2YUPA

Solution structure of the second sh3 domain of human vinexin
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
90
structure length
90
Chain Sequence
b'GSSGSSGKPPTYQVLEYGEAVAQYTFKGDLEVELSFRKGEHICLIRKVNENWYEGRITGTGRQGIFPASYVQVSREPRLRLCDDSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinexin
molecule tags Cell adhesion
source organism Homo sapiens
publication title Solution structure of the second SH3 domain of human Vinexin
rcsb
total genus 6
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2007-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2yupA01
3UA7A 1NLPC 4JJDA 2CDTA 3ULRB 2EW3A 4J9DA 1CKAA 1UE9A 1ABOA 4Z89A 1VA7A 2JT4A 4FSSA 3VRYA 1TUDA 1WXTA 2F2WA 4AFSC 1GCQC 4AFQC 3I9QA 3R6NA 1KSWA 1FYNA 4OMLA 2A37A 4OMOA 4DEXA 2ED0A 4J9BA 1UGVA 4Y92A 5IHIA 2RQRA 2O88A 2FO0A 2DRMA 2ED1A 4J9IA 1VYUA 1YCSB 1W70A 2YSQA 2PNIA 2KXCA 5HCKA 2KROA 2YUNA 1V1CA 1X2QA 3EG2A 3NGPA 1X6BA 2KT1A 2GNCA 3VS4A 3I5RA 3LH5A 4LUDA 3ZL7C 4JZ3A 1QWEA 1YNZA 2I0NA 1UTIA 1TG0A 1BU1A 3M0SA 1RLQC 2C0TA 5I11A 2ESWA 2W10A 1ZLMA 3H0FA 2DA9A 1SRLA 5IHKA 1I1JA 1M3CA 1WX6A 5EC7A 1AZGB 1YWOA 5GJVB 4KRTA 2YT6A 3JV3A 3PVLA 4J9GA 5IXBA 2FPDA 4JJBA 1UFFA 2JM9A 1YP5A 1LCKA 2KT8A 4J9CA 3M0QA 1Z9QA 1E7OA 2K2MA 1YN8A 2JS2A 2J05A 4OMPA 4CC4B 3O5ZA 4CC2A 3VS3A 2BZXA 2BZYA 1HSQA 2RNAA 1ZBJA 3QWYA 1K9AA 3H0IA 2NUZA 2DE0X 1B07A 1G83A 4R0KA 2L2PA 4Z88A 5I22A 1BB9A 2F2XA 2DL3A 2D8JA 2YUOA 2EBPA 2EGCA 2ROTA 1PHTA 2PTKA 1G2BA 2J06A 3M0TA 2CH4W 2L3PA 1SHGA 2PZ1A 4J9EA 1ZX6A 1UJYA 2CSQA 2JW4A 4RUGA 2OJ2A 1MV0B 2VKNA 1ZUUA 2AK5A 1OV3A 2RQWA 3RBBB 2DMOA 1SHFA 4JZ4A 2KNBB 2CT3A 3REAB 2J6KA 1MV3A 2LX7A 4IIMA 2O9VA 3UF4A 1NG2A 2LNHB 3VS6A 1NM7A 1RUWA 4RTXA 1YWPA 2K79A 5FWCA 1WA7A 3EG0A 2YUPA 4ORZA 2HSPA 3EG1A 1A0NB 1UHFA 2BTTA 4F16A 2DL8A 2GBQA 1ARKA 3SHWA 3VRZA 4DEYA 2DRKA 2CSIA 2FG0A 2EPDA 1UHCA 2RQUA 1I0CA 1T0HA 2VWFA 1UJ0A 1QKXA 1QLYA 3EG3A 2DJQA 4GBQA 4RTTA 3A98A 1WXBA 1ABQA 2EKHA 1NEGA 2OAWA 4RTUA 5FWBA 4WCIA 4AG2C 1Z9ZA 1H92A 3M0RA 2CREA 4RTYA 3FJ5A 4M4ZA 2L3QA 2ENMA 4GLMA 3KFVA 1CKBA 1H3HA 2KRSA 2FRYA 1OOTA 2YDLA 2JMCA 4LE9A 3I5SA 1E6GA 1FMKA 3QWXX 1K0XA 2DVJA 2EQIA 1E6HA 1B3QA 2X3XD 2AZSA 2RPNA 2EYZA 1KJWA 4LNPA 5FW9A 2V1RA 3NMZC 2JM8A 1AWWA 2P4RA 3IQLA 1ZSGA 1WI7A 5IXFA 3THKA 1AVZC 1GCPA 1QWFA 2J7IA 2KE9A 4RTWA 2E5KA 3H0HA 2RMOA 4ESRA 1WYXA 1SRMA 2H8HA 2QDLA 4D8DA 4CC7A 4HVVA 1Y0MA 1K4US 3NHNA 2EYXA 2EYWA 3EGUA 1J3TA 1PKTA 3GBQA 1U5SA 2JTEA 2MCNA 4IIOA 1WDXA 2GTOA 1JXOA 1OPKA 5IHNA 1JO8A 1AEYA 3PE0A 4AG1C 2GGRA 4JJCA 3NPFA 1WXUA 2KRMA 2JXBA 4RTVA 2MIOA 3U23A 1TUCA 2BZ8A 2L3SA 1AWOA 1AD5A 3UA6A 1JQQA 1T3SA 1BBZA 2KRNA 1K0SA 1GRIA 2M51A 1PRLC 4OMNA 2EYYA 2CUBA 2D0NA 4F17A 1QKWA 3TSZA 3VS5A 2KGTA 4OMQA 2KYBA 2SRCA 1W6XA 2DM1A 3H41A 1GL5A 1SEMA 2X3WD 2A36A 2DBMA 2AZVA 2V1QA 2M0YA 2L0AA 1XOVA 2DF6A 2FRWA 2K7AA 2EGAA 2LQWA 2LJ1A 2RF0A 1M30A 2MOXA 4AFZC 4RTZA 4CC3A 1UDLA 4A63B 2KR3A 1OPLA 1KIKA 3VS1A 1RLPC 2HBWA 3I35A 1UUEA 5IH2A 1NLOC 2C0IA 5L23A 1PWTA 1M8MA 2RQTA 4E6RA 2HEQA 2W0ZA 2LQNA 2LJ0A 4HVWA 2A28A 1NEBA 1U06A 4OMMA 2O2OA 3M0PA 3TVTA 1X43A 2C0OA 2EVRA 1HJDA 1QCFA 2KBTA 2D1XA 2KEAA 2FPEA 1OEBA 2DL4A 2OI3A 1GBQA 2YUQA 1NYFA 2KXDA 1NYGA 2HCKA 1X27A 1GCQA 2SEMA 1HD3A 1X6GA 2K3BA 2NWMA 3M0UA 2DYBA 3EHQA 2XMFA 1AOJA 1PNJA 4EIKA 1PKSA 1W1FA 1JEGA 2LP5A 1UECA 3REBB 3VS0A 2HDAA 3UATA 1N5ZA 3CQTA 2LMJA 2IIMA 2KYMA 1T0JA 1ZUKA 2A08A 2J6FA 1U3OA 2G6FX 1EFNA 1WFWA 1PRMC 1RI9A 2K6DA 1T3LA 1M27C 2DBKA 1JXMA 3SEMA 2ROLA 4J9FA 1GFDA 4JPBW 1CSKA 2FPFA 4D8KA 4QT7A 2D8HA 2DILA 1K1ZA 2DNUA 1KFZA 5ECAA 2ECZA 2CH4A 4X1VA 4ZNXA 4HCKA 2CT4A 2GTJA 3RNJA 1AWJA 2ABLA 2JMAA 4LUEA 2B86A 1MUZA 2VVKA 2J6OA 2DL5A 1Y57A 2DLPA 1SSHA 1M3AA 2CUDA 4AFUC 2DL7A 2O31A 5GJWB 3VS7A 2AKKA 2F2VA 2FEIA 3PVQA 2LJ3A 2LCSA 3TSWA 2LZ6B 1M3BA 1VYTA 2K9GA 2AKLA 1GFCA 1H8KA 4J9HA 1JU5C 1GBRA 1WIEA 4Z8AA 2DX1A 2RN8A 2JS0A 4HXJA 1BK2A 1I07A 4F14A 1S1NA 1VYVA 1AWXA 1X69A 3VS2A 1ZUYA 2O9SA 1UG1A 1K76A 1AZEA 1X2KA 1SPKA 4LN2A 2EGEA 1IO6A 3EHRA 2RQVA 4HVUA 3C0CA 4K11A 2GQIA 1WLPB
chains in the Genus database with same CATH superfamily
4M75C 2EQJA 2E70A 4JJDA 3ULRB 2RA2A 4DBRA 3CMAT 3P8DA 1NJIR 3JCMh 6AT1B 1PCXA 4QVDA 4FSSA 1RAFB 4XU2A 3CPWS 2M16A 1VQ8A 1N8RU 3CXCP 1KD1C 2DEQA 4OGEA 3I9QA 1KSWA 1VQKA 4OMLA 4M75F 2A37A 3CCUQ 3RUXA 2ED0A 3CXCA 3M56A 3ME9A 5IHIA 1VQ7Q 1NPPA 1N6AA 4C92D 5LJ5h 1TUGB 2FB7A 3JCMV 3BDLA 4XK8E 4ATOA 3HFNA 1KD1U 4E7ZA 1I8FA 4M75A 1UB4A 2AT1B 3JCMW 1UEBA 3VS4A 3I5RA 4XU1A 1QWEA 3G4SA 4F7UA 3JCMQ 3LGFA 5I11A 3OSVA 1M2OA 3H0FA 4WTOB 5GAN2 4N0AC 2DA9A 1SRLA 4NOYA 1C1AA 3LYIA 1RI0A 2HKNA 3CMAQ 2OTLT 3HP9A 5GJVB 1MMGA 4KRTA 4IUUA 1JRIA 4J9GA 4KH0B 4B9XA 5IXBA 4C0GA 2JM9A 3FIFA 2EJFA 1TU0B 1O75A 1YN8A 4PJOA 4CC4B 4CC2A 4C92A 4QW2A 3SWNA 1K9MC 3BDUA 4XTYA 4II1A 5FU7B 4KGVB 4M77D 5KCHA 3C12A 3RKXA 4R0KA 2AIRB 3OS5A 4OMFB 3CCEA 4IURA 1YITT 3EG9B 2RM4A 4M78E 2YUOA 3QXEB 2RB6A 2LVMA 1YJ9A 3DKMA 3HRSA 1G2BA 2VB6A 3M0TA 2PVDB 1SHGA 2GF7A 2DTOA 1R0BG 3L2ZA 4A4FA 2K5FA 2JW4A 2XI9A 5KYXA 1MV0B 2AK5A 1OV3A 4JUVA 3RBBB 2DMOA 5GANj 2QGFB 1K8AR 1M4ZA 2KNBB 2EQMA 3QZ5B 4E7SA 3LH0A 3M58A 1BIAA 2HL3A 2O9VA 2FYKA 3OYLA 1TXQA 3G71Q 1B34B 3MEVA 4RTXA 5CAIA 3RR6A 2K79A 1VQNT 5FWCA 1WA7A 1Q82R 1IGUA 4NL2A 1QW1A 4E7HA 1R8OB 1YHQQ 1M90R 4M7AE 1UHFA 1YJWQ 2DKGA 2HQXA 1ARKA 3OS0A 3SHWA 4PFOA 3VRZA 2DTIA 3LW5E 1YCYA 1YIJT 2CSIA 3JCMf 5GANf 3UDCA 1JB0E 2DJQA 3JRZA 3JAME 3M59A 4J6WA 3QJYA 2YWWA 1IGQA 4XTUA 1SG5A 4J6YA 1VQ9A 3LLRA 4YTLA 3NTIA 3M0RA 4RTYA 1Y96A 1RAHB 3HFOA 4FU6A 2JUFA 4KBMB 3L2UA 1VQ9T 2D0QB 3J7AF 3JB9H 5D6YA 1Q81C 2RO0A 4BE2A 4KT0E 4FCYA 1ZA1B 2F5TX 3QWXX 1QVGP 1B34A 1E6HA 5LJ5e 2RJEA 1B3QA 3URGA 2NUPB 4LNPA 2HAXA 3MO8A 2DTHA 2LT1A 2L5QA 1AVZC 1GCPA 1QWFA 3Q1JA 3JB9G 2HBPA 4VUBA 3OMGA 4CRIA 3C4SA 1SRMA 2QDLA 1Y0MA 2EYWA 4IUPA 3EGUA 5LJ3g 3GBQA 1U5SA 1Q86R 2JTEA 1WGSA 2VASA 2GTOA 1OPKA 5IHNA 1TWBA 1PSFA 1D1CA 1W2BS 2KRMA 2JXBA 4RTVA 5LJ3h 1TUCA 3JCMP 3SWNB 1VQ4Q 5KYYA 2YXYA 1K73U 4OMNA 2CUBA 4F17A 2XDBA 3SB2A 2KK4A 3CC4A 4FW2A 1SEMA 2X3WD 2A36A 1NJIU 4RKUE 2XICA 2E6NA 3CCSA 2FRWA 5KH6A 1M30A 4C8QE 4PJOG 5AT1B 3CD6A 2GFUA 2E65A 1UDLA 3OYMA 4OF1A 3P8BB 1WNLA 4PFZA 5L23A 2QI2A 2DO3A 2DPPB 3CCMT 1WHJA 1VQ7A 4JJNK 2RQTA 4E6RA 4ZGJB 3AHUA 2K2VA 1ZBXA 3QG1A 4C0FA 1G8XA 4A53A 4JRQA 5FU6C 2C0OA 2EVRA 1QCFA 4BY6C 3V8LA 2YRDA 5DM7R 3CCUT 2FPEA 1GBQA 3CC7A 1FWZA 1G3WA 2R5MA 2K5LA 3HTRA 3OYGA 4IKFA 5FROA 3CCLT 2XMFA 4M7AD 1PNJA 4EIKA 3PGGA 1PKSA 3VYHB 1UECA 1G3TA 3REBB 5KYWA 2QA4T 2XIDA 4QVZA 2Y4YA 2LMJA 1ZQ1A 5DLOA 2A08A 2J6FA 5J26A 3P8HA 1WFWA 1YI2Q 2VGMA 2K6DA 4PLIA 1KQSA 1K9MU 2DAQA 4DQ2A 4HCZA 4FYWB 3RKYA 4X34A 1VQNA 3G6EQ 2DILA 2DNUA 2ECZA 2CH4A 3MP8A 4QQDA 3CC7T 2RI3A 5GAOn 2CT4A 2GTJA 2JMAA 2E10A 3OW2P 1NZ9A 1Y57A 1ZSZC 2XDDA 2CUDA 1Q81R 5GJWB 3V8JA 3VS7A 1KC8C 2F2VA 3PVQA 2LJ3A 1MMAA 2LZ6B 3E2UA 1M3BA 4J9HA 3FRNA 4PFPA 3RKWA 3G71T 1TTHB 4E7LA 4M78G 3G1JA 2LQKA 4OB0B 4HXJA 4C92F 4PKCC 1S1NA 1V29B 2K57A 2RK1A 1X69A 5GAMf 5A0LA 2DZCA 1N27A 2O9SA 4O5VA 1OI1A 1IB8A 1JJ2A 2M02A 5LJ3j 2CP7A 2D9TA 3S3OA 1YJWA 1K8AC 5DLQE 4RMOA 1M1KC 1BI3A 2RQVA 3C0CA 2MYSA 3RDVA 2HZYA 1WLPB 5A0DA 4C0ZA 2I2LA 1OX8A 2E1HA 3EGDB 1VQ5A 5EG2A 2CDTA 4OB2B 2EW3A 4J9DA 5I2MA 1CKAA 3NTKA 2P4TA 3OYIA 2NLUA 4F7UF 4JLIA 1VQ4T 1RAAB 1VA7A 2JT4A 4IUTA 1KQ1A 1TUDA 4OB1B 1WXTA 3EG9A 4AFSC 3GOXA 1JJ2S 3VUBA 2OTJT 2QQBA 1PG5B 1RAGB 3R6NA 1FYNA 2RK2A 2KY9A 4OMOA 3TU4K 3L2RA 1I81A 1ZSZB 4DEXA 1EZZB 2CP6A 4Y92A 2FVUA 2KMTA 5GAN4 2FO0A 4M75B 2HSEB 4C92B 4DOWA 4JS5A 3CCVQ 1W70A 2PQWA 2YSQA 1M2VB 2RHIA 1SF9A 2KXCA 5HCKA 2KROA 2QEXQ 1V1CA 1X2QA 3OYAA 3EG2A 2L89A 1M2VA 1X6BA 2KT1A 2DZ9A 4LUDA 5D6XA 2M0OA 1QP3A 2BUDA 4M75G 1UTIA 1TG0A 1BU1A 2LT4A 4XTXA 2C0TA 3TCJA 2W10A 2DK3A 1I1JA 2CP0A 4HT9A 1WX6A 2KVQG 5EC7A 4F7UB 3CMAA 1N8RC 1G3YA 3JV3A 1VQ6A 1N9SA 2LCCA 3CCLA 3G4ST 1UFFA 2JZ2A 4M78C 2QA4Q 1LCKA 2KT8A 4FM4B 3M0QA 5GMKh 2QA4A 3ER0A 3QUIA 1E7OA 4O6JA 5HKCA 2JS2A 3MEUA 1V76A 3O5ZA 3JB9F 2E5QA 3EFRA 3V8KA 1HSQA 2DXCA 1YBYA 3QWYA 3LWHA 1B07A 1EX4A 1G83A 1YJNA 4J5YA 2NUTA 2L2PA 4Z88A 2COYA 2F2XA 5KYYB 1BI2A 1KHIA 2DL3A 3X25B 3EFSA 5D6WA 1R77A 3M55A 5FRNA 2EGCA 2KAFA 4F7UE 5LJ5g 1S72T 2CH4W 2HNIA 2L3PA 3PIPA 3OW2A 4PJMA 2QQRA 1WHKA 3QYHB 2VC8A 4J9EA 1S72A 4QQ6A 4M7AC 2JVVA 2OJ2A 2VKNA 1OYXA 1ZUUA 4M7DA 1X01A 1SHFA 4M77F 4PJOE 4PJOD 1BI1A 2CS7A 2JTFA 4D6WA 5GMKj 3VS6A 1RUWA 5GAOl 2JJ9A 2YUPA 1XTDA 3CEYA 3SDZA 3CCJT 1A0NB 2BTTA 2GBQA 1YJNT 4N4GA 4KGXB 1D09B 2DRKA 2XK0A 2ZPGB 3GNGA 5KYUA 1LNXA 2DIQA 5KYNA 1MNDA 4PNOA 4GBQA 4RTTA 1Y96B 1ABQA 4GLKA 3INZA 5FWBA 2GFAA 4WCIA 4WF2A 4AG2C 3C95A 1XJWB 2L3QA 3HHTB 1XQHA 2RH2A 5HK3A 4IUQA 4GLMA 1EIFA 2R58A 1JJ2P 2QK0A 3PT9A 4LXCA 2KRSA 1RAIB 1E6GA 2X4JA 1FMKA 3I5SA 4QVCA 3CCVA 2DVJA 4M7AB 3RIRA 2KQWA 3KXTA 2AZSA 1KJWA 2VGNA 2LQ8A 3L1AA 1VQLA 3NMZC 4KUDK 1H641 2JM8A 1AWWA 3FDRA 3IQLA 4HT8A 1ZSGA 4LD6A 3THKA 3OW2S 2J7IA 4M7AA 1D0ZA 3L2QA 2RMOA 4ESRA 2P0PA 2H8HA 5KYXB 3VKIA 1K4US 1MGQA 2CP2A 3CC2A 2EYXA 4MZTA 5KYWB 3V7SA 3CC2Q 4M7DG 1J3TA 1PKTA 2E6ZA 2AHJB 5KE2A 3BY7A 1VIEA 4IIOA 1D1BA 4EMKA 1HYOA 4M7DE 3AT1B 3PE0A 4EDUA 4AG1C 3PFSA 2ZAEA 2MIOA 1VQMQ 2BZ8A 2L3SA 1AWOA 1AD5A 3UA6A 2Z0WA 2DXTA 3OS2A 1Q7YU 3QDFA 2EYYA 3T9NA 1QKWA 1TOVA 5KE3A 2H3JA 2KGTA 3FEOA 4PJOC 2FZKB 3S3NA 1LVKA 1W6XA 3H41A 4LDVA 2AZVA 2F5KA 2V1QA 4M77G 1VQMT 2E64A 2M0YA 2L0AA 1BCMA 4ZN1A 3OYEA 2CP3A 2LQWA 3CBPA 4MDWA 2C06A 2X4XA 3LGLA 3KUFA 4JLGA 4CC3A 2RJCA 3WVEB 3SWNC 3H6ZA 1OPLA 1KIKA 3VS1A 4M7DB 2MAMA 1UUEA 3I55Q 1LPLA 1NLOC 5IH2A 2MMPA 3OQ5A 4E7KA 1M8VA 3GNFB 1M8MA 4C5HA 2DXBA 3E9GA 1D3BB 3EAEA 2EFIA 3HPWA 1VIFA 2W0ZA 4FIBA 2LJ0A 4HVWA 3QIIA 3A8HB 1WQWA 2ZPIB 1NEBA 1FMWA 4OMMA 2O2OA 1RL2A 2RJDA 3M0PA 2NYSA 1YIJQ 1BI0A 1HJDA 4EPCA 2KBTA 3A8MB 4XTZA 1OULA 1RABB 1M9SA 2KEAA 4A4KA 3M54A 3UT1A 1WZOA 1NJIC 5LJ3d 1OEBA 5LJ5d 2OI3A 1NYFA 2GQVA 4C8QA 1NYGA 1WHLA 3CC7Q 1X27A 1QVFS 1HD3A 2K3BA 2NWMA 3EHQA 1WJRA 1AOJA 3HRUA 4PJNA 3OMCA 1W1FA 3QYGB 5FLXE 2LP5A 3VS0A 3EGXA 3OA6A 1TH7A 4JRPA 9ATCB 3CQTA 2GCXA 2EJGA 2EYQA 4M78D 1QVFP 2IIMA 2LCLA 2OTJA 1U3OA 5GANd 4Q5WA 5CKBA 1EFNA 3JCMd 1PRMC 1RI9A 2YLCA 1OZ3A 4PK4A 2E3IA 1QCNA 1QCOA 2EWNA 4A4EA 1VQ6T 1WHMA 4XTVA 4BUGA 1GFDA 4JPBW 1CSKA 2FPFA 3G6EA 1IHWA 5CKFA 4NS5A 3HL8A 4QT7A 1Y7XA 2RI2A 2PVOB 3CMEA 5GAMh 5J3BA 4X1VA 4ZNXA 5GAN6 3QHSA 4XAXB 2VVKA 1MUZA 2J6OA 2JOYA 4HCBA 1M90C 3JB9J 1M3AA 4AFUC 3MJXA 2O31A 2AKKA 3M5AA 2RHUA 5CIUA 1GFCA 1JU5C 1GBRA 4JRKA 4RG2A 3QJ6A 4J6XA 2JS0A 2WACA 1SSFA 2V8JA 4BD3A 3M9QA 2VYTA 4F7UG 3G71A 1IZ6A 1AWXA 1QVGA 4C92E 3G6ET 1K76A 3GPLA 2BE9B 1IO6A 1BCOA 4HVUA 4K11A 3CCMQ 2GQIA 2RHYA 3CCRT 3MPUB 4V2SA 1KHCA 3GLXA 1UE9A 4LDXA 1ABOA 4MMKA 1ZA2B 3A8GB 2X4WA 1GXIE 1U8RA 3ASKA 1BYMA 2X51A 1QMCA 4E2FB 1VQ8Q 2QXFA 3PIOA 2DYIA 2OX7A 1GCQC 3JCMJ 4ZTJA 4AFQC 1IXDA 4XU0A 1ACMB 5GAMe 1UGVA 5CCAA 3OYFA 1NE8A 2P84A 2DRMA 2ED1A 4J9IA 1YCSB 2YHTA 5D7UA 3PMTA 4BACA 1YFNA 3R6OA 3PMIA 1IHVA 5CR2A 2R5AA 1QP2A 3WVDB 4JZ3A 3CCRA 1YNZA 5GMKm 2I0NA 3M0SA 3G4SQ 1RLQC 5LJ5j 1ZLMA 4J7IA 5GAMd 5IHKA 2JNGA 1M3CA 4C92C 4EMHA 1AZGB 1W4SA 3OSSC 1PD0A 1YWOA 2YT6A 4J7FA 3RESA 1WJQA 4DOVA 2RI5A 4QQGA 4M7DD 2OTJQ 4JJBA 1WHHA 3OYJA 2QG9B 3OBYA 4J9CA 2DERA 2MK5A 3FLGA 5AYFA 1YITQ 1YITA 3VS3A 2BZYA 3VV0A 3CCVT 2X4YA 1NPRA 5A2QE 1ZBJA 3HSBA 4B9WA 1K9AA 3H0IA 4J8OA 3X26B 4LDUA 1QQJA 3L2WA 2NUTB 1Q82U 4KH1B 1VQOQ 5I22A 1BB9A 1LJOA 3CMEQ 2D8JA 1VUBA 3OS1A 4RCCA 3CMET 2EBPA 3CD6Q 2ROTA 1PSEA 2PTKA 2J06A 3JCMe 2ATCB 1OU9A 5J39A 2YRCA 3ZFJA 4BI8B 1UJYA 4M78A 3CXCS 3G7ZA 3L2VA 1TSFA 2HQEA 4R55A 4JZ4A 2CT3A 3REAB 4IIMA 3NTHA 1KQSP 3EG0A 1W2BA 3X20B 4FT2A 4Z02A 2HSPA 4BI4A 1YHQA 5CQXA 2DL8A 1YJWT 4DEYA 1VQ5Q 5GAOp 2EPDA 1UHCA 2RQUA 1I0CA 3JCMX 1T0HA 2F1LA 3F70A 4BI3A 4NL3A 1QKXA 4AT1B 1QLYA 3OB9A 3EG3A 4X9CA 4C8QF 2QGGA 1WXBA 3OYHA 2OAWA 4RG8A 4F04B 1Z9ZA 3EH1A 1VQ9Q 1VQPQ 2CREA 3MCAB 4M4ZA 1VQPA 2L3RA 1KG1A 1BKBA 2ENMA 3SD4A 3CCUA 1K73R 1CKBA 2QTXA 2B8AA 1H3HA 1M90U 2FRYA 1OOTA 2YDLA 1OZ2A 2JMCA 1K0XA 2JN0A 2EQIA 1YJ9T 2X3XD 3EGDA 2RPNA 3FB9A 2FHDA 3HRTA 3JCMg 5GAOr 2EYZA 5GANg 2V1RA 2EAYA 1F1BB 1VQLQ 4P5NA 1WPYA 2E3HA 2KE9A 3H0HA 2ZPFB 4XTWA 3BW1A 4AMCA 5KCOA 4HVVA 1M1GA 1M1KU 4A4HA 4HKEA 3OYCA 2BIVA 2IPOB 2MF2A 3H9NA 1U1SA 2MCNA 3EH2A 2LX9A 1WDXA 5L8RE 3VUZA 1AEYA 1YI2T 2GGRA 3NPFA 1LOJA 7AT1B 1WXUA 3CCST 1UGQB 3U23A 4EMKB 2L8DA 3GIBA 1JQQA 1T3SA 2H3EB 4C8QC 1BBZA 2KRNA 2MI6A 3CC2T 2M51A 3LX7A 1PRLC 5A0GA 1K73C 3TSZA 3VS5A 3TQ7P 2QYZA 1O9SA 1D0XA 1ZHIA 3CC4Q 2Y4XA 4PLLA 1XOVA 2DF6A 3FC3A 3M4GA 1VQLT 2LJ1A 5LJ3f 2RF0A 4C92G 2XD0A 5GANe 5LJ3e 2MOXA 5GAOm 2DIGA 4RTZA 2ZGWA 3MEAA 2OTLQ 2DVEA 1DJ7B 2HQHA 2HBWA 1S72Q 2KSSA 2M9UA 3E1SA 2C0IA 4ZGDB 4C5GA 3TREA 1PWTA 4HCCA 2A7YA 2DFUA 3CCJQ 3QSUA 2LQNA 3E9FA 2KDSA 1RACB 1VQ8T 2E41A 3MHXA 2EJ9A 1D1AA 5GAMj 4EMGA 2DL4A 2YUQA 4M7DC 4BDYA 1VOMA 3QBYA 2KXDA 4C8QB 2V8IA 1SKUB 1GCQA 1X6GA 3M0UA 2DYBA 3M4YA 1PM3A 3GP8A 3E19A 2LDMA 2CZ0B 1N5ZA 4C8QD 1VQ5T 4XQ3A 2KYMA 3JSCA 2HD0A 1XNIA 1T0JA 1ZUKA 3JB9I 2G6FX 1YI2A 4OB3B 1T3LA 4MMLA 2DBKA 4PJJA 1KC8U 4M77B 4M77A 4ZGEB 2DD4A 3VYGA 2ROLA 3A5ZB 4MZMA 4M7DF 2YLBA 4J9FA 4E47A 4M78F 5CO7A 5CQYA 2D8HA 1VQOA 4DA4A 2V26A 5ECAA 5GAMg 4LDYA 3CCQQ 3ZEHA 4MDXA 3CCQA 4FYYB 3CPWA 4LUEA 1YJ9Q 1M1KR 4C0DC 3GF5A 2ZCFB 4J83A 2BKDN 5FU6B 2MPXC 1WQ7A 1SSHA 5CVIA 1MMDA 2QDYB 3CPFA 3PTAA 2LCSA 3TSWA 5GAN3 1VYTA 2K9GA 2AKLA 2XDPA 4KGZB 3OBWA 2XU8A 4KULA 1I07A 1KD1R 2VXEA 1VYVA 5IAYA 3I56A 4M75E 1VQ4A 1ZUYA 1UG1A 1AZEA 4ELZC 4C5IA 2HKQB 1SPKA 1X75C 4QKUA 4LN2A 2EGEA 4DBFA 4FYVB 2PUOB 3CCMA 3L42A 3UA7A 4RCBA 1NLPC 2NUPA 4M77C 2WSEE 1Q81U 3WXMB 3EGXB 2MWOA 2EKOA 1VQKT 5C0MA 3I55T 2LC4A 4Z89A 3DLLA 3VRYA 4ME7A 5I2SA 2F2WA 4BDZA 1FXXA 2YRVA 1C0MA 1Y71A 1VQKQ 1Y07A 4J9BA 3X24B 4DBHA 2RQRA 2O88A 3JB9D 1KQSS 2DETA 3OYKA 2A0FB 4OVAA 1I5LA 1VYUA 5HK0A 4BE1A 2PNIA 2HMAA 4N0AA 1D3BA 2YUNA 2QEXA 4L6V5 4UC4A 3NGPA 4R56A 3CCQT 3QPHA 2GNCA 3LH5A 4DBQA 3ZL7C 1VQ7T 1M1FA 2VXFA 5DY9A 2K3XA 3MP1A 3CCRQ 4A4GA 1OQKA 1UGPB 2ESWA 1Q95G 5FU7C 3UPUA 1UGRB 2XHCA 4GY5A 3PVLA 5LJ5f 4JDSA 3CCLQ 2V8KA 2FPDA 5GMKl 1U1TA 4BB7A 1YP5A 2O4XB 2O01E 1Z9QA 5CKDA 2K2MA 2VUBA 4OMPA 2J05A 1K8AU 2BZXA 2HL5C 2KI7A 2RNAA 1OU8A 4L5GA 5CKEA 2RHXA 3N5BB 2DE0X 2NUZA 2QTVA 2ZPEB 4HA8A 2RJFA 2CKKA 1TS9A 3SFMA 2JTMA 1PHTA 4L59A 3UWNA 2F69A 4FL6A 4Y91A 2R57A 2P0KA 1IREB 2PZ1A 4Y28E 1ZX6A 2IG0A 2P0QA 2CSQA 4CI0C 4RUGA 2EQUA 3RMSA 3QZ9B 2LTOA 4PL6A 3EFOB 3ZBDA 2RQWA 4MZPA 5CKHA 3VU3C 3PNWC 1W2BP 2J6KA 1MV3A 2LX7A 1OX9A 1R0CB 3UF4A 2PVGB 1NG2A 2LNHB 1NM7A 1YWPA 4M7AG 2FZGB 3M53A 2K4YA 3META 2E4HA 4ORZA 2FL7A 1QVPA 3OYDA 1HK9A 3EG1A 3OYBA 3BFMA 4F16A 2DXUA 3S3MA 4M78B 1NBEB 3JCMb 4N4HA 2MWPA 1HXDA 2FG0A 2VWFA 1UJ0A 5M9OA 1Q86U 3A98A 3LWIA 2EKHA 1NEGA 4RTUA 3A8LB 1H92A 3FJ5A 1KC8R 4PJOB 1QVGS 1N8RR 3A1PA 1Q7YR 2K3YA 1ZSZA 3KFVA 4LE9A 2PU9B 3S6WA 2VV5A 3RMQA 4C8QG 3J81E 1G5VA 4BE0A 5GANh 3CC4T 5FW9A 1MHNA 1FMVA 1RADB 4EMKC 3CBMA 2P4RA 3DB4A 5FRMA 1WI7A 5IXFA 5GAN7 4LDWA 4ZN3A 4RTWA 2E5KA 4ELYC 1WYXA 4D8DA 4CC7A 5GAN8 5IT9E 3MKDA 2XKOC 3NHNA 2QASA 2WSCE 1WHGA 1Q7YC 2DJZA 2QQSA 8ATCB 1I5OB 4FYXB 5GAN5 1VQPT 1JXOA 1JO8A 4JJCA 4C5EA 4KUIA 3DLMA 3KBGA 1VQMA 1K0SA 1KQ2A 1GRIA 4LD9K 2CGHA 1C6VX 2QEXT 2D0NA 3HKSA 4OMQA 5GAOq 2KYBA 2SRCA 3OYYA 2DM1A 3CD6T 1YJNQ 1GL5A 2DBMA 3CCSQ 1Q82C 1AT1B 2K7AA 2EGAA 1Q86C 4M7AF 4TVRA 1D0YA 4AFZC 2LRQA 2A3LA 3CBOA 2OTLA 2G3RA 2BE7D 4IUVA 4A63B 2FZCB 2KR3A 2WSFE 1AHJB 1RLPC 3MP6A 3EFOA 3I35A 1QVFA 2EQKA 2COZA 1K9MR 2EIFA 4A54A 3NFCA 3I55A 2ZZDA 1PD1A 4M75D 3X28B 3CCJA 4XU3A 3QKJA 2HEQA 1FX7A 1BIBA 2OAUA 4ZTFA 3V7CA 2A28A 4ANJA 4JRIA 3CCET 1U06A 1YIJA 8AT1B 3TVTA 1X43A 3C94A 2COWA 1WJSA 2D1XA 2XG8D 3MEWA 3TEEA 2CP5A 1VQOT 2QQ9A 3I56T 2RHZA 3D7SB 3QDRB 1X6OA 2HCKA 3OY9A 5IN1A 2SEMA 4OGCA 1JEGA 2PUKB 2HDAA 2ZPBB 5HY6A 3UATA 1VQ6Q 2Y90A 2RD1A 4BY6B 3BE3A 2LNVA 3CPWP 3H8ZA 1M27C 2DD5A 1M5Q1 2QAZA 4FSXA 2CZ6B 1JXMA 2M1HA 4FT4A 1VQNQ 1UGSB 3SEMA 1IRXA 4D8KA 1I4K1 1MMNA 1JBMA 3CCEQ 1K1ZA 1N9RA 1KFZA 2IVWA 2CYZB 2CZ7B 3VJPA 2X35A 4HCKA 5C6SA 4PJLA 1PC0A 3RNJA 1AWJA 2ABLA 3JCMc 2X9HA 3A8OB 1YHQT 2B86A 3J80E 3V7RA 2DL5A 3FJPA 1P92A 3RERA 4OP0A 1G3SA 2DLPA 4E7IA 2CZ1B 2DEUA 2DL7A 2O4XA 5GMKi 2FEIA 5KYUB 2E12A 4JS4A 5GMKe 1H3ZA 3M57A 1RAEB 5LL6S 1H8KA 2K5IA 1KK7A 4FW1A 5CK9A 3O8VA 1WIEA 4Z8AA 2DX1A 2RN8A 5I21A 1BK2A 1MNEA 2QQAA 4M77E 4PJOF 2ZPHB 4F14A 3I56Q 2D6FA 4B6MA 3QO3A 3DB3A 3VS2A 3OYNA 4C0DB 4E7JA 1X2KA 1B7TA 4N4IA 3EHRA 4X9DA
chains in the Genus database with same CATH topology
3UA7A 1NLPC 4JJDA 2CDTA 3ULRB 2EW3A 4J9DA 1CKAA 1UE9A 1ABOA 4Z89A 1VA7A 2JT4A 4FSSA 3VRYA 1TUDA 1WXTA 2F2WA 4AFSC 1GCQC 4AFQC 3I9QA 3R6NA 1KSWA 1FYNA 4OMLA 2A37A 4OMOA 4DEXA 2ED0A 4J9BA 1UGVA 4Y92A 5IHIA 2RQRA 2O88A 2FO0A 2DRMA 2ED1A 4J9IA 1VYUA 1YCSB 1W70A 2YSQA 2PNIA 2KXCA 5HCKA 2KROA 2YUNA 1V1CA 1X2QA 3EG2A 3NGPA 1X6BA 2KT1A 2GNCA 3VS4A 3I5RA 3LH5A 4LUDA 3ZL7C 4JZ3A 1QWEA 1YNZA 2I0NA 1UTIA 1TG0A 1BU1A 3M0SA 1RLQC 2C0TA 5I11A 2ESWA 2W10A 1ZLMA 3H0FA 2DA9A 1SRLA 5IHKA 1I1JA 1M3CA 1WX6A 5EC7A 1AZGB 1YWOA 5GJVB 4KRTA 2YT6A 3JV3A 3PVLA 4J9GA 5IXBA 2FPDA 4JJBA 1UFFA 2JM9A 1YP5A 1LCKA 2KT8A 4J9CA 3M0QA 1Z9QA 1E7OA 2K2MA 1YN8A 2JS2A 2J05A 4OMPA 4CC4B 3O5ZA 4CC2A 3VS3A 2BZXA 2BZYA 1HSQA 2RNAA 1ZBJA 3QWYA 1K9AA 3H0IA 2NUZA 2DE0X 1B07A 1G83A 4R0KA 2L2PA 4Z88A 5I22A 1BB9A 2F2XA 2DL3A 2D8JA 2YUOA 2EBPA 2EGCA 2ROTA 1PHTA 2PTKA 1G2BA 2J06A 3M0TA 2CH4W 2L3PA 1SHGA 2PZ1A 4J9EA 1ZX6A 1UJYA 2CSQA 2JW4A 4RUGA 2OJ2A 1MV0B 2VKNA 1ZUUA 2AK5A 1OV3A 2RQWA 3RBBB 2DMOA 1SHFA 4JZ4A 2KNBB 2CT3A 3REAB 2J6KA 1MV3A 2LX7A 4IIMA 2O9VA 3UF4A 1NG2A 2LNHB 3VS6A 1NM7A 1RUWA 4RTXA 1YWPA 2K79A 5FWCA 1WA7A 3EG0A 2YUPA 4ORZA 2HSPA 3EG1A 1A0NB 1UHFA 2BTTA 4F16A 2DL8A 2GBQA 1ARKA 3SHWA 3VRZA 4DEYA 2DRKA 2CSIA 2FG0A 2EPDA 1UHCA 2RQUA 1I0CA 1T0HA 2VWFA 1UJ0A 1QKXA 1QLYA 3EG3A 2DJQA 4GBQA 4RTTA 3A98A 1WXBA 1ABQA 2EKHA 1NEGA 2OAWA 4RTUA 5FWBA 4WCIA 4AG2C 1Z9ZA 1H92A 3M0RA 2CREA 4RTYA 3FJ5A 4M4ZA 2L3QA 2ENMA 4GLMA 3KFVA 1CKBA 1H3HA 2KRSA 2FRYA 1OOTA 2YDLA 2JMCA 4LE9A 3I5SA 1E6GA 1FMKA 3QWXX 1K0XA 2DVJA 2EQIA 1E6HA 1B3QA 2X3XD 2AZSA 2RPNA 2EYZA 1KJWA 4LNPA 5FW9A 2V1RA 3NMZC 2JM8A 1AWWA 2P4RA 3IQLA 1ZSGA 1WI7A 5IXFA 3THKA 1AVZC 1GCPA 1QWFA 2J7IA 2KE9A 4RTWA 2E5KA 3H0HA 2RMOA 4ESRA 1WYXA 1SRMA 2H8HA 2QDLA 4D8DA 4CC7A 4HVVA 1Y0MA 1K4US 3NHNA 2EYXA 2EYWA 3EGUA 1J3TA 1PKTA 3GBQA 1U5SA 2JTEA 2MCNA 4IIOA 1WDXA 2GTOA 1JXOA 1OPKA 5IHNA 1JO8A 1AEYA 3PE0A 4AG1C 2GGRA 4JJCA 3NPFA 1WXUA 2KRMA 2JXBA 4RTVA 2MIOA 3U23A 1TUCA 2BZ8A 2L3SA 1AWOA 1AD5A 3UA6A 1JQQA 1T3SA 1BBZA 2KRNA 1K0SA 1GRIA 2M51A 1PRLC 4OMNA 2EYYA 2CUBA 2D0NA 4F17A 1QKWA 3TSZA 3VS5A 2KGTA 4OMQA 2KYBA 2SRCA 1W6XA 2DM1A 3H41A 1GL5A 1SEMA 2X3WD 2A36A 2DBMA 2AZVA 2V1QA 2M0YA 2L0AA 1XOVA 2DF6A 2FRWA 2K7AA 2EGAA 2LQWA 2LJ1A 2RF0A 1M30A 2MOXA 4AFZC 4RTZA 4CC3A 1UDLA 4A63B 2KR3A 1OPLA 1KIKA 3VS1A 1RLPC 2HBWA 3I35A 1UUEA 5IH2A 1NLOC 2C0IA 5L23A 1PWTA 1M8MA 2RQTA 4E6RA 2HEQA 2W0ZA 2LQNA 2LJ0A 4HVWA 2A28A 1NEBA 1U06A 4OMMA 2O2OA 3M0PA 3TVTA 1X43A 2C0OA 2EVRA 1HJDA 1QCFA 2KBTA 2D1XA 2KEAA 2FPEA 1OEBA 2DL4A 2OI3A 1GBQA 2YUQA 1NYFA 2KXDA 1NYGA 2HCKA 1X27A 1GCQA 2SEMA 1HD3A 1X6GA 2K3BA 2NWMA 3M0UA 2DYBA 3EHQA 2XMFA 1AOJA 1PNJA 4EIKA 1PKSA 1W1FA 1JEGA 2LP5A 1UECA 3REBB 3VS0A 2HDAA 3UATA 1N5ZA 3CQTA 2LMJA 2IIMA 2KYMA 1T0JA 1ZUKA 2A08A 2J6FA 1U3OA 2G6FX 1EFNA 1WFWA 1PRMC 1RI9A 2K6DA 1T3LA 1M27C 2DBKA 1JXMA 3SEMA 2ROLA 4J9FA 1GFDA 4JPBW 1CSKA 2FPFA 4D8KA 4QT7A 2D8HA 2DILA 1K1ZA 2DNUA 1KFZA 5ECAA 2ECZA 2CH4A 4X1VA 4ZNXA 4HCKA 2CT4A 2GTJA 3RNJA 1AWJA 2ABLA 2JMAA 4LUEA 2B86A 1MUZA 2VVKA 2J6OA 2DL5A 1Y57A 2DLPA 1SSHA 1M3AA 2CUDA 4AFUC 2DL7A 2O31A 5GJWB 3VS7A 2AKKA 2F2VA 2FEIA 3PVQA 2LJ3A 2LCSA 3TSWA 2LZ6B 1M3BA 1VYTA 2K9GA 2AKLA 1GFCA 1H8KA 4J9HA 1JU5C 1GBRA 1WIEA 4Z8AA 2DX1A 2RN8A 2JS0A 4HXJA 1BK2A 1I07A 4F14A 1S1NA 1VYVA 1AWXA 1X69A 3VS2A 1ZUYA 2O9SA 1UG1A 1K76A 1AZEA 1X2KA 1SPKA 4LN2A 2EGEA 1IO6A 3EHRA 2RQVA 4HVUA 3C0CA 4K11A 2GQIA 1WLPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UA7 A;  1NLP C;  4JJD A;  2CDT A;  3ULR B;  2EW3 A;  4J9D A;  1CKA A;  1UE9 A;  1ABO A;  4Z89 A;  1VA7 A;  2JT4 A;  4FSS A;  3VRY A;  1TUD A;  1WXT A;  2F2W A;  4AFS C;  1GCQ C;  4AFQ C;  3I9Q A;  3R6N A;  1KSW A;  1FYN A;  4OML A;  2A37 A;  4OMO A;  4DEX A;  2ED0 A;  4J9B A;  1UGV A;  4Y92 A;  5IHI A;  2RQR A;  2O88 A;  2FO0 A;  2DRM A;  2ED1 A;  4J9I A;  1VYU A;  1YCS B;  1W70 A;  2YSQ A;  2PNI A;  2KXC A;  5HCK A;  2KRO A;  2YUN A;  1V1C A;  1X2Q A;  3EG2 A;  3NGP A;  1X6B A;  2KT1 A;  2GNC A;  3VS4 A;  3I5R A;  3LH5 A;  4LUD A;  3ZL7 C;  4JZ3 A;  1QWE A;  1YNZ A;  2I0N A;  1UTI A;  1TG0 A;  1BU1 A;  3M0S A;  1RLQ C;  2C0T A;  5I11 A;  2ESW A;  2W10 A;  1ZLM A;  3H0F A;  2DA9 A;  1SRL A;  5IHK A;  1I1J A;  1M3C A;  1WX6 A;  5EC7 A;  1AZG B;  1YWO A;  5GJV B;  4KRT A;  2YT6 A;  3JV3 A;  3PVL A;  4J9G A;  5IXB A;  2FPD A;  4JJB A;  1UFF A;  2JM9 A;  1YP5 A;  1LCK A;  2KT8 A;  4J9C A;  3M0Q A;  1Z9Q A;  1E7O A;  2K2M A;  1YN8 A;  2JS2 A;  2J05 A;  4OMP A;  4CC4 B;  3O5Z A;  4CC2 A;  3VS3 A;  2BZX A;  2BZY A;  1HSQ A;  2RNA A;  1ZBJ A;  3QWY A;  1K9A A;  3H0I A;  2NUZ A;  2DE0 X;  1B07 A;  1G83 A;  4R0K A;  2L2P A;  4Z88 A;  5I22 A;  1BB9 A;  2F2X A;  2DL3 A;  2D8J A;  2YUO A;  2EBP A;  2EGC A;  2ROT A;  1PHT A;  2PTK A;  1G2B A;  2J06 A;  3M0T A;  2CH4 W;  2L3P A;  1SHG A;  2PZ1 A;  4J9E A;  1ZX6 A;  1UJY A;  2CSQ A;  2JW4 A;  4RUG A;  2OJ2 A;  1MV0 B;  2VKN A;  1ZUU A;  2AK5 A;  1OV3 A;  2RQW A;  3RBB B;  2DMO A;  1SHF A;  4JZ4 A;  2KNB B;  2CT3 A;  3REA B;  2J6K A;  1MV3 A;  2LX7 A;  4IIM A;  2O9V A;  3UF4 A;  1NG2 A;  2LNH B;  3VS6 A;  1NM7 A;  1RUW A;  4RTX A;  1YWP A;  2K79 A;  5FWC A;  1WA7 A;  3EG0 A;  2YUP A;  4ORZ A;  2HSP A;  3EG1 A;  1A0N B;  1UHF A;  2BTT A;  4F16 A;  2DL8 A;  2GBQ A;  1ARK A;  3SHW A;  3VRZ A;  4DEY A;  2DRK A;  2CSI A;  2FG0 A;  2EPD A;  1UHC A;  2RQU A;  1I0C A;  1T0H A;  2VWF A;  1UJ0 A;  1QKX A;  1QLY A;  3EG3 A;  2DJQ A;  4GBQ A;  4RTT A;  3A98 A;  1WXB A;  1ABQ A;  2EKH A;  1NEG A;  2OAW A;  4RTU A;  5FWB A;  4WCI A;  4AG2 C;  1Z9Z A;  1H92 A;  3M0R A;  2CRE A;  4RTY A;  3FJ5 A;  4M4Z A;  2L3Q A;  2ENM A;  4GLM A;  3KFV A;  1CKB A;  1H3H A;  2KRS A;  2FRY A;  1OOT A;  2YDL A;  2JMC A;  4LE9 A;  3I5S A;  1E6G A;  1FMK A;  3QWX X;  1K0X A;  2DVJ A;  2EQI A;  1E6H A;  1B3Q A;  2X3X D;  2AZS A;  2RPN A;  2EYZ A;  1KJW A;  4LNP A;  5FW9 A;  2V1R A;  3NMZ C;  2JM8 A;  1AWW A;  2P4R A;  3IQL A;  1ZSG A;  1WI7 A;  5IXF A;  3THK A;  1AVZ C;  1GCP A;  1QWF A;  2J7I A;  2KE9 A;  4RTW A;  2E5K A;  3H0H A;  2RMO A;  4ESR A;  1WYX A;  1SRM A;  2H8H A;  2QDL A;  4D8D A;  4CC7 A;  4HVV A;  1Y0M A;  1K4U S;  3NHN A;  2EYX A;  2EYW A;  3EGU A;  1J3T A;  1PKT A;  3GBQ A;  1U5S A;  2JTE A;  2MCN A;  4IIO A;  1WDX A;  2GTO A;  1JXO A;  1OPK A;  5IHN A;  1JO8 A;  1AEY A;  3PE0 A;  4AG1 C;  2GGR A;  4JJC A;  3NPF A;  1WXU A;  2KRM A;  2JXB A;  4RTV A;  2MIO A;  3U23 A;  1TUC A;  2BZ8 A;  2L3S A;  1AWO A;  1AD5 A;  3UA6 A;  1JQQ A;  1T3S A;  1BBZ A;  2KRN A;  1K0S A;  1GRI A;  2M51 A;  1PRL C;  4OMN A;  2EYY A;  2CUB A;  2D0N A;  4F17 A;  1QKW A;  3TSZ A;  3VS5 A;  2KGT A;  4OMQ A;  2KYB A;  2SRC A;  1W6X A;  2DM1 A;  3H41 A;  1GL5 A;  1SEM A;  2X3W D;  2A36 A;  2DBM A;  2AZV A;  2V1Q A;  2M0Y A;  2L0A A;  1XOV A;  2DF6 A;  2FRW A;  2K7A A;  2EGA A;  2LQW A;  2LJ1 A;  2RF0 A;  1M30 A;  2MOX A;  4AFZ C;  4RTZ A;  4CC3 A;  1UDL A;  4A63 B;  2KR3 A;  1OPL A;  1KIK A;  3VS1 A;  1RLP C;  2HBW A;  3I35 A;  1UUE A;  5IH2 A;  1NLO C;  2C0I A;  5L23 A;  1PWT A;  1M8M A;  2RQT A;  4E6R A;  2HEQ A;  2W0Z A;  2LQN A;  2LJ0 A;  4HVW A;  2A28 A;  1NEB A;  1U06 A;  4OMM A;  2O2O A;  3M0P A;  3TVT A;  1X43 A;  2C0O A;  2EVR A;  1HJD A;  1QCF A;  2KBT A;  2D1X A;  2KEA A;  2FPE A;  1OEB A;  2DL4 A;  2OI3 A;  1GBQ A;  2YUQ A;  1NYF A;  2KXD A;  1NYG A;  2HCK A;  1X27 A;  1GCQ A;  2SEM A;  1HD3 A;  1X6G A;  2K3B A;  2NWM A;  3M0U A;  2DYB A;  3EHQ A;  2XMF A;  1AOJ A;  1PNJ A;  4EIK A;  1PKS A;  1W1F A;  1JEG A;  2LP5 A;  1UEC A;  3REB B;  3VS0 A;  2HDA A;  3UAT A;  1N5Z A;  3CQT A;  2LMJ A;  2IIM A;  2KYM A;  1T0J A;  1ZUK A;  2A08 A;  2J6F A;  1U3O A;  2G6F X;  1EFN A;  1WFW A;  1PRM C;  1RI9 A;  2K6D A;  1T3L A;  1M27 C;  2DBK A;  1JXM A;  3SEM A;  2ROL A;  4J9F A;  1GFD A;  4JPB W;  1CSK A;  2FPF A;  4D8K A;  4QT7 A;  2D8H A;  2DIL A;  1K1Z A;  2DNU A;  1KFZ A;  5ECA A;  2ECZ A;  2CH4 A;  4X1V A;  4ZNX A;  4HCK A;  2CT4 A;  2GTJ A;  3RNJ A;  1AWJ A;  2ABL A;  2JMA A;  4LUE A;  2B86 A;  1MUZ A;  2VVK A;  2J6O A;  2DL5 A;  1Y57 A;  2DLP A;  1SSH A;  1M3A A;  2CUD A;  4AFU C;  2DL7 A;  2O31 A;  5GJW B;  3VS7 A;  2AKK A;  2F2V A;  2FEI A;  3PVQ A;  2LJ3 A;  2LCS A;  3TSW A;  2LZ6 B;  1M3B A;  1VYT A;  2K9G A;  2AKL A;  1GFC A;  1H8K A;  4J9H A;  1JU5 C;  1GBR A;  1WIE A;  4Z8A A;  2DX1 A;  2RN8 A;  2JS0 A;  4HXJ A;  1BK2 A;  1I07 A;  4F14 A;  1S1N A;  1VYV A;  1AWX A;  1X69 A;  3VS2 A;  1ZUY A;  2O9S A;  1UG1 A;  1K76 A;  1AZE A;  1X2K A;  1SPK A;  4LN2 A;  2EGE A;  1IO6 A;  3EHR A;  2RQV A;  4HVU A;  3C0C A;  4K11 A;  2GQI A;  1WLP B; 
#chains in the Genus database with same CATH topology
 4M75 C;  2EQJ A;  2E70 A;  4JJD A;  3ULR B;  2RA2 A;  4DBR A;  3CMA T;  3P8D A;  1NJI R;  3JCM h;  6AT1 B;  1PCX A;  4QVD A;  4FSS A;  1RAF B;  4XU2 A;  3CPW S;  2M16 A;  1VQ8 A;  1N8R U;  3CXC P;  1KD1 C;  2DEQ A;  4OGE A;  3I9Q A;  1KSW A;  1VQK A;  4OML A;  4M75 F;  2A37 A;  3CCU Q;  3RUX A;  2ED0 A;  3CXC A;  3M56 A;  3ME9 A;  5IHI A;  1VQ7 Q;  1NPP A;  1N6A A;  4C92 D;  5LJ5 h;  1TUG B;  2FB7 A;  3JCM V;  3BDL A;  4XK8 E;  4ATO A;  3HFN A;  1KD1 U;  4E7Z A;  1I8F A;  4M75 A;  1UB4 A;  2AT1 B;  3JCM W;  1UEB A;  3VS4 A;  3I5R A;  4XU1 A;  1QWE A;  3G4S A;  4F7U A;  3JCM Q;  3LGF A;  5I11 A;  3OSV A;  1M2O A;  3H0F A;  4WTO B;  5GAN 2;  4N0A C;  2DA9 A;  1SRL A;  4NOY A;  1C1A A;  3LYI A;  1RI0 A;  2HKN A;  3CMA Q;  2OTL T;  3HP9 A;  5GJV B;  1MMG A;  4KRT A;  4IUU A;  1JRI A;  4J9G A;  4KH0 B;  4B9X A;  5IXB A;  4C0G A;  2JM9 A;  3FIF A;  2EJF A;  1TU0 B;  1O75 A;  1YN8 A;  4PJO A;  4CC4 B;  4CC2 A;  4C92 A;  4QW2 A;  3SWN A;  1K9M C;  3BDU A;  4XTY A;  4II1 A;  5FU7 B;  4KGV B;  4M77 D;  5KCH A;  3C12 A;  3RKX A;  4R0K A;  2AIR B;  3OS5 A;  4OMF B;  3CCE A;  4IUR A;  1YIT T;  3EG9 B;  2RM4 A;  4M78 E;  2YUO A;  3QXE B;  2RB6 A;  2LVM A;  1YJ9 A;  3DKM A;  3HRS A;  1G2B A;  2VB6 A;  3M0T A;  2PVD B;  1SHG A;  2GF7 A;  2DTO A;  1R0B G;  3L2Z A;  4A4F A;  2K5F A;  2JW4 A;  2XI9 A;  5KYX A;  1MV0 B;  2AK5 A;  1OV3 A;  4JUV A;  3RBB B;  2DMO A;  5GAN j;  2QGF B;  1K8A R;  1M4Z A;  2KNB B;  2EQM A;  3QZ5 B;  4E7S A;  3LH0 A;  3M58 A;  1BIA A;  2HL3 A;  2O9V A;  2FYK A;  3OYL A;  1TXQ A;  3G71 Q;  1B34 B;  3MEV A;  4RTX A;  5CAI A;  3RR6 A;  2K79 A;  1VQN T;  5FWC A;  1WA7 A;  1Q82 R;  1IGU A;  4NL2 A;  1QW1 A;  4E7H A;  1R8O B;  1YHQ Q;  1M90 R;  4M7A E;  1UHF A;  1YJW Q;  2DKG A;  2HQX A;  1ARK A;  3OS0 A;  3SHW A;  4PFO A;  3VRZ A;  2DTI A;  3LW5 E;  1YCY A;  1YIJ T;  2CSI A;  3JCM f;  5GAN f;  3UDC A;  1JB0 E;  2DJQ A;  3JRZ A;  3JAM E;  3M59 A;  4J6W A;  3QJY A;  2YWW A;  1IGQ A;  4XTU A;  1SG5 A;  4J6Y A;  1VQ9 A;  3LLR A;  4YTL A;  3NTI A;  3M0R A;  4RTY A;  1Y96 A;  1RAH B;  3HFO A;  4FU6 A;  2JUF A;  4KBM B;  3L2U A;  1VQ9 T;  2D0Q B;  3J7A F;  3JB9 H;  5D6Y A;  1Q81 C;  2RO0 A;  4BE2 A;  4KT0 E;  4FCY A;  1ZA1 B;  2F5T X;  3QWX X;  1QVG P;  1B34 A;  1E6H A;  5LJ5 e;  2RJE A;  1B3Q A;  3URG A;  2NUP B;  4LNP A;  2HAX A;  3MO8 A;  2DTH A;  2LT1 A;  2L5Q A;  1AVZ C;  1GCP A;  1QWF A;  3Q1J A;  3JB9 G;  2HBP A;  4VUB A;  3OMG A;  4CRI A;  3C4S A;  1SRM A;  2QDL A;  1Y0M A;  2EYW A;  4IUP A;  3EGU A;  5LJ3 g;  3GBQ A;  1U5S A;  1Q86 R;  2JTE A;  1WGS A;  2VAS A;  2GTO A;  1OPK A;  5IHN A;  1TWB A;  1PSF A;  1D1C A;  1W2B S;  2KRM A;  2JXB A;  4RTV A;  5LJ3 h;  1TUC A;  3JCM P;  3SWN B;  1VQ4 Q;  5KYY A;  2YXY A;  1K73 U;  4OMN A;  2CUB A;  4F17 A;  2XDB A;  3SB2 A;  2KK4 A;  3CC4 A;  4FW2 A;  1SEM A;  2X3W D;  2A36 A;  1NJI U;  4RKU E;  2XIC A;  2E6N A;  3CCS A;  2FRW A;  5KH6 A;  1M30 A;  4C8Q E;  4PJO G;  5AT1 B;  3CD6 A;  2GFU A;  2E65 A;  1UDL A;  3OYM A;  4OF1 A;  3P8B B;  1WNL A;  4PFZ A;  5L23 A;  2QI2 A;  2DO3 A;  2DPP B;  3CCM T;  1WHJ A;  1VQ7 A;  4JJN K;  2RQT A;  4E6R A;  4ZGJ B;  3AHU A;  2K2V A;  1ZBX A;  3QG1 A;  4C0F A;  1G8X A;  4A53 A;  4JRQ A;  5FU6 C;  2C0O A;  2EVR A;  1QCF A;  4BY6 C;  3V8L A;  2YRD A;  5DM7 R;  3CCU T;  2FPE A;  1GBQ A;  3CC7 A;  1FWZ A;  1G3W A;  2R5M A;  2K5L A;  3HTR A;  3OYG A;  4IKF A;  5FRO A;  3CCL T;  2XMF A;  4M7A D;  1PNJ A;  4EIK A;  3PGG A;  1PKS A;  3VYH B;  1UEC A;  1G3T A;  3REB B;  5KYW A;  2QA4 T;  2XID A;  4QVZ A;  2Y4Y A;  2LMJ A;  1ZQ1 A;  5DLO A;  2A08 A;  2J6F A;  5J26 A;  3P8H A;  1WFW A;  1YI2 Q;  2VGM A;  2K6D A;  4PLI A;  1KQS A;  1K9M U;  2DAQ A;  4DQ2 A;  4HCZ A;  4FYW B;  3RKY A;  4X34 A;  1VQN A;  3G6E Q;  2DIL A;  2DNU A;  2ECZ A;  2CH4 A;  3MP8 A;  4QQD A;  3CC7 T;  2RI3 A;  5GAO n;  2CT4 A;  2GTJ A;  2JMA A;  2E10 A;  3OW2 P;  1NZ9 A;  1Y57 A;  1ZSZ C;  2XDD A;  2CUD A;  1Q81 R;  5GJW B;  3V8J A;  3VS7 A;  1KC8 C;  2F2V A;  3PVQ A;  2LJ3 A;  1MMA A;  2LZ6 B;  3E2U A;  1M3B A;  4J9H A;  3FRN A;  4PFP A;  3RKW A;  3G71 T;  1TTH B;  4E7L A;  4M78 G;  3G1J A;  2LQK A;  4OB0 B;  4HXJ A;  4C92 F;  4PKC C;  1S1N A;  1V29 B;  2K57 A;  2RK1 A;  1X69 A;  5GAM f;  5A0L A;  2DZC A;  1N27 A;  2O9S A;  4O5V A;  1OI1 A;  1IB8 A;  1JJ2 A;  2M02 A;  5LJ3 j;  2CP7 A;  2D9T A;  3S3O A;  1YJW A;  1K8A C;  5DLQ E;  4RMO A;  1M1K C;  1BI3 A;  2RQV A;  3C0C A;  2MYS A;  3RDV A;  2HZY A;  1WLP B;  5A0D A;  4C0Z A;  2I2L A;  1OX8 A;  2E1H A;  3EGD B;  1VQ5 A;  5EG2 A;  2CDT A;  4OB2 B;  2EW3 A;  4J9D A;  5I2M A;  1CKA A;  3NTK A;  2P4T A;  3OYI A;  2NLU A;  4F7U F;  4JLI A;  1VQ4 T;  1RAA B;  1VA7 A;  2JT4 A;  4IUT A;  1KQ1 A;  1TUD A;  4OB1 B;  1WXT A;  3EG9 A;  4AFS C;  3GOX A;  1JJ2 S;  3VUB A;  2OTJ T;  2QQB A;  1PG5 B;  1RAG B;  3R6N A;  1FYN A;  2RK2 A;  2KY9 A;  4OMO A;  3TU4 K;  3L2R A;  1I81 A;  1ZSZ B;  4DEX A;  1EZZ B;  2CP6 A;  4Y92 A;  2FVU A;  2KMT A;  5GAN 4;  2FO0 A;  4M75 B;  2HSE B;  4C92 B;  4DOW A;  4JS5 A;  3CCV Q;  1W70 A;  2PQW A;  2YSQ A;  1M2V B;  2RHI A;  1SF9 A;  2KXC A;  5HCK A;  2KRO A;  2QEX Q;  1V1C A;  1X2Q A;  3OYA A;  3EG2 A;  2L89 A;  1M2V A;  1X6B A;  2KT1 A;  2DZ9 A;  4LUD A;  5D6X A;  2M0O A;  1QP3 A;  2BUD A;  4M75 G;  1UTI A;  1TG0 A;  1BU1 A;  2LT4 A;  4XTX A;  2C0T A;  3TCJ A;  2W10 A;  2DK3 A;  1I1J A;  2CP0 A;  4HT9 A;  1WX6 A;  2KVQ G;  5EC7 A;  4F7U B;  3CMA A;  1N8R C;  1G3Y A;  3JV3 A;  1VQ6 A;  1N9S A;  2LCC A;  3CCL A;  3G4S T;  1UFF A;  2JZ2 A;  4M78 C;  2QA4 Q;  1LCK A;  2KT8 A;  4FM4 B;  3M0Q A;  5GMK h;  2QA4 A;  3ER0 A;  3QUI A;  1E7O A;  4O6J A;  5HKC A;  2JS2 A;  3MEU A;  1V76 A;  3O5Z A;  3JB9 F;  2E5Q A;  3EFR A;  3V8K A;  1HSQ A;  2DXC A;  1YBY A;  3QWY A;  3LWH A;  1B07 A;  1EX4 A;  1G83 A;  1YJN A;  4J5Y A;  2NUT A;  2L2P A;  4Z88 A;  2COY A;  2F2X A;  5KYY B;  1BI2 A;  1KHI A;  2DL3 A;  3X25 B;  3EFS A;  5D6W A;  1R77 A;  3M55 A;  5FRN A;  2EGC A;  2KAF A;  4F7U E;  5LJ5 g;  1S72 T;  2CH4 W;  2HNI A;  2L3P A;  3PIP A;  3OW2 A;  4PJM A;  2QQR A;  1WHK A;  3QYH B;  2VC8 A;  4J9E A;  1S72 A;  4QQ6 A;  4M7A C;  2JVV A;  2OJ2 A;  2VKN A;  1OYX A;  1ZUU A;  4M7D A;  1X01 A;  1SHF A;  4M77 F;  4PJO E;  4PJO D;  1BI1 A;  2CS7 A;  2JTF A;  4D6W A;  5GMK j;  3VS6 A;  1RUW A;  5GAO l;  2JJ9 A;  2YUP A;  1XTD A;  3CEY A;  3SDZ A;  3CCJ T;  1A0N B;  2BTT A;  2GBQ A;  1YJN T;  4N4G A;  4KGX B;  1D09 B;  2DRK A;  2XK0 A;  2ZPG B;  3GNG A;  5KYU A;  1LNX A;  2DIQ A;  5KYN A;  1MND A;  4PNO A;  4GBQ A;  4RTT A;  1Y96 B;  1ABQ A;  4GLK A;  3INZ A;  5FWB A;  2GFA A;  4WCI A;  4WF2 A;  4AG2 C;  3C95 A;  1XJW B;  2L3Q A;  3HHT B;  1XQH A;  2RH2 A;  5HK3 A;  4IUQ A;  4GLM A;  1EIF A;  2R58 A;  1JJ2 P;  2QK0 A;  3PT9 A;  4LXC A;  2KRS A;  1RAI B;  1E6G A;  2X4J A;  1FMK A;  3I5S A;  4QVC A;  3CCV A;  2DVJ A;  4M7A B;  3RIR A;  2KQW A;  3KXT A;  2AZS A;  1KJW A;  2VGN A;  2LQ8 A;  3L1A A;  1VQL A;  3NMZ C;  4KUD K;  1H64 1;  2JM8 A;  1AWW A;  3FDR A;  3IQL A;  4HT8 A;  1ZSG A;  4LD6 A;  3THK A;  3OW2 S;  2J7I A;  4M7A A;  1D0Z A;  3L2Q A;  2RMO A;  4ESR A;  2P0P A;  2H8H A;  5KYX B;  3VKI A;  1K4U S;  1MGQ A;  2CP2 A;  3CC2 A;  2EYX A;  4MZT A;  5KYW B;  3V7S A;  3CC2 Q;  4M7D G;  1J3T A;  1PKT A;  2E6Z A;  2AHJ B;  5KE2 A;  3BY7 A;  1VIE A;  4IIO A;  1D1B A;  4EMK A;  1HYO A;  4M7D E;  3AT1 B;  3PE0 A;  4EDU A;  4AG1 C;  3PFS A;  2ZAE A;  2MIO A;  1VQM Q;  2BZ8 A;  2L3S A;  1AWO A;  1AD5 A;  3UA6 A;  2Z0W A;  2DXT A;  3OS2 A;  1Q7Y U;  3QDF A;  2EYY A;  3T9N A;  1QKW A;  1TOV A;  5KE3 A;  2H3J A;  2KGT A;  3FEO A;  4PJO C;  2FZK B;  3S3N A;  1LVK A;  1W6X A;  3H41 A;  4LDV A;  2AZV A;  2F5K A;  2V1Q A;  4M77 G;  1VQM T;  2E64 A;  2M0Y A;  2L0A A;  1BCM A;  4ZN1 A;  3OYE A;  2CP3 A;  2LQW A;  3CBP A;  4MDW A;  2C06 A;  2X4X A;  3LGL A;  3KUF A;  4JLG A;  4CC3 A;  2RJC A;  3WVE B;  3SWN C;  3H6Z A;  1OPL A;  1KIK A;  3VS1 A;  4M7D B;  2MAM A;  1UUE A;  3I55 Q;  1LPL A;  1NLO C;  5IH2 A;  2MMP A;  3OQ5 A;  4E7K A;  1M8V A;  3GNF B;  1M8M A;  4C5H A;  2DXB A;  3E9G A;  1D3B B;  3EAE A;  2EFI A;  3HPW A;  1VIF A;  2W0Z A;  4FIB A;  2LJ0 A;  4HVW A;  3QII A;  3A8H B;  1WQW A;  2ZPI B;  1NEB A;  1FMW A;  4OMM A;  2O2O A;  1RL2 A;  2RJD A;  3M0P A;  2NYS A;  1YIJ Q;  1BI0 A;  1HJD A;  4EPC A;  2KBT A;  3A8M B;  4XTZ A;  1OUL A;  1RAB B;  1M9S A;  2KEA A;  4A4K A;  3M54 A;  3UT1 A;  1WZO A;  1NJI C;  5LJ3 d;  1OEB A;  5LJ5 d;  2OI3 A;  1NYF A;  2GQV A;  4C8Q A;  1NYG A;  1WHL A;  3CC7 Q;  1X27 A;  1QVF S;  1HD3 A;  2K3B A;  2NWM A;  3EHQ A;  1WJR A;  1AOJ A;  3HRU A;  4PJN A;  3OMC A;  1W1F A;  3QYG B;  5FLX E;  2LP5 A;  3VS0 A;  3EGX A;  3OA6 A;  1TH7 A;  4JRP A;  9ATC B;  3CQT A;  2GCX A;  2EJG A;  2EYQ A;  4M78 D;  1QVF P;  2IIM A;  2LCL A;  2OTJ A;  1U3O A;  5GAN d;  4Q5W A;  5CKB A;  1EFN A;  3JCM d;  1PRM C;  1RI9 A;  2YLC A;  1OZ3 A;  4PK4 A;  2E3I A;  1QCN A;  1QCO A;  2EWN A;  4A4E A;  1VQ6 T;  1WHM A;  4XTV A;  4BUG A;  1GFD A;  4JPB W;  1CSK A;  2FPF A;  3G6E A;  1IHW A;  5CKF A;  4NS5 A;  3HL8 A;  4QT7 A;  1Y7X A;  2RI2 A;  2PVO B;  3CME A;  5GAM h;  5J3B A;  4X1V A;  4ZNX A;  5GAN 6;  3QHS A;  4XAX B;  2VVK A;  1MUZ A;  2J6O A;  2JOY A;  4HCB A;  1M90 C;  3JB9 J;  1M3A A;  4AFU C;  3MJX A;  2O31 A;  2AKK A;  3M5A A;  2RHU A;  5CIU A;  1GFC A;  1JU5 C;  1GBR A;  4JRK A;  4RG2 A;  3QJ6 A;  4J6X A;  2JS0 A;  2WAC A;  1SSF A;  2V8J A;  4BD3 A;  3M9Q A;  2VYT A;  4F7U G;  3G71 A;  1IZ6 A;  1AWX A;  1QVG A;  4C92 E;  3G6E T;  1K76 A;  3GPL A;  2BE9 B;  1IO6 A;  1BCO A;  4HVU A;  4K11 A;  3CCM Q;  2GQI A;  2RHY A;  3CCR T;  3MPU B;  4V2S A;  1KHC A;  3GLX A;  1UE9 A;  4LDX A;  1ABO A;  4MMK A;  1ZA2 B;  3A8G B;  2X4W A;  1GXI E;  1U8R A;  3ASK A;  1BYM A;  2X51 A;  1QMC A;  4E2F B;  1VQ8 Q;  2QXF A;  3PIO A;  2DYI A;  2OX7 A;  1GCQ C;  3JCM J;  4ZTJ A;  4AFQ C;  1IXD A;  4XU0 A;  1ACM B;  5GAM e;  1UGV A;  5CCA A;  3OYF A;  1NE8 A;  2P84 A;  2DRM A;  2ED1 A;  4J9I A;  1YCS B;  2YHT A;  5D7U A;  3PMT A;  4BAC A;  1YFN A;  3R6O A;  3PMI A;  1IHV A;  5CR2 A;  2R5A A;  1QP2 A;  3WVD B;  4JZ3 A;  3CCR A;  1YNZ A;  5GMK m;  2I0N A;  3M0S A;  3G4S Q;  1RLQ C;  5LJ5 j;  1ZLM A;  4J7I A;  5GAM d;  5IHK A;  2JNG A;  1M3C A;  4C92 C;  4EMH A;  1AZG B;  1W4S A;  3OSS C;  1PD0 A;  1YWO A;  2YT6 A;  4J7F A;  3RES A;  1WJQ A;  4DOV A;  2RI5 A;  4QQG A;  4M7D D;  2OTJ Q;  4JJB A;  1WHH A;  3OYJ A;  2QG9 B;  3OBY A;  4J9C A;  2DER A;  2MK5 A;  3FLG A;  5AYF A;  1YIT Q;  1YIT A;  3VS3 A;  2BZY A;  3VV0 A;  3CCV T;  2X4Y A;  1NPR A;  5A2Q E;  1ZBJ A;  3HSB A;  4B9W A;  1K9A A;  3H0I A;  4J8O A;  3X26 B;  4LDU A;  1QQJ A;  3L2W A;  2NUT B;  1Q82 U;  4KH1 B;  1VQO Q;  5I22 A;  1BB9 A;  1LJO A;  3CME Q;  2D8J A;  1VUB A;  3OS1 A;  4RCC A;  3CME T;  2EBP A;  3CD6 Q;  2ROT A;  1PSE A;  2PTK A;  2J06 A;  3JCM e;  2ATC B;  1OU9 A;  5J39 A;  2YRC A;  3ZFJ A;  4BI8 B;  1UJY A;  4M78 A;  3CXC S;  3G7Z A;  3L2V A;  1TSF A;  2HQE A;  4R55 A;  4JZ4 A;  2CT3 A;  3REA B;  4IIM A;  3NTH A;  1KQS P;  3EG0 A;  1W2B A;  3X20 B;  4FT2 A;  4Z02 A;  2HSP A;  4BI4 A;  1YHQ A;  5CQX A;  2DL8 A;  1YJW T;  4DEY A;  1VQ5 Q;  5GAO p;  2EPD A;  1UHC A;  2RQU A;  1I0C A;  3JCM X;  1T0H A;  2F1L A;  3F70 A;  4BI3 A;  4NL3 A;  1QKX A;  4AT1 B;  1QLY A;  3OB9 A;  3EG3 A;  4X9C A;  4C8Q F;  2QGG A;  1WXB A;  3OYH A;  2OAW A;  4RG8 A;  4F04 B;  1Z9Z A;  3EH1 A;  1VQ9 Q;  1VQP Q;  2CRE A;  3MCA B;  4M4Z A;  1VQP A;  2L3R A;  1KG1 A;  1BKB A;  2ENM A;  3SD4 A;  3CCU A;  1K73 R;  1CKB A;  2QTX A;  2B8A A;  1H3H A;  1M90 U;  2FRY A;  1OOT A;  2YDL A;  1OZ2 A;  2JMC A;  1K0X A;  2JN0 A;  2EQI A;  1YJ9 T;  2X3X D;  3EGD A;  2RPN A;  3FB9 A;  2FHD A;  3HRT A;  3JCM g;  5GAO r;  2EYZ A;  5GAN g;  2V1R A;  2EAY A;  1F1B B;  1VQL Q;  4P5N A;  1WPY A;  2E3H A;  2KE9 A;  3H0H A;  2ZPF B;  4XTW A;  3BW1 A;  4AMC A;  5KCO A;  4HVV A;  1M1G A;  1M1K U;  4A4H A;  4HKE A;  3OYC A;  2BIV A;  2IPO B;  2MF2 A;  3H9N A;  1U1S A;  2MCN A;  3EH2 A;  2LX9 A;  1WDX A;  5L8R E;  3VUZ A;  1AEY A;  1YI2 T;  2GGR A;  3NPF A;  1LOJ A;  7AT1 B;  1WXU A;  3CCS T;  1UGQ B;  3U23 A;  4EMK B;  2L8D A;  3GIB A;  1JQQ A;  1T3S A;  2H3E B;  4C8Q C;  1BBZ A;  2KRN A;  2MI6 A;  3CC2 T;  2M51 A;  3LX7 A;  1PRL C;  5A0G A;  1K73 C;  3TSZ A;  3VS5 A;  3TQ7 P;  2QYZ A;  1O9S A;  1D0X A;  1ZHI A;  3CC4 Q;  2Y4X A;  4PLL A;  1XOV A;  2DF6 A;  3FC3 A;  3M4G A;  1VQL T;  2LJ1 A;  5LJ3 f;  2RF0 A;  4C92 G;  2XD0 A;  5GAN e;  5LJ3 e;  2MOX A;  5GAO m;  2DIG A;  4RTZ A;  2ZGW A;  3MEA A;  2OTL Q;  2DVE A;  1DJ7 B;  2HQH A;  2HBW A;  1S72 Q;  2KSS A;  2M9U A;  3E1S A;  2C0I A;  4ZGD B;  4C5G A;  3TRE A;  1PWT A;  4HCC A;  2A7Y A;  2DFU A;  3CCJ Q;  3QSU A;  2LQN A;  3E9F A;  2KDS A;  1RAC B;  1VQ8 T;  2E41 A;  3MHX A;  2EJ9 A;  1D1A A;  5GAM j;  4EMG A;  2DL4 A;  2YUQ A;  4M7D C;  4BDY A;  1VOM A;  3QBY A;  2KXD A;  4C8Q B;  2V8I A;  1SKU B;  1GCQ A;  1X6G A;  3M0U A;  2DYB A;  3M4Y A;  1PM3 A;  3GP8 A;  3E19 A;  2LDM A;  2CZ0 B;  1N5Z A;  4C8Q D;  1VQ5 T;  4XQ3 A;  2KYM A;  3JSC A;  2HD0 A;  1XNI A;  1T0J A;  1ZUK A;  3JB9 I;  2G6F X;  1YI2 A;  4OB3 B;  1T3L A;  4MML A;  2DBK A;  4PJJ A;  1KC8 U;  4M77 B;  4M77 A;  4ZGE B;  2DD4 A;  3VYG A;  2ROL A;  3A5Z B;  4MZM A;  4M7D F;  2YLB A;  4J9F A;  4E47 A;  4M78 F;  5CO7 A;  5CQY A;  2D8H A;  1VQO A;  4DA4 A;  2V26 A;  5ECA A;  5GAM g;  4LDY A;  3CCQ Q;  3ZEH A;  4MDX A;  3CCQ A;  4FYY B;  3CPW A;  4LUE A;  1YJ9 Q;  1M1K R;  4C0D C;  3GF5 A;  2ZCF B;  4J83 A;  2BKD N;  5FU6 B;  2MPX C;  1WQ7 A;  1SSH A;  5CVI A;  1MMD A;  2QDY B;  3CPF A;  3PTA A;  2LCS A;  3TSW A;  5GAN 3;  1VYT A;  2K9G A;  2AKL A;  2XDP A;  4KGZ B;  3OBW A;  2XU8 A;  4KUL A;  1I07 A;  1KD1 R;  2VXE A;  1VYV A;  5IAY A;  3I56 A;  4M75 E;  1VQ4 A;  1ZUY A;  1UG1 A;  1AZE A;  4ELZ C;  4C5I A;  2HKQ B;  1SPK A;  1X75 C;  4QKU A;  4LN2 A;  2EGE A;  4DBF A;  4FYV B;  2PUO B;  3CCM A;  3L42 A;  3UA7 A;  4RCB A;  1NLP C;  2NUP A;  4M77 C;  2WSE E;  1Q81 U;  3WXM B;  3EGX B;  2MWO A;  2EKO A;  1VQK T;  5C0M A;  3I55 T;  2LC4 A;  4Z89 A;  3DLL A;  3VRY A;  4ME7 A;  5I2S A;  2F2W A;  4BDZ A;  1FXX A;  2YRV A;  1C0M A;  1Y71 A;  1VQK Q;  1Y07 A;  4J9B A;  3X24 B;  4DBH A;  2RQR A;  2O88 A;  3JB9 D;  1KQS S;  2DET A;  3OYK A;  2A0F B;  4OVA A;  1I5L A;  1VYU A;  5HK0 A;  4BE1 A;  2PNI A;  2HMA A;  4N0A A;  1D3B A;  2YUN A;  2QEX A;  4L6V 5;  4UC4 A;  3NGP A;  4R56 A;  3CCQ T;  3QPH A;  2GNC A;  3LH5 A;  4DBQ A;  3ZL7 C;  1VQ7 T;  1M1F A;  2VXF A;  5DY9 A;  2K3X A;  3MP1 A;  3CCR Q;  4A4G A;  1OQK A;  1UGP B;  2ESW A;  1Q95 G;  5FU7 C;  3UPU A;  1UGR B;  2XHC A;  4GY5 A;  3PVL A;  5LJ5 f;  4JDS A;  3CCL Q;  2V8K A;  2FPD A;  5GMK l;  1U1T A;  4BB7 A;  1YP5 A;  2O4X B;  2O01 E;  1Z9Q A;  5CKD A;  2K2M A;  2VUB A;  4OMP A;  2J05 A;  1K8A U;  2BZX A;  2HL5 C;  2KI7 A;  2RNA A;  1OU8 A;  4L5G A;  5CKE A;  2RHX A;  3N5B B;  2DE0 X;  2NUZ A;  2QTV A;  2ZPE B;  4HA8 A;  2RJF A;  2CKK A;  1TS9 A;  3SFM A;  2JTM A;  1PHT A;  4L59 A;  3UWN A;  2F69 A;  4FL6 A;  4Y91 A;  2R57 A;  2P0K A;  1IRE B;  2PZ1 A;  4Y28 E;  1ZX6 A;  2IG0 A;  2P0Q A;  2CSQ A;  4CI0 C;  4RUG A;  2EQU A;  3RMS A;  3QZ9 B;  2LTO A;  4PL6 A;  3EFO B;  3ZBD A;  2RQW A;  4MZP A;  5CKH A;  3VU3 C;  3PNW C;  1W2B P;  2J6K A;  1MV3 A;  2LX7 A;  1OX9 A;  1R0C B;  3UF4 A;  2PVG B;  1NG2 A;  2LNH B;  1NM7 A;  1YWP A;  4M7A G;  2FZG B;  3M53 A;  2K4Y A;  3MET A;  2E4H A;  4ORZ A;  2FL7 A;  1QVP A;  3OYD A;  1HK9 A;  3EG1 A;  3OYB A;  3BFM A;  4F16 A;  2DXU A;  3S3M A;  4M78 B;  1NBE B;  3JCM b;  4N4H A;  2MWP A;  1HXD A;  2FG0 A;  2VWF A;  1UJ0 A;  5M9O A;  1Q86 U;  3A98 A;  3LWI A;  2EKH A;  1NEG A;  4RTU A;  3A8L B;  1H92 A;  3FJ5 A;  1KC8 R;  4PJO B;  1QVG S;  1N8R R;  3A1P A;  1Q7Y R;  2K3Y A;  1ZSZ A;  3KFV A;  4LE9 A;  2PU9 B;  3S6W A;  2VV5 A;  3RMQ A;  4C8Q G;  3J81 E;  1G5V A;  4BE0 A;  5GAN h;  3CC4 T;  5FW9 A;  1MHN A;  1FMV A;  1RAD B;  4EMK C;  3CBM A;  2P4R A;  3DB4 A;  5FRM A;  1WI7 A;  5IXF A;  5GAN 7;  4LDW A;  4ZN3 A;  4RTW A;  2E5K A;  4ELY C;  1WYX A;  4D8D A;  4CC7 A;  5GAN 8;  5IT9 E;  3MKD A;  2XKO C;  3NHN A;  2QAS A;  2WSC E;  1WHG A;  1Q7Y C;  2DJZ A;  2QQS A;  8ATC B;  1I5O B;  4FYX B;  5GAN 5;  1VQP T;  1JXO A;  1JO8 A;  4JJC A;  4C5E A;  4KUI A;  3DLM A;  3KBG A;  1VQM A;  1K0S A;  1KQ2 A;  1GRI A;  4LD9 K;  2CGH A;  1C6V X;  2QEX T;  2D0N A;  3HKS A;  4OMQ A;  5GAO q;  2KYB A;  2SRC A;  3OYY A;  2DM1 A;  3CD6 T;  1YJN Q;  1GL5 A;  2DBM A;  3CCS Q;  1Q82 C;  1AT1 B;  2K7A A;  2EGA A;  1Q86 C;  4M7A F;  4TVR A;  1D0Y A;  4AFZ C;  2LRQ A;  2A3L A;  3CBO A;  2OTL A;  2G3R A;  2BE7 D;  4IUV A;  4A63 B;  2FZC B;  2KR3 A;  2WSF E;  1AHJ B;  1RLP C;  3MP6 A;  3EFO A;  3I35 A;  1QVF A;  2EQK A;  2COZ A;  1K9M R;  2EIF A;  4A54 A;  3NFC A;  3I55 A;  2ZZD A;  1PD1 A;  4M75 D;  3X28 B;  3CCJ A;  4XU3 A;  3QKJ A;  2HEQ A;  1FX7 A;  1BIB A;  2OAU A;  4ZTF A;  3V7C A;  2A28 A;  4ANJ A;  4JRI A;  3CCE T;  1U06 A;  1YIJ A;  8AT1 B;  3TVT A;  1X43 A;  3C94 A;  2COW A;  1WJS A;  2D1X A;  2XG8 D;  3MEW A;  3TEE A;  2CP5 A;  1VQO T;  2QQ9 A;  3I56 T;  2RHZ A;  3D7S B;  3QDR B;  1X6O A;  2HCK A;  3OY9 A;  5IN1 A;  2SEM A;  4OGC A;  1JEG A;  2PUK B;  2HDA A;  2ZPB B;  5HY6 A;  3UAT A;  1VQ6 Q;  2Y90 A;  2RD1 A;  4BY6 B;  3BE3 A;  2LNV A;  3CPW P;  3H8Z A;  1M27 C;  2DD5 A;  1M5Q 1;  2QAZ A;  4FSX A;  2CZ6 B;  1JXM A;  2M1H A;  4FT4 A;  1VQN Q;  1UGS B;  3SEM A;  1IRX A;  4D8K A;  1I4K 1;  1MMN A;  1JBM A;  3CCE Q;  1K1Z A;  1N9R A;  1KFZ A;  2IVW A;  2CYZ B;  2CZ7 B;  3VJP A;  2X35 A;  4HCK A;  5C6S A;  4PJL A;  1PC0 A;  3RNJ A;  1AWJ A;  2ABL A;  3JCM c;  2X9H A;  3A8O B;  1YHQ T;  2B86 A;  3J80 E;  3V7R A;  2DL5 A;  3FJP A;  1P92 A;  3RER A;  4OP0 A;  1G3S A;  2DLP A;  4E7I A;  2CZ1 B;  2DEU A;  2DL7 A;  2O4X A;  5GMK i;  2FEI A;  5KYU B;  2E12 A;  4JS4 A;  5GMK e;  1H3Z A;  3M57 A;  1RAE B;  5LL6 S;  1H8K A;  2K5I A;  1KK7 A;  4FW1 A;  5CK9 A;  3O8V A;  1WIE A;  4Z8A A;  2DX1 A;  2RN8 A;  5I21 A;  1BK2 A;  1MNE A;  2QQA A;  4M77 E;  4PJO F;  2ZPH B;  4F14 A;  3I56 Q;  2D6F A;  4B6M A;  3QO3 A;  3DB3 A;  3VS2 A;  3OYN A;  4C0D B;  4E7J A;  1X2K A;  1B7T A;  4N4I A;  3EHR A;  4X9D A; 
#chains in the Genus database with same CATH homology
 3UA7 A;  1NLP C;  4JJD A;  2CDT A;  3ULR B;  2EW3 A;  4J9D A;  1CKA A;  1UE9 A;  1ABO A;  4Z89 A;  1VA7 A;  2JT4 A;  4FSS A;  3VRY A;  1TUD A;  1WXT A;  2F2W A;  4AFS C;  1GCQ C;  4AFQ C;  3I9Q A;  3R6N A;  1KSW A;  1FYN A;  4OML A;  2A37 A;  4OMO A;  4DEX A;  2ED0 A;  4J9B A;  1UGV A;  4Y92 A;  5IHI A;  2RQR A;  2O88 A;  2FO0 A;  2DRM A;  2ED1 A;  4J9I A;  1VYU A;  1YCS B;  1W70 A;  2YSQ A;  2PNI A;  2KXC A;  5HCK A;  2KRO A;  2YUN A;  1V1C A;  1X2Q A;  3EG2 A;  3NGP A;  1X6B A;  2KT1 A;  2GNC A;  3VS4 A;  3I5R A;  3LH5 A;  4LUD A;  3ZL7 C;  4JZ3 A;  1QWE A;  1YNZ A;  2I0N A;  1UTI A;  1TG0 A;  1BU1 A;  3M0S A;  1RLQ C;  2C0T A;  5I11 A;  2ESW A;  2W10 A;  1ZLM A;  3H0F A;  2DA9 A;  1SRL A;  5IHK A;  1I1J A;  1M3C A;  1WX6 A;  5EC7 A;  1AZG B;  1YWO A;  5GJV B;  4KRT A;  2YT6 A;  3JV3 A;  3PVL A;  4J9G A;  5IXB A;  2FPD A;  4JJB A;  1UFF A;  2JM9 A;  1YP5 A;  1LCK A;  2KT8 A;  4J9C A;  3M0Q A;  1Z9Q A;  1E7O A;  2K2M A;  1YN8 A;  2JS2 A;  2J05 A;  4OMP A;  4CC4 B;  3O5Z A;  4CC2 A;  3VS3 A;  2BZX A;  2BZY A;  1HSQ A;  2RNA A;  1ZBJ A;  3QWY A;  1K9A A;  3H0I A;  2NUZ A;  2DE0 X;  1B07 A;  1G83 A;  4R0K A;  2L2P A;  4Z88 A;  5I22 A;  1BB9 A;  2F2X A;  2DL3 A;  2D8J A;  2YUO A;  2EBP A;  2EGC A;  2ROT A;  1PHT A;  2PTK A;  1G2B A;  2J06 A;  3M0T A;  2CH4 W;  2L3P A;  1SHG A;  2PZ1 A;  4J9E A;  1ZX6 A;  1UJY A;  2CSQ A;  2JW4 A;  4RUG A;  2OJ2 A;  1MV0 B;  2VKN A;  1ZUU A;  2AK5 A;  1OV3 A;  2RQW A;  3RBB B;  2DMO A;  1SHF A;  4JZ4 A;  2KNB B;  2CT3 A;  3REA B;  2J6K A;  1MV3 A;  2LX7 A;  4IIM A;  2O9V A;  3UF4 A;  1NG2 A;  2LNH B;  3VS6 A;  1NM7 A;  1RUW A;  4RTX A;  1YWP A;  2K79 A;  5FWC A;  1WA7 A;  3EG0 A;  2YUP A;  4ORZ A;  2HSP A;  3EG1 A;  1A0N B;  1UHF A;  2BTT A;  4F16 A;  2DL8 A;  2GBQ A;  1ARK A;  3SHW A;  3VRZ A;  4DEY A;  2DRK A;  2CSI A;  2FG0 A;  2EPD A;  1UHC A;  2RQU A;  1I0C A;  1T0H A;  2VWF A;  1UJ0 A;  1QKX A;  1QLY A;  3EG3 A;  2DJQ A;  4GBQ A;  4RTT A;  3A98 A;  1WXB A;  1ABQ A;  2EKH A;  1NEG A;  2OAW A;  4RTU A;  5FWB A;  4WCI A;  4AG2 C;  1Z9Z A;  1H92 A;  3M0R A;  2CRE A;  4RTY A;  3FJ5 A;  4M4Z A;  2L3Q A;  2ENM A;  4GLM A;  3KFV A;  1CKB A;  1H3H A;  2KRS A;  2FRY A;  1OOT A;  2YDL A;  2JMC A;  4LE9 A;  3I5S A;  1E6G A;  1FMK A;  3QWX X;  1K0X A;  2DVJ A;  2EQI A;  1E6H A;  1B3Q A;  2X3X D;  2AZS A;  2RPN A;  2EYZ A;  1KJW A;  4LNP A;  5FW9 A;  2V1R A;  3NMZ C;  2JM8 A;  1AWW A;  2P4R A;  3IQL A;  1ZSG A;  1WI7 A;  5IXF A;  3THK A;  1AVZ C;  1GCP A;  1QWF A;  2J7I A;  2KE9 A;  4RTW A;  2E5K A;  3H0H A;  2RMO A;  4ESR A;  1WYX A;  1SRM A;  2H8H A;  2QDL A;  4D8D A;  4CC7 A;  4HVV A;  1Y0M A;  1K4U S;  3NHN A;  2EYX A;  2EYW A;  3EGU A;  1J3T A;  1PKT A;  3GBQ A;  1U5S A;  2JTE A;  2MCN A;  4IIO A;  1WDX A;  2GTO A;  1JXO A;  1OPK A;  5IHN A;  1JO8 A;  1AEY A;  3PE0 A;  4AG1 C;  2GGR A;  4JJC A;  3NPF A;  1WXU A;  2KRM A;  2JXB A;  4RTV A;  2MIO A;  3U23 A;  1TUC A;  2BZ8 A;  2L3S A;  1AWO A;  1AD5 A;  3UA6 A;  1JQQ A;  1T3S A;  1BBZ A;  2KRN A;  1K0S A;  1GRI A;  2M51 A;  1PRL C;  4OMN A;  2EYY A;  2CUB A;  2D0N A;  4F17 A;  1QKW A;  3TSZ A;  3VS5 A;  2KGT A;  4OMQ A;  2KYB A;  2SRC A;  1W6X A;  2DM1 A;  3H41 A;  1GL5 A;  1SEM A;  2X3W D;  2A36 A;  2DBM A;  2AZV A;  2V1Q A;  2M0Y A;  2L0A A;  1XOV A;  2DF6 A;  2FRW A;  2K7A A;  2EGA A;  2LQW A;  2LJ1 A;  2RF0 A;  1M30 A;  2MOX A;  4AFZ C;  4RTZ A;  4CC3 A;  1UDL A;  4A63 B;  2KR3 A;  1OPL A;  1KIK A;  3VS1 A;  1RLP C;  2HBW A;  3I35 A;  1UUE A;  5IH2 A;  1NLO C;  2C0I A;  5L23 A;  1PWT A;  1M8M A;  2RQT A;  4E6R A;  2HEQ A;  2W0Z A;  2LQN A;  2LJ0 A;  4HVW A;  2A28 A;  1NEB A;  1U06 A;  4OMM A;  2O2O A;  3M0P A;  3TVT A;  1X43 A;  2C0O A;  2EVR A;  1HJD A;  1QCF A;  2KBT A;  2D1X A;  2KEA A;  2FPE A;  1OEB A;  2DL4 A;  2OI3 A;  1GBQ A;  2YUQ A;  1NYF A;  2KXD A;  1NYG A;  2HCK A;  1X27 A;  1GCQ A;  2SEM A;  1HD3 A;  1X6G A;  2K3B A;  2NWM A;  3M0U A;  2DYB A;  3EHQ A;  2XMF A;  1AOJ A;  1PNJ A;  4EIK A;  1PKS A;  1W1F A;  1JEG A;  2LP5 A;  1UEC A;  3REB B;  3VS0 A;  2HDA A;  3UAT A;  1N5Z A;  3CQT A;  2LMJ A;  2IIM A;  2KYM A;  1T0J A;  1ZUK A;  2A08 A;  2J6F A;  1U3O A;  2G6F X;  1EFN A;  1WFW A;  1PRM C;  1RI9 A;  2K6D A;  1T3L A;  1M27 C;  2DBK A;  1JXM A;  3SEM A;  2ROL A;  4J9F A;  1GFD A;  4JPB W;  1CSK A;  2FPF A;  4D8K A;  4QT7 A;  2D8H A;  2DIL A;  1K1Z A;  2DNU A;  1KFZ A;  5ECA A;  2ECZ A;  2CH4 A;  4X1V A;  4ZNX A;  4HCK A;  2CT4 A;  2GTJ A;  3RNJ A;  1AWJ A;  2ABL A;  2JMA A;  4LUE A;  2B86 A;  1MUZ A;  2VVK A;  2J6O A;  2DL5 A;  1Y57 A;  2DLP A;  1SSH A;  1M3A A;  2CUD A;  4AFU C;  2DL7 A;  2O31 A;  5GJW B;  3VS7 A;  2AKK A;  2F2V A;  2FEI A;  3PVQ A;  2LJ3 A;  2LCS A;  3TSW A;  2LZ6 B;  1M3B A;  1VYT A;  2K9G A;  2AKL A;  1GFC A;  1H8K A;  4J9H A;  1JU5 C;  1GBR A;  1WIE A;  4Z8A A;  2DX1 A;  2RN8 A;  2JS0 A;  4HXJ A;  1BK2 A;  1I07 A;  4F14 A;  1S1N A;  1VYV A;  1AWX A;  1X69 A;  3VS2 A;  1ZUY A;  2O9S A;  1UG1 A;  1K76 A;  1AZE A;  1X2K A;  1SPK A;  4LN2 A;  2EGE A;  1IO6 A;  3EHR A;  2RQV A;  4HVU A;  3C0C A;  4K11 A;  2GQI A;  1WLP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...