2DILA

Solution structure of the sh3 domain of the human proline-serine-threonine phosphatase-interacting protein 1
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
69
structure length
69
Chain Sequence
GSSGSSGAQEYRALYDYTAQNPDELDLSAGDILEVILEGEDGWWTVERNGQRGFVPGSYLEKLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline-serine-threonine phosphatase-interacting protein 1
publication title Solution structure of the SH3 domain of the human Proline-serine-threonine phosphatase-interacting protein 1
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 5
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dilA00
1NM7A 2IIMA 4Y92A 3VS1A 4R0KA 1BB9A 4HVVA 3VS3A 2DF6A 2D1XA 2GGRA 1UHCA 1RLPC 3EG0A 3I35A 1WXUA 2B86A 1CSKA 2DE0X 4J9GA 4ESRA 1AOJA 4LUEA 1SHGA 1KSWA 4IIMA 5FW9A 1G83A 1UTIA 5IHKA 2NWMA 3R6NA 4RTXA 3I5RA 4OMPA 5I22A 1AEYA 1CKAA 1GFCA 2CH4W 4F17A 1M8MA 1MV3A 1SEMA 1ZUKA 2M0YA 3NMZC 2DMOA 1VA7A 4JJBA 5EC7A 1Z9QA 4KRTA 1HJDA 4CC3A 1JQQA 3SEMA 1NLOC 2L3PA 1X2QA 4RTUA 2YUPA 3CQTA 5IXBA 2D8HA 2LP5A 2J06A 4CC7A 3EG2A 1M3CA 4J9IA 1K76A 2FPDA 2VKNA 5IHNA 2E5KA 2KYMA 1M3BA 3TVTA 1T3LA 1X6GA 1BBZA 3JV3A 3REBB 4A63B 2CT4A 5IHIA 1TG0A 2KE9A 1UECA 1AD5A 2KRNA 4AG1C 2EPDA 4OMNA 1AWXA 3UF4A 2KRMA 1VYUA 2J6KA 2ED0A 2KYBA 2EYYA 2SEMA 3PVLA 3KFVA 1SSHA 3M0SA 1GCQC 2RQTA 1UGVA 4J9EA 2O9VA 2A37A 2L3QA 4AFUC 1GFDA 2DL3A 4CC4B 2ROLA 1WXTA 2NUZA 2OJ2A 4JZ3A 2EKHA 4X1VA 2DNUA 1UDLA 4E6RA 2K7AA 3ULRB 2RNAA 2EYWA 1UJYA 1AWJA 4RTZA 5IH2A 3EGUA 3H0HA 1Y57A 1E7OA 4HCKA 1XOVA 3THKA 2HSPA 2GNCA 1I1JA 2DJQA 2EGAA 2C0OA 2KEAA 5L23A 2DILA 1EFNA 1MUZA 1YP5A 2EYZA 2YUNA 1E6GA 2X3WD 1NEGA 4AFZC 2VWFA 4FSSA 1B07A 2JTEA 2V1RA 1WYXA 1QWFA 2RN8A 1IO6A 4J9CA 2EYXA 2BTTA 1VYTA 1KJWA 1ZUYA 1OOTA 1NLPC 1K0SA 1H92A 2KT8A 2LQNA 2YUQA 1PKSA 1WX6A 1MV0B 2M51A 5IXFA 2FO0A 1GL5A 2L3SA 3VRZA 2YUOA 2LMJA 3PVQA 2KNBB 2HBWA 2CSQA 1GCPA 1AWWA 1W70A 1W6XA 1WI7A 2VVKA 1W1FA 1QCFA 2YT6A 3VS0A 2J05A 1QLYA 3UA7A 1T3SA 4ORZA 1JXOA 1ZLMA 2V1QA 1I07A 2C0TA 2LJ3A 1N5ZA 1NYFA 2GTOA 2RQVA 3GBQA 1SRLA 3NGPA 3QWYA 3M0TA 3M0QA 4K11A 1TUDA 1OEBA 2O88A 2KROA 4J9HA 2K79A 2RQWA 3RBBB 2ABLA 4D8DA 1JU5C 2SRCA 2LZ6B 2MCNA 4F14A 3I9QA 2BZYA 4LNPA 2CUDA 2K6DA 4DEXA 3H0FA 1FYNA 2D0NA 3PE0A 2AKKA 4ZNXA 2DL7A 1YNZA 2FG0A 3VS2A 2F2VA 2CT3A 2QDLA 4RTVA 2J7IA 1UE9A 2RPNA 2HDAA 1GCQA 4D8KA 2X3XD 2ROTA 4J9FA 2EGEA 1UUEA 2KXCA 1X27A 1QKWA 1RLQC 2D8JA 3TSWA 3O5ZA 3EHRA 2P4RA 2AK5A 4JJCA 1WA7A 1TUCA 2JMCA 2JW4A 2I0NA 1U5SA 1NYGA 2KR3A 1ARKA 2DRKA 3IQLA 2CUBA 2PTKA 4JZ4A 3RNJA 2DBMA 1OV3A 1UHFA 1PHTA 1UFFA 2K2MA 1BK2A 1Y0MA 1K1ZA 1SPKA 2GQIA 2O2OA 2DVJA 2F2XA 2KXDA 2JMAA 2ED1A 3H41A 4OMLA 1PKTA 1WDXA 3A98A 4HXJA 2RQRA 3REAB 1K0XA 1PRMC 4RUGA 3EG3A 1SHFA 4LUDA 4RTYA 1H8KA 2BZXA 1FMKA 1HD3A 4GBQA 1A0NB 3C0CA 1ABQA 1KFZA 2KBTA 3VS4A 2JT4A 2DRMA 4J9BA 1HSQA 2O31A 1LCKA 1SRMA 4OMMA 3NHNA 5GJVB 1M27C 2RMOA 1NG2A 4Z8AA 1PRLC 1OPKA 2YDLA 2C0IA 1X2KA 4LE9A 1PNJA 2YSQA 2MIOA 4JPBW 4RTWA 1AVZC 2GTJA 3LH5A 2CSIA 2J6OA 1X6BA 2GBQA 1GBQA 2FRWA 2ENMA 4J9DA 2ESWA 1GBRA 4Z89A 2EGCA 5FWBA 1I0CA 2J6FA 4Z88A 1YWPA 2DLPA 2A28A 2DX1A 2FEIA 1T0JA 1U3OA 3TSZA 2LX7A 3I5SA 3VS6A 4AFSC 4M4ZA 2A36A 2DM1A 2CDTA 2K9GA 2L2PA 2PNIA 4LN2A 1AZEA 2XMFA 1M30A 1WFWA 1ZBJA 2PZ1A 5I11A 2EBPA 1NEBA 4OMQA 4OMOA 2DBKA 1WLPB 3FJ5A 5HCKA 1J3TA 1U06A 2EVRA 4HVUA 1S1NA 1M3AA 1UJ0A 3EHQA 1WXBA 2RQUA 2HEQA 2DL5A 1RUWA 1VYVA 2MOXA 2W10A 2A08A 2L0AA 2LQWA 2OI3A 1BU1A 2F2WA 2ECZA 1ZSGA 1T0HA 2KGTA 1AZGB 1YCSB 4QT7A 3VRYA 2KRSA 1K9AA 1RI9A 3SHWA 2K3BA 4AFQC 2EW3A 1JO8A 4GLMA 4RTTA 2FPEA 2AKLA 4HVWA 1V1CA 2LJ1A 1QWEA 1X43A 2FPFA 3UATA 1ABOA 2LJ0A 1K4US 2JS0A 3NPFA 3M0PA 2DL4A 2O9SA 1AWOA 1ZUUA 2BZ8A 2AZVA 4EIKA 2KT1A 2CREA 2LNHB 3QWXX 1X69A 1JXMA 3EG1A 1ZX6A 1WIEA 4CC2A 1H3HA 1Z9ZA 1YWOA 3ZL7C 1E6HA 4DEYA 3M0UA 3U23A 2DA9A 2JM9A 1JEGA 2FRYA 4IIOA 1UG1A 1GRIA 2H8HA 2CH4A 1B3QA 2G6FX 5GJWB 2HCKA 3VS7A 2LCSA 1CKBA 4JJDA 1YN8A 3VS5A 1OPLA 3H0IA 1PWTA 2DYBA 2EQIA 4AG2C 5FWCA 1KIKA 2AZSA 2JXBA 2RF0A 3UA6A 2JS2A 4F16A 3M0RA 2DL8A 2OAWA 1QKXA 2JM8A 4WCIA 2W0ZA 1G2BA 5ECAA
chains in the Genus database with same CATH superfamily
4PJOD 4IUTA 3O8VA 3QZ5B 3VS3A 1JJ2S 5C6SA 1IREB 1C0MA 4M77A 3CC7Q 4PJNA 3I55Q 1BIAA 4J9GA 1TTHB 4LUEA 2F5TX 1QVGA 3MEUA 5KYYA 4IIMA 5FW9A 1JJ2A 2QTVA 3BW1A 4UC4A 5LJ5d 1CKAA 1GFCA 2CH4W 3CCUT 4PJOB 1MV3A 5DLOA 4JRQA 1VQ7T 2LCLA 2M0YA 5I21A 1XJWB 5EC7A 3CCJA 1X2QA 3CQTA 3L2QA 2DYIA 2B8AA 2D8HA 1ZSZC 2E65A 3HRTA 3CCRA 5CVIA 4M78F 3P8DA 3C95A 4BI4A 2CZ0B 2IVWA 3TVTA 1F1BB 3JSCA 3M9QA 3OYBA 1T3LA 5LJ3j 1BI3A 1B34A 4C8QG 1OU9A 4PJJA 1O75A 2P0KA 1UECA 3X20B 3OBWA 5KCHA 2E3IA 5GAOn 3CCVQ 5J26A 2NYSA 3OA6A 4FT4A 3OYHA 1AWXA 2Y4XA 2ED0A 2M1HA 1ZQ1A 4C8QF 1RACB 1SSHA 2L8DA 1KG1A 2QQSA 4F7UE 2O9VA 4AFUC 5GANg 1Q86U 1WXTA 2VXFA 2VYTA 2HQXA 3M56A 3OYAA 2GQVA 1C6VX 2DNUA 2K7AA 3ME9A 3JCMc 1Y57A 1G8XA 2RH2A 4HCKA 2ZPGB 1I1JA 2EYZA 2QQ9A 1MNDA 1IB8A 1K9MR 1E6GA 4MMKA 3JCMe 3CEYA 4XK8E 5C0MA 4E7LA 2V1RA 1WYXA 3KXTA 3URGA 4R55A 4J9CA 4ZN3A 1RABB 4HT8A 5GMKl 2FB7A 1NLPC 3CMAT 2QA4Q 4M7DD 3SWNB 4X34A 1BI2A 4V2SA 1WQWA 3VRZA 3ZFJA 4FYVB 4KBMB 2HBWA 3PNWC 4BB7A 5GMKi 3FEOA 3OMGA 3OYCA 1W6XA 2EIFA 2VVKA 2RJCA 3I56Q 3CCEA 1QCFA 3UPUA 3BDLA 3RIRA 4Y28E 4ORZA 1ZLMA 3L2WA 4FL6A 1I07A 4M7DB 1M4ZA 3A8GB 3ER0A 2K2VA 4C92G 4M78D 2KSSA 1RI0A 1KC8C 2OTJQ 3CCJT 3META 2R57A 1OEBA 1X6OA 5LJ5g 1LOJA 2ZAEA 2K79A 4J6XA 2RHUA 3PIPA 4M75G 3I9QA 3OYIA 2RHIA 1KHIA 1BKBA 1O9SA 3H0FA 1FYNA 2DFUA 3CCRT 3PE0A 2AKKA 4C5EA 3EGDB 2XK0A 3QIIA 3VS2A 4RTVA 1YCYA 4C8QD 1UB4A 4B9WA 4M75F 1VQ8T 2G3RA 3VYGA 1S72Q 2CZ1B 4J9FA 1PSEA 3MEWA 3JB9G 2PU9B 3EHRA 5GAN5 2P0PA 2X4WA 4JJCA 3EAEA 2JW4A 4KUIA 3L2VA 3H8ZA 1U5SA 1VQPA 1NYGA 3OS5A 3JCMW 3IQLA 3G1JA 4OGEA 1OV3A 1UHFA 4F7UA 1U1TA 3OYLA 3MP6A 3JB9F 1YJNA 3OS2A 1GXIE 2C06A 4F04B 4Q5WA 2ED1A 1WDXA 2HKNA 2IPOB 2WSEE 3MCAB 4XQ3A 2HMAA 1IHVA 4BDZA 1W2BP 4OMFB 4RUGA 5GAOq 1SHFA 4PFOA 2NUTA 5GAOr 1BCOA 4RTYA 4M77B 1HK9A 1HD3A 3HPWA 1VQ9Q 3JB9J 4IUPA 4KGZB 4XTVA 1JB0E 3JCMf 2KBTA 3VS4A 2DRMA 5KYYB 2CP3A 3M53A 3M58A 3KUFA 5GAOl 2QGGA 3PTAA 4J5YA 5KE3A 3A8LB 2LDMA 2VUBA 1TOVA 4J6WA 4KULA 1PRLC 2C0IA 2PVOB 1D09B 1X2KA 2PVGB 4XTZA 2MIOA 5FU6C 2CSIA 1NE8A 3G4ST 1X6BA 2ENMA 4J9DA 2ESWA 5A0DA 1TXQA 2L3RA 1GBRA 4Z89A 2CP2A 2MYSA 2DLPA 3OYDA 3CD6A 2F1LA 3AT1B 1U3OA 3TSZA 4FT2A 4GLKA 3UT1A 1OULA 1VQ5Q 1OZ3A 2PNIA 1AZEA 3RUXA 1M30A 2COWA 1KHCA 1MMDA 2EBPA 1B34B 1NPRA 4PKCC 3DKMA 1JRIA 4JRPA 1PSFA 2K5FA 4HVUA 1WJRA 3CBOA 1S1NA 3X28B 1UJ0A 4L6V5 3OSSC 1WXBA 5D6WA 2LNVA 1Y71A 5KH6A 2DL5A 2K5LA 2XICA 4J8OA 2W10A 3DLMA 2A08A 2L0AA 5FRMA 1KQSP 2MF2A 3V8KA 4M7AG 2MPXC 3RERA 2DD4A 3JB9D 3HKSA 1W4SA 3S3MA 3MHXA 1K8AC 3P8BB 2DIGA 4RTTA 2AKLA 5GAMj 1KC8R 1QWEA 1VQPT 4LD9K 1X43A 1EIFA 2FPFA 1VIFA 2PUKB 3CCUQ 4ELZC 2O9SA 3HFNA 3LGLA 4FYYB 2RI3A 1RAFB 2BZ8A 4EIKA 2KT1A 2LNHB 4FYWB 3QWXX 3OW2S 2NUPA 3RR6A 1ZX6A 4CC2A 1Z9ZA 1YWOA 2DAQA 2YXYA 1E6HA 2ZPHB 4XTYA 3G7ZA 1VQOQ 8AT1B 3CMET 2CH4A 4MDWA 3VS7A 4L59A 1XQHA 3EG9A 2E12A 1OPLA 2DJZA 4B9XA 4EDUA 2DYBA 3NTHA 1VQ4Q 1KIKA 4RCCA 2DD5A 3CCQA 2JXBA 1OX9A 1M2VA 1QVPA 4WCIA 4KH1B 2A7YA 2QEXQ 3VS1A 2M0OA 4JRKA 3MO8A 4PJOG 1QMCA 2LX9A 3BY7A 2CGHA 4M77E 2GGRA 1NJIU 1UHCA 3CD6T 5A2QE 3EG0A 3I35A 2ZPIB 1SHGA 1KSWA 2E6ZA 1BYMA 1RADB 2DVEA 1Y7XA 5IHKA 3SFMA 4JUVA 4RTXA 3I5RA 1NPPA 1AEYA 4PJOF 3DB3A 5LJ5h 2DZ9A 1SEMA 2KQWA 4M77C 3NMZC 3OSVA 3CC2Q 3A8OB 1JQQA 4EMHA 4QVDA 2L3PA 5CKEA 2BIVA 1KD1U 2CZ6B 4Z02A 3V8JA 5IXBA 4CC7A 2VASA 1UGPB 3PMIA 2COZA 2RHYA 4J9IA 2VKNA 4N0AA 4LDWA 4LDUA 2K3YA 4F7UB 4J7IA 2QGFB 5KE2A 2EWNA 1TS9A 2DEUA 1OZ2A 3JV3A 3REBB 4A63B 1N8RC 3S3NA 1TG0A 4HKEA 2R5AA 2KRNA 1AD5A 4AG1C 2D9TA 3RESA 1N27A 1LJOA 5GANd 4OB1B 4JRIA 3UF4A 2ZGWA 3G6EA 2NUTB 2SEMA 1PM3A 3OYYA 4PK4A 5LJ3g 3NFCA 1JBMA 3M0SA 4BD3A 4DBQA 5KYWA 2RQTA 3J7AF 4J9EA 2QTXA 1Q82C 2DL3A 2NUZA 2EFIA 2M02A 3ULRB 2RNAA 4XU3A 1P92A 1AWJA 1MMNA 1K8AR 5GAMf 3H0HA 3RDVA 2DJQA 2DILA 1EFNA 2X3WD 2BUDA 4LD6A 4AFZC 1B07A 3CCQT 3OW2P 2DEQA 1IO6A 1VYTA 1KJWA 2V8IA 1ZUYA 3E1SA 3JCMX 3J80E 1WX6A 1YITQ 2QXFA 3FJPA 1I8FA 4M7DG 2ATCB 2FO0A 1GL5A 2L3SA 2AIRB 2YUOA 2A3LA 1M1GA 4JLIA 3TEEA 3QDRB 2GF7A 1QP2A 1VQLA 5FLXE 3VS0A 2J05A 1QLYA 1T3SA 5DLQE 2BE9B 1MMAA 4M7DF 1VQNA 1N6AA 5M9OA 2V1QA 5GAN7 4RKUE 4XTXA 2GTOA 4BE2A 1SRLA 4M78G 3QWYA 3PGGA 4B6MA 3VUBA 2P4TA 5J39A 2Z0WA 5HKCA 1PC0A 2O88A 3H9NA 2RD1A 2ABLA 4D8DA 2MCNA 2QAZA 1XNIA 2HQEA 3T9NA 2DERA 2DXUA 4ZNXA 1MMGA 5GAN2 1ZA2B 4FM4B 2CT3A 2QDLA 2HZYA 1VQ8A 1YJWT 2J7IA 1UEBA 1I81A 1VQMA 3CCSQ 2NUPB 3CCEQ 3VJPA 1QKWA 2EQUA 2D8JA 2EJFA 3TSWA 4ZGEB 2EJGA 4PFZA 3X25B 3BE3A 3PIOA 1W2BS 1WA7A 1TUCA 2JMCA 3INZA 2XKOC 1YIJA 2YHTA 3G6ET 5HK3A 2KR3A 5FU6B 4JZ4A 2DBMA 3EG9B 4C92A 1W2BA 2K2MA 1UFFA 1BK2A 2XG8D 4HA8A 1K1ZA 2CP5A 1SPKA 2JTFA 2CZ7B 4M77G 4XU2A 2LVMA 2O2OA 3KBGA 3PT9A 2DVJA 2KXDA 5A0LA 3WVDB 1M2VB 4IUUA 3CBMA 3RMQA 3A98A 4HXJA 1KQ2A 2RQRA 2YWWA 3GF5A 3PFSA 4A4GA 1UGSB 1PRMC 2E41A 4A4FA 1N8RR 3EG3A 4M77F 4LUDA 2M16A 2BZXA 1FMKA 3E2UA 4GBQA 4E7JA 1SKUB 2JNGA 1M8VA 1D1AA 2RHZA 3C0CA 2JT4A 2ZPFB 1Y07A 4TVRA 4VUBA 4J9BA 3FIFA 2O31A 1LCKA 1SRMA 3M4GA 2WSCE 2VV5A 4E7HA 3NHNA 1G3WA 4DOVA 1M27C 2RMOA 1NG2A 2ZCFB 2YDLA 3P8HA 3A8HB 1PNJA 3CBPA 2GFUA 3L2RA 1Q82R 2YRDA 3G4SA 2GTJA 2J6OA 1VQLT 3QJYA 1GBQA 1VOMA 2CP0A 3JCMb 1YJNQ 3M5AA 5CKBA 1VIEA 1VQNT 1YWPA 2A28A 2DX1A 1M1KR 2JN0A 4QKUA 2LX7A 1KQSS 3FLGA 2LT1A 4C5IA 2A36A 2DM1A 3G71Q 2DXBA 5FU7B 3QHSA 2CDTA 2L2PA 4JLGA 3DB4A 1KQSA 3CC4T 4QQ6A 3AHUA 1YBYA 1WHHA 1NEBA 4OMOA 1LVKA 4ME7A 1WLPB 1YJ9T 2EVRA 1M3AA 3EHQA 4FW1A 3FDRA 1I4K1 2RQUA 1RUWA 1VYVA 4BDYA 1Q86C 1V29B 2LQWA 4IKFA 1R8OB 2R5MA 1VQKT 2ECZA 3QSUA 5KYWB 1VQMT 2H3EB 2KRSA 2EKOA 1K9AA 1G3YA 3LH0A 2K3BA 4DA4A 3CD6Q 3SD4A 1QVFP 1YIJT 4MZMA 2LJ1A 1D0YA 3RKXA 5FROA 3DLLA 5LJ3h 4IUQA 2LJ0A 3EGXA 3LW5E 3NPFA 3H6ZA 4M77D 3CCMQ 1ZUUA 1Q7YR 2AZVA 1X75C 3HP9A 1M1FA 2CREA 3CC7T 5GAMg 3I55T 2HSEB 2L89A 1H3HA 2IG0A 3CCLQ 1C1AA 3U23A 1FX7A 3CMEA 2E10A 2FRYA 4IIOA 3A1PA 2EJ9A 1UG1A 1GRIA 3ASKA 2H8HA 2HL3A 2M9UA 4A54A 5GANe 1K8AU 1WNLA 3HRSA 1M90C 1TWBA 2COYA 1YN8A 4M7AA 2OTJA 3H0IA 2QK0A 1G3SA 2EQIA 5KYUA 3Q1JA 2RF0A 2DXCA 4C0GA 4WTOB 2XDPA 3C4SA 2JM8A 4RG8A 5J3BA 1FWZA 2RJFA 4IURA 1Q81C 1NZ9A 4HVVA 3OBYA 5KYNA 4C0DB 2DF6A 2D1XA 2RK2A 3GNGA 1WXUA 2B86A 1CSKA 2EQKA 2DE0X 4BE1A 1S72A 2DXTA 1VUBA 3L42A 3HRUA 5LJ5j 1UTIA 3GLXA 5D7UA 2NWMA 3CCVT 3R6NA 1HYOA 5I22A 4F17A 3EFOA 1M8MA 1ZUKA 3CXCP 1H3ZA 1YI2A 1VA7A 4C0ZA 4F7UG 4JJBA 3RKWA 4CC3A 3SEMA 1NLOC 3OYFA 2JTMA 5D6YA 2MWPA 2QYZA 1YHQQ 4HCBA 2HKQB 1RAAB 4II1A 4XU1A 3X26B 4F7UF 2FPDA 5LJ5e 5IHNA 3V7CA 4C92B 2E5KA 2KYMA 3C12A 1X6GA 1IHWA 4GY5A 2RHXA 3J81E 2CT4A 5IHIA 5KCOA 3BDUA 2ZZDA 5LJ3d 2XU8A 3OMCA 3M57A 4AMCA 5CAIA 1VQ6A 4N0AC 4OGCA 2Y90A 5FU7C 3F70A 2EPDA 2HL5C 4OMNA 4C0FA 4DBHA 2YLCA 1VQ7Q 1VYUA 5GANh 2J6KA 2EYYA 4QVZA 2OTLA 3KFVA 1DJ7B 4KT0E 1GCQC 3JCMd 3LGFA 5CKFA 3GOXA 2VGMA 4N4HA 2A37A 1GFDA 1G5VA 1Q86R 2ROLA 2OJ2A 2EKHA 4X1VA 3OW2A 1UDLA 4OVAA 1D1CA 4E6RA 5D6XA 4RTZA 1R0CB 4LDXA 2GNCA 2KEAA 2EGAA 2C0OA 1VQ5A 1MUZA 1YP5A 3GNFB 2YUNA 2OTJT 1K9MU 1N8RU 1NEGA 3E9FA 2RA2A 2YRVA 1H641 3JB9H 1QWFA 2EYXA 2BTTA 3MKDA 1OOTA 4PJLA 1H92A 2YUQA 3MEVA 1MV0B 3QBYA 5IXFA 3G6EQ 1D3BA 4MZTA 4XAXB 3PVQA 1GCPA 2BE7D 4RMOA 4QQGA 1W1FA 1S72T 2YT6A 3EH2A 2L5QA 2LQ8A 4NL2A 1WQ7A 4KUDK 1JXOA 4JJNK 2VXEA 1FMWA 4LDVA 1M90R 2HAXA 4X9CA 3UWNA 1NYFA 3HTRA 3NGPA 1YI2T 4E7ZA 2FZKB 2E5QA 4K11A 1TUDA 4NOYA 2JZ2A 2KROA 1NBEB 3SWNA 3FB9A 2FYKA 3RBBB 5I2SA 1ZHIA 2LZ6B 2DETA 4F14A 2BZYA 4LNPA 3QYHB 2CUDA 2K6DA 3CMAQ 1EX4A 4EMKA 2OX7A 3CPWP 2DL7A 1YNZA 3EGXB 1Q81R 5LJ5f 1YJWA 3HHTB 4RG2A 4X9DA 2RPNA 2HDAA 3M54A 4C0DC 1GCQA 2KMTA 4D8KA 4HCCA 2XD0A 2ROTA 3TCJA 3QDFA 1UUEA 3QJ6A 4O5VA 2DPPB 1X27A 2DIQA 1RLQC 1VQ6T 2EAYA 2HQHA 2P4RA 1VQ4A 1MHNA 4KGVB 1ARKA 2DRKA 3CCJQ 2CUBA 2PTKA 2RJDA 2OTLT 3RNJA 4M7AB 1FXXA 4C92E 3JCMQ 2D0QB 1Y0MA 2CYZB 4M78A 2RI2A 3BFMA 3MPUB 5KYUB 2LT4A 2F5KA 3MP1A 2F2XA 4OMLA 3CCRQ 1M1KC 4M75E 1PKTA 3JCMg 3V8LA 2XI9A 4OP0A 4E7SA 2H3JA 4DOWA 4C92C 2DK3A 1K0XA 1OQKA 1VQ5T 3S6WA 1VQ8Q 3L2ZA 2QQRA 2I2LA 1U8RA 1M9SA 1H8KA 2YRCA 1VQMQ 4C8QA 1K73C 4M75C 1ABQA 1KFZA 4CRIA 4BI3A 1PD0A 3EFOB 2KVQG 5IT9E 4OMMA 4LDYA 1OYXA 2GCXA 4Z8AA 2VGNA 4JDSA 4LE9A 1N9SA 1MGQA 2YSQA 4RTWA 3LH5A 4ZN1A 2FRWA 3VV0A 5FWBA 1I0CA 4Z88A 1IXDA 1QVGS 2XDBA 1FMVA 2FEIA 4Y91A 1M5Q1 1UGQB 4M4ZA 2OAUA 3A8MB 2DO3A 2YLBA 1SG5A 4E7IA 2XMFA 1WFWA 1ZBJA 2K3XA 3CC4A 2AHJB 4PFPA 2PZ1A 5I11A 1ZBXA 4OB0B 1X01A 4XU0A 1Q7YC 1YJ9A 1QVFS 4QW2A 3GP8A 2DBKA 2RJEA 5HCKA 4C5HA 4E7KA 1U06A 4ZTFA 2DTHA 2DZCA 3OYGA 4DQ2A 2RK1A 1QVFA 3ZBDA 4P5NA 2HEQA 1OU8A 1TUGB 2FHDA 5GAN6 1VQKA 1BU1A 1VQOT 1B7TA 4AT1B 1WJSA 1ZSGA 2KGTA 3QYGB 4MZPA 3G4SQ 1AZGB 1IZ6A 1YCSB 5CIUA 2X4XA 2HBPA 4KGXB 3S3OA 3LWIA 2JOYA 1D0XA 2FPEA 2E4HA 2ZPEB 3EFRA 1VQ4T 1KC8U 2D6FA 4HVWA 3NTKA 5GAMd 2JVVA 1ABOA 4OB2B 2CS7A 5GMKh 4C5GA 2JS0A 3M0PA 1AWOA 1YITA 5DM7R 2QEXT 4D6WA 5IN1A 3CC7A 4M75A 2LQKA 3I55A 1X69A 1JXMA 1WIEA 1RAEB 1PG5B 2EYQA 3EFSA 1WHKA 5CKHA 1AHJB 5LJ3e 2K4YA 2DA9A 2JM9A 2VC8A 4QVCA 1D3BB 3L2UA 4PL6A 1Y96A 1B3QA 5GJWB 2QG9B 4M7AE 5L8RE 3HL8A 3VS5A 3CC2T 1LPLA 2O4XA 5FWCA 4XTUA 3OS0A 3OYKA 1VQPQ 5CR2A 2JS2A 3CXCS 2JJ9A 1Q95G 1WHMA 3RMSA 4ATOA 4M7AC 1G2BA 5ECAA 1NM7A 2IIMA 4Y92A 4R0KA 1WHLA 3CXCA 1BB9A 3TQ7P 3E19A 5LL6S 1RLPC 2EQJA 4E47A 1NJIR 1RAIB 2K57A 4EMKB 2FVUA 4ESRA 3CCSA 1AOJA 2CKKA 3CCVA 2RM4A 1G83A 2RB6A 1R77A 2NLUA 4OMPA 2WACA 1ZSZA 2A0FB 2DKGA 3CMEQ 5CK9A 3JCMJ 3HFOA 1WZOA 1K73R 1M90U 1TU0B 3PMTA 2DMOA 2X35A 1Z9QA 4KRTA 1HJDA 1EZZB 3LLRA 4RTUA 3GPLA 2YUPA 2HD0A 4PNOA 2QDYB 3OY9A 1KD1R 1QVGP 4BY6B 2LP5A 1JJ2P 2J06A 3OS1A 3EG2A 1M3CA 5CCAA 4OF1A 5GAN4 4C92F 1K76A 2RI5A 4OB3B 3MJXA 1M3BA 4M78B 2V8KA 1Q81U 5AT1B 1BBZA 3JCMP 3EH1A 2FZGB 3JRZA 4PJOE 5GMKm 1BCMA 3QUIA 5EG2A 4L5GA 2FZCB 2KE9A 3SB2A 3CPFA 5GANj 1TH7A 4A4HA 2QA4A 2KAFA 4N4GA 1WHGA 1SSFA 2KRMA 2MAMA 1BI0A 2ZPBB 2KYBA 1YITT 4R56A 4FYXB 4PJOC 3PVLA 1YI2Q 4FW2A 4C8QB 5KYXA 1UGVA 3I56A 3JCMh 2L3QA 3JCMV 4PJMA 4CC4B 2F69A 5IAYA 4JZ3A 3QO3A 1AT1B 2QQAA 1BIBA 5LJ3f 1PD1A 2EYWA 4JS5A 1UJYA 4N4IA 8ATCB 5IH2A 3EGUA 1N9RA 1E7OA 4J6YA 1XOVA 3THKA 2HSPA 4EPCA 5L23A 3G71A 4YTLA 3M55A 4EMGA 2JUFA 4BE0A 2VWFA 4FSSA 2JTEA 2LRQA 4RCBA 2RN8A 2DTOA 2QASA 4JS4A 3GIBA 1PCXA 1IGUA 3VU3C 1VQ6Q 1I5LA 4KH0B 1K0SA 1UGRB 2KT8A 2LQNA 1PKSA 2M51A 4CI0C 4DBFA 2LMJA 2OTLQ 2KNBB 3RKYA 2CSQA 1AWWA 3OYEA 1W70A 1WI7A 2EQMA 3FRNA 3CCST 3UA7A 3CCET 3CPWS 5CKDA 1MNEA 5I2MA 1WJQA 4MDXA 2C0TA 4A53A 4A4KA 4HCZA 2LJ3A 4C92D 1N5ZA 3CPWA 3VUZA 2RQVA 2KK4A 3GBQA 3JB9I 1WGSA 3M0TA 2PUOB 3M0QA 3OB9A 5DY9A 2E3HA 3VYHB 3HSBA 1M2OA 2LC4A 3CCQQ 4J9HA 3LWHA 1WHJA 3CCMA 2RQWA 3WXMB 4M75D 1JU5C 2SRCA 5GAOp 1KQ1A 2Y4YA 2XIDA 1OX8A 4DEXA 4FU6A 2D0NA 3N5BB 3R6OA 2E1HA 2FG0A 1YFNA 3A5ZB 3CCLA 2F2VA 2CP7A 1KK7A 3OQ5A 3SWNC 4PJOA 1UE9A 4M7DE 1WPYA 5CO7A 1VQ9A 4M75B 2X3XD 2CP6A 5GAOm 2EGEA 2V8JA 2KXCA 1RAHB 2RO0A 2X4YA 2LTOA 4EMKC 3V7RA 3QG1A 3O5ZA 5AYFA 2QA4T 2MK5A 2AK5A 4FIBA 4DBRA 2I0NA 2V26A 1Y96B 4M7DC 4M7AF 1IRXA 3WVEB 1PHTA 4M78E 2KDSA 2K5IA 3I56T 2GQIA 3QKJA 2O4XB 3UDCA 2QQBA 2E6NA 1YJNT 4BI8B 4BY6C 3H41A 2JMAA 2X4JA 3SDZA 5CQYA 3REAB 2P0QA 5GANf 3G71T 4M78C 1YJWQ 3OYMA 1R0BG 5GAMe 3ZEHA 4ANJA 4HT9A 4C8QE 1A0NB 2PQWA 2E70A 1D0ZA 2MI6A 3QZ9B 2LCCA 3M4YA 1HSQA 2E64A 1ZSZB 1YHQA 3LYIA 5GJVB 2FL7A 1OPKA 5FRNA 1Q82U 4JPBW 2X9HA 4XTWA 4C8QC 1AVZC 3MEAA 2GBQA 3TREA 2XDDA 3OYNA 2EGCA 2J6FA 4FSXA 3D7SB 3V7SA 1M1KU 2KY9A 1T0JA 4NL3A 5GAN8 1XTDA 3I5SA 3VS6A 4AFSC 9ATCB 4J83A 1ZA1B 2K9GA 3CCUA 4LN2A 2MWOA 4ZGDB 1VQ7A 3JAME 3CCMT 1K73U 1D1BA 4OMQA 3E9GA 4MMLA 1QCNA 3FJ5A 1J3TA 4LXCA 2MMPA 3C94A 5HK0A 3VKIA 3CCLT 1I5OB 4ZTJA 2MOXA 3OYJA 4M7DA 1VQOA 4M7AD 1LNXA 2OI3A 5CQXA 2F2WA 1U1SA 5A0GA 1VQ9T 5KYXB 1T0HA 1VQLQ 1ACMB 1SF9A 4QT7A 4IUVA 3MP8A 3VRYA 1RI9A 4NS5A 3SHWA 1VQNQ 4AFQC 2EW3A 1JO8A 4O6JA 1QQJA 1V76A 4GLMA 6AT1B 3FC3A 1TSFA 1G3TA 4J7FA 2QI2A 4QQDA 1K9MC 2VB6A 5GMKj 3QXEB 1V1CA 4BACA 4BUGA 3UATA 2DTIA 3X24B 1BI1A 1K4US 2HNIA 4A4EA 5GAMh 2BKDN 3EGDA 2DL4A 2QEXA 1RAGB 3CC4Q 3TU4K 1HXDA 1Q7YU 4WF2A 7AT1B 1QW1A 1YJ9Q 4PLLA 2X51A 1NJIC 3EG1A 2KI7A 4FCYA 2WSFE 5GAN3 3ZL7C 4ELYC 4DEYA 1QCOA 3M0UA 2P84A 5HY6A 5GMKe 2GFAA 1JEGA 1VQKQ 2G6FX 3QPHA 2HCKA 2O01E 2LCSA 1CKBA 4JJDA 3LX7A 3CC2A 2XHCA 1IGQA 1QP3A 2AT1B 1PWTA 3NTIA 4E2FB 4AG2C 1RL2A 2AZSA 1YIJQ 4ZGJB 1YHQT 1KD1C 3UA6A 4PLIA 2R58A 3L1AA 3M59A 1OI1A 3M0RA 4F16A 2DL8A 2OAWA 1QKXA 2PVDB 3CMAA 2W0ZA
chains in the Genus database with same CATH topology
1NM7A 2IIMA 4Y92A 3VS1A 4R0KA 1BB9A 4HVVA 3VS3A 2DF6A 2D1XA 2GGRA 1UHCA 1RLPC 3EG0A 3I35A 1WXUA 2B86A 1CSKA 2DE0X 4J9GA 4ESRA 1AOJA 4LUEA 1SHGA 1KSWA 4IIMA 5FW9A 1G83A 1UTIA 5IHKA 2NWMA 3R6NA 4RTXA 3I5RA 4OMPA 5I22A 1AEYA 1CKAA 1GFCA 2CH4W 4F17A 1M8MA 1MV3A 1SEMA 1ZUKA 2M0YA 3NMZC 2DMOA 1VA7A 4JJBA 5EC7A 1Z9QA 4KRTA 1HJDA 4CC3A 1JQQA 3SEMA 1NLOC 2L3PA 1X2QA 4RTUA 2YUPA 3CQTA 5IXBA 2D8HA 2LP5A 2J06A 4CC7A 3EG2A 1M3CA 4J9IA 1K76A 2FPDA 2VKNA 5IHNA 2E5KA 2KYMA 1M3BA 3TVTA 1T3LA 1X6GA 1BBZA 3JV3A 3REBB 4A63B 2CT4A 5IHIA 1TG0A 2KE9A 1UECA 1AD5A 2KRNA 4AG1C 2EPDA 4OMNA 1AWXA 3UF4A 2KRMA 1VYUA 2J6KA 2ED0A 2KYBA 2EYYA 2SEMA 3PVLA 3KFVA 1SSHA 3M0SA 1GCQC 2RQTA 1UGVA 4J9EA 2O9VA 2A37A 2L3QA 4AFUC 1GFDA 2DL3A 4CC4B 2ROLA 1WXTA 2NUZA 2OJ2A 4JZ3A 2EKHA 4X1VA 2DNUA 1UDLA 4E6RA 2K7AA 3ULRB 2RNAA 2EYWA 1UJYA 1AWJA 4RTZA 5IH2A 3EGUA 3H0HA 1Y57A 1E7OA 4HCKA 1XOVA 3THKA 2HSPA 2GNCA 1I1JA 2DJQA 2EGAA 2C0OA 2KEAA 5L23A 2DILA 1EFNA 1MUZA 1YP5A 2EYZA 2YUNA 1E6GA 2X3WD 1NEGA 4AFZC 2VWFA 4FSSA 1B07A 2JTEA 2V1RA 1WYXA 1QWFA 2RN8A 1IO6A 4J9CA 2EYXA 2BTTA 1VYTA 1KJWA 1ZUYA 1OOTA 1NLPC 1K0SA 1H92A 2KT8A 2LQNA 2YUQA 1PKSA 1WX6A 1MV0B 2M51A 5IXFA 2FO0A 1GL5A 2L3SA 3VRZA 2YUOA 2LMJA 3PVQA 2KNBB 2HBWA 2CSQA 1GCPA 1AWWA 1W70A 1W6XA 1WI7A 2VVKA 1W1FA 1QCFA 2YT6A 3VS0A 2J05A 1QLYA 3UA7A 1T3SA 4ORZA 1JXOA 1ZLMA 2V1QA 1I07A 2C0TA 2LJ3A 1N5ZA 1NYFA 2GTOA 2RQVA 3GBQA 1SRLA 3NGPA 3QWYA 3M0TA 3M0QA 4K11A 1TUDA 1OEBA 2O88A 2KROA 4J9HA 2K79A 2RQWA 3RBBB 2ABLA 4D8DA 1JU5C 2SRCA 2LZ6B 2MCNA 4F14A 3I9QA 2BZYA 4LNPA 2CUDA 2K6DA 4DEXA 3H0FA 1FYNA 2D0NA 3PE0A 2AKKA 4ZNXA 2DL7A 1YNZA 2FG0A 3VS2A 2F2VA 2CT3A 2QDLA 4RTVA 2J7IA 1UE9A 2RPNA 2HDAA 1GCQA 4D8KA 2X3XD 2ROTA 4J9FA 2EGEA 1UUEA 2KXCA 1X27A 1QKWA 1RLQC 2D8JA 3TSWA 3O5ZA 3EHRA 2P4RA 2AK5A 4JJCA 1WA7A 1TUCA 2JMCA 2JW4A 2I0NA 1U5SA 1NYGA 2KR3A 1ARKA 2DRKA 3IQLA 2CUBA 2PTKA 4JZ4A 3RNJA 2DBMA 1OV3A 1UHFA 1PHTA 1UFFA 2K2MA 1BK2A 1Y0MA 1K1ZA 1SPKA 2GQIA 2O2OA 2DVJA 2F2XA 2KXDA 2JMAA 2ED1A 3H41A 4OMLA 1PKTA 1WDXA 3A98A 4HXJA 2RQRA 3REAB 1K0XA 1PRMC 4RUGA 3EG3A 1SHFA 4LUDA 4RTYA 1H8KA 2BZXA 1FMKA 1HD3A 4GBQA 1A0NB 3C0CA 1ABQA 1KFZA 2KBTA 3VS4A 2JT4A 2DRMA 4J9BA 1HSQA 2O31A 1LCKA 1SRMA 4OMMA 3NHNA 5GJVB 1M27C 2RMOA 1NG2A 4Z8AA 1PRLC 1OPKA 2YDLA 2C0IA 1X2KA 4LE9A 1PNJA 2YSQA 2MIOA 4JPBW 4RTWA 1AVZC 2GTJA 3LH5A 2CSIA 2J6OA 1X6BA 2GBQA 1GBQA 2FRWA 2ENMA 4J9DA 2ESWA 1GBRA 4Z89A 2EGCA 5FWBA 1I0CA 2J6FA 4Z88A 1YWPA 2DLPA 2A28A 2DX1A 2FEIA 1T0JA 1U3OA 3TSZA 2LX7A 3I5SA 3VS6A 4AFSC 4M4ZA 2A36A 2DM1A 2CDTA 2K9GA 2L2PA 2PNIA 4LN2A 1AZEA 2XMFA 1M30A 1WFWA 1ZBJA 2PZ1A 5I11A 2EBPA 1NEBA 4OMQA 4OMOA 2DBKA 1WLPB 3FJ5A 5HCKA 1J3TA 1U06A 2EVRA 4HVUA 1S1NA 1M3AA 1UJ0A 3EHQA 1WXBA 2RQUA 2HEQA 2DL5A 1RUWA 1VYVA 2MOXA 2W10A 2A08A 2L0AA 2LQWA 2OI3A 1BU1A 2F2WA 2ECZA 1ZSGA 1T0HA 2KGTA 1AZGB 1YCSB 4QT7A 3VRYA 2KRSA 1K9AA 1RI9A 3SHWA 2K3BA 4AFQC 2EW3A 1JO8A 4GLMA 4RTTA 2FPEA 2AKLA 4HVWA 1V1CA 2LJ1A 1QWEA 1X43A 2FPFA 3UATA 1ABOA 2LJ0A 1K4US 2JS0A 3NPFA 3M0PA 2DL4A 2O9SA 1AWOA 1ZUUA 2BZ8A 2AZVA 4EIKA 2KT1A 2CREA 2LNHB 3QWXX 1X69A 1JXMA 3EG1A 1ZX6A 1WIEA 4CC2A 1H3HA 1Z9ZA 1YWOA 3ZL7C 1E6HA 4DEYA 3M0UA 3U23A 2DA9A 2JM9A 1JEGA 2FRYA 4IIOA 1UG1A 1GRIA 2H8HA 2CH4A 1B3QA 2G6FX 5GJWB 2HCKA 3VS7A 2LCSA 1CKBA 4JJDA 1YN8A 3VS5A 1OPLA 3H0IA 1PWTA 2DYBA 2EQIA 4AG2C 5FWCA 1KIKA 2AZSA 2JXBA 2RF0A 3UA6A 2JS2A 4F16A 3M0RA 2DL8A 2OAWA 1QKXA 2JM8A 4WCIA 2W0ZA 1G2BA 5ECAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NM7 A;  2IIM A;  4Y92 A;  3VS1 A;  4R0K A;  1BB9 A;  4HVV A;  3VS3 A;  2DF6 A;  2D1X A;  2GGR A;  1UHC A;  1RLP C;  3EG0 A;  3I35 A;  1WXU A;  2B86 A;  1CSK A;  2DE0 X;  4J9G A;  4ESR A;  1AOJ A;  4LUE A;  1SHG A;  1KSW A;  4IIM A;  5FW9 A;  1G83 A;  1UTI A;  5IHK A;  2NWM A;  3R6N A;  4RTX A;  3I5R A;  4OMP A;  5I22 A;  1AEY A;  1CKA A;  1GFC A;  2CH4 W;  4F17 A;  1M8M A;  1MV3 A;  1SEM A;  1ZUK A;  2M0Y A;  3NMZ C;  2DMO A;  1VA7 A;  4JJB A;  5EC7 A;  1Z9Q A;  4KRT A;  1HJD A;  4CC3 A;  1JQQ A;  3SEM A;  1NLO C;  2L3P A;  1X2Q A;  4RTU A;  2YUP A;  3CQT A;  5IXB A;  2D8H A;  2LP5 A;  2J06 A;  4CC7 A;  3EG2 A;  1M3C A;  4J9I A;  1K76 A;  2FPD A;  2VKN A;  5IHN A;  2E5K A;  2KYM A;  1M3B A;  3TVT A;  1T3L A;  1X6G A;  1BBZ A;  3JV3 A;  3REB B;  4A63 B;  2CT4 A;  5IHI A;  1TG0 A;  2KE9 A;  1UEC A;  1AD5 A;  2KRN A;  4AG1 C;  2EPD A;  4OMN A;  1AWX A;  3UF4 A;  2KRM A;  1VYU A;  2J6K A;  2ED0 A;  2KYB A;  2EYY A;  2SEM A;  3PVL A;  3KFV A;  1SSH A;  3M0S A;  1GCQ C;  2RQT A;  1UGV A;  4J9E A;  2O9V A;  2A37 A;  2L3Q A;  4AFU C;  1GFD A;  2DL3 A;  4CC4 B;  2ROL A;  1WXT A;  2NUZ A;  2OJ2 A;  4JZ3 A;  2EKH A;  4X1V A;  2DNU A;  1UDL A;  4E6R A;  2K7A A;  3ULR B;  2RNA A;  2EYW A;  1UJY A;  1AWJ A;  4RTZ A;  5IH2 A;  3EGU A;  3H0H A;  1Y57 A;  1E7O A;  4HCK A;  1XOV A;  3THK A;  2HSP A;  2GNC A;  1I1J A;  2DJQ A;  2EGA A;  2C0O A;  2KEA A;  5L23 A;  2DIL A;  1EFN A;  1MUZ A;  1YP5 A;  2EYZ A;  2YUN A;  1E6G A;  2X3W D;  1NEG A;  4AFZ C;  2VWF A;  4FSS A;  1B07 A;  2JTE A;  2V1R A;  1WYX A;  1QWF A;  2RN8 A;  1IO6 A;  4J9C A;  2EYX A;  2BTT A;  1VYT A;  1KJW A;  1ZUY A;  1OOT A;  1NLP C;  1K0S A;  1H92 A;  2KT8 A;  2LQN A;  2YUQ A;  1PKS A;  1WX6 A;  1MV0 B;  2M51 A;  5IXF A;  2FO0 A;  1GL5 A;  2L3S A;  3VRZ A;  2YUO A;  2LMJ A;  3PVQ A;  2KNB B;  2HBW A;  2CSQ A;  1GCP A;  1AWW A;  1W70 A;  1W6X A;  1WI7 A;  2VVK A;  1W1F A;  1QCF A;  2YT6 A;  3VS0 A;  2J05 A;  1QLY A;  3UA7 A;  1T3S A;  4ORZ A;  1JXO A;  1ZLM A;  2V1Q A;  1I07 A;  2C0T A;  2LJ3 A;  1N5Z A;  1NYF A;  2GTO A;  2RQV A;  3GBQ A;  1SRL A;  3NGP A;  3QWY A;  3M0T A;  3M0Q A;  4K11 A;  1TUD A;  1OEB A;  2O88 A;  2KRO A;  4J9H A;  2K79 A;  2RQW A;  3RBB B;  2ABL A;  4D8D A;  1JU5 C;  2SRC A;  2LZ6 B;  2MCN A;  4F14 A;  3I9Q A;  2BZY A;  4LNP A;  2CUD A;  2K6D A;  4DEX A;  3H0F A;  1FYN A;  2D0N A;  3PE0 A;  2AKK A;  4ZNX A;  2DL7 A;  1YNZ A;  2FG0 A;  3VS2 A;  2F2V A;  2CT3 A;  2QDL A;  4RTV A;  2J7I A;  1UE9 A;  2RPN A;  2HDA A;  1GCQ A;  4D8K A;  2X3X D;  2ROT A;  4J9F A;  2EGE A;  1UUE A;  2KXC A;  1X27 A;  1QKW A;  1RLQ C;  2D8J A;  3TSW A;  3O5Z A;  3EHR A;  2P4R A;  2AK5 A;  4JJC A;  1WA7 A;  1TUC A;  2JMC A;  2JW4 A;  2I0N A;  1U5S A;  1NYG A;  2KR3 A;  1ARK A;  2DRK A;  3IQL A;  2CUB A;  2PTK A;  4JZ4 A;  3RNJ A;  2DBM A;  1OV3 A;  1UHF A;  1PHT A;  1UFF A;  2K2M A;  1BK2 A;  1Y0M A;  1K1Z A;  1SPK A;  2GQI A;  2O2O A;  2DVJ A;  2F2X A;  2KXD A;  2JMA A;  2ED1 A;  3H41 A;  4OML A;  1PKT A;  1WDX A;  3A98 A;  4HXJ A;  2RQR A;  3REA B;  1K0X A;  1PRM C;  4RUG A;  3EG3 A;  1SHF A;  4LUD A;  4RTY A;  1H8K A;  2BZX A;  1FMK A;  1HD3 A;  4GBQ A;  1A0N B;  3C0C A;  1ABQ A;  1KFZ A;  2KBT A;  3VS4 A;  2JT4 A;  2DRM A;  4J9B A;  1HSQ A;  2O31 A;  1LCK A;  1SRM A;  4OMM A;  3NHN A;  5GJV B;  1M27 C;  2RMO A;  1NG2 A;  4Z8A A;  1PRL C;  1OPK A;  2YDL A;  2C0I A;  1X2K A;  4LE9 A;  1PNJ A;  2YSQ A;  2MIO A;  4JPB W;  4RTW A;  1AVZ C;  2GTJ A;  3LH5 A;  2CSI A;  2J6O A;  1X6B A;  2GBQ A;  1GBQ A;  2FRW A;  2ENM A;  4J9D A;  2ESW A;  1GBR A;  4Z89 A;  2EGC A;  5FWB A;  1I0C A;  2J6F A;  4Z88 A;  1YWP A;  2DLP A;  2A28 A;  2DX1 A;  2FEI A;  1T0J A;  1U3O A;  3TSZ A;  2LX7 A;  3I5S A;  3VS6 A;  4AFS C;  4M4Z A;  2A36 A;  2DM1 A;  2CDT A;  2K9G A;  2L2P A;  2PNI A;  4LN2 A;  1AZE A;  2XMF A;  1M30 A;  1WFW A;  1ZBJ A;  2PZ1 A;  5I11 A;  2EBP A;  1NEB A;  4OMQ A;  4OMO A;  2DBK A;  1WLP B;  3FJ5 A;  5HCK A;  1J3T A;  1U06 A;  2EVR A;  4HVU A;  1S1N A;  1M3A A;  1UJ0 A;  3EHQ A;  1WXB A;  2RQU A;  2HEQ A;  2DL5 A;  1RUW A;  1VYV A;  2MOX A;  2W10 A;  2A08 A;  2L0A A;  2LQW A;  2OI3 A;  1BU1 A;  2F2W A;  2ECZ A;  1ZSG A;  1T0H A;  2KGT A;  1AZG B;  1YCS B;  4QT7 A;  3VRY A;  2KRS A;  1K9A A;  1RI9 A;  3SHW A;  2K3B A;  4AFQ C;  2EW3 A;  1JO8 A;  4GLM A;  4RTT A;  2FPE A;  2AKL A;  4HVW A;  1V1C A;  2LJ1 A;  1QWE A;  1X43 A;  2FPF A;  3UAT A;  1ABO A;  2LJ0 A;  1K4U S;  2JS0 A;  3NPF A;  3M0P A;  2DL4 A;  2O9S A;  1AWO A;  1ZUU A;  2BZ8 A;  2AZV A;  4EIK A;  2KT1 A;  2CRE A;  2LNH B;  3QWX X;  1X69 A;  1JXM A;  3EG1 A;  1ZX6 A;  1WIE A;  4CC2 A;  1H3H A;  1Z9Z A;  1YWO A;  3ZL7 C;  1E6H A;  4DEY A;  3M0U A;  3U23 A;  2DA9 A;  2JM9 A;  1JEG A;  2FRY A;  4IIO A;  1UG1 A;  1GRI A;  2H8H A;  2CH4 A;  1B3Q A;  2G6F X;  5GJW B;  2HCK A;  3VS7 A;  2LCS A;  1CKB A;  4JJD A;  1YN8 A;  3VS5 A;  1OPL A;  3H0I A;  1PWT A;  2DYB A;  2EQI A;  4AG2 C;  5FWC A;  1KIK A;  2AZS A;  2JXB A;  2RF0 A;  3UA6 A;  2JS2 A;  4F16 A;  3M0R A;  2DL8 A;  2OAW A;  1QKX A;  2JM8 A;  4WCI A;  2W0Z A;  1G2B A;  5ECA A; 
#chains in the Genus database with same CATH topology
 4PJO D;  4IUT A;  3O8V A;  3QZ5 B;  3VS3 A;  1JJ2 S;  5C6S A;  1IRE B;  1C0M A;  4M77 A;  3CC7 Q;  4PJN A;  3I55 Q;  1BIA A;  4J9G A;  1TTH B;  4LUE A;  2F5T X;  1QVG A;  3MEU A;  5KYY A;  4IIM A;  5FW9 A;  1JJ2 A;  2QTV A;  3BW1 A;  4UC4 A;  5LJ5 d;  1CKA A;  1GFC A;  2CH4 W;  3CCU T;  4PJO B;  1MV3 A;  5DLO A;  4JRQ A;  1VQ7 T;  2LCL A;  2M0Y A;  5I21 A;  1XJW B;  5EC7 A;  3CCJ A;  1X2Q A;  3CQT A;  3L2Q A;  2DYI A;  2B8A A;  2D8H A;  1ZSZ C;  2E65 A;  3HRT A;  3CCR A;  5CVI A;  4M78 F;  3P8D A;  3C95 A;  4BI4 A;  2CZ0 B;  2IVW A;  3TVT A;  1F1B B;  3JSC A;  3M9Q A;  3OYB A;  1T3L A;  5LJ3 j;  1BI3 A;  1B34 A;  4C8Q G;  1OU9 A;  4PJJ A;  1O75 A;  2P0K A;  1UEC A;  3X20 B;  3OBW A;  5KCH A;  2E3I A;  5GAO n;  3CCV Q;  5J26 A;  2NYS A;  3OA6 A;  4FT4 A;  3OYH A;  1AWX A;  2Y4X A;  2ED0 A;  2M1H A;  1ZQ1 A;  4C8Q F;  1RAC B;  1SSH A;  2L8D A;  1KG1 A;  2QQS A;  4F7U E;  2O9V A;  4AFU C;  5GAN g;  1Q86 U;  1WXT A;  2VXF A;  2VYT A;  2HQX A;  3M56 A;  3OYA A;  2GQV A;  1C6V X;  2DNU A;  2K7A A;  3ME9 A;  3JCM c;  1Y57 A;  1G8X A;  2RH2 A;  4HCK A;  2ZPG B;  1I1J A;  2EYZ A;  2QQ9 A;  1MND A;  1IB8 A;  1K9M R;  1E6G A;  4MMK A;  3JCM e;  3CEY A;  4XK8 E;  5C0M A;  4E7L A;  2V1R A;  1WYX A;  3KXT A;  3URG A;  4R55 A;  4J9C A;  4ZN3 A;  1RAB B;  4HT8 A;  5GMK l;  2FB7 A;  1NLP C;  3CMA T;  2QA4 Q;  4M7D D;  3SWN B;  4X34 A;  1BI2 A;  4V2S A;  1WQW A;  3VRZ A;  3ZFJ A;  4FYV B;  4KBM B;  2HBW A;  3PNW C;  4BB7 A;  5GMK i;  3FEO A;  3OMG A;  3OYC A;  1W6X A;  2EIF A;  2VVK A;  2RJC A;  3I56 Q;  3CCE A;  1QCF A;  3UPU A;  3BDL A;  3RIR A;  4Y28 E;  4ORZ A;  1ZLM A;  3L2W A;  4FL6 A;  1I07 A;  4M7D B;  1M4Z A;  3A8G B;  3ER0 A;  2K2V A;  4C92 G;  4M78 D;  2KSS A;  1RI0 A;  1KC8 C;  2OTJ Q;  3CCJ T;  3MET A;  2R57 A;  1OEB A;  1X6O A;  5LJ5 g;  1LOJ A;  2ZAE A;  2K79 A;  4J6X A;  2RHU A;  3PIP A;  4M75 G;  3I9Q A;  3OYI A;  2RHI A;  1KHI A;  1BKB A;  1O9S A;  3H0F A;  1FYN A;  2DFU A;  3CCR T;  3PE0 A;  2AKK A;  4C5E A;  3EGD B;  2XK0 A;  3QII A;  3VS2 A;  4RTV A;  1YCY A;  4C8Q D;  1UB4 A;  4B9W A;  4M75 F;  1VQ8 T;  2G3R A;  3VYG A;  1S72 Q;  2CZ1 B;  4J9F A;  1PSE A;  3MEW A;  3JB9 G;  2PU9 B;  3EHR A;  5GAN 5;  2P0P A;  2X4W A;  4JJC A;  3EAE A;  2JW4 A;  4KUI A;  3L2V A;  3H8Z A;  1U5S A;  1VQP A;  1NYG A;  3OS5 A;  3JCM W;  3IQL A;  3G1J A;  4OGE A;  1OV3 A;  1UHF A;  4F7U A;  1U1T A;  3OYL A;  3MP6 A;  3JB9 F;  1YJN A;  3OS2 A;  1GXI E;  2C06 A;  4F04 B;  4Q5W A;  2ED1 A;  1WDX A;  2HKN A;  2IPO B;  2WSE E;  3MCA B;  4XQ3 A;  2HMA A;  1IHV A;  4BDZ A;  1W2B P;  4OMF B;  4RUG A;  5GAO q;  1SHF A;  4PFO A;  2NUT A;  5GAO r;  1BCO A;  4RTY A;  4M77 B;  1HK9 A;  1HD3 A;  3HPW A;  1VQ9 Q;  3JB9 J;  4IUP A;  4KGZ B;  4XTV A;  1JB0 E;  3JCM f;  2KBT A;  3VS4 A;  2DRM A;  5KYY B;  2CP3 A;  3M53 A;  3M58 A;  3KUF A;  5GAO l;  2QGG A;  3PTA A;  4J5Y A;  5KE3 A;  3A8L B;  2LDM A;  2VUB A;  1TOV A;  4J6W A;  4KUL A;  1PRL C;  2C0I A;  2PVO B;  1D09 B;  1X2K A;  2PVG B;  4XTZ A;  2MIO A;  5FU6 C;  2CSI A;  1NE8 A;  3G4S T;  1X6B A;  2ENM A;  4J9D A;  2ESW A;  5A0D A;  1TXQ A;  2L3R A;  1GBR A;  4Z89 A;  2CP2 A;  2MYS A;  2DLP A;  3OYD A;  3CD6 A;  2F1L A;  3AT1 B;  1U3O A;  3TSZ A;  4FT2 A;  4GLK A;  3UT1 A;  1OUL A;  1VQ5 Q;  1OZ3 A;  2PNI A;  1AZE A;  3RUX A;  1M30 A;  2COW A;  1KHC A;  1MMD A;  2EBP A;  1B34 B;  1NPR A;  4PKC C;  3DKM A;  1JRI A;  4JRP A;  1PSF A;  2K5F A;  4HVU A;  1WJR A;  3CBO A;  1S1N A;  3X28 B;  1UJ0 A;  4L6V 5;  3OSS C;  1WXB A;  5D6W A;  2LNV A;  1Y71 A;  5KH6 A;  2DL5 A;  2K5L A;  2XIC A;  4J8O A;  2W10 A;  3DLM A;  2A08 A;  2L0A A;  5FRM A;  1KQS P;  2MF2 A;  3V8K A;  4M7A G;  2MPX C;  3RER A;  2DD4 A;  3JB9 D;  3HKS A;  1W4S A;  3S3M A;  3MHX A;  1K8A C;  3P8B B;  2DIG A;  4RTT A;  2AKL A;  5GAM j;  1KC8 R;  1QWE A;  1VQP T;  4LD9 K;  1X43 A;  1EIF A;  2FPF A;  1VIF A;  2PUK B;  3CCU Q;  4ELZ C;  2O9S A;  3HFN A;  3LGL A;  4FYY B;  2RI3 A;  1RAF B;  2BZ8 A;  4EIK A;  2KT1 A;  2LNH B;  4FYW B;  3QWX X;  3OW2 S;  2NUP A;  3RR6 A;  1ZX6 A;  4CC2 A;  1Z9Z A;  1YWO A;  2DAQ A;  2YXY A;  1E6H A;  2ZPH B;  4XTY A;  3G7Z A;  1VQO Q;  8AT1 B;  3CME T;  2CH4 A;  4MDW A;  3VS7 A;  4L59 A;  1XQH A;  3EG9 A;  2E12 A;  1OPL A;  2DJZ A;  4B9X A;  4EDU A;  2DYB A;  3NTH A;  1VQ4 Q;  1KIK A;  4RCC A;  2DD5 A;  3CCQ A;  2JXB A;  1OX9 A;  1M2V A;  1QVP A;  4WCI A;  4KH1 B;  2A7Y A;  2QEX Q;  3VS1 A;  2M0O A;  4JRK A;  3MO8 A;  4PJO G;  1QMC A;  2LX9 A;  3BY7 A;  2CGH A;  4M77 E;  2GGR A;  1NJI U;  1UHC A;  3CD6 T;  5A2Q E;  3EG0 A;  3I35 A;  2ZPI B;  1SHG A;  1KSW A;  2E6Z A;  1BYM A;  1RAD B;  2DVE A;  1Y7X A;  5IHK A;  3SFM A;  4JUV A;  4RTX A;  3I5R A;  1NPP A;  1AEY A;  4PJO F;  3DB3 A;  5LJ5 h;  2DZ9 A;  1SEM A;  2KQW A;  4M77 C;  3NMZ C;  3OSV A;  3CC2 Q;  3A8O B;  1JQQ A;  4EMH A;  4QVD A;  2L3P A;  5CKE A;  2BIV A;  1KD1 U;  2CZ6 B;  4Z02 A;  3V8J A;  5IXB A;  4CC7 A;  2VAS A;  1UGP B;  3PMI A;  2COZ A;  2RHY A;  4J9I A;  2VKN A;  4N0A A;  4LDW A;  4LDU A;  2K3Y A;  4F7U B;  4J7I A;  2QGF B;  5KE2 A;  2EWN A;  1TS9 A;  2DEU A;  1OZ2 A;  3JV3 A;  3REB B;  4A63 B;  1N8R C;  3S3N A;  1TG0 A;  4HKE A;  2R5A A;  2KRN A;  1AD5 A;  4AG1 C;  2D9T A;  3RES A;  1N27 A;  1LJO A;  5GAN d;  4OB1 B;  4JRI A;  3UF4 A;  2ZGW A;  3G6E A;  2NUT B;  2SEM A;  1PM3 A;  3OYY A;  4PK4 A;  5LJ3 g;  3NFC A;  1JBM A;  3M0S A;  4BD3 A;  4DBQ A;  5KYW A;  2RQT A;  3J7A F;  4J9E A;  2QTX A;  1Q82 C;  2DL3 A;  2NUZ A;  2EFI A;  2M02 A;  3ULR B;  2RNA A;  4XU3 A;  1P92 A;  1AWJ A;  1MMN A;  1K8A R;  5GAM f;  3H0H A;  3RDV A;  2DJQ A;  2DIL A;  1EFN A;  2X3W D;  2BUD A;  4LD6 A;  4AFZ C;  1B07 A;  3CCQ T;  3OW2 P;  2DEQ A;  1IO6 A;  1VYT A;  1KJW A;  2V8I A;  1ZUY A;  3E1S A;  3JCM X;  3J80 E;  1WX6 A;  1YIT Q;  2QXF A;  3FJP A;  1I8F A;  4M7D G;  2ATC B;  2FO0 A;  1GL5 A;  2L3S A;  2AIR B;  2YUO A;  2A3L A;  1M1G A;  4JLI A;  3TEE A;  3QDR B;  2GF7 A;  1QP2 A;  1VQL A;  5FLX E;  3VS0 A;  2J05 A;  1QLY A;  1T3S A;  5DLQ E;  2BE9 B;  1MMA A;  4M7D F;  1VQN A;  1N6A A;  5M9O A;  2V1Q A;  5GAN 7;  4RKU E;  4XTX A;  2GTO A;  4BE2 A;  1SRL A;  4M78 G;  3QWY A;  3PGG A;  4B6M A;  3VUB A;  2P4T A;  5J39 A;  2Z0W A;  5HKC A;  1PC0 A;  2O88 A;  3H9N A;  2RD1 A;  2ABL A;  4D8D A;  2MCN A;  2QAZ A;  1XNI A;  2HQE A;  3T9N A;  2DER A;  2DXU A;  4ZNX A;  1MMG A;  5GAN 2;  1ZA2 B;  4FM4 B;  2CT3 A;  2QDL A;  2HZY A;  1VQ8 A;  1YJW T;  2J7I A;  1UEB A;  1I81 A;  1VQM A;  3CCS Q;  2NUP B;  3CCE Q;  3VJP A;  1QKW A;  2EQU A;  2D8J A;  2EJF A;  3TSW A;  4ZGE B;  2EJG A;  4PFZ A;  3X25 B;  3BE3 A;  3PIO A;  1W2B S;  1WA7 A;  1TUC A;  2JMC A;  3INZ A;  2XKO C;  1YIJ A;  2YHT A;  3G6E T;  5HK3 A;  2KR3 A;  5FU6 B;  4JZ4 A;  2DBM A;  3EG9 B;  4C92 A;  1W2B A;  2K2M A;  1UFF A;  1BK2 A;  2XG8 D;  4HA8 A;  1K1Z A;  2CP5 A;  1SPK A;  2JTF A;  2CZ7 B;  4M77 G;  4XU2 A;  2LVM A;  2O2O A;  3KBG A;  3PT9 A;  2DVJ A;  2KXD A;  5A0L A;  3WVD B;  1M2V B;  4IUU A;  3CBM A;  3RMQ A;  3A98 A;  4HXJ A;  1KQ2 A;  2RQR A;  2YWW A;  3GF5 A;  3PFS A;  4A4G A;  1UGS B;  1PRM C;  2E41 A;  4A4F A;  1N8R R;  3EG3 A;  4M77 F;  4LUD A;  2M16 A;  2BZX A;  1FMK A;  3E2U A;  4GBQ A;  4E7J A;  1SKU B;  2JNG A;  1M8V A;  1D1A A;  2RHZ A;  3C0C A;  2JT4 A;  2ZPF B;  1Y07 A;  4TVR A;  4VUB A;  4J9B A;  3FIF A;  2O31 A;  1LCK A;  1SRM A;  3M4G A;  2WSC E;  2VV5 A;  4E7H A;  3NHN A;  1G3W A;  4DOV A;  1M27 C;  2RMO A;  1NG2 A;  2ZCF B;  2YDL A;  3P8H A;  3A8H B;  1PNJ A;  3CBP A;  2GFU A;  3L2R A;  1Q82 R;  2YRD A;  3G4S A;  2GTJ A;  2J6O A;  1VQL T;  3QJY A;  1GBQ A;  1VOM A;  2CP0 A;  3JCM b;  1YJN Q;  3M5A A;  5CKB A;  1VIE A;  1VQN T;  1YWP A;  2A28 A;  2DX1 A;  1M1K R;  2JN0 A;  4QKU A;  2LX7 A;  1KQS S;  3FLG A;  2LT1 A;  4C5I A;  2A36 A;  2DM1 A;  3G71 Q;  2DXB A;  5FU7 B;  3QHS A;  2CDT A;  2L2P A;  4JLG A;  3DB4 A;  1KQS A;  3CC4 T;  4QQ6 A;  3AHU A;  1YBY A;  1WHH A;  1NEB A;  4OMO A;  1LVK A;  4ME7 A;  1WLP B;  1YJ9 T;  2EVR A;  1M3A A;  3EHQ A;  4FW1 A;  3FDR A;  1I4K 1;  2RQU A;  1RUW A;  1VYV A;  4BDY A;  1Q86 C;  1V29 B;  2LQW A;  4IKF A;  1R8O B;  2R5M A;  1VQK T;  2ECZ A;  3QSU A;  5KYW B;  1VQM T;  2H3E B;  2KRS A;  2EKO A;  1K9A A;  1G3Y A;  3LH0 A;  2K3B A;  4DA4 A;  3CD6 Q;  3SD4 A;  1QVF P;  1YIJ T;  4MZM A;  2LJ1 A;  1D0Y A;  3RKX A;  5FRO A;  3DLL A;  5LJ3 h;  4IUQ A;  2LJ0 A;  3EGX A;  3LW5 E;  3NPF A;  3H6Z A;  4M77 D;  3CCM Q;  1ZUU A;  1Q7Y R;  2AZV A;  1X75 C;  3HP9 A;  1M1F A;  2CRE A;  3CC7 T;  5GAM g;  3I55 T;  2HSE B;  2L89 A;  1H3H A;  2IG0 A;  3CCL Q;  1C1A A;  3U23 A;  1FX7 A;  3CME A;  2E10 A;  2FRY A;  4IIO A;  3A1P A;  2EJ9 A;  1UG1 A;  1GRI A;  3ASK A;  2H8H A;  2HL3 A;  2M9U A;  4A54 A;  5GAN e;  1K8A U;  1WNL A;  3HRS A;  1M90 C;  1TWB A;  2COY A;  1YN8 A;  4M7A A;  2OTJ A;  3H0I A;  2QK0 A;  1G3S A;  2EQI A;  5KYU A;  3Q1J A;  2RF0 A;  2DXC A;  4C0G A;  4WTO B;  2XDP A;  3C4S A;  2JM8 A;  4RG8 A;  5J3B A;  1FWZ A;  2RJF A;  4IUR A;  1Q81 C;  1NZ9 A;  4HVV A;  3OBY A;  5KYN A;  4C0D B;  2DF6 A;  2D1X A;  2RK2 A;  3GNG A;  1WXU A;  2B86 A;  1CSK A;  2EQK A;  2DE0 X;  4BE1 A;  1S72 A;  2DXT A;  1VUB A;  3L42 A;  3HRU A;  5LJ5 j;  1UTI A;  3GLX A;  5D7U A;  2NWM A;  3CCV T;  3R6N A;  1HYO A;  5I22 A;  4F17 A;  3EFO A;  1M8M A;  1ZUK A;  3CXC P;  1H3Z A;  1YI2 A;  1VA7 A;  4C0Z A;  4F7U G;  4JJB A;  3RKW A;  4CC3 A;  3SEM A;  1NLO C;  3OYF A;  2JTM A;  5D6Y A;  2MWP A;  2QYZ A;  1YHQ Q;  4HCB A;  2HKQ B;  1RAA B;  4II1 A;  4XU1 A;  3X26 B;  4F7U F;  2FPD A;  5LJ5 e;  5IHN A;  3V7C A;  4C92 B;  2E5K A;  2KYM A;  3C12 A;  1X6G A;  1IHW A;  4GY5 A;  2RHX A;  3J81 E;  2CT4 A;  5IHI A;  5KCO A;  3BDU A;  2ZZD A;  5LJ3 d;  2XU8 A;  3OMC A;  3M57 A;  4AMC A;  5CAI A;  1VQ6 A;  4N0A C;  4OGC A;  2Y90 A;  5FU7 C;  3F70 A;  2EPD A;  2HL5 C;  4OMN A;  4C0F A;  4DBH A;  2YLC A;  1VQ7 Q;  1VYU A;  5GAN h;  2J6K A;  2EYY A;  4QVZ A;  2OTL A;  3KFV A;  1DJ7 B;  4KT0 E;  1GCQ C;  3JCM d;  3LGF A;  5CKF A;  3GOX A;  2VGM A;  4N4H A;  2A37 A;  1GFD A;  1G5V A;  1Q86 R;  2ROL A;  2OJ2 A;  2EKH A;  4X1V A;  3OW2 A;  1UDL A;  4OVA A;  1D1C A;  4E6R A;  5D6X A;  4RTZ A;  1R0C B;  4LDX A;  2GNC A;  2KEA A;  2EGA A;  2C0O A;  1VQ5 A;  1MUZ A;  1YP5 A;  3GNF B;  2YUN A;  2OTJ T;  1K9M U;  1N8R U;  1NEG A;  3E9F A;  2RA2 A;  2YRV A;  1H64 1;  3JB9 H;  1QWF A;  2EYX A;  2BTT A;  3MKD A;  1OOT A;  4PJL A;  1H92 A;  2YUQ A;  3MEV A;  1MV0 B;  3QBY A;  5IXF A;  3G6E Q;  1D3B A;  4MZT A;  4XAX B;  3PVQ A;  1GCP A;  2BE7 D;  4RMO A;  4QQG A;  1W1F A;  1S72 T;  2YT6 A;  3EH2 A;  2L5Q A;  2LQ8 A;  4NL2 A;  1WQ7 A;  4KUD K;  1JXO A;  4JJN K;  2VXE A;  1FMW A;  4LDV A;  1M90 R;  2HAX A;  4X9C A;  3UWN A;  1NYF A;  3HTR A;  3NGP A;  1YI2 T;  4E7Z A;  2FZK B;  2E5Q A;  4K11 A;  1TUD A;  4NOY A;  2JZ2 A;  2KRO A;  1NBE B;  3SWN A;  3FB9 A;  2FYK A;  3RBB B;  5I2S A;  1ZHI A;  2LZ6 B;  2DET A;  4F14 A;  2BZY A;  4LNP A;  3QYH B;  2CUD A;  2K6D A;  3CMA Q;  1EX4 A;  4EMK A;  2OX7 A;  3CPW P;  2DL7 A;  1YNZ A;  3EGX B;  1Q81 R;  5LJ5 f;  1YJW A;  3HHT B;  4RG2 A;  4X9D A;  2RPN A;  2HDA A;  3M54 A;  4C0D C;  1GCQ A;  2KMT A;  4D8K A;  4HCC A;  2XD0 A;  2ROT A;  3TCJ A;  3QDF A;  1UUE A;  3QJ6 A;  4O5V A;  2DPP B;  1X27 A;  2DIQ A;  1RLQ C;  1VQ6 T;  2EAY A;  2HQH A;  2P4R A;  1VQ4 A;  1MHN A;  4KGV B;  1ARK A;  2DRK A;  3CCJ Q;  2CUB A;  2PTK A;  2RJD A;  2OTL T;  3RNJ A;  4M7A B;  1FXX A;  4C92 E;  3JCM Q;  2D0Q B;  1Y0M A;  2CYZ B;  4M78 A;  2RI2 A;  3BFM A;  3MPU B;  5KYU B;  2LT4 A;  2F5K A;  3MP1 A;  2F2X A;  4OML A;  3CCR Q;  1M1K C;  4M75 E;  1PKT A;  3JCM g;  3V8L A;  2XI9 A;  4OP0 A;  4E7S A;  2H3J A;  4DOW A;  4C92 C;  2DK3 A;  1K0X A;  1OQK A;  1VQ5 T;  3S6W A;  1VQ8 Q;  3L2Z A;  2QQR A;  2I2L A;  1U8R A;  1M9S A;  1H8K A;  2YRC A;  1VQM Q;  4C8Q A;  1K73 C;  4M75 C;  1ABQ A;  1KFZ A;  4CRI A;  4BI3 A;  1PD0 A;  3EFO B;  2KVQ G;  5IT9 E;  4OMM A;  4LDY A;  1OYX A;  2GCX A;  4Z8A A;  2VGN A;  4JDS A;  4LE9 A;  1N9S A;  1MGQ A;  2YSQ A;  4RTW A;  3LH5 A;  4ZN1 A;  2FRW A;  3VV0 A;  5FWB A;  1I0C A;  4Z88 A;  1IXD A;  1QVG S;  2XDB A;  1FMV A;  2FEI A;  4Y91 A;  1M5Q 1;  1UGQ B;  4M4Z A;  2OAU A;  3A8M B;  2DO3 A;  2YLB A;  1SG5 A;  4E7I A;  2XMF A;  1WFW A;  1ZBJ A;  2K3X A;  3CC4 A;  2AHJ B;  4PFP A;  2PZ1 A;  5I11 A;  1ZBX A;  4OB0 B;  1X01 A;  4XU0 A;  1Q7Y C;  1YJ9 A;  1QVF S;  4QW2 A;  3GP8 A;  2DBK A;  2RJE A;  5HCK A;  4C5H A;  4E7K A;  1U06 A;  4ZTF A;  2DTH A;  2DZC A;  3OYG A;  4DQ2 A;  2RK1 A;  1QVF A;  3ZBD A;  4P5N A;  2HEQ A;  1OU8 A;  1TUG B;  2FHD A;  5GAN 6;  1VQK A;  1BU1 A;  1VQO T;  1B7T A;  4AT1 B;  1WJS A;  1ZSG A;  2KGT A;  3QYG B;  4MZP A;  3G4S Q;  1AZG B;  1IZ6 A;  1YCS B;  5CIU A;  2X4X A;  2HBP A;  4KGX B;  3S3O A;  3LWI A;  2JOY A;  1D0X A;  2FPE A;  2E4H A;  2ZPE B;  3EFR A;  1VQ4 T;  1KC8 U;  2D6F A;  4HVW A;  3NTK A;  5GAM d;  2JVV A;  1ABO A;  4OB2 B;  2CS7 A;  5GMK h;  4C5G A;  2JS0 A;  3M0P A;  1AWO A;  1YIT A;  5DM7 R;  2QEX T;  4D6W A;  5IN1 A;  3CC7 A;  4M75 A;  2LQK A;  3I55 A;  1X69 A;  1JXM A;  1WIE A;  1RAE B;  1PG5 B;  2EYQ A;  3EFS A;  1WHK A;  5CKH A;  1AHJ B;  5LJ3 e;  2K4Y A;  2DA9 A;  2JM9 A;  2VC8 A;  4QVC A;  1D3B B;  3L2U A;  4PL6 A;  1Y96 A;  1B3Q A;  5GJW B;  2QG9 B;  4M7A E;  5L8R E;  3HL8 A;  3VS5 A;  3CC2 T;  1LPL A;  2O4X A;  5FWC A;  4XTU A;  3OS0 A;  3OYK A;  1VQP Q;  5CR2 A;  2JS2 A;  3CXC S;  2JJ9 A;  1Q95 G;  1WHM A;  3RMS A;  4ATO A;  4M7A C;  1G2B A;  5ECA A;  1NM7 A;  2IIM A;  4Y92 A;  4R0K A;  1WHL A;  3CXC A;  1BB9 A;  3TQ7 P;  3E19 A;  5LL6 S;  1RLP C;  2EQJ A;  4E47 A;  1NJI R;  1RAI B;  2K57 A;  4EMK B;  2FVU A;  4ESR A;  3CCS A;  1AOJ A;  2CKK A;  3CCV A;  2RM4 A;  1G83 A;  2RB6 A;  1R77 A;  2NLU A;  4OMP A;  2WAC A;  1ZSZ A;  2A0F B;  2DKG A;  3CME Q;  5CK9 A;  3JCM J;  3HFO A;  1WZO A;  1K73 R;  1M90 U;  1TU0 B;  3PMT A;  2DMO A;  2X35 A;  1Z9Q A;  4KRT A;  1HJD A;  1EZZ B;  3LLR A;  4RTU A;  3GPL A;  2YUP A;  2HD0 A;  4PNO A;  2QDY B;  3OY9 A;  1KD1 R;  1QVG P;  4BY6 B;  2LP5 A;  1JJ2 P;  2J06 A;  3OS1 A;  3EG2 A;  1M3C A;  5CCA A;  4OF1 A;  5GAN 4;  4C92 F;  1K76 A;  2RI5 A;  4OB3 B;  3MJX A;  1M3B A;  4M78 B;  2V8K A;  1Q81 U;  5AT1 B;  1BBZ A;  3JCM P;  3EH1 A;  2FZG B;  3JRZ A;  4PJO E;  5GMK m;  1BCM A;  3QUI A;  5EG2 A;  4L5G A;  2FZC B;  2KE9 A;  3SB2 A;  3CPF A;  5GAN j;  1TH7 A;  4A4H A;  2QA4 A;  2KAF A;  4N4G A;  1WHG A;  1SSF A;  2KRM A;  2MAM A;  1BI0 A;  2ZPB B;  2KYB A;  1YIT T;  4R56 A;  4FYX B;  4PJO C;  3PVL A;  1YI2 Q;  4FW2 A;  4C8Q B;  5KYX A;  1UGV A;  3I56 A;  3JCM h;  2L3Q A;  3JCM V;  4PJM A;  4CC4 B;  2F69 A;  5IAY A;  4JZ3 A;  3QO3 A;  1AT1 B;  2QQA A;  1BIB A;  5LJ3 f;  1PD1 A;  2EYW A;  4JS5 A;  1UJY A;  4N4I A;  8ATC B;  5IH2 A;  3EGU A;  1N9R A;  1E7O A;  4J6Y A;  1XOV A;  3THK A;  2HSP A;  4EPC A;  5L23 A;  3G71 A;  4YTL A;  3M55 A;  4EMG A;  2JUF A;  4BE0 A;  2VWF A;  4FSS A;  2JTE A;  2LRQ A;  4RCB A;  2RN8 A;  2DTO A;  2QAS A;  4JS4 A;  3GIB A;  1PCX A;  1IGU A;  3VU3 C;  1VQ6 Q;  1I5L A;  4KH0 B;  1K0S A;  1UGR B;  2KT8 A;  2LQN A;  1PKS A;  2M51 A;  4CI0 C;  4DBF A;  2LMJ A;  2OTL Q;  2KNB B;  3RKY A;  2CSQ A;  1AWW A;  3OYE A;  1W70 A;  1WI7 A;  2EQM A;  3FRN A;  3CCS T;  3UA7 A;  3CCE T;  3CPW S;  5CKD A;  1MNE A;  5I2M A;  1WJQ A;  4MDX A;  2C0T A;  4A53 A;  4A4K A;  4HCZ A;  2LJ3 A;  4C92 D;  1N5Z A;  3CPW A;  3VUZ A;  2RQV A;  2KK4 A;  3GBQ A;  3JB9 I;  1WGS A;  3M0T A;  2PUO B;  3M0Q A;  3OB9 A;  5DY9 A;  2E3H A;  3VYH B;  3HSB A;  1M2O A;  2LC4 A;  3CCQ Q;  4J9H A;  3LWH A;  1WHJ A;  3CCM A;  2RQW A;  3WXM B;  4M75 D;  1JU5 C;  2SRC A;  5GAO p;  1KQ1 A;  2Y4Y A;  2XID A;  1OX8 A;  4DEX A;  4FU6 A;  2D0N A;  3N5B B;  3R6O A;  2E1H A;  2FG0 A;  1YFN A;  3A5Z B;  3CCL A;  2F2V A;  2CP7 A;  1KK7 A;  3OQ5 A;  3SWN C;  4PJO A;  1UE9 A;  4M7D E;  1WPY A;  5CO7 A;  1VQ9 A;  4M75 B;  2X3X D;  2CP6 A;  5GAO m;  2EGE A;  2V8J A;  2KXC A;  1RAH B;  2RO0 A;  2X4Y A;  2LTO A;  4EMK C;  3V7R A;  3QG1 A;  3O5Z A;  5AYF A;  2QA4 T;  2MK5 A;  2AK5 A;  4FIB A;  4DBR A;  2I0N A;  2V26 A;  1Y96 B;  4M7D C;  4M7A F;  1IRX A;  3WVE B;  1PHT A;  4M78 E;  2KDS A;  2K5I A;  3I56 T;  2GQI A;  3QKJ A;  2O4X B;  3UDC A;  2QQB A;  2E6N A;  1YJN T;  4BI8 B;  4BY6 C;  3H41 A;  2JMA A;  2X4J A;  3SDZ A;  5CQY A;  3REA B;  2P0Q A;  5GAN f;  3G71 T;  4M78 C;  1YJW Q;  3OYM A;  1R0B G;  5GAM e;  3ZEH A;  4ANJ A;  4HT9 A;  4C8Q E;  1A0N B;  2PQW A;  2E70 A;  1D0Z A;  2MI6 A;  3QZ9 B;  2LCC A;  3M4Y A;  1HSQ A;  2E64 A;  1ZSZ B;  1YHQ A;  3LYI A;  5GJV B;  2FL7 A;  1OPK A;  5FRN A;  1Q82 U;  4JPB W;  2X9H A;  4XTW A;  4C8Q C;  1AVZ C;  3MEA A;  2GBQ A;  3TRE A;  2XDD A;  3OYN A;  2EGC A;  2J6F A;  4FSX A;  3D7S B;  3V7S A;  1M1K U;  2KY9 A;  1T0J A;  4NL3 A;  5GAN 8;  1XTD A;  3I5S A;  3VS6 A;  4AFS C;  9ATC B;  4J83 A;  1ZA1 B;  2K9G A;  3CCU A;  4LN2 A;  2MWO A;  4ZGD B;  1VQ7 A;  3JAM E;  3CCM T;  1K73 U;  1D1B A;  4OMQ A;  3E9G A;  4MML A;  1QCN A;  3FJ5 A;  1J3T A;  4LXC A;  2MMP A;  3C94 A;  5HK0 A;  3VKI A;  3CCL T;  1I5O B;  4ZTJ A;  2MOX A;  3OYJ A;  4M7D A;  1VQO A;  4M7A D;  1LNX A;  2OI3 A;  5CQX A;  2F2W A;  1U1S A;  5A0G A;  1VQ9 T;  5KYX B;  1T0H A;  1VQL Q;  1ACM B;  1SF9 A;  4QT7 A;  4IUV A;  3MP8 A;  3VRY A;  1RI9 A;  4NS5 A;  3SHW A;  1VQN Q;  4AFQ C;  2EW3 A;  1JO8 A;  4O6J A;  1QQJ A;  1V76 A;  4GLM A;  6AT1 B;  3FC3 A;  1TSF A;  1G3T A;  4J7F A;  2QI2 A;  4QQD A;  1K9M C;  2VB6 A;  5GMK j;  3QXE B;  1V1C A;  4BAC A;  4BUG A;  3UAT A;  2DTI A;  3X24 B;  1BI1 A;  1K4U S;  2HNI A;  4A4E A;  5GAM h;  2BKD N;  3EGD A;  2DL4 A;  2QEX A;  1RAG B;  3CC4 Q;  3TU4 K;  1HXD A;  1Q7Y U;  4WF2 A;  7AT1 B;  1QW1 A;  1YJ9 Q;  4PLL A;  2X51 A;  1NJI C;  3EG1 A;  2KI7 A;  4FCY A;  2WSF E;  5GAN 3;  3ZL7 C;  4ELY C;  4DEY A;  1QCO A;  3M0U A;  2P84 A;  5HY6 A;  5GMK e;  2GFA A;  1JEG A;  1VQK Q;  2G6F X;  3QPH A;  2HCK A;  2O01 E;  2LCS A;  1CKB A;  4JJD A;  3LX7 A;  3CC2 A;  2XHC A;  1IGQ A;  1QP3 A;  2AT1 B;  1PWT A;  3NTI A;  4E2F B;  4AG2 C;  1RL2 A;  2AZS A;  1YIJ Q;  4ZGJ B;  1YHQ T;  1KD1 C;  3UA6 A;  4PLI A;  2R58 A;  3L1A A;  3M59 A;  1OI1 A;  3M0R A;  4F16 A;  2DL8 A;  2OAW A;  1QKX A;  2PVD B;  3CMA A;  2W0Z A; 
#chains in the Genus database with same CATH homology
 1NM7 A;  2IIM A;  4Y92 A;  3VS1 A;  4R0K A;  1BB9 A;  4HVV A;  3VS3 A;  2DF6 A;  2D1X A;  2GGR A;  1UHC A;  1RLP C;  3EG0 A;  3I35 A;  1WXU A;  2B86 A;  1CSK A;  2DE0 X;  4J9G A;  4ESR A;  1AOJ A;  4LUE A;  1SHG A;  1KSW A;  4IIM A;  5FW9 A;  1G83 A;  1UTI A;  5IHK A;  2NWM A;  3R6N A;  4RTX A;  3I5R A;  4OMP A;  5I22 A;  1AEY A;  1CKA A;  1GFC A;  2CH4 W;  4F17 A;  1M8M A;  1MV3 A;  1SEM A;  1ZUK A;  2M0Y A;  3NMZ C;  2DMO A;  1VA7 A;  4JJB A;  5EC7 A;  1Z9Q A;  4KRT A;  1HJD A;  4CC3 A;  1JQQ A;  3SEM A;  1NLO C;  2L3P A;  1X2Q A;  4RTU A;  2YUP A;  3CQT A;  5IXB A;  2D8H A;  2LP5 A;  2J06 A;  4CC7 A;  3EG2 A;  1M3C A;  4J9I A;  1K76 A;  2FPD A;  2VKN A;  5IHN A;  2E5K A;  2KYM A;  1M3B A;  3TVT A;  1T3L A;  1X6G A;  1BBZ A;  3JV3 A;  3REB B;  4A63 B;  2CT4 A;  5IHI A;  1TG0 A;  2KE9 A;  1UEC A;  1AD5 A;  2KRN A;  4AG1 C;  2EPD A;  4OMN A;  1AWX A;  3UF4 A;  2KRM A;  1VYU A;  2J6K A;  2ED0 A;  2KYB A;  2EYY A;  2SEM A;  3PVL A;  3KFV A;  1SSH A;  3M0S A;  1GCQ C;  2RQT A;  1UGV A;  4J9E A;  2O9V A;  2A37 A;  2L3Q A;  4AFU C;  1GFD A;  2DL3 A;  4CC4 B;  2ROL A;  1WXT A;  2NUZ A;  2OJ2 A;  4JZ3 A;  2EKH A;  4X1V A;  2DNU A;  1UDL A;  4E6R A;  2K7A A;  3ULR B;  2RNA A;  2EYW A;  1UJY A;  1AWJ A;  4RTZ A;  5IH2 A;  3EGU A;  3H0H A;  1Y57 A;  1E7O A;  4HCK A;  1XOV A;  3THK A;  2HSP A;  2GNC A;  1I1J A;  2DJQ A;  2EGA A;  2C0O A;  2KEA A;  5L23 A;  2DIL A;  1EFN A;  1MUZ A;  1YP5 A;  2EYZ A;  2YUN A;  1E6G A;  2X3W D;  1NEG A;  4AFZ C;  2VWF A;  4FSS A;  1B07 A;  2JTE A;  2V1R A;  1WYX A;  1QWF A;  2RN8 A;  1IO6 A;  4J9C A;  2EYX A;  2BTT A;  1VYT A;  1KJW A;  1ZUY A;  1OOT A;  1NLP C;  1K0S A;  1H92 A;  2KT8 A;  2LQN A;  2YUQ A;  1PKS A;  1WX6 A;  1MV0 B;  2M51 A;  5IXF A;  2FO0 A;  1GL5 A;  2L3S A;  3VRZ A;  2YUO A;  2LMJ A;  3PVQ A;  2KNB B;  2HBW A;  2CSQ A;  1GCP A;  1AWW A;  1W70 A;  1W6X A;  1WI7 A;  2VVK A;  1W1F A;  1QCF A;  2YT6 A;  3VS0 A;  2J05 A;  1QLY A;  3UA7 A;  1T3S A;  4ORZ A;  1JXO A;  1ZLM A;  2V1Q A;  1I07 A;  2C0T A;  2LJ3 A;  1N5Z A;  1NYF A;  2GTO A;  2RQV A;  3GBQ A;  1SRL A;  3NGP A;  3QWY A;  3M0T A;  3M0Q A;  4K11 A;  1TUD A;  1OEB A;  2O88 A;  2KRO A;  4J9H A;  2K79 A;  2RQW A;  3RBB B;  2ABL A;  4D8D A;  1JU5 C;  2SRC A;  2LZ6 B;  2MCN A;  4F14 A;  3I9Q A;  2BZY A;  4LNP A;  2CUD A;  2K6D A;  4DEX A;  3H0F A;  1FYN A;  2D0N A;  3PE0 A;  2AKK A;  4ZNX A;  2DL7 A;  1YNZ A;  2FG0 A;  3VS2 A;  2F2V A;  2CT3 A;  2QDL A;  4RTV A;  2J7I A;  1UE9 A;  2RPN A;  2HDA A;  1GCQ A;  4D8K A;  2X3X D;  2ROT A;  4J9F A;  2EGE A;  1UUE A;  2KXC A;  1X27 A;  1QKW A;  1RLQ C;  2D8J A;  3TSW A;  3O5Z A;  3EHR A;  2P4R A;  2AK5 A;  4JJC A;  1WA7 A;  1TUC A;  2JMC A;  2JW4 A;  2I0N A;  1U5S A;  1NYG A;  2KR3 A;  1ARK A;  2DRK A;  3IQL A;  2CUB A;  2PTK A;  4JZ4 A;  3RNJ A;  2DBM A;  1OV3 A;  1UHF A;  1PHT A;  1UFF A;  2K2M A;  1BK2 A;  1Y0M A;  1K1Z A;  1SPK A;  2GQI A;  2O2O A;  2DVJ A;  2F2X A;  2KXD A;  2JMA A;  2ED1 A;  3H41 A;  4OML A;  1PKT A;  1WDX A;  3A98 A;  4HXJ A;  2RQR A;  3REA B;  1K0X A;  1PRM C;  4RUG A;  3EG3 A;  1SHF A;  4LUD A;  4RTY A;  1H8K A;  2BZX A;  1FMK A;  1HD3 A;  4GBQ A;  1A0N B;  3C0C A;  1ABQ A;  1KFZ A;  2KBT A;  3VS4 A;  2JT4 A;  2DRM A;  4J9B A;  1HSQ A;  2O31 A;  1LCK A;  1SRM A;  4OMM A;  3NHN A;  5GJV B;  1M27 C;  2RMO A;  1NG2 A;  4Z8A A;  1PRL C;  1OPK A;  2YDL A;  2C0I A;  1X2K A;  4LE9 A;  1PNJ A;  2YSQ A;  2MIO A;  4JPB W;  4RTW A;  1AVZ C;  2GTJ A;  3LH5 A;  2CSI A;  2J6O A;  1X6B A;  2GBQ A;  1GBQ A;  2FRW A;  2ENM A;  4J9D A;  2ESW A;  1GBR A;  4Z89 A;  2EGC A;  5FWB A;  1I0C A;  2J6F A;  4Z88 A;  1YWP A;  2DLP A;  2A28 A;  2DX1 A;  2FEI A;  1T0J A;  1U3O A;  3TSZ A;  2LX7 A;  3I5S A;  3VS6 A;  4AFS C;  4M4Z A;  2A36 A;  2DM1 A;  2CDT A;  2K9G A;  2L2P A;  2PNI A;  4LN2 A;  1AZE A;  2XMF A;  1M30 A;  1WFW A;  1ZBJ A;  2PZ1 A;  5I11 A;  2EBP A;  1NEB A;  4OMQ A;  4OMO A;  2DBK A;  1WLP B;  3FJ5 A;  5HCK A;  1J3T A;  1U06 A;  2EVR A;  4HVU A;  1S1N A;  1M3A A;  1UJ0 A;  3EHQ A;  1WXB A;  2RQU A;  2HEQ A;  2DL5 A;  1RUW A;  1VYV A;  2MOX A;  2W10 A;  2A08 A;  2L0A A;  2LQW A;  2OI3 A;  1BU1 A;  2F2W A;  2ECZ A;  1ZSG A;  1T0H A;  2KGT A;  1AZG B;  1YCS B;  4QT7 A;  3VRY A;  2KRS A;  1K9A A;  1RI9 A;  3SHW A;  2K3B A;  4AFQ C;  2EW3 A;  1JO8 A;  4GLM A;  4RTT A;  2FPE A;  2AKL A;  4HVW A;  1V1C A;  2LJ1 A;  1QWE A;  1X43 A;  2FPF A;  3UAT A;  1ABO A;  2LJ0 A;  1K4U S;  2JS0 A;  3NPF A;  3M0P A;  2DL4 A;  2O9S A;  1AWO A;  1ZUU A;  2BZ8 A;  2AZV A;  4EIK A;  2KT1 A;  2CRE A;  2LNH B;  3QWX X;  1X69 A;  1JXM A;  3EG1 A;  1ZX6 A;  1WIE A;  4CC2 A;  1H3H A;  1Z9Z A;  1YWO A;  3ZL7 C;  1E6H A;  4DEY A;  3M0U A;  3U23 A;  2DA9 A;  2JM9 A;  1JEG A;  2FRY A;  4IIO A;  1UG1 A;  1GRI A;  2H8H A;  2CH4 A;  1B3Q A;  2G6F X;  5GJW B;  2HCK A;  3VS7 A;  2LCS A;  1CKB A;  4JJD A;  1YN8 A;  3VS5 A;  1OPL A;  3H0I A;  1PWT A;  2DYB A;  2EQI A;  4AG2 C;  5FWC A;  1KIK A;  2AZS A;  2JXB A;  2RF0 A;  3UA6 A;  2JS2 A;  4F16 A;  3M0R A;  2DL8 A;  2OAW A;  1QKX A;  2JM8 A;  4WCI A;  2W0Z A;  1G2B A;  5ECA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...