1ZLMA

Crystal structure of the sh3 domain of human osteoclast stimulating factor
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
58
structure length
58
Chain Sequence
GQVKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Osteoclast stimulating factor 1
publication title Structure of the SH3 domain of human osteoclast-stimulating factor at atomic resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 13
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2005-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1zlmA00
4IIOA 3VS0A 3REAB 1N5ZA 2CT4A 2JXBA 2D8HA 1CKBA 3U23A 2J6OA 2JM9A 4OMNA 2W10A 4LNPA 2H8HA 3H0IA 4AG2C 3EGUA 3M0RA 2DRKA 2E5KA 1KSWA 2BZ8A 1QCFA 3NPFA 2QDLA 4D8KA 1VYUA 2KRSA 1K4US 1EFNA 1T0JA 1TUCA 2XMFA 3PVLA 1W6XA 2J6FA 1CSKA 2CH4A 2LQNA 4OMOA 5IHNA 2O9SA 3I5RA 4J9HA 1GFCA 1UFFA 1PRLC 2BZYA 2CSQA 2DYBA 2AKKA 2CT3A 4J9BA 4Z8AA 1PRMC 2KXCA 3H41A 2DILA 1NLPC 2EGAA 4X1VA 1AVZC 1U3OA 4OMQA 1QKWA 1QWEA 2AZVA 4HVVA 2LJ3A 3VS4A 2DMOA 1K9AA 3VS7A 1UJ0A 1UHCA 2NWMA 2JMAA 2DM1A 1FYNA 1PKTA 4J9DA 2DLPA 4ZNXA 2ED1A 2K7AA 3EG3A 3VS1A 4F14A 1NYGA 2NUZA 1G2BA 2LMJA 1WX6A 1UG1A 1PWTA 2PTKA 4AFSC 4RTTA 1ZUKA 5IH2A 2RNAA 1AOJA 2AK5A 4OMPA 3ZL7C 1SEMA 2LQWA 2GTOA 1S1NA 1FMKA 1AWJA 3CQTA 1GBRA 1AD5A 3VS5A 1WYXA 2MIOA 2HEQA 2EGEA 1VYVA 2LZ6B 1X2KA 2PNIA 1TG0A 2DNUA 2FEIA 3LH5A 1RLQC 3EG2A 2KXDA 2J7IA 2RQRA 3RNJA 1NM7A 5FWCA 2I0NA 2KT1A 1MV3A 1MUZA 1ZUYA 5FW9A 2ABLA 2DL3A 1WIEA 1X43A 1X6GA 1YWOA 1MV0B 2A36A 2RQVA 2ECZA 3QWYA 4J9FA 2V1RA 2JT4A 2AKLA 1CKAA 2OJ2A 2KNBB 2FRYA 1ABOA 2PZ1A 1PHTA 1J3TA 2K2MA 2K9GA 1RLPC 1QLYA 4CC2A 3EG1A 3I5SA 1OV3A 3M0SA 1K76A 4Z88A 1ZBJA 1M3CA 2ROTA 4OMLA 3VS3A 1JEGA 1ZLMA 1KJWA 1I0CA 3VS2A 1JU5C 1UECA 2SEMA 4ESRA 3VRZA 1H92A 2D0NA 2KROA 2EYXA 2RF0A 1RUWA 2DL8A 3UA7A 4JJCA 5IHKA 1GBQA 4HVWA 1BK2A 1AZGB 3M0PA 4DEYA 1WXUA 2VKNA 1G83A 2DA9A 5EC7A 1ZSGA 2DBKA 2X3XD 2KYBA 5GJVB 4OMMA 3I35A 2VWFA 1T0HA 4QT7A 1AWOA 2EPDA 1AZEA 2L3PA 1BU1A 2L0AA 2KYMA 4JPBW 1PNJA 1SHFA 2DJQA 2O9VA 1KIKA 4JZ3A 2DVJA 2GNCA 3FJ5A 2C0OA 1LCKA 1JO8A 2GTJA 4LUDA 1OPKA 1SSHA 2EBPA 2HBWA 2GGRA 2O2OA 1Z9QA 1HJDA 2L3SA 1NEBA 1B07A 4RTXA 4LE9A 2V1QA 2J6KA 1WXTA 2GQIA 3TVTA 1T3LA 2CUBA 2J06A 3EHQA 1RI9A 4JJBA 4RTUA 2EGCA 2LP5A 4RTWA 1W70A 2HSPA 4CC4B 1TUDA 2C0IA 1UJYA 4A63B 2DBMA 4E6RA 2RQTA 2KE9A 2JMCA 3REBB 2A28A 2O88A 5GJWB 1E7OA 2YUOA 1I1JA 1Y0MA 1HD3A 2CH4W 2DL4A 4HVUA 2RPNA 1XOVA 1AWWA 2DE0X 2F2VA 1QWFA 5I11A 2CUDA 2J05A 1QKXA 3NGPA 3VRYA 1W1FA 1K1ZA 3EG0A 3SHWA 2FG0A 1X27A 2CREA 1B3QA 2IIMA 5FWBA 2A08A 1SRMA 1GRIA 1WDXA 3O5ZA 2EW3A 1E6HA 3NHNA 2ED0A 3JV3A 1GFDA 1BBZA 4CC3A 2CSIA 3SEMA 3GBQA 2K3BA 1VA7A 4ORZA 1UUEA 1K0XA 4AG1C 1A0NB 3UATA 2DL5A 1M3BA 3TSZA 3M0QA 1M3AA 1YWPA 3PE0A 2FPFA 1AWXA 1VYTA 1YN8A 1SPKA 1UTIA 1T3SA 1WI7A 1M27C 4DEXA 3UA6A 2P4RA 2LCSA 1I07A 4EIKA 2LJ0A 1M8MA 4R0KA 2D8JA 2EYWA 1E6GA 2MOXA 1YP5A 3C0CA 1H8KA 4J9EA 4M4ZA 5I22A 1GCQA 2BTTA 2SRCA 1SHGA 2EYZA 2KRMA 2KRNA 1ZUUA 2LJ1A 2KGTA 2YUPA 4J9IA 1WA7A 2M51A 3EHRA 2ESWA 3R6NA 4IIMA 2VVKA 4LUEA 1NG2A 1NLOC 4WCIA 1GL5A 4FSSA 1NEGA 4GBQA 1X2QA 2RMOA 2JW4A 2MCNA 2ENMA 2W0ZA 3UF4A 2C0TA 4GLMA 2FPDA 2FO0A 4AFUC 2BZXA 1X69A 5ECAA 2RQUA 2YUQA 2L2PA 4RTYA 1U5SA 4RTZA 2EVRA 3TSWA 4F16A 2GBQA 1WLPB 1H3HA 1M30A 1JXOA 2YT6A 3QWXX 1X6BA 2K79A 5HCKA 1YNZA 2OI3A 1UDLA 4AFQC 1BB9A 3M0UA 1UHFA 3PVQA 1K0SA 1ABQA 3VS6A 1UGVA 4JZ4A 2EKHA 3KFVA 2FRWA 1ZX6A 2RQWA 2X3WD 2FPEA 2DX1A 1SRLA 2OAWA 4RUGA 2HDAA 2JS2A 2YUNA 2AZSA 1GCPA 2DL7A 2DRMA 1KFZA 2M0YA 4LN2A 1HSQA 2ROLA 5IHIA 2B86A 2KBTA 3H0FA 1ARKA 2JTEA 4HXJA 2KT8A 2EYYA 4Z89A 2CDTA 1WXBA 2JM8A 1JQQA 1JXMA 2F2WA 4CC7A 3THKA 1Y57A 4HCKA 2EQIA 1PKSA 2K6DA 2A37A 1UE9A 5IXFA 3RBBB 2F2XA 1U06A 3M0TA 2LX7A 3H0HA 1V1CA 2L3QA 2KR3A 5IXBA 2YDLA 4KRTA 2YSQA 4J9GA 1OOTA 1GCQC 4AFZC 4J9CA 2RN8A 4K11A 1YCSB 5L23A 2D1XA 1OEBA 3IQLA 2JS0A 4RTVA 4Y92A 3I9QA 2LNHB 4D8DA 2KEAA 1OPLA 1NYFA 1Z9ZA 2DF6A 3ULRB 1AEYA 2HCKA 3A98A 1IO6A 4F17A 3NMZC 2G6FX 1WFWA 4JJDA 2O31A
chains in the Genus database with same CATH superfamily
4BDZA 3VS0A 2CP0A 2CT4A 1WQ7A 2D8HA 1CKBA 4C92C 2MMPA 1VQPA 4NOYA 1UEBA 3MO8A 2H8HA 1I8FA 2FHDA 3CCUQ 4DQ2A 3OYBA 1PD0A 1X6OA 3RKXA 3CXCS 5CQXA 2OTLQ 5GANj 3DB3A 2JNGA 2XMFA 1F1BB 1VQ5A 2FZGB 1GFCA 4F7UB 1OI1A 5KYYA 4J9BA 2KXCA 3H41A 3SWNC 4OMQA 1QKWA 5KCOA 2OTJA 4HT8A 3MEUA 4X34A 2LNVA 2GQVA 2QQSA 4EMKB 1K9AA 5GAOl 3FC3A 2XDPA 3CCQQ 2QA4Q 5HK0A 4M75B 5LJ5f 3CMAT 4BI3A 2BIVA 3S3MA 1VQLA 2RD1A 2DM1A 1U1TA 3P8DA 2PVOB 4JRIA 4J9DA 4ZNXA 4MZMA 2ED1A 2K7AA 4PJLA 1M4ZA 4F14A 2NUZA 1VQNT 3GLXA 1RAHB 2LMJA 3FIFA 5CKFA 4PJOG 1PWTA 4AFSC 1VQOT 1M8VA 4RTTA 1ZUKA 4XK8E 3CCJQ 2LRQA 1AOJA 2AK5A 2EQJA 5LJ3e 6AT1B 2LQWA 2GTOA 1S1NA 5GAN2 3LLRA 4KULA 1AD5A 3VS5A 2MK5A 2VYTA 1IREB 1YIJT 3JCMf 2HEQA 1VYVA 5KYYB 3I55Q 5GAN8 2EKOA 2PNIA 4YTLA 3X25B 3JSCA 4EPCA 3FEOA 3C94A 1Y96A 2FL7A 1K9MR 2KT1A 3JB9G 1MV3A 3M9QA 2PQWA 4MDWA 2ABLA 1JBMA 3CC4T 4M7DF 4A4FA 2CZ7B 2JT4A 3I56A 4N0AA 3RMSA 3EAEA 3URGA 5GMKm 1CKAA 4A53A 2FRYA 4M78G 1QVFS 2HBPA 4C8QD 1D1AA 1XTDA 4GY5A 1OZ3A 2DTHA 2E41A 5IN1A 1PSFA 3GIBA 2KDSA 1OV3A 3M0SA 4Z88A 4X9CA 2F69A 1PD1A 2RK2A 3L2ZA 3VS3A 2LT1A 3E9GA 1ZLMA 5HY6A 1I0CA 3VS2A 4Q5WA 1JU5C 2RHXA 2SEMA 1QVFA 1WHJA 4BI8B 4J8OA 3QDFA 3CCRQ 1QVGA 1M90U 2YWWA 3EH2A 5D6XA 2EYXA 3CCEA 2DL8A 3UA7A 1P92A 2KY9A 5A0DA 1D0XA 1TUGB 2MPXC 3OW2S 4QQGA 3R6OA 1Y96B 3BE3A 1DJ7B 3QO3A 1ZBXA 4OVAA 4A4HA 2DERA 1YBYA 4A4GA 2VKNA 1LVKA 3CPWS 1WHKA 5A0LA 2RJEA 5EC7A 2QI2A 1S72A 3VYHB 2XG8D 3UT1A 1T0HA 4ELYC 4IUQA 1OU9A 4M77A 3A8GB 1AZEA 2L3PA 1BU1A 4JRPA 3OBYA 2DD5A 4JZ3A 4ME7A 2DVJA 3SB2A 1JO8A 4LUDA 4DBQA 3EGDA 1G3TA 4XTWA 2LTOA 3G7ZA 3JCMc 4NL2A 4ANJA 3L2QA 3Q1JA 3JCMV 2J6KA 4C0ZA 1BI3A 2J06A 5EG2A 4LDVA 3CCUA 4CC4B 2C0IA 4M7DC 4PNOA 2QQAA 3HKSA 2VGMA 4A63B 4E7SA 2RQTA 5GJWB 2DKGA 1E7OA 5D7UA 3MCAB 3CCVT 1I1JA 4HCZA 2XI9A 4TVRA 1H641 5GMKe 2RPNA 2DE0X 1IB8A 2Y90A 3KBGA 4IUPA 1W1FA 1I5OB 1K1ZA 3X20B 1B3QA 1BCOA 4M77B 3VUBA 3QPHA 1SRMA 1Y7XA 3O5ZA 3NHNA 1E6HA 2RHUA 4B9XA 1IGQA 2IG0A 3HFOA 3QYHB 1GFDA 1BBZA 2EQUA 3SEMA 3CBMA 1M1KR 1YHQT 2K3BA 1M1KC 4FL6A 3CCQA 4ZTJA 1A0NB 3EGDB 4M7AE 1M3BA 3M0QA 3J81E 1VYTA 5GANd 2CP3A 1VQ4Q 3OYJA 1M27C 3DLMA 4QQ6A 2RHZA 3UA6A 2MYSA 1I07A 2LJ0A 2K5IA 4PJOA 3JAME 1NE8A 3V8JA 2DO3A 1K73U 1HK9A 1YP5A 1VQNQ 2M1HA 4M4ZA 1GCQA 3RERA 5FU6B 1SHGA 4L59A 2KRMA 2KRNA 1VQOQ 2KGTA 2PU9B 4JRQA 4IIMA 2VVKA 3GNFB 3CCLQ 4LD6A 1RAAB 4IUUA 5GAMj 1GL5A 3OYEA 4FSSA 2FVUA 2E12A 2R58A 2HSEB 1X2QA 3CXCP 2HKNA 2ENMA 1YIJQ 3QHSA 1KQSS 3OSVA 1MMAA 2DXUA 2RQUA 2L2PA 4RTYA 3VYGA 2EVRA 2K4YA 3TSWA 1MMGA 2GBQA 3E1SA 4OMFB 4BY6B 2L8DA 2YT6A 3CC4Q 2RK1A 1X6BA 1YNZA 2OI3A 1UDLA 3L2UA 3M0UA 4JS4A 1KD1R 1W4SA 4PJOB 1KD1C 1PM3A 2QASA 1VQ9A 1VQ6T 4M7AA 9ATCB 2X3WD 4DBHA 3MJXA 2FPEA 1SRLA 2OAWA 4RUGA 2QYZA 2DRMA 1KFZA 2OTLT 1HSQA 2EAYA 4BDYA 1YJNA 4BUGA 1YJWT 3QJ6A 4CC7A 3CCRA 1WNLA 1SKUB 4FYVB 3EFSA 2A37A 1VQ7T 2DZCA 1HXDA 1OX8A 4NL3A 3CBPA 2YRDA 2LT4A 2V8KA 5IXFA 3EGXA 2XHCA 2QEXQ 4DBRA 1U06A 5CCAA 4O5VA 1N9SA 4C5EA 4F7UF 1V1CA 2FYKA 2HQEA 3META 3MKDA 2H3EB 2RM4A 1OOTA 5A0GA 3DB4A 4J9CA 1EZZB 5LJ5j 5L23A 4BB7A 1Q86U 2RI3A 3IQLA 4Y92A 3GP8A 3INZA 4C92G 3G71T 4HCCA 1Z9ZA 2E3IA 4M75F 4M7AB 1ZSZC 3JCMQ 1M1FA 4KH1B 4ZGEB 3NMZC 5DLOA 1WFWA 4JJDA 3T9NA 1R0BG 3V7SA 2JXBA 2QTXA 2XKOC 2J6OA 1QVFP 5IAYA 4LNPA 2XK0A 2D9TA 2RHIA 3H0IA 2MAMA 2YLBA 3V8LA 4RCBA 2BZ8A 1K4US 3EGXB 1EFNA 1N9RA 5CKDA 1QMCA 4HKEA 3L1AA 3PVLA 1Q81U 2LQNA 2CH4A 4FYXB 4OMOA 5IHNA 4MDXA 3UDCA 2O9SA 4J9HA 1WGSA 2QQRA 4M78D 2CSQA 2AKKA 2RJFA 1C6VX 1PRMC 4VUBA 3OW2P 1NLPC 2IPOB 2ZGWA 5J26A 1RAEB 1U3OA 2DPPB 2YHTA 2ZPIB 3NTKA 1TOVA 4M75E 2AZVA 3C12A 3CPWP 2DMOA 1GXIE 2P0KA 3VS7A 5LJ3f 1UJ0A 1YHQQ 4JUVA 1AT1B 2XDDA 1TTHB 1FYNA 1PKTA 3CMAA 2P84A 1ZA2B 3HFNA 5CO7A 5GAN3 2LQ8A 3EG3A 3CCSQ 1UGRB 4LDUA 1WX6A 3CC7A 1VQNA 1VIFA 5IH2A 2RNAA 4C0DB 1Q7YU 1JRIA 1RADB 3ZL7C 2RI2A 1VQOA 4PLLA 1FMKA 1OZ2A 4V2SA 2P0QA 1MHNA 4EMKC 1QVPA 3OYCA 4M75C 3TCJA 3CBOA 2MIOA 3PGGA 1IHWA 1Y07A 2EGEA 2DXTA 2LZ6B 1X2KA 4MMLA 4LD9K 3LH5A 4EMGA 3WVEB 1M90C 1YIJA 2J7IA 2RQRA 3RNJA 5FWCA 2I0NA 3G4SA 1QW1A 3NFCA 4KT0E 2DL3A 3PTAA 1O9SA 2DZ9A 4EDUA 1MV0B 3QDRB 2I2LA 2ECZA 3CC4A 1NJIU 1LNXA 2OJ2A 3PFSA 1ABOA 1X75C 5M9OA 2F5TX 5GAMd 1B34B 3PT9A 1J3TA 2K2MA 2LCLA 2X35A 3CCMA 2K9GA 2JUFA 2X4WA 1QLYA 4CC2A 3EG1A 4R55A 1VQ6Q 3H9NA 2FZCB 2XDBA 3HRUA 1ZBJA 1N8RU 5CAIA 3P8BB 1RAGB 3OYGA 2X4JA 3X26B 1JEGA 4C8QA 3SD4A 3ZBDA 3SFMA 3VU3C 3VV0A 1H92A 2D0NA 2KROA 1RUWA 1YJWQ 2XIDA 1PSEA 1KQ2A 5C6SA 1BK2A 3AT1B 1AZGB 1VQ7Q 5CR2A 4XTYA 3M0PA 4FW2A 4DEYA 1WXUA 3CXCA 1G83A 2DA9A 2RJCA 1VQKA 4D6WA 3MEAA 3MEVA 4M77F 1QCNA 2QGGA 4OMMA 3I35A 4QT7A 3UWNA 1VQ4T 2YLCA 4ZTFA 1KQSP 2KYMA 4AT1B 2P4TA 2GNCA 3FJ5A 2RB6A 3G71Q 4M7DG 1HYOA 5CKHA 4FT2A 1C1AA 2EBPA 2HBWA 4J7IA 1Z9QA 1NEBA 4E2FB 4LE9A 1LJOA 2CP2A 1W2BS 2KK4A 3TVTA 5KCHA 4C8QB 3OMGA 2A3LA 2RH2A 2RHYA 3EHQA 1RI9A 1QQJA 3OYAA 3CCLT 1BCMA 5HK3A 3VUZA 5LJ5d 4QVDA 4BE1A 1JB0E 4N0AC 2JMCA 4KUDK 1BKBA 1K73R 1KC8U 1VQ8Q 1K73C 4ZGDB 4N4IA 2CH4W 1HD3A 3OMCA 4HVUA 1XOVA 4M77E 1QWFA 3CCVA 2J05A 3OS1A 3NGPA 2K5FA 2EJ9A 3M53A 5CIUA 3EG0A 1X27A 2E4HA 4PFPA 2CREA 3C95A 7AT1B 3HL8A 2ED0A 2OAUA 2PUOB 1V76A 1VA7A 1UUEA 3JCMd 4AG1C 2DL5A 3OS5A 1M3AA 3PNWC 1YHQA 3PE0A 1AWXA 1YN8A 4BD3A 2V8IA 3M56A 1UTIA 1WI7A 2CP5A 3N5BB 4DEXA 4PJOF 3PIPA 8AT1B 1FWZA 1SG5A 2P4RA 4GLKA 3RR6A 3WVDB 2LCSA 2AHJB 4EIKA 4OGEA 2XICA 2X9HA 4J7FA 3MP8A 1VQPT 2DAQA 2MOXA 2WACA 3C0CA 4M77C 1H8KA 5I22A 4AMCA 1YJ9T 2JOYA 2QEXT 2JZ2A 1JJ2S 3EG9A 2VGNA 3R6NA 4LUEA 4C92D 2BKDN 4WCIA 2E64A 5LJ5g 4GBQA 2PVDB 2RMOA 1WZOA 3JB9F 4FW1A 4LDYA 4XU0A 4CI0C 3G6EA 3UF4A 2V8JA 5FRMA 3CD6Q 5FROA 1YITT 3QSUA 1AHJB 1ZQ1A 1IZ6A 2OTJT 1JJ2A 3OW2A 2KVQG 3OYDA 4RTZA 1M5Q1 5IT9E 3LH0A 4F16A 1WLPB 5FU6C 2OX7A 4PJOE 1JXOA 3CPWA 2ZPHB 3GPLA 4PFZA 1VQLT 4LXCA 5HCKA 1D09B 4AFQC 3A8OB 2HZYA 1UHFA 1Q86C 4M7AF 2ZPGB 1UGVA 5J3BA 4JZ4A 3KFVA 5GAOm 2EJGA 1ZX6A 2RQWA 2Z0WA 2AZSA 2DL7A 1VQ6A 2M0YA 4PLIA 4LN2A 2ROLA 3LX7A 3OYMA 3EG9B 1O75A 4BI4A 4Z89A 2CDTA 2OTLA 2LDMA 2F2WA 1I4K1 3ZEHA 4BY6C 4FCYA 2K6DA 1YJWA 2R57A 2E6NA 4L5GA 2X4XA 2CZ6B 2Y4XA 1ZHIA 1VQ7A 4PJOC 1I81A 2L3QA 2DVEA 3CEYA 5IXBA 1YCYA 1Q81R 1GCQC 4AFZC 1Q81C 2RN8A 5LJ3j 4FIBA 2QA4A 4PFOA 2D1XA 2JS0A 3G1JA 3I9QA 3S3NA 4II1A 5CKEA 5DM7R 3CCST 3CMEQ 2KEAA 1OPLA 3I56T 2DF6A 4M7DA 3ULRB 2XD0A 3E9FA 3G71A 1IO6A 4OP0A 2YXYA 1K8AU 2O31A 4IIOA 1R77A 3CCJA 1Q82U 3AHUA 1MNDA 2BUDA 4DBFA 2JM9A 4OMNA 2W10A 1EIFA 1TH7A 1XQHA 1OQKA 4AG2C 2E70A 1G3YA 3OYYA 2E5KA 3JCMX 2KSSA 1QCFA 2A7YA 1VYUA 2KRSA 3I55A 1Q7YR 5GAN4 4RKUE 1W6XA 1CSKA 1Q7YC 4M7AC 3I5RA 3MHXA 2XU8A 3A1PA 2JTFA 3ME9A 1K9MU 4IUTA 2DYBA 4O6JA 1KQ1A 4L6V5 2QQ9A 1M2OA 3OYNA 2DILA 2EGAA 2G3RA 1AVZC 4X1VA 2DIGA 2VUBA 1QWEA 4HVVA 2RO0A 1D0ZA 1FX7A 2LJ3A 3BW1A 3NTHA 3VS4A 4F7UG 3JCMP 4M78A 4M7DB 4PKCC 1KQSA 2HD0A 5KYXA 1BI1A 1WJRA 4MMKA 3TQ7P 2HQHA 4QVCA 3OYIA 1Q95G 2GCXA 1IRXA 1NYGA 3DKMA 5GANg 3QZ5B 1NJIR 1UG1A 4M75G 1NJIC 2HKQB 1WHGA 1N27A 1VQPQ 2EQMA 3EFRA 3M54A 1W2BP 2LQKA 5LJ5h 4FYYB 3CQTA 1YJ9Q 1GBRA 2GF7A 4E7LA 3X24B 4F04B 4JLIA 1WYXA 3OYLA 3LW5E 1NPRA 4J6YA 1TG0A 2DNUA 4C5IA 1U8RA 2R5AA 4M7DD 2AIRB 1VQ5Q 2KXDA 1NM7A 1D0YA 1LOJA 2E6ZA 3OSSC 4M78B 1MUZA 3D7SB 1WIEA 1X43A 1X6GA 1YITQ 4C0DC 3HRSA 2OTJQ 2A36A 3MPUB 2VXFA 1VIEA 5GMKj 3OBWA 1QCOA 3F70A 5GANe 1VQLQ 2JTMA 1PHTA 1RLPC 2MWPA 2NYSA 3DLLA 1PG5B 1VQ8T 1M3CA 4C8QF 1RABB 1N6AA 1KJWA 5KE2A 3ER0A 4N4GA 1UECA 3PMTA 3L2WA 2WSFE 2E1HA 1TSFA 2E10A 1BIBA 2F5KA 2F1LA 5HKCA 2NUTA 1GBQA 1JJ2P 1Y71A 2E3HA 2YRCA 1KC8C 4XTVA 2DFUA 2DBKA 2KYBA 2V26A 5GAOn 4E7HA 3M57A 3NTIA 4E7KA 1YI2T 1OYXA 4FT4A 4ATOA 5FU7B 2M9UA 4JPBW 1PNJA 1VQ4A 2HNIA 3HHTB 1IXDA 3QYGB 5GAN7 1LCKA 2DEUA 3BDUA 1V29B 4DA4A 4C8QE 5CK9A 3I56Q 1TS9A 3FDRA 1VQ9T 2O2OA 1HJDA 1B07A 3ASKA 3KUFA 1WHLA 3BFMA 1T3LA 4XTXA 4JJBA 2A0FB 2EGCA 3TEEA 2DETA 1W70A 3LWIA 5LJ3d 2HSPA 1UJYA 1U1SA 2MWOA 3CCLA 4E6RA 2KE9A 2QAZA 2A28A 2EJFA 2NUTB 1TU0B 3VKIA 4JDSA 4RCCA 4DOVA 1Y0MA 3FB9A 1M90R 2DL4A 3CD6T 1VUBA 2VC8A 1AWWA 8ATCB 2F2VA 5I11A 1QKXA 3OB9A 4C92E 4JRKA 3SHWA 2FG0A 4KH0B 2IIMA 1IGUA 2EIFA 5GMKl 4KGXB 2LC4A 1WDXA 5DLQE 4C8QC 3JV3A 5FRNA 4JS5A 4CC3A 3PMIA 2WSEE 2PVGB 4ORZA 1WHMA 1K0XA 4PJNA 3TSZA 4M77G 4E7ZA 2DEQA 3H8ZA 1YWPA 5GANh 1SSFA 2DD4A 1T3SA 3M5AA 1MNEA 3MP1A 3A8MB 3E2UA 3P8HA 2EYWA 1E6GA 4C5HA 5D6YA 1BI2A 3O8VA 4A4KA 2SRCA 4IURA 2EYZA 4Y28E 2LJ1A 2YUPA 2K2VA 5I21A 3M4YA 3EHRA 2M51A 2D0QB 2VXEA 4WF2A 1VQMT 1YJ9A 2QEXA 4B9WA 1NG2A 3BY7A 3H6ZA 1NEGA 5LJ3g 1M9SA 2MCNA 1OULA 3L2VA 2FZKB 4OGCA 4X9DA 2C0TA 2FO0A 3CMET 2RA2A 2BZXA 2HL5C 1X69A 4C92A 3LGLA 5GAN5 2DYIA 3QIIA 1YITA 3CPFA 2M16A 1H3HA 2O01E 2QGFB 3QJYA 2CS7A 1RAFB 2K79A 4P5NA 1BIAA 1BB9A 2CKKA 4KGVB 3PVQA 1K0SA 1ABQA 3S6WA 2EKHA 3OS0A 2FRWA 2DX1A 2ZAEA 2YUNA 1GCPA 5GAMg 3CC7T 1K8AR 5IHIA 2HL3A 2B86A 2RI5A 3SWNA 4DOWA 2JTEA 4HXJA 4E47A 1K8AC 2KT8A 2Y4YA 1KHIA 3RKWA 2JJ9A 1Q82R 2JM8A 2HMAA 1JXMA 1Q82C 2R5MA 3THKA 1W2BA 2EQIA 4MZPA 2BE7D 1I5LA 2COZA 3V7CA 3OYHA 1RACB 5FLXE 4JJNK 2AT1B 3GOXA 3M0TA 2LX7A 4C92B 2YDLA 4KRTA 2E65A 3G4ST 4A54A 2KAFA 2ZPFB 4M75D 3E19A 3CC2T 1OEBA 1K9MC 4RTVA 3JB9J 2LNHB 4D8DA 1YI2Q 4PJJA 1NYFA 1VOMA 1AEYA 4BE0A 3A98A 3CCSA 4PK4A 2G6FX 5KYWA 5GAMe 4XAXB 3CCMT 5DY9A 4KUIA 3HTRA 3REAB 3WXMB 1BI0A 1QVGS 1N5ZA 3SWNB 3U23A 1VQ9Q 1RL2A 4M7AG 4PL6A 1B7TA 5J39A 1M1GA 1FXXA 3EGUA 3M0RA 2DRKA 3TREA 1KSWA 3GNGA 1VQ5T 4NS5A 3NPFA 2QDLA 4D8KA 2EQKA 4BE2A 1YJNQ 4HT9A 1T0JA 1TUCA 3RUXA 2K3XA 2J6FA 4CRIA 4B6MA 3MEWA 2CP7A 1UFFA 2CGHA 4KGZB 1PRLC 4MZTA 2BZYA 3HP9A 2CT3A 4Z8AA 1NBEB 1VQKT 4M7DE 4J5YA 4M78F 1Q86R 4J6XA 2DXBA 5KYWB 2RJDA 1UHCA 3M59A 2NWMA 2JMAA 4Y91A 1EX4A 1QP3A 2QTVA 3M55A 1FMVA 2DLPA 1LPLA 1WPYA 3JCMg 5CVIA 3L2RA 1WHHA 4QVZA 3VS1A 2CYZB 3QBYA 1G2BA 2COYA 2QG9B 2CZ0B 1PCXA 4OB0B 5GMKi 1M2VA 2PTKA 1UGQB 3OY9A 3LYIA 4LDWA 1KHCA 3ZFJA 5LJ5e 4OMPA 5C0MA 1SEMA 2ZZDA 4C0FA 1AWJA 5LJ3h 3EH1A 3RESA 4ZN3A 3S3OA 4XU1A 4E7IA 2ZPEB 2B8AA 2GFAA 5GAN6 1VQMQ 4M78E 2FEIA 3C4SA 1RLQC 5GANf 3TU4K 2ZCFB 3EG2A 1C0MA 3RMQA 4FSXA 4R56A 3VJPA 5GAOr 2X51A 4XQ3A 4C0GA 1ZUYA 5FW9A 1QP2A 1G3WA 2K3YA 4OB1B 2QQBA 4OF1A 1YWOA 1IHVA 2VB6A 3KXTA 3JCMW 5LL6S 2RQVA 3QWYA 4J9FA 5AT1B 3JCMe 2V1RA 2L3RA 5GAOp 1MMNA 5KYNA 2DTIA 2AKLA 4QQDA 2KNBB 4XU2A 5GAMh 2PZ1A 2YRVA 2NUPA 3V7RA 1M2VB 3CMAQ 2K57A 3I5SA 2IVWA 4QKUA 1K76A 2QDYB 2ROTA 3MP6A 4OMLA 4M78C 1VQ8A 5GAOq 1YFNA 3X28B 3CC7Q 3CCET 4ESRA 3VRZA 2RF0A 4ELZC 4EMHA 1BYMA 4JJCA 4WTOB 4RG8A 5IHKA 4M77D 4HVWA 1S72T 3G6ET 2CP6A 2KI7A 3QUIA 1ZSGA 2X3XD 5KH6A 5GJVB 1MMDA 3FJPA 1TWBA 2VWFA 1AWOA 2KQWA 3G4SQ 2EPDA 5I2SA 2VASA 5L8RE 3EFOA 4XTZA 1G3SA 3A5ZB 2L0AA 4OB2B 1D3BA 5KYUA 3CC2Q 1SHFA 1YI2A 2DJQA 2DJZA 2O9VA 3OA6A 1KIKA 2NUPB 2GFUA 2C0OA 2GTJA 1OPKA 1SSHA 1G8XA 4FM4B 2GGRA 5A2QE 2L3SA 4RTXA 2DTOA 2V1QA 4J6WA 2BE9B 1KG1A 4FU6A 1WXTA 2GQIA 3CCUT 1D1CA 2CUBA 3OS2A 3CCMQ 4IUVA 3RIRA 2M0OA 2ZPBB 3PIOA 4RTUA 2LP5A 4RTWA 3JCMb 1FMWA 1TUDA 1N8RR 1N8RC 2DBMA 2LX9A 2QK0A 3BDLA 4RG2A 3REBB 3FLGA 3M58A 2O88A 5FU7C 4PJMA 4C8QG 2YUOA 4XTUA 3QXEB 3OYKA 2EYQA 2C06A 1UB4A 1OX9A 1SF9A 2CUDA 3OYFA 3VRYA 3CD6A 5GMKh 2HAXA 2PUKB 5FWBA 2A08A 1GRIA 2H3JA 2EW3A 2QXFA 3EFOB 1WQWA 5KYXB 3SDZA 1KK7A 1D3BB 2CSIA 3CCQT 2QA4T 5KYUB 3GBQA 1VQKQ 3UPUA 4BACA 4PJOD 3JCMh 3UATA 3M4GA 2FPFA 4Z02A 1SPKA 4QW2A 3RKYA 2MF2A 3A8LB 4C5GA 1ACMB 2DK3A 1WJQA 1M8MA 3L42A 4R0KA 3CCJT 2D8JA 4UC4A 3JCMJ 4XU3A 4J9EA 2BTTA 2HQXA 3JB9I 2E5QA 2O4XA 3HRTA 2ATCB 1MGQA 1RI0A 1QVGP 1ZUUA 2X4YA 1OU8A 4J9IA 1XJWB 1H3ZA 1NZ9A 4IKFA 1WA7A 3JB9D 2ESWA 4J83A 3I55T 5D6WA 1NLOC 1KC8R 1R0CB 2D6FA 1UGPB 4N4HA 4F7UE 1ZSZA 1VQMA 2JW4A 1ZA1B 2NLUA 2FB7A 1M1KU 5I2MA 2W0ZA 4C92F 3CCVQ 4GLMA 2FPDA 4AFUC 5ECAA 2DXCA 2YUQA 3CMEA 1U5SA 4M7AD 4ZGJB 2L89A 3OQ5A 1M30A 1PC0A 2LVMA 3GF5A 4ZN1A 3QWXX 2VV5A 4FYWB 3HPWA 2WSCE 1NPPA 2MI6A 4OB3B 3HSBA 1WJSA 1G5VA 4E7JA 2JVVA 3VS6A 1RAIB 3V8KA 2P0PA 1UGSB 2HDAA 2JS2A 2O4XB 5CKBA 2COWA 5KE3A 4A4EA 2CZ1B 1YJNT 2KBTA 3H0FA 1B34A 3CCRT 1ARKA 2EYYA 1WXBA 3J7AF 2DIQA 1D1BA 1JQQA 4RMOA 3A8HB 1Y57A 1ZSZB 4HCKA 1PKSA 3QG1A 3LGFA 3CCEQ 3FRNA 2LCCA 4JLGA 1X01A 1UE9A 2K5LA 5AYFA 3J80E 3RBBB 1R8OB 3JRZA 4KBMB 4HA8A 2F2XA 2KMTA 1XNIA 3H0HA 2KR3A 5GAMf 2YSQA 4F7UA 4J9GA 1S72Q 4K11A 3G6EQ 3QKJA 4HCBA 1YCSB 3QZ9B 1KD1U 2JN0A 3RDVA 5CQYA 3CC2A 2EWNA 3JB9H 4EMKA 3LWHA 2L5QA 1TXQA 2HCKA 4F17A 4M75A 4LDXA 2EFIA 2M02A
chains in the Genus database with same CATH topology
4IIOA 3VS0A 3REAB 1N5ZA 2CT4A 2JXBA 2D8HA 1CKBA 3U23A 2J6OA 2JM9A 4OMNA 2W10A 4LNPA 2H8HA 3H0IA 4AG2C 3EGUA 3M0RA 2DRKA 2E5KA 1KSWA 2BZ8A 1QCFA 3NPFA 2QDLA 4D8KA 1VYUA 2KRSA 1K4US 1EFNA 1T0JA 1TUCA 2XMFA 3PVLA 1W6XA 2J6FA 1CSKA 2CH4A 2LQNA 4OMOA 5IHNA 2O9SA 3I5RA 4J9HA 1GFCA 1UFFA 1PRLC 2BZYA 2CSQA 2DYBA 2AKKA 2CT3A 4J9BA 4Z8AA 1PRMC 2KXCA 3H41A 2DILA 1NLPC 2EGAA 4X1VA 1AVZC 1U3OA 4OMQA 1QKWA 1QWEA 2AZVA 4HVVA 2LJ3A 3VS4A 2DMOA 1K9AA 3VS7A 1UJ0A 1UHCA 2NWMA 2JMAA 2DM1A 1FYNA 1PKTA 4J9DA 2DLPA 4ZNXA 2ED1A 2K7AA 3EG3A 3VS1A 4F14A 1NYGA 2NUZA 1G2BA 2LMJA 1WX6A 1UG1A 1PWTA 2PTKA 4AFSC 4RTTA 1ZUKA 5IH2A 2RNAA 1AOJA 2AK5A 4OMPA 3ZL7C 1SEMA 2LQWA 2GTOA 1S1NA 1FMKA 1AWJA 3CQTA 1GBRA 1AD5A 3VS5A 1WYXA 2MIOA 2HEQA 2EGEA 1VYVA 2LZ6B 1X2KA 2PNIA 1TG0A 2DNUA 2FEIA 3LH5A 1RLQC 3EG2A 2KXDA 2J7IA 2RQRA 3RNJA 1NM7A 5FWCA 2I0NA 2KT1A 1MV3A 1MUZA 1ZUYA 5FW9A 2ABLA 2DL3A 1WIEA 1X43A 1X6GA 1YWOA 1MV0B 2A36A 2RQVA 2ECZA 3QWYA 4J9FA 2V1RA 2JT4A 2AKLA 1CKAA 2OJ2A 2KNBB 2FRYA 1ABOA 2PZ1A 1PHTA 1J3TA 2K2MA 2K9GA 1RLPC 1QLYA 4CC2A 3EG1A 3I5SA 1OV3A 3M0SA 1K76A 4Z88A 1ZBJA 1M3CA 2ROTA 4OMLA 3VS3A 1JEGA 1ZLMA 1KJWA 1I0CA 3VS2A 1JU5C 1UECA 2SEMA 4ESRA 3VRZA 1H92A 2D0NA 2KROA 2EYXA 2RF0A 1RUWA 2DL8A 3UA7A 4JJCA 5IHKA 1GBQA 4HVWA 1BK2A 1AZGB 3M0PA 4DEYA 1WXUA 2VKNA 1G83A 2DA9A 5EC7A 1ZSGA 2DBKA 2X3XD 2KYBA 5GJVB 4OMMA 3I35A 2VWFA 1T0HA 4QT7A 1AWOA 2EPDA 1AZEA 2L3PA 1BU1A 2L0AA 2KYMA 4JPBW 1PNJA 1SHFA 2DJQA 2O9VA 1KIKA 4JZ3A 2DVJA 2GNCA 3FJ5A 2C0OA 1LCKA 1JO8A 2GTJA 4LUDA 1OPKA 1SSHA 2EBPA 2HBWA 2GGRA 2O2OA 1Z9QA 1HJDA 2L3SA 1NEBA 1B07A 4RTXA 4LE9A 2V1QA 2J6KA 1WXTA 2GQIA 3TVTA 1T3LA 2CUBA 2J06A 3EHQA 1RI9A 4JJBA 4RTUA 2EGCA 2LP5A 4RTWA 1W70A 2HSPA 4CC4B 1TUDA 2C0IA 1UJYA 4A63B 2DBMA 4E6RA 2RQTA 2KE9A 2JMCA 3REBB 2A28A 2O88A 5GJWB 1E7OA 2YUOA 1I1JA 1Y0MA 1HD3A 2CH4W 2DL4A 4HVUA 2RPNA 1XOVA 1AWWA 2DE0X 2F2VA 1QWFA 5I11A 2CUDA 2J05A 1QKXA 3NGPA 3VRYA 1W1FA 1K1ZA 3EG0A 3SHWA 2FG0A 1X27A 2CREA 1B3QA 2IIMA 5FWBA 2A08A 1SRMA 1GRIA 1WDXA 3O5ZA 2EW3A 1E6HA 3NHNA 2ED0A 3JV3A 1GFDA 1BBZA 4CC3A 2CSIA 3SEMA 3GBQA 2K3BA 1VA7A 4ORZA 1UUEA 1K0XA 4AG1C 1A0NB 3UATA 2DL5A 1M3BA 3TSZA 3M0QA 1M3AA 1YWPA 3PE0A 2FPFA 1AWXA 1VYTA 1YN8A 1SPKA 1UTIA 1T3SA 1WI7A 1M27C 4DEXA 3UA6A 2P4RA 2LCSA 1I07A 4EIKA 2LJ0A 1M8MA 4R0KA 2D8JA 2EYWA 1E6GA 2MOXA 1YP5A 3C0CA 1H8KA 4J9EA 4M4ZA 5I22A 1GCQA 2BTTA 2SRCA 1SHGA 2EYZA 2KRMA 2KRNA 1ZUUA 2LJ1A 2KGTA 2YUPA 4J9IA 1WA7A 2M51A 3EHRA 2ESWA 3R6NA 4IIMA 2VVKA 4LUEA 1NG2A 1NLOC 4WCIA 1GL5A 4FSSA 1NEGA 4GBQA 1X2QA 2RMOA 2JW4A 2MCNA 2ENMA 2W0ZA 3UF4A 2C0TA 4GLMA 2FPDA 2FO0A 4AFUC 2BZXA 1X69A 5ECAA 2RQUA 2YUQA 2L2PA 4RTYA 1U5SA 4RTZA 2EVRA 3TSWA 4F16A 2GBQA 1WLPB 1H3HA 1M30A 1JXOA 2YT6A 3QWXX 1X6BA 2K79A 5HCKA 1YNZA 2OI3A 1UDLA 4AFQC 1BB9A 3M0UA 1UHFA 3PVQA 1K0SA 1ABQA 3VS6A 1UGVA 4JZ4A 2EKHA 3KFVA 2FRWA 1ZX6A 2RQWA 2X3WD 2FPEA 2DX1A 1SRLA 2OAWA 4RUGA 2HDAA 2JS2A 2YUNA 2AZSA 1GCPA 2DL7A 2DRMA 1KFZA 2M0YA 4LN2A 1HSQA 2ROLA 5IHIA 2B86A 2KBTA 3H0FA 1ARKA 2JTEA 4HXJA 2KT8A 2EYYA 4Z89A 2CDTA 1WXBA 2JM8A 1JQQA 1JXMA 2F2WA 4CC7A 3THKA 1Y57A 4HCKA 2EQIA 1PKSA 2K6DA 2A37A 1UE9A 5IXFA 3RBBB 2F2XA 1U06A 3M0TA 2LX7A 3H0HA 1V1CA 2L3QA 2KR3A 5IXBA 2YDLA 4KRTA 2YSQA 4J9GA 1OOTA 1GCQC 4AFZC 4J9CA 2RN8A 4K11A 1YCSB 5L23A 2D1XA 1OEBA 3IQLA 2JS0A 4RTVA 4Y92A 3I9QA 2LNHB 4D8DA 2KEAA 1OPLA 1NYFA 1Z9ZA 2DF6A 3ULRB 1AEYA 2HCKA 3A98A 1IO6A 4F17A 3NMZC 2G6FX 1WFWA 4JJDA 2O31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IIO A;  3VS0 A;  3REA B;  1N5Z A;  2CT4 A;  2JXB A;  2D8H A;  1CKB A;  3U23 A;  2J6O A;  2JM9 A;  4OMN A;  2W10 A;  4LNP A;  2H8H A;  3H0I A;  4AG2 C;  3EGU A;  3M0R A;  2DRK A;  2E5K A;  1KSW A;  2BZ8 A;  1QCF A;  3NPF A;  2QDL A;  4D8K A;  1VYU A;  2KRS A;  1K4U S;  1EFN A;  1T0J A;  1TUC A;  2XMF A;  3PVL A;  1W6X A;  2J6F A;  1CSK A;  2CH4 A;  2LQN A;  4OMO A;  5IHN A;  2O9S A;  3I5R A;  4J9H A;  1GFC A;  1UFF A;  1PRL C;  2BZY A;  2CSQ A;  2DYB A;  2AKK A;  2CT3 A;  4J9B A;  4Z8A A;  1PRM C;  2KXC A;  3H41 A;  2DIL A;  1NLP C;  2EGA A;  4X1V A;  1AVZ C;  1U3O A;  4OMQ A;  1QKW A;  1QWE A;  2AZV A;  4HVV A;  2LJ3 A;  3VS4 A;  2DMO A;  1K9A A;  3VS7 A;  1UJ0 A;  1UHC A;  2NWM A;  2JMA A;  2DM1 A;  1FYN A;  1PKT A;  4J9D A;  2DLP A;  4ZNX A;  2ED1 A;  2K7A A;  3EG3 A;  3VS1 A;  4F14 A;  1NYG A;  2NUZ A;  1G2B A;  2LMJ A;  1WX6 A;  1UG1 A;  1PWT A;  2PTK A;  4AFS C;  4RTT A;  1ZUK A;  5IH2 A;  2RNA A;  1AOJ A;  2AK5 A;  4OMP A;  3ZL7 C;  1SEM A;  2LQW A;  2GTO A;  1S1N A;  1FMK A;  1AWJ A;  3CQT A;  1GBR A;  1AD5 A;  3VS5 A;  1WYX A;  2MIO A;  2HEQ A;  2EGE A;  1VYV A;  2LZ6 B;  1X2K A;  2PNI A;  1TG0 A;  2DNU A;  2FEI A;  3LH5 A;  1RLQ C;  3EG2 A;  2KXD A;  2J7I A;  2RQR A;  3RNJ A;  1NM7 A;  5FWC A;  2I0N A;  2KT1 A;  1MV3 A;  1MUZ A;  1ZUY A;  5FW9 A;  2ABL A;  2DL3 A;  1WIE A;  1X43 A;  1X6G A;  1YWO A;  1MV0 B;  2A36 A;  2RQV A;  2ECZ A;  3QWY A;  4J9F A;  2V1R A;  2JT4 A;  2AKL A;  1CKA A;  2OJ2 A;  2KNB B;  2FRY A;  1ABO A;  2PZ1 A;  1PHT A;  1J3T A;  2K2M A;  2K9G A;  1RLP C;  1QLY A;  4CC2 A;  3EG1 A;  3I5S A;  1OV3 A;  3M0S A;  1K76 A;  4Z88 A;  1ZBJ A;  1M3C A;  2ROT A;  4OML A;  3VS3 A;  1JEG A;  1ZLM A;  1KJW A;  1I0C A;  3VS2 A;  1JU5 C;  1UEC A;  2SEM A;  4ESR A;  3VRZ A;  1H92 A;  2D0N A;  2KRO A;  2EYX A;  2RF0 A;  1RUW A;  2DL8 A;  3UA7 A;  4JJC A;  5IHK A;  1GBQ A;  4HVW A;  1BK2 A;  1AZG B;  3M0P A;  4DEY A;  1WXU A;  2VKN A;  1G83 A;  2DA9 A;  5EC7 A;  1ZSG A;  2DBK A;  2X3X D;  2KYB A;  5GJV B;  4OMM A;  3I35 A;  2VWF A;  1T0H A;  4QT7 A;  1AWO A;  2EPD A;  1AZE A;  2L3P A;  1BU1 A;  2L0A A;  2KYM A;  4JPB W;  1PNJ A;  1SHF A;  2DJQ A;  2O9V A;  1KIK A;  4JZ3 A;  2DVJ A;  2GNC A;  3FJ5 A;  2C0O A;  1LCK A;  1JO8 A;  2GTJ A;  4LUD A;  1OPK A;  1SSH A;  2EBP A;  2HBW A;  2GGR A;  2O2O A;  1Z9Q A;  1HJD A;  2L3S A;  1NEB A;  1B07 A;  4RTX A;  4LE9 A;  2V1Q A;  2J6K A;  1WXT A;  2GQI A;  3TVT A;  1T3L A;  2CUB A;  2J06 A;  3EHQ A;  1RI9 A;  4JJB A;  4RTU A;  2EGC A;  2LP5 A;  4RTW A;  1W70 A;  2HSP A;  4CC4 B;  1TUD A;  2C0I A;  1UJY A;  4A63 B;  2DBM A;  4E6R A;  2RQT A;  2KE9 A;  2JMC A;  3REB B;  2A28 A;  2O88 A;  5GJW B;  1E7O A;  2YUO A;  1I1J A;  1Y0M A;  1HD3 A;  2CH4 W;  2DL4 A;  4HVU A;  2RPN A;  1XOV A;  1AWW A;  2DE0 X;  2F2V A;  1QWF A;  5I11 A;  2CUD A;  2J05 A;  1QKX A;  3NGP A;  3VRY A;  1W1F A;  1K1Z A;  3EG0 A;  3SHW A;  2FG0 A;  1X27 A;  2CRE A;  1B3Q A;  2IIM A;  5FWB A;  2A08 A;  1SRM A;  1GRI A;  1WDX A;  3O5Z A;  2EW3 A;  1E6H A;  3NHN A;  2ED0 A;  3JV3 A;  1GFD A;  1BBZ A;  4CC3 A;  2CSI A;  3SEM A;  3GBQ A;  2K3B A;  1VA7 A;  4ORZ A;  1UUE A;  1K0X A;  4AG1 C;  1A0N B;  3UAT A;  2DL5 A;  1M3B A;  3TSZ A;  3M0Q A;  1M3A A;  1YWP A;  3PE0 A;  2FPF A;  1AWX A;  1VYT A;  1YN8 A;  1SPK A;  1UTI A;  1T3S A;  1WI7 A;  1M27 C;  4DEX A;  3UA6 A;  2P4R A;  2LCS A;  1I07 A;  4EIK A;  2LJ0 A;  1M8M A;  4R0K A;  2D8J A;  2EYW A;  1E6G A;  2MOX A;  1YP5 A;  3C0C A;  1H8K A;  4J9E A;  4M4Z A;  5I22 A;  1GCQ A;  2BTT A;  2SRC A;  1SHG A;  2EYZ A;  2KRM A;  2KRN A;  1ZUU A;  2LJ1 A;  2KGT A;  2YUP A;  4J9I A;  1WA7 A;  2M51 A;  3EHR A;  2ESW A;  3R6N A;  4IIM A;  2VVK A;  4LUE A;  1NG2 A;  1NLO C;  4WCI A;  1GL5 A;  4FSS A;  1NEG A;  4GBQ A;  1X2Q A;  2RMO A;  2JW4 A;  2MCN A;  2ENM A;  2W0Z A;  3UF4 A;  2C0T A;  4GLM A;  2FPD A;  2FO0 A;  4AFU C;  2BZX A;  1X69 A;  5ECA A;  2RQU A;  2YUQ A;  2L2P A;  4RTY A;  1U5S A;  4RTZ A;  2EVR A;  3TSW A;  4F16 A;  2GBQ A;  1WLP B;  1H3H A;  1M30 A;  1JXO A;  2YT6 A;  3QWX X;  1X6B A;  2K79 A;  5HCK A;  1YNZ A;  2OI3 A;  1UDL A;  4AFQ C;  1BB9 A;  3M0U A;  1UHF A;  3PVQ A;  1K0S A;  1ABQ A;  3VS6 A;  1UGV A;  4JZ4 A;  2EKH A;  3KFV A;  2FRW A;  1ZX6 A;  2RQW A;  2X3W D;  2FPE A;  2DX1 A;  1SRL A;  2OAW A;  4RUG A;  2HDA A;  2JS2 A;  2YUN A;  2AZS A;  1GCP A;  2DL7 A;  2DRM A;  1KFZ A;  2M0Y A;  4LN2 A;  1HSQ A;  2ROL A;  5IHI A;  2B86 A;  2KBT A;  3H0F A;  1ARK A;  2JTE A;  4HXJ A;  2KT8 A;  2EYY A;  4Z89 A;  2CDT A;  1WXB A;  2JM8 A;  1JQQ A;  1JXM A;  2F2W A;  4CC7 A;  3THK A;  1Y57 A;  4HCK A;  2EQI A;  1PKS A;  2K6D A;  2A37 A;  1UE9 A;  5IXF A;  3RBB B;  2F2X A;  1U06 A;  3M0T A;  2LX7 A;  3H0H A;  1V1C A;  2L3Q A;  2KR3 A;  5IXB A;  2YDL A;  4KRT A;  2YSQ A;  4J9G A;  1OOT A;  1GCQ C;  4AFZ C;  4J9C A;  2RN8 A;  4K11 A;  1YCS B;  5L23 A;  2D1X A;  1OEB A;  3IQL A;  2JS0 A;  4RTV A;  4Y92 A;  3I9Q A;  2LNH B;  4D8D A;  2KEA A;  1OPL A;  1NYF A;  1Z9Z A;  2DF6 A;  3ULR B;  1AEY A;  2HCK A;  3A98 A;  1IO6 A;  4F17 A;  3NMZ C;  2G6F X;  1WFW A;  4JJD A;  2O31 A; 
#chains in the Genus database with same CATH topology
 4BDZ A;  3VS0 A;  2CP0 A;  2CT4 A;  1WQ7 A;  2D8H A;  1CKB A;  4C92 C;  2MMP A;  1VQP A;  4NOY A;  1UEB A;  3MO8 A;  2H8H A;  1I8F A;  2FHD A;  3CCU Q;  4DQ2 A;  3OYB A;  1PD0 A;  1X6O A;  3RKX A;  3CXC S;  5CQX A;  2OTL Q;  5GAN j;  3DB3 A;  2JNG A;  2XMF A;  1F1B B;  1VQ5 A;  2FZG B;  1GFC A;  4F7U B;  1OI1 A;  5KYY A;  4J9B A;  2KXC A;  3H41 A;  3SWN C;  4OMQ A;  1QKW A;  5KCO A;  2OTJ A;  4HT8 A;  3MEU A;  4X34 A;  2LNV A;  2GQV A;  2QQS A;  4EMK B;  1K9A A;  5GAO l;  3FC3 A;  2XDP A;  3CCQ Q;  2QA4 Q;  5HK0 A;  4M75 B;  5LJ5 f;  3CMA T;  4BI3 A;  2BIV A;  3S3M A;  1VQL A;  2RD1 A;  2DM1 A;  1U1T A;  3P8D A;  2PVO B;  4JRI A;  4J9D A;  4ZNX A;  4MZM A;  2ED1 A;  2K7A A;  4PJL A;  1M4Z A;  4F14 A;  2NUZ A;  1VQN T;  3GLX A;  1RAH B;  2LMJ A;  3FIF A;  5CKF A;  4PJO G;  1PWT A;  4AFS C;  1VQO T;  1M8V A;  4RTT A;  1ZUK A;  4XK8 E;  3CCJ Q;  2LRQ A;  1AOJ A;  2AK5 A;  2EQJ A;  5LJ3 e;  6AT1 B;  2LQW A;  2GTO A;  1S1N A;  5GAN 2;  3LLR A;  4KUL A;  1AD5 A;  3VS5 A;  2MK5 A;  2VYT A;  1IRE B;  1YIJ T;  3JCM f;  2HEQ A;  1VYV A;  5KYY B;  3I55 Q;  5GAN 8;  2EKO A;  2PNI A;  4YTL A;  3X25 B;  3JSC A;  4EPC A;  3FEO A;  3C94 A;  1Y96 A;  2FL7 A;  1K9M R;  2KT1 A;  3JB9 G;  1MV3 A;  3M9Q A;  2PQW A;  4MDW A;  2ABL A;  1JBM A;  3CC4 T;  4M7D F;  4A4F A;  2CZ7 B;  2JT4 A;  3I56 A;  4N0A A;  3RMS A;  3EAE A;  3URG A;  5GMK m;  1CKA A;  4A53 A;  2FRY A;  4M78 G;  1QVF S;  2HBP A;  4C8Q D;  1D1A A;  1XTD A;  4GY5 A;  1OZ3 A;  2DTH A;  2E41 A;  5IN1 A;  1PSF A;  3GIB A;  2KDS A;  1OV3 A;  3M0S A;  4Z88 A;  4X9C A;  2F69 A;  1PD1 A;  2RK2 A;  3L2Z A;  3VS3 A;  2LT1 A;  3E9G A;  1ZLM A;  5HY6 A;  1I0C A;  3VS2 A;  4Q5W A;  1JU5 C;  2RHX A;  2SEM A;  1QVF A;  1WHJ A;  4BI8 B;  4J8O A;  3QDF A;  3CCR Q;  1QVG A;  1M90 U;  2YWW A;  3EH2 A;  5D6X A;  2EYX A;  3CCE A;  2DL8 A;  3UA7 A;  1P92 A;  2KY9 A;  5A0D A;  1D0X A;  1TUG B;  2MPX C;  3OW2 S;  4QQG A;  3R6O A;  1Y96 B;  3BE3 A;  1DJ7 B;  3QO3 A;  1ZBX A;  4OVA A;  4A4H A;  2DER A;  1YBY A;  4A4G A;  2VKN A;  1LVK A;  3CPW S;  1WHK A;  5A0L A;  2RJE A;  5EC7 A;  2QI2 A;  1S72 A;  3VYH B;  2XG8 D;  3UT1 A;  1T0H A;  4ELY C;  4IUQ A;  1OU9 A;  4M77 A;  3A8G B;  1AZE A;  2L3P A;  1BU1 A;  4JRP A;  3OBY A;  2DD5 A;  4JZ3 A;  4ME7 A;  2DVJ A;  3SB2 A;  1JO8 A;  4LUD A;  4DBQ A;  3EGD A;  1G3T A;  4XTW A;  2LTO A;  3G7Z A;  3JCM c;  4NL2 A;  4ANJ A;  3L2Q A;  3Q1J A;  3JCM V;  2J6K A;  4C0Z A;  1BI3 A;  2J06 A;  5EG2 A;  4LDV A;  3CCU A;  4CC4 B;  2C0I A;  4M7D C;  4PNO A;  2QQA A;  3HKS A;  2VGM A;  4A63 B;  4E7S A;  2RQT A;  5GJW B;  2DKG A;  1E7O A;  5D7U A;  3MCA B;  3CCV T;  1I1J A;  4HCZ A;  2XI9 A;  4TVR A;  1H64 1;  5GMK e;  2RPN A;  2DE0 X;  1IB8 A;  2Y90 A;  3KBG A;  4IUP A;  1W1F A;  1I5O B;  1K1Z A;  3X20 B;  1B3Q A;  1BCO A;  4M77 B;  3VUB A;  3QPH A;  1SRM A;  1Y7X A;  3O5Z A;  3NHN A;  1E6H A;  2RHU A;  4B9X A;  1IGQ A;  2IG0 A;  3HFO A;  3QYH B;  1GFD A;  1BBZ A;  2EQU A;  3SEM A;  3CBM A;  1M1K R;  1YHQ T;  2K3B A;  1M1K C;  4FL6 A;  3CCQ A;  4ZTJ A;  1A0N B;  3EGD B;  4M7A E;  1M3B A;  3M0Q A;  3J81 E;  1VYT A;  5GAN d;  2CP3 A;  1VQ4 Q;  3OYJ A;  1M27 C;  3DLM A;  4QQ6 A;  2RHZ A;  3UA6 A;  2MYS A;  1I07 A;  2LJ0 A;  2K5I A;  4PJO A;  3JAM E;  1NE8 A;  3V8J A;  2DO3 A;  1K73 U;  1HK9 A;  1YP5 A;  1VQN Q;  2M1H A;  4M4Z A;  1GCQ A;  3RER A;  5FU6 B;  1SHG A;  4L59 A;  2KRM A;  2KRN A;  1VQO Q;  2KGT A;  2PU9 B;  4JRQ A;  4IIM A;  2VVK A;  3GNF B;  3CCL Q;  4LD6 A;  1RAA B;  4IUU A;  5GAM j;  1GL5 A;  3OYE A;  4FSS A;  2FVU A;  2E12 A;  2R58 A;  2HSE B;  1X2Q A;  3CXC P;  2HKN A;  2ENM A;  1YIJ Q;  3QHS A;  1KQS S;  3OSV A;  1MMA A;  2DXU A;  2RQU A;  2L2P A;  4RTY A;  3VYG A;  2EVR A;  2K4Y A;  3TSW A;  1MMG A;  2GBQ A;  3E1S A;  4OMF B;  4BY6 B;  2L8D A;  2YT6 A;  3CC4 Q;  2RK1 A;  1X6B A;  1YNZ A;  2OI3 A;  1UDL A;  3L2U A;  3M0U A;  4JS4 A;  1KD1 R;  1W4S A;  4PJO B;  1KD1 C;  1PM3 A;  2QAS A;  1VQ9 A;  1VQ6 T;  4M7A A;  9ATC B;  2X3W D;  4DBH A;  3MJX A;  2FPE A;  1SRL A;  2OAW A;  4RUG A;  2QYZ A;  2DRM A;  1KFZ A;  2OTL T;  1HSQ A;  2EAY A;  4BDY A;  1YJN A;  4BUG A;  1YJW T;  3QJ6 A;  4CC7 A;  3CCR A;  1WNL A;  1SKU B;  4FYV B;  3EFS A;  2A37 A;  1VQ7 T;  2DZC A;  1HXD A;  1OX8 A;  4NL3 A;  3CBP A;  2YRD A;  2LT4 A;  2V8K A;  5IXF A;  3EGX A;  2XHC A;  2QEX Q;  4DBR A;  1U06 A;  5CCA A;  4O5V A;  1N9S A;  4C5E A;  4F7U F;  1V1C A;  2FYK A;  2HQE A;  3MET A;  3MKD A;  2H3E B;  2RM4 A;  1OOT A;  5A0G A;  3DB4 A;  4J9C A;  1EZZ B;  5LJ5 j;  5L23 A;  4BB7 A;  1Q86 U;  2RI3 A;  3IQL A;  4Y92 A;  3GP8 A;  3INZ A;  4C92 G;  3G71 T;  4HCC A;  1Z9Z A;  2E3I A;  4M75 F;  4M7A B;  1ZSZ C;  3JCM Q;  1M1F A;  4KH1 B;  4ZGE B;  3NMZ C;  5DLO A;  1WFW A;  4JJD A;  3T9N A;  1R0B G;  3V7S A;  2JXB A;  2QTX A;  2XKO C;  2J6O A;  1QVF P;  5IAY A;  4LNP A;  2XK0 A;  2D9T A;  2RHI A;  3H0I A;  2MAM A;  2YLB A;  3V8L A;  4RCB A;  2BZ8 A;  1K4U S;  3EGX B;  1EFN A;  1N9R A;  5CKD A;  1QMC A;  4HKE A;  3L1A A;  3PVL A;  1Q81 U;  2LQN A;  2CH4 A;  4FYX B;  4OMO A;  5IHN A;  4MDX A;  3UDC A;  2O9S A;  4J9H A;  1WGS A;  2QQR A;  4M78 D;  2CSQ A;  2AKK A;  2RJF A;  1C6V X;  1PRM C;  4VUB A;  3OW2 P;  1NLP C;  2IPO B;  2ZGW A;  5J26 A;  1RAE B;  1U3O A;  2DPP B;  2YHT A;  2ZPI B;  3NTK A;  1TOV A;  4M75 E;  2AZV A;  3C12 A;  3CPW P;  2DMO A;  1GXI E;  2P0K A;  3VS7 A;  5LJ3 f;  1UJ0 A;  1YHQ Q;  4JUV A;  1AT1 B;  2XDD A;  1TTH B;  1FYN A;  1PKT A;  3CMA A;  2P84 A;  1ZA2 B;  3HFN A;  5CO7 A;  5GAN 3;  2LQ8 A;  3EG3 A;  3CCS Q;  1UGR B;  4LDU A;  1WX6 A;  3CC7 A;  1VQN A;  1VIF A;  5IH2 A;  2RNA A;  4C0D B;  1Q7Y U;  1JRI A;  1RAD B;  3ZL7 C;  2RI2 A;  1VQO A;  4PLL A;  1FMK A;  1OZ2 A;  4V2S A;  2P0Q A;  1MHN A;  4EMK C;  1QVP A;  3OYC A;  4M75 C;  3TCJ A;  3CBO A;  2MIO A;  3PGG A;  1IHW A;  1Y07 A;  2EGE A;  2DXT A;  2LZ6 B;  1X2K A;  4MML A;  4LD9 K;  3LH5 A;  4EMG A;  3WVE B;  1M90 C;  1YIJ A;  2J7I A;  2RQR A;  3RNJ A;  5FWC A;  2I0N A;  3G4S A;  1QW1 A;  3NFC A;  4KT0 E;  2DL3 A;  3PTA A;  1O9S A;  2DZ9 A;  4EDU A;  1MV0 B;  3QDR B;  2I2L A;  2ECZ A;  3CC4 A;  1NJI U;  1LNX A;  2OJ2 A;  3PFS A;  1ABO A;  1X75 C;  5M9O A;  2F5T X;  5GAM d;  1B34 B;  3PT9 A;  1J3T A;  2K2M A;  2LCL A;  2X35 A;  3CCM A;  2K9G A;  2JUF A;  2X4W A;  1QLY A;  4CC2 A;  3EG1 A;  4R55 A;  1VQ6 Q;  3H9N A;  2FZC B;  2XDB A;  3HRU A;  1ZBJ A;  1N8R U;  5CAI A;  3P8B B;  1RAG B;  3OYG A;  2X4J A;  3X26 B;  1JEG A;  4C8Q A;  3SD4 A;  3ZBD A;  3SFM A;  3VU3 C;  3VV0 A;  1H92 A;  2D0N A;  2KRO A;  1RUW A;  1YJW Q;  2XID A;  1PSE A;  1KQ2 A;  5C6S A;  1BK2 A;  3AT1 B;  1AZG B;  1VQ7 Q;  5CR2 A;  4XTY A;  3M0P A;  4FW2 A;  4DEY A;  1WXU A;  3CXC A;  1G83 A;  2DA9 A;  2RJC A;  1VQK A;  4D6W A;  3MEA A;  3MEV A;  4M77 F;  1QCN A;  2QGG A;  4OMM A;  3I35 A;  4QT7 A;  3UWN A;  1VQ4 T;  2YLC A;  4ZTF A;  1KQS P;  2KYM A;  4AT1 B;  2P4T A;  2GNC A;  3FJ5 A;  2RB6 A;  3G71 Q;  4M7D G;  1HYO A;  5CKH A;  4FT2 A;  1C1A A;  2EBP A;  2HBW A;  4J7I A;  1Z9Q A;  1NEB A;  4E2F B;  4LE9 A;  1LJO A;  2CP2 A;  1W2B S;  2KK4 A;  3TVT A;  5KCH A;  4C8Q B;  3OMG A;  2A3L A;  2RH2 A;  2RHY A;  3EHQ A;  1RI9 A;  1QQJ A;  3OYA A;  3CCL T;  1BCM A;  5HK3 A;  3VUZ A;  5LJ5 d;  4QVD A;  4BE1 A;  1JB0 E;  4N0A C;  2JMC A;  4KUD K;  1BKB A;  1K73 R;  1KC8 U;  1VQ8 Q;  1K73 C;  4ZGD B;  4N4I A;  2CH4 W;  1HD3 A;  3OMC A;  4HVU A;  1XOV A;  4M77 E;  1QWF A;  3CCV A;  2J05 A;  3OS1 A;  3NGP A;  2K5F A;  2EJ9 A;  3M53 A;  5CIU A;  3EG0 A;  1X27 A;  2E4H A;  4PFP A;  2CRE A;  3C95 A;  7AT1 B;  3HL8 A;  2ED0 A;  2OAU A;  2PUO B;  1V76 A;  1VA7 A;  1UUE A;  3JCM d;  4AG1 C;  2DL5 A;  3OS5 A;  1M3A A;  3PNW C;  1YHQ A;  3PE0 A;  1AWX A;  1YN8 A;  4BD3 A;  2V8I A;  3M56 A;  1UTI A;  1WI7 A;  2CP5 A;  3N5B B;  4DEX A;  4PJO F;  3PIP A;  8AT1 B;  1FWZ A;  1SG5 A;  2P4R A;  4GLK A;  3RR6 A;  3WVD B;  2LCS A;  2AHJ B;  4EIK A;  4OGE A;  2XIC A;  2X9H A;  4J7F A;  3MP8 A;  1VQP T;  2DAQ A;  2MOX A;  2WAC A;  3C0C A;  4M77 C;  1H8K A;  5I22 A;  4AMC A;  1YJ9 T;  2JOY A;  2QEX T;  2JZ2 A;  1JJ2 S;  3EG9 A;  2VGN A;  3R6N A;  4LUE A;  4C92 D;  2BKD N;  4WCI A;  2E64 A;  5LJ5 g;  4GBQ A;  2PVD B;  2RMO A;  1WZO A;  3JB9 F;  4FW1 A;  4LDY A;  4XU0 A;  4CI0 C;  3G6E A;  3UF4 A;  2V8J A;  5FRM A;  3CD6 Q;  5FRO A;  1YIT T;  3QSU A;  1AHJ B;  1ZQ1 A;  1IZ6 A;  2OTJ T;  1JJ2 A;  3OW2 A;  2KVQ G;  3OYD A;  4RTZ A;  1M5Q 1;  5IT9 E;  3LH0 A;  4F16 A;  1WLP B;  5FU6 C;  2OX7 A;  4PJO E;  1JXO A;  3CPW A;  2ZPH B;  3GPL A;  4PFZ A;  1VQL T;  4LXC A;  5HCK A;  1D09 B;  4AFQ C;  3A8O B;  2HZY A;  1UHF A;  1Q86 C;  4M7A F;  2ZPG B;  1UGV A;  5J3B A;  4JZ4 A;  3KFV A;  5GAO m;  2EJG A;  1ZX6 A;  2RQW A;  2Z0W A;  2AZS A;  2DL7 A;  1VQ6 A;  2M0Y A;  4PLI A;  4LN2 A;  2ROL A;  3LX7 A;  3OYM A;  3EG9 B;  1O75 A;  4BI4 A;  4Z89 A;  2CDT A;  2OTL A;  2LDM A;  2F2W A;  1I4K 1;  3ZEH A;  4BY6 C;  4FCY A;  2K6D A;  1YJW A;  2R57 A;  2E6N A;  4L5G A;  2X4X A;  2CZ6 B;  2Y4X A;  1ZHI A;  1VQ7 A;  4PJO C;  1I81 A;  2L3Q A;  2DVE A;  3CEY A;  5IXB A;  1YCY A;  1Q81 R;  1GCQ C;  4AFZ C;  1Q81 C;  2RN8 A;  5LJ3 j;  4FIB A;  2QA4 A;  4PFO A;  2D1X A;  2JS0 A;  3G1J A;  3I9Q A;  3S3N A;  4II1 A;  5CKE A;  5DM7 R;  3CCS T;  3CME Q;  2KEA A;  1OPL A;  3I56 T;  2DF6 A;  4M7D A;  3ULR B;  2XD0 A;  3E9F A;  3G71 A;  1IO6 A;  4OP0 A;  2YXY A;  1K8A U;  2O31 A;  4IIO A;  1R77 A;  3CCJ A;  1Q82 U;  3AHU A;  1MND A;  2BUD A;  4DBF A;  2JM9 A;  4OMN A;  2W10 A;  1EIF A;  1TH7 A;  1XQH A;  1OQK A;  4AG2 C;  2E70 A;  1G3Y A;  3OYY A;  2E5K A;  3JCM X;  2KSS A;  1QCF A;  2A7Y A;  1VYU A;  2KRS A;  3I55 A;  1Q7Y R;  5GAN 4;  4RKU E;  1W6X A;  1CSK A;  1Q7Y C;  4M7A C;  3I5R A;  3MHX A;  2XU8 A;  3A1P A;  2JTF A;  3ME9 A;  1K9M U;  4IUT A;  2DYB A;  4O6J A;  1KQ1 A;  4L6V 5;  2QQ9 A;  1M2O A;  3OYN A;  2DIL A;  2EGA A;  2G3R A;  1AVZ C;  4X1V A;  2DIG A;  2VUB A;  1QWE A;  4HVV A;  2RO0 A;  1D0Z A;  1FX7 A;  2LJ3 A;  3BW1 A;  3NTH A;  3VS4 A;  4F7U G;  3JCM P;  4M78 A;  4M7D B;  4PKC C;  1KQS A;  2HD0 A;  5KYX A;  1BI1 A;  1WJR A;  4MMK A;  3TQ7 P;  2HQH A;  4QVC A;  3OYI A;  1Q95 G;  2GCX A;  1IRX A;  1NYG A;  3DKM A;  5GAN g;  3QZ5 B;  1NJI R;  1UG1 A;  4M75 G;  1NJI C;  2HKQ B;  1WHG A;  1N27 A;  1VQP Q;  2EQM A;  3EFR A;  3M54 A;  1W2B P;  2LQK A;  5LJ5 h;  4FYY B;  3CQT A;  1YJ9 Q;  1GBR A;  2GF7 A;  4E7L A;  3X24 B;  4F04 B;  4JLI A;  1WYX A;  3OYL A;  3LW5 E;  1NPR A;  4J6Y A;  1TG0 A;  2DNU A;  4C5I A;  1U8R A;  2R5A A;  4M7D D;  2AIR B;  1VQ5 Q;  2KXD A;  1NM7 A;  1D0Y A;  1LOJ A;  2E6Z A;  3OSS C;  4M78 B;  1MUZ A;  3D7S B;  1WIE A;  1X43 A;  1X6G A;  1YIT Q;  4C0D C;  3HRS A;  2OTJ Q;  2A36 A;  3MPU B;  2VXF A;  1VIE A;  5GMK j;  3OBW A;  1QCO A;  3F70 A;  5GAN e;  1VQL Q;  2JTM A;  1PHT A;  1RLP C;  2MWP A;  2NYS A;  3DLL A;  1PG5 B;  1VQ8 T;  1M3C A;  4C8Q F;  1RAB B;  1N6A A;  1KJW A;  5KE2 A;  3ER0 A;  4N4G A;  1UEC A;  3PMT A;  3L2W A;  2WSF E;  2E1H A;  1TSF A;  2E10 A;  1BIB A;  2F5K A;  2F1L A;  5HKC A;  2NUT A;  1GBQ A;  1JJ2 P;  1Y71 A;  2E3H A;  2YRC A;  1KC8 C;  4XTV A;  2DFU A;  2DBK A;  2KYB A;  2V26 A;  5GAO n;  4E7H A;  3M57 A;  3NTI A;  4E7K A;  1YI2 T;  1OYX A;  4FT4 A;  4ATO A;  5FU7 B;  2M9U A;  4JPB W;  1PNJ A;  1VQ4 A;  2HNI A;  3HHT B;  1IXD A;  3QYG B;  5GAN 7;  1LCK A;  2DEU A;  3BDU A;  1V29 B;  4DA4 A;  4C8Q E;  5CK9 A;  3I56 Q;  1TS9 A;  3FDR A;  1VQ9 T;  2O2O A;  1HJD A;  1B07 A;  3ASK A;  3KUF A;  1WHL A;  3BFM A;  1T3L A;  4XTX A;  4JJB A;  2A0F B;  2EGC A;  3TEE A;  2DET A;  1W70 A;  3LWI A;  5LJ3 d;  2HSP A;  1UJY A;  1U1S A;  2MWO A;  3CCL A;  4E6R A;  2KE9 A;  2QAZ A;  2A28 A;  2EJF A;  2NUT B;  1TU0 B;  3VKI A;  4JDS A;  4RCC A;  4DOV A;  1Y0M A;  3FB9 A;  1M90 R;  2DL4 A;  3CD6 T;  1VUB A;  2VC8 A;  1AWW A;  8ATC B;  2F2V A;  5I11 A;  1QKX A;  3OB9 A;  4C92 E;  4JRK A;  3SHW A;  2FG0 A;  4KH0 B;  2IIM A;  1IGU A;  2EIF A;  5GMK l;  4KGX B;  2LC4 A;  1WDX A;  5DLQ E;  4C8Q C;  3JV3 A;  5FRN A;  4JS5 A;  4CC3 A;  3PMI A;  2WSE E;  2PVG B;  4ORZ A;  1WHM A;  1K0X A;  4PJN A;  3TSZ A;  4M77 G;  4E7Z A;  2DEQ A;  3H8Z A;  1YWP A;  5GAN h;  1SSF A;  2DD4 A;  1T3S A;  3M5A A;  1MNE A;  3MP1 A;  3A8M B;  3E2U A;  3P8H A;  2EYW A;  1E6G A;  4C5H A;  5D6Y A;  1BI2 A;  3O8V A;  4A4K A;  2SRC A;  4IUR A;  2EYZ A;  4Y28 E;  2LJ1 A;  2YUP A;  2K2V A;  5I21 A;  3M4Y A;  3EHR A;  2M51 A;  2D0Q B;  2VXE A;  4WF2 A;  1VQM T;  1YJ9 A;  2QEX A;  4B9W A;  1NG2 A;  3BY7 A;  3H6Z A;  1NEG A;  5LJ3 g;  1M9S A;  2MCN A;  1OUL A;  3L2V A;  2FZK B;  4OGC A;  4X9D A;  2C0T A;  2FO0 A;  3CME T;  2RA2 A;  2BZX A;  2HL5 C;  1X69 A;  4C92 A;  3LGL A;  5GAN 5;  2DYI A;  3QII A;  1YIT A;  3CPF A;  2M16 A;  1H3H A;  2O01 E;  2QGF B;  3QJY A;  2CS7 A;  1RAF B;  2K79 A;  4P5N A;  1BIA A;  1BB9 A;  2CKK A;  4KGV B;  3PVQ A;  1K0S A;  1ABQ A;  3S6W A;  2EKH A;  3OS0 A;  2FRW A;  2DX1 A;  2ZAE A;  2YUN A;  1GCP A;  5GAM g;  3CC7 T;  1K8A R;  5IHI A;  2HL3 A;  2B86 A;  2RI5 A;  3SWN A;  4DOW A;  2JTE A;  4HXJ A;  4E47 A;  1K8A C;  2KT8 A;  2Y4Y A;  1KHI A;  3RKW A;  2JJ9 A;  1Q82 R;  2JM8 A;  2HMA A;  1JXM A;  1Q82 C;  2R5M A;  3THK A;  1W2B A;  2EQI A;  4MZP A;  2BE7 D;  1I5L A;  2COZ A;  3V7C A;  3OYH A;  1RAC B;  5FLX E;  4JJN K;  2AT1 B;  3GOX A;  3M0T A;  2LX7 A;  4C92 B;  2YDL A;  4KRT A;  2E65 A;  3G4S T;  4A54 A;  2KAF A;  2ZPF B;  4M75 D;  3E19 A;  3CC2 T;  1OEB A;  1K9M C;  4RTV A;  3JB9 J;  2LNH B;  4D8D A;  1YI2 Q;  4PJJ A;  1NYF A;  1VOM A;  1AEY A;  4BE0 A;  3A98 A;  3CCS A;  4PK4 A;  2G6F X;  5KYW A;  5GAM e;  4XAX B;  3CCM T;  5DY9 A;  4KUI A;  3HTR A;  3REA B;  3WXM B;  1BI0 A;  1QVG S;  1N5Z A;  3SWN B;  3U23 A;  1VQ9 Q;  1RL2 A;  4M7A G;  4PL6 A;  1B7T A;  5J39 A;  1M1G A;  1FXX A;  3EGU A;  3M0R A;  2DRK A;  3TRE A;  1KSW A;  3GNG A;  1VQ5 T;  4NS5 A;  3NPF A;  2QDL A;  4D8K A;  2EQK A;  4BE2 A;  1YJN Q;  4HT9 A;  1T0J A;  1TUC A;  3RUX A;  2K3X A;  2J6F A;  4CRI A;  4B6M A;  3MEW A;  2CP7 A;  1UFF A;  2CGH A;  4KGZ B;  1PRL C;  4MZT A;  2BZY A;  3HP9 A;  2CT3 A;  4Z8A A;  1NBE B;  1VQK T;  4M7D E;  4J5Y A;  4M78 F;  1Q86 R;  4J6X A;  2DXB A;  5KYW B;  2RJD A;  1UHC A;  3M59 A;  2NWM A;  2JMA A;  4Y91 A;  1EX4 A;  1QP3 A;  2QTV A;  3M55 A;  1FMV A;  2DLP A;  1LPL A;  1WPY A;  3JCM g;  5CVI A;  3L2R A;  1WHH A;  4QVZ A;  3VS1 A;  2CYZ B;  3QBY A;  1G2B A;  2COY A;  2QG9 B;  2CZ0 B;  1PCX A;  4OB0 B;  5GMK i;  1M2V A;  2PTK A;  1UGQ B;  3OY9 A;  3LYI A;  4LDW A;  1KHC A;  3ZFJ A;  5LJ5 e;  4OMP A;  5C0M A;  1SEM A;  2ZZD A;  4C0F A;  1AWJ A;  5LJ3 h;  3EH1 A;  3RES A;  4ZN3 A;  3S3O A;  4XU1 A;  4E7I A;  2ZPE B;  2B8A A;  2GFA A;  5GAN 6;  1VQM Q;  4M78 E;  2FEI A;  3C4S A;  1RLQ C;  5GAN f;  3TU4 K;  2ZCF B;  3EG2 A;  1C0M A;  3RMQ A;  4FSX A;  4R56 A;  3VJP A;  5GAO r;  2X51 A;  4XQ3 A;  4C0G A;  1ZUY A;  5FW9 A;  1QP2 A;  1G3W A;  2K3Y A;  4OB1 B;  2QQB A;  4OF1 A;  1YWO A;  1IHV A;  2VB6 A;  3KXT A;  3JCM W;  5LL6 S;  2RQV A;  3QWY A;  4J9F A;  5AT1 B;  3JCM e;  2V1R A;  2L3R A;  5GAO p;  1MMN A;  5KYN A;  2DTI A;  2AKL A;  4QQD A;  2KNB B;  4XU2 A;  5GAM h;  2PZ1 A;  2YRV A;  2NUP A;  3V7R A;  1M2V B;  3CMA Q;  2K57 A;  3I5S A;  2IVW A;  4QKU A;  1K76 A;  2QDY B;  2ROT A;  3MP6 A;  4OML A;  4M78 C;  1VQ8 A;  5GAO q;  1YFN A;  3X28 B;  3CC7 Q;  3CCE T;  4ESR A;  3VRZ A;  2RF0 A;  4ELZ C;  4EMH A;  1BYM A;  4JJC A;  4WTO B;  4RG8 A;  5IHK A;  4M77 D;  4HVW A;  1S72 T;  3G6E T;  2CP6 A;  2KI7 A;  3QUI A;  1ZSG A;  2X3X D;  5KH6 A;  5GJV B;  1MMD A;  3FJP A;  1TWB A;  2VWF A;  1AWO A;  2KQW A;  3G4S Q;  2EPD A;  5I2S A;  2VAS A;  5L8R E;  3EFO A;  4XTZ A;  1G3S A;  3A5Z B;  2L0A A;  4OB2 B;  1D3B A;  5KYU A;  3CC2 Q;  1SHF A;  1YI2 A;  2DJQ A;  2DJZ A;  2O9V A;  3OA6 A;  1KIK A;  2NUP B;  2GFU A;  2C0O A;  2GTJ A;  1OPK A;  1SSH A;  1G8X A;  4FM4 B;  2GGR A;  5A2Q E;  2L3S A;  4RTX A;  2DTO A;  2V1Q A;  4J6W A;  2BE9 B;  1KG1 A;  4FU6 A;  1WXT A;  2GQI A;  3CCU T;  1D1C A;  2CUB A;  3OS2 A;  3CCM Q;  4IUV A;  3RIR A;  2M0O A;  2ZPB B;  3PIO A;  4RTU A;  2LP5 A;  4RTW A;  3JCM b;  1FMW A;  1TUD A;  1N8R R;  1N8R C;  2DBM A;  2LX9 A;  2QK0 A;  3BDL A;  4RG2 A;  3REB B;  3FLG A;  3M58 A;  2O88 A;  5FU7 C;  4PJM A;  4C8Q G;  2YUO A;  4XTU A;  3QXE B;  3OYK A;  2EYQ A;  2C06 A;  1UB4 A;  1OX9 A;  1SF9 A;  2CUD A;  3OYF A;  3VRY A;  3CD6 A;  5GMK h;  2HAX A;  2PUK B;  5FWB A;  2A08 A;  1GRI A;  2H3J A;  2EW3 A;  2QXF A;  3EFO B;  1WQW A;  5KYX B;  3SDZ A;  1KK7 A;  1D3B B;  2CSI A;  3CCQ T;  2QA4 T;  5KYU B;  3GBQ A;  1VQK Q;  3UPU A;  4BAC A;  4PJO D;  3JCM h;  3UAT A;  3M4G A;  2FPF A;  4Z02 A;  1SPK A;  4QW2 A;  3RKY A;  2MF2 A;  3A8L B;  4C5G A;  1ACM B;  2DK3 A;  1WJQ A;  1M8M A;  3L42 A;  4R0K A;  3CCJ T;  2D8J A;  4UC4 A;  3JCM J;  4XU3 A;  4J9E A;  2BTT A;  2HQX A;  3JB9 I;  2E5Q A;  2O4X A;  3HRT A;  2ATC B;  1MGQ A;  1RI0 A;  1QVG P;  1ZUU A;  2X4Y A;  1OU8 A;  4J9I A;  1XJW B;  1H3Z A;  1NZ9 A;  4IKF A;  1WA7 A;  3JB9 D;  2ESW A;  4J83 A;  3I55 T;  5D6W A;  1NLO C;  1KC8 R;  1R0C B;  2D6F A;  1UGP B;  4N4H A;  4F7U E;  1ZSZ A;  1VQM A;  2JW4 A;  1ZA1 B;  2NLU A;  2FB7 A;  1M1K U;  5I2M A;  2W0Z A;  4C92 F;  3CCV Q;  4GLM A;  2FPD A;  4AFU C;  5ECA A;  2DXC A;  2YUQ A;  3CME A;  1U5S A;  4M7A D;  4ZGJ B;  2L89 A;  3OQ5 A;  1M30 A;  1PC0 A;  2LVM A;  3GF5 A;  4ZN1 A;  3QWX X;  2VV5 A;  4FYW B;  3HPW A;  2WSC E;  1NPP A;  2MI6 A;  4OB3 B;  3HSB A;  1WJS A;  1G5V A;  4E7J A;  2JVV A;  3VS6 A;  1RAI B;  3V8K A;  2P0P A;  1UGS B;  2HDA A;  2JS2 A;  2O4X B;  5CKB A;  2COW A;  5KE3 A;  4A4E A;  2CZ1 B;  1YJN T;  2KBT A;  3H0F A;  1B34 A;  3CCR T;  1ARK A;  2EYY A;  1WXB A;  3J7A F;  2DIQ A;  1D1B A;  1JQQ A;  4RMO A;  3A8H B;  1Y57 A;  1ZSZ B;  4HCK A;  1PKS A;  3QG1 A;  3LGF A;  3CCE Q;  3FRN A;  2LCC A;  4JLG A;  1X01 A;  1UE9 A;  2K5L A;  5AYF A;  3J80 E;  3RBB B;  1R8O B;  3JRZ A;  4KBM B;  4HA8 A;  2F2X A;  2KMT A;  1XNI A;  3H0H A;  2KR3 A;  5GAM f;  2YSQ A;  4F7U A;  4J9G A;  1S72 Q;  4K11 A;  3G6E Q;  3QKJ A;  4HCB A;  1YCS B;  3QZ9 B;  1KD1 U;  2JN0 A;  3RDV A;  5CQY A;  3CC2 A;  2EWN A;  3JB9 H;  4EMK A;  3LWH A;  2L5Q A;  1TXQ A;  2HCK A;  4F17 A;  4M75 A;  4LDX A;  2EFI A;  2M02 A; 
#chains in the Genus database with same CATH homology
 4IIO A;  3VS0 A;  3REA B;  1N5Z A;  2CT4 A;  2JXB A;  2D8H A;  1CKB A;  3U23 A;  2J6O A;  2JM9 A;  4OMN A;  2W10 A;  4LNP A;  2H8H A;  3H0I A;  4AG2 C;  3EGU A;  3M0R A;  2DRK A;  2E5K A;  1KSW A;  2BZ8 A;  1QCF A;  3NPF A;  2QDL A;  4D8K A;  1VYU A;  2KRS A;  1K4U S;  1EFN A;  1T0J A;  1TUC A;  2XMF A;  3PVL A;  1W6X A;  2J6F A;  1CSK A;  2CH4 A;  2LQN A;  4OMO A;  5IHN A;  2O9S A;  3I5R A;  4J9H A;  1GFC A;  1UFF A;  1PRL C;  2BZY A;  2CSQ A;  2DYB A;  2AKK A;  2CT3 A;  4J9B A;  4Z8A A;  1PRM C;  2KXC A;  3H41 A;  2DIL A;  1NLP C;  2EGA A;  4X1V A;  1AVZ C;  1U3O A;  4OMQ A;  1QKW A;  1QWE A;  2AZV A;  4HVV A;  2LJ3 A;  3VS4 A;  2DMO A;  1K9A A;  3VS7 A;  1UJ0 A;  1UHC A;  2NWM A;  2JMA A;  2DM1 A;  1FYN A;  1PKT A;  4J9D A;  2DLP A;  4ZNX A;  2ED1 A;  2K7A A;  3EG3 A;  3VS1 A;  4F14 A;  1NYG A;  2NUZ A;  1G2B A;  2LMJ A;  1WX6 A;  1UG1 A;  1PWT A;  2PTK A;  4AFS C;  4RTT A;  1ZUK A;  5IH2 A;  2RNA A;  1AOJ A;  2AK5 A;  4OMP A;  3ZL7 C;  1SEM A;  2LQW A;  2GTO A;  1S1N A;  1FMK A;  1AWJ A;  3CQT A;  1GBR A;  1AD5 A;  3VS5 A;  1WYX A;  2MIO A;  2HEQ A;  2EGE A;  1VYV A;  2LZ6 B;  1X2K A;  2PNI A;  1TG0 A;  2DNU A;  2FEI A;  3LH5 A;  1RLQ C;  3EG2 A;  2KXD A;  2J7I A;  2RQR A;  3RNJ A;  1NM7 A;  5FWC A;  2I0N A;  2KT1 A;  1MV3 A;  1MUZ A;  1ZUY A;  5FW9 A;  2ABL A;  2DL3 A;  1WIE A;  1X43 A;  1X6G A;  1YWO A;  1MV0 B;  2A36 A;  2RQV A;  2ECZ A;  3QWY A;  4J9F A;  2V1R A;  2JT4 A;  2AKL A;  1CKA A;  2OJ2 A;  2KNB B;  2FRY A;  1ABO A;  2PZ1 A;  1PHT A;  1J3T A;  2K2M A;  2K9G A;  1RLP C;  1QLY A;  4CC2 A;  3EG1 A;  3I5S A;  1OV3 A;  3M0S A;  1K76 A;  4Z88 A;  1ZBJ A;  1M3C A;  2ROT A;  4OML A;  3VS3 A;  1JEG A;  1ZLM A;  1KJW A;  1I0C A;  3VS2 A;  1JU5 C;  1UEC A;  2SEM A;  4ESR A;  3VRZ A;  1H92 A;  2D0N A;  2KRO A;  2EYX A;  2RF0 A;  1RUW A;  2DL8 A;  3UA7 A;  4JJC A;  5IHK A;  1GBQ A;  4HVW A;  1BK2 A;  1AZG B;  3M0P A;  4DEY A;  1WXU A;  2VKN A;  1G83 A;  2DA9 A;  5EC7 A;  1ZSG A;  2DBK A;  2X3X D;  2KYB A;  5GJV B;  4OMM A;  3I35 A;  2VWF A;  1T0H A;  4QT7 A;  1AWO A;  2EPD A;  1AZE A;  2L3P A;  1BU1 A;  2L0A A;  2KYM A;  4JPB W;  1PNJ A;  1SHF A;  2DJQ A;  2O9V A;  1KIK A;  4JZ3 A;  2DVJ A;  2GNC A;  3FJ5 A;  2C0O A;  1LCK A;  1JO8 A;  2GTJ A;  4LUD A;  1OPK A;  1SSH A;  2EBP A;  2HBW A;  2GGR A;  2O2O A;  1Z9Q A;  1HJD A;  2L3S A;  1NEB A;  1B07 A;  4RTX A;  4LE9 A;  2V1Q A;  2J6K A;  1WXT A;  2GQI A;  3TVT A;  1T3L A;  2CUB A;  2J06 A;  3EHQ A;  1RI9 A;  4JJB A;  4RTU A;  2EGC A;  2LP5 A;  4RTW A;  1W70 A;  2HSP A;  4CC4 B;  1TUD A;  2C0I A;  1UJY A;  4A63 B;  2DBM A;  4E6R A;  2RQT A;  2KE9 A;  2JMC A;  3REB B;  2A28 A;  2O88 A;  5GJW B;  1E7O A;  2YUO A;  1I1J A;  1Y0M A;  1HD3 A;  2CH4 W;  2DL4 A;  4HVU A;  2RPN A;  1XOV A;  1AWW A;  2DE0 X;  2F2V A;  1QWF A;  5I11 A;  2CUD A;  2J05 A;  1QKX A;  3NGP A;  3VRY A;  1W1F A;  1K1Z A;  3EG0 A;  3SHW A;  2FG0 A;  1X27 A;  2CRE A;  1B3Q A;  2IIM A;  5FWB A;  2A08 A;  1SRM A;  1GRI A;  1WDX A;  3O5Z A;  2EW3 A;  1E6H A;  3NHN A;  2ED0 A;  3JV3 A;  1GFD A;  1BBZ A;  4CC3 A;  2CSI A;  3SEM A;  3GBQ A;  2K3B A;  1VA7 A;  4ORZ A;  1UUE A;  1K0X A;  4AG1 C;  1A0N B;  3UAT A;  2DL5 A;  1M3B A;  3TSZ A;  3M0Q A;  1M3A A;  1YWP A;  3PE0 A;  2FPF A;  1AWX A;  1VYT A;  1YN8 A;  1SPK A;  1UTI A;  1T3S A;  1WI7 A;  1M27 C;  4DEX A;  3UA6 A;  2P4R A;  2LCS A;  1I07 A;  4EIK A;  2LJ0 A;  1M8M A;  4R0K A;  2D8J A;  2EYW A;  1E6G A;  2MOX A;  1YP5 A;  3C0C A;  1H8K A;  4J9E A;  4M4Z A;  5I22 A;  1GCQ A;  2BTT A;  2SRC A;  1SHG A;  2EYZ A;  2KRM A;  2KRN A;  1ZUU A;  2LJ1 A;  2KGT A;  2YUP A;  4J9I A;  1WA7 A;  2M51 A;  3EHR A;  2ESW A;  3R6N A;  4IIM A;  2VVK A;  4LUE A;  1NG2 A;  1NLO C;  4WCI A;  1GL5 A;  4FSS A;  1NEG A;  4GBQ A;  1X2Q A;  2RMO A;  2JW4 A;  2MCN A;  2ENM A;  2W0Z A;  3UF4 A;  2C0T A;  4GLM A;  2FPD A;  2FO0 A;  4AFU C;  2BZX A;  1X69 A;  5ECA A;  2RQU A;  2YUQ A;  2L2P A;  4RTY A;  1U5S A;  4RTZ A;  2EVR A;  3TSW A;  4F16 A;  2GBQ A;  1WLP B;  1H3H A;  1M30 A;  1JXO A;  2YT6 A;  3QWX X;  1X6B A;  2K79 A;  5HCK A;  1YNZ A;  2OI3 A;  1UDL A;  4AFQ C;  1BB9 A;  3M0U A;  1UHF A;  3PVQ A;  1K0S A;  1ABQ A;  3VS6 A;  1UGV A;  4JZ4 A;  2EKH A;  3KFV A;  2FRW A;  1ZX6 A;  2RQW A;  2X3W D;  2FPE A;  2DX1 A;  1SRL A;  2OAW A;  4RUG A;  2HDA A;  2JS2 A;  2YUN A;  2AZS A;  1GCP A;  2DL7 A;  2DRM A;  1KFZ A;  2M0Y A;  4LN2 A;  1HSQ A;  2ROL A;  5IHI A;  2B86 A;  2KBT A;  3H0F A;  1ARK A;  2JTE A;  4HXJ A;  2KT8 A;  2EYY A;  4Z89 A;  2CDT A;  1WXB A;  2JM8 A;  1JQQ A;  1JXM A;  2F2W A;  4CC7 A;  3THK A;  1Y57 A;  4HCK A;  2EQI A;  1PKS A;  2K6D A;  2A37 A;  1UE9 A;  5IXF A;  3RBB B;  2F2X A;  1U06 A;  3M0T A;  2LX7 A;  3H0H A;  1V1C A;  2L3Q A;  2KR3 A;  5IXB A;  2YDL A;  4KRT A;  2YSQ A;  4J9G A;  1OOT A;  1GCQ C;  4AFZ C;  4J9C A;  2RN8 A;  4K11 A;  1YCS B;  5L23 A;  2D1X A;  1OEB A;  3IQL A;  2JS0 A;  4RTV A;  4Y92 A;  3I9Q A;  2LNH B;  4D8D A;  2KEA A;  1OPL A;  1NYF A;  1Z9Z A;  2DF6 A;  3ULR B;  1AEY A;  2HCK A;  3A98 A;  1IO6 A;  4F17 A;  3NMZ C;  2G6F X;  1WFW A;  4JJD A;  2O31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...