1R8OB

Crystal structure of an unusual kunitz-type trypsin inhibitor from copaifera langsdorffii seeds
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
71
structure length
71
Chain Sequence
WKLPSVTVGNPKVSVFGGPFKIEEGKSGYKDVYSSSKGRDLDDGIEVNKKKEKRLVVKDGNPFIIRFKKSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kunitz trypsin inhibitor
publication title Three-dimensional structure of an unusual Kunitz (STI) type trypsin inhibitor from Copaifera langsdorffii.
pubmed doi rcsb
molecule tags Hydrolase inhibitor
total genus 9
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2003-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.480 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1r8oB01
1R8OB
chains in the Genus database with same CATH superfamily
3PT9A 3NHNA 1YJWQ 4F14A 2D6FA 5KYYA 2J6FA 3CCLT 1R77A 2MF2A 2DL4A 2X35A 1NPRA 2FL7A 3CCST 4JZ4A 4BB7A 3KBGA 3TSWA 1PSEA 5HKCA 1KSWA 2QGGA 3QZ5B 1KHIA 2AKKA 4Q5WA 3X26B 4B9WA 3CCUA 4M77B 1I07A 4FW2A 1E6GA 2J6KA 3VKIA 4C92G 4MDWA 1NEGA 1N9RA 1W1FA 1CKBA 1JQQA 1WHHA 3X28B 1QVPA 3CCEA 4JJBA 2YHTA 1X6BA 7AT1B 3NFCA 1WNLA 4HT9A 3MKDA 3VS7A 3U23A 1NEBA 4RG2A 1D0XA 1ZSZC 2KROA 4PNOA 4O5VA 4YTLA 4PJLA 1MMDA 1QWEA 1V1CA 1ZBXA 2FZCB 2HEQA 4KUDK 2K5IA 1GRIA 2AHJB 4JPBW 5D6YA 1I4K1 4FSXA 3JCMd 1U5SA 2CP7A 3RESA 3A8GB 2EIFA 1VQ6A 1HYOA 2JM9A 3OYAA 2ED1A 4HCCA 3HTRA 5GAN6 4N0AC 3OYLA 1M90U 1CSKA 3SDZA 3M55A 1OYXA 4GLMA 4ESRA 5GAN4 1OU8A 1VA7A 2KT1A 1KC8C 2B86A 1Y7XA 2IIMA 1OI1A 1MUZA 2KAFA 3LH5A 3FC3A 1OU9A 1OX9A 2KRSA 3A1PA 1AD5A 5KYUB 4C8QG 1I1JA 2DTIA 2NUTB 5FU7B 1K8AR 1YI2A 1Z9ZA 2OTJA 3CXCP 4J9FA 3REBB 3TVTA 4GBQA 1CKAA 1PRLC 2DIQA 2VGMA 2FPDA 3CCMT 2HBPA 4M78F 2EJ9A 1WDXA 2EKHA 4XAXB 4FYXB 3CXCA 2C0IA 2ATCB 1NLPC 3OBWA 5CKDA 2C06A 2LVMA 4M75E 4X34A 3OYJA 2DRKA 3C4SA 2QI2A 3EH1A 1OZ3A 2COWA 4M7AG 1K4US 4PJOG 1GCPA 1AWOA 3EG2A 2MOXA 3RKXA 2DRMA 3OYBA 1F1BB 4ZGDB 1R0CB 1D3BA 1WXUA 3QUIA 2KDSA 3S3MA 4M75B 1AVZC 3EFOA 3C0CA 2O4XA 2OAUA 2DVEA 4B9XA 4ZGEB 4DEYA 4XK8E 4C92C 2EQIA 3LGLA 5HY6A 4WCIA 2RB6A 4AFQC 2EBPA 2QEXQ 3VS2A 3JCMe 2DAQA 4J9EA 3M58A 4M77C 1X6GA 5KYNA 2X4XA 2JMAA 1Q81C 4JJNK 4BE0A 3A8LB 2HZYA 4XTVA 2RHYA 3CCQQ 4KGXB 2E3IA 1YJNQ 2E1HA 1ZSGA 2PU9B 4E2FB 1H8KA 1RAFB 3I9QA 4JLGA 3CD6Q 5IAYA 1K0SA 1AEYA 1QVGP 2EPDA 2QQBA 2LCCA 5GAMd 3V7RA 1RUWA 2LTOA 1VQ7Q 3SHWA 5KH6A 1RAAB 1XOVA 2GFUA 1B07A 1QVGA 4FYYB 4FIBA 4HCZA 2HKQB 2EYQA 2X51A 5LJ5d 3OW2P 1YFNA 2VXFA 2CZ6B 4IUVA 2F5TX 4JUVA 1W2BS 2RJCA 2DEUA 1U06A 2DX1A 1W6XA 4IUPA 2A37A 2QGFB 3OW2A 1ZHIA 4KT0E 4F7UG 1IRXA 2RK1A 2JTMA 2QQRA 1KHCA 2HL5C 1JU5C 1N6AA 2H3EB 2JXBA 3G71A 4DQ2A 4HCBA 2HBWA 1BCOA 1M4ZA 3ER0A 4C8QC 1QVFS 3QBYA 4MZTA 4IIOA 3OMCA 1VIFA 4LNPA 2K5FA 1K9AA 2CP3A 3FEOA 2QA4A 3S3NA 2A28A 2EGAA 2D0NA 5FU6B 1GCQC 1BI2A 3CC7A 2E5KA 2L89A 1B7TA 3MEUA 4EPCA 1ZSZA 2DZ9A 3UA6A 5IXFA 2X4YA 1EX4A 2E6ZA 1RAIB 4PFPA 2JJ9A 4M7DG 4M7AC 4PJOC 5LJ3h 1M1KR 3SWNA 2DTHA 2LJ1A 2LT1A 2K2VA 4QT7A 4KBMB 3JRZA 4EDUA 5L23A 5IHNA 1BU1A 1YJWT 3CCLQ 2RM4A 4R55A 1HK9A 2KRMA 5KCOA 2X9HA 2FEIA 3BDUA 1SG5A 5GAN3 1N8RR 3JB9F 2HQXA 5KYWA 1QLYA 3OYHA 2DLPA 1RL2A 3LGFA 3M5AA 2NWMA 5AT1B 1WHMA 2M51A 2ZPGB 3JCMW 4D6WA 2EVRA 4M75F 4PLIA 2XMFA 2CZ0B 1PCXA 1KK7A 4BDZA 1RLPC 1VQKA 1G3TA 3CC4A 4KH0B 2DZCA 3P8BB 3EFSA 3CMAA 4IUQA 3RUXA 3KFVA 3V8JA 3I56A 9ATCB 3JB9I 4C0FA 1D09B 4HT8A 4E7ZA 2JTFA 2QQSA 1X75C 3VS6A 2EQJA 2LT4A 2JS2A 3CPWS 3G6EA 2ZPHB 3VS1A 2EJFA 2F5KA 5KYXA 4N4HA 1SHGA 1VQLA 5GAN5 1K0XA 1JEGA 1C6VX 1GFDA 2XI9A 1E7OA 1D1BA 2K3BA 5HCKA 1VQNA 2R58A 5GJVB 1D3BB 4C92A 2KYMA 3CCSA 1BYMA 1KFZA 3BY7A 2O4XB 3PIOA 2GBQA 1M9SA 3PMIA 2X4JA 2VXEA 1YWPA 1TUCA 2WACA 2O88A 3R6NA 4E47A 4A4HA 1IO6A 1M3BA 2JVVA 5I11A 4JLIA 4RKUE 4EMKC 2D8JA 4HCKA 3P8HA 3VRZA 3MO8A 1VQPA 2Z0WA 1M1FA 4C92D 3CCRT 4XTWA 4MMKA 4JRQA 3EG3A 2BE7D 2MCNA 4J9DA 1ZX6A 1G3SA 2V26A 1YITQ 1H641 2LCSA 4ORZA 2LX7A 1I5LA 1KC8U 1K76A 4QQ6A 2CZ1B 1M90R 2L0AA 1I81A 2IG0A 2CREA 4NL3A 4JRIA 1O9SA 3A98A 1Y07A 2VGNA 3LLRA 1NM7A 1ZA1B 2EYWA 2I2LA 1E6HA 1SKUB 4JRPA 5IH2A 3A8OB 1LCKA 1FWZA 4MZPA 3UDCA 3HRUA 1KQSS 2EFIA 3QYHB 2RJFA 2QK0A 2NUPB 4HXJA 3CMEA 1ARKA 3MP6A 2I0NA 4CC7A 2QEXT 1A0NB 2XD0A 2ZZDA 2KQWA 2FB7A 2QQ9A 2JS0A 1PWTA 3CCQT 1YJNT 3INZA 4M4ZA 2OTLQ 6AT1B 3CD6T 2BKDN 2Y90A 4B6MA 2FPEA 1ZSZB 4M7AA 4PJOA 1YHQQ 4ZN1A 5CK9A 1W2BP 3TREA 1TUGB 3EAEA 2LZ6B 5LJ3g 1VQ7T 2K2MA 1M1GA 2ZPEB 4X9DA 3TQ7P 2CDTA 4RCBA 2PUKB 3SWNB 5LJ3f 1W2BA 4J9CA 2CGHA 1WIEA 1WJQA 3VS3A 3O5ZA 2FVUA 4F17A 3I55Q 3GPLA 2JOYA 1OULA 3PVQA 2OI3A 1MNEA 4A4EA 4OMNA 3JCMQ 1QVFP 4M7AD 1S72A 4PJOD 1UUEA 5CKBA 4J7FA 2JMCA 3S6WA 5FRNA 5CQXA 3EHQA 1QVFA 1UGVA 3H6ZA 4PL6A 1ZLMA 1UGRB 2H8HA 4XTYA 4IURA 5CIUA 2C0OA 2VWFA 2KEAA 3CCVQ 2RHIA 2KY9A 3M0PA 1QQJA 2HMAA 2O31A 3PE0A 5IHKA 3CCUQ 2XG8D 2KMTA 2ZCFB 4MZMA 2PVGB 1GL5A 3EFRA 4BACA 3MEAA 5GAN7 2DL7A 2DMOA 1WHGA 2RQUA 4AFSC 3QWXX 4ANJA 3CCEQ 3QG1A 4V2SA 1H3HA 1QKXA 3UA7A 4NS5A 4F7UA 2DM1A 4OMOA 1JB0E 4HVUA 2P4RA 1QMCA 1KG1A 3QJYA 2JT4A 2YRCA 2PTKA 1XNIA 1LOJA 5IXBA 2ECZA 2E10A 3JCMh 4M78G 1M27C 5KYXB 3G1JA 4M77E 2VV5A 3OYIA 2DD5A 1PSFA 3OYEA 5J26A 1UTIA 3QZ9B 4Y28E 1OPLA 4K11A 4A4KA 3OBYA 4C92B 4J9BA 2MIOA 1ABQA 3C94A 3TEEA 3CC2A 2GGRA 2DJZA 4EMKA 3KXTA 1BI0A 2V1RA 4LDWA 3CCJA 4J7IA 2A0FB 3X24B 1WYXA 1Q7YU 1K73C 3HKSA 3MP8A 4CI0C 4M7DA 3VYGA 2VB6A 5GAN8 3J7AF 3M57A 2KBTA 1AWJA 1JRIA 5GANg 3CPWP 3E9GA 1XJWB 2V8JA 2JZ2A 5GANf 2DL3A 1WHKA 3CPWA 1YI2Q 1RADB 1MV3A 3BE3A 2OTJQ 1RI0A 4OB1B 4JDSA 3SWNC 4OGCA 5CAIA 3KUFA 4M7DD 2PQWA 5DY9A 1UJ0A 1Y0MA 3M53A 1EZZB 5GJWB 4RTXA 1T3LA 3VS0A 4C8QE 1S1NA 1PKSA 2QDYB 8ATCB 1WQ7A 3NMZC 3L2RA 4JRKA 1J3TA 1NG2A 3EGXA 2QTXA 4RTZA 4LXCA 2VVKA 3GP8A 2GCXA 4C8QB 1NJIC 1PM3A 3O8VA 1HJDA 1YJ9A 1O75A 2O01E 4OMLA 2LCLA 3G4SA 2YUNA 2K5LA 1M8VA 5GMKm 1YIJA 2E6NA 2SRCA 1VQ9A 3ASKA 2DBKA 3CCRQ 1NLOC 2D0QB 3J81E 3UATA 4OP0A 2Y4YA 4O6JA 3LW5E 1YCSB 1QP3A 2OJ2A 3HP9A 3I5SA 4LN2A 2DA9A 3JCMV 4M7AB 2YDLA 3PFSA 2V8IA 2HQHA 4JZ3A 4PJOB 3GF5A 5GAMh 2SEMA 1YITT 5HK3A 1KQSP 4M78C 1VQ5A 2XICA 4OMFB 3CBMA 3TSZA 3HFNA 4J6WA 4KULA 3SB2A 5LJ5h 2YUPA 3THKA 1BKBA 4RTUA 4J9HA 4XTXA 4LDUA 4R0KA 5I2SA 2XU8A 3CBOA 3L2UA 4OMQA 4KRTA 2YLBA 3JB9H 2EYZA 1BI1A 3M0QA 4GY5A 2RHZA 5C6SA 1RAEB 1HXDA 2MWOA 2P84A 2LMJA 2XK0A 3JB9G 1X43A 3G71Q 3JCMX 1Q95G 3BW1A 1KC8R 4M77F 5EG2A 3EG0A 2LNVA 2DNUA 2OTLT 5D6WA 3BFMA 3PGGA 4M75G 2RD1A 3V7SA 1FX7A 3S3OA 2CYZB 5J3BA 2EW3A 1YHQT 1MMGA 2EYYA 2QA4Q 1VQ4A 4RG8A 1KD1C 3MEVA 4OMMA 3CC7Q 2YT6A 3H9NA 2D1XA 3OS5A 4C5HA 2QASA 4F7UB 1SHFA 2M02A 3I55T 1WGSA 1X2QA 3UT1A 3V7CA 2P4TA 4FCYA 3J80E 5KYYB 1MGQA 5CKHA 1BIBA 3OYDA 1M2VA 4VUBA 1OPKA 4WF2A 3CEYA 1VQOA 2DBMA 3L2VA 2E12A 3JV3A 4XU1A 4JS4A 2ZGWA 2YWWA 3H0FA 4WTOB 2J06A 3JB9J 2VASA 1ZBJA 3CCVT 4EMKB 3EG9A 1N27A 3CCUT 4E7HA 3C95A 2FZKB 3EG1A 4EMHA 4M7DB 1YJNA 1IGUA 2HAXA 1Q81R 2BUDA 3QSUA 3CD6A 1VQMA 2FG0A 3SD4A 2X3WD 5D7UA 3CCET 4FU6A 1C1AA 4LUEA 1H3ZA 2LRQA 1MNDA 2CT4A 5FLXE 3I56Q 3AT1B 1Q82C 1Q7YC 4D8KA 5FWCA 1N9SA 2ABLA 3BDLA 2HCKA 1B34A 2CH4A 4BE2A 2LQWA 5C0MA 2DK3A 1GXIE 2HSPA 3QXEB 3G6EQ 4DEXA 2QTVA 1ACMB 2CP0A 1QCNA 1H92A 1ZA2B 1UGPB 1VQLQ 1YN8A 4EIKA 3EGXB 3FIFA 5A0LA 1AZGB 1VQNQ 4HVVA 4BI4A 1EIFA 4BY6C 4XQ3A 3X25B 1K9MC 2JW4A 4CRIA 4C0GA 1LVKA 3D7SB 1VUBA 4RTYA 2RQWA 2L5QA 1UG1A 2LP5A 1T0HA 1HD3A 2OAWA 1M8MA 5GAOq 4XU0A 3OYKA 1OX8A 4Y91A 4OGEA 4XTZA 2M0YA 2DL8A 4ELZC 3OS0A 1VQPQ 4M78A 3V8KA 3JAME 1YI2T 1ZUKA 5GAMf 2OTJT 1VQ8A 3PVLA 2L2PA 4J9IA 4XU2A 2E64A 2RNAA 2COYA 5LJ3d 2ROLA 1K73U 1IHVA 4QQDA 1WHLA 2IPOB 5LJ5f 2EKOA 3CCLA 5A0GA 1RLQC 1OZ2A 3WVDB 4PJNA 2RMOA 2X3XD 4M78D 2A3LA 3EFOB 3G7ZA 3NTKA 1Y57A 2KE9A 4X9CA 1PD0A 3GIBA 3CMEQ 1JXMA 1AOJA 4A53A 3M4GA 4BE1A 3DB4A 4M7DC 1NPPA 1BCMA 1TWBA 2FZGB 5I22A 1QW1A 4J5YA 1G8XA 4Z89A 4PFZA 3FLGA 5GMKi 4N4IA 5KCHA 4OB3B 1NE8A 3TU4K 3ZL7C 1T3SA 3MEWA 2E4HA 3V8LA 1NJIU 3HFOA 4RUGA 1NBEB 2MYSA 3FDRA 3OYYA 5GMKl 3FJPA 3QHSA 4L5GA 2QQAA 2EWNA 5HK0A 1V76A 3LWHA 2FYKA 3QJ6A 3JSCA 3RBBB 5FWBA 3A8HB 3QO3A 2COZA 1D1AA 4DBQA 1M2VB 3RERA 1UGQB 5DLQE 1XTDA 2A7YA 2O9VA 3VU3C 1SSHA 4J9GA 1S72Q 2RJDA 1X27A 3VJPA 2GF7A 2R5AA 5LJ3e 3H8ZA 4ME7A 5CR2A 3G71T 4KUIA 3VRYA 2E65A 2RQTA 1U3OA 5GAOm 3EHRA 2KYBA 3EG9B 4E7IA 1GBRA 3URGA 1OV3A 3QYGB 1OQKA 3JCMc 2VC8A 3FB9A 2DJQA 2BZXA 2DEQA 2QA4T 2XDBA 2D8HA 3UPUA 3CCMA 4LDYA 3CC7T 2MWPA 1G3YA 2AZSA 4JJDA 3CQTA 5GANd 2KXCA 1QCOA 2FRYA 3L2ZA 5IN1A 3WVEB 5L8RE 1YWOA 1Q86C 2JUFA 2GFAA 2MMPA 1SSFA 3HRTA 4QVDA 3M9QA 1QWFA 3EH2A 5KYWB 4UC4A 3ZEHA 1WXBA 2WSCE 3M56A 2E5QA 2CP2A 2R5MA 5GAN2 4M75A 3M59A 1SPKA 2X4WA 5M9OA 1KD1U 1SRMA 4DBHA 2QDLA 4C0ZA 8AT1B 4F04B 1WPYA 1UGSB 3I5RA 2XKOC 2GNCA 1QP2A 2DPPB 3CC2Q 3L42A 2KK4A 3JB9D 1U1TA 2G6FX 1LJOA 2E41A 3LX7A 1DJ7B 4C5EA 5GAOr 3CCJQ 1N5ZA 2QG9B 1YNZA 3QKJA 3OQ5A 1BBZA 1T0JA 4M75D 2QAZA 4RTVA 1N8RU 3F70A 1X2KA 1WJRA 4FT4A 4M78B 2V8KA 1RACB 2EGEA 2JN0A 3I56T 1TSFA 1HSQA 4PJMA 3M0RA 4C92E 2OX7A 3VS4A 3NPFA 4E7LA 2VUBA 2RO0A 4ZTJA 2K79A 3HSBA 4E7KA 4HVWA 3P8DA 2AIRB 1IB8A 3M54A 3G6ET 1VOMA 2ZPFB 3NTIA 2DF6A 2CS7A 2K57A 4AFZC 1VQLT 4A4GA 5GANe 1FYNA 4NL2A 1VQ6Q 3OYNA 1VQNT 1G5VA 3A5ZB 1D1CA 4Z02A 3NGPA 2RQRA 2CSQA 1UEBA 2CH4W 2GTOA 1Q82U 3CCVA 3E19A 4A4FA 2G3RA 2XIDA 3DLMA 4JS5A 1G2BA 2RPNA 1YJ9Q 3OY9A 1K8AC 2P0KA 1MMAA 2JNGA 2CUDA 3G4SQ 2RA2A 3LYIA 4LE9A 1X01A 1W70A 2MK5A 2M9UA 4DOWA 2LJ0A 1YIJQ 2RH2A 1VQPT 1VQ9Q 3OYFA 4L6V5 5CKFA 4M77G 2XDPA 1YBYA 3L1AA 1UE9A 3MHXA 1UB4A 3M4YA 2A08A 2F2WA 3ULRB 5GMKe 1K9MU 3OA6A 3H0IA 1WA7A 2XDDA 1YJWA 1Z9QA 5LJ3j 1AZEA 1RAHB 1VQ5Q 4RTWA 2NUZA 5DLOA 1WXTA 2J7IA 2LQKA 2MPXC 5GAOn 4E7JA 1EFNA 1XQHA 4BI8B 3GNGA 2RI3A 3N5BB 4PK4A 3QDRB 3CMET 2DETA 2DXCA 2JTEA 4M7AE 4PJOE 2M0OA 3DLLA 3GOXA 4KGZB 1TS9A 1U8RA 4LD9K 3WXMB 2DXTA 3RNJA 2DO3A 4N4GA 4ZGJB 2HKNA 2PVDB 1U1SA 3H41A 1JO8A 1K73R 2O9SA 1SF9A 1WLPB 2DXBA 5J39A 1SRLA 1Y96A 2MI6A 2D9TA 4FM4B 3HL8A 1IZ6A 1M3CA 3ME9A 3R6OA 1ABOA 3L2WA 1VQ4Q 3ZFJA 1KQSA 2F2XA 3C12A 3NTHA 4PKCC 1IHWA 2HSEB 4AG2C 1VYVA 1UHCA 2KNBB 2ZPIB 3RIRA 2EJGA 3SEMA 4TVRA 4FW1A 5CCAA 2KI7A 2LQNA 1LPLA 3PTAA 1OEBA 2Y4XA 4BY6B 1TTHB 3RKYA 4PLLA 2F2VA 1S72T 2RJEA 3E9FA 1BIAA 2PNIA 3VS5A 1IXDA 1M3AA 4C92F 4FYWB 1MV0B 1VQOQ 1PNJA 2AZVA 1PKTA 1D0ZA 1NJIR 1TXQA 2KGTA 3LWIA 2YXYA 1I0CA 3CCRA 2BIVA 2K3YA 4J8OA 4F7UE 1JBMA 2W0ZA 3M0UA 3VV0A 4OMPA 2GQVA 2WSFE 2DFUA 1KQ1A 1PG5B 1ZUUA 3QDFA 2NLUA 2XHCA 1M1KC 4FSSA 4CC2A 3MP1A 2LC4A 5A0DA 1VQMQ 2HD0A 3HRSA 3JCMg 5GANj 1PC0A 5GAOl 3FJ5A 1OOTA 3M0SA 1WJSA 2RHUA 1YCYA 4X1VA 2K3XA 5CO7A 3JCMf 2O2OA 4A63B 4F16A 1TG0A 2HQEA 4L59A 4QVCA 2GTJA 4IUTA 1N8RC 1WQWA 3FRNA 1ZUYA 2P0QA 5FW9A 1QCFA 4M7DE 2QEXA 1UJYA 2HL3A 1K1ZA 4IIMA 4CC3A 5KE2A 2J05A 4RMOA 2NUPA 4OB0B 2F69A 2E3HA 4C8QF 2AK5A 3CCQA 1IREB 3CC2T 1FXXA 2KSSA 4C0DB 1Q86U 3OB9A 3GBQA 1RABB 5GMKj 1VQKQ 3CCJT 1JJ2S 3CC4Q 2L3PA 2L3SA 1MHNA 2H3JA 2WSEE 3CMAQ 1I8FA 2EQKA 2RI2A 2KT8A 1VQ7A 2CT3A 4LD6A 3RKWA 5FU7C 2ESWA 2JM8A 2LDMA 4D8DA 1TOVA 4LDXA 1YP5A 4EMGA 1UECA 4M7AF 4PJOF 3META 2YRVA 2PZ1A 3AHUA 1KD1R 2F1LA 1AT1B 2RHXA 4HKEA 1VQ8Q 3MCAB 1VIEA 3QPHA 2CUBA 2RK2A 4GLKA 4AG1C 2DYBA 3OSSC 5IHIA 2PVOB 1QKWA 1VQ6T 1BK2A 3PIPA 1WHJA 3JCMJ 4FT2A 3VYHB 2W10A 3MPUB 3JCMb 3CCSQ 2PUOB 4N0AA 3QWYA 5GAMe 4R56A 3RDVA 4M75C 1WZOA 4E6RA 5EC7A 1NZ9A 1KJWA 1YJ9T 2DERA 2FPFA 5LJ5e 1TUDA 1WX6A 3OMGA 3G4ST 1KIKA 3E1SA 4HA8A 5I21A 4BUGA 1YIJT 2P0PA 5GAMg 3UF4A 1VQ9T 1R8OB 1ZQ1A 4C5GA 4MDXA 4A54A 4ZTFA 3Q1JA 2NYSA 2BTTA 2KR3A 3T9NA 1TU0B 5FROA 2LJ3A 2ZAEA 4BI3A 1PHTA 1Y96B 1AWXA 4BD3A 1FMVA 2BZ8A 1JXOA 1MMNA 1PD1A 5LJ5g 2ED0A 1M90C 4DA4A 1PRMC 2CP6A 3RMQA 1G3WA 2M16A 2LX9A 3RR6A 2HDAA 5IT9E 5ECAA 3L2QA 2YUOA 1VQ5T 1Q82R 1Q7YR 4F7UF 1K8AU 3EGDA 4AT1B 2J6OA 2A36A 2EAYA 2RQVA 2ZPBB 1NYGA 1FMWA 2L8DA 3LH0A 2CSIA 4FL6A 4II1A 4CC4B 2QXFA 2MAMA 4QW2A 3M0TA 4Z88A 4M77A 5CQYA 3DB3A 1FMKA 1R0BG 5I2MA 4C0DC 5CKEA 2CKKA 2BZYA 1K9MR 4AFUC 4RCCA 3ZBDA 1M30A 2VYTA 3HHTB 2YLCA 1RI9A 4OF1A 4M7DF 2DVJA 4ATOA 1W4SA 2EQMA 3PMTA 5FU6C 5A2QE 2L3QA 4J6YA 2L3RA 2RN8A 4M77D 5GANh 4ZNXA 1BB9A 1VQ4T 2YUQA 4NOYA 3CCMQ 3EGUA 1NYFA 4ELYC 1D0YA 1WFWA 2BE9B 3IQLA 2LQ8A 4E7SA 3CXCS 4ZN3A 4DBRA 3E2UA 4P5NA 2AT1B 1VYUA 2LNHB 1WI7A 2M1HA 4KGVB 4DOVA 5LL6S 2EGCA 3OYCA 3UWNA 4Z8AA 1VQOT 5FRMA 2FO0A 4C8QA 1LNXA 1RAGB 2K7AA 2ROTA 2GQIA 3SFMA 3X20B 4XTUA 1X69A 1X6OA 5GMKh 2FRWA 2VKNA 5DM7R 3DKMA 4Y92A 3REAB 2QYZA 5KYUA 4MMLA 1GFCA 2K4YA 2DILA 2DKGA 3RMSA 5GAOp 1G83A 1UFFA 1KQ2A 2NUTA 1GCQA 2KRNA 2IVWA 2RI5A 5CVIA 2B8AA 1UHFA 1YITA 1GBQA 4QKUA 4C8QD 2HNIA 1VQMT 3OYGA 3MJXA 4QVZA 1IGQA 1B34B 4DBFA 3OS2A 2EQUA 1AWWA 1B3QA 1M5Q1 5GAMj 4IUUA 3OYMA 2DTOA 4J6XA 3HPWA 3CPFA 3PNWC 1V29B 2K6DA 1BI3A 2E70A 4KH1B 2KXDA 1QVGS 1I5OB 4RTTA 5KE3A 1Q81U 2DYIA 5LJ5j 2CZ7B 2CP5A 2V1QA 1JJ2P 1M1KU 2DD4A 3CBPA 2C0TA 3OW2S 1SEMA 2DIGA 3OS1A 1JJ2A 3A8MB 3GNFB 2DXUA 4M78E 3OSVA 2ENMA 2RF0A 2YSQA 3VUZA 2OTLA 1VQKT 1C0MA 1M2OA 1VYTA 4LUDA 4PJJA 4BDYA 3CC4T 4JJCA 4C5IA 3I35A 3CMAT 1YHQA 3VUBA 4FYVB 3QIIA 4LDVA 2K9GA 5AYFA 2KVQG 2R57A 2DE0X 4OVAA 2AKLA 3JCMP 1P92A 4OB2B 3I55A 4AMCA 4IKFA 4PFOA 5D6XA 1UDLA 4J83A 4XU3A 2YRDA 3H0HA 4QQGA 2EYXA 3TCJA 1AHJB 3GLXA 2FHDA 1VQ8T 1TH7A 1Y71A 1Q86R 3EGDB 2DL5A
chains in the Genus database with same CATH topology
3PT9A 5CCAA 3QXEB 4JRPA 2D6FA 3A8OB 3CCLT 3PTAA 1FWZA 4MZPA 3UDCA 2MF2A 3HRUA 1KQSS 2EFIA 2X35A 2Y4XA 2RJFA 3QYHB 3CMAA 1NPRA 2FL7A 4BY6B 3CCST 3RKYA 4BB7A 3KBGA 4PLLA 1S72T 2RJEA 1UGPB 3CMEA 3E9FA 1BIAA 3MP6A 3FIFA 5A0LA 1PSEA 4BI4A 1EIFA 4BY6C 4C92F 5HKCA 2QEXT 4XQ3A 3QZ5B 1KHIA 3X25B 1K9MC 2XD0A 2ZZDA 4CRIA 4Q5WA 3X26B 4B9WA 4C0GA 3CCUA 2KQWA 1VUBA 4M77B 2FB7A 3LWIA 2L5QA 2QQ9A 3VKIA 4C92G 4MDWA 3CCQT 3CCRA 1N9RA 2BIVA 2K3YA 4J8OA 1YJNT 4F7UE 1JBMA 3INZA 5GAOq 4XU0A 3OYKA 3VV0A 4Y91A 2GQVA 2WSFE 4OGEA 3X28B 4XTZA 1KQ1A 1QVPA 3CCEA 2YHTA 3CD6T 2BKDN 2Y90A 4ELZC 3OS0A 3NFCA 1WNLA 2NLUA 2XHCA 4M7AA 4PJOA 4M78A 4HT9A 3V8KA 1M1KC 4ZN1A 5CK9A 3JAME 3TREA 1YI2T 3EAEA 5LJ3g 1VQ7T 4RG2A 5A0DA 1M1GA 2LC4A 3MP1A 5GAMf 2OTJT 2HD0A 2ZPEB 3HRSA 4X9DA 3JCMg 5GANj 1VQ8A 4PNOA 4O5VA 4YTLA 4RCBA 5GAOl 2PUKB 3SWNB 5LJ3f 1W2BA 2CGHA 4XU2A 1WJSA 2RHUA 1YCYA 1WJQA 2K3XA 2E64A 5CO7A 2FVUA 3JCMf 5LJ3d 1ZBXA 4KUDK 3GPLA 2JOYA 2K5IA 1K73U 2AHJB 5D6YA 1I4K1 4FSXA 4QQDA 4A4EA 5LJ5f 2EKOA 2HQEA 3JCMd 4L59A 5A0GA 3CCLA 4QVCA 3JCMQ 1OZ2A 3WVDB 3RESA 4IUTA 1N8RC 1WQWA 3FRNA 3A8GB 4M7AD 2P0QA 1S72A 2EIFA 4PJOD 4M78D 2A3LA 5CKBA 1VQ6A 3G7ZA 4J7FA 3NTKA 3OYAA 3S6WA 5FRNA 5CQXA 4HCCA 4M7DE 1QVFA 2QEXA 5KE2A 5GAN6 4RMOA 4X9CA 4N0AC 3H6ZA 3OYLA 4OB0B 1M90U 4PL6A 2F69A 3SDZA 1UGRB 1OYXA 3M55A 5GAN4 3GIBA 4C8QF 4XTYA 4IURA 1KC8C 1Y7XA 3CCQA 1IREB 5CIUA 3CC2T 1FXXA 2KSSA 4C0DB 2RHIA 1Q86U 1OI1A 3OB9A 2KY9A 2KAFA 3FC3A 5GMKj 4A53A 3M4GA 3CCJT 3DB4A 4BE1A 1JJ2S 2XG8D 2KMTA 4M7DC 4C8QG 1NPPA 2DTIA 2ZCFB 1MHNA 2H3JA 2WSEE 1QW1A 4MZMA 2PVGB 1I8FA 4J5YA 5FU7B 2EQKA 2RI2A 1YI2A 3EFRA 4BACA 1VQ7A 3MEAA 5GAN7 3FLGA 5GMKi 4LD6A 3RKWA 2OTJA 4N4IA 5KCHA 4OB3B 1NE8A 5FU7C 3TU4K 2LDMA 3MEWA 4V2SA 3QG1A 3V8LA 2DIQA 2VGMA 1NJIU 4LDXA 3HFOA 4EMGA 3CCMT 4M7AF 4PJOF 2HBPA 3FDRA 4M78F 2EJ9A 4XAXB 3META 4NS5A 4F7UA 3OYYA 2YRVA 3CXCA 5GMKl 3FJPA 3QHSA 3AHUA 4L5GA 2QQAA 1JB0E 2EWNA 2RHXA 4HKEA 5HK0A 3OBWA 1KG1A 5CKDA 3QJYA 2C06A 2LVMA 4M75E 1XNIA 1LOJA 2FYKA 4X34A 3OYJA 3LWHA 3C4SA 3QJ6A 3JSCA 3MCAB 2QI2A 1VIEA 1OZ3A 3QPHA 2E10A 3JCMh 4M7AG 2RK2A 4PJOG 4GLKA 4M78G 3OSSC 3RKXA 4M77E 2PVOB 2VV5A 3A8HB 3QO3A 3OYIA 3OYBA 2DD5A 1PSFA 4ZGDB 1D3BA 3OYEA 1VQ6T 5J26A 3QUIA 2KDSA 3QZ9B 1UGQB 4Y28E 3RERA 5DLQE 1XTDA 2A7YA 4M75B 4A4KA 3S3MA 3OBYA 3PIPA 3VU3C 4C92B 3JCMJ 1KQ2A 4FT2A 3VYHB 2O4XA 2OAUA 3C94A 3JCMb 2PUOB 4N0AA 2DVEA 4B9XA 5GAMe 4ZGEB 2RJDA 3VJPA 3TEEA 3CC2A 4R56A 4M75C 4XK8E 2GF7A 2R5AA 3LGLA 5HY6A 4C92C 2DJZA 5LJ3e 2RB6A 4EMKA 3H8ZA 3KXTA 1BI0A 1NZ9A 4ME7A 3JCMe 2DAQA 5CR2A 3G71T 4KUIA 3M58A 4LDWA 4J7IA 4M77C 3CCJA 2E65A 3X24B 1YJ9T 2X4XA 5GAOm 5LJ5e 4E7IA 1Q81C 3OMGA 1Q7YU 3URGA 4JJNK 4BE0A 1K73C 3G4ST 3HKSA 3A8LB 3MP8A 4XTVA 4CI0C 4M7DA 3QYGB 3E1SA 2RHYA 4HA8A 3VYGA 5GAN8 3J7AF 3M57A 5I21A 4BUGA 1YIJT 3JCMc 2VC8A 3FB9A 1JRIA 2P0PA 5GAMg 2E1HA 1VQ9T 1R8OB 1ZQ1A 4C5GA 5GANg 4MDXA 4A54A 4ZTFA 2DEQA 3Q1JA 2PU9B 2QA4T 3E9GA 2XDBA 4JLGA 3T9NA 3UPUA 5FROA 5IAYA 2V8JA 3CCMA 4BI3A 4LDYA 3CC7T 1Y96B 2JZ2A 2MWPA 5GANf 4BD3A 1G3YA 2QQBA 2LCCA 5GAMd 3CPWA 3V7RA 5LJ5g 1M90C 5GANd 2LTOA 4DA4A 3RMQA 5KH6A 3L2ZA 5IN1A 1G3WA 1RI0A 4OB1B 4JDSA 1XOVA 3WVEB 2GFUA 3SWNC 2M16A 2LX9A 1QVGA 5L8RE 4OGCA 5CAIA 3KUFA 4FIBA 4HCZA 2JUFA 2EYQA 2PQWA 5DY9A 3L2QA 5IT9E 1VQ5T 5LJ5d 4F7UF 3M53A 2VXFA 2CZ6B 2GFAA 1K8AU 2MMPA 4IUVA 4C8QE 2F5TX 1SSFA 4JUVA 1W2BS 2RJCA 2QDYB 3HRTA 4QVDA 3M9QA 1I5LA 2EAYA 4IUPA 1WQ7A 2ZPBB 3OW2A 4UC4A 3L2RA 3ZEHA 1ZHIA 4JRKA 4KT0E 2WSCE 4F7UG 3M56A 2E5QA 2RK1A 2JTMA 2L8DA 2QQRA 2QTXA 2R5MA 3LH0A 5GAN2 1KHCA 4M75A 3M59A 5M9OA 2X4WA 2GCXA 4C8QB 3GP8A 1NJIC 1N6AA 1KD1U 4FL6A 3G71A 4DQ2A 4II1A 2QXFA 4C0ZA 3O8VA 4HCBA 2MAMA 4QW2A 1YJ9A 1O75A 2O01E 1M4ZA 1WPYA 1UGSB 3ER0A 4M77A 4C8QC 1QVFS 2LCLA 3G4SA 2K5LA 2XKOC 1M8VA 5CQYA 3DB3A 3QBYA 5I2MA 4MZTA 3OMCA 4C0DC 1QP2A 2DPPB 5CKEA 5GMKm 2CKKA 3L42A 2KK4A 1YIJA 2E6NA 3JB9D 1VIFA 2K5FA 4RCCA 1VQ9A 3ASKA 1U1TA 3ZBDA 1LJOA 2E41A 3LX7A 1DJ7B 3FEOA 4C5EA 2QA4A 3S3NA 5GAOr 2VYTA 2D0QB 3HHTB 3J81E 2Y4YA 3QKJA 4OP0A 2YLCA 3LW5E 3OQ5A 4O6JA 1BI2A 5FU6B 3CC7A 2L89A 3MEUA 4OF1A 4EPCA 4M7DF 1QP3A 2DZ9A 4M75D 3HP9A 1N8RU 3F70A 3JCMV 1WJRA 4ATOA 1W4SA 4FT4A 2EQMA 4M7AB 3PMTA 3PFSA 2V8IA 5FU6C 4M78B 2X4YA 4PJOB 5A2QE 2V8KA 2E6ZA 3GF5A 5GAMh 4J6YA 2JN0A 3I56T 2L3RA 4M77D 5GANh 1YITT 5HK3A 4M7DG 1VQ4T 4M7AC 4PJOC 5LJ3h 4M78C 4NOYA 3SWNA 4C92E 1VQ5A 2DTHA 2XICA 4OMFB 2LT1A 3CBMA 4E7LA 2VUBA 2RO0A 3HFNA 4J6WA 4KULA 4ZTJA 4ELYC 2K2VA 3SB2A 5LJ5h 4KBMB 3HSBA 1BKBA 3JRZA 4E7KA 4EDUA 2LQ8A 3P8DA 3CXCS 4ZN3A 4XTXA 3M54A 3G6ET 1YJWT 4LDUA 2RM4A 4R55A 2ZPFB 5I2SA 2XU8A 3CBOA 3L2UA 1HK9A 2YLBA 3NTIA 4P5NA 3JB9H 4M7DD 2CS7A 2K57A 5KCOA 1BI1A 2M1HA 1VQLT 4A4GA 5GANe 3BDUA 4GY5A 4NL2A 5GAN3 3JB9F 2HQXA 4DOVA 3OYNA 5LL6S 2RHZA 5C6SA 1VQNT 3OYHA 1G5VA 3OYCA 1RL2A 3A5ZB 3LGFA 1HXDA 3UWNA 3M5AA 2MWOA 4Z02A 1VQOT 5FRMA 2ZPGB 3JCMW 1UEBA 4D6WA 4C8QA 1Q86C 1LNXA 2XK0A 1Q82U 3CCVA 3SFMA 4M75F 3JB9G 3E19A 4PLIA 4A4FA 3X20B 2G3RA 4XTUA 2XIDA 3DLMA 2CZ0B 4JS5A 1X6OA 4BDZA 5GMKh 1VQKA 3JCMX 5DM7R 3DKMA 3BW1A 3OY9A 1K8AC 1G3TA 2P0KA 4M77F 4MMLA 5EG2A 3CC4A 2DZCA 2K4YA 2JNGA 2LNVA 2OTLT 3P8BB 2RA2A 2DKGA 3EFSA 3BFMA 3LYIA 1X01A 4IUQA 5D6WA 3RMSA 3PGGA 4M75G 2RD1A 3V7SA 1FX7A 2IVWA 3RUXA 2M9UA 4DOWA 3S3OA 2RH2A 2RI5A 5CVIA 1VQPT 2B8AA 2CYZB 5J3BA 1YHQT 3V8JA 3OYFA 4L6V5 3I56A 5CKFA 4M77G 1YITA 3JB9I 1VQ4A 2XDPA 1YBYA 4RG8A 4C8QD 2HNIA 3L1AA 4C0FA 1VQMT 3MEVA 1KD1C 4HT8A 3MHXA 3OYGA 1UB4A 3M4YA 4QVZA 1B34B 2JTFA 5GMKe 2QQSA 1X75C 3OS2A 2EQUA 3OS5A 1K9MU 4C5HA 3OA6A 1M5Q1 4F7UB 2EQJA 2LT4A 3I55T 1WGSA 5GAMj 4IUUA 3OYMA 3CPWS 2DTOA 4J6XA 3HPWA 2ZPHB 3CPFA 2XDDA 2EJFA 3UT1A 3G6EA 1YJWA 3PNWC 1V29B 2F5KA 5LJ3j 3V7CA 2P4TA 1BI3A 2E70A 3J80E 4N4HA 5DLOA 1VQLA 1QVGS 5GAN5 1MGQA 5KE3A 1Q81U 5CKHA 1BIBA 2LQKA 2XI9A 5GAOn 5LJ5j 3OYDA 4E7JA 1VQNA 2R58A 4VUBA 2CZ7B 1D3BB 4C92A 4WF2A 3CEYA 3CCSA 1VQOA 1XQHA 1BYMA 4BI8B 1M1KU 2DD4A 3GNGA 2RI3A 3BY7A 2O4XB 3CBPA 3PIOA 2E12A 3N5BB 4XU1A 3L2VA 4JS4A 1M9SA 3PMIA 2ZGWA 2X4JA 3QDRB 3OW2S 2DIGA 2VXEA 3CMET 3OS1A 2DXCA 1JJ2A 3A8MB 3JB9J 3CCVT 4M7AE 3GNFB 2DXUA 4EMKB 4M78E 2M0OA 3OSVA 4PJOE 2WACA 3DLLA 3GOXA 4E47A 3VUZA 4A4HA 2OTLA 1VQKT 1U8RA 4LD9K 3WXMB 2DXTA 2JVVA 1N27A 2DO3A 3CCUT 4N4GA 4ZGJB 4JLIA 3C95A 4RKUE 4EMKC 3CC4T 4BDYA 4E7HA 2PVDB 3P8HA 4C5IA 3MO8A 4EMHA 1U1SA 1VQPA 1YJNA 3CMAT 4M7DB 1YHQA 2HAXA 3VUBA 1M1FA 4C92D 3CCRT 3QIIA 4LDVA 2BUDA 3QSUA 3CD6A 4XTWA 5AYFA 2DXBA 2KVQG 4MMKA 4JRQA 1VQMA 5J39A 1Y96A 2MI6A 2R57A 2D9TA 4FM4B 3HL8A 3SD4A 3CCET 4FU6A 4OVAA 1G3SA 3JCMP 1P92A 4OB2B 1IZ6A 3I55A 4IKFA 1H3ZA 2LRQA 5D6XA 4J83A 5FLXE 4XU3A 3ME9A 1Q82C 3R6OA 1H641 1Q7YC 3L2WA 1N9SA 3BDLA 4QQGA 3ZFJA 1KC8U 1B34A 4QQ6A 3TCJA 2CZ1B 1KQSA 1AHJB 1I81A 2IG0A 2FHDA 3GLXA 5GAOp 1VQ8T 1TH7A 3C12A 3NTHA 4NL3A 4PKCC 4JRIA 1O9SA 5C0MA 4BE2A 1Y71A 1Y07A 2DK3A 2VGNA 3LLRA 2ZPIB 3RIRA 2EJGA 2I2LA 4TVRA 1GXIE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R8O B; 
#chains in the Genus database with same CATH topology
 3PT9 A;  3NHN A;  1YJW Q;  4F14 A;  2D6F A;  5KYY A;  2J6F A;  3CCL T;  1R77 A;  2MF2 A;  2DL4 A;  2X35 A;  1NPR A;  2FL7 A;  3CCS T;  4JZ4 A;  4BB7 A;  3KBG A;  3TSW A;  1PSE A;  5HKC A;  1KSW A;  2QGG A;  3QZ5 B;  1KHI A;  2AKK A;  4Q5W A;  3X26 B;  4B9W A;  3CCU A;  4M77 B;  1I07 A;  4FW2 A;  1E6G A;  2J6K A;  3VKI A;  4C92 G;  4MDW A;  1NEG A;  1N9R A;  1W1F A;  1CKB A;  1JQQ A;  1WHH A;  3X28 B;  1QVP A;  3CCE A;  4JJB A;  2YHT A;  1X6B A;  7AT1 B;  3NFC A;  1WNL A;  4HT9 A;  3MKD A;  3VS7 A;  3U23 A;  1NEB A;  4RG2 A;  1D0X A;  1ZSZ C;  2KRO A;  4PNO A;  4O5V A;  4YTL A;  4PJL A;  1MMD A;  1QWE A;  1V1C A;  1ZBX A;  2FZC B;  2HEQ A;  4KUD K;  2K5I A;  1GRI A;  2AHJ B;  4JPB W;  5D6Y A;  1I4K 1;  4FSX A;  3JCM d;  1U5S A;  2CP7 A;  3RES A;  3A8G B;  2EIF A;  1VQ6 A;  1HYO A;  2JM9 A;  3OYA A;  2ED1 A;  4HCC A;  3HTR A;  5GAN 6;  4N0A C;  3OYL A;  1M90 U;  1CSK A;  3SDZ A;  3M55 A;  1OYX A;  4GLM A;  4ESR A;  5GAN 4;  1OU8 A;  1VA7 A;  2KT1 A;  1KC8 C;  2B86 A;  1Y7X A;  2IIM A;  1OI1 A;  1MUZ A;  2KAF A;  3LH5 A;  3FC3 A;  1OU9 A;  1OX9 A;  2KRS A;  3A1P A;  1AD5 A;  5KYU B;  4C8Q G;  1I1J A;  2DTI A;  2NUT B;  5FU7 B;  1K8A R;  1YI2 A;  1Z9Z A;  2OTJ A;  3CXC P;  4J9F A;  3REB B;  3TVT A;  4GBQ A;  1CKA A;  1PRL C;  2DIQ A;  2VGM A;  2FPD A;  3CCM T;  2HBP A;  4M78 F;  2EJ9 A;  1WDX A;  2EKH A;  4XAX B;  4FYX B;  3CXC A;  2C0I A;  2ATC B;  1NLP C;  3OBW A;  5CKD A;  2C06 A;  2LVM A;  4M75 E;  4X34 A;  3OYJ A;  2DRK A;  3C4S A;  2QI2 A;  3EH1 A;  1OZ3 A;  2COW A;  4M7A G;  1K4U S;  4PJO G;  1GCP A;  1AWO A;  3EG2 A;  2MOX A;  3RKX A;  2DRM A;  3OYB A;  1F1B B;  4ZGD B;  1R0C B;  1D3B A;  1WXU A;  3QUI A;  2KDS A;  3S3M A;  4M75 B;  1AVZ C;  3EFO A;  3C0C A;  2O4X A;  2OAU A;  2DVE A;  4B9X A;  4ZGE B;  4DEY A;  4XK8 E;  4C92 C;  2EQI A;  3LGL A;  5HY6 A;  4WCI A;  2RB6 A;  4AFQ C;  2EBP A;  2QEX Q;  3VS2 A;  3JCM e;  2DAQ A;  4J9E A;  3M58 A;  4M77 C;  1X6G A;  5KYN A;  2X4X A;  2JMA A;  1Q81 C;  4JJN K;  4BE0 A;  3A8L B;  2HZY A;  4XTV A;  2RHY A;  3CCQ Q;  4KGX B;  2E3I A;  1YJN Q;  2E1H A;  1ZSG A;  2PU9 B;  4E2F B;  1H8K A;  1RAF B;  3I9Q A;  4JLG A;  3CD6 Q;  5IAY A;  1K0S A;  1AEY A;  1QVG P;  2EPD A;  2QQB A;  2LCC A;  5GAM d;  3V7R A;  1RUW A;  2LTO A;  1VQ7 Q;  3SHW A;  5KH6 A;  1RAA B;  1XOV A;  2GFU A;  1B07 A;  1QVG A;  4FYY B;  4FIB A;  4HCZ A;  2HKQ B;  2EYQ A;  2X51 A;  5LJ5 d;  3OW2 P;  1YFN A;  2VXF A;  2CZ6 B;  4IUV A;  2F5T X;  4JUV A;  1W2B S;  2RJC A;  2DEU A;  1U06 A;  2DX1 A;  1W6X A;  4IUP A;  2A37 A;  2QGF B;  3OW2 A;  1ZHI A;  4KT0 E;  4F7U G;  1IRX A;  2RK1 A;  2JTM A;  2QQR A;  1KHC A;  2HL5 C;  1JU5 C;  1N6A A;  2H3E B;  2JXB A;  3G71 A;  4DQ2 A;  4HCB A;  2HBW A;  1BCO A;  1M4Z A;  3ER0 A;  4C8Q C;  1QVF S;  3QBY A;  4MZT A;  4IIO A;  3OMC A;  1VIF A;  4LNP A;  2K5F A;  1K9A A;  2CP3 A;  3FEO A;  2QA4 A;  3S3N A;  2A28 A;  2EGA A;  2D0N A;  5FU6 B;  1GCQ C;  1BI2 A;  3CC7 A;  2E5K A;  2L89 A;  1B7T A;  3MEU A;  4EPC A;  1ZSZ A;  2DZ9 A;  3UA6 A;  5IXF A;  2X4Y A;  1EX4 A;  2E6Z A;  1RAI B;  4PFP A;  2JJ9 A;  4M7D G;  4M7A C;  4PJO C;  5LJ3 h;  1M1K R;  3SWN A;  2DTH A;  2LJ1 A;  2LT1 A;  2K2V A;  4QT7 A;  4KBM B;  3JRZ A;  4EDU A;  5L23 A;  5IHN A;  1BU1 A;  1YJW T;  3CCL Q;  2RM4 A;  4R55 A;  1HK9 A;  2KRM A;  5KCO A;  2X9H A;  2FEI A;  3BDU A;  1SG5 A;  5GAN 3;  1N8R R;  3JB9 F;  2HQX A;  5KYW A;  1QLY A;  3OYH A;  2DLP A;  1RL2 A;  3LGF A;  3M5A A;  2NWM A;  5AT1 B;  1WHM A;  2M51 A;  2ZPG B;  3JCM W;  4D6W A;  2EVR A;  4M75 F;  4PLI A;  2XMF A;  2CZ0 B;  1PCX A;  1KK7 A;  4BDZ A;  1RLP C;  1VQK A;  1G3T A;  3CC4 A;  4KH0 B;  2DZC A;  3P8B B;  3EFS A;  3CMA A;  4IUQ A;  3RUX A;  3KFV A;  3V8J A;  3I56 A;  9ATC B;  3JB9 I;  4C0F A;  1D09 B;  4HT8 A;  4E7Z A;  2JTF A;  2QQS A;  1X75 C;  3VS6 A;  2EQJ A;  2LT4 A;  2JS2 A;  3CPW S;  3G6E A;  2ZPH B;  3VS1 A;  2EJF A;  2F5K A;  5KYX A;  4N4H A;  1SHG A;  1VQL A;  5GAN 5;  1K0X A;  1JEG A;  1C6V X;  1GFD A;  2XI9 A;  1E7O A;  1D1B A;  2K3B A;  5HCK A;  1VQN A;  2R58 A;  5GJV B;  1D3B B;  4C92 A;  2KYM A;  3CCS A;  1BYM A;  1KFZ A;  3BY7 A;  2O4X B;  3PIO A;  2GBQ A;  1M9S A;  3PMI A;  2X4J A;  2VXE A;  1YWP A;  1TUC A;  2WAC A;  2O88 A;  3R6N A;  4E47 A;  4A4H A;  1IO6 A;  1M3B A;  2JVV A;  5I11 A;  4JLI A;  4RKU E;  4EMK C;  2D8J A;  4HCK A;  3P8H A;  3VRZ A;  3MO8 A;  1VQP A;  2Z0W A;  1M1F A;  4C92 D;  3CCR T;  4XTW A;  4MMK A;  4JRQ A;  3EG3 A;  2BE7 D;  2MCN A;  4J9D A;  1ZX6 A;  1G3S A;  2V26 A;  1YIT Q;  1H64 1;  2LCS A;  4ORZ A;  2LX7 A;  1I5L A;  1KC8 U;  1K76 A;  4QQ6 A;  2CZ1 B;  1M90 R;  2L0A A;  1I81 A;  2IG0 A;  2CRE A;  4NL3 A;  4JRI A;  1O9S A;  3A98 A;  1Y07 A;  2VGN A;  3LLR A;  1NM7 A;  1ZA1 B;  2EYW A;  2I2L A;  1E6H A;  1SKU B;  4JRP A;  5IH2 A;  3A8O B;  1LCK A;  1FWZ A;  4MZP A;  3UDC A;  3HRU A;  1KQS S;  2EFI A;  3QYH B;  2RJF A;  2QK0 A;  2NUP B;  4HXJ A;  3CME A;  1ARK A;  3MP6 A;  2I0N A;  4CC7 A;  2QEX T;  1A0N B;  2XD0 A;  2ZZD A;  2KQW A;  2FB7 A;  2QQ9 A;  2JS0 A;  1PWT A;  3CCQ T;  1YJN T;  3INZ A;  4M4Z A;  2OTL Q;  6AT1 B;  3CD6 T;  2BKD N;  2Y90 A;  4B6M A;  2FPE A;  1ZSZ B;  4M7A A;  4PJO A;  1YHQ Q;  4ZN1 A;  5CK9 A;  1W2B P;  3TRE A;  1TUG B;  3EAE A;  2LZ6 B;  5LJ3 g;  1VQ7 T;  2K2M A;  1M1G A;  2ZPE B;  4X9D A;  3TQ7 P;  2CDT A;  4RCB A;  2PUK B;  3SWN B;  5LJ3 f;  1W2B A;  4J9C A;  2CGH A;  1WIE A;  1WJQ A;  3VS3 A;  3O5Z A;  2FVU A;  4F17 A;  3I55 Q;  3GPL A;  2JOY A;  1OUL A;  3PVQ A;  2OI3 A;  1MNE A;  4A4E A;  4OMN A;  3JCM Q;  1QVF P;  4M7A D;  1S72 A;  4PJO D;  1UUE A;  5CKB A;  4J7F A;  2JMC A;  3S6W A;  5FRN A;  5CQX A;  3EHQ A;  1QVF A;  1UGV A;  3H6Z A;  4PL6 A;  1ZLM A;  1UGR B;  2H8H A;  4XTY A;  4IUR A;  5CIU A;  2C0O A;  2VWF A;  2KEA A;  3CCV Q;  2RHI A;  2KY9 A;  3M0P A;  1QQJ A;  2HMA A;  2O31 A;  3PE0 A;  5IHK A;  3CCU Q;  2XG8 D;  2KMT A;  2ZCF B;  4MZM A;  2PVG B;  1GL5 A;  3EFR A;  4BAC A;  3MEA A;  5GAN 7;  2DL7 A;  2DMO A;  1WHG A;  2RQU A;  4AFS C;  3QWX X;  4ANJ A;  3CCE Q;  3QG1 A;  4V2S A;  1H3H A;  1QKX A;  3UA7 A;  4NS5 A;  4F7U A;  2DM1 A;  4OMO A;  1JB0 E;  4HVU A;  2P4R A;  1QMC A;  1KG1 A;  3QJY A;  2JT4 A;  2YRC A;  2PTK A;  1XNI A;  1LOJ A;  5IXB A;  2ECZ A;  2E10 A;  3JCM h;  4M78 G;  1M27 C;  5KYX B;  3G1J A;  4M77 E;  2VV5 A;  3OYI A;  2DD5 A;  1PSF A;  3OYE A;  5J26 A;  1UTI A;  3QZ9 B;  4Y28 E;  1OPL A;  4K11 A;  4A4K A;  3OBY A;  4C92 B;  4J9B A;  2MIO A;  1ABQ A;  3C94 A;  3TEE A;  3CC2 A;  2GGR A;  2DJZ A;  4EMK A;  3KXT A;  1BI0 A;  2V1R A;  4LDW A;  3CCJ A;  4J7I A;  2A0F B;  3X24 B;  1WYX A;  1Q7Y U;  1K73 C;  3HKS A;  3MP8 A;  4CI0 C;  4M7D A;  3VYG A;  2VB6 A;  5GAN 8;  3J7A F;  3M57 A;  2KBT A;  1AWJ A;  1JRI A;  5GAN g;  3CPW P;  3E9G A;  1XJW B;  2V8J A;  2JZ2 A;  5GAN f;  2DL3 A;  1WHK A;  3CPW A;  1YI2 Q;  1RAD B;  1MV3 A;  3BE3 A;  2OTJ Q;  1RI0 A;  4OB1 B;  4JDS A;  3SWN C;  4OGC A;  5CAI A;  3KUF A;  4M7D D;  2PQW A;  5DY9 A;  1UJ0 A;  1Y0M A;  3M53 A;  1EZZ B;  5GJW B;  4RTX A;  1T3L A;  3VS0 A;  4C8Q E;  1S1N A;  1PKS A;  2QDY B;  8ATC B;  1WQ7 A;  3NMZ C;  3L2R A;  4JRK A;  1J3T A;  1NG2 A;  3EGX A;  2QTX A;  4RTZ A;  4LXC A;  2VVK A;  3GP8 A;  2GCX A;  4C8Q B;  1NJI C;  1PM3 A;  3O8V A;  1HJD A;  1YJ9 A;  1O75 A;  2O01 E;  4OML A;  2LCL A;  3G4S A;  2YUN A;  2K5L A;  1M8V A;  5GMK m;  1YIJ A;  2E6N A;  2SRC A;  1VQ9 A;  3ASK A;  2DBK A;  3CCR Q;  1NLO C;  2D0Q B;  3J81 E;  3UAT A;  4OP0 A;  2Y4Y A;  4O6J A;  3LW5 E;  1YCS B;  1QP3 A;  2OJ2 A;  3HP9 A;  3I5S A;  4LN2 A;  2DA9 A;  3JCM V;  4M7A B;  2YDL A;  3PFS A;  2V8I A;  2HQH A;  4JZ3 A;  4PJO B;  3GF5 A;  5GAM h;  2SEM A;  1YIT T;  5HK3 A;  1KQS P;  4M78 C;  1VQ5 A;  2XIC A;  4OMF B;  3CBM A;  3TSZ A;  3HFN A;  4J6W A;  4KUL A;  3SB2 A;  5LJ5 h;  2YUP A;  3THK A;  1BKB A;  4RTU A;  4J9H A;  4XTX A;  4LDU A;  4R0K A;  5I2S A;  2XU8 A;  3CBO A;  3L2U A;  4OMQ A;  4KRT A;  2YLB A;  3JB9 H;  2EYZ A;  1BI1 A;  3M0Q A;  4GY5 A;  2RHZ A;  5C6S A;  1RAE B;  1HXD A;  2MWO A;  2P84 A;  2LMJ A;  2XK0 A;  3JB9 G;  1X43 A;  3G71 Q;  3JCM X;  1Q95 G;  3BW1 A;  1KC8 R;  4M77 F;  5EG2 A;  3EG0 A;  2LNV A;  2DNU A;  2OTL T;  5D6W A;  3BFM A;  3PGG A;  4M75 G;  2RD1 A;  3V7S A;  1FX7 A;  3S3O A;  2CYZ B;  5J3B A;  2EW3 A;  1YHQ T;  1MMG A;  2EYY A;  2QA4 Q;  1VQ4 A;  4RG8 A;  1KD1 C;  3MEV A;  4OMM A;  3CC7 Q;  2YT6 A;  3H9N A;  2D1X A;  3OS5 A;  4C5H A;  2QAS A;  4F7U B;  1SHF A;  2M02 A;  3I55 T;  1WGS A;  1X2Q A;  3UT1 A;  3V7C A;  2P4T A;  4FCY A;  3J80 E;  5KYY B;  1MGQ A;  5CKH A;  1BIB A;  3OYD A;  1M2V A;  4VUB A;  1OPK A;  4WF2 A;  3CEY A;  1VQO A;  2DBM A;  3L2V A;  2E12 A;  3JV3 A;  4XU1 A;  4JS4 A;  2ZGW A;  2YWW A;  3H0F A;  4WTO B;  2J06 A;  3JB9 J;  2VAS A;  1ZBJ A;  3CCV T;  4EMK B;  3EG9 A;  1N27 A;  3CCU T;  4E7H A;  3C95 A;  2FZK B;  3EG1 A;  4EMH A;  4M7D B;  1YJN A;  1IGU A;  2HAX A;  1Q81 R;  2BUD A;  3QSU A;  3CD6 A;  1VQM A;  2FG0 A;  3SD4 A;  2X3W D;  5D7U A;  3CCE T;  4FU6 A;  1C1A A;  4LUE A;  1H3Z A;  2LRQ A;  1MND A;  2CT4 A;  5FLX E;  3I56 Q;  3AT1 B;  1Q82 C;  1Q7Y C;  4D8K A;  5FWC A;  1N9S A;  2ABL A;  3BDL A;  2HCK A;  1B34 A;  2CH4 A;  4BE2 A;  2LQW A;  5C0M A;  2DK3 A;  1GXI E;  2HSP A;  3QXE B;  3G6E Q;  4DEX A;  2QTV A;  1ACM B;  2CP0 A;  1QCN A;  1H92 A;  1ZA2 B;  1UGP B;  1VQL Q;  1YN8 A;  4EIK A;  3EGX B;  3FIF A;  5A0L A;  1AZG B;  1VQN Q;  4HVV A;  4BI4 A;  1EIF A;  4BY6 C;  4XQ3 A;  3X25 B;  1K9M C;  2JW4 A;  4CRI A;  4C0G A;  1LVK A;  3D7S B;  1VUB A;  4RTY A;  2RQW A;  2L5Q A;  1UG1 A;  2LP5 A;  1T0H A;  1HD3 A;  2OAW A;  1M8M A;  5GAO q;  4XU0 A;  3OYK A;  1OX8 A;  4Y91 A;  4OGE A;  4XTZ A;  2M0Y A;  2DL8 A;  4ELZ C;  3OS0 A;  1VQP Q;  4M78 A;  3V8K A;  3JAM E;  1YI2 T;  1ZUK A;  5GAM f;  2OTJ T;  1VQ8 A;  3PVL A;  2L2P A;  4J9I A;  4XU2 A;  2E64 A;  2RNA A;  2COY A;  5LJ3 d;  2ROL A;  1K73 U;  1IHV A;  4QQD A;  1WHL A;  2IPO B;  5LJ5 f;  2EKO A;  3CCL A;  5A0G A;  1RLQ C;  1OZ2 A;  3WVD B;  4PJN A;  2RMO A;  2X3X D;  4M78 D;  2A3L A;  3EFO B;  3G7Z A;  3NTK A;  1Y57 A;  2KE9 A;  4X9C A;  1PD0 A;  3GIB A;  3CME Q;  1JXM A;  1AOJ A;  4A53 A;  3M4G A;  4BE1 A;  3DB4 A;  4M7D C;  1NPP A;  1BCM A;  1TWB A;  2FZG B;  5I22 A;  1QW1 A;  4J5Y A;  1G8X A;  4Z89 A;  4PFZ A;  3FLG A;  5GMK i;  4N4I A;  5KCH A;  4OB3 B;  1NE8 A;  3TU4 K;  3ZL7 C;  1T3S A;  3MEW A;  2E4H A;  3V8L A;  1NJI U;  3HFO A;  4RUG A;  1NBE B;  2MYS A;  3FDR A;  3OYY A;  5GMK l;  3FJP A;  3QHS A;  4L5G A;  2QQA A;  2EWN A;  5HK0 A;  1V76 A;  3LWH A;  2FYK A;  3QJ6 A;  3JSC A;  3RBB B;  5FWB A;  3A8H B;  3QO3 A;  2COZ A;  1D1A A;  4DBQ A;  1M2V B;  3RER A;  1UGQ B;  5DLQ E;  1XTD A;  2A7Y A;  2O9V A;  3VU3 C;  1SSH A;  4J9G A;  1S72 Q;  2RJD A;  1X27 A;  3VJP A;  2GF7 A;  2R5A A;  5LJ3 e;  3H8Z A;  4ME7 A;  5CR2 A;  3G71 T;  4KUI A;  3VRY A;  2E65 A;  2RQT A;  1U3O A;  5GAO m;  3EHR A;  2KYB A;  3EG9 B;  4E7I A;  1GBR A;  3URG A;  1OV3 A;  3QYG B;  1OQK A;  3JCM c;  2VC8 A;  3FB9 A;  2DJQ A;  2BZX A;  2DEQ A;  2QA4 T;  2XDB A;  2D8H A;  3UPU A;  3CCM A;  4LDY A;  3CC7 T;  2MWP A;  1G3Y A;  2AZS A;  4JJD A;  3CQT A;  5GAN d;  2KXC A;  1QCO A;  2FRY A;  3L2Z A;  5IN1 A;  3WVE B;  5L8R E;  1YWO A;  1Q86 C;  2JUF A;  2GFA A;  2MMP A;  1SSF A;  3HRT A;  4QVD A;  3M9Q A;  1QWF A;  3EH2 A;  5KYW B;  4UC4 A;  3ZEH A;  1WXB A;  2WSC E;  3M56 A;  2E5Q A;  2CP2 A;  2R5M A;  5GAN 2;  4M75 A;  3M59 A;  1SPK A;  2X4W A;  5M9O A;  1KD1 U;  1SRM A;  4DBH A;  2QDL A;  4C0Z A;  8AT1 B;  4F04 B;  1WPY A;  1UGS B;  3I5R A;  2XKO C;  2GNC A;  1QP2 A;  2DPP B;  3CC2 Q;  3L42 A;  2KK4 A;  3JB9 D;  1U1T A;  2G6F X;  1LJO A;  2E41 A;  3LX7 A;  1DJ7 B;  4C5E A;  5GAO r;  3CCJ Q;  1N5Z A;  2QG9 B;  1YNZ A;  3QKJ A;  3OQ5 A;  1BBZ A;  1T0J A;  4M75 D;  2QAZ A;  4RTV A;  1N8R U;  3F70 A;  1X2K A;  1WJR A;  4FT4 A;  4M78 B;  2V8K A;  1RAC B;  2EGE A;  2JN0 A;  3I56 T;  1TSF A;  1HSQ A;  4PJM A;  3M0R A;  4C92 E;  2OX7 A;  3VS4 A;  3NPF A;  4E7L A;  2VUB A;  2RO0 A;  4ZTJ A;  2K79 A;  3HSB A;  4E7K A;  4HVW A;  3P8D A;  2AIR B;  1IB8 A;  3M54 A;  3G6E T;  1VOM A;  2ZPF B;  3NTI A;  2DF6 A;  2CS7 A;  2K57 A;  4AFZ C;  1VQL T;  4A4G A;  5GAN e;  1FYN A;  4NL2 A;  1VQ6 Q;  3OYN A;  1VQN T;  1G5V A;  3A5Z B;  1D1C A;  4Z02 A;  3NGP A;  2RQR A;  2CSQ A;  1UEB A;  2CH4 W;  2GTO A;  1Q82 U;  3CCV A;  3E19 A;  4A4F A;  2G3R A;  2XID A;  3DLM A;  4JS5 A;  1G2B A;  2RPN A;  1YJ9 Q;  3OY9 A;  1K8A C;  2P0K A;  1MMA A;  2JNG A;  2CUD A;  3G4S Q;  2RA2 A;  3LYI A;  4LE9 A;  1X01 A;  1W70 A;  2MK5 A;  2M9U A;  4DOW A;  2LJ0 A;  1YIJ Q;  2RH2 A;  1VQP T;  1VQ9 Q;  3OYF A;  4L6V 5;  5CKF A;  4M77 G;  2XDP A;  1YBY A;  3L1A A;  1UE9 A;  3MHX A;  1UB4 A;  3M4Y A;  2A08 A;  2F2W A;  3ULR B;  5GMK e;  1K9M U;  3OA6 A;  3H0I A;  1WA7 A;  2XDD A;  1YJW A;  1Z9Q A;  5LJ3 j;  1AZE A;  1RAH B;  1VQ5 Q;  4RTW A;  2NUZ A;  5DLO A;  1WXT A;  2J7I A;  2LQK A;  2MPX C;  5GAO n;  4E7J A;  1EFN A;  1XQH A;  4BI8 B;  3GNG A;  2RI3 A;  3N5B B;  4PK4 A;  3QDR B;  3CME T;  2DET A;  2DXC A;  2JTE A;  4M7A E;  4PJO E;  2M0O A;  3DLL A;  3GOX A;  4KGZ B;  1TS9 A;  1U8R A;  4LD9 K;  3WXM B;  2DXT A;  3RNJ A;  2DO3 A;  4N4G A;  4ZGJ B;  2HKN A;  2PVD B;  1U1S A;  3H41 A;  1JO8 A;  1K73 R;  2O9S A;  1SF9 A;  1WLP B;  2DXB A;  5J39 A;  1SRL A;  1Y96 A;  2MI6 A;  2D9T A;  4FM4 B;  3HL8 A;  1IZ6 A;  1M3C A;  3ME9 A;  3R6O A;  1ABO A;  3L2W A;  1VQ4 Q;  3ZFJ A;  1KQS A;  2F2X A;  3C12 A;  3NTH A;  4PKC C;  1IHW A;  2HSE B;  4AG2 C;  1VYV A;  1UHC A;  2KNB B;  2ZPI B;  3RIR A;  2EJG A;  3SEM A;  4TVR A;  4FW1 A;  5CCA A;  2KI7 A;  2LQN A;  1LPL A;  3PTA A;  1OEB A;  2Y4X A;  4BY6 B;  1TTH B;  3RKY A;  4PLL A;  2F2V A;  1S72 T;  2RJE A;  3E9F A;  1BIA A;  2PNI A;  3VS5 A;  1IXD A;  1M3A A;  4C92 F;  4FYW B;  1MV0 B;  1VQO Q;  1PNJ A;  2AZV A;  1PKT A;  1D0Z A;  1NJI R;  1TXQ A;  2KGT A;  3LWI A;  2YXY A;  1I0C A;  3CCR A;  2BIV A;  2K3Y A;  4J8O A;  4F7U E;  1JBM A;  2W0Z A;  3M0U A;  3VV0 A;  4OMP A;  2GQV A;  2WSF E;  2DFU A;  1KQ1 A;  1PG5 B;  1ZUU A;  3QDF A;  2NLU A;  2XHC A;  1M1K C;  4FSS A;  4CC2 A;  3MP1 A;  2LC4 A;  5A0D A;  1VQM Q;  2HD0 A;  3HRS A;  3JCM g;  5GAN j;  1PC0 A;  5GAO l;  3FJ5 A;  1OOT A;  3M0S A;  1WJS A;  2RHU A;  1YCY A;  4X1V A;  2K3X A;  5CO7 A;  3JCM f;  2O2O A;  4A63 B;  4F16 A;  1TG0 A;  2HQE A;  4L59 A;  4QVC A;  2GTJ A;  4IUT A;  1N8R C;  1WQW A;  3FRN A;  1ZUY A;  2P0Q A;  5FW9 A;  1QCF A;  4M7D E;  2QEX A;  1UJY A;  2HL3 A;  1K1Z A;  4IIM A;  4CC3 A;  5KE2 A;  2J05 A;  4RMO A;  2NUP A;  4OB0 B;  2F69 A;  2E3H A;  4C8Q F;  2AK5 A;  3CCQ A;  1IRE B;  3CC2 T;  1FXX A;  2KSS A;  4C0D B;  1Q86 U;  3OB9 A;  3GBQ A;  1RAB B;  5GMK j;  1VQK Q;  3CCJ T;  1JJ2 S;  3CC4 Q;  2L3P A;  2L3S A;  1MHN A;  2H3J A;  2WSE E;  3CMA Q;  1I8F A;  2EQK A;  2RI2 A;  2KT8 A;  1VQ7 A;  2CT3 A;  4LD6 A;  3RKW A;  5FU7 C;  2ESW A;  2JM8 A;  2LDM A;  4D8D A;  1TOV A;  4LDX A;  1YP5 A;  4EMG A;  1UEC A;  4M7A F;  4PJO F;  3MET A;  2YRV A;  2PZ1 A;  3AHU A;  1KD1 R;  2F1L A;  1AT1 B;  2RHX A;  4HKE A;  1VQ8 Q;  3MCA B;  1VIE A;  3QPH A;  2CUB A;  2RK2 A;  4GLK A;  4AG1 C;  2DYB A;  3OSS C;  5IHI A;  2PVO B;  1QKW A;  1VQ6 T;  1BK2 A;  3PIP A;  1WHJ A;  3JCM J;  4FT2 A;  3VYH B;  2W10 A;  3MPU B;  3JCM b;  3CCS Q;  2PUO B;  4N0A A;  3QWY A;  5GAM e;  4R56 A;  3RDV A;  4M75 C;  1WZO A;  4E6R A;  5EC7 A;  1NZ9 A;  1KJW A;  1YJ9 T;  2DER A;  2FPF A;  5LJ5 e;  1TUD A;  1WX6 A;  3OMG A;  3G4S T;  1KIK A;  3E1S A;  4HA8 A;  5I21 A;  4BUG A;  1YIJ T;  2P0P A;  5GAM g;  3UF4 A;  1VQ9 T;  1R8O B;  1ZQ1 A;  4C5G A;  4MDX A;  4A54 A;  4ZTF A;  3Q1J A;  2NYS A;  2BTT A;  2KR3 A;  3T9N A;  1TU0 B;  5FRO A;  2LJ3 A;  2ZAE A;  4BI3 A;  1PHT A;  1Y96 B;  1AWX A;  4BD3 A;  1FMV A;  2BZ8 A;  1JXO A;  1MMN A;  1PD1 A;  5LJ5 g;  2ED0 A;  1M90 C;  4DA4 A;  1PRM C;  2CP6 A;  3RMQ A;  1G3W A;  2M16 A;  2LX9 A;  3RR6 A;  2HDA A;  5IT9 E;  5ECA A;  3L2Q A;  2YUO A;  1VQ5 T;  1Q82 R;  1Q7Y R;  4F7U F;  1K8A U;  3EGD A;  4AT1 B;  2J6O A;  2A36 A;  2EAY A;  2RQV A;  2ZPB B;  1NYG A;  1FMW A;  2L8D A;  3LH0 A;  2CSI A;  4FL6 A;  4II1 A;  4CC4 B;  2QXF A;  2MAM A;  4QW2 A;  3M0T A;  4Z88 A;  4M77 A;  5CQY A;  3DB3 A;  1FMK A;  1R0B G;  5I2M A;  4C0D C;  5CKE A;  2CKK A;  2BZY A;  1K9M R;  4AFU C;  4RCC A;  3ZBD A;  1M30 A;  2VYT A;  3HHT B;  2YLC A;  1RI9 A;  4OF1 A;  4M7D F;  2DVJ A;  4ATO A;  1W4S A;  2EQM A;  3PMT A;  5FU6 C;  5A2Q E;  2L3Q A;  4J6Y A;  2L3R A;  2RN8 A;  4M77 D;  5GAN h;  4ZNX A;  1BB9 A;  1VQ4 T;  2YUQ A;  4NOY A;  3CCM Q;  3EGU A;  1NYF A;  4ELY C;  1D0Y A;  1WFW A;  2BE9 B;  3IQL A;  2LQ8 A;  4E7S A;  3CXC S;  4ZN3 A;  4DBR A;  3E2U A;  4P5N A;  2AT1 B;  1VYU A;  2LNH B;  1WI7 A;  2M1H A;  4KGV B;  4DOV A;  5LL6 S;  2EGC A;  3OYC A;  3UWN A;  4Z8A A;  1VQO T;  5FRM A;  2FO0 A;  4C8Q A;  1LNX A;  1RAG B;  2K7A A;  2ROT A;  2GQI A;  3SFM A;  3X20 B;  4XTU A;  1X69 A;  1X6O A;  5GMK h;  2FRW A;  2VKN A;  5DM7 R;  3DKM A;  4Y92 A;  3REA B;  2QYZ A;  5KYU A;  4MML A;  1GFC A;  2K4Y A;  2DIL A;  2DKG A;  3RMS A;  5GAO p;  1G83 A;  1UFF A;  1KQ2 A;  2NUT A;  1GCQ A;  2KRN A;  2IVW A;  2RI5 A;  5CVI A;  2B8A A;  1UHF A;  1YIT A;  1GBQ A;  4QKU A;  4C8Q D;  2HNI A;  1VQM T;  3OYG A;  3MJX A;  4QVZ A;  1IGQ A;  1B34 B;  4DBF A;  3OS2 A;  2EQU A;  1AWW A;  1B3Q A;  1M5Q 1;  5GAM j;  4IUU A;  3OYM A;  2DTO A;  4J6X A;  3HPW A;  3CPF A;  3PNW C;  1V29 B;  2K6D A;  1BI3 A;  2E70 A;  4KH1 B;  2KXD A;  1QVG S;  1I5O B;  4RTT A;  5KE3 A;  1Q81 U;  2DYI A;  5LJ5 j;  2CZ7 B;  2CP5 A;  2V1Q A;  1JJ2 P;  1M1K U;  2DD4 A;  3CBP A;  2C0T A;  3OW2 S;  1SEM A;  2DIG A;  3OS1 A;  1JJ2 A;  3A8M B;  3GNF B;  2DXU A;  4M78 E;  3OSV A;  2ENM A;  2RF0 A;  2YSQ A;  3VUZ A;  2OTL A;  1VQK T;  1C0M A;  1M2O A;  1VYT A;  4LUD A;  4PJJ A;  4BDY A;  3CC4 T;  4JJC A;  4C5I A;  3I35 A;  3CMA T;  1YHQ A;  3VUB A;  4FYV B;  3QII A;  4LDV A;  2K9G A;  5AYF A;  2KVQ G;  2R57 A;  2DE0 X;  4OVA A;  2AKL A;  3JCM P;  1P92 A;  4OB2 B;  3I55 A;  4AMC A;  4IKF A;  4PFO A;  5D6X A;  1UDL A;  4J83 A;  4XU3 A;  2YRD A;  3H0H A;  4QQG A;  2EYX A;  3TCJ A;  1AHJ B;  3GLX A;  2FHD A;  1VQ8 T;  1TH7 A;  1Y71 A;  1Q86 R;  3EGD B;  2DL5 A; 
#chains in the Genus database with same CATH homology
 3PT9 A;  5CCA A;  3QXE B;  4JRP A;  2D6F A;  3A8O B;  3CCL T;  3PTA A;  1FWZ A;  4MZP A;  3UDC A;  2MF2 A;  3HRU A;  1KQS S;  2EFI A;  2X35 A;  2Y4X A;  2RJF A;  3QYH B;  3CMA A;  1NPR A;  2FL7 A;  4BY6 B;  3CCS T;  3RKY A;  4BB7 A;  3KBG A;  4PLL A;  1S72 T;  2RJE A;  1UGP B;  3CME A;  3E9F A;  1BIA A;  3MP6 A;  3FIF A;  5A0L A;  1PSE A;  4BI4 A;  1EIF A;  4BY6 C;  4C92 F;  5HKC A;  2QEX T;  4XQ3 A;  3QZ5 B;  1KHI A;  3X25 B;  1K9M C;  2XD0 A;  2ZZD A;  4CRI A;  4Q5W A;  3X26 B;  4B9W A;  4C0G A;  3CCU A;  2KQW A;  1VUB A;  4M77 B;  2FB7 A;  3LWI A;  2L5Q A;  2QQ9 A;  3VKI A;  4C92 G;  4MDW A;  3CCQ T;  3CCR A;  1N9R A;  2BIV A;  2K3Y A;  4J8O A;  1YJN T;  4F7U E;  1JBM A;  3INZ A;  5GAO q;  4XU0 A;  3OYK A;  3VV0 A;  4Y91 A;  2GQV A;  2WSF E;  4OGE A;  3X28 B;  4XTZ A;  1KQ1 A;  1QVP A;  3CCE A;  2YHT A;  3CD6 T;  2BKD N;  2Y90 A;  4ELZ C;  3OS0 A;  3NFC A;  1WNL A;  2NLU A;  2XHC A;  4M7A A;  4PJO A;  4M78 A;  4HT9 A;  3V8K A;  1M1K C;  4ZN1 A;  5CK9 A;  3JAM E;  3TRE A;  1YI2 T;  3EAE A;  5LJ3 g;  1VQ7 T;  4RG2 A;  5A0D A;  1M1G A;  2LC4 A;  3MP1 A;  5GAM f;  2OTJ T;  2HD0 A;  2ZPE B;  3HRS A;  4X9D A;  3JCM g;  5GAN j;  1VQ8 A;  4PNO A;  4O5V A;  4YTL A;  4RCB A;  5GAO l;  2PUK B;  3SWN B;  5LJ3 f;  1W2B A;  2CGH A;  4XU2 A;  1WJS A;  2RHU A;  1YCY A;  1WJQ A;  2K3X A;  2E64 A;  5CO7 A;  2FVU A;  3JCM f;  5LJ3 d;  1ZBX A;  4KUD K;  3GPL A;  2JOY A;  2K5I A;  1K73 U;  2AHJ B;  5D6Y A;  1I4K 1;  4FSX A;  4QQD A;  4A4E A;  5LJ5 f;  2EKO A;  2HQE A;  3JCM d;  4L59 A;  5A0G A;  3CCL A;  4QVC A;  3JCM Q;  1OZ2 A;  3WVD B;  3RES A;  4IUT A;  1N8R C;  1WQW A;  3FRN A;  3A8G B;  4M7A D;  2P0Q A;  1S72 A;  2EIF A;  4PJO D;  4M78 D;  2A3L A;  5CKB A;  1VQ6 A;  3G7Z A;  4J7F A;  3NTK A;  3OYA A;  3S6W A;  5FRN A;  5CQX A;  4HCC A;  4M7D E;  1QVF A;  2QEX A;  5KE2 A;  5GAN 6;  4RMO A;  4X9C A;  4N0A C;  3H6Z A;  3OYL A;  4OB0 B;  1M90 U;  4PL6 A;  2F69 A;  3SDZ A;  1UGR B;  1OYX A;  3M55 A;  5GAN 4;  3GIB A;  4C8Q F;  4XTY A;  4IUR A;  1KC8 C;  1Y7X A;  3CCQ A;  1IRE B;  5CIU A;  3CC2 T;  1FXX A;  2KSS A;  4C0D B;  2RHI A;  1Q86 U;  1OI1 A;  3OB9 A;  2KY9 A;  2KAF A;  3FC3 A;  5GMK j;  4A53 A;  3M4G A;  3CCJ T;  3DB4 A;  4BE1 A;  1JJ2 S;  2XG8 D;  2KMT A;  4M7D C;  4C8Q G;  1NPP A;  2DTI A;  2ZCF B;  1MHN A;  2H3J A;  2WSE E;  1QW1 A;  4MZM A;  2PVG B;  1I8F A;  4J5Y A;  5FU7 B;  2EQK A;  2RI2 A;  1YI2 A;  3EFR A;  4BAC A;  1VQ7 A;  3MEA A;  5GAN 7;  3FLG A;  5GMK i;  4LD6 A;  3RKW A;  2OTJ A;  4N4I A;  5KCH A;  4OB3 B;  1NE8 A;  5FU7 C;  3TU4 K;  2LDM A;  3MEW A;  4V2S A;  3QG1 A;  3V8L A;  2DIQ A;  2VGM A;  1NJI U;  4LDX A;  3HFO A;  4EMG A;  3CCM T;  4M7A F;  4PJO F;  2HBP A;  3FDR A;  4M78 F;  2EJ9 A;  4XAX B;  3MET A;  4NS5 A;  4F7U A;  3OYY A;  2YRV A;  3CXC A;  5GMK l;  3FJP A;  3QHS A;  3AHU A;  4L5G A;  2QQA A;  1JB0 E;  2EWN A;  2RHX A;  4HKE A;  5HK0 A;  3OBW A;  1KG1 A;  5CKD A;  3QJY A;  2C06 A;  2LVM A;  4M75 E;  1XNI A;  1LOJ A;  2FYK A;  4X34 A;  3OYJ A;  3LWH A;  3C4S A;  3QJ6 A;  3JSC A;  3MCA B;  2QI2 A;  1VIE A;  1OZ3 A;  3QPH A;  2E10 A;  3JCM h;  4M7A G;  2RK2 A;  4PJO G;  4GLK A;  4M78 G;  3OSS C;  3RKX A;  4M77 E;  2PVO B;  2VV5 A;  3A8H B;  3QO3 A;  3OYI A;  3OYB A;  2DD5 A;  1PSF A;  4ZGD B;  1D3B A;  3OYE A;  1VQ6 T;  5J26 A;  3QUI A;  2KDS A;  3QZ9 B;  1UGQ B;  4Y28 E;  3RER A;  5DLQ E;  1XTD A;  2A7Y A;  4M75 B;  4A4K A;  3S3M A;  3OBY A;  3PIP A;  3VU3 C;  4C92 B;  3JCM J;  1KQ2 A;  4FT2 A;  3VYH B;  2O4X A;  2OAU A;  3C94 A;  3JCM b;  2PUO B;  4N0A A;  2DVE A;  4B9X A;  5GAM e;  4ZGE B;  2RJD A;  3VJP A;  3TEE A;  3CC2 A;  4R56 A;  4M75 C;  4XK8 E;  2GF7 A;  2R5A A;  3LGL A;  5HY6 A;  4C92 C;  2DJZ A;  5LJ3 e;  2RB6 A;  4EMK A;  3H8Z A;  3KXT A;  1BI0 A;  1NZ9 A;  4ME7 A;  3JCM e;  2DAQ A;  5CR2 A;  3G71 T;  4KUI A;  3M58 A;  4LDW A;  4J7I A;  4M77 C;  3CCJ A;  2E65 A;  3X24 B;  1YJ9 T;  2X4X A;  5GAO m;  5LJ5 e;  4E7I A;  1Q81 C;  3OMG A;  1Q7Y U;  3URG A;  4JJN K;  4BE0 A;  1K73 C;  3G4S T;  3HKS A;  3A8L B;  3MP8 A;  4XTV A;  4CI0 C;  4M7D A;  3QYG B;  3E1S A;  2RHY A;  4HA8 A;  3VYG A;  5GAN 8;  3J7A F;  3M57 A;  5I21 A;  4BUG A;  1YIJ T;  3JCM c;  2VC8 A;  3FB9 A;  1JRI A;  2P0P A;  5GAM g;  2E1H A;  1VQ9 T;  1R8O B;  1ZQ1 A;  4C5G A;  5GAN g;  4MDX A;  4A54 A;  4ZTF A;  2DEQ A;  3Q1J A;  2PU9 B;  2QA4 T;  3E9G A;  2XDB A;  4JLG A;  3T9N A;  3UPU A;  5FRO A;  5IAY A;  2V8J A;  3CCM A;  4BI3 A;  4LDY A;  3CC7 T;  1Y96 B;  2JZ2 A;  2MWP A;  5GAN f;  4BD3 A;  1G3Y A;  2QQB A;  2LCC A;  5GAM d;  3CPW A;  3V7R A;  5LJ5 g;  1M90 C;  5GAN d;  2LTO A;  4DA4 A;  3RMQ A;  5KH6 A;  3L2Z A;  5IN1 A;  1G3W A;  1RI0 A;  4OB1 B;  4JDS A;  1XOV A;  3WVE B;  2GFU A;  3SWN C;  2M16 A;  2LX9 A;  1QVG A;  5L8R E;  4OGC A;  5CAI A;  3KUF A;  4FIB A;  4HCZ A;  2JUF A;  2EYQ A;  2PQW A;  5DY9 A;  3L2Q A;  5IT9 E;  1VQ5 T;  5LJ5 d;  4F7U F;  3M53 A;  2VXF A;  2CZ6 B;  2GFA A;  1K8A U;  2MMP A;  4IUV A;  4C8Q E;  2F5T X;  1SSF A;  4JUV A;  1W2B S;  2RJC A;  2QDY B;  3HRT A;  4QVD A;  3M9Q A;  1I5L A;  2EAY A;  4IUP A;  1WQ7 A;  2ZPB B;  3OW2 A;  4UC4 A;  3L2R A;  3ZEH A;  1ZHI A;  4JRK A;  4KT0 E;  2WSC E;  4F7U G;  3M56 A;  2E5Q A;  2RK1 A;  2JTM A;  2L8D A;  2QQR A;  2QTX A;  2R5M A;  3LH0 A;  5GAN 2;  1KHC A;  4M75 A;  3M59 A;  5M9O A;  2X4W A;  2GCX A;  4C8Q B;  3GP8 A;  1NJI C;  1N6A A;  1KD1 U;  4FL6 A;  3G71 A;  4DQ2 A;  4II1 A;  2QXF A;  4C0Z A;  3O8V A;  4HCB A;  2MAM A;  4QW2 A;  1YJ9 A;  1O75 A;  2O01 E;  1M4Z A;  1WPY A;  1UGS B;  3ER0 A;  4M77 A;  4C8Q C;  1QVF S;  2LCL A;  3G4S A;  2K5L A;  2XKO C;  1M8V A;  5CQY A;  3DB3 A;  3QBY A;  5I2M A;  4MZT A;  3OMC A;  4C0D C;  1QP2 A;  2DPP B;  5CKE A;  5GMK m;  2CKK A;  3L42 A;  2KK4 A;  1YIJ A;  2E6N A;  3JB9 D;  1VIF A;  2K5F A;  4RCC A;  1VQ9 A;  3ASK A;  1U1T A;  3ZBD A;  1LJO A;  2E41 A;  3LX7 A;  1DJ7 B;  3FEO A;  4C5E A;  2QA4 A;  3S3N A;  5GAO r;  2VYT A;  2D0Q B;  3HHT B;  3J81 E;  2Y4Y A;  3QKJ A;  4OP0 A;  2YLC A;  3LW5 E;  3OQ5 A;  4O6J A;  1BI2 A;  5FU6 B;  3CC7 A;  2L89 A;  3MEU A;  4OF1 A;  4EPC A;  4M7D F;  1QP3 A;  2DZ9 A;  4M75 D;  3HP9 A;  1N8R U;  3F70 A;  3JCM V;  1WJR A;  4ATO A;  1W4S A;  4FT4 A;  2EQM A;  4M7A B;  3PMT A;  3PFS A;  2V8I A;  5FU6 C;  4M78 B;  2X4Y A;  4PJO B;  5A2Q E;  2V8K A;  2E6Z A;  3GF5 A;  5GAM h;  4J6Y A;  2JN0 A;  3I56 T;  2L3R A;  4M77 D;  5GAN h;  1YIT T;  5HK3 A;  4M7D G;  1VQ4 T;  4M7A C;  4PJO C;  5LJ3 h;  4M78 C;  4NOY A;  3SWN A;  4C92 E;  1VQ5 A;  2DTH A;  2XIC A;  4OMF B;  2LT1 A;  3CBM A;  4E7L A;  2VUB A;  2RO0 A;  3HFN A;  4J6W A;  4KUL A;  4ZTJ A;  4ELY C;  2K2V A;  3SB2 A;  5LJ5 h;  4KBM B;  3HSB A;  1BKB A;  3JRZ A;  4E7K A;  4EDU A;  2LQ8 A;  3P8D A;  3CXC S;  4ZN3 A;  4XTX A;  3M54 A;  3G6E T;  1YJW T;  4LDU A;  2RM4 A;  4R55 A;  2ZPF B;  5I2S A;  2XU8 A;  3CBO A;  3L2U A;  1HK9 A;  2YLB A;  3NTI A;  4P5N A;  3JB9 H;  4M7D D;  2CS7 A;  2K57 A;  5KCO A;  1BI1 A;  2M1H A;  1VQL T;  4A4G A;  5GAN e;  3BDU A;  4GY5 A;  4NL2 A;  5GAN 3;  3JB9 F;  2HQX A;  4DOV A;  3OYN A;  5LL6 S;  2RHZ A;  5C6S A;  1VQN T;  3OYH A;  1G5V A;  3OYC A;  1RL2 A;  3A5Z B;  3LGF A;  1HXD A;  3UWN A;  3M5A A;  2MWO A;  4Z02 A;  1VQO T;  5FRM A;  2ZPG B;  3JCM W;  1UEB A;  4D6W A;  4C8Q A;  1Q86 C;  1LNX A;  2XK0 A;  1Q82 U;  3CCV A;  3SFM A;  4M75 F;  3JB9 G;  3E19 A;  4PLI A;  4A4F A;  3X20 B;  2G3R A;  4XTU A;  2XID A;  3DLM A;  2CZ0 B;  4JS5 A;  1X6O A;  4BDZ A;  5GMK h;  1VQK A;  3JCM X;  5DM7 R;  3DKM A;  3BW1 A;  3OY9 A;  1K8A C;  1G3T A;  2P0K A;  4M77 F;  4MML A;  5EG2 A;  3CC4 A;  2DZC A;  2K4Y A;  2JNG A;  2LNV A;  2OTL T;  3P8B B;  2RA2 A;  2DKG A;  3EFS A;  3BFM A;  3LYI A;  1X01 A;  4IUQ A;  5D6W A;  3RMS A;  3PGG A;  4M75 G;  2RD1 A;  3V7S A;  1FX7 A;  2IVW A;  3RUX A;  2M9U A;  4DOW A;  3S3O A;  2RH2 A;  2RI5 A;  5CVI A;  1VQP T;  2B8A A;  2CYZ B;  5J3B A;  1YHQ T;  3V8J A;  3OYF A;  4L6V 5;  3I56 A;  5CKF A;  4M77 G;  1YIT A;  3JB9 I;  1VQ4 A;  2XDP A;  1YBY A;  4RG8 A;  4C8Q D;  2HNI A;  3L1A A;  4C0F A;  1VQM T;  3MEV A;  1KD1 C;  4HT8 A;  3MHX A;  3OYG A;  1UB4 A;  3M4Y A;  4QVZ A;  1B34 B;  2JTF A;  5GMK e;  2QQS A;  1X75 C;  3OS2 A;  2EQU A;  3OS5 A;  1K9M U;  4C5H A;  3OA6 A;  1M5Q 1;  4F7U B;  2EQJ A;  2LT4 A;  3I55 T;  1WGS A;  5GAM j;  4IUU A;  3OYM A;  3CPW S;  2DTO A;  4J6X A;  3HPW A;  2ZPH B;  3CPF A;  2XDD A;  2EJF A;  3UT1 A;  3G6E A;  1YJW A;  3PNW C;  1V29 B;  2F5K A;  5LJ3 j;  3V7C A;  2P4T A;  1BI3 A;  2E70 A;  3J80 E;  4N4H A;  5DLO A;  1VQL A;  1QVG S;  5GAN 5;  1MGQ A;  5KE3 A;  1Q81 U;  5CKH A;  1BIB A;  2LQK A;  2XI9 A;  5GAO n;  5LJ5 j;  3OYD A;  4E7J A;  1VQN A;  2R58 A;  4VUB A;  2CZ7 B;  1D3B B;  4C92 A;  4WF2 A;  3CEY A;  3CCS A;  1VQO A;  1XQH A;  1BYM A;  4BI8 B;  1M1K U;  2DD4 A;  3GNG A;  2RI3 A;  3BY7 A;  2O4X B;  3CBP A;  3PIO A;  2E12 A;  3N5B B;  4XU1 A;  3L2V A;  4JS4 A;  1M9S A;  3PMI A;  2ZGW A;  2X4J A;  3QDR B;  3OW2 S;  2DIG A;  2VXE A;  3CME T;  3OS1 A;  2DXC A;  1JJ2 A;  3A8M B;  3JB9 J;  3CCV T;  4M7A E;  3GNF B;  2DXU A;  4EMK B;  4M78 E;  2M0O A;  3OSV A;  4PJO E;  2WAC A;  3DLL A;  3GOX A;  4E47 A;  3VUZ A;  4A4H A;  2OTL A;  1VQK T;  1U8R A;  4LD9 K;  3WXM B;  2DXT A;  2JVV A;  1N27 A;  2DO3 A;  3CCU T;  4N4G A;  4ZGJ B;  4JLI A;  3C95 A;  4RKU E;  4EMK C;  3CC4 T;  4BDY A;  4E7H A;  2PVD B;  3P8H A;  4C5I A;  3MO8 A;  4EMH A;  1U1S A;  1VQP A;  1YJN A;  3CMA T;  4M7D B;  1YHQ A;  2HAX A;  3VUB A;  1M1F A;  4C92 D;  3CCR T;  3QII A;  4LDV A;  2BUD A;  3QSU A;  3CD6 A;  4XTW A;  5AYF A;  2DXB A;  2KVQ G;  4MMK A;  4JRQ A;  1VQM A;  5J39 A;  1Y96 A;  2MI6 A;  2R57 A;  2D9T A;  4FM4 B;  3HL8 A;  3SD4 A;  3CCE T;  4FU6 A;  4OVA A;  1G3S A;  3JCM P;  1P92 A;  4OB2 B;  1IZ6 A;  3I55 A;  4IKF A;  1H3Z A;  2LRQ A;  5D6X A;  4J83 A;  5FLX E;  4XU3 A;  3ME9 A;  1Q82 C;  3R6O A;  1H64 1;  1Q7Y C;  3L2W A;  1N9S A;  3BDL A;  4QQG A;  3ZFJ A;  1KC8 U;  1B34 A;  4QQ6 A;  3TCJ A;  2CZ1 B;  1KQS A;  1AHJ B;  1I81 A;  2IG0 A;  2FHD A;  3GLX A;  5GAO p;  1VQ8 T;  1TH7 A;  3C12 A;  3NTH A;  4NL3 A;  4PKC C;  4JRI A;  1O9S A;  5C0M A;  4BE2 A;  1Y71 A;  1Y07 A;  2DK3 A;  2VGN A;  3LLR A;  2ZPI B;  3RIR A;  2EJG A;  2I2L A;  4TVR A;  1GXI E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...