1K0XA

Solution structure of melanoma inhibitory activity protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
108
structure length
108
Chain Sequence
MGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Melanoma Derived Growth Regulatory Protein
publication title Solution structure and dynamics of melanoma inhibitory activity protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 15
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2001-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1k0xA00
3I35A 1WXUA 1U5SA 1AD5A 3VS0A 2KGTA 3UA6A 2O88A 4K11A 4Z89A 1XOVA 2FO0A 2JM8A 2KT8A 4OMNA 5GJVB 2DNUA 2LQNA 2JS2A 2FRWA 1AVZC 2EGEA 2KROA 4WCIA 4AFQC 2KBTA 1X6GA 2YDLA 3I5RA 2AKKA 2KT1A 1I1JA 1Y57A 2LNHB 2KRSA 2PNIA 2W10A 4RTXA 1BU1A 1BBZA 1G2BA 2D8JA 1WIEA 2GTOA 2BTTA 2IIMA 2LJ1A 2BZYA 2ED0A 2GTJA 2LJ0A 1KFZA 4J9FA 4DEYA 1J3TA 2EYYA 3REAB 2RPNA 1I0CA 2O9VA 2PTKA 3THKA 1X69A 2DF6A 2DILA 1KIKA 4JZ3A 4JJDA 5HCKA 1W1FA 2MCNA 2GBQA 2YSQA 4Z8AA 1RLQC 1M30A 1CSKA 3TVTA 1JO8A 3UATA 1S1NA 2EYZA 3VRYA 2M51A 1YWPA 1GCPA 1W6XA 1H8KA 1PKTA 2LMJA 1G83A 4AFZC 3QWYA 2ABLA 1ABQA 4ORZA 2BZXA 3CQTA 4OMLA 4AFSC 1UDLA 2ED1A 1KSWA 3I9QA 1NM7A 1BK2A 1I07A 2HBWA 3ZL7C 1VYTA 2G6FX 1RUWA 5FWCA 2EKHA 4HVWA 3EHRA 2RQUA 3JV3A 1ABOA 3M0RA 4F17A 1UUEA 2AZVA 2OAWA 2RQWA 4RTWA 1B3QA 2LZ6B 4E6RA 1GFDA 1OPLA 1AOJA 4X1VA 2KYMA 4CC2A 1CKBA 3R6NA 1PRLC 3UF4A 2O2OA 2J06A 1NEGA 2KEAA 3FJ5A 4J9GA 2EYWA 4Y92A 2JW4A 4A63B 1YN8A 2JMAA 4GLMA 1GL5A 1JU5C 1SSHA 2C0TA 2GGRA 2KNBB 2DRKA 2YT6A 4FSSA 2AKLA 2HDAA 2B86A 2X3WD 1Z9QA 1WXTA 1T3LA 1U06A 4IIOA 1T0JA 3EG0A 4HXJA 2DLPA 1ZUYA 1QWFA 3PE0A 4J9CA 4OMOA 1UG1A 2GQIA 3M0TA 2I0NA 1K76A 1E6GA 1TG0A 1B07A 5EC7A 1V1CA 2FPEA 1QKXA 1WX6A 2CT4A 5IHIA 2JM9A 4QT7A 1UTIA 1ZUKA 1WI7A 2D1XA 1MV0B 1ZUUA 2J6KA 2J7IA 3A98A 2NUZA 2CUBA 2AK5A 2XMFA 1QKWA 2NWMA 3KFVA 1ZLMA 1M27C 1ZBJA 3M0SA 3VS1A 1K9AA 4D8DA 2SRCA 2CREA 1AZEA 1M8MA 1JXMA 1YCSB 1HSQA 2HSPA 2DJQA 2LQWA 4R0KA 1NYFA 2CSQA 1NG2A 1M3BA 1T0HA 2CH4W 1OV3A 1NLOC 4OMMA 3H0HA 2C0OA 2L2PA 4Z88A 2A37A 2DL8A 2EYXA 4AFUC 3VS2A 1H92A 4JPBW 1IO6A 2ECZA 3SEMA 1GRIA 2LX7A 3UA7A 1K1ZA 2A28A 1X2KA 3EG1A 1YNZA 2P4RA 5I22A 1YWOA 3QWXX 5IH2A 1UJYA 1SEMA 1SHGA 2EBPA 5FW9A 2D8HA 2YUNA 1AEYA 4DEXA 2J6OA 2KE9A 2HCKA 2OJ2A 4RTVA 1K0XA 4J9EA 2AZSA 3NGPA 2VKNA 1WDXA 3M0PA 3REBB 4HVUA 3PVQA 1W70A 2JXBA 1GCQC 2PZ1A 2DL4A 3GBQA 1WYXA 3VS4A 1UFFA 1WXBA 2DE0X 1OOTA 1MUZA 2F2VA 1QLYA 2RN8A 3VS3A 2CSIA 2D0NA 2VVKA 3VS6A 1E6HA 2BZ8A 2K3BA 1SRLA 2LP5A 2DL3A 1UHCA 1VYVA 2CT3A 2HEQA 2FPFA 1PRMC 4HCKA 3I5SA 4CC4B 1CKAA 4LUDA 2K79A 2RF0A 2J6FA 5FWBA 1X6BA 4J9DA 1OEBA 3H0IA 4ZNXA 2C0IA 1BB9A 1UECA 2X3XD 3NPFA 1A0NB 5IXFA 4RTZA 2DBKA 1Y0MA 1H3HA 1X43A 2KXCA 4JJCA 1SRMA 2CH4A 1RLPC 2YUQA 4F16A 2L3SA 2SEMA 3EG2A 1PKSA 1QWEA 1WA7A 3NHNA 1PWTA 4ESRA 4AG2C 2RQVA 4JJBA 2EPDA 3U23A 2ENMA 1WLPB 2ESWA 2FEIA 1UJ0A 5GJWB 2EQIA 4GBQA 2V1QA 2O9SA 2ROTA 3H41A 1ZX6A 4OMPA 5IHKA 1AWXA 1U3OA 3VS7A 2K2MA 1LCKA 4IIMA 3EGUA 4RTTA 1TUDA 2H8HA 2A08A 1T3SA 1OPKA 2ROLA 4LE9A 1HD3A 1N5ZA 5L23A 4CC3A 1VA7A 2JTEA 2K6DA 1TUCA 1ZSGA 2O31A 2LCSA 2DRMA 2KXDA 2F2WA 1M3AA 2DL5A 5IHNA 2EVRA 1NYGA 3VS5A 3ULRB 2FG0A 1HJDA 2A36A 2RQRA 2OI3A 1NEBA 1SHFA 2K7AA 3H0FA 1MV3A 2DYBA 2YUPA 5ECAA 2DA9A 2JMCA 3TSZA 3VRZA 1GBQA 2V1RA 1PNJA 1AWWA 1FYNA 1YP5A 4J9BA 4AG1C 1JEGA 2K9GA 3NMZC 2W0ZA 4D8KA 1K4US 2KRMA 2KRNA 4JZ4A 1JXOA 2F2XA 2LJ3A 2QDLA 3EHQA 2FPDA 4F14A 3SHWA 2DBMA 1PHTA 4J9IA 1NLPC 4LN2A 4M4ZA 1X2QA 1X27A 2MOXA 1UGVA 4RTYA 1ARKA 2EGCA 2JT4A 1SPKA 3EG3A 5IXBA 2YUOA 2DL7A 3IQLA 2RMOA 3O5ZA 4LUEA 2DVJA 1GBRA 2DX1A 2E5KA 3PVLA 4LNPA 2EGAA 2EW3A 2L3PA 1E7OA 4J9HA 2MIOA 2DMOA 1UHFA 1UE9A 2L3QA 3RNJA 1FMKA 1RI9A 4KRTA 2GNCA 3TSWA 2RQTA 3C0CA 4EIKA 4CC7A 1EFNA 2KR3A 1K0SA 2KYBA 1AWOA 2J05A 1QCFA 1JQQA 3M0UA 1M3CA 2JS0A 1GCQA 2FRYA 1AZGB 2VWFA 3LH5A 1KJWA 5I11A 2CDTA 4HVVA 1VYUA 3RBBB 2L0AA 2DM1A 3M0QA 4RTUA 1GFCA 1Z9ZA 4OMQA 1AWJA 2CUDA 1WFWA 2RNAA 2M0YA 4RUGA
chains in the Genus database with same CATH superfamily
1WXUA 4PJNA 1U5SA 5FLXE 4OGCA 3VS0A 2VASA 2CS7A 3OYDA 1VQMQ 4C8QC 3CCMQ 2JM8A 3VKIA 4OMNA 2WACA 5KCHA 2NUTA 4C92B 2LDMA 4AFQC 1W2BP 3A8LB 3CPWA 2HMAA 2AKKA 4M75D 4ELYC 2LNHB 4L6V5 1H641 2DYIA 1LVKA 3MCAB 8ATCB 4E7HA 2P0KA 2IIMA 2LJ1A 1D09B 2BIVA 1WQ7A 2LJ0A 1RABB 3CCJA 4FYVB 4B9WA 2QASA 3GF5A 2WSFE 2PTKA 4EMKB 1Y07A 2H3JA 3THKA 4PJOA 2PVDB 4FM4B 3UT1A 2VGNA 5LJ3g 2F5KA 4LDVA 1KIKA 4CRIA 2O01E 2ZPEB 4ZTJA 4XTUA 2DEUA 2ZPGB 2QQRA 1R77A 1KQSP 1H8KA 1DJ7B 1OULA 2DFUA 1OZ2A 3CC2Q 4BI3A 4BI4A 2Y4XA 4OVAA 1UDLA 4ZTFA 1XNIA 2EFIA 2DAQA 4V2SA 4OGEA 1BCOA 2EJFA 2MMPA 1VQ5T 3CC7Q 4NL2A 1ZBXA 1Q86R 3I55A 1BK2A 2EYQA 3I56Q 1VQ8A 2YLBA 3ZL7C 2G6FX 1RUWA 4KUIA 1OU9A 3L2RA 1BIBA 4RTWA 1IGQA 1B3QA 2LZ6B 4F7UG 3OA6A 1GFDA 3AT1B 2NUPA 4LDYA 5CIUA 4CC2A 1UB4A 3CMAT 1I8FA 3FLGA 3UF4A 3WVDB 3OS0A 3EGDB 3QDRB 1PC0A 5CK9A 2EYWA 4A63B 2LT1A 1D3BA 2XG8D 1YN8A 1I5LA 1VQKQ 3CCVQ 2KNBB 2XU8A 4BUGA 2B86A 2X3WD 4M77C 1ZA2B 3OW2P 1U06A 2DLPA 4XK8E 5GAN6 3PE0A 2GQIA 4BY6C 1IXDA 1FMVA 1Q81U 4JLGA 2OTJQ 4Y28E 1QKXA 1WX6A 2PVGB 1NJIC 4F7UB 3X25B 1N8RU 4QT7A 1YITA 1UTIA 1ZUKA 1WI7A 2GFAA 2JVVA 3TEEA 5D6WA 2CUBA 1KHIA 1RAAB 1YJNA 1S72T 5IAYA 3KFVA 1MMDA 1VIEA 3VS1A 2A3LA 1D1CA 4D8DA 5GANf 2PQWA 2QA4Q 2CZ1B 2I2LA 3OS2A 4Y91A 3BY7A 4OB2B 4R0KA 2COYA 1NG2A 1VQ6T 2MPXC 4PJLA 4XQ3A 3CCSA 3PNWC 5LJ3h 1TSFA 2L2PA 2HL3A 2DL8A 3O8VA 3JCMd 1H92A 5HK0A 1VQ4Q 2CGHA 2QG9B 3VU3C 2A28A 3KBGA 3VV0A 3EG1A 4A53A 4MZTA 3QJ6A 4HCZA 3VUZA 4LDXA 1WNLA 4XTYA 4M7AC 5D6XA 5CR2A 4M75G 5LL6S 3PIPA 2M02A 1Y96A 4C0DB 1QP2A 1M5Q1 1RADB 5GAOr 4DEXA 4IUTA 2COZA 1G3TA 2DZCA 4RTVA 3HHTB 4M75E 2VKNA 3M0PA 1JB0E 1YJ9T 2V8IA 4QVZA 3T9NA 3PVQA 3E2UA 1GCQC 3MEVA 1WYXA 3G6ET 2YRDA 3VS4A 1UFFA 2DE0X 2VB6A 1QLYA 4NS5A 1G8XA 1IGUA 1YHQT 3HRSA 2BZ8A 1KHCA 4PL6A 1VYVA 2FPFA 4HCKA 3I5SA 4LUDA 5HY6A 2RF0A 3JCMg 5FWBA 3EFOB 1X6BA 4RCCA 2CP3A 3H0IA 4M75B 3L42A 6AT1B 2OTLT 1YIJQ 4KGVB 2E6NA 2P0PA 2CP6A 5IXFA 2L5QA 5LJ5d 5FU7C 1H3HA 3GIBA 1RLPC 4ELZC 2L3SA 3RKWA 2K57A 3RMQA 1QWEA 1YBYA 1PWTA 4ESRA 2RQVA 1VQ5A 2EPDA 2ESWA 3META 5GJWB 2RA2A 3CMET 1Q86C 4GBQA 1QVGA 2XI9A 1LOJA 3M59A 2K2MA 1C0MA 3EG9B 5GANe 5KCOA 2HZYA 1TUDA 4Z02A 1ZSZB 1XQHA 4M7DA 2ROLA 1HD3A 3JB9I 2CP5A 4DA4A 2K6DA 3CMAA 2LCSA 1ZSGA 2DRMA 2KXDA 2RJDA 2M16A 1LJOA 4WF2A 2B8AA 3LLRA 1K73R 3INZA 3L2WA 2ZCFB 3CD6Q 2FG0A 2HQHA 2RH2A 3CCJQ 1N27A 5LJ5g 2QQAA 4C92C 3WXMB 2WSEE 1Q82R 3MKDA 3VRZA 4EPCA 2V1RA 2ZPFB 1W4SA 2JUFA 2EKOA 3CXCP 1JEGA 2K9GA 4D8KA 2KRNA 4JZ4A 1KD1R 2FPDA 4F14A 2M1HA 2QDYB 4FSXA 4JS5A 1PHTA 1RACB 2IVWA 4M4ZA 1X27A 4PJOG 5CKDA 3QXEB 4EMKC 2CZ6B 4J8OA 4OF1A 3QHSA 2E70A 1NJIU 2R5MA 3EG3A 3HSBA 4PJOE 2LCCA 2C06A 2DL7A 3V7RA 3GP8A 1S72A 3CPWP 5FRMA 4JJNK 2NUTB 2JN0A 3HFNA 1GBRA 4LNPA 3I55Q 2CKKA 4J6XA 1ZA1B 4J7FA 2HQEA 3OYLA 3HRTA 4LD9K 2OX7A 5J39A 3JCMh 1FMKA 2DXBA 3ME9A 2GNCA 2DTHA 2F1LA 3TSWA 1QVFS 4CC7A 1K0SA 2KYBA 1QCFA 4PJOB 3FDRA 2JS0A 2VC8A 4JRQA 1VQNA 1VYUA 3RBBB 2M9UA 8AT1B 1PM3A 2FZGB 2RD1A 2IPOB 4KGZB 4BD3A 1WJSA 2QI2A 4IUPA 3VYGA 1YJ9A 1AWJA 1WFWA 3CEYA 2HKQB 3I35A 2V8JA 1AD5A 2KGTA 5CCAA 3GNGA 4K11A 3JB9D 3G6EA 2KT8A 3Q1JA 4IURA 1OQKA 4MDXA 3S3MA 1YHQA 2EGEA 4KBMB 4WCIA 1MMGA 1X6GA 3LWIA 2DK3A 1QVFA 3R6OA 2KT1A 1MNDA 1I1JA 1Y57A 2PNIA 3RIRA 3A8OB 2MAMA 2QEXA 1VQ8T 1YJNQ 3QUIA 2GTOA 4FU6A 1RAHB 3MP8A 1Q7YR 3FC3A 2XK0A 2OTLA 3JCMV 5GANj 1KQ2A 4DEYA 1WHLA 3SWNA 3ZBDA 5LJ3f 1FMWA 2EYYA 1M90C 1QP3A 1X69A 2DILA 3CCSQ 3RDVA 1IHVA 1VQ7T 4PFPA 1BI1A 1VQPT 3OQ5A 4JJDA 5HCKA 5GAN8 2GBQA 1MMNA 4E47A 2L3RA 4OMFB 3CC4A 5EG2A 1JO8A 3UATA 2L89A 2M51A 4ZN3A 1D1AA 3CMEA 1NPRA 1UGSB 1GCPA 1W6XA 2LMJA 3QWYA 3S3NA 4EMHA 1XJWB 3SB2A 2LT4A 1PG5B 2RHUA 1ABQA 1Q86U 2GQVA 3DB3A 4OMLA 3CQTA 1QVPA 3QYHB 2ED1A 2ZPIB 2K5IA 5DM7R 3RERA 1YITT 3MJXA 4J6YA 3CBOA 1JJ2A 3JRZA 1K73C 2EKHA 2RB6A 3DLLA 4C5HA 2Z0WA 4C0DC 3J81E 3M0RA 5HKCA 4ZGEB 1UUEA 2RQWA 2OAWA 3JB9F 4MZMA 1AOJA 5KH6A 2K2VA 1Q82C 2JTFA 4A4KA 5DY9A 2O2OA 2KEAA 3HP9A 3FJ5A 4J9GA 2JW4A 4LDWA 1KD1C 4GLMA 2KSSA 1GL5A 1OZ3A 2C0TA 2DRKA 1X6OA 2IG0A 1WHGA 4IIOA 3EG0A 1EZZB 4M78D 4O6JA 5GAN3 4J9CA 4OMOA 1M2VA 5KE2A 1Y96B 1E6GA 2OAUA 4CI0C 1VOMA 1TG0A 1VQ5Q 3EH2A 2P84A 2V26A 2CT4A 5IHIA 3LGLA 1PCXA 1RL2A 4C0GA 4C5EA 2MF2A 1FX7A 1N9RA 1MV0B 4FYWB 3PTAA 3OYGA 2ZPBB 4JRPA 1QKWA 1WHKA 1ZLMA 1M27C 2EJ9A 3EGXB 1ZBJA 3CMAQ 2Y90A 3HRUA 4C8QD 1K9AA 3QZ9B 4PFZA 4M77A 1XTDA 2CREA 1M8MA 1JXMA 2PVOB 2HSPA 2DJQA 1M1FA 1KC8R 3OYAA 1VQOT 3LH0A 3QO3A 1M3BA 4M7DG 4PNOA 1R0CB 1N9SA 2HNIA 3MP1A 1NLOC 1QCNA 1ZSZC 5C6SA 2E5QA 4Z88A 2A37A 2EYXA 4M7DE 3PGGA 3OY9A 1MNEA 3SEMA 2DVEA 1K1ZA 1X2KA 4N0AA 4ZGJB 1C1AA 4GY5A 5AT1B 2EAYA 2EQKA 2XDBA 1SEMA 1SHGA 3OYKA 2DXUA 4FT4A 5GAN5 4DBHA 1QVGP 2KE9A 2E4HA 2AZSA 1HK9A 4HVUA 3CCQT 1BI2A 1SKUB 2E3IA 3CCUT 2PZ1A 1S72Q 1OYXA 4YTLA 2DERA 4RKUE 1Q7YC 1OOTA 4M7DB 4M78F 2RK1A 1M1GA 1M1KR 3JCMf 2F5TX 1I81A 2MK5A 2VVKA 1E6HA 3GPLA 2LP5A 1WHMA 2DL3A 2X4JA 1VQ6Q 2D9TA 5DLQE 2ATCB 1NPPA 4E7SA 1VQ7A 5KE3A 3OBYA 4M7AA 2K79A 2R58A 2J6FA 1I5OB 3S6WA 1M90U 1VQPA 4XTXA 4J9DA 1M4ZA 1OEBA 1R0BG 4FW2A 2X4WA 1IREB 1WQWA 5I2SA 2DBKA 1RAEB 2HAXA 4QQGA 3J80E 4J6WA 4C8QF 2M0OA 2A0FB 2VGMA 5FU6C 2QAZA 3E1SA 2KXCA 4JJCA 4DQ2A 5GAMd 2SEMA 4E7JA 3EG2A 4MMLA 1YJ9Q 3NHNA 4XU0A 3U23A 1OI1A 3M5AA 4XAXB 2CZ0B 4D6WA 1TOVA 2JNGA 4PJOC 2JJ9A 1V76A 3VS7A 4QVDA 4M77D 4DOWA 3EGUA 1YHQQ 3GLXA 5CQXA 2A08A 1UGPB 1IRXA 1T3SA 1K73U 4J7IA 1N5ZA 1G5VA 5FRNA 3SDZA 3EH1A 2JTEA 4JS4A 1TUCA 2K5LA 5LJ5f 2F2WA 2XHCA 4RCBA 1NYGA 2EVRA 3VS5A 3ULRB 1Q82U 1B34B 2OTLQ 3OSSC 3UDCA 2A36A 2RQRA 1NEBA 2KK4A 3X28B 1SHFA 3HL8A 3FJPA 3M57A 1KD1U 5ECAA 2DA9A 3P8BB 1U8RA 4OP0A 2FL7A 4L5GA 5GAN7 1W2BS 3TSZA 5D6YA 5GAMg 3OYIA 1AWWA 3OYYA 1YP5A 3QPHA 1VQNT 2KRMA 1JXOA 2LJ3A 3EHQA 3ASKA 3SHWA 5GAOl 3CMEQ 3E9FA 1NLPC 1X2QA 2EWNA 3ZFJA 3TREA 3QG1A 2A7YA 2K3YA 4NOYA 4HT9A 2LQKA 3L1AA 2COWA 2FB7A 1HXDA 4Q5WA 5IXBA 2YUOA 3BE3A 5GAN2 4C8QE 1QVFP 4M7AD 3PVLA 3ER0A 4C92A 2EGAA 2EW3A 4O5VA 2YWWA 4J9HA 4HT8A 2HSEB 2LCLA 2MIOA 2PUOB 1VQOA 1H3ZA 1LNXA 3JCMW 2QEXT 1KC8C 5GMKm 1TXQA 1K9MR 2D0QB 1Q95G 2E10A 1RI9A 5CKFA 4KRTA 3LX7A 3C0CA 4M77F 4EIKA 3QZ5B 5A0DA 2FZCB 5CKEA 1M90R 1RAFB 2LC4A 5GMKl 1M3CA 3X26B 1QQJA 1F1BB 1KJWA 4HVVA 2QA4T 1VQ9T 4N4HA 4DBQA 3M0QA 4RTUA 4NL3A 1GFCA 1M9SA 3JB9J 1X01A 3BDLA 2LX9A 3NFCA 1Z9ZA 1ZQ1A 3EFSA 1D0YA 2RJCA 3CC4T 3CCQA 2CUDA 2DD5A 3KUFA 3CCUA 2YXYA 4Z89A 2NLUA 2FO0A 5GJVB 4BE2A 2LQNA 2JS2A 5LJ5e 2EIFA 3OBWA 1IHWA 3OMCA 2KBTA 1M1KC 1JJ2P 1Q7YU 1QW1A 3JCMJ 3I5RA 4JDSA 4PKCC 2DIQA 3HPWA 3OW2S 2KRSA 1UGQB 1G2BA 1BCMA 3OYCA 2D8JA 3FIFA 1G3SA 2DPPB 1JRIA 1KFZA 2QYZA 4PJJA 4RMOA 3C94A 2RPNA 2O9VA 4M7AF 4ZGDB 1HYOA 5GAMh 3CCET 1Y7XA 5GMKe 3EGDA 4JZ3A 2YSQA 1RLQC 4QW2A 1OX9A 1PD0A 3MEAA 1CSKA 5GAOn 1MMAA 3V8LA 3QDFA 4EMGA 4KH0B 3NTHA 3MHXA 4M77E 1M2VB 4C92D 5KYUA 4AFZC 3G4ST 2ABLA 4HA8A 4ORZA 2BZXA 2G3RA 3CC2A 3VYHB 4DBFA 2DKGA 4PLLA 1WJRA 1KSWA 3G7ZA 2LNVA 1VQ8Q 3P8HA 2H3EB 3MEWA 1YJWT 3CCLT 1VYTA 2ZPHB 3I56A 2P4TA 4XU3A 5IN1A 5KYYA 3EHRA 3JV3A 4JRKA 3G71T 4F17A 2AZVA 3KXTA 4E6RA 1OPLA 2QQBA 4X1VA 1VQ7Q 1FXXA 1WPYA 4UC4A 4EDUA 3R6NA 3M58A 1PRLC 1VQPQ 4A54A 2DD4A 2V8KA 2CP0A 4Y92A 4M7DC 1SSHA 1LPLA 3P8DA 4FSSA 2AKLA 3EFRA 3HFOA 4GLKA 3RR6A 1QWFA 1UG1A 3M53A 3M0TA 5A0LA 1K76A 4KGXB 4M7AE 4PJMA 1D1BA 3TQ7P 1KQ1A 4M78A 2FPEA 4BACA 1YITQ 4X34A 5GMKi 3PFSA 2X4YA 2D1XA 4E7KA 4BB7A 2EQJA 2J7IA 3A98A 1VUBA 2NUZA 2XMFA 2HL5C 2NWMA 1K9MC 4KT0E 4C92F 1KC8U 3A8HB 5LJ5j 4XTZA 2NUPB 3M0SA 3FB9A 2DIGA 1KK7A 3LW5E 4VUBA 2DZ9A 2RHXA 2HKNA 1HSQA 2LQWA 4FCYA 3OYEA 2R57A 2QA4A 2VXFA 1VQ9A 3JCMc 4MMKA 3CPFA 4AT1B 4C8QA 3QSUA 4JUVA 4ANJA 1D3BB 1IZ6A 2CH4W 1D0ZA 3VJPA 5CKBA 5GANh 2C0OA 4AFUC 3VS2A 1IO6A 2ECZA 1GRIA 2LX7A 2R5AA 2HQXA 5I22A 1YWOA 4BE0A 5IH2A 2BE7D 1UJYA 3CCRT 2EBPA 5GMKj 2YUNA 2X4XA 4PK4A 1AEYA 3C4SA 3VUBA 2HCKA 2OJ2A 1K0XA 4J9EA 3REBB 3C12A 2L8DA 3X20B 1W70A 2JXBA 2Y4YA 1M1KU 3GNFB 1SSFA 4HKEA 3OYMA 2DL4A 2LRQA 2CP2A 3GBQA 4OB3B 1EX4A 2PU9B 2PUKB 3EG9A 3CXCS 4ME7A 3V7SA 2RN8A 3LWHA 1EIFA 2K3BA 1SRLA 1VQOQ 1UHCA 3A8MB 3CCEA 5M9OA 1PRMC 4IUVA 1CKAA 1M8VA 1VQLT 2E41A 1YFNA 3QIIA 1WGSA 5I21A 3CPWS 3WVEB 4X9CA 1BB9A 3RKYA 1RI0A 2HD0A 1YIJA 4C92E 3NPFA 1Y0MA 3JCMb 3G4SA 2XDPA 3PMTA 2CH4A 2YUQA 4MZPA 4F16A 4E7IA 3D7SB 4M75C 1ACMB 1WA7A 4JJBA 2RK2A 2QXFA 3C95A 3CCUQ 1YI2T 1UJ0A 2BE9B 1YJWA 3CCLA 5FROA 2O9SA 2ROTA 4B9XA 5AYFA 4HCBA 3H41A 1V29B 3DB4A 5LJ3e 3A8GB 4E2FB 1UEBA 2H8HA 3G71A 1RAIB 1Y71A 4LE9A 3QBYA 3DLMA 5L23A 2RJFA 3BFMA 4CC3A 4F7UF 1VA7A 2O31A 1VIFA 5C0MA 3FEOA 5CAIA 4FYXB 1PD1A 1OX8A 5GAMf 2OI3A 3CD6A 2AHJB 2QTXA 2FHDA 2RHYA 3JB9G 2XDDA 3H0FA 1MV3A 2YUPA 3JCMQ 1AHJB 2JMCA 1PNJA 4J9BA 4AG1C 2RJEA 4OB1B 3QKJA 1K4US 2W0ZA 3N5BB 1NBEB 3OS1A 2F2XA 2QGFB 2QDLA 1KG1A 2DBMA 3GOXA 1PSEA 2F69A 4LN2A 2AIRB 4A4GA 3L2QA 2MOXA 1UGVA 4RTYA 2EGCA 2JT4A 1SPKA 1FWZA 3EAEA 3A5ZB 4C0ZA 2GFUA 3IQLA 4R55A 1JBMA 2RMOA 3H9NA 7AT1B 4A4HA 3O5ZA 1VQMT 3CCMT 4PFOA 2E5KA 4XTWA 3OYJA 1K9MU 1E7OA 3LYIA 5A0GA 2KDSA 2RI3A 1UHFA 1UE9A 3RNJA 2K3XA 4B6MA 2VYTA 3DKMA 3FRNA 3JCMP 1D0XA 2RHIA 3RUXA 2KR3A 2J05A 1VQNQ 1BI0A 1TTHB 2VXEA 1GCQA 2VWFA 1AZGB 4F7UE 5D7UA 3TU4K 3LH5A 4ATOA 2CDTA 2FYKA 3OSVA 3CCRA 4XTVA 5CKHA 3JB9H 2DM1A 4RG2A 3OYBA 3V7CA 2GF7A 4MDWA 4M75F 2DXTA 2RI2A 2DO3A 4L59A 2M0YA 2LQ8A 4RUGA 5KYUB 3G6EQ 2XKOC 1TU0B 4QQ6A 4JRIA 5KYNA 3UA6A 1U1SA 2O4XA 2O88A 2KQWA 1XOVA 2DNUA 2X51A 2FRWA 1AVZC 1R8OB 4FYYB 3A1PA 3CC2T 2KROA 3URGA 5KYWA 1TUGB 2KI7A 2YDLA 4IKFA 4N0AC 5GAMe 2QEXQ 2YRVA 2W10A 4RTXA 1BU1A 1BBZA 3CC7T 2EQMA 1K8AC 3I56T 5KYYB 1VQLA 1WIEA 2WSCE 4E7LA 4M78G 1G3YA 4PJOD 2BTTA 5LJ3j 2ZZDA 3M4GA 2BZYA 1U1TA 2ED0A 2GTJA 4FW1A 4J9FA 1BKBA 1J3TA 1AT1B 3REAB 4M78E 1I0CA 5GAOm 3JCMX 2YRCA 3HTRA 1VQ9Q 2DF6A 3UPUA 1RAGB 3MP6A 2XD0A 2AT1B 3OMGA 3OYFA 2JTMA 5KYXA 2MCNA 1W1FA 2QTVA 4BI8B 3CC4Q 2GCXA 4Z8AA 1M30A 1OU8A 5GAOq 1YI2A 3TVTA 4J83A 1NZ9A 1TS9A 1S1NA 2EYZA 3VRYA 1YWPA 1VQKT 3CCVT 4FIBA 2DTIA 4OB0B 1PKTA 4C8QG 1G83A 2KAFA 2DETA 2X35A 3JCMe 2XICA 2K4YA 4AFSC 4M78B 3RMSA 3I9QA 3OB9A 1NM7A 2OTJT 2E12A 2KVQG 4LD6A 1I07A 1BI3A 2HBWA 4P5NA 1W2BA 1KQSS 2BUDA 5FWCA 4LXCA 2D6FA 4HVWA 2RQUA 1ABOA 3JAME 3SWNB 1G3WA 5A2QE 1GXIE 3EGXA 4FL6A 5J26A 1QVGS 2BKDN 2KYMA 5IT9E 3CCEQ 1MHNA 4EMKA 2QQSA 1CKBA 4BE1A 2J06A 1NEGA 4C8QB 1O75A 4RG8A 3V8JA 4KH1B 2JMAA 1JU5C 1UGRB 4E7ZA 2GGRA 2YT6A 3MO8A 3BDUA 2HDAA 3NTIA 3G4SQ 1Z9QA 1WXTA 1T3LA 4PJOF 5GANd 1T0JA 1QMCA 2EQUA 4HXJA 1ZUYA 2K5FA 1VQ4T 3E9GA 3G1JA 2MI6A 2I0NA 1O9SA 1M2OA 1KQSA 1B07A 1VQMA 5EC7A 5CO7A 3CCMA 1V1CA 3E19A 1YJWQ 2JM9A 4IUUA 4QVCA 3CCLQ 1NE8A 1ZHIA 1Q81R 1ZUUA 2J6KA 4X9DA 3OYHA 3G71Q 2AK5A 1N8RR 5GAN4 1BIAA 5CVIA 2KMTA 1WHHA 2SRCA 1AZEA 4DBRA 2RI5A 1YCSB 4F04B 2LTOA 5GAMj 1IB8A 1NYFA 1WJQA 2CSQA 4XU2A 1T0HA 3OYNA 5GANg 1OV3A 3UWNA 4OMMA 3H0HA 4M77G 4JPBW 3MPUB 3UA7A 1YIJT 2ZAEA 1YNZA 2MYSA 2P4RA 3QWXX 2E64A 3OW2A 5FW9A 2D8HA 5I2MA 2VUBA 2J6OA 9ATCB 5J3BA 3NGPA 1WDXA 2E3HA 5DLOA 1PSFA 4F7UA 2FZKB 3CC7A 3PT9A 3S3OA 2YHTA 2QK0A 3CBPA 1WXBA 2CP7A 3M56A 1MUZA 2F2VA 2JZ2A 1C6VX 1K8AU 4BDZA 4KUDK 3VS3A 2CSIA 2D0NA 4II1A 4M77B 3VS6A 2JOYA 2HBPA 2CT3A 3QYGB 2HEQA 3M9QA 5CQYA 4CC4B 5FU6B 1VQ6A 4BY6B 4N4GA 2E65A 4C5IA 1B34A 3LGFA 4ZNXA 2C0IA 3QJYA 5HK3A 2QGGA 3CD6T 2X9HA 1UECA 1VQKA 3CCJT 4J5YA 2X3XD 3CCVA 3PMIA 1A0NB 4M7AG 4RTZA 4A4EA 3CCRQ 2RO0A 2MWOA 1X43A 1SRMA 2CYZB 1I4K1 1N6AA 3ZEHA 1TWBA 4N4IA 1PKSA 4AG2C 2ENMA 1WLPB 2OTJA 2FEIA 1QCOA 2EQIA 1P92A 4M7DD 2V1QA 1ZX6A 4OMPA 5IHKA 1AWXA 3L2VA 1U3OA 3M54A 1TH7A 3BW1A 1LCKA 4IIMA 2FVUA 2RM4A 4RTTA 3PIOA 2CZ7B 1OPKA 4QKUA 2DJZA 2QQ9A 2DXCA 3H8ZA 3I55T 1M3AA 4C0FA 2DL5A 4QQDA 4M7AB 1VQLQ 5IHNA 3L2UA 2P0QA 3AHUA 1MGQA 2E6ZA 1HJDA 3EFOA 2KY9A 2MWPA 3V8KA 4M75A 4DOVA 4KULA 3MEUA 3TCJA 2K7AA 5LJ5h 3RKXA 2DYBA 1JJ2S 3J7AF 5GAOp 1GBQA 1WHJA 1VQ4A 1FYNA 2VV5A 2E1HA 1WZOA 3NMZC 4IUQA 4AMCA 3SD4A 4BDYA 1YI2Q 4J9IA 1SF9A 3CBMA 3H6ZA 2RHZA 4WTOB 1ARKA 2O4XB 3HKSA 3X24B 1Q81C 1YCYA 2ZGWA 2DEQA 1SG5A 4HCCA 1X75C 4A4FA 4LUEA 5GMKh 1N8RC 2DVJA 2DX1A 1ZSZA 5KYWB 2NYSA 1NJIR 4JLIA 2L3PA 2LVMA 4C5GA 5FU7B 1BYMA 3JSCA 2DMOA 4XU1A 1K8AR 2L3QA 4C92G 2XIDA 1YJNT 4M7DF 3NTKA 4TVRA 4LDUA 4M78C 3SFMA 3M55A 2RQTA 4PLIA 1EFNA 1AWOA 4FT2A 1JQQA 1B7TA 3M0UA 2YLCA 3OS5A 3F70A 2FRYA 3L2ZA 5I11A 4ZN1A 5KYXB 2L0AA 3CCST 5L8RE 3CCQQ 3SWNC 3CXCA 3RESA 3M4YA 5LJ3d 2DTOA 4OMQA 4R56A 2RNAA 2EJGA
chains in the Genus database with same CATH topology
3I35A 1WXUA 1U5SA 1AD5A 3VS0A 2KGTA 3UA6A 2O88A 4K11A 4Z89A 1XOVA 2FO0A 2JM8A 2KT8A 4OMNA 5GJVB 2DNUA 2LQNA 2JS2A 2FRWA 1AVZC 2EGEA 2KROA 4WCIA 4AFQC 2KBTA 1X6GA 2YDLA 3I5RA 2AKKA 2KT1A 1I1JA 1Y57A 2LNHB 2KRSA 2PNIA 2W10A 4RTXA 1BU1A 1BBZA 1G2BA 2D8JA 1WIEA 2GTOA 2BTTA 2IIMA 2LJ1A 2BZYA 2ED0A 2GTJA 2LJ0A 1KFZA 4J9FA 4DEYA 1J3TA 2EYYA 3REAB 2RPNA 1I0CA 2O9VA 2PTKA 3THKA 1X69A 2DF6A 2DILA 1KIKA 4JZ3A 4JJDA 5HCKA 1W1FA 2MCNA 2GBQA 2YSQA 4Z8AA 1RLQC 1M30A 1CSKA 3TVTA 1JO8A 3UATA 1S1NA 2EYZA 3VRYA 2M51A 1YWPA 1GCPA 1W6XA 1H8KA 1PKTA 2LMJA 1G83A 4AFZC 3QWYA 2ABLA 1ABQA 4ORZA 2BZXA 3CQTA 4OMLA 4AFSC 1UDLA 2ED1A 1KSWA 3I9QA 1NM7A 1BK2A 1I07A 2HBWA 3ZL7C 1VYTA 2G6FX 1RUWA 5FWCA 2EKHA 4HVWA 3EHRA 2RQUA 3JV3A 1ABOA 3M0RA 4F17A 1UUEA 2AZVA 2OAWA 2RQWA 4RTWA 1B3QA 2LZ6B 4E6RA 1GFDA 1OPLA 1AOJA 4X1VA 2KYMA 4CC2A 1CKBA 3R6NA 1PRLC 3UF4A 2O2OA 2J06A 1NEGA 2KEAA 3FJ5A 4J9GA 2EYWA 4Y92A 2JW4A 4A63B 1YN8A 2JMAA 4GLMA 1GL5A 1JU5C 1SSHA 2C0TA 2GGRA 2KNBB 2DRKA 2YT6A 4FSSA 2AKLA 2HDAA 2B86A 2X3WD 1Z9QA 1WXTA 1T3LA 1U06A 4IIOA 1T0JA 3EG0A 4HXJA 2DLPA 1ZUYA 1QWFA 3PE0A 4J9CA 4OMOA 1UG1A 2GQIA 3M0TA 2I0NA 1K76A 1E6GA 1TG0A 1B07A 5EC7A 1V1CA 2FPEA 1QKXA 1WX6A 2CT4A 5IHIA 2JM9A 4QT7A 1UTIA 1ZUKA 1WI7A 2D1XA 1MV0B 1ZUUA 2J6KA 2J7IA 3A98A 2NUZA 2CUBA 2AK5A 2XMFA 1QKWA 2NWMA 3KFVA 1ZLMA 1M27C 1ZBJA 3M0SA 3VS1A 1K9AA 4D8DA 2SRCA 2CREA 1AZEA 1M8MA 1JXMA 1YCSB 1HSQA 2HSPA 2DJQA 2LQWA 4R0KA 1NYFA 2CSQA 1NG2A 1M3BA 1T0HA 2CH4W 1OV3A 1NLOC 4OMMA 3H0HA 2C0OA 2L2PA 4Z88A 2A37A 2DL8A 2EYXA 4AFUC 3VS2A 1H92A 4JPBW 1IO6A 2ECZA 3SEMA 1GRIA 2LX7A 3UA7A 1K1ZA 2A28A 1X2KA 3EG1A 1YNZA 2P4RA 5I22A 1YWOA 3QWXX 5IH2A 1UJYA 1SEMA 1SHGA 2EBPA 5FW9A 2D8HA 2YUNA 1AEYA 4DEXA 2J6OA 2KE9A 2HCKA 2OJ2A 4RTVA 1K0XA 4J9EA 2AZSA 3NGPA 2VKNA 1WDXA 3M0PA 3REBB 4HVUA 3PVQA 1W70A 2JXBA 1GCQC 2PZ1A 2DL4A 3GBQA 1WYXA 3VS4A 1UFFA 1WXBA 2DE0X 1OOTA 1MUZA 2F2VA 1QLYA 2RN8A 3VS3A 2CSIA 2D0NA 2VVKA 3VS6A 1E6HA 2BZ8A 2K3BA 1SRLA 2LP5A 2DL3A 1UHCA 1VYVA 2CT3A 2HEQA 2FPFA 1PRMC 4HCKA 3I5SA 4CC4B 1CKAA 4LUDA 2K79A 2RF0A 2J6FA 5FWBA 1X6BA 4J9DA 1OEBA 3H0IA 4ZNXA 2C0IA 1BB9A 1UECA 2X3XD 3NPFA 1A0NB 5IXFA 4RTZA 2DBKA 1Y0MA 1H3HA 1X43A 2KXCA 4JJCA 1SRMA 2CH4A 1RLPC 2YUQA 4F16A 2L3SA 2SEMA 3EG2A 1PKSA 1QWEA 1WA7A 3NHNA 1PWTA 4ESRA 4AG2C 2RQVA 4JJBA 2EPDA 3U23A 2ENMA 1WLPB 2ESWA 2FEIA 1UJ0A 5GJWB 2EQIA 4GBQA 2V1QA 2O9SA 2ROTA 3H41A 1ZX6A 4OMPA 5IHKA 1AWXA 1U3OA 3VS7A 2K2MA 1LCKA 4IIMA 3EGUA 4RTTA 1TUDA 2H8HA 2A08A 1T3SA 1OPKA 2ROLA 4LE9A 1HD3A 1N5ZA 5L23A 4CC3A 1VA7A 2JTEA 2K6DA 1TUCA 1ZSGA 2O31A 2LCSA 2DRMA 2KXDA 2F2WA 1M3AA 2DL5A 5IHNA 2EVRA 1NYGA 3VS5A 3ULRB 2FG0A 1HJDA 2A36A 2RQRA 2OI3A 1NEBA 1SHFA 2K7AA 3H0FA 1MV3A 2DYBA 2YUPA 5ECAA 2DA9A 2JMCA 3TSZA 3VRZA 1GBQA 2V1RA 1PNJA 1AWWA 1FYNA 1YP5A 4J9BA 4AG1C 1JEGA 2K9GA 3NMZC 2W0ZA 4D8KA 1K4US 2KRMA 2KRNA 4JZ4A 1JXOA 2F2XA 2LJ3A 2QDLA 3EHQA 2FPDA 4F14A 3SHWA 2DBMA 1PHTA 4J9IA 1NLPC 4LN2A 4M4ZA 1X2QA 1X27A 2MOXA 1UGVA 4RTYA 1ARKA 2EGCA 2JT4A 1SPKA 3EG3A 5IXBA 2YUOA 2DL7A 3IQLA 2RMOA 3O5ZA 4LUEA 2DVJA 1GBRA 2DX1A 2E5KA 3PVLA 4LNPA 2EGAA 2EW3A 2L3PA 1E7OA 4J9HA 2MIOA 2DMOA 1UHFA 1UE9A 2L3QA 3RNJA 1FMKA 1RI9A 4KRTA 2GNCA 3TSWA 2RQTA 3C0CA 4EIKA 4CC7A 1EFNA 2KR3A 1K0SA 2KYBA 1AWOA 2J05A 1QCFA 1JQQA 3M0UA 1M3CA 2JS0A 1GCQA 2FRYA 1AZGB 2VWFA 3LH5A 1KJWA 5I11A 2CDTA 4HVVA 1VYUA 3RBBB 2L0AA 2DM1A 3M0QA 4RTUA 1GFCA 1Z9ZA 4OMQA 1AWJA 2CUDA 1WFWA 2RNAA 2M0YA 4RUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I35 A;  1WXU A;  1U5S A;  1AD5 A;  3VS0 A;  2KGT A;  3UA6 A;  2O88 A;  4K11 A;  4Z89 A;  1XOV A;  2FO0 A;  2JM8 A;  2KT8 A;  4OMN A;  5GJV B;  2DNU A;  2LQN A;  2JS2 A;  2FRW A;  1AVZ C;  2EGE A;  2KRO A;  4WCI A;  4AFQ C;  2KBT A;  1X6G A;  2YDL A;  3I5R A;  2AKK A;  2KT1 A;  1I1J A;  1Y57 A;  2LNH B;  2KRS A;  2PNI A;  2W10 A;  4RTX A;  1BU1 A;  1BBZ A;  1G2B A;  2D8J A;  1WIE A;  2GTO A;  2BTT A;  2IIM A;  2LJ1 A;  2BZY A;  2ED0 A;  2GTJ A;  2LJ0 A;  1KFZ A;  4J9F A;  4DEY A;  1J3T A;  2EYY A;  3REA B;  2RPN A;  1I0C A;  2O9V A;  2PTK A;  3THK A;  1X69 A;  2DF6 A;  2DIL A;  1KIK A;  4JZ3 A;  4JJD A;  5HCK A;  1W1F A;  2MCN A;  2GBQ A;  2YSQ A;  4Z8A A;  1RLQ C;  1M30 A;  1CSK A;  3TVT A;  1JO8 A;  3UAT A;  1S1N A;  2EYZ A;  3VRY A;  2M51 A;  1YWP A;  1GCP A;  1W6X A;  1H8K A;  1PKT A;  2LMJ A;  1G83 A;  4AFZ C;  3QWY A;  2ABL A;  1ABQ A;  4ORZ A;  2BZX A;  3CQT A;  4OML A;  4AFS C;  1UDL A;  2ED1 A;  1KSW A;  3I9Q A;  1NM7 A;  1BK2 A;  1I07 A;  2HBW A;  3ZL7 C;  1VYT A;  2G6F X;  1RUW A;  5FWC A;  2EKH A;  4HVW A;  3EHR A;  2RQU A;  3JV3 A;  1ABO A;  3M0R A;  4F17 A;  1UUE A;  2AZV A;  2OAW A;  2RQW A;  4RTW A;  1B3Q A;  2LZ6 B;  4E6R A;  1GFD A;  1OPL A;  1AOJ A;  4X1V A;  2KYM A;  4CC2 A;  1CKB A;  3R6N A;  1PRL C;  3UF4 A;  2O2O A;  2J06 A;  1NEG A;  2KEA A;  3FJ5 A;  4J9G A;  2EYW A;  4Y92 A;  2JW4 A;  4A63 B;  1YN8 A;  2JMA A;  4GLM A;  1GL5 A;  1JU5 C;  1SSH A;  2C0T A;  2GGR A;  2KNB B;  2DRK A;  2YT6 A;  4FSS A;  2AKL A;  2HDA A;  2B86 A;  2X3W D;  1Z9Q A;  1WXT A;  1T3L A;  1U06 A;  4IIO A;  1T0J A;  3EG0 A;  4HXJ A;  2DLP A;  1ZUY A;  1QWF A;  3PE0 A;  4J9C A;  4OMO A;  1UG1 A;  2GQI A;  3M0T A;  2I0N A;  1K76 A;  1E6G A;  1TG0 A;  1B07 A;  5EC7 A;  1V1C A;  2FPE A;  1QKX A;  1WX6 A;  2CT4 A;  5IHI A;  2JM9 A;  4QT7 A;  1UTI A;  1ZUK A;  1WI7 A;  2D1X A;  1MV0 B;  1ZUU A;  2J6K A;  2J7I A;  3A98 A;  2NUZ A;  2CUB A;  2AK5 A;  2XMF A;  1QKW A;  2NWM A;  3KFV A;  1ZLM A;  1M27 C;  1ZBJ A;  3M0S A;  3VS1 A;  1K9A A;  4D8D A;  2SRC A;  2CRE A;  1AZE A;  1M8M A;  1JXM A;  1YCS B;  1HSQ A;  2HSP A;  2DJQ A;  2LQW A;  4R0K A;  1NYF A;  2CSQ A;  1NG2 A;  1M3B A;  1T0H A;  2CH4 W;  1OV3 A;  1NLO C;  4OMM A;  3H0H A;  2C0O A;  2L2P A;  4Z88 A;  2A37 A;  2DL8 A;  2EYX A;  4AFU C;  3VS2 A;  1H92 A;  4JPB W;  1IO6 A;  2ECZ A;  3SEM A;  1GRI A;  2LX7 A;  3UA7 A;  1K1Z A;  2A28 A;  1X2K A;  3EG1 A;  1YNZ A;  2P4R A;  5I22 A;  1YWO A;  3QWX X;  5IH2 A;  1UJY A;  1SEM A;  1SHG A;  2EBP A;  5FW9 A;  2D8H A;  2YUN A;  1AEY A;  4DEX A;  2J6O A;  2KE9 A;  2HCK A;  2OJ2 A;  4RTV A;  1K0X A;  4J9E A;  2AZS A;  3NGP A;  2VKN A;  1WDX A;  3M0P A;  3REB B;  4HVU A;  3PVQ A;  1W70 A;  2JXB A;  1GCQ C;  2PZ1 A;  2DL4 A;  3GBQ A;  1WYX A;  3VS4 A;  1UFF A;  1WXB A;  2DE0 X;  1OOT A;  1MUZ A;  2F2V A;  1QLY A;  2RN8 A;  3VS3 A;  2CSI A;  2D0N A;  2VVK A;  3VS6 A;  1E6H A;  2BZ8 A;  2K3B A;  1SRL A;  2LP5 A;  2DL3 A;  1UHC A;  1VYV A;  2CT3 A;  2HEQ A;  2FPF A;  1PRM C;  4HCK A;  3I5S A;  4CC4 B;  1CKA A;  4LUD A;  2K79 A;  2RF0 A;  2J6F A;  5FWB A;  1X6B A;  4J9D A;  1OEB A;  3H0I A;  4ZNX A;  2C0I A;  1BB9 A;  1UEC A;  2X3X D;  3NPF A;  1A0N B;  5IXF A;  4RTZ A;  2DBK A;  1Y0M A;  1H3H A;  1X43 A;  2KXC A;  4JJC A;  1SRM A;  2CH4 A;  1RLP C;  2YUQ A;  4F16 A;  2L3S A;  2SEM A;  3EG2 A;  1PKS A;  1QWE A;  1WA7 A;  3NHN A;  1PWT A;  4ESR A;  4AG2 C;  2RQV A;  4JJB A;  2EPD A;  3U23 A;  2ENM A;  1WLP B;  2ESW A;  2FEI A;  1UJ0 A;  5GJW B;  2EQI A;  4GBQ A;  2V1Q A;  2O9S A;  2ROT A;  3H41 A;  1ZX6 A;  4OMP A;  5IHK A;  1AWX A;  1U3O A;  3VS7 A;  2K2M A;  1LCK A;  4IIM A;  3EGU A;  4RTT A;  1TUD A;  2H8H A;  2A08 A;  1T3S A;  1OPK A;  2ROL A;  4LE9 A;  1HD3 A;  1N5Z A;  5L23 A;  4CC3 A;  1VA7 A;  2JTE A;  2K6D A;  1TUC A;  1ZSG A;  2O31 A;  2LCS A;  2DRM A;  2KXD A;  2F2W A;  1M3A A;  2DL5 A;  5IHN A;  2EVR A;  1NYG A;  3VS5 A;  3ULR B;  2FG0 A;  1HJD A;  2A36 A;  2RQR A;  2OI3 A;  1NEB A;  1SHF A;  2K7A A;  3H0F A;  1MV3 A;  2DYB A;  2YUP A;  5ECA A;  2DA9 A;  2JMC A;  3TSZ A;  3VRZ A;  1GBQ A;  2V1R A;  1PNJ A;  1AWW A;  1FYN A;  1YP5 A;  4J9B A;  4AG1 C;  1JEG A;  2K9G A;  3NMZ C;  2W0Z A;  4D8K A;  1K4U S;  2KRM A;  2KRN A;  4JZ4 A;  1JXO A;  2F2X A;  2LJ3 A;  2QDL A;  3EHQ A;  2FPD A;  4F14 A;  3SHW A;  2DBM A;  1PHT A;  4J9I A;  1NLP C;  4LN2 A;  4M4Z A;  1X2Q A;  1X27 A;  2MOX A;  1UGV A;  4RTY A;  1ARK A;  2EGC A;  2JT4 A;  1SPK A;  3EG3 A;  5IXB A;  2YUO A;  2DL7 A;  3IQL A;  2RMO A;  3O5Z A;  4LUE A;  2DVJ A;  1GBR A;  2DX1 A;  2E5K A;  3PVL A;  4LNP A;  2EGA A;  2EW3 A;  2L3P A;  1E7O A;  4J9H A;  2MIO A;  2DMO A;  1UHF A;  1UE9 A;  2L3Q A;  3RNJ A;  1FMK A;  1RI9 A;  4KRT A;  2GNC A;  3TSW A;  2RQT A;  3C0C A;  4EIK A;  4CC7 A;  1EFN A;  2KR3 A;  1K0S A;  2KYB A;  1AWO A;  2J05 A;  1QCF A;  1JQQ A;  3M0U A;  1M3C A;  2JS0 A;  1GCQ A;  2FRY A;  1AZG B;  2VWF A;  3LH5 A;  1KJW A;  5I11 A;  2CDT A;  4HVV A;  1VYU A;  3RBB B;  2L0A A;  2DM1 A;  3M0Q A;  4RTU A;  1GFC A;  1Z9Z A;  4OMQ A;  1AWJ A;  2CUD A;  1WFW A;  2RNA A;  2M0Y A;  4RUG A; 
#chains in the Genus database with same CATH topology
 1WXU A;  4PJN A;  1U5S A;  5FLX E;  4OGC A;  3VS0 A;  2VAS A;  2CS7 A;  3OYD A;  1VQM Q;  4C8Q C;  3CCM Q;  2JM8 A;  3VKI A;  4OMN A;  2WAC A;  5KCH A;  2NUT A;  4C92 B;  2LDM A;  4AFQ C;  1W2B P;  3A8L B;  3CPW A;  2HMA A;  2AKK A;  4M75 D;  4ELY C;  2LNH B;  4L6V 5;  1H64 1;  2DYI A;  1LVK A;  3MCA B;  8ATC B;  4E7H A;  2P0K A;  2IIM A;  2LJ1 A;  1D09 B;  2BIV A;  1WQ7 A;  2LJ0 A;  1RAB B;  3CCJ A;  4FYV B;  4B9W A;  2QAS A;  3GF5 A;  2WSF E;  2PTK A;  4EMK B;  1Y07 A;  2H3J A;  3THK A;  4PJO A;  2PVD B;  4FM4 B;  3UT1 A;  2VGN A;  5LJ3 g;  2F5K A;  4LDV A;  1KIK A;  4CRI A;  2O01 E;  2ZPE B;  4ZTJ A;  4XTU A;  2DEU A;  2ZPG B;  2QQR A;  1R77 A;  1KQS P;  1H8K A;  1DJ7 B;  1OUL A;  2DFU A;  1OZ2 A;  3CC2 Q;  4BI3 A;  4BI4 A;  2Y4X A;  4OVA A;  1UDL A;  4ZTF A;  1XNI A;  2EFI A;  2DAQ A;  4V2S A;  4OGE A;  1BCO A;  2EJF A;  2MMP A;  1VQ5 T;  3CC7 Q;  4NL2 A;  1ZBX A;  1Q86 R;  3I55 A;  1BK2 A;  2EYQ A;  3I56 Q;  1VQ8 A;  2YLB A;  3ZL7 C;  2G6F X;  1RUW A;  4KUI A;  1OU9 A;  3L2R A;  1BIB A;  4RTW A;  1IGQ A;  1B3Q A;  2LZ6 B;  4F7U G;  3OA6 A;  1GFD A;  3AT1 B;  2NUP A;  4LDY A;  5CIU A;  4CC2 A;  1UB4 A;  3CMA T;  1I8F A;  3FLG A;  3UF4 A;  3WVD B;  3OS0 A;  3EGD B;  3QDR B;  1PC0 A;  5CK9 A;  2EYW A;  4A63 B;  2LT1 A;  1D3B A;  2XG8 D;  1YN8 A;  1I5L A;  1VQK Q;  3CCV Q;  2KNB B;  2XU8 A;  4BUG A;  2B86 A;  2X3W D;  4M77 C;  1ZA2 B;  3OW2 P;  1U06 A;  2DLP A;  4XK8 E;  5GAN 6;  3PE0 A;  2GQI A;  4BY6 C;  1IXD A;  1FMV A;  1Q81 U;  4JLG A;  2OTJ Q;  4Y28 E;  1QKX A;  1WX6 A;  2PVG B;  1NJI C;  4F7U B;  3X25 B;  1N8R U;  4QT7 A;  1YIT A;  1UTI A;  1ZUK A;  1WI7 A;  2GFA A;  2JVV A;  3TEE A;  5D6W A;  2CUB A;  1KHI A;  1RAA B;  1YJN A;  1S72 T;  5IAY A;  3KFV A;  1MMD A;  1VIE A;  3VS1 A;  2A3L A;  1D1C A;  4D8D A;  5GAN f;  2PQW A;  2QA4 Q;  2CZ1 B;  2I2L A;  3OS2 A;  4Y91 A;  3BY7 A;  4OB2 B;  4R0K A;  2COY A;  1NG2 A;  1VQ6 T;  2MPX C;  4PJL A;  4XQ3 A;  3CCS A;  3PNW C;  5LJ3 h;  1TSF A;  2L2P A;  2HL3 A;  2DL8 A;  3O8V A;  3JCM d;  1H92 A;  5HK0 A;  1VQ4 Q;  2CGH A;  2QG9 B;  3VU3 C;  2A28 A;  3KBG A;  3VV0 A;  3EG1 A;  4A53 A;  4MZT A;  3QJ6 A;  4HCZ A;  3VUZ A;  4LDX A;  1WNL A;  4XTY A;  4M7A C;  5D6X A;  5CR2 A;  4M75 G;  5LL6 S;  3PIP A;  2M02 A;  1Y96 A;  4C0D B;  1QP2 A;  1M5Q 1;  1RAD B;  5GAO r;  4DEX A;  4IUT A;  2COZ A;  1G3T A;  2DZC A;  4RTV A;  3HHT B;  4M75 E;  2VKN A;  3M0P A;  1JB0 E;  1YJ9 T;  2V8I A;  4QVZ A;  3T9N A;  3PVQ A;  3E2U A;  1GCQ C;  3MEV A;  1WYX A;  3G6E T;  2YRD A;  3VS4 A;  1UFF A;  2DE0 X;  2VB6 A;  1QLY A;  4NS5 A;  1G8X A;  1IGU A;  1YHQ T;  3HRS A;  2BZ8 A;  1KHC A;  4PL6 A;  1VYV A;  2FPF A;  4HCK A;  3I5S A;  4LUD A;  5HY6 A;  2RF0 A;  3JCM g;  5FWB A;  3EFO B;  1X6B A;  4RCC A;  2CP3 A;  3H0I A;  4M75 B;  3L42 A;  6AT1 B;  2OTL T;  1YIJ Q;  4KGV B;  2E6N A;  2P0P A;  2CP6 A;  5IXF A;  2L5Q A;  5LJ5 d;  5FU7 C;  1H3H A;  3GIB A;  1RLP C;  4ELZ C;  2L3S A;  3RKW A;  2K57 A;  3RMQ A;  1QWE A;  1YBY A;  1PWT A;  4ESR A;  2RQV A;  1VQ5 A;  2EPD A;  2ESW A;  3MET A;  5GJW B;  2RA2 A;  3CME T;  1Q86 C;  4GBQ A;  1QVG A;  2XI9 A;  1LOJ A;  3M59 A;  2K2M A;  1C0M A;  3EG9 B;  5GAN e;  5KCO A;  2HZY A;  1TUD A;  4Z02 A;  1ZSZ B;  1XQH A;  4M7D A;  2ROL A;  1HD3 A;  3JB9 I;  2CP5 A;  4DA4 A;  2K6D A;  3CMA A;  2LCS A;  1ZSG A;  2DRM A;  2KXD A;  2RJD A;  2M16 A;  1LJO A;  4WF2 A;  2B8A A;  3LLR A;  1K73 R;  3INZ A;  3L2W A;  2ZCF B;  3CD6 Q;  2FG0 A;  2HQH A;  2RH2 A;  3CCJ Q;  1N27 A;  5LJ5 g;  2QQA A;  4C92 C;  3WXM B;  2WSE E;  1Q82 R;  3MKD A;  3VRZ A;  4EPC A;  2V1R A;  2ZPF B;  1W4S A;  2JUF A;  2EKO A;  3CXC P;  1JEG A;  2K9G A;  4D8K A;  2KRN A;  4JZ4 A;  1KD1 R;  2FPD A;  4F14 A;  2M1H A;  2QDY B;  4FSX A;  4JS5 A;  1PHT A;  1RAC B;  2IVW A;  4M4Z A;  1X27 A;  4PJO G;  5CKD A;  3QXE B;  4EMK C;  2CZ6 B;  4J8O A;  4OF1 A;  3QHS A;  2E70 A;  1NJI U;  2R5M A;  3EG3 A;  3HSB A;  4PJO E;  2LCC A;  2C06 A;  2DL7 A;  3V7R A;  3GP8 A;  1S72 A;  3CPW P;  5FRM A;  4JJN K;  2NUT B;  2JN0 A;  3HFN A;  1GBR A;  4LNP A;  3I55 Q;  2CKK A;  4J6X A;  1ZA1 B;  4J7F A;  2HQE A;  3OYL A;  3HRT A;  4LD9 K;  2OX7 A;  5J39 A;  3JCM h;  1FMK A;  2DXB A;  3ME9 A;  2GNC A;  2DTH A;  2F1L A;  3TSW A;  1QVF S;  4CC7 A;  1K0S A;  2KYB A;  1QCF A;  4PJO B;  3FDR A;  2JS0 A;  2VC8 A;  4JRQ A;  1VQN A;  1VYU A;  3RBB B;  2M9U A;  8AT1 B;  1PM3 A;  2FZG B;  2RD1 A;  2IPO B;  4KGZ B;  4BD3 A;  1WJS A;  2QI2 A;  4IUP A;  3VYG A;  1YJ9 A;  1AWJ A;  1WFW A;  3CEY A;  2HKQ B;  3I35 A;  2V8J A;  1AD5 A;  2KGT A;  5CCA A;  3GNG A;  4K11 A;  3JB9 D;  3G6E A;  2KT8 A;  3Q1J A;  4IUR A;  1OQK A;  4MDX A;  3S3M A;  1YHQ A;  2EGE A;  4KBM B;  4WCI A;  1MMG A;  1X6G A;  3LWI A;  2DK3 A;  1QVF A;  3R6O A;  2KT1 A;  1MND A;  1I1J A;  1Y57 A;  2PNI A;  3RIR A;  3A8O B;  2MAM A;  2QEX A;  1VQ8 T;  1YJN Q;  3QUI A;  2GTO A;  4FU6 A;  1RAH B;  3MP8 A;  1Q7Y R;  3FC3 A;  2XK0 A;  2OTL A;  3JCM V;  5GAN j;  1KQ2 A;  4DEY A;  1WHL A;  3SWN A;  3ZBD A;  5LJ3 f;  1FMW A;  2EYY A;  1M90 C;  1QP3 A;  1X69 A;  2DIL A;  3CCS Q;  3RDV A;  1IHV A;  1VQ7 T;  4PFP A;  1BI1 A;  1VQP T;  3OQ5 A;  4JJD A;  5HCK A;  5GAN 8;  2GBQ A;  1MMN A;  4E47 A;  2L3R A;  4OMF B;  3CC4 A;  5EG2 A;  1JO8 A;  3UAT A;  2L89 A;  2M51 A;  4ZN3 A;  1D1A A;  3CME A;  1NPR A;  1UGS B;  1GCP A;  1W6X A;  2LMJ A;  3QWY A;  3S3N A;  4EMH A;  1XJW B;  3SB2 A;  2LT4 A;  1PG5 B;  2RHU A;  1ABQ A;  1Q86 U;  2GQV A;  3DB3 A;  4OML A;  3CQT A;  1QVP A;  3QYH B;  2ED1 A;  2ZPI B;  2K5I A;  5DM7 R;  3RER A;  1YIT T;  3MJX A;  4J6Y A;  3CBO A;  1JJ2 A;  3JRZ A;  1K73 C;  2EKH A;  2RB6 A;  3DLL A;  4C5H A;  2Z0W A;  4C0D C;  3J81 E;  3M0R A;  5HKC A;  4ZGE B;  1UUE A;  2RQW A;  2OAW A;  3JB9 F;  4MZM A;  1AOJ A;  5KH6 A;  2K2V A;  1Q82 C;  2JTF A;  4A4K A;  5DY9 A;  2O2O A;  2KEA A;  3HP9 A;  3FJ5 A;  4J9G A;  2JW4 A;  4LDW A;  1KD1 C;  4GLM A;  2KSS A;  1GL5 A;  1OZ3 A;  2C0T A;  2DRK A;  1X6O A;  2IG0 A;  1WHG A;  4IIO A;  3EG0 A;  1EZZ B;  4M78 D;  4O6J A;  5GAN 3;  4J9C A;  4OMO A;  1M2V A;  5KE2 A;  1Y96 B;  1E6G A;  2OAU A;  4CI0 C;  1VOM A;  1TG0 A;  1VQ5 Q;  3EH2 A;  2P84 A;  2V26 A;  2CT4 A;  5IHI A;  3LGL A;  1PCX A;  1RL2 A;  4C0G A;  4C5E A;  2MF2 A;  1FX7 A;  1N9R A;  1MV0 B;  4FYW B;  3PTA A;  3OYG A;  2ZPB B;  4JRP A;  1QKW A;  1WHK A;  1ZLM A;  1M27 C;  2EJ9 A;  3EGX B;  1ZBJ A;  3CMA Q;  2Y90 A;  3HRU A;  4C8Q D;  1K9A A;  3QZ9 B;  4PFZ A;  4M77 A;  1XTD A;  2CRE A;  1M8M A;  1JXM A;  2PVO B;  2HSP A;  2DJQ A;  1M1F A;  1KC8 R;  3OYA A;  1VQO T;  3LH0 A;  3QO3 A;  1M3B A;  4M7D G;  4PNO A;  1R0C B;  1N9S A;  2HNI A;  3MP1 A;  1NLO C;  1QCN A;  1ZSZ C;  5C6S A;  2E5Q A;  4Z88 A;  2A37 A;  2EYX A;  4M7D E;  3PGG A;  3OY9 A;  1MNE A;  3SEM A;  2DVE A;  1K1Z A;  1X2K A;  4N0A A;  4ZGJ B;  1C1A A;  4GY5 A;  5AT1 B;  2EAY A;  2EQK A;  2XDB A;  1SEM A;  1SHG A;  3OYK A;  2DXU A;  4FT4 A;  5GAN 5;  4DBH A;  1QVG P;  2KE9 A;  2E4H A;  2AZS A;  1HK9 A;  4HVU A;  3CCQ T;  1BI2 A;  1SKU B;  2E3I A;  3CCU T;  2PZ1 A;  1S72 Q;  1OYX A;  4YTL A;  2DER A;  4RKU E;  1Q7Y C;  1OOT A;  4M7D B;  4M78 F;  2RK1 A;  1M1G A;  1M1K R;  3JCM f;  2F5T X;  1I81 A;  2MK5 A;  2VVK A;  1E6H A;  3GPL A;  2LP5 A;  1WHM A;  2DL3 A;  2X4J A;  1VQ6 Q;  2D9T A;  5DLQ E;  2ATC B;  1NPP A;  4E7S A;  1VQ7 A;  5KE3 A;  3OBY A;  4M7A A;  2K79 A;  2R58 A;  2J6F A;  1I5O B;  3S6W A;  1M90 U;  1VQP A;  4XTX A;  4J9D A;  1M4Z A;  1OEB A;  1R0B G;  4FW2 A;  2X4W A;  1IRE B;  1WQW A;  5I2S A;  2DBK A;  1RAE B;  2HAX A;  4QQG A;  3J80 E;  4J6W A;  4C8Q F;  2M0O A;  2A0F B;  2VGM A;  5FU6 C;  2QAZ A;  3E1S A;  2KXC A;  4JJC A;  4DQ2 A;  5GAM d;  2SEM A;  4E7J A;  3EG2 A;  4MML A;  1YJ9 Q;  3NHN A;  4XU0 A;  3U23 A;  1OI1 A;  3M5A A;  4XAX B;  2CZ0 B;  4D6W A;  1TOV A;  2JNG A;  4PJO C;  2JJ9 A;  1V76 A;  3VS7 A;  4QVD A;  4M77 D;  4DOW A;  3EGU A;  1YHQ Q;  3GLX A;  5CQX A;  2A08 A;  1UGP B;  1IRX A;  1T3S A;  1K73 U;  4J7I A;  1N5Z A;  1G5V A;  5FRN A;  3SDZ A;  3EH1 A;  2JTE A;  4JS4 A;  1TUC A;  2K5L A;  5LJ5 f;  2F2W A;  2XHC A;  4RCB A;  1NYG A;  2EVR A;  3VS5 A;  3ULR B;  1Q82 U;  1B34 B;  2OTL Q;  3OSS C;  3UDC A;  2A36 A;  2RQR A;  1NEB A;  2KK4 A;  3X28 B;  1SHF A;  3HL8 A;  3FJP A;  3M57 A;  1KD1 U;  5ECA A;  2DA9 A;  3P8B B;  1U8R A;  4OP0 A;  2FL7 A;  4L5G A;  5GAN 7;  1W2B S;  3TSZ A;  5D6Y A;  5GAM g;  3OYI A;  1AWW A;  3OYY A;  1YP5 A;  3QPH A;  1VQN T;  2KRM A;  1JXO A;  2LJ3 A;  3EHQ A;  3ASK A;  3SHW A;  5GAO l;  3CME Q;  3E9F A;  1NLP C;  1X2Q A;  2EWN A;  3ZFJ A;  3TRE A;  3QG1 A;  2A7Y A;  2K3Y A;  4NOY A;  4HT9 A;  2LQK A;  3L1A A;  2COW A;  2FB7 A;  1HXD A;  4Q5W A;  5IXB A;  2YUO A;  3BE3 A;  5GAN 2;  4C8Q E;  1QVF P;  4M7A D;  3PVL A;  3ER0 A;  4C92 A;  2EGA A;  2EW3 A;  4O5V A;  2YWW A;  4J9H A;  4HT8 A;  2HSE B;  2LCL A;  2MIO A;  2PUO B;  1VQO A;  1H3Z A;  1LNX A;  3JCM W;  2QEX T;  1KC8 C;  5GMK m;  1TXQ A;  1K9M R;  2D0Q B;  1Q95 G;  2E10 A;  1RI9 A;  5CKF A;  4KRT A;  3LX7 A;  3C0C A;  4M77 F;  4EIK A;  3QZ5 B;  5A0D A;  2FZC B;  5CKE A;  1M90 R;  1RAF B;  2LC4 A;  5GMK l;  1M3C A;  3X26 B;  1QQJ A;  1F1B B;  1KJW A;  4HVV A;  2QA4 T;  1VQ9 T;  4N4H A;  4DBQ A;  3M0Q A;  4RTU A;  4NL3 A;  1GFC A;  1M9S A;  3JB9 J;  1X01 A;  3BDL A;  2LX9 A;  3NFC A;  1Z9Z A;  1ZQ1 A;  3EFS A;  1D0Y A;  2RJC A;  3CC4 T;  3CCQ A;  2CUD A;  2DD5 A;  3KUF A;  3CCU A;  2YXY A;  4Z89 A;  2NLU A;  2FO0 A;  5GJV B;  4BE2 A;  2LQN A;  2JS2 A;  5LJ5 e;  2EIF A;  3OBW A;  1IHW A;  3OMC A;  2KBT A;  1M1K C;  1JJ2 P;  1Q7Y U;  1QW1 A;  3JCM J;  3I5R A;  4JDS A;  4PKC C;  2DIQ A;  3HPW A;  3OW2 S;  2KRS A;  1UGQ B;  1G2B A;  1BCM A;  3OYC A;  2D8J A;  3FIF A;  1G3S A;  2DPP B;  1JRI A;  1KFZ A;  2QYZ A;  4PJJ A;  4RMO A;  3C94 A;  2RPN A;  2O9V A;  4M7A F;  4ZGD B;  1HYO A;  5GAM h;  3CCE T;  1Y7X A;  5GMK e;  3EGD A;  4JZ3 A;  2YSQ A;  1RLQ C;  4QW2 A;  1OX9 A;  1PD0 A;  3MEA A;  1CSK A;  5GAO n;  1MMA A;  3V8L A;  3QDF A;  4EMG A;  4KH0 B;  3NTH A;  3MHX A;  4M77 E;  1M2V B;  4C92 D;  5KYU A;  4AFZ C;  3G4S T;  2ABL A;  4HA8 A;  4ORZ A;  2BZX A;  2G3R A;  3CC2 A;  3VYH B;  4DBF A;  2DKG A;  4PLL A;  1WJR A;  1KSW A;  3G7Z A;  2LNV A;  1VQ8 Q;  3P8H A;  2H3E B;  3MEW A;  1YJW T;  3CCL T;  1VYT A;  2ZPH B;  3I56 A;  2P4T A;  4XU3 A;  5IN1 A;  5KYY A;  3EHR A;  3JV3 A;  4JRK A;  3G71 T;  4F17 A;  2AZV A;  3KXT A;  4E6R A;  1OPL A;  2QQB A;  4X1V A;  1VQ7 Q;  1FXX A;  1WPY A;  4UC4 A;  4EDU A;  3R6N A;  3M58 A;  1PRL C;  1VQP Q;  4A54 A;  2DD4 A;  2V8K A;  2CP0 A;  4Y92 A;  4M7D C;  1SSH A;  1LPL A;  3P8D A;  4FSS A;  2AKL A;  3EFR A;  3HFO A;  4GLK A;  3RR6 A;  1QWF A;  1UG1 A;  3M53 A;  3M0T A;  5A0L A;  1K76 A;  4KGX B;  4M7A E;  4PJM A;  1D1B A;  3TQ7 P;  1KQ1 A;  4M78 A;  2FPE A;  4BAC A;  1YIT Q;  4X34 A;  5GMK i;  3PFS A;  2X4Y A;  2D1X A;  4E7K A;  4BB7 A;  2EQJ A;  2J7I A;  3A98 A;  1VUB A;  2NUZ A;  2XMF A;  2HL5 C;  2NWM A;  1K9M C;  4KT0 E;  4C92 F;  1KC8 U;  3A8H B;  5LJ5 j;  4XTZ A;  2NUP B;  3M0S A;  3FB9 A;  2DIG A;  1KK7 A;  3LW5 E;  4VUB A;  2DZ9 A;  2RHX A;  2HKN A;  1HSQ A;  2LQW A;  4FCY A;  3OYE A;  2R57 A;  2QA4 A;  2VXF A;  1VQ9 A;  3JCM c;  4MMK A;  3CPF A;  4AT1 B;  4C8Q A;  3QSU A;  4JUV A;  4ANJ A;  1D3B B;  1IZ6 A;  2CH4 W;  1D0Z A;  3VJP A;  5CKB A;  5GAN h;  2C0O A;  4AFU C;  3VS2 A;  1IO6 A;  2ECZ A;  1GRI A;  2LX7 A;  2R5A A;  2HQX A;  5I22 A;  1YWO A;  4BE0 A;  5IH2 A;  2BE7 D;  1UJY A;  3CCR T;  2EBP A;  5GMK j;  2YUN A;  2X4X A;  4PK4 A;  1AEY A;  3C4S A;  3VUB A;  2HCK A;  2OJ2 A;  1K0X A;  4J9E A;  3REB B;  3C12 A;  2L8D A;  3X20 B;  1W70 A;  2JXB A;  2Y4Y A;  1M1K U;  3GNF B;  1SSF A;  4HKE A;  3OYM A;  2DL4 A;  2LRQ A;  2CP2 A;  3GBQ A;  4OB3 B;  1EX4 A;  2PU9 B;  2PUK B;  3EG9 A;  3CXC S;  4ME7 A;  3V7S A;  2RN8 A;  3LWH A;  1EIF A;  2K3B A;  1SRL A;  1VQO Q;  1UHC A;  3A8M B;  3CCE A;  5M9O A;  1PRM C;  4IUV A;  1CKA A;  1M8V A;  1VQL T;  2E41 A;  1YFN A;  3QII A;  1WGS A;  5I21 A;  3CPW S;  3WVE B;  4X9C A;  1BB9 A;  3RKY A;  1RI0 A;  2HD0 A;  1YIJ A;  4C92 E;  3NPF A;  1Y0M A;  3JCM b;  3G4S A;  2XDP A;  3PMT A;  2CH4 A;  2YUQ A;  4MZP A;  4F16 A;  4E7I A;  3D7S B;  4M75 C;  1ACM B;  1WA7 A;  4JJB A;  2RK2 A;  2QXF A;  3C95 A;  3CCU Q;  1YI2 T;  1UJ0 A;  2BE9 B;  1YJW A;  3CCL A;  5FRO A;  2O9S A;  2ROT A;  4B9X A;  5AYF A;  4HCB A;  3H41 A;  1V29 B;  3DB4 A;  5LJ3 e;  3A8G B;  4E2F B;  1UEB A;  2H8H A;  3G71 A;  1RAI B;  1Y71 A;  4LE9 A;  3QBY A;  3DLM A;  5L23 A;  2RJF A;  3BFM A;  4CC3 A;  4F7U F;  1VA7 A;  2O31 A;  1VIF A;  5C0M A;  3FEO A;  5CAI A;  4FYX B;  1PD1 A;  1OX8 A;  5GAM f;  2OI3 A;  3CD6 A;  2AHJ B;  2QTX A;  2FHD A;  2RHY A;  3JB9 G;  2XDD A;  3H0F A;  1MV3 A;  2YUP A;  3JCM Q;  1AHJ B;  2JMC A;  1PNJ A;  4J9B A;  4AG1 C;  2RJE A;  4OB1 B;  3QKJ A;  1K4U S;  2W0Z A;  3N5B B;  1NBE B;  3OS1 A;  2F2X A;  2QGF B;  2QDL A;  1KG1 A;  2DBM A;  3GOX A;  1PSE A;  2F69 A;  4LN2 A;  2AIR B;  4A4G A;  3L2Q A;  2MOX A;  1UGV A;  4RTY A;  2EGC A;  2JT4 A;  1SPK A;  1FWZ A;  3EAE A;  3A5Z B;  4C0Z A;  2GFU A;  3IQL A;  4R55 A;  1JBM A;  2RMO A;  3H9N A;  7AT1 B;  4A4H A;  3O5Z A;  1VQM T;  3CCM T;  4PFO A;  2E5K A;  4XTW A;  3OYJ A;  1K9M U;  1E7O A;  3LYI A;  5A0G A;  2KDS A;  2RI3 A;  1UHF A;  1UE9 A;  3RNJ A;  2K3X A;  4B6M A;  2VYT A;  3DKM A;  3FRN A;  3JCM P;  1D0X A;  2RHI A;  3RUX A;  2KR3 A;  2J05 A;  1VQN Q;  1BI0 A;  1TTH B;  2VXE A;  1GCQ A;  2VWF A;  1AZG B;  4F7U E;  5D7U A;  3TU4 K;  3LH5 A;  4ATO A;  2CDT A;  2FYK A;  3OSV A;  3CCR A;  4XTV A;  5CKH A;  3JB9 H;  2DM1 A;  4RG2 A;  3OYB A;  3V7C A;  2GF7 A;  4MDW A;  4M75 F;  2DXT A;  2RI2 A;  2DO3 A;  4L59 A;  2M0Y A;  2LQ8 A;  4RUG A;  5KYU B;  3G6E Q;  2XKO C;  1TU0 B;  4QQ6 A;  4JRI A;  5KYN A;  3UA6 A;  1U1S A;  2O4X A;  2O88 A;  2KQW A;  1XOV A;  2DNU A;  2X51 A;  2FRW A;  1AVZ C;  1R8O B;  4FYY B;  3A1P A;  3CC2 T;  2KRO A;  3URG A;  5KYW A;  1TUG B;  2KI7 A;  2YDL A;  4IKF A;  4N0A C;  5GAM e;  2QEX Q;  2YRV A;  2W10 A;  4RTX A;  1BU1 A;  1BBZ A;  3CC7 T;  2EQM A;  1K8A C;  3I56 T;  5KYY B;  1VQL A;  1WIE A;  2WSC E;  4E7L A;  4M78 G;  1G3Y A;  4PJO D;  2BTT A;  5LJ3 j;  2ZZD A;  3M4G A;  2BZY A;  1U1T A;  2ED0 A;  2GTJ A;  4FW1 A;  4J9F A;  1BKB A;  1J3T A;  1AT1 B;  3REA B;  4M78 E;  1I0C A;  5GAO m;  3JCM X;  2YRC A;  3HTR A;  1VQ9 Q;  2DF6 A;  3UPU A;  1RAG B;  3MP6 A;  2XD0 A;  2AT1 B;  3OMG A;  3OYF A;  2JTM A;  5KYX A;  2MCN A;  1W1F A;  2QTV A;  4BI8 B;  3CC4 Q;  2GCX A;  4Z8A A;  1M30 A;  1OU8 A;  5GAO q;  1YI2 A;  3TVT A;  4J83 A;  1NZ9 A;  1TS9 A;  1S1N A;  2EYZ A;  3VRY A;  1YWP A;  1VQK T;  3CCV T;  4FIB A;  2DTI A;  4OB0 B;  1PKT A;  4C8Q G;  1G83 A;  2KAF A;  2DET A;  2X35 A;  3JCM e;  2XIC A;  2K4Y A;  4AFS C;  4M78 B;  3RMS A;  3I9Q A;  3OB9 A;  1NM7 A;  2OTJ T;  2E12 A;  2KVQ G;  4LD6 A;  1I07 A;  1BI3 A;  2HBW A;  4P5N A;  1W2B A;  1KQS S;  2BUD A;  5FWC A;  4LXC A;  2D6F A;  4HVW A;  2RQU A;  1ABO A;  3JAM E;  3SWN B;  1G3W A;  5A2Q E;  1GXI E;  3EGX A;  4FL6 A;  5J26 A;  1QVG S;  2BKD N;  2KYM A;  5IT9 E;  3CCE Q;  1MHN A;  4EMK A;  2QQS A;  1CKB A;  4BE1 A;  2J06 A;  1NEG A;  4C8Q B;  1O75 A;  4RG8 A;  3V8J A;  4KH1 B;  2JMA A;  1JU5 C;  1UGR B;  4E7Z A;  2GGR A;  2YT6 A;  3MO8 A;  3BDU A;  2HDA A;  3NTI A;  3G4S Q;  1Z9Q A;  1WXT A;  1T3L A;  4PJO F;  5GAN d;  1T0J A;  1QMC A;  2EQU A;  4HXJ A;  1ZUY A;  2K5F A;  1VQ4 T;  3E9G A;  3G1J A;  2MI6 A;  2I0N A;  1O9S A;  1M2O A;  1KQS A;  1B07 A;  1VQM A;  5EC7 A;  5CO7 A;  3CCM A;  1V1C A;  3E19 A;  1YJW Q;  2JM9 A;  4IUU A;  4QVC A;  3CCL Q;  1NE8 A;  1ZHI A;  1Q81 R;  1ZUU A;  2J6K A;  4X9D A;  3OYH A;  3G71 Q;  2AK5 A;  1N8R R;  5GAN 4;  1BIA A;  5CVI A;  2KMT A;  1WHH A;  2SRC A;  1AZE A;  4DBR A;  2RI5 A;  1YCS B;  4F04 B;  2LTO A;  5GAM j;  1IB8 A;  1NYF A;  1WJQ A;  2CSQ A;  4XU2 A;  1T0H A;  3OYN A;  5GAN g;  1OV3 A;  3UWN A;  4OMM A;  3H0H A;  4M77 G;  4JPB W;  3MPU B;  3UA7 A;  1YIJ T;  2ZAE A;  1YNZ A;  2MYS A;  2P4R A;  3QWX X;  2E64 A;  3OW2 A;  5FW9 A;  2D8H A;  5I2M A;  2VUB A;  2J6O A;  9ATC B;  5J3B A;  3NGP A;  1WDX A;  2E3H A;  5DLO A;  1PSF A;  4F7U A;  2FZK B;  3CC7 A;  3PT9 A;  3S3O A;  2YHT A;  2QK0 A;  3CBP A;  1WXB A;  2CP7 A;  3M56 A;  1MUZ A;  2F2V A;  2JZ2 A;  1C6V X;  1K8A U;  4BDZ A;  4KUD K;  3VS3 A;  2CSI A;  2D0N A;  4II1 A;  4M77 B;  3VS6 A;  2JOY A;  2HBP A;  2CT3 A;  3QYG B;  2HEQ A;  3M9Q A;  5CQY A;  4CC4 B;  5FU6 B;  1VQ6 A;  4BY6 B;  4N4G A;  2E65 A;  4C5I A;  1B34 A;  3LGF A;  4ZNX A;  2C0I A;  3QJY A;  5HK3 A;  2QGG A;  3CD6 T;  2X9H A;  1UEC A;  1VQK A;  3CCJ T;  4J5Y A;  2X3X D;  3CCV A;  3PMI A;  1A0N B;  4M7A G;  4RTZ A;  4A4E A;  3CCR Q;  2RO0 A;  2MWO A;  1X43 A;  1SRM A;  2CYZ B;  1I4K 1;  1N6A A;  3ZEH A;  1TWB A;  4N4I A;  1PKS A;  4AG2 C;  2ENM A;  1WLP B;  2OTJ A;  2FEI A;  1QCO A;  2EQI A;  1P92 A;  4M7D D;  2V1Q A;  1ZX6 A;  4OMP A;  5IHK A;  1AWX A;  3L2V A;  1U3O A;  3M54 A;  1TH7 A;  3BW1 A;  1LCK A;  4IIM A;  2FVU A;  2RM4 A;  4RTT A;  3PIO A;  2CZ7 B;  1OPK A;  4QKU A;  2DJZ A;  2QQ9 A;  2DXC A;  3H8Z A;  3I55 T;  1M3A A;  4C0F A;  2DL5 A;  4QQD A;  4M7A B;  1VQL Q;  5IHN A;  3L2U A;  2P0Q A;  3AHU A;  1MGQ A;  2E6Z A;  1HJD A;  3EFO A;  2KY9 A;  2MWP A;  3V8K A;  4M75 A;  4DOV A;  4KUL A;  3MEU A;  3TCJ A;  2K7A A;  5LJ5 h;  3RKX A;  2DYB A;  1JJ2 S;  3J7A F;  5GAO p;  1GBQ A;  1WHJ A;  1VQ4 A;  1FYN A;  2VV5 A;  2E1H A;  1WZO A;  3NMZ C;  4IUQ A;  4AMC A;  3SD4 A;  4BDY A;  1YI2 Q;  4J9I A;  1SF9 A;  3CBM A;  3H6Z A;  2RHZ A;  4WTO B;  1ARK A;  2O4X B;  3HKS A;  3X24 B;  1Q81 C;  1YCY A;  2ZGW A;  2DEQ A;  1SG5 A;  4HCC A;  1X75 C;  4A4F A;  4LUE A;  5GMK h;  1N8R C;  2DVJ A;  2DX1 A;  1ZSZ A;  5KYW B;  2NYS A;  1NJI R;  4JLI A;  2L3P A;  2LVM A;  4C5G A;  5FU7 B;  1BYM A;  3JSC A;  2DMO A;  4XU1 A;  1K8A R;  2L3Q A;  4C92 G;  2XID A;  1YJN T;  4M7D F;  3NTK A;  4TVR A;  4LDU A;  4M78 C;  3SFM A;  3M55 A;  2RQT A;  4PLI A;  1EFN A;  1AWO A;  4FT2 A;  1JQQ A;  1B7T A;  3M0U A;  2YLC A;  3OS5 A;  3F70 A;  2FRY A;  3L2Z A;  5I11 A;  4ZN1 A;  5KYX B;  2L0A A;  3CCS T;  5L8R E;  3CCQ Q;  3SWN C;  3CXC A;  3RES A;  3M4Y A;  5LJ3 d;  2DTO A;  4OMQ A;  4R56 A;  2RNA A;  2EJG A; 
#chains in the Genus database with same CATH homology
 3I35 A;  1WXU A;  1U5S A;  1AD5 A;  3VS0 A;  2KGT A;  3UA6 A;  2O88 A;  4K11 A;  4Z89 A;  1XOV A;  2FO0 A;  2JM8 A;  2KT8 A;  4OMN A;  5GJV B;  2DNU A;  2LQN A;  2JS2 A;  2FRW A;  1AVZ C;  2EGE A;  2KRO A;  4WCI A;  4AFQ C;  2KBT A;  1X6G A;  2YDL A;  3I5R A;  2AKK A;  2KT1 A;  1I1J A;  1Y57 A;  2LNH B;  2KRS A;  2PNI A;  2W10 A;  4RTX A;  1BU1 A;  1BBZ A;  1G2B A;  2D8J A;  1WIE A;  2GTO A;  2BTT A;  2IIM A;  2LJ1 A;  2BZY A;  2ED0 A;  2GTJ A;  2LJ0 A;  1KFZ A;  4J9F A;  4DEY A;  1J3T A;  2EYY A;  3REA B;  2RPN A;  1I0C A;  2O9V A;  2PTK A;  3THK A;  1X69 A;  2DF6 A;  2DIL A;  1KIK A;  4JZ3 A;  4JJD A;  5HCK A;  1W1F A;  2MCN A;  2GBQ A;  2YSQ A;  4Z8A A;  1RLQ C;  1M30 A;  1CSK A;  3TVT A;  1JO8 A;  3UAT A;  1S1N A;  2EYZ A;  3VRY A;  2M51 A;  1YWP A;  1GCP A;  1W6X A;  1H8K A;  1PKT A;  2LMJ A;  1G83 A;  4AFZ C;  3QWY A;  2ABL A;  1ABQ A;  4ORZ A;  2BZX A;  3CQT A;  4OML A;  4AFS C;  1UDL A;  2ED1 A;  1KSW A;  3I9Q A;  1NM7 A;  1BK2 A;  1I07 A;  2HBW A;  3ZL7 C;  1VYT A;  2G6F X;  1RUW A;  5FWC A;  2EKH A;  4HVW A;  3EHR A;  2RQU A;  3JV3 A;  1ABO A;  3M0R A;  4F17 A;  1UUE A;  2AZV A;  2OAW A;  2RQW A;  4RTW A;  1B3Q A;  2LZ6 B;  4E6R A;  1GFD A;  1OPL A;  1AOJ A;  4X1V A;  2KYM A;  4CC2 A;  1CKB A;  3R6N A;  1PRL C;  3UF4 A;  2O2O A;  2J06 A;  1NEG A;  2KEA A;  3FJ5 A;  4J9G A;  2EYW A;  4Y92 A;  2JW4 A;  4A63 B;  1YN8 A;  2JMA A;  4GLM A;  1GL5 A;  1JU5 C;  1SSH A;  2C0T A;  2GGR A;  2KNB B;  2DRK A;  2YT6 A;  4FSS A;  2AKL A;  2HDA A;  2B86 A;  2X3W D;  1Z9Q A;  1WXT A;  1T3L A;  1U06 A;  4IIO A;  1T0J A;  3EG0 A;  4HXJ A;  2DLP A;  1ZUY A;  1QWF A;  3PE0 A;  4J9C A;  4OMO A;  1UG1 A;  2GQI A;  3M0T A;  2I0N A;  1K76 A;  1E6G A;  1TG0 A;  1B07 A;  5EC7 A;  1V1C A;  2FPE A;  1QKX A;  1WX6 A;  2CT4 A;  5IHI A;  2JM9 A;  4QT7 A;  1UTI A;  1ZUK A;  1WI7 A;  2D1X A;  1MV0 B;  1ZUU A;  2J6K A;  2J7I A;  3A98 A;  2NUZ A;  2CUB A;  2AK5 A;  2XMF A;  1QKW A;  2NWM A;  3KFV A;  1ZLM A;  1M27 C;  1ZBJ A;  3M0S A;  3VS1 A;  1K9A A;  4D8D A;  2SRC A;  2CRE A;  1AZE A;  1M8M A;  1JXM A;  1YCS B;  1HSQ A;  2HSP A;  2DJQ A;  2LQW A;  4R0K A;  1NYF A;  2CSQ A;  1NG2 A;  1M3B A;  1T0H A;  2CH4 W;  1OV3 A;  1NLO C;  4OMM A;  3H0H A;  2C0O A;  2L2P A;  4Z88 A;  2A37 A;  2DL8 A;  2EYX A;  4AFU C;  3VS2 A;  1H92 A;  4JPB W;  1IO6 A;  2ECZ A;  3SEM A;  1GRI A;  2LX7 A;  3UA7 A;  1K1Z A;  2A28 A;  1X2K A;  3EG1 A;  1YNZ A;  2P4R A;  5I22 A;  1YWO A;  3QWX X;  5IH2 A;  1UJY A;  1SEM A;  1SHG A;  2EBP A;  5FW9 A;  2D8H A;  2YUN A;  1AEY A;  4DEX A;  2J6O A;  2KE9 A;  2HCK A;  2OJ2 A;  4RTV A;  1K0X A;  4J9E A;  2AZS A;  3NGP A;  2VKN A;  1WDX A;  3M0P A;  3REB B;  4HVU A;  3PVQ A;  1W70 A;  2JXB A;  1GCQ C;  2PZ1 A;  2DL4 A;  3GBQ A;  1WYX A;  3VS4 A;  1UFF A;  1WXB A;  2DE0 X;  1OOT A;  1MUZ A;  2F2V A;  1QLY A;  2RN8 A;  3VS3 A;  2CSI A;  2D0N A;  2VVK A;  3VS6 A;  1E6H A;  2BZ8 A;  2K3B A;  1SRL A;  2LP5 A;  2DL3 A;  1UHC A;  1VYV A;  2CT3 A;  2HEQ A;  2FPF A;  1PRM C;  4HCK A;  3I5S A;  4CC4 B;  1CKA A;  4LUD A;  2K79 A;  2RF0 A;  2J6F A;  5FWB A;  1X6B A;  4J9D A;  1OEB A;  3H0I A;  4ZNX A;  2C0I A;  1BB9 A;  1UEC A;  2X3X D;  3NPF A;  1A0N B;  5IXF A;  4RTZ A;  2DBK A;  1Y0M A;  1H3H A;  1X43 A;  2KXC A;  4JJC A;  1SRM A;  2CH4 A;  1RLP C;  2YUQ A;  4F16 A;  2L3S A;  2SEM A;  3EG2 A;  1PKS A;  1QWE A;  1WA7 A;  3NHN A;  1PWT A;  4ESR A;  4AG2 C;  2RQV A;  4JJB A;  2EPD A;  3U23 A;  2ENM A;  1WLP B;  2ESW A;  2FEI A;  1UJ0 A;  5GJW B;  2EQI A;  4GBQ A;  2V1Q A;  2O9S A;  2ROT A;  3H41 A;  1ZX6 A;  4OMP A;  5IHK A;  1AWX A;  1U3O A;  3VS7 A;  2K2M A;  1LCK A;  4IIM A;  3EGU A;  4RTT A;  1TUD A;  2H8H A;  2A08 A;  1T3S A;  1OPK A;  2ROL A;  4LE9 A;  1HD3 A;  1N5Z A;  5L23 A;  4CC3 A;  1VA7 A;  2JTE A;  2K6D A;  1TUC A;  1ZSG A;  2O31 A;  2LCS A;  2DRM A;  2KXD A;  2F2W A;  1M3A A;  2DL5 A;  5IHN A;  2EVR A;  1NYG A;  3VS5 A;  3ULR B;  2FG0 A;  1HJD A;  2A36 A;  2RQR A;  2OI3 A;  1NEB A;  1SHF A;  2K7A A;  3H0F A;  1MV3 A;  2DYB A;  2YUP A;  5ECA A;  2DA9 A;  2JMC A;  3TSZ A;  3VRZ A;  1GBQ A;  2V1R A;  1PNJ A;  1AWW A;  1FYN A;  1YP5 A;  4J9B A;  4AG1 C;  1JEG A;  2K9G A;  3NMZ C;  2W0Z A;  4D8K A;  1K4U S;  2KRM A;  2KRN A;  4JZ4 A;  1JXO A;  2F2X A;  2LJ3 A;  2QDL A;  3EHQ A;  2FPD A;  4F14 A;  3SHW A;  2DBM A;  1PHT A;  4J9I A;  1NLP C;  4LN2 A;  4M4Z A;  1X2Q A;  1X27 A;  2MOX A;  1UGV A;  4RTY A;  1ARK A;  2EGC A;  2JT4 A;  1SPK A;  3EG3 A;  5IXB A;  2YUO A;  2DL7 A;  3IQL A;  2RMO A;  3O5Z A;  4LUE A;  2DVJ A;  1GBR A;  2DX1 A;  2E5K A;  3PVL A;  4LNP A;  2EGA A;  2EW3 A;  2L3P A;  1E7O A;  4J9H A;  2MIO A;  2DMO A;  1UHF A;  1UE9 A;  2L3Q A;  3RNJ A;  1FMK A;  1RI9 A;  4KRT A;  2GNC A;  3TSW A;  2RQT A;  3C0C A;  4EIK A;  4CC7 A;  1EFN A;  2KR3 A;  1K0S A;  2KYB A;  1AWO A;  2J05 A;  1QCF A;  1JQQ A;  3M0U A;  1M3C A;  2JS0 A;  1GCQ A;  2FRY A;  1AZG B;  2VWF A;  3LH5 A;  1KJW A;  5I11 A;  2CDT A;  4HVV A;  1VYU A;  3RBB B;  2L0A A;  2DM1 A;  3M0Q A;  4RTU A;  1GFC A;  1Z9Z A;  4OMQ A;  1AWJ A;  2CUD A;  1WFW A;  2RNA A;  2M0Y A;  4RUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...