2YUPA

Solution structure of the second sh3 domain of human vinexin
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
90
structure length
90
Chain Sequence
GSSGSSGKPPTYQVLEYGEAVAQYTFKGDLEVELSFRKGEHICLIRKVNENWYEGRITGTGRQGIFPASYVQVSREPRLRLCDDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Vinexin
publication title Solution structure of the second SH3 domain of human Vinexin
rcsb
source organism Homo sapiens
total genus 6
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2yupA01
2FPFA 3EG1A 3I5RA 3M0PA 2KT8A 1M30A 5IHNA 2ROLA 1M3AA 1OPKA 2J7IA 1IO6A 2K7AA 3M0SA 1VYTA 2LJ0A 3TSZA 3THKA 2EYXA 2ROTA 2LX7A 3IQLA 1OEBA 1OV3A 4WCIA 1QWFA 1N5ZA 4GBQA 1U06A 2KE9A 4FSSA 4JZ4A 1BB9A 2LZ6B 1WIEA 2LJ1A 2DYBA 3SHWA 2AKLA 2J6FA 2DBMA 3M0UA 2KXCA 1E7OA 1AD5A 2G6FX 2VVKA 2DL3A 2RMOA 3VS7A 1BBZA 2PZ1A 2YDLA 1PWTA 1WI7A 2D0NA 4AFQC 5EC7A 2HSPA 2NUZA 4Y92A 2DL4A 1BU1A 2CSIA 2HEQA 1JO8A 5IHIA 4AFUC 1H3HA 1MUZA 1Y0MA 4IIMA 2L3QA 2KROA 2EBPA 3UA6A 2JM8A 2X3WD 2EYWA 1M3CA 1GFDA 3VS1A 2KXDA 2AZVA 2KR3A 2DLPA 1G83A 3EHQA 4QT7A 2DNUA 2CH4W 1TUCA 2KYBA 2XMFA 3M0TA 1ARKA 1NEBA 2CT3A 2M51A 1Y57A 3REAB 2EGCA 1ZUKA 2DJQA 1NYFA 1Z9QA 2B86A 2V1RA 2RN8A 1SHGA 3UA7A 1GRIA 2DILA 2IIMA 2KRMA 1AEYA 1HJDA 2C0IA 1UE9A 1FYNA 4OMPA 2EYYA 1RUWA 3VS3A 4HVVA 2RF0A 1MV0B 3ULRB 2MOXA 2LCSA 4Z89A 2MIOA 4LNPA 2LQNA 2JXBA 2DL8A 2F2XA 4J9BA 2A36A 4AFZC 1ZBJA 4Z88A 4F17A 2GQIA 2RNAA 2KT1A 2OAWA 2D1XA 3VS2A 2HCKA 4Z8AA 3LH5A 1T0JA 2PNIA 2J6OA 4LN2A 2F2VA 3H0HA 4AG2C 4D8DA 3H0IA 3R6NA 1VYUA 4OMQA 4RTTA 4IIOA 2P4RA 1SEMA 3EG0A 3VRZA 3KFVA 1AZEA 1UHCA 2VWFA 2OJ2A 2D8HA 2MCNA 1K9AA 1PKSA 1UHFA 2CH4A 2CREA 2FPDA 1KSWA 3NMZC 3VS5A 1VA7A 2DRKA 1ABQA 2EW3A 2YSQA 2GTOA 2ECZA 2DM1A 1ZUUA 2AZSA 2ABLA 4J9DA 4HVUA 1K4US 2KEAA 1SHFA 3H0FA 3I35A 1UFFA 2EYZA 2J05A 1PKTA 2JS0A 4OMLA 4DEYA 4JPBW 2O9VA 4JJCA 2YT6A 4GLMA 5I11A 4OMNA 4RUGA 2ED1A 1YWPA 4RTUA 2GTJA 4R0KA 2KYMA 5L23A 3UATA 1X2KA 1U5SA 2YUPA 2EGEA 2DRMA 3UF4A 1X6GA 1KFZA 3RNJA 2I0NA 2M0YA 3QWXX 5IXFA 2AK5A 4HXJA 1ZLMA 1JEGA 1FMKA 1HSQA 3NPFA 1Z9ZA 3EG3A 2EQIA 2HDAA 4E6RA 2O9SA 1W1FA 2CT4A 1AWWA 1RLPC 3O5ZA 4HVWA 4JZ3A 2DA9A 4K11A 2JS2A 1UDLA 2K6DA 1SRMA 2F2WA 2LJ3A 2EKHA 2K3BA 1TG0A 4JJBA 4CC7A 4J9FA 2FEIA 5FWCA 3ZL7C 4CC3A 2CUBA 1GCQA 1J3TA 3SEMA 3CQTA 4LUEA 1WA7A 2YUOA 1WDXA 4J9CA 2J06A 1LCKA 1NYGA 1YN8A 1XOVA 1G2BA 1WXUA 1T3LA 3PVLA 1WFWA 3PE0A 2V1QA 2L3PA 1E6HA 1ZX6A 2GGRA 2DL7A 4CC2A 2A37A 4J9GA 1GBRA 4LE9A 4M4ZA 4ORZA 4RTZA 4A63B 1YNZA 3C0CA 1M8MA 2J6KA 1AWOA 2BZYA 3NHNA 1PRLC 2DF6A 2K79A 4ESRA 2EVRA 3H41A 2JM9A 2L2PA 4AG1C 1SPKA 1BK2A 1K1ZA 4RTYA 1PNJA 2GNCA 1ZUYA 1X2QA 1K0SA 2RQUA 2NWMA 2HBWA 1WYXA 2DMOA 2AKKA 3QWYA 2KBTA 1X43A 1W6XA 4X1VA 5FW9A 2W10A 1QCFA 1S1NA 2EGAA 5I22A 1NLOC 4RTVA 3EGUA 2FG0A 1E6GA 4EIKA 2ESWA 2GBQA 2DX1A 4F16A 1ZSGA 2FRYA 1GL5A 1K0XA 2DL5A 1RI9A 2K2MA 2RQTA 2K9GA 1GBQA 2LMJA 2CSQA 4J9EA 2RQVA 4DEXA 5HCKA 1PHTA 1CSKA 2D8JA 2PTKA 2YUQA 2L3SA 1GFCA 2JMCA 1AOJA 1JQQA 3VS0A 1H92A 1JXMA 3TSWA 2VKNA 1A0NB 1SRLA 1YP5A 4HCKA 4F14A 1UJYA 2E5KA 4AFSC 3EG2A 1B07A 5IXBA 1OOTA 2ENMA 1NG2A 3RBBB 2KRSA 1UJ0A 1WXTA 3EHRA 2YUNA 1SSHA 2BZXA 2ED0A 1NLPC 4J9IA 3M0QA 5IHKA 3FJ5A 2CDTA 4LUDA 1WLPB 2CUDA 1QLYA 3TVTA 1UECA 1QWEA 4D8KA 2BTTA 2LP5A 1AVZC 3GBQA 1T0HA 1K76A 1TUDA 1X69A 1X6BA 3VS4A 1MV3A 1AWJA 1I07A 1PRMC 2JMAA 3VS6A 2C0OA 1AZGB 2DVJA 1UGVA 2FO0A 5GJVB 3I9QA 4RTXA 1X27A 1M3BA 1NEGA 2RPNA 1NM7A 3JV3A 2JT4A 4JJDA 1JU5C 3NGPA 2L0AA 1B3QA 1RLQC 1M27C 2FRWA 1YWOA 1YCSB 4CC4B 1OPLA 2X3XD 3A98A 2RQWA 2SEMA 2LNHB 2O31A 1CKBA 3VRYA 5FWBA 2RQRA 2LQWA 1WXBA 3REBB 1QKXA 1V1CA 2DBKA 3PVQA 2C0TA 4J9HA 1UUEA 4KRTA 1HD3A 2SRCA 2BZ8A 4OMMA 2KRNA 2H8HA 1W70A 1QKWA 1EFNA 2EPDA 1UTIA 1AWXA 5ECAA 1GCPA 5GJWB 5IH2A 3I5SA 1CKAA 2A08A 2A28A 1UG1A 2QDLA 1KJWA 4RTWA 2DE0X 1I0CA 1WX6A 2JTEA 1I1JA 2OI3A 4ZNXA 2W0ZA 1H8KA 1T3SA 2O2OA 1ABOA 1VYVA 2JW4A 3U23A 4OMOA 3M0RA 1KIKA 1GCQC 2O88A 1U3OA 2KGTA 1JXOA 2FPEA 2KNBB
chains in the Genus database with same CATH superfamily
3EG1A 3I5RA 1W2BA 2LCCA 4JLIA 5IHNA 4RCCA 1O9SA 2DTIA 2C06A 2J7IA 4LDWA 4ELYC 3G4ST 4RMOA 3OYEA 2RHYA 3OSVA 1N5ZA 3L1AA 2KE9A 1BIAA 3EG9A 4FSSA 1BB9A 4C5IA 1YFNA 3OYGA 3CCMQ 2K57A 2XI9A 5KYUB 2DBMA 2KXCA 2G6FX 1V76A 2PZ1A 4M7AE 2RD1A 1PWTA 4J5YA 5EC7A 1KC8U 1SG5A 4J6XA 2HD0A 1BYMA 4E7ZA 1VQ9T 2HSEB 1JO8A 2OTJA 1VQ6T 1MUZA 4M77D 1M4ZA 3OSSC 5D6XA 1M5Q1 2R58A 2EYWA 1ZSZA 2KXDA 3I56T 3CCUQ 4EMKC 2X4WA 4QT7A 3VV0A 2KYBA 2QYZA 1M90R 3GOXA 4ATOA 4OP0A 3JCMe 4DBFA 2V1RA 2RN8A 1IGUA 3JCMJ 2DPPB 2Y90A 2HKQB 5KE3A 2MK5A 1UE9A 3QUIA 4II1A 2DXTA 4OB2B 1HK9A 1R0BG 1YITT 3ULRB 2MIOA 2LQNA 2JXBA 1JJ2S 2DL8A 2B8AA 1G8XA 5GAMh 2DO3A 2JVVA 1QP3A 1ZBJA 1YJNA 4Z88A 2KT1A 4R56A 2OAWA 5I2MA 3VS2A 3EH1A 1NJIC 2PNIA 5GMKm 2QXFA 3JCMc 4LN2A 1F1BB 1B7TA 3OW2A 1OX9A 1YJNT 4C92F 3R6NA 5KE2A 1VYUA 4OMQA 1VQ4Q 4IIOA 4BDYA 4BDZA 2RHUA 2JOYA 3VRZA 2MWOA 3KFVA 4GY5A 3M55A 3A5ZB 5CKEA 3G1JA 3SWNA 5LJ5d 1WHLA 3HFOA 3G7ZA 1UHFA 2CREA 1VQKQ 5LJ5g 3NMZC 4N4GA 3OQ5A 1ABQA 4BE2A 4M7AF 2R5AA 2EFIA 2YWWA 4Y28E 2DTOA 4GLKA 5GAN4 4J9DA 2XKOC 1K4US 4M75B 1VQ8A 3KBGA 5CO7A 2KEAA 1UFFA 1PKTA 4M77C 4QVZA 2VYTA 2QTVA 3C4SA 2RI3A 3EGXB 3HL8A 5I11A 1C6VX 5CQXA 1YBYA 3CCJA 1XNIA 3GIBA 2R5MA 3C94A 4NL3A 4M7DG 2E12A 1S72A 2EGEA 1KFZA 5LJ3h 3RNJA 1ZLMA 1JEGA 2X9HA 1Z9ZA 1LOJA 2EQIA 3JB9J 1YIJT 2O9SA 4M78A 2HAXA 3CCJT 1JBMA 4N4HA 4IUTA 4HKEA 3RMQA 1YJWT 1JJ2A 1DJ7B 2WSCE 4K11A 2HMAA 2VGNA 1RAEB 3RKXA 2OTLT 2LJ3A 3UT1A 2EKHA 4PJOC 1X75C 2RK1A 4BI4A 4E7SA 3JRZA 4CC7A 4B9WA 4MDWA 3X25B 4BE0A 1WA7A 2YUOA 2J06A 4PKCC 1QMCA 3OYYA 1G2BA 3INZA 3EH2A 1RADB 1VUBA 1E6HA 2GGRA 5J3BA 2DL7A 2E4HA 3MEWA 4CC2A 4JRIA 2VB6A 3JB9F 1GBRA 1KG1A 1KQ1A 2AIRB 4A63B 1M90U 1YNZA 3C0CA 2K3XA 2JJ9A 3M9QA 2J6KA 1AWOA 1TSFA 4BI8B 1R8OB 3P8BB 3Q1JA 2DF6A 3OMGA 4LDXA 2OTJQ 1D09B 4AG1C 1SPKA 2VV5A 1U8RA 5GANh 4OB3B 4JUVA 1WNLA 3QZ5B 1VIEA 3JCMQ 2DMOA 1MHNA 1RAHB 2HBPA 1W4SA 4XTXA 4C8QG 1KQSP 2ZGWA 1N9RA 4X1VA 4RG2A 5GAOl 2W10A 4KGVB 1Q86C 1K73C 2LX9A 2FZKB 1N8RR 1VQ5A 2YRCA 3OBYA 5I22A 1QCNA 2FG0A 1V29B 2OAUA 2ESWA 5GAOq 4XQ3A 2GBQA 3FRNA 1G5VA 4F16A 2VXEA 1GL5A 1ZHIA 1W2BP 2QAZA 2RM4A 2X35A 2NUTB 4J9EA 5CIUA 1LPLA 1CSKA 2D8JA 1D3BB 2HQXA 2YUQA 2XD0A 4R55A 3CCEA 2JMCA 5A0GA 1ZSZB 3VS0A 2E3IA 2VKNA 2V8IA 1YJNQ 3QG1A 2DERA 2CZ1B 4RG8A 3CBPA 3QHSA 4C92B 4F14A 3FLGA 2E5KA 3JB9H 5IXBA 3RBBB 2CP5A 3CCET 2YUNA 1SSHA 1VQMT 3M0QA 3FJ5A 1WLPB 3VUBA 5GAMg 4M7AB 1YI2A 4C92G 4LDVA 1UECA 5D6YA 2BTTA 2LP5A 4XU2A 1AVZC 1MNEA 3QBYA 3VS4A 4IUPA 4J7FA 1AWJA 1PRMC 1K9MC 1Q82U 5CKDA 3EFSA 4ZGJB 3P8HA 4QW2A 4A4HA 2RJCA 5GJVB 4RTXA 2RPNA 2K5LA 4IURA 3CMAA 4M7AG 3JV3A 3JSCA 3JCMP 2JT4A 1VQ8Q 1JU5C 3NGPA 2NYSA 4OB1B 4MMKA 2ZPGB 3HSBA 4DQ2A 3TU4K 2X3XD 2SEMA 2X4JA 3PMTA 4XTWA 5FWBA 2LQWA 1QKXA 3CCJQ 3G71A 1TU0B 2D9TA 3V7CA 1Y96B 4PJLA 3OYKA 2XHCA 5KYNA 3SWNB 1HD3A 1S72Q 5KCHA 2BZ8A 3E19A 2H8HA 4ME7A 3CCVA 2GQVA 4ZTJA 1MMGA 2EPDA 1UTIA 3DKMA 1PCXA 2KQWA 3M54A 1GCPA 3G71T 3I5SA 2A28A 3CCMT 3LX7A 4RTWA 1N6AA 1I0CA 1Q81R 2BE7D 2JTEA 3HFNA 4F7UA 2W0ZA 4C0ZA 3M56A 5LJ3d 3M0RA 3CCVT 2K3YA 2QQ9A 4OGCA 2RJFA 2KGTA 3I55A 2KY9A 2CP6A 2KNBB 2JZ2A 3OW2P 1M30A 5A0LA 4M75E 3P8DA 1IO6A 1B34A 4ZTFA 3OYFA 1KQSS 1VYTA 2LJ0A 3TSZA 4RCBA 1D0YA 4PJOA 3TCJA 8AT1B 1OV3A 4M78B 1ZQ1A 4D6WA 3I55T 4GBQA 3CCUT 1YJ9A 3JB9G 2XU8A 4DOVA 1N8RU 2LJ1A 1W2BS 1KHCA 1TOVA 1OYXA 5FU7C 2AKLA 1H641 2J6FA 2AHJB 4M77F 3VYHB 1PSFA 1OZ3A 3JCMh 3E9GA 1AD5A 2MMPA 3VS7A 1Q7YC 1WI7A 2CYZB 2MI6A 1NPPA 2NUZA 2MF2A 5LJ3j 1OQKA 1BI2A 4FU6A 4J8OA 2CSIA 3CD6A 2HEQA 5IHIA 4AFUC 2KMTA 1QW1A 2L3QA 2KROA 2ZPEB 2L5QA 1VQ5Q 5EG2A 2D6FA 2JN0A 2DTHA 2DK3A 1M3CA 1GFDA 5GAN7 2WSFE 1KK7A 5GANd 2FZCB 1G83A 2XMFA 2CH4W 1ARKA 2M51A 4E2FB 3REAB 1QP2A 2EGCA 1JJ2P 1UGRB 1Z9QA 1OX8A 2ZPIB 3OA6A 2RH2A 1M2VB 4O5VA 1GRIA 2KRMA 3MP6A 5KYYA 1VQOA 3CCEQ 4PFZA 1HJDA 1MMNA 2M16A 1FYNA 1VQ4T 1RUWA 3QKJA 3JCMV 2RF0A 1D1CA 5I2SA 4Z89A 2KI7A 4LNPA 2WACA 3QDFA 4J9BA 1VQKT 4AFZC 1IHVA 5KYXA 2MAMA 2V26A 2GQIA 1IZ6A 2P84A 4OMFB 1BCMA 2KK4A 2VGMA 4A53A 4EMKB 1YI2Q 4WTOB 4Z8AA 4QVDA 3QZ9B 3CCSA 2J6OA 5LL6S 2Z0WA 5GANj 3TREA 4HCBA 3H0HA 3PT9A 1QVPA 4FYYB 3X24B 3FEOA 3CMAQ 3VYGA 1YHQA 1UHCA 5KYWB 1UGSB 3CCST 2PUOB 2VASA 4V2SA 2LT4A 3V8JA 3VS5A 1VA7A 3MO8A 5HKCA 3QJ6A 2GTOA 4HCCA 4C92E 4AT1B 2DM1A 3BDUA 3OW2S 1YHQT 1Q81U 3G71Q 4C8QA 1TXQA 4N0AA 4CI0C 5GAN8 1QCOA 2LT1A 1SHFA 2MYSA 3I35A 1NE8A 2EYZA 4MMLA 3L2WA 3ZFJA 4OMLA 3A8LB 3QXEB 3A8MB 3J81E 1WPYA 3CCVQ 4QKUA 2XDDA 4GLMA 2LVMA 4WF2A 4PJJA 1FXXA 4RUGA 1RAIB 6AT1B 3SFMA 2K5IA 1KD1C 2GTJA 4R0KA 8ATCB 2IG0A 2OX7A 1X2KA 1Q86R 1K73R 2DRMA 2FHDA 2I0NA 2NUPA 3WVEB 2HKNA 2AK5A 4FT4A 2P0PA 2HDAA 4E6RA 1W1FA 2O01E 3I55Q 1RLPC 3EFOB 2HNIA 3O5ZA 4ZN1A 3HKSA 4JZ3A 2DA9A 3HPWA 3L2ZA 2OTJT 5DLOA 1SRMA 2F2WA 4XU3A 5GMKi 2ZCFB 4JJBA 4M77B 4J9FA 4CC3A 5FWCA 3J80E 3SEMA 4XTVA 1YJ9Q 1WDXA 1YN8A 2COZA 3URGA 4OGEA 1R0CB 1RAAB 3CCRA 4PJOD 1EZZB 2X4XA 5DY9A 3PE0A 2V1QA 4KBMB 3S6WA 2DYIA 1ZX6A 3A1PA 2O4XB 4M77G 1EIFA 4E7KA 1MNDA 2F5KA 3ER0A 5GMKj 5GAOn 4RTZA 1R77A 1N9SA 4O6JA 3FC3A 1KC8C 2FVUA 3CCRT 3S3NA 2M1HA 3CD6Q 1WHGA 3M4YA 2EVRA 2L2PA 2RJEA 3JCMd 4RTYA 5GAN6 4F04B 4KGZB 1VQLA 3JCMg 1Y71A 3EAEA 2P0QA 2AKKA 3QWYA 3OS1A 1X43A 1W6XA 2BE9B 3ME9A 4QQDA 1H3ZA 4XU0A 2KSSA 4M78E 9ATCB 2GFAA 1E6GA 1VQOQ 2E5QA 2VUBA 2E3HA 1ZSGA 1RI9A 2RQTA 4M7DD 2K9GA 2CP0A 3MKDA 5GAN5 2EIFA 2PTKA 1ZA2B 2BUDA 1VQPA 2DEQA 2QK0A 3MEAA 2RB6A 4HCKA 2QGFB 1UJYA 1M1GA 1VQ8T 2RHXA 4M75G 4A4EA 3DB4A 3M5AA 2EJGA 1UJ0A 2FZGB 3WXMB 3EHRA 2CZ6B 3H9NA 3CCSQ 2BZXA 2CP2A 2CDTA 4LUDA 1VQ7A 2L8DA 2CUDA 3O8VA 3LGLA 1QLYA 4UC4A 1K8AR 2MWPA 5LJ5j 4D8KA 1LNXA 4AMCA 3GBQA 1S72T 1YHQQ 2EWNA 4IUVA 4XK8E 1I07A 3QDRB 2JMAA 3VS6A 4KUDK 3GP8A 2DVJA 1RI0A 2QQSA 4YTLA 5KYXB 3CCQA 1UGPB 3PFSA 1NEGA 3GPLA 4QQ6A 5GAOp 5CAIA 1Q86U 1G3YA 4JJDA 4ZGDB 3MPUB 2HQHA 3MEUA 4IUQA 4CC4B 4DBRA 3CCQT 3UPUA 2DXUA 2O31A 4LDUA 2PVGB 1Q7YR 1CKBA 2XIDA 3CEYA 3VRYA 4JLGA 4C8QD 3GF5A 1WXBA 3CCLA 4A4KA 3PVQA 4E7LA 2C0TA 4N4IA 2A3LA 1D0ZA 1UUEA 2DZ9A 3QYGB 4OMMA 1BIBA 3RKWA 4M78F 3VJPA 2E1HA 5CCAA 1O75A 5CKBA 3RKYA 4ANJA 1IB8A 4A54A 1AWXA 3EG9B 1I8FA 5ECAA 1PD0A 5L8RE 3CCLT 3SD4A 4M7DC 4JRPA 2QTXA 1KJWA 1WX6A 4A4GA 2D0QB 3JCMW 2JW4A 2E10A 4OMOA 4HT9A 3X28B 4Z02A 1KIKA 2O88A 1U3OA 2DXBA 1W70A 2FPFA 4KUIA 4PLLA 3M0PA 5C0MA 2ROLA 1M3AA 2K7AA 3RERA 1VQ5T 1FWZA 3ZBDA 2EQJA 3CCRQ 3EGDA 4OB0B 2PU9B 2ROTA 3IQLA 3L2QA 1OEBA 4WCIA 1QWFA 2DFUA 3J7AF 1U06A 2CP3A 2GF7A 4FM4B 4JZ4A 2X51A 2CZ7B 1Y7XA 4OVAA 1WGSA 2DJZA 3D7SB 3SHWA 2COYA 5LJ5f 2ZZDA 4FW1A 1E7OA 2E65A 5GAMd 5M9OA 2YRVA 1ACMB 2DL3A 1BBZA 4M7AD 4AFQC 4L6V5 1VQLQ 5FROA 1BU1A 2Y4XA 1H3HA 1UEBA 4EMGA 2GFUA 2EBPA 1WJQA 4M77E 4XTYA 2FYKA 2DAQA 4IKFA 3VS1A 2DIQA 1QVFS 2KVQG 2AZVA 2DIGA 2E6ZA 1YI2T 2DLPA 4C8QC 4N0AC 5D6WA 2Y4YA 3V7RA 1TUCA 1JRIA 2LRQA 3M0TA 2MPXC 4F7UE 2DEUA 4NS5A 2DJQA 4LD6A 4HT8A 5FU7B 4FL6A 1TWBA 1VQPQ 4XU1A 1I4K1 1K8AU 1WJSA 4IUUA 3RMSA 2X4YA 4OMPA 3CMAT 1QVGA 5LJ3e 5GAMj 2DZCA 4MZPA 2F2XA 4FW2A 1VQ7Q 2E41A 3T9NA 2D1XA 2QA4A 3LH0A 4QVCA 4KH1B 1G3WA 1Q82C 3TEEA 3BW1A 2F2VA 3CC2A 2YHTA 3CCQQ 3H0IA 1M9SA 3OYIA 2CP7A 1SSFA 4RTTA 3G6EA 3BY7A 3EG0A 3RDVA 1AZEA 2VWFA 3QIIA 2OJ2A 1K9AA 1PKSA 4Q5WA 1TS9A 4ELZC 1KSWA 3MJXA 1WHMA 2DRKA 2EW3A 4JS4A 3CPFA 3V7SA 4M7AC 2ECZA 4DA4A 1ZUUA 3G6ET 2ABLA 5GAN3 4HVUA 4C0DC 2HL5C 3CCLQ 3RIRA 1HXDA 3E2UA 1SKUB 1QVFA 2JS0A 5FU6C 5GANe 1NJIR 1M1KC 1Q95G 1D1BA 1OZ2A 3OS2A 4M78G 2O9VA 2E64A 4P5NA 4XTZA 1YJ9T 4KH0B 4OMNA 1YWPA 2EJFA 3M58A 4RTUA 4F7UF 3CMEA 4FSXA 3C95A 3UATA 1M2OA 1U5SA 2YUPA 1WJRA 3UF4A 3QWXX 5CR2A 4C0GA 4HXJA 2CKKA 4PLIA 1BCOA 2LQKA 3NPFA 3EG3A 2QGGA 3OYJA 1AWWA 2JUFA 2BIVA 2E70A 4TVRA 4PJNA 1BI0A 2QQBA 4C5GA 1RAFB 4BY6C 4M75A 3CD6T 4M7DA 4DBHA 4LXCA 1UDLA 1C0MA 2K6DA 4PJOF 1RL2A 2KDSA 1TG0A 5GAMf 5KH6A 3CQTA 4LUEA 3CPWS 1LCKA 5HK0A 4BI3A 1XOVA 2RK2A 1T3LA 3PVLA 1WFWA 1VQOT 1MMAA 4J9GA 4M4ZA 4ORZA 1M8MA 4CRIA 2LQ8A 2DD5A 5GMKl 1PRLC 2K79A 1MGQA 2M9UA 2JM9A 5FRNA 1PNJA 2GNCA 2HQEA 4E7HA 1N27A 1ZUYA 4NL2A 1X2QA 1K0SA 2XG8D 2HBWA 3X20B 2CZ0B 1HYOA 2KBTA 3SDZA 2KAFA 1ZA1B 1QCFA 3ASKA 3G4SA 5HY6A 3LLRA 4X9DA 2AT1B 4RTVA 4MDXA 1NZ9A 4J83A 2LNVA 4EIKA 5GMKe 1ZBXA 3S3OA 2DX1A 4KULA 2FRYA 1K0XA 2K2MA 4DEXA 2RQVA 2F1LA 2P4TA 5HCKA 4J6WA 2L3SA 4ZGEB 2HL3A 1AOJA 5LJ3f 2F69A 1JQQA 2CS7A 1H92A 1JXMA 3LWHA 2K5FA 1YP5A 1PD1A 4Y91A 3RR6A 5KCOA 3EFRA 1WHKA 4AFSC 2EQMA 3H6ZA 1OOTA 2QA4Q 1VQ9A 2KRSA 2JTMA 4FT2A 3MCAB 1VQ6A 3OS5A 1KQ2A 2ED0A 5IHKA 3JB9I 3CC2Q 3CPWA 3NTHA 4RKUE 3I56A 3TVTA 4L5GA 5CKHA 3G6EQ 1T0HA 3A8GB 1X69A 1X6BA 3N5BB 1MV3A 2NUTA 3FJPA 1NJIU 3M4GA 4BB7A 3A8OB 1AZGB 2NLUA 1UGVA 3L2UA 1D3BA 4FYXB 4QQGA 2QASA 3I9QA 3GNGA 2G3RA 1M3BA 3BE3A 3DLMA 4KGXB 4C8QF 3CXCA 4LD9K 4C92A 4PJMA 2LC4A 1RACB 1Y07A 1YITA 1Q81C 2XICA 4F7UB 3X26B 1RLQC 2VXFA 1M27C 3MP8A 1YWOA 1YCSB 2QEXA 1OPLA 3A98A 2COWA 2PVDB 3OYLA 2LNHB 3PIOA 4HCZA 2RQRA 1BKBA 5GANf 5LJ5e 4M7AA 2DBKA 1B34B 3META 3CMEQ 4KRTA 3FDRA 4F7UG 2YLBA 4MZTA 1QVGP 1K9MR 4PJOB 1OU8A 2QEXT 4E7JA 1QKWA 2K2VA 3BDLA 4FCYA 3PIPA 5GJWB 5IH2A 3CC4A 1CKAA 1UGQB 2IVWA 4BUGA 2DE0X 1I1JA 3FB9A 4ZNXA 1EX4A 4PJOG 3U23A 1GCQC 3JAME 2FPEA 1UG1A 1RABB 1VQLT 3KXTA 2KT8A 5I21A 2YXYA 2QG9B 4M75D 3CC4T 1OPKA 1U1SA 3V8LA 1Y96A 3M0SA 1FMWA 1QQJA 2RHIA 3THKA 2EYXA 1BI1A 4DOWA 3E9FA 3JCMb 2LX7A 4BD3A 1KHIA 3VU3C 1FMVA 4BACA 3LYIA 3WVDB 1OU9A 1IHWA 5D7UA 2EQKA 2LZ6B 1WIEA 4M7DB 3FIFA 1UB4A 2DYBA 2FB7A 3HHTB 3HRUA 4E47A 2ATCB 1PSEA 3M0UA 5KYYB 1VQPT 3KUFA 1Q82R 1M1FA 2VVKA 1QVFP 2RMOA 1XJWB 1YIJA 3HRTA 2YDLA 2D0NA 4B6MA 1WZOA 2HSPA 1AHJB 1YJWA 2V8KA 1WQWA 4PFPA 4Y92A 3AT1B 4L59A 2DL4A 3BFMA 2PVOB 2YRDA 1RAGB 2OTLA 4IIMA 1Y0MA 3G4SQ 3PMIA 3OYDA 2JNGA 3UA6A 3M57A 2JM8A 5FRMA 4BE1A 2X3WD 1VQ7T 4HA8A 1SF9A 3CBOA 1G3SA 2KR3A 5CQYA 4EPCA 3EHQA 2DNUA 1NEBA 1K73U 2CT3A 1Y57A 2XDPA 2R57A 1ZUKA 5DM7R 1NYFA 2B86A 4KT0E 1SHGA 3UA7A 2IIMA 2DILA 1AEYA 1M1KR 4J6YA 5A0DA 2C0IA 3OMCA 2DXCA 3UDCA 2EYYA 1M8VA 3VS3A 4HVVA 1MV0B 2MOXA 2LCSA 1JB0E 4A4FA 1VQ9Q 4OF1A 2A36A 1VQ6Q 2M0OA 3OY9A 1IRXA 2ZPBB 4PK4A 4MZMA 3PGGA 4F17A 1VOMA 3R6OA 2RNAA 2I2LA 1TUGB 4M75C 3I56Q 2L3RA 4C8QB 2P0KA 1WHHA 2EQUA 3LGFA 1VQNA 2HCKA 2EJ9A 2YLCA 2QDYB 3LH5A 1T0JA 1QVGS 3OS0A 1M2VA 5CVIA 4AG2C 4D8DA 4VUBA 4E7IA 1P92A 3QSUA 1GXIE 3DB3A 2P4RA 1SEMA 4X9CA 5GAMe 1VQNT 1K9MU 1YITQ 2NUPB 1OI1A 2D8HA 2MCNA 5IT9E 2CH4A 3DLLA 2FPDA 4J7IA 4C5HA 2K4YA 2QEXQ 1U1TA 5CKFA 3JCMf 1WHJA 1AT1B 2YSQA 4C92D 1YCYA 2AZSA 3QO3A 2H3EB 1M90C 3PTAA 4EMHA 4EMKA 3OYBA 2RO0A 3QJYA 4XAXB 3M59A 3OYAA 3H0FA 1FX7A 3OBWA 2CGHA 2H3JA 2J05A 4DEYA 4JPBW 1VQMA 3A8HB 3PNWC 3MEVA 5GAOr 4JJCA 5IN1A 2YT6A 3SB2A 3C12A 1I5OB 2ED1A 3LWIA 3CC4Q 1X6OA 4PNOA 2KYMA 5L23A 4FIBA 2L89A 1X6GA 5KYWA 2M0YA 2EAYA 2E6NA 5IXFA 2GCXA 1FMKA 1HSQA 3S3MA 2PUKB 2CT4A 3OYCA 3CC7A 3CPWP 4HVWA 4C0DB 1NBEB 2JS2A 4JDSA 3ZEHA 1BI3A 1TH7A 2K3BA 3GNFB 5KYUA 5A2QE 5FU6B 2QQRA 2FEIA 3ZL7C 1IXDA 3TQ7P 2BKDN 2CUBA 1GCQA 1G3TA 1J3TA 3CC7T 4J9CA 2LTOA 3L2VA 1NYGA 3NFCA 3CXCP 1KD1R 1WXUA 4JJNK 4PJOE 2L3PA 5J26A 2HZYA 2A37A 2DETA 2EKOA 5C6SA 4LE9A 1YIJQ 3EFOA 5GMKh 1PC0A 3UWNA 1YJWQ 3CCMA 2BZYA 3NHNA 4ZN3A 4BY6B 4EDUA 2RJDA 4ESRA 1M1KU 2OTLQ 2DD4A 3H41A 3CBMA 1ZSZC 1BK2A 2VC8A 1K1ZA 4M77A 1Q7YU 2LCLA 3JB9D 3RESA 2RQUA 4C92C 2NWMA 2ZAEA 1WYXA 3VUZA 2XDBA 1I81A 2QA4T 5FW9A 4JRKA 1S1NA 5CK9A 2QI2A 5GAOm 2RI5A 2EGAA 3OYHA 3AHUA 5IAYA 3LW5E 1NLOC 4M78D 1I5LA 3CC2T 2ZPHB 3HRSA 3EGUA 2O4XA 1OULA 5LJ3g 3CCUA 1TTHB 1XQHA 1K8AC 5DLQE 2DL5A 2DVEA 4M7DE 3V8KA 1WQ7A 1GBQA 4JRQA 1KC8R 2LMJA 2CSQA 3HP9A 2RI2A 3NTIA 1PHTA 1GFCA 3H8ZA 3TSWA 3MP1A 1A0NB 3JCMX 2ZPFB 1SRLA 4B9XA 3OYNA 2DKGA 3EG2A 2A0FB 1B07A 4XTUA 2ENMA 1NG2A 4LDYA 3QPHA 3OYMA 1VQNQ 1WXTA 1NLPC 4J9IA 3M53A 4C5EA 1MMDA 3E1SA 2EYQA 1QWEA 3CMET 3QYHB 1K76A 3SWNC 1TUDA 2PQWA 5LJ5h 1VIFA 5GAN2 1D1AA 2C0OA 5FLXE 5J39A 2FO0A 1X27A 3EGXA 1VQ4A 5HK3A 1NM7A 2F5TX 2LDMA 5GANg 1N8RC 3L2RA 2A7YA 4JS5A 1D0XA 2L0AA 1B3QA 2XK0A 7AT1B 2FRWA 4PL6A 1VQKA 1XTDA 2RQWA 3NTKA 1VQMQ 3VKIA 4C0FA 1LVKA 3L42A 2IPOB 4DBQA 4C8QE 2FL7A 2WSEE 3REBB 1V1CA 3MHXA 1IGQA 1X01A 4J9HA 3GLXA 4PFOA 3CXCS 4FYWB 3EGDB 3RUXA 2SRCA 1LJOA 2KRNA 4M78C 2QQAA 1EFNA 4NOYA 2M02A 2RHZA 3F70A 5AYFA 1KQSA 4M75F 1KD1U 3CC7Q 4M7DF 2A08A 2QDLA 2RA2A 1PG5B 4X34A 2OI3A 4FYVB 3HTRA 2JTFA 1H8KA 1T3SA 2O2OA 1ABOA 1C1AA 1VYVA 1PM3A 3OB9A 5AT1B 1JXOA 1IREB 1NPRA 2V8JA
chains in the Genus database with same CATH topology
2FPFA 3EG1A 3I5RA 3M0PA 2KT8A 1M30A 5IHNA 2ROLA 1M3AA 1OPKA 2J7IA 1IO6A 2K7AA 3M0SA 1VYTA 2LJ0A 3TSZA 3THKA 2EYXA 2ROTA 2LX7A 3IQLA 1OEBA 1OV3A 4WCIA 1QWFA 1N5ZA 4GBQA 1U06A 2KE9A 4FSSA 4JZ4A 1BB9A 2LZ6B 1WIEA 2LJ1A 2DYBA 3SHWA 2AKLA 2J6FA 2DBMA 3M0UA 2KXCA 1E7OA 1AD5A 2G6FX 2VVKA 2DL3A 2RMOA 3VS7A 1BBZA 2PZ1A 2YDLA 1PWTA 1WI7A 2D0NA 4AFQC 5EC7A 2HSPA 2NUZA 4Y92A 2DL4A 1BU1A 2CSIA 2HEQA 1JO8A 5IHIA 4AFUC 1H3HA 1MUZA 1Y0MA 4IIMA 2L3QA 2KROA 2EBPA 3UA6A 2JM8A 2X3WD 2EYWA 1M3CA 1GFDA 3VS1A 2KXDA 2AZVA 2KR3A 2DLPA 1G83A 3EHQA 4QT7A 2DNUA 2CH4W 1TUCA 2KYBA 2XMFA 3M0TA 1ARKA 1NEBA 2CT3A 2M51A 1Y57A 3REAB 2EGCA 1ZUKA 2DJQA 1NYFA 1Z9QA 2B86A 2V1RA 2RN8A 1SHGA 3UA7A 1GRIA 2DILA 2IIMA 2KRMA 1AEYA 1HJDA 2C0IA 1UE9A 1FYNA 4OMPA 2EYYA 1RUWA 3VS3A 4HVVA 2RF0A 1MV0B 3ULRB 2MOXA 2LCSA 4Z89A 2MIOA 4LNPA 2LQNA 2JXBA 2DL8A 2F2XA 4J9BA 2A36A 4AFZC 1ZBJA 4Z88A 4F17A 2GQIA 2RNAA 2KT1A 2OAWA 2D1XA 3VS2A 2HCKA 4Z8AA 3LH5A 1T0JA 2PNIA 2J6OA 4LN2A 2F2VA 3H0HA 4AG2C 4D8DA 3H0IA 3R6NA 1VYUA 4OMQA 4RTTA 4IIOA 2P4RA 1SEMA 3EG0A 3VRZA 3KFVA 1AZEA 1UHCA 2VWFA 2OJ2A 2D8HA 2MCNA 1K9AA 1PKSA 1UHFA 2CH4A 2CREA 2FPDA 1KSWA 3NMZC 3VS5A 1VA7A 2DRKA 1ABQA 2EW3A 2YSQA 2GTOA 2ECZA 2DM1A 1ZUUA 2AZSA 2ABLA 4J9DA 4HVUA 1K4US 2KEAA 1SHFA 3H0FA 3I35A 1UFFA 2EYZA 2J05A 1PKTA 2JS0A 4OMLA 4DEYA 4JPBW 2O9VA 4JJCA 2YT6A 4GLMA 5I11A 4OMNA 4RUGA 2ED1A 1YWPA 4RTUA 2GTJA 4R0KA 2KYMA 5L23A 3UATA 1X2KA 1U5SA 2YUPA 2EGEA 2DRMA 3UF4A 1X6GA 1KFZA 3RNJA 2I0NA 2M0YA 3QWXX 5IXFA 2AK5A 4HXJA 1ZLMA 1JEGA 1FMKA 1HSQA 3NPFA 1Z9ZA 3EG3A 2EQIA 2HDAA 4E6RA 2O9SA 1W1FA 2CT4A 1AWWA 1RLPC 3O5ZA 4HVWA 4JZ3A 2DA9A 4K11A 2JS2A 1UDLA 2K6DA 1SRMA 2F2WA 2LJ3A 2EKHA 2K3BA 1TG0A 4JJBA 4CC7A 4J9FA 2FEIA 5FWCA 3ZL7C 4CC3A 2CUBA 1GCQA 1J3TA 3SEMA 3CQTA 4LUEA 1WA7A 2YUOA 1WDXA 4J9CA 2J06A 1LCKA 1NYGA 1YN8A 1XOVA 1G2BA 1WXUA 1T3LA 3PVLA 1WFWA 3PE0A 2V1QA 2L3PA 1E6HA 1ZX6A 2GGRA 2DL7A 4CC2A 2A37A 4J9GA 1GBRA 4LE9A 4M4ZA 4ORZA 4RTZA 4A63B 1YNZA 3C0CA 1M8MA 2J6KA 1AWOA 2BZYA 3NHNA 1PRLC 2DF6A 2K79A 4ESRA 2EVRA 3H41A 2JM9A 2L2PA 4AG1C 1SPKA 1BK2A 1K1ZA 4RTYA 1PNJA 2GNCA 1ZUYA 1X2QA 1K0SA 2RQUA 2NWMA 2HBWA 1WYXA 2DMOA 2AKKA 3QWYA 2KBTA 1X43A 1W6XA 4X1VA 5FW9A 2W10A 1QCFA 1S1NA 2EGAA 5I22A 1NLOC 4RTVA 3EGUA 2FG0A 1E6GA 4EIKA 2ESWA 2GBQA 2DX1A 4F16A 1ZSGA 2FRYA 1GL5A 1K0XA 2DL5A 1RI9A 2K2MA 2RQTA 2K9GA 1GBQA 2LMJA 2CSQA 4J9EA 2RQVA 4DEXA 5HCKA 1PHTA 1CSKA 2D8JA 2PTKA 2YUQA 2L3SA 1GFCA 2JMCA 1AOJA 1JQQA 3VS0A 1H92A 1JXMA 3TSWA 2VKNA 1A0NB 1SRLA 1YP5A 4HCKA 4F14A 1UJYA 2E5KA 4AFSC 3EG2A 1B07A 5IXBA 1OOTA 2ENMA 1NG2A 3RBBB 2KRSA 1UJ0A 1WXTA 3EHRA 2YUNA 1SSHA 2BZXA 2ED0A 1NLPC 4J9IA 3M0QA 5IHKA 3FJ5A 2CDTA 4LUDA 1WLPB 2CUDA 1QLYA 3TVTA 1UECA 1QWEA 4D8KA 2BTTA 2LP5A 1AVZC 3GBQA 1T0HA 1K76A 1TUDA 1X69A 1X6BA 3VS4A 1MV3A 1AWJA 1I07A 1PRMC 2JMAA 3VS6A 2C0OA 1AZGB 2DVJA 1UGVA 2FO0A 5GJVB 3I9QA 4RTXA 1X27A 1M3BA 1NEGA 2RPNA 1NM7A 3JV3A 2JT4A 4JJDA 1JU5C 3NGPA 2L0AA 1B3QA 1RLQC 1M27C 2FRWA 1YWOA 1YCSB 4CC4B 1OPLA 2X3XD 3A98A 2RQWA 2SEMA 2LNHB 2O31A 1CKBA 3VRYA 5FWBA 2RQRA 2LQWA 1WXBA 3REBB 1QKXA 1V1CA 2DBKA 3PVQA 2C0TA 4J9HA 1UUEA 4KRTA 1HD3A 2SRCA 2BZ8A 4OMMA 2KRNA 2H8HA 1W70A 1QKWA 1EFNA 2EPDA 1UTIA 1AWXA 5ECAA 1GCPA 5GJWB 5IH2A 3I5SA 1CKAA 2A08A 2A28A 1UG1A 2QDLA 1KJWA 4RTWA 2DE0X 1I0CA 1WX6A 2JTEA 1I1JA 2OI3A 4ZNXA 2W0ZA 1H8KA 1T3SA 2O2OA 1ABOA 1VYVA 2JW4A 3U23A 4OMOA 3M0RA 1KIKA 1GCQC 2O88A 1U3OA 2KGTA 1JXOA 2FPEA 2KNBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FPF A;  3EG1 A;  3I5R A;  3M0P A;  2KT8 A;  1M30 A;  5IHN A;  2ROL A;  1M3A A;  1OPK A;  2J7I A;  1IO6 A;  2K7A A;  3M0S A;  1VYT A;  2LJ0 A;  3TSZ A;  3THK A;  2EYX A;  2ROT A;  2LX7 A;  3IQL A;  1OEB A;  1OV3 A;  4WCI A;  1QWF A;  1N5Z A;  4GBQ A;  1U06 A;  2KE9 A;  4FSS A;  4JZ4 A;  1BB9 A;  2LZ6 B;  1WIE A;  2LJ1 A;  2DYB A;  3SHW A;  2AKL A;  2J6F A;  2DBM A;  3M0U A;  2KXC A;  1E7O A;  1AD5 A;  2G6F X;  2VVK A;  2DL3 A;  2RMO A;  3VS7 A;  1BBZ A;  2PZ1 A;  2YDL A;  1PWT A;  1WI7 A;  2D0N A;  4AFQ C;  5EC7 A;  2HSP A;  2NUZ A;  4Y92 A;  2DL4 A;  1BU1 A;  2CSI A;  2HEQ A;  1JO8 A;  5IHI A;  4AFU C;  1H3H A;  1MUZ A;  1Y0M A;  4IIM A;  2L3Q A;  2KRO A;  2EBP A;  3UA6 A;  2JM8 A;  2X3W D;  2EYW A;  1M3C A;  1GFD A;  3VS1 A;  2KXD A;  2AZV A;  2KR3 A;  2DLP A;  1G83 A;  3EHQ A;  4QT7 A;  2DNU A;  2CH4 W;  1TUC A;  2KYB A;  2XMF A;  3M0T A;  1ARK A;  1NEB A;  2CT3 A;  2M51 A;  1Y57 A;  3REA B;  2EGC A;  1ZUK A;  2DJQ A;  1NYF A;  1Z9Q A;  2B86 A;  2V1R A;  2RN8 A;  1SHG A;  3UA7 A;  1GRI A;  2DIL A;  2IIM A;  2KRM A;  1AEY A;  1HJD A;  2C0I A;  1UE9 A;  1FYN A;  4OMP A;  2EYY A;  1RUW A;  3VS3 A;  4HVV A;  2RF0 A;  1MV0 B;  3ULR B;  2MOX A;  2LCS A;  4Z89 A;  2MIO A;  4LNP A;  2LQN A;  2JXB A;  2DL8 A;  2F2X A;  4J9B A;  2A36 A;  4AFZ C;  1ZBJ A;  4Z88 A;  4F17 A;  2GQI A;  2RNA A;  2KT1 A;  2OAW A;  2D1X A;  3VS2 A;  2HCK A;  4Z8A A;  3LH5 A;  1T0J A;  2PNI A;  2J6O A;  4LN2 A;  2F2V A;  3H0H A;  4AG2 C;  4D8D A;  3H0I A;  3R6N A;  1VYU A;  4OMQ A;  4RTT A;  4IIO A;  2P4R A;  1SEM A;  3EG0 A;  3VRZ A;  3KFV A;  1AZE A;  1UHC A;  2VWF A;  2OJ2 A;  2D8H A;  2MCN A;  1K9A A;  1PKS A;  1UHF A;  2CH4 A;  2CRE A;  2FPD A;  1KSW A;  3NMZ C;  3VS5 A;  1VA7 A;  2DRK A;  1ABQ A;  2EW3 A;  2YSQ A;  2GTO A;  2ECZ A;  2DM1 A;  1ZUU A;  2AZS A;  2ABL A;  4J9D A;  4HVU A;  1K4U S;  2KEA A;  1SHF A;  3H0F A;  3I35 A;  1UFF A;  2EYZ A;  2J05 A;  1PKT A;  2JS0 A;  4OML A;  4DEY A;  4JPB W;  2O9V A;  4JJC A;  2YT6 A;  4GLM A;  5I11 A;  4OMN A;  4RUG A;  2ED1 A;  1YWP A;  4RTU A;  2GTJ A;  4R0K A;  2KYM A;  5L23 A;  3UAT A;  1X2K A;  1U5S A;  2YUP A;  2EGE A;  2DRM A;  3UF4 A;  1X6G A;  1KFZ A;  3RNJ A;  2I0N A;  2M0Y A;  3QWX X;  5IXF A;  2AK5 A;  4HXJ A;  1ZLM A;  1JEG A;  1FMK A;  1HSQ A;  3NPF A;  1Z9Z A;  3EG3 A;  2EQI A;  2HDA A;  4E6R A;  2O9S A;  1W1F A;  2CT4 A;  1AWW A;  1RLP C;  3O5Z A;  4HVW A;  4JZ3 A;  2DA9 A;  4K11 A;  2JS2 A;  1UDL A;  2K6D A;  1SRM A;  2F2W A;  2LJ3 A;  2EKH A;  2K3B A;  1TG0 A;  4JJB A;  4CC7 A;  4J9F A;  2FEI A;  5FWC A;  3ZL7 C;  4CC3 A;  2CUB A;  1GCQ A;  1J3T A;  3SEM A;  3CQT A;  4LUE A;  1WA7 A;  2YUO A;  1WDX A;  4J9C A;  2J06 A;  1LCK A;  1NYG A;  1YN8 A;  1XOV A;  1G2B A;  1WXU A;  1T3L A;  3PVL A;  1WFW A;  3PE0 A;  2V1Q A;  2L3P A;  1E6H A;  1ZX6 A;  2GGR A;  2DL7 A;  4CC2 A;  2A37 A;  4J9G A;  1GBR A;  4LE9 A;  4M4Z A;  4ORZ A;  4RTZ A;  4A63 B;  1YNZ A;  3C0C A;  1M8M A;  2J6K A;  1AWO A;  2BZY A;  3NHN A;  1PRL C;  2DF6 A;  2K79 A;  4ESR A;  2EVR A;  3H41 A;  2JM9 A;  2L2P A;  4AG1 C;  1SPK A;  1BK2 A;  1K1Z A;  4RTY A;  1PNJ A;  2GNC A;  1ZUY A;  1X2Q A;  1K0S A;  2RQU A;  2NWM A;  2HBW A;  1WYX A;  2DMO A;  2AKK A;  3QWY A;  2KBT A;  1X43 A;  1W6X A;  4X1V A;  5FW9 A;  2W10 A;  1QCF A;  1S1N A;  2EGA A;  5I22 A;  1NLO C;  4RTV A;  3EGU A;  2FG0 A;  1E6G A;  4EIK A;  2ESW A;  2GBQ A;  2DX1 A;  4F16 A;  1ZSG A;  2FRY A;  1GL5 A;  1K0X A;  2DL5 A;  1RI9 A;  2K2M A;  2RQT A;  2K9G A;  1GBQ A;  2LMJ A;  2CSQ A;  4J9E A;  2RQV A;  4DEX A;  5HCK A;  1PHT A;  1CSK A;  2D8J A;  2PTK A;  2YUQ A;  2L3S A;  1GFC A;  2JMC A;  1AOJ A;  1JQQ A;  3VS0 A;  1H92 A;  1JXM A;  3TSW A;  2VKN A;  1A0N B;  1SRL A;  1YP5 A;  4HCK A;  4F14 A;  1UJY A;  2E5K A;  4AFS C;  3EG2 A;  1B07 A;  5IXB A;  1OOT A;  2ENM A;  1NG2 A;  3RBB B;  2KRS A;  1UJ0 A;  1WXT A;  3EHR A;  2YUN A;  1SSH A;  2BZX A;  2ED0 A;  1NLP C;  4J9I A;  3M0Q A;  5IHK A;  3FJ5 A;  2CDT A;  4LUD A;  1WLP B;  2CUD A;  1QLY A;  3TVT A;  1UEC A;  1QWE A;  4D8K A;  2BTT A;  2LP5 A;  1AVZ C;  3GBQ A;  1T0H A;  1K76 A;  1TUD A;  1X69 A;  1X6B A;  3VS4 A;  1MV3 A;  1AWJ A;  1I07 A;  1PRM C;  2JMA A;  3VS6 A;  2C0O A;  1AZG B;  2DVJ A;  1UGV A;  2FO0 A;  5GJV B;  3I9Q A;  4RTX A;  1X27 A;  1M3B A;  1NEG A;  2RPN A;  1NM7 A;  3JV3 A;  2JT4 A;  4JJD A;  1JU5 C;  3NGP A;  2L0A A;  1B3Q A;  1RLQ C;  1M27 C;  2FRW A;  1YWO A;  1YCS B;  4CC4 B;  1OPL A;  2X3X D;  3A98 A;  2RQW A;  2SEM A;  2LNH B;  2O31 A;  1CKB A;  3VRY A;  5FWB A;  2RQR A;  2LQW A;  1WXB A;  3REB B;  1QKX A;  1V1C A;  2DBK A;  3PVQ A;  2C0T A;  4J9H A;  1UUE A;  4KRT A;  1HD3 A;  2SRC A;  2BZ8 A;  4OMM A;  2KRN A;  2H8H A;  1W70 A;  1QKW A;  1EFN A;  2EPD A;  1UTI A;  1AWX A;  5ECA A;  1GCP A;  5GJW B;  5IH2 A;  3I5S A;  1CKA A;  2A08 A;  2A28 A;  1UG1 A;  2QDL A;  1KJW A;  4RTW A;  2DE0 X;  1I0C A;  1WX6 A;  2JTE A;  1I1J A;  2OI3 A;  4ZNX A;  2W0Z A;  1H8K A;  1T3S A;  2O2O A;  1ABO A;  1VYV A;  2JW4 A;  3U23 A;  4OMO A;  3M0R A;  1KIK A;  1GCQ C;  2O88 A;  1U3O A;  2KGT A;  1JXO A;  2FPE A;  2KNB B; 
#chains in the Genus database with same CATH topology
 3EG1 A;  3I5R A;  1W2B A;  2LCC A;  4JLI A;  5IHN A;  4RCC A;  1O9S A;  2DTI A;  2C06 A;  2J7I A;  4LDW A;  4ELY C;  3G4S T;  4RMO A;  3OYE A;  2RHY A;  3OSV A;  1N5Z A;  3L1A A;  2KE9 A;  1BIA A;  3EG9 A;  4FSS A;  1BB9 A;  4C5I A;  1YFN A;  3OYG A;  3CCM Q;  2K57 A;  2XI9 A;  5KYU B;  2DBM A;  2KXC A;  2G6F X;  1V76 A;  2PZ1 A;  4M7A E;  2RD1 A;  1PWT A;  4J5Y A;  5EC7 A;  1KC8 U;  1SG5 A;  4J6X A;  2HD0 A;  1BYM A;  4E7Z A;  1VQ9 T;  2HSE B;  1JO8 A;  2OTJ A;  1VQ6 T;  1MUZ A;  4M77 D;  1M4Z A;  3OSS C;  5D6X A;  1M5Q 1;  2R58 A;  2EYW A;  1ZSZ A;  2KXD A;  3I56 T;  3CCU Q;  4EMK C;  2X4W A;  4QT7 A;  3VV0 A;  2KYB A;  2QYZ A;  1M90 R;  3GOX A;  4ATO A;  4OP0 A;  3JCM e;  4DBF A;  2V1R A;  2RN8 A;  1IGU A;  3JCM J;  2DPP B;  2Y90 A;  2HKQ B;  5KE3 A;  2MK5 A;  1UE9 A;  3QUI A;  4II1 A;  2DXT A;  4OB2 B;  1HK9 A;  1R0B G;  1YIT T;  3ULR B;  2MIO A;  2LQN A;  2JXB A;  1JJ2 S;  2DL8 A;  2B8A A;  1G8X A;  5GAM h;  2DO3 A;  2JVV A;  1QP3 A;  1ZBJ A;  1YJN A;  4Z88 A;  2KT1 A;  4R56 A;  2OAW A;  5I2M A;  3VS2 A;  3EH1 A;  1NJI C;  2PNI A;  5GMK m;  2QXF A;  3JCM c;  4LN2 A;  1F1B B;  1B7T A;  3OW2 A;  1OX9 A;  1YJN T;  4C92 F;  3R6N A;  5KE2 A;  1VYU A;  4OMQ A;  1VQ4 Q;  4IIO A;  4BDY A;  4BDZ A;  2RHU A;  2JOY A;  3VRZ A;  2MWO A;  3KFV A;  4GY5 A;  3M55 A;  3A5Z B;  5CKE A;  3G1J A;  3SWN A;  5LJ5 d;  1WHL A;  3HFO A;  3G7Z A;  1UHF A;  2CRE A;  1VQK Q;  5LJ5 g;  3NMZ C;  4N4G A;  3OQ5 A;  1ABQ A;  4BE2 A;  4M7A F;  2R5A A;  2EFI A;  2YWW A;  4Y28 E;  2DTO A;  4GLK A;  5GAN 4;  4J9D A;  2XKO C;  1K4U S;  4M75 B;  1VQ8 A;  3KBG A;  5CO7 A;  2KEA A;  1UFF A;  1PKT A;  4M77 C;  4QVZ A;  2VYT A;  2QTV A;  3C4S A;  2RI3 A;  3EGX B;  3HL8 A;  5I11 A;  1C6V X;  5CQX A;  1YBY A;  3CCJ A;  1XNI A;  3GIB A;  2R5M A;  3C94 A;  4NL3 A;  4M7D G;  2E12 A;  1S72 A;  2EGE A;  1KFZ A;  5LJ3 h;  3RNJ A;  1ZLM A;  1JEG A;  2X9H A;  1Z9Z A;  1LOJ A;  2EQI A;  3JB9 J;  1YIJ T;  2O9S A;  4M78 A;  2HAX A;  3CCJ T;  1JBM A;  4N4H A;  4IUT A;  4HKE A;  3RMQ A;  1YJW T;  1JJ2 A;  1DJ7 B;  2WSC E;  4K11 A;  2HMA A;  2VGN A;  1RAE B;  3RKX A;  2OTL T;  2LJ3 A;  3UT1 A;  2EKH A;  4PJO C;  1X75 C;  2RK1 A;  4BI4 A;  4E7S A;  3JRZ A;  4CC7 A;  4B9W A;  4MDW A;  3X25 B;  4BE0 A;  1WA7 A;  2YUO A;  2J06 A;  4PKC C;  1QMC A;  3OYY A;  1G2B A;  3INZ A;  3EH2 A;  1RAD B;  1VUB A;  1E6H A;  2GGR A;  5J3B A;  2DL7 A;  2E4H A;  3MEW A;  4CC2 A;  4JRI A;  2VB6 A;  3JB9 F;  1GBR A;  1KG1 A;  1KQ1 A;  2AIR B;  4A63 B;  1M90 U;  1YNZ A;  3C0C A;  2K3X A;  2JJ9 A;  3M9Q A;  2J6K A;  1AWO A;  1TSF A;  4BI8 B;  1R8O B;  3P8B B;  3Q1J A;  2DF6 A;  3OMG A;  4LDX A;  2OTJ Q;  1D09 B;  4AG1 C;  1SPK A;  2VV5 A;  1U8R A;  5GAN h;  4OB3 B;  4JUV A;  1WNL A;  3QZ5 B;  1VIE A;  3JCM Q;  2DMO A;  1MHN A;  1RAH B;  2HBP A;  1W4S A;  4XTX A;  4C8Q G;  1KQS P;  2ZGW A;  1N9R A;  4X1V A;  4RG2 A;  5GAO l;  2W10 A;  4KGV B;  1Q86 C;  1K73 C;  2LX9 A;  2FZK B;  1N8R R;  1VQ5 A;  2YRC A;  3OBY A;  5I22 A;  1QCN A;  2FG0 A;  1V29 B;  2OAU A;  2ESW A;  5GAO q;  4XQ3 A;  2GBQ A;  3FRN A;  1G5V A;  4F16 A;  2VXE A;  1GL5 A;  1ZHI A;  1W2B P;  2QAZ A;  2RM4 A;  2X35 A;  2NUT B;  4J9E A;  5CIU A;  1LPL A;  1CSK A;  2D8J A;  1D3B B;  2HQX A;  2YUQ A;  2XD0 A;  4R55 A;  3CCE A;  2JMC A;  5A0G A;  1ZSZ B;  3VS0 A;  2E3I A;  2VKN A;  2V8I A;  1YJN Q;  3QG1 A;  2DER A;  2CZ1 B;  4RG8 A;  3CBP A;  3QHS A;  4C92 B;  4F14 A;  3FLG A;  2E5K A;  3JB9 H;  5IXB A;  3RBB B;  2CP5 A;  3CCE T;  2YUN A;  1SSH A;  1VQM T;  3M0Q A;  3FJ5 A;  1WLP B;  3VUB A;  5GAM g;  4M7A B;  1YI2 A;  4C92 G;  4LDV A;  1UEC A;  5D6Y A;  2BTT A;  2LP5 A;  4XU2 A;  1AVZ C;  1MNE A;  3QBY A;  3VS4 A;  4IUP A;  4J7F A;  1AWJ A;  1PRM C;  1K9M C;  1Q82 U;  5CKD A;  3EFS A;  4ZGJ B;  3P8H A;  4QW2 A;  4A4H A;  2RJC A;  5GJV B;  4RTX A;  2RPN A;  2K5L A;  4IUR A;  3CMA A;  4M7A G;  3JV3 A;  3JSC A;  3JCM P;  2JT4 A;  1VQ8 Q;  1JU5 C;  3NGP A;  2NYS A;  4OB1 B;  4MMK A;  2ZPG B;  3HSB A;  4DQ2 A;  3TU4 K;  2X3X D;  2SEM A;  2X4J A;  3PMT A;  4XTW A;  5FWB A;  2LQW A;  1QKX A;  3CCJ Q;  3G71 A;  1TU0 B;  2D9T A;  3V7C A;  1Y96 B;  4PJL A;  3OYK A;  2XHC A;  5KYN A;  3SWN B;  1HD3 A;  1S72 Q;  5KCH A;  2BZ8 A;  3E19 A;  2H8H A;  4ME7 A;  3CCV A;  2GQV A;  4ZTJ A;  1MMG A;  2EPD A;  1UTI A;  3DKM A;  1PCX A;  2KQW A;  3M54 A;  1GCP A;  3G71 T;  3I5S A;  2A28 A;  3CCM T;  3LX7 A;  4RTW A;  1N6A A;  1I0C A;  1Q81 R;  2BE7 D;  2JTE A;  3HFN A;  4F7U A;  2W0Z A;  4C0Z A;  3M56 A;  5LJ3 d;  3M0R A;  3CCV T;  2K3Y A;  2QQ9 A;  4OGC A;  2RJF A;  2KGT A;  3I55 A;  2KY9 A;  2CP6 A;  2KNB B;  2JZ2 A;  3OW2 P;  1M30 A;  5A0L A;  4M75 E;  3P8D A;  1IO6 A;  1B34 A;  4ZTF A;  3OYF A;  1KQS S;  1VYT A;  2LJ0 A;  3TSZ A;  4RCB A;  1D0Y A;  4PJO A;  3TCJ A;  8AT1 B;  1OV3 A;  4M78 B;  1ZQ1 A;  4D6W A;  3I55 T;  4GBQ A;  3CCU T;  1YJ9 A;  3JB9 G;  2XU8 A;  4DOV A;  1N8R U;  2LJ1 A;  1W2B S;  1KHC A;  1TOV A;  1OYX A;  5FU7 C;  2AKL A;  1H64 1;  2J6F A;  2AHJ B;  4M77 F;  3VYH B;  1PSF A;  1OZ3 A;  3JCM h;  3E9G A;  1AD5 A;  2MMP A;  3VS7 A;  1Q7Y C;  1WI7 A;  2CYZ B;  2MI6 A;  1NPP A;  2NUZ A;  2MF2 A;  5LJ3 j;  1OQK A;  1BI2 A;  4FU6 A;  4J8O A;  2CSI A;  3CD6 A;  2HEQ A;  5IHI A;  4AFU C;  2KMT A;  1QW1 A;  2L3Q A;  2KRO A;  2ZPE B;  2L5Q A;  1VQ5 Q;  5EG2 A;  2D6F A;  2JN0 A;  2DTH A;  2DK3 A;  1M3C A;  1GFD A;  5GAN 7;  2WSF E;  1KK7 A;  5GAN d;  2FZC B;  1G83 A;  2XMF A;  2CH4 W;  1ARK A;  2M51 A;  4E2F B;  3REA B;  1QP2 A;  2EGC A;  1JJ2 P;  1UGR B;  1Z9Q A;  1OX8 A;  2ZPI B;  3OA6 A;  2RH2 A;  1M2V B;  4O5V A;  1GRI A;  2KRM A;  3MP6 A;  5KYY A;  1VQO A;  3CCE Q;  4PFZ A;  1HJD A;  1MMN A;  2M16 A;  1FYN A;  1VQ4 T;  1RUW A;  3QKJ A;  3JCM V;  2RF0 A;  1D1C A;  5I2S A;  4Z89 A;  2KI7 A;  4LNP A;  2WAC A;  3QDF A;  4J9B A;  1VQK T;  4AFZ C;  1IHV A;  5KYX A;  2MAM A;  2V26 A;  2GQI A;  1IZ6 A;  2P84 A;  4OMF B;  1BCM A;  2KK4 A;  2VGM A;  4A53 A;  4EMK B;  1YI2 Q;  4WTO B;  4Z8A A;  4QVD A;  3QZ9 B;  3CCS A;  2J6O A;  5LL6 S;  2Z0W A;  5GAN j;  3TRE A;  4HCB A;  3H0H A;  3PT9 A;  1QVP A;  4FYY B;  3X24 B;  3FEO A;  3CMA Q;  3VYG A;  1YHQ A;  1UHC A;  5KYW B;  1UGS B;  3CCS T;  2PUO B;  2VAS A;  4V2S A;  2LT4 A;  3V8J A;  3VS5 A;  1VA7 A;  3MO8 A;  5HKC A;  3QJ6 A;  2GTO A;  4HCC A;  4C92 E;  4AT1 B;  2DM1 A;  3BDU A;  3OW2 S;  1YHQ T;  1Q81 U;  3G71 Q;  4C8Q A;  1TXQ A;  4N0A A;  4CI0 C;  5GAN 8;  1QCO A;  2LT1 A;  1SHF A;  2MYS A;  3I35 A;  1NE8 A;  2EYZ A;  4MML A;  3L2W A;  3ZFJ A;  4OML A;  3A8L B;  3QXE B;  3A8M B;  3J81 E;  1WPY A;  3CCV Q;  4QKU A;  2XDD A;  4GLM A;  2LVM A;  4WF2 A;  4PJJ A;  1FXX A;  4RUG A;  1RAI B;  6AT1 B;  3SFM A;  2K5I A;  1KD1 C;  2GTJ A;  4R0K A;  8ATC B;  2IG0 A;  2OX7 A;  1X2K A;  1Q86 R;  1K73 R;  2DRM A;  2FHD A;  2I0N A;  2NUP A;  3WVE B;  2HKN A;  2AK5 A;  4FT4 A;  2P0P A;  2HDA A;  4E6R A;  1W1F A;  2O01 E;  3I55 Q;  1RLP C;  3EFO B;  2HNI A;  3O5Z A;  4ZN1 A;  3HKS A;  4JZ3 A;  2DA9 A;  3HPW A;  3L2Z A;  2OTJ T;  5DLO A;  1SRM A;  2F2W A;  4XU3 A;  5GMK i;  2ZCF B;  4JJB A;  4M77 B;  4J9F A;  4CC3 A;  5FWC A;  3J80 E;  3SEM A;  4XTV A;  1YJ9 Q;  1WDX A;  1YN8 A;  2COZ A;  3URG A;  4OGE A;  1R0C B;  1RAA B;  3CCR A;  4PJO D;  1EZZ B;  2X4X A;  5DY9 A;  3PE0 A;  2V1Q A;  4KBM B;  3S6W A;  2DYI A;  1ZX6 A;  3A1P A;  2O4X B;  4M77 G;  1EIF A;  4E7K A;  1MND A;  2F5K A;  3ER0 A;  5GMK j;  5GAO n;  4RTZ A;  1R77 A;  1N9S A;  4O6J A;  3FC3 A;  1KC8 C;  2FVU A;  3CCR T;  3S3N A;  2M1H A;  3CD6 Q;  1WHG A;  3M4Y A;  2EVR A;  2L2P A;  2RJE A;  3JCM d;  4RTY A;  5GAN 6;  4F04 B;  4KGZ B;  1VQL A;  3JCM g;  1Y71 A;  3EAE A;  2P0Q A;  2AKK A;  3QWY A;  3OS1 A;  1X43 A;  1W6X A;  2BE9 B;  3ME9 A;  4QQD A;  1H3Z A;  4XU0 A;  2KSS A;  4M78 E;  9ATC B;  2GFA A;  1E6G A;  1VQO Q;  2E5Q A;  2VUB A;  2E3H A;  1ZSG A;  1RI9 A;  2RQT A;  4M7D D;  2K9G A;  2CP0 A;  3MKD A;  5GAN 5;  2EIF A;  2PTK A;  1ZA2 B;  2BUD A;  1VQP A;  2DEQ A;  2QK0 A;  3MEA A;  2RB6 A;  4HCK A;  2QGF B;  1UJY A;  1M1G A;  1VQ8 T;  2RHX A;  4M75 G;  4A4E A;  3DB4 A;  3M5A A;  2EJG A;  1UJ0 A;  2FZG B;  3WXM B;  3EHR A;  2CZ6 B;  3H9N A;  3CCS Q;  2BZX A;  2CP2 A;  2CDT A;  4LUD A;  1VQ7 A;  2L8D A;  2CUD A;  3O8V A;  3LGL A;  1QLY A;  4UC4 A;  1K8A R;  2MWP A;  5LJ5 j;  4D8K A;  1LNX A;  4AMC A;  3GBQ A;  1S72 T;  1YHQ Q;  2EWN A;  4IUV A;  4XK8 E;  1I07 A;  3QDR B;  2JMA A;  3VS6 A;  4KUD K;  3GP8 A;  2DVJ A;  1RI0 A;  2QQS A;  4YTL A;  5KYX B;  3CCQ A;  1UGP B;  3PFS A;  1NEG A;  3GPL A;  4QQ6 A;  5GAO p;  5CAI A;  1Q86 U;  1G3Y A;  4JJD A;  4ZGD B;  3MPU B;  2HQH A;  3MEU A;  4IUQ A;  4CC4 B;  4DBR A;  3CCQ T;  3UPU A;  2DXU A;  2O31 A;  4LDU A;  2PVG B;  1Q7Y R;  1CKB A;  2XID A;  3CEY A;  3VRY A;  4JLG A;  4C8Q D;  3GF5 A;  1WXB A;  3CCL A;  4A4K A;  3PVQ A;  4E7L A;  2C0T A;  4N4I A;  2A3L A;  1D0Z A;  1UUE A;  2DZ9 A;  3QYG B;  4OMM A;  1BIB A;  3RKW A;  4M78 F;  3VJP A;  2E1H A;  5CCA A;  1O75 A;  5CKB A;  3RKY A;  4ANJ A;  1IB8 A;  4A54 A;  1AWX A;  3EG9 B;  1I8F A;  5ECA A;  1PD0 A;  5L8R E;  3CCL T;  3SD4 A;  4M7D C;  4JRP A;  2QTX A;  1KJW A;  1WX6 A;  4A4G A;  2D0Q B;  3JCM W;  2JW4 A;  2E10 A;  4OMO A;  4HT9 A;  3X28 B;  4Z02 A;  1KIK A;  2O88 A;  1U3O A;  2DXB A;  1W70 A;  2FPF A;  4KUI A;  4PLL A;  3M0P A;  5C0M A;  2ROL A;  1M3A A;  2K7A A;  3RER A;  1VQ5 T;  1FWZ A;  3ZBD A;  2EQJ A;  3CCR Q;  3EGD A;  4OB0 B;  2PU9 B;  2ROT A;  3IQL A;  3L2Q A;  1OEB A;  4WCI A;  1QWF A;  2DFU A;  3J7A F;  1U06 A;  2CP3 A;  2GF7 A;  4FM4 B;  4JZ4 A;  2X51 A;  2CZ7 B;  1Y7X A;  4OVA A;  1WGS A;  2DJZ A;  3D7S B;  3SHW A;  2COY A;  5LJ5 f;  2ZZD A;  4FW1 A;  1E7O A;  2E65 A;  5GAM d;  5M9O A;  2YRV A;  1ACM B;  2DL3 A;  1BBZ A;  4M7A D;  4AFQ C;  4L6V 5;  1VQL Q;  5FRO A;  1BU1 A;  2Y4X A;  1H3H A;  1UEB A;  4EMG A;  2GFU A;  2EBP A;  1WJQ A;  4M77 E;  4XTY A;  2FYK A;  2DAQ A;  4IKF A;  3VS1 A;  2DIQ A;  1QVF S;  2KVQ G;  2AZV A;  2DIG A;  2E6Z A;  1YI2 T;  2DLP A;  4C8Q C;  4N0A C;  5D6W A;  2Y4Y A;  3V7R A;  1TUC A;  1JRI A;  2LRQ A;  3M0T A;  2MPX C;  4F7U E;  2DEU A;  4NS5 A;  2DJQ A;  4LD6 A;  4HT8 A;  5FU7 B;  4FL6 A;  1TWB A;  1VQP Q;  4XU1 A;  1I4K 1;  1K8A U;  1WJS A;  4IUU A;  3RMS A;  2X4Y A;  4OMP A;  3CMA T;  1QVG A;  5LJ3 e;  5GAM j;  2DZC A;  4MZP A;  2F2X A;  4FW2 A;  1VQ7 Q;  2E41 A;  3T9N A;  2D1X A;  2QA4 A;  3LH0 A;  4QVC A;  4KH1 B;  1G3W A;  1Q82 C;  3TEE A;  3BW1 A;  2F2V A;  3CC2 A;  2YHT A;  3CCQ Q;  3H0I A;  1M9S A;  3OYI A;  2CP7 A;  1SSF A;  4RTT A;  3G6E A;  3BY7 A;  3EG0 A;  3RDV A;  1AZE A;  2VWF A;  3QII A;  2OJ2 A;  1K9A A;  1PKS A;  4Q5W A;  1TS9 A;  4ELZ C;  1KSW A;  3MJX A;  1WHM A;  2DRK A;  2EW3 A;  4JS4 A;  3CPF A;  3V7S A;  4M7A C;  2ECZ A;  4DA4 A;  1ZUU A;  3G6E T;  2ABL A;  5GAN 3;  4HVU A;  4C0D C;  2HL5 C;  3CCL Q;  3RIR A;  1HXD A;  3E2U A;  1SKU B;  1QVF A;  2JS0 A;  5FU6 C;  5GAN e;  1NJI R;  1M1K C;  1Q95 G;  1D1B A;  1OZ2 A;  3OS2 A;  4M78 G;  2O9V A;  2E64 A;  4P5N A;  4XTZ A;  1YJ9 T;  4KH0 B;  4OMN A;  1YWP A;  2EJF A;  3M58 A;  4RTU A;  4F7U F;  3CME A;  4FSX A;  3C95 A;  3UAT A;  1M2O A;  1U5S A;  2YUP A;  1WJR A;  3UF4 A;  3QWX X;  5CR2 A;  4C0G A;  4HXJ A;  2CKK A;  4PLI A;  1BCO A;  2LQK A;  3NPF A;  3EG3 A;  2QGG A;  3OYJ A;  1AWW A;  2JUF A;  2BIV A;  2E70 A;  4TVR A;  4PJN A;  1BI0 A;  2QQB A;  4C5G A;  1RAF B;  4BY6 C;  4M75 A;  3CD6 T;  4M7D A;  4DBH A;  4LXC A;  1UDL A;  1C0M A;  2K6D A;  4PJO F;  1RL2 A;  2KDS A;  1TG0 A;  5GAM f;  5KH6 A;  3CQT A;  4LUE A;  3CPW S;  1LCK A;  5HK0 A;  4BI3 A;  1XOV A;  2RK2 A;  1T3L A;  3PVL A;  1WFW A;  1VQO T;  1MMA A;  4J9G A;  4M4Z A;  4ORZ A;  1M8M A;  4CRI A;  2LQ8 A;  2DD5 A;  5GMK l;  1PRL C;  2K79 A;  1MGQ A;  2M9U A;  2JM9 A;  5FRN A;  1PNJ A;  2GNC A;  2HQE A;  4E7H A;  1N27 A;  1ZUY A;  4NL2 A;  1X2Q A;  1K0S A;  2XG8 D;  2HBW A;  3X20 B;  2CZ0 B;  1HYO A;  2KBT A;  3SDZ A;  2KAF A;  1ZA1 B;  1QCF A;  3ASK A;  3G4S A;  5HY6 A;  3LLR A;  4X9D A;  2AT1 B;  4RTV A;  4MDX A;  1NZ9 A;  4J83 A;  2LNV A;  4EIK A;  5GMK e;  1ZBX A;  3S3O A;  2DX1 A;  4KUL A;  2FRY A;  1K0X A;  2K2M A;  4DEX A;  2RQV A;  2F1L A;  2P4T A;  5HCK A;  4J6W A;  2L3S A;  4ZGE B;  2HL3 A;  1AOJ A;  5LJ3 f;  2F69 A;  1JQQ A;  2CS7 A;  1H92 A;  1JXM A;  3LWH A;  2K5F A;  1YP5 A;  1PD1 A;  4Y91 A;  3RR6 A;  5KCO A;  3EFR A;  1WHK A;  4AFS C;  2EQM A;  3H6Z A;  1OOT A;  2QA4 Q;  1VQ9 A;  2KRS A;  2JTM A;  4FT2 A;  3MCA B;  1VQ6 A;  3OS5 A;  1KQ2 A;  2ED0 A;  5IHK A;  3JB9 I;  3CC2 Q;  3CPW A;  3NTH A;  4RKU E;  3I56 A;  3TVT A;  4L5G A;  5CKH A;  3G6E Q;  1T0H A;  3A8G B;  1X69 A;  1X6B A;  3N5B B;  1MV3 A;  2NUT A;  3FJP A;  1NJI U;  3M4G A;  4BB7 A;  3A8O B;  1AZG B;  2NLU A;  1UGV A;  3L2U A;  1D3B A;  4FYX B;  4QQG A;  2QAS A;  3I9Q A;  3GNG A;  2G3R A;  1M3B A;  3BE3 A;  3DLM A;  4KGX B;  4C8Q F;  3CXC A;  4LD9 K;  4C92 A;  4PJM A;  2LC4 A;  1RAC B;  1Y07 A;  1YIT A;  1Q81 C;  2XIC A;  4F7U B;  3X26 B;  1RLQ C;  2VXF A;  1M27 C;  3MP8 A;  1YWO A;  1YCS B;  2QEX A;  1OPL A;  3A98 A;  2COW A;  2PVD B;  3OYL A;  2LNH B;  3PIO A;  4HCZ A;  2RQR A;  1BKB A;  5GAN f;  5LJ5 e;  4M7A A;  2DBK A;  1B34 B;  3MET A;  3CME Q;  4KRT A;  3FDR A;  4F7U G;  2YLB A;  4MZT A;  1QVG P;  1K9M R;  4PJO B;  1OU8 A;  2QEX T;  4E7J A;  1QKW A;  2K2V A;  3BDL A;  4FCY A;  3PIP A;  5GJW B;  5IH2 A;  3CC4 A;  1CKA A;  1UGQ B;  2IVW A;  4BUG A;  2DE0 X;  1I1J A;  3FB9 A;  4ZNX A;  1EX4 A;  4PJO G;  3U23 A;  1GCQ C;  3JAM E;  2FPE A;  1UG1 A;  1RAB B;  1VQL T;  3KXT A;  2KT8 A;  5I21 A;  2YXY A;  2QG9 B;  4M75 D;  3CC4 T;  1OPK A;  1U1S A;  3V8L A;  1Y96 A;  3M0S A;  1FMW A;  1QQJ A;  2RHI A;  3THK A;  2EYX A;  1BI1 A;  4DOW A;  3E9F A;  3JCM b;  2LX7 A;  4BD3 A;  1KHI A;  3VU3 C;  1FMV A;  4BAC A;  3LYI A;  3WVD B;  1OU9 A;  1IHW A;  5D7U A;  2EQK A;  2LZ6 B;  1WIE A;  4M7D B;  3FIF A;  1UB4 A;  2DYB A;  2FB7 A;  3HHT B;  3HRU A;  4E47 A;  2ATC B;  1PSE A;  3M0U A;  5KYY B;  1VQP T;  3KUF A;  1Q82 R;  1M1F A;  2VVK A;  1QVF P;  2RMO A;  1XJW B;  1YIJ A;  3HRT A;  2YDL A;  2D0N A;  4B6M A;  1WZO A;  2HSP A;  1AHJ B;  1YJW A;  2V8K A;  1WQW A;  4PFP A;  4Y92 A;  3AT1 B;  4L59 A;  2DL4 A;  3BFM A;  2PVO B;  2YRD A;  1RAG B;  2OTL A;  4IIM A;  1Y0M A;  3G4S Q;  3PMI A;  3OYD A;  2JNG A;  3UA6 A;  3M57 A;  2JM8 A;  5FRM A;  4BE1 A;  2X3W D;  1VQ7 T;  4HA8 A;  1SF9 A;  3CBO A;  1G3S A;  2KR3 A;  5CQY A;  4EPC A;  3EHQ A;  2DNU A;  1NEB A;  1K73 U;  2CT3 A;  1Y57 A;  2XDP A;  2R57 A;  1ZUK A;  5DM7 R;  1NYF A;  2B86 A;  4KT0 E;  1SHG A;  3UA7 A;  2IIM A;  2DIL A;  1AEY A;  1M1K R;  4J6Y A;  5A0D A;  2C0I A;  3OMC A;  2DXC A;  3UDC A;  2EYY A;  1M8V A;  3VS3 A;  4HVV A;  1MV0 B;  2MOX A;  2LCS A;  1JB0 E;  4A4F A;  1VQ9 Q;  4OF1 A;  2A36 A;  1VQ6 Q;  2M0O A;  3OY9 A;  1IRX A;  2ZPB B;  4PK4 A;  4MZM A;  3PGG A;  4F17 A;  1VOM A;  3R6O A;  2RNA A;  2I2L A;  1TUG B;  4M75 C;  3I56 Q;  2L3R A;  4C8Q B;  2P0K A;  1WHH A;  2EQU A;  3LGF A;  1VQN A;  2HCK A;  2EJ9 A;  2YLC A;  2QDY B;  3LH5 A;  1T0J A;  1QVG S;  3OS0 A;  1M2V A;  5CVI A;  4AG2 C;  4D8D A;  4VUB A;  4E7I A;  1P92 A;  3QSU A;  1GXI E;  3DB3 A;  2P4R A;  1SEM A;  4X9C A;  5GAM e;  1VQN T;  1K9M U;  1YIT Q;  2NUP B;  1OI1 A;  2D8H A;  2MCN A;  5IT9 E;  2CH4 A;  3DLL A;  2FPD A;  4J7I A;  4C5H A;  2K4Y A;  2QEX Q;  1U1T A;  5CKF A;  3JCM f;  1WHJ A;  1AT1 B;  2YSQ A;  4C92 D;  1YCY A;  2AZS A;  3QO3 A;  2H3E B;  1M90 C;  3PTA A;  4EMH A;  4EMK A;  3OYB A;  2RO0 A;  3QJY A;  4XAX B;  3M59 A;  3OYA A;  3H0F A;  1FX7 A;  3OBW A;  2CGH A;  2H3J A;  2J05 A;  4DEY A;  4JPB W;  1VQM A;  3A8H B;  3PNW C;  3MEV A;  5GAO r;  4JJC A;  5IN1 A;  2YT6 A;  3SB2 A;  3C12 A;  1I5O B;  2ED1 A;  3LWI A;  3CC4 Q;  1X6O A;  4PNO A;  2KYM A;  5L23 A;  4FIB A;  2L89 A;  1X6G A;  5KYW A;  2M0Y A;  2EAY A;  2E6N A;  5IXF A;  2GCX A;  1FMK A;  1HSQ A;  3S3M A;  2PUK B;  2CT4 A;  3OYC A;  3CC7 A;  3CPW P;  4HVW A;  4C0D B;  1NBE B;  2JS2 A;  4JDS A;  3ZEH A;  1BI3 A;  1TH7 A;  2K3B A;  3GNF B;  5KYU A;  5A2Q E;  5FU6 B;  2QQR A;  2FEI A;  3ZL7 C;  1IXD A;  3TQ7 P;  2BKD N;  2CUB A;  1GCQ A;  1G3T A;  1J3T A;  3CC7 T;  4J9C A;  2LTO A;  3L2V A;  1NYG A;  3NFC A;  3CXC P;  1KD1 R;  1WXU A;  4JJN K;  4PJO E;  2L3P A;  5J26 A;  2HZY A;  2A37 A;  2DET A;  2EKO A;  5C6S A;  4LE9 A;  1YIJ Q;  3EFO A;  5GMK h;  1PC0 A;  3UWN A;  1YJW Q;  3CCM A;  2BZY A;  3NHN A;  4ZN3 A;  4BY6 B;  4EDU A;  2RJD A;  4ESR A;  1M1K U;  2OTL Q;  2DD4 A;  3H41 A;  3CBM A;  1ZSZ C;  1BK2 A;  2VC8 A;  1K1Z A;  4M77 A;  1Q7Y U;  2LCL A;  3JB9 D;  3RES A;  2RQU A;  4C92 C;  2NWM A;  2ZAE A;  1WYX A;  3VUZ A;  2XDB A;  1I81 A;  2QA4 T;  5FW9 A;  4JRK A;  1S1N A;  5CK9 A;  2QI2 A;  5GAO m;  2RI5 A;  2EGA A;  3OYH A;  3AHU A;  5IAY A;  3LW5 E;  1NLO C;  4M78 D;  1I5L A;  3CC2 T;  2ZPH B;  3HRS A;  3EGU A;  2O4X A;  1OUL A;  5LJ3 g;  3CCU A;  1TTH B;  1XQH A;  1K8A C;  5DLQ E;  2DL5 A;  2DVE A;  4M7D E;  3V8K A;  1WQ7 A;  1GBQ A;  4JRQ A;  1KC8 R;  2LMJ A;  2CSQ A;  3HP9 A;  2RI2 A;  3NTI A;  1PHT A;  1GFC A;  3H8Z A;  3TSW A;  3MP1 A;  1A0N B;  3JCM X;  2ZPF B;  1SRL A;  4B9X A;  3OYN A;  2DKG A;  3EG2 A;  2A0F B;  1B07 A;  4XTU A;  2ENM A;  1NG2 A;  4LDY A;  3QPH A;  3OYM A;  1VQN Q;  1WXT A;  1NLP C;  4J9I A;  3M53 A;  4C5E A;  1MMD A;  3E1S A;  2EYQ A;  1QWE A;  3CME T;  3QYH B;  1K76 A;  3SWN C;  1TUD A;  2PQW A;  5LJ5 h;  1VIF A;  5GAN 2;  1D1A A;  2C0O A;  5FLX E;  5J39 A;  2FO0 A;  1X27 A;  3EGX A;  1VQ4 A;  5HK3 A;  1NM7 A;  2F5T X;  2LDM A;  5GAN g;  1N8R C;  3L2R A;  2A7Y A;  4JS5 A;  1D0X A;  2L0A A;  1B3Q A;  2XK0 A;  7AT1 B;  2FRW A;  4PL6 A;  1VQK A;  1XTD A;  2RQW A;  3NTK A;  1VQM Q;  3VKI A;  4C0F A;  1LVK A;  3L42 A;  2IPO B;  4DBQ A;  4C8Q E;  2FL7 A;  2WSE E;  3REB B;  1V1C A;  3MHX A;  1IGQ A;  1X01 A;  4J9H A;  3GLX A;  4PFO A;  3CXC S;  4FYW B;  3EGD B;  3RUX A;  2SRC A;  1LJO A;  2KRN A;  4M78 C;  2QQA A;  1EFN A;  4NOY A;  2M02 A;  2RHZ A;  3F70 A;  5AYF A;  1KQS A;  4M75 F;  1KD1 U;  3CC7 Q;  4M7D F;  2A08 A;  2QDL A;  2RA2 A;  1PG5 B;  4X34 A;  2OI3 A;  4FYV B;  3HTR A;  2JTF A;  1H8K A;  1T3S A;  2O2O A;  1ABO A;  1C1A A;  1VYV A;  1PM3 A;  3OB9 A;  5AT1 B;  1JXO A;  1IRE B;  1NPR A;  2V8J A; 
#chains in the Genus database with same CATH homology
 2FPF A;  3EG1 A;  3I5R A;  3M0P A;  2KT8 A;  1M30 A;  5IHN A;  2ROL A;  1M3A A;  1OPK A;  2J7I A;  1IO6 A;  2K7A A;  3M0S A;  1VYT A;  2LJ0 A;  3TSZ A;  3THK A;  2EYX A;  2ROT A;  2LX7 A;  3IQL A;  1OEB A;  1OV3 A;  4WCI A;  1QWF A;  1N5Z A;  4GBQ A;  1U06 A;  2KE9 A;  4FSS A;  4JZ4 A;  1BB9 A;  2LZ6 B;  1WIE A;  2LJ1 A;  2DYB A;  3SHW A;  2AKL A;  2J6F A;  2DBM A;  3M0U A;  2KXC A;  1E7O A;  1AD5 A;  2G6F X;  2VVK A;  2DL3 A;  2RMO A;  3VS7 A;  1BBZ A;  2PZ1 A;  2YDL A;  1PWT A;  1WI7 A;  2D0N A;  4AFQ C;  5EC7 A;  2HSP A;  2NUZ A;  4Y92 A;  2DL4 A;  1BU1 A;  2CSI A;  2HEQ A;  1JO8 A;  5IHI A;  4AFU C;  1H3H A;  1MUZ A;  1Y0M A;  4IIM A;  2L3Q A;  2KRO A;  2EBP A;  3UA6 A;  2JM8 A;  2X3W D;  2EYW A;  1M3C A;  1GFD A;  3VS1 A;  2KXD A;  2AZV A;  2KR3 A;  2DLP A;  1G83 A;  3EHQ A;  4QT7 A;  2DNU A;  2CH4 W;  1TUC A;  2KYB A;  2XMF A;  3M0T A;  1ARK A;  1NEB A;  2CT3 A;  2M51 A;  1Y57 A;  3REA B;  2EGC A;  1ZUK A;  2DJQ A;  1NYF A;  1Z9Q A;  2B86 A;  2V1R A;  2RN8 A;  1SHG A;  3UA7 A;  1GRI A;  2DIL A;  2IIM A;  2KRM A;  1AEY A;  1HJD A;  2C0I A;  1UE9 A;  1FYN A;  4OMP A;  2EYY A;  1RUW A;  3VS3 A;  4HVV A;  2RF0 A;  1MV0 B;  3ULR B;  2MOX A;  2LCS A;  4Z89 A;  2MIO A;  4LNP A;  2LQN A;  2JXB A;  2DL8 A;  2F2X A;  4J9B A;  2A36 A;  4AFZ C;  1ZBJ A;  4Z88 A;  4F17 A;  2GQI A;  2RNA A;  2KT1 A;  2OAW A;  2D1X A;  3VS2 A;  2HCK A;  4Z8A A;  3LH5 A;  1T0J A;  2PNI A;  2J6O A;  4LN2 A;  2F2V A;  3H0H A;  4AG2 C;  4D8D A;  3H0I A;  3R6N A;  1VYU A;  4OMQ A;  4RTT A;  4IIO A;  2P4R A;  1SEM A;  3EG0 A;  3VRZ A;  3KFV A;  1AZE A;  1UHC A;  2VWF A;  2OJ2 A;  2D8H A;  2MCN A;  1K9A A;  1PKS A;  1UHF A;  2CH4 A;  2CRE A;  2FPD A;  1KSW A;  3NMZ C;  3VS5 A;  1VA7 A;  2DRK A;  1ABQ A;  2EW3 A;  2YSQ A;  2GTO A;  2ECZ A;  2DM1 A;  1ZUU A;  2AZS A;  2ABL A;  4J9D A;  4HVU A;  1K4U S;  2KEA A;  1SHF A;  3H0F A;  3I35 A;  1UFF A;  2EYZ A;  2J05 A;  1PKT A;  2JS0 A;  4OML A;  4DEY A;  4JPB W;  2O9V A;  4JJC A;  2YT6 A;  4GLM A;  5I11 A;  4OMN A;  4RUG A;  2ED1 A;  1YWP A;  4RTU A;  2GTJ A;  4R0K A;  2KYM A;  5L23 A;  3UAT A;  1X2K A;  1U5S A;  2YUP A;  2EGE A;  2DRM A;  3UF4 A;  1X6G A;  1KFZ A;  3RNJ A;  2I0N A;  2M0Y A;  3QWX X;  5IXF A;  2AK5 A;  4HXJ A;  1ZLM A;  1JEG A;  1FMK A;  1HSQ A;  3NPF A;  1Z9Z A;  3EG3 A;  2EQI A;  2HDA A;  4E6R A;  2O9S A;  1W1F A;  2CT4 A;  1AWW A;  1RLP C;  3O5Z A;  4HVW A;  4JZ3 A;  2DA9 A;  4K11 A;  2JS2 A;  1UDL A;  2K6D A;  1SRM A;  2F2W A;  2LJ3 A;  2EKH A;  2K3B A;  1TG0 A;  4JJB A;  4CC7 A;  4J9F A;  2FEI A;  5FWC A;  3ZL7 C;  4CC3 A;  2CUB A;  1GCQ A;  1J3T A;  3SEM A;  3CQT A;  4LUE A;  1WA7 A;  2YUO A;  1WDX A;  4J9C A;  2J06 A;  1LCK A;  1NYG A;  1YN8 A;  1XOV A;  1G2B A;  1WXU A;  1T3L A;  3PVL A;  1WFW A;  3PE0 A;  2V1Q A;  2L3P A;  1E6H A;  1ZX6 A;  2GGR A;  2DL7 A;  4CC2 A;  2A37 A;  4J9G A;  1GBR A;  4LE9 A;  4M4Z A;  4ORZ A;  4RTZ A;  4A63 B;  1YNZ A;  3C0C A;  1M8M A;  2J6K A;  1AWO A;  2BZY A;  3NHN A;  1PRL C;  2DF6 A;  2K79 A;  4ESR A;  2EVR A;  3H41 A;  2JM9 A;  2L2P A;  4AG1 C;  1SPK A;  1BK2 A;  1K1Z A;  4RTY A;  1PNJ A;  2GNC A;  1ZUY A;  1X2Q A;  1K0S A;  2RQU A;  2NWM A;  2HBW A;  1WYX A;  2DMO A;  2AKK A;  3QWY A;  2KBT A;  1X43 A;  1W6X A;  4X1V A;  5FW9 A;  2W10 A;  1QCF A;  1S1N A;  2EGA A;  5I22 A;  1NLO C;  4RTV A;  3EGU A;  2FG0 A;  1E6G A;  4EIK A;  2ESW A;  2GBQ A;  2DX1 A;  4F16 A;  1ZSG A;  2FRY A;  1GL5 A;  1K0X A;  2DL5 A;  1RI9 A;  2K2M A;  2RQT A;  2K9G A;  1GBQ A;  2LMJ A;  2CSQ A;  4J9E A;  2RQV A;  4DEX A;  5HCK A;  1PHT A;  1CSK A;  2D8J A;  2PTK A;  2YUQ A;  2L3S A;  1GFC A;  2JMC A;  1AOJ A;  1JQQ A;  3VS0 A;  1H92 A;  1JXM A;  3TSW A;  2VKN A;  1A0N B;  1SRL A;  1YP5 A;  4HCK A;  4F14 A;  1UJY A;  2E5K A;  4AFS C;  3EG2 A;  1B07 A;  5IXB A;  1OOT A;  2ENM A;  1NG2 A;  3RBB B;  2KRS A;  1UJ0 A;  1WXT A;  3EHR A;  2YUN A;  1SSH A;  2BZX A;  2ED0 A;  1NLP C;  4J9I A;  3M0Q A;  5IHK A;  3FJ5 A;  2CDT A;  4LUD A;  1WLP B;  2CUD A;  1QLY A;  3TVT A;  1UEC A;  1QWE A;  4D8K A;  2BTT A;  2LP5 A;  1AVZ C;  3GBQ A;  1T0H A;  1K76 A;  1TUD A;  1X69 A;  1X6B A;  3VS4 A;  1MV3 A;  1AWJ A;  1I07 A;  1PRM C;  2JMA A;  3VS6 A;  2C0O A;  1AZG B;  2DVJ A;  1UGV A;  2FO0 A;  5GJV B;  3I9Q A;  4RTX A;  1X27 A;  1M3B A;  1NEG A;  2RPN A;  1NM7 A;  3JV3 A;  2JT4 A;  4JJD A;  1JU5 C;  3NGP A;  2L0A A;  1B3Q A;  1RLQ C;  1M27 C;  2FRW A;  1YWO A;  1YCS B;  4CC4 B;  1OPL A;  2X3X D;  3A98 A;  2RQW A;  2SEM A;  2LNH B;  2O31 A;  1CKB A;  3VRY A;  5FWB A;  2RQR A;  2LQW A;  1WXB A;  3REB B;  1QKX A;  1V1C A;  2DBK A;  3PVQ A;  2C0T A;  4J9H A;  1UUE A;  4KRT A;  1HD3 A;  2SRC A;  2BZ8 A;  4OMM A;  2KRN A;  2H8H A;  1W70 A;  1QKW A;  1EFN A;  2EPD A;  1UTI A;  1AWX A;  5ECA A;  1GCP A;  5GJW B;  5IH2 A;  3I5S A;  1CKA A;  2A08 A;  2A28 A;  1UG1 A;  2QDL A;  1KJW A;  4RTW A;  2DE0 X;  1I0C A;  1WX6 A;  2JTE A;  1I1J A;  2OI3 A;  4ZNX A;  2W0Z A;  1H8K A;  1T3S A;  2O2O A;  1ABO A;  1VYV A;  2JW4 A;  3U23 A;  4OMO A;  3M0R A;  1KIK A;  1GCQ C;  2O88 A;  1U3O A;  2KGT A;  1JXO A;  2FPE A;  2KNB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...