1K0XA

Solution structure of melanoma inhibitory activity protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
108
structure length
108
Chain Sequence
b'MGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Melanoma Derived Growth Regulatory Protein
molecule tags Hormone/growth factor
source organism Homo sapiens
publication title Solution structure and dynamics of melanoma inhibitory activity protein.
pubmed doi rcsb
total genus 15
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2001-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1k0xA00
2FG0A 2EKHA 1QKWA 1ZBJA 4LUDA 3O5ZA 4CC7A 1OEBA 1K9AA 5EC7A 2DL7A 2VKNA 1FMKA 2MCNA 2M0YA 2EQIA 4AFQC 2DRMA 2DLPA 1G83A 4JZ4A 5HCKA 1X2QA 1GCQC 5GJVB 1BBZA 1GFCA 2K6DA 1JXMA 1UECA 2P4RA 4WCIA 1SEMA 2SRCA 2VVKA 2ENMA 1ZUUA 1E6HA 2HBWA 1AWXA 2SEMA 4RTWA 2KE9A 1ABQA 2HCKA 2RQUA 2O2OA 2C0IA 1YWOA 4HVWA 4LNPA 1SRLA 1H8KA 1ZX6A 3VS2A 2KROA 1WFWA 1RI9A 2IIMA 1SHGA 4RTZA 2KXCA 2KYBA 2L3PA 4D8KA 2JM8A 2EGCA 1PKSA 4CC4B 3QWXX 1PRLC 2FRYA 2DBKA 2DNUA 4J9GA 1M30A 1NYGA 1NLOC 2F2XA 2DL3A 4D8DA 4K11A 3TSWA 4GBQA 1OPKA 1WDXA 2K2MA 1W6XA 1S1NA 3CQTA 3M0TA 3VS0A 1YCSB 2DBMA 3JV3A 4OMOA 4AFUC 1KSWA 1WX6A 2A08A 2LZ6B 1GFDA 2DRKA 1A0NB 3M0UA 3H0HA 2CT4A 3EHQA 2JMCA 1Y57A 1MV3A 1PKTA 2LJ3A 4JZ3A 2XMFA 1U5SA 2OI3A 1X6BA 1B3QA 1AOJA 2BZXA 2OAWA 2QDLA 2DL8A 3NGPA 1X6GA 1RLPC 2OJ2A 2KR3A 2YSQA 2GTOA 4RTTA 1UJYA 3RBBB 1MV0B 2A28A 2HEQA 1HJDA 4AG2C 2HDAA 2X3WD 4RTVA 4R0KA 2CDTA 2RNAA 1K76A 2KRNA 2D1XA 2CT3A 1J3TA 1UDLA 2LP5A 1SSHA 2MOXA 2KGTA 1JXOA 4CC2A 1BK2A 1TG0A 1Y0MA 2V1QA 1WYXA 2JM9A 1WXUA 2AK5A 2D0NA 2BTTA 5IHKA 2RQVA 3M0QA 2JTEA 2W10A 4QT7A 2F2VA 1AZGB 2BZYA 1K1ZA 1M3AA 1V1CA 2KRMA 1ZUKA 4OMNA 4AG1C 2EBPA 4JJBA 5FWBA 1YP5A 2JS0A 2V1RA 4Z88A 2RPNA 3REBB 1W1FA 4J9CA 4Y92A 3VS3A 1AEYA 2EYXA 2MIOA 3M0SA 2KT1A 1YWPA 2JMAA 2B86A 4Z8AA 1GL5A 3VS4A 1X69A 1E6GA 1WI7A 4OMPA 1SRMA 3LH5A 4J9DA 3UA6A 1WXTA 2DVJA 2LX7A 3EG1A 4RUGA 5FW9A 4DEYA 1JO8A 1T3LA 2G6FX 2KNBB 1XOVA 1WA7A 5IXBA 1KJWA 5IH2A 4F17A 2K79A 1OV3A 2K9GA 1X2KA 2C0OA 1FYNA 2K3BA 4J9IA 1UG1A 4X1VA 2JT4A 2A36A 1E7OA 1K0XA 1VYVA 3NHNA 2M51A 3EG3A 2F2WA 3NPFA 2RN8A 2LCSA 1QCFA 2L3SA 4F16A 1CKBA 5I11A 2DM1A 2ROLA 2KRSA 1VYTA 2EGEA 3SEMA 1SPKA 1YN8A 1AVZC 4JJCA 2C0TA 2DX1A 3I35A 4Z89A 3EG2A 1UTIA 1NLPC 2O88A 2E5KA 1GRIA 3VS7A 2DL4A 3UF4A 1JU5C 2K7AA 3PE0A 2VWFA 1K4US 1KFZA 4RTXA 3TSZA 3H41A 1GBQA 3M0PA 2AZSA 4RTUA 1I0CA 2YUNA 4J9BA 1Z9QA 1M27C 1RLQC 1N5ZA 5GJWB 1HSQA 1UUEA 2BZ8A 3PVQA 1PRMC 2ESWA 2JXBA 1PNJA 3R6NA 1UHFA 2KT8A 2GTJA 2RF0A 3VRYA 1T3SA 4J9EA 1AZEA 2J05A 4AFZC 1NEGA 3QWYA 1QKXA 2PNIA 3EGUA 1GBRA 1X27A 4A63B 1X43A 2H8HA 3I5RA 3A98A 5FWCA 1AWWA 3VS6A 3NMZC 1M8MA 1T0HA 2EW3A 4HVVA 5IHIA 1W70A 2LMJA 1WIEA 4KRTA 1ARKA 4CC3A 2ROTA 3VS5A 2EGAA 4M4ZA 2DMOA 2LJ1A 2YUOA 4E6RA 2X3XD 4J9FA 3FJ5A 3H0FA 1M3CA 2CSIA 2GQIA 1ZSGA 4ESRA 2RQWA 3RNJA 2GNCA 2ECZA 3KFVA 1NEBA 1UGVA 4FSSA 1GCPA 2DJQA 1AWJA 2O9VA 2FPDA 2O9SA 2YUPA 2LJ0A 2NWMA 2KBTA 3TVTA 1AD5A 1M3BA 2LNHB 4ORZA 2YUQA 2J6KA 2PTKA 2A37A 2DE0X 2KEAA 1HD3A 2EPDA 2ABLA 2D8HA 2NUZA 3M0RA 2CH4A 1NYFA 3GBQA 1QWEA 1VYUA 2AKLA 3REAB 4J9HA 3VRZA 4HVUA 2FPFA 2CH4W 2JS2A 1EFNA 1UE9A 1IO6A 1LCKA 1ABOA 1ZLMA 1KIKA 4IIMA 2DF6A 2ED1A 5IHNA 4DEXA 4F14A 3IQLA 2D8JA 4OMMA 1RUWA 2EYYA 2J6OA 1AWOA 2CREA 1U3OA 2AZVA 1OOTA 5ECAA 4LE9A 4JJDA 2FO0A 3I9QA 2FPEA 1PHTA 1H3HA 2O31A 3UATA 4LUEA 1JQQA 2L2PA 4OMQA 1U06A 1UJ0A 2GBQA 5I22A 1WLPB 1BB9A 2CUBA 1QLYA 1H92A 3EHRA 2RQRA 4LN2A 2KYMA 2FEIA 2YT6A 4JPBW 2ED0A 4GLMA 2J7IA 2HSPA 1Z9ZA 3UA7A 2KXDA 1I07A 2LQWA 3H0IA 5IXFA 1BU1A 1OPLA 3C0CA 2PZ1A 1T0JA 2YDLA 2J6FA 1YNZA 4RTYA 1TUCA 1VA7A 2DILA 2GGRA 2FRWA 1I1JA 1WXBA 1MUZA 2L3QA 1UHCA 1GCQA 4HXJA 3THKA 5L23A 2DL5A 2AKKA 1SHFA 4ZNXA 2RQTA 2LQNA 3PVLA 1PWTA 2J06A 1G2BA 2JW4A 1NM7A 3ZL7C 2EYZA 2CSQA 2DYBA 2W0ZA 1NG2A 1JEGA 2RMOA 4IIOA 2EYWA 1B07A 2I0NA 3U23A 1TUDA 2CUDA 3VS1A 2L0AA 3SHWA 3ULRB 4AFSC 3I5SA 2DA9A 1CKAA 1CSKA 1K0SA 4OMLA 1UFFA 2EVRA 4EIKA 1QWFA 1ZUYA 3EG0A 4HCKA
chains in the Genus database with same CATH superfamily
3L42A 1MHNA 2L8DA 1ZBJA 3LLRA 1D0YA 1OEBA 1SF9A 3HKSA 2FZGB 2K2VA 2DL7A 3CMEQ 2VKNA 2MCNA 5A0DA 2M0YA 2KI7A 1W2BS 2DRMA 2DLPA 1UGSB 1BBZA 5EG2A 1JXMA 4M78A 1E6HA 3E1SA 4RTWA 4ZGEB 3EFSA 5GAOr 5I2SA 1BI1A 4PJOF 3OMGA 1YWOA 5LJ3h 2HQXA 4HVWA 5IAYA 4LDVA 3OS5A 1ZSZA 2KROA 2DTIA 4FYXB 2IIMA 1SHGA 4DBQA 4D8KA 1Y96B 4M77D 2GF7A 2JNGA 4LXCA 1D1BA 5KYUB 1K73R 3QYGB 2DNUA 2LVMA 3L2ZA 1NYGA 3OYLA 1M90U 3JRZA 2MMPA 1YFNA 2QTVA 1M4ZA 4DBRA 3VU3C 4AT1B 5LJ3d 5C0MA 1OPKA 1WDXA 3OQ5A 4XU2A 2IG0A 1RAFB 3M0TA 4XU1A 3VS0A 1YCSB 3JV3A 1IZ6A 3MP1A 2K3XA 2EFIA 3MJXA 4KGXB 3G71T 2KSSA 2X4YA 2M02A 3M0UA 3HHTB 1Y57A 3G1JA 2XMFA 2OI3A 3TU4K 5FU6B 1B3QA 1Y07A 3OYJA 2D9TA 3I55A 5D6YA 2QDLA 3LW5E 4FT2A 2KR3A 4C0ZA 2GTOA 4J5YA 5DM7R 3M5AA 2JUFA 2K4YA 4M7DD 1MV0B 2A28A 4M75G 2HEQA 1HJDA 3MEVA 1QVFP 4JJNK 3RKWA 2RNAA 4FW1A 4M75D 2AIRB 2D1XA 4FYWB 1C6VX 3I56Q 2QYZA 4CC2A 2B8AA 4C0GA 1K8AU 3HRUA 2RA2A 4M78E 1WXUA 4BDZA 1IHWA 3F70A 2OTLA 3CEYA 2RQVA 1NJIC 2F2VA 1AZGB 3JCMc 1N27A 5KCOA 1K1ZA 3LWHA 3CC4A 2DO3A 5CK9A 2EBPA 1FMWA 4M78F 1X01A 4C8QE 5HKCA 1WHKA 4Z88A 1W1FA 3VUZA 1NPPA 3RUXA 4M77F 5GAN8 3M0SA 1VQKQ 1YWPA 3JCMe 4BE0A 3VS4A 2VGNA 3NTIA 5FLXE 1SRMA 4A4HA 3MP8A 3RMSA 1VQKA 4Z02A 1W2BA 1JO8A 1T3LA 2P4TA 3FEOA 1WA7A 1VQ8A 3OS2A 1MNDA 2X35A 1R0BG 4XK8E 1FYNA 5GAN3 3URGA 2LT1A 1UG1A 4E7SA 1SG5A 4KH0B 3AT1B 2JT4A 2FHDA 2LRQA 1VQMQ 3JB9G 2M51A 4PJOD 3EG3A 1F1BB 3CMAT 2YLCA 1VQ5T 1CKBA 5I11A 2ROLA 4C8QA 2KRSA 4IUUA 1YBYA 3OB9A 3JCMX 2YRVA 2E5KA 1GRIA 2BE7D 2BUDA 3UF4A 3CCQT 1KFZA 5KYWB 3H41A 1GBQA 2QA4T 4LD9K 3J7AF 1D09B 1I0CA 1YITQ 2XD0A 2CP3A 1MMNA 4C0DB 1WPYA 5GAMj 1KQSP 1N5ZA 2O4XA 2RO0A 4X9DA 1N8RR 4HA8A 4LD6A 2PVGB 4DBHA 1TTHB 2JXBA 1PNJA 3TQ7P 4Y91A 2GTJA 2DVEA 1NZ9A 2DERA 4M7AD 2J05A 2MPXC 4AFZC 2NUPA 2PUKB 3EGUA 1GBRA 1BCOA 1YJ9A 1X27A 3BY7A 4CI0C 4C0DC 1AWWA 1KC8U 2CZ6B 1G3TA 4LDWA 3CC2T 4M75B 2F5TX 1Q86C 5IHIA 4M75F 4PKCC 5KYYB 2QA4Q 1ARKA 1KC8R 3PTAA 3VS5A 4M4ZA 1KQSS 2NLUA 5GMKe 4E6RA 2X3XD 1M3CA 2GQIA 5GANh 1UGVA 2DTHA 4FSSA 3SWNC 1GCPA 5A0LA 5KYUA 2DJQA 1AWJA 5CKDA 1PD1A 4YTLA 1KQ2A 1Y96A 2LJ0A 2NWMA 2KBTA 2JJ9A 2VGMA 3OYCA 2YUQA 2J6KA 4QQGA 5LL6S 1HD3A 2DFUA 4F7UF 1VQLQ 2BKDN 4KGZB 2NUZA 4C8QC 3M0RA 1NYFA 2CH4A 1Q7YR 2LX9A 2CZ1B 3RMQA 2ZAEA 4FM4B 2FPFA 4BI3A 3M4YA 4F7UE 4A53A 5IHNA 1B34B 3IQLA 1VQOT 3UWNA 3OW2A 1OOTA 5GAOq 4LE9A 2FPEA 3QBYA 4EMHA 4LUEA 1JQQA 2L2PA 4OMQA 2HL3A 2QEXT 3DKMA 2CUBA 1AT1B 4BD3A 3EHRA 4LN2A 3Q1JA 2FEIA 2Y4XA 5CKFA 4M77C 2ED0A 1MNEA 1NJIR 2EQJA 2LQWA 3CXCP 5IXFA 1WHLA 1OPLA 3OYDA 1YHQQ 2PZ1A 5GAOl 2J6FA 4RTYA 1YIJA 2P0PA 2X4XA 4E7IA 1GCQA 5GANj 4LDUA 8ATCB 4KBMB 3QDFA 1VQ4Q 1R0CB 4FL6A 5FRNA 4L59A 2LQNA 3CCJA 4FIBA 4ZN1A 3ZL7C 2CSQA 1R8OB 1S72A 2G3RA 2W0ZA 2OTJT 3RR6A 1VQLT 4DOVA 2F5KA 2CP0A 3QDRB 3OYIA 2RHZA 4IUPA 2PVOB 3U23A 3G7ZA 3VS1A 1N9SA 3PIPA 4MDWA 1VQPQ 4OB2B 3G71Q 3DB4A 1CSKA 2YWWA 1K0SA 4M78C 3VYGA 2EVRA 4NL2A 4M7DC 3E9FA 4A54A 2DPPB 3EG0A 1QMCA 2CP5A 3GIBA 4M7DG 4M75C 1UB4A 4GY5A 4LUDA 2F1LA 2FYKA 1M2VA 4ANJA 4MZPA 2CKKA 1KC8C 1X2QA 4J83A 1GCQC 5GJVB 2XIDA 1GFCA 4XTWA 2XDPA 2P4RA 1G8XA 2VVKA 1Q86U 1M1KC 3QG1A 2HBWA 1NJIU 1ABQA 2HCKA 1IB8A 3OBYA 3KXTA 3JCMW 4OVAA 1SRLA 1H8KA 3GOXA 3VS2A 3FIFA 5CIUA 1RI9A 3CBOA 4X34A 3HTRA 2EGCA 3CCMA 4J6WA 2FRYA 1JB0E 3PNWC 2DBKA 3OYYA 1W4SA 1NLOC 1QVPA 2NUTB 3H9NA 4D8DA 1BI3A 5I2MA 5KYWA 2RHXA 5GAOp 4CRIA 5CKEA 2DBMA 4OMOA 1RAIB 4M7AB 1GFDA 2YXYA 1QVGA 2IPOB 3P8DA 3JCMg 4QVCA 2K57A 3H0HA 3FDRA 3N5BB 3QYHB 2JMCA 4M7DF 1MV3A 1PKTA 2LJ3A 3CCST 1Q82R 3MCAB 4KUIA 1U5SA 3H8ZA 2BZXA 5HY6A 4FYVB 3DLMA 1VQ5A 2OAWA 3M59A 3LGLA 3NGPA 2XU8A 4QKUA 4PJOB 4ZGDB 2OJ2A 3SB2A 1QVGS 4N4IA 2GQVA 4M77G 2JN0A 3JCMf 5D7UA 2ZZDA 2X3WD 2EKOA 4RTVA 4R0KA 2CDTA 3EGDB 1FX7A 1EIFA 2KRNA 3X24B 5GMKm 2CT3A 3C4SA 1VQ5Q 2X4WA 3O8VA 1IREB 2DETA 1BK2A 3QZ9B 4J8OA 5CKHA 2JM9A 2L89A 2BTTA 3MEWA 1JBMA 3KBGA 3RIRA 4ME7A 2E12A 2E6ZA 4QT7A 3GP8A 1BIAA 3I56A 1V1CA 2KRMA 4OMNA 1ZUKA 5L8RE 3OYGA 2X51A 4J6YA 2X4JA 3SWNB 4JJBA 3X25B 1WJSA 1YITT 1TU0B 2RPNA 3REBB 1AEYA 3PFSA 1PC0A 2KT1A 3L2RA 2JMAA 4C5IA 4C5HA 1RAEB 3C95A 2QQAA 5DY9A 1VQ9T 3JCMb 4Y28E 1E6GA 1WI7A 2Y90A 4OMPA 1QP2A 3V8LA 3UA6A 1YIJT 4RUGA 2DVJA 2FVUA 2LX7A 1MGQA 1TXQA 2ZPHB 2G6FX 4B9XA 4BUGA 4OGCA 5IT9E 1FMVA 4C8QB 5IH2A 1G5VA 1OV3A 1TOVA 3ER0A 2E65A 4R56A 2C0OA 1PM3A 1I5LA 4J9IA 2EAYA 3EFOA 4JRIA 1D1CA 4E7ZA 4X1VA 2IVWA 3QO3A 5GAN5 2MI6A 4MZTA 4C8QF 3NHNA 1SSFA 4J6XA 2F2WA 3LH0A 4XTXA 2RJCA 4KGVB 2JTFA 2DXBA 2LCSA 3RKXA 4MDXA 1K73U 2DM1A 5CVIA 2EGEA 1SPKA 1YN8A 3GLXA 4JRQA 4PJNA 3M56A 2C0TA 4PNOA 2DX1A 2V8IA 2DAQA 1KD1R 4EMKA 3EG2A 3CXCA 1FXXA 2DEUA 4N4HA 4HCBA 2LCCA 4AMCA 5J26A 1U1TA 2VWFA 4RTXA 5LJ3j 4C92F 3CBMA 1XNIA 2KDSA 2RHIA 1OX9A 2AZSA 2OTLQ 1VQ6T 1MMAA 1VQMT 3CC7A 4C92E 1D3BB 2YLBA 1BI2A 2HKNA 5GMKi 3CMAQ 2HD0A 3R6NA 3UDCA 1UHFA 1YITA 4A4FA 2FZCB 5LJ3f 1AZEA 3OW2S 3OA6A 3CCMT 2OTJA 3CC7Q 2HKQB 2PNIA 3DLLA 3OYAA 5GMKh 1JJ2A 4PJOG 1OI1A 5LJ5j 4O5VA 1T0HA 1W70A 4C5EA 2LMJA 1YJ9Q 4CC3A 4E47A 3JB9J 2ROTA 4ELYC 2CZ7B 3CCRT 1OU8A 3CCRA 2EJ9A 1OZ3A 1WQWA 2LJ1A 2WACA 3JAME 3H0FA 1YI2A 1LOJA 3RNJA 3KFVA 2KVQG 4JUVA 1NEBA 5GANg 3CCRQ 2A0FB 4C8QG 3BDLA 2O9SA 2YUPA 4ZGJB 3QJ6A 2RH2A 2JTMA 1AD5A 2HZYA 1M3BA 1YI2Q 4ORZA 4M77B 1RL2A 8AT1B 4M78D 3A8HB 3BW1A 3L1AA 3VJPA 2D8HA 1JJ2P 4GLKA 3QIIA 1GXIE 1M5Q1 3CMEA 1VQPT 2E70A 2CH4W 4C92D 5LJ5g 4PLIA 4ELZC 3C12A 4XU0A 2QQBA 4IIMA 3WVDB 1KIKA 4DEXA 3L2QA 3EGXB 2LNVA 3MO8A 2EYYA 3QUIA 2J6OA 1QVGP 1QP3A 5ECAA 1PCXA 4JJDA 2MYSA 3QPHA 3UATA 1U06A 2GBQA 1B7TA 2E64A 1WLPB 1BB9A 4TVRA 1H92A 2RQRA 3QXEB 3SDZA 2KYMA 2YT6A 5CCAA 2QDYB 2R5AA 1ZSZC 1VUBA 1Z9ZA 1N6AA 4E7JA 3H0IA 4MMLA 4BB7A 1BU1A 1M1FA 3C0CA 1T0JA 2P0QA 3HPWA 1KK7A 2GGRA 4HCCA 3THKA 3CCLT 3G4ST 2H3EB 2HBPA 1LVKA 3CBPA 2PU9B 3LYIA 2XK0A 3HFNA 1YJWQ 4N0AA 2RQTA 1NPRA 4JLIA 3PGGA 3PVLA 4L6V5 1YIJQ 4R55A 1VQ4T 3OSVA 1XJWB 3TREA 3VV0A 2RMOA 3CCSA 1I81A 4IUVA 2ZCFB 2E10A 4M7DB 1UEBA 2BE9B 2QTXA 4FCYA 4AFSC 4EMKB 3KUFA 4IURA 2GCXA 3M55A 4RG2A 5A2QE 3A8LB 4OMLA 1UFFA 3JB9D 4NL3A 2VUBA 1ZUYA 1IXDA 3META 2EKHA 1QKWA 3VYHB 2PUOB 1PSFA 4DOWA 3LWIA 3CCLQ 1KHCA 5EC7A 4M75A 4L5GA 3HSBA 1FMKA 2EQIA 4AFQC 2E6NA 4JZ4A 2K6DA 3UPUA 4WCIA 1SEMA 2SRCA 2ENMA 1ZUUA 3EFRA 1AWXA 1MMDA 2KE9A 2L5QA 2RQUA 2C0IA 1QVFS 4QQDA 2RI3A 2I2LA 2WSCE 5LJ3e 3AHUA 2EIFA 1ZX6A 1YI2T 4M7DE 3CCUT 2D6FA 4RTZA 2KXCA 2L3PA 1M90R 3X26B 2X9HA 2JM8A 4J7IA 3V8KA 1PKSA 2VXFA 2O4XB 4CC4B 1AHJB 1PRLC 3SFMA 1QVFA 2VXEA 4P5NA 4J9GA 1M30A 4PJJA 5DLQE 4JRPA 2DL3A 3JB9H 1KD1U 5AYFA 2RD1A 2K5LA 2CS7A 2RJDA 2A7YA 4VUBA 2K2MA 1QW1A 2QGFB 1VQ7Q 3P8HA 2QQRA 1WX6A 2A08A 3QKJA 3OW2P 2DRKA 1TWBA 5KYYA 2CT4A 3FC3A 2XDBA 4JZ3A 1S72Q 4HT8A 1VQ7A 1ZHIA 3OYHA 4EMGA 2DD4A 4HT9A 1SKUB 1X6GA 1Q82U 2LDMA 4M7DA 2YSQA 3X20B 2PVDB 2DXCA 4BE1A 3RBBB 3RKYA 1H3ZA 3G71A 2DJZA 5HK3A 1K9MU 2NUTA 4AG2C 2HDAA 5C6SA 2COZA 3GNFB 4M75E 1K76A 2R57A 1J3TA 1UDLA 2LP5A 2MOXA 3QSUA 3C94A 2KGTA 2V1QA 4M7AA 2M1HA 3FJPA 2XI9A 2D0NA 1HK9A 3S3MA 1LPLA 3MEUA 4PFOA 1TH7A 4PJLA 1M3AA 5LJ3g 3JCMP 3CPWS 1JJ2S 4BI8B 1YP5A 2GFUA 2JS0A 4D6WA 2BIVA 2K5FA 1ZBXA 4Y92A 3VS3A 1LNXA 2EYXA 4KUDK 3OYBA 2RHUA 4A4GA 2B86A 4FW2A 2QXFA 1OU9A 4NOYA 1X69A 1H641 3HL8A 4PL6A 4PJOE 1NBEB 3LH5A 4J9DA 2QA4A 3EFOB 5CO7A 4DEYA 3M4GA 1YCYA 2LQKA 4ATOA 1XOVA 3JCMQ 5GAN4 4E2FB 1VQ9A 5IXBA 1KJWA 2Z0WA 2K79A 1BCMA 2XG8D 4M7AE 4KT0E 2K3BA 2DXTA 3M53A 3OS0A 2MWOA 5FU7B 1E7OA 3ASKA 1G3SA 1VQ9Q 1D3BA 4EMKC 1K0XA 2FZKB 5CAIA 3CCUQ 3JB9F 2A3LA 2RN8A 1Y71A 2ATCB 4F16A 1M2OA 3SEMA 1LJOA 4BI4A 1AVZC 3I55Q 4BE2A 3CCQQ 2MK5A 2DD5A 3DB3A 2LC4A 1NLPC 3E9GA 1UGQB 3J80E 3CXCS 3MKDA 3PE0A 1K4US 3PT9A 4C92C 4II1A 3JSCA 3WXMB 3EAEA 3TSZA 3G6EQ 4UC4A 3M0PA 4J9BA 5D6XA 1M27C 1RLQC 2DZCA 4PK4A 5FU6C 2QK0A 1HSQA 1WHJA 3INZA 1M90C 2DIQA 3PVQA 3RESA 4RMOA 3JCMh 1IHVA 3P8BB 3PMIA 1PRMC 1VIEA 3CC2A 4DQ2A 1VQKT 3LGFA 2JZ2A 5GANd 3GF5A 1T3SA 3SD4A 3MPUB 1W2BP 2QG9B 1NEGA 2RK1A 1MMGA 1QKXA 3OSSC 4A63B 1X43A 2H8HA 5HK0A 4PJOA 3A98A 3CMAA 1VQNQ 4QVDA 4QW2A 2ZPGB 4XQ3A 3VS6A 2XHCA 1M8MA 1Q7YC 2OTLT 4IUTA 1WHGA 2EW3A 4HVVA 2ZGWA 1DJ7B 4KRTA 3CPWP 3OS1A 2QEXQ 4MZMA 2EGAA 3UT1A 3CCVA 2H3JA 4QVZA 2ZPIB 2YUOA 3OYFA 3CD6T 1IRXA 1PG5B 3HRSA 4C5GA 2CSIA 2EQKA 1R77A 4NS5A 2MAMA 2RQWA 1XTDA 1WNLA 4M7AF 4RKUE 1Y7XA 4C92A 1VQPA 4RG8A 2FPDA 3CCVQ 1K8AC 3SWNA 1VQMA 1VQ7T 1D0ZA 2RI5A 3S6WA 3S3NA 1O9SA 4QQ6A 2PTKA 1OULA 1Q81R 2DE0X 4XTZA 3CCEA 2ABLA 5LJ5h 2D0QB 3EGXA 2RK2A 1RADB 3REAB 1C1AA 4J9HA 3VRZA 4HVUA 4OF1A 2JS2A 1UE9A 1IO6A 1ABOA 3FRNA 3RDVA 3CCEQ 2DF6A 2EJGA 4F14A 4OMMA 4F7UG 3OBWA 1U3OA 2AZVA 2RI2A 1V76A 1HYOA 2CYZB 2FO0A 1KQSA 1UGPB 3I9QA 1BI0A 1N8RC 1M1KR 3BE3A 2E41A 1VQ6Q 1YJNA 2CP6A 5FRMA 1ZA1B 1WQ7A 4FYYB 3G4SA 2EYQA 2J7IA 5CQXA 4E7KA 1K8AR 2HSPA 2QQ9A 2NUPB 2DYIA 4N4GA 3CC7T 2C06A 3TEEA 3CD6Q 3A5ZB 5GAOm 3R6OA 3MP6A 4M7AG 1VA7A 2DILA 2FRWA 1WXBA 1MUZA 1UHCA 4HXJA 1RAHB 3ZEHA 2AKKA 5CKBA 5LJ5f 2O01E 1SHFA 5LJ5e 3A8OB 2P0KA 1NM7A 4C92G 3TCJA 1TS9A 2CP7A 5IN1A 1KHIA 3GNGA 4IIOA 2LQ8A 2EYWA 4M78B 1B07A 2VB6A 1TUDA 3M9QA 4XAXB 3A8GB 1YJWA 2M16A 4OGEA 3ULRB 1QCNA 1WZOA 5CQYA 4LDYA 5GAOn 3E19A 2VC8A 1Q82C 5KH6A 1K9MC 5FROA 5DLOA 3L2WA 2EQUA 3CC4T 2FG0A 2KK4A 3O5ZA 4CC7A 1K9AA 1Q86R 1QQJA 1Q7YU 4F7UB 2VYTA 1RI0A 4J7FA 2ZPFB 1G83A 5HCKA 4XU3A 3CC4Q 2EQMA 1UECA 1ZQ1A 1YHQT 4JLGA 2SEMA 2RM4A 2O2OA 2HQEA 1BIBA 4BY6C 1KD1C 4LNPA 2R5MA 1WFWA 4M77A 2RHYA 1RACB 2QI2A 1G3WA 4JRKA 4JS4A 1WJQA 2KYBA 4ZTJA 4LDXA 2P84A 3QWXX 4JS5A 2DZ9A 2JOYA 3EGDA 3JCMV 4WTOB 2F2XA 1RABB 2L3RA 3VKIA 2FL7A 1BYMA 1ZA2B 2E5QA 4K11A 1S72T 2WSFE 5GANe 4OB3B 3TSWA 3I56T 4GBQA 1M1KU 5J39A 3X28B 1W6XA 1S1NA 3CQTA 5GANf 1WHMA 1D0XA 4AFUC 1KSWA 3T9NA 5KE2A 2LZ6B 1A0NB 3OYEA 3CCJQ 2COYA 3EHQA 3PMTA 1ACMB 5GAMh 4XTVA 1X6BA 1AOJA 3CCSQ 1I4K1 2DL8A 4M77E 3BFMA 1RLPC 4RTTA 1UJYA 2XDDA 3V7SA 1VQ8T 2KMTA 5J3BA 1SSHA 1I8FA 2JVVA 1JXOA 5KYNA 2DIGA 4RCBA 1TG0A 1Y0MA 2WSEE 1WYXA 2QQSA 2AK5A 1IGQA 5IHKA 3M0QA 2JTEA 2W10A 1EZZB 5LJ5d 2HNIA 2BZYA 3A8MB 4AG1C 2KAFA 2DXUA 1YJNT 5D6WA 5FWBA 2V1RA 1UGRB 3M54A 3ZFJA 4J9CA 4KH1B 4OB1B 2MIOA 4BDYA 2OAUA 4Z8AA 2RJEA 5I21A 5KCHA 4PFZA 2K3YA 1GL5A 1VQ8Q 2CGHA 1X75C 3OMCA 4IUQA 3CCMQ 1B34A 5GAMf 4F04B 4KULA 1K73C 4V2SA 1WXTA 2R58A 3EG1A 3BDUA 5FW9A 3NFCA 2M0OA 3JB9I 2KNBB 4MMKA 4IKFA 1D1AA 1EX4A 4F17A 1NE8A 4X9CA 2K9GA 3A1PA 1X2KA 5KYXA 5KYXB 4B6MA 1U8RA 3MEAA 2OX7A 2YRDA 3I55T 1OZ2A 2NYSA 2AHJB 2A36A 1X6OA 1TUGB 4EDUA 4PJMA 1Q81U 1VYVA 4XTYA 4FSXA 2AT1B 3NPFA 2DTOA 4HCZA 1QCFA 2L3SA 2V8JA 2V26A 1VYTA 3G6ET 1WJRA 2ZPBB 4N0AC 2E3IA 4JJCA 3I35A 3CCUA 4Z89A 1UTIA 3M58A 2QAZA 2DEQA 2O88A 3VS7A 2DL4A 2LT4A 1PD0A 1JU5C 2K7AA 3EG9B 3EG9A 3NTKA 3QZ5B 4A4EA 4RTUA 3OY9A 5GAN6 2HAXA 2YUNA 4ZTFA 1OX8A 1Z9QA 5GJWB 3EH1A 2RB6A 2MWPA 1UUEA 3MHXA 1HXDA 4WF2A 2BZ8A 3G6EA 5CR2A 3EH2A 2ESWA 2HSEB 2VV5A 4JDSA 2KT8A 2RF0A 3VRYA 1VIFA 4J9EA 2HMAA 5GAN2 4A4KA 3QWYA 1JRIA 3CPFA 1N8RU 3E2UA 1I5OB 3PIOA 3I5RA 4RCCA 2M9UA 2KQWA 5FWCA 1FWZA 3ME9A 1YJWT 3NMZC 5GMKl 4F7UA 2E3HA 4C92B 2COWA 3CCET 2EWNA 1WIEA 4OMFB 2LCLA 2XICA 2YHTA 4PFPA 2DMOA 2E4HA 2KY9A 4DA4A 4J9FA 3FJ5A 3WVEB 4OB0B 1ZSGA 4ESRA 1Q95G 2GNCA 2ECZA 2VASA 2PQWA 3OYKA 4Q5WA 4BY6B 1VQLA 3FB9A 4PJOC 2O9VA 3V8JA 3CPWA 1VQOQ 4EPCA 1WGSA 7AT1B 3QHSA 2E1HA 3TVTA 1C0MA 2LNHB 2A37A 2KEAA 2EPDA 3ZBDA 1KQ1A 4FU6A 1KG1A 2HQHA 3FLGA 3HRTA 3GBQA 1QWEA 3CCLA 1VYUA 1VQOA 2AKLA 2V8KA 3QJYA 4ZN3A 5GAMd 3CCQA 1P92A 1TSFA 1EFNA 3JCMJ 1V29B 1LCKA 5KE3A 3LX7A 1ZLMA 2FB7A 5M9OA 2ED1A 3D7SB 2D8JA 1U1SA 1RUWA 3OYMA 4C0FA 2XKOC 1M2VB 5A0GA 3V7CA 1AWOA 2HL5C 4E7LA 2CREA 1RAGB 5AT1B 2LTOA 3NTHA 3V7RA 4BACA 2ZPEB 1RAAB 3J81E 2DKGA 4M78G 1PHTA 3VUBA 2RJFA 5FU7C 1H3HA 3CMET 2O31A 1IGUA 5GAN7 4B9WA 1YJ9T 2EJFA 1XQHA 1M9SA 1UJ0A 1YHQA 5I22A 2K5IA 3CC2Q 2DK3A 2F69A 1QLYA 3GPLA 3RERA 4M7AC 3HFOA 1PSEA 4JPBW 4GLMA 5GAMe 3UA7A 1Q81C 2KXDA 1VQ6A 1I07A 1YJNQ 2OTJQ 4XTUA 4DBFA 2QGGA 1OQKA 3JCMd 1VQ4A 2YDLA 1YNZA 1K9MR 1VQNA 1VQNT 4O6JA 3G4SQ 1TUCA 1N9RA 2CZ0B 1I1JA 2L3QA 2Y4YA 1G3YA 2GFAA 5L23A 2QASA 2DL5A 3M57A 3CD6A 1BKBA 4ZNXA 3L2UA 4PLLA 3L2VA 3S3OA 1ZSZB 1O75A 2QEXA 3OYNA 1PWTA 2J06A 1G2BA 2JW4A 6AT1B 5GAMg 2EYZA 2DYBA 3HP9A 1VOMA 3H6ZA 1NG2A 1WHHA 2CP2A 1JEGA 2MF2A 1QCOA 2I0NA 2CUDA 2L0AA 3SHWA 9ATCB 4FT4A 3I5SA 3CCVT 2DA9A 5GMKj 4E7HA 1CKAA 1M8VA 3CCJT 4EIKA 1M1GA 1QWFA 1OYXA 4OP0A 4HKEA 4C8QD 2YRCA 4HCKA
chains in the Genus database with same CATH topology
2FG0A 2EKHA 1QKWA 1ZBJA 4LUDA 3O5ZA 4CC7A 1OEBA 1K9AA 5EC7A 2DL7A 2VKNA 1FMKA 2MCNA 2M0YA 2EQIA 4AFQC 2DRMA 2DLPA 1G83A 4JZ4A 5HCKA 1X2QA 1GCQC 5GJVB 1BBZA 1GFCA 2K6DA 1JXMA 1UECA 2P4RA 4WCIA 1SEMA 2SRCA 2VVKA 2ENMA 1ZUUA 1E6HA 2HBWA 1AWXA 2SEMA 4RTWA 2KE9A 1ABQA 2HCKA 2RQUA 2O2OA 2C0IA 1YWOA 4HVWA 4LNPA 1SRLA 1H8KA 1ZX6A 3VS2A 2KROA 1WFWA 1RI9A 2IIMA 1SHGA 4RTZA 2KXCA 2KYBA 2L3PA 4D8KA 2JM8A 2EGCA 1PKSA 4CC4B 3QWXX 1PRLC 2FRYA 2DBKA 2DNUA 4J9GA 1M30A 1NYGA 1NLOC 2F2XA 2DL3A 4D8DA 4K11A 3TSWA 4GBQA 1OPKA 1WDXA 2K2MA 1W6XA 1S1NA 3CQTA 3M0TA 3VS0A 1YCSB 2DBMA 3JV3A 4OMOA 4AFUC 1KSWA 1WX6A 2A08A 2LZ6B 1GFDA 2DRKA 1A0NB 3M0UA 3H0HA 2CT4A 3EHQA 2JMCA 1Y57A 1MV3A 1PKTA 2LJ3A 4JZ3A 2XMFA 1U5SA 2OI3A 1X6BA 1B3QA 1AOJA 2BZXA 2OAWA 2QDLA 2DL8A 3NGPA 1X6GA 1RLPC 2OJ2A 2KR3A 2YSQA 2GTOA 4RTTA 1UJYA 3RBBB 1MV0B 2A28A 2HEQA 1HJDA 4AG2C 2HDAA 2X3WD 4RTVA 4R0KA 2CDTA 2RNAA 1K76A 2KRNA 2D1XA 2CT3A 1J3TA 1UDLA 2LP5A 1SSHA 2MOXA 2KGTA 1JXOA 4CC2A 1BK2A 1TG0A 1Y0MA 2V1QA 1WYXA 2JM9A 1WXUA 2AK5A 2D0NA 2BTTA 5IHKA 2RQVA 3M0QA 2JTEA 2W10A 4QT7A 2F2VA 1AZGB 2BZYA 1K1ZA 1M3AA 1V1CA 2KRMA 1ZUKA 4OMNA 4AG1C 2EBPA 4JJBA 5FWBA 1YP5A 2JS0A 2V1RA 4Z88A 2RPNA 3REBB 1W1FA 4J9CA 4Y92A 3VS3A 1AEYA 2EYXA 2MIOA 3M0SA 2KT1A 1YWPA 2JMAA 2B86A 4Z8AA 1GL5A 3VS4A 1X69A 1E6GA 1WI7A 4OMPA 1SRMA 3LH5A 4J9DA 3UA6A 1WXTA 2DVJA 2LX7A 3EG1A 4RUGA 5FW9A 4DEYA 1JO8A 1T3LA 2G6FX 2KNBB 1XOVA 1WA7A 5IXBA 1KJWA 5IH2A 4F17A 2K79A 1OV3A 2K9GA 1X2KA 2C0OA 1FYNA 2K3BA 4J9IA 1UG1A 4X1VA 2JT4A 2A36A 1E7OA 1K0XA 1VYVA 3NHNA 2M51A 3EG3A 2F2WA 3NPFA 2RN8A 2LCSA 1QCFA 2L3SA 4F16A 1CKBA 5I11A 2DM1A 2ROLA 2KRSA 1VYTA 2EGEA 3SEMA 1SPKA 1YN8A 1AVZC 4JJCA 2C0TA 2DX1A 3I35A 4Z89A 3EG2A 1UTIA 1NLPC 2O88A 2E5KA 1GRIA 3VS7A 2DL4A 3UF4A 1JU5C 2K7AA 3PE0A 2VWFA 1K4US 1KFZA 4RTXA 3TSZA 3H41A 1GBQA 3M0PA 2AZSA 4RTUA 1I0CA 2YUNA 4J9BA 1Z9QA 1M27C 1RLQC 1N5ZA 5GJWB 1HSQA 1UUEA 2BZ8A 3PVQA 1PRMC 2ESWA 2JXBA 1PNJA 3R6NA 1UHFA 2KT8A 2GTJA 2RF0A 3VRYA 1T3SA 4J9EA 1AZEA 2J05A 4AFZC 1NEGA 3QWYA 1QKXA 2PNIA 3EGUA 1GBRA 1X27A 4A63B 1X43A 2H8HA 3I5RA 3A98A 5FWCA 1AWWA 3VS6A 3NMZC 1M8MA 1T0HA 2EW3A 4HVVA 5IHIA 1W70A 2LMJA 1WIEA 4KRTA 1ARKA 4CC3A 2ROTA 3VS5A 2EGAA 4M4ZA 2DMOA 2LJ1A 2YUOA 4E6RA 2X3XD 4J9FA 3FJ5A 3H0FA 1M3CA 2CSIA 2GQIA 1ZSGA 4ESRA 2RQWA 3RNJA 2GNCA 2ECZA 3KFVA 1NEBA 1UGVA 4FSSA 1GCPA 2DJQA 1AWJA 2O9VA 2FPDA 2O9SA 2YUPA 2LJ0A 2NWMA 2KBTA 3TVTA 1AD5A 1M3BA 2LNHB 4ORZA 2YUQA 2J6KA 2PTKA 2A37A 2DE0X 2KEAA 1HD3A 2EPDA 2ABLA 2D8HA 2NUZA 3M0RA 2CH4A 1NYFA 3GBQA 1QWEA 1VYUA 2AKLA 3REAB 4J9HA 3VRZA 4HVUA 2FPFA 2CH4W 2JS2A 1EFNA 1UE9A 1IO6A 1LCKA 1ABOA 1ZLMA 1KIKA 4IIMA 2DF6A 2ED1A 5IHNA 4DEXA 4F14A 3IQLA 2D8JA 4OMMA 1RUWA 2EYYA 2J6OA 1AWOA 2CREA 1U3OA 2AZVA 1OOTA 5ECAA 4LE9A 4JJDA 2FO0A 3I9QA 2FPEA 1PHTA 1H3HA 2O31A 3UATA 4LUEA 1JQQA 2L2PA 4OMQA 1U06A 1UJ0A 2GBQA 5I22A 1WLPB 1BB9A 2CUBA 1QLYA 1H92A 3EHRA 2RQRA 4LN2A 2KYMA 2FEIA 2YT6A 4JPBW 2ED0A 4GLMA 2J7IA 2HSPA 1Z9ZA 3UA7A 2KXDA 1I07A 2LQWA 3H0IA 5IXFA 1BU1A 1OPLA 3C0CA 2PZ1A 1T0JA 2YDLA 2J6FA 1YNZA 4RTYA 1TUCA 1VA7A 2DILA 2GGRA 2FRWA 1I1JA 1WXBA 1MUZA 2L3QA 1UHCA 1GCQA 4HXJA 3THKA 5L23A 2DL5A 2AKKA 1SHFA 4ZNXA 2RQTA 2LQNA 3PVLA 1PWTA 2J06A 1G2BA 2JW4A 1NM7A 3ZL7C 2EYZA 2CSQA 2DYBA 2W0ZA 1NG2A 1JEGA 2RMOA 4IIOA 2EYWA 1B07A 2I0NA 3U23A 1TUDA 2CUDA 3VS1A 2L0AA 3SHWA 3ULRB 4AFSC 3I5SA 2DA9A 1CKAA 1CSKA 1K0SA 4OMLA 1UFFA 2EVRA 4EIKA 1QWFA 1ZUYA 3EG0A 4HCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FG0 A;  2EKH A;  1QKW A;  1ZBJ A;  4LUD A;  3O5Z A;  4CC7 A;  1OEB A;  1K9A A;  5EC7 A;  2DL7 A;  2VKN A;  1FMK A;  2MCN A;  2M0Y A;  2EQI A;  4AFQ C;  2DRM A;  2DLP A;  1G83 A;  4JZ4 A;  5HCK A;  1X2Q A;  1GCQ C;  5GJV B;  1BBZ A;  1GFC A;  2K6D A;  1JXM A;  1UEC A;  2P4R A;  4WCI A;  1SEM A;  2SRC A;  2VVK A;  2ENM A;  1ZUU A;  1E6H A;  2HBW A;  1AWX A;  2SEM A;  4RTW A;  2KE9 A;  1ABQ A;  2HCK A;  2RQU A;  2O2O A;  2C0I A;  1YWO A;  4HVW A;  4LNP A;  1SRL A;  1H8K A;  1ZX6 A;  3VS2 A;  2KRO A;  1WFW A;  1RI9 A;  2IIM A;  1SHG A;  4RTZ A;  2KXC A;  2KYB A;  2L3P A;  4D8K A;  2JM8 A;  2EGC A;  1PKS A;  4CC4 B;  3QWX X;  1PRL C;  2FRY A;  2DBK A;  2DNU A;  4J9G A;  1M30 A;  1NYG A;  1NLO C;  2F2X A;  2DL3 A;  4D8D A;  4K11 A;  3TSW A;  4GBQ A;  1OPK A;  1WDX A;  2K2M A;  1W6X A;  1S1N A;  3CQT A;  3M0T A;  3VS0 A;  1YCS B;  2DBM A;  3JV3 A;  4OMO A;  4AFU C;  1KSW A;  1WX6 A;  2A08 A;  2LZ6 B;  1GFD A;  2DRK A;  1A0N B;  3M0U A;  3H0H A;  2CT4 A;  3EHQ A;  2JMC A;  1Y57 A;  1MV3 A;  1PKT A;  2LJ3 A;  4JZ3 A;  2XMF A;  1U5S A;  2OI3 A;  1X6B A;  1B3Q A;  1AOJ A;  2BZX A;  2OAW A;  2QDL A;  2DL8 A;  3NGP A;  1X6G A;  1RLP C;  2OJ2 A;  2KR3 A;  2YSQ A;  2GTO A;  4RTT A;  1UJY A;  3RBB B;  1MV0 B;  2A28 A;  2HEQ A;  1HJD A;  4AG2 C;  2HDA A;  2X3W D;  4RTV A;  4R0K A;  2CDT A;  2RNA A;  1K76 A;  2KRN A;  2D1X A;  2CT3 A;  1J3T A;  1UDL A;  2LP5 A;  1SSH A;  2MOX A;  2KGT A;  1JXO A;  4CC2 A;  1BK2 A;  1TG0 A;  1Y0M A;  2V1Q A;  1WYX A;  2JM9 A;  1WXU A;  2AK5 A;  2D0N A;  2BTT A;  5IHK A;  2RQV A;  3M0Q A;  2JTE A;  2W10 A;  4QT7 A;  2F2V A;  1AZG B;  2BZY A;  1K1Z A;  1M3A A;  1V1C A;  2KRM A;  1ZUK A;  4OMN A;  4AG1 C;  2EBP A;  4JJB A;  5FWB A;  1YP5 A;  2JS0 A;  2V1R A;  4Z88 A;  2RPN A;  3REB B;  1W1F A;  4J9C A;  4Y92 A;  3VS3 A;  1AEY A;  2EYX A;  2MIO A;  3M0S A;  2KT1 A;  1YWP A;  2JMA A;  2B86 A;  4Z8A A;  1GL5 A;  3VS4 A;  1X69 A;  1E6G A;  1WI7 A;  4OMP A;  1SRM A;  3LH5 A;  4J9D A;  3UA6 A;  1WXT A;  2DVJ A;  2LX7 A;  3EG1 A;  4RUG A;  5FW9 A;  4DEY A;  1JO8 A;  1T3L A;  2G6F X;  2KNB B;  1XOV A;  1WA7 A;  5IXB A;  1KJW A;  5IH2 A;  4F17 A;  2K79 A;  1OV3 A;  2K9G A;  1X2K A;  2C0O A;  1FYN A;  2K3B A;  4J9I A;  1UG1 A;  4X1V A;  2JT4 A;  2A36 A;  1E7O A;  1K0X A;  1VYV A;  3NHN A;  2M51 A;  3EG3 A;  2F2W A;  3NPF A;  2RN8 A;  2LCS A;  1QCF A;  2L3S A;  4F16 A;  1CKB A;  5I11 A;  2DM1 A;  2ROL A;  2KRS A;  1VYT A;  2EGE A;  3SEM A;  1SPK A;  1YN8 A;  1AVZ C;  4JJC A;  2C0T A;  2DX1 A;  3I35 A;  4Z89 A;  3EG2 A;  1UTI A;  1NLP C;  2O88 A;  2E5K A;  1GRI A;  3VS7 A;  2DL4 A;  3UF4 A;  1JU5 C;  2K7A A;  3PE0 A;  2VWF A;  1K4U S;  1KFZ A;  4RTX A;  3TSZ A;  3H41 A;  1GBQ A;  3M0P A;  2AZS A;  4RTU A;  1I0C A;  2YUN A;  4J9B A;  1Z9Q A;  1M27 C;  1RLQ C;  1N5Z A;  5GJW B;  1HSQ A;  1UUE A;  2BZ8 A;  3PVQ A;  1PRM C;  2ESW A;  2JXB A;  1PNJ A;  3R6N A;  1UHF A;  2KT8 A;  2GTJ A;  2RF0 A;  3VRY A;  1T3S A;  4J9E A;  1AZE A;  2J05 A;  4AFZ C;  1NEG A;  3QWY A;  1QKX A;  2PNI A;  3EGU A;  1GBR A;  1X27 A;  4A63 B;  1X43 A;  2H8H A;  3I5R A;  3A98 A;  5FWC A;  1AWW A;  3VS6 A;  3NMZ C;  1M8M A;  1T0H A;  2EW3 A;  4HVV A;  5IHI A;  1W70 A;  2LMJ A;  1WIE A;  4KRT A;  1ARK A;  4CC3 A;  2ROT A;  3VS5 A;  2EGA A;  4M4Z A;  2DMO A;  2LJ1 A;  2YUO A;  4E6R A;  2X3X D;  4J9F A;  3FJ5 A;  3H0F A;  1M3C A;  2CSI A;  2GQI A;  1ZSG A;  4ESR A;  2RQW A;  3RNJ A;  2GNC A;  2ECZ A;  3KFV A;  1NEB A;  1UGV A;  4FSS A;  1GCP A;  2DJQ A;  1AWJ A;  2O9V A;  2FPD A;  2O9S A;  2YUP A;  2LJ0 A;  2NWM A;  2KBT A;  3TVT A;  1AD5 A;  1M3B A;  2LNH B;  4ORZ A;  2YUQ A;  2J6K A;  2PTK A;  2A37 A;  2DE0 X;  2KEA A;  1HD3 A;  2EPD A;  2ABL A;  2D8H A;  2NUZ A;  3M0R A;  2CH4 A;  1NYF A;  3GBQ A;  1QWE A;  1VYU A;  2AKL A;  3REA B;  4J9H A;  3VRZ A;  4HVU A;  2FPF A;  2CH4 W;  2JS2 A;  1EFN A;  1UE9 A;  1IO6 A;  1LCK A;  1ABO A;  1ZLM A;  1KIK A;  4IIM A;  2DF6 A;  2ED1 A;  5IHN A;  4DEX A;  4F14 A;  3IQL A;  2D8J A;  4OMM A;  1RUW A;  2EYY A;  2J6O A;  1AWO A;  2CRE A;  1U3O A;  2AZV A;  1OOT A;  5ECA A;  4LE9 A;  4JJD A;  2FO0 A;  3I9Q A;  2FPE A;  1PHT A;  1H3H A;  2O31 A;  3UAT A;  4LUE A;  1JQQ A;  2L2P A;  4OMQ A;  1U06 A;  1UJ0 A;  2GBQ A;  5I22 A;  1WLP B;  1BB9 A;  2CUB A;  1QLY A;  1H92 A;  3EHR A;  2RQR A;  4LN2 A;  2KYM A;  2FEI A;  2YT6 A;  4JPB W;  2ED0 A;  4GLM A;  2J7I A;  2HSP A;  1Z9Z A;  3UA7 A;  2KXD A;  1I07 A;  2LQW A;  3H0I A;  5IXF A;  1BU1 A;  1OPL A;  3C0C A;  2PZ1 A;  1T0J A;  2YDL A;  2J6F A;  1YNZ A;  4RTY A;  1TUC A;  1VA7 A;  2DIL A;  2GGR A;  2FRW A;  1I1J A;  1WXB A;  1MUZ A;  2L3Q A;  1UHC A;  1GCQ A;  4HXJ A;  3THK A;  5L23 A;  2DL5 A;  2AKK A;  1SHF A;  4ZNX A;  2RQT A;  2LQN A;  3PVL A;  1PWT A;  2J06 A;  1G2B A;  2JW4 A;  1NM7 A;  3ZL7 C;  2EYZ A;  2CSQ A;  2DYB A;  2W0Z A;  1NG2 A;  1JEG A;  2RMO A;  4IIO A;  2EYW A;  1B07 A;  2I0N A;  3U23 A;  1TUD A;  2CUD A;  3VS1 A;  2L0A A;  3SHW A;  3ULR B;  4AFS C;  3I5S A;  2DA9 A;  1CKA A;  1CSK A;  1K0S A;  4OML A;  1UFF A;  2EVR A;  4EIK A;  1QWF A;  1ZUY A;  3EG0 A;  4HCK A; 
#chains in the Genus database with same CATH topology
 3L42 A;  1MHN A;  2L8D A;  1ZBJ A;  3LLR A;  1D0Y A;  1OEB A;  1SF9 A;  3HKS A;  2FZG B;  2K2V A;  2DL7 A;  3CME Q;  2VKN A;  2MCN A;  5A0D A;  2M0Y A;  2KI7 A;  1W2B S;  2DRM A;  2DLP A;  1UGS B;  1BBZ A;  5EG2 A;  1JXM A;  4M78 A;  1E6H A;  3E1S A;  4RTW A;  4ZGE B;  3EFS A;  5GAO r;  5I2S A;  1BI1 A;  4PJO F;  3OMG A;  1YWO A;  5LJ3 h;  2HQX A;  4HVW A;  5IAY A;  4LDV A;  3OS5 A;  1ZSZ A;  2KRO A;  2DTI A;  4FYX B;  2IIM A;  1SHG A;  4DBQ A;  4D8K A;  1Y96 B;  4M77 D;  2GF7 A;  2JNG A;  4LXC A;  1D1B A;  5KYU B;  1K73 R;  3QYG B;  2DNU A;  2LVM A;  3L2Z A;  1NYG A;  3OYL A;  1M90 U;  3JRZ A;  2MMP A;  1YFN A;  2QTV A;  1M4Z A;  4DBR A;  3VU3 C;  4AT1 B;  5LJ3 d;  5C0M A;  1OPK A;  1WDX A;  3OQ5 A;  4XU2 A;  2IG0 A;  1RAF B;  3M0T A;  4XU1 A;  3VS0 A;  1YCS B;  3JV3 A;  1IZ6 A;  3MP1 A;  2K3X A;  2EFI A;  3MJX A;  4KGX B;  3G71 T;  2KSS A;  2X4Y A;  2M02 A;  3M0U A;  3HHT B;  1Y57 A;  3G1J A;  2XMF A;  2OI3 A;  3TU4 K;  5FU6 B;  1B3Q A;  1Y07 A;  3OYJ A;  2D9T A;  3I55 A;  5D6Y A;  2QDL A;  3LW5 E;  4FT2 A;  2KR3 A;  4C0Z A;  2GTO A;  4J5Y A;  5DM7 R;  3M5A A;  2JUF A;  2K4Y A;  4M7D D;  1MV0 B;  2A28 A;  4M75 G;  2HEQ A;  1HJD A;  3MEV A;  1QVF P;  4JJN K;  3RKW A;  2RNA A;  4FW1 A;  4M75 D;  2AIR B;  2D1X A;  4FYW B;  1C6V X;  3I56 Q;  2QYZ A;  4CC2 A;  2B8A A;  4C0G A;  1K8A U;  3HRU A;  2RA2 A;  4M78 E;  1WXU A;  4BDZ A;  1IHW A;  3F70 A;  2OTL A;  3CEY A;  2RQV A;  1NJI C;  2F2V A;  1AZG B;  3JCM c;  1N27 A;  5KCO A;  1K1Z A;  3LWH A;  3CC4 A;  2DO3 A;  5CK9 A;  2EBP A;  1FMW A;  4M78 F;  1X01 A;  4C8Q E;  5HKC A;  1WHK A;  4Z88 A;  1W1F A;  3VUZ A;  1NPP A;  3RUX A;  4M77 F;  5GAN 8;  3M0S A;  1VQK Q;  1YWP A;  3JCM e;  4BE0 A;  3VS4 A;  2VGN A;  3NTI A;  5FLX E;  1SRM A;  4A4H A;  3MP8 A;  3RMS A;  1VQK A;  4Z02 A;  1W2B A;  1JO8 A;  1T3L A;  2P4T A;  3FEO A;  1WA7 A;  1VQ8 A;  3OS2 A;  1MND A;  2X35 A;  1R0B G;  4XK8 E;  1FYN A;  5GAN 3;  3URG A;  2LT1 A;  1UG1 A;  4E7S A;  1SG5 A;  4KH0 B;  3AT1 B;  2JT4 A;  2FHD A;  2LRQ A;  1VQM Q;  3JB9 G;  2M51 A;  4PJO D;  3EG3 A;  1F1B B;  3CMA T;  2YLC A;  1VQ5 T;  1CKB A;  5I11 A;  2ROL A;  4C8Q A;  2KRS A;  4IUU A;  1YBY A;  3OB9 A;  3JCM X;  2YRV A;  2E5K A;  1GRI A;  2BE7 D;  2BUD A;  3UF4 A;  3CCQ T;  1KFZ A;  5KYW B;  3H41 A;  1GBQ A;  2QA4 T;  4LD9 K;  3J7A F;  1D09 B;  1I0C A;  1YIT Q;  2XD0 A;  2CP3 A;  1MMN A;  4C0D B;  1WPY A;  5GAM j;  1KQS P;  1N5Z A;  2O4X A;  2RO0 A;  4X9D A;  1N8R R;  4HA8 A;  4LD6 A;  2PVG B;  4DBH A;  1TTH B;  2JXB A;  1PNJ A;  3TQ7 P;  4Y91 A;  2GTJ A;  2DVE A;  1NZ9 A;  2DER A;  4M7A D;  2J05 A;  2MPX C;  4AFZ C;  2NUP A;  2PUK B;  3EGU A;  1GBR A;  1BCO A;  1YJ9 A;  1X27 A;  3BY7 A;  4CI0 C;  4C0D C;  1AWW A;  1KC8 U;  2CZ6 B;  1G3T A;  4LDW A;  3CC2 T;  4M75 B;  2F5T X;  1Q86 C;  5IHI A;  4M75 F;  4PKC C;  5KYY B;  2QA4 Q;  1ARK A;  1KC8 R;  3PTA A;  3VS5 A;  4M4Z A;  1KQS S;  2NLU A;  5GMK e;  4E6R A;  2X3X D;  1M3C A;  2GQI A;  5GAN h;  1UGV A;  2DTH A;  4FSS A;  3SWN C;  1GCP A;  5A0L A;  5KYU A;  2DJQ A;  1AWJ A;  5CKD A;  1PD1 A;  4YTL A;  1KQ2 A;  1Y96 A;  2LJ0 A;  2NWM A;  2KBT A;  2JJ9 A;  2VGM A;  3OYC A;  2YUQ A;  2J6K A;  4QQG A;  5LL6 S;  1HD3 A;  2DFU A;  4F7U F;  1VQL Q;  2BKD N;  4KGZ B;  2NUZ A;  4C8Q C;  3M0R A;  1NYF A;  2CH4 A;  1Q7Y R;  2LX9 A;  2CZ1 B;  3RMQ A;  2ZAE A;  4FM4 B;  2FPF A;  4BI3 A;  3M4Y A;  4F7U E;  4A53 A;  5IHN A;  1B34 B;  3IQL A;  1VQO T;  3UWN A;  3OW2 A;  1OOT A;  5GAO q;  4LE9 A;  2FPE A;  3QBY A;  4EMH A;  4LUE A;  1JQQ A;  2L2P A;  4OMQ A;  2HL3 A;  2QEX T;  3DKM A;  2CUB A;  1AT1 B;  4BD3 A;  3EHR A;  4LN2 A;  3Q1J A;  2FEI A;  2Y4X A;  5CKF A;  4M77 C;  2ED0 A;  1MNE A;  1NJI R;  2EQJ A;  2LQW A;  3CXC P;  5IXF A;  1WHL A;  1OPL A;  3OYD A;  1YHQ Q;  2PZ1 A;  5GAO l;  2J6F A;  4RTY A;  1YIJ A;  2P0P A;  2X4X A;  4E7I A;  1GCQ A;  5GAN j;  4LDU A;  8ATC B;  4KBM B;  3QDF A;  1VQ4 Q;  1R0C B;  4FL6 A;  5FRN A;  4L59 A;  2LQN A;  3CCJ A;  4FIB A;  4ZN1 A;  3ZL7 C;  2CSQ A;  1R8O B;  1S72 A;  2G3R A;  2W0Z A;  2OTJ T;  3RR6 A;  1VQL T;  4DOV A;  2F5K A;  2CP0 A;  3QDR B;  3OYI A;  2RHZ A;  4IUP A;  2PVO B;  3U23 A;  3G7Z A;  3VS1 A;  1N9S A;  3PIP A;  4MDW A;  1VQP Q;  4OB2 B;  3G71 Q;  3DB4 A;  1CSK A;  2YWW A;  1K0S A;  4M78 C;  3VYG A;  2EVR A;  4NL2 A;  4M7D C;  3E9F A;  4A54 A;  2DPP B;  3EG0 A;  1QMC A;  2CP5 A;  3GIB A;  4M7D G;  4M75 C;  1UB4 A;  4GY5 A;  4LUD A;  2F1L A;  2FYK A;  1M2V A;  4ANJ A;  4MZP A;  2CKK A;  1KC8 C;  1X2Q A;  4J83 A;  1GCQ C;  5GJV B;  2XID A;  1GFC A;  4XTW A;  2XDP A;  2P4R A;  1G8X A;  2VVK A;  1Q86 U;  1M1K C;  3QG1 A;  2HBW A;  1NJI U;  1ABQ A;  2HCK A;  1IB8 A;  3OBY A;  3KXT A;  3JCM W;  4OVA A;  1SRL A;  1H8K A;  3GOX A;  3VS2 A;  3FIF A;  5CIU A;  1RI9 A;  3CBO A;  4X34 A;  3HTR A;  2EGC A;  3CCM A;  4J6W A;  2FRY A;  1JB0 E;  3PNW C;  2DBK A;  3OYY A;  1W4S A;  1NLO C;  1QVP A;  2NUT B;  3H9N A;  4D8D A;  1BI3 A;  5I2M A;  5KYW A;  2RHX A;  5GAO p;  4CRI A;  5CKE A;  2DBM A;  4OMO A;  1RAI B;  4M7A B;  1GFD A;  2YXY A;  1QVG A;  2IPO B;  3P8D A;  3JCM g;  4QVC A;  2K57 A;  3H0H A;  3FDR A;  3N5B B;  3QYH B;  2JMC A;  4M7D F;  1MV3 A;  1PKT A;  2LJ3 A;  3CCS T;  1Q82 R;  3MCA B;  4KUI A;  1U5S A;  3H8Z A;  2BZX A;  5HY6 A;  4FYV B;  3DLM A;  1VQ5 A;  2OAW A;  3M59 A;  3LGL A;  3NGP A;  2XU8 A;  4QKU A;  4PJO B;  4ZGD B;  2OJ2 A;  3SB2 A;  1QVG S;  4N4I A;  2GQV A;  4M77 G;  2JN0 A;  3JCM f;  5D7U A;  2ZZD A;  2X3W D;  2EKO A;  4RTV A;  4R0K A;  2CDT A;  3EGD B;  1FX7 A;  1EIF A;  2KRN A;  3X24 B;  5GMK m;  2CT3 A;  3C4S A;  1VQ5 Q;  2X4W A;  3O8V A;  1IRE B;  2DET A;  1BK2 A;  3QZ9 B;  4J8O A;  5CKH A;  2JM9 A;  2L89 A;  2BTT A;  3MEW A;  1JBM A;  3KBG A;  3RIR A;  4ME7 A;  2E12 A;  2E6Z A;  4QT7 A;  3GP8 A;  1BIA A;  3I56 A;  1V1C A;  2KRM A;  4OMN A;  1ZUK A;  5L8R E;  3OYG A;  2X51 A;  4J6Y A;  2X4J A;  3SWN B;  4JJB A;  3X25 B;  1WJS A;  1YIT T;  1TU0 B;  2RPN A;  3REB B;  1AEY A;  3PFS A;  1PC0 A;  2KT1 A;  3L2R A;  2JMA A;  4C5I A;  4C5H A;  1RAE B;  3C95 A;  2QQA A;  5DY9 A;  1VQ9 T;  3JCM b;  4Y28 E;  1E6G A;  1WI7 A;  2Y90 A;  4OMP A;  1QP2 A;  3V8L A;  3UA6 A;  1YIJ T;  4RUG A;  2DVJ A;  2FVU A;  2LX7 A;  1MGQ A;  1TXQ A;  2ZPH B;  2G6F X;  4B9X A;  4BUG A;  4OGC A;  5IT9 E;  1FMV A;  4C8Q B;  5IH2 A;  1G5V A;  1OV3 A;  1TOV A;  3ER0 A;  2E65 A;  4R56 A;  2C0O A;  1PM3 A;  1I5L A;  4J9I A;  2EAY A;  3EFO A;  4JRI A;  1D1C A;  4E7Z A;  4X1V A;  2IVW A;  3QO3 A;  5GAN 5;  2MI6 A;  4MZT A;  4C8Q F;  3NHN A;  1SSF A;  4J6X A;  2F2W A;  3LH0 A;  4XTX A;  2RJC A;  4KGV B;  2JTF A;  2DXB A;  2LCS A;  3RKX A;  4MDX A;  1K73 U;  2DM1 A;  5CVI A;  2EGE A;  1SPK A;  1YN8 A;  3GLX A;  4JRQ A;  4PJN A;  3M56 A;  2C0T A;  4PNO A;  2DX1 A;  2V8I A;  2DAQ A;  1KD1 R;  4EMK A;  3EG2 A;  3CXC A;  1FXX A;  2DEU A;  4N4H A;  4HCB A;  2LCC A;  4AMC A;  5J26 A;  1U1T A;  2VWF A;  4RTX A;  5LJ3 j;  4C92 F;  3CBM A;  1XNI A;  2KDS A;  2RHI A;  1OX9 A;  2AZS A;  2OTL Q;  1VQ6 T;  1MMA A;  1VQM T;  3CC7 A;  4C92 E;  1D3B B;  2YLB A;  1BI2 A;  2HKN A;  5GMK i;  3CMA Q;  2HD0 A;  3R6N A;  3UDC A;  1UHF A;  1YIT A;  4A4F A;  2FZC B;  5LJ3 f;  1AZE A;  3OW2 S;  3OA6 A;  3CCM T;  2OTJ A;  3CC7 Q;  2HKQ B;  2PNI A;  3DLL A;  3OYA A;  5GMK h;  1JJ2 A;  4PJO G;  1OI1 A;  5LJ5 j;  4O5V A;  1T0H A;  1W70 A;  4C5E A;  2LMJ A;  1YJ9 Q;  4CC3 A;  4E47 A;  3JB9 J;  2ROT A;  4ELY C;  2CZ7 B;  3CCR T;  1OU8 A;  3CCR A;  2EJ9 A;  1OZ3 A;  1WQW A;  2LJ1 A;  2WAC A;  3JAM E;  3H0F A;  1YI2 A;  1LOJ A;  3RNJ A;  3KFV A;  2KVQ G;  4JUV A;  1NEB A;  5GAN g;  3CCR Q;  2A0F B;  4C8Q G;  3BDL A;  2O9S A;  2YUP A;  4ZGJ B;  3QJ6 A;  2RH2 A;  2JTM A;  1AD5 A;  2HZY A;  1M3B A;  1YI2 Q;  4ORZ A;  4M77 B;  1RL2 A;  8AT1 B;  4M78 D;  3A8H B;  3BW1 A;  3L1A A;  3VJP A;  2D8H A;  1JJ2 P;  4GLK A;  3QII A;  1GXI E;  1M5Q 1;  3CME A;  1VQP T;  2E70 A;  2CH4 W;  4C92 D;  5LJ5 g;  4PLI A;  4ELZ C;  3C12 A;  4XU0 A;  2QQB A;  4IIM A;  3WVD B;  1KIK A;  4DEX A;  3L2Q A;  3EGX B;  2LNV A;  3MO8 A;  2EYY A;  3QUI A;  2J6O A;  1QVG P;  1QP3 A;  5ECA A;  1PCX A;  4JJD A;  2MYS A;  3QPH A;  3UAT A;  1U06 A;  2GBQ A;  1B7T A;  2E64 A;  1WLP B;  1BB9 A;  4TVR A;  1H92 A;  2RQR A;  3QXE B;  3SDZ A;  2KYM A;  2YT6 A;  5CCA A;  2QDY B;  2R5A A;  1ZSZ C;  1VUB A;  1Z9Z A;  1N6A A;  4E7J A;  3H0I A;  4MML A;  4BB7 A;  1BU1 A;  1M1F A;  3C0C A;  1T0J A;  2P0Q A;  3HPW A;  1KK7 A;  2GGR A;  4HCC A;  3THK A;  3CCL T;  3G4S T;  2H3E B;  2HBP A;  1LVK A;  3CBP A;  2PU9 B;  3LYI A;  2XK0 A;  3HFN A;  1YJW Q;  4N0A A;  2RQT A;  1NPR A;  4JLI A;  3PGG A;  3PVL A;  4L6V 5;  1YIJ Q;  4R55 A;  1VQ4 T;  3OSV A;  1XJW B;  3TRE A;  3VV0 A;  2RMO A;  3CCS A;  1I81 A;  4IUV A;  2ZCF B;  2E10 A;  4M7D B;  1UEB A;  2BE9 B;  2QTX A;  4FCY A;  4AFS C;  4EMK B;  3KUF A;  4IUR A;  2GCX A;  3M55 A;  4RG2 A;  5A2Q E;  3A8L B;  4OML A;  1UFF A;  3JB9 D;  4NL3 A;  2VUB A;  1ZUY A;  1IXD A;  3MET A;  2EKH A;  1QKW A;  3VYH B;  2PUO B;  1PSF A;  4DOW A;  3LWI A;  3CCL Q;  1KHC A;  5EC7 A;  4M75 A;  4L5G A;  3HSB A;  1FMK A;  2EQI A;  4AFQ C;  2E6N A;  4JZ4 A;  2K6D A;  3UPU A;  4WCI A;  1SEM A;  2SRC A;  2ENM A;  1ZUU A;  3EFR A;  1AWX A;  1MMD A;  2KE9 A;  2L5Q A;  2RQU A;  2C0I A;  1QVF S;  4QQD A;  2RI3 A;  2I2L A;  2WSC E;  5LJ3 e;  3AHU A;  2EIF A;  1ZX6 A;  1YI2 T;  4M7D E;  3CCU T;  2D6F A;  4RTZ A;  2KXC A;  2L3P A;  1M90 R;  3X26 B;  2X9H A;  2JM8 A;  4J7I A;  3V8K A;  1PKS A;  2VXF A;  2O4X B;  4CC4 B;  1AHJ B;  1PRL C;  3SFM A;  1QVF A;  2VXE A;  4P5N A;  4J9G A;  1M30 A;  4PJJ A;  5DLQ E;  4JRP A;  2DL3 A;  3JB9 H;  1KD1 U;  5AYF A;  2RD1 A;  2K5L A;  2CS7 A;  2RJD A;  2A7Y A;  4VUB A;  2K2M A;  1QW1 A;  2QGF B;  1VQ7 Q;  3P8H A;  2QQR A;  1WX6 A;  2A08 A;  3QKJ A;  3OW2 P;  2DRK A;  1TWB A;  5KYY A;  2CT4 A;  3FC3 A;  2XDB A;  4JZ3 A;  1S72 Q;  4HT8 A;  1VQ7 A;  1ZHI A;  3OYH A;  4EMG A;  2DD4 A;  4HT9 A;  1SKU B;  1X6G A;  1Q82 U;  2LDM A;  4M7D A;  2YSQ A;  3X20 B;  2PVD B;  2DXC A;  4BE1 A;  3RBB B;  3RKY A;  1H3Z A;  3G71 A;  2DJZ A;  5HK3 A;  1K9M U;  2NUT A;  4AG2 C;  2HDA A;  5C6S A;  2COZ A;  3GNF B;  4M75 E;  1K76 A;  2R57 A;  1J3T A;  1UDL A;  2LP5 A;  2MOX A;  3QSU A;  3C94 A;  2KGT A;  2V1Q A;  4M7A A;  2M1H A;  3FJP A;  2XI9 A;  2D0N A;  1HK9 A;  3S3M A;  1LPL A;  3MEU A;  4PFO A;  1TH7 A;  4PJL A;  1M3A A;  5LJ3 g;  3JCM P;  3CPW S;  1JJ2 S;  4BI8 B;  1YP5 A;  2GFU A;  2JS0 A;  4D6W A;  2BIV A;  2K5F A;  1ZBX A;  4Y92 A;  3VS3 A;  1LNX A;  2EYX A;  4KUD K;  3OYB A;  2RHU A;  4A4G A;  2B86 A;  4FW2 A;  2QXF A;  1OU9 A;  4NOY A;  1X69 A;  1H64 1;  3HL8 A;  4PL6 A;  4PJO E;  1NBE B;  3LH5 A;  4J9D A;  2QA4 A;  3EFO B;  5CO7 A;  4DEY A;  3M4G A;  1YCY A;  2LQK A;  4ATO A;  1XOV A;  3JCM Q;  5GAN 4;  4E2F B;  1VQ9 A;  5IXB A;  1KJW A;  2Z0W A;  2K79 A;  1BCM A;  2XG8 D;  4M7A E;  4KT0 E;  2K3B A;  2DXT A;  3M53 A;  3OS0 A;  2MWO A;  5FU7 B;  1E7O A;  3ASK A;  1G3S A;  1VQ9 Q;  1D3B A;  4EMK C;  1K0X A;  2FZK B;  5CAI A;  3CCU Q;  3JB9 F;  2A3L A;  2RN8 A;  1Y71 A;  2ATC B;  4F16 A;  1M2O A;  3SEM A;  1LJO A;  4BI4 A;  1AVZ C;  3I55 Q;  4BE2 A;  3CCQ Q;  2MK5 A;  2DD5 A;  3DB3 A;  2LC4 A;  1NLP C;  3E9G A;  1UGQ B;  3J80 E;  3CXC S;  3MKD A;  3PE0 A;  1K4U S;  3PT9 A;  4C92 C;  4II1 A;  3JSC A;  3WXM B;  3EAE A;  3TSZ A;  3G6E Q;  4UC4 A;  3M0P A;  4J9B A;  5D6X A;  1M27 C;  1RLQ C;  2DZC A;  4PK4 A;  5FU6 C;  2QK0 A;  1HSQ A;  1WHJ A;  3INZ A;  1M90 C;  2DIQ A;  3PVQ A;  3RES A;  4RMO A;  3JCM h;  1IHV A;  3P8B B;  3PMI A;  1PRM C;  1VIE A;  3CC2 A;  4DQ2 A;  1VQK T;  3LGF A;  2JZ2 A;  5GAN d;  3GF5 A;  1T3S A;  3SD4 A;  3MPU B;  1W2B P;  2QG9 B;  1NEG A;  2RK1 A;  1MMG A;  1QKX A;  3OSS C;  4A63 B;  1X43 A;  2H8H A;  5HK0 A;  4PJO A;  3A98 A;  3CMA A;  1VQN Q;  4QVD A;  4QW2 A;  2ZPG B;  4XQ3 A;  3VS6 A;  2XHC A;  1M8M A;  1Q7Y C;  2OTL T;  4IUT A;  1WHG A;  2EW3 A;  4HVV A;  2ZGW A;  1DJ7 B;  4KRT A;  3CPW P;  3OS1 A;  2QEX Q;  4MZM A;  2EGA A;  3UT1 A;  3CCV A;  2H3J A;  4QVZ A;  2ZPI B;  2YUO A;  3OYF A;  3CD6 T;  1IRX A;  1PG5 B;  3HRS A;  4C5G A;  2CSI A;  2EQK A;  1R77 A;  4NS5 A;  2MAM A;  2RQW A;  1XTD A;  1WNL A;  4M7A F;  4RKU E;  1Y7X A;  4C92 A;  1VQP A;  4RG8 A;  2FPD A;  3CCV Q;  1K8A C;  3SWN A;  1VQM A;  1VQ7 T;  1D0Z A;  2RI5 A;  3S6W A;  3S3N A;  1O9S A;  4QQ6 A;  2PTK A;  1OUL A;  1Q81 R;  2DE0 X;  4XTZ A;  3CCE A;  2ABL A;  5LJ5 h;  2D0Q B;  3EGX A;  2RK2 A;  1RAD B;  3REA B;  1C1A A;  4J9H A;  3VRZ A;  4HVU A;  4OF1 A;  2JS2 A;  1UE9 A;  1IO6 A;  1ABO A;  3FRN A;  3RDV A;  3CCE Q;  2DF6 A;  2EJG A;  4F14 A;  4OMM A;  4F7U G;  3OBW A;  1U3O A;  2AZV A;  2RI2 A;  1V76 A;  1HYO A;  2CYZ B;  2FO0 A;  1KQS A;  1UGP B;  3I9Q A;  1BI0 A;  1N8R C;  1M1K R;  3BE3 A;  2E41 A;  1VQ6 Q;  1YJN A;  2CP6 A;  5FRM A;  1ZA1 B;  1WQ7 A;  4FYY B;  3G4S A;  2EYQ A;  2J7I A;  5CQX A;  4E7K A;  1K8A R;  2HSP A;  2QQ9 A;  2NUP B;  2DYI A;  4N4G A;  3CC7 T;  2C06 A;  3TEE A;  3CD6 Q;  3A5Z B;  5GAO m;  3R6O A;  3MP6 A;  4M7A G;  1VA7 A;  2DIL A;  2FRW A;  1WXB A;  1MUZ A;  1UHC A;  4HXJ A;  1RAH B;  3ZEH A;  2AKK A;  5CKB A;  5LJ5 f;  2O01 E;  1SHF A;  5LJ5 e;  3A8O B;  2P0K A;  1NM7 A;  4C92 G;  3TCJ A;  1TS9 A;  2CP7 A;  5IN1 A;  1KHI A;  3GNG A;  4IIO A;  2LQ8 A;  2EYW A;  4M78 B;  1B07 A;  2VB6 A;  1TUD A;  3M9Q A;  4XAX B;  3A8G B;  1YJW A;  2M16 A;  4OGE A;  3ULR B;  1QCN A;  1WZO A;  5CQY A;  4LDY A;  5GAO n;  3E19 A;  2VC8 A;  1Q82 C;  5KH6 A;  1K9M C;  5FRO A;  5DLO A;  3L2W A;  2EQU A;  3CC4 T;  2FG0 A;  2KK4 A;  3O5Z A;  4CC7 A;  1K9A A;  1Q86 R;  1QQJ A;  1Q7Y U;  4F7U B;  2VYT A;  1RI0 A;  4J7F A;  2ZPF B;  1G83 A;  5HCK A;  4XU3 A;  3CC4 Q;  2EQM A;  1UEC A;  1ZQ1 A;  1YHQ T;  4JLG A;  2SEM A;  2RM4 A;  2O2O A;  2HQE A;  1BIB A;  4BY6 C;  1KD1 C;  4LNP A;  2R5M A;  1WFW A;  4M77 A;  2RHY A;  1RAC B;  2QI2 A;  1G3W A;  4JRK A;  4JS4 A;  1WJQ A;  2KYB A;  4ZTJ A;  4LDX A;  2P84 A;  3QWX X;  4JS5 A;  2DZ9 A;  2JOY A;  3EGD A;  3JCM V;  4WTO B;  2F2X A;  1RAB B;  2L3R A;  3VKI A;  2FL7 A;  1BYM A;  1ZA2 B;  2E5Q A;  4K11 A;  1S72 T;  2WSF E;  5GAN e;  4OB3 B;  3TSW A;  3I56 T;  4GBQ A;  1M1K U;  5J39 A;  3X28 B;  1W6X A;  1S1N A;  3CQT A;  5GAN f;  1WHM A;  1D0X A;  4AFU C;  1KSW A;  3T9N A;  5KE2 A;  2LZ6 B;  1A0N B;  3OYE A;  3CCJ Q;  2COY A;  3EHQ A;  3PMT A;  1ACM B;  5GAM h;  4XTV A;  1X6B A;  1AOJ A;  3CCS Q;  1I4K 1;  2DL8 A;  4M77 E;  3BFM A;  1RLP C;  4RTT A;  1UJY A;  2XDD A;  3V7S A;  1VQ8 T;  2KMT A;  5J3B A;  1SSH A;  1I8F A;  2JVV A;  1JXO A;  5KYN A;  2DIG A;  4RCB A;  1TG0 A;  1Y0M A;  2WSE E;  1WYX A;  2QQS A;  2AK5 A;  1IGQ A;  5IHK A;  3M0Q A;  2JTE A;  2W10 A;  1EZZ B;  5LJ5 d;  2HNI A;  2BZY A;  3A8M B;  4AG1 C;  2KAF A;  2DXU A;  1YJN T;  5D6W A;  5FWB A;  2V1R A;  1UGR B;  3M54 A;  3ZFJ A;  4J9C A;  4KH1 B;  4OB1 B;  2MIO A;  4BDY A;  2OAU A;  4Z8A A;  2RJE A;  5I21 A;  5KCH A;  4PFZ A;  2K3Y A;  1GL5 A;  1VQ8 Q;  2CGH A;  1X75 C;  3OMC A;  4IUQ A;  3CCM Q;  1B34 A;  5GAM f;  4F04 B;  4KUL A;  1K73 C;  4V2S A;  1WXT A;  2R58 A;  3EG1 A;  3BDU A;  5FW9 A;  3NFC A;  2M0O A;  3JB9 I;  2KNB B;  4MMK A;  4IKF A;  1D1A A;  1EX4 A;  4F17 A;  1NE8 A;  4X9C A;  2K9G A;  3A1P A;  1X2K A;  5KYX A;  5KYX B;  4B6M A;  1U8R A;  3MEA A;  2OX7 A;  2YRD A;  3I55 T;  1OZ2 A;  2NYS A;  2AHJ B;  2A36 A;  1X6O A;  1TUG B;  4EDU A;  4PJM A;  1Q81 U;  1VYV A;  4XTY A;  4FSX A;  2AT1 B;  3NPF A;  2DTO A;  4HCZ A;  1QCF A;  2L3S A;  2V8J A;  2V26 A;  1VYT A;  3G6E T;  1WJR A;  2ZPB B;  4N0A C;  2E3I A;  4JJC A;  3I35 A;  3CCU A;  4Z89 A;  1UTI A;  3M58 A;  2QAZ A;  2DEQ A;  2O88 A;  3VS7 A;  2DL4 A;  2LT4 A;  1PD0 A;  1JU5 C;  2K7A A;  3EG9 B;  3EG9 A;  3NTK A;  3QZ5 B;  4A4E A;  4RTU A;  3OY9 A;  5GAN 6;  2HAX A;  2YUN A;  4ZTF A;  1OX8 A;  1Z9Q A;  5GJW B;  3EH1 A;  2RB6 A;  2MWP A;  1UUE A;  3MHX A;  1HXD A;  4WF2 A;  2BZ8 A;  3G6E A;  5CR2 A;  3EH2 A;  2ESW A;  2HSE B;  2VV5 A;  4JDS A;  2KT8 A;  2RF0 A;  3VRY A;  1VIF A;  4J9E A;  2HMA A;  5GAN 2;  4A4K A;  3QWY A;  1JRI A;  3CPF A;  1N8R U;  3E2U A;  1I5O B;  3PIO A;  3I5R A;  4RCC A;  2M9U A;  2KQW A;  5FWC A;  1FWZ A;  3ME9 A;  1YJW T;  3NMZ C;  5GMK l;  4F7U A;  2E3H A;  4C92 B;  2COW A;  3CCE T;  2EWN A;  1WIE A;  4OMF B;  2LCL A;  2XIC A;  2YHT A;  4PFP A;  2DMO A;  2E4H A;  2KY9 A;  4DA4 A;  4J9F A;  3FJ5 A;  3WVE B;  4OB0 B;  1ZSG A;  4ESR A;  1Q95 G;  2GNC A;  2ECZ A;  2VAS A;  2PQW A;  3OYK A;  4Q5W A;  4BY6 B;  1VQL A;  3FB9 A;  4PJO C;  2O9V A;  3V8J A;  3CPW A;  1VQO Q;  4EPC A;  1WGS A;  7AT1 B;  3QHS A;  2E1H A;  3TVT A;  1C0M A;  2LNH B;  2A37 A;  2KEA A;  2EPD A;  3ZBD A;  1KQ1 A;  4FU6 A;  1KG1 A;  2HQH A;  3FLG A;  3HRT A;  3GBQ A;  1QWE A;  3CCL A;  1VYU A;  1VQO A;  2AKL A;  2V8K A;  3QJY A;  4ZN3 A;  5GAM d;  3CCQ A;  1P92 A;  1TSF A;  1EFN A;  3JCM J;  1V29 B;  1LCK A;  5KE3 A;  3LX7 A;  1ZLM A;  2FB7 A;  5M9O A;  2ED1 A;  3D7S B;  2D8J A;  1U1S A;  1RUW A;  3OYM A;  4C0F A;  2XKO C;  1M2V B;  5A0G A;  3V7C A;  1AWO A;  2HL5 C;  4E7L A;  2CRE A;  1RAG B;  5AT1 B;  2LTO A;  3NTH A;  3V7R A;  4BAC A;  2ZPE B;  1RAA B;  3J81 E;  2DKG A;  4M78 G;  1PHT A;  3VUB A;  2RJF A;  5FU7 C;  1H3H A;  3CME T;  2O31 A;  1IGU A;  5GAN 7;  4B9W A;  1YJ9 T;  2EJF A;  1XQH A;  1M9S A;  1UJ0 A;  1YHQ A;  5I22 A;  2K5I A;  3CC2 Q;  2DK3 A;  2F69 A;  1QLY A;  3GPL A;  3RER A;  4M7A C;  3HFO A;  1PSE A;  4JPB W;  4GLM A;  5GAM e;  3UA7 A;  1Q81 C;  2KXD A;  1VQ6 A;  1I07 A;  1YJN Q;  2OTJ Q;  4XTU A;  4DBF A;  2QGG A;  1OQK A;  3JCM d;  1VQ4 A;  2YDL A;  1YNZ A;  1K9M R;  1VQN A;  1VQN T;  4O6J A;  3G4S Q;  1TUC A;  1N9R A;  2CZ0 B;  1I1J A;  2L3Q A;  2Y4Y A;  1G3Y A;  2GFA A;  5L23 A;  2QAS A;  2DL5 A;  3M57 A;  3CD6 A;  1BKB A;  4ZNX A;  3L2U A;  4PLL A;  3L2V A;  3S3O A;  1ZSZ B;  1O75 A;  2QEX A;  3OYN A;  1PWT A;  2J06 A;  1G2B A;  2JW4 A;  6AT1 B;  5GAM g;  2EYZ A;  2DYB A;  3HP9 A;  1VOM A;  3H6Z A;  1NG2 A;  1WHH A;  2CP2 A;  1JEG A;  2MF2 A;  1QCO A;  2I0N A;  2CUD A;  2L0A A;  3SHW A;  9ATC B;  4FT4 A;  3I5S A;  3CCV T;  2DA9 A;  5GMK j;  4E7H A;  1CKA A;  1M8V A;  3CCJ T;  4EIK A;  1M1G A;  1QWF A;  1OYX A;  4OP0 A;  4HKE A;  4C8Q D;  2YRC A;  4HCK A; 
#chains in the Genus database with same CATH homology
 2FG0 A;  2EKH A;  1QKW A;  1ZBJ A;  4LUD A;  3O5Z A;  4CC7 A;  1OEB A;  1K9A A;  5EC7 A;  2DL7 A;  2VKN A;  1FMK A;  2MCN A;  2M0Y A;  2EQI A;  4AFQ C;  2DRM A;  2DLP A;  1G83 A;  4JZ4 A;  5HCK A;  1X2Q A;  1GCQ C;  5GJV B;  1BBZ A;  1GFC A;  2K6D A;  1JXM A;  1UEC A;  2P4R A;  4WCI A;  1SEM A;  2SRC A;  2VVK A;  2ENM A;  1ZUU A;  1E6H A;  2HBW A;  1AWX A;  2SEM A;  4RTW A;  2KE9 A;  1ABQ A;  2HCK A;  2RQU A;  2O2O A;  2C0I A;  1YWO A;  4HVW A;  4LNP A;  1SRL A;  1H8K A;  1ZX6 A;  3VS2 A;  2KRO A;  1WFW A;  1RI9 A;  2IIM A;  1SHG A;  4RTZ A;  2KXC A;  2KYB A;  2L3P A;  4D8K A;  2JM8 A;  2EGC A;  1PKS A;  4CC4 B;  3QWX X;  1PRL C;  2FRY A;  2DBK A;  2DNU A;  4J9G A;  1M30 A;  1NYG A;  1NLO C;  2F2X A;  2DL3 A;  4D8D A;  4K11 A;  3TSW A;  4GBQ A;  1OPK A;  1WDX A;  2K2M A;  1W6X A;  1S1N A;  3CQT A;  3M0T A;  3VS0 A;  1YCS B;  2DBM A;  3JV3 A;  4OMO A;  4AFU C;  1KSW A;  1WX6 A;  2A08 A;  2LZ6 B;  1GFD A;  2DRK A;  1A0N B;  3M0U A;  3H0H A;  2CT4 A;  3EHQ A;  2JMC A;  1Y57 A;  1MV3 A;  1PKT A;  2LJ3 A;  4JZ3 A;  2XMF A;  1U5S A;  2OI3 A;  1X6B A;  1B3Q A;  1AOJ A;  2BZX A;  2OAW A;  2QDL A;  2DL8 A;  3NGP A;  1X6G A;  1RLP C;  2OJ2 A;  2KR3 A;  2YSQ A;  2GTO A;  4RTT A;  1UJY A;  3RBB B;  1MV0 B;  2A28 A;  2HEQ A;  1HJD A;  4AG2 C;  2HDA A;  2X3W D;  4RTV A;  4R0K A;  2CDT A;  2RNA A;  1K76 A;  2KRN A;  2D1X A;  2CT3 A;  1J3T A;  1UDL A;  2LP5 A;  1SSH A;  2MOX A;  2KGT A;  1JXO A;  4CC2 A;  1BK2 A;  1TG0 A;  1Y0M A;  2V1Q A;  1WYX A;  2JM9 A;  1WXU A;  2AK5 A;  2D0N A;  2BTT A;  5IHK A;  2RQV A;  3M0Q A;  2JTE A;  2W10 A;  4QT7 A;  2F2V A;  1AZG B;  2BZY A;  1K1Z A;  1M3A A;  1V1C A;  2KRM A;  1ZUK A;  4OMN A;  4AG1 C;  2EBP A;  4JJB A;  5FWB A;  1YP5 A;  2JS0 A;  2V1R A;  4Z88 A;  2RPN A;  3REB B;  1W1F A;  4J9C A;  4Y92 A;  3VS3 A;  1AEY A;  2EYX A;  2MIO A;  3M0S A;  2KT1 A;  1YWP A;  2JMA A;  2B86 A;  4Z8A A;  1GL5 A;  3VS4 A;  1X69 A;  1E6G A;  1WI7 A;  4OMP A;  1SRM A;  3LH5 A;  4J9D A;  3UA6 A;  1WXT A;  2DVJ A;  2LX7 A;  3EG1 A;  4RUG A;  5FW9 A;  4DEY A;  1JO8 A;  1T3L A;  2G6F X;  2KNB B;  1XOV A;  1WA7 A;  5IXB A;  1KJW A;  5IH2 A;  4F17 A;  2K79 A;  1OV3 A;  2K9G A;  1X2K A;  2C0O A;  1FYN A;  2K3B A;  4J9I A;  1UG1 A;  4X1V A;  2JT4 A;  2A36 A;  1E7O A;  1K0X A;  1VYV A;  3NHN A;  2M51 A;  3EG3 A;  2F2W A;  3NPF A;  2RN8 A;  2LCS A;  1QCF A;  2L3S A;  4F16 A;  1CKB A;  5I11 A;  2DM1 A;  2ROL A;  2KRS A;  1VYT A;  2EGE A;  3SEM A;  1SPK A;  1YN8 A;  1AVZ C;  4JJC A;  2C0T A;  2DX1 A;  3I35 A;  4Z89 A;  3EG2 A;  1UTI A;  1NLP C;  2O88 A;  2E5K A;  1GRI A;  3VS7 A;  2DL4 A;  3UF4 A;  1JU5 C;  2K7A A;  3PE0 A;  2VWF A;  1K4U S;  1KFZ A;  4RTX A;  3TSZ A;  3H41 A;  1GBQ A;  3M0P A;  2AZS A;  4RTU A;  1I0C A;  2YUN A;  4J9B A;  1Z9Q A;  1M27 C;  1RLQ C;  1N5Z A;  5GJW B;  1HSQ A;  1UUE A;  2BZ8 A;  3PVQ A;  1PRM C;  2ESW A;  2JXB A;  1PNJ A;  3R6N A;  1UHF A;  2KT8 A;  2GTJ A;  2RF0 A;  3VRY A;  1T3S A;  4J9E A;  1AZE A;  2J05 A;  4AFZ C;  1NEG A;  3QWY A;  1QKX A;  2PNI A;  3EGU A;  1GBR A;  1X27 A;  4A63 B;  1X43 A;  2H8H A;  3I5R A;  3A98 A;  5FWC A;  1AWW A;  3VS6 A;  3NMZ C;  1M8M A;  1T0H A;  2EW3 A;  4HVV A;  5IHI A;  1W70 A;  2LMJ A;  1WIE A;  4KRT A;  1ARK A;  4CC3 A;  2ROT A;  3VS5 A;  2EGA A;  4M4Z A;  2DMO A;  2LJ1 A;  2YUO A;  4E6R A;  2X3X D;  4J9F A;  3FJ5 A;  3H0F A;  1M3C A;  2CSI A;  2GQI A;  1ZSG A;  4ESR A;  2RQW A;  3RNJ A;  2GNC A;  2ECZ A;  3KFV A;  1NEB A;  1UGV A;  4FSS A;  1GCP A;  2DJQ A;  1AWJ A;  2O9V A;  2FPD A;  2O9S A;  2YUP A;  2LJ0 A;  2NWM A;  2KBT A;  3TVT A;  1AD5 A;  1M3B A;  2LNH B;  4ORZ A;  2YUQ A;  2J6K A;  2PTK A;  2A37 A;  2DE0 X;  2KEA A;  1HD3 A;  2EPD A;  2ABL A;  2D8H A;  2NUZ A;  3M0R A;  2CH4 A;  1NYF A;  3GBQ A;  1QWE A;  1VYU A;  2AKL A;  3REA B;  4J9H A;  3VRZ A;  4HVU A;  2FPF A;  2CH4 W;  2JS2 A;  1EFN A;  1UE9 A;  1IO6 A;  1LCK A;  1ABO A;  1ZLM A;  1KIK A;  4IIM A;  2DF6 A;  2ED1 A;  5IHN A;  4DEX A;  4F14 A;  3IQL A;  2D8J A;  4OMM A;  1RUW A;  2EYY A;  2J6O A;  1AWO A;  2CRE A;  1U3O A;  2AZV A;  1OOT A;  5ECA A;  4LE9 A;  4JJD A;  2FO0 A;  3I9Q A;  2FPE A;  1PHT A;  1H3H A;  2O31 A;  3UAT A;  4LUE A;  1JQQ A;  2L2P A;  4OMQ A;  1U06 A;  1UJ0 A;  2GBQ A;  5I22 A;  1WLP B;  1BB9 A;  2CUB A;  1QLY A;  1H92 A;  3EHR A;  2RQR A;  4LN2 A;  2KYM A;  2FEI A;  2YT6 A;  4JPB W;  2ED0 A;  4GLM A;  2J7I A;  2HSP A;  1Z9Z A;  3UA7 A;  2KXD A;  1I07 A;  2LQW A;  3H0I A;  5IXF A;  1BU1 A;  1OPL A;  3C0C A;  2PZ1 A;  1T0J A;  2YDL A;  2J6F A;  1YNZ A;  4RTY A;  1TUC A;  1VA7 A;  2DIL A;  2GGR A;  2FRW A;  1I1J A;  1WXB A;  1MUZ A;  2L3Q A;  1UHC A;  1GCQ A;  4HXJ A;  3THK A;  5L23 A;  2DL5 A;  2AKK A;  1SHF A;  4ZNX A;  2RQT A;  2LQN A;  3PVL A;  1PWT A;  2J06 A;  1G2B A;  2JW4 A;  1NM7 A;  3ZL7 C;  2EYZ A;  2CSQ A;  2DYB A;  2W0Z A;  1NG2 A;  1JEG A;  2RMO A;  4IIO A;  2EYW A;  1B07 A;  2I0N A;  3U23 A;  1TUD A;  2CUD A;  3VS1 A;  2L0A A;  3SHW A;  3ULR B;  4AFS C;  3I5S A;  2DA9 A;  1CKA A;  1CSK A;  1K0S A;  4OML A;  1UFF A;  2EVR A;  4EIK A;  1QWF A;  1ZUY A;  3EG0 A;  4HCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...