2DILA

Solution structure of the sh3 domain of the human proline-serine-threonine phosphatase-interacting protein 1
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
69
structure length
69
Chain Sequence
GSSGSSGAQEYRALYDYTAQNPDELDLSAGDILEVILEGEDGWWTVERNGQRGFVPGSYLEKLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SH3 domain of the human Proline-serine-threonine phosphatase-interacting protein 1
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Proline-serine-threonine phosphatase-interacting protein 1
total genus 5
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dilA00
1X6BA 2PNIA 4Z88A 1W70A 1WX6A 3REAB 3EG3A 2LZ6B 3UA6A 1X6GA 2RPNA 1H3HA 2DL4A 4GBQA 2MOXA 3TSZA 4D8DA 2DBMA 2EVRA 2K6DA 2VKNA 2JM8A 1JO8A 5FWBA 3UF4A 2A28A 4IIOA 2D8HA 2CSQA 1ABOA 4OMQA 1GFDA 2YT6A 4HVVA 2EYZA 2LQNA 2KBTA 3GBQA 4A63B 4AFUC 2IIMA 4QT7A 2PTKA 2EYYA 2O9SA 2DL3A 1JXMA 1E7OA 1YNZA 3EG1A 2GTOA 4LNPA 4KRTA 4HVUA 1ZSGA 1PRLC 1VYUA 2X3WD 4CC7A 1T3SA 2YDLA 3M0PA 2HDAA 2GTJA 3VS1A 3VS7A 4J9IA 4LN2A 1I0CA 1AWWA 2KT1A 1KFZA 2OI3A 1WDXA 1B3QA 1E6HA 1YCSB 4LE9A 3VRYA 3TSWA 1AEYA 2K9GA 1UFFA 1JU5C 2VVKA 5IXBA 2DL7A 1QLYA 2EW3A 2J6FA 1B07A 2XMFA 5EC7A 4LUEA 1ZUUA 4AFQC 2JT4A 3EHRA 1M3CA 1GL5A 2KGTA 2DBKA 1M30A 2OAWA 2DL5A 2FRYA 4AG2C 1K4US 3UA7A 3TVTA 3NGPA 4OMLA 1JXOA 4ESRA 2E5KA 1UE9A 2M0YA 2DM1A 1HJDA 1MV0B 1UG1A 3O5ZA 1ZLMA 1E6GA 3VS0A 2O9VA 1W6XA 1SHFA 2K7AA 3I5SA 3EG2A 3FJ5A 2DL8A 1GCQC 3U23A 2L2PA 2JXBA 3NPFA 4OMNA 1X27A 1ZUYA 2EGEA 2KRMA 2F2WA 2JW4A 4FSSA 2BZYA 1NYFA 2MIOA 2KXCA 4F14A 2LJ1A 2O2OA 1WXUA 1T3LA 1I1JA 3EG0A 2EYXA 1MV3A 2HSPA 4Y92A 1NM7A 5ECAA 2L3SA 1ZBJA 4JZ3A 3M0RA 3PE0A 2EKHA 1JQQA 1K76A 3M0QA 1AOJA 2K3BA 2ECZA 1X2QA 2JTEA 4JJBA 1PHTA 4J9CA 1OPKA 2EGCA 1RLQC 1V1CA 2EBPA 2RNAA 1UTIA 2KT8A 1Y57A 2YUQA 1TUDA 3NHNA 3A98A 2C0OA 2CSIA 1JEGA 5FWCA 1YP5A 2ED0A 2LP5A 3VS3A 2KRNA 2X3XD 2DRMA 3H0IA 5IHKA 1WFWA 2DVJA 2YUOA 1K0SA 1BB9A 2HBWA 2C0TA 1M27C 4LUDA 1ZUKA 1Y0MA 2DILA 2HCKA 3M0TA 1I07A 1RI9A 2SRCA 4F16A 3VS4A 1YWPA 1MUZA 2DYBA 3SHWA 2FPDA 2CT4A 3ZL7C 1KJWA 3VS2A 3VS5A 1H8KA 2CDTA 1PNJA 2ENMA 2CREA 2CH4A 1RUWA 1YN8A 2YUPA 1BBZA 3H0FA 2EYWA 1VYTA 1AZEA 2GBQA 2CT3A 4HVWA 3VS6A 4EIKA 4J9GA 2AZVA 1G83A 2ROLA 1QCFA 4OMMA 2W0ZA 1SRMA 3M0UA 2JS2A 1UGVA 4RTZA 3IQLA 2OJ2A 4J9BA 4CC3A 2BTTA 4AFZC 1GBQA 1UHCA 4HCKA 1CKAA 1NEGA 1T0HA 3SEMA 4JJDA 1KSWA 2DA9A 2I0NA 1AWJA 5GJWB 2DLPA 1NLOC 4Z8AA 1BU1A 2YSQA 2GGRA 1M8MA 2LCSA 2FEIA 1U06A 5IXFA 1GCQA 3KFVA 1HSQA 1UECA 1K1ZA 3RBBB 1SRLA 2JMCA 2B86A 3LH5A 1WXBA 2VWFA 5GJVB 1K9AA 3THKA 1WLPB 1WIEA 2FRWA 2YUNA 2LJ3A 3QWXX 1AZGB 2A37A 3PVLA 3I5RA 2SEMA 1VA7A 2EGAA 1HD3A 2EPDA 1WXTA 1Z9QA 3JV3A 1PWTA 3H41A 2DNUA 2MCNA 1EFNA 4RTTA 2L0AA 1QKXA 2L3PA 5HCKA 2J06A 1X2KA 1SEMA 3M0SA 1S1NA 2FG0A 2G6FX 2BZ8A 2JS0A 2J6KA 4DEYA 1OEBA 1U5SA 2FPEA 3C0CA 1UHFA 2CH4W 2FPFA 2NWMA 2CUBA 2K2MA 4F17A 1NLPC 1CKBA 5L23A 2QDLA 4D8KA 1G2BA 2RQUA 4RTWA 2RN8A 2M51A 4RTYA 2D0NA 1XOVA 2H8HA 5IHIA 1GRIA 3RNJA 2HEQA 2W10A 1WA7A 4OMOA 2KROA 1ARKA 1TG0A 1AVZC 2K79A 1SHGA 1UDLA 4HXJA 4RTVA 1M3AA 4J9HA 3CQTA 2A36A 1W1FA 4RUGA 2F2XA 2FO0A 3I35A 4CC4B 1SSHA 1UJ0A 1IO6A 3I9QA 1J3TA 1GFCA 4E6RA 2LMJA 1X43A 4ORZA 1H92A 4JPBW 2A08A 2RF0A 2KRSA 2GNCA 1X69A 4DEXA 4Z89A 1AD5A 1CSKA 2J05A 2RQTA 1QWFA 3H0HA 4JJCA 1GBRA 4AFSC 5FW9A 2LJ0A 4GLMA 1RLPC 4ZNXA 1QKWA 2KEAA 2KXDA 2AKKA 5IHNA 4K11A 4AG1C 2J7IA 1K0XA 1BK2A 1UUEA 2L3QA 3EGUA 2DJQA 2DRKA 1KIKA 2RMOA 1OPLA 1TUCA 2GQIA 4JZ4A 2KYMA 4R0KA 1OOTA 1NEBA 1PKSA 3EHQA 2F2VA 2V1QA 3NMZC 1NYGA 4M4ZA 1AWOA 3REBB 2C0IA 4WCIA 1LCKA 1M3BA 2DF6A 2DMOA 1WI7A 1WYXA 5I11A 3PVQA 1GCPA 3ULRB 2PZ1A 2DX1A 1ABQA 2V1RA 2KNBB 2O88A 1PKTA 1UJYA 1ZX6A 1T0JA 1VYVA 2RQVA 1NG2A 2LQWA 2P4RA 2ABLA 4J9DA 2D8JA 2EQIA 2KYBA 3VRZA 2J6OA 4J9FA 4OMPA 1Z9ZA 3QWYA 2AZSA 2NUZA 3R6NA 4IIMA 4RTXA 2DE0X 2RQRA 2LNHB 1QWEA 4X1VA 2D1XA 4J9EA 4CC2A 2KE9A 1AWXA 2KR3A 5IH2A 2AKLA 2O31A 3UATA 2JM9A 1U3OA 2ED1A 2JMAA 5I22A 1SPKA 2RQWA 1N5ZA 4RTUA 1A0NB 2BZXA 2LX7A 1OV3A 1PRMC 2ESWA 1FMKA 2ROTA 1FYNA 2CUDA 2AK5A 1YWOA
chains in the Genus database with same CATH superfamily
5GAOr 2RK1A 3FIFA 2CP3A 2MYSA 3EG3A 1BI3A 2RHYA 3V7RA 2CP0A 3TSZA 3C4SA 5KYXA 1WPYA 2EVRA 2EQJA 2K6DA 5LJ3h 5FWBA 4M7DC 2DZ9A 3CCQA 1I8FA 2A28A 3HRUA 3JB9I 4M75D 2MI6A 1KQSS 4C92D 2D8HA 3S6WA 2CSQA 1YHQT 1GFDA 2LQNA 3EG9B 4AFUC 4A54A 2DKGA 3LWIA 1M1GA 3CXCP 2VXFA 1M1KC 3CCMT 1VIFA 5L8RE 4LNPA 3GF5A 3Q1JA 1T3SA 2YDLA 2OAUA 2GTJA 4O6JA 4Y91A 3AT1B 4J9IA 1F1BB 1I0CA 4LN2A 3JCMf 2XKOC 3OYJA 1G8XA 5GANd 4M77D 3LLRA 2M0OA 3VRYA 1B3QA 4LE9A 4X9DA 1MMDA 3EG9A 2P0PA 1QLYA 1N6AA 4DBRA 1K9MC 1VOMA 4LUEA 1ZUUA 4AFQC 1KHIA 1VQ8A 3BDLA 4M75B 2E41A 4C8QG 4C92B 3MKDA 3OQ5A 2M02A 4AG2C 1EIFA 4IUPA 1YJWT 3QG1A 1QVFA 3DB3A 3QBYA 3CCVT 3JCMW 3RR6A 1U1TA 5J26A 3GLXA 1IRXA 3EAEA 2M0YA 2VGMA 3JCMh 4C0GA 1UG1A 1ZLMA 4RG2A 2NLUA 2PVOB 1ZBXA 3CCJQ 1TH7A 2O9VA 3CD6A 1W6XA 3S3MA 3I5SA 3EG2A 3FJ5A 3SWNB 2DL8A 4BE0A 2K2VA 2L2PA 2GFUA 3NPFA 4OMNA 2EGEA 3CCSQ 2F2WA 4FSSA 1NYFA 3OYLA 4OMFB 4JRIA 4QVZA 4F14A 5J39A 4XTZA 1T3LA 4FSXA 4MZMA 1M1FA 4FT2A 1MV3A 1LNXA 2L3SA 3OMGA 3X28B 8AT1B 4JZ3A 5FROA 3PFSA 4KT0E 3KXTA 1K76A 2JTMA 3M0QA 1LOJA 1VQ7A 3RESA 1X2QA 4JJBA 1PHTA 1YITT 4XU0A 1VQ5Q 4XTWA 1XJWB 5GAN7 4BE1A 3G4SA 3A98A 2LT1A 3NFCA 2HKQB 3CCJA 1K8AC 3VS3A 3H0IA 2C0TA 1B7TA 4M7AA 4LUDA 3A5ZB 4JJNK 1Y0MA 2DILA 2PQWA 3NTHA 3TCJA 1KQ1A 4C0ZA 1I07A 2SRCA 1YJ9Q 1YWPA 1G3SA 2E12A 2EAYA 3CMAA 2E5QA 1WHGA 5KCHA 1MGQA 1BIBA 4JLIA 1YJNT 4JRQA 4J6WA 2CH4A 1VQOA 1NPRA 2YXYA 2P4TA 1Q81U 1N9RA 4M78G 1K9MR 1DJ7B 3F70A 2VV5A 3G71T 1G83A 1WZOA 2K5IA 3CBOA 3JAME 4OMMA 1RACB 1O9SA 2W0ZA 1SRMA 4ATOA 1OULA 2JS2A 2V8KA 2XDPA 4RTZA 3IQLA 2OJ2A 2FZKB 2DD4A 4FL6A 1ZA1B 3MJXA 2BTTA 4AFZC 3LH0A 4HCKA 1CKAA 4A4FA 1IGUA 4C8QE 1VQPQ 4J7FA 1T0HA 3SEMA 1K73U 1YITA 1NLOC 1OZ2A 2GGRA 3OSVA 4PL6A 1U06A 3HL8A 2MF2A 1HSQA 2QEXT 2NYSA 2LVMA 3E19A 1K1ZA 1OI1A 1W2BA 3RBBB 1SRLA 4PLLA 2B86A 1TXQA 3S3OA 3UDCA 1M1KU 5GJVB 3L2WA 1K9AA 4FYVB 1WIEA 1D3BB 3ZEHA 3NTKA 2LNVA 1B34A 4PK4A 3KUFA 4X9CA 2DD5A 2RJCA 3PVLA 4BY6B 1HD3A 2KDSA 1Z9QA 2LQ8A 2MCNA 4RTTA 3CMAT 1QKXA 2L3PA 5GMKm 1S1NA 2FG0A 2DJZA 4E7IA 1VQ8T 2JJ9A 1U5SA 3RUXA 1Q95G 1ZA2B 3V8JA 4F17A 2DEQA 4DBFA 2QDLA 2RJDA 3QDFA 2XDDA 2RN8A 2M51A 3CCJT 1VQLQ 2ZPIB 2D0NA 5GMKl 2H8HA 3SWNA 3RNJA 3MEUA 5FLXE 1G3WA 4KGXB 1ARKA 4EPCA 4HXJA 2HBPA 1QP3A 2FO0A 2CZ1B 2I2LA 1UJ0A 1J3TA 2VGNA 1GFCA 1S72T 3M53A 4ORZA 3OS1A 3JB9F 1VQ9A 5FU7B 3I56A 2CP7A 3CMET 2KRSA 1G3YA 4IUQA 4DEXA 4Z89A 1UB4A 2A7YA 2L8DA 1AD5A 5GAOn 5HK0A 2RQTA 1LVKA 3H0HA 4JJCA 4A4KA 2RHIA 5FW9A 2E1HA 1KQSA 1BI2A 2KEAA 4C5EA 4FT4A 4XAXB 4AG1C 4RCBA 1K0XA 1P92A 3JB9D 2CGHA 2RMOA 2VYTA 1OPLA 4KUIA 2CYZB 2JVVA 2E4HA 3C95A 4LD6A 1QVFP 2HZYA 4KGZB 1AWOA 3REBB 2DAQA 3MCAB 5I11A 3PVQA 1GCPA 1VQNQ 4XU1A 3JCMe 2OX7A 1T0JA 3A1PA 3CCSA 4J9DA 2XHCA 1NJIR 5LJ5g 2J6OA 1Z9ZA 1IHVA 2NUPA 1KC8U 1KC8R 1VQMT 3V8KA 4WTOB 3NTIA 2E70A 3JCMb 3MEVA 4X1VA 2D1XA 4WF2A 3GIBA 4Q5WA 3CC4A 3WXMB 1U3OA 2KVQG 1HK9A 1VQ6A 1ZSZB 1N5ZA 3JRZA 3MEWA 4E47A 5GAN6 2PVDB 4OB3B 1S72Q 1TSFA 2BE9B 2ATCB 3J81E 2ROTA 1FYNA 2AK5A 4DBQA 3OB9A 1VQOT 3QO3A 1X6BA 2F5KA 5KYYB 1OQKA 1RADB 3ER0A 5EG2A 1V29B 1WX6A 1D0XA 4BI8B 3UA6A 2RO0A 4QQ6A 2ZPBB 1MHNA 2A3LA 1VQ7T 2PU9B 4A4HA 2QQSA 1YI2A 3I55Q 1FMVA 1YI2T 4ZGDB 2O4XA 1ABOA 4OMQA 4A4EA 3CCRQ 2WSFE 2QGGA 2KBTA 5M9OA 4OB2B 4LDUA 4A63B 2PTKA 2EYYA 1UGQB 4EMKC 4MDXA 2DL3A 1JXMA 2X35A 2JOYA 5GAN3 4CRIA 4QVDA 4KRTA 4HVUA 1WHKA 1PRLC 1Y7XA 3L2VA 3CCRA 1XQHA 2QXFA 4DOWA 4E7JA 3VS1A 4L5GA 1AWWA 4M78B 2KT1A 4N4IA 1KFZA 1I5LA 1JRIA 2OI3A 3QSUA 4M75G 2QQBA 1VQ4A 4KH0B 2VVKA 4DBHA 5IXBA 4PFOA 2DETA 1VUBA 2VC8A 1YJNQ 1R0CB 2JT4A 4AMCA 2MPXC 4E7HA 1M3CA 2D0QB 4NS5A 4V2SA 1HXDA 5A0DA 2DBKA 1M30A 3HRSA 4PJOB 3DLMA 1YJ9T 3VUBA 3CCEQ 2XU8A 4O5VA 2RHXA 1UE9A 3WVDB 1Q7YR 5DLOA 1TU0B 3SD4A 1M90U 5CVIA 1B34B 3S3NA 1MV0B 2QA4Q 3VS0A 2DXCA 1PC0A 1PCXA 2RI5A 4J5YA 1YCYA 1SHFA 2K7AA 4M7AD 3HSBA 3OBWA 3TQ7P 2QQAA 4M77E 3QHSA 3HRTA 2C06A 1ZUYA 4FW2A 5FU7C 2KRMA 3OW2A 1PD1A 1H641 2XICA 5KYWB 1BKBA 3H8ZA 1YHQA 1VQKA 2DTIA 2EYXA 2LTOA 1K8AR 4Y92A 3CPWA 3A8LB 3HTRA 4JRPA 4M78F 1VQPA 3PE0A 4X34A 3I56Q 2EKHA 3CC4T 4JUVA 2K3BA 2ECZA 3MPUB 2JTEA 4JLGA 1RLQC 1V1CA 2EYQA 1W2BP 1UTIA 2KT8A 2YUQA 3NHNA 2RD1A 1VQKQ 2M9UA 4EMGA 2CSIA 3CPFA 1WQWA 4ZN1A 2ED0A 3RKYA 2QQ9A 5I21A 3EH1A 2CP2A 2YUOA 1VQ6Q 4N0AC 1K0SA 3G4SQ 1BB9A 3KBGA 4L6V5 4MZPA 3P8HA 1Q7YC 2L89A 5D6XA 1VQOQ 5CKHA 1ZUKA 5HK3A 2YHTA 2DXBA 1C0MA 2RI3A 3OYNA 3ME9A 3CXCS 4CI0C 1I81A 2DYBA 3SHWA 4HT9A 3ZL7C 2LDMA 3FJPA 3PIOA 2KK4A 5GANh 2YUPA 4F7UB 3H0FA 2EYWA 3JCMc 1PG5B 1YJWA 4M75E 3CC7T 2GBQA 3OYIA 8ATCB 5DM7R 4J9GA 4RCCA 3EH2A 4HA8A 3HFOA 3TEEA 4EMHA 3CD6T 3TU4K 3M0UA 4M7DB 2F5TX 1ZSZC 3VUZA 2QG9B 4J9BA 2QK0A 2HQHA 4HKEA 3LW5E 1OX9A 1QCOA 1GBQA 1Y71A 3H9NA 2FYKA 5AYFA 1NEGA 4IKFA 2V26A 2I0NA 1WHHA 1G5VA 4C8QD 3EGXA 1Y96A 2WSCE 1M8MA 3C12A 4QW2A 3CBMA 2L5QA 4OB0B 5IXFA 1GCQA 3KFVA 3L2ZA 3QYGB 2NUPB 3LX7A 3JB9G 4FU6A 2AT1B 2VWFA 1WLPB 4VUBA 1V76A 1WNLA 2Y4YA 2YUNA 1D0YA 3I56T 2MWOA 2MK5A 3EFRA 3CMEA 3QWXX 1AZGB 2A37A 4IUVA 2FHDA 3I5RA 2DYIA 4PFZA 5DLQE 3P8DA 2CZ0B 4PJOG 5GAMh 3H41A 3CBPA 1EFNA 1RL2A 2L0AA 3CCRT 3M5AA 1X2KA 3PT9A 1SEMA 3OW2S 3PMTA 1YHQQ 2FPEA 1AHJB 2CH4W 1K73R 3CMEQ 4P5NA 5L23A 4F7UG 4HT8A 1QVPA 2YLBA 5GAMe 2DZCA 2CZ6B 1GRIA 3FB9A 1NPPA 2W10A 2WSEE 1WA7A 1VQ9T 1FXXA 1D1BA 3QUIA 4ZTFA 1IHWA 3CCMA 4C0FA 3CCUT 5DY9A 3JCMg 3H6ZA 3E9FA 3I35A 2KI7A 3FDRA 3PGGA 1N27A 3I9QA 5CK9A 3N5BB 1KD1C 1H92A 1X43A 4JPBW 2A08A 2RF0A 1M90C 5C6SA 1X69A 1VQNT 1CSKA 1D09B 4C8QC 2J05A 1QWFA 2E3IA 2QASA 1U1SA 3G6ET 5CKEA 1QKWA 3CCLQ 2KXDA 4M75A 2AKKA 5IHNA 2VXEA 1GXIE 2J7IA 3RMQA 1VQ4T 1BK2A 5GANj 1UUEA 3E1SA 4PKCC 3OYAA 3EGUA 2COYA 2DJQA 2EJGA 2DRKA 2LQKA 1KIKA 2GCXA 1K8AU 1VQ4Q 3CC2Q 2DVEA 2KYMA 5IT9E 1OOTA 4MMKA 1PKSA 2X51A 2R58A 1WHMA 4M75C 4E7SA 2F2VA 1NYGA 4E7ZA 1JJ2P 2C0IA 4WCIA 1M3BA 5GANf 5GAMf 4BDZA 3ULRB 2DX1A 1ABQA 2KNBB 1PKTA 2E3HA 1VYVA 2P4RA 2D8JA 2EQIA 1U8RA 2F1LA 3VRZA 2O01E 4J9FA 4OMPA 7AT1B 2JN0A 1K9MU 1TTHB 3QWYA 4M7AF 2XK0A 4C92G 2K3XA 4TVRA 1FX7A 2QQRA 5LJ3g 5CQYA 4M77C 4B6MA 5GANg 1VQ9Q 1QWEA 1N8RU 2KR3A 1MMGA 2XI9A 1HYOA 2ED1A 3X26B 5I22A 4M7DF 4RTUA 4HCCA 1BIAA 5GAMd 2AIRB 4R56A 2IPOB 2LX7A 2L3RA 3TREA 1OV3A 4N4GA 2E64A 3T9NA 1EX4A 2CUDA 1QP2A 3RDVA 3CMAQ 3RERA 1VQ5A 2DEUA 3PTAA 2EQMA 2PNIA 1W70A 1ZSZA 4FW1A 3DB4A 4M77F 1KG1A 4GBQA 3DLLA 2MOXA 4D8DA 2XIDA 2DBMA 1KD1U 1Q82C 1MNEA 2RB6A 4PJNA 1JO8A 4XQ3A 3A8HB 3QYHB 3UF4A 2HL3A 2GQVA 3CC4Q 4IIOA 4II1A 4BY6C 3QKJA 4KGVB 2YT6A 4HVVA 1XTDA 2EYZA 1OU9A 2DK3A 3GBQA 2IIMA 2P0KA 3JCMP 4QT7A 3JCMV 1QVGS 2O9SA 2X4XA 2HQXA 1BYMA 1YNZA 4M75F 1RAIB 3MEAA 4ZGEB 2DFUA 1VYUA 2QTXA 2X3WD 2RJFA 4CC7A 3M0PA 3QXEB 2HDAA 3J80E 4KULA 1UGPB 2EJ9A 3RKWA 2DTHA 3VS7A 3UWNA 1M8VA 3SB2A 2D6FA 2HMAA 4AT1B 2MMPA 1YCSB 2FVUA 2K9GA 1UFFA 2XDBA 1JU5C 3CCUA 2DL7A 2EW3A 3CCVQ 2J6FA 1B07A 2R5AA 5EC7A 1ZHIA 4MMLA 1G3TA 4J7IA 3D7SB 2IG0A 4D6WA 4F7UE 1GL5A 2KGTA 4XU2A 2OAWA 2DL5A 2RK2A 4M77A 1K4US 5CCAA 3UA7A 2YRDA 4OMLA 1IGQA 2OTJT 4HCZA 5LJ5e 3V8LA 1YJNA 2X9HA 2X4WA 3BDUA 2DM1A 1HJDA 4DA4A 3O5ZA 1NZ9A 2QI2A 1VQLT 5KCOA 4PJOA 3JCMJ 4M7AG 3CCEA 1VQKT 3U23A 1GCQC 4ZN3A 4JS5A 1X27A 4R55A 5GANe 4PJOE 3CCMQ 3GOXA 3OS2A 2JW4A 2ZGWA 3O8VA 3JCMQ 5GMKe 2MIOA 2JTFA 2LJ1A 2O2OA 1WXUA 4C8QB 1VQ6T 3ASKA 1I1JA 4M7DG 4IUTA 4E7LA 2HSPA 1NM7A 3ZBDA 1ZBJA 2YWWA 5CQXA 3OYMA 5GAOl 2BIVA 3VV0A 3GPLA 1JQQA 1AOJA 1TWBA 4DOVA 4J9CA 1OPKA 3SDZA 3JCMd 2EGCA 2CZ7B 4BDYA 3L1AA 1YIJA 3OYDA 1JEGA 3INZA 1LJOA 5FWCA 1YP5A 1LPLA 3BFMA 2LP5A 3SFMA 1PD0A 4Z02A 2K5LA 1D3BA 5D7UA 1QW1A 1WJQA 3V7SA 2KRNA 1WHJA 2DVJA 3L42A 4BE2A 4LDXA 4EDUA 1M27C 1Y07A 2HCKA 3M0TA 3A8OB 4PJMA 2RH2A 5CKBA 3VS4A 1MUZA 1M2VB 1TUGB 3E2UA 2JUFA 2CT4A 3JSCA 1EZZB 3OS5A 1OZ3A 1PM3A 3VS2A 3VS5A 1H8KA 4KUDK 1PNJA 2ENMA 3BY7A 1RUWA 1YN8A 3MHXA 5HKCA 3FRNA 4C92E 3G71Q 1NJIU 4C5GA 2ZZDA 1VYTA 1YIJT 1M5Q1 4MZTA 4ZGJB 3G71A 2GF7A 2VASA 4HVWA 2E6NA 3WVEB 2MWPA 3ZFJA 2X4JA 2ROLA 1Q86R 1X01A 2QDYB 4PLIA 5GAOq 3CPWP 2X4YA 1BI1A 1UGVA 3OW2P 1UGRB 2NUTB 1AT1B 4UC4A 4JJDA 2K5FA 2DA9A 3M57A 1AWJA 5GJWB 2DLPA 2EQUA 4ANJA 1BU1A 2YSQA 2LCSA 2FEIA 2H3EB 4C92A 2DTOA 4NOYA 4B9XA 2HL5C 1X6OA 3OYFA 1IB8A 2JMCA 3LH5A 3FLGA 1RABB 4JS4A 5FU6B 4FIBA 1K73C 2FRWA 3OA6A 2F69A 3MP1A 4F7UF 2FZCB 1VA7A 2EPDA 1XNIA 3JV3A 1C6VX 1PWTA 1QCNA 3SWNC 4XK8E 2RA2A 2J06A 4RMOA 3M0SA 3OBYA 3M56A 2J6KA 4DEYA 1N8RR 1OEBA 3C0CA 4LDWA 2KMTA 5KYUA 1UHFA 3M58A 3OMCA 2FPFA 2NWMA 4ELYC 1BCMA 2K2MA 5LJ5f 1CKBA 5LJ3j 1IREB 4D8KA 1G2BA 2JZ2A 1VQ7Q 5LJ5d 5I2SA 4B9WA 2XG8D 3HFNA 3LGLA 1XOVA 2DXUA 2Y90A 3M54A 3UT1A 1AVZC 2RJEA 5LJ5j 5CKFA 1UDLA 1ZQ1A 4RTVA 1M3AA 1YJWQ 4MDWA 4CC4B 1KQ2A 1IO6A 4E6RA 3VJPA 1WHLA 4FYWB 1SSFA 2GNCA 4C5HA 1WGSA 3HKSA 2CS7A 1GBRA 2KAFA 3L2UA 1M1KR 6AT1B 2FB7A 4AFSC 3JB9H 2WACA 5GMKj 5A0GA 4GLMA 2M1HA 3A8MB 3M9QA 1Q86U 3GP8A 2PUKB 1VQLA 2HAXA 4OGEA 4FCYA 4N0AA 3CC7A 3BW1A 1H3ZA 1I4K1 4XTUA 4R0KA 3GNFB 4XTXA 3EHQA 4M77G 3NMZC 2COZA 4PJLA 4M4ZA 1LCKA 4OVAA 2DF6A 2DMOA 1WI7A 1N8RC 1SKUB 2HQEA 2K57A 2V1RA 4LDVA 2O88A 1UJYA 2COWA 2RQVA 2LQWA 5KE2A 2ABLA 2H3JA 2HSEB 3RKXA 1SF9A 3OYEA 2AZSA 1TS9A 2LCLA 3CCLA 3QDRB 1M4ZA 2DPPB 2DXTA 3R6NA 3CCLT 4IIMA 4RTXA 3UPUA 2QA4A 2DE0X 2FZGB 2RQRA 1RAFB 2LNHB 1WJRA 2OTLT 4QQDA 5KH6A 4YTLA 2NUTA 2ZAEA 4J9EA 3E9GA 4J6YA 3OS0A 1AWXA 3CC7Q 4M7AB 4NL2A 5IH2A 2O31A 3UATA 1D0ZA 4OP0A 4M7DA 1SPKA 2RQWA 1MMAA 1A0NB 3MO8A 2BZXA 2DIGA 2LC4A 2ESWA 1PSEA 1FMKA 4J6XA 4GLKA 3VU3C 2Z0WA 3OSSC 4XU3A 2KY9A 4Z88A 2IVWA 3G4ST 5GAMj 1YJ9A 1UGSB 3REAB 1VQMQ 1I5OB 2QEXA 2LZ6B 1X6GA 2M16A 2RPNA 1H3HA 1Q81C 2DL4A 4OF1A 4BB7A 1Q82R 4IUUA 1JB0E 1OYXA 3MP8A 1MNDA 1R77A 2VKNA 2VUBA 2JM8A 1RI0A 4PFPA 3VYGA 1RAEB 3OYCA 1M2VA 1BI0A 5LJ5h 2RHZA 3CCQQ 4C5IA 1Q82U 3OYBA 1E7OA 1M9SA 4A53A 2DIQA 3EG1A 2EJFA 2GTOA 3CC2T 1ZSGA 2YRCA 1FWZA 3QPHA 4BD3A 5FU6C 4BACA 3JCMX 2MAMA 1QVGP 3G6EQ 4M7DE 4JDSA 3V7CA 1WDXA 1E6HA 3TSWA 1AEYA 2E65A 1FMWA 3PIPA 1KD1R 1NJIC 2XMFA 5IAYA 4QKUA 1M90R 3HPWA 3EHRA 3OY9A 4JRKA 4LXCA 2HNIA 5CO7A 2FRYA 4PJJA 5KYUB 3TVTA 3CCUQ 3NGPA 1JXOA 3M55A 4ESRA 2E5KA 5D6WA 5GAN5 3VKIA 4BI4A 1YIJQ 1E6GA 4C8QF 1JJ2S 5GMKi 1QVFS 1NE8A 1RAAB 3G6EA 2OTJA 2JXBA 4KH1B 3LWHA 1YITQ 2LT4A 1KK7A 1R0BG 2BZYA 1VQNA 5GMKh 2KXCA 1QVGA 1BCOA 3PMIA 4LD9K 2YLCA 3EG0A 5ECAA 2EWNA 4RKUE 3M0RA 2RHUA 3CCST 2D9TA 3HHTB 2RNAA 2EBPA 1MMNA 1Y57A 1TUDA 1VQ5T 3P8BB 3OYGA 1X75C 2LX9A 2VB6A 5GAN4 1OU8A 2C0OA 5A2QE 3M4GA 2QEXQ 4M77B 5GAN8 4OGCA 4HCBA 3QZ9B 4XTVA 2X3XD 5IHKA 4L59A 2DRMA 1JBMA 1WFWA 4PNOA 4ELZC 2HBWA 1KC8C 3VYHB 1C1AA 5CAIA 4NL3A 2R57A 3BE3A 2AHJB 3CCET 1RI9A 4F16A 5A0LA 3LGFA 3AHUA 3OYYA 2BUDA 5HY6A 2FPDA 2DERA 1KJWA 2CDTA 3M59A 2QYZA 2CREA 2LCCA 2OTLA 1BBZA 4FYXB 4RG8A 2XD0A 1AZEA 5GAOm 4M78D 4Y28E 2OTLQ 4OB1B 2ZPHB 2CT3A 1S72A 3VS6A 4EIKA 1Q86C 2AZVA 1QCFA 1KHCA 3DKMA 4M7AC 5CR2A 4XTYA 4M78E 4CC3A 5FRNA 3URGA 1UHCA 1YFNA 4E7KA 4PJOD 1KSWA 2CP6A 2CKKA 3CCQT 2EQKA 4IURA 4Z8AA 1SG5A 5KE3A 5KYNA 3CPWS 2G3RA 3G1JA 4C8QA 5GAN2 1UECA 1IXDA 1D1AA 4PJOF 1ACMB 1WXBA 1KQSP 5KYWA 3THKA 1JJ2A 3QZ5B 3OYKA 2KSSA 2KQWA 5I2MA 3MP6A 2LJ3A 5C0MA 4FM4B 2SEMA 3EGDB 2EGAA 1N9SA 1WXTA 2GFAA 3QJYA 4C0DB 2DNUA 5HCKA 3EGDA 2R5MA 5CIUA 4EMKB 3I55A 2G6FX 2BZ8A 2JS0A 1YI2Q 3I55T 2CUBA 3A8GB 2CP5A 2RI2A 1NLPC 4ZTJA 1M2OA 5LL6S 2RQUA 2QTVA 4RTWA 4N4HA 3CCVA 3X20B 4RTYA 1IZ6A 4KBMB 2JNGA 4BI3A 2O4XB 4LDYA 1VIEA 2QA4T 5IHIA 2YRVA 4BUGA 2HEQA 4M78C 5D6YA 3X24B 3HP9A 3L2RA 4OMOA 2KROA 3PNWC 1TG0A 2K79A 5LJ3d 3L2QA 3R6OA 1SHGA 4M7AE 2OTJQ 1D1CA 3FEOA 2Y4XA 4J9HA 1YBYA 2EFIA 2ZPEB 4RUGA 2A36A 1W1FA 3CQTA 2F2XA 3M4YA 1SSHA 3J7AF 2K4YA 4J8OA 1Q7YU 2LMJA 2EIFA 1RAGB 4EMKA 4DQ2A 5GAMg 4J83A 3C94A 2EKOA 1R8OB 4PJOC 1VQ8Q 3X25B 3CEYA 3QIIA 2A0FB 5FRMA 3RIRA 2LJ0A 2QAZA 3FC3A 1RLPC 1O75A 4ZNXA 2PVGB 4F04B 4K11A 4F7UA 5LJ3f 2L3QA 1WJSA 4QVCA 3JB9J 4M7DD 2P0QA 1TUCA 2FL7A 2GQIA 4M78A 1W4SA 4JZ4A 3EGXB 3G7ZA 2QGFB 1NEBA 3GNGA 3EFSA 4C92C 1OX8A 2V1QA 1W2BS 2BKDN 5IN1A 3CC2A 4GY5A 4QQGA 1WYXA 1RAHB 2RM4A 2P84A 1QMCA 4C92F 4ME7A 2PZ1A 2ZPFB 1TOVA 1ZX6A 2V8JA 3META 9ATCB 1NG2A 1VQPT 3CXCA 3QJ6A 2KYBA 3EFOA 3CD6Q 2B8AA 2ZPGB 4A4GA 2HKNA 2E6ZA 2NUZA 2PUOB 2HD0A 5J3BA 2LRQA 1PSFA 5KYXB 5AT1B 4CC2A 2E10A 2KE9A 3OYHA 1Y96B 2AKLA 1NBEB 2JM9A 5KYYA 2JMAA 1QQJA 2K3YA 3RMSA 1Q81R 5GAOp 1VQMA 4E2FB 2ZCFB 5CKDA 4FYYB 2DO3A 1PRMC 3LYIA 3EFOB 4C0DC 2BE7D 2V8IA 5LJ3e 1WQ7A 1YWOA 1UEBA
chains in the Genus database with same CATH topology
1X6BA 2PNIA 4Z88A 1W70A 1WX6A 3REAB 3EG3A 2LZ6B 3UA6A 1X6GA 2RPNA 1H3HA 2DL4A 4GBQA 2MOXA 3TSZA 4D8DA 2DBMA 2EVRA 2K6DA 2VKNA 2JM8A 1JO8A 5FWBA 3UF4A 2A28A 4IIOA 2D8HA 2CSQA 1ABOA 4OMQA 1GFDA 2YT6A 4HVVA 2EYZA 2LQNA 2KBTA 3GBQA 4A63B 4AFUC 2IIMA 4QT7A 2PTKA 2EYYA 2O9SA 2DL3A 1JXMA 1E7OA 1YNZA 3EG1A 2GTOA 4LNPA 4KRTA 4HVUA 1ZSGA 1PRLC 1VYUA 2X3WD 4CC7A 1T3SA 2YDLA 3M0PA 2HDAA 2GTJA 3VS1A 3VS7A 4J9IA 4LN2A 1I0CA 1AWWA 2KT1A 1KFZA 2OI3A 1WDXA 1B3QA 1E6HA 1YCSB 4LE9A 3VRYA 3TSWA 1AEYA 2K9GA 1UFFA 1JU5C 2VVKA 5IXBA 2DL7A 1QLYA 2EW3A 2J6FA 1B07A 2XMFA 5EC7A 4LUEA 1ZUUA 4AFQC 2JT4A 3EHRA 1M3CA 1GL5A 2KGTA 2DBKA 1M30A 2OAWA 2DL5A 2FRYA 4AG2C 1K4US 3UA7A 3TVTA 3NGPA 4OMLA 1JXOA 4ESRA 2E5KA 1UE9A 2M0YA 2DM1A 1HJDA 1MV0B 1UG1A 3O5ZA 1ZLMA 1E6GA 3VS0A 2O9VA 1W6XA 1SHFA 2K7AA 3I5SA 3EG2A 3FJ5A 2DL8A 1GCQC 3U23A 2L2PA 2JXBA 3NPFA 4OMNA 1X27A 1ZUYA 2EGEA 2KRMA 2F2WA 2JW4A 4FSSA 2BZYA 1NYFA 2MIOA 2KXCA 4F14A 2LJ1A 2O2OA 1WXUA 1T3LA 1I1JA 3EG0A 2EYXA 1MV3A 2HSPA 4Y92A 1NM7A 5ECAA 2L3SA 1ZBJA 4JZ3A 3M0RA 3PE0A 2EKHA 1JQQA 1K76A 3M0QA 1AOJA 2K3BA 2ECZA 1X2QA 2JTEA 4JJBA 1PHTA 4J9CA 1OPKA 2EGCA 1RLQC 1V1CA 2EBPA 2RNAA 1UTIA 2KT8A 1Y57A 2YUQA 1TUDA 3NHNA 3A98A 2C0OA 2CSIA 1JEGA 5FWCA 1YP5A 2ED0A 2LP5A 3VS3A 2KRNA 2X3XD 2DRMA 3H0IA 5IHKA 1WFWA 2DVJA 2YUOA 1K0SA 1BB9A 2HBWA 2C0TA 1M27C 4LUDA 1ZUKA 1Y0MA 2DILA 2HCKA 3M0TA 1I07A 1RI9A 2SRCA 4F16A 3VS4A 1YWPA 1MUZA 2DYBA 3SHWA 2FPDA 2CT4A 3ZL7C 1KJWA 3VS2A 3VS5A 1H8KA 2CDTA 1PNJA 2ENMA 2CREA 2CH4A 1RUWA 1YN8A 2YUPA 1BBZA 3H0FA 2EYWA 1VYTA 1AZEA 2GBQA 2CT3A 4HVWA 3VS6A 4EIKA 4J9GA 2AZVA 1G83A 2ROLA 1QCFA 4OMMA 2W0ZA 1SRMA 3M0UA 2JS2A 1UGVA 4RTZA 3IQLA 2OJ2A 4J9BA 4CC3A 2BTTA 4AFZC 1GBQA 1UHCA 4HCKA 1CKAA 1NEGA 1T0HA 3SEMA 4JJDA 1KSWA 2DA9A 2I0NA 1AWJA 5GJWB 2DLPA 1NLOC 4Z8AA 1BU1A 2YSQA 2GGRA 1M8MA 2LCSA 2FEIA 1U06A 5IXFA 1GCQA 3KFVA 1HSQA 1UECA 1K1ZA 3RBBB 1SRLA 2JMCA 2B86A 3LH5A 1WXBA 2VWFA 5GJVB 1K9AA 3THKA 1WLPB 1WIEA 2FRWA 2YUNA 2LJ3A 3QWXX 1AZGB 2A37A 3PVLA 3I5RA 2SEMA 1VA7A 2EGAA 1HD3A 2EPDA 1WXTA 1Z9QA 3JV3A 1PWTA 3H41A 2DNUA 2MCNA 1EFNA 4RTTA 2L0AA 1QKXA 2L3PA 5HCKA 2J06A 1X2KA 1SEMA 3M0SA 1S1NA 2FG0A 2G6FX 2BZ8A 2JS0A 2J6KA 4DEYA 1OEBA 1U5SA 2FPEA 3C0CA 1UHFA 2CH4W 2FPFA 2NWMA 2CUBA 2K2MA 4F17A 1NLPC 1CKBA 5L23A 2QDLA 4D8KA 1G2BA 2RQUA 4RTWA 2RN8A 2M51A 4RTYA 2D0NA 1XOVA 2H8HA 5IHIA 1GRIA 3RNJA 2HEQA 2W10A 1WA7A 4OMOA 2KROA 1ARKA 1TG0A 1AVZC 2K79A 1SHGA 1UDLA 4HXJA 4RTVA 1M3AA 4J9HA 3CQTA 2A36A 1W1FA 4RUGA 2F2XA 2FO0A 3I35A 4CC4B 1SSHA 1UJ0A 1IO6A 3I9QA 1J3TA 1GFCA 4E6RA 2LMJA 1X43A 4ORZA 1H92A 4JPBW 2A08A 2RF0A 2KRSA 2GNCA 1X69A 4DEXA 4Z89A 1AD5A 1CSKA 2J05A 2RQTA 1QWFA 3H0HA 4JJCA 1GBRA 4AFSC 5FW9A 2LJ0A 4GLMA 1RLPC 4ZNXA 1QKWA 2KEAA 2KXDA 2AKKA 5IHNA 4K11A 4AG1C 2J7IA 1K0XA 1BK2A 1UUEA 2L3QA 3EGUA 2DJQA 2DRKA 1KIKA 2RMOA 1OPLA 1TUCA 2GQIA 4JZ4A 2KYMA 4R0KA 1OOTA 1NEBA 1PKSA 3EHQA 2F2VA 2V1QA 3NMZC 1NYGA 4M4ZA 1AWOA 3REBB 2C0IA 4WCIA 1LCKA 1M3BA 2DF6A 2DMOA 1WI7A 1WYXA 5I11A 3PVQA 1GCPA 3ULRB 2PZ1A 2DX1A 1ABQA 2V1RA 2KNBB 2O88A 1PKTA 1UJYA 1ZX6A 1T0JA 1VYVA 2RQVA 1NG2A 2LQWA 2P4RA 2ABLA 4J9DA 2D8JA 2EQIA 2KYBA 3VRZA 2J6OA 4J9FA 4OMPA 1Z9ZA 3QWYA 2AZSA 2NUZA 3R6NA 4IIMA 4RTXA 2DE0X 2RQRA 2LNHB 1QWEA 4X1VA 2D1XA 4J9EA 4CC2A 2KE9A 1AWXA 2KR3A 5IH2A 2AKLA 2O31A 3UATA 2JM9A 1U3OA 2ED1A 2JMAA 5I22A 1SPKA 2RQWA 1N5ZA 4RTUA 1A0NB 2BZXA 2LX7A 1OV3A 1PRMC 2ESWA 1FMKA 2ROTA 1FYNA 2CUDA 2AK5A 1YWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X6B A;  2PNI A;  4Z88 A;  1W70 A;  1WX6 A;  3REA B;  3EG3 A;  2LZ6 B;  3UA6 A;  1X6G A;  2RPN A;  1H3H A;  2DL4 A;  4GBQ A;  2MOX A;  3TSZ A;  4D8D A;  2DBM A;  2EVR A;  2K6D A;  2VKN A;  2JM8 A;  1JO8 A;  5FWB A;  3UF4 A;  2A28 A;  4IIO A;  2D8H A;  2CSQ A;  1ABO A;  4OMQ A;  1GFD A;  2YT6 A;  4HVV A;  2EYZ A;  2LQN A;  2KBT A;  3GBQ A;  4A63 B;  4AFU C;  2IIM A;  4QT7 A;  2PTK A;  2EYY A;  2O9S A;  2DL3 A;  1JXM A;  1E7O A;  1YNZ A;  3EG1 A;  2GTO A;  4LNP A;  4KRT A;  4HVU A;  1ZSG A;  1PRL C;  1VYU A;  2X3W D;  4CC7 A;  1T3S A;  2YDL A;  3M0P A;  2HDA A;  2GTJ A;  3VS1 A;  3VS7 A;  4J9I A;  4LN2 A;  1I0C A;  1AWW A;  2KT1 A;  1KFZ A;  2OI3 A;  1WDX A;  1B3Q A;  1E6H A;  1YCS B;  4LE9 A;  3VRY A;  3TSW A;  1AEY A;  2K9G A;  1UFF A;  1JU5 C;  2VVK A;  5IXB A;  2DL7 A;  1QLY A;  2EW3 A;  2J6F A;  1B07 A;  2XMF A;  5EC7 A;  4LUE A;  1ZUU A;  4AFQ C;  2JT4 A;  3EHR A;  1M3C A;  1GL5 A;  2KGT A;  2DBK A;  1M30 A;  2OAW A;  2DL5 A;  2FRY A;  4AG2 C;  1K4U S;  3UA7 A;  3TVT A;  3NGP A;  4OML A;  1JXO A;  4ESR A;  2E5K A;  1UE9 A;  2M0Y A;  2DM1 A;  1HJD A;  1MV0 B;  1UG1 A;  3O5Z A;  1ZLM A;  1E6G A;  3VS0 A;  2O9V A;  1W6X A;  1SHF A;  2K7A A;  3I5S A;  3EG2 A;  3FJ5 A;  2DL8 A;  1GCQ C;  3U23 A;  2L2P A;  2JXB A;  3NPF A;  4OMN A;  1X27 A;  1ZUY A;  2EGE A;  2KRM A;  2F2W A;  2JW4 A;  4FSS A;  2BZY A;  1NYF A;  2MIO A;  2KXC A;  4F14 A;  2LJ1 A;  2O2O A;  1WXU A;  1T3L A;  1I1J A;  3EG0 A;  2EYX A;  1MV3 A;  2HSP A;  4Y92 A;  1NM7 A;  5ECA A;  2L3S A;  1ZBJ A;  4JZ3 A;  3M0R A;  3PE0 A;  2EKH A;  1JQQ A;  1K76 A;  3M0Q A;  1AOJ A;  2K3B A;  2ECZ A;  1X2Q A;  2JTE A;  4JJB A;  1PHT A;  4J9C A;  1OPK A;  2EGC A;  1RLQ C;  1V1C A;  2EBP A;  2RNA A;  1UTI A;  2KT8 A;  1Y57 A;  2YUQ A;  1TUD A;  3NHN A;  3A98 A;  2C0O A;  2CSI A;  1JEG A;  5FWC A;  1YP5 A;  2ED0 A;  2LP5 A;  3VS3 A;  2KRN A;  2X3X D;  2DRM A;  3H0I A;  5IHK A;  1WFW A;  2DVJ A;  2YUO A;  1K0S A;  1BB9 A;  2HBW A;  2C0T A;  1M27 C;  4LUD A;  1ZUK A;  1Y0M A;  2DIL A;  2HCK A;  3M0T A;  1I07 A;  1RI9 A;  2SRC A;  4F16 A;  3VS4 A;  1YWP A;  1MUZ A;  2DYB A;  3SHW A;  2FPD A;  2CT4 A;  3ZL7 C;  1KJW A;  3VS2 A;  3VS5 A;  1H8K A;  2CDT A;  1PNJ A;  2ENM A;  2CRE A;  2CH4 A;  1RUW A;  1YN8 A;  2YUP A;  1BBZ A;  3H0F A;  2EYW A;  1VYT A;  1AZE A;  2GBQ A;  2CT3 A;  4HVW A;  3VS6 A;  4EIK A;  4J9G A;  2AZV A;  1G83 A;  2ROL A;  1QCF A;  4OMM A;  2W0Z A;  1SRM A;  3M0U A;  2JS2 A;  1UGV A;  4RTZ A;  3IQL A;  2OJ2 A;  4J9B A;  4CC3 A;  2BTT A;  4AFZ C;  1GBQ A;  1UHC A;  4HCK A;  1CKA A;  1NEG A;  1T0H A;  3SEM A;  4JJD A;  1KSW A;  2DA9 A;  2I0N A;  1AWJ A;  5GJW B;  2DLP A;  1NLO C;  4Z8A A;  1BU1 A;  2YSQ A;  2GGR A;  1M8M A;  2LCS A;  2FEI A;  1U06 A;  5IXF A;  1GCQ A;  3KFV A;  1HSQ A;  1UEC A;  1K1Z A;  3RBB B;  1SRL A;  2JMC A;  2B86 A;  3LH5 A;  1WXB A;  2VWF A;  5GJV B;  1K9A A;  3THK A;  1WLP B;  1WIE A;  2FRW A;  2YUN A;  2LJ3 A;  3QWX X;  1AZG B;  2A37 A;  3PVL A;  3I5R A;  2SEM A;  1VA7 A;  2EGA A;  1HD3 A;  2EPD A;  1WXT A;  1Z9Q A;  3JV3 A;  1PWT A;  3H41 A;  2DNU A;  2MCN A;  1EFN A;  4RTT A;  2L0A A;  1QKX A;  2L3P A;  5HCK A;  2J06 A;  1X2K A;  1SEM A;  3M0S A;  1S1N A;  2FG0 A;  2G6F X;  2BZ8 A;  2JS0 A;  2J6K A;  4DEY A;  1OEB A;  1U5S A;  2FPE A;  3C0C A;  1UHF A;  2CH4 W;  2FPF A;  2NWM A;  2CUB A;  2K2M A;  4F17 A;  1NLP C;  1CKB A;  5L23 A;  2QDL A;  4D8K A;  1G2B A;  2RQU A;  4RTW A;  2RN8 A;  2M51 A;  4RTY A;  2D0N A;  1XOV A;  2H8H A;  5IHI A;  1GRI A;  3RNJ A;  2HEQ A;  2W10 A;  1WA7 A;  4OMO A;  2KRO A;  1ARK A;  1TG0 A;  1AVZ C;  2K79 A;  1SHG A;  1UDL A;  4HXJ A;  4RTV A;  1M3A A;  4J9H A;  3CQT A;  2A36 A;  1W1F A;  4RUG A;  2F2X A;  2FO0 A;  3I35 A;  4CC4 B;  1SSH A;  1UJ0 A;  1IO6 A;  3I9Q A;  1J3T A;  1GFC A;  4E6R A;  2LMJ A;  1X43 A;  4ORZ A;  1H92 A;  4JPB W;  2A08 A;  2RF0 A;  2KRS A;  2GNC A;  1X69 A;  4DEX A;  4Z89 A;  1AD5 A;  1CSK A;  2J05 A;  2RQT A;  1QWF A;  3H0H A;  4JJC A;  1GBR A;  4AFS C;  5FW9 A;  2LJ0 A;  4GLM A;  1RLP C;  4ZNX A;  1QKW A;  2KEA A;  2KXD A;  2AKK A;  5IHN A;  4K11 A;  4AG1 C;  2J7I A;  1K0X A;  1BK2 A;  1UUE A;  2L3Q A;  3EGU A;  2DJQ A;  2DRK A;  1KIK A;  2RMO A;  1OPL A;  1TUC A;  2GQI A;  4JZ4 A;  2KYM A;  4R0K A;  1OOT A;  1NEB A;  1PKS A;  3EHQ A;  2F2V A;  2V1Q A;  3NMZ C;  1NYG A;  4M4Z A;  1AWO A;  3REB B;  2C0I A;  4WCI A;  1LCK A;  1M3B A;  2DF6 A;  2DMO A;  1WI7 A;  1WYX A;  5I11 A;  3PVQ A;  1GCP A;  3ULR B;  2PZ1 A;  2DX1 A;  1ABQ A;  2V1R A;  2KNB B;  2O88 A;  1PKT A;  1UJY A;  1ZX6 A;  1T0J A;  1VYV A;  2RQV A;  1NG2 A;  2LQW A;  2P4R A;  2ABL A;  4J9D A;  2D8J A;  2EQI A;  2KYB A;  3VRZ A;  2J6O A;  4J9F A;  4OMP A;  1Z9Z A;  3QWY A;  2AZS A;  2NUZ A;  3R6N A;  4IIM A;  4RTX A;  2DE0 X;  2RQR A;  2LNH B;  1QWE A;  4X1V A;  2D1X A;  4J9E A;  4CC2 A;  2KE9 A;  1AWX A;  2KR3 A;  5IH2 A;  2AKL A;  2O31 A;  3UAT A;  2JM9 A;  1U3O A;  2ED1 A;  2JMA A;  5I22 A;  1SPK A;  2RQW A;  1N5Z A;  4RTU A;  1A0N B;  2BZX A;  2LX7 A;  1OV3 A;  1PRM C;  2ESW A;  1FMK A;  2ROT A;  1FYN A;  2CUD A;  2AK5 A;  1YWO A; 
#chains in the Genus database with same CATH topology
 5GAO r;  2RK1 A;  3FIF A;  2CP3 A;  2MYS A;  3EG3 A;  1BI3 A;  2RHY A;  3V7R A;  2CP0 A;  3TSZ A;  3C4S A;  5KYX A;  1WPY A;  2EVR A;  2EQJ A;  2K6D A;  5LJ3 h;  5FWB A;  4M7D C;  2DZ9 A;  3CCQ A;  1I8F A;  2A28 A;  3HRU A;  3JB9 I;  4M75 D;  2MI6 A;  1KQS S;  4C92 D;  2D8H A;  3S6W A;  2CSQ A;  1YHQ T;  1GFD A;  2LQN A;  3EG9 B;  4AFU C;  4A54 A;  2DKG A;  3LWI A;  1M1G A;  3CXC P;  2VXF A;  1M1K C;  3CCM T;  1VIF A;  5L8R E;  4LNP A;  3GF5 A;  3Q1J A;  1T3S A;  2YDL A;  2OAU A;  2GTJ A;  4O6J A;  4Y91 A;  3AT1 B;  4J9I A;  1F1B B;  1I0C A;  4LN2 A;  3JCM f;  2XKO C;  3OYJ A;  1G8X A;  5GAN d;  4M77 D;  3LLR A;  2M0O A;  3VRY A;  1B3Q A;  4LE9 A;  4X9D A;  1MMD A;  3EG9 A;  2P0P A;  1QLY A;  1N6A A;  4DBR A;  1K9M C;  1VOM A;  4LUE A;  1ZUU A;  4AFQ C;  1KHI A;  1VQ8 A;  3BDL A;  4M75 B;  2E41 A;  4C8Q G;  4C92 B;  3MKD A;  3OQ5 A;  2M02 A;  4AG2 C;  1EIF A;  4IUP A;  1YJW T;  3QG1 A;  1QVF A;  3DB3 A;  3QBY A;  3CCV T;  3JCM W;  3RR6 A;  1U1T A;  5J26 A;  3GLX A;  1IRX A;  3EAE A;  2M0Y A;  2VGM A;  3JCM h;  4C0G A;  1UG1 A;  1ZLM A;  4RG2 A;  2NLU A;  2PVO B;  1ZBX A;  3CCJ Q;  1TH7 A;  2O9V A;  3CD6 A;  1W6X A;  3S3M A;  3I5S A;  3EG2 A;  3FJ5 A;  3SWN B;  2DL8 A;  4BE0 A;  2K2V A;  2L2P A;  2GFU A;  3NPF A;  4OMN A;  2EGE A;  3CCS Q;  2F2W A;  4FSS A;  1NYF A;  3OYL A;  4OMF B;  4JRI A;  4QVZ A;  4F14 A;  5J39 A;  4XTZ A;  1T3L A;  4FSX A;  4MZM A;  1M1F A;  4FT2 A;  1MV3 A;  1LNX A;  2L3S A;  3OMG A;  3X28 B;  8AT1 B;  4JZ3 A;  5FRO A;  3PFS A;  4KT0 E;  3KXT A;  1K76 A;  2JTM A;  3M0Q A;  1LOJ A;  1VQ7 A;  3RES A;  1X2Q A;  4JJB A;  1PHT A;  1YIT T;  4XU0 A;  1VQ5 Q;  4XTW A;  1XJW B;  5GAN 7;  4BE1 A;  3G4S A;  3A98 A;  2LT1 A;  3NFC A;  2HKQ B;  3CCJ A;  1K8A C;  3VS3 A;  3H0I A;  2C0T A;  1B7T A;  4M7A A;  4LUD A;  3A5Z B;  4JJN K;  1Y0M A;  2DIL A;  2PQW A;  3NTH A;  3TCJ A;  1KQ1 A;  4C0Z A;  1I07 A;  2SRC A;  1YJ9 Q;  1YWP A;  1G3S A;  2E12 A;  2EAY A;  3CMA A;  2E5Q A;  1WHG A;  5KCH A;  1MGQ A;  1BIB A;  4JLI A;  1YJN T;  4JRQ A;  4J6W A;  2CH4 A;  1VQO A;  1NPR A;  2YXY A;  2P4T A;  1Q81 U;  1N9R A;  4M78 G;  1K9M R;  1DJ7 B;  3F70 A;  2VV5 A;  3G71 T;  1G83 A;  1WZO A;  2K5I A;  3CBO A;  3JAM E;  4OMM A;  1RAC B;  1O9S A;  2W0Z A;  1SRM A;  4ATO A;  1OUL A;  2JS2 A;  2V8K A;  2XDP A;  4RTZ A;  3IQL A;  2OJ2 A;  2FZK B;  2DD4 A;  4FL6 A;  1ZA1 B;  3MJX A;  2BTT A;  4AFZ C;  3LH0 A;  4HCK A;  1CKA A;  4A4F A;  1IGU A;  4C8Q E;  1VQP Q;  4J7F A;  1T0H A;  3SEM A;  1K73 U;  1YIT A;  1NLO C;  1OZ2 A;  2GGR A;  3OSV A;  4PL6 A;  1U06 A;  3HL8 A;  2MF2 A;  1HSQ A;  2QEX T;  2NYS A;  2LVM A;  3E19 A;  1K1Z A;  1OI1 A;  1W2B A;  3RBB B;  1SRL A;  4PLL A;  2B86 A;  1TXQ A;  3S3O A;  3UDC A;  1M1K U;  5GJV B;  3L2W A;  1K9A A;  4FYV B;  1WIE A;  1D3B B;  3ZEH A;  3NTK A;  2LNV A;  1B34 A;  4PK4 A;  3KUF A;  4X9C A;  2DD5 A;  2RJC A;  3PVL A;  4BY6 B;  1HD3 A;  2KDS A;  1Z9Q A;  2LQ8 A;  2MCN A;  4RTT A;  3CMA T;  1QKX A;  2L3P A;  5GMK m;  1S1N A;  2FG0 A;  2DJZ A;  4E7I A;  1VQ8 T;  2JJ9 A;  1U5S A;  3RUX A;  1Q95 G;  1ZA2 B;  3V8J A;  4F17 A;  2DEQ A;  4DBF A;  2QDL A;  2RJD A;  3QDF A;  2XDD A;  2RN8 A;  2M51 A;  3CCJ T;  1VQL Q;  2ZPI B;  2D0N A;  5GMK l;  2H8H A;  3SWN A;  3RNJ A;  3MEU A;  5FLX E;  1G3W A;  4KGX B;  1ARK A;  4EPC A;  4HXJ A;  2HBP A;  1QP3 A;  2FO0 A;  2CZ1 B;  2I2L A;  1UJ0 A;  1J3T A;  2VGN A;  1GFC A;  1S72 T;  3M53 A;  4ORZ A;  3OS1 A;  3JB9 F;  1VQ9 A;  5FU7 B;  3I56 A;  2CP7 A;  3CME T;  2KRS A;  1G3Y A;  4IUQ A;  4DEX A;  4Z89 A;  1UB4 A;  2A7Y A;  2L8D A;  1AD5 A;  5GAO n;  5HK0 A;  2RQT A;  1LVK A;  3H0H A;  4JJC A;  4A4K A;  2RHI A;  5FW9 A;  2E1H A;  1KQS A;  1BI2 A;  2KEA A;  4C5E A;  4FT4 A;  4XAX B;  4AG1 C;  4RCB A;  1K0X A;  1P92 A;  3JB9 D;  2CGH A;  2RMO A;  2VYT A;  1OPL A;  4KUI A;  2CYZ B;  2JVV A;  2E4H A;  3C95 A;  4LD6 A;  1QVF P;  2HZY A;  4KGZ B;  1AWO A;  3REB B;  2DAQ A;  3MCA B;  5I11 A;  3PVQ A;  1GCP A;  1VQN Q;  4XU1 A;  3JCM e;  2OX7 A;  1T0J A;  3A1P A;  3CCS A;  4J9D A;  2XHC A;  1NJI R;  5LJ5 g;  2J6O A;  1Z9Z A;  1IHV A;  2NUP A;  1KC8 U;  1KC8 R;  1VQM T;  3V8K A;  4WTO B;  3NTI A;  2E70 A;  3JCM b;  3MEV A;  4X1V A;  2D1X A;  4WF2 A;  3GIB A;  4Q5W A;  3CC4 A;  3WXM B;  1U3O A;  2KVQ G;  1HK9 A;  1VQ6 A;  1ZSZ B;  1N5Z A;  3JRZ A;  3MEW A;  4E47 A;  5GAN 6;  2PVD B;  4OB3 B;  1S72 Q;  1TSF A;  2BE9 B;  2ATC B;  3J81 E;  2ROT A;  1FYN A;  2AK5 A;  4DBQ A;  3OB9 A;  1VQO T;  3QO3 A;  1X6B A;  2F5K A;  5KYY B;  1OQK A;  1RAD B;  3ER0 A;  5EG2 A;  1V29 B;  1WX6 A;  1D0X A;  4BI8 B;  3UA6 A;  2RO0 A;  4QQ6 A;  2ZPB B;  1MHN A;  2A3L A;  1VQ7 T;  2PU9 B;  4A4H A;  2QQS A;  1YI2 A;  3I55 Q;  1FMV A;  1YI2 T;  4ZGD B;  2O4X A;  1ABO A;  4OMQ A;  4A4E A;  3CCR Q;  2WSF E;  2QGG A;  2KBT A;  5M9O A;  4OB2 B;  4LDU A;  4A63 B;  2PTK A;  2EYY A;  1UGQ B;  4EMK C;  4MDX A;  2DL3 A;  1JXM A;  2X35 A;  2JOY A;  5GAN 3;  4CRI A;  4QVD A;  4KRT A;  4HVU A;  1WHK A;  1PRL C;  1Y7X A;  3L2V A;  3CCR A;  1XQH A;  2QXF A;  4DOW A;  4E7J A;  3VS1 A;  4L5G A;  1AWW A;  4M78 B;  2KT1 A;  4N4I A;  1KFZ A;  1I5L A;  1JRI A;  2OI3 A;  3QSU A;  4M75 G;  2QQB A;  1VQ4 A;  4KH0 B;  2VVK A;  4DBH A;  5IXB A;  4PFO A;  2DET A;  1VUB A;  2VC8 A;  1YJN Q;  1R0C B;  2JT4 A;  4AMC A;  2MPX C;  4E7H A;  1M3C A;  2D0Q B;  4NS5 A;  4V2S A;  1HXD A;  5A0D A;  2DBK A;  1M30 A;  3HRS A;  4PJO B;  3DLM A;  1YJ9 T;  3VUB A;  3CCE Q;  2XU8 A;  4O5V A;  2RHX A;  1UE9 A;  3WVD B;  1Q7Y R;  5DLO A;  1TU0 B;  3SD4 A;  1M90 U;  5CVI A;  1B34 B;  3S3N A;  1MV0 B;  2QA4 Q;  3VS0 A;  2DXC A;  1PC0 A;  1PCX A;  2RI5 A;  4J5Y A;  1YCY A;  1SHF A;  2K7A A;  4M7A D;  3HSB A;  3OBW A;  3TQ7 P;  2QQA A;  4M77 E;  3QHS A;  3HRT A;  2C06 A;  1ZUY A;  4FW2 A;  5FU7 C;  2KRM A;  3OW2 A;  1PD1 A;  1H64 1;  2XIC A;  5KYW B;  1BKB A;  3H8Z A;  1YHQ A;  1VQK A;  2DTI A;  2EYX A;  2LTO A;  1K8A R;  4Y92 A;  3CPW A;  3A8L B;  3HTR A;  4JRP A;  4M78 F;  1VQP A;  3PE0 A;  4X34 A;  3I56 Q;  2EKH A;  3CC4 T;  4JUV A;  2K3B A;  2ECZ A;  3MPU B;  2JTE A;  4JLG A;  1RLQ C;  1V1C A;  2EYQ A;  1W2B P;  1UTI A;  2KT8 A;  2YUQ A;  3NHN A;  2RD1 A;  1VQK Q;  2M9U A;  4EMG A;  2CSI A;  3CPF A;  1WQW A;  4ZN1 A;  2ED0 A;  3RKY A;  2QQ9 A;  5I21 A;  3EH1 A;  2CP2 A;  2YUO A;  1VQ6 Q;  4N0A C;  1K0S A;  3G4S Q;  1BB9 A;  3KBG A;  4L6V 5;  4MZP A;  3P8H A;  1Q7Y C;  2L89 A;  5D6X A;  1VQO Q;  5CKH A;  1ZUK A;  5HK3 A;  2YHT A;  2DXB A;  1C0M A;  2RI3 A;  3OYN A;  3ME9 A;  3CXC S;  4CI0 C;  1I81 A;  2DYB A;  3SHW A;  4HT9 A;  3ZL7 C;  2LDM A;  3FJP A;  3PIO A;  2KK4 A;  5GAN h;  2YUP A;  4F7U B;  3H0F A;  2EYW A;  3JCM c;  1PG5 B;  1YJW A;  4M75 E;  3CC7 T;  2GBQ A;  3OYI A;  8ATC B;  5DM7 R;  4J9G A;  4RCC A;  3EH2 A;  4HA8 A;  3HFO A;  3TEE A;  4EMH A;  3CD6 T;  3TU4 K;  3M0U A;  4M7D B;  2F5T X;  1ZSZ C;  3VUZ A;  2QG9 B;  4J9B A;  2QK0 A;  2HQH A;  4HKE A;  3LW5 E;  1OX9 A;  1QCO A;  1GBQ A;  1Y71 A;  3H9N A;  2FYK A;  5AYF A;  1NEG A;  4IKF A;  2V26 A;  2I0N A;  1WHH A;  1G5V A;  4C8Q D;  3EGX A;  1Y96 A;  2WSC E;  1M8M A;  3C12 A;  4QW2 A;  3CBM A;  2L5Q A;  4OB0 B;  5IXF A;  1GCQ A;  3KFV A;  3L2Z A;  3QYG B;  2NUP B;  3LX7 A;  3JB9 G;  4FU6 A;  2AT1 B;  2VWF A;  1WLP B;  4VUB A;  1V76 A;  1WNL A;  2Y4Y A;  2YUN A;  1D0Y A;  3I56 T;  2MWO A;  2MK5 A;  3EFR A;  3CME A;  3QWX X;  1AZG B;  2A37 A;  4IUV A;  2FHD A;  3I5R A;  2DYI A;  4PFZ A;  5DLQ E;  3P8D A;  2CZ0 B;  4PJO G;  5GAM h;  3H41 A;  3CBP A;  1EFN A;  1RL2 A;  2L0A A;  3CCR T;  3M5A A;  1X2K A;  3PT9 A;  1SEM A;  3OW2 S;  3PMT A;  1YHQ Q;  2FPE A;  1AHJ B;  2CH4 W;  1K73 R;  3CME Q;  4P5N A;  5L23 A;  4F7U G;  4HT8 A;  1QVP A;  2YLB A;  5GAM e;  2DZC A;  2CZ6 B;  1GRI A;  3FB9 A;  1NPP A;  2W10 A;  2WSE E;  1WA7 A;  1VQ9 T;  1FXX A;  1D1B A;  3QUI A;  4ZTF A;  1IHW A;  3CCM A;  4C0F A;  3CCU T;  5DY9 A;  3JCM g;  3H6Z A;  3E9F A;  3I35 A;  2KI7 A;  3FDR A;  3PGG A;  1N27 A;  3I9Q A;  5CK9 A;  3N5B B;  1KD1 C;  1H92 A;  1X43 A;  4JPB W;  2A08 A;  2RF0 A;  1M90 C;  5C6S A;  1X69 A;  1VQN T;  1CSK A;  1D09 B;  4C8Q C;  2J05 A;  1QWF A;  2E3I A;  2QAS A;  1U1S A;  3G6E T;  5CKE A;  1QKW A;  3CCL Q;  2KXD A;  4M75 A;  2AKK A;  5IHN A;  2VXE A;  1GXI E;  2J7I A;  3RMQ A;  1VQ4 T;  1BK2 A;  5GAN j;  1UUE A;  3E1S A;  4PKC C;  3OYA A;  3EGU A;  2COY A;  2DJQ A;  2EJG A;  2DRK A;  2LQK A;  1KIK A;  2GCX A;  1K8A U;  1VQ4 Q;  3CC2 Q;  2DVE A;  2KYM A;  5IT9 E;  1OOT A;  4MMK A;  1PKS A;  2X51 A;  2R58 A;  1WHM A;  4M75 C;  4E7S A;  2F2V A;  1NYG A;  4E7Z A;  1JJ2 P;  2C0I A;  4WCI A;  1M3B A;  5GAN f;  5GAM f;  4BDZ A;  3ULR B;  2DX1 A;  1ABQ A;  2KNB B;  1PKT A;  2E3H A;  1VYV A;  2P4R A;  2D8J A;  2EQI A;  1U8R A;  2F1L A;  3VRZ A;  2O01 E;  4J9F A;  4OMP A;  7AT1 B;  2JN0 A;  1K9M U;  1TTH B;  3QWY A;  4M7A F;  2XK0 A;  4C92 G;  2K3X A;  4TVR A;  1FX7 A;  2QQR A;  5LJ3 g;  5CQY A;  4M77 C;  4B6M A;  5GAN g;  1VQ9 Q;  1QWE A;  1N8R U;  2KR3 A;  1MMG A;  2XI9 A;  1HYO A;  2ED1 A;  3X26 B;  5I22 A;  4M7D F;  4RTU A;  4HCC A;  1BIA A;  5GAM d;  2AIR B;  4R56 A;  2IPO B;  2LX7 A;  2L3R A;  3TRE A;  1OV3 A;  4N4G A;  2E64 A;  3T9N A;  1EX4 A;  2CUD A;  1QP2 A;  3RDV A;  3CMA Q;  3RER A;  1VQ5 A;  2DEU A;  3PTA A;  2EQM A;  2PNI A;  1W70 A;  1ZSZ A;  4FW1 A;  3DB4 A;  4M77 F;  1KG1 A;  4GBQ A;  3DLL A;  2MOX A;  4D8D A;  2XID A;  2DBM A;  1KD1 U;  1Q82 C;  1MNE A;  2RB6 A;  4PJN A;  1JO8 A;  4XQ3 A;  3A8H B;  3QYH B;  3UF4 A;  2HL3 A;  2GQV A;  3CC4 Q;  4IIO A;  4II1 A;  4BY6 C;  3QKJ A;  4KGV B;  2YT6 A;  4HVV A;  1XTD A;  2EYZ A;  1OU9 A;  2DK3 A;  3GBQ A;  2IIM A;  2P0K A;  3JCM P;  4QT7 A;  3JCM V;  1QVG S;  2O9S A;  2X4X A;  2HQX A;  1BYM A;  1YNZ A;  4M75 F;  1RAI B;  3MEA A;  4ZGE B;  2DFU A;  1VYU A;  2QTX A;  2X3W D;  2RJF A;  4CC7 A;  3M0P A;  3QXE B;  2HDA A;  3J80 E;  4KUL A;  1UGP B;  2EJ9 A;  3RKW A;  2DTH A;  3VS7 A;  3UWN A;  1M8V A;  3SB2 A;  2D6F A;  2HMA A;  4AT1 B;  2MMP A;  1YCS B;  2FVU A;  2K9G A;  1UFF A;  2XDB A;  1JU5 C;  3CCU A;  2DL7 A;  2EW3 A;  3CCV Q;  2J6F A;  1B07 A;  2R5A A;  5EC7 A;  1ZHI A;  4MML A;  1G3T A;  4J7I A;  3D7S B;  2IG0 A;  4D6W A;  4F7U E;  1GL5 A;  2KGT A;  4XU2 A;  2OAW A;  2DL5 A;  2RK2 A;  4M77 A;  1K4U S;  5CCA A;  3UA7 A;  2YRD A;  4OML A;  1IGQ A;  2OTJ T;  4HCZ A;  5LJ5 e;  3V8L A;  1YJN A;  2X9H A;  2X4W A;  3BDU A;  2DM1 A;  1HJD A;  4DA4 A;  3O5Z A;  1NZ9 A;  2QI2 A;  1VQL T;  5KCO A;  4PJO A;  3JCM J;  4M7A G;  3CCE A;  1VQK T;  3U23 A;  1GCQ C;  4ZN3 A;  4JS5 A;  1X27 A;  4R55 A;  5GAN e;  4PJO E;  3CCM Q;  3GOX A;  3OS2 A;  2JW4 A;  2ZGW A;  3O8V A;  3JCM Q;  5GMK e;  2MIO A;  2JTF A;  2LJ1 A;  2O2O A;  1WXU A;  4C8Q B;  1VQ6 T;  3ASK A;  1I1J A;  4M7D G;  4IUT A;  4E7L A;  2HSP A;  1NM7 A;  3ZBD A;  1ZBJ A;  2YWW A;  5CQX A;  3OYM A;  5GAO l;  2BIV A;  3VV0 A;  3GPL A;  1JQQ A;  1AOJ A;  1TWB A;  4DOV A;  4J9C A;  1OPK A;  3SDZ A;  3JCM d;  2EGC A;  2CZ7 B;  4BDY A;  3L1A A;  1YIJ A;  3OYD A;  1JEG A;  3INZ A;  1LJO A;  5FWC A;  1YP5 A;  1LPL A;  3BFM A;  2LP5 A;  3SFM A;  1PD0 A;  4Z02 A;  2K5L A;  1D3B A;  5D7U A;  1QW1 A;  1WJQ A;  3V7S A;  2KRN A;  1WHJ A;  2DVJ A;  3L42 A;  4BE2 A;  4LDX A;  4EDU A;  1M27 C;  1Y07 A;  2HCK A;  3M0T A;  3A8O B;  4PJM A;  2RH2 A;  5CKB A;  3VS4 A;  1MUZ A;  1M2V B;  1TUG B;  3E2U A;  2JUF A;  2CT4 A;  3JSC A;  1EZZ B;  3OS5 A;  1OZ3 A;  1PM3 A;  3VS2 A;  3VS5 A;  1H8K A;  4KUD K;  1PNJ A;  2ENM A;  3BY7 A;  1RUW A;  1YN8 A;  3MHX A;  5HKC A;  3FRN A;  4C92 E;  3G71 Q;  1NJI U;  4C5G A;  2ZZD A;  1VYT A;  1YIJ T;  1M5Q 1;  4MZT A;  4ZGJ B;  3G71 A;  2GF7 A;  2VAS A;  4HVW A;  2E6N A;  3WVE B;  2MWP A;  3ZFJ A;  2X4J A;  2ROL A;  1Q86 R;  1X01 A;  2QDY B;  4PLI A;  5GAO q;  3CPW P;  2X4Y A;  1BI1 A;  1UGV A;  3OW2 P;  1UGR B;  2NUT B;  1AT1 B;  4UC4 A;  4JJD A;  2K5F A;  2DA9 A;  3M57 A;  1AWJ A;  5GJW B;  2DLP A;  2EQU A;  4ANJ A;  1BU1 A;  2YSQ A;  2LCS A;  2FEI A;  2H3E B;  4C92 A;  2DTO A;  4NOY A;  4B9X A;  2HL5 C;  1X6O A;  3OYF A;  1IB8 A;  2JMC A;  3LH5 A;  3FLG A;  1RAB B;  4JS4 A;  5FU6 B;  4FIB A;  1K73 C;  2FRW A;  3OA6 A;  2F69 A;  3MP1 A;  4F7U F;  2FZC B;  1VA7 A;  2EPD A;  1XNI A;  3JV3 A;  1C6V X;  1PWT A;  1QCN A;  3SWN C;  4XK8 E;  2RA2 A;  2J06 A;  4RMO A;  3M0S A;  3OBY A;  3M56 A;  2J6K A;  4DEY A;  1N8R R;  1OEB A;  3C0C A;  4LDW A;  2KMT A;  5KYU A;  1UHF A;  3M58 A;  3OMC A;  2FPF A;  2NWM A;  4ELY C;  1BCM A;  2K2M A;  5LJ5 f;  1CKB A;  5LJ3 j;  1IRE B;  4D8K A;  1G2B A;  2JZ2 A;  1VQ7 Q;  5LJ5 d;  5I2S A;  4B9W A;  2XG8 D;  3HFN A;  3LGL A;  1XOV A;  2DXU A;  2Y90 A;  3M54 A;  3UT1 A;  1AVZ C;  2RJE A;  5LJ5 j;  5CKF A;  1UDL A;  1ZQ1 A;  4RTV A;  1M3A A;  1YJW Q;  4MDW A;  4CC4 B;  1KQ2 A;  1IO6 A;  4E6R A;  3VJP A;  1WHL A;  4FYW B;  1SSF A;  2GNC A;  4C5H A;  1WGS A;  3HKS A;  2CS7 A;  1GBR A;  2KAF A;  3L2U A;  1M1K R;  6AT1 B;  2FB7 A;  4AFS C;  3JB9 H;  2WAC A;  5GMK j;  5A0G A;  4GLM A;  2M1H A;  3A8M B;  3M9Q A;  1Q86 U;  3GP8 A;  2PUK B;  1VQL A;  2HAX A;  4OGE A;  4FCY A;  4N0A A;  3CC7 A;  3BW1 A;  1H3Z A;  1I4K 1;  4XTU A;  4R0K A;  3GNF B;  4XTX A;  3EHQ A;  4M77 G;  3NMZ C;  2COZ A;  4PJL A;  4M4Z A;  1LCK A;  4OVA A;  2DF6 A;  2DMO A;  1WI7 A;  1N8R C;  1SKU B;  2HQE A;  2K57 A;  2V1R A;  4LDV A;  2O88 A;  1UJY A;  2COW A;  2RQV A;  2LQW A;  5KE2 A;  2ABL A;  2H3J A;  2HSE B;  3RKX A;  1SF9 A;  3OYE A;  2AZS A;  1TS9 A;  2LCL A;  3CCL A;  3QDR B;  1M4Z A;  2DPP B;  2DXT A;  3R6N A;  3CCL T;  4IIM A;  4RTX A;  3UPU A;  2QA4 A;  2DE0 X;  2FZG B;  2RQR A;  1RAF B;  2LNH B;  1WJR A;  2OTL T;  4QQD A;  5KH6 A;  4YTL A;  2NUT A;  2ZAE A;  4J9E A;  3E9G A;  4J6Y A;  3OS0 A;  1AWX A;  3CC7 Q;  4M7A B;  4NL2 A;  5IH2 A;  2O31 A;  3UAT A;  1D0Z A;  4OP0 A;  4M7D A;  1SPK A;  2RQW A;  1MMA A;  1A0N B;  3MO8 A;  2BZX A;  2DIG A;  2LC4 A;  2ESW A;  1PSE A;  1FMK A;  4J6X A;  4GLK A;  3VU3 C;  2Z0W A;  3OSS C;  4XU3 A;  2KY9 A;  4Z88 A;  2IVW A;  3G4S T;  5GAM j;  1YJ9 A;  1UGS B;  3REA B;  1VQM Q;  1I5O B;  2QEX A;  2LZ6 B;  1X6G A;  2M16 A;  2RPN A;  1H3H A;  1Q81 C;  2DL4 A;  4OF1 A;  4BB7 A;  1Q82 R;  4IUU A;  1JB0 E;  1OYX A;  3MP8 A;  1MND A;  1R77 A;  2VKN A;  2VUB A;  2JM8 A;  1RI0 A;  4PFP A;  3VYG A;  1RAE B;  3OYC A;  1M2V A;  1BI0 A;  5LJ5 h;  2RHZ A;  3CCQ Q;  4C5I A;  1Q82 U;  3OYB A;  1E7O A;  1M9S A;  4A53 A;  2DIQ A;  3EG1 A;  2EJF A;  2GTO A;  3CC2 T;  1ZSG A;  2YRC A;  1FWZ A;  3QPH A;  4BD3 A;  5FU6 C;  4BAC A;  3JCM X;  2MAM A;  1QVG P;  3G6E Q;  4M7D E;  4JDS A;  3V7C A;  1WDX A;  1E6H A;  3TSW A;  1AEY A;  2E65 A;  1FMW A;  3PIP A;  1KD1 R;  1NJI C;  2XMF A;  5IAY A;  4QKU A;  1M90 R;  3HPW A;  3EHR A;  3OY9 A;  4JRK A;  4LXC A;  2HNI A;  5CO7 A;  2FRY A;  4PJJ A;  5KYU B;  3TVT A;  3CCU Q;  3NGP A;  1JXO A;  3M55 A;  4ESR A;  2E5K A;  5D6W A;  5GAN 5;  3VKI A;  4BI4 A;  1YIJ Q;  1E6G A;  4C8Q F;  1JJ2 S;  5GMK i;  1QVF S;  1NE8 A;  1RAA B;  3G6E A;  2OTJ A;  2JXB A;  4KH1 B;  3LWH A;  1YIT Q;  2LT4 A;  1KK7 A;  1R0B G;  2BZY A;  1VQN A;  5GMK h;  2KXC A;  1QVG A;  1BCO A;  3PMI A;  4LD9 K;  2YLC A;  3EG0 A;  5ECA A;  2EWN A;  4RKU E;  3M0R A;  2RHU A;  3CCS T;  2D9T A;  3HHT B;  2RNA A;  2EBP A;  1MMN A;  1Y57 A;  1TUD A;  1VQ5 T;  3P8B B;  3OYG A;  1X75 C;  2LX9 A;  2VB6 A;  5GAN 4;  1OU8 A;  2C0O A;  5A2Q E;  3M4G A;  2QEX Q;  4M77 B;  5GAN 8;  4OGC A;  4HCB A;  3QZ9 B;  4XTV A;  2X3X D;  5IHK A;  4L59 A;  2DRM A;  1JBM A;  1WFW A;  4PNO A;  4ELZ C;  2HBW A;  1KC8 C;  3VYH B;  1C1A A;  5CAI A;  4NL3 A;  2R57 A;  3BE3 A;  2AHJ B;  3CCE T;  1RI9 A;  4F16 A;  5A0L A;  3LGF A;  3AHU A;  3OYY A;  2BUD A;  5HY6 A;  2FPD A;  2DER A;  1KJW A;  2CDT A;  3M59 A;  2QYZ A;  2CRE A;  2LCC A;  2OTL A;  1BBZ A;  4FYX B;  4RG8 A;  2XD0 A;  1AZE A;  5GAO m;  4M78 D;  4Y28 E;  2OTL Q;  4OB1 B;  2ZPH B;  2CT3 A;  1S72 A;  3VS6 A;  4EIK A;  1Q86 C;  2AZV A;  1QCF A;  1KHC A;  3DKM A;  4M7A C;  5CR2 A;  4XTY A;  4M78 E;  4CC3 A;  5FRN A;  3URG A;  1UHC A;  1YFN A;  4E7K A;  4PJO D;  1KSW A;  2CP6 A;  2CKK A;  3CCQ T;  2EQK A;  4IUR A;  4Z8A A;  1SG5 A;  5KE3 A;  5KYN A;  3CPW S;  2G3R A;  3G1J A;  4C8Q A;  5GAN 2;  1UEC A;  1IXD A;  1D1A A;  4PJO F;  1ACM B;  1WXB A;  1KQS P;  5KYW A;  3THK A;  1JJ2 A;  3QZ5 B;  3OYK A;  2KSS A;  2KQW A;  5I2M A;  3MP6 A;  2LJ3 A;  5C0M A;  4FM4 B;  2SEM A;  3EGD B;  2EGA A;  1N9S A;  1WXT A;  2GFA A;  3QJY A;  4C0D B;  2DNU A;  5HCK A;  3EGD A;  2R5M A;  5CIU A;  4EMK B;  3I55 A;  2G6F X;  2BZ8 A;  2JS0 A;  1YI2 Q;  3I55 T;  2CUB A;  3A8G B;  2CP5 A;  2RI2 A;  1NLP C;  4ZTJ A;  1M2O A;  5LL6 S;  2RQU A;  2QTV A;  4RTW A;  4N4H A;  3CCV A;  3X20 B;  4RTY A;  1IZ6 A;  4KBM B;  2JNG A;  4BI3 A;  2O4X B;  4LDY A;  1VIE A;  2QA4 T;  5IHI A;  2YRV A;  4BUG A;  2HEQ A;  4M78 C;  5D6Y A;  3X24 B;  3HP9 A;  3L2R A;  4OMO A;  2KRO A;  3PNW C;  1TG0 A;  2K79 A;  5LJ3 d;  3L2Q A;  3R6O A;  1SHG A;  4M7A E;  2OTJ Q;  1D1C A;  3FEO A;  2Y4X A;  4J9H A;  1YBY A;  2EFI A;  2ZPE B;  4RUG A;  2A36 A;  1W1F A;  3CQT A;  2F2X A;  3M4Y A;  1SSH A;  3J7A F;  2K4Y A;  4J8O A;  1Q7Y U;  2LMJ A;  2EIF A;  1RAG B;  4EMK A;  4DQ2 A;  5GAM g;  4J83 A;  3C94 A;  2EKO A;  1R8O B;  4PJO C;  1VQ8 Q;  3X25 B;  3CEY A;  3QII A;  2A0F B;  5FRM A;  3RIR A;  2LJ0 A;  2QAZ A;  3FC3 A;  1RLP C;  1O75 A;  4ZNX A;  2PVG B;  4F04 B;  4K11 A;  4F7U A;  5LJ3 f;  2L3Q A;  1WJS A;  4QVC A;  3JB9 J;  4M7D D;  2P0Q A;  1TUC A;  2FL7 A;  2GQI A;  4M78 A;  1W4S A;  4JZ4 A;  3EGX B;  3G7Z A;  2QGF B;  1NEB A;  3GNG A;  3EFS A;  4C92 C;  1OX8 A;  2V1Q A;  1W2B S;  2BKD N;  5IN1 A;  3CC2 A;  4GY5 A;  4QQG A;  1WYX A;  1RAH B;  2RM4 A;  2P84 A;  1QMC A;  4C92 F;  4ME7 A;  2PZ1 A;  2ZPF B;  1TOV A;  1ZX6 A;  2V8J A;  3MET A;  9ATC B;  1NG2 A;  1VQP T;  3CXC A;  3QJ6 A;  2KYB A;  3EFO A;  3CD6 Q;  2B8A A;  2ZPG B;  4A4G A;  2HKN A;  2E6Z A;  2NUZ A;  2PUO B;  2HD0 A;  5J3B A;  2LRQ A;  1PSF A;  5KYX B;  5AT1 B;  4CC2 A;  2E10 A;  2KE9 A;  3OYH A;  1Y96 B;  2AKL A;  1NBE B;  2JM9 A;  5KYY A;  2JMA A;  1QQJ A;  2K3Y A;  3RMS A;  1Q81 R;  5GAO p;  1VQM A;  4E2F B;  2ZCF B;  5CKD A;  4FYY B;  2DO3 A;  1PRM C;  3LYI A;  3EFO B;  4C0D C;  2BE7 D;  2V8I A;  5LJ3 e;  1WQ7 A;  1YWO A;  1UEB A; 
#chains in the Genus database with same CATH homology
 1X6B A;  2PNI A;  4Z88 A;  1W70 A;  1WX6 A;  3REA B;  3EG3 A;  2LZ6 B;  3UA6 A;  1X6G A;  2RPN A;  1H3H A;  2DL4 A;  4GBQ A;  2MOX A;  3TSZ A;  4D8D A;  2DBM A;  2EVR A;  2K6D A;  2VKN A;  2JM8 A;  1JO8 A;  5FWB A;  3UF4 A;  2A28 A;  4IIO A;  2D8H A;  2CSQ A;  1ABO A;  4OMQ A;  1GFD A;  2YT6 A;  4HVV A;  2EYZ A;  2LQN A;  2KBT A;  3GBQ A;  4A63 B;  4AFU C;  2IIM A;  4QT7 A;  2PTK A;  2EYY A;  2O9S A;  2DL3 A;  1JXM A;  1E7O A;  1YNZ A;  3EG1 A;  2GTO A;  4LNP A;  4KRT A;  4HVU A;  1ZSG A;  1PRL C;  1VYU A;  2X3W D;  4CC7 A;  1T3S A;  2YDL A;  3M0P A;  2HDA A;  2GTJ A;  3VS1 A;  3VS7 A;  4J9I A;  4LN2 A;  1I0C A;  1AWW A;  2KT1 A;  1KFZ A;  2OI3 A;  1WDX A;  1B3Q A;  1E6H A;  1YCS B;  4LE9 A;  3VRY A;  3TSW A;  1AEY A;  2K9G A;  1UFF A;  1JU5 C;  2VVK A;  5IXB A;  2DL7 A;  1QLY A;  2EW3 A;  2J6F A;  1B07 A;  2XMF A;  5EC7 A;  4LUE A;  1ZUU A;  4AFQ C;  2JT4 A;  3EHR A;  1M3C A;  1GL5 A;  2KGT A;  2DBK A;  1M30 A;  2OAW A;  2DL5 A;  2FRY A;  4AG2 C;  1K4U S;  3UA7 A;  3TVT A;  3NGP A;  4OML A;  1JXO A;  4ESR A;  2E5K A;  1UE9 A;  2M0Y A;  2DM1 A;  1HJD A;  1MV0 B;  1UG1 A;  3O5Z A;  1ZLM A;  1E6G A;  3VS0 A;  2O9V A;  1W6X A;  1SHF A;  2K7A A;  3I5S A;  3EG2 A;  3FJ5 A;  2DL8 A;  1GCQ C;  3U23 A;  2L2P A;  2JXB A;  3NPF A;  4OMN A;  1X27 A;  1ZUY A;  2EGE A;  2KRM A;  2F2W A;  2JW4 A;  4FSS A;  2BZY A;  1NYF A;  2MIO A;  2KXC A;  4F14 A;  2LJ1 A;  2O2O A;  1WXU A;  1T3L A;  1I1J A;  3EG0 A;  2EYX A;  1MV3 A;  2HSP A;  4Y92 A;  1NM7 A;  5ECA A;  2L3S A;  1ZBJ A;  4JZ3 A;  3M0R A;  3PE0 A;  2EKH A;  1JQQ A;  1K76 A;  3M0Q A;  1AOJ A;  2K3B A;  2ECZ A;  1X2Q A;  2JTE A;  4JJB A;  1PHT A;  4J9C A;  1OPK A;  2EGC A;  1RLQ C;  1V1C A;  2EBP A;  2RNA A;  1UTI A;  2KT8 A;  1Y57 A;  2YUQ A;  1TUD A;  3NHN A;  3A98 A;  2C0O A;  2CSI A;  1JEG A;  5FWC A;  1YP5 A;  2ED0 A;  2LP5 A;  3VS3 A;  2KRN A;  2X3X D;  2DRM A;  3H0I A;  5IHK A;  1WFW A;  2DVJ A;  2YUO A;  1K0S A;  1BB9 A;  2HBW A;  2C0T A;  1M27 C;  4LUD A;  1ZUK A;  1Y0M A;  2DIL A;  2HCK A;  3M0T A;  1I07 A;  1RI9 A;  2SRC A;  4F16 A;  3VS4 A;  1YWP A;  1MUZ A;  2DYB A;  3SHW A;  2FPD A;  2CT4 A;  3ZL7 C;  1KJW A;  3VS2 A;  3VS5 A;  1H8K A;  2CDT A;  1PNJ A;  2ENM A;  2CRE A;  2CH4 A;  1RUW A;  1YN8 A;  2YUP A;  1BBZ A;  3H0F A;  2EYW A;  1VYT A;  1AZE A;  2GBQ A;  2CT3 A;  4HVW A;  3VS6 A;  4EIK A;  4J9G A;  2AZV A;  1G83 A;  2ROL A;  1QCF A;  4OMM A;  2W0Z A;  1SRM A;  3M0U A;  2JS2 A;  1UGV A;  4RTZ A;  3IQL A;  2OJ2 A;  4J9B A;  4CC3 A;  2BTT A;  4AFZ C;  1GBQ A;  1UHC A;  4HCK A;  1CKA A;  1NEG A;  1T0H A;  3SEM A;  4JJD A;  1KSW A;  2DA9 A;  2I0N A;  1AWJ A;  5GJW B;  2DLP A;  1NLO C;  4Z8A A;  1BU1 A;  2YSQ A;  2GGR A;  1M8M A;  2LCS A;  2FEI A;  1U06 A;  5IXF A;  1GCQ A;  3KFV A;  1HSQ A;  1UEC A;  1K1Z A;  3RBB B;  1SRL A;  2JMC A;  2B86 A;  3LH5 A;  1WXB A;  2VWF A;  5GJV B;  1K9A A;  3THK A;  1WLP B;  1WIE A;  2FRW A;  2YUN A;  2LJ3 A;  3QWX X;  1AZG B;  2A37 A;  3PVL A;  3I5R A;  2SEM A;  1VA7 A;  2EGA A;  1HD3 A;  2EPD A;  1WXT A;  1Z9Q A;  3JV3 A;  1PWT A;  3H41 A;  2DNU A;  2MCN A;  1EFN A;  4RTT A;  2L0A A;  1QKX A;  2L3P A;  5HCK A;  2J06 A;  1X2K A;  1SEM A;  3M0S A;  1S1N A;  2FG0 A;  2G6F X;  2BZ8 A;  2JS0 A;  2J6K A;  4DEY A;  1OEB A;  1U5S A;  2FPE A;  3C0C A;  1UHF A;  2CH4 W;  2FPF A;  2NWM A;  2CUB A;  2K2M A;  4F17 A;  1NLP C;  1CKB A;  5L23 A;  2QDL A;  4D8K A;  1G2B A;  2RQU A;  4RTW A;  2RN8 A;  2M51 A;  4RTY A;  2D0N A;  1XOV A;  2H8H A;  5IHI A;  1GRI A;  3RNJ A;  2HEQ A;  2W10 A;  1WA7 A;  4OMO A;  2KRO A;  1ARK A;  1TG0 A;  1AVZ C;  2K79 A;  1SHG A;  1UDL A;  4HXJ A;  4RTV A;  1M3A A;  4J9H A;  3CQT A;  2A36 A;  1W1F A;  4RUG A;  2F2X A;  2FO0 A;  3I35 A;  4CC4 B;  1SSH A;  1UJ0 A;  1IO6 A;  3I9Q A;  1J3T A;  1GFC A;  4E6R A;  2LMJ A;  1X43 A;  4ORZ A;  1H92 A;  4JPB W;  2A08 A;  2RF0 A;  2KRS A;  2GNC A;  1X69 A;  4DEX A;  4Z89 A;  1AD5 A;  1CSK A;  2J05 A;  2RQT A;  1QWF A;  3H0H A;  4JJC A;  1GBR A;  4AFS C;  5FW9 A;  2LJ0 A;  4GLM A;  1RLP C;  4ZNX A;  1QKW A;  2KEA A;  2KXD A;  2AKK A;  5IHN A;  4K11 A;  4AG1 C;  2J7I A;  1K0X A;  1BK2 A;  1UUE A;  2L3Q A;  3EGU A;  2DJQ A;  2DRK A;  1KIK A;  2RMO A;  1OPL A;  1TUC A;  2GQI A;  4JZ4 A;  2KYM A;  4R0K A;  1OOT A;  1NEB A;  1PKS A;  3EHQ A;  2F2V A;  2V1Q A;  3NMZ C;  1NYG A;  4M4Z A;  1AWO A;  3REB B;  2C0I A;  4WCI A;  1LCK A;  1M3B A;  2DF6 A;  2DMO A;  1WI7 A;  1WYX A;  5I11 A;  3PVQ A;  1GCP A;  3ULR B;  2PZ1 A;  2DX1 A;  1ABQ A;  2V1R A;  2KNB B;  2O88 A;  1PKT A;  1UJY A;  1ZX6 A;  1T0J A;  1VYV A;  2RQV A;  1NG2 A;  2LQW A;  2P4R A;  2ABL A;  4J9D A;  2D8J A;  2EQI A;  2KYB A;  3VRZ A;  2J6O A;  4J9F A;  4OMP A;  1Z9Z A;  3QWY A;  2AZS A;  2NUZ A;  3R6N A;  4IIM A;  4RTX A;  2DE0 X;  2RQR A;  2LNH B;  1QWE A;  4X1V A;  2D1X A;  4J9E A;  4CC2 A;  2KE9 A;  1AWX A;  2KR3 A;  5IH2 A;  2AKL A;  2O31 A;  3UAT A;  2JM9 A;  1U3O A;  2ED1 A;  2JMA A;  5I22 A;  1SPK A;  2RQW A;  1N5Z A;  4RTU A;  1A0N B;  2BZX A;  2LX7 A;  1OV3 A;  1PRM C;  2ESW A;  1FMK A;  2ROT A;  1FYN A;  2CUD A;  2AK5 A;  1YWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...