1ZLMA

Crystal structure of the sh3 domain of human osteoclast stimulating factor
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
58
structure length
58
Chain Sequence
b'GQVKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Osteoclast stimulating factor 1
publication title Structure of the SH3 domain of human osteoclast-stimulating factor at atomic resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 13
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2005-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1zlmA00
1ABQA 1OV3A 1FYNA 4RTZA 1OPLA 2G6FX 2DRKA 4OMQA 1K9AA 1M8MA 2FG0A 2OI3A 3NHNA 1QKWA 2RMOA 1YP5A 1U3OA 1U06A 1CKBA 2K2MA 1M3AA 3REAB 4LUDA 3SEMA 1WXTA 1ZUKA 2VVKA 2LMJA 2RF0A 2DBMA 1GBRA 1QKXA 3U23A 2DLPA 3H41A 3RNJA 1T0HA 2E5KA 1I0CA 2J6FA 1UUEA 4FSSA 1AZGB 2EYWA 1T3SA 1SSHA 4A63B 1WDXA 1QWFA 3ZL7C 4RTTA 2L0AA 3NPFA 5I22A 5IHKA 1JXOA 3M0QA 5EC7A 1UECA 5FWCA 4AG1C 1E7OA 2PNIA 3EHQA 2DF6A 2HEQA 3O5ZA 5FWBA 1S1NA 1VYUA 1WXUA 1V1CA 4GLMA 1AWJA 1EFNA 1ZUUA 2RQVA 2V1QA 1M27C 3M0UA 1TUCA 1NLPC 1ZUYA 4OMLA 4RTWA 3VS2A 1PWTA 1QWEA 1JQQA 1I07A 3VS1A 2D0NA 2ECZA 5ECAA 2JMCA 1UFFA 4X1VA 4J9EA 3EG2A 5FW9A 2EPDA 5IH2A 1I1JA 1OOTA 1ZBJA 1WFWA 2LJ0A 1H8KA 1AD5A 4DEXA 2O9VA 1UHCA 1GCQC 1SPKA 1KIKA 4D8KA 2EQIA 2RQWA 2BZYA 1QLYA 1M30A 1Z9QA 3I5RA 3H0HA 3TSWA 4JZ3A 1PRMC 3QWYA 1SHGA 1W6XA 2JM9A 4AFZC 2MIOA 2DL7A 2YUQA 4KRTA 1BK2A 3R6NA 1E6HA 4ESRA 3VRZA 2KROA 4JZ4A 4J9FA 3GBQA 1X43A 1YN8A 2HCKA 2QDLA 1JO8A 2DA9A 5I11A 2GTOA 2GGRA 2CREA 1SRLA 3H0FA 4GBQA 1TG0A 1MUZA 2LNHB 3REBB 2EGAA 1G2BA 1HD3A 1LCKA 1CSKA 4HCKA 3KFVA 1BBZA 2L3QA 1YNZA 1TUDA 4Z88A 3A98A 1X27A 4J9GA 4JJCA 4JJBA 1JU5C 4DEYA 4Z8AA 1SRMA 2DYBA 3JV3A 4Y92A 1UE9A 1A0NB 2YUPA 2F2XA 1MV0B 2SEMA 1RI9A 2DL8A 1AWXA 4F16A 1X69A 4OMOA 2RNAA 2DJQA 1GFCA 1W70A 2B86A 1FMKA 1RUWA 2OAWA 1GRIA 3PE0A 2K7AA 4LE9A 1K1ZA 2EYYA 1PRLC 1M3CA 1UDLA 2ED1A 1UTIA 3QWXX 1NG2A 2CH4A 2BZXA 2IIMA 1VYVA 3CQTA 2CUDA 2O88A 2J7IA 2CSQA 2EGEA 1ARKA 4RTUA 2K3BA 1HSQA 4CC7A 2AZVA 1N5ZA 1XOVA 5IHIA 2CT4A 4J9CA 3M0RA 2HDAA 5IXBA 1B3QA 2ED0A 2EYXA 2A08A 4CC2A 1SHFA 1KJWA 2FEIA 2YDLA 2ROLA 1GFDA 2O2OA 2CH4W 2EBPA 1K76A 1U5SA 1JXMA 1UG1A 2C0OA 2DL3A 2YUOA 4ZNXA 2DM1A 1VYTA 3LH5A 2KR3A 4RTYA 1NLOC 1RLQC 2BZ8A 4J9HA 2EW3A 1CKAA 2EKHA 3M0TA 1X2KA 1Y57A 5HCKA 1E6GA 2CUBA 2M51A 2YSQA 2HSPA 2KBTA 2LCSA 2DX1A 2FO0A 1AVZC 2DVJA 3UA7A 2D8JA 2JT4A 2J05A 2VWFA 2M0YA 3VS0A 2JS0A 2EYZA 2GBQA 4HVWA 2RQRA 3EG3A 1K0XA 4JPBW 2RQTA 2YT6A 2W0ZA 4AFSC 2LQNA 1PHTA 3VS6A 3VRYA 2LQWA 2OJ2A 2GNCA 1MV3A 1WI7A 1ZSGA 2DILA 2L3PA 4M4ZA 4WCIA 2CT3A 1NYGA 2DNUA 1AWWA 2HBWA 2ESWA 2V1RA 2FRYA 4QT7A 2O9SA 4IIMA 2AK5A 3EG0A 2C0TA 2JS2A 1GL5A 1AZEA 1T0JA 4HVUA 2ENMA 1UJ0A 2K9GA 3I5SA 1RLPC 3FJ5A 2C0IA 2A36A 1KSWA 1Z9ZA 3TVTA 1G83A 1YWOA 4RUGA 2H8HA 2A37A 4HXJA 1WIEA 1SEMA 1KFZA 1T3LA 5IXFA 2A28A 4OMNA 2FRWA 2JTEA 4AFQC 2LX7A 2DL4A 3THKA 4HVVA 3I9QA 1BU1A 1PKSA 2AKLA 3M0SA 4J9IA 2JXBA 3VS7A 1HJDA 2JMAA 2RPNA 1VA7A 2NUZA 2LJ3A 1UJYA 1BB9A 2RN8A 1NYFA 3IQLA 4CC3A 1UHFA 2I0NA 2KRMA 2F2VA 1AWOA 2GQIA 2FPDA 1ABOA 2SRCA 1YWPA 4F14A 4OMMA 5GJVB 3RBBB 1OEBA 1GBQA 2K79A 2ROTA 4AFUC 1X6GA 4F17A 2J6OA 2DBKA 4CC4B 2CSIA 1WX6A 3M0PA 1YCSB 4RTVA 1PKTA 1X2QA 3SHWA 2AKKA 4OMPA 2EVRA 1M3BA 4AG2C 4LN2A 3C0CA 1H3HA 2FPFA 2KYMA 2X3WD 1IO6A 2KXCA 2NWMA 2RQUA 2YUNA 3EHRA 1H92A 1NEGA 2ABLA 2KRNA 3VS4A 2DL5A 1NM7A 2J6KA 3UATA 2EGCA 2J06A 3H0IA 1GCQA 1B07A 1WYXA 2DRMA 2KT8A 2L3SA 5IHNA 2DMOA 2KEAA 4R0KA 3ULRB 2JM8A 3PVLA 2MCNA 3UA6A 2PTKA 1AEYA 2L2PA 2D8HA 1QCFA 2P4RA 1PNJA 1W1FA 1WA7A 3TSZA 3EGUA 1ZX6A 4J9DA 2DE0X 5L23A 3PVQA 2AZSA 2BTTA 2CDTA 4Z89A 1J3TA 1ZLMA 4EIKA 1WLPB 1K0SA 2LJ1A 2KNBB 2FPEA 1UGVA 2O31A 4D8DA 2PZ1A 2LZ6B 2K6DA 1NEBA 4ORZA 2XMFA 4E6RA 3I35A 1Y0MA 2F2WA 2VKNA 1AOJA 3VS5A 3EG1A 1GCPA 3NMZC 4JJDA 2D1XA 1WXBA 3VS3A 2KE9A 4LUEA 2KT1A 2KRSA 5GJWB 3NGPA 2JW4A 2LP5A 1X6BA 4J9BA 4RTXA 2KXDA 1OPKA 4IIOA 4K11A 4LNPA 2KYBA 2W10A 3UF4A 1K4US 2KGTA 1JEGA 2GTJA 2MOXA 2X3XD
chains in the Genus database with same CATH superfamily
4C92B 1OV3A 2C06A 2RI2A 4PLIA 3KBGA 4PJOB 1IB8A 4BACA 3M57A 3QUIA 2K2MA 2E41A 4MDWA 4BI4A 1TOVA 4LUDA 4WF2A 3UPUA 1ZUKA 1VQKT 4PK4A 2RF0A 2BE7D 4BI3A 3U23A 2DLPA 4ZTJA 2E5KA 3A8HB 1MNDA 1WHHA 4JS4A 1KQ2A 3MEAA 5IHKA 3M0QA 3EGDB 4EMHA 1YITA 5FWCA 3CXCP 3EAEA 4E7ZA 1E7OA 2RHXA 4WTOB 5CKDA 5J3BA 2RD1A 1MGQA 3OYNA 1S1NA 3JCMJ 4GLMA 4DA4A 1AWJA 3FC3A 2V1QA 1WPYA 2CP0A 1ZUYA 4OMLA 2EWNA 3VS2A 1MMAA 4JLGA 1WJQA 3VS1A 4MZPA 5ECAA 4DBFA 2JMCA 1H3ZA 3L2VA 5FLXE 2ATCB 2QA4A 2LVMA 4DBRA 1KC8R 1YIJA 1VQPQ 2LJ0A 3UDCA 4C92D 3OA6A 3OYFA 2HBPA 1F1BB 3WXMB 1FXXA 5FU6B 1Q86R 3GNGA 4PJOD 2BZYA 3JB9G 2MWOA 3I5RA 1ZQ1A 4JZ3A 3OYMA 1V29B 2I2LA 4M7DB 2MIOA 2DL7A 5GAMh 4M75B 4A4KA 2WSCE 4M78B 4DOWA 4XU2A 4E2FB 3EGXB 1PD0A 4IUPA 1VQ4A 2EJFA 2KROA 4J9FA 3GBQA 3A5ZB 2JTFA 2RHYA 1VQMT 5KYNA 1YN8A 2HCKA 2GGRA 1Q81R 1TG0A 4BY6B 2LNHB 2H3JA 1G2BA 1JB0E 2P0KA 3EH1A 1LCKA 1SKUB 1VQLA 3CCQA 3BDUA 2EJ9A 4Z88A 4DEYA 2QI2A 1SRMA 4ZN3A 2DYBA 4Y92A 1YITQ 4Y91A 2F2XA 5LJ5f 2SEMA 1AWXA 3L42A 3RKYA 4II1A 2DJQA 4XTZA 2QG9B 1GFCA 2QQRA 4C92C 1R8OB 3CBMA 4N0AC 3RR6A 4C0DC 2OX7A 4OB1B 4PJOC 1AHJB 2E1HA 2CH4A 1VYVA 3OYJA 4OMFB 4OVAA 2O88A 4Q5WA 4M7DD 2J7IA 1JRIA 2CSQA 2EGEA 2QA4Q 4M75D 4M78D 3LH0A 4RTUA 2KI7A 5AYFA 3X26B 1XOVA 3P8DA 3MEWA 2DYIA 2CT4A 4JJNK 2ED0A 3OS0A 4CC2A 1SHFA 2ROLA 1K76A 3A8MB 1U5SA 2DL3A 2QAZA 4ZNXA 3CC4T 1LJOA 2DM1A 3LH5A 1VQ4Q 2K5LA 4PFPA 4CRIA 1RLQC 5KYWA 4OGCA 2EKHA 3CPFA 3QJ6A 1X2KA 3G1JA 1NJIU 4NOYA 4N4IA 2E6ZA 1G5VA 4FT4A 1WGSA 1UEBA 2RB6A 3CCLT 1K8AU 2P4TA 5IT9E 3VUZA 1YJ9T 2M0YA 2BUDA 2D6FA 5KYUB 5FU6C 3A8OB 2LQNA 4XU3A 1W2BA 1M8VA 3P8HA 1QCNA 4DBHA 3ASKA 3BE3A 4M7DC 4KH1B 4M75C 2L3PA 4M78C 2FHDA 5FU7B 2HQHA 3JRZA 4O5VA 5GAN3 3TREA 3J81E 1Q86C 1AWWA 2HBWA 4ME7A 2V1RA 2CP2A 3I55A 3SD4A 5CAIA 2XK0A 1GL5A 1AZEA 1X01A 3CMEA 1G83A 4RUGA 2M16A 3M4YA 2YLBA 2DFUA 4C8QE 5DLOA 3MHXA 3G6EA 1KFZA 1P92A 4OMNA 1SSFA 4M7AE 2RK2A 2O01E 4ELYC 1S72A 3M59A 3THKA 4EMKA 2KK4A 4ANJA 2HNIA 1KQ1A 2ZGWA 2X4YA 4F7UE 1N9SA 3VYHB 2AKLA 4DBQA 1G8XA 1HJDA 3CCEA 2NUZA 1BB9A 3JAME 4RG2A 3OY9A 1KD1C 1FWZA 5CQXA 3PIOA 2SRCA 2X4XA 3QSUA 4B9WA 2DEUA 3I56T 2ROTA 3BFMA 2LT4A 4V2SA 2QQAA 3RMQA 2DBKA 1D0ZA 1VQNA 5DLQE 4CC4B 3BW1A 3VU3C 4D6WA 4ZGEB 2DD4A 1IHVA 3CPWA 2CP5A 5KCOA 2EVRA 4AG2C 1G3TA 2KYMA 1NJIR 1IO6A 2GFAA 2NWMA 4C5IA 2RQUA 4EMGA 2NYSA 1KQSA 3HP9A 3I55Q 3HRTA 2DL5A 2ZPIB 2OTJA 1TTHB 2F5TX 2J6KA 4F04B 1U8RA 3OSSC 1K8AR 3PGGA 1NE8A 2PU9B 4XTXA 1GCQA 1B07A 2L3SA 5IHNA 3HPWA 2DERA 3CMEQ 2CKKA 2JM8A 2MCNA 2PTKA 3BDLA 4L59A 4M77G 4HCCA 3TSZA 3JCMb 3G6EQ 3EGUA 1WHMA 2LQ8A 2HD0A 2AZSA 3S3NA 2CDTA 3F70A 1ZLMA 1WLPB 1K0SA 2KNBB 2FPEA 2O31A 2DKGA 1S72Q 4QVDA 2IPOB 1YI2T 5D6XA 2V8IA 2XMFA 5FU7C 1VQ5T 3OB9A 1VQ7T 1Y0MA 4FT2A 1Q95G 4FYXB 2JTMA 4RCCA 1GCPA 3NMZC 4ELZC 2D1XA 1WXBA 3HRSA 3URGA 5GJWB 3CCEQ 5HKCA 4LDYA 3OYIA 2DVEA 2QEXQ 1OPKA 1HK9A 4K11A 3JCMQ 3CMAA 1KHCA 3X25B 5FRMA 1JEGA 1WQWA 3HFNA 3CC2A 2K2VA 2MWPA 1UGQB 3CCMT 1OPLA 2G6FX 2DRKA 1K9AA 1M8MA 2DTIA 3NHNA 2RMOA 2X9HA 5GAN6 3WVDB 5LJ3j 5GAOm 1CKBA 1M3AA 3SWNA 4M77F 2PVOB 3META 1GBRA 2KMTA 1QVGP 3SWNC 3RNJA 2ZPHB 1D0XA 2GCXA 2OTJQ 1I0CA 2V8KA 4FSSA 1UUEA 1XTDA 1T3SA 1SSHA 4A63B 3ZL7C 4RTTA 2L0AA 3KUFA 1JXOA 1W2BS 4LDXA 1MMNA 3GIBA 2PNIA 1VQ9Q 4AT1B 2HEQA 3O5ZA 4JRIA 3OW2P 2ZPBB 3QZ5B 5D7UA 2LNVA 3ZFJA 1VQ8Q 1ZUUA 2K5FA 3M0UA 4N4HA 3CCJT 1NLPC 4RTWA 1RAHB 2LC4A 2ECZA 1UGSB 3SDZA 3CCRA 2FZGB 3M56A 5IAYA 1QQJA 4J9EA 3QKJA 3EG2A 1OOTA 1FX7A 5CIUA 3PIPA 1AD5A 3QHSA 4RCBA 1UHCA 4E7LA 1ZHIA 2QQBA 1SPKA 4BD3A 5FRNA 5GAMj 1Q86U 3G71T 2QGFB 4B6MA 1N9RA 1DJ7B 1QLYA 1M30A 3CMAQ 3H0HA 3R6OA 1YJNA 1PRMC 4BE1A 1SHGA 3OYGA 4KRTA 1BK2A 3HRUA 1TWBA 2P0QA 4ESRA 3VRZA 1ZA1B 3M9QA 2QDLA 3TQ7P 1D3BA 1SRLA 3PMTA 3L1AA 5J39A 3LGLA 4RKUE 3CC7T 4OB3B 4P5NA 3OMCA 5CKFA 1N6AA 4HCKA 1BIBA 1WHGA 3CXCS 3A98A 1YJWT 4BB7A 4J6WA 4J9GA 4JJCA 4JJBA 4PJNA 3C94A 4Z8AA 2LCCA 3HHTB 2YUPA 4C0DB 1MV0B 4GY5A 3DKMA 4F16A 4OMOA 2RNAA 4M77A 8ATCB 1JBMA 2Y90A 2CS7A 1W70A 1YHQA 1VQOA 2M9UA 1KD1U 1VQMA 4ATOA 3CD6T 2ED1A 2OTLT 1BI0A 2LT1A 5LJ3h 2BZXA 5GAOp 3CCRQ 3JCMP 5GAOl 1QVFP 4R56A 5GANj 4KGVB 5CVIA 1VQ6T 1X75C 5IHIA 4FU6A 3CPWP 4J9CA 4FCYA 1Q7YR 2E4HA 1YJNQ 2HDAA 1B3QA 2EYXA 4E7JA 1GFDA 2O2OA 2CH4W 3E19A 2EBPA 4FYYB 1KQSP 4C0GA 2C0OA 1Y7XA 2JUFA 5KYWB 1NLOC 2BZ8A 2A7YA 5C0MA 2CZ0B 3OYLA 4KGXB 1I81A 2E3IA 2QQ9A 2XD0A 1Y57A 5HCKA 2CUBA 2YSQA 4XAXB 3EFOB 5HK0A 4IURA 1OI1A 3UA7A 2D8JA 1VQPT 4C92E 1N8RC 3MEVA 2VWFA 2ZAEA 5LJ3g 1QW1A 3EG3A 2YT6A 4PJOE 3TU4K 1SF9A 3VS6A 2V26A 3VRYA 2X4JA 4PL6A 2RHIA 2EQMA 1YHQQ 1VQOQ 2NUPA 1RI0A 3S3OA 2WSFE 2E64A 1VQMQ 2L5QA 4WCIA 2DETA 2XI9A 3GF5A 1MMDA 2FRYA 4QT7A 1LNXA 2O9SA 4IIMA 4KH0B 3EG9A 1M4ZA 1T0JA 1EX4A 4PJMA 2HKQB 3I5SA 5CKBA 1RLPC 3JCMh 1MMGA 1D1AA 1C1AA 1C0MA 1M2VA 3DB3A 5CR2A 2DJZA 3NFCA 1KD1R 2FRWA 2E10A 6AT1B 3JCMX 2MAMA 4C8QG 2DO3A 1PM3A 3CCVT 1O9SA 4LDVA 2DK3A 5GAMg 2CGHA 4M7AG 3I9QA 1BU1A 2QDYB 1PKSA 2RM4A 4J9IA 2LX9A 3E1SA 3SFMA 3ER0A 2JXBA 3QYGB 4J6XA 4BE0A 3NTKA 2VXFA 2LJ3A 1QVGA 2VUBA 1LOJA 1NYFA 4F7UG 4M7DE 2I0NA 1UGRB 2RJDA 5GANh 3VUBA 4M75E 4M78E 2FPDA 3G4SA 2CP3A 4KBMB 3CCUA 1YIJT 4F14A 3RESA 5GJVB 3C12A 3HL8A 4F17A 3JCMg 3OBWA 3ZBDA 3OW2A 3VV0A 2EIFA 3EGDA 3M0PA 3FEOA 4RTVA 1X2QA 3SHWA 4OMPA 5A2QE 4IUVA 3C0CA 1IXDA 2O4XB 3RERA 3QJYA 4BDYA 1NEGA 2ABLA 1VQ4T 1WJRA 3JB9D 1Q7YC 3MPUB 4OF1A 1D0YA 1TS9A 3JCMc 2J06A 4C8QF 2CZ1B 2E5QA 3CCLQ 4XTUA 3EFRA 3J7AF 1YJ9Q 1C6VX 2RK1A 3PVLA 3QPHA 1IHWA 5LJ5j 2DXUA 4M7AF 3EFSA 1QCFA 1VQLT 1W1FA 3CCQT 2RJFA 2DTHA 2KSSA 4C5EA 2DE0X 2BE9B 2MMPA 3PVQA 2BTTA 5GANg 4EIKA 2E6NA 4F7UF 4HT8A 2YRDA 2FB7A 4IUUA 4E6RA 3MJXA 5KYXB 2VKNA 3EGXA 1AOJA 2CP6A 2XG8D 2F69A 1G3WA 4YTLA 1YBYA 4MZMA 3VS3A 2KT1A 2KRSA 3E9FA 3NGPA 2JW4A 4LD6A 5L8RE 1OZ3A 3DLMA 3JCMV 1X6BA 2NUTA 5GAN2 3FDRA 2E65A 4BE2A 4C5HA 2KYBA 3G4SQ 2LQKA 3CCUQ 1M90C 3UF4A 1EZZB 1K9MC 2KGTA 2RJEA 2QTXA 2COZA 3HSBA 1FYNA 3M5AA 2R5MA 4RTZA 2PUOB 4OMQA 1RAEB 2OI3A 1QKWA 3LYIA 5KE3A 3SWNB 3AT1B 1BIAA 4HCBA 4EMKC 5GAN5 1ZA2B 2IVWA 3RIRA 4QQGA 2CZ6B 3SEMA 2DXCA 1WXTA 3CCST 2VVKA 2DBMA 2QEXA 3H41A 4ZN1A 3L2QA 1T0HA 2RI5A 2J6FA 1QVFA 1AZGB 2EYWA 1PC0A 2DD5A 1WDXA 4E7HA 1QWFA 1PSFA 2D9TA 3NPFA 5GMKl 1OZ2A 5I22A 3NTHA 5LJ3d 1RL2A 4JUVA 5EC7A 3H6ZA 1UB4A 2L89A 4B9XA 5GAN7 3MO8A 3QZ9B 4A54A 3EHQA 4PJLA 2CP7A 2DF6A 2JN0A 2JNGA 2Y4YA 3QDRB 1WXUA 1V1CA 3S3MA 1EFNA 1WQ7A 2PQWA 3X28B 4L5GA 3VYGA 3G7ZA 1M27C 2LRQA 4N4GA 4KUDK 1TUCA 1PWTA 3LGFA 1QWEA 3FLGA 1N8RU 4C8QA 1I07A 1NPRA 2GFUA 1UFFA 1SG5A 1OYXA 1VUBA 5LL6S 4X1VA 4M7AA 5GAN8 3S6WA 3X20B 5FW9A 3OS2A 5IH2A 1I1JA 4L6V5 3RMSA 2DIGA 4ZGDB 5LJ3f 3I55T 1I8FA 1GCQC 1VQ9A 1KIKA 5EG2A 1YFNA 2EQIA 2P84A 4D8KA 2RQWA 4F7UA 1VQ8A 3OQ5A 5LJ5h 3QWYA 2R58A 3R6NA 7AT1B 3G6ET 4JZ4A 5GAMd 3M53A 1X43A 2AT1B 1D3BB 2B8AA 3EH2A 1EIFA 1YI2Q 2HAXA 1VQ5Q 5CKHA 2DA9A 5DY9A 4PFOA 2CREA 2EYQA 1QVGS 3LW5E 1S72T 2ZPGB 2HKNA 2E70A 1MUZA 3REBB 2EGAA 5GMKj 4IUTA 3GPLA 1Q82R 1CSKA 3KFVA 3G71A 1BBZA 1LVKA 1TUDA 5KYYA 5CK9A 2XU8A 5CO7A 5CQYA 3JV3A 3OW2S 1UE9A 1A0NB 2DXBA 2DTOA 3JCMd 1PCXA 4PLLA 1RI9A 3CCMQ 2DL8A 1GXIE 3VJPA 4MMKA 5GAMf 5GAN4 1RUWA 1GRIA 3PE0A 2K7AA 1K1ZA 4DOVA 1I5LA 1PRLC 2YRVA 1VQNT 5LJ5g 1RAIB 4J8OA 2K4YA 2IIMA 3CQTA 2CUDA 5CCAA 4HA8A 4TVRA 4LDUA 1ARKA 2K3BA 4KULA 3WVEB 4EPCA 1QMCA 2WACA 2OTJT 2QXFA 3MCAB 5HK3A 1KG1A 1Q7YU 5IXBA 4JRKA 2A08A 2EQKA 1KJWA 2YDLA 2ZZDA 3VKIA 5GANd 1N8RR 4VUBA 5GAOq 4LDWA 3M58A 4Z02A 1VQKA 2OTLA 3V8JA 2QGGA 3OMGA 3PNWC 4QVCA 3A8GB 2FVUA 3M0TA 1RAAB 1W4SA 3JB9I 3M54A 4M77D 2LCLA 3OYDA 3NTIA 2HSPA 2MF2A 3DLLA 2KBTA 4FW1A 3CBPA 3C95A 4A4GA 1JJ2P 1M1GA 1AT1B 3RDVA 3G71Q 2JS0A 2EYZA 2GBQA 2R57A 4PFZA 1K0XA 4JPBW 2EFIA 2RQTA 2W0ZA 4AFSC 3L2WA 2LTOA 4HT9A 3HTRA 2RHUA 2ZPEB 2DZ9A 4C92G 3CMAT 1ZSZA 2RO0A 2LQWA 2NUPB 4KUIA 1PD1A 1R0BG 2EQJA 4PJOG 4M4ZA 1ZSZC 2PUKB 3CC2T 1M90U 4XU1A 2CT3A 3EG9B 1Y07A 2ESWA 1K9MU 2R5AA 3EG0A 1QVFS 2C0TA 1OU8A 5LJ3e 2DIQA 2H3EB 3CC7Q 4HVUA 2MYSA 1Y96A 1UJ0A 1IRXA 3FJ5A 1WHJA 2C0IA 1KSWA 1O75A 1Z9ZA 5GMKh 1YWOA 4DQ2A 1YCYA 1YJWQ 1M2VB 3AHUA 1OU9A 3OYHA 1WHLA 4JRPA 3CPWS 2FZKB 3OYCA 2A37A 3RKXA 3E9GA 1WIEA 1SEMA 5GAOr 3C4SA 5IXFA 1QVPA 2A28A 5DM7R 1KQSS 3QO3A 4M77C 1G3YA 2JTEA 1Q82C 2JJ9A 5J26A 2FL7A 2LX7A 5M9OA 2PVGB 3O8VA 4X9DA 4FYWB 4LXCA 2VC8A 3P8BB 3SB2A 1VQKQ 2OTLQ 4FW2A 3TEEA 1NBEB 2DEQA 2VASA 3M0SA 2MPXC 4A4HA 3JB9J 3VS7A 2RPNA 2K3YA 4C92F 1VA7A 4NL3A 4AMCA 1UJYA 2RN8A 3OS1A 3CCRT 4CC3A 2FYKA 1UHFA 3LWHA 1VQ6Q 1AWOA 2GQIA 3GOXA 1I4K1 4PJOF 1IZ6A 2ZPFB 1MHNA 3X24B 2K79A 3H8ZA 2COWA 2M0OA 2XIDA 3LX7A 5GAMe 4AFUC 4M7DG 2J6OA 4M75G 2QQSA 4M78G 4RMOA 1BI1A 4NL2A 1UGPB 2CSIA 3CCVA 5GMKi 1YCSB 1YJNT 4HCZA 1OX8A 4LN2A 2FPFA 2QTVA 5KCHA 2X3WD 3JB9H 2VGMA 2KRNA 3VS4A 1NM7A 2GF7A 1TU0B 3N5BB 4IUQA 3MP6A 2YWWA 2EGCA 2PVDB 1WYXA 2KT8A 3JCMe 3ULRB 1TH7A 8AT1B 1QP2A 5AT1B 1PG5B 1BKBA 2D8HA 3MP8A 3QXEB 1QP3A 4A53A 1B7TA 1PNJA 3MP1A 2LDMA 1WA7A 3CC4A 1ZX6A 4J9DA 5CKEA 3KXTA 1WNLA 1G3SA 5FROA 1J3TA 1B34A 2LJ1A 3PFSA 1M90R 4EDUA 1UGVA 3L2RA 2LZ6B 5LJ5d 2K6DA 1K9MR 3PT9A 1YHQT 1VQOT 2JOYA 3I35A 3CCLA 2BKDN 1RACB 4M7DF 4FIBA 1K73U 3EG1A 1YJ9A 4BDZA 4M75F 4M78F 2NUTB 4A4FA 2KE9A 4FYVB 2Y4XA 3L2ZA 1R0CB 2YLCA 4J9BA 5KH6A 5GANe 4LNPA 1U1TA 2X35A 2AIRB 3OBYA 1YITT 4PJJA 3INZA 1FMWA 4EMKB 2X3XD 1ABQA 4X34A 3OSVA 3L2UA 3CCVQ 1D09B 1OQKA 4C92A 2FG0A 4N0AA 1YP5A 2BIVA 1D1CA 1U3OA 1U06A 1M1KC 3REAB 4PJOA 5GMKm 1XQHA 3LWIA 2LMJA 1QKXA 1KK7A 3JB9F 5HY6A 2E12A 4X9CA 4XQ3A 3MEUA 5KE2A 2QA4T 3QIIA 4OGEA 3A8LB 5IN1A 3A1PA 3T9NA 1YIJQ 1UECA 4AG1C 2A0FB 2CYZB 4A4EA 1BI2A 1KHIA 4UC4A 5FWBA 9ATCB 3V7CA 1ACMB 1VYUA 2JZ2A 3CC4Q 3UT1A 4IKFA 5I21A 2RQVA 4JS5A 4C8QB 2HL5C 3JCMW 2YHTA 1JQQA 2HQEA 2D0NA 3M55A 3FJPA 4M7AB 3CCSA 4JRQA 2KDSA 2EPDA 1ZBJA 1WFWA 2FZCB 4J5YA 5A0LA 1H8KA 3CBOA 2COYA 3I56A 4DEXA 2O9VA 2MI6A 4F7UB 4E7SA 2YXYA 4O6JA 1M5Q1 4XTWA 1JJ2A 1BYMA 1XNIA 3EFOA 1Z9QA 1VQLQ 3CCQQ 3TSWA 2M02A 1RABB 1W6XA 2JM9A 4AFZC 5D6WA 1WZOA 2YUQA 3PMIA 3CEYA 4M7DA 4MDXA 1E6HA 4E47A 2M1HA 4M75A 4M78A 1KC8C 3QG1A 1M1FA 3V8KA 1JO8A 2QYZA 1K73R 5I11A 2XDPA 3GP8A 2GTOA 3D7SB 3DB4A 1N27A 3H0FA 4GBQA 2KVQG 4BI8B 2RA2A 2Z0WA 1HD3A 2VV5A 4LD9K 1Q82U 4R55A 2MK5A 5KYYB 4J7FA 2L3QA 4C8QD 1YNZA 2VXEA 4BY6C 1X27A 2YRCA 3QDFA 1JU5C 2HZYA 3OYBA 4M7AD 2DPPB 3FB9A 1XJWB 3G4ST 1QCOA 1ZBXA 1YI2A 1X69A 3CCUT 1RAFB 1Q81C 1VQ5A 4J7IA 2P0PA 2B86A 1FMKA 2OAWA 1VQ7A 3OYYA 4LE9A 4QVZA 2EYYA 3UWNA 1M3CA 3TCJA 1UDLA 2HMAA 1UTIA 3QWXX 1NG2A 2G3RA 3CCSQ 1IGQA 2EJGA 2JVVA 4Y28E 3V8LA 1HSQA 3I56Q 4QKUA 2XDDA 3H9NA 4CC7A 2AZVA 1N5ZA 3CCMA 4C5GA 4XTVA 3HFOA 4GLKA 1I5OB 3M0RA 4J83A 5LJ5e 2A3LA 2FEIA 3CXCA 2DAQA 1JXMA 1UG1A 2YUOA 1VYTA 3PTAA 2OAUA 2KR3A 4RTYA 4J9HA 4C8QC 1M2OA 2EW3A 5I2SA 1CKAA 1RADB 1X6OA 4PKCC 3QYHB 2RH2A 1NPPA 4M7AC 1E6GA 2M51A 2E3HA 2O4XA 2V8JA 2LCSA 2DX1A 2FO0A 1AVZC 2DVJA 2F1LA 2X51A 1MNEA 2JT4A 3CMET 2J05A 4XK8E 3VS0A 2VGNA 4HVWA 2RQRA 2EQUA 3CCJA 3MKDA 1ZSZB 1PHTA 2DXTA 5KYUA 2OJ2A 4C0FA 1MV3A 1WI7A 1ZSGA 2GNCA 2EKOA 2DILA 1VQ7Q 2HSEB 2L8DA 2CZ7B 3OYKA 2RI3A 3RKWA 4QQ6A 2DNUA 1NYGA 2K5IA 2L3RA 3FRNA 2AK5A 3HKSA 1R77A 1Y96B 2JS2A 2XDBA 5GAOn 2ENMA 2K9GA 4FM4B 2AHJB 3RUXA 3CCET 2A36A 2QASA 3OYEA 1M9SA 1Y71A 3TVTA 3ME9A 4CI0C 5KYXA 4MZTA 4M77B 2QEXT 5D6YA 2XKOC 3OS5A 1M1KU 2H8HA 4BUGA 4HXJA 1K73C 2RJCA 4MMLA 3LLRA 1T3LA 3QBYA 4J6YA 5I2MA 1TSFA 2KY9A 4PNOA 1H641 4XTYA 4AFQC 1LPLA 1VQNQ 4FSXA 2DL4A 3CC7A 4HVVA 3M4GA 3FIFA 1VOMA 4ZGJB 4OB2B 1BCOA 2JMAA 1YJWA 5C6SA 1WJSA 1V76A 2HQXA 1JJ2S 3IQLA 2XICA 3JCMf 2KRMA 1FMVA 2F2VA 1ABOA 1YWPA 1IREB 4OMMA 1WHKA 3RBBB 1OEBA 1GBQA 3CD6A 1X6GA 1VQ9T 3CCJQ 1WX6A 2KAFA 4NS5A 1VQ8T 4QQDA 2RHZA 2WSEE 2F5KA 1BCMA 1PKTA 2AKKA 1M3BA 2HL3A 4JDSA 1H3HA 1RAGB 2X4WA 2GQVA 1IGUA 2KXCA 2YUNA 3EHRA 3BY7A 1TUGB 1H92A 3ZEHA 1VQ6A 4KGZB 4E7IA 3UATA 3GNFB 2VB6A 2NLUA 4JLIA 4M77E 3H0IA 1KC8U 2DRMA 3J80E 1PSEA 2DMOA 2KEAA 4R0KA 1NZ9A 4OP0A 5GMKe 5GANf 3UA6A 2ZCFB 1AEYA 4RG8A 2L2PA 2XHCA 2P4RA 1W2BP 2DZCA 4FL6A 4HKEA 1NJIC 1B34B 5L23A 4E7KA 2D0QB 2KQWA 3Q1JA 4Z89A 3GLXA 2IG0A 1VIFA 4D8DA 3CC2Q 1HYOA 2PZ1A 1K8AC 1NEBA 4ORZA 1VIEA 4KT0E 2F2WA 3VS5A 5A0GA 1VQPA 2EAYA 2VYTA 4JJDA 1Q81U 3OYAA 4OB0B 4LUEA 5A0DA 2LP5A 3V7SA 1U1SA 1M1KR 1TXQA 4RTXA 3E2UA 1D1BA 2KXDA 1HXDA 4QW2A 4IIOA 1BI3A 2K3XA 2W10A 1OX9A 3JSCA 3V7RA 1K4US 1OULA 4C0ZA 2GTJA 2K57A 2MOXA 4ZTFA 2QK0A 3CD6Q 4XU0A
chains in the Genus database with same CATH topology
1ABQA 1OV3A 1FYNA 4RTZA 1OPLA 2G6FX 2DRKA 4OMQA 1K9AA 1M8MA 2FG0A 2OI3A 3NHNA 1QKWA 2RMOA 1YP5A 1U3OA 1U06A 1CKBA 2K2MA 1M3AA 3REAB 4LUDA 3SEMA 1WXTA 1ZUKA 2VVKA 2LMJA 2RF0A 2DBMA 1GBRA 1QKXA 3U23A 2DLPA 3H41A 3RNJA 1T0HA 2E5KA 1I0CA 2J6FA 1UUEA 4FSSA 1AZGB 2EYWA 1T3SA 1SSHA 4A63B 1WDXA 1QWFA 3ZL7C 4RTTA 2L0AA 3NPFA 5I22A 5IHKA 1JXOA 3M0QA 5EC7A 1UECA 5FWCA 4AG1C 1E7OA 2PNIA 3EHQA 2DF6A 2HEQA 3O5ZA 5FWBA 1S1NA 1VYUA 1WXUA 1V1CA 4GLMA 1AWJA 1EFNA 1ZUUA 2RQVA 2V1QA 1M27C 3M0UA 1TUCA 1NLPC 1ZUYA 4OMLA 4RTWA 3VS2A 1PWTA 1QWEA 1JQQA 1I07A 3VS1A 2D0NA 2ECZA 5ECAA 2JMCA 1UFFA 4X1VA 4J9EA 3EG2A 5FW9A 2EPDA 5IH2A 1I1JA 1OOTA 1ZBJA 1WFWA 2LJ0A 1H8KA 1AD5A 4DEXA 2O9VA 1UHCA 1GCQC 1SPKA 1KIKA 4D8KA 2EQIA 2RQWA 2BZYA 1QLYA 1M30A 1Z9QA 3I5RA 3H0HA 3TSWA 4JZ3A 1PRMC 3QWYA 1SHGA 1W6XA 2JM9A 4AFZC 2MIOA 2DL7A 2YUQA 4KRTA 1BK2A 3R6NA 1E6HA 4ESRA 3VRZA 2KROA 4JZ4A 4J9FA 3GBQA 1X43A 1YN8A 2HCKA 2QDLA 1JO8A 2DA9A 5I11A 2GTOA 2GGRA 2CREA 1SRLA 3H0FA 4GBQA 1TG0A 1MUZA 2LNHB 3REBB 2EGAA 1G2BA 1HD3A 1LCKA 1CSKA 4HCKA 3KFVA 1BBZA 2L3QA 1YNZA 1TUDA 4Z88A 3A98A 1X27A 4J9GA 4JJCA 4JJBA 1JU5C 4DEYA 4Z8AA 1SRMA 2DYBA 3JV3A 4Y92A 1UE9A 1A0NB 2YUPA 2F2XA 1MV0B 2SEMA 1RI9A 2DL8A 1AWXA 4F16A 1X69A 4OMOA 2RNAA 2DJQA 1GFCA 1W70A 2B86A 1FMKA 1RUWA 2OAWA 1GRIA 3PE0A 2K7AA 4LE9A 1K1ZA 2EYYA 1PRLC 1M3CA 1UDLA 2ED1A 1UTIA 3QWXX 1NG2A 2CH4A 2BZXA 2IIMA 1VYVA 3CQTA 2CUDA 2O88A 2J7IA 2CSQA 2EGEA 1ARKA 4RTUA 2K3BA 1HSQA 4CC7A 2AZVA 1N5ZA 1XOVA 5IHIA 2CT4A 4J9CA 3M0RA 2HDAA 5IXBA 1B3QA 2ED0A 2EYXA 2A08A 4CC2A 1SHFA 1KJWA 2FEIA 2YDLA 2ROLA 1GFDA 2O2OA 2CH4W 2EBPA 1K76A 1U5SA 1JXMA 1UG1A 2C0OA 2DL3A 2YUOA 4ZNXA 2DM1A 1VYTA 3LH5A 2KR3A 4RTYA 1NLOC 1RLQC 2BZ8A 4J9HA 2EW3A 1CKAA 2EKHA 3M0TA 1X2KA 1Y57A 5HCKA 1E6GA 2CUBA 2M51A 2YSQA 2HSPA 2KBTA 2LCSA 2DX1A 2FO0A 1AVZC 2DVJA 3UA7A 2D8JA 2JT4A 2J05A 2VWFA 2M0YA 3VS0A 2JS0A 2EYZA 2GBQA 4HVWA 2RQRA 3EG3A 1K0XA 4JPBW 2RQTA 2YT6A 2W0ZA 4AFSC 2LQNA 1PHTA 3VS6A 3VRYA 2LQWA 2OJ2A 2GNCA 1MV3A 1WI7A 1ZSGA 2DILA 2L3PA 4M4ZA 4WCIA 2CT3A 1NYGA 2DNUA 1AWWA 2HBWA 2ESWA 2V1RA 2FRYA 4QT7A 2O9SA 4IIMA 2AK5A 3EG0A 2C0TA 2JS2A 1GL5A 1AZEA 1T0JA 4HVUA 2ENMA 1UJ0A 2K9GA 3I5SA 1RLPC 3FJ5A 2C0IA 2A36A 1KSWA 1Z9ZA 3TVTA 1G83A 1YWOA 4RUGA 2H8HA 2A37A 4HXJA 1WIEA 1SEMA 1KFZA 1T3LA 5IXFA 2A28A 4OMNA 2FRWA 2JTEA 4AFQC 2LX7A 2DL4A 3THKA 4HVVA 3I9QA 1BU1A 1PKSA 2AKLA 3M0SA 4J9IA 2JXBA 3VS7A 1HJDA 2JMAA 2RPNA 1VA7A 2NUZA 2LJ3A 1UJYA 1BB9A 2RN8A 1NYFA 3IQLA 4CC3A 1UHFA 2I0NA 2KRMA 2F2VA 1AWOA 2GQIA 2FPDA 1ABOA 2SRCA 1YWPA 4F14A 4OMMA 5GJVB 3RBBB 1OEBA 1GBQA 2K79A 2ROTA 4AFUC 1X6GA 4F17A 2J6OA 2DBKA 4CC4B 2CSIA 1WX6A 3M0PA 1YCSB 4RTVA 1PKTA 1X2QA 3SHWA 2AKKA 4OMPA 2EVRA 1M3BA 4AG2C 4LN2A 3C0CA 1H3HA 2FPFA 2KYMA 2X3WD 1IO6A 2KXCA 2NWMA 2RQUA 2YUNA 3EHRA 1H92A 1NEGA 2ABLA 2KRNA 3VS4A 2DL5A 1NM7A 2J6KA 3UATA 2EGCA 2J06A 3H0IA 1GCQA 1B07A 1WYXA 2DRMA 2KT8A 2L3SA 5IHNA 2DMOA 2KEAA 4R0KA 3ULRB 2JM8A 3PVLA 2MCNA 3UA6A 2PTKA 1AEYA 2L2PA 2D8HA 1QCFA 2P4RA 1PNJA 1W1FA 1WA7A 3TSZA 3EGUA 1ZX6A 4J9DA 2DE0X 5L23A 3PVQA 2AZSA 2BTTA 2CDTA 4Z89A 1J3TA 1ZLMA 4EIKA 1WLPB 1K0SA 2LJ1A 2KNBB 2FPEA 1UGVA 2O31A 4D8DA 2PZ1A 2LZ6B 2K6DA 1NEBA 4ORZA 2XMFA 4E6RA 3I35A 1Y0MA 2F2WA 2VKNA 1AOJA 3VS5A 3EG1A 1GCPA 3NMZC 4JJDA 2D1XA 1WXBA 3VS3A 2KE9A 4LUEA 2KT1A 2KRSA 5GJWB 3NGPA 2JW4A 2LP5A 1X6BA 4J9BA 4RTXA 2KXDA 1OPKA 4IIOA 4K11A 4LNPA 2KYBA 2W10A 3UF4A 1K4US 2KGTA 1JEGA 2GTJA 2MOXA 2X3XD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ABQ A;  1OV3 A;  1FYN A;  4RTZ A;  1OPL A;  2G6F X;  2DRK A;  4OMQ A;  1K9A A;  1M8M A;  2FG0 A;  2OI3 A;  3NHN A;  1QKW A;  2RMO A;  1YP5 A;  1U3O A;  1U06 A;  1CKB A;  2K2M A;  1M3A A;  3REA B;  4LUD A;  3SEM A;  1WXT A;  1ZUK A;  2VVK A;  2LMJ A;  2RF0 A;  2DBM A;  1GBR A;  1QKX A;  3U23 A;  2DLP A;  3H41 A;  3RNJ A;  1T0H A;  2E5K A;  1I0C A;  2J6F A;  1UUE A;  4FSS A;  1AZG B;  2EYW A;  1T3S A;  1SSH A;  4A63 B;  1WDX A;  1QWF A;  3ZL7 C;  4RTT A;  2L0A A;  3NPF A;  5I22 A;  5IHK A;  1JXO A;  3M0Q A;  5EC7 A;  1UEC A;  5FWC A;  4AG1 C;  1E7O A;  2PNI A;  3EHQ A;  2DF6 A;  2HEQ A;  3O5Z A;  5FWB A;  1S1N A;  1VYU A;  1WXU A;  1V1C A;  4GLM A;  1AWJ A;  1EFN A;  1ZUU A;  2RQV A;  2V1Q A;  1M27 C;  3M0U A;  1TUC A;  1NLP C;  1ZUY A;  4OML A;  4RTW A;  3VS2 A;  1PWT A;  1QWE A;  1JQQ A;  1I07 A;  3VS1 A;  2D0N A;  2ECZ A;  5ECA A;  2JMC A;  1UFF A;  4X1V A;  4J9E A;  3EG2 A;  5FW9 A;  2EPD A;  5IH2 A;  1I1J A;  1OOT A;  1ZBJ A;  1WFW A;  2LJ0 A;  1H8K A;  1AD5 A;  4DEX A;  2O9V A;  1UHC A;  1GCQ C;  1SPK A;  1KIK A;  4D8K A;  2EQI A;  2RQW A;  2BZY A;  1QLY A;  1M30 A;  1Z9Q A;  3I5R A;  3H0H A;  3TSW A;  4JZ3 A;  1PRM C;  3QWY A;  1SHG A;  1W6X A;  2JM9 A;  4AFZ C;  2MIO A;  2DL7 A;  2YUQ A;  4KRT A;  1BK2 A;  3R6N A;  1E6H A;  4ESR A;  3VRZ A;  2KRO A;  4JZ4 A;  4J9F A;  3GBQ A;  1X43 A;  1YN8 A;  2HCK A;  2QDL A;  1JO8 A;  2DA9 A;  5I11 A;  2GTO A;  2GGR A;  2CRE A;  1SRL A;  3H0F A;  4GBQ A;  1TG0 A;  1MUZ A;  2LNH B;  3REB B;  2EGA A;  1G2B A;  1HD3 A;  1LCK A;  1CSK A;  4HCK A;  3KFV A;  1BBZ A;  2L3Q A;  1YNZ A;  1TUD A;  4Z88 A;  3A98 A;  1X27 A;  4J9G A;  4JJC A;  4JJB A;  1JU5 C;  4DEY A;  4Z8A A;  1SRM A;  2DYB A;  3JV3 A;  4Y92 A;  1UE9 A;  1A0N B;  2YUP A;  2F2X A;  1MV0 B;  2SEM A;  1RI9 A;  2DL8 A;  1AWX A;  4F16 A;  1X69 A;  4OMO A;  2RNA A;  2DJQ A;  1GFC A;  1W70 A;  2B86 A;  1FMK A;  1RUW A;  2OAW A;  1GRI A;  3PE0 A;  2K7A A;  4LE9 A;  1K1Z A;  2EYY A;  1PRL C;  1M3C A;  1UDL A;  2ED1 A;  1UTI A;  3QWX X;  1NG2 A;  2CH4 A;  2BZX A;  2IIM A;  1VYV A;  3CQT A;  2CUD A;  2O88 A;  2J7I A;  2CSQ A;  2EGE A;  1ARK A;  4RTU A;  2K3B A;  1HSQ A;  4CC7 A;  2AZV A;  1N5Z A;  1XOV A;  5IHI A;  2CT4 A;  4J9C A;  3M0R A;  2HDA A;  5IXB A;  1B3Q A;  2ED0 A;  2EYX A;  2A08 A;  4CC2 A;  1SHF A;  1KJW A;  2FEI A;  2YDL A;  2ROL A;  1GFD A;  2O2O A;  2CH4 W;  2EBP A;  1K76 A;  1U5S A;  1JXM A;  1UG1 A;  2C0O A;  2DL3 A;  2YUO A;  4ZNX A;  2DM1 A;  1VYT A;  3LH5 A;  2KR3 A;  4RTY A;  1NLO C;  1RLQ C;  2BZ8 A;  4J9H A;  2EW3 A;  1CKA A;  2EKH A;  3M0T A;  1X2K A;  1Y57 A;  5HCK A;  1E6G A;  2CUB A;  2M51 A;  2YSQ A;  2HSP A;  2KBT A;  2LCS A;  2DX1 A;  2FO0 A;  1AVZ C;  2DVJ A;  3UA7 A;  2D8J A;  2JT4 A;  2J05 A;  2VWF A;  2M0Y A;  3VS0 A;  2JS0 A;  2EYZ A;  2GBQ A;  4HVW A;  2RQR A;  3EG3 A;  1K0X A;  4JPB W;  2RQT A;  2YT6 A;  2W0Z A;  4AFS C;  2LQN A;  1PHT A;  3VS6 A;  3VRY A;  2LQW A;  2OJ2 A;  2GNC A;  1MV3 A;  1WI7 A;  1ZSG A;  2DIL A;  2L3P A;  4M4Z A;  4WCI A;  2CT3 A;  1NYG A;  2DNU A;  1AWW A;  2HBW A;  2ESW A;  2V1R A;  2FRY A;  4QT7 A;  2O9S A;  4IIM A;  2AK5 A;  3EG0 A;  2C0T A;  2JS2 A;  1GL5 A;  1AZE A;  1T0J A;  4HVU A;  2ENM A;  1UJ0 A;  2K9G A;  3I5S A;  1RLP C;  3FJ5 A;  2C0I A;  2A36 A;  1KSW A;  1Z9Z A;  3TVT A;  1G83 A;  1YWO A;  4RUG A;  2H8H A;  2A37 A;  4HXJ A;  1WIE A;  1SEM A;  1KFZ A;  1T3L A;  5IXF A;  2A28 A;  4OMN A;  2FRW A;  2JTE A;  4AFQ C;  2LX7 A;  2DL4 A;  3THK A;  4HVV A;  3I9Q A;  1BU1 A;  1PKS A;  2AKL A;  3M0S A;  4J9I A;  2JXB A;  3VS7 A;  1HJD A;  2JMA A;  2RPN A;  1VA7 A;  2NUZ A;  2LJ3 A;  1UJY A;  1BB9 A;  2RN8 A;  1NYF A;  3IQL A;  4CC3 A;  1UHF A;  2I0N A;  2KRM A;  2F2V A;  1AWO A;  2GQI A;  2FPD A;  1ABO A;  2SRC A;  1YWP A;  4F14 A;  4OMM A;  5GJV B;  3RBB B;  1OEB A;  1GBQ A;  2K79 A;  2ROT A;  4AFU C;  1X6G A;  4F17 A;  2J6O A;  2DBK A;  4CC4 B;  2CSI A;  1WX6 A;  3M0P A;  1YCS B;  4RTV A;  1PKT A;  1X2Q A;  3SHW A;  2AKK A;  4OMP A;  2EVR A;  1M3B A;  4AG2 C;  4LN2 A;  3C0C A;  1H3H A;  2FPF A;  2KYM A;  2X3W D;  1IO6 A;  2KXC A;  2NWM A;  2RQU A;  2YUN A;  3EHR A;  1H92 A;  1NEG A;  2ABL A;  2KRN A;  3VS4 A;  2DL5 A;  1NM7 A;  2J6K A;  3UAT A;  2EGC A;  2J06 A;  3H0I A;  1GCQ A;  1B07 A;  1WYX A;  2DRM A;  2KT8 A;  2L3S A;  5IHN A;  2DMO A;  2KEA A;  4R0K A;  3ULR B;  2JM8 A;  3PVL A;  2MCN A;  3UA6 A;  2PTK A;  1AEY A;  2L2P A;  2D8H A;  1QCF A;  2P4R A;  1PNJ A;  1W1F A;  1WA7 A;  3TSZ A;  3EGU A;  1ZX6 A;  4J9D A;  2DE0 X;  5L23 A;  3PVQ A;  2AZS A;  2BTT A;  2CDT A;  4Z89 A;  1J3T A;  1ZLM A;  4EIK A;  1WLP B;  1K0S A;  2LJ1 A;  2KNB B;  2FPE A;  1UGV A;  2O31 A;  4D8D A;  2PZ1 A;  2LZ6 B;  2K6D A;  1NEB A;  4ORZ A;  2XMF A;  4E6R A;  3I35 A;  1Y0M A;  2F2W A;  2VKN A;  1AOJ A;  3VS5 A;  3EG1 A;  1GCP A;  3NMZ C;  4JJD A;  2D1X A;  1WXB A;  3VS3 A;  2KE9 A;  4LUE A;  2KT1 A;  2KRS A;  5GJW B;  3NGP A;  2JW4 A;  2LP5 A;  1X6B A;  4J9B A;  4RTX A;  2KXD A;  1OPK A;  4IIO A;  4K11 A;  4LNP A;  2KYB A;  2W10 A;  3UF4 A;  1K4U S;  2KGT A;  1JEG A;  2GTJ A;  2MOX A;  2X3X D; 
#chains in the Genus database with same CATH topology
 4C92 B;  1OV3 A;  2C06 A;  2RI2 A;  4PLI A;  3KBG A;  4PJO B;  1IB8 A;  4BAC A;  3M57 A;  3QUI A;  2K2M A;  2E41 A;  4MDW A;  4BI4 A;  1TOV A;  4LUD A;  4WF2 A;  3UPU A;  1ZUK A;  1VQK T;  4PK4 A;  2RF0 A;  2BE7 D;  4BI3 A;  3U23 A;  2DLP A;  4ZTJ A;  2E5K A;  3A8H B;  1MND A;  1WHH A;  4JS4 A;  1KQ2 A;  3MEA A;  5IHK A;  3M0Q A;  3EGD B;  4EMH A;  1YIT A;  5FWC A;  3CXC P;  3EAE A;  4E7Z A;  1E7O A;  2RHX A;  4WTO B;  5CKD A;  5J3B A;  2RD1 A;  1MGQ A;  3OYN A;  1S1N A;  3JCM J;  4GLM A;  4DA4 A;  1AWJ A;  3FC3 A;  2V1Q A;  1WPY A;  2CP0 A;  1ZUY A;  4OML A;  2EWN A;  3VS2 A;  1MMA A;  4JLG A;  1WJQ A;  3VS1 A;  4MZP A;  5ECA A;  4DBF A;  2JMC A;  1H3Z A;  3L2V A;  5FLX E;  2ATC B;  2QA4 A;  2LVM A;  4DBR A;  1KC8 R;  1YIJ A;  1VQP Q;  2LJ0 A;  3UDC A;  4C92 D;  3OA6 A;  3OYF A;  2HBP A;  1F1B B;  3WXM B;  1FXX A;  5FU6 B;  1Q86 R;  3GNG A;  4PJO D;  2BZY A;  3JB9 G;  2MWO A;  3I5R A;  1ZQ1 A;  4JZ3 A;  3OYM A;  1V29 B;  2I2L A;  4M7D B;  2MIO A;  2DL7 A;  5GAM h;  4M75 B;  4A4K A;  2WSC E;  4M78 B;  4DOW A;  4XU2 A;  4E2F B;  3EGX B;  1PD0 A;  4IUP A;  1VQ4 A;  2EJF A;  2KRO A;  4J9F A;  3GBQ A;  3A5Z B;  2JTF A;  2RHY A;  1VQM T;  5KYN A;  1YN8 A;  2HCK A;  2GGR A;  1Q81 R;  1TG0 A;  4BY6 B;  2LNH B;  2H3J A;  1G2B A;  1JB0 E;  2P0K A;  3EH1 A;  1LCK A;  1SKU B;  1VQL A;  3CCQ A;  3BDU A;  2EJ9 A;  4Z88 A;  4DEY A;  2QI2 A;  1SRM A;  4ZN3 A;  2DYB A;  4Y92 A;  1YIT Q;  4Y91 A;  2F2X A;  5LJ5 f;  2SEM A;  1AWX A;  3L42 A;  3RKY A;  4II1 A;  2DJQ A;  4XTZ A;  2QG9 B;  1GFC A;  2QQR A;  4C92 C;  1R8O B;  3CBM A;  4N0A C;  3RR6 A;  4C0D C;  2OX7 A;  4OB1 B;  4PJO C;  1AHJ B;  2E1H A;  2CH4 A;  1VYV A;  3OYJ A;  4OMF B;  4OVA A;  2O88 A;  4Q5W A;  4M7D D;  2J7I A;  1JRI A;  2CSQ A;  2EGE A;  2QA4 Q;  4M75 D;  4M78 D;  3LH0 A;  4RTU A;  2KI7 A;  5AYF A;  3X26 B;  1XOV A;  3P8D A;  3MEW A;  2DYI A;  2CT4 A;  4JJN K;  2ED0 A;  3OS0 A;  4CC2 A;  1SHF A;  2ROL A;  1K76 A;  3A8M B;  1U5S A;  2DL3 A;  2QAZ A;  4ZNX A;  3CC4 T;  1LJO A;  2DM1 A;  3LH5 A;  1VQ4 Q;  2K5L A;  4PFP A;  4CRI A;  1RLQ C;  5KYW A;  4OGC A;  2EKH A;  3CPF A;  3QJ6 A;  1X2K A;  3G1J A;  1NJI U;  4NOY A;  4N4I A;  2E6Z A;  1G5V A;  4FT4 A;  1WGS A;  1UEB A;  2RB6 A;  3CCL T;  1K8A U;  2P4T A;  5IT9 E;  3VUZ A;  1YJ9 T;  2M0Y A;  2BUD A;  2D6F A;  5KYU B;  5FU6 C;  3A8O B;  2LQN A;  4XU3 A;  1W2B A;  1M8V A;  3P8H A;  1QCN A;  4DBH A;  3ASK A;  3BE3 A;  4M7D C;  4KH1 B;  4M75 C;  2L3P A;  4M78 C;  2FHD A;  5FU7 B;  2HQH A;  3JRZ A;  4O5V A;  5GAN 3;  3TRE A;  3J81 E;  1Q86 C;  1AWW A;  2HBW A;  4ME7 A;  2V1R A;  2CP2 A;  3I55 A;  3SD4 A;  5CAI A;  2XK0 A;  1GL5 A;  1AZE A;  1X01 A;  3CME A;  1G83 A;  4RUG A;  2M16 A;  3M4Y A;  2YLB A;  2DFU A;  4C8Q E;  5DLO A;  3MHX A;  3G6E A;  1KFZ A;  1P92 A;  4OMN A;  1SSF A;  4M7A E;  2RK2 A;  2O01 E;  4ELY C;  1S72 A;  3M59 A;  3THK A;  4EMK A;  2KK4 A;  4ANJ A;  2HNI A;  1KQ1 A;  2ZGW A;  2X4Y A;  4F7U E;  1N9S A;  3VYH B;  2AKL A;  4DBQ A;  1G8X A;  1HJD A;  3CCE A;  2NUZ A;  1BB9 A;  3JAM E;  4RG2 A;  3OY9 A;  1KD1 C;  1FWZ A;  5CQX A;  3PIO A;  2SRC A;  2X4X A;  3QSU A;  4B9W A;  2DEU A;  3I56 T;  2ROT A;  3BFM A;  2LT4 A;  4V2S A;  2QQA A;  3RMQ A;  2DBK A;  1D0Z A;  1VQN A;  5DLQ E;  4CC4 B;  3BW1 A;  3VU3 C;  4D6W A;  4ZGE B;  2DD4 A;  1IHV A;  3CPW A;  2CP5 A;  5KCO A;  2EVR A;  4AG2 C;  1G3T A;  2KYM A;  1NJI R;  1IO6 A;  2GFA A;  2NWM A;  4C5I A;  2RQU A;  4EMG A;  2NYS A;  1KQS A;  3HP9 A;  3I55 Q;  3HRT A;  2DL5 A;  2ZPI B;  2OTJ A;  1TTH B;  2F5T X;  2J6K A;  4F04 B;  1U8R A;  3OSS C;  1K8A R;  3PGG A;  1NE8 A;  2PU9 B;  4XTX A;  1GCQ A;  1B07 A;  2L3S A;  5IHN A;  3HPW A;  2DER A;  3CME Q;  2CKK A;  2JM8 A;  2MCN A;  2PTK A;  3BDL A;  4L59 A;  4M77 G;  4HCC A;  3TSZ A;  3JCM b;  3G6E Q;  3EGU A;  1WHM A;  2LQ8 A;  2HD0 A;  2AZS A;  3S3N A;  2CDT A;  3F70 A;  1ZLM A;  1WLP B;  1K0S A;  2KNB B;  2FPE A;  2O31 A;  2DKG A;  1S72 Q;  4QVD A;  2IPO B;  1YI2 T;  5D6X A;  2V8I A;  2XMF A;  5FU7 C;  1VQ5 T;  3OB9 A;  1VQ7 T;  1Y0M A;  4FT2 A;  1Q95 G;  4FYX B;  2JTM A;  4RCC A;  1GCP A;  3NMZ C;  4ELZ C;  2D1X A;  1WXB A;  3HRS A;  3URG A;  5GJW B;  3CCE Q;  5HKC A;  4LDY A;  3OYI A;  2DVE A;  2QEX Q;  1OPK A;  1HK9 A;  4K11 A;  3JCM Q;  3CMA A;  1KHC A;  3X25 B;  5FRM A;  1JEG A;  1WQW A;  3HFN A;  3CC2 A;  2K2V A;  2MWP A;  1UGQ B;  3CCM T;  1OPL A;  2G6F X;  2DRK A;  1K9A A;  1M8M A;  2DTI A;  3NHN A;  2RMO A;  2X9H A;  5GAN 6;  3WVD B;  5LJ3 j;  5GAO m;  1CKB A;  1M3A A;  3SWN A;  4M77 F;  2PVO B;  3MET A;  1GBR A;  2KMT A;  1QVG P;  3SWN C;  3RNJ A;  2ZPH B;  1D0X A;  2GCX A;  2OTJ Q;  1I0C A;  2V8K A;  4FSS A;  1UUE A;  1XTD A;  1T3S A;  1SSH A;  4A63 B;  3ZL7 C;  4RTT A;  2L0A A;  3KUF A;  1JXO A;  1W2B S;  4LDX A;  1MMN A;  3GIB A;  2PNI A;  1VQ9 Q;  4AT1 B;  2HEQ A;  3O5Z A;  4JRI A;  3OW2 P;  2ZPB B;  3QZ5 B;  5D7U A;  2LNV A;  3ZFJ A;  1VQ8 Q;  1ZUU A;  2K5F A;  3M0U A;  4N4H A;  3CCJ T;  1NLP C;  4RTW A;  1RAH B;  2LC4 A;  2ECZ A;  1UGS B;  3SDZ A;  3CCR A;  2FZG B;  3M56 A;  5IAY A;  1QQJ A;  4J9E A;  3QKJ A;  3EG2 A;  1OOT A;  1FX7 A;  5CIU A;  3PIP A;  1AD5 A;  3QHS A;  4RCB A;  1UHC A;  4E7L A;  1ZHI A;  2QQB A;  1SPK A;  4BD3 A;  5FRN A;  5GAM j;  1Q86 U;  3G71 T;  2QGF B;  4B6M A;  1N9R A;  1DJ7 B;  1QLY A;  1M30 A;  3CMA Q;  3H0H A;  3R6O A;  1YJN A;  1PRM C;  4BE1 A;  1SHG A;  3OYG A;  4KRT A;  1BK2 A;  3HRU A;  1TWB A;  2P0Q A;  4ESR A;  3VRZ A;  1ZA1 B;  3M9Q A;  2QDL A;  3TQ7 P;  1D3B A;  1SRL A;  3PMT A;  3L1A A;  5J39 A;  3LGL A;  4RKU E;  3CC7 T;  4OB3 B;  4P5N A;  3OMC A;  5CKF A;  1N6A A;  4HCK A;  1BIB A;  1WHG A;  3CXC S;  3A98 A;  1YJW T;  4BB7 A;  4J6W A;  4J9G A;  4JJC A;  4JJB A;  4PJN A;  3C94 A;  4Z8A A;  2LCC A;  3HHT B;  2YUP A;  4C0D B;  1MV0 B;  4GY5 A;  3DKM A;  4F16 A;  4OMO A;  2RNA A;  4M77 A;  8ATC B;  1JBM A;  2Y90 A;  2CS7 A;  1W70 A;  1YHQ A;  1VQO A;  2M9U A;  1KD1 U;  1VQM A;  4ATO A;  3CD6 T;  2ED1 A;  2OTL T;  1BI0 A;  2LT1 A;  5LJ3 h;  2BZX A;  5GAO p;  3CCR Q;  3JCM P;  5GAO l;  1QVF P;  4R56 A;  5GAN j;  4KGV B;  5CVI A;  1VQ6 T;  1X75 C;  5IHI A;  4FU6 A;  3CPW P;  4J9C A;  4FCY A;  1Q7Y R;  2E4H A;  1YJN Q;  2HDA A;  1B3Q A;  2EYX A;  4E7J A;  1GFD A;  2O2O A;  2CH4 W;  3E19 A;  2EBP A;  4FYY B;  1KQS P;  4C0G A;  2C0O A;  1Y7X A;  2JUF A;  5KYW B;  1NLO C;  2BZ8 A;  2A7Y A;  5C0M A;  2CZ0 B;  3OYL A;  4KGX B;  1I81 A;  2E3I A;  2QQ9 A;  2XD0 A;  1Y57 A;  5HCK A;  2CUB A;  2YSQ A;  4XAX B;  3EFO B;  5HK0 A;  4IUR A;  1OI1 A;  3UA7 A;  2D8J A;  1VQP T;  4C92 E;  1N8R C;  3MEV A;  2VWF A;  2ZAE A;  5LJ3 g;  1QW1 A;  3EG3 A;  2YT6 A;  4PJO E;  3TU4 K;  1SF9 A;  3VS6 A;  2V26 A;  3VRY A;  2X4J A;  4PL6 A;  2RHI A;  2EQM A;  1YHQ Q;  1VQO Q;  2NUP A;  1RI0 A;  3S3O A;  2WSF E;  2E64 A;  1VQM Q;  2L5Q A;  4WCI A;  2DET A;  2XI9 A;  3GF5 A;  1MMD A;  2FRY A;  4QT7 A;  1LNX A;  2O9S A;  4IIM A;  4KH0 B;  3EG9 A;  1M4Z A;  1T0J A;  1EX4 A;  4PJM A;  2HKQ B;  3I5S A;  5CKB A;  1RLP C;  3JCM h;  1MMG A;  1D1A A;  1C1A A;  1C0M A;  1M2V A;  3DB3 A;  5CR2 A;  2DJZ A;  3NFC A;  1KD1 R;  2FRW A;  2E10 A;  6AT1 B;  3JCM X;  2MAM A;  4C8Q G;  2DO3 A;  1PM3 A;  3CCV T;  1O9S A;  4LDV A;  2DK3 A;  5GAM g;  2CGH A;  4M7A G;  3I9Q A;  1BU1 A;  2QDY B;  1PKS A;  2RM4 A;  4J9I A;  2LX9 A;  3E1S A;  3SFM A;  3ER0 A;  2JXB A;  3QYG B;  4J6X A;  4BE0 A;  3NTK A;  2VXF A;  2LJ3 A;  1QVG A;  2VUB A;  1LOJ A;  1NYF A;  4F7U G;  4M7D E;  2I0N A;  1UGR B;  2RJD A;  5GAN h;  3VUB A;  4M75 E;  4M78 E;  2FPD A;  3G4S A;  2CP3 A;  4KBM B;  3CCU A;  1YIJ T;  4F14 A;  3RES A;  5GJV B;  3C12 A;  3HL8 A;  4F17 A;  3JCM g;  3OBW A;  3ZBD A;  3OW2 A;  3VV0 A;  2EIF A;  3EGD A;  3M0P A;  3FEO A;  4RTV A;  1X2Q A;  3SHW A;  4OMP A;  5A2Q E;  4IUV A;  3C0C A;  1IXD A;  2O4X B;  3RER A;  3QJY A;  4BDY A;  1NEG A;  2ABL A;  1VQ4 T;  1WJR A;  3JB9 D;  1Q7Y C;  3MPU B;  4OF1 A;  1D0Y A;  1TS9 A;  3JCM c;  2J06 A;  4C8Q F;  2CZ1 B;  2E5Q A;  3CCL Q;  4XTU A;  3EFR A;  3J7A F;  1YJ9 Q;  1C6V X;  2RK1 A;  3PVL A;  3QPH A;  1IHW A;  5LJ5 j;  2DXU A;  4M7A F;  3EFS A;  1QCF A;  1VQL T;  1W1F A;  3CCQ T;  2RJF A;  2DTH A;  2KSS A;  4C5E A;  2DE0 X;  2BE9 B;  2MMP A;  3PVQ A;  2BTT A;  5GAN g;  4EIK A;  2E6N A;  4F7U F;  4HT8 A;  2YRD A;  2FB7 A;  4IUU A;  4E6R A;  3MJX A;  5KYX B;  2VKN A;  3EGX A;  1AOJ A;  2CP6 A;  2XG8 D;  2F69 A;  1G3W A;  4YTL A;  1YBY A;  4MZM A;  3VS3 A;  2KT1 A;  2KRS A;  3E9F A;  3NGP A;  2JW4 A;  4LD6 A;  5L8R E;  1OZ3 A;  3DLM A;  3JCM V;  1X6B A;  2NUT A;  5GAN 2;  3FDR A;  2E65 A;  4BE2 A;  4C5H A;  2KYB A;  3G4S Q;  2LQK A;  3CCU Q;  1M90 C;  3UF4 A;  1EZZ B;  1K9M C;  2KGT A;  2RJE A;  2QTX A;  2COZ A;  3HSB A;  1FYN A;  3M5A A;  2R5M A;  4RTZ A;  2PUO B;  4OMQ A;  1RAE B;  2OI3 A;  1QKW A;  3LYI A;  5KE3 A;  3SWN B;  3AT1 B;  1BIA A;  4HCB A;  4EMK C;  5GAN 5;  1ZA2 B;  2IVW A;  3RIR A;  4QQG A;  2CZ6 B;  3SEM A;  2DXC A;  1WXT A;  3CCS T;  2VVK A;  2DBM A;  2QEX A;  3H41 A;  4ZN1 A;  3L2Q A;  1T0H A;  2RI5 A;  2J6F A;  1QVF A;  1AZG B;  2EYW A;  1PC0 A;  2DD5 A;  1WDX A;  4E7H A;  1QWF A;  1PSF A;  2D9T A;  3NPF A;  5GMK l;  1OZ2 A;  5I22 A;  3NTH A;  5LJ3 d;  1RL2 A;  4JUV A;  5EC7 A;  3H6Z A;  1UB4 A;  2L89 A;  4B9X A;  5GAN 7;  3MO8 A;  3QZ9 B;  4A54 A;  3EHQ A;  4PJL A;  2CP7 A;  2DF6 A;  2JN0 A;  2JNG A;  2Y4Y A;  3QDR B;  1WXU A;  1V1C A;  3S3M A;  1EFN A;  1WQ7 A;  2PQW A;  3X28 B;  4L5G A;  3VYG A;  3G7Z A;  1M27 C;  2LRQ A;  4N4G A;  4KUD K;  1TUC A;  1PWT A;  3LGF A;  1QWE A;  3FLG A;  1N8R U;  4C8Q A;  1I07 A;  1NPR A;  2GFU A;  1UFF A;  1SG5 A;  1OYX A;  1VUB A;  5LL6 S;  4X1V A;  4M7A A;  5GAN 8;  3S6W A;  3X20 B;  5FW9 A;  3OS2 A;  5IH2 A;  1I1J A;  4L6V 5;  3RMS A;  2DIG A;  4ZGD B;  5LJ3 f;  3I55 T;  1I8F A;  1GCQ C;  1VQ9 A;  1KIK A;  5EG2 A;  1YFN A;  2EQI A;  2P84 A;  4D8K A;  2RQW A;  4F7U A;  1VQ8 A;  3OQ5 A;  5LJ5 h;  3QWY A;  2R58 A;  3R6N A;  7AT1 B;  3G6E T;  4JZ4 A;  5GAM d;  3M53 A;  1X43 A;  2AT1 B;  1D3B B;  2B8A A;  3EH2 A;  1EIF A;  1YI2 Q;  2HAX A;  1VQ5 Q;  5CKH A;  2DA9 A;  5DY9 A;  4PFO A;  2CRE A;  2EYQ A;  1QVG S;  3LW5 E;  1S72 T;  2ZPG B;  2HKN A;  2E70 A;  1MUZ A;  3REB B;  2EGA A;  5GMK j;  4IUT A;  3GPL A;  1Q82 R;  1CSK A;  3KFV A;  3G71 A;  1BBZ A;  1LVK A;  1TUD A;  5KYY A;  5CK9 A;  2XU8 A;  5CO7 A;  5CQY A;  3JV3 A;  3OW2 S;  1UE9 A;  1A0N B;  2DXB A;  2DTO A;  3JCM d;  1PCX A;  4PLL A;  1RI9 A;  3CCM Q;  2DL8 A;  1GXI E;  3VJP A;  4MMK A;  5GAM f;  5GAN 4;  1RUW A;  1GRI A;  3PE0 A;  2K7A A;  1K1Z A;  4DOV A;  1I5L A;  1PRL C;  2YRV A;  1VQN T;  5LJ5 g;  1RAI B;  4J8O A;  2K4Y A;  2IIM A;  3CQT A;  2CUD A;  5CCA A;  4HA8 A;  4TVR A;  4LDU A;  1ARK A;  2K3B A;  4KUL A;  3WVE B;  4EPC A;  1QMC A;  2WAC A;  2OTJ T;  2QXF A;  3MCA B;  5HK3 A;  1KG1 A;  1Q7Y U;  5IXB A;  4JRK A;  2A08 A;  2EQK A;  1KJW A;  2YDL A;  2ZZD A;  3VKI A;  5GAN d;  1N8R R;  4VUB A;  5GAO q;  4LDW A;  3M58 A;  4Z02 A;  1VQK A;  2OTL A;  3V8J A;  2QGG A;  3OMG A;  3PNW C;  4QVC A;  3A8G B;  2FVU A;  3M0T A;  1RAA B;  1W4S A;  3JB9 I;  3M54 A;  4M77 D;  2LCL A;  3OYD A;  3NTI A;  2HSP A;  2MF2 A;  3DLL A;  2KBT A;  4FW1 A;  3CBP A;  3C95 A;  4A4G A;  1JJ2 P;  1M1G A;  1AT1 B;  3RDV A;  3G71 Q;  2JS0 A;  2EYZ A;  2GBQ A;  2R57 A;  4PFZ A;  1K0X A;  4JPB W;  2EFI A;  2RQT A;  2W0Z A;  4AFS C;  3L2W A;  2LTO A;  4HT9 A;  3HTR A;  2RHU A;  2ZPE B;  2DZ9 A;  4C92 G;  3CMA T;  1ZSZ A;  2RO0 A;  2LQW A;  2NUP B;  4KUI A;  1PD1 A;  1R0B G;  2EQJ A;  4PJO G;  4M4Z A;  1ZSZ C;  2PUK B;  3CC2 T;  1M90 U;  4XU1 A;  2CT3 A;  3EG9 B;  1Y07 A;  2ESW A;  1K9M U;  2R5A A;  3EG0 A;  1QVF S;  2C0T A;  1OU8 A;  5LJ3 e;  2DIQ A;  2H3E B;  3CC7 Q;  4HVU A;  2MYS A;  1Y96 A;  1UJ0 A;  1IRX A;  3FJ5 A;  1WHJ A;  2C0I A;  1KSW A;  1O75 A;  1Z9Z A;  5GMK h;  1YWO A;  4DQ2 A;  1YCY A;  1YJW Q;  1M2V B;  3AHU A;  1OU9 A;  3OYH A;  1WHL A;  4JRP A;  3CPW S;  2FZK B;  3OYC A;  2A37 A;  3RKX A;  3E9G A;  1WIE A;  1SEM A;  5GAO r;  3C4S A;  5IXF A;  1QVP A;  2A28 A;  5DM7 R;  1KQS S;  3QO3 A;  4M77 C;  1G3Y A;  2JTE A;  1Q82 C;  2JJ9 A;  5J26 A;  2FL7 A;  2LX7 A;  5M9O A;  2PVG B;  3O8V A;  4X9D A;  4FYW B;  4LXC A;  2VC8 A;  3P8B B;  3SB2 A;  1VQK Q;  2OTL Q;  4FW2 A;  3TEE A;  1NBE B;  2DEQ A;  2VAS A;  3M0S A;  2MPX C;  4A4H A;  3JB9 J;  3VS7 A;  2RPN A;  2K3Y A;  4C92 F;  1VA7 A;  4NL3 A;  4AMC A;  1UJY A;  2RN8 A;  3OS1 A;  3CCR T;  4CC3 A;  2FYK A;  1UHF A;  3LWH A;  1VQ6 Q;  1AWO A;  2GQI A;  3GOX A;  1I4K 1;  4PJO F;  1IZ6 A;  2ZPF B;  1MHN A;  3X24 B;  2K79 A;  3H8Z A;  2COW A;  2M0O A;  2XID A;  3LX7 A;  5GAM e;  4AFU C;  4M7D G;  2J6O A;  4M75 G;  2QQS A;  4M78 G;  4RMO A;  1BI1 A;  4NL2 A;  1UGP B;  2CSI A;  3CCV A;  5GMK i;  1YCS B;  1YJN T;  4HCZ A;  1OX8 A;  4LN2 A;  2FPF A;  2QTV A;  5KCH A;  2X3W D;  3JB9 H;  2VGM A;  2KRN A;  3VS4 A;  1NM7 A;  2GF7 A;  1TU0 B;  3N5B B;  4IUQ A;  3MP6 A;  2YWW A;  2EGC A;  2PVD B;  1WYX A;  2KT8 A;  3JCM e;  3ULR B;  1TH7 A;  8AT1 B;  1QP2 A;  5AT1 B;  1PG5 B;  1BKB A;  2D8H A;  3MP8 A;  3QXE B;  1QP3 A;  4A53 A;  1B7T A;  1PNJ A;  3MP1 A;  2LDM A;  1WA7 A;  3CC4 A;  1ZX6 A;  4J9D A;  5CKE A;  3KXT A;  1WNL A;  1G3S A;  5FRO A;  1J3T A;  1B34 A;  2LJ1 A;  3PFS A;  1M90 R;  4EDU A;  1UGV A;  3L2R A;  2LZ6 B;  5LJ5 d;  2K6D A;  1K9M R;  3PT9 A;  1YHQ T;  1VQO T;  2JOY A;  3I35 A;  3CCL A;  2BKD N;  1RAC B;  4M7D F;  4FIB A;  1K73 U;  3EG1 A;  1YJ9 A;  4BDZ A;  4M75 F;  4M78 F;  2NUT B;  4A4F A;  2KE9 A;  4FYV B;  2Y4X A;  3L2Z A;  1R0C B;  2YLC A;  4J9B A;  5KH6 A;  5GAN e;  4LNP A;  1U1T A;  2X35 A;  2AIR B;  3OBY A;  1YIT T;  4PJJ A;  3INZ A;  1FMW A;  4EMK B;  2X3X D;  1ABQ A;  4X34 A;  3OSV A;  3L2U A;  3CCV Q;  1D09 B;  1OQK A;  4C92 A;  2FG0 A;  4N0A A;  1YP5 A;  2BIV A;  1D1C A;  1U3O A;  1U06 A;  1M1K C;  3REA B;  4PJO A;  5GMK m;  1XQH A;  3LWI A;  2LMJ A;  1QKX A;  1KK7 A;  3JB9 F;  5HY6 A;  2E12 A;  4X9C A;  4XQ3 A;  3MEU A;  5KE2 A;  2QA4 T;  3QII A;  4OGE A;  3A8L B;  5IN1 A;  3A1P A;  3T9N A;  1YIJ Q;  1UEC A;  4AG1 C;  2A0F B;  2CYZ B;  4A4E A;  1BI2 A;  1KHI A;  4UC4 A;  5FWB A;  9ATC B;  3V7C A;  1ACM B;  1VYU A;  2JZ2 A;  3CC4 Q;  3UT1 A;  4IKF A;  5I21 A;  2RQV A;  4JS5 A;  4C8Q B;  2HL5 C;  3JCM W;  2YHT A;  1JQQ A;  2HQE A;  2D0N A;  3M55 A;  3FJP A;  4M7A B;  3CCS A;  4JRQ A;  2KDS A;  2EPD A;  1ZBJ A;  1WFW A;  2FZC B;  4J5Y A;  5A0L A;  1H8K A;  3CBO A;  2COY A;  3I56 A;  4DEX A;  2O9V A;  2MI6 A;  4F7U B;  4E7S A;  2YXY A;  4O6J A;  1M5Q 1;  4XTW A;  1JJ2 A;  1BYM A;  1XNI A;  3EFO A;  1Z9Q A;  1VQL Q;  3CCQ Q;  3TSW A;  2M02 A;  1RAB B;  1W6X A;  2JM9 A;  4AFZ C;  5D6W A;  1WZO A;  2YUQ A;  3PMI A;  3CEY A;  4M7D A;  4MDX A;  1E6H A;  4E47 A;  2M1H A;  4M75 A;  4M78 A;  1KC8 C;  3QG1 A;  1M1F A;  3V8K A;  1JO8 A;  2QYZ A;  1K73 R;  5I11 A;  2XDP A;  3GP8 A;  2GTO A;  3D7S B;  3DB4 A;  1N27 A;  3H0F A;  4GBQ A;  2KVQ G;  4BI8 B;  2RA2 A;  2Z0W A;  1HD3 A;  2VV5 A;  4LD9 K;  1Q82 U;  4R55 A;  2MK5 A;  5KYY B;  4J7F A;  2L3Q A;  4C8Q D;  1YNZ A;  2VXE A;  4BY6 C;  1X27 A;  2YRC A;  3QDF A;  1JU5 C;  2HZY A;  3OYB A;  4M7A D;  2DPP B;  3FB9 A;  1XJW B;  3G4S T;  1QCO A;  1ZBX A;  1YI2 A;  1X69 A;  3CCU T;  1RAF B;  1Q81 C;  1VQ5 A;  4J7I A;  2P0P A;  2B86 A;  1FMK A;  2OAW A;  1VQ7 A;  3OYY A;  4LE9 A;  4QVZ A;  2EYY A;  3UWN A;  1M3C A;  3TCJ A;  1UDL A;  2HMA A;  1UTI A;  3QWX X;  1NG2 A;  2G3R A;  3CCS Q;  1IGQ A;  2EJG A;  2JVV A;  4Y28 E;  3V8L A;  1HSQ A;  3I56 Q;  4QKU A;  2XDD A;  3H9N A;  4CC7 A;  2AZV A;  1N5Z A;  3CCM A;  4C5G A;  4XTV A;  3HFO A;  4GLK A;  1I5O B;  3M0R A;  4J83 A;  5LJ5 e;  2A3L A;  2FEI A;  3CXC A;  2DAQ A;  1JXM A;  1UG1 A;  2YUO A;  1VYT A;  3PTA A;  2OAU A;  2KR3 A;  4RTY A;  4J9H A;  4C8Q C;  1M2O A;  2EW3 A;  5I2S A;  1CKA A;  1RAD B;  1X6O A;  4PKC C;  3QYH B;  2RH2 A;  1NPP A;  4M7A C;  1E6G A;  2M51 A;  2E3H A;  2O4X A;  2V8J A;  2LCS A;  2DX1 A;  2FO0 A;  1AVZ C;  2DVJ A;  2F1L A;  2X51 A;  1MNE A;  2JT4 A;  3CME T;  2J05 A;  4XK8 E;  3VS0 A;  2VGN A;  4HVW A;  2RQR A;  2EQU A;  3CCJ A;  3MKD A;  1ZSZ B;  1PHT A;  2DXT A;  5KYU A;  2OJ2 A;  4C0F A;  1MV3 A;  1WI7 A;  1ZSG A;  2GNC A;  2EKO A;  2DIL A;  1VQ7 Q;  2HSE B;  2L8D A;  2CZ7 B;  3OYK A;  2RI3 A;  3RKW A;  4QQ6 A;  2DNU A;  1NYG A;  2K5I A;  2L3R A;  3FRN A;  2AK5 A;  3HKS A;  1R77 A;  1Y96 B;  2JS2 A;  2XDB A;  5GAO n;  2ENM A;  2K9G A;  4FM4 B;  2AHJ B;  3RUX A;  3CCE T;  2A36 A;  2QAS A;  3OYE A;  1M9S A;  1Y71 A;  3TVT A;  3ME9 A;  4CI0 C;  5KYX A;  4MZT A;  4M77 B;  2QEX T;  5D6Y A;  2XKO C;  3OS5 A;  1M1K U;  2H8H A;  4BUG A;  4HXJ A;  1K73 C;  2RJC A;  4MML A;  3LLR A;  1T3L A;  3QBY A;  4J6Y A;  5I2M A;  1TSF A;  2KY9 A;  4PNO A;  1H64 1;  4XTY A;  4AFQ C;  1LPL A;  1VQN Q;  4FSX A;  2DL4 A;  3CC7 A;  4HVV A;  3M4G A;  3FIF A;  1VOM A;  4ZGJ B;  4OB2 B;  1BCO A;  2JMA A;  1YJW A;  5C6S A;  1WJS A;  1V76 A;  2HQX A;  1JJ2 S;  3IQL A;  2XIC A;  3JCM f;  2KRM A;  1FMV A;  2F2V A;  1ABO A;  1YWP A;  1IRE B;  4OMM A;  1WHK A;  3RBB B;  1OEB A;  1GBQ A;  3CD6 A;  1X6G A;  1VQ9 T;  3CCJ Q;  1WX6 A;  2KAF A;  4NS5 A;  1VQ8 T;  4QQD A;  2RHZ A;  2WSE E;  2F5K A;  1BCM A;  1PKT A;  2AKK A;  1M3B A;  2HL3 A;  4JDS A;  1H3H A;  1RAG B;  2X4W A;  2GQV A;  1IGU A;  2KXC A;  2YUN A;  3EHR A;  3BY7 A;  1TUG B;  1H92 A;  3ZEH A;  1VQ6 A;  4KGZ B;  4E7I A;  3UAT A;  3GNF B;  2VB6 A;  2NLU A;  4JLI A;  4M77 E;  3H0I A;  1KC8 U;  2DRM A;  3J80 E;  1PSE A;  2DMO A;  2KEA A;  4R0K A;  1NZ9 A;  4OP0 A;  5GMK e;  5GAN f;  3UA6 A;  2ZCF B;  1AEY A;  4RG8 A;  2L2P A;  2XHC A;  2P4R A;  1W2B P;  2DZC A;  4FL6 A;  4HKE A;  1NJI C;  1B34 B;  5L23 A;  4E7K A;  2D0Q B;  2KQW A;  3Q1J A;  4Z89 A;  3GLX A;  2IG0 A;  1VIF A;  4D8D A;  3CC2 Q;  1HYO A;  2PZ1 A;  1K8A C;  1NEB A;  4ORZ A;  1VIE A;  4KT0 E;  2F2W A;  3VS5 A;  5A0G A;  1VQP A;  2EAY A;  2VYT A;  4JJD A;  1Q81 U;  3OYA A;  4OB0 B;  4LUE A;  5A0D A;  2LP5 A;  3V7S A;  1U1S A;  1M1K R;  1TXQ A;  4RTX A;  3E2U A;  1D1B A;  2KXD A;  1HXD A;  4QW2 A;  4IIO A;  1BI3 A;  2K3X A;  2W10 A;  1OX9 A;  3JSC A;  3V7R A;  1K4U S;  1OUL A;  4C0Z A;  2GTJ A;  2K57 A;  2MOX A;  4ZTF A;  2QK0 A;  3CD6 Q;  4XU0 A; 
#chains in the Genus database with same CATH homology
 1ABQ A;  1OV3 A;  1FYN A;  4RTZ A;  1OPL A;  2G6F X;  2DRK A;  4OMQ A;  1K9A A;  1M8M A;  2FG0 A;  2OI3 A;  3NHN A;  1QKW A;  2RMO A;  1YP5 A;  1U3O A;  1U06 A;  1CKB A;  2K2M A;  1M3A A;  3REA B;  4LUD A;  3SEM A;  1WXT A;  1ZUK A;  2VVK A;  2LMJ A;  2RF0 A;  2DBM A;  1GBR A;  1QKX A;  3U23 A;  2DLP A;  3H41 A;  3RNJ A;  1T0H A;  2E5K A;  1I0C A;  2J6F A;  1UUE A;  4FSS A;  1AZG B;  2EYW A;  1T3S A;  1SSH A;  4A63 B;  1WDX A;  1QWF A;  3ZL7 C;  4RTT A;  2L0A A;  3NPF A;  5I22 A;  5IHK A;  1JXO A;  3M0Q A;  5EC7 A;  1UEC A;  5FWC A;  4AG1 C;  1E7O A;  2PNI A;  3EHQ A;  2DF6 A;  2HEQ A;  3O5Z A;  5FWB A;  1S1N A;  1VYU A;  1WXU A;  1V1C A;  4GLM A;  1AWJ A;  1EFN A;  1ZUU A;  2RQV A;  2V1Q A;  1M27 C;  3M0U A;  1TUC A;  1NLP C;  1ZUY A;  4OML A;  4RTW A;  3VS2 A;  1PWT A;  1QWE A;  1JQQ A;  1I07 A;  3VS1 A;  2D0N A;  2ECZ A;  5ECA A;  2JMC A;  1UFF A;  4X1V A;  4J9E A;  3EG2 A;  5FW9 A;  2EPD A;  5IH2 A;  1I1J A;  1OOT A;  1ZBJ A;  1WFW A;  2LJ0 A;  1H8K A;  1AD5 A;  4DEX A;  2O9V A;  1UHC A;  1GCQ C;  1SPK A;  1KIK A;  4D8K A;  2EQI A;  2RQW A;  2BZY A;  1QLY A;  1M30 A;  1Z9Q A;  3I5R A;  3H0H A;  3TSW A;  4JZ3 A;  1PRM C;  3QWY A;  1SHG A;  1W6X A;  2JM9 A;  4AFZ C;  2MIO A;  2DL7 A;  2YUQ A;  4KRT A;  1BK2 A;  3R6N A;  1E6H A;  4ESR A;  3VRZ A;  2KRO A;  4JZ4 A;  4J9F A;  3GBQ A;  1X43 A;  1YN8 A;  2HCK A;  2QDL A;  1JO8 A;  2DA9 A;  5I11 A;  2GTO A;  2GGR A;  2CRE A;  1SRL A;  3H0F A;  4GBQ A;  1TG0 A;  1MUZ A;  2LNH B;  3REB B;  2EGA A;  1G2B A;  1HD3 A;  1LCK A;  1CSK A;  4HCK A;  3KFV A;  1BBZ A;  2L3Q A;  1YNZ A;  1TUD A;  4Z88 A;  3A98 A;  1X27 A;  4J9G A;  4JJC A;  4JJB A;  1JU5 C;  4DEY A;  4Z8A A;  1SRM A;  2DYB A;  3JV3 A;  4Y92 A;  1UE9 A;  1A0N B;  2YUP A;  2F2X A;  1MV0 B;  2SEM A;  1RI9 A;  2DL8 A;  1AWX A;  4F16 A;  1X69 A;  4OMO A;  2RNA A;  2DJQ A;  1GFC A;  1W70 A;  2B86 A;  1FMK A;  1RUW A;  2OAW A;  1GRI A;  3PE0 A;  2K7A A;  4LE9 A;  1K1Z A;  2EYY A;  1PRL C;  1M3C A;  1UDL A;  2ED1 A;  1UTI A;  3QWX X;  1NG2 A;  2CH4 A;  2BZX A;  2IIM A;  1VYV A;  3CQT A;  2CUD A;  2O88 A;  2J7I A;  2CSQ A;  2EGE A;  1ARK A;  4RTU A;  2K3B A;  1HSQ A;  4CC7 A;  2AZV A;  1N5Z A;  1XOV A;  5IHI A;  2CT4 A;  4J9C A;  3M0R A;  2HDA A;  5IXB A;  1B3Q A;  2ED0 A;  2EYX A;  2A08 A;  4CC2 A;  1SHF A;  1KJW A;  2FEI A;  2YDL A;  2ROL A;  1GFD A;  2O2O A;  2CH4 W;  2EBP A;  1K76 A;  1U5S A;  1JXM A;  1UG1 A;  2C0O A;  2DL3 A;  2YUO A;  4ZNX A;  2DM1 A;  1VYT A;  3LH5 A;  2KR3 A;  4RTY A;  1NLO C;  1RLQ C;  2BZ8 A;  4J9H A;  2EW3 A;  1CKA A;  2EKH A;  3M0T A;  1X2K A;  1Y57 A;  5HCK A;  1E6G A;  2CUB A;  2M51 A;  2YSQ A;  2HSP A;  2KBT A;  2LCS A;  2DX1 A;  2FO0 A;  1AVZ C;  2DVJ A;  3UA7 A;  2D8J A;  2JT4 A;  2J05 A;  2VWF A;  2M0Y A;  3VS0 A;  2JS0 A;  2EYZ A;  2GBQ A;  4HVW A;  2RQR A;  3EG3 A;  1K0X A;  4JPB W;  2RQT A;  2YT6 A;  2W0Z A;  4AFS C;  2LQN A;  1PHT A;  3VS6 A;  3VRY A;  2LQW A;  2OJ2 A;  2GNC A;  1MV3 A;  1WI7 A;  1ZSG A;  2DIL A;  2L3P A;  4M4Z A;  4WCI A;  2CT3 A;  1NYG A;  2DNU A;  1AWW A;  2HBW A;  2ESW A;  2V1R A;  2FRY A;  4QT7 A;  2O9S A;  4IIM A;  2AK5 A;  3EG0 A;  2C0T A;  2JS2 A;  1GL5 A;  1AZE A;  1T0J A;  4HVU A;  2ENM A;  1UJ0 A;  2K9G A;  3I5S A;  1RLP C;  3FJ5 A;  2C0I A;  2A36 A;  1KSW A;  1Z9Z A;  3TVT A;  1G83 A;  1YWO A;  4RUG A;  2H8H A;  2A37 A;  4HXJ A;  1WIE A;  1SEM A;  1KFZ A;  1T3L A;  5IXF A;  2A28 A;  4OMN A;  2FRW A;  2JTE A;  4AFQ C;  2LX7 A;  2DL4 A;  3THK A;  4HVV A;  3I9Q A;  1BU1 A;  1PKS A;  2AKL A;  3M0S A;  4J9I A;  2JXB A;  3VS7 A;  1HJD A;  2JMA A;  2RPN A;  1VA7 A;  2NUZ A;  2LJ3 A;  1UJY A;  1BB9 A;  2RN8 A;  1NYF A;  3IQL A;  4CC3 A;  1UHF A;  2I0N A;  2KRM A;  2F2V A;  1AWO A;  2GQI A;  2FPD A;  1ABO A;  2SRC A;  1YWP A;  4F14 A;  4OMM A;  5GJV B;  3RBB B;  1OEB A;  1GBQ A;  2K79 A;  2ROT A;  4AFU C;  1X6G A;  4F17 A;  2J6O A;  2DBK A;  4CC4 B;  2CSI A;  1WX6 A;  3M0P A;  1YCS B;  4RTV A;  1PKT A;  1X2Q A;  3SHW A;  2AKK A;  4OMP A;  2EVR A;  1M3B A;  4AG2 C;  4LN2 A;  3C0C A;  1H3H A;  2FPF A;  2KYM A;  2X3W D;  1IO6 A;  2KXC A;  2NWM A;  2RQU A;  2YUN A;  3EHR A;  1H92 A;  1NEG A;  2ABL A;  2KRN A;  3VS4 A;  2DL5 A;  1NM7 A;  2J6K A;  3UAT A;  2EGC A;  2J06 A;  3H0I A;  1GCQ A;  1B07 A;  1WYX A;  2DRM A;  2KT8 A;  2L3S A;  5IHN A;  2DMO A;  2KEA A;  4R0K A;  3ULR B;  2JM8 A;  3PVL A;  2MCN A;  3UA6 A;  2PTK A;  1AEY A;  2L2P A;  2D8H A;  1QCF A;  2P4R A;  1PNJ A;  1W1F A;  1WA7 A;  3TSZ A;  3EGU A;  1ZX6 A;  4J9D A;  2DE0 X;  5L23 A;  3PVQ A;  2AZS A;  2BTT A;  2CDT A;  4Z89 A;  1J3T A;  1ZLM A;  4EIK A;  1WLP B;  1K0S A;  2LJ1 A;  2KNB B;  2FPE A;  1UGV A;  2O31 A;  4D8D A;  2PZ1 A;  2LZ6 B;  2K6D A;  1NEB A;  4ORZ A;  2XMF A;  4E6R A;  3I35 A;  1Y0M A;  2F2W A;  2VKN A;  1AOJ A;  3VS5 A;  3EG1 A;  1GCP A;  3NMZ C;  4JJD A;  2D1X A;  1WXB A;  3VS3 A;  2KE9 A;  4LUE A;  2KT1 A;  2KRS A;  5GJW B;  3NGP A;  2JW4 A;  2LP5 A;  1X6B A;  4J9B A;  4RTX A;  2KXD A;  1OPK A;  4IIO A;  4K11 A;  4LNP A;  2KYB A;  2W10 A;  3UF4 A;  1K4U S;  2KGT A;  1JEG A;  2GTJ A;  2MOX A;  2X3X D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...