2DILA

Solution structure of the sh3 domain of the human proline-serine-threonine phosphatase-interacting protein 1
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
69
structure length
69
Chain Sequence
GSSGSSGAQEYRALYDYTAQNPDELDLSAGDILEVILEGEDGWWTVERNGQRGFVPGSYLEKLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SH3 domain of the human Proline-serine-threonine phosphatase-interacting protein 1
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Proline-serine-threonine phosphatase-interacting protein 1
total genus 5
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dilA00
2KT1A 2OAWA 2YUQA 1ZUKA 1KFZA 2P4RA 2K6DA 1W1FA 2FPDA 2J6FA 3I5SA 2JMCA 2LQNA 1A0NB 2LQWA 1UG1A 2EPDA 2J6KA 2DL7A 4A63B 2KGTA 2A37A 1OPKA 4IIOA 1E7OA 2SRCA 4RTTA 2CSIA 2JM8A 3VS1A 1UJYA 2J05A 1OPLA 4K11A 2O9VA 3RNJA 1XOVA 1JEGA 1YP5A 1GBQA 2ED0A 4ORZA 1ZUYA 1TG0A 4RTXA 1ZSGA 2NUZA 2H8HA 2RN8A 2RQVA 4AFZC 4JZ3A 2RQTA 2SEMA 2FG0A 2LJ0A 2DNUA 2J6OA 2K3BA 4CC7A 1WXBA 1X6GA 2AK5A 2YUOA 5IHKA 2AKLA 1I0CA 1SEMA 2YUPA 4AG1C 2X3WD 4OMQA 2MOXA 1JU5C 2PTKA 2FPFA 1SHFA 1G2BA 2J7IA 4WCIA 3KFVA 3RBBB 1B3QA 3JV3A 4AFSC 2C0OA 3A98A 1AD5A 1AWOA 1PRLC 1ABOA 2DE0X 1QWFA 2A36A 1ARKA 3H0HA 2C0IA 2L2PA 2IIMA 2RF0A 1WA7A 1WX6A 1KIKA 1VA7A 1UJ0A 1VYUA 1ABQA 1HSQA 1T3LA 2DILA 5IXBA 2JS0A 4Z89A 2ED1A 2EYYA 1UUEA 1NLPC 2VKNA 2X3XD 2QDLA 2ROTA 2BTTA 2M0YA 1H92A 3VS0A 2LCSA 2DL8A 4J9DA 1Y57A 2FEIA 3VRZA 2RNAA 4RTWA 4CC4B 5IXFA 2F2VA 4J9GA 2KRMA 3UF4A 2KYBA 3M0PA 1QKWA 1M30A 2AZVA 4RTVA 2HDAA 4QT7A 3VS6A 2LP5A 1J3TA 1B07A 2K79A 1BB9A 4HVWA 2YT6A 1AVZC 2D8JA 4CC2A 1TUDA 4EIKA 1EFNA 2PNIA 5HCKA 4F14A 3IQLA 2LZ6B 3M0SA 3C0CA 2LNHB 2BZXA 3EHRA 2RQUA 4J9EA 1PKSA 1CSKA 2BZ8A 1RLQC 2CUDA 2D0NA 3M0QA 3VS7A 2RQRA 1ZX6A 4DEXA 3QWXX 2A08A 3I35A 4LN2A 1WDXA 3NMZC 1K0SA 4X1VA 4ESRA 3REBB 3M0RA 1PNJA 4RUGA 2O88A 2D1XA 1K4US 3NGPA 1HD3A 3TSZA 1GCQC 1JXOA 3I5RA 2DM1A 3EG0A 3EG1A 1RLPC 2JMAA 2ROLA 2K9GA 2EYZA 4M4ZA 1BK2A 1I07A 1GCQA 3M0TA 5I11A 2DMOA 4R0KA 1NYGA 3SHWA 2FO0A 3VS3A 1W6XA 2PZ1A 4GBQA 2EYXA 2W0ZA 1X69A 2JT4A 5FWCA 2I0NA 2L3QA 2BZYA 2YDLA 1TUCA 2OI3A 1YWPA 4JPBW 2LJ1A 4J9IA 1AZEA 1QLYA 1I1JA 4HCKA 2EVRA 1K1ZA 1X6BA 1UECA 1YWOA 1KSWA 3PE0A 3UA7A 1E6HA 4CC3A 1IO6A 1PKTA 1WXUA 4LNPA 3FJ5A 2HCKA 1T0HA 1ZBJA 1WLPB 1H3HA 2CH4A 2G6FX 3H0IA 1FYNA 2CREA 2O9SA 4JJDA 1PWTA 2F2WA 1RUWA 2ECZA 3EGUA 3VS2A 2JW4A 4JJCA 4J9CA 3PVLA 2CH4W 3H41A 1GFDA 2L0AA 5FW9A 1NEBA 3NHNA 4HXJA 1WI7A 4LUDA 1H8KA 1OV3A 1UHCA 1QKXA 1NLOC 2VVKA 2E5KA 1LCKA 2K2MA 1K9AA 1ZLMA 2NWMA 4DEYA 2EKHA 1GRIA 3EG2A 3I9QA 2GTOA 3M0UA 2GBQA 1AOJA 2EBPA 1NYFA 2LX7A 1K0XA 3SEMA 3H0FA 1YCSB 1UTIA 1T3SA 5L23A 1V1CA 1E6GA 4JJBA 3THKA 2FPEA 4KRTA 1GBRA 4F17A 1VYVA 2JS2A 5FWBA 4J9HA 3VRYA 1M3CA 3R6NA 1SRMA 2DVJA 4D8DA 2DYBA 1GCPA 1BU1A 2EGCA 5IHNA 1AWWA 2V1QA 2FRYA 2KNBB 1X27A 2L3SA 2KROA 1X43A 2HSPA 1WIEA 2DLPA 1JQQA 1M3AA 5I22A 1ZUUA 2LJ3A 3TSWA 2DL4A 2KYMA 1M3BA 2EGAA 1Z9QA 5EC7A 2ENMA 5GJWB 3EG3A 2CDTA 1NG2A 2RPNA 4HVVA 1YN8A 1PRMC 1K76A 4ZNXA 2GTJA 2EQIA 1GFCA 2CSQA 2RQWA 3PVQA 1U5SA 1FMKA 2DRKA 4AFUC 2F2XA 2KE9A 1WFWA 1OOTA 4RTUA 2ABLA 2KEAA 5IH2A 4OMOA 2W10A 2ESWA 2DJQA 5IHIA 4HVUA 1X2KA 4F16A 2EYWA 1MUZA 1UDLA 4Y92A 2KRNA 2CT4A 4GLMA 4J9FA 1NM7A 1Z9ZA 5ECAA 2OJ2A 1AEYA 1RI9A 1S1NA 1BBZA 2K7AA 4RTZA 1JO8A 2DBMA 3EHQA 2O2OA 3LH5A 4AFQC 4OMLA 3ZL7C 4D8KA 2HBWA 1SPKA 4LUEA 2C0TA 1QCFA 2GNCA 4FSSA 1HJDA 2JTEA 1OEBA 1M8MA 4RTYA 1NEGA 1PHTA 1UHFA 2AZSA 2DBKA 2KBTA 2GGRA 3REAB 1CKBA 2J06A 1T0JA 2DL3A 1WYXA 4E6RA 1UGVA 4Z8AA 3VS4A 2B86A 1M27C 2O31A 1AWXA 2CUBA 3UA6A 1VYTA 4OMMA 1X2QA 2EGEA 1SSHA 2L3PA 3NPFA 1CKAA 2KT8A 1UFFA 2YUNA 2CT3A 4LE9A 2D8HA 1U06A 2JXBA 1G83A 2XMFA 1WXTA 4Z88A 2KR3A 2YSQA 3ULRB 2JM9A 1AZGB 1MV0B 2M51A 1UE9A 2DRMA 2DF6A 3TVTA 5GJVB 3QWYA 2DX1A 1SRLA 2GQIA 2LMJA 4JZ4A 2EW3A 1AWJA 1N5ZA 1SHGA 1U3OA 1YNZA 4OMPA 1GL5A 1Y0MA 4IIMA 2RMOA 2KXCA 2DA9A 2HEQA 1MV3A 2FRWA 3CQTA 3VS5A 2KXDA 4J9BA 3O5ZA 1QWEA 4OMNA 3U23A 4AG2C 3GBQA 1KJWA 2VWFA 2V1RA 3UATA 2MIOA 2A28A 2DL5A 1JXMA 2AKKA 1W70A 2MCNA 2KRSA
chains in the Genus database with same CATH superfamily
1TU0B 2KT1A 1YITQ 1KFZA 4IUTA 2K6DA 2K5LA 2FPDA 2JMCA 2LQNA 3G71T 5GAOq 3L2ZA 4A63B 2KGTA 1OU8A 1VQ7Q 2A37A 5I21A 4RTTA 2SRCA 1M5Q1 4B9XA 4C92C 3H6ZA 1K73U 4PJOG 3RNJA 1GBQA 5D7UA 1C0MA 1TG0A 1X01A 2GCXA 1BKBA 3M4GA 2FG0A 2P4TA 2DNUA 1Q86C 1JB0E 4J83A 2R5MA 1SEMA 1VQNQ 2YUPA 4AG1C 1C6VX 2K3YA 2PVOB 3G1JA 2PTKA 3A1PA 6AT1B 4O6JA 2R5AA 1B34B 4JLIA 4CI0C 3ER0A 1MGQA 3RBBB 1B3QA 4AFSC 3I55Q 2C0OA 1D09B 2L2PA 2RM4A 2RF0A 4M75E 4M7AB 3PIPA 2FVUA 2K2VA 2BE7D 1KIKA 1VA7A 4M78C 1T3LA 3NFCA 5IXBA 1ZSZA 4PJOF 5J39A 3AT1B 3UDCA 2ED1A 2EYYA 2VKNA 3HKSA 1VUBA 1TH7A 2QDLA 2ROTA 5IN1A 1RAGB 1JRIA 4EDUA 3VS0A 1NJIU 2LVMA 1OU9A 4MMKA 2CP0A 1IB8A 1TXQA 3UPUA 3JB9D 2PU9B 1VIEA 2M0OA 3M0PA 1M30A 4Q5WA 2LP5A 4M78F 3BE3A 1B07A 4M78B 4OP0A 4QQGA 3KXTA 2PNIA 4HCBA 5KYXB 5GAMd 2BZXA 3EHRA 5GAMh 4J9EA 4GY5A 3CCLT 1AT1B 2ZPHB 2D0NA 2R57A 4MZTA 3M56A 2RQRA 3DB4A 1MMAA 1ZX6A 2A08A 2DFUA 1W2BP 1QP3A 1TTHB 1WDXA 3LWHA 2CP6A 1VQLQ 2V26A 3S3OA 2YHTA 4BD3A 1YHQT 4KUIA 3I5RA 2HMAA 2M16A 2JMAA 5D6WA 2K9GA 2NLUA 1I8FA 1VQLT 2DVEA 4UC4A 1ZQ1A 4MZPA 3GP8A 3SHWA 3V7RA 2PZ1A 4GBQA 1YITA 2W0ZA 4PNOA 2F5KA 4ELYC 3HPWA 4DQ2A 5FWCA 3JB9F 3P8BB 3HRUA 3RMQA 3M5AA 5GAOr 2LJ1A 1AZEA 4HCKA 4OF1A 1YWOA 1UECA 4PJLA 3PE0A 1KHIA 4YTLA 2QQ9A 3JCMg 1IO6A 1OULA 3MEVA 3FJ5A 4XU3A 2HCKA 1T0HA 5LJ5f 2COWA 1Q82R 4EMGA 1KQ1A 1H3HA 5LJ3d 4F7UG 1FYNA 1VQMT 4ANJA 2EQUA 2GFAA 4JJDA 1R77A 4WF2A 4M78A 2DJZA 2QEXA 1NJIC 1PM3A 3G71A 2HBPA 2ECZA 3EGUA 3V7CA 5KYYA 2M1HA 1B34A 4C8QD 2WSEE 2CH4W 3H41A 4XU0A 2IG0A 2LRQA 3P8HA 4O5VA 1D0XA 4RCCA 3J81E 1ACMB 1IREB 2MYSA 4FU6A 2RK1A 5GAOm 2KSSA 3CXCS 3OW2S 2K2MA 1P92A 3G6EA 4C5IA 4DEYA 2EKHA 3CCQT 3EG2A 4LDYA 1UEBA 2HAXA 2GBQA 1AOJA 1N9SA 1RAAB 1FX7A 1LJOA 3H0FA 4KGVB 3ASKA 4GLKA 5L23A 3CD6A 1QQJA 4NL2A 2CZ6B 4J7FA 4FSXA 2XIDA 4E7ZA 4M7DD 2EYQA 3VRYA 4E7IA 2DXBA 1KD1U 1W4SA 5KE3A 1TUGB 3R6NA 3OYKA 1SRMA 3PIOA 2XKOC 1VOMA 2X4JA 3INZA 1KG1A 4D8DA 1Q7YR 2CGHA 4JS5A 3OMCA 2FL7A 2FRYA 3ZEHA 1VQ7T 1WPYA 2OX7A 3HSBA 2JN0A 4C92D 1WIEA 5CKBA 2VXEA 2FZGB 2D0QB 4QW2A 4FYYB 5GJWB 3JB9H 4XAXB 4LD6A 5CK9A 3RR6A 1YN8A 1VQKT 2ZPFB 5KCOA 2K4YA 3VUZA 4PFZA 2RD1A 5GMKi 1FWZA 2P0KA 2EQIA 1GFCA 1MHNA 2CSQA 3PVQA 4BDYA 3FC3A 4M7AF 2DZCA 3URGA 2BUDA 1NPRA 2GQVA 4JRKA 4FYWB 3M4YA 3H8ZA 4HVUA 3RERA 4OB1B 3CCUT 3JCMe 2JUFA 2NUTA 4F16A 2EYWA 5GMKm 4KGZB 3JCMV 2QASA 2KI7A 3C4SA 1RABB 5ECAA 2KAFA 3CCVQ 1VQPQ 1IHVA 4ME7A 1VQPA 4M7AC 2A7YA 3KUFA 2VGNA 1IZ6A 1JO8A 2DBMA 4AFQC 2O2OA 5IAYA 1RACB 4LXCA 1M8VA 2HD0A 1WJQA 2E6ZA 3CCMT 3QBYA 2GNCA 1HJDA 1BCOA 2JTEA 2V8JA 1KC8R 4OB0B 3EFOA 3ME9A 3PT9A 2RJFA 1PHTA 1IRXA 1UHFA 3V8KA 4XTYA 2XD0A 2DBKA 2R58A 2KBTA 3NTKA 3REAB 2K5FA 4JJNK 4PJOC 2DL3A 4QQDA 3CMAT 2NYSA 3GIBA 1M27C 5C6SA 3PNWC 4M7DE 4E7HA 3S3NA 1X2QA 2EGEA 2H3EB 2DK3A 3NPFA 2KT8A 4XTZA 3MP1A 1GXIE 2CT3A 4N4HA 4C8QG 1YJ9Q 1OI1A 2JXBA 1YJ9A 1IGQA 2XMFA 4Z88A 3GPLA 4MDWA 1QVFP 1I5LA 1B7TA 2JM9A 5LJ3g 3BDLA 2L3RA 1KD1R 3CC4A 1VQ4Q 2P0QA 3PFSA 4OB3B 2GQIA 2LMJA 1JJ2A 2PQWA 5IT9E 3L2QA 1MV3A 2CKKA 2KXDA 3EFRA 1QWEA 3EGXB 1VQ4T 4V2SA 3HHTB 1F1BB 1KJWA 1X75C 2LDMA 2K57A 3QSUA 3SD4A 3LX7A 1YI2T 2A28A 4C5HA 5KYYB 1VQKQ 2IVWA 1VQ5A 1QVGP 2MCNA 3HRTA 3QDFA 4M75A 2KRSA 5GANd 4C8QA 2YUQA 2P4RA 2H3JA 2RI2A 2EQKA 3M57A 1A0NB 8AT1B 4D6WA 2P0PA 1BI3A 3PTAA 3I55A 3CCJA 3VS1A 2JM8A 3HRSA 2OTJA 1YP5A 2JJ9A 2MPXC 1MNDA 3QUIA 1G3SA 4RTXA 1I81A 1WZOA 2MMPA 2HQXA 4EMKA 4JZ3A 2K3BA 3E2UA 1EX4A 1X6GA 2AK5A 3G6EQ 2F1LA 1I0CA 1XTDA 4B9WA 4OMQA 2F5TX 4X9CA 2X4XA 3OYDA 1BI0A 3FDRA 3X24B 4CRIA 5CKFA 3TQ7P 3DLMA 2A36A 3FJPA 2B8AA 1LNXA 3QJYA 4J6YA 3CMET 5D6YA 2O01E 1M90R 5KCHA 1D1BA 1UJ0A 1Q81R 1PC0A 4C0ZA 4N0AC 2E1HA 2NUPB 5HK3A 4MMLA 1SSFA 3X26B 2M0YA 1VQ5T 1Y57A 1VQ6T 2LTOA 3CBOA 2KRMA 1QKWA 2AZVA 4RTVA 5KYUA 4QT7A 4BE1A 1VQKA 2P84A 1XQHA 1WHKA 3SB2A 4QKUA 2YT6A 1TUDA 2QAZA 4EIKA 1Y71A 5HCKA 1QVFA 2O4XA 4M7DA 3JB9I 3M0SA 3C0CA 3A5ZB 2JTMA 3SWNA 3OYNA 4KH1B 2RK2A 2RQUA 4ZN1A 2DERA 1CSKA 1YJNT 2L5QA 4A4GA 3CCSQ 5GAOp 4DEXA 4F7UF 5GAN7 3VU3C 3A8MB 2QQSA 2KVQG 3EG9A 4LN2A 3NMZC 4FT4A 1K0SA 3MP6A 3OY9A 3RIRA 1YI2A 4DBFA 4M77B 2ZAEA 1HYOA 2I2LA 3OW2P 1K4US 5GAMj 1Y96A 4EMHA 3JCMd 1GCQC 1JXOA 4ZN3A 2DM1A 3EG0A 1EZZB 2ROLA 2EYZA 4KBMB 4M4ZA 1GCQA 1O75A 2KQWA 3M0TA 4ZTFA 3LH0A 3OS1A 5I11A 3HL8A 4C92A 1Q81U 2FO0A 3VS3A 3CCQA 3NTHA 1ZA1B 2V8IA 2CYZB 3HFOA 2DIQA 3TREA 2I0NA 1RAEB 3DB3A 5CO7A 2OTLA 2O4XB 3CCLQ 1QLYA 1I1JA 2HKQB 2HSEB 3UA7A 5LJ5g 3JB9G 5KYWA 1WQ7A 1PKTA 3M54A 1ZBJA 2G6FX 3E9GA 1UGSB 5FRNA 1M2VB 1FMWA 2QK0A 1Y96B 4FYXB 3LW5E 2G3RA 3OMGA 1QVFS 1PWTA 4FIBA 1QVGS 4C8QC 3VS2A 3G4SQ 4JJCA 1PSFA 3MO8A 2XU8A 3V8LA 3PVLA 2KMTA 2PVGB 1GFDA 1QW1A 2L0AA 3J7AF 2ZCFB 3T9NA 2E64A 5A2QE 2BIVA 2LT4A 1G3WA 1UHCA 1QKXA 5GMKl 1LCKA 3SWNB 2CP7A 3QIIA 3BW1A 3OYGA 2GTOA 3M0UA 3EG9B 1VQ4A 4B6MA 3EH1A 2EAYA 3CC2T 5LJ3e 1T3SA 1D3BA 1RAFB 5CKEA 3CCJQ 1V1CA 1JJ2P 2WSCE 4JJBA 2CZ7B 2D6FA 3CC2A 4EMKC 1Q82U 4XTVA 1G3TA 5CIUA 4EMKB 2JS2A 1WHGA 1UGRB 5FWBA 1NBEB 2QA4T 1QVPA 3OW2A 2D9TA 2LCLA 2EWNA 2Z0WA 2DVJA 2DYBA 1K9MC 1GCPA 1BU1A 1UB4A 2RB6A 2RHYA 1AWWA 2V1QA 4F04B 1X27A 2L3SA 2KROA 3CXCP 3OYCA 3OBWA 3EGDA 3G71Q 4Y91A 2MWPA 4PLIA 1M3AA 1ZUUA 2OTJQ 2LJ3A 3VJPA 3LLRA 1QMCA 2HQEA 4HA8A 3JCMQ 2XDPA 4JRPA 1EIFA 1K8AU 2DTOA 3M55A 4JUVA 4BI3A 2AIRB 4IURA 5EC7A 2BE9B 4C8QB 1PRMC 1Q7YU 3E19A 3QYHB 4PKCC 3MEAA 3EAEA 2CZ1B 4DOWA 4RG8A 4E7SA 2C06A 1FMKA 1VQPT 1WFWA 1OOTA 4RTUA 5IH2A 1WGSA 3OYBA 4OGCA 2ESWA 3GNFB 2Y4XA 2CP2A 1X6OA 4FM4B 4AT1B 2CS7A 5A0LA 4JLGA 2CT4A 2X4YA 1M1KR 1NM7A 3OYAA 1RI9A 1YBYA 1BBZA 3JCMb 1XNIA 4C0DB 4OMFB 2PUKB 4D8KA 1SPKA 3CCSA 1H641 3LWIA 3JB9J 3MJXA 2K3XA 5GAMe 4FSSA 4C92E 1OX9A 3UT1A 1OEBA 4DA4A 3JSCA 1VQLA 1TSFA 4RTYA 1NEGA 2AZSA 2EJGA 4C92G 5L8RE 2QGFB 4VUBA 1UGVA 3RUXA 2E70A 5LJ5e 2O31A 3JCMc 1AWXA 1BIAA 5LJ3h 3OBYA 1NZ9A 5I2MA 4FYVB 1SSHA 1R0CB 3RMSA 2YUNA 2YLCA 3C12A 1U06A 3CPWS 1G83A 1RAHB 1WXTA 2COYA 3GLXA 2JOYA 3ULRB 1Q86U 2K5IA 3CCVA 3GF5A 1M2OA 1MV0B 4XU1A 2M51A 1UE9A 2DRMA 3TVTA 3QWYA 2DX1A 5GANe 2YWWA 4L6V5 4M7DF 4IUQA 2EW3A 1AWJA 1N5ZA 1YNZA 2EIFA 4IIMA 3VS5A 1G8XA 2KXCA 2FRWA 4E7JA 2CZ0B 3I56Q 2HZYA 3DKMA 2RA2A 1IXDA 1R0BG 3M59A 3WVEB 4C0GA 2VWFA 5DLQE 1Q7YC 3UATA 4PJMA 2MIOA 3CMEA 1JXMA 4C0DC 2AKKA 1RAIB 2NUPA 2QGGA 3TEEA 4II1A 4A4EA 2X9HA 5GANh 1SF9A 3CCST 1KHCA 1W1FA 1WHJA 3I5SA 2OTLQ 1D0ZA 1VQ8Q 1W2BS 4IKFA 2LQWA 2EPDA 1N8RC 1OPKA 1N27A 4C8QF 4K11A 2O9VA 1JEGA 1XOVA 2VUBA 1YITT 4JRQA 1Q82C 2ED0A 3OB9A 4ORZA 5AYFA 1ZUYA 1N6AA 3BFMA 2H8HA 2RN8A 2RQTA 2SEMA 2J6OA 3CCMQ 1U8RA 4DBHA 1WXBA 2YUOA 2ZGWA 2RJDA 4PK4A 1R8OB 1M1FA 2X3WD 4XTXA 2MOXA 1WQWA 3CD6Q 2LQKA 4MDXA 3PMTA 2FPFA 2MAMA 4A53A 1Q86R 1OQKA 3MEWA 3RESA 2J7IA 3A8OB 3G4SA 3JV3A 3A98A 1ABOA 2DE0X 2DTIA 3FEOA 2QG9B 1QWFA 1ARKA 2C0IA 3JCMX 1PD0A 2DKGA 2HL3A 5LJ5d 2E12A 3I55T 4XQ3A 9ATCB 5HKCA 1ABQA 2DILA 2JS0A 2ZPBB 4KH0B 4KUDK 4BDZA 4M7AD 3J80E 2BTTA 1H92A 3L1AA 2LCSA 2DL8A 2M02A 4J9DA 2CP5A 3CC7T 4M7AG 3RDVA 2FEIA 2JZ2A 3VRZA 2RNAA 4RTWA 5IXFA 2F2VA 3UF4A 2KYBA 2JVVA 4N4IA 2MI6A 3FRNA 2K79A 3E1SA 1TOVA 2D8JA 4CC2A 2RH2A 3JAME 4RCBA 4F14A 3FIFA 4PJNA 3EH2A 3C95A 1D1CA 2BZ8A 1RLQC 2VYTA 3CCQQ 4PLLA 3VS7A 4ZGEB 4N4GA 4C8QE 1JJ2S 3I35A 1QCNA 2DEQA 2MK5A 1VQ6Q 4PJJA 3MPUB 1O9SA 2ATCB 4M78D 1YIJQ 1PNJA 3OYHA 4QVCA 2D1XA 4A4KA 3TSZA 3EG1A 1RLPC 3BDUA 4J6WA 1BK2A 3EGDB 1VQNT 3F70A 5GAMf 1VQMA 1VQMQ 1NYGA 1YFNA 4PJOD 4J5YA 5LJ5h 4LD9K 2FHDA 1OYXA 2EYXA 2Y90A 4PFOA 5M9OA 1S72A 3VYGA 2L3QA 2BZYA 2YDLA 1TUCA 2OI3A 2QYZA 2E10A 4JPBW 3CCEQ 4J9IA 3TU4K 3HP9A 1K1ZA 3OSSC 1KSWA 5CKHA 2OTLT 3RKYA 5DM7R 4CC3A 2DO3A 4M75G 4BE0A 4M7AE 1WXUA 1N9RA 4M78G 2QTVA 2FZKB 2CH4A 1YI2Q 1UGPB 3CC4Q 2KK4A 2DYIA 1SKUB 5LJ5j 2VGMA 1RI0A 2O9SA 4ZTJA 2F2WA 2XICA 3M58A 3OSVA 4FW1A 3CC2Q 3PGGA 3I56A 5GAOl 1MMDA 1ZSZB 5CAIA 1ZSZC 2HL5C 3QHSA 1KC8C 2AHJB 4DBQA 5FW9A 1M2VA 4OVAA 3NHNA 2FZCB 4RKUE 3O8VA 1WI7A 4F7UA 4LUDA 5CQYA 5CQXA 1LOJA 1LVKA 1H8KA 3CCRT 3HFNA 1NLOC 3JCMf 3MKDA 1K9AA 2NWMA 3CPFA 2E65A 1H3ZA 3CCLA 1K9MU 2EBPA 4A4FA 1NYFA 2LX7A 3SEMA 3D7SB 1YCSB 1UTIA 1VQNA 4DOVA 4OGEA 3JCMJ 1WHHA 5GANg 3QG1A 4KRTA 1GBRA 4F17A 1VYVA 5FRMA 4J9HA 4MZMA 2DZ9A 1M3CA 1YJ9T 2LQ8A 5C0MA 1KQSP 4M75B 3RKWA 1S72Q 5HK0A 1X43A 5GMKe 3OYLA 4FL6A 2YRDA 3V8JA 1YJNA 3OYYA 2DLPA 4IUVA 4QVZA 4PJOE 1C1AA 1PG5B 5GAOn 3CCUA 1YJWQ 4C5EA 1M4ZA 1Y7XA 2ENMA 1V76A 2V8KA 2CDTA 5GANj 3FB9A 1VQOQ 2RPNA 3OQ5A 3FLGA 2QA4Q 1VQOA 2DTHA 5EG2A 3CXCA 3LGFA 4M78E 3WVDB 5GANf 2EJ9A 4Z02A 3H9NA 1U5SA 2RJCA 2QQBA 2DRKA 2F2XA 2DD5A 2KE9A 2QI2A 4FW2A 4QVDA 2ABLA 2KEAA 4OMOA 3C94A 5LJ3f 2YRVA 3MP8A 1X2KA 4BI8B 5KYUB 4RMOA 1MUZA 2XDBA 4Y92A 2KRNA 1Q81C 4J9FA 1AEYA 1S1NA 3QZ9B 5J3BA 4KGXB 4LDUA 1UGQB 2K7AA 3AHUA 5GAN6 3LH5A 1S72T 5D6XA 4QQ6A 3OA6A 4LUEA 1VQOT 1WJSA 2RJEA 1XJWB 4J8OA 2XK0A 2EKOA 1BI2A 1VQ6A 1PCXA 1PD1A 1M8MA 3CBPA 3S6WA 2J06A 1D1AA 5A0GA 4E6RA 3VS4A 2B86A 4M77A 1OZ3A 2QXFA 2XG8D 4C0FA 3LYIA 2E5QA 2CUBA 3WXMB 2X35A 1VYTA 3UA6A 5FLXE 2EJFA 1LPLA 4IUPA 3CCVT 3M9QA 3CMEQ 1CKAA 2DETA 4LE9A 3CCUQ 1YJWA 1KD1C 1TS9A 5KYWB 2KR3A 2VB6A 2YSQA 4M7DB 5KYXA 1VQ8A 3OYFA 4M75C 3CCEA 3SFMA 3OS0A 1IGUA 5KH6A 3CPWP 1OX8A 1U3OA 4OMPA 1SHGA 2RMOA 2DA9A 2HEQA 4PL6A 3O5ZA 4J9BA 1YHQQ 4HKEA 1Q95G 2LC4A 3G6ET 2PUOB 1KC8U 2F69A 5DY9A 4R55A 1K9MR 4M77D 4A54A 4BACA 1VIFA 1PSEA 2MWOA 1HK9A 2OAWA 1TWBA 3OYMA 4M75F 1ZUKA 2OTJT 3EFOB 1YJNQ 2J6FA 3MHXA 1UG1A 2E6NA 2AT1B 2DL7A 2J6KA 3KBGA 4IIOA 1WNLA 1E7OA 2CSIA 1UJYA 2DAQA 2J05A 1OPLA 4BUGA 5DLOA 4M77G 8ATCB 5CCAA 2QDYB 4NS5A 1V29B 3VYHB 1ZSGA 2NUZA 4X9DA 4WTOB 2RQVA 3PMIA 4AFZC 3JCMP 2LJ0A 3VUBA 1W2BA 1D0YA 4CC7A 5IHKA 2AKLA 2NUTB 3HTRA 4AMCA 2XDDA 2L8DA 1ZHIA 1JU5C 1NJIR 2CP3A 2FB7A 4OB2B 5CKDA 1SHFA 4JS4A 1G2BA 1KK7A 4HT8A 4FCYA 4WCIA 3KFVA 4R56A 1AD5A 1AWOA 1PRLC 5HY6A 1M1GA 4HCCA 5GAN8 1NE8A 3H0HA 5GAN3 1K8AR 2IIMA 4ZGDB 4ELZC 4C5GA 1WA7A 1G5VA 2E41A 1ZA2B 1WX6A 1QVGA 1VYUA 3EFSA 1KQSS 1HSQA 2DXCA 4Z89A 2ZZDA 1UUEA 1NLPC 1M90C 4J6XA 2YRCA 2DXTA 2X3XD 1BIBA 4KULA 2RHZA 4CC4B 4LDXA 1BYMA 4J9GA 3EGXA 3CC7A 3QPHA 2QA4A 4ZGJB 2HDAA 2XHCA 3META 3VS6A 3JCMW 1YJWT 1J3TA 5LL6S 3A8GB 1BB9A 4HVWA 4XTWA 4M7DC 3X28B 4ATOA 1AVZC 1EFNA 2RO0A 3IQLA 2LZ6B 2VC8A 2WSFE 2LNHB 5GMKh 4RG2A 4PFPA 3CCJT 1M1KU 4BB7A 1VQ8T 3L2RA 2JTFA 1PKSA 4IUUA 4M77E 3X20B 4E7LA 2CUDA 3M0QA 2GF7A 2WACA 3SDZA 3Q1JA 3CPWA 1RL2A 3CMAA 4NOYA 3QWXX 3VKIA 3CCRQ 2EQMA 2GFUA 4E7KA 4KT0E 2RI3A 4X1VA 4ESRA 1FXXA 3REBB 3A8LB 4X34A 3M0RA 4RUGA 2O88A 1U1TA 3I56T 3NGPA 1HD3A 2ZPEB 2M9UA 4BE2A 5FU7B 2IPOB 5GAN2 1JBMA 3R6OA 3A8HB 1I07A 1YCYA 4E47A 4BY6B 2DMOA 4HCZA 3OS5A 1YIJT 2QTXA 4R0KA 3QZ5B 1WHMA 1W6XA 3L2UA 1I5OB 2YLBA 1X69A 2JT4A 3SWNC 5GMKj 3UWNA 3G4ST 7AT1B 1FMVA 1Y07A 1YWPA 1WJRA 2XI9A 1VQ7A 5I2SA 1X6BA 2EVRA 3CEYA 1VQ9A 1E6HA 4M7DG 4JRIA 1KQSA 3QKJA 4LNPA 5J26A 2HQHA 1M9SA 1WLPB 3H0IA 3X25B 3CC7Q 2DXUA 2CREA 1VQ5Q 2DPPB 2X4WA 1KQ2A 2E3HA 5FU6C 3JCMh 1RUWA 1YHQA 1VQ9T 2JW4A 3L2WA 3NTIA 1AHJB 4J9CA 4N0AA 2LX9A 1QCOA 4L5GA 4JDSA 1K8AC 2QQRA 5A0DA 2BKDN 2RHUA 1NEBA 3LGLA 3M53A 4HXJA 5LJ3j 1U1SA 1OV3A 1I4K1 4PJOB 2VVKA 2E5KA 2EFIA 3P8DA 1ZLMA 3QO3A 4TVRA 1GRIA 2L89A 3I9QA 3BY7A 1WHLA 4M77F 1K0XA 3JRZA 2X51A 2KY9A 3CD6T 1OZ2A 2YXYA 2DEUA 1E6GA 4XTUA 3THKA 2FPEA 2JNGA 1K73C 3L2VA 2QEXQ 4F7UB 2RHXA 2KDSA 3QYGB 3CCMA 3V7SA 1MMNA 4F7UE 1MMGA 4E2FB 1MNEA 2EGCA 5IHNA 2ZPIB 4M77C 2KNBB 4LDWA 3OYEA 4PJOA 2HSPA 1M90U 4Y28E 2EQJA 3CMAQ 1JQQA 4BI4A 5I22A 5GAN5 3TSWA 2DL4A 1N8RR 2KYMA 2DD4A 3CCRA 3S3MA 1M3BA 2EGAA 1DJ7B 1Z9QA 4J7IA 4A4HA 2FYKA 3EG3A 3MCAB 4FT2A 1NG2A 2MF2A 4HVVA 5GAMg 1K76A 5FU6B 1HXDA 2A3LA 4XK8E 4ZNXA 2GTJA 5CVIA 3OS2A 4M7AA 1QP2A 2RHIA 2ZPGB 2RQWA 3DLLA 2RI5A 3RKXA 1M1KC 4AFUC 3GOXA 3ZFJA 2E3IA 1D3BB 5AT1B 2LNVA 2W10A 3L42A 2DJQA 1RADB 4C92B 5IHIA 1NPPA 2PVDB 1K73R 1UDLA 2VXFA 4GLMA 1Z9ZA 2OJ2A 3QJ6A 4NL3A 1BCMA 1VQ9Q 4M75D 2QQAA 3MEUA 4RTZA 3EHQA 5KYNA 4OMLA 3ZL7C 1IHWA 2HBWA 4DBRA 4BY6C 2A0FB 4XU2A 3G7ZA 4HT9A 2C0TA 3CBMA 1QCFA 1YIJA 2DIGA 5FU7C 2GGRA 1CKBA 5GAN4 1T0JA 5FROA 1SG5A 1WYXA 2Y4YA 4Z8AA 5KE2A 3ZBDA 1N8RU 4EPCA 2HKNA 3CCET 1ZBXA 4OMMA 4P5NA 3N5BB 3QXEB 3QDRB 3VV0A 2L3PA 3TCJA 1UFFA 3GNGA 1G3YA 2D8HA 3OYIA 2LCCA 2HNIA 2QEXT 1AZGB 2DF6A 4LDVA 5GJVB 2VASA 1SRLA 4JZ4A 1GL5A 1Y0MA 1BI1A 3E9FA 3CQTA 4OMNA 3OYJA 3U23A 2COZA 4AG2C 3GBQA 4C92F 2E4HA 5CR2A 3CC4T 2V1RA 2OAUA 2DL5A 1W70A 4L59A 2LT1A 2VV5A
chains in the Genus database with same CATH topology
2KT1A 2OAWA 2YUQA 1ZUKA 1KFZA 2P4RA 2K6DA 1W1FA 2FPDA 2J6FA 3I5SA 2JMCA 2LQNA 1A0NB 2LQWA 1UG1A 2EPDA 2J6KA 2DL7A 4A63B 2KGTA 2A37A 1OPKA 4IIOA 1E7OA 2SRCA 4RTTA 2CSIA 2JM8A 3VS1A 1UJYA 2J05A 1OPLA 4K11A 2O9VA 3RNJA 1XOVA 1JEGA 1YP5A 1GBQA 2ED0A 4ORZA 1ZUYA 1TG0A 4RTXA 1ZSGA 2NUZA 2H8HA 2RN8A 2RQVA 4AFZC 4JZ3A 2RQTA 2SEMA 2FG0A 2LJ0A 2DNUA 2J6OA 2K3BA 4CC7A 1WXBA 1X6GA 2AK5A 2YUOA 5IHKA 2AKLA 1I0CA 1SEMA 2YUPA 4AG1C 2X3WD 4OMQA 2MOXA 1JU5C 2PTKA 2FPFA 1SHFA 1G2BA 2J7IA 4WCIA 3KFVA 3RBBB 1B3QA 3JV3A 4AFSC 2C0OA 3A98A 1AD5A 1AWOA 1PRLC 1ABOA 2DE0X 1QWFA 2A36A 1ARKA 3H0HA 2C0IA 2L2PA 2IIMA 2RF0A 1WA7A 1WX6A 1KIKA 1VA7A 1UJ0A 1VYUA 1ABQA 1HSQA 1T3LA 2DILA 5IXBA 2JS0A 4Z89A 2ED1A 2EYYA 1UUEA 1NLPC 2VKNA 2X3XD 2QDLA 2ROTA 2BTTA 2M0YA 1H92A 3VS0A 2LCSA 2DL8A 4J9DA 1Y57A 2FEIA 3VRZA 2RNAA 4RTWA 4CC4B 5IXFA 2F2VA 4J9GA 2KRMA 3UF4A 2KYBA 3M0PA 1QKWA 1M30A 2AZVA 4RTVA 2HDAA 4QT7A 3VS6A 2LP5A 1J3TA 1B07A 2K79A 1BB9A 4HVWA 2YT6A 1AVZC 2D8JA 4CC2A 1TUDA 4EIKA 1EFNA 2PNIA 5HCKA 4F14A 3IQLA 2LZ6B 3M0SA 3C0CA 2LNHB 2BZXA 3EHRA 2RQUA 4J9EA 1PKSA 1CSKA 2BZ8A 1RLQC 2CUDA 2D0NA 3M0QA 3VS7A 2RQRA 1ZX6A 4DEXA 3QWXX 2A08A 3I35A 4LN2A 1WDXA 3NMZC 1K0SA 4X1VA 4ESRA 3REBB 3M0RA 1PNJA 4RUGA 2O88A 2D1XA 1K4US 3NGPA 1HD3A 3TSZA 1GCQC 1JXOA 3I5RA 2DM1A 3EG0A 3EG1A 1RLPC 2JMAA 2ROLA 2K9GA 2EYZA 4M4ZA 1BK2A 1I07A 1GCQA 3M0TA 5I11A 2DMOA 4R0KA 1NYGA 3SHWA 2FO0A 3VS3A 1W6XA 2PZ1A 4GBQA 2EYXA 2W0ZA 1X69A 2JT4A 5FWCA 2I0NA 2L3QA 2BZYA 2YDLA 1TUCA 2OI3A 1YWPA 4JPBW 2LJ1A 4J9IA 1AZEA 1QLYA 1I1JA 4HCKA 2EVRA 1K1ZA 1X6BA 1UECA 1YWOA 1KSWA 3PE0A 3UA7A 1E6HA 4CC3A 1IO6A 1PKTA 1WXUA 4LNPA 3FJ5A 2HCKA 1T0HA 1ZBJA 1WLPB 1H3HA 2CH4A 2G6FX 3H0IA 1FYNA 2CREA 2O9SA 4JJDA 1PWTA 2F2WA 1RUWA 2ECZA 3EGUA 3VS2A 2JW4A 4JJCA 4J9CA 3PVLA 2CH4W 3H41A 1GFDA 2L0AA 5FW9A 1NEBA 3NHNA 4HXJA 1WI7A 4LUDA 1H8KA 1OV3A 1UHCA 1QKXA 1NLOC 2VVKA 2E5KA 1LCKA 2K2MA 1K9AA 1ZLMA 2NWMA 4DEYA 2EKHA 1GRIA 3EG2A 3I9QA 2GTOA 3M0UA 2GBQA 1AOJA 2EBPA 1NYFA 2LX7A 1K0XA 3SEMA 3H0FA 1YCSB 1UTIA 1T3SA 5L23A 1V1CA 1E6GA 4JJBA 3THKA 2FPEA 4KRTA 1GBRA 4F17A 1VYVA 2JS2A 5FWBA 4J9HA 3VRYA 1M3CA 3R6NA 1SRMA 2DVJA 4D8DA 2DYBA 1GCPA 1BU1A 2EGCA 5IHNA 1AWWA 2V1QA 2FRYA 2KNBB 1X27A 2L3SA 2KROA 1X43A 2HSPA 1WIEA 2DLPA 1JQQA 1M3AA 5I22A 1ZUUA 2LJ3A 3TSWA 2DL4A 2KYMA 1M3BA 2EGAA 1Z9QA 5EC7A 2ENMA 5GJWB 3EG3A 2CDTA 1NG2A 2RPNA 4HVVA 1YN8A 1PRMC 1K76A 4ZNXA 2GTJA 2EQIA 1GFCA 2CSQA 2RQWA 3PVQA 1U5SA 1FMKA 2DRKA 4AFUC 2F2XA 2KE9A 1WFWA 1OOTA 4RTUA 2ABLA 2KEAA 5IH2A 4OMOA 2W10A 2ESWA 2DJQA 5IHIA 4HVUA 1X2KA 4F16A 2EYWA 1MUZA 1UDLA 4Y92A 2KRNA 2CT4A 4GLMA 4J9FA 1NM7A 1Z9ZA 5ECAA 2OJ2A 1AEYA 1RI9A 1S1NA 1BBZA 2K7AA 4RTZA 1JO8A 2DBMA 3EHQA 2O2OA 3LH5A 4AFQC 4OMLA 3ZL7C 4D8KA 2HBWA 1SPKA 4LUEA 2C0TA 1QCFA 2GNCA 4FSSA 1HJDA 2JTEA 1OEBA 1M8MA 4RTYA 1NEGA 1PHTA 1UHFA 2AZSA 2DBKA 2KBTA 2GGRA 3REAB 1CKBA 2J06A 1T0JA 2DL3A 1WYXA 4E6RA 1UGVA 4Z8AA 3VS4A 2B86A 1M27C 2O31A 1AWXA 2CUBA 3UA6A 1VYTA 4OMMA 1X2QA 2EGEA 1SSHA 2L3PA 3NPFA 1CKAA 2KT8A 1UFFA 2YUNA 2CT3A 4LE9A 2D8HA 1U06A 2JXBA 1G83A 2XMFA 1WXTA 4Z88A 2KR3A 2YSQA 3ULRB 2JM9A 1AZGB 1MV0B 2M51A 1UE9A 2DRMA 2DF6A 3TVTA 5GJVB 3QWYA 2DX1A 1SRLA 2GQIA 2LMJA 4JZ4A 2EW3A 1AWJA 1N5ZA 1SHGA 1U3OA 1YNZA 4OMPA 1GL5A 1Y0MA 4IIMA 2RMOA 2KXCA 2DA9A 2HEQA 1MV3A 2FRWA 3CQTA 3VS5A 2KXDA 4J9BA 3O5ZA 1QWEA 4OMNA 3U23A 4AG2C 3GBQA 1KJWA 2VWFA 2V1RA 3UATA 2MIOA 2A28A 2DL5A 1JXMA 2AKKA 1W70A 2MCNA 2KRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KT1 A;  2OAW A;  2YUQ A;  1ZUK A;  1KFZ A;  2P4R A;  2K6D A;  1W1F A;  2FPD A;  2J6F A;  3I5S A;  2JMC A;  2LQN A;  1A0N B;  2LQW A;  1UG1 A;  2EPD A;  2J6K A;  2DL7 A;  4A63 B;  2KGT A;  2A37 A;  1OPK A;  4IIO A;  1E7O A;  2SRC A;  4RTT A;  2CSI A;  2JM8 A;  3VS1 A;  1UJY A;  2J05 A;  1OPL A;  4K11 A;  2O9V A;  3RNJ A;  1XOV A;  1JEG A;  1YP5 A;  1GBQ A;  2ED0 A;  4ORZ A;  1ZUY A;  1TG0 A;  4RTX A;  1ZSG A;  2NUZ A;  2H8H A;  2RN8 A;  2RQV A;  4AFZ C;  4JZ3 A;  2RQT A;  2SEM A;  2FG0 A;  2LJ0 A;  2DNU A;  2J6O A;  2K3B A;  4CC7 A;  1WXB A;  1X6G A;  2AK5 A;  2YUO A;  5IHK A;  2AKL A;  1I0C A;  1SEM A;  2YUP A;  4AG1 C;  2X3W D;  4OMQ A;  2MOX A;  1JU5 C;  2PTK A;  2FPF A;  1SHF A;  1G2B A;  2J7I A;  4WCI A;  3KFV A;  3RBB B;  1B3Q A;  3JV3 A;  4AFS C;  2C0O A;  3A98 A;  1AD5 A;  1AWO A;  1PRL C;  1ABO A;  2DE0 X;  1QWF A;  2A36 A;  1ARK A;  3H0H A;  2C0I A;  2L2P A;  2IIM A;  2RF0 A;  1WA7 A;  1WX6 A;  1KIK A;  1VA7 A;  1UJ0 A;  1VYU A;  1ABQ A;  1HSQ A;  1T3L A;  2DIL A;  5IXB A;  2JS0 A;  4Z89 A;  2ED1 A;  2EYY A;  1UUE A;  1NLP C;  2VKN A;  2X3X D;  2QDL A;  2ROT A;  2BTT A;  2M0Y A;  1H92 A;  3VS0 A;  2LCS A;  2DL8 A;  4J9D A;  1Y57 A;  2FEI A;  3VRZ A;  2RNA A;  4RTW A;  4CC4 B;  5IXF A;  2F2V A;  4J9G A;  2KRM A;  3UF4 A;  2KYB A;  3M0P A;  1QKW A;  1M30 A;  2AZV A;  4RTV A;  2HDA A;  4QT7 A;  3VS6 A;  2LP5 A;  1J3T A;  1B07 A;  2K79 A;  1BB9 A;  4HVW A;  2YT6 A;  1AVZ C;  2D8J A;  4CC2 A;  1TUD A;  4EIK A;  1EFN A;  2PNI A;  5HCK A;  4F14 A;  3IQL A;  2LZ6 B;  3M0S A;  3C0C A;  2LNH B;  2BZX A;  3EHR A;  2RQU A;  4J9E A;  1PKS A;  1CSK A;  2BZ8 A;  1RLQ C;  2CUD A;  2D0N A;  3M0Q A;  3VS7 A;  2RQR A;  1ZX6 A;  4DEX A;  3QWX X;  2A08 A;  3I35 A;  4LN2 A;  1WDX A;  3NMZ C;  1K0S A;  4X1V A;  4ESR A;  3REB B;  3M0R A;  1PNJ A;  4RUG A;  2O88 A;  2D1X A;  1K4U S;  3NGP A;  1HD3 A;  3TSZ A;  1GCQ C;  1JXO A;  3I5R A;  2DM1 A;  3EG0 A;  3EG1 A;  1RLP C;  2JMA A;  2ROL A;  2K9G A;  2EYZ A;  4M4Z A;  1BK2 A;  1I07 A;  1GCQ A;  3M0T A;  5I11 A;  2DMO A;  4R0K A;  1NYG A;  3SHW A;  2FO0 A;  3VS3 A;  1W6X A;  2PZ1 A;  4GBQ A;  2EYX A;  2W0Z A;  1X69 A;  2JT4 A;  5FWC A;  2I0N A;  2L3Q A;  2BZY A;  2YDL A;  1TUC A;  2OI3 A;  1YWP A;  4JPB W;  2LJ1 A;  4J9I A;  1AZE A;  1QLY A;  1I1J A;  4HCK A;  2EVR A;  1K1Z A;  1X6B A;  1UEC A;  1YWO A;  1KSW A;  3PE0 A;  3UA7 A;  1E6H A;  4CC3 A;  1IO6 A;  1PKT A;  1WXU A;  4LNP A;  3FJ5 A;  2HCK A;  1T0H A;  1ZBJ A;  1WLP B;  1H3H A;  2CH4 A;  2G6F X;  3H0I A;  1FYN A;  2CRE A;  2O9S A;  4JJD A;  1PWT A;  2F2W A;  1RUW A;  2ECZ A;  3EGU A;  3VS2 A;  2JW4 A;  4JJC A;  4J9C A;  3PVL A;  2CH4 W;  3H41 A;  1GFD A;  2L0A A;  5FW9 A;  1NEB A;  3NHN A;  4HXJ A;  1WI7 A;  4LUD A;  1H8K A;  1OV3 A;  1UHC A;  1QKX A;  1NLO C;  2VVK A;  2E5K A;  1LCK A;  2K2M A;  1K9A A;  1ZLM A;  2NWM A;  4DEY A;  2EKH A;  1GRI A;  3EG2 A;  3I9Q A;  2GTO A;  3M0U A;  2GBQ A;  1AOJ A;  2EBP A;  1NYF A;  2LX7 A;  1K0X A;  3SEM A;  3H0F A;  1YCS B;  1UTI A;  1T3S A;  5L23 A;  1V1C A;  1E6G A;  4JJB A;  3THK A;  2FPE A;  4KRT A;  1GBR A;  4F17 A;  1VYV A;  2JS2 A;  5FWB A;  4J9H A;  3VRY A;  1M3C A;  3R6N A;  1SRM A;  2DVJ A;  4D8D A;  2DYB A;  1GCP A;  1BU1 A;  2EGC A;  5IHN A;  1AWW A;  2V1Q A;  2FRY A;  2KNB B;  1X27 A;  2L3S A;  2KRO A;  1X43 A;  2HSP A;  1WIE A;  2DLP A;  1JQQ A;  1M3A A;  5I22 A;  1ZUU A;  2LJ3 A;  3TSW A;  2DL4 A;  2KYM A;  1M3B A;  2EGA A;  1Z9Q A;  5EC7 A;  2ENM A;  5GJW B;  3EG3 A;  2CDT A;  1NG2 A;  2RPN A;  4HVV A;  1YN8 A;  1PRM C;  1K76 A;  4ZNX A;  2GTJ A;  2EQI A;  1GFC A;  2CSQ A;  2RQW A;  3PVQ A;  1U5S A;  1FMK A;  2DRK A;  4AFU C;  2F2X A;  2KE9 A;  1WFW A;  1OOT A;  4RTU A;  2ABL A;  2KEA A;  5IH2 A;  4OMO A;  2W10 A;  2ESW A;  2DJQ A;  5IHI A;  4HVU A;  1X2K A;  4F16 A;  2EYW A;  1MUZ A;  1UDL A;  4Y92 A;  2KRN A;  2CT4 A;  4GLM A;  4J9F A;  1NM7 A;  1Z9Z A;  5ECA A;  2OJ2 A;  1AEY A;  1RI9 A;  1S1N A;  1BBZ A;  2K7A A;  4RTZ A;  1JO8 A;  2DBM A;  3EHQ A;  2O2O A;  3LH5 A;  4AFQ C;  4OML A;  3ZL7 C;  4D8K A;  2HBW A;  1SPK A;  4LUE A;  2C0T A;  1QCF A;  2GNC A;  4FSS A;  1HJD A;  2JTE A;  1OEB A;  1M8M A;  4RTY A;  1NEG A;  1PHT A;  1UHF A;  2AZS A;  2DBK A;  2KBT A;  2GGR A;  3REA B;  1CKB A;  2J06 A;  1T0J A;  2DL3 A;  1WYX A;  4E6R A;  1UGV A;  4Z8A A;  3VS4 A;  2B86 A;  1M27 C;  2O31 A;  1AWX A;  2CUB A;  3UA6 A;  1VYT A;  4OMM A;  1X2Q A;  2EGE A;  1SSH A;  2L3P A;  3NPF A;  1CKA A;  2KT8 A;  1UFF A;  2YUN A;  2CT3 A;  4LE9 A;  2D8H A;  1U06 A;  2JXB A;  1G83 A;  2XMF A;  1WXT A;  4Z88 A;  2KR3 A;  2YSQ A;  3ULR B;  2JM9 A;  1AZG B;  1MV0 B;  2M51 A;  1UE9 A;  2DRM A;  2DF6 A;  3TVT A;  5GJV B;  3QWY A;  2DX1 A;  1SRL A;  2GQI A;  2LMJ A;  4JZ4 A;  2EW3 A;  1AWJ A;  1N5Z A;  1SHG A;  1U3O A;  1YNZ A;  4OMP A;  1GL5 A;  1Y0M A;  4IIM A;  2RMO A;  2KXC A;  2DA9 A;  2HEQ A;  1MV3 A;  2FRW A;  3CQT A;  3VS5 A;  2KXD A;  4J9B A;  3O5Z A;  1QWE A;  4OMN A;  3U23 A;  4AG2 C;  3GBQ A;  1KJW A;  2VWF A;  2V1R A;  3UAT A;  2MIO A;  2A28 A;  2DL5 A;  1JXM A;  2AKK A;  1W70 A;  2MCN A;  2KRS A; 
#chains in the Genus database with same CATH topology
 1TU0 B;  2KT1 A;  1YIT Q;  1KFZ A;  4IUT A;  2K6D A;  2K5L A;  2FPD A;  2JMC A;  2LQN A;  3G71 T;  5GAO q;  3L2Z A;  4A63 B;  2KGT A;  1OU8 A;  1VQ7 Q;  2A37 A;  5I21 A;  4RTT A;  2SRC A;  1M5Q 1;  4B9X A;  4C92 C;  3H6Z A;  1K73 U;  4PJO G;  3RNJ A;  1GBQ A;  5D7U A;  1C0M A;  1TG0 A;  1X01 A;  2GCX A;  1BKB A;  3M4G A;  2FG0 A;  2P4T A;  2DNU A;  1Q86 C;  1JB0 E;  4J83 A;  2R5M A;  1SEM A;  1VQN Q;  2YUP A;  4AG1 C;  1C6V X;  2K3Y A;  2PVO B;  3G1J A;  2PTK A;  3A1P A;  6AT1 B;  4O6J A;  2R5A A;  1B34 B;  4JLI A;  4CI0 C;  3ER0 A;  1MGQ A;  3RBB B;  1B3Q A;  4AFS C;  3I55 Q;  2C0O A;  1D09 B;  2L2P A;  2RM4 A;  2RF0 A;  4M75 E;  4M7A B;  3PIP A;  2FVU A;  2K2V A;  2BE7 D;  1KIK A;  1VA7 A;  4M78 C;  1T3L A;  3NFC A;  5IXB A;  1ZSZ A;  4PJO F;  5J39 A;  3AT1 B;  3UDC A;  2ED1 A;  2EYY A;  2VKN A;  3HKS A;  1VUB A;  1TH7 A;  2QDL A;  2ROT A;  5IN1 A;  1RAG B;  1JRI A;  4EDU A;  3VS0 A;  1NJI U;  2LVM A;  1OU9 A;  4MMK A;  2CP0 A;  1IB8 A;  1TXQ A;  3UPU A;  3JB9 D;  2PU9 B;  1VIE A;  2M0O A;  3M0P A;  1M30 A;  4Q5W A;  2LP5 A;  4M78 F;  3BE3 A;  1B07 A;  4M78 B;  4OP0 A;  4QQG A;  3KXT A;  2PNI A;  4HCB A;  5KYX B;  5GAM d;  2BZX A;  3EHR A;  5GAM h;  4J9E A;  4GY5 A;  3CCL T;  1AT1 B;  2ZPH B;  2D0N A;  2R57 A;  4MZT A;  3M56 A;  2RQR A;  3DB4 A;  1MMA A;  1ZX6 A;  2A08 A;  2DFU A;  1W2B P;  1QP3 A;  1TTH B;  1WDX A;  3LWH A;  2CP6 A;  1VQL Q;  2V26 A;  3S3O A;  2YHT A;  4BD3 A;  1YHQ T;  4KUI A;  3I5R A;  2HMA A;  2M16 A;  2JMA A;  5D6W A;  2K9G A;  2NLU A;  1I8F A;  1VQL T;  2DVE A;  4UC4 A;  1ZQ1 A;  4MZP A;  3GP8 A;  3SHW A;  3V7R A;  2PZ1 A;  4GBQ A;  1YIT A;  2W0Z A;  4PNO A;  2F5K A;  4ELY C;  3HPW A;  4DQ2 A;  5FWC A;  3JB9 F;  3P8B B;  3HRU A;  3RMQ A;  3M5A A;  5GAO r;  2LJ1 A;  1AZE A;  4HCK A;  4OF1 A;  1YWO A;  1UEC A;  4PJL A;  3PE0 A;  1KHI A;  4YTL A;  2QQ9 A;  3JCM g;  1IO6 A;  1OUL A;  3MEV A;  3FJ5 A;  4XU3 A;  2HCK A;  1T0H A;  5LJ5 f;  2COW A;  1Q82 R;  4EMG A;  1KQ1 A;  1H3H A;  5LJ3 d;  4F7U G;  1FYN A;  1VQM T;  4ANJ A;  2EQU A;  2GFA A;  4JJD A;  1R77 A;  4WF2 A;  4M78 A;  2DJZ A;  2QEX A;  1NJI C;  1PM3 A;  3G71 A;  2HBP A;  2ECZ A;  3EGU A;  3V7C A;  5KYY A;  2M1H A;  1B34 A;  4C8Q D;  2WSE E;  2CH4 W;  3H41 A;  4XU0 A;  2IG0 A;  2LRQ A;  3P8H A;  4O5V A;  1D0X A;  4RCC A;  3J81 E;  1ACM B;  1IRE B;  2MYS A;  4FU6 A;  2RK1 A;  5GAO m;  2KSS A;  3CXC S;  3OW2 S;  2K2M A;  1P92 A;  3G6E A;  4C5I A;  4DEY A;  2EKH A;  3CCQ T;  3EG2 A;  4LDY A;  1UEB A;  2HAX A;  2GBQ A;  1AOJ A;  1N9S A;  1RAA B;  1FX7 A;  1LJO A;  3H0F A;  4KGV B;  3ASK A;  4GLK A;  5L23 A;  3CD6 A;  1QQJ A;  4NL2 A;  2CZ6 B;  4J7F A;  4FSX A;  2XID A;  4E7Z A;  4M7D D;  2EYQ A;  3VRY A;  4E7I A;  2DXB A;  1KD1 U;  1W4S A;  5KE3 A;  1TUG B;  3R6N A;  3OYK A;  1SRM A;  3PIO A;  2XKO C;  1VOM A;  2X4J A;  3INZ A;  1KG1 A;  4D8D A;  1Q7Y R;  2CGH A;  4JS5 A;  3OMC A;  2FL7 A;  2FRY A;  3ZEH A;  1VQ7 T;  1WPY A;  2OX7 A;  3HSB A;  2JN0 A;  4C92 D;  1WIE A;  5CKB A;  2VXE A;  2FZG B;  2D0Q B;  4QW2 A;  4FYY B;  5GJW B;  3JB9 H;  4XAX B;  4LD6 A;  5CK9 A;  3RR6 A;  1YN8 A;  1VQK T;  2ZPF B;  5KCO A;  2K4Y A;  3VUZ A;  4PFZ A;  2RD1 A;  5GMK i;  1FWZ A;  2P0K A;  2EQI A;  1GFC A;  1MHN A;  2CSQ A;  3PVQ A;  4BDY A;  3FC3 A;  4M7A F;  2DZC A;  3URG A;  2BUD A;  1NPR A;  2GQV A;  4JRK A;  4FYW B;  3M4Y A;  3H8Z A;  4HVU A;  3RER A;  4OB1 B;  3CCU T;  3JCM e;  2JUF A;  2NUT A;  4F16 A;  2EYW A;  5GMK m;  4KGZ B;  3JCM V;  2QAS A;  2KI7 A;  3C4S A;  1RAB B;  5ECA A;  2KAF A;  3CCV Q;  1VQP Q;  1IHV A;  4ME7 A;  1VQP A;  4M7A C;  2A7Y A;  3KUF A;  2VGN A;  1IZ6 A;  1JO8 A;  2DBM A;  4AFQ C;  2O2O A;  5IAY A;  1RAC B;  4LXC A;  1M8V A;  2HD0 A;  1WJQ A;  2E6Z A;  3CCM T;  3QBY A;  2GNC A;  1HJD A;  1BCO A;  2JTE A;  2V8J A;  1KC8 R;  4OB0 B;  3EFO A;  3ME9 A;  3PT9 A;  2RJF A;  1PHT A;  1IRX A;  1UHF A;  3V8K A;  4XTY A;  2XD0 A;  2DBK A;  2R58 A;  2KBT A;  3NTK A;  3REA B;  2K5F A;  4JJN K;  4PJO C;  2DL3 A;  4QQD A;  3CMA T;  2NYS A;  3GIB A;  1M27 C;  5C6S A;  3PNW C;  4M7D E;  4E7H A;  3S3N A;  1X2Q A;  2EGE A;  2H3E B;  2DK3 A;  3NPF A;  2KT8 A;  4XTZ A;  3MP1 A;  1GXI E;  2CT3 A;  4N4H A;  4C8Q G;  1YJ9 Q;  1OI1 A;  2JXB A;  1YJ9 A;  1IGQ A;  2XMF A;  4Z88 A;  3GPL A;  4MDW A;  1QVF P;  1I5L A;  1B7T A;  2JM9 A;  5LJ3 g;  3BDL A;  2L3R A;  1KD1 R;  3CC4 A;  1VQ4 Q;  2P0Q A;  3PFS A;  4OB3 B;  2GQI A;  2LMJ A;  1JJ2 A;  2PQW A;  5IT9 E;  3L2Q A;  1MV3 A;  2CKK A;  2KXD A;  3EFR A;  1QWE A;  3EGX B;  1VQ4 T;  4V2S A;  3HHT B;  1F1B B;  1KJW A;  1X75 C;  2LDM A;  2K57 A;  3QSU A;  3SD4 A;  3LX7 A;  1YI2 T;  2A28 A;  4C5H A;  5KYY B;  1VQK Q;  2IVW A;  1VQ5 A;  1QVG P;  2MCN A;  3HRT A;  3QDF A;  4M75 A;  2KRS A;  5GAN d;  4C8Q A;  2YUQ A;  2P4R A;  2H3J A;  2RI2 A;  2EQK A;  3M57 A;  1A0N B;  8AT1 B;  4D6W A;  2P0P A;  1BI3 A;  3PTA A;  3I55 A;  3CCJ A;  3VS1 A;  2JM8 A;  3HRS A;  2OTJ A;  1YP5 A;  2JJ9 A;  2MPX C;  1MND A;  3QUI A;  1G3S A;  4RTX A;  1I81 A;  1WZO A;  2MMP A;  2HQX A;  4EMK A;  4JZ3 A;  2K3B A;  3E2U A;  1EX4 A;  1X6G A;  2AK5 A;  3G6E Q;  2F1L A;  1I0C A;  1XTD A;  4B9W A;  4OMQ A;  2F5T X;  4X9C A;  2X4X A;  3OYD A;  1BI0 A;  3FDR A;  3X24 B;  4CRI A;  5CKF A;  3TQ7 P;  3DLM A;  2A36 A;  3FJP A;  2B8A A;  1LNX A;  3QJY A;  4J6Y A;  3CME T;  5D6Y A;  2O01 E;  1M90 R;  5KCH A;  1D1B A;  1UJ0 A;  1Q81 R;  1PC0 A;  4C0Z A;  4N0A C;  2E1H A;  2NUP B;  5HK3 A;  4MML A;  1SSF A;  3X26 B;  2M0Y A;  1VQ5 T;  1Y57 A;  1VQ6 T;  2LTO A;  3CBO A;  2KRM A;  1QKW A;  2AZV A;  4RTV A;  5KYU A;  4QT7 A;  4BE1 A;  1VQK A;  2P84 A;  1XQH A;  1WHK A;  3SB2 A;  4QKU A;  2YT6 A;  1TUD A;  2QAZ A;  4EIK A;  1Y71 A;  5HCK A;  1QVF A;  2O4X A;  4M7D A;  3JB9 I;  3M0S A;  3C0C A;  3A5Z B;  2JTM A;  3SWN A;  3OYN A;  4KH1 B;  2RK2 A;  2RQU A;  4ZN1 A;  2DER A;  1CSK A;  1YJN T;  2L5Q A;  4A4G A;  3CCS Q;  5GAO p;  4DEX A;  4F7U F;  5GAN 7;  3VU3 C;  3A8M B;  2QQS A;  2KVQ G;  3EG9 A;  4LN2 A;  3NMZ C;  4FT4 A;  1K0S A;  3MP6 A;  3OY9 A;  3RIR A;  1YI2 A;  4DBF A;  4M77 B;  2ZAE A;  1HYO A;  2I2L A;  3OW2 P;  1K4U S;  5GAM j;  1Y96 A;  4EMH A;  3JCM d;  1GCQ C;  1JXO A;  4ZN3 A;  2DM1 A;  3EG0 A;  1EZZ B;  2ROL A;  2EYZ A;  4KBM B;  4M4Z A;  1GCQ A;  1O75 A;  2KQW A;  3M0T A;  4ZTF A;  3LH0 A;  3OS1 A;  5I11 A;  3HL8 A;  4C92 A;  1Q81 U;  2FO0 A;  3VS3 A;  3CCQ A;  3NTH A;  1ZA1 B;  2V8I A;  2CYZ B;  3HFO A;  2DIQ A;  3TRE A;  2I0N A;  1RAE B;  3DB3 A;  5CO7 A;  2OTL A;  2O4X B;  3CCL Q;  1QLY A;  1I1J A;  2HKQ B;  2HSE B;  3UA7 A;  5LJ5 g;  3JB9 G;  5KYW A;  1WQ7 A;  1PKT A;  3M54 A;  1ZBJ A;  2G6F X;  3E9G A;  1UGS B;  5FRN A;  1M2V B;  1FMW A;  2QK0 A;  1Y96 B;  4FYX B;  3LW5 E;  2G3R A;  3OMG A;  1QVF S;  1PWT A;  4FIB A;  1QVG S;  4C8Q C;  3VS2 A;  3G4S Q;  4JJC A;  1PSF A;  3MO8 A;  2XU8 A;  3V8L A;  3PVL A;  2KMT A;  2PVG B;  1GFD A;  1QW1 A;  2L0A A;  3J7A F;  2ZCF B;  3T9N A;  2E64 A;  5A2Q E;  2BIV A;  2LT4 A;  1G3W A;  1UHC A;  1QKX A;  5GMK l;  1LCK A;  3SWN B;  2CP7 A;  3QII A;  3BW1 A;  3OYG A;  2GTO A;  3M0U A;  3EG9 B;  1VQ4 A;  4B6M A;  3EH1 A;  2EAY A;  3CC2 T;  5LJ3 e;  1T3S A;  1D3B A;  1RAF B;  5CKE A;  3CCJ Q;  1V1C A;  1JJ2 P;  2WSC E;  4JJB A;  2CZ7 B;  2D6F A;  3CC2 A;  4EMK C;  1Q82 U;  4XTV A;  1G3T A;  5CIU A;  4EMK B;  2JS2 A;  1WHG A;  1UGR B;  5FWB A;  1NBE B;  2QA4 T;  1QVP A;  3OW2 A;  2D9T A;  2LCL A;  2EWN A;  2Z0W A;  2DVJ A;  2DYB A;  1K9M C;  1GCP A;  1BU1 A;  1UB4 A;  2RB6 A;  2RHY A;  1AWW A;  2V1Q A;  4F04 B;  1X27 A;  2L3S A;  2KRO A;  3CXC P;  3OYC A;  3OBW A;  3EGD A;  3G71 Q;  4Y91 A;  2MWP A;  4PLI A;  1M3A A;  1ZUU A;  2OTJ Q;  2LJ3 A;  3VJP A;  3LLR A;  1QMC A;  2HQE A;  4HA8 A;  3JCM Q;  2XDP A;  4JRP A;  1EIF A;  1K8A U;  2DTO A;  3M55 A;  4JUV A;  4BI3 A;  2AIR B;  4IUR A;  5EC7 A;  2BE9 B;  4C8Q B;  1PRM C;  1Q7Y U;  3E19 A;  3QYH B;  4PKC C;  3MEA A;  3EAE A;  2CZ1 B;  4DOW A;  4RG8 A;  4E7S A;  2C06 A;  1FMK A;  1VQP T;  1WFW A;  1OOT A;  4RTU A;  5IH2 A;  1WGS A;  3OYB A;  4OGC A;  2ESW A;  3GNF B;  2Y4X A;  2CP2 A;  1X6O A;  4FM4 B;  4AT1 B;  2CS7 A;  5A0L A;  4JLG A;  2CT4 A;  2X4Y A;  1M1K R;  1NM7 A;  3OYA A;  1RI9 A;  1YBY A;  1BBZ A;  3JCM b;  1XNI A;  4C0D B;  4OMF B;  2PUK B;  4D8K A;  1SPK A;  3CCS A;  1H64 1;  3LWI A;  3JB9 J;  3MJX A;  2K3X A;  5GAM e;  4FSS A;  4C92 E;  1OX9 A;  3UT1 A;  1OEB A;  4DA4 A;  3JSC A;  1VQL A;  1TSF A;  4RTY A;  1NEG A;  2AZS A;  2EJG A;  4C92 G;  5L8R E;  2QGF B;  4VUB A;  1UGV A;  3RUX A;  2E70 A;  5LJ5 e;  2O31 A;  3JCM c;  1AWX A;  1BIA A;  5LJ3 h;  3OBY A;  1NZ9 A;  5I2M A;  4FYV B;  1SSH A;  1R0C B;  3RMS A;  2YUN A;  2YLC A;  3C12 A;  1U06 A;  3CPW S;  1G83 A;  1RAH B;  1WXT A;  2COY A;  3GLX A;  2JOY A;  3ULR B;  1Q86 U;  2K5I A;  3CCV A;  3GF5 A;  1M2O A;  1MV0 B;  4XU1 A;  2M51 A;  1UE9 A;  2DRM A;  3TVT A;  3QWY A;  2DX1 A;  5GAN e;  2YWW A;  4L6V 5;  4M7D F;  4IUQ A;  2EW3 A;  1AWJ A;  1N5Z A;  1YNZ A;  2EIF A;  4IIM A;  3VS5 A;  1G8X A;  2KXC A;  2FRW A;  4E7J A;  2CZ0 B;  3I56 Q;  2HZY A;  3DKM A;  2RA2 A;  1IXD A;  1R0B G;  3M59 A;  3WVE B;  4C0G A;  2VWF A;  5DLQ E;  1Q7Y C;  3UAT A;  4PJM A;  2MIO A;  3CME A;  1JXM A;  4C0D C;  2AKK A;  1RAI B;  2NUP A;  2QGG A;  3TEE A;  4II1 A;  4A4E A;  2X9H A;  5GAN h;  1SF9 A;  3CCS T;  1KHC A;  1W1F A;  1WHJ A;  3I5S A;  2OTL Q;  1D0Z A;  1VQ8 Q;  1W2B S;  4IKF A;  2LQW A;  2EPD A;  1N8R C;  1OPK A;  1N27 A;  4C8Q F;  4K11 A;  2O9V A;  1JEG A;  1XOV A;  2VUB A;  1YIT T;  4JRQ A;  1Q82 C;  2ED0 A;  3OB9 A;  4ORZ A;  5AYF A;  1ZUY A;  1N6A A;  3BFM A;  2H8H A;  2RN8 A;  2RQT A;  2SEM A;  2J6O A;  3CCM Q;  1U8R A;  4DBH A;  1WXB A;  2YUO A;  2ZGW A;  2RJD A;  4PK4 A;  1R8O B;  1M1F A;  2X3W D;  4XTX A;  2MOX A;  1WQW A;  3CD6 Q;  2LQK A;  4MDX A;  3PMT A;  2FPF A;  2MAM A;  4A53 A;  1Q86 R;  1OQK A;  3MEW A;  3RES A;  2J7I A;  3A8O B;  3G4S A;  3JV3 A;  3A98 A;  1ABO A;  2DE0 X;  2DTI A;  3FEO A;  2QG9 B;  1QWF A;  1ARK A;  2C0I A;  3JCM X;  1PD0 A;  2DKG A;  2HL3 A;  5LJ5 d;  2E12 A;  3I55 T;  4XQ3 A;  9ATC B;  5HKC A;  1ABQ A;  2DIL A;  2JS0 A;  2ZPB B;  4KH0 B;  4KUD K;  4BDZ A;  4M7A D;  3J80 E;  2BTT A;  1H92 A;  3L1A A;  2LCS A;  2DL8 A;  2M02 A;  4J9D A;  2CP5 A;  3CC7 T;  4M7A G;  3RDV A;  2FEI A;  2JZ2 A;  3VRZ A;  2RNA A;  4RTW A;  5IXF A;  2F2V A;  3UF4 A;  2KYB A;  2JVV A;  4N4I A;  2MI6 A;  3FRN A;  2K79 A;  3E1S A;  1TOV A;  2D8J A;  4CC2 A;  2RH2 A;  3JAM E;  4RCB A;  4F14 A;  3FIF A;  4PJN A;  3EH2 A;  3C95 A;  1D1C A;  2BZ8 A;  1RLQ C;  2VYT A;  3CCQ Q;  4PLL A;  3VS7 A;  4ZGE B;  4N4G A;  4C8Q E;  1JJ2 S;  3I35 A;  1QCN A;  2DEQ A;  2MK5 A;  1VQ6 Q;  4PJJ A;  3MPU B;  1O9S A;  2ATC B;  4M78 D;  1YIJ Q;  1PNJ A;  3OYH A;  4QVC A;  2D1X A;  4A4K A;  3TSZ A;  3EG1 A;  1RLP C;  3BDU A;  4J6W A;  1BK2 A;  3EGD B;  1VQN T;  3F70 A;  5GAM f;  1VQM A;  1VQM Q;  1NYG A;  1YFN A;  4PJO D;  4J5Y A;  5LJ5 h;  4LD9 K;  2FHD A;  1OYX A;  2EYX A;  2Y90 A;  4PFO A;  5M9O A;  1S72 A;  3VYG A;  2L3Q A;  2BZY A;  2YDL A;  1TUC A;  2OI3 A;  2QYZ A;  2E10 A;  4JPB W;  3CCE Q;  4J9I A;  3TU4 K;  3HP9 A;  1K1Z A;  3OSS C;  1KSW A;  5CKH A;  2OTL T;  3RKY A;  5DM7 R;  4CC3 A;  2DO3 A;  4M75 G;  4BE0 A;  4M7A E;  1WXU A;  1N9R A;  4M78 G;  2QTV A;  2FZK B;  2CH4 A;  1YI2 Q;  1UGP B;  3CC4 Q;  2KK4 A;  2DYI A;  1SKU B;  5LJ5 j;  2VGM A;  1RI0 A;  2O9S A;  4ZTJ A;  2F2W A;  2XIC A;  3M58 A;  3OSV A;  4FW1 A;  3CC2 Q;  3PGG A;  3I56 A;  5GAO l;  1MMD A;  1ZSZ B;  5CAI A;  1ZSZ C;  2HL5 C;  3QHS A;  1KC8 C;  2AHJ B;  4DBQ A;  5FW9 A;  1M2V A;  4OVA A;  3NHN A;  2FZC B;  4RKU E;  3O8V A;  1WI7 A;  4F7U A;  4LUD A;  5CQY A;  5CQX A;  1LOJ A;  1LVK A;  1H8K A;  3CCR T;  3HFN A;  1NLO C;  3JCM f;  3MKD A;  1K9A A;  2NWM A;  3CPF A;  2E65 A;  1H3Z A;  3CCL A;  1K9M U;  2EBP A;  4A4F A;  1NYF A;  2LX7 A;  3SEM A;  3D7S B;  1YCS B;  1UTI A;  1VQN A;  4DOV A;  4OGE A;  3JCM J;  1WHH A;  5GAN g;  3QG1 A;  4KRT A;  1GBR A;  4F17 A;  1VYV A;  5FRM A;  4J9H A;  4MZM A;  2DZ9 A;  1M3C A;  1YJ9 T;  2LQ8 A;  5C0M A;  1KQS P;  4M75 B;  3RKW A;  1S72 Q;  5HK0 A;  1X43 A;  5GMK e;  3OYL A;  4FL6 A;  2YRD A;  3V8J A;  1YJN A;  3OYY A;  2DLP A;  4IUV A;  4QVZ A;  4PJO E;  1C1A A;  1PG5 B;  5GAO n;  3CCU A;  1YJW Q;  4C5E A;  1M4Z A;  1Y7X A;  2ENM A;  1V76 A;  2V8K A;  2CDT A;  5GAN j;  3FB9 A;  1VQO Q;  2RPN A;  3OQ5 A;  3FLG A;  2QA4 Q;  1VQO A;  2DTH A;  5EG2 A;  3CXC A;  3LGF A;  4M78 E;  3WVD B;  5GAN f;  2EJ9 A;  4Z02 A;  3H9N A;  1U5S A;  2RJC A;  2QQB A;  2DRK A;  2F2X A;  2DD5 A;  2KE9 A;  2QI2 A;  4FW2 A;  4QVD A;  2ABL A;  2KEA A;  4OMO A;  3C94 A;  5LJ3 f;  2YRV A;  3MP8 A;  1X2K A;  4BI8 B;  5KYU B;  4RMO A;  1MUZ A;  2XDB A;  4Y92 A;  2KRN A;  1Q81 C;  4J9F A;  1AEY A;  1S1N A;  3QZ9 B;  5J3B A;  4KGX B;  4LDU A;  1UGQ B;  2K7A A;  3AHU A;  5GAN 6;  3LH5 A;  1S72 T;  5D6X A;  4QQ6 A;  3OA6 A;  4LUE A;  1VQO T;  1WJS A;  2RJE A;  1XJW B;  4J8O A;  2XK0 A;  2EKO A;  1BI2 A;  1VQ6 A;  1PCX A;  1PD1 A;  1M8M A;  3CBP A;  3S6W A;  2J06 A;  1D1A A;  5A0G A;  4E6R A;  3VS4 A;  2B86 A;  4M77 A;  1OZ3 A;  2QXF A;  2XG8 D;  4C0F A;  3LYI A;  2E5Q A;  2CUB A;  3WXM B;  2X35 A;  1VYT A;  3UA6 A;  5FLX E;  2EJF A;  1LPL A;  4IUP A;  3CCV T;  3M9Q A;  3CME Q;  1CKA A;  2DET A;  4LE9 A;  3CCU Q;  1YJW A;  1KD1 C;  1TS9 A;  5KYW B;  2KR3 A;  2VB6 A;  2YSQ A;  4M7D B;  5KYX A;  1VQ8 A;  3OYF A;  4M75 C;  3CCE A;  3SFM A;  3OS0 A;  1IGU A;  5KH6 A;  3CPW P;  1OX8 A;  1U3O A;  4OMP A;  1SHG A;  2RMO A;  2DA9 A;  2HEQ A;  4PL6 A;  3O5Z A;  4J9B A;  1YHQ Q;  4HKE A;  1Q95 G;  2LC4 A;  3G6E T;  2PUO B;  1KC8 U;  2F69 A;  5DY9 A;  4R55 A;  1K9M R;  4M77 D;  4A54 A;  4BAC A;  1VIF A;  1PSE A;  2MWO A;  1HK9 A;  2OAW A;  1TWB A;  3OYM A;  4M75 F;  1ZUK A;  2OTJ T;  3EFO B;  1YJN Q;  2J6F A;  3MHX A;  1UG1 A;  2E6N A;  2AT1 B;  2DL7 A;  2J6K A;  3KBG A;  4IIO A;  1WNL A;  1E7O A;  2CSI A;  1UJY A;  2DAQ A;  2J05 A;  1OPL A;  4BUG A;  5DLO A;  4M77 G;  8ATC B;  5CCA A;  2QDY B;  4NS5 A;  1V29 B;  3VYH B;  1ZSG A;  2NUZ A;  4X9D A;  4WTO B;  2RQV A;  3PMI A;  4AFZ C;  3JCM P;  2LJ0 A;  3VUB A;  1W2B A;  1D0Y A;  4CC7 A;  5IHK A;  2AKL A;  2NUT B;  3HTR A;  4AMC A;  2XDD A;  2L8D A;  1ZHI A;  1JU5 C;  1NJI R;  2CP3 A;  2FB7 A;  4OB2 B;  5CKD A;  1SHF A;  4JS4 A;  1G2B A;  1KK7 A;  4HT8 A;  4FCY A;  4WCI A;  3KFV A;  4R56 A;  1AD5 A;  1AWO A;  1PRL C;  5HY6 A;  1M1G A;  4HCC A;  5GAN 8;  1NE8 A;  3H0H A;  5GAN 3;  1K8A R;  2IIM A;  4ZGD B;  4ELZ C;  4C5G A;  1WA7 A;  1G5V A;  2E41 A;  1ZA2 B;  1WX6 A;  1QVG A;  1VYU A;  3EFS A;  1KQS S;  1HSQ A;  2DXC A;  4Z89 A;  2ZZD A;  1UUE A;  1NLP C;  1M90 C;  4J6X A;  2YRC A;  2DXT A;  2X3X D;  1BIB A;  4KUL A;  2RHZ A;  4CC4 B;  4LDX A;  1BYM A;  4J9G A;  3EGX A;  3CC7 A;  3QPH A;  2QA4 A;  4ZGJ B;  2HDA A;  2XHC A;  3MET A;  3VS6 A;  3JCM W;  1YJW T;  1J3T A;  5LL6 S;  3A8G B;  1BB9 A;  4HVW A;  4XTW A;  4M7D C;  3X28 B;  4ATO A;  1AVZ C;  1EFN A;  2RO0 A;  3IQL A;  2LZ6 B;  2VC8 A;  2WSF E;  2LNH B;  5GMK h;  4RG2 A;  4PFP A;  3CCJ T;  1M1K U;  4BB7 A;  1VQ8 T;  3L2R A;  2JTF A;  1PKS A;  4IUU A;  4M77 E;  3X20 B;  4E7L A;  2CUD A;  3M0Q A;  2GF7 A;  2WAC A;  3SDZ A;  3Q1J A;  3CPW A;  1RL2 A;  3CMA A;  4NOY A;  3QWX X;  3VKI A;  3CCR Q;  2EQM A;  2GFU A;  4E7K A;  4KT0 E;  2RI3 A;  4X1V A;  4ESR A;  1FXX A;  3REB B;  3A8L B;  4X34 A;  3M0R A;  4RUG A;  2O88 A;  1U1T A;  3I56 T;  3NGP A;  1HD3 A;  2ZPE B;  2M9U A;  4BE2 A;  5FU7 B;  2IPO B;  5GAN 2;  1JBM A;  3R6O A;  3A8H B;  1I07 A;  1YCY A;  4E47 A;  4BY6 B;  2DMO A;  4HCZ A;  3OS5 A;  1YIJ T;  2QTX A;  4R0K A;  3QZ5 B;  1WHM A;  1W6X A;  3L2U A;  1I5O B;  2YLB A;  1X69 A;  2JT4 A;  3SWN C;  5GMK j;  3UWN A;  3G4S T;  7AT1 B;  1FMV A;  1Y07 A;  1YWP A;  1WJR A;  2XI9 A;  1VQ7 A;  5I2S A;  1X6B A;  2EVR A;  3CEY A;  1VQ9 A;  1E6H A;  4M7D G;  4JRI A;  1KQS A;  3QKJ A;  4LNP A;  5J26 A;  2HQH A;  1M9S A;  1WLP B;  3H0I A;  3X25 B;  3CC7 Q;  2DXU A;  2CRE A;  1VQ5 Q;  2DPP B;  2X4W A;  1KQ2 A;  2E3H A;  5FU6 C;  3JCM h;  1RUW A;  1YHQ A;  1VQ9 T;  2JW4 A;  3L2W A;  3NTI A;  1AHJ B;  4J9C A;  4N0A A;  2LX9 A;  1QCO A;  4L5G A;  4JDS A;  1K8A C;  2QQR A;  5A0D A;  2BKD N;  2RHU A;  1NEB A;  3LGL A;  3M53 A;  4HXJ A;  5LJ3 j;  1U1S A;  1OV3 A;  1I4K 1;  4PJO B;  2VVK A;  2E5K A;  2EFI A;  3P8D A;  1ZLM A;  3QO3 A;  4TVR A;  1GRI A;  2L89 A;  3I9Q A;  3BY7 A;  1WHL A;  4M77 F;  1K0X A;  3JRZ A;  2X51 A;  2KY9 A;  3CD6 T;  1OZ2 A;  2YXY A;  2DEU A;  1E6G A;  4XTU A;  3THK A;  2FPE A;  2JNG A;  1K73 C;  3L2V A;  2QEX Q;  4F7U B;  2RHX A;  2KDS A;  3QYG B;  3CCM A;  3V7S A;  1MMN A;  4F7U E;  1MMG A;  4E2F B;  1MNE A;  2EGC A;  5IHN A;  2ZPI B;  4M77 C;  2KNB B;  4LDW A;  3OYE A;  4PJO A;  2HSP A;  1M90 U;  4Y28 E;  2EQJ A;  3CMA Q;  1JQQ A;  4BI4 A;  5I22 A;  5GAN 5;  3TSW A;  2DL4 A;  1N8R R;  2KYM A;  2DD4 A;  3CCR A;  3S3M A;  1M3B A;  2EGA A;  1DJ7 B;  1Z9Q A;  4J7I A;  4A4H A;  2FYK A;  3EG3 A;  3MCA B;  4FT2 A;  1NG2 A;  2MF2 A;  4HVV A;  5GAM g;  1K76 A;  5FU6 B;  1HXD A;  2A3L A;  4XK8 E;  4ZNX A;  2GTJ A;  5CVI A;  3OS2 A;  4M7A A;  1QP2 A;  2RHI A;  2ZPG B;  2RQW A;  3DLL A;  2RI5 A;  3RKX A;  1M1K C;  4AFU C;  3GOX A;  3ZFJ A;  2E3I A;  1D3B B;  5AT1 B;  2LNV A;  2W10 A;  3L42 A;  2DJQ A;  1RAD B;  4C92 B;  5IHI A;  1NPP A;  2PVD B;  1K73 R;  1UDL A;  2VXF A;  4GLM A;  1Z9Z A;  2OJ2 A;  3QJ6 A;  4NL3 A;  1BCM A;  1VQ9 Q;  4M75 D;  2QQA A;  3MEU A;  4RTZ A;  3EHQ A;  5KYN A;  4OML A;  3ZL7 C;  1IHW A;  2HBW A;  4DBR A;  4BY6 C;  2A0F B;  4XU2 A;  3G7Z A;  4HT9 A;  2C0T A;  3CBM A;  1QCF A;  1YIJ A;  2DIG A;  5FU7 C;  2GGR A;  1CKB A;  5GAN 4;  1T0J A;  5FRO A;  1SG5 A;  1WYX A;  2Y4Y A;  4Z8A A;  5KE2 A;  3ZBD A;  1N8R U;  4EPC A;  2HKN A;  3CCE T;  1ZBX A;  4OMM A;  4P5N A;  3N5B B;  3QXE B;  3QDR B;  3VV0 A;  2L3P A;  3TCJ A;  1UFF A;  3GNG A;  1G3Y A;  2D8H A;  3OYI A;  2LCC A;  2HNI A;  2QEX T;  1AZG B;  2DF6 A;  4LDV A;  5GJV B;  2VAS A;  1SRL A;  4JZ4 A;  1GL5 A;  1Y0M A;  1BI1 A;  3E9F A;  3CQT A;  4OMN A;  3OYJ A;  3U23 A;  2COZ A;  4AG2 C;  3GBQ A;  4C92 F;  2E4H A;  5CR2 A;  3CC4 T;  2V1R A;  2OAU A;  2DL5 A;  1W70 A;  4L59 A;  2LT1 A;  2VV5 A; 
#chains in the Genus database with same CATH homology
 2KT1 A;  2OAW A;  2YUQ A;  1ZUK A;  1KFZ A;  2P4R A;  2K6D A;  1W1F A;  2FPD A;  2J6F A;  3I5S A;  2JMC A;  2LQN A;  1A0N B;  2LQW A;  1UG1 A;  2EPD A;  2J6K A;  2DL7 A;  4A63 B;  2KGT A;  2A37 A;  1OPK A;  4IIO A;  1E7O A;  2SRC A;  4RTT A;  2CSI A;  2JM8 A;  3VS1 A;  1UJY A;  2J05 A;  1OPL A;  4K11 A;  2O9V A;  3RNJ A;  1XOV A;  1JEG A;  1YP5 A;  1GBQ A;  2ED0 A;  4ORZ A;  1ZUY A;  1TG0 A;  4RTX A;  1ZSG A;  2NUZ A;  2H8H A;  2RN8 A;  2RQV A;  4AFZ C;  4JZ3 A;  2RQT A;  2SEM A;  2FG0 A;  2LJ0 A;  2DNU A;  2J6O A;  2K3B A;  4CC7 A;  1WXB A;  1X6G A;  2AK5 A;  2YUO A;  5IHK A;  2AKL A;  1I0C A;  1SEM A;  2YUP A;  4AG1 C;  2X3W D;  4OMQ A;  2MOX A;  1JU5 C;  2PTK A;  2FPF A;  1SHF A;  1G2B A;  2J7I A;  4WCI A;  3KFV A;  3RBB B;  1B3Q A;  3JV3 A;  4AFS C;  2C0O A;  3A98 A;  1AD5 A;  1AWO A;  1PRL C;  1ABO A;  2DE0 X;  1QWF A;  2A36 A;  1ARK A;  3H0H A;  2C0I A;  2L2P A;  2IIM A;  2RF0 A;  1WA7 A;  1WX6 A;  1KIK A;  1VA7 A;  1UJ0 A;  1VYU A;  1ABQ A;  1HSQ A;  1T3L A;  2DIL A;  5IXB A;  2JS0 A;  4Z89 A;  2ED1 A;  2EYY A;  1UUE A;  1NLP C;  2VKN A;  2X3X D;  2QDL A;  2ROT A;  2BTT A;  2M0Y A;  1H92 A;  3VS0 A;  2LCS A;  2DL8 A;  4J9D A;  1Y57 A;  2FEI A;  3VRZ A;  2RNA A;  4RTW A;  4CC4 B;  5IXF A;  2F2V A;  4J9G A;  2KRM A;  3UF4 A;  2KYB A;  3M0P A;  1QKW A;  1M30 A;  2AZV A;  4RTV A;  2HDA A;  4QT7 A;  3VS6 A;  2LP5 A;  1J3T A;  1B07 A;  2K79 A;  1BB9 A;  4HVW A;  2YT6 A;  1AVZ C;  2D8J A;  4CC2 A;  1TUD A;  4EIK A;  1EFN A;  2PNI A;  5HCK A;  4F14 A;  3IQL A;  2LZ6 B;  3M0S A;  3C0C A;  2LNH B;  2BZX A;  3EHR A;  2RQU A;  4J9E A;  1PKS A;  1CSK A;  2BZ8 A;  1RLQ C;  2CUD A;  2D0N A;  3M0Q A;  3VS7 A;  2RQR A;  1ZX6 A;  4DEX A;  3QWX X;  2A08 A;  3I35 A;  4LN2 A;  1WDX A;  3NMZ C;  1K0S A;  4X1V A;  4ESR A;  3REB B;  3M0R A;  1PNJ A;  4RUG A;  2O88 A;  2D1X A;  1K4U S;  3NGP A;  1HD3 A;  3TSZ A;  1GCQ C;  1JXO A;  3I5R A;  2DM1 A;  3EG0 A;  3EG1 A;  1RLP C;  2JMA A;  2ROL A;  2K9G A;  2EYZ A;  4M4Z A;  1BK2 A;  1I07 A;  1GCQ A;  3M0T A;  5I11 A;  2DMO A;  4R0K A;  1NYG A;  3SHW A;  2FO0 A;  3VS3 A;  1W6X A;  2PZ1 A;  4GBQ A;  2EYX A;  2W0Z A;  1X69 A;  2JT4 A;  5FWC A;  2I0N A;  2L3Q A;  2BZY A;  2YDL A;  1TUC A;  2OI3 A;  1YWP A;  4JPB W;  2LJ1 A;  4J9I A;  1AZE A;  1QLY A;  1I1J A;  4HCK A;  2EVR A;  1K1Z A;  1X6B A;  1UEC A;  1YWO A;  1KSW A;  3PE0 A;  3UA7 A;  1E6H A;  4CC3 A;  1IO6 A;  1PKT A;  1WXU A;  4LNP A;  3FJ5 A;  2HCK A;  1T0H A;  1ZBJ A;  1WLP B;  1H3H A;  2CH4 A;  2G6F X;  3H0I A;  1FYN A;  2CRE A;  2O9S A;  4JJD A;  1PWT A;  2F2W A;  1RUW A;  2ECZ A;  3EGU A;  3VS2 A;  2JW4 A;  4JJC A;  4J9C A;  3PVL A;  2CH4 W;  3H41 A;  1GFD A;  2L0A A;  5FW9 A;  1NEB A;  3NHN A;  4HXJ A;  1WI7 A;  4LUD A;  1H8K A;  1OV3 A;  1UHC A;  1QKX A;  1NLO C;  2VVK A;  2E5K A;  1LCK A;  2K2M A;  1K9A A;  1ZLM A;  2NWM A;  4DEY A;  2EKH A;  1GRI A;  3EG2 A;  3I9Q A;  2GTO A;  3M0U A;  2GBQ A;  1AOJ A;  2EBP A;  1NYF A;  2LX7 A;  1K0X A;  3SEM A;  3H0F A;  1YCS B;  1UTI A;  1T3S A;  5L23 A;  1V1C A;  1E6G A;  4JJB A;  3THK A;  2FPE A;  4KRT A;  1GBR A;  4F17 A;  1VYV A;  2JS2 A;  5FWB A;  4J9H A;  3VRY A;  1M3C A;  3R6N A;  1SRM A;  2DVJ A;  4D8D A;  2DYB A;  1GCP A;  1BU1 A;  2EGC A;  5IHN A;  1AWW A;  2V1Q A;  2FRY A;  2KNB B;  1X27 A;  2L3S A;  2KRO A;  1X43 A;  2HSP A;  1WIE A;  2DLP A;  1JQQ A;  1M3A A;  5I22 A;  1ZUU A;  2LJ3 A;  3TSW A;  2DL4 A;  2KYM A;  1M3B A;  2EGA A;  1Z9Q A;  5EC7 A;  2ENM A;  5GJW B;  3EG3 A;  2CDT A;  1NG2 A;  2RPN A;  4HVV A;  1YN8 A;  1PRM C;  1K76 A;  4ZNX A;  2GTJ A;  2EQI A;  1GFC A;  2CSQ A;  2RQW A;  3PVQ A;  1U5S A;  1FMK A;  2DRK A;  4AFU C;  2F2X A;  2KE9 A;  1WFW A;  1OOT A;  4RTU A;  2ABL A;  2KEA A;  5IH2 A;  4OMO A;  2W10 A;  2ESW A;  2DJQ A;  5IHI A;  4HVU A;  1X2K A;  4F16 A;  2EYW A;  1MUZ A;  1UDL A;  4Y92 A;  2KRN A;  2CT4 A;  4GLM A;  4J9F A;  1NM7 A;  1Z9Z A;  5ECA A;  2OJ2 A;  1AEY A;  1RI9 A;  1S1N A;  1BBZ A;  2K7A A;  4RTZ A;  1JO8 A;  2DBM A;  3EHQ A;  2O2O A;  3LH5 A;  4AFQ C;  4OML A;  3ZL7 C;  4D8K A;  2HBW A;  1SPK A;  4LUE A;  2C0T A;  1QCF A;  2GNC A;  4FSS A;  1HJD A;  2JTE A;  1OEB A;  1M8M A;  4RTY A;  1NEG A;  1PHT A;  1UHF A;  2AZS A;  2DBK A;  2KBT A;  2GGR A;  3REA B;  1CKB A;  2J06 A;  1T0J A;  2DL3 A;  1WYX A;  4E6R A;  1UGV A;  4Z8A A;  3VS4 A;  2B86 A;  1M27 C;  2O31 A;  1AWX A;  2CUB A;  3UA6 A;  1VYT A;  4OMM A;  1X2Q A;  2EGE A;  1SSH A;  2L3P A;  3NPF A;  1CKA A;  2KT8 A;  1UFF A;  2YUN A;  2CT3 A;  4LE9 A;  2D8H A;  1U06 A;  2JXB A;  1G83 A;  2XMF A;  1WXT A;  4Z88 A;  2KR3 A;  2YSQ A;  3ULR B;  2JM9 A;  1AZG B;  1MV0 B;  2M51 A;  1UE9 A;  2DRM A;  2DF6 A;  3TVT A;  5GJV B;  3QWY A;  2DX1 A;  1SRL A;  2GQI A;  2LMJ A;  4JZ4 A;  2EW3 A;  1AWJ A;  1N5Z A;  1SHG A;  1U3O A;  1YNZ A;  4OMP A;  1GL5 A;  1Y0M A;  4IIM A;  2RMO A;  2KXC A;  2DA9 A;  2HEQ A;  1MV3 A;  2FRW A;  3CQT A;  3VS5 A;  2KXD A;  4J9B A;  3O5Z A;  1QWE A;  4OMN A;  3U23 A;  4AG2 C;  3GBQ A;  1KJW A;  2VWF A;  2V1R A;  3UAT A;  2MIO A;  2A28 A;  2DL5 A;  1JXM A;  2AKK A;  1W70 A;  2MCN A;  2KRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...