2YUPA

Solution structure of the second sh3 domain of human vinexin
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
90
structure length
90
Chain Sequence
GSSGSSGKPPTYQVLEYGEAVAQYTFKGDLEVELSFRKGEHICLIRKVNENWYEGRITGTGRQGIFPASYVQVSREPRLRLCDDSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinexin
publication title Solution structure of the second SH3 domain of human Vinexin
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 6
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2yupA01
1Y57A 1WDXA 1OOTA 2AZVA 4GLMA 2J6KA 4J9DA 2DJQA 4DEYA 1KJWA 1HD3A 2RQUA 4HCKA 1ABOA 4FSSA 2DA9A 4IIMA 1JQQA 5I22A 2CUDA 2CH4A 3SEMA 1W6XA 2G6FX 4CC2A 2DMOA 1OV3A 2C0TA 4RUGA 2QDLA 2V1QA 2JMAA 2YT6A 3FJ5A 4J9HA 1M27C 3REBB 2CT4A 1K1ZA 2LNHB 1J3TA 2RF0A 4AFQC 2MCNA 4RTXA 2K2MA 1T3SA 5ECAA 2YUOA 3EG3A 4HVVA 1MUZA 2EKHA 4OMMA 2K6DA 4Y92A 4ESRA 1X6BA 4OMQA 2ENMA 1CKAA 4LUEA 2X3XD 3VS1A 1HSQA 4D8KA 1NYGA 3EG1A 4AG1C 2KROA 4J9EA 1YCSB 2EGCA 2CSQA 1K9AA 2DILA 1EFNA 3KFVA 2DM1A 1VYUA 3QWXX 4JPBW 4J9IA 4J9GA 1TG0A 1QLYA 4J9FA 1UHFA 1NG2A 3VS2A 1PRLC 1H3HA 1B07A 3ULRB 1YWOA 2EBPA 3VRYA 2KEAA 2RQWA 3VS3A 2ED0A 2KNBB 2KRNA 3EG2A 2CUBA 1SHFA 3VS4A 2P4RA 3O5ZA 4OMLA 5IXBA 1JO8A 3UA7A 3H0FA 4AFUC 2F2WA 4J9BA 1N5ZA 2JT4A 2K9GA 2KGTA 2A36A 2GNCA 2KT8A 4F16A 3UF4A 2D8HA 4AFSC 4F14A 4HVWA 1GBRA 2LQWA 1QWFA 4RTYA 1WLPB 2LCSA 5IHNA 2D1XA 2J7IA 1AOJA 1OPKA 2A28A 2X3WD 2ABLA 3REAB 1WYXA 4QT7A 2DNUA 2JW4A 5HCKA 3EGUA 1I1JA 4Z89A 4LN2A 1YP5A 2EYXA 2KYMA 1K4US 1GFDA 2HSPA 2FEIA 1AWXA 1BB9A 1X43A 2LP5A 2PZ1A 2RQRA 1GFCA 2EYYA 2EVRA 2BTTA 2F2XA 2V1RA 4JJBA 2BZYA 2IIMA 3H0IA 2RMOA 2DL7A 3ZL7C 3VS6A 4DEXA 1JEGA 5IH2A 1T3LA 1UECA 1K0XA 2JXBA 3NHNA 1UUEA 1UGVA 4RTTA 4Z88A 1GRIA 5L23A 1AZEA 1M3BA 3I5RA 1SEMA 1ZUKA 1MV0B 2B86A 1FYNA 2AKKA 2RN8A 2FPFA 1M3CA 2J6FA 4RTVA 1ZBJA 1BBZA 1NYFA 2FRYA 2EYZA 2LMJA 2ROTA 2KYBA 2LZ6B 2ED1A 2PTKA 4LE9A 3SHWA 3H0HA 2CREA 5EC7A 2HCKA 1PWTA 2D8JA 1RLQC 2O2OA 1AWJA 4AFZC 1YN8A 2AK5A 2LJ0A 1KIKA 1SPKA 1RUWA 1AZGB 1UHCA 1V1CA 1NLOC 3TSZA 4JZ3A 2JS0A 4HVUA 2DVJA 2GBQA 1G83A 4IIOA 1SRMA 4X1VA 2C0OA 4F17A 1X6GA 2DL5A 2KRSA 2CT3A 4OMNA 3H41A 3TSWA 3EHQA 2E5KA 1YWPA 1GCQC 1KSWA 1JU5C 1SHGA 2J06A 1B3QA 2O9SA 1UTIA 3NPFA 2KT1A 4Z8AA 1NEGA 2DRMA 2A37A 2YUQA 3M0UA 1WX6A 3C0CA 1UJYA 2EGAA 1NM7A 1WXBA 2DL4A 2KXDA 1QKWA 1PHTA 2BZ8A 1UFFA 1CSKA 4A63B 2NUZA 2DL3A 4CC7A 1E6GA 2FO0A 5FWBA 2GTOA 1Z9QA 1QCFA 2LJ1A 2DYBA 2ROLA 1M30A 1X2KA 2GTJA 2C0IA 1OEBA 2D0NA 3I35A 2L3PA 1X2QA 1Z9ZA 1M3AA 1WXUA 1E6HA 2JS2A 1YNZA 2SRCA 4OMOA 5GJWB 1E7OA 1CKBA 3NMZC 2H8HA 1BU1A 1WFWA 1MV3A 2CH4W 2FPEA 2L3QA 1NEBA 3UATA 2L3SA 3VS5A 2DRKA 2K3BA 2M0YA 3PVQA 4AG2C 2I0NA 1GCPA 2KBTA 1SSHA 1ABQA 2JM8A 5IHKA 3PVLA 1AEYA 3M0SA 2EW3A 4HXJA 2OAWA 1WI7A 1PKTA 2A08A 1PRMC 4J9CA 4CC4B 2FRWA 1H8KA 1W1FA 3JV3A 3I9QA 1TUDA 1X27A 2DX1A 1TUCA 4M4ZA 2O88A 1W70A 2HEQA 2YUNA 2YSQA 1VYTA 1QKXA 4GBQA 3R6NA 4R0KA 3RNJA 4JZ4A 1GL5A 2FPDA 2JTEA 1I07A 2KXCA 4KRTA 4LNPA 1HJDA 1U5SA 1UJ0A 4WCIA 3NGPA 2EGEA 1K0SA 2VWFA 2HBWA 3QWYA 2O9VA 1VA7A 2CDTA 1ZSGA 1QWEA 3M0QA 3EG0A 2OI3A 4RTZA 2L0AA 3UA6A 1WA7A 1LCKA 2DL8A 2O31A 1AWWA 2DBKA 1PKSA 2K79A 2LQNA 4CC3A 1AD5A 5IXFA 2DF6A 1WIEA 4JJDA 1ZUYA 1OPLA 1T0HA 1T0JA 2VKNA 2DLPA 1A0NB 1PNJA 1UDLA 2CSIA 2NWMA 2MOXA 3U23A 1JXMA 2RPNA 2LX7A 2DE0X 2RNAA 3M0TA 1XOVA 4RTWA 3I5SA 2GGRA 1FMKA 2KR3A 3GBQA 4ORZA 3VRZA 1IO6A 4D8DA 1U3OA 2SEMA 5IHIA 1GBQA 2EYWA 4LUDA 2GQIA 5FWCA 2LJ3A 2DBMA 5FW9A 2ECZA 2XMFA 3A98A 3EHRA 2AKLA 1Y0MA 1SRLA 3LH5A 2KRMA 5I11A 4JJCA 1UE9A 1AVZC 2F2VA 1JXOA 2HDAA 1AWOA 1VYVA 1K76A 2EQIA 1ZLMA 3VS0A 1BK2A 3CQTA 2OJ2A 3M0PA 4OMPA 1U06A 4RTUA 1KFZA 2M51A 2RQTA 3IQLA 1GCQA 2VVKA 3RBBB 1ZUUA 2AZSA 2K7AA 2FG0A 1I0CA 1ZX6A 1S1NA 2MIOA 4E6RA 2JM9A 2KE9A 3PE0A 2PNIA 2RQVA 2BZXA 1NLPC 1M8MA 1UG1A 4ZNXA 3THKA 2YUPA 1RLPC 2YDLA 4EIKA 2JMCA 3M0RA 3TVTA 2L2PA 3VS7A 2J05A 2J6OA 1WXTA 2W10A 1ARKA 2ESWA 2W0ZA 1RI9A 5GJVB 1H92A 4K11A 1X69A 2EPDA 1G2BA
chains in the Genus database with same CATH superfamily
1Y57A 1WDXA 4A54A 2DJQA 4C92F 5EG2A 1YI2T 2MMPA 5HK0A 1TSFA 2DAQA 2GF7A 2BKDN 3RERA 1W2BA 3WVDB 4ME7A 4J7IA 1PD1A 2FVUA 2VB6A 1JQQA 1VQ5Q 2G3RA 3CPWS 3KXTA 2OAUA 5GAN5 2QDLA 2V1QA 1HXDA 2X4WA 1VQ7T 4OGEA 2CT4A 1N27A 4KT0E 4M77A 4XTYA 1BI3A 2YHTA 1YJ9T 2Y4XA 1N8RR 3H8ZA 1J3TA 4BDYA 1RAHB 2WACA 5GMKj 3M57A 4RTXA 3DLMA 2LRQA 1D3BA 4HVVA 4OMMA 1IGUA 1VQ7Q 4M7DE 1N9RA 3CBOA 1CKAA 1YJ9Q 1UGPB 2QI2A 4LUEA 1MMNA 1IB8A 3EG1A 4J9EA 1K9MR 2CSQA 2XKOC 4GY5A 2DIQA 3OMGA 2DILA 4O5VA 3QG1A 4DOWA 4JPBW 3CCUT 4OVAA 1QLYA 3L2UA 4OF1A 2ZPIB 1KC8R 1U1TA 2DTIA 2PUKB 3EH2A 1B07A 2QGGA 4BE0A 2EBPA 2VGNA 1RABB 2KEAA 2RQWA 3VRYA 2JUFA 6AT1B 3CCUQ 3JB9J 3E9GA 2EQKA 2CUBA 4OMLA 3JCMc 3CCRQ 1DJ7B 4AFUC 2E6ZA 4LDWA 3PMIA 4J9BA 3JCMQ 2JT4A 5GAN4 1M90C 2E10A 5FU6C 3F70A 4RKUE 5LJ3j 2KT8A 4F16A 2KAFA 3BW1A 2K4YA 3HRUA 3X28B 3OYKA 2LQWA 1SSFA 2DXBA 1UGQB 2EYQA 1WLPB 4M7DC 4RMOA 2LCSA 4XTXA 3SWNC 5GAOm 3Q1JA 3R6OA 1VQ8T 3REAB 2VV5A 3E19A 1D0XA 2DNUA 1BKBA 2LVMA 1YJNQ 3OW2A 1YP5A 2L3RA 2PUOB 3L1AA 2V8IA 5DY9A 2PZ1A 3L42A 2QK0A 1GFCA 4JRKA 4N0AC 1QVFA 3I55A 2RMOA 3OYMA 3V7CA 3VS6A 3QZ5B 4DEXA 1NJIC 1UECA 2JXBA 1O9SA 4RTTA 4LDUA 3I5RA 4C8QD 3CC7T 3NFCA 1KHIA 2HAXA 1H641 3JCMb 4DQ2A 1SF9A 3GOXA 2KYBA 3MO8A 3BDLA 2ED1A 3SHWA 4M78E 2DETA 4C5EA 5CKDA 3G4SA 5GAMf 4PJOD 1AWJA 2LJ0A 3OYLA 4C0GA 2MYSA 2QA4Q 9ATCB 2XDBA 1YI2A 2DD4A 1NLOC 4M78G 2JS0A 3QZ9B 4IIOA 4ATOA 3RIRA 4X1VA 1H3ZA 2C0OA 2KMTA 3CD6T 4JLGA 3QDRB 3T9NA 3H41A 2RM4A 2E5KA 2J06A 2O9SA 1UTIA 2KT1A 2DD5A 4PJMA 2A37A 1Y71A 4JJNK 2IG0A 1WX6A 2QTXA 1UJYA 3EFOA 1KQ1A 1YITQ 2KQWA 4PFOA 4A63B 5GANd 3ZFJA 2FO0A 2GTOA 4DBHA 5IAYA 1IRXA 1BIBA 1WPYA 2DYBA 1X2KA 1IREB 2LCLA 4MMLA 4KGXB 2C0IA 1KG1A 3LGFA 2X4XA 3I35A 5IT9E 3CCET 1P92A 1WHMA 3A1PA 2XDPA 4OP0A 1YNZA 2MK5A 3CCVQ 3CXCP 4HCZA 2X4YA 5LJ3d 5CO7A 2E6NA 1BU1A 1WFWA 1MV3A 5GMKi 4M75C 2FPEA 1WQWA 2F1LA 4MDWA 3UATA 3JB9F 4M7DB 3SWNB 1O75A 2I0NA 4JRQA 1GCPA 1D1CA 2JM8A 2JTFA 3DB3A 3M0SA 4HKEA 3M9QA 2LT4A 3V8JA 2KVQG 4J9CA 5LJ3g 1H8KA 3JV3A 1IHWA 1X27A 1WHLA 1VQ6T 1TUCA 5A2QE 3BE3A 1W70A 4A4GA 2HEQA 2KDSA 3FRNA 1VQMA 2HBPA 3CBMA 3QDFA 1VYTA 1QKXA 3MCAB 1VQ8A 2X35A 3EGXB 1RACB 4M7DA 3SWNA 3JB9H 1PD0A 1VQ6Q 3OYIA 2LDMA 1S72T 1RAGB 5D6YA 3EGDB 2GFUA 4KH1B 3NGPA 2CP6A 3I56A 4C92G 2NYSA 2HBWA 2RHIA 2O9VA 1VA7A 3D7SB 2OI3A 1KD1C 2CP2A 2CZ6B 4F04B 3X26B 1AWWA 2DL8A 2DBKA 1QP2A 1S72Q 2DF6A 4N0AA 2O4XB 1T0HA 1A0NB 2QEXT 3CCJT 1UDLA 3OYGA 2M9UA 3CC7A 2QYZA 1M90U 1LPLA 4F7UB 3A8MB 3EGXA 2GGRA 4M77E 3VRZA 2YRDA 4II1A 5KYUB 4D8DA 3CCJQ 3EGDA 5FWCA 2RB6A 2LJ3A 1TUGB 3H9NA 1TH7A 3OYHA 2WSFE 1SRLA 4ZGDB 5FROA 2GQVA 2QXFA 2F2VA 3J7AF 1JXOA 4NL3A 1D09B 2HDAA 1WJRA 2OTLA 1AWOA 1I8FA 3CD6A 2YRVA 3PT9A 1K76A 2XD0A 2ZPBB 1K9MU 2DO3A 2CYZB 2FB7A 3QJYA 3A5ZB 2CP5A 3DKMA 3CMET 3CCSQ 4M75B 3IQLA 4F7UA 1I5LA 2VVKA 3P8BB 4L6V5 4BE1A 5D6WA 1TOVA 1BIAA 2FYKA 4PKCC 3MJXA 1ZX6A 4OGCA 1S1NA 4XU1A 4XTWA 4E6RA 2JM9A 5C6SA 2MI6A 3EAEA 3LWHA 5CKBA 3CCMA 2Z0WA 3QUIA 4M77C 3VJPA 4EDUA 1SG5A 3CCEA 3LGLA 2YUPA 2ZPFB 1YJWT 4J83A 3S3MA 1BI0A 3MEAA 1KQSA 1YCYA 2E1HA 2JMCA 2DK3A 4XTUA 3M0RA 1I5OB 4LXCA 2RJCA 2EIFA 2RK2A 2F5KA 5LJ5f 4E7ZA 3OA6A 1K8AU 1RI9A 1VQOA 1H92A 4UC4A 1W2BS 3EFRA 1G2BA 5J3BA 2FZGB 1YJWQ 1OU9A 3P8HA 4M75A 2J6KA 4J9DA 1VQ9T 1YIJA 4PJOC 4DEYA 1KJWA 1D1AA 4FSSA 1M2VB 2QQAA 2DA9A 4XTZA 2CH4A 3SEMA 4M78F 1W6XA 4CC2A 4N4HA 4GLKA 4RUGA 1VQ4A 3FJ5A 1EZZB 1M27C 1VQ9Q 3CC2T 5FRNA 5CQYA 3REBB 1OULA 4X34A 1RAFB 3C12A 2LQKA 4Y28E 4AFQC 2MCNA 3EG9A 2YUOA 3EG3A 4ESRA 4X9CA 1X6BA 4M7AB 3CMAA 1HSQA 1NYGA 4C0FA 4AG1C 4QVZA 1G3WA 4VUBA 5GAN8 4OMFB 3A8OB 3CCLT 4C0DC 3OYCA 1K73C 3OYAA 1KQ2A 1R77A 4J9GA 4J9IA 5GAMe 1IZ6A 1Q95G 1UHFA 3VS2A 1Y96A 2IPOB 2NUTB 2QEXA 3ULRB 4MZMA 3TU4K 2ED0A 3OQ5A 1IXDA 3ASKA 1RAEB 5GANh 2CP3A 1SHFA 2P4RA 5IXBA 1JO8A 3E2UA 1M1GA 1UGSB 1M8VA 2JVVA 1N5ZA 2KGTA 2KY9A 2DTHA 4L5GA 3CCQA 1VQKA 2D8HA 1GBRA 4F14A 3JAME 3SB2A 1TWBA 3M5AA 4RTYA 1ZA2B 2YRCA 3VUZA 5DLOA 3OW2S 5IHNA 2D1XA 3ER0A 1AOJA 1OPKA 2A28A 4Z02A 5L8RE 5IN1A 2YWWA 4QW2A 2NUTA 1PM3A 4C8QB 2D6FA 1NZ9A 4JLIA 1I1JA 4Z89A 1WHJA 1C6VX 3JB9G 2KYMA 4BY6C 1HYOA 1WHKA 2E3HA 4EMKC 1QVFS 3CMEA 1AWXA 2BUDA 3JCMe 4XU0A 3VKIA 1X01A 2RQRA 4WTOB 2V1RA 2BZYA 1Q81C 1Q86C 4IUTA 3ZL7C 1MGQA 4PJOB 5CIUA 1VQNQ 1M90R 1OQKA 3QBYA 2NUPB 4Z88A 3ME9A 3AT1B 3V8KA 2H3EB 1SEMA 2B86A 2FPFA 3OY9A 4OB2B 2RO0A 3VUBA 1M9SA 2LMJA 2P4TA 4C8QA 3H0HA 3KUFA 2CREA 2ZPHB 4LD6A 2D8JA 1RLQC 1KIKA 5KYYB 3G71T 2RHYA 2O01E 2DXCA 1X75C 1AZGB 4TVRA 3M56A 4B6MA 3OYDA 4PJOA 4M77F 2P0KA 1D1BA 1X6GA 2DL5A 2CZ0B 1NJIR 4OMNA 5D7UA 4PLIA 4XK8E 3G71Q 3EHQA 4C0DB 4M7DG 3CC2A 3KBGA 1GCQC 2LC4A 5I2MA 1JJ2S 3CCRT 3C0CA 1XTDA 1FXXA 4E7LA 1NM7A 3FB9A 5GANj 4M7AD 2KXDA 1QKWA 3FC3A 2BZ8A 2KI7A 1MNDA 1Z9QA 3HFNA 4BD3A 2GTJA 1MHNA 1QW1A 3O8VA 4E7JA 2L3PA 1X2QA 1M3AA 3HP9A 1WXUA 2D0QB 2JS2A 3CPWP 1K8AR 3CCLA 4FM4B 1YJNT 1VQPT 2HKNA 2DJZA 3TQ7P 2L3SA 3VS5A 3OS0A 4AG2C 4C92D 1QVGS 1SSHA 1VQPQ 3RESA 2PQWA 2PVDB 4OB0B 1NBEB 4HXJA 4BY6B 1OYXA 3DB4A 1WI7A 2HQXA 4EMKB 1PKTA 2A08A 5CKHA 1PRMC 3TEEA 4CC4B 4F7UE 1M2OA 3QJ6A 2OTJT 1RI0A 2VUBA 4BDZA 2DX1A 8ATCB 5CR2A 4M4ZA 1V76A 2ZGWA 3QYGB 4E7SA 5LJ3f 2O88A 2PVOB 4XU3A 3CBPA 2DZ9A 1FWZA 5CK9A 4LD9K 3ZEHA 4J5YA 4JZ4A 1GL5A 2EAYA 2QA4T 3M55A 1I07A 2OTJQ 2KXCA 5AT1B 2XK0A 4C0ZA 4KRTA 1U5SA 3GLXA 4FIBA 3L2ZA 3J81E 2E3IA 2XHCA 1VQLQ 1VQ5A 2XI9A 1K0SA 2LT1A 4EMKA 1QWEA 3M0QA 3EG0A 4M75E 5I2SA 1WZOA 3PNWC 1Q82C 4B9XA 2LQNA 4CC3A 3PTAA 1WIEA 4JJDA 1T0JA 2VKNA 2YLBA 2DVEA 4HA8A 4MMKA 3MP1A 2FHDA 2QAZA 4J6YA 1YITT 2EQUA 2K3YA 4J6XA 2L89A 1VQ7A 2DE0X 2C06A 2RH2A 4JS4A 5HY6A 4XQ3A 5C0MA 1YJ9A 3OSSC 2RA2A 1NPPA 1IO6A 3HL8A 2JOYA 5IHIA 4J8OA 3RMQA 3N5BB 3CCVT 1BYMA 4DA4A 2BIVA 1JJ2A 3OYJA 3M53A 4FT2A 2KRMA 1LNXA 4JJCA 2HQHA 4MDXA 2MWOA 1UE9A 1AVZC 4QKUA 1KD1R 1Y7XA 2OTLQ 2YXYA 5HKCA 4FW2A 4P5NA 2QGFB 4E7HA 3CCUA 3VS0A 1Q86U 4OMPA 4RTUA 2BE7D 2RQTA 5GAN6 3CCRA 4HT8A 1GCQA 3TCJA 3RBBB 3JCMV 1ZUUA 2AZSA 2F5TX 5GANg 5J26A 4V2SA 3PIOA 2FG0A 1I0CA 2B8AA 4BI3A 2XG8D 1UB4A 2BZXA 1KQSS 1QQJA 1QVGA 3PMTA 1NLPC 1I81A 3THKA 1RLPC 4M7AE 2X9HA 2YDLA 4EIKA 1YJNA 2EWNA 2P0PA 4MZTA 3VS7A 2CS7A 3OYEA 2RJFA 1WJSA 2J6OA 1WXTA 1ARKA 2ESWA 5GAMd 1SKUB 2COZA 4K11A 1X69A 1M1KC 2EPDA 1U1SA 3MEWA 3C4SA 2KSSA 1OOTA 2MPXC 3FJPA 2F69A 1HD3A 2RQUA 1ABOA 1WHHA 4IIMA 4WF2A 2CUDA 4NS5A 2DMOA 1OV3A 4BACA 2YT6A 2M1HA 4QQ6A 3A8LB 4J6WA 3CXCA 1K1ZA 4KUDK 4M7DF 2X51A 4FU6A 4DBRA 2RF0A 4HCCA 4E7KA 2K2MA 1T3SA 2E5QA 5ECAA 3CC4Q 1MUZA 2EKHA 2QA4A 4Y92A 2XU8A 2JNGA 1WGSA 4M7AC 2ENMA 1C1AA 4QQGA 3VS1A 4D8KA 2COYA 3JCMW 4C8QE 2EGCA 3JCMd 3LW5E 1FX7A 1K9AA 1EFNA 1VYUA 3QWXX 2GFAA 2RD1A 4M77G 3RKXA 5KE3A 4IUVA 2FZCB 1BI2A 3JB9D 3CCST 1TG0A 4J9FA 3SFMA 2E70A 3L2RA 1NG2A 2MAMA 1PRLC 2FZKB 5CKEA 1LOJA 5CAIA 1VIEA 4PJOE 1YWOA 5DLQE 2K5IA 2O4XA 2AT1B 1QMCA 4IKFA 4QVDA 3EG2A 4PJJA 3QSUA 3O5ZA 1NJIU 1YHQQ 3H0FA 5J39A 4PJOG 2F2WA 2K9GA 4ZGEB 1X6OA 2A36A 4R56A 2DFUA 3CCVA 1EX4A 5KYUA 2GNCA 4AFSC 5GAOp 2RK1A 4AT1B 1QWFA 2DTOA 3H6ZA 2J7IA 1RADB 3GNGA 5KYXB 1R8OB 3G6EQ 4C8QC 4PFZA 2V8KA 4F7UF 5GAOq 2JW4A 5HCKA 3OBWA 1AHJB 4LN2A 3BDUA 2EYXA 1K4US 2JZ2A 3GIBA 2HQEA 1GFDA 3V7SA 2HSPA 2FEIA 3M58A 1B34B 2R5MA 2DZCA 1BB9A 1X43A 2LP5A 4FT4A 3RKWA 2EYYA 1PC0A 2BTTA 4JJBA 1LJOA 2IIMA 3URGA 3WVEB 4R55A 5IH2A 1T3LA 1K0XA 1VIFA 3SDZA 1UUEA 1UGVA 2COWA 5L23A 1AZEA 1M3BA 1JBMA 1ZUKA 1MV0B 2AKKA 2RN8A 1WQ7A 3JRZA 2JN0A 2J6FA 2RI5A 1NYFA 5KYXA 1VQ6A 1I4K1 2EYZA 2ROTA 2VGMA 2M02A 4M75F 2PTKA 4LE9A 2VXEA 2DEQA 3JSCA 4AMCA 2HCKA 2K5LA 2EKOA 2O2OA 2AIRB 1JB0E 2JJ9A 4AFZC 1GXIE 3QIIA 3QKJA 4KH0B 1UHCA 1RUWA 1ZBXA 3ZBDA 1S72A 3TSZA 4HVUA 4BE2A 4LDXA 2GBQA 3S6WA 1Q81R 1Q86R 1M2VA 4RG2A 1BI1A 4F17A 2KRSA 3EFSA 1YWPA 1JU5C 3NPFA 2DPPB 4Z8AA 4PNOA 3UDCA 4DBFA 2LNVA 2R57A 2YUQA 2V8JA 3M0UA 3CCJA 2EGAA 1WXBA 2DL4A 1PHTA 1TTHB 1MMAA 1CSKA 1UFFA 2NUZA 1W2BP 4CC7A 1JRIA 1E6GA 5FWBA 4C92B 1OX9A 2VXFA 2LJ1A 4A4FA 2ROLA 1M30A 4BUGA 4M7AA 2FL7A 3WXMB 5A0LA 3MEVA 1Z9ZA 4EPCA 2ZCFB 4L59A 1Q7YC 5CKFA 4LDVA 4PJNA 4OMOA 3E1SA 5GJWB 4ZTJA 5GAN2 4A53A 2QASA 1QP3A 3NMZC 4FYYB 2CH4W 2ZAEA 2L3QA 4YTLA 4QQDA 3OS1A 5KYNA 3UPUA 3X20B 5GMKl 1EIFA 3I55T 1XQHA 2EJFA 1KD1U 1VQNT 3RDVA 1AEYA 2K2VA 5CQXA 2EQJA 2K57A 3NTIA 4M78D 4Q5WA 2PU9B 1QVPA 3OYBA 2H3JA 3MHXA 3I9QA 4KGVB 1TUDA 3VYHB 3I55Q 1ZSZB 3QYHB 2Y4YA 4FYWB 2YUNA 5GAMh 2YSQA 1D3BB 2EJ9A 5D6XA 4GBQA 3RNJA 3PGGA 4R0KA 1YJWA 3M59A 2JTEA 2I2LA 4LNPA 1HJDA 1UJ0A 4WCIA 3X24B 3G4SQ 4PFPA 2CP7A 3FLGA 2CDTA 1ZSGA 5FU7C 1M5Q1 1VQ9A 1QCOA 2ZPEB 3L2WA 1G3YA 2EJGA 5AYFA 3OYNA 4FCYA 1YI2Q 1ACMB 1PKSA 3FEOA 3FIFA 1AD5A 5IXFA 4XU2A 1ZSZA 1PCXA 1ZUYA 1KHCA 3OS5A 2DIGA 2NUPA 3U23A 4C8QF 4LDYA 3VU3C 1KK7A 3OW2P 3LH0A 2RNAA 3M0TA 1XOVA 3JCMX 4IURA 4ELYC 3OB9A 2KR3A 3GBQA 4ORZA 3C94A 1PG5B 1B7TA 3FDRA 1U3OA 3META 1ZA1B 2SEMA 2EYWA 2GQIA 2DXUA 1QVFP 3JCMh 2DBMA 2A7YA 5FW9A 2ECZA 3M4GA 3A98A 4PJOF 4HCBA 3HKSA 2RJDA 3LH5A 2AHJB 3RR6A 5KYYA 5I11A 1M4ZA 4B9WA 1Q82R 3RUXA 2CP0A 3M4YA 4JRIA 2M16A 2EQIA 2DEUA 1ZLMA 1BK2A 3V7RA 3CQTA 1U8RA 1NPRA 3M0PA 4FL6A 3C95A 1U06A 3G7ZA 1KFZA 1M1FA 3JCMJ 1WJQA 2K7AA 1MMGA 1Y07A 2KE9A 4OB3B 4RG8A 1G5VA 5GANf 2PNIA 2RQVA 2K3XA 5CVIA 4DOVA 2QQSA 1M8MA 1UG1A 1VQMT 5I21A 4ZNXA 1N8RC 2LTOA 3CEYA 1IHVA 2K5FA 2XICA 5GAMj 3LLRA 3TVTA 1VQLT 2L2PA 3G1JA 2J05A 3PFSA 1N6AA 4BI4A 3I56T 5GJVB 4F7UG 1VQMQ 1JJ2P 2AZVA 1VQ8Q 2HKQB 4GLMA 3UT1A 1IGQA 3VV0A 4C5GA 1OU8A 2Y90A 2RHUA 1RAAB 1K9MC 4HCKA 1K73U 1VQNA 4N4GA 1OZ3A 1RL2A 4M77D 5I22A 3J80E 1C0MA 3I56Q 3CXCS 2G6FX 2LQ8A 2C0TA 1VOMA 3BFMA 2ZPGB 2JMAA 5LJ5e 1KC8C 4J9HA 3AHUA 5FU7B 4A4HA 3E9FA 2RHZA 3CPWA 2HD0A 2LNHB 3EFOB 4E2FB 3UWNA 3JCMP 2L5QA 3OSVA 2DKGA 3CC7Q 4M75G 2HMAA 1Q7YU 2K6DA 4N4IA 5CCAA 2A0FB 4OMQA 1M1KR 1QVGP 2X3XD 4MZPA 1K8AC 1XNIA 4X9DA 2KROA 1YCSB 2OTLT 4IUPA 2R58A 3KFVA 2DM1A 3G71A 3QPHA 4CRIA 1OX8A 4FYVB 4CI0C 1H3HA 7AT1B 5M9OA 2QTVA 3VS3A 3CD6Q 2KNBB 1V29B 4KGZB 2DXTA 1Q81U 2RI3A 4JRPA 2KRNA 2XIDA 4ZN1A 3HRTA 3VS4A 3UA7A 5FLXE 4ANJA 3CCMT 4HT9A 1TS9A 1LVKA 4M78C 4FW1A 4PL6A 4A4EA 3EH1A 5FU6B 3JCMf 3UF4A 4HVWA 5A0GA 1ZHIA 4JDSA 4NOYA 2HZYA 5LJ5h 1G3TA 1YBYA 2L8DA 4EMHA 4OB1B 2P84A 4NL2A 2ATCB 2LX9A 1VQOT 1WHGA 3GPLA 3CCMQ 3CCEQ 2X3WD 2ABLA 3MKDA 1WYXA 2RHXA 3X25B 4QT7A 1VQPA 3EGUA 1QCNA 1YIJT 3MP8A 4QVCA 5GAOn 4KBMB 2QQBA 2HNIA 1VQOQ 2EQMA 2VASA 2LCCA 1UEBA 1NE8A 4M7AG 1FMWA 1VQ4T 5GAOl 2EVRA 2F2XA 3H0IA 1YIJQ 2DL7A 2QDYB 1JEGA 1D0YA 3NHNA 3JB9I 2VYTA 1GRIA 3S3NA 1G3SA 3LYIA 2DERA 4PJLA 1FYNA 4BI8B 1VQ4Q 4C92E 1M3CA 3CC4T 2OTJA 4RTVA 1ZBJA 1BBZA 4D6WA 1BCMA 5GAMg 2D9TA 2FRYA 5KH6A 8AT1B 3DLLA 2LZ6B 4FYXB 4DBQA 3A8GB 1VQLA 3CMAT 4E47A 5EC7A 3MPUB 2R5AA 1PWTA 2KK4A 4Y91A 3OYYA 3HSBA 4ZGJB 1YN8A 2AK5A 5HK3A 2E65A 4BB7A 1SPKA 2QQ9A 1V1CA 4JZ3A 3CMAQ 2DVJA 1G83A 2JTMA 3GP8A 1SRMA 1D0ZA 2HSEB 1YFNA 5A0DA 1KQSP 3M54A 4XAXB 4ZTFA 2CT3A 3TSWA 2EFIA 3MEUA 1KSWA 1SHGA 1B3QA 4KUIA 5KCHA 1NEGA 2DRMA 4O6JA 1YHQT 4C8QG 4C5HA 2E64A 2QEXQ 4RCBA 3LX7A 3GNFB 2M0OA 1YITA 3CCQT 5KE2A 1AT1B 1N8RU 1VQKT 4C92C 2DL3A 4RCCA 5DM7R 1QCFA 3JCMg 3RMSA 1OEBA 5FRMA 2D0NA 3L2QA 5GMKm 3G6ET 4M78B 5LJ5j 1E6HA 3CCQQ 2SRCA 1VQKQ 1E7OA 5KCOA 1CKBA 2H8HA 3P8DA 1VUBA 2CZ1B 1NEBA 2DRKA 2K3BA 2M0YA 1K73R 3PVQA 3OMCA 5GMKe 3INZA 3BY7A 3HRSA 2KBTA 1ABQA 5IHKA 1KC8U 2WSEE 3PVLA 2EW3A 3RKYA 1Q82U 2RJEA 2OAWA 4IUUA 3CMEQ 4PK4A 2NLUA 3VYGA 2FRWA 2GCXA 1W1FA 1ZSZC 2PVGB 1N9SA 2E41A 4M7DD 2OX7A 4M78A 3EG9B 4JS5A 1ZQ1A 1Q7YR 1W4SA 2HL5C 2E4HA 4IUQA 3OYFA 3R6NA 2CZ7B 3QXEB 2FPDA 4J7FA 2CKKA 5GANe 3HHTB 2QQRA 2HL3A 2YLCA 3GF5A 1XJWB 2EGEA 2VWFA 1OZ2A 3QWYA 1UGRB 4XTVA 1B34A 5LJ3e 2ZZDA 5LL6S 4RTZA 2L0AA 3UA6A 1WA7A 1LCKA 2O31A 1Y96B 2K79A 3CPFA 3QHSA 4PLLA 1OPLA 2V26A 4EMGA 2DLPA 1PNJA 2CSIA 2NWMA 2MOXA 3LWIA 2RI2A 3CC4A 1MNEA 1JXMA 5GMKh 2RPNA 1TXQA 2LX7A 5GAN7 3CC2Q 5GAOr 1BCOA 4RTWA 3I5SA 2X4JA 3MP6A 1FMKA 2P0QA 3A8HB 1PSEA 5KYWB 1PSFA 1FMVA 1GBQA 4LUDA 3OS2A 2XMFA 3EHRA 3QO3A 3TREA 2BE9B 2AKLA 1Y0MA 4JUVA 1RAIB 4C5IA 2CGHA 2A3LA 1VYVA 1M1KU 3PIPA 3CCLQ 1HK9A 5LJ5d 2OJ2A 3SD4A 2M51A 3CCSA 2E12A 1MMDA 1YHQA 2QG9B 2XDDA 4A4KA 1R0CB 5KYWA 4ELZC 3L2VA 1WNLA 4M7AF 3HFOA 2WSCE 2MIOA 1F1BB 3PE0A 5LJ3h 5GAN3 2VC8A 3NTHA 3S3OA 4C92A 1OI1A 1R0BG 5LJ5g 3HTRA 4M77B 3G6EA 3NTKA 3OBYA 4FSXA 2DYIA 2IVWA 4M75D 4KULA 4E7IA 1G8XA 1TU0B 3V8LA 3G4ST 1VQ5T 2W10A 2MF2A 2W0ZA 4ZN3A 2MWPA 3HPWA
chains in the Genus database with same CATH topology
1Y57A 1WDXA 1OOTA 2AZVA 4GLMA 2J6KA 4J9DA 2DJQA 4DEYA 1KJWA 1HD3A 2RQUA 4HCKA 1ABOA 4FSSA 2DA9A 4IIMA 1JQQA 5I22A 2CUDA 2CH4A 3SEMA 1W6XA 2G6FX 4CC2A 2DMOA 1OV3A 2C0TA 4RUGA 2QDLA 2V1QA 2JMAA 2YT6A 3FJ5A 4J9HA 1M27C 3REBB 2CT4A 1K1ZA 2LNHB 1J3TA 2RF0A 4AFQC 2MCNA 4RTXA 2K2MA 1T3SA 5ECAA 2YUOA 3EG3A 4HVVA 1MUZA 2EKHA 4OMMA 2K6DA 4Y92A 4ESRA 1X6BA 4OMQA 2ENMA 1CKAA 4LUEA 2X3XD 3VS1A 1HSQA 4D8KA 1NYGA 3EG1A 4AG1C 2KROA 4J9EA 1YCSB 2EGCA 2CSQA 1K9AA 2DILA 1EFNA 3KFVA 2DM1A 1VYUA 3QWXX 4JPBW 4J9IA 4J9GA 1TG0A 1QLYA 4J9FA 1UHFA 1NG2A 3VS2A 1PRLC 1H3HA 1B07A 3ULRB 1YWOA 2EBPA 3VRYA 2KEAA 2RQWA 3VS3A 2ED0A 2KNBB 2KRNA 3EG2A 2CUBA 1SHFA 3VS4A 2P4RA 3O5ZA 4OMLA 5IXBA 1JO8A 3UA7A 3H0FA 4AFUC 2F2WA 4J9BA 1N5ZA 2JT4A 2K9GA 2KGTA 2A36A 2GNCA 2KT8A 4F16A 3UF4A 2D8HA 4AFSC 4F14A 4HVWA 1GBRA 2LQWA 1QWFA 4RTYA 1WLPB 2LCSA 5IHNA 2D1XA 2J7IA 1AOJA 1OPKA 2A28A 2X3WD 2ABLA 3REAB 1WYXA 4QT7A 2DNUA 2JW4A 5HCKA 3EGUA 1I1JA 4Z89A 4LN2A 1YP5A 2EYXA 2KYMA 1K4US 1GFDA 2HSPA 2FEIA 1AWXA 1BB9A 1X43A 2LP5A 2PZ1A 2RQRA 1GFCA 2EYYA 2EVRA 2BTTA 2F2XA 2V1RA 4JJBA 2BZYA 2IIMA 3H0IA 2RMOA 2DL7A 3ZL7C 3VS6A 4DEXA 1JEGA 5IH2A 1T3LA 1UECA 1K0XA 2JXBA 3NHNA 1UUEA 1UGVA 4RTTA 4Z88A 1GRIA 5L23A 1AZEA 1M3BA 3I5RA 1SEMA 1ZUKA 1MV0B 2B86A 1FYNA 2AKKA 2RN8A 2FPFA 1M3CA 2J6FA 4RTVA 1ZBJA 1BBZA 1NYFA 2FRYA 2EYZA 2LMJA 2ROTA 2KYBA 2LZ6B 2ED1A 2PTKA 4LE9A 3SHWA 3H0HA 2CREA 5EC7A 2HCKA 1PWTA 2D8JA 1RLQC 2O2OA 1AWJA 4AFZC 1YN8A 2AK5A 2LJ0A 1KIKA 1SPKA 1RUWA 1AZGB 1UHCA 1V1CA 1NLOC 3TSZA 4JZ3A 2JS0A 4HVUA 2DVJA 2GBQA 1G83A 4IIOA 1SRMA 4X1VA 2C0OA 4F17A 1X6GA 2DL5A 2KRSA 2CT3A 4OMNA 3H41A 3TSWA 3EHQA 2E5KA 1YWPA 1GCQC 1KSWA 1JU5C 1SHGA 2J06A 1B3QA 2O9SA 1UTIA 3NPFA 2KT1A 4Z8AA 1NEGA 2DRMA 2A37A 2YUQA 3M0UA 1WX6A 3C0CA 1UJYA 2EGAA 1NM7A 1WXBA 2DL4A 2KXDA 1QKWA 1PHTA 2BZ8A 1UFFA 1CSKA 4A63B 2NUZA 2DL3A 4CC7A 1E6GA 2FO0A 5FWBA 2GTOA 1Z9QA 1QCFA 2LJ1A 2DYBA 2ROLA 1M30A 1X2KA 2GTJA 2C0IA 1OEBA 2D0NA 3I35A 2L3PA 1X2QA 1Z9ZA 1M3AA 1WXUA 1E6HA 2JS2A 1YNZA 2SRCA 4OMOA 5GJWB 1E7OA 1CKBA 3NMZC 2H8HA 1BU1A 1WFWA 1MV3A 2CH4W 2FPEA 2L3QA 1NEBA 3UATA 2L3SA 3VS5A 2DRKA 2K3BA 2M0YA 3PVQA 4AG2C 2I0NA 1GCPA 2KBTA 1SSHA 1ABQA 2JM8A 5IHKA 3PVLA 1AEYA 3M0SA 2EW3A 4HXJA 2OAWA 1WI7A 1PKTA 2A08A 1PRMC 4J9CA 4CC4B 2FRWA 1H8KA 1W1FA 3JV3A 3I9QA 1TUDA 1X27A 2DX1A 1TUCA 4M4ZA 2O88A 1W70A 2HEQA 2YUNA 2YSQA 1VYTA 1QKXA 4GBQA 3R6NA 4R0KA 3RNJA 4JZ4A 1GL5A 2FPDA 2JTEA 1I07A 2KXCA 4KRTA 4LNPA 1HJDA 1U5SA 1UJ0A 4WCIA 3NGPA 2EGEA 1K0SA 2VWFA 2HBWA 3QWYA 2O9VA 1VA7A 2CDTA 1ZSGA 1QWEA 3M0QA 3EG0A 2OI3A 4RTZA 2L0AA 3UA6A 1WA7A 1LCKA 2DL8A 2O31A 1AWWA 2DBKA 1PKSA 2K79A 2LQNA 4CC3A 1AD5A 5IXFA 2DF6A 1WIEA 4JJDA 1ZUYA 1OPLA 1T0HA 1T0JA 2VKNA 2DLPA 1A0NB 1PNJA 1UDLA 2CSIA 2NWMA 2MOXA 3U23A 1JXMA 2RPNA 2LX7A 2DE0X 2RNAA 3M0TA 1XOVA 4RTWA 3I5SA 2GGRA 1FMKA 2KR3A 3GBQA 4ORZA 3VRZA 1IO6A 4D8DA 1U3OA 2SEMA 5IHIA 1GBQA 2EYWA 4LUDA 2GQIA 5FWCA 2LJ3A 2DBMA 5FW9A 2ECZA 2XMFA 3A98A 3EHRA 2AKLA 1Y0MA 1SRLA 3LH5A 2KRMA 5I11A 4JJCA 1UE9A 1AVZC 2F2VA 1JXOA 2HDAA 1AWOA 1VYVA 1K76A 2EQIA 1ZLMA 3VS0A 1BK2A 3CQTA 2OJ2A 3M0PA 4OMPA 1U06A 4RTUA 1KFZA 2M51A 2RQTA 3IQLA 1GCQA 2VVKA 3RBBB 1ZUUA 2AZSA 2K7AA 2FG0A 1I0CA 1ZX6A 1S1NA 2MIOA 4E6RA 2JM9A 2KE9A 3PE0A 2PNIA 2RQVA 2BZXA 1NLPC 1M8MA 1UG1A 4ZNXA 3THKA 2YUPA 1RLPC 2YDLA 4EIKA 2JMCA 3M0RA 3TVTA 2L2PA 3VS7A 2J05A 2J6OA 1WXTA 2W10A 1ARKA 2ESWA 2W0ZA 1RI9A 5GJVB 1H92A 4K11A 1X69A 2EPDA 1G2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y57 A;  1WDX A;  1OOT A;  2AZV A;  4GLM A;  2J6K A;  4J9D A;  2DJQ A;  4DEY A;  1KJW A;  1HD3 A;  2RQU A;  4HCK A;  1ABO A;  4FSS A;  2DA9 A;  4IIM A;  1JQQ A;  5I22 A;  2CUD A;  2CH4 A;  3SEM A;  1W6X A;  2G6F X;  4CC2 A;  2DMO A;  1OV3 A;  2C0T A;  4RUG A;  2QDL A;  2V1Q A;  2JMA A;  2YT6 A;  3FJ5 A;  4J9H A;  1M27 C;  3REB B;  2CT4 A;  1K1Z A;  2LNH B;  1J3T A;  2RF0 A;  4AFQ C;  2MCN A;  4RTX A;  2K2M A;  1T3S A;  5ECA A;  2YUO A;  3EG3 A;  4HVV A;  1MUZ A;  2EKH A;  4OMM A;  2K6D A;  4Y92 A;  4ESR A;  1X6B A;  4OMQ A;  2ENM A;  1CKA A;  4LUE A;  2X3X D;  3VS1 A;  1HSQ A;  4D8K A;  1NYG A;  3EG1 A;  4AG1 C;  2KRO A;  4J9E A;  1YCS B;  2EGC A;  2CSQ A;  1K9A A;  2DIL A;  1EFN A;  3KFV A;  2DM1 A;  1VYU A;  3QWX X;  4JPB W;  4J9I A;  4J9G A;  1TG0 A;  1QLY A;  4J9F A;  1UHF A;  1NG2 A;  3VS2 A;  1PRL C;  1H3H A;  1B07 A;  3ULR B;  1YWO A;  2EBP A;  3VRY A;  2KEA A;  2RQW A;  3VS3 A;  2ED0 A;  2KNB B;  2KRN A;  3EG2 A;  2CUB A;  1SHF A;  3VS4 A;  2P4R A;  3O5Z A;  4OML A;  5IXB A;  1JO8 A;  3UA7 A;  3H0F A;  4AFU C;  2F2W A;  4J9B A;  1N5Z A;  2JT4 A;  2K9G A;  2KGT A;  2A36 A;  2GNC A;  2KT8 A;  4F16 A;  3UF4 A;  2D8H A;  4AFS C;  4F14 A;  4HVW A;  1GBR A;  2LQW A;  1QWF A;  4RTY A;  1WLP B;  2LCS A;  5IHN A;  2D1X A;  2J7I A;  1AOJ A;  1OPK A;  2A28 A;  2X3W D;  2ABL A;  3REA B;  1WYX A;  4QT7 A;  2DNU A;  2JW4 A;  5HCK A;  3EGU A;  1I1J A;  4Z89 A;  4LN2 A;  1YP5 A;  2EYX A;  2KYM A;  1K4U S;  1GFD A;  2HSP A;  2FEI A;  1AWX A;  1BB9 A;  1X43 A;  2LP5 A;  2PZ1 A;  2RQR A;  1GFC A;  2EYY A;  2EVR A;  2BTT A;  2F2X A;  2V1R A;  4JJB A;  2BZY A;  2IIM A;  3H0I A;  2RMO A;  2DL7 A;  3ZL7 C;  3VS6 A;  4DEX A;  1JEG A;  5IH2 A;  1T3L A;  1UEC A;  1K0X A;  2JXB A;  3NHN A;  1UUE A;  1UGV A;  4RTT A;  4Z88 A;  1GRI A;  5L23 A;  1AZE A;  1M3B A;  3I5R A;  1SEM A;  1ZUK A;  1MV0 B;  2B86 A;  1FYN A;  2AKK A;  2RN8 A;  2FPF A;  1M3C A;  2J6F A;  4RTV A;  1ZBJ A;  1BBZ A;  1NYF A;  2FRY A;  2EYZ A;  2LMJ A;  2ROT A;  2KYB A;  2LZ6 B;  2ED1 A;  2PTK A;  4LE9 A;  3SHW A;  3H0H A;  2CRE A;  5EC7 A;  2HCK A;  1PWT A;  2D8J A;  1RLQ C;  2O2O A;  1AWJ A;  4AFZ C;  1YN8 A;  2AK5 A;  2LJ0 A;  1KIK A;  1SPK A;  1RUW A;  1AZG B;  1UHC A;  1V1C A;  1NLO C;  3TSZ A;  4JZ3 A;  2JS0 A;  4HVU A;  2DVJ A;  2GBQ A;  1G83 A;  4IIO A;  1SRM A;  4X1V A;  2C0O A;  4F17 A;  1X6G A;  2DL5 A;  2KRS A;  2CT3 A;  4OMN A;  3H41 A;  3TSW A;  3EHQ A;  2E5K A;  1YWP A;  1GCQ C;  1KSW A;  1JU5 C;  1SHG A;  2J06 A;  1B3Q A;  2O9S A;  1UTI A;  3NPF A;  2KT1 A;  4Z8A A;  1NEG A;  2DRM A;  2A37 A;  2YUQ A;  3M0U A;  1WX6 A;  3C0C A;  1UJY A;  2EGA A;  1NM7 A;  1WXB A;  2DL4 A;  2KXD A;  1QKW A;  1PHT A;  2BZ8 A;  1UFF A;  1CSK A;  4A63 B;  2NUZ A;  2DL3 A;  4CC7 A;  1E6G A;  2FO0 A;  5FWB A;  2GTO A;  1Z9Q A;  1QCF A;  2LJ1 A;  2DYB A;  2ROL A;  1M30 A;  1X2K A;  2GTJ A;  2C0I A;  1OEB A;  2D0N A;  3I35 A;  2L3P A;  1X2Q A;  1Z9Z A;  1M3A A;  1WXU A;  1E6H A;  2JS2 A;  1YNZ A;  2SRC A;  4OMO A;  5GJW B;  1E7O A;  1CKB A;  3NMZ C;  2H8H A;  1BU1 A;  1WFW A;  1MV3 A;  2CH4 W;  2FPE A;  2L3Q A;  1NEB A;  3UAT A;  2L3S A;  3VS5 A;  2DRK A;  2K3B A;  2M0Y A;  3PVQ A;  4AG2 C;  2I0N A;  1GCP A;  2KBT A;  1SSH A;  1ABQ A;  2JM8 A;  5IHK A;  3PVL A;  1AEY A;  3M0S A;  2EW3 A;  4HXJ A;  2OAW A;  1WI7 A;  1PKT A;  2A08 A;  1PRM C;  4J9C A;  4CC4 B;  2FRW A;  1H8K A;  1W1F A;  3JV3 A;  3I9Q A;  1TUD A;  1X27 A;  2DX1 A;  1TUC A;  4M4Z A;  2O88 A;  1W70 A;  2HEQ A;  2YUN A;  2YSQ A;  1VYT A;  1QKX A;  4GBQ A;  3R6N A;  4R0K A;  3RNJ A;  4JZ4 A;  1GL5 A;  2FPD A;  2JTE A;  1I07 A;  2KXC A;  4KRT A;  4LNP A;  1HJD A;  1U5S A;  1UJ0 A;  4WCI A;  3NGP A;  2EGE A;  1K0S A;  2VWF A;  2HBW A;  3QWY A;  2O9V A;  1VA7 A;  2CDT A;  1ZSG A;  1QWE A;  3M0Q A;  3EG0 A;  2OI3 A;  4RTZ A;  2L0A A;  3UA6 A;  1WA7 A;  1LCK A;  2DL8 A;  2O31 A;  1AWW A;  2DBK A;  1PKS A;  2K79 A;  2LQN A;  4CC3 A;  1AD5 A;  5IXF A;  2DF6 A;  1WIE A;  4JJD A;  1ZUY A;  1OPL A;  1T0H A;  1T0J A;  2VKN A;  2DLP A;  1A0N B;  1PNJ A;  1UDL A;  2CSI A;  2NWM A;  2MOX A;  3U23 A;  1JXM A;  2RPN A;  2LX7 A;  2DE0 X;  2RNA A;  3M0T A;  1XOV A;  4RTW A;  3I5S A;  2GGR A;  1FMK A;  2KR3 A;  3GBQ A;  4ORZ A;  3VRZ A;  1IO6 A;  4D8D A;  1U3O A;  2SEM A;  5IHI A;  1GBQ A;  2EYW A;  4LUD A;  2GQI A;  5FWC A;  2LJ3 A;  2DBM A;  5FW9 A;  2ECZ A;  2XMF A;  3A98 A;  3EHR A;  2AKL A;  1Y0M A;  1SRL A;  3LH5 A;  2KRM A;  5I11 A;  4JJC A;  1UE9 A;  1AVZ C;  2F2V A;  1JXO A;  2HDA A;  1AWO A;  1VYV A;  1K76 A;  2EQI A;  1ZLM A;  3VS0 A;  1BK2 A;  3CQT A;  2OJ2 A;  3M0P A;  4OMP A;  1U06 A;  4RTU A;  1KFZ A;  2M51 A;  2RQT A;  3IQL A;  1GCQ A;  2VVK A;  3RBB B;  1ZUU A;  2AZS A;  2K7A A;  2FG0 A;  1I0C A;  1ZX6 A;  1S1N A;  2MIO A;  4E6R A;  2JM9 A;  2KE9 A;  3PE0 A;  2PNI A;  2RQV A;  2BZX A;  1NLP C;  1M8M A;  1UG1 A;  4ZNX A;  3THK A;  2YUP A;  1RLP C;  2YDL A;  4EIK A;  2JMC A;  3M0R A;  3TVT A;  2L2P A;  3VS7 A;  2J05 A;  2J6O A;  1WXT A;  2W10 A;  1ARK A;  2ESW A;  2W0Z A;  1RI9 A;  5GJV B;  1H92 A;  4K11 A;  1X69 A;  2EPD A;  1G2B A; 
#chains in the Genus database with same CATH topology
 1Y57 A;  1WDX A;  4A54 A;  2DJQ A;  4C92 F;  5EG2 A;  1YI2 T;  2MMP A;  5HK0 A;  1TSF A;  2DAQ A;  2GF7 A;  2BKD N;  3RER A;  1W2B A;  3WVD B;  4ME7 A;  4J7I A;  1PD1 A;  2FVU A;  2VB6 A;  1JQQ A;  1VQ5 Q;  2G3R A;  3CPW S;  3KXT A;  2OAU A;  5GAN 5;  2QDL A;  2V1Q A;  1HXD A;  2X4W A;  1VQ7 T;  4OGE A;  2CT4 A;  1N27 A;  4KT0 E;  4M77 A;  4XTY A;  1BI3 A;  2YHT A;  1YJ9 T;  2Y4X A;  1N8R R;  3H8Z A;  1J3T A;  4BDY A;  1RAH B;  2WAC A;  5GMK j;  3M57 A;  4RTX A;  3DLM A;  2LRQ A;  1D3B A;  4HVV A;  4OMM A;  1IGU A;  1VQ7 Q;  4M7D E;  1N9R A;  3CBO A;  1CKA A;  1YJ9 Q;  1UGP B;  2QI2 A;  4LUE A;  1MMN A;  1IB8 A;  3EG1 A;  4J9E A;  1K9M R;  2CSQ A;  2XKO C;  4GY5 A;  2DIQ A;  3OMG A;  2DIL A;  4O5V A;  3QG1 A;  4DOW A;  4JPB W;  3CCU T;  4OVA A;  1QLY A;  3L2U A;  4OF1 A;  2ZPI B;  1KC8 R;  1U1T A;  2DTI A;  2PUK B;  3EH2 A;  1B07 A;  2QGG A;  4BE0 A;  2EBP A;  2VGN A;  1RAB B;  2KEA A;  2RQW A;  3VRY A;  2JUF A;  6AT1 B;  3CCU Q;  3JB9 J;  3E9G A;  2EQK A;  2CUB A;  4OML A;  3JCM c;  3CCR Q;  1DJ7 B;  4AFU C;  2E6Z A;  4LDW A;  3PMI A;  4J9B A;  3JCM Q;  2JT4 A;  5GAN 4;  1M90 C;  2E10 A;  5FU6 C;  3F70 A;  4RKU E;  5LJ3 j;  2KT8 A;  4F16 A;  2KAF A;  3BW1 A;  2K4Y A;  3HRU A;  3X28 B;  3OYK A;  2LQW A;  1SSF A;  2DXB A;  1UGQ B;  2EYQ A;  1WLP B;  4M7D C;  4RMO A;  2LCS A;  4XTX A;  3SWN C;  5GAO m;  3Q1J A;  3R6O A;  1VQ8 T;  3REA B;  2VV5 A;  3E19 A;  1D0X A;  2DNU A;  1BKB A;  2LVM A;  1YJN Q;  3OW2 A;  1YP5 A;  2L3R A;  2PUO B;  3L1A A;  2V8I A;  5DY9 A;  2PZ1 A;  3L42 A;  2QK0 A;  1GFC A;  4JRK A;  4N0A C;  1QVF A;  3I55 A;  2RMO A;  3OYM A;  3V7C A;  3VS6 A;  3QZ5 B;  4DEX A;  1NJI C;  1UEC A;  2JXB A;  1O9S A;  4RTT A;  4LDU A;  3I5R A;  4C8Q D;  3CC7 T;  3NFC A;  1KHI A;  2HAX A;  1H64 1;  3JCM b;  4DQ2 A;  1SF9 A;  3GOX A;  2KYB A;  3MO8 A;  3BDL A;  2ED1 A;  3SHW A;  4M78 E;  2DET A;  4C5E A;  5CKD A;  3G4S A;  5GAM f;  4PJO D;  1AWJ A;  2LJ0 A;  3OYL A;  4C0G A;  2MYS A;  2QA4 Q;  9ATC B;  2XDB A;  1YI2 A;  2DD4 A;  1NLO C;  4M78 G;  2JS0 A;  3QZ9 B;  4IIO A;  4ATO A;  3RIR A;  4X1V A;  1H3Z A;  2C0O A;  2KMT A;  3CD6 T;  4JLG A;  3QDR B;  3T9N A;  3H41 A;  2RM4 A;  2E5K A;  2J06 A;  2O9S A;  1UTI A;  2KT1 A;  2DD5 A;  4PJM A;  2A37 A;  1Y71 A;  4JJN K;  2IG0 A;  1WX6 A;  2QTX A;  1UJY A;  3EFO A;  1KQ1 A;  1YIT Q;  2KQW A;  4PFO A;  4A63 B;  5GAN d;  3ZFJ A;  2FO0 A;  2GTO A;  4DBH A;  5IAY A;  1IRX A;  1BIB A;  1WPY A;  2DYB A;  1X2K A;  1IRE B;  2LCL A;  4MML A;  4KGX B;  2C0I A;  1KG1 A;  3LGF A;  2X4X A;  3I35 A;  5IT9 E;  3CCE T;  1P92 A;  1WHM A;  3A1P A;  2XDP A;  4OP0 A;  1YNZ A;  2MK5 A;  3CCV Q;  3CXC P;  4HCZ A;  2X4Y A;  5LJ3 d;  5CO7 A;  2E6N A;  1BU1 A;  1WFW A;  1MV3 A;  5GMK i;  4M75 C;  2FPE A;  1WQW A;  2F1L A;  4MDW A;  3UAT A;  3JB9 F;  4M7D B;  3SWN B;  1O75 A;  2I0N A;  4JRQ A;  1GCP A;  1D1C A;  2JM8 A;  2JTF A;  3DB3 A;  3M0S A;  4HKE A;  3M9Q A;  2LT4 A;  3V8J A;  2KVQ G;  4J9C A;  5LJ3 g;  1H8K A;  3JV3 A;  1IHW A;  1X27 A;  1WHL A;  1VQ6 T;  1TUC A;  5A2Q E;  3BE3 A;  1W70 A;  4A4G A;  2HEQ A;  2KDS A;  3FRN A;  1VQM A;  2HBP A;  3CBM A;  3QDF A;  1VYT A;  1QKX A;  3MCA B;  1VQ8 A;  2X35 A;  3EGX B;  1RAC B;  4M7D A;  3SWN A;  3JB9 H;  1PD0 A;  1VQ6 Q;  3OYI A;  2LDM A;  1S72 T;  1RAG B;  5D6Y A;  3EGD B;  2GFU A;  4KH1 B;  3NGP A;  2CP6 A;  3I56 A;  4C92 G;  2NYS A;  2HBW A;  2RHI A;  2O9V A;  1VA7 A;  3D7S B;  2OI3 A;  1KD1 C;  2CP2 A;  2CZ6 B;  4F04 B;  3X26 B;  1AWW A;  2DL8 A;  2DBK A;  1QP2 A;  1S72 Q;  2DF6 A;  4N0A A;  2O4X B;  1T0H A;  1A0N B;  2QEX T;  3CCJ T;  1UDL A;  3OYG A;  2M9U A;  3CC7 A;  2QYZ A;  1M90 U;  1LPL A;  4F7U B;  3A8M B;  3EGX A;  2GGR A;  4M77 E;  3VRZ A;  2YRD A;  4II1 A;  5KYU B;  4D8D A;  3CCJ Q;  3EGD A;  5FWC A;  2RB6 A;  2LJ3 A;  1TUG B;  3H9N A;  1TH7 A;  3OYH A;  2WSF E;  1SRL A;  4ZGD B;  5FRO A;  2GQV A;  2QXF A;  2F2V A;  3J7A F;  1JXO A;  4NL3 A;  1D09 B;  2HDA A;  1WJR A;  2OTL A;  1AWO A;  1I8F A;  3CD6 A;  2YRV A;  3PT9 A;  1K76 A;  2XD0 A;  2ZPB B;  1K9M U;  2DO3 A;  2CYZ B;  2FB7 A;  3QJY A;  3A5Z B;  2CP5 A;  3DKM A;  3CME T;  3CCS Q;  4M75 B;  3IQL A;  4F7U A;  1I5L A;  2VVK A;  3P8B B;  4L6V 5;  4BE1 A;  5D6W A;  1TOV A;  1BIA A;  2FYK A;  4PKC C;  3MJX A;  1ZX6 A;  4OGC A;  1S1N A;  4XU1 A;  4XTW A;  4E6R A;  2JM9 A;  5C6S A;  2MI6 A;  3EAE A;  3LWH A;  5CKB A;  3CCM A;  2Z0W A;  3QUI A;  4M77 C;  3VJP A;  4EDU A;  1SG5 A;  3CCE A;  3LGL A;  2YUP A;  2ZPF B;  1YJW T;  4J83 A;  3S3M A;  1BI0 A;  3MEA A;  1KQS A;  1YCY A;  2E1H A;  2JMC A;  2DK3 A;  4XTU A;  3M0R A;  1I5O B;  4LXC A;  2RJC A;  2EIF A;  2RK2 A;  2F5K A;  5LJ5 f;  4E7Z A;  3OA6 A;  1K8A U;  1RI9 A;  1VQO A;  1H92 A;  4UC4 A;  1W2B S;  3EFR A;  1G2B A;  5J3B A;  2FZG B;  1YJW Q;  1OU9 A;  3P8H A;  4M75 A;  2J6K A;  4J9D A;  1VQ9 T;  1YIJ A;  4PJO C;  4DEY A;  1KJW A;  1D1A A;  4FSS A;  1M2V B;  2QQA A;  2DA9 A;  4XTZ A;  2CH4 A;  3SEM A;  4M78 F;  1W6X A;  4CC2 A;  4N4H A;  4GLK A;  4RUG A;  1VQ4 A;  3FJ5 A;  1EZZ B;  1M27 C;  1VQ9 Q;  3CC2 T;  5FRN A;  5CQY A;  3REB B;  1OUL A;  4X34 A;  1RAF B;  3C12 A;  2LQK A;  4Y28 E;  4AFQ C;  2MCN A;  3EG9 A;  2YUO A;  3EG3 A;  4ESR A;  4X9C A;  1X6B A;  4M7A B;  3CMA A;  1HSQ A;  1NYG A;  4C0F A;  4AG1 C;  4QVZ A;  1G3W A;  4VUB A;  5GAN 8;  4OMF B;  3A8O B;  3CCL T;  4C0D C;  3OYC A;  1K73 C;  3OYA A;  1KQ2 A;  1R77 A;  4J9G A;  4J9I A;  5GAM e;  1IZ6 A;  1Q95 G;  1UHF A;  3VS2 A;  1Y96 A;  2IPO B;  2NUT B;  2QEX A;  3ULR B;  4MZM A;  3TU4 K;  2ED0 A;  3OQ5 A;  1IXD A;  3ASK A;  1RAE B;  5GAN h;  2CP3 A;  1SHF A;  2P4R A;  5IXB A;  1JO8 A;  3E2U A;  1M1G A;  1UGS B;  1M8V A;  2JVV A;  1N5Z A;  2KGT A;  2KY9 A;  2DTH A;  4L5G A;  3CCQ A;  1VQK A;  2D8H A;  1GBR A;  4F14 A;  3JAM E;  3SB2 A;  1TWB A;  3M5A A;  4RTY A;  1ZA2 B;  2YRC A;  3VUZ A;  5DLO A;  3OW2 S;  5IHN A;  2D1X A;  3ER0 A;  1AOJ A;  1OPK A;  2A28 A;  4Z02 A;  5L8R E;  5IN1 A;  2YWW A;  4QW2 A;  2NUT A;  1PM3 A;  4C8Q B;  2D6F A;  1NZ9 A;  4JLI A;  1I1J A;  4Z89 A;  1WHJ A;  1C6V X;  3JB9 G;  2KYM A;  4BY6 C;  1HYO A;  1WHK A;  2E3H A;  4EMK C;  1QVF S;  3CME A;  1AWX A;  2BUD A;  3JCM e;  4XU0 A;  3VKI A;  1X01 A;  2RQR A;  4WTO B;  2V1R A;  2BZY A;  1Q81 C;  1Q86 C;  4IUT A;  3ZL7 C;  1MGQ A;  4PJO B;  5CIU A;  1VQN Q;  1M90 R;  1OQK A;  3QBY A;  2NUP B;  4Z88 A;  3ME9 A;  3AT1 B;  3V8K A;  2H3E B;  1SEM A;  2B86 A;  2FPF A;  3OY9 A;  4OB2 B;  2RO0 A;  3VUB A;  1M9S A;  2LMJ A;  2P4T A;  4C8Q A;  3H0H A;  3KUF A;  2CRE A;  2ZPH B;  4LD6 A;  2D8J A;  1RLQ C;  1KIK A;  5KYY B;  3G71 T;  2RHY A;  2O01 E;  2DXC A;  1X75 C;  1AZG B;  4TVR A;  3M56 A;  4B6M A;  3OYD A;  4PJO A;  4M77 F;  2P0K A;  1D1B A;  1X6G A;  2DL5 A;  2CZ0 B;  1NJI R;  4OMN A;  5D7U A;  4PLI A;  4XK8 E;  3G71 Q;  3EHQ A;  4C0D B;  4M7D G;  3CC2 A;  3KBG A;  1GCQ C;  2LC4 A;  5I2M A;  1JJ2 S;  3CCR T;  3C0C A;  1XTD A;  1FXX A;  4E7L A;  1NM7 A;  3FB9 A;  5GAN j;  4M7A D;  2KXD A;  1QKW A;  3FC3 A;  2BZ8 A;  2KI7 A;  1MND A;  1Z9Q A;  3HFN A;  4BD3 A;  2GTJ A;  1MHN A;  1QW1 A;  3O8V A;  4E7J A;  2L3P A;  1X2Q A;  1M3A A;  3HP9 A;  1WXU A;  2D0Q B;  2JS2 A;  3CPW P;  1K8A R;  3CCL A;  4FM4 B;  1YJN T;  1VQP T;  2HKN A;  2DJZ A;  3TQ7 P;  2L3S A;  3VS5 A;  3OS0 A;  4AG2 C;  4C92 D;  1QVG S;  1SSH A;  1VQP Q;  3RES A;  2PQW A;  2PVD B;  4OB0 B;  1NBE B;  4HXJ A;  4BY6 B;  1OYX A;  3DB4 A;  1WI7 A;  2HQX A;  4EMK B;  1PKT A;  2A08 A;  5CKH A;  1PRM C;  3TEE A;  4CC4 B;  4F7U E;  1M2O A;  3QJ6 A;  2OTJ T;  1RI0 A;  2VUB A;  4BDZ A;  2DX1 A;  8ATC B;  5CR2 A;  4M4Z A;  1V76 A;  2ZGW A;  3QYG B;  4E7S A;  5LJ3 f;  2O88 A;  2PVO B;  4XU3 A;  3CBP A;  2DZ9 A;  1FWZ A;  5CK9 A;  4LD9 K;  3ZEH A;  4J5Y A;  4JZ4 A;  1GL5 A;  2EAY A;  2QA4 T;  3M55 A;  1I07 A;  2OTJ Q;  2KXC A;  5AT1 B;  2XK0 A;  4C0Z A;  4KRT A;  1U5S A;  3GLX A;  4FIB A;  3L2Z A;  3J81 E;  2E3I A;  2XHC A;  1VQL Q;  1VQ5 A;  2XI9 A;  1K0S A;  2LT1 A;  4EMK A;  1QWE A;  3M0Q A;  3EG0 A;  4M75 E;  5I2S A;  1WZO A;  3PNW C;  1Q82 C;  4B9X A;  2LQN A;  4CC3 A;  3PTA A;  1WIE A;  4JJD A;  1T0J A;  2VKN A;  2YLB A;  2DVE A;  4HA8 A;  4MMK A;  3MP1 A;  2FHD A;  2QAZ A;  4J6Y A;  1YIT T;  2EQU A;  2K3Y A;  4J6X A;  2L89 A;  1VQ7 A;  2DE0 X;  2C06 A;  2RH2 A;  4JS4 A;  5HY6 A;  4XQ3 A;  5C0M A;  1YJ9 A;  3OSS C;  2RA2 A;  1NPP A;  1IO6 A;  3HL8 A;  2JOY A;  5IHI A;  4J8O A;  3RMQ A;  3N5B B;  3CCV T;  1BYM A;  4DA4 A;  2BIV A;  1JJ2 A;  3OYJ A;  3M53 A;  4FT2 A;  2KRM A;  1LNX A;  4JJC A;  2HQH A;  4MDX A;  2MWO A;  1UE9 A;  1AVZ C;  4QKU A;  1KD1 R;  1Y7X A;  2OTL Q;  2YXY A;  5HKC A;  4FW2 A;  4P5N A;  2QGF B;  4E7H A;  3CCU A;  3VS0 A;  1Q86 U;  4OMP A;  4RTU A;  2BE7 D;  2RQT A;  5GAN 6;  3CCR A;  4HT8 A;  1GCQ A;  3TCJ A;  3RBB B;  3JCM V;  1ZUU A;  2AZS A;  2F5T X;  5GAN g;  5J26 A;  4V2S A;  3PIO A;  2FG0 A;  1I0C A;  2B8A A;  4BI3 A;  2XG8 D;  1UB4 A;  2BZX A;  1KQS S;  1QQJ A;  1QVG A;  3PMT A;  1NLP C;  1I81 A;  3THK A;  1RLP C;  4M7A E;  2X9H A;  2YDL A;  4EIK A;  1YJN A;  2EWN A;  2P0P A;  4MZT A;  3VS7 A;  2CS7 A;  3OYE A;  2RJF A;  1WJS A;  2J6O A;  1WXT A;  1ARK A;  2ESW A;  5GAM d;  1SKU B;  2COZ A;  4K11 A;  1X69 A;  1M1K C;  2EPD A;  1U1S A;  3MEW A;  3C4S A;  2KSS A;  1OOT A;  2MPX C;  3FJP A;  2F69 A;  1HD3 A;  2RQU A;  1ABO A;  1WHH A;  4IIM A;  4WF2 A;  2CUD A;  4NS5 A;  2DMO A;  1OV3 A;  4BAC A;  2YT6 A;  2M1H A;  4QQ6 A;  3A8L B;  4J6W A;  3CXC A;  1K1Z A;  4KUD K;  4M7D F;  2X51 A;  4FU6 A;  4DBR A;  2RF0 A;  4HCC A;  4E7K A;  2K2M A;  1T3S A;  2E5Q A;  5ECA A;  3CC4 Q;  1MUZ A;  2EKH A;  2QA4 A;  4Y92 A;  2XU8 A;  2JNG A;  1WGS A;  4M7A C;  2ENM A;  1C1A A;  4QQG A;  3VS1 A;  4D8K A;  2COY A;  3JCM W;  4C8Q E;  2EGC A;  3JCM d;  3LW5 E;  1FX7 A;  1K9A A;  1EFN A;  1VYU A;  3QWX X;  2GFA A;  2RD1 A;  4M77 G;  3RKX A;  5KE3 A;  4IUV A;  2FZC B;  1BI2 A;  3JB9 D;  3CCS T;  1TG0 A;  4J9F A;  3SFM A;  2E70 A;  3L2R A;  1NG2 A;  2MAM A;  1PRL C;  2FZK B;  5CKE A;  1LOJ A;  5CAI A;  1VIE A;  4PJO E;  1YWO A;  5DLQ E;  2K5I A;  2O4X A;  2AT1 B;  1QMC A;  4IKF A;  4QVD A;  3EG2 A;  4PJJ A;  3QSU A;  3O5Z A;  1NJI U;  1YHQ Q;  3H0F A;  5J39 A;  4PJO G;  2F2W A;  2K9G A;  4ZGE B;  1X6O A;  2A36 A;  4R56 A;  2DFU A;  3CCV A;  1EX4 A;  5KYU A;  2GNC A;  4AFS C;  5GAO p;  2RK1 A;  4AT1 B;  1QWF A;  2DTO A;  3H6Z A;  2J7I A;  1RAD B;  3GNG A;  5KYX B;  1R8O B;  3G6E Q;  4C8Q C;  4PFZ A;  2V8K A;  4F7U F;  5GAO q;  2JW4 A;  5HCK A;  3OBW A;  1AHJ B;  4LN2 A;  3BDU A;  2EYX A;  1K4U S;  2JZ2 A;  3GIB A;  2HQE A;  1GFD A;  3V7S A;  2HSP A;  2FEI A;  3M58 A;  1B34 B;  2R5M A;  2DZC A;  1BB9 A;  1X43 A;  2LP5 A;  4FT4 A;  3RKW A;  2EYY A;  1PC0 A;  2BTT A;  4JJB A;  1LJO A;  2IIM A;  3URG A;  3WVE B;  4R55 A;  5IH2 A;  1T3L A;  1K0X A;  1VIF A;  3SDZ A;  1UUE A;  1UGV A;  2COW A;  5L23 A;  1AZE A;  1M3B A;  1JBM A;  1ZUK A;  1MV0 B;  2AKK A;  2RN8 A;  1WQ7 A;  3JRZ A;  2JN0 A;  2J6F A;  2RI5 A;  1NYF A;  5KYX A;  1VQ6 A;  1I4K 1;  2EYZ A;  2ROT A;  2VGM A;  2M02 A;  4M75 F;  2PTK A;  4LE9 A;  2VXE A;  2DEQ A;  3JSC A;  4AMC A;  2HCK A;  2K5L A;  2EKO A;  2O2O A;  2AIR B;  1JB0 E;  2JJ9 A;  4AFZ C;  1GXI E;  3QII A;  3QKJ A;  4KH0 B;  1UHC A;  1RUW A;  1ZBX A;  3ZBD A;  1S72 A;  3TSZ A;  4HVU A;  4BE2 A;  4LDX A;  2GBQ A;  3S6W A;  1Q81 R;  1Q86 R;  1M2V A;  4RG2 A;  1BI1 A;  4F17 A;  2KRS A;  3EFS A;  1YWP A;  1JU5 C;  3NPF A;  2DPP B;  4Z8A A;  4PNO A;  3UDC A;  4DBF A;  2LNV A;  2R57 A;  2YUQ A;  2V8J A;  3M0U A;  3CCJ A;  2EGA A;  1WXB A;  2DL4 A;  1PHT A;  1TTH B;  1MMA A;  1CSK A;  1UFF A;  2NUZ A;  1W2B P;  4CC7 A;  1JRI A;  1E6G A;  5FWB A;  4C92 B;  1OX9 A;  2VXF A;  2LJ1 A;  4A4F A;  2ROL A;  1M30 A;  4BUG A;  4M7A A;  2FL7 A;  3WXM B;  5A0L A;  3MEV A;  1Z9Z A;  4EPC A;  2ZCF B;  4L59 A;  1Q7Y C;  5CKF A;  4LDV A;  4PJN A;  4OMO A;  3E1S A;  5GJW B;  4ZTJ A;  5GAN 2;  4A53 A;  2QAS A;  1QP3 A;  3NMZ C;  4FYY B;  2CH4 W;  2ZAE A;  2L3Q A;  4YTL A;  4QQD A;  3OS1 A;  5KYN A;  3UPU A;  3X20 B;  5GMK l;  1EIF A;  3I55 T;  1XQH A;  2EJF A;  1KD1 U;  1VQN T;  3RDV A;  1AEY A;  2K2V A;  5CQX A;  2EQJ A;  2K57 A;  3NTI A;  4M78 D;  4Q5W A;  2PU9 B;  1QVP A;  3OYB A;  2H3J A;  3MHX A;  3I9Q A;  4KGV B;  1TUD A;  3VYH B;  3I55 Q;  1ZSZ B;  3QYH B;  2Y4Y A;  4FYW B;  2YUN A;  5GAM h;  2YSQ A;  1D3B B;  2EJ9 A;  5D6X A;  4GBQ A;  3RNJ A;  3PGG A;  4R0K A;  1YJW A;  3M59 A;  2JTE A;  2I2L A;  4LNP A;  1HJD A;  1UJ0 A;  4WCI A;  3X24 B;  3G4S Q;  4PFP A;  2CP7 A;  3FLG A;  2CDT A;  1ZSG A;  5FU7 C;  1M5Q 1;  1VQ9 A;  1QCO A;  2ZPE B;  3L2W A;  1G3Y A;  2EJG A;  5AYF A;  3OYN A;  4FCY A;  1YI2 Q;  1ACM B;  1PKS A;  3FEO A;  3FIF A;  1AD5 A;  5IXF A;  4XU2 A;  1ZSZ A;  1PCX A;  1ZUY A;  1KHC A;  3OS5 A;  2DIG A;  2NUP A;  3U23 A;  4C8Q F;  4LDY A;  3VU3 C;  1KK7 A;  3OW2 P;  3LH0 A;  2RNA A;  3M0T A;  1XOV A;  3JCM X;  4IUR A;  4ELY C;  3OB9 A;  2KR3 A;  3GBQ A;  4ORZ A;  3C94 A;  1PG5 B;  1B7T A;  3FDR A;  1U3O A;  3MET A;  1ZA1 B;  2SEM A;  2EYW A;  2GQI A;  2DXU A;  1QVF P;  3JCM h;  2DBM A;  2A7Y A;  5FW9 A;  2ECZ A;  3M4G A;  3A98 A;  4PJO F;  4HCB A;  3HKS A;  2RJD A;  3LH5 A;  2AHJ B;  3RR6 A;  5KYY A;  5I11 A;  1M4Z A;  4B9W A;  1Q82 R;  3RUX A;  2CP0 A;  3M4Y A;  4JRI A;  2M16 A;  2EQI A;  2DEU A;  1ZLM A;  1BK2 A;  3V7R A;  3CQT A;  1U8R A;  1NPR A;  3M0P A;  4FL6 A;  3C95 A;  1U06 A;  3G7Z A;  1KFZ A;  1M1F A;  3JCM J;  1WJQ A;  2K7A A;  1MMG A;  1Y07 A;  2KE9 A;  4OB3 B;  4RG8 A;  1G5V A;  5GAN f;  2PNI A;  2RQV A;  2K3X A;  5CVI A;  4DOV A;  2QQS A;  1M8M A;  1UG1 A;  1VQM T;  5I21 A;  4ZNX A;  1N8R C;  2LTO A;  3CEY A;  1IHV A;  2K5F A;  2XIC A;  5GAM j;  3LLR A;  3TVT A;  1VQL T;  2L2P A;  3G1J A;  2J05 A;  3PFS A;  1N6A A;  4BI4 A;  3I56 T;  5GJV B;  4F7U G;  1VQM Q;  1JJ2 P;  2AZV A;  1VQ8 Q;  2HKQ B;  4GLM A;  3UT1 A;  1IGQ A;  3VV0 A;  4C5G A;  1OU8 A;  2Y90 A;  2RHU A;  1RAA B;  1K9M C;  4HCK A;  1K73 U;  1VQN A;  4N4G A;  1OZ3 A;  1RL2 A;  4M77 D;  5I22 A;  3J80 E;  1C0M A;  3I56 Q;  3CXC S;  2G6F X;  2LQ8 A;  2C0T A;  1VOM A;  3BFM A;  2ZPG B;  2JMA A;  5LJ5 e;  1KC8 C;  4J9H A;  3AHU A;  5FU7 B;  4A4H A;  3E9F A;  2RHZ A;  3CPW A;  2HD0 A;  2LNH B;  3EFO B;  4E2F B;  3UWN A;  3JCM P;  2L5Q A;  3OSV A;  2DKG A;  3CC7 Q;  4M75 G;  2HMA A;  1Q7Y U;  2K6D A;  4N4I A;  5CCA A;  2A0F B;  4OMQ A;  1M1K R;  1QVG P;  2X3X D;  4MZP A;  1K8A C;  1XNI A;  4X9D A;  2KRO A;  1YCS B;  2OTL T;  4IUP A;  2R58 A;  3KFV A;  2DM1 A;  3G71 A;  3QPH A;  4CRI A;  1OX8 A;  4FYV B;  4CI0 C;  1H3H A;  7AT1 B;  5M9O A;  2QTV A;  3VS3 A;  3CD6 Q;  2KNB B;  1V29 B;  4KGZ B;  2DXT A;  1Q81 U;  2RI3 A;  4JRP A;  2KRN A;  2XID A;  4ZN1 A;  3HRT A;  3VS4 A;  3UA7 A;  5FLX E;  4ANJ A;  3CCM T;  4HT9 A;  1TS9 A;  1LVK A;  4M78 C;  4FW1 A;  4PL6 A;  4A4E A;  3EH1 A;  5FU6 B;  3JCM f;  3UF4 A;  4HVW A;  5A0G A;  1ZHI A;  4JDS A;  4NOY A;  2HZY A;  5LJ5 h;  1G3T A;  1YBY A;  2L8D A;  4EMH A;  4OB1 B;  2P84 A;  4NL2 A;  2ATC B;  2LX9 A;  1VQO T;  1WHG A;  3GPL A;  3CCM Q;  3CCE Q;  2X3W D;  2ABL A;  3MKD A;  1WYX A;  2RHX A;  3X25 B;  4QT7 A;  1VQP A;  3EGU A;  1QCN A;  1YIJ T;  3MP8 A;  4QVC A;  5GAO n;  4KBM B;  2QQB A;  2HNI A;  1VQO Q;  2EQM A;  2VAS A;  2LCC A;  1UEB A;  1NE8 A;  4M7A G;  1FMW A;  1VQ4 T;  5GAO l;  2EVR A;  2F2X A;  3H0I A;  1YIJ Q;  2DL7 A;  2QDY B;  1JEG A;  1D0Y A;  3NHN A;  3JB9 I;  2VYT A;  1GRI A;  3S3N A;  1G3S A;  3LYI A;  2DER A;  4PJL A;  1FYN A;  4BI8 B;  1VQ4 Q;  4C92 E;  1M3C A;  3CC4 T;  2OTJ A;  4RTV A;  1ZBJ A;  1BBZ A;  4D6W A;  1BCM A;  5GAM g;  2D9T A;  2FRY A;  5KH6 A;  8AT1 B;  3DLL A;  2LZ6 B;  4FYX B;  4DBQ A;  3A8G B;  1VQL A;  3CMA T;  4E47 A;  5EC7 A;  3MPU B;  2R5A A;  1PWT A;  2KK4 A;  4Y91 A;  3OYY A;  3HSB A;  4ZGJ B;  1YN8 A;  2AK5 A;  5HK3 A;  2E65 A;  4BB7 A;  1SPK A;  2QQ9 A;  1V1C A;  4JZ3 A;  3CMA Q;  2DVJ A;  1G83 A;  2JTM A;  3GP8 A;  1SRM A;  1D0Z A;  2HSE B;  1YFN A;  5A0D A;  1KQS P;  3M54 A;  4XAX B;  4ZTF A;  2CT3 A;  3TSW A;  2EFI A;  3MEU A;  1KSW A;  1SHG A;  1B3Q A;  4KUI A;  5KCH A;  1NEG A;  2DRM A;  4O6J A;  1YHQ T;  4C8Q G;  4C5H A;  2E64 A;  2QEX Q;  4RCB A;  3LX7 A;  3GNF B;  2M0O A;  1YIT A;  3CCQ T;  5KE2 A;  1AT1 B;  1N8R U;  1VQK T;  4C92 C;  2DL3 A;  4RCC A;  5DM7 R;  1QCF A;  3JCM g;  3RMS A;  1OEB A;  5FRM A;  2D0N A;  3L2Q A;  5GMK m;  3G6E T;  4M78 B;  5LJ5 j;  1E6H A;  3CCQ Q;  2SRC A;  1VQK Q;  1E7O A;  5KCO A;  1CKB A;  2H8H A;  3P8D A;  1VUB A;  2CZ1 B;  1NEB A;  2DRK A;  2K3B A;  2M0Y A;  1K73 R;  3PVQ A;  3OMC A;  5GMK e;  3INZ A;  3BY7 A;  3HRS A;  2KBT A;  1ABQ A;  5IHK A;  1KC8 U;  2WSE E;  3PVL A;  2EW3 A;  3RKY A;  1Q82 U;  2RJE A;  2OAW A;  4IUU A;  3CME Q;  4PK4 A;  2NLU A;  3VYG A;  2FRW A;  2GCX A;  1W1F A;  1ZSZ C;  2PVG B;  1N9S A;  2E41 A;  4M7D D;  2OX7 A;  4M78 A;  3EG9 B;  4JS5 A;  1ZQ1 A;  1Q7Y R;  1W4S A;  2HL5 C;  2E4H A;  4IUQ A;  3OYF A;  3R6N A;  2CZ7 B;  3QXE B;  2FPD A;  4J7F A;  2CKK A;  5GAN e;  3HHT B;  2QQR A;  2HL3 A;  2YLC A;  3GF5 A;  1XJW B;  2EGE A;  2VWF A;  1OZ2 A;  3QWY A;  1UGR B;  4XTV A;  1B34 A;  5LJ3 e;  2ZZD A;  5LL6 S;  4RTZ A;  2L0A A;  3UA6 A;  1WA7 A;  1LCK A;  2O31 A;  1Y96 B;  2K79 A;  3CPF A;  3QHS A;  4PLL A;  1OPL A;  2V26 A;  4EMG A;  2DLP A;  1PNJ A;  2CSI A;  2NWM A;  2MOX A;  3LWI A;  2RI2 A;  3CC4 A;  1MNE A;  1JXM A;  5GMK h;  2RPN A;  1TXQ A;  2LX7 A;  5GAN 7;  3CC2 Q;  5GAO r;  1BCO A;  4RTW A;  3I5S A;  2X4J A;  3MP6 A;  1FMK A;  2P0Q A;  3A8H B;  1PSE A;  5KYW B;  1PSF A;  1FMV A;  1GBQ A;  4LUD A;  3OS2 A;  2XMF A;  3EHR A;  3QO3 A;  3TRE A;  2BE9 B;  2AKL A;  1Y0M A;  4JUV A;  1RAI B;  4C5I A;  2CGH A;  2A3L A;  1VYV A;  1M1K U;  3PIP A;  3CCL Q;  1HK9 A;  5LJ5 d;  2OJ2 A;  3SD4 A;  2M51 A;  3CCS A;  2E12 A;  1MMD A;  1YHQ A;  2QG9 B;  2XDD A;  4A4K A;  1R0C B;  5KYW A;  4ELZ C;  3L2V A;  1WNL A;  4M7A F;  3HFO A;  2WSC E;  2MIO A;  1F1B B;  3PE0 A;  5LJ3 h;  5GAN 3;  2VC8 A;  3NTH A;  3S3O A;  4C92 A;  1OI1 A;  1R0B G;  5LJ5 g;  3HTR A;  4M77 B;  3G6E A;  3NTK A;  3OBY A;  4FSX A;  2DYI A;  2IVW A;  4M75 D;  4KUL A;  4E7I A;  1G8X A;  1TU0 B;  3V8L A;  3G4S T;  1VQ5 T;  2W10 A;  2MF2 A;  2W0Z A;  4ZN3 A;  2MWP A;  3HPW A; 
#chains in the Genus database with same CATH homology
 1Y57 A;  1WDX A;  1OOT A;  2AZV A;  4GLM A;  2J6K A;  4J9D A;  2DJQ A;  4DEY A;  1KJW A;  1HD3 A;  2RQU A;  4HCK A;  1ABO A;  4FSS A;  2DA9 A;  4IIM A;  1JQQ A;  5I22 A;  2CUD A;  2CH4 A;  3SEM A;  1W6X A;  2G6F X;  4CC2 A;  2DMO A;  1OV3 A;  2C0T A;  4RUG A;  2QDL A;  2V1Q A;  2JMA A;  2YT6 A;  3FJ5 A;  4J9H A;  1M27 C;  3REB B;  2CT4 A;  1K1Z A;  2LNH B;  1J3T A;  2RF0 A;  4AFQ C;  2MCN A;  4RTX A;  2K2M A;  1T3S A;  5ECA A;  2YUO A;  3EG3 A;  4HVV A;  1MUZ A;  2EKH A;  4OMM A;  2K6D A;  4Y92 A;  4ESR A;  1X6B A;  4OMQ A;  2ENM A;  1CKA A;  4LUE A;  2X3X D;  3VS1 A;  1HSQ A;  4D8K A;  1NYG A;  3EG1 A;  4AG1 C;  2KRO A;  4J9E A;  1YCS B;  2EGC A;  2CSQ A;  1K9A A;  2DIL A;  1EFN A;  3KFV A;  2DM1 A;  1VYU A;  3QWX X;  4JPB W;  4J9I A;  4J9G A;  1TG0 A;  1QLY A;  4J9F A;  1UHF A;  1NG2 A;  3VS2 A;  1PRL C;  1H3H A;  1B07 A;  3ULR B;  1YWO A;  2EBP A;  3VRY A;  2KEA A;  2RQW A;  3VS3 A;  2ED0 A;  2KNB B;  2KRN A;  3EG2 A;  2CUB A;  1SHF A;  3VS4 A;  2P4R A;  3O5Z A;  4OML A;  5IXB A;  1JO8 A;  3UA7 A;  3H0F A;  4AFU C;  2F2W A;  4J9B A;  1N5Z A;  2JT4 A;  2K9G A;  2KGT A;  2A36 A;  2GNC A;  2KT8 A;  4F16 A;  3UF4 A;  2D8H A;  4AFS C;  4F14 A;  4HVW A;  1GBR A;  2LQW A;  1QWF A;  4RTY A;  1WLP B;  2LCS A;  5IHN A;  2D1X A;  2J7I A;  1AOJ A;  1OPK A;  2A28 A;  2X3W D;  2ABL A;  3REA B;  1WYX A;  4QT7 A;  2DNU A;  2JW4 A;  5HCK A;  3EGU A;  1I1J A;  4Z89 A;  4LN2 A;  1YP5 A;  2EYX A;  2KYM A;  1K4U S;  1GFD A;  2HSP A;  2FEI A;  1AWX A;  1BB9 A;  1X43 A;  2LP5 A;  2PZ1 A;  2RQR A;  1GFC A;  2EYY A;  2EVR A;  2BTT A;  2F2X A;  2V1R A;  4JJB A;  2BZY A;  2IIM A;  3H0I A;  2RMO A;  2DL7 A;  3ZL7 C;  3VS6 A;  4DEX A;  1JEG A;  5IH2 A;  1T3L A;  1UEC A;  1K0X A;  2JXB A;  3NHN A;  1UUE A;  1UGV A;  4RTT A;  4Z88 A;  1GRI A;  5L23 A;  1AZE A;  1M3B A;  3I5R A;  1SEM A;  1ZUK A;  1MV0 B;  2B86 A;  1FYN A;  2AKK A;  2RN8 A;  2FPF A;  1M3C A;  2J6F A;  4RTV A;  1ZBJ A;  1BBZ A;  1NYF A;  2FRY A;  2EYZ A;  2LMJ A;  2ROT A;  2KYB A;  2LZ6 B;  2ED1 A;  2PTK A;  4LE9 A;  3SHW A;  3H0H A;  2CRE A;  5EC7 A;  2HCK A;  1PWT A;  2D8J A;  1RLQ C;  2O2O A;  1AWJ A;  4AFZ C;  1YN8 A;  2AK5 A;  2LJ0 A;  1KIK A;  1SPK A;  1RUW A;  1AZG B;  1UHC A;  1V1C A;  1NLO C;  3TSZ A;  4JZ3 A;  2JS0 A;  4HVU A;  2DVJ A;  2GBQ A;  1G83 A;  4IIO A;  1SRM A;  4X1V A;  2C0O A;  4F17 A;  1X6G A;  2DL5 A;  2KRS A;  2CT3 A;  4OMN A;  3H41 A;  3TSW A;  3EHQ A;  2E5K A;  1YWP A;  1GCQ C;  1KSW A;  1JU5 C;  1SHG A;  2J06 A;  1B3Q A;  2O9S A;  1UTI A;  3NPF A;  2KT1 A;  4Z8A A;  1NEG A;  2DRM A;  2A37 A;  2YUQ A;  3M0U A;  1WX6 A;  3C0C A;  1UJY A;  2EGA A;  1NM7 A;  1WXB A;  2DL4 A;  2KXD A;  1QKW A;  1PHT A;  2BZ8 A;  1UFF A;  1CSK A;  4A63 B;  2NUZ A;  2DL3 A;  4CC7 A;  1E6G A;  2FO0 A;  5FWB A;  2GTO A;  1Z9Q A;  1QCF A;  2LJ1 A;  2DYB A;  2ROL A;  1M30 A;  1X2K A;  2GTJ A;  2C0I A;  1OEB A;  2D0N A;  3I35 A;  2L3P A;  1X2Q A;  1Z9Z A;  1M3A A;  1WXU A;  1E6H A;  2JS2 A;  1YNZ A;  2SRC A;  4OMO A;  5GJW B;  1E7O A;  1CKB A;  3NMZ C;  2H8H A;  1BU1 A;  1WFW A;  1MV3 A;  2CH4 W;  2FPE A;  2L3Q A;  1NEB A;  3UAT A;  2L3S A;  3VS5 A;  2DRK A;  2K3B A;  2M0Y A;  3PVQ A;  4AG2 C;  2I0N A;  1GCP A;  2KBT A;  1SSH A;  1ABQ A;  2JM8 A;  5IHK A;  3PVL A;  1AEY A;  3M0S A;  2EW3 A;  4HXJ A;  2OAW A;  1WI7 A;  1PKT A;  2A08 A;  1PRM C;  4J9C A;  4CC4 B;  2FRW A;  1H8K A;  1W1F A;  3JV3 A;  3I9Q A;  1TUD A;  1X27 A;  2DX1 A;  1TUC A;  4M4Z A;  2O88 A;  1W70 A;  2HEQ A;  2YUN A;  2YSQ A;  1VYT A;  1QKX A;  4GBQ A;  3R6N A;  4R0K A;  3RNJ A;  4JZ4 A;  1GL5 A;  2FPD A;  2JTE A;  1I07 A;  2KXC A;  4KRT A;  4LNP A;  1HJD A;  1U5S A;  1UJ0 A;  4WCI A;  3NGP A;  2EGE A;  1K0S A;  2VWF A;  2HBW A;  3QWY A;  2O9V A;  1VA7 A;  2CDT A;  1ZSG A;  1QWE A;  3M0Q A;  3EG0 A;  2OI3 A;  4RTZ A;  2L0A A;  3UA6 A;  1WA7 A;  1LCK A;  2DL8 A;  2O31 A;  1AWW A;  2DBK A;  1PKS A;  2K79 A;  2LQN A;  4CC3 A;  1AD5 A;  5IXF A;  2DF6 A;  1WIE A;  4JJD A;  1ZUY A;  1OPL A;  1T0H A;  1T0J A;  2VKN A;  2DLP A;  1A0N B;  1PNJ A;  1UDL A;  2CSI A;  2NWM A;  2MOX A;  3U23 A;  1JXM A;  2RPN A;  2LX7 A;  2DE0 X;  2RNA A;  3M0T A;  1XOV A;  4RTW A;  3I5S A;  2GGR A;  1FMK A;  2KR3 A;  3GBQ A;  4ORZ A;  3VRZ A;  1IO6 A;  4D8D A;  1U3O A;  2SEM A;  5IHI A;  1GBQ A;  2EYW A;  4LUD A;  2GQI A;  5FWC A;  2LJ3 A;  2DBM A;  5FW9 A;  2ECZ A;  2XMF A;  3A98 A;  3EHR A;  2AKL A;  1Y0M A;  1SRL A;  3LH5 A;  2KRM A;  5I11 A;  4JJC A;  1UE9 A;  1AVZ C;  2F2V A;  1JXO A;  2HDA A;  1AWO A;  1VYV A;  1K76 A;  2EQI A;  1ZLM A;  3VS0 A;  1BK2 A;  3CQT A;  2OJ2 A;  3M0P A;  4OMP A;  1U06 A;  4RTU A;  1KFZ A;  2M51 A;  2RQT A;  3IQL A;  1GCQ A;  2VVK A;  3RBB B;  1ZUU A;  2AZS A;  2K7A A;  2FG0 A;  1I0C A;  1ZX6 A;  1S1N A;  2MIO A;  4E6R A;  2JM9 A;  2KE9 A;  3PE0 A;  2PNI A;  2RQV A;  2BZX A;  1NLP C;  1M8M A;  1UG1 A;  4ZNX A;  3THK A;  2YUP A;  1RLP C;  2YDL A;  4EIK A;  2JMC A;  3M0R A;  3TVT A;  2L2P A;  3VS7 A;  2J05 A;  2J6O A;  1WXT A;  2W10 A;  1ARK A;  2ESW A;  2W0Z A;  1RI9 A;  5GJV B;  1H92 A;  4K11 A;  1X69 A;  2EPD A;  1G2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...