2YUPA

Solution structure of the second sh3 domain of human vinexin
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
90
structure length
90
Chain Sequence
GSSGSSGKPPTYQVLEYGEAVAQYTFKGDLEVELSFRKGEHICLIRKVNENWYEGRITGTGRQGIFPASYVQVSREPRLRLCDDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the second SH3 domain of human Vinexin
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Vinexin
total genus 6
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2yupA01
3H0IA 2JXBA 1HD3A 1WYXA 2LCSA 3NMZC 2AZVA 2KRNA 1JO8A 5GJWB 1T0HA 1UHCA 3EHRA 1YN8A 2BZXA 2DVJA 2J6OA 3REBB 1PHTA 2D8HA 3VS1A 1ZX6A 1Z9ZA 2EKHA 2D1XA 2LNHB 1X2QA 2CSIA 2I0NA 2YT6A 4D8DA 4Y92A 1UJYA 2LQNA 1NEBA 4ORZA 2QDLA 2LMJA 2KGTA 1VYUA 1E6HA 4RUGA 4Z89A 1HSQA 2JM9A 1RLPC 3H41A 3UA7A 2EGCA 2P4RA 1TUDA 2FO0A 1NEGA 1VA7A 2J7IA 4J9GA 3R6NA 1MV3A 4J9BA 1UHFA 2EVRA 1WIEA 2RPNA 3PVLA 1ARKA 3I9QA 1JXMA 5IHKA 1NLPC 1ZUUA 2X3XD 1AOJA 1PKTA 4J9EA 1AWWA 4RTZA 2FEIA 1AWXA 3VS6A 2JMCA 1S1NA 1K4US 1AZGB 1OPLA 2GTJA 4KRTA 3QWYA 2RN8A 3PVQA 2A36A 3QWXX 5IHNA 1IO6A 1X69A 2RQRA 1ZSGA 2CT4A 3VS5A 2KE9A 1ZUYA 4R0KA 2D8JA 3VRZA 1XOVA 1QKXA 1A0NB 1M30A 2DL5A 1SRLA 2K79A 2W10A 2CDTA 4AFUC 1H92A 2DX1A 1BU1A 1AWJA 2VWFA 1YWPA 4EIKA 4GBQA 1RI9A 3M0RA 2KR3A 2RNAA 1NYGA 3U23A 2K6DA 2BZ8A 1B3QA 4J9DA 1T3LA 1YNZA 2KT8A 2EYYA 2ESWA 5FWBA 2HSPA 1JEGA 3M0TA 1M8MA 2LZ6B 3PE0A 3KFVA 4HCKA 3H0HA 4D8KA 3RBBB 3I5RA 2CUBA 5GJVB 2RQUA 4Z88A 2A28A 2EBPA 1TG0A 2DE0X 4OMNA 2BTTA 1AD5A 4AG1C 4GLMA 2F2XA 1BK2A 2YUQA 2KRMA 4CC4B 1M3BA 5L23A 2KNBB 2FPEA 2CH4A 5I11A 2NUZA 3M0PA 3VS7A 1EFNA 2CSQA 1E6GA 3NHNA 4WCIA 1AWOA 1V1CA 1X2KA 1UUEA 1K0XA 1RUWA 2DL7A 1KFZA 1ABQA 3CQTA 2KYMA 1U5SA 2YUOA 1ABOA 1NYFA 2JW4A 2AZSA 2MCNA 1ZLMA 2FRWA 1U06A 4RTTA 2KXCA 4JZ4A 2F2WA 1X27A 2JS0A 1GCQA 2W0ZA 4AFZC 1I0CA 4OMLA 4X1VA 2EGEA 3EGUA 3VS2A 2PZ1A 2CREA 1I07A 1JU5C 2J05A 1W70A 2RQWA 2V1QA 1NM7A 3I35A 5EC7A 4E6RA 2L3SA 2RMOA 2K3BA 1KSWA 1YWOA 1GCPA 1MUZA 2O88A 4ESRA 1UFFA 3UF4A 3ULRB 1UECA 1UE9A 2EW3A 2HBWA 4J9CA 2J6KA 1ZUKA 1SHGA 4JJBA 4A63B 1WA7A 5ECAA 2F2VA 2JMAA 2KROA 2CT3A 1PRMC 4M4ZA 4AFQC 1Z9QA 3JV3A 1UGVA 2DRMA 2JT4A 1PNJA 4IIMA 1M3AA 3RNJA 1PKSA 3TVTA 2EPDA 1W6XA 3UATA 5IH2A 1SPKA 1SEMA 1T3SA 4JPBW 5IXFA 3TSZA 2K9GA 2DF6A 1K76A 3M0UA 2JS2A 2KXDA 1T0JA 2RQTA 2DILA 1JQQA 4HXJA 1E7OA 4J9HA 2O9VA 2DL4A 1OEBA 5FWCA 2GQIA 2C0TA 1UDLA 2EYZA 1OOTA 2D0NA 1J3TA 1X43A 1G2BA 3VS0A 3FJ5A 4AG2C 1K1ZA 1GRIA 3VS3A 2YSQA 2A37A 4Z8AA 1UG1A 1WX6A 2ROLA 2LP5A 1NG2A 3LH5A 1M27C 4DEXA 4IIOA 1YP5A 4J9FA 4RTWA 1I1JA 1AVZC 2LJ0A 3REAB 2LJ3A 1WXTA 3VS4A 5I22A 2M0YA 3O5ZA 1U3OA 4OMMA 4LE9A 2HDAA 2IIMA 2DNUA 4HVWA 2OJ2A 4HVVA 3M0SA 2HCKA 1GBQA 2DMOA 2NWMA 1AEYA 2VVKA 4AFSC 2LJ1A 2ECZA 1CSKA 1PWTA 2AK5A 1UJ0A 4CC3A 2FG0A 2KBTA 2SEMA 2DRKA 1SSHA 1JXOA 1SHFA 1CKBA 2KEAA 2KYBA 4ZNXA 1VYVA 2PNIA 1K9AA 4CC2A 2CUDA 4LUDA 3SHWA 1SRMA 2V1RA 1H8KA 1GCQC 3ZL7C 3EHQA 2BZYA 2J6FA 1VYTA 1QLYA 3I5SA 2DYBA 2YUNA 2CH4W 2J06A 1OV3A 4F16A 2B86A 2X3WD 2EYXA 2EYWA 1WXBA 2KT1A 1QCFA 3NGPA 1M3CA 2L0AA 1BB9A 1FMKA 2O2OA 1NLOC 1KIKA 1BBZA 2OAWA 4FSSA 2EQIA 2DJQA 4F14A 3EG2A 1YCSB 1AZEA 3SEMA 2FPDA 4JJCA 2GNCA 3NPFA 3TSWA 2O9SA 2XMFA 2FRYA 3EG0A 2GTOA 1G83A 1WXUA 1X6GA 3VRYA 1WFWA 1GL5A 2MIOA 2PTKA 2SRCA 4K11A 2DM1A 2YDLA 4OMPA 2C0IA 2LX7A 1RLQC 2JTEA 3A98A 2RQVA 2M51A 2GBQA 3EG3A 2DA9A 2GGRA 2EGAA 2ROTA 1HJDA 2VKNA 4RTUA 4RTYA 1TUCA 2C0OA 1QWEA 2MOXA 4RTXA 1B07A 2A08A 1QWFA 1CKAA 4OMOA 4QT7A 2H8HA 1WI7A 1X6BA 4F17A 2K2MA 4HVUA 4LUEA 5IHIA 2DBKA 5FW9A 4JJDA 4RTVA 1W1FA 5IXBA 4LN2A 2ENMA 1ZBJA 1GFCA 4LNPA 2ED0A 3H0FA 1OPKA 2DBMA 2DLPA 2O31A 1FYNA 2E5KA 5HCKA 4J9IA 1WLPB 2L3QA 3GBQA 2OI3A 1QKWA 2KRSA 3THKA 2ABLA 1GFDA 2AKKA 1N5ZA 2LQWA 4CC7A 1PRLC 2DL3A 1Y0MA 3M0QA 1MV0B 2FPFA 2RF0A 4OMQA 4DEYA 3EG1A 1H3HA 2DL8A 2L3PA 1K0SA 1LCKA 1WDXA 1UTIA 1GBRA 1Y57A 2AKLA 2G6FX 3IQLA 3UA6A 2HEQA 3C0CA 1KJWA 2K7AA 2YUPA 2L2PA 2ED1A 2JM8A 4JZ3A
chains in the Genus database with same CATH superfamily
2CZ0B 1WYXA 1NPPA 3RIRA 3MP1A 2KRNA 5GJWB 1UHCA 3OYEA 2BZXA 1YI2A 3R6OA 4EMHA 3A8OB 1Z9ZA 2VB6A 2EKHA 3VUZA 1UEBA 1TSFA 2D1XA 2XU8A 2LNHB 2I0NA 4M7DC 5HK0A 1RAGB 3L42A 1UJYA 3JB9G 3LWHA 1YJ9T 2GFAA 3RMQA 2WSFE 3LWIA 1I4K1 1U8RA 2LMJA 2XHCA 2DZCA 3EG9A 1XQHA 3OMGA 4HT8A 1KD1R 1RLPC 4JS5A 3OW2A 1VQ8Q 3TCJA 4N4GA 2FO0A 3S3MA 3HTRA 1TTHB 1JXMA 5GAN4 4J6WA 2DTHA 1ZUUA 1R77A 2X3XD 1AOJA 1UGRB 4FW1A 3OA6A 1TU0B 3KXTA 2FEIA 2OTLA 4DBFA 2FYKA 3X25B 5FRMA 3L2QA 2RN8A 1IXDA 1AHJB 2PQWA 4N0AA 2QGFB 5DY9A 4RKUE 3CCQQ 1D0YA 3OYNA 5GAMe 3MP6A 1VQ5T 1WQ7A 1XOVA 1QKXA 3JCMX 1D0ZA 4X9DA 4HKEA 3UT1A 3MO8A 1Y7XA 2QQAA 5KYWA 2DX1A 1VUBA 1YBYA 2X4XA 3V8JA 1RI9A 5KYUA 2RNAA 3CCSA 1YITQ 3BFMA 1YNZA 2LCLA 1VQ6T 2ESWA 3OYDA 2HSPA 4J6YA 1SG5A 3M0TA 8ATCB 3G71Q 2EWNA 4J5YA 2HZYA 2RO0A 2E10A 4QKUA 4C5GA 1M2OA 1KD1C 1MMNA 5GMKe 1NPRA 4BE0A 1M2VB 2BTTA 4F04B 1BI3A 1MHNA 2E5QA 4GLMA 4ZTJA 3HRTA 2JUFA 4J7FA 3L1AA 5L23A 2LNVA 1R0CB 1FWZA 2KNBB 1M5Q1 3KBGA 5LJ5d 1RAEB 3M0PA 2CSQA 1QCOA 3NHNA 1AWOA 3OYKA 1M9SA 1UUEA 3EG9B 4C8QG 1I5OB 2DL7A 4PJOG 3BW1A 3CEYA 3CQTA 1KC8R 2AZSA 2FRWA 1U06A 2KXCA 5FU7B 3CCQT 2IVWA 4C92A 2E6ZA 3TQ7P 3AHUA 1X27A 4AFZC 5C6SA 4X1VA 2ZAEA 4BY6B 2RD1A 2J05A 2MWPA 2MWOA 1NM7A 3NTKA 1B7TA 3NTHA 1K9MU 2L3SA 4XQ3A 1N8RU 1GCPA 1TH7A 3LGFA 1BI2A 1UFFA 3UF4A 3ULRB 1PG5B 1OI1A 4C0GA 2AT1B 4M77C 2EW3A 4M7DA 1ZUKA 4BD3A 4IUVA 2D9TA 4M4ZA 1Z9QA 2RI2A 2DRMA 1PNJA 2DKGA 2HKQB 4NS5A 3HSBA 1D1CA 3RNJA 2EPDA 3JCMh 2CKKA 3CPWS 5IH2A 1SEMA 4JPBW 1LJOA 3V7SA 1PC0A 1N9RA 4MMLA 4BDZA 1WNLA 4PJOA 1VQOA 1KC8C 1YJWT 1I8FA 4J9HA 3GPLA 2DL4A 4IKFA 3OYAA 4M78F 5FRNA 1X6OA 4FT2A 1B34A 2EYZA 1OOTA 3EH2A 2FZCB 2K5IA 2BUDA 1W2BA 1G2BA 2P4TA 3CBPA 3CCET 1M1KC 3FJ5A 3FIFA 1OU8A 3VS3A 3CCMT 2A37A 2I2LA 4Z8AA 1OYXA 3CD6A 1ZSZC 4R55A 3C12A 2LP5A 1NG2A 2ZCFB 1I1JA 1IB8A 4PJJA 2YRCA 2LJ0A 4C92B 1QW1A 2KMTA 1Q86R 2M0YA 2AIRB 3O5ZA 4LE9A 2QXFA 4MMKA 2KSSA 2LDMA 4QW2A 4C0ZA 5CKDA 2HCKA 2X4JA 4VUBA 4ZTFA 1AEYA 4AFSC 1QQJA 2LJ1A 3MKDA 1CSKA 1UJ0A 2QK0A 2BE7D 2FG0A 4ANJA 2SEMA 3VJPA 4XTWA 1Y07A 3RERA 2KEAA 3EH1A 4ZNXA 4KGVB 4C0DC 1BI0A 1PM3A 1MMGA 3SHWA 3CCJT 3LH0A 3CXCA 4OVAA 3CCJQ 1RI0A 5GMKi 2K57A 2CH4W 4QVCA 2B86A 3EGXA 4RG8A 1BB9A 2O2OA 1LOJA 1NLOC 5GAN3 3HFNA 1H3ZA 3CC7Q 4F14A 1Q86C 2QDYB 4JJCA 3A5ZB 1VQMA 2GNCA 2HKNA 3H6ZA 2DXCA 4HCZA 3O8VA 3CBOA 2QQ9A 5LJ5g 2GTOA 1D1AA 2DEQA 1X6GA 3WXMB 3PNWC 5D7UA 1WFWA 3FB9A 3L2RA 1I81A 1D09B 4KH1B 2Y4XA 2ZPGB 2JTEA 5D6YA 2KY9A 3EG3A 2GGRA 2OTJT 2RHIA 2EQKA 4RTUA 1TUCA 4O5VA 4RTXA 1B07A 3G1JA 1TUGB 1XJWB 2QGGA 4DBHA 1QWFA 4BE2A 1CKAA 3FLGA 4C92G 3M4GA 4QT7A 1WI7A 4F17A 4GY5A 4PLLA 1TS9A 2DBKA 1FX7A 4JJDA 2RA2A 4N4HA 1VQ6Q 2HL3A 4FYVB 4RTVA 2P84A 3CC2A 5FU6B 5GAN8 3CC2Q 3M9QA 1QP2A 2EJ9A 3QG1A 1VQKQ 2X4WA 3OYJA 1WHJA 4QVDA 2FL7A 2LQKA 3QZ9B 2L3QA 3GBQA 3G71T 1VQ5A 1V29B 4PJLA 2OI3A 1VQ5Q 2KRSA 4JLGA 5CVIA 2AKKA 1KHIA 2FZGB 4A54A 5CQXA 2YLCA 4CC7A 4A4FA 1YIJA 2NUTB 3CCEQ 4Y28E 1NBEB 2DL3A 3MEUA 2FPFA 1OU9A 1I5LA 2RB6A 1QVFA 4M77F 1V76A 3EG1A 3M53A 1K0SA 2RI5A 5C0MA 2AKLA 3IQLA 2DIGA 3L2VA 2WSCE 3I56A 1O75A 4MZTA 2E70A 3OQ5A 2JTMA 4LD6A 3JCMe 1U1SA 2JM8A 2JXBA 3M55A 3MEWA 1HD3A 1TWBA 2AZVA 3GLXA 2YHTA 3HRSA 4XU2A 1WHKA 1T0HA 2R5AA 5GMKl 3G4SA 1IHWA 4P5NA 1MGQA 3Q1JA 4PL6A 1JBMA 2CP3A 2YT6A 2IPOB 2Z0WA 2YXYA 4M7AC 1SKUB 2F5TX 4LXCA 4EDUA 4E7ZA 2QDLA 4OGEA 2KGTA 4BB7A 1VYUA 3BDLA 4TVRA 1E6HA 3RKWA 8AT1B 3OYIA 1YJ9A 4FSXA 3PFSA 3H41A 4A4EA 3CD6Q 3PT9A 1YIJT 5DM7R 4RG2A 4C8QA 1MV3A 1UHFA 2EVRA 4M7AB 1M1GA 5KH6A 2VGNA 1PD0A 2RPNA 3OSSC 4M77B 5IHKA 1PKTA 2QG9B 2PVOB 3G71A 4DQ2A 1BYMA 1S1NA 2GTJA 3A8MB 3QWXX 4GLKA 4J83A 1D1BA 2L3RA 4R0KA 3JCMQ 4FM4B 5GANd 2XDBA 2XICA 1RACB 1M30A 1SRLA 2XI9A 2V8JA 2XIDA 1Q81C 1UB4A 1K9MR 4IUQA 5CKFA 1G3YA 1YWPA 4EIKA 3U23A 2K6DA 2H3EB 2BZ8A 4J9DA 2EYYA 1KQSP 1JEGA 3P8HA 5GAOn 2E12A 1KC8U 3C4SA 4D8KA 3I5RA 2KAFA 5GJVB 2DEUA 4Z88A 4J8OA 2A28A 3RR6A 2MF2A 4FL6A 3DB4A 3G6ET 2YUQA 4CC4B 5IN1A 2YLBA 1R0BG 2QQSA 3DLLA 1PSEA 1M2VA 5KCHA 3EGDA 3VS7A 2E6NA 1E6GA 5CCAA 4ZN3A 5GAMh 1M1KR 2JTFA 1M90C 1QVPA 1ABQA 1KQ2A 3ZEHA 1HK9A 1XTDA 2KYMA 2YUOA 1ABOA 3CPWA 1NYFA 1K9MC 2ZGWA 3CMEA 1ZLMA 3CC4Q 4C0DB 4A4KA 4JZ4A 3VYHB 4FW2A 2F2WA 2MPXC 3JAME 2JS0A 1GCQA 3OYBA 4M78E 2P0QA 3INZA 3S3OA 2M0OA 5GMKj 4L5GA 4DBRA 3BY7A 1ZA2B 2CP5A 2QQRA 5LJ3e 1MUZA 4ESRA 1UECA 3QUIA 3JCMg 2J6KA 4M7DE 1Y96B 4B9XA 2DYIA 2V8IA 4QQDA 4C5HA 2VXEA 3X24B 4BUGA 2F2VA 4EPCA 4CI0C 4FYYB 3JV3A 1C6VX 1UGVA 4KT0E 2JT4A 2HMAA 1ZSZA 4B9WA 2QTXA 1W6XA 1QVFP 1SPKA 5GAOm 1T3SA 2QYZA 3TSZA 2K9GA 2DF6A 1K76A 2KXDA 1KQSA 2V26A 2WSEE 1E7OA 1JJ2A 1BIBA 1OEBA 5FWCA 2GQIA 2C0TA 1UDLA 2M16A 2R57A 5J3BA 1X43A 4XU1A 4AG2C 3LYIA 1F1BB 1WX6A 5AYFA 1WGSA 4KH0B 2XKOC 3CBMA 5GAN6 2ROLA 5J26A 3T9NA 2FHDA 1AVZC 4XU3A 1WZOA 5I22A 3M58A 1AT1B 3CCRT 1U3OA 1FMVA 3E2UA 3EFOB 2O4XA 4DA4A 3H8ZA 1D3BB 5KE2A 2R5MA 3QKJA 4MDWA 2P0KA 5LJ3h 2OJ2A 3G4SQ 1LPLA 2NWMA 4BI8B 1RAIB 2AK5A 1OULA 2NUPA 4WTOB 1M90U 2DRKA 3ME9A 1BI1A 2BIVA 2E3HA 1SHFA 5GAMd 2VC8A 1CKBA 3OYFA 3CCVQ 3CCUT 1VYVA 2GF7A 2PNIA 1VQNT 3ASKA 2CUDA 1WQWA 2MK5A 3M54A 5KYYA 3GNGA 4DOWA 1GCQC 2BZYA 5GAOr 2VUBA 3I5SA 2LT1A 3PMTA 2X3WD 9ATCB 4F7UB 4X34A 2L89A 2L0AA 1X75C 3M5AA 3M57A 3GF5A 5I2SA 3OW2S 1G8XA 4EMKA 4IUPA 2OAWA 2OX7A 4E2FB 4M7DD 3A8HB 3FEOA 2PU9B 3M4YA 1VQKT 4J7IA 5HKCA 2NLUA 3FJPA 2QASA 2XMFA 2FRYA 4KGZB 2GQVA 3QYGB 4M78A 2CP2A 1S72Q 5A0LA 3PGGA 1VQOT 2SRCA 2EQUA 2X9HA 4K11A 2YDLA 4OMPA 4Q5WA 3HRUA 3A98A 5FU7C 2RQVA 4C8QC 2MAMA 2M51A 1IHVA 1VQ4A 5LJ3f 2ROTA 4WF2A 3CMAQ 2VKNA 4RTYA 1HJDA 2B8AA 3OS5A 1QWEA 1U1TA 2MMPA 1WHHA 2CS7A 3TREA 2MOXA 4KGXB 3JB9H 3M56A 1MMDA 3OS0A 4E7LA 2COZA 5FW9A 3CCLQ 2JJ9A 2LTOA 5D6XA 1OZ3A 5IXBA 2LC4A 2C06A 1UGQB 4LNPA 2ED0A 3H0FA 1OPKA 2ZPIB 2DLPA 2O31A 5HCKA 2KI7A 2RK1A 3QJ6A 3MCAB 2Y4YA 3THKA 3VYGA 4E7SA 3OY9A 1C0MA 2ABLA 4C92F 1HYOA 4JRPA 3HKSA 2LQWA 1N6AA 3RESA 3EAEA 4C5EA 1Y0MA 2CZ7B 3QJYA 3LLRA 2QTVA 2DTOA 1QCNA 4DEYA 1H3HA 3RMSA 2L3PA 1WJRA 2KQWA 5GAMf 5J39A 1LCKA 3JCMW 4FYWB 1Y57A 2E65A 2G6FX 3QO3A 4M75F 3ZFJA 5GMKm 1WHMA 2HEQA 2L2PA 3SWNA 1NJIC 4FCYA 2DAQA 3A1PA 3BE3A 1JJ2S 4F7UG 5IT9E 4Y91A 2QA4T 3EHRA 1YN8A 2DVJA 2J6OA 1PHTA 3VS1A 1ZX6A 1YCYA 2RJCA 2CSIA 2CZ1B 1VOMA 4D8DA 3HHTB 1BKBA 4Y92A 2VGMA 3URGA 2LQNA 1NEBA 3CCMA 4F7UA 2OTJA 5FLXE 1NZ9A 1N9SA 5CO7A 4Z89A 2DD4A 1VQPT 1FXXA 5DLQE 2EGCA 4M7AD 1YFNA 3HFOA 5GAOq 2E1HA 1YJNT 1VQ7Q 1NEGA 5KYYB 3R6NA 4J9BA 1MNEA 1WIEA 4II1A 3PVLA 5CQYA 2XDPA 4AT1B 1ARKA 1NLPC 1M8VA 2K3YA 2L5QA 1KD1U 2JMCA 1S72A 1K4US 2DZ9A 1OPLA 2NUPB 1PCXA 2A36A 1NJIR 5IHNA 1X69A 1S72T 1WHLA 2EJFA 2RQRA 5KE3A 2CT4A 2EKOA 3VS5A 1YITT 1VQLT 2D8JA 5LJ3j 3VRZA 2QI2A 3VUBA 2QEXQ 2K79A 2QEXA 1H92A 2Y90A 3PIPA 4MDXA 4M75B 3H9NA 4HA8A 1KG1A 3JCMb 1AWJA 2VWFA 4DBQA 4GBQA 4M75A 3M0RA 2KR3A 1NYGA 4ZGDB 3JB9F 1B3QA 1Q81R 5FWBA 2DO3A 3F70A 1GXIE 3PE0A 4C5IA 2BE9B 3MPUB 3H0HA 3RBBB 1IGQA 1QMCA 1IZ6A 3L2UA 3CC4A 2RQUA 2EQJA 3P8BB 4PKCC 3J7AF 2EBPA 5DLOA 4AG1C 1AD5A 5I2MA 1YI2T 3CCUQ 2O01E 1BK2A 3CCVT 1EZZB 1M3BA 1YHQT 1IREB 1D0XA 3MEVA 3N5BB 1FMWA 2CH4A 2NUZA 4C8QD 4AMCA 1VQLQ 3G4ST 4RCCA 4JLIA 3OYMA 4WCIA 4HT9A 4EMGA 2FZKB 5FU6C 1V1CA 2XD0A 1X2KA 2OTLQ 1ZSZB 1RUWA 3UWNA 2RHUA 2K2VA 1KFZA 2PVGB 2RHXA 4PLIA 1U5SA 5HK3A 1Q82R 3V7RA 3I55A 4E7IA 3I55Q 2MCNA 1O9SA 1N8RR 4PJNA 4RTTA 4OP0A 2HNIA 2W0ZA 5A0GA 1I0CA 4OMLA 3C95A 2EGEA 2LCCA 3EGUA 4M7DG 3VS2A 5GANf 2CREA 3BDUA 1W70A 3VU3C 1Q82U 2M1HA 2V1QA 1G3SA 3L2ZA 2RHZA 4E6RA 1BCOA 1KSWA 5KCOA 2F69A 3CCLT 2DETA 2VYTA 1P92A 1M1KU 1C1AA 1YIJQ 3SB2A 4ME7A 2HBWA 2VASA 5EG2A 5CR2A 3FC3A 1SHGA 4M78G 4A63B 3CC2T 3QXEB 5ECAA 5GANh 5CK9A 2MYSA 2E41A 5GAOl 3GP8A 2CT3A 4A4HA 4AFQC 1ZHIA 1SF9A 3GNFB 4IIMA 1M3AA 2HD0A 1PKSA 3TVTA 1VQKA 3UATA 3JCMd 5IXFA 1LNXA 2RQTA 4M77G 4XTUA 2QA4A 1NJIU 2JZ2A 3QYHB 4M77D 2CYZB 3UPUA 2D0NA 1J3TA 2A0FB 4F7UE 4ZGJB 1VQ9T 3VS0A 3SFMA 1Q86U 2EYQA 1DJ7B 1K1ZA 3CC7A 3EFRA 2YSQA 3SDZA 1M4ZA 1UG1A 1RL2A 2OTLT 1UGSB 4PFPA 4YTLA 3JCMV 3E19A 4DEXA 2QQBA 4RTWA 3E1SA 1WXTA 2K5LA 3JCMc 4NOYA 4PJOC 2X35A 5AT1B 2HDAA 4E7JA 5A0DA 2JVVA 4DOVA 4M7AG 3V8KA 4HVVA 2DERA 4NL2A 1JJ2P 2ZPBB 1GBQA 2DMOA 5LL6S 2VVKA 3OBYA 3JSCA 1PWTA 1R8OB 3CCUA 4KULA 2DVEA 4A4GA 1SSHA 1JXOA 5L8RE 5GANe 2KYBA 3AT1B 2VV5A 4CC2A 4LUDA 1TXQA 4BI4A 1SRMA 4EMKB 2CP0A 2ZPHB 2RM4A 1IGUA 4JRKA 3EHQA 3WVDB 2J6FA 1VQOQ 2LQ8A 7AT1B 2YUNA 4PNOA 2J06A 1OV3A 4F16A 2GFUA 3MJXA 2KT1A 3NGPA 3LX7A 2AHJB 1FMKA 3LW5E 5GAN2 2HSEB 1KIKA 4EMKC 1BBZA 4FSSA 4PJOE 4OMFB 4FU6A 3EG2A 3EFSA 4PFOA 3SEMA 4M75E 3NPFA 4RMOA 3VRYA 3MHXA 2COWA 3VV0A 5LJ5e 4KBMB 1GL5A 2MIOA 2PTKA 4OF1A 2C0IA 1VQ7A 2LX7A 3CPFA 4JUVA 1RLQC 1YHQA 2RJEA 3EFOA 2DA9A 2EGAA 2K3XA 2D6FA 3X20B 2C0OA 2XDDA 3HL8A 2XG8D 4C92C 2A08A 3CXCS 4HCCA 4OMOA 2CP6A 2DPPB 3OB9A 1X6BA 5IHIA 3QBYA 3I56Q 1Y71A 1W1FA 1WJSA 5A2QE 4E7HA 4LN2A 4QQ6A 2ENMA 4C8QE 1ZBJA 1VIFA 4JS4A 1Q7YC 2DBMA 1N8RC 4M75C 2E5KA 4J9IA 1WLPB 2EQMA 3E9FA 3DB3A 3I56T 3D7SB 2IG0A 5LJ5j 4UC4A 3CCRQ 2DD5A 1N5ZA 3JB9D 3CCSQ 3SWNB 3M0QA 3JB9I 2QAZA 1MV0B 3FRNA 4M78D 2G3RA 2HQXA 4C92E 1Y96A 1WDXA 1GBRA 4JJNK 3CCMQ 3UA6A 5GAOp 2K7AA 2YUPA 2DXTA 2ED1A 4JZ3A 2M02A 3G6EA 3H0IA 1EIFA 2HQHA 2ZPEB 1K8AU 2LCSA 3NMZC 3CMAT 5GAMj 4MZPA 1YJNA 3GIBA 1JO8A 1H641 3REBB 3JCMJ 2D8HA 1TOVA 2M9UA 1QVGP 1X2QA 4PJMA 4Z02A 4OGCA 4LDXA 1JRIA 4OB3B 4ATOA 4J6XA 3L2WA 4XU0A 5CIUA 4IURA 3CPWP 4ORZA 3E9GA 3VKIA 1YJWQ 3EGXB 4RUGA 4ZGEB 2D0QB 4C8QF 3JB9J 1HSQA 2JM9A 3NFCA 3CMAA 3CXCP 3UA7A 2P4RA 2PUOB 1K73C 3J80E 1RADB 1TUDA 1VA7A 2J7IA 4J9GA 2F5KA 4ELYC 3CMET 5CKEA 2XK0A 2A7YA 5FROA 3I9QA 3ZBDA 3TU4K 2RJFA 4N4IA 1OQKA 4J9EA 1AWWA 4RTZA 5CKBA 1AWXA 3VS6A 4A53A 3MP8A 4MZMA 1AZGB 1VQNA 4FYXB 3KUFA 3QWYA 4KRTA 2R58A 3PVQA 5D6WA 1IO6A 1ZSGA 3OS1A 2KE9A 6AT1B 1ZUYA 4PK4A 2CGHA 1G3WA 2ZZDA 4XTYA 1A0NB 4M78B 2DL5A 1ACMB 1RABB 2W10A 2CDTA 5HY6A 4X9CA 4AFUC 4XTVA 3FDRA 4PJOD 4LDWA 1KK7A 1BU1A 3CCJA 5I21A 5GAN5 4KUIA 2JNGA 3OSVA 4OB0B 1T3LA 2KT8A 3OYHA 1KQ1A 1M8MA 2LZ6B 3RKXA 2LVMA 1G5VA 3KFVA 4M78C 4HCKA 3RUXA 3TEEA 2CUBA 3HPWA 3CCVA 3M59A 4LDUA 1TG0A 2DE0X 3V8LA 4OMNA 4NL3A 1B34B 1YJ9Q 3OYGA 2F2XA 1VQ7T 2KRMA 2COYA 3OYLA 2K4YA 5M9OA 1K73U 3ER0A 1M90R 1VQPQ 4M7AA 4XAXB 4PJOB 2WACA 2FPEA 4C8QB 2LT4A 5I11A 2OAUA 1EFNA 3HP9A 3X28B 1VQ9A 2NYSA 1EX4A 1K0XA 2KK4A 1QVFS 3S3NA 4LD9K 2YWWA 4RCBA 2FB7A 1MMAA 4JRIA 1Q81U 1K73R 3OMCA 1D3BA 2X51A 5GANg 2YRDA 2JW4A 1ZA1B 5CKHA 3QDRB 1IRXA 2EFIA 1Q95G 4M7DB 4C92D 2BKDN 4E47A 3A8LB 2E4HA 2PZ1A 1I07A 1JU5C 2RQWA 3I35A 5EC7A 2RMOA 2X4YA 2K3BA 4L59A 1YWOA 4M7AF 1MNDA 2YRVA 2O88A 1UE9A 2HAXA 4F7UF 3LGLA 3P8DA 3S6WA 2KVQG 4J9CA 4XTXA 4JJBA 3JCMf 1WA7A 4ELZC 1BCMA 4L6V5 3CCST 5KYNA 4BACA 2CZ6B 4KUDK 2JMAA 2KROA 3V7CA 1PRMC 4O6JA 1JB0E 2V8KA 1VIEA 1VQNQ 1BIAA 2E64A 2NUTA 4V2SA 4C0FA 1RAFB 2A3LA 3NTIA 2CP7A 3CC4T 4JRQA 1OZ2A 2JS2A 3M0UA 1T0JA 1Q7YU 2ATCB 4PJOF 1JQQA 2DILA 4HXJA 4BE1A 1VQ8A 2O9VA 4M75D 1VQMT 4M7DF 4BI3A 3CC7T 3MEAA 3OYYA 4M75G 5LJ3d 2JN0A 1Q7YR 1GRIA 4JDSA 2KDSA 1SSFA 1OX9A 2PUKB 4BDYA 3LH5A 1M27C 4IIOA 1YP5A 4J9FA 4BY6C 1KQSS 2LX9A 5KYUB 4LDYA 1WHGA 3REAB 2LJ3A 3VS4A 3OYCA 3G6EQ 5KYWB 4OMMA 2E3IA 3QPHA 4HCBA 2HBPA 2HQEA 4OB2B 1VQPA 2IIMA 2RJDA 2RI3A 2DNUA 3META 4HVWA 3JCMP 2DIQA 3M0SA 4IUTA 2P0PA 3A8GB 5GMKh 2ECZA 4CC3A 1N27A 1VQ4T 3DLMA 2KBTA 2DK3A 3EGDB 5GAMg 2PVDB 3PTAA 1XNIA 2DFUA 4M77E 1QVGS 1K9AA 1ZQ1A 4QQGA 3I55T 1M1FA 3CCLA 2MI6A 2OTJQ 2EAYA 2V1RA 1H8KA 1YITA 1W4SA 2DTIA 3SWNC 3PIOA 3ZL7C 3OW2P 1HXDA 1VYTA 1KHCA 1QLYA 3C94A 2DYBA 3QHSA 2F1LA 1YHQQ 2EYXA 2EYWA 1WXBA 1YJNQ 1QCFA 1M3CA 1YI2Q 4OB1B 2EQIA 3QZ5B 2DJQA 3CD6T 1W2BS 1YCSB 1AZEA 2FPDA 1WPYA 4XK8E 2VXFA 4E7KA 3JRZA 3TSWA 2O9SA 1X01A 3EG0A 1G83A 1WXUA 1RAHB 1G3TA 5IAYA 1UGPB 4N0AC 2EIFA 2DM1A 4IUUA 2QA4Q 2DXUA 3DKMA 4PFZA 5GANj 2GBQA 1K8AR 5KYXB 3X26B 3UDCA 2JOYA 4ZN1A 2K5FA 4M77A 5GAN7 3CCRA 4M7AE 1VQ8T 2DXBA 3QSUA 4CRIA 3CCQA 1VQMQ 1VQ9Q 2H8HA 2K2MA 2ZPFB 4HVUA 3CMEQ 4LUEA 1LVKA 5CAIA 2QEXT 3OS2A 3QDFA 1QVGA 2FVUA 3SD4A 5LJ5h 3PMIA 1ZBXA 1GFCA 3G7ZA 2H3JA 4B6MA 1FYNA 4FT4A 5LJ3g 1VQ6A 1NE8A 2HL5C 1VQLA 2LRQA 1W2BP 3J81E 1QKWA 1OX8A 2DJZA 1GFDA 4QVZA 2L8DA 3RKYA 2RK2A 4D6WA 1WJQA 1PRLC 4FIBA 1VQ4Q 2RH2A 4LDVA 5LJ5f 2RF0A 4OMQA 1QP3A 2O4XB 3QIIA 1RAAB 2GCXA 1PSFA 1K8AC 2DL8A 3CCEA 3OBWA 1UTIA 2EJGA 2RHYA 5KYXA 3GOXA 4XTZA 1YJWA 3RDVA 1Q82C 3C0CA 1KJWA 3WVEB 4R56A 1PD1A
chains in the Genus database with same CATH topology
3H0IA 2JXBA 1HD3A 1WYXA 2LCSA 3NMZC 2AZVA 2KRNA 1JO8A 5GJWB 1T0HA 1UHCA 3EHRA 1YN8A 2BZXA 2DVJA 2J6OA 3REBB 1PHTA 2D8HA 3VS1A 1ZX6A 1Z9ZA 2EKHA 2D1XA 2LNHB 1X2QA 2CSIA 2I0NA 2YT6A 4D8DA 4Y92A 1UJYA 2LQNA 1NEBA 4ORZA 2QDLA 2LMJA 2KGTA 1VYUA 1E6HA 4RUGA 4Z89A 1HSQA 2JM9A 1RLPC 3H41A 3UA7A 2EGCA 2P4RA 1TUDA 2FO0A 1NEGA 1VA7A 2J7IA 4J9GA 3R6NA 1MV3A 4J9BA 1UHFA 2EVRA 1WIEA 2RPNA 3PVLA 1ARKA 3I9QA 1JXMA 5IHKA 1NLPC 1ZUUA 2X3XD 1AOJA 1PKTA 4J9EA 1AWWA 4RTZA 2FEIA 1AWXA 3VS6A 2JMCA 1S1NA 1K4US 1AZGB 1OPLA 2GTJA 4KRTA 3QWYA 2RN8A 3PVQA 2A36A 3QWXX 5IHNA 1IO6A 1X69A 2RQRA 1ZSGA 2CT4A 3VS5A 2KE9A 1ZUYA 4R0KA 2D8JA 3VRZA 1XOVA 1QKXA 1A0NB 1M30A 2DL5A 1SRLA 2K79A 2W10A 2CDTA 4AFUC 1H92A 2DX1A 1BU1A 1AWJA 2VWFA 1YWPA 4EIKA 4GBQA 1RI9A 3M0RA 2KR3A 2RNAA 1NYGA 3U23A 2K6DA 2BZ8A 1B3QA 4J9DA 1T3LA 1YNZA 2KT8A 2EYYA 2ESWA 5FWBA 2HSPA 1JEGA 3M0TA 1M8MA 2LZ6B 3PE0A 3KFVA 4HCKA 3H0HA 4D8KA 3RBBB 3I5RA 2CUBA 5GJVB 2RQUA 4Z88A 2A28A 2EBPA 1TG0A 2DE0X 4OMNA 2BTTA 1AD5A 4AG1C 4GLMA 2F2XA 1BK2A 2YUQA 2KRMA 4CC4B 1M3BA 5L23A 2KNBB 2FPEA 2CH4A 5I11A 2NUZA 3M0PA 3VS7A 1EFNA 2CSQA 1E6GA 3NHNA 4WCIA 1AWOA 1V1CA 1X2KA 1UUEA 1K0XA 1RUWA 2DL7A 1KFZA 1ABQA 3CQTA 2KYMA 1U5SA 2YUOA 1ABOA 1NYFA 2JW4A 2AZSA 2MCNA 1ZLMA 2FRWA 1U06A 4RTTA 2KXCA 4JZ4A 2F2WA 1X27A 2JS0A 1GCQA 2W0ZA 4AFZC 1I0CA 4OMLA 4X1VA 2EGEA 3EGUA 3VS2A 2PZ1A 2CREA 1I07A 1JU5C 2J05A 1W70A 2RQWA 2V1QA 1NM7A 3I35A 5EC7A 4E6RA 2L3SA 2RMOA 2K3BA 1KSWA 1YWOA 1GCPA 1MUZA 2O88A 4ESRA 1UFFA 3UF4A 3ULRB 1UECA 1UE9A 2EW3A 2HBWA 4J9CA 2J6KA 1ZUKA 1SHGA 4JJBA 4A63B 1WA7A 5ECAA 2F2VA 2JMAA 2KROA 2CT3A 1PRMC 4M4ZA 4AFQC 1Z9QA 3JV3A 1UGVA 2DRMA 2JT4A 1PNJA 4IIMA 1M3AA 3RNJA 1PKSA 3TVTA 2EPDA 1W6XA 3UATA 5IH2A 1SPKA 1SEMA 1T3SA 4JPBW 5IXFA 3TSZA 2K9GA 2DF6A 1K76A 3M0UA 2JS2A 2KXDA 1T0JA 2RQTA 2DILA 1JQQA 4HXJA 1E7OA 4J9HA 2O9VA 2DL4A 1OEBA 5FWCA 2GQIA 2C0TA 1UDLA 2EYZA 1OOTA 2D0NA 1J3TA 1X43A 1G2BA 3VS0A 3FJ5A 4AG2C 1K1ZA 1GRIA 3VS3A 2YSQA 2A37A 4Z8AA 1UG1A 1WX6A 2ROLA 2LP5A 1NG2A 3LH5A 1M27C 4DEXA 4IIOA 1YP5A 4J9FA 4RTWA 1I1JA 1AVZC 2LJ0A 3REAB 2LJ3A 1WXTA 3VS4A 5I22A 2M0YA 3O5ZA 1U3OA 4OMMA 4LE9A 2HDAA 2IIMA 2DNUA 4HVWA 2OJ2A 4HVVA 3M0SA 2HCKA 1GBQA 2DMOA 2NWMA 1AEYA 2VVKA 4AFSC 2LJ1A 2ECZA 1CSKA 1PWTA 2AK5A 1UJ0A 4CC3A 2FG0A 2KBTA 2SEMA 2DRKA 1SSHA 1JXOA 1SHFA 1CKBA 2KEAA 2KYBA 4ZNXA 1VYVA 2PNIA 1K9AA 4CC2A 2CUDA 4LUDA 3SHWA 1SRMA 2V1RA 1H8KA 1GCQC 3ZL7C 3EHQA 2BZYA 2J6FA 1VYTA 1QLYA 3I5SA 2DYBA 2YUNA 2CH4W 2J06A 1OV3A 4F16A 2B86A 2X3WD 2EYXA 2EYWA 1WXBA 2KT1A 1QCFA 3NGPA 1M3CA 2L0AA 1BB9A 1FMKA 2O2OA 1NLOC 1KIKA 1BBZA 2OAWA 4FSSA 2EQIA 2DJQA 4F14A 3EG2A 1YCSB 1AZEA 3SEMA 2FPDA 4JJCA 2GNCA 3NPFA 3TSWA 2O9SA 2XMFA 2FRYA 3EG0A 2GTOA 1G83A 1WXUA 1X6GA 3VRYA 1WFWA 1GL5A 2MIOA 2PTKA 2SRCA 4K11A 2DM1A 2YDLA 4OMPA 2C0IA 2LX7A 1RLQC 2JTEA 3A98A 2RQVA 2M51A 2GBQA 3EG3A 2DA9A 2GGRA 2EGAA 2ROTA 1HJDA 2VKNA 4RTUA 4RTYA 1TUCA 2C0OA 1QWEA 2MOXA 4RTXA 1B07A 2A08A 1QWFA 1CKAA 4OMOA 4QT7A 2H8HA 1WI7A 1X6BA 4F17A 2K2MA 4HVUA 4LUEA 5IHIA 2DBKA 5FW9A 4JJDA 4RTVA 1W1FA 5IXBA 4LN2A 2ENMA 1ZBJA 1GFCA 4LNPA 2ED0A 3H0FA 1OPKA 2DBMA 2DLPA 2O31A 1FYNA 2E5KA 5HCKA 4J9IA 1WLPB 2L3QA 3GBQA 2OI3A 1QKWA 2KRSA 3THKA 2ABLA 1GFDA 2AKKA 1N5ZA 2LQWA 4CC7A 1PRLC 2DL3A 1Y0MA 3M0QA 1MV0B 2FPFA 2RF0A 4OMQA 4DEYA 3EG1A 1H3HA 2DL8A 2L3PA 1K0SA 1LCKA 1WDXA 1UTIA 1GBRA 1Y57A 2AKLA 2G6FX 3IQLA 3UA6A 2HEQA 3C0CA 1KJWA 2K7AA 2YUPA 2L2PA 2ED1A 2JM8A 4JZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0I A;  2JXB A;  1HD3 A;  1WYX A;  2LCS A;  3NMZ C;  2AZV A;  2KRN A;  1JO8 A;  5GJW B;  1T0H A;  1UHC A;  3EHR A;  1YN8 A;  2BZX A;  2DVJ A;  2J6O A;  3REB B;  1PHT A;  2D8H A;  3VS1 A;  1ZX6 A;  1Z9Z A;  2EKH A;  2D1X A;  2LNH B;  1X2Q A;  2CSI A;  2I0N A;  2YT6 A;  4D8D A;  4Y92 A;  1UJY A;  2LQN A;  1NEB A;  4ORZ A;  2QDL A;  2LMJ A;  2KGT A;  1VYU A;  1E6H A;  4RUG A;  4Z89 A;  1HSQ A;  2JM9 A;  1RLP C;  3H41 A;  3UA7 A;  2EGC A;  2P4R A;  1TUD A;  2FO0 A;  1NEG A;  1VA7 A;  2J7I A;  4J9G A;  3R6N A;  1MV3 A;  4J9B A;  1UHF A;  2EVR A;  1WIE A;  2RPN A;  3PVL A;  1ARK A;  3I9Q A;  1JXM A;  5IHK A;  1NLP C;  1ZUU A;  2X3X D;  1AOJ A;  1PKT A;  4J9E A;  1AWW A;  4RTZ A;  2FEI A;  1AWX A;  3VS6 A;  2JMC A;  1S1N A;  1K4U S;  1AZG B;  1OPL A;  2GTJ A;  4KRT A;  3QWY A;  2RN8 A;  3PVQ A;  2A36 A;  3QWX X;  5IHN A;  1IO6 A;  1X69 A;  2RQR A;  1ZSG A;  2CT4 A;  3VS5 A;  2KE9 A;  1ZUY A;  4R0K A;  2D8J A;  3VRZ A;  1XOV A;  1QKX A;  1A0N B;  1M30 A;  2DL5 A;  1SRL A;  2K79 A;  2W10 A;  2CDT A;  4AFU C;  1H92 A;  2DX1 A;  1BU1 A;  1AWJ A;  2VWF A;  1YWP A;  4EIK A;  4GBQ A;  1RI9 A;  3M0R A;  2KR3 A;  2RNA A;  1NYG A;  3U23 A;  2K6D A;  2BZ8 A;  1B3Q A;  4J9D A;  1T3L A;  1YNZ A;  2KT8 A;  2EYY A;  2ESW A;  5FWB A;  2HSP A;  1JEG A;  3M0T A;  1M8M A;  2LZ6 B;  3PE0 A;  3KFV A;  4HCK A;  3H0H A;  4D8K A;  3RBB B;  3I5R A;  2CUB A;  5GJV B;  2RQU A;  4Z88 A;  2A28 A;  2EBP A;  1TG0 A;  2DE0 X;  4OMN A;  2BTT A;  1AD5 A;  4AG1 C;  4GLM A;  2F2X A;  1BK2 A;  2YUQ A;  2KRM A;  4CC4 B;  1M3B A;  5L23 A;  2KNB B;  2FPE A;  2CH4 A;  5I11 A;  2NUZ A;  3M0P A;  3VS7 A;  1EFN A;  2CSQ A;  1E6G A;  3NHN A;  4WCI A;  1AWO A;  1V1C A;  1X2K A;  1UUE A;  1K0X A;  1RUW A;  2DL7 A;  1KFZ A;  1ABQ A;  3CQT A;  2KYM A;  1U5S A;  2YUO A;  1ABO A;  1NYF A;  2JW4 A;  2AZS A;  2MCN A;  1ZLM A;  2FRW A;  1U06 A;  4RTT A;  2KXC A;  4JZ4 A;  2F2W A;  1X27 A;  2JS0 A;  1GCQ A;  2W0Z A;  4AFZ C;  1I0C A;  4OML A;  4X1V A;  2EGE A;  3EGU A;  3VS2 A;  2PZ1 A;  2CRE A;  1I07 A;  1JU5 C;  2J05 A;  1W70 A;  2RQW A;  2V1Q A;  1NM7 A;  3I35 A;  5EC7 A;  4E6R A;  2L3S A;  2RMO A;  2K3B A;  1KSW A;  1YWO A;  1GCP A;  1MUZ A;  2O88 A;  4ESR A;  1UFF A;  3UF4 A;  3ULR B;  1UEC A;  1UE9 A;  2EW3 A;  2HBW A;  4J9C A;  2J6K A;  1ZUK A;  1SHG A;  4JJB A;  4A63 B;  1WA7 A;  5ECA A;  2F2V A;  2JMA A;  2KRO A;  2CT3 A;  1PRM C;  4M4Z A;  4AFQ C;  1Z9Q A;  3JV3 A;  1UGV A;  2DRM A;  2JT4 A;  1PNJ A;  4IIM A;  1M3A A;  3RNJ A;  1PKS A;  3TVT A;  2EPD A;  1W6X A;  3UAT A;  5IH2 A;  1SPK A;  1SEM A;  1T3S A;  4JPB W;  5IXF A;  3TSZ A;  2K9G A;  2DF6 A;  1K76 A;  3M0U A;  2JS2 A;  2KXD A;  1T0J A;  2RQT A;  2DIL A;  1JQQ A;  4HXJ A;  1E7O A;  4J9H A;  2O9V A;  2DL4 A;  1OEB A;  5FWC A;  2GQI A;  2C0T A;  1UDL A;  2EYZ A;  1OOT A;  2D0N A;  1J3T A;  1X43 A;  1G2B A;  3VS0 A;  3FJ5 A;  4AG2 C;  1K1Z A;  1GRI A;  3VS3 A;  2YSQ A;  2A37 A;  4Z8A A;  1UG1 A;  1WX6 A;  2ROL A;  2LP5 A;  1NG2 A;  3LH5 A;  1M27 C;  4DEX A;  4IIO A;  1YP5 A;  4J9F A;  4RTW A;  1I1J A;  1AVZ C;  2LJ0 A;  3REA B;  2LJ3 A;  1WXT A;  3VS4 A;  5I22 A;  2M0Y A;  3O5Z A;  1U3O A;  4OMM A;  4LE9 A;  2HDA A;  2IIM A;  2DNU A;  4HVW A;  2OJ2 A;  4HVV A;  3M0S A;  2HCK A;  1GBQ A;  2DMO A;  2NWM A;  1AEY A;  2VVK A;  4AFS C;  2LJ1 A;  2ECZ A;  1CSK A;  1PWT A;  2AK5 A;  1UJ0 A;  4CC3 A;  2FG0 A;  2KBT A;  2SEM A;  2DRK A;  1SSH A;  1JXO A;  1SHF A;  1CKB A;  2KEA A;  2KYB A;  4ZNX A;  1VYV A;  2PNI A;  1K9A A;  4CC2 A;  2CUD A;  4LUD A;  3SHW A;  1SRM A;  2V1R A;  1H8K A;  1GCQ C;  3ZL7 C;  3EHQ A;  2BZY A;  2J6F A;  1VYT A;  1QLY A;  3I5S A;  2DYB A;  2YUN A;  2CH4 W;  2J06 A;  1OV3 A;  4F16 A;  2B86 A;  2X3W D;  2EYX A;  2EYW A;  1WXB A;  2KT1 A;  1QCF A;  3NGP A;  1M3C A;  2L0A A;  1BB9 A;  1FMK A;  2O2O A;  1NLO C;  1KIK A;  1BBZ A;  2OAW A;  4FSS A;  2EQI A;  2DJQ A;  4F14 A;  3EG2 A;  1YCS B;  1AZE A;  3SEM A;  2FPD A;  4JJC A;  2GNC A;  3NPF A;  3TSW A;  2O9S A;  2XMF A;  2FRY A;  3EG0 A;  2GTO A;  1G83 A;  1WXU A;  1X6G A;  3VRY A;  1WFW A;  1GL5 A;  2MIO A;  2PTK A;  2SRC A;  4K11 A;  2DM1 A;  2YDL A;  4OMP A;  2C0I A;  2LX7 A;  1RLQ C;  2JTE A;  3A98 A;  2RQV A;  2M51 A;  2GBQ A;  3EG3 A;  2DA9 A;  2GGR A;  2EGA A;  2ROT A;  1HJD A;  2VKN A;  4RTU A;  4RTY A;  1TUC A;  2C0O A;  1QWE A;  2MOX A;  4RTX A;  1B07 A;  2A08 A;  1QWF A;  1CKA A;  4OMO A;  4QT7 A;  2H8H A;  1WI7 A;  1X6B A;  4F17 A;  2K2M A;  4HVU A;  4LUE A;  5IHI A;  2DBK A;  5FW9 A;  4JJD A;  4RTV A;  1W1F A;  5IXB A;  4LN2 A;  2ENM A;  1ZBJ A;  1GFC A;  4LNP A;  2ED0 A;  3H0F A;  1OPK A;  2DBM A;  2DLP A;  2O31 A;  1FYN A;  2E5K A;  5HCK A;  4J9I A;  1WLP B;  2L3Q A;  3GBQ A;  2OI3 A;  1QKW A;  2KRS A;  3THK A;  2ABL A;  1GFD A;  2AKK A;  1N5Z A;  2LQW A;  4CC7 A;  1PRL C;  2DL3 A;  1Y0M A;  3M0Q A;  1MV0 B;  2FPF A;  2RF0 A;  4OMQ A;  4DEY A;  3EG1 A;  1H3H A;  2DL8 A;  2L3P A;  1K0S A;  1LCK A;  1WDX A;  1UTI A;  1GBR A;  1Y57 A;  2AKL A;  2G6F X;  3IQL A;  3UA6 A;  2HEQ A;  3C0C A;  1KJW A;  2K7A A;  2YUP A;  2L2P A;  2ED1 A;  2JM8 A;  4JZ3 A; 
#chains in the Genus database with same CATH topology
 2CZ0 B;  1WYX A;  1NPP A;  3RIR A;  3MP1 A;  2KRN A;  5GJW B;  1UHC A;  3OYE A;  2BZX A;  1YI2 A;  3R6O A;  4EMH A;  3A8O B;  1Z9Z A;  2VB6 A;  2EKH A;  3VUZ A;  1UEB A;  1TSF A;  2D1X A;  2XU8 A;  2LNH B;  2I0N A;  4M7D C;  5HK0 A;  1RAG B;  3L42 A;  1UJY A;  3JB9 G;  3LWH A;  1YJ9 T;  2GFA A;  3RMQ A;  2WSF E;  3LWI A;  1I4K 1;  1U8R A;  2LMJ A;  2XHC A;  2DZC A;  3EG9 A;  1XQH A;  3OMG A;  4HT8 A;  1KD1 R;  1RLP C;  4JS5 A;  3OW2 A;  1VQ8 Q;  3TCJ A;  4N4G A;  2FO0 A;  3S3M A;  3HTR A;  1TTH B;  1JXM A;  5GAN 4;  4J6W A;  2DTH A;  1ZUU A;  1R77 A;  2X3X D;  1AOJ A;  1UGR B;  4FW1 A;  3OA6 A;  1TU0 B;  3KXT A;  2FEI A;  2OTL A;  4DBF A;  2FYK A;  3X25 B;  5FRM A;  3L2Q A;  2RN8 A;  1IXD A;  1AHJ B;  2PQW A;  4N0A A;  2QGF B;  5DY9 A;  4RKU E;  3CCQ Q;  1D0Y A;  3OYN A;  5GAM e;  3MP6 A;  1VQ5 T;  1WQ7 A;  1XOV A;  1QKX A;  3JCM X;  1D0Z A;  4X9D A;  4HKE A;  3UT1 A;  3MO8 A;  1Y7X A;  2QQA A;  5KYW A;  2DX1 A;  1VUB A;  1YBY A;  2X4X A;  3V8J A;  1RI9 A;  5KYU A;  2RNA A;  3CCS A;  1YIT Q;  3BFM A;  1YNZ A;  2LCL A;  1VQ6 T;  2ESW A;  3OYD A;  2HSP A;  4J6Y A;  1SG5 A;  3M0T A;  8ATC B;  3G71 Q;  2EWN A;  4J5Y A;  2HZY A;  2RO0 A;  2E10 A;  4QKU A;  4C5G A;  1M2O A;  1KD1 C;  1MMN A;  5GMK e;  1NPR A;  4BE0 A;  1M2V B;  2BTT A;  4F04 B;  1BI3 A;  1MHN A;  2E5Q A;  4GLM A;  4ZTJ A;  3HRT A;  2JUF A;  4J7F A;  3L1A A;  5L23 A;  2LNV A;  1R0C B;  1FWZ A;  2KNB B;  1M5Q 1;  3KBG A;  5LJ5 d;  1RAE B;  3M0P A;  2CSQ A;  1QCO A;  3NHN A;  1AWO A;  3OYK A;  1M9S A;  1UUE A;  3EG9 B;  4C8Q G;  1I5O B;  2DL7 A;  4PJO G;  3BW1 A;  3CEY A;  3CQT A;  1KC8 R;  2AZS A;  2FRW A;  1U06 A;  2KXC A;  5FU7 B;  3CCQ T;  2IVW A;  4C92 A;  2E6Z A;  3TQ7 P;  3AHU A;  1X27 A;  4AFZ C;  5C6S A;  4X1V A;  2ZAE A;  4BY6 B;  2RD1 A;  2J05 A;  2MWP A;  2MWO A;  1NM7 A;  3NTK A;  1B7T A;  3NTH A;  1K9M U;  2L3S A;  4XQ3 A;  1N8R U;  1GCP A;  1TH7 A;  3LGF A;  1BI2 A;  1UFF A;  3UF4 A;  3ULR B;  1PG5 B;  1OI1 A;  4C0G A;  2AT1 B;  4M77 C;  2EW3 A;  4M7D A;  1ZUK A;  4BD3 A;  4IUV A;  2D9T A;  4M4Z A;  1Z9Q A;  2RI2 A;  2DRM A;  1PNJ A;  2DKG A;  2HKQ B;  4NS5 A;  3HSB A;  1D1C A;  3RNJ A;  2EPD A;  3JCM h;  2CKK A;  3CPW S;  5IH2 A;  1SEM A;  4JPB W;  1LJO A;  3V7S A;  1PC0 A;  1N9R A;  4MML A;  4BDZ A;  1WNL A;  4PJO A;  1VQO A;  1KC8 C;  1YJW T;  1I8F A;  4J9H A;  3GPL A;  2DL4 A;  4IKF A;  3OYA A;  4M78 F;  5FRN A;  1X6O A;  4FT2 A;  1B34 A;  2EYZ A;  1OOT A;  3EH2 A;  2FZC B;  2K5I A;  2BUD A;  1W2B A;  1G2B A;  2P4T A;  3CBP A;  3CCE T;  1M1K C;  3FJ5 A;  3FIF A;  1OU8 A;  3VS3 A;  3CCM T;  2A37 A;  2I2L A;  4Z8A A;  1OYX A;  3CD6 A;  1ZSZ C;  4R55 A;  3C12 A;  2LP5 A;  1NG2 A;  2ZCF B;  1I1J A;  1IB8 A;  4PJJ A;  2YRC A;  2LJ0 A;  4C92 B;  1QW1 A;  2KMT A;  1Q86 R;  2M0Y A;  2AIR B;  3O5Z A;  4LE9 A;  2QXF A;  4MMK A;  2KSS A;  2LDM A;  4QW2 A;  4C0Z A;  5CKD A;  2HCK A;  2X4J A;  4VUB A;  4ZTF A;  1AEY A;  4AFS C;  1QQJ A;  2LJ1 A;  3MKD A;  1CSK A;  1UJ0 A;  2QK0 A;  2BE7 D;  2FG0 A;  4ANJ A;  2SEM A;  3VJP A;  4XTW A;  1Y07 A;  3RER A;  2KEA A;  3EH1 A;  4ZNX A;  4KGV B;  4C0D C;  1BI0 A;  1PM3 A;  1MMG A;  3SHW A;  3CCJ T;  3LH0 A;  3CXC A;  4OVA A;  3CCJ Q;  1RI0 A;  5GMK i;  2K57 A;  2CH4 W;  4QVC A;  2B86 A;  3EGX A;  4RG8 A;  1BB9 A;  2O2O A;  1LOJ A;  1NLO C;  5GAN 3;  3HFN A;  1H3Z A;  3CC7 Q;  4F14 A;  1Q86 C;  2QDY B;  4JJC A;  3A5Z B;  1VQM A;  2GNC A;  2HKN A;  3H6Z A;  2DXC A;  4HCZ A;  3O8V A;  3CBO A;  2QQ9 A;  5LJ5 g;  2GTO A;  1D1A A;  2DEQ A;  1X6G A;  3WXM B;  3PNW C;  5D7U A;  1WFW A;  3FB9 A;  3L2R A;  1I81 A;  1D09 B;  4KH1 B;  2Y4X A;  2ZPG B;  2JTE A;  5D6Y A;  2KY9 A;  3EG3 A;  2GGR A;  2OTJ T;  2RHI A;  2EQK A;  4RTU A;  1TUC A;  4O5V A;  4RTX A;  1B07 A;  3G1J A;  1TUG B;  1XJW B;  2QGG A;  4DBH A;  1QWF A;  4BE2 A;  1CKA A;  3FLG A;  4C92 G;  3M4G A;  4QT7 A;  1WI7 A;  4F17 A;  4GY5 A;  4PLL A;  1TS9 A;  2DBK A;  1FX7 A;  4JJD A;  2RA2 A;  4N4H A;  1VQ6 Q;  2HL3 A;  4FYV B;  4RTV A;  2P84 A;  3CC2 A;  5FU6 B;  5GAN 8;  3CC2 Q;  3M9Q A;  1QP2 A;  2EJ9 A;  3QG1 A;  1VQK Q;  2X4W A;  3OYJ A;  1WHJ A;  4QVD A;  2FL7 A;  2LQK A;  3QZ9 B;  2L3Q A;  3GBQ A;  3G71 T;  1VQ5 A;  1V29 B;  4PJL A;  2OI3 A;  1VQ5 Q;  2KRS A;  4JLG A;  5CVI A;  2AKK A;  1KHI A;  2FZG B;  4A54 A;  5CQX A;  2YLC A;  4CC7 A;  4A4F A;  1YIJ A;  2NUT B;  3CCE Q;  4Y28 E;  1NBE B;  2DL3 A;  3MEU A;  2FPF A;  1OU9 A;  1I5L A;  2RB6 A;  1QVF A;  4M77 F;  1V76 A;  3EG1 A;  3M53 A;  1K0S A;  2RI5 A;  5C0M A;  2AKL A;  3IQL A;  2DIG A;  3L2V A;  2WSC E;  3I56 A;  1O75 A;  4MZT A;  2E70 A;  3OQ5 A;  2JTM A;  4LD6 A;  3JCM e;  1U1S A;  2JM8 A;  2JXB A;  3M55 A;  3MEW A;  1HD3 A;  1TWB A;  2AZV A;  3GLX A;  2YHT A;  3HRS A;  4XU2 A;  1WHK A;  1T0H A;  2R5A A;  5GMK l;  3G4S A;  1IHW A;  4P5N A;  1MGQ A;  3Q1J A;  4PL6 A;  1JBM A;  2CP3 A;  2YT6 A;  2IPO B;  2Z0W A;  2YXY A;  4M7A C;  1SKU B;  2F5T X;  4LXC A;  4EDU A;  4E7Z A;  2QDL A;  4OGE A;  2KGT A;  4BB7 A;  1VYU A;  3BDL A;  4TVR A;  1E6H A;  3RKW A;  8AT1 B;  3OYI A;  1YJ9 A;  4FSX A;  3PFS A;  3H41 A;  4A4E A;  3CD6 Q;  3PT9 A;  1YIJ T;  5DM7 R;  4RG2 A;  4C8Q A;  1MV3 A;  1UHF A;  2EVR A;  4M7A B;  1M1G A;  5KH6 A;  2VGN A;  1PD0 A;  2RPN A;  3OSS C;  4M77 B;  5IHK A;  1PKT A;  2QG9 B;  2PVO B;  3G71 A;  4DQ2 A;  1BYM A;  1S1N A;  2GTJ A;  3A8M B;  3QWX X;  4GLK A;  4J83 A;  1D1B A;  2L3R A;  4R0K A;  3JCM Q;  4FM4 B;  5GAN d;  2XDB A;  2XIC A;  1RAC B;  1M30 A;  1SRL A;  2XI9 A;  2V8J A;  2XID A;  1Q81 C;  1UB4 A;  1K9M R;  4IUQ A;  5CKF A;  1G3Y A;  1YWP A;  4EIK A;  3U23 A;  2K6D A;  2H3E B;  2BZ8 A;  4J9D A;  2EYY A;  1KQS P;  1JEG A;  3P8H A;  5GAO n;  2E12 A;  1KC8 U;  3C4S A;  4D8K A;  3I5R A;  2KAF A;  5GJV B;  2DEU A;  4Z88 A;  4J8O A;  2A28 A;  3RR6 A;  2MF2 A;  4FL6 A;  3DB4 A;  3G6E T;  2YUQ A;  4CC4 B;  5IN1 A;  2YLB A;  1R0B G;  2QQS A;  3DLL A;  1PSE A;  1M2V A;  5KCH A;  3EGD A;  3VS7 A;  2E6N A;  1E6G A;  5CCA A;  4ZN3 A;  5GAM h;  1M1K R;  2JTF A;  1M90 C;  1QVP A;  1ABQ A;  1KQ2 A;  3ZEH A;  1HK9 A;  1XTD A;  2KYM A;  2YUO A;  1ABO A;  3CPW A;  1NYF A;  1K9M C;  2ZGW A;  3CME A;  1ZLM A;  3CC4 Q;  4C0D B;  4A4K A;  4JZ4 A;  3VYH B;  4FW2 A;  2F2W A;  2MPX C;  3JAM E;  2JS0 A;  1GCQ A;  3OYB A;  4M78 E;  2P0Q A;  3INZ A;  3S3O A;  2M0O A;  5GMK j;  4L5G A;  4DBR A;  3BY7 A;  1ZA2 B;  2CP5 A;  2QQR A;  5LJ3 e;  1MUZ A;  4ESR A;  1UEC A;  3QUI A;  3JCM g;  2J6K A;  4M7D E;  1Y96 B;  4B9X A;  2DYI A;  2V8I A;  4QQD A;  4C5H A;  2VXE A;  3X24 B;  4BUG A;  2F2V A;  4EPC A;  4CI0 C;  4FYY B;  3JV3 A;  1C6V X;  1UGV A;  4KT0 E;  2JT4 A;  2HMA A;  1ZSZ A;  4B9W A;  2QTX A;  1W6X A;  1QVF P;  1SPK A;  5GAO m;  1T3S A;  2QYZ A;  3TSZ A;  2K9G A;  2DF6 A;  1K76 A;  2KXD A;  1KQS A;  2V26 A;  2WSE E;  1E7O A;  1JJ2 A;  1BIB A;  1OEB A;  5FWC A;  2GQI A;  2C0T A;  1UDL A;  2M16 A;  2R57 A;  5J3B A;  1X43 A;  4XU1 A;  4AG2 C;  3LYI A;  1F1B B;  1WX6 A;  5AYF A;  1WGS A;  4KH0 B;  2XKO C;  3CBM A;  5GAN 6;  2ROL A;  5J26 A;  3T9N A;  2FHD A;  1AVZ C;  4XU3 A;  1WZO A;  5I22 A;  3M58 A;  1AT1 B;  3CCR T;  1U3O A;  1FMV A;  3E2U A;  3EFO B;  2O4X A;  4DA4 A;  3H8Z A;  1D3B B;  5KE2 A;  2R5M A;  3QKJ A;  4MDW A;  2P0K A;  5LJ3 h;  2OJ2 A;  3G4S Q;  1LPL A;  2NWM A;  4BI8 B;  1RAI B;  2AK5 A;  1OUL A;  2NUP A;  4WTO B;  1M90 U;  2DRK A;  3ME9 A;  1BI1 A;  2BIV A;  2E3H A;  1SHF A;  5GAM d;  2VC8 A;  1CKB A;  3OYF A;  3CCV Q;  3CCU T;  1VYV A;  2GF7 A;  2PNI A;  1VQN T;  3ASK A;  2CUD A;  1WQW A;  2MK5 A;  3M54 A;  5KYY A;  3GNG A;  4DOW A;  1GCQ C;  2BZY A;  5GAO r;  2VUB A;  3I5S A;  2LT1 A;  3PMT A;  2X3W D;  9ATC B;  4F7U B;  4X34 A;  2L89 A;  2L0A A;  1X75 C;  3M5A A;  3M57 A;  3GF5 A;  5I2S A;  3OW2 S;  1G8X A;  4EMK A;  4IUP A;  2OAW A;  2OX7 A;  4E2F B;  4M7D D;  3A8H B;  3FEO A;  2PU9 B;  3M4Y A;  1VQK T;  4J7I A;  5HKC A;  2NLU A;  3FJP A;  2QAS A;  2XMF A;  2FRY A;  4KGZ B;  2GQV A;  3QYG B;  4M78 A;  2CP2 A;  1S72 Q;  5A0L A;  3PGG A;  1VQO T;  2SRC A;  2EQU A;  2X9H A;  4K11 A;  2YDL A;  4OMP A;  4Q5W A;  3HRU A;  3A98 A;  5FU7 C;  2RQV A;  4C8Q C;  2MAM A;  2M51 A;  1IHV A;  1VQ4 A;  5LJ3 f;  2ROT A;  4WF2 A;  3CMA Q;  2VKN A;  4RTY A;  1HJD A;  2B8A A;  3OS5 A;  1QWE A;  1U1T A;  2MMP A;  1WHH A;  2CS7 A;  3TRE A;  2MOX A;  4KGX B;  3JB9 H;  3M56 A;  1MMD A;  3OS0 A;  4E7L A;  2COZ A;  5FW9 A;  3CCL Q;  2JJ9 A;  2LTO A;  5D6X A;  1OZ3 A;  5IXB A;  2LC4 A;  2C06 A;  1UGQ B;  4LNP A;  2ED0 A;  3H0F A;  1OPK A;  2ZPI B;  2DLP A;  2O31 A;  5HCK A;  2KI7 A;  2RK1 A;  3QJ6 A;  3MCA B;  2Y4Y A;  3THK A;  3VYG A;  4E7S A;  3OY9 A;  1C0M A;  2ABL A;  4C92 F;  1HYO A;  4JRP A;  3HKS A;  2LQW A;  1N6A A;  3RES A;  3EAE A;  4C5E A;  1Y0M A;  2CZ7 B;  3QJY A;  3LLR A;  2QTV A;  2DTO A;  1QCN A;  4DEY A;  1H3H A;  3RMS A;  2L3P A;  1WJR A;  2KQW A;  5GAM f;  5J39 A;  1LCK A;  3JCM W;  4FYW B;  1Y57 A;  2E65 A;  2G6F X;  3QO3 A;  4M75 F;  3ZFJ A;  5GMK m;  1WHM A;  2HEQ A;  2L2P A;  3SWN A;  1NJI C;  4FCY A;  2DAQ A;  3A1P A;  3BE3 A;  1JJ2 S;  4F7U G;  5IT9 E;  4Y91 A;  2QA4 T;  3EHR A;  1YN8 A;  2DVJ A;  2J6O A;  1PHT A;  3VS1 A;  1ZX6 A;  1YCY A;  2RJC A;  2CSI A;  2CZ1 B;  1VOM A;  4D8D A;  3HHT B;  1BKB A;  4Y92 A;  2VGM A;  3URG A;  2LQN A;  1NEB A;  3CCM A;  4F7U A;  2OTJ A;  5FLX E;  1NZ9 A;  1N9S A;  5CO7 A;  4Z89 A;  2DD4 A;  1VQP T;  1FXX A;  5DLQ E;  2EGC A;  4M7A D;  1YFN A;  3HFO A;  5GAO q;  2E1H A;  1YJN T;  1VQ7 Q;  1NEG A;  5KYY B;  3R6N A;  4J9B A;  1MNE A;  1WIE A;  4II1 A;  3PVL A;  5CQY A;  2XDP A;  4AT1 B;  1ARK A;  1NLP C;  1M8V A;  2K3Y A;  2L5Q A;  1KD1 U;  2JMC A;  1S72 A;  1K4U S;  2DZ9 A;  1OPL A;  2NUP B;  1PCX A;  2A36 A;  1NJI R;  5IHN A;  1X69 A;  1S72 T;  1WHL A;  2EJF A;  2RQR A;  5KE3 A;  2CT4 A;  2EKO A;  3VS5 A;  1YIT T;  1VQL T;  2D8J A;  5LJ3 j;  3VRZ A;  2QI2 A;  3VUB A;  2QEX Q;  2K79 A;  2QEX A;  1H92 A;  2Y90 A;  3PIP A;  4MDX A;  4M75 B;  3H9N A;  4HA8 A;  1KG1 A;  3JCM b;  1AWJ A;  2VWF A;  4DBQ A;  4GBQ A;  4M75 A;  3M0R A;  2KR3 A;  1NYG A;  4ZGD B;  3JB9 F;  1B3Q A;  1Q81 R;  5FWB A;  2DO3 A;  3F70 A;  1GXI E;  3PE0 A;  4C5I A;  2BE9 B;  3MPU B;  3H0H A;  3RBB B;  1IGQ A;  1QMC A;  1IZ6 A;  3L2U A;  3CC4 A;  2RQU A;  2EQJ A;  3P8B B;  4PKC C;  3J7A F;  2EBP A;  5DLO A;  4AG1 C;  1AD5 A;  5I2M A;  1YI2 T;  3CCU Q;  2O01 E;  1BK2 A;  3CCV T;  1EZZ B;  1M3B A;  1YHQ T;  1IRE B;  1D0X A;  3MEV A;  3N5B B;  1FMW A;  2CH4 A;  2NUZ A;  4C8Q D;  4AMC A;  1VQL Q;  3G4S T;  4RCC A;  4JLI A;  3OYM A;  4WCI A;  4HT9 A;  4EMG A;  2FZK B;  5FU6 C;  1V1C A;  2XD0 A;  1X2K A;  2OTL Q;  1ZSZ B;  1RUW A;  3UWN A;  2RHU A;  2K2V A;  1KFZ A;  2PVG B;  2RHX A;  4PLI A;  1U5S A;  5HK3 A;  1Q82 R;  3V7R A;  3I55 A;  4E7I A;  3I55 Q;  2MCN A;  1O9S A;  1N8R R;  4PJN A;  4RTT A;  4OP0 A;  2HNI A;  2W0Z A;  5A0G A;  1I0C A;  4OML A;  3C95 A;  2EGE A;  2LCC A;  3EGU A;  4M7D G;  3VS2 A;  5GAN f;  2CRE A;  3BDU A;  1W70 A;  3VU3 C;  1Q82 U;  2M1H A;  2V1Q A;  1G3S A;  3L2Z A;  2RHZ A;  4E6R A;  1BCO A;  1KSW A;  5KCO A;  2F69 A;  3CCL T;  2DET A;  2VYT A;  1P92 A;  1M1K U;  1C1A A;  1YIJ Q;  3SB2 A;  4ME7 A;  2HBW A;  2VAS A;  5EG2 A;  5CR2 A;  3FC3 A;  1SHG A;  4M78 G;  4A63 B;  3CC2 T;  3QXE B;  5ECA A;  5GAN h;  5CK9 A;  2MYS A;  2E41 A;  5GAO l;  3GP8 A;  2CT3 A;  4A4H A;  4AFQ C;  1ZHI A;  1SF9 A;  3GNF B;  4IIM A;  1M3A A;  2HD0 A;  1PKS A;  3TVT A;  1VQK A;  3UAT A;  3JCM d;  5IXF A;  1LNX A;  2RQT A;  4M77 G;  4XTU A;  2QA4 A;  1NJI U;  2JZ2 A;  3QYH B;  4M77 D;  2CYZ B;  3UPU A;  2D0N A;  1J3T A;  2A0F B;  4F7U E;  4ZGJ B;  1VQ9 T;  3VS0 A;  3SFM A;  1Q86 U;  2EYQ A;  1DJ7 B;  1K1Z A;  3CC7 A;  3EFR A;  2YSQ A;  3SDZ A;  1M4Z A;  1UG1 A;  1RL2 A;  2OTL T;  1UGS B;  4PFP A;  4YTL A;  3JCM V;  3E19 A;  4DEX A;  2QQB A;  4RTW A;  3E1S A;  1WXT A;  2K5L A;  3JCM c;  4NOY A;  4PJO C;  2X35 A;  5AT1 B;  2HDA A;  4E7J A;  5A0D A;  2JVV A;  4DOV A;  4M7A G;  3V8K A;  4HVV A;  2DER A;  4NL2 A;  1JJ2 P;  2ZPB B;  1GBQ A;  2DMO A;  5LL6 S;  2VVK A;  3OBY A;  3JSC A;  1PWT A;  1R8O B;  3CCU A;  4KUL A;  2DVE A;  4A4G A;  1SSH A;  1JXO A;  5L8R E;  5GAN e;  2KYB A;  3AT1 B;  2VV5 A;  4CC2 A;  4LUD A;  1TXQ A;  4BI4 A;  1SRM A;  4EMK B;  2CP0 A;  2ZPH B;  2RM4 A;  1IGU A;  4JRK A;  3EHQ A;  3WVD B;  2J6F A;  1VQO Q;  2LQ8 A;  7AT1 B;  2YUN A;  4PNO A;  2J06 A;  1OV3 A;  4F16 A;  2GFU A;  3MJX A;  2KT1 A;  3NGP A;  3LX7 A;  2AHJ B;  1FMK A;  3LW5 E;  5GAN 2;  2HSE B;  1KIK A;  4EMK C;  1BBZ A;  4FSS A;  4PJO E;  4OMF B;  4FU6 A;  3EG2 A;  3EFS A;  4PFO A;  3SEM A;  4M75 E;  3NPF A;  4RMO A;  3VRY A;  3MHX A;  2COW A;  3VV0 A;  5LJ5 e;  4KBM B;  1GL5 A;  2MIO A;  2PTK A;  4OF1 A;  2C0I A;  1VQ7 A;  2LX7 A;  3CPF A;  4JUV A;  1RLQ C;  1YHQ A;  2RJE A;  3EFO A;  2DA9 A;  2EGA A;  2K3X A;  2D6F A;  3X20 B;  2C0O A;  2XDD A;  3HL8 A;  2XG8 D;  4C92 C;  2A08 A;  3CXC S;  4HCC A;  4OMO A;  2CP6 A;  2DPP B;  3OB9 A;  1X6B A;  5IHI A;  3QBY A;  3I56 Q;  1Y71 A;  1W1F A;  1WJS A;  5A2Q E;  4E7H A;  4LN2 A;  4QQ6 A;  2ENM A;  4C8Q E;  1ZBJ A;  1VIF A;  4JS4 A;  1Q7Y C;  2DBM A;  1N8R C;  4M75 C;  2E5K A;  4J9I A;  1WLP B;  2EQM A;  3E9F A;  3DB3 A;  3I56 T;  3D7S B;  2IG0 A;  5LJ5 j;  4UC4 A;  3CCR Q;  2DD5 A;  1N5Z A;  3JB9 D;  3CCS Q;  3SWN B;  3M0Q A;  3JB9 I;  2QAZ A;  1MV0 B;  3FRN A;  4M78 D;  2G3R A;  2HQX A;  4C92 E;  1Y96 A;  1WDX A;  1GBR A;  4JJN K;  3CCM Q;  3UA6 A;  5GAO p;  2K7A A;  2YUP A;  2DXT A;  2ED1 A;  4JZ3 A;  2M02 A;  3G6E A;  3H0I A;  1EIF A;  2HQH A;  2ZPE B;  1K8A U;  2LCS A;  3NMZ C;  3CMA T;  5GAM j;  4MZP A;  1YJN A;  3GIB A;  1JO8 A;  1H64 1;  3REB B;  3JCM J;  2D8H A;  1TOV A;  2M9U A;  1QVG P;  1X2Q A;  4PJM A;  4Z02 A;  4OGC A;  4LDX A;  1JRI A;  4OB3 B;  4ATO A;  4J6X A;  3L2W A;  4XU0 A;  5CIU A;  4IUR A;  3CPW P;  4ORZ A;  3E9G A;  3VKI A;  1YJW Q;  3EGX B;  4RUG A;  4ZGE B;  2D0Q B;  4C8Q F;  3JB9 J;  1HSQ A;  2JM9 A;  3NFC A;  3CMA A;  3CXC P;  3UA7 A;  2P4R A;  2PUO B;  1K73 C;  3J80 E;  1RAD B;  1TUD A;  1VA7 A;  2J7I A;  4J9G A;  2F5K A;  4ELY C;  3CME T;  5CKE A;  2XK0 A;  2A7Y A;  5FRO A;  3I9Q A;  3ZBD A;  3TU4 K;  2RJF A;  4N4I A;  1OQK A;  4J9E A;  1AWW A;  4RTZ A;  5CKB A;  1AWX A;  3VS6 A;  4A53 A;  3MP8 A;  4MZM A;  1AZG B;  1VQN A;  4FYX B;  3KUF A;  3QWY A;  4KRT A;  2R58 A;  3PVQ A;  5D6W A;  1IO6 A;  1ZSG A;  3OS1 A;  2KE9 A;  6AT1 B;  1ZUY A;  4PK4 A;  2CGH A;  1G3W A;  2ZZD A;  4XTY A;  1A0N B;  4M78 B;  2DL5 A;  1ACM B;  1RAB B;  2W10 A;  2CDT A;  5HY6 A;  4X9C A;  4AFU C;  4XTV A;  3FDR A;  4PJO D;  4LDW A;  1KK7 A;  1BU1 A;  3CCJ A;  5I21 A;  5GAN 5;  4KUI A;  2JNG A;  3OSV A;  4OB0 B;  1T3L A;  2KT8 A;  3OYH A;  1KQ1 A;  1M8M A;  2LZ6 B;  3RKX A;  2LVM A;  1G5V A;  3KFV A;  4M78 C;  4HCK A;  3RUX A;  3TEE A;  2CUB A;  3HPW A;  3CCV A;  3M59 A;  4LDU A;  1TG0 A;  2DE0 X;  3V8L A;  4OMN A;  4NL3 A;  1B34 B;  1YJ9 Q;  3OYG A;  2F2X A;  1VQ7 T;  2KRM A;  2COY A;  3OYL A;  2K4Y A;  5M9O A;  1K73 U;  3ER0 A;  1M90 R;  1VQP Q;  4M7A A;  4XAX B;  4PJO B;  2WAC A;  2FPE A;  4C8Q B;  2LT4 A;  5I11 A;  2OAU A;  1EFN A;  3HP9 A;  3X28 B;  1VQ9 A;  2NYS A;  1EX4 A;  1K0X A;  2KK4 A;  1QVF S;  3S3N A;  4LD9 K;  2YWW A;  4RCB A;  2FB7 A;  1MMA A;  4JRI A;  1Q81 U;  1K73 R;  3OMC A;  1D3B A;  2X51 A;  5GAN g;  2YRD A;  2JW4 A;  1ZA1 B;  5CKH A;  3QDR B;  1IRX A;  2EFI A;  1Q95 G;  4M7D B;  4C92 D;  2BKD N;  4E47 A;  3A8L B;  2E4H A;  2PZ1 A;  1I07 A;  1JU5 C;  2RQW A;  3I35 A;  5EC7 A;  2RMO A;  2X4Y A;  2K3B A;  4L59 A;  1YWO A;  4M7A F;  1MND A;  2YRV A;  2O88 A;  1UE9 A;  2HAX A;  4F7U F;  3LGL A;  3P8D A;  3S6W A;  2KVQ G;  4J9C A;  4XTX A;  4JJB A;  3JCM f;  1WA7 A;  4ELZ C;  1BCM A;  4L6V 5;  3CCS T;  5KYN A;  4BAC A;  2CZ6 B;  4KUD K;  2JMA A;  2KRO A;  3V7C A;  1PRM C;  4O6J A;  1JB0 E;  2V8K A;  1VIE A;  1VQN Q;  1BIA A;  2E64 A;  2NUT A;  4V2S A;  4C0F A;  1RAF B;  2A3L A;  3NTI A;  2CP7 A;  3CC4 T;  4JRQ A;  1OZ2 A;  2JS2 A;  3M0U A;  1T0J A;  1Q7Y U;  2ATC B;  4PJO F;  1JQQ A;  2DIL A;  4HXJ A;  4BE1 A;  1VQ8 A;  2O9V A;  4M75 D;  1VQM T;  4M7D F;  4BI3 A;  3CC7 T;  3MEA A;  3OYY A;  4M75 G;  5LJ3 d;  2JN0 A;  1Q7Y R;  1GRI A;  4JDS A;  2KDS A;  1SSF A;  1OX9 A;  2PUK B;  4BDY A;  3LH5 A;  1M27 C;  4IIO A;  1YP5 A;  4J9F A;  4BY6 C;  1KQS S;  2LX9 A;  5KYU B;  4LDY A;  1WHG A;  3REA B;  2LJ3 A;  3VS4 A;  3OYC A;  3G6E Q;  5KYW B;  4OMM A;  2E3I A;  3QPH A;  4HCB A;  2HBP A;  2HQE A;  4OB2 B;  1VQP A;  2IIM A;  2RJD A;  2RI3 A;  2DNU A;  3MET A;  4HVW A;  3JCM P;  2DIQ A;  3M0S A;  4IUT A;  2P0P A;  3A8G B;  5GMK h;  2ECZ A;  4CC3 A;  1N27 A;  1VQ4 T;  3DLM A;  2KBT A;  2DK3 A;  3EGD B;  5GAM g;  2PVD B;  3PTA A;  1XNI A;  2DFU A;  4M77 E;  1QVG S;  1K9A A;  1ZQ1 A;  4QQG A;  3I55 T;  1M1F A;  3CCL A;  2MI6 A;  2OTJ Q;  2EAY A;  2V1R A;  1H8K A;  1YIT A;  1W4S A;  2DTI A;  3SWN C;  3PIO A;  3ZL7 C;  3OW2 P;  1HXD A;  1VYT A;  1KHC A;  1QLY A;  3C94 A;  2DYB A;  3QHS A;  2F1L A;  1YHQ Q;  2EYX A;  2EYW A;  1WXB A;  1YJN Q;  1QCF A;  1M3C A;  1YI2 Q;  4OB1 B;  2EQI A;  3QZ5 B;  2DJQ A;  3CD6 T;  1W2B S;  1YCS B;  1AZE A;  2FPD A;  1WPY A;  4XK8 E;  2VXF A;  4E7K A;  3JRZ A;  3TSW A;  2O9S A;  1X01 A;  3EG0 A;  1G83 A;  1WXU A;  1RAH B;  1G3T A;  5IAY A;  1UGP B;  4N0A C;  2EIF A;  2DM1 A;  4IUU A;  2QA4 Q;  2DXU A;  3DKM A;  4PFZ A;  5GAN j;  2GBQ A;  1K8A R;  5KYX B;  3X26 B;  3UDC A;  2JOY A;  4ZN1 A;  2K5F A;  4M77 A;  5GAN 7;  3CCR A;  4M7A E;  1VQ8 T;  2DXB A;  3QSU A;  4CRI A;  3CCQ A;  1VQM Q;  1VQ9 Q;  2H8H A;  2K2M A;  2ZPF B;  4HVU A;  3CME Q;  4LUE A;  1LVK A;  5CAI A;  2QEX T;  3OS2 A;  3QDF A;  1QVG A;  2FVU A;  3SD4 A;  5LJ5 h;  3PMI A;  1ZBX A;  1GFC A;  3G7Z A;  2H3J A;  4B6M A;  1FYN A;  4FT4 A;  5LJ3 g;  1VQ6 A;  1NE8 A;  2HL5 C;  1VQL A;  2LRQ A;  1W2B P;  3J81 E;  1QKW A;  1OX8 A;  2DJZ A;  1GFD A;  4QVZ A;  2L8D A;  3RKY A;  2RK2 A;  4D6W A;  1WJQ A;  1PRL C;  4FIB A;  1VQ4 Q;  2RH2 A;  4LDV A;  5LJ5 f;  2RF0 A;  4OMQ A;  1QP3 A;  2O4X B;  3QII A;  1RAA B;  2GCX A;  1PSF A;  1K8A C;  2DL8 A;  3CCE A;  3OBW A;  1UTI A;  2EJG A;  2RHY A;  5KYX A;  3GOX A;  4XTZ A;  1YJW A;  3RDV A;  1Q82 C;  3C0C A;  1KJW A;  3WVE B;  4R56 A;  1PD1 A; 
#chains in the Genus database with same CATH homology
 3H0I A;  2JXB A;  1HD3 A;  1WYX A;  2LCS A;  3NMZ C;  2AZV A;  2KRN A;  1JO8 A;  5GJW B;  1T0H A;  1UHC A;  3EHR A;  1YN8 A;  2BZX A;  2DVJ A;  2J6O A;  3REB B;  1PHT A;  2D8H A;  3VS1 A;  1ZX6 A;  1Z9Z A;  2EKH A;  2D1X A;  2LNH B;  1X2Q A;  2CSI A;  2I0N A;  2YT6 A;  4D8D A;  4Y92 A;  1UJY A;  2LQN A;  1NEB A;  4ORZ A;  2QDL A;  2LMJ A;  2KGT A;  1VYU A;  1E6H A;  4RUG A;  4Z89 A;  1HSQ A;  2JM9 A;  1RLP C;  3H41 A;  3UA7 A;  2EGC A;  2P4R A;  1TUD A;  2FO0 A;  1NEG A;  1VA7 A;  2J7I A;  4J9G A;  3R6N A;  1MV3 A;  4J9B A;  1UHF A;  2EVR A;  1WIE A;  2RPN A;  3PVL A;  1ARK A;  3I9Q A;  1JXM A;  5IHK A;  1NLP C;  1ZUU A;  2X3X D;  1AOJ A;  1PKT A;  4J9E A;  1AWW A;  4RTZ A;  2FEI A;  1AWX A;  3VS6 A;  2JMC A;  1S1N A;  1K4U S;  1AZG B;  1OPL A;  2GTJ A;  4KRT A;  3QWY A;  2RN8 A;  3PVQ A;  2A36 A;  3QWX X;  5IHN A;  1IO6 A;  1X69 A;  2RQR A;  1ZSG A;  2CT4 A;  3VS5 A;  2KE9 A;  1ZUY A;  4R0K A;  2D8J A;  3VRZ A;  1XOV A;  1QKX A;  1A0N B;  1M30 A;  2DL5 A;  1SRL A;  2K79 A;  2W10 A;  2CDT A;  4AFU C;  1H92 A;  2DX1 A;  1BU1 A;  1AWJ A;  2VWF A;  1YWP A;  4EIK A;  4GBQ A;  1RI9 A;  3M0R A;  2KR3 A;  2RNA A;  1NYG A;  3U23 A;  2K6D A;  2BZ8 A;  1B3Q A;  4J9D A;  1T3L A;  1YNZ A;  2KT8 A;  2EYY A;  2ESW A;  5FWB A;  2HSP A;  1JEG A;  3M0T A;  1M8M A;  2LZ6 B;  3PE0 A;  3KFV A;  4HCK A;  3H0H A;  4D8K A;  3RBB B;  3I5R A;  2CUB A;  5GJV B;  2RQU A;  4Z88 A;  2A28 A;  2EBP A;  1TG0 A;  2DE0 X;  4OMN A;  2BTT A;  1AD5 A;  4AG1 C;  4GLM A;  2F2X A;  1BK2 A;  2YUQ A;  2KRM A;  4CC4 B;  1M3B A;  5L23 A;  2KNB B;  2FPE A;  2CH4 A;  5I11 A;  2NUZ A;  3M0P A;  3VS7 A;  1EFN A;  2CSQ A;  1E6G A;  3NHN A;  4WCI A;  1AWO A;  1V1C A;  1X2K A;  1UUE A;  1K0X A;  1RUW A;  2DL7 A;  1KFZ A;  1ABQ A;  3CQT A;  2KYM A;  1U5S A;  2YUO A;  1ABO A;  1NYF A;  2JW4 A;  2AZS A;  2MCN A;  1ZLM A;  2FRW A;  1U06 A;  4RTT A;  2KXC A;  4JZ4 A;  2F2W A;  1X27 A;  2JS0 A;  1GCQ A;  2W0Z A;  4AFZ C;  1I0C A;  4OML A;  4X1V A;  2EGE A;  3EGU A;  3VS2 A;  2PZ1 A;  2CRE A;  1I07 A;  1JU5 C;  2J05 A;  1W70 A;  2RQW A;  2V1Q A;  1NM7 A;  3I35 A;  5EC7 A;  4E6R A;  2L3S A;  2RMO A;  2K3B A;  1KSW A;  1YWO A;  1GCP A;  1MUZ A;  2O88 A;  4ESR A;  1UFF A;  3UF4 A;  3ULR B;  1UEC A;  1UE9 A;  2EW3 A;  2HBW A;  4J9C A;  2J6K A;  1ZUK A;  1SHG A;  4JJB A;  4A63 B;  1WA7 A;  5ECA A;  2F2V A;  2JMA A;  2KRO A;  2CT3 A;  1PRM C;  4M4Z A;  4AFQ C;  1Z9Q A;  3JV3 A;  1UGV A;  2DRM A;  2JT4 A;  1PNJ A;  4IIM A;  1M3A A;  3RNJ A;  1PKS A;  3TVT A;  2EPD A;  1W6X A;  3UAT A;  5IH2 A;  1SPK A;  1SEM A;  1T3S A;  4JPB W;  5IXF A;  3TSZ A;  2K9G A;  2DF6 A;  1K76 A;  3M0U A;  2JS2 A;  2KXD A;  1T0J A;  2RQT A;  2DIL A;  1JQQ A;  4HXJ A;  1E7O A;  4J9H A;  2O9V A;  2DL4 A;  1OEB A;  5FWC A;  2GQI A;  2C0T A;  1UDL A;  2EYZ A;  1OOT A;  2D0N A;  1J3T A;  1X43 A;  1G2B A;  3VS0 A;  3FJ5 A;  4AG2 C;  1K1Z A;  1GRI A;  3VS3 A;  2YSQ A;  2A37 A;  4Z8A A;  1UG1 A;  1WX6 A;  2ROL A;  2LP5 A;  1NG2 A;  3LH5 A;  1M27 C;  4DEX A;  4IIO A;  1YP5 A;  4J9F A;  4RTW A;  1I1J A;  1AVZ C;  2LJ0 A;  3REA B;  2LJ3 A;  1WXT A;  3VS4 A;  5I22 A;  2M0Y A;  3O5Z A;  1U3O A;  4OMM A;  4LE9 A;  2HDA A;  2IIM A;  2DNU A;  4HVW A;  2OJ2 A;  4HVV A;  3M0S A;  2HCK A;  1GBQ A;  2DMO A;  2NWM A;  1AEY A;  2VVK A;  4AFS C;  2LJ1 A;  2ECZ A;  1CSK A;  1PWT A;  2AK5 A;  1UJ0 A;  4CC3 A;  2FG0 A;  2KBT A;  2SEM A;  2DRK A;  1SSH A;  1JXO A;  1SHF A;  1CKB A;  2KEA A;  2KYB A;  4ZNX A;  1VYV A;  2PNI A;  1K9A A;  4CC2 A;  2CUD A;  4LUD A;  3SHW A;  1SRM A;  2V1R A;  1H8K A;  1GCQ C;  3ZL7 C;  3EHQ A;  2BZY A;  2J6F A;  1VYT A;  1QLY A;  3I5S A;  2DYB A;  2YUN A;  2CH4 W;  2J06 A;  1OV3 A;  4F16 A;  2B86 A;  2X3W D;  2EYX A;  2EYW A;  1WXB A;  2KT1 A;  1QCF A;  3NGP A;  1M3C A;  2L0A A;  1BB9 A;  1FMK A;  2O2O A;  1NLO C;  1KIK A;  1BBZ A;  2OAW A;  4FSS A;  2EQI A;  2DJQ A;  4F14 A;  3EG2 A;  1YCS B;  1AZE A;  3SEM A;  2FPD A;  4JJC A;  2GNC A;  3NPF A;  3TSW A;  2O9S A;  2XMF A;  2FRY A;  3EG0 A;  2GTO A;  1G83 A;  1WXU A;  1X6G A;  3VRY A;  1WFW A;  1GL5 A;  2MIO A;  2PTK A;  2SRC A;  4K11 A;  2DM1 A;  2YDL A;  4OMP A;  2C0I A;  2LX7 A;  1RLQ C;  2JTE A;  3A98 A;  2RQV A;  2M51 A;  2GBQ A;  3EG3 A;  2DA9 A;  2GGR A;  2EGA A;  2ROT A;  1HJD A;  2VKN A;  4RTU A;  4RTY A;  1TUC A;  2C0O A;  1QWE A;  2MOX A;  4RTX A;  1B07 A;  2A08 A;  1QWF A;  1CKA A;  4OMO A;  4QT7 A;  2H8H A;  1WI7 A;  1X6B A;  4F17 A;  2K2M A;  4HVU A;  4LUE A;  5IHI A;  2DBK A;  5FW9 A;  4JJD A;  4RTV A;  1W1F A;  5IXB A;  4LN2 A;  2ENM A;  1ZBJ A;  1GFC A;  4LNP A;  2ED0 A;  3H0F A;  1OPK A;  2DBM A;  2DLP A;  2O31 A;  1FYN A;  2E5K A;  5HCK A;  4J9I A;  1WLP B;  2L3Q A;  3GBQ A;  2OI3 A;  1QKW A;  2KRS A;  3THK A;  2ABL A;  1GFD A;  2AKK A;  1N5Z A;  2LQW A;  4CC7 A;  1PRL C;  2DL3 A;  1Y0M A;  3M0Q A;  1MV0 B;  2FPF A;  2RF0 A;  4OMQ A;  4DEY A;  3EG1 A;  1H3H A;  2DL8 A;  2L3P A;  1K0S A;  1LCK A;  1WDX A;  1UTI A;  1GBR A;  1Y57 A;  2AKL A;  2G6F X;  3IQL A;  3UA6 A;  2HEQ A;  3C0C A;  1KJW A;  2K7A A;  2YUP A;  2L2P A;  2ED1 A;  2JM8 A;  4JZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...