2RB6A

X-ray structure of the protein q8ei81. northeast structural genomics consortium target sor78a
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
57
structure length
57
Chain Sequence
SSQYIMSTKDGKMITSDSKPKLDKTTGMYLYYDEDGREVMIKQEDVTQIIERLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray structure of the protein Q8EI81.
rcsb
source organism Shewanella oneidensis
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 7
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rb6A00
3BY7A 4M75D 2VXFA 4PJOB 1KQ2A 3QO3A 4M77B 5GMKj 5LJ3g 3JB9H 3JB9I 5GAN4 5GANf 5GANd 2YLCA 4Y91A 1LJOA 4C8QD 5LJ5e 4WF2A 2FYKA 2JN0A 4XTWA 1JRIA 3JCMc 3JCMd 4HT8A 4PJOC 4XU3A 4A53A 2E64A 4M7AG 2VC8A 2RD1A 2E10A 4XU1A 2DJZA 2YHTA 3RUXA 4C92F 5I21A 3SWNC 5GMKl 4J5YA 1D3BA 3EFSA 4C8QG 5LJ5j 3RERA 2CGHA 4M75C 1Y96A 2ZGWA 4QVCA 3JB9J 1I81A 4M75A 4C92D 4M75G 5GAMj 1I5LA 4M75F 3HSBA 1X01A 4C8QC 4F7UG 3GIBA 4M77G 4M77F 5GMKe 1BIBA 1WNLA 5GAN7 1KQ1A 3V7RA 2E65A 4C92B 2FB7A 4XTZA 4PJOG 5GMKh 4M78D 3QSUA 2EJ9A 1N9RA 1I4K1 1Y96B 2I2LA 3V7SA 3BFMA 4M78F 1LOJA 2DVEA 2VXEA 3M4GA 5CAIA 3JB9F 5LJ3e 2YLBA 4M7DF 5GAOl 4XQ3A 5GAN6 5GAN5 2Y90A 2EJGA 2DXTA 3QHSA 3JCMh 3JCMV 5GAN2 5GAOq 3BW1A 3JB9D 3JCMe 2E1HA 5GANj 1D3BB 3FB9A 4C8QB 4M7AD 4MMLA 3AHUA 4QVDA 4M7AC 1U1TA 4M7AE 2RM4A 4M7DC 4C92G 2EWNA 4OP0A 5GANg 1JBMA 4EMKC 4N0AA 2DTHA 4M7DD 3V8JA 5LJ3j 4MMKA 4M7DE 4PJOA 1MGQA 4PJOF 4X9DA 1B34B 4F7UE 4NL3A 1H641 3HFNA 2DZCA 1WPYA 4XU0A 3V8KA 4M78B 4C92A 4M75B 4PJOD 4XTYA 4PJOE 3FIFA 1M8VA 4C8QF 4M77E 5GMKi 3RIRA 5DY9A 2DTIA 5GANe 3INZA 5GAOp 3SWNA 4JLIA 5LJ5d 3JCMX 4EMGA 4NL2A 1WQ7A 4JRKA 4JUVA 4XTUA 5GAOm 3RKWA 4M7AA 4RCBA 3RESA 2DKGA 2RA2A 3FJPA 3HFOA 2RB6A 4C8QA 1HK9A 4X9CA 2DEQA 4HA8A 3RKXA 5LJ3h 1LNXA 4M78C 3SB2A 2DXUA 3L2ZA 4NOYA 2EAYA 4M78G 4M78A 1TH7A 1WQWA 4XTXA 4C92C 4EMHA 4EMKB 2DZ9A 4M7DG 4F7UA 4M77A 5GAOr 4M7AF 1I8FA 3QUIA 4DQ2A 5LJ5h 5GAMf 5GAOn 3PGGA 1N9SA 4C92E 5GAMd 4M77D 1BIAA 5GAMg 5LJ5f 1B34A 5GMKm 4M7DA 1HXDA 2E41A 2QTXA 3JCMb 4F7UF 4PNOA 5LJ3d 4EMKA 5LJ3f 4XU2A 5LJ5g 1U1SA 4J6WA 4XTVA 3VU3C 2EJFA 3BDUA 4C8QE 2HNIA 4HT9A 4M77C 4V2SA 4RCCA 2DTOA 4M7AB 3JCMf 5GAN8 3RKYA 3JB9G 3V7CA 5GANh 3SWNB 4J6XA 3JCMQ 3EFRA 3JCMP 3V8LA 3JCMg 2K57A 4M7DB 1YCYA 4A54A 5GAMh 5GAN3 3JCMJ 4F7UB 3L1AA 4JRIA 4J6YA 4N0AC 5GAMe 3JCMW 4M78E 4M75E 1M5Q1
chains in the Genus database with same CATH superfamily
3EG9B 3S3OA 1KQSS 3T9NA 3PVQA 4IUVA 2QDYB 2DNUA 3O5ZA 3EFSA 2DETA 1OZ3A 2M0YA 1D0YA 3OB9A 4KULA 5KE3A 2O88A 1MUZA 2J05A 3M59A 3OYDA 2DIQA 3OYEA 1KQ1A 3WXMB 2AZSA 4J9FA 3RMSA 2YT6A 3TCJA 1MV0B 2Y90A 4IKFA 1D3BB 2F2VA 4LDUA 5IH2A 1VQNA 2A3LA 1R0CB 3HL8A 2EIFA 1CKBA 1BI0A 4X9DA 4NL3A 5CKBA 1VOMA 2RQRA 1RL2A 3X25B 1K9MU 3INZA 2B8AA 3QDFA 2PU9B 1WQ7A 3ULRB 3CMEQ 3E9GA 2QYZA 4OMQA 2RJCA 1UJYA 3CC7A 2K3YA 5FRNA 2A7YA 1GFCA 4OB2B 1U5SA 4JZ4A 1TSFA 3NTIA 4E7JA 2QEXQ 1SPKA 2QI2A 1B34A 3EGXB 4M7DA 2M9UA 5KYXA 5LJ3d 2DFUA 1IGUA 2KK4A 5GJWB 2M51A 1Q7YU 1Z9ZA 4M77C 4V2SA 4RKUE 2DTOA 4CI0C 2IVWA 2YWWA 1NYGA 2QQBA 2JMCA 1D0ZA 1G3WA 2QA4T 3L1AA 1VQ9A 1AWXA 1UECA 3I56A 3L2RA 1QWEA 1YI2T 2CUBA 2R58A 1VQKA 5GANf 4Y91A 1WXTA 2DXCA 2MOXA 3JCMc 2YXYA 1YP5A 2RD1A 1K8AR 5I21A 1MHNA 2COWA 5GMKl 3RERA 3VUBA 2MYSA 2KT1A 2P0PA 1BBZA 3CCJQ 2AK5A 2FB7A 2KDSA 2VASA 1NE8A 3EFOA 2Z0WA 3CBPA 2FPDA 3TREA 1OX9A 3SHWA 2Y4YA 2CZ1B 3I35A 4CC7A 2ROLA 5FROA 1OPLA 2H8HA 3NFCA 3VYHB 2EVRA 2FRYA 4BDYA 2DTHA 1QW1A 3V8JA 1DJ7B 3S3MA 4BDZA 4HVWA 1OYXA 3QPHA 4NS5A 1W70A 4VUBA 3ZEHA 3EH1A 4JLIA 2MF2A 3M57A 4C0DB 5EG2A 1Q81C 2RHZA 1ZHIA 1Q81U 3RKXA 5LJ3h 3SB2A 2FVUA 2DXUA 1PKSA 3S3NA 5DM7R 5AT1B 4B6MA 3PGGA 2KYBA 2P4RA 2DXBA 1UG1A 3NMZC 5D6WA 3C12A 4F7UF 2EW3A 2X9HA 2F69A 3H6ZA 2JS2A 5IHIA 4RCCA 2O4XA 1SRMA 3SWNB 1X6OA 2DF6A 3OYNA 1D1AA 5IHKA 4TVRA 2FRWA 3BDLA 1SG5A 2G3RA 4M78E 5CKHA 1AD5A 1QKWA 3EG0A 3A8OB 1KQ2A 1HJDA 3JB9H 1JJ2A 2YRVA 3DKMA 4MZPA 3LX7A 3CC4A 3OSVA 3CMAQ 1OOTA 1D3BA 4BE0A 1TU0B 4OGCA 1G3SA 4M75G 3CC4Q 3A8MB 1G8XA 2FEIA 3CCVT 4ZNXA 3I55A 1MV3A 5IT9E 2RI5A 2VXEA 2ZCFB 5LJ3e 3JB9D 1BI3A 3JCMV 5KYNA 1GCQC 2FPEA 2GNCA 4E47A 4J9EA 3CPWS 2V1RA 1P92A 3M0SA 2CREA 4J7IA 1K73C 3URGA 3OYCA 1VQMA 3VS3A 2KVQG 2F2WA 4OP0A 3I9QA 1M9SA 3H0IA 2RPNA 2CYZB 4PK4A 2JNGA 2ZPBB 1X75C 2DL3A 3CXCA 4PJOD 3M0TA 4KBMB 4XAXB 1YNZA 4HCBA 3GNFB 1PKTA 2KYMA 4JRKA 4XTUA 3REAB 3RKWA 4L6V5 3MEWA 3MP1A 3EFOB 2JVVA 1FYNA 4M78A 4M7DG 2EQJA 3CCUT 2BKDN 4F7UA 2CDTA 3QJYA 1UTIA 1U3OA 3FEOA 3H9NA 2GTJA 3OMGA 2ZPGB 5CIUA 1WJRA 1BU1A 1U1SA 1VQ4Q 2PZ1A 2CP5A 1FMWA 2C06A 2JTFA 3M54A 5C0MA 1RABB 3EFRA 1GBQA 2XD0A 2JTEA 3ER0A 3JCMJ 2RF0A 3EAEA 3CCEQ 3JV3A 1WXBA 3NPFA 2JJ9A 2K2VA 4JZ3A 5GAN2 1X2QA 2MI6A 2LC4A 1OV3A 2XDPA 2A36A 1YITA 3E9FA 4OB3B 4C8QG 1VQ5A 1Z9QA 1I81A 5GAMj 1I5LA 4M75F 3L2UA 5FLXE 1YHQA 2KXDA 4PL6A 3V7RA 2OI3A 1RACB 4M78D 3GP8A 2M0OA 1VQ7Q 1WIEA 4X1VA 4M78F 5CAIA 2L0AA 1XOVA 4J9IA 5I22A 1UGQB 1QCFA 3MKDA 3EHQA 2MCNA 1I0CA 2CH4W 2VB6A 4IUTA 2JS0A 1WHLA 2DD4A 1PG5B 2RM4A 2XDDA 3FC3A 2XIDA 2MK5A 1VQ8Q 4JJCA 4BACA 2H3JA 4F17A 3LH5A 4N4GA 4RTZA 4F7UE 1H3ZA 1B7TA 2QQAA 4HVUA 4MDXA 2AZVA 3I5RA 4QKUA 1XQHA 1NPRA 3SWNA 4RTTA 3MP6A 2OTLQ 4M4ZA 2YUPA 2BE9B 3MP8A 1K8AU 2QASA 1UHFA 1LCKA 4XTXA 4DBHA 3VKIA 5GAOr 1PNJA 4KRTA 2LDMA 5LL6S 5GAMd 4EPCA 3M0PA 1K9MR 4Z02A 3QYGB 1BI1A 1H92A 2F1LA 1SSHA 4LXCA 2JM8A 1WYXA 2VKNA 2XMFA 1R8OB 4FL6A 1KC8C 3A5ZB 1AWWA 2D8HA 2AHJB 1PRMC 2KBTA 1ZSGA 2JW4A 2ZPEB 2O2OA 1NM7A 2HD0A 1GBRA 4JRIA 4B9WA 2L3PA 4C92F 3QWYA 1KSWA 1GXIE 2RJEA 2L89A 2K3XA 4BB7A 3VRYA 1SSFA 3CCUQ 3CCLA 3C94A 2BZXA 2RK1A 4JRQA 1ZLMA 2ZGWA 4FW2A 3OMCA 1WNLA 2P0QA 1EIFA 2COZA 1BKBA 4PJOG 3HP9A 1I4K1 1NLOC 3M55A 3CCJT 4PJNA 1S72T 5GAN5 4DA4A 3OA6A 1VQ9T 2LTOA 3QZ9B 3M56A 2KAFA 3EGDA 4O5VA 2DIGA 4BE2A 3PFSA 3A8LB 4PLIA 2B86A 3LGLA 4AFQC 1W2BA 1KD1U 3CCQQ 1WPYA 3QKJA 4AT1B 3H41A 2QEXT 2DBMA 1OPKA 4LUDA 2K79A 4FCYA 3E2UA 2DX1A 2X3XD 3CXCP 2EKHA 5HK3A 2OTLT 2RB6A 2HQHA 1H3HA 1NYFA 3PT9A 2RQWA 4C0FA 4M77A 4PFOA 4DQ2A 4E6RA 2QGFB 1WX6A 2V26A 2P0KA 3DLMA 3VYGA 1MMDA 3CC4T 5FU6B 2EJFA 1RAHB 2JMAA 1UDLA 2NUZA 1I1JA 1G5VA 3JB9G 4PFPA 3OYLA 3CD6T 4E7LA 4J6XA 4QW2A 1VQ6T 5GAN3 1M4ZA 1WA7A 4DOWA 1QP3A 3EGUA 2SEMA 3PTAA 3J80E 2L8DA 4ZN1A 4WF2A 3JCMd 1JRIA 1HYOA 1RAIB 1K9AA 5CK9A 2E64A 2DMOA 2OAUA 2VC8A 1VQPQ 2EGCA 3G4SA 1VYTA 2X3WD 4JS5A 4C0DC 4M75C 5DLQE 3PMTA 1MMNA 4OMPA 2VGNA 3CCSQ 1XJWB 2COYA 2EFIA 3U23A 5IAYA 1RAEB 1QQJA 3V7SA 2OAWA 4XQ3A 2CP2A 1ABOA 1YJNT 3VS7A 4BI4A 4FYWB 4C8QB 3OW2P 1KIKA 4OVAA 4QVDA 1UGRB 3CC7Q 4M7AE 1YN8A 1X43A 5GANg 1RI9A 2RHUA 3NHNA 4C5GA 4MMKA 3CC2A 2MAMA 3CCLQ 3CCUA 4Y28E 2OTJT 2M1HA 4OMOA 5GMKi 3RIRA 4E7IA 4CC2A 1K0XA 4HCZA 2F5TX 3RESA 4CC3A 1IZ6A 2KSSA 1RAGB 1RLPC 2NUTA 1TUCA 2L3QA 4HA8A 1Y7XA 4QQGA 3REBB 1R0BG 4OB0B 1YIJA 4ATOA 4Z8AA 1M3CA 2X35A 1M2VB 2CT3A 4ZTJA 2E6NA 2CH4A 4AFZC 2WSFE 2BZYA 1V29B 1WHMA 4FT4A 1XNIA 4LD9K 2LQ8A 5FU7B 4HT9A 2HCKA 4KH0B 3UATA 4FYXB 1Q7YR 2KMTA 2HKNA 4C5HA 2GBQA 2X51A 4RG8A 1GFDA 4F7UB 1PC0A 2QK0A 1M1FA 2ESWA 3HHTB 4FYYB 3EG1A 1KD1C 3OYFA 5J26A 1N8RC 1FMKA 2CZ7B 2MWPA 4M7AG 2RO0A 2DAQA 2YHTA 1AVZC 3PE0A 1Q82R 4JJNK 4C92D 3GF5A 5C6SA 5HKCA 3OS2A 1YHQQ 3HSBA 4C8QC 3UDCA 2CSQA 3META 2QEXA 4XTZA 3L2VA 1N9RA 2EJ9A 4M7DF 1QVPA 2YLBA 1YJNQ 5GAN6 2EJGA 2DXTA 3N5BB 2YRCA 2A08A 1LPLA 4FIBA 3P8BB 3FB9A 3MEUA 5KYXB 2R57A 2HBWA 2IG0A 3G6ET 2EWNA 3EG3A 1BI2A 2CZ6B 4EMKC 1G3YA 4M7DE 3OYAA 4R0KA 4IUQA 1VQPT 1Q7YC 2K9GA 2J6OA 5HY6A 2A28A 4N4HA 2HZYA 4RUGA 3JCMX 4K11A 4NL2A 1Q82U 5D7UA 3VJPA 1WHGA 4AMCA 1QP2A 3VS0A 1D09B 3QUIA 1QCNA 2QQRA 1VQPA 1ZBXA 2IIMA 4JJBA 3LYIA 5LJ5f 1NLPC 5KCHA 3ZL7C 3JCMb 3CCET 1JEGA 4F16A 4J9BA 1KQSA 2CSIA 4Q5WA 4GY5A 2QQSA 1X27A 5FWBA 4LUEA 3CCRQ 4LE9A 2HKQB 2RHYA 4PJLA 2QXFA 5GMKj 1J3TA 5GAN4 4ESRA 1K4US 2NWMA 4XTWA 2A37A 3M0QA 2XHCA 2F2XA 9ATCB 3M4YA 1N5ZA 2YSQA 3I55Q 3CCQT 5LJ5j 3EG9A 5FW9A 4BY6C 2EYWA 5A0LA 1WJSA 1YWPA 1B3QA 3SDZA 1RAFB 2LNVA 2GQVA 4J83A 4MDWA 2A0FB 2QGGA 1TUGB 1Y96B 3VS1A 1UGSB 1M1KC 4D6WA 5GAOl 2EPDA 3OW2S 5EC7A 2EYXA 1YJ9A 3JCMe 1VQOA 2E1HA 5GANj 2OTLA 1YITQ 4L59A 3G71Q 4N0AA 3MHXA 3CC2Q 4J9DA 1IRXA 3VUZA 4M78B 2CP0A 3FIFA 2W0ZA 2PTKA 1YJWT 4IURA 4KH1B 3CCVQ 1EZZB 2JM9A 1ZUKA 2C0OA 3CMET 1AHJB 2FG0A 3CD6A 2VUBA 2K3BA 2GFUA 4IUUA 3F70A 4J9GA 2CZ0B 1IXDA 3LLRA 2ED1A 3CXCS 3WVEB 4EMKA 1M1GA 4XU2A 2L3SA 3OYYA 3VU3C 1OULA 1T3LA 2HBPA 4BUGA 5I2MA 4M7AB 3JCMf 5CR2A 2ABLA 2DD5A 3AT1B 1ZSZA 5KYUB 1SRLA 3C4SA 1AEYA 1AOJA 1M90U 2V8KA 3KBGA 2E5QA 3PMIA 4L5GA 2CUDA 1SKUB 4OMMA 2DEUA 1JQQA 4M77B 2VYTA 5CQYA 2LJ1A 5LJ5e 2PUKB 2JN0A 1W4SA 3CPFA 2DK3A 2I0NA 4J7FA 1W6XA 2LT4A 1PSFA 1E7OA 2DYBA 1VIEA 3GOXA 2CGHA 1GCPA 3VS2A 2LX9A 2O9VA 4A4KA 2L2PA 2KNBB 2HEQA 3MCAB 3G6EQ 4IIOA 3R6NA 4RTUA 3JRZA 1ZUYA 4EIKA 3OYJA 4E7ZA 2CT4A 1Q82C 1TTHB 2J6FA 3P8HA 2KT8A 1I07A 3TVTA 4FW1A 5IHNA 1M3AA 3I56Q 2RI2A 3NTKA 1BCOA 2ZAEA 1QKXA 4M7DD 5ECAA 3GPLA 4KUIA 1H641 2AIRB 4GLKA 4XU0A 1CKAA 1IB8A 1G3TA 4R56A 2LX7A 1K8AC 1M8VA 1KC8R 3L2QA 1OQKA 4LD6A 1N27A 2DTIA 5GANe 2XDBA 1QMCA 3OY9A 4DBQA 1VQ9Q 1WHHA 1VQLQ 4RMOA 4C5EA 1PCXA 3M58A 4OMFB 4E7HA 2PVOB 4M78C 2XICA 4C92E 4M77D 4JJDA 5GMKm 3QZ5B 3GBQA 1X2KA 3GNGA 2GTOA 4PNOA 3Q1JA 2R5MA 1NJIU 2D1XA 5J39A 1F1BB 3RMQA 1VQ5Q 1S72Q 1MNEA 2OTJQ 2SRCA 1ARKA 3UF4A 2LMJA 4M7DB 1KQSP 1SF9A 1WLPB 5GAMe 2EYQA 2K5FA 1T3SA 3BY7A 2VXFA 3RR6A 1TWBA 2C0TA 3DB3A 2YLCA 1IREB 3MJXA 4PJOC 4XU1A 7AT1B 4QT7A 4XK8E 1BK2A 1VQ4A 2E12A 4M77G 1VQLT 2KROA 1B07A 1KJWA 3A1PA 4M7AC 1EFNA 2ECZA 3OBYA 2DL5A 1PSEA 3M4GA 2BIVA 3HRUA 1ZSZC 4LNPA 1BB9A 5KYWA 3PNWC 4GBQA 2RJDA 2E6ZA 2C0IA 2E4HA 3S6WA 3HRTA 1D0XA 3RNJA 1M2OA 2E70A 3ME9A 3CD6Q 3NTHA 1Q86R 4XTYA 3OS0A 3CMAT 2F5KA 5DY9A 2KEAA 1Y71A 5GAOp 5KYWB 5LJ5d 3UT1A 3WVDB 1W2BP 4PFZA 4RTWA 4RCBA 2J7IA 1VQMT 1YFNA 1BYMA 4IUPA 3HPWA 3VRZA 1OX8A 1NJIC 3GLXA 4M7AF 1I8FA 3SD4A 3I56T 3CMAA 4J8OA 1YBYA 2QTXA 1OU9A 3R6OA 3SFMA 5I11A 4FT2A 2EKOA 1VQ8A 4BY6B 1O75A 2K57A 2NUPB 1UEBA 1FX7A 2DL7A 1MMGA 1RAAB 2DL8A 3TSWA 3CCRA 3QO3A 5LJ3g 5GANd 2GQIA 2VV5A 1NEBA 5HK0A 2HDAA 3RUXA 3CCEA 4A4EA 4R55A 4OF1A 4LDVA 1BCMA 2K5IA 4BI8B 3GIBA 2CS7A 4M77F 2EGAA 1ACMB 4RTVA 2AT1B 2YDLA 4ME7A 2QA4Q 1M90R 1SEMA 1NEGA 1YI2Q 1U1TA 4LDXA 2FZGB 3TQ7P 2RK2A 3VS4A 1RUWA 3D7SB 1WXUA 3CCLT 5LJ3j 4PJOA 2AKLA 2ZPFB 2LZ6B 4IIMA 3E19A 4BD3A 2DZCA 3HTRA 1K73U 3I5SA 2GGRA 3EG2A 1GL5A 2YUQA 4M77E 1WGSA 3PIPA 2D6FA 1NG2A 1JJ2S 4M7AA 3CCJA 2D9TA 1HK9A 3LH0A 1YJ9T 3X28B 2L5QA 5CKFA 2OTJA 4C92C 4YTLA 3MO8A 4EMKB 2LRQA 1ABQA 1TS9A 1QVFA 3LWIA 1A0NB 2FL7A 2KI7A 1N8RR 5LJ5h 5GAMf 2LJ0A 3TEEA 1X6BA 4X34A 2KE9A 2P4TA 1K0SA 1ZX6A 5GJVB 3QG1A 4C0ZA 1IHVA 3PIOA 3MEVA 4XTVA 1EX4A 2DM1A 1YWOA 2LJ3A 2ED0A 2O01E 3ZBDA 3JCMQ 3PVLA 3L2WA 1Y07A 3JAME 2RQVA 1JXMA 2ZPIB 4HVVA 4PLLA 4PJOB 3OBWA 1YCSB 1LJOA 1QVFS 2E5KA 2ENMA 2CKKA 2MMPA 2ZPHB 2XU8A 2DJZA 2QDLA 3SWNC 1D1CA 6AT1B 1OEBA 1X01A 5L8RE 1AWOA 2LP5A 2ROTA 5GAN7 4C0GA 3JSCA 2E65A 1PHTA 1M2VA 2W10A 2DRKA 4RTYA 4AG1C 1AZEA 2I2LA 2GFAA 1LOJA 1D1BA 1ZQ1A 2XG8D 3EHRA 5CCAA 3JCMh 3QHSA 4GLMA 1IO6A 4AG2C 3BW1A 1RLQC 1FWZA 4QQ6A 3A98A 3SEMA 1JO8A 3CCST 2DERA 3QWXX 2X4YA 2PUOB 1VQ7T 4Y92A 5CVIA 3VV0A 1UJ0A 4PKCC 1YJNA 3CCVA 2MIOA 2YUOA 3CCMT 5J3BA 2KR3A 1WJQA 4UC4A 1LVKA 3M0UA 1I5OB 2HMAA 2DE0X 2BTTA 4NOYA 4EMHA 3CCSA 1UGPB 2D0NA 1KK7A 3FLGA 4J9HA 4KGXB 5CQXA 1QVGA 1BIAA 2NYSA 2LQNA 1RADB 5FU7C 1WZOA 5IXFA 1K76A 2EBPA 2DO3A 2EQMA 1VUBA 1GRIA 3UPUA 3UA6A 3OYIA 1TUDA 2E3HA 1VQ4T 1VQLA 4ORZA 1VQMQ 1YHQT 1VQ5T 5A0GA 2FZCB 1YITT 4JLGA 3JCMg 3BE3A 4BI3A 3EGXA 4A54A 1KHCA 2VGMA 1M5Q1 3OYGA 2X4XA 3JB9I 1YJ9Q 1JU5C 3CBOA 1WDXA 1M27C 1M3BA 2CP3A 1Q95G 1PD1A 2KQWA 2K5LA 3LWHA 2PVDB 4HCCA 3JB9J 4QVZA 2JT4A 1VIFA 1RI0A 1VQNT 4FSSA 1KD1R 1G83A 8ATCB 4OMLA 1K73R 1NPPA 1PRLC 2O4XB 3TU4K 3CMEA 1GCQA 2VVKA 4DBFA 4MMLA 2JTMA 2KRSA 2E3IA 3QBYA 5IN1A 2DJQA 2CP6A 1JBMA 2PVGB 3CC7T 5A0DA 1MGQA 3MPUB 4EDUA 2RHXA 4M75B 1ZSZB 1NZ9A 4FYVB 1ZUUA 1HSQA 3VS6A 1YIJQ 4EMGA 4JUVA 3UWNA 1CSKA 3DB4A 2XI9A 2WACA 4FU6A 4M78G 2MWOA 4AFUC 1QVFP 2V8JA 2BUDA 2QTVA 1W1FA 3G4SQ 4HKEA 1YI2A 3A8HB 2K6DA 1JB0E 1HXDA 3LGFA 2DPPB 2QA4A 3KUFA 5D6XA 1UB4A 4E7KA 2BE7D 2NUTB 1VA7A 3P8DA 1Y57A 2AKKA 3G1JA 3G71A 5GAN8 3OYKA 2KGTA 2H3EB 2JZ2A 3V7CA 2WSEE 2V1QA 3FRNA 4JDSA 2EYZA 4OMNA 1WHJA 2MPXC 4J6YA 5KE2A 1AT1B 4M75D 1QLYA 2WSCE 3TSZA 4ELYC 1ZA1B 1KG1A 2VWFA 1PM3A 3J7AF 1M8MA 3FJ5A 2E10A 2XKOC 2EGEA 4LDWA 2YRDA 1VQ6Q 1Y96A 1IGQA 4QVCA 1VQ8T 3OYMA 2DYIA 2LNHB 3RDVA 3CEYA 4RTXA 2HL3A 4KGVB 3QSUA 4ZGEB 4D8DA 4C5IA 4BE1A 3E1SA 3OYHA 3DLLA 1YJWQ 2KXCA 5CKDA 2XK0A 4QQDA 3CCMA 1SHFA 1MMAA 1C6VX 1UFFA 4WCIA 3CCQA 4M7AD 3AHUA 1QVGP 2LCCA 4C92G 1V76A 1M90C 3QXEB 1XTDA 5HCKA 2KRMA 2RHIA 4JPBW 4A63B 2LVMA 2GF7A 5D6YA 1B34B 5KCOA 5KYYA 1UGVA 4PJOE 3CQTA 2BZ8A 1YIJT 3NGPA 4PJJA 4DEYA 8AT1B 2LCLA 1M1KU 3MEAA 3G6EA 2QG9B 2DKGA 1PWTA 1KHIA 3L2ZA 1TH7A 1WQWA 2JXBA 3C0CA 2O31A 2DZ9A 2L3RA 1E6GA 2RI3A 2RN8A 2EYYA 1UHCA 5FWCA 2X4WA 3CC2T 4AFSC 2RNAA 2P84A 1WHKA 1FXXA 3M0RA 2E41A 1VQ6A 5FU6C 4J9CA 1T0HA 2DILA 4P5NA 3M5AA 2RQUA 3CBMA 4A4FA 2IPOB 3LW5E 4LDYA 3V8LA 4RG2A 1HD3A 5I2SA 2RQTA 3OSSC 2EQKA 1U8RA 3KXTA 2OJ2A 3RBBB 2DBKA 4C8QD 2FYKA 4HT8A 3IQLA 3I55T 4A53A 1Q86C 4KUDK 3X24B 4F04B 1KC8U 1OU8A 4Z89A 4WTOB 2DRMA 3EGDB 2HQXA 5KYYB 1QWFA 2JOYA 2NLUA 4F7UG 1VYVA 2YUNA 1QCOA 5GMKe 1BIBA 2K2MA 3X20B 3M53A 4C92B 5GMKh 4F14A 1C0MA 2HAXA 4ZGJB 3H0HA 2Y4XA 3JB9F 2DVEA 5M9OA 1V1CA 1C1AA 5GAOq 3CCRT 2DL4A 1ZA2B 4A4GA 1X6GA 2KRNA 3VS5A 1K1ZA 3ASKA 2HL5C 2G6FX 4CRIA 3H8ZA 4DOVA 2CP7A 2M02A 1JJ2P 1OI1A 3KFVA 4PJOF 5CKEA 1NBEB 3HFNA 5CO7A 3J81E 1VQOT 4C92A 2LT1A 3A8GB 2K4YA 2O9SA 1H8KA 2GCXA 4O6JA 1WFWA 3CCMQ 4OB1B 5DLOA 1UE9A 1UUEA 3FJPA 4C8QA 1JXOA 4X9CA 2DEQA 1WI7A 5A2QE 3X26B 1LNXA 4CC4B 4ZGDB 2EAYA 2HQEA 2DA9A 1M1KR 4ZN3A 1VQOQ 3QDRB 1YJWA 2K7AA 1VQ7A 1M30A 1VQKQ 3C95A 3EH2A 5LJ5g 4J6WA 2QAZA 1AWJA 3OQ5A 1TOVA 4N4IA 3RKYA 4ELZC 3G4ST 4OGEA 5GANh 3CPWP 3OS5A 3JCMP 4DBRA 1S1NA 4N0AC 1MNDA 1O9SA 1QVGS 2D8JA 4M75E 1AZGB 4LN2A 5AYFA 3OS1A 4A4HA 2D0QB 4MZMA 2DLPA 3THKA 2X4JA 4XU3A 3OW2A 2FZKB 2LCSA 1K9MC 1S72A 4J5YA 4DEXA 1TXQA 1Q86U 2V8IA 4M75A 2FO0A 4D8KA 2M16A 1VQNQ 2FPFA 1KFZA 5L23A 5KYUA 4E7SA 2JUFA 3BFMA 4FSXA 2OX7A 3HKSA 2RJFA 2J6KA 1IHWA 3L42A 1FMVA 3QJ6A 4ANJA 4M7DC 2LQKA 4II1A 4JS4A 4PJMA 4KT0E 4MZTA 1T0JA 2ZZDA 1W2BS 3FDRA 4HXJA 2ATCB 1Q81R 3V8KA 2PNIA 2QQ9A 1U06A 4C8QF 2J06A 2RMOA 1G2BA 5KH6A 3CPWA 2EQIA 2LQWA 1N8RU 4E2FB 1PD0A 1Y0MA 5GAOm 3G71T 1VYUA 3HRSA 2RA2A 3HFOA 2HSEB 1X69A 4ZTFA 1TG0A 5GAOn 1N9SA 4KGZB 5GAMg 3M9QA 2NUPA 2PQWA 3QIIA 1R77A 4FM4B 5LJ3f 4HCKA 5FRMA 1VQKT 1NJIR 3QYHB 3BDUA 4C8QE 2HNIA 2R5AA 1OZ2A 2FHDA 3G7ZA 2EQUA 1N6AA 3O8VA 4B9XA 4JRPA 2RH2A 2KY9A 5IXBA 1ZBJA 2HSPA 4Z88A 3H0FA 3UA7A 1E6HA 3OYBA 1YCYA 5GAMh 3ZFJA 3JCMW 2DVJA 1SHGA
chains in the Genus database with same CATH topology
4M77B 2VYTA 3OYGA 1GXIE 2RJEA 5CQYA 3S3OA 2X4XA 3JB9I 2L89A 1KQSS 2K3XA 2PUKB 5LJ5e 3T9NA 2JN0A 1W4SA 4IUVA 3CBOA 3CPFA 2DK3A 2QDYB 4BB7A 1SSFA 3CCLA 4J7FA 3C94A 2KQWA 2LT4A 2RK1A 1PSFA 2OTJA 2K5LA 1VIEA 4JRQA 3LWHA 3EFSA 1OZ3A 3GOXA 2CGHA 2PVDB 4HCCA 2LX9A 2ZGWA 4QVZA 3OB9A 4KULA 5KE3A 1VIFA 4A4KA 3JB9J 1RI0A 3M59A 1VQNT 3OMCA 3OYDA 2DIQA 1WNLA 2P0QA 3MCAB 1EIFA 3OYEA 1BKBA 1KQ1A 3WXMB 3JRZA 4PJOG 3HP9A 1I4K1 3RMSA 1NPPA 3M55A 3TCJA 3OYJA 3CCJT 1Q82C 1S72T 5GAN5 2Y90A 4DA4A 3OA6A 1VQ9T 2LTOA 3QZ9B 3M56A 3P8HA 4IKFA 2O4XB 2KAFA 4O5VA 3CMEA 3TU4K 2DIGA 1D3BB 4LDUA 4BE2A 1VQNA 2A3LA 4MMLA 2JTMA 3PFSA 3A8LB 3QBYA 5IN1A 4PLIA 2RI2A 3NTKA 1JBMA 2PVGB 3HL8A 3LGLA 3CC7T 2EIFA 1W2BA 4M7DD 5A0DA 1MGQA 3GPLA 4KUIA 1KD1U 1BI0A 4X9DA 4EDUA 4NL3A 1H641 5CKBA 1WPYA 2RHXA 3QKJA 4GLKA 1G3TA 4M75B 4XU0A 2QEXT 4R56A 1RL2A 1NZ9A 1K8AC 1M8VA 3X25B 1K9MU 3L2QA 4LD6A 1N27A 2DTIA 5GANe 3INZA 2XDBA 3OY9A 2B8AA 4EMGA 2PU9B 1WQ7A 4JUVA 3UWNA 4RMOA 4C5EA 3E9GA 5HK3A 2OTLT 2RB6A 2RJCA 3M58A 3DB4A 4OMFB 3CC7A 4E7HA 2XI9A 2PVOB 2WACA 3PT9A 4M78C 2K3YA 4FU6A 4M78G 5FRNA 2A7YA 2MWOA 2V8JA 4OB2B 4C0FA 3NTIA 4M77A 4E7JA 2BUDA 2XICA 4DQ2A 4C92E 4HKEA 4M77D 1YI2A 2P0KA 3A8HB 2QI2A 1B34A 3DLMA 1JB0E 3QZ5B 5GMKm 4M7DA 1HXDA 3VYGA 2M9UA 3LGFA 2DPPB 3GNGA 2QA4A 4PNOA 3Q1JA 5LJ3d 3CC4T 2KK4A 3KUFA 5D6XA 5FU6B 2R5MA 1UB4A 4E7KA 1NJIU 2EJFA 5J39A 3RMQA 1Q7YU 3P8DA 1G5VA 4M77C 4V2SA 4RKUE 2DTOA 3G71A 3JB9G 4CI0C 5GAN8 3OYKA 2JZ2A 2IVWA 3OYLA 3V7CA 3CD6T 2WSEE 4E7LA 2QQBA 4J6XA 1G3WA 3FRNA 4QW2A 1VQ6T 4JDSA 4M7DB 5GAN3 2QA4T 1M4ZA 3L1AA 1VQ9A 4J6YA 5GAMe 4DOWA 2EYQA 2K5FA 1QP3A 5KE2A 3I56A 3L2RA 3BY7A 4M75D 2VXFA 2L8DA 2WSCE 3J80E 3PTAA 4ELYC 1YI2T 2R58A 3DB3A 1VQKA 3HSBA 1KG1A 5GANf 2YLCA 4Y91A 4ZN1A 4WF2A 2DXCA 3JCMc 3JCMd 1JRIA 3J7AF 1IREB 4PJOC 5CK9A 2E64A 2OAUA 2VC8A 2RD1A 2E10A 4XU1A 1MHNA 5I21A 3G4SA 2XKOC 5GMKl 3RERA 4LDWA 4JS5A 4C0DC 4M75C 1Y96A 5DLQE 4QVCA 1VQ8T 4XK8E 3OYMA 3VUBA 1VQLA 3PMTA 3CEYA 1VQ4A 2E12A 4M77G 2P0PA 2VGNA 1VQLT 2EFIA 5IAYA 3QSUA 4ZGEB 4M7AC 2FB7A 3OBYA 4C5IA 2KDSA 4BE1A 3E1SA 3OYHA 3DLLA 1PSEA 3V7SA 5CKDA 3M4GA 1NE8A 2BIVA 2XK0A 3HRUA 4QQDA 3CCMA 4XQ3A 1YJNT 3CBPA 3TREA 4BI4A 2Y4YA 2CZ1B 4C8QB 3CCQA 3PNWC 5FROA 4M7AD 3AHUA 4OVAA 4QVDA 1UGRB 4M7AE 3NFCA 2RJDA 2LCCA 2E6ZA 3VYHB 4C92G 1M90C 4M7DG 4BDYA 3QXEB 5GANg 3S6WA 2RHUA 1XTDA 3HRTA 2DTHA 1QW1A 3V8JA 1DJ7B 2E70A 2RHIA 3ME9A 4C5GA 4MMKA 3CC2A 3S3MA 2LVMA 2MAMA 2GF7A 5D6YA 1B34B 3CCUA 4BDZA 5KCOA 4Y28E 2OTJT 1OYXA 2M1HA 3NTHA 3QPHA 4XTYA 3OS0A 3CMAT 4NS5A 2F5KA 4PJOE 5GMKi 4VUBA 3RIRA 5DY9A 4E7IA 1YIJT 3ZEHA 1Y71A 5GAOp 4HCZA 5LJ5d 4JLIA 3UT1A 3WVDB 2LCLA 2MF2A 3M57A 4C0DB 1M1KU 3MEAA 4RCBA 2F5TX 5EG2A 3RESA 3G6EA 1IZ6A 2DKGA 2KSSA 1VQMT 2RHZA 1Q81C 1KHIA 1ZHIA 4IUPA 1Q81U 1BYMA 4HA8A 3RKXA 5LJ3h 3HPWA 2FVUA 3SB2A 2DXUA 3L2ZA 3S3NA 1TH7A 1WQWA 1Y7XA 5DM7R 2DZ9A 2L3RA 4QQGA 1NJIC 2RI3A 3GLXA 4M7AF 1I8FA 4OB0B 3SD4A 1YIJA 3I56T 4ATOA 3PGGA 3CMAA 4J8OA 2DXBA 2X35A 2X4WA 4ZTJA 3CC2T 2E6NA 1FXXA 5D6WA 1YBYA 2E41A 2QTXA 3C12A 1VQ6A 5FU6C 3R6OA 4F7UF 2F69A 3H6ZA 2WSFE 1V29B 4FT4A 1XNIA 4LD9K 2LQ8A 5FU7B 4P5NA 4HT9A 3SFMA 4RCCA 3M5AA 3CBMA 2KMTA 2O4XA 3SWNB 1X6OA 4A4FA 4C5HA 4FT2A 3OYNA 2EKOA 3LW5E 1VQ8A 4LDYA 3V8LA 4BY6B 1O75A 2K57A 4RG2A 4RG8A 4TVRA 1UEBA 4F7UB 5I2SA 1FX7A 3BDLA 3OSSC 2G3RA 1M1FA 4M78E 2EQKA 1U8RA 5CKHA 3KXTA 3A8OB 3HHTB 3CCRA 1KQ2A 3QO3A 5LJ3g 3JB9H 1JJ2A 2YRVA 3DKMA 4C8QD 5GANd 3OYFA 1KD1C 2FYKA 2VV5A 4MZPA 5J26A 1N8RC 5HK0A 4HT8A 3LX7A 3I55T 3CC4A 2CZ7B 3OSVA 2MWPA 4A53A 4M7AG 1Q86C 2RO0A 4KUDK 2DAQA 2YHTA 3RUXA 3X24B 3CCEA 4A4EA 1KC8U 1D3BA 4BE0A 4OGCA 4R55A 4OF1A 4JJNK 1G3SA 2HQXA 4C92D 2JOYA 4M75G 3GF5A 4LDVA 5C6SA 2K5IA 2NLUA 4BI8B 4C8QC 4F7UG 5HKCA 3OS2A 3GIBA 2CS7A 3A8MB 4M77F 3UDCA 3META 1BIBA 3X20B 5GMKe 3CCVT 2QEXA 3M53A 4C92B 5GMKh 4XTZA 3L2VA 1K73U 3I55A 1N9RA 2EJ9A 5IT9E 2HAXA 4ZGJB 2RI5A 2Y4XA 3JB9F 2DVEA 2VXEA 2ZCFB 5M9OA 1QVPA 5LJ3e 2YLBA 4M7DF 4ME7A 5GAN6 5GAOq 2EJGA 2DXTA 1BI3A 3N5BB 3JCMV 3CCRT 3JB9D 4FIBA 3P8BB 3FB9A 4A4GA 4E47A 3CPWS 1P92A 3MEUA 4J7IA 1U1TA 2R57A 3ASKA 1K73C 2IG0A 4LDXA 3URGA 3OYCA 4CRIA 3G6ET 1VQMA 2RK2A 2KVQG 3H8ZA 4DOVA 2EWNA 4OP0A 3CCLT 1BI2A 2CZ6B 4EMKC 1G3YA 1M9SA 1OI1A 2CYZB 5LJ3j 4M7DE 4PJOA 4PJOF 2ZPFB 5CKEA 3OYAA 4BD3A 3E19A 3HFNA 5CO7A 2DZCA 2JNGA 2ZPBB 3J81E 1VQOT 4C92A 1X75C 2LT1A 3A8GB 4IUQA 2K4YA 3CXCA 1VQPT 4PJOD 4KBMB 1Q7YC 2GCXA 4M77E 4XAXB 4O6JA 4HCBA 3GNFB 5HY6A 4OB1B 1WGSA 4N4HA 3PIPA 3JCMX 5DLOA 4NL2A 2D6FA 1Q82U 4JRKA 4XTUA 3RKWA 1JJ2S 4M7AA 3CCJA 4L6V5 3FJPA 4C8QA 2D9TA 3MEWA 1HK9A 3LH0A 2DEQA 4X9CA 3MP1A 3VJPA 5A2QE 3X26B 1LNXA 1YJ9T 2JVVA 3X28B 2EAYA 2L5QA 4M78A 5CKFA 4C92C 4ZGDB 4YTLA 3MO8A 2HQEA 2LRQA 4EMKB 2EQJA 3CCUT 2BKDN 1QP2A 4F7UA 4ZN3A 2FL7A 3LWIA 1QVFA 3QJYA 3QUIA 5LJ5h 5GAMf 2QQRA 1VQPA 1ZBXA 3TEEA 3LYIA 4X34A 3QDRB 3FEOA 5LJ5f 2P4TA 1YJWA 1VQ7A 3QG1A 4C0ZA 5KCHA 3JCMb 3OMGA 2ZPGB 5CIUA 3CCET 3C95A 3PIOA 1WJRA 5LJ5g 3MEVA 1U1SA 4J6WA 4XTVA 1KQSA 4Q5WA 4GY5A 2QQSA 2C06A 2JTFA 3OQ5A 4N4IA 3RKYA 4ELZC 3G4ST 4OGEA 3M54A 5GANh 3OS5A 2O01E 3ZBDA 5C0MA 3JCMQ 3EFRA 3L2WA 3JCMP 2XD0A 1Y07A 2RHYA 3ER0A 3JCMJ 3EAEA 4N0AC 1O9SA 1QVGS 2QXFA 4M75E 3JAME 2ZPIB 4PLLA 5AYFA 4PJOB 3OBWA 3OS1A 4A4HA 5GMKj 2D0QB 4MZMA 2K2VA 5GAN4 2X4JA 5GAN2 1LJOA 4XTWA 1QVFS 2MI6A 2LC4A 2XDPA 2XHCA 4XU3A 2CKKA 2MMPA 2ZPHB 1YITA 2XU8A 3OW2A 2DJZA 3M4YA 4C92F 3E9FA 1K9MC 1S72A 3SWNC 4J5YA 4OB3B 4C8QG 3CCQT 5LJ5j 1VQ5A 1Q86U 2V8IA 4BY6C 1I81A 4M75A 5GAMj 1I5LA 5A0LA 4M75F 1WJSA 5FLXE 1X01A 3L2UA 5L8RE 1YHQA 2M16A 3SDZA 2LNVA 2GQVA 4J83A 3JSCA 4MDWA 2E65A 4PL6A 3V7RA 4C0GA 5GAN7 4M78D 3GP8A 2M0OA 2JUFA 1Y96B 2GFAA 2I2LA 3BFMA 4FSXA 1UGSB 1LOJA 4M78F 5CAIA 1M1KC 4D6WA 1ZQ1A 2XG8D 5GAOl 1XOVA 5CCAA 3JCMh 3QHSA 3OW2S 1UGQB 3HKSA 3BW1A 2RJFA 1YJ9A 3JCMe 1VQOA 2E1HA 1FWZA 4IUTA 4QQ6A 5GANj 2OTLA 2DD4A 3L42A 3QJ6A 3CCST 2RM4A 2X4YA 4M7DC 4L59A 2LQKA 2PUOB 4II1A 2XDDA 4JS4A 3FC3A 2XIDA 4KT0E 4N0AA 1VQ7T 4MZTA 2ZZDA 1W2BS 3MHXA 3FDRA 2H3JA 5CVIA 4BACA 4N4GA 4F7UE 3VV0A 1H3ZA 3V8KA 3VUZA 4M78B 4PKCC 2QQAA 2QQ9A 4MDXA 3FIFA 4C8QF 1XQHA 1YJNA 1YJWT 4IURA 3CCVA 5KH6A 3CPWA 1NPRA 3SWNA 3CCMT 1N8RU 5J3BA 3MP6A 1WJQA 4UC4A 5GAOm 3G71T 3HRSA 3CMET 1AHJB 2RA2A 3HFOA 3MP8A 1K8AU 3CD6A 2VUBA 4NOYA 4XTXA 4EMHA 1VQ4T 4ZTFA 3VKIA 2GFUA 4IUUA 5GAOr 3F70A 2LDMA 3CCSA 5GAOn 1UGPB 3FLGA 1N9SA 5LL6S 5GAMd 5CQXA 4EPCA 1QVGA 1BIAA 2CZ0B 5GAMg 3LLRA 3M9QA 3CXCS 4Z02A 3QYGB 1BI1A 2PQWA 3WVEB 3QIIA 5FU7C 4FM4B 4EMKA 1M1GA 5LJ3f 2DO3A 4XU2A 2EQMA 5FRMA 1VQKT 1VUBA 3OYYA 3QYHB 3VU3C 3UPUA 3OYIA 3BDUA 4C8QE 2HNIA 2R5AA 1OZ2A 2FHDA 2HBPA 3G7ZA 5I2MA 2EQUA 4M7AB 1N6AA 3JCMf 4BUGA 5CR2A 1R8OB 4FL6A 1KC8C 3A5ZB 2DD5A 3O8VA 4B9XA 1YHQT 4JRPA 1VQ5T 2RH2A 3C4SA 2KY9A 2AHJB 5A0GA 1YITT 4JLGA 3JCMg 2ZPEB 4BI3A 3OYBA 1YCYA 4A54A 5GAMh 2HD0A 1M90U 2V8KA 3ZFJA 3KBGA 4JRIA 1KHCA 4B9WA 2E5QA 3PMIA 3JCMW 2VGMA 4L5GA 1M5Q1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BY7 A;  4M75 D;  2VXF A;  4PJO B;  1KQ2 A;  3QO3 A;  4M77 B;  5GMK j;  5LJ3 g;  3JB9 H;  3JB9 I;  5GAN 4;  5GAN f;  5GAN d;  2YLC A;  4Y91 A;  1LJO A;  4C8Q D;  5LJ5 e;  4WF2 A;  2FYK A;  2JN0 A;  4XTW A;  1JRI A;  3JCM c;  3JCM d;  4HT8 A;  4PJO C;  4XU3 A;  4A53 A;  2E64 A;  4M7A G;  2VC8 A;  2RD1 A;  2E10 A;  4XU1 A;  2DJZ A;  2YHT A;  3RUX A;  4C92 F;  5I21 A;  3SWN C;  5GMK l;  4J5Y A;  1D3B A;  3EFS A;  4C8Q G;  5LJ5 j;  3RER A;  2CGH A;  4M75 C;  1Y96 A;  2ZGW A;  4QVC A;  3JB9 J;  1I81 A;  4M75 A;  4C92 D;  4M75 G;  5GAM j;  1I5L A;  4M75 F;  3HSB A;  1X01 A;  4C8Q C;  4F7U G;  3GIB A;  4M77 G;  4M77 F;  5GMK e;  1BIB A;  1WNL A;  5GAN 7;  1KQ1 A;  3V7R A;  2E65 A;  4C92 B;  2FB7 A;  4XTZ A;  4PJO G;  5GMK h;  4M78 D;  3QSU A;  2EJ9 A;  1N9R A;  1I4K 1;  1Y96 B;  2I2L A;  3V7S A;  3BFM A;  4M78 F;  1LOJ A;  2DVE A;  2VXE A;  3M4G A;  5CAI A;  3JB9 F;  5LJ3 e;  2YLB A;  4M7D F;  5GAO l;  4XQ3 A;  5GAN 6;  5GAN 5;  2Y90 A;  2EJG A;  2DXT A;  3QHS A;  3JCM h;  3JCM V;  5GAN 2;  5GAO q;  3BW1 A;  3JB9 D;  3JCM e;  2E1H A;  5GAN j;  1D3B B;  3FB9 A;  4C8Q B;  4M7A D;  4MML A;  3AHU A;  4QVD A;  4M7A C;  1U1T A;  4M7A E;  2RM4 A;  4M7D C;  4C92 G;  2EWN A;  4OP0 A;  5GAN g;  1JBM A;  4EMK C;  4N0A A;  2DTH A;  4M7D D;  3V8J A;  5LJ3 j;  4MMK A;  4M7D E;  4PJO A;  1MGQ A;  4PJO F;  4X9D A;  1B34 B;  4F7U E;  4NL3 A;  1H64 1;  3HFN A;  2DZC A;  1WPY A;  4XU0 A;  3V8K A;  4M78 B;  4C92 A;  4M75 B;  4PJO D;  4XTY A;  4PJO E;  3FIF A;  1M8V A;  4C8Q F;  4M77 E;  5GMK i;  3RIR A;  5DY9 A;  2DTI A;  5GAN e;  3INZ A;  5GAO p;  3SWN A;  4JLI A;  5LJ5 d;  3JCM X;  4EMG A;  4NL2 A;  1WQ7 A;  4JRK A;  4JUV A;  4XTU A;  5GAO m;  3RKW A;  4M7A A;  4RCB A;  3RES A;  2DKG A;  2RA2 A;  3FJP A;  3HFO A;  2RB6 A;  4C8Q A;  1HK9 A;  4X9C A;  2DEQ A;  4HA8 A;  3RKX A;  5LJ3 h;  1LNX A;  4M78 C;  3SB2 A;  2DXU A;  3L2Z A;  4NOY A;  2EAY A;  4M78 G;  4M78 A;  1TH7 A;  1WQW A;  4XTX A;  4C92 C;  4EMH A;  4EMK B;  2DZ9 A;  4M7D G;  4F7U A;  4M77 A;  5GAO r;  4M7A F;  1I8F A;  3QUI A;  4DQ2 A;  5LJ5 h;  5GAM f;  5GAO n;  3PGG A;  1N9S A;  4C92 E;  5GAM d;  4M77 D;  1BIA A;  5GAM g;  5LJ5 f;  1B34 A;  5GMK m;  4M7D A;  1HXD A;  2E41 A;  2QTX A;  3JCM b;  4F7U F;  4PNO A;  5LJ3 d;  4EMK A;  5LJ3 f;  4XU2 A;  5LJ5 g;  1U1S A;  4J6W A;  4XTV A;  3VU3 C;  2EJF A;  3BDU A;  4C8Q E;  2HNI A;  4HT9 A;  4M77 C;  4V2S A;  4RCC A;  2DTO A;  4M7A B;  3JCM f;  5GAN 8;  3RKY A;  3JB9 G;  3V7C A;  5GAN h;  3SWN B;  4J6X A;  3JCM Q;  3EFR A;  3JCM P;  3V8L A;  3JCM g;  2K57 A;  4M7D B;  1YCY A;  4A54 A;  5GAM h;  5GAN 3;  3JCM J;  4F7U B;  3L1A A;  4JRI A;  4J6Y A;  4N0A C;  5GAM e;  3JCM W;  4M78 E;  4M75 E;  1M5Q 1; 
#chains in the Genus database with same CATH topology
 3EG9 B;  3S3O A;  1KQS S;  3T9N A;  3PVQ A;  4IUV A;  2QDY B;  2DNU A;  3O5Z A;  3EFS A;  2DET A;  1OZ3 A;  2M0Y A;  1D0Y A;  3OB9 A;  4KUL A;  5KE3 A;  2O88 A;  1MUZ A;  2J05 A;  3M59 A;  3OYD A;  2DIQ A;  3OYE A;  1KQ1 A;  3WXM B;  2AZS A;  4J9F A;  3RMS A;  2YT6 A;  3TCJ A;  1MV0 B;  2Y90 A;  4IKF A;  1D3B B;  2F2V A;  4LDU A;  5IH2 A;  1VQN A;  2A3L A;  1R0C B;  3HL8 A;  2EIF A;  1CKB A;  1BI0 A;  4X9D A;  4NL3 A;  5CKB A;  1VOM A;  2RQR A;  1RL2 A;  3X25 B;  1K9M U;  3INZ A;  2B8A A;  3QDF A;  2PU9 B;  1WQ7 A;  3ULR B;  3CME Q;  3E9G A;  2QYZ A;  4OMQ A;  2RJC A;  1UJY A;  3CC7 A;  2K3Y A;  5FRN A;  2A7Y A;  1GFC A;  4OB2 B;  1U5S A;  4JZ4 A;  1TSF A;  3NTI A;  4E7J A;  2QEX Q;  1SPK A;  2QI2 A;  1B34 A;  3EGX B;  4M7D A;  2M9U A;  5KYX A;  5LJ3 d;  2DFU A;  1IGU A;  2KK4 A;  5GJW B;  2M51 A;  1Q7Y U;  1Z9Z A;  4M77 C;  4V2S A;  4RKU E;  2DTO A;  4CI0 C;  2IVW A;  2YWW A;  1NYG A;  2QQB A;  2JMC A;  1D0Z A;  1G3W A;  2QA4 T;  3L1A A;  1VQ9 A;  1AWX A;  1UEC A;  3I56 A;  3L2R A;  1QWE A;  1YI2 T;  2CUB A;  2R58 A;  1VQK A;  5GAN f;  4Y91 A;  1WXT A;  2DXC A;  2MOX A;  3JCM c;  2YXY A;  1YP5 A;  2RD1 A;  1K8A R;  5I21 A;  1MHN A;  2COW A;  5GMK l;  3RER A;  3VUB A;  2MYS A;  2KT1 A;  2P0P A;  1BBZ A;  3CCJ Q;  2AK5 A;  2FB7 A;  2KDS A;  2VAS A;  1NE8 A;  3EFO A;  2Z0W A;  3CBP A;  2FPD A;  3TRE A;  1OX9 A;  3SHW A;  2Y4Y A;  2CZ1 B;  3I35 A;  4CC7 A;  2ROL A;  5FRO A;  1OPL A;  2H8H A;  3NFC A;  3VYH B;  2EVR A;  2FRY A;  4BDY A;  2DTH A;  1QW1 A;  3V8J A;  1DJ7 B;  3S3M A;  4BDZ A;  4HVW A;  1OYX A;  3QPH A;  4NS5 A;  1W70 A;  4VUB A;  3ZEH A;  3EH1 A;  4JLI A;  2MF2 A;  3M57 A;  4C0D B;  5EG2 A;  1Q81 C;  2RHZ A;  1ZHI A;  1Q81 U;  3RKX A;  5LJ3 h;  3SB2 A;  2FVU A;  2DXU A;  1PKS A;  3S3N A;  5DM7 R;  5AT1 B;  4B6M A;  3PGG A;  2KYB A;  2P4R A;  2DXB A;  1UG1 A;  3NMZ C;  5D6W A;  3C12 A;  4F7U F;  2EW3 A;  2X9H A;  2F69 A;  3H6Z A;  2JS2 A;  5IHI A;  4RCC A;  2O4X A;  1SRM A;  3SWN B;  1X6O A;  2DF6 A;  3OYN A;  1D1A A;  5IHK A;  4TVR A;  2FRW A;  3BDL A;  1SG5 A;  2G3R A;  4M78 E;  5CKH A;  1AD5 A;  1QKW A;  3EG0 A;  3A8O B;  1KQ2 A;  1HJD A;  3JB9 H;  1JJ2 A;  2YRV A;  3DKM A;  4MZP A;  3LX7 A;  3CC4 A;  3OSV A;  3CMA Q;  1OOT A;  1D3B A;  4BE0 A;  1TU0 B;  4OGC A;  1G3S A;  4M75 G;  3CC4 Q;  3A8M B;  1G8X A;  2FEI A;  3CCV T;  4ZNX A;  3I55 A;  1MV3 A;  5IT9 E;  2RI5 A;  2VXE A;  2ZCF B;  5LJ3 e;  3JB9 D;  1BI3 A;  3JCM V;  5KYN A;  1GCQ C;  2FPE A;  2GNC A;  4E47 A;  4J9E A;  3CPW S;  2V1R A;  1P92 A;  3M0S A;  2CRE A;  4J7I A;  1K73 C;  3URG A;  3OYC A;  1VQM A;  3VS3 A;  2KVQ G;  2F2W A;  4OP0 A;  3I9Q A;  1M9S A;  3H0I A;  2RPN A;  2CYZ B;  4PK4 A;  2JNG A;  2ZPB B;  1X75 C;  2DL3 A;  3CXC A;  4PJO D;  3M0T A;  4KBM B;  4XAX B;  1YNZ A;  4HCB A;  3GNF B;  1PKT A;  2KYM A;  4JRK A;  4XTU A;  3REA B;  3RKW A;  4L6V 5;  3MEW A;  3MP1 A;  3EFO B;  2JVV A;  1FYN A;  4M78 A;  4M7D G;  2EQJ A;  3CCU T;  2BKD N;  4F7U A;  2CDT A;  3QJY A;  1UTI A;  1U3O A;  3FEO A;  3H9N A;  2GTJ A;  3OMG A;  2ZPG B;  5CIU A;  1WJR A;  1BU1 A;  1U1S A;  1VQ4 Q;  2PZ1 A;  2CP5 A;  1FMW A;  2C06 A;  2JTF A;  3M54 A;  5C0M A;  1RAB B;  3EFR A;  1GBQ A;  2XD0 A;  2JTE A;  3ER0 A;  3JCM J;  2RF0 A;  3EAE A;  3CCE Q;  3JV3 A;  1WXB A;  3NPF A;  2JJ9 A;  2K2V A;  4JZ3 A;  5GAN 2;  1X2Q A;  2MI6 A;  2LC4 A;  1OV3 A;  2XDP A;  2A36 A;  1YIT A;  3E9F A;  4OB3 B;  4C8Q G;  1VQ5 A;  1Z9Q A;  1I81 A;  5GAM j;  1I5L A;  4M75 F;  3L2U A;  5FLX E;  1YHQ A;  2KXD A;  4PL6 A;  3V7R A;  2OI3 A;  1RAC B;  4M78 D;  3GP8 A;  2M0O A;  1VQ7 Q;  1WIE A;  4X1V A;  4M78 F;  5CAI A;  2L0A A;  1XOV A;  4J9I A;  5I22 A;  1UGQ B;  1QCF A;  3MKD A;  3EHQ A;  2MCN A;  1I0C A;  2CH4 W;  2VB6 A;  4IUT A;  2JS0 A;  1WHL A;  2DD4 A;  1PG5 B;  2RM4 A;  2XDD A;  3FC3 A;  2XID A;  2MK5 A;  1VQ8 Q;  4JJC A;  4BAC A;  2H3J A;  4F17 A;  3LH5 A;  4N4G A;  4RTZ A;  4F7U E;  1H3Z A;  1B7T A;  2QQA A;  4HVU A;  4MDX A;  2AZV A;  3I5R A;  4QKU A;  1XQH A;  1NPR A;  3SWN A;  4RTT A;  3MP6 A;  2OTL Q;  4M4Z A;  2YUP A;  2BE9 B;  3MP8 A;  1K8A U;  2QAS A;  1UHF A;  1LCK A;  4XTX A;  4DBH A;  3VKI A;  5GAO r;  1PNJ A;  4KRT A;  2LDM A;  5LL6 S;  5GAM d;  4EPC A;  3M0P A;  1K9M R;  4Z02 A;  3QYG B;  1BI1 A;  1H92 A;  2F1L A;  1SSH A;  4LXC A;  2JM8 A;  1WYX A;  2VKN A;  2XMF A;  1R8O B;  4FL6 A;  1KC8 C;  3A5Z B;  1AWW A;  2D8H A;  2AHJ B;  1PRM C;  2KBT A;  1ZSG A;  2JW4 A;  2ZPE B;  2O2O A;  1NM7 A;  2HD0 A;  1GBR A;  4JRI A;  4B9W A;  2L3P A;  4C92 F;  3QWY A;  1KSW A;  1GXI E;  2RJE A;  2L89 A;  2K3X A;  4BB7 A;  3VRY A;  1SSF A;  3CCU Q;  3CCL A;  3C94 A;  2BZX A;  2RK1 A;  4JRQ A;  1ZLM A;  2ZGW A;  4FW2 A;  3OMC A;  1WNL A;  2P0Q A;  1EIF A;  2COZ A;  1BKB A;  4PJO G;  3HP9 A;  1I4K 1;  1NLO C;  3M55 A;  3CCJ T;  4PJN A;  1S72 T;  5GAN 5;  4DA4 A;  3OA6 A;  1VQ9 T;  2LTO A;  3QZ9 B;  3M56 A;  2KAF A;  3EGD A;  4O5V A;  2DIG A;  4BE2 A;  3PFS A;  3A8L B;  4PLI A;  2B86 A;  3LGL A;  4AFQ C;  1W2B A;  1KD1 U;  3CCQ Q;  1WPY A;  3QKJ A;  4AT1 B;  3H41 A;  2QEX T;  2DBM A;  1OPK A;  4LUD A;  2K79 A;  4FCY A;  3E2U A;  2DX1 A;  2X3X D;  3CXC P;  2EKH A;  5HK3 A;  2OTL T;  2RB6 A;  2HQH A;  1H3H A;  1NYF A;  3PT9 A;  2RQW A;  4C0F A;  4M77 A;  4PFO A;  4DQ2 A;  4E6R A;  2QGF B;  1WX6 A;  2V26 A;  2P0K A;  3DLM A;  3VYG A;  1MMD A;  3CC4 T;  5FU6 B;  2EJF A;  1RAH B;  2JMA A;  1UDL A;  2NUZ A;  1I1J A;  1G5V A;  3JB9 G;  4PFP A;  3OYL A;  3CD6 T;  4E7L A;  4J6X A;  4QW2 A;  1VQ6 T;  5GAN 3;  1M4Z A;  1WA7 A;  4DOW A;  1QP3 A;  3EGU A;  2SEM A;  3PTA A;  3J80 E;  2L8D A;  4ZN1 A;  4WF2 A;  3JCM d;  1JRI A;  1HYO A;  1RAI B;  1K9A A;  5CK9 A;  2E64 A;  2DMO A;  2OAU A;  2VC8 A;  1VQP Q;  2EGC A;  3G4S A;  1VYT A;  2X3W D;  4JS5 A;  4C0D C;  4M75 C;  5DLQ E;  3PMT A;  1MMN A;  4OMP A;  2VGN A;  3CCS Q;  1XJW B;  2COY A;  2EFI A;  3U23 A;  5IAY A;  1RAE B;  1QQJ A;  3V7S A;  2OAW A;  4XQ3 A;  2CP2 A;  1ABO A;  1YJN T;  3VS7 A;  4BI4 A;  4FYW B;  4C8Q B;  3OW2 P;  1KIK A;  4OVA A;  4QVD A;  1UGR B;  3CC7 Q;  4M7A E;  1YN8 A;  1X43 A;  5GAN g;  1RI9 A;  2RHU A;  3NHN A;  4C5G A;  4MMK A;  3CC2 A;  2MAM A;  3CCL Q;  3CCU A;  4Y28 E;  2OTJ T;  2M1H A;  4OMO A;  5GMK i;  3RIR A;  4E7I A;  4CC2 A;  1K0X A;  4HCZ A;  2F5T X;  3RES A;  4CC3 A;  1IZ6 A;  2KSS A;  1RAG B;  1RLP C;  2NUT A;  1TUC A;  2L3Q A;  4HA8 A;  1Y7X A;  4QQG A;  3REB B;  1R0B G;  4OB0 B;  1YIJ A;  4ATO A;  4Z8A A;  1M3C A;  2X35 A;  1M2V B;  2CT3 A;  4ZTJ A;  2E6N A;  2CH4 A;  4AFZ C;  2WSF E;  2BZY A;  1V29 B;  1WHM A;  4FT4 A;  1XNI A;  4LD9 K;  2LQ8 A;  5FU7 B;  4HT9 A;  2HCK A;  4KH0 B;  3UAT A;  4FYX B;  1Q7Y R;  2KMT A;  2HKN A;  4C5H A;  2GBQ A;  2X51 A;  4RG8 A;  1GFD A;  4F7U B;  1PC0 A;  2QK0 A;  1M1F A;  2ESW A;  3HHT B;  4FYY B;  3EG1 A;  1KD1 C;  3OYF A;  5J26 A;  1N8R C;  1FMK A;  2CZ7 B;  2MWP A;  4M7A G;  2RO0 A;  2DAQ A;  2YHT A;  1AVZ C;  3PE0 A;  1Q82 R;  4JJN K;  4C92 D;  3GF5 A;  5C6S A;  5HKC A;  3OS2 A;  1YHQ Q;  3HSB A;  4C8Q C;  3UDC A;  2CSQ A;  3MET A;  2QEX A;  4XTZ A;  3L2V A;  1N9R A;  2EJ9 A;  4M7D F;  1QVP A;  2YLB A;  1YJN Q;  5GAN 6;  2EJG A;  2DXT A;  3N5B B;  2YRC A;  2A08 A;  1LPL A;  4FIB A;  3P8B B;  3FB9 A;  3MEU A;  5KYX B;  2R57 A;  2HBW A;  2IG0 A;  3G6E T;  2EWN A;  3EG3 A;  1BI2 A;  2CZ6 B;  4EMK C;  1G3Y A;  4M7D E;  3OYA A;  4R0K A;  4IUQ A;  1VQP T;  1Q7Y C;  2K9G A;  2J6O A;  5HY6 A;  2A28 A;  4N4H A;  2HZY A;  4RUG A;  3JCM X;  4K11 A;  4NL2 A;  1Q82 U;  5D7U A;  3VJP A;  1WHG A;  4AMC A;  1QP2 A;  3VS0 A;  1D09 B;  3QUI A;  1QCN A;  2QQR A;  1VQP A;  1ZBX A;  2IIM A;  4JJB A;  3LYI A;  5LJ5 f;  1NLP C;  5KCH A;  3ZL7 C;  3JCM b;  3CCE T;  1JEG A;  4F16 A;  4J9B A;  1KQS A;  2CSI A;  4Q5W A;  4GY5 A;  2QQS A;  1X27 A;  5FWB A;  4LUE A;  3CCR Q;  4LE9 A;  2HKQ B;  2RHY A;  4PJL A;  2QXF A;  5GMK j;  1J3T A;  5GAN 4;  4ESR A;  1K4U S;  2NWM A;  4XTW A;  2A37 A;  3M0Q A;  2XHC A;  2F2X A;  9ATC B;  3M4Y A;  1N5Z A;  2YSQ A;  3I55 Q;  3CCQ T;  5LJ5 j;  3EG9 A;  5FW9 A;  4BY6 C;  2EYW A;  5A0L A;  1WJS A;  1YWP A;  1B3Q A;  3SDZ A;  1RAF B;  2LNV A;  2GQV A;  4J83 A;  4MDW A;  2A0F B;  2QGG A;  1TUG B;  1Y96 B;  3VS1 A;  1UGS B;  1M1K C;  4D6W A;  5GAO l;  2EPD A;  3OW2 S;  5EC7 A;  2EYX A;  1YJ9 A;  3JCM e;  1VQO A;  2E1H A;  5GAN j;  2OTL A;  1YIT Q;  4L59 A;  3G71 Q;  4N0A A;  3MHX A;  3CC2 Q;  4J9D A;  1IRX A;  3VUZ A;  4M78 B;  2CP0 A;  3FIF A;  2W0Z A;  2PTK A;  1YJW T;  4IUR A;  4KH1 B;  3CCV Q;  1EZZ B;  2JM9 A;  1ZUK A;  2C0O A;  3CME T;  1AHJ B;  2FG0 A;  3CD6 A;  2VUB A;  2K3B A;  2GFU A;  4IUU A;  3F70 A;  4J9G A;  2CZ0 B;  1IXD A;  3LLR A;  2ED1 A;  3CXC S;  3WVE B;  4EMK A;  1M1G A;  4XU2 A;  2L3S A;  3OYY A;  3VU3 C;  1OUL A;  1T3L A;  2HBP A;  4BUG A;  5I2M A;  4M7A B;  3JCM f;  5CR2 A;  2ABL A;  2DD5 A;  3AT1 B;  1ZSZ A;  5KYU B;  1SRL A;  3C4S A;  1AEY A;  1AOJ A;  1M90 U;  2V8K A;  3KBG A;  2E5Q A;  3PMI A;  4L5G A;  2CUD A;  1SKU B;  4OMM A;  2DEU A;  1JQQ A;  4M77 B;  2VYT A;  5CQY A;  2LJ1 A;  5LJ5 e;  2PUK B;  2JN0 A;  1W4S A;  3CPF A;  2DK3 A;  2I0N A;  4J7F A;  1W6X A;  2LT4 A;  1PSF A;  1E7O A;  2DYB A;  1VIE A;  3GOX A;  2CGH A;  1GCP A;  3VS2 A;  2LX9 A;  2O9V A;  4A4K A;  2L2P A;  2KNB B;  2HEQ A;  3MCA B;  3G6E Q;  4IIO A;  3R6N A;  4RTU A;  3JRZ A;  1ZUY A;  4EIK A;  3OYJ A;  4E7Z A;  2CT4 A;  1Q82 C;  1TTH B;  2J6F A;  3P8H A;  2KT8 A;  1I07 A;  3TVT A;  4FW1 A;  5IHN A;  1M3A A;  3I56 Q;  2RI2 A;  3NTK A;  1BCO A;  2ZAE A;  1QKX A;  4M7D D;  5ECA A;  3GPL A;  4KUI A;  1H64 1;  2AIR B;  4GLK A;  4XU0 A;  1CKA A;  1IB8 A;  1G3T A;  4R56 A;  2LX7 A;  1K8A C;  1M8V A;  1KC8 R;  3L2Q A;  1OQK A;  4LD6 A;  1N27 A;  2DTI A;  5GAN e;  2XDB A;  1QMC A;  3OY9 A;  4DBQ A;  1VQ9 Q;  1WHH A;  1VQL Q;  4RMO A;  4C5E A;  1PCX A;  3M58 A;  4OMF B;  4E7H A;  2PVO B;  4M78 C;  2XIC A;  4C92 E;  4M77 D;  4JJD A;  5GMK m;  3QZ5 B;  3GBQ A;  1X2K A;  3GNG A;  2GTO A;  4PNO A;  3Q1J A;  2R5M A;  1NJI U;  2D1X A;  5J39 A;  1F1B B;  3RMQ A;  1VQ5 Q;  1S72 Q;  1MNE A;  2OTJ Q;  2SRC A;  1ARK A;  3UF4 A;  2LMJ A;  4M7D B;  1KQS P;  1SF9 A;  1WLP B;  5GAM e;  2EYQ A;  2K5F A;  1T3S A;  3BY7 A;  2VXF A;  3RR6 A;  1TWB A;  2C0T A;  3DB3 A;  2YLC A;  1IRE B;  3MJX A;  4PJO C;  4XU1 A;  7AT1 B;  4QT7 A;  4XK8 E;  1BK2 A;  1VQ4 A;  2E12 A;  4M77 G;  1VQL T;  2KRO A;  1B07 A;  1KJW A;  3A1P A;  4M7A C;  1EFN A;  2ECZ A;  3OBY A;  2DL5 A;  1PSE A;  3M4G A;  2BIV A;  3HRU A;  1ZSZ C;  4LNP A;  1BB9 A;  5KYW A;  3PNW C;  4GBQ A;  2RJD A;  2E6Z A;  2C0I A;  2E4H A;  3S6W A;  3HRT A;  1D0X A;  3RNJ A;  1M2O A;  2E70 A;  3ME9 A;  3CD6 Q;  3NTH A;  1Q86 R;  4XTY A;  3OS0 A;  3CMA T;  2F5K A;  5DY9 A;  2KEA A;  1Y71 A;  5GAO p;  5KYW B;  5LJ5 d;  3UT1 A;  3WVD B;  1W2B P;  4PFZ A;  4RTW A;  4RCB A;  2J7I A;  1VQM T;  1YFN A;  1BYM A;  4IUP A;  3HPW A;  3VRZ A;  1OX8 A;  1NJI C;  3GLX A;  4M7A F;  1I8F A;  3SD4 A;  3I56 T;  3CMA A;  4J8O A;  1YBY A;  2QTX A;  1OU9 A;  3R6O A;  3SFM A;  5I11 A;  4FT2 A;  2EKO A;  1VQ8 A;  4BY6 B;  1O75 A;  2K57 A;  2NUP B;  1UEB A;  1FX7 A;  2DL7 A;  1MMG A;  1RAA B;  2DL8 A;  3TSW A;  3CCR A;  3QO3 A;  5LJ3 g;  5GAN d;  2GQI A;  2VV5 A;  1NEB A;  5HK0 A;  2HDA A;  3RUX A;  3CCE A;  4A4E A;  4R55 A;  4OF1 A;  4LDV A;  1BCM A;  2K5I A;  4BI8 B;  3GIB A;  2CS7 A;  4M77 F;  2EGA A;  1ACM B;  4RTV A;  2AT1 B;  2YDL A;  4ME7 A;  2QA4 Q;  1M90 R;  1SEM A;  1NEG A;  1YI2 Q;  1U1T A;  4LDX A;  2FZG B;  3TQ7 P;  2RK2 A;  3VS4 A;  1RUW A;  3D7S B;  1WXU A;  3CCL T;  5LJ3 j;  4PJO A;  2AKL A;  2ZPF B;  2LZ6 B;  4IIM A;  3E19 A;  4BD3 A;  2DZC A;  3HTR A;  1K73 U;  3I5S A;  2GGR A;  3EG2 A;  1GL5 A;  2YUQ A;  4M77 E;  1WGS A;  3PIP A;  2D6F A;  1NG2 A;  1JJ2 S;  4M7A A;  3CCJ A;  2D9T A;  1HK9 A;  3LH0 A;  1YJ9 T;  3X28 B;  2L5Q A;  5CKF A;  2OTJ A;  4C92 C;  4YTL A;  3MO8 A;  4EMK B;  2LRQ A;  1ABQ A;  1TS9 A;  1QVF A;  3LWI A;  1A0N B;  2FL7 A;  2KI7 A;  1N8R R;  5LJ5 h;  5GAM f;  2LJ0 A;  3TEE A;  1X6B A;  4X34 A;  2KE9 A;  2P4T A;  1K0S A;  1ZX6 A;  5GJV B;  3QG1 A;  4C0Z A;  1IHV A;  3PIO A;  3MEV A;  4XTV A;  1EX4 A;  2DM1 A;  1YWO A;  2LJ3 A;  2ED0 A;  2O01 E;  3ZBD A;  3JCM Q;  3PVL A;  3L2W A;  1Y07 A;  3JAM E;  2RQV A;  1JXM A;  2ZPI B;  4HVV A;  4PLL A;  4PJO B;  3OBW A;  1YCS B;  1LJO A;  1QVF S;  2E5K A;  2ENM A;  2CKK A;  2MMP A;  2ZPH B;  2XU8 A;  2DJZ A;  2QDL A;  3SWN C;  1D1C A;  6AT1 B;  1OEB A;  1X01 A;  5L8R E;  1AWO A;  2LP5 A;  2ROT A;  5GAN 7;  4C0G A;  3JSC A;  2E65 A;  1PHT A;  1M2V A;  2W10 A;  2DRK A;  4RTY A;  4AG1 C;  1AZE A;  2I2L A;  2GFA A;  1LOJ A;  1D1B A;  1ZQ1 A;  2XG8 D;  3EHR A;  5CCA A;  3JCM h;  3QHS A;  4GLM A;  1IO6 A;  4AG2 C;  3BW1 A;  1RLQ C;  1FWZ A;  4QQ6 A;  3A98 A;  3SEM A;  1JO8 A;  3CCS T;  2DER A;  3QWX X;  2X4Y A;  2PUO B;  1VQ7 T;  4Y92 A;  5CVI A;  3VV0 A;  1UJ0 A;  4PKC C;  1YJN A;  3CCV A;  2MIO A;  2YUO A;  3CCM T;  5J3B A;  2KR3 A;  1WJQ A;  4UC4 A;  1LVK A;  3M0U A;  1I5O B;  2HMA A;  2DE0 X;  2BTT A;  4NOY A;  4EMH A;  3CCS A;  1UGP B;  2D0N A;  1KK7 A;  3FLG A;  4J9H A;  4KGX B;  5CQX A;  1QVG A;  1BIA A;  2NYS A;  2LQN A;  1RAD B;  5FU7 C;  1WZO A;  5IXF A;  1K76 A;  2EBP A;  2DO3 A;  2EQM A;  1VUB A;  1GRI A;  3UPU A;  3UA6 A;  3OYI A;  1TUD A;  2E3H A;  1VQ4 T;  1VQL A;  4ORZ A;  1VQM Q;  1YHQ T;  1VQ5 T;  5A0G A;  2FZC B;  1YIT T;  4JLG A;  3JCM g;  3BE3 A;  4BI3 A;  3EGX A;  4A54 A;  1KHC A;  2VGM A;  1M5Q 1;  3OYG A;  2X4X A;  3JB9 I;  1YJ9 Q;  1JU5 C;  3CBO A;  1WDX A;  1M27 C;  1M3B A;  2CP3 A;  1Q95 G;  1PD1 A;  2KQW A;  2K5L A;  3LWH A;  2PVD B;  4HCC A;  3JB9 J;  4QVZ A;  2JT4 A;  1VIF A;  1RI0 A;  1VQN T;  4FSS A;  1KD1 R;  1G83 A;  8ATC B;  4OML A;  1K73 R;  1NPP A;  1PRL C;  2O4X B;  3TU4 K;  3CME A;  1GCQ A;  2VVK A;  4DBF A;  4MML A;  2JTM A;  2KRS A;  2E3I A;  3QBY A;  5IN1 A;  2DJQ A;  2CP6 A;  1JBM A;  2PVG B;  3CC7 T;  5A0D A;  1MGQ A;  3MPU B;  4EDU A;  2RHX A;  4M75 B;  1ZSZ B;  1NZ9 A;  4FYV B;  1ZUU A;  1HSQ A;  3VS6 A;  1YIJ Q;  4EMG A;  4JUV A;  3UWN A;  1CSK A;  3DB4 A;  2XI9 A;  2WAC A;  4FU6 A;  4M78 G;  2MWO A;  4AFU C;  1QVF P;  2V8J A;  2BUD A;  2QTV A;  1W1F A;  3G4S Q;  4HKE A;  1YI2 A;  3A8H B;  2K6D A;  1JB0 E;  1HXD A;  3LGF A;  2DPP B;  2QA4 A;  3KUF A;  5D6X A;  1UB4 A;  4E7K A;  2BE7 D;  2NUT B;  1VA7 A;  3P8D A;  1Y57 A;  2AKK A;  3G1J A;  3G71 A;  5GAN 8;  3OYK A;  2KGT A;  2H3E B;  2JZ2 A;  3V7C A;  2WSE E;  2V1Q A;  3FRN A;  4JDS A;  2EYZ A;  4OMN A;  1WHJ A;  2MPX C;  4J6Y A;  5KE2 A;  1AT1 B;  4M75 D;  1QLY A;  2WSC E;  3TSZ A;  4ELY C;  1ZA1 B;  1KG1 A;  2VWF A;  1PM3 A;  3J7A F;  1M8M A;  3FJ5 A;  2E10 A;  2XKO C;  2EGE A;  4LDW A;  2YRD A;  1VQ6 Q;  1Y96 A;  1IGQ A;  4QVC A;  1VQ8 T;  3OYM A;  2DYI A;  2LNH B;  3RDV A;  3CEY A;  4RTX A;  2HL3 A;  4KGV B;  3QSU A;  4ZGE B;  4D8D A;  4C5I A;  4BE1 A;  3E1S A;  3OYH A;  3DLL A;  1YJW Q;  2KXC A;  5CKD A;  2XK0 A;  4QQD A;  3CCM A;  1SHF A;  1MMA A;  1C6V X;  1UFF A;  4WCI A;  3CCQ A;  4M7A D;  3AHU A;  1QVG P;  2LCC A;  4C92 G;  1V76 A;  1M90 C;  3QXE B;  1XTD A;  5HCK A;  2KRM A;  2RHI A;  4JPB W;  4A63 B;  2LVM A;  2GF7 A;  5D6Y A;  1B34 B;  5KCO A;  5KYY A;  1UGV A;  4PJO E;  3CQT A;  2BZ8 A;  1YIJ T;  3NGP A;  4PJJ A;  4DEY A;  8AT1 B;  2LCL A;  1M1K U;  3MEA A;  3G6E A;  2QG9 B;  2DKG A;  1PWT A;  1KHI A;  3L2Z A;  1TH7 A;  1WQW A;  2JXB A;  3C0C A;  2O31 A;  2DZ9 A;  2L3R A;  1E6G A;  2RI3 A;  2RN8 A;  2EYY A;  1UHC A;  5FWC A;  2X4W A;  3CC2 T;  4AFS C;  2RNA A;  2P84 A;  1WHK A;  1FXX A;  3M0R A;  2E41 A;  1VQ6 A;  5FU6 C;  4J9C A;  1T0H A;  2DIL A;  4P5N A;  3M5A A;  2RQU A;  3CBM A;  4A4F A;  2IPO B;  3LW5 E;  4LDY A;  3V8L A;  4RG2 A;  1HD3 A;  5I2S A;  2RQT A;  3OSS C;  2EQK A;  1U8R A;  3KXT A;  2OJ2 A;  3RBB B;  2DBK A;  4C8Q D;  2FYK A;  4HT8 A;  3IQL A;  3I55 T;  4A53 A;  1Q86 C;  4KUD K;  3X24 B;  4F04 B;  1KC8 U;  1OU8 A;  4Z89 A;  4WTO B;  2DRM A;  3EGD B;  2HQX A;  5KYY B;  1QWF A;  2JOY A;  2NLU A;  4F7U G;  1VYV A;  2YUN A;  1QCO A;  5GMK e;  1BIB A;  2K2M A;  3X20 B;  3M53 A;  4C92 B;  5GMK h;  4F14 A;  1C0M A;  2HAX A;  4ZGJ B;  3H0H A;  2Y4X A;  3JB9 F;  2DVE A;  5M9O A;  1V1C A;  1C1A A;  5GAO q;  3CCR T;  2DL4 A;  1ZA2 B;  4A4G A;  1X6G A;  2KRN A;  3VS5 A;  1K1Z A;  3ASK A;  2HL5 C;  2G6F X;  4CRI A;  3H8Z A;  4DOV A;  2CP7 A;  2M02 A;  1JJ2 P;  1OI1 A;  3KFV A;  4PJO F;  5CKE A;  1NBE B;  3HFN A;  5CO7 A;  3J81 E;  1VQO T;  4C92 A;  2LT1 A;  3A8G B;  2K4Y A;  2O9S A;  1H8K A;  2GCX A;  4O6J A;  1WFW A;  3CCM Q;  4OB1 B;  5DLO A;  1UE9 A;  1UUE A;  3FJP A;  4C8Q A;  1JXO A;  4X9C A;  2DEQ A;  1WI7 A;  5A2Q E;  3X26 B;  1LNX A;  4CC4 B;  4ZGD B;  2EAY A;  2HQE A;  2DA9 A;  1M1K R;  4ZN3 A;  1VQO Q;  3QDR B;  1YJW A;  2K7A A;  1VQ7 A;  1M30 A;  1VQK Q;  3C95 A;  3EH2 A;  5LJ5 g;  4J6W A;  2QAZ A;  1AWJ A;  3OQ5 A;  1TOV A;  4N4I A;  3RKY A;  4ELZ C;  3G4S T;  4OGE A;  5GAN h;  3CPW P;  3OS5 A;  3JCM P;  4DBR A;  1S1N A;  4N0A C;  1MND A;  1O9S A;  1QVG S;  2D8J A;  4M75 E;  1AZG B;  4LN2 A;  5AYF A;  3OS1 A;  4A4H A;  2D0Q B;  4MZM A;  2DLP A;  3THK A;  2X4J A;  4XU3 A;  3OW2 A;  2FZK B;  2LCS A;  1K9M C;  1S72 A;  4J5Y A;  4DEX A;  1TXQ A;  1Q86 U;  2V8I A;  4M75 A;  2FO0 A;  4D8K A;  2M16 A;  1VQN Q;  2FPF A;  1KFZ A;  5L23 A;  5KYU A;  4E7S A;  2JUF A;  3BFM A;  4FSX A;  2OX7 A;  3HKS A;  2RJF A;  2J6K A;  1IHW A;  3L42 A;  1FMV A;  3QJ6 A;  4ANJ A;  4M7D C;  2LQK A;  4II1 A;  4JS4 A;  4PJM A;  4KT0 E;  4MZT A;  1T0J A;  2ZZD A;  1W2B S;  3FDR A;  4HXJ A;  2ATC B;  1Q81 R;  3V8K A;  2PNI A;  2QQ9 A;  1U06 A;  4C8Q F;  2J06 A;  2RMO A;  1G2B A;  5KH6 A;  3CPW A;  2EQI A;  2LQW A;  1N8R U;  4E2F B;  1PD0 A;  1Y0M A;  5GAO m;  3G71 T;  1VYU A;  3HRS A;  2RA2 A;  3HFO A;  2HSE B;  1X69 A;  4ZTF A;  1TG0 A;  5GAO n;  1N9S A;  4KGZ B;  5GAM g;  3M9Q A;  2NUP A;  2PQW A;  3QII A;  1R77 A;  4FM4 B;  5LJ3 f;  4HCK A;  5FRM A;  1VQK T;  1NJI R;  3QYH B;  3BDU A;  4C8Q E;  2HNI A;  2R5A A;  1OZ2 A;  2FHD A;  3G7Z A;  2EQU A;  1N6A A;  3O8V A;  4B9X A;  4JRP A;  2RH2 A;  2KY9 A;  5IXB A;  1ZBJ A;  2HSP A;  4Z88 A;  3H0F A;  3UA7 A;  1E6H A;  3OYB A;  1YCY A;  5GAM h;  3ZFJ A;  3JCM W;  2DVJ A;  1SHG A; 
#chains in the Genus database with same CATH homology
 4M77 B;  2VYT A;  3OYG A;  1GXI E;  2RJE A;  5CQY A;  3S3O A;  2X4X A;  3JB9 I;  2L89 A;  1KQS S;  2K3X A;  2PUK B;  5LJ5 e;  3T9N A;  2JN0 A;  1W4S A;  4IUV A;  3CBO A;  3CPF A;  2DK3 A;  2QDY B;  4BB7 A;  1SSF A;  3CCL A;  4J7F A;  3C94 A;  2KQW A;  2LT4 A;  2RK1 A;  1PSF A;  2OTJ A;  2K5L A;  1VIE A;  4JRQ A;  3LWH A;  3EFS A;  1OZ3 A;  3GOX A;  2CGH A;  2PVD B;  4HCC A;  2LX9 A;  2ZGW A;  4QVZ A;  3OB9 A;  4KUL A;  5KE3 A;  1VIF A;  4A4K A;  3JB9 J;  1RI0 A;  3M59 A;  1VQN T;  3OMC A;  3OYD A;  2DIQ A;  1WNL A;  2P0Q A;  3MCA B;  1EIF A;  3OYE A;  1BKB A;  1KQ1 A;  3WXM B;  3JRZ A;  4PJO G;  3HP9 A;  1I4K 1;  3RMS A;  1NPP A;  3M55 A;  3TCJ A;  3OYJ A;  3CCJ T;  1Q82 C;  1S72 T;  5GAN 5;  2Y90 A;  4DA4 A;  3OA6 A;  1VQ9 T;  2LTO A;  3QZ9 B;  3M56 A;  3P8H A;  4IKF A;  2O4X B;  2KAF A;  4O5V A;  3CME A;  3TU4 K;  2DIG A;  1D3B B;  4LDU A;  4BE2 A;  1VQN A;  2A3L A;  4MML A;  2JTM A;  3PFS A;  3A8L B;  3QBY A;  5IN1 A;  4PLI A;  2RI2 A;  3NTK A;  1JBM A;  2PVG B;  3HL8 A;  3LGL A;  3CC7 T;  2EIF A;  1W2B A;  4M7D D;  5A0D A;  1MGQ A;  3GPL A;  4KUI A;  1KD1 U;  1BI0 A;  4X9D A;  4EDU A;  4NL3 A;  1H64 1;  5CKB A;  1WPY A;  2RHX A;  3QKJ A;  4GLK A;  1G3T A;  4M75 B;  4XU0 A;  2QEX T;  4R56 A;  1RL2 A;  1NZ9 A;  1K8A C;  1M8V A;  3X25 B;  1K9M U;  3L2Q A;  4LD6 A;  1N27 A;  2DTI A;  5GAN e;  3INZ A;  2XDB A;  3OY9 A;  2B8A A;  4EMG A;  2PU9 B;  1WQ7 A;  4JUV A;  3UWN A;  4RMO A;  4C5E A;  3E9G A;  5HK3 A;  2OTL T;  2RB6 A;  2RJC A;  3M58 A;  3DB4 A;  4OMF B;  3CC7 A;  4E7H A;  2XI9 A;  2PVO B;  2WAC A;  3PT9 A;  4M78 C;  2K3Y A;  4FU6 A;  4M78 G;  5FRN A;  2A7Y A;  2MWO A;  2V8J A;  4OB2 B;  4C0F A;  3NTI A;  4M77 A;  4E7J A;  2BUD A;  2XIC A;  4DQ2 A;  4C92 E;  4HKE A;  4M77 D;  1YI2 A;  2P0K A;  3A8H B;  2QI2 A;  1B34 A;  3DLM A;  1JB0 E;  3QZ5 B;  5GMK m;  4M7D A;  1HXD A;  3VYG A;  2M9U A;  3LGF A;  2DPP B;  3GNG A;  2QA4 A;  4PNO A;  3Q1J A;  5LJ3 d;  3CC4 T;  2KK4 A;  3KUF A;  5D6X A;  5FU6 B;  2R5M A;  1UB4 A;  4E7K A;  1NJI U;  2EJF A;  5J39 A;  3RMQ A;  1Q7Y U;  3P8D A;  1G5V A;  4M77 C;  4V2S A;  4RKU E;  2DTO A;  3G71 A;  3JB9 G;  4CI0 C;  5GAN 8;  3OYK A;  2JZ2 A;  2IVW A;  3OYL A;  3V7C A;  3CD6 T;  2WSE E;  4E7L A;  2QQB A;  4J6X A;  1G3W A;  3FRN A;  4QW2 A;  1VQ6 T;  4JDS A;  4M7D B;  5GAN 3;  2QA4 T;  1M4Z A;  3L1A A;  1VQ9 A;  4J6Y A;  5GAM e;  4DOW A;  2EYQ A;  2K5F A;  1QP3 A;  5KE2 A;  3I56 A;  3L2R A;  3BY7 A;  4M75 D;  2VXF A;  2L8D A;  2WSC E;  3J80 E;  3PTA A;  4ELY C;  1YI2 T;  2R58 A;  3DB3 A;  1VQK A;  3HSB A;  1KG1 A;  5GAN f;  2YLC A;  4Y91 A;  4ZN1 A;  4WF2 A;  2DXC A;  3JCM c;  3JCM d;  1JRI A;  3J7A F;  1IRE B;  4PJO C;  5CK9 A;  2E64 A;  2OAU A;  2VC8 A;  2RD1 A;  2E10 A;  4XU1 A;  1MHN A;  5I21 A;  3G4S A;  2XKO C;  5GMK l;  3RER A;  4LDW A;  4JS5 A;  4C0D C;  4M75 C;  1Y96 A;  5DLQ E;  4QVC A;  1VQ8 T;  4XK8 E;  3OYM A;  3VUB A;  1VQL A;  3PMT A;  3CEY A;  1VQ4 A;  2E12 A;  4M77 G;  2P0P A;  2VGN A;  1VQL T;  2EFI A;  5IAY A;  3QSU A;  4ZGE B;  4M7A C;  2FB7 A;  3OBY A;  4C5I A;  2KDS A;  4BE1 A;  3E1S A;  3OYH A;  3DLL A;  1PSE A;  3V7S A;  5CKD A;  3M4G A;  1NE8 A;  2BIV A;  2XK0 A;  3HRU A;  4QQD A;  3CCM A;  4XQ3 A;  1YJN T;  3CBP A;  3TRE A;  4BI4 A;  2Y4Y A;  2CZ1 B;  4C8Q B;  3CCQ A;  3PNW C;  5FRO A;  4M7A D;  3AHU A;  4OVA A;  4QVD A;  1UGR B;  4M7A E;  3NFC A;  2RJD A;  2LCC A;  2E6Z A;  3VYH B;  4C92 G;  1M90 C;  4M7D G;  4BDY A;  3QXE B;  5GAN g;  3S6W A;  2RHU A;  1XTD A;  3HRT A;  2DTH A;  1QW1 A;  3V8J A;  1DJ7 B;  2E70 A;  2RHI A;  3ME9 A;  4C5G A;  4MMK A;  3CC2 A;  3S3M A;  2LVM A;  2MAM A;  2GF7 A;  5D6Y A;  1B34 B;  3CCU A;  4BDZ A;  5KCO A;  4Y28 E;  2OTJ T;  1OYX A;  2M1H A;  3NTH A;  3QPH A;  4XTY A;  3OS0 A;  3CMA T;  4NS5 A;  2F5K A;  4PJO E;  5GMK i;  4VUB A;  3RIR A;  5DY9 A;  4E7I A;  1YIJ T;  3ZEH A;  1Y71 A;  5GAO p;  4HCZ A;  5LJ5 d;  4JLI A;  3UT1 A;  3WVD B;  2LCL A;  2MF2 A;  3M57 A;  4C0D B;  1M1K U;  3MEA A;  4RCB A;  2F5T X;  5EG2 A;  3RES A;  3G6E A;  1IZ6 A;  2DKG A;  2KSS A;  1VQM T;  2RHZ A;  1Q81 C;  1KHI A;  1ZHI A;  4IUP A;  1Q81 U;  1BYM A;  4HA8 A;  3RKX A;  5LJ3 h;  3HPW A;  2FVU A;  3SB2 A;  2DXU A;  3L2Z A;  3S3N A;  1TH7 A;  1WQW A;  1Y7X A;  5DM7 R;  2DZ9 A;  2L3R A;  4QQG A;  1NJI C;  2RI3 A;  3GLX A;  4M7A F;  1I8F A;  4OB0 B;  3SD4 A;  1YIJ A;  3I56 T;  4ATO A;  3PGG A;  3CMA A;  4J8O A;  2DXB A;  2X35 A;  2X4W A;  4ZTJ A;  3CC2 T;  2E6N A;  1FXX A;  5D6W A;  1YBY A;  2E41 A;  2QTX A;  3C12 A;  1VQ6 A;  5FU6 C;  3R6O A;  4F7U F;  2F69 A;  3H6Z A;  2WSF E;  1V29 B;  4FT4 A;  1XNI A;  4LD9 K;  2LQ8 A;  5FU7 B;  4P5N A;  4HT9 A;  3SFM A;  4RCC A;  3M5A A;  3CBM A;  2KMT A;  2O4X A;  3SWN B;  1X6O A;  4A4F A;  4C5H A;  4FT2 A;  3OYN A;  2EKO A;  3LW5 E;  1VQ8 A;  4LDY A;  3V8L A;  4BY6 B;  1O75 A;  2K57 A;  4RG2 A;  4RG8 A;  4TVR A;  1UEB A;  4F7U B;  5I2S A;  1FX7 A;  3BDL A;  3OSS C;  2G3R A;  1M1F A;  4M78 E;  2EQK A;  1U8R A;  5CKH A;  3KXT A;  3A8O B;  3HHT B;  3CCR A;  1KQ2 A;  3QO3 A;  5LJ3 g;  3JB9 H;  1JJ2 A;  2YRV A;  3DKM A;  4C8Q D;  5GAN d;  3OYF A;  1KD1 C;  2FYK A;  2VV5 A;  4MZP A;  5J26 A;  1N8R C;  5HK0 A;  4HT8 A;  3LX7 A;  3I55 T;  3CC4 A;  2CZ7 B;  3OSV A;  2MWP A;  4A53 A;  4M7A G;  1Q86 C;  2RO0 A;  4KUD K;  2DAQ A;  2YHT A;  3RUX A;  3X24 B;  3CCE A;  4A4E A;  1KC8 U;  1D3B A;  4BE0 A;  4OGC A;  4R55 A;  4OF1 A;  4JJN K;  1G3S A;  2HQX A;  4C92 D;  2JOY A;  4M75 G;  3GF5 A;  4LDV A;  5C6S A;  2K5I A;  2NLU A;  4BI8 B;  4C8Q C;  4F7U G;  5HKC A;  3OS2 A;  3GIB A;  2CS7 A;  3A8M B;  4M77 F;  3UDC A;  3MET A;  1BIB A;  3X20 B;  5GMK e;  3CCV T;  2QEX A;  3M53 A;  4C92 B;  5GMK h;  4XTZ A;  3L2V A;  1K73 U;  3I55 A;  1N9R A;  2EJ9 A;  5IT9 E;  2HAX A;  4ZGJ B;  2RI5 A;  2Y4X A;  3JB9 F;  2DVE A;  2VXE A;  2ZCF B;  5M9O A;  1QVP A;  5LJ3 e;  2YLB A;  4M7D F;  4ME7 A;  5GAN 6;  5GAO q;  2EJG A;  2DXT A;  1BI3 A;  3N5B B;  3JCM V;  3CCR T;  3JB9 D;  4FIB A;  3P8B B;  3FB9 A;  4A4G A;  4E47 A;  3CPW S;  1P92 A;  3MEU A;  4J7I A;  1U1T A;  2R57 A;  3ASK A;  1K73 C;  2IG0 A;  4LDX A;  3URG A;  3OYC A;  4CRI A;  3G6E T;  1VQM A;  2RK2 A;  2KVQ G;  3H8Z A;  4DOV A;  2EWN A;  4OP0 A;  3CCL T;  1BI2 A;  2CZ6 B;  4EMK C;  1G3Y A;  1M9S A;  1OI1 A;  2CYZ B;  5LJ3 j;  4M7D E;  4PJO A;  4PJO F;  2ZPF B;  5CKE A;  3OYA A;  4BD3 A;  3E19 A;  3HFN A;  5CO7 A;  2DZC A;  2JNG A;  2ZPB B;  3J81 E;  1VQO T;  4C92 A;  1X75 C;  2LT1 A;  3A8G B;  4IUQ A;  2K4Y A;  3CXC A;  1VQP T;  4PJO D;  4KBM B;  1Q7Y C;  2GCX A;  4M77 E;  4XAX B;  4O6J A;  4HCB A;  3GNF B;  5HY6 A;  4OB1 B;  1WGS A;  4N4H A;  3PIP A;  3JCM X;  5DLO A;  4NL2 A;  2D6F A;  1Q82 U;  4JRK A;  4XTU A;  3RKW A;  1JJ2 S;  4M7A A;  3CCJ A;  4L6V 5;  3FJP A;  4C8Q A;  2D9T A;  3MEW A;  1HK9 A;  3LH0 A;  2DEQ A;  4X9C A;  3MP1 A;  3VJP A;  5A2Q E;  3X26 B;  1LNX A;  1YJ9 T;  2JVV A;  3X28 B;  2EAY A;  2L5Q A;  4M78 A;  5CKF A;  4C92 C;  4ZGD B;  4YTL A;  3MO8 A;  2HQE A;  2LRQ A;  4EMK B;  2EQJ A;  3CCU T;  2BKD N;  1QP2 A;  4F7U A;  4ZN3 A;  2FL7 A;  3LWI A;  1QVF A;  3QJY A;  3QUI A;  5LJ5 h;  5GAM f;  2QQR A;  1VQP A;  1ZBX A;  3TEE A;  3LYI A;  4X34 A;  3QDR B;  3FEO A;  5LJ5 f;  2P4T A;  1YJW A;  1VQ7 A;  3QG1 A;  4C0Z A;  5KCH A;  3JCM b;  3OMG A;  2ZPG B;  5CIU A;  3CCE T;  3C95 A;  3PIO A;  1WJR A;  5LJ5 g;  3MEV A;  1U1S A;  4J6W A;  4XTV A;  1KQS A;  4Q5W A;  4GY5 A;  2QQS A;  2C06 A;  2JTF A;  3OQ5 A;  4N4I A;  3RKY A;  4ELZ C;  3G4S T;  4OGE A;  3M54 A;  5GAN h;  3OS5 A;  2O01 E;  3ZBD A;  5C0M A;  3JCM Q;  3EFR A;  3L2W A;  3JCM P;  2XD0 A;  1Y07 A;  2RHY A;  3ER0 A;  3JCM J;  3EAE A;  4N0A C;  1O9S A;  1QVG S;  2QXF A;  4M75 E;  3JAM E;  2ZPI B;  4PLL A;  5AYF A;  4PJO B;  3OBW A;  3OS1 A;  4A4H A;  5GMK j;  2D0Q B;  4MZM A;  2K2V A;  5GAN 4;  2X4J A;  5GAN 2;  1LJO A;  4XTW A;  1QVF S;  2MI6 A;  2LC4 A;  2XDP A;  2XHC A;  4XU3 A;  2CKK A;  2MMP A;  2ZPH B;  1YIT A;  2XU8 A;  3OW2 A;  2DJZ A;  3M4Y A;  4C92 F;  3E9F A;  1K9M C;  1S72 A;  3SWN C;  4J5Y A;  4OB3 B;  4C8Q G;  3CCQ T;  5LJ5 j;  1VQ5 A;  1Q86 U;  2V8I A;  4BY6 C;  1I81 A;  4M75 A;  5GAM j;  1I5L A;  5A0L A;  4M75 F;  1WJS A;  5FLX E;  1X01 A;  3L2U A;  5L8R E;  1YHQ A;  2M16 A;  3SDZ A;  2LNV A;  2GQV A;  4J83 A;  3JSC A;  4MDW A;  2E65 A;  4PL6 A;  3V7R A;  4C0G A;  5GAN 7;  4M78 D;  3GP8 A;  2M0O A;  2JUF A;  1Y96 B;  2GFA A;  2I2L A;  3BFM A;  4FSX A;  1UGS B;  1LOJ A;  4M78 F;  5CAI A;  1M1K C;  4D6W A;  1ZQ1 A;  2XG8 D;  5GAO l;  1XOV A;  5CCA A;  3JCM h;  3QHS A;  3OW2 S;  1UGQ B;  3HKS A;  3BW1 A;  2RJF A;  1YJ9 A;  3JCM e;  1VQO A;  2E1H A;  1FWZ A;  4IUT A;  4QQ6 A;  5GAN j;  2OTL A;  2DD4 A;  3L42 A;  3QJ6 A;  3CCS T;  2RM4 A;  2X4Y A;  4M7D C;  4L59 A;  2LQK A;  2PUO B;  4II1 A;  2XDD A;  4JS4 A;  3FC3 A;  2XID A;  4KT0 E;  4N0A A;  1VQ7 T;  4MZT A;  2ZZD A;  1W2B S;  3MHX A;  3FDR A;  2H3J A;  5CVI A;  4BAC A;  4N4G A;  4F7U E;  3VV0 A;  1H3Z A;  3V8K A;  3VUZ A;  4M78 B;  4PKC C;  2QQA A;  2QQ9 A;  4MDX A;  3FIF A;  4C8Q F;  1XQH A;  1YJN A;  1YJW T;  4IUR A;  3CCV A;  5KH6 A;  3CPW A;  1NPR A;  3SWN A;  3CCM T;  1N8R U;  5J3B A;  3MP6 A;  1WJQ A;  4UC4 A;  5GAO m;  3G71 T;  3HRS A;  3CME T;  1AHJ B;  2RA2 A;  3HFO A;  3MP8 A;  1K8A U;  3CD6 A;  2VUB A;  4NOY A;  4XTX A;  4EMH A;  1VQ4 T;  4ZTF A;  3VKI A;  2GFU A;  4IUU A;  5GAO r;  3F70 A;  2LDM A;  3CCS A;  5GAO n;  1UGP B;  3FLG A;  1N9S A;  5LL6 S;  5GAM d;  5CQX A;  4EPC A;  1QVG A;  1BIA A;  2CZ0 B;  5GAM g;  3LLR A;  3M9Q A;  3CXC S;  4Z02 A;  3QYG B;  1BI1 A;  2PQW A;  3WVE B;  3QII A;  5FU7 C;  4FM4 B;  4EMK A;  1M1G A;  5LJ3 f;  2DO3 A;  4XU2 A;  2EQM A;  5FRM A;  1VQK T;  1VUB A;  3OYY A;  3QYH B;  3VU3 C;  3UPU A;  3OYI A;  3BDU A;  4C8Q E;  2HNI A;  2R5A A;  1OZ2 A;  2FHD A;  2HBP A;  3G7Z A;  5I2M A;  2EQU A;  4M7A B;  1N6A A;  3JCM f;  4BUG A;  5CR2 A;  1R8O B;  4FL6 A;  1KC8 C;  3A5Z B;  2DD5 A;  3O8V A;  4B9X A;  1YHQ T;  4JRP A;  1VQ5 T;  2RH2 A;  3C4S A;  2KY9 A;  2AHJ B;  5A0G A;  1YIT T;  4JLG A;  3JCM g;  2ZPE B;  4BI3 A;  3OYB A;  1YCY A;  4A54 A;  5GAM h;  2HD0 A;  1M90 U;  2V8K A;  3ZFJ A;  3KBG A;  4JRI A;  1KHC A;  4B9W A;  2E5Q A;  3PMI A;  3JCM W;  2VGM A;  4L5G A;  1M5Q 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...