1ZLMA

Crystal structure of the sh3 domain of human osteoclast stimulating factor
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
58
structure length
58
Chain Sequence
GQVKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the SH3 domain of human osteoclast-stimulating factor at atomic resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Osteoclast stimulating factor 1
total genus 13
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2005-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1zlmA00
2L3QA 1GL5A 2J6FA 2EKHA 1JXOA 2RN8A 3EG0A 3KFVA 4CC2A 2B86A 1RLPC 4D8DA 2DL3A 2KT8A 1NG2A 5GJVB 1I07A 4OMNA 2KYBA 1WXBA 4J9BA 2GTJA 2MOXA 4LUDA 3EHQA 1X2QA 1YWOA 2DMOA 1NYFA 2J6KA 2ABLA 2FPEA 2FPFA 5I11A 1Y57A 3H41A 2KXCA 2CT3A 2KROA 1WLPB 1AD5A 1NEGA 5IHIA 1WDXA 3RNJA 2BTTA 1TUDA 5L23A 2JS0A 4J9HA 2A37A 2FPDA 2FRYA 3QWXX 1UHFA 2ENMA 2JW4A 3I35A 1QWEA 1GRIA 1QCFA 1YNZA 2JXBA 4R0KA 2CSQA 2DL5A 2L3PA 3QWYA 2LNHB 2J6OA 2GGRA 1KFZA 3PVQA 2W10A 4HCKA 2JM9A 2LP5A 2ED1A 3UF4A 2DL7A 1ARKA 5EC7A 1K4US 2L0AA 1NM7A 2J05A 1RI9A 3VS2A 1VYVA 1WI7A 1B07A 2IIMA 3I5SA 2QDLA 1PWTA 2K7AA 1QKWA 1TG0A 3EHRA 4J9CA 1CSKA 2F2XA 2KRNA 4JPBW 2KRSA 2EGCA 4RTTA 1UHCA 2YUNA 2A28A 2EGAA 2KGTA 4E6RA 2F2WA 1E6GA 1X43A 3C0CA 4HXJA 1VYUA 4M4ZA 2HDAA 1H92A 4DEXA 3CQTA 1BK2A 1BB9A 5FWBA 4RTZA 4JZ4A 2X3WD 1JQQA 1AEYA 4OMOA 4AG2C 2C0TA 2OJ2A 2VKNA 2I0NA 1UECA 1GCQC 2KXDA 2EYWA 2ESWA 1GFCA 2K79A 2HBWA 1M8MA 2H8HA 4J9DA 4HVVA 1X2KA 2O2OA 1AWWA 1ABOA 4AG1C 4QT7A 2LQNA 1M3BA 2PZ1A 2F2VA 1YN8A 4RTVA 1GFDA 4AFSC 1YWPA 2EPDA 1GCQA 2C0OA 3ULRB 2DLPA 2DL4A 1FMKA 2MIOA 1U3OA 2LJ3A 2BZXA 2YDLA 1SHGA 2EYXA 4LE9A 2YUOA 2SRCA 1WIEA 2DRKA 3I5RA 1NYGA 1G83A 1Z9ZA 4IIOA 4Z88A 2DE0X 1SEMA 2NWMA 1I0CA 1QKXA 1M27C 2CSIA 3IQLA 1H3HA 1CKBA 3REBB 2ECZA 3O5ZA 3NHNA 1NLPC 1UJ0A 2C0IA 2O9VA 4KRTA 3JV3A 4J9EA 4X1VA 2LZ6B 4F14A 1JU5C 1E7OA 1T0JA 2VWFA 4JZ3A 1ZUUA 2P4RA 1I1JA 4IIMA 2LJ1A 2J06A 1T0HA 2KE9A 1GBRA 1UUEA 2BZYA 1Y0MA 1SSHA 2O31A 2EVRA 2DM1A 5IHNA 1WA7A 3THKA 2RQWA 1AZGB 1X6GA 3EGUA 4ESRA 1K76A 2CH4W 2K3BA 4HVUA 4LUEA 2X3XD 1H8KA 1ZUYA 2RQVA 3M0UA 2HCKA 2AK5A 2KYMA 2FO0A 3M0PA 1CKAA 2K2MA 1HD3A 1Z9QA 3M0QA 5HCKA 4DEYA 3FJ5A 2LX7A 1JEGA 2YUPA 1VA7A 1ZBJA 2ED0A 2O9SA 4Z8AA 2RPNA 3VS1A 1AOJA 2CUDA 4AFUC 1VYTA 4ORZA 3TVTA 4F16A 1PHTA 1W1FA 1JO8A 2RMOA 1FYNA 1AVZC 4LNPA 4OMQA 3UA6A 2DX1A 2DNUA 1M30A 4CC4B 2NUZA 1JXMA 5IXFA 2VVKA 3H0FA 2EYZA 3VRYA 4LN2A 4Y92A 2KR3A 2L3SA 3PE0A 2XMFA 3M0TA 2K6DA 1MV3A 2YUQA 2EBPA 1M3AA 4WCIA 3UA7A 2CT4A 2DILA 1ABQA 3ZL7C 3VS4A 1BBZA 3TSZA 2AZSA 2CUBA 2RQRA 3EG3A 3TSWA 2M0YA 3SEMA 1E6HA 1WX6A 2JMCA 1UTIA 5IHKA 2FRWA 2JMAA 1LCKA 2FG0A 5FWCA 4RTYA 1W70A 1KSWA 2AZVA 3LH5A 1AWOA 4GLMA 1K9AA 2DBMA 3GBQA 1G2BA 2D0NA 1EFNA 1SHFA 2ROLA 2LCSA 1ZUKA 3REAB 1M3CA 1RUWA 2AKLA 4JJDA 4OMMA 2YSQA 1OPLA 1ZSGA 2DRMA 2M51A 1WYXA 2MCNA 3M0RA 2JS2A 1B3QA 1GBQA 3A98A 5ECAA 2HEQA 2DF6A 3NGPA 1HJDA 1PRMC 2RQUA 2G6FX 3VRZA 2JTEA 3UATA 2A08A 2KBTA 1T3LA 1S1NA 1BU1A 1WXTA 3SHWA 3NMZC 5GJWB 3U23A 2D8JA 4GBQA 1GCPA 2RF0A 1X27A 4J9GA 4Z89A 1OV3A 4J9FA 1SPKA 2KRMA 2CREA 4JJBA 5IH2A 2E5KA 2O88A 3VS3A 1ZLMA 1AZEA 3PVLA 2DYBA 4OMPA 3R6NA 1ZX6A 2JM8A 3M0SA 1TUCA 4FSSA 2KNBB 1MUZA 2BZ8A 2GTOA 2PNIA 2RNAA 1KJWA 2CDTA 2V1RA 1PKSA 4HVWA 3NPFA 1PKTA 3VS5A 1KIKA 2GBQA 2W0ZA 1X6BA 2J7IA 1UG1A 3H0HA 1K1ZA 2JT4A 1J3TA 1WXUA 2D8HA 2DBKA 1QWFA 2LJ0A 1W6XA 1YCSB 3EG2A 2K9GA 1MV0B 4ZNXA 2HSPA 4OMLA 1NLOC 1UDLA 2DL8A 1OOTA 2ROTA 2GNCA 4CC3A 2EYYA 4CC7A 2OAWA 4RUGA 3VS0A 1U06A 2D1XA 4RTWA 1U5SA 4JJCA 1IO6A 2EQIA 2OI3A 2EW3A 4F17A 4AFZC 1PRLC 2RQTA 4A63B 1PNJA 3H0IA 4D8KA 3VS6A 1YP5A 1WFWA 1K0SA 2GQIA 4RTUA 1OEBA 1UE9A 2LMJA 3VS7A 4AFQC 3I9QA 2AKKA 2LQWA 1QLYA 1SRLA 2DVJA 2L2PA 1AWXA 2A36A 1UGVA 4RTXA 1UJYA 1T3SA 5IXBA 1RLQC 1UFFA 3RBBB 2EGEA 2KEAA 4K11A 2FEIA 4J9IA 1N5ZA 2DJQA 2V1QA 2YT6A 1HSQA 1OPKA 2CH4A 1NEBA 2DA9A 4EIKA 1A0NB 1AWJA 1K0XA 5FW9A 1SRMA 5I22A 1X69A 1V1CA 3EG1A 2SEMA 2KT1A 1XOVA 2PTKA
chains in the Genus database with same CATH superfamily
2L3QA 2J6FA 3JCMX 2EKHA 4XU0A 4KT0E 3L42A 3M54A 1Q82R 1R8OB 4JRPA 4N4HA 4TVRA 5LJ3e 4C0ZA 1NJIC 1HYOA 3CC7T 1JBMA 5D6YA 2K2VA 3H6ZA 1RACB 2LT1A 2P84A 3VUBA 1FMWA 2DMOA 2OTJQ 2FPEA 1Y57A 4C8QA 5FU6C 1WLPB 4LD9K 2JVVA 3JB9J 3CC7A 3RMSA 3MEWA 2RJFA 4PLIA 3CMEQ 2JW4A 3CCQT 5L8RE 4PK4A 1IB8A 2NUPA 2LNHB 1QVFA 4IUVA 3CMAQ 3G7ZA 4M78A 3CCRT 3PVQA 1KFZA 3ZFJA 1BYMA 4HCKA 2JM9A 2AIRB 1N8RU 2LX9A 5EC7A 1NM7A 2J05A 1RI9A 5GAMg 4E7IA 2MF2A 4C0FA 2DZ9A 2K7AA 3JCMh 2QA4Q 4E7LA 1CSKA 1I5LA 2DERA 4JRKA 3M4GA 5GMKl 3HRTA 4JPBW 4M75A 3LW5E 1NPPA 1E6GA 1TUGB 4HXJA 1G5VA 2DKGA 1I4K1 2HQEA 1VQ7T 1MHNA 5A0DA 5CKHA 1F1BB 4OMOA 2GF7A 2I0NA 3BDLA 1UECA 2EYWA 2HBWA 2YRCA 2H8HA 1Y07A 3E1SA 1JJ2A 1VIEA 4XK8E 4M78E 1JJ2P 4GY5A 2PZ1A 3SFMA 4M78B 4JJNK 3AT1B 4EMKA 4OP0A 2DYIA 2VV5A 3EG9A 1VQKQ 1YWPA 4PNOA 2KSSA 3G71A 4M7DG 2E70A 3EFOB 2RI2A 4C92A 4FSXA 4J6XA 1OX9A 4R55A 3WVEB 1VQPQ 4RCCA 5CQXA 4J7IA 4LE9A 1ZHIA 2YUOA 3RIRA 1WIEA 3CBPA 1JRIA 2DRKA 2CKKA 3NTKA 5M9OA 3M59A 4AMCA 1KC8U 4IIOA 2DXTA 3IQLA 4BB7A 1QKXA 2ECZA 1UJ0A 1K73C 4KULA 1K73U 2LNVA 4L5GA 1JU5C 4F14A 4JUVA 1ZUUA 1I1JA 3S3OA 3KUFA 5GANh 1TXQA 4IIMA 3QUIA 2KE9A 3LWHA 2BE7D 3X28B 2XDDA 4Q5WA 2O31A 4C8QE 3MHXA 2MWPA 3THKA 2HBPA 5LJ5f 2JTMA 3J7AF 2K3BA 3FB9A 4IURA 3HFOA 4E7JA 2DAQA 3M55A 3M0UA 2AK5A 2FZGB 1N8RR 1AHJB 1I5OB 1HK9A 4DEYA 1IXDA 1RABB 1QW1A 1WJRA 2LQ8A 3GOXA 1MMDA 3ZBDA 3TVTA 1PHTA 2KAFA 3EFRA 1AVZC 4C5IA 1S72Q 3H8ZA 1KHIA 4A4EA 2QK0A 3GNGA 3RDVA 4CC4B 2NUZA 1JXMA 2X4WA 3H0FA 1S72T 2EJ9A 2EYZA 5LJ5h 2OTLQ 1ZBXA 2DTHA 3M0TA 2QYZA 2YUQA 4JRIA 3EGDB 1M3AA 3TCJA 1FX7A 2NUTA 3L2UA 3TU4K 1ABQA 3TEEA 2PVDB 1VQ6A 2XKOC 4FIBA 1Q86U 1BI2A 3SEMA 1WX6A 1UTIA 3G1JA 5HY6A 4KUDK 1C1AA 4OF1A 3LX7A 5FWCA 4QKUA 2QEXQ 1KQ2A 4GLMA 2ROLA 4PJOC 3OMCA 1ZUKA 4M7AA 5CKEA 1YJ9Q 2YSQA 2WSCE 1ZSZA 4HCCA 2MCNA 3DLLA 2VB6A 5ECAA 3A98A 1YIJQ 1HJDA 2G6FX 3SB2A 1MGQA 4C92B 4FCYA 3RUXA 2A08A 4M7AD 1Q7YU 3A1PA 4D6WA 3NMZC 3RKWA 1WHKA 2DTIA 4C0DC 3U23A 4GBQA 3CCJA 3L2VA 4XTVA 2NYSA 2ZGWA 4M77F 1NJIU 2LT4A 3QPHA 1TUCA 2KNBB 4RKUE 2LDMA 3A8LB 3X20B 2RA2A 2BZ8A 2GTOA 3PFSA 2CDTA 2E6NA 4FYVB 3OBYA 4C8QB 5GANe 2J7IA 2HSEB 1K1ZA 2D8HA 3HPWA 4RG2A 2K9GA 3MEUA 1MV0B 1WJSA 2COWA 1UDLA 2L3RA 2YRDA 1OOTA 1WQWA 5KYYB 2E65A 2XD0A 1RL2A 5I2SA 3V8LA 3FJPA 1EZZB 4J5YA 4A53A 3EG9B 1XJWB 3BDUA 5GAN6 4RTWA 3UWNA 3QDFA 3MKDA 4LDXA 1BCMA 4PJOF 4QW2A 2EW3A 3E9FA 1PRLC 1PNJA 1YI2Q 1ACMB 3VS6A 1YP5A 2GQIA 1MNEA 1WHMA 1UE9A 4BY6C 4AFQC 2D0QB 2LQWA 4PJOB 4F7UG 3HSBA 2F5KA 1AWXA 1HXDA 2A36A 4LDWA 1YIJT 1NBEB 4C92E 1IREB 3CPFA 1IGUA 4K11A 2DJQA 1H3ZA 2DA9A 1C0MA 1AWJA 1VQMQ 5IAYA 3LYIA 2G3RA 2PUOB 2E1HA 4ATOA 3EG1A 3JCMf 2KT1A 2FVUA 4OB1B 2XG8D 1QCNA 3KFVA 4M75E 2RI3A 2EQJA 1RLPC 4M77C 1YHQT 2DL3A 2YWWA 2KT8A 3HTRA 1NG2A 3OA6A 5FU7C 1VQOQ 4C92G 4XTYA 1VQ5T 5GMKm 1BI1A 4J9BA 5AT1B 1B34B 2MOXA 2YLBA 3CCRA 1TS9A 3PNWC 2X4JA 3G71Q 4XQ3A 1X2QA 1YWOA 4IKFA 2QASA 2BIVA 2J6KA 1R0CB 2L8DA 3C95A 4XAXB 1M1KR 2KXCA 2CT3A 3EGXA 2FYKA 1O9SA 4OGEA 1WDXA 3FLGA 2BTTA 3OS5A 4J9HA 2A37A 2FPDA 1OU8A 1KQ1A 2RO0A 4P5NA 1VQKA 1GRIA 1QCFA 1YNZA 1D0ZA 2JXBA 4X9DA 2CSQA 2DL5A 3QWYA 3CXCS 1KQSA 2J6OA 1YJNA 1Q7YC 3FEOA 5J3BA 1M4ZA 2D9TA 2LP5A 4OB2B 1ARKA 4OB3B 1K4US 2DETA 2JOYA 1B07A 2VXEA 5GAN3 3I5SA 4DBFA 3JCMJ 2OTJT 3M4YA 2QDLA 1PWTA 1QKWA 1G3YA 2VXFA 2FL7A 3EAEA 2E3HA 2F2XA 2KRNA 4RTTA 1K8AR 1V29B 3HP9A 2P0KA 1MMAA 1DJ7B 3CC7Q 1X43A 4MZTA 2DEUA 3CCVA 3SD4A 4F7UE 1H92A 1IGQA 4DEXA 1BK2A 1VQLA 5FWBA 3JCMQ 4RTZA 2HQHA 3RESA 3PTAA 5FLXE 1AEYA 3WVDB 4PJOA 4R56A 2A3LA 3NTHA 4PJOG 3S6WA 2ZAEA 2OJ2A 3OS1A 4M7AC 3HL8A 1IRXA 3G6EA 3OW2A 3OYLA 1N9RA 5GAN7 4MMLA 4OVAA 1RI0A 1YCYA 1ABOA 2QA4T 2AT1B 4J8OA 4QVZA 2LQNA 1M3BA 3JCMd 4RTVA 2V8KA 2QGGA 4C5HA 3LGFA 2EPDA 1GCQA 3CMAA 2WSEE 2C0OA 4DOVA 3QIIA 5KYWB 2DIQA 4M7AE 1EIFA 2DL4A 2CP2A 4Y91A 2QG9B 4M7AB 1VQ9Q 2MIOA 3V7RA 5CCAA 4JLGA 5I21A 2PQWA 1QVGP 3CC4T 1ZA1B 4E7SA 1VQNQ 3HFNA 4EMKC 2DE0X 3CMEA 4KH1B 3GIBA 1M27C 4M75B 1CKBA 3QYGB 4BD3A 2LCCA 4JS5A 3NHNA 4M7DE 3OB9A 3INZA 3OY9A 3FIFA 4FYWB 4J9EA 1D3BA 2KY9A 3EH2A 1VQMA 2VWFA 1T0JA 4JZ3A 3OYHA 5GAOp 1T0HA 3BFMA 5KYUA 4IUQA 3CC2Q 1SSHA 2QEXA 1SKUB 1PM3A 2OTLA 1WA7A 3DKMA 3T9NA 4EMGA 4ELZC 5GMKj 3OSSC 5CKFA 1MNDA 3G4SQ 2X3XD 2R5MA 5A0LA 2HMAA 2CP3A 4C0GA 1ZUYA 2RQVA 5CR2A 2HCKA 1ZQ1A 1CKAA 3JCMg 4B9WA 4ZGEB 1Z9QA 2HKNA 4F7UF 3EGXB 2YUPA 4PJLA 2DJZA 2XDPA 2RPNA 2CUDA 4AFUC 1VYTA 4JRQA 5FU7B 3BY7A 3META 1RADB 2VUBA 4MMKA 4LNPA 3J81E 4M78F 1PSFA 4BDZA 4PFPA 1M30A 2LC4A 5GAOl 3JB9D 4WF2A 4FYYB 1IHWA 4DOWA 4XU2A 1QCOA 4LN2A 2AHJB 4Y92A 2KR3A 2HAXA 3BW1A 2FZCB 2K6DA 4J6WA 4WCIA 3CCUA 2CP5A 2CT4A 4X9CA 3L2QA 1OI1A 2LQKA 2Z0WA 5DY9A 2X35A 4QQGA 4II1A 3TSZA 3J80E 2CUBA 2EKOA 1KQSP 2M0YA 1VQ9T 1UGPB 1E6HA 2O01E 2JMCA 3PGGA 2FRWA 3HRSA 3CD6Q 2JMAA 3QYHB 1X01A 4C8QD 2FG0A 5HKCA 1W70A 3LH5A 1AWOA 1R0BG 4N4IA 2GCXA 3JCMW 2LCSA 2PVGB 2ZPBB 2VGMA 4V2SA 5KCHA 1M3CA 1RUWA 3M9QA 4JJDA 3JB9G 1M90U 3L2ZA 3X26B 2DRMA 4JS4A 1B3QA 4J83A 2LRQA 2CZ7B 1PRMC 5LJ3h 2FZKB 3MP6A 4ZN1A 4M75G 2JTEA 2BKDN 1M90R 1VQNT 1T3LA 2KBTA 3MPUB 1S1NA 2HKQB 4B9XA 1FWZA 3CCST 2MYSA 2D8JA 1PCXA 3VUZA 5GAN5 3LGLA 2E5KA 5GAMd 1TWBA 5A0GA 1ZLMA 4XTWA 2HNIA 3RKYA 2JZ2A 2CP6A 3RMQA 1N6AA 4DA4A 1Q82C 4HKEA 1M1FA 3RKXA 1VQ6Q 1VQ7Q 2VYTA 2XIDA 2CP7A 2COYA 2PNIA 2RNAA 2GQVA 1Q86R 4X34A 1PKTA 4C0DB 3VS5A 2OAUA 2GBQA 1B7TA 2RHZA 1J3TA 2XDBA 1WXUA 3I56Q 2LCLA 4LXCA 1YCSB 4HCZA 4ZNXA 3CCJQ 1NLOC 1U8RA 1MMNA 2RK2A 4OMFB 4CC3A 1BI0A 2V8IA 2OAWA 3I56T 5GAOm 2Y90A 2D1XA 1W2BA 4N4GA 3VKIA 1W4SA 4JJCA 5EG2A 2EQIA 3UDCA 4QVDA 5KYXA 2QQSA 1BIBA 2RQTA 1KHCA 3CMET 3H0IA 5A2QE 3VJPA 1OEBA 3CCLT 5FRNA 2K3XA 1TOVA 2AKKA 3OYMA 1QLYA 5GAMf 1D1AA 2QAZA 4QVCA 3LLRA 3OYAA 1M1KC 1UJYA 1T3SA 3RBBB 1D1BA 1OU9A 2KEAA 2BUDA 3C4SA 4ELYC 1N5ZA 2VASA 2V1QA 3A5ZB 1A0NB 3E19A 1G8XA 1SRMA 2CP0A 5I22A 1U1SA 4BI8B 4M75F 1GL5A 1OX8A 5GAOn 1JXOA 2RN8A 4CC2A 4PL6A 2B86A 4PJMA 1RAFB 5GAMe 4D8DA 2RM4A 5CQYA 4OMNA 3GLXA 1YJWQ 5D7UA 4IUTA 4FW1A 2WSFE 4N0AA 2QDYB 1Q81C 1YJWT 4LUDA 4FT4A 1LJOA 3EHQA 3M5AA 2RJCA 2QGFB 2ABLA 2KI7A 5I11A 2C06A 4WTOB 2KROA 5KE2A 1LOJA 3G71T 1NEGA 3LWIA 2M16A 4N0AC 3RNJA 1M2OA 1TUDA 4FU6A 2JS0A 4LDUA 5GMKh 2P4TA 1UHFA 2ENMA 3I35A 1O75A 1XNIA 3CC4Q 4A4GA 5KH6A 4R0KA 5KE3A 2L3PA 2GGRA 2ZPFB 1VQ8T 3GP8A 4PKCC 4ZTFA 4HT9A 2DXBA 3G6EQ 1KG1A 1WHGA 2ED1A 3UF4A 2DL7A 1RAIB 2L0AA 2NLUA 3VS2A 3EGDA 2DD4A 4HA8A 4OB0B 2ATCB 4J9CA 3QZ9B 4PFZA 3MEVA 5J39A 5FROA 2LTOA 2KGTA 4E6RA 5GAMj 3CCSQ 1TTHB 3QXEB 1XTDA 1PD0A 1VYUA 1RAGB 1UEBA 3E9GA 3ER0A 3CC2A 1BB9A 2RHXA 3C94A 5FRMA 4JZ4A 2X3WD 1KD1R 2EJGA 4BE1A 5CAIA 2MMPA 1K8AU 3D7SB 2C0TA 1SSFA 3I56A 2VKNA 3R6OA 2E4HA 3G4SA 1VQ4T 4Y28E 5LJ5e 2RH2A 1GCQC 2KXDA 1GFCA 2K79A 1M8MA 4M78G 1G3SA 4HVVA 4MZMA 4MZPA 4AG1C 3E2UA 1OYXA 1N27A 1K9MR 4QT7A 2H3EB 3CCQA 1YN8A 4M7DB 1KD1U 5HK3A 1M9SA 2DIGA 1IHVA 1GFDA 2X4YA 4AFSC 3KBGA 1YBYA 4PJJA 4C92D 3ME9A 2ZPIB 4PJNA 1YJNQ 4BI4A 3ULRB 3CCVQ 1NE8A 3CCUT 2DLPA 5CKBA 1BIAA 1U3OA 2LJ3A 2BZXA 3SWNA 2YDLA 2EYXA 1M2VB 3I5RA 1G3TA 1G83A 3V7SA 1C6VX 3JAME 2NWMA 1I0CA 2VC8A 2CSIA 4L6V5 3MO8A 4IUPA 3L2RA 1NLPC 2C0IA 3GNFB 4KRTA 3JV3A 2E3IA 1BI3A 1OZ3A 4X1VA 2LZ6B 2VGNA 1JB0E 1YFNA 3SWNC 4BUGA 2XICA 3EFOA 2J06A 4UC4A 1QVFP 1GBRA 1UUEA 2CZ0B 1UGSB 4FT2A 3FDRA 3SDZA 2DXCA 2ZCFB 1NPRA 4EMHA 2EYQA 1Q81R 3BE3A 3EGUA 4O6JA 4ESRA 2CH4W 5IN1A 2P0PA 2NUPB 4LUEA 3I55T 2JUFA 2FB7A 2K57A 3CBMA 2X51A 3ASKA 2HD0A 1VQNA 1WQ7A 2KYMA 4XU1A 3UPUA 5HCKA 3FJ5A 3PMIA 4C5GA 1VA7A 5LJ3g 1M8VA 2ED0A 2YRVA 3QDRB 3VS1A 1AOJA 2E41A 4ORZA 1YJ9T 3JCMb 3CCMA 4F16A 1W1FA 1JO8A 5I2MA 1RAHB 1FYNA 4J7FA 4BY6B 3UA6A 1M1KU 2RD1A 1VQ9A 2DNUA 4VUBA 1PG5B 1PD1A 5CIUA 2VVKA 1G3WA 1KD1C 2MPXC 3CC4A 3DLMA 1OQKA 1MV3A 2V26A 2EBPA 1TH7A 2F69A 3EFSA 3UA7A 4BDYA 2DILA 3JCMc 1D09B 3ZL7C 3VS4A 1BBZA 3CCVT 2IG0A 1VQOA 3EG3A 3TSWA 2E5QA 2PUKB 5LJ3j 1QVGS 9ATCB 2RHUA 3Q1JA 2AZVA 2Y4XA 4KBMB 4XU3A 4M77B 5KYNA 3JRZA 3GBQA 1G2BA 2D0NA 4ME7A 1SHFA 4BI3A 2DK3A 2RJDA 2H3JA 2AKLA 3VV0A 2OX7A 3CPWP 4O5VA 2XHCA 3OW2S 1WNLA 1WHJA 2M51A 1R77A 1WYXA 2EQKA 3M0RA 3QSUA 1WPYA 1VQ8A 4JLIA 1YITT 2HEQA 3KXTA 2DF6A 4RG8A 3UT1A 3NGPA 3CCUQ 5LL6S 5CO7A 4C8QF 2RQUA 1RAAB 2MAMA 2B8AA 1I81A 3UATA 3V8KA 3A8MB 1BU1A 3CD6A 3VYGA 1AT1B 5GJWB 3I55A 1VQMT 1GCPA 5GAMh 4LDYA 2RF0A 1X27A 3OYCA 1YITA 4J9GA 4Z89A 1OV3A 4J9FA 4L59A 4JJBA 3MEAA 2JTFA 3OYIA 2QEXT 1AZEA 3PVLA 2DYBA 4OMPA 4KGZB 4NL3A 1ZX6A 2JM8A 3M0SA 4KUIA 5CK9A 2WACA 3CD6T 1MUZA 2RHYA 3QO3A 3JCMe 2HQXA 2V1RA 4HVWA 1PKSA 1YHQA 3HHTB 2QQ9A 3NPFA 3OYNA 2CZ6B 5KYWA 4M77D 1KIKA 1X6BA 1UG1A 2CYZB 5C6SA 2MK5A 2ZPEB 1VQOT 2QQRA 2JT4A 4C8QG 5D6WA 2DBKA 2KDSA 3EG2A 4IUUA 1ZSZB 3A8GB 2F5TX 4OMLA 2DL8A 4ANJA 2ROTA 1FMVA 3LH0A 2GNCA 4ZGJB 3RR6A 3JB9H 1WGSA 2Y4YA 2EYYA 4CC7A 2LVMA 4RUGA 1D1CA 4F7UA 3CBOA 4GLKA 5GAOr 1TU0B 1U5SA 2M0OA 4KGVB 3CCLA 2OI3A 3CCMT 4A63B 2O4XA 4E2FB 4MDWA 1K0SA 4RTUA 2LMJA 2RHIA 3MP8A 4HCBA 5J26A 1ZA2B 1M2VA 1SRLA 2DVJA 2E10A 4NOYA 4C92F 3NTIA 4FM4B 5IXBA 7AT1B 2EGEA 4J6YA 3CC2T 4C8QC 2MWOA 8ATCB 2YT6A 1HSQA 1OPKA 2CH4A 1EX4A 4EIKA 3X25B 1K0XA 5FW9A 4M78D 3OS0A 3RERA 3OW2P 3MCAB 1WHHA 2QTVA 3URGA 3OS2A 2QA4A 3OQ5A 2PTKA 2EWNA 3EG0A 2L5QA 1RAEB 3P8HA 5D6XA 1WHLA 3PT9A 5GJVB 1I07A 2K5LA 2KYBA 1WXBA 1ZSZC 1V76A 1WZOA 3C12A 4M75C 3CCQQ 2X4XA 4ZTJA 2GTJA 2DVEA 2FHDA 4A54A 1VQ7A 5GANd 4CRIA 4EPCA 2EQUA 2EIFA 2DD5A 2X9HA 3N5BB 5LJ3d 2ZPGB 3HRUA 1KK7A 1NYFA 4XTZA 2FPFA 4BACA 2EFIA 3H41A 1M5Q1 3OYYA 2JJ9A 1UGRB 1AD5A 3CCSA 5IHIA 3P8DA 5L23A 5DLQE 3CXCA 4XTUA 2FRYA 3QWXX 1YI2T 4FYXB 5GANg 1X6OA 2DXUA 4DQ2A 1QWEA 2D6FA 3X24B 3WXMB 2EJFA 3QG1A 3PIOA 4NS5A 1YJWA 2W10A 1K73R 1QP3A 3VU3C 3OYGA 1W2BP 1QP2A 1VOMA 4LDVA 2XU8A 1VQKT 1VYVA 1WI7A 1M1GA 3A8OB 3CCJT 2IIMA 2M1HA 4KGXB 3PMTA 4E7HA 1TG0A 2DTOA 3EHRA 1W2BS 3P8BB 1Q86C 3TREA 2KRSA 2EGCA 3FRNA 1UHCA 2YUNA 4AT1B 2A28A 2EGAA 4M77A 1D0YA 2F2WA 3C0CA 4PLLA 2A7YA 3S3NA 4M4ZA 2HDAA 4CI0C 1BCOA 3SWNB 3CQTA 3G6ET 4M77E 6AT1B 1LVKA 3G4ST 1JQQA 1VQ4A 1VQ5A 4QQ6A 5AYFA 4AG2C 4BE2A 1Y96B 3JCMP 4PFOA 2DFUA 5CVIA 2XI9A 4M78C 2K5IA 2KQWA 3MP1A 4DBHA 1VQLT 2ESWA 3QBYA 3M58A 1XQHA 4J9DA 2JNGA 2YXYA 1X2KA 2O2OA 5C0MA 1AWWA 2P0QA 4KH0B 2F2VA 4OGCA 2DO3A 3V7CA 1KC8R 2PVOB 4M7AG 2HL3A 2QQBA 2OTJA 1QQJA 1FMKA 4A4FA 1SHGA 2KK4A 3L1AA 2SRCA 4FL6A 3OYJA 1MMGA 1NYGA 1WJQA 5GMKi 3F70A 4EDUA 1Z9ZA 4Z88A 1YJNT 1SEMA 2OTLT 2COZA 2ZZDA 4M7DF 1H3HA 3REBB 1UB4A 3O5ZA 5KYXB 2O9VA 3GF5A 3S3MA 2R58A 3ZEHA 1E7OA 3GPLA 1FXXA 3DB4A 1M90C 4PJOE 2P4RA 2R57A 3M57A 3OYEA 2RK1A 2LJ1A 2QXFA 2ZPHB 5GAN8 5KYYA 2BZYA 1Y0MA 4EMKB 1D3BB 4M7DD 3PIPA 2EVRA 2DM1A 2O4XB 5LJ5d 5IHNA 2RQWA 1AZGB 1X6GA 3TQ7P 1QVFS 1K76A 1B34A 3MJXA 2I2LA 1Q81U 2YLCA 2HL5C 1PC0A 4HVUA 1PSEA 1KC8C 2E64A 5GAN2 1H8KA 4E7ZA 1X75C 3I55Q 4C5EA 3VYHB 2FO0A 3M0PA 1YITQ 1Y96A 4DBQA 2K2MA 1HD3A 2DPPB 3M0QA 2F1LA 1LPLA 2LX7A 2IPOB 1JEGA 1ZBJA 2O9SA 4JDSA 4Z8AA 5GANj 1UGQB 1GXIE 4E7KA 4ZGDB 3OYBA 4DBRA 2RMOA 2M9UA 2HZYA 4C92C 4OMQA 3QHSA 1YJ9A 2DX1A 3QKJA 1K9MC 5GAOq 2RB6A 2RJEA 1K9MU 5IXFA 2QQAA 3VRYA 5GMKe 1VIFA 2L3SA 2R5AA 3CCEQ 3PE0A 2XMFA 3JSCA 4NL2A 4M7DC 3O8VA 2YHTA 2CZ1B 4RMOA 2KMTA 2AZSA 2RQRA 1K8AC 1YHQQ 3JB9I 1VQPA 5IHKA 3QZ5B 5KYUB 3QJYA 1N9SA 4LD6A 2E6ZA 3OYKA 1LCKA 4RTYA 1SF9A 5GAN4 1KSWA 2QI2A 2K3YA 1K9AA 1VUBA 2DBMA 3OSVA 1N8RC 1EFNA 3REAB 1S72A 1JJ2S 1Y7XA 4OMMA 3JCMV 1OPLA 1ZSGA 3L2WA 2E12A 3QJ6A 3OBWA 4ZN3A 2BE9B 2K5FA 2JS2A 1VQLQ 3CPWS 1GBQA 2GFAA 1VQ4Q 1VQPT 2DEQA 1Y71A 1D0XA 1OULA 3VRZA 2IVWA 4M77G 4F7UB 3CCMQ 3CCLQ 1IZ6A 3CMAT 3FC3A 4A4HA 1WXTA 3SHWA 4MDXA 5LJ3f 1OZ2A 3A8HB 4M7DA 1SG5A 1SPKA 2KRMA 1BKBA 2CREA 4YTLA 2M02A 5IH2A 2O88A 3OYFA 3H9NA 3VS3A 1Q82U 3R6NA 8AT1B 4FSSA 2L89A 3HKSA 3CCRQ 2DZCA 1YI2A 1H641 1KJWA 3DB3A 1U1TA 4F04B 1NZ9A 1QMCA 2KVQG 2W0ZA 3H0HA 4M75D 1Q95G 1QVGA 2A0FB 3CCET 3EH1A 3OYDA 1QWFA 2LJ0A 5DM7R 3OMGA 1W6XA 1Q7YR 2HSPA 4E47A 5IT9E 4M7AF 2EQMA 4Z02A 4BE0A 5FU6B 4XTXA 2NUTB 2K4YA 4FW2A 3V8JA 4HT8A 3M56A 4PJOD 3CXCP 1YIJA 3VS0A 4RCBA 2V8JA 5KCOA 1U06A 5CKDA 4QQDA 5DLOA 1NJIR 3M53A 5LJ5j 2CGHA 2XK0A 1IO6A 4F17A 2JN0A 4AFZC 1TSFA 4D8KA 3CPWA 2MI6A 2PU9B 1WFWA 1I8FA 3VS7A 1VQ6T 2CS7A 3I9QA 1LNXA 1VQ8Q 2L2PA 4A4KA 3AHUA 1UGVA 4RTXA 1RLQC 1UFFA 5HK0A 1KQSS 3NFCA 2RI5A 1QVPA 2FEIA 3CEYA 4J9IA 5LJ5g 1NEBA 2EAYA 2GFUA 3JB9F 1P92A 2QTXA 4B6MA 1X69A 1V1CA 2SEMA 5GANf 1XOVA 1VQ5Q 3CCEA
chains in the Genus database with same CATH topology
2L3QA 1GL5A 2J6FA 2EKHA 1JXOA 2RN8A 3EG0A 3KFVA 4CC2A 2B86A 1RLPC 4D8DA 2DL3A 2KT8A 1NG2A 5GJVB 1I07A 4OMNA 2KYBA 1WXBA 4J9BA 2GTJA 2MOXA 4LUDA 3EHQA 1X2QA 1YWOA 2DMOA 1NYFA 2J6KA 2ABLA 2FPEA 2FPFA 5I11A 1Y57A 3H41A 2KXCA 2CT3A 2KROA 1WLPB 1AD5A 1NEGA 5IHIA 1WDXA 3RNJA 2BTTA 1TUDA 5L23A 2JS0A 4J9HA 2A37A 2FPDA 2FRYA 3QWXX 1UHFA 2ENMA 2JW4A 3I35A 1QWEA 1GRIA 1QCFA 1YNZA 2JXBA 4R0KA 2CSQA 2DL5A 2L3PA 3QWYA 2LNHB 2J6OA 2GGRA 1KFZA 3PVQA 2W10A 4HCKA 2JM9A 2LP5A 2ED1A 3UF4A 2DL7A 1ARKA 5EC7A 1K4US 2L0AA 1NM7A 2J05A 1RI9A 3VS2A 1VYVA 1WI7A 1B07A 2IIMA 3I5SA 2QDLA 1PWTA 2K7AA 1QKWA 1TG0A 3EHRA 4J9CA 1CSKA 2F2XA 2KRNA 4JPBW 2KRSA 2EGCA 4RTTA 1UHCA 2YUNA 2A28A 2EGAA 2KGTA 4E6RA 2F2WA 1E6GA 1X43A 3C0CA 4HXJA 1VYUA 4M4ZA 2HDAA 1H92A 4DEXA 3CQTA 1BK2A 1BB9A 5FWBA 4RTZA 4JZ4A 2X3WD 1JQQA 1AEYA 4OMOA 4AG2C 2C0TA 2OJ2A 2VKNA 2I0NA 1UECA 1GCQC 2KXDA 2EYWA 2ESWA 1GFCA 2K79A 2HBWA 1M8MA 2H8HA 4J9DA 4HVVA 1X2KA 2O2OA 1AWWA 1ABOA 4AG1C 4QT7A 2LQNA 1M3BA 2PZ1A 2F2VA 1YN8A 4RTVA 1GFDA 4AFSC 1YWPA 2EPDA 1GCQA 2C0OA 3ULRB 2DLPA 2DL4A 1FMKA 2MIOA 1U3OA 2LJ3A 2BZXA 2YDLA 1SHGA 2EYXA 4LE9A 2YUOA 2SRCA 1WIEA 2DRKA 3I5RA 1NYGA 1G83A 1Z9ZA 4IIOA 4Z88A 2DE0X 1SEMA 2NWMA 1I0CA 1QKXA 1M27C 2CSIA 3IQLA 1H3HA 1CKBA 3REBB 2ECZA 3O5ZA 3NHNA 1NLPC 1UJ0A 2C0IA 2O9VA 4KRTA 3JV3A 4J9EA 4X1VA 2LZ6B 4F14A 1JU5C 1E7OA 1T0JA 2VWFA 4JZ3A 1ZUUA 2P4RA 1I1JA 4IIMA 2LJ1A 2J06A 1T0HA 2KE9A 1GBRA 1UUEA 2BZYA 1Y0MA 1SSHA 2O31A 2EVRA 2DM1A 5IHNA 1WA7A 3THKA 2RQWA 1AZGB 1X6GA 3EGUA 4ESRA 1K76A 2CH4W 2K3BA 4HVUA 4LUEA 2X3XD 1H8KA 1ZUYA 2RQVA 3M0UA 2HCKA 2AK5A 2KYMA 2FO0A 3M0PA 1CKAA 2K2MA 1HD3A 1Z9QA 3M0QA 5HCKA 4DEYA 3FJ5A 2LX7A 1JEGA 2YUPA 1VA7A 1ZBJA 2ED0A 2O9SA 4Z8AA 2RPNA 3VS1A 1AOJA 2CUDA 4AFUC 1VYTA 4ORZA 3TVTA 4F16A 1PHTA 1W1FA 1JO8A 2RMOA 1FYNA 1AVZC 4LNPA 4OMQA 3UA6A 2DX1A 2DNUA 1M30A 4CC4B 2NUZA 1JXMA 5IXFA 2VVKA 3H0FA 2EYZA 3VRYA 4LN2A 4Y92A 2KR3A 2L3SA 3PE0A 2XMFA 3M0TA 2K6DA 1MV3A 2YUQA 2EBPA 1M3AA 4WCIA 3UA7A 2CT4A 2DILA 1ABQA 3ZL7C 3VS4A 1BBZA 3TSZA 2AZSA 2CUBA 2RQRA 3EG3A 3TSWA 2M0YA 3SEMA 1E6HA 1WX6A 2JMCA 1UTIA 5IHKA 2FRWA 2JMAA 1LCKA 2FG0A 5FWCA 4RTYA 1W70A 1KSWA 2AZVA 3LH5A 1AWOA 4GLMA 1K9AA 2DBMA 3GBQA 1G2BA 2D0NA 1EFNA 1SHFA 2ROLA 2LCSA 1ZUKA 3REAB 1M3CA 1RUWA 2AKLA 4JJDA 4OMMA 2YSQA 1OPLA 1ZSGA 2DRMA 2M51A 1WYXA 2MCNA 3M0RA 2JS2A 1B3QA 1GBQA 3A98A 5ECAA 2HEQA 2DF6A 3NGPA 1HJDA 1PRMC 2RQUA 2G6FX 3VRZA 2JTEA 3UATA 2A08A 2KBTA 1T3LA 1S1NA 1BU1A 1WXTA 3SHWA 3NMZC 5GJWB 3U23A 2D8JA 4GBQA 1GCPA 2RF0A 1X27A 4J9GA 4Z89A 1OV3A 4J9FA 1SPKA 2KRMA 2CREA 4JJBA 5IH2A 2E5KA 2O88A 3VS3A 1ZLMA 1AZEA 3PVLA 2DYBA 4OMPA 3R6NA 1ZX6A 2JM8A 3M0SA 1TUCA 4FSSA 2KNBB 1MUZA 2BZ8A 2GTOA 2PNIA 2RNAA 1KJWA 2CDTA 2V1RA 1PKSA 4HVWA 3NPFA 1PKTA 3VS5A 1KIKA 2GBQA 2W0ZA 1X6BA 2J7IA 1UG1A 3H0HA 1K1ZA 2JT4A 1J3TA 1WXUA 2D8HA 2DBKA 1QWFA 2LJ0A 1W6XA 1YCSB 3EG2A 2K9GA 1MV0B 4ZNXA 2HSPA 4OMLA 1NLOC 1UDLA 2DL8A 1OOTA 2ROTA 2GNCA 4CC3A 2EYYA 4CC7A 2OAWA 4RUGA 3VS0A 1U06A 2D1XA 4RTWA 1U5SA 4JJCA 1IO6A 2EQIA 2OI3A 2EW3A 4F17A 4AFZC 1PRLC 2RQTA 4A63B 1PNJA 3H0IA 4D8KA 3VS6A 1YP5A 1WFWA 1K0SA 2GQIA 4RTUA 1OEBA 1UE9A 2LMJA 3VS7A 4AFQC 3I9QA 2AKKA 2LQWA 1QLYA 1SRLA 2DVJA 2L2PA 1AWXA 2A36A 1UGVA 4RTXA 1UJYA 1T3SA 5IXBA 1RLQC 1UFFA 3RBBB 2EGEA 2KEAA 4K11A 2FEIA 4J9IA 1N5ZA 2DJQA 2V1QA 2YT6A 1HSQA 1OPKA 2CH4A 1NEBA 2DA9A 4EIKA 1A0NB 1AWJA 1K0XA 5FW9A 1SRMA 5I22A 1X69A 1V1CA 3EG1A 2SEMA 2KT1A 1XOVA 2PTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L3Q A;  1GL5 A;  2J6F A;  2EKH A;  1JXO A;  2RN8 A;  3EG0 A;  3KFV A;  4CC2 A;  2B86 A;  1RLP C;  4D8D A;  2DL3 A;  2KT8 A;  1NG2 A;  5GJV B;  1I07 A;  4OMN A;  2KYB A;  1WXB A;  4J9B A;  2GTJ A;  2MOX A;  4LUD A;  3EHQ A;  1X2Q A;  1YWO A;  2DMO A;  1NYF A;  2J6K A;  2ABL A;  2FPE A;  2FPF A;  5I11 A;  1Y57 A;  3H41 A;  2KXC A;  2CT3 A;  2KRO A;  1WLP B;  1AD5 A;  1NEG A;  5IHI A;  1WDX A;  3RNJ A;  2BTT A;  1TUD A;  5L23 A;  2JS0 A;  4J9H A;  2A37 A;  2FPD A;  2FRY A;  3QWX X;  1UHF A;  2ENM A;  2JW4 A;  3I35 A;  1QWE A;  1GRI A;  1QCF A;  1YNZ A;  2JXB A;  4R0K A;  2CSQ A;  2DL5 A;  2L3P A;  3QWY A;  2LNH B;  2J6O A;  2GGR A;  1KFZ A;  3PVQ A;  2W10 A;  4HCK A;  2JM9 A;  2LP5 A;  2ED1 A;  3UF4 A;  2DL7 A;  1ARK A;  5EC7 A;  1K4U S;  2L0A A;  1NM7 A;  2J05 A;  1RI9 A;  3VS2 A;  1VYV A;  1WI7 A;  1B07 A;  2IIM A;  3I5S A;  2QDL A;  1PWT A;  2K7A A;  1QKW A;  1TG0 A;  3EHR A;  4J9C A;  1CSK A;  2F2X A;  2KRN A;  4JPB W;  2KRS A;  2EGC A;  4RTT A;  1UHC A;  2YUN A;  2A28 A;  2EGA A;  2KGT A;  4E6R A;  2F2W A;  1E6G A;  1X43 A;  3C0C A;  4HXJ A;  1VYU A;  4M4Z A;  2HDA A;  1H92 A;  4DEX A;  3CQT A;  1BK2 A;  1BB9 A;  5FWB A;  4RTZ A;  4JZ4 A;  2X3W D;  1JQQ A;  1AEY A;  4OMO A;  4AG2 C;  2C0T A;  2OJ2 A;  2VKN A;  2I0N A;  1UEC A;  1GCQ C;  2KXD A;  2EYW A;  2ESW A;  1GFC A;  2K79 A;  2HBW A;  1M8M A;  2H8H A;  4J9D A;  4HVV A;  1X2K A;  2O2O A;  1AWW A;  1ABO A;  4AG1 C;  4QT7 A;  2LQN A;  1M3B A;  2PZ1 A;  2F2V A;  1YN8 A;  4RTV A;  1GFD A;  4AFS C;  1YWP A;  2EPD A;  1GCQ A;  2C0O A;  3ULR B;  2DLP A;  2DL4 A;  1FMK A;  2MIO A;  1U3O A;  2LJ3 A;  2BZX A;  2YDL A;  1SHG A;  2EYX A;  4LE9 A;  2YUO A;  2SRC A;  1WIE A;  2DRK A;  3I5R A;  1NYG A;  1G83 A;  1Z9Z A;  4IIO A;  4Z88 A;  2DE0 X;  1SEM A;  2NWM A;  1I0C A;  1QKX A;  1M27 C;  2CSI A;  3IQL A;  1H3H A;  1CKB A;  3REB B;  2ECZ A;  3O5Z A;  3NHN A;  1NLP C;  1UJ0 A;  2C0I A;  2O9V A;  4KRT A;  3JV3 A;  4J9E A;  4X1V A;  2LZ6 B;  4F14 A;  1JU5 C;  1E7O A;  1T0J A;  2VWF A;  4JZ3 A;  1ZUU A;  2P4R A;  1I1J A;  4IIM A;  2LJ1 A;  2J06 A;  1T0H A;  2KE9 A;  1GBR A;  1UUE A;  2BZY A;  1Y0M A;  1SSH A;  2O31 A;  2EVR A;  2DM1 A;  5IHN A;  1WA7 A;  3THK A;  2RQW A;  1AZG B;  1X6G A;  3EGU A;  4ESR A;  1K76 A;  2CH4 W;  2K3B A;  4HVU A;  4LUE A;  2X3X D;  1H8K A;  1ZUY A;  2RQV A;  3M0U A;  2HCK A;  2AK5 A;  2KYM A;  2FO0 A;  3M0P A;  1CKA A;  2K2M A;  1HD3 A;  1Z9Q A;  3M0Q A;  5HCK A;  4DEY A;  3FJ5 A;  2LX7 A;  1JEG A;  2YUP A;  1VA7 A;  1ZBJ A;  2ED0 A;  2O9S A;  4Z8A A;  2RPN A;  3VS1 A;  1AOJ A;  2CUD A;  4AFU C;  1VYT A;  4ORZ A;  3TVT A;  4F16 A;  1PHT A;  1W1F A;  1JO8 A;  2RMO A;  1FYN A;  1AVZ C;  4LNP A;  4OMQ A;  3UA6 A;  2DX1 A;  2DNU A;  1M30 A;  4CC4 B;  2NUZ A;  1JXM A;  5IXF A;  2VVK A;  3H0F A;  2EYZ A;  3VRY A;  4LN2 A;  4Y92 A;  2KR3 A;  2L3S A;  3PE0 A;  2XMF A;  3M0T A;  2K6D A;  1MV3 A;  2YUQ A;  2EBP A;  1M3A A;  4WCI A;  3UA7 A;  2CT4 A;  2DIL A;  1ABQ A;  3ZL7 C;  3VS4 A;  1BBZ A;  3TSZ A;  2AZS A;  2CUB A;  2RQR A;  3EG3 A;  3TSW A;  2M0Y A;  3SEM A;  1E6H A;  1WX6 A;  2JMC A;  1UTI A;  5IHK A;  2FRW A;  2JMA A;  1LCK A;  2FG0 A;  5FWC A;  4RTY A;  1W70 A;  1KSW A;  2AZV A;  3LH5 A;  1AWO A;  4GLM A;  1K9A A;  2DBM A;  3GBQ A;  1G2B A;  2D0N A;  1EFN A;  1SHF A;  2ROL A;  2LCS A;  1ZUK A;  3REA B;  1M3C A;  1RUW A;  2AKL A;  4JJD A;  4OMM A;  2YSQ A;  1OPL A;  1ZSG A;  2DRM A;  2M51 A;  1WYX A;  2MCN A;  3M0R A;  2JS2 A;  1B3Q A;  1GBQ A;  3A98 A;  5ECA A;  2HEQ A;  2DF6 A;  3NGP A;  1HJD A;  1PRM C;  2RQU A;  2G6F X;  3VRZ A;  2JTE A;  3UAT A;  2A08 A;  2KBT A;  1T3L A;  1S1N A;  1BU1 A;  1WXT A;  3SHW A;  3NMZ C;  5GJW B;  3U23 A;  2D8J A;  4GBQ A;  1GCP A;  2RF0 A;  1X27 A;  4J9G A;  4Z89 A;  1OV3 A;  4J9F A;  1SPK A;  2KRM A;  2CRE A;  4JJB A;  5IH2 A;  2E5K A;  2O88 A;  3VS3 A;  1ZLM A;  1AZE A;  3PVL A;  2DYB A;  4OMP A;  3R6N A;  1ZX6 A;  2JM8 A;  3M0S A;  1TUC A;  4FSS A;  2KNB B;  1MUZ A;  2BZ8 A;  2GTO A;  2PNI A;  2RNA A;  1KJW A;  2CDT A;  2V1R A;  1PKS A;  4HVW A;  3NPF A;  1PKT A;  3VS5 A;  1KIK A;  2GBQ A;  2W0Z A;  1X6B A;  2J7I A;  1UG1 A;  3H0H A;  1K1Z A;  2JT4 A;  1J3T A;  1WXU A;  2D8H A;  2DBK A;  1QWF A;  2LJ0 A;  1W6X A;  1YCS B;  3EG2 A;  2K9G A;  1MV0 B;  4ZNX A;  2HSP A;  4OML A;  1NLO C;  1UDL A;  2DL8 A;  1OOT A;  2ROT A;  2GNC A;  4CC3 A;  2EYY A;  4CC7 A;  2OAW A;  4RUG A;  3VS0 A;  1U06 A;  2D1X A;  4RTW A;  1U5S A;  4JJC A;  1IO6 A;  2EQI A;  2OI3 A;  2EW3 A;  4F17 A;  4AFZ C;  1PRL C;  2RQT A;  4A63 B;  1PNJ A;  3H0I A;  4D8K A;  3VS6 A;  1YP5 A;  1WFW A;  1K0S A;  2GQI A;  4RTU A;  1OEB A;  1UE9 A;  2LMJ A;  3VS7 A;  4AFQ C;  3I9Q A;  2AKK A;  2LQW A;  1QLY A;  1SRL A;  2DVJ A;  2L2P A;  1AWX A;  2A36 A;  1UGV A;  4RTX A;  1UJY A;  1T3S A;  5IXB A;  1RLQ C;  1UFF A;  3RBB B;  2EGE A;  2KEA A;  4K11 A;  2FEI A;  4J9I A;  1N5Z A;  2DJQ A;  2V1Q A;  2YT6 A;  1HSQ A;  1OPK A;  2CH4 A;  1NEB A;  2DA9 A;  4EIK A;  1A0N B;  1AWJ A;  1K0X A;  5FW9 A;  1SRM A;  5I22 A;  1X69 A;  1V1C A;  3EG1 A;  2SEM A;  2KT1 A;  1XOV A;  2PTK A; 
#chains in the Genus database with same CATH topology
 2L3Q A;  2J6F A;  3JCM X;  2EKH A;  4XU0 A;  4KT0 E;  3L42 A;  3M54 A;  1Q82 R;  1R8O B;  4JRP A;  4N4H A;  4TVR A;  5LJ3 e;  4C0Z A;  1NJI C;  1HYO A;  3CC7 T;  1JBM A;  5D6Y A;  2K2V A;  3H6Z A;  1RAC B;  2LT1 A;  2P84 A;  3VUB A;  1FMW A;  2DMO A;  2OTJ Q;  2FPE A;  1Y57 A;  4C8Q A;  5FU6 C;  1WLP B;  4LD9 K;  2JVV A;  3JB9 J;  3CC7 A;  3RMS A;  3MEW A;  2RJF A;  4PLI A;  3CME Q;  2JW4 A;  3CCQ T;  5L8R E;  4PK4 A;  1IB8 A;  2NUP A;  2LNH B;  1QVF A;  4IUV A;  3CMA Q;  3G7Z A;  4M78 A;  3CCR T;  3PVQ A;  1KFZ A;  3ZFJ A;  1BYM A;  4HCK A;  2JM9 A;  2AIR B;  1N8R U;  2LX9 A;  5EC7 A;  1NM7 A;  2J05 A;  1RI9 A;  5GAM g;  4E7I A;  2MF2 A;  4C0F A;  2DZ9 A;  2K7A A;  3JCM h;  2QA4 Q;  4E7L A;  1CSK A;  1I5L A;  2DER A;  4JRK A;  3M4G A;  5GMK l;  3HRT A;  4JPB W;  4M75 A;  3LW5 E;  1NPP A;  1E6G A;  1TUG B;  4HXJ A;  1G5V A;  2DKG A;  1I4K 1;  2HQE A;  1VQ7 T;  1MHN A;  5A0D A;  5CKH A;  1F1B B;  4OMO A;  2GF7 A;  2I0N A;  3BDL A;  1UEC A;  2EYW A;  2HBW A;  2YRC A;  2H8H A;  1Y07 A;  3E1S A;  1JJ2 A;  1VIE A;  4XK8 E;  4M78 E;  1JJ2 P;  4GY5 A;  2PZ1 A;  3SFM A;  4M78 B;  4JJN K;  3AT1 B;  4EMK A;  4OP0 A;  2DYI A;  2VV5 A;  3EG9 A;  1VQK Q;  1YWP A;  4PNO A;  2KSS A;  3G71 A;  4M7D G;  2E70 A;  3EFO B;  2RI2 A;  4C92 A;  4FSX A;  4J6X A;  1OX9 A;  4R55 A;  3WVE B;  1VQP Q;  4RCC A;  5CQX A;  4J7I A;  4LE9 A;  1ZHI A;  2YUO A;  3RIR A;  1WIE A;  3CBP A;  1JRI A;  2DRK A;  2CKK A;  3NTK A;  5M9O A;  3M59 A;  4AMC A;  1KC8 U;  4IIO A;  2DXT A;  3IQL A;  4BB7 A;  1QKX A;  2ECZ A;  1UJ0 A;  1K73 C;  4KUL A;  1K73 U;  2LNV A;  4L5G A;  1JU5 C;  4F14 A;  4JUV A;  1ZUU A;  1I1J A;  3S3O A;  3KUF A;  5GAN h;  1TXQ A;  4IIM A;  3QUI A;  2KE9 A;  3LWH A;  2BE7 D;  3X28 B;  2XDD A;  4Q5W A;  2O31 A;  4C8Q E;  3MHX A;  2MWP A;  3THK A;  2HBP A;  5LJ5 f;  2JTM A;  3J7A F;  2K3B A;  3FB9 A;  4IUR A;  3HFO A;  4E7J A;  2DAQ A;  3M55 A;  3M0U A;  2AK5 A;  2FZG B;  1N8R R;  1AHJ B;  1I5O B;  1HK9 A;  4DEY A;  1IXD A;  1RAB B;  1QW1 A;  1WJR A;  2LQ8 A;  3GOX A;  1MMD A;  3ZBD A;  3TVT A;  1PHT A;  2KAF A;  3EFR A;  1AVZ C;  4C5I A;  1S72 Q;  3H8Z A;  1KHI A;  4A4E A;  2QK0 A;  3GNG A;  3RDV A;  4CC4 B;  2NUZ A;  1JXM A;  2X4W A;  3H0F A;  1S72 T;  2EJ9 A;  2EYZ A;  5LJ5 h;  2OTL Q;  1ZBX A;  2DTH A;  3M0T A;  2QYZ A;  2YUQ A;  4JRI A;  3EGD B;  1M3A A;  3TCJ A;  1FX7 A;  2NUT A;  3L2U A;  3TU4 K;  1ABQ A;  3TEE A;  2PVD B;  1VQ6 A;  2XKO C;  4FIB A;  1Q86 U;  1BI2 A;  3SEM A;  1WX6 A;  1UTI A;  3G1J A;  5HY6 A;  4KUD K;  1C1A A;  4OF1 A;  3LX7 A;  5FWC A;  4QKU A;  2QEX Q;  1KQ2 A;  4GLM A;  2ROL A;  4PJO C;  3OMC A;  1ZUK A;  4M7A A;  5CKE A;  1YJ9 Q;  2YSQ A;  2WSC E;  1ZSZ A;  4HCC A;  2MCN A;  3DLL A;  2VB6 A;  5ECA A;  3A98 A;  1YIJ Q;  1HJD A;  2G6F X;  3SB2 A;  1MGQ A;  4C92 B;  4FCY A;  3RUX A;  2A08 A;  4M7A D;  1Q7Y U;  3A1P A;  4D6W A;  3NMZ C;  3RKW A;  1WHK A;  2DTI A;  4C0D C;  3U23 A;  4GBQ A;  3CCJ A;  3L2V A;  4XTV A;  2NYS A;  2ZGW A;  4M77 F;  1NJI U;  2LT4 A;  3QPH A;  1TUC A;  2KNB B;  4RKU E;  2LDM A;  3A8L B;  3X20 B;  2RA2 A;  2BZ8 A;  2GTO A;  3PFS A;  2CDT A;  2E6N A;  4FYV B;  3OBY A;  4C8Q B;  5GAN e;  2J7I A;  2HSE B;  1K1Z A;  2D8H A;  3HPW A;  4RG2 A;  2K9G A;  3MEU A;  1MV0 B;  1WJS A;  2COW A;  1UDL A;  2L3R A;  2YRD A;  1OOT A;  1WQW A;  5KYY B;  2E65 A;  2XD0 A;  1RL2 A;  5I2S A;  3V8L A;  3FJP A;  1EZZ B;  4J5Y A;  4A53 A;  3EG9 B;  1XJW B;  3BDU A;  5GAN 6;  4RTW A;  3UWN A;  3QDF A;  3MKD A;  4LDX A;  1BCM A;  4PJO F;  4QW2 A;  2EW3 A;  3E9F A;  1PRL C;  1PNJ A;  1YI2 Q;  1ACM B;  3VS6 A;  1YP5 A;  2GQI A;  1MNE A;  1WHM A;  1UE9 A;  4BY6 C;  4AFQ C;  2D0Q B;  2LQW A;  4PJO B;  4F7U G;  3HSB A;  2F5K A;  1AWX A;  1HXD A;  2A36 A;  4LDW A;  1YIJ T;  1NBE B;  4C92 E;  1IRE B;  3CPF A;  1IGU A;  4K11 A;  2DJQ A;  1H3Z A;  2DA9 A;  1C0M A;  1AWJ A;  1VQM Q;  5IAY A;  3LYI A;  2G3R A;  2PUO B;  2E1H A;  4ATO A;  3EG1 A;  3JCM f;  2KT1 A;  2FVU A;  4OB1 B;  2XG8 D;  1QCN A;  3KFV A;  4M75 E;  2RI3 A;  2EQJ A;  1RLP C;  4M77 C;  1YHQ T;  2DL3 A;  2YWW A;  2KT8 A;  3HTR A;  1NG2 A;  3OA6 A;  5FU7 C;  1VQO Q;  4C92 G;  4XTY A;  1VQ5 T;  5GMK m;  1BI1 A;  4J9B A;  5AT1 B;  1B34 B;  2MOX A;  2YLB A;  3CCR A;  1TS9 A;  3PNW C;  2X4J A;  3G71 Q;  4XQ3 A;  1X2Q A;  1YWO A;  4IKF A;  2QAS A;  2BIV A;  2J6K A;  1R0C B;  2L8D A;  3C95 A;  4XAX B;  1M1K R;  2KXC A;  2CT3 A;  3EGX A;  2FYK A;  1O9S A;  4OGE A;  1WDX A;  3FLG A;  2BTT A;  3OS5 A;  4J9H A;  2A37 A;  2FPD A;  1OU8 A;  1KQ1 A;  2RO0 A;  4P5N A;  1VQK A;  1GRI A;  1QCF A;  1YNZ A;  1D0Z A;  2JXB A;  4X9D A;  2CSQ A;  2DL5 A;  3QWY A;  3CXC S;  1KQS A;  2J6O A;  1YJN A;  1Q7Y C;  3FEO A;  5J3B A;  1M4Z A;  2D9T A;  2LP5 A;  4OB2 B;  1ARK A;  4OB3 B;  1K4U S;  2DET A;  2JOY A;  1B07 A;  2VXE A;  5GAN 3;  3I5S A;  4DBF A;  3JCM J;  2OTJ T;  3M4Y A;  2QDL A;  1PWT A;  1QKW A;  1G3Y A;  2VXF A;  2FL7 A;  3EAE A;  2E3H A;  2F2X A;  2KRN A;  4RTT A;  1K8A R;  1V29 B;  3HP9 A;  2P0K A;  1MMA A;  1DJ7 B;  3CC7 Q;  1X43 A;  4MZT A;  2DEU A;  3CCV A;  3SD4 A;  4F7U E;  1H92 A;  1IGQ A;  4DEX A;  1BK2 A;  1VQL A;  5FWB A;  3JCM Q;  4RTZ A;  2HQH A;  3RES A;  3PTA A;  5FLX E;  1AEY A;  3WVD B;  4PJO A;  4R56 A;  2A3L A;  3NTH A;  4PJO G;  3S6W A;  2ZAE A;  2OJ2 A;  3OS1 A;  4M7A C;  3HL8 A;  1IRX A;  3G6E A;  3OW2 A;  3OYL A;  1N9R A;  5GAN 7;  4MML A;  4OVA A;  1RI0 A;  1YCY A;  1ABO A;  2QA4 T;  2AT1 B;  4J8O A;  4QVZ A;  2LQN A;  1M3B A;  3JCM d;  4RTV A;  2V8K A;  2QGG A;  4C5H A;  3LGF A;  2EPD A;  1GCQ A;  3CMA A;  2WSE E;  2C0O A;  4DOV A;  3QII A;  5KYW B;  2DIQ A;  4M7A E;  1EIF A;  2DL4 A;  2CP2 A;  4Y91 A;  2QG9 B;  4M7A B;  1VQ9 Q;  2MIO A;  3V7R A;  5CCA A;  4JLG A;  5I21 A;  2PQW A;  1QVG P;  3CC4 T;  1ZA1 B;  4E7S A;  1VQN Q;  3HFN A;  4EMK C;  2DE0 X;  3CME A;  4KH1 B;  3GIB A;  1M27 C;  4M75 B;  1CKB A;  3QYG B;  4BD3 A;  2LCC A;  4JS5 A;  3NHN A;  4M7D E;  3OB9 A;  3INZ A;  3OY9 A;  3FIF A;  4FYW B;  4J9E A;  1D3B A;  2KY9 A;  3EH2 A;  1VQM A;  2VWF A;  1T0J A;  4JZ3 A;  3OYH A;  5GAO p;  1T0H A;  3BFM A;  5KYU A;  4IUQ A;  3CC2 Q;  1SSH A;  2QEX A;  1SKU B;  1PM3 A;  2OTL A;  1WA7 A;  3DKM A;  3T9N A;  4EMG A;  4ELZ C;  5GMK j;  3OSS C;  5CKF A;  1MND A;  3G4S Q;  2X3X D;  2R5M A;  5A0L A;  2HMA A;  2CP3 A;  4C0G A;  1ZUY A;  2RQV A;  5CR2 A;  2HCK A;  1ZQ1 A;  1CKA A;  3JCM g;  4B9W A;  4ZGE B;  1Z9Q A;  2HKN A;  4F7U F;  3EGX B;  2YUP A;  4PJL A;  2DJZ A;  2XDP A;  2RPN A;  2CUD A;  4AFU C;  1VYT A;  4JRQ A;  5FU7 B;  3BY7 A;  3MET A;  1RAD B;  2VUB A;  4MMK A;  4LNP A;  3J81 E;  4M78 F;  1PSF A;  4BDZ A;  4PFP A;  1M30 A;  2LC4 A;  5GAO l;  3JB9 D;  4WF2 A;  4FYY B;  1IHW A;  4DOW A;  4XU2 A;  1QCO A;  4LN2 A;  2AHJ B;  4Y92 A;  2KR3 A;  2HAX A;  3BW1 A;  2FZC B;  2K6D A;  4J6W A;  4WCI A;  3CCU A;  2CP5 A;  2CT4 A;  4X9C A;  3L2Q A;  1OI1 A;  2LQK A;  2Z0W A;  5DY9 A;  2X35 A;  4QQG A;  4II1 A;  3TSZ A;  3J80 E;  2CUB A;  2EKO A;  1KQS P;  2M0Y A;  1VQ9 T;  1UGP B;  1E6H A;  2O01 E;  2JMC A;  3PGG A;  2FRW A;  3HRS A;  3CD6 Q;  2JMA A;  3QYH B;  1X01 A;  4C8Q D;  2FG0 A;  5HKC A;  1W70 A;  3LH5 A;  1AWO A;  1R0B G;  4N4I A;  2GCX A;  3JCM W;  2LCS A;  2PVG B;  2ZPB B;  2VGM A;  4V2S A;  5KCH A;  1M3C A;  1RUW A;  3M9Q A;  4JJD A;  3JB9 G;  1M90 U;  3L2Z A;  3X26 B;  2DRM A;  4JS4 A;  1B3Q A;  4J83 A;  2LRQ A;  2CZ7 B;  1PRM C;  5LJ3 h;  2FZK B;  3MP6 A;  4ZN1 A;  4M75 G;  2JTE A;  2BKD N;  1M90 R;  1VQN T;  1T3L A;  2KBT A;  3MPU B;  1S1N A;  2HKQ B;  4B9X A;  1FWZ A;  3CCS T;  2MYS A;  2D8J A;  1PCX A;  3VUZ A;  5GAN 5;  3LGL A;  2E5K A;  5GAM d;  1TWB A;  5A0G A;  1ZLM A;  4XTW A;  2HNI A;  3RKY A;  2JZ2 A;  2CP6 A;  3RMQ A;  1N6A A;  4DA4 A;  1Q82 C;  4HKE A;  1M1F A;  3RKX A;  1VQ6 Q;  1VQ7 Q;  2VYT A;  2XID A;  2CP7 A;  2COY A;  2PNI A;  2RNA A;  2GQV A;  1Q86 R;  4X34 A;  1PKT A;  4C0D B;  3VS5 A;  2OAU A;  2GBQ A;  1B7T A;  2RHZ A;  1J3T A;  2XDB A;  1WXU A;  3I56 Q;  2LCL A;  4LXC A;  1YCS B;  4HCZ A;  4ZNX A;  3CCJ Q;  1NLO C;  1U8R A;  1MMN A;  2RK2 A;  4OMF B;  4CC3 A;  1BI0 A;  2V8I A;  2OAW A;  3I56 T;  5GAO m;  2Y90 A;  2D1X A;  1W2B A;  4N4G A;  3VKI A;  1W4S A;  4JJC A;  5EG2 A;  2EQI A;  3UDC A;  4QVD A;  5KYX A;  2QQS A;  1BIB A;  2RQT A;  1KHC A;  3CME T;  3H0I A;  5A2Q E;  3VJP A;  1OEB A;  3CCL T;  5FRN A;  2K3X A;  1TOV A;  2AKK A;  3OYM A;  1QLY A;  5GAM f;  1D1A A;  2QAZ A;  4QVC A;  3LLR A;  3OYA A;  1M1K C;  1UJY A;  1T3S A;  3RBB B;  1D1B A;  1OU9 A;  2KEA A;  2BUD A;  3C4S A;  4ELY C;  1N5Z A;  2VAS A;  2V1Q A;  3A5Z B;  1A0N B;  3E19 A;  1G8X A;  1SRM A;  2CP0 A;  5I22 A;  1U1S A;  4BI8 B;  4M75 F;  1GL5 A;  1OX8 A;  5GAO n;  1JXO A;  2RN8 A;  4CC2 A;  4PL6 A;  2B86 A;  4PJM A;  1RAF B;  5GAM e;  4D8D A;  2RM4 A;  5CQY A;  4OMN A;  3GLX A;  1YJW Q;  5D7U A;  4IUT A;  4FW1 A;  2WSF E;  4N0A A;  2QDY B;  1Q81 C;  1YJW T;  4LUD A;  4FT4 A;  1LJO A;  3EHQ A;  3M5A A;  2RJC A;  2QGF B;  2ABL A;  2KI7 A;  5I11 A;  2C06 A;  4WTO B;  2KRO A;  5KE2 A;  1LOJ A;  3G71 T;  1NEG A;  3LWI A;  2M16 A;  4N0A C;  3RNJ A;  1M2O A;  1TUD A;  4FU6 A;  2JS0 A;  4LDU A;  5GMK h;  2P4T A;  1UHF A;  2ENM A;  3I35 A;  1O75 A;  1XNI A;  3CC4 Q;  4A4G A;  5KH6 A;  4R0K A;  5KE3 A;  2L3P A;  2GGR A;  2ZPF B;  1VQ8 T;  3GP8 A;  4PKC C;  4ZTF A;  4HT9 A;  2DXB A;  3G6E Q;  1KG1 A;  1WHG A;  2ED1 A;  3UF4 A;  2DL7 A;  1RAI B;  2L0A A;  2NLU A;  3VS2 A;  3EGD A;  2DD4 A;  4HA8 A;  4OB0 B;  2ATC B;  4J9C A;  3QZ9 B;  4PFZ A;  3MEV A;  5J39 A;  5FRO A;  2LTO A;  2KGT A;  4E6R A;  5GAM j;  3CCS Q;  1TTH B;  3QXE B;  1XTD A;  1PD0 A;  1VYU A;  1RAG B;  1UEB A;  3E9G A;  3ER0 A;  3CC2 A;  1BB9 A;  2RHX A;  3C94 A;  5FRM A;  4JZ4 A;  2X3W D;  1KD1 R;  2EJG A;  4BE1 A;  5CAI A;  2MMP A;  1K8A U;  3D7S B;  2C0T A;  1SSF A;  3I56 A;  2VKN A;  3R6O A;  2E4H A;  3G4S A;  1VQ4 T;  4Y28 E;  5LJ5 e;  2RH2 A;  1GCQ C;  2KXD A;  1GFC A;  2K79 A;  1M8M A;  4M78 G;  1G3S A;  4HVV A;  4MZM A;  4MZP A;  4AG1 C;  3E2U A;  1OYX A;  1N27 A;  1K9M R;  4QT7 A;  2H3E B;  3CCQ A;  1YN8 A;  4M7D B;  1KD1 U;  5HK3 A;  1M9S A;  2DIG A;  1IHV A;  1GFD A;  2X4Y A;  4AFS C;  3KBG A;  1YBY A;  4PJJ A;  4C92 D;  3ME9 A;  2ZPI B;  4PJN A;  1YJN Q;  4BI4 A;  3ULR B;  3CCV Q;  1NE8 A;  3CCU T;  2DLP A;  5CKB A;  1BIA A;  1U3O A;  2LJ3 A;  2BZX A;  3SWN A;  2YDL A;  2EYX A;  1M2V B;  3I5R A;  1G3T A;  1G83 A;  3V7S A;  1C6V X;  3JAM E;  2NWM A;  1I0C A;  2VC8 A;  2CSI A;  4L6V 5;  3MO8 A;  4IUP A;  3L2R A;  1NLP C;  2C0I A;  3GNF B;  4KRT A;  3JV3 A;  2E3I A;  1BI3 A;  1OZ3 A;  4X1V A;  2LZ6 B;  2VGN A;  1JB0 E;  1YFN A;  3SWN C;  4BUG A;  2XIC A;  3EFO A;  2J06 A;  4UC4 A;  1QVF P;  1GBR A;  1UUE A;  2CZ0 B;  1UGS B;  4FT2 A;  3FDR A;  3SDZ A;  2DXC A;  2ZCF B;  1NPR A;  4EMH A;  2EYQ A;  1Q81 R;  3BE3 A;  3EGU A;  4O6J A;  4ESR A;  2CH4 W;  5IN1 A;  2P0P A;  2NUP B;  4LUE A;  3I55 T;  2JUF A;  2FB7 A;  2K57 A;  3CBM A;  2X51 A;  3ASK A;  2HD0 A;  1VQN A;  1WQ7 A;  2KYM A;  4XU1 A;  3UPU A;  5HCK A;  3FJ5 A;  3PMI A;  4C5G A;  1VA7 A;  5LJ3 g;  1M8V A;  2ED0 A;  2YRV A;  3QDR B;  3VS1 A;  1AOJ A;  2E41 A;  4ORZ A;  1YJ9 T;  3JCM b;  3CCM A;  4F16 A;  1W1F A;  1JO8 A;  5I2M A;  1RAH B;  1FYN A;  4J7F A;  4BY6 B;  3UA6 A;  1M1K U;  2RD1 A;  1VQ9 A;  2DNU A;  4VUB A;  1PG5 B;  1PD1 A;  5CIU A;  2VVK A;  1G3W A;  1KD1 C;  2MPX C;  3CC4 A;  3DLM A;  1OQK A;  1MV3 A;  2V26 A;  2EBP A;  1TH7 A;  2F69 A;  3EFS A;  3UA7 A;  4BDY A;  2DIL A;  3JCM c;  1D09 B;  3ZL7 C;  3VS4 A;  1BBZ A;  3CCV T;  2IG0 A;  1VQO A;  3EG3 A;  3TSW A;  2E5Q A;  2PUK B;  5LJ3 j;  1QVG S;  9ATC B;  2RHU A;  3Q1J A;  2AZV A;  2Y4X A;  4KBM B;  4XU3 A;  4M77 B;  5KYN A;  3JRZ A;  3GBQ A;  1G2B A;  2D0N A;  4ME7 A;  1SHF A;  4BI3 A;  2DK3 A;  2RJD A;  2H3J A;  2AKL A;  3VV0 A;  2OX7 A;  3CPW P;  4O5V A;  2XHC A;  3OW2 S;  1WNL A;  1WHJ A;  2M51 A;  1R77 A;  1WYX A;  2EQK A;  3M0R A;  3QSU A;  1WPY A;  1VQ8 A;  4JLI A;  1YIT T;  2HEQ A;  3KXT A;  2DF6 A;  4RG8 A;  3UT1 A;  3NGP A;  3CCU Q;  5LL6 S;  5CO7 A;  4C8Q F;  2RQU A;  1RAA B;  2MAM A;  2B8A A;  1I81 A;  3UAT A;  3V8K A;  3A8M B;  1BU1 A;  3CD6 A;  3VYG A;  1AT1 B;  5GJW B;  3I55 A;  1VQM T;  1GCP A;  5GAM h;  4LDY A;  2RF0 A;  1X27 A;  3OYC A;  1YIT A;  4J9G A;  4Z89 A;  1OV3 A;  4J9F A;  4L59 A;  4JJB A;  3MEA A;  2JTF A;  3OYI A;  2QEX T;  1AZE A;  3PVL A;  2DYB A;  4OMP A;  4KGZ B;  4NL3 A;  1ZX6 A;  2JM8 A;  3M0S A;  4KUI A;  5CK9 A;  2WAC A;  3CD6 T;  1MUZ A;  2RHY A;  3QO3 A;  3JCM e;  2HQX A;  2V1R A;  4HVW A;  1PKS A;  1YHQ A;  3HHT B;  2QQ9 A;  3NPF A;  3OYN A;  2CZ6 B;  5KYW A;  4M77 D;  1KIK A;  1X6B A;  1UG1 A;  2CYZ B;  5C6S A;  2MK5 A;  2ZPE B;  1VQO T;  2QQR A;  2JT4 A;  4C8Q G;  5D6W A;  2DBK A;  2KDS A;  3EG2 A;  4IUU A;  1ZSZ B;  3A8G B;  2F5T X;  4OML A;  2DL8 A;  4ANJ A;  2ROT A;  1FMV A;  3LH0 A;  2GNC A;  4ZGJ B;  3RR6 A;  3JB9 H;  1WGS A;  2Y4Y A;  2EYY A;  4CC7 A;  2LVM A;  4RUG A;  1D1C A;  4F7U A;  3CBO A;  4GLK A;  5GAO r;  1TU0 B;  1U5S A;  2M0O A;  4KGV B;  3CCL A;  2OI3 A;  3CCM T;  4A63 B;  2O4X A;  4E2F B;  4MDW A;  1K0S A;  4RTU A;  2LMJ A;  2RHI A;  3MP8 A;  4HCB A;  5J26 A;  1ZA2 B;  1M2V A;  1SRL A;  2DVJ A;  2E10 A;  4NOY A;  4C92 F;  3NTI A;  4FM4 B;  5IXB A;  7AT1 B;  2EGE A;  4J6Y A;  3CC2 T;  4C8Q C;  2MWO A;  8ATC B;  2YT6 A;  1HSQ A;  1OPK A;  2CH4 A;  1EX4 A;  4EIK A;  3X25 B;  1K0X A;  5FW9 A;  4M78 D;  3OS0 A;  3RER A;  3OW2 P;  3MCA B;  1WHH A;  2QTV A;  3URG A;  3OS2 A;  2QA4 A;  3OQ5 A;  2PTK A;  2EWN A;  3EG0 A;  2L5Q A;  1RAE B;  3P8H A;  5D6X A;  1WHL A;  3PT9 A;  5GJV B;  1I07 A;  2K5L A;  2KYB A;  1WXB A;  1ZSZ C;  1V76 A;  1WZO A;  3C12 A;  4M75 C;  3CCQ Q;  2X4X A;  4ZTJ A;  2GTJ A;  2DVE A;  2FHD A;  4A54 A;  1VQ7 A;  5GAN d;  4CRI A;  4EPC A;  2EQU A;  2EIF A;  2DD5 A;  2X9H A;  3N5B B;  5LJ3 d;  2ZPG B;  3HRU A;  1KK7 A;  1NYF A;  4XTZ A;  2FPF A;  4BAC A;  2EFI A;  3H41 A;  1M5Q 1;  3OYY A;  2JJ9 A;  1UGR B;  1AD5 A;  3CCS A;  5IHI A;  3P8D A;  5L23 A;  5DLQ E;  3CXC A;  4XTU A;  2FRY A;  3QWX X;  1YI2 T;  4FYX B;  5GAN g;  1X6O A;  2DXU A;  4DQ2 A;  1QWE A;  2D6F A;  3X24 B;  3WXM B;  2EJF A;  3QG1 A;  3PIO A;  4NS5 A;  1YJW A;  2W10 A;  1K73 R;  1QP3 A;  3VU3 C;  3OYG A;  1W2B P;  1QP2 A;  1VOM A;  4LDV A;  2XU8 A;  1VQK T;  1VYV A;  1WI7 A;  1M1G A;  3A8O B;  3CCJ T;  2IIM A;  2M1H A;  4KGX B;  3PMT A;  4E7H A;  1TG0 A;  2DTO A;  3EHR A;  1W2B S;  3P8B B;  1Q86 C;  3TRE A;  2KRS A;  2EGC A;  3FRN A;  1UHC A;  2YUN A;  4AT1 B;  2A28 A;  2EGA A;  4M77 A;  1D0Y A;  2F2W A;  3C0C A;  4PLL A;  2A7Y A;  3S3N A;  4M4Z A;  2HDA A;  4CI0 C;  1BCO A;  3SWN B;  3CQT A;  3G6E T;  4M77 E;  6AT1 B;  1LVK A;  3G4S T;  1JQQ A;  1VQ4 A;  1VQ5 A;  4QQ6 A;  5AYF A;  4AG2 C;  4BE2 A;  1Y96 B;  3JCM P;  4PFO A;  2DFU A;  5CVI A;  2XI9 A;  4M78 C;  2K5I A;  2KQW A;  3MP1 A;  4DBH A;  1VQL T;  2ESW A;  3QBY A;  3M58 A;  1XQH A;  4J9D A;  2JNG A;  2YXY A;  1X2K A;  2O2O A;  5C0M A;  1AWW A;  2P0Q A;  4KH0 B;  2F2V A;  4OGC A;  2DO3 A;  3V7C A;  1KC8 R;  2PVO B;  4M7A G;  2HL3 A;  2QQB A;  2OTJ A;  1QQJ A;  1FMK A;  4A4F A;  1SHG A;  2KK4 A;  3L1A A;  2SRC A;  4FL6 A;  3OYJ A;  1MMG A;  1NYG A;  1WJQ A;  5GMK i;  3F70 A;  4EDU A;  1Z9Z A;  4Z88 A;  1YJN T;  1SEM A;  2OTL T;  2COZ A;  2ZZD A;  4M7D F;  1H3H A;  3REB B;  1UB4 A;  3O5Z A;  5KYX B;  2O9V A;  3GF5 A;  3S3M A;  2R58 A;  3ZEH A;  1E7O A;  3GPL A;  1FXX A;  3DB4 A;  1M90 C;  4PJO E;  2P4R A;  2R57 A;  3M57 A;  3OYE A;  2RK1 A;  2LJ1 A;  2QXF A;  2ZPH B;  5GAN 8;  5KYY A;  2BZY A;  1Y0M A;  4EMK B;  1D3B B;  4M7D D;  3PIP A;  2EVR A;  2DM1 A;  2O4X B;  5LJ5 d;  5IHN A;  2RQW A;  1AZG B;  1X6G A;  3TQ7 P;  1QVF S;  1K76 A;  1B34 A;  3MJX A;  2I2L A;  1Q81 U;  2YLC A;  2HL5 C;  1PC0 A;  4HVU A;  1PSE A;  1KC8 C;  2E64 A;  5GAN 2;  1H8K A;  4E7Z A;  1X75 C;  3I55 Q;  4C5E A;  3VYH B;  2FO0 A;  3M0P A;  1YIT Q;  1Y96 A;  4DBQ A;  2K2M A;  1HD3 A;  2DPP B;  3M0Q A;  2F1L A;  1LPL A;  2LX7 A;  2IPO B;  1JEG A;  1ZBJ A;  2O9S A;  4JDS A;  4Z8A A;  5GAN j;  1UGQ B;  1GXI E;  4E7K A;  4ZGD B;  3OYB A;  4DBR A;  2RMO A;  2M9U A;  2HZY A;  4C92 C;  4OMQ A;  3QHS A;  1YJ9 A;  2DX1 A;  3QKJ A;  1K9M C;  5GAO q;  2RB6 A;  2RJE A;  1K9M U;  5IXF A;  2QQA A;  3VRY A;  5GMK e;  1VIF A;  2L3S A;  2R5A A;  3CCE Q;  3PE0 A;  2XMF A;  3JSC A;  4NL2 A;  4M7D C;  3O8V A;  2YHT A;  2CZ1 B;  4RMO A;  2KMT A;  2AZS A;  2RQR A;  1K8A C;  1YHQ Q;  3JB9 I;  1VQP A;  5IHK A;  3QZ5 B;  5KYU B;  3QJY A;  1N9S A;  4LD6 A;  2E6Z A;  3OYK A;  1LCK A;  4RTY A;  1SF9 A;  5GAN 4;  1KSW A;  2QI2 A;  2K3Y A;  1K9A A;  1VUB A;  2DBM A;  3OSV A;  1N8R C;  1EFN A;  3REA B;  1S72 A;  1JJ2 S;  1Y7X A;  4OMM A;  3JCM V;  1OPL A;  1ZSG A;  3L2W A;  2E12 A;  3QJ6 A;  3OBW A;  4ZN3 A;  2BE9 B;  2K5F A;  2JS2 A;  1VQL Q;  3CPW S;  1GBQ A;  2GFA A;  1VQ4 Q;  1VQP T;  2DEQ A;  1Y71 A;  1D0X A;  1OUL A;  3VRZ A;  2IVW A;  4M77 G;  4F7U B;  3CCM Q;  3CCL Q;  1IZ6 A;  3CMA T;  3FC3 A;  4A4H A;  1WXT A;  3SHW A;  4MDX A;  5LJ3 f;  1OZ2 A;  3A8H B;  4M7D A;  1SG5 A;  1SPK A;  2KRM A;  1BKB A;  2CRE A;  4YTL A;  2M02 A;  5IH2 A;  2O88 A;  3OYF A;  3H9N A;  3VS3 A;  1Q82 U;  3R6N A;  8AT1 B;  4FSS A;  2L89 A;  3HKS A;  3CCR Q;  2DZC A;  1YI2 A;  1H64 1;  1KJW A;  3DB3 A;  1U1T A;  4F04 B;  1NZ9 A;  1QMC A;  2KVQ G;  2W0Z A;  3H0H A;  4M75 D;  1Q95 G;  1QVG A;  2A0F B;  3CCE T;  3EH1 A;  3OYD A;  1QWF A;  2LJ0 A;  5DM7 R;  3OMG A;  1W6X A;  1Q7Y R;  2HSP A;  4E47 A;  5IT9 E;  4M7A F;  2EQM A;  4Z02 A;  4BE0 A;  5FU6 B;  4XTX A;  2NUT B;  2K4Y A;  4FW2 A;  3V8J A;  4HT8 A;  3M56 A;  4PJO D;  3CXC P;  1YIJ A;  3VS0 A;  4RCB A;  2V8J A;  5KCO A;  1U06 A;  5CKD A;  4QQD A;  5DLO A;  1NJI R;  3M53 A;  5LJ5 j;  2CGH A;  2XK0 A;  1IO6 A;  4F17 A;  2JN0 A;  4AFZ C;  1TSF A;  4D8K A;  3CPW A;  2MI6 A;  2PU9 B;  1WFW A;  1I8F A;  3VS7 A;  1VQ6 T;  2CS7 A;  3I9Q A;  1LNX A;  1VQ8 Q;  2L2P A;  4A4K A;  3AHU A;  1UGV A;  4RTX A;  1RLQ C;  1UFF A;  5HK0 A;  1KQS S;  3NFC A;  2RI5 A;  1QVP A;  2FEI A;  3CEY A;  4J9I A;  5LJ5 g;  1NEB A;  2EAY A;  2GFU A;  3JB9 F;  1P92 A;  2QTX A;  4B6M A;  1X69 A;  1V1C A;  2SEM A;  5GAN f;  1XOV A;  1VQ5 Q;  3CCE A; 
#chains in the Genus database with same CATH homology
 2L3Q A;  1GL5 A;  2J6F A;  2EKH A;  1JXO A;  2RN8 A;  3EG0 A;  3KFV A;  4CC2 A;  2B86 A;  1RLP C;  4D8D A;  2DL3 A;  2KT8 A;  1NG2 A;  5GJV B;  1I07 A;  4OMN A;  2KYB A;  1WXB A;  4J9B A;  2GTJ A;  2MOX A;  4LUD A;  3EHQ A;  1X2Q A;  1YWO A;  2DMO A;  1NYF A;  2J6K A;  2ABL A;  2FPE A;  2FPF A;  5I11 A;  1Y57 A;  3H41 A;  2KXC A;  2CT3 A;  2KRO A;  1WLP B;  1AD5 A;  1NEG A;  5IHI A;  1WDX A;  3RNJ A;  2BTT A;  1TUD A;  5L23 A;  2JS0 A;  4J9H A;  2A37 A;  2FPD A;  2FRY A;  3QWX X;  1UHF A;  2ENM A;  2JW4 A;  3I35 A;  1QWE A;  1GRI A;  1QCF A;  1YNZ A;  2JXB A;  4R0K A;  2CSQ A;  2DL5 A;  2L3P A;  3QWY A;  2LNH B;  2J6O A;  2GGR A;  1KFZ A;  3PVQ A;  2W10 A;  4HCK A;  2JM9 A;  2LP5 A;  2ED1 A;  3UF4 A;  2DL7 A;  1ARK A;  5EC7 A;  1K4U S;  2L0A A;  1NM7 A;  2J05 A;  1RI9 A;  3VS2 A;  1VYV A;  1WI7 A;  1B07 A;  2IIM A;  3I5S A;  2QDL A;  1PWT A;  2K7A A;  1QKW A;  1TG0 A;  3EHR A;  4J9C A;  1CSK A;  2F2X A;  2KRN A;  4JPB W;  2KRS A;  2EGC A;  4RTT A;  1UHC A;  2YUN A;  2A28 A;  2EGA A;  2KGT A;  4E6R A;  2F2W A;  1E6G A;  1X43 A;  3C0C A;  4HXJ A;  1VYU A;  4M4Z A;  2HDA A;  1H92 A;  4DEX A;  3CQT A;  1BK2 A;  1BB9 A;  5FWB A;  4RTZ A;  4JZ4 A;  2X3W D;  1JQQ A;  1AEY A;  4OMO A;  4AG2 C;  2C0T A;  2OJ2 A;  2VKN A;  2I0N A;  1UEC A;  1GCQ C;  2KXD A;  2EYW A;  2ESW A;  1GFC A;  2K79 A;  2HBW A;  1M8M A;  2H8H A;  4J9D A;  4HVV A;  1X2K A;  2O2O A;  1AWW A;  1ABO A;  4AG1 C;  4QT7 A;  2LQN A;  1M3B A;  2PZ1 A;  2F2V A;  1YN8 A;  4RTV A;  1GFD A;  4AFS C;  1YWP A;  2EPD A;  1GCQ A;  2C0O A;  3ULR B;  2DLP A;  2DL4 A;  1FMK A;  2MIO A;  1U3O A;  2LJ3 A;  2BZX A;  2YDL A;  1SHG A;  2EYX A;  4LE9 A;  2YUO A;  2SRC A;  1WIE A;  2DRK A;  3I5R A;  1NYG A;  1G83 A;  1Z9Z A;  4IIO A;  4Z88 A;  2DE0 X;  1SEM A;  2NWM A;  1I0C A;  1QKX A;  1M27 C;  2CSI A;  3IQL A;  1H3H A;  1CKB A;  3REB B;  2ECZ A;  3O5Z A;  3NHN A;  1NLP C;  1UJ0 A;  2C0I A;  2O9V A;  4KRT A;  3JV3 A;  4J9E A;  4X1V A;  2LZ6 B;  4F14 A;  1JU5 C;  1E7O A;  1T0J A;  2VWF A;  4JZ3 A;  1ZUU A;  2P4R A;  1I1J A;  4IIM A;  2LJ1 A;  2J06 A;  1T0H A;  2KE9 A;  1GBR A;  1UUE A;  2BZY A;  1Y0M A;  1SSH A;  2O31 A;  2EVR A;  2DM1 A;  5IHN A;  1WA7 A;  3THK A;  2RQW A;  1AZG B;  1X6G A;  3EGU A;  4ESR A;  1K76 A;  2CH4 W;  2K3B A;  4HVU A;  4LUE A;  2X3X D;  1H8K A;  1ZUY A;  2RQV A;  3M0U A;  2HCK A;  2AK5 A;  2KYM A;  2FO0 A;  3M0P A;  1CKA A;  2K2M A;  1HD3 A;  1Z9Q A;  3M0Q A;  5HCK A;  4DEY A;  3FJ5 A;  2LX7 A;  1JEG A;  2YUP A;  1VA7 A;  1ZBJ A;  2ED0 A;  2O9S A;  4Z8A A;  2RPN A;  3VS1 A;  1AOJ A;  2CUD A;  4AFU C;  1VYT A;  4ORZ A;  3TVT A;  4F16 A;  1PHT A;  1W1F A;  1JO8 A;  2RMO A;  1FYN A;  1AVZ C;  4LNP A;  4OMQ A;  3UA6 A;  2DX1 A;  2DNU A;  1M30 A;  4CC4 B;  2NUZ A;  1JXM A;  5IXF A;  2VVK A;  3H0F A;  2EYZ A;  3VRY A;  4LN2 A;  4Y92 A;  2KR3 A;  2L3S A;  3PE0 A;  2XMF A;  3M0T A;  2K6D A;  1MV3 A;  2YUQ A;  2EBP A;  1M3A A;  4WCI A;  3UA7 A;  2CT4 A;  2DIL A;  1ABQ A;  3ZL7 C;  3VS4 A;  1BBZ A;  3TSZ A;  2AZS A;  2CUB A;  2RQR A;  3EG3 A;  3TSW A;  2M0Y A;  3SEM A;  1E6H A;  1WX6 A;  2JMC A;  1UTI A;  5IHK A;  2FRW A;  2JMA A;  1LCK A;  2FG0 A;  5FWC A;  4RTY A;  1W70 A;  1KSW A;  2AZV A;  3LH5 A;  1AWO A;  4GLM A;  1K9A A;  2DBM A;  3GBQ A;  1G2B A;  2D0N A;  1EFN A;  1SHF A;  2ROL A;  2LCS A;  1ZUK A;  3REA B;  1M3C A;  1RUW A;  2AKL A;  4JJD A;  4OMM A;  2YSQ A;  1OPL A;  1ZSG A;  2DRM A;  2M51 A;  1WYX A;  2MCN A;  3M0R A;  2JS2 A;  1B3Q A;  1GBQ A;  3A98 A;  5ECA A;  2HEQ A;  2DF6 A;  3NGP A;  1HJD A;  1PRM C;  2RQU A;  2G6F X;  3VRZ A;  2JTE A;  3UAT A;  2A08 A;  2KBT A;  1T3L A;  1S1N A;  1BU1 A;  1WXT A;  3SHW A;  3NMZ C;  5GJW B;  3U23 A;  2D8J A;  4GBQ A;  1GCP A;  2RF0 A;  1X27 A;  4J9G A;  4Z89 A;  1OV3 A;  4J9F A;  1SPK A;  2KRM A;  2CRE A;  4JJB A;  5IH2 A;  2E5K A;  2O88 A;  3VS3 A;  1ZLM A;  1AZE A;  3PVL A;  2DYB A;  4OMP A;  3R6N A;  1ZX6 A;  2JM8 A;  3M0S A;  1TUC A;  4FSS A;  2KNB B;  1MUZ A;  2BZ8 A;  2GTO A;  2PNI A;  2RNA A;  1KJW A;  2CDT A;  2V1R A;  1PKS A;  4HVW A;  3NPF A;  1PKT A;  3VS5 A;  1KIK A;  2GBQ A;  2W0Z A;  1X6B A;  2J7I A;  1UG1 A;  3H0H A;  1K1Z A;  2JT4 A;  1J3T A;  1WXU A;  2D8H A;  2DBK A;  1QWF A;  2LJ0 A;  1W6X A;  1YCS B;  3EG2 A;  2K9G A;  1MV0 B;  4ZNX A;  2HSP A;  4OML A;  1NLO C;  1UDL A;  2DL8 A;  1OOT A;  2ROT A;  2GNC A;  4CC3 A;  2EYY A;  4CC7 A;  2OAW A;  4RUG A;  3VS0 A;  1U06 A;  2D1X A;  4RTW A;  1U5S A;  4JJC A;  1IO6 A;  2EQI A;  2OI3 A;  2EW3 A;  4F17 A;  4AFZ C;  1PRL C;  2RQT A;  4A63 B;  1PNJ A;  3H0I A;  4D8K A;  3VS6 A;  1YP5 A;  1WFW A;  1K0S A;  2GQI A;  4RTU A;  1OEB A;  1UE9 A;  2LMJ A;  3VS7 A;  4AFQ C;  3I9Q A;  2AKK A;  2LQW A;  1QLY A;  1SRL A;  2DVJ A;  2L2P A;  1AWX A;  2A36 A;  1UGV A;  4RTX A;  1UJY A;  1T3S A;  5IXB A;  1RLQ C;  1UFF A;  3RBB B;  2EGE A;  2KEA A;  4K11 A;  2FEI A;  4J9I A;  1N5Z A;  2DJQ A;  2V1Q A;  2YT6 A;  1HSQ A;  1OPK A;  2CH4 A;  1NEB A;  2DA9 A;  4EIK A;  1A0N B;  1AWJ A;  1K0X A;  5FW9 A;  1SRM A;  5I22 A;  1X69 A;  1V1C A;  3EG1 A;  2SEM A;  2KT1 A;  1XOV A;  2PTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...