1K0XA

Solution structure of melanoma inhibitory activity protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
108
structure length
108
Chain Sequence
MGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Melanoma Derived Growth Regulatory Protein
publication title Solution structure and dynamics of melanoma inhibitory activity protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 15
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2001-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1k0xA00
2ENMA 1WFWA 2MIOA 3EG2A 4E6RA 2DL4A 2XMFA 2FRWA 4EIKA 3REAB 3M0QA 3EHQA 1ABOA 4RTWA 2A08A 1K0XA 2C0IA 2G6FX 2YUNA 2NUZA 1AWXA 1SPKA 2PNIA 2KE9A 1UGVA 2O2OA 1OPLA 1YP5A 1JU5C 1YCSB 4J9CA 1AZEA 2CSIA 1BU1A 1T0HA 2KXDA 2YUPA 2L3QA 2YUQA 1X6BA 1NEBA 4OMMA 1W6XA 1SEMA 2DBMA 2K3BA 1UTIA 5I11A 1EFNA 2D8JA 2K7AA 3PE0A 4Y92A 3U23A 2K79A 1GL5A 1CSKA 1W70A 2DF6A 4K11A 3NHNA 3EGUA 2ROTA 1ZLMA 1B3QA 2KYBA 2JS2A 4AFSC 2FEIA 4RTUA 4AFQC 2P4RA 2LQWA 2L2PA 1GFDA 2KXCA 2OJ2A 1IO6A 1T3LA 4AG1C 2NWMA 1TUDA 4J9FA 2RQRA 2O88A 1WX6A 2KYMA 5EC7A 4AG2C 3EHRA 3RBBB 1UJ0A 4RTYA 2FPDA 4R0KA 2MOXA 1X2KA 3C0CA 3NGPA 2OI3A 1AD5A 1PKSA 1I1JA 4LE9A 1UHFA 2BTTA 1KFZA 4HVWA 4FSSA 4DEYA 1JXMA 1VYUA 3TSZA 3H0IA 2K9GA 2W10A 5FWCA 1JXOA 3R6NA 3O5ZA 3SEMA 3NMZC 2D1XA 4RTZA 1LCKA 2K2MA 1T3SA 4JJDA 4J9EA 1W1FA 1KJWA 3M0TA 2LZ6B 1GCPA 1XOVA 4Z88A 3EG0A 3UA7A 4KRTA 3VS3A 4D8KA 2KRNA 3RNJA 1SRMA 3ZL7C 2JW4A 3VRYA 2FRYA 4JZ4A 2DX1A 5IHNA 1RLPC 2HBWA 2LCSA 3UF4A 2AKLA 4ZNXA 2CH4A 1PNJA 2CUDA 1AWJA 2LX7A 3QWYA 1JQQA 4CC3A 3CQTA 5FW9A 2J6KA 2RQTA 2D8HA 1AWWA 2DL7A 5ECAA 2J05A 1MV0B 3IQLA 2QDLA 3EG3A 3I9QA 1UFFA 4JZ3A 2ROLA 4OMPA 1T0JA 4HVUA 1H92A 2EPDA 2F2WA 1UG1A 1UHCA 2M51A 4OMOA 2YDLA 4LUDA 1X6GA 2AK5A 2W0ZA 1ABQA 1GCQA 2EGEA 4J9BA 4LUEA 1OEBA 3GBQA 2GBQA 2O31A 4OMLA 5GJVB 5HCKA 1MV3A 2AKKA 1WI7A 2F2XA 2SRCA 1KIKA 1HD3A 1X43A 2KRSA 1A0NB 3VS5A 1PWTA 5IHKA 1M30A 2RQWA 2M0YA 2KEAA 2DILA 4QT7A 5IHIA 1SSHA 1WYXA 2EGAA 4OMQA 2YSQA 2CH4W 1U5SA 2J7IA 2JTEA 1SHFA 2VWFA 2RN8A 3VS2A 2L0AA 3M0RA 2KT1A 4CC7A 4JJCA 2JMCA 2MCNA 2DBKA 1U3OA 2LNHB 3REBB 4J9IA 3I5RA 4Z89A 1NEGA 2C0TA 1X27A 1NYFA 1Z9QA 3NPFA 2CREA 1Y0MA 2LMJA 1N5ZA 1K76A 2J6FA 3I35A 1K1ZA 4Z8AA 1K0SA 3EG1A 2EGCA 4OMNA 2JM9A 1QCFA 2DVJA 3VS4A 1QKWA 2KR3A 2KNBB 1SRLA 2HSPA 2RQVA 2JM8A 2DRMA 1CKAA 1E7OA 4CC4B 1PRLC 2YT6A 1E6GA 1GBQA 4AFUC 4M4ZA 4DEXA 1NG2A 1UUEA 2K6DA 2EQIA 2LJ3A 4HCKA 2KT8A 2EVRA 2ABLA 1NLPC 1UE9A 2CT3A 1I0CA 2JMAA 1GRIA 1RUWA 2HEQA 1HJDA 4D8DA 2KRMA 2DRKA 2H8HA 4X1VA 2J06A 4GLMA 1S1NA 4RTXA 1AZGB 1M8MA 2LJ0A 1I07A 3H41A 2FPEA 1WXBA 3JV3A 2DYBA 1OOTA 1WDXA 3UATA 1BB9A 4F16A 1E6HA 2RF0A 2GNCA 1ZX6A 2YUOA 2V1RA 2B86A 1X69A 5I22A 1U06A 1ZUYA 1MUZA 3KFVA 2V1QA 1Z9ZA 2I0NA 4F17A 2FG0A 4LN2A 2C0OA 2CUBA 3A98A 1JO8A 1M27C 2DM1A 2E5KA 1YWPA 4CC2A 2SEMA 1PKTA 2DL3A 2JXBA 2L3PA 2JS0A 1M3AA 2EW3A 3VRZA 2O9VA 1AOJA 3PVLA 2ED1A 2X3XD 3LH5A 2AZVA 4AFZC 1YNZA 1K4US 1YWOA 1H8KA 4RUGA 3UA6A 2LQNA 2RMOA 5GJWB 5IXFA 1QKXA 3FJ5A 2BZYA 2KROA 1QWEA 2KGTA 2DNUA 2OAWA 2A36A 1QLYA 2GQIA 1M3BA 4J9DA 1VA7A 2BZXA 1B07A 2HCKA 2RNAA 3H0FA 3VS0A 1G83A 3PVQA 1V1CA 1WIEA 1NM7A 2A37A 4HXJA 1CKBA 2KBTA 5FWBA 2EYWA 2LP5A 2CDTA 4LNPA 3TSWA 2DMOA 2ECZA 1JEGA 1AVZC 1NLOC 4ESRA 2CSQA 2RQUA 2IIMA 4IIMA 4JPBW 3THKA 2ED0A 4GBQA 2EKHA 1RLQC 2RPNA 1FYNA 1NYGA 1WA7A 1TG0A 4JJBA 2DE0X 3M0PA 4RTVA 4ORZA 1GCQC 1BBZA 1GFCA 5IXBA 3VS6A 1ZSGA 3QWXX 1ZUUA 1H3HA 2HDAA 1WXTA 2DJQA 4J9GA 2FPFA 1M3CA 1UJYA 3M0SA 2EBPA 2GGRA 1VYVA 2EYYA 1RI9A 1AWOA 2BZ8A 2DL5A 1PRMC 3VS1A 2X3WD 2VKNA 5IH2A 1WXUA 4IIOA 3M0UA 1VYTA 3SHWA 1OV3A 2FO0A 2LJ1A 2ESWA 1J3TA 1UECA 1HSQA 1YN8A 4WCIA 1OPKA 3I5SA 2DLPA 2GTOA 4A63B 1Y57A 2DL8A 1UDLA 4RTTA 1SHGA 4HVVA 3ULRB 2A28A 1ARKA 4F14A 1ZBJA 1WLPB 1GBRA 1PHTA 2CT4A 5L23A 4J9HA 1BK2A 2GTJA 2J6OA 1X2QA 3TVTA 2JT4A 2PTKA 1AEYA 1TUCA 2L3SA 1KSWA 1ZUKA 2AZSA 1G2BA 2O9SA 2PZ1A 3VS7A 1K9AA 2EYXA 2EYZA 1QWFA 3H0HA 2DA9A 2VVKA 2D0NA 2F2VA 1FMKA
chains in the Genus database with same CATH superfamily
1WFWA 1MMGA 2RA2A 3EH2A 2FYKA 2DL4A 1EZZB 2FRWA 1ACMB 2CP7A 2A08A 2C0IA 1ZBXA 6AT1B 1X75C 3MEUA 1AWXA 1SPKA 2MMPA 2ZPHB 1UGQB 2LRQA 3P8DA 1YCSB 4QKUA 2P84A 1BU1A 3PMTA 3CCSA 2X4WA 4PL6A 2HZYA 2L3QA 2YUQA 3FEOA 1X6BA 2EQKA 4OMMA 5I11A 1EFNA 4LD6A 1OZ2A 3WXMB 1GL5A 3HRTA 1Q82R 2QTXA 4UC4A 1YIJA 3RERA 1LNXA 1K73C 3OYYA 2KYBA 1WHHA 4M75G 1VQLA 2YRCA 3HHTB 5GAN7 3RKYA 4EMKA 1JB0E 4RTUA 5J26A 2LQWA 2DZ9A 1GFDA 1NPRA 2KXCA 2OJ2A 1T3LA 1X01A 2NWMA 1Y71A 4M7AE 2F69A 2HNIA 3EFOA 1WX6A 3RKXA 2KYMA 5EC7A 1G8XA 4AG2C 3EHRA 4IUPA 1UJ0A 4C92B 3BE3A 3I56A 1AD5A 1I8FA 1Q7YU 4OGEA 3E9GA 3VV0A 1JXMA 3KUFA 4M77F 2KMTA 4MDXA 3JCMQ 1ZSZA 2CZ1B 3PNWC 5CIUA 3O8VA 3M0TA 2LZ6B 4M7AD 3LH0A 4MZTA 3OBWA 3HKSA 4PLIA 4KRTA 4M7AA 2L3RA 5GMKh 2FRYA 2RO0A 1RAEB 1D0YA 2YRVA 4J8OA 4JZ4A 1RLPC 2HBWA 3GPLA 2EAYA 4IUUA 4ZNXA 2E10A 2CH4A 1PNJA 2DTIA 2JNGA 2LX7A 3MO8A 4P5NA 5FW9A 4C0DC 4M78C 1YI2A 5CQYA 2DL7A 1IZ6A 3ER0A 2J05A 3EG3A 4OMPA 1UFFA 3MHXA 2ROLA 1K9MU 3X20B 3OW2P 4LDXA 4OB1B 1VQ8T 4J83A 5AT1B 1VQ8Q 2AK5A 2KK4A 2W0ZA 4M7DF 4E7KA 3EGXA 3GBQA 2GBQA 1D3BB 2FVUA 2L8DA 3VKIA 2SRCA 1X43A 2RHXA 1RACB 4C5GA 3LYIA 3OYIA 2DXTA 1GXIE 5C6SA 5KYXB 2J7IA 2JTEA 2VWFA 5GANg 2L0AA 4J6YA 3M0RA 3M4GA 4JJCA 1D0ZA 2EKOA 2MCNA 1U3OA 1VQKA 2MWOA 4J9IA 4DBHA 4X9DA 1G3WA 4Z89A 1NEGA 2C0TA 1TOVA 3CCLT 1QQJA 3CCLQ 2HD0A 1TSFA 5GMKj 2LMJA 1M1GA 2ZZDA 3EG1A 1M2OA 2RB6A 2JM9A 2V8IA 2MI6A 5HK0A 2X51A 2KR3A 1M1KC 4PJOE 2FL7A 3JB9F 1YIJT 1PRLC 1YIJQ 1W2BA 1VQLT 3GIBA 5CR2A 1VQLQ 5D6YA 2VXFA 1UUEA 4A4HA 2EQIA 1HK9A 2MWPA 4Y91A 2DYIA 2QXFA 1XNIA 3CXCP 2PVDB 4PJOD 3I56T 4RCBA 3I56Q 2E5QA 4PJOA 4JLIA 1AZGB 1BCOA 2QQBA 5KYYB 2LJ0A 3GP8A 1G3TA 2FPEA 1WXBA 4VUBA 3JCMW 4C8QF 2CP0A 1WDXA 2I2LA 1K73R 4F16A 2RF0A 2GNCA 1KQSA 1UGRB 3HRUA 1U06A 2DKGA 3S6WA 4JDSA 1MUZA 3JCMP 2EWNA 4DQ2A 3A8MB 1IGQA 4M75F 3CD6A 1M27C 1AT1B 1QVGP 3PIOA 3L2RA 4BI4A 3PTAA 3VUZA 2MPXC 2Z0WA 1AOJA 1M5Q1 1YI2T 3UA6A 2LQNA 1YI2Q 4L6V5 1QKXA 3KXTA 2BZYA 2KROA 1QWEA 3FIFA 2A36A 5CVIA 4J9DA 3C12A 1VA7A 4EMKB 2BZXA 1B07A 3MCAB 2RNAA 4C92C 1MMAA 1G83A 4BY6B 1NE8A 4FT2A 1NM7A 3L2UA 3JCMe 4PFZA 5FWBA 4HCBA 2LP5A 1N8RU 1YFNA 2CDTA 3E19A 2DMOA 1YJWA 3EFOB 2RQUA 4E7IA 4FYVB 2DD4A 2OAUA 4XAXB 3X26B 4HKEA 4BUGA 2E1HA 3S3OA 1UB4A 1PC0A 1VQMA 4M77D 1FYNA 4E7ZA 1TG0A 4C0ZA 3HTRA 1ZSZB 2DIQA 5J3BA 1GCQC 1ZSGA 3QWXX 1ZUUA 1VQKT 2K4YA 4RG2A 1VQKQ 4XTWA 2VGNA 1VIFA 3GOXA 2KVQG 4M7AB 1VYVA 2EYYA 3CBMA 4ELZC 2VASA 1NBEB 5A0GA 3MP6A 3X28B 5IT9E 4RKUE 1D1BA 1M2VA 2P0KA 3SHWA 2YLBA 4XTYA 4JS5A 2ESWA 4EMGA 1PSEA 4F7UF 4ATOA 4BE0A 1KD1U 4M7DD 3OYDA 4RTTA 3EGXB 4F14A 4HT8A 1VQ4A 2PVGB 1TWBA 4PLLA 1AEYA 4M77G 1TUCA 3NTHA 4XU2A 2L3SA 2CS7A 3BFMA 3VS7A 3OYKA 2KQWA 2EYZA 1YJNT 1VQNA 2DA9A 2VVKA 3OA6A 1YJNQ 2EYQA 2VV5A 5GAMh 1OU8A 5KYWA 2RJDA 2MIOA 8AT1B 1G5VA 1M1KR 3EAEA 3EG2A 4E6RA 1BI2A 2K3YA 4EIKA 4C0GA 5A0DA 2JTMA 1ABOA 3R6OA 1VQ9A 1K0XA 4C8QC 3CCMA 1WJSA 1N6AA 2YUNA 2NUZA 3L2ZA 2K3XA 2PNIA 4R56A 4AT1B 2KE9A 5HK3A 3CCVA 1OPLA 3HP9A 1W2BS 1KC8U 1XQHA 3CCQA 2YUPA 2ZPGB 1SEMA 2K2VA 1U1TA 2PU9B 2ZPEB 2K3BA 1UTIA 1Q81C 3LW5E 2D8JA 2K7AA 4Y92A 2JVVA 1M90C 1JJ2A 2K79A 4M7DG 3RDVA 2DF6A 4C5EA 4ZTFA 3LWIA 1ZLMA 1UGSB 3BDUA 2HBPA 1WHJA 3OSVA 1D09B 2P4RA 2L2PA 4XK8E 2GF7A 4AG1C 2CP6A 1P92A 3A8LB 1I4K1 1SSFA 1KQSS 2EJGA 4PJLA 2M0OA 2MOXA 4R0KA 3HRSA 3C0CA 3NGPA 2JUFA 4OGCA 1UHFA 4N0AA 2BTTA 5KE3A 2OTLA 4HVWA 4M78F 4DEYA 3RIRA 3S3NA 4PJOB 1R8OB 2K9GA 4E7JA 4NOYA 5GAMj 1ZA1B 2QASA 1LCKA 4ME7A 4JJDA 4J9EA 1W1FA 2YHTA 1VQPA 5GAN6 3EG0A 3UA7A 1ZHIA 1WNLA 2CYZB 5CAIA 1SRMA 2DTHA 3ZL7C 2JW4A 1JRIA 4OB0B 2X4JA 1SF9A 4BDZA 4M75D 1TS9A 1IHWA 3JB9G 2AKLA 2CUDA 3A8GB 4EMKC 4M75A 3CCEA 2X4YA 4A53A 1BIAA 2PUKB 4PKCC 1AWWA 5ECAA 4JRQA 5FU6B 3SFMA 2QDLA 2XDBA 3I9QA 4ELYC 4MZPA 2HQEA 3CMAT 2LC4A 4HVUA 3CMAQ 4J7FA 1H92A 1TUGB 2EPDA 4PJNA 4JS4A 1UG1A 1UHCA 3DKMA 4BACA 2M51A 4LUDA 1IHVA 1C6VX 1ABQA 1RAHB 2EGEA 4LUEA 1OEBA 2XKOC 2FZCB 1IGUA 4LDUA 3CPWA 2IVWA 2PVOB 2F2XA 3M58A 1Q86U 1VQ4T 1W2BP 5IHKA 1M30A 1VQ4Q 2RI2A 2RQWA 3V8JA 4C8QG 2E6NA 2KEAA 2JOYA 2LCCA 2E12A 1VQNT 4TVRA 1SSHA 5FU7B 1VQNQ 4F04B 2YSQA 1U5SA 3P8HA 5DLOA 3VS2A 2PUOB 2FHDA 3JCMX 2M16A 3JCMg 4M7AC 1PCXA 2LNHB 3G71A 5GAMd 1RAGB 1VQ9T 1OI1A 2NLUA 3I5RA 3CMEA 3N5BB 3CCMT 1H641 1VQ9Q 5LJ3e 3CCMQ 2P4TA 3OYMA 1C1AA 1D1AA 4J6WA 4FL6A 2E4HA 2FZKB 4C5HA 1X27A 2DETA 3CCRA 4BE2A 3CCVT 2DZCA 3CCQT 1B7TA 4II1A 1N5ZA 3CCVQ 1K76A 1LJOA 3I35A 1K1ZA 3CCQQ 1FWZA 5GANh 1M2VB 2DD5A 1QCFA 2DVJA 3VS4A 1QKWA 3RUXA 2GFAA 1SRLA 2RJEA 2HSPA 2FB7A 1CKAA 3OS5A 1E7OA 1QCNA 4XU0A 1QVFA 1FMVA 5LJ5f 4ZN1A 1KG1A 1NG2A 3OYJA 3OYBA 4HT9A 2COWA 3HPWA 1Y07A 4C0FA 4HCKA 2XK0A 4ANJA 2EVRA 2KY9A 2CT3A 2V8JA 5GAN8 1GRIA 1RUWA 2LQKA 2L89A 5A0LA 4YTLA 3X24B 4FM4B 2XDDA 3SWNA 2D9TA 4HCCA 2KRMA 2DRKA 3BY7A 4B6MA 3OYLA 3M4YA 3MKDA 4OF1A 3PT9A 1Q81R 2OTLT 1S1NA 4KUIA 1D0XA 2A3LA 2CZ6B 1M90R 2OTLQ 5KYWB 3JV3A 2CP5A 1O75A 2DYBA 1OOTA 4GY5A 2DIGA 1U8RA 2B86A 4ZGJB 4C92F 1VQPT 1VQ6A 1ZUYA 1VQPQ 5D6WA 5LJ5e 4ZTJA 1JJ2S 1Z9ZA 3TQ7P 3RKWA 4F17A 4LN2A 5CO7A 3JB9J 1YWPA 5CQXA 4KUDK 2L3PA 2JS0A 1M3AA 5GANj 4D6WA 4F7UG 2E6ZA 1K4US 1RABB 2BIVA 4OMFB 3OYHA 5GJWB 3QKJA 1RI0A 2DNUA 1PSFA 1M3BA 2YXYA 4EDUA 1V76A 3H0FA 5D7UA 4V2SA 3OS1A 2VC8A 3A8HB 3ASKA 3RR6A 2RD1A 1PD1A 2WACA 2CP2A 1V1CA 3A5ZB 4HXJA 2KBTA 4PJOC 4DA4A 1NLOC 4ESRA 3UWNA 2LQ8A 2F5TX 1KK7A 4LD9K 2KDSA 5KCOA 3THKA 1QVPA 3CCST 5LL6S 3L2VA 4M78D 3AT1B 3CCSQ 4CRIA 2JJ9A 1NYGA 5CK9A 2VB6A 1NJIU 3G71T 2OTJA 1H3HA 3CMET 3G71Q 1C0MA 3CMEQ 3S3MA 2M1HA 3C95A 3MEVA 2GQVA 3M0SA 2IG0A 2RI5A 1D1CA 2RJFA 2EBPA 1F1BB 3CCRT 1BYMA 1AWOA 1Q7YC 3CCRQ 1FMWA 1RADB 2DL5A 3VS1A 2X3WD 1YBYA 1S72A 5IH2A 1WXUA 4PJMA 4IIOA 1YHQA 4A54A 2A7YA 3M0UA 2KAFA 3A8OB 4M75B 1VYTA 3INZA 1VQ7A 1OV3A 4XTXA 3M55A 3CPWS 1J3TA 3OMCA 5GANd 1BI0A 1Q82U 4A4KA 2DLPA 3SD4A 3JB9H 4C5IA 3JB9I 3L1AA 3JSCA 2LX9A 3WVEB 5GAMe 1UDLA 1JJ2P 2KSSA 2BKDN 5FLXE 3JCMf 5FU7C 1LOJA 1WLPB 4BD3A 2CT4A 5L23A 3OSSC 3J81E 4M78G 2J6OA 3TVTA 2JT4A 3G1JA 1M8VA 2V26A 3CC7A 1ZUKA 1N9SA 2O9SA 1QWFA 3H0HA 1K9MC 3JCMb 2E70A 4QQ6A 2ENMA 2G3RA 3DB3A 3M57A 4EMHA 3EHQA 1B34A 4GLKA 5HKCA 4RTWA 2NYSA 1VQ6T 1G3YA 4NS5A 1VQ6Q 2EQUA 3E1SA 3NTIA 4M77E 2HQHA 2QI2A 2H3EB 3LWHA 4EPCA 3CCUA 1TTHB 2LDMA 1QVFS 2KXDA 4KULA 5KYNA 1YCYA 1W6XA 3PE0A 5LJ3g 1CSKA 5I2SA 5KYUA 5CKEA 4K11A 2P0QA 3NHNA 2RHIA 2CZ0B 2JS2A 4AFSC 2HSEB 2FEIA 4AMCA 2QQRA 1LPLA 2B8AA 3RMSA 3JCMV 4M77A 3QZ9B 2EIFA 1IO6A 2YLCA 4JRKA 1TUDA 3OW2A 2YWWA 3KBGA 4ZGEB 1WJRA 2R57A 2FPDA 3SWNB 1X2KA 4KH1B 3AHUA 1PKSA 1I1JA 4M7DE 1NJIC 2Y4XA 1KFZA 2DXBA 4FSSA 3UDCA 5A2QE 3H0IA 3PGGA 4QQGA 7AT1B 3O5ZA 2DO3A 2DERA 2D1XA 2XG8D 4RTZA 2K2MA 2V8KA 3QIIA 1T3SA 2LT1A 2DVEA 4KT0E 2NUTA 1KJWA 2AIRB 2ZCFB 3HFNA 2OTJT 1XOVA 3OQ5A 2OTJQ 2X9HA 3CC4A 2ZGWA 4QVZA 4D8KA 2KRNA 3CEYA 1TH7A 3VRYA 4E7SA 3V7SA 1LVKA 4RG8A 2QDYB 2LCSA 4M7DA 3UF4A 4Q5WA 3OYFA 4FW2A 1SG5A 3RMQA 1ZQ1A 1S72T 4CC3A 4FYWB 4BI8B 3MJXA 1YHQT 1S72Q 2J6KA 2RQTA 1VQ7T 1YHQQ 1VQ7Q 3CCJA 2RK1A 5LJ5g 1K8AU 4M7AF 1YITA 1BCMA 2HAXA 2F2WA 4OMOA 2YDLA 4IURA 1X6GA 2RHZA 2M9UA 5AYFA 2HL5C 3LGFA 1GCQA 3OY9A 2O31A 4OMLA 5GJVB 5HCKA 3URGA 3EGDA 2QA4A 3OYAA 1KIKA 2A0FB 3QZ5B 2K5FA 4RCCA 1IRXA 4QVCA 1OX9A 1Q7YR 2Y90A 3CC7T 3A1PA 3CC7Q 3CD6T 1M4ZA 4OB3B 3HSBA 5IHIA 1AHJB 3G4SA 3CD6Q 2EGAA 4C92G 1ZA2B 3QJYA 4OMQA 2VYTA 2CH4W 3CXCA 2RN8A 3PFSA 1WQ7A 4PFPA 2KT1A 3QDFA 3CBPA 4CC7A 2E64A 4LDVA 2DBKA 2GCXA 3JB9D 3V7CA 2QAZA 5GANe 2R58A 3QO3A 1K73U 2HQXA 5FRMA 4FU6A 4KBMB 1N8RC 1QP2A 3OS2A 4C8QE 1NYFA 1Z9QA 3ZEHA 2CREA 2XIDA 2LVMA 3H6ZA 4Z8AA 1K0SA 2EGCA 4NL2A 1YJWT 1VOMA 2DXUA 1YJWQ 1MGQA 2X4XA 3JCMh 1K9MR 4MMLA 3EFSA 1M1FA 2RQVA 3D7SB 2JM8A 4PJJA 4M75E 1QVGA 1VQMT 5GMKe 4J5YA 2QTVA 4A4FA 1E6GA 1GBQA 3T9NA 1WHKA 4C8QD 1VQMQ 2K5LA 1R0BG 4E7LA 3L42A 2K6DA 5GAN4 4ZN3A 1TU0B 2K5IA 4J6XA 4C8QA 2KT8A 2ABLA 3PIPA 1NLPC 2ZPBB 2JMAA 2DJZA 5J39A 4DOVA 5M9OA 1VQ5A 4E2FB 1I5OB 4FCYA 1KQ2A 1HJDA 3E2UA 1MNEA 3META 2DTOA 2H8HA 4PNOA 5GAN2 2J06A 2CGHA 2JTFA 5GMKi 4RTXA 1M8MA 5DY9A 2MF2A 1IREB 1I07A 3H41A 4XTVA 3UATA 1KD1C 3FLGA 1BKBA 1BB9A 1B34B 4BY6C 2BE7D 5HY6A 1OZ3A 2YUOA 3VYHB 2IPOB 1VIEA 1X69A 5LJ3f 2HMAA 1XJWB 2V1QA 3CC4T 2R5MA 4PK4A 4PJOF 3CC4Q 1QCOA 2FG0A 2L5QA 3A98A 3ME9A 3BDLA 5GAN5 2BE9B 2YRDA 4Z02A 2DM1A 5DLQE 4KGZB 1PKTA 1K8AC 3I55A 2JXBA 4N4HA 2RH2A 4FSXA 3M54A 1NJIR 3HFOA 1ZSZC 3PVLA 2COZA 2ED1A 2X3XD 2AZVA 3SB2A 2XHCA 4AFZC 1M9SA 1YNZA 2QK0A 1YWOA 1H8KA 2DAQA 2XDPA 4RUGA 3OW2S 3CCJT 5IXFA 2RMOA 5KYUB 3CCJQ 3FJ5A 1YITT 2KGTA 3QYGB 1QLYA 4O6JA 1YITQ 4FYYB 3MEAA 3MPUB 3CCLA 3SWNC 5L8RE 4M77B 1NZ9A 3PVQA 1KC8C 4QQDA 2E65A 1CKBA 4HCZA 2QQSA 2EYWA 2QA4T 3TSWA 1JEGA 1AVZC 2AT1B 3M59A 2QA4Q 1BIBA 3PMIA 4F7UE 5CKDA 1WHGA 1YJ9A 2XD0A 3TCJA 1KQSP 4JPBW 1MMNA 3HL8A 2ED0A 4GBQA 3J7AF 3G4ST 2EKHA 1RLQC 2BUDA 3G4SQ 2ZPFB 4ORZA 1BBZA 1M1KU 2NUTB 1G3SA 3VS6A 2HL3A 4R55A 1BI1A 2XICA 2EJFA 1WXTA 4J9GA 4BE1A 2FPFA 1UGPB 1M3CA 1FX7A 1UJYA 2GGRA 2P0PA 4JUVA 3QDRB 3FJPA 1RI9A 3MP1A 4F7UA 3CPFA 2DFUA 2RK2A 4M7DB 1PRMC 4A4EA 2EQMA 1SKUB 1N9RA 3V8KA 1WZOA 4B9XA 3M53A 2GFUA 3UPUA 1UECA 4WCIA 2R5AA 2E3HA 3JCMd 1OPKA 3I5SA 4A63B 1MHNA 3FRNA 1Y57A 4LDYA 2DXCA 1N8RR 1RAFB 2O01E 3ULRB 1X6OA 1ZBJA 3CXCS 1FXXA 3QUIA 4J9HA 3EGDB 1BK2A 2H3JA 1VQ5T 2PTKA 3OYGA 4XU1A 1VQ5Q 1OU9A 3FDRA 2EJ9A 3Q1JA 1KSWA 2AZSA 1G2BA 2PZ1A 4QW2A 3JCMc 5GAOl 1K9AA 3F70A 4DBRA 2EFIA 3FC3A 3CCET 2XMFA 2C06A 5GAOp 3REAB 3M0QA 3CCEQ 1Y96A 1WGSA 4KH0B 4FIBA 3JCMJ 1OULA 2G6FX 4DBFA 4M78E 1Q86C 1QP3A 2QQ9A 5GAOq 1I81A 1UGVA 2QGFB 2O2OA 1QVGS 1WHLA 4IUQA 2WSCE 1YP5A 2QEXA 1JU5C 3GNFB 4J9CA 1AZEA 2CSIA 1T0HA 3VUBA 2ZPIB 1PM3A 4M7AG 3I55T 4FT4A 1NEBA 3I55Q 2DBMA 3U23A 1EIFA 2RJCA 1W70A 4OVAA 5GAOn 1HYOA 4NL3A 3EGUA 3BW1A 2ROTA 1KD1R 1B3QA 4KGXB 4N4IA 3L2QA 4M78A 4AFQC 5CKHA 5GAMf 3CC2A 1IB8A 1RAIB 4C8QB 1R0CB 3QJ6A 3QSUA 4J9FA 2RQRA 2QG9B 2O88A 1WJQA 4BI3A 3EH1A 2LCLA 4RTYA 3RBBB 2D0QB 5LJ3h 3OMGA 2OI3A 5FU6C 1YJ9T 3TEEA 1K8AR 4LE9A 1OYXA 1YJ9Q 3VYGA 5CCAA 1IXDA 1VYUA 3TSZA 2W10A 2NUPA 1JXOA 5FWCA 3R6NA 3VU3C 3GF5A 3SEMA 3NMZC 1WPYA 5EG2A 1V29B 3H9NA 2LNVA 2O4XA 4IKFA 2ZAEA 1N27A 1GCPA 4Z88A 4PFOA 2PQWA 5GMKl 5I2MA 1KC8R 3VS3A 1NPPA 3RNJA 2E41A 1UEBA 4JRPA 3G6EA 2DX1A 5IHNA 3EG9A 1YJNA 2JZ2A 3JAME 4LXCA 3QWYA 1QW1A 1AWJA 1JQQA 3CQTA 2DEQA 4IUTA 2D8HA 2VUBA 4E47A 4M77C 1MV0B 3IQLA 1EX4A 4JZ3A 5D6XA 1T0JA 4IUVA 2ATCB 3QG1A 2RI3A 2OX7A 3M9QA 4DOWA 2M02A 3C4SA 4RMOA 2KI7A 2XI9A 3V8LA 3VJPA 4J9BA 5GAN3 4WTOB 3GLXA 1MV3A 2AKKA 1WI7A 3LLRA 1HD3A 2KRSA 1A0NB 3VS5A 1PWTA 3WVDB 2K57A 3ZBDA 5C0MA 2M0YA 4OB2B 2RHUA 5LJ3j 2DILA 4QT7A 5LJ5h 4X34A 1WYXA 4MDWA 2RM4A 3DLLA 1SHFA 5KE2A 1U1SA 1Q81U 1O9SA 3QXEB 2JMCA 1M90U 1R77A 4PJOG 3REBB 1PG5B 4BDYA 2Y4YA 4CI0C 2AHJB 4M7DC 4WF2A 2WSFE 3NPFA 3NFCA 1Y0MA 1KHIA 2QEXT 1DJ7B 4F7UB 2J6FA 2QEXQ 5IAYA 4C92E 4OMNA 4B9WA 2DK3A 1VQOA 5FRNA 2KNBB 1MNDA 2DRMA 4BB7A 9ATCB 4CC4B 3CPWP 2YT6A 2QQAA 3OYEA 4AFUC 4M4ZA 4DEXA 3CC2T 4JJNK 1Q86R 2HKQB 2LJ3A 4C92D 3CC2Q 1WHMA 1UE9A 1I0CA 2CKKA 2HEQA 3QYHB 1PD0A 4D8DA 4C92A 4L59A 1H3ZA 4X1VA 1JBMA 3RESA 3CMAA 4GLMA 5LJ5j 2CP3A 1I5LA 1Q82C 4FW1A 5LJ3d 3ZFJA 5DM7R 1RL2A 4FYXB 2DPPB 3LGLA 1E6HA 1Y96B 1ZX6A 5GANf 2V1RA 5I22A 1TXQA 1OX8A 2F1LA 3OBYA 2HKNA 3KFVA 3M5AA 2WSEE 2I0NA 3MEWA 5GAOr 4QVDA 1W4SA 3G6ET 4ZGDB 2C0OA 2CUBA 1JO8A 3H8ZA 3OB9A 4N0AC 3G6EQ 3JRZA 2E5KA 1WQWA 4CC2A 2SEMA 2X35A 2DL3A 5GAOm 3FB9A 1QVFP 4JRIA 3OS0A 2EW3A 3VRZA 2O9VA 3LX7A 3LH5A 2QGGA 2E3IA 2OAWA 3QPHA 2GQIA 2HCKA 2MK5A 4C0DB 4M78B 3VS0A 1D3BA 1Q95G 1WIEA 4L5GA 2A37A 3CBOA 4KGVB 2F5KA 4LNPA 2ECZA 3TU4K 4HA8A 4M75C 2RHYA 3UT1A 2CSQA 5I21A 4E7HA 2IIMA 2LT4A 3CCUT 3QBYA 4IIMA 5FROA 3CCUQ 1Y7XA 5KYXA 1RAAB 3MP8A 2RPNA 2VGMA 2NUPB 1WA7A 4JJBA 2DE0X 2DEUA 5LJ5d 3TREA 3M0PA 4RTVA 5CKFA 1GFCA 2O4XB 4XTZA 5IXBA 3OYCA 1QMCA 5IN1A 1MMDA 3P8BB 4XU3A 2CZ7B 2HDAA 4XQ3A 2DJQA 4J7IA 4LDWA 2QYZA 8ATCB 3OYNA 3EG9B 2BZ8A 3QHSA 3X25B 1BI3A 4Y28E 3G7ZA 2LTOA 2VKNA 1XTDA 3NTKA 3DB4A 3L2WA 1VQOT 3EFRA 2FO0A 1VQOQ 5KCHA 2EQJA 1OQKA 2LJ1A 2XU8A 1HSQA 1YN8A 2JN0A 4A4GA 4X9CA 4JLGA 4MZMA 3C94A 1VQ8A 3E9FA 5GAMg 1HXDA 3GNGA 3DLMA 3M56A 2D6FA 2COYA 2GTOA 2DL8A 2FZGB 5GMKm 4MMKA 4O5VA 4DBQA 4N4GA 1SHGA 4HVVA 1ARKA 2A28A 5CKBA 4XTUA 5KH6A 1GBRA 1PHTA 2GTJA 1KHCA 1X2QA 3V7RA 2MAMA 1VUBA 3SDZA 2EYXA 2MYSA 1KQ1A 2D0NA 2F2VA 3J80E 2VXEA 5KYYA 1FMKA 4OP0A
chains in the Genus database with same CATH topology
2ENMA 1WFWA 2MIOA 3EG2A 4E6RA 2DL4A 2XMFA 2FRWA 4EIKA 3REAB 3M0QA 3EHQA 1ABOA 4RTWA 2A08A 1K0XA 2C0IA 2G6FX 2YUNA 2NUZA 1AWXA 1SPKA 2PNIA 2KE9A 1UGVA 2O2OA 1OPLA 1YP5A 1JU5C 1YCSB 4J9CA 1AZEA 2CSIA 1BU1A 1T0HA 2KXDA 2YUPA 2L3QA 2YUQA 1X6BA 1NEBA 4OMMA 1W6XA 1SEMA 2DBMA 2K3BA 1UTIA 5I11A 1EFNA 2D8JA 2K7AA 3PE0A 4Y92A 3U23A 2K79A 1GL5A 1CSKA 1W70A 2DF6A 4K11A 3NHNA 3EGUA 2ROTA 1ZLMA 1B3QA 2KYBA 2JS2A 4AFSC 2FEIA 4RTUA 4AFQC 2P4RA 2LQWA 2L2PA 1GFDA 2KXCA 2OJ2A 1IO6A 1T3LA 4AG1C 2NWMA 1TUDA 4J9FA 2RQRA 2O88A 1WX6A 2KYMA 5EC7A 4AG2C 3EHRA 3RBBB 1UJ0A 4RTYA 2FPDA 4R0KA 2MOXA 1X2KA 3C0CA 3NGPA 2OI3A 1AD5A 1PKSA 1I1JA 4LE9A 1UHFA 2BTTA 1KFZA 4HVWA 4FSSA 4DEYA 1JXMA 1VYUA 3TSZA 3H0IA 2K9GA 2W10A 5FWCA 1JXOA 3R6NA 3O5ZA 3SEMA 3NMZC 2D1XA 4RTZA 1LCKA 2K2MA 1T3SA 4JJDA 4J9EA 1W1FA 1KJWA 3M0TA 2LZ6B 1GCPA 1XOVA 4Z88A 3EG0A 3UA7A 4KRTA 3VS3A 4D8KA 2KRNA 3RNJA 1SRMA 3ZL7C 2JW4A 3VRYA 2FRYA 4JZ4A 2DX1A 5IHNA 1RLPC 2HBWA 2LCSA 3UF4A 2AKLA 4ZNXA 2CH4A 1PNJA 2CUDA 1AWJA 2LX7A 3QWYA 1JQQA 4CC3A 3CQTA 5FW9A 2J6KA 2RQTA 2D8HA 1AWWA 2DL7A 5ECAA 2J05A 1MV0B 3IQLA 2QDLA 3EG3A 3I9QA 1UFFA 4JZ3A 2ROLA 4OMPA 1T0JA 4HVUA 1H92A 2EPDA 2F2WA 1UG1A 1UHCA 2M51A 4OMOA 2YDLA 4LUDA 1X6GA 2AK5A 2W0ZA 1ABQA 1GCQA 2EGEA 4J9BA 4LUEA 1OEBA 3GBQA 2GBQA 2O31A 4OMLA 5GJVB 5HCKA 1MV3A 2AKKA 1WI7A 2F2XA 2SRCA 1KIKA 1HD3A 1X43A 2KRSA 1A0NB 3VS5A 1PWTA 5IHKA 1M30A 2RQWA 2M0YA 2KEAA 2DILA 4QT7A 5IHIA 1SSHA 1WYXA 2EGAA 4OMQA 2YSQA 2CH4W 1U5SA 2J7IA 2JTEA 1SHFA 2VWFA 2RN8A 3VS2A 2L0AA 3M0RA 2KT1A 4CC7A 4JJCA 2JMCA 2MCNA 2DBKA 1U3OA 2LNHB 3REBB 4J9IA 3I5RA 4Z89A 1NEGA 2C0TA 1X27A 1NYFA 1Z9QA 3NPFA 2CREA 1Y0MA 2LMJA 1N5ZA 1K76A 2J6FA 3I35A 1K1ZA 4Z8AA 1K0SA 3EG1A 2EGCA 4OMNA 2JM9A 1QCFA 2DVJA 3VS4A 1QKWA 2KR3A 2KNBB 1SRLA 2HSPA 2RQVA 2JM8A 2DRMA 1CKAA 1E7OA 4CC4B 1PRLC 2YT6A 1E6GA 1GBQA 4AFUC 4M4ZA 4DEXA 1NG2A 1UUEA 2K6DA 2EQIA 2LJ3A 4HCKA 2KT8A 2EVRA 2ABLA 1NLPC 1UE9A 2CT3A 1I0CA 2JMAA 1GRIA 1RUWA 2HEQA 1HJDA 4D8DA 2KRMA 2DRKA 2H8HA 4X1VA 2J06A 4GLMA 1S1NA 4RTXA 1AZGB 1M8MA 2LJ0A 1I07A 3H41A 2FPEA 1WXBA 3JV3A 2DYBA 1OOTA 1WDXA 3UATA 1BB9A 4F16A 1E6HA 2RF0A 2GNCA 1ZX6A 2YUOA 2V1RA 2B86A 1X69A 5I22A 1U06A 1ZUYA 1MUZA 3KFVA 2V1QA 1Z9ZA 2I0NA 4F17A 2FG0A 4LN2A 2C0OA 2CUBA 3A98A 1JO8A 1M27C 2DM1A 2E5KA 1YWPA 4CC2A 2SEMA 1PKTA 2DL3A 2JXBA 2L3PA 2JS0A 1M3AA 2EW3A 3VRZA 2O9VA 1AOJA 3PVLA 2ED1A 2X3XD 3LH5A 2AZVA 4AFZC 1YNZA 1K4US 1YWOA 1H8KA 4RUGA 3UA6A 2LQNA 2RMOA 5GJWB 5IXFA 1QKXA 3FJ5A 2BZYA 2KROA 1QWEA 2KGTA 2DNUA 2OAWA 2A36A 1QLYA 2GQIA 1M3BA 4J9DA 1VA7A 2BZXA 1B07A 2HCKA 2RNAA 3H0FA 3VS0A 1G83A 3PVQA 1V1CA 1WIEA 1NM7A 2A37A 4HXJA 1CKBA 2KBTA 5FWBA 2EYWA 2LP5A 2CDTA 4LNPA 3TSWA 2DMOA 2ECZA 1JEGA 1AVZC 1NLOC 4ESRA 2CSQA 2RQUA 2IIMA 4IIMA 4JPBW 3THKA 2ED0A 4GBQA 2EKHA 1RLQC 2RPNA 1FYNA 1NYGA 1WA7A 1TG0A 4JJBA 2DE0X 3M0PA 4RTVA 4ORZA 1GCQC 1BBZA 1GFCA 5IXBA 3VS6A 1ZSGA 3QWXX 1ZUUA 1H3HA 2HDAA 1WXTA 2DJQA 4J9GA 2FPFA 1M3CA 1UJYA 3M0SA 2EBPA 2GGRA 1VYVA 2EYYA 1RI9A 1AWOA 2BZ8A 2DL5A 1PRMC 3VS1A 2X3WD 2VKNA 5IH2A 1WXUA 4IIOA 3M0UA 1VYTA 3SHWA 1OV3A 2FO0A 2LJ1A 2ESWA 1J3TA 1UECA 1HSQA 1YN8A 4WCIA 1OPKA 3I5SA 2DLPA 2GTOA 4A63B 1Y57A 2DL8A 1UDLA 4RTTA 1SHGA 4HVVA 3ULRB 2A28A 1ARKA 4F14A 1ZBJA 1WLPB 1GBRA 1PHTA 2CT4A 5L23A 4J9HA 1BK2A 2GTJA 2J6OA 1X2QA 3TVTA 2JT4A 2PTKA 1AEYA 1TUCA 2L3SA 1KSWA 1ZUKA 2AZSA 1G2BA 2O9SA 2PZ1A 3VS7A 1K9AA 2EYXA 2EYZA 1QWFA 3H0HA 2DA9A 2VVKA 2D0NA 2F2VA 1FMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ENM A;  1WFW A;  2MIO A;  3EG2 A;  4E6R A;  2DL4 A;  2XMF A;  2FRW A;  4EIK A;  3REA B;  3M0Q A;  3EHQ A;  1ABO A;  4RTW A;  2A08 A;  1K0X A;  2C0I A;  2G6F X;  2YUN A;  2NUZ A;  1AWX A;  1SPK A;  2PNI A;  2KE9 A;  1UGV A;  2O2O A;  1OPL A;  1YP5 A;  1JU5 C;  1YCS B;  4J9C A;  1AZE A;  2CSI A;  1BU1 A;  1T0H A;  2KXD A;  2YUP A;  2L3Q A;  2YUQ A;  1X6B A;  1NEB A;  4OMM A;  1W6X A;  1SEM A;  2DBM A;  2K3B A;  1UTI A;  5I11 A;  1EFN A;  2D8J A;  2K7A A;  3PE0 A;  4Y92 A;  3U23 A;  2K79 A;  1GL5 A;  1CSK A;  1W70 A;  2DF6 A;  4K11 A;  3NHN A;  3EGU A;  2ROT A;  1ZLM A;  1B3Q A;  2KYB A;  2JS2 A;  4AFS C;  2FEI A;  4RTU A;  4AFQ C;  2P4R A;  2LQW A;  2L2P A;  1GFD A;  2KXC A;  2OJ2 A;  1IO6 A;  1T3L A;  4AG1 C;  2NWM A;  1TUD A;  4J9F A;  2RQR A;  2O88 A;  1WX6 A;  2KYM A;  5EC7 A;  4AG2 C;  3EHR A;  3RBB B;  1UJ0 A;  4RTY A;  2FPD A;  4R0K A;  2MOX A;  1X2K A;  3C0C A;  3NGP A;  2OI3 A;  1AD5 A;  1PKS A;  1I1J A;  4LE9 A;  1UHF A;  2BTT A;  1KFZ A;  4HVW A;  4FSS A;  4DEY A;  1JXM A;  1VYU A;  3TSZ A;  3H0I A;  2K9G A;  2W10 A;  5FWC A;  1JXO A;  3R6N A;  3O5Z A;  3SEM A;  3NMZ C;  2D1X A;  4RTZ A;  1LCK A;  2K2M A;  1T3S A;  4JJD A;  4J9E A;  1W1F A;  1KJW A;  3M0T A;  2LZ6 B;  1GCP A;  1XOV A;  4Z88 A;  3EG0 A;  3UA7 A;  4KRT A;  3VS3 A;  4D8K A;  2KRN A;  3RNJ A;  1SRM A;  3ZL7 C;  2JW4 A;  3VRY A;  2FRY A;  4JZ4 A;  2DX1 A;  5IHN A;  1RLP C;  2HBW A;  2LCS A;  3UF4 A;  2AKL A;  4ZNX A;  2CH4 A;  1PNJ A;  2CUD A;  1AWJ A;  2LX7 A;  3QWY A;  1JQQ A;  4CC3 A;  3CQT A;  5FW9 A;  2J6K A;  2RQT A;  2D8H A;  1AWW A;  2DL7 A;  5ECA A;  2J05 A;  1MV0 B;  3IQL A;  2QDL A;  3EG3 A;  3I9Q A;  1UFF A;  4JZ3 A;  2ROL A;  4OMP A;  1T0J A;  4HVU A;  1H92 A;  2EPD A;  2F2W A;  1UG1 A;  1UHC A;  2M51 A;  4OMO A;  2YDL A;  4LUD A;  1X6G A;  2AK5 A;  2W0Z A;  1ABQ A;  1GCQ A;  2EGE A;  4J9B A;  4LUE A;  1OEB A;  3GBQ A;  2GBQ A;  2O31 A;  4OML A;  5GJV B;  5HCK A;  1MV3 A;  2AKK A;  1WI7 A;  2F2X A;  2SRC A;  1KIK A;  1HD3 A;  1X43 A;  2KRS A;  1A0N B;  3VS5 A;  1PWT A;  5IHK A;  1M30 A;  2RQW A;  2M0Y A;  2KEA A;  2DIL A;  4QT7 A;  5IHI A;  1SSH A;  1WYX A;  2EGA A;  4OMQ A;  2YSQ A;  2CH4 W;  1U5S A;  2J7I A;  2JTE A;  1SHF A;  2VWF A;  2RN8 A;  3VS2 A;  2L0A A;  3M0R A;  2KT1 A;  4CC7 A;  4JJC A;  2JMC A;  2MCN A;  2DBK A;  1U3O A;  2LNH B;  3REB B;  4J9I A;  3I5R A;  4Z89 A;  1NEG A;  2C0T A;  1X27 A;  1NYF A;  1Z9Q A;  3NPF A;  2CRE A;  1Y0M A;  2LMJ A;  1N5Z A;  1K76 A;  2J6F A;  3I35 A;  1K1Z A;  4Z8A A;  1K0S A;  3EG1 A;  2EGC A;  4OMN A;  2JM9 A;  1QCF A;  2DVJ A;  3VS4 A;  1QKW A;  2KR3 A;  2KNB B;  1SRL A;  2HSP A;  2RQV A;  2JM8 A;  2DRM A;  1CKA A;  1E7O A;  4CC4 B;  1PRL C;  2YT6 A;  1E6G A;  1GBQ A;  4AFU C;  4M4Z A;  4DEX A;  1NG2 A;  1UUE A;  2K6D A;  2EQI A;  2LJ3 A;  4HCK A;  2KT8 A;  2EVR A;  2ABL A;  1NLP C;  1UE9 A;  2CT3 A;  1I0C A;  2JMA A;  1GRI A;  1RUW A;  2HEQ A;  1HJD A;  4D8D A;  2KRM A;  2DRK A;  2H8H A;  4X1V A;  2J06 A;  4GLM A;  1S1N A;  4RTX A;  1AZG B;  1M8M A;  2LJ0 A;  1I07 A;  3H41 A;  2FPE A;  1WXB A;  3JV3 A;  2DYB A;  1OOT A;  1WDX A;  3UAT A;  1BB9 A;  4F16 A;  1E6H A;  2RF0 A;  2GNC A;  1ZX6 A;  2YUO A;  2V1R A;  2B86 A;  1X69 A;  5I22 A;  1U06 A;  1ZUY A;  1MUZ A;  3KFV A;  2V1Q A;  1Z9Z A;  2I0N A;  4F17 A;  2FG0 A;  4LN2 A;  2C0O A;  2CUB A;  3A98 A;  1JO8 A;  1M27 C;  2DM1 A;  2E5K A;  1YWP A;  4CC2 A;  2SEM A;  1PKT A;  2DL3 A;  2JXB A;  2L3P A;  2JS0 A;  1M3A A;  2EW3 A;  3VRZ A;  2O9V A;  1AOJ A;  3PVL A;  2ED1 A;  2X3X D;  3LH5 A;  2AZV A;  4AFZ C;  1YNZ A;  1K4U S;  1YWO A;  1H8K A;  4RUG A;  3UA6 A;  2LQN A;  2RMO A;  5GJW B;  5IXF A;  1QKX A;  3FJ5 A;  2BZY A;  2KRO A;  1QWE A;  2KGT A;  2DNU A;  2OAW A;  2A36 A;  1QLY A;  2GQI A;  1M3B A;  4J9D A;  1VA7 A;  2BZX A;  1B07 A;  2HCK A;  2RNA A;  3H0F A;  3VS0 A;  1G83 A;  3PVQ A;  1V1C A;  1WIE A;  1NM7 A;  2A37 A;  4HXJ A;  1CKB A;  2KBT A;  5FWB A;  2EYW A;  2LP5 A;  2CDT A;  4LNP A;  3TSW A;  2DMO A;  2ECZ A;  1JEG A;  1AVZ C;  1NLO C;  4ESR A;  2CSQ A;  2RQU A;  2IIM A;  4IIM A;  4JPB W;  3THK A;  2ED0 A;  4GBQ A;  2EKH A;  1RLQ C;  2RPN A;  1FYN A;  1NYG A;  1WA7 A;  1TG0 A;  4JJB A;  2DE0 X;  3M0P A;  4RTV A;  4ORZ A;  1GCQ C;  1BBZ A;  1GFC A;  5IXB A;  3VS6 A;  1ZSG A;  3QWX X;  1ZUU A;  1H3H A;  2HDA A;  1WXT A;  2DJQ A;  4J9G A;  2FPF A;  1M3C A;  1UJY A;  3M0S A;  2EBP A;  2GGR A;  1VYV A;  2EYY A;  1RI9 A;  1AWO A;  2BZ8 A;  2DL5 A;  1PRM C;  3VS1 A;  2X3W D;  2VKN A;  5IH2 A;  1WXU A;  4IIO A;  3M0U A;  1VYT A;  3SHW A;  1OV3 A;  2FO0 A;  2LJ1 A;  2ESW A;  1J3T A;  1UEC A;  1HSQ A;  1YN8 A;  4WCI A;  1OPK A;  3I5S A;  2DLP A;  2GTO A;  4A63 B;  1Y57 A;  2DL8 A;  1UDL A;  4RTT A;  1SHG A;  4HVV A;  3ULR B;  2A28 A;  1ARK A;  4F14 A;  1ZBJ A;  1WLP B;  1GBR A;  1PHT A;  2CT4 A;  5L23 A;  4J9H A;  1BK2 A;  2GTJ A;  2J6O A;  1X2Q A;  3TVT A;  2JT4 A;  2PTK A;  1AEY A;  1TUC A;  2L3S A;  1KSW A;  1ZUK A;  2AZS A;  1G2B A;  2O9S A;  2PZ1 A;  3VS7 A;  1K9A A;  2EYX A;  2EYZ A;  1QWF A;  3H0H A;  2DA9 A;  2VVK A;  2D0N A;  2F2V A;  1FMK A; 
#chains in the Genus database with same CATH topology
 1WFW A;  1MMG A;  2RA2 A;  3EH2 A;  2FYK A;  2DL4 A;  1EZZ B;  2FRW A;  1ACM B;  2CP7 A;  2A08 A;  2C0I A;  1ZBX A;  6AT1 B;  1X75 C;  3MEU A;  1AWX A;  1SPK A;  2MMP A;  2ZPH B;  1UGQ B;  2LRQ A;  3P8D A;  1YCS B;  4QKU A;  2P84 A;  1BU1 A;  3PMT A;  3CCS A;  2X4W A;  4PL6 A;  2HZY A;  2L3Q A;  2YUQ A;  3FEO A;  1X6B A;  2EQK A;  4OMM A;  5I11 A;  1EFN A;  4LD6 A;  1OZ2 A;  3WXM B;  1GL5 A;  3HRT A;  1Q82 R;  2QTX A;  4UC4 A;  1YIJ A;  3RER A;  1LNX A;  1K73 C;  3OYY A;  2KYB A;  1WHH A;  4M75 G;  1VQL A;  2YRC A;  3HHT B;  5GAN 7;  3RKY A;  4EMK A;  1JB0 E;  4RTU A;  5J26 A;  2LQW A;  2DZ9 A;  1GFD A;  1NPR A;  2KXC A;  2OJ2 A;  1T3L A;  1X01 A;  2NWM A;  1Y71 A;  4M7A E;  2F69 A;  2HNI A;  3EFO A;  1WX6 A;  3RKX A;  2KYM A;  5EC7 A;  1G8X A;  4AG2 C;  3EHR A;  4IUP A;  1UJ0 A;  4C92 B;  3BE3 A;  3I56 A;  1AD5 A;  1I8F A;  1Q7Y U;  4OGE A;  3E9G A;  3VV0 A;  1JXM A;  3KUF A;  4M77 F;  2KMT A;  4MDX A;  3JCM Q;  1ZSZ A;  2CZ1 B;  3PNW C;  5CIU A;  3O8V A;  3M0T A;  2LZ6 B;  4M7A D;  3LH0 A;  4MZT A;  3OBW A;  3HKS A;  4PLI A;  4KRT A;  4M7A A;  2L3R A;  5GMK h;  2FRY A;  2RO0 A;  1RAE B;  1D0Y A;  2YRV A;  4J8O A;  4JZ4 A;  1RLP C;  2HBW A;  3GPL A;  2EAY A;  4IUU A;  4ZNX A;  2E10 A;  2CH4 A;  1PNJ A;  2DTI A;  2JNG A;  2LX7 A;  3MO8 A;  4P5N A;  5FW9 A;  4C0D C;  4M78 C;  1YI2 A;  5CQY A;  2DL7 A;  1IZ6 A;  3ER0 A;  2J05 A;  3EG3 A;  4OMP A;  1UFF A;  3MHX A;  2ROL A;  1K9M U;  3X20 B;  3OW2 P;  4LDX A;  4OB1 B;  1VQ8 T;  4J83 A;  5AT1 B;  1VQ8 Q;  2AK5 A;  2KK4 A;  2W0Z A;  4M7D F;  4E7K A;  3EGX A;  3GBQ A;  2GBQ A;  1D3B B;  2FVU A;  2L8D A;  3VKI A;  2SRC A;  1X43 A;  2RHX A;  1RAC B;  4C5G A;  3LYI A;  3OYI A;  2DXT A;  1GXI E;  5C6S A;  5KYX B;  2J7I A;  2JTE A;  2VWF A;  5GAN g;  2L0A A;  4J6Y A;  3M0R A;  3M4G A;  4JJC A;  1D0Z A;  2EKO A;  2MCN A;  1U3O A;  1VQK A;  2MWO A;  4J9I A;  4DBH A;  4X9D A;  1G3W A;  4Z89 A;  1NEG A;  2C0T A;  1TOV A;  3CCL T;  1QQJ A;  3CCL Q;  2HD0 A;  1TSF A;  5GMK j;  2LMJ A;  1M1G A;  2ZZD A;  3EG1 A;  1M2O A;  2RB6 A;  2JM9 A;  2V8I A;  2MI6 A;  5HK0 A;  2X51 A;  2KR3 A;  1M1K C;  4PJO E;  2FL7 A;  3JB9 F;  1YIJ T;  1PRL C;  1YIJ Q;  1W2B A;  1VQL T;  3GIB A;  5CR2 A;  1VQL Q;  5D6Y A;  2VXF A;  1UUE A;  4A4H A;  2EQI A;  1HK9 A;  2MWP A;  4Y91 A;  2DYI A;  2QXF A;  1XNI A;  3CXC P;  2PVD B;  4PJO D;  3I56 T;  4RCB A;  3I56 Q;  2E5Q A;  4PJO A;  4JLI A;  1AZG B;  1BCO A;  2QQB A;  5KYY B;  2LJ0 A;  3GP8 A;  1G3T A;  2FPE A;  1WXB A;  4VUB A;  3JCM W;  4C8Q F;  2CP0 A;  1WDX A;  2I2L A;  1K73 R;  4F16 A;  2RF0 A;  2GNC A;  1KQS A;  1UGR B;  3HRU A;  1U06 A;  2DKG A;  3S6W A;  4JDS A;  1MUZ A;  3JCM P;  2EWN A;  4DQ2 A;  3A8M B;  1IGQ A;  4M75 F;  3CD6 A;  1M27 C;  1AT1 B;  1QVG P;  3PIO A;  3L2R A;  4BI4 A;  3PTA A;  3VUZ A;  2MPX C;  2Z0W A;  1AOJ A;  1M5Q 1;  1YI2 T;  3UA6 A;  2LQN A;  1YI2 Q;  4L6V 5;  1QKX A;  3KXT A;  2BZY A;  2KRO A;  1QWE A;  3FIF A;  2A36 A;  5CVI A;  4J9D A;  3C12 A;  1VA7 A;  4EMK B;  2BZX A;  1B07 A;  3MCA B;  2RNA A;  4C92 C;  1MMA A;  1G83 A;  4BY6 B;  1NE8 A;  4FT2 A;  1NM7 A;  3L2U A;  3JCM e;  4PFZ A;  5FWB A;  4HCB A;  2LP5 A;  1N8R U;  1YFN A;  2CDT A;  3E19 A;  2DMO A;  1YJW A;  3EFO B;  2RQU A;  4E7I A;  4FYV B;  2DD4 A;  2OAU A;  4XAX B;  3X26 B;  4HKE A;  4BUG A;  2E1H A;  3S3O A;  1UB4 A;  1PC0 A;  1VQM A;  4M77 D;  1FYN A;  4E7Z A;  1TG0 A;  4C0Z A;  3HTR A;  1ZSZ B;  2DIQ A;  5J3B A;  1GCQ C;  1ZSG A;  3QWX X;  1ZUU A;  1VQK T;  2K4Y A;  4RG2 A;  1VQK Q;  4XTW A;  2VGN A;  1VIF A;  3GOX A;  2KVQ G;  4M7A B;  1VYV A;  2EYY A;  3CBM A;  4ELZ C;  2VAS A;  1NBE B;  5A0G A;  3MP6 A;  3X28 B;  5IT9 E;  4RKU E;  1D1B A;  1M2V A;  2P0K A;  3SHW A;  2YLB A;  4XTY A;  4JS5 A;  2ESW A;  4EMG A;  1PSE A;  4F7U F;  4ATO A;  4BE0 A;  1KD1 U;  4M7D D;  3OYD A;  4RTT A;  3EGX B;  4F14 A;  4HT8 A;  1VQ4 A;  2PVG B;  1TWB A;  4PLL A;  1AEY A;  4M77 G;  1TUC A;  3NTH A;  4XU2 A;  2L3S A;  2CS7 A;  3BFM A;  3VS7 A;  3OYK A;  2KQW A;  2EYZ A;  1YJN T;  1VQN A;  2DA9 A;  2VVK A;  3OA6 A;  1YJN Q;  2EYQ A;  2VV5 A;  5GAM h;  1OU8 A;  5KYW A;  2RJD A;  2MIO A;  8AT1 B;  1G5V A;  1M1K R;  3EAE A;  3EG2 A;  4E6R A;  1BI2 A;  2K3Y A;  4EIK A;  4C0G A;  5A0D A;  2JTM A;  1ABO A;  3R6O A;  1VQ9 A;  1K0X A;  4C8Q C;  3CCM A;  1WJS A;  1N6A A;  2YUN A;  2NUZ A;  3L2Z A;  2K3X A;  2PNI A;  4R56 A;  4AT1 B;  2KE9 A;  5HK3 A;  3CCV A;  1OPL A;  3HP9 A;  1W2B S;  1KC8 U;  1XQH A;  3CCQ A;  2YUP A;  2ZPG B;  1SEM A;  2K2V A;  1U1T A;  2PU9 B;  2ZPE B;  2K3B A;  1UTI A;  1Q81 C;  3LW5 E;  2D8J A;  2K7A A;  4Y92 A;  2JVV A;  1M90 C;  1JJ2 A;  2K79 A;  4M7D G;  3RDV A;  2DF6 A;  4C5E A;  4ZTF A;  3LWI A;  1ZLM A;  1UGS B;  3BDU A;  2HBP A;  1WHJ A;  3OSV A;  1D09 B;  2P4R A;  2L2P A;  4XK8 E;  2GF7 A;  4AG1 C;  2CP6 A;  1P92 A;  3A8L B;  1I4K 1;  1SSF A;  1KQS S;  2EJG A;  4PJL A;  2M0O A;  2MOX A;  4R0K A;  3HRS A;  3C0C A;  3NGP A;  2JUF A;  4OGC A;  1UHF A;  4N0A A;  2BTT A;  5KE3 A;  2OTL A;  4HVW A;  4M78 F;  4DEY A;  3RIR A;  3S3N A;  4PJO B;  1R8O B;  2K9G A;  4E7J A;  4NOY A;  5GAM j;  1ZA1 B;  2QAS A;  1LCK A;  4ME7 A;  4JJD A;  4J9E A;  1W1F A;  2YHT A;  1VQP A;  5GAN 6;  3EG0 A;  3UA7 A;  1ZHI A;  1WNL A;  2CYZ B;  5CAI A;  1SRM A;  2DTH A;  3ZL7 C;  2JW4 A;  1JRI A;  4OB0 B;  2X4J A;  1SF9 A;  4BDZ A;  4M75 D;  1TS9 A;  1IHW A;  3JB9 G;  2AKL A;  2CUD A;  3A8G B;  4EMK C;  4M75 A;  3CCE A;  2X4Y A;  4A53 A;  1BIA A;  2PUK B;  4PKC C;  1AWW A;  5ECA A;  4JRQ A;  5FU6 B;  3SFM A;  2QDL A;  2XDB A;  3I9Q A;  4ELY C;  4MZP A;  2HQE A;  3CMA T;  2LC4 A;  4HVU A;  3CMA Q;  4J7F A;  1H92 A;  1TUG B;  2EPD A;  4PJN A;  4JS4 A;  1UG1 A;  1UHC A;  3DKM A;  4BAC A;  2M51 A;  4LUD A;  1IHV A;  1C6V X;  1ABQ A;  1RAH B;  2EGE A;  4LUE A;  1OEB A;  2XKO C;  2FZC B;  1IGU A;  4LDU A;  3CPW A;  2IVW A;  2PVO B;  2F2X A;  3M58 A;  1Q86 U;  1VQ4 T;  1W2B P;  5IHK A;  1M30 A;  1VQ4 Q;  2RI2 A;  2RQW A;  3V8J A;  4C8Q G;  2E6N A;  2KEA A;  2JOY A;  2LCC A;  2E12 A;  1VQN T;  4TVR A;  1SSH A;  5FU7 B;  1VQN Q;  4F04 B;  2YSQ A;  1U5S A;  3P8H A;  5DLO A;  3VS2 A;  2PUO B;  2FHD A;  3JCM X;  2M16 A;  3JCM g;  4M7A C;  1PCX A;  2LNH B;  3G71 A;  5GAM d;  1RAG B;  1VQ9 T;  1OI1 A;  2NLU A;  3I5R A;  3CME A;  3N5B B;  3CCM T;  1H64 1;  1VQ9 Q;  5LJ3 e;  3CCM Q;  2P4T A;  3OYM A;  1C1A A;  1D1A A;  4J6W A;  4FL6 A;  2E4H A;  2FZK B;  4C5H A;  1X27 A;  2DET A;  3CCR A;  4BE2 A;  3CCV T;  2DZC A;  3CCQ T;  1B7T A;  4II1 A;  1N5Z A;  3CCV Q;  1K76 A;  1LJO A;  3I35 A;  1K1Z A;  3CCQ Q;  1FWZ A;  5GAN h;  1M2V B;  2DD5 A;  1QCF A;  2DVJ A;  3VS4 A;  1QKW A;  3RUX A;  2GFA A;  1SRL A;  2RJE A;  2HSP A;  2FB7 A;  1CKA A;  3OS5 A;  1E7O A;  1QCN A;  4XU0 A;  1QVF A;  1FMV A;  5LJ5 f;  4ZN1 A;  1KG1 A;  1NG2 A;  3OYJ A;  3OYB A;  4HT9 A;  2COW A;  3HPW A;  1Y07 A;  4C0F A;  4HCK A;  2XK0 A;  4ANJ A;  2EVR A;  2KY9 A;  2CT3 A;  2V8J A;  5GAN 8;  1GRI A;  1RUW A;  2LQK A;  2L89 A;  5A0L A;  4YTL A;  3X24 B;  4FM4 B;  2XDD A;  3SWN A;  2D9T A;  4HCC A;  2KRM A;  2DRK A;  3BY7 A;  4B6M A;  3OYL A;  3M4Y A;  3MKD A;  4OF1 A;  3PT9 A;  1Q81 R;  2OTL T;  1S1N A;  4KUI A;  1D0X A;  2A3L A;  2CZ6 B;  1M90 R;  2OTL Q;  5KYW B;  3JV3 A;  2CP5 A;  1O75 A;  2DYB A;  1OOT A;  4GY5 A;  2DIG A;  1U8R A;  2B86 A;  4ZGJ B;  4C92 F;  1VQP T;  1VQ6 A;  1ZUY A;  1VQP Q;  5D6W A;  5LJ5 e;  4ZTJ A;  1JJ2 S;  1Z9Z A;  3TQ7 P;  3RKW A;  4F17 A;  4LN2 A;  5CO7 A;  3JB9 J;  1YWP A;  5CQX A;  4KUD K;  2L3P A;  2JS0 A;  1M3A A;  5GAN j;  4D6W A;  4F7U G;  2E6Z A;  1K4U S;  1RAB B;  2BIV A;  4OMF B;  3OYH A;  5GJW B;  3QKJ A;  1RI0 A;  2DNU A;  1PSF A;  1M3B A;  2YXY A;  4EDU A;  1V76 A;  3H0F A;  5D7U A;  4V2S A;  3OS1 A;  2VC8 A;  3A8H B;  3ASK A;  3RR6 A;  2RD1 A;  1PD1 A;  2WAC A;  2CP2 A;  1V1C A;  3A5Z B;  4HXJ A;  2KBT A;  4PJO C;  4DA4 A;  1NLO C;  4ESR A;  3UWN A;  2LQ8 A;  2F5T X;  1KK7 A;  4LD9 K;  2KDS A;  5KCO A;  3THK A;  1QVP A;  3CCS T;  5LL6 S;  3L2V A;  4M78 D;  3AT1 B;  3CCS Q;  4CRI A;  2JJ9 A;  1NYG A;  5CK9 A;  2VB6 A;  1NJI U;  3G71 T;  2OTJ A;  1H3H A;  3CME T;  3G71 Q;  1C0M A;  3CME Q;  3S3M A;  2M1H A;  3C95 A;  3MEV A;  2GQV A;  3M0S A;  2IG0 A;  2RI5 A;  1D1C A;  2RJF A;  2EBP A;  1F1B B;  3CCR T;  1BYM A;  1AWO A;  1Q7Y C;  3CCR Q;  1FMW A;  1RAD B;  2DL5 A;  3VS1 A;  2X3W D;  1YBY A;  1S72 A;  5IH2 A;  1WXU A;  4PJM A;  4IIO A;  1YHQ A;  4A54 A;  2A7Y A;  3M0U A;  2KAF A;  3A8O B;  4M75 B;  1VYT A;  3INZ A;  1VQ7 A;  1OV3 A;  4XTX A;  3M55 A;  3CPW S;  1J3T A;  3OMC A;  5GAN d;  1BI0 A;  1Q82 U;  4A4K A;  2DLP A;  3SD4 A;  3JB9 H;  4C5I A;  3JB9 I;  3L1A A;  3JSC A;  2LX9 A;  3WVE B;  5GAM e;  1UDL A;  1JJ2 P;  2KSS A;  2BKD N;  5FLX E;  3JCM f;  5FU7 C;  1LOJ A;  1WLP B;  4BD3 A;  2CT4 A;  5L23 A;  3OSS C;  3J81 E;  4M78 G;  2J6O A;  3TVT A;  2JT4 A;  3G1J A;  1M8V A;  2V26 A;  3CC7 A;  1ZUK A;  1N9S A;  2O9S A;  1QWF A;  3H0H A;  1K9M C;  3JCM b;  2E70 A;  4QQ6 A;  2ENM A;  2G3R A;  3DB3 A;  3M57 A;  4EMH A;  3EHQ A;  1B34 A;  4GLK A;  5HKC A;  4RTW A;  2NYS A;  1VQ6 T;  1G3Y A;  4NS5 A;  1VQ6 Q;  2EQU A;  3E1S A;  3NTI A;  4M77 E;  2HQH A;  2QI2 A;  2H3E B;  3LWH A;  4EPC A;  3CCU A;  1TTH B;  2LDM A;  1QVF S;  2KXD A;  4KUL A;  5KYN A;  1YCY A;  1W6X A;  3PE0 A;  5LJ3 g;  1CSK A;  5I2S A;  5KYU A;  5CKE A;  4K11 A;  2P0Q A;  3NHN A;  2RHI A;  2CZ0 B;  2JS2 A;  4AFS C;  2HSE B;  2FEI A;  4AMC A;  2QQR A;  1LPL A;  2B8A A;  3RMS A;  3JCM V;  4M77 A;  3QZ9 B;  2EIF A;  1IO6 A;  2YLC A;  4JRK A;  1TUD A;  3OW2 A;  2YWW A;  3KBG A;  4ZGE B;  1WJR A;  2R57 A;  2FPD A;  3SWN B;  1X2K A;  4KH1 B;  3AHU A;  1PKS A;  1I1J A;  4M7D E;  1NJI C;  2Y4X A;  1KFZ A;  2DXB A;  4FSS A;  3UDC A;  5A2Q E;  3H0I A;  3PGG A;  4QQG A;  7AT1 B;  3O5Z A;  2DO3 A;  2DER A;  2D1X A;  2XG8 D;  4RTZ A;  2K2M A;  2V8K A;  3QII A;  1T3S A;  2LT1 A;  2DVE A;  4KT0 E;  2NUT A;  1KJW A;  2AIR B;  2ZCF B;  3HFN A;  2OTJ T;  1XOV A;  3OQ5 A;  2OTJ Q;  2X9H A;  3CC4 A;  2ZGW A;  4QVZ A;  4D8K A;  2KRN A;  3CEY A;  1TH7 A;  3VRY A;  4E7S A;  3V7S A;  1LVK A;  4RG8 A;  2QDY B;  2LCS A;  4M7D A;  3UF4 A;  4Q5W A;  3OYF A;  4FW2 A;  1SG5 A;  3RMQ A;  1ZQ1 A;  1S72 T;  4CC3 A;  4FYW B;  4BI8 B;  3MJX A;  1YHQ T;  1S72 Q;  2J6K A;  2RQT A;  1VQ7 T;  1YHQ Q;  1VQ7 Q;  3CCJ A;  2RK1 A;  5LJ5 g;  1K8A U;  4M7A F;  1YIT A;  1BCM A;  2HAX A;  2F2W A;  4OMO A;  2YDL A;  4IUR A;  1X6G A;  2RHZ A;  2M9U A;  5AYF A;  2HL5 C;  3LGF A;  1GCQ A;  3OY9 A;  2O31 A;  4OML A;  5GJV B;  5HCK A;  3URG A;  3EGD A;  2QA4 A;  3OYA A;  1KIK A;  2A0F B;  3QZ5 B;  2K5F A;  4RCC A;  1IRX A;  4QVC A;  1OX9 A;  1Q7Y R;  2Y90 A;  3CC7 T;  3A1P A;  3CC7 Q;  3CD6 T;  1M4Z A;  4OB3 B;  3HSB A;  5IHI A;  1AHJ B;  3G4S A;  3CD6 Q;  2EGA A;  4C92 G;  1ZA2 B;  3QJY A;  4OMQ A;  2VYT A;  2CH4 W;  3CXC A;  2RN8 A;  3PFS A;  1WQ7 A;  4PFP A;  2KT1 A;  3QDF A;  3CBP A;  4CC7 A;  2E64 A;  4LDV A;  2DBK A;  2GCX A;  3JB9 D;  3V7C A;  2QAZ A;  5GAN e;  2R58 A;  3QO3 A;  1K73 U;  2HQX A;  5FRM A;  4FU6 A;  4KBM B;  1N8R C;  1QP2 A;  3OS2 A;  4C8Q E;  1NYF A;  1Z9Q A;  3ZEH A;  2CRE A;  2XID A;  2LVM A;  3H6Z A;  4Z8A A;  1K0S A;  2EGC A;  4NL2 A;  1YJW T;  1VOM A;  2DXU A;  1YJW Q;  1MGQ A;  2X4X A;  3JCM h;  1K9M R;  4MML A;  3EFS A;  1M1F A;  2RQV A;  3D7S B;  2JM8 A;  4PJJ A;  4M75 E;  1QVG A;  1VQM T;  5GMK e;  4J5Y A;  2QTV A;  4A4F A;  1E6G A;  1GBQ A;  3T9N A;  1WHK A;  4C8Q D;  1VQM Q;  2K5L A;  1R0B G;  4E7L A;  3L42 A;  2K6D A;  5GAN 4;  4ZN3 A;  1TU0 B;  2K5I A;  4J6X A;  4C8Q A;  2KT8 A;  2ABL A;  3PIP A;  1NLP C;  2ZPB B;  2JMA A;  2DJZ A;  5J39 A;  4DOV A;  5M9O A;  1VQ5 A;  4E2F B;  1I5O B;  4FCY A;  1KQ2 A;  1HJD A;  3E2U A;  1MNE A;  3MET A;  2DTO A;  2H8H A;  4PNO A;  5GAN 2;  2J06 A;  2CGH A;  2JTF A;  5GMK i;  4RTX A;  1M8M A;  5DY9 A;  2MF2 A;  1IRE B;  1I07 A;  3H41 A;  4XTV A;  3UAT A;  1KD1 C;  3FLG A;  1BKB A;  1BB9 A;  1B34 B;  4BY6 C;  2BE7 D;  5HY6 A;  1OZ3 A;  2YUO A;  3VYH B;  2IPO B;  1VIE A;  1X69 A;  5LJ3 f;  2HMA A;  1XJW B;  2V1Q A;  3CC4 T;  2R5M A;  4PK4 A;  4PJO F;  3CC4 Q;  1QCO A;  2FG0 A;  2L5Q A;  3A98 A;  3ME9 A;  3BDL A;  5GAN 5;  2BE9 B;  2YRD A;  4Z02 A;  2DM1 A;  5DLQ E;  4KGZ B;  1PKT A;  1K8A C;  3I55 A;  2JXB A;  4N4H A;  2RH2 A;  4FSX A;  3M54 A;  1NJI R;  3HFO A;  1ZSZ C;  3PVL A;  2COZ A;  2ED1 A;  2X3X D;  2AZV A;  3SB2 A;  2XHC A;  4AFZ C;  1M9S A;  1YNZ A;  2QK0 A;  1YWO A;  1H8K A;  2DAQ A;  2XDP A;  4RUG A;  3OW2 S;  3CCJ T;  5IXF A;  2RMO A;  5KYU B;  3CCJ Q;  3FJ5 A;  1YIT T;  2KGT A;  3QYG B;  1QLY A;  4O6J A;  1YIT Q;  4FYY B;  3MEA A;  3MPU B;  3CCL A;  3SWN C;  5L8R E;  4M77 B;  1NZ9 A;  3PVQ A;  1KC8 C;  4QQD A;  2E65 A;  1CKB A;  4HCZ A;  2QQS A;  2EYW A;  2QA4 T;  3TSW A;  1JEG A;  1AVZ C;  2AT1 B;  3M59 A;  2QA4 Q;  1BIB A;  3PMI A;  4F7U E;  5CKD A;  1WHG A;  1YJ9 A;  2XD0 A;  3TCJ A;  1KQS P;  4JPB W;  1MMN A;  3HL8 A;  2ED0 A;  4GBQ A;  3J7A F;  3G4S T;  2EKH A;  1RLQ C;  2BUD A;  3G4S Q;  2ZPF B;  4ORZ A;  1BBZ A;  1M1K U;  2NUT B;  1G3S A;  3VS6 A;  2HL3 A;  4R55 A;  1BI1 A;  2XIC A;  2EJF A;  1WXT A;  4J9G A;  4BE1 A;  2FPF A;  1UGP B;  1M3C A;  1FX7 A;  1UJY A;  2GGR A;  2P0P A;  4JUV A;  3QDR B;  3FJP A;  1RI9 A;  3MP1 A;  4F7U A;  3CPF A;  2DFU A;  2RK2 A;  4M7D B;  1PRM C;  4A4E A;  2EQM A;  1SKU B;  1N9R A;  3V8K A;  1WZO A;  4B9X A;  3M53 A;  2GFU A;  3UPU A;  1UEC A;  4WCI A;  2R5A A;  2E3H A;  3JCM d;  1OPK A;  3I5S A;  4A63 B;  1MHN A;  3FRN A;  1Y57 A;  4LDY A;  2DXC A;  1N8R R;  1RAF B;  2O01 E;  3ULR B;  1X6O A;  1ZBJ A;  3CXC S;  1FXX A;  3QUI A;  4J9H A;  3EGD B;  1BK2 A;  2H3J A;  1VQ5 T;  2PTK A;  3OYG A;  4XU1 A;  1VQ5 Q;  1OU9 A;  3FDR A;  2EJ9 A;  3Q1J A;  1KSW A;  2AZS A;  1G2B A;  2PZ1 A;  4QW2 A;  3JCM c;  5GAO l;  1K9A A;  3F70 A;  4DBR A;  2EFI A;  3FC3 A;  3CCE T;  2XMF A;  2C06 A;  5GAO p;  3REA B;  3M0Q A;  3CCE Q;  1Y96 A;  1WGS A;  4KH0 B;  4FIB A;  3JCM J;  1OUL A;  2G6F X;  4DBF A;  4M78 E;  1Q86 C;  1QP3 A;  2QQ9 A;  5GAO q;  1I81 A;  1UGV A;  2QGF B;  2O2O A;  1QVG S;  1WHL A;  4IUQ A;  2WSC E;  1YP5 A;  2QEX A;  1JU5 C;  3GNF B;  4J9C A;  1AZE A;  2CSI A;  1T0H A;  3VUB A;  2ZPI B;  1PM3 A;  4M7A G;  3I55 T;  4FT4 A;  1NEB A;  3I55 Q;  2DBM A;  3U23 A;  1EIF A;  2RJC A;  1W70 A;  4OVA A;  5GAO n;  1HYO A;  4NL3 A;  3EGU A;  3BW1 A;  2ROT A;  1KD1 R;  1B3Q A;  4KGX B;  4N4I A;  3L2Q A;  4M78 A;  4AFQ C;  5CKH A;  5GAM f;  3CC2 A;  1IB8 A;  1RAI B;  4C8Q B;  1R0C B;  3QJ6 A;  3QSU A;  4J9F A;  2RQR A;  2QG9 B;  2O88 A;  1WJQ A;  4BI3 A;  3EH1 A;  2LCL A;  4RTY A;  3RBB B;  2D0Q B;  5LJ3 h;  3OMG A;  2OI3 A;  5FU6 C;  1YJ9 T;  3TEE A;  1K8A R;  4LE9 A;  1OYX A;  1YJ9 Q;  3VYG A;  5CCA A;  1IXD A;  1VYU A;  3TSZ A;  2W10 A;  2NUP A;  1JXO A;  5FWC A;  3R6N A;  3VU3 C;  3GF5 A;  3SEM A;  3NMZ C;  1WPY A;  5EG2 A;  1V29 B;  3H9N A;  2LNV A;  2O4X A;  4IKF A;  2ZAE A;  1N27 A;  1GCP A;  4Z88 A;  4PFO A;  2PQW A;  5GMK l;  5I2M A;  1KC8 R;  3VS3 A;  1NPP A;  3RNJ A;  2E41 A;  1UEB A;  4JRP A;  3G6E A;  2DX1 A;  5IHN A;  3EG9 A;  1YJN A;  2JZ2 A;  3JAM E;  4LXC A;  3QWY A;  1QW1 A;  1AWJ A;  1JQQ A;  3CQT A;  2DEQ A;  4IUT A;  2D8H A;  2VUB A;  4E47 A;  4M77 C;  1MV0 B;  3IQL A;  1EX4 A;  4JZ3 A;  5D6X A;  1T0J A;  4IUV A;  2ATC B;  3QG1 A;  2RI3 A;  2OX7 A;  3M9Q A;  4DOW A;  2M02 A;  3C4S A;  4RMO A;  2KI7 A;  2XI9 A;  3V8L A;  3VJP A;  4J9B A;  5GAN 3;  4WTO B;  3GLX A;  1MV3 A;  2AKK A;  1WI7 A;  3LLR A;  1HD3 A;  2KRS A;  1A0N B;  3VS5 A;  1PWT A;  3WVD B;  2K57 A;  3ZBD A;  5C0M A;  2M0Y A;  4OB2 B;  2RHU A;  5LJ3 j;  2DIL A;  4QT7 A;  5LJ5 h;  4X34 A;  1WYX A;  4MDW A;  2RM4 A;  3DLL A;  1SHF A;  5KE2 A;  1U1S A;  1Q81 U;  1O9S A;  3QXE B;  2JMC A;  1M90 U;  1R77 A;  4PJO G;  3REB B;  1PG5 B;  4BDY A;  2Y4Y A;  4CI0 C;  2AHJ B;  4M7D C;  4WF2 A;  2WSF E;  3NPF A;  3NFC A;  1Y0M A;  1KHI A;  2QEX T;  1DJ7 B;  4F7U B;  2J6F A;  2QEX Q;  5IAY A;  4C92 E;  4OMN A;  4B9W A;  2DK3 A;  1VQO A;  5FRN A;  2KNB B;  1MND A;  2DRM A;  4BB7 A;  9ATC B;  4CC4 B;  3CPW P;  2YT6 A;  2QQA A;  3OYE A;  4AFU C;  4M4Z A;  4DEX A;  3CC2 T;  4JJN K;  1Q86 R;  2HKQ B;  2LJ3 A;  4C92 D;  3CC2 Q;  1WHM A;  1UE9 A;  1I0C A;  2CKK A;  2HEQ A;  3QYH B;  1PD0 A;  4D8D A;  4C92 A;  4L59 A;  1H3Z A;  4X1V A;  1JBM A;  3RES A;  3CMA A;  4GLM A;  5LJ5 j;  2CP3 A;  1I5L A;  1Q82 C;  4FW1 A;  5LJ3 d;  3ZFJ A;  5DM7 R;  1RL2 A;  4FYX B;  2DPP B;  3LGL A;  1E6H A;  1Y96 B;  1ZX6 A;  5GAN f;  2V1R A;  5I22 A;  1TXQ A;  1OX8 A;  2F1L A;  3OBY A;  2HKN A;  3KFV A;  3M5A A;  2WSE E;  2I0N A;  3MEW A;  5GAO r;  4QVD A;  1W4S A;  3G6E T;  4ZGD B;  2C0O A;  2CUB A;  1JO8 A;  3H8Z A;  3OB9 A;  4N0A C;  3G6E Q;  3JRZ A;  2E5K A;  1WQW A;  4CC2 A;  2SEM A;  2X35 A;  2DL3 A;  5GAO m;  3FB9 A;  1QVF P;  4JRI A;  3OS0 A;  2EW3 A;  3VRZ A;  2O9V A;  3LX7 A;  3LH5 A;  2QGG A;  2E3I A;  2OAW A;  3QPH A;  2GQI A;  2HCK A;  2MK5 A;  4C0D B;  4M78 B;  3VS0 A;  1D3B A;  1Q95 G;  1WIE A;  4L5G A;  2A37 A;  3CBO A;  4KGV B;  2F5K A;  4LNP A;  2ECZ A;  3TU4 K;  4HA8 A;  4M75 C;  2RHY A;  3UT1 A;  2CSQ A;  5I21 A;  4E7H A;  2IIM A;  2LT4 A;  3CCU T;  3QBY A;  4IIM A;  5FRO A;  3CCU Q;  1Y7X A;  5KYX A;  1RAA B;  3MP8 A;  2RPN A;  2VGM A;  2NUP B;  1WA7 A;  4JJB A;  2DE0 X;  2DEU A;  5LJ5 d;  3TRE A;  3M0P A;  4RTV A;  5CKF A;  1GFC A;  2O4X B;  4XTZ A;  5IXB A;  3OYC A;  1QMC A;  5IN1 A;  1MMD A;  3P8B B;  4XU3 A;  2CZ7 B;  2HDA A;  4XQ3 A;  2DJQ A;  4J7I A;  4LDW A;  2QYZ A;  8ATC B;  3OYN A;  3EG9 B;  2BZ8 A;  3QHS A;  3X25 B;  1BI3 A;  4Y28 E;  3G7Z A;  2LTO A;  2VKN A;  1XTD A;  3NTK A;  3DB4 A;  3L2W A;  1VQO T;  3EFR A;  2FO0 A;  1VQO Q;  5KCH A;  2EQJ A;  1OQK A;  2LJ1 A;  2XU8 A;  1HSQ A;  1YN8 A;  2JN0 A;  4A4G A;  4X9C A;  4JLG A;  4MZM A;  3C94 A;  1VQ8 A;  3E9F A;  5GAM g;  1HXD A;  3GNG A;  3DLM A;  3M56 A;  2D6F A;  2COY A;  2GTO A;  2DL8 A;  2FZG B;  5GMK m;  4MMK A;  4O5V A;  4DBQ A;  4N4G A;  1SHG A;  4HVV A;  1ARK A;  2A28 A;  5CKB A;  4XTU A;  5KH6 A;  1GBR A;  1PHT A;  2GTJ A;  1KHC A;  1X2Q A;  3V7R A;  2MAM A;  1VUB A;  3SDZ A;  2EYX A;  2MYS A;  1KQ1 A;  2D0N A;  2F2V A;  3J80 E;  2VXE A;  5KYY A;  1FMK A;  4OP0 A; 
#chains in the Genus database with same CATH homology
 2ENM A;  1WFW A;  2MIO A;  3EG2 A;  4E6R A;  2DL4 A;  2XMF A;  2FRW A;  4EIK A;  3REA B;  3M0Q A;  3EHQ A;  1ABO A;  4RTW A;  2A08 A;  1K0X A;  2C0I A;  2G6F X;  2YUN A;  2NUZ A;  1AWX A;  1SPK A;  2PNI A;  2KE9 A;  1UGV A;  2O2O A;  1OPL A;  1YP5 A;  1JU5 C;  1YCS B;  4J9C A;  1AZE A;  2CSI A;  1BU1 A;  1T0H A;  2KXD A;  2YUP A;  2L3Q A;  2YUQ A;  1X6B A;  1NEB A;  4OMM A;  1W6X A;  1SEM A;  2DBM A;  2K3B A;  1UTI A;  5I11 A;  1EFN A;  2D8J A;  2K7A A;  3PE0 A;  4Y92 A;  3U23 A;  2K79 A;  1GL5 A;  1CSK A;  1W70 A;  2DF6 A;  4K11 A;  3NHN A;  3EGU A;  2ROT A;  1ZLM A;  1B3Q A;  2KYB A;  2JS2 A;  4AFS C;  2FEI A;  4RTU A;  4AFQ C;  2P4R A;  2LQW A;  2L2P A;  1GFD A;  2KXC A;  2OJ2 A;  1IO6 A;  1T3L A;  4AG1 C;  2NWM A;  1TUD A;  4J9F A;  2RQR A;  2O88 A;  1WX6 A;  2KYM A;  5EC7 A;  4AG2 C;  3EHR A;  3RBB B;  1UJ0 A;  4RTY A;  2FPD A;  4R0K A;  2MOX A;  1X2K A;  3C0C A;  3NGP A;  2OI3 A;  1AD5 A;  1PKS A;  1I1J A;  4LE9 A;  1UHF A;  2BTT A;  1KFZ A;  4HVW A;  4FSS A;  4DEY A;  1JXM A;  1VYU A;  3TSZ A;  3H0I A;  2K9G A;  2W10 A;  5FWC A;  1JXO A;  3R6N A;  3O5Z A;  3SEM A;  3NMZ C;  2D1X A;  4RTZ A;  1LCK A;  2K2M A;  1T3S A;  4JJD A;  4J9E A;  1W1F A;  1KJW A;  3M0T A;  2LZ6 B;  1GCP A;  1XOV A;  4Z88 A;  3EG0 A;  3UA7 A;  4KRT A;  3VS3 A;  4D8K A;  2KRN A;  3RNJ A;  1SRM A;  3ZL7 C;  2JW4 A;  3VRY A;  2FRY A;  4JZ4 A;  2DX1 A;  5IHN A;  1RLP C;  2HBW A;  2LCS A;  3UF4 A;  2AKL A;  4ZNX A;  2CH4 A;  1PNJ A;  2CUD A;  1AWJ A;  2LX7 A;  3QWY A;  1JQQ A;  4CC3 A;  3CQT A;  5FW9 A;  2J6K A;  2RQT A;  2D8H A;  1AWW A;  2DL7 A;  5ECA A;  2J05 A;  1MV0 B;  3IQL A;  2QDL A;  3EG3 A;  3I9Q A;  1UFF A;  4JZ3 A;  2ROL A;  4OMP A;  1T0J A;  4HVU A;  1H92 A;  2EPD A;  2F2W A;  1UG1 A;  1UHC A;  2M51 A;  4OMO A;  2YDL A;  4LUD A;  1X6G A;  2AK5 A;  2W0Z A;  1ABQ A;  1GCQ A;  2EGE A;  4J9B A;  4LUE A;  1OEB A;  3GBQ A;  2GBQ A;  2O31 A;  4OML A;  5GJV B;  5HCK A;  1MV3 A;  2AKK A;  1WI7 A;  2F2X A;  2SRC A;  1KIK A;  1HD3 A;  1X43 A;  2KRS A;  1A0N B;  3VS5 A;  1PWT A;  5IHK A;  1M30 A;  2RQW A;  2M0Y A;  2KEA A;  2DIL A;  4QT7 A;  5IHI A;  1SSH A;  1WYX A;  2EGA A;  4OMQ A;  2YSQ A;  2CH4 W;  1U5S A;  2J7I A;  2JTE A;  1SHF A;  2VWF A;  2RN8 A;  3VS2 A;  2L0A A;  3M0R A;  2KT1 A;  4CC7 A;  4JJC A;  2JMC A;  2MCN A;  2DBK A;  1U3O A;  2LNH B;  3REB B;  4J9I A;  3I5R A;  4Z89 A;  1NEG A;  2C0T A;  1X27 A;  1NYF A;  1Z9Q A;  3NPF A;  2CRE A;  1Y0M A;  2LMJ A;  1N5Z A;  1K76 A;  2J6F A;  3I35 A;  1K1Z A;  4Z8A A;  1K0S A;  3EG1 A;  2EGC A;  4OMN A;  2JM9 A;  1QCF A;  2DVJ A;  3VS4 A;  1QKW A;  2KR3 A;  2KNB B;  1SRL A;  2HSP A;  2RQV A;  2JM8 A;  2DRM A;  1CKA A;  1E7O A;  4CC4 B;  1PRL C;  2YT6 A;  1E6G A;  1GBQ A;  4AFU C;  4M4Z A;  4DEX A;  1NG2 A;  1UUE A;  2K6D A;  2EQI A;  2LJ3 A;  4HCK A;  2KT8 A;  2EVR A;  2ABL A;  1NLP C;  1UE9 A;  2CT3 A;  1I0C A;  2JMA A;  1GRI A;  1RUW A;  2HEQ A;  1HJD A;  4D8D A;  2KRM A;  2DRK A;  2H8H A;  4X1V A;  2J06 A;  4GLM A;  1S1N A;  4RTX A;  1AZG B;  1M8M A;  2LJ0 A;  1I07 A;  3H41 A;  2FPE A;  1WXB A;  3JV3 A;  2DYB A;  1OOT A;  1WDX A;  3UAT A;  1BB9 A;  4F16 A;  1E6H A;  2RF0 A;  2GNC A;  1ZX6 A;  2YUO A;  2V1R A;  2B86 A;  1X69 A;  5I22 A;  1U06 A;  1ZUY A;  1MUZ A;  3KFV A;  2V1Q A;  1Z9Z A;  2I0N A;  4F17 A;  2FG0 A;  4LN2 A;  2C0O A;  2CUB A;  3A98 A;  1JO8 A;  1M27 C;  2DM1 A;  2E5K A;  1YWP A;  4CC2 A;  2SEM A;  1PKT A;  2DL3 A;  2JXB A;  2L3P A;  2JS0 A;  1M3A A;  2EW3 A;  3VRZ A;  2O9V A;  1AOJ A;  3PVL A;  2ED1 A;  2X3X D;  3LH5 A;  2AZV A;  4AFZ C;  1YNZ A;  1K4U S;  1YWO A;  1H8K A;  4RUG A;  3UA6 A;  2LQN A;  2RMO A;  5GJW B;  5IXF A;  1QKX A;  3FJ5 A;  2BZY A;  2KRO A;  1QWE A;  2KGT A;  2DNU A;  2OAW A;  2A36 A;  1QLY A;  2GQI A;  1M3B A;  4J9D A;  1VA7 A;  2BZX A;  1B07 A;  2HCK A;  2RNA A;  3H0F A;  3VS0 A;  1G83 A;  3PVQ A;  1V1C A;  1WIE A;  1NM7 A;  2A37 A;  4HXJ A;  1CKB A;  2KBT A;  5FWB A;  2EYW A;  2LP5 A;  2CDT A;  4LNP A;  3TSW A;  2DMO A;  2ECZ A;  1JEG A;  1AVZ C;  1NLO C;  4ESR A;  2CSQ A;  2RQU A;  2IIM A;  4IIM A;  4JPB W;  3THK A;  2ED0 A;  4GBQ A;  2EKH A;  1RLQ C;  2RPN A;  1FYN A;  1NYG A;  1WA7 A;  1TG0 A;  4JJB A;  2DE0 X;  3M0P A;  4RTV A;  4ORZ A;  1GCQ C;  1BBZ A;  1GFC A;  5IXB A;  3VS6 A;  1ZSG A;  3QWX X;  1ZUU A;  1H3H A;  2HDA A;  1WXT A;  2DJQ A;  4J9G A;  2FPF A;  1M3C A;  1UJY A;  3M0S A;  2EBP A;  2GGR A;  1VYV A;  2EYY A;  1RI9 A;  1AWO A;  2BZ8 A;  2DL5 A;  1PRM C;  3VS1 A;  2X3W D;  2VKN A;  5IH2 A;  1WXU A;  4IIO A;  3M0U A;  1VYT A;  3SHW A;  1OV3 A;  2FO0 A;  2LJ1 A;  2ESW A;  1J3T A;  1UEC A;  1HSQ A;  1YN8 A;  4WCI A;  1OPK A;  3I5S A;  2DLP A;  2GTO A;  4A63 B;  1Y57 A;  2DL8 A;  1UDL A;  4RTT A;  1SHG A;  4HVV A;  3ULR B;  2A28 A;  1ARK A;  4F14 A;  1ZBJ A;  1WLP B;  1GBR A;  1PHT A;  2CT4 A;  5L23 A;  4J9H A;  1BK2 A;  2GTJ A;  2J6O A;  1X2Q A;  3TVT A;  2JT4 A;  2PTK A;  1AEY A;  1TUC A;  2L3S A;  1KSW A;  1ZUK A;  2AZS A;  1G2B A;  2O9S A;  2PZ1 A;  3VS7 A;  1K9A A;  2EYX A;  2EYZ A;  1QWF A;  3H0H A;  2DA9 A;  2VVK A;  2D0N A;  2F2V A;  1FMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...