2YUPA

Solution structure of the second sh3 domain of human vinexin
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
90
structure length
90
Chain Sequence
GSSGSSGKPPTYQVLEYGEAVAQYTFKGDLEVELSFRKGEHICLIRKVNENWYEGRITGTGRQGIFPASYVQVSREPRLRLCDDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the second SH3 domain of human Vinexin
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Vinexin
total genus 6
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2yupA01
1I07A 4KRTA 1UECA 4F14A 4Y92A 1QWFA 3M0SA 5IXBA 2DNUA 3VS4A 3UA6A 4ORZA 2IIMA 4RTYA 2DA9A 5FWCA 4F16A 1H92A 4CC4B 2GGRA 3TVTA 1WYXA 4D8DA 1U5SA 3I35A 1CSKA 4AFZC 2DF6A 5I22A 5GJVB 1YCSB 4J9BA 2CT4A 2OJ2A 1B07A 2GNCA 2CUBA 2CREA 4JJDA 1QWEA 2VKNA 4IIMA 1PKTA 2O31A 2LQNA 1X2QA 1TUDA 2P4RA 1S1NA 4E6RA 1N5ZA 2YUOA 1AZGB 2DL8A 1X69A 1KFZA 2YDLA 3EG1A 3H0FA 2J06A 1PKSA 1GFCA 3PE0A 2EW3A 2YUQA 1GCQC 2KR3A 2KYBA 5ECAA 4DEYA 2RMOA 4RTTA 3UATA 3RBBB 2MOXA 2W0ZA 2DILA 2LX7A 1PRMC 2LJ1A 4JPBW 2KE9A 1VYVA 1VYTA 1UTIA 1SPKA 1WIEA 2CT3A 2BZXA 2C0TA 4OMOA 2DLPA 1ZLMA 1ZUUA 2DBMA 1MV3A 2JS0A 2EVRA 1NYFA 3M0PA 2M51A 4CC2A 2PZ1A 2ESWA 2KROA 2L3SA 2FPFA 1A0NB 1K0SA 2AZVA 4ESRA 2KRMA 4LE9A 2YUPA 3EHQA 1KSWA 1K4US 1PHTA 1TUCA 2GQIA 1FMKA 1UDLA 1UJYA 2DBKA 1WXUA 1WA7A 2MIOA 2HEQA 4Z88A 1AD5A 3U23A 1OPKA 2L2PA 5FWBA 4J9DA 2JMCA 4HVUA 4J9EA 2BZYA 1AWWA 1AWOA 4R0KA 2DYBA 1OPLA 1T0HA 1SRLA 1NEGA 2B86A 2YT6A 2DJQA 2SRCA 4AFSC 2KYMA 2HCKA 3VS5A 2OAWA 3NPFA 1ABQA 1GCQA 4J9FA 1MUZA 3H41A 1KJWA 4LUEA 1TG0A 2KXDA 3C0CA 2VVKA 1UFFA 2KEAA 2RN8A 2O9SA 4RTVA 4CC7A 2FRWA 4Z89A 1HD3A 1NEBA 2L3PA 5IHNA 1NYGA 2D1XA 2HSPA 1PWTA 4ZNXA 5HCKA 4IIOA 2EGEA 1X2KA 4QT7A 4LNPA 1AWXA 3VS2A 2RQTA 2EBPA 1W6XA 1H3HA 1Z9ZA 1BU1A 2JT4A 2FPEA 1E7OA 4AFQC 3TSWA 1GL5A 1JO8A 1NG2A 2KRSA 3NMZC 4AG1C 1K76A 2J6FA 1OV3A 2BZ8A 1M30A 2RF0A 2DL3A 1LCKA 1RLQC 4WCIA 1RLPC 1RI9A 1GBRA 2A08A 2ED1A 2VWFA 3EG0A 4HXJA 2ENMA 3VRYA 1ZUYA 4J9HA 5GJWB 4OMLA 2JM8A 2KT8A 4J9GA 2J6OA 4D8KA 4M4ZA 4J9IA 1E6GA 5L23A 2KNBB 3THKA 2JTEA 1WI7A 1AWJA 4Z8AA 4F17A 2J6KA 4X1VA 2DVJA 2FEIA 2PNIA 2KT1A 2HBWA 2BTTA 1PRLC 2F2VA 1YWPA 2CH4W 2EYZA 2LNHB 2LP5A 3EG3A 4GLMA 2CUDA 4RUGA 3REAB 1WX6A 4FSSA 3NGPA 3A98A 1KIKA 3ULRB 3RNJA 4AG2C 1VYUA 4JZ3A 1M8MA 2PTKA 2RPNA 2X3XD 5IHKA 1EFNA 3TSZA 2K2MA 3SEMA 1AEYA 1GCPA 1MV0B 1UHCA 1ZSGA 4K11A 3I9QA 1K0XA 1G2BA 1WXTA 1OEBA 2DL7A 1BK2A 2H8HA 2RQWA 3O5ZA 1SHGA 2C0OA 3KFVA 1W70A 3M0QA 1M3BA 3VS6A 3JV3A 2X3WD 1ZBJA 1IO6A 1X6GA 3CQTA 2K7AA 4RTWA 1HJDA 2MCNA 2K9GA 3QWYA 1W1FA 2O2OA 1SRMA 3REBB 2RQUA 2K79A 3UA7A 2KXCA 2F2WA 3VS3A 2RNAA 1WXBA 3QWXX 1QKWA 1QKXA 1UG1A 1YWOA 2CDTA 2RQRA 1T0JA 1SEMA 2EYYA 5IHIA 2F2XA 2AK5A 1Y0MA 3H0IA 4J9CA 2YUNA 2L0AA 1Z9QA 1X43A 4OMQA 1M3AA 2O88A 1CKAA 2D8JA 1JEGA 1I1JA 2FO0A 2KGTA 2AKKA 4HVVA 2EYWA 2EPDA 3VS7A 2J7IA 3EHRA 4CC3A 3ZL7C 2D0NA 1ABOA 2ED0A 1V1CA 2KBTA 4OMMA 4RTXA 4HCKA 2DM1A 1T3LA 1U06A 1UJ0A 3I5SA 1B3QA 1WFWA 2AKLA 2K6DA 3NHNA 4OMPA 1UHFA 2M0YA 1UUEA 2I0NA 1ARKA 2JS2A 2QDLA 2GBQA 1AVZC 2W10A 4DEXA 2XMFA 3IQLA 2KRNA 1M27C 2J05A 1QCFA 1M3CA 1NLPC 2C0IA 2D8HA 5IH2A 2DRMA 1WDXA 1JXOA 1XOVA 2A36A 4LUDA 1JXMA 2JW4A 4JZ4A 5FW9A 3FJ5A 1X27A 3I5RA 1QLYA 3EG2A 1GFDA 1E6HA 4AFUC 2GTJA 1J3TA 3UF4A 2EKHA 2A37A 2CSQA 1G83A 3R6NA 2DL5A 1X6BA 4GBQA 2SEMA 2LZ6B 1ZX6A 1GRIA 1FYNA 1K9AA 2EQIA 2JM9A 2RQVA 2FPDA 3PVQA 1AZEA 4HVWA 1PNJA 1HSQA 1NLOC 1H8KA 1UGVA 1SSHA 2FRYA 2GTOA 1YP5A 1OOTA 2JMAA 1NM7A 2OI3A 1I0CA 2NWMA 2CSIA 4JJBA 4A63B 2AZSA 2DMOA 1RUWA 2HDAA 3EGUA 1K1ZA 1WLPB 2NUZA 1GBQA 3LH5A 4RTZA 2A28A 2O9VA 2DX1A 2L3QA 2YSQA 2LMJA 3VRZA 2JXBA 1VA7A 4EIKA 1Y57A 2E5KA 3GBQA 1YNZA 1UE9A 2ECZA 4JJCA 4LN2A 2EYXA 2DE0X 2LCSA 4OMNA 1JU5C 3VS1A 2LJ0A 1SHFA 2EGCA 5EC7A 3SHWA 2DRKA 4RTUA 2CH4A 3PVLA 2K3BA 2LQWA 2G6FX 2FG0A 5I11A 2DL4A 2V1RA 3VS0A 3M0TA 3H0HA 1BB9A 2ROTA 2ROLA 1BBZA 3M0RA 3M0UA 1T3SA 5IXFA 1ZUKA 1AOJA 1YN8A 2LJ3A 1JQQA 1CKBA 2EGAA 2V1QA 2ABLA 1U3OA
chains in the Genus database with same CATH superfamily
4M75A 1I07A 1M90U 3CMAA 1QWFA 1VQNT 3M0SA 5IXBA 4C0DC 1IGUA 4JDSA 1RAFB 5LJ5j 4E7SA 1Q82R 1H92A 3MP8A 4CC4B 3TVTA 1NPPA 4BI8B 4D8DA 1U5SA 4C0ZA 1CSKA 2DF6A 2QYZA 2O4XB 1JB0E 1XTDA 2QA4Q 1TUDA 1W4SA 1AZGB 1Q81C 4JJNK 4RCCA 4FSXA 2YDLA 3H0FA 1QW1A 4PJMA 2Y90A 3CCSQ 2YUQA 2RHUA 4DEYA 1YJNA 1G3YA 3M4GA 3UATA 1Q86C 3RBBB 2ZPGB 4EMGA 2MOXA 3SD4A 2R57A 1OI1A 1PD0A 1ZSZA 1VYVA 1WHJA 1FXXA 2CT3A 2BZXA 2C0TA 1ZLMA 4OGEA 3CD6T 4C92G 2DBMA 2JS0A 2EVRA 1KG1A 4EMKC 2DPPB 2IPOB 4CC2A 2PZ1A 2L3SA 3EFSA 2AT1B 1K0SA 2EQKA 4LE9A 2YUPA 1BYMA 1YITQ 1KSWA 3KBGA 3L2VA 4M7AE 1UJYA 1WA7A 1R8OB 1V29B 1Q81R 1AD5A 4M75B 2MYSA 2L2PA 5FWBA 3OYKA 4PJNA 4HVUA 4C92A 3VYHB 3G71Q 1Q86U 3M56A 4XAXB 2YHTA 1AWWA 4RCBA 4B9WA 1M2VA 4R0KA 3SWNB 1YJ9Q 2DYBA 1OPLA 2FL7A 4DBHA 4ME7A 5CO7A 4BUGA 4ZTJA 2B86A 2DJQA 2KQWA 4OVAA 2SRCA 2HKQB 4M78G 3NPFA 3X26B 4J9FA 2DTOA 4RKUE 1IHVA 1KJWA 4IUQA 3C0CA 4LDVA 3EGXB 2RJCA 4ZN3A 4RTVA 4CC7A 3N5BB 1U1SA 3CMET 4VUBA 1HD3A 1W2BA 1NEBA 2D1XA 3GF5A 5GMKl 2HSPA 4ZNXA 1X2KA 4QT7A 5D6XA 2NLUA 1KHIA 3P8DA 1Z9ZA 3OYEA 2EJFA 3JCMJ 2FPEA 3JCMd 3EGDA 1WQ7A 4C0FA 1GL5A 4V2SA 1VQ8Q 1LVKA 2J6FA 5LL6S 1M30A 2RF0A 6AT1B 2QG9B 3M57A 4UC4A 2RHIA 1QCOA 2GFAA 3BE3A 4XK8E 2A7YA 3VRYA 3G1JA 4J9HA 4OB1B 1NBEB 2E4HA 4OMLA 2GCXA 4J9GA 3HKSA 2QQSA 4C0GA 1WI7A 4KUDK 4Z8AA 1R77A 2P0KA 3CCLT 2CP2A 2J6KA 4WTOB 2DVJA 2FEIA 2KK4A 2KT1A 2RJDA 2HBWA 1I81A 2BTTA 1GXIE 1PRLC 2CZ7B 1N8RU 2CH4W 3EG3A 2C06A 4C5HA 3NGPA 1PM3A 1KIKA 4KGVB 3ULRB 3RNJA 4EMKA 3L1AA 1VYUA 4L5GA 1M8MA 3E9GA 2X3XD 3CCSA 3OYYA 2VC8A 2HZYA 2HKNA 1MV0B 5C0MA 4XTWA 3JCMW 1LOJA 2E10A 1WXTA 1OEBA 3RMQA 1LPLA 1WHGA 1YITT 1ZSZB 1BI1A 3ASKA 1ZBJA 4J7FA 3LH0A 1VQ7Q 4TVRA 4PJOB 3M9QA 3PIPA 1SRMA 3HHTB 2X51A 4M7AB 3OYLA 3UA7A 3AHUA 2DD5A 1YI2Q 2LC4A 1WXBA 3QWXX 1QKXA 2D6FA 3GNGA 3L2RA 1M1KC 2RQRA 1T0JA 3VKIA 2EYYA 3L2UA 3FLGA 1D1BA 2F2XA 1Y0MA 3OMGA 2YUNA 3JCMh 4M7AG 1C0MA 4C92C 1JEGA 1CKAA 1RACB 2D8JA 2FO0A 1MMGA 2OX7A 4FCYA 4HVVA 2EPDA 3A8GB 3VS7A 5IAYA 1FMWA 4BE2A 2LQKA 2R5MA 2ED0A 3M55A 2IVWA 1RAHB 4HCKA 5GMKj 2DM1A 4J7IA 5KYWB 2QXFA 1IRXA 4KBMB 2VYTA 4MZTA 3P8BB 1WFWA 3RIRA 5GMKm 2COZA 3E9FA 2I0NA 4ANJA 2JS2A 2GBQA 3OYIA 2GQVA 2W10A 1YJNQ 2DKGA 2XMFA 5KH6A 1PG5B 4QKUA 2MMPA 4DBQA 1QCFA 2C0IA 2V8JA 1X6OA 3G4SQ 2DRMA 1WDXA 1YJWT 1YI2T 1JXOA 5KYXB 3CMAQ 3CC4T 4LUDA 4JZ4A 3G4SA 1QLYA 3CPWA 3EG2A 1M4ZA 3MP1A 1WPYA 1G3SA 4AFUC 5IT9E 1J3TA 2QTXA 1SKUB 1IGQA 2QI2A 2A37A 2VASA 2CSQA 5GAN2 2SEMA 2NYSA 4C8QA 1ZX6A 1K9AA 2BE9B 2FPDA 3PVQA 1UGVA 3X28B 1SSHA 3GNFB 2FRYA 4Q5WA 4KUIA 1OZ2A 1Q81U 2F5KA 2OI3A 3EH2A 2EYQA 4JJBA 4A63B 1BI3A 2AZSA 2K5LA 5LJ3d 3EGUA 4PJJA 2DXTA 1K1ZA 1WLPB 5DLOA 1U8RA 4A4FA 4PJOC 3JB9H 2DX1A 1QVGP 2YSQA 1JJ2S 2JXBA 4M7AF 2E6ZA 3PMTA 4OMFB 4A4KA 2ECZA 4F7UB 3JCMe 1UB4A 2KDSA 4LN2A 2EYXA 2LCSA 2MPXC 5CQXA 3LYIA 4FT4A 2EGCA 2CS7A 4M75G 5EC7A 3SHWA 4C92D 2CZ1B 3DLLA 2YLBA 2LCCA 4M75E 2G6FX 1OX8A 5I11A 1VQ7A 4F7UG 3CC4A 3SWNC 1BIAA 3VS0A 1K9MR 1YI2A 2DAQA 4PFZA 1C1AA 4ZTFA 3H0HA 2WACA 2E70A 3M58A 5J39A 1BB9A 2ROTA 1W2BP 4NS5A 3JB9G 1PC0A 3C4SA 4MZMA 3M0RA 1ZUKA 2RK2A 1XJWB 1Q7YC 3WVEB 1V76A 1CKBA 2RM4A 4NL3A 1AT1B 2WSCE 2YRDA 2ABLA 4DQ2A 3MCAB 4F14A 1VQLQ 5KYNA 4A4GA 1VUBA 4ORZA 4OP0A 4P5NA 5KYUA 4OB2B 1TTHB 2DEQA 1KD1U 2E6NA 2RA2A 1IREB 5I22A 1BKBA 1VQOQ 2JOYA 3LX7A 1YCSB 4DOVA 4ZN1A 1TU0B 2GNCA 1M2OA 3CC4Q 4FT2A 3EFOB 3CMAT 4JJDA 2O31A 5GAMd 1K8AU 2P4RA 2YUOA 2EIFA 2F69A 2RHXA 3GOXA 3VV0A 3CC2A 2F1LA 2LQ8A 1RABB 3EG1A 1X01A 2QEXA 5GAN5 4J83A 3QDFA 3L2QA 2EW3A 2KYBA 4BI3A 4C5GA 4IUUA 4LDYA 1D0XA 4PLLA 2DILA 3H9NA 2LT4A 1ZA2B 1DJ7B 5GAN6 4M7DG 4M77G 2XICA 3CCMA 2HMAA 4PFPA 2ZPBB 2DLPA 4PLIA 2DIQA 1NYFA 4ELZC 2ESWA 2KROA 5M9OA 5LJ3f 2FPFA 2LCLA 5GAOl 1A0NB 2H3EB 2KRMA 1VQOA 1KD1R 3CXCP 1RAIB 1RI0A 3RR6A 2JVVA 1VQ6A 5J26A 2YXYA 4X34A 3JCMV 5D7UA 3U23A 1VOMA 4J9DA 3EGDB 5KYYA 2E65A 4E7ZA 4J9EA 1YJ9A 1Q7YU 1AWOA 3EG9B 1D09B 1UGQB 5GAOq 4X9CA 1WQWA 4PL6A 2HD0A 1NEGA 4M7DE 3O8VA 1OZ3A 1M90C 3CPWP 4M7DF 3X20B 2HCKA 2LT1A 3OYHA 3VS5A 1GCQA 1ZBXA 3CCJA 3CCLA 3H41A 4PJOD 3DKMA 3MEUA 2VVKA 1UFFA 4C92F 1MGQA 5GAN3 3GIBA 3RMSA 3OB9A 2KMTA 1XNIA 1PWTA 1Y71A 3PT9A 3CCEQ 1TH7A 4RG2A 2EGEA 1M1FA 1G3WA 4LNPA 3VS2A 3X25B 2DVEA 1EX4A 1VQMT 1B34B 2JT4A 1SF9A 1E7OA 4C8QD 4AFQC 1JO8A 2G3RA 4ZGEB 2B8AA 1PD1A 4MMKA 1NG2A 1OU8A 3NMZC 3VU3C 2Z0WA 3G71A 1K73R 2E5QA 4J6XA 1VQLA 1RLQC 1YJWQ 1GBRA 1RADB 3EG0A 4XTXA 2ENMA 4C8QB 3NTIA 5GJWB 4J6WA 2KT8A 4D8KA 1WNLA 2J6OA 2RH2A 3URGA 2CZ6B 3M4YA 2KNBB 4FYWB 3THKA 5GAMh 2QTVA 3BW1A 1AWJA 3CCJT 4X1VA 2DXUA 2HQXA 2HQHA 3CCJQ 3JAME 1QVFS 2F2VA 3SDZA 3LGLA 4BE0A 4MZPA 2VXEA 2LP5A 1Y96A 4GLMA 3JB9F 3A98A 2K3YA 1N6AA 2M16A 1Q7YR 3EFRA 4JZ3A 4HT8A 3QUIA 4M7DD 2YRCA 3SEMA 1AEYA 4IUPA 4IURA 3OSVA 3S3MA 3G6ET 2DL7A 3JCMP 3CBMA 1SHGA 4M77D 3M0QA 3JV3A 2X35A 3CQTA 1KQSA 1VQKA 3RKXA 2X4JA 4N4HA 4FL6A 1YITA 1LJOA 8AT1B 2K9GA 3RDVA 3RERA 5GAOm 1I8FA 2KXCA 5GAOr 1KQSP 2P0QA 2RI2A 1PSFA 2QEXT 5KCHA 5CCAA 3CCQT 3CC2T 4BDZA 1YWOA 4FIBA 2CDTA 4N4GA 4NOYA 5J3BA 1VQ8T 4M7DC 2AK5A 4KH1B 4BDYA 4J9CA 1Z9QA 3TCJA 5KYUB 3TEEA 2QK0A 4OMQA 1M3AA 2QA4T 4GLKA 5KE3A 4N4IA 2O88A 4FM4B 2KGTA 2AKKA 1OU9A 2EYWA 3EHRA 4CC3A 3ZL7C 2D0NA 1Y07A 5GAN7 4OMMA 2VUBA 4C92B 1U06A 1UJ0A 1H3ZA 1I5LA 4PFOA 3JB9D 3PIOA 3JRZA 4QVCA 4OMPA 2M0YA 1IZ6A 1MNEA 1ARKA 2PVDB 1AVZC 4HKEA 3IQLA 4RG8A 1M27C 3UPUA 3FB9A 1EIFA 2D8HA 2IG0A 2MI6A 2OTJQ 5GANf 2JN0A 4OB0B 2K5IA 5KYYB 2CYZB 2X4WA 1HXDA 1JXMA 1ZSZC 5CVIA 1X27A 3I5RA 2E1HA 4J6YA 1VIEA 3RESA 2M9UA 2RHYA 2DTIA 4PJOA 3HPWA 3UF4A 2NUTA 1VQMQ 1KHCA 1G83A 3R6NA 5HK0A 4HCZA 1X6BA 5FRMA 3X24B 3QHSA 1D3BB 2LZ6B 1GRIA 2JM9A 2EQIA 5A0LA 2RB6A 1OYXA 1QQJA 3RKWA 1NLOC 5GANj 4LD9K 1D0ZA 1HYOA 1N9RA 1YP5A 1OOTA 3J80E 2JMAA 2YRVA 3E2UA 2CSIA 2A3LA 3UDCA 2DMOA 5D6WA 1RUWA 4EMKB 4A54A 2NUZA 3J81E 3PMIA 2LNVA 2A28A 2O9VA 1TUGB 3OW2A 3DB4A 4BE1A 2A0FB 4IUTA 3VRZA 2HSEB 5GAMj 4EIKA 1OULA 1YJWA 2E5KA 1U1TA 2DEUA 5CKHA 4BY6C 4M77E 2KSSA 2OTJT 4IUVA 2AIRB 4LXCA 2FVUA 1HK9A 4GY5A 3CCMQ 2GFUA 1TXQA 2DRKA 1KD1C 3M54A 2ZZDA 2QAZA 2CP7A 2FG0A 2ZCFB 2PU9B 3M0TA 1MMAA 2ZAEA 4M75F 1YJNT 4QQ6A 1BBZA 1OQKA 5FROA 3M0UA 5IXFA 2ZPEB 8ATCB 3OS1A 1Y7XA 5DM7R 2JTMA 5FU7B 1UECA 4HA8A 4E7JA 2MK5A 4Y92A 5CK9A 1BI2A 2FZGB 4QVDA 2DNUA 3QG1A 1VQ8A 5GANe 2IIMA 1NPRA 4M78E 4Z02A 4MDWA 4QVZA 2JTFA 1AHJB 4JRKA 5GANg 1WHMA 5GAMg 5FWCA 4KH0B 3FC3A 1WYXA 4ZGDB 5GAMe 5LJ5f 4ELYC 4BD3A 1QCNA 2ZPFB 1K9MC 3KXTA 4F7UF 3JCMX 3JCMc 3OYDA 2EWNA 5GJVB 1FX7A 4J9BA 3WVDB 3TREA 4A53A 3CCMT 1QWEA 2VKNA 1PKTA 1X2QA 3OW2S 1M1GA 4E6RA 1N5ZA 1VQ5T 2ZPHB 1SG5A 1RAGB 4FW2A 3V7CA 5ECAA 2KR3A 4XU3A 2RMOA 4RTTA 5LJ3h 3CCST 1S72T 2W0ZA 2XU8A 2JNGA 2LX7A 1PRMC 2R5AA 2LJ1A 1K73U 4JPBW 3T9NA 2KE9A 1VYTA 1VQ9Q 1UTIA 3DB3A 1SPKA 1WIEA 3I55A 3CMEQ 5A2QE 1JJ2P 4BY6B 2QQBA 3VYGA 1ZUUA 1P92A 1MV3A 1VQ9T 2KY9A 2D0QB 3A8MB 4IKFA 1O9SA 2DETA 2XIDA 4J8OA 2M02A 4ESRA 5I21A 2XI9A 3EG9A 1K8AC 3OY9A 1PHTA 2GQIA 1FMKA 1UDLA 2XKOC 1WXUA 2MIOA 4OGCA 3LLRA 4O6JA 2HEQA 4Z88A 1QVFA 3L2WA 1OPKA 3TQ7P 2JMCA 2HQEA 1NE8A 2BZYA 2EQMA 3OYNA 2GF7A 2COWA 1T0HA 3G71T 2YT6A 2O4XA 4AFSC 3HRSA 2OAWA 1ABQA 4LUEA 2KXDA 2DFUA 1TS9A 4N0AA 1VQKQ 1VQMA 5GANh 2O9SA 1RL2A 3FEOA 1G3TA 2L3PA 1NYGA 2ATCB 4ZGJB 1R0BG 3QDRB 5DY9A 1M1KR 2K4YA 3CMEA 2HAXA 4AMCA 1AWXA 2L5QA 3OBWA 2EBPA 2DYIA 2L3RA 5GAMf 2QDYB 4M77A 2OTJA 3TSWA 2EQJA 1N9SA 1K76A 3C12A 2BZ8A 3OYAA 2WSEE 2RJEA 2AHJB 2DL3A 4E2FB 3QKJA 1RLPC 1RI9A 4HXJA 5GMKh 3MPUB 3HRTA 3CC7Q 2JM8A 2MF2A 4M4ZA 4J9IA 1E6GA 5L23A 4KGXB 3SFMA 2JUFA 4E7IA 4F17A 4E47A 1WJQA 2EKOA 1RAEB 4JRIA 1VQOT 2PNIA 2EYZA 3QPHA 1ZA1B 3MKDA 1TOVA 3REAB 3BDUA 1KC8C 2OAUA 1VQ4A 2RPNA 2DXCA 3AT1B 2K2MA 5CKFA 2PUKB 3JCMQ 2KVQG 1KQ2A 5KE2A 1UHCA 4C92E 3ZEHA 4K11A 4A4HA 3OYGA 1YIJA 4M78B 1G2BA 4YTLA 4JRPA 2V8IA 1BK2A 2H8HA 1FWZA 3O5ZA 2L8DA 3KFVA 4E7KA 3HTRA 2HL5C 4XU2A 1M3BA 5CIUA 3VS6A 1MMDA 4CRIA 1IO6A 4RTWA 2K7AA 1HJDA 3QWYA 1W1FA 3V7RA 2X9HA 1Q95G 3REBB 2RQUA 3C94A 1OX9A 3I56T 3A8HB 2CP6A 3VS3A 2LDMA 1VQPQ 3V7SA 2ZGWA 2CP5A 1KC8R 4CI0C 2NUPA 1SEMA 5IHIA 2Y4YA 5GANd 1WHLA 1M90R 3QYGB 1KK7A 2DD4A 2L0AA 1X43A 3FDRA 2PVOB 3KUFA 3C95A 1I1JA 4MDXA 2J7IA 4M77B 3CCQA 2XK0A 4HCBA 3PTAA 5GMKe 1ABOA 3CCQQ 4RTXA 1V1CA 2KBTA 4XTVA 2HL3A 1RAAB 4M7DA 2DK3A 4JLGA 1B3QA 3UT1A 1VQNA 3HFOA 2AKLA 3OMCA 3NHNA 3Q1JA 1W2BS 1UUEA 1IHWA 4BI4A 3GP8A 3HSBA 1LNXA 3S3NA 1N8RC 4DEXA 2VV5A 3V8JA 2KRNA 1M3CA 2EJGA 1NLPC 5IH2A 5LJ5e 3META 4N0AC 2COYA 1UGRB 1UGPB 1VQPT 1XOVA 5KYWA 2JW4A 2CKKA 5GAN8 3CBPA 3CCUA 1PSEA 2VGNA 4F04B 2ZPIB 5LJ3e 4C8QE 2GTJA 3I55Q 2BUDA 1D0YA 4JS4A 4LDWA 1Q86R 2VB6A 1NJIC 5A0GA 4GBQA 4C8QC 2MAMA 4M77F 1FYNA 4BB7A 1AZEA 1G5VA 1PNJA 3RKYA 3CCVQ 1JJ2A 1HSQA 2CZ0B 3HL8A 2NUPB 1WZOA 5KYXA 3VJPA 2FB7A 2RD1A 2QEXQ 2NWMA 1D3BA 2K3XA 1ACMB 2RI3A 1VQ5Q 3SWNA 4JUVA 4EDUA 1GBQA 5CAIA 1VQLT 1VQ6Q 1TWBA 2YWWA 4JLIA 2L3QA 4M7AA 4II1A 1QVPA 1Y57A 4C8QG 1YNZA 1UE9A 3V8LA 2PVGB 4OMNA 1JU5C 3I56Q 4M78C 1VQ9A 4M7DB 3QJYA 3VS1A 5LJ3j 3JB9I 1SHFA 2P4TA 1MMNA 3ZBDA 3I55T 3CD6Q 2R58A 3PVLA 2CH4A 2RJFA 1MNDA 4J5YA 2QGFB 2LQWA 3CCRA 4PJLA 1K9MU 2QGGA 5AYFA 5FU6B 2K5FA 2HBPA 1KQSS 2FZCB 4Y91A 4DA4A 4L59A 3CPFA 3QSUA 2XG8D 3CCEA 1X75C 3CCUQ 2EGAA 1B34A 1U3OA 4KRTA 5LJ5h 1YJ9T 2XDPA 4ATOA 3H6ZA 1SSFA 1YIJQ 5D6YA 3VS4A 4DBRA 3UA6A 2V8KA 3QZ5B 4RTYA 3G7ZA 2DA9A 3A5ZB 1VQ6T 1K73C 4EMHA 4RMOA 4F16A 2GGRA 3NFCA 3PGGA 3OS5A 2DIGA 1Q82U 4FYYB 1YFNA 3I35A 4AFZC 1JBMA 3FJPA 1BCOA 3OW2P 5A0DA 2CT4A 2OJ2A 1B07A 2DJZA 2CUBA 5FRNA 3JB9J 2CREA 4IIMA 2LQNA 4QQGA 4DOWA 2E3HA 3M5AA 2XHCA 1S1NA 2DL8A 1X69A 1KFZA 3JCMg 3OYBA 3M53A 2J06A 1PKSA 4KT0E 1GFCA 3PE0A 3EFOA 4FYXB 3I56A 1GCQC 2PUOB 3QJ6A 3OBYA 3QYHB 1YCYA 2BKDN 5CKEA 4JRQA 4DBFA 3CCRT 2V26A 3MP6A 3QBYA 4FU6A 4A4EA 3OSSC 4OMOA 2E41A 1WHHA 5GAOp 1D1CA 3M0PA 2M51A 1YIJT 2XDDA 3G6EQ 2AZVA 1G8XA 3EHQA 1K4US 1TUCA 4MMLA 2NUTB 1KC8U 2DBKA 2EAYA 2EFIA 5KCOA 3SB2A 1VQ4T 3MHXA 1BI0A 4LDUA 2RK1A 4XU1A 3J7AF 2F5TX 2H3JA 1VQ4Q 3L2ZA 4AT1B 1YHQQ 2BE7D 1YHQA 1SRLA 3CCVT 3LGFA 1WJSA 4M75D 3OYFA 5FU7C 2KYMA 3GLXA 3CPWS 5CKBA 1MUZA 4F7UE 4FW1A 2OTLT 2DXBA 2X4YA 1TG0A 2KEAA 2RN8A 1XQHA 2LRQA 4KULA 1VQ7T 2FRWA 3HFNA 4Z89A 2KAFA 1Q82C 3CCRQ 3CCUT 5IHNA 5HKCA 4E7LA 4M78D 5HCKA 3NTKA 4IIOA 3ZFJA 1O75A 3WXMB 2RQTA 1QVFP 1W6XA 1H3HA 1BIBA 3CXCS 1BU1A 3JCMb 2JZ2A 1ZQ1A 2KRSA 4AG1C 2LTOA 4M78A 1OV3A 1LCKA 2EQUA 2DTHA 5CQYA 4WCIA 1YHQT 2A08A 2ED1A 2VWFA 3EAEA 3VUBA 1ZUYA 5EG2A 3HRUA 4XQ3A 1F1BB 1UEBA 4XTYA 2JTEA 1WHKA 2OTLA 5HK3A 2OTLQ 3HP9A 3ER0A 4Y28E 3RUXA 3CCVA 3MEVA 4R55A 5GMKi 2XDBA 5I2MA 1N8RR 2E12A 1YWPA 2LNHB 1IB8A 4OF1A 4PNOA 2QA4A 2CUDA 4RUGA 3CD6A 1WX6A 4FSSA 5AT1B 3E1SA 2YLCA 4F7UA 5FU6C 5HY6A 3CXCA 2E3IA 2M0OA 3P8HA 3OS0A 4AG2C 9ATCB 3G4ST 4R56A 4HT9A 4M7AC 1WJRA 2PTKA 5IHKA 1EFNA 4E7HA 3TU4K 3TSZA 1GCPA 2BIVA 4X9DA 1ZSGA 2KI7A 3I9QA 3JSCA 1K0XA 3BFMA 2MWPA 2RQWA 1NJIR 2C0OA 2P0PA 1W70A 3OYMA 1Y96B 1VQKT 2E64A 1M8VA 2RO0A 2X3WD 5IN1A 1X6GA 1R0CB 3FRNA 3GPLA 1H641 2I2LA 2MCNA 1K8AR 3S6WA 2QASA 1FMVA 1S72A 3ME9A 2O2OA 3OA6A 1VQNQ 1N27A 3G6EA 4LD6A 2K79A 2VGMA 5CR2A 2F2WA 2DZ9A 2RNAA 3OYCA 3LWIA 4NL2A 4WF2A 5LJ5d 1QKWA 1UG1A 3F70A 2QQ9A 4M7AD 3BY7A 3A8OB 5GAN4 3H0IA 4BACA 4PJOE 3NTHA 1KQ1A 5LJ5g 5I2SA 1M2VB 2L89A 2X4XA 4M77C 2MWOA 3CCET 3A1PA 2QQRA 3MO8A 1T3LA 1TSFA 2LX9A 3I5SA 3QIIA 1ZHIA 2O01E 3CC7A 1NJIU 1MHNA 3BDLA 1QVGA 3CEYA 1I4K1 2K6DA 4KGZB 1S72Q 1UHFA 1PCXA 1YBYA 2CP0A 5FLXE 4O5VA 2QDLA 1C6VX 3OS2A 3MEAA 2EJ9A 2FZKB 1IXDA 2FHDA 2J05A 2M1HA 3PFSA 3CC2Q 3OYJA 1NZ9A 4XTZA 4C5IA 1VIFA 2JJ9A 3QO3A 4QW2A 2A36A 5FW9A 1QMCA 4C8QF 3FJ5A 4HCCA 3QZ9B 2CGHA 3V8KA 1GFDA 3LWHA 1E6HA 3CCLQ 2EKHA 3LW5E 2LVMA 2QQAA 3R6OA 4QQDA 2DL5A 4PK4A 2P84A 4LDXA 1JRIA 4B9XA 2RQVA 4FYVB 4HVWA 4OB3B 3VUZA 2K57A 4PJOF 1H8KA 4EPCA 2XD0A 2GTOA 2K2VA 3MJXA 1NM7A 3H8ZA 1I0CA 3MEWA 2RI5A 3UWNA 3EH1A 4PJOG 2HDAA 3E19A 4M78F 1M1KU 1EZZB 5DLQE 5GAOn 3LH5A 4RTZA 4JS5A 2CP3A 3INZA 1B7TA 7AT1B 3A8LB 3D7SB 2LMJA 2DZCA 1VA7A 2DO3A 4C0DB 2HNIA 3GBQA 5C6SA 4L6V5 1QP3A 3DLMA 4JJCA 3CBOA 2DE0X 1QP2A 3EGXA 4C5EA 4M75C 1QVGS 2Y4XA 4B6MA 3QXEB 2LJ0A 1M5Q1 2WSFE 2DERA 4RTUA 4XU0A 2K3BA 3PNWC 2RHZA 4PKCC 2FYKA 2DL4A 2V1RA 5L8RE 1VQPA 3CC7T 3M59A 2PQWA 1BCMA 2ROLA 4XTUA 4D6WA 1T3SA 2VXFA 1AOJA 1D1AA 1YN8A 1M9SA 1I5OB 2LJ3A 1JQQA 1UGSB 2D9TA 1VQ5A 5CKDA 3OQ5A 2V1QA 3FIFA 5LJ3g 3L42A 3S3OA 1WGSA 3JCMf
chains in the Genus database with same CATH topology
1I07A 4KRTA 1UECA 4F14A 4Y92A 1QWFA 3M0SA 5IXBA 2DNUA 3VS4A 3UA6A 4ORZA 2IIMA 4RTYA 2DA9A 5FWCA 4F16A 1H92A 4CC4B 2GGRA 3TVTA 1WYXA 4D8DA 1U5SA 3I35A 1CSKA 4AFZC 2DF6A 5I22A 5GJVB 1YCSB 4J9BA 2CT4A 2OJ2A 1B07A 2GNCA 2CUBA 2CREA 4JJDA 1QWEA 2VKNA 4IIMA 1PKTA 2O31A 2LQNA 1X2QA 1TUDA 2P4RA 1S1NA 4E6RA 1N5ZA 2YUOA 1AZGB 2DL8A 1X69A 1KFZA 2YDLA 3EG1A 3H0FA 2J06A 1PKSA 1GFCA 3PE0A 2EW3A 2YUQA 1GCQC 2KR3A 2KYBA 5ECAA 4DEYA 2RMOA 4RTTA 3UATA 3RBBB 2MOXA 2W0ZA 2DILA 2LX7A 1PRMC 2LJ1A 4JPBW 2KE9A 1VYVA 1VYTA 1UTIA 1SPKA 1WIEA 2CT3A 2BZXA 2C0TA 4OMOA 2DLPA 1ZLMA 1ZUUA 2DBMA 1MV3A 2JS0A 2EVRA 1NYFA 3M0PA 2M51A 4CC2A 2PZ1A 2ESWA 2KROA 2L3SA 2FPFA 1A0NB 1K0SA 2AZVA 4ESRA 2KRMA 4LE9A 2YUPA 3EHQA 1KSWA 1K4US 1PHTA 1TUCA 2GQIA 1FMKA 1UDLA 1UJYA 2DBKA 1WXUA 1WA7A 2MIOA 2HEQA 4Z88A 1AD5A 3U23A 1OPKA 2L2PA 5FWBA 4J9DA 2JMCA 4HVUA 4J9EA 2BZYA 1AWWA 1AWOA 4R0KA 2DYBA 1OPLA 1T0HA 1SRLA 1NEGA 2B86A 2YT6A 2DJQA 2SRCA 4AFSC 2KYMA 2HCKA 3VS5A 2OAWA 3NPFA 1ABQA 1GCQA 4J9FA 1MUZA 3H41A 1KJWA 4LUEA 1TG0A 2KXDA 3C0CA 2VVKA 1UFFA 2KEAA 2RN8A 2O9SA 4RTVA 4CC7A 2FRWA 4Z89A 1HD3A 1NEBA 2L3PA 5IHNA 1NYGA 2D1XA 2HSPA 1PWTA 4ZNXA 5HCKA 4IIOA 2EGEA 1X2KA 4QT7A 4LNPA 1AWXA 3VS2A 2RQTA 2EBPA 1W6XA 1H3HA 1Z9ZA 1BU1A 2JT4A 2FPEA 1E7OA 4AFQC 3TSWA 1GL5A 1JO8A 1NG2A 2KRSA 3NMZC 4AG1C 1K76A 2J6FA 1OV3A 2BZ8A 1M30A 2RF0A 2DL3A 1LCKA 1RLQC 4WCIA 1RLPC 1RI9A 1GBRA 2A08A 2ED1A 2VWFA 3EG0A 4HXJA 2ENMA 3VRYA 1ZUYA 4J9HA 5GJWB 4OMLA 2JM8A 2KT8A 4J9GA 2J6OA 4D8KA 4M4ZA 4J9IA 1E6GA 5L23A 2KNBB 3THKA 2JTEA 1WI7A 1AWJA 4Z8AA 4F17A 2J6KA 4X1VA 2DVJA 2FEIA 2PNIA 2KT1A 2HBWA 2BTTA 1PRLC 2F2VA 1YWPA 2CH4W 2EYZA 2LNHB 2LP5A 3EG3A 4GLMA 2CUDA 4RUGA 3REAB 1WX6A 4FSSA 3NGPA 3A98A 1KIKA 3ULRB 3RNJA 4AG2C 1VYUA 4JZ3A 1M8MA 2PTKA 2RPNA 2X3XD 5IHKA 1EFNA 3TSZA 2K2MA 3SEMA 1AEYA 1GCPA 1MV0B 1UHCA 1ZSGA 4K11A 3I9QA 1K0XA 1G2BA 1WXTA 1OEBA 2DL7A 1BK2A 2H8HA 2RQWA 3O5ZA 1SHGA 2C0OA 3KFVA 1W70A 3M0QA 1M3BA 3VS6A 3JV3A 2X3WD 1ZBJA 1IO6A 1X6GA 3CQTA 2K7AA 4RTWA 1HJDA 2MCNA 2K9GA 3QWYA 1W1FA 2O2OA 1SRMA 3REBB 2RQUA 2K79A 3UA7A 2KXCA 2F2WA 3VS3A 2RNAA 1WXBA 3QWXX 1QKWA 1QKXA 1UG1A 1YWOA 2CDTA 2RQRA 1T0JA 1SEMA 2EYYA 5IHIA 2F2XA 2AK5A 1Y0MA 3H0IA 4J9CA 2YUNA 2L0AA 1Z9QA 1X43A 4OMQA 1M3AA 2O88A 1CKAA 2D8JA 1JEGA 1I1JA 2FO0A 2KGTA 2AKKA 4HVVA 2EYWA 2EPDA 3VS7A 2J7IA 3EHRA 4CC3A 3ZL7C 2D0NA 1ABOA 2ED0A 1V1CA 2KBTA 4OMMA 4RTXA 4HCKA 2DM1A 1T3LA 1U06A 1UJ0A 3I5SA 1B3QA 1WFWA 2AKLA 2K6DA 3NHNA 4OMPA 1UHFA 2M0YA 1UUEA 2I0NA 1ARKA 2JS2A 2QDLA 2GBQA 1AVZC 2W10A 4DEXA 2XMFA 3IQLA 2KRNA 1M27C 2J05A 1QCFA 1M3CA 1NLPC 2C0IA 2D8HA 5IH2A 2DRMA 1WDXA 1JXOA 1XOVA 2A36A 4LUDA 1JXMA 2JW4A 4JZ4A 5FW9A 3FJ5A 1X27A 3I5RA 1QLYA 3EG2A 1GFDA 1E6HA 4AFUC 2GTJA 1J3TA 3UF4A 2EKHA 2A37A 2CSQA 1G83A 3R6NA 2DL5A 1X6BA 4GBQA 2SEMA 2LZ6B 1ZX6A 1GRIA 1FYNA 1K9AA 2EQIA 2JM9A 2RQVA 2FPDA 3PVQA 1AZEA 4HVWA 1PNJA 1HSQA 1NLOC 1H8KA 1UGVA 1SSHA 2FRYA 2GTOA 1YP5A 1OOTA 2JMAA 1NM7A 2OI3A 1I0CA 2NWMA 2CSIA 4JJBA 4A63B 2AZSA 2DMOA 1RUWA 2HDAA 3EGUA 1K1ZA 1WLPB 2NUZA 1GBQA 3LH5A 4RTZA 2A28A 2O9VA 2DX1A 2L3QA 2YSQA 2LMJA 3VRZA 2JXBA 1VA7A 4EIKA 1Y57A 2E5KA 3GBQA 1YNZA 1UE9A 2ECZA 4JJCA 4LN2A 2EYXA 2DE0X 2LCSA 4OMNA 1JU5C 3VS1A 2LJ0A 1SHFA 2EGCA 5EC7A 3SHWA 2DRKA 4RTUA 2CH4A 3PVLA 2K3BA 2LQWA 2G6FX 2FG0A 5I11A 2DL4A 2V1RA 3VS0A 3M0TA 3H0HA 1BB9A 2ROTA 2ROLA 1BBZA 3M0RA 3M0UA 1T3SA 5IXFA 1ZUKA 1AOJA 1YN8A 2LJ3A 1JQQA 1CKBA 2EGAA 2V1QA 2ABLA 1U3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I07 A;  4KRT A;  1UEC A;  4F14 A;  4Y92 A;  1QWF A;  3M0S A;  5IXB A;  2DNU A;  3VS4 A;  3UA6 A;  4ORZ A;  2IIM A;  4RTY A;  2DA9 A;  5FWC A;  4F16 A;  1H92 A;  4CC4 B;  2GGR A;  3TVT A;  1WYX A;  4D8D A;  1U5S A;  3I35 A;  1CSK A;  4AFZ C;  2DF6 A;  5I22 A;  5GJV B;  1YCS B;  4J9B A;  2CT4 A;  2OJ2 A;  1B07 A;  2GNC A;  2CUB A;  2CRE A;  4JJD A;  1QWE A;  2VKN A;  4IIM A;  1PKT A;  2O31 A;  2LQN A;  1X2Q A;  1TUD A;  2P4R A;  1S1N A;  4E6R A;  1N5Z A;  2YUO A;  1AZG B;  2DL8 A;  1X69 A;  1KFZ A;  2YDL A;  3EG1 A;  3H0F A;  2J06 A;  1PKS A;  1GFC A;  3PE0 A;  2EW3 A;  2YUQ A;  1GCQ C;  2KR3 A;  2KYB A;  5ECA A;  4DEY A;  2RMO A;  4RTT A;  3UAT A;  3RBB B;  2MOX A;  2W0Z A;  2DIL A;  2LX7 A;  1PRM C;  2LJ1 A;  4JPB W;  2KE9 A;  1VYV A;  1VYT A;  1UTI A;  1SPK A;  1WIE A;  2CT3 A;  2BZX A;  2C0T A;  4OMO A;  2DLP A;  1ZLM A;  1ZUU A;  2DBM A;  1MV3 A;  2JS0 A;  2EVR A;  1NYF A;  3M0P A;  2M51 A;  4CC2 A;  2PZ1 A;  2ESW A;  2KRO A;  2L3S A;  2FPF A;  1A0N B;  1K0S A;  2AZV A;  4ESR A;  2KRM A;  4LE9 A;  2YUP A;  3EHQ A;  1KSW A;  1K4U S;  1PHT A;  1TUC A;  2GQI A;  1FMK A;  1UDL A;  1UJY A;  2DBK A;  1WXU A;  1WA7 A;  2MIO A;  2HEQ A;  4Z88 A;  1AD5 A;  3U23 A;  1OPK A;  2L2P A;  5FWB A;  4J9D A;  2JMC A;  4HVU A;  4J9E A;  2BZY A;  1AWW A;  1AWO A;  4R0K A;  2DYB A;  1OPL A;  1T0H A;  1SRL A;  1NEG A;  2B86 A;  2YT6 A;  2DJQ A;  2SRC A;  4AFS C;  2KYM A;  2HCK A;  3VS5 A;  2OAW A;  3NPF A;  1ABQ A;  1GCQ A;  4J9F A;  1MUZ A;  3H41 A;  1KJW A;  4LUE A;  1TG0 A;  2KXD A;  3C0C A;  2VVK A;  1UFF A;  2KEA A;  2RN8 A;  2O9S A;  4RTV A;  4CC7 A;  2FRW A;  4Z89 A;  1HD3 A;  1NEB A;  2L3P A;  5IHN A;  1NYG A;  2D1X A;  2HSP A;  1PWT A;  4ZNX A;  5HCK A;  4IIO A;  2EGE A;  1X2K A;  4QT7 A;  4LNP A;  1AWX A;  3VS2 A;  2RQT A;  2EBP A;  1W6X A;  1H3H A;  1Z9Z A;  1BU1 A;  2JT4 A;  2FPE A;  1E7O A;  4AFQ C;  3TSW A;  1GL5 A;  1JO8 A;  1NG2 A;  2KRS A;  3NMZ C;  4AG1 C;  1K76 A;  2J6F A;  1OV3 A;  2BZ8 A;  1M30 A;  2RF0 A;  2DL3 A;  1LCK A;  1RLQ C;  4WCI A;  1RLP C;  1RI9 A;  1GBR A;  2A08 A;  2ED1 A;  2VWF A;  3EG0 A;  4HXJ A;  2ENM A;  3VRY A;  1ZUY A;  4J9H A;  5GJW B;  4OML A;  2JM8 A;  2KT8 A;  4J9G A;  2J6O A;  4D8K A;  4M4Z A;  4J9I A;  1E6G A;  5L23 A;  2KNB B;  3THK A;  2JTE A;  1WI7 A;  1AWJ A;  4Z8A A;  4F17 A;  2J6K A;  4X1V A;  2DVJ A;  2FEI A;  2PNI A;  2KT1 A;  2HBW A;  2BTT A;  1PRL C;  2F2V A;  1YWP A;  2CH4 W;  2EYZ A;  2LNH B;  2LP5 A;  3EG3 A;  4GLM A;  2CUD A;  4RUG A;  3REA B;  1WX6 A;  4FSS A;  3NGP A;  3A98 A;  1KIK A;  3ULR B;  3RNJ A;  4AG2 C;  1VYU A;  4JZ3 A;  1M8M A;  2PTK A;  2RPN A;  2X3X D;  5IHK A;  1EFN A;  3TSZ A;  2K2M A;  3SEM A;  1AEY A;  1GCP A;  1MV0 B;  1UHC A;  1ZSG A;  4K11 A;  3I9Q A;  1K0X A;  1G2B A;  1WXT A;  1OEB A;  2DL7 A;  1BK2 A;  2H8H A;  2RQW A;  3O5Z A;  1SHG A;  2C0O A;  3KFV A;  1W70 A;  3M0Q A;  1M3B A;  3VS6 A;  3JV3 A;  2X3W D;  1ZBJ A;  1IO6 A;  1X6G A;  3CQT A;  2K7A A;  4RTW A;  1HJD A;  2MCN A;  2K9G A;  3QWY A;  1W1F A;  2O2O A;  1SRM A;  3REB B;  2RQU A;  2K79 A;  3UA7 A;  2KXC A;  2F2W A;  3VS3 A;  2RNA A;  1WXB A;  3QWX X;  1QKW A;  1QKX A;  1UG1 A;  1YWO A;  2CDT A;  2RQR A;  1T0J A;  1SEM A;  2EYY A;  5IHI A;  2F2X A;  2AK5 A;  1Y0M A;  3H0I A;  4J9C A;  2YUN A;  2L0A A;  1Z9Q A;  1X43 A;  4OMQ A;  1M3A A;  2O88 A;  1CKA A;  2D8J A;  1JEG A;  1I1J A;  2FO0 A;  2KGT A;  2AKK A;  4HVV A;  2EYW A;  2EPD A;  3VS7 A;  2J7I A;  3EHR A;  4CC3 A;  3ZL7 C;  2D0N A;  1ABO A;  2ED0 A;  1V1C A;  2KBT A;  4OMM A;  4RTX A;  4HCK A;  2DM1 A;  1T3L A;  1U06 A;  1UJ0 A;  3I5S A;  1B3Q A;  1WFW A;  2AKL A;  2K6D A;  3NHN A;  4OMP A;  1UHF A;  2M0Y A;  1UUE A;  2I0N A;  1ARK A;  2JS2 A;  2QDL A;  2GBQ A;  1AVZ C;  2W10 A;  4DEX A;  2XMF A;  3IQL A;  2KRN A;  1M27 C;  2J05 A;  1QCF A;  1M3C A;  1NLP C;  2C0I A;  2D8H A;  5IH2 A;  2DRM A;  1WDX A;  1JXO A;  1XOV A;  2A36 A;  4LUD A;  1JXM A;  2JW4 A;  4JZ4 A;  5FW9 A;  3FJ5 A;  1X27 A;  3I5R A;  1QLY A;  3EG2 A;  1GFD A;  1E6H A;  4AFU C;  2GTJ A;  1J3T A;  3UF4 A;  2EKH A;  2A37 A;  2CSQ A;  1G83 A;  3R6N A;  2DL5 A;  1X6B A;  4GBQ A;  2SEM A;  2LZ6 B;  1ZX6 A;  1GRI A;  1FYN A;  1K9A A;  2EQI A;  2JM9 A;  2RQV A;  2FPD A;  3PVQ A;  1AZE A;  4HVW A;  1PNJ A;  1HSQ A;  1NLO C;  1H8K A;  1UGV A;  1SSH A;  2FRY A;  2GTO A;  1YP5 A;  1OOT A;  2JMA A;  1NM7 A;  2OI3 A;  1I0C A;  2NWM A;  2CSI A;  4JJB A;  4A63 B;  2AZS A;  2DMO A;  1RUW A;  2HDA A;  3EGU A;  1K1Z A;  1WLP B;  2NUZ A;  1GBQ A;  3LH5 A;  4RTZ A;  2A28 A;  2O9V A;  2DX1 A;  2L3Q A;  2YSQ A;  2LMJ A;  3VRZ A;  2JXB A;  1VA7 A;  4EIK A;  1Y57 A;  2E5K A;  3GBQ A;  1YNZ A;  1UE9 A;  2ECZ A;  4JJC A;  4LN2 A;  2EYX A;  2DE0 X;  2LCS A;  4OMN A;  1JU5 C;  3VS1 A;  2LJ0 A;  1SHF A;  2EGC A;  5EC7 A;  3SHW A;  2DRK A;  4RTU A;  2CH4 A;  3PVL A;  2K3B A;  2LQW A;  2G6F X;  2FG0 A;  5I11 A;  2DL4 A;  2V1R A;  3VS0 A;  3M0T A;  3H0H A;  1BB9 A;  2ROT A;  2ROL A;  1BBZ A;  3M0R A;  3M0U A;  1T3S A;  5IXF A;  1ZUK A;  1AOJ A;  1YN8 A;  2LJ3 A;  1JQQ A;  1CKB A;  2EGA A;  2V1Q A;  2ABL A;  1U3O A; 
#chains in the Genus database with same CATH topology
 4M75 A;  1I07 A;  1M90 U;  3CMA A;  1QWF A;  1VQN T;  3M0S A;  5IXB A;  4C0D C;  1IGU A;  4JDS A;  1RAF B;  5LJ5 j;  4E7S A;  1Q82 R;  1H92 A;  3MP8 A;  4CC4 B;  3TVT A;  1NPP A;  4BI8 B;  4D8D A;  1U5S A;  4C0Z A;  1CSK A;  2DF6 A;  2QYZ A;  2O4X B;  1JB0 E;  1XTD A;  2QA4 Q;  1TUD A;  1W4S A;  1AZG B;  1Q81 C;  4JJN K;  4RCC A;  4FSX A;  2YDL A;  3H0F A;  1QW1 A;  4PJM A;  2Y90 A;  3CCS Q;  2YUQ A;  2RHU A;  4DEY A;  1YJN A;  1G3Y A;  3M4G A;  3UAT A;  1Q86 C;  3RBB B;  2ZPG B;  4EMG A;  2MOX A;  3SD4 A;  2R57 A;  1OI1 A;  1PD0 A;  1ZSZ A;  1VYV A;  1WHJ A;  1FXX A;  2CT3 A;  2BZX A;  2C0T A;  1ZLM A;  4OGE A;  3CD6 T;  4C92 G;  2DBM A;  2JS0 A;  2EVR A;  1KG1 A;  4EMK C;  2DPP B;  2IPO B;  4CC2 A;  2PZ1 A;  2L3S A;  3EFS A;  2AT1 B;  1K0S A;  2EQK A;  4LE9 A;  2YUP A;  1BYM A;  1YIT Q;  1KSW A;  3KBG A;  3L2V A;  4M7A E;  1UJY A;  1WA7 A;  1R8O B;  1V29 B;  1Q81 R;  1AD5 A;  4M75 B;  2MYS A;  2L2P A;  5FWB A;  3OYK A;  4PJN A;  4HVU A;  4C92 A;  3VYH B;  3G71 Q;  1Q86 U;  3M56 A;  4XAX B;  2YHT A;  1AWW A;  4RCB A;  4B9W A;  1M2V A;  4R0K A;  3SWN B;  1YJ9 Q;  2DYB A;  1OPL A;  2FL7 A;  4DBH A;  4ME7 A;  5CO7 A;  4BUG A;  4ZTJ A;  2B86 A;  2DJQ A;  2KQW A;  4OVA A;  2SRC A;  2HKQ B;  4M78 G;  3NPF A;  3X26 B;  4J9F A;  2DTO A;  4RKU E;  1IHV A;  1KJW A;  4IUQ A;  3C0C A;  4LDV A;  3EGX B;  2RJC A;  4ZN3 A;  4RTV A;  4CC7 A;  3N5B B;  1U1S A;  3CME T;  4VUB A;  1HD3 A;  1W2B A;  1NEB A;  2D1X A;  3GF5 A;  5GMK l;  2HSP A;  4ZNX A;  1X2K A;  4QT7 A;  5D6X A;  2NLU A;  1KHI A;  3P8D A;  1Z9Z A;  3OYE A;  2EJF A;  3JCM J;  2FPE A;  3JCM d;  3EGD A;  1WQ7 A;  4C0F A;  1GL5 A;  4V2S A;  1VQ8 Q;  1LVK A;  2J6F A;  5LL6 S;  1M30 A;  2RF0 A;  6AT1 B;  2QG9 B;  3M57 A;  4UC4 A;  2RHI A;  1QCO A;  2GFA A;  3BE3 A;  4XK8 E;  2A7Y A;  3VRY A;  3G1J A;  4J9H A;  4OB1 B;  1NBE B;  2E4H A;  4OML A;  2GCX A;  4J9G A;  3HKS A;  2QQS A;  4C0G A;  1WI7 A;  4KUD K;  4Z8A A;  1R77 A;  2P0K A;  3CCL T;  2CP2 A;  2J6K A;  4WTO B;  2DVJ A;  2FEI A;  2KK4 A;  2KT1 A;  2RJD A;  2HBW A;  1I81 A;  2BTT A;  1GXI E;  1PRL C;  2CZ7 B;  1N8R U;  2CH4 W;  3EG3 A;  2C06 A;  4C5H A;  3NGP A;  1PM3 A;  1KIK A;  4KGV B;  3ULR B;  3RNJ A;  4EMK A;  3L1A A;  1VYU A;  4L5G A;  1M8M A;  3E9G A;  2X3X D;  3CCS A;  3OYY A;  2VC8 A;  2HZY A;  2HKN A;  1MV0 B;  5C0M A;  4XTW A;  3JCM W;  1LOJ A;  2E10 A;  1WXT A;  1OEB A;  3RMQ A;  1LPL A;  1WHG A;  1YIT T;  1ZSZ B;  1BI1 A;  3ASK A;  1ZBJ A;  4J7F A;  3LH0 A;  1VQ7 Q;  4TVR A;  4PJO B;  3M9Q A;  3PIP A;  1SRM A;  3HHT B;  2X51 A;  4M7A B;  3OYL A;  3UA7 A;  3AHU A;  2DD5 A;  1YI2 Q;  2LC4 A;  1WXB A;  3QWX X;  1QKX A;  2D6F A;  3GNG A;  3L2R A;  1M1K C;  2RQR A;  1T0J A;  3VKI A;  2EYY A;  3L2U A;  3FLG A;  1D1B A;  2F2X A;  1Y0M A;  3OMG A;  2YUN A;  3JCM h;  4M7A G;  1C0M A;  4C92 C;  1JEG A;  1CKA A;  1RAC B;  2D8J A;  2FO0 A;  1MMG A;  2OX7 A;  4FCY A;  4HVV A;  2EPD A;  3A8G B;  3VS7 A;  5IAY A;  1FMW A;  4BE2 A;  2LQK A;  2R5M A;  2ED0 A;  3M55 A;  2IVW A;  1RAH B;  4HCK A;  5GMK j;  2DM1 A;  4J7I A;  5KYW B;  2QXF A;  1IRX A;  4KBM B;  2VYT A;  4MZT A;  3P8B B;  1WFW A;  3RIR A;  5GMK m;  2COZ A;  3E9F A;  2I0N A;  4ANJ A;  2JS2 A;  2GBQ A;  3OYI A;  2GQV A;  2W10 A;  1YJN Q;  2DKG A;  2XMF A;  5KH6 A;  1PG5 B;  4QKU A;  2MMP A;  4DBQ A;  1QCF A;  2C0I A;  2V8J A;  1X6O A;  3G4S Q;  2DRM A;  1WDX A;  1YJW T;  1YI2 T;  1JXO A;  5KYX B;  3CMA Q;  3CC4 T;  4LUD A;  4JZ4 A;  3G4S A;  1QLY A;  3CPW A;  3EG2 A;  1M4Z A;  3MP1 A;  1WPY A;  1G3S A;  4AFU C;  5IT9 E;  1J3T A;  2QTX A;  1SKU B;  1IGQ A;  2QI2 A;  2A37 A;  2VAS A;  2CSQ A;  5GAN 2;  2SEM A;  2NYS A;  4C8Q A;  1ZX6 A;  1K9A A;  2BE9 B;  2FPD A;  3PVQ A;  1UGV A;  3X28 B;  1SSH A;  3GNF B;  2FRY A;  4Q5W A;  4KUI A;  1OZ2 A;  1Q81 U;  2F5K A;  2OI3 A;  3EH2 A;  2EYQ A;  4JJB A;  4A63 B;  1BI3 A;  2AZS A;  2K5L A;  5LJ3 d;  3EGU A;  4PJJ A;  2DXT A;  1K1Z A;  1WLP B;  5DLO A;  1U8R A;  4A4F A;  4PJO C;  3JB9 H;  2DX1 A;  1QVG P;  2YSQ A;  1JJ2 S;  2JXB A;  4M7A F;  2E6Z A;  3PMT A;  4OMF B;  4A4K A;  2ECZ A;  4F7U B;  3JCM e;  1UB4 A;  2KDS A;  4LN2 A;  2EYX A;  2LCS A;  2MPX C;  5CQX A;  3LYI A;  4FT4 A;  2EGC A;  2CS7 A;  4M75 G;  5EC7 A;  3SHW A;  4C92 D;  2CZ1 B;  3DLL A;  2YLB A;  2LCC A;  4M75 E;  2G6F X;  1OX8 A;  5I11 A;  1VQ7 A;  4F7U G;  3CC4 A;  3SWN C;  1BIA A;  3VS0 A;  1K9M R;  1YI2 A;  2DAQ A;  4PFZ A;  1C1A A;  4ZTF A;  3H0H A;  2WAC A;  2E70 A;  3M58 A;  5J39 A;  1BB9 A;  2ROT A;  1W2B P;  4NS5 A;  3JB9 G;  1PC0 A;  3C4S A;  4MZM A;  3M0R A;  1ZUK A;  2RK2 A;  1XJW B;  1Q7Y C;  3WVE B;  1V76 A;  1CKB A;  2RM4 A;  4NL3 A;  1AT1 B;  2WSC E;  2YRD A;  2ABL A;  4DQ2 A;  3MCA B;  4F14 A;  1VQL Q;  5KYN A;  4A4G A;  1VUB A;  4ORZ A;  4OP0 A;  4P5N A;  5KYU A;  4OB2 B;  1TTH B;  2DEQ A;  1KD1 U;  2E6N A;  2RA2 A;  1IRE B;  5I22 A;  1BKB A;  1VQO Q;  2JOY A;  3LX7 A;  1YCS B;  4DOV A;  4ZN1 A;  1TU0 B;  2GNC A;  1M2O A;  3CC4 Q;  4FT2 A;  3EFO B;  3CMA T;  4JJD A;  2O31 A;  5GAM d;  1K8A U;  2P4R A;  2YUO A;  2EIF A;  2F69 A;  2RHX A;  3GOX A;  3VV0 A;  3CC2 A;  2F1L A;  2LQ8 A;  1RAB B;  3EG1 A;  1X01 A;  2QEX A;  5GAN 5;  4J83 A;  3QDF A;  3L2Q A;  2EW3 A;  2KYB A;  4BI3 A;  4C5G A;  4IUU A;  4LDY A;  1D0X A;  4PLL A;  2DIL A;  3H9N A;  2LT4 A;  1ZA2 B;  1DJ7 B;  5GAN 6;  4M7D G;  4M77 G;  2XIC A;  3CCM A;  2HMA A;  4PFP A;  2ZPB B;  2DLP A;  4PLI A;  2DIQ A;  1NYF A;  4ELZ C;  2ESW A;  2KRO A;  5M9O A;  5LJ3 f;  2FPF A;  2LCL A;  5GAO l;  1A0N B;  2H3E B;  2KRM A;  1VQO A;  1KD1 R;  3CXC P;  1RAI B;  1RI0 A;  3RR6 A;  2JVV A;  1VQ6 A;  5J26 A;  2YXY A;  4X34 A;  3JCM V;  5D7U A;  3U23 A;  1VOM A;  4J9D A;  3EGD B;  5KYY A;  2E65 A;  4E7Z A;  4J9E A;  1YJ9 A;  1Q7Y U;  1AWO A;  3EG9 B;  1D09 B;  1UGQ B;  5GAO q;  4X9C A;  1WQW A;  4PL6 A;  2HD0 A;  1NEG A;  4M7D E;  3O8V A;  1OZ3 A;  1M90 C;  3CPW P;  4M7D F;  3X20 B;  2HCK A;  2LT1 A;  3OYH A;  3VS5 A;  1GCQ A;  1ZBX A;  3CCJ A;  3CCL A;  3H41 A;  4PJO D;  3DKM A;  3MEU A;  2VVK A;  1UFF A;  4C92 F;  1MGQ A;  5GAN 3;  3GIB A;  3RMS A;  3OB9 A;  2KMT A;  1XNI A;  1PWT A;  1Y71 A;  3PT9 A;  3CCE Q;  1TH7 A;  4RG2 A;  2EGE A;  1M1F A;  1G3W A;  4LNP A;  3VS2 A;  3X25 B;  2DVE A;  1EX4 A;  1VQM T;  1B34 B;  2JT4 A;  1SF9 A;  1E7O A;  4C8Q D;  4AFQ C;  1JO8 A;  2G3R A;  4ZGE B;  2B8A A;  1PD1 A;  4MMK A;  1NG2 A;  1OU8 A;  3NMZ C;  3VU3 C;  2Z0W A;  3G71 A;  1K73 R;  2E5Q A;  4J6X A;  1VQL A;  1RLQ C;  1YJW Q;  1GBR A;  1RAD B;  3EG0 A;  4XTX A;  2ENM A;  4C8Q B;  3NTI A;  5GJW B;  4J6W A;  2KT8 A;  4D8K A;  1WNL A;  2J6O A;  2RH2 A;  3URG A;  2CZ6 B;  3M4Y A;  2KNB B;  4FYW B;  3THK A;  5GAM h;  2QTV A;  3BW1 A;  1AWJ A;  3CCJ T;  4X1V A;  2DXU A;  2HQX A;  2HQH A;  3CCJ Q;  3JAM E;  1QVF S;  2F2V A;  3SDZ A;  3LGL A;  4BE0 A;  4MZP A;  2VXE A;  2LP5 A;  1Y96 A;  4GLM A;  3JB9 F;  3A98 A;  2K3Y A;  1N6A A;  2M16 A;  1Q7Y R;  3EFR A;  4JZ3 A;  4HT8 A;  3QUI A;  4M7D D;  2YRC A;  3SEM A;  1AEY A;  4IUP A;  4IUR A;  3OSV A;  3S3M A;  3G6E T;  2DL7 A;  3JCM P;  3CBM A;  1SHG A;  4M77 D;  3M0Q A;  3JV3 A;  2X35 A;  3CQT A;  1KQS A;  1VQK A;  3RKX A;  2X4J A;  4N4H A;  4FL6 A;  1YIT A;  1LJO A;  8AT1 B;  2K9G A;  3RDV A;  3RER A;  5GAO m;  1I8F A;  2KXC A;  5GAO r;  1KQS P;  2P0Q A;  2RI2 A;  1PSF A;  2QEX T;  5KCH A;  5CCA A;  3CCQ T;  3CC2 T;  4BDZ A;  1YWO A;  4FIB A;  2CDT A;  4N4G A;  4NOY A;  5J3B A;  1VQ8 T;  4M7D C;  2AK5 A;  4KH1 B;  4BDY A;  4J9C A;  1Z9Q A;  3TCJ A;  5KYU B;  3TEE A;  2QK0 A;  4OMQ A;  1M3A A;  2QA4 T;  4GLK A;  5KE3 A;  4N4I A;  2O88 A;  4FM4 B;  2KGT A;  2AKK A;  1OU9 A;  2EYW A;  3EHR A;  4CC3 A;  3ZL7 C;  2D0N A;  1Y07 A;  5GAN 7;  4OMM A;  2VUB A;  4C92 B;  1U06 A;  1UJ0 A;  1H3Z A;  1I5L A;  4PFO A;  3JB9 D;  3PIO A;  3JRZ A;  4QVC A;  4OMP A;  2M0Y A;  1IZ6 A;  1MNE A;  1ARK A;  2PVD B;  1AVZ C;  4HKE A;  3IQL A;  4RG8 A;  1M27 C;  3UPU A;  3FB9 A;  1EIF A;  2D8H A;  2IG0 A;  2MI6 A;  2OTJ Q;  5GAN f;  2JN0 A;  4OB0 B;  2K5I A;  5KYY B;  2CYZ B;  2X4W A;  1HXD A;  1JXM A;  1ZSZ C;  5CVI A;  1X27 A;  3I5R A;  2E1H A;  4J6Y A;  1VIE A;  3RES A;  2M9U A;  2RHY A;  2DTI A;  4PJO A;  3HPW A;  3UF4 A;  2NUT A;  1VQM Q;  1KHC A;  1G83 A;  3R6N A;  5HK0 A;  4HCZ A;  1X6B A;  5FRM A;  3X24 B;  3QHS A;  1D3B B;  2LZ6 B;  1GRI A;  2JM9 A;  2EQI A;  5A0L A;  2RB6 A;  1OYX A;  1QQJ A;  3RKW A;  1NLO C;  5GAN j;  4LD9 K;  1D0Z A;  1HYO A;  1N9R A;  1YP5 A;  1OOT A;  3J80 E;  2JMA A;  2YRV A;  3E2U A;  2CSI A;  2A3L A;  3UDC A;  2DMO A;  5D6W A;  1RUW A;  4EMK B;  4A54 A;  2NUZ A;  3J81 E;  3PMI A;  2LNV A;  2A28 A;  2O9V A;  1TUG B;  3OW2 A;  3DB4 A;  4BE1 A;  2A0F B;  4IUT A;  3VRZ A;  2HSE B;  5GAM j;  4EIK A;  1OUL A;  1YJW A;  2E5K A;  1U1T A;  2DEU A;  5CKH A;  4BY6 C;  4M77 E;  2KSS A;  2OTJ T;  4IUV A;  2AIR B;  4LXC A;  2FVU A;  1HK9 A;  4GY5 A;  3CCM Q;  2GFU A;  1TXQ A;  2DRK A;  1KD1 C;  3M54 A;  2ZZD A;  2QAZ A;  2CP7 A;  2FG0 A;  2ZCF B;  2PU9 B;  3M0T A;  1MMA A;  2ZAE A;  4M75 F;  1YJN T;  4QQ6 A;  1BBZ A;  1OQK A;  5FRO A;  3M0U A;  5IXF A;  2ZPE B;  8ATC B;  3OS1 A;  1Y7X A;  5DM7 R;  2JTM A;  5FU7 B;  1UEC A;  4HA8 A;  4E7J A;  2MK5 A;  4Y92 A;  5CK9 A;  1BI2 A;  2FZG B;  4QVD A;  2DNU A;  3QG1 A;  1VQ8 A;  5GAN e;  2IIM A;  1NPR A;  4M78 E;  4Z02 A;  4MDW A;  4QVZ A;  2JTF A;  1AHJ B;  4JRK A;  5GAN g;  1WHM A;  5GAM g;  5FWC A;  4KH0 B;  3FC3 A;  1WYX A;  4ZGD B;  5GAM e;  5LJ5 f;  4ELY C;  4BD3 A;  1QCN A;  2ZPF B;  1K9M C;  3KXT A;  4F7U F;  3JCM X;  3JCM c;  3OYD A;  2EWN A;  5GJV B;  1FX7 A;  4J9B A;  3WVD B;  3TRE A;  4A53 A;  3CCM T;  1QWE A;  2VKN A;  1PKT A;  1X2Q A;  3OW2 S;  1M1G A;  4E6R A;  1N5Z A;  1VQ5 T;  2ZPH B;  1SG5 A;  1RAG B;  4FW2 A;  3V7C A;  5ECA A;  2KR3 A;  4XU3 A;  2RMO A;  4RTT A;  5LJ3 h;  3CCS T;  1S72 T;  2W0Z A;  2XU8 A;  2JNG A;  2LX7 A;  1PRM C;  2R5A A;  2LJ1 A;  1K73 U;  4JPB W;  3T9N A;  2KE9 A;  1VYT A;  1VQ9 Q;  1UTI A;  3DB3 A;  1SPK A;  1WIE A;  3I55 A;  3CME Q;  5A2Q E;  1JJ2 P;  4BY6 B;  2QQB A;  3VYG A;  1ZUU A;  1P92 A;  1MV3 A;  1VQ9 T;  2KY9 A;  2D0Q B;  3A8M B;  4IKF A;  1O9S A;  2DET A;  2XID A;  4J8O A;  2M02 A;  4ESR A;  5I21 A;  2XI9 A;  3EG9 A;  1K8A C;  3OY9 A;  1PHT A;  2GQI A;  1FMK A;  1UDL A;  2XKO C;  1WXU A;  2MIO A;  4OGC A;  3LLR A;  4O6J A;  2HEQ A;  4Z88 A;  1QVF A;  3L2W A;  1OPK A;  3TQ7 P;  2JMC A;  2HQE A;  1NE8 A;  2BZY A;  2EQM A;  3OYN A;  2GF7 A;  2COW A;  1T0H A;  3G71 T;  2YT6 A;  2O4X A;  4AFS C;  3HRS A;  2OAW A;  1ABQ A;  4LUE A;  2KXD A;  2DFU A;  1TS9 A;  4N0A A;  1VQK Q;  1VQM A;  5GAN h;  2O9S A;  1RL2 A;  3FEO A;  1G3T A;  2L3P A;  1NYG A;  2ATC B;  4ZGJ B;  1R0B G;  3QDR B;  5DY9 A;  1M1K R;  2K4Y A;  3CME A;  2HAX A;  4AMC A;  1AWX A;  2L5Q A;  3OBW A;  2EBP A;  2DYI A;  2L3R A;  5GAM f;  2QDY B;  4M77 A;  2OTJ A;  3TSW A;  2EQJ A;  1N9S A;  1K76 A;  3C12 A;  2BZ8 A;  3OYA A;  2WSE E;  2RJE A;  2AHJ B;  2DL3 A;  4E2F B;  3QKJ A;  1RLP C;  1RI9 A;  4HXJ A;  5GMK h;  3MPU B;  3HRT A;  3CC7 Q;  2JM8 A;  2MF2 A;  4M4Z A;  4J9I A;  1E6G A;  5L23 A;  4KGX B;  3SFM A;  2JUF A;  4E7I A;  4F17 A;  4E47 A;  1WJQ A;  2EKO A;  1RAE B;  4JRI A;  1VQO T;  2PNI A;  2EYZ A;  3QPH A;  1ZA1 B;  3MKD A;  1TOV A;  3REA B;  3BDU A;  1KC8 C;  2OAU A;  1VQ4 A;  2RPN A;  2DXC A;  3AT1 B;  2K2M A;  5CKF A;  2PUK B;  3JCM Q;  2KVQ G;  1KQ2 A;  5KE2 A;  1UHC A;  4C92 E;  3ZEH A;  4K11 A;  4A4H A;  3OYG A;  1YIJ A;  4M78 B;  1G2B A;  4YTL A;  4JRP A;  2V8I A;  1BK2 A;  2H8H A;  1FWZ A;  3O5Z A;  2L8D A;  3KFV A;  4E7K A;  3HTR A;  2HL5 C;  4XU2 A;  1M3B A;  5CIU A;  3VS6 A;  1MMD A;  4CRI A;  1IO6 A;  4RTW A;  2K7A A;  1HJD A;  3QWY A;  1W1F A;  3V7R A;  2X9H A;  1Q95 G;  3REB B;  2RQU A;  3C94 A;  1OX9 A;  3I56 T;  3A8H B;  2CP6 A;  3VS3 A;  2LDM A;  1VQP Q;  3V7S A;  2ZGW A;  2CP5 A;  1KC8 R;  4CI0 C;  2NUP A;  1SEM A;  5IHI A;  2Y4Y A;  5GAN d;  1WHL A;  1M90 R;  3QYG B;  1KK7 A;  2DD4 A;  2L0A A;  1X43 A;  3FDR A;  2PVO B;  3KUF A;  3C95 A;  1I1J A;  4MDX A;  2J7I A;  4M77 B;  3CCQ A;  2XK0 A;  4HCB A;  3PTA A;  5GMK e;  1ABO A;  3CCQ Q;  4RTX A;  1V1C A;  2KBT A;  4XTV A;  2HL3 A;  1RAA B;  4M7D A;  2DK3 A;  4JLG A;  1B3Q A;  3UT1 A;  1VQN A;  3HFO A;  2AKL A;  3OMC A;  3NHN A;  3Q1J A;  1W2B S;  1UUE A;  1IHW A;  4BI4 A;  3GP8 A;  3HSB A;  1LNX A;  3S3N A;  1N8R C;  4DEX A;  2VV5 A;  3V8J A;  2KRN A;  1M3C A;  2EJG A;  1NLP C;  5IH2 A;  5LJ5 e;  3MET A;  4N0A C;  2COY A;  1UGR B;  1UGP B;  1VQP T;  1XOV A;  5KYW A;  2JW4 A;  2CKK A;  5GAN 8;  3CBP A;  3CCU A;  1PSE A;  2VGN A;  4F04 B;  2ZPI B;  5LJ3 e;  4C8Q E;  2GTJ A;  3I55 Q;  2BUD A;  1D0Y A;  4JS4 A;  4LDW A;  1Q86 R;  2VB6 A;  1NJI C;  5A0G A;  4GBQ A;  4C8Q C;  2MAM A;  4M77 F;  1FYN A;  4BB7 A;  1AZE A;  1G5V A;  1PNJ A;  3RKY A;  3CCV Q;  1JJ2 A;  1HSQ A;  2CZ0 B;  3HL8 A;  2NUP B;  1WZO A;  5KYX A;  3VJP A;  2FB7 A;  2RD1 A;  2QEX Q;  2NWM A;  1D3B A;  2K3X A;  1ACM B;  2RI3 A;  1VQ5 Q;  3SWN A;  4JUV A;  4EDU A;  1GBQ A;  5CAI A;  1VQL T;  1VQ6 Q;  1TWB A;  2YWW A;  4JLI A;  2L3Q A;  4M7A A;  4II1 A;  1QVP A;  1Y57 A;  4C8Q G;  1YNZ A;  1UE9 A;  3V8L A;  2PVG B;  4OMN A;  1JU5 C;  3I56 Q;  4M78 C;  1VQ9 A;  4M7D B;  3QJY A;  3VS1 A;  5LJ3 j;  3JB9 I;  1SHF A;  2P4T A;  1MMN A;  3ZBD A;  3I55 T;  3CD6 Q;  2R58 A;  3PVL A;  2CH4 A;  2RJF A;  1MND A;  4J5Y A;  2QGF B;  2LQW A;  3CCR A;  4PJL A;  1K9M U;  2QGG A;  5AYF A;  5FU6 B;  2K5F A;  2HBP A;  1KQS S;  2FZC B;  4Y91 A;  4DA4 A;  4L59 A;  3CPF A;  3QSU A;  2XG8 D;  3CCE A;  1X75 C;  3CCU Q;  2EGA A;  1B34 A;  1U3O A;  4KRT A;  5LJ5 h;  1YJ9 T;  2XDP A;  4ATO A;  3H6Z A;  1SSF A;  1YIJ Q;  5D6Y A;  3VS4 A;  4DBR A;  3UA6 A;  2V8K A;  3QZ5 B;  4RTY A;  3G7Z A;  2DA9 A;  3A5Z B;  1VQ6 T;  1K73 C;  4EMH A;  4RMO A;  4F16 A;  2GGR A;  3NFC A;  3PGG A;  3OS5 A;  2DIG A;  1Q82 U;  4FYY B;  1YFN A;  3I35 A;  4AFZ C;  1JBM A;  3FJP A;  1BCO A;  3OW2 P;  5A0D A;  2CT4 A;  2OJ2 A;  1B07 A;  2DJZ A;  2CUB A;  5FRN A;  3JB9 J;  2CRE A;  4IIM A;  2LQN A;  4QQG A;  4DOW A;  2E3H A;  3M5A A;  2XHC A;  1S1N A;  2DL8 A;  1X69 A;  1KFZ A;  3JCM g;  3OYB A;  3M53 A;  2J06 A;  1PKS A;  4KT0 E;  1GFC A;  3PE0 A;  3EFO A;  4FYX B;  3I56 A;  1GCQ C;  2PUO B;  3QJ6 A;  3OBY A;  3QYH B;  1YCY A;  2BKD N;  5CKE A;  4JRQ A;  4DBF A;  3CCR T;  2V26 A;  3MP6 A;  3QBY A;  4FU6 A;  4A4E A;  3OSS C;  4OMO A;  2E41 A;  1WHH A;  5GAO p;  1D1C A;  3M0P A;  2M51 A;  1YIJ T;  2XDD A;  3G6E Q;  2AZV A;  1G8X A;  3EHQ A;  1K4U S;  1TUC A;  4MML A;  2NUT B;  1KC8 U;  2DBK A;  2EAY A;  2EFI A;  5KCO A;  3SB2 A;  1VQ4 T;  3MHX A;  1BI0 A;  4LDU A;  2RK1 A;  4XU1 A;  3J7A F;  2F5T X;  2H3J A;  1VQ4 Q;  3L2Z A;  4AT1 B;  1YHQ Q;  2BE7 D;  1YHQ A;  1SRL A;  3CCV T;  3LGF A;  1WJS A;  4M75 D;  3OYF A;  5FU7 C;  2KYM A;  3GLX A;  3CPW S;  5CKB A;  1MUZ A;  4F7U E;  4FW1 A;  2OTL T;  2DXB A;  2X4Y A;  1TG0 A;  2KEA A;  2RN8 A;  1XQH A;  2LRQ A;  4KUL A;  1VQ7 T;  2FRW A;  3HFN A;  4Z89 A;  2KAF A;  1Q82 C;  3CCR Q;  3CCU T;  5IHN A;  5HKC A;  4E7L A;  4M78 D;  5HCK A;  3NTK A;  4IIO A;  3ZFJ A;  1O75 A;  3WXM B;  2RQT A;  1QVF P;  1W6X A;  1H3H A;  1BIB A;  3CXC S;  1BU1 A;  3JCM b;  2JZ2 A;  1ZQ1 A;  2KRS A;  4AG1 C;  2LTO A;  4M78 A;  1OV3 A;  1LCK A;  2EQU A;  2DTH A;  5CQY A;  4WCI A;  1YHQ T;  2A08 A;  2ED1 A;  2VWF A;  3EAE A;  3VUB A;  1ZUY A;  5EG2 A;  3HRU A;  4XQ3 A;  1F1B B;  1UEB A;  4XTY A;  2JTE A;  1WHK A;  2OTL A;  5HK3 A;  2OTL Q;  3HP9 A;  3ER0 A;  4Y28 E;  3RUX A;  3CCV A;  3MEV A;  4R55 A;  5GMK i;  2XDB A;  5I2M A;  1N8R R;  2E12 A;  1YWP A;  2LNH B;  1IB8 A;  4OF1 A;  4PNO A;  2QA4 A;  2CUD A;  4RUG A;  3CD6 A;  1WX6 A;  4FSS A;  5AT1 B;  3E1S A;  2YLC A;  4F7U A;  5FU6 C;  5HY6 A;  3CXC A;  2E3I A;  2M0O A;  3P8H A;  3OS0 A;  4AG2 C;  9ATC B;  3G4S T;  4R56 A;  4HT9 A;  4M7A C;  1WJR A;  2PTK A;  5IHK A;  1EFN A;  4E7H A;  3TU4 K;  3TSZ A;  1GCP A;  2BIV A;  4X9D A;  1ZSG A;  2KI7 A;  3I9Q A;  3JSC A;  1K0X A;  3BFM A;  2MWP A;  2RQW A;  1NJI R;  2C0O A;  2P0P A;  1W70 A;  3OYM A;  1Y96 B;  1VQK T;  2E64 A;  1M8V A;  2RO0 A;  2X3W D;  5IN1 A;  1X6G A;  1R0C B;  3FRN A;  3GPL A;  1H64 1;  2I2L A;  2MCN A;  1K8A R;  3S6W A;  2QAS A;  1FMV A;  1S72 A;  3ME9 A;  2O2O A;  3OA6 A;  1VQN Q;  1N27 A;  3G6E A;  4LD6 A;  2K79 A;  2VGM A;  5CR2 A;  2F2W A;  2DZ9 A;  2RNA A;  3OYC A;  3LWI A;  4NL2 A;  4WF2 A;  5LJ5 d;  1QKW A;  1UG1 A;  3F70 A;  2QQ9 A;  4M7A D;  3BY7 A;  3A8O B;  5GAN 4;  3H0I A;  4BAC A;  4PJO E;  3NTH A;  1KQ1 A;  5LJ5 g;  5I2S A;  1M2V B;  2L89 A;  2X4X A;  4M77 C;  2MWO A;  3CCE T;  3A1P A;  2QQR A;  3MO8 A;  1T3L A;  1TSF A;  2LX9 A;  3I5S A;  3QII A;  1ZHI A;  2O01 E;  3CC7 A;  1NJI U;  1MHN A;  3BDL A;  1QVG A;  3CEY A;  1I4K 1;  2K6D A;  4KGZ B;  1S72 Q;  1UHF A;  1PCX A;  1YBY A;  2CP0 A;  5FLX E;  4O5V A;  2QDL A;  1C6V X;  3OS2 A;  3MEA A;  2EJ9 A;  2FZK B;  1IXD A;  2FHD A;  2J05 A;  2M1H A;  3PFS A;  3CC2 Q;  3OYJ A;  1NZ9 A;  4XTZ A;  4C5I A;  1VIF A;  2JJ9 A;  3QO3 A;  4QW2 A;  2A36 A;  5FW9 A;  1QMC A;  4C8Q F;  3FJ5 A;  4HCC A;  3QZ9 B;  2CGH A;  3V8K A;  1GFD A;  3LWH A;  1E6H A;  3CCL Q;  2EKH A;  3LW5 E;  2LVM A;  2QQA A;  3R6O A;  4QQD A;  2DL5 A;  4PK4 A;  2P84 A;  4LDX A;  1JRI A;  4B9X A;  2RQV A;  4FYV B;  4HVW A;  4OB3 B;  3VUZ A;  2K57 A;  4PJO F;  1H8K A;  4EPC A;  2XD0 A;  2GTO A;  2K2V A;  3MJX A;  1NM7 A;  3H8Z A;  1I0C A;  3MEW A;  2RI5 A;  3UWN A;  3EH1 A;  4PJO G;  2HDA A;  3E19 A;  4M78 F;  1M1K U;  1EZZ B;  5DLQ E;  5GAO n;  3LH5 A;  4RTZ A;  4JS5 A;  2CP3 A;  3INZ A;  1B7T A;  7AT1 B;  3A8L B;  3D7S B;  2LMJ A;  2DZC A;  1VA7 A;  2DO3 A;  4C0D B;  2HNI A;  3GBQ A;  5C6S A;  4L6V 5;  1QP3 A;  3DLM A;  4JJC A;  3CBO A;  2DE0 X;  1QP2 A;  3EGX A;  4C5E A;  4M75 C;  1QVG S;  2Y4X A;  4B6M A;  3QXE B;  2LJ0 A;  1M5Q 1;  2WSF E;  2DER A;  4RTU A;  4XU0 A;  2K3B A;  3PNW C;  2RHZ A;  4PKC C;  2FYK A;  2DL4 A;  2V1R A;  5L8R E;  1VQP A;  3CC7 T;  3M59 A;  2PQW A;  1BCM A;  2ROL A;  4XTU A;  4D6W A;  1T3S A;  2VXF A;  1AOJ A;  1D1A A;  1YN8 A;  1M9S A;  1I5O B;  2LJ3 A;  1JQQ A;  1UGS B;  2D9T A;  1VQ5 A;  5CKD A;  3OQ5 A;  2V1Q A;  3FIF A;  5LJ3 g;  3L42 A;  3S3O A;  1WGS A;  3JCM f; 
#chains in the Genus database with same CATH homology
 1I07 A;  4KRT A;  1UEC A;  4F14 A;  4Y92 A;  1QWF A;  3M0S A;  5IXB A;  2DNU A;  3VS4 A;  3UA6 A;  4ORZ A;  2IIM A;  4RTY A;  2DA9 A;  5FWC A;  4F16 A;  1H92 A;  4CC4 B;  2GGR A;  3TVT A;  1WYX A;  4D8D A;  1U5S A;  3I35 A;  1CSK A;  4AFZ C;  2DF6 A;  5I22 A;  5GJV B;  1YCS B;  4J9B A;  2CT4 A;  2OJ2 A;  1B07 A;  2GNC A;  2CUB A;  2CRE A;  4JJD A;  1QWE A;  2VKN A;  4IIM A;  1PKT A;  2O31 A;  2LQN A;  1X2Q A;  1TUD A;  2P4R A;  1S1N A;  4E6R A;  1N5Z A;  2YUO A;  1AZG B;  2DL8 A;  1X69 A;  1KFZ A;  2YDL A;  3EG1 A;  3H0F A;  2J06 A;  1PKS A;  1GFC A;  3PE0 A;  2EW3 A;  2YUQ A;  1GCQ C;  2KR3 A;  2KYB A;  5ECA A;  4DEY A;  2RMO A;  4RTT A;  3UAT A;  3RBB B;  2MOX A;  2W0Z A;  2DIL A;  2LX7 A;  1PRM C;  2LJ1 A;  4JPB W;  2KE9 A;  1VYV A;  1VYT A;  1UTI A;  1SPK A;  1WIE A;  2CT3 A;  2BZX A;  2C0T A;  4OMO A;  2DLP A;  1ZLM A;  1ZUU A;  2DBM A;  1MV3 A;  2JS0 A;  2EVR A;  1NYF A;  3M0P A;  2M51 A;  4CC2 A;  2PZ1 A;  2ESW A;  2KRO A;  2L3S A;  2FPF A;  1A0N B;  1K0S A;  2AZV A;  4ESR A;  2KRM A;  4LE9 A;  2YUP A;  3EHQ A;  1KSW A;  1K4U S;  1PHT A;  1TUC A;  2GQI A;  1FMK A;  1UDL A;  1UJY A;  2DBK A;  1WXU A;  1WA7 A;  2MIO A;  2HEQ A;  4Z88 A;  1AD5 A;  3U23 A;  1OPK A;  2L2P A;  5FWB A;  4J9D A;  2JMC A;  4HVU A;  4J9E A;  2BZY A;  1AWW A;  1AWO A;  4R0K A;  2DYB A;  1OPL A;  1T0H A;  1SRL A;  1NEG A;  2B86 A;  2YT6 A;  2DJQ A;  2SRC A;  4AFS C;  2KYM A;  2HCK A;  3VS5 A;  2OAW A;  3NPF A;  1ABQ A;  1GCQ A;  4J9F A;  1MUZ A;  3H41 A;  1KJW A;  4LUE A;  1TG0 A;  2KXD A;  3C0C A;  2VVK A;  1UFF A;  2KEA A;  2RN8 A;  2O9S A;  4RTV A;  4CC7 A;  2FRW A;  4Z89 A;  1HD3 A;  1NEB A;  2L3P A;  5IHN A;  1NYG A;  2D1X A;  2HSP A;  1PWT A;  4ZNX A;  5HCK A;  4IIO A;  2EGE A;  1X2K A;  4QT7 A;  4LNP A;  1AWX A;  3VS2 A;  2RQT A;  2EBP A;  1W6X A;  1H3H A;  1Z9Z A;  1BU1 A;  2JT4 A;  2FPE A;  1E7O A;  4AFQ C;  3TSW A;  1GL5 A;  1JO8 A;  1NG2 A;  2KRS A;  3NMZ C;  4AG1 C;  1K76 A;  2J6F A;  1OV3 A;  2BZ8 A;  1M30 A;  2RF0 A;  2DL3 A;  1LCK A;  1RLQ C;  4WCI A;  1RLP C;  1RI9 A;  1GBR A;  2A08 A;  2ED1 A;  2VWF A;  3EG0 A;  4HXJ A;  2ENM A;  3VRY A;  1ZUY A;  4J9H A;  5GJW B;  4OML A;  2JM8 A;  2KT8 A;  4J9G A;  2J6O A;  4D8K A;  4M4Z A;  4J9I A;  1E6G A;  5L23 A;  2KNB B;  3THK A;  2JTE A;  1WI7 A;  1AWJ A;  4Z8A A;  4F17 A;  2J6K A;  4X1V A;  2DVJ A;  2FEI A;  2PNI A;  2KT1 A;  2HBW A;  2BTT A;  1PRL C;  2F2V A;  1YWP A;  2CH4 W;  2EYZ A;  2LNH B;  2LP5 A;  3EG3 A;  4GLM A;  2CUD A;  4RUG A;  3REA B;  1WX6 A;  4FSS A;  3NGP A;  3A98 A;  1KIK A;  3ULR B;  3RNJ A;  4AG2 C;  1VYU A;  4JZ3 A;  1M8M A;  2PTK A;  2RPN A;  2X3X D;  5IHK A;  1EFN A;  3TSZ A;  2K2M A;  3SEM A;  1AEY A;  1GCP A;  1MV0 B;  1UHC A;  1ZSG A;  4K11 A;  3I9Q A;  1K0X A;  1G2B A;  1WXT A;  1OEB A;  2DL7 A;  1BK2 A;  2H8H A;  2RQW A;  3O5Z A;  1SHG A;  2C0O A;  3KFV A;  1W70 A;  3M0Q A;  1M3B A;  3VS6 A;  3JV3 A;  2X3W D;  1ZBJ A;  1IO6 A;  1X6G A;  3CQT A;  2K7A A;  4RTW A;  1HJD A;  2MCN A;  2K9G A;  3QWY A;  1W1F A;  2O2O A;  1SRM A;  3REB B;  2RQU A;  2K79 A;  3UA7 A;  2KXC A;  2F2W A;  3VS3 A;  2RNA A;  1WXB A;  3QWX X;  1QKW A;  1QKX A;  1UG1 A;  1YWO A;  2CDT A;  2RQR A;  1T0J A;  1SEM A;  2EYY A;  5IHI A;  2F2X A;  2AK5 A;  1Y0M A;  3H0I A;  4J9C A;  2YUN A;  2L0A A;  1Z9Q A;  1X43 A;  4OMQ A;  1M3A A;  2O88 A;  1CKA A;  2D8J A;  1JEG A;  1I1J A;  2FO0 A;  2KGT A;  2AKK A;  4HVV A;  2EYW A;  2EPD A;  3VS7 A;  2J7I A;  3EHR A;  4CC3 A;  3ZL7 C;  2D0N A;  1ABO A;  2ED0 A;  1V1C A;  2KBT A;  4OMM A;  4RTX A;  4HCK A;  2DM1 A;  1T3L A;  1U06 A;  1UJ0 A;  3I5S A;  1B3Q A;  1WFW A;  2AKL A;  2K6D A;  3NHN A;  4OMP A;  1UHF A;  2M0Y A;  1UUE A;  2I0N A;  1ARK A;  2JS2 A;  2QDL A;  2GBQ A;  1AVZ C;  2W10 A;  4DEX A;  2XMF A;  3IQL A;  2KRN A;  1M27 C;  2J05 A;  1QCF A;  1M3C A;  1NLP C;  2C0I A;  2D8H A;  5IH2 A;  2DRM A;  1WDX A;  1JXO A;  1XOV A;  2A36 A;  4LUD A;  1JXM A;  2JW4 A;  4JZ4 A;  5FW9 A;  3FJ5 A;  1X27 A;  3I5R A;  1QLY A;  3EG2 A;  1GFD A;  1E6H A;  4AFU C;  2GTJ A;  1J3T A;  3UF4 A;  2EKH A;  2A37 A;  2CSQ A;  1G83 A;  3R6N A;  2DL5 A;  1X6B A;  4GBQ A;  2SEM A;  2LZ6 B;  1ZX6 A;  1GRI A;  1FYN A;  1K9A A;  2EQI A;  2JM9 A;  2RQV A;  2FPD A;  3PVQ A;  1AZE A;  4HVW A;  1PNJ A;  1HSQ A;  1NLO C;  1H8K A;  1UGV A;  1SSH A;  2FRY A;  2GTO A;  1YP5 A;  1OOT A;  2JMA A;  1NM7 A;  2OI3 A;  1I0C A;  2NWM A;  2CSI A;  4JJB A;  4A63 B;  2AZS A;  2DMO A;  1RUW A;  2HDA A;  3EGU A;  1K1Z A;  1WLP B;  2NUZ A;  1GBQ A;  3LH5 A;  4RTZ A;  2A28 A;  2O9V A;  2DX1 A;  2L3Q A;  2YSQ A;  2LMJ A;  3VRZ A;  2JXB A;  1VA7 A;  4EIK A;  1Y57 A;  2E5K A;  3GBQ A;  1YNZ A;  1UE9 A;  2ECZ A;  4JJC A;  4LN2 A;  2EYX A;  2DE0 X;  2LCS A;  4OMN A;  1JU5 C;  3VS1 A;  2LJ0 A;  1SHF A;  2EGC A;  5EC7 A;  3SHW A;  2DRK A;  4RTU A;  2CH4 A;  3PVL A;  2K3B A;  2LQW A;  2G6F X;  2FG0 A;  5I11 A;  2DL4 A;  2V1R A;  3VS0 A;  3M0T A;  3H0H A;  1BB9 A;  2ROT A;  2ROL A;  1BBZ A;  3M0R A;  3M0U A;  1T3S A;  5IXF A;  1ZUK A;  1AOJ A;  1YN8 A;  2LJ3 A;  1JQQ A;  1CKB A;  2EGA A;  2V1Q A;  2ABL A;  1U3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...