1K0XA

Solution structure of melanoma inhibitory activity protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
108
structure length
108
Chain Sequence
MGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor
molecule keywords Melanoma Derived Growth Regulatory Protein
publication title Solution structure and dynamics of melanoma inhibitory activity protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2001-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1k0xA00
1JO8A 2J6FA 4JJBA 1UTIA 4DEYA 4Z88A 3PVLA 2CSIA 4LN2A 1PKSA 2JM8A 2FPDA 2LX7A 2ABLA 3M0UA 1NG2A 5IHIA 2L2PA 5FWBA 2PNIA 3UA6A 1QKXA 2HBWA 2L3QA 2ENMA 3H0FA 1WDXA 4AG2C 1X43A 4J9EA 5I22A 2X3WD 2DBMA 2H8HA 1GCQC 1ABQA 5L23A 2EPDA 2EYZA 1JU5C 2J6OA 2YT6A 5GJVB 1AWOA 2YUPA 1OPLA 1SRMA 2G6FX 1MV3A 2DMOA 1W6XA 1AZEA 1LCKA 2A37A 4IIOA 2OJ2A 1WYXA 1YN8A 1WLPB 3EG1A 1VYUA 3UATA 1X69A 2KXDA 2W10A 4J9BA 2NUZA 2EBPA 2CH4W 2SRCA 2O2OA 2VVKA 2JTEA 2RMOA 3M0PA 1SSHA 1T0JA 4IIMA 1QKWA 2EGAA 2DRMA 3C0CA 1BU1A 4J9GA 1AWJA 1RUWA 2ROLA 2OI3A 2DX1A 3NGPA 2LJ0A 1X6BA 2F2VA 1TG0A 4CC7A 2VWFA 1CKBA 2M51A 2AZSA 3A98A 1VYTA 3VS6A 1T0HA 2FG0A 1MV0B 1M3BA 2F2WA 3M0RA 1EFNA 2ED0A 2V1RA 3RBBB 4LUEA 5FWCA 2KR3A 1QWFA 2RF0A 3UA7A 2EGCA 2SEMA 3R6NA 2LCSA 5IH2A 4ESRA 1SEMA 1ZBJA 1M27C 2RQVA 2FO0A 2C0TA 2A08A 1OV3A 2J6KA 2FRYA 1PNJA 2J7IA 1NYGA 2L3PA 4F16A 2CDTA 2EW3A 2W0ZA 4OMQA 1OEBA 4JPBW 3M0SA 1CSKA 2PTKA 4HVUA 2DRKA 1U5SA 1T3SA 4J9IA 1U06A 1NLOC 4J9HA 4LE9A 2KXCA 2BZXA 1VA7A 4D8KA 2RQUA 3I9QA 4RTWA 3VS3A 1GRIA 1BBZA 2EYWA 4EIKA 1Y57A 4RTTA 4A63B 1K9AA 3PE0A 4J9DA 1UFFA 1TUDA 2RQWA 4RTYA 2D8HA 1GFCA 1OPKA 4X1VA 4R0KA 2DM1A 2J05A 2XMFA 2LJ1A 2AKLA 3H0IA 2FRWA 1PHTA 1ZSGA 5IHKA 3ULRB 2DILA 2HEQA 1GFDA 2HSPA 4GBQA 1GBQA 2K6DA 4QT7A 1WXTA 4D8DA 1AEYA 1GCPA 1JQQA 2LMJA 3TVTA 1ABOA 4CC2A 3EG3A 1J3TA 2CT4A 3PVQA 2EKHA 2AKKA 4ZNXA 2RQTA 2F2XA 2FEIA 4AFUC 4RTZA 2C0OA 3KFVA 2EYYA 1YCSB 2YUNA 1K0SA 1WXUA 1YWOA 2GTOA 2I0NA 1T3LA 3VS4A 5IHNA 2JS2A 2DNUA 2JXBA 4RTUA 3VRYA 2KNBB 2A36A 2HCKA 1E6HA 3I35A 3ZL7C 2JS0A 2DF6A 2OAWA 1JEGA 4F17A 2D0NA 4K11A 2KRSA 4OMOA 1FYNA 1NM7A 2CUBA 1JXMA 2BZYA 2L3SA 2MIOA 3H41A 2LQWA 2JM9A 2MCNA 2RPNA 5FW9A 1HJDA 3VS5A 4JJDA 3JV3A 3SEMA 2LQNA 4AG1C 4AFQC 1OOTA 1Z9QA 2JT4A 2AZVA 4FSSA 2DJQA 1JXOA 4OMMA 3RNJA 2M0YA 4GLMA 1E6GA 2KRNA 1AVZC 1WI7A 1WXBA 4Z89A 2PZ1A 1V1CA 1Y0MA 2CSQA 2J06A 2KYBA 1RLPC 3VS2A 1CKAA 2V1QA 4AFSC 1BB9A 2LZ6B 4JJCA 1M30A 1H8KA 1NEBA 1SRLA 1XOVA 3EG0A 1MUZA 2LNHB 2YDLA 3CQTA 1UUEA 5HCKA 1UECA 2KGTA 3REAB 1UGVA 1YNZA 2KEAA 1W1FA 4CC4B 4ORZA 2ED1A 3QWYA 4RTXA 1ZX6A 1UG1A 4LNPA 2EQIA 3O5ZA 1RLQC 2MOXA 2VKNA 1WIEA 2YUQA 2GGRA 1X2KA 1YWPA 1NYFA 5GJWB 2RQRA 2YSQA 2NWMA 1H3HA 1NEGA 2LP5A 1I07A 2BZ8A 2D1XA 2DYBA 1AD5A 4OMPA 2DLPA 2LJ3A 4Y92A 2L0AA 2HDAA 2GQIA 3GBQA 2K79A 2O31A 2E5KA 1KFZA 4CC3A 2FPEA 1G2BA 2JW4A 3EGUA 3I5SA 5EC7A 1SPKA 4M4ZA 3H0HA 4KRTA 1AWWA 2ESWA 2K3BA 1N5ZA 1IO6A 3M0QA 2KBTA 2JMCA 2JMAA 1X27A 2CREA 4AFZC 1WX6A 2K7AA 2KT1A 1Z9ZA 2DE0X 2K9GA 2DA9A 4J9FA 4LUDA 1G83A 1AOJA 1SHFA 5ECAA 1ZUKA 3NPFA 1E7OA 3FJ5A 3EG2A 3TSWA 2C0IA 1SHGA 3M0TA 3REBB 2BTTA 1FMKA 2K2MA 2KROA 2CT3A 3THKA 2D8JA 1H92A 4Z8AA 2IIMA 1KSWA 2DL8A 4F14A 2EGEA 1B3QA 1YP5A 2ROTA 4OMLA 1PRLC 2EYXA 4OMNA 1K0XA 2P4RA 2GNCA 2DL4A 2GTJA 1A0NB 2DVJA 4WCIA 1M8MA 1WA7A 1K1ZA 1QCFA 1KIKA 2O88A 1AZGB 2CUDA 1ZUUA 1GCQA 1HD3A 1TUCA 3LH5A 1BK2A 1S1NA 2A28A 1I0CA 1UHCA 1WFWA 2FPFA 4HVVA 1GL5A 1X6GA 2KYMA 4JZ3A 1QLYA 1M3CA 2KRMA 1ZLMA 1M3AA 1ZUYA 2B86A 2DL7A 1HSQA 2RNAA 2DBKA 1UE9A 3VS7A 3IQLA 2YUOA 3NMZC 2RN8A 1B07A 1UJ0A 3VS1A 1VYVA 1KJWA 4JZ4A 3TSZA 3UF4A 2CH4A 1NLPC 2O9VA 4HVWA 4HXJA 1ARKA 5I11A 2EVRA 5IXFA 1UDLA 2KE9A 4DEXA 2X3XD 2AK5A 2DL5A 1W70A 2O9SA 1AWXA 4J9CA 3QWXX 2DL3A 1UJYA 1U3OA 2ECZA 3EHRA 1I1JA 4HCKA 2GBQA 1RI9A 1K76A 3NHNA 5IXBA 3SHWA 1PKTA 4RTVA 3EHQA 2QDLA 4RUGA 1K4US 1X2QA 2KT8A 3VRZA 3I5RA 1PRMC 3VS0A 1UHFA 1PWTA 1GBRA 1QWEA 3U23A 4E6RA
chains in the Genus database with same CATH superfamily
2QYZA 1W4SA 4JRQA 2F1LA 1VQOQ 4HCBA 4C0ZA 1QP3A 4Z88A 2EIFA 1KC8C 2JM8A 2ABLA 2L2PA 5FWBA 2DAQA 1U8RA 3CC4A 3H0FA 3NTKA 3QDFA 2KDSA 2H8HA 1ABQA 5GAMg 4GY5A 5L23A 4A53A 4N4HA 5HY6A 1SRMA 2K5LA 1GXIE 1IXDA 2MYSA 1MV3A 1AZEA 3HRUA 1YN8A 1M2VB 1WLPB 1QVGS 1Q82U 1X69A 4PL6A 1YJWA 3EAEA 1VQ7T 4J9BA 2EBPA 4A4EA 2JTEA 1RAGB 4XTUA 3CCMA 1QKWA 5GAN2 4OP0A 2QQAA 4JRIA 3CCRA 2HL3A 5AT1B 4QQGA 2X9HA 1YITQ 1CKBA 2CP3A 3QJYA 5CAIA 2FG0A 1OU8A 1M3BA 2F2WA 1UGSB 4XTZA 4RMOA 1VQ4A 3BDUA 4IUTA 2XDBA 1YJNA 5LJ3g 3V7RA 2OTJT 2QTVA 2P0PA 3BE3A 4LUEA 4KGXB 5FWCA 2RHYA 3UA7A 1BI3A 2MAMA 3CXCA 2LQKA 2DK3A 1JJ2S 2BKDN 4J7IA 3QZ9B 2E12A 3G7ZA 1M27C 4ZTFA 2AT1B 2FO0A 1N8RU 2RK2A 1EZZB 2K3YA 2D0QB 3F70A 3CCQQ 1SKUB 2L8DA 3QG1A 1YHQA 3QJ6A 2CKKA 3N5BB 2HNIA 2LTOA 3M0SA 3NTIA 3QBYA 4M77A 3V8KA 1F1BB 3M56A 3QDRB 5GAOp 1YJ9A 2EFIA 4J9IA 3CXCP 1KQSA 1QVFS 3LH0A 2KXCA 3RIRA 3VUBA 5GMKj 4FSXA 2VXEA 3JCMV 4RTTA 2DIQA 4A63B 3L2QA 5D6YA 3OQ5A 2DTIA 4J9DA 3L1AA 1UFFA 3S3OA 1TUDA 3QZ5B 4RTYA 2D8HA 4C8QC 3HSBA 4MZPA 1GFCA 4X1VA 2XKOC 5GAOm 3OYMA 3CCSA 3I55T 4ZTJA 3MP8A 2J05A 1TWBA 2DILA 2HEQA 3P8HA 4RCCA 2HSPA 4NL2A 1IHWA 1GBQA 4QT7A 3CD6A 2CP5A 1KQSP 1R77A 1GCPA 3RERA 4HT9A 3OW2S 3HFOA 1I4K1 2CP6A 4CRIA 1PD0A 5J39A 3G4ST 4NOYA 3KFVA 1KHCA 2XU8A 3T9NA 5DM7R 2EYYA 3H6ZA 3CBMA 1TS9A 2O4XA 1WXUA 1YWOA 1M1KU 2ZZDA 3RESA 3G6EA 1WHJA 5KE2A 4KBMB 5GAMf 3X24B 2DNUA 4C0DB 1VQPA 5GAN3 2KNBB 3CC2A 2NUPA 3CMAA 1PSFA 2ZPEB 2JS0A 2QQSA 1JEGA 4F17A 3D7SB 2XK0A 1M90U 2F5TX 2BZYA 3H41A 3C12A 1TSFA 1WGSA 5FW9A 4EMKB 1HJDA 2COWA 1OOTA 2DD4A 3CCJT 4FSSA 1M9SA 1E6GA 4M7DG 4C5EA 4Z89A 2ZPFB 1QVGP 3EGDB 1Y0MA 4DBFA 3VS2A 1ZA2B 1V29B 4PJOG 3CCVT 3HL8A 2E3HA 2Y4YA 1M2OA 1JJ2A 3CQTA 2CZ1B 1TOVA 2KGTA 4E7LA 1BKBA 1YNZA 3JCMc 1R0CB 4OB0B 1W1FA 2HL5C 2LX9A 4MMKA 4N4GA 3S3MA 4HA8A 5GAOl 3A8OB 1ZX6A 3O5ZA 3X20B 2MOXA 4FT2A 4BE1A 2GGRA 1C0MA 2YRVA 1X2KA 1NYFA 3NFCA 2NWMA 1U1SA 2BZ8A 5LL6S 1AD5A 3EG9A 1OI1A 2I2LA 4OMPA 4EMGA 1QP2A 4Y92A 2GQIA 2K79A 1JJ2P 1KFZA 2QA4A 3H8ZA 1VQLQ 3EFOB 5GAN4 5KYXA 2E64A 1AWWA 2XG8D 4FW1A 5KCOA 3KBGA 2KBTA 2JMCA 3FEOA 1M1KR 2WACA 4PJOB 3I55Q 1Y7XA 4LUDA 1G83A 1YIJT 1AOJA 4M7AG 3CCET 3EH1A 2KI7A 3EG2A 2MWOA 2D6FA 3OSVA 1BCOA 4F7UG 2DEQA 1WPYA 1QVFP 2RK1A 2LVMA 1VQ9T 1RAHB 2X4JA 5KYNA 4X9DA 2EWNA 1QCOA 4LD6A 2HZYA 2X4YA 2IIMA 2ROTA 4OMLA 3G4SQ 1PRLC 1R8OB 1YI2A 1MGQA 2P4RA 3INZA 4KT0E 4FYWB 3MPUB 1I5LA 1ZSZC 1K1ZA 1EX4A 2PVOB 4M75G 2OTLT 4M78G 1TUCA 1PSEA 1S72T 1X6OA 4A54A 2L5QA 4HVVA 1GL5A 2G3RA 5CCAA 1QLYA 2KRMA 4PJOD 7AT1B 3OW2P 2HKQB 1ZBXA 2LQ8A 2XI9A 2M16A 2RNAA 1VQKA 3IQLA 1FMVA 2DETA 3CCJQ 2IG0A 2QEXT 1UJ0A 1UGQB 3P8BB 2CH4A 3X26B 2JOYA 1NLPC 2DTHA 4C92G 4FL6A 4DEXA 4HKEA 3CCVQ 2Y4XA 5HK3A 4E7KA 3QHSA 5A0LA 1UJYA 2ECZA 3EHRA 4DQ2A 2RI3A 2GBQA 1RAIB 2CP0A 5GANh 1K76A 3Q1JA 2GQVA 5IXBA 1VQNT 4DBRA 2AIRB 2KT8A 1N6AA 2OX7A 4E7HA 1PRMC 1UHFA 3GNFB 1PCXA 3LGLA 2R5MA 3JCMh 2RI5A 2LRQA 1PD1A 2J6FA 1UTIA 4JJBA 3A8HB 4M7DF 4DEYA 3QUIA 2CSIA 1PKSA 2FPDA 8ATCB 2ZGWA 3OY9A 1D0XA 2EJFA 3NTHA 3I56T 4XU1A 1QKXA 1K9MC 2DIGA 4PK4A 3ZBDA 2H3JA 1X43A 2DBMA 1MNDA 3QKJA 4FYYB 2YT6A 2FHDA 2RI2A 1AWOA 2YUPA 1NJIC 3OMCA 2G6FX 5CO7A 1OQKA 1RL2A 2A37A 4IIOA 1MHNA 3DB3A 1M1GA 3UATA 5GANd 1VQMT 1YIJQ 4A4GA 2KXDA 2YWWA 3CCEQ 3M59A 2SRCA 1VQ8T 2VVKA 3HHTB 3SD4A 1SSHA 3AHUA 1VQOA 1IB8A 3JCMP 1UB4A 4BDYA 1Q7YC 4C8QA 3FDRA 2OI3A 3GP8A 1OZ3A 1Y07A 5GANe 2F2VA 1TG0A 4CC7A 2RJCA 2M51A 2AZSA 1VYTA 1T0HA 3HP9A 3MHXA 3EGXA 3TREA 1K8AR 2XDPA 1EFNA 5KYYA 2V1RA 2OTLQ 3UWNA 1N8RC 3L2RA 1S72Q 3CCLA 2KR3A 1QWFA 2EGCA 2R5AA 1VUBA 3JCMe 4M7AF 5GAMj 4JUVA 4ESRA 1G5VA 1KD1U 1ZBJA 3LWHA 4F7UF 1O75A 2A0FB 1AHJB 1MMGA 2EQMA 3S6WA 1PNJA 2QEXQ 3QSUA 3JRZA 2L3PA 3OYYA 3X28B 3UT1A 1K73R 2NUTB 1IGUA 1V76A 4JPBW 1G3TA 3OYBA 2MPXC 3OBYA 4M75F 1G8XA 1U06A 4M78F 1NLOC 3OB9A 1YJWT 4J9HA 4C0GA 3J81E 3HTRA 3QIIA 3TU4K 4OVAA 2DO3A 1VA7A 2RQUA 5FU6B 2MMPA 4FYVB 2HQEA 1BBZA 2EYWA 4EIKA 3PE0A 2RD1A 3CCRT 5DLQE 5LJ3j 3RDVA 3FJPA 1OPKA 4J83A 1KG1A 3V8LA 4OGEA 1XTDA 2FRWA 1ZA1B 3E9FA 2JVVA 1ZSGA 4C92F 1N27A 3GF5A 4ANJA 1D1CA 1BCMA 3SWNC 5CKBA 1YJNT 4PJLA 3I56Q 2M9UA 4JRKA 4D8DA 3FRNA 1AEYA 1JQQA 5LJ5h 1PM3A 2GCXA 2JTMA 1TU0B 4C0FA 4BY6C 2RQTA 2FEIA 4M77G 2M0OA 1D0YA 2C0OA 4KGZB 3JCMX 1MMNA 1W2BA 1QMCA 1YCSB 1BI1A 2QAZA 3G71T 4QW2A 1VQMQ 1M90C 2I0NA 1T3LA 2DZ9A 2DPPB 3JCMf 3CC7Q 3MP6A 1YHQT 2PVDB 2JS2A 2JXBA 3VRYA 2YHTA 1KD1R 4IUUA 4E7ZA 3G1JA 1VQ5A 1BI0A 1G3SA 2KRSA 4RCBA 5KH6A 1Q86R 1NM7A 1O9SA 2LT4A 5KYUA 1JXMA 4EMHA 1YJ9T 2L3SA 3SB2A 2LQWA 2E65A 4IUQA 2DVEA 3CPFA 3V8JA 3QXEB 5C0MA 2MCNA 1SG5A 4BACA 2BE7D 3E19A 3SEMA 2LDMA 2LQNA 4E7IA 3L2UA 1Z9QA 2L89A 4FYXB 4HCCA 1W2BP 3PNWC 1RAFB 3RR6A 4IUPA 2KRNA 5C6SA 1QVPA 1VIFA 2V8IA 5LJ5d 1HXDA 1OX8A 1M30A 1RAEB 2COYA 1BIBA 3EFRA 4QKUA 1UUEA 4M77B 1ZSZA 4M7DE 5I21A 3MCAB 5CKHA 3A8LB 2ED1A 2VYTA 5LJ5e 3PTAA 1U1TA 1D3BB 2MF2A 1WIEA 4IURA 1IGQA 4YTLA 2RQRA 2LP5A 1D3BA 1OULA 2X4XA 5LJ3d 2P0KA 3G6ET 2L0AA 2HDAA 2OAUA 3GBQA 2E5KA 4NL3A 3M53A 3CC2T 3CMAT 1SPKA 3PGGA 1B34A 3H0HA 4KRTA 3OMGA 5L8RE 1K9MR 5CQXA 4FIBA 4LDWA 3M0QA 1X27A 2CREA 2FZGB 2P0QA 5LJ3e 2VGMA 4AFZC 4FW2A 1WX6A 4O6JA 3JAME 4M77D 1WHMA 1WQWA 3OYHA 2V26A 3GLXA 2MWPA 2X4WA 1E7OA 2O4XB 3FJ5A 2CZ6B 1YJNQ 1HK9A 3L2ZA 2EQJA 3QPHA 2QTXA 2QGGA 1Q81C 4LXCA 1NBEB 4CI0C 1QVGA 2NUPB 2D8JA 1VQ7Q 4N0AC 4PLIA 5GMKh 2EAYA 2ATCB 1B3QA 2EGEA 1N9RA 3WVEB 4M7AE 1Q7YR 1VQLA 1SSFA 1K0XA 3E1SA 2MK5A 2GNCA 1RAAB 2DL4A 2DVJA 4F7UE 3G71Q 3VJPA 4BE2A 2CUDA 3M4YA 2PQWA 1FMWA 1HD3A 2NYSA 2FYKA 1SF9A 3I55A 2FPFA 2JTFA 3L2WA 1M3CA 1WHHA 1M3AA 1ZUYA 3HFNA 4Z02A 2OTJQ 2B86A 4Q5WA 2AHJB 2QA4T 2RHUA 3VS7A 4M75E 2DD5A 4OB3B 2RJDA 1VQ6T 4Y91A 4M78E 3GIBA 3VYHB 3HKSA 1EIFA 4ME7A 3TSZA 5FU7C 1KQ2A 2O9VA 4HVWA 4HXJA 3G4SA 4E47A 2X3XD 1XJWB 2A7YA 2O9SA 4LDYA 2HAXA 2E41A 4J9CA 3OYNA 3CCUT 1D09B 2DTOA 3QYHB 3EG9B 3NHNA 4C92E 5KYWA 2DXCA 2QDLA 4RUGA 3VRZA 1QVFA 5KYXB 3VS0A 2WSFE 2LCLA 1KC8R 5GMKe 5J26A 2VB6A 3MEUA 3CCJA 2VGNA 3S3NA 3M0UA 1NG2A 4OB1B 4FT4A 5IHIA 3BDLA 2YRCA 2PUOB 3PT9A 4JDSA 2L3QA 3DKMA 3CCVA 4XU2A 1WDXA 5I22A 2X3WD 2DXTA 1GCQC 3KXTA 2EPDA 2EYZA 1JU5C 2P4TA 2RHXA 5GJVB 1QW1A 2KMTA 1OPLA 5A2QE 3QO3A 1W6XA 3L42A 2OJ2A 3OW2A 4E7SA 2NUZA 4ZN1A 4V2SA 4MDXA 4DBQA 2VC8A 3M57A 3KUFA 4OMFB 2GFAA 3M4GA 5GAN5 1T0JA 3FIFA 2EGAA 5GAOq 2ZPIB 1LJOA 2DRMA 5DY9A 1BU1A 2CZ7B 5GAOr 3M54A 4J9GA 1RUWA 3SDZA 1FX7A 3SWNB 2DX1A 3NGPA 2LJ0A 3BFMA 1X6BA 1KQ1A 3R6OA 3SWNA 3A98A 3UDCA 3PFSA 2RO0A 2ED0A 2GF7A 2R57A 4JS5A 2RF0A 2SEMA 3RMQA 4N4IA 4KUIA 1YIJA 5IH2A 2CS7A 3X25B 4ZGJB 1SEMA 4WF2A 2C0TA 2DZCA 1DJ7B 2A08A 1OV3A 2DKGA 2WSEE 1K8AU 2VASA 2J6KA 1VQ6Q 2FRYA 4A4FA 2KK4A 3MEWA 2EW3A 3CMET 4RKUE 4C8QG 1TTHB 2PU9B 2NLUA 4JLIA 3CPWS 1HYOA 3JSCA 4A4KA 3CCUQ 3OS2A 2OTLA 5GANg 3JB9G 1S72A 4TVRA 3I9QA 3VS3A 2VUBA 1VQOT 3VYGA 1Y57A 1K73U 4XTYA 3ZFJA 2RQWA 4PJOF 2RHZA 4R0KA 2DM1A 3JCMg 4XTXA 2HD0A 3OA6A 4JJNK 2LJ1A 2AKLA 4M75A 1Q82C 2QEXA 1PHTA 4M78A 2RJFA 3ULRB 1VOMA 1MNEA 2B8AA 1NZ9A 1GFDA 3MEVA 4GBQA 3RKYA 3J80E 2F5KA 4C0DC 2YLBA 2VXFA 1WXTA 2DERA 3CCLT 4CC2A 3EG3A 1WHKA 1J3TA 4ELYC 4XAXB 2CT4A 5GAOn 2AKKA 4ZNXA 1Q81R 1JB0E 4AFUC 5DLOA 4C8QB 4RTZA 4BI4A 3OYFA 1VQ9Q 4BD3A 1YCYA 1K0SA 4C92A 2D9TA 2GTOA 2BE9B 2VV5A 3LGFA 5FRMA 3VS4A 3JCMb 5IN1A 3EGXB 2V8JA 4E2FB 3I35A 2DF6A 2OAWA 5KYYB 2D0NA 4J7FA 4K11A 4OMOA 2MIOA 5AYFA 3JB9H 3OYIA 3I56A 2JM9A 2RJEA 2RPNA 2WSCE 3VS5A 4JJDA 2COZA 4KULA 1I81A 1Y96A 4AFQC 3M5AA 2AZVA 1M4ZA 2HSEB 1C6VX 3CXCS 5HKCA 1WHGA 4GLMA 1KK7A 2X51A 5D6XA 1WXBA 5D7UA 1XQHA 1V1CA 1Q86U 3GPLA 3CC4T 2PUKB 3EH2A 1CKAA 2V1QA 1UGPB 3A8GB 1H8KA 4N0AA 1SRLA 3PIOA 1XOVA 4BUGA 4C8QD 3EG0A 1VQMA 3UPUA 1MUZA 2LNHB 2YDLA 3OS0A 3CC7A 5HCKA 1YITA 1UECA 1UGVA 1H641 2P84A 4PKCC 4R55A 5CIUA 3JB9D 4M7DC 4RTXA 4KUDK 4LNPA 1UG1A 2C06A 2YRDA 4PFZA 1KQSS 2VKNA 2YUQA 3O8VA 3WXMB 3M55A 4PFOA 3CMEQ 1VQNQ 4PJOC 5GJWB 3CCMT 2YSQA 1FWZA 1NEGA 4LDXA 2D1XA 2L3RA 4FCYA 2DLPA 2LJ3A 5FU7B 5IT9E 1LPLA 1D1BA 2XICA 3HPWA 1WQ7A 4CC3A 2YLCA 2QQBA 1G2BA 2JW4A 2QXFA 3I5SA 4MZTA 5EG2A 5EC7A 3CCQA 3JB9I 2LNVA 5GAMh 4M4ZA 1IZ6A 1VQ5T 4QQDA 2ESWA 2K3BA 1BYMA 1UGRB 1VQ4T 4B9XA 2JMAA 3OYLA 4KH0B 2K7AA 1RADB 1Y71A 3LYIA 3M58A 3TEEA 1Z9ZA 3OYKA 2DA9A 2FVUA 4J9FA 4J6XA 5FRNA 2QI2A 3A5ZB 1M1KC 5GANf 3CPWP 1YFNA 5A0DA 5ECAA 3WVDB 4GLKA 1ZUKA 4C8QF 3TSWA 2C0IA 1K9MU 1SHGA 4ATOA 2BTTA 3CCLQ 1FMKA 2K2MA 4DOVA 2KROA 5LJ5g 2CT3A 3THKA 3DLMA 3LX7A 2KQWA 1H92A 1VQ8Q 3JB9F 1KSWA 1NJIU 4HT8A 2HMAA 1M2VA 4X34A 5KYUB 2QK0A 4OMNA 3OYGA 2GTJA 1A0NB 4M7AC 2E70A 2BIVA 2JN0A 2BUDA 5LJ3h 5CQYA 1QCFA 2O88A 5CKDA 2QASA 5GAMd 1ZUUA 1GCQA 3LH5A 2A28A 3VUZA 1OYXA 5GMKl 1PC0A 3VV0A 1I0CA 1UHCA 4A4HA 2DJZA 1X6GA 2V8KA 2KYMA 4JZ3A 2E6NA 1Q7YU 3BW1A 1VIEA 1ZLMA 4P5NA 2KVQG 2EYQA 4ZGDB 2XHCA 3E9GA 1G3YA 4XU3A 3CCST 1UE9A 2ZPHB 5IAYA 1Q95G 1ZSZB 3NMZC 5GAMe 1B07A 3VS1A 4JZ4A 1VQ7A 3UF4A 3DLLA 2JZ2A 4M75C 4M78C 3L2VA 4B9WA 1ARKA 3CD6T 3CC4Q 4IKFA 5IXFA 2JJ9A 2KE9A 2DL5A 3MKDA 1W70A 4EDUA 3G71A 3DB4A 1AWXA 4PJJA 2M02A 4PJOE 2DL3A 2K57A 1U3OA 4JS4A 1D1AA 4HCKA 1I1JA 2JNGA 4Y28E 4ZN3A 6AT1B 1X75C 1RI9A 3C4SA 3EHQA 2Y90A 3AT1B 2Z0WA 1YJWQ 4C92C 1B34B 2OTJA 1QWEA 4AT1B 3META 1VQPT 2E4HA 3U23A 4E6RA 1JO8A 1VQLT 1JBMA 3CCMQ 5CKFA 3PVLA 9ATCB 4UC4A 5A0GA 4LN2A 2LX7A 3CCRQ 4KH1B 2PNIA 3UA6A 2HBWA 4IUVA 2E10A 1Q82R 2ENMA 2QDYB 2HBPA 4AG2C 4J9EA 1ZQ1A 1NJIR 1VQ5Q 1KC8U 1NPRA 2J6OA 3OSSC 1QCNA 1VQ4Q 1UEBA 3GNGA 1ZHIA 2DMOA 3MP1A 1NE8A 1B7TA 3A8MB 4QVDA 3LW5E 1LCKA 2RM4A 1WYXA 3EG1A 1VYUA 2FZKB 3RKWA 1WJQA 1D0ZA 2W10A 1LOJA 2CH4W 1IRXA 2O2OA 4E7JA 1X01A 2RMOA 1JRIA 3M0PA 2YXYA 4DBHA 4IIMA 3H9NA 2DEUA 1I5OB 2GFUA 4ELZC 1ACMB 3C0CA 1AWJA 3VU3C 1YHQQ 2H3EB 3C94A 1C1AA 2ROLA 1N9SA 4D6WA 2VWFA 4JLGA 4II1A 2F69A 1M8VA 4DOWA 3VS6A 1N8RR 1MV0B 1M5Q1 1YJ9Q 2ZPBB 3M0RA 5I2MA 5LJ5f 5CR2A 3RBBB 4WTOB 1KHIA 4XQ3A 1K8AC 3MEAA 3R6NA 4OF1A 2LCSA 4C5IA 4KGVB 4M77F 4MMLA 3SFMA 2ZCFB 4EMKA 3FLGA 5I2SA 2RQVA 3JCMW 5FU6C 3CCSQ 4FU6A 5KCHA 3MO8A 3EGDA 2J7IA 1NYGA 5KYWB 4F16A 4RG2A 2CDTA 2W0ZA 4OMQA 3CD6Q 1OEBA 5LJ3f 1CSKA 3C95A 1K73C 2PTKA 4HVUA 2DRKA 1U5SA 1T3SA 2EJ9A 4OB2B 2PVGB 1RI0A 4LE9A 2BZXA 1YI2T 4D8KA 2KAFA 2RA2A 4RTWA 4J8OA 4PJNA 1GRIA 3URGA 4C8QE 1K9AA 8AT1B 3G6EQ 2XD0A 4C5GA 2ZAEA 2EQKA 2QGFB 2MI6A 4MZMA 3ZEHA 1VQPQ 4DA4A 3CC2Q 3CMAQ 2O01E 3EFSA 2K5FA 1WHLA 1LNXA 1VQ6A 2XMFA 1MMAA 1BIAA 3H0IA 3HRTA 2HQHA 5IHKA 4M7DB 3OYCA 4PLLA 3EFOA 2E1HA 4L59A 5GAN7 4OGCA 2K6DA 3M9QA 1VQKT 4M7DA 3BY7A 2LMJA 3TVTA 1ABOA 4X9CA 3PVQA 2EKHA 4PNOA 1QQJA 3CCUA 4PJOA 3CBOA 2F2XA 2K5IA 5GMKi 4NS5A 1FXXA 3OS5A 1M90R 2YUNA 1WJRA 1M1FA 2FB7A 2KSSA 4BE0A 2CGHA 4LDVA 1H3ZA 5IHNA 2RHIA 1OZ2A 4RTUA 3V7CA 3OYJA 5KE3A 2IVWA 2A36A 2HCKA 1E6HA 5GANj 3ZL7C 2JUFA 1Q81U 3OS1A 3A1PA 4QVCA 1FYNA 4BY6B 1KD1C 2CUBA 3RMSA 4RG8A 3P8DA 5FROA 4M77C 2A3LA 5M9OA 1Q86C 2K3XA 3TCJA 4JRPA 3JV3A 4M7DD 1WJSA 4XTVA 4AG1C 2JT4A 3ER0A 2DJQA 1JXOA 4OMMA 3RNJA 4J6WA 2M0YA 3ME9A 4BI3A 3CCEA 3ASKA 1P92A 2CP2A 1AVZC 1WI7A 3JCMJ 2PZ1A 1TH7A 4BI8B 2CSQA 2J06A 2KYBA 1RLPC 4F04B 2QA4Q 4AFSC 1MMDA 2X35A 1VQ9A 1BB9A 2LZ6B 4JJCA 1NEBA 3RKXA 4B6MA 5FLXE 4M7AB 4FM4B 3RUXA 2ZPGB 2DXBA 3REAB 2DYIA 2E5QA 4F7UB 4M7AA 2KEAA 3QYGB 3PMIA 4CC4B 1G3WA 1I8FA 4ORZA 4BDZA 1WZOA 2XIDA 2IPOB 4F7UA 1R0BG 3QWYA 1TUGB 2CP7A 2EQIA 4ZGEB 1RLQC 2CYZB 3PMTA 1YWPA 2HQXA 4PJMA 1H3HA 1I07A 2DYBA 3FB9A 1OX9A 2EKOA 3PIPA 3OYDA 3FC3A 4M75B 2HKNA 3OBWA 2O31A 4M78B 4C5HA 2EQUA 1WNLA 2FPEA 1YI2Q 2E3IA 3EGUA 3JB9J 2K4YA 1LVKA 4HCZA 2CZ0B 2QG9B 3E2UA 1YBYA 1N5ZA 1IO6A 4PFPA 3HRSA 4AMCA 3V7SA 1BI2A 4XTWA 4M7AD 2KT1A 3GOXA 2DE0X 2K9GA 4XK8E 2RH2A 1OU9A 1SHFA 1XNIA 3NPFA 4C92B 4J5YA 5CKEA 2FL7A 4EMKC 1RABB 2LCCA 3CMEA 1VQNA 1RACB 3MJXA 3VKIA 1VQKQ 3M0TA 3REBB 2LT1A 1W2BS 2KY9A 2DXUA 5CK9A 4LDUA 3J7AF 5J3BA 4Z8AA 3CC7T 4EPCA 5GAN6 4XU0A 1YITT 4F14A 2DL8A 2RB6A 1YP5A 2EYXA 4R56A 4M77E 4M75D 1PG5B 4WCIA 1M8MA 4M78D 1WA7A 4LD9K 1Y96B 3JCMd 1KIKA 1AZGB 3CBPA 3OYEA 1BK2A 2QQ9A 1S1NA 1WFWA 5CVIA 2K2VA 4MDWA 5HK0A 4L6V5 2EJGA 2DL7A 1HSQA 2DBKA 1AT1B 1IHVA 4VUBA 5GAN8 3LWIA 2E6ZA 4QVZA 3CEYA 3CCQT 4C92D 2M1HA 2YUOA 2RN8A 3OYAA 1VYVA 1KJWA 5GMKm 3LLRA 1VQ8A 5I11A 3JCMQ 2EVRA 1UDLA 1NPPA 4QQ6A 2AK5A 4BB7A 5LJ5j 2DFUA 3QWXX 2R58A 4J6YA 2LC4A 2QQRA 3TQ7P 5D6WA 3CPWA 3SHWA 2XDDA 1PKTA 1TXQA 2FZCB 4RTVA 1K4US 1X2QA 4O5VA 3I5RA 2NUTA 1IREB 4L5GA 1PWTA 1GBRA
chains in the Genus database with same CATH topology
1JO8A 2J6FA 4JJBA 1UTIA 4DEYA 4Z88A 3PVLA 2CSIA 4LN2A 1PKSA 2JM8A 2FPDA 2LX7A 2ABLA 3M0UA 1NG2A 5IHIA 2L2PA 5FWBA 2PNIA 3UA6A 1QKXA 2HBWA 2L3QA 2ENMA 3H0FA 1WDXA 4AG2C 1X43A 4J9EA 5I22A 2X3WD 2DBMA 2H8HA 1GCQC 1ABQA 5L23A 2EPDA 2EYZA 1JU5C 2J6OA 2YT6A 5GJVB 1AWOA 2YUPA 1OPLA 1SRMA 2G6FX 1MV3A 2DMOA 1W6XA 1AZEA 1LCKA 2A37A 4IIOA 2OJ2A 1WYXA 1YN8A 1WLPB 3EG1A 1VYUA 3UATA 1X69A 2KXDA 2W10A 4J9BA 2NUZA 2EBPA 2CH4W 2SRCA 2O2OA 2VVKA 2JTEA 2RMOA 3M0PA 1SSHA 1T0JA 4IIMA 1QKWA 2EGAA 2DRMA 3C0CA 1BU1A 4J9GA 1AWJA 1RUWA 2ROLA 2OI3A 2DX1A 3NGPA 2LJ0A 1X6BA 2F2VA 1TG0A 4CC7A 2VWFA 1CKBA 2M51A 2AZSA 3A98A 1VYTA 3VS6A 1T0HA 2FG0A 1MV0B 1M3BA 2F2WA 3M0RA 1EFNA 2ED0A 2V1RA 3RBBB 4LUEA 5FWCA 2KR3A 1QWFA 2RF0A 3UA7A 2EGCA 2SEMA 3R6NA 2LCSA 5IH2A 4ESRA 1SEMA 1ZBJA 1M27C 2RQVA 2FO0A 2C0TA 2A08A 1OV3A 2J6KA 2FRYA 1PNJA 2J7IA 1NYGA 2L3PA 4F16A 2CDTA 2EW3A 2W0ZA 4OMQA 1OEBA 4JPBW 3M0SA 1CSKA 2PTKA 4HVUA 2DRKA 1U5SA 1T3SA 4J9IA 1U06A 1NLOC 4J9HA 4LE9A 2KXCA 2BZXA 1VA7A 4D8KA 2RQUA 3I9QA 4RTWA 3VS3A 1GRIA 1BBZA 2EYWA 4EIKA 1Y57A 4RTTA 4A63B 1K9AA 3PE0A 4J9DA 1UFFA 1TUDA 2RQWA 4RTYA 2D8HA 1GFCA 1OPKA 4X1VA 4R0KA 2DM1A 2J05A 2XMFA 2LJ1A 2AKLA 3H0IA 2FRWA 1PHTA 1ZSGA 5IHKA 3ULRB 2DILA 2HEQA 1GFDA 2HSPA 4GBQA 1GBQA 2K6DA 4QT7A 1WXTA 4D8DA 1AEYA 1GCPA 1JQQA 2LMJA 3TVTA 1ABOA 4CC2A 3EG3A 1J3TA 2CT4A 3PVQA 2EKHA 2AKKA 4ZNXA 2RQTA 2F2XA 2FEIA 4AFUC 4RTZA 2C0OA 3KFVA 2EYYA 1YCSB 2YUNA 1K0SA 1WXUA 1YWOA 2GTOA 2I0NA 1T3LA 3VS4A 5IHNA 2JS2A 2DNUA 2JXBA 4RTUA 3VRYA 2KNBB 2A36A 2HCKA 1E6HA 3I35A 3ZL7C 2JS0A 2DF6A 2OAWA 1JEGA 4F17A 2D0NA 4K11A 2KRSA 4OMOA 1FYNA 1NM7A 2CUBA 1JXMA 2BZYA 2L3SA 2MIOA 3H41A 2LQWA 2JM9A 2MCNA 2RPNA 5FW9A 1HJDA 3VS5A 4JJDA 3JV3A 3SEMA 2LQNA 4AG1C 4AFQC 1OOTA 1Z9QA 2JT4A 2AZVA 4FSSA 2DJQA 1JXOA 4OMMA 3RNJA 2M0YA 4GLMA 1E6GA 2KRNA 1AVZC 1WI7A 1WXBA 4Z89A 2PZ1A 1V1CA 1Y0MA 2CSQA 2J06A 2KYBA 1RLPC 3VS2A 1CKAA 2V1QA 4AFSC 1BB9A 2LZ6B 4JJCA 1M30A 1H8KA 1NEBA 1SRLA 1XOVA 3EG0A 1MUZA 2LNHB 2YDLA 3CQTA 1UUEA 5HCKA 1UECA 2KGTA 3REAB 1UGVA 1YNZA 2KEAA 1W1FA 4CC4B 4ORZA 2ED1A 3QWYA 4RTXA 1ZX6A 1UG1A 4LNPA 2EQIA 3O5ZA 1RLQC 2MOXA 2VKNA 1WIEA 2YUQA 2GGRA 1X2KA 1YWPA 1NYFA 5GJWB 2RQRA 2YSQA 2NWMA 1H3HA 1NEGA 2LP5A 1I07A 2BZ8A 2D1XA 2DYBA 1AD5A 4OMPA 2DLPA 2LJ3A 4Y92A 2L0AA 2HDAA 2GQIA 3GBQA 2K79A 2O31A 2E5KA 1KFZA 4CC3A 2FPEA 1G2BA 2JW4A 3EGUA 3I5SA 5EC7A 1SPKA 4M4ZA 3H0HA 4KRTA 1AWWA 2ESWA 2K3BA 1N5ZA 1IO6A 3M0QA 2KBTA 2JMCA 2JMAA 1X27A 2CREA 4AFZC 1WX6A 2K7AA 2KT1A 1Z9ZA 2DE0X 2K9GA 2DA9A 4J9FA 4LUDA 1G83A 1AOJA 1SHFA 5ECAA 1ZUKA 3NPFA 1E7OA 3FJ5A 3EG2A 3TSWA 2C0IA 1SHGA 3M0TA 3REBB 2BTTA 1FMKA 2K2MA 2KROA 2CT3A 3THKA 2D8JA 1H92A 4Z8AA 2IIMA 1KSWA 2DL8A 4F14A 2EGEA 1B3QA 1YP5A 2ROTA 4OMLA 1PRLC 2EYXA 4OMNA 1K0XA 2P4RA 2GNCA 2DL4A 2GTJA 1A0NB 2DVJA 4WCIA 1M8MA 1WA7A 1K1ZA 1QCFA 1KIKA 2O88A 1AZGB 2CUDA 1ZUUA 1GCQA 1HD3A 1TUCA 3LH5A 1BK2A 1S1NA 2A28A 1I0CA 1UHCA 1WFWA 2FPFA 4HVVA 1GL5A 1X6GA 2KYMA 4JZ3A 1QLYA 1M3CA 2KRMA 1ZLMA 1M3AA 1ZUYA 2B86A 2DL7A 1HSQA 2RNAA 2DBKA 1UE9A 3VS7A 3IQLA 2YUOA 3NMZC 2RN8A 1B07A 1UJ0A 3VS1A 1VYVA 1KJWA 4JZ4A 3TSZA 3UF4A 2CH4A 1NLPC 2O9VA 4HVWA 4HXJA 1ARKA 5I11A 2EVRA 5IXFA 1UDLA 2KE9A 4DEXA 2X3XD 2AK5A 2DL5A 1W70A 2O9SA 1AWXA 4J9CA 3QWXX 2DL3A 1UJYA 1U3OA 2ECZA 3EHRA 1I1JA 4HCKA 2GBQA 1RI9A 1K76A 3NHNA 5IXBA 3SHWA 1PKTA 4RTVA 3EHQA 2QDLA 4RUGA 1K4US 1X2QA 2KT8A 3VRZA 3I5RA 1PRMC 3VS0A 1UHFA 1PWTA 1GBRA 1QWEA 3U23A 4E6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JO8 A;  2J6F A;  4JJB A;  1UTI A;  4DEY A;  4Z88 A;  3PVL A;  2CSI A;  4LN2 A;  1PKS A;  2JM8 A;  2FPD A;  2LX7 A;  2ABL A;  3M0U A;  1NG2 A;  5IHI A;  2L2P A;  5FWB A;  2PNI A;  3UA6 A;  1QKX A;  2HBW A;  2L3Q A;  2ENM A;  3H0F A;  1WDX A;  4AG2 C;  1X43 A;  4J9E A;  5I22 A;  2X3W D;  2DBM A;  2H8H A;  1GCQ C;  1ABQ A;  5L23 A;  2EPD A;  2EYZ A;  1JU5 C;  2J6O A;  2YT6 A;  5GJV B;  1AWO A;  2YUP A;  1OPL A;  1SRM A;  2G6F X;  1MV3 A;  2DMO A;  1W6X A;  1AZE A;  1LCK A;  2A37 A;  4IIO A;  2OJ2 A;  1WYX A;  1YN8 A;  1WLP B;  3EG1 A;  1VYU A;  3UAT A;  1X69 A;  2KXD A;  2W10 A;  4J9B A;  2NUZ A;  2EBP A;  2CH4 W;  2SRC A;  2O2O A;  2VVK A;  2JTE A;  2RMO A;  3M0P A;  1SSH A;  1T0J A;  4IIM A;  1QKW A;  2EGA A;  2DRM A;  3C0C A;  1BU1 A;  4J9G A;  1AWJ A;  1RUW A;  2ROL A;  2OI3 A;  2DX1 A;  3NGP A;  2LJ0 A;  1X6B A;  2F2V A;  1TG0 A;  4CC7 A;  2VWF A;  1CKB A;  2M51 A;  2AZS A;  3A98 A;  1VYT A;  3VS6 A;  1T0H A;  2FG0 A;  1MV0 B;  1M3B A;  2F2W A;  3M0R A;  1EFN A;  2ED0 A;  2V1R A;  3RBB B;  4LUE A;  5FWC A;  2KR3 A;  1QWF A;  2RF0 A;  3UA7 A;  2EGC A;  2SEM A;  3R6N A;  2LCS A;  5IH2 A;  4ESR A;  1SEM A;  1ZBJ A;  1M27 C;  2RQV A;  2FO0 A;  2C0T A;  2A08 A;  1OV3 A;  2J6K A;  2FRY A;  1PNJ A;  2J7I A;  1NYG A;  2L3P A;  4F16 A;  2CDT A;  2EW3 A;  2W0Z A;  4OMQ A;  1OEB A;  4JPB W;  3M0S A;  1CSK A;  2PTK A;  4HVU A;  2DRK A;  1U5S A;  1T3S A;  4J9I A;  1U06 A;  1NLO C;  4J9H A;  4LE9 A;  2KXC A;  2BZX A;  1VA7 A;  4D8K A;  2RQU A;  3I9Q A;  4RTW A;  3VS3 A;  1GRI A;  1BBZ A;  2EYW A;  4EIK A;  1Y57 A;  4RTT A;  4A63 B;  1K9A A;  3PE0 A;  4J9D A;  1UFF A;  1TUD A;  2RQW A;  4RTY A;  2D8H A;  1GFC A;  1OPK A;  4X1V A;  4R0K A;  2DM1 A;  2J05 A;  2XMF A;  2LJ1 A;  2AKL A;  3H0I A;  2FRW A;  1PHT A;  1ZSG A;  5IHK A;  3ULR B;  2DIL A;  2HEQ A;  1GFD A;  2HSP A;  4GBQ A;  1GBQ A;  2K6D A;  4QT7 A;  1WXT A;  4D8D A;  1AEY A;  1GCP A;  1JQQ A;  2LMJ A;  3TVT A;  1ABO A;  4CC2 A;  3EG3 A;  1J3T A;  2CT4 A;  3PVQ A;  2EKH A;  2AKK A;  4ZNX A;  2RQT A;  2F2X A;  2FEI A;  4AFU C;  4RTZ A;  2C0O A;  3KFV A;  2EYY A;  1YCS B;  2YUN A;  1K0S A;  1WXU A;  1YWO A;  2GTO A;  2I0N A;  1T3L A;  3VS4 A;  5IHN A;  2JS2 A;  2DNU A;  2JXB A;  4RTU A;  3VRY A;  2KNB B;  2A36 A;  2HCK A;  1E6H A;  3I35 A;  3ZL7 C;  2JS0 A;  2DF6 A;  2OAW A;  1JEG A;  4F17 A;  2D0N A;  4K11 A;  2KRS A;  4OMO A;  1FYN A;  1NM7 A;  2CUB A;  1JXM A;  2BZY A;  2L3S A;  2MIO A;  3H41 A;  2LQW A;  2JM9 A;  2MCN A;  2RPN A;  5FW9 A;  1HJD A;  3VS5 A;  4JJD A;  3JV3 A;  3SEM A;  2LQN A;  4AG1 C;  4AFQ C;  1OOT A;  1Z9Q A;  2JT4 A;  2AZV A;  4FSS A;  2DJQ A;  1JXO A;  4OMM A;  3RNJ A;  2M0Y A;  4GLM A;  1E6G A;  2KRN A;  1AVZ C;  1WI7 A;  1WXB A;  4Z89 A;  2PZ1 A;  1V1C A;  1Y0M A;  2CSQ A;  2J06 A;  2KYB A;  1RLP C;  3VS2 A;  1CKA A;  2V1Q A;  4AFS C;  1BB9 A;  2LZ6 B;  4JJC A;  1M30 A;  1H8K A;  1NEB A;  1SRL A;  1XOV A;  3EG0 A;  1MUZ A;  2LNH B;  2YDL A;  3CQT A;  1UUE A;  5HCK A;  1UEC A;  2KGT A;  3REA B;  1UGV A;  1YNZ A;  2KEA A;  1W1F A;  4CC4 B;  4ORZ A;  2ED1 A;  3QWY A;  4RTX A;  1ZX6 A;  1UG1 A;  4LNP A;  2EQI A;  3O5Z A;  1RLQ C;  2MOX A;  2VKN A;  1WIE A;  2YUQ A;  2GGR A;  1X2K A;  1YWP A;  1NYF A;  5GJW B;  2RQR A;  2YSQ A;  2NWM A;  1H3H A;  1NEG A;  2LP5 A;  1I07 A;  2BZ8 A;  2D1X A;  2DYB A;  1AD5 A;  4OMP A;  2DLP A;  2LJ3 A;  4Y92 A;  2L0A A;  2HDA A;  2GQI A;  3GBQ A;  2K79 A;  2O31 A;  2E5K A;  1KFZ A;  4CC3 A;  2FPE A;  1G2B A;  2JW4 A;  3EGU A;  3I5S A;  5EC7 A;  1SPK A;  4M4Z A;  3H0H A;  4KRT A;  1AWW A;  2ESW A;  2K3B A;  1N5Z A;  1IO6 A;  3M0Q A;  2KBT A;  2JMC A;  2JMA A;  1X27 A;  2CRE A;  4AFZ C;  1WX6 A;  2K7A A;  2KT1 A;  1Z9Z A;  2DE0 X;  2K9G A;  2DA9 A;  4J9F A;  4LUD A;  1G83 A;  1AOJ A;  1SHF A;  5ECA A;  1ZUK A;  3NPF A;  1E7O A;  3FJ5 A;  3EG2 A;  3TSW A;  2C0I A;  1SHG A;  3M0T A;  3REB B;  2BTT A;  1FMK A;  2K2M A;  2KRO A;  2CT3 A;  3THK A;  2D8J A;  1H92 A;  4Z8A A;  2IIM A;  1KSW A;  2DL8 A;  4F14 A;  2EGE A;  1B3Q A;  1YP5 A;  2ROT A;  4OML A;  1PRL C;  2EYX A;  4OMN A;  1K0X A;  2P4R A;  2GNC A;  2DL4 A;  2GTJ A;  1A0N B;  2DVJ A;  4WCI A;  1M8M A;  1WA7 A;  1K1Z A;  1QCF A;  1KIK A;  2O88 A;  1AZG B;  2CUD A;  1ZUU A;  1GCQ A;  1HD3 A;  1TUC A;  3LH5 A;  1BK2 A;  1S1N A;  2A28 A;  1I0C A;  1UHC A;  1WFW A;  2FPF A;  4HVV A;  1GL5 A;  1X6G A;  2KYM A;  4JZ3 A;  1QLY A;  1M3C A;  2KRM A;  1ZLM A;  1M3A A;  1ZUY A;  2B86 A;  2DL7 A;  1HSQ A;  2RNA A;  2DBK A;  1UE9 A;  3VS7 A;  3IQL A;  2YUO A;  3NMZ C;  2RN8 A;  1B07 A;  1UJ0 A;  3VS1 A;  1VYV A;  1KJW A;  4JZ4 A;  3TSZ A;  3UF4 A;  2CH4 A;  1NLP C;  2O9V A;  4HVW A;  4HXJ A;  1ARK A;  5I11 A;  2EVR A;  5IXF A;  1UDL A;  2KE9 A;  4DEX A;  2X3X D;  2AK5 A;  2DL5 A;  1W70 A;  2O9S A;  1AWX A;  4J9C A;  3QWX X;  2DL3 A;  1UJY A;  1U3O A;  2ECZ A;  3EHR A;  1I1J A;  4HCK A;  2GBQ A;  1RI9 A;  1K76 A;  3NHN A;  5IXB A;  3SHW A;  1PKT A;  4RTV A;  3EHQ A;  2QDL A;  4RUG A;  1K4U S;  1X2Q A;  2KT8 A;  3VRZ A;  3I5R A;  1PRM C;  3VS0 A;  1UHF A;  1PWT A;  1GBR A;  1QWE A;  3U23 A;  4E6R A; 
#chains in the Genus database with same CATH topology
 2QYZ A;  1W4S A;  4JRQ A;  2F1L A;  1VQO Q;  4HCB A;  4C0Z A;  1QP3 A;  4Z88 A;  2EIF A;  1KC8 C;  2JM8 A;  2ABL A;  2L2P A;  5FWB A;  2DAQ A;  1U8R A;  3CC4 A;  3H0F A;  3NTK A;  3QDF A;  2KDS A;  2H8H A;  1ABQ A;  5GAM g;  4GY5 A;  5L23 A;  4A53 A;  4N4H A;  5HY6 A;  1SRM A;  2K5L A;  1GXI E;  1IXD A;  2MYS A;  1MV3 A;  1AZE A;  3HRU A;  1YN8 A;  1M2V B;  1WLP B;  1QVG S;  1Q82 U;  1X69 A;  4PL6 A;  1YJW A;  3EAE A;  1VQ7 T;  4J9B A;  2EBP A;  4A4E A;  2JTE A;  1RAG B;  4XTU A;  3CCM A;  1QKW A;  5GAN 2;  4OP0 A;  2QQA A;  4JRI A;  3CCR A;  2HL3 A;  5AT1 B;  4QQG A;  2X9H A;  1YIT Q;  1CKB A;  2CP3 A;  3QJY A;  5CAI A;  2FG0 A;  1OU8 A;  1M3B A;  2F2W A;  1UGS B;  4XTZ A;  4RMO A;  1VQ4 A;  3BDU A;  4IUT A;  2XDB A;  1YJN A;  5LJ3 g;  3V7R A;  2OTJ T;  2QTV A;  2P0P A;  3BE3 A;  4LUE A;  4KGX B;  5FWC A;  2RHY A;  3UA7 A;  1BI3 A;  2MAM A;  3CXC A;  2LQK A;  2DK3 A;  1JJ2 S;  2BKD N;  4J7I A;  3QZ9 B;  2E12 A;  3G7Z A;  1M27 C;  4ZTF A;  2AT1 B;  2FO0 A;  1N8R U;  2RK2 A;  1EZZ B;  2K3Y A;  2D0Q B;  3F70 A;  3CCQ Q;  1SKU B;  2L8D A;  3QG1 A;  1YHQ A;  3QJ6 A;  2CKK A;  3N5B B;  2HNI A;  2LTO A;  3M0S A;  3NTI A;  3QBY A;  4M77 A;  3V8K A;  1F1B B;  3M56 A;  3QDR B;  5GAO p;  1YJ9 A;  2EFI A;  4J9I A;  3CXC P;  1KQS A;  1QVF S;  3LH0 A;  2KXC A;  3RIR A;  3VUB A;  5GMK j;  4FSX A;  2VXE A;  3JCM V;  4RTT A;  2DIQ A;  4A63 B;  3L2Q A;  5D6Y A;  3OQ5 A;  2DTI A;  4J9D A;  3L1A A;  1UFF A;  3S3O A;  1TUD A;  3QZ5 B;  4RTY A;  2D8H A;  4C8Q C;  3HSB A;  4MZP A;  1GFC A;  4X1V A;  2XKO C;  5GAO m;  3OYM A;  3CCS A;  3I55 T;  4ZTJ A;  3MP8 A;  2J05 A;  1TWB A;  2DIL A;  2HEQ A;  3P8H A;  4RCC A;  2HSP A;  4NL2 A;  1IHW A;  1GBQ A;  4QT7 A;  3CD6 A;  2CP5 A;  1KQS P;  1R77 A;  1GCP A;  3RER A;  4HT9 A;  3OW2 S;  3HFO A;  1I4K 1;  2CP6 A;  4CRI A;  1PD0 A;  5J39 A;  3G4S T;  4NOY A;  3KFV A;  1KHC A;  2XU8 A;  3T9N A;  5DM7 R;  2EYY A;  3H6Z A;  3CBM A;  1TS9 A;  2O4X A;  1WXU A;  1YWO A;  1M1K U;  2ZZD A;  3RES A;  3G6E A;  1WHJ A;  5KE2 A;  4KBM B;  5GAM f;  3X24 B;  2DNU A;  4C0D B;  1VQP A;  5GAN 3;  2KNB B;  3CC2 A;  2NUP A;  3CMA A;  1PSF A;  2ZPE B;  2JS0 A;  2QQS A;  1JEG A;  4F17 A;  3D7S B;  2XK0 A;  1M90 U;  2F5T X;  2BZY A;  3H41 A;  3C12 A;  1TSF A;  1WGS A;  5FW9 A;  4EMK B;  1HJD A;  2COW A;  1OOT A;  2DD4 A;  3CCJ T;  4FSS A;  1M9S A;  1E6G A;  4M7D G;  4C5E A;  4Z89 A;  2ZPF B;  1QVG P;  3EGD B;  1Y0M A;  4DBF A;  3VS2 A;  1ZA2 B;  1V29 B;  4PJO G;  3CCV T;  3HL8 A;  2E3H A;  2Y4Y A;  1M2O A;  1JJ2 A;  3CQT A;  2CZ1 B;  1TOV A;  2KGT A;  4E7L A;  1BKB A;  1YNZ A;  3JCM c;  1R0C B;  4OB0 B;  1W1F A;  2HL5 C;  2LX9 A;  4MMK A;  4N4G A;  3S3M A;  4HA8 A;  5GAO l;  3A8O B;  1ZX6 A;  3O5Z A;  3X20 B;  2MOX A;  4FT2 A;  4BE1 A;  2GGR A;  1C0M A;  2YRV A;  1X2K A;  1NYF A;  3NFC A;  2NWM A;  1U1S A;  2BZ8 A;  5LL6 S;  1AD5 A;  3EG9 A;  1OI1 A;  2I2L A;  4OMP A;  4EMG A;  1QP2 A;  4Y92 A;  2GQI A;  2K79 A;  1JJ2 P;  1KFZ A;  2QA4 A;  3H8Z A;  1VQL Q;  3EFO B;  5GAN 4;  5KYX A;  2E64 A;  1AWW A;  2XG8 D;  4FW1 A;  5KCO A;  3KBG A;  2KBT A;  2JMC A;  3FEO A;  1M1K R;  2WAC A;  4PJO B;  3I55 Q;  1Y7X A;  4LUD A;  1G83 A;  1YIJ T;  1AOJ A;  4M7A G;  3CCE T;  3EH1 A;  2KI7 A;  3EG2 A;  2MWO A;  2D6F A;  3OSV A;  1BCO A;  4F7U G;  2DEQ A;  1WPY A;  1QVF P;  2RK1 A;  2LVM A;  1VQ9 T;  1RAH B;  2X4J A;  5KYN A;  4X9D A;  2EWN A;  1QCO A;  4LD6 A;  2HZY A;  2X4Y A;  2IIM A;  2ROT A;  4OML A;  3G4S Q;  1PRL C;  1R8O B;  1YI2 A;  1MGQ A;  2P4R A;  3INZ A;  4KT0 E;  4FYW B;  3MPU B;  1I5L A;  1ZSZ C;  1K1Z A;  1EX4 A;  2PVO B;  4M75 G;  2OTL T;  4M78 G;  1TUC A;  1PSE A;  1S72 T;  1X6O A;  4A54 A;  2L5Q A;  4HVV A;  1GL5 A;  2G3R A;  5CCA A;  1QLY A;  2KRM A;  4PJO D;  7AT1 B;  3OW2 P;  2HKQ B;  1ZBX A;  2LQ8 A;  2XI9 A;  2M16 A;  2RNA A;  1VQK A;  3IQL A;  1FMV A;  2DET A;  3CCJ Q;  2IG0 A;  2QEX T;  1UJ0 A;  1UGQ B;  3P8B B;  2CH4 A;  3X26 B;  2JOY A;  1NLP C;  2DTH A;  4C92 G;  4FL6 A;  4DEX A;  4HKE A;  3CCV Q;  2Y4X A;  5HK3 A;  4E7K A;  3QHS A;  5A0L A;  1UJY A;  2ECZ A;  3EHR A;  4DQ2 A;  2RI3 A;  2GBQ A;  1RAI B;  2CP0 A;  5GAN h;  1K76 A;  3Q1J A;  2GQV A;  5IXB A;  1VQN T;  4DBR A;  2AIR B;  2KT8 A;  1N6A A;  2OX7 A;  4E7H A;  1PRM C;  1UHF A;  3GNF B;  1PCX A;  3LGL A;  2R5M A;  3JCM h;  2RI5 A;  2LRQ A;  1PD1 A;  2J6F A;  1UTI A;  4JJB A;  3A8H B;  4M7D F;  4DEY A;  3QUI A;  2CSI A;  1PKS A;  2FPD A;  8ATC B;  2ZGW A;  3OY9 A;  1D0X A;  2EJF A;  3NTH A;  3I56 T;  4XU1 A;  1QKX A;  1K9M C;  2DIG A;  4PK4 A;  3ZBD A;  2H3J A;  1X43 A;  2DBM A;  1MND A;  3QKJ A;  4FYY B;  2YT6 A;  2FHD A;  2RI2 A;  1AWO A;  2YUP A;  1NJI C;  3OMC A;  2G6F X;  5CO7 A;  1OQK A;  1RL2 A;  2A37 A;  4IIO A;  1MHN A;  3DB3 A;  1M1G A;  3UAT A;  5GAN d;  1VQM T;  1YIJ Q;  4A4G A;  2KXD A;  2YWW A;  3CCE Q;  3M59 A;  2SRC A;  1VQ8 T;  2VVK A;  3HHT B;  3SD4 A;  1SSH A;  3AHU A;  1VQO A;  1IB8 A;  3JCM P;  1UB4 A;  4BDY A;  1Q7Y C;  4C8Q A;  3FDR A;  2OI3 A;  3GP8 A;  1OZ3 A;  1Y07 A;  5GAN e;  2F2V A;  1TG0 A;  4CC7 A;  2RJC A;  2M51 A;  2AZS A;  1VYT A;  1T0H A;  3HP9 A;  3MHX A;  3EGX A;  3TRE A;  1K8A R;  2XDP A;  1EFN A;  5KYY A;  2V1R A;  2OTL Q;  3UWN A;  1N8R C;  3L2R A;  1S72 Q;  3CCL A;  2KR3 A;  1QWF A;  2EGC A;  2R5A A;  1VUB A;  3JCM e;  4M7A F;  5GAM j;  4JUV A;  4ESR A;  1G5V A;  1KD1 U;  1ZBJ A;  3LWH A;  4F7U F;  1O75 A;  2A0F B;  1AHJ B;  1MMG A;  2EQM A;  3S6W A;  1PNJ A;  2QEX Q;  3QSU A;  3JRZ A;  2L3P A;  3OYY A;  3X28 B;  3UT1 A;  1K73 R;  2NUT B;  1IGU A;  1V76 A;  4JPB W;  1G3T A;  3OYB A;  2MPX C;  3OBY A;  4M75 F;  1G8X A;  1U06 A;  4M78 F;  1NLO C;  3OB9 A;  1YJW T;  4J9H A;  4C0G A;  3J81 E;  3HTR A;  3QII A;  3TU4 K;  4OVA A;  2DO3 A;  1VA7 A;  2RQU A;  5FU6 B;  2MMP A;  4FYV B;  2HQE A;  1BBZ A;  2EYW A;  4EIK A;  3PE0 A;  2RD1 A;  3CCR T;  5DLQ E;  5LJ3 j;  3RDV A;  3FJP A;  1OPK A;  4J83 A;  1KG1 A;  3V8L A;  4OGE A;  1XTD A;  2FRW A;  1ZA1 B;  3E9F A;  2JVV A;  1ZSG A;  4C92 F;  1N27 A;  3GF5 A;  4ANJ A;  1D1C A;  1BCM A;  3SWN C;  5CKB A;  1YJN T;  4PJL A;  3I56 Q;  2M9U A;  4JRK A;  4D8D A;  3FRN A;  1AEY A;  1JQQ A;  5LJ5 h;  1PM3 A;  2GCX A;  2JTM A;  1TU0 B;  4C0F A;  4BY6 C;  2RQT A;  2FEI A;  4M77 G;  2M0O A;  1D0Y A;  2C0O A;  4KGZ B;  3JCM X;  1MMN A;  1W2B A;  1QMC A;  1YCS B;  1BI1 A;  2QAZ A;  3G71 T;  4QW2 A;  1VQM Q;  1M90 C;  2I0N A;  1T3L A;  2DZ9 A;  2DPP B;  3JCM f;  3CC7 Q;  3MP6 A;  1YHQ T;  2PVD B;  2JS2 A;  2JXB A;  3VRY A;  2YHT A;  1KD1 R;  4IUU A;  4E7Z A;  3G1J A;  1VQ5 A;  1BI0 A;  1G3S A;  2KRS A;  4RCB A;  5KH6 A;  1Q86 R;  1NM7 A;  1O9S A;  2LT4 A;  5KYU A;  1JXM A;  4EMH A;  1YJ9 T;  2L3S A;  3SB2 A;  2LQW A;  2E65 A;  4IUQ A;  2DVE A;  3CPF A;  3V8J A;  3QXE B;  5C0M A;  2MCN A;  1SG5 A;  4BAC A;  2BE7 D;  3E19 A;  3SEM A;  2LDM A;  2LQN A;  4E7I A;  3L2U A;  1Z9Q A;  2L89 A;  4FYX B;  4HCC A;  1W2B P;  3PNW C;  1RAF B;  3RR6 A;  4IUP A;  2KRN A;  5C6S A;  1QVP A;  1VIF A;  2V8I A;  5LJ5 d;  1HXD A;  1OX8 A;  1M30 A;  1RAE B;  2COY A;  1BIB A;  3EFR A;  4QKU A;  1UUE A;  4M77 B;  1ZSZ A;  4M7D E;  5I21 A;  3MCA B;  5CKH A;  3A8L B;  2ED1 A;  2VYT A;  5LJ5 e;  3PTA A;  1U1T A;  1D3B B;  2MF2 A;  1WIE A;  4IUR A;  1IGQ A;  4YTL A;  2RQR A;  2LP5 A;  1D3B A;  1OUL A;  2X4X A;  5LJ3 d;  2P0K A;  3G6E T;  2L0A A;  2HDA A;  2OAU A;  3GBQ A;  2E5K A;  4NL3 A;  3M53 A;  3CC2 T;  3CMA T;  1SPK A;  3PGG A;  1B34 A;  3H0H A;  4KRT A;  3OMG A;  5L8R E;  1K9M R;  5CQX A;  4FIB A;  4LDW A;  3M0Q A;  1X27 A;  2CRE A;  2FZG B;  2P0Q A;  5LJ3 e;  2VGM A;  4AFZ C;  4FW2 A;  1WX6 A;  4O6J A;  3JAM E;  4M77 D;  1WHM A;  1WQW A;  3OYH A;  2V26 A;  3GLX A;  2MWP A;  2X4W A;  1E7O A;  2O4X B;  3FJ5 A;  2CZ6 B;  1YJN Q;  1HK9 A;  3L2Z A;  2EQJ A;  3QPH A;  2QTX A;  2QGG A;  1Q81 C;  4LXC A;  1NBE B;  4CI0 C;  1QVG A;  2NUP B;  2D8J A;  1VQ7 Q;  4N0A C;  4PLI A;  5GMK h;  2EAY A;  2ATC B;  1B3Q A;  2EGE A;  1N9R A;  3WVE B;  4M7A E;  1Q7Y R;  1VQL A;  1SSF A;  1K0X A;  3E1S A;  2MK5 A;  2GNC A;  1RAA B;  2DL4 A;  2DVJ A;  4F7U E;  3G71 Q;  3VJP A;  4BE2 A;  2CUD A;  3M4Y A;  2PQW A;  1FMW A;  1HD3 A;  2NYS A;  2FYK A;  1SF9 A;  3I55 A;  2FPF A;  2JTF A;  3L2W A;  1M3C A;  1WHH A;  1M3A A;  1ZUY A;  3HFN A;  4Z02 A;  2OTJ Q;  2B86 A;  4Q5W A;  2AHJ B;  2QA4 T;  2RHU A;  3VS7 A;  4M75 E;  2DD5 A;  4OB3 B;  2RJD A;  1VQ6 T;  4Y91 A;  4M78 E;  3GIB A;  3VYH B;  3HKS A;  1EIF A;  4ME7 A;  3TSZ A;  5FU7 C;  1KQ2 A;  2O9V A;  4HVW A;  4HXJ A;  3G4S A;  4E47 A;  2X3X D;  1XJW B;  2A7Y A;  2O9S A;  4LDY A;  2HAX A;  2E41 A;  4J9C A;  3OYN A;  3CCU T;  1D09 B;  2DTO A;  3QYH B;  3EG9 B;  3NHN A;  4C92 E;  5KYW A;  2DXC A;  2QDL A;  4RUG A;  3VRZ A;  1QVF A;  5KYX B;  3VS0 A;  2WSF E;  2LCL A;  1KC8 R;  5GMK e;  5J26 A;  2VB6 A;  3MEU A;  3CCJ A;  2VGN A;  3S3N A;  3M0U A;  1NG2 A;  4OB1 B;  4FT4 A;  5IHI A;  3BDL A;  2YRC A;  2PUO B;  3PT9 A;  4JDS A;  2L3Q A;  3DKM A;  3CCV A;  4XU2 A;  1WDX A;  5I22 A;  2X3W D;  2DXT A;  1GCQ C;  3KXT A;  2EPD A;  2EYZ A;  1JU5 C;  2P4T A;  2RHX A;  5GJV B;  1QW1 A;  2KMT A;  1OPL A;  5A2Q E;  3QO3 A;  1W6X A;  3L42 A;  2OJ2 A;  3OW2 A;  4E7S A;  2NUZ A;  4ZN1 A;  4V2S A;  4MDX A;  4DBQ A;  2VC8 A;  3M57 A;  3KUF A;  4OMF B;  2GFA A;  3M4G A;  5GAN 5;  1T0J A;  3FIF A;  2EGA A;  5GAO q;  2ZPI B;  1LJO A;  2DRM A;  5DY9 A;  1BU1 A;  2CZ7 B;  5GAO r;  3M54 A;  4J9G A;  1RUW A;  3SDZ A;  1FX7 A;  3SWN B;  2DX1 A;  3NGP A;  2LJ0 A;  3BFM A;  1X6B A;  1KQ1 A;  3R6O A;  3SWN A;  3A98 A;  3UDC A;  3PFS A;  2RO0 A;  2ED0 A;  2GF7 A;  2R57 A;  4JS5 A;  2RF0 A;  2SEM A;  3RMQ A;  4N4I A;  4KUI A;  1YIJ A;  5IH2 A;  2CS7 A;  3X25 B;  4ZGJ B;  1SEM A;  4WF2 A;  2C0T A;  2DZC A;  1DJ7 B;  2A08 A;  1OV3 A;  2DKG A;  2WSE E;  1K8A U;  2VAS A;  2J6K A;  1VQ6 Q;  2FRY A;  4A4F A;  2KK4 A;  3MEW A;  2EW3 A;  3CME T;  4RKU E;  4C8Q G;  1TTH B;  2PU9 B;  2NLU A;  4JLI A;  3CPW S;  1HYO A;  3JSC A;  4A4K A;  3CCU Q;  3OS2 A;  2OTL A;  5GAN g;  3JB9 G;  1S72 A;  4TVR A;  3I9Q A;  3VS3 A;  2VUB A;  1VQO T;  3VYG A;  1Y57 A;  1K73 U;  4XTY A;  3ZFJ A;  2RQW A;  4PJO F;  2RHZ A;  4R0K A;  2DM1 A;  3JCM g;  4XTX A;  2HD0 A;  3OA6 A;  4JJN K;  2LJ1 A;  2AKL A;  4M75 A;  1Q82 C;  2QEX A;  1PHT A;  4M78 A;  2RJF A;  3ULR B;  1VOM A;  1MNE A;  2B8A A;  1NZ9 A;  1GFD A;  3MEV A;  4GBQ A;  3RKY A;  3J80 E;  2F5K A;  4C0D C;  2YLB A;  2VXF A;  1WXT A;  2DER A;  3CCL T;  4CC2 A;  3EG3 A;  1WHK A;  1J3T A;  4ELY C;  4XAX B;  2CT4 A;  5GAO n;  2AKK A;  4ZNX A;  1Q81 R;  1JB0 E;  4AFU C;  5DLO A;  4C8Q B;  4RTZ A;  4BI4 A;  3OYF A;  1VQ9 Q;  4BD3 A;  1YCY A;  1K0S A;  4C92 A;  2D9T A;  2GTO A;  2BE9 B;  2VV5 A;  3LGF A;  5FRM A;  3VS4 A;  3JCM b;  5IN1 A;  3EGX B;  2V8J A;  4E2F B;  3I35 A;  2DF6 A;  2OAW A;  5KYY B;  2D0N A;  4J7F A;  4K11 A;  4OMO A;  2MIO A;  5AYF A;  3JB9 H;  3OYI A;  3I56 A;  2JM9 A;  2RJE A;  2RPN A;  2WSC E;  3VS5 A;  4JJD A;  2COZ A;  4KUL A;  1I81 A;  1Y96 A;  4AFQ C;  3M5A A;  2AZV A;  1M4Z A;  2HSE B;  1C6V X;  3CXC S;  5HKC A;  1WHG A;  4GLM A;  1KK7 A;  2X51 A;  5D6X A;  1WXB A;  5D7U A;  1XQH A;  1V1C A;  1Q86 U;  3GPL A;  3CC4 T;  2PUK B;  3EH2 A;  1CKA A;  2V1Q A;  1UGP B;  3A8G B;  1H8K A;  4N0A A;  1SRL A;  3PIO A;  1XOV A;  4BUG A;  4C8Q D;  3EG0 A;  1VQM A;  3UPU A;  1MUZ A;  2LNH B;  2YDL A;  3OS0 A;  3CC7 A;  5HCK A;  1YIT A;  1UEC A;  1UGV A;  1H64 1;  2P84 A;  4PKC C;  4R55 A;  5CIU A;  3JB9 D;  4M7D C;  4RTX A;  4KUD K;  4LNP A;  1UG1 A;  2C06 A;  2YRD A;  4PFZ A;  1KQS S;  2VKN A;  2YUQ A;  3O8V A;  3WXM B;  3M55 A;  4PFO A;  3CME Q;  1VQN Q;  4PJO C;  5GJW B;  3CCM T;  2YSQ A;  1FWZ A;  1NEG A;  4LDX A;  2D1X A;  2L3R A;  4FCY A;  2DLP A;  2LJ3 A;  5FU7 B;  5IT9 E;  1LPL A;  1D1B A;  2XIC A;  3HPW A;  1WQ7 A;  4CC3 A;  2YLC A;  2QQB A;  1G2B A;  2JW4 A;  2QXF A;  3I5S A;  4MZT A;  5EG2 A;  5EC7 A;  3CCQ A;  3JB9 I;  2LNV A;  5GAM h;  4M4Z A;  1IZ6 A;  1VQ5 T;  4QQD A;  2ESW A;  2K3B A;  1BYM A;  1UGR B;  1VQ4 T;  4B9X A;  2JMA A;  3OYL A;  4KH0 B;  2K7A A;  1RAD B;  1Y71 A;  3LYI A;  3M58 A;  3TEE A;  1Z9Z A;  3OYK A;  2DA9 A;  2FVU A;  4J9F A;  4J6X A;  5FRN A;  2QI2 A;  3A5Z B;  1M1K C;  5GAN f;  3CPW P;  1YFN A;  5A0D A;  5ECA A;  3WVD B;  4GLK A;  1ZUK A;  4C8Q F;  3TSW A;  2C0I A;  1K9M U;  1SHG A;  4ATO A;  2BTT A;  3CCL Q;  1FMK A;  2K2M A;  4DOV A;  2KRO A;  5LJ5 g;  2CT3 A;  3THK A;  3DLM A;  3LX7 A;  2KQW A;  1H92 A;  1VQ8 Q;  3JB9 F;  1KSW A;  1NJI U;  4HT8 A;  2HMA A;  1M2V A;  4X34 A;  5KYU B;  2QK0 A;  4OMN A;  3OYG A;  2GTJ A;  1A0N B;  4M7A C;  2E70 A;  2BIV A;  2JN0 A;  2BUD A;  5LJ3 h;  5CQY A;  1QCF A;  2O88 A;  5CKD A;  2QAS A;  5GAM d;  1ZUU A;  1GCQ A;  3LH5 A;  2A28 A;  3VUZ A;  1OYX A;  5GMK l;  1PC0 A;  3VV0 A;  1I0C A;  1UHC A;  4A4H A;  2DJZ A;  1X6G A;  2V8K A;  2KYM A;  4JZ3 A;  2E6N A;  1Q7Y U;  3BW1 A;  1VIE A;  1ZLM A;  4P5N A;  2KVQ G;  2EYQ A;  4ZGD B;  2XHC A;  3E9G A;  1G3Y A;  4XU3 A;  3CCS T;  1UE9 A;  2ZPH B;  5IAY A;  1Q95 G;  1ZSZ B;  3NMZ C;  5GAM e;  1B07 A;  3VS1 A;  4JZ4 A;  1VQ7 A;  3UF4 A;  3DLL A;  2JZ2 A;  4M75 C;  4M78 C;  3L2V A;  4B9W A;  1ARK A;  3CD6 T;  3CC4 Q;  4IKF A;  5IXF A;  2JJ9 A;  2KE9 A;  2DL5 A;  3MKD A;  1W70 A;  4EDU A;  3G71 A;  3DB4 A;  1AWX A;  4PJJ A;  2M02 A;  4PJO E;  2DL3 A;  2K57 A;  1U3O A;  4JS4 A;  1D1A A;  4HCK A;  1I1J A;  2JNG A;  4Y28 E;  4ZN3 A;  6AT1 B;  1X75 C;  1RI9 A;  3C4S A;  3EHQ A;  2Y90 A;  3AT1 B;  2Z0W A;  1YJW Q;  4C92 C;  1B34 B;  2OTJ A;  1QWE A;  4AT1 B;  3MET A;  1VQP T;  2E4H A;  3U23 A;  4E6R A;  1JO8 A;  1VQL T;  1JBM A;  3CCM Q;  5CKF A;  3PVL A;  9ATC B;  4UC4 A;  5A0G A;  4LN2 A;  2LX7 A;  3CCR Q;  4KH1 B;  2PNI A;  3UA6 A;  2HBW A;  4IUV A;  2E10 A;  1Q82 R;  2ENM A;  2QDY B;  2HBP A;  4AG2 C;  4J9E A;  1ZQ1 A;  1NJI R;  1VQ5 Q;  1KC8 U;  1NPR A;  2J6O A;  3OSS C;  1QCN A;  1VQ4 Q;  1UEB A;  3GNG A;  1ZHI A;  2DMO A;  3MP1 A;  1NE8 A;  1B7T A;  3A8M B;  4QVD A;  3LW5 E;  1LCK A;  2RM4 A;  1WYX A;  3EG1 A;  1VYU A;  2FZK B;  3RKW A;  1WJQ A;  1D0Z A;  2W10 A;  1LOJ A;  2CH4 W;  1IRX A;  2O2O A;  4E7J A;  1X01 A;  2RMO A;  1JRI A;  3M0P A;  2YXY A;  4DBH A;  4IIM A;  3H9N A;  2DEU A;  1I5O B;  2GFU A;  4ELZ C;  1ACM B;  3C0C A;  1AWJ A;  3VU3 C;  1YHQ Q;  2H3E B;  3C94 A;  1C1A A;  2ROL A;  1N9S A;  4D6W A;  2VWF A;  4JLG A;  4II1 A;  2F69 A;  1M8V A;  4DOW A;  3VS6 A;  1N8R R;  1MV0 B;  1M5Q 1;  1YJ9 Q;  2ZPB B;  3M0R A;  5I2M A;  5LJ5 f;  5CR2 A;  3RBB B;  4WTO B;  1KHI A;  4XQ3 A;  1K8A C;  3MEA A;  3R6N A;  4OF1 A;  2LCS A;  4C5I A;  4KGV B;  4M77 F;  4MML A;  3SFM A;  2ZCF B;  4EMK A;  3FLG A;  5I2S A;  2RQV A;  3JCM W;  5FU6 C;  3CCS Q;  4FU6 A;  5KCH A;  3MO8 A;  3EGD A;  2J7I A;  1NYG A;  5KYW B;  4F16 A;  4RG2 A;  2CDT A;  2W0Z A;  4OMQ A;  3CD6 Q;  1OEB A;  5LJ3 f;  1CSK A;  3C95 A;  1K73 C;  2PTK A;  4HVU A;  2DRK A;  1U5S A;  1T3S A;  2EJ9 A;  4OB2 B;  2PVG B;  1RI0 A;  4LE9 A;  2BZX A;  1YI2 T;  4D8K A;  2KAF A;  2RA2 A;  4RTW A;  4J8O A;  4PJN A;  1GRI A;  3URG A;  4C8Q E;  1K9A A;  8AT1 B;  3G6E Q;  2XD0 A;  4C5G A;  2ZAE A;  2EQK A;  2QGF B;  2MI6 A;  4MZM A;  3ZEH A;  1VQP Q;  4DA4 A;  3CC2 Q;  3CMA Q;  2O01 E;  3EFS A;  2K5F A;  1WHL A;  1LNX A;  1VQ6 A;  2XMF A;  1MMA A;  1BIA A;  3H0I A;  3HRT A;  2HQH A;  5IHK A;  4M7D B;  3OYC A;  4PLL A;  3EFO A;  2E1H A;  4L59 A;  5GAN 7;  4OGC A;  2K6D A;  3M9Q A;  1VQK T;  4M7D A;  3BY7 A;  2LMJ A;  3TVT A;  1ABO A;  4X9C A;  3PVQ A;  2EKH A;  4PNO A;  1QQJ A;  3CCU A;  4PJO A;  3CBO A;  2F2X A;  2K5I A;  5GMK i;  4NS5 A;  1FXX A;  3OS5 A;  1M90 R;  2YUN A;  1WJR A;  1M1F A;  2FB7 A;  2KSS A;  4BE0 A;  2CGH A;  4LDV A;  1H3Z A;  5IHN A;  2RHI A;  1OZ2 A;  4RTU A;  3V7C A;  3OYJ A;  5KE3 A;  2IVW A;  2A36 A;  2HCK A;  1E6H A;  5GAN j;  3ZL7 C;  2JUF A;  1Q81 U;  3OS1 A;  3A1P A;  4QVC A;  1FYN A;  4BY6 B;  1KD1 C;  2CUB A;  3RMS A;  4RG8 A;  3P8D A;  5FRO A;  4M77 C;  2A3L A;  5M9O A;  1Q86 C;  2K3X A;  3TCJ A;  4JRP A;  3JV3 A;  4M7D D;  1WJS A;  4XTV A;  4AG1 C;  2JT4 A;  3ER0 A;  2DJQ A;  1JXO A;  4OMM A;  3RNJ A;  4J6W A;  2M0Y A;  3ME9 A;  4BI3 A;  3CCE A;  3ASK A;  1P92 A;  2CP2 A;  1AVZ C;  1WI7 A;  3JCM J;  2PZ1 A;  1TH7 A;  4BI8 B;  2CSQ A;  2J06 A;  2KYB A;  1RLP C;  4F04 B;  2QA4 Q;  4AFS C;  1MMD A;  2X35 A;  1VQ9 A;  1BB9 A;  2LZ6 B;  4JJC A;  1NEB A;  3RKX A;  4B6M A;  5FLX E;  4M7A B;  4FM4 B;  3RUX A;  2ZPG B;  2DXB A;  3REA B;  2DYI A;  2E5Q A;  4F7U B;  4M7A A;  2KEA A;  3QYG B;  3PMI A;  4CC4 B;  1G3W A;  1I8F A;  4ORZ A;  4BDZ A;  1WZO A;  2XID A;  2IPO B;  4F7U A;  1R0B G;  3QWY A;  1TUG B;  2CP7 A;  2EQI A;  4ZGE B;  1RLQ C;  2CYZ B;  3PMT A;  1YWP A;  2HQX A;  4PJM A;  1H3H A;  1I07 A;  2DYB A;  3FB9 A;  1OX9 A;  2EKO A;  3PIP A;  3OYD A;  3FC3 A;  4M75 B;  2HKN A;  3OBW A;  2O31 A;  4M78 B;  4C5H A;  2EQU A;  1WNL A;  2FPE A;  1YI2 Q;  2E3I A;  3EGU A;  3JB9 J;  2K4Y A;  1LVK A;  4HCZ A;  2CZ0 B;  2QG9 B;  3E2U A;  1YBY A;  1N5Z A;  1IO6 A;  4PFP A;  3HRS A;  4AMC A;  3V7S A;  1BI2 A;  4XTW A;  4M7A D;  2KT1 A;  3GOX A;  2DE0 X;  2K9G A;  4XK8 E;  2RH2 A;  1OU9 A;  1SHF A;  1XNI A;  3NPF A;  4C92 B;  4J5Y A;  5CKE A;  2FL7 A;  4EMK C;  1RAB B;  2LCC A;  3CME A;  1VQN A;  1RAC B;  3MJX A;  3VKI A;  1VQK Q;  3M0T A;  3REB B;  2LT1 A;  1W2B S;  2KY9 A;  2DXU A;  5CK9 A;  4LDU A;  3J7A F;  5J3B A;  4Z8A A;  3CC7 T;  4EPC A;  5GAN 6;  4XU0 A;  1YIT T;  4F14 A;  2DL8 A;  2RB6 A;  1YP5 A;  2EYX A;  4R56 A;  4M77 E;  4M75 D;  1PG5 B;  4WCI A;  1M8M A;  4M78 D;  1WA7 A;  4LD9 K;  1Y96 B;  3JCM d;  1KIK A;  1AZG B;  3CBP A;  3OYE A;  1BK2 A;  2QQ9 A;  1S1N A;  1WFW A;  5CVI A;  2K2V A;  4MDW A;  5HK0 A;  4L6V 5;  2EJG A;  2DL7 A;  1HSQ A;  2DBK A;  1AT1 B;  1IHV A;  4VUB A;  5GAN 8;  3LWI A;  2E6Z A;  4QVZ A;  3CEY A;  3CCQ T;  4C92 D;  2M1H A;  2YUO A;  2RN8 A;  3OYA A;  1VYV A;  1KJW A;  5GMK m;  3LLR A;  1VQ8 A;  5I11 A;  3JCM Q;  2EVR A;  1UDL A;  1NPP A;  4QQ6 A;  2AK5 A;  4BB7 A;  5LJ5 j;  2DFU A;  3QWX X;  2R58 A;  4J6Y A;  2LC4 A;  2QQR A;  3TQ7 P;  5D6W A;  3CPW A;  3SHW A;  2XDD A;  1PKT A;  1TXQ A;  2FZC B;  4RTV A;  1K4U S;  1X2Q A;  4O5V A;  3I5R A;  2NUT A;  1IRE B;  4L5G A;  1PWT A;  1GBR A; 
#chains in the Genus database with same CATH homology
 1JO8 A;  2J6F A;  4JJB A;  1UTI A;  4DEY A;  4Z88 A;  3PVL A;  2CSI A;  4LN2 A;  1PKS A;  2JM8 A;  2FPD A;  2LX7 A;  2ABL A;  3M0U A;  1NG2 A;  5IHI A;  2L2P A;  5FWB A;  2PNI A;  3UA6 A;  1QKX A;  2HBW A;  2L3Q A;  2ENM A;  3H0F A;  1WDX A;  4AG2 C;  1X43 A;  4J9E A;  5I22 A;  2X3W D;  2DBM A;  2H8H A;  1GCQ C;  1ABQ A;  5L23 A;  2EPD A;  2EYZ A;  1JU5 C;  2J6O A;  2YT6 A;  5GJV B;  1AWO A;  2YUP A;  1OPL A;  1SRM A;  2G6F X;  1MV3 A;  2DMO A;  1W6X A;  1AZE A;  1LCK A;  2A37 A;  4IIO A;  2OJ2 A;  1WYX A;  1YN8 A;  1WLP B;  3EG1 A;  1VYU A;  3UAT A;  1X69 A;  2KXD A;  2W10 A;  4J9B A;  2NUZ A;  2EBP A;  2CH4 W;  2SRC A;  2O2O A;  2VVK A;  2JTE A;  2RMO A;  3M0P A;  1SSH A;  1T0J A;  4IIM A;  1QKW A;  2EGA A;  2DRM A;  3C0C A;  1BU1 A;  4J9G A;  1AWJ A;  1RUW A;  2ROL A;  2OI3 A;  2DX1 A;  3NGP A;  2LJ0 A;  1X6B A;  2F2V A;  1TG0 A;  4CC7 A;  2VWF A;  1CKB A;  2M51 A;  2AZS A;  3A98 A;  1VYT A;  3VS6 A;  1T0H A;  2FG0 A;  1MV0 B;  1M3B A;  2F2W A;  3M0R A;  1EFN A;  2ED0 A;  2V1R A;  3RBB B;  4LUE A;  5FWC A;  2KR3 A;  1QWF A;  2RF0 A;  3UA7 A;  2EGC A;  2SEM A;  3R6N A;  2LCS A;  5IH2 A;  4ESR A;  1SEM A;  1ZBJ A;  1M27 C;  2RQV A;  2FO0 A;  2C0T A;  2A08 A;  1OV3 A;  2J6K A;  2FRY A;  1PNJ A;  2J7I A;  1NYG A;  2L3P A;  4F16 A;  2CDT A;  2EW3 A;  2W0Z A;  4OMQ A;  1OEB A;  4JPB W;  3M0S A;  1CSK A;  2PTK A;  4HVU A;  2DRK A;  1U5S A;  1T3S A;  4J9I A;  1U06 A;  1NLO C;  4J9H A;  4LE9 A;  2KXC A;  2BZX A;  1VA7 A;  4D8K A;  2RQU A;  3I9Q A;  4RTW A;  3VS3 A;  1GRI A;  1BBZ A;  2EYW A;  4EIK A;  1Y57 A;  4RTT A;  4A63 B;  1K9A A;  3PE0 A;  4J9D A;  1UFF A;  1TUD A;  2RQW A;  4RTY A;  2D8H A;  1GFC A;  1OPK A;  4X1V A;  4R0K A;  2DM1 A;  2J05 A;  2XMF A;  2LJ1 A;  2AKL A;  3H0I A;  2FRW A;  1PHT A;  1ZSG A;  5IHK A;  3ULR B;  2DIL A;  2HEQ A;  1GFD A;  2HSP A;  4GBQ A;  1GBQ A;  2K6D A;  4QT7 A;  1WXT A;  4D8D A;  1AEY A;  1GCP A;  1JQQ A;  2LMJ A;  3TVT A;  1ABO A;  4CC2 A;  3EG3 A;  1J3T A;  2CT4 A;  3PVQ A;  2EKH A;  2AKK A;  4ZNX A;  2RQT A;  2F2X A;  2FEI A;  4AFU C;  4RTZ A;  2C0O A;  3KFV A;  2EYY A;  1YCS B;  2YUN A;  1K0S A;  1WXU A;  1YWO A;  2GTO A;  2I0N A;  1T3L A;  3VS4 A;  5IHN A;  2JS2 A;  2DNU A;  2JXB A;  4RTU A;  3VRY A;  2KNB B;  2A36 A;  2HCK A;  1E6H A;  3I35 A;  3ZL7 C;  2JS0 A;  2DF6 A;  2OAW A;  1JEG A;  4F17 A;  2D0N A;  4K11 A;  2KRS A;  4OMO A;  1FYN A;  1NM7 A;  2CUB A;  1JXM A;  2BZY A;  2L3S A;  2MIO A;  3H41 A;  2LQW A;  2JM9 A;  2MCN A;  2RPN A;  5FW9 A;  1HJD A;  3VS5 A;  4JJD A;  3JV3 A;  3SEM A;  2LQN A;  4AG1 C;  4AFQ C;  1OOT A;  1Z9Q A;  2JT4 A;  2AZV A;  4FSS A;  2DJQ A;  1JXO A;  4OMM A;  3RNJ A;  2M0Y A;  4GLM A;  1E6G A;  2KRN A;  1AVZ C;  1WI7 A;  1WXB A;  4Z89 A;  2PZ1 A;  1V1C A;  1Y0M A;  2CSQ A;  2J06 A;  2KYB A;  1RLP C;  3VS2 A;  1CKA A;  2V1Q A;  4AFS C;  1BB9 A;  2LZ6 B;  4JJC A;  1M30 A;  1H8K A;  1NEB A;  1SRL A;  1XOV A;  3EG0 A;  1MUZ A;  2LNH B;  2YDL A;  3CQT A;  1UUE A;  5HCK A;  1UEC A;  2KGT A;  3REA B;  1UGV A;  1YNZ A;  2KEA A;  1W1F A;  4CC4 B;  4ORZ A;  2ED1 A;  3QWY A;  4RTX A;  1ZX6 A;  1UG1 A;  4LNP A;  2EQI A;  3O5Z A;  1RLQ C;  2MOX A;  2VKN A;  1WIE A;  2YUQ A;  2GGR A;  1X2K A;  1YWP A;  1NYF A;  5GJW B;  2RQR A;  2YSQ A;  2NWM A;  1H3H A;  1NEG A;  2LP5 A;  1I07 A;  2BZ8 A;  2D1X A;  2DYB A;  1AD5 A;  4OMP A;  2DLP A;  2LJ3 A;  4Y92 A;  2L0A A;  2HDA A;  2GQI A;  3GBQ A;  2K79 A;  2O31 A;  2E5K A;  1KFZ A;  4CC3 A;  2FPE A;  1G2B A;  2JW4 A;  3EGU A;  3I5S A;  5EC7 A;  1SPK A;  4M4Z A;  3H0H A;  4KRT A;  1AWW A;  2ESW A;  2K3B A;  1N5Z A;  1IO6 A;  3M0Q A;  2KBT A;  2JMC A;  2JMA A;  1X27 A;  2CRE A;  4AFZ C;  1WX6 A;  2K7A A;  2KT1 A;  1Z9Z A;  2DE0 X;  2K9G A;  2DA9 A;  4J9F A;  4LUD A;  1G83 A;  1AOJ A;  1SHF A;  5ECA A;  1ZUK A;  3NPF A;  1E7O A;  3FJ5 A;  3EG2 A;  3TSW A;  2C0I A;  1SHG A;  3M0T A;  3REB B;  2BTT A;  1FMK A;  2K2M A;  2KRO A;  2CT3 A;  3THK A;  2D8J A;  1H92 A;  4Z8A A;  2IIM A;  1KSW A;  2DL8 A;  4F14 A;  2EGE A;  1B3Q A;  1YP5 A;  2ROT A;  4OML A;  1PRL C;  2EYX A;  4OMN A;  1K0X A;  2P4R A;  2GNC A;  2DL4 A;  2GTJ A;  1A0N B;  2DVJ A;  4WCI A;  1M8M A;  1WA7 A;  1K1Z A;  1QCF A;  1KIK A;  2O88 A;  1AZG B;  2CUD A;  1ZUU A;  1GCQ A;  1HD3 A;  1TUC A;  3LH5 A;  1BK2 A;  1S1N A;  2A28 A;  1I0C A;  1UHC A;  1WFW A;  2FPF A;  4HVV A;  1GL5 A;  1X6G A;  2KYM A;  4JZ3 A;  1QLY A;  1M3C A;  2KRM A;  1ZLM A;  1M3A A;  1ZUY A;  2B86 A;  2DL7 A;  1HSQ A;  2RNA A;  2DBK A;  1UE9 A;  3VS7 A;  3IQL A;  2YUO A;  3NMZ C;  2RN8 A;  1B07 A;  1UJ0 A;  3VS1 A;  1VYV A;  1KJW A;  4JZ4 A;  3TSZ A;  3UF4 A;  2CH4 A;  1NLP C;  2O9V A;  4HVW A;  4HXJ A;  1ARK A;  5I11 A;  2EVR A;  5IXF A;  1UDL A;  2KE9 A;  4DEX A;  2X3X D;  2AK5 A;  2DL5 A;  1W70 A;  2O9S A;  1AWX A;  4J9C A;  3QWX X;  2DL3 A;  1UJY A;  1U3O A;  2ECZ A;  3EHR A;  1I1J A;  4HCK A;  2GBQ A;  1RI9 A;  1K76 A;  3NHN A;  5IXB A;  3SHW A;  1PKT A;  4RTV A;  3EHQ A;  2QDL A;  4RUG A;  1K4U S;  1X2Q A;  2KT8 A;  3VRZ A;  3I5R A;  1PRM C;  3VS0 A;  1UHF A;  1PWT A;  1GBR A;  1QWE A;  3U23 A;  4E6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...