2RB6A

X-ray structure of the protein q8ei81. northeast structural genomics consortium target sor78a
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
57
structure length
57
Chain Sequence
SSQYIMSTKDGKMITSDSKPKLDKTTGMYLYYDEDGREVMIKQEDVTQIIERLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray structure of the protein Q8EI81.
rcsb
source organism Shewanella oneidensis
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 7
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rb6A00
5GAN2 2RD1A 3HFOA 1WNLA 2E41A 1WPYA 4J6XA 4JRKA 4PJOE 4M78A 2YHTA 1N9RA 4C92C 4F7UE 4PJOB 2RB6A 4C8QC 4M7AG 4JRIA 5GANf 2FB7A 5LJ5j 4C8QB 5CAIA 4F7UB 4PJOD 5GMKj 3QSUA 1LOJA 2EJFA 1M5Q1 3M4GA 5GAN6 4M77E 4RCBA 5GMKm 4M75E 3EFSA 1LJOA 1D3BA 3EFRA 3FB9A 4MMLA 3RIRA 5LJ5e 3JB9D 1I4K1 1X01A 3SWNA 3JCMP 2EWNA 3FIFA 1WQWA 4M78F 4M7DA 3RERA 4C92A 4M7DG 5LJ5f 4J6YA 5GANj 4C92B 5GAOn 1Y96B 4M7AC 4M77D 4J5YA 4XTVA 4EMGA 5LJ3g 3JB9I 4PJOA 5I21A 4M75D 3JCMW 2DKGA 5LJ3e 5GAN8 4HA8A 4M77F 1MGQA 4EMHA 2K57A 2Y90A 1I5LA 4XU1A 4C8QG 5GAOl 3V8KA 5LJ3f 1U1SA 5GAMh 2DZCA 3VU3C 1BIAA 3RESA 4NL2A 1HXDA 5LJ3h 4C92D 5LJ5g 1KQ2A 4M77C 5GANg 2JN0A 5GMKi 4WF2A 4XTYA 3L2ZA 4M75A 5GAMe 4V2SA 3RKYA 1B34A 3L1AA 1B34B 3QHSA 4M78G 4XU0A 1BIBA 2CGHA 4PNOA 1U1TA 4C92E 5LJ5h 5GANd 3JB9H 4F7UF 4XU2A 3HFNA 4EMKC 2E65A 5LJ5d 4A53A 3JCMQ 4HT8A 3RKWA 2DZ9A 4EMKB 2HNIA 4F7UG 3RKXA 1TH7A 2DEQA 4M78B 4F7UA 4M7AE 4DQ2A 2YLBA 2YLCA 4M77A 3BW1A 2I2LA 5GAN4 4QVCA 4J6WA 2FYKA 2EAYA 4M75F 5LJ3d 3PGGA 3BDUA 1HK9A 4C92F 5GAN7 4NOYA 3FJPA 2EJ9A 3QO3A 4XTUA 3SWNC 4M7AD 4X9CA 5GAMf 4M7DC 4M7AF 2E1HA 1JBMA 4Y91A 3V8JA 4PJOG 5DY9A 1LNXA 2DVEA 4XU3A 2DTIA 4M78C 2DXUA 3V7CA 3JCMd 4QVDA 5GMKl 3JB9G 1Y96A 4X9DA 1I8FA 1YCYA 4NL3A 4HT9A 1M8VA 2RA2A 4JLIA 4XTWA 3JCMc 2DXTA 3V7SA 5GAN5 4M7DD 3V7RA 1H641 3JCMV 3BY7A 2EJGA 5GMKh 5GAMj 2RM4A 3JCMJ 4M77G 3SWNB 4M75G 4M7DB 4A54A 4C8QF 2ZGWA 2VXFA 2VC8A 3SB2A 1D3BB 3HSBA 4C8QD 4M7DE 4XQ3A 3BFMA 5GANh 3RUXA 3QUIA 4M78E 4M75B 4N0AA 4XTXA 1JRIA 4M7AB 2E64A 5GAOr 4C92G 4M7AA 4EMKA 3JB9J 3JCMh 4PJOC 3INZA 5GAMg 1I81A 2QTXA 3JCMX 1KQ1A 4JUVA 5GAN3 3JCMf 4RCCA 5GANe 4C8QE 5GAOp 2DTHA 2DTOA 2VXEA 4PJOF 3JCMb 4M78D 2DJZA 4MMKA 3JCMe 4M7DF 5GAOq 4C8QA 4M77B 3JCMg 5GAMd 3GIBA 3JB9F 2E10A 4XTZA 4OP0A 4N0AC 3V8LA 5GMKe 3AHUA 4M75C 5GAOm 1WQ7A 1N9SA 5LJ3j
chains in the Genus database with same CATH superfamily
5FRMA 4C0DC 1QVGA 3MP1A 2EIFA 5LJ5j 5FWBA 2QI2A 5GMKj 2X4YA 3QYGB 2BTTA 1VQKA 1N8RU 2B86A 4RCBA 2LX9A 3EFRA 3QBYA 1VQ9Q 2MCNA 3JCMP 1WLPB 4GLKA 4M7AC 4PJOA 1OYXA 2ROTA 3CCUA 1RI9A 2EYZA 3H9NA 4PL6A 1VQ7T 2Z0WA 4ESRA 3OW2A 2P0KA 5C0MA 1K0SA 4J9EA 2LJ0A 1X6BA 1M1GA 4PNOA 2KT1A 3G71Q 1Q86C 2DXCA 2HNIA 3M5AA 3RKXA 4OF1A 3KUFA 3HRUA 1X6GA 2I2LA 2DX1A 3E9GA 3QXEB 3CCMT 3MEVA 4M7AD 2B8AA 3OYDA 1UDLA 2COZA 4PJOG 2DTIA 2GBQA 3VYHB 1RLPC 1M8MA 2QTVA 2JS0A 4LDXA 2DEUA 3HHTB 2RA2A 5GAN5 1RAAB 3HL8A 5IHNA 3SWNB 2JTFA 1IGQA 1UECA 2VXFA 3OYJA 2NUPA 2JVVA 5GANh 3VRZA 3LX7A 2L5QA 4IUPA 2K79A 1I81A 4Z8AA 1OULA 4Y92A 4M77B 5GAMd 1PCXA 4F04B 4ELZC 2EPDA 1YWPA 3HRTA 1WHMA 1K73U 2OTJQ 2RK1A 4RTVA 2R5MA 1RAIB 2DD5A 1ZSZC 1Q7YU 5FRNA 4M7AG 1M1KC 2BZYA 2AZVA 2LCLA 1GL5A 3CBOA 3PIPA 2CZ6B 2QDLA 2P4TA 2RJDA 1LJOA 2WSCE 2K7AA 1WQWA 3TSZA 1NM7A 3CCVT 4KGXB 3NTKA 4J6YA 5GANj 4C92B 2LT4A 1FMVA 1FWZA 1LCKA 4A4GA 3CBMA 3C0CA 1Z9QA 5J3BA 2DNUA 3CPWP 3CCJA 2RQUA 1Q95G 2MMPA 4A4KA 2EQIA 1Q86R 4DBHA 1PRMC 1B7TA 5GANg 2EGCA 3CC7Q 3L2ZA 4J7IA 4E7LA 2BE9B 1BCOA 2OTJT 5KH6A 1EFNA 1FXXA 4EMKC 5KYWA 3VRYA 1M30A 2DZ9A 4F7UA 5EG2A 2YLCA 4PJLA 3ZL7C 2O01E 3VUBA 3OMCA 4AT1B 2EAYA 5CKEA 4CC7A 1OEBA 4IUQA 1R8OB 4ZGJB 3FJPA 3VUZA 4XK8E 1OI1A 3UATA 3V8JA 2CH4W 4J83A 4RG8A 2M16A 1MMGA 3CPWA 1B07A 4KULA 1YCYA 3MHXA 3JCMc 3CC2T 3ASKA 1AD5A 3JCMV 1YITA 2DO3A 4JZ4A 3I5RA 1BYMA 2EBPA 3OYYA 4M75G 5FROA 2VKNA 1WHJA 1K1ZA 1G2BA 2K5LA 1TOVA 4C8QD 5J26A 2CZ1B 1M27C 2XKOC 3LGFA 1IRXA 2JXBA 2QGFB 2I0NA 2FVUA 5GAOp 2ABLA 3CMEQ 1MMNA 1VIFA 2P0PA 1ZLMA 2KQWA 4KT0E 1QCOA 2HD0A 3A1PA 2EGEA 3EGDB 4QQDA 1UJYA 1AT1B 3A5ZB 4E7KA 5HKCA 2FPFA 4E7JA 1KQSA 4PJOB 3L2VA 5KYWB 4F7UB 2KROA 1F1BB 1AWJA 5GAN6 1YITT 3EHQA 3NHNA 3SHWA 3A8MB 5AYFA 4M7DA 1G3TA 2VV5A 1G8XA 2XICA 1KK7A 3QIIA 1QWFA 1VQ6T 2MIOA 3CEYA 2E6NA 4FSXA 1I5LA 2DF6A 2EGAA 4CRIA 5GAMh 2ED0A 1IB8A 2ECZA 4F16A 1Q82U 1Z9ZA 1W2BA 4Z02A 3RKYA 1M1KU 2HKNA 3IQLA 1RAEB 2RI5A 3ZFJA 2OTJA 3R6OA 1H3ZA 1ZX6A 3X28B 1JJ2S 4DQ2A 3HP9A 3ME9A 3EG3A 1K73R 2FO0A 2L3PA 2KRSA 1MUZA 5D7UA 2K6DA 1X43A 4XU3A 4L6V5 4M78C 4F14A 1MMDA 1S72Q 3GNFB 1Y96A 3RNJA 3RR6A 4JLIA 1M8VA 1VQ6Q 5GAMj 1SPKA 2K2VA 4PFPA 4R55A 3TVTA 3JCMJ 4C8QF 2LX7A 2LVMA 2VYTA 3M4YA 5CKDA 4PLIA 1WDXA 2DFUA 4M7AB 4PJOC 4BY6C 5GAMg 1T0JA 3KXTA 2QTXA 2QDYB 2QA4A 1GCQC 1V76A 2EVRA 2KMTA 3HKSA 2HMAA 3URGA 3GIBA 1KC8C 1YIJQ 3NPFA 2HCKA 2PUOB 4QT7A 5LJ3j 4AFQC 1W2BP 2X4JA 3F70A 4J6XA 4J9DA 1NE8A 4OB1B 4BDYA 3RIRA 3C94A 4M78F 1E6HA 4M7DG 2ED1A 5HK3A 2KXDA 2HL5C 4J8OA 1VQ8T 2LDMA 3J7AF 3CCMA 1EIFA 4OB2B 1K9MC 1BI1A 3QYHB 5CVIA 1I1JA 5GMKi 3GLXA 2PUKB 3DLMA 1QKXA 4XTYA 4M75A 2OJ2A 3WVEB 2AZSA 3CD6A 3OQ5A 1NZ9A 3JCMQ 2COYA 5IXFA 2GTJA 3RKWA 5KYUA 4EMKB 1SSHA 4BI8B 2YLBA 1SG5A 3FLGA 7AT1B 3QKJA 4JRQA 4Q5WA 3MO8A 2O88A 1AEYA 1YHQA 1QVFP 2RJCA 4RTTA 3QWXX 4PK4A 1UJ0A 1G3WA 5KCHA 3OW2P 2AKKA 4Y91A 2RQRA 2QQAA 4ME7A 1YJ9T 3L2QA 2ATCB 2DVJA 1UUEA 3V7RA 2L3QA 2DD4A 5CKBA 4HKEA 4LE9A 2IPOB 1AZGB 1TUCA 5DLQE 3CCVQ 2CP3A 3OYLA 3BFMA 3EFOA 1VQPQ 3H0FA 2KGTA 4N4GA 4E7HA 3G71A 2DK3A 4PJOF 2DE0X 4M7DF 1UE9A 3JCMg 3VKIA 1YWOA 1D0YA 1T3LA 2HSPA 1WZOA 3CPFA 3QZ9B 2EQKA 4C5GA 1VQ9T 1RLQC 1NLOC 5LL6S 1WX6A 2XHCA 2FB7A 2RF0A 1W1FA 4AG2C 5KYUB 2JTMA 1O9SA 4BUGA 2EJFA 2KVQG 3OYNA 4OMFB 1VQ6A 2H8HA 1OQKA 4A4HA 3ZEHA 5LJ5f 1SHFA 1N6AA 1NLPC 3JB9I 1KC8U 2RJEA 2ZZDA 3G4SA 1OV3A 4MZMA 1E7OA 1WHKA 4E6RA 4RTUA 5CQYA 4OMMA 5EC7A 1X2QA 1B34B 3ULRB 2ESWA 5LJ5d 1K8AU 1K4US 4FCYA 1VQ8A 2RHUA 4DBQA 3BW1A 4X1VA 5DM7R 1KHIA 2JUFA 4HCCA 2WSEE 3PMTA 2JOYA 1NEGA 2ZPHB 4MZPA 3M57A 1W6XA 4FYWB 1ZBXA 2YUQA 1GCQA 4WCIA 3U23A 3EAEA 2G3RA 2O9SA 3X26B 3PE0A 2H3EB 4NS5A 1CSKA 4ZN3A 1BK2A 4M7DE 1NJIU 1VQLQ 4N4IA 4N0AA 2QA4T 3INZA 3S3OA 2KNBB 2NUTB 1NBEB 3LWIA 1T3SA 1N5ZA 4LUDA 1Y7XA 2X51A 4OP0A 2A3LA 2OX7A 1W2BS 1KD1U 2KSSA 5A0DA 3MP8A 3S3NA 1BKBA 1PG5B 2XU8A 2RB6A 4LDVA 4BI4A 4F7UE 5D6WA 3OS5A 2VUBA 2L3RA 4OMNA 4JS5A 4JJBA 4ELYC 3OYFA 2D8HA 3QSUA 4ZGDB 2V8JA 5M9OA 3JB9D 1OX8A 3OS2A 4C92A 3DKMA 5FU6C 3CCVA 2K3XA 2FZKB 3EH2A 5GAN8 1MGQA 4KH0B 3M58A 1H8KA 1TWBA 3CXCA 2QK0A 1SHGA 3EGDA 1PNJA 3A8HB 1QCFA 4HCKA 4QKUA 3CMEA 4P5NA 4PKCC 1ABOA 4LDYA 2WSFE 3M0RA 4C5EA 1VA7A 4BY6B 3OYCA 2OTLT 4XU2A 4BE0A 4MZTA 1VUBA 4Y28E 4JPBW 2QAZA 1IXDA 1NPRA 1R0CB 3X20B 5GAN7 3CC4Q 3GP8A 3CCLQ 2D0NA 4OGEA 3DB3A 4JJCA 3A98A 3QJYA 5CKFA 5A0GA 4LUEA 1YJWT 4C0FA 3TQ7P 3P8BB 2K5FA 2A7YA 4HT9A 1M3BA 1N27A 3EG2A 3AT1B 3M54A 2PVDB 2DJQA 4XQ3A 3QUIA 4M78E 5D6YA 1SRLA 2F5KA 1J3TA 2FG0A 2JM8A 1Q86U 2FRWA 1VQ8Q 4IIOA 4FIBA 4AG1C 5I22A 4UC4A 1MMAA 3EG9B 3EGUA 1AOJA 1WXUA 2CH4A 1VYUA 2P84A 3M56A 1OU8A 2LNHB 2CDTA 4J9HA 3VS1A 2MAMA 1UGRB 3CCSA 1NJIC 4PJOD 1Y57A 2LC4A 1TG0A 1K0XA 1D3BA 3M0UA 4OMOA 1I4K1 2BZXA 1XTDA 1PKSA 2JJ9A 1DJ7B 1LPLA 1HD3A 2DKGA 5LJ3e 2NYSA 1VQKT 1FMWA 2YXYA 2LZ6B 3LLRA 3RESA 1SKUB 3P8DA 2XDDA 1IHWA 1Y07A 4JRPA 4OVAA 3CCJT 2V26A 2F1LA 2CGHA 1QP2A 4IIMA 3G6ET 1K73C 1BCMA 2FPEA 2HEQA 2XI9A 4M78B 2D6FA 1VIEA 4M77A 1H3HA 1RACB 1UFFA 2H3JA 4J6WA 2L2PA 3HRSA 3QO3A 2HSEB 3C12A 3M0SA 2RHIA 3HTRA 2LJ3A 2AT1B 5IN1A 1VQKQ 3I9QA 3I56T 3V7SA 3OYMA 2EJGA 1VQMA 1QWEA 1CKAA 2RMOA 2KY9A 4DBFA 2F2XA 1S1NA 4IUVA 1D3BB 3EHRA 2MYSA 4DEXA 4EMKA 4ZGEB 2CT4A 1SSFA 3JCMX 2L8DA 4GY5A 2HZYA 3A8OB 2VXEA 5KCOA 4M78D 3O5ZA 1QQJA 3HPWA 4D8DA 2XDPA 1Q82R 2E10A 1VOMA 4N0AC 3AHUA 1PHTA 1JB0E 5GAOm 3N5BB 2COWA 2CT3A 3CMAQ 2KXCA 2YDLA 1D09B 4AFSC 5IAYA 1U06A 2ENMA 3SFMA 2ZAEA 3UPUA 1LOJA 2K2MA 1M2VB 3NFCA 1G83A 3CCEA 3LGLA 2LCSA 1M9SA 3SWNA 4D6WA 1S72A 4JJNK 3CMET 2L3SA 2RQWA 1X27A 2DPPB 5KYXA 2F5TX 2R5AA 1PD1A 4J9FA 1YJWQ 2X9HA 1FX7A 2CP5A 2QQSA 8AT1B 1K9AA 5D6XA 4OMLA 1R77A 4YTLA 3H0IA 4A63B 4LD6A 1JJ2P 2BE7D 3PVLA 3RDVA 2DL8A 2KT8A 4QVCA 4M75F 1ZHIA 1OZ2A 4AFZC 2PVOB 2GCXA 2RPNA 4A4FA 2DETA 1NYFA 1D1BA 2DVEA 3FJ5A 2AKLA 2NUZA 2DXUA 1Q81C 2VWFA 1WHGA 4NL3A 2F69A 4XTWA 2DXTA 1UB4A 2J7IA 5GMKh 2RN8A 1S72T 4M7DB 3CCET 4BI3A 3LW5E 4XTXA 3QZ5B 2YT6A 2FL7A 1IGUA 3M53A 1OPLA 3S6WA 1TUGB 3VV0A 5GANe 2ZPFB 3UA6A 2DTOA 2DYIA 2BZ8A 2DJZA 2LP5A 1PWTA 4BE1A 5IXBA 4RG2A 2HL3A 3UA7A 2P4RA 1TU0B 2IVWA 4EPCA 2E70A 1VQOQ 3VS4A 3DB4A 4RTZA 2EQJA 2J05A 5CO7A 5CAIA 1VQ7Q 5FU7C 2Y4XA 1MV3A 4C0ZA 1QVPA 4TVRA 3GOXA 3FEOA 4MMLA 4EDUA 4MDXA 3KBGA 1VQMQ 3VS5A 3FC3A 4M77F 3LWHA 3MEUA 2K57A 2QQBA 3A8GB 5GAOl 1M3AA 4QQGA 3MJXA 3MCAB 1KQ2A 4IURA 1AVZC 1YP5A 2HAXA 1I5OB 1B34A 2QGGA 4FYYB 1I07A 2O9VA 3EH1A 1ACMB 1ZUKA 3CCQA 1IREB 3CMAA 2LCCA 1VQ5T 1D0XA 1D1AA 2FPDA 1OPKA 1K76A 1HK9A 4XTUA 2K5IA 2R58A 2KEAA 5ECAA 1G3SA 3OA6A 3JAME 1UEBA 2JTEA 3CCEQ 1LNXA 3NTIA 1XOVA 2SEMA 3H0HA 2PQWA 2V8KA 1VQNT 4II1A 2A37A 1C1AA 4RKUE 2VVKA 2HQHA 2EKHA 4LNPA 1H92A 1IHVA 4DOVA 3META 2CP6A 2HKQB 4KRTA 3CCST 1NPPA 4C0DB 3JB9J 3H41A 2L0AA 1HJDA 1GFCA 1PSFA 1SRMA 4MDWA 3JCMf 1YI2A 3SD4A 1XNIA 3SEMA 4J7FA 3OYEA 4FYXB 2KK4A 1IZ6A 1N9SA 1JQQA 2J6FA 1TXQA 4PJOE 1JEGA 4RTYA 1EZZB 3CCQT 3M59A 2HBWA 2J6OA 1RADB 2FRYA 5FLXE 1BB9A 2JT4A 3CD6T 3BDLA 3OSSC 2JM9A 4RTXA 5I21A 1WI7A 1KHCA 3VS6A 1OZ3A 3VS2A 1M90U 2ZPBB 1YJ9Q 4NL2A 4B9WA 4GLMA 2DXBA 2RHYA 1JU5C 1CKBA 3VS3A 1YJNQ 5GAMe 4XU0A 4R0KA 4C5IA 4F7UF 4L59A 4OGCA 1WXBA 4CC2A 1KSWA 1M4ZA 1VQOA 1KIKA 3PT9A 4BE2A 5GAN4 3TREA 2FYKA 1YIJA 3WVDB 1RABB 4C92F 3X25B 5GJWB 3CCSQ 4X9CA 5GAMf 1ARKA 4M7DC 1C6VX 1GFDA 1NYGA 2DIGA 1VQ9A 1K8AR 1UGPB 3LYIA 4QVDA 2BUDA 1GBQA 3PVQA 1WHHA 2XIDA 3I56Q 2CREA 4DA4A 1AWWA 4M77G 1SF9A 1QCNA 3J81E 2ZGWA 3G71T 5L23A 3CCRT 2VC8A 3S3MA 2DL7A 1MV0B 4Z88A 2PTKA 1W70A 2FZGB 3O8VA 2XD0A 5GAN3 5GJVB 4ZTJA 3CCQQ 3QDFA 1VQ4T 3QPHA 4EIKA 2O2OA 2RK2A 3UF4A 1KJWA 2RI3A 5FU7B 4PJMA 1ZA1B 3JSCA 3OBYA 1V29B 3G6EQ 1WGSA 3CD6Q 4R56A 1QLYA 4M75C 2W0ZA 4KH1B 5IHKA 1WPYA 4BD3A 2KRMA 5IHIA 3UWNA 4IUTA 3C4SA 4FW2A 1WIEA 4FU6A 3ER0A 2GTOA 4O5VA 4N4HA 2XG8D 4KGVB 4OMQA 5KYYA 3RERA 1X2KA 4KUIA 2CKKA 3UDCA 1KD1R 4J5YA 2X3XD 1YBYA 2X4WA 1Q7YR 2C06A 4PJJA 2KR3A 1RAHB 3J80E 2D0QB 2C0TA 3OSVA 4B9XA 5I11A 1BIAA 1HXDA 3OYBA 3ZBDA 1WJQA 3LH5A 3NMZC 5LJ5h 1ZSZA 4A53A 1QVFA 1VQ5Q 1Y71A 1OOTA 1TH7A 2P0QA 1BU1A 1YCSB 3RMQA 8ATCB 3CC2Q 5A0LA 3PGGA 2KBTA 2J6KA 2PU9B 4NOYA 2IG0A 1G3YA 3SWNC 1UGSB 1BI3A 2E1HA 2RQTA 5FU6B 4JDSA 4FM4B 5KYXB 3M55A 3G4ST 1I8FA 2DLPA 2EYYA 2OAUA 4OB0B 2V8IA 2NUTA 4D8KA 2RHXA 2W10A 3MKDA 3CCJQ 4A54A 2JW4A 1VQMT 2O4XB 1BI0A 1JXOA 3D7SB 2A08A 1YJNT 4M7AA 2E3IA 2F2VA 2LJ1A 4ORZA 2DL5A 4DEYA 2QEXA 5I2SA 2DBMA 3I35A 2CSQA 4HVVA 4O6JA 3M0TA 2K4YA 2LT1A 4C92C 4C8QC 1ZSZB 6AT1B 5GANf 2BKDN 2MPXC 3M9QA 3M4GA 1Q7YC 2LQ8A 2AK5A 4M77E 2EYWA 3L42A 3REBB 1VQNA 2RH2A 2HDAA 2MWPA 1K9MR 3FIFA 3CCRQ 1PKTA 1M1FA 5KYNA 2X4XA 4XTVA 2JMCA 1U8RA 1YFNA 4JS4A 3MEWA 2D9TA 1BBZA 1VQLA 2K9GA 3CMAT 4V2SA 3GPLA 1YHQT 3OYIA 3MPUB 3QHSA 3I55T 2RI2A 4C92E 3HFNA 5CKHA 2GFAA 2E6ZA 4RUGA 5FW9A 4CC3A 1ZA2B 2MI6A 2CZ0B 1PM3A 2LMJA 2SRCA 3CC4T 1JBMA 2CUBA 3CXCS 3V7CA 1A0NB 1D0ZA 1RUWA 4X9DA 1KQSS 2FEIA 2DL4A 5C6SA 4M7DD 5AT1B 1M90R 3MEAA 2PVGB 1LVKA 1E6GA 1WYXA 3RUXA 3EG9A 1GXIE 2ROLA 1YJWA 2LQNA 1X69A 2F2WA 2M02A 2GGRA 4B6MA 3CC2A 4JLGA 2IIMA 3CPWS 4KUDK 2R57A 2RD1A 3HFOA 2MOXA 3H8ZA 1WNLA 3KFVA 4HVUA 4M78A 1D1CA 2E5QA 2YHTA 3NGPA 2YSQA 3PNWC 4IKFA 2ZPGB 4E47A 3OB9A 4FSSA 1QVGP 3CC4A 2OI3A 3CQTA 3L2UA 3EFSA 4E2FB 1X01A 3OS0A 1M1KR 1Y96B 4M77D 2RNAA 3OY9A 5FWCA 1UHCA 3FRNA 4HA8A 3OYGA 1VYVA 3I55A 4XU1A 2HQEA 2MWOA 1X6OA 1RAGB 5I2MA 1RAFB 4ATOA 1PSEA 5LJ5g 1YI2Q 1VQLT 3CCUT 1ZUYA 4M4ZA 1MHNA 2ZPEB 1KQSP 1JO8A 3UT1A 2QEXQ 2A28A 2JMAA 5CR2A 1ZSGA 2GFUA 2JZ2A 3VYGA 2DEQA 4FT2A 3C95A 1X75C 1Q81R 1ZUUA 1V1CA 4C5HA 1RL2A 1PD0A 4HCBA 2M1HA 1AWOA 1M90C 4J9BA 3L2WA 4C0GA 3CCRA 5GMKl 1HSQA 1UGVA 3L2RA 2CZ7B 1TS9A 2E12A 4J9CA 5DLOA 3Q1JA 2JNGA 3G7ZA 3WXMB 2DRMA 2NUPB 4LDWA 3CCUQ 3PIOA 1ABQA 5GAOr 1ZQ1A 4C92G 3FDRA 2DTHA 1VQOT 2XDBA 3JCMe 3JB9F 2RO0A 1WA7A 2OTLQ 2VB6A 2VGNA 3V8LA 4HXJA 5GMKe 4IUUA 2C0OA 1WQ7A 1YHQQ 5GAN2 3E2UA 2HBPA 1VYTA 2D1XA 2PNIA 3P8HA 4DOWA 4C8QB 1Q81U 1KG1A 4LDUA 4E7ZA 1NG2A 1QW1A 4M75E 3I56A 3FB9A 5LJ5e 1QP3A 2J06A 2A0FB 4CC4B 4ZTFA 3RMSA 2VGMA 3TEEA 5GAOn 5A2QE 4EMGA 3LH0A 3VJPA 2MK5A 4HVWA 2Y90A 3EGXA 1EX4A 1VQPA 5HY6A 4C8QG 5LJ3f 1U1SA 3OYKA 2DZCA 3NTHA 2ZCFB 5HK0A 5LJ3h 1TUDA 2JN0A 2LNVA 1K9MU 4WF2A 2LQKA 3GNGA 5L8RE 2C0IA 2GQVA 3L1AA 4M78G 1UHFA 3G6EA 1AZEA 1BIBA 3JB9H 1U1TA 1B3QA 1YN8A 4F7UG 1I0CA 2DL3A 3QWYA 2EYQA 3BE3A 3VS0A 2LQWA 2EKOA 2QQRA 4OMPA 5LJ3d 1W4SA 4PFOA 5KYYB 1FMKA 4AMCA 1U5SA 1BI2A 2DAQA 3JCMd 5J39A 4A4EA 3JB9G 4LXCA 3TSWA 2BIVA 2FZCB 4X34A 3BY7A 3DLLA 2RM4A 3I55Q 1PC0A 1WHLA 3M0QA 4QVZA 3VS7A 9ATCB 2QXFA 4HCZA 1VQ4A 2E3HA 4ANJA 1ZBJA 3T9NA 2QEXT 2AHJB 1WXTA 4M75B 1JRIA 4LN2A 1TTHB 2E64A 4XAXB 3JCMh 3PMIA 1YJ9A 4JUVA 2DYBA 1WFWA 1M2OA 3EGXB 4ZNXA 4AFUC 1VQ5A 5GAOq 1YJNA 2M0OA 2CS7A 1XJWB 3E9FA 2D8JA 1WJRA 4XTZA 1N8RR 3REAB 4PFZA 3TU4K 1NJIR 1SEMA 4BB7A 2E41A 2JS2A 4BACA 1UGQB 1Y0MA 3EG1A 1RI0A 1AWXA 1QVGS 2Y4YA 2O4XA 5GMKm 3OYAA 4JJDA 2WACA 1YIJT 4E7IA 4VUBA 2KYMA 2GF7A 2EFIA 4CI0C 2YRDA 4FL6A 3PTAA 3EFOB 4M75D 1YITQ 4KBMB 3X24B 3A8LB 1NEBA 2ZPIB 1HYOA 3R6NA 2QA4Q 5CQXA 5KE2A 4RTWA 2FHDA 4C92D 1JJ2A 4M77C 5CIUA 2CP7A 1U3OA 2OTLA 2QASA 3E1SA 1TSFA 4F17A 1K8AC 2CUDA 2V1QA 2AIRB 3BDUA 2GQIA 3TCJA 4FT4A 3CXCP 2EJ9A 2YUPA 1C0MA 2QYZA 3QJ6A 4Z89A 2CP0A 4J9GA 4RMOA 3E19A 5DY9A 3OMGA 3RBBB 4KGZB 1VQ7A 3CCLT 2XK0A 4WTOB 2QG9B 2G6FX 2NWMA 2LTOA 3H6ZA 2DILA 2DM1A 4E7SA 2V1RA 2K3YA 1N8RC 2E5KA 3PFSA 4ZN1A 2L89A 3OYHA 2NLUA 2KYBA 4FW1A 4C8QE 1UTIA 4QQ6A 2KE9A 4JZ3A 4L5GA 4C8QA 5IT9E 2M51A 1YNZA 3CBPA 1G5VA 2KDSA 3CCLA 3CC7T 1R0BG 4JRKA 1N9RA 2RJFA 1OX9A 4PJNA 1PRLC 2A36A 3M0PA 4PLLA 1Q82C 3I5SA 1KC8R 4JRIA 1GRIA 3MP6A 3THKA 2M9UA 5CCAA 1KD1C 1M2VA 1M5Q1 2X35A 1UG1A 3G1JA 2K3BA 1MNEA 2DMOA 2EWNA 2CSIA 4OB3B 4BDZA 2M0YA 2YUOA 2RQVA 2CYZB 1KFZA 3SDZA 1VQ4Q 3OS1A 5LJ3g 3JCMW 2QQ9A 2CP2A 2YRVA 4EMHA 3V8KA 3VU3C 3GF5A 1VQPT 1WJSA 1T0HA 2DBKA 3EG0A 5GANd 4HT8A 2DA9A 2E65A 2RHZA 4GBQA 2YWWA 4M7AE 3QG1A 2EYXA 3JV3A 1AHJB 2OAWA 1JXMA 1GBRA 5CK9A 1FYNA 1QVFS 4M7AF 1GCPA 4J9IA 1OU9A 2PZ1A 2KAFA 2DERA 5IH2A 3QDRB 1XQHA 2EQMA 2HQXA 2VASA 2DRKA 1VQNQ 1H641 2KI7A 3G4SQ 4LD9K 1O75A 2DIQA 3GBQA 2XMFA 2E4HA 2X3WD 4K11A 2LRQA 3OBWA 2GNCA 5KE3A 3SB2A 3HSBA 2KRNA 3JRZA 2YRCA 2EQUA 3CCMQ 4QW2A 3OW2S 1M3CA 1KQ1A 1YI2T 4DBRA 4RCCA 1QKWA 4FYVB 2O31A 2YUNA 3JCMb 2MF2A 4MMKA 1IO6A 3CC7A 2EW3A 1QMCA 5HCKA 1MNDA 1P92A
chains in the Genus database with same CATH topology
4RG2A 2R57A 2RD1A 3HFOA 4KUDK 3H8ZA 1WNLA 5FRMA 2IVWA 4C5GA 1VQ9T 4EPCA 2E70A 4M78A 2E5QA 2YHTA 3DB4A 5LL6S 2EQJA 4C0DC 1QVGA 3MP1A 2XHCA 2EIFA 2FB7A 2ZPGB 3PNWC 5CO7A 3OB9A 4E47A 2JTMA 5FU7C 1O9SA 5CAIA 2QI2A 3CC4A 2Y4XA 3QZ9B 4C0ZA 5GMKj 2X4YA 2EJFA 2KVQG 1QVPA 3QYGB 4BUGA 4OMFB 3OYNA 3L2UA 1VQKA 4TVRA 4RCBA 3GOXA 1N8RU 2LX9A 3EFSA 3EFRA 3FEOA 4MMLA 3QBYA 1VQ6A 4EDUA 4MDXA 4A4HA 3KBGA 1X01A 3JCMP 3OS0A 4GLKA 3ZEHA 5LJ5f 1Y96B 4M7AC 1N6AA 4M77D 3OY9A 3JB9I 3FC3A 4PJOA 1OYXA 3CCUA 3FRNA 4HA8A 2RJEA 2ZZDA 4M77F 3OYGA 3LWHA 3G4SA 3MEUA 2K57A 2QQBA 4MZMA 3A8GB 4PL6A 3I55A 4XU1A 1VQ7T 5GAOl 2HQEA 2MWOA 1X6OA 3OW2A 5I2MA 4QQGA 4ATOA 1PSEA 5LJ5g 3MCAB 2P0KA 5C0MA 1VQLT 3CCUT 5CQYA 1KQ2A 1MHNA 2ZPEB 4IURA 2HAXA 1B34A 3UT1A 1B34B 1M1GA 4PNOA 1KC8U 5CR2A 5LJ5d 3CCQA 1IREB 2GFUA 1Q86C 2DXCA 2JZ2A 3CMAA 2HNIA 1K8AU 3M5AA 3VYGA 2RHUA 3RKXA 2DEQA 1VQ8A 2LCCA 3C95A 4FT2A 1X75C 4OF1A 3KUFA 1VQ5T 3HRUA 3BW1A 2I2LA 5DM7R 1KHIA 2JUFA 4C5HA 1RL2A 4HCCA 1HK9A 3E9GA 4HCBA 3QXEB 2WSEE 3CCMT 2M1HA 3MEVA 2K5IA 2R58A 2JOYA 3PMTA 4XTUA 4M7AD 2ZPHB 1G3SA 1M90C 4MZPA 2B8AA 3M57A 3OYDA 3OA6A 3JAME 1UEBA 3L2WA 4PJOG 1LNXA 4C0GA 3CCRA 2DTIA 3NTIA 3VYHB 1XOVA 4LDXA 1ZBXA 2PQWA 5GMKl 2V8KA 3L2RA 1VQNT 3HHTB 2RA2A 4II1A 2CZ7B 5GAN5 3HL8A 4RKUE 3EAEA 3SWNB 2G3RA 2E12A 5DLOA 3Q1JA 3X26B 2JNGA 2JTFA 2VXFA 4NS5A 4DOVA 3G7ZA 3META 3OYJA 3WXMB 4ZN3A 2JVVA 4LDWA 1NJIU 4M7DE 5GANh 3PIOA 4N4IA 4N0AA 3LX7A 3CCST 5GAOr 1NPPA 1ZQ1A 2L5QA 4IUPA 4C0DB 4C92G 3INZA 2QA4T 3S3OA 1I81A 3JB9J 1PSFA 4MDWA 3JCMf 3FDRA 1YI2A 2DTHA 3SD4A 1XNIA 3LWIA 1VQOT 4J7FA 3OYEA 2XDBA 3JCMe 4M77B 5GAMd 3JB9F 2RO0A 4ELZC 2KK4A 1Y7XA 4OP0A 5LJ5j 2VGNA 3V8LA 3HRTA 1IZ6A 5GMKe 1K73U 4IUUA 1WQ7A 2RK1A 2A3LA 1N9SA 2R5MA 5GAN2 2HBPA 4PJOE 1W2BS 1KD1U 2DD5A 2KSSA 5A0DA 3CCQT 3MP8A 3S3NA 1BKBA 2XU8A 4LDVA 2RB6A 4F7UE 3P8HA 4BI4A 1Q7YU 5D6WA 5FRNA 1M1KC 3OS5A 4DOWA 2VUBA 4M7AG 2L3RA 4C8QB 4JS5A 1Q81U 1KG1A 3M59A 4ELYC 4LDUA 2LCLA 3OYFA 3CBOA 3QSUA 3PIPA 2CZ6B 5FLXE 1QW1A 4ZGDB 2P4TA 2V8JA 5M9OA 2RJDA 4M75E 3I56A 1LJOA 2WSCE 3FB9A 5LJ5e 3JB9D 1QP3A 3CD6T 3OS2A 1WQWA 3CCVT 3BDLA 4ZTFA 4C92A 3NTKA 3DKMA 4J6YA 2VGMA 3RMSA 2LT4A 5FU6C 3TEEA 4C92B 3OSSC 2K3XA 5GAOn 5A2QE 3CCVA 4EMGA 3LH0A 1FWZA 5I21A 4A4GA 5GAN8 1KHCA 3VJPA 1MGQA 3CBMA 2Y90A 3M58A 1OZ3A 1VQPA 5HY6A 5J3BA 3CXCA 4C8QG 1M90U 5LJ3f 1U1SA 3OYKA 2DZCA 2ZPBB 3CCJA 4A4KA 2MMPA 3NTHA 2ZCFB 4NL2A 5LJ3h 4B9WA 5HK0A 2DXBA 2RHYA 3A8HB 5GANg 2JN0A 2LNVA 1K9MU 3CMEA 4P5NA 4WF2A 4PKCC 2LQKA 3L2ZA 4J7IA 4LDYA 5GAMe 3GNGA 4E7LA 5L8RE 2GQVA 3L1AA 4M78G 2WSFE 5KH6A 4XU0A 3G6EA 1BIBA 3JB9H 2OTJT 1U1TA 4C5IA 4BY6B 4C5EA 3OYCA 4F7UF 1FXXA 4XU2A 4EMKC 4BE0A 2OTLT 4MZTA 4L59A 2DZ9A 4OGCA 1VUBA 4F7UG 4F7UA 5EG2A 2YLCA 2EYQA 4Y28E 1VQOA 1M4ZA 2O01E 3VUBA 3PT9A 4BE2A 3OMCA 5GAN4 2EKOA 2FYKA 2QQRA 2EAYA 5CKEA 5LJ3d 3TREA 1YIJA 4IUQA 1NPRA 3WVDB 3X20B 1R8OB 1W4SA 4C92F 3X25B 5GAN7 4ZGJB 3GP8A 3FJPA 3VUZA 4X9CA 5GAMf 4OGEA 4XK8E 4M7DC 1OI1A 3DB3A 3QJYA 5CKFA 3V8JA 4J83A 1BI2A 2DIGA 4RG8A 5A0GA 1VQ9A 2M16A 4C0FA 1YJWT 2DAQA 3JCMd 5J39A 3CPWA 4A4EA 3P8BB 1UGPB 3LYIA 4QVDA 3JB9G 2BUDA 2K5FA 4KULA 1YCYA 2A7YA 3MHXA 4HT9A 2BIVA 3JCMc 3CC2T 3ASKA 2XIDA 4X34A 1N27A 3JCMV 3BY7A 1YITA 3DLLA 4DA4A 2RM4A 2DO3A 1BYMA 4M77G 4QVZA 3OYYA 3J81E 4M75G 5FROA 3M54A 2ZGWA 2PVDB 3G71T 3CCRT 2QXFA 2VC8A 4HCZA 1VQ4A 2K5LA 4C8QD 3S3MA 4XQ3A 3T9NA 2QEXT 2AHJB 3QUIA 4M78E 4M75B 5J26A 1JRIA 2CZ1B 2E64A 2F5KA 4XAXB 5D6YA 2XKOC 3LGFA 3PMIA 3JCMh 2XD0A 3O8VA 5GAN3 1YJ9A 4JUVA 2FVUA 5GAOp 4ZTJA 1VQ4T 1Q86U 1VQ5A 3QPHA 1VIFA 2P0PA 2RK2A 2KQWA 2M0OA 2CS7A 5GAOq 2RI3A 4KT0E 1YJNA 3E9FA 2HD0A 3JSCA 5FU7B 1WJRA 3OBYA 4FIBA 4XTZA 1V29B 4QQDA 1WGSA 4R56A 3TU4K 4UC4A 4M75C 3A5ZB 4E7KA 4BB7A 5HKCA 4E7JA 1KQSA 2E41A 1WPYA 4BACA 4BD3A 1UGQB 3M56A 4PJOB 3UWNA 4IUTA 3L2VA 1RI0A 3C4SA 4F7UB 2MAMA 1QVGS 1UGRB 3CCSA 1NJIC 4PJOD 4FU6A 3ER0A 5GAN6 1YITT 2Y4YA 2LC4A 2O4XA 5GMKm 4O5VA 1D3BA 4N4HA 2WACA 2XG8D 3OYAA 1YIJT 4E7IA 1I4K1 4VUBA 3A8MB 5AYFA 4M7DA 1G3TA 2VV5A 1XTDA 2EFIA 2GF7A 2XICA 4CI0C 4KUIA 3RERA 2CKKA 4FL6A 3QIIA 3PTAA 3UDCA 4J5YA 1DJ7B 1VQ6T 4M75D 1YBYA 2DKGA 2E6NA 2X4WA 3CEYA 4FSXA 4KBMB 3X24B 3A8LB 5LJ3e 1VQKT 2C06A 1I5LA 2ZPIB 3J80E 4CRIA 5GAMh 2D0QB 3OSVA 5CQXA 4B9XA 1BIAA 3LLRA 3RESA 5KE2A 1HXDA 2FHDA 4C92D 3OYBA 1JJ2A 4M77C 3P8DA 3ZBDA 5CIUA 2XDDA 1Y07A 1WJQA 3CPWS 4JRPA 1Q82U 4OVAA 1W2BA 3CCJT 4Z02A 3RKYA 1M1KU 2OTLA 2CGHA 1QP2A 2RI5A 3ZFJA 5LJ5h 3G6ET 1K73C 2OTJA 1QVFA 4A53A 3R6OA 1H3ZA 3E1SA 1Y71A 2XI9A 3X28B 1TH7A 2P0QA 4M78B 1JJ2S 3RMQA 1VIEA 4M77A 4DQ2A 3HP9A 2D6FA 3ME9A 2H3JA 4J6WA 5A0LA 1K8AC 3PGGA 3BDUA 3TCJA 2PU9B 3HRSA 4FT4A 4NOYA 2IG0A 1G3YA 2EJ9A 3QO3A 3SWNC 3QJ6A 3C12A 1UGSB 1BI3A 2E1HA 4RMOA 3E19A 5DY9A 5FU6B 4XU3A 4L6V5 3OMGA 4JDSA 4M78C 4FM4B 2RHIA 3CCLT 1VQ7A 2XK0A 3GNFB 1Y96A 3M55A 3G4ST 1I8FA 5IN1A 3I56T 2OAUA 4OB0B 2V8IA 4JLIA 1M8VA 3V7SA 3OYMA 2RHXA 5GAMj 2EJGA 2K2VA 2LTOA 4R55A 3JCMJ 1VQMA 3H6ZA 4A54A 4C8QF 1VQMT 2LVMA 2KY9A 2VYTA 3M4YA 2O4XB 5CKDA 1BI0A 4PLIA 4IUVA 1D3BB 4M7AB 2K3YA 1YJNT 1N8RC 4M7AA 4EMKA 4ZGEB 3PFSA 4BY6C 5GAMg 4PJOC 4ZN1A 3KXTA 2QTXA 1SSFA 2L89A 2QDYB 3JCMX 3OYHA 2QA4A 2NLUA 2L8DA 2KMTA 4GY5A 4C8QE 4QQ6A 3A8OB 2VXEA 5KCOA 3HKSA 4M78D 4L5GA 3HPWA 4C8QA 5IT9E 3URGA 3GIBA 2XDPA 3CBPA 2QEXA 1KC8C 2E10A 5I2SA 1G5VA 4N0AC 3AHUA 1JB0E 5GAOm 2PUOB 5LJ3j 2KDSA 3N5BB 3CCLA 4O6JA 3CC7T 2K4YA 2X4JA 3F70A 4J6XA 4JRKA 2LT1A 1N9RA 4C92C 2RJFA 4PLLA 1Q82C 4C8QC 5IAYA 4JRIA 5GANf 3SFMA 2BKDN 5CCAA 3MP6A 1KD1C 2M9UA 1NE8A 5GANj 3UPUA 3M9QA 1LOJA 3M4GA 1M5Q1 2X35A 1Q7YC 2LQ8A 4M77E 4OB1B 3L42A 3NFCA 1VQNA 2RH2A 4BDYA 2MWPA 3RIRA 3CCEA 3LGLA 4D6WA 1M9SA 3SWNA 2EWNA 3C94A 3FIFA 4M78F 4OB3B 4M7DG 4BDZA 1S72A 5HK3A 1M1FA 2CYZB 4J8OA 4JJNK 1VQ8T 3SDZA 2X4XA 3OS1A 4XTVA 3CMET 5LJ3g 1U8RA 3JCMW 2QQ9A 2LDMA 2YRVA 3J7AF 4EMHA 4JS4A 3CCMA 1EIFA 2DPPB 4OB2B 2F5TX 1K9MC 3V8KA 1BI1A 2R5AA 3GF5A 3VU3C 3QYHB 1VQPT 5CVIA 3MEWA 1FX7A 2D9TA 2QQSA 1VQLA 5GMKi 3GLXA 2PUKB 5D6XA 3DLMA 1WJSA 4XTYA 4M75A 3CMAT 4V2SA 3WVEB 3GPLA 1YHQT 3OYIA 4YTLA 3QHSA 3I55T 2RI2A 3CD6A 4C92E 5GANd 4LD6A 3OQ5A 4HT8A 1NZ9A 3HFNA 2E65A 2RHZA 3JCMQ 5CKHA 2GFAA 3RKWA 4EMKB 2E6ZA 4M7AE 3QG1A 4BI8B 2YLBA 3FLGA 3QKJA 4JRQA 4Q5WA 3MO8A 4QVCA 2MI6A 4M75F 1ZHIA 1AHJB 1OZ2A 2CZ0B 1YHQA 2RJCA 2PVOB 2GCXA 5CK9A 1G3WA 5KCHA 3CC4T 4A4FA 1QVFS 4M7AF 1JBMA 4Y91A 2KAFA 2DVEA 2QQAA 3CXCS 2DXUA 4ME7A 3V7CA 1YJ9T 3QDRB 1Q81C 1XQHA 2EQMA 2HQXA 3L2QA 4X9DA 1KQSS 4NL3A 2F69A 5C6SA 4XTWA 2DXTA 4M7DD 1UB4A 1H641 3V7RA 5GMKh 3MEAA 4LD9K 1S72T 2DD4A 1O75A 5CKBA 2PVGB 2DIQA 4HKEA 4M7DB 5DLQE 3CCET 4BI3A 2LRQA 3OYLA 3OBWA 5KE3A 3SB2A 3HSBA 3BFMA 3RUXA 3JRZA 3LW5E 2EQUA 4XTXA 3QZ5B 4IKFA 4QW2A 2FL7A 3OW2S 1GXIE 3M53A 1KQ1A 3S6WA 1YI2T 1YJWA 4RCCA 3VV0A 5GANe 4N4GA 2ZPFB 4E7HA 3G71A 2DK3A 2DTOA 4PJOF 3JCMb 2MF2A 2DJZA 4MMKA 4M7DF 3CC7A 3JCMg 3VKIA 4BE1A 3CC2A 1P92A 3CPFA 4JLGA 2EQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN 2;  2RD1 A;  3HFO A;  1WNL A;  2E41 A;  1WPY A;  4J6X A;  4JRK A;  4PJO E;  4M78 A;  2YHT A;  1N9R A;  4C92 C;  4F7U E;  4PJO B;  2RB6 A;  4C8Q C;  4M7A G;  4JRI A;  5GAN f;  2FB7 A;  5LJ5 j;  4C8Q B;  5CAI A;  4F7U B;  4PJO D;  5GMK j;  3QSU A;  1LOJ A;  2EJF A;  1M5Q 1;  3M4G A;  5GAN 6;  4M77 E;  4RCB A;  5GMK m;  4M75 E;  3EFS A;  1LJO A;  1D3B A;  3EFR A;  3FB9 A;  4MML A;  3RIR A;  5LJ5 e;  3JB9 D;  1I4K 1;  1X01 A;  3SWN A;  3JCM P;  2EWN A;  3FIF A;  1WQW A;  4M78 F;  4M7D A;  3RER A;  4C92 A;  4M7D G;  5LJ5 f;  4J6Y A;  5GAN j;  4C92 B;  5GAO n;  1Y96 B;  4M7A C;  4M77 D;  4J5Y A;  4XTV A;  4EMG A;  5LJ3 g;  3JB9 I;  4PJO A;  5I21 A;  4M75 D;  3JCM W;  2DKG A;  5LJ3 e;  5GAN 8;  4HA8 A;  4M77 F;  1MGQ A;  4EMH A;  2K57 A;  2Y90 A;  1I5L A;  4XU1 A;  4C8Q G;  5GAO l;  3V8K A;  5LJ3 f;  1U1S A;  5GAM h;  2DZC A;  3VU3 C;  1BIA A;  3RES A;  4NL2 A;  1HXD A;  5LJ3 h;  4C92 D;  5LJ5 g;  1KQ2 A;  4M77 C;  5GAN g;  2JN0 A;  5GMK i;  4WF2 A;  4XTY A;  3L2Z A;  4M75 A;  5GAM e;  4V2S A;  3RKY A;  1B34 A;  3L1A A;  1B34 B;  3QHS A;  4M78 G;  4XU0 A;  1BIB A;  2CGH A;  4PNO A;  1U1T A;  4C92 E;  5LJ5 h;  5GAN d;  3JB9 H;  4F7U F;  4XU2 A;  3HFN A;  4EMK C;  2E65 A;  5LJ5 d;  4A53 A;  3JCM Q;  4HT8 A;  3RKW A;  2DZ9 A;  4EMK B;  2HNI A;  4F7U G;  3RKX A;  1TH7 A;  2DEQ A;  4M78 B;  4F7U A;  4M7A E;  4DQ2 A;  2YLB A;  2YLC A;  4M77 A;  3BW1 A;  2I2L A;  5GAN 4;  4QVC A;  4J6W A;  2FYK A;  2EAY A;  4M75 F;  5LJ3 d;  3PGG A;  3BDU A;  1HK9 A;  4C92 F;  5GAN 7;  4NOY A;  3FJP A;  2EJ9 A;  3QO3 A;  4XTU A;  3SWN C;  4M7A D;  4X9C A;  5GAM f;  4M7D C;  4M7A F;  2E1H A;  1JBM A;  4Y91 A;  3V8J A;  4PJO G;  5DY9 A;  1LNX A;  2DVE A;  4XU3 A;  2DTI A;  4M78 C;  2DXU A;  3V7C A;  3JCM d;  4QVD A;  5GMK l;  3JB9 G;  1Y96 A;  4X9D A;  1I8F A;  1YCY A;  4NL3 A;  4HT9 A;  1M8V A;  2RA2 A;  4JLI A;  4XTW A;  3JCM c;  2DXT A;  3V7S A;  5GAN 5;  4M7D D;  3V7R A;  1H64 1;  3JCM V;  3BY7 A;  2EJG A;  5GMK h;  5GAM j;  2RM4 A;  3JCM J;  4M77 G;  3SWN B;  4M75 G;  4M7D B;  4A54 A;  4C8Q F;  2ZGW A;  2VXF A;  2VC8 A;  3SB2 A;  1D3B B;  3HSB A;  4C8Q D;  4M7D E;  4XQ3 A;  3BFM A;  5GAN h;  3RUX A;  3QUI A;  4M78 E;  4M75 B;  4N0A A;  4XTX A;  1JRI A;  4M7A B;  2E64 A;  5GAO r;  4C92 G;  4M7A A;  4EMK A;  3JB9 J;  3JCM h;  4PJO C;  3INZ A;  5GAM g;  1I81 A;  2QTX A;  3JCM X;  1KQ1 A;  4JUV A;  5GAN 3;  3JCM f;  4RCC A;  5GAN e;  4C8Q E;  5GAO p;  2DTH A;  2DTO A;  2VXE A;  4PJO F;  3JCM b;  4M78 D;  2DJZ A;  4MMK A;  3JCM e;  4M7D F;  5GAO q;  4C8Q A;  4M77 B;  3JCM g;  5GAM d;  3GIB A;  3JB9 F;  2E10 A;  4XTZ A;  4OP0 A;  4N0A C;  3V8L A;  5GMK e;  3AHU A;  4M75 C;  5GAO m;  1WQ7 A;  1N9S A;  5LJ3 j; 
#chains in the Genus database with same CATH topology
 5FRM A;  4C0D C;  1QVG A;  3MP1 A;  2EIF A;  5LJ5 j;  5FWB A;  2QI2 A;  5GMK j;  2X4Y A;  3QYG B;  2BTT A;  1VQK A;  1N8R U;  2B86 A;  4RCB A;  2LX9 A;  3EFR A;  3QBY A;  1VQ9 Q;  2MCN A;  3JCM P;  1WLP B;  4GLK A;  4M7A C;  4PJO A;  1OYX A;  2ROT A;  3CCU A;  1RI9 A;  2EYZ A;  3H9N A;  4PL6 A;  1VQ7 T;  2Z0W A;  4ESR A;  3OW2 A;  2P0K A;  5C0M A;  1K0S A;  4J9E A;  2LJ0 A;  1X6B A;  1M1G A;  4PNO A;  2KT1 A;  3G71 Q;  1Q86 C;  2DXC A;  2HNI A;  3M5A A;  3RKX A;  4OF1 A;  3KUF A;  3HRU A;  1X6G A;  2I2L A;  2DX1 A;  3E9G A;  3QXE B;  3CCM T;  3MEV A;  4M7A D;  2B8A A;  3OYD A;  1UDL A;  2COZ A;  4PJO G;  2DTI A;  2GBQ A;  3VYH B;  1RLP C;  1M8M A;  2QTV A;  2JS0 A;  4LDX A;  2DEU A;  3HHT B;  2RA2 A;  5GAN 5;  1RAA B;  3HL8 A;  5IHN A;  3SWN B;  2JTF A;  1IGQ A;  1UEC A;  2VXF A;  3OYJ A;  2NUP A;  2JVV A;  5GAN h;  3VRZ A;  3LX7 A;  2L5Q A;  4IUP A;  2K79 A;  1I81 A;  4Z8A A;  1OUL A;  4Y92 A;  4M77 B;  5GAM d;  1PCX A;  4F04 B;  4ELZ C;  2EPD A;  1YWP A;  3HRT A;  1WHM A;  1K73 U;  2OTJ Q;  2RK1 A;  4RTV A;  2R5M A;  1RAI B;  2DD5 A;  1ZSZ C;  1Q7Y U;  5FRN A;  4M7A G;  1M1K C;  2BZY A;  2AZV A;  2LCL A;  1GL5 A;  3CBO A;  3PIP A;  2CZ6 B;  2QDL A;  2P4T A;  2RJD A;  1LJO A;  2WSC E;  2K7A A;  1WQW A;  3TSZ A;  1NM7 A;  3CCV T;  4KGX B;  3NTK A;  4J6Y A;  5GAN j;  4C92 B;  2LT4 A;  1FMV A;  1FWZ A;  1LCK A;  4A4G A;  3CBM A;  3C0C A;  1Z9Q A;  5J3B A;  2DNU A;  3CPW P;  3CCJ A;  2RQU A;  1Q95 G;  2MMP A;  4A4K A;  2EQI A;  1Q86 R;  4DBH A;  1PRM C;  1B7T A;  5GAN g;  2EGC A;  3CC7 Q;  3L2Z A;  4J7I A;  4E7L A;  2BE9 B;  1BCO A;  2OTJ T;  5KH6 A;  1EFN A;  1FXX A;  4EMK C;  5KYW A;  3VRY A;  1M30 A;  2DZ9 A;  4F7U A;  5EG2 A;  2YLC A;  4PJL A;  3ZL7 C;  2O01 E;  3VUB A;  3OMC A;  4AT1 B;  2EAY A;  5CKE A;  4CC7 A;  1OEB A;  4IUQ A;  1R8O B;  4ZGJ B;  3FJP A;  3VUZ A;  4XK8 E;  1OI1 A;  3UAT A;  3V8J A;  2CH4 W;  4J83 A;  4RG8 A;  2M16 A;  1MMG A;  3CPW A;  1B07 A;  4KUL A;  1YCY A;  3MHX A;  3JCM c;  3CC2 T;  3ASK A;  1AD5 A;  3JCM V;  1YIT A;  2DO3 A;  4JZ4 A;  3I5R A;  1BYM A;  2EBP A;  3OYY A;  4M75 G;  5FRO A;  2VKN A;  1WHJ A;  1K1Z A;  1G2B A;  2K5L A;  1TOV A;  4C8Q D;  5J26 A;  2CZ1 B;  1M27 C;  2XKO C;  3LGF A;  1IRX A;  2JXB A;  2QGF B;  2I0N A;  2FVU A;  5GAO p;  2ABL A;  3CME Q;  1MMN A;  1VIF A;  2P0P A;  1ZLM A;  2KQW A;  4KT0 E;  1QCO A;  2HD0 A;  3A1P A;  2EGE A;  3EGD B;  4QQD A;  1UJY A;  1AT1 B;  3A5Z B;  4E7K A;  5HKC A;  2FPF A;  4E7J A;  1KQS A;  4PJO B;  3L2V A;  5KYW B;  4F7U B;  2KRO A;  1F1B B;  1AWJ A;  5GAN 6;  1YIT T;  3EHQ A;  3NHN A;  3SHW A;  3A8M B;  5AYF A;  4M7D A;  1G3T A;  2VV5 A;  1G8X A;  2XIC A;  1KK7 A;  3QII A;  1QWF A;  1VQ6 T;  2MIO A;  3CEY A;  2E6N A;  4FSX A;  1I5L A;  2DF6 A;  2EGA A;  4CRI A;  5GAM h;  2ED0 A;  1IB8 A;  2ECZ A;  4F16 A;  1Q82 U;  1Z9Z A;  1W2B A;  4Z02 A;  3RKY A;  1M1K U;  2HKN A;  3IQL A;  1RAE B;  2RI5 A;  3ZFJ A;  2OTJ A;  3R6O A;  1H3Z A;  1ZX6 A;  3X28 B;  1JJ2 S;  4DQ2 A;  3HP9 A;  3ME9 A;  3EG3 A;  1K73 R;  2FO0 A;  2L3P A;  2KRS A;  1MUZ A;  5D7U A;  2K6D A;  1X43 A;  4XU3 A;  4L6V 5;  4M78 C;  4F14 A;  1MMD A;  1S72 Q;  3GNF B;  1Y96 A;  3RNJ A;  3RR6 A;  4JLI A;  1M8V A;  1VQ6 Q;  5GAM j;  1SPK A;  2K2V A;  4PFP A;  4R55 A;  3TVT A;  3JCM J;  4C8Q F;  2LX7 A;  2LVM A;  2VYT A;  3M4Y A;  5CKD A;  4PLI A;  1WDX A;  2DFU A;  4M7A B;  4PJO C;  4BY6 C;  5GAM g;  1T0J A;  3KXT A;  2QTX A;  2QDY B;  2QA4 A;  1GCQ C;  1V76 A;  2EVR A;  2KMT A;  3HKS A;  2HMA A;  3URG A;  3GIB A;  1KC8 C;  1YIJ Q;  3NPF A;  2HCK A;  2PUO B;  4QT7 A;  5LJ3 j;  4AFQ C;  1W2B P;  2X4J A;  3F70 A;  4J6X A;  4J9D A;  1NE8 A;  4OB1 B;  4BDY A;  3RIR A;  3C94 A;  4M78 F;  1E6H A;  4M7D G;  2ED1 A;  5HK3 A;  2KXD A;  2HL5 C;  4J8O A;  1VQ8 T;  2LDM A;  3J7A F;  3CCM A;  1EIF A;  4OB2 B;  1K9M C;  1BI1 A;  3QYH B;  5CVI A;  1I1J A;  5GMK i;  3GLX A;  2PUK B;  3DLM A;  1QKX A;  4XTY A;  4M75 A;  2OJ2 A;  3WVE B;  2AZS A;  3CD6 A;  3OQ5 A;  1NZ9 A;  3JCM Q;  2COY A;  5IXF A;  2GTJ A;  3RKW A;  5KYU A;  4EMK B;  1SSH A;  4BI8 B;  2YLB A;  1SG5 A;  3FLG A;  7AT1 B;  3QKJ A;  4JRQ A;  4Q5W A;  3MO8 A;  2O88 A;  1AEY A;  1YHQ A;  1QVF P;  2RJC A;  4RTT A;  3QWX X;  4PK4 A;  1UJ0 A;  1G3W A;  5KCH A;  3OW2 P;  2AKK A;  4Y91 A;  2RQR A;  2QQA A;  4ME7 A;  1YJ9 T;  3L2Q A;  2ATC B;  2DVJ A;  1UUE A;  3V7R A;  2L3Q A;  2DD4 A;  5CKB A;  4HKE A;  4LE9 A;  2IPO B;  1AZG B;  1TUC A;  5DLQ E;  3CCV Q;  2CP3 A;  3OYL A;  3BFM A;  3EFO A;  1VQP Q;  3H0F A;  2KGT A;  4N4G A;  4E7H A;  3G71 A;  2DK3 A;  4PJO F;  2DE0 X;  4M7D F;  1UE9 A;  3JCM g;  3VKI A;  1YWO A;  1D0Y A;  1T3L A;  2HSP A;  1WZO A;  3CPF A;  3QZ9 B;  2EQK A;  4C5G A;  1VQ9 T;  1RLQ C;  1NLO C;  5LL6 S;  1WX6 A;  2XHC A;  2FB7 A;  2RF0 A;  1W1F A;  4AG2 C;  5KYU B;  2JTM A;  1O9S A;  4BUG A;  2EJF A;  2KVQ G;  3OYN A;  4OMF B;  1VQ6 A;  2H8H A;  1OQK A;  4A4H A;  3ZEH A;  5LJ5 f;  1SHF A;  1N6A A;  1NLP C;  3JB9 I;  1KC8 U;  2RJE A;  2ZZD A;  3G4S A;  1OV3 A;  4MZM A;  1E7O A;  1WHK A;  4E6R A;  4RTU A;  5CQY A;  4OMM A;  5EC7 A;  1X2Q A;  1B34 B;  3ULR B;  2ESW A;  5LJ5 d;  1K8A U;  1K4U S;  4FCY A;  1VQ8 A;  2RHU A;  4DBQ A;  3BW1 A;  4X1V A;  5DM7 R;  1KHI A;  2JUF A;  4HCC A;  2WSE E;  3PMT A;  2JOY A;  1NEG A;  2ZPH B;  4MZP A;  3M57 A;  1W6X A;  4FYW B;  1ZBX A;  2YUQ A;  1GCQ A;  4WCI A;  3U23 A;  3EAE A;  2G3R A;  2O9S A;  3X26 B;  3PE0 A;  2H3E B;  4NS5 A;  1CSK A;  4ZN3 A;  1BK2 A;  4M7D E;  1NJI U;  1VQL Q;  4N4I A;  4N0A A;  2QA4 T;  3INZ A;  3S3O A;  2KNB B;  2NUT B;  1NBE B;  3LWI A;  1T3S A;  1N5Z A;  4LUD A;  1Y7X A;  2X51 A;  4OP0 A;  2A3L A;  2OX7 A;  1W2B S;  1KD1 U;  2KSS A;  5A0D A;  3MP8 A;  3S3N A;  1BKB A;  1PG5 B;  2XU8 A;  2RB6 A;  4LDV A;  4BI4 A;  4F7U E;  5D6W A;  3OS5 A;  2VUB A;  2L3R A;  4OMN A;  4JS5 A;  4JJB A;  4ELY C;  3OYF A;  2D8H A;  3QSU A;  4ZGD B;  2V8J A;  5M9O A;  3JB9 D;  1OX8 A;  3OS2 A;  4C92 A;  3DKM A;  5FU6 C;  3CCV A;  2K3X A;  2FZK B;  3EH2 A;  5GAN 8;  1MGQ A;  4KH0 B;  3M58 A;  1H8K A;  1TWB A;  3CXC A;  2QK0 A;  1SHG A;  3EGD A;  1PNJ A;  3A8H B;  1QCF A;  4HCK A;  4QKU A;  3CME A;  4P5N A;  4PKC C;  1ABO A;  4LDY A;  2WSF E;  3M0R A;  4C5E A;  1VA7 A;  4BY6 B;  3OYC A;  2OTL T;  4XU2 A;  4BE0 A;  4MZT A;  1VUB A;  4Y28 E;  4JPB W;  2QAZ A;  1IXD A;  1NPR A;  1R0C B;  3X20 B;  5GAN 7;  3CC4 Q;  3GP8 A;  3CCL Q;  2D0N A;  4OGE A;  3DB3 A;  4JJC A;  3A98 A;  3QJY A;  5CKF A;  5A0G A;  4LUE A;  1YJW T;  4C0F A;  3TQ7 P;  3P8B B;  2K5F A;  2A7Y A;  4HT9 A;  1M3B A;  1N27 A;  3EG2 A;  3AT1 B;  3M54 A;  2PVD B;  2DJQ A;  4XQ3 A;  3QUI A;  4M78 E;  5D6Y A;  1SRL A;  2F5K A;  1J3T A;  2FG0 A;  2JM8 A;  1Q86 U;  2FRW A;  1VQ8 Q;  4IIO A;  4FIB A;  4AG1 C;  5I22 A;  4UC4 A;  1MMA A;  3EG9 B;  3EGU A;  1AOJ A;  1WXU A;  2CH4 A;  1VYU A;  2P84 A;  3M56 A;  1OU8 A;  2LNH B;  2CDT A;  4J9H A;  3VS1 A;  2MAM A;  1UGR B;  3CCS A;  1NJI C;  4PJO D;  1Y57 A;  2LC4 A;  1TG0 A;  1K0X A;  1D3B A;  3M0U A;  4OMO A;  1I4K 1;  2BZX A;  1XTD A;  1PKS A;  2JJ9 A;  1DJ7 B;  1LPL A;  1HD3 A;  2DKG A;  5LJ3 e;  2NYS A;  1VQK T;  1FMW A;  2YXY A;  2LZ6 B;  3LLR A;  3RES A;  1SKU B;  3P8D A;  2XDD A;  1IHW A;  1Y07 A;  4JRP A;  4OVA A;  3CCJ T;  2V26 A;  2F1L A;  2CGH A;  1QP2 A;  4IIM A;  3G6E T;  1K73 C;  1BCM A;  2FPE A;  2HEQ A;  2XI9 A;  4M78 B;  2D6F A;  1VIE A;  4M77 A;  1H3H A;  1RAC B;  1UFF A;  2H3J A;  4J6W A;  2L2P A;  3HRS A;  3QO3 A;  2HSE B;  3C12 A;  3M0S A;  2RHI A;  3HTR A;  2LJ3 A;  2AT1 B;  5IN1 A;  1VQK Q;  3I9Q A;  3I56 T;  3V7S A;  3OYM A;  2EJG A;  1VQM A;  1QWE A;  1CKA A;  2RMO A;  2KY9 A;  4DBF A;  2F2X A;  1S1N A;  4IUV A;  1D3B B;  3EHR A;  2MYS A;  4DEX A;  4EMK A;  4ZGE B;  2CT4 A;  1SSF A;  3JCM X;  2L8D A;  4GY5 A;  2HZY A;  3A8O B;  2VXE A;  5KCO A;  4M78 D;  3O5Z A;  1QQJ A;  3HPW A;  4D8D A;  2XDP A;  1Q82 R;  2E10 A;  1VOM A;  4N0A C;  3AHU A;  1PHT A;  1JB0 E;  5GAO m;  3N5B B;  2COW A;  2CT3 A;  3CMA Q;  2KXC A;  2YDL A;  1D09 B;  4AFS C;  5IAY A;  1U06 A;  2ENM A;  3SFM A;  2ZAE A;  3UPU A;  1LOJ A;  2K2M A;  1M2V B;  3NFC A;  1G83 A;  3CCE A;  3LGL A;  2LCS A;  1M9S A;  3SWN A;  4D6W A;  1S72 A;  4JJN K;  3CME T;  2L3S A;  2RQW A;  1X27 A;  2DPP B;  5KYX A;  2F5T X;  2R5A A;  1PD1 A;  4J9F A;  1YJW Q;  2X9H A;  1FX7 A;  2CP5 A;  2QQS A;  8AT1 B;  1K9A A;  5D6X A;  4OML A;  1R77 A;  4YTL A;  3H0I A;  4A63 B;  4LD6 A;  1JJ2 P;  2BE7 D;  3PVL A;  3RDV A;  2DL8 A;  2KT8 A;  4QVC A;  4M75 F;  1ZHI A;  1OZ2 A;  4AFZ C;  2PVO B;  2GCX A;  2RPN A;  4A4F A;  2DET A;  1NYF A;  1D1B A;  2DVE A;  3FJ5 A;  2AKL A;  2NUZ A;  2DXU A;  1Q81 C;  2VWF A;  1WHG A;  4NL3 A;  2F69 A;  4XTW A;  2DXT A;  1UB4 A;  2J7I A;  5GMK h;  2RN8 A;  1S72 T;  4M7D B;  3CCE T;  4BI3 A;  3LW5 E;  4XTX A;  3QZ5 B;  2YT6 A;  2FL7 A;  1IGU A;  3M53 A;  1OPL A;  3S6W A;  1TUG B;  3VV0 A;  5GAN e;  2ZPF B;  3UA6 A;  2DTO A;  2DYI A;  2BZ8 A;  2DJZ A;  2LP5 A;  1PWT A;  4BE1 A;  5IXB A;  4RG2 A;  2HL3 A;  3UA7 A;  2P4R A;  1TU0 B;  2IVW A;  4EPC A;  2E70 A;  1VQO Q;  3VS4 A;  3DB4 A;  4RTZ A;  2EQJ A;  2J05 A;  5CO7 A;  5CAI A;  1VQ7 Q;  5FU7 C;  2Y4X A;  1MV3 A;  4C0Z A;  1QVP A;  4TVR A;  3GOX A;  3FEO A;  4MML A;  4EDU A;  4MDX A;  3KBG A;  1VQM Q;  3VS5 A;  3FC3 A;  4M77 F;  3LWH A;  3MEU A;  2K57 A;  2QQB A;  3A8G B;  5GAO l;  1M3A A;  4QQG A;  3MJX A;  3MCA B;  1KQ2 A;  4IUR A;  1AVZ C;  1YP5 A;  2HAX A;  1I5O B;  1B34 A;  2QGG A;  4FYY B;  1I07 A;  2O9V A;  3EH1 A;  1ACM B;  1ZUK A;  3CCQ A;  1IRE B;  3CMA A;  2LCC A;  1VQ5 T;  1D0X A;  1D1A A;  2FPD A;  1OPK A;  1K76 A;  1HK9 A;  4XTU A;  2K5I A;  2R58 A;  2KEA A;  5ECA A;  1G3S A;  3OA6 A;  3JAM E;  1UEB A;  2JTE A;  3CCE Q;  1LNX A;  3NTI A;  1XOV A;  2SEM A;  3H0H A;  2PQW A;  2V8K A;  1VQN T;  4II1 A;  2A37 A;  1C1A A;  4RKU E;  2VVK A;  2HQH A;  2EKH A;  4LNP A;  1H92 A;  1IHV A;  4DOV A;  3MET A;  2CP6 A;  2HKQ B;  4KRT A;  3CCS T;  1NPP A;  4C0D B;  3JB9 J;  3H41 A;  2L0A A;  1HJD A;  1GFC A;  1PSF A;  1SRM A;  4MDW A;  3JCM f;  1YI2 A;  3SD4 A;  1XNI A;  3SEM A;  4J7F A;  3OYE A;  4FYX B;  2KK4 A;  1IZ6 A;  1N9S A;  1JQQ A;  2J6F A;  1TXQ A;  4PJO E;  1JEG A;  4RTY A;  1EZZ B;  3CCQ T;  3M59 A;  2HBW A;  2J6O A;  1RAD B;  2FRY A;  5FLX E;  1BB9 A;  2JT4 A;  3CD6 T;  3BDL A;  3OSS C;  2JM9 A;  4RTX A;  5I21 A;  1WI7 A;  1KHC A;  3VS6 A;  1OZ3 A;  3VS2 A;  1M90 U;  2ZPB B;  1YJ9 Q;  4NL2 A;  4B9W A;  4GLM A;  2DXB A;  2RHY A;  1JU5 C;  1CKB A;  3VS3 A;  1YJN Q;  5GAM e;  4XU0 A;  4R0K A;  4C5I A;  4F7U F;  4L59 A;  4OGC A;  1WXB A;  4CC2 A;  1KSW A;  1M4Z A;  1VQO A;  1KIK A;  3PT9 A;  4BE2 A;  5GAN 4;  3TRE A;  2FYK A;  1YIJ A;  3WVD B;  1RAB B;  4C92 F;  3X25 B;  5GJW B;  3CCS Q;  4X9C A;  5GAM f;  1ARK A;  4M7D C;  1C6V X;  1GFD A;  1NYG A;  2DIG A;  1VQ9 A;  1K8A R;  1UGP B;  3LYI A;  4QVD A;  2BUD A;  1GBQ A;  3PVQ A;  1WHH A;  2XID A;  3I56 Q;  2CRE A;  4DA4 A;  1AWW A;  4M77 G;  1SF9 A;  1QCN A;  3J81 E;  2ZGW A;  3G71 T;  5L23 A;  3CCR T;  2VC8 A;  3S3M A;  2DL7 A;  1MV0 B;  4Z88 A;  2PTK A;  1W70 A;  2FZG B;  3O8V A;  2XD0 A;  5GAN 3;  5GJV B;  4ZTJ A;  3CCQ Q;  3QDF A;  1VQ4 T;  3QPH A;  4EIK A;  2O2O A;  2RK2 A;  3UF4 A;  1KJW A;  2RI3 A;  5FU7 B;  4PJM A;  1ZA1 B;  3JSC A;  3OBY A;  1V29 B;  3G6E Q;  1WGS A;  3CD6 Q;  4R56 A;  1QLY A;  4M75 C;  2W0Z A;  4KH1 B;  5IHK A;  1WPY A;  4BD3 A;  2KRM A;  5IHI A;  3UWN A;  4IUT A;  3C4S A;  4FW2 A;  1WIE A;  4FU6 A;  3ER0 A;  2GTO A;  4O5V A;  4N4H A;  2XG8 D;  4KGV B;  4OMQ A;  5KYY A;  3RER A;  1X2K A;  4KUI A;  2CKK A;  3UDC A;  1KD1 R;  4J5Y A;  2X3X D;  1YBY A;  2X4W A;  1Q7Y R;  2C06 A;  4PJJ A;  2KR3 A;  1RAH B;  3J80 E;  2D0Q B;  2C0T A;  3OSV A;  4B9X A;  5I11 A;  1BIA A;  1HXD A;  3OYB A;  3ZBD A;  1WJQ A;  3LH5 A;  3NMZ C;  5LJ5 h;  1ZSZ A;  4A53 A;  1QVF A;  1VQ5 Q;  1Y71 A;  1OOT A;  1TH7 A;  2P0Q A;  1BU1 A;  1YCS B;  3RMQ A;  8ATC B;  3CC2 Q;  5A0L A;  3PGG A;  2KBT A;  2J6K A;  2PU9 B;  4NOY A;  2IG0 A;  1G3Y A;  3SWN C;  1UGS B;  1BI3 A;  2E1H A;  2RQT A;  5FU6 B;  4JDS A;  4FM4 B;  5KYX B;  3M55 A;  3G4S T;  1I8F A;  2DLP A;  2EYY A;  2OAU A;  4OB0 B;  2V8I A;  2NUT A;  4D8K A;  2RHX A;  2W10 A;  3MKD A;  3CCJ Q;  4A54 A;  2JW4 A;  1VQM T;  2O4X B;  1BI0 A;  1JXO A;  3D7S B;  2A08 A;  1YJN T;  4M7A A;  2E3I A;  2F2V A;  2LJ1 A;  4ORZ A;  2DL5 A;  4DEY A;  2QEX A;  5I2S A;  2DBM A;  3I35 A;  2CSQ A;  4HVV A;  4O6J A;  3M0T A;  2K4Y A;  2LT1 A;  4C92 C;  4C8Q C;  1ZSZ B;  6AT1 B;  5GAN f;  2BKD N;  2MPX C;  3M9Q A;  3M4G A;  1Q7Y C;  2LQ8 A;  2AK5 A;  4M77 E;  2EYW A;  3L42 A;  3REB B;  1VQN A;  2RH2 A;  2HDA A;  2MWP A;  1K9M R;  3FIF A;  3CCR Q;  1PKT A;  1M1F A;  5KYN A;  2X4X A;  4XTV A;  2JMC A;  1U8R A;  1YFN A;  4JS4 A;  3MEW A;  2D9T A;  1BBZ A;  1VQL A;  2K9G A;  3CMA T;  4V2S A;  3GPL A;  1YHQ T;  3OYI A;  3MPU B;  3QHS A;  3I55 T;  2RI2 A;  4C92 E;  3HFN A;  5CKH A;  2GFA A;  2E6Z A;  4RUG A;  5FW9 A;  4CC3 A;  1ZA2 B;  2MI6 A;  2CZ0 B;  1PM3 A;  2LMJ A;  2SRC A;  3CC4 T;  1JBM A;  2CUB A;  3CXC S;  3V7C A;  1A0N B;  1D0Z A;  1RUW A;  4X9D A;  1KQS S;  2FEI A;  2DL4 A;  5C6S A;  4M7D D;  5AT1 B;  1M90 R;  3MEA A;  2PVG B;  1LVK A;  1E6G A;  1WYX A;  3RUX A;  3EG9 A;  1GXI E;  2ROL A;  1YJW A;  2LQN A;  1X69 A;  2F2W A;  2M02 A;  2GGR A;  4B6M A;  3CC2 A;  4JLG A;  2IIM A;  3CPW S;  4KUD K;  2R57 A;  2RD1 A;  3HFO A;  2MOX A;  3H8Z A;  1WNL A;  3KFV A;  4HVU A;  4M78 A;  1D1C A;  2E5Q A;  2YHT A;  3NGP A;  2YSQ A;  3PNW C;  4IKF A;  2ZPG B;  4E47 A;  3OB9 A;  4FSS A;  1QVG P;  3CC4 A;  2OI3 A;  3CQT A;  3L2U A;  3EFS A;  4E2F B;  1X01 A;  3OS0 A;  1M1K R;  1Y96 B;  4M77 D;  2RNA A;  3OY9 A;  5FWC A;  1UHC A;  3FRN A;  4HA8 A;  3OYG A;  1VYV A;  3I55 A;  4XU1 A;  2HQE A;  2MWO A;  1X6O A;  1RAG B;  5I2M A;  1RAF B;  4ATO A;  1PSE A;  5LJ5 g;  1YI2 Q;  1VQL T;  3CCU T;  1ZUY A;  4M4Z A;  1MHN A;  2ZPE B;  1KQS P;  1JO8 A;  3UT1 A;  2QEX Q;  2A28 A;  2JMA A;  5CR2 A;  1ZSG A;  2GFU A;  2JZ2 A;  3VYG A;  2DEQ A;  4FT2 A;  3C95 A;  1X75 C;  1Q81 R;  1ZUU A;  1V1C A;  4C5H A;  1RL2 A;  1PD0 A;  4HCB A;  2M1H A;  1AWO A;  1M90 C;  4J9B A;  3L2W A;  4C0G A;  3CCR A;  5GMK l;  1HSQ A;  1UGV A;  3L2R A;  2CZ7 B;  1TS9 A;  2E12 A;  4J9C A;  5DLO A;  3Q1J A;  2JNG A;  3G7Z A;  3WXM B;  2DRM A;  2NUP B;  4LDW A;  3CCU Q;  3PIO A;  1ABQ A;  5GAO r;  1ZQ1 A;  4C92 G;  3FDR A;  2DTH A;  1VQO T;  2XDB A;  3JCM e;  3JB9 F;  2RO0 A;  1WA7 A;  2OTL Q;  2VB6 A;  2VGN A;  3V8L A;  4HXJ A;  5GMK e;  4IUU A;  2C0O A;  1WQ7 A;  1YHQ Q;  5GAN 2;  3E2U A;  2HBP A;  1VYT A;  2D1X A;  2PNI A;  3P8H A;  4DOW A;  4C8Q B;  1Q81 U;  1KG1 A;  4LDU A;  4E7Z A;  1NG2 A;  1QW1 A;  4M75 E;  3I56 A;  3FB9 A;  5LJ5 e;  1QP3 A;  2J06 A;  2A0F B;  4CC4 B;  4ZTF A;  3RMS A;  2VGM A;  3TEE A;  5GAO n;  5A2Q E;  4EMG A;  3LH0 A;  3VJP A;  2MK5 A;  4HVW A;  2Y90 A;  3EGX A;  1EX4 A;  1VQP A;  5HY6 A;  4C8Q G;  5LJ3 f;  1U1S A;  3OYK A;  2DZC A;  3NTH A;  2ZCF B;  5HK0 A;  5LJ3 h;  1TUD A;  2JN0 A;  2LNV A;  1K9M U;  4WF2 A;  2LQK A;  3GNG A;  5L8R E;  2C0I A;  2GQV A;  3L1A A;  4M78 G;  1UHF A;  3G6E A;  1AZE A;  1BIB A;  3JB9 H;  1U1T A;  1B3Q A;  1YN8 A;  4F7U G;  1I0C A;  2DL3 A;  3QWY A;  2EYQ A;  3BE3 A;  3VS0 A;  2LQW A;  2EKO A;  2QQR A;  4OMP A;  5LJ3 d;  1W4S A;  4PFO A;  5KYY B;  1FMK A;  4AMC A;  1U5S A;  1BI2 A;  2DAQ A;  3JCM d;  5J39 A;  4A4E A;  3JB9 G;  4LXC A;  3TSW A;  2BIV A;  2FZC B;  4X34 A;  3BY7 A;  3DLL A;  2RM4 A;  3I55 Q;  1PC0 A;  1WHL A;  3M0Q A;  4QVZ A;  3VS7 A;  9ATC B;  2QXF A;  4HCZ A;  1VQ4 A;  2E3H A;  4ANJ A;  1ZBJ A;  3T9N A;  2QEX T;  2AHJ B;  1WXT A;  4M75 B;  1JRI A;  4LN2 A;  1TTH B;  2E64 A;  4XAX B;  3JCM h;  3PMI A;  1YJ9 A;  4JUV A;  2DYB A;  1WFW A;  1M2O A;  3EGX B;  4ZNX A;  4AFU C;  1VQ5 A;  5GAO q;  1YJN A;  2M0O A;  2CS7 A;  1XJW B;  3E9F A;  2D8J A;  1WJR A;  4XTZ A;  1N8R R;  3REA B;  4PFZ A;  3TU4 K;  1NJI R;  1SEM A;  4BB7 A;  2E41 A;  2JS2 A;  4BAC A;  1UGQ B;  1Y0M A;  3EG1 A;  1RI0 A;  1AWX A;  1QVG S;  2Y4Y A;  2O4X A;  5GMK m;  3OYA A;  4JJD A;  2WAC A;  1YIJ T;  4E7I A;  4VUB A;  2KYM A;  2GF7 A;  2EFI A;  4CI0 C;  2YRD A;  4FL6 A;  3PTA A;  3EFO B;  4M75 D;  1YIT Q;  4KBM B;  3X24 B;  3A8L B;  1NEB A;  2ZPI B;  1HYO A;  3R6N A;  2QA4 Q;  5CQX A;  5KE2 A;  4RTW A;  2FHD A;  4C92 D;  1JJ2 A;  4M77 C;  5CIU A;  2CP7 A;  1U3O A;  2OTL A;  2QAS A;  3E1S A;  1TSF A;  4F17 A;  1K8A C;  2CUD A;  2V1Q A;  2AIR B;  3BDU A;  2GQI A;  3TCJ A;  4FT4 A;  3CXC P;  2EJ9 A;  2YUP A;  1C0M A;  2QYZ A;  3QJ6 A;  4Z89 A;  2CP0 A;  4J9G A;  4RMO A;  3E19 A;  5DY9 A;  3OMG A;  3RBB B;  4KGZ B;  1VQ7 A;  3CCL T;  2XK0 A;  4WTO B;  2QG9 B;  2G6F X;  2NWM A;  2LTO A;  3H6Z A;  2DIL A;  2DM1 A;  4E7S A;  2V1R A;  2K3Y A;  1N8R C;  2E5K A;  3PFS A;  4ZN1 A;  2L89 A;  3OYH A;  2NLU A;  2KYB A;  4FW1 A;  4C8Q E;  1UTI A;  4QQ6 A;  2KE9 A;  4JZ3 A;  4L5G A;  4C8Q A;  5IT9 E;  2M51 A;  1YNZ A;  3CBP A;  1G5V A;  2KDS A;  3CCL A;  3CC7 T;  1R0B G;  4JRK A;  1N9R A;  2RJF A;  1OX9 A;  4PJN A;  1PRL C;  2A36 A;  3M0P A;  4PLL A;  1Q82 C;  3I5S A;  1KC8 R;  4JRI A;  1GRI A;  3MP6 A;  3THK A;  2M9U A;  5CCA A;  1KD1 C;  1M2V A;  1M5Q 1;  2X35 A;  1UG1 A;  3G1J A;  2K3B A;  1MNE A;  2DMO A;  2EWN A;  2CSI A;  4OB3 B;  4BDZ A;  2M0Y A;  2YUO A;  2RQV A;  2CYZ B;  1KFZ A;  3SDZ A;  1VQ4 Q;  3OS1 A;  5LJ3 g;  3JCM W;  2QQ9 A;  2CP2 A;  2YRV A;  4EMH A;  3V8K A;  3VU3 C;  3GF5 A;  1VQP T;  1WJS A;  1T0H A;  2DBK A;  3EG0 A;  5GAN d;  4HT8 A;  2DA9 A;  2E65 A;  2RHZ A;  4GBQ A;  2YWW A;  4M7A E;  3QG1 A;  2EYX A;  3JV3 A;  1AHJ B;  2OAW A;  1JXM A;  1GBR A;  5CK9 A;  1FYN A;  1QVF S;  4M7A F;  1GCP A;  4J9I A;  1OU9 A;  2PZ1 A;  2KAF A;  2DER A;  5IH2 A;  3QDR B;  1XQH A;  2EQM A;  2HQX A;  2VAS A;  2DRK A;  1VQN Q;  1H64 1;  2KI7 A;  3G4S Q;  4LD9 K;  1O75 A;  2DIQ A;  3GBQ A;  2XMF A;  2E4H A;  2X3W D;  4K11 A;  2LRQ A;  3OBW A;  2GNC A;  5KE3 A;  3SB2 A;  3HSB A;  2KRN A;  3JRZ A;  2YRC A;  2EQU A;  3CCM Q;  4QW2 A;  3OW2 S;  1M3C A;  1KQ1 A;  1YI2 T;  4DBR A;  4RCC A;  1QKW A;  4FYV B;  2O31 A;  2YUN A;  3JCM b;  2MF2 A;  4MMK A;  1IO6 A;  3CC7 A;  2EW3 A;  1QMC A;  5HCK A;  1MND A;  1P92 A; 
#chains in the Genus database with same CATH homology
 4RG2 A;  2R57 A;  2RD1 A;  3HFO A;  4KUD K;  3H8Z A;  1WNL A;  5FRM A;  2IVW A;  4C5G A;  1VQ9 T;  4EPC A;  2E70 A;  4M78 A;  2E5Q A;  2YHT A;  3DB4 A;  5LL6 S;  2EQJ A;  4C0D C;  1QVG A;  3MP1 A;  2XHC A;  2EIF A;  2FB7 A;  2ZPG B;  3PNW C;  5CO7 A;  3OB9 A;  4E47 A;  2JTM A;  5FU7 C;  1O9S A;  5CAI A;  2QI2 A;  3CC4 A;  2Y4X A;  3QZ9 B;  4C0Z A;  5GMK j;  2X4Y A;  2EJF A;  2KVQ G;  1QVP A;  3QYG B;  4BUG A;  4OMF B;  3OYN A;  3L2U A;  1VQK A;  4TVR A;  4RCB A;  3GOX A;  1N8R U;  2LX9 A;  3EFS A;  3EFR A;  3FEO A;  4MML A;  3QBY A;  1VQ6 A;  4EDU A;  4MDX A;  4A4H A;  3KBG A;  1X01 A;  3JCM P;  3OS0 A;  4GLK A;  3ZEH A;  5LJ5 f;  1Y96 B;  4M7A C;  1N6A A;  4M77 D;  3OY9 A;  3JB9 I;  3FC3 A;  4PJO A;  1OYX A;  3CCU A;  3FRN A;  4HA8 A;  2RJE A;  2ZZD A;  4M77 F;  3OYG A;  3LWH A;  3G4S A;  3MEU A;  2K57 A;  2QQB A;  4MZM A;  3A8G B;  4PL6 A;  3I55 A;  4XU1 A;  1VQ7 T;  5GAO l;  2HQE A;  2MWO A;  1X6O A;  3OW2 A;  5I2M A;  4QQG A;  4ATO A;  1PSE A;  5LJ5 g;  3MCA B;  2P0K A;  5C0M A;  1VQL T;  3CCU T;  5CQY A;  1KQ2 A;  1MHN A;  2ZPE B;  4IUR A;  2HAX A;  1B34 A;  3UT1 A;  1B34 B;  1M1G A;  4PNO A;  1KC8 U;  5CR2 A;  5LJ5 d;  3CCQ A;  1IRE B;  2GFU A;  1Q86 C;  2DXC A;  2JZ2 A;  3CMA A;  2HNI A;  1K8A U;  3M5A A;  3VYG A;  2RHU A;  3RKX A;  2DEQ A;  1VQ8 A;  2LCC A;  3C95 A;  4FT2 A;  1X75 C;  4OF1 A;  3KUF A;  1VQ5 T;  3HRU A;  3BW1 A;  2I2L A;  5DM7 R;  1KHI A;  2JUF A;  4C5H A;  1RL2 A;  4HCC A;  1HK9 A;  3E9G A;  4HCB A;  3QXE B;  2WSE E;  3CCM T;  2M1H A;  3MEV A;  2K5I A;  2R58 A;  2JOY A;  3PMT A;  4XTU A;  4M7A D;  2ZPH B;  1G3S A;  1M90 C;  4MZP A;  2B8A A;  3M57 A;  3OYD A;  3OA6 A;  3JAM E;  1UEB A;  3L2W A;  4PJO G;  1LNX A;  4C0G A;  3CCR A;  2DTI A;  3NTI A;  3VYH B;  1XOV A;  4LDX A;  1ZBX A;  2PQW A;  5GMK l;  2V8K A;  3L2R A;  1VQN T;  3HHT B;  2RA2 A;  4II1 A;  2CZ7 B;  5GAN 5;  3HL8 A;  4RKU E;  3EAE A;  3SWN B;  2G3R A;  2E12 A;  5DLO A;  3Q1J A;  3X26 B;  2JNG A;  2JTF A;  2VXF A;  4NS5 A;  4DOV A;  3G7Z A;  3MET A;  3OYJ A;  3WXM B;  4ZN3 A;  2JVV A;  4LDW A;  1NJI U;  4M7D E;  5GAN h;  3PIO A;  4N4I A;  4N0A A;  3LX7 A;  3CCS T;  5GAO r;  1NPP A;  1ZQ1 A;  2L5Q A;  4IUP A;  4C0D B;  4C92 G;  3INZ A;  2QA4 T;  3S3O A;  1I81 A;  3JB9 J;  1PSF A;  4MDW A;  3JCM f;  3FDR A;  1YI2 A;  2DTH A;  3SD4 A;  1XNI A;  3LWI A;  1VQO T;  4J7F A;  3OYE A;  2XDB A;  3JCM e;  4M77 B;  5GAM d;  3JB9 F;  2RO0 A;  4ELZ C;  2KK4 A;  1Y7X A;  4OP0 A;  5LJ5 j;  2VGN A;  3V8L A;  3HRT A;  1IZ6 A;  5GMK e;  1K73 U;  4IUU A;  1WQ7 A;  2RK1 A;  2A3L A;  1N9S A;  2R5M A;  5GAN 2;  2HBP A;  4PJO E;  1W2B S;  1KD1 U;  2DD5 A;  2KSS A;  5A0D A;  3CCQ T;  3MP8 A;  3S3N A;  1BKB A;  2XU8 A;  4LDV A;  2RB6 A;  4F7U E;  3P8H A;  4BI4 A;  1Q7Y U;  5D6W A;  5FRN A;  1M1K C;  3OS5 A;  4DOW A;  2VUB A;  4M7A G;  2L3R A;  4C8Q B;  4JS5 A;  1Q81 U;  1KG1 A;  3M59 A;  4ELY C;  4LDU A;  2LCL A;  3OYF A;  3CBO A;  3QSU A;  3PIP A;  2CZ6 B;  5FLX E;  1QW1 A;  4ZGD B;  2P4T A;  2V8J A;  5M9O A;  2RJD A;  4M75 E;  3I56 A;  1LJO A;  2WSC E;  3FB9 A;  5LJ5 e;  3JB9 D;  1QP3 A;  3CD6 T;  3OS2 A;  1WQW A;  3CCV T;  3BDL A;  4ZTF A;  4C92 A;  3NTK A;  3DKM A;  4J6Y A;  2VGM A;  3RMS A;  2LT4 A;  5FU6 C;  3TEE A;  4C92 B;  3OSS C;  2K3X A;  5GAO n;  5A2Q E;  3CCV A;  4EMG A;  3LH0 A;  1FWZ A;  5I21 A;  4A4G A;  5GAN 8;  1KHC A;  3VJP A;  1MGQ A;  3CBM A;  2Y90 A;  3M58 A;  1OZ3 A;  1VQP A;  5HY6 A;  5J3B A;  3CXC A;  4C8Q G;  1M90 U;  5LJ3 f;  1U1S A;  3OYK A;  2DZC A;  2ZPB B;  3CCJ A;  4A4K A;  2MMP A;  3NTH A;  2ZCF B;  4NL2 A;  5LJ3 h;  4B9W A;  5HK0 A;  2DXB A;  2RHY A;  3A8H B;  5GAN g;  2JN0 A;  2LNV A;  1K9M U;  3CME A;  4P5N A;  4WF2 A;  4PKC C;  2LQK A;  3L2Z A;  4J7I A;  4LDY A;  5GAM e;  3GNG A;  4E7L A;  5L8R E;  2GQV A;  3L1A A;  4M78 G;  2WSF E;  5KH6 A;  4XU0 A;  3G6E A;  1BIB A;  3JB9 H;  2OTJ T;  1U1T A;  4C5I A;  4BY6 B;  4C5E A;  3OYC A;  4F7U F;  1FXX A;  4XU2 A;  4EMK C;  4BE0 A;  2OTL T;  4MZT A;  4L59 A;  2DZ9 A;  4OGC A;  1VUB A;  4F7U G;  4F7U A;  5EG2 A;  2YLC A;  2EYQ A;  4Y28 E;  1VQO A;  1M4Z A;  2O01 E;  3VUB A;  3PT9 A;  4BE2 A;  3OMC A;  5GAN 4;  2EKO A;  2FYK A;  2QQR A;  2EAY A;  5CKE A;  5LJ3 d;  3TRE A;  1YIJ A;  4IUQ A;  1NPR A;  3WVD B;  3X20 B;  1R8O B;  1W4S A;  4C92 F;  3X25 B;  5GAN 7;  4ZGJ B;  3GP8 A;  3FJP A;  3VUZ A;  4X9C A;  5GAM f;  4OGE A;  4XK8 E;  4M7D C;  1OI1 A;  3DB3 A;  3QJY A;  5CKF A;  3V8J A;  4J83 A;  1BI2 A;  2DIG A;  4RG8 A;  5A0G A;  1VQ9 A;  2M16 A;  4C0F A;  1YJW T;  2DAQ A;  3JCM d;  5J39 A;  3CPW A;  4A4E A;  3P8B B;  1UGP B;  3LYI A;  4QVD A;  3JB9 G;  2BUD A;  2K5F A;  4KUL A;  1YCY A;  2A7Y A;  3MHX A;  4HT9 A;  2BIV A;  3JCM c;  3CC2 T;  3ASK A;  2XID A;  4X34 A;  1N27 A;  3JCM V;  3BY7 A;  1YIT A;  3DLL A;  4DA4 A;  2RM4 A;  2DO3 A;  1BYM A;  4M77 G;  4QVZ A;  3OYY A;  3J81 E;  4M75 G;  5FRO A;  3M54 A;  2ZGW A;  2PVD B;  3G71 T;  3CCR T;  2QXF A;  2VC8 A;  4HCZ A;  1VQ4 A;  2K5L A;  4C8Q D;  3S3M A;  4XQ3 A;  3T9N A;  2QEX T;  2AHJ B;  3QUI A;  4M78 E;  4M75 B;  5J26 A;  1JRI A;  2CZ1 B;  2E64 A;  2F5K A;  4XAX B;  5D6Y A;  2XKO C;  3LGF A;  3PMI A;  3JCM h;  2XD0 A;  3O8V A;  5GAN 3;  1YJ9 A;  4JUV A;  2FVU A;  5GAO p;  4ZTJ A;  1VQ4 T;  1Q86 U;  1VQ5 A;  3QPH A;  1VIF A;  2P0P A;  2RK2 A;  2KQW A;  2M0O A;  2CS7 A;  5GAO q;  2RI3 A;  4KT0 E;  1YJN A;  3E9F A;  2HD0 A;  3JSC A;  5FU7 B;  1WJR A;  3OBY A;  4FIB A;  4XTZ A;  1V29 B;  4QQD A;  1WGS A;  4R56 A;  3TU4 K;  4UC4 A;  4M75 C;  3A5Z B;  4E7K A;  4BB7 A;  5HKC A;  4E7J A;  1KQS A;  2E41 A;  1WPY A;  4BAC A;  4BD3 A;  1UGQ B;  3M56 A;  4PJO B;  3UWN A;  4IUT A;  3L2V A;  1RI0 A;  3C4S A;  4F7U B;  2MAM A;  1QVG S;  1UGR B;  3CCS A;  1NJI C;  4PJO D;  4FU6 A;  3ER0 A;  5GAN 6;  1YIT T;  2Y4Y A;  2LC4 A;  2O4X A;  5GMK m;  4O5V A;  1D3B A;  4N4H A;  2WAC A;  2XG8 D;  3OYA A;  1YIJ T;  4E7I A;  1I4K 1;  4VUB A;  3A8M B;  5AYF A;  4M7D A;  1G3T A;  2VV5 A;  1XTD A;  2EFI A;  2GF7 A;  2XIC A;  4CI0 C;  4KUI A;  3RER A;  2CKK A;  4FL6 A;  3QII A;  3PTA A;  3UDC A;  4J5Y A;  1DJ7 B;  1VQ6 T;  4M75 D;  1YBY A;  2DKG A;  2E6N A;  2X4W A;  3CEY A;  4FSX A;  4KBM B;  3X24 B;  3A8L B;  5LJ3 e;  1VQK T;  2C06 A;  1I5L A;  2ZPI B;  3J80 E;  4CRI A;  5GAM h;  2D0Q B;  3OSV A;  5CQX A;  4B9X A;  1BIA A;  3LLR A;  3RES A;  5KE2 A;  1HXD A;  2FHD A;  4C92 D;  3OYB A;  1JJ2 A;  4M77 C;  3P8D A;  3ZBD A;  5CIU A;  2XDD A;  1Y07 A;  1WJQ A;  3CPW S;  4JRP A;  1Q82 U;  4OVA A;  1W2B A;  3CCJ T;  4Z02 A;  3RKY A;  1M1K U;  2OTL A;  2CGH A;  1QP2 A;  2RI5 A;  3ZFJ A;  5LJ5 h;  3G6E T;  1K73 C;  2OTJ A;  1QVF A;  4A53 A;  3R6O A;  1H3Z A;  3E1S A;  1Y71 A;  2XI9 A;  3X28 B;  1TH7 A;  2P0Q A;  4M78 B;  1JJ2 S;  3RMQ A;  1VIE A;  4M77 A;  4DQ2 A;  3HP9 A;  2D6F A;  3ME9 A;  2H3J A;  4J6W A;  5A0L A;  1K8A C;  3PGG A;  3BDU A;  3TCJ A;  2PU9 B;  3HRS A;  4FT4 A;  4NOY A;  2IG0 A;  1G3Y A;  2EJ9 A;  3QO3 A;  3SWN C;  3QJ6 A;  3C12 A;  1UGS B;  1BI3 A;  2E1H A;  4RMO A;  3E19 A;  5DY9 A;  5FU6 B;  4XU3 A;  4L6V 5;  3OMG A;  4JDS A;  4M78 C;  4FM4 B;  2RHI A;  3CCL T;  1VQ7 A;  2XK0 A;  3GNF B;  1Y96 A;  3M55 A;  3G4S T;  1I8F A;  5IN1 A;  3I56 T;  2OAU A;  4OB0 B;  2V8I A;  4JLI A;  1M8V A;  3V7S A;  3OYM A;  2RHX A;  5GAM j;  2EJG A;  2K2V A;  2LTO A;  4R55 A;  3JCM J;  1VQM A;  3H6Z A;  4A54 A;  4C8Q F;  1VQM T;  2LVM A;  2KY9 A;  2VYT A;  3M4Y A;  2O4X B;  5CKD A;  1BI0 A;  4PLI A;  4IUV A;  1D3B B;  4M7A B;  2K3Y A;  1YJN T;  1N8R C;  4M7A A;  4EMK A;  4ZGE B;  3PFS A;  4BY6 C;  5GAM g;  4PJO C;  4ZN1 A;  3KXT A;  2QTX A;  1SSF A;  2L89 A;  2QDY B;  3JCM X;  3OYH A;  2QA4 A;  2NLU A;  2L8D A;  2KMT A;  4GY5 A;  4C8Q E;  4QQ6 A;  3A8O B;  2VXE A;  5KCO A;  3HKS A;  4M78 D;  4L5G A;  3HPW A;  4C8Q A;  5IT9 E;  3URG A;  3GIB A;  2XDP A;  3CBP A;  2QEX A;  1KC8 C;  2E10 A;  5I2S A;  1G5V A;  4N0A C;  3AHU A;  1JB0 E;  5GAO m;  2PUO B;  5LJ3 j;  2KDS A;  3N5B B;  3CCL A;  4O6J A;  3CC7 T;  2K4Y A;  2X4J A;  3F70 A;  4J6X A;  4JRK A;  2LT1 A;  1N9R A;  4C92 C;  2RJF A;  4PLL A;  1Q82 C;  4C8Q C;  5IAY A;  4JRI A;  5GAN f;  3SFM A;  2BKD N;  5CCA A;  3MP6 A;  1KD1 C;  2M9U A;  1NE8 A;  5GAN j;  3UPU A;  3M9Q A;  1LOJ A;  3M4G A;  1M5Q 1;  2X35 A;  1Q7Y C;  2LQ8 A;  4M77 E;  4OB1 B;  3L42 A;  3NFC A;  1VQN A;  2RH2 A;  4BDY A;  2MWP A;  3RIR A;  3CCE A;  3LGL A;  4D6W A;  1M9S A;  3SWN A;  2EWN A;  3C94 A;  3FIF A;  4M78 F;  4OB3 B;  4M7D G;  4BDZ A;  1S72 A;  5HK3 A;  1M1F A;  2CYZ B;  4J8O A;  4JJN K;  1VQ8 T;  3SDZ A;  2X4X A;  3OS1 A;  4XTV A;  3CME T;  5LJ3 g;  1U8R A;  3JCM W;  2QQ9 A;  2LDM A;  2YRV A;  3J7A F;  4EMH A;  4JS4 A;  3CCM A;  1EIF A;  2DPP B;  4OB2 B;  2F5T X;  1K9M C;  3V8K A;  1BI1 A;  2R5A A;  3GF5 A;  3VU3 C;  3QYH B;  1VQP T;  5CVI A;  3MEW A;  1FX7 A;  2D9T A;  2QQS A;  1VQL A;  5GMK i;  3GLX A;  2PUK B;  5D6X A;  3DLM A;  1WJS A;  4XTY A;  4M75 A;  3CMA T;  4V2S A;  3WVE B;  3GPL A;  1YHQ T;  3OYI A;  4YTL A;  3QHS A;  3I55 T;  2RI2 A;  3CD6 A;  4C92 E;  5GAN d;  4LD6 A;  3OQ5 A;  4HT8 A;  1NZ9 A;  3HFN A;  2E65 A;  2RHZ A;  3JCM Q;  5CKH A;  2GFA A;  3RKW A;  4EMK B;  2E6Z A;  4M7A E;  3QG1 A;  4BI8 B;  2YLB A;  3FLG A;  3QKJ A;  4JRQ A;  4Q5W A;  3MO8 A;  4QVC A;  2MI6 A;  4M75 F;  1ZHI A;  1AHJ B;  1OZ2 A;  2CZ0 B;  1YHQ A;  2RJC A;  2PVO B;  2GCX A;  5CK9 A;  1G3W A;  5KCH A;  3CC4 T;  4A4F A;  1QVF S;  4M7A F;  1JBM A;  4Y91 A;  2KAF A;  2DVE A;  2QQA A;  3CXC S;  2DXU A;  4ME7 A;  3V7C A;  1YJ9 T;  3QDR B;  1Q81 C;  1XQH A;  2EQM A;  2HQX A;  3L2Q A;  4X9D A;  1KQS S;  4NL3 A;  2F69 A;  5C6S A;  4XTW A;  2DXT A;  4M7D D;  1UB4 A;  1H64 1;  3V7R A;  5GMK h;  3MEA A;  4LD9 K;  1S72 T;  2DD4 A;  1O75 A;  5CKB A;  2PVG B;  2DIQ A;  4HKE A;  4M7D B;  5DLQ E;  3CCE T;  4BI3 A;  2LRQ A;  3OYL A;  3OBW A;  5KE3 A;  3SB2 A;  3HSB A;  3BFM A;  3RUX A;  3JRZ A;  3LW5 E;  2EQU A;  4XTX A;  3QZ5 B;  4IKF A;  4QW2 A;  2FL7 A;  3OW2 S;  1GXI E;  3M53 A;  1KQ1 A;  3S6W A;  1YI2 T;  1YJW A;  4RCC A;  3VV0 A;  5GAN e;  4N4G A;  2ZPF B;  4E7H A;  3G71 A;  2DK3 A;  2DTO A;  4PJO F;  3JCM b;  2MF2 A;  2DJZ A;  4MMK A;  4M7D F;  3CC7 A;  3JCM g;  3VKI A;  4BE1 A;  3CC2 A;  1P92 A;  3CPF A;  4JLG A;  2EQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...