2RB6A

X-ray structure of the protein q8ei81. northeast structural genomics consortium target sor78a
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
57
structure length
57
Chain Sequence
SSQYIMSTKDGKMITSDSKPKLDKTTGMYLYYDEDGREVMIKQEDVTQIIERLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title X-Ray structure of the protein Q8EI81.
rcsb
source organism Shewanella oneidensis
molecule tags Structural genomics, unknown function
total genus 7
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rb6A00
4M75F 4XU2A 5GAMh 5LJ5e 5GAOn 1D3BB 2DZCA 5GAN4 4M78D 4PJOF 4NL2A 2DEQA 1KQ2A 2VC8A 4HT8A 4M7AD 1N9SA 1X01A 1JRIA 2EJFA 4MMLA 4XU1A 3AHUA 1WQ7A 3GIBA 2FB7A 3HFOA 4M75B 2EJGA 3L1AA 3SWNC 5GAMe 1D3BA 2VXEA 5LJ5d 3JB9I 1U1SA 4M75G 4PJOB 3RKXA 4M77F 4C92G 4C8QC 4M75A 3JCMJ 4PJOG 5GMKj 5GAN2 5GAMd 2YLBA 4XQ3A 5GAN8 5GAN7 4PJOA 2DXUA 3QUIA 4C92D 3V7RA 4M77B 5LJ3j 3JCMe 3BDUA 3V7SA 5LJ3h 1WNLA 3EFSA 3JCMW 4M77G 2DZ9A 4PJOE 3RUXA 1LJOA 1M5Q1 4RCBA 4M77A 1I4K1 4XTUA 2DXTA 2DKGA 3JCMd 4M7DD 2EJ9A 4JRKA 5GAOl 4XTVA 5LJ5g 4N0AA 2E41A 1TH7A 2RD1A 4M77E 5GAMf 5GANj 4RCCA 4MMKA 5GANh 2DTOA 5GAOq 2DVEA 2YHTA 4JRIA 4C8QF 5GAMg 5GMKi 1BIBA 3JCMP 3QSUA 3SWNB 3M4GA 3JCMQ 3FB9A 4OP0A 4HT9A 1HK9A 4J6WA 4J6YA 5GANe 1I5LA 1LOJA 4M78C 4C8QB 4M7AC 4J6XA 4M75D 3JCMf 3SWNA 4XTYA 4M78B 5GMKh 4M7AB 2FYKA 3SB2A 3JCMg 4PJOD 4EMKC 1Y96A 4C8QA 2DTHA 3INZA 4JLIA 1WPYA 1LNXA 2HNIA 4M78A 3V8JA 5GMKe 5GAOm 4M7AA 3EFRA 4EMHA 2DJZA 4C8QE 4M77D 5LJ3e 3BY7A 4M78E 4C92C 4M7AE 4XTWA 3JB9F 4PNOA 2I2LA 5GAN5 4A54A 1MGQA 5GMKl 4X9DA 5LJ3d 4M78F 4F7UB 4M7AF 1JBMA 5GANf 4M7DC 2QTXA 4QVDA 2EAYA 1HXDA 3QO3A 3BW1A 4NOYA 4JUVA 3JB9G 4M7DB 5LJ5j 3QHSA 3V8LA 4HA8A 4F7UA 5LJ5h 1M8VA 3RKWA 1N9RA 5CAIA 3JCMc 4C8QG 1BIAA 2RA2A 5I21A 2RB6A 4M7DA 4M78G 4XTZA 4WF2A 5GAMj 3JCMV 4M7AG 5DY9A 3V7CA 4EMGA 5GANd 4EMKB 4F7UE 2CGHA 1I8FA 4A53A 2Y90A 4C8QD 4C92F 3JCMX 3FJPA 5LJ3f 4M7DE 5GAOr 4V2SA 4M75C 2E1HA 5LJ3g 2ZGWA 1I81A 4EMKA 3JB9J 5GMKm 4XU3A 4F7UF 3FIFA 4PJOC 2VXFA 4C92B 4NL3A 4XTXA 4Y91A 1H641 2YLCA 2DTIA 3JCMh 5GAN6 4QVCA 4M7DF 3VU3C 1WQWA 1YCYA 1U1TA 1B34B 5GAN3 3RERA 2JN0A 4C92A 3RESA 2E10A 4M77C 3HSBA 3JCMb 5GAOp 3HFNA 4F7UG 3L2ZA 2E65A 4J5YA 4M75E 5GANg 1Y96B 1B34A 3RIRA 4N0AC 3JB9H 3RKYA 2RM4A 4C92E 4M7DG 4XU0A 3JB9D 3V8KA 3BFMA 4DQ2A 2E64A 1KQ1A 5LJ5f 3PGGA 2EWNA 4X9CA 2K57A
chains in the Genus database with same CATH superfamily
2QQ9A 1PKTA 2DMOA 2KYMA 5DM7R 4BE0A 4PJOF 4Z02A 1BCMA 5CR2A 2DNUA 3VUZA 2FB7A 2BZYA 3HHTB 1D3BA 4C0GA 2ZPFB 2MYSA 2RJDA 3H41A 4LD9K 2CYZB 4OGEA 1KG1A 4C0DB 4BDZA 2O2OA 4PJJA 2LJ1A 2JNGA 3ER0A 2KXDA 1WXUA 2K3BA 4ZGDB 2QXFA 1TH7A 5GANj 4AFQC 2FZGB 2ZPIB 4JRIA 1YHQQ 1WHJA 2J6FA 3CEYA 2LP5A 3JCMQ 3TREA 4HT9A 1YJWQ 1YI2T 5IXFA 3QJYA 2FYKA 1KQSS 1QVFS 4C5IA 1IHVA 4JLIA 1SHFA 1M3AA 1RI9A 3I55T 4M77D 4PL6A 2GGRA 3E2UA 1LVKA 4F17A 2PTKA 1C6VX 3CCJA 1QMCA 4J9DA 4FW1A 3OYHA 3A1PA 3M0QA 1PSEA 3CCVT 3NHNA 2DA9A 1VQ7Q 4X1VA 1IZ6A 1BIAA 2D0NA 1M2VA 3M58A 3V7CA 4L6V5 3PVLA 1BBZA 2CZ6B 4M7DE 4V2SA 2HL5C 2FPDA 1X69A 4BE1A 1SG5A 1VIEA 2YLCA 1X43A 2WSCE 2K5FA 1TWBA 4F14A 1U1TA 3RERA 2E10A 2E6NA 1TXQA 4KULA 1QVGS 3G71A 2VGNA 3H0IA 2ESWA 3JB9D 4ZTJA 2E4HA 5GAMh 4IUVA 4ZN1A 1SSFA 2SRCA 2VC8A 3HFOA 2EJGA 4FYXB 3JCMJ 1TOVA 1UG1A 1JEGA 1SEMA 1RABB 2F1LA 4M77G 4RUGA 3VS2A 1KFZA 1Q81C 1T3SA 5LJ5g 1K0SA 2E41A 4FU6A 2FRWA 5A2QE 4RCCA 1B07A 2K5LA 3VS0A 3CC2T 2EQKA 2HKQB 4R56A 4AT1B 4FT2A 1OU9A 5CK9A 1X6GA 1VQLQ 4M78C 1OX8A 2C06A 5GMKh 3CCSQ 2RJFA 2QEXA 4O5VA 4E7SA 2GTOA 1ZSGA 3M56A 3VJPA 3CCEA 1ZA2B 1SSHA 2LVMA 4E7ZA 1TG0A 5J39A 1P92A 3G6EA 1X6BA 1D1BA 5HCKA 1FX7A 2M0OA 2EAYA 1YCSB 4M7DB 3JB9G 4IUQA 3V8LA 3MP8A 1RAEB 1UE9A 4C8QG 1F1BB 1Q95G 5DY9A 4EMKB 2NYSA 3NFCA 1G3WA 3PT9A 1OQKA 2KMTA 1X75C 1YWPA 1VQ4A 3ZEHA 5HKCA 2LNVA 2CP6A 4PLLA 3OYGA 4HCZA 1H92A 1VQOA 2LJ0A 2F69A 3H0FA 4F7UG 4LUDA 3AT1B 1MV0B 2G6FX 4MZPA 3S3MA 2K2MA 2OTJA 5A0LA 1XJWB 5LJ5f 3PGGA 1M4ZA 4RTXA 3KUFA 1WHMA 3IQLA 3CCMT 1M3CA 1XTDA 3VRYA 4M78D 2P84A 2NUTA 2EPDA 1G3SA 1E6GA 1AWJA 2HZYA 2XU8A 4LDVA 2JT4A 3KFVA 3CCLT 5LJ3j 3JCMe 1G2BA 3LX7A 2DZ9A 1TUDA 2R58A 4M77A 4XTUA 4Y28E 2V8JA 2LQWA 3CMEQ 3SFMA 5GAMg 2VB6A 4AG2C 2RI2A 4DEYA 2PQWA 2V1RA 2YUNA 3M5AA 1YJ9A 2KK4A 8ATCB 2NUZA 3O5ZA 1JJ2S 2NUPB 3H9NA 4QQGA 1VQ6Q 1QLYA 1WYXA 2K6DA 4D8DA 5LJ3e 2LDMA 4C92C 5A0GA 8AT1B 4IUUA 1KIKA 2P4TA 1AWXA 4LD6A 1HYOA 1ZUYA 3M57A 2NLUA 2CSQA 1DJ7B 3I56A 1QVGP 5KE3A 4LUEA 4JLGA 3RKWA 1N9RA 4B9WA 4JJNK 5IHNA 1NZ9A 4M78G 3E9FA 2CZ7B 1YJNT 2L89A 4E47A 2Y90A 3TSZA 5KH6A 3UA6A 3SD4A 2WACA 4M75C 1U06A 2HBPA 1I81A 2ZGWA 2D9TA 2D8HA 2W0ZA 5KYUB 1Q86R 1YJWT 4C5EA 4NL3A 4M7DF 2EGAA 1WQWA 3REAB 2CDTA 1TSFA 3HFNA 1U3OA 2LZ6B 3FLGA 2BZ8A 4MDXA 1UGPB 1VQ8A 1Q81U 2XD0A 4XU2A 4JPBW 3JRZA 1QP3A 1R0BG 5CKEA 1UHFA 4XU1A 2EJFA 3OS5A 1QVGA 3L1AA 2LTOA 1WLPB 1AOJA 1VQ7T 3M9QA 2RK2A 1PKSA 1BI0A 4C92D 4FYVB 1PD0A 2EYYA 3BDUA 5DLQE 2J6OA 1AEYA 2OTLA 4PJOE 2NUPA 1Q7YR 1XQHA 2DD4A 1VUBA 2IG0A 2GCXA 4C8QF 3C94A 5KCHA 2CS7A 4OB2B 3FEOA 2XMFA 2DILA 1WJQA 1HK9A 4J6WA 2E5QA 4GBQA 4M75D 1VQ9A 5IN1A 4JS5A 1AZGB 2ZAEA 3CXCS 3OYMA 2M02A 3O8VA 4PFPA 2DJZA 2RN8A 2XHCA 4OMMA 1VQNA 2K9GA 1VQKA 2L3PA 2DAQA 3MJXA 3GNFB 1OYXA 2VVKA 1Y07A 1U8RA 1JQQA 3G7ZA 2JXBA 1A0NB 3OYLA 1IREB 3EGDA 2DIQA 2EYXA 3CCUQ 4IUTA 5FRMA 2X3WD 1RAFB 4CC7A 1W4SA 3DLMA 1VQLT 1WDXA 4QVCA 3MEUA 1WIEA 1B34B 4JJCA 2R5MA 3CCST 2MWPA 3RMSA 3HSBA 1D0ZA 4C0DC 5GANg 4J5YA 3G6EQ 1TUCA 4FSXA 4ZTFA 4RTUA 1X6OA 4DQ2A 3H6ZA 2E6ZA 1X2KA 1I0CA 4HCCA 2RK1A 5KYNA 1EIFA 1R77A 1WFWA 1JRIA 4CC3A 2FRYA 1BB9A 4M75G 4PJOB 1VOMA 3J81E 2PU9B 4P5NA 1VQ4Q 3EG9B 3MP6A 1ZSZB 4LE9A 1WNLA 3JCMW 1K1ZA 4AG1C 3EGXA 2D8JA 4IKFA 3CC4A 4BACA 2KVQG 2L0AA 4DBQA 1W70A 3N5BB 2AKKA 2AIRB 1TTHB 4XAXB 1WZOA 4HKEA 3DB4A 2K79A 1WJSA 1YIJQ 4JRPA 4K11A 3QIIA 3C12A 1YITA 2DYBA 1IRXA 3LLRA 3CC7A 1N27A 1UEBA 1S72A 2DFUA 5CKHA 4CRIA 1G8XA 2PVGB 4M7AE 4XTWA 5IH2A 1PG5B 1K0XA 2P0QA 5GANf 2QTXA 4A4HA 1OULA 2EQIA 1LPLA 2RJCA 2P0KA 1D1CA 3QHSA 2C0OA 3EGUA 2KT8A 3EG1A 2DL7A 3RR6A 3UT1A 2AT1B 2FZCB 3FJ5A 2PUKB 3CMET 3UA7A 2ZPBB 1Q82R 1ZA1B 3OA6A 5EC7A 2LCCA 3HKSA 3VS6A 1K9AA 1H641 2ED1A 1MMAA 5LL6S 4KH0B 4C92A 3HL8A 2PNIA 2HCKA 2QYZA 1KC8U 3RIRA 1AWOA 4AFSC 2P4RA 3QWYA 1VQ6T 3BFMA 2J05A 2LQKA 4KH1B 3DB3A 5AT1B 2CUBA 3CCRA 4HT8A 1OX9A 1WHGA 1H8KA 2DE0X 1O9SA 2FPFA 4M75A 1M1KU 3EG2A 2JW4A 2CSIA 4LXCA 2L3SA 3OB9A 3V7SA 2EQUA 3SDZA 3C0CA 2WSFE 3MEWA 3I5SA 1NG2A 1Y57A 1W6XA 3JSCA 2O31A 1ZX6A 3META 4FL6A 1I07A 5GMKi 3SWNB 3VS3A 1G5VA 3OBYA 3HRUA 4J7IA 4KRTA 4FYYB 4J9CA 1AD5A 4M7AB 1HSQA 3JCMg 1OPLA 4EMKC 1NPRA 2XG8D 3VS1A 1R0CB 4JS4A 3A98A 2RNAA 4II1A 4DA4A 5CIUA 3TU4K 4E7IA 3QO3A 5FU6B 2JM9A 2OI3A 1JXOA 1WXBA 1NLPC 1MHNA 5C6SA 4RTYA 4QVZA 4WF2A 5D6WA 3OMGA 4QKUA 1C1AA 4EMGA 1RAHB 1I8FA 5D6YA 3FJPA 2HEQA 2MF2A 3OYKA 4ZGEB 3CD6T 5LJ3g 3JB9J 1UJYA 4KUDK 4BB7A 1VYTA 3CCQA 4Y91A 3M59A 2K4YA 4WCIA 2RQUA 3VS7A 1WX6A 4O6JA 3RESA 3UPUA 3DLLA 3NTKA 4N4GA 1UGRB 5L23A 4RMOA 2A36A 3EAEA 4QT7A 1QCNA 1OPKA 2DL8A 1VQMQ 3OW2P 4RG2A 4J9BA 2DO3A 1J3TA 1X27A 4BI3A 2DBMA 2F2VA 1ZBXA 5GAN2 1NEGA 4PLIA 1K73U 4XQ3A 3QUIA 3LH0A 3CCUT 1HD3A 4PFZA 1I4K1 2EIFA 1BU1A 2EJ9A 4ESRA 1ZQ1A 3H0HA 3CMAQ 2ROTA 1YI2A 3A5ZB 4E7LA 1Q81R 4LN2A 4KBMB 1UDLA 4B9XA 2XDPA 4LDWA 1KD1C 1LOJA 3EFOB 4AFUC 2LQ8A 4XTYA 1W2BS 2KDSA 5FW9A 3OW2A 3I55A 1KJWA 2G3RA 4VUBA 1FMWA 2HNIA 2F5TX 3EFRA 2CT4A 4C8QE 1KHIA 1QKWA 3OYEA 3GLXA 4PNOA 2I2LA 2RQTA 2KI7A 3PTAA 3CPWP 3CCVA 4GY5A 2RHXA 4M7AF 2HL3A 5DLOA 4B6MA 5IT9E 2DL4A 3D7SB 4J9FA 1WJRA 4ATOA 2COZA 4PJNA 5I21A 2QA4T 2D6FA 1VQ5T 4F7UE 1JO8A 4FM4B 2I0NA 4DOWA 1K9MU 4R55A 4C5GA 3QG1A 2MPXC 1RLQC 2KT1A 4XTXA 5GAN6 2YRCA 1YIJT 2QG9B 4KT0E 4EIKA 2JTMA 2XIDA 2GBQA 4JDSA 4OMPA 3G4SQ 2X4XA 4D6WA 2BZXA 1GFDA 1I5OB 3CPWA 3V8KA 3OYDA 1RADB 2K7AA 4C0FA 5L8RE 4NL2A 2DEQA 3GOXA 1FWZA 4F16A 1NM7A 1OV3A 2QASA 3ZL7C 5CQXA 1VQPQ 3M54A 4Q5WA 1UGQB 1AWWA 4E7KA 1OU8A 4LDXA 2DLPA 3I5RA 2C0IA 3BE3A 1M5Q1 2DXTA 5KCOA 2DPPB 3RMQA 5GAOl 5CKDA 3CC2A 3M55A 2XICA 2KQWA 4DOVA 3TEEA 3PIOA 2KROA 4C8QB 2AZVA 1WHLA 1FYNA 1BI1A 5FU7C 3X26B 2CP5A 2IPOB 1KQSP 1D0XA 1QVFP 3PVQA 2YDLA 2E3IA 1RUWA 4OF1A 2H8HA 1XNIA 4M78E 3VS5A 2JOYA 3J7AF 5GMKl 4FT4A 4F7UB 5ECAA 3L2QA 4ZGJB 1YBYA 3QYGB 4JUVA 4GLKA 1M8VA 2DVJA 3C4SA 3JCMc 4M7DA 2O4XB 3DKMA 3PMIA 3RDVA 1QVPA 2L2PA 4A53A 3X25B 2DF6A 4Z8AA 1N8RU 4EMKA 2EQMA 4PJOC 1AVZC 2M51A 3GPLA 2LX9A 2V26A 2HAXA 1H3HA 1UUEA 1KQSA 1QVFA 2KBTA 3OYIA 4J9IA 5I11A 3CCMA 3E9GA 2DD5A 1QW1A 3L42A 1KQ1A 3OMCA 2QK0A 2HQEA 2JM8A 5IAYA 4DEXA 1D0YA 4MMLA 1YHQT 5D7UA 3LH5A 5LJ5d 3CCLA 1Z9ZA 3NGPA 3ASKA 2MMPA 2FEIA 3RKXA 1U5SA 4M77F 2E70A 3LGLA 1ABQA 1Z9QA 1KD1U 1AZEA 5GAN8 3CCQQ 4E6RA 1UGVA 3CCJQ 4L5GA 3JAME 5GJVB 3BDLA 1FMVA 1RACB 2AHJB 1NLOC 2RQVA 1IGQA 2YRDA 2CP3A 1NYFA 3VKIA 5I22A 5GAMf 2LCSA 2DJQA 1QCFA 4BD3A 3JCMP 1GCQC 4OP0A 2FO0A 2ED0A 2AZSA 3GP8A 2RQWA 4M78B 1KC8C 1JXMA 4PJOD 1VYVA 3TVTA 1M1KR 3INZA 5GAOm 1VQMT 3V8JA 1QKXA 2GFAA 2EYZA 2RJEA 1T0HA 2QGFB 1KSWA 3G71Q 3M0UA 4E7JA 3JB9F 3ZFJA 3VS4A 4A54A 1TU0B 1M1KC 2OAUA 4OGCA 3QZ5B 1SF9A 4PKCC 3X20B 1YJNA 2A28A 2EKOA 2RA2A 1NJIC 3JCMV 3CMAT 2KR3A 1YJWA 2FPEA 4L59A 2D0QB 5A0DA 2A37A 5GMKm 5FLXE 4XU3A 4F7UF 2HQXA 2JTFA 4JZ3A 4JJBA 4MZTA 5KYUA 3JCMb 1GBRA 2X3XD 3EG3A 2E65A 4M75E 2EYWA 2QDLA 4A4KA 3L2UA 3QDFA 2HD0A 2X4JA 1M30A 5J3BA 1KQ2A 1VQ7A 1MUZA 2LT4A 2QEXQ 3R6NA 4RTZA 3SWNC 4OB1B 3JB9I 1SRMA 4LDYA 3CCEQ 2LQNA 4C92G 1M1FA 1NYGA 4PJOG 5GAMd 2Z0WA 1LCKA 2YLBA 4HVWA 5KYWB 2QQAA 3M0TA 1G3YA 4ZN3A 2DRKA 3QKJA 2RHZA 3REBB 3EH2A 5KYXB 3UF4A 4NS5A 2JJ9A 5FU6C 3G4ST 3S3OA 4Y92A 2RI3A 4J6XA 5J26A 2E5KA 2RQRA 4EDUA 2CH4W 1M2OA 1JJ2P 1UJ0A 1WPYA 2JZ2A 2KRSA 1D1AA 1K73R 2KNBB 1VQOQ 4KGZB 1VQPT 2COYA 2OTJQ 1OZ2A 4M78F 2CREA 1ABOA 2JS0A 3M0RA 3QPHA 4QVDA 1K73C 3OS2A 2J6KA 1ZUKA 2MK5A 1O75A 4OMNA 5KE2A 2GTJA 1WHHA 4GLMA 2X51A 1VQLA 2GNCA 3S3NA 1MNDA 2ATCB 1MNEA 2GQIA 2M9UA 3CCSA 9ATCB 2LT1A 1MMNA 2LC4A 5KYYB 1JJ2A 2HSPA 1TUGB 5GAN3 4J7FA 5I2MA 2YSQA 3ME9A 4EPCA 4BI4A 1Y96B 1B34A 2L3RA 2V8IA 4AMCA 1CKBA 4X9CA 2DETA 2DX1A 3LW5E 1YJ9Q 3OBWA 1D3BB 2ZPEB 5GAN4 7AT1B 2HMAA 1ZBJA 4KGVB 1X01A 4OVAA 4CC2A 2QQSA 4AFZC 1XOVA 4BUGA 1BKBA 4PJOA 4A63B 4J8OA 4FW2A 3QBYA 2EBPA 3EG9A 2KAFA 2K2VA 2KRMA 3P8BB 1ZSZA 2E3HA 3QWXX 2JMAA 2ENMA 3I56Q 2A7YA 5M9OA 1K9MC 4MMKA 5HK3A 4N4HA 1GFCA 2QDYB 2KGTA 2MOXA 2M16A 4J6YA 1WA7A 4IURA 2VKNA 2YXYA 2CP2A 2O9VA 2HDAA 1NJIU 2ECZA 2VWFA 3CXCP 4FIBA 4RKUE 1W1FA 1M9SA 5GAN5 2DEUA 1N5ZA 2F2WA 1VQ8Q 1PSFA 1GXIE 2DIGA 2QGGA 4M7DC 1Q7YU 2DXCA 3NTHA 1M2VB 1SHGA 2MAMA 3CCJT 5LJ5h 2RF0A 3GF5A 2DL3A 3CMEA 1GCQA 3X24B 1K8AU 1CSKA 1VYUA 4FYWB 3PNWC 2MWOA 5GANd 3QJ6A 3E1SA 4C92F 2VUBA 2HBWA 1N6AA 3LWHA 4BY6B 1FXXA 1X2QA 3T9NA 2OTLQ 2GQVA 2L8DA 2DTIA 2BKDN 2JN0A 3THKA 2GFUA 1VQ6A 5GAOp 3CXCA 3FRNA 4D8KA 3L2ZA 4Z88A 1IHWA 5C0MA 4ELZC 2RM4A 1UHCA 2SEMA 4XU0A 2LRQA 4J83A 3MO8A 4HCKA 1WGSA 3G71T 1YP5A 3RNJA 4M75F 3LGFA 4ORZA 1YJNQ 2R57A 1G3TA 3U23A 1VQ9Q 5IXBA 1BK2A 4PK4A 1AT1B 3FDRA 5AYFA 2YUQA 2VXEA 2X4WA 2E12A 1PM3A 4C8QC 1N8RR 1FMKA 2DERA 1VQNQ 2XK0A 1VQKQ 2IVWA 4RCBA 4M7DD 1V1CA 3NMZC 1VIFA 2H3JA 3OS1A 1N8RC 4M77E 4RG8A 4WTOB 2YHTA 2EYQA 1YWOA 3M4GA 1QCOA 3H8ZA 5GANe 2YWWA 2EW3A 3JCMf 2L3QA 3SWNA 1MMDA 3SB2A 2LCLA 4BI8B 2DTHA 4M7AA 3VUBA 1KD1R 3A8MB 2QEXT 2XI9A 3CCET 1ZLMA 2RHYA 4X9DA 3EH1A 3WVDB 1JBMA 2YUOA 3OYCA 3G6ET 3SHWA 4IIOA 1NE8A 1S1NA 1YNZA 5CAIA 2RB6A 2ABLA 3E19A 3CD6A 2CGHA 1B7TA 2IIMA 4C8QD 3JCMX 5LJ3f 1PHTA 1BYMA 3EHRA 1QWFA 2H3EB 3OS0A 3TCJA 3L2RA 1PCXA 3KXTA 3OYJA 4YTLA 2R5AA 4J9GA 3ULRB 2AK5A 5CCAA 3CC4Q 1YCYA 1VQ4T 3MPUB 3EG0A 2XDDA 1M1GA 2KYBA 2Y4YA 1GRIA 4M7DG 2C0TA 1RAAB 1KK7A 1VQOT 3GBQA 2NUTB 2NWMA 3FB9A 3M4YA 4CI0C 5GAOn 2DZCA 2OTJT 1N9SA 1UTIA 1JB0E 1YITQ 1V76A 2M1HA 3CC7Q 1KHCA 1U1SA 2D1XA 2VASA 2BE7D 1S72Q 3X28B 3VRZA 2RHUA 2LJ3A 2CT3A 5GJWB 3CCUA 2ZPGB 4M77B 1Q82U 1UECA 1Y0MA 4A4EA 3WXMB 3RUXA 3JCMd 2QI2A 3FC3A 2DVEA 2EFIA 3ZBDA 3A8GB 3OSVA 1MMGA 1M90U 2QQRA 5IHKA 2WSEE 1E6HA 1YJ9T 3EFOA 1Y7XA 1SPKA 4J9HA 2XDBA 3I9QA 5FWCA 2EGCA 1Y71A 5LJ3d 1EZZB 1T3LA 3OQ5A 1SKUB 1ACMB 1HXDA 4RTTA 3CCRQ 2QA4A 4TVRA 1VQ5A 4HA8A 2JTEA 2Y4XA 4XTZA 3I56T 2KSSA 3PE0A 3HRTA 3HPWA 4DBHA 1YIJA 3PFSA 4MDWA 3VU3C 2OAWA 2CP0A 3R6OA 1BI2A 1OZ3A 2OX7A 4JZ4A 4N0AC 2W10A 4F04B 1C0MA 2VGMA 3OYBA 1NBEB 4A4GA 2FL7A 1PD1A 2M0YA 3L2VA 1JU5C 4BDYA 2O9SA 4LDUA 1VQ8T 3AHUA 4HVUA 3P8HA 1UGSB 3HTRA 2LX7A 2CUDA 1NPPA 3TQ7P 4ZNXA 1ZSZC 1ARKA 3WVEB 3A8HB 3CQTA 3I35A 4DBFA 3EFSA 3HP9A 3C95A 1RI0A 4E7HA 2DKGA 1OOTA 2OTLT 4XTVA 2DK3A 2J7IA 1WI7A 2DBKA 5D6XA 2RD1A 2DL5A 1OEBA 3L2WA 5GANh 5GAOq 2QQBA 1V29B 3A8OB 4R0KA 2CKKA 4HVVA 4QQ6A 1GL5A 2B86A 3TSWA 3MEAA 2QTVA 2EQJA 1W2BP 4C8QA 1VQ9T 1G83A 4EMHA 1T0JA 1KC8R 3BY7A 4C0ZA 5CQYA 4E2FB 2BE9B 3KBGA 2KRNA 1ZUUA 3QXEB 6AT1B 2DRMA 1VQNT 1D09B 1VQKT 2PVDB 1PC0A 4C5HA 2HSEB 4MZMA 3EGDB 4RTVA 5LJ5j 3PIPA 3VYHB 1R8OB 4F7UA 1EFNA 3QDRB 1Q86C 1OI1A 4A4FA 1QQJA 1UB4A 3LYIA 2O4XA 2K3YA 5HY6A 1SRLA 4ANJA 2K3XA 5I2SA 2XKOC 3OYFA 3PMTA 3FIFA 2VXFA 3NTIA 1NJIR 1W2BA 3CPFA 1QP2A 2FG0A 3M53A 1NEBA 1PRLC 3NPFA 5FWBA 1YI2Q 3RKYA 4C92E 2PUOB 2CH4A 1YHQA 2K57A 5LJ5e 1PRMC 2RPNA 2ZCFB 2BTTA 1K8AR 3GIBA 1WQ7A 3I55Q 1B3QA 3CD6Q 4FSSA 1TS9A 4OB3B 3QZ9B 1Q7YC 5GAN7 3CBPA 2DXUA 4IIMA 3V7RA 4DBRA 3EGXB 3CCVQ 2EKHA 2MI6A 1K8AC 1IGUA 2GF7A 2DM1A 2YUPA 3JV3A 2CP7A 3UWNA 1M3BA 4X34A 1RAIB 1YN8A 5CVIA 3CC4T 1UFFA 2RHIA 1GBQA 1BIBA 2CZ0B 2K5IA 2FZKB 1GCPA 4M7AC 1VQMA 3MEVA 2ROLA 1YFNA 4ELYC 4RTWA 5EG2A 5FU7B 4KGXB 4M78A 1LNXA 4BE2A 4BY6C 1YITT 2BUDA 2KEAA 3CC7T 3Q1JA 4OMFB 1S72T 2V8KA 2VV5A 3CBMA 1IB8A 1MGQA 1E7OA 2HQHA 3MP1A 4QW2A 1K4US 3VYGA 4J9EA 1RL2A 2L5QA 2EVRA 4NOYA 4N4IA 3CMAA 1H3ZA 3A8LB 5CKBA 5GAMj 3QYHB 2O88A 3VV0A 2F5KA 3S6WA 3OYAA 5GAOr 2FVUA 4PJMA 2X4YA 4C92B 2VYTA 2BIVA 3JCMh 2J06A 4HXJA 2KY9A 2ZZDA 3CC2Q 3OSSC 1HJDA 4IUPA 2ZPHB 2AKLA 4HCBA 2QA4Q 2EWNA 2EGEA 3OW2S 1VQ5Q 1VA7A 2DYIA 4M7AD 2B8AA 3P8DA 2CZ1B 4M75B 5GAMe 2KXCA 2JUFA 3CCRT 4OMQA 1K76A 4OMLA 5GMKj 2PVOB 2X9HA 3RBBB 3GNGA 3M0SA 4UC4A 3LWIA 5LJ3h 4QQDA 1AHJB 2FHDA 2JS2A 1LJOA 1BCOA 5KYWA 3URGA 5IHIA 2LMJA 3J80E 4JRKA 2MCNA 4N0AA 2YT6A 2JMCA 5FRNA 4ME7A 3G4SA 3M0PA 4JJDA 2DTOA 2MIOA 3MHXA 4OB0B 1IXDA 3QSUA 5KYXA 2RI5A 1I5LA 1K9MR 4LNPA 1M27C 5FROA 1ZHIA 1RAGB 4PFOA 2HKNA 2COWA 3UATA 4FCYA 4PJLA 1MV3A 1Q86U 1VQPA 5GMKe 2RO0A 2F2XA 4KUIA 1M8MA 5HK0A 1WXTA 3CBOA 4M4ZA 1BI3A 3CPWS 2QAZA 3CCMQ 5CKFA 3SEMA 4OMOA 2O01E 4XK8E 2A0FB 2YRVA 3MCAB 1WHKA 3BW1A 3G1JA 3OYNA 1PWTA 3HRSA 2RH2A 1Q82C 3CCLQ 4JRQA 4CC4B 5CO7A 4M7AG 3MKDA 2PZ1A 3UDCA 1M90R 2X35A 2E1HA 2KE9A 2P0PA 1I1JA 2A3LA 3F70A 2DXBA 2A08A 1IO6A 2RMOA 3EHQA 2JVVA 4Z89A 1EX4A 3OY9A 2OJ2A 4M77C 3CCQT 5KYYA 1M90C 2LNHB 3JB9H 2V1QA 3OYYA 2E64A 1RLPC 1PNJA 1QWEA 1Y96A 1CKAA
chains in the Genus database with same CATH topology
2QQ9A 2RK1A 4HCCA 3M4YA 5IAYA 1EIFA 4CI0C 5GAOn 5DM7R 2DZCA 4BE0A 2OTJT 4PJOF 4Z02A 1N9SA 4MMLA 1JRIA 5CR2A 1JB0E 1YHQT 3VUZA 2FB7A 3HHTB 1D3BA 4C0GA 5LJ5d 2M1HA 2ZPFB 3CCLA 1KHCA 1U1SA 3ASKA 2MMPA 4M75G 4PJOB 3RKXA 4M77F 2E70A 3LGLA 3J81E 3X28B 2RJDA 2PU9B 2RHUA 1KD1U 4LD9K 2CYZB 4P5NA 3CCUA 5GAN8 2ZPGB 3MP6A 4M77B 1Q82U 4OGEA 1KG1A 4C0DB 4BDZA 1WNLA 4L5GA 4A4EA 3WXMB 3JAME 3JCMW 3RUXA 3BDLA 2AHJB 2JNGA 3ER0A 3JCMd 2QI2A 3CC4A 3FC3A 4IKFA 4ZGDB 4BACA 2KVQG 3VKIA 2QXFA 1TH7A 5GAMf 5GANj 3N5BB 2DVEA 2ZPIB 2EFIA 4JRIA 4BD3A 3ZBDA 3JCMP 3CEYA 3JCMQ 4XAXB 3A8GB 3FB9A 3OSVA 4OP0A 3TREA 4HT9A 4HKEA 1YI2T 3DB4A 1WJSA 3GP8A 1M90U 3QJYA 2QQRA 4JRPA 2WSEE 4M78B 2FYKA 1KC8C 1KQSS 1QVFS 3QIIA 3C12A 4C5IA 4PJOD 1YITA 1YJ9T 3LLRA 3CC7A 3INZA 4JLIA 5GAOm 1VQMT 1N27A 3V8JA 1UEBA 2GFAA 1S72A 1Y7XA 2RJEA 3I55T 4M77D 4PL6A 5CKHA 4CRIA 2XDBA 2PVGB 4E7JA 4M7AE 4XTWA 3JB9F 3ZFJA 4A54A 3CCJA 1Y71A 5LJ3d 2P0QA 3OQ5A 3OYHA 5GANf 1PSEA 2QTXA 2OAUA 3CCVT 1M1KC 3QZ5B 1HXDA 4OGCA 4A4HA 2QA4A 4TVRA 2RJCA 2P0KA 4PKCC 3X20B 1YJNA 1VQ5A 3QHSA 4HA8A 1IZ6A 2Y4XA 1BIAA 2EKOA 2RA2A 3M58A 3UT1A 4XTZA 1NJIC 3JCMV 3V7CA 3I56T 4L6V5 2KSSA 3CMAT 2PUKB 3HRTA 2CZ6B 3CMET 3HPWA 1YJWA 4M7DE 4V2SA 4L59A 2D0QB 2ZPBB 5A0DA 4BE1A 5GMKm 5FLXE 4XU3A 1YIJA 3OA6A 4F7UF 2HQXA 2LCCA 3HKSA 3PFSA 2JTFA 1H641 1VIEA 2YLCA 4MDWA 2WSCE 2K5FA 3VU3C 5LL6S 4MZTA 1U1TA 3R6OA 3RERA 4C92A 2E10A 1BI2A 3HL8A 2E6NA 1OZ3A 4KULA 3JCMb 1QVGS 3G71A 2E65A 4M75E 1KC8U 2VGNA 4N0AC 3RIRA 4A4KA 2VGMA 1VQ6T 3OYBA 3JB9D 3BFMA 4ZTJA 4A4GA 3L2UA 2FL7A 2LQKA 2HD0A 5GAMh 4IUVA 2X4JA 3DB3A 3L2VA 5J3BA 4ZN1A 1SSFA 3CCRA 4BDYA 1VQ7A 1KQ2A 2VC8A 4HT8A 4LDUA 2LT4A 1VQ8T 3AHUA 3P8HA 3HFOA 2EJGA 3SWNC 4OB1B 3JB9I 1UGSB 4LDYA 1O9SA 4C92G 1M1KU 4M75A 3JCMJ 1M1FA 4PJOG 5GAMd 1NPPA 2YLBA 3OB9A 3WVEB 3A8HB 3V7SA 2QQAA 3EFSA 2EQUA 4M77G 3HP9A 3SDZA 2WSFE 3C95A 1Q81C 1RI0A 4E7HA 1G3YA 2DKGA 3MEWA 4ZN3A 3QKJA 2RHZA 2OTLT 4XTVA 5LJ5g 2DK3A 3JSCA 2E41A 4FU6A 5D6XA 2RD1A 5A2QE 3L2WA 4NS5A 3META 4FL6A 4RCCA 5GANh 2QQBA 5GAOq 2K5LA 1V29B 5GMKi 3CC2T 2EQKA 4R56A 3SWNB 4FT2A 3A8OB 3OBYA 2CKKA 5FU6C 5CK9A 3HRUA 4J7IA 3G4ST 1G5VA 3S3OA 4M78C 2RI3A 4J6XA 4QQ6A 5J26A 5GMKh 2C06A 4EDUA 4M7AB 3MEAA 2EQJA 2RJFA 3JCMg 2QEXA 4O5VA 4EMKC 4C8QA 1NPRA 2XG8D 1WPYA 2JZ2A 3M56A 3VJPA 1VQ9T 3CCEA 4EMHA 2LVMA 3BY7A 4C0ZA 5CQYA 1VQPT 4JS4A 4DA4A 4II1A 5J39A 3KBGA 1P92A 5CIUA 3G6EA 1OZ2A 3QXEB 4M78F 3TU4K 1VQNT 4E7IA 1VQKT 1FX7A 2M0OA 2PVDB 3QPHA 2EAYA 4C5HA 4QVDA 3QO3A 5FU6B 4M7DB 3PIPA 4MZMA 3JB9G 1K73C 5LJ5j 3OS2A 3VYHB 1R8OB 4IUQA 3V8LA 3MP8A 1MHNA 4F7UA 5C6SA 5KE2A 1O75A 3QDRB 4C8QG 4QVZA 1Q86C 4WF2A 5D6WA 3OMGA 1OI1A 5DY9A 1UB4A 3LYIA 4A4FA 3NFCA 4EMGA 1I8FA 1G3WA 4EMKB 5D6YA 3FJPA 3OYKA 2MF2A 2O4XA 2K3YA 3PT9A 5HY6A 3S3NA 1VQLA 4ZGEB 2K3XA 2KMTA 1X75C 5I2SA 2XKOC 5LJ3g 3JB9J 3CD6T 4KUDK 4BB7A 3OYFA 1VQ4A 3PMTA 2M9UA 3ZEHA 3FIFA 5HKCA 3CCSA 2VXFA 2LT1A 3NTIA 2LNVA 3CCQA 4Y91A 1W2BA 2LC4A 3M59A 1JJ2A 4PLLA 3OYGA 2K4YA 3CPFA 1QP2A 5GAN3 4J7FA 4O6JA 5I2MA 3RESA 3UPUA 4HCZA 3DLLA 3ME9A 3M53A 1VQOA 2F69A 3NTKA 4N4GA 4EPCA 4F7UG 4BI4A 1UGRB 1Y96B 1B34A 3RKYA 4C92E 2L3RA 4MZPA 4RMOA 3S3MA 2PUOB 2V8IA 2OTJA 5A0LA 5LJ5f 3EAEA 3PGGA 1M4ZA 1YHQA 4X9CA 2K57A 3KUFA 3LW5E 3CCMT 5LJ5e 3OBWA 1D3BB 1XTDA 2ZPEB 5GAN4 4M78D 2ZCFB 4OVAA 1X01A 1G3SA 4RG2A 3GIBA 1WQ7A 2DO3A 2XU8A 4BI3A 4LDVA 4OB3B 2QQSA 3QZ9B 1ZBXA 5GAN2 1Q7YC 3CCLT 1XOVA 4PLIA 1K73U 5GAN7 3CBPA 1BKBA 4XQ3A 4BUGA 2DXUA 3QUIA 4PJOA 3V7RA 4J8OA 5LJ3j 3JCMe 3QBYA 3LX7A 2DZ9A 2MI6A 3LH0A 3CCUT 2KAFA 1K8AC 2K2VA 2GF7A 1YJNT 2R58A 3P8BB 4M77A 1I4K1 4XTUA 2EIFA 2EJ9A 1ZQ1A 3UWNA 4Y28E 2V8JA 4X34A 2A7YA 5CVIA 5M9OA 1K9MC 3CC4T 3SFMA 3A5ZB 4MMKA 5HK3A 1YI2A 2RHIA 4N4HA 5GAMg 4E7LA 2QDYB 2RI2A 1BIBA 2CZ0B 2PQWA 4KBMB 2K5IA 4B9XA 2XDPA 4LDWA 2M16A 1KD1C 4J6YA 3M5AA 1YJ9A 1LOJA 2KK4A 4M7AC 4IURA 2LQ8A 4XTYA 1VQMA 2KDSA 1W2BS 1JJ2S 3MEVA 4ELYC 3OW2A 5EG2A 3I55A 5FU7B 2G3RA 4VUBA 1NJIU 4M78A 1LNXA 2HNIA 4BE2A 2F5TX 4BY6C 3EFRA 4QQGA 1YITT 4C8QE 5LJ3e 2LDMA 1KHIA 2BUDA 4FIBA 4RKUE 4C92C 5A0GA 3OYEA 1M9SA 3GLXA 3CC7T 4PNOA 4IUUA 3Q1JA 2I2LA 4OMFB 5GAN5 2V8KA 2VV5A 3CBMA 3PTAA 3CCVA 1S72T 2P4TA 1MGQA 4GY5A 1GXIE 3MP1A 1PSFA 4QW2A 3VYGA 2DIGA 2RHXA 4M7AF 4LD6A 5DLOA 4M7DC 1Q7YU 1RL2A 2L5QA 3M57A 2NLUA 2DXCA 4NOYA 3NTHA 2MAMA 1DJ7B 3CCJT 5IT9E 4N4IA 3I56A 5LJ5h 5KE3A 1WJRA 4JLGA 3RKWA 1N9RA 4B9WA 3CMAA 4JJNK 4ATOA 3GF5A 3A8LB 3CMEA 2QA4T 3X24B 5I21A 1NZ9A 5CKBA 1K8AU 2D6FA 4M78G 5GAMj 3E9FA 2CZ7B 2MWOA 3PNWC 3QJ6A 3QYHB 4F7UE 2L89A 4E47A 5GANd 4FM4B 3E1SA 2Y90A 4C92F 3VV0A 5KH6A 2VUBA 2F5KA 3S6WA 3OYAA 5GAOr 1N6AA 2FVUA 4BY6B 3SD4A 2WACA 4M75C 4DOWA 3LWHA 2HBPA 1I81A 2ZGWA 2D9TA 4C5GA 3QG1A 4R55A 1U8RA 1K9MU 1FXXA 2X4YA 3T9NA 2GQVA 4C92B 1YJWT 2VYTA 2BIVA 4XTXA 4C5EA 2L8DA 2DTIA 3JCMh 5GAN6 4NL3A 1VQ5T 4M7DF 2BKDN 1WQWA 1YIJT 2KY9A 2JN0A 4KT0E 2ZZDA 2JTMA 2GFUA 2XIDA 1VQ6A 4JDSA 3OSSC 5GAOp 3FRNA 3HFNA 3CXCA 3L2ZA 4IUPA 2X4XA 4ELZC 4D6WA 3FLGA 5C0MA 2RM4A 4MDXA 4XU0A 2ZPHB 2LRQA 4J83A 1UGPB 3V8KA 3CPWA 4HCBA 3MO8A 1WGSA 3OYDA 3G71T 2EWNA 1VQ8A 1Q81U 2XD0A 4M75F 4XU2A 3LGFA 4C0FA 3OW2S 2R57A 1G3TA 3JRZA 5L8RE 4NL2A 1QP3A 2DEQA 5CKEA 4M7AD 2B8AA 4XU1A 2EJFA 3OS5A 3P8DA 3GOXA 1FWZA 3FDRA 2CZ1B 4M75B 5GAMe 3L1AA 5AYFA 1QVGA 2VXEA 2LTOA 2JUFA 5CQXA 5GAOl 2X4WA 3CCRT 3M54A 4Q5WA 1VQ7T 1UGQB 3M9QA 2E12A 4E7KA 4C8QC 2RK2A 5GMKj 2PVOB 3GNGA 4LDXA 1BI0A 4C92D 2XK0A 3BDUA 4UC4A 3LWIA 5DLQE 4QQDA 5LJ3h 1AHJB 2OTLA 2FHDA 4PJOE 2IVWA 1LJOA 1M5Q1 4RCBA 3URGA 2DXTA 4M7DD 5KCOA 3J80E 4JRKA 2DPPB 1XQHA 1VIFA 2DD4A 2H3JA 4N0AA 3RMQA 5CKDA 1VUBA 2IG0A 3OS1A 3M55A 1N8RC 4M77E 3CC2A 5FRNA 4RG8A 4ME7A 3G4SA 2XICA 2KQWA 2GCXA 2DTOA 3MHXA 2YHTA 4OB0B 4C8QF 2EYQA 3C94A 5KCHA 2CS7A 4DOVA 4OB2B 3QSUA 3TEEA 3M4GA 3FEOA 2RI5A 3PIOA 1WJQA 1HK9A 4J6WA 3H8ZA 5GANe 1I5LA 2E5QA 4C8QB 3JCMf 4M75D 5FROA 3SWNA 1ZHIA 1VQ9A 1H3ZA 3SB2A 1BI1A 5FU7C 5IN1A 4JS5A 3X26B 2LCLA 4BI8B 2DTHA 1Q86U 1VQPA 3CXCS 3VUBA 5GMKe 3OYMA 2RO0A 4M7AA 3A8MB 3O8VA 2QEXT 2DJZA 4KUIA 4OF1A 2XHCA 5HK0A 1XNIA 2XI9A 3CBOA 1BI3A 4M78E 3CPWS 2JOYA 1VQNA 5CKFA 3CCET 1VQKA 3J7AF 2RHYA 2DAQA 5GMKl 4FT4A 4X9DA 2O01E 4XK8E 3WVDB 4F7UB 2YRVA 3GNFB 1JBMA 3L2QA 4ZGJB 1OYXA 3MCAB 1Y07A 3OYCA 1YBYA 3G6ET 3BW1A 3QYGB 4JUVA 3OYNA 1NE8A 4GLKA 3HRSA 3G7ZA 2RH2A 1M8VA 1Q82C 5CAIA 3C4SA 3JCMc 1IREB 3OYLA 4JRQA 4M7DA 2O4XB 2RB6A 3DKMA 3PMIA 5CO7A 1QVPA 4M7AG 2DIQA 3E19A 3CD6A 2CGHA 3JCMX 4A53A 3UDCA 4C8QD 2X35A 5LJ3f 4IUTA 1BYMA 3X25B 3OS0A 2E1HA 1N8RU 5FRMA 2P0PA 3TCJA 2EQMA 4EMKA 2A3LA 3L2RA 3F70A 1W4SA 3DLMA 2DXBA 4PJOC 3KXTA 3GPLA 2LX9A 3OYJA 4YTLA 1VQLT 2R5AA 4QVCA 2JVVA 3MEUA 2HAXA 1KQSA 1QVFA 5CCAA 1YCYA 1VQ4T 1B34B 3CCST 2R5MA 2XDDA 3OY9A 1M1GA 2MWPA 4M77C 3RMSA 3CCQT 3HSBA 4C0DC 1M90C 5GANg 2Y4YA 4J5YA 3OYIA 3CCMA 3JB9H 4FSXA 4ZTFA 3E9GA 2DD5A 4M7DG 1X6OA 1QW1A 1VQOT 3L42A 4DQ2A 3H6ZA 2E64A 2E6ZA 1KQ1A 3OYYA 3OMCA 1Y96A 2HQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M75 F;  4XU2 A;  5GAM h;  5LJ5 e;  5GAO n;  1D3B B;  2DZC A;  5GAN 4;  4M78 D;  4PJO F;  4NL2 A;  2DEQ A;  1KQ2 A;  2VC8 A;  4HT8 A;  4M7A D;  1N9S A;  1X01 A;  1JRI A;  2EJF A;  4MML A;  4XU1 A;  3AHU A;  1WQ7 A;  3GIB A;  2FB7 A;  3HFO A;  4M75 B;  2EJG A;  3L1A A;  3SWN C;  5GAM e;  1D3B A;  2VXE A;  5LJ5 d;  3JB9 I;  1U1S A;  4M75 G;  4PJO B;  3RKX A;  4M77 F;  4C92 G;  4C8Q C;  4M75 A;  3JCM J;  4PJO G;  5GMK j;  5GAN 2;  5GAM d;  2YLB A;  4XQ3 A;  5GAN 8;  5GAN 7;  4PJO A;  2DXU A;  3QUI A;  4C92 D;  3V7R A;  4M77 B;  5LJ3 j;  3JCM e;  3BDU A;  3V7S A;  5LJ3 h;  1WNL A;  3EFS A;  3JCM W;  4M77 G;  2DZ9 A;  4PJO E;  3RUX A;  1LJO A;  1M5Q 1;  4RCB A;  4M77 A;  1I4K 1;  4XTU A;  2DXT A;  2DKG A;  3JCM d;  4M7D D;  2EJ9 A;  4JRK A;  5GAO l;  4XTV A;  5LJ5 g;  4N0A A;  2E41 A;  1TH7 A;  2RD1 A;  4M77 E;  5GAM f;  5GAN j;  4RCC A;  4MMK A;  5GAN h;  2DTO A;  5GAO q;  2DVE A;  2YHT A;  4JRI A;  4C8Q F;  5GAM g;  5GMK i;  1BIB A;  3JCM P;  3QSU A;  3SWN B;  3M4G A;  3JCM Q;  3FB9 A;  4OP0 A;  4HT9 A;  1HK9 A;  4J6W A;  4J6Y A;  5GAN e;  1I5L A;  1LOJ A;  4M78 C;  4C8Q B;  4M7A C;  4J6X A;  4M75 D;  3JCM f;  3SWN A;  4XTY A;  4M78 B;  5GMK h;  4M7A B;  2FYK A;  3SB2 A;  3JCM g;  4PJO D;  4EMK C;  1Y96 A;  4C8Q A;  2DTH A;  3INZ A;  4JLI A;  1WPY A;  1LNX A;  2HNI A;  4M78 A;  3V8J A;  5GMK e;  5GAO m;  4M7A A;  3EFR A;  4EMH A;  2DJZ A;  4C8Q E;  4M77 D;  5LJ3 e;  3BY7 A;  4M78 E;  4C92 C;  4M7A E;  4XTW A;  3JB9 F;  4PNO A;  2I2L A;  5GAN 5;  4A54 A;  1MGQ A;  5GMK l;  4X9D A;  5LJ3 d;  4M78 F;  4F7U B;  4M7A F;  1JBM A;  5GAN f;  4M7D C;  2QTX A;  4QVD A;  2EAY A;  1HXD A;  3QO3 A;  3BW1 A;  4NOY A;  4JUV A;  3JB9 G;  4M7D B;  5LJ5 j;  3QHS A;  3V8L A;  4HA8 A;  4F7U A;  5LJ5 h;  1M8V A;  3RKW A;  1N9R A;  5CAI A;  3JCM c;  4C8Q G;  1BIA A;  2RA2 A;  5I21 A;  2RB6 A;  4M7D A;  4M78 G;  4XTZ A;  4WF2 A;  5GAM j;  3JCM V;  4M7A G;  5DY9 A;  3V7C A;  4EMG A;  5GAN d;  4EMK B;  4F7U E;  2CGH A;  1I8F A;  4A53 A;  2Y90 A;  4C8Q D;  4C92 F;  3JCM X;  3FJP A;  5LJ3 f;  4M7D E;  5GAO r;  4V2S A;  4M75 C;  2E1H A;  5LJ3 g;  2ZGW A;  1I81 A;  4EMK A;  3JB9 J;  5GMK m;  4XU3 A;  4F7U F;  3FIF A;  4PJO C;  2VXF A;  4C92 B;  4NL3 A;  4XTX A;  4Y91 A;  1H64 1;  2YLC A;  2DTI A;  3JCM h;  5GAN 6;  4QVC A;  4M7D F;  3VU3 C;  1WQW A;  1YCY A;  1U1T A;  1B34 B;  5GAN 3;  3RER A;  2JN0 A;  4C92 A;  3RES A;  2E10 A;  4M77 C;  3HSB A;  3JCM b;  5GAO p;  3HFN A;  4F7U G;  3L2Z A;  2E65 A;  4J5Y A;  4M75 E;  5GAN g;  1Y96 B;  1B34 A;  3RIR A;  4N0A C;  3JB9 H;  3RKY A;  2RM4 A;  4C92 E;  4M7D G;  4XU0 A;  3JB9 D;  3V8K A;  3BFM A;  4DQ2 A;  2E64 A;  1KQ1 A;  5LJ5 f;  3PGG A;  2EWN A;  4X9C A;  2K57 A; 
#chains in the Genus database with same CATH topology
 2QQ9 A;  1PKT A;  2DMO A;  2KYM A;  5DM7 R;  4BE0 A;  4PJO F;  4Z02 A;  1BCM A;  5CR2 A;  2DNU A;  3VUZ A;  2FB7 A;  2BZY A;  3HHT B;  1D3B A;  4C0G A;  2ZPF B;  2MYS A;  2RJD A;  3H41 A;  4LD9 K;  2CYZ B;  4OGE A;  1KG1 A;  4C0D B;  4BDZ A;  2O2O A;  4PJJ A;  2LJ1 A;  2JNG A;  3ER0 A;  2KXD A;  1WXU A;  2K3B A;  4ZGD B;  2QXF A;  1TH7 A;  5GAN j;  4AFQ C;  2FZG B;  2ZPI B;  4JRI A;  1YHQ Q;  1WHJ A;  2J6F A;  3CEY A;  2LP5 A;  3JCM Q;  3TRE A;  4HT9 A;  1YJW Q;  1YI2 T;  5IXF A;  3QJY A;  2FYK A;  1KQS S;  1QVF S;  4C5I A;  1IHV A;  4JLI A;  1SHF A;  1M3A A;  1RI9 A;  3I55 T;  4M77 D;  4PL6 A;  2GGR A;  3E2U A;  1LVK A;  4F17 A;  2PTK A;  1C6V X;  3CCJ A;  1QMC A;  4J9D A;  4FW1 A;  3OYH A;  3A1P A;  3M0Q A;  1PSE A;  3CCV T;  3NHN A;  2DA9 A;  1VQ7 Q;  4X1V A;  1IZ6 A;  1BIA A;  2D0N A;  1M2V A;  3M58 A;  3V7C A;  4L6V 5;  3PVL A;  1BBZ A;  2CZ6 B;  4M7D E;  4V2S A;  2HL5 C;  2FPD A;  1X69 A;  4BE1 A;  1SG5 A;  1VIE A;  2YLC A;  1X43 A;  2WSC E;  2K5F A;  1TWB A;  4F14 A;  1U1T A;  3RER A;  2E10 A;  2E6N A;  1TXQ A;  4KUL A;  1QVG S;  3G71 A;  2VGN A;  3H0I A;  2ESW A;  3JB9 D;  4ZTJ A;  2E4H A;  5GAM h;  4IUV A;  4ZN1 A;  1SSF A;  2SRC A;  2VC8 A;  3HFO A;  2EJG A;  4FYX B;  3JCM J;  1TOV A;  1UG1 A;  1JEG A;  1SEM A;  1RAB B;  2F1L A;  4M77 G;  4RUG A;  3VS2 A;  1KFZ A;  1Q81 C;  1T3S A;  5LJ5 g;  1K0S A;  2E41 A;  4FU6 A;  2FRW A;  5A2Q E;  4RCC A;  1B07 A;  2K5L A;  3VS0 A;  3CC2 T;  2EQK A;  2HKQ B;  4R56 A;  4AT1 B;  4FT2 A;  1OU9 A;  5CK9 A;  1X6G A;  1VQL Q;  4M78 C;  1OX8 A;  2C06 A;  5GMK h;  3CCS Q;  2RJF A;  2QEX A;  4O5V A;  4E7S A;  2GTO A;  1ZSG A;  3M56 A;  3VJP A;  3CCE A;  1ZA2 B;  1SSH A;  2LVM A;  4E7Z A;  1TG0 A;  5J39 A;  1P92 A;  3G6E A;  1X6B A;  1D1B A;  5HCK A;  1FX7 A;  2M0O A;  2EAY A;  1YCS B;  4M7D B;  3JB9 G;  4IUQ A;  3V8L A;  3MP8 A;  1RAE B;  1UE9 A;  4C8Q G;  1F1B B;  1Q95 G;  5DY9 A;  4EMK B;  2NYS A;  3NFC A;  1G3W A;  3PT9 A;  1OQK A;  2KMT A;  1X75 C;  1YWP A;  1VQ4 A;  3ZEH A;  5HKC A;  2LNV A;  2CP6 A;  4PLL A;  3OYG A;  4HCZ A;  1H92 A;  1VQO A;  2LJ0 A;  2F69 A;  3H0F A;  4F7U G;  4LUD A;  3AT1 B;  1MV0 B;  2G6F X;  4MZP A;  3S3M A;  2K2M A;  2OTJ A;  5A0L A;  1XJW B;  5LJ5 f;  3PGG A;  1M4Z A;  4RTX A;  3KUF A;  1WHM A;  3IQL A;  3CCM T;  1M3C A;  1XTD A;  3VRY A;  4M78 D;  2P84 A;  2NUT A;  2EPD A;  1G3S A;  1E6G A;  1AWJ A;  2HZY A;  2XU8 A;  4LDV A;  2JT4 A;  3KFV A;  3CCL T;  5LJ3 j;  3JCM e;  1G2B A;  3LX7 A;  2DZ9 A;  1TUD A;  2R58 A;  4M77 A;  4XTU A;  4Y28 E;  2V8J A;  2LQW A;  3CME Q;  3SFM A;  5GAM g;  2VB6 A;  4AG2 C;  2RI2 A;  4DEY A;  2PQW A;  2V1R A;  2YUN A;  3M5A A;  1YJ9 A;  2KK4 A;  8ATC B;  2NUZ A;  3O5Z A;  1JJ2 S;  2NUP B;  3H9N A;  4QQG A;  1VQ6 Q;  1QLY A;  1WYX A;  2K6D A;  4D8D A;  5LJ3 e;  2LDM A;  4C92 C;  5A0G A;  8AT1 B;  4IUU A;  1KIK A;  2P4T A;  1AWX A;  4LD6 A;  1HYO A;  1ZUY A;  3M57 A;  2NLU A;  2CSQ A;  1DJ7 B;  3I56 A;  1QVG P;  5KE3 A;  4LUE A;  4JLG A;  3RKW A;  1N9R A;  4B9W A;  4JJN K;  5IHN A;  1NZ9 A;  4M78 G;  3E9F A;  2CZ7 B;  1YJN T;  2L89 A;  4E47 A;  2Y90 A;  3TSZ A;  5KH6 A;  3UA6 A;  3SD4 A;  2WAC A;  4M75 C;  1U06 A;  2HBP A;  1I81 A;  2ZGW A;  2D9T A;  2D8H A;  2W0Z A;  5KYU B;  1Q86 R;  1YJW T;  4C5E A;  4NL3 A;  4M7D F;  2EGA A;  1WQW A;  3REA B;  2CDT A;  1TSF A;  3HFN A;  1U3O A;  2LZ6 B;  3FLG A;  2BZ8 A;  4MDX A;  1UGP B;  1VQ8 A;  1Q81 U;  2XD0 A;  4XU2 A;  4JPB W;  3JRZ A;  1QP3 A;  1R0B G;  5CKE A;  1UHF A;  4XU1 A;  2EJF A;  3OS5 A;  1QVG A;  3L1A A;  2LTO A;  1WLP B;  1AOJ A;  1VQ7 T;  3M9Q A;  2RK2 A;  1PKS A;  1BI0 A;  4C92 D;  4FYV B;  1PD0 A;  2EYY A;  3BDU A;  5DLQ E;  2J6O A;  1AEY A;  2OTL A;  4PJO E;  2NUP A;  1Q7Y R;  1XQH A;  2DD4 A;  1VUB A;  2IG0 A;  2GCX A;  4C8Q F;  3C94 A;  5KCH A;  2CS7 A;  4OB2 B;  3FEO A;  2XMF A;  2DIL A;  1WJQ A;  1HK9 A;  4J6W A;  2E5Q A;  4GBQ A;  4M75 D;  1VQ9 A;  5IN1 A;  4JS5 A;  1AZG B;  2ZAE A;  3CXC S;  3OYM A;  2M02 A;  3O8V A;  4PFP A;  2DJZ A;  2RN8 A;  2XHC A;  4OMM A;  1VQN A;  2K9G A;  1VQK A;  2L3P A;  2DAQ A;  3MJX A;  3GNF B;  1OYX A;  2VVK A;  1Y07 A;  1U8R A;  1JQQ A;  3G7Z A;  2JXB A;  1A0N B;  3OYL A;  1IRE B;  3EGD A;  2DIQ A;  2EYX A;  3CCU Q;  4IUT A;  5FRM A;  2X3W D;  1RAF B;  4CC7 A;  1W4S A;  3DLM A;  1VQL T;  1WDX A;  4QVC A;  3MEU A;  1WIE A;  1B34 B;  4JJC A;  2R5M A;  3CCS T;  2MWP A;  3RMS A;  3HSB A;  1D0Z A;  4C0D C;  5GAN g;  4J5Y A;  3G6E Q;  1TUC A;  4FSX A;  4ZTF A;  4RTU A;  1X6O A;  4DQ2 A;  3H6Z A;  2E6Z A;  1X2K A;  1I0C A;  4HCC A;  2RK1 A;  5KYN A;  1EIF A;  1R77 A;  1WFW A;  1JRI A;  4CC3 A;  2FRY A;  1BB9 A;  4M75 G;  4PJO B;  1VOM A;  3J81 E;  2PU9 B;  4P5N A;  1VQ4 Q;  3EG9 B;  3MP6 A;  1ZSZ B;  4LE9 A;  1WNL A;  3JCM W;  1K1Z A;  4AG1 C;  3EGX A;  2D8J A;  4IKF A;  3CC4 A;  4BAC A;  2KVQ G;  2L0A A;  4DBQ A;  1W70 A;  3N5B B;  2AKK A;  2AIR B;  1TTH B;  4XAX B;  1WZO A;  4HKE A;  3DB4 A;  2K79 A;  1WJS A;  1YIJ Q;  4JRP A;  4K11 A;  3QII A;  3C12 A;  1YIT A;  2DYB A;  1IRX A;  3LLR A;  3CC7 A;  1N27 A;  1UEB A;  1S72 A;  2DFU A;  5CKH A;  4CRI A;  1G8X A;  2PVG B;  4M7A E;  4XTW A;  5IH2 A;  1PG5 B;  1K0X A;  2P0Q A;  5GAN f;  2QTX A;  4A4H A;  1OUL A;  2EQI A;  1LPL A;  2RJC A;  2P0K A;  1D1C A;  3QHS A;  2C0O A;  3EGU A;  2KT8 A;  3EG1 A;  2DL7 A;  3RR6 A;  3UT1 A;  2AT1 B;  2FZC B;  3FJ5 A;  2PUK B;  3CME T;  3UA7 A;  2ZPB B;  1Q82 R;  1ZA1 B;  3OA6 A;  5EC7 A;  2LCC A;  3HKS A;  3VS6 A;  1K9A A;  1H64 1;  2ED1 A;  1MMA A;  5LL6 S;  4KH0 B;  4C92 A;  3HL8 A;  2PNI A;  2HCK A;  2QYZ A;  1KC8 U;  3RIR A;  1AWO A;  4AFS C;  2P4R A;  3QWY A;  1VQ6 T;  3BFM A;  2J05 A;  2LQK A;  4KH1 B;  3DB3 A;  5AT1 B;  2CUB A;  3CCR A;  4HT8 A;  1OX9 A;  1WHG A;  1H8K A;  2DE0 X;  1O9S A;  2FPF A;  4M75 A;  1M1K U;  3EG2 A;  2JW4 A;  2CSI A;  4LXC A;  2L3S A;  3OB9 A;  3V7S A;  2EQU A;  3SDZ A;  3C0C A;  2WSF E;  3MEW A;  3I5S A;  1NG2 A;  1Y57 A;  1W6X A;  3JSC A;  2O31 A;  1ZX6 A;  3MET A;  4FL6 A;  1I07 A;  5GMK i;  3SWN B;  3VS3 A;  1G5V A;  3OBY A;  3HRU A;  4J7I A;  4KRT A;  4FYY B;  4J9C A;  1AD5 A;  4M7A B;  1HSQ A;  3JCM g;  1OPL A;  4EMK C;  1NPR A;  2XG8 D;  3VS1 A;  1R0C B;  4JS4 A;  3A98 A;  2RNA A;  4II1 A;  4DA4 A;  5CIU A;  3TU4 K;  4E7I A;  3QO3 A;  5FU6 B;  2JM9 A;  2OI3 A;  1JXO A;  1WXB A;  1NLP C;  1MHN A;  5C6S A;  4RTY A;  4QVZ A;  4WF2 A;  5D6W A;  3OMG A;  4QKU A;  1C1A A;  4EMG A;  1RAH B;  1I8F A;  5D6Y A;  3FJP A;  2HEQ A;  2MF2 A;  3OYK A;  4ZGE B;  3CD6 T;  5LJ3 g;  3JB9 J;  1UJY A;  4KUD K;  4BB7 A;  1VYT A;  3CCQ A;  4Y91 A;  3M59 A;  2K4Y A;  4WCI A;  2RQU A;  3VS7 A;  1WX6 A;  4O6J A;  3RES A;  3UPU A;  3DLL A;  3NTK A;  4N4G A;  1UGR B;  5L23 A;  4RMO A;  2A36 A;  3EAE A;  4QT7 A;  1QCN A;  1OPK A;  2DL8 A;  1VQM Q;  3OW2 P;  4RG2 A;  4J9B A;  2DO3 A;  1J3T A;  1X27 A;  4BI3 A;  2DBM A;  2F2V A;  1ZBX A;  5GAN 2;  1NEG A;  4PLI A;  1K73 U;  4XQ3 A;  3QUI A;  3LH0 A;  3CCU T;  1HD3 A;  4PFZ A;  1I4K 1;  2EIF A;  1BU1 A;  2EJ9 A;  4ESR A;  1ZQ1 A;  3H0H A;  3CMA Q;  2ROT A;  1YI2 A;  3A5Z B;  4E7L A;  1Q81 R;  4LN2 A;  4KBM B;  1UDL A;  4B9X A;  2XDP A;  4LDW A;  1KD1 C;  1LOJ A;  3EFO B;  4AFU C;  2LQ8 A;  4XTY A;  1W2B S;  2KDS A;  5FW9 A;  3OW2 A;  3I55 A;  1KJW A;  2G3R A;  4VUB A;  1FMW A;  2HNI A;  2F5T X;  3EFR A;  2CT4 A;  4C8Q E;  1KHI A;  1QKW A;  3OYE A;  3GLX A;  4PNO A;  2I2L A;  2RQT A;  2KI7 A;  3PTA A;  3CPW P;  3CCV A;  4GY5 A;  2RHX A;  4M7A F;  2HL3 A;  5DLO A;  4B6M A;  5IT9 E;  2DL4 A;  3D7S B;  4J9F A;  1WJR A;  4ATO A;  2COZ A;  4PJN A;  5I21 A;  2QA4 T;  2D6F A;  1VQ5 T;  4F7U E;  1JO8 A;  4FM4 B;  2I0N A;  4DOW A;  1K9M U;  4R55 A;  4C5G A;  3QG1 A;  2MPX C;  1RLQ C;  2KT1 A;  4XTX A;  5GAN 6;  2YRC A;  1YIJ T;  2QG9 B;  4KT0 E;  4EIK A;  2JTM A;  2XID A;  2GBQ A;  4JDS A;  4OMP A;  3G4S Q;  2X4X A;  4D6W A;  2BZX A;  1GFD A;  1I5O B;  3CPW A;  3V8K A;  3OYD A;  1RAD B;  2K7A A;  4C0F A;  5L8R E;  4NL2 A;  2DEQ A;  3GOX A;  1FWZ A;  4F16 A;  1NM7 A;  1OV3 A;  2QAS A;  3ZL7 C;  5CQX A;  1VQP Q;  3M54 A;  4Q5W A;  1UGQ B;  1AWW A;  4E7K A;  1OU8 A;  4LDX A;  2DLP A;  3I5R A;  2C0I A;  3BE3 A;  1M5Q 1;  2DXT A;  5KCO A;  2DPP B;  3RMQ A;  5GAO l;  5CKD A;  3CC2 A;  3M55 A;  2XIC A;  2KQW A;  4DOV A;  3TEE A;  3PIO A;  2KRO A;  4C8Q B;  2AZV A;  1WHL A;  1FYN A;  1BI1 A;  5FU7 C;  3X26 B;  2CP5 A;  2IPO B;  1KQS P;  1D0X A;  1QVF P;  3PVQ A;  2YDL A;  2E3I A;  1RUW A;  4OF1 A;  2H8H A;  1XNI A;  4M78 E;  3VS5 A;  2JOY A;  3J7A F;  5GMK l;  4FT4 A;  4F7U B;  5ECA A;  3L2Q A;  4ZGJ B;  1YBY A;  3QYG B;  4JUV A;  4GLK A;  1M8V A;  2DVJ A;  3C4S A;  3JCM c;  4M7D A;  2O4X B;  3DKM A;  3PMI A;  3RDV A;  1QVP A;  2L2P A;  4A53 A;  3X25 B;  2DF6 A;  4Z8A A;  1N8R U;  4EMK A;  2EQM A;  4PJO C;  1AVZ C;  2M51 A;  3GPL A;  2LX9 A;  2V26 A;  2HAX A;  1H3H A;  1UUE A;  1KQS A;  1QVF A;  2KBT A;  3OYI A;  4J9I A;  5I11 A;  3CCM A;  3E9G A;  2DD5 A;  1QW1 A;  3L42 A;  1KQ1 A;  3OMC A;  2QK0 A;  2HQE A;  2JM8 A;  5IAY A;  4DEX A;  1D0Y A;  4MML A;  1YHQ T;  5D7U A;  3LH5 A;  5LJ5 d;  3CCL A;  1Z9Z A;  3NGP A;  3ASK A;  2MMP A;  2FEI A;  3RKX A;  1U5S A;  4M77 F;  2E70 A;  3LGL A;  1ABQ A;  1Z9Q A;  1KD1 U;  1AZE A;  5GAN 8;  3CCQ Q;  4E6R A;  1UGV A;  3CCJ Q;  4L5G A;  3JAM E;  5GJV B;  3BDL A;  1FMV A;  1RAC B;  2AHJ B;  1NLO C;  2RQV A;  1IGQ A;  2YRD A;  2CP3 A;  1NYF A;  3VKI A;  5I22 A;  5GAM f;  2LCS A;  2DJQ A;  1QCF A;  4BD3 A;  3JCM P;  1GCQ C;  4OP0 A;  2FO0 A;  2ED0 A;  2AZS A;  3GP8 A;  2RQW A;  4M78 B;  1KC8 C;  1JXM A;  4PJO D;  1VYV A;  3TVT A;  1M1K R;  3INZ A;  5GAO m;  1VQM T;  3V8J A;  1QKX A;  2GFA A;  2EYZ A;  2RJE A;  1T0H A;  2QGF B;  1KSW A;  3G71 Q;  3M0U A;  4E7J A;  3JB9 F;  3ZFJ A;  3VS4 A;  4A54 A;  1TU0 B;  1M1K C;  2OAU A;  4OGC A;  3QZ5 B;  1SF9 A;  4PKC C;  3X20 B;  1YJN A;  2A28 A;  2EKO A;  2RA2 A;  1NJI C;  3JCM V;  3CMA T;  2KR3 A;  1YJW A;  2FPE A;  4L59 A;  2D0Q B;  5A0D A;  2A37 A;  5GMK m;  5FLX E;  4XU3 A;  4F7U F;  2HQX A;  2JTF A;  4JZ3 A;  4JJB A;  4MZT A;  5KYU A;  3JCM b;  1GBR A;  2X3X D;  3EG3 A;  2E65 A;  4M75 E;  2EYW A;  2QDL A;  4A4K A;  3L2U A;  3QDF A;  2HD0 A;  2X4J A;  1M30 A;  5J3B A;  1KQ2 A;  1VQ7 A;  1MUZ A;  2LT4 A;  2QEX Q;  3R6N A;  4RTZ A;  3SWN C;  4OB1 B;  3JB9 I;  1SRM A;  4LDY A;  3CCE Q;  2LQN A;  4C92 G;  1M1F A;  1NYG A;  4PJO G;  5GAM d;  2Z0W A;  1LCK A;  2YLB A;  4HVW A;  5KYW B;  2QQA A;  3M0T A;  1G3Y A;  4ZN3 A;  2DRK A;  3QKJ A;  2RHZ A;  3REB B;  3EH2 A;  5KYX B;  3UF4 A;  4NS5 A;  2JJ9 A;  5FU6 C;  3G4S T;  3S3O A;  4Y92 A;  2RI3 A;  4J6X A;  5J26 A;  2E5K A;  2RQR A;  4EDU A;  2CH4 W;  1M2O A;  1JJ2 P;  1UJ0 A;  1WPY A;  2JZ2 A;  2KRS A;  1D1A A;  1K73 R;  2KNB B;  1VQO Q;  4KGZ B;  1VQP T;  2COY A;  2OTJ Q;  1OZ2 A;  4M78 F;  2CRE A;  1ABO A;  2JS0 A;  3M0R A;  3QPH A;  4QVD A;  1K73 C;  3OS2 A;  2J6K A;  1ZUK A;  2MK5 A;  1O75 A;  4OMN A;  5KE2 A;  2GTJ A;  1WHH A;  4GLM A;  2X51 A;  1VQL A;  2GNC A;  3S3N A;  1MND A;  2ATC B;  1MNE A;  2GQI A;  2M9U A;  3CCS A;  9ATC B;  2LT1 A;  1MMN A;  2LC4 A;  5KYY B;  1JJ2 A;  2HSP A;  1TUG B;  5GAN 3;  4J7F A;  5I2M A;  2YSQ A;  3ME9 A;  4EPC A;  4BI4 A;  1Y96 B;  1B34 A;  2L3R A;  2V8I A;  4AMC A;  1CKB A;  4X9C A;  2DET A;  2DX1 A;  3LW5 E;  1YJ9 Q;  3OBW A;  1D3B B;  2ZPE B;  5GAN 4;  7AT1 B;  2HMA A;  1ZBJ A;  4KGV B;  1X01 A;  4OVA A;  4CC2 A;  2QQS A;  4AFZ C;  1XOV A;  4BUG A;  1BKB A;  4PJO A;  4A63 B;  4J8O A;  4FW2 A;  3QBY A;  2EBP A;  3EG9 A;  2KAF A;  2K2V A;  2KRM A;  3P8B B;  1ZSZ A;  2E3H A;  3QWX X;  2JMA A;  2ENM A;  3I56 Q;  2A7Y A;  5M9O A;  1K9M C;  4MMK A;  5HK3 A;  4N4H A;  1GFC A;  2QDY B;  2KGT A;  2MOX A;  2M16 A;  4J6Y A;  1WA7 A;  4IUR A;  2VKN A;  2YXY A;  2CP2 A;  2O9V A;  2HDA A;  1NJI U;  2ECZ A;  2VWF A;  3CXC P;  4FIB A;  4RKU E;  1W1F A;  1M9S A;  5GAN 5;  2DEU A;  1N5Z A;  2F2W A;  1VQ8 Q;  1PSF A;  1GXI E;  2DIG A;  2QGG A;  4M7D C;  1Q7Y U;  2DXC A;  3NTH A;  1M2V B;  1SHG A;  2MAM A;  3CCJ T;  5LJ5 h;  2RF0 A;  3GF5 A;  2DL3 A;  3CME A;  1GCQ A;  3X24 B;  1K8A U;  1CSK A;  1VYU A;  4FYW B;  3PNW C;  2MWO A;  5GAN d;  3QJ6 A;  3E1S A;  4C92 F;  2VUB A;  2HBW A;  1N6A A;  3LWH A;  4BY6 B;  1FXX A;  1X2Q A;  3T9N A;  2OTL Q;  2GQV A;  2L8D A;  2DTI A;  2BKD N;  2JN0 A;  3THK A;  2GFU A;  1VQ6 A;  5GAO p;  3CXC A;  3FRN A;  4D8K A;  3L2Z A;  4Z88 A;  1IHW A;  5C0M A;  4ELZ C;  2RM4 A;  1UHC A;  2SEM A;  4XU0 A;  2LRQ A;  4J83 A;  3MO8 A;  4HCK A;  1WGS A;  3G71 T;  1YP5 A;  3RNJ A;  4M75 F;  3LGF A;  4ORZ A;  1YJN Q;  2R57 A;  1G3T A;  3U23 A;  1VQ9 Q;  5IXB A;  1BK2 A;  4PK4 A;  1AT1 B;  3FDR A;  5AYF A;  2YUQ A;  2VXE A;  2X4W A;  2E12 A;  1PM3 A;  4C8Q C;  1N8R R;  1FMK A;  2DER A;  1VQN Q;  2XK0 A;  1VQK Q;  2IVW A;  4RCB A;  4M7D D;  1V1C A;  3NMZ C;  1VIF A;  2H3J A;  3OS1 A;  1N8R C;  4M77 E;  4RG8 A;  4WTO B;  2YHT A;  2EYQ A;  1YWO A;  3M4G A;  1QCO A;  3H8Z A;  5GAN e;  2YWW A;  2EW3 A;  3JCM f;  2L3Q A;  3SWN A;  1MMD A;  3SB2 A;  2LCL A;  4BI8 B;  2DTH A;  4M7A A;  3VUB A;  1KD1 R;  3A8M B;  2QEX T;  2XI9 A;  3CCE T;  1ZLM A;  2RHY A;  4X9D A;  3EH1 A;  3WVD B;  1JBM A;  2YUO A;  3OYC A;  3G6E T;  3SHW A;  4IIO A;  1NE8 A;  1S1N A;  1YNZ A;  5CAI A;  2RB6 A;  2ABL A;  3E19 A;  3CD6 A;  2CGH A;  1B7T A;  2IIM A;  4C8Q D;  3JCM X;  5LJ3 f;  1PHT A;  1BYM A;  3EHR A;  1QWF A;  2H3E B;  3OS0 A;  3TCJ A;  3L2R A;  1PCX A;  3KXT A;  3OYJ A;  4YTL A;  2R5A A;  4J9G A;  3ULR B;  2AK5 A;  5CCA A;  3CC4 Q;  1YCY A;  1VQ4 T;  3MPU B;  3EG0 A;  2XDD A;  1M1G A;  2KYB A;  2Y4Y A;  1GRI A;  4M7D G;  2C0T A;  1RAA B;  1KK7 A;  1VQO T;  3GBQ A;  2NUT B;  2NWM A;  3FB9 A;  3M4Y A;  4CI0 C;  5GAO n;  2DZC A;  2OTJ T;  1N9S A;  1UTI A;  1JB0 E;  1YIT Q;  1V76 A;  2M1H A;  3CC7 Q;  1KHC A;  1U1S A;  2D1X A;  2VAS A;  2BE7 D;  1S72 Q;  3X28 B;  3VRZ A;  2RHU A;  2LJ3 A;  2CT3 A;  5GJW B;  3CCU A;  2ZPG B;  4M77 B;  1Q82 U;  1UEC A;  1Y0M A;  4A4E A;  3WXM B;  3RUX A;  3JCM d;  2QI2 A;  3FC3 A;  2DVE A;  2EFI A;  3ZBD A;  3A8G B;  3OSV A;  1MMG A;  1M90 U;  2QQR A;  5IHK A;  2WSE E;  1E6H A;  1YJ9 T;  3EFO A;  1Y7X A;  1SPK A;  4J9H A;  2XDB A;  3I9Q A;  5FWC A;  2EGC A;  1Y71 A;  5LJ3 d;  1EZZ B;  1T3L A;  3OQ5 A;  1SKU B;  1ACM B;  1HXD A;  4RTT A;  3CCR Q;  2QA4 A;  4TVR A;  1VQ5 A;  4HA8 A;  2JTE A;  2Y4X A;  4XTZ A;  3I56 T;  2KSS A;  3PE0 A;  3HRT A;  3HPW A;  4DBH A;  1YIJ A;  3PFS A;  4MDW A;  3VU3 C;  2OAW A;  2CP0 A;  3R6O A;  1BI2 A;  1OZ3 A;  2OX7 A;  4JZ4 A;  4N0A C;  2W10 A;  4F04 B;  1C0M A;  2VGM A;  3OYB A;  1NBE B;  4A4G A;  2FL7 A;  1PD1 A;  2M0Y A;  3L2V A;  1JU5 C;  4BDY A;  2O9S A;  4LDU A;  1VQ8 T;  3AHU A;  4HVU A;  3P8H A;  1UGS B;  3HTR A;  2LX7 A;  2CUD A;  1NPP A;  3TQ7 P;  4ZNX A;  1ZSZ C;  1ARK A;  3WVE B;  3A8H B;  3CQT A;  3I35 A;  4DBF A;  3EFS A;  3HP9 A;  3C95 A;  1RI0 A;  4E7H A;  2DKG A;  1OOT A;  2OTL T;  4XTV A;  2DK3 A;  2J7I A;  1WI7 A;  2DBK A;  5D6X A;  2RD1 A;  2DL5 A;  1OEB A;  3L2W A;  5GAN h;  5GAO q;  2QQB A;  1V29 B;  3A8O B;  4R0K A;  2CKK A;  4HVV A;  4QQ6 A;  1GL5 A;  2B86 A;  3TSW A;  3MEA A;  2QTV A;  2EQJ A;  1W2B P;  4C8Q A;  1VQ9 T;  1G83 A;  4EMH A;  1T0J A;  1KC8 R;  3BY7 A;  4C0Z A;  5CQY A;  4E2F B;  2BE9 B;  3KBG A;  2KRN A;  1ZUU A;  3QXE B;  6AT1 B;  2DRM A;  1VQN T;  1D09 B;  1VQK T;  2PVD B;  1PC0 A;  4C5H A;  2HSE B;  4MZM A;  3EGD B;  4RTV A;  5LJ5 j;  3PIP A;  3VYH B;  1R8O B;  4F7U A;  1EFN A;  3QDR B;  1Q86 C;  1OI1 A;  4A4F A;  1QQJ A;  1UB4 A;  3LYI A;  2O4X A;  2K3Y A;  5HY6 A;  1SRL A;  4ANJ A;  2K3X A;  5I2S A;  2XKO C;  3OYF A;  3PMT A;  3FIF A;  2VXF A;  3NTI A;  1NJI R;  1W2B A;  3CPF A;  1QP2 A;  2FG0 A;  3M53 A;  1NEB A;  1PRL C;  3NPF A;  5FWB A;  1YI2 Q;  3RKY A;  4C92 E;  2PUO B;  2CH4 A;  1YHQ A;  2K57 A;  5LJ5 e;  1PRM C;  2RPN A;  2ZCF B;  2BTT A;  1K8A R;  3GIB A;  1WQ7 A;  3I55 Q;  1B3Q A;  3CD6 Q;  4FSS A;  1TS9 A;  4OB3 B;  3QZ9 B;  1Q7Y C;  5GAN 7;  3CBP A;  2DXU A;  4IIM A;  3V7R A;  4DBR A;  3EGX B;  3CCV Q;  2EKH A;  2MI6 A;  1K8A C;  1IGU A;  2GF7 A;  2DM1 A;  2YUP A;  3JV3 A;  2CP7 A;  3UWN A;  1M3B A;  4X34 A;  1RAI B;  1YN8 A;  5CVI A;  3CC4 T;  1UFF A;  2RHI A;  1GBQ A;  1BIB A;  2CZ0 B;  2K5I A;  2FZK B;  1GCP A;  4M7A C;  1VQM A;  3MEV A;  2ROL A;  1YFN A;  4ELY C;  4RTW A;  5EG2 A;  5FU7 B;  4KGX B;  4M78 A;  1LNX A;  4BE2 A;  4BY6 C;  1YIT T;  2BUD A;  2KEA A;  3CC7 T;  3Q1J A;  4OMF B;  1S72 T;  2V8K A;  2VV5 A;  3CBM A;  1IB8 A;  1MGQ A;  1E7O A;  2HQH A;  3MP1 A;  4QW2 A;  1K4U S;  3VYG A;  4J9E A;  1RL2 A;  2L5Q A;  2EVR A;  4NOY A;  4N4I A;  3CMA A;  1H3Z A;  3A8L B;  5CKB A;  5GAM j;  3QYH B;  2O88 A;  3VV0 A;  2F5K A;  3S6W A;  3OYA A;  5GAO r;  2FVU A;  4PJM A;  2X4Y A;  4C92 B;  2VYT A;  2BIV A;  3JCM h;  2J06 A;  4HXJ A;  2KY9 A;  2ZZD A;  3CC2 Q;  3OSS C;  1HJD A;  4IUP A;  2ZPH B;  2AKL A;  4HCB A;  2QA4 Q;  2EWN A;  2EGE A;  3OW2 S;  1VQ5 Q;  1VA7 A;  2DYI A;  4M7A D;  2B8A A;  3P8D A;  2CZ1 B;  4M75 B;  5GAM e;  2KXC A;  2JUF A;  3CCR T;  4OMQ A;  1K76 A;  4OML A;  5GMK j;  2PVO B;  2X9H A;  3RBB B;  3GNG A;  3M0S A;  4UC4 A;  3LWI A;  5LJ3 h;  4QQD A;  1AHJ B;  2FHD A;  2JS2 A;  1LJO A;  1BCO A;  5KYW A;  3URG A;  5IHI A;  2LMJ A;  3J80 E;  4JRK A;  2MCN A;  4N0A A;  2YT6 A;  2JMC A;  5FRN A;  4ME7 A;  3G4S A;  3M0P A;  4JJD A;  2DTO A;  2MIO A;  3MHX A;  4OB0 B;  1IXD A;  3QSU A;  5KYX A;  2RI5 A;  1I5L A;  1K9M R;  4LNP A;  1M27 C;  5FRO A;  1ZHI A;  1RAG B;  4PFO A;  2HKN A;  2COW A;  3UAT A;  4FCY A;  4PJL A;  1MV3 A;  1Q86 U;  1VQP A;  5GMK e;  2RO0 A;  2F2X A;  4KUI A;  1M8M A;  5HK0 A;  1WXT A;  3CBO A;  4M4Z A;  1BI3 A;  3CPW S;  2QAZ A;  3CCM Q;  5CKF A;  3SEM A;  4OMO A;  2O01 E;  4XK8 E;  2A0F B;  2YRV A;  3MCA B;  1WHK A;  3BW1 A;  3G1J A;  3OYN A;  1PWT A;  3HRS A;  2RH2 A;  1Q82 C;  3CCL Q;  4JRQ A;  4CC4 B;  5CO7 A;  4M7A G;  3MKD A;  2PZ1 A;  3UDC A;  1M90 R;  2X35 A;  2E1H A;  2KE9 A;  2P0P A;  1I1J A;  2A3L A;  3F70 A;  2DXB A;  2A08 A;  1IO6 A;  2RMO A;  3EHQ A;  2JVV A;  4Z89 A;  1EX4 A;  3OY9 A;  2OJ2 A;  4M77 C;  3CCQ T;  5KYY A;  1M90 C;  2LNH B;  3JB9 H;  2V1Q A;  3OYY A;  2E64 A;  1RLP C;  1PNJ A;  1QWE A;  1Y96 A;  1CKA A; 
#chains in the Genus database with same CATH homology
 2QQ9 A;  2RK1 A;  4HCC A;  3M4Y A;  5IAY A;  1EIF A;  4CI0 C;  5GAO n;  5DM7 R;  2DZC A;  4BE0 A;  2OTJ T;  4PJO F;  4Z02 A;  1N9S A;  4MML A;  1JRI A;  5CR2 A;  1JB0 E;  1YHQ T;  3VUZ A;  2FB7 A;  3HHT B;  1D3B A;  4C0G A;  5LJ5 d;  2M1H A;  2ZPF B;  3CCL A;  1KHC A;  1U1S A;  3ASK A;  2MMP A;  4M75 G;  4PJO B;  3RKX A;  4M77 F;  2E70 A;  3LGL A;  3J81 E;  3X28 B;  2RJD A;  2PU9 B;  2RHU A;  1KD1 U;  4LD9 K;  2CYZ B;  4P5N A;  3CCU A;  5GAN 8;  2ZPG B;  3MP6 A;  4M77 B;  1Q82 U;  4OGE A;  1KG1 A;  4C0D B;  4BDZ A;  1WNL A;  4L5G A;  4A4E A;  3WXM B;  3JAM E;  3JCM W;  3RUX A;  3BDL A;  2AHJ B;  2JNG A;  3ER0 A;  3JCM d;  2QI2 A;  3CC4 A;  3FC3 A;  4IKF A;  4ZGD B;  4BAC A;  2KVQ G;  3VKI A;  2QXF A;  1TH7 A;  5GAM f;  5GAN j;  3N5B B;  2DVE A;  2ZPI B;  2EFI A;  4JRI A;  4BD3 A;  3ZBD A;  3JCM P;  3CEY A;  3JCM Q;  4XAX B;  3A8G B;  3FB9 A;  3OSV A;  4OP0 A;  3TRE A;  4HT9 A;  4HKE A;  1YI2 T;  3DB4 A;  1WJS A;  3GP8 A;  1M90 U;  3QJY A;  2QQR A;  4JRP A;  2WSE E;  4M78 B;  2FYK A;  1KC8 C;  1KQS S;  1QVF S;  3QII A;  3C12 A;  4C5I A;  4PJO D;  1YIT A;  1YJ9 T;  3LLR A;  3CC7 A;  3INZ A;  4JLI A;  5GAO m;  1VQM T;  1N27 A;  3V8J A;  1UEB A;  2GFA A;  1S72 A;  1Y7X A;  2RJE A;  3I55 T;  4M77 D;  4PL6 A;  5CKH A;  4CRI A;  2XDB A;  2PVG B;  4E7J A;  4M7A E;  4XTW A;  3JB9 F;  3ZFJ A;  4A54 A;  3CCJ A;  1Y71 A;  5LJ3 d;  2P0Q A;  3OQ5 A;  3OYH A;  5GAN f;  1PSE A;  2QTX A;  2OAU A;  3CCV T;  1M1K C;  3QZ5 B;  1HXD A;  4OGC A;  4A4H A;  2QA4 A;  4TVR A;  2RJC A;  2P0K A;  4PKC C;  3X20 B;  1YJN A;  1VQ5 A;  3QHS A;  4HA8 A;  1IZ6 A;  2Y4X A;  1BIA A;  2EKO A;  2RA2 A;  3M58 A;  3UT1 A;  4XTZ A;  1NJI C;  3JCM V;  3V7C A;  3I56 T;  4L6V 5;  2KSS A;  3CMA T;  2PUK B;  3HRT A;  2CZ6 B;  3CME T;  3HPW A;  1YJW A;  4M7D E;  4V2S A;  4L59 A;  2D0Q B;  2ZPB B;  5A0D A;  4BE1 A;  5GMK m;  5FLX E;  4XU3 A;  1YIJ A;  3OA6 A;  4F7U F;  2HQX A;  2LCC A;  3HKS A;  3PFS A;  2JTF A;  1H64 1;  1VIE A;  2YLC A;  4MDW A;  2WSC E;  2K5F A;  3VU3 C;  5LL6 S;  4MZT A;  1U1T A;  3R6O A;  3RER A;  4C92 A;  2E10 A;  1BI2 A;  3HL8 A;  2E6N A;  1OZ3 A;  4KUL A;  3JCM b;  1QVG S;  3G71 A;  2E65 A;  4M75 E;  1KC8 U;  2VGN A;  4N0A C;  3RIR A;  4A4K A;  2VGM A;  1VQ6 T;  3OYB A;  3JB9 D;  3BFM A;  4ZTJ A;  4A4G A;  3L2U A;  2FL7 A;  2LQK A;  2HD0 A;  5GAM h;  4IUV A;  2X4J A;  3DB3 A;  3L2V A;  5J3B A;  4ZN1 A;  1SSF A;  3CCR A;  4BDY A;  1VQ7 A;  1KQ2 A;  2VC8 A;  4HT8 A;  4LDU A;  2LT4 A;  1VQ8 T;  3AHU A;  3P8H A;  3HFO A;  2EJG A;  3SWN C;  4OB1 B;  3JB9 I;  1UGS B;  4LDY A;  1O9S A;  4C92 G;  1M1K U;  4M75 A;  3JCM J;  1M1F A;  4PJO G;  5GAM d;  1NPP A;  2YLB A;  3OB9 A;  3WVE B;  3A8H B;  3V7S A;  2QQA A;  3EFS A;  2EQU A;  4M77 G;  3HP9 A;  3SDZ A;  2WSF E;  3C95 A;  1Q81 C;  1RI0 A;  4E7H A;  1G3Y A;  2DKG A;  3MEW A;  4ZN3 A;  3QKJ A;  2RHZ A;  2OTL T;  4XTV A;  5LJ5 g;  2DK3 A;  3JSC A;  2E41 A;  4FU6 A;  5D6X A;  2RD1 A;  5A2Q E;  3L2W A;  4NS5 A;  3MET A;  4FL6 A;  4RCC A;  5GAN h;  2QQB A;  5GAO q;  2K5L A;  1V29 B;  5GMK i;  3CC2 T;  2EQK A;  4R56 A;  3SWN B;  4FT2 A;  3A8O B;  3OBY A;  2CKK A;  5FU6 C;  5CK9 A;  3HRU A;  4J7I A;  3G4S T;  1G5V A;  3S3O A;  4M78 C;  2RI3 A;  4J6X A;  4QQ6 A;  5J26 A;  5GMK h;  2C06 A;  4EDU A;  4M7A B;  3MEA A;  2EQJ A;  2RJF A;  3JCM g;  2QEX A;  4O5V A;  4EMK C;  4C8Q A;  1NPR A;  2XG8 D;  1WPY A;  2JZ2 A;  3M56 A;  3VJP A;  1VQ9 T;  3CCE A;  4EMH A;  2LVM A;  3BY7 A;  4C0Z A;  5CQY A;  1VQP T;  4JS4 A;  4DA4 A;  4II1 A;  5J39 A;  3KBG A;  1P92 A;  5CIU A;  3G6E A;  1OZ2 A;  3QXE B;  4M78 F;  3TU4 K;  1VQN T;  4E7I A;  1VQK T;  1FX7 A;  2M0O A;  2PVD B;  3QPH A;  2EAY A;  4C5H A;  4QVD A;  3QO3 A;  5FU6 B;  4M7D B;  3PIP A;  4MZM A;  3JB9 G;  1K73 C;  5LJ5 j;  3OS2 A;  3VYH B;  1R8O B;  4IUQ A;  3V8L A;  3MP8 A;  1MHN A;  4F7U A;  5C6S A;  5KE2 A;  1O75 A;  3QDR B;  4C8Q G;  4QVZ A;  1Q86 C;  4WF2 A;  5D6W A;  3OMG A;  1OI1 A;  5DY9 A;  1UB4 A;  3LYI A;  4A4F A;  3NFC A;  4EMG A;  1I8F A;  1G3W A;  4EMK B;  5D6Y A;  3FJP A;  3OYK A;  2MF2 A;  2O4X A;  2K3Y A;  3PT9 A;  5HY6 A;  3S3N A;  1VQL A;  4ZGE B;  2K3X A;  2KMT A;  1X75 C;  5I2S A;  2XKO C;  5LJ3 g;  3JB9 J;  3CD6 T;  4KUD K;  4BB7 A;  3OYF A;  1VQ4 A;  3PMT A;  2M9U A;  3ZEH A;  3FIF A;  5HKC A;  3CCS A;  2VXF A;  2LT1 A;  3NTI A;  2LNV A;  3CCQ A;  4Y91 A;  1W2B A;  2LC4 A;  3M59 A;  1JJ2 A;  4PLL A;  3OYG A;  2K4Y A;  3CPF A;  1QP2 A;  5GAN 3;  4J7F A;  4O6J A;  5I2M A;  3RES A;  3UPU A;  4HCZ A;  3DLL A;  3ME9 A;  3M53 A;  1VQO A;  2F69 A;  3NTK A;  4N4G A;  4EPC A;  4F7U G;  4BI4 A;  1UGR B;  1Y96 B;  1B34 A;  3RKY A;  4C92 E;  2L3R A;  4MZP A;  4RMO A;  3S3M A;  2PUO B;  2V8I A;  2OTJ A;  5A0L A;  5LJ5 f;  3EAE A;  3PGG A;  1M4Z A;  1YHQ A;  4X9C A;  2K57 A;  3KUF A;  3LW5 E;  3CCM T;  5LJ5 e;  3OBW A;  1D3B B;  1XTD A;  2ZPE B;  5GAN 4;  4M78 D;  2ZCF B;  4OVA A;  1X01 A;  1G3S A;  4RG2 A;  3GIB A;  1WQ7 A;  2DO3 A;  2XU8 A;  4BI3 A;  4LDV A;  4OB3 B;  2QQS A;  3QZ9 B;  1ZBX A;  5GAN 2;  1Q7Y C;  3CCL T;  1XOV A;  4PLI A;  1K73 U;  5GAN 7;  3CBP A;  1BKB A;  4XQ3 A;  4BUG A;  2DXU A;  3QUI A;  4PJO A;  3V7R A;  4J8O A;  5LJ3 j;  3JCM e;  3QBY A;  3LX7 A;  2DZ9 A;  2MI6 A;  3LH0 A;  3CCU T;  2KAF A;  1K8A C;  2K2V A;  2GF7 A;  1YJN T;  2R58 A;  3P8B B;  4M77 A;  1I4K 1;  4XTU A;  2EIF A;  2EJ9 A;  1ZQ1 A;  3UWN A;  4Y28 E;  2V8J A;  4X34 A;  2A7Y A;  5CVI A;  5M9O A;  1K9M C;  3CC4 T;  3SFM A;  3A5Z B;  4MMK A;  5HK3 A;  1YI2 A;  2RHI A;  4N4H A;  5GAM g;  4E7L A;  2QDY B;  2RI2 A;  1BIB A;  2CZ0 B;  2PQW A;  4KBM B;  2K5I A;  4B9X A;  2XDP A;  4LDW A;  2M16 A;  1KD1 C;  4J6Y A;  3M5A A;  1YJ9 A;  1LOJ A;  2KK4 A;  4M7A C;  4IUR A;  2LQ8 A;  4XTY A;  1VQM A;  2KDS A;  1W2B S;  1JJ2 S;  3MEV A;  4ELY C;  3OW2 A;  5EG2 A;  3I55 A;  5FU7 B;  2G3R A;  4VUB A;  1NJI U;  4M78 A;  1LNX A;  2HNI A;  4BE2 A;  2F5T X;  4BY6 C;  3EFR A;  4QQG A;  1YIT T;  4C8Q E;  5LJ3 e;  2LDM A;  1KHI A;  2BUD A;  4FIB A;  4RKU E;  4C92 C;  5A0G A;  3OYE A;  1M9S A;  3GLX A;  3CC7 T;  4PNO A;  4IUU A;  3Q1J A;  2I2L A;  4OMF B;  5GAN 5;  2V8K A;  2VV5 A;  3CBM A;  3PTA A;  3CCV A;  1S72 T;  2P4T A;  1MGQ A;  4GY5 A;  1GXI E;  3MP1 A;  1PSF A;  4QW2 A;  3VYG A;  2DIG A;  2RHX A;  4M7A F;  4LD6 A;  5DLO A;  4M7D C;  1Q7Y U;  1RL2 A;  2L5Q A;  3M57 A;  2NLU A;  2DXC A;  4NOY A;  3NTH A;  2MAM A;  1DJ7 B;  3CCJ T;  5IT9 E;  4N4I A;  3I56 A;  5LJ5 h;  5KE3 A;  1WJR A;  4JLG A;  3RKW A;  1N9R A;  4B9W A;  3CMA A;  4JJN K;  4ATO A;  3GF5 A;  3A8L B;  3CME A;  2QA4 T;  3X24 B;  5I21 A;  1NZ9 A;  5CKB A;  1K8A U;  2D6F A;  4M78 G;  5GAM j;  3E9F A;  2CZ7 B;  2MWO A;  3PNW C;  3QJ6 A;  3QYH B;  4F7U E;  2L89 A;  4E47 A;  5GAN d;  4FM4 B;  3E1S A;  2Y90 A;  4C92 F;  3VV0 A;  5KH6 A;  2VUB A;  2F5K A;  3S6W A;  3OYA A;  5GAO r;  1N6A A;  2FVU A;  4BY6 B;  3SD4 A;  2WAC A;  4M75 C;  4DOW A;  3LWH A;  2HBP A;  1I81 A;  2ZGW A;  2D9T A;  4C5G A;  3QG1 A;  4R55 A;  1U8R A;  1K9M U;  1FXX A;  2X4Y A;  3T9N A;  2GQV A;  4C92 B;  1YJW T;  2VYT A;  2BIV A;  4XTX A;  4C5E A;  2L8D A;  2DTI A;  3JCM h;  5GAN 6;  4NL3 A;  1VQ5 T;  4M7D F;  2BKD N;  1WQW A;  1YIJ T;  2KY9 A;  2JN0 A;  4KT0 E;  2ZZD A;  2JTM A;  2GFU A;  2XID A;  1VQ6 A;  4JDS A;  3OSS C;  5GAO p;  3FRN A;  3HFN A;  3CXC A;  3L2Z A;  4IUP A;  2X4X A;  4ELZ C;  4D6W A;  3FLG A;  5C0M A;  2RM4 A;  4MDX A;  4XU0 A;  2ZPH B;  2LRQ A;  4J83 A;  1UGP B;  3V8K A;  3CPW A;  4HCB A;  3MO8 A;  1WGS A;  3OYD A;  3G71 T;  2EWN A;  1VQ8 A;  1Q81 U;  2XD0 A;  4M75 F;  4XU2 A;  3LGF A;  4C0F A;  3OW2 S;  2R57 A;  1G3T A;  3JRZ A;  5L8R E;  4NL2 A;  1QP3 A;  2DEQ A;  5CKE A;  4M7A D;  2B8A A;  4XU1 A;  2EJF A;  3OS5 A;  3P8D A;  3GOX A;  1FWZ A;  3FDR A;  2CZ1 B;  4M75 B;  5GAM e;  3L1A A;  5AYF A;  1QVG A;  2VXE A;  2LTO A;  2JUF A;  5CQX A;  5GAO l;  2X4W A;  3CCR T;  3M54 A;  4Q5W A;  1VQ7 T;  1UGQ B;  3M9Q A;  2E12 A;  4E7K A;  4C8Q C;  2RK2 A;  5GMK j;  2PVO B;  3GNG A;  4LDX A;  1BI0 A;  4C92 D;  2XK0 A;  3BDU A;  4UC4 A;  3LWI A;  5DLQ E;  4QQD A;  5LJ3 h;  1AHJ B;  2OTL A;  2FHD A;  4PJO E;  2IVW A;  1LJO A;  1M5Q 1;  4RCB A;  3URG A;  2DXT A;  4M7D D;  5KCO A;  3J80 E;  4JRK A;  2DPP B;  1XQH A;  1VIF A;  2DD4 A;  2H3J A;  4N0A A;  3RMQ A;  5CKD A;  1VUB A;  2IG0 A;  3OS1 A;  3M55 A;  1N8R C;  4M77 E;  3CC2 A;  5FRN A;  4RG8 A;  4ME7 A;  3G4S A;  2XIC A;  2KQW A;  2GCX A;  2DTO A;  3MHX A;  2YHT A;  4OB0 B;  4C8Q F;  2EYQ A;  3C94 A;  5KCH A;  2CS7 A;  4DOV A;  4OB2 B;  3QSU A;  3TEE A;  3M4G A;  3FEO A;  2RI5 A;  3PIO A;  1WJQ A;  1HK9 A;  4J6W A;  3H8Z A;  5GAN e;  1I5L A;  2E5Q A;  4C8Q B;  3JCM f;  4M75 D;  5FRO A;  3SWN A;  1ZHI A;  1VQ9 A;  1H3Z A;  3SB2 A;  1BI1 A;  5FU7 C;  5IN1 A;  4JS5 A;  3X26 B;  2LCL A;  4BI8 B;  2DTH A;  1Q86 U;  1VQP A;  3CXC S;  3VUB A;  5GMK e;  3OYM A;  2RO0 A;  4M7A A;  3A8M B;  3O8V A;  2QEX T;  2DJZ A;  4KUI A;  4OF1 A;  2XHC A;  5HK0 A;  1XNI A;  2XI9 A;  3CBO A;  1BI3 A;  4M78 E;  3CPW S;  2JOY A;  1VQN A;  5CKF A;  3CCE T;  1VQK A;  3J7A F;  2RHY A;  2DAQ A;  5GMK l;  4FT4 A;  4X9D A;  2O01 E;  4XK8 E;  3WVD B;  4F7U B;  2YRV A;  3GNF B;  1JBM A;  3L2Q A;  4ZGJ B;  1OYX A;  3MCA B;  1Y07 A;  3OYC A;  1YBY A;  3G6E T;  3BW1 A;  3QYG B;  4JUV A;  3OYN A;  1NE8 A;  4GLK A;  3HRS A;  3G7Z A;  2RH2 A;  1M8V A;  1Q82 C;  5CAI A;  3C4S A;  3JCM c;  1IRE B;  3OYL A;  4JRQ A;  4M7D A;  2O4X B;  2RB6 A;  3DKM A;  3PMI A;  5CO7 A;  1QVP A;  4M7A G;  2DIQ A;  3E19 A;  3CD6 A;  2CGH A;  3JCM X;  4A53 A;  3UDC A;  4C8Q D;  2X35 A;  5LJ3 f;  4IUT A;  1BYM A;  3X25 B;  3OS0 A;  2E1H A;  1N8R U;  5FRM A;  2P0P A;  3TCJ A;  2EQM A;  4EMK A;  2A3L A;  3L2R A;  3F70 A;  1W4S A;  3DLM A;  2DXB A;  4PJO C;  3KXT A;  3GPL A;  2LX9 A;  3OYJ A;  4YTL A;  1VQL T;  2R5A A;  4QVC A;  2JVV A;  3MEU A;  2HAX A;  1KQS A;  1QVF A;  5CCA A;  1YCY A;  1VQ4 T;  1B34 B;  3CCS T;  2R5M A;  2XDD A;  3OY9 A;  1M1G A;  2MWP A;  4M77 C;  3RMS A;  3CCQ T;  3HSB A;  4C0D C;  1M90 C;  5GAN g;  2Y4Y A;  4J5Y A;  3OYI A;  3CCM A;  3JB9 H;  4FSX A;  4ZTF A;  3E9G A;  2DD5 A;  4M7D G;  1X6O A;  1QW1 A;  1VQO T;  3L42 A;  4DQ2 A;  3H6Z A;  2E64 A;  2E6Z A;  1KQ1 A;  3OYY A;  3OMC A;  1Y96 A;  2HQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...