UG1A 2RN8A 1UUEA 1AWXA 1WYXA 1WFWA 2LQNA 1WXBA 1YN8A 1H8KA 1GRIA 3PVQA 4D8DA 3C0CA 1VA7A 1Z9QA 2BZXA 1NLPC 2AZVA 3EG1A 2F2XA 1QCFA 4KRTA 1SEMA 1M3AA 2FRWA 1NEBA 3R6NA 1QWEA 4EIKA 2DBKA 5FWCA 2DYBA 2KT8A 2HBWA 2KRNA 3UATA 1BU1A 1KJWA 1SRLA 1WXTA 2DM1A 2F2WA 1AWOA 2O2OA 4AG1C 2H8HA 3EHQA 1S1NA 2CSIA 3H0HA 2J06A 1M3CA 2L3SA 2X3WD 3RNJA 1FMKA 3UA6A 5GJVB 1UE9A 2EKHA 2YUPA 4OMQA 4LUEA 2A37A 3TSWA 1B3QA 4A63B 1BB9A 1M8MA 3LH5A 1X27A 2G6FX 4F16A 3ZL7C 4HVUA 2LJ3A 3M0TA 2JT4A 1X6BA 1QLYA 2DL7A 4K11A 4CC4B 2LNHB 2DF6A 3SEMA 2DE0X 3VS0A 3I5RA 1PKTA 1WX6A 2LZ6B 3QWXX 2KYBA 3JV3A 4M4ZA 2C0TA 3I9QA 4Y92A 1OEBA 5IHIA 4LN2A 4AFSC 2CUBA 1GBQA 1H92A 5IH2A 4JJDA 5IXBA 2PTKA 1T0HA 4J9FA 4JJBA 1M27C 2JTEA 2OJ2A 1TG0A 1K4US 1OV3A 3SHWA 2W10A 4ESRA 1GCQC 2RPNA 1ZBJA 2RQUA 2HEQA 2EQIA 2VWFA 2RQVA 2KBTA 2O9VA 4RUGA 2HSPA 3NMZC 4X1VA 2EVRA 3VS5A 2KE9A 2B86A 1H3HA 1KSWA 2MIOA 1QWFA 2LX7A 1T3SA 2W0ZA 2RF0A 4AFQC 2K2MA 2NWMA 2KRMA 3H0FA 2DJQA 4HCKA 4RTUA 1CKBA 2M0YA 1OPLA 2DRKA 1ZLMA 1UECA 2DX1A 2EGEA 3FJ5A 4LUDA 3EGUA 5GJWB 1E6GA 3CQTA 2EGCA 3M0QA 3RBBB 1NLOC 2JS2A 2FPEA 2V1QA 2GGRA 2YUOA 3THKA 1GBRA 5IHKA 2DRMA 4FSSA 3PE0A 5L23A 1UJ0A 2ED1A 1GFDA 1AEYA 1ARKA 2KNBB 4RTTA 5ECAA 2NUZA 1PHTA 2KEAA 2L3PA 1JO8A 2CSQA 3NGPA 5FW9A 4J9CA 2EBPA 2J6KA 2LP5A 3VS7A 4HXJA 4OMOA 2ENMA 1AOJA 2CT4A 4GBQA 1Y57A 1K76A 2DNUA 1QKXA 2O31A 4OMPA 2SRCA 1ZSGA 4JZ4A 1UJYA 4IIOA 1WA7A 1NYGA 5I22A 2FO0A 3VRZA 2J05A 2KGTA 1UDLA 3U23A 1YWOA 1AWJA 4RTZA 1FYNA 1G83A 2DL4A 1PRLC 1BBZA 1AZEA 1I0CA 2DLPA 1TUCA 4AG2C 1WI7A 1VYUA 2ED0A 2HDAA 3H41A 2LJ0A 2FPFA 1UGVA 2DILA 1RLPC 4D8KA 1E7OA 1WIEA 3IQLA 1CKAA 1WXUA 2KT1A 3M0PA 1ZUUA 2KXCA 3M0RA 1HD3A 5I11A 2BTTA 2PZ1A 2J6OA 2BZ8A 1SRMA 1X43A 1JQQA 3TVTA 4DEXA 1T0JA 1BK2A 1G2BA 1U06A 2K79A 1ABQA 2KYMA 2SEMA 2VKNA 1JEGA 4DEYA 2D0NA 2RQTA 2ECZA 1I1JA 1SHFA 2LQWA 4LE9A 2GBQA 2J7IA 1W70A 1K1ZA 2ROTA 1ABOA 4J9EA 3EHRA 2EPDA 2GQIA 4J9GA 2MCNA 1RLQC 3NPFA 4CC3A 2M51A 2D1XA 2FG0A 3ULRB 4F17A 1Z9ZA 4CC7A 4QT7A 4RTYA 3GBQA 1W6XA 2I0NA 4J9DA 4J9HA 1X2KA 2RQRA 1K9AA 3KFVA 1AZGB 2GTJA 2EYWA 3VS1A 2D8JA 1MV3A 3QWYA
chains in the Genus database with same CATH superfamily
1AWWA 1WDXA 4BE2A 4FYVB 5GAMh 3M4GA 4EMKC 1SHGA 1QP2A 4M78F 2EYQA 3CC7T 4HCBA 5IHNA 4FCYA 3G6EQ 4M78A 3I55A 2KROA 4M7AC 1QW1A 5KYYA 3CXCP 4JJCA 1LPLA 2AKKA 2AK5A 4PFZA 2LQ8A 2V8KA 2QQAA 1W1FA 2HQHA 1K0XA 3E19A 2FB7A 4FYWB 4BDYA 2CUDA 4AFUC 1VQ7Q 4HKEA 3VRYA 3ZFJA 4M75C 1YJWA 5HCKA 4RCCA 3J81E 4PKCC 2KR3A 3RKWA 2JM9A 4OB1B 2EFIA 1YJ9Q 1K9MC 1N9SA 2EGAA 2K7AA 2EQKA 5KYUA 3FIFA 1Q82R 2DA9A 1N5ZA 3CC7A 4E2FB 5IXFA 5J26A 1NJIU 3P8DA 2BKDN 3CC4T 3CD6T 1PWTA 2RI5A 4KT0E 1MMNA 2K57A 1MUZA 3OA6A 2EYZA 1VQOQ 2XD0A 2K6DA 3OS5A 2VUBA 3I35A 2RB6A 2F5TX 3MO8A 4ME7A 1RUWA 2LT1A 3E9FA 3JCMf 3M0SA 5CKDA 2A36A 3M0UA 2HAXA 4PK4A 2V1RA 1YJNT 3BDLA 5GAN4 2JS0A 1IREB 2CH4W 2JZ2A 1UB4A 1YITT 2P0PA 5GANd 2YDLA 4J9BA 1U5SA 2GF7A 1IGQA 3KBGA 1D3BA 3P8HA 3UA7A 5M9OA 4C5EA 5HKCA 1QVFS 2FZCB 3H0IA 3CC4A 3CD6A 2A3LA 3OW2P 4AFZC 2X3XD 1NYFA 1UHFA 2CP2A 1ZUYA 1AVZC 2DMOA 1JXOA 4IIMA 3I56T 3QJ6A 1VQ9T 2JW4A 5GANg 5KYXA 2E3HA 1SSHA 2CZ0B 2LCSA 1B34B 2VXFA 3RUXA 2B8AA 1VYTA 2QDLA 2RI3A 5LJ3j 1KQ2A 1B7TA 3H8ZA 1YJNA 3R6OA 4E6RA 2FPDA 4C5HA 1O75A 1C6VX 3EG0A 2GCXA 4M7DC 2CDTA 2EYXA 1D1AA 1YWPA 3CCJQ 2QQBA 3C94A 4LDYA 1ZBXA 3FC3A 2X9HA 4IUUA 2AKLA 2HD0A 2RN8A 1AWXA 5LL6S 3Q1JA 1WYXA 1RAIB 1RADB 1WXBA 1YN8A 4E7HA 1JJ2A 1TS9A 2BZXA 2NYSA 4RG8A 1BCMA 5FRMA 1KQSP 1FWZA 4C0ZA 1LJOA 4KRTA 2OAUA 4M75F 2A7YA 1N8RC 3R6NA 4KGXB 4EIKA 3GNFB 4E7SA 2DYBA 2HQEA 2K3YA 2PVOB 2O2OA 4AG1C 4M75A 3LWIA 1G3YA 2LC4A 2H3JA 3RNJA 2DEUA 5GMKj 1FMKA 5A0LA 4M77A 1VQ6T 1M8MA 3LH5A 4FT4A 3BW1A 3MPUB 3RIRA 3EAEA 4JRQA 1X6BA 2DF6A 1BI3A 3SEMA 1ZHIA 3VS0A 1WX6A 2KYBA 3JV3A 2JJ9A 3I9QA 4X34A 3H9NA 4ZGJB 4BD3A 3OYIA 4AFSC 4BUGA 3GP8A 1H92A 5IH2A 4JJDA 5FLXE 4XK8E 4J9FA 4WTOB 5CQXA 4KH1B 1GCQC 2X4JA 3P8BB 3PTAA 1N6AA 2RQUA 2RHUA 1RL2A 4PLIA 1D0YA 4DBQA 4V2SA 1KC8C 2HSPA 3NMZC 4EMHA 3VS5A 2DIQA 4L59A 5IN1A 2F5KA 2MIOA 1QWFA 4P5NA 2LX7A 2MMPA 2ZPEB 4C5IA 4AFQC 2K2MA 1KD1C 2KRMA 2DJQA 4HCKA 1BI2A 4PJOF 2QASA 1UECA 8AT1B 3CMET 5LJ5j 1FMVA 3FJ5A 5GAOl 4M7DF 4IUPA 3CMAT 4PJOA 3RBBB 3OBWA 2JS2A 1K9MU 2V1QA 2DIGA 3GNGA 2JTMA 3L2WA 3EFOA 5IHKA 3E1SA 2DRMA 2RK2A 2EIFA 5GMKe 1SF9A 4RTTA 4FSXA 3M4YA 4MZMA 1JO8A 3G7ZA 1VQPA 3QBYA 4HXJA 4OMOA 4KUIA 1JRIA 3KUFA 1I4K1 4R56A 5D6XA 1PCXA 1QKXA 3URGA 4OMPA 4E7ZA 1O9SA 1Q86C 3V8JA 1WA7A 3OSSC 3CMAA 4KBMB 1K8AC 4CRIA 4MDXA 1WHJA 1MNEA 3LGFA 5GAMf 3MJXA 4KUDK 5I21A 5AT1B 1AWJA 2QQ9A 3BFMA 3EFRA 4F7UA 3MEWA 3DLLA 1AZEA 1N9RA 3I55Q 1TUCA 4AG2C 2ED0A 2VGNA 1IHVA 3CCVT 3QO3A 1EIFA 1UGVA 2LCCA 1RLPC 1E7OA 1WIEA 4A4FA 3QHSA 1QCNA 1D3BB 1ZUUA 1HD3A 2XG8D 1YIJT 2BTTA 2IVWA 3OS0A 4DEXA 1WHMA 4BY6B 4PFOA 4QQGA 1G2BA 1YJWQ 1H641 1QVGS 3WVDB 4JLIA 1ABQA 2KYMA 2NUPA 2WSFE 2LTOA 2RQTA 3H6ZA 2E4HA 1I1JA 2CKKA 3M58A 1WHLA 1QVFA 5KYXB 3CC7Q 2ZCFB 1ABOA 3EHRA 1IHWA 4ELZC 2M51A 5GAOn 4CI0C 1OI1A 1YBYA 3ER0A 2DZ9A 3EG9B 3MP1A 1K9AA 1OQKA 3KFVA 1AZGB 2E6NA 1YIJA 4M7AE 3OSVA 1MV3A 1YCYA 3OB9A 2L2PA 1Y71A 2RJCA 1XNIA 1J3TA 3NFCA 1D1CA 2QGGA 2ZPHB 2ESWA 1XOVA 4JPBW 4WCIA 5LJ3h 1JJ2P 1K73U 4Z89A 1UFFA 1GL5A 5GANh 3FLGA 2OTJA 2XIDA 3CC4Q 2YSQA 3S6WA 3CD6Q 4D6WA 2HKQB 3V7SA 3N5BB 3X28B 1VQKT 1PNJA 3CC2A 1T3LA 3O5ZA 2PUKB 2E64A 4II1A 3OMCA 3CCMT 4RCBA 1UGRB 4IKFA 1YJNQ 2KXDA 1TXQA 4J7FA 2MYSA 5D6WA 1Q81U 2DL3A 3C12A 3JCMP 1WJQA 3M59A 2AHJB 3G4SA 1YITQ 1G8XA 3BDUA 4MDWA 4ZN1A 3CCET 2RNAA 1NJIR 3JCMJ 2AZSA 1RAGB 4L6V5 4HVWA 4C0DB 3LW5E 4J5YA 3HRTA 3MCAB 5GAOr 2FYKA 3CCST 3PIPA 1VQKA 3VS2A 3QZ5B 4FT2A 3JCMW 2J6FA 2I2LA 1NEGA 3SWNB 4MZTA 1VQ9Q 3QIIA 4IUTA 2CS7A 4NS5A 3FB9A 1D09B 5CR2A 1JXMA 3GPLA 3V8LA 2RMOA 2F2VA 2L89A 1I07A 2XMFA 1WQWA 3HRUA 2L0AA 2IIMA 4F04B 2RJDA 1VQ5T 2ZZDA 4OGEA 4FL6A 1VYVA 3CCQA 1VQ8T 3JCMd 3CPWS 2DL8A 2DXBA 4CC2A 3S3OA 2CREA 1LCKA 4R0KA 2FHDA 5GAN5 3REAB 4F14A 1LOJA 2BZYA 1K0SA 1KQ1A 3JCMQ 2ABLA 1UTIA 1WLPB 2MK5A 4TVRA 4A4EA 4J9IA 2CT3A 2A28A 4RG2A 1U3OA 1RI9A 2XU8A 1TOVA 1OZ2A 1VQ4T 4DBFA 4N0AA 1R77A 5FRNA 3JCMg 3X25B 3GIBA 1OOTA 1IB8A 2Y90A 2E5KA 3EFOB 4LDXA 4OMMA 1M30A 2GNCA 1RAEB 3FEOA 1VQ5A 2QAZA 2K2VA 4PLLA 3WXMB 2JM8A 1VQ8A 1X6OA 2MOXA 2EKOA 5CK9A 2JNGA 3OYGA 5LJ5h 1OU8A 1VQ6Q 1H8KA 1GRIA 4D8DA 1OX8A 2ZPBB 1QMCA 1EX4A 3AT1B 2DFUA 4C8QB 2E10A 1VQ4A 4FYXB 1N27A 3EFSA 2CP5A 1M3AA 2GQVA 1QWEA 5FWCA 4F7UB 2R57A 2KRNA 4OGCA 4XTUA 1KJWA 1SRLA 2DM1A 2F2WA 3SB2A 1UGQB 3EHQA 2HKNA 3HKSA 3FDRA 4M78G 4MZPA 5GJVB 1UE9A 4OMFB 1B3QA 4QQDA 1BB9A 4JDSA 1X27A 3OS2A 1QVPA 2K5FA 4FU6A 3ZL7C 3OYYA 4JRIA 1M1KU 2DXCA 3FRNA 3JCMb 1ZSZA 2YLCA 1WHGA 5D7UA 2P4TA 5CKBA 1OEBA 2CP6A 2OTLA 1QVFP 2CUBA 3DKMA 2PTKA 3CMEQ 1QVGA 2RHYA 5KYWA 4OP0A 4JJBA 1M27C 3SWNC 3LX7A 4ESRA 3CMAQ 1FX7A 4HT9A 3JB9J 2HEQA 2EQIA 2RQVA 2BIVA 2KBTA 4M78D 2O9VA 2DERA 2KVQG 4RUGA 4X1VA 4A54A 9ATCB 2B86A 2YWWA 2MAMA 3S3MA 2QEXT 5GANj 1VQNT 3H0FA 3OYFA 2LT4A 3FJPA 4RTUA 4XTWA 1TUGB 2Z0WA 2P84A 3OYEA 2EGCA 3M0QA 1S72T 1Q7YC 3QUIA 4EMKA 4QQ6A 1K9MR 3L2UA 2GGRA 2FVUA 1WNLA 4M7AF 4FSSA 2PQWA 1GFDA 2KNBB 5ECAA 4R55A 1M2VA 1R8OB 2KEAA 2L3PA 4XTXA 2E6ZA 3NGPA 3OMGA 4M7AA 4UC4A 2QXFA 3VS7A 2D9TA 2ENMA 3X26B 4HA8A 3CCVQ 5GAOq 4DOVA 2LCLA 2QEXA 1VQNA 2QQRA 2VV5A 2ZPFB 4ZTFA 4C0GA 4PJJA 5FROA 3JAME 3EGXA 1YIJQ 4JZ4A 4NL3A 3OYDA 3M54A 3JCMV 1PG5B 1KQSS 1S72A 1M90C 4LD6A 1UDLA 3G1JA 3U23A 1G83A 1VIEA 2RHIA 5LJ3f 2HBPA 2F1LA 2O4XA 1HXDA 3V8KA 3M53A 3UT1A 2OTJQ 2VYTA 3VKIA 3RR6A 2DAQA 2HDAA 2IG0A 5DY9A 2DD4A 3A8GB 5LJ3e 2KT1A 3M0PA 2CYZB 5GAMd 5I11A 1VQLT 1SRMA 1VQMA 5GANe 3TVTA 1MNDA 1BIBA 4RMOA 3BY7A 1FXXA 3M56A 3OYAA 2NUTA 4J7IA 5KH6A 2LQWA 1MMDA 4XU0A 4M77G 1W70A 4C92B 3CPWA 3CCLA 1K1ZA 7AT1B 1VQPT 2D1XA 2FG0A 4J6WA 4Q5WA 5GMKm 3ULRB 4F17A 4ZGEB 5GAMg 3OYCA 4CC7A 4QT7A 2Y4YA 3GBQA 1VQKQ 2X4WA 4N4HA 5CKFA 3CCMQ 4M78B 4QVZA 1VQLA 3JSCA 1FMWA 3HL8A 3QWYA 5KYYB 5D6YA 3LYIA 2P0KA 3PVLA 1YJ9A 5GAN7 3PT9A 1MV0B 2LMJA 4M7DA 4X9DA 1K73R 2RQWA 1RAFB 1QCOA 2P4RA 3CCEQ 1Y0MA 1ZUKA 2COZA 4ANJA 3CBPA 2K3BA 1IO6A 4M77D 3EG2A 2EYYA 2DBMA 3JCMh 5KYUB 3OYMA 3CCSQ 2ROLA 1YP5A 2CZ7B 2PVGB 2RH2A 4XAXB 2DL5A 4A4GA 1I5OB 2EW3A 2HCKA 3MEVA 5CKHA 1TH7A 3UF4A 3PFSA 1Q81R 4J6XA 2E70A 4LNPA 4HVVA 4B9XA 2XI9A 1U1SA 4GLMA 4KGVB 3HRSA 4RTXA 3NTHA 3REBB 2QA4T 3OYKA 3OYNA 5FWBA 3PIOA 4O5VA 3ZEHA 1VQ5Q 3OBYA 1VUBA 1VQ8Q 5GAN2 1V29B 5GMKi 1BI1A 3A98A 2O88A 1HJDA 4RKUE 3TU4K 2OI3A 4HCZA 2R5MA 5KYWB 2FEIA 2CZ6B 1QVGP 1WGSA 4ZNXA 2CH4A 3WVEB 2EJ9A 2MWPA 1VQ4Q 4RTVA 2DEQA 2K9GA 3HP9A 2LRQA 3EG3A 4OMLA 3MP6A 5HY6A 5LJ5e 2XKOC 3HPWA 4O6JA 2E3IA 3TSZA 1X6GA 4C8QG 2DVEA 1G3WA 1SPKA 1BKBA 2MPXC 2QA4A 1C0MA 2JXBA 1NJIC 3CCJA 2OTJT 4FW1A 2HL3A 2KRSA 4F7UG 1GCQA 4KGZB 1Q7YU 2K3XA 2JMCA 3CC2T 4XTVA 3JB9I 2X4XA 2C0IA 1M3BA 1ZX6A 2V26A 4OB0B 4B9WA 4NL2A 3TQ7P 1NM7A 1HK9A 3M55A 3TEEA 2XK0A 2JN0A 2OAWA 1V1CA 4C92C 1UHCA 3NTKA 1AD5A 3G4ST 1GCPA 2JTFA 1N8RU 2H3EB 2FZKB 1TUDA 3VS6A 4JS5A 1YI2T 3UPUA 1KFZA 4HT8A 2A0FB 3L2ZA 1V76A 1BYMA 1OPKA 2M1HA 1G3SA 4JUVA 2LQKA 1W2BS 2QQSA 1D0XA 4C8QD 3JB9G 3QSUA 1NZ9A 4M78C 2COYA 4NOYA 1M90U 3PMIA 2XDPA 2BE9B 2LQNA 1BIAA 2RD1A 2XDBA 3C0CA 1VA7A 1NLPC 3ME9A 2HL5C 4M75B 1TU0B 4QW2A 2QTVA 3EG1A 2P0QA 3HFNA 2F2XA 1M9SA 1QQJA 4M77B 5IAYA 1SEMA 3MP8A 3A8HB 2CP7A 2DBKA 2KT8A 1YI2A 3CCQT 5KE2A 4PJLA 1AWOA 2V8JA 1S1NA 2CSIA 1KQSA 3H0HA 5GAN3 3CCRT 4LD9K 2X3WD 2D6FA 1KG1A 1MGQA 3X20B 2EKHA 4IUVA 5CO7A 2KQWA 3JB9D 4A63B 2RO0A 3ZBDA 2JVVA 5DM7R 2M02A 2G6FX 1KC8U 2BUDA 2LJ3A 3M0TA 3M57A 4K11A 4OF1A 1M1KR 2LNHB 1VOMA 3RDVA 5A0DA 2VXEA 2DE0X 3SD4A 1KD1U 1PKTA 1Y96A 2LZ6B 2DKGA 2QEXQ 4M4ZA 4Y92A 1VQNQ 2X4YA 3CPWP 2LNVA 3GLXA 1Q82C 4LN2A 4KH0B 5IXBA 1T0HA 2WSEE 3L1AA 3G71T 1TG0A 4MMKA 1K4US 3A5ZB 3SHWA 4JS4A 3EGDA 2M0OA 1KK7A 3CCRA 1S72Q 4PNOA 2RPNA 4BY6C 2E65A 4DA4A 2RHXA 1TSFA 3CPFA 5L8RE 4B6MA 4PJOB 4JJNK 1KSWA 2VASA 2YLBA 4EMGA 2W0ZA 2YHTA 4M7DB 4ZGDB 2NWMA 4J8OA 1Y07A 1CKBA 1OPLA 3PMTA 4JRPA 3RMSA 2DX1A 1I5LA 1I81A 2CZ1B 1VQMQ 2RK1A 1Q86U 5GJWB 2MWOA 3CQTA 4N4GA 4E47A 3L2RA 1RACB 3G71A 1K8AU 5AYFA 2FPEA 2DXUA 2YUOA 3THKA 1UGSB 3OQ5A 1GBRA 5DLQE 1YHQT 1P92A 4XU2A 1JBMA 3PE0A 5L23A 1UJ0A 3CCLQ 2EQMA 2ED1A 1XTDA 5J39A 3CEYA 2HMAA 4A4HA 2EBPA 5KCHA 3A8LB 4C92G 4C8QE 2EJFA 2LP5A 4C5GA 2CT4A 1RAAB 2JOYA 4BI4A 1Y57A 1K76A 5A0GA 3CXCS 2OTLT 2RHZA 5HK3A 1Y7XA 2DNUA 4F7UE 2X51A 1BCOA 2EWNA 5GAN6 2SRCA 3T9NA 4LDWA 1VQLQ 1SKUB 1UJYA 2KAFA 4IIOA 4BI8B 2FO0A 1MMAA 1GXIE 3VRZA 4DOWA 2KGTA 2FZGB 3TREA 5IT9E 3CCUT 5CKEA 1NE8A 4M77C 1F1BB 1YHQA 4RTZA 2PU9B 5CAIA 2DTOA 2D0QB 2R5AA 1BBZA 1DJ7B 3QZ9B 3MKDA 2DLPA 1U8RA 1VQPQ 1TTHB 4ZN3A 2NUPB 4J83A 2RI2A 3H41A 3EH1A 3OYBA 2RJEA 2FPFA 1PD1A 2OX7A 3DLMA 3QXEB 4C0DC 2CP0A 2HSEB 3IQLA 3J7AF 4C92D 3MEAA 2PVDB 1CKAA 1WXUA 3S3NA 4DBHA 2L3RA 3D7SB 3DB4A 3M0RA 4LXCA 2PUOB 1OYXA 3JCMc 4BI3A 1JQQA 2L8DA 5LJ3d 3A1PA 1BK2A 3C95A 2EQJA 1JEGA 5EG2A 2SEMA 3RKYA 3UWNA 3E2UA 2D0NA 3JCMe 1KHCA 2L5QA 4LE9A 2GBQA 3CCUA 4LDVA 2EPDA 2GQIA 4J9GA 4C0FA 5KCOA 3NPFA 4CC3A 3PNWC 3RESA 2G3RA 3F70A 1IZ6A 5LJ3g 4RTYA 3OW2S 2IPOB 1NBEB 3QG1A 1W6XA 3VUBA 2C06A 3QKJA 1WQ7A 1X2KA 2RQRA 2DYIA 1WPYA 2GTJA 2EJGA 1WJSA 2EYWA 1OULA 3RERA 4BACA 2D8JA 4PL6A 1RI0A 4OB3B 2M16A 2YT6A 4PJOC 1SSFA 1YCSB 2PNIA 2VVKA 1YITA 4QVDA 4E7LA 1W2BA 2QYZA 3EG9A 6AT1B 2HZYA 4PJMA 2QA4Q 2DVJA 1Q95G 3JRZA 1AHJB 1EZZB 1QKWA 2YXYA 3LH0A 2L3QA 1WJRA 3CBMA 3JB9H 2KI7A 1PRMC 2X35A 5GAOm 2FRYA 1XJWB 1HSQA 2A08A 2LJ1A 4RTWA 3I56A 4E7JA 5J3BA 1VQ9A 1VQMT 1BI0A 5KE3A 1NG2A 1UGPB 4OMNA 3QJYA 4E7IA 1IRXA 1M8VA 4C8QC 4ORZA 3DB3A 4EDUA 3CCLT 2CP3A 3I5SA 5EC7A 1Q82U 1K73C 3JCMX 1X69A 1YNZA 3VJPA 3G6ET 2ZAEA 3HFOA 4M77F 1D1BA 1EFNA 4QKUA 1G3TA 2DPPB 5GANf 2JMAA 1D0ZA 1A0NB 1Y96B 3HTRA 4M7AG 1G5VA 3CC2Q 3C4SA 3MEUA 2KK4A 1IGUA 3L2VA 3PGGA 2YUNA 4VUBA 1VQ7T 3L42A 4Z8AA 4FYYB 3QDRB 2QTXA 1JU5C 5GAN8 1B07A 2MI6A 3RKXA 5CCAA 3EGDB 4M75G 4Z88A 2ATCB 1YJ9T 1GFCA 1Q81C 4BDZA 4JZ3A 2C0OA 1IXDA 5CVIA 3G4SQ 2V8IA 2YUQA 2WSCE 4XU1A 3VS4A 5KYNA 1YI2Q 1E6HA 1H3ZA 2RA2A 4C92E 5LJ5d 4Y91A 3SWNA 1ZA1B 3G6EA 4GY5A 1Q7YR 1M2OA 5FU6B 2YRDA 3M5AA 1VQOT 2YRVA 1KHIA 2E12A 1HYOA 1WHKA 1VQ6A 1KIKA 2COWA 5FU7B 1YFNA 2WACA 4M7AD 4XTZA 2VGMA 5GAMj 4ZTJA 1I8FA 1VQ7A 1PKSA 4M78E 4HCCA 1X75C 3NHNA 4KULA 1TWBA 5LJ5g 2HNIA 2VB6A 4X9CA 4E7KA 3ASKA 4Y28E 4A4KA 1N8RR 1OX9A 1CSKA 1RABB 2GTOA 1X2QA 4M75D 4MMLA 4J6YA 2DJZA 2O9SA 3CCQQ 3VU3C 1NPRA 3X24B 3VUZA 1ACMB 1WZOA 2D8HA 3O8VA 3VS3A 1QP3A 3CCRQ 1VQOA 1UG1A 1M90R 3GF5A 1UUEA 1M1GA 1WFWA 3PVQA 3V7RA 1Z9QA 1OZ3A 2AZVA 4BE0A 3QDFA 4DBRA 2KDSA 1QCFA 4WF2A 3CXCA 4PJOG 2FRWA 1NEBA 2QI2A 4YTLA 3UDCA 4IURA 2EAYA 2HBWA 1X01A 4C8QF 3UATA 1BU1A 1WXTA 3CCJT 4M7DG 4FW2A 2KY9A 2H8HA 3CMEA 4EPCA 1PC0A 2J06A 2ZPIB 1M3CA 1NPPA 2L3SA 3G71Q 4C8QA 2LDMA 4F7UF 1ZSZB 3UA6A 3MHXA 2YUPA 4OMQA 2DK3A 4LUEA 2A37A 3TSWA 5LJ5f 1U1TA 1UEBA 4F16A 2MF2A 1KC8R 4HVUA 3EH2A 4OB2B 2ZGWA 2JT4A 1QLYA 2DL7A 4CC4B 2QDYB 2XICA 1JB0E 5GAMe 4DQ2A 3I5RA 1VIFA 4BE1A 1ZA2B 1KD1R 3QWXX 5I2MA 5GMKl 2HQXA 2C0TA 4XQ3A 3META 5IHIA 2DD5A 4PJOD 1GBQA 4ATOA 2E1HA 4OVAA 1MHNA 2JTEA 2OJ2A 4LDUA 2CGHA 1OV3A 2W10A 4M7DD 2ZPGB 4XTYA 3JB9F 1ZBJA 2DTIA 2E41A 3CBOA 2Y4XA 3QYHB 3L2QA 2VWFA 1YHQQ 4BB7A 1OU9A 3AHUA 2F69A 3GOXA 3VYGA 2EVRA 2KE9A 1H3HA 4EMKB 1M1KC 2GFAA 3OW2A 4N0AC 1T3SA 2DETA 2RF0A 3CCVA 5FU6C 3OYLA 2DTHA 3TCJA 1W2BP 3BE3A 2M0YA 1LNXA 2OTLQ 2DRKA 1M2VB 1ZLMA 2KMTA 2EGEA 4M7AB 5FU7C 4LUDA 1Q86R 2NLUA 3EGUA 1E6GA 2KSSA 4QVCA 1B34A 1NLOC 1K8AR 3NTIA 3KXTA 1M5Q1 1R0CB 4N4IA 2DZCA 4PFPA 3CCUQ 5GAOp 3EGXB 1AEYA 1ARKA 2E5QA 3V7CA 4M75E 1JJ2S 1AT1B 2NUZA 1PHTA 2CSQA 5FW9A 2M9UA 4J9CA 1PSEA 2J6KA 1M1FA 1WHHA 4AMCA 1AOJA 2FL7A 3LWHA 4XU3A 4PJNA 4M77E 4GBQA 4GLKA 2JUFA 2AT1B 2O4XB 5DLOA 2O31A 4IUQA 2QK0A 3VV0A 1C1AA 1PSFA 1ZSGA 2K5LA 4AT1B 8ATCB 5A2QE 3INZA 2LX9A 1NYGA 5I22A 3OS1A 1MMGA 4Z02A 3M9QA 3OYJA 2J05A 1SG5A 3E9GA 2AIRB 2VC8A 1YWOA 1RAHB 2XDDA 1FYNA 3LGLA 1PM3A 2DL4A 1PRLC 1I0CA 1WI7A 5C0MA 1VYUA 4L5GA 2NUTB 3J80E 2LJ0A 2DXTA 2DILA 5I2SA 4D8KA 3LLRA 3VYHB 2DO3A 1ZSZC 5C6SA 1R0BG 5CIUA 3I56Q 4JRKA 2KXCA 5HK0A 2LVMA 5GMKh 2PZ1A 2K5IA 2J6OA 2BZ8A 4A53A 3CCMA 1X43A 1T0JA 1U06A 2K79A 3QYGB 2VKNA 4DEYA 2GFUA 3OYHA 2ECZA 1M4ZA 3QPHA 4ELYC 3HSBA 1SHFA 1W4SA 2J7IA 3OY9A 2RJFA 3SFMA 2ROTA 4J9EA 3CCEA 3A8OB 2QG9B 3I55T 2MCNA 1RLQC 2BE7D 4PJOE 2XHCA 1ZQ1A 3A8MB 5CQYA 2EQUA 1Z9ZA 4JLGA 2YRCA 2K4YA 4C92F 3RMQA 4M7DE 3CCSA 4FM4B 3SDZA 1PD0A 2I0NA 1LVKA 4J9DA 4J9HA 3HHTB 2QGFB 4C92A 3VS1A 2O01E 1YJWT 2R58A 2RM4A 1XQHA 4FIBA
chains in the Genus database with same CATH topology
2YT6A 1AWWA 1WDXA 2L2PA 1J3TA 1YCSB 3PVLA 2PNIA 2VVKA 1SHGA 1MV0B 2ESWA 1XOVA 4JPBW 2LMJA 4WCIA 4Z89A 2RQWA 5IHNA 2P4RA 2DVJA 1UFFA 1GL5A 1Y0MA 1QKWA 1ZUKA 2K3BA 1IO6A 2KROA 2YSQA 2L3QA 3EG2A 4JJCA 1PNJA 2AKKA 2EYYA 2DBMA 1PRMC 2AK5A 1T3LA 2FRYA 3O5ZA 2A08A 1HSQA 1W1FA 2LJ1A 2ROLA 1K0XA 4RTWA 1YP5A 2DL5A 2CUDA 4AFUC 1NG2A 2EW3A 2HCKA 3VRYA 4OMNA 5HCKA 2KXDA 3UF4A 2KR3A 2DL3A 2JM9A 4LNPA 4HVVA 4GLMA 4ORZA 4RTXA 3REBB 2EGAA 2K7AA 3I5SA 5EC7A 2DA9A 1N5ZA 2RNAA 5FWBA 1X69A 5IXFA 1YNZA 2AZSA 1PWTA 1EFNA 4HVWA 1MUZA 2JMAA 2EYZA 3A98A 1A0NB 2K6DA 2O88A 3I35A 1HJDA 3VS2A 1RUWA 2J6FA 3M0SA 2OI3A 1NEGA 2A36A 2YUNA 3M0UA 4Z8AA 2FEIA 2V1RA 1JU5C 1B07A 4ZNXA 2CH4A 1JXMA 4RTVA 2K9GA 4Z88A 2JS0A 3EG3A 4OMLA 2CH4W 2F2VA 1GFCA 2RMOA 4JZ3A 2C0OA 1I07A 2XMFA 2YUQA 3TSZA 2YDLA 1X6GA 2L0AA 2IIMA 4J9BA 1U5SA 3VS4A 1SPKA 1E6HA 1VYVA 2JXBA 3UA7A 2DL8A 3H0IA 2KRSA 4CC2A 2CREA 1GCQA 1LCKA 4R0KA 3REAB 4F14A 2BZYA 2JMCA 1K0SA 4AFZC 2X3XD 2ABLA 1UTIA 1NYFA 1UHFA 1WLPB 1ZUYA 2C0IA 4J9IA 1AVZC 1M3BA 2DMOA 1JXOA 4IIMA 1ZX6A 1KIKA 2CT3A 2A28A 2JW4A 1U3OA 1RI9A 1NM7A 1SSHA 1PKSA 2LCSA 2OAWA 1V1CA 3NHNA 1VYTA 2QDLA 1UHCA 1AD5A 4E6RA 2FPDA 1GCPA 1OOTA 2E5KA 1TUDA 3VS6A 1KFZA 1CSKA 3EG0A 1M30A 1X2QA 2GNCA 2GTOA 4OMMA 1OPKA 2CDTA 2O9SA 2EYXA 2JM8A 1YWPA 2D8HA 2MOXA 3VS3A 2AKLA 1UG1A 2RN8A 1UUEA 1AWXA 1WYXA 1WFWA 2LQNA 1WXBA 1YN8A 1H8KA 1GRIA 3PVQA 4D8DA 3C0CA 1VA7A 1Z9QA 2BZXA 1NLPC 2AZVA 3EG1A 2F2XA 1QCFA 4KRTA 1SEMA 1M3AA 2FRWA 1NEBA 3R6NA 1QWEA 4EIKA 2DBKA 5FWCA 2DYBA 2KT8A 2HBWA 2KRNA 3UATA 1BU1A 1KJWA 1SRLA 1WXTA 2DM1A 2F2WA 1AWOA 2O2OA 4AG1C 2H8HA 3EHQA 1S1NA 2CSIA 3H0HA 2J06A 1M3CA 2L3SA 2X3WD 3RNJA 1FMKA 3UA6A 5GJVB 1UE9A 2EKHA 2YUPA 4OMQA 4LUEA 2A37A 3TSWA 1B3QA 4A63B 1BB9A 1M8MA 3LH5A 1X27A 2G6FX 4F16A 3ZL7C 4HVUA 2LJ3A 3M0TA 2JT4A 1X6BA 1QLYA 2DL7A 4K11A 4CC4B 2LNHB 2DF6A 3SEMA 2DE0X 3VS0A 3I5RA 1PKTA 1WX6A 2LZ6B 3QWXX 2KYBA 3JV3A 4M4ZA 2C0TA 3I9QA 4Y92A 1OEBA 5IHIA 4LN2A 4AFSC 2CUBA 1GBQA 1H92A 5IH2A 4JJDA 5IXBA 2PTKA 1T0HA 4J9FA 4JJBA 1M27C 2JTEA 2OJ2A 1TG0A 1K4US 1OV3A 3SHWA 2W10A 4ESRA 1GCQC 2RPNA 1ZBJA 2RQUA 2HEQA 2EQIA 2VWFA 2RQVA 2KBTA 2O9VA 4RUGA 2HSPA 3NMZC 4X1VA 2EVRA 3VS5A 2KE9A 2B86A 1H3HA 1KSWA 2MIOA 1QWFA 2LX7A 1T3SA 2W0ZA 2RF0A 4AFQC 2K2MA 2NWMA 2KRMA 3H0FA 2DJQA 4HCKA 4RTUA 1CKBA 2M0YA 1OPLA 2DRKA 1ZLMA 1UECA 2DX1A 2EGEA 3FJ5A 4LUDA 3EGUA 5GJWB 1E6GA 3CQTA 2EGCA 3M0QA 3RBBB 1NLOC 2JS2A 2FPEA 2V1QA 2GGRA 2YUOA 3THKA 1GBRA 5IHKA 2DRMA 4FSSA 3PE0A 5L23A 1UJ0A 2ED1A 1GFDA 1AEYA 1ARKA 2KNBB 4RTTA 5ECAA 2NUZA 1PHTA 2KEAA 2L3PA 1JO8A 2CSQA 3NGPA 5FW9A 4J9CA 2EBPA 2J6KA 2LP5A 3VS7A 4HXJA 4OMOA 2ENMA 1AOJA 2CT4A 4GBQA 1Y57A 1K76A 2DNUA 1QKXA 2O31A 4OMPA 2SRCA 1ZSGA 4JZ4A 1UJYA 4IIOA 1WA7A 1NYGA 5I22A 2FO0A 3VRZA 2J05A 2KGTA 1UDLA 3U23A 1YWOA 1AWJA 4RTZA 1FYNA 1G83A 2DL4A 1PRLC 1BBZA 1AZEA 1I0CA 2DLPA 1TUCA 4AG2C 1WI7A 1VYUA 2ED0A 2HDAA 3H41A 2LJ0A 2FPFA 1UGVA 2DILA 1RLPC 4D8KA 1E7OA 1WIEA 3IQLA 1CKAA 1WXUA 2KT1A 3M0PA 1ZUUA 2KXCA 3M0RA 1HD3A 5I11A 2BTTA 2PZ1A 2J6OA 2BZ8A 1SRMA 1X43A 1JQQA 3TVTA 4DEXA 1T0JA 1BK2A 1G2BA 1U06A 2K79A 1ABQA 2KYMA 2SEMA 2VKNA 1JEGA 4DEYA 2D0NA 2RQTA 2ECZA 1I1JA 1SHFA 2LQWA 4LE9A 2GBQA 2J7IA 1W70A 1K1ZA 2ROTA 1ABOA 4J9EA 3EHRA 2EPDA 2GQIA 4J9GA 2MCNA 1RLQC 3NPFA 4CC3A 2M51A 2D1XA 2FG0A 3ULRB 4F17A 1Z9ZA 4CC7A 4QT7A 4RTYA 3GBQA 1W6XA 2I0NA 4J9DA 4J9HA 1X2KA 2RQRA 1K9AA 3KFVA 1AZGB 2GTJA 2EYWA 3VS1A 2D8JA 1MV3A 3QWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YT6 A;  1AWW A;  1WDX A;  2L2P A;  1J3T A;  1YCS B;  3PVL A;  2PNI A;  2VVK A;  1SHG A;  1MV0 B;  2ESW A;  1XOV A;  4JPB W;  2LMJ A;  4WCI A;  4Z89 A;  2RQW A;  5IHN A;  2P4R A;  2DVJ A;  1UFF A;  1GL5 A;  1Y0M A;  1QKW A;  1ZUK A;  2K3B A;  1IO6 A;  2KRO A;  2YSQ A;  2L3Q A;  3EG2 A;  4JJC A;  1PNJ A;  2AKK A;  2EYY A;  2DBM A;  1PRM C;  2AK5 A;  1T3L A;  2FRY A;  3O5Z A;  2A08 A;  1HSQ A;  1W1F A;  2LJ1 A;  2ROL A;  1K0X A;  4RTW A;  1YP5 A;  2DL5 A;  2CUD A;  4AFU C;  1NG2 A;  2EW3 A;  2HCK A;  3VRY A;  4OMN A;  5HCK A;  2KXD A;  3UF4 A;  2KR3 A;  2DL3 A;  2JM9 A;  4LNP A;  4HVV A;  4GLM A;  4ORZ A;  4RTX A;  3REB B;  2EGA A;  2K7A A;  3I5S A;  5EC7 A;  2DA9 A;  1N5Z A;  2RNA A;  5FWB A;  1X69 A;  5IXF A;  1YNZ A;  2AZS A;  1PWT A;  1EFN A;  4HVW A;  1MUZ A;  2JMA A;  2EYZ A;  3A98 A;  1A0N B;  2K6D A;  2O88 A;  3I35 A;  1HJD A;  3VS2 A;  1RUW A;  2J6F A;  3M0S A;  2OI3 A;  1NEG A;  2A36 A;  2YUN A;  3M0U A;  4Z8A A;  2FEI A;  2V1R A;  1JU5 C;  1B07 A;  4ZNX A;  2CH4 A;  1JXM A;  4RTV A;  2K9G A;  4Z88 A;  2JS0 A;  3EG3 A;  4OML A;  2CH4 W;  2F2V A;  1GFC A;  2RMO A;  4JZ3 A;  2C0O A;  1I07 A;  2XMF A;  2YUQ A;  3TSZ A;  2YDL A;  1X6G A;  2L0A A;  2IIM A;  4J9B A;  1U5S A;  3VS4 A;  1SPK A;  1E6H A;  1VYV A;  2JXB A;  3UA7 A;  2DL8 A;  3H0I A;  2KRS A;  4CC2 A;  2CRE A;  1GCQ A;  1LCK A;  4R0K A;  3REA B;  4F14 A;  2BZY A;  2JMC A;  1K0S A;  4AFZ C;  2X3X D;  2ABL A;  1UTI A;  1NYF A;  1UHF A;  1WLP B;  1ZUY A;  2C0I A;  4J9I A;  1AVZ C;  1M3B A;  2DMO A;  1JXO A;  4IIM A;  1ZX6 A;  1KIK A;  2CT3 A;  2A28 A;  2JW4 A;  1U3O A;  1RI9 A;  1NM7 A;  1SSH A;  1PKS A;  2LCS A;  2OAW A;  1V1C A;  3NHN A;  1VYT A;  2QDL A;  1UHC A;  1AD5 A;  4E6R A;  2FPD A;  1GCP A;  1OOT A;  2E5K A;  1TUD A;  3VS6 A;  1KFZ A;  1CSK A;  3EG0 A;  1M30 A;  1X2Q A;  2GNC A;  2GTO A;  4OMM A;  1OPK A;  2CDT A;  2O9S A;  2EYX A;  2JM8 A;  1YWP A;  2D8H A;  2MOX A;  3VS3 A;  2AKL A;  1UG1 A;  2RN8 A;  1UUE A;  1AWX A;  1WYX A;  1WFW A;  2LQN A;  1WXB A;  1YN8 A;  1H8K A;  1GRI A;  3PVQ A;  4D8D A;  3C0C A;  1VA7 A;  1Z9Q A;  2BZX A;  1NLP C;  2AZV A;  3EG1 A;  2F2X A;  1QCF A;  4KRT A;  1SEM A;  1M3A A;  2FRW A;  1NEB A;  3R6N A;  1QWE A;  4EIK A;  2DBK A;  5FWC A;  2DYB A;  2KT8 A;  2HBW A;  2KRN A;  3UAT A;  1BU1 A;  1KJW A;  1SRL A;  1WXT A;  2DM1 A;  2F2W A;  1AWO A;  2O2O A;  4AG1 C;  2H8H A;  3EHQ A;  1S1N A;  2CSI A;  3H0H A;  2J06 A;  1M3C A;  2L3S A;  2X3W D;  3RNJ A;  1FMK A;  3UA6 A;  5GJV B;  1UE9 A;  2EKH A;  2YUP A;  4OMQ A;  4LUE A;  2A37 A;  3TSW A;  1B3Q A;  4A63 B;  1BB9 A;  1M8M A;  3LH5 A;  1X27 A;  2G6F X;  4F16 A;  3ZL7 C;  4HVU A;  2LJ3 A;  3M0T A;  2JT4 A;  1X6B A;  1QLY A;  2DL7 A;  4K11 A;  4CC4 B;  2LNH B;  2DF6 A;  3SEM A;  2DE0 X;  3VS0 A;  3I5R A;  1PKT A;  1WX6 A;  2LZ6 B;  3QWX X;  2KYB A;  3JV3 A;  4M4Z A;  2C0T A;  3I9Q A;  4Y92 A;  1OEB A;  5IHI A;  4LN2 A;  4AFS C;  2CUB A;  1GBQ A;  1H92 A;  5IH2 A;  4JJD A;  5IXB A;  2PTK A;  1T0H A;  4J9F A;  4JJB A;  1M27 C;  2JTE A;  2OJ2 A;  1TG0 A;  1K4U S;  1OV3 A;  3SHW A;  2W10 A;  4ESR A;  1GCQ C;  2RPN A;  1ZBJ A;  2RQU A;  2HEQ A;  2EQI A;  2VWF A;  2RQV A;  2KBT A;  2O9V A;  4RUG A;  2HSP A;  3NMZ C;  4X1V A;  2EVR A;  3VS5 A;  2KE9 A;  2B86 A;  1H3H A;  1KSW A;  2MIO A;  1QWF A;  2LX7 A;  1T3S A;  2W0Z A;  2RF0 A;  4AFQ C;  2K2M A;  2NWM A;  2KRM A;  3H0F A;  2DJQ A;  4HCK A;  4RTU A;  1CKB A;  2M0Y A;  1OPL A;  2DRK A;  1ZLM A;  1UEC A;  2DX1 A;  2EGE A;  3FJ5 A;  4LUD A;  3EGU A;  5GJW B;  1E6G A;  3CQT A;  2EGC A;  3M0Q A;  3RBB B;  1NLO C;  2JS2 A;  2FPE A;  2V1Q A;  2GGR A;  2YUO A;  3THK A;  1GBR A;  5IHK A;  2DRM A;  4FSS A;  3PE0 A;  5L23 A;  1UJ0 A;  2ED1 A;  1GFD A;  1AEY A;  1ARK A;  2KNB B;  4RTT A;  5ECA A;  2NUZ A;  1PHT A;  2KEA A;  2L3P A;  1JO8 A;  2CSQ A;  3NGP A;  5FW9 A;  4J9C A;  2EBP A;  2J6K A;  2LP5 A;  3VS7 A;  4HXJ A;  4OMO A;  2ENM A;  1AOJ A;  2CT4 A;  4GBQ A;  1Y57 A;  1K76 A;  2DNU A;  1QKX A;  2O31 A;  4OMP A;  2SRC A;  1ZSG A;  4JZ4 A;  1UJY A;  4IIO A;  1WA7 A;  1NYG A;  5I22 A;  2FO0 A;  3VRZ A;  2J05 A;  2KGT A;  1UDL A;  3U23 A;  1YWO A;  1AWJ A;  4RTZ A;  1FYN A;  1G83 A;  2DL4 A;  1PRL C;  1BBZ A;  1AZE A;  1I0C A;  2DLP A;  1TUC A;  4AG2 C;  1WI7 A;  1VYU A;  2ED0 A;  2HDA A;  3H41 A;  2LJ0 A;  2FPF A;  1UGV A;  2DIL A;  1RLP C;  4D8K A;  1E7O A;  1WIE A;  3IQL A;  1CKA A;  1WXU A;  2KT1 A;  3M0P A;  1ZUU A;  2KXC A;  3M0R A;  1HD3 A;  5I11 A;  2BTT A;  2PZ1 A;  2J6O A;  2BZ8 A;  1SRM A;  1X43 A;  1JQQ A;  3TVT A;  4DEX A;  1T0J A;  1BK2 A;  1G2B A;  1U06 A;  2K79 A;  1ABQ A;  2KYM A;  2SEM A;  2VKN A;  1JEG A;  4DEY A;  2D0N A;  2RQT A;  2ECZ A;  1I1J A;  1SHF A;  2LQW A;  4LE9 A;  2GBQ A;  2J7I A;  1W70 A;  1K1Z A;  2ROT A;  1ABO A;  4J9E A;  3EHR A;  2EPD A;  2GQI A;  4J9G A;  2MCN A;  1RLQ C;  3NPF A;  4CC3 A;  2M51 A;  2D1X A;  2FG0 A;  3ULR B;  4F17 A;  1Z9Z A;  4CC7 A;  4QT7 A;  4RTY A;  3GBQ A;  1W6X A;  2I0N A;  4J9D A;  4J9H A;  1X2K A;  2RQR A;  1K9A A;  3KFV A;  1AZG B;  2GTJ A;  2EYW A;  3VS1 A;  2D8J A;  1MV3 A;  3QWY A; 
#chains in the Genus database with same CATH topology
 1AWW A;  1WDX A;  4BE2 A;  4FYV B;  5GAM h;  3M4G A;  4EMK C;  1SHG A;  1QP2 A;  4M78 F;  2EYQ A;  3CC7 T;  4HCB A;  5IHN A;  4FCY A;  3G6E Q;  4M78 A;  3I55 A;  2KRO A;  4M7A C;  1QW1 A;  5KYY A;  3CXC P;  4JJC A;  1LPL A;  2AKK A;  2AK5 A;  4PFZ A;  2LQ8 A;  2V8K A;  2QQA A;  1W1F A;  2HQH A;  1K0X A;  3E19 A;  2FB7 A;  4FYW B;  4BDY A;  2CUD A;  4AFU C;  1VQ7 Q;  4HKE A;  3VRY A;  3ZFJ A;  4M75 C;  1YJW A;  5HCK A;  4RCC A;  3J81 E;  4PKC C;  2KR3 A;  3RKW A;  2JM9 A;  4OB1 B;  2EFI A;  1YJ9 Q;  1K9M C;  1N9S A;  2EGA A;  2K7A A;  2EQK A;  5KYU A;  3FIF A;  1Q82 R;  2DA9 A;  1N5Z A;  3CC7 A;  4E2F B;  5IXF A;  5J26 A;  1NJI U;  3P8D A;  2BKD N;  3CC4 T;  3CD6 T;  1PWT A;  2RI5 A;  4KT0 E;  1MMN A;  2K57 A;  1MUZ A;  3OA6 A;  2EYZ A;  1VQO Q;  2XD0 A;  2K6D A;  3OS5 A;  2VUB A;  3I35 A;  2RB6 A;  2F5T X;  3MO8 A;  4ME7 A;  1RUW A;  2LT1 A;  3E9F A;  3JCM f;  3M0S A;  5CKD A;  2A36 A;  3M0U A;  2HAX A;  4PK4 A;  2V1R A;  1YJN T;  3BDL A;  5GAN 4;  2JS0 A;  1IRE B;  2CH4 W;  2JZ2 A;  1UB4 A;  1YIT T;  2P0P A;  5GAN d;  2YDL A;  4J9B A;  1U5S A;  2GF7 A;  1IGQ A;  3KBG A;  1D3B A;  3P8H A;  3UA7 A;  5M9O A;  4C5E A;  5HKC A;  1QVF S;  2FZC B;  3H0I A;  3CC4 A;  3CD6 A;  2A3L A;  3OW2 P;  4AFZ C;  2X3X D;  1NYF A;  1UHF A;  2CP2 A;  1ZUY A;  1AVZ C;  2DMO A;  1JXO A;  4IIM A;  3I56 T;  3QJ6 A;  1VQ9 T;  2JW4 A;  5GAN g;  5KYX A;  2E3H A;  1SSH A;  2CZ0 B;  2LCS A;  1B34 B;  2VXF A;  3RUX A;  2B8A A;  1VYT A;  2QDL A;  2RI3 A;  5LJ3 j;  1KQ2 A;  1B7T A;  3H8Z A;  1YJN A;  3R6O A;  4E6R A;  2FPD A;  4C5H A;  1O75 A;  1C6V X;  3EG0 A;  2GCX A;  4M7D C;  2CDT A;  2EYX A;  1D1A A;  1YWP A;  3CCJ Q;  2QQB A;  3C94 A;  4LDY A;  1ZBX A;  3FC3 A;  2X9H A;  4IUU A;  2AKL A;  2HD0 A;  2RN8 A;  1AWX A;  5LL6 S;  3Q1J A;  1WYX A;  1RAI B;  1RAD B;  1WXB A;  1YN8 A;  4E7H A;  1JJ2 A;  1TS9 A;  2BZX A;  2NYS A;  4RG8 A;  1BCM A;  5FRM A;  1KQS P;  1FWZ A;  4C0Z A;  1LJO A;  4KRT A;  2OAU A;  4M75 F;  2A7Y A;  1N8R C;  3R6N A;  4KGX B;  4EIK A;  3GNF B;  4E7S A;  2DYB A;  2HQE A;  2K3Y A;  2PVO B;  2O2O A;  4AG1 C;  4M75 A;  3LWI A;  1G3Y A;  2LC4 A;  2H3J A;  3RNJ A;  2DEU A;  5GMK j;  1FMK A;  5A0L A;  4M77 A;  1VQ6 T;  1M8M A;  3LH5 A;  4FT4 A;  3BW1 A;  3MPU B;  3RIR A;  3EAE A;  4JRQ A;  1X6B A;  2DF6 A;  1BI3 A;  3SEM A;  1ZHI A;  3VS0 A;  1WX6 A;  2KYB A;  3JV3 A;  2JJ9 A;  3I9Q A;  4X34 A;  3H9N A;  4ZGJ B;  4BD3 A;  3OYI A;  4AFS C;  4BUG A;  3GP8 A;  1H92 A;  5IH2 A;  4JJD A;  5FLX E;  4XK8 E;  4J9F A;  4WTO B;  5CQX A;  4KH1 B;  1GCQ C;  2X4J A;  3P8B B;  3PTA A;  1N6A A;  2RQU A;  2RHU A;  1RL2 A;  4PLI A;  1D0Y A;  4DBQ A;  4V2S A;  1KC8 C;  2HSP A;  3NMZ C;  4EMH A;  3VS5 A;  2DIQ A;  4L59 A;  5IN1 A;  2F5K A;  2MIO A;  1QWF A;  4P5N A;  2LX7 A;  2MMP A;  2ZPE B;  4C5I A;  4AFQ C;  2K2M A;  1KD1 C;  2KRM A;  2DJQ A;  4HCK A;  1BI2 A;  4PJO F;  2QAS A;  1UEC A;  8AT1 B;  3CME T;  5LJ5 j;  1FMV A;  3FJ5 A;  5GAO l;  4M7D F;  4IUP A;  3CMA T;  4PJO A;  3RBB B;  3OBW A;  2JS2 A;  1K9M U;  2V1Q A;  2DIG A;  3GNG A;  2JTM A;  3L2W A;  3EFO A;  5IHK A;  3E1S A;  2DRM A;  2RK2 A;  2EIF A;  5GMK e;  1SF9 A;  4RTT A;  4FSX A;  3M4Y A;  4MZM A;  1JO8 A;  3G7Z A;  1VQP A;  3QBY A;  4HXJ A;  4OMO A;  4KUI A;  1JRI A;  3KUF A;  1I4K 1;  4R56 A;  5D6X A;  1PCX A;  1QKX A;  3URG A;  4OMP A;  4E7Z A;  1O9S A;  1Q86 C;  3V8J A;  1WA7 A;  3OSS C;  3CMA A;  4KBM B;  1K8A C;  4CRI A;  4MDX A;  1WHJ A;  1MNE A;  3LGF A;  5GAM f;  3MJX A;  4KUD K;  5I21 A;  5AT1 B;  1AWJ A;  2QQ9 A;  3BFM A;  3EFR A;  4F7U A;  3MEW A;  3DLL A;  1AZE A;  1N9R A;  3I55 Q;  1TUC A;  4AG2 C;  2ED0 A;  2VGN A;  1IHV A;  3CCV T;  3QO3 A;  1EIF A;  1UGV A;  2LCC A;  1RLP C;  1E7O A;  1WIE A;  4A4F A;  3QHS A;  1QCN A;  1D3B B;  1ZUU A;  1HD3 A;  2XG8 D;  1YIJ T;  2BTT A;  2IVW A;  3OS0 A;  4DEX A;  1WHM A;  4BY6 B;  4PFO A;  4QQG A;  1G2B A;  1YJW Q;  1H64 1;  1QVG S;  3WVD B;  4JLI A;  1ABQ A;  2KYM A;  2NUP A;  2WSF E;  2LTO A;  2RQT A;  3H6Z A;  2E4H A;  1I1J A;  2CKK A;  3M58 A;  1WHL A;  1QVF A;  5KYX B;  3CC7 Q;  2ZCF B;  1ABO A;  3EHR A;  1IHW A;  4ELZ C;  2M51 A;  5GAO n;  4CI0 C;  1OI1 A;  1YBY A;  3ER0 A;  2DZ9 A;  3EG9 B;  3MP1 A;  1K9A A;  1OQK A;  3KFV A;  1AZG B;  2E6N A;  1YIJ A;  4M7A E;  3OSV A;  1MV3 A;  1YCY A;  3OB9 A;  2L2P A;  1Y71 A;  2RJC A;  1XNI A;  1J3T A;  3NFC A;  1D1C A;  2QGG A;  2ZPH B;  2ESW A;  1XOV A;  4JPB W;  4WCI A;  5LJ3 h;  1JJ2 P;  1K73 U;  4Z89 A;  1UFF A;  1GL5 A;  5GAN h;  3FLG A;  2OTJ A;  2XID A;  3CC4 Q;  2YSQ A;  3S6W A;  3CD6 Q;  4D6W A;  2HKQ B;  3V7S A;  3N5B B;  3X28 B;  1VQK T;  1PNJ A;  3CC2 A;  1T3L A;  3O5Z A;  2PUK B;  2E64 A;  4II1 A;  3OMC A;  3CCM T;  4RCB A;  1UGR B;  4IKF A;  1YJN Q;  2KXD A;  1TXQ A;  4J7F A;  2MYS A;  5D6W A;  1Q81 U;  2DL3 A;  3C12 A;  3JCM P;  1WJQ A;  3M59 A;  2AHJ B;  3G4S A;  1YIT Q;  1G8X A;  3BDU A;  4MDW A;  4ZN1 A;  3CCE T;  2RNA A;  1NJI R;  3JCM J;  2AZS A;  1RAG B;  4L6V 5;  4HVW A;  4C0D B;  3LW5 E;  4J5Y A;  3HRT A;  3MCA B;  5GAO r;  2FYK A;  3CCS T;  3PIP A;  1VQK A;  3VS2 A;  3QZ5 B;  4FT2 A;  3JCM W;  2J6F A;  2I2L A;  1NEG A;  3SWN B;  4MZT A;  1VQ9 Q;  3QII A;  4IUT A;  2CS7 A;  4NS5 A;  3FB9 A;  1D09 B;  5CR2 A;  1JXM A;  3GPL A;  3V8L A;  2RMO A;  2F2V A;  2L89 A;  1I07 A;  2XMF A;  1WQW A;  3HRU A;  2L0A A;  2IIM A;  4F04 B;  2RJD A;  1VQ5 T;  2ZZD A;  4OGE A;  4FL6 A;  1VYV A;  3CCQ A;  1VQ8 T;  3JCM d;  3CPW S;  2DL8 A;  2DXB A;  4CC2 A;  3S3O A;  2CRE A;  1LCK A;  4R0K A;  2FHD A;  5GAN 5;  3REA B;  4F14 A;  1LOJ A;  2BZY A;  1K0S A;  1KQ1 A;  3JCM Q;  2ABL A;  1UTI A;  1WLP B;  2MK5 A;  4TVR A;  4A4E A;  4J9I A;  2CT3 A;  2A28 A;  4RG2 A;  1U3O A;  1RI9 A;  2XU8 A;  1TOV A;  1OZ2 A;  1VQ4 T;  4DBF A;  4N0A A;  1R77 A;  5FRN A;  3JCM g;  3X25 B;  3GIB A;  1OOT A;  1IB8 A;  2Y90 A;  2E5K A;  3EFO B;  4LDX A;  4OMM A;  1M30 A;  2GNC A;  1RAE B;  3FEO A;  1VQ5 A;  2QAZ A;  2K2V A;  4PLL A;  3WXM B;  2JM8 A;  1VQ8 A;  1X6O A;  2MOX A;  2EKO A;  5CK9 A;  2JNG A;  3OYG A;  5LJ5 h;  1OU8 A;  1VQ6 Q;  1H8K A;  1GRI A;  4D8D A;  1OX8 A;  2ZPB B;  1QMC A;  1EX4 A;  3AT1 B;  2DFU A;  4C8Q B;  2E10 A;  1VQ4 A;  4FYX B;  1N27 A;  3EFS A;  2CP5 A;  1M3A A;  2GQV A;  1QWE A;  5FWC A;  4F7U B;  2R57 A;  2KRN A;  4OGC A;  4XTU A;  1KJW A;  1SRL A;  2DM1 A;  2F2W A;  3SB2 A;  1UGQ B;  3EHQ A;  2HKN A;  3HKS A;  3FDR A;  4M78 G;  4MZP A;  5GJV B;  1UE9 A;  4OMF B;  1B3Q A;  4QQD A;  1BB9 A;  4JDS A;  1X27 A;  3OS2 A;  1QVP A;  2K5F A;  4FU6 A;  3ZL7 C;  3OYY A;  4JRI A;  1M1K U;  2DXC A;  3FRN A;  3JCM b;  1ZSZ A;  2YLC A;  1WHG A;  5D7U A;  2P4T A;  5CKB A;  1OEB A;  2CP6 A;  2OTL A;  1QVF P;  2CUB A;  3DKM A;  2PTK A;  3CME Q;  1QVG A;  2RHY A;  5KYW A;  4OP0 A;  4JJB A;  1M27 C;  3SWN C;  3LX7 A;  4ESR A;  3CMA Q;  1FX7 A;  4HT9 A;  3JB9 J;  2HEQ A;  2EQI A;  2RQV A;  2BIV A;  2KBT A;  4M78 D;  2O9V A;  2DER A;  2KVQ G;  4RUG A;  4X1V A;  4A54 A;  9ATC B;  2B86 A;  2YWW A;  2MAM A;  3S3M A;  2QEX T;  5GAN j;  1VQN T;  3H0F A;  3OYF A;  2LT4 A;  3FJP A;  4RTU A;  4XTW A;  1TUG B;  2Z0W A;  2P84 A;  3OYE A;  2EGC A;  3M0Q A;  1S72 T;  1Q7Y C;  3QUI A;  4EMK A;  4QQ6 A;  1K9M R;  3L2U A;  2GGR A;  2FVU A;  1WNL A;  4M7A F;  4FSS A;  2PQW A;  1GFD A;  2KNB B;  5ECA A;  4R55 A;  1M2V A;  1R8O B;  2KEA A;  2L3P A;  4XTX A;  2E6Z A;  3NGP A;  3OMG A;  4M7A A;  4UC4 A;  2QXF A;  3VS7 A;  2D9T A;  2ENM A;  3X26 B;  4HA8 A;  3CCV Q;  5GAO q;  4DOV A;  2LCL A;  2QEX A;  1VQN A;  2QQR A;  2VV5 A;  2ZPF B;  4ZTF A;  4C0G A;  4PJJ A;  5FRO A;  3JAM E;  3EGX A;  1YIJ Q;  4JZ4 A;  4NL3 A;  3OYD A;  3M54 A;  3JCM V;  1PG5 B;  1KQS S;  1S72 A;  1M90 C;  4LD6 A;  1UDL A;  3G1J A;  3U23 A;  1G83 A;  1VIE A;  2RHI A;  5LJ3 f;  2HBP A;  2F1L A;  2O4X A;  1HXD A;  3V8K A;  3M53 A;  3UT1 A;  2OTJ Q;  2VYT A;  3VKI A;  3RR6 A;  2DAQ A;  2HDA A;  2IG0 A;  5DY9 A;  2DD4 A;  3A8G B;  5LJ3 e;  2KT1 A;  3M0P A;  2CYZ B;  5GAM d;  5I11 A;  1VQL T;  1SRM A;  1VQM A;  5GAN e;  3TVT A;  1MND A;  1BIB A;  4RMO A;  3BY7 A;  1FXX A;  3M56 A;  3OYA A;  2NUT A;  4J7I A;  5KH6 A;  2LQW A;  1MMD A;  4XU0 A;  4M77 G;  1W70 A;  4C92 B;  3CPW A;  3CCL A;  1K1Z A;  7AT1 B;  1VQP T;  2D1X A;  2FG0 A;  4J6W A;  4Q5W A;  5GMK m;  3ULR B;  4F17 A;  4ZGE B;  5GAM g;  3OYC A;  4CC7 A;  4QT7 A;  2Y4Y A;  3GBQ A;  1VQK Q;  2X4W A;  4N4H A;  5CKF A;  3CCM Q;  4M78 B;  4QVZ A;  1VQL A;  3JSC A;  1FMW A;  3HL8 A;  3QWY A;  5KYY B;  5D6Y A;  3LYI A;  2P0K A;  3PVL A;  1YJ9 A;  5GAN 7;  3PT9 A;  1MV0 B;  2LMJ A;  4M7D A;  4X9D A;  1K73 R;  2RQW A;  1RAF B;  1QCO A;  2P4R A;  3CCE Q;  1Y0M A;  1ZUK A;  2COZ A;  4ANJ A;  3CBP A;  2K3B A;  1IO6 A;  4M77 D;  3EG2 A;  2EYY A;  2DBM A;  3JCM h;  5KYU B;  3OYM A;  3CCS Q;  2ROL A;  1YP5 A;  2CZ7 B;  2PVG B;  2RH2 A;  4XAX B;  2DL5 A;  4A4G A;  1I5O B;  2EW3 A;  2HCK A;  3MEV A;  5CKH A;  1TH7 A;  3UF4 A;  3PFS A;  1Q81 R;  4J6X A;  2E70 A;  4LNP A;  4HVV A;  4B9X A;  2XI9 A;  1U1S A;  4GLM A;  4KGV B;  3HRS A;  4RTX A;  3NTH A;  3REB B;  2QA4 T;  3OYK A;  3OYN A;  5FWB A;  3PIO A;  4O5V A;  3ZEH A;  1VQ5 Q;  3OBY A;  1VUB A;  1VQ8 Q;  5GAN 2;  1V29 B;  5GMK i;  1BI1 A;  3A98 A;  2O88 A;  1HJD A;  4RKU E;  3TU4 K;  2OI3 A;  4HCZ A;  2R5M A;  5KYW B;  2FEI A;  2CZ6 B;  1QVG P;  1WGS A;  4ZNX A;  2CH4 A;  3WVE B;  2EJ9 A;  2MWP A;  1VQ4 Q;  4RTV A;  2DEQ A;  2K9G A;  3HP9 A;  2LRQ A;  3EG3 A;  4OML A;  3MP6 A;  5HY6 A;  5LJ5 e;  2XKO C;  3HPW A;  4O6J A;  2E3I A;  3TSZ A;  1X6G A;  4C8Q G;  2DVE A;  1G3W A;  1SPK A;  1BKB A;  2MPX C;  2QA4 A;  1C0M A;  2JXB A;  1NJI C;  3CCJ A;  2OTJ T;  4FW1 A;  2HL3 A;  2KRS A;  4F7U G;  1GCQ A;  4KGZ B;  1Q7Y U;  2K3X A;  2JMC A;  3CC2 T;  4XTV A;  3JB9 I;  2X4X A;  2C0I A;  1M3B A;  1ZX6 A;  2V26 A;  4OB0 B;  4B9W A;  4NL2 A;  3TQ7 P;  1NM7 A;  1HK9 A;  3M55 A;  3TEE A;  2XK0 A;  2JN0 A;  2OAW A;  1V1C A;  4C92 C;  1UHC A;  3NTK A;  1AD5 A;  3G4S T;  1GCP A;  2JTF A;  1N8R U;  2H3E B;  2FZK B;  1TUD A;  3VS6 A;  4JS5 A;  1YI2 T;  3UPU A;  1KFZ A;  4HT8 A;  2A0F B;  3L2Z A;  1V76 A;  1BYM A;  1OPK A;  2M1H A;  1G3S A;  4JUV A;  2LQK A;  1W2B S;  2QQS A;  1D0X A;  4C8Q D;  3JB9 G;  3QSU A;  1NZ9 A;  4M78 C;  2COY A;  4NOY A;  1M90 U;  3PMI A;  2XDP A;  2BE9 B;  2LQN A;  1BIA A;  2RD1 A;  2XDB A;  3C0C A;  1VA7 A;  1NLP C;  3ME9 A;  2HL5 C;  4M75 B;  1TU0 B;  4QW2 A;  2QTV A;  3EG1 A;  2P0Q A;  3HFN A;  2F2X A;  1M9S A;  1QQJ A;  4M77 B;  5IAY A;  1SEM A;  3MP8 A;  3A8H B;  2CP7 A;  2DBK A;  2KT8 A;  1YI2 A;  3CCQ T;  5KE2 A;  4PJL A;  1AWO A;  2V8J A;  1S1N A;  2CSI A;  1KQS A;  3H0H A;  5GAN 3;  3CCR T;  4LD9 K;  2X3W D;  2D6F A;  1KG1 A;  1MGQ A;  3X20 B;  2EKH A;  4IUV A;  5CO7 A;  2KQW A;  3JB9 D;  4A63 B;  2RO0 A;  3ZBD A;  2JVV A;  5DM7 R;  2M02 A;  2G6F X;  1KC8 U;  2BUD A;  2LJ3 A;  3M0T A;  3M57 A;  4K11 A;  4OF1 A;  1M1K R;  2LNH B;  1VOM A;  3RDV A;  5A0D A;  2VXE A;  2DE0 X;  3SD4 A;  1KD1 U;  1PKT A;  1Y96 A;  2LZ6 B;  2DKG A;  2QEX Q;  4M4Z A;  4Y92 A;  1VQN Q;  2X4Y A;  3CPW P;  2LNV A;  3GLX A;  1Q82 C;  4LN2 A;  4KH0 B;  5IXB A;  1T0H A;  2WSE E;  3L1A A;  3G71 T;  1TG0 A;  4MMK A;  1K4U S;  3A5Z B;  3SHW A;  4JS4 A;  3EGD A;  2M0O A;  1KK7 A;  3CCR A;  1S72 Q;  4PNO A;  2RPN A;  4BY6 C;  2E65 A;  4DA4 A;  2RHX A;  1TSF A;  3CPF A;  5L8R E;  4B6M A;  4PJO B;  4JJN K;  1KSW A;  2VAS A;  2YLB A;  4EMG A;  2W0Z A;  2YHT A;  4M7D B;  4ZGD B;  2NWM A;  4J8O A;  1Y07 A;  1CKB A;  1OPL A;  3PMT A;  4JRP A;  3RMS A;  2DX1 A;  1I5L A;  1I81 A;  2CZ1 B;  1VQM Q;  2RK1 A;  1Q86 U;  5GJW B;  2MWO A;  3CQT A;  4N4G A;  4E47 A;  3L2R A;  1RAC B;  3G71 A;  1K8A U;  5AYF A;  2FPE A;  2DXU A;  2YUO A;  3THK A;  1UGS B;  3OQ5 A;  1GBR A;  5DLQ E;  1YHQ T;  1P92 A;  4XU2 A;  1JBM A;  3PE0 A;  5L23 A;  1UJ0 A;  3CCL Q;  2EQM A;  2ED1 A;  1XTD A;  5J39 A;  3CEY A;  2HMA A;  4A4H A;  2EBP A;  5KCH A;  3A8L B;  4C92 G;  4C8Q E;  2EJF A;  2LP5 A;  4C5G A;  2CT4 A;  1RAA B;  2JOY A;  4BI4 A;  1Y57 A;  1K76 A;  5A0G A;  3CXC S;  2OTL T;  2RHZ A;  5HK3 A;  1Y7X A;  2DNU A;  4F7U E;  2X51 A;  1BCO A;  2EWN A;  5GAN 6;  2SRC A;  3T9N A;  4LDW A;  1VQL Q;  1SKU B;  1UJY A;  2KAF A;  4IIO A;  4BI8 B;  2FO0 A;  1MMA A;  1GXI E;  3VRZ A;  4DOW A;  2KGT A;  2FZG B;  3TRE A;  5IT9 E;  3CCU T;  5CKE A;  1NE8 A;  4M77 C;  1F1B B;  1YHQ A;  4RTZ A;  2PU9 B;  5CAI A;  2DTO A;  2D0Q B;  2R5A A;  1BBZ A;  1DJ7 B;  3QZ9 B;  3MKD A;  2DLP A;  1U8R A;  1VQP Q;  1TTH B;  4ZN3 A;  2NUP B;  4J83 A;  2RI2 A;  3H41 A;  3EH1 A;  3OYB A;  2RJE A;  2FPF A;  1PD1 A;  2OX7 A;  3DLM A;  3QXE B;  4C0D C;  2CP0 A;  2HSE B;  3IQL A;  3J7A F;  4C92 D;  3MEA A;  2PVD B;  1CKA A;  1WXU A;  3S3N A;  4DBH A;  2L3R A;  3D7S B;  3DB4 A;  3M0R A;  4LXC A;  2PUO B;  1OYX A;  3JCM c;  4BI3 A;  1JQQ A;  2L8D A;  5LJ3 d;  3A1P A;  1BK2 A;  3C95 A;  2EQJ A;  1JEG A;  5EG2 A;  2SEM A;  3RKY A;  3UWN A;  3E2U A;  2D0N A;  3JCM e;  1KHC A;  2L5Q A;  4LE9 A;  2GBQ A;  3CCU A;  4LDV A;  2EPD A;  2GQI A;  4J9G A;  4C0F A;  5KCO A;  3NPF A;  4CC3 A;  3PNW C;  3RES A;  2G3R A;  3F70 A;  1IZ6 A;  5LJ3 g;  4RTY A;  3OW2 S;  2IPO B;  1NBE B;  3QG1 A;  1W6X A;  3VUB A;  2C06 A;  3QKJ A;  1WQ7 A;  1X2K A;  2RQR A;  2DYI A;  1WPY A;  2GTJ A;  2EJG A;  1WJS A;  2EYW A;  1OUL A;  3RER A;  4BAC A;  2D8J A;  4PL6 A;  1RI0 A;  4OB3 B;  2M16 A;  2YT6 A;  4PJO C;  1SSF A;  1YCS B;  2PNI A;  2VVK A;  1YIT A;  4QVD A;  4E7L A;  1W2B A;  2QYZ A;  3EG9 A;  6AT1 B;  2HZY A;  4PJM A;  2QA4 Q;  2DVJ A;  1Q95 G;  3JRZ A;  1AHJ B;  1EZZ B;  1QKW A;  2YXY A;  3LH0 A;  2L3Q A;  1WJR A;  3CBM A;  3JB9 H;  2KI7 A;  1PRM C;  2X35 A;  5GAO m;  2FRY A;  1XJW B;  1HSQ A;  2A08 A;  2LJ1 A;  4RTW A;  3I56 A;  4E7J A;  5J3B A;  1VQ9 A;  1VQM T;  1BI0 A;  5KE3 A;  1NG2 A;  1UGP B;  4OMN A;  3QJY A;  4E7I A;  1IRX A;  1M8V A;  4C8Q C;  4ORZ A;  3DB3 A;  4EDU A;  3CCL T;  2CP3 A;  3I5S A;  5EC7 A;  1Q82 U;  1K73 C;  3JCM X;  1X69 A;  1YNZ A;  3VJP A;  3G6E T;  2ZAE A;  3HFO A;  4M77 F;  1D1B A;  1EFN A;  4QKU A;  1G3T A;  2DPP B;  5GAN f;  2JMA A;  1D0Z A;  1A0N B;  1Y96 B;  3HTR A;  4M7A G;  1G5V A;  3CC2 Q;  3C4S A;  3MEU A;  2KK4 A;  1IGU A;  3L2V A;  3PGG A;  2YUN A;  4VUB A;  1VQ7 T;  3L42 A;  4Z8A A;  4FYY B;  3QDR B;  2QTX A;  1JU5 C;  5GAN 8;  1B07 A;  2MI6 A;  3RKX A;  5CCA A;  3EGD B;  4M75 G;  4Z88 A;  2ATC B;  1YJ9 T;  1GFC A;  1Q81 C;  4BDZ A;  4JZ3 A;  2C0O A;  1IXD A;  5CVI A;  3G4S Q;  2V8I A;  2YUQ A;  2WSC E;  4XU1 A;  3VS4 A;  5KYN A;  1YI2 Q;  1E6H A;  1H3Z A;  2RA2 A;  4C92 E;  5LJ5 d;  4Y91 A;  3SWN A;  1ZA1 B;  3G6E A;  4GY5 A;  1Q7Y R;  1M2O A;  5FU6 B;  2YRD A;  3M5A A;  1VQO T;  2YRV A;  1KHI A;  2E12 A;  1HYO A;  1WHK A;  1VQ6 A;  1KIK A;  2COW A;  5FU7 B;  1YFN A;  2WAC A;  4M7A D;  4XTZ A;  2VGM A;  5GAM j;  4ZTJ A;  1I8F A;  1VQ7 A;  1PKS A;  4M78 E;  4HCC A;  1X75 C;  3NHN A;  4KUL A;  1TWB A;  5LJ5 g;  2HNI A;  2VB6 A;  4X9C A;  4E7K A;  3ASK A;  4Y28 E;  4A4K A;  1N8R R;  1OX9 A;  1CSK A;  1RAB B;  2GTO A;  1X2Q A;  4M75 D;  4MML A;  4J6Y A;  2DJZ A;  2O9S A;  3CCQ Q;  3VU3 C;  1NPR A;  3X24 B;  3VUZ A;  1ACM B;  1WZO A;  2D8H A;  3O8V A;  3VS3 A;  1QP3 A;  3CCR Q;  1VQO A;  1UG1 A;  1M90 R;  3GF5 A;  1UUE A;  1M1G A;  1WFW A;  3PVQ A;  3V7R A;  1Z9Q A;  1OZ3 A;  2AZV A;  4BE0 A;  3QDF A;  4DBR A;  2KDS A;  1QCF A;  4WF2 A;  3CXC A;  4PJO G;  2FRW A;  1NEB A;  2QI2 A;  4YTL A;  3UDC A;  4IUR A;  2EAY A;  2HBW A;  1X01 A;  4C8Q F;  3UAT A;  1BU1 A;  1WXT A;  3CCJ T;  4M7D G;  4FW2 A;  2KY9 A;  2H8H A;  3CME A;  4EPC A;  1PC0 A;  2J06 A;  2ZPI B;  1M3C A;  1NPP A;  2L3S A;  3G71 Q;  4C8Q A;  2LDM A;  4F7U F;  1ZSZ B;  3UA6 A;  3MHX A;  2YUP A;  4OMQ A;  2DK3 A;  4LUE A;  2A37 A;  3TSW A;  5LJ5 f;  1U1T A;  1UEB A;  4F16 A;  2MF2 A;  1KC8 R;  4HVU A;  3EH2 A;  4OB2 B;  2ZGW A;  2JT4 A;  1QLY A;  2DL7 A;  4CC4 B;  2QDY B;  2XIC A;  1JB0 E;  5GAM e;  4DQ2 A;  3I5R A;  1VIF A;  4BE1 A;  1ZA2 B;  1KD1 R;  3QWX X;  5I2M A;  5GMK l;  2HQX A;  2C0T A;  4XQ3 A;  3MET A;  5IHI A;  2DD5 A;  4PJO D;  1GBQ A;  4ATO A;  2E1H A;  4OVA A;  1MHN A;  2JTE A;  2OJ2 A;  4LDU A;  2CGH A;  1OV3 A;  2W10 A;  4M7D D;  2ZPG B;  4XTY A;  3JB9 F;  1ZBJ A;  2DTI A;  2E41 A;  3CBO A;  2Y4X A;  3QYH B;  3L2Q A;  2VWF A;  1YHQ Q;  4BB7 A;  1OU9 A;  3AHU A;  2F69 A;  3GOX A;  3VYG A;  2EVR A;  2KE9 A;  1H3H A;  4EMK B;  1M1K C;  2GFA A;  3OW2 A;  4N0A C;  1T3S A;  2DET A;  2RF0 A;  3CCV A;  5FU6 C;  3OYL A;  2DTH A;  3TCJ A;  1W2B P;  3BE3 A;  2M0Y A;  1LNX A;  2OTL Q;  2DRK A;  1M2V B;  1ZLM A;  2KMT A;  2EGE A;  4M7A B;  5FU7 C;  4LUD A;  1Q86 R;  2NLU A;  3EGU A;  1E6G A;  2KSS A;  4QVC A;  1B34 A;  1NLO C;  1K8A R;  3NTI A;  3KXT A;  1M5Q 1;  1R0C B;  4N4I A;  2DZC A;  4PFP A;  3CCU Q;  5GAO p;  3EGX B;  1AEY A;  1ARK A;  2E5Q A;  3V7C A;  4M75 E;  1JJ2 S;  1AT1 B;  2NUZ A;  1PHT A;  2CSQ A;  5FW9 A;  2M9U A;  4J9C A;  1PSE A;  2J6K A;  1M1F A;  1WHH A;  4AMC A;  1AOJ A;  2FL7 A;  3LWH A;  4XU3 A;  4PJN A;  4M77 E;  4GBQ A;  4GLK A;  2JUF A;  2AT1 B;  2O4X B;  5DLO A;  2O31 A;  4IUQ A;  2QK0 A;  3VV0 A;  1C1A A;  1PSF A;  1ZSG A;  2K5L A;  4AT1 B;  8ATC B;  5A2Q E;  3INZ A;  2LX9 A;  1NYG A;  5I22 A;  3OS1 A;  1MMG A;  4Z02 A;  3M9Q A;  3OYJ A;  2J05 A;  1SG5 A;  3E9G A;  2AIR B;  2VC8 A;  1YWO A;  1RAH B;  2XDD A;  1FYN A;  3LGL A;  1PM3 A;  2DL4 A;  1PRL C;  1I0C A;  1WI7 A;  5C0M A;  1VYU A;  4L5G A;  2NUT B;  3J80 E;  2LJ0 A;  2DXT A;  2DIL A;  5I2S A;  4D8K A;  3LLR A;  3VYH B;  2DO3 A;  1ZSZ C;  5C6S A;  1R0B G;  5CIU A;  3I56 Q;  4JRK A;  2KXC A;  5HK0 A;  2LVM A;  5GMK h;  2PZ1 A;  2K5I A;  2J6O A;  2BZ8 A;  4A53 A;  3CCM A;  1X43 A;  1T0J A;  1U06 A;  2K79 A;  3QYG B;  2VKN A;  4DEY A;  2GFU A;  3OYH A;  2ECZ A;  1M4Z A;  3QPH A;  4ELY C;  3HSB A;  1SHF A;  1W4S A;  2J7I A;  3OY9 A;  2RJF A;  3SFM A;  2ROT A;  4J9E A;  3CCE A;  3A8O B;  2QG9 B;  3I55 T;  2MCN A;  1RLQ C;  2BE7 D;  4PJO E;  2XHC A;  1ZQ1 A;  3A8M B;  5CQY A;  2EQU A;  1Z9Z A;  4JLG A;  2YRC A;  2K4Y A;  4C92 F;  3RMQ A;  4M7D E;  3CCS A;  4FM4 B;  3SDZ A;  1PD0 A;  2I0N A;  1LVK A;  4J9D A;  4J9H A;  3HHT B;  2QGF B;  4C92 A;  3VS1 A;  2O01 E;  1YJW T;  2R58 A;  2RM4 A;  1XQH A;  4FIB A; 
#chains in the Genus database with same CATH homology
 2YT6 A;  1AWW A;  1WDX A;  2L2P A;  1J3T A;  1YCS B;  3PVL A;  2PNI A;  2VVK A;  1SHG A;  1MV0 B;  2ESW A;  1XOV A;  4JPB W;  2LMJ A;  4WCI A;  4Z89 A;  2RQW A;  5IHN A;  2P4R A;  2DVJ A;  1UFF A;  1GL5 A;  1Y0M A;  1QKW A;  1ZUK A;  2K3B A;  1IO6 A;  2KRO A;  2YSQ A;  2L3Q A;  3EG2 A;  4JJC A;  1PNJ A;  2AKK A;  2EYY A;  2DBM A;  1PRM C;  2AK5 A;  1T3L A;  2FRY A;  3O5Z A;  2A08 A;  1HSQ A;  1W1F A;  2LJ1 A;  2ROL A;  1K0X A;  4RTW A;  1YP5 A;  2DL5 A;  2CUD A;  4AFU C;  1NG2 A;  2EW3 A;  2HCK A;  3VRY A;  4OMN A;  5HCK A;  2KXD A;  3UF4 A;  2KR3 A;  2DL3 A;  2JM9 A;  4LNP A;  4HVV A;  4GLM A;  4ORZ A;  4RTX A;  3REB B;  2EGA A;  2K7A A;  3I5S A;  5EC7 A;  2DA9 A;  1N5Z A;  2RNA A;  5FWB A;  1X69 A;  5IXF A;  1YNZ A;  2AZS A;  1PWT A;  1EFN A;  4HVW A;  1MUZ A;  2JMA A;  2EYZ A;  3A98 A;  1A0N B;  2K6D A;  2O88 A;  3I35 A;  1HJD A;  3VS2 A;  1RUW A;  2J6F A;  3M0S A;  2OI3 A;  1NEG A;  2A36 A;  2YUN A;  3M0U A;  4Z8A A;  2FEI A;  2V1R A;  1JU5 C;  1B07 A;  4ZNX A;  2CH4 A;  1JXM A;  4RTV A;  2K9G A;  4Z88 A;  2JS0 A;  3EG3 A;  4OML A;  2CH4 W;  2F2V A;  1GFC A;  2RMO A;  4JZ3 A;  2C0O A;  1I07 A;  2XMF A;  2YUQ A;  3TSZ A;  2YDL A;  1X6G A;  2L0A A;  2IIM A;  4J9B A;  1U5S A;  3VS4 A;  1SPK A;  1E6H A;  1VYV A;  2JXB A;  3UA7 A;  2DL8 A;  3H0I A;  2KRS A;  4CC2 A;  2CRE A;  1GCQ A;  1LCK A;  4R0K A;  3REA B;  4F14 A;  2BZY A;  2JMC A;  1K0S A;  4AFZ C;  2X3X D;  2ABL A;  1UTI A;  1NYF A;  1UHF A;  1WLP B;  1ZUY A;  2C0I A;  4J9I A;  1AVZ C;  1M3B A;  2DMO A;  1JXO A;  4IIM A;  1ZX6 A;  1KIK A;  2CT3 A;  2A28 A;  2JW4 A;  1U3O A;  1RI9 A;  1NM7 A;  1SSH A;  1PKS A;  2LCS A;  2OAW A;  1V1C A;  3NHN A;  1VYT A;  2QDL A;  1UHC A;  1AD5 A;  4E6R A;  2FPD A;  1GCP A;  1OOT A;  2E5K A;  1TUD A;  3VS6 A;  1KFZ A;  1CSK A;  3EG0 A;  1M30 A;  1X2Q A;  2GNC A;  2GTO A;  4OMM A;  1OPK A;  2CDT A;  2O9S A;  2EYX A;  2JM8 A;  1YWP A;  2D8H A;  2MOX A;  3VS3 A;  2AKL A;  1UG1 A;  2RN8 A;  1UUE A;  1AWX A;  1WYX A;  1WFW A;  2LQN A;  1WXB A;  1YN8 A;  1H8K A;  1GRI A;  3PVQ A;  4D8D A;  3C0C A;  1VA7 A;  1Z9Q A;  2BZX A;  1NLP C;  2AZV A;  3EG1 A;  2F2X A;  1QCF A;  4KRT A;  1SEM A;  1M3A A;  2FRW A;  1NEB A;  3R6N A;  1QWE A;  4EIK A;  2DBK A;  5FWC A;  2DYB A;  2KT8 A;  2HBW A;  2KRN A;  3UAT A;  1BU1 A;  1KJW A;  1SRL A;  1WXT A;  2DM1 A;  2F2W A;  1AWO A;  2O2O A;  4AG1 C;  2H8H A;  3EHQ A;  1S1N A;  2CSI A;  3H0H A;  2J06 A;  1M3C A;  2L3S A;  2X3W D;  3RNJ A;  1FMK A;  3UA6 A;  5GJV B;  1UE9 A;  2EKH A;  2YUP A;  4OMQ A;  4LUE A;  2A37 A;  3TSW A;  1B3Q A;  4A63 B;  1BB9 A;  1M8M A;  3LH5 A;  1X27 A;  2G6F X;  4F16 A;  3ZL7 C;  4HVU A;  2LJ3 A;  3M0T A;  2JT4 A;  1X6B A;  1QLY A;  2DL7 A;  4K11 A;  4CC4 B;  2LNH B;  2DF6 A;  3SEM A;  2DE0 X;  3VS0 A;  3I5R A;  1PKT A;  1WX6 A;  2LZ6 B;  3QWX X;  2KYB A;  3JV3 A;  4M4Z A;  2C0T A;  3I9Q A;  4Y92 A;  1OEB A;  5IHI A;  4LN2 A;  4AFS C;  2CUB A;  1GBQ A;  1H92 A;  5IH2 A;  4JJD A;  5IXB A;  2PTK A;  1T0H A;  4J9F A;  4JJB A;  1M27 C;  2JTE A;  2OJ2 A;  1TG0 A;  1K4U S;  1OV3 A;  3SHW A;  2W10 A;  4ESR A;  1GCQ C;  2RPN A;  1ZBJ A;  2RQU A;  2HEQ A;  2EQI A;  2VWF A;  2RQV A;  2KBT A;  2O9V A;  4RUG A;  2HSP A;  3NMZ C;  4X1V A;  2EVR A;  3VS5 A;  2KE9 A;  2B86 A;  1H3H A;  1KSW A;  2MIO A;  1QWF A;  2LX7 A;  1T3S A;  2W0Z A;  2RF0 A;  4AFQ C;  2K2M A;  2NWM A;  2KRM A;  3H0F A;  2DJQ A;  4HCK A;  4RTU A;  1CKB A;  2M0Y A;  1OPL A;  2DRK A;  1ZLM A;  1UEC A;  2DX1 A;  2EGE A;  3FJ5 A;  4LUD A;  3EGU A;  5GJW B;  1E6G A;  3CQT A;  2EGC A;  3M0Q A;  3RBB B;  1NLO C;  2JS2 A;  2FPE A;  2V1Q A;  2GGR A;  2YUO A;  3THK A;  1GBR A;  5IHK A;  2DRM A;  4FSS A;  3PE0 A;  5L23 A;  1UJ0 A;  2ED1 A;  1GFD A;  1AEY A;  1ARK A;  2KNB B;  4RTT A;  5ECA A;  2NUZ A;  1PHT A;  2KEA A;  2L3P A;  1JO8 A;  2CSQ A;  3NGP A;  5FW9 A;  4J9C A;  2EBP A;  2J6K A;  2LP5 A;  3VS7 A;  4HXJ A;  4OMO A;  2ENM A;  1AOJ A;  2CT4 A;  4GBQ A;  1Y57 A;  1K76 A;  2DNU A;  1QKX A;  2O31 A;  4OMP A;  2SRC A;  1ZSG A;  4JZ4 A;  1UJY A;  4IIO A;  1WA7 A;  1NYG A;  5I22 A;  2FO0 A;  3VRZ A;  2J05 A;  2KGT A;  1UDL A;  3U23 A;  1YWO A;  1AWJ A;  4RTZ A;  1FYN A;  1G83 A;  2DL4 A;  1PRL C;  1BBZ A;  1AZE A;  1I0C A;  2DLP A;  1TUC A;  4AG2 C;  1WI7 A;  1VYU A;  2ED0 A;  2HDA A;  3H41 A;  2LJ0 A;  2FPF A;  1UGV A;  2DIL A;  1RLP C;  4D8K A;  1E7O A;  1WIE A;  3IQL A;  1CKA A;  1WXU A;  2KT1 A;  3M0P A;  1ZUU A;  2KXC A;  3M0R A;  1HD3 A;  5I11 A;  2BTT A;  2PZ1 A;  2J6O A;  2BZ8 A;  1SRM A;  1X43 A;  1JQQ A;  3TVT A;  4DEX A;  1T0J A;  1BK2 A;  1G2B A;  1U06 A;  2K79 A;  1ABQ A;  2KYM A;  2SEM A;  2VKN A;  1JEG A;  4DEY A;  2D0N A;  2RQT A;  2ECZ A;  1I1J A;  1SHF A;  2LQW A;  4LE9 A;  2GBQ A;  2J7I A;  1W70 A;  1K1Z A;  2ROT A;  1ABO A;  4J9E A;  3EHR A;  2EPD A;  2GQI A;  4J9G A;  2MCN A;  1RLQ C;  3NPF A;  4CC3 A;  2M51 A;  2D1X A;  2FG0 A;  3ULR B;  4F17 A;  1Z9Z A;  4CC7 A;  4QT7 A;  4RTY A;  3GBQ A;  1W6X A;  2I0N A;  4J9D A;  4J9H A;  1X2K A;  2RQR A;  1K9A A;  3KFV A;  1AZG B;  2GTJ A;  2EYW A;  3VS1 A;  2D8J A;  1MV3 A;  3QWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...