1ZLMA

Crystal structure of the sh3 domain of human osteoclast stimulating factor
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
58
structure length
58
Chain Sequence
GQVKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Osteoclast stimulating factor 1
publication title Structure of the SH3 domain of human osteoclast-stimulating factor at atomic resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2005-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1zlmA00
1KFZA 1MV3A 4AG1C 3M0SA 1GCQA 2A36A 2CSIA 1BK2A 2CUDA 2F2XA 3FJ5A 2KRSA 1GCQC 1AVZC 3EG1A 2GTJA 2FPDA 4D8KA 1AOJA 2W0ZA 2X3WD 1Z9QA 2C0TA 5HCKA 3SHWA 2VKNA 2PZ1A 3A98A 1H8KA 2KYBA 1EFNA 1HSQA 1AD5A 2EKHA 4HXJA 4RTTA 4Z8AA 1I07A 1PWTA 3REBB 1UHFA 1WYXA 2KT1A 2O2OA 1WFWA 1GFDA 3O5ZA 1CSKA 1JQQA 1H3HA 2EPDA 1Z9ZA 3PVLA 1NEGA 2NUZA 1IO6A 2FPFA 1SRLA 1UFFA 1ZUKA 4QT7A 2KR3A 1GBRA 1X43A 2DBMA 1ZLMA 1BBZA 1X2QA 2RQUA 1BB9A 1OEBA 1OPKA 2JTEA 4RTZA 1NYFA 2EVRA 4J9IA 2KRNA 2YUPA 3M0QA 1KIKA 1SSHA 2DJQA 2YDLA 2PNIA 3THKA 2CT4A 2JT4A 2KNBB 2O31A 2M51A 4ZNXA 1KSWA 4OMMA 2AZSA 4JPBW 3LH5A 2D1XA 3R6NA 2J05A 1VA7A 1T0HA 2OJ2A 1I1JA 1OOTA 2EBPA 1GBQA 1QKXA 3UA7A 4J9HA 2FEIA 2K9GA 1WX6A 5GJVB 1NYGA 2QDLA 1JXMA 2EGCA 1UDLA 3NGPA 1XOVA 3VS7A 1AWWA 1QKWA 2J6KA 1V1CA 1X6GA 2KEAA 1YNZA 1W70A 1TUDA 1HD3A 1M3CA 2LMJA 2RQTA 1SHFA 2FRYA 5IH2A 3VS6A 3NMZC 2DYBA 2LZ6B 1FYNA 2SEMA 5FWBA 4RTVA 5IHIA 5I11A 4ORZA 4AFZC 4AFSC 2DLPA 3CQTA 1UHCA 4CC2A 1T3SA 2VWFA 3UF4A 1UGVA 2LP5A 2K6DA 2C0OA 4K11A 4DEYA 2LCSA 1ABQA 2B86A 2RQVA 2J7IA 3IQLA 2ESWA 3ZL7C 2A28A 3JV3A 1QWFA 1A0NB 3EG3A 1LCKA 1TG0A 2A08A 2EGEA 4RTXA 1X6BA 2GGRA 2KXDA 3PVQA 5IHKA 4Z88A 1CKAA 2J06A 4AFUC 2RQRA 2LJ3A 1U06A 3KFVA 1ARKA 2CT3A 1PKSA 1GFCA 1UG1A 2XMFA 2L3SA 2YSQA 2BZ8A 2LX7A 3QWXX 2O9VA 4GLMA 2EYYA 1M3AA 1U3OA 1QWEA 3UATA 4KRTA 4IIOA 5EC7A 2LQWA 4WCIA 1QLYA 2DL5A 1X27A 2HCKA 1T3LA 2BZYA 3GBQA 2DBKA 2KROA 1MV0B 1UJYA 2CDTA 2JM8A 4JZ4A 4Z89A 1I0CA 1NLOC 3RBBB 1B07A 1U5SA 2O88A 1MUZA 1NLPC 1GRIA 2DF6A 2AK5A 2HDAA 1WIEA 3M0RA 4JJDA 2VVKA 4JZ3A 2BTTA 3VRZA 4F16A 2ED1A 1UUEA 1RI9A 3EHRA 2V1RA 2ENMA 4OMLA 3UA6A 1E6GA 1NEBA 5I22A 2I0NA 2HSPA 2PTKA 5IHNA 1B3QA 3M0UA 1ZBJA 2RQWA 2JW4A 2JM9A 2RNAA 2IIMA 3NPFA 2C0IA 2KRMA 2GTOA 1HJDA 2X3XD 1WXUA 4RTUA 3M0PA 2CH4A 4J9GA 1H92A 1PRMC 1YWPA 2DMOA 2RMOA 1WI7A 1ZUYA 4J9BA 2L2PA 3VS3A 2FO0A 2KYMA 1VYTA 1VYUA 5IXBA 1UTIA 1J3TA 2JMAA 2JS0A 4RTYA 2D0NA 4FSSA 1AWJA 2DVJA 4IIMA 2D8HA 2OI3A 1GL5A 2P4RA 3VS5A 3PE0A 2AZVA 1Y57A 4GBQA 1RLQC 2DNUA 4LUDA 4R0KA 3H41A 4OMNA 2YUQA 1JU5C 4LE9A 2DE0X 1UJ0A 1RUWA 2RF0A 1YN8A 3M0TA 4HVWA 4AFQC 1ZUUA 4ESRA 5IXFA 2GNCA 2KBTA 2O9SA 1K9AA 4M4ZA 2ROTA 1X2KA 1OPLA 3I35A 2DL8A 4LUEA 4E6RA 2HEQA 2D8JA 4F17A 2LJ1A 1SPKA 2DRKA 5GJWB 1AEYA 2H8HA 3U23A 3ULRB 2K79A 1UECA 1M27C 1VYVA 2DL3A 2F2WA 3I5SA 1JEGA 1WDXA 2K7AA 2J6OA 2L0AA 2E5KA 2LNHB 2JMCA 2YUOA 1NG2A 2DA9A 1QCFA 4CC3A 2ECZA 4LN2A 2BZXA 2DX1A 3VS0A 2ED0A 2DILA 2DL7A 1AZEA 2L3PA 1K0SA 1JO8A 1M8MA 3H0HA 1PKTA 4LNPA 2CSQA 1ZSGA 2EYZA 4J9DA 1YP5A 2MIOA 2ROLA 3I5RA 5ECAA 1WA7A 3NHNA 5FWCA 1M3BA 4DEXA 1K76A 4EIKA 1G2BA 4RTWA 1K1ZA 4Y92A 1WLPB 1SEMA 4HCKA 1M30A 2CH4W 4OMOA 4D8DA 1AZGB 1KJWA 3TSWA 2J6FA 1YCSB 3H0FA 4CC7A 4A63B 2DM1A 1TUCA 1Y0MA 2KGTA 4J9FA 5FW9A 4J9CA 3VRYA 2G6FX 1W1FA 2K2MA 2YT6A 2GBQA 2YUNA 4RUGA 2CREA 1S1NA 4HVUA 2A37A 1NM7A 1CKBA 3SEMA 2FRWA 1BU1A 1PHTA 1SHGA 4X1VA 2RN8A 4OMQA 3EHQA 2DL4A 4AG2C 2K3BA 3REAB 1RLPC 1W6XA 4HVVA 2LJ0A 1FMKA 5L23A 2AKKA 1X69A 2KXCA 1E7OA 1SRMA 2EW3A 2CUBA 1OV3A 3C0CA 2DRMA 2LQNA 1K4US 3H0IA 1K0XA 2AKLA 2KT8A 3EGUA 2NWMA 2L3QA 1G83A 3VS2A 3EG2A 3QWYA 2JXBA 4OMPA 2F2VA 2ABLA 3EG0A 3TSZA 3VS1A 1ABOA 1UE9A 1PNJA 1YWOA 2V1QA 1AWXA 2EYXA 1N5ZA 2M0YA 2MOXA 4JJBA 2EYWA 4JJCA 2JS2A 1WXBA 2W10A 2RPNA 2HBWA 2KE9A 2EGAA 2SRCA 4J9EA 2EQIA 1WXTA 2OAWA 1GCPA 3I9QA 1T0JA 1AWOA 2GQIA 3VS4A 2FPEA 1ZX6A 2MCNA 1JXOA 3RNJA 3TVTA 4F14A 4CC4B 2FG0A 1PRLC 1E6HA
chains in the Genus database with same CATH superfamily
3VV0A 1VUBA 3MEUA 3M0SA 1GCQA 2CUDA 2MPXC 4F7UE 4JRQA 1VQ5Q 5CCAA 4D8KA 3S3OA 3EGXB 2BIVA 3CCMQ 5LJ5e 2M9UA 1OI1A 2X3WD 5CKFA 3CC7T 3SHWA 2ZGWA 3OW2S 4C92G 2PZ1A 2R5MA 1JRIA 3ER0A 2PVOB 3QDFA 5GMKj 4A4FA 4C5HA 2L8DA 3G4SQ 2QGFB 3CCVT 1GFDA 5GAN8 4FU6A 3T9NA 4II1A 4X34A 2XIDA 4DOVA 2NUZA 4BI3A 3QHSA 1MNEA 2KY9A 1KQSA 2RJEA 1I8FA 3OYIA 1UFFA 2LVMA 4QT7A 3Q1JA 4JRKA 1X43A 3LYIA 3V8KA 2VYTA 3HL8A 3V7SA 4HCBA 1VQ4A 2RQUA 1BB9A 3CCLT 1BCOA 2JTEA 4RTZA 3CC7A 3O8VA 1MMNA 4J9IA 3QPHA 4PJOA 4MZTA 4E7SA 1B34B 3CEYA 2PNIA 1XQHA 4GLKA 4NS5A 1M90U 1M90C 1KSWA 3FEOA 3CCVA 1D0XA 4C8QG 3M56A 2IPOB 1VA7A 3JCMd 2HL5C 2MF2A 2K9GA 4PL6A 5A0GA 3BDUA 3CMET 3L42A 5GAMd 1XOVA 4C92D 5DM7R 1NJIC 2KEAA 1TUDA 1WHLA 4JUVA 1SHFA 2EQKA 1OX8A 3VS6A 2ZCFB 1YJWT 2NYSA 5C6SA 1Q86C 1IGUA 1C6VX 2CP7A 4ORZA 5LJ5j 1OZ2A 4CC2A 1T3SA 2WSFE 4K11A 4Q5WA 4XTXA 2LCSA 5DY9A 1ABQA 1AHJB 2DD5A 4L5GA 2A28A 3OYYA 3JV3A 2WSEE 3CMEA 2D9TA 3JCMQ 3EG3A 5GAOp 1LCKA 1N8RR 2QA4T 5GANg 5GAN3 1M1KR 1MHNA 3OQ5A 2EJFA 4GY5A 2VUBA 2DZCA 1KQ1A 5CO7A 4M7DB 1ZQ1A 2A0FB 2J06A 1YJWA 1G8XA 4XU1A 1TH7A 2X4JA 1PKSA 1IHVA 4C8QD 3TREA 3JCMe 2X4YA 2NLUA 2BZ8A 5CKBA 2QK0A 2K5FA 4ANJA 2O9VA 4GLMA 4HA8A 1VQ5T 1QVFS 1SKUB 3CCMT 4M7AF 4M75B 4R56A 5GAMe 4QKUA 1TS9A 1YJNT 1QLYA 3E1SA 4FW2A 2RA2A 3A8LB 1M2OA 4XTZA 3BE3A 1MV0B 1RABB 1UJYA 2K5LA 4JZ4A 3G4ST 4MMLA 2QA4A 3RBBB 1B07A 1U5SA 5FU6B 3CCJQ 5GANh 5GAOr 2XKOC 4DBQA 1C0MA 1IRXA 3M0RA 3KXTA 1N8RU 6AT1B 2QAZA 4M77F 4F16A 1M1KU 4KUDK 1M1KC 2XD0A 2ED1A 3X25B 1RI9A 4OMLA 4IUQA 4KUIA 3QJ6A 1WJRA 3KUFA 4HCZA 4MDXA 2K4YA 1VQ5A 1U1SA 2HSPA 2FZGB 1KHCA 5LL6S 1B3QA 4F7UF 3M0UA 3BY7A 3CCMA 3BDLA 1ZSZC 2JW4A 3JCMX 5GAOm 2XDDA 1YJNA 2XU8A 1IHWA 3NPFA 2K57A 2DETA 5CKEA 4FIBA 1YITQ 2D0QB 4QVCA 2QDYB 3G4SA 1H92A 1FXXA 3JB9J 1YWPA 1ZUYA 4J9BA 3RR6A 2YWWA 3RKXA 4C8QE 2DEUA 2FO0A 2KYMA 1D09B 1VYUA 2L89A 5IXBA 4NL3A 1VQMQ 2JS0A 4RTYA 4XU2A 3X26B 2EJ9A 1AWJA 2DVJA 3RERA 2ZPGB 4E7JA 2DTIA 2QI2A 1KQSS 2PUKB 4AT1B 4M7DG 2QASA 5M9OA 2Z0WA 4M7AB 3HHTB 1JU5C 2DE0X 4M78C 5D6XA 4RCCA 4RKUE 2RF0A 2FZCB 3M0TA 4QW2A 1ZUUA 5KYNA 3E19A 4M75G 1RAHB 1LJOA 1KG1A 2ROTA 4X9DA 3QBYA 2I2LA 2HEQA 2JN0A 2PU9B 5GAMj 3M54A 1AEYA 2ZZDA 2CP3A 1UECA 4M77B 2DL3A 1UGQB 5KYWB 3ZEHA 3GOXA 2LNHB 2DA9A 1QCFA 4LN2A 4DOWA 2BZXA 3ME9A 3M4GA 2K2VA 2DILA 3QDRB 3VYGA 2L3PA 1M8MA 3SWNB 2CSQA 5KYUA 3V7RA 4E7ZA 5ECAA 1WA7A 5FWCA 4DEXA 4EIKA 1XNIA 1K1ZA 2HL3A 3PNWC 2WACA 1WLPB 4HCKA 2CH4W 1Q81R 1AZGB 2J6FA 2DIQA 2COYA 3GP8A 4FCYA 4A4GA 2KGTA 4M7DD 4J9CA 2DKGA 2HD0A 2YT6A 2HQEA 4LDXA 2QQ9A 2YUNA 1QCNA 3OYGA 4HVUA 4XTYA 1PD1A 3OSVA 3CCJT 1CKBA 1OU9A 3TQ7P 1SHGA 3HSBA 4F7UA 4M75D 3DB3A 4X1VA 1K8AR 4OMQA 3OMCA 2DL4A 2CZ7B 3REAB 1RLPC 4HVVA 2EWNA 5GAN4 4M7AG 1N6AA 4PJJA 3P8HA 4LDUA 4PK4A 5IAYA 3CCSQ 1K0XA 2O01E 4C0DB 2AKLA 5GAOn 2MWPA 4ELYC 3VS2A 1YITT 3EG2A 3QWYA 1R8OB 3SDZA 5CR2A 3EG0A 2ABLA 3VS1A 1Q81U 5I2MA 1RAIB 1YWOA 4M78A 1KK7A 2EYXA 5HK0A 5KH6A 4R55A 1N5ZA 2M0YA 4M77G 4C92C 5KYXB 3CCJA 2EYWA 4JJCA 1SF9A 2JS2A 4WTOB 1VQMT 1RI0A 2HQHA 1Q7YR 2KE9A 4J83A 1ZBXA 5KCHA 5GAN6 5HY6A 2K3XA 4ME7A 4BDYA 5J39A 3UT1A 2GQIA 1TSFA 1ZX6A 4M7DE 4FM4B 4CC4B 2FG0A 1E6HA 1IB8A 1KFZA 3M58A 4AG1C 5GAOq 1QVGP 2CSIA 3QO3A 1YITA 2KRSA 1GCQC 3G71Q 2OX7A 2GTJA 4OB0B 1W2BP 4M75E 2M0OA 1AOJA 2W0ZA 2EQUA 4KGZB 2X4WA 3J81E 4BDZA 2NUTB 2LDMA 2KYBA 1BIAA 3HFNA 1AD5A 3FRNA 1VQMA 4M7AD 3LW5E 4FSXA 1UEBA 4RTTA 3GNFB 4Z8AA 1PWTA 1M5Q1 5GAN2 3UWNA 4EMKB 1WFWA 3CCLQ 3O5ZA 1JQQA 2K5IA 3OY9A 4RMOA 1H3HA 3PVLA 2XDBA 3D7SB 1Y71A 1NEGA 1IO6A 3P8DA 1RAGB 4MZMA 1YJ9Q 1WHHA 2Y4YA 4PJMA 3A8GB 1PCXA 2RO0A 2DBMA 4M77D 1WHMA 3A1PA 5GMKl 1K9MR 3JB9I 1X2QA 2RK1A 1PC0A 3QXEB 1NYFA 2EVRA 2KRNA 2X51A 3M0QA 1SSHA 2YDLA 1VQNQ 4RCBA 4PJOC 3THKA 2JT4A 3VYHB 3QYGB 2V8IA 5L8RE 4KH0B 2HKNA 2XHCA 4OMMA 5LJ3g 1I5OB 4OF1A 2AIRB 3QZ9B 4FYYB 2ZPHB 2JUFA 1I1JA 2X4XA 3CXCP 4BI4A 1GBQA 1NZ9A 3UA7A 1MMGA 1WX6A 2FZKB 2DO3A 1N9SA 5GMKh 2ZPEB 1JJ2A 3M5AA 3VS7A 1WNLA 3CC4Q 4IUTA 2RQTA 4E2FB 2FRYA 5DLQE 2VXFA 3PIPA 3CCST 1YFNA 5FWBA 1VQPQ 4QVZA 4AFZC 4E47A 4FW1A 2DLPA 1X6OA 3CQTA 1VIEA 3UF4A 5LJ3h 2LP5A 2C0OA 2JTFA 4M77E 3MEWA 3H9NA 2QEXQ 2J7IA 2ESWA 1QWFA 2AHJB 1TG0A 1X01A 4KH1B 1M90R 2CZ6B 2EGEA 5LJ5g 3CPFA 2GGRA 4BUGA 4TVRA 1YJNQ 1LPLA 4AFUC 2E64A 3CCSA 1ARKA 4RG8A 1NPPA 2YXYA 4C8QA 5CKDA 2YSQA 2E41A 3G71T 1YHQQ 2RJCA 4DBRA 2R5AA 2CYZB 1U3OA 1QWEA 4J6WA 3UATA 1WQWA 5EC7A 1AT1B 1QP2A 2LQWA 2RM4A 1NJIR 4WCIA 5KYYB 3CC2Q 1TTHB 1Y96A 1X27A 4C0ZA 2HCKA 1T3LA 4ZGEB 5FU7C 2XDPA 3LGFA 2DBKA 3JSCA 2KROA 2JM8A 4NOYA 3L2VA 1Q86R 2O88A 2RJFA 2OTJQ 2DF6A 2AK5A 2M1HA 3LLRA 1WIEA 5EG2A 3EGXA 4M7DF 4JZ3A 4XTUA 5LJ5h 2E12A 1KD1U 2PQWA 3VRZA 1KD1C 3M55A 1FMWA 5D7UA 1YJ9T 2KVQG 1RAAB 3EHRA 2V1RA 2HKQB 2DD4A 1Q95G 1Q82U 3G71A 1Q82C 4OP0A 5I22A 2DEQA 5IHNA 3FJPA 1WGSA 1UB4A 1WZOA 2RQWA 4M75F 5CQXA 1VOMA 4JS4A 1M1FA 2E10A 1VQNT 2V8KA 2DXCA 1OYXA 2QTXA 4ELZC 4RTUA 1VQ6Q 2E3HA 2Y90A 2JJ9A 4J9GA 1NJIU 1PRMC 3CCLA 2DMOA 3VS3A 3INZA 4PJLA 1S72Q 3HKSA 3M53A 1UTIA 1J3TA 2D0NA 4FSSA 3E9FA 1G3YA 2D8HA 2OI3A 4J6XA 1GL5A 1YJ9A 2LX9A 3VS5A 1Q86U 2KDSA 1B34A 4GBQA 2E1HA 1RLQC 2DNUA 1VQLT 4OMNA 1SG5A 3CC4T 2YUQA 3VUZA 4LE9A 4UC4A 5A0LA 1RACB 3AHUA 1FMVA 1RUWA 1VQNA 3RESA 1BI1A 4AFQC 3GPLA 3EFOB 3MP6A 4PFPA 2KBTA 3CBPA 1F1BB 3JB9D 1VQPT 3QG1A 1TUGB 2RI3A 5GAN7 1U8RA 2DL8A 4E6RA 2CP5A 2D8JA 4F17A 2DRKA 3JAME 2JTMA 2H8HA 3ULRB 2K79A 2QEXT 1M27C 4N0AA 2PUOB 1JEGA 1WDXA 2K7AA 4IKFA 4L59A 1WQ7A 3X20B 2E5KA 1VQLA 3G6EQ 1NG2A 2WSCE 3CC4A 1JJ2S 2DX1A 4E7HA 2DXUA 5GAMg 1QQJA 4JLIA 1LVKA 1I81A 1K0SA 2ZPIB 1JO8A 2P0QA 4LNPA 4BI8B 2EYQA 1YP5A 2MIOA 1VQPA 1VQ7Q 2EKOA 1YHQT 3OMGA 3SB2A 3TSWA 1YCSB 3CC2T 2DM1A 2QEXA 5FRMA 4J9FA 3EAEA 2YRVA 4M7DA 2G6FX 1W1FA 4C0GA 1PM3A 4J7IA 3C94A 3C4SA 1HYOA 4QVDA 2OTJT 2FRWA 1DJ7B 1PHTA 1WHGA 3MJXA 4M75A 5GAMh 1W6XA 2E3IA 2H3EB 2V26A 3QUIA 1BCMA 2AKKA 2K3YA 2KXCA 2R57A 3EG9B 2DXBA 2XK0A 1YHQA 3C0CA 4A53A 4ZN1A 1K4US 1VQ8Q 3H0IA 3CC2A 4LXCA 3EGUA 1G3TA 2L3QA 1G83A 3RKYA 2EQMA 3EFRA 2RD1A 4BE2A 2F2VA 1VQ6T 4EMGA 4OVAA 1PNJA 2OAUA 3V8JA 4HT8A 2OTJA 1S72T 3JRZA 4A4HA 2HBWA 4ZGJB 1YBYA 3BW1A 1D3BB 3CCEQ 2DK3A 2SRCA 3OW2P 1GCPA 3LGLA 4DA4A 3VS4A 1MMDA 4YTLA 2LNVA 1G3SA 3RNJA 5D6WA 3KBGA 3OA6A 3MPUB 4OMFB 3L2RA 2VXEA 3QZ5B 1KC8C 2LRQA 2QG9B 3C95A 2F2XA 1HXDA 3FJ5A 1VQ6A 3JCMV 3CBOA 2C0TA 2VKNA 1S72A 4VUBA 3MEVA 2DYIA 1H8KA 3FIFA 1JB0E 3H6ZA 1VQOQ 3V7CA 3UPUA 4M7AA 4HXJA 1I07A 1ZSZB 4C5EA 3REBB 1UHFA 1WYXA 3DB4A 2CZ0B 2IG0A 3M4YA 3EGDB 3G6ET 2HAXA 2XI9A 3GF5A 2FPFA 4PJNA 1BI0A 2LT4A 1ZUKA 1GBRA 4OB2B 1QMCA 3MHXA 1ZLMA 5LJ3f 1BBZA 2Y4XA 4PLIA 2MYSA 4BE1A 4M77A 1RADB 3PMIA 2JZ2A 1OEBA 1OPKA 1VQ7T 3RMQA 3HTRA 3OYKA 3L2QA 1D0ZA 4N4GA 5KYWA 1Y07A 3L2WA 4J5YA 4B6MA 1KIKA 2DJQA 4KGVB 3FC3A 2CT4A 2KNBB 2O31A 4BY6C 1RL2A 2HBPA 2O4XB 4M78B 3RKWA 2AZSA 2P0KA 4JPBW 3SWNA 3LH5A 3G6EA 3R6NA 1T0HA 1IZ6A 1OOTA 2EBPA 1QKXA 2FL7A 1ACMB 4F04B 3OB9A 2IVWA 2LQ8A 2R58A 4O5VA 3HP9A 2HNIA 3A8MB 2JOYA 5GJVB 1FWZA 2QDLA 4A4EA 3CPWP 2LC4A 1EX4A 2EGCA 1UDLA 1G5VA 4KGXB 1AWWA 1QKWA 5KE3A 1VQ7A 1V1CA 1X6GA 4KT0E 3OYEA 4QQ6A 1M3CA 1M9SA 2LMJA 1M2VB 5IH2A 2NUPB 3NMZC 1OQKA 5J26A 3S3MA 2QQSA 1VQ8T 2COWA 2LZ6B 5FROA 4DBFA 4RTVA 3QSUA 2KI7A 1UHCA 4FYVB 4DEYA 4BD3A 3OBYA 2P4TA 2RQVA 4X9CA 3ZL7C 3JB9F 3MEAA 4HT9A 1R0BG 1I5LA 2QGGA 1PSFA 1QVFP 3CCET 1BYMA 2C06A 5J3BA 2RK2A 4FT2A 1OU8A 2A08A 1QW1A 4IUVA 1VQ9Q 3OS2A 2E5QA 1X6BA 2MAMA 2F5TX 5IHKA 4XU3A 4BACA 1NE8A 3DKMA 5LJ3d 1CKAA 1VQ8A 5AYFA 5KYXA 2CT3A 5DLOA 1GFCA 1UG1A 2L3SA 4CRIA 2LX7A 4C8QC 3E2UA 3QWXX 1PD0A 2EYYA 1M3AA 2DPPB 4KRTA 5IN1A 8ATCB 3GIBA 4IIOA 1YIJQ 1RAFB 1XJWB 2DL5A 2ZPBB 1VQOT 3RMSA 1P92A 3CCEA 2DZ9A 3GBQA 4PNOA 3BFMA 5GAOl 4Z89A 1I0CA 3J7AF 4FT4A 1MUZA 1GRIA 4EPCA 3WVDB 3QYHB 4JJDA 2VVKA 2BTTA 2EJGA 2NUTA 4C92B 4JLGA 1UUEA 3CPWA 4C5GA 1YCYA 3EFSA 4QQGA 1WJQA 3A8HB 2RJDA 2A7YA 3OYMA 2PTKA 4FYWB 1VQKQ 4EMKA 2RNAA 3OS1A 1D1BA 1B7TA 1VQOA 1D1CA 2BE9B 4IUPA 3HFOA 1PSEA 3JCMc 2KAFA 5LJ3e 1VQLQ 2DTHA 3FLGA 1WI7A 2L2PA 1H641 4LD6A 3X28B 3A8OB 1O9SA 2MMPA 4QQDA 2P4RA 2PVGB 1HK9A 1QVGA 2PVDB 2AZVA 5GANf 1W2BA 1R77A 4R0KA 5I2SA 3M9QA 1NBEB 3VJPA 2M16A 1UJ0A 1YN8A 4HVWA 4ESRA 2KSSA 5D6YA 1KD1R 3QIIA 3MCAB 1K9AA 3OYCA 3HRUA 2FYKA 3I35A 4LUEA 4E7IA 3PFSA 1EZZB 5KCOA 1Q82R 4B9XA 3TCJA 1SPKA 5GJWB 2RI2A 4DQ2A 1EIFA 1OULA 3U23A 1VYVA 2F2WA 3JCMJ 2J6OA 4N0AC 4PJOB 1VQ4T 4AMCA 2JMCA 2YUOA 4CC3A 1VQ9T 3VS0A 2ED0A 2ZAEA 1MGQA 3ZBDA 1AZEA 2LTOA 2CKKA 2RHXA 2F69A 3HRTA 3H0HA 1PKTA 3CMAQ 3I5RA 1OX9A 4JRIA 1M3BA 2COZA 2RB6A 4Y92A 9ATCB 3JB9G 3CXCA 4XAXB 1M4ZA 1YIJT 2MK5A 4M78E 2EQJA 3M59A 1Y0MA 2XICA 2E70A 5FW9A 3VRYA 2RHYA 2K2MA 2DIGA 5LJ3j 4M7DC 4B9WA 2GBQA 3L2UA 2CREA 1VQ9A 2BKDN 5FLXE 1S1NA 3MO8A 3PIOA 5GANd 1W4SA 2KMTA 3EHQA 2RHUA 3CCUQ 4RG2A 4C5IA 4M75C 5KYYA 2JVVA 2LCLA 2VC8A 5L23A 2M02A 1E7OA 2EW3A 1VQKT 1OV3A 2DRMA 5A0DA 1H3ZA 1YIJA 1BIBA 2DTOA 2KT8A 1TXQA 5FU6C 2VGMA 4LDWA 1BI3A 2JXBA 4OMPA 4WF2A 2DAQA 4LDVA 2EFIA 2V1QA 1AWXA 1M8VA 4JJBA 4EMHA 1WXBA 3WXMB 2W10A 3ZFJA 4MZPA 4C0FA 4PJOG 3L1AA 2EGAA 1BKBA 3LWHA 2EQIA 1WXTA 3S6WA 1KQ2A 4E7LA 3I9QA 1N27A 3E9GA 3CPWS 1VIFA 3NTHA 1VQKA 5IT9E 5FU7B 2MCNA 1JXOA 3TVTA 4ZN3A 3MP1A 2L3RA 1PRLC 3G7ZA 2LT1A 8AT1B 4ZTFA 1MV3A 3DLLA 4MDWA 2A36A 3URGA 1BK2A 3JCMg 1AVZC 3I56Q 3EG1A 5GANe 2FPDA 3MP8A 2B8AA 5HK3A 3OYAA 2EAYA 3LX7A 2X35A 4IURA 4PFOA 1Z9QA 5HCKA 3A98A 1EFNA 1HSQA 2H3JA 2EKHA 1YI2Q 5CVIA 3VU3C 4M7AC 4Z02A 4A54A 2KT1A 3RUXA 2O2OA 5GAN5 1CSKA 1QVGS 2EPDA 1Z9ZA 3EFOA 2L5QA 4KBMB 3AT1B 1W2BS 3ASKA 4JS5A 4BE0A 3RDVA 2GF7A 4C92E 1SRLA 3HPWA 2KR3A 3CMAT 1LNXA 2MI6A 2FB7A 2XG8D 2RHZA 3JCMh 4M77C 4JDSA 4PJOD 4XK8E 2YUPA 1QP3A 3PGGA 3N5BB 4OB3B 1N8RC 1IXDA 5KE2A 1MNDA 2M51A 1JBMA 1XTDA 4ZNXA 3HRSA 1KC8R 1V76A 2D1XA 3SWNC 2J05A 2OJ2A 5GMKm 4J9HA 3F70A 2FEIA 3DLMA 5FRNA 1NYGA 1JXMA 3CMAA 3CCUT 3JCMP 3NGPA 4J6YA 1UGPB 1ZA1B 4ZTJA 3SD4A 2J6KA 1IREB 5C0MA 1YNZA 2DERA 1W70A 1HD3A 1U1TA 2F5KA 2DYBA 2RHIA 2HMAA 2YHTA 2JNGA 3CXCS 4M78F 1FYNA 2SEMA 3FDRA 5IHIA 5GANj 2LCCA 5I11A 4KULA 2HSEB 4AFSC 4LDYA 3VUBA 2VWFA 4Y91A 1UGVA 2K6DA 3EG9A 4DBHA 5KYUB 2B86A 1KC8U 1QVPA 3FB9A 3IQLA 2ZPFB 3NTIA 3I55Q 3CCUA 1A0NB 4PJOE 4XU0A 4XTVA 2GCXA 2YRCA 2V8JA 4J7FA 4N4IA 2CP2A 4RTXA 4C0DC 3CBMA 4OB1B 4V2SA 2KXDA 3CD6Q 3PVQA 3JCMW 4Z88A 2RQRA 2GFUA 2LJ3A 1U06A 3KFVA 2XMFA 2P0PA 3PMTA 4OGEA 1WHKA 4J8OA 3QKJA 3CCRQ 2CP6A 3I56T 1D3BA 4ZGDB 4L6V5 4F7UB 4XQ3A 2X9HA 2E6ZA 5I21A 2QQAA 2DVEA 1YI2T 2BZYA 2HZYA 1KHIA 2QYZA 3RIRA 1UGSB 2F1LA 2CDTA 2EIFA 1IGQA 1NLOC 2E4HA 2ATCB 3JCMb 1NLPC 2HDAA 1TU0B 4Y28E 2MWOA 3MKDA 3CCQQ 1ZA2B 1WHJA 2ENMA 2OTLQ 3QJYA 1QCOA 3UA6A 1E6GA 1G3WA 1WPYA 3I56A 1NEBA 2I0NA 1TOVA 1ZSZA 3C12A 2GQVA 2VASA 1ZBJA 2GFAA 3M57A 2JM9A 2D6FA 2AT1B 2IIMA 4EMKC 3EGDA 2QQBA 2C0IA 2KRMA 2GTOA 4A4KA 1YI2A 1HJDA 4FYXB 2A3LA 2X3XD 1WXUA 1UGRB 3M0PA 3NFCA 2CH4A 5CK9A 2YLCA 3S3NA 3OW2A 2RMOA 4EDUA 1M1GA 2QTVA 1VYTA 3NTKA 1V29B 2JMAA 3META 4JJNK 4IIMA 2G3RA 4C92F 3PE0A 4LD9K 1Y57A 4ATOA 1K73R 5LJ5f 1Q81C 4LUDA 1OZ3A 2O4XA 3H41A 1I4K1 5CKHA 4NL2A 4CI0C 3WVEB 2CZ1B 2BE7D 5IXFA 4F7UG 2GNCA 1TWBA 1O75A 4BB7A 1JJ2P 2CGHA 2O9SA 2YLBA 1VQ4Q 4M4ZA 4FL6A 1X2KA 2VB6A 2LQKA 5HKCA 1OPLA 3CC7Q 2BUDA 2HQXA 1K8AU 1C1AA 1K8AC 1Y7XA 2LJ1A 2CS7A 4IUUA 5GMKi 7AT1B 1M2VA 3I5SA 3I55T 3CCVQ 4PFZA 2NUPA 2L0AA 3P8BB 4BY6B 1GXIE 2ECZA 3X24B 1NPRA 5A2QE 2DL7A 2DXTA 4C8QF 4M78G 3CD6T 4MMKA 1K73U 5CQYA 4XTWA 1K73C 4PKCC 2FHDA 3J80E 1ZSGA 3PTAA 3CCRT 1RAEB 2EYZA 4J9DA 2ROLA 3OS0A 1MMAA 2QXFA 2QQRA 2FVUA 3NHNA 1X75C 3OSSC 1K76A 1G2BA 1ZHIA 3SFMA 4RTWA 3A5ZB 1Q7YU 1SEMA 1M30A 1Q7YC 4OMOA 4D8DA 4CC7A 1KJWA 3H0FA 5GMKe 1SSFA 4A63B 1WJSA 1TUCA 3R6OA 3I55A 3G1JA 3V8LA 4JRPA 2VV5A 4PJOF 4D6WA 3TEEA 3OYBA 4OGCA 4RUGA 3LH0A 3EH2A 1PG5B 2A37A 1NM7A 3CD6A 3SEMA 2CP0A 1BU1A 1KQSP 1D1AA 2DJZA 3VKIA 2RN8A 4P5NA 3UDCA 5LJ5d 3PT9A 4AG2C 2K3BA 3OYDA 2E65A 3CMEQ 3CCRA 3CCQT 2LJ0A 2E6NA 1FMKA 2OTLT 2VGNA 3LWIA 1X69A 3OS5A 2KQWA 5CIUA 1LOJA 1SRMA 1R0CB 2CUBA 1N9RA 4O6JA 2RH2A 5AT1B 2LQNA 1YJWQ 2NWMA 3OYFA 3EH1A 1QVFA 3OYLA 4N4HA 3TSZA 1ABOA 1UE9A 4M78D 3JB9H 4C92A 4M7AE 4E7KA 3OYHA 3TU4K 2MOXA 4HKEA 4C8QB 2RPNA 2RI5A 1K9MU 3GNGA 1K9MC 3JCMf 3H8ZA 3CCQA 1FX7A 3OYJA 2P84A 4J9EA 2QA4Q 4HCCA 2OTLA 2OAWA 3OBWA 1T0JA 4PLLA 1AWOA 2DFUA 3GLXA 2FPEA 1Y96B 2KK4A 5GAMf 3OYNA 3L2ZA 4F14A 1BI2A 1D0YA 5CAIA 2YRDA
chains in the Genus database with same CATH topology
1KFZA 1MV3A 4AG1C 3M0SA 1GCQA 2A36A 2CSIA 1BK2A 2CUDA 2F2XA 3FJ5A 2KRSA 1GCQC 1AVZC 3EG1A 2GTJA 2FPDA 4D8KA 1AOJA 2W0ZA 2X3WD 1Z9QA 2C0TA 5HCKA 3SHWA 2VKNA 2PZ1A 3A98A 1H8KA 2KYBA 1EFNA 1HSQA 1AD5A 2EKHA 4HXJA 4RTTA 4Z8AA 1I07A 1PWTA 3REBB 1UHFA 1WYXA 2KT1A 2O2OA 1WFWA 1GFDA 3O5ZA 1CSKA 1JQQA 1H3HA 2EPDA 1Z9ZA 3PVLA 1NEGA 2NUZA 1IO6A 2FPFA 1SRLA 1UFFA 1ZUKA 4QT7A 2KR3A 1GBRA 1X43A 2DBMA 1ZLMA 1BBZA 1X2QA 2RQUA 1BB9A 1OEBA 1OPKA 2JTEA 4RTZA 1NYFA 2EVRA 4J9IA 2KRNA 2YUPA 3M0QA 1KIKA 1SSHA 2DJQA 2YDLA 2PNIA 3THKA 2CT4A 2JT4A 2KNBB 2O31A 2M51A 4ZNXA 1KSWA 4OMMA 2AZSA 4JPBW 3LH5A 2D1XA 3R6NA 2J05A 1VA7A 1T0HA 2OJ2A 1I1JA 1OOTA 2EBPA 1GBQA 1QKXA 3UA7A 4J9HA 2FEIA 2K9GA 1WX6A 5GJVB 1NYGA 2QDLA 1JXMA 2EGCA 1UDLA 3NGPA 1XOVA 3VS7A 1AWWA 1QKWA 2J6KA 1V1CA 1X6GA 2KEAA 1YNZA 1W70A 1TUDA 1HD3A 1M3CA 2LMJA 2RQTA 1SHFA 2FRYA 5IH2A 3VS6A 3NMZC 2DYBA 2LZ6B 1FYNA 2SEMA 5FWBA 4RTVA 5IHIA 5I11A 4ORZA 4AFZC 4AFSC 2DLPA 3CQTA 1UHCA 4CC2A 1T3SA 2VWFA 3UF4A 1UGVA 2LP5A 2K6DA 2C0OA 4K11A 4DEYA 2LCSA 1ABQA 2B86A 2RQVA 2J7IA 3IQLA 2ESWA 3ZL7C 2A28A 3JV3A 1QWFA 1A0NB 3EG3A 1LCKA 1TG0A 2A08A 2EGEA 4RTXA 1X6BA 2GGRA 2KXDA 3PVQA 5IHKA 4Z88A 1CKAA 2J06A 4AFUC 2RQRA 2LJ3A 1U06A 3KFVA 1ARKA 2CT3A 1PKSA 1GFCA 1UG1A 2XMFA 2L3SA 2YSQA 2BZ8A 2LX7A 3QWXX 2O9VA 4GLMA 2EYYA 1M3AA 1U3OA 1QWEA 3UATA 4KRTA 4IIOA 5EC7A 2LQWA 4WCIA 1QLYA 2DL5A 1X27A 2HCKA 1T3LA 2BZYA 3GBQA 2DBKA 2KROA 1MV0B 1UJYA 2CDTA 2JM8A 4JZ4A 4Z89A 1I0CA 1NLOC 3RBBB 1B07A 1U5SA 2O88A 1MUZA 1NLPC 1GRIA 2DF6A 2AK5A 2HDAA 1WIEA 3M0RA 4JJDA 2VVKA 4JZ3A 2BTTA 3VRZA 4F16A 2ED1A 1UUEA 1RI9A 3EHRA 2V1RA 2ENMA 4OMLA 3UA6A 1E6GA 1NEBA 5I22A 2I0NA 2HSPA 2PTKA 5IHNA 1B3QA 3M0UA 1ZBJA 2RQWA 2JW4A 2JM9A 2RNAA 2IIMA 3NPFA 2C0IA 2KRMA 2GTOA 1HJDA 2X3XD 1WXUA 4RTUA 3M0PA 2CH4A 4J9GA 1H92A 1PRMC 1YWPA 2DMOA 2RMOA 1WI7A 1ZUYA 4J9BA 2L2PA 3VS3A 2FO0A 2KYMA 1VYTA 1VYUA 5IXBA 1UTIA 1J3TA 2JMAA 2JS0A 4RTYA 2D0NA 4FSSA 1AWJA 2DVJA 4IIMA 2D8HA 2OI3A 1GL5A 2P4RA 3VS5A 3PE0A 2AZVA 1Y57A 4GBQA 1RLQC 2DNUA 4LUDA 4R0KA 3H41A 4OMNA 2YUQA 1JU5C 4LE9A 2DE0X 1UJ0A 1RUWA 2RF0A 1YN8A 3M0TA 4HVWA 4AFQC 1ZUUA 4ESRA 5IXFA 2GNCA 2KBTA 2O9SA 1K9AA 4M4ZA 2ROTA 1X2KA 1OPLA 3I35A 2DL8A 4LUEA 4E6RA 2HEQA 2D8JA 4F17A 2LJ1A 1SPKA 2DRKA 5GJWB 1AEYA 2H8HA 3U23A 3ULRB 2K79A 1UECA 1M27C 1VYVA 2DL3A 2F2WA 3I5SA 1JEGA 1WDXA 2K7AA 2J6OA 2L0AA 2E5KA 2LNHB 2JMCA 2YUOA 1NG2A 2DA9A 1QCFA 4CC3A 2ECZA 4LN2A 2BZXA 2DX1A 3VS0A 2ED0A 2DILA 2DL7A 1AZEA 2L3PA 1K0SA 1JO8A 1M8MA 3H0HA 1PKTA 4LNPA 2CSQA 1ZSGA 2EYZA 4J9DA 1YP5A 2MIOA 2ROLA 3I5RA 5ECAA 1WA7A 3NHNA 5FWCA 1M3BA 4DEXA 1K76A 4EIKA 1G2BA 4RTWA 1K1ZA 4Y92A 1WLPB 1SEMA 4HCKA 1M30A 2CH4W 4OMOA 4D8DA 1AZGB 1KJWA 3TSWA 2J6FA 1YCSB 3H0FA 4CC7A 4A63B 2DM1A 1TUCA 1Y0MA 2KGTA 4J9FA 5FW9A 4J9CA 3VRYA 2G6FX 1W1FA 2K2MA 2YT6A 2GBQA 2YUNA 4RUGA 2CREA 1S1NA 4HVUA 2A37A 1NM7A 1CKBA 3SEMA 2FRWA 1BU1A 1PHTA 1SHGA 4X1VA 2RN8A 4OMQA 3EHQA 2DL4A 4AG2C 2K3BA 3REAB 1RLPC 1W6XA 4HVVA 2LJ0A 1FMKA 5L23A 2AKKA 1X69A 2KXCA 1E7OA 1SRMA 2EW3A 2CUBA 1OV3A 3C0CA 2DRMA 2LQNA 1K4US 3H0IA 1K0XA 2AKLA 2KT8A 3EGUA 2NWMA 2L3QA 1G83A 3VS2A 3EG2A 3QWYA 2JXBA 4OMPA 2F2VA 2ABLA 3EG0A 3TSZA 3VS1A 1ABOA 1UE9A 1PNJA 1YWOA 2V1QA 1AWXA 2EYXA 1N5ZA 2M0YA 2MOXA 4JJBA 2EYWA 4JJCA 2JS2A 1WXBA 2W10A 2RPNA 2HBWA 2KE9A 2EGAA 2SRCA 4J9EA 2EQIA 1WXTA 2OAWA 1GCPA 3I9QA 1T0JA 1AWOA 2GQIA 3VS4A 2FPEA 1ZX6A 2MCNA 1JXOA 3RNJA 3TVTA 4F14A 4CC4B 2FG0A 1PRLC 1E6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFZ A;  1MV3 A;  4AG1 C;  3M0S A;  1GCQ A;  2A36 A;  2CSI A;  1BK2 A;  2CUD A;  2F2X A;  3FJ5 A;  2KRS A;  1GCQ C;  1AVZ C;  3EG1 A;  2GTJ A;  2FPD A;  4D8K A;  1AOJ A;  2W0Z A;  2X3W D;  1Z9Q A;  2C0T A;  5HCK A;  3SHW A;  2VKN A;  2PZ1 A;  3A98 A;  1H8K A;  2KYB A;  1EFN A;  1HSQ A;  1AD5 A;  2EKH A;  4HXJ A;  4RTT A;  4Z8A A;  1I07 A;  1PWT A;  3REB B;  1UHF A;  1WYX A;  2KT1 A;  2O2O A;  1WFW A;  1GFD A;  3O5Z A;  1CSK A;  1JQQ A;  1H3H A;  2EPD A;  1Z9Z A;  3PVL A;  1NEG A;  2NUZ A;  1IO6 A;  2FPF A;  1SRL A;  1UFF A;  1ZUK A;  4QT7 A;  2KR3 A;  1GBR A;  1X43 A;  2DBM A;  1ZLM A;  1BBZ A;  1X2Q A;  2RQU A;  1BB9 A;  1OEB A;  1OPK A;  2JTE A;  4RTZ A;  1NYF A;  2EVR A;  4J9I A;  2KRN A;  2YUP A;  3M0Q A;  1KIK A;  1SSH A;  2DJQ A;  2YDL A;  2PNI A;  3THK A;  2CT4 A;  2JT4 A;  2KNB B;  2O31 A;  2M51 A;  4ZNX A;  1KSW A;  4OMM A;  2AZS A;  4JPB W;  3LH5 A;  2D1X A;  3R6N A;  2J05 A;  1VA7 A;  1T0H A;  2OJ2 A;  1I1J A;  1OOT A;  2EBP A;  1GBQ A;  1QKX A;  3UA7 A;  4J9H A;  2FEI A;  2K9G A;  1WX6 A;  5GJV B;  1NYG A;  2QDL A;  1JXM A;  2EGC A;  1UDL A;  3NGP A;  1XOV A;  3VS7 A;  1AWW A;  1QKW A;  2J6K A;  1V1C A;  1X6G A;  2KEA A;  1YNZ A;  1W70 A;  1TUD A;  1HD3 A;  1M3C A;  2LMJ A;  2RQT A;  1SHF A;  2FRY A;  5IH2 A;  3VS6 A;  3NMZ C;  2DYB A;  2LZ6 B;  1FYN A;  2SEM A;  5FWB A;  4RTV A;  5IHI A;  5I11 A;  4ORZ A;  4AFZ C;  4AFS C;  2DLP A;  3CQT A;  1UHC A;  4CC2 A;  1T3S A;  2VWF A;  3UF4 A;  1UGV A;  2LP5 A;  2K6D A;  2C0O A;  4K11 A;  4DEY A;  2LCS A;  1ABQ A;  2B86 A;  2RQV A;  2J7I A;  3IQL A;  2ESW A;  3ZL7 C;  2A28 A;  3JV3 A;  1QWF A;  1A0N B;  3EG3 A;  1LCK A;  1TG0 A;  2A08 A;  2EGE A;  4RTX A;  1X6B A;  2GGR A;  2KXD A;  3PVQ A;  5IHK A;  4Z88 A;  1CKA A;  2J06 A;  4AFU C;  2RQR A;  2LJ3 A;  1U06 A;  3KFV A;  1ARK A;  2CT3 A;  1PKS A;  1GFC A;  1UG1 A;  2XMF A;  2L3S A;  2YSQ A;  2BZ8 A;  2LX7 A;  3QWX X;  2O9V A;  4GLM A;  2EYY A;  1M3A A;  1U3O A;  1QWE A;  3UAT A;  4KRT A;  4IIO A;  5EC7 A;  2LQW A;  4WCI A;  1QLY A;  2DL5 A;  1X27 A;  2HCK A;  1T3L A;  2BZY A;  3GBQ A;  2DBK A;  2KRO A;  1MV0 B;  1UJY A;  2CDT A;  2JM8 A;  4JZ4 A;  4Z89 A;  1I0C A;  1NLO C;  3RBB B;  1B07 A;  1U5S A;  2O88 A;  1MUZ A;  1NLP C;  1GRI A;  2DF6 A;  2AK5 A;  2HDA A;  1WIE A;  3M0R A;  4JJD A;  2VVK A;  4JZ3 A;  2BTT A;  3VRZ A;  4F16 A;  2ED1 A;  1UUE A;  1RI9 A;  3EHR A;  2V1R A;  2ENM A;  4OML A;  3UA6 A;  1E6G A;  1NEB A;  5I22 A;  2I0N A;  2HSP A;  2PTK A;  5IHN A;  1B3Q A;  3M0U A;  1ZBJ A;  2RQW A;  2JW4 A;  2JM9 A;  2RNA A;  2IIM A;  3NPF A;  2C0I A;  2KRM A;  2GTO A;  1HJD A;  2X3X D;  1WXU A;  4RTU A;  3M0P A;  2CH4 A;  4J9G A;  1H92 A;  1PRM C;  1YWP A;  2DMO A;  2RMO A;  1WI7 A;  1ZUY A;  4J9B A;  2L2P A;  3VS3 A;  2FO0 A;  2KYM A;  1VYT A;  1VYU A;  5IXB A;  1UTI A;  1J3T A;  2JMA A;  2JS0 A;  4RTY A;  2D0N A;  4FSS A;  1AWJ A;  2DVJ A;  4IIM A;  2D8H A;  2OI3 A;  1GL5 A;  2P4R A;  3VS5 A;  3PE0 A;  2AZV A;  1Y57 A;  4GBQ A;  1RLQ C;  2DNU A;  4LUD A;  4R0K A;  3H41 A;  4OMN A;  2YUQ A;  1JU5 C;  4LE9 A;  2DE0 X;  1UJ0 A;  1RUW A;  2RF0 A;  1YN8 A;  3M0T A;  4HVW A;  4AFQ C;  1ZUU A;  4ESR A;  5IXF A;  2GNC A;  2KBT A;  2O9S A;  1K9A A;  4M4Z A;  2ROT A;  1X2K A;  1OPL A;  3I35 A;  2DL8 A;  4LUE A;  4E6R A;  2HEQ A;  2D8J A;  4F17 A;  2LJ1 A;  1SPK A;  2DRK A;  5GJW B;  1AEY A;  2H8H A;  3U23 A;  3ULR B;  2K79 A;  1UEC A;  1M27 C;  1VYV A;  2DL3 A;  2F2W A;  3I5S A;  1JEG A;  1WDX A;  2K7A A;  2J6O A;  2L0A A;  2E5K A;  2LNH B;  2JMC A;  2YUO A;  1NG2 A;  2DA9 A;  1QCF A;  4CC3 A;  2ECZ A;  4LN2 A;  2BZX A;  2DX1 A;  3VS0 A;  2ED0 A;  2DIL A;  2DL7 A;  1AZE A;  2L3P A;  1K0S A;  1JO8 A;  1M8M A;  3H0H A;  1PKT A;  4LNP A;  2CSQ A;  1ZSG A;  2EYZ A;  4J9D A;  1YP5 A;  2MIO A;  2ROL A;  3I5R A;  5ECA A;  1WA7 A;  3NHN A;  5FWC A;  1M3B A;  4DEX A;  1K76 A;  4EIK A;  1G2B A;  4RTW A;  1K1Z A;  4Y92 A;  1WLP B;  1SEM A;  4HCK A;  1M30 A;  2CH4 W;  4OMO A;  4D8D A;  1AZG B;  1KJW A;  3TSW A;  2J6F A;  1YCS B;  3H0F A;  4CC7 A;  4A63 B;  2DM1 A;  1TUC A;  1Y0M A;  2KGT A;  4J9F A;  5FW9 A;  4J9C A;  3VRY A;  2G6F X;  1W1F A;  2K2M A;  2YT6 A;  2GBQ A;  2YUN A;  4RUG A;  2CRE A;  1S1N A;  4HVU A;  2A37 A;  1NM7 A;  1CKB A;  3SEM A;  2FRW A;  1BU1 A;  1PHT A;  1SHG A;  4X1V A;  2RN8 A;  4OMQ A;  3EHQ A;  2DL4 A;  4AG2 C;  2K3B A;  3REA B;  1RLP C;  1W6X A;  4HVV A;  2LJ0 A;  1FMK A;  5L23 A;  2AKK A;  1X69 A;  2KXC A;  1E7O A;  1SRM A;  2EW3 A;  2CUB A;  1OV3 A;  3C0C A;  2DRM A;  2LQN A;  1K4U S;  3H0I A;  1K0X A;  2AKL A;  2KT8 A;  3EGU A;  2NWM A;  2L3Q A;  1G83 A;  3VS2 A;  3EG2 A;  3QWY A;  2JXB A;  4OMP A;  2F2V A;  2ABL A;  3EG0 A;  3TSZ A;  3VS1 A;  1ABO A;  1UE9 A;  1PNJ A;  1YWO A;  2V1Q A;  1AWX A;  2EYX A;  1N5Z A;  2M0Y A;  2MOX A;  4JJB A;  2EYW A;  4JJC A;  2JS2 A;  1WXB A;  2W10 A;  2RPN A;  2HBW A;  2KE9 A;  2EGA A;  2SRC A;  4J9E A;  2EQI A;  1WXT A;  2OAW A;  1GCP A;  3I9Q A;  1T0J A;  1AWO A;  2GQI A;  3VS4 A;  2FPE A;  1ZX6 A;  2MCN A;  1JXO A;  3RNJ A;  3TVT A;  4F14 A;  4CC4 B;  2FG0 A;  1PRL C;  1E6H A; 
#chains in the Genus database with same CATH topology
 3VV0 A;  1VUB A;  3MEU A;  3M0S A;  1GCQ A;  2CUD A;  2MPX C;  4F7U E;  4JRQ A;  1VQ5 Q;  5CCA A;  4D8K A;  3S3O A;  3EGX B;  2BIV A;  3CCM Q;  5LJ5 e;  2M9U A;  1OI1 A;  2X3W D;  5CKF A;  3CC7 T;  3SHW A;  2ZGW A;  3OW2 S;  4C92 G;  2PZ1 A;  2R5M A;  1JRI A;  3ER0 A;  2PVO B;  3QDF A;  5GMK j;  4A4F A;  4C5H A;  2L8D A;  3G4S Q;  2QGF B;  3CCV T;  1GFD A;  5GAN 8;  4FU6 A;  3T9N A;  4II1 A;  4X34 A;  2XID A;  4DOV A;  2NUZ A;  4BI3 A;  3QHS A;  1MNE A;  2KY9 A;  1KQS A;  2RJE A;  1I8F A;  3OYI A;  1UFF A;  2LVM A;  4QT7 A;  3Q1J A;  4JRK A;  1X43 A;  3LYI A;  3V8K A;  2VYT A;  3HL8 A;  3V7S A;  4HCB A;  1VQ4 A;  2RQU A;  1BB9 A;  3CCL T;  1BCO A;  2JTE A;  4RTZ A;  3CC7 A;  3O8V A;  1MMN A;  4J9I A;  3QPH A;  4PJO A;  4MZT A;  4E7S A;  1B34 B;  3CEY A;  2PNI A;  1XQH A;  4GLK A;  4NS5 A;  1M90 U;  1M90 C;  1KSW A;  3FEO A;  3CCV A;  1D0X A;  4C8Q G;  3M56 A;  2IPO B;  1VA7 A;  3JCM d;  2HL5 C;  2MF2 A;  2K9G A;  4PL6 A;  5A0G A;  3BDU A;  3CME T;  3L42 A;  5GAM d;  1XOV A;  4C92 D;  5DM7 R;  1NJI C;  2KEA A;  1TUD A;  1WHL A;  4JUV A;  1SHF A;  2EQK A;  1OX8 A;  3VS6 A;  2ZCF B;  1YJW T;  2NYS A;  5C6S A;  1Q86 C;  1IGU A;  1C6V X;  2CP7 A;  4ORZ A;  5LJ5 j;  1OZ2 A;  4CC2 A;  1T3S A;  2WSF E;  4K11 A;  4Q5W A;  4XTX A;  2LCS A;  5DY9 A;  1ABQ A;  1AHJ B;  2DD5 A;  4L5G A;  2A28 A;  3OYY A;  3JV3 A;  2WSE E;  3CME A;  2D9T A;  3JCM Q;  3EG3 A;  5GAO p;  1LCK A;  1N8R R;  2QA4 T;  5GAN g;  5GAN 3;  1M1K R;  1MHN A;  3OQ5 A;  2EJF A;  4GY5 A;  2VUB A;  2DZC A;  1KQ1 A;  5CO7 A;  4M7D B;  1ZQ1 A;  2A0F B;  2J06 A;  1YJW A;  1G8X A;  4XU1 A;  1TH7 A;  2X4J A;  1PKS A;  1IHV A;  4C8Q D;  3TRE A;  3JCM e;  2X4Y A;  2NLU A;  2BZ8 A;  5CKB A;  2QK0 A;  2K5F A;  4ANJ A;  2O9V A;  4GLM A;  4HA8 A;  1VQ5 T;  1QVF S;  1SKU B;  3CCM T;  4M7A F;  4M75 B;  4R56 A;  5GAM e;  4QKU A;  1TS9 A;  1YJN T;  1QLY A;  3E1S A;  4FW2 A;  2RA2 A;  3A8L B;  1M2O A;  4XTZ A;  3BE3 A;  1MV0 B;  1RAB B;  1UJY A;  2K5L A;  4JZ4 A;  3G4S T;  4MML A;  2QA4 A;  3RBB B;  1B07 A;  1U5S A;  5FU6 B;  3CCJ Q;  5GAN h;  5GAO r;  2XKO C;  4DBQ A;  1C0M A;  1IRX A;  3M0R A;  3KXT A;  1N8R U;  6AT1 B;  2QAZ A;  4M77 F;  4F16 A;  1M1K U;  4KUD K;  1M1K C;  2XD0 A;  2ED1 A;  3X25 B;  1RI9 A;  4OML A;  4IUQ A;  4KUI A;  3QJ6 A;  1WJR A;  3KUF A;  4HCZ A;  4MDX A;  2K4Y A;  1VQ5 A;  1U1S A;  2HSP A;  2FZG B;  1KHC A;  5LL6 S;  1B3Q A;  4F7U F;  3M0U A;  3BY7 A;  3CCM A;  3BDL A;  1ZSZ C;  2JW4 A;  3JCM X;  5GAO m;  2XDD A;  1YJN A;  2XU8 A;  1IHW A;  3NPF A;  2K57 A;  2DET A;  5CKE A;  4FIB A;  1YIT Q;  2D0Q B;  4QVC A;  2QDY B;  3G4S A;  1H92 A;  1FXX A;  3JB9 J;  1YWP A;  1ZUY A;  4J9B A;  3RR6 A;  2YWW A;  3RKX A;  4C8Q E;  2DEU A;  2FO0 A;  2KYM A;  1D09 B;  1VYU A;  2L89 A;  5IXB A;  4NL3 A;  1VQM Q;  2JS0 A;  4RTY A;  4XU2 A;  3X26 B;  2EJ9 A;  1AWJ A;  2DVJ A;  3RER A;  2ZPG B;  4E7J A;  2DTI A;  2QI2 A;  1KQS S;  2PUK B;  4AT1 B;  4M7D G;  2QAS A;  5M9O A;  2Z0W A;  4M7A B;  3HHT B;  1JU5 C;  2DE0 X;  4M78 C;  5D6X A;  4RCC A;  4RKU E;  2RF0 A;  2FZC B;  3M0T A;  4QW2 A;  1ZUU A;  5KYN A;  3E19 A;  4M75 G;  1RAH B;  1LJO A;  1KG1 A;  2ROT A;  4X9D A;  3QBY A;  2I2L A;  2HEQ A;  2JN0 A;  2PU9 B;  5GAM j;  3M54 A;  1AEY A;  2ZZD A;  2CP3 A;  1UEC A;  4M77 B;  2DL3 A;  1UGQ B;  5KYW B;  3ZEH A;  3GOX A;  2LNH B;  2DA9 A;  1QCF A;  4LN2 A;  4DOW A;  2BZX A;  3ME9 A;  3M4G A;  2K2V A;  2DIL A;  3QDR B;  3VYG A;  2L3P A;  1M8M A;  3SWN B;  2CSQ A;  5KYU A;  3V7R A;  4E7Z A;  5ECA A;  1WA7 A;  5FWC A;  4DEX A;  4EIK A;  1XNI A;  1K1Z A;  2HL3 A;  3PNW C;  2WAC A;  1WLP B;  4HCK A;  2CH4 W;  1Q81 R;  1AZG B;  2J6F A;  2DIQ A;  2COY A;  3GP8 A;  4FCY A;  4A4G A;  2KGT A;  4M7D D;  4J9C A;  2DKG A;  2HD0 A;  2YT6 A;  2HQE A;  4LDX A;  2QQ9 A;  2YUN A;  1QCN A;  3OYG A;  4HVU A;  4XTY A;  1PD1 A;  3OSV A;  3CCJ T;  1CKB A;  1OU9 A;  3TQ7 P;  1SHG A;  3HSB A;  4F7U A;  4M75 D;  3DB3 A;  4X1V A;  1K8A R;  4OMQ A;  3OMC A;  2DL4 A;  2CZ7 B;  3REA B;  1RLP C;  4HVV A;  2EWN A;  5GAN 4;  4M7A G;  1N6A A;  4PJJ A;  3P8H A;  4LDU A;  4PK4 A;  5IAY A;  3CCS Q;  1K0X A;  2O01 E;  4C0D B;  2AKL A;  5GAO n;  2MWP A;  4ELY C;  3VS2 A;  1YIT T;  3EG2 A;  3QWY A;  1R8O B;  3SDZ A;  5CR2 A;  3EG0 A;  2ABL A;  3VS1 A;  1Q81 U;  5I2M A;  1RAI B;  1YWO A;  4M78 A;  1KK7 A;  2EYX A;  5HK0 A;  5KH6 A;  4R55 A;  1N5Z A;  2M0Y A;  4M77 G;  4C92 C;  5KYX B;  3CCJ A;  2EYW A;  4JJC A;  1SF9 A;  2JS2 A;  4WTO B;  1VQM T;  1RI0 A;  2HQH A;  1Q7Y R;  2KE9 A;  4J83 A;  1ZBX A;  5KCH A;  5GAN 6;  5HY6 A;  2K3X A;  4ME7 A;  4BDY A;  5J39 A;  3UT1 A;  2GQI A;  1TSF A;  1ZX6 A;  4M7D E;  4FM4 B;  4CC4 B;  2FG0 A;  1E6H A;  1IB8 A;  1KFZ A;  3M58 A;  4AG1 C;  5GAO q;  1QVG P;  2CSI A;  3QO3 A;  1YIT A;  2KRS A;  1GCQ C;  3G71 Q;  2OX7 A;  2GTJ A;  4OB0 B;  1W2B P;  4M75 E;  2M0O A;  1AOJ A;  2W0Z A;  2EQU A;  4KGZ B;  2X4W A;  3J81 E;  4BDZ A;  2NUT B;  2LDM A;  2KYB A;  1BIA A;  3HFN A;  1AD5 A;  3FRN A;  1VQM A;  4M7A D;  3LW5 E;  4FSX A;  1UEB A;  4RTT A;  3GNF B;  4Z8A A;  1PWT A;  1M5Q 1;  5GAN 2;  3UWN A;  4EMK B;  1WFW A;  3CCL Q;  3O5Z A;  1JQQ A;  2K5I A;  3OY9 A;  4RMO A;  1H3H A;  3PVL A;  2XDB A;  3D7S B;  1Y71 A;  1NEG A;  1IO6 A;  3P8D A;  1RAG B;  4MZM A;  1YJ9 Q;  1WHH A;  2Y4Y A;  4PJM A;  3A8G B;  1PCX A;  2RO0 A;  2DBM A;  4M77 D;  1WHM A;  3A1P A;  5GMK l;  1K9M R;  3JB9 I;  1X2Q A;  2RK1 A;  1PC0 A;  3QXE B;  1NYF A;  2EVR A;  2KRN A;  2X51 A;  3M0Q A;  1SSH A;  2YDL A;  1VQN Q;  4RCB A;  4PJO C;  3THK A;  2JT4 A;  3VYH B;  3QYG B;  2V8I A;  5L8R E;  4KH0 B;  2HKN A;  2XHC A;  4OMM A;  5LJ3 g;  1I5O B;  4OF1 A;  2AIR B;  3QZ9 B;  4FYY B;  2ZPH B;  2JUF A;  1I1J A;  2X4X A;  3CXC P;  4BI4 A;  1GBQ A;  1NZ9 A;  3UA7 A;  1MMG A;  1WX6 A;  2FZK B;  2DO3 A;  1N9S A;  5GMK h;  2ZPE B;  1JJ2 A;  3M5A A;  3VS7 A;  1WNL A;  3CC4 Q;  4IUT A;  2RQT A;  4E2F B;  2FRY A;  5DLQ E;  2VXF A;  3PIP A;  3CCS T;  1YFN A;  5FWB A;  1VQP Q;  4QVZ A;  4AFZ C;  4E47 A;  4FW1 A;  2DLP A;  1X6O A;  3CQT A;  1VIE A;  3UF4 A;  5LJ3 h;  2LP5 A;  2C0O A;  2JTF A;  4M77 E;  3MEW A;  3H9N A;  2QEX Q;  2J7I A;  2ESW A;  1QWF A;  2AHJ B;  1TG0 A;  1X01 A;  4KH1 B;  1M90 R;  2CZ6 B;  2EGE A;  5LJ5 g;  3CPF A;  2GGR A;  4BUG A;  4TVR A;  1YJN Q;  1LPL A;  4AFU C;  2E64 A;  3CCS A;  1ARK A;  4RG8 A;  1NPP A;  2YXY A;  4C8Q A;  5CKD A;  2YSQ A;  2E41 A;  3G71 T;  1YHQ Q;  2RJC A;  4DBR A;  2R5A A;  2CYZ B;  1U3O A;  1QWE A;  4J6W A;  3UAT A;  1WQW A;  5EC7 A;  1AT1 B;  1QP2 A;  2LQW A;  2RM4 A;  1NJI R;  4WCI A;  5KYY B;  3CC2 Q;  1TTH B;  1Y96 A;  1X27 A;  4C0Z A;  2HCK A;  1T3L A;  4ZGE B;  5FU7 C;  2XDP A;  3LGF A;  2DBK A;  3JSC A;  2KRO A;  2JM8 A;  4NOY A;  3L2V A;  1Q86 R;  2O88 A;  2RJF A;  2OTJ Q;  2DF6 A;  2AK5 A;  2M1H A;  3LLR A;  1WIE A;  5EG2 A;  3EGX A;  4M7D F;  4JZ3 A;  4XTU A;  5LJ5 h;  2E12 A;  1KD1 U;  2PQW A;  3VRZ A;  1KD1 C;  3M55 A;  1FMW A;  5D7U A;  1YJ9 T;  2KVQ G;  1RAA B;  3EHR A;  2V1R A;  2HKQ B;  2DD4 A;  1Q95 G;  1Q82 U;  3G71 A;  1Q82 C;  4OP0 A;  5I22 A;  2DEQ A;  5IHN A;  3FJP A;  1WGS A;  1UB4 A;  1WZO A;  2RQW A;  4M75 F;  5CQX A;  1VOM A;  4JS4 A;  1M1F A;  2E10 A;  1VQN T;  2V8K A;  2DXC A;  1OYX A;  2QTX A;  4ELZ C;  4RTU A;  1VQ6 Q;  2E3H A;  2Y90 A;  2JJ9 A;  4J9G A;  1NJI U;  1PRM C;  3CCL A;  2DMO A;  3VS3 A;  3INZ A;  4PJL A;  1S72 Q;  3HKS A;  3M53 A;  1UTI A;  1J3T A;  2D0N A;  4FSS A;  3E9F A;  1G3Y A;  2D8H A;  2OI3 A;  4J6X A;  1GL5 A;  1YJ9 A;  2LX9 A;  3VS5 A;  1Q86 U;  2KDS A;  1B34 A;  4GBQ A;  2E1H A;  1RLQ C;  2DNU A;  1VQL T;  4OMN A;  1SG5 A;  3CC4 T;  2YUQ A;  3VUZ A;  4LE9 A;  4UC4 A;  5A0L A;  1RAC B;  3AHU A;  1FMV A;  1RUW A;  1VQN A;  3RES A;  1BI1 A;  4AFQ C;  3GPL A;  3EFO B;  3MP6 A;  4PFP A;  2KBT A;  3CBP A;  1F1B B;  3JB9 D;  1VQP T;  3QG1 A;  1TUG B;  2RI3 A;  5GAN 7;  1U8R A;  2DL8 A;  4E6R A;  2CP5 A;  2D8J A;  4F17 A;  2DRK A;  3JAM E;  2JTM A;  2H8H A;  3ULR B;  2K79 A;  2QEX T;  1M27 C;  4N0A A;  2PUO B;  1JEG A;  1WDX A;  2K7A A;  4IKF A;  4L59 A;  1WQ7 A;  3X20 B;  2E5K A;  1VQL A;  3G6E Q;  1NG2 A;  2WSC E;  3CC4 A;  1JJ2 S;  2DX1 A;  4E7H A;  2DXU A;  5GAM g;  1QQJ A;  4JLI A;  1LVK A;  1I81 A;  1K0S A;  2ZPI B;  1JO8 A;  2P0Q A;  4LNP A;  4BI8 B;  2EYQ A;  1YP5 A;  2MIO A;  1VQP A;  1VQ7 Q;  2EKO A;  1YHQ T;  3OMG A;  3SB2 A;  3TSW A;  1YCS B;  3CC2 T;  2DM1 A;  2QEX A;  5FRM A;  4J9F A;  3EAE A;  2YRV A;  4M7D A;  2G6F X;  1W1F A;  4C0G A;  1PM3 A;  4J7I A;  3C94 A;  3C4S A;  1HYO A;  4QVD A;  2OTJ T;  2FRW A;  1DJ7 B;  1PHT A;  1WHG A;  3MJX A;  4M75 A;  5GAM h;  1W6X A;  2E3I A;  2H3E B;  2V26 A;  3QUI A;  1BCM A;  2AKK A;  2K3Y A;  2KXC A;  2R57 A;  3EG9 B;  2DXB A;  2XK0 A;  1YHQ A;  3C0C A;  4A53 A;  4ZN1 A;  1K4U S;  1VQ8 Q;  3H0I A;  3CC2 A;  4LXC A;  3EGU A;  1G3T A;  2L3Q A;  1G83 A;  3RKY A;  2EQM A;  3EFR A;  2RD1 A;  4BE2 A;  2F2V A;  1VQ6 T;  4EMG A;  4OVA A;  1PNJ A;  2OAU A;  3V8J A;  4HT8 A;  2OTJ A;  1S72 T;  3JRZ A;  4A4H A;  2HBW A;  4ZGJ B;  1YBY A;  3BW1 A;  1D3B B;  3CCE Q;  2DK3 A;  2SRC A;  3OW2 P;  1GCP A;  3LGL A;  4DA4 A;  3VS4 A;  1MMD A;  4YTL A;  2LNV A;  1G3S A;  3RNJ A;  5D6W A;  3KBG A;  3OA6 A;  3MPU B;  4OMF B;  3L2R A;  2VXE A;  3QZ5 B;  1KC8 C;  2LRQ A;  2QG9 B;  3C95 A;  2F2X A;  1HXD A;  3FJ5 A;  1VQ6 A;  3JCM V;  3CBO A;  2C0T A;  2VKN A;  1S72 A;  4VUB A;  3MEV A;  2DYI A;  1H8K A;  3FIF A;  1JB0 E;  3H6Z A;  1VQO Q;  3V7C A;  3UPU A;  4M7A A;  4HXJ A;  1I07 A;  1ZSZ B;  4C5E A;  3REB B;  1UHF A;  1WYX A;  3DB4 A;  2CZ0 B;  2IG0 A;  3M4Y A;  3EGD B;  3G6E T;  2HAX A;  2XI9 A;  3GF5 A;  2FPF A;  4PJN A;  1BI0 A;  2LT4 A;  1ZUK A;  1GBR A;  4OB2 B;  1QMC A;  3MHX A;  1ZLM A;  5LJ3 f;  1BBZ A;  2Y4X A;  4PLI A;  2MYS A;  4BE1 A;  4M77 A;  1RAD B;  3PMI A;  2JZ2 A;  1OEB A;  1OPK A;  1VQ7 T;  3RMQ A;  3HTR A;  3OYK A;  3L2Q A;  1D0Z A;  4N4G A;  5KYW A;  1Y07 A;  3L2W A;  4J5Y A;  4B6M A;  1KIK A;  2DJQ A;  4KGV B;  3FC3 A;  2CT4 A;  2KNB B;  2O31 A;  4BY6 C;  1RL2 A;  2HBP A;  2O4X B;  4M78 B;  3RKW A;  2AZS A;  2P0K A;  4JPB W;  3SWN A;  3LH5 A;  3G6E A;  3R6N A;  1T0H A;  1IZ6 A;  1OOT A;  2EBP A;  1QKX A;  2FL7 A;  1ACM B;  4F04 B;  3OB9 A;  2IVW A;  2LQ8 A;  2R58 A;  4O5V A;  3HP9 A;  2HNI A;  3A8M B;  2JOY A;  5GJV B;  1FWZ A;  2QDL A;  4A4E A;  3CPW P;  2LC4 A;  1EX4 A;  2EGC A;  1UDL A;  1G5V A;  4KGX B;  1AWW A;  1QKW A;  5KE3 A;  1VQ7 A;  1V1C A;  1X6G A;  4KT0 E;  3OYE A;  4QQ6 A;  1M3C A;  1M9S A;  2LMJ A;  1M2V B;  5IH2 A;  2NUP B;  3NMZ C;  1OQK A;  5J26 A;  3S3M A;  2QQS A;  1VQ8 T;  2COW A;  2LZ6 B;  5FRO A;  4DBF A;  4RTV A;  3QSU A;  2KI7 A;  1UHC A;  4FYV B;  4DEY A;  4BD3 A;  3OBY A;  2P4T A;  2RQV A;  4X9C A;  3ZL7 C;  3JB9 F;  3MEA A;  4HT9 A;  1R0B G;  1I5L A;  2QGG A;  1PSF A;  1QVF P;  3CCE T;  1BYM A;  2C06 A;  5J3B A;  2RK2 A;  4FT2 A;  1OU8 A;  2A08 A;  1QW1 A;  4IUV A;  1VQ9 Q;  3OS2 A;  2E5Q A;  1X6B A;  2MAM A;  2F5T X;  5IHK A;  4XU3 A;  4BAC A;  1NE8 A;  3DKM A;  5LJ3 d;  1CKA A;  1VQ8 A;  5AYF A;  5KYX A;  2CT3 A;  5DLO A;  1GFC A;  1UG1 A;  2L3S A;  4CRI A;  2LX7 A;  4C8Q C;  3E2U A;  3QWX X;  1PD0 A;  2EYY A;  1M3A A;  2DPP B;  4KRT A;  5IN1 A;  8ATC B;  3GIB A;  4IIO A;  1YIJ Q;  1RAF B;  1XJW B;  2DL5 A;  2ZPB B;  1VQO T;  3RMS A;  1P92 A;  3CCE A;  2DZ9 A;  3GBQ A;  4PNO A;  3BFM A;  5GAO l;  4Z89 A;  1I0C A;  3J7A F;  4FT4 A;  1MUZ A;  1GRI A;  4EPC A;  3WVD B;  3QYH B;  4JJD A;  2VVK A;  2BTT A;  2EJG A;  2NUT A;  4C92 B;  4JLG A;  1UUE A;  3CPW A;  4C5G A;  1YCY A;  3EFS A;  4QQG A;  1WJQ A;  3A8H B;  2RJD A;  2A7Y A;  3OYM A;  2PTK A;  4FYW B;  1VQK Q;  4EMK A;  2RNA A;  3OS1 A;  1D1B A;  1B7T A;  1VQO A;  1D1C A;  2BE9 B;  4IUP A;  3HFO A;  1PSE A;  3JCM c;  2KAF A;  5LJ3 e;  1VQL Q;  2DTH A;  3FLG A;  1WI7 A;  2L2P A;  1H64 1;  4LD6 A;  3X28 B;  3A8O B;  1O9S A;  2MMP A;  4QQD A;  2P4R A;  2PVG B;  1HK9 A;  1QVG A;  2PVD B;  2AZV A;  5GAN f;  1W2B A;  1R77 A;  4R0K A;  5I2S A;  3M9Q A;  1NBE B;  3VJP A;  2M16 A;  1UJ0 A;  1YN8 A;  4HVW A;  4ESR A;  2KSS A;  5D6Y A;  1KD1 R;  3QII A;  3MCA B;  1K9A A;  3OYC A;  3HRU A;  2FYK A;  3I35 A;  4LUE A;  4E7I A;  3PFS A;  1EZZ B;  5KCO A;  1Q82 R;  4B9X A;  3TCJ A;  1SPK A;  5GJW B;  2RI2 A;  4DQ2 A;  1EIF A;  1OUL A;  3U23 A;  1VYV A;  2F2W A;  3JCM J;  2J6O A;  4N0A C;  4PJO B;  1VQ4 T;  4AMC A;  2JMC A;  2YUO A;  4CC3 A;  1VQ9 T;  3VS0 A;  2ED0 A;  2ZAE A;  1MGQ A;  3ZBD A;  1AZE A;  2LTO A;  2CKK A;  2RHX A;  2F69 A;  3HRT A;  3H0H A;  1PKT A;  3CMA Q;  3I5R A;  1OX9 A;  4JRI A;  1M3B A;  2COZ A;  2RB6 A;  4Y92 A;  9ATC B;  3JB9 G;  3CXC A;  4XAX B;  1M4Z A;  1YIJ T;  2MK5 A;  4M78 E;  2EQJ A;  3M59 A;  1Y0M A;  2XIC A;  2E70 A;  5FW9 A;  3VRY A;  2RHY A;  2K2M A;  2DIG A;  5LJ3 j;  4M7D C;  4B9W A;  2GBQ A;  3L2U A;  2CRE A;  1VQ9 A;  2BKD N;  5FLX E;  1S1N A;  3MO8 A;  3PIO A;  5GAN d;  1W4S A;  2KMT A;  3EHQ A;  2RHU A;  3CCU Q;  4RG2 A;  4C5I A;  4M75 C;  5KYY A;  2JVV A;  2LCL A;  2VC8 A;  5L23 A;  2M02 A;  1E7O A;  2EW3 A;  1VQK T;  1OV3 A;  2DRM A;  5A0D A;  1H3Z A;  1YIJ A;  1BIB A;  2DTO A;  2KT8 A;  1TXQ A;  5FU6 C;  2VGM A;  4LDW A;  1BI3 A;  2JXB A;  4OMP A;  4WF2 A;  2DAQ A;  4LDV A;  2EFI A;  2V1Q A;  1AWX A;  1M8V A;  4JJB A;  4EMH A;  1WXB A;  3WXM B;  2W10 A;  3ZFJ A;  4MZP A;  4C0F A;  4PJO G;  3L1A A;  2EGA A;  1BKB A;  3LWH A;  2EQI A;  1WXT A;  3S6W A;  1KQ2 A;  4E7L A;  3I9Q A;  1N27 A;  3E9G A;  3CPW S;  1VIF A;  3NTH A;  1VQK A;  5IT9 E;  5FU7 B;  2MCN A;  1JXO A;  3TVT A;  4ZN3 A;  3MP1 A;  2L3R A;  1PRL C;  3G7Z A;  2LT1 A;  8AT1 B;  4ZTF A;  1MV3 A;  3DLL A;  4MDW A;  2A36 A;  3URG A;  1BK2 A;  3JCM g;  1AVZ C;  3I56 Q;  3EG1 A;  5GAN e;  2FPD A;  3MP8 A;  2B8A A;  5HK3 A;  3OYA A;  2EAY A;  3LX7 A;  2X35 A;  4IUR A;  4PFO A;  1Z9Q A;  5HCK A;  3A98 A;  1EFN A;  1HSQ A;  2H3J A;  2EKH A;  1YI2 Q;  5CVI A;  3VU3 C;  4M7A C;  4Z02 A;  4A54 A;  2KT1 A;  3RUX A;  2O2O A;  5GAN 5;  1CSK A;  1QVG S;  2EPD A;  1Z9Z A;  3EFO A;  2L5Q A;  4KBM B;  3AT1 B;  1W2B S;  3ASK A;  4JS5 A;  4BE0 A;  3RDV A;  2GF7 A;  4C92 E;  1SRL A;  3HPW A;  2KR3 A;  3CMA T;  1LNX A;  2MI6 A;  2FB7 A;  2XG8 D;  2RHZ A;  3JCM h;  4M77 C;  4JDS A;  4PJO D;  4XK8 E;  2YUP A;  1QP3 A;  3PGG A;  3N5B B;  4OB3 B;  1N8R C;  1IXD A;  5KE2 A;  1MND A;  2M51 A;  1JBM A;  1XTD A;  4ZNX A;  3HRS A;  1KC8 R;  1V76 A;  2D1X A;  3SWN C;  2J05 A;  2OJ2 A;  5GMK m;  4J9H A;  3F70 A;  2FEI A;  3DLM A;  5FRN A;  1NYG A;  1JXM A;  3CMA A;  3CCU T;  3JCM P;  3NGP A;  4J6Y A;  1UGP B;  1ZA1 B;  4ZTJ A;  3SD4 A;  2J6K A;  1IRE B;  5C0M A;  1YNZ A;  2DER A;  1W70 A;  1HD3 A;  1U1T A;  2F5K A;  2DYB A;  2RHI A;  2HMA A;  2YHT A;  2JNG A;  3CXC S;  4M78 F;  1FYN A;  2SEM A;  3FDR A;  5IHI A;  5GAN j;  2LCC A;  5I11 A;  4KUL A;  2HSE B;  4AFS C;  4LDY A;  3VUB A;  2VWF A;  4Y91 A;  1UGV A;  2K6D A;  3EG9 A;  4DBH A;  5KYU B;  2B86 A;  1KC8 U;  1QVP A;  3FB9 A;  3IQL A;  2ZPF B;  3NTI A;  3I55 Q;  3CCU A;  1A0N B;  4PJO E;  4XU0 A;  4XTV A;  2GCX A;  2YRC A;  2V8J A;  4J7F A;  4N4I A;  2CP2 A;  4RTX A;  4C0D C;  3CBM A;  4OB1 B;  4V2S A;  2KXD A;  3CD6 Q;  3PVQ A;  3JCM W;  4Z88 A;  2RQR A;  2GFU A;  2LJ3 A;  1U06 A;  3KFV A;  2XMF A;  2P0P A;  3PMT A;  4OGE A;  1WHK A;  4J8O A;  3QKJ A;  3CCR Q;  2CP6 A;  3I56 T;  1D3B A;  4ZGD B;  4L6V 5;  4F7U B;  4XQ3 A;  2X9H A;  2E6Z A;  5I21 A;  2QQA A;  2DVE A;  1YI2 T;  2BZY A;  2HZY A;  1KHI A;  2QYZ A;  3RIR A;  1UGS B;  2F1L A;  2CDT A;  2EIF A;  1IGQ A;  1NLO C;  2E4H A;  2ATC B;  3JCM b;  1NLP C;  2HDA A;  1TU0 B;  4Y28 E;  2MWO A;  3MKD A;  3CCQ Q;  1ZA2 B;  1WHJ A;  2ENM A;  2OTL Q;  3QJY A;  1QCO A;  3UA6 A;  1E6G A;  1G3W A;  1WPY A;  3I56 A;  1NEB A;  2I0N A;  1TOV A;  1ZSZ A;  3C12 A;  2GQV A;  2VAS A;  1ZBJ A;  2GFA A;  3M57 A;  2JM9 A;  2D6F A;  2AT1 B;  2IIM A;  4EMK C;  3EGD A;  2QQB A;  2C0I A;  2KRM A;  2GTO A;  4A4K A;  1YI2 A;  1HJD A;  4FYX B;  2A3L A;  2X3X D;  1WXU A;  1UGR B;  3M0P A;  3NFC A;  2CH4 A;  5CK9 A;  2YLC A;  3S3N A;  3OW2 A;  2RMO A;  4EDU A;  1M1G A;  2QTV A;  1VYT A;  3NTK A;  1V29 B;  2JMA A;  3MET A;  4JJN K;  4IIM A;  2G3R A;  4C92 F;  3PE0 A;  4LD9 K;  1Y57 A;  4ATO A;  1K73 R;  5LJ5 f;  1Q81 C;  4LUD A;  1OZ3 A;  2O4X A;  3H41 A;  1I4K 1;  5CKH A;  4NL2 A;  4CI0 C;  3WVE B;  2CZ1 B;  2BE7 D;  5IXF A;  4F7U G;  2GNC A;  1TWB A;  1O75 A;  4BB7 A;  1JJ2 P;  2CGH A;  2O9S A;  2YLB A;  1VQ4 Q;  4M4Z A;  4FL6 A;  1X2K A;  2VB6 A;  2LQK A;  5HKC A;  1OPL A;  3CC7 Q;  2BUD A;  2HQX A;  1K8A U;  1C1A A;  1K8A C;  1Y7X A;  2LJ1 A;  2CS7 A;  4IUU A;  5GMK i;  7AT1 B;  1M2V A;  3I5S A;  3I55 T;  3CCV Q;  4PFZ A;  2NUP A;  2L0A A;  3P8B B;  4BY6 B;  1GXI E;  2ECZ A;  3X24 B;  1NPR A;  5A2Q E;  2DL7 A;  2DXT A;  4C8Q F;  4M78 G;  3CD6 T;  4MMK A;  1K73 U;  5CQY A;  4XTW A;  1K73 C;  4PKC C;  2FHD A;  3J80 E;  1ZSG A;  3PTA A;  3CCR T;  1RAE B;  2EYZ A;  4J9D A;  2ROL A;  3OS0 A;  1MMA A;  2QXF A;  2QQR A;  2FVU A;  3NHN A;  1X75 C;  3OSS C;  1K76 A;  1G2B A;  1ZHI A;  3SFM A;  4RTW A;  3A5Z B;  1Q7Y U;  1SEM A;  1M30 A;  1Q7Y C;  4OMO A;  4D8D A;  4CC7 A;  1KJW A;  3H0F A;  5GMK e;  1SSF A;  4A63 B;  1WJS A;  1TUC A;  3R6O A;  3I55 A;  3G1J A;  3V8L A;  4JRP A;  2VV5 A;  4PJO F;  4D6W A;  3TEE A;  3OYB A;  4OGC A;  4RUG A;  3LH0 A;  3EH2 A;  1PG5 B;  2A37 A;  1NM7 A;  3CD6 A;  3SEM A;  2CP0 A;  1BU1 A;  1KQS P;  1D1A A;  2DJZ A;  3VKI A;  2RN8 A;  4P5N A;  3UDC A;  5LJ5 d;  3PT9 A;  4AG2 C;  2K3B A;  3OYD A;  2E65 A;  3CME Q;  3CCR A;  3CCQ T;  2LJ0 A;  2E6N A;  1FMK A;  2OTL T;  2VGN A;  3LWI A;  1X69 A;  3OS5 A;  2KQW A;  5CIU A;  1LOJ A;  1SRM A;  1R0C B;  2CUB A;  1N9R A;  4O6J A;  2RH2 A;  5AT1 B;  2LQN A;  1YJW Q;  2NWM A;  3OYF A;  3EH1 A;  1QVF A;  3OYL A;  4N4H A;  3TSZ A;  1ABO A;  1UE9 A;  4M78 D;  3JB9 H;  4C92 A;  4M7A E;  4E7K A;  3OYH A;  3TU4 K;  2MOX A;  4HKE A;  4C8Q B;  2RPN A;  2RI5 A;  1K9M U;  3GNG A;  1K9M C;  3JCM f;  3H8Z A;  3CCQ A;  1FX7 A;  3OYJ A;  2P84 A;  4J9E A;  2QA4 Q;  4HCC A;  2OTL A;  2OAW A;  3OBW A;  1T0J A;  4PLL A;  1AWO A;  2DFU A;  3GLX A;  2FPE A;  1Y96 B;  2KK4 A;  5GAM f;  3OYN A;  3L2Z A;  4F14 A;  1BI2 A;  1D0Y A;  5CAI A;  2YRD A; 
#chains in the Genus database with same CATH homology
 1KFZ A;  1MV3 A;  4AG1 C;  3M0S A;  1GCQ A;  2A36 A;  2CSI A;  1BK2 A;  2CUD A;  2F2X A;  3FJ5 A;  2KRS A;  1GCQ C;  1AVZ C;  3EG1 A;  2GTJ A;  2FPD A;  4D8K A;  1AOJ A;  2W0Z A;  2X3W D;  1Z9Q A;  2C0T A;  5HCK A;  3SHW A;  2VKN A;  2PZ1 A;  3A98 A;  1H8K A;  2KYB A;  1EFN A;  1HSQ A;  1AD5 A;  2EKH A;  4HXJ A;  4RTT A;  4Z8A A;  1I07 A;  1PWT A;  3REB B;  1UHF A;  1WYX A;  2KT1 A;  2O2O A;  1WFW A;  1GFD A;  3O5Z A;  1CSK A;  1JQQ A;  1H3H A;  2EPD A;  1Z9Z A;  3PVL A;  1NEG A;  2NUZ A;  1IO6 A;  2FPF A;  1SRL A;  1UFF A;  1ZUK A;  4QT7 A;  2KR3 A;  1GBR A;  1X43 A;  2DBM A;  1ZLM A;  1BBZ A;  1X2Q A;  2RQU A;  1BB9 A;  1OEB A;  1OPK A;  2JTE A;  4RTZ A;  1NYF A;  2EVR A;  4J9I A;  2KRN A;  2YUP A;  3M0Q A;  1KIK A;  1SSH A;  2DJQ A;  2YDL A;  2PNI A;  3THK A;  2CT4 A;  2JT4 A;  2KNB B;  2O31 A;  2M51 A;  4ZNX A;  1KSW A;  4OMM A;  2AZS A;  4JPB W;  3LH5 A;  2D1X A;  3R6N A;  2J05 A;  1VA7 A;  1T0H A;  2OJ2 A;  1I1J A;  1OOT A;  2EBP A;  1GBQ A;  1QKX A;  3UA7 A;  4J9H A;  2FEI A;  2K9G A;  1WX6 A;  5GJV B;  1NYG A;  2QDL A;  1JXM A;  2EGC A;  1UDL A;  3NGP A;  1XOV A;  3VS7 A;  1AWW A;  1QKW A;  2J6K A;  1V1C A;  1X6G A;  2KEA A;  1YNZ A;  1W70 A;  1TUD A;  1HD3 A;  1M3C A;  2LMJ A;  2RQT A;  1SHF A;  2FRY A;  5IH2 A;  3VS6 A;  3NMZ C;  2DYB A;  2LZ6 B;  1FYN A;  2SEM A;  5FWB A;  4RTV A;  5IHI A;  5I11 A;  4ORZ A;  4AFZ C;  4AFS C;  2DLP A;  3CQT A;  1UHC A;  4CC2 A;  1T3S A;  2VWF A;  3UF4 A;  1UGV A;  2LP5 A;  2K6D A;  2C0O A;  4K11 A;  4DEY A;  2LCS A;  1ABQ A;  2B86 A;  2RQV A;  2J7I A;  3IQL A;  2ESW A;  3ZL7 C;  2A28 A;  3JV3 A;  1QWF A;  1A0N B;  3EG3 A;  1LCK A;  1TG0 A;  2A08 A;  2EGE A;  4RTX A;  1X6B A;  2GGR A;  2KXD A;  3PVQ A;  5IHK A;  4Z88 A;  1CKA A;  2J06 A;  4AFU C;  2RQR A;  2LJ3 A;  1U06 A;  3KFV A;  1ARK A;  2CT3 A;  1PKS A;  1GFC A;  1UG1 A;  2XMF A;  2L3S A;  2YSQ A;  2BZ8 A;  2LX7 A;  3QWX X;  2O9V A;  4GLM A;  2EYY A;  1M3A A;  1U3O A;  1QWE A;  3UAT A;  4KRT A;  4IIO A;  5EC7 A;  2LQW A;  4WCI A;  1QLY A;  2DL5 A;  1X27 A;  2HCK A;  1T3L A;  2BZY A;  3GBQ A;  2DBK A;  2KRO A;  1MV0 B;  1UJY A;  2CDT A;  2JM8 A;  4JZ4 A;  4Z89 A;  1I0C A;  1NLO C;  3RBB B;  1B07 A;  1U5S A;  2O88 A;  1MUZ A;  1NLP C;  1GRI A;  2DF6 A;  2AK5 A;  2HDA A;  1WIE A;  3M0R A;  4JJD A;  2VVK A;  4JZ3 A;  2BTT A;  3VRZ A;  4F16 A;  2ED1 A;  1UUE A;  1RI9 A;  3EHR A;  2V1R A;  2ENM A;  4OML A;  3UA6 A;  1E6G A;  1NEB A;  5I22 A;  2I0N A;  2HSP A;  2PTK A;  5IHN A;  1B3Q A;  3M0U A;  1ZBJ A;  2RQW A;  2JW4 A;  2JM9 A;  2RNA A;  2IIM A;  3NPF A;  2C0I A;  2KRM A;  2GTO A;  1HJD A;  2X3X D;  1WXU A;  4RTU A;  3M0P A;  2CH4 A;  4J9G A;  1H92 A;  1PRM C;  1YWP A;  2DMO A;  2RMO A;  1WI7 A;  1ZUY A;  4J9B A;  2L2P A;  3VS3 A;  2FO0 A;  2KYM A;  1VYT A;  1VYU A;  5IXB A;  1UTI A;  1J3T A;  2JMA A;  2JS0 A;  4RTY A;  2D0N A;  4FSS A;  1AWJ A;  2DVJ A;  4IIM A;  2D8H A;  2OI3 A;  1GL5 A;  2P4R A;  3VS5 A;  3PE0 A;  2AZV A;  1Y57 A;  4GBQ A;  1RLQ C;  2DNU A;  4LUD A;  4R0K A;  3H41 A;  4OMN A;  2YUQ A;  1JU5 C;  4LE9 A;  2DE0 X;  1UJ0 A;  1RUW A;  2RF0 A;  1YN8 A;  3M0T A;  4HVW A;  4AFQ C;  1ZUU A;  4ESR A;  5IXF A;  2GNC A;  2KBT A;  2O9S A;  1K9A A;  4M4Z A;  2ROT A;  1X2K A;  1OPL A;  3I35 A;  2DL8 A;  4LUE A;  4E6R A;  2HEQ A;  2D8J A;  4F17 A;  2LJ1 A;  1SPK A;  2DRK A;  5GJW B;  1AEY A;  2H8H A;  3U23 A;  3ULR B;  2K79 A;  1UEC A;  1M27 C;  1VYV A;  2DL3 A;  2F2W A;  3I5S A;  1JEG A;  1WDX A;  2K7A A;  2J6O A;  2L0A A;  2E5K A;  2LNH B;  2JMC A;  2YUO A;  1NG2 A;  2DA9 A;  1QCF A;  4CC3 A;  2ECZ A;  4LN2 A;  2BZX A;  2DX1 A;  3VS0 A;  2ED0 A;  2DIL A;  2DL7 A;  1AZE A;  2L3P A;  1K0S A;  1JO8 A;  1M8M A;  3H0H A;  1PKT A;  4LNP A;  2CSQ A;  1ZSG A;  2EYZ A;  4J9D A;  1YP5 A;  2MIO A;  2ROL A;  3I5R A;  5ECA A;  1WA7 A;  3NHN A;  5FWC A;  1M3B A;  4DEX A;  1K76 A;  4EIK A;  1G2B A;  4RTW A;  1K1Z A;  4Y92 A;  1WLP B;  1SEM A;  4HCK A;  1M30 A;  2CH4 W;  4OMO A;  4D8D A;  1AZG B;  1KJW A;  3TSW A;  2J6F A;  1YCS B;  3H0F A;  4CC7 A;  4A63 B;  2DM1 A;  1TUC A;  1Y0M A;  2KGT A;  4J9F A;  5FW9 A;  4J9C A;  3VRY A;  2G6F X;  1W1F A;  2K2M A;  2YT6 A;  2GBQ A;  2YUN A;  4RUG A;  2CRE A;  1S1N A;  4HVU A;  2A37 A;  1NM7 A;  1CKB A;  3SEM A;  2FRW A;  1BU1 A;  1PHT A;  1SHG A;  4X1V A;  2RN8 A;  4OMQ A;  3EHQ A;  2DL4 A;  4AG2 C;  2K3B A;  3REA B;  1RLP C;  1W6X A;  4HVV A;  2LJ0 A;  1FMK A;  5L23 A;  2AKK A;  1X69 A;  2KXC A;  1E7O A;  1SRM A;  2EW3 A;  2CUB A;  1OV3 A;  3C0C A;  2DRM A;  2LQN A;  1K4U S;  3H0I A;  1K0X A;  2AKL A;  2KT8 A;  3EGU A;  2NWM A;  2L3Q A;  1G83 A;  3VS2 A;  3EG2 A;  3QWY A;  2JXB A;  4OMP A;  2F2V A;  2ABL A;  3EG0 A;  3TSZ A;  3VS1 A;  1ABO A;  1UE9 A;  1PNJ A;  1YWO A;  2V1Q A;  1AWX A;  2EYX A;  1N5Z A;  2M0Y A;  2MOX A;  4JJB A;  2EYW A;  4JJC A;  2JS2 A;  1WXB A;  2W10 A;  2RPN A;  2HBW A;  2KE9 A;  2EGA A;  2SRC A;  4J9E A;  2EQI A;  1WXT A;  2OAW A;  1GCP A;  3I9Q A;  1T0J A;  1AWO A;  2GQI A;  3VS4 A;  2FPE A;  1ZX6 A;  2MCN A;  1JXO A;  3RNJ A;  3TVT A;  4F14 A;  4CC4 B;  2FG0 A;  1PRL C;  1E6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...