2DILA

Solution structure of the sh3 domain of the human proline-serine-threonine phosphatase-interacting protein 1
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
69
structure length
69
Chain Sequence
b'GSSGSSGAQEYRALYDYTAQNPDELDLSAGDILEVILEGEDGWWTVERNGQRGFVPGSYLEKLSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline-serine-threonine phosphatase-interacting protein 1
publication title Solution structure of the SH3 domain of the human Proline-serine-threonine phosphatase-interacting protein 1
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 5
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dilA00
2EQIA 2AK5A 2JM8A 2DMOA 4Z8AA 1AOJA 2GQIA 4J9BA 4J9GA 3M0TA 3M0PA 2I0NA 1IO6A 3TVTA 1W70A 2RMOA 1OPLA 2KR3A 1M27C 1GFCA 3H0IA 2DF6A 4RTYA 4F16A 1U3OA 2PTKA 1X6BA 2J6KA 1MUZA 2OI3A 4QT7A 2YSQA 1WDXA 1WXBA 3M0SA 1K76A 4J9CA 2KBTA 2E5KA 4AFSC 1X2KA 5FWBA 1WXTA 1B3QA 3EG2A 1T3SA 2CUBA 1UECA 2F2WA 2LCSA 1ZSGA 3RBBB 1PKTA 1W1FA 2D0NA 4RTUA 1G83A 4FSSA 1X2QA 3QWYA 2LNHB 2K3BA 1NYFA 2FPEA 2LQWA 3I5RA 1BB9A 4K11A 1KIKA 2J7IA 1PKSA 4DEYA 1LCKA 2HEQA 4AFUC 3UATA 2O31A 4JZ4A 1W6XA 1AWOA 1SEMA 1M30A 2ECZA 1NEGA 1SRLA 1UE9A 2ROLA 1K0SA 4A63B 1AZEA 4Y92A 3NPFA 4RTTA 2KROA 2OAWA 3LH5A 4OMQA 3RNJA 1TUDA 2DJQA 2HSPA 2FRWA 4M4ZA 2DL7A 2JM9A 1HSQA 2KYBA 1BK2A 1M3CA 4Z89A 3EHQA 3VRYA 1WLPB 1VA7A 2JT4A 1X43A 2JMCA 2KEAA 2CH4A 3I35A 1M3AA 1QKWA 3U23A 1PNJA 5IHNA 3NMZC 5I22A 1HJDA 4ORZA 1ZUUA 2YUPA 1M8MA 2BZXA 3H41A 1CKAA 1UFFA 4F14A 3UF4A 2DYBA 1WXUA 2X3WD 4HVWA 1PRMC 5FWCA 2LJ1A 1BBZA 3VS1A 1M3BA 1GBRA 2PZ1A 1FMKA 2J06A 1JXMA 3EGUA 1VYTA 1UDLA 1T0HA 4AFQC 1E6GA 3PE0A 2KT1A 1UGVA 2EGEA 4OMNA 1NM7A 3VS2A 2XMFA 2FO0A 1RLQC 1RI9A 1GBQA 1QWEA 2O9VA 2L3SA 3TSZA 2ED1A 2JTEA 2EPDA 3H0HA 2J6FA 4HVVA 1UUEA 2KGTA 2DM1A 2KRNA 3NGPA 1U5SA 2DL3A 1PWTA 2DA9A 1WYXA 4OMOA 2GGRA 2BTTA 2RN8A 3CQTA 3VS6A 2MIOA 2DL8A 3UA7A 2O9SA 1G2BA 4KRTA 2D8JA 2CH4W 2ABLA 2DL4A 2FG0A 2YUNA 2K79A 1E7OA 3H0FA 1WX6A 4CC2A 4OMLA 1GL5A 1CKBA 1UJYA 2BZ8A 2C0TA 2PNIA 2JW4A 2QDLA 2CT4A 1NYGA 1GRIA 2JXBA 1V1CA 2LJ0A 1TUCA 2CSIA 1YN8A 1H92A 1K4US 1JQQA 2EYXA 1K0XA 4LN2A 2G6FX 2H8HA 2YUQA 3M0RA 4HXJA 2KRSA 4HVUA 4E6RA 3NHNA 3SHWA 4F17A 2OJ2A 2RQVA 2K9GA 2RQTA 5IXFA 5IHIA 2EGAA 1YWOA 2FPDA 1AVZC 4R0KA 1PHTA 3VS5A 4D8KA 2NWMA 5IH2A 1NEBA 1X27A 2DX1A 1UHCA 1XOVA 2GTJA 3M0UA 1U06A 4EIKA 5I11A 1BU1A 4AFZC 2O88A 2EVRA 4JJBA 2J05A 1S1NA 1VYVA 1NLOC 3I5SA 5ECAA 1HD3A 1OV3A 4JPBW 2EYYA 1ABOA 2EBPA 3UA6A 2HCKA 4J9HA 3VS4A 2KE9A 3REAB 1JO8A 2CUDA 4LNPA 2EGCA 2CT3A 1GCPA 4GBQA 3TSWA 2KXDA 2NUZA 2W0ZA 1I0CA 2DLPA 4GLMA 2VWFA 5GJWB 1WFWA 2YT6A 3KFVA 4X1VA 1WA7A 2AZSA 1RLPC 2F2XA 2FPFA 2O2OA 1NG2A 5EC7A 1UHFA 3GBQA 1YWPA 2EYWA 2RNAA 2FRYA 1X6GA 2DL5A 2AZVA 4ESRA 2YDLA 4HCKA 1QLYA 3IQLA 1B07A 3SEMA 1NLPC 2JS0A 2EW3A 1RUWA 1AWWA 2D8HA 4J9DA 2A28A 1SPKA 2DE0X 1YNZA 2LQNA 1J3TA 1JXOA 2CSQA 2F2VA 1WIEA 2RF0A 3FJ5A 2HBWA 2C0IA 2RPNA 2EKHA 2AKKA 1VYUA 2FEIA 1WI7A 4AG2C 4CC4B 1AEYA 1SRMA 2A08A 2L0AA 2EYZA 5GJVB 4RTZA 1H8KA 1TG0A 2LP5A 2ENMA 5IXBA 3VS7A 3VS0A 3ULRB 4LE9A 2C0OA 1Y0MA 2P4RA 3EG0A 1AWJA 4ZNXA 2VVKA 4JJCA 1ZUKA 1MV3A 2DRMA 1A0NB 2W10A 2VKNA 2CDTA 2SRCA 1N5ZA 3VS3A 3QWXX 1ARKA 3M0QA 2DNUA 2GNCA 2RQUA 2HDAA 4RUGA 2JMAA 4JZ3A 1I07A 4CC7A 1Z9ZA 4OMMA 5HCKA 4Z88A 1SSHA 1YCSB 2YUOA 4J9FA 1K9AA 1EFNA 2KRMA 2V1QA 2DBMA 4D8DA 1JEGA 2K2MA 2MOXA 3C0CA 1MV0B 1X69A 4JJDA 2LX7A 1SHFA 1Y57A 3ZL7C 4CC3A 1T0JA 3PVLA 4RTXA 3I9QA 3A98A 1GCQA 2L3PA 2AKLA 1ABQA 1AWXA 2DVJA 2X3XD 2MCNA 3R6NA 3THKA 1YP5A 2BZYA 4IIOA 2DILA 2A37A 2RQWA 3JV3A 4LUDA 3EG1A 3O5ZA 4WCIA 1K1ZA 2L3QA 2LZ6B 4LUEA 5FW9A 3EHRA 4AG1C 1GCQC 2KXCA 1OPKA 5L23A 4RTWA 2LMJA 2GTOA 2IIMA 1QKXA 1ZUYA 1AZGB 1Z9QA 1QCFA 2RQRA 2D1XA 1CSKA 2M0YA 2CREA 2DRKA 2ESWA 2J6OA 1E6HA 2LJ3A 2KYMA 3EG3A 4J9EA 2SEMA 1QWFA 1PRLC 5IHKA 3PVQA 2ED0A 1FYNA 2GBQA 1JU5C 1SHGA 1UG1A 1H3HA 1GFDA 2L2PA 2M51A 1KJWA 1I1JA 1ZX6A 4DEXA 2DBKA 1ZLMA 3REBB 2A36A 2ROTA 1T3LA 4IIMA 1UJ0A 1KFZA 4OMPA 3VRZA 1OEBA 2K6DA 1ZBJA 2KT8A 1UTIA 1KSWA 2K7AA 2KNBB 1AD5A 2V1RA 4RTVA 2B86A 1OOTA 2JS2A 4J9IA
chains in the Genus database with same CATH superfamily
2EQIA 3WVEB 3GP8A 3QIIA 4IUUA 4Z8AA 2O4XA 2GQIA 1VQOT 4J9BA 5D7UA 2ZPGB 3GF5A 4PLIA 2CKKA 1VUBA 3M54A 1Q95G 1R77A 2I0NA 4B9WA 1K8AR 4EMKB 4KBMB 1VQ8T 2RMOA 2GFUA 2KR3A 2C06A 1JRIA 3H0IA 4TVRA 5GAN5 3CMAA 2EFIA 2PTKA 3OYKA 3X20B 2HBPA 1IB8A 1MUZA 3VU3C 2YSQA 5GAN7 2R5MA 2DTOA 2E5KA 2HKQB 4OP0A 1X2KA 1X6OA 1M9SA 1BIAA 1T3SA 3JCMh 3CXCP 2K3XA 3RBBB 2A7YA 3CCJQ 1NBEB 1FMWA 3H8ZA 5J39A 2LQ8A 1N8RR 4RTUA 4FSSA 1X2QA 2K3BA 3I5RA 1PM3A 1PKSA 3VUBA 5GAN8 1I81A 3M58A 2M1HA 3PIPA 1R8OB 1SKUB 3DB3A 5AYFA 4JZ4A 3BDUA 4BI4A 3E9FA 4KGXB 1SEMA 1NPPA 2JUFA 4ZN3A 4HCBA 5L8RE 1TUGB 4ZGJB 5LJ3f 1K0SA 2RI2A 1W2BP 1AZEA 4Y92A 4JJNK 5FU7B 1VQOA 4RTTA 2KROA 1QVGA 5LJ5h 1TUDA 2HSPA 2FRWA 1VQ8A 3C4SA 5GAN6 4M4ZA 4OB1B 4HT8A 1BK2A 3QPHA 4Z89A 3PMTA 1RAIB 2RI3A 1WLPB 1X43A 4KUIA 3OY9A 3ZEHA 3T9NA 4ATOA 4DA4A 1M8MA 1TSFA 2L3RA 1Q7YR 2WSEE 2HNIA 4C8QC 1KQSS 2DYBA 2KI7A 2X3WD 4PKCC 4HVWA 1PRMC 5FWCA 3LYIA 2PZ1A 1FMKA 3EFOB 2CZ1B 1ZSZA 1BYMA 1UGVA 4OMNA 1D3BA 2XDPA 3ZFJA 2XMFA 4FT4A 4ZGDB 1Q86U 2XG8D 5GAMh 4C0FA 2L3SA 2PU9B 4JRKA 4HVVA 1UUEA 3A8LB 2KGTA 2KRNA 3NGPA 1VQLQ 3PNWC 4F7UG 5CKFA 2GQVA 4B9XA 4OMOA 2FVUA 2X4XA 4X34A 3S3MA 2GF7A 2QEXQ 1WQ7A 2RD1A 1KQSA 5HY6A 4N4GA 3MO8A 4LDUA 3M4GA 4FU6A 2K79A 1E7OA 1YBYA 2YRDA 1UJYA 4BE0A 1K9MR 1KC8C 1IREB 5I2MA 1V1CA 2LNVA 1TUCA 4M77A 3QJ6A 1H92A 2MYSA 2LC4A 1K0XA 4IUTA 2RM4A 4DBFA 5I2SA 3M0RA 4PJOE 1QVPA 2VASA 4Y28E 2QA4T 2K3YA 4A4KA 2FPDA 2BIVA 4M77C 3VS5A 1NEBA 4M78D 1UHCA 1YFNA 2GTJA 2R5AA 4M77F 5M9OA 3I55T 4EIKA 4BI3A 4M7DG 3CPWS 1ZHIA 3OSVA 3M56A 2EVRA 3DLLA 2JN0A 2LQKA 1VYVA 2VGMA 1FWZA 3C95A 5ECAA 2EYYA 1JJ2S 4RG8A 2EBPA 1KD1C 1IZ6A 4M7AC 3JRZA 3BFMA 3GOXA 1O9SA 3MHXA 5LJ5g 1PD0A 2OTLT 1ACMB 4ZGEB 5KYUA 4F7UA 2W0ZA 3QO3A 3OYNA 1QVFS 4GLMA 2VWFA 2RHUA 3OYGA 4EPCA 1RLPC 2F2XA 2FPFA 1NG2A 2XKOC 5CAIA 3AT1B 1YJWQ 3OS1A 1IGQA 1X6GA 2IG0A 2EQUA 3CCQT 4ESRA 4QVZA 4NOYA 1B07A 2CZ7B 2ZPBB 1MNDA 3QXEB 1RUWA 2MWPA 5GAOn 4F7UF 1NZ9A 3DLMA 2QA4A 4J9DA 2A28A 1WHJA 3BE3A 1J3TA 1VQ6T 3ME9A 2CSQA 1WIEA 2MMPA 3FJ5A 3G6EQ 4OB0B 4JUVA 3JSCA 4O5VA 1N6AA 2EAYA 2L8DA 2ZZDA 3I55A 4MMKA 1AT1B 4C0ZA 4LDXA 3OSSC 2A08A 4BI8B 2HL3A 3FLGA 1JJ2A 3PTAA 5GJVB 5GAOl 4ZTJA 1H8KA 1TG0A 2Y4XA 5GAMg 4LD6A 2C0OA 4C8QB 2Y90A 2QQSA 3SB2A 2Y4YA 4GY5A 1NE8A 4JJCA 4ZNXA 4M7DA 2QDYB 2OTLA 2NUPB 3EGXB 4J6XA 3PMIA 2RH2A 1M1GA 3M0QA 2HDAA 1K9MU 2JMAA 4UC4A 3CCQA 1YI2T 1Z9ZA 3SWNA 2H3JA 1SSHA 2YUOA 4C92E 4M7DF 3VJPA 2XK0A 1VQ6A 4XTYA 3C0CA 3CC7T 4IKFA 1SHFA 2JZ2A 4RTXA 2E65A 1QP2A 1Q7YC 2L3PA 1I5LA 2CZ6B 1AWXA 2MCNA 1VQPQ 3THKA 3OS2A 3JB9D 3JV3A 4L5GA 4FYYB 4J83A 3EG1A 1YITT 4WCIA 1K1ZA 2QQRA 2LZ6B 4LUEA 1QP3A 1VQ5Q 1OPKA 5L23A 4RTWA 2K5FA 1I5OB 2GTOA 3CPFA 2D0QB 3P8HA 5GANh 4E47A 1Z9QA 5GAN2 1QCFA 3AHUA 1CSKA 1YI2A 3S3NA 2DRKA 2X9HA 3HRUA 2J6OA 1E6HA 4R56A 5HKCA 2V8IA 4F04B 1N9SA 2E5QA 5LJ3g 1BI2A 3X28B 5IHKA 3CC7A 5CKHA 4B6MA 2GBQA 1JU5C 1SHGA 2VXFA 1UG1A 5LL6S 2IPOB 1YJ9Q 1RADB 1LPLA 4M7AB 3A5ZB 2ROTA 3HSBA 2CS7A 3CCRT 5GMKh 5KE3A 2GFAA 1YITA 3OS0A 1KSWA 3MEVA 4RTVA 4V2SA 4E7ZA 4PJOC 1WZOA 1W2BS 4Q5WA 2AK5A 2KAFA 4C8QE 1AOJA 1RAAB 4KH0B 3JCMf 1Y07A 1VQ9Q 4L6V5 4J5YA 2RHXA 9ATCB 3M0TA 3RR6A 5C6SA 1BCMA 1D0YA 2M16A 4A4EA 3OS5A 1GFCA 1IRXA 1TU0B 1U3OA 2X4JA 1IHWA 1OULA 2YWWA 3RKXA 3LLRA 2I2LA 1WXBA 3FRNA 3M0SA 4J9CA 5D6XA 3PIOA 1M2OA 3CC4Q 2KBTA 3L42A 3S6WA 4BDYA 1VQMQ 3OW2S 4AFSC 1WXTA 4XK8E 2CUBA 1UECA 2F2WA 1PKTA 2QXFA 5CIUA 2D0NA 1OZ2A 2DK3A 3CCRA 3V8KA 2FPEA 2QQ9A 1RACB 1XTDA 3CCMQ 5CKDA 4CRIA 1WHLA 3MEWA 1M90C 1B34A 1NJIC 3E1SA 1TOVA 2O31A 2KK4A 2AHJB 4M75C 1NEGA 3CCLT 2ROLA 3URGA 2OTJT 2PUOB 4II1A 2OAWA 4OMQA 3RNJA 1HSQA 4Y91A 2DERA 1FMVA 1VA7A 2JMCA 4M78G 4NS5A 5GANg 5IHNA 3OYLA 4XTZA 5I22A 3OW2A 2DEUA 1MGQA 1ZUUA 3HPWA 3CD6T 3MP6A 4HT9A 1H3ZA 3EGDA 2EWNA 2FB7A 4BACA 2L5QA 4M77E 3M9QA 2DXTA 1WXUA 1R0CB 4OF1A 2JOYA 4FW2A 1M3BA 3QBYA 2J06A 1Y7XA 3EGUA 1VYTA 1QW1A 5LJ5j 4M7AE 1VQKQ 2EGEA 1NM7A 3VS2A 4PK4A 1QMCA 5KYXB 3CC2T 2FO0A 2X4WA 3RDVA 1M2VA 1QQJA 3CCLA 1VQ7Q 2E10A 2O9VA 2OTJA 2ED1A 1C1AA 2DFUA 4AMCA 3H0HA 2V26A 1OX8A 1LJOA 4RG2A 1WYXA 3HP9A 2QQBA 3CQTA 2KVQG 2MIOA 4NL2A 1X01A 2F1LA 1VQNQ 1RAHB 3CD6A 5KYYB 3UA7A 3CCUQ 1G2BA 4KRTA 2D8JA 2EJ9A 4OGCA 3WVDB 2RB6A 2YUNA 3QDRB 1FX7A 2XDDA 3CBOA 3H0FA 1WX6A 1GL5A 4M78A 1BI3A 2ZCFB 1YHQT 2BZ8A 4LXCA 3OMCA 5GAMj 2FL7A 2QDLA 2CT4A 3QJYA 1GRIA 4FIBA 3MJXA 3NFCA 4D6WA 3HRTA 4PJOB 1VQ4Q 1JQQA 4QW2A 2EYXA 4J7IA 5GMKm 1UB4A 2KRSA 3CC2A 4F17A 4PNOA 3SHWA 5LJ5e 3S3OA 5LJ3d 4M78F 4JLGA 4C5EA 5IHIA 3DB4A 4R0KA 5IH2A 4D8KA 3H6ZA 4DBRA 1X27A 3UPUA 1M5Q1 3MEUA 3M0UA 4XTVA 3I56Q 2XHCA 4RCCA 2OAUA 2DD4A 2J05A 1I4K1 3I5SA 1HD3A 1EIFA 1OV3A 3GNFB 1XJWB 3X24B 5GAN3 1ABOA 3CMAQ 3UA6A 2HCKA 1OX9A 3JB9G 2EGCA 2CT3A 2P0KA 1JBMA 1K73R 4Z02A 2DLPA 3RESA 1YHQA 1WFWA 2YT6A 3KFVA 2AZSA 3LX7A 5EG2A 1Q82U 3LW5E 1UHFA 2LRQA 1XQHA 1YWPA 3VYHB 4M75B 2RI5A 5GAMe 2AZVA 1LNXA 2BKDN 1M1KC 1NLPC 2EW3A 5CVIA 1AWWA 2G3RA 3M57A 1C6VX 1SPKA 1YNZA 3EG9B 2QTXA 2F2VA 4BE1A 2RF0A 3HL8A 3L2WA 1Q81R 2FEIA 2GCXA 3UWNA 4CC4B 1ZSZC 2P4TA 3EAEA 5LJ3j 4WTOB 5IXBA 3VS7A 3VS0A 4FYXB 3CMET 4BE2A 2K57A 4J8OA 1M1FA 1Y0MA 1AWJA 4QQDA 2CP0A 4C0DC 2E3HA 4LDWA 3G6ET 1MV3A 2DRMA 2W10A 2VKNA 2CDTA 3UDCA 1N5ZA 3QWXX 2RQUA 2X4YA 3META 4C92B 1I07A 2P84A 3OYCA 1PCXA 2V8JA 5HCKA 3L2QA 2QI2A 2KQWA 4MZPA 4X9DA 4J9FA 2RJCA 4DBQA 2V1QA 3JCMg 2MOXA 2P0QA 1HK9A 1MV0B 1X69A 3NTKA 1WJQA 4JJDA 2LX7A 3ZL7C 3DKMA 4CC3A 3I9QA 3A98A 4FSXA 3N5BB 3JB9F 1M4ZA 2DVJA 1H641 2X3XD 5GANf 3JCMW 1YP5A 2BZYA 4IIOA 2HL5C 1WHMA 2OX7A 2O4XB 4RCBA 3OYJA 3CMEA 5LJ3e 2L3QA 2X51A 2CYZB 3KXTA 2VYTA 4XU3A 3G6EA 2DXUA 5KYNA 2E70A 1EZZB 1U1TA 1GXIE 3L1AA 1Q86C 1K73U 1ZUYA 1WJRA 2E1HA 3M4YA 3FDRA 3HKSA 5KE2A 2PVGB 3QZ9B 2CREA 1NPRA 1QVGP 2YLBA 1K8AC 2SEMA 2XICA 2EYQA 3CCVT 1C0MA 3BW1A 1LOJA 3FJPA 3PVQA 2ED0A 2LT1A 2NUTA 4M75E 3RKWA 1FYNA 5KH6A 2M0OA 1GFDA 2JTFA 2M02A 3E19A 1I1JA 1Q81U 5CR2A 4ANJA 3CPWA 2LCLA 4C8QD 1D1CA 2LCCA 4IIMA 2AT1B 1ZQ1A 1BKBA 1YCYA 1OEBA 1N8RC 2K6DA 1U1SA 2KT8A 1UTIA 2KNBB 3ZBDA 4C5GA 2B86A 2JS2A 1IXDA 4LDVA 2DETA 4J9IA 1QVFA 4J7FA 3JCMP 3MP1A 2DMOA 2MWOA 3G4ST 3CCET 3RIRA 5CKEA 5DY9A 2IVWA 5HK3A 4J9GA 2ZAEA 2ZPIB 3TVTA 1OPLA 1Y96A 4M7DC 3KUFA 4RTYA 3CCVA 1V29B 4MDXA 1FXXA 4QT7A 1WDXA 3OYFA 1K76A 3BDLA 1ZSZB 1YIJT 1D3BB 2FHDA 1B3QA 3EG2A 1D09B 1KQSP 1VQ9T 3SWNC 3OMGA 5KYWA 3I55Q 2HD0A 5GMKi 2XU8A 1RAEB 2LQWA 3CEYA 5D6YA 5GAOm 1IHVA 2HKNA 2J7IA 4A53A 5GANe 2D9TA 2HEQA 2MI6A 2VC8A 3CC4T 1BI1A 4CI0C 3A8GB 4BY6C 4PJJA 1W6XA 3L2ZA 3G7ZA 4XU0A 1AWOA 1U8RA 3LGFA 1M30A 2ECZA 3CCEA 1LVKA 3G4SA 1UE9A 3X26B 4A63B 3FEOA 4PL6A 2DAQA 3GPLA 2DJQA 4IUPA 4OVAA 4E7IA 1G3YA 3CCQQ 3VRYA 2JT4A 2KEAA 1M3AA 4EMHA 3U23A 2X35A 2DJZA 4LD9K 1O75A 2ZPHB 4M77B 4ORZA 2BZXA 1YIJA 1VQ6Q 5GMKe 4M7AD 1UFFA 4F14A 3SDZA 1YJNQ 4J6YA 1VQ9A 3UF4A 3CXCS 4EMKA 1PG5B 1BI0A 1BBZA 3CBPA 2DZCA 3VS1A 1K9MC 2HQEA 1WPYA 2RHYA 5J3BA 4AFQC 1M90U 3PE0A 7AT1B 4ZN1A 4IUQA 3CC4A 3TQ7P 2PVOB 2XIDA 4DOWA 4HCZA 1RLQC 1RI9A 2CP6A 3JCMd 1GBQA 4PJMA 2JJ9A 5KYUB 4F7UB 3QDFA 2DM1A 1SF9A 3CPWP 2DXCA 4FYVB 3UT1A 2DL3A 1PWTA 2DA9A 1PSFA 3QZ5B 2RHIA 2RN8A 3VS6A 5CK9A 3CCST 2YRVA 1JJ2P 3QUIA 2DL8A 2EQKA 2YXYA 4ELZC 2CGHA 3CXCA 2EKOA 2DL4A 1KHCA 2ZPEB 1QVFP 2HSEB 3M59A 4N0AA 3LWIA 4CC2A 5LJ5d 1MMAA 2C0TA 1VIFA 2PNIA 2JW4A 3LWHA 1NYGA 4C92G 3JCMb 2JXBA 4OMFB 4FT2A 5FU7C 2CSIA 1YN8A 2Z0WA 2COZA 5GAN4 2PVDB 2QGGA 4FYWB 1WJSA 2QG9B 2G6FX 8AT1B 2YUQA 4HXJA 3CCUT 2V8KA 4GLKA 4HVUA 3NHNA 1W2BA 2K9GA 2RQTA 3OYEA 2EGAA 3V7CA 1AVZC 3SD4A 2NWMA 2BE7D 4QQGA 2LDMA 2DX1A 1XOVA 2RK2A 4M7DB 3EFOA 3OYAA 1TXQA 3CCJT 2CP2A 1BU1A 1MMGA 4AFZC 2O88A 4JJBA 2NLUA 1NLOC 5DM7R 3CCSA 4JPBW 4J9HA 3VS4A 1OQKA 3REAB 1JO8A 3SWNB 4LNPA 1BIBA 1GCPA 4GBQA 5GAMd 2XDBA 3TSWA 2KXDA 3A1PA 2NUZA 3ASKA 1I0CA 1KC8R 4JRIA 5GJWB 4X1VA 3I56T 4WF2A 2RO0A 1Q82R 4PJNA 2O2OA 2EJFA 2COYA 5EC7A 3M55A 2EYWA 4PJLA 4BY6B 2FRYA 2DL5A 4EMGA 4XAXB 2YDLA 4HCKA 1QLYA 3IQLA 3NTIA 2B8AA 3SEMA 1WQWA 3CCUA 5D6WA 1WNLA 3A8HB 2LQNA 1JXOA 2YHTA 2HBWA 2DTIA 2RPNA 2EKHA 1G3WA 4N4IA 2QASA 3CCJA 1WI7A 2DIGA 4AG2C 1BCOA 2E6ZA 4RMOA 4OGEA 5KCOA 2VXEA 3VUZA 4MMLA 2XD0A 2AIRB 2L0AA 4QVCA 3D7SB 2KMTA 2EIFA 3G71Q 4RTZA 3L2UA 2LP5A 5GMKl 4LE9A 4F7UE 3NTHA 2JNGA 3JCMe 3OYDA 2P4RA 2LTOA 3HFOA 4JS4A 4C8QG 3P8BB 2VVKA 1S72Q 3EFSA 1A0NB 5AT1B 2CP5A 2SRCA 2D6FA 3I56A 2CZ0B 4AT1B 4PJOD 2DNUA 1OU9A 1TWBA 4KUDK 1QVGS 2DEQA 1VQLT 6AT1B 4CC7A 1M1KU 5FLXE 3A8OB 4OMMA 1UGPB 4DQ2A 1ZA1B 1EFNA 1G5VA 4C5IA 2KRMA 1JEGA 2QEXT 4KT0E 2K2MA 4M78C 5IT9E 2CP3A 1PC0A 3C12A 3J7AF 1Y57A 1VIEA 3PVLA 3L2RA 4O6JA 2HQHA 5C0MA 3CCLQ 3O8VA 2OTJQ 1QCNA 1WHHA 3LGLA 2DILA 2A37A 5CO7A 2RQWA 3OYBA 4M7DE 2DVEA 1N9RA 3O5ZA 5FW9A 3EHRA 4AG1C 3TU4K 2DXBA 1F1BB 1ZBXA 4XU2A 2KXCA 4JLIA 1HXDA 2VUBA 3HFNA 3CD6Q 5GAOr 3OQ5A 8ATCB 1RABB 1W4SA 2IIMA 3EH1A 1KK7A 4M75D 1KC8U 4OB3B 1TS9A 1VQLA 4C8QA 3QYHB 3OB9A 2DTHA 4J9EA 2ATCB 2NUPA 3GIBA 2QEXA 3EGXA 4M77G 4PFOA 3JCMV 2FZCB 3CC2Q 3JB9H 3VV0A 2E3IA 1B34B 3OW2P 2M51A 3FC3A 4X9CA 3JAME 4C8QF 2H3EB 3PFSA 1VQOQ 4EDUA 2JVVA 3HTRA 4YTLA 4M7AG 1YJWT 3A8MB 3JCMX 3MKDA 5J26A 1ZBJA 2E4HA 1VQ8Q 2WACA 1KD1U 5GAOp 4KGZB 1AD5A 1JB0E 2V1RA 1D0XA 1OOTA 1KQ2A 2DZ9A 4PFZA 4C92D 2PUKB 3Q1JA 2JM8A 3BY7A 3EGDB 1PSEA 3RMSA 1YHQQ 3M0PA 4FW1A 1IO6A 1K8AU 4N4HA 2LT4A 5KCHA 1W70A 1M27C 3V8JA 2DPPB 2DF6A 1OZ3A 3L2VA 4F16A 1X6BA 1OYXA 2YRCA 2J6KA 5CCAA 2OI3A 5FU6C 3JCMQ 5GANd 5FWBA 4FM4B 4ZTFA 2QQAA 2WSFE 2VV5A 3JB9I 5FROA 1TTHB 2BE9B 2LCSA 1ZSGA 1W1FA 1M2VB 4MZMA 5A2QE 1N8RU 2NYSA 1G83A 2R58A 3LH0A 3QWYA 1YJWA 1Q82C 4XQ3A 2LNHB 1NYFA 1BB9A 4K11A 2MAMA 1KIKA 3P8DA 4DEYA 4JRQA 1LCKA 4AFUC 3UATA 1G3SA 4BB7A 3RERA 2F5KA 4M7AA 1SRLA 4NL3A 2BUDA 3NPFA 1P92A 2RA2A 3RKYA 3M5AA 1VQPT 3SFMA 5DLOA 3LH5A 2RJDA 2DL7A 2JM9A 3OYHA 2KYBA 4M78B 4A4HA 2HMAA 1M3CA 3EHQA 3E2UA 3I35A 1KG1A 2CH4A 1QKWA 4P5NA 1PNJA 4M7AF 2A0FB 3NMZC 1VQ5T 4KULA 3OA6A 1HJDA 2YUPA 3H41A 1CKAA 3X25B 5LJ3h 1Q7YU 1VOMA 2MPXC 5FRMA 2QYZA 2LJ1A 1WHGA 3C94A 1GBRA 1JXMA 1UDLA 1PD1A 5I21A 2K4YA 1T0HA 1M90R 4LDYA 1E6GA 5GANj 4PLLA 1NJIR 3QG1A 2KT1A 3CMEQ 1Y71A 1XNIA 4E7KA 1UGQB 2R57A 2QAZA 3F70A 1ZA2B 3FB9A 4BD3A 4E7SA 4ME7A 1YJNT 2E64A 1QWEA 3OBWA 1X75C 3TSZA 2JTEA 2EPDA 1VQPA 1YJ9T 3PGGA 2J6FA 3V8LA 2RK1A 2QK0A 1U5SA 4IUVA 2GGRA 3V7SA 1MMDA 2BTTA 3JCMJ 4A54A 1VQ5A 1OI1A 3QKJA 5GMKj 1N27A 2O9SA 2QA4Q 3PT9A 2CH4W 2ABLA 2FG0A 3HHTB 3JCMc 3WXMB 1IGUA 4OMLA 1K73C 3TREA 1CKBA 1D1BA 3INZA 1RI0A 3V7RA 2LJ0A 4FL6A 4BDZA 3VKIA 1B7TA 1K4US 4C0DB 4E2FB 4LN2A 1SG5A 4PJOG 2H8HA 3EH2A 1MMNA 4E6RA 2EQMA 3FIFA 1YJNA 2OJ2A 2RQVA 1VQMT 5IXFA 5GAOq 1YWOA 2OTLQ 1PHTA 1YJ9A 5HK0A 3JB9J 1U06A 2EQJA 2HQXA 3CBMA 1Q81C 4R55A 3RMQA 4DOVA 5I11A 3OYMA 2E12A 1KHIA 2VB6A 4M77D 5FU6B 1S1NA 4DBHA 1UGSB 5KYXA 4JS5A 3CCMT 4C5HA 4HCCA 2FZKB 2CP7A 3CCVQ 5CQXA 4MZTA 2KE9A 4MDWA 2YLCA 2RHZA 2CUDA 3MCAB 4M78E 4FCYA 3QSUA 3VYGA 2VGNA 2DYIA 2RJEA 2K5IA 4A4FA 2FZGB 1WA7A 4BUGA 4XTUA 1RL2A 1RAGB 4A4GA 1M8VA 5CKBA 1D1AA 3GBQA 3ER0A 1RAFB 2RNAA 5KYYA 2FYKA 1NJIU 4OB2B 4M75G 2JS0A 1EX4A 2D8HA 2LVMA 2KDSA 2DE0X 4EMKC 1VQMA 2QTVA 3EFRA 2C0IA 2AKKA 3CCEQ 3G4SQ 1VYUA 2DIQA 4PJOA 3J81E 1AEYA 1MHNA 4HA8A 1SRMA 3E9GA 3TCJA 2EYZA 4JDSA 5CQYA 2E6NA 3CCMA 2ENMA 1YI2Q 2MK5A 3ULRB 5IN1A 1VQKT 1HYOA 1I8FA 3EG0A 4C0GA 1DJ7B 1ZUKA 2LX9A 1YIJQ 2PQWA 4PJOF 1VQ7T 3CC7Q 2XI9A 4HKEA 1SSFA 2NUTB 3VS3A 1G3TA 2A3LA 3HRSA 4RKUE 1ARKA 4E7LA 2GNCA 1WGSA 4RUGA 3TEEA 2KSSA 4JZ3A 2COWA 3OBYA 3G71T 1M1KR 2M9UA 3QHSA 5A0LA 4Z88A 2EJGA 1YCSB 4XTXA 1K9AA 1VQNT 4VUBA 1YITQ 1S72T 4M7DD 2DBMA 4N0AC 4D8DA 1G8XA 5A0DA 2RJFA 1T0JA 2O01E 1GCQA 2AKLA 1ABQA 3R6NA 1TH7A 4M75A 3GLXA 4XTWA 5LJ5f 4KH1B 4JRPA 3RUXA 4LUDA 2KY9A 3MPUB 4J6WA 3EG9A 1VQ4T 4IURA 2ZGWA 1VQKA 2WSCE 2P0PA 3M53A 1GCQC 1Y96B 2HAXA 1AHJB 1VQ7A 2F69A 4M75F 2LMJA 3MP8A 1QKXA 3J80E 1AZGB 4E7JA 4E7HA 2K5LA 4QVDA 3QYGB 5DLQE 1UEBA 3OYIA 2RQRA 2JTMA 2D1XA 4PFPA 3G71A 5FRNA 1QCOA 2DO3A 2M0YA 2ESWA 2LJ3A 1WHKA 3CCRQ 2QGFB 5KYWB 2KYMA 3EG3A 1VQNA 3MEAA 1QWFA 1PRLC 3CMAT 2F5TX 1S72A 3G1JA 2ZPFB 4XU1A 2MF2A 1H3HA 1UGRB 5IAYA 5GAMf 2L2PA 4C92A 1KJWA 4ELYC 4KGVB 1ZX6A 1D0ZA 4DEXA 1KQ1A 2DBKA 1ZLMA 2HZYA 3REBB 2A36A 1T3LA 4QKUA 1UJ0A 1KFZA 4OMPA 3VRZA 1VQ4A 3KBGA 2K2VA 1KD1R 2K7AA 3H9NA 1V76A 4C92C 4QQ6A 3CCSQ 1R0BG 5A0GA 1MNEA 2DD5A 3GNGA 4C92F 2L89A 1Q86R 3OYYA 2E41A 2DKGA 1OU8A 4L59A 3R6OA
chains in the Genus database with same CATH topology
2EQIA 2AK5A 2JM8A 2DMOA 4Z8AA 1AOJA 2GQIA 4J9BA 4J9GA 3M0TA 3M0PA 2I0NA 1IO6A 3TVTA 1W70A 2RMOA 1OPLA 2KR3A 1M27C 1GFCA 3H0IA 2DF6A 4RTYA 4F16A 1U3OA 2PTKA 1X6BA 2J6KA 1MUZA 2OI3A 4QT7A 2YSQA 1WDXA 1WXBA 3M0SA 1K76A 4J9CA 2KBTA 2E5KA 4AFSC 1X2KA 5FWBA 1WXTA 1B3QA 3EG2A 1T3SA 2CUBA 1UECA 2F2WA 2LCSA 1ZSGA 3RBBB 1PKTA 1W1FA 2D0NA 4RTUA 1G83A 4FSSA 1X2QA 3QWYA 2LNHB 2K3BA 1NYFA 2FPEA 2LQWA 3I5RA 1BB9A 4K11A 1KIKA 2J7IA 1PKSA 4DEYA 1LCKA 2HEQA 4AFUC 3UATA 2O31A 4JZ4A 1W6XA 1AWOA 1SEMA 1M30A 2ECZA 1NEGA 1SRLA 1UE9A 2ROLA 1K0SA 4A63B 1AZEA 4Y92A 3NPFA 4RTTA 2KROA 2OAWA 3LH5A 4OMQA 3RNJA 1TUDA 2DJQA 2HSPA 2FRWA 4M4ZA 2DL7A 2JM9A 1HSQA 2KYBA 1BK2A 1M3CA 4Z89A 3EHQA 3VRYA 1WLPB 1VA7A 2JT4A 1X43A 2JMCA 2KEAA 2CH4A 3I35A 1M3AA 1QKWA 3U23A 1PNJA 5IHNA 3NMZC 5I22A 1HJDA 4ORZA 1ZUUA 2YUPA 1M8MA 2BZXA 3H41A 1CKAA 1UFFA 4F14A 3UF4A 2DYBA 1WXUA 2X3WD 4HVWA 1PRMC 5FWCA 2LJ1A 1BBZA 3VS1A 1M3BA 1GBRA 2PZ1A 1FMKA 2J06A 1JXMA 3EGUA 1VYTA 1UDLA 1T0HA 4AFQC 1E6GA 3PE0A 2KT1A 1UGVA 2EGEA 4OMNA 1NM7A 3VS2A 2XMFA 2FO0A 1RLQC 1RI9A 1GBQA 1QWEA 2O9VA 2L3SA 3TSZA 2ED1A 2JTEA 2EPDA 3H0HA 2J6FA 4HVVA 1UUEA 2KGTA 2DM1A 2KRNA 3NGPA 1U5SA 2DL3A 1PWTA 2DA9A 1WYXA 4OMOA 2GGRA 2BTTA 2RN8A 3CQTA 3VS6A 2MIOA 2DL8A 3UA7A 2O9SA 1G2BA 4KRTA 2D8JA 2CH4W 2ABLA 2DL4A 2FG0A 2YUNA 2K79A 1E7OA 3H0FA 1WX6A 4CC2A 4OMLA 1GL5A 1CKBA 1UJYA 2BZ8A 2C0TA 2PNIA 2JW4A 2QDLA 2CT4A 1NYGA 1GRIA 2JXBA 1V1CA 2LJ0A 1TUCA 2CSIA 1YN8A 1H92A 1K4US 1JQQA 2EYXA 1K0XA 4LN2A 2G6FX 2H8HA 2YUQA 3M0RA 4HXJA 2KRSA 4HVUA 4E6RA 3NHNA 3SHWA 4F17A 2OJ2A 2RQVA 2K9GA 2RQTA 5IXFA 5IHIA 2EGAA 1YWOA 2FPDA 1AVZC 4R0KA 1PHTA 3VS5A 4D8KA 2NWMA 5IH2A 1NEBA 1X27A 2DX1A 1UHCA 1XOVA 2GTJA 3M0UA 1U06A 4EIKA 5I11A 1BU1A 4AFZC 2O88A 2EVRA 4JJBA 2J05A 1S1NA 1VYVA 1NLOC 3I5SA 5ECAA 1HD3A 1OV3A 4JPBW 2EYYA 1ABOA 2EBPA 3UA6A 2HCKA 4J9HA 3VS4A 2KE9A 3REAB 1JO8A 2CUDA 4LNPA 2EGCA 2CT3A 1GCPA 4GBQA 3TSWA 2KXDA 2NUZA 2W0ZA 1I0CA 2DLPA 4GLMA 2VWFA 5GJWB 1WFWA 2YT6A 3KFVA 4X1VA 1WA7A 2AZSA 1RLPC 2F2XA 2FPFA 2O2OA 1NG2A 5EC7A 1UHFA 3GBQA 1YWPA 2EYWA 2RNAA 2FRYA 1X6GA 2DL5A 2AZVA 4ESRA 2YDLA 4HCKA 1QLYA 3IQLA 1B07A 3SEMA 1NLPC 2JS0A 2EW3A 1RUWA 1AWWA 2D8HA 4J9DA 2A28A 1SPKA 2DE0X 1YNZA 2LQNA 1J3TA 1JXOA 2CSQA 2F2VA 1WIEA 2RF0A 3FJ5A 2HBWA 2C0IA 2RPNA 2EKHA 2AKKA 1VYUA 2FEIA 1WI7A 4AG2C 4CC4B 1AEYA 1SRMA 2A08A 2L0AA 2EYZA 5GJVB 4RTZA 1H8KA 1TG0A 2LP5A 2ENMA 5IXBA 3VS7A 3VS0A 3ULRB 4LE9A 2C0OA 1Y0MA 2P4RA 3EG0A 1AWJA 4ZNXA 2VVKA 4JJCA 1ZUKA 1MV3A 2DRMA 1A0NB 2W10A 2VKNA 2CDTA 2SRCA 1N5ZA 3VS3A 3QWXX 1ARKA 3M0QA 2DNUA 2GNCA 2RQUA 2HDAA 4RUGA 2JMAA 4JZ3A 1I07A 4CC7A 1Z9ZA 4OMMA 5HCKA 4Z88A 1SSHA 1YCSB 2YUOA 4J9FA 1K9AA 1EFNA 2KRMA 2V1QA 2DBMA 4D8DA 1JEGA 2K2MA 2MOXA 3C0CA 1MV0B 1X69A 4JJDA 2LX7A 1SHFA 1Y57A 3ZL7C 4CC3A 1T0JA 3PVLA 4RTXA 3I9QA 3A98A 1GCQA 2L3PA 2AKLA 1ABQA 1AWXA 2DVJA 2X3XD 2MCNA 3R6NA 3THKA 1YP5A 2BZYA 4IIOA 2DILA 2A37A 2RQWA 3JV3A 4LUDA 3EG1A 3O5ZA 4WCIA 1K1ZA 2L3QA 2LZ6B 4LUEA 5FW9A 3EHRA 4AG1C 1GCQC 2KXCA 1OPKA 5L23A 4RTWA 2LMJA 2GTOA 2IIMA 1QKXA 1ZUYA 1AZGB 1Z9QA 1QCFA 2RQRA 2D1XA 1CSKA 2M0YA 2CREA 2DRKA 2ESWA 2J6OA 1E6HA 2LJ3A 2KYMA 3EG3A 4J9EA 2SEMA 1QWFA 1PRLC 5IHKA 3PVQA 2ED0A 1FYNA 2GBQA 1JU5C 1SHGA 1UG1A 1H3HA 1GFDA 2L2PA 2M51A 1KJWA 1I1JA 1ZX6A 4DEXA 2DBKA 1ZLMA 3REBB 2A36A 2ROTA 1T3LA 4IIMA 1UJ0A 1KFZA 4OMPA 3VRZA 1OEBA 2K6DA 1ZBJA 2KT8A 1UTIA 1KSWA 2K7AA 2KNBB 1AD5A 2V1RA 4RTVA 2B86A 1OOTA 2JS2A 4J9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQI A;  2AK5 A;  2JM8 A;  2DMO A;  4Z8A A;  1AOJ A;  2GQI A;  4J9B A;  4J9G A;  3M0T A;  3M0P A;  2I0N A;  1IO6 A;  3TVT A;  1W70 A;  2RMO A;  1OPL A;  2KR3 A;  1M27 C;  1GFC A;  3H0I A;  2DF6 A;  4RTY A;  4F16 A;  1U3O A;  2PTK A;  1X6B A;  2J6K A;  1MUZ A;  2OI3 A;  4QT7 A;  2YSQ A;  1WDX A;  1WXB A;  3M0S A;  1K76 A;  4J9C A;  2KBT A;  2E5K A;  4AFS C;  1X2K A;  5FWB A;  1WXT A;  1B3Q A;  3EG2 A;  1T3S A;  2CUB A;  1UEC A;  2F2W A;  2LCS A;  1ZSG A;  3RBB B;  1PKT A;  1W1F A;  2D0N A;  4RTU A;  1G83 A;  4FSS A;  1X2Q A;  3QWY A;  2LNH B;  2K3B A;  1NYF A;  2FPE A;  2LQW A;  3I5R A;  1BB9 A;  4K11 A;  1KIK A;  2J7I A;  1PKS A;  4DEY A;  1LCK A;  2HEQ A;  4AFU C;  3UAT A;  2O31 A;  4JZ4 A;  1W6X A;  1AWO A;  1SEM A;  1M30 A;  2ECZ A;  1NEG A;  1SRL A;  1UE9 A;  2ROL A;  1K0S A;  4A63 B;  1AZE A;  4Y92 A;  3NPF A;  4RTT A;  2KRO A;  2OAW A;  3LH5 A;  4OMQ A;  3RNJ A;  1TUD A;  2DJQ A;  2HSP A;  2FRW A;  4M4Z A;  2DL7 A;  2JM9 A;  1HSQ A;  2KYB A;  1BK2 A;  1M3C A;  4Z89 A;  3EHQ A;  3VRY A;  1WLP B;  1VA7 A;  2JT4 A;  1X43 A;  2JMC A;  2KEA A;  2CH4 A;  3I35 A;  1M3A A;  1QKW A;  3U23 A;  1PNJ A;  5IHN A;  3NMZ C;  5I22 A;  1HJD A;  4ORZ A;  1ZUU A;  2YUP A;  1M8M A;  2BZX A;  3H41 A;  1CKA A;  1UFF A;  4F14 A;  3UF4 A;  2DYB A;  1WXU A;  2X3W D;  4HVW A;  1PRM C;  5FWC A;  2LJ1 A;  1BBZ A;  3VS1 A;  1M3B A;  1GBR A;  2PZ1 A;  1FMK A;  2J06 A;  1JXM A;  3EGU A;  1VYT A;  1UDL A;  1T0H A;  4AFQ C;  1E6G A;  3PE0 A;  2KT1 A;  1UGV A;  2EGE A;  4OMN A;  1NM7 A;  3VS2 A;  2XMF A;  2FO0 A;  1RLQ C;  1RI9 A;  1GBQ A;  1QWE A;  2O9V A;  2L3S A;  3TSZ A;  2ED1 A;  2JTE A;  2EPD A;  3H0H A;  2J6F A;  4HVV A;  1UUE A;  2KGT A;  2DM1 A;  2KRN A;  3NGP A;  1U5S A;  2DL3 A;  1PWT A;  2DA9 A;  1WYX A;  4OMO A;  2GGR A;  2BTT A;  2RN8 A;  3CQT A;  3VS6 A;  2MIO A;  2DL8 A;  3UA7 A;  2O9S A;  1G2B A;  4KRT A;  2D8J A;  2CH4 W;  2ABL A;  2DL4 A;  2FG0 A;  2YUN A;  2K79 A;  1E7O A;  3H0F A;  1WX6 A;  4CC2 A;  4OML A;  1GL5 A;  1CKB A;  1UJY A;  2BZ8 A;  2C0T A;  2PNI A;  2JW4 A;  2QDL A;  2CT4 A;  1NYG A;  1GRI A;  2JXB A;  1V1C A;  2LJ0 A;  1TUC A;  2CSI A;  1YN8 A;  1H92 A;  1K4U S;  1JQQ A;  2EYX A;  1K0X A;  4LN2 A;  2G6F X;  2H8H A;  2YUQ A;  3M0R A;  4HXJ A;  2KRS A;  4HVU A;  4E6R A;  3NHN A;  3SHW A;  4F17 A;  2OJ2 A;  2RQV A;  2K9G A;  2RQT A;  5IXF A;  5IHI A;  2EGA A;  1YWO A;  2FPD A;  1AVZ C;  4R0K A;  1PHT A;  3VS5 A;  4D8K A;  2NWM A;  5IH2 A;  1NEB A;  1X27 A;  2DX1 A;  1UHC A;  1XOV A;  2GTJ A;  3M0U A;  1U06 A;  4EIK A;  5I11 A;  1BU1 A;  4AFZ C;  2O88 A;  2EVR A;  4JJB A;  2J05 A;  1S1N A;  1VYV A;  1NLO C;  3I5S A;  5ECA A;  1HD3 A;  1OV3 A;  4JPB W;  2EYY A;  1ABO A;  2EBP A;  3UA6 A;  2HCK A;  4J9H A;  3VS4 A;  2KE9 A;  3REA B;  1JO8 A;  2CUD A;  4LNP A;  2EGC A;  2CT3 A;  1GCP A;  4GBQ A;  3TSW A;  2KXD A;  2NUZ A;  2W0Z A;  1I0C A;  2DLP A;  4GLM A;  2VWF A;  5GJW B;  1WFW A;  2YT6 A;  3KFV A;  4X1V A;  1WA7 A;  2AZS A;  1RLP C;  2F2X A;  2FPF A;  2O2O A;  1NG2 A;  5EC7 A;  1UHF A;  3GBQ A;  1YWP A;  2EYW A;  2RNA A;  2FRY A;  1X6G A;  2DL5 A;  2AZV A;  4ESR A;  2YDL A;  4HCK A;  1QLY A;  3IQL A;  1B07 A;  3SEM A;  1NLP C;  2JS0 A;  2EW3 A;  1RUW A;  1AWW A;  2D8H A;  4J9D A;  2A28 A;  1SPK A;  2DE0 X;  1YNZ A;  2LQN A;  1J3T A;  1JXO A;  2CSQ A;  2F2V A;  1WIE A;  2RF0 A;  3FJ5 A;  2HBW A;  2C0I A;  2RPN A;  2EKH A;  2AKK A;  1VYU A;  2FEI A;  1WI7 A;  4AG2 C;  4CC4 B;  1AEY A;  1SRM A;  2A08 A;  2L0A A;  2EYZ A;  5GJV B;  4RTZ A;  1H8K A;  1TG0 A;  2LP5 A;  2ENM A;  5IXB A;  3VS7 A;  3VS0 A;  3ULR B;  4LE9 A;  2C0O A;  1Y0M A;  2P4R A;  3EG0 A;  1AWJ A;  4ZNX A;  2VVK A;  4JJC A;  1ZUK A;  1MV3 A;  2DRM A;  1A0N B;  2W10 A;  2VKN A;  2CDT A;  2SRC A;  1N5Z A;  3VS3 A;  3QWX X;  1ARK A;  3M0Q A;  2DNU A;  2GNC A;  2RQU A;  2HDA A;  4RUG A;  2JMA A;  4JZ3 A;  1I07 A;  4CC7 A;  1Z9Z A;  4OMM A;  5HCK A;  4Z88 A;  1SSH A;  1YCS B;  2YUO A;  4J9F A;  1K9A A;  1EFN A;  2KRM A;  2V1Q A;  2DBM A;  4D8D A;  1JEG A;  2K2M A;  2MOX A;  3C0C A;  1MV0 B;  1X69 A;  4JJD A;  2LX7 A;  1SHF A;  1Y57 A;  3ZL7 C;  4CC3 A;  1T0J A;  3PVL A;  4RTX A;  3I9Q A;  3A98 A;  1GCQ A;  2L3P A;  2AKL A;  1ABQ A;  1AWX A;  2DVJ A;  2X3X D;  2MCN A;  3R6N A;  3THK A;  1YP5 A;  2BZY A;  4IIO A;  2DIL A;  2A37 A;  2RQW A;  3JV3 A;  4LUD A;  3EG1 A;  3O5Z A;  4WCI A;  1K1Z A;  2L3Q A;  2LZ6 B;  4LUE A;  5FW9 A;  3EHR A;  4AG1 C;  1GCQ C;  2KXC A;  1OPK A;  5L23 A;  4RTW A;  2LMJ A;  2GTO A;  2IIM A;  1QKX A;  1ZUY A;  1AZG B;  1Z9Q A;  1QCF A;  2RQR A;  2D1X A;  1CSK A;  2M0Y A;  2CRE A;  2DRK A;  2ESW A;  2J6O A;  1E6H A;  2LJ3 A;  2KYM A;  3EG3 A;  4J9E A;  2SEM A;  1QWF A;  1PRL C;  5IHK A;  3PVQ A;  2ED0 A;  1FYN A;  2GBQ A;  1JU5 C;  1SHG A;  1UG1 A;  1H3H A;  1GFD A;  2L2P A;  2M51 A;  1KJW A;  1I1J A;  1ZX6 A;  4DEX A;  2DBK A;  1ZLM A;  3REB B;  2A36 A;  2ROT A;  1T3L A;  4IIM A;  1UJ0 A;  1KFZ A;  4OMP A;  3VRZ A;  1OEB A;  2K6D A;  1ZBJ A;  2KT8 A;  1UTI A;  1KSW A;  2K7A A;  2KNB B;  1AD5 A;  2V1R A;  4RTV A;  2B86 A;  1OOT A;  2JS2 A;  4J9I A; 
#chains in the Genus database with same CATH topology
 2EQI A;  3WVE B;  3GP8 A;  3QII A;  4IUU A;  4Z8A A;  2O4X A;  2GQI A;  1VQO T;  4J9B A;  5D7U A;  2ZPG B;  3GF5 A;  4PLI A;  2CKK A;  1VUB A;  3M54 A;  1Q95 G;  1R77 A;  2I0N A;  4B9W A;  1K8A R;  4EMK B;  4KBM B;  1VQ8 T;  2RMO A;  2GFU A;  2KR3 A;  2C06 A;  1JRI A;  3H0I A;  4TVR A;  5GAN 5;  3CMA A;  2EFI A;  2PTK A;  3OYK A;  3X20 B;  2HBP A;  1IB8 A;  1MUZ A;  3VU3 C;  2YSQ A;  5GAN 7;  2R5M A;  2DTO A;  2E5K A;  2HKQ B;  4OP0 A;  1X2K A;  1X6O A;  1M9S A;  1BIA A;  1T3S A;  3JCM h;  3CXC P;  2K3X A;  3RBB B;  2A7Y A;  3CCJ Q;  1NBE B;  1FMW A;  3H8Z A;  5J39 A;  2LQ8 A;  1N8R R;  4RTU A;  4FSS A;  1X2Q A;  2K3B A;  3I5R A;  1PM3 A;  1PKS A;  3VUB A;  5GAN 8;  1I81 A;  3M58 A;  2M1H A;  3PIP A;  1R8O B;  1SKU B;  3DB3 A;  5AYF A;  4JZ4 A;  3BDU A;  4BI4 A;  3E9F A;  4KGX B;  1SEM A;  1NPP A;  2JUF A;  4ZN3 A;  4HCB A;  5L8R E;  1TUG B;  4ZGJ B;  5LJ3 f;  1K0S A;  2RI2 A;  1W2B P;  1AZE A;  4Y92 A;  4JJN K;  5FU7 B;  1VQO A;  4RTT A;  2KRO A;  1QVG A;  5LJ5 h;  1TUD A;  2HSP A;  2FRW A;  1VQ8 A;  3C4S A;  5GAN 6;  4M4Z A;  4OB1 B;  4HT8 A;  1BK2 A;  3QPH A;  4Z89 A;  3PMT A;  1RAI B;  2RI3 A;  1WLP B;  1X43 A;  4KUI A;  3OY9 A;  3ZEH A;  3T9N A;  4ATO A;  4DA4 A;  1M8M A;  1TSF A;  2L3R A;  1Q7Y R;  2WSE E;  2HNI A;  4C8Q C;  1KQS S;  2DYB A;  2KI7 A;  2X3W D;  4PKC C;  4HVW A;  1PRM C;  5FWC A;  3LYI A;  2PZ1 A;  1FMK A;  3EFO B;  2CZ1 B;  1ZSZ A;  1BYM A;  1UGV A;  4OMN A;  1D3B A;  2XDP A;  3ZFJ A;  2XMF A;  4FT4 A;  4ZGD B;  1Q86 U;  2XG8 D;  5GAM h;  4C0F A;  2L3S A;  2PU9 B;  4JRK A;  4HVV A;  1UUE A;  3A8L B;  2KGT A;  2KRN A;  3NGP A;  1VQL Q;  3PNW C;  4F7U G;  5CKF A;  2GQV A;  4B9X A;  4OMO A;  2FVU A;  2X4X A;  4X34 A;  3S3M A;  2GF7 A;  2QEX Q;  1WQ7 A;  2RD1 A;  1KQS A;  5HY6 A;  4N4G A;  3MO8 A;  4LDU A;  3M4G A;  4FU6 A;  2K79 A;  1E7O A;  1YBY A;  2YRD A;  1UJY A;  4BE0 A;  1K9M R;  1KC8 C;  1IRE B;  5I2M A;  1V1C A;  2LNV A;  1TUC A;  4M77 A;  3QJ6 A;  1H92 A;  2MYS A;  2LC4 A;  1K0X A;  4IUT A;  2RM4 A;  4DBF A;  5I2S A;  3M0R A;  4PJO E;  1QVP A;  2VAS A;  4Y28 E;  2QA4 T;  2K3Y A;  4A4K A;  2FPD A;  2BIV A;  4M77 C;  3VS5 A;  1NEB A;  4M78 D;  1UHC A;  1YFN A;  2GTJ A;  2R5A A;  4M77 F;  5M9O A;  3I55 T;  4EIK A;  4BI3 A;  4M7D G;  3CPW S;  1ZHI A;  3OSV A;  3M56 A;  2EVR A;  3DLL A;  2JN0 A;  2LQK A;  1VYV A;  2VGM A;  1FWZ A;  3C95 A;  5ECA A;  2EYY A;  1JJ2 S;  4RG8 A;  2EBP A;  1KD1 C;  1IZ6 A;  4M7A C;  3JRZ A;  3BFM A;  3GOX A;  1O9S A;  3MHX A;  5LJ5 g;  1PD0 A;  2OTL T;  1ACM B;  4ZGE B;  5KYU A;  4F7U A;  2W0Z A;  3QO3 A;  3OYN A;  1QVF S;  4GLM A;  2VWF A;  2RHU A;  3OYG A;  4EPC A;  1RLP C;  2F2X A;  2FPF A;  1NG2 A;  2XKO C;  5CAI A;  3AT1 B;  1YJW Q;  3OS1 A;  1IGQ A;  1X6G A;  2IG0 A;  2EQU A;  3CCQ T;  4ESR A;  4QVZ A;  4NOY A;  1B07 A;  2CZ7 B;  2ZPB B;  1MND A;  3QXE B;  1RUW A;  2MWP A;  5GAO n;  4F7U F;  1NZ9 A;  3DLM A;  2QA4 A;  4J9D A;  2A28 A;  1WHJ A;  3BE3 A;  1J3T A;  1VQ6 T;  3ME9 A;  2CSQ A;  1WIE A;  2MMP A;  3FJ5 A;  3G6E Q;  4OB0 B;  4JUV A;  3JSC A;  4O5V A;  1N6A A;  2EAY A;  2L8D A;  2ZZD A;  3I55 A;  4MMK A;  1AT1 B;  4C0Z A;  4LDX A;  3OSS C;  2A08 A;  4BI8 B;  2HL3 A;  3FLG A;  1JJ2 A;  3PTA A;  5GJV B;  5GAO l;  4ZTJ A;  1H8K A;  1TG0 A;  2Y4X A;  5GAM g;  4LD6 A;  2C0O A;  4C8Q B;  2Y90 A;  2QQS A;  3SB2 A;  2Y4Y A;  4GY5 A;  1NE8 A;  4JJC A;  4ZNX A;  4M7D A;  2QDY B;  2OTL A;  2NUP B;  3EGX B;  4J6X A;  3PMI A;  2RH2 A;  1M1G A;  3M0Q A;  2HDA A;  1K9M U;  2JMA A;  4UC4 A;  3CCQ A;  1YI2 T;  1Z9Z A;  3SWN A;  2H3J A;  1SSH A;  2YUO A;  4C92 E;  4M7D F;  3VJP A;  2XK0 A;  1VQ6 A;  4XTY A;  3C0C A;  3CC7 T;  4IKF A;  1SHF A;  2JZ2 A;  4RTX A;  2E65 A;  1QP2 A;  1Q7Y C;  2L3P A;  1I5L A;  2CZ6 B;  1AWX A;  2MCN A;  1VQP Q;  3THK A;  3OS2 A;  3JB9 D;  3JV3 A;  4L5G A;  4FYY B;  4J83 A;  3EG1 A;  1YIT T;  4WCI A;  1K1Z A;  2QQR A;  2LZ6 B;  4LUE A;  1QP3 A;  1VQ5 Q;  1OPK A;  5L23 A;  4RTW A;  2K5F A;  1I5O B;  2GTO A;  3CPF A;  2D0Q B;  3P8H A;  5GAN h;  4E47 A;  1Z9Q A;  5GAN 2;  1QCF A;  3AHU A;  1CSK A;  1YI2 A;  3S3N A;  2DRK A;  2X9H A;  3HRU A;  2J6O A;  1E6H A;  4R56 A;  5HKC A;  2V8I A;  4F04 B;  1N9S A;  2E5Q A;  5LJ3 g;  1BI2 A;  3X28 B;  5IHK A;  3CC7 A;  5CKH A;  4B6M A;  2GBQ A;  1JU5 C;  1SHG A;  2VXF A;  1UG1 A;  5LL6 S;  2IPO B;  1YJ9 Q;  1RAD B;  1LPL A;  4M7A B;  3A5Z B;  2ROT A;  3HSB A;  2CS7 A;  3CCR T;  5GMK h;  5KE3 A;  2GFA A;  1YIT A;  3OS0 A;  1KSW A;  3MEV A;  4RTV A;  4V2S A;  4E7Z A;  4PJO C;  1WZO A;  1W2B S;  4Q5W A;  2AK5 A;  2KAF A;  4C8Q E;  1AOJ A;  1RAA B;  4KH0 B;  3JCM f;  1Y07 A;  1VQ9 Q;  4L6V 5;  4J5Y A;  2RHX A;  9ATC B;  3M0T A;  3RR6 A;  5C6S A;  1BCM A;  1D0Y A;  2M16 A;  4A4E A;  3OS5 A;  1GFC A;  1IRX A;  1TU0 B;  1U3O A;  2X4J A;  1IHW A;  1OUL A;  2YWW A;  3RKX A;  3LLR A;  2I2L A;  1WXB A;  3FRN A;  3M0S A;  4J9C A;  5D6X A;  3PIO A;  1M2O A;  3CC4 Q;  2KBT A;  3L42 A;  3S6W A;  4BDY A;  1VQM Q;  3OW2 S;  4AFS C;  1WXT A;  4XK8 E;  2CUB A;  1UEC A;  2F2W A;  1PKT A;  2QXF A;  5CIU A;  2D0N A;  1OZ2 A;  2DK3 A;  3CCR A;  3V8K A;  2FPE A;  2QQ9 A;  1RAC B;  1XTD A;  3CCM Q;  5CKD A;  4CRI A;  1WHL A;  3MEW A;  1M90 C;  1B34 A;  1NJI C;  3E1S A;  1TOV A;  2O31 A;  2KK4 A;  2AHJ B;  4M75 C;  1NEG A;  3CCL T;  2ROL A;  3URG A;  2OTJ T;  2PUO B;  4II1 A;  2OAW A;  4OMQ A;  3RNJ A;  1HSQ A;  4Y91 A;  2DER A;  1FMV A;  1VA7 A;  2JMC A;  4M78 G;  4NS5 A;  5GAN g;  5IHN A;  3OYL A;  4XTZ A;  5I22 A;  3OW2 A;  2DEU A;  1MGQ A;  1ZUU A;  3HPW A;  3CD6 T;  3MP6 A;  4HT9 A;  1H3Z A;  3EGD A;  2EWN A;  2FB7 A;  4BAC A;  2L5Q A;  4M77 E;  3M9Q A;  2DXT A;  1WXU A;  1R0C B;  4OF1 A;  2JOY A;  4FW2 A;  1M3B A;  3QBY A;  2J06 A;  1Y7X A;  3EGU A;  1VYT A;  1QW1 A;  5LJ5 j;  4M7A E;  1VQK Q;  2EGE A;  1NM7 A;  3VS2 A;  4PK4 A;  1QMC A;  5KYX B;  3CC2 T;  2FO0 A;  2X4W A;  3RDV A;  1M2V A;  1QQJ A;  3CCL A;  1VQ7 Q;  2E10 A;  2O9V A;  2OTJ A;  2ED1 A;  1C1A A;  2DFU A;  4AMC A;  3H0H A;  2V26 A;  1OX8 A;  1LJO A;  4RG2 A;  1WYX A;  3HP9 A;  2QQB A;  3CQT A;  2KVQ G;  2MIO A;  4NL2 A;  1X01 A;  2F1L A;  1VQN Q;  1RAH B;  3CD6 A;  5KYY B;  3UA7 A;  3CCU Q;  1G2B A;  4KRT A;  2D8J A;  2EJ9 A;  4OGC A;  3WVD B;  2RB6 A;  2YUN A;  3QDR B;  1FX7 A;  2XDD A;  3CBO A;  3H0F A;  1WX6 A;  1GL5 A;  4M78 A;  1BI3 A;  2ZCF B;  1YHQ T;  2BZ8 A;  4LXC A;  3OMC A;  5GAM j;  2FL7 A;  2QDL A;  2CT4 A;  3QJY A;  1GRI A;  4FIB A;  3MJX A;  3NFC A;  4D6W A;  3HRT A;  4PJO B;  1VQ4 Q;  1JQQ A;  4QW2 A;  2EYX A;  4J7I A;  5GMK m;  1UB4 A;  2KRS A;  3CC2 A;  4F17 A;  4PNO A;  3SHW A;  5LJ5 e;  3S3O A;  5LJ3 d;  4M78 F;  4JLG A;  4C5E A;  5IHI A;  3DB4 A;  4R0K A;  5IH2 A;  4D8K A;  3H6Z A;  4DBR A;  1X27 A;  3UPU A;  1M5Q 1;  3MEU A;  3M0U A;  4XTV A;  3I56 Q;  2XHC A;  4RCC A;  2OAU A;  2DD4 A;  2J05 A;  1I4K 1;  3I5S A;  1HD3 A;  1EIF A;  1OV3 A;  3GNF B;  1XJW B;  3X24 B;  5GAN 3;  1ABO A;  3CMA Q;  3UA6 A;  2HCK A;  1OX9 A;  3JB9 G;  2EGC A;  2CT3 A;  2P0K A;  1JBM A;  1K73 R;  4Z02 A;  2DLP A;  3RES A;  1YHQ A;  1WFW A;  2YT6 A;  3KFV A;  2AZS A;  3LX7 A;  5EG2 A;  1Q82 U;  3LW5 E;  1UHF A;  2LRQ A;  1XQH A;  1YWP A;  3VYH B;  4M75 B;  2RI5 A;  5GAM e;  2AZV A;  1LNX A;  2BKD N;  1M1K C;  1NLP C;  2EW3 A;  5CVI A;  1AWW A;  2G3R A;  3M57 A;  1C6V X;  1SPK A;  1YNZ A;  3EG9 B;  2QTX A;  2F2V A;  4BE1 A;  2RF0 A;  3HL8 A;  3L2W A;  1Q81 R;  2FEI A;  2GCX A;  3UWN A;  4CC4 B;  1ZSZ C;  2P4T A;  3EAE A;  5LJ3 j;  4WTO B;  5IXB A;  3VS7 A;  3VS0 A;  4FYX B;  3CME T;  4BE2 A;  2K57 A;  4J8O A;  1M1F A;  1Y0M A;  1AWJ A;  4QQD A;  2CP0 A;  4C0D C;  2E3H A;  4LDW A;  3G6E T;  1MV3 A;  2DRM A;  2W10 A;  2VKN A;  2CDT A;  3UDC A;  1N5Z A;  3QWX X;  2RQU A;  2X4Y A;  3MET A;  4C92 B;  1I07 A;  2P84 A;  3OYC A;  1PCX A;  2V8J A;  5HCK A;  3L2Q A;  2QI2 A;  2KQW A;  4MZP A;  4X9D A;  4J9F A;  2RJC A;  4DBQ A;  2V1Q A;  3JCM g;  2MOX A;  2P0Q A;  1HK9 A;  1MV0 B;  1X69 A;  3NTK A;  1WJQ A;  4JJD A;  2LX7 A;  3ZL7 C;  3DKM A;  4CC3 A;  3I9Q A;  3A98 A;  4FSX A;  3N5B B;  3JB9 F;  1M4Z A;  2DVJ A;  1H64 1;  2X3X D;  5GAN f;  3JCM W;  1YP5 A;  2BZY A;  4IIO A;  2HL5 C;  1WHM A;  2OX7 A;  2O4X B;  4RCB A;  3OYJ A;  3CME A;  5LJ3 e;  2L3Q A;  2X51 A;  2CYZ B;  3KXT A;  2VYT A;  4XU3 A;  3G6E A;  2DXU A;  5KYN A;  2E70 A;  1EZZ B;  1U1T A;  1GXI E;  3L1A A;  1Q86 C;  1K73 U;  1ZUY A;  1WJR A;  2E1H A;  3M4Y A;  3FDR A;  3HKS A;  5KE2 A;  2PVG B;  3QZ9 B;  2CRE A;  1NPR A;  1QVG P;  2YLB A;  1K8A C;  2SEM A;  2XIC A;  2EYQ A;  3CCV T;  1C0M A;  3BW1 A;  1LOJ A;  3FJP A;  3PVQ A;  2ED0 A;  2LT1 A;  2NUT A;  4M75 E;  3RKW A;  1FYN A;  5KH6 A;  2M0O A;  1GFD A;  2JTF A;  2M02 A;  3E19 A;  1I1J A;  1Q81 U;  5CR2 A;  4ANJ A;  3CPW A;  2LCL A;  4C8Q D;  1D1C A;  2LCC A;  4IIM A;  2AT1 B;  1ZQ1 A;  1BKB A;  1YCY A;  1OEB A;  1N8R C;  2K6D A;  1U1S A;  2KT8 A;  1UTI A;  2KNB B;  3ZBD A;  4C5G A;  2B86 A;  2JS2 A;  1IXD A;  4LDV A;  2DET A;  4J9I A;  1QVF A;  4J7F A;  3JCM P;  3MP1 A;  2DMO A;  2MWO A;  3G4S T;  3CCE T;  3RIR A;  5CKE A;  5DY9 A;  2IVW A;  5HK3 A;  4J9G A;  2ZAE A;  2ZPI B;  3TVT A;  1OPL A;  1Y96 A;  4M7D C;  3KUF A;  4RTY A;  3CCV A;  1V29 B;  4MDX A;  1FXX A;  4QT7 A;  1WDX A;  3OYF A;  1K76 A;  3BDL A;  1ZSZ B;  1YIJ T;  1D3B B;  2FHD A;  1B3Q A;  3EG2 A;  1D09 B;  1KQS P;  1VQ9 T;  3SWN C;  3OMG A;  5KYW A;  3I55 Q;  2HD0 A;  5GMK i;  2XU8 A;  1RAE B;  2LQW A;  3CEY A;  5D6Y A;  5GAO m;  1IHV A;  2HKN A;  2J7I A;  4A53 A;  5GAN e;  2D9T A;  2HEQ A;  2MI6 A;  2VC8 A;  3CC4 T;  1BI1 A;  4CI0 C;  3A8G B;  4BY6 C;  4PJJ A;  1W6X A;  3L2Z A;  3G7Z A;  4XU0 A;  1AWO A;  1U8R A;  3LGF A;  1M30 A;  2ECZ A;  3CCE A;  1LVK A;  3G4S A;  1UE9 A;  3X26 B;  4A63 B;  3FEO A;  4PL6 A;  2DAQ A;  3GPL A;  2DJQ A;  4IUP A;  4OVA A;  4E7I A;  1G3Y A;  3CCQ Q;  3VRY A;  2JT4 A;  2KEA A;  1M3A A;  4EMH A;  3U23 A;  2X35 A;  2DJZ A;  4LD9 K;  1O75 A;  2ZPH B;  4M77 B;  4ORZ A;  2BZX A;  1YIJ A;  1VQ6 Q;  5GMK e;  4M7A D;  1UFF A;  4F14 A;  3SDZ A;  1YJN Q;  4J6Y A;  1VQ9 A;  3UF4 A;  3CXC S;  4EMK A;  1PG5 B;  1BI0 A;  1BBZ A;  3CBP A;  2DZC A;  3VS1 A;  1K9M C;  2HQE A;  1WPY A;  2RHY A;  5J3B A;  4AFQ C;  1M90 U;  3PE0 A;  7AT1 B;  4ZN1 A;  4IUQ A;  3CC4 A;  3TQ7 P;  2PVO B;  2XID A;  4DOW A;  4HCZ A;  1RLQ C;  1RI9 A;  2CP6 A;  3JCM d;  1GBQ A;  4PJM A;  2JJ9 A;  5KYU B;  4F7U B;  3QDF A;  2DM1 A;  1SF9 A;  3CPW P;  2DXC A;  4FYV B;  3UT1 A;  2DL3 A;  1PWT A;  2DA9 A;  1PSF A;  3QZ5 B;  2RHI A;  2RN8 A;  3VS6 A;  5CK9 A;  3CCS T;  2YRV A;  1JJ2 P;  3QUI A;  2DL8 A;  2EQK A;  2YXY A;  4ELZ C;  2CGH A;  3CXC A;  2EKO A;  2DL4 A;  1KHC A;  2ZPE B;  1QVF P;  2HSE B;  3M59 A;  4N0A A;  3LWI A;  4CC2 A;  5LJ5 d;  1MMA A;  2C0T A;  1VIF A;  2PNI A;  2JW4 A;  3LWH A;  1NYG A;  4C92 G;  3JCM b;  2JXB A;  4OMF B;  4FT2 A;  5FU7 C;  2CSI A;  1YN8 A;  2Z0W A;  2COZ A;  5GAN 4;  2PVD B;  2QGG A;  4FYW B;  1WJS A;  2QG9 B;  2G6F X;  8AT1 B;  2YUQ A;  4HXJ A;  3CCU T;  2V8K A;  4GLK A;  4HVU A;  3NHN A;  1W2B A;  2K9G A;  2RQT A;  3OYE A;  2EGA A;  3V7C A;  1AVZ C;  3SD4 A;  2NWM A;  2BE7 D;  4QQG A;  2LDM A;  2DX1 A;  1XOV A;  2RK2 A;  4M7D B;  3EFO A;  3OYA A;  1TXQ A;  3CCJ T;  2CP2 A;  1BU1 A;  1MMG A;  4AFZ C;  2O88 A;  4JJB A;  2NLU A;  1NLO C;  5DM7 R;  3CCS A;  4JPB W;  4J9H A;  3VS4 A;  1OQK A;  3REA B;  1JO8 A;  3SWN B;  4LNP A;  1BIB A;  1GCP A;  4GBQ A;  5GAM d;  2XDB A;  3TSW A;  2KXD A;  3A1P A;  2NUZ A;  3ASK A;  1I0C A;  1KC8 R;  4JRI A;  5GJW B;  4X1V A;  3I56 T;  4WF2 A;  2RO0 A;  1Q82 R;  4PJN A;  2O2O A;  2EJF A;  2COY A;  5EC7 A;  3M55 A;  2EYW A;  4PJL A;  4BY6 B;  2FRY A;  2DL5 A;  4EMG A;  4XAX B;  2YDL A;  4HCK A;  1QLY A;  3IQL A;  3NTI A;  2B8A A;  3SEM A;  1WQW A;  3CCU A;  5D6W A;  1WNL A;  3A8H B;  2LQN A;  1JXO A;  2YHT A;  2HBW A;  2DTI A;  2RPN A;  2EKH A;  1G3W A;  4N4I A;  2QAS A;  3CCJ A;  1WI7 A;  2DIG A;  4AG2 C;  1BCO A;  2E6Z A;  4RMO A;  4OGE A;  5KCO A;  2VXE A;  3VUZ A;  4MML A;  2XD0 A;  2AIR B;  2L0A A;  4QVC A;  3D7S B;  2KMT A;  2EIF A;  3G71 Q;  4RTZ A;  3L2U A;  2LP5 A;  5GMK l;  4LE9 A;  4F7U E;  3NTH A;  2JNG A;  3JCM e;  3OYD A;  2P4R A;  2LTO A;  3HFO A;  4JS4 A;  4C8Q G;  3P8B B;  2VVK A;  1S72 Q;  3EFS A;  1A0N B;  5AT1 B;  2CP5 A;  2SRC A;  2D6F A;  3I56 A;  2CZ0 B;  4AT1 B;  4PJO D;  2DNU A;  1OU9 A;  1TWB A;  4KUD K;  1QVG S;  2DEQ A;  1VQL T;  6AT1 B;  4CC7 A;  1M1K U;  5FLX E;  3A8O B;  4OMM A;  1UGP B;  4DQ2 A;  1ZA1 B;  1EFN A;  1G5V A;  4C5I A;  2KRM A;  1JEG A;  2QEX T;  4KT0 E;  2K2M A;  4M78 C;  5IT9 E;  2CP3 A;  1PC0 A;  3C12 A;  3J7A F;  1Y57 A;  1VIE A;  3PVL A;  3L2R A;  4O6J A;  2HQH A;  5C0M A;  3CCL Q;  3O8V A;  2OTJ Q;  1QCN A;  1WHH A;  3LGL A;  2DIL A;  2A37 A;  5CO7 A;  2RQW A;  3OYB A;  4M7D E;  2DVE A;  1N9R A;  3O5Z A;  5FW9 A;  3EHR A;  4AG1 C;  3TU4 K;  2DXB A;  1F1B B;  1ZBX A;  4XU2 A;  2KXC A;  4JLI A;  1HXD A;  2VUB A;  3HFN A;  3CD6 Q;  5GAO r;  3OQ5 A;  8ATC B;  1RAB B;  1W4S A;  2IIM A;  3EH1 A;  1KK7 A;  4M75 D;  1KC8 U;  4OB3 B;  1TS9 A;  1VQL A;  4C8Q A;  3QYH B;  3OB9 A;  2DTH A;  4J9E A;  2ATC B;  2NUP A;  3GIB A;  2QEX A;  3EGX A;  4M77 G;  4PFO A;  3JCM V;  2FZC B;  3CC2 Q;  3JB9 H;  3VV0 A;  2E3I A;  1B34 B;  3OW2 P;  2M51 A;  3FC3 A;  4X9C A;  3JAM E;  4C8Q F;  2H3E B;  3PFS A;  1VQO Q;  4EDU A;  2JVV A;  3HTR A;  4YTL A;  4M7A G;  1YJW T;  3A8M B;  3JCM X;  3MKD A;  5J26 A;  1ZBJ A;  2E4H A;  1VQ8 Q;  2WAC A;  1KD1 U;  5GAO p;  4KGZ B;  1AD5 A;  1JB0 E;  2V1R A;  1D0X A;  1OOT A;  1KQ2 A;  2DZ9 A;  4PFZ A;  4C92 D;  2PUK B;  3Q1J A;  2JM8 A;  3BY7 A;  3EGD B;  1PSE A;  3RMS A;  1YHQ Q;  3M0P A;  4FW1 A;  1IO6 A;  1K8A U;  4N4H A;  2LT4 A;  5KCH A;  1W70 A;  1M27 C;  3V8J A;  2DPP B;  2DF6 A;  1OZ3 A;  3L2V A;  4F16 A;  1X6B A;  1OYX A;  2YRC A;  2J6K A;  5CCA A;  2OI3 A;  5FU6 C;  3JCM Q;  5GAN d;  5FWB A;  4FM4 B;  4ZTF A;  2QQA A;  2WSF E;  2VV5 A;  3JB9 I;  5FRO A;  1TTH B;  2BE9 B;  2LCS A;  1ZSG A;  1W1F A;  1M2V B;  4MZM A;  5A2Q E;  1N8R U;  2NYS A;  1G83 A;  2R58 A;  3LH0 A;  3QWY A;  1YJW A;  1Q82 C;  4XQ3 A;  2LNH B;  1NYF A;  1BB9 A;  4K11 A;  2MAM A;  1KIK A;  3P8D A;  4DEY A;  4JRQ A;  1LCK A;  4AFU C;  3UAT A;  1G3S A;  4BB7 A;  3RER A;  2F5K A;  4M7A A;  1SRL A;  4NL3 A;  2BUD A;  3NPF A;  1P92 A;  2RA2 A;  3RKY A;  3M5A A;  1VQP T;  3SFM A;  5DLO A;  3LH5 A;  2RJD A;  2DL7 A;  2JM9 A;  3OYH A;  2KYB A;  4M78 B;  4A4H A;  2HMA A;  1M3C A;  3EHQ A;  3E2U A;  3I35 A;  1KG1 A;  2CH4 A;  1QKW A;  4P5N A;  1PNJ A;  4M7A F;  2A0F B;  3NMZ C;  1VQ5 T;  4KUL A;  3OA6 A;  1HJD A;  2YUP A;  3H41 A;  1CKA A;  3X25 B;  5LJ3 h;  1Q7Y U;  1VOM A;  2MPX C;  5FRM A;  2QYZ A;  2LJ1 A;  1WHG A;  3C94 A;  1GBR A;  1JXM A;  1UDL A;  1PD1 A;  5I21 A;  2K4Y A;  1T0H A;  1M90 R;  4LDY A;  1E6G A;  5GAN j;  4PLL A;  1NJI R;  3QG1 A;  2KT1 A;  3CME Q;  1Y71 A;  1XNI A;  4E7K A;  1UGQ B;  2R57 A;  2QAZ A;  3F70 A;  1ZA2 B;  3FB9 A;  4BD3 A;  4E7S A;  4ME7 A;  1YJN T;  2E64 A;  1QWE A;  3OBW A;  1X75 C;  3TSZ A;  2JTE A;  2EPD A;  1VQP A;  1YJ9 T;  3PGG A;  2J6F A;  3V8L A;  2RK1 A;  2QK0 A;  1U5S A;  4IUV A;  2GGR A;  3V7S A;  1MMD A;  2BTT A;  3JCM J;  4A54 A;  1VQ5 A;  1OI1 A;  3QKJ A;  5GMK j;  1N27 A;  2O9S A;  2QA4 Q;  3PT9 A;  2CH4 W;  2ABL A;  2FG0 A;  3HHT B;  3JCM c;  3WXM B;  1IGU A;  4OML A;  1K73 C;  3TRE A;  1CKB A;  1D1B A;  3INZ A;  1RI0 A;  3V7R A;  2LJ0 A;  4FL6 A;  4BDZ A;  3VKI A;  1B7T A;  1K4U S;  4C0D B;  4E2F B;  4LN2 A;  1SG5 A;  4PJO G;  2H8H A;  3EH2 A;  1MMN A;  4E6R A;  2EQM A;  3FIF A;  1YJN A;  2OJ2 A;  2RQV A;  1VQM T;  5IXF A;  5GAO q;  1YWO A;  2OTL Q;  1PHT A;  1YJ9 A;  5HK0 A;  3JB9 J;  1U06 A;  2EQJ A;  2HQX A;  3CBM A;  1Q81 C;  4R55 A;  3RMQ A;  4DOV A;  5I11 A;  3OYM A;  2E12 A;  1KHI A;  2VB6 A;  4M77 D;  5FU6 B;  1S1N A;  4DBH A;  1UGS B;  5KYX A;  4JS5 A;  3CCM T;  4C5H A;  4HCC A;  2FZK B;  2CP7 A;  3CCV Q;  5CQX A;  4MZT A;  2KE9 A;  4MDW A;  2YLC A;  2RHZ A;  2CUD A;  3MCA B;  4M78 E;  4FCY A;  3QSU A;  3VYG A;  2VGN A;  2DYI A;  2RJE A;  2K5I A;  4A4F A;  2FZG B;  1WA7 A;  4BUG A;  4XTU A;  1RL2 A;  1RAG B;  4A4G A;  1M8V A;  5CKB A;  1D1A A;  3GBQ A;  3ER0 A;  1RAF B;  2RNA A;  5KYY A;  2FYK A;  1NJI U;  4OB2 B;  4M75 G;  2JS0 A;  1EX4 A;  2D8H A;  2LVM A;  2KDS A;  2DE0 X;  4EMK C;  1VQM A;  2QTV A;  3EFR A;  2C0I A;  2AKK A;  3CCE Q;  3G4S Q;  1VYU A;  2DIQ A;  4PJO A;  3J81 E;  1AEY A;  1MHN A;  4HA8 A;  1SRM A;  3E9G A;  3TCJ A;  2EYZ A;  4JDS A;  5CQY A;  2E6N A;  3CCM A;  2ENM A;  1YI2 Q;  2MK5 A;  3ULR B;  5IN1 A;  1VQK T;  1HYO A;  1I8F A;  3EG0 A;  4C0G A;  1DJ7 B;  1ZUK A;  2LX9 A;  1YIJ Q;  2PQW A;  4PJO F;  1VQ7 T;  3CC7 Q;  2XI9 A;  4HKE A;  1SSF A;  2NUT B;  3VS3 A;  1G3T A;  2A3L A;  3HRS A;  4RKU E;  1ARK A;  4E7L A;  2GNC A;  1WGS A;  4RUG A;  3TEE A;  2KSS A;  4JZ3 A;  2COW A;  3OBY A;  3G71 T;  1M1K R;  2M9U A;  3QHS A;  5A0L A;  4Z88 A;  2EJG A;  1YCS B;  4XTX A;  1K9A A;  1VQN T;  4VUB A;  1YIT Q;  1S72 T;  4M7D D;  2DBM A;  4N0A C;  4D8D A;  1G8X A;  5A0D A;  2RJF A;  1T0J A;  2O01 E;  1GCQ A;  2AKL A;  1ABQ A;  3R6N A;  1TH7 A;  4M75 A;  3GLX A;  4XTW A;  5LJ5 f;  4KH1 B;  4JRP A;  3RUX A;  4LUD A;  2KY9 A;  3MPU B;  4J6W A;  3EG9 A;  1VQ4 T;  4IUR A;  2ZGW A;  1VQK A;  2WSC E;  2P0P A;  3M53 A;  1GCQ C;  1Y96 B;  2HAX A;  1AHJ B;  1VQ7 A;  2F69 A;  4M75 F;  2LMJ A;  3MP8 A;  1QKX A;  3J80 E;  1AZG B;  4E7J A;  4E7H A;  2K5L A;  4QVD A;  3QYG B;  5DLQ E;  1UEB A;  3OYI A;  2RQR A;  2JTM A;  2D1X A;  4PFP A;  3G71 A;  5FRN A;  1QCO A;  2DO3 A;  2M0Y A;  2ESW A;  2LJ3 A;  1WHK A;  3CCR Q;  2QGF B;  5KYW B;  2KYM A;  3EG3 A;  1VQN A;  3MEA A;  1QWF A;  1PRL C;  3CMA T;  2F5T X;  1S72 A;  3G1J A;  2ZPF B;  4XU1 A;  2MF2 A;  1H3H A;  1UGR B;  5IAY A;  5GAM f;  2L2P A;  4C92 A;  1KJW A;  4ELY C;  4KGV B;  1ZX6 A;  1D0Z A;  4DEX A;  1KQ1 A;  2DBK A;  1ZLM A;  2HZY A;  3REB B;  2A36 A;  1T3L A;  4QKU A;  1UJ0 A;  1KFZ A;  4OMP A;  3VRZ A;  1VQ4 A;  3KBG A;  2K2V A;  1KD1 R;  2K7A A;  3H9N A;  1V76 A;  4C92 C;  4QQ6 A;  3CCS Q;  1R0B G;  5A0G A;  1MNE A;  2DD5 A;  3GNG A;  4C92 F;  2L89 A;  1Q86 R;  3OYY A;  2E41 A;  2DKG A;  1OU8 A;  4L59 A;  3R6O A; 
#chains in the Genus database with same CATH homology
 2EQI A;  2AK5 A;  2JM8 A;  2DMO A;  4Z8A A;  1AOJ A;  2GQI A;  4J9B A;  4J9G A;  3M0T A;  3M0P A;  2I0N A;  1IO6 A;  3TVT A;  1W70 A;  2RMO A;  1OPL A;  2KR3 A;  1M27 C;  1GFC A;  3H0I A;  2DF6 A;  4RTY A;  4F16 A;  1U3O A;  2PTK A;  1X6B A;  2J6K A;  1MUZ A;  2OI3 A;  4QT7 A;  2YSQ A;  1WDX A;  1WXB A;  3M0S A;  1K76 A;  4J9C A;  2KBT A;  2E5K A;  4AFS C;  1X2K A;  5FWB A;  1WXT A;  1B3Q A;  3EG2 A;  1T3S A;  2CUB A;  1UEC A;  2F2W A;  2LCS A;  1ZSG A;  3RBB B;  1PKT A;  1W1F A;  2D0N A;  4RTU A;  1G83 A;  4FSS A;  1X2Q A;  3QWY A;  2LNH B;  2K3B A;  1NYF A;  2FPE A;  2LQW A;  3I5R A;  1BB9 A;  4K11 A;  1KIK A;  2J7I A;  1PKS A;  4DEY A;  1LCK A;  2HEQ A;  4AFU C;  3UAT A;  2O31 A;  4JZ4 A;  1W6X A;  1AWO A;  1SEM A;  1M30 A;  2ECZ A;  1NEG A;  1SRL A;  1UE9 A;  2ROL A;  1K0S A;  4A63 B;  1AZE A;  4Y92 A;  3NPF A;  4RTT A;  2KRO A;  2OAW A;  3LH5 A;  4OMQ A;  3RNJ A;  1TUD A;  2DJQ A;  2HSP A;  2FRW A;  4M4Z A;  2DL7 A;  2JM9 A;  1HSQ A;  2KYB A;  1BK2 A;  1M3C A;  4Z89 A;  3EHQ A;  3VRY A;  1WLP B;  1VA7 A;  2JT4 A;  1X43 A;  2JMC A;  2KEA A;  2CH4 A;  3I35 A;  1M3A A;  1QKW A;  3U23 A;  1PNJ A;  5IHN A;  3NMZ C;  5I22 A;  1HJD A;  4ORZ A;  1ZUU A;  2YUP A;  1M8M A;  2BZX A;  3H41 A;  1CKA A;  1UFF A;  4F14 A;  3UF4 A;  2DYB A;  1WXU A;  2X3W D;  4HVW A;  1PRM C;  5FWC A;  2LJ1 A;  1BBZ A;  3VS1 A;  1M3B A;  1GBR A;  2PZ1 A;  1FMK A;  2J06 A;  1JXM A;  3EGU A;  1VYT A;  1UDL A;  1T0H A;  4AFQ C;  1E6G A;  3PE0 A;  2KT1 A;  1UGV A;  2EGE A;  4OMN A;  1NM7 A;  3VS2 A;  2XMF A;  2FO0 A;  1RLQ C;  1RI9 A;  1GBQ A;  1QWE A;  2O9V A;  2L3S A;  3TSZ A;  2ED1 A;  2JTE A;  2EPD A;  3H0H A;  2J6F A;  4HVV A;  1UUE A;  2KGT A;  2DM1 A;  2KRN A;  3NGP A;  1U5S A;  2DL3 A;  1PWT A;  2DA9 A;  1WYX A;  4OMO A;  2GGR A;  2BTT A;  2RN8 A;  3CQT A;  3VS6 A;  2MIO A;  2DL8 A;  3UA7 A;  2O9S A;  1G2B A;  4KRT A;  2D8J A;  2CH4 W;  2ABL A;  2DL4 A;  2FG0 A;  2YUN A;  2K79 A;  1E7O A;  3H0F A;  1WX6 A;  4CC2 A;  4OML A;  1GL5 A;  1CKB A;  1UJY A;  2BZ8 A;  2C0T A;  2PNI A;  2JW4 A;  2QDL A;  2CT4 A;  1NYG A;  1GRI A;  2JXB A;  1V1C A;  2LJ0 A;  1TUC A;  2CSI A;  1YN8 A;  1H92 A;  1K4U S;  1JQQ A;  2EYX A;  1K0X A;  4LN2 A;  2G6F X;  2H8H A;  2YUQ A;  3M0R A;  4HXJ A;  2KRS A;  4HVU A;  4E6R A;  3NHN A;  3SHW A;  4F17 A;  2OJ2 A;  2RQV A;  2K9G A;  2RQT A;  5IXF A;  5IHI A;  2EGA A;  1YWO A;  2FPD A;  1AVZ C;  4R0K A;  1PHT A;  3VS5 A;  4D8K A;  2NWM A;  5IH2 A;  1NEB A;  1X27 A;  2DX1 A;  1UHC A;  1XOV A;  2GTJ A;  3M0U A;  1U06 A;  4EIK A;  5I11 A;  1BU1 A;  4AFZ C;  2O88 A;  2EVR A;  4JJB A;  2J05 A;  1S1N A;  1VYV A;  1NLO C;  3I5S A;  5ECA A;  1HD3 A;  1OV3 A;  4JPB W;  2EYY A;  1ABO A;  2EBP A;  3UA6 A;  2HCK A;  4J9H A;  3VS4 A;  2KE9 A;  3REA B;  1JO8 A;  2CUD A;  4LNP A;  2EGC A;  2CT3 A;  1GCP A;  4GBQ A;  3TSW A;  2KXD A;  2NUZ A;  2W0Z A;  1I0C A;  2DLP A;  4GLM A;  2VWF A;  5GJW B;  1WFW A;  2YT6 A;  3KFV A;  4X1V A;  1WA7 A;  2AZS A;  1RLP C;  2F2X A;  2FPF A;  2O2O A;  1NG2 A;  5EC7 A;  1UHF A;  3GBQ A;  1YWP A;  2EYW A;  2RNA A;  2FRY A;  1X6G A;  2DL5 A;  2AZV A;  4ESR A;  2YDL A;  4HCK A;  1QLY A;  3IQL A;  1B07 A;  3SEM A;  1NLP C;  2JS0 A;  2EW3 A;  1RUW A;  1AWW A;  2D8H A;  4J9D A;  2A28 A;  1SPK A;  2DE0 X;  1YNZ A;  2LQN A;  1J3T A;  1JXO A;  2CSQ A;  2F2V A;  1WIE A;  2RF0 A;  3FJ5 A;  2HBW A;  2C0I A;  2RPN A;  2EKH A;  2AKK A;  1VYU A;  2FEI A;  1WI7 A;  4AG2 C;  4CC4 B;  1AEY A;  1SRM A;  2A08 A;  2L0A A;  2EYZ A;  5GJV B;  4RTZ A;  1H8K A;  1TG0 A;  2LP5 A;  2ENM A;  5IXB A;  3VS7 A;  3VS0 A;  3ULR B;  4LE9 A;  2C0O A;  1Y0M A;  2P4R A;  3EG0 A;  1AWJ A;  4ZNX A;  2VVK A;  4JJC A;  1ZUK A;  1MV3 A;  2DRM A;  1A0N B;  2W10 A;  2VKN A;  2CDT A;  2SRC A;  1N5Z A;  3VS3 A;  3QWX X;  1ARK A;  3M0Q A;  2DNU A;  2GNC A;  2RQU A;  2HDA A;  4RUG A;  2JMA A;  4JZ3 A;  1I07 A;  4CC7 A;  1Z9Z A;  4OMM A;  5HCK A;  4Z88 A;  1SSH A;  1YCS B;  2YUO A;  4J9F A;  1K9A A;  1EFN A;  2KRM A;  2V1Q A;  2DBM A;  4D8D A;  1JEG A;  2K2M A;  2MOX A;  3C0C A;  1MV0 B;  1X69 A;  4JJD A;  2LX7 A;  1SHF A;  1Y57 A;  3ZL7 C;  4CC3 A;  1T0J A;  3PVL A;  4RTX A;  3I9Q A;  3A98 A;  1GCQ A;  2L3P A;  2AKL A;  1ABQ A;  1AWX A;  2DVJ A;  2X3X D;  2MCN A;  3R6N A;  3THK A;  1YP5 A;  2BZY A;  4IIO A;  2DIL A;  2A37 A;  2RQW A;  3JV3 A;  4LUD A;  3EG1 A;  3O5Z A;  4WCI A;  1K1Z A;  2L3Q A;  2LZ6 B;  4LUE A;  5FW9 A;  3EHR A;  4AG1 C;  1GCQ C;  2KXC A;  1OPK A;  5L23 A;  4RTW A;  2LMJ A;  2GTO A;  2IIM A;  1QKX A;  1ZUY A;  1AZG B;  1Z9Q A;  1QCF A;  2RQR A;  2D1X A;  1CSK A;  2M0Y A;  2CRE A;  2DRK A;  2ESW A;  2J6O A;  1E6H A;  2LJ3 A;  2KYM A;  3EG3 A;  4J9E A;  2SEM A;  1QWF A;  1PRL C;  5IHK A;  3PVQ A;  2ED0 A;  1FYN A;  2GBQ A;  1JU5 C;  1SHG A;  1UG1 A;  1H3H A;  1GFD A;  2L2P A;  2M51 A;  1KJW A;  1I1J A;  1ZX6 A;  4DEX A;  2DBK A;  1ZLM A;  3REB B;  2A36 A;  2ROT A;  1T3L A;  4IIM A;  1UJ0 A;  1KFZ A;  4OMP A;  3VRZ A;  1OEB A;  2K6D A;  1ZBJ A;  2KT8 A;  1UTI A;  1KSW A;  2K7A A;  2KNB B;  1AD5 A;  2V1R A;  4RTV A;  2B86 A;  1OOT A;  2JS2 A;  4J9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...