1R8OB

Crystal structure of an unusual kunitz-type trypsin inhibitor from copaifera langsdorffii seeds
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
71
structure length
71
Chain Sequence
WKLPSVTVGNPKVSVFGGPFKIEEGKSGYKDVYSSSKGRDLDDGIEVNKKKEKRLVVKDGNPFIIRFKKSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kunitz trypsin inhibitor
publication title Three-dimensional structure of an unusual Kunitz (STI) type trypsin inhibitor from Copaifera langsdorffii.
pubmed doi rcsb
molecule tags Hydrolase inhibitor
total genus 9
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2003-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.480 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1r8oB01
1R8OB
chains in the Genus database with same CATH superfamily
3I5SA 4JJCA 4XQ3A 4PJOG 4QT7A 1M8VA 3X24B 2RQUA 2EYWA 2F69A 2JS0A 2QG9B 4QQDA 2COWA 2LQ8A 1S72Q 6AT1B 3OYEA 2DBMA 4LN2A 2Y90A 4AT1B 4L5GA 2LVMA 3OA6A 4Z89A 5GMKj 2RD1A 3NPFA 5EC7A 1ZBJA 4C92C 2QA4Q 2LP5A 1OPLA 4XTZA 5CO7A 5DM7R 3NTIA 2LZ6B 3VS6A 1G3SA 4NS5A 4KUIA 2YUNA 3OBWA 1D1BA 2DEQA 2HD0A 4MZTA 4PNOA 4O5VA 3EG1A 3JCMW 5HK0A 2DAQA 2QGFB 3CCST 3CCLT 1VQ5T 4RTTA 2DXTA 5GAMf 2LJ3A 3QKJA 1ARKA 2MIOA 3REBB 2QTXA 2CSIA 2RHYA 1BK2A 2K2VA 2CH4A 5GANg 2EVRA 2I0NA 1U1TA 2A3LA 5DLQE 1PD1A 3META 1K8AC 4IUQA 2DRMA 3CXCP 3M57A 3H9NA 2RNAA 2R58A 8AT1B 2QAZA 1JJ2P 1MGQA 1LOJA 3L2UA 2LNHB 4JJNK 2GF7A 1KD1C 2KGTA 2X51A 2Y4XA 3G71T 1RAFB 1IREB 4M75B 3EGXA 2NUTA 5HY6A 1AWJA 1PKSA 2GFAA 2MWOA 3EH2A 3JB9G 2X4WA 1W2BS 1Q7YU 1N27A 2W10A 2G6FX 3FEOA 2CP5A 2DKGA 2OAUA 2FPFA 2QQRA 2WSCE 2HKNA 4M77D 5A0GA 3DKMA 4QQGA 3HPWA 2C0IA 4IIMA 3JB9H 1NYFA 2F2VA 1M90R 5HK3A 1VQ9Q 4IKFA 4FSXA 1N8RR 2I2LA 4A53A 3SWNB 2K3BA 2EYYA 3INZA 4PFZA 1TTHB 5AYFA 3PTAA 1VQ6T 3C4SA 3I5RA 2DNUA 2DL7A 5GJVB 2RQVA 2DRKA 2MCNA 1PG5B 4A4GA 4M7AC 1K1ZA 2K7AA 5IHKA 4C8QD 1VQ4T 2EGAA 3WVEB 1VQMT 1B07A 2O4XA 2DXBA 1UDLA 2BE9B 2MOXA 1WYXA 3J7AF 4J5YA 2RPNA 1WDXA 1IRXA 2OTLQ 3CXCA 4E6RA 2KXDA 1JJ2A 4Y28E 2XK0A 1BCOA 2CP3A 2HBPA 2GGRA 1VIFA 1IGUA 2GQIA 2J7IA 1K73C 2CT4A 3CCUT 4BY6C 3CC7T 1W70A 1N9SA 4KGVB 3A8OB 4PJOB 1I81A 2RB6A 4YTLA 2EYZA 3LWIA 5KYYA 2YUOA 4KH0B 4BI4A 2QYZA 5LJ3e 3X25B 1QMCA 1R8OB 4J9EA 1LCKA 1Y07A 2XU8A 4E7ZA 1EFNA 1Y0MA 4A4EA 3CMET 1OQKA 1NJIU 2HMAA 3VS2A 1VQ7A 4ESRA 1IO6A 2WSFE 2EGCA 4E7HA 4OMLA 1NM7A 4OB1B 2DL4A 1K9MR 1CKBA 3G6EQ 4M7DG 2O88A 1X6OA 4X9CA 1X2KA 1Y7XA 3RKWA 1SKUB 1MHNA 2G3RA 4EMKB 1VOMA 2CYZB 3CC2T 2OTJT 3DLMA 2ED0A 1GCQC 3QPHA 1G3WA 3A8HB 3MP8A 3OS5A 3AT1B 2QEXT 2L5QA 1D0YA 1PD0A 3JCMg 1NYGA 1YNZA 4M75D 2DM1A 4DEXA 5IT9E 2AIRB 4EIKA 2CH4W 4J9CA 1AD5A 3ZEHA 3TSZA 2OAWA 4PJLA 4X34A 4MMLA 1AVZC 2RN8A 1E6GA 2FRWA 5KYWB 2E41A 2VKNA 4ZN1A 2K5FA 5IN1A 3ZL7C 4QVCA 1VQ4A 4E7IA 3VS5A 2AT1B 5CR2A 3OYYA 2GQVA 2NUPA 3KUFA 1RLQC 2L3RA 2NUTB 3S3MA 2EKOA 2VXEA 3CCVT 1YITQ 3OYLA 1PNJA 2PUOB 1I4K1 1VQKQ 3CC4T 1MMDA 1VYVA 1YJNA 1KQSP 2KBTA 3OYNA 4IUVA 1GBQA 3JB9J 3M4GA 3PVQA 1VQPQ 1W4SA 2DTHA 5GAMj 1KQ2A 2BKDN 3OSSC 2E3HA 2KE9A 1OEBA 3A1PA 1BU1A 2FHDA 4KRTA 5KYXB 4PFPA 4UC4A 4IURA 2L2PA 1NBEB 1YWPA 4DOWA 5GAN5 1B3QA 1G3TA 1Q82R 2L8DA 1OU8A 1QP3A 2KQWA 2VB6A 5GAN6 2HQEA 1ZSZC 2BE7D 1HSQA 2CP6A 3S3OA 1KC8U 2D9TA 1YP5A 1OPKA 3QG1A 4XTVA 1K9MC 4J83A 3JCMP 1ZUKA 3ME9A 1MUZA 2RJDA 1M2VA 2DJZA 4ZGDB 2K3YA 4M77G 4IUUA 2B8AA 3GF5A 4M78C 1UGSB 4AG1C 2QQSA 2QEXA 2D6FA 2J06A 1KD1U 5J26A 3OW2S 2H3JA 1QQJA 2H3EB 4N0AC 4F16A 1RAEB 1Z9QA 4C92A 3UF4A 3OMGA 2ATCB 3PT9A 3PIPA 2YLCA 1BI0A 4FW2A 3CCQA 4PJOE 2CZ1B 1B34A 1RABB 2E1HA 1QWFA 4CC7A 4J6XA 1YIJA 1KQSA 1QVFS 4IUPA 4Y92A 3G4SQ 2CDTA 4M7DB 2ZPIB 5CKFA 4C8QG 1DJ7B 2DL5A 1X75C 2DE0X 1Q7YC 2F2WA 1G8XA 2FO0A 3GNFB 2L0AA 1S72A 2LNVA 1K0SA 2C0TA 3QJYA 3HSBA 2JJ9A 1RL2A 5FW9A 3Q1JA 3CCVA 3ULRB 4PJJA 2QA4A 1U5SA 3F70A 2PZ1A 2DPPB 4DBHA 1PM3A 3JV3A 2J6KA 3UA6A 2XDDA 2IVWA 3QIIA 5A0LA 1H3ZA 3FDRA 4HCZA 2KROA 3JB9D 3WVDB 2YUPA 1EIFA 2ZAEA 2LCLA 3RMQA 1XNIA 1SRLA 4KT0E 2DETA 4MZMA 1FMVA 1C6VX 4ANJA 3JCMV 2HSPA 5GANd 4XK8E 1W2BP 3M55A 4HVVA 1SSFA 4HT8A 1EZZB 4MZPA 4WF2A 4WTOB 2KYMA 4Z02A 1M4ZA 3PNWC 1NZ9A 2ZCFB 4OMNA 3EG0A 4II1A 1WXBA 4J9BA 3CCMQ 2HDAA 2MPXC 1VQOQ 2V26A 5GAMg 2DTOA 4E2FB 1M8MA 4KGZB 4OMMA 3THKA 1ZUYA 2ESWA 3CQTA 4Q5WA 4DBRA 5HKCA 2RH2A 4OP0A 5DY9A 3CCJQ 1UFFA 5ECAA 1BIBA 5CAIA 2EQIA 1UEBA 4GLKA 5CQXA 1RLPC 4N4IA 4J8OA 1HYOA 4M7AA 1D0XA 4M75G 2DBKA 4M78E 1LVKA 3RNJA 2JMCA 2EBPA 3PE0A 3X26B 3E9GA 3P8HA 1HXDA 3UT1A 1QKWA 1UTIA 3VYGA 3E9FA 1VQ9A 3EG9A 1ZLMA 4LE9A 2OJ2A 1MMGA 2EQMA 1ZBXA 1LNXA 1M1KR 4JUVA 2O2OA 3BW1A 3CCEQ 1BI2A 4M77B 4C0FA 5GAOl 4CI0C 2R5AA 3EG3A 3EGDA 1TOVA 1M90U 1RAAB 5FU6C 3VU3C 2FZKB 3C94A 2LJ0A 1W2BA 3JCMb 1N8RU 2FYKA 4JLGA 2MF2A 2DXUA 4DBFA 4ZNXA 2FZGB 3E19A 4C0GA 2DJQA 1M2VB 4M78F 2A28A 2ENMA 1WHHA 3I9QA 1U3OA 2KVQG 3VV0A 3L2QA 2OTLA 2KRSA 1UUEA 4OB3B 1IB8A 2A7YA 4C0DC 2HKQB 1RI9A 4D8DA 4HVWA 1WHJA 3DB4A 2P0PA 5FRMA 4C92B 1QLYA 4HT9A 1GFDA 4N4GA 3UWNA 2EJGA 3JCMX 1GCQA 1NE8A 4BB7A 1XTDA 2FZCB 4PFOA 3VUZA 1B34B 4J9HA 2GCXA 3RDVA 1YJWQ 5CKEA 1YI2Q 2JZ2A 1I8FA 2MI6A 4M7DE 3QBYA 3OYBA 2SRCA 4KGXB 4C5GA 5J39A 2X9HA 3JCMc 4XTWA 1N6AA 4EMGA 1PHTA 2E10A 2F5TX 3EFSA 1M27C 3CD6Q 2AZSA 2DYIA 3OS1A 2VV5A 3OSVA 4C5EA 1A0NB 2JM9A 4OMOA 5KYUA 2F5KA 1IGQA 2PVGB 1SEMA 1WFWA 4ZN3A 1K9MU 5GMKh 1KIKA 1QCOA 2VGNA 4CC2A 3GOXA 2CS7A 4J9IA 2VXFA 2HAXA 4ZTJA 3I35A 1KC8C 2M0YA 1M1FA 5CKHA 3RUXA 3RIRA 4RCCA 1MMAA 2CREA 3NHNA 3URGA 4DOVA 2RI3A 2JTFA 5I22A 3EH1A 5FWCA 3LWHA 1M1KC 1ZX6A 2KYBA 3EG2A 1VQ7T 5GJWB 1YJ9T 4F04B 5D6XA 2EJFA 3JCMJ 2YLBA 1Y96A 4R0KA 4E7SA 1Q81R 1SF9A 4BDYA 1G83A 3NGPA 2HQHA 3OS0A 2RK1A 4LUEA 3HRUA 2XDBA 4EPCA 2DIQA 4J9DA 4ME7A 1QP2A 3KXTA 1T3LA 2DERA 5DLOA 2EJ9A 1YHQQ 2XKOC 4OVAA 3M9QA 3X28B 3VJPA 4RG8A 1VQKA 3OYHA 1ZSZA 4E7LA 4KULA 1XOVA 2EGEA 2D8JA 4M7AB 2DLPA 3CPWA 1G5VA 4HA8A 4MDXA 3JCMh 1VQPA 4JS5A 2LX7A 2O01E 2CKKA 1JRIA 1BYMA 1TXQA 1WJSA 2RHXA 4JRIA 1FMWA 2QXFA 4PKCC 4XU1A 2DF6A 3H6ZA 2YDLA 5GAOq 3EG9B 2DL8A 3RBBB 3CCRQ 3FJ5A 3RMSA 3TSWA 3OYFA 3RR6A 1RAGB 2EYXA 3I56Q 4FCYA 4BY6B 4N0AA 2K57A 1TSFA 2CT3A 3FJPA 1N9RA 2VUBA 4OGEA 3UDCA 3EGDB 3HRTA 1I1JA 4C92D 3L1AA 4M77E 4M4ZA 3JB9I 1VQLQ 4F7UA 3I55Q 4F17A 3QYHB 5HCKA 2PTKA 5IXBA 2KEAA 1Q82U 2LTOA 1RAIB 5LJ3f 3VS3A 3M53A 2K3XA 3SEMA 2KNBB 2RI2A 5GAN4 4LD6A 2J6OA 2X4YA 1YJNT 2KR3A 2EW3A 1IZ6A 2XD0A 2RM4A 3GLXA 2P4RA 1U06A 2ZPBB 5LJ5j 3MEAA 4XTYA 2DD4A 2L3PA 5FLXE 2BZYA 2CZ0B 5KCOA 2O31A 2QGGA 2AKKA 4C8QE 1E7OA 4JS4A 1D3BA 4M77F 3MP6A 2B86A 5J3BA 3SWNC 3G4SA 2FB7A 1AT1B 1WQWA 4FU6A 2RI5A 5LJ5h 2FG0A 1YJ9A 3RKYA 1HJDA 3LW5E 2RF0A 1I5OB 4RTZA 3CCET 2H8HA 2L3QA 4LNPA 1SHGA 3UATA 2X3WD 2LCSA 2LDMA 3LGFA 1P92A 4KBMB 5KH6A 3VKIA 3MO8A 1M3AA 2DMOA 2COYA 3EGUA 4P5NA 2J6FA 1K9AA 1XQHA 3OW2A 3M58A 4FYWB 4A54A 3OQ5A 3FIFA 2QQ9A 3CBOA 4RKUE 2JVVA 4X9DA 4C8QF 4DEYA 1ACMB 1VQ8Q 3ZFJA 3CMAQ 2EIFA 1WPYA 2JTEA 1JBMA 3NTKA 4PJOC 3TU4K 1QVFA 4BE2A 2PNIA 2A37A 2E3IA 3CPWS 3TVTA 1VQNT 1M90C 3CCQT 1UB4A 1N8RC 1TS9A 5GANf 2ZPGB 3LGLA 1YIJT 2C0OA 2PU9B 4FYYB 2CSQA 1O75A 1MV3A 4LDVA 2VYTA 2ABLA 2FEIA 4M7AD 2GNCA 1Q86R 2RA2A 1JXOA 3QO3A 3CCMA 1Y96B 1VQOA 4AG2C 3OY9A 3OYGA 1S72T 2DVJA 5GAOm 5GANe 1W1FA 4BDZA 3EGXB 1ZA1B 3S6WA 4EMKC 4QVDA 4BI8B 2JTMA 4PJNA 3V8JA 3CCJA 2QA4T 4M75E 3M4YA 1M5Q1 2XICA 3M0PA 1UE9A 2KAFA 4C5HA 2Z0WA 2YRVA 2JS2A 4HCKA 2LCCA 4HCBA 5C0MA 1K4US 2XHCA 1K76A 4BACA 4KUDK 3QHSA 1WJQA 2KMTA 2DVEA 1MV0B 5A2QE 5GAMh 2YRDA 2ROTA 4OMPA 1NEGA 4HVUA 4ORZA 1EX4A 1KJWA 4PJMA 2LQWA 2RMOA 3CCEA 2ZPEB 3LYIA 3TQ7P 4M75F 2MAMA 1I0CA 2DA9A 1WI7A 2L89A 5LJ5g 1TUGB 2DTIA 4OMFB 2VASA 3OBYA 2O4XB 2LT4A 2YRCA 1KQ1A 1WXUA 2LX9A 1M1KU 3MJXA 3O8VA 2K79A 2DZ9A 2FVUA 1UGRB 3M5AA 2EAYA 2ZPHB 4LDWA 1WHKA 2RQWA 4AFQC 3MP1A 5AT1B 1SRMA 1VIEA 3VRZA 5KYYB 1SHFA 2BIVA 1VQNA 3PGGA 3QJ6A 3EAEA 4NL3A 4OMQA 2LC4A 3DB3A 3EHQA 1AZGB 3CCSQ 2E5KA 1VQ9T 2LT1A 1PCXA 5IXFA 3CCLQ 4NL2A 1VQ5Q 1OX8A 4RTVA 2YWWA 2F2XA 4C92G 1YI2A 2QASA 4PLLA 5FU7C 1YBYA 3EFOA 5GMKe 1QW1A 3NFCA 1RACB 4GY5A 3PVLA 2KK4A 1NPPA 4Z8AA 1QVPA 3HTRA 5KCHA 4JJBA 2KY9A 5LJ3j 5GAN8 1FX7A 3CD6A 3BY7A 1W6XA 1JXMA 1TUCA 2CP2A 2F1LA 3G71Q 2OTLT 4C5IA 4PJOF 3H0HA 1PRMC 1ABOA 1FWZA 1BIAA 2PVOB 4JPBW 5LJ3h 5LL6S 4HKEA 1TU0B 1F1BB 1R77A 2E65A 1IHVA 3LH0A 2WACA 2DO3A 1QCNA 4E7JA 3C95A 4B9WA 3J81E 2FPDA 4LDUA 4M7DC 2IPOB 2YUQA 3H41A 2P0KA 2QQAA 3EHRA 1Q82C 2ROLA 4AFSC 4QKUA 1QVGS 1YCYA 3GP8A 1I07A 2X4XA 3JCMe 1M3CA 1TWBA 3HP9A 2RO0A 2SEMA 4FIBA 2NUPB 1OULA 3G7ZA 3G6ET 4ATOA 1BKBA 1V76A 1VQ6Q 4MDWA 1OU9A 3TREA 3IQLA 5CQYA 3H0FA 2LRQA 4OF1A 1VQ4Q 1OOTA 1VQMQ 1JQQA 4R56A 5L8RE 1Q81U 5EG2A 5I2MA 3V8KA 2E4HA 1PKTA 3VS1A 5CVIA 1YWOA 2OX7A 1LJOA 2A36A 3QUIA 1YCSB 2KXCA 3X20B 3MEWA 1TG0A 5A0DA 5CIUA 3OS2A 1Q95G 4M7AG 4C0DB 3CCUQ 3JSCA 1BCMA 3MCAB 3CC7Q 3JB9F 5GAOn 3CCRA 2NWMA 2DILA 4BE1A 2DD5A 5I2SA 3QXEB 3BDLA 3QZ5B 3T9NA 4JRQA 4JZ3A 3CMEQ 1ZHIA 1VQLA 2D0QB 2NUZA 3SWNA 1QKXA 1K8AR 4QW2A 3TCJA 4BUGA 1V29B 1YITT 1VQKT 2YT6A 1VUBA 3AHUA 5KE2A 1FYNA 1H641 1UG1A 1AZEA 2COZA 3CC2Q 2OTJQ 1VQPT 4LDXA 2QDYB 2M16A 3V7SA 5GAN2 4Y91A 5LJ3g 2J05A 4D8KA 2QEXQ 4EMHA 1O9SA 1WHLA 3ZBDA 2HQXA 2E64A 2V1RA 1R0CB 1Y57A 1BBZA 1X69A 1OZ3A 2RQRA 2RK2A 3TEEA 4PJOA 4M77C 4FYVB 2PUKB 1BI3A 1ZA2B 4L59A 3EFRA 3JAME 4ZTFA 3R6NA 5D7UA 1XJWB 3CPWP 1NEBA 3G6EA 3SFMA 3M0SA 7AT1B 1WNLA 2DYBA 1CKAA 1OYXA 2LQKA 2X35A 1D09B 3OYAA 3LX7A 3QSUA 2VVKA 3BFMA 1WHGA 2DXCA 2EKHA 2HSEB 4ZGJB 1D1AA 3JRZA 1VQ8A 2A0FB 2LQNA 3CMAA 1J3TA 4F14A 3P8BB 4XU3A 3CCVQ 1OX9A 3O5ZA 3H0IA 4OB0B 3JCMd 4JLIA 3CC4Q 4C8QC 1HD3A 2O9VA 3LLRA 3ER0A 4EMKA 3OYDA 4M7DF 2DIGA 3CEYA 4HCCA 2R57A 1PSFA 3QYGB 1WX6A 3JCMQ 4RG2A 1X6GA 1IXDA 1K73R 2HNIA 3PMTA 2CP0A 3G4ST 1G3YA 1YN8A 2K5IA 4RTWA 1H3HA 3CBPA 4DA4A 2MYSA 2E6NA 4OGCA 4Z88A 2BZXA 2QTVA 4N4HA 3L2ZA 1TH7A 3NMZC 3N5BB 5KYNA 1WLPB 1AWWA 4VUBA 2VWFA 4RTYA 1AOJA 2D0NA 1YITA 1MNEA 1RUWA 1VA7A 2V8JA 5KYWA 1U1SA 1Q86U 5GAMe 4AMCA 2HBWA 5GMKl 1GRIA 4J7IA 3FRNA 1WZOA 3RKXA 1BB9A 3BDUA 3KBGA 2GTOA 4M78A 2PQWA 1UGPB 1VYUA 1M30A 5D6WA 2LJ1A 3OW2P 2V8KA 4FT4A 5LJ5d 2WSEE 4JRPA 1M1GA 2K6DA 2YXYA 4LUDA 3CPFA 4M78G 1I5LA 3CCMT 4KH1B 1VQOT 4PK4A 5M9OA 2P0QA 1ZUUA 2XI9A 3C0CA 2EFIA 4M75C 5KYXA 2JMAA 1KHIA 1N5ZA 4RTUA 1SG5A 3L2RA 1QVFP 2EQKA 1GFCA 1UJYA 2HL5C 3NTHA 2RHZA 3GBQA 4XTXA 2JNGA 3CCJT 1X43A 2DEUA 5D6YA 8ATCB 5KE3A 4X1VA 3WXMB 2CZ6B 4J6WA 4FM4B 4F7UG 1ZSGA 4QVZA 3OYIA 3SB2A 2EQJA 4RUGA 2QQBA 3A8LB 1X01A 2RHIA 2JXBA 2GTJA 3DLLA 5C6SA 4B9XA 1WIEA 4C92E 3D7SB 1U8RA 1RI0A 1WJRA 2M0OA 2YHTA 1PSEA 2CP7A 2AK5A 3M0UA 2JUFA 2MWPA 4BI3A 3CCSA 3V7RA 1VQ5A 3CCLA 3R6OA 1H92A 2KSSA 1T0JA 1PWTA 2V8IA 2HCKA 4LD9K 4CC4B 4NOYA 3HHTB 1X2QA 5GAOp 1Q81C 4OB2B 4XU0A 4AFUC 2BZ8A 4M7DA 1QWEA 2DX1A 3QWYA 1WXTA 2LMJA 4B6MA 5KYUB 4RTXA 4A63B 3L42A 1QVGP 4BD3A 2X3XD 4C92F 4RMOA 3G71A 2D1XA 3MHXA 1OV3A 5CKBA 4J9GA 4JDSA 4FSSA 1HK9A 4A4KA 1CSKA 4TVRA 4A4HA 1GXIE 2FPEA 2NYSA 4DBQA 2GBQA 2DZCA 1C0MA 5FRNA 4E47A 2QK0A 5GAMd 1YJWT 1YI2T 3FB9A 1KHCA 3QZ9B 3HFOA 2EWNA 2ED1A 1FXXA 2JW4A 4C0ZA 1X6BA 1MMNA 2JM8A 4XTUA 3HFNA 3VS4A 1VQ6A 1H8KA 2O9SA 1Q7YR 3CD6T 1ZSZB 3QWXX 1WA7A 2KI7A 1YFNA 3M59A 1VQMA 1C1AA 4WCIA 4K11A 2XG8D 3FC3A 2QDLA 1Y71A 1UHFA 2W0ZA 5GAN7 1E6HA 4M7AE 2EQUA 1D0ZA 4J9FA 2CUBA 4IIOA 3HRSA 1KFZA 2IG0A 1RAHB 4M78B 1QVGA 1SSHA 4D6WA 2BTTA 3CCUA 3CC7A 3ASKA 2DFUA 3CXCS 4HXJA 2OI3A 3VS0A 2A08A 1JJ2S 1AWXA 1NPRA 2M51A 3U23A 3M56A 1VYTA 5IAYA 1GCPA 4JZ4A 4QQ6A 3G1JA 4F7UB 3CMEA 1AWOA 1KSWA 1PRLC 2M1HA 1OZ2A 3H8ZA 4JJDA 4M7AF 2RQTA 1X27A 2D8HA 2MMPA 3M0RA 1GL5A 1AEYA 1YHQT 4FW1A 5FU7B 4M77A 2PVDB 2CGHA 3MPUB 4ZGEB 5GMKi 4XU2A 4GLMA 2E70A 4PJOD 1M9SA 2EYQA 5LJ3d 2E12A 3SD4A 2VC8A 3CC2A 2OTJA 2L3SA 1K8AU 4E7KA 3J80E 1UECA 1D3BB 1NJIR 1M3BA 3VS7A 3BE3A 3A8GB 3MKDA 4DQ2A 2K4YA 3CCRT 3FLGA 2R5MA 1YJWA 1LPLA 4PLIA 2BUDA 4C8QA 3S3NA 3I56T 3OYJA 1Q86C 2JOYA 1T3SA 3E2UA 3VYHB 3OYMA 3PIOA 4L6V5 1NG2A 1VQ7Q 1YJ9Q 2CZ7B 2XIDA 3GIBA 1VQLT 2E5QA 3UA7A 3I55T 5I21A 4J7FA 4ELYC 4ELZC 2RJFA 2DL3A 4XAXB 1WQ7A 3E1SA 3RERA 2VGMA 5IHNA 2GFUA 5CK9A 5FROA 1FMKA 5GMKm 3CC4A 3MEVA 1GBRA 3JCMf 1MNDA 5IH2A 5IHIA 5GAN3 2ZZDA 2IIMA 4J6YA 4RCBA 3PFSA 1WGSA 1RADB 1AHJB 2RHUA 1R0BG 2NLUA 3LH5A 3OB9A 2RJCA 3SHWA 2HEQA 5CKDA 2K5LA 1PC0A 2AHJB 4FL6A 1T0HA 2YSQA 2MK5A 2KT8A 4CC3A 1JO8A 3HL8A 2K9GA 2AZVA 4IUTA 1K73U 1SPKA 4M78D 1YHQA 3OYKA 2ZGWA 4MMKA 4FYXB 1M2OA 2JT4A 3KFVA 1WHMA 5FU6B 3VRYA 1VQ8T 2FL7A 4M75A 3CMAT 5GAOr 2KRMA 3A5ZB 4PL6A 2KRNA 3OYCA 1UHCA 5GANj 3PMIA 3A8MB 1YJNQ 1NLOC 2M02A 2K2MA 1NJIC 1KG1A 1BI1A 1JEGA 2ECZA 3GNGA 3I56A 1KK7A 4GBQA 5GANh 1KC8R 5CCAA 3C12A 5LJ5f 2QI2A 3L2VA 3A98A 2KDSA 1Z9ZA 4O6JA 3I55A 2AKLA 2HL3A 2DK3A 2ZPFB 3SDZA 1IHWA 5I11A 2HZYA 2P4TA 2V1QA 4FT2A 4F7UE 4V2SA 3QDFA 1D1CA 1KQSS 3RESA 1UGVA 5LJ5e 1KD1R 3OMCA 3VUBA 4CRIA 1B7TA 2Y4YA 4R55A 5FWBA 4BE0A 4EDUA 3V8LA 1ZQ1A 2XDPA 3GPLA 3UPUA 3M54A 2C06A 1ABQA 1K0XA 1JU5C 3M0QA 4A4FA 1S1NA 4M7DD 2JN0A 3P8DA 1V1CA 1UGQB 3CBMA 3L2WA 3MEUA 3HKSA 3REAB 1OI1A 1TUDA 2M9UA 2XMFA 5L23A 2P84A 1UJ0A 4LDYA 4C8QB 2KT1A 3M0TA 3EFOB 1VQNQ 4LXCA 4F7UF 2X4JA 1JB0E 4AFZC 1G2BA 3CCQQ 2RJEA 2E6ZA 1YIJQ 3QDRB 3V7CA 1QCFA 9ATCB 1NLPC 2EPDA 4JRKA 2CUDA 2FRYA
chains in the Genus database with same CATH topology
5D6YA 4XK8E 4HCBA 4XQ3A 5C0MA 4PJOG 5KE3A 3M55A 1M8VA 1SSFA 3WXMB 2CZ6B 4J6WA 3X24B 4HT8A 4MZPA 4FM4B 4F7UG 2F69A 4QVZA 3OYIA 4WF2A 3SB2A 4QQDA 2EQJA 2LQ8A 2XHCA 2QQBA 3A8LB 4Z02A 1M4ZA 1X01A 3PNWC 3OYEA 4BACA 3QHSA 4KUDK 2RHIA 1WJQA 1NZ9A 2ZCFB 2Y90A 4L5GA 4II1A 2KMTA 2LVMA 3OA6A 5GMKj 3DLLA 2DVEA 2RD1A 5C6SA 4B9XA 5A2QE 5GAMh 5GAMg 4C92E 2DTOA 4C92C 1U8RA 1RI0A 1WJRA 2M0OA 2YHTA 1PSEA 4XTZA 5CO7A 5DM7R 3CCEA 2JUFA 2ZPEB 3LYIA 3NTIA 2MWPA 1G3SA 4BI3A 3CCSA 4NS5A 4M75F 2MAMA 4Q5WA 3V7RA 4KUIA 1VQ5A 5HKCA 2RH2A 3R6OA 3CCLA 2KSSA 2L89A 2V8IA 3OBWA 5LJ5g 2DTIA 4OP0A 2DEQA 5DY9A 4LD9K 4OMFB 2HD0A 1BIBA 3OBYA 4MZTA 4PNOA 4O5VA 5CAIA 3JCMW 4NOYA 5HK0A 1UEBA 2DAQA 2O4XB 2LT4A 3HHTB 4GLKA 5GAOp 3CCST 1KQ1A 5CQXA 4N4IA 4J8OA 3CCLT 1VQ5T 1Q81C 2LX9A 4OB2B 4XU0A 1M1KU 3O8VA 3CCMT 4M7AA 2DXTA 4M75G 5GAMf 4M7DA 4M78E 2DZ9A 3QKJA 2FVUA 1UGRB 3M5AA 2QTXA 2EAYA 2ZPHB 3X26B 4LDWA 2RHYA 2K2VA 5GANg 3E9GA 3L42A 1U1TA 2A3LA 3P8HA 5DLQE 1HXDA 3UT1A 3MP1A 4BD3A 3VYGA 3E9FA 3META 4C92F 4RMOA 1VQ9A 3G71A 1K8AC 1VIEA 3MHXA 4IUQA 5CKBA 3M57A 2BIVA 1VQNA 3PGGA 3QJ6A 3EAEA 2R58A 2EQMA 1ZBXA 4JDSA 1LNXA 4NL3A 1HK9A 2LC4A 1MGQA 1LOJA 4JUVA 3DB3A 3L2UA 3BW1A 4JJNK 1BI2A 2GF7A 4A4KA 1KD1C 1VQ9T 2Y4XA 2LT1A 3G71T 4M77B 4C0FA 4NL2A 4TVRA 5GAOl 4CI0C 1IREB 2R5AA 4M75B 4A4HA 1GXIE 5HY6A 4C92G 1M90U 5FU6C 3VU3C 1YI2A 4PLLA 3C94A 5FU7C 1YBYA 2GFAA 2MWOA 1W2BA 3JCMb 1N8RU 3JB9G 5GMKe 1QW1A 2DZCA 2FYKA 2X4WA 1W2BS 3NFCA 2MF2A 2DXUA 4JLGA 1Q7YU 5FRNA 1N27A 4E47A 3E19A 4GY5A 4C0GA 3FEOA 5GAMd 4M78F 2KK4A 2DKGA 1YJWT 2OAUA 1NPPA 1QVPA 1YI2T 5KCHA 2QQRA 2KY9A 2WSCE 2KVQG 3VV0A 4M77D 5LJ3j 3L2QA 2OTLA 3FB9A 1KHCA 3QZ9B 3HFOA 4OB3B 2EWNA 3DKMA 4QQGA 2A7YA 3HPWA 1FX7A 4C0DC 5A0GA 5GAN8 3BY7A 3CD6A 3JB9H 1FXXA 4C0ZA 3DB4A 4XTUA 2P0PA 5FRMA 3HFNA 5HK3A 1VQ6A 2OTLT 4IKFA 4FSXA 4PJOF 4C5IA 4C92B 3CD6T 2PVOB 1FWZA 1BIAA 4HT9A 5LJ3h 2I2LA 5LL6S 4N4GA 4A53A 4HKEA 3SWNB 3UWNA 2EJGA 3M59A 3JCMX 1NE8A 4BB7A 1XTDA 3VUZA 3INZA 1B34B 5AYFA 3PTAA 1VQMA 1VQ6T 2E65A 3C4SA 2GCXA 2XG8D 3LH0A 2WACA 3FC3A 2DO3A 1Y71A 3C95A 5GAN7 4E7JA 5CKEA 4A4GA 4B9WA 4M7AE 4M7AC 3J81E 2JZ2A 1I8FA 2MI6A 4LDUA 1H3ZA 4M7DE 4C8QD 1VQ4T 4M7DC 3QBYA 3WVEB 2EQUA 3OYBA 1VQMT 3HRSA 2O4XA 2P0KA 2QQAA 4C5GA 2IG0A 5J39A 2DXBA 1Q82C 4M78B 3JCMc 1QVGA 4D6WA 4XTWA 1N6AA 4EMGA 2E10A 2F5TX 3J7AF 1QVGS 1YCYA 3EFSA 4J5YA 3GP8A 3CCUA 2X4XA 3CC7A 3ASKA 3CXCA 3JCMe 3HP9A 2RO0A 3CXCS 1VQOT 4FIBA 1JJ2A 4Y28E 3OS1A 2VV5A 2XK0A 3OSVA 2HBPA 4C5EA 1JJ2S 1VIFA 2F5KA 3G7ZA 3G6ET 4ATOA 1BKBA 1NPRA 3CCUT 1K73C 4BY6C 2PVGB 3M56A 3CC7T 1N9SA 4MDWA 3A8OB 4ZN3A 5IAYA 4PJOB 1I81A 4QQ6A 1K9MU 2RB6A 5GMKh 4YTLA 4F7UB 3TREA 3LWIA 3CMEA 5CQYA 4BI4A 5LJ3e 2VGNA 3X25B 2LRQA 1R8OB 2M1HA 1OZ2A 4OF1A 3GOXA 3H8ZA 1Y07A 4R56A 2CS7A 5L8RE 1Q81U 4M7AF 5EG2A 2MMPA 5I2MA 2VXFA 1YHQT 2XU8A 2HAXA 5FU7B 3V8KA 4ZTJA 4M77A 1KC8C 4A4EA 1M1FA 2PVDB 3CMET 5CVIA 2CGHA 4ZGEB 1NJIU 5GMKi 5CKHA 3RUXA 1VQ7A 4XU2A 3RIRA 1LJOA 2E70A 4RCCA 4PJOD 3QUIA 2WSFE 4E7HA 3URGA 1M9SA 4DOVA 2RI3A 3X20B 3MEWA 2EYQA 2JTFA 4OB1B 5LJ3d 2E12A 5A0DA 5CIUA 3SD4A 2VC8A 3LWHA 1M1KC 3OS2A 3CC2A 4M7AG 2OTJA 4C0DB 1VQ7T 1K8AU 3JSCA 1YJ9T 3MCAB 5D6XA 3J80E 4E7KA 2EJFA 5GAOn 3CCRA 2YLBA 3JCMJ 3JB9F 4M7DG 1X6OA 4BE1A 1Y96A 4X9CA 1Y7XA 3RKWA 1MHNA 4BDYA 3OS0A 2G3RA 2RK1A 4EMKB 3HRUA 2XDBA 1D3BB 2CYZB 4EPCA 3CC2T 2OTJT 3DLMA 2DD5A 2DIQA 3QXEB 5I2SA 4ME7A 3A8GB 1QP2A 2K4YA 3QPHA 3FLGA 4DQ2A 3BDLA 2R5MA 3QZ5B 3T9NA 3KXTA 3CCRT 5DLOA 4JRQA 2EJ9A 1YJWA 2XKOC 4OVAA 3M9QA 4PLIA 1G3WA 2BUDA 3A8HB 3MP8A 3X28B 4C8QA 3S3NA 3OS5A 3I56T 2QEXT 3VJPA 3OYJA 2L5QA 4RG8A 1Q86C 3OYHA 1VQKA 1ZHIA 2JOYA 1VQLA 2D0QB 4E7LA 3SWNA 4KULA 1XOVA 3VYHB 3OYMA 4QW2A 4M7AB 3TCJA 3PIOA 3CPWA 1G5VA 4L6V5 4HA8A 4BUGA 1V29B 3JCMh 3JCMg 4MDXA 1YITT 4M75D 1VQPA 4JS5A 1VQKT 2CZ7B 2XIDA 2O01E 5IT9E 2E5QA 1VQLT 3I55T 3GIBA 2CKKA 5I21A 1JRIA 1BYMA 1WJSA 1VUBA 4J7FA 3AHUA 2RHXA 4JRIA 4ELYC 5KE2A 2QXFA 1H641 3ZEHA 2RJFA 4ELZC 4PKCC 4XU1A 4XAXB 3H6ZA 1WQ7A 3E1SA 5GAOq 1VQPT 3RERA 2VGMA 4LDXA 4X34A 2QDYB 4MMLA 2M16A 3V7SA 2GFUA 5GAN2 3RMSA 3OYFA 4Y91A 5CK9A 5LJ3g 2E41A 5FROA 5GMKm 4ZN1A 2K5FA 5IN1A 4EMHA 4QVCA 1O9SA 4BY6B 1VQ4A 4N0AA 4E7IA 3CC4A 3ZBDA 5CR2A 2HQXA 2K57A 3MEVA 2E64A 3OYYA 3FJPA 3JCMf 5GAN3 2GQVA 2ZZDA 1N9RA 3KUFA 2VUBA 4OGEA 2L3RA 1OZ3A 3UDCA 4J6YA 3S3MA 4RCBA 3HRTA 2EKOA 2VXEA 3PFSA 4C92D 2RK2A 3L1AA 3CCVT 1WGSA 3TEEA 3OYLA 4M77E 4M77C 2PUOB 3JB9I 4PJOA 1I4K1 3CC4T 2PUKB 1AHJB 2RHUA 4F7UA 1BI3A 2NLUA 3OB9A 4L59A 3EFRA 3QYHB 2RJCA 3JAME 4ZTFA 5CKDA 2K5LA 1YJNA 3OYNA 2LTOA 2AHJB 1Q82U 4IUVA 3G6EA 5LJ3f 3M53A 2K3XA 4FL6A 3SFMA 2XDDA 3M4GA 3JB9J 1W4SA 2DTHA 2RI2A 5GAN4 5GAMj 4LD6A 2X4YA 1YJNT 1WNLA 1KQ2A 1IZ6A 3HL8A 2BKDN 3OSSC 2XD0A 1OYXA 2X35A 2LQKA 2RM4A 3OYAA 3GLXA 3LX7A 4IUTA 3QSUA 1K73U 2ZPBB 5LJ5j 3BFMA 4M78D 1YHQA 2FHDA 2ZGWA 3MEAA 2DXCA 4MMKA 3OYKA 4ZGJB 3JRZA 4XTYA 1VQ8A 2DD4A 4UC4A 4IURA 3CMAA 5FLXE 3P8BB 2CZ0B 4XU3A 4DOWA 5KCOA 5GAN5 4OB0B 1G3TA 3JCMd 2L8DA 4JLIA 4C8QE 4C8QC 1QP3A 2KQWA 3LLRA 5GAN6 2HQEA 3ER0A 5FU6B 4JS4A 4EMKA 3OYDA 1D3BA 4M77F 3MP6A 4M7DF 5J3BA 3SWNC 1VQ8T 2FL7A 2FB7A 1WQWA 4M75A 3G4SA 3S3OA 2DIGA 4FU6A 1KC8U 3CMAT 5GAOr 3CEYA 2D9TA 2RI5A 3A5ZB 4PL6A 3QG1A 2R57A 4XTVA 5LJ5h 1YJ9A 1K9MC 4HCCA 1PSFA 3QYGB 3RKYA 3LW5E 4J83A 3OYCA 3ME9A 3JCMP 3JCMQ 4RG2A 5GANj 3PMIA 3CCET 2HNIA 3A8MB 3PMTA 2RJDA 3G4ST 2DJZA 1G3YA 2LDMA 3LGFA 4ZGDB 1P92A 2K3YA 2K5IA 4KBMB 4M77G 5KH6A 4IUUA 1NJIC 2B8AA 3VKIA 1KG1A 3MO8A 1BI1A 3CBPA 4DA4A 3GF5A 4M78C 1UGSB 2E6NA 4OGCA 4P5NA 2QQSA 3GNGA 3I56A 2QEXA 2D6FA 1XQHA 4N4HA 3M58A 3L2ZA 3OW2A 4A54A 1KD1U 3OQ5A 5J26A 5GANh 3OW2S 3FIFA 1TH7A 2H3JA 3N5BB 5CCAA 3C12A 4N0AC 5LJ5f 2QQ9A 3CBOA 4RKUE 4VUBA 2JVVA 2QI2A 4C92A 4X9DA 4C8QF 3OMGA 3ZFJA 1YITA 3PT9A 3PIPA 2YLCA 3L2VA 2EIFA 1BI0A 2KDSA 4O6JA 2V8JA 1WPYA 1U1SA 3I55A 1JBMA 1Q86U 3CCQA 2ZPFB 2DK3A 3NTKA 3SDZA 5GAMe 2CZ1B 4PJOC 4PJOE 5GMKl 2P4TA 3TU4K 1QVFA 1B34A 2E1HA 4FT2A 4F7UE 4BE2A 4J6XA 4V2SA 1YIJA 1KQSA 1QVFS 4J7IA 4IUPA 4M7DB 1KQSS 3CPWS 3RESA 1VQNT 3FRNA 1M90C 2ZPIB 5CKFA 1UB4A 4C8QG 5LJ5e 3CCQT 1N8RC 1DJ7B 3OMCA 5GANf 1X75C 3RKXA 1Q7YC 3BDUA 3VUBA 2ZPGB 4CRIA 3LGLA 1YIJT 2PU9B 2Y4YA 4R55A 4BE0A 3GNFB 1O75A 4EDUA 3KBGA 3V8LA 2LNVA 1S72A 1ZQ1A 2XDPA 4LDVA 3GPLA 2VYTA 2PQWA 4M78A 3UPUA 3QJYA 3M54A 2C06A 3HSBA 1UGPB 4M7AD 1RL2A 5D6WA 2RA2A 4A4FA 4M7DD 3Q1JA 3QO3A 2JN0A 1Y96B 3P8DA 3CCVA 3CCMA 1VQOA 3OY9A 2V8KA 4FT4A 2QA4A 3OYGA 1UGQB 1S72T 3CBMA 5LJ5d 3L2WA 2WSEE 5GAOm 1M1GA 4JRPA 5GANe 3F70A 4BDZA 3MEUA 3CPFA 3HKSA 2DPPB 4M78G 1I5LA 3S6WA 1OI1A 2IVWA 2M9UA 2JTMA 3QIIA 4BI8B 4EMKC 4LDYA 4QVDA 3V8JA 4C8QB 5A0LA 5M9OA 2P0QA 3FDRA 2XI9A 4HCZA 3CCJA 2EFIA 4M75E 4M75C 4F7UF 3M4YA 1KHIA 1JB0E 1M5Q1 2X4JA 3JB9D 3WVDB 1EIFA 3L2RA 2XICA 2RJEA 2E6ZA 2EQKA 2LCLA 3RMQA 3NTHA 1XNIA 2KAFA 4KT0E 4C5HA 3QDRB 3V7CA 2RHZA 4MZMA 2QA4T 4XTXA 2YRVA 2JNGA 3JCMV 3CCJT 5GANd 4JRKA 2LCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R8O B; 
#chains in the Genus database with same CATH topology
 3I5S A;  4JJC A;  4XQ3 A;  4PJO G;  4QT7 A;  1M8V A;  3X24 B;  2RQU A;  2EYW A;  2F69 A;  2JS0 A;  2QG9 B;  4QQD A;  2COW A;  2LQ8 A;  1S72 Q;  6AT1 B;  3OYE A;  2DBM A;  4LN2 A;  2Y90 A;  4AT1 B;  4L5G A;  2LVM A;  3OA6 A;  4Z89 A;  5GMK j;  2RD1 A;  3NPF A;  5EC7 A;  1ZBJ A;  4C92 C;  2QA4 Q;  2LP5 A;  1OPL A;  4XTZ A;  5CO7 A;  5DM7 R;  3NTI A;  2LZ6 B;  3VS6 A;  1G3S A;  4NS5 A;  4KUI A;  2YUN A;  3OBW A;  1D1B A;  2DEQ A;  2HD0 A;  4MZT A;  4PNO A;  4O5V A;  3EG1 A;  3JCM W;  5HK0 A;  2DAQ A;  2QGF B;  3CCS T;  3CCL T;  1VQ5 T;  4RTT A;  2DXT A;  5GAM f;  2LJ3 A;  3QKJ A;  1ARK A;  2MIO A;  3REB B;  2QTX A;  2CSI A;  2RHY A;  1BK2 A;  2K2V A;  2CH4 A;  5GAN g;  2EVR A;  2I0N A;  1U1T A;  2A3L A;  5DLQ E;  1PD1 A;  3MET A;  1K8A C;  4IUQ A;  2DRM A;  3CXC P;  3M57 A;  3H9N A;  2RNA A;  2R58 A;  8AT1 B;  2QAZ A;  1JJ2 P;  1MGQ A;  1LOJ A;  3L2U A;  2LNH B;  4JJN K;  2GF7 A;  1KD1 C;  2KGT A;  2X51 A;  2Y4X A;  3G71 T;  1RAF B;  1IRE B;  4M75 B;  3EGX A;  2NUT A;  5HY6 A;  1AWJ A;  1PKS A;  2GFA A;  2MWO A;  3EH2 A;  3JB9 G;  2X4W A;  1W2B S;  1Q7Y U;  1N27 A;  2W10 A;  2G6F X;  3FEO A;  2CP5 A;  2DKG A;  2OAU A;  2FPF A;  2QQR A;  2WSC E;  2HKN A;  4M77 D;  5A0G A;  3DKM A;  4QQG A;  3HPW A;  2C0I A;  4IIM A;  3JB9 H;  1NYF A;  2F2V A;  1M90 R;  5HK3 A;  1VQ9 Q;  4IKF A;  4FSX A;  1N8R R;  2I2L A;  4A53 A;  3SWN B;  2K3B A;  2EYY A;  3INZ A;  4PFZ A;  1TTH B;  5AYF A;  3PTA A;  1VQ6 T;  3C4S A;  3I5R A;  2DNU A;  2DL7 A;  5GJV B;  2RQV A;  2DRK A;  2MCN A;  1PG5 B;  4A4G A;  4M7A C;  1K1Z A;  2K7A A;  5IHK A;  4C8Q D;  1VQ4 T;  2EGA A;  3WVE B;  1VQM T;  1B07 A;  2O4X A;  2DXB A;  1UDL A;  2BE9 B;  2MOX A;  1WYX A;  3J7A F;  4J5Y A;  2RPN A;  1WDX A;  1IRX A;  2OTL Q;  3CXC A;  4E6R A;  2KXD A;  1JJ2 A;  4Y28 E;  2XK0 A;  1BCO A;  2CP3 A;  2HBP A;  2GGR A;  1VIF A;  1IGU A;  2GQI A;  2J7I A;  1K73 C;  2CT4 A;  3CCU T;  4BY6 C;  3CC7 T;  1W70 A;  1N9S A;  4KGV B;  3A8O B;  4PJO B;  1I81 A;  2RB6 A;  4YTL A;  2EYZ A;  3LWI A;  5KYY A;  2YUO A;  4KH0 B;  4BI4 A;  2QYZ A;  5LJ3 e;  3X25 B;  1QMC A;  1R8O B;  4J9E A;  1LCK A;  1Y07 A;  2XU8 A;  4E7Z A;  1EFN A;  1Y0M A;  4A4E A;  3CME T;  1OQK A;  1NJI U;  2HMA A;  3VS2 A;  1VQ7 A;  4ESR A;  1IO6 A;  2WSF E;  2EGC A;  4E7H A;  4OML A;  1NM7 A;  4OB1 B;  2DL4 A;  1K9M R;  1CKB A;  3G6E Q;  4M7D G;  2O88 A;  1X6O A;  4X9C A;  1X2K A;  1Y7X A;  3RKW A;  1SKU B;  1MHN A;  2G3R A;  4EMK B;  1VOM A;  2CYZ B;  3CC2 T;  2OTJ T;  3DLM A;  2ED0 A;  1GCQ C;  3QPH A;  1G3W A;  3A8H B;  3MP8 A;  3OS5 A;  3AT1 B;  2QEX T;  2L5Q A;  1D0Y A;  1PD0 A;  3JCM g;  1NYG A;  1YNZ A;  4M75 D;  2DM1 A;  4DEX A;  5IT9 E;  2AIR B;  4EIK A;  2CH4 W;  4J9C A;  1AD5 A;  3ZEH A;  3TSZ A;  2OAW A;  4PJL A;  4X34 A;  4MML A;  1AVZ C;  2RN8 A;  1E6G A;  2FRW A;  5KYW B;  2E41 A;  2VKN A;  4ZN1 A;  2K5F A;  5IN1 A;  3ZL7 C;  4QVC A;  1VQ4 A;  4E7I A;  3VS5 A;  2AT1 B;  5CR2 A;  3OYY A;  2GQV A;  2NUP A;  3KUF A;  1RLQ C;  2L3R A;  2NUT B;  3S3M A;  2EKO A;  2VXE A;  3CCV T;  1YIT Q;  3OYL A;  1PNJ A;  2PUO B;  1I4K 1;  1VQK Q;  3CC4 T;  1MMD A;  1VYV A;  1YJN A;  1KQS P;  2KBT A;  3OYN A;  4IUV A;  1GBQ A;  3JB9 J;  3M4G A;  3PVQ A;  1VQP Q;  1W4S A;  2DTH A;  5GAM j;  1KQ2 A;  2BKD N;  3OSS C;  2E3H A;  2KE9 A;  1OEB A;  3A1P A;  1BU1 A;  2FHD A;  4KRT A;  5KYX B;  4PFP A;  4UC4 A;  4IUR A;  2L2P A;  1NBE B;  1YWP A;  4DOW A;  5GAN 5;  1B3Q A;  1G3T A;  1Q82 R;  2L8D A;  1OU8 A;  1QP3 A;  2KQW A;  2VB6 A;  5GAN 6;  2HQE A;  1ZSZ C;  2BE7 D;  1HSQ A;  2CP6 A;  3S3O A;  1KC8 U;  2D9T A;  1YP5 A;  1OPK A;  3QG1 A;  4XTV A;  1K9M C;  4J83 A;  3JCM P;  1ZUK A;  3ME9 A;  1MUZ A;  2RJD A;  1M2V A;  2DJZ A;  4ZGD B;  2K3Y A;  4M77 G;  4IUU A;  2B8A A;  3GF5 A;  4M78 C;  1UGS B;  4AG1 C;  2QQS A;  2QEX A;  2D6F A;  2J06 A;  1KD1 U;  5J26 A;  3OW2 S;  2H3J A;  1QQJ A;  2H3E B;  4N0A C;  4F16 A;  1RAE B;  1Z9Q A;  4C92 A;  3UF4 A;  3OMG A;  2ATC B;  3PT9 A;  3PIP A;  2YLC A;  1BI0 A;  4FW2 A;  3CCQ A;  4PJO E;  2CZ1 B;  1B34 A;  1RAB B;  2E1H A;  1QWF A;  4CC7 A;  4J6X A;  1YIJ A;  1KQS A;  1QVF S;  4IUP A;  4Y92 A;  3G4S Q;  2CDT A;  4M7D B;  2ZPI B;  5CKF A;  4C8Q G;  1DJ7 B;  2DL5 A;  1X75 C;  2DE0 X;  1Q7Y C;  2F2W A;  1G8X A;  2FO0 A;  3GNF B;  2L0A A;  1S72 A;  2LNV A;  1K0S A;  2C0T A;  3QJY A;  3HSB A;  2JJ9 A;  1RL2 A;  5FW9 A;  3Q1J A;  3CCV A;  3ULR B;  4PJJ A;  2QA4 A;  1U5S A;  3F70 A;  2PZ1 A;  2DPP B;  4DBH A;  1PM3 A;  3JV3 A;  2J6K A;  3UA6 A;  2XDD A;  2IVW A;  3QII A;  5A0L A;  1H3Z A;  3FDR A;  4HCZ A;  2KRO A;  3JB9 D;  3WVD B;  2YUP A;  1EIF A;  2ZAE A;  2LCL A;  3RMQ A;  1XNI A;  1SRL A;  4KT0 E;  2DET A;  4MZM A;  1FMV A;  1C6V X;  4ANJ A;  3JCM V;  2HSP A;  5GAN d;  4XK8 E;  1W2B P;  3M55 A;  4HVV A;  1SSF A;  4HT8 A;  1EZZ B;  4MZP A;  4WF2 A;  4WTO B;  2KYM A;  4Z02 A;  1M4Z A;  3PNW C;  1NZ9 A;  2ZCF B;  4OMN A;  3EG0 A;  4II1 A;  1WXB A;  4J9B A;  3CCM Q;  2HDA A;  2MPX C;  1VQO Q;  2V26 A;  5GAM g;  2DTO A;  4E2F B;  1M8M A;  4KGZ B;  4OMM A;  3THK A;  1ZUY A;  2ESW A;  3CQT A;  4Q5W A;  4DBR A;  5HKC A;  2RH2 A;  4OP0 A;  5DY9 A;  3CCJ Q;  1UFF A;  5ECA A;  1BIB A;  5CAI A;  2EQI A;  1UEB A;  4GLK A;  5CQX A;  1RLP C;  4N4I A;  4J8O A;  1HYO A;  4M7A A;  1D0X A;  4M75 G;  2DBK A;  4M78 E;  1LVK A;  3RNJ A;  2JMC A;  2EBP A;  3PE0 A;  3X26 B;  3E9G A;  3P8H A;  1HXD A;  3UT1 A;  1QKW A;  1UTI A;  3VYG A;  3E9F A;  1VQ9 A;  3EG9 A;  1ZLM A;  4LE9 A;  2OJ2 A;  1MMG A;  2EQM A;  1ZBX A;  1LNX A;  1M1K R;  4JUV A;  2O2O A;  3BW1 A;  3CCE Q;  1BI2 A;  4M77 B;  4C0F A;  5GAO l;  4CI0 C;  2R5A A;  3EG3 A;  3EGD A;  1TOV A;  1M90 U;  1RAA B;  5FU6 C;  3VU3 C;  2FZK B;  3C94 A;  2LJ0 A;  1W2B A;  3JCM b;  1N8R U;  2FYK A;  4JLG A;  2MF2 A;  2DXU A;  4DBF A;  4ZNX A;  2FZG B;  3E19 A;  4C0G A;  2DJQ A;  1M2V B;  4M78 F;  2A28 A;  2ENM A;  1WHH A;  3I9Q A;  1U3O A;  2KVQ G;  3VV0 A;  3L2Q A;  2OTL A;  2KRS A;  1UUE A;  4OB3 B;  1IB8 A;  2A7Y A;  4C0D C;  2HKQ B;  1RI9 A;  4D8D A;  4HVW A;  1WHJ A;  3DB4 A;  2P0P A;  5FRM A;  4C92 B;  1QLY A;  4HT9 A;  1GFD A;  4N4G A;  3UWN A;  2EJG A;  3JCM X;  1GCQ A;  1NE8 A;  4BB7 A;  1XTD A;  2FZC B;  4PFO A;  3VUZ A;  1B34 B;  4J9H A;  2GCX A;  3RDV A;  1YJW Q;  5CKE A;  1YI2 Q;  2JZ2 A;  1I8F A;  2MI6 A;  4M7D E;  3QBY A;  3OYB A;  2SRC A;  4KGX B;  4C5G A;  5J39 A;  2X9H A;  3JCM c;  4XTW A;  1N6A A;  4EMG A;  1PHT A;  2E10 A;  2F5T X;  3EFS A;  1M27 C;  3CD6 Q;  2AZS A;  2DYI A;  3OS1 A;  2VV5 A;  3OSV A;  4C5E A;  1A0N B;  2JM9 A;  4OMO A;  5KYU A;  2F5K A;  1IGQ A;  2PVG B;  1SEM A;  1WFW A;  4ZN3 A;  1K9M U;  5GMK h;  1KIK A;  1QCO A;  2VGN A;  4CC2 A;  3GOX A;  2CS7 A;  4J9I A;  2VXF A;  2HAX A;  4ZTJ A;  3I35 A;  1KC8 C;  2M0Y A;  1M1F A;  5CKH A;  3RUX A;  3RIR A;  4RCC A;  1MMA A;  2CRE A;  3NHN A;  3URG A;  4DOV A;  2RI3 A;  2JTF A;  5I22 A;  3EH1 A;  5FWC A;  3LWH A;  1M1K C;  1ZX6 A;  2KYB A;  3EG2 A;  1VQ7 T;  5GJW B;  1YJ9 T;  4F04 B;  5D6X A;  2EJF A;  3JCM J;  2YLB A;  1Y96 A;  4R0K A;  4E7S A;  1Q81 R;  1SF9 A;  4BDY A;  1G83 A;  3NGP A;  2HQH A;  3OS0 A;  2RK1 A;  4LUE A;  3HRU A;  2XDB A;  4EPC A;  2DIQ A;  4J9D A;  4ME7 A;  1QP2 A;  3KXT A;  1T3L A;  2DER A;  5DLO A;  2EJ9 A;  1YHQ Q;  2XKO C;  4OVA A;  3M9Q A;  3X28 B;  3VJP A;  4RG8 A;  1VQK A;  3OYH A;  1ZSZ A;  4E7L A;  4KUL A;  1XOV A;  2EGE A;  2D8J A;  4M7A B;  2DLP A;  3CPW A;  1G5V A;  4HA8 A;  4MDX A;  3JCM h;  1VQP A;  4JS5 A;  2LX7 A;  2O01 E;  2CKK A;  1JRI A;  1BYM A;  1TXQ A;  1WJS A;  2RHX A;  4JRI A;  1FMW A;  2QXF A;  4PKC C;  4XU1 A;  2DF6 A;  3H6Z A;  2YDL A;  5GAO q;  3EG9 B;  2DL8 A;  3RBB B;  3CCR Q;  3FJ5 A;  3RMS A;  3TSW A;  3OYF A;  3RR6 A;  1RAG B;  2EYX A;  3I56 Q;  4FCY A;  4BY6 B;  4N0A A;  2K57 A;  1TSF A;  2CT3 A;  3FJP A;  1N9R A;  2VUB A;  4OGE A;  3UDC A;  3EGD B;  3HRT A;  1I1J A;  4C92 D;  3L1A A;  4M77 E;  4M4Z A;  3JB9 I;  1VQL Q;  4F7U A;  3I55 Q;  4F17 A;  3QYH B;  5HCK A;  2PTK A;  5IXB A;  2KEA A;  1Q82 U;  2LTO A;  1RAI B;  5LJ3 f;  3VS3 A;  3M53 A;  2K3X A;  3SEM A;  2KNB B;  2RI2 A;  5GAN 4;  4LD6 A;  2J6O A;  2X4Y A;  1YJN T;  2KR3 A;  2EW3 A;  1IZ6 A;  2XD0 A;  2RM4 A;  3GLX A;  2P4R A;  1U06 A;  2ZPB B;  5LJ5 j;  3MEA A;  4XTY A;  2DD4 A;  2L3P A;  5FLX E;  2BZY A;  2CZ0 B;  5KCO A;  2O31 A;  2QGG A;  2AKK A;  4C8Q E;  1E7O A;  4JS4 A;  1D3B A;  4M77 F;  3MP6 A;  2B86 A;  5J3B A;  3SWN C;  3G4S A;  2FB7 A;  1AT1 B;  1WQW A;  4FU6 A;  2RI5 A;  5LJ5 h;  2FG0 A;  1YJ9 A;  3RKY A;  1HJD A;  3LW5 E;  2RF0 A;  1I5O B;  4RTZ A;  3CCE T;  2H8H A;  2L3Q A;  4LNP A;  1SHG A;  3UAT A;  2X3W D;  2LCS A;  2LDM A;  3LGF A;  1P92 A;  4KBM B;  5KH6 A;  3VKI A;  3MO8 A;  1M3A A;  2DMO A;  2COY A;  3EGU A;  4P5N A;  2J6F A;  1K9A A;  1XQH A;  3OW2 A;  3M58 A;  4FYW B;  4A54 A;  3OQ5 A;  3FIF A;  2QQ9 A;  3CBO A;  4RKU E;  2JVV A;  4X9D A;  4C8Q F;  4DEY A;  1ACM B;  1VQ8 Q;  3ZFJ A;  3CMA Q;  2EIF A;  1WPY A;  2JTE A;  1JBM A;  3NTK A;  4PJO C;  3TU4 K;  1QVF A;  4BE2 A;  2PNI A;  2A37 A;  2E3I A;  3CPW S;  3TVT A;  1VQN T;  1M90 C;  3CCQ T;  1UB4 A;  1N8R C;  1TS9 A;  5GAN f;  2ZPG B;  3LGL A;  1YIJ T;  2C0O A;  2PU9 B;  4FYY B;  2CSQ A;  1O75 A;  1MV3 A;  4LDV A;  2VYT A;  2ABL A;  2FEI A;  4M7A D;  2GNC A;  1Q86 R;  2RA2 A;  1JXO A;  3QO3 A;  3CCM A;  1Y96 B;  1VQO A;  4AG2 C;  3OY9 A;  3OYG A;  1S72 T;  2DVJ A;  5GAO m;  5GAN e;  1W1F A;  4BDZ A;  3EGX B;  1ZA1 B;  3S6W A;  4EMK C;  4QVD A;  4BI8 B;  2JTM A;  4PJN A;  3V8J A;  3CCJ A;  2QA4 T;  4M75 E;  3M4Y A;  1M5Q 1;  2XIC A;  3M0P A;  1UE9 A;  2KAF A;  4C5H A;  2Z0W A;  2YRV A;  2JS2 A;  4HCK A;  2LCC A;  4HCB A;  5C0M A;  1K4U S;  2XHC A;  1K76 A;  4BAC A;  4KUD K;  3QHS A;  1WJQ A;  2KMT A;  2DVE A;  1MV0 B;  5A2Q E;  5GAM h;  2YRD A;  2ROT A;  4OMP A;  1NEG A;  4HVU A;  4ORZ A;  1EX4 A;  1KJW A;  4PJM A;  2LQW A;  2RMO A;  3CCE A;  2ZPE B;  3LYI A;  3TQ7 P;  4M75 F;  2MAM A;  1I0C A;  2DA9 A;  1WI7 A;  2L89 A;  5LJ5 g;  1TUG B;  2DTI A;  4OMF B;  2VAS A;  3OBY A;  2O4X B;  2LT4 A;  2YRC A;  1KQ1 A;  1WXU A;  2LX9 A;  1M1K U;  3MJX A;  3O8V A;  2K79 A;  2DZ9 A;  2FVU A;  1UGR B;  3M5A A;  2EAY A;  2ZPH B;  4LDW A;  1WHK A;  2RQW A;  4AFQ C;  3MP1 A;  5AT1 B;  1SRM A;  1VIE A;  3VRZ A;  5KYY B;  1SHF A;  2BIV A;  1VQN A;  3PGG A;  3QJ6 A;  3EAE A;  4NL3 A;  4OMQ A;  2LC4 A;  3DB3 A;  3EHQ A;  1AZG B;  3CCS Q;  2E5K A;  1VQ9 T;  2LT1 A;  1PCX A;  5IXF A;  3CCL Q;  4NL2 A;  1VQ5 Q;  1OX8 A;  4RTV A;  2YWW A;  2F2X A;  4C92 G;  1YI2 A;  2QAS A;  4PLL A;  5FU7 C;  1YBY A;  3EFO A;  5GMK e;  1QW1 A;  3NFC A;  1RAC B;  4GY5 A;  3PVL A;  2KK4 A;  1NPP A;  4Z8A A;  1QVP A;  3HTR A;  5KCH A;  4JJB A;  2KY9 A;  5LJ3 j;  5GAN 8;  1FX7 A;  3CD6 A;  3BY7 A;  1W6X A;  1JXM A;  1TUC A;  2CP2 A;  2F1L A;  3G71 Q;  2OTL T;  4C5I A;  4PJO F;  3H0H A;  1PRM C;  1ABO A;  1FWZ A;  1BIA A;  2PVO B;  4JPB W;  5LJ3 h;  5LL6 S;  4HKE A;  1TU0 B;  1F1B B;  1R77 A;  2E65 A;  1IHV A;  3LH0 A;  2WAC A;  2DO3 A;  1QCN A;  4E7J A;  3C95 A;  4B9W A;  3J81 E;  2FPD A;  4LDU A;  4M7D C;  2IPO B;  2YUQ A;  3H41 A;  2P0K A;  2QQA A;  3EHR A;  1Q82 C;  2ROL A;  4AFS C;  4QKU A;  1QVG S;  1YCY A;  3GP8 A;  1I07 A;  2X4X A;  3JCM e;  1M3C A;  1TWB A;  3HP9 A;  2RO0 A;  2SEM A;  4FIB A;  2NUP B;  1OUL A;  3G7Z A;  3G6E T;  4ATO A;  1BKB A;  1V76 A;  1VQ6 Q;  4MDW A;  1OU9 A;  3TRE A;  3IQL A;  5CQY A;  3H0F A;  2LRQ A;  4OF1 A;  1VQ4 Q;  1OOT A;  1VQM Q;  1JQQ A;  4R56 A;  5L8R E;  1Q81 U;  5EG2 A;  5I2M A;  3V8K A;  2E4H A;  1PKT A;  3VS1 A;  5CVI A;  1YWO A;  2OX7 A;  1LJO A;  2A36 A;  3QUI A;  1YCS B;  2KXC A;  3X20 B;  3MEW A;  1TG0 A;  5A0D A;  5CIU A;  3OS2 A;  1Q95 G;  4M7A G;  4C0D B;  3CCU Q;  3JSC A;  1BCM A;  3MCA B;  3CC7 Q;  3JB9 F;  5GAO n;  3CCR A;  2NWM A;  2DIL A;  4BE1 A;  2DD5 A;  5I2S A;  3QXE B;  3BDL A;  3QZ5 B;  3T9N A;  4JRQ A;  4JZ3 A;  3CME Q;  1ZHI A;  1VQL A;  2D0Q B;  2NUZ A;  3SWN A;  1QKX A;  1K8A R;  4QW2 A;  3TCJ A;  4BUG A;  1V29 B;  1YIT T;  1VQK T;  2YT6 A;  1VUB A;  3AHU A;  5KE2 A;  1FYN A;  1H64 1;  1UG1 A;  1AZE A;  2COZ A;  3CC2 Q;  2OTJ Q;  1VQP T;  4LDX A;  2QDY B;  2M16 A;  3V7S A;  5GAN 2;  4Y91 A;  5LJ3 g;  2J05 A;  4D8K A;  2QEX Q;  4EMH A;  1O9S A;  1WHL A;  3ZBD A;  2HQX A;  2E64 A;  2V1R A;  1R0C B;  1Y57 A;  1BBZ A;  1X69 A;  1OZ3 A;  2RQR A;  2RK2 A;  3TEE A;  4PJO A;  4M77 C;  4FYV B;  2PUK B;  1BI3 A;  1ZA2 B;  4L59 A;  3EFR A;  3JAM E;  4ZTF A;  3R6N A;  5D7U A;  1XJW B;  3CPW P;  1NEB A;  3G6E A;  3SFM A;  3M0S A;  7AT1 B;  1WNL A;  2DYB A;  1CKA A;  1OYX A;  2LQK A;  2X35 A;  1D09 B;  3OYA A;  3LX7 A;  3QSU A;  2VVK A;  3BFM A;  1WHG A;  2DXC A;  2EKH A;  2HSE B;  4ZGJ B;  1D1A A;  3JRZ A;  1VQ8 A;  2A0F B;  2LQN A;  3CMA A;  1J3T A;  4F14 A;  3P8B B;  4XU3 A;  3CCV Q;  1OX9 A;  3O5Z A;  3H0I A;  4OB0 B;  3JCM d;  4JLI A;  3CC4 Q;  4C8Q C;  1HD3 A;  2O9V A;  3LLR A;  3ER0 A;  4EMK A;  3OYD A;  4M7D F;  2DIG A;  3CEY A;  4HCC A;  2R57 A;  1PSF A;  3QYG B;  1WX6 A;  3JCM Q;  4RG2 A;  1X6G A;  1IXD A;  1K73 R;  2HNI A;  3PMT A;  2CP0 A;  3G4S T;  1G3Y A;  1YN8 A;  2K5I A;  4RTW A;  1H3H A;  3CBP A;  4DA4 A;  2MYS A;  2E6N A;  4OGC A;  4Z88 A;  2BZX A;  2QTV A;  4N4H A;  3L2Z A;  1TH7 A;  3NMZ C;  3N5B B;  5KYN A;  1WLP B;  1AWW A;  4VUB A;  2VWF A;  4RTY A;  1AOJ A;  2D0N A;  1YIT A;  1MNE A;  1RUW A;  1VA7 A;  2V8J A;  5KYW A;  1U1S A;  1Q86 U;  5GAM e;  4AMC A;  2HBW A;  5GMK l;  1GRI A;  4J7I A;  3FRN A;  1WZO A;  3RKX A;  1BB9 A;  3BDU A;  3KBG A;  2GTO A;  4M78 A;  2PQW A;  1UGP B;  1VYU A;  1M30 A;  5D6W A;  2LJ1 A;  3OW2 P;  2V8K A;  4FT4 A;  5LJ5 d;  2WSE E;  4JRP A;  1M1G A;  2K6D A;  2YXY A;  4LUD A;  3CPF A;  4M78 G;  1I5L A;  3CCM T;  4KH1 B;  1VQO T;  4PK4 A;  5M9O A;  2P0Q A;  1ZUU A;  2XI9 A;  3C0C A;  2EFI A;  4M75 C;  5KYX A;  2JMA A;  1KHI A;  1N5Z A;  4RTU A;  1SG5 A;  3L2R A;  1QVF P;  2EQK A;  1GFC A;  1UJY A;  2HL5 C;  3NTH A;  2RHZ A;  3GBQ A;  4XTX A;  2JNG A;  3CCJ T;  1X43 A;  2DEU A;  5D6Y A;  8ATC B;  5KE3 A;  4X1V A;  3WXM B;  2CZ6 B;  4J6W A;  4FM4 B;  4F7U G;  1ZSG A;  4QVZ A;  3OYI A;  3SB2 A;  2EQJ A;  4RUG A;  2QQB A;  3A8L B;  1X01 A;  2RHI A;  2JXB A;  2GTJ A;  3DLL A;  5C6S A;  4B9X A;  1WIE A;  4C92 E;  3D7S B;  1U8R A;  1RI0 A;  1WJR A;  2M0O A;  2YHT A;  1PSE A;  2CP7 A;  2AK5 A;  3M0U A;  2JUF A;  2MWP A;  4BI3 A;  3CCS A;  3V7R A;  1VQ5 A;  3CCL A;  3R6O A;  1H92 A;  2KSS A;  1T0J A;  1PWT A;  2V8I A;  2HCK A;  4LD9 K;  4CC4 B;  4NOY A;  3HHT B;  1X2Q A;  5GAO p;  1Q81 C;  4OB2 B;  4XU0 A;  4AFU C;  2BZ8 A;  4M7D A;  1QWE A;  2DX1 A;  3QWY A;  1WXT A;  2LMJ A;  4B6M A;  5KYU B;  4RTX A;  4A63 B;  3L42 A;  1QVG P;  4BD3 A;  2X3X D;  4C92 F;  4RMO A;  3G71 A;  2D1X A;  3MHX A;  1OV3 A;  5CKB A;  4J9G A;  4JDS A;  4FSS A;  1HK9 A;  4A4K A;  1CSK A;  4TVR A;  4A4H A;  1GXI E;  2FPE A;  2NYS A;  4DBQ A;  2GBQ A;  2DZC A;  1C0M A;  5FRN A;  4E47 A;  2QK0 A;  5GAM d;  1YJW T;  1YI2 T;  3FB9 A;  1KHC A;  3QZ9 B;  3HFO A;  2EWN A;  2ED1 A;  1FXX A;  2JW4 A;  4C0Z A;  1X6B A;  1MMN A;  2JM8 A;  4XTU A;  3HFN A;  3VS4 A;  1VQ6 A;  1H8K A;  2O9S A;  1Q7Y R;  3CD6 T;  1ZSZ B;  3QWX X;  1WA7 A;  2KI7 A;  1YFN A;  3M59 A;  1VQM A;  1C1A A;  4WCI A;  4K11 A;  2XG8 D;  3FC3 A;  2QDL A;  1Y71 A;  1UHF A;  2W0Z A;  5GAN 7;  1E6H A;  4M7A E;  2EQU A;  1D0Z A;  4J9F A;  2CUB A;  4IIO A;  3HRS A;  1KFZ A;  2IG0 A;  1RAH B;  4M78 B;  1QVG A;  1SSH A;  4D6W A;  2BTT A;  3CCU A;  3CC7 A;  3ASK A;  2DFU A;  3CXC S;  4HXJ A;  2OI3 A;  3VS0 A;  2A08 A;  1JJ2 S;  1AWX A;  1NPR A;  2M51 A;  3U23 A;  3M56 A;  1VYT A;  5IAY A;  1GCP A;  4JZ4 A;  4QQ6 A;  3G1J A;  4F7U B;  3CME A;  1AWO A;  1KSW A;  1PRL C;  2M1H A;  1OZ2 A;  3H8Z A;  4JJD A;  4M7A F;  2RQT A;  1X27 A;  2D8H A;  2MMP A;  3M0R A;  1GL5 A;  1AEY A;  1YHQ T;  4FW1 A;  5FU7 B;  4M77 A;  2PVD B;  2CGH A;  3MPU B;  4ZGE B;  5GMK i;  4XU2 A;  4GLM A;  2E70 A;  4PJO D;  1M9S A;  2EYQ A;  5LJ3 d;  2E12 A;  3SD4 A;  2VC8 A;  3CC2 A;  2OTJ A;  2L3S A;  1K8A U;  4E7K A;  3J80 E;  1UEC A;  1D3B B;  1NJI R;  1M3B A;  3VS7 A;  3BE3 A;  3A8G B;  3MKD A;  4DQ2 A;  2K4Y A;  3CCR T;  3FLG A;  2R5M A;  1YJW A;  1LPL A;  4PLI A;  2BUD A;  4C8Q A;  3S3N A;  3I56 T;  3OYJ A;  1Q86 C;  2JOY A;  1T3S A;  3E2U A;  3VYH B;  3OYM A;  3PIO A;  4L6V 5;  1NG2 A;  1VQ7 Q;  1YJ9 Q;  2CZ7 B;  2XID A;  3GIB A;  1VQL T;  2E5Q A;  3UA7 A;  3I55 T;  5I21 A;  4J7F A;  4ELY C;  4ELZ C;  2RJF A;  2DL3 A;  4XAX B;  1WQ7 A;  3E1S A;  3RER A;  2VGM A;  5IHN A;  2GFU A;  5CK9 A;  5FRO A;  1FMK A;  5GMK m;  3CC4 A;  3MEV A;  1GBR A;  3JCM f;  1MND A;  5IH2 A;  5IHI A;  5GAN 3;  2ZZD A;  2IIM A;  4J6Y A;  4RCB A;  3PFS A;  1WGS A;  1RAD B;  1AHJ B;  2RHU A;  1R0B G;  2NLU A;  3LH5 A;  3OB9 A;  2RJC A;  3SHW A;  2HEQ A;  5CKD A;  2K5L A;  1PC0 A;  2AHJ B;  4FL6 A;  1T0H A;  2YSQ A;  2MK5 A;  2KT8 A;  4CC3 A;  1JO8 A;  3HL8 A;  2K9G A;  2AZV A;  4IUT A;  1K73 U;  1SPK A;  4M78 D;  1YHQ A;  3OYK A;  2ZGW A;  4MMK A;  4FYX B;  1M2O A;  2JT4 A;  3KFV A;  1WHM A;  5FU6 B;  3VRY A;  1VQ8 T;  2FL7 A;  4M75 A;  3CMA T;  5GAO r;  2KRM A;  3A5Z B;  4PL6 A;  2KRN A;  3OYC A;  1UHC A;  5GAN j;  3PMI A;  3A8M B;  1YJN Q;  1NLO C;  2M02 A;  2K2M A;  1NJI C;  1KG1 A;  1BI1 A;  1JEG A;  2ECZ A;  3GNG A;  3I56 A;  1KK7 A;  4GBQ A;  5GAN h;  1KC8 R;  5CCA A;  3C12 A;  5LJ5 f;  2QI2 A;  3L2V A;  3A98 A;  2KDS A;  1Z9Z A;  4O6J A;  3I55 A;  2AKL A;  2HL3 A;  2DK3 A;  2ZPF B;  3SDZ A;  1IHW A;  5I11 A;  2HZY A;  2P4T A;  2V1Q A;  4FT2 A;  4F7U E;  4V2S A;  3QDF A;  1D1C A;  1KQS S;  3RES A;  1UGV A;  5LJ5 e;  1KD1 R;  3OMC A;  3VUB A;  4CRI A;  1B7T A;  2Y4Y A;  4R55 A;  5FWB A;  4BE0 A;  4EDU A;  3V8L A;  1ZQ1 A;  2XDP A;  3GPL A;  3UPU A;  3M54 A;  2C06 A;  1ABQ A;  1K0X A;  1JU5 C;  3M0Q A;  4A4F A;  1S1N A;  4M7D D;  2JN0 A;  3P8D A;  1V1C A;  1UGQ B;  3CBM A;  3L2W A;  3MEU A;  3HKS A;  3REA B;  1OI1 A;  1TUD A;  2M9U A;  2XMF A;  5L23 A;  2P84 A;  1UJ0 A;  4LDY A;  4C8Q B;  2KT1 A;  3M0T A;  3EFO B;  1VQN Q;  4LXC A;  4F7U F;  2X4J A;  1JB0 E;  4AFZ C;  1G2B A;  3CCQ Q;  2RJE A;  2E6Z A;  1YIJ Q;  3QDR B;  3V7C A;  1QCF A;  9ATC B;  1NLP C;  2EPD A;  4JRK A;  2CUD A;  2FRY A; 
#chains in the Genus database with same CATH homology
 5D6Y A;  4XK8 E;  4HCB A;  4XQ3 A;  5C0M A;  4PJO G;  5KE3 A;  3M55 A;  1M8V A;  1SSF A;  3WXM B;  2CZ6 B;  4J6W A;  3X24 B;  4HT8 A;  4MZP A;  4FM4 B;  4F7U G;  2F69 A;  4QVZ A;  3OYI A;  4WF2 A;  3SB2 A;  4QQD A;  2EQJ A;  2LQ8 A;  2XHC A;  2QQB A;  3A8L B;  4Z02 A;  1M4Z A;  1X01 A;  3PNW C;  3OYE A;  4BAC A;  3QHS A;  4KUD K;  2RHI A;  1WJQ A;  1NZ9 A;  2ZCF B;  2Y90 A;  4L5G A;  4II1 A;  2KMT A;  2LVM A;  3OA6 A;  5GMK j;  3DLL A;  2DVE A;  2RD1 A;  5C6S A;  4B9X A;  5A2Q E;  5GAM h;  5GAM g;  4C92 E;  2DTO A;  4C92 C;  1U8R A;  1RI0 A;  1WJR A;  2M0O A;  2YHT A;  1PSE A;  4XTZ A;  5CO7 A;  5DM7 R;  3CCE A;  2JUF A;  2ZPE B;  3LYI A;  3NTI A;  2MWP A;  1G3S A;  4BI3 A;  3CCS A;  4NS5 A;  4M75 F;  2MAM A;  4Q5W A;  3V7R A;  4KUI A;  1VQ5 A;  5HKC A;  2RH2 A;  3R6O A;  3CCL A;  2KSS A;  2L89 A;  2V8I A;  3OBW A;  5LJ5 g;  2DTI A;  4OP0 A;  2DEQ A;  5DY9 A;  4LD9 K;  4OMF B;  2HD0 A;  1BIB A;  3OBY A;  4MZT A;  4PNO A;  4O5V A;  5CAI A;  3JCM W;  4NOY A;  5HK0 A;  1UEB A;  2DAQ A;  2O4X B;  2LT4 A;  3HHT B;  4GLK A;  5GAO p;  3CCS T;  1KQ1 A;  5CQX A;  4N4I A;  4J8O A;  3CCL T;  1VQ5 T;  1Q81 C;  2LX9 A;  4OB2 B;  4XU0 A;  1M1K U;  3O8V A;  3CCM T;  4M7A A;  2DXT A;  4M75 G;  5GAM f;  4M7D A;  4M78 E;  2DZ9 A;  3QKJ A;  2FVU A;  1UGR B;  3M5A A;  2QTX A;  2EAY A;  2ZPH B;  3X26 B;  4LDW A;  2RHY A;  2K2V A;  5GAN g;  3E9G A;  3L42 A;  1U1T A;  2A3L A;  3P8H A;  5DLQ E;  1HXD A;  3UT1 A;  3MP1 A;  4BD3 A;  3VYG A;  3E9F A;  3MET A;  4C92 F;  4RMO A;  1VQ9 A;  3G71 A;  1K8A C;  1VIE A;  3MHX A;  4IUQ A;  5CKB A;  3M57 A;  2BIV A;  1VQN A;  3PGG A;  3QJ6 A;  3EAE A;  2R58 A;  2EQM A;  1ZBX A;  4JDS A;  1LNX A;  4NL3 A;  1HK9 A;  2LC4 A;  1MGQ A;  1LOJ A;  4JUV A;  3DB3 A;  3L2U A;  3BW1 A;  4JJN K;  1BI2 A;  2GF7 A;  4A4K A;  1KD1 C;  1VQ9 T;  2Y4X A;  2LT1 A;  3G71 T;  4M77 B;  4C0F A;  4NL2 A;  4TVR A;  5GAO l;  4CI0 C;  1IRE B;  2R5A A;  4M75 B;  4A4H A;  1GXI E;  5HY6 A;  4C92 G;  1M90 U;  5FU6 C;  3VU3 C;  1YI2 A;  4PLL A;  3C94 A;  5FU7 C;  1YBY A;  2GFA A;  2MWO A;  1W2B A;  3JCM b;  1N8R U;  3JB9 G;  5GMK e;  1QW1 A;  2DZC A;  2FYK A;  2X4W A;  1W2B S;  3NFC A;  2MF2 A;  2DXU A;  4JLG A;  1Q7Y U;  5FRN A;  1N27 A;  4E47 A;  3E19 A;  4GY5 A;  4C0G A;  3FEO A;  5GAM d;  4M78 F;  2KK4 A;  2DKG A;  1YJW T;  2OAU A;  1NPP A;  1QVP A;  1YI2 T;  5KCH A;  2QQR A;  2KY9 A;  2WSC E;  2KVQ G;  3VV0 A;  4M77 D;  5LJ3 j;  3L2Q A;  2OTL A;  3FB9 A;  1KHC A;  3QZ9 B;  3HFO A;  4OB3 B;  2EWN A;  3DKM A;  4QQG A;  2A7Y A;  3HPW A;  1FX7 A;  4C0D C;  5A0G A;  5GAN 8;  3BY7 A;  3CD6 A;  3JB9 H;  1FXX A;  4C0Z A;  3DB4 A;  4XTU A;  2P0P A;  5FRM A;  3HFN A;  5HK3 A;  1VQ6 A;  2OTL T;  4IKF A;  4FSX A;  4PJO F;  4C5I A;  4C92 B;  3CD6 T;  2PVO B;  1FWZ A;  1BIA A;  4HT9 A;  5LJ3 h;  2I2L A;  5LL6 S;  4N4G A;  4A53 A;  4HKE A;  3SWN B;  3UWN A;  2EJG A;  3M59 A;  3JCM X;  1NE8 A;  4BB7 A;  1XTD A;  3VUZ A;  3INZ A;  1B34 B;  5AYF A;  3PTA A;  1VQM A;  1VQ6 T;  2E65 A;  3C4S A;  2GCX A;  2XG8 D;  3LH0 A;  2WAC A;  3FC3 A;  2DO3 A;  1Y71 A;  3C95 A;  5GAN 7;  4E7J A;  5CKE A;  4A4G A;  4B9W A;  4M7A E;  4M7A C;  3J81 E;  2JZ2 A;  1I8F A;  2MI6 A;  4LDU A;  1H3Z A;  4M7D E;  4C8Q D;  1VQ4 T;  4M7D C;  3QBY A;  3WVE B;  2EQU A;  3OYB A;  1VQM T;  3HRS A;  2O4X A;  2P0K A;  2QQA A;  4C5G A;  2IG0 A;  5J39 A;  2DXB A;  1Q82 C;  4M78 B;  3JCM c;  1QVG A;  4D6W A;  4XTW A;  1N6A A;  4EMG A;  2E10 A;  2F5T X;  3J7A F;  1QVG S;  1YCY A;  3EFS A;  4J5Y A;  3GP8 A;  3CCU A;  2X4X A;  3CC7 A;  3ASK A;  3CXC A;  3JCM e;  3HP9 A;  2RO0 A;  3CXC S;  1VQO T;  4FIB A;  1JJ2 A;  4Y28 E;  3OS1 A;  2VV5 A;  2XK0 A;  3OSV A;  2HBP A;  4C5E A;  1JJ2 S;  1VIF A;  2F5K A;  3G7Z A;  3G6E T;  4ATO A;  1BKB A;  1NPR A;  3CCU T;  1K73 C;  4BY6 C;  2PVG B;  3M56 A;  3CC7 T;  1N9S A;  4MDW A;  3A8O B;  4ZN3 A;  5IAY A;  4PJO B;  1I81 A;  4QQ6 A;  1K9M U;  2RB6 A;  5GMK h;  4YTL A;  4F7U B;  3TRE A;  3LWI A;  3CME A;  5CQY A;  4BI4 A;  5LJ3 e;  2VGN A;  3X25 B;  2LRQ A;  1R8O B;  2M1H A;  1OZ2 A;  4OF1 A;  3GOX A;  3H8Z A;  1Y07 A;  4R56 A;  2CS7 A;  5L8R E;  1Q81 U;  4M7A F;  5EG2 A;  2MMP A;  5I2M A;  2VXF A;  1YHQ T;  2XU8 A;  2HAX A;  5FU7 B;  3V8K A;  4ZTJ A;  4M77 A;  1KC8 C;  4A4E A;  1M1F A;  2PVD B;  3CME T;  5CVI A;  2CGH A;  4ZGE B;  1NJI U;  5GMK i;  5CKH A;  3RUX A;  1VQ7 A;  4XU2 A;  3RIR A;  1LJO A;  2E70 A;  4RCC A;  4PJO D;  3QUI A;  2WSF E;  4E7H A;  3URG A;  1M9S A;  4DOV A;  2RI3 A;  3X20 B;  3MEW A;  2EYQ A;  2JTF A;  4OB1 B;  5LJ3 d;  2E12 A;  5A0D A;  5CIU A;  3SD4 A;  2VC8 A;  3LWH A;  1M1K C;  3OS2 A;  3CC2 A;  4M7A G;  2OTJ A;  4C0D B;  1VQ7 T;  1K8A U;  3JSC A;  1YJ9 T;  3MCA B;  5D6X A;  3J80 E;  4E7K A;  2EJF A;  5GAO n;  3CCR A;  2YLB A;  3JCM J;  3JB9 F;  4M7D G;  1X6O A;  4BE1 A;  1Y96 A;  4X9C A;  1Y7X A;  3RKW A;  1MHN A;  4BDY A;  3OS0 A;  2G3R A;  2RK1 A;  4EMK B;  3HRU A;  2XDB A;  1D3B B;  2CYZ B;  4EPC A;  3CC2 T;  2OTJ T;  3DLM A;  2DD5 A;  2DIQ A;  3QXE B;  5I2S A;  4ME7 A;  3A8G B;  1QP2 A;  2K4Y A;  3QPH A;  3FLG A;  4DQ2 A;  3BDL A;  2R5M A;  3QZ5 B;  3T9N A;  3KXT A;  3CCR T;  5DLO A;  4JRQ A;  2EJ9 A;  1YJW A;  2XKO C;  4OVA A;  3M9Q A;  4PLI A;  1G3W A;  2BUD A;  3A8H B;  3MP8 A;  3X28 B;  4C8Q A;  3S3N A;  3OS5 A;  3I56 T;  2QEX T;  3VJP A;  3OYJ A;  2L5Q A;  4RG8 A;  1Q86 C;  3OYH A;  1VQK A;  1ZHI A;  2JOY A;  1VQL A;  2D0Q B;  4E7L A;  3SWN A;  4KUL A;  1XOV A;  3VYH B;  3OYM A;  4QW2 A;  4M7A B;  3TCJ A;  3PIO A;  3CPW A;  1G5V A;  4L6V 5;  4HA8 A;  4BUG A;  1V29 B;  3JCM h;  3JCM g;  4MDX A;  1YIT T;  4M75 D;  1VQP A;  4JS5 A;  1VQK T;  2CZ7 B;  2XID A;  2O01 E;  5IT9 E;  2E5Q A;  1VQL T;  3I55 T;  3GIB A;  2CKK A;  5I21 A;  1JRI A;  1BYM A;  1WJS A;  1VUB A;  4J7F A;  3AHU A;  2RHX A;  4JRI A;  4ELY C;  5KE2 A;  2QXF A;  1H64 1;  3ZEH A;  2RJF A;  4ELZ C;  4PKC C;  4XU1 A;  4XAX B;  3H6Z A;  1WQ7 A;  3E1S A;  5GAO q;  1VQP T;  3RER A;  2VGM A;  4LDX A;  4X34 A;  2QDY B;  4MML A;  2M16 A;  3V7S A;  2GFU A;  5GAN 2;  3RMS A;  3OYF A;  4Y91 A;  5CK9 A;  5LJ3 g;  2E41 A;  5FRO A;  5GMK m;  4ZN1 A;  2K5F A;  5IN1 A;  4EMH A;  4QVC A;  1O9S A;  4BY6 B;  1VQ4 A;  4N0A A;  4E7I A;  3CC4 A;  3ZBD A;  5CR2 A;  2HQX A;  2K57 A;  3MEV A;  2E64 A;  3OYY A;  3FJP A;  3JCM f;  5GAN 3;  2GQV A;  2ZZD A;  1N9R A;  3KUF A;  2VUB A;  4OGE A;  2L3R A;  1OZ3 A;  3UDC A;  4J6Y A;  3S3M A;  4RCB A;  3HRT A;  2EKO A;  2VXE A;  3PFS A;  4C92 D;  2RK2 A;  3L1A A;  3CCV T;  1WGS A;  3TEE A;  3OYL A;  4M77 E;  4M77 C;  2PUO B;  3JB9 I;  4PJO A;  1I4K 1;  3CC4 T;  2PUK B;  1AHJ B;  2RHU A;  4F7U A;  1BI3 A;  2NLU A;  3OB9 A;  4L59 A;  3EFR A;  3QYH B;  2RJC A;  3JAM E;  4ZTF A;  5CKD A;  2K5L A;  1YJN A;  3OYN A;  2LTO A;  2AHJ B;  1Q82 U;  4IUV A;  3G6E A;  5LJ3 f;  3M53 A;  2K3X A;  4FL6 A;  3SFM A;  2XDD A;  3M4G A;  3JB9 J;  1W4S A;  2DTH A;  2RI2 A;  5GAN 4;  5GAM j;  4LD6 A;  2X4Y A;  1YJN T;  1WNL A;  1KQ2 A;  1IZ6 A;  3HL8 A;  2BKD N;  3OSS C;  2XD0 A;  1OYX A;  2X35 A;  2LQK A;  2RM4 A;  3OYA A;  3GLX A;  3LX7 A;  4IUT A;  3QSU A;  1K73 U;  2ZPB B;  5LJ5 j;  3BFM A;  4M78 D;  1YHQ A;  2FHD A;  2ZGW A;  3MEA A;  2DXC A;  4MMK A;  3OYK A;  4ZGJ B;  3JRZ A;  4XTY A;  1VQ8 A;  2DD4 A;  4UC4 A;  4IUR A;  3CMA A;  5FLX E;  3P8B B;  2CZ0 B;  4XU3 A;  4DOW A;  5KCO A;  5GAN 5;  4OB0 B;  1G3T A;  3JCM d;  2L8D A;  4JLI A;  4C8Q E;  4C8Q C;  1QP3 A;  2KQW A;  3LLR A;  5GAN 6;  2HQE A;  3ER0 A;  5FU6 B;  4JS4 A;  4EMK A;  3OYD A;  1D3B A;  4M77 F;  3MP6 A;  4M7D F;  5J3B A;  3SWN C;  1VQ8 T;  2FL7 A;  2FB7 A;  1WQW A;  4M75 A;  3G4S A;  3S3O A;  2DIG A;  4FU6 A;  1KC8 U;  3CMA T;  5GAO r;  3CEY A;  2D9T A;  2RI5 A;  3A5Z B;  4PL6 A;  3QG1 A;  2R57 A;  4XTV A;  5LJ5 h;  1YJ9 A;  1K9M C;  4HCC A;  1PSF A;  3QYG B;  3RKY A;  3LW5 E;  4J83 A;  3OYC A;  3ME9 A;  3JCM P;  3JCM Q;  4RG2 A;  5GAN j;  3PMI A;  3CCE T;  2HNI A;  3A8M B;  3PMT A;  2RJD A;  3G4S T;  2DJZ A;  1G3Y A;  2LDM A;  3LGF A;  4ZGD B;  1P92 A;  2K3Y A;  2K5I A;  4KBM B;  4M77 G;  5KH6 A;  4IUU A;  1NJI C;  2B8A A;  3VKI A;  1KG1 A;  3MO8 A;  1BI1 A;  3CBP A;  4DA4 A;  3GF5 A;  4M78 C;  1UGS B;  2E6N A;  4OGC A;  4P5N A;  2QQS A;  3GNG A;  3I56 A;  2QEX A;  2D6F A;  1XQH A;  4N4H A;  3M58 A;  3L2Z A;  3OW2 A;  4A54 A;  1KD1 U;  3OQ5 A;  5J26 A;  5GAN h;  3OW2 S;  3FIF A;  1TH7 A;  2H3J A;  3N5B B;  5CCA A;  3C12 A;  4N0A C;  5LJ5 f;  2QQ9 A;  3CBO A;  4RKU E;  4VUB A;  2JVV A;  2QI2 A;  4C92 A;  4X9D A;  4C8Q F;  3OMG A;  3ZFJ A;  1YIT A;  3PT9 A;  3PIP A;  2YLC A;  3L2V A;  2EIF A;  1BI0 A;  2KDS A;  4O6J A;  2V8J A;  1WPY A;  1U1S A;  3I55 A;  1JBM A;  1Q86 U;  3CCQ A;  2ZPF B;  2DK3 A;  3NTK A;  3SDZ A;  5GAM e;  2CZ1 B;  4PJO C;  4PJO E;  5GMK l;  2P4T A;  3TU4 K;  1QVF A;  1B34 A;  2E1H A;  4FT2 A;  4F7U E;  4BE2 A;  4J6X A;  4V2S A;  1YIJ A;  1KQS A;  1QVF S;  4J7I A;  4IUP A;  4M7D B;  1KQS S;  3CPW S;  3RES A;  1VQN T;  3FRN A;  1M90 C;  2ZPI B;  5CKF A;  1UB4 A;  4C8Q G;  5LJ5 e;  3CCQ T;  1N8R C;  1DJ7 B;  3OMC A;  5GAN f;  1X75 C;  3RKX A;  1Q7Y C;  3BDU A;  3VUB A;  2ZPG B;  4CRI A;  3LGL A;  1YIJ T;  2PU9 B;  2Y4Y A;  4R55 A;  4BE0 A;  3GNF B;  1O75 A;  4EDU A;  3KBG A;  3V8L A;  2LNV A;  1S72 A;  1ZQ1 A;  2XDP A;  4LDV A;  3GPL A;  2VYT A;  2PQW A;  4M78 A;  3UPU A;  3QJY A;  3M54 A;  2C06 A;  3HSB A;  1UGP B;  4M7A D;  1RL2 A;  5D6W A;  2RA2 A;  4A4F A;  4M7D D;  3Q1J A;  3QO3 A;  2JN0 A;  1Y96 B;  3P8D A;  3CCV A;  3CCM A;  1VQO A;  3OY9 A;  2V8K A;  4FT4 A;  2QA4 A;  3OYG A;  1UGQ B;  1S72 T;  3CBM A;  5LJ5 d;  3L2W A;  2WSE E;  5GAO m;  1M1G A;  4JRP A;  5GAN e;  3F70 A;  4BDZ A;  3MEU A;  3CPF A;  3HKS A;  2DPP B;  4M78 G;  1I5L A;  3S6W A;  1OI1 A;  2IVW A;  2M9U A;  2JTM A;  3QII A;  4BI8 B;  4EMK C;  4LDY A;  4QVD A;  3V8J A;  4C8Q B;  5A0L A;  5M9O A;  2P0Q A;  3FDR A;  2XI9 A;  4HCZ A;  3CCJ A;  2EFI A;  4M75 E;  4M75 C;  4F7U F;  3M4Y A;  1KHI A;  1JB0 E;  1M5Q 1;  2X4J A;  3JB9 D;  3WVD B;  1EIF A;  3L2R A;  2XIC A;  2RJE A;  2E6Z A;  2EQK A;  2LCL A;  3RMQ A;  3NTH A;  1XNI A;  2KAF A;  4KT0 E;  4C5H A;  3QDR B;  3V7C A;  2RHZ A;  4MZM A;  2QA4 T;  4XTX A;  2YRV A;  2JNG A;  3JCM V;  3CCJ T;  5GAN d;  4JRK A;  2LCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...