1R8OB

Crystal structure of an unusual kunitz-type trypsin inhibitor from copaifera langsdorffii seeds
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
71
structure length
71
Chain Sequence
WKLPSVTVGNPKVSVFGGPFKIEEGKSGYKDVYSSSKGRDLDDGIEVNKKKEKRLVVKDGNPFIIRFKKSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Kunitz trypsin inhibitor
publication title Three-dimensional structure of an unusual Kunitz (STI) type trypsin inhibitor from Copaifera langsdorffii.
pubmed doi rcsb
total genus 9
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2003-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.480 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1r8oB01
1R8OB
chains in the Genus database with same CATH superfamily
2QTVA 4OMQA 4C5GA 2K7AA 2E12A 4EPCA 1R77A 1EIFA 4QQDA 4J9DA 3OYGA 1ZX6A 1FMVA 2KQWA 1D1AA 2MYSA 1VQLA 2GFAA 4M7DF 3G71T 1KHIA 4LD9K 3CD6A 4DEYA 3CXCA 2M0OA 2RI3A 1N8RC 4CI0C 2JUFA 4C92D 1VQ8A 2KRMA 4GBQA 2EKOA 1C0MA 3SFMA 1M2OA 5CKEA 1YIJA 4JRIA 1PSFA 1X43A 4J9EA 4ZN1A 4RTYA 2L3PA 4Y92A 2DKGA 3MHXA 1BU1A 2FO0A 3OYNA 1ZUUA 1NLOC 3ZFJA 4BY6C 3CCMT 1JRIA 2KR3A 4EDUA 1PRMC 3F70A 3CCJT 1I1JA 3N5BB 2LTOA 5GAOl 1VIEA 1YJ9A 1T0HA 1VQOA 1QP2A 2CH4A 3JCMJ 5ECAA 4EMKC 8ATCB 3PFSA 1V29B 2E5QA 2BZYA 3G4ST 3CCET 5LJ5e 2K3BA 1K9MU 1FWZA 2HKNA 5EG2A 2GQVA 4EMKB 1CKAA 1KD1C 4XTZA 1FMWA 1WJSA 3KBGA 4LDWA 4FYWB 4M75G 4RG2A 1PG5B 1VQ4Q 2LX7A 3A1PA 5GAN6 2JS0A 4DBRA 3H6ZA 2RD1A 2W10A 2WSFE 5DY9A 4A4EA 4A53A 3UA6A 1WXUA 5DLOA 1TOVA 2A08A 2DM1A 4PJOG 2WACA 2B8AA 4E7ZA 4QVCA 1XJWB 1D09B 2C0TA 3QWXX 1C6VX 3PGGA 3H0HA 1ABQA 1VQNT 4M7DG 1FXXA 1O75A 2IPOB 3CCQQ 1D1CA 4KULA 1YI2A 1NM7A 1LOJA 2RA2A 1Q86U 2KRSA 1SPKA 3KUFA 1D1BA 4EIKA 3CPFA 3SWNC 3CCRA 4OMNA 2QA4A 3UATA 2CS7A 1LNXA 2LJ1A 4OMLA 1XNIA 2XDBA 4HVVA 2DEUA 2RPNA 1G3YA 3PE0A 2HZYA 2RNAA 3VS3A 1BB9A 2L3RA 3H0FA 4ZGEB 4Z89A 1VQKT 1U5SA 2G3RA 3SDZA 3JB9H 1PC0A 4LUEA 1DJ7B 2F5TX 1UHFA 3I55T 4PJMA 3MO8A 4X9DA 3FEOA 4FYVB 3EHQA 4KH0B 2VV5A 4PLIA 3QDRB 1QVFS 4FT2A 3FRNA 2D8JA 3GIBA 2XIDA 2HDAA 5KYYA 3CMAA 2JN0A 3REAB 3CC7Q 4KUDK 2BIVA 2AIRB 2LRQA 1Q7YC 2RI5A 2MK5A 2RO0A 3RDVA 2QQ9A 4OMPA 3C4SA 2COWA 2DXUA 3PVQA 2HKQB 2YLCA 1WFWA 1Q82R 2H3EB 4CC2A 4ZTFA 2J05A 2V8KA 1M27C 1WXTA 3EH2A 1M3CA 4C92F 3VRYA 1KJWA 3C95A 2EJFA 3A8LB 2DIQA 1S72A 3CC4Q 1M90R 1WLPB 4M78E 1ZBXA 1R8OB 3OS1A 2MPXC 4FSSA 3CCLA 1VQPQ 2RHZA 3G6ET 4E7HA 1WHJA 3MJXA 3OYYA 4QVZA 4DBFA 1KQSA 3JCMP 3BE3A 1VQ6Q 1JBMA 2HNIA 1ZLMA 3FJ5A 2H8HA 2QQBA 1I8FA 3I5RA 4M78D 5A0GA 2QASA 2EWNA 4M78C 5FU6C 1GBRA 3VV0A 2BZXA 3QHSA 4HCBA 3J7AF 2CT3A 1WZOA 2ROLA 2LT4A 1QCNA 1AHJB 3EG9A 2CZ0B 2VGMA 1YIJQ 5GAMg 1MUZA 4Z02A 4E2FB 1TS9A 4M78B 5FU6B 2HQXA 2M0YA 4F7UA 3S3MA 2QEXA 2K5LA 2P4TA 1E7OA 4V2SA 2H3JA 1NLPC 1N8RR 4C8QE 3O5ZA 5D6YA 2KAFA 1Y71A 3CC7T 1IREB 5CKBA 2FB7A 1MV0B 2O4XA 4GY5A 1UGQB 2JM8A 2I0NA 1WGSA 4JDSA 4PJOE 4AFUC 1VQOQ 2CZ7B 4PK4A 1SHFA 1ZA2B 2M02A 2Y4XA 1I5OB 2YUPA 3S3OA 4IUPA 3THKA 3OW2A 3RKWA 2KNBB 1BCMA 2ZPFB 4C8QD 1J3TA 3Q1JA 1R0BG 2RHYA 3GF5A 3EFOB 3PMTA 3C0CA 1YHQT 3TVTA 2XKOC 4R0KA 4PJOC 1BCOA 2EYZA 4BDZA 1BI1A 1NYFA 2OTLA 1OEBA 1OX8A 1VQLT 1ZUYA 4PJOB 5GANg 5GANj 1TXQA 5FRNA 3VS6A 1KD1R 1UGVA 4JJNK 1NJIU 3CD6T 2BE7D 2YWWA 3MEUA 4XU2A 3HSBA 1BBZA 4MMKA 4M7AE 1RL2A 2E10A 1VQ8T 2JXBA 4J9BA 2PUOB 3JB9J 3P8DA 1KSWA 5FU7C 1QW1A 8AT1B 3JCMV 4C0GA 3PMIA 2DLPA 4J5YA 2HQHA 4CRIA 4KBMB 3ASKA 2JW4A 2KMTA 1Y7XA 1T0JA 1ZBJA 5FU7B 1M1GA 3CCRQ 2F2VA 1TUGB 3VKIA 4MMLA 2QA4Q 4AMCA 4M7AC 4F7UF 1BI3A 1QVPA 1VUBA 3JCMW 1C1AA 3M58A 3OYFA 3EHRA 1XQHA 1JQQA 5IHKA 2SEMA 5CQXA 2LNVA 1X6BA 1YJ9T 3C94A 3KXTA 2XU8A 4M7AB 1VQOT 4Q5WA 1ZHIA 2EYWA 2CP2A 3RR6A 3VS2A 2IIMA 1WYXA 3I35A 3CCUA 1GRIA 1YWOA 1SEMA 4PKCC 2CP7A 2ZZDA 1FYNA 1VQ5A 4A4HA 1G3SA 5GAMe 2KT8A 1IB8A 2RM4A 1FX7A 3EFSA 1D0YA 4LDVA 4M7DA 2E5KA 1M1FA 2CZ6B 2JTEA 1YWPA 3E19A 5KYXA 2XI9A 1K8AC 1ACMB 4J9IA 4IUTA 5CQYA 1I0CA 2DYIA 4E7LA 4N0AA 4JUVA 2JTFA 1M2VA 3FIFA 3E9FA 3MCAB 4ZGDB 1KIKA 4A4GA 1PHTA 5GMKj 4JRPA 2AKLA 3QZ9B 2DAQA 3WVEB 1QKWA 2L2PA 5LJ3h 3QJYA 2O31A 2ZAEA 4AG1C 3CMAQ 3PTAA 2O9VA 3CCVA 4J7FA 3ME9A 1PD0A 1GXIE 1JO8A 1TTHB 2K2MA 3PVLA 3T9NA 4PFZA 2K4YA 3L2WA 1G5VA 3LH0A 2VXFA 3OMGA 5KYUA 3M57A 5J26A 1K9AA 1TH7A 1YI2T 4M78F 2YLBA 2L8DA 3SB2A 1Q95G 3EGDB 1S72Q 2KSSA 1Q7YR 3CCMQ 3JB9G 3L1AA 3L2RA 3EAEA 3CCJQ 2QA4T 4E6RA 2EQMA 1KG1A 3LWIA 3CCLQ 5HK0A 2WSCE 2F2WA 4ATOA 3G1JA 1XOVA 2QDYB 1LPLA 3CXCS 1VYUA 2DRMA 2NWMA 3G7ZA 2D1XA 5CO7A 2CH4W 3PIPA 3CPWA 2HL3A 5GANe 4DBHA 1ZSZA 2QK0A 4F7UG 1YCSB 2XICA 3G4SQ 3CCEQ 1K1ZA 4FCYA 1WA7A 5FROA 4JJDA 3OYMA 3OS0A 1EZZB 1VQ7A 3LLRA 4RTXA 4AFSC 4F17A 3TSWA 3META 2EAYA 1RI9A 3HPWA 2C0IA 4JRQA 3ZEHA 3MKDA 2W0ZA 4C8QF 1GFCA 2EYQA 5A0LA 2PNIA 3ZBDA 3OA6A 4BE0A 2DVJA 1WQ7A 2A0FB 1K9MC 4HXJA 4M4ZA 3TU4K 2BUDA 2FG0A 2DILA 1RUWA 1SHGA 3LH5A 3I56A 2DBKA 3CMAT 1KQSP 1VQNQ 5KCOA 1WQWA 2RK1A 3LW5E 4DBQA 1OV3A 4O5VA 3REBB 1Q82U 3VUBA 4XTUA 2LDMA 3OQ5A 4YTLA 2VVKA 1PSEA 1OQKA 3O8VA 4GLMA 4OB1B 4RUGA 2IVWA 1VIFA 4MDWA 1GBQA 4AG2C 4HA8A 2V26A 5M9OA 5HY6A 2OAUA 4FSXA 3URGA 2LCLA 5IHNA 2AK5A 2HAXA 2EGAA 1M90U 1ARKA 4C0ZA 1AWWA 2MWPA 1S72T 2CZ1B 2YSQA 2LQKA 1YN8A 4IKFA 1ZUKA 3DLMA 4J7IA 2FHDA 3VUZA 4J8OA 1AWXA 3SHWA 4F14A 2V1RA 4DQ2A 3OS2A 2KYMA 3CCLT 4XTYA 3JRZA 1SRLA 1Q86C 4BI4A 1D3BA 1OZ2A 5GMKe 3EGXB 1NZ9A 2YXYA 4M77E 2NUPA 5GAN4 3M54A 2RF0A 1VQKQ 4RMOA 2DETA 3DLLA 5KYNA 3LGFA 2QGGA 2QQAA 5LJ3f 2JM9A 1BYMA 2DTIA 4P5NA 3I55Q 2EPDA 5I21A 2COYA 1M1KR 3S3NA 3OW2P 4JS4A 2RK2A 2DZ9A 2LC4A 3FDRA 5IH2A 3CBPA 1UE9A 4LUDA 4M77C 1S1NA 3CCSA 1KQ2A 5AT1B 3GOXA 1KK7A 3JCMh 1KC8U 2QEXT 1OPLA 4M77B 3QO3A 1MNDA 2ZGWA 1SG5A 3M0PA 5FRMA 2PZ1A 1RADB 2RJFA 4C92A 1QQJA 4O6JA 1WHMA 3NHNA 3TSZA 2LQNA 3M0UA 4RTUA 3LWHA 2K57A 2PQWA 1AWJA 1H92A 2LCCA 4RTVA 3VYGA 3OBWA 3P8HA 3S6WA 2DA9A 5EC7A 5GAOp 4FW1A 4BB7A 3NGPA 1E6GA 5LJ3g 5LJ3j 1HXDA 2M9UA 1QWFA 1K0SA 3JCMd 3OYEA 1HYOA 2KT1A 4OVAA 1GFDA 3G6EQ 3D7SB 4GLKA 4NL3A 2DK3A 1W2BP 2X3WD 1JXMA 4X9CA 2JOYA 4EMKA 3GNGA 1FMKA 2JT4A 3EH1A 2K2VA 2OTLT 2CREA 2NUTA 3GP8A 2RJCA 1EX4A 1UJ0A 4ME7A 4XTVA 4JS5A 4LE9A 3QIIA 4LD6A 2KBTA 3P8BB 3LGLA 3SEMA 3CBMA 2RQVA 4LNPA 3VJPA 1AD5A 3TREA 3OYHA 2MI6A 4J9CA 2QGFB 3L2UA 2LCSA 2DZCA 3A5ZB 4Z88A 1WXBA 1JJ2P 3A98A 2G6FX 3M9QA 2V1QA 2FVUA 4A63B 4LDXA 2E41A 4PJLA 1V1CA 1KQSS 3JCMQ 3CC2T 2GFUA 3MPUB 4L6V5 2DD5A 4MZMA 5DLQE 2K5IA 4XTXA 2RB6A 4DOWA 2AHJB 2R58A 1Q81U 2K5FA 2HL5C 1TUDA 1T3SA 2CUBA 3J81E 1YJNA 4D6WA 1KHCA 2K9GA 4E7JA 3RUXA 3BW1A 4FYXB 4KGVB 3JV3A 3HRSA 4BD3A 1K73C 3CCUT 1YHQQ 1UEBA 5FWCA 3SWNA 2A36A 1VQ7Q 1P92A 2YUNA 1QVGA 2X4WA 1OYXA 2L3SA 2ZPGB 4EMGA 1VQ5T 1VYVA 5IAYA 1BI0A 2QQRA 2ESWA 5IN1A 3AHUA 2CP6A 4OP0A 2DRKA 3RMQA 1Y07A 1NBEB 4R55A 1VQLQ 4BI8B 2XD0A 4OF1A 5LJ5h 4JJBA 1SSHA 3UWNA 3CD6Q 2XMFA 1H3ZA 2DYBA 3I56Q 3CPWP 1Z9QA 5GAOq 2HCKA 2GNCA 3CCVT 1VQ8Q 2BE9B 3EG1A 2LJ3A 1UGPB 4J6WA 4QW2A 2KEAA 4OGCA 2CGHA 2NYSA 3VS7A 1M9SA 3RKXA 4LXCA 4XU0A 2ZCFB 2X3XD 2XK0A 3M0RA 4NL2A 2JVVA 1M4ZA 2OX7A 4XAXB 1K9MR 3FJPA 5LJ3e 2I2LA 1WHHA 2A28A 4ZGJB 5GJWB 1NJIC 4M75E 4HT9A 2AKKA 1Y96B 3X26B 5LJ5d 2DNUA 1B7TA 5CIUA 4FU6A 4ELYC 4HVUA 2M51A 1ABOA 2MF2A 2COZA 1IGQA 4RTZA 2NUZA 3VS5A 1YJ9Q 2DJQA 2E6ZA 2IG0A 4A54A 2HEQA 3CQTA 3M5AA 1A0NB 2VB6A 1AT1B 1OULA 2E70A 1N9SA 2HBWA 2DXTA 4JZ3A 4M75D 4M75C 4M7DE 1OOTA 3J80E 9ATCB 2A7YA 4J9GA 2VYTA 1VQ7T 1GCQA 4UC4A 4Y91A 7AT1B 2BTTA 4C92G 1I07A 4PJOD 1GL5A 4M75B 4ELZC 1Q86R 2O9SA 2DIGA 2Y4YA 4D8DA 3M4YA 4LDYA 1WHGA 2O01E 5KE3A 4HCZA 2EFIA 3CCSQ 1VQMA 3NPFA 2EYYA 2GTOA 1M3AA 2XHCA 2FPFA 2PVOB 2VXEA 2EJGA 1W1FA 4M7DC 3QPHA 4OB0B 4HCCA 5IXFA 2QTXA 1K4US 3OY9A 2QXFA 3I56T 4OGEA 3VRZA 1AWOA 5C6SA 4M78A 1M8VA 4X1VA 2LP5A 1NPPA 4F04B 2GQIA 4M7DB 4PNOA 1NYGA 2RHUA 3V8LA 2ROTA 5KYXB 3M0QA 4JLGA 1YI2Q 2VKNA 3MP6A 2DL8A 3RBBB 4C0DC 2DERA 1M2VB 1PWTA 4N4HA 1U3OA 1LJOA 2EIFA 3V7SA 5C0MA 5CR2A 3VU3C 5D7UA 1W2BA 4D8KA 1AVZC 2FEIA 1VQ4A 4M7AD 3CC2A 4L5GA 4C0DB 3FLGA 2CT4A 2RMOA 4C5EA 1HK9A 3QJ6A 2OTJA 1U8RA 2ED0A 2X4XA 4FT4A 5LJ5f 3IQLA 4B6MA 5FW9A 3E2UA 5KH6A 4LDUA 2RQWA 2L89A 5GAOr 1TG0A 1M1KU 3CCQA 4C8QA 4E7IA 3OYCA 5CVIA 3JAME 1QCOA 3X20B 1BKBA 1UG1A 1BIAA 2FZKB 4ZN3A 4XU3A 4ZTJA 2X4JA 5D6WA 1ZSZC 1UGSB 1JJ2A 4II1A 2D6FA 1M5Q1 3ER0A 1UECA 2V8IA 4MZTA 1YNZA 3MP8A 2KY9A 5I2SA 3H8ZA 1T3LA 3CCST 1ZSZB 1RLPC 3C12A 1H3HA 3GBQA 1NPRA 4OMOA 1UHCA 2QYZA 5I22A 2GGRA 2P84A 3OYAA 1PM3A 3M56A 5KYWA 2E6NA 3M0TA 2YHTA 1WJQA 1X6OA 4HKEA 4IIOA 5L8RE 3CMEA 2K3XA 2DXCA 3QDFA 3A8MB 2LZ6B 1X27A 1QWEA 1YFNA 4FL6A 1UUEA 2E64A 1MGQA 2M1HA 2FZCB 3OB9A 4OB2B 2M16A 3EG3A 4B9XA 3H0IA 5GAN3 4Z8AA 3RIRA 1PD1A 2HQEA 3JCMX 2O2OA 4NS5A 2EGEA 4M7AA 3QSUA 5A2QE 1RAHB 5A0DA 5CK9A 3A8GB 2ENMA 4DEXA 4JJCA 4QQ6A 2LJ0A 1K73R 5GAN7 1RAEB 1QCFA 1X6GA 4JRKA 4R56A 1HJDA 2F1LA 3L42A 4BE1A 4HVWA 4M75F 5CKDA 1B34A 1RAGB 3OYIA 3CC4A 3OSVA 2AT1B 1QVGP 1D3BB 1X69A 4AT1B 2YRVA 1WX6A 2NUPB 3OYDA 1YP5A 3V7CA 1NEBA 3QXEB 2QEXQ 1IRXA 1KQ1A 4PJOF 3NTKA 3UT1A 3I5SA 1VQPA 3QG1A 2DVEA 1IHVA 2QI2A 4FIBA 2VGNA 3H41A 3OYBA 1QVFP 1M8MA 3QKJA 4N4IA 2R57A 4A4FA 2RQUA 2BZ8A 3UPUA 2VWFA 1VQ6A 4KGZB 2C0OA 2VC8A 2OAWA 3EGDA 1WHLA 2EQKA 2AZSA 4JZ4A 1YJWA 1TU0B 2D0NA 5AYFA 4B9WA 2AZVA 2FL7A 3M53A 4CC3A 1NJIR 1KC8C 3CEYA 1YJNT 3UDCA 4C92C 1RAFB 3H9NA 2CUDA 4IUUA 2LVMA 2Z0WA 2FRYA 2J06A 1IO6A 4M78G 1X01A 2JMCA 4BI3A 2D8HA 2QG9B 2EQUA 4RCBA 5GMKi 4C92B 2JJ9A 3UA7A 4XTWA 1UB4A 2RJEA 1AZGB 3EGUA 5CCAA 4BACA 2PU9B 3HHTB 2YRCA 1RLQC 2OI3A 2E3HA 1RABB 2F5KA 4MZPA 2LX9A 4M7AF 1VQMQ 2OTLQ 1UTIA 2EYXA 2JNGA 2J7IA 2F2XA 1G3TA 2EVRA 2ZPBB 1M30A 4J9HA 5GAMh 2HMAA 4N4GA 1PKTA 2K3YA 4BY6B 3JB9I 1NE8A 2DBMA 1WNLA 1YCYA 1N5ZA 3HKSA 1I5LA 1VOMA 1ZQ1A 4M77D 2ATCB 2R5AA 2K6DA 1MMDA 2J6OA 2VUBA 1YBYA 4J83A 5DM7R 5J39A 1VYTA 3QUIA 5IT9E 2MIOA 2YUOA 1N8RU 3HP9A 4C5HA 4PJNA 4ANJA 2NUTB 2RQRA 2WSEE 4RKUE 4C8QG 2E4HA 2MOXA 1PKSA 4PFOA 3CC2Q 3L2QA 2CDTA 5GAMd 1H641 1B3QA 2DE0X 2P0QA 5D6XA 3FB9A 2OTJQ 2CYZB 2CP5A 2DL4A 4OMFB 3PNWC 3QBYA 4KH1B 3EFRA 3CCUQ 1UFFA 5KYYB 3X25B 2YT6A 4AFZC 5KCHA 1RAAB 2KI7A 3M55A 3EGXA 1VQ5Q 1U1SA 1CSKA 1Q81C 1E6HA 3TCJA 4KT0E 2LMJA 2DX1A 3HRTA 1EFNA 3V7RA 1JB0E 4CC7A 2DXBA 5GANh 3HTRA 2JMAA 3GLXA 1YITA 1AOJA 2YUQA 1RI0A 3HL8A 1VQMT 1VQ9A 1D0XA 3NFCA 3NMZC 1KD1U 4WTOB 1G3WA 4C5IA 2RHIA 3SWNB 3CCVQ 1X75C 3JCMb 2XDDA 2PTKA 1HD3A 4M7AG 4RCCA 4WCIA 5L23A 2HSEB 1K8AR 4F7UE 1W4SA 1W6XA 3CMEQ 1QLYA 3JB9D 3DKMA 2LQWA 3OYLA 1QVGS 4M77A 3PIOA 2DFUA 2ABLA 4IUQA 4BDYA 2D9TA 5GANd 1K76A 5GJVB 1PRLC 5I2MA 3MEVA 2QAZA 2L5QA 1SSFA 1ZA1B 1UDLA 2K79A 2KK4A 2JTMA 2D0QB 4TVRA 1VQ4T 1RAIB 2EBPA 3G71A 1OU9A 4ZNXA 1IHWA 3EG9B 3OMCA 2HSPA 2KGTA 2MCNA 5KE2A 3VS0A 1MMNA 1HSQA 2Y90A 2OTJT 1I81A 3E1SA 2PVDB 2E1HA 3X28B 4F7UB 2PUKB 2O88A 4KGXB 5GAMf 2VASA 1N6AA 1OX9A 2HBPA 3CCQT 2E65A 1BI2A 2DL3A 1R0CB 2KDSA 4QKUA 2O4XB 3OYKA 5GMKh 2CSIA 1SF9A 2DL7A 3OYJA 2CSQA 2X35A 3VS1A 3RNJA 3CCMA 5FWBA 2R5MA 1QVFA 4E7SA 3JCMf 4E7KA 1GCQC 1N27A 3CCJA 3L2ZA 4QT7A 3QWYA 2J6FA 3X24B 4J6YA 2XDPA 3WVDB 1OPKA 2GTJA 1TSFA 2CP3A 1AEYA 4IIMA 4KRTA 3OW2S 1QMCA 2RI2A 2MMPA 4PFPA 4PLLA 3FC3A 3G4SA 3CCEA 2A3LA 1QKXA 2EQJA 5GAN8 1SKUB 4C0FA 3CMET 3BFMA 1YJWQ 1UGRB 3A8OB 3CBOA 2LQ8A 4F16A 2DL5A 1Q7YU 1RACB 1Z9ZA 2DF6A 3HFNA 5IHIA 6AT1B 5CAIA 5I11A 2GBQA 4M77F 2KE9A 5GAMj 3VS4A 2QDLA 3KFVA 2HD0A 2DEQA 2FPEA 2EKHA 2J6KA 4Y28E 2X9HA 2NLUA 5GANf 1OZ3A 5HKCA 2XG8D 1KC8R 4E47A 1K73U 1VQNA 1PNJA 2GCXA 4X34A 1GCPA 4XQ3A 5HK3A 1LCKA 3JCMg 1ZSGA 3LYIA 5GMKm 3CXCP 4XU1A 3QYGB 3OS5A 1KFZA 4QVDA 2KXCA 5GAN5 3R6NA 4KUIA 1W2BS 4ORZA 1OU8A 1OI1A 2DD4A 4DOVA 4C8QC 3QYHB 2FYKA 2PVGB 2YRDA 3LX7A 3U23A 3CC4T 2QQSA 2CKKA 1JEGA 4M7DD 4L59A 3RKYA 1M1KC 3UF4A 3NTIA 1U1TA 2ECZA 4WF2A 4VUBA 2FRWA 5CKFA 5IXBA 3AT1B 1VQPT 4C8QB 3L2VA 3E9GA 4N0AC 1MHNA 1VQKA 1QP3A 4QQGA 1X2KA 3RERA 4JLIA 1VQ6T 2E3IA 3OBYA 1I4K1 1LVKA 5GAN2 1WPYA 3RMSA 4PJJA 3I55A 1Y96A 4IUVA 1WI7A 3BDLA 1YJWT 1G2BA 4CC4B 4K11A 5LL6S 1JJ2S 3VYHB 4HT8A 2F69A 2LT1A 4HCKA 4OB3B 4IURA 2P0PA 3JB9F 2RN8A 1YIJT 4LN2A 2V8JA 3OSSC 1F1BB 5KYWB 1V76A 1K0XA 1IZ6A 2FZGB 3M0SA 1O9SA 4FYYB 4XK8E 2ZPEB 3MEAA 1NEGA 4RTWA 2ZPHB 2RHXA 4M77G 5KYUB 3EFOA 2EQIA 1NG2A 1D0ZA 2X51A 1PCXA 1YITQ 1XTDA 2KYBA 3V8JA 3EG2A 2EJ9A 3I9QA 2FPDA 2DTOA 1N9RA 1VQ9Q 2RQTA 4PL6A 1TWBA 2A37A 4M75A 2LNHB 2SRCA 1JXOA 1Q81R 1AZEA 2L0AA 1H8KA 4PJOA 2YDLA 1G8XA 5CKHA 3HFOA 2CP0A 4J6XA 1IXDA 1MMAA 2MWOA 5GAOm 3RESA 3MP1A 1BK2A 2EW3A 3JCMc 2P4RA 3G6EA 3WXMB 1TUCA 2L3QA 4J9FA 5FLXE 3JSCA 3HRUA 3CPWS 2KRNA 3A8HB 3G71Q 4FW2A 4DA4A 1MNEA 3NTHA 1MV3A 2BKDN 3R6OA 3SD4A 4FM4B 5GAOn 1B34B 4RG8A 3JCMe 4A4KA 2KROA 1WHKA 4BUGA 1YJNQ 4RTTA 3GPLA 1U06A 4NOYA 1WIEA 2GF7A 5LJ5g 5LJ5j 2B86A 2KVQG 1JU5C 2EGCA 5J3BA 2DPPB 2JS2A 4AFQC 3BY7A 2X4YA 3M4GA 4MDXA 1Q82C 5GMKl 4ESRA 2JZ2A 4OMMA 3V8KA 1CKBA 2DJZA 2MAMA 3ZL7C 2P0KA 1M3BA 3CC7A 2RJDA 4JPBW 1M90C 1YITT 3CCRT 1Y0MA 1B07A 2RH2A 5LJ3d 3PT9A 4BE2A 1VQ9T 3M59A 3INZA 3TEEA 3ULRB 3MEWA 2DMOA 2DTHA 2KXDA 1VA7A 1Y57A 1K8AU 3QZ5B 2C06A 2DO3A 3BDUA 1UJYA 3TQ7P 3DB3A 1SRMA 2ED1A 1G83A 5HCKA 1YHQA 1MMGA 2ZPIB 4EMHA 3EG0A 1WJRA 1IGUA 1X2QA 3DB4A 1W70A 2OJ2A 1BIBA 4C92E 1WDXA 3GNFB
chains in the Genus database with same CATH topology
4QW2A 1UGPB 3M58A 4J6WA 4OGCA 3OYFA 2CGHA 1XQHA 1U1SA 1M9SA 3RKXA 4C5GA 2E12A 4EPCA 5CQXA 2LNVA 4XU0A 1Q81C 1EIFA 4QQDA 3OYGA 2ZCFB 3TCJA 4KT0E 1YJ9T 3C94A 3KXTA 2XK0A 2KQWA 1VQLA 4NL2A 4M7DF 2GFAA 2XU8A 4M7AB 3G71T 1KHIA 3HRTA 1VQOT 4Q5WA 1ZHIA 1JB0E 3V7RA 2DXBA 2JVVA 5GANh 1M4ZA 4LD9K 4XAXB 3CD6A 3FJPA 5LJ3e 2I2LA 3GLXA 3CCUA 1YITA 1RI0A 3HL8A 3CXCA 4ZGJB 2M0OA 4PKCC 1VQMT 2RI3A 1NJIC 1N8RC 1VQ9A 4M75E 3NFCA 4CI0C 2JUFA 4HT9A 1KD1U 4C92D 1VQ8A 1Y96B 2ZZDA 3X26B 2EKOA 5LJ5d 1VQ5A 4A4HA 1G3SA 5CIUA 5GAMe 4FU6A 1G3WA 2RM4A 3EFSA 1FX7A 4LDVA 2RHIA 3SFMA 3SWNB 4C5IA 1X75C 4M7DA 2MF2A 3JCMb 1M1FA 2CZ6B 5CKEA 2XDDA 1YIJA 4M7AG 4JRIA 1PSFA 3E19A 2XI9A 4RCCA 1K8AC 4IUTA 5CQYA 4F7UE 4ZN1A 2E6ZA 4E7LA 2IG0A 4N0AA 4A54A 1W4SA 4JUVA 2JTFA 3M5AA 3FIFA 3E9FA 3MCAB 4ZGDB 3JB9D 3DKMA 2DKGA 2E70A 3MHXA 3OYLA 4A4GA 1N9SA 4M77A 5GMKj 3OYNA 2DXTA 3QZ9B 2DAQA 3WVEB 3PIOA 4JRPA 4IUQA 4M75D 4BDYA 5LJ3h 2D9TA 3QJYA 5GANd 3ZFJA 4M75C 4M7DE 4BY6C 3PTAA 3CCMT 3J80E 1JRIA 5I2MA 3CCVA 4J7FA 3ME9A 3MEVA 1GXIE 4EDUA 2A7YA 3OW2A 2L5QA 3F70A 3CCJT 3T9NA 1SSFA 2LTOA 3N5BB 2VYTA 1VQ7T 5GAOl 4UC4A 2KK4A 1VIEA 2JTMA 4Y91A 2K4YA 2D0QB 4TVRA 4C92G 3L2WA 1VQ4T 1YJ9A 4PJOD 1VQOA 3G71A 1G5VA 1QP2A 3LH0A 4M75B 4ELZC 3JCMJ 4ELYC 2DIGA 2VXFA 2Y4YA 3OMGA 4EMKC 3M4YA 3M57A 4LDYA 5J26A 2O01E 1TH7A 4HCZA 5KE3A 3PFSA 4M78F 1V29B 1YI2T 3OMCA 2E5QA 2EFIA 2YLBA 1VQMA 2L8DA 5KE2A 3SB2A 3G4ST 3CCET 2XHCA 2Y90A 5LJ5e 2OTJT 1I81A 1K9MU 3E1SA 2PVOB 2VXEA 2EJGA 1FWZA 2PVDB 2KSSA 5EG2A 2GQVA 4M7DC 2E1HA 3QPHA 4OB0B 3X28B 4EMKB 1KD1C 4F7UB 4XTZA 4HCCA 3JB9G 2PUKB 1WJSA 3KBGA 4LDWA 2QTXA 3L1AA 5GAMf 3OY9A 3L2RA 2QXFA 3EAEA 4M75G 2QA4T 4RG2A 1N6AA 3I56T 2EQMA 4OGEA 1KG1A 3LWIA 2HBPA 5C6SA 5HK0A 2E65A 4M78A 3CCQT 2WSCE 1M8VA 5GAN6 1NPPA 1BI2A 4ATOA 1M90C 4M7DB 1XOVA 2QDYB 3H6ZA 3CXCS 4PNOA 2KDSA 2RD1A 5DY9A 2WSFE 2RHUA 2O4XB 4A4EA 4A53A 3V8LA 3OYKA 3G7ZA 5GMKh 5DLOA 5CO7A 3PIPA 4JLGA 3CPWA 5GANe 4PJOG 3OYJA 2WACA 3MP6A 2X35A 4F7UG 2XICA 2B8AA 4C0DC 4QVCA 3CCMA 2R5MA 4N4HA 1QVFA 5FROA 3OYMA 1LJOA 3JCMf 2EIFA 3V7SA 4E7KA 3OS0A 1N27A 3CCJA 3PGGA 3LLRA 5C0MA 3L2ZA 5CR2A 3VU3C 1VQ7A 3X24B 1W2BA 4J6YA 2XDPA 1VQNT 3WVDB 1VQ4A 4M7DG 4M7AD 1FXXA 1O75A 3META 2EAYA 3CC2A 4L5GA 4C0DB 3FLGA 3HPWA 3OW2S 4JRQA 3ZEHA 2RI2A 4KULA 1YI2A 1LOJA 4C8QF 4C5EA 1HK9A 2RA2A 2MMPA 4PLLA 1Q86U 2EYQA 3FC3A 3G4SA 3CCEA 2A3LA 3QJ6A 3KUFA 2OTJA 2EQJA 5A0LA 5GAN8 1U8RA 2X4XA 3ZBDA 4C0FA 3CMET 3OA6A 3BFMA 4BE0A 4FT4A 5LJ5f 1WQ7A 1K9MC 3TU4K 3CPFA 2BUDA 3SWNC 1UGRB 3CCRA 5KH6A 3A8OB 3CBOA 4LDUA 2LQ8A 2QA4A 2L89A 3I56A 2CS7A 1LNXA 5GAOr 1Q7YU 1M1KU 3HFNA 3CMAT 3CCQA 5KCOA 1WQWA 1XNIA 2RK1A 3LW5E 4C8QA 5CVIA 5CAIA 3OYCA 4E7IA 3JAME 4O5VA 4M77F 3X20B 1BKBA 2XDBA 1BIAA 4ZN3A 5GAMj 4XU3A 4ZTJA 2X4JA 1Q82U 3VUBA 4XTUA 2HD0A 1G3YA 2DEQA 1UGSB 2LDMA 3OQ5A 5D6WA 4YTLA 1JJ2A 4Y28E 1PSEA 4II1A 2D6FA 1M5Q1 3O8VA 3ER0A 4OB1B 2NLUA 2IVWA 1VIFA 1OZ3A 2V8IA 5GANf 2L3RA 4MDWA 4ZGEB 5HKCA 4MZTA 4HA8A 1VQKT 5M9OA 3MP8A 2G3RA 2OAUA 4FSXA 2KY9A 5HY6A 5I2SA 3H8ZA 3URGA 3SDZA 1QVGS 2LCLA 2XG8D 3CCST 3JB9H 4E47A 2HAXA 1DJ7B 2F5TX 1K73U 1M90U 4C0ZA 1VQNA 2GCXA 4X34A 3I55T 3C12A 2MWPA 3MO8A 4X9DA 3FEOA 1S72T 2CZ1B 4XQ3A 2LQKA 5HK3A 1NPRA 4IKFA 3JCMg 3DLMA 3LYIA 2FHDA 4J7IA 3VUZA 5GMKm 3OYAA 4J8OA 3M56A 4XU1A 3QYGB 4DQ2A 3OS5A 2VV5A 2E6NA 3OS2A 4PLIA 3QDRB 2YHTA 3CCLT 1WJQA 1QVFS 1X6OA 4HKEA 4XTYA 4QVDA 3JRZA 1Q86C 4BI4A 5L8RE 1D3BA 1OZ2A 2K3XA 5GMKe 5GAN5 3CMEA 2DXCA 4KUIA 1NZ9A 4M77E 4FT2A 5GAN4 3M54A 3A8MB 4RMOA 1W2BS 3FRNA 3GIBA 2XIDA 3DLLA 1OI1A 3LGFA 2DD4A 4DOVA 2QQAA 5LJ3f 3QYHB 2FYKA 2PVGB 4C8QC 4FL6A 3LX7A 3CC4T 3CMAA 2JN0A 1BYMA 2QQSA 2CKKA 2DTIA 4P5NA 4KUDK 4L59A 2BIVA 2LRQA 1Q7YC 4M7DD 3RKYA 2E64A 1MGQA 5I21A 2RI5A 2M1HA 2RO0A 3NTIA 1U1TA 1M1KC 3OB9A 2QQ9A 3S3NA 3C4SA 4OB2B 4WF2A 2M16A 4JS4A 2DXUA 4VUBA 2RK2A 4B9XA 5GAN3 5CKFA 3RIRA 2HQEA 2YLCA 4C8QB 3JCMX 3L2VA 1VQPT 3E9GA 2DZ9A 4NS5A 4M7AA 2LC4A 4N0AC 3FDRA 3QSUA 1MHNA 5A2QE 1VQKA 3CBPA 1QP3A 5A0DA 5CK9A 3A8GB 4ZTFA 2V8KA 4M77C 4QQGA 3CCSA 1KQ2A 3RERA 4JLIA 4C92F 1VQ6T 4QQ6A 3OBYA 1I4K1 5GAN2 3C95A 1WPYA 3RMSA 3I55A 1Y96A 2EJFA 4IUVA 3A8LB 2DIQA 1S72A 3GOXA 3BDLA 1YJWT 3JCMh 5LL6S 1KC8U 2QEXT 1JJ2S 3VYHB 4HT8A 2F69A 4M77B 5GAN7 2LT1A 3QO3A 2ZGWA 4M78E 1ZBXA 1R8OB 3OS1A 4JRKA 4OB3B 3CCLA 5FRMA 4IURA 2RHZA 4R56A 2P0PA 2RJFA 4C92A 3G6ET 3JB9F 4E7HA 1YIJT 2V8JA 3OSSC 4O6JA 3OYYA 3L42A 4BE1A 4M75F 5CKDA 4QVZA 2K57A 3LWHA 2PQWA 1B34A 1IZ6A 1KQSA 3JCMP 3OYIA 1O9SA 2LCCA 3OSVA 3CC4A 1D3BB 1JBMA 2HNIA 3VYGA 4XK8E 2ZPEB 1NJIU 2YRVA 3MEAA 3OBWA 2ZPHB 2RHXA 3P8HA 4M77G 3V7CA 3OYDA 2QQBA 3S6WA 1I8FA 5GAOp 1XTDA 3QXEB 3V8JA 5GAOq 2EJ9A 4BB7A 1KQ1A 2DTOA 4PJOF 3NTKA 5LJ3j 1HXDA 1N9RA 4M78D 3UT1A 5LJ3g 5A0GA 2M9UA 1VQPA 3QG1A 4PL6A 1K73C 2EWNA 4M78C 5FU6C 3VV0A 3QHSA 2DVEA 4M75A 3JCMd 2QI2A 4FIBA 2VGNA 3OYEA 4HCBA 3J7AF 3OYBA 2LT4A 4OVAA 1AHJB 3QKJA 4N4IA 2CZ0B 2R57A 2VGMA 4A4FA 4GLKA 5GAMg 4NL3A 3UPUA 2DK3A 1VQ6A 4Z02A 4M78B 5FU6B 2VC8A 4X9CA 2EQKA 2HQXA 4PJOA 2JOYA 1YJWA 5AYFA 4B9WA 4EMKA 3GNGA 4F7UA 2FL7A 3S3MA 2QEXA 2K5LA 2K2VA 5CKHA 3HFOA 3M53A 2P4TA 2OTLT 4J6XA 4V2SA 2H3JA 3GP8A 1KC8C 2MWOA 2RJCA 3CEYA 4C8QE 1YJNT 4ME7A 3UDCA 5D6YA 4XTVA 5GAOm 2KAFA 3RESA 4JS5A 1Y71A 3MP1A 4C92C 3CC7T 3QIIA 1IREB 4IUUA 4LD6A 5CKBA 3JCMc 3P8BB 2FB7A 2LVMA 3LGLA 3G6EA 3WXMB 5FLXE 2O4XA 3JSCA 3HRUA 4GY5A 1UGQB 3CBMA 3CPWS 4M78G 1X01A 1WGSA 4JDSA 4PJOE 4BI3A 3VJPA 3TREA 3OYHA 2MI6A 3A8HB 2EQUA 4RCBA 5GMKi 2CZ7B 4C92B 2Y4XA 4XTWA 4DA4A 3L2UA 1UB4A 3NTHA 3S3OA 2RJEA 2BKDN 3R6OA 2DZCA 4IUPA 5CCAA 2PU9B 3A5ZB 3HHTB 4FM4B 3SD4A 5GAOn 1B34B 4BACA 4MZPA 2F5KA 2LX9A 3RKWA 4M7AF 2ZPFB 4C8QD 4RG8A 3JCMe 3Q1JA 4A4KA 3M9QA 2RHYA 3GF5A 4BUGA 2JNGA 3GPLA 2FVUA 3PMTA 1YHQT 1G3TA 4NOYA 2GF7A 2ZPBB 5LJ5g 5LJ5j 4LDXA 2E41A 2KVQG 5J3BA 2DPPB 1KQSS 5GAMh 4N4GA 2XKOC 3BY7A 2K3YA 3JCMQ 3CC2T 2X4YA 3M4GA 2GFUA 4BY6B 3JB9I 1NE8A 4PJOC 4MDXA 4L6V5 1WNLA 2DD5A 4MZMA 5DLQE 1Q82C 2K5IA 4XTXA 2RB6A 1YCYA 4DOWA 5GMKl 2AHJB 2JZ2A 2R58A 3HKSA 4BDZA 1Q81U 2K5FA 1I5LA 3V8KA 1ZQ1A 4M77D 1BI1A 2DJZA 2OTLA 2R5AA 3J81E 1YJNA 2MAMA 1VQLT 2P0KA 4D6WA 4PJOB 1KHCA 2VUBA 3CC7A 2RJDA 1YBYA 3BW1A 4J83A 3RUXA 5DM7R 5GANg 5J39A 4E7JA 5GANj 5FRNA 3HRSA 3CD6T 4BD3A 3QUIA 4JJNK 5IT9E 3CCUT 1YITT 3MEUA 4XU2A 3CCRT 1UEBA 2RH2A 3HP9A 4C5HA 1N8RU 4RKUE 2WSEE 3SWNA 5LJ3d 3HSBA 3PT9A 1P92A 4MMKA 4C8QG 4BE2A 4M7AE 1VQ9T 1QVGA 1RL2A 3INZA 3M59A 3TEEA 2E10A 2X4WA 1OYXA 2ZPGB 4EMGA 1VQ8T 3L2QA 1VQ5T 3MEWA 5IAYA 2PUOB 1BI0A 3JB9J 2DTHA 3P8DA 2QQRA 5IN1A 5FU7C 3AHUA 1QW1A 5GAMd 3JCMV 4OP0A 1H641 3PMIA 3QZ5B 4C0GA 1K8AU 2C06A 4J5YA 2DO3A 3BDUA 3RMQA 2P0QA 4CRIA 3DB3A 4KBMB 5D6XA 1Y07A 4R55A 3ASKA 3FB9A 2CYZB 2KMTA 1Y7XA 4BI8B 1YHQA 4OF1A 4OMFB 5LJ5h 2XD0A 3PNWC 2ZPIB 5FU7B 3UWNA 1M1GA 4EMHA 3QBYA 1WJRA 3EFRA 1H3ZA 3VKIA 4MMLA 3DB4A 3X25B 1BIBA 4M7AC 4C92E 4F7UF 5KCHA 1BI3A 3GNFB 1QVPA 3M55A 3CCVT 1VUBA 3JCMW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R8O B; 
#chains in the Genus database with same CATH topology
 2QTV A;  4OMQ A;  4C5G A;  2K7A A;  2E12 A;  4EPC A;  1R77 A;  1EIF A;  4QQD A;  4J9D A;  3OYG A;  1ZX6 A;  1FMV A;  2KQW A;  1D1A A;  2MYS A;  1VQL A;  2GFA A;  4M7D F;  3G71 T;  1KHI A;  4LD9 K;  3CD6 A;  4DEY A;  3CXC A;  2M0O A;  2RI3 A;  1N8R C;  4CI0 C;  2JUF A;  4C92 D;  1VQ8 A;  2KRM A;  4GBQ A;  2EKO A;  1C0M A;  3SFM A;  1M2O A;  5CKE A;  1YIJ A;  4JRI A;  1PSF A;  1X43 A;  4J9E A;  4ZN1 A;  4RTY A;  2L3P A;  4Y92 A;  2DKG A;  3MHX A;  1BU1 A;  2FO0 A;  3OYN A;  1ZUU A;  1NLO C;  3ZFJ A;  4BY6 C;  3CCM T;  1JRI A;  2KR3 A;  4EDU A;  1PRM C;  3F70 A;  3CCJ T;  1I1J A;  3N5B B;  2LTO A;  5GAO l;  1VIE A;  1YJ9 A;  1T0H A;  1VQO A;  1QP2 A;  2CH4 A;  3JCM J;  5ECA A;  4EMK C;  8ATC B;  3PFS A;  1V29 B;  2E5Q A;  2BZY A;  3G4S T;  3CCE T;  5LJ5 e;  2K3B A;  1K9M U;  1FWZ A;  2HKN A;  5EG2 A;  2GQV A;  4EMK B;  1CKA A;  1KD1 C;  4XTZ A;  1FMW A;  1WJS A;  3KBG A;  4LDW A;  4FYW B;  4M75 G;  4RG2 A;  1PG5 B;  1VQ4 Q;  2LX7 A;  3A1P A;  5GAN 6;  2JS0 A;  4DBR A;  3H6Z A;  2RD1 A;  2W10 A;  2WSF E;  5DY9 A;  4A4E A;  4A53 A;  3UA6 A;  1WXU A;  5DLO A;  1TOV A;  2A08 A;  2DM1 A;  4PJO G;  2WAC A;  2B8A A;  4E7Z A;  4QVC A;  1XJW B;  1D09 B;  2C0T A;  3QWX X;  1C6V X;  3PGG A;  3H0H A;  1ABQ A;  1VQN T;  4M7D G;  1FXX A;  1O75 A;  2IPO B;  3CCQ Q;  1D1C A;  4KUL A;  1YI2 A;  1NM7 A;  1LOJ A;  2RA2 A;  1Q86 U;  2KRS A;  1SPK A;  3KUF A;  1D1B A;  4EIK A;  3CPF A;  3SWN C;  3CCR A;  4OMN A;  2QA4 A;  3UAT A;  2CS7 A;  1LNX A;  2LJ1 A;  4OML A;  1XNI A;  2XDB A;  4HVV A;  2DEU A;  2RPN A;  1G3Y A;  3PE0 A;  2HZY A;  2RNA A;  3VS3 A;  1BB9 A;  2L3R A;  3H0F A;  4ZGE B;  4Z89 A;  1VQK T;  1U5S A;  2G3R A;  3SDZ A;  3JB9 H;  1PC0 A;  4LUE A;  1DJ7 B;  2F5T X;  1UHF A;  3I55 T;  4PJM A;  3MO8 A;  4X9D A;  3FEO A;  4FYV B;  3EHQ A;  4KH0 B;  2VV5 A;  4PLI A;  3QDR B;  1QVF S;  4FT2 A;  3FRN A;  2D8J A;  3GIB A;  2XID A;  2HDA A;  5KYY A;  3CMA A;  2JN0 A;  3REA B;  3CC7 Q;  4KUD K;  2BIV A;  2AIR B;  2LRQ A;  1Q7Y C;  2RI5 A;  2MK5 A;  2RO0 A;  3RDV A;  2QQ9 A;  4OMP A;  3C4S A;  2COW A;  2DXU A;  3PVQ A;  2HKQ B;  2YLC A;  1WFW A;  1Q82 R;  2H3E B;  4CC2 A;  4ZTF A;  2J05 A;  2V8K A;  1M27 C;  1WXT A;  3EH2 A;  1M3C A;  4C92 F;  3VRY A;  1KJW A;  3C95 A;  2EJF A;  3A8L B;  2DIQ A;  1S72 A;  3CC4 Q;  1M90 R;  1WLP B;  4M78 E;  1ZBX A;  1R8O B;  3OS1 A;  2MPX C;  4FSS A;  3CCL A;  1VQP Q;  2RHZ A;  3G6E T;  4E7H A;  1WHJ A;  3MJX A;  3OYY A;  4QVZ A;  4DBF A;  1KQS A;  3JCM P;  3BE3 A;  1VQ6 Q;  1JBM A;  2HNI A;  1ZLM A;  3FJ5 A;  2H8H A;  2QQB A;  1I8F A;  3I5R A;  4M78 D;  5A0G A;  2QAS A;  2EWN A;  4M78 C;  5FU6 C;  1GBR A;  3VV0 A;  2BZX A;  3QHS A;  4HCB A;  3J7A F;  2CT3 A;  1WZO A;  2ROL A;  2LT4 A;  1QCN A;  1AHJ B;  3EG9 A;  2CZ0 B;  2VGM A;  1YIJ Q;  5GAM g;  1MUZ A;  4Z02 A;  4E2F B;  1TS9 A;  4M78 B;  5FU6 B;  2HQX A;  2M0Y A;  4F7U A;  3S3M A;  2QEX A;  2K5L A;  2P4T A;  1E7O A;  4V2S A;  2H3J A;  1NLP C;  1N8R R;  4C8Q E;  3O5Z A;  5D6Y A;  2KAF A;  1Y71 A;  3CC7 T;  1IRE B;  5CKB A;  2FB7 A;  1MV0 B;  2O4X A;  4GY5 A;  1UGQ B;  2JM8 A;  2I0N A;  1WGS A;  4JDS A;  4PJO E;  4AFU C;  1VQO Q;  2CZ7 B;  4PK4 A;  1SHF A;  1ZA2 B;  2M02 A;  2Y4X A;  1I5O B;  2YUP A;  3S3O A;  4IUP A;  3THK A;  3OW2 A;  3RKW A;  2KNB B;  1BCM A;  2ZPF B;  4C8Q D;  1J3T A;  3Q1J A;  1R0B G;  2RHY A;  3GF5 A;  3EFO B;  3PMT A;  3C0C A;  1YHQ T;  3TVT A;  2XKO C;  4R0K A;  4PJO C;  1BCO A;  2EYZ A;  4BDZ A;  1BI1 A;  1NYF A;  2OTL A;  1OEB A;  1OX8 A;  1VQL T;  1ZUY A;  4PJO B;  5GAN g;  5GAN j;  1TXQ A;  5FRN A;  3VS6 A;  1KD1 R;  1UGV A;  4JJN K;  1NJI U;  3CD6 T;  2BE7 D;  2YWW A;  3MEU A;  4XU2 A;  3HSB A;  1BBZ A;  4MMK A;  4M7A E;  1RL2 A;  2E10 A;  1VQ8 T;  2JXB A;  4J9B A;  2PUO B;  3JB9 J;  3P8D A;  1KSW A;  5FU7 C;  1QW1 A;  8AT1 B;  3JCM V;  4C0G A;  3PMI A;  2DLP A;  4J5Y A;  2HQH A;  4CRI A;  4KBM B;  3ASK A;  2JW4 A;  2KMT A;  1Y7X A;  1T0J A;  1ZBJ A;  5FU7 B;  1M1G A;  3CCR Q;  2F2V A;  1TUG B;  3VKI A;  4MML A;  2QA4 Q;  4AMC A;  4M7A C;  4F7U F;  1BI3 A;  1QVP A;  1VUB A;  3JCM W;  1C1A A;  3M58 A;  3OYF A;  3EHR A;  1XQH A;  1JQQ A;  5IHK A;  2SEM A;  5CQX A;  2LNV A;  1X6B A;  1YJ9 T;  3C94 A;  3KXT A;  2XU8 A;  4M7A B;  1VQO T;  4Q5W A;  1ZHI A;  2EYW A;  2CP2 A;  3RR6 A;  3VS2 A;  2IIM A;  1WYX A;  3I35 A;  3CCU A;  1GRI A;  1YWO A;  1SEM A;  4PKC C;  2CP7 A;  2ZZD A;  1FYN A;  1VQ5 A;  4A4H A;  1G3S A;  5GAM e;  2KT8 A;  1IB8 A;  2RM4 A;  1FX7 A;  3EFS A;  1D0Y A;  4LDV A;  4M7D A;  2E5K A;  1M1F A;  2CZ6 B;  2JTE A;  1YWP A;  3E19 A;  5KYX A;  2XI9 A;  1K8A C;  1ACM B;  4J9I A;  4IUT A;  5CQY A;  1I0C A;  2DYI A;  4E7L A;  4N0A A;  4JUV A;  2JTF A;  1M2V A;  3FIF A;  3E9F A;  3MCA B;  4ZGD B;  1KIK A;  4A4G A;  1PHT A;  5GMK j;  4JRP A;  2AKL A;  3QZ9 B;  2DAQ A;  3WVE B;  1QKW A;  2L2P A;  5LJ3 h;  3QJY A;  2O31 A;  2ZAE A;  4AG1 C;  3CMA Q;  3PTA A;  2O9V A;  3CCV A;  4J7F A;  3ME9 A;  1PD0 A;  1GXI E;  1JO8 A;  1TTH B;  2K2M A;  3PVL A;  3T9N A;  4PFZ A;  2K4Y A;  3L2W A;  1G5V A;  3LH0 A;  2VXF A;  3OMG A;  5KYU A;  3M57 A;  5J26 A;  1K9A A;  1TH7 A;  1YI2 T;  4M78 F;  2YLB A;  2L8D A;  3SB2 A;  1Q95 G;  3EGD B;  1S72 Q;  2KSS A;  1Q7Y R;  3CCM Q;  3JB9 G;  3L1A A;  3L2R A;  3EAE A;  3CCJ Q;  2QA4 T;  4E6R A;  2EQM A;  1KG1 A;  3LWI A;  3CCL Q;  5HK0 A;  2WSC E;  2F2W A;  4ATO A;  3G1J A;  1XOV A;  2QDY B;  1LPL A;  3CXC S;  1VYU A;  2DRM A;  2NWM A;  3G7Z A;  2D1X A;  5CO7 A;  2CH4 W;  3PIP A;  3CPW A;  2HL3 A;  5GAN e;  4DBH A;  1ZSZ A;  2QK0 A;  4F7U G;  1YCS B;  2XIC A;  3G4S Q;  3CCE Q;  1K1Z A;  4FCY A;  1WA7 A;  5FRO A;  4JJD A;  3OYM A;  3OS0 A;  1EZZ B;  1VQ7 A;  3LLR A;  4RTX A;  4AFS C;  4F17 A;  3TSW A;  3MET A;  2EAY A;  1RI9 A;  3HPW A;  2C0I A;  4JRQ A;  3ZEH A;  3MKD A;  2W0Z A;  4C8Q F;  1GFC A;  2EYQ A;  5A0L A;  2PNI A;  3ZBD A;  3OA6 A;  4BE0 A;  2DVJ A;  1WQ7 A;  2A0F B;  1K9M C;  4HXJ A;  4M4Z A;  3TU4 K;  2BUD A;  2FG0 A;  2DIL A;  1RUW A;  1SHG A;  3LH5 A;  3I56 A;  2DBK A;  3CMA T;  1KQS P;  1VQN Q;  5KCO A;  1WQW A;  2RK1 A;  3LW5 E;  4DBQ A;  1OV3 A;  4O5V A;  3REB B;  1Q82 U;  3VUB A;  4XTU A;  2LDM A;  3OQ5 A;  4YTL A;  2VVK A;  1PSE A;  1OQK A;  3O8V A;  4GLM A;  4OB1 B;  4RUG A;  2IVW A;  1VIF A;  4MDW A;  1GBQ A;  4AG2 C;  4HA8 A;  2V26 A;  5M9O A;  5HY6 A;  2OAU A;  4FSX A;  3URG A;  2LCL A;  5IHN A;  2AK5 A;  2HAX A;  2EGA A;  1M90 U;  1ARK A;  4C0Z A;  1AWW A;  2MWP A;  1S72 T;  2CZ1 B;  2YSQ A;  2LQK A;  1YN8 A;  4IKF A;  1ZUK A;  3DLM A;  4J7I A;  2FHD A;  3VUZ A;  4J8O A;  1AWX A;  3SHW A;  4F14 A;  2V1R A;  4DQ2 A;  3OS2 A;  2KYM A;  3CCL T;  4XTY A;  3JRZ A;  1SRL A;  1Q86 C;  4BI4 A;  1D3B A;  1OZ2 A;  5GMK e;  3EGX B;  1NZ9 A;  2YXY A;  4M77 E;  2NUP A;  5GAN 4;  3M54 A;  2RF0 A;  1VQK Q;  4RMO A;  2DET A;  3DLL A;  5KYN A;  3LGF A;  2QGG A;  2QQA A;  5LJ3 f;  2JM9 A;  1BYM A;  2DTI A;  4P5N A;  3I55 Q;  2EPD A;  5I21 A;  2COY A;  1M1K R;  3S3N A;  3OW2 P;  4JS4 A;  2RK2 A;  2DZ9 A;  2LC4 A;  3FDR A;  5IH2 A;  3CBP A;  1UE9 A;  4LUD A;  4M77 C;  1S1N A;  3CCS A;  1KQ2 A;  5AT1 B;  3GOX A;  1KK7 A;  3JCM h;  1KC8 U;  2QEX T;  1OPL A;  4M77 B;  3QO3 A;  1MND A;  2ZGW A;  1SG5 A;  3M0P A;  5FRM A;  2PZ1 A;  1RAD B;  2RJF A;  4C92 A;  1QQJ A;  4O6J A;  1WHM A;  3NHN A;  3TSZ A;  2LQN A;  3M0U A;  4RTU A;  3LWH A;  2K57 A;  2PQW A;  1AWJ A;  1H92 A;  2LCC A;  4RTV A;  3VYG A;  3OBW A;  3P8H A;  3S6W A;  2DA9 A;  5EC7 A;  5GAO p;  4FW1 A;  4BB7 A;  3NGP A;  1E6G A;  5LJ3 g;  5LJ3 j;  1HXD A;  2M9U A;  1QWF A;  1K0S A;  3JCM d;  3OYE A;  1HYO A;  2KT1 A;  4OVA A;  1GFD A;  3G6E Q;  3D7S B;  4GLK A;  4NL3 A;  2DK3 A;  1W2B P;  2X3W D;  1JXM A;  4X9C A;  2JOY A;  4EMK A;  3GNG A;  1FMK A;  2JT4 A;  3EH1 A;  2K2V A;  2OTL T;  2CRE A;  2NUT A;  3GP8 A;  2RJC A;  1EX4 A;  1UJ0 A;  4ME7 A;  4XTV A;  4JS5 A;  4LE9 A;  3QII A;  4LD6 A;  2KBT A;  3P8B B;  3LGL A;  3SEM A;  3CBM A;  2RQV A;  4LNP A;  3VJP A;  1AD5 A;  3TRE A;  3OYH A;  2MI6 A;  4J9C A;  2QGF B;  3L2U A;  2LCS A;  2DZC A;  3A5Z B;  4Z88 A;  1WXB A;  1JJ2 P;  3A98 A;  2G6F X;  3M9Q A;  2V1Q A;  2FVU A;  4A63 B;  4LDX A;  2E41 A;  4PJL A;  1V1C A;  1KQS S;  3JCM Q;  3CC2 T;  2GFU A;  3MPU B;  4L6V 5;  2DD5 A;  4MZM A;  5DLQ E;  2K5I A;  4XTX A;  2RB6 A;  4DOW A;  2AHJ B;  2R58 A;  1Q81 U;  2K5F A;  2HL5 C;  1TUD A;  1T3S A;  2CUB A;  3J81 E;  1YJN A;  4D6W A;  1KHC A;  2K9G A;  4E7J A;  3RUX A;  3BW1 A;  4FYX B;  4KGV B;  3JV3 A;  3HRS A;  4BD3 A;  1K73 C;  3CCU T;  1YHQ Q;  1UEB A;  5FWC A;  3SWN A;  2A36 A;  1VQ7 Q;  1P92 A;  2YUN A;  1QVG A;  2X4W A;  1OYX A;  2L3S A;  2ZPG B;  4EMG A;  1VQ5 T;  1VYV A;  5IAY A;  1BI0 A;  2QQR A;  2ESW A;  5IN1 A;  3AHU A;  2CP6 A;  4OP0 A;  2DRK A;  3RMQ A;  1Y07 A;  1NBE B;  4R55 A;  1VQL Q;  4BI8 B;  2XD0 A;  4OF1 A;  5LJ5 h;  4JJB A;  1SSH A;  3UWN A;  3CD6 Q;  2XMF A;  1H3Z A;  2DYB A;  3I56 Q;  3CPW P;  1Z9Q A;  5GAO q;  2HCK A;  2GNC A;  3CCV T;  1VQ8 Q;  2BE9 B;  3EG1 A;  2LJ3 A;  1UGP B;  4J6W A;  4QW2 A;  2KEA A;  4OGC A;  2CGH A;  2NYS A;  3VS7 A;  1M9S A;  3RKX A;  4LXC A;  4XU0 A;  2ZCF B;  2X3X D;  2XK0 A;  3M0R A;  4NL2 A;  2JVV A;  1M4Z A;  2OX7 A;  4XAX B;  1K9M R;  3FJP A;  5LJ3 e;  2I2L A;  1WHH A;  2A28 A;  4ZGJ B;  5GJW B;  1NJI C;  4M75 E;  4HT9 A;  2AKK A;  1Y96 B;  3X26 B;  5LJ5 d;  2DNU A;  1B7T A;  5CIU A;  4FU6 A;  4ELY C;  4HVU A;  2M51 A;  1ABO A;  2MF2 A;  2COZ A;  1IGQ A;  4RTZ A;  2NUZ A;  3VS5 A;  1YJ9 Q;  2DJQ A;  2E6Z A;  2IG0 A;  4A54 A;  2HEQ A;  3CQT A;  3M5A A;  1A0N B;  2VB6 A;  1AT1 B;  1OUL A;  2E70 A;  1N9S A;  2HBW A;  2DXT A;  4JZ3 A;  4M75 D;  4M75 C;  4M7D E;  1OOT A;  3J80 E;  9ATC B;  2A7Y A;  4J9G A;  2VYT A;  1VQ7 T;  1GCQ A;  4UC4 A;  4Y91 A;  7AT1 B;  2BTT A;  4C92 G;  1I07 A;  4PJO D;  1GL5 A;  4M75 B;  4ELZ C;  1Q86 R;  2O9S A;  2DIG A;  2Y4Y A;  4D8D A;  3M4Y A;  4LDY A;  1WHG A;  2O01 E;  5KE3 A;  4HCZ A;  2EFI A;  3CCS Q;  1VQM A;  3NPF A;  2EYY A;  2GTO A;  1M3A A;  2XHC A;  2FPF A;  2PVO B;  2VXE A;  2EJG A;  1W1F A;  4M7D C;  3QPH A;  4OB0 B;  4HCC A;  5IXF A;  2QTX A;  1K4U S;  3OY9 A;  2QXF A;  3I56 T;  4OGE A;  3VRZ A;  1AWO A;  5C6S A;  4M78 A;  1M8V A;  4X1V A;  2LP5 A;  1NPP A;  4F04 B;  2GQI A;  4M7D B;  4PNO A;  1NYG A;  2RHU A;  3V8L A;  2ROT A;  5KYX B;  3M0Q A;  4JLG A;  1YI2 Q;  2VKN A;  3MP6 A;  2DL8 A;  3RBB B;  4C0D C;  2DER A;  1M2V B;  1PWT A;  4N4H A;  1U3O A;  1LJO A;  2EIF A;  3V7S A;  5C0M A;  5CR2 A;  3VU3 C;  5D7U A;  1W2B A;  4D8K A;  1AVZ C;  2FEI A;  1VQ4 A;  4M7A D;  3CC2 A;  4L5G A;  4C0D B;  3FLG A;  2CT4 A;  2RMO A;  4C5E A;  1HK9 A;  3QJ6 A;  2OTJ A;  1U8R A;  2ED0 A;  2X4X A;  4FT4 A;  5LJ5 f;  3IQL A;  4B6M A;  5FW9 A;  3E2U A;  5KH6 A;  4LDU A;  2RQW A;  2L89 A;  5GAO r;  1TG0 A;  1M1K U;  3CCQ A;  4C8Q A;  4E7I A;  3OYC A;  5CVI A;  3JAM E;  1QCO A;  3X20 B;  1BKB A;  1UG1 A;  1BIA A;  2FZK B;  4ZN3 A;  4XU3 A;  4ZTJ A;  2X4J A;  5D6W A;  1ZSZ C;  1UGS B;  1JJ2 A;  4II1 A;  2D6F A;  1M5Q 1;  3ER0 A;  1UEC A;  2V8I A;  4MZT A;  1YNZ A;  3MP8 A;  2KY9 A;  5I2S A;  3H8Z A;  1T3L A;  3CCS T;  1ZSZ B;  1RLP C;  3C12 A;  1H3H A;  3GBQ A;  1NPR A;  4OMO A;  1UHC A;  2QYZ A;  5I22 A;  2GGR A;  2P84 A;  3OYA A;  1PM3 A;  3M56 A;  5KYW A;  2E6N A;  3M0T A;  2YHT A;  1WJQ A;  1X6O A;  4HKE A;  4IIO A;  5L8R E;  3CME A;  2K3X A;  2DXC A;  3QDF A;  3A8M B;  2LZ6 B;  1X27 A;  1QWE A;  1YFN A;  4FL6 A;  1UUE A;  2E64 A;  1MGQ A;  2M1H A;  2FZC B;  3OB9 A;  4OB2 B;  2M16 A;  3EG3 A;  4B9X A;  3H0I A;  5GAN 3;  4Z8A A;  3RIR A;  1PD1 A;  2HQE A;  3JCM X;  2O2O A;  4NS5 A;  2EGE A;  4M7A A;  3QSU A;  5A2Q E;  1RAH B;  5A0D A;  5CK9 A;  3A8G B;  2ENM A;  4DEX A;  4JJC A;  4QQ6 A;  2LJ0 A;  1K73 R;  5GAN 7;  1RAE B;  1QCF A;  1X6G A;  4JRK A;  4R56 A;  1HJD A;  2F1L A;  3L42 A;  4BE1 A;  4HVW A;  4M75 F;  5CKD A;  1B34 A;  1RAG B;  3OYI A;  3CC4 A;  3OSV A;  2AT1 B;  1QVG P;  1D3B B;  1X69 A;  4AT1 B;  2YRV A;  1WX6 A;  2NUP B;  3OYD A;  1YP5 A;  3V7C A;  1NEB A;  3QXE B;  2QEX Q;  1IRX A;  1KQ1 A;  4PJO F;  3NTK A;  3UT1 A;  3I5S A;  1VQP A;  3QG1 A;  2DVE A;  1IHV A;  2QI2 A;  4FIB A;  2VGN A;  3H41 A;  3OYB A;  1QVF P;  1M8M A;  3QKJ A;  4N4I A;  2R57 A;  4A4F A;  2RQU A;  2BZ8 A;  3UPU A;  2VWF A;  1VQ6 A;  4KGZ B;  2C0O A;  2VC8 A;  2OAW A;  3EGD A;  1WHL A;  2EQK A;  2AZS A;  4JZ4 A;  1YJW A;  1TU0 B;  2D0N A;  5AYF A;  4B9W A;  2AZV A;  2FL7 A;  3M53 A;  4CC3 A;  1NJI R;  1KC8 C;  3CEY A;  1YJN T;  3UDC A;  4C92 C;  1RAF B;  3H9N A;  2CUD A;  4IUU A;  2LVM A;  2Z0W A;  2FRY A;  2J06 A;  1IO6 A;  4M78 G;  1X01 A;  2JMC A;  4BI3 A;  2D8H A;  2QG9 B;  2EQU A;  4RCB A;  5GMK i;  4C92 B;  2JJ9 A;  3UA7 A;  4XTW A;  1UB4 A;  2RJE A;  1AZG B;  3EGU A;  5CCA A;  4BAC A;  2PU9 B;  3HHT B;  2YRC A;  1RLQ C;  2OI3 A;  2E3H A;  1RAB B;  2F5K A;  4MZP A;  2LX9 A;  4M7A F;  1VQM Q;  2OTL Q;  1UTI A;  2EYX A;  2JNG A;  2J7I A;  2F2X A;  1G3T A;  2EVR A;  2ZPB B;  1M30 A;  4J9H A;  5GAM h;  2HMA A;  4N4G A;  1PKT A;  2K3Y A;  4BY6 B;  3JB9 I;  1NE8 A;  2DBM A;  1WNL A;  1YCY A;  1N5Z A;  3HKS A;  1I5L A;  1VOM A;  1ZQ1 A;  4M77 D;  2ATC B;  2R5A A;  2K6D A;  1MMD A;  2J6O A;  2VUB A;  1YBY A;  4J83 A;  5DM7 R;  5J39 A;  1VYT A;  3QUI A;  5IT9 E;  2MIO A;  2YUO A;  1N8R U;  3HP9 A;  4C5H A;  4PJN A;  4ANJ A;  2NUT B;  2RQR A;  2WSE E;  4RKU E;  4C8Q G;  2E4H A;  2MOX A;  1PKS A;  4PFO A;  3CC2 Q;  3L2Q A;  2CDT A;  5GAM d;  1H64 1;  1B3Q A;  2DE0 X;  2P0Q A;  5D6X A;  3FB9 A;  2OTJ Q;  2CYZ B;  2CP5 A;  2DL4 A;  4OMF B;  3PNW C;  3QBY A;  4KH1 B;  3EFR A;  3CCU Q;  1UFF A;  5KYY B;  3X25 B;  2YT6 A;  4AFZ C;  5KCH A;  1RAA B;  2KI7 A;  3M55 A;  3EGX A;  1VQ5 Q;  1U1S A;  1CSK A;  1Q81 C;  1E6H A;  3TCJ A;  4KT0 E;  2LMJ A;  2DX1 A;  3HRT A;  1EFN A;  3V7R A;  1JB0 E;  4CC7 A;  2DXB A;  5GAN h;  3HTR A;  2JMA A;  3GLX A;  1YIT A;  1AOJ A;  2YUQ A;  1RI0 A;  3HL8 A;  1VQM T;  1VQ9 A;  1D0X A;  3NFC A;  3NMZ C;  1KD1 U;  4WTO B;  1G3W A;  4C5I A;  2RHI A;  3SWN B;  3CCV Q;  1X75 C;  3JCM b;  2XDD A;  2PTK A;  1HD3 A;  4M7A G;  4RCC A;  4WCI A;  5L23 A;  2HSE B;  1K8A R;  4F7U E;  1W4S A;  1W6X A;  3CME Q;  1QLY A;  3JB9 D;  3DKM A;  2LQW A;  3OYL A;  1QVG S;  4M77 A;  3PIO A;  2DFU A;  2ABL A;  4IUQ A;  4BDY A;  2D9T A;  5GAN d;  1K76 A;  5GJV B;  1PRL C;  5I2M A;  3MEV A;  2QAZ A;  2L5Q A;  1SSF A;  1ZA1 B;  1UDL A;  2K79 A;  2KK4 A;  2JTM A;  2D0Q B;  4TVR A;  1VQ4 T;  1RAI B;  2EBP A;  3G71 A;  1OU9 A;  4ZNX A;  1IHW A;  3EG9 B;  3OMC A;  2HSP A;  2KGT A;  2MCN A;  5KE2 A;  3VS0 A;  1MMN A;  1HSQ A;  2Y90 A;  2OTJ T;  1I81 A;  3E1S A;  2PVD B;  2E1H A;  3X28 B;  4F7U B;  2PUK B;  2O88 A;  4KGX B;  5GAM f;  2VAS A;  1N6A A;  1OX9 A;  2HBP A;  3CCQ T;  2E65 A;  1BI2 A;  2DL3 A;  1R0C B;  2KDS A;  4QKU A;  2O4X B;  3OYK A;  5GMK h;  2CSI A;  1SF9 A;  2DL7 A;  3OYJ A;  2CSQ A;  2X35 A;  3VS1 A;  3RNJ A;  3CCM A;  5FWB A;  2R5M A;  1QVF A;  4E7S A;  3JCM f;  4E7K A;  1GCQ C;  1N27 A;  3CCJ A;  3L2Z A;  4QT7 A;  3QWY A;  2J6F A;  3X24 B;  4J6Y A;  2XDP A;  3WVD B;  1OPK A;  2GTJ A;  1TSF A;  2CP3 A;  1AEY A;  4IIM A;  4KRT A;  3OW2 S;  1QMC A;  2RI2 A;  2MMP A;  4PFP A;  4PLL A;  3FC3 A;  3G4S A;  3CCE A;  2A3L A;  1QKX A;  2EQJ A;  5GAN 8;  1SKU B;  4C0F A;  3CME T;  3BFM A;  1YJW Q;  1UGR B;  3A8O B;  3CBO A;  2LQ8 A;  4F16 A;  2DL5 A;  1Q7Y U;  1RAC B;  1Z9Z A;  2DF6 A;  3HFN A;  5IHI A;  6AT1 B;  5CAI A;  5I11 A;  2GBQ A;  4M77 F;  2KE9 A;  5GAM j;  3VS4 A;  2QDL A;  3KFV A;  2HD0 A;  2DEQ A;  2FPE A;  2EKH A;  2J6K A;  4Y28 E;  2X9H A;  2NLU A;  5GAN f;  1OZ3 A;  5HKC A;  2XG8 D;  1KC8 R;  4E47 A;  1K73 U;  1VQN A;  1PNJ A;  2GCX A;  4X34 A;  1GCP A;  4XQ3 A;  5HK3 A;  1LCK A;  3JCM g;  1ZSG A;  3LYI A;  5GMK m;  3CXC P;  4XU1 A;  3QYG B;  3OS5 A;  1KFZ A;  4QVD A;  2KXC A;  5GAN 5;  3R6N A;  4KUI A;  1W2B S;  4ORZ A;  1OU8 A;  1OI1 A;  2DD4 A;  4DOV A;  4C8Q C;  3QYH B;  2FYK A;  2PVG B;  2YRD A;  3LX7 A;  3U23 A;  3CC4 T;  2QQS A;  2CKK A;  1JEG A;  4M7D D;  4L59 A;  3RKY A;  1M1K C;  3UF4 A;  3NTI A;  1U1T A;  2ECZ A;  4WF2 A;  4VUB A;  2FRW A;  5CKF A;  5IXB A;  3AT1 B;  1VQP T;  4C8Q B;  3L2V A;  3E9G A;  4N0A C;  1MHN A;  1VQK A;  1QP3 A;  4QQG A;  1X2K A;  3RER A;  4JLI A;  1VQ6 T;  2E3I A;  3OBY A;  1I4K 1;  1LVK A;  5GAN 2;  1WPY A;  3RMS A;  4PJJ A;  3I55 A;  1Y96 A;  4IUV A;  1WI7 A;  3BDL A;  1YJW T;  1G2B A;  4CC4 B;  4K11 A;  5LL6 S;  1JJ2 S;  3VYH B;  4HT8 A;  2F69 A;  2LT1 A;  4HCK A;  4OB3 B;  4IUR A;  2P0P A;  3JB9 F;  2RN8 A;  1YIJ T;  4LN2 A;  2V8J A;  3OSS C;  1F1B B;  5KYW B;  1V76 A;  1K0X A;  1IZ6 A;  2FZG B;  3M0S A;  1O9S A;  4FYY B;  4XK8 E;  2ZPE B;  3MEA A;  1NEG A;  4RTW A;  2ZPH B;  2RHX A;  4M77 G;  5KYU B;  3EFO A;  2EQI A;  1NG2 A;  1D0Z A;  2X51 A;  1PCX A;  1YIT Q;  1XTD A;  2KYB A;  3V8J A;  3EG2 A;  2EJ9 A;  3I9Q A;  2FPD A;  2DTO A;  1N9R A;  1VQ9 Q;  2RQT A;  4PL6 A;  1TWB A;  2A37 A;  4M75 A;  2LNH B;  2SRC A;  1JXO A;  1Q81 R;  1AZE A;  2L0A A;  1H8K A;  4PJO A;  2YDL A;  1G8X A;  5CKH A;  3HFO A;  2CP0 A;  4J6X A;  1IXD A;  1MMA A;  2MWO A;  5GAO m;  3RES A;  3MP1 A;  1BK2 A;  2EW3 A;  3JCM c;  2P4R A;  3G6E A;  3WXM B;  1TUC A;  2L3Q A;  4J9F A;  5FLX E;  3JSC A;  3HRU A;  3CPW S;  2KRN A;  3A8H B;  3G71 Q;  4FW2 A;  4DA4 A;  1MNE A;  3NTH A;  1MV3 A;  2BKD N;  3R6O A;  3SD4 A;  4FM4 B;  5GAO n;  1B34 B;  4RG8 A;  3JCM e;  4A4K A;  2KRO A;  1WHK A;  4BUG A;  1YJN Q;  4RTT A;  3GPL A;  1U06 A;  4NOY A;  1WIE A;  2GF7 A;  5LJ5 g;  5LJ5 j;  2B86 A;  2KVQ G;  1JU5 C;  2EGC A;  5J3B A;  2DPP B;  2JS2 A;  4AFQ C;  3BY7 A;  2X4Y A;  3M4G A;  4MDX A;  1Q82 C;  5GMK l;  4ESR A;  2JZ2 A;  4OMM A;  3V8K A;  1CKB A;  2DJZ A;  2MAM A;  3ZL7 C;  2P0K A;  1M3B A;  3CC7 A;  2RJD A;  4JPB W;  1M90 C;  1YIT T;  3CCR T;  1Y0M A;  1B07 A;  2RH2 A;  5LJ3 d;  3PT9 A;  4BE2 A;  1VQ9 T;  3M59 A;  3INZ A;  3TEE A;  3ULR B;  3MEW A;  2DMO A;  2DTH A;  2KXD A;  1VA7 A;  1Y57 A;  1K8A U;  3QZ5 B;  2C06 A;  2DO3 A;  3BDU A;  1UJY A;  3TQ7 P;  3DB3 A;  1SRM A;  2ED1 A;  1G83 A;  5HCK A;  1YHQ A;  1MMG A;  2ZPI B;  4EMH A;  3EG0 A;  1WJR A;  1IGU A;  1X2Q A;  3DB4 A;  1W70 A;  2OJ2 A;  1BIB A;  4C92 E;  1WDX A;  3GNF B; 
#chains in the Genus database with same CATH homology
 4QW2 A;  1UGP B;  3M58 A;  4J6W A;  4OGC A;  3OYF A;  2CGH A;  1XQH A;  1U1S A;  1M9S A;  3RKX A;  4C5G A;  2E12 A;  4EPC A;  5CQX A;  2LNV A;  4XU0 A;  1Q81 C;  1EIF A;  4QQD A;  3OYG A;  2ZCF B;  3TCJ A;  4KT0 E;  1YJ9 T;  3C94 A;  3KXT A;  2XK0 A;  2KQW A;  1VQL A;  4NL2 A;  4M7D F;  2GFA A;  2XU8 A;  4M7A B;  3G71 T;  1KHI A;  3HRT A;  1VQO T;  4Q5W A;  1ZHI A;  1JB0 E;  3V7R A;  2DXB A;  2JVV A;  5GAN h;  1M4Z A;  4LD9 K;  4XAX B;  3CD6 A;  3FJP A;  5LJ3 e;  2I2L A;  3GLX A;  3CCU A;  1YIT A;  1RI0 A;  3HL8 A;  3CXC A;  4ZGJ B;  2M0O A;  4PKC C;  1VQM T;  2RI3 A;  1NJI C;  1N8R C;  1VQ9 A;  4M75 E;  3NFC A;  4CI0 C;  2JUF A;  4HT9 A;  1KD1 U;  4C92 D;  1VQ8 A;  1Y96 B;  2ZZD A;  3X26 B;  2EKO A;  5LJ5 d;  1VQ5 A;  4A4H A;  1G3S A;  5CIU A;  5GAM e;  4FU6 A;  1G3W A;  2RM4 A;  3EFS A;  1FX7 A;  4LDV A;  2RHI A;  3SFM A;  3SWN B;  4C5I A;  1X75 C;  4M7D A;  2MF2 A;  3JCM b;  1M1F A;  2CZ6 B;  5CKE A;  2XDD A;  1YIJ A;  4M7A G;  4JRI A;  1PSF A;  3E19 A;  2XI9 A;  4RCC A;  1K8A C;  4IUT A;  5CQY A;  4F7U E;  4ZN1 A;  2E6Z A;  4E7L A;  2IG0 A;  4N0A A;  4A54 A;  1W4S A;  4JUV A;  2JTF A;  3M5A A;  3FIF A;  3E9F A;  3MCA B;  4ZGD B;  3JB9 D;  3DKM A;  2DKG A;  2E70 A;  3MHX A;  3OYL A;  4A4G A;  1N9S A;  4M77 A;  5GMK j;  3OYN A;  2DXT A;  3QZ9 B;  2DAQ A;  3WVE B;  3PIO A;  4JRP A;  4IUQ A;  4M75 D;  4BDY A;  5LJ3 h;  2D9T A;  3QJY A;  5GAN d;  3ZFJ A;  4M75 C;  4M7D E;  4BY6 C;  3PTA A;  3CCM T;  3J80 E;  1JRI A;  5I2M A;  3CCV A;  4J7F A;  3ME9 A;  3MEV A;  1GXI E;  4EDU A;  2A7Y A;  3OW2 A;  2L5Q A;  3F70 A;  3CCJ T;  3T9N A;  1SSF A;  2LTO A;  3N5B B;  2VYT A;  1VQ7 T;  5GAO l;  4UC4 A;  2KK4 A;  1VIE A;  2JTM A;  4Y91 A;  2K4Y A;  2D0Q B;  4TVR A;  4C92 G;  3L2W A;  1VQ4 T;  1YJ9 A;  4PJO D;  1VQO A;  3G71 A;  1G5V A;  1QP2 A;  3LH0 A;  4M75 B;  4ELZ C;  3JCM J;  4ELY C;  2DIG A;  2VXF A;  2Y4Y A;  3OMG A;  4EMK C;  3M4Y A;  3M57 A;  4LDY A;  5J26 A;  2O01 E;  1TH7 A;  4HCZ A;  5KE3 A;  3PFS A;  4M78 F;  1V29 B;  1YI2 T;  3OMC A;  2E5Q A;  2EFI A;  2YLB A;  1VQM A;  2L8D A;  5KE2 A;  3SB2 A;  3G4S T;  3CCE T;  2XHC A;  2Y90 A;  5LJ5 e;  2OTJ T;  1I81 A;  1K9M U;  3E1S A;  2PVO B;  2VXE A;  2EJG A;  1FWZ A;  2PVD B;  2KSS A;  5EG2 A;  2GQV A;  4M7D C;  2E1H A;  3QPH A;  4OB0 B;  3X28 B;  4EMK B;  1KD1 C;  4F7U B;  4XTZ A;  4HCC A;  3JB9 G;  2PUK B;  1WJS A;  3KBG A;  4LDW A;  2QTX A;  3L1A A;  5GAM f;  3OY9 A;  3L2R A;  2QXF A;  3EAE A;  4M75 G;  2QA4 T;  4RG2 A;  1N6A A;  3I56 T;  2EQM A;  4OGE A;  1KG1 A;  3LWI A;  2HBP A;  5C6S A;  5HK0 A;  2E65 A;  4M78 A;  3CCQ T;  2WSC E;  1M8V A;  5GAN 6;  1NPP A;  1BI2 A;  4ATO A;  1M90 C;  4M7D B;  1XOV A;  2QDY B;  3H6Z A;  3CXC S;  4PNO A;  2KDS A;  2RD1 A;  5DY9 A;  2WSF E;  2RHU A;  2O4X B;  4A4E A;  4A53 A;  3V8L A;  3OYK A;  3G7Z A;  5GMK h;  5DLO A;  5CO7 A;  3PIP A;  4JLG A;  3CPW A;  5GAN e;  4PJO G;  3OYJ A;  2WAC A;  3MP6 A;  2X35 A;  4F7U G;  2XIC A;  2B8A A;  4C0D C;  4QVC A;  3CCM A;  2R5M A;  4N4H A;  1QVF A;  5FRO A;  3OYM A;  1LJO A;  3JCM f;  2EIF A;  3V7S A;  4E7K A;  3OS0 A;  1N27 A;  3CCJ A;  3PGG A;  3LLR A;  5C0M A;  3L2Z A;  5CR2 A;  3VU3 C;  1VQ7 A;  3X24 B;  1W2B A;  4J6Y A;  2XDP A;  1VQN T;  3WVD B;  1VQ4 A;  4M7D G;  4M7A D;  1FXX A;  1O75 A;  3MET A;  2EAY A;  3CC2 A;  4L5G A;  4C0D B;  3FLG A;  3HPW A;  3OW2 S;  4JRQ A;  3ZEH A;  2RI2 A;  4KUL A;  1YI2 A;  1LOJ A;  4C8Q F;  4C5E A;  1HK9 A;  2RA2 A;  2MMP A;  4PLL A;  1Q86 U;  2EYQ A;  3FC3 A;  3G4S A;  3CCE A;  2A3L A;  3QJ6 A;  3KUF A;  2OTJ A;  2EQJ A;  5A0L A;  5GAN 8;  1U8R A;  2X4X A;  3ZBD A;  4C0F A;  3CME T;  3OA6 A;  3BFM A;  4BE0 A;  4FT4 A;  5LJ5 f;  1WQ7 A;  1K9M C;  3TU4 K;  3CPF A;  2BUD A;  3SWN C;  1UGR B;  3CCR A;  5KH6 A;  3A8O B;  3CBO A;  4LDU A;  2LQ8 A;  2QA4 A;  2L89 A;  3I56 A;  2CS7 A;  1LNX A;  5GAO r;  1Q7Y U;  1M1K U;  3HFN A;  3CMA T;  3CCQ A;  5KCO A;  1WQW A;  1XNI A;  2RK1 A;  3LW5 E;  4C8Q A;  5CVI A;  5CAI A;  3OYC A;  4E7I A;  3JAM E;  4O5V A;  4M77 F;  3X20 B;  1BKB A;  2XDB A;  1BIA A;  4ZN3 A;  5GAM j;  4XU3 A;  4ZTJ A;  2X4J A;  1Q82 U;  3VUB A;  4XTU A;  2HD0 A;  1G3Y A;  2DEQ A;  1UGS B;  2LDM A;  3OQ5 A;  5D6W A;  4YTL A;  1JJ2 A;  4Y28 E;  1PSE A;  4II1 A;  2D6F A;  1M5Q 1;  3O8V A;  3ER0 A;  4OB1 B;  2NLU A;  2IVW A;  1VIF A;  1OZ3 A;  2V8I A;  5GAN f;  2L3R A;  4MDW A;  4ZGE B;  5HKC A;  4MZT A;  4HA8 A;  1VQK T;  5M9O A;  3MP8 A;  2G3R A;  2OAU A;  4FSX A;  2KY9 A;  5HY6 A;  5I2S A;  3H8Z A;  3URG A;  3SDZ A;  1QVG S;  2LCL A;  2XG8 D;  3CCS T;  3JB9 H;  4E47 A;  2HAX A;  1DJ7 B;  2F5T X;  1K73 U;  1M90 U;  4C0Z A;  1VQN A;  2GCX A;  4X34 A;  3I55 T;  3C12 A;  2MWP A;  3MO8 A;  4X9D A;  3FEO A;  1S72 T;  2CZ1 B;  4XQ3 A;  2LQK A;  5HK3 A;  1NPR A;  4IKF A;  3JCM g;  3DLM A;  3LYI A;  2FHD A;  4J7I A;  3VUZ A;  5GMK m;  3OYA A;  4J8O A;  3M56 A;  4XU1 A;  3QYG B;  4DQ2 A;  3OS5 A;  2VV5 A;  2E6N A;  3OS2 A;  4PLI A;  3QDR B;  2YHT A;  3CCL T;  1WJQ A;  1QVF S;  1X6O A;  4HKE A;  4XTY A;  4QVD A;  3JRZ A;  1Q86 C;  4BI4 A;  5L8R E;  1D3B A;  1OZ2 A;  2K3X A;  5GMK e;  5GAN 5;  3CME A;  2DXC A;  4KUI A;  1NZ9 A;  4M77 E;  4FT2 A;  5GAN 4;  3M54 A;  3A8M B;  4RMO A;  1W2B S;  3FRN A;  3GIB A;  2XID A;  3DLL A;  1OI1 A;  3LGF A;  2DD4 A;  4DOV A;  2QQA A;  5LJ3 f;  3QYH B;  2FYK A;  2PVG B;  4C8Q C;  4FL6 A;  3LX7 A;  3CC4 T;  3CMA A;  2JN0 A;  1BYM A;  2QQS A;  2CKK A;  2DTI A;  4P5N A;  4KUD K;  4L59 A;  2BIV A;  2LRQ A;  1Q7Y C;  4M7D D;  3RKY A;  2E64 A;  1MGQ A;  5I21 A;  2RI5 A;  2M1H A;  2RO0 A;  3NTI A;  1U1T A;  1M1K C;  3OB9 A;  2QQ9 A;  3S3N A;  3C4S A;  4OB2 B;  4WF2 A;  2M16 A;  4JS4 A;  2DXU A;  4VUB A;  2RK2 A;  4B9X A;  5GAN 3;  5CKF A;  3RIR A;  2HQE A;  2YLC A;  4C8Q B;  3JCM X;  3L2V A;  1VQP T;  3E9G A;  2DZ9 A;  4NS5 A;  4M7A A;  2LC4 A;  4N0A C;  3FDR A;  3QSU A;  1MHN A;  5A2Q E;  1VQK A;  3CBP A;  1QP3 A;  5A0D A;  5CK9 A;  3A8G B;  4ZTF A;  2V8K A;  4M77 C;  4QQG A;  3CCS A;  1KQ2 A;  3RER A;  4JLI A;  4C92 F;  1VQ6 T;  4QQ6 A;  3OBY A;  1I4K 1;  5GAN 2;  3C95 A;  1WPY A;  3RMS A;  3I55 A;  1Y96 A;  2EJF A;  4IUV A;  3A8L B;  2DIQ A;  1S72 A;  3GOX A;  3BDL A;  1YJW T;  3JCM h;  5LL6 S;  1KC8 U;  2QEX T;  1JJ2 S;  3VYH B;  4HT8 A;  2F69 A;  4M77 B;  5GAN 7;  2LT1 A;  3QO3 A;  2ZGW A;  4M78 E;  1ZBX A;  1R8O B;  3OS1 A;  4JRK A;  4OB3 B;  3CCL A;  5FRM A;  4IUR A;  2RHZ A;  4R56 A;  2P0P A;  2RJF A;  4C92 A;  3G6E T;  3JB9 F;  4E7H A;  1YIJ T;  2V8J A;  3OSS C;  4O6J A;  3OYY A;  3L42 A;  4BE1 A;  4M75 F;  5CKD A;  4QVZ A;  2K57 A;  3LWH A;  2PQW A;  1B34 A;  1IZ6 A;  1KQS A;  3JCM P;  3OYI A;  1O9S A;  2LCC A;  3OSV A;  3CC4 A;  1D3B B;  1JBM A;  2HNI A;  3VYG A;  4XK8 E;  2ZPE B;  1NJI U;  2YRV A;  3MEA A;  3OBW A;  2ZPH B;  2RHX A;  3P8H A;  4M77 G;  3V7C A;  3OYD A;  2QQB A;  3S6W A;  1I8F A;  5GAO p;  1XTD A;  3QXE B;  3V8J A;  5GAO q;  2EJ9 A;  4BB7 A;  1KQ1 A;  2DTO A;  4PJO F;  3NTK A;  5LJ3 j;  1HXD A;  1N9R A;  4M78 D;  3UT1 A;  5LJ3 g;  5A0G A;  2M9U A;  1VQP A;  3QG1 A;  4PL6 A;  1K73 C;  2EWN A;  4M78 C;  5FU6 C;  3VV0 A;  3QHS A;  2DVE A;  4M75 A;  3JCM d;  2QI2 A;  4FIB A;  2VGN A;  3OYE A;  4HCB A;  3J7A F;  3OYB A;  2LT4 A;  4OVA A;  1AHJ B;  3QKJ A;  4N4I A;  2CZ0 B;  2R57 A;  2VGM A;  4A4F A;  4GLK A;  5GAM g;  4NL3 A;  3UPU A;  2DK3 A;  1VQ6 A;  4Z02 A;  4M78 B;  5FU6 B;  2VC8 A;  4X9C A;  2EQK A;  2HQX A;  4PJO A;  2JOY A;  1YJW A;  5AYF A;  4B9W A;  4EMK A;  3GNG A;  4F7U A;  2FL7 A;  3S3M A;  2QEX A;  2K5L A;  2K2V A;  5CKH A;  3HFO A;  3M53 A;  2P4T A;  2OTL T;  4J6X A;  4V2S A;  2H3J A;  3GP8 A;  1KC8 C;  2MWO A;  2RJC A;  3CEY A;  4C8Q E;  1YJN T;  4ME7 A;  3UDC A;  5D6Y A;  4XTV A;  5GAO m;  2KAF A;  3RES A;  4JS5 A;  1Y71 A;  3MP1 A;  4C92 C;  3CC7 T;  3QII A;  1IRE B;  4IUU A;  4LD6 A;  5CKB A;  3JCM c;  3P8B B;  2FB7 A;  2LVM A;  3LGL A;  3G6E A;  3WXM B;  5FLX E;  2O4X A;  3JSC A;  3HRU A;  4GY5 A;  1UGQ B;  3CBM A;  3CPW S;  4M78 G;  1X01 A;  1WGS A;  4JDS A;  4PJO E;  4BI3 A;  3VJP A;  3TRE A;  3OYH A;  2MI6 A;  3A8H B;  2EQU A;  4RCB A;  5GMK i;  2CZ7 B;  4C92 B;  2Y4X A;  4XTW A;  4DA4 A;  3L2U A;  1UB4 A;  3NTH A;  3S3O A;  2RJE A;  2BKD N;  3R6O A;  2DZC A;  4IUP A;  5CCA A;  2PU9 B;  3A5Z B;  3HHT B;  4FM4 B;  3SD4 A;  5GAO n;  1B34 B;  4BAC A;  4MZP A;  2F5K A;  2LX9 A;  3RKW A;  4M7A F;  2ZPF B;  4C8Q D;  4RG8 A;  3JCM e;  3Q1J A;  4A4K A;  3M9Q A;  2RHY A;  3GF5 A;  4BUG A;  2JNG A;  3GPL A;  2FVU A;  3PMT A;  1YHQ T;  1G3T A;  4NOY A;  2GF7 A;  2ZPB B;  5LJ5 g;  5LJ5 j;  4LDX A;  2E41 A;  2KVQ G;  5J3B A;  2DPP B;  1KQS S;  5GAM h;  4N4G A;  2XKO C;  3BY7 A;  2K3Y A;  3JCM Q;  3CC2 T;  2X4Y A;  3M4G A;  2GFU A;  4BY6 B;  3JB9 I;  1NE8 A;  4PJO C;  4MDX A;  4L6V 5;  1WNL A;  2DD5 A;  4MZM A;  5DLQ E;  1Q82 C;  2K5I A;  4XTX A;  2RB6 A;  1YCY A;  4DOW A;  5GMK l;  2AHJ B;  2JZ2 A;  2R58 A;  3HKS A;  4BDZ A;  1Q81 U;  2K5F A;  1I5L A;  3V8K A;  1ZQ1 A;  4M77 D;  1BI1 A;  2DJZ A;  2OTL A;  2R5A A;  3J81 E;  1YJN A;  2MAM A;  1VQL T;  2P0K A;  4D6W A;  4PJO B;  1KHC A;  2VUB A;  3CC7 A;  2RJD A;  1YBY A;  3BW1 A;  4J83 A;  3RUX A;  5DM7 R;  5GAN g;  5J39 A;  4E7J A;  5GAN j;  5FRN A;  3HRS A;  3CD6 T;  4BD3 A;  3QUI A;  4JJN K;  5IT9 E;  3CCU T;  1YIT T;  3MEU A;  4XU2 A;  3CCR T;  1UEB A;  2RH2 A;  3HP9 A;  4C5H A;  1N8R U;  4RKU E;  2WSE E;  3SWN A;  5LJ3 d;  3HSB A;  3PT9 A;  1P92 A;  4MMK A;  4C8Q G;  4BE2 A;  4M7A E;  1VQ9 T;  1QVG A;  1RL2 A;  3INZ A;  3M59 A;  3TEE A;  2E10 A;  2X4W A;  1OYX A;  2ZPG B;  4EMG A;  1VQ8 T;  3L2Q A;  1VQ5 T;  3MEW A;  5IAY A;  2PUO B;  1BI0 A;  3JB9 J;  2DTH A;  3P8D A;  2QQR A;  5IN1 A;  5FU7 C;  3AHU A;  1QW1 A;  5GAM d;  3JCM V;  4OP0 A;  1H64 1;  3PMI A;  3QZ5 B;  4C0G A;  1K8A U;  2C06 A;  4J5Y A;  2DO3 A;  3BDU A;  3RMQ A;  2P0Q A;  4CRI A;  3DB3 A;  4KBM B;  5D6X A;  1Y07 A;  4R55 A;  3ASK A;  3FB9 A;  2CYZ B;  2KMT A;  1Y7X A;  4BI8 B;  1YHQ A;  4OF1 A;  4OMF B;  5LJ5 h;  2XD0 A;  3PNW C;  2ZPI B;  5FU7 B;  3UWN A;  1M1G A;  4EMH A;  3QBY A;  1WJR A;  3EFR A;  1H3Z A;  3VKI A;  4MML A;  3DB4 A;  3X25 B;  1BIB A;  4M7A C;  4C92 E;  4F7U F;  5KCH A;  1BI3 A;  3GNF B;  1QVP A;  3M55 A;  3CCV T;  1VUB A;  3JCM W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...