2YUPA

Solution structure of the second sh3 domain of human vinexin
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
90
structure length
90
Chain Sequence
b'GSSGSSGKPPTYQVLEYGEAVAQYTFKGDLEVELSFRKGEHICLIRKVNENWYEGRITGTGRQGIFPASYVQVSREPRLRLCDDSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinexin
publication title Solution structure of the second SH3 domain of human Vinexin
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 6
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2yupA01
2OJ2A 2JMCA 4JPBW 1T0JA 1U5SA 1XOVA 2KT8A 5FWCA 1UG1A 1Y0MA 3FJ5A 1BK2A 1RUWA 2EYYA 3H41A 3VRYA 2DM1A 4HVUA 1WX6A 3UA7A 1I0CA 1QKXA 1V1CA 4Y92A 1X69A 1WI7A 1N5ZA 1KIKA 3TVTA 2LMJA 1YN8A 3VS3A 1AWXA 5FWBA 3KFVA 4RUGA 2DL4A 1X43A 2HEQA 3GBQA 2YT6A 2LJ1A 2P4RA 2LX7A 4LUDA 2MCNA 1AZGB 1ZLMA 1JXOA 3H0FA 2J6OA 2DNUA 2JTEA 2EGAA 4R0KA 1JXMA 3PVQA 5IXFA 3QWYA 3REBB 4AG1C 4KRTA 3VRZA 2KXCA 1K4US 2MOXA 2F2XA 2EGEA 4DEXA 2FPEA 2D0NA 2PNIA 1OOTA 4GLMA 1AD5A 4J9DA 3EHRA 2D8JA 1M3CA 5ECAA 2IIMA 4JJDA 5GJVB 2EBPA 2LJ3A 2KXDA 2RN8A 1WXBA 1PRMC 2C0TA 1GRIA 3IQLA 1YWPA 4OMNA 2RQUA 1WXTA 2LQWA 2JW4A 2JXBA 1IO6A 2O31A 1GL5A 2KBTA 2RQRA 4ZNXA 2FRYA 2L3SA 1Z9QA 2J05A 1KJWA 2DBKA 2CH4A 1VYVA 3CQTA 2LZ6B 1NEGA 2QDLA 2OI3A 2YUNA 5GJWB 1YCSB 1BBZA 2FEIA 1G83A 1TUDA 2DL8A 1ZSGA 4J9HA 4F17A 3RNJA 3M0UA 2EYXA 3UA6A 2ESWA 2NWMA 2GTOA 4ESRA 4EIKA 1X27A 4J9BA 4D8DA 1CKAA 3I35A 2AZSA 2CREA 1X2KA 3EHQA 1OV3A 3U23A 4F16A 1UE9A 2BZYA 2FPDA 2ROLA 1YWOA 1CKBA 2K7AA 3PE0A 2KE9A 1WA7A 2ECZA 2J06A 1SSHA 4OMQA 3A98A 1GBQA 2DX1A 3R6NA 1UJYA 3VS6A 1K76A 2A36A 1JU5C 1ZX6A 3RBBB 2EQIA 1QKWA 1M3AA 2X3WD 1NYFA 2YDLA 3UF4A 2L2PA 4J9GA 5I22A 4K11A 3I9QA 3M0SA 1J3TA 1H3HA 2CT3A 3NPFA 1QLYA 3NGPA 1WIEA 2I0NA 2ROTA 4Z89A 1JEGA 2MIOA 1S1NA 3M0QA 1GFDA 1WFWA 1B07A 2W10A 4M4ZA 4RTVA 4CC7A 3I5SA 1AZEA 2HDAA 4ORZA 2E5KA 2AK5A 1WLPB 2K6DA 2F2WA 2K9GA 1PKTA 1NG2A 1SRLA 1QWFA 5FW9A 4AFZC 3PVLA 1M27C 1VYUA 2DRMA 1GCQC 5IXBA 2SEMA 3JV3A 2KRSA 2FO0A 1GCPA 1UTIA 2DBMA 3QWXX 4IIOA 4RTUA 2HCKA 3VS1A 1PWTA 2AKKA 3THKA 1T0HA 2J7IA 3ULRB 1ARKA 2YSQA 2KR3A 1UHFA 1E6GA 4DEYA 1Z9ZA 3EG0A 2L3QA 2ED1A 1KSWA 5EC7A 1RLPC 2GTJA 2DE0X 1UFFA 2ENMA 1JQQA 1MV3A 2RPNA 4LUEA 3UATA 4OMOA 2K3BA 2XMFA 1VA7A 1FMKA 2FRWA 2EGCA 5IHIA 1YP5A 2SRCA 1UHCA 1W70A 1M8MA 1QWEA 2RQTA 2KRNA 2OAWA 2H8HA 1Y57A 2RQWA 1E7OA 2CSIA 3REAB 2CDTA 4WCIA 1PKSA 1UECA 4AFSC 1AVZC 2EYWA 2VKNA 1G2BA 2V1QA 2BTTA 1PHTA 3EG1A 5IHNA 1AWJA 2G6FX 4JZ4A 2JS2A 1PRLC 1EFNA 2O2OA 1W1FA 1M3BA 2DYBA 1ABOA 2C0IA 2YUPA 2DILA 1ZUYA 1H8KA 3NHNA 4J9FA 1SHGA 2GGRA 2PTKA 2JM8A 2JM9A 3EGUA 2ABLA 1HJDA 1TG0A 1RLQC 5L23A 1VYTA 2FG0A 4RTZA 4LNPA 2M0YA 4A63B 1QCFA 2M51A 1WXUA 4FSSA 3SHWA 3M0RA 1OEBA 2VWFA 4JZ3A 4CC3A 2HSPA 5HCKA 1ABQA 4CC2A 1AWWA 1NEBA 1SHFA 4D8KA 2GBQA 1I07A 2DRKA 2A37A 2L3PA 2O88A 2AKLA 1SEMA 1U3OA 2JS0A 1B3QA 4AFQC 1GFCA 1X6GA 2O9VA 3VS4A 1ZBJA 2EW3A 1YNZA 2KYMA 1HD3A 1GCQA 3VS0A 2DL5A 2LCSA 2J6FA 2K2MA 2EYZA 2VVKA 4JJBA 2LNHB 2EVRA 4E6RA 4OMMA 2F2VA 1NLOC 1JO8A 2DMOA 2PZ1A 2CUBA 1HSQA 4Z8AA 4HCKA 1AOJA 2K79A 2DL3A 1AEYA 1AWOA 1X6BA 3VS5A 1CSKA 4AG2C 4JJCA 3VS2A 3EG2A 4RTTA 5I11A 3SEMA 1MUZA 3TSWA 4J9IA 1MV0B 4QT7A 4RTWA 3TSZA 2EPDA 2HBWA 1KFZA 1FYNA 2GNCA 1OPLA 1T3LA 4X1VA 2J6KA 2YUQA 4Z88A 2NUZA 2KT1A 3O5ZA 3ZL7C 1I1JA 2KEAA 3H0HA 2V1RA 2CT4A 2L0AA 4LE9A 2RQVA 2RNAA 1SPKA 1UGVA 4OMPA 1RI9A 4J9CA 1LCKA 1NM7A 3I5RA 4AFUC 3EG3A 2JMAA 1OPKA 1U06A 2W0ZA 2DF6A 2A08A 1NYGA 1T3SA 2CH4W 1BU1A 2X3XD 4CC4B 1TUCA 2GQIA 1UUEA 2KNBB 4RTXA 1H92A 1W6XA 2C0OA 3NMZC 2LQNA 2KROA 5IH2A 1M30A 1SRMA 2BZXA 2ED0A 2KRMA 2KYBA 1GBRA 2LJ0A 1K0XA 2DL7A 1ZUKA 1PNJA 2D8HA 3M0PA 2BZ8A 2D1XA 1WYXA 2RF0A 1NLPC 4LN2A 3LH5A 2DJQA 4RTYA 4F14A 4GBQA 2AZVA 3VS7A 5IHKA 1A0NB 1WDXA 2CUDA 1K9AA 3C0CA 3M0TA 2DVJA 2YUOA 2FPFA 4OMLA 2A28A 2RMOA 1K1ZA 2DLPA 1UJ0A 2KGTA 1E6HA 2EKHA 3H0IA 4HXJA 1X2QA 2LP5A 2JT4A 1UDLA 4IIMA 1BB9A 1ZUUA 2CSQA 4HVVA 1K0SA 2B86A 4HVWA 4J9EA 2O9SA 2DA9A
chains in the Genus database with same CATH superfamily
1D0XA 2MI6A 5FU7C 5KH6A 2KT8A 1VQMA 1N6AA 5DLOA 1UG1A 1K73R 2A0FB 3OS5A 5C0MA 3H41A 3CCQA 1PC0A 2YRCA 4DBRA 4M7AF 3AT1B 5CR2A 1QKXA 4Y92A 1SG5A 1X69A 5KCOA 5LJ3e 1N8RU 4M7DC 3DLMA 3TVTA 2V26A 2RH2A 4II1A 3G71A 1M90R 4PJOF 2DL4A 1YITA 1X43A 4A4EA 2LJ1A 2MCNA 2E4HA 1IHWA 4ZGJB 2CGHA 2J6OA 2DNUA 2JTEA 1VQ5T 3OYJA 1YIJQ 1N27A 3PMIA 1Q82R 2P4TA 3REBB 3L2QA 3MP8A 4DEXA 2D0NA 2LT1A 2BIVA 1OOTA 3A8MB 1K8AC 4IKFA 3CCJQ 4J9DA 2XDPA 3EHRA 1BI0A 3CC4T 3CCUT 2DXUA 1WHMA 2LJ3A 3CXCA 3CCVT 4OB3B 2CP6A 1YWPA 2NUPB 1QP3A 2JW4A 1GL5A 2KBTA 2RQRA 3FDRA 3CPWP 2V8IA 3CC2T 3OYYA 2RHZA 2L3SA 1NZ9A 2DBKA 4PJOC 5LL6S 3A8LB 2A3LA 1RAEB 2KY9A 5GAMe 2F5TX 4MMKA 4C5EA 3PNWC 1QVFS 2D9TA 5J39A 2DZCA 2K5IA 3RNJA 1K9MC 2Y4XA 1Q81C 4DOVA 3QZ9B 2RD1A 2XDBA 4DA4A 4KUDK 2GTOA 3VYGA 2P0KA 4BE2A 2LRQA 1VQKT 1S72Q 2QTVA 4JLGA 4HT8A 2CREA 1KD1U 1RADB 3EHQA 3GOXA 2RJCA 2FPDA 1H3ZA 2EJ9A 3EGXB 2DD5A 3JB9G 4EMKC 2K2VA 2VXEA 2ECZA 4RG8A 3CBMA 5J26A 5GMKh 3R6NA 2XI9A 2MYSA 1K76A 1ZX6A 1QQJA 2EQIA 3CC7A 2C06A 1M3AA 4OB0B 2YDLA 1LJOA 4KGXB 3JCMe 1UGSB 5KE2A 3HSBA 3QZ5B 1J3TA 5KYXB 1ZBXA 3WXMB 3JCMV 1WIEA 2I0NA 1VOMA 1S1NA 1F1BB 2K3XA 3HFNA 3OYGA 5D6XA 2JTFA 4L5GA 4ORZA 5CAIA 2DXBA 3MKDA 5A0GA 1WLPB 2M1HA 3HRSA 1VQMQ 4O6JA 1SRLA 2FZGB 5FW9A 3OYNA 2E3IA 3V7SA 3CCQQ 2HL3A 3R6OA 2DRMA 5I2SA 2SEMA 2FO0A 1GCPA 3QWXX 1SSFA 4RTUA 1XTDA 1N9RA 3T9NA 2MPXC 2AKKA 3THKA 4KT0E 2DIQA 2J7IA 4ANJA 1ARKA 3G71Q 1YITQ 1Q7YC 1Z9ZA 4M77B 1AT1B 1WHLA 3HRUA 2ZPGB 3EFOA 2O4XB 3I56T 2DE0X 4OMFB 2ENMA 2CP7A 1JQQA 1M1FA 4LUEA 4OMOA 2K4YA 2LVMA 1YP5A 2LC4A 1BIBA 4JLIA 2KRNA 5GAN7 2H8HA 3VUBA 3F70A 1KHIA 2XIDA 1E7OA 1XQHA 3RKYA 1KQSA 4PK4A 3REAB 3HRTA 3CCMA 5I21A 4J6XA 4WCIA 1UECA 2DTIA 4AFSC 5AT1B 5HK3A 1G2BA 3JB9D 1NJIU 3VUZA 1PHTA 5IHNA 1VIFA 1Q86R 1PSFA 2G6FX 1W2BP 1PRLC 2JS2A 1EFNA 3EG9B 1W1FA 1M3BA 2DO3A 3M59A 4LDYA 4LD9K 1JJ2P 1VQPA 2OAUA 3MPUB 1H8KA 1KC8C 2QQAA 4M78A 1D0YA 4PFOA 4VUBA 3A8OB 3UT1A 1WQWA 2ABLA 5GANe 3MEUA 2KSSA 3NTKA 5L23A 4C8QA 2FZCB 1QCFA 4OVAA 4FSSA 3S3OA 1OEBA 2VWFA 3G1JA 3MEWA 5HCKA 4DBFA 3QSUA 6AT1B 4D8KA 5GAOq 2GBQA 5CKEA 3J81E 1VQ8T 2AKLA 1U3OA 2QGGA 2X4YA 2O9VA 2EW3A 5I2MA 5CKFA 4KH0B 3OS1A 2KYMA 4NL3A 3VS0A 5LJ5f 2LCSA 4YTLA 2EYZA 1R8OB 3E1SA 1NLOC 1JO8A 4PFPA 2PU9B 1HSQA 3H6ZA 1K73C 1M2VA 3CBPA 3CC7Q 1D1CA 3LYIA 3CMEQ 5CIUA 5GAN2 5IT9E 1VQ4A 4AG2C 1CSKA 5M9OA 2VXFA 1N8RR 5D6WA 3EG2A 1M90C 5I11A 1D3BB 2RHIA 1Q95G 5LJ5h 2MK5A 5GMKm 2YRDA 2QEXA 3TSZA 2EPDA 2HBWA 2L89A 2RB6A 2QA4Q 1G3SA 4N0AC 1ACMB 3OYHA 2YUQA 2HQXA 1UB4A 1Q82C 4D6WA 2V1RA 1EZZB 2CT4A 2R5AA 8ATCB 2CZ7B 1OU8A 4B6MA 5HK0A 1UGVA 3RUXA 1V76A 4EDUA 2LTOA 5GAOl 1LCKA 4AFUC 1OPKA 4HKEA 4OF1A 1FWZA 2RHYA 1BU1A 5GANf 1TUCA 1IREB 1W6XA 1X75C 2ZPBB 3LWIA 2YRVA 4C0DB 1SRMA 2EYQA 2BZXA 2ED0A 4KUIA 2KRMA 2KYBA 4FCYA 5IAYA 1TWBA 2PUKB 1WJQA 2D8HA 1I5LA 2IVWA 1RAFB 3PMTA 2D1XA 2RK2A 2RF0A 2VGNA 1NLPC 1M4ZA 4L6V5 1X6OA 2QQRA 2WSFE 4F14A 2AZVA 1M5Q1 2CKKA 2KAFA 4XTWA 2X4XA 2QDYB 4JS4A 1BI2A 3M9QA 3FC3A 3P8HA 2YUOA 1PM3A 2A28A 3TEEA 3CCLT 2YLCA 2KI7A 1OULA 1IGUA 1X2QA 3CPWS 3GF5A 1VQPQ 1ZUUA 2CSQA 4HVVA 4J9EA 3MP1A 1U5SA 1XOVA 4A53A 1B7TA 5FWCA 2E5QA 2WACA 3PT9A 1Y0MA 2OTLA 3EFOB 3TU4K 1RUWA 2EYYA 3BW1A 4HCBA 3UA7A 1WI7A 4M78G 5KYWA 2Y90A 3CCRT 4C0GA 2LMJA 1YN8A 3VS3A 1YJWA 4C5GA 4LDUA 5FWBA 4RUGA 3TREA 5KYYA 5LJ5d 2HEQA 4LD6A 2YT6A 4C8QG 2P4RA 3H8ZA 4J6WA 3RKXA 4ZGEB 1QW1A 3HKSA 1NPPA 1JXOA 5GAN6 5FU6B 2EGAA 4M78E 3PVQA 3QWYA 1G5VA 2ZPIB 1R0BG 2KXCA 4PJNA 3G6EA 3PIOA 2FPEA 4C8QE 5CCAA 1IHVA 2DXCA 2D8JA 1M3CA 2F69A 4JRKA 3LW5E 4M78B 1PRMC 3IQLA 3O8VA 2K5FA 4A54A 3CCET 2P0PA 1VQ4Q 1D1BA 1IO6A 1B34A 4ZNXA 4C8QB 1KQSP 2NUTA 1Z9QA 1KJWA 1RABB 2QEXQ 1XJWB 2R58A 3ER0A 3I55A 2FVUA 4JRPA 2LZ6B 4ZGDB 5GJWB 2WSCE 1BBZA 2E10A 2QYZA 1FMVA 1TUDA 2DL8A 4J9HA 1YHQT 1Y96A 4PL6A 3MEAA 4F17A 2CZ0B 4M77A 3L1AA 3UA6A 1YI2Q 2ZPEB 3M4YA 1CKAA 1M2VB 2MF2A 4HT9A 1OI1A 2LCLA 4N4IA 1W2BA 1X2KA 1ZSZC 3U23A 4F16A 2P0QA 1UE9A 1JJ2A 3I56A 2ROLA 3GP8A 4M78D 1CKBA 3JCMP 3OW2A 3LWHA 2K7AA 1Q86C 2XD0A 4JDSA 5LJ5j 4O5VA 4M7DA 9ATCB 1SSHA 4NS5A 4OMQA 2R5MA 4C8QD 4IURA 1UJYA 1HXDA 2HZYA 1BIAA 4MZTA 1EIFA 4IUVA 4FYVB 1K8AU 2L2PA 4F04B 3EAEA 1RAHB 4J9GA 5I22A 4K11A 3I9QA 1H3HA 3EG9A 3QKJA 3G4ST 1QLYA 3NGPA 3LH0A 2MIOA 3M0QA 3RESA 1WFWA 1VIEA 2OTJT 4CC7A 1FXXA 2E65A 2W10A 4RTVA 2HDAA 1ZA1B 4ELYC 5HY6A 1BYMA 2K6DA 2F2WA 5GMKi 3CEYA 2K9GA 2OTLQ 1YI2T 1QWFA 3LGLA 3CMAQ 1VQ6A 2F1LA 3PVLA 4MDXA 2NYSA 3QUIA 1GCQC 3TQ7P 3GPLA 1LOJA 1YJ9A 5CKDA 3OS2A 4JUVA 4IIOA 1M8VA 4FYXB 2HCKA 2LNVA 2BE7D 4M75D 1YJWQ 1T0HA 3CBOA 3NTHA 2MAMA 2EQKA 4X9CA 2RM4A 1UHFA 4PJOA 4QQDA 1E6GA 4C92F 2L3QA 2X4WA 4FW2A 4M7AC 1KSWA 3CCSA 5DY9A 3SDZA 3L2ZA 2GTJA 2VC8A 1VQ7A 2RHXA 1N8RC 1QVGS 3QDRB 4RCBA 2EWNA 5GAN8 2K3BA 5C6SA 1U1TA 1OX8A 2GQVA 2HMAA 2XMFA 1JRIA 2ATCB 2PVOB 1TTHB 2FRWA 1RL2A 3S3MA 1QWEA 1R0CB 1WHJA 2K57A 4RG2A 1Y57A 2K3YA 2L8DA 3JCMJ 2F5KA 5FRNA 1D3BA 1YIJT 4JRQA 3CMAT 4PJLA 2V1QA 5KYWB 2BTTA 3CXCS 2YHTA 1QCNA 4EMKA 1ABOA 1MMDA 2C0IA 5KYYB 4C92C 3CCJT 4KBMB 5LJ3f 2PTKA 2BE9B 3WVEB 3EGUA 3BDUA 2WSEE 1RLQC 2MWOA 1XNIA 4EMGA 1VYTA 1IZ6A 2FG0A 4LNPA 4BE0A 2FB7A 1BCMA 2X4JA 2NLUA 4JZ3A 4CC3A 1PCXA 1WPYA 1Y7XA 4PJMA 3C4SA 1ABQA 3MP6A 4FYWB 2E6ZA 2L5QA 1AWWA 1I07A 3JCMW 2HD0A 2A37A 2XDDA 4M77G 3JSCA 1SEMA 4MZPA 4AFQC 1GFCA 1X6GA 3VS4A 2COYA 5LJ3h 3MJXA 1Q7YU 1MNEA 4HCZA 4GY5A 4XTVA 8AT1B 4JJBA 2LNHB 1B34B 5DM7R 2GFUA 2YLBA 2VV5A 3HL8A 4E6RA 2NUTB 2PZ1A 4M77E 5GAN5 1KHCA 3VKIA 4A4HA 4Z8AA 1S72T 4C5HA 2KMTA 1VQLA 4HCKA 4M7DG 3GIBA 2PVGB 2L3RA 3JCMb 5FRMA 1Y96B 3QHSA 5GAMf 3OA6A 1VQOA 4ZTFA 3TSWA 3FRNA 4Y28E 1DJ7B 1MGQA 2BKDN 3OBWA 4J7IA 1FYNA 4M7DE 4DQ2A 2GNCA 1OPLA 3VYHB 1T3LA 1VQ6Q 4X1VA 2EJGA 4Z88A 2NUZA 3O5ZA 3ZL7C 1I1JA 5FU7B 2KEAA 4UC4A 4IUUA 4C5IA 1YJ9Q 4FYYB 3META 1D1AA 2RQVA 4OMPA 1UGRB 3OMCA 3M55A 3BY7A 4PJJA 1I81A 1R77A 2DF6A 4R56A 4M7DB 3M56A 4IUPA 5KE3A 5GAMh 1YBYA 4ZN1A 4DBQA 4XTUA 1VQMT 3OYCA 3RERA 1BI3A 1M30A 1VQ7Q 3CCQT 1U1SA 4PJOG 4BDYA 5FLXE 2D0QB 4DOWA 1GBRA 1U8RA 2LJ0A 1RI0A 1ZUKA 2E12A 3MO8A 1VQNA 4XU0A 3KUFA 4Z02A 4X9DA 3JCMf 3OW2P 2KQWA 3G71T 1WYXA 4JRIA 2RA2A 1YITT 3CD6A 3A8HB 1KG1A 3ZEHA 4M77D 2IG0A 2FZKB 2QASA 1WDXA 1SF9A 4MMLA 4PJOE 1VQ9A 3CPFA 2RI5A 3C0CA 5LJ3d 4OMLA 1K73U 4MZMA 4RKUE 1K1ZA 2DLPA 4M7AB 1YJNA 1C1AA 4E7ZA 2LP5A 2JT4A 1UDLA 1BB9A 1K0SA 4J8OA 2O9SA 4PJOB 2DA9A 1KQSS 2DD4A 2OJ2A 2JMCA 4JPBW 1T0JA 3JCMh 3JCMc 1M90U 4M7DD 4PFZA 4BI3A 3X25B 3AHUA 2DERA 2DK3A 3VRYA 2DM1A 3QO3A 2VASA 1LVKA 4M75F 1WX6A 4BI8B 1I0CA 4QVZA 4F7UF 2OX7A 4C0FA 1N5ZA 1KIKA 1Q82U 1AWXA 2X9HA 3MCAB 2E1HA 3RIRA 3GBQA 2LX7A 5LJ5g 1AZGB 1ZLMA 1I8FA 4QVCA 2CZ6B 4N0AA 3DB4A 4R0KA 1JXMA 5IXFA 2RJDA 2M16A 4AG1C 2FL7A 2DXTA 1K4US 4PNOA 2EGEA 2EKOA 1WJRA 4ZN3A 4GLMA 1AD5A 1HYOA 4EMKB 1PG5B 4JJDA 4JJNK 1M1KU 5GAMd 1VQLQ 2KXDA 1WXBA 3PFSA 3L2RA 1TXQA 1C6VX 4XAXB 2LQ8A 1GRIA 4IUQA 3QDFA 4OMNA 2RQUA 2ZPFB 4PJOD 1WXTA 2Y4YA 5KYUA 2LQWA 2JXBA 2O31A 3MHXA 3FEOA 3L2WA 1M1GA 1VQOQ 1MMAA 1SKUB 3A1PA 3LX7A 3CQTA 4J5YA 1NEGA 2QDLA 1IXDA 4J83A 1TOVA 1VQ5A 2OI3A 2YUNA 5LJ3j 3CC7T 2E3HA 4R55A 3CMET 2DEQA 4BACA 2FEIA 1G83A 4XTYA 3LGFA 1ZSGA 1QMCA 3FB9A 4E7HA 3E9GA 2QQBA 2AT1B 2NWMA 3NTIA 1WZOA 3CC4A 3CCUA 2DYIA 3M54A 2XG8D 1I4K1 5GANh 4E7SA 3OSVA 1X27A 3HTRA 4D8DA 2QA4T 3I35A 3CCVA 4B9XA 3JCMd 3CCMQ 5GAOn 1QCOA 1FX7A 1YWOA 2R57A 3GNGA 3CC2A 2V8JA 3SWNC 1VQNQ 4LDXA 1WA7A 2MWPA 1KD1R 2DEUA 3X26B 3VS6A 1W4SA 4XQ3A 4PKCC 1UGPB 1QKWA 2X3WD 2G3RA 3UF4A 2XHCA 3RMQA 1WJSA 1VQ9Q 3M0SA 3OYDA 2CT3A 3NPFA 1YJNQ 4Z89A 2ROTA 1JEGA 3VJPA 3Q1JA 1GFDA 4HCCA 2VYTA 2QK0A 4M4ZA 3I5SA 5GAMj 1AZEA 1VQKA 3JCMQ 3JB9I 2E5KA 3QIIA 3P8DA 3E19A 4A4FA 3OBYA 4BUGA 2QI2A 1VYUA 1WHHA 3QBYA 2QQSA 5L8RE 2KRSA 4OB2B 4E7KA 4E2FB 1PWTA 3CCMT 1LNXA 2B8AA 3QG1A 5CKBA 3ULRB 1WHGA 1D0ZA 2LT4A 3S3NA 4L59A 1TUGB 5A0LA 1VQPT 3DKMA 3JB9F 2CP0A 2GF7A 5EC7A 1UEBA 3V7RA 1UFFA 1OQKA 2RPNA 3UATA 1VUBA 1VA7A 5J3BA 4M77F 1FMKA 5CQXA 2EGCA 2JUFA 2RQTA 2DIGA 5GANd 2PVDB 2CSIA 4FL6A 1ZSZA 2LQKA 2DAQA 2CDTA 4ELZC 2FYKA 1AVZC 3V8LA 3OMGA 2LX9A 3KXTA 3VU3C 2RI3A 2DPPB 1OU9A 2DYBA 2RK1A 2YUPA 1H641 1PD0A 1HK9A 4GLKA 1VQ5Q 2V8KA 3ZBDA 2JM8A 1TG0A 1NJIR 1IGQA 4TVRA 4FIBA 1TSFA 4BI4A 1VQ4T 4A63B 1WXUA 3H9NA 3SHWA 5GAOm 3CC4Q 1OZ2A 4CC2A 2DZ9A 1NEBA 2HL5C 2QEXT 3OYKA 1C0MA 3CCVQ 1KQ2A 1G3YA 3OYAA 5GMKe 2JOYA 4QKUA 2Z0WA 4LDWA 1GCQA 3CC2Q 2DL5A 5KYUB 2DTHA 2K2MA 2DETA 2EVRA 2HKNA 4OMMA 1IB8A 5A0DA 1W2BS 3PGGA 1O9SA 2CUBA 3V8KA 3HFOA 4NOYA 1JJ2S 3BFMA 1QVGA 3OYMA 5GAN4 3OW2S 4M7AA 2DL3A 4XU2A 1AEYA 1M2OA 1AWOA 3M5AA 2CYZB 3M53A 3C95A 3OYLA 3VS5A 3DB3A 3X24B 1K9MU 1MUZA 1Q81U 1VQKQ 5GANj 1QVFA 2KVQG 1KFZA 1VQ8A 4BD3A 3SWNB 3OYFA 3ME9A 1TH7A 2J6KA 2KT1A 3G6EQ 3SFMA 1PSEA 1RI9A 4J9CA 2ZAEA 1NM7A 3EG3A 2JMAA 1U06A 3RMSA 4QQ6A 2A08A 5IN1A 2AIRB 2CH4W 4BE1A 3GLXA 1M1KR 5KYNA 4ATOA 1UUEA 4C92A 4RTXA 1H92A 3NMZC 2LQNA 2OTLT 2KROA 5IH2A 1RAGB 2JZ2A 1MHNA 2LDMA 2HNIA 4QVDA 2DJZA 3I55Q 3KBGA 1K0XA 3RKWA 2DL7A 1NE8A 1PNJA 4P5NA 1AHJB 1YJWT 1OYXA 2VUBA 4E7LA 4LN2A 2DJQA 4RTYA 1BKBA 4GBQA 3VS7A 5IHKA 2IPOB 5CKHA 4C0ZA 4IUTA 2CUDA 3M0TA 2CP3A 2E6NA 2FPFA 3E9FA 1G3WA 2KGTA 4LXCA 1E6HA 5LJ3g 3G6ET 3S6WA 4J6YA 5GMKl 3X28B 2HQHA 4DBHA 3OQ5A 3VV0A 4HVWA 3UPUA 3DLLA 1RACB 3I56Q 2ZCFB 5GAOp 3PTAA 4OGCA 3FIFA 3NFCA 3JAME 2HSEB 2XKOC 3FJ5A 1BK2A 1OX9A 4ME7A 2E70A 1PD1A 2O01E 4HVUA 3ZFJA 1G3TA 1LPLA 1V1CA 4QQGA 3CMEA 4OP0A 4XTZA 1WQ7A 2I2LA 1ZA2B 4AMCA 3QYHB 1KD1C 3V7CA 3KFVA 2X35A 3I55T 2PQWA 2QQ9A 4LUDA 4KH1B 2M0OA 3UDCA 4C0DC 3H0FA 3WVDB 2EIFA 2QA4A 1O75A 2JN0A 3CCLA 1ZSZB 4FM4B 4EMHA 4KRTA 3VRZA 2P84A 1QVPA 2MOXA 4NL2A 2ZGWA 3QYGB 2F2XA 2PNIA 5CK9A 3EFSA 2M9UA 5ECAA 2XICA 2IIMA 2EQUA 5LJ5e 5GJVB 2EBPA 2RN8A 5DLQE 1KC8U 2C0TA 5GAMg 3SD4A 3QXEB 2QTXA 3J7AF 3LLRA 3CCRA 4M7AG 2FRYA 2J05A 4CRIA 3CCSQ 4KULA 2CH4A 4XTXA 5CO7A 1YFNA 1VYVA 3V8JA 1VQ8Q 4M78F 5GAOr 5D6YA 4RCCA 2MMPA 2LCCA 2CZ1B 4XU3A 5CVIA 2DTOA 1YCSB 3HPWA 5EG2A 3BDLA 3EH1A 4KGZB 1NPRA 2RI2A 4C8QF 3EGDA 5KCHA 4M7AE 4BDZA 3OYEA 3QPHA 1KQ1A 1OZ3A 3M0UA 2EYXA 2ESWA 4ESRA 4EIKA 2XU8A 5FU6C 2CS7A 2GCXA 1MNDA 2EQMA 4J9BA 2AZSA 2ZPHB 1VQ6T 4Y91A 1OV3A 1QP2A 2QG9B 2BZYA 3CCEA 3JCMg 2JJ9A 1ZQ1A 1YJ9T 4WF2A 4C92G 2FHDA 3PE0A 2KE9A 2J06A 2QXFA 1Y07A 4A4GA 2X51A 2H3JA 4M78C 3A98A 1GBQA 2DX1A 4X34A 3L2VA 1JU5C 2A36A 4E7JA 3GNFB 3RBBB 1NJIC 3CCST 1NYFA 3X20B 4E47A 4C92E 1QVGP 3M58A 3SB2A 4C8QC 3OS0A 4PLLA 3JCMX 1VQ7T 2E64A 1YHQA 2XK0A 2K5LA 3L42A 1WGSA 1B07A 4FT2A 1RAAB 2YXYA 1K8AR 2AK5A 1NG2A 1PKTA 4C92B 1QVFP 4AFZC 3HHTB 1M27C 4J7FA 5IXBA 3JV3A 1UTIA 2DBMA 3JB9J 4M75A 3TCJA 3VS1A 4M7AD 4F7UA 3CXCP 3EFRA 2RHUA 2YSQA 2KR3A 4DEYA 3A5ZB 3EG0A 2ED1A 1BCOA 4LDVA 2M02A 3P8BB 2QGFB 4M75C 2GFAA 2E41A 1RLPC 4RMOA 3CCLQ 4FSXA 1MV3A 3G4SA 2EAYA 1P92A 2JVVA 4BY6C 1NBEB 3MEVA 1WHKA 1WNLA 2OTJA 1Y71A 4HA8A 1K9MR 1Q81R 5GAN3 5IHIA 2SRCA 4E7IA 1UHCA 1W70A 4FW1A 1M8MA 2OAWA 2YWWA 1YI2A 5GMKj 3CPWA 2RQWA 4MDWA 5GANg 3M4GA 1FMWA 4C92D 3CCRQ 2KK4A 1PKSA 2EYWA 2VKNA 3OYIA 3EG1A 3SWNA 1AWJA 5A2QE 3OYBA 4JZ4A 2O2OA 1M1KC 3UWNA 2RJFA 2DILA 1ZUYA 3NHNA 1BI1A 1RAIB 4ZTJA 4J9FA 1SHGA 2GGRA 2QAZA 2JM9A 1VQLT 3QJYA 5AYFA 1MMNA 1HJDA 2NUPA 4QW2A 4RTZA 2M0YA 2M51A 3URGA 3M57A 3CD6Q 3BE3A 2BUDA 3M0RA 3OSSC 2HSPA 4OGEA 1VQOT 1SHFA 3HP9A 4CI0C 2DRKA 3C94A 2L3PA 2O88A 3C12A 3JB9H 2JS0A 1B3QA 1D09B 3CCEQ 1ZBJA 1YIJA 1YNZA 1HD3A 3CMAA 2J6FA 3J80E 2VVKA 3N5BB 1YCYA 2F2VA 1IRXA 2DMOA 3CCJA 3INZA 1M9SA 3FLGA 1Q7YR 2RJEA 4OB1B 1AOJA 2DKGA 2K79A 4PLIA 1X01A 1ZHIA 3OY9A 1YHQQ 2D6FA 1V29B 1X6BA 2VGMA 3EGXA 3EGDB 4JJCA 3RDVA 3VS2A 2HKQB 4FU6A 2VB6A 2JNGA 4WTOB 4RTTA 5FROA 3SEMA 4Q5WA 1VQNT 4N4GA 1KK7A 4J9IA 1MV0B 2PUOB 4QT7A 2HAXA 3G7ZA 4RTWA 3CD6T 1TS9A 1EX4A 3ASKA 4BB7A 3EH2A 3E2UA 4JS5A 2COZA 2ZZDA 3H0HA 5KYXA 7AT1B 2L0AA 1VQ9T 2CP5A 5D7UA 4LE9A 2RNAA 4A4KA 2DFUA 1SPKA 3QJ6A 1MMGA 3I5RA 4B9WA 4N4HA 1YJNT 2A7YA 1Q86U 3A8GB 2W0ZA 2H3EB 1NYGA 1T3SA 1JBMA 2AHJB 2X3XD 4AT1B 4CC4B 1S72A 4M75G 2GQIA 4V2SA 4FT4A 4F7UG 2KNBB 1KC8R 3D7SB 1I5OB 2C0OA 2HQEA 5CQYA 1N9SA 4XU1A 3G4SQ 3PIPA 2KDSA 4KGVB 2COWA 2EQJA 4M7DF 2OTJQ 4EPCA 2CP2A 2DVEA 1UGQB 3M0PA 4M75E 2BZ8A 4F7UE 3RR6A 3LH5A 2O4XA 1A0NB 1JB0E 2HBPA 1K9AA 2EJFA 2DVJA 3OB9A 2RMOA 4XK8E 4M77C 2RO0A 1UJ0A 3CCUQ 1TU0B 4M75B 2EKHA 1GXIE 3H0IA 4HXJA 4F7UB 5HKCA 3JRZA 3L2UA 2EFIA 4IIMA 1G8XA 2JTMA 2B86A 4BY6B 3FJPA
chains in the Genus database with same CATH topology
2OJ2A 2JMCA 4JPBW 1T0JA 1U5SA 1XOVA 2KT8A 5FWCA 1UG1A 1Y0MA 3FJ5A 1BK2A 1RUWA 2EYYA 3H41A 3VRYA 2DM1A 4HVUA 1WX6A 3UA7A 1I0CA 1QKXA 1V1CA 4Y92A 1X69A 1WI7A 1N5ZA 1KIKA 3TVTA 2LMJA 1YN8A 3VS3A 1AWXA 5FWBA 3KFVA 4RUGA 2DL4A 1X43A 2HEQA 3GBQA 2YT6A 2LJ1A 2P4RA 2LX7A 4LUDA 2MCNA 1AZGB 1ZLMA 1JXOA 3H0FA 2J6OA 2DNUA 2JTEA 2EGAA 4R0KA 1JXMA 3PVQA 5IXFA 3QWYA 3REBB 4AG1C 4KRTA 3VRZA 2KXCA 1K4US 2MOXA 2F2XA 2EGEA 4DEXA 2FPEA 2D0NA 2PNIA 1OOTA 4GLMA 1AD5A 4J9DA 3EHRA 2D8JA 1M3CA 5ECAA 2IIMA 4JJDA 5GJVB 2EBPA 2LJ3A 2KXDA 2RN8A 1WXBA 1PRMC 2C0TA 1GRIA 3IQLA 1YWPA 4OMNA 2RQUA 1WXTA 2LQWA 2JW4A 2JXBA 1IO6A 2O31A 1GL5A 2KBTA 2RQRA 4ZNXA 2FRYA 2L3SA 1Z9QA 2J05A 1KJWA 2DBKA 2CH4A 1VYVA 3CQTA 2LZ6B 1NEGA 2QDLA 2OI3A 2YUNA 5GJWB 1YCSB 1BBZA 2FEIA 1G83A 1TUDA 2DL8A 1ZSGA 4J9HA 4F17A 3RNJA 3M0UA 2EYXA 3UA6A 2ESWA 2NWMA 2GTOA 4ESRA 4EIKA 1X27A 4J9BA 4D8DA 1CKAA 3I35A 2AZSA 2CREA 1X2KA 3EHQA 1OV3A 3U23A 4F16A 1UE9A 2BZYA 2FPDA 2ROLA 1YWOA 1CKBA 2K7AA 3PE0A 2KE9A 1WA7A 2ECZA 2J06A 1SSHA 4OMQA 3A98A 1GBQA 2DX1A 3R6NA 1UJYA 3VS6A 1K76A 2A36A 1JU5C 1ZX6A 3RBBB 2EQIA 1QKWA 1M3AA 2X3WD 1NYFA 2YDLA 3UF4A 2L2PA 4J9GA 5I22A 4K11A 3I9QA 3M0SA 1J3TA 1H3HA 2CT3A 3NPFA 1QLYA 3NGPA 1WIEA 2I0NA 2ROTA 4Z89A 1JEGA 2MIOA 1S1NA 3M0QA 1GFDA 1WFWA 1B07A 2W10A 4M4ZA 4RTVA 4CC7A 3I5SA 1AZEA 2HDAA 4ORZA 2E5KA 2AK5A 1WLPB 2K6DA 2F2WA 2K9GA 1PKTA 1NG2A 1SRLA 1QWFA 5FW9A 4AFZC 3PVLA 1M27C 1VYUA 2DRMA 1GCQC 5IXBA 2SEMA 3JV3A 2KRSA 2FO0A 1GCPA 1UTIA 2DBMA 3QWXX 4IIOA 4RTUA 2HCKA 3VS1A 1PWTA 2AKKA 3THKA 1T0HA 2J7IA 3ULRB 1ARKA 2YSQA 2KR3A 1UHFA 1E6GA 4DEYA 1Z9ZA 3EG0A 2L3QA 2ED1A 1KSWA 5EC7A 1RLPC 2GTJA 2DE0X 1UFFA 2ENMA 1JQQA 1MV3A 2RPNA 4LUEA 3UATA 4OMOA 2K3BA 2XMFA 1VA7A 1FMKA 2FRWA 2EGCA 5IHIA 1YP5A 2SRCA 1UHCA 1W70A 1M8MA 1QWEA 2RQTA 2KRNA 2OAWA 2H8HA 1Y57A 2RQWA 1E7OA 2CSIA 3REAB 2CDTA 4WCIA 1PKSA 1UECA 4AFSC 1AVZC 2EYWA 2VKNA 1G2BA 2V1QA 2BTTA 1PHTA 3EG1A 5IHNA 1AWJA 2G6FX 4JZ4A 2JS2A 1PRLC 1EFNA 2O2OA 1W1FA 1M3BA 2DYBA 1ABOA 2C0IA 2YUPA 2DILA 1ZUYA 1H8KA 3NHNA 4J9FA 1SHGA 2GGRA 2PTKA 2JM8A 2JM9A 3EGUA 2ABLA 1HJDA 1TG0A 1RLQC 5L23A 1VYTA 2FG0A 4RTZA 4LNPA 2M0YA 4A63B 1QCFA 2M51A 1WXUA 4FSSA 3SHWA 3M0RA 1OEBA 2VWFA 4JZ3A 4CC3A 2HSPA 5HCKA 1ABQA 4CC2A 1AWWA 1NEBA 1SHFA 4D8KA 2GBQA 1I07A 2DRKA 2A37A 2L3PA 2O88A 2AKLA 1SEMA 1U3OA 2JS0A 1B3QA 4AFQC 1GFCA 1X6GA 2O9VA 3VS4A 1ZBJA 2EW3A 1YNZA 2KYMA 1HD3A 1GCQA 3VS0A 2DL5A 2LCSA 2J6FA 2K2MA 2EYZA 2VVKA 4JJBA 2LNHB 2EVRA 4E6RA 4OMMA 2F2VA 1NLOC 1JO8A 2DMOA 2PZ1A 2CUBA 1HSQA 4Z8AA 4HCKA 1AOJA 2K79A 2DL3A 1AEYA 1AWOA 1X6BA 3VS5A 1CSKA 4AG2C 4JJCA 3VS2A 3EG2A 4RTTA 5I11A 3SEMA 1MUZA 3TSWA 4J9IA 1MV0B 4QT7A 4RTWA 3TSZA 2EPDA 2HBWA 1KFZA 1FYNA 2GNCA 1OPLA 1T3LA 4X1VA 2J6KA 2YUQA 4Z88A 2NUZA 2KT1A 3O5ZA 3ZL7C 1I1JA 2KEAA 3H0HA 2V1RA 2CT4A 2L0AA 4LE9A 2RQVA 2RNAA 1SPKA 1UGVA 4OMPA 1RI9A 4J9CA 1LCKA 1NM7A 3I5RA 4AFUC 3EG3A 2JMAA 1OPKA 1U06A 2W0ZA 2DF6A 2A08A 1NYGA 1T3SA 2CH4W 1BU1A 2X3XD 4CC4B 1TUCA 2GQIA 1UUEA 2KNBB 4RTXA 1H92A 1W6XA 2C0OA 3NMZC 2LQNA 2KROA 5IH2A 1M30A 1SRMA 2BZXA 2ED0A 2KRMA 2KYBA 1GBRA 2LJ0A 1K0XA 2DL7A 1ZUKA 1PNJA 2D8HA 3M0PA 2BZ8A 2D1XA 1WYXA 2RF0A 1NLPC 4LN2A 3LH5A 2DJQA 4RTYA 4F14A 4GBQA 2AZVA 3VS7A 5IHKA 1A0NB 1WDXA 2CUDA 1K9AA 3C0CA 3M0TA 2DVJA 2YUOA 2FPFA 4OMLA 2A28A 2RMOA 1K1ZA 2DLPA 1UJ0A 2KGTA 1E6HA 2EKHA 3H0IA 4HXJA 1X2QA 2LP5A 2JT4A 1UDLA 4IIMA 1BB9A 1ZUUA 2CSQA 4HVVA 1K0SA 2B86A 4HVWA 4J9EA 2O9SA 2DA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OJ2 A;  2JMC A;  4JPB W;  1T0J A;  1U5S A;  1XOV A;  2KT8 A;  5FWC A;  1UG1 A;  1Y0M A;  3FJ5 A;  1BK2 A;  1RUW A;  2EYY A;  3H41 A;  3VRY A;  2DM1 A;  4HVU A;  1WX6 A;  3UA7 A;  1I0C A;  1QKX A;  1V1C A;  4Y92 A;  1X69 A;  1WI7 A;  1N5Z A;  1KIK A;  3TVT A;  2LMJ A;  1YN8 A;  3VS3 A;  1AWX A;  5FWB A;  3KFV A;  4RUG A;  2DL4 A;  1X43 A;  2HEQ A;  3GBQ A;  2YT6 A;  2LJ1 A;  2P4R A;  2LX7 A;  4LUD A;  2MCN A;  1AZG B;  1ZLM A;  1JXO A;  3H0F A;  2J6O A;  2DNU A;  2JTE A;  2EGA A;  4R0K A;  1JXM A;  3PVQ A;  5IXF A;  3QWY A;  3REB B;  4AG1 C;  4KRT A;  3VRZ A;  2KXC A;  1K4U S;  2MOX A;  2F2X A;  2EGE A;  4DEX A;  2FPE A;  2D0N A;  2PNI A;  1OOT A;  4GLM A;  1AD5 A;  4J9D A;  3EHR A;  2D8J A;  1M3C A;  5ECA A;  2IIM A;  4JJD A;  5GJV B;  2EBP A;  2LJ3 A;  2KXD A;  2RN8 A;  1WXB A;  1PRM C;  2C0T A;  1GRI A;  3IQL A;  1YWP A;  4OMN A;  2RQU A;  1WXT A;  2LQW A;  2JW4 A;  2JXB A;  1IO6 A;  2O31 A;  1GL5 A;  2KBT A;  2RQR A;  4ZNX A;  2FRY A;  2L3S A;  1Z9Q A;  2J05 A;  1KJW A;  2DBK A;  2CH4 A;  1VYV A;  3CQT A;  2LZ6 B;  1NEG A;  2QDL A;  2OI3 A;  2YUN A;  5GJW B;  1YCS B;  1BBZ A;  2FEI A;  1G83 A;  1TUD A;  2DL8 A;  1ZSG A;  4J9H A;  4F17 A;  3RNJ A;  3M0U A;  2EYX A;  3UA6 A;  2ESW A;  2NWM A;  2GTO A;  4ESR A;  4EIK A;  1X27 A;  4J9B A;  4D8D A;  1CKA A;  3I35 A;  2AZS A;  2CRE A;  1X2K A;  3EHQ A;  1OV3 A;  3U23 A;  4F16 A;  1UE9 A;  2BZY A;  2FPD A;  2ROL A;  1YWO A;  1CKB A;  2K7A A;  3PE0 A;  2KE9 A;  1WA7 A;  2ECZ A;  2J06 A;  1SSH A;  4OMQ A;  3A98 A;  1GBQ A;  2DX1 A;  3R6N A;  1UJY A;  3VS6 A;  1K76 A;  2A36 A;  1JU5 C;  1ZX6 A;  3RBB B;  2EQI A;  1QKW A;  1M3A A;  2X3W D;  1NYF A;  2YDL A;  3UF4 A;  2L2P A;  4J9G A;  5I22 A;  4K11 A;  3I9Q A;  3M0S A;  1J3T A;  1H3H A;  2CT3 A;  3NPF A;  1QLY A;  3NGP A;  1WIE A;  2I0N A;  2ROT A;  4Z89 A;  1JEG A;  2MIO A;  1S1N A;  3M0Q A;  1GFD A;  1WFW A;  1B07 A;  2W10 A;  4M4Z A;  4RTV A;  4CC7 A;  3I5S A;  1AZE A;  2HDA A;  4ORZ A;  2E5K A;  2AK5 A;  1WLP B;  2K6D A;  2F2W A;  2K9G A;  1PKT A;  1NG2 A;  1SRL A;  1QWF A;  5FW9 A;  4AFZ C;  3PVL A;  1M27 C;  1VYU A;  2DRM A;  1GCQ C;  5IXB A;  2SEM A;  3JV3 A;  2KRS A;  2FO0 A;  1GCP A;  1UTI A;  2DBM A;  3QWX X;  4IIO A;  4RTU A;  2HCK A;  3VS1 A;  1PWT A;  2AKK A;  3THK A;  1T0H A;  2J7I A;  3ULR B;  1ARK A;  2YSQ A;  2KR3 A;  1UHF A;  1E6G A;  4DEY A;  1Z9Z A;  3EG0 A;  2L3Q A;  2ED1 A;  1KSW A;  5EC7 A;  1RLP C;  2GTJ A;  2DE0 X;  1UFF A;  2ENM A;  1JQQ A;  1MV3 A;  2RPN A;  4LUE A;  3UAT A;  4OMO A;  2K3B A;  2XMF A;  1VA7 A;  1FMK A;  2FRW A;  2EGC A;  5IHI A;  1YP5 A;  2SRC A;  1UHC A;  1W70 A;  1M8M A;  1QWE A;  2RQT A;  2KRN A;  2OAW A;  2H8H A;  1Y57 A;  2RQW A;  1E7O A;  2CSI A;  3REA B;  2CDT A;  4WCI A;  1PKS A;  1UEC A;  4AFS C;  1AVZ C;  2EYW A;  2VKN A;  1G2B A;  2V1Q A;  2BTT A;  1PHT A;  3EG1 A;  5IHN A;  1AWJ A;  2G6F X;  4JZ4 A;  2JS2 A;  1PRL C;  1EFN A;  2O2O A;  1W1F A;  1M3B A;  2DYB A;  1ABO A;  2C0I A;  2YUP A;  2DIL A;  1ZUY A;  1H8K A;  3NHN A;  4J9F A;  1SHG A;  2GGR A;  2PTK A;  2JM8 A;  2JM9 A;  3EGU A;  2ABL A;  1HJD A;  1TG0 A;  1RLQ C;  5L23 A;  1VYT A;  2FG0 A;  4RTZ A;  4LNP A;  2M0Y A;  4A63 B;  1QCF A;  2M51 A;  1WXU A;  4FSS A;  3SHW A;  3M0R A;  1OEB A;  2VWF A;  4JZ3 A;  4CC3 A;  2HSP A;  5HCK A;  1ABQ A;  4CC2 A;  1AWW A;  1NEB A;  1SHF A;  4D8K A;  2GBQ A;  1I07 A;  2DRK A;  2A37 A;  2L3P A;  2O88 A;  2AKL A;  1SEM A;  1U3O A;  2JS0 A;  1B3Q A;  4AFQ C;  1GFC A;  1X6G A;  2O9V A;  3VS4 A;  1ZBJ A;  2EW3 A;  1YNZ A;  2KYM A;  1HD3 A;  1GCQ A;  3VS0 A;  2DL5 A;  2LCS A;  2J6F A;  2K2M A;  2EYZ A;  2VVK A;  4JJB A;  2LNH B;  2EVR A;  4E6R A;  4OMM A;  2F2V A;  1NLO C;  1JO8 A;  2DMO A;  2PZ1 A;  2CUB A;  1HSQ A;  4Z8A A;  4HCK A;  1AOJ A;  2K79 A;  2DL3 A;  1AEY A;  1AWO A;  1X6B A;  3VS5 A;  1CSK A;  4AG2 C;  4JJC A;  3VS2 A;  3EG2 A;  4RTT A;  5I11 A;  3SEM A;  1MUZ A;  3TSW A;  4J9I A;  1MV0 B;  4QT7 A;  4RTW A;  3TSZ A;  2EPD A;  2HBW A;  1KFZ A;  1FYN A;  2GNC A;  1OPL A;  1T3L A;  4X1V A;  2J6K A;  2YUQ A;  4Z88 A;  2NUZ A;  2KT1 A;  3O5Z A;  3ZL7 C;  1I1J A;  2KEA A;  3H0H A;  2V1R A;  2CT4 A;  2L0A A;  4LE9 A;  2RQV A;  2RNA A;  1SPK A;  1UGV A;  4OMP A;  1RI9 A;  4J9C A;  1LCK A;  1NM7 A;  3I5R A;  4AFU C;  3EG3 A;  2JMA A;  1OPK A;  1U06 A;  2W0Z A;  2DF6 A;  2A08 A;  1NYG A;  1T3S A;  2CH4 W;  1BU1 A;  2X3X D;  4CC4 B;  1TUC A;  2GQI A;  1UUE A;  2KNB B;  4RTX A;  1H92 A;  1W6X A;  2C0O A;  3NMZ C;  2LQN A;  2KRO A;  5IH2 A;  1M30 A;  1SRM A;  2BZX A;  2ED0 A;  2KRM A;  2KYB A;  1GBR A;  2LJ0 A;  1K0X A;  2DL7 A;  1ZUK A;  1PNJ A;  2D8H A;  3M0P A;  2BZ8 A;  2D1X A;  1WYX A;  2RF0 A;  1NLP C;  4LN2 A;  3LH5 A;  2DJQ A;  4RTY A;  4F14 A;  4GBQ A;  2AZV A;  3VS7 A;  5IHK A;  1A0N B;  1WDX A;  2CUD A;  1K9A A;  3C0C A;  3M0T A;  2DVJ A;  2YUO A;  2FPF A;  4OML A;  2A28 A;  2RMO A;  1K1Z A;  2DLP A;  1UJ0 A;  2KGT A;  1E6H A;  2EKH A;  3H0I A;  4HXJ A;  1X2Q A;  2LP5 A;  2JT4 A;  1UDL A;  4IIM A;  1BB9 A;  1ZUU A;  2CSQ A;  4HVV A;  1K0S A;  2B86 A;  4HVW A;  4J9E A;  2O9S A;  2DA9 A; 
#chains in the Genus database with same CATH topology
 1D0X A;  2MI6 A;  5FU7 C;  5KH6 A;  2KT8 A;  1VQM A;  1N6A A;  5DLO A;  1UG1 A;  1K73 R;  2A0F B;  3OS5 A;  5C0M A;  3H41 A;  3CCQ A;  1PC0 A;  2YRC A;  4DBR A;  4M7A F;  3AT1 B;  5CR2 A;  1QKX A;  4Y92 A;  1SG5 A;  1X69 A;  5KCO A;  5LJ3 e;  1N8R U;  4M7D C;  3DLM A;  3TVT A;  2V26 A;  2RH2 A;  4II1 A;  3G71 A;  1M90 R;  4PJO F;  2DL4 A;  1YIT A;  1X43 A;  4A4E A;  2LJ1 A;  2MCN A;  2E4H A;  1IHW A;  4ZGJ B;  2CGH A;  2J6O A;  2DNU A;  2JTE A;  1VQ5 T;  3OYJ A;  1YIJ Q;  1N27 A;  3PMI A;  1Q82 R;  2P4T A;  3REB B;  3L2Q A;  3MP8 A;  4DEX A;  2D0N A;  2LT1 A;  2BIV A;  1OOT A;  3A8M B;  1K8A C;  4IKF A;  3CCJ Q;  4J9D A;  2XDP A;  3EHR A;  1BI0 A;  3CC4 T;  3CCU T;  2DXU A;  1WHM A;  2LJ3 A;  3CXC A;  3CCV T;  4OB3 B;  2CP6 A;  1YWP A;  2NUP B;  1QP3 A;  2JW4 A;  1GL5 A;  2KBT A;  2RQR A;  3FDR A;  3CPW P;  2V8I A;  3CC2 T;  3OYY A;  2RHZ A;  2L3S A;  1NZ9 A;  2DBK A;  4PJO C;  5LL6 S;  3A8L B;  2A3L A;  1RAE B;  2KY9 A;  5GAM e;  2F5T X;  4MMK A;  4C5E A;  3PNW C;  1QVF S;  2D9T A;  5J39 A;  2DZC A;  2K5I A;  3RNJ A;  1K9M C;  2Y4X A;  1Q81 C;  4DOV A;  3QZ9 B;  2RD1 A;  2XDB A;  4DA4 A;  4KUD K;  2GTO A;  3VYG A;  2P0K A;  4BE2 A;  2LRQ A;  1VQK T;  1S72 Q;  2QTV A;  4JLG A;  4HT8 A;  2CRE A;  1KD1 U;  1RAD B;  3EHQ A;  3GOX A;  2RJC A;  2FPD A;  1H3Z A;  2EJ9 A;  3EGX B;  2DD5 A;  3JB9 G;  4EMK C;  2K2V A;  2VXE A;  2ECZ A;  4RG8 A;  3CBM A;  5J26 A;  5GMK h;  3R6N A;  2XI9 A;  2MYS A;  1K76 A;  1ZX6 A;  1QQJ A;  2EQI A;  3CC7 A;  2C06 A;  1M3A A;  4OB0 B;  2YDL A;  1LJO A;  4KGX B;  3JCM e;  1UGS B;  5KE2 A;  3HSB A;  3QZ5 B;  1J3T A;  5KYX B;  1ZBX A;  3WXM B;  3JCM V;  1WIE A;  2I0N A;  1VOM A;  1S1N A;  1F1B B;  2K3X A;  3HFN A;  3OYG A;  5D6X A;  2JTF A;  4L5G A;  4ORZ A;  5CAI A;  2DXB A;  3MKD A;  5A0G A;  1WLP B;  2M1H A;  3HRS A;  1VQM Q;  4O6J A;  1SRL A;  2FZG B;  5FW9 A;  3OYN A;  2E3I A;  3V7S A;  3CCQ Q;  2HL3 A;  3R6O A;  2DRM A;  5I2S A;  2SEM A;  2FO0 A;  1GCP A;  3QWX X;  1SSF A;  4RTU A;  1XTD A;  1N9R A;  3T9N A;  2MPX C;  2AKK A;  3THK A;  4KT0 E;  2DIQ A;  2J7I A;  4ANJ A;  1ARK A;  3G71 Q;  1YIT Q;  1Q7Y C;  1Z9Z A;  4M77 B;  1AT1 B;  1WHL A;  3HRU A;  2ZPG B;  3EFO A;  2O4X B;  3I56 T;  2DE0 X;  4OMF B;  2ENM A;  2CP7 A;  1JQQ A;  1M1F A;  4LUE A;  4OMO A;  2K4Y A;  2LVM A;  1YP5 A;  2LC4 A;  1BIB A;  4JLI A;  2KRN A;  5GAN 7;  2H8H A;  3VUB A;  3F70 A;  1KHI A;  2XID A;  1E7O A;  1XQH A;  3RKY A;  1KQS A;  4PK4 A;  3REA B;  3HRT A;  3CCM A;  5I21 A;  4J6X A;  4WCI A;  1UEC A;  2DTI A;  4AFS C;  5AT1 B;  5HK3 A;  1G2B A;  3JB9 D;  1NJI U;  3VUZ A;  1PHT A;  5IHN A;  1VIF A;  1Q86 R;  1PSF A;  2G6F X;  1W2B P;  1PRL C;  2JS2 A;  1EFN A;  3EG9 B;  1W1F A;  1M3B A;  2DO3 A;  3M59 A;  4LDY A;  4LD9 K;  1JJ2 P;  1VQP A;  2OAU A;  3MPU B;  1H8K A;  1KC8 C;  2QQA A;  4M78 A;  1D0Y A;  4PFO A;  4VUB A;  3A8O B;  3UT1 A;  1WQW A;  2ABL A;  5GAN e;  3MEU A;  2KSS A;  3NTK A;  5L23 A;  4C8Q A;  2FZC B;  1QCF A;  4OVA A;  4FSS A;  3S3O A;  1OEB A;  2VWF A;  3G1J A;  3MEW A;  5HCK A;  4DBF A;  3QSU A;  6AT1 B;  4D8K A;  5GAO q;  2GBQ A;  5CKE A;  3J81 E;  1VQ8 T;  2AKL A;  1U3O A;  2QGG A;  2X4Y A;  2O9V A;  2EW3 A;  5I2M A;  5CKF A;  4KH0 B;  3OS1 A;  2KYM A;  4NL3 A;  3VS0 A;  5LJ5 f;  2LCS A;  4YTL A;  2EYZ A;  1R8O B;  3E1S A;  1NLO C;  1JO8 A;  4PFP A;  2PU9 B;  1HSQ A;  3H6Z A;  1K73 C;  1M2V A;  3CBP A;  3CC7 Q;  1D1C A;  3LYI A;  3CME Q;  5CIU A;  5GAN 2;  5IT9 E;  1VQ4 A;  4AG2 C;  1CSK A;  5M9O A;  2VXF A;  1N8R R;  5D6W A;  3EG2 A;  1M90 C;  5I11 A;  1D3B B;  2RHI A;  1Q95 G;  5LJ5 h;  2MK5 A;  5GMK m;  2YRD A;  2QEX A;  3TSZ A;  2EPD A;  2HBW A;  2L89 A;  2RB6 A;  2QA4 Q;  1G3S A;  4N0A C;  1ACM B;  3OYH A;  2YUQ A;  2HQX A;  1UB4 A;  1Q82 C;  4D6W A;  2V1R A;  1EZZ B;  2CT4 A;  2R5A A;  8ATC B;  2CZ7 B;  1OU8 A;  4B6M A;  5HK0 A;  1UGV A;  3RUX A;  1V76 A;  4EDU A;  2LTO A;  5GAO l;  1LCK A;  4AFU C;  1OPK A;  4HKE A;  4OF1 A;  1FWZ A;  2RHY A;  1BU1 A;  5GAN f;  1TUC A;  1IRE B;  1W6X A;  1X75 C;  2ZPB B;  3LWI A;  2YRV A;  4C0D B;  1SRM A;  2EYQ A;  2BZX A;  2ED0 A;  4KUI A;  2KRM A;  2KYB A;  4FCY A;  5IAY A;  1TWB A;  2PUK B;  1WJQ A;  2D8H A;  1I5L A;  2IVW A;  1RAF B;  3PMT A;  2D1X A;  2RK2 A;  2RF0 A;  2VGN A;  1NLP C;  1M4Z A;  4L6V 5;  1X6O A;  2QQR A;  2WSF E;  4F14 A;  2AZV A;  1M5Q 1;  2CKK A;  2KAF A;  4XTW A;  2X4X A;  2QDY B;  4JS4 A;  1BI2 A;  3M9Q A;  3FC3 A;  3P8H A;  2YUO A;  1PM3 A;  2A28 A;  3TEE A;  3CCL T;  2YLC A;  2KI7 A;  1OUL A;  1IGU A;  1X2Q A;  3CPW S;  3GF5 A;  1VQP Q;  1ZUU A;  2CSQ A;  4HVV A;  4J9E A;  3MP1 A;  1U5S A;  1XOV A;  4A53 A;  1B7T A;  5FWC A;  2E5Q A;  2WAC A;  3PT9 A;  1Y0M A;  2OTL A;  3EFO B;  3TU4 K;  1RUW A;  2EYY A;  3BW1 A;  4HCB A;  3UA7 A;  1WI7 A;  4M78 G;  5KYW A;  2Y90 A;  3CCR T;  4C0G A;  2LMJ A;  1YN8 A;  3VS3 A;  1YJW A;  4C5G A;  4LDU A;  5FWB A;  4RUG A;  3TRE A;  5KYY A;  5LJ5 d;  2HEQ A;  4LD6 A;  2YT6 A;  4C8Q G;  2P4R A;  3H8Z A;  4J6W A;  3RKX A;  4ZGE B;  1QW1 A;  3HKS A;  1NPP A;  1JXO A;  5GAN 6;  5FU6 B;  2EGA A;  4M78 E;  3PVQ A;  3QWY A;  1G5V A;  2ZPI B;  1R0B G;  2KXC A;  4PJN A;  3G6E A;  3PIO A;  2FPE A;  4C8Q E;  5CCA A;  1IHV A;  2DXC A;  2D8J A;  1M3C A;  2F69 A;  4JRK A;  3LW5 E;  4M78 B;  1PRM C;  3IQL A;  3O8V A;  2K5F A;  4A54 A;  3CCE T;  2P0P A;  1VQ4 Q;  1D1B A;  1IO6 A;  1B34 A;  4ZNX A;  4C8Q B;  1KQS P;  2NUT A;  1Z9Q A;  1KJW A;  1RAB B;  2QEX Q;  1XJW B;  2R58 A;  3ER0 A;  3I55 A;  2FVU A;  4JRP A;  2LZ6 B;  4ZGD B;  5GJW B;  2WSC E;  1BBZ A;  2E10 A;  2QYZ A;  1FMV A;  1TUD A;  2DL8 A;  4J9H A;  1YHQ T;  1Y96 A;  4PL6 A;  3MEA A;  4F17 A;  2CZ0 B;  4M77 A;  3L1A A;  3UA6 A;  1YI2 Q;  2ZPE B;  3M4Y A;  1CKA A;  1M2V B;  2MF2 A;  4HT9 A;  1OI1 A;  2LCL A;  4N4I A;  1W2B A;  1X2K A;  1ZSZ C;  3U23 A;  4F16 A;  2P0Q A;  1UE9 A;  1JJ2 A;  3I56 A;  2ROL A;  3GP8 A;  4M78 D;  1CKB A;  3JCM P;  3OW2 A;  3LWH A;  2K7A A;  1Q86 C;  2XD0 A;  4JDS A;  5LJ5 j;  4O5V A;  4M7D A;  9ATC B;  1SSH A;  4NS5 A;  4OMQ A;  2R5M A;  4C8Q D;  4IUR A;  1UJY A;  1HXD A;  2HZY A;  1BIA A;  4MZT A;  1EIF A;  4IUV A;  4FYV B;  1K8A U;  2L2P A;  4F04 B;  3EAE A;  1RAH B;  4J9G A;  5I22 A;  4K11 A;  3I9Q A;  1H3H A;  3EG9 A;  3QKJ A;  3G4S T;  1QLY A;  3NGP A;  3LH0 A;  2MIO A;  3M0Q A;  3RES A;  1WFW A;  1VIE A;  2OTJ T;  4CC7 A;  1FXX A;  2E65 A;  2W10 A;  4RTV A;  2HDA A;  1ZA1 B;  4ELY C;  5HY6 A;  1BYM A;  2K6D A;  2F2W A;  5GMK i;  3CEY A;  2K9G A;  2OTL Q;  1YI2 T;  1QWF A;  3LGL A;  3CMA Q;  1VQ6 A;  2F1L A;  3PVL A;  4MDX A;  2NYS A;  3QUI A;  1GCQ C;  3TQ7 P;  3GPL A;  1LOJ A;  1YJ9 A;  5CKD A;  3OS2 A;  4JUV A;  4IIO A;  1M8V A;  4FYX B;  2HCK A;  2LNV A;  2BE7 D;  4M75 D;  1YJW Q;  1T0H A;  3CBO A;  3NTH A;  2MAM A;  2EQK A;  4X9C A;  2RM4 A;  1UHF A;  4PJO A;  4QQD A;  1E6G A;  4C92 F;  2L3Q A;  2X4W A;  4FW2 A;  4M7A C;  1KSW A;  3CCS A;  5DY9 A;  3SDZ A;  3L2Z A;  2GTJ A;  2VC8 A;  1VQ7 A;  2RHX A;  1N8R C;  1QVG S;  3QDR B;  4RCB A;  2EWN A;  5GAN 8;  2K3B A;  5C6S A;  1U1T A;  1OX8 A;  2GQV A;  2HMA A;  2XMF A;  1JRI A;  2ATC B;  2PVO B;  1TTH B;  2FRW A;  1RL2 A;  3S3M A;  1QWE A;  1R0C B;  1WHJ A;  2K57 A;  4RG2 A;  1Y57 A;  2K3Y A;  2L8D A;  3JCM J;  2F5K A;  5FRN A;  1D3B A;  1YIJ T;  4JRQ A;  3CMA T;  4PJL A;  2V1Q A;  5KYW B;  2BTT A;  3CXC S;  2YHT A;  1QCN A;  4EMK A;  1ABO A;  1MMD A;  2C0I A;  5KYY B;  4C92 C;  3CCJ T;  4KBM B;  5LJ3 f;  2PTK A;  2BE9 B;  3WVE B;  3EGU A;  3BDU A;  2WSE E;  1RLQ C;  2MWO A;  1XNI A;  4EMG A;  1VYT A;  1IZ6 A;  2FG0 A;  4LNP A;  4BE0 A;  2FB7 A;  1BCM A;  2X4J A;  2NLU A;  4JZ3 A;  4CC3 A;  1PCX A;  1WPY A;  1Y7X A;  4PJM A;  3C4S A;  1ABQ A;  3MP6 A;  4FYW B;  2E6Z A;  2L5Q A;  1AWW A;  1I07 A;  3JCM W;  2HD0 A;  2A37 A;  2XDD A;  4M77 G;  3JSC A;  1SEM A;  4MZP A;  4AFQ C;  1GFC A;  1X6G A;  3VS4 A;  2COY A;  5LJ3 h;  3MJX A;  1Q7Y U;  1MNE A;  4HCZ A;  4GY5 A;  4XTV A;  8AT1 B;  4JJB A;  2LNH B;  1B34 B;  5DM7 R;  2GFU A;  2YLB A;  2VV5 A;  3HL8 A;  4E6R A;  2NUT B;  2PZ1 A;  4M77 E;  5GAN 5;  1KHC A;  3VKI A;  4A4H A;  4Z8A A;  1S72 T;  4C5H A;  2KMT A;  1VQL A;  4HCK A;  4M7D G;  3GIB A;  2PVG B;  2L3R A;  3JCM b;  5FRM A;  1Y96 B;  3QHS A;  5GAM f;  3OA6 A;  1VQO A;  4ZTF A;  3TSW A;  3FRN A;  4Y28 E;  1DJ7 B;  1MGQ A;  2BKD N;  3OBW A;  4J7I A;  1FYN A;  4M7D E;  4DQ2 A;  2GNC A;  1OPL A;  3VYH B;  1T3L A;  1VQ6 Q;  4X1V A;  2EJG A;  4Z88 A;  2NUZ A;  3O5Z A;  3ZL7 C;  1I1J A;  5FU7 B;  2KEA A;  4UC4 A;  4IUU A;  4C5I A;  1YJ9 Q;  4FYY B;  3MET A;  1D1A A;  2RQV A;  4OMP A;  1UGR B;  3OMC A;  3M55 A;  3BY7 A;  4PJJ A;  1I81 A;  1R77 A;  2DF6 A;  4R56 A;  4M7D B;  3M56 A;  4IUP A;  5KE3 A;  5GAM h;  1YBY A;  4ZN1 A;  4DBQ A;  4XTU A;  1VQM T;  3OYC A;  3RER A;  1BI3 A;  1M30 A;  1VQ7 Q;  3CCQ T;  1U1S A;  4PJO G;  4BDY A;  5FLX E;  2D0Q B;  4DOW A;  1GBR A;  1U8R A;  2LJ0 A;  1RI0 A;  1ZUK A;  2E12 A;  3MO8 A;  1VQN A;  4XU0 A;  3KUF A;  4Z02 A;  4X9D A;  3JCM f;  3OW2 P;  2KQW A;  3G71 T;  1WYX A;  4JRI A;  2RA2 A;  1YIT T;  3CD6 A;  3A8H B;  1KG1 A;  3ZEH A;  4M77 D;  2IG0 A;  2FZK B;  2QAS A;  1WDX A;  1SF9 A;  4MML A;  4PJO E;  1VQ9 A;  3CPF A;  2RI5 A;  3C0C A;  5LJ3 d;  4OML A;  1K73 U;  4MZM A;  4RKU E;  1K1Z A;  2DLP A;  4M7A B;  1YJN A;  1C1A A;  4E7Z A;  2LP5 A;  2JT4 A;  1UDL A;  1BB9 A;  1K0S A;  4J8O A;  2O9S A;  4PJO B;  2DA9 A;  1KQS S;  2DD4 A;  2OJ2 A;  2JMC A;  4JPB W;  1T0J A;  3JCM h;  3JCM c;  1M90 U;  4M7D D;  4PFZ A;  4BI3 A;  3X25 B;  3AHU A;  2DER A;  2DK3 A;  3VRY A;  2DM1 A;  3QO3 A;  2VAS A;  1LVK A;  4M75 F;  1WX6 A;  4BI8 B;  1I0C A;  4QVZ A;  4F7U F;  2OX7 A;  4C0F A;  1N5Z A;  1KIK A;  1Q82 U;  1AWX A;  2X9H A;  3MCA B;  2E1H A;  3RIR A;  3GBQ A;  2LX7 A;  5LJ5 g;  1AZG B;  1ZLM A;  1I8F A;  4QVC A;  2CZ6 B;  4N0A A;  3DB4 A;  4R0K A;  1JXM A;  5IXF A;  2RJD A;  2M16 A;  4AG1 C;  2FL7 A;  2DXT A;  1K4U S;  4PNO A;  2EGE A;  2EKO A;  1WJR A;  4ZN3 A;  4GLM A;  1AD5 A;  1HYO A;  4EMK B;  1PG5 B;  4JJD A;  4JJN K;  1M1K U;  5GAM d;  1VQL Q;  2KXD A;  1WXB A;  3PFS A;  3L2R A;  1TXQ A;  1C6V X;  4XAX B;  2LQ8 A;  1GRI A;  4IUQ A;  3QDF A;  4OMN A;  2RQU A;  2ZPF B;  4PJO D;  1WXT A;  2Y4Y A;  5KYU A;  2LQW A;  2JXB A;  2O31 A;  3MHX A;  3FEO A;  3L2W A;  1M1G A;  1VQO Q;  1MMA A;  1SKU B;  3A1P A;  3LX7 A;  3CQT A;  4J5Y A;  1NEG A;  2QDL A;  1IXD A;  4J83 A;  1TOV A;  1VQ5 A;  2OI3 A;  2YUN A;  5LJ3 j;  3CC7 T;  2E3H A;  4R55 A;  3CME T;  2DEQ A;  4BAC A;  2FEI A;  1G83 A;  4XTY A;  3LGF A;  1ZSG A;  1QMC A;  3FB9 A;  4E7H A;  3E9G A;  2QQB A;  2AT1 B;  2NWM A;  3NTI A;  1WZO A;  3CC4 A;  3CCU A;  2DYI A;  3M54 A;  2XG8 D;  1I4K 1;  5GAN h;  4E7S A;  3OSV A;  1X27 A;  3HTR A;  4D8D A;  2QA4 T;  3I35 A;  3CCV A;  4B9X A;  3JCM d;  3CCM Q;  5GAO n;  1QCO A;  1FX7 A;  1YWO A;  2R57 A;  3GNG A;  3CC2 A;  2V8J A;  3SWN C;  1VQN Q;  4LDX A;  1WA7 A;  2MWP A;  1KD1 R;  2DEU A;  3X26 B;  3VS6 A;  1W4S A;  4XQ3 A;  4PKC C;  1UGP B;  1QKW A;  2X3W D;  2G3R A;  3UF4 A;  2XHC A;  3RMQ A;  1WJS A;  1VQ9 Q;  3M0S A;  3OYD A;  2CT3 A;  3NPF A;  1YJN Q;  4Z89 A;  2ROT A;  1JEG A;  3VJP A;  3Q1J A;  1GFD A;  4HCC A;  2VYT A;  2QK0 A;  4M4Z A;  3I5S A;  5GAM j;  1AZE A;  1VQK A;  3JCM Q;  3JB9 I;  2E5K A;  3QII A;  3P8D A;  3E19 A;  4A4F A;  3OBY A;  4BUG A;  2QI2 A;  1VYU A;  1WHH A;  3QBY A;  2QQS A;  5L8R E;  2KRS A;  4OB2 B;  4E7K A;  4E2F B;  1PWT A;  3CCM T;  1LNX A;  2B8A A;  3QG1 A;  5CKB A;  3ULR B;  1WHG A;  1D0Z A;  2LT4 A;  3S3N A;  4L59 A;  1TUG B;  5A0L A;  1VQP T;  3DKM A;  3JB9 F;  2CP0 A;  2GF7 A;  5EC7 A;  1UEB A;  3V7R A;  1UFF A;  1OQK A;  2RPN A;  3UAT A;  1VUB A;  1VA7 A;  5J3B A;  4M77 F;  1FMK A;  5CQX A;  2EGC A;  2JUF A;  2RQT A;  2DIG A;  5GAN d;  2PVD B;  2CSI A;  4FL6 A;  1ZSZ A;  2LQK A;  2DAQ A;  2CDT A;  4ELZ C;  2FYK A;  1AVZ C;  3V8L A;  3OMG A;  2LX9 A;  3KXT A;  3VU3 C;  2RI3 A;  2DPP B;  1OU9 A;  2DYB A;  2RK1 A;  2YUP A;  1H64 1;  1PD0 A;  1HK9 A;  4GLK A;  1VQ5 Q;  2V8K A;  3ZBD A;  2JM8 A;  1TG0 A;  1NJI R;  1IGQ A;  4TVR A;  4FIB A;  1TSF A;  4BI4 A;  1VQ4 T;  4A63 B;  1WXU A;  3H9N A;  3SHW A;  5GAO m;  3CC4 Q;  1OZ2 A;  4CC2 A;  2DZ9 A;  1NEB A;  2HL5 C;  2QEX T;  3OYK A;  1C0M A;  3CCV Q;  1KQ2 A;  1G3Y A;  3OYA A;  5GMK e;  2JOY A;  4QKU A;  2Z0W A;  4LDW A;  1GCQ A;  3CC2 Q;  2DL5 A;  5KYU B;  2DTH A;  2K2M A;  2DET A;  2EVR A;  2HKN A;  4OMM A;  1IB8 A;  5A0D A;  1W2B S;  3PGG A;  1O9S A;  2CUB A;  3V8K A;  3HFO A;  4NOY A;  1JJ2 S;  3BFM A;  1QVG A;  3OYM A;  5GAN 4;  3OW2 S;  4M7A A;  2DL3 A;  4XU2 A;  1AEY A;  1M2O A;  1AWO A;  3M5A A;  2CYZ B;  3M53 A;  3C95 A;  3OYL A;  3VS5 A;  3DB3 A;  3X24 B;  1K9M U;  1MUZ A;  1Q81 U;  1VQK Q;  5GAN j;  1QVF A;  2KVQ G;  1KFZ A;  1VQ8 A;  4BD3 A;  3SWN B;  3OYF A;  3ME9 A;  1TH7 A;  2J6K A;  2KT1 A;  3G6E Q;  3SFM A;  1PSE A;  1RI9 A;  4J9C A;  2ZAE A;  1NM7 A;  3EG3 A;  2JMA A;  1U06 A;  3RMS A;  4QQ6 A;  2A08 A;  5IN1 A;  2AIR B;  2CH4 W;  4BE1 A;  3GLX A;  1M1K R;  5KYN A;  4ATO A;  1UUE A;  4C92 A;  4RTX A;  1H92 A;  3NMZ C;  2LQN A;  2OTL T;  2KRO A;  5IH2 A;  1RAG B;  2JZ2 A;  1MHN A;  2LDM A;  2HNI A;  4QVD A;  2DJZ A;  3I55 Q;  3KBG A;  1K0X A;  3RKW A;  2DL7 A;  1NE8 A;  1PNJ A;  4P5N A;  1AHJ B;  1YJW T;  1OYX A;  2VUB A;  4E7L A;  4LN2 A;  2DJQ A;  4RTY A;  1BKB A;  4GBQ A;  3VS7 A;  5IHK A;  2IPO B;  5CKH A;  4C0Z A;  4IUT A;  2CUD A;  3M0T A;  2CP3 A;  2E6N A;  2FPF A;  3E9F A;  1G3W A;  2KGT A;  4LXC A;  1E6H A;  5LJ3 g;  3G6E T;  3S6W A;  4J6Y A;  5GMK l;  3X28 B;  2HQH A;  4DBH A;  3OQ5 A;  3VV0 A;  4HVW A;  3UPU A;  3DLL A;  1RAC B;  3I56 Q;  2ZCF B;  5GAO p;  3PTA A;  4OGC A;  3FIF A;  3NFC A;  3JAM E;  2HSE B;  2XKO C;  3FJ5 A;  1BK2 A;  1OX9 A;  4ME7 A;  2E70 A;  1PD1 A;  2O01 E;  4HVU A;  3ZFJ A;  1G3T A;  1LPL A;  1V1C A;  4QQG A;  3CME A;  4OP0 A;  4XTZ A;  1WQ7 A;  2I2L A;  1ZA2 B;  4AMC A;  3QYH B;  1KD1 C;  3V7C A;  3KFV A;  2X35 A;  3I55 T;  2PQW A;  2QQ9 A;  4LUD A;  4KH1 B;  2M0O A;  3UDC A;  4C0D C;  3H0F A;  3WVD B;  2EIF A;  2QA4 A;  1O75 A;  2JN0 A;  3CCL A;  1ZSZ B;  4FM4 B;  4EMH A;  4KRT A;  3VRZ A;  2P84 A;  1QVP A;  2MOX A;  4NL2 A;  2ZGW A;  3QYG B;  2F2X A;  2PNI A;  5CK9 A;  3EFS A;  2M9U A;  5ECA A;  2XIC A;  2IIM A;  2EQU A;  5LJ5 e;  5GJV B;  2EBP A;  2RN8 A;  5DLQ E;  1KC8 U;  2C0T A;  5GAM g;  3SD4 A;  3QXE B;  2QTX A;  3J7A F;  3LLR A;  3CCR A;  4M7A G;  2FRY A;  2J05 A;  4CRI A;  3CCS Q;  4KUL A;  2CH4 A;  4XTX A;  5CO7 A;  1YFN A;  1VYV A;  3V8J A;  1VQ8 Q;  4M78 F;  5GAO r;  5D6Y A;  4RCC A;  2MMP A;  2LCC A;  2CZ1 B;  4XU3 A;  5CVI A;  2DTO A;  1YCS B;  3HPW A;  5EG2 A;  3BDL A;  3EH1 A;  4KGZ B;  1NPR A;  2RI2 A;  4C8Q F;  3EGD A;  5KCH A;  4M7A E;  4BDZ A;  3OYE A;  3QPH A;  1KQ1 A;  1OZ3 A;  3M0U A;  2EYX A;  2ESW A;  4ESR A;  4EIK A;  2XU8 A;  5FU6 C;  2CS7 A;  2GCX A;  1MND A;  2EQM A;  4J9B A;  2AZS A;  2ZPH B;  1VQ6 T;  4Y91 A;  1OV3 A;  1QP2 A;  2QG9 B;  2BZY A;  3CCE A;  3JCM g;  2JJ9 A;  1ZQ1 A;  1YJ9 T;  4WF2 A;  4C92 G;  2FHD A;  3PE0 A;  2KE9 A;  2J06 A;  2QXF A;  1Y07 A;  4A4G A;  2X51 A;  2H3J A;  4M78 C;  3A98 A;  1GBQ A;  2DX1 A;  4X34 A;  3L2V A;  1JU5 C;  2A36 A;  4E7J A;  3GNF B;  3RBB B;  1NJI C;  3CCS T;  1NYF A;  3X20 B;  4E47 A;  4C92 E;  1QVG P;  3M58 A;  3SB2 A;  4C8Q C;  3OS0 A;  4PLL A;  3JCM X;  1VQ7 T;  2E64 A;  1YHQ A;  2XK0 A;  2K5L A;  3L42 A;  1WGS A;  1B07 A;  4FT2 A;  1RAA B;  2YXY A;  1K8A R;  2AK5 A;  1NG2 A;  1PKT A;  4C92 B;  1QVF P;  4AFZ C;  3HHT B;  1M27 C;  4J7F A;  5IXB A;  3JV3 A;  1UTI A;  2DBM A;  3JB9 J;  4M75 A;  3TCJ A;  3VS1 A;  4M7A D;  4F7U A;  3CXC P;  3EFR A;  2RHU A;  2YSQ A;  2KR3 A;  4DEY A;  3A5Z B;  3EG0 A;  2ED1 A;  1BCO A;  4LDV A;  2M02 A;  3P8B B;  2QGF B;  4M75 C;  2GFA A;  2E41 A;  1RLP C;  4RMO A;  3CCL Q;  4FSX A;  1MV3 A;  3G4S A;  2EAY A;  1P92 A;  2JVV A;  4BY6 C;  1NBE B;  3MEV A;  1WHK A;  1WNL A;  2OTJ A;  1Y71 A;  4HA8 A;  1K9M R;  1Q81 R;  5GAN 3;  5IHI A;  2SRC A;  4E7I A;  1UHC A;  1W70 A;  4FW1 A;  1M8M A;  2OAW A;  2YWW A;  1YI2 A;  5GMK j;  3CPW A;  2RQW A;  4MDW A;  5GAN g;  3M4G A;  1FMW A;  4C92 D;  3CCR Q;  2KK4 A;  1PKS A;  2EYW A;  2VKN A;  3OYI A;  3EG1 A;  3SWN A;  1AWJ A;  5A2Q E;  3OYB A;  4JZ4 A;  2O2O A;  1M1K C;  3UWN A;  2RJF A;  2DIL A;  1ZUY A;  3NHN A;  1BI1 A;  1RAI B;  4ZTJ A;  4J9F A;  1SHG A;  2GGR A;  2QAZ A;  2JM9 A;  1VQL T;  3QJY A;  5AYF A;  1MMN A;  1HJD A;  2NUP A;  4QW2 A;  4RTZ A;  2M0Y A;  2M51 A;  3URG A;  3M57 A;  3CD6 Q;  3BE3 A;  2BUD A;  3M0R A;  3OSS C;  2HSP A;  4OGE A;  1VQO T;  1SHF A;  3HP9 A;  4CI0 C;  2DRK A;  3C94 A;  2L3P A;  2O88 A;  3C12 A;  3JB9 H;  2JS0 A;  1B3Q A;  1D09 B;  3CCE Q;  1ZBJ A;  1YIJ A;  1YNZ A;  1HD3 A;  3CMA A;  2J6F A;  3J80 E;  2VVK A;  3N5B B;  1YCY A;  2F2V A;  1IRX A;  2DMO A;  3CCJ A;  3INZ A;  1M9S A;  3FLG A;  1Q7Y R;  2RJE A;  4OB1 B;  1AOJ A;  2DKG A;  2K79 A;  4PLI A;  1X01 A;  1ZHI A;  3OY9 A;  1YHQ Q;  2D6F A;  1V29 B;  1X6B A;  2VGM A;  3EGX A;  3EGD B;  4JJC A;  3RDV A;  3VS2 A;  2HKQ B;  4FU6 A;  2VB6 A;  2JNG A;  4WTO B;  4RTT A;  5FRO A;  3SEM A;  4Q5W A;  1VQN T;  4N4G A;  1KK7 A;  4J9I A;  1MV0 B;  2PUO B;  4QT7 A;  2HAX A;  3G7Z A;  4RTW A;  3CD6 T;  1TS9 A;  1EX4 A;  3ASK A;  4BB7 A;  3EH2 A;  3E2U A;  4JS5 A;  2COZ A;  2ZZD A;  3H0H A;  5KYX A;  7AT1 B;  2L0A A;  1VQ9 T;  2CP5 A;  5D7U A;  4LE9 A;  2RNA A;  4A4K A;  2DFU A;  1SPK A;  3QJ6 A;  1MMG A;  3I5R A;  4B9W A;  4N4H A;  1YJN T;  2A7Y A;  1Q86 U;  3A8G B;  2W0Z A;  2H3E B;  1NYG A;  1T3S A;  1JBM A;  2AHJ B;  2X3X D;  4AT1 B;  4CC4 B;  1S72 A;  4M75 G;  2GQI A;  4V2S A;  4FT4 A;  4F7U G;  2KNB B;  1KC8 R;  3D7S B;  1I5O B;  2C0O A;  2HQE A;  5CQY A;  1N9S A;  4XU1 A;  3G4S Q;  3PIP A;  2KDS A;  4KGV B;  2COW A;  2EQJ A;  4M7D F;  2OTJ Q;  4EPC A;  2CP2 A;  2DVE A;  1UGQ B;  3M0P A;  4M75 E;  2BZ8 A;  4F7U E;  3RR6 A;  3LH5 A;  2O4X A;  1A0N B;  1JB0 E;  2HBP A;  1K9A A;  2EJF A;  2DVJ A;  3OB9 A;  2RMO A;  4XK8 E;  4M77 C;  2RO0 A;  1UJ0 A;  3CCU Q;  1TU0 B;  4M75 B;  2EKH A;  1GXI E;  3H0I A;  4HXJ A;  4F7U B;  5HKC A;  3JRZ A;  3L2U A;  2EFI A;  4IIM A;  1G8X A;  2JTM A;  2B86 A;  4BY6 B;  3FJP A; 
#chains in the Genus database with same CATH homology
 2OJ2 A;  2JMC A;  4JPB W;  1T0J A;  1U5S A;  1XOV A;  2KT8 A;  5FWC A;  1UG1 A;  1Y0M A;  3FJ5 A;  1BK2 A;  1RUW A;  2EYY A;  3H41 A;  3VRY A;  2DM1 A;  4HVU A;  1WX6 A;  3UA7 A;  1I0C A;  1QKX A;  1V1C A;  4Y92 A;  1X69 A;  1WI7 A;  1N5Z A;  1KIK A;  3TVT A;  2LMJ A;  1YN8 A;  3VS3 A;  1AWX A;  5FWB A;  3KFV A;  4RUG A;  2DL4 A;  1X43 A;  2HEQ A;  3GBQ A;  2YT6 A;  2LJ1 A;  2P4R A;  2LX7 A;  4LUD A;  2MCN A;  1AZG B;  1ZLM A;  1JXO A;  3H0F A;  2J6O A;  2DNU A;  2JTE A;  2EGA A;  4R0K A;  1JXM A;  3PVQ A;  5IXF A;  3QWY A;  3REB B;  4AG1 C;  4KRT A;  3VRZ A;  2KXC A;  1K4U S;  2MOX A;  2F2X A;  2EGE A;  4DEX A;  2FPE A;  2D0N A;  2PNI A;  1OOT A;  4GLM A;  1AD5 A;  4J9D A;  3EHR A;  2D8J A;  1M3C A;  5ECA A;  2IIM A;  4JJD A;  5GJV B;  2EBP A;  2LJ3 A;  2KXD A;  2RN8 A;  1WXB A;  1PRM C;  2C0T A;  1GRI A;  3IQL A;  1YWP A;  4OMN A;  2RQU A;  1WXT A;  2LQW A;  2JW4 A;  2JXB A;  1IO6 A;  2O31 A;  1GL5 A;  2KBT A;  2RQR A;  4ZNX A;  2FRY A;  2L3S A;  1Z9Q A;  2J05 A;  1KJW A;  2DBK A;  2CH4 A;  1VYV A;  3CQT A;  2LZ6 B;  1NEG A;  2QDL A;  2OI3 A;  2YUN A;  5GJW B;  1YCS B;  1BBZ A;  2FEI A;  1G83 A;  1TUD A;  2DL8 A;  1ZSG A;  4J9H A;  4F17 A;  3RNJ A;  3M0U A;  2EYX A;  3UA6 A;  2ESW A;  2NWM A;  2GTO A;  4ESR A;  4EIK A;  1X27 A;  4J9B A;  4D8D A;  1CKA A;  3I35 A;  2AZS A;  2CRE A;  1X2K A;  3EHQ A;  1OV3 A;  3U23 A;  4F16 A;  1UE9 A;  2BZY A;  2FPD A;  2ROL A;  1YWO A;  1CKB A;  2K7A A;  3PE0 A;  2KE9 A;  1WA7 A;  2ECZ A;  2J06 A;  1SSH A;  4OMQ A;  3A98 A;  1GBQ A;  2DX1 A;  3R6N A;  1UJY A;  3VS6 A;  1K76 A;  2A36 A;  1JU5 C;  1ZX6 A;  3RBB B;  2EQI A;  1QKW A;  1M3A A;  2X3W D;  1NYF A;  2YDL A;  3UF4 A;  2L2P A;  4J9G A;  5I22 A;  4K11 A;  3I9Q A;  3M0S A;  1J3T A;  1H3H A;  2CT3 A;  3NPF A;  1QLY A;  3NGP A;  1WIE A;  2I0N A;  2ROT A;  4Z89 A;  1JEG A;  2MIO A;  1S1N A;  3M0Q A;  1GFD A;  1WFW A;  1B07 A;  2W10 A;  4M4Z A;  4RTV A;  4CC7 A;  3I5S A;  1AZE A;  2HDA A;  4ORZ A;  2E5K A;  2AK5 A;  1WLP B;  2K6D A;  2F2W A;  2K9G A;  1PKT A;  1NG2 A;  1SRL A;  1QWF A;  5FW9 A;  4AFZ C;  3PVL A;  1M27 C;  1VYU A;  2DRM A;  1GCQ C;  5IXB A;  2SEM A;  3JV3 A;  2KRS A;  2FO0 A;  1GCP A;  1UTI A;  2DBM A;  3QWX X;  4IIO A;  4RTU A;  2HCK A;  3VS1 A;  1PWT A;  2AKK A;  3THK A;  1T0H A;  2J7I A;  3ULR B;  1ARK A;  2YSQ A;  2KR3 A;  1UHF A;  1E6G A;  4DEY A;  1Z9Z A;  3EG0 A;  2L3Q A;  2ED1 A;  1KSW A;  5EC7 A;  1RLP C;  2GTJ A;  2DE0 X;  1UFF A;  2ENM A;  1JQQ A;  1MV3 A;  2RPN A;  4LUE A;  3UAT A;  4OMO A;  2K3B A;  2XMF A;  1VA7 A;  1FMK A;  2FRW A;  2EGC A;  5IHI A;  1YP5 A;  2SRC A;  1UHC A;  1W70 A;  1M8M A;  1QWE A;  2RQT A;  2KRN A;  2OAW A;  2H8H A;  1Y57 A;  2RQW A;  1E7O A;  2CSI A;  3REA B;  2CDT A;  4WCI A;  1PKS A;  1UEC A;  4AFS C;  1AVZ C;  2EYW A;  2VKN A;  1G2B A;  2V1Q A;  2BTT A;  1PHT A;  3EG1 A;  5IHN A;  1AWJ A;  2G6F X;  4JZ4 A;  2JS2 A;  1PRL C;  1EFN A;  2O2O A;  1W1F A;  1M3B A;  2DYB A;  1ABO A;  2C0I A;  2YUP A;  2DIL A;  1ZUY A;  1H8K A;  3NHN A;  4J9F A;  1SHG A;  2GGR A;  2PTK A;  2JM8 A;  2JM9 A;  3EGU A;  2ABL A;  1HJD A;  1TG0 A;  1RLQ C;  5L23 A;  1VYT A;  2FG0 A;  4RTZ A;  4LNP A;  2M0Y A;  4A63 B;  1QCF A;  2M51 A;  1WXU A;  4FSS A;  3SHW A;  3M0R A;  1OEB A;  2VWF A;  4JZ3 A;  4CC3 A;  2HSP A;  5HCK A;  1ABQ A;  4CC2 A;  1AWW A;  1NEB A;  1SHF A;  4D8K A;  2GBQ A;  1I07 A;  2DRK A;  2A37 A;  2L3P A;  2O88 A;  2AKL A;  1SEM A;  1U3O A;  2JS0 A;  1B3Q A;  4AFQ C;  1GFC A;  1X6G A;  2O9V A;  3VS4 A;  1ZBJ A;  2EW3 A;  1YNZ A;  2KYM A;  1HD3 A;  1GCQ A;  3VS0 A;  2DL5 A;  2LCS A;  2J6F A;  2K2M A;  2EYZ A;  2VVK A;  4JJB A;  2LNH B;  2EVR A;  4E6R A;  4OMM A;  2F2V A;  1NLO C;  1JO8 A;  2DMO A;  2PZ1 A;  2CUB A;  1HSQ A;  4Z8A A;  4HCK A;  1AOJ A;  2K79 A;  2DL3 A;  1AEY A;  1AWO A;  1X6B A;  3VS5 A;  1CSK A;  4AG2 C;  4JJC A;  3VS2 A;  3EG2 A;  4RTT A;  5I11 A;  3SEM A;  1MUZ A;  3TSW A;  4J9I A;  1MV0 B;  4QT7 A;  4RTW A;  3TSZ A;  2EPD A;  2HBW A;  1KFZ A;  1FYN A;  2GNC A;  1OPL A;  1T3L A;  4X1V A;  2J6K A;  2YUQ A;  4Z88 A;  2NUZ A;  2KT1 A;  3O5Z A;  3ZL7 C;  1I1J A;  2KEA A;  3H0H A;  2V1R A;  2CT4 A;  2L0A A;  4LE9 A;  2RQV A;  2RNA A;  1SPK A;  1UGV A;  4OMP A;  1RI9 A;  4J9C A;  1LCK A;  1NM7 A;  3I5R A;  4AFU C;  3EG3 A;  2JMA A;  1OPK A;  1U06 A;  2W0Z A;  2DF6 A;  2A08 A;  1NYG A;  1T3S A;  2CH4 W;  1BU1 A;  2X3X D;  4CC4 B;  1TUC A;  2GQI A;  1UUE A;  2KNB B;  4RTX A;  1H92 A;  1W6X A;  2C0O A;  3NMZ C;  2LQN A;  2KRO A;  5IH2 A;  1M30 A;  1SRM A;  2BZX A;  2ED0 A;  2KRM A;  2KYB A;  1GBR A;  2LJ0 A;  1K0X A;  2DL7 A;  1ZUK A;  1PNJ A;  2D8H A;  3M0P A;  2BZ8 A;  2D1X A;  1WYX A;  2RF0 A;  1NLP C;  4LN2 A;  3LH5 A;  2DJQ A;  4RTY A;  4F14 A;  4GBQ A;  2AZV A;  3VS7 A;  5IHK A;  1A0N B;  1WDX A;  2CUD A;  1K9A A;  3C0C A;  3M0T A;  2DVJ A;  2YUO A;  2FPF A;  4OML A;  2A28 A;  2RMO A;  1K1Z A;  2DLP A;  1UJ0 A;  2KGT A;  1E6H A;  2EKH A;  3H0I A;  4HXJ A;  1X2Q A;  2LP5 A;  2JT4 A;  1UDL A;  4IIM A;  1BB9 A;  1ZUU A;  2CSQ A;  4HVV A;  1K0S A;  2B86 A;  4HVW A;  4J9E A;  2O9S A;  2DA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...