2RB6A

X-ray structure of the protein q8ei81. northeast structural genomics consortium target sor78a
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
57
structure length
57
Chain Sequence
b'SSQYIMSTKDGKMITSDSKPKLDKTTGMYLYYDEDGREVMIKQEDVTQIIERLEHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title X-Ray structure of the protein Q8EI81.
rcsb
source organism Shewanella oneidensis
molecule tags Structural genomics, unknown function
total genus 7
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rb6A00
3V8KA 5GMKm 2Y90A 3JB9H 4Y91A 3RKWA 4HT9A 2QTXA 4M77E 4XTZA 3SWNB 4M77C 4EMKB 5GAN4 4XU0A 3RESA 3QUIA 3JCMh 1KQ1A 4C8QA 3BDUA 3V7SA 3JCMg 4M7DF 5GAN3 4M7DD 3RKXA 2EJFA 3JCMX 1JBMA 1WNLA 1WQWA 2FB7A 1MGQA 4M7DG 2RA2A 1WPYA 4M77D 2DZ9A 4QVDA 4JUVA 3L1AA 2EWNA 3QHSA 4M7AG 5GAN7 3AHUA 4M75E 3V7RA 1U1TA 2I2LA 4M75C 3JB9J 4M78D 4M78G 4PJOE 4X9CA 4PJOC 3HFOA 1HXDA 5GMKl 4JLIA 4C92E 4M7DB 3JCMP 1B34B 4C92C 3RKYA 1I81A 3JB9G 2FYKA 5DY9A 4F7UG 4M75D 5GAN6 3JCMJ 4XU2A 2E41A 4NOYA 3EFSA 4PJOD 4M7AB 2VC8A 4N0AC 1LNXA 4N0AA 3RIRA 4M7AF 4C92D 4JRIA 4XTYA 4M78B 2RM4A 1HK9A 3SWNA 4C8QE 4EMKA 4MMLA 4X9DA 4C8QC 2HNIA 2YLBA 5GAMg 3JCMe 3FB9A 2DEQA 2EAYA 5GMKi 3HSBA 4XQ3A 1N9RA 2E10A 3M4GA 4J5YA 5LJ3g 3HFNA 4DQ2A 4F7UB 5GMKh 5GAMj 4QVCA 4M77G 2DZCA 3JB9F 4C8QD 1X01A 5LJ5f 4NL3A 1JRIA 3V8LA 3JCMW 5GAN5 5GMKj 1M5Q1 3RERA 3EFRA 4XU1A 2CGHA 3QO3A 2DKGA 5LJ5h 5LJ5e 2DJZA 4J6WA 1B34A 2VXEA 1U1SA 4OP0A 1BIBA 4M75G 1TH7A 3V8JA 5GAMf 4M77B 5LJ5g 5GAN2 4JRKA 4PJOG 4XTXA 4NL2A 1H641 4M77F 5LJ3f 4HA8A 4M7AA 5LJ5j 4HT8A 4C92G 3SWNC 3BY7A 4PNOA 3RUXA 4EMKC 3JCMQ 5GAMe 5GAMh 1I5LA 4M78F 1KQ2A 1M8VA 5LJ3h 5GAOn 5LJ3e 2DXUA 3BFMA 4A53A 5GAOm 4M75B 2RB6A 5CAIA 5GMKe 3V7CA 1Y96B 4F7UF 4M75F 3JCMd 4PJOB 4C8QG 5GAOr 4EMHA 4PJOF 1D3BB 2K57A 5LJ3j 3BW1A 4C92B 3QSUA 2EJ9A 3FIFA 4C92F 5GANd 2DVEA 2E64A 2ZGWA 5GANg 4M7DE 2EJGA 4M7DC 3PGGA 2JN0A 4A54A 4M7DA 1YCYA 4RCBA 4RCCA 5GAOq 4XTUA 5GANj 4M77A 4XU3A 3JCMV 4C8QB 4J6YA 3GIBA 3INZA 2YHTA 4M7AE 4M7AC 5LJ5d 4C8QF 5GAOl 4M78E 2E65A 1LOJA 4M78C 5GAN8 3JCMb 4M78A 2DXTA 5I21A 4XTVA 4EMGA 5GAOp 4V2SA 4J6XA 3VU3C 1N9SA 4MMKA 4M7AD 4F7UE 2E1HA 2VXFA 3JCMc 5GAMd 1BIAA 2RD1A 4F7UA 4M75A 5GANf 4WF2A 3SB2A 1Y96A 4PJOA 1I8FA 2YLCA 5LJ3d 1WQ7A 1D3BA 2DTHA 2DTOA 2DTIA 4C92A 5GANh 3FJPA 4XTWA 1LJOA 5GANe 3JB9D 3JCMf 1I4K1 3JB9I 3L2ZA
chains in the Genus database with same CATH superfamily
2QI2A 1KQSS 2CH4A 1YJNQ 2R57A 3CD6T 2HSPA 2LT4A 2PUKB 2VVKA 3V7SA 1R77A 3PIPA 4M7DG 2JMCA 1X75C 1MGQA 2RA2A 2BZYA 1S72T 4F17A 4ZTJA 1K0SA 5HKCA 4AFZC 4EDUA 2JOYA 3TCJA 2I2LA 3VV0A 5IN1A 2F2VA 2GCXA 3JCMP 3EFSA 3UATA 3DKMA 4Z8AA 2DA9A 5KYWA 3G4SA 4X34A 2HNIA 5KYYA 2LDMA 2MI6A 3M4YA 2DYBA 1YN8A 3JB9F 1C6VX 5CKFA 2C0IA 2LX7A 4A4HA 1M5Q1 1JU5C 1NE8A 1WZOA 2MMPA 5FLXE 5DLOA 2AK5A 3PE0A 4PJOG 4M77F 2E6ZA 3LGFA 2F1LA 1VQOT 2HQEA 1VQPT 2RQTA 1YITA 1WHMA 3A8GB 2MCNA 2DXUA 3SD4A 4LNPA 3VJPA 5CAIA 1QCOA 2L3SA 2X4JA 3EHRA 2BE9B 1U8RA 3M0QA 2R5MA 1VQ6T 4F14A 3CC4T 4JRPA 1AZGB 1ZBXA 1RAFB 3VUZA 3OBWA 3QG1A 4FU6A 2NWMA 5GAOl 3I55A 1Q7YC 2K5LA 1SF9A 1NG2A 1GFDA 2JNGA 2OTLT 2O4XB 3MPUB 2KDSA 2EQKA 2BE7D 2KK4A 3Q1JA 4C92A 2EKHA 3CCEA 4XTWA 1LJOA 1RAEB 2Z0WA 3CMAT 3SWNB 4M77C 3E9FA 3JCMh 4LDVA 1FYNA 2DL3A 3OMGA 1SHFA 3KBGA 4A4GA 2L8DA 1XNIA 4GY5A 4D6WA 1CKBA 3QPHA 1HXDA 1QCFA 1K76A 4JZ3A 2HEQA 4CC2A 4C0GA 4PJOD 3U23A 1WHLA 4N0AA 5CQYA 4M7AF 1YJNT 1KHCA 1UGPB 1MV0B 1JJ2A 4CC7A 4E6RA 4E7IA 5D6XA 1VQ7T 3WVDB 2ZCFB 4F16A 3OW2A 1H3HA 4OF1A 2FPEA 2DNUA 2R5AA 2ED0A 2F5TX 2VB6A 3FC3A 4M7DF 2JS2A 2LRQA 3CCJA 5IH2A 2HKQB 4E7LA 4EMKC 2DPPB 2NUTB 1SKUB 3VS0A 1PKSA 2FHDA 1JXOA 5LJ3h 2NUPA 2HAXA 5FU7C 1GRIA 5GMKe 1I07A 3V7CA 1M3AA 1VQNA 2K57A 2K2VA 4J8OA 2KMTA 4FSSA 2EJ9A 2ROLA 4M4ZA 5FWCA 1JQQA 4LE9A 2ZGWA 4M7DE 2JN0A 4JPBW 4M7AC 2QDLA 3GP8A 5AYFA 5HK3A 1AWWA 4M78C 3JCMb 2DXTA 1NEGA 2H3JA 3CQTA 4J6XA 3VU3C 4MMKA 1FMKA 1VQLA 2VXFA 4XK8E 2I0NA 2P0PA 3J7AF 3VS1A 3MEUA 5LJ3d 1NEBA 2DTOA 2RJDA 1H3ZA 2FPDA 1M90U 3RKWA 4FW2A 2FG0A 2M16A 5A0DA 3LLRA 4XU0A 2KXDA 2WSFE 3OMCA 1AEYA 2EJFA 2K3BA 2RJEA 1RACB 3F70A 4BY6C 4DOVA 2VUBA 3HL8A 4ZGEB 3HRUA 1OULA 3R6OA 1YJ9Q 2CDTA 4AMCA 2OTJA 5J26A 2XICA 3I55Q 1Z9QA 4J9IA 4AFQC 4PJOE 2LQ8A 2NUZA 5HCKA 1N6AA 4M7DB 2FZCB 1W2BP 4A4KA 3LH5A 1TUDA 2FYKA 4LN2A 1UJYA 4BACA 1UEBA 4BY6B 2XIDA 2RQWA 4XTYA 3CCEQ 3S3NA 3E19A 4BUGA 1G3YA 3CCQQ 4QVCA 2DZCA 3GOXA 3SHWA 3OB9A 1X01A 2FZKB 1ZQ1A 2DFUA 1VQ5A 1B07A 2KNBB 1E6GA 3VS5A 4OP0A 4ATOA 3JV3A 2LVMA 4JRKA 1H641 2ED1A 1TUCA 3CC7A 2EGEA 4C92G 4PNOA 2FEIA 4OB1B 4E7SA 4ZGDB 5CKEA 2RQRA 3M0TA 1QWFA 2M51A 4PJOB 1M3CA 5ECAA 2L2PA 1MNEA 2JS0A 2GGRA 4RTXA 4A63B 1KQSA 4L59A 1IO6A 4M77A 3IQLA 4XU3A 3VS3A 4C8QF 1NYGA 3QKJA 4DEXA 4LUEA 1GCQA 5I22A 4HCZA 4PKCC 3EGXB 4OMPA 2EGCA 3SDZA 2X3WD 2KI7A 2EGAA 4ESRA 4LXCA 2E5KA 1I1JA 1ZUUA 4O6JA 1SG5A 2EQJA 4IUTA 3V8KA 2Y90A 1JXMA 2RHUA 2RJCA 1WHGA 2LCLA 5J39A 2X4XA 1C0MA 2NUTA 3NFCA 2L3PA 2Y4XA 3PFSA 1NPRA 5L23A 3DB3A 4KH0B 3SEMA 1C1AA 3M5AA 1YITT 3HFOA 4JS4A 1VQLQ 1M9SA 2E41A 3MP1A 3LGLA 1TXQA 1SPKA 1MNDA 1X2KA 1NLPC 4L5GA 4C92D 3QWXX 1G3TA 2ECZA 4EMKA 1VA7A 4C8QC 2GBQA 2JW4A 4J9CA 1PWTA 2ZPGB 2E10A 1M90C 1O9SA 5GAMj 4ANJA 1EFNA 4C0ZA 1PSEA 2FL7A 4NL3A 1YJWA 3I55T 3E2UA 1V29B 3CCUA 1PCXA 1QWEA 2XG8D 5FWBA 1K9MU 5LJ5e 2OTJQ 2VXEA 1TH7A 2YRCA 3NPFA 1VQ4Q 4M7AA 5LJ5j 4HT8A 3CCET 1PM3A 5CKHA 3DB4A 4K11A 1TOVA 2YT6A 5CKBA 2QEXQ 3CCQT 1G83A 1RI0A 2DL5A 1AHJB 9ATCB 4KBMB 6AT1B 3M56A 1OOTA 2JXBA 2CYZB 4JJNK 1NJIU 4OMQA 2G6FX 3OYEA 4BDZA 1IGUA 1W6XA 1X6BA 2HKNA 3EG0A 4M7DA 2L5QA 3AT1B 4OB0B 2V8IA 1X69A 1ZA1B 3NGPA 2RHXA 3GIBA 2V8KA 2C0TA 3E1SA 1UGRB 5I21A 3TU4K 5KYXB 1BK2A 2QQRA 3CC7Q 2KE9A 2DMOA 2A7YA 2GFUA 2VV5A 4WTOB 2EPDA 4BD3A 2DO3A 4ZNXA 1T0HA 1PKTA 2DD4A 4IURA 5DLQE 3URGA 5GMKm 5IAYA 5KYWB 4JJBA 1TWBA 3META 2LC4A 5KYYB 5GAN3 4FT4A 2RNAA 2DZ9A 1YIJA 2CP0A 1VQKA 3QHSA 1UJ0A 3V7RA 2W10A 1RI9A 4X1VA 4R0KA 4C92E 3ZFJA 3JB9G 3NTKA 3EGDA 1FMWA 4HKEA 3OS1A 3OYHA 2VYTA 3JCMe 3OSSC 5GMKi 5LJ3g 2C0OA 2AT1B 3L2QA 4M77G 3EGXA 2K4YA 2ZPEB 3MKDA 2ESWA 1ZBJA 2RI5A 3A1PA 1KD1U 3S6WA 1VOMA 3A5ZB 1VQLT 1U1SA 5KYUB 2QQSA 1M4ZA 1JEGA 1VQOQ 2CZ7B 1R0BG 4AT1B 1IHVA 3JCMQ 1WJSA 1I5LA 5KYNA 1K73R 1R0CB 3EG9A 3CCRQ 3DLMA 3E9GA 4QKUA 4BE0A 3VRYA 4C92B 3QSUA 3M57A 1OX9A 5IHIA 3VYGA 4R55A 2OTJT 1YJWQ 1ZUKA 3CC4Q 3CC2A 1D09B 3OYFA 3BDLA 3CCUQ 1K73C 1K9MC 1NJIR 1R8OB 4XTVA 4EMGA 1KC8U 1OPKA 4V2SA 2QEXT 4RTTA 1N9SA 2MYSA 4LDYA 2RD1A 2JTEA 1YNZA 2NYSA 1GBQA 4PJJA 3JB9D 2CKKA 1KQSP 5GANe 3L2ZA 3CCMQ 3CCSA 4JZ4A 1NJIC 5GAN4 3CMEA 3I56A 3OYDA 5D7UA 1VQ5T 1EIFA 4DBHA 4C8QA 4AG1C 1SRLA 4M77D 4QVDA 4M7AG 3CC7T 2V1RA 2F69A 3QJYA 4WCIA 2YDLA 4M78G 1QCNA 2HD0A 4FM4B 2LJ0A 4NOYA 1Q82U 1ZSZC 1N8RU 1SHGA 2HQXA 4E2FB 4PJLA 3NTIA 3C0CA 2NUPB 4XQ3A 5FROA 4PJNA 1VQMA 4DEYA 3J81E 1MHNA 1VQ7Q 1TS9A 5KYXA 4OGEA 2GFAA 1WHHA 3EG2A 3TVTA 1YIJQ 2CGHA 5LJ5h 3REAB 4FL6A 2HSEB 1LPLA 1RUWA 5CR2A 4IUUA 3RUXA 1UB4A 2J7IA 1GXIE 1EZZB 2D0NA 3VS6A 4E7HA 4R56A 2BZXA 2BZ8A 2PQWA 1RAGB 2FPFA 3QYGB 1U5SA 4LD6A 5IXFA 3FIFA 4PLIA 4FW1A 4E7ZA 3LYIA 1VQ9A 2HBPA 1RABB 3ASKA 1KD1C 4JRQA 2P4RA 5LJ5d 4AFUC 3X26B 2YWWA 2KVQG 1BI2A 4M7AD 1Q7YR 4ELYC 3PVQA 3CCRT 1BIAA 1SRMA 4OVAA 1KC8R 2KGTA 3OYYA 3JCMf 1PRMC 4KUDK 3M0RA 1YJWT 1WGSA 1ABOA 2X4YA 4M77E 2CP5A 1UE9A 5KYUA 3CCUT 4M7DD 2KXCA 5GJVB 1ACMB 2DF6A 4PFOA 1KC8C 2IG0A 2QQ9A 2DJQA 2O01E 1PC0A 4F7UG 1YHQA 3P8BB 1RAHB 3CCMT 2LJ1A 4OB2B 1YCSB 1YI2A 1N9RA 5A0GA 2LT1A 2FVUA 2CP7A 3CCSQ 1AOJA 4KT0E 3QZ5B 1DJ7B 1QQJA 4MDXA 4DBRA 4BE2A 5HK0A 3RERA 1D0ZA 4Y28E 4A53A 1M1GA 4M77B 5CO7A 2DILA 3BE3A 4XTXA 5LJ3f 4D8DA 2HCKA 1KG1A 1Q82C 2AZVA 4M78F 1N8RC 2EW3A 3FEOA 3BFMA 5GAOm 1M1KU 4J9BA 4HVUA 1OZ2A 3JCMd 3A8LB 4C8QG 4EMHA 2QGGA 1H92A 2LQWA 1VQMQ 3FLGA 1YIJT 1YP5A 1VQKT 3CCVA 3GNFB 4ME7A 2P84A 2RQUA 4XTUA 4M7AE 2YHTA 2KYBA 4M78E 4PL6A 2VGMA 4B9WA 5HY6A 4HCCA 2E1HA 3G4SQ 3PMTA 3A8OB 5GANh 2PUOB 1ZSZA 2CP6A 3RR6A 3QWYA 4EMKB 2RI3A 1FX7A 2XMFA 3G71A 5FU7B 1UGQB 1VQ9Q 1Y71A 3QBYA 4AFSC 1RADB 3OYAA 1UHCA 1GL5A 2RH2A 1U1TA 1OI1A 3EGUA 3M53A 1PNJA 1YITQ 2QASA 4CC3A 2MF2A 2RJFA 1QVFP 3H41A 3C95A 3P8HA 4M7AB 1UFFA 2QDYB 4AG2C 4J9GA 5GANd 1IB8A 4M78B 3PNWC 4FYVB 2JM9A 3FB9A 3LW5E 2BTTA 2E6NA 3A98A 2H8HA 1KK7A 4C8QD 1IREB 2PU9B 2KY9A 3CXCA 4C5IA 2EQMA 2KQWA 4XU1A 1UDLA 2A37A 5KCOA 2KSSA 3CPWP 1ZHIA 1BIBA 2KROA 3PVLA 2YUOA 3A8HB 4DOWA 1QVFS 1MUZA 1YHQQ 3QDRB 3UA6A 3CCST 2RB6A 3I56T 4F7UF 4M75F 3GPLA 5GAOr 2K2MA 2VASA 2A28A 2QGFB 4II1A 2MOXA 3LX7A 1TUGB 3OYBA 2LX9A 4OMMA 4J7IA 1PHTA 4A4EA 3CPWS 2EFIA 1G5VA 4P5NA 2LCSA 2YXYA 3EG1A 2KT8A 4FYWB 4F7UE 4N4HA 8ATCB 1VIFA 1D3BA 4YTLA 1M1KC 1VQMT 2DTHA 2AIRB 3EGDB 3HTRA 2A08A 4DA4A 1ZA2B 4DBFA 1VYUA 4XTZA 3OYGA 2AKLA 1Y0MA 1G8XA 1WNLA 3CCJQ 2J6KA 4M75C 3G4ST 1KJWA 4BI8B 2YUQA 1XTDA 1PRLC 3RKYA 5M9OA 2RPNA 5FU6C 1S72A 1VYVA 1VQNQ 5KE3A 1IGQA 4C8QE 1UGSB 4MMLA 1UG1A 5DM7R 2DL8A 4HVWA 3EG9B 5CIUA 1BI1A 4F7UB 1VQ9T 2KBTA 1NYFA 1M90R 3G71Q 5GAN5 3N5BB 4QQGA 5FU6B 1TSFA 2DKGA 2L89A 1OX8A 1UECA 3HP9A 3GBQA 2MPXC 4C5GA 1Q81U 4EPCA 3HRSA 4Q5WA 4IIOA 5GAMe 2A3LA 1B7TA 3LWIA 1M8VA 1D0XA 1V76A 1D0YA 2K3XA 3D7SB 2ZPFB 1VQPA 4J9DA 3ZBDA 3I5SA 3NTHA 1VQ8A 2H3EB 1X2QA 2KRSA 2XDBA 4RCCA 2JT4A 5GAOq 2WACA 5CQXA 4C8QB 2AHJB 1WHJA 4FCYA 2QYZA 1YHQT 4J9FA 5GAN8 4M78A 2JZ2A 1BI0A 3CCLA 2YRVA 1PSFA 1ARKA 1VQ6A 3H6ZA 5FRNA 2GTJA 2RN8A 1YI2T 2L3QA 2DTIA 1KQ2A 4E7JA 4BI4A 2CUBA 4HCBA 1K4US 2HMAA 3EH1A 1BBZA 3R6NA 2DRKA 3M55A 1VQ5Q 1OU9A 1RLPC 4C5EA 2GQIA 3JCMg 2F5KA 1MMGA 3QIIA 5FW9A 1J3TA 2HQHA 3JB9J 2LNHB 3G1JA 4RTWA 3SFMA 1G3SA 2CP3A 1O75A 5DY9A 2KEAA 3QYHB 4C0DC 4XU2A 3HHTB 4RMOA 1OV3A 1A0NB 1LNXA 2AZSA 4J9EA 3RIRA 2CUDA 3ZEHA 2YLBA 3CCVT 1Q95G 1X43A 3CCJT 4FYYB 5CVIA 1JRIA 4D8KA 3JCMW 2PVOB 5KH6A 3EFRA 2DK3A 4J7FA 4LDXA 1BB9A 4Z88A 3S3OA 2FZGB 1VQNT 3L2VA 3OBYA 3VYHB 5IHNA 2ZPIB 4GLKA 1W4SA 2LQKA 2DVJA 1UHFA 3I35A 1K9AA 2L0AA 4KRTA 2QAZA 3G71T 3CXCP 3EHQA 2E64A 2DX1A 2QK0A 5GANg 3ZL7C 2VKNA 3C12A 1TU0B 3JCMV 1K1ZA 2X9HA 5KE2A 5CKDA 1Q81C 3OYLA 1K9MR 2ENMA 4F7UA 4M75A 2XK0A 1HD3A 1I8FA 4C5HA 1K0XA 3CXCS 2EBPA 2LJ3A 1WXBA 2PNIA 3PMIA 1WHKA 5IXBA 4MZMA 1VQ8Q 1KQ1A 3BDUA 3RKXA 3OS5A 1JBMA 3M58A 2EVRA 2CSQA 2DIQA 1B3QA 4JUVA 3TQ7P 1OU8A 2YUNA 1GFCA 4LD9K 4Z02A 3WVEB 2A0FB 3CCLQ 1BCMA 4KH1B 1BI3A 1D1CA 1YFNA 3C4SA 5LL6S 1QVFA 4N0AC 4MZTA 5C6SA 1IRXA 1MMAA 4QQ6A 1M30A 1QMCA 2FRYA 4BB7A 2QQAA 3WXMB 2ZAEA 5LJ5f 2MK5A 1Y57A 1MMNA 2GNCA 3CBOA 1PD1A 1B34A 4OMNA 1M2VB 4QW2A 3CPWA 4GBQA 2RK1A 1Z9ZA 2GTOA 3G6EA 4PLLA 5GAMh 3O8VA 1MMDA 1ZLMA 5EG2A 2E4HA 4FIBA 2DVEA 1ZSZB 2P0KA 1VQKQ 3PGGA 1M1FA 2LNVA 2J06A 1YCYA 3ER0A 2B86A 2IIMA 2X35A 4J6YA 2DE0X 1QVGP 1LOJA 2PZ1A 3KFVA 1KD1R 1X6GA 2OAUA 5GAMd 3MO8A 5A2QE 4TVRA 3X25B 3SB2A 4QVZA 1T0JA 2X3XD 1M27C 1GBRA 2P0QA 3PTAA 4RTZA 1I4K1 1H8KA 2LQNA 3M9QA 3JB9I 1HSQA 2V1QA 1K8AU 2KAFA 1QW1A 3H9NA 2SRCA 3JCMX 1WJRA 2IPOB 4IIMA 3EAEA 3PIOA 2D8HA 1VUBA 2OI3A 4O5VA 1QVGS 3AHUA 2DXBA 1M3BA 4M78D 5IT9E 2VGNA 4B9XA 1WIEA 3RDVA 5GAN6 1YWOA 1Q86U 1JB0E 3UT1A 1FWZA 2DL7A 1TTHB 2EYQA 2L3RA 1OQKA 3X20B 4JRIA 2PVDB 2RM4A 1HK9A 1VQ8T 2D6FA 2EYZA 2C06A 3M4GA 2ATCB 3CC2Q 2EYWA 2GQVA 4CI0C 1KFZA 3V8LA 2CZ1B 2O9VA 4XAXB 3CCLT 4OMLA 2R58A 3QO3A 2HDAA 2DXCA 4ORZA 4QQDA 1I0CA 2E5QA 2MWPA 3JSCA 2CH4W 2CP2A 4M75G 5GAN2 4Y92A 2RO0A 1FMVA 3QJ6A 1YJ9A 2X51A 3I9QA 3PT9A 2D8JA 3SWNC 1EX4A 1VYTA 2DL4A 2OAWA 3NMZC 1QVPA 2K5FA 4LUDA 1P92A 3CMEQ 1RAAB 3I56Q 1Q82R 1N8RR 1UTIA 2NLUA 2RK2A 1Y7XA 1D3BB 1QP2A 1WDXA 2Y4YA 1FXXA 1QP3A 2DD5A 4DBQA 3CCQA 2LMJA 3VS4A 4CRIA 1KIKA 5D6YA 2ZPBB 3UDCA 2A36A 3MP6A 1GCQC 4QT7A 1AWXA 1GCPA 4FSXA 1WFWA 1W70A 2YUPA 3G6EQ 2EIFA 5GANf 3FRNA 1Y96A 2YLCA 2PVGB 2VWFA 1SEMA 2E3HA 4PFZA 1YBYA 2FO0A 2K6DA 4N4IA 5A0LA 4Y91A 2EYXA 1M2VA 3QUIA 3TEEA 4B6MA 3H0IA 3EH2A 5J3BA 2EKOA 3MCAB 2KRMA 1BCOA 2KYMA 2E3IA 3L1AA 3REBB 2EWNA 1K8AR 4F04B 1BKBA 4X9CA 4VUBA 4IUQA 3ME9A 2M02A 1I81A 3UA7A 4M75D 2RQVA 3OQ5A 2PTKA 4ELZC 3MJXA 4PJMA 2RHYA 3NHNA 1OZ3A 4X9DA 3J80E 1K8AC 4J5YA 1Q86R 3MEAA 3HFNA 1AT1B 1WXUA 1G3WA 5GMKj 1NLOC 4J6WA 1LVKA 3OYMA 1AD5A 1MV3A 2XDDA 3H8ZA 2RI2A 1Q86C 1N5ZA 3KXTA 3VUBA 2MIOA 4ZTFA 1LCKA 5CK9A 3CC2T 4MZPA 1D1BA 1NZ9A 2K7AA 1XOVA 4PJOF 1AWOA 3CBPA 2O9SA 1I5OB 3VRZA 1F1BB 4M7DC 1KSWA 3MEVA 2F2WA 4BI3A 3M0PA 3INZA 2EQUA 3TSZA 3CEYA 3T9NA 3KUFA 1IXDA 3TREA 1QKXA 1VIEA 2DBMA 2F2XA 4RTVA 2M0YA 2COWA 3JCMc 3CMET 3MHXA 1VQ4A 3OS2A 2CS7A 4OB3B 1RL2A 3LH0A 5KCHA 1YI2Q 1WQ7A 1XQHA 1V1CA 1NPPA 2JVVA 3FJPA 2XI9A 2QEXA 3VKIA 2HZYA 1M1KR 4E7KA 2QTVA 2DYIA 3I5RA 3RESA 4CC4B 1N27A 3OYCA 3X28B 4OGCA 5GJWB 2V8JA 3HKSA 3G6ET 5GAN7 4M75E 4PFPA 3UPUA 1QKWA 3A8MB 5C0MA 1HYOA 2DLPA 2O4XA 4PJOC 2QA4A 2RF0A 2CT4A 1JO8A 2KT1A 2XHCA 1W2BS 4FYXB 2BIVA 3O5ZA 1OPLA 2JM8A 7AT1B 3SWNA 1QLYA 5GAMg 2AKKA 2DEQA 3CCVQ 2IVWA 4JJCA 3UWNA 1WYXA 2GF7A 4ZN1A 2FRWA 2KRNA 3JAME 2O88A 3M59A 3ULRB 4UC4A 3CD6A 1WA7A 4JJDA 1OEBA 5LJ5g 2XU8A 2LTOA 2YRDA 3L2UA 2MAMA 1ZUYA 2DEUA 2LCCA 1YWPA 3RMQA 4OMFB 5GAOn 4KGZB 4FT2A 4M75B 1T3SA 3HPWA 3EG3A 1CKAA 3OSVA 3L42A 2CREA 3L2WA 2RHZA 2WSCE 1ZSGA 4LDUA 4RTYA 4RG8A 2MWOA 2CZ6B 3VS7A 4KGVB 2E65A 2JTMA 2LZ6B 1QVGA 5GAOp 2EYYA 4RUGA 1M2OA 4L6V5 5L8RE 1ZX6A 3UF4A 2O31A 1WJQA 1VQOA 2CSIA 5EC7A 2JUFA 3OS0A 1SSHA 2B8AA 3JB9H 1NM7A 4HT9A 1ABQA 3CCRA 2XD0A 2DIGA 2WSEE 1WQWA 2D1XA 1WXTA 1AVZC 2QG9B 3LWHA 1E6HA 1YJ9T 2E12A 4JLGA 2X4WA 3CC4A 1IHWA 2K79A 2OJ2A 1U06A 2JTFA 4KGXB 3FDRA 2D9TA 5GMKl 5I2MA 1K73U 1B34B 2M1HA 2OX7A 2ZPHB 4ZN3A 1X6OA 3OYKA 2K9GA 2OTLA 4JDSA 4RTUA 4RG2A 4Z89A 3G7ZA 1PD0A 2EAYA 3HSBA 2DBKA 1JJ2P 4DQ2A 3GLXA 5GMKh 4N4GA 3CPFA 2KR3A 3CCMA 4HVVA 3CMAA 3OW2P 3EFOB 3RNJA 3MEWA 4ZGJB 2XDPA 1WX6A 1SSFA 3CBMA 3V8JA 4IUVA 3OYJA 2DM1A 4NL2A 3QXEB 2QA4Q 1T3LA 1BU1A 4IUPA 3RMSA 2LP5A 3QZ9B 2COZA 1JJ2S 2G3RA 3H0HA 3BW1A 1YJNA 3X24B 4C92F 4C0DB 1AWJA 1UUEA 8AT1B 3OW2S 4RCBA 2DERA 5I11A 2RMOA 1VQ7A 3S3MA 1X27A 2RHIA 3CD6Q 3OYNA 4OMOA 1AZEA 1HJDA 1S72Q 1Y07A 2BKDN 2CT3A 2DAQA 4BE1A 4WF2A 5D6WA 4PJOA 1Q81R 2DETA 1OYXA 1U3OA 4C0FA 3OA6A 2M9UA 3THKA 2QQBA 4IKFA 3TSWA 4BDYA 2QTXA 4HCKA 3OYIA 3OY9A 1RLQC 2K3YA 2ZZDA 5FRMA 2FB7A 2J6FA 1D1AA 1WPYA 2YSQA 2BUDA 4LDWA 5CCAA 4HXJA 3GNGA 4JLIA 5I2SA 4C92C 1NBEB 1TG0A 3HRTA 3VS2A 3JCMJ 3M0SA 1RAIB 2HBWA 1IZ6A 3C94A 2VC8A 3P8DA 4E47A 1VQPQ 2ROTA 1G2BA 2V26A 5AT1B 1PG5B 2M0OA 3FJ5A 3RBBB 2J6OA 2JJ9A 1WLPB 3L2RA 3M0UA 4KUIA 2K5IA 1BYMA 4J9HA 4JS5A 3M54A 2DJZA 5GAMf 1VQ6Q 1Q7YU 2HL3A 5IHKA 1VQ4T 4J83A 4HA8A 2JMAA 4KULA 2EQIA 1UGVA 3BY7A 2XKOC 4MDWA 4EIKA 2DRMA 5LJ3e 2O2OA 1E7OA 2P4TA 2QXFA 2OTLQ 3DLLA 1Y96B 2W0ZA 5LJ3j 3MP8A 4GLMA 4NS5A 1W1FA 4PK4A 1KHIA 4RKUE 2EJGA 3GF5A 1M8MA 4A54A 4A4FA 3CMAQ 5GANj 3H0FA 2QA4T 1XJWB 2COYA 3JRZA 2CZ0B 2SEMA 2J05A 2E70A 2ABLA 1CSKA 3QDFA 1S1NA 2HL5C 1WI7A 2D0QB 1W2BA 3EFOA
chains in the Genus database with same CATH topology
4DA4A 5A0LA 5GMKm 2QI2A 4Y91A 1KQSS 5IAYA 4XTZA 3META 3OYGA 2LC4A 2R57A 3QUIA 3CD6T 2LT4A 2PUKB 3TEEA 3V7SA 5GAN3 3PIPA 4M7DG 4FT4A 1WNLA 1X75C 1MGQA 5J3BA 2RA2A 2EKOA 3MCAB 2DZ9A 1YIJA 1S72T 4ZTJA 1VQKA 5HKCA 3L1AA 2EWNA 3QHSA 4EDUA 2JOYA 3TCJA 2I2LA 3V7RA 4M75C 3G4ST 4BI8B 1BKBA 4X9CA 4VUBA 3VV0A 4IUQA 5IN1A 1XTDA 3ME9A 4C92E 2GCXA 3JCMP 3ZFJA 3RKYA 1I81A 3JB9G 3NTKA 4M75D 5M9OA 3OQ5A 5FU6C 3EFSA 1S72A 4HKEA 4ELZC 3DKMA 3OS1A 3OYHA 5KE3A 3G4SA 4C8QE 2RHYA 1UGSB 2VYTA 1OZ3A 4MMLA 2HNIA 4X34A 4X9DA 3JCMe 3J80E 3OSSC 5GMKi 5DM7R 1K8AC 2LDMA 2MI6A 3M4YA 3MEAA 4J5YA 5LJ3g 3HFNA 5CIUA 1BI1A 4F7UB 3L2QA 1VQ9T 4M77G 3JB9F 2K4YA 5CKFA 2ZPEB 5GAN5 4A4HA 1G3WA 2RI5A 5GMKj 1M5Q1 1KD1U 3N5BB 4QQGA 5FU6B 3S6WA 1NE8A 2DKGA 3A5ZB 1VQLT 2L89A 2MMPA 1U1SA 4J6WA 2QQSA 3OYMA 5FLXE 5DLOA 3HP9A 4PJOG 4C5GA 4M77F 2E6ZA 1M4ZA 3LGFA 2XDDA 1Q81U 3H8ZA 4EPCA 1VQOT 3HRSA 2RI2A 4Q5WA 2HQEA 2CZ7B 1VQPT 1Q86C 3JCMQ 3KXTA 5GAMe 1WJSA 3VUBA 4ZTFA 1I5LA 2A3LA 1YITA 3LWIA 1M8VA 5CK9A 3A8GB 3CC2T 2DXUA 3SD4A 4MZPA 3VJPA 1NZ9A 5CAIA 3DLMA 3E9GA 2K3XA 4BE0A 1XOVA 4PJOF 2ZPFB 2X4JA 4C92B 3QSUA 1VQPA 3CBPA 3ZBDA 1VQ8A 3NTHA 3M57A 1U8RA 3VYGA 4M7DC 2R5MA 4R55A 1VQ6T 2OTJT 3CC4T 2XDBA 4JRPA 3CC2A 3MEVA 4RCCA 4BI3A 5GAOq 1ZBXA 2WACA 5CQXA 3BDLA 3OYFA 3VUZA 3OBWA 4C8QB 3INZA 2EQUA 2AHJB 3QG1A 3CEYA 4FU6A 3T9NA 3KUFA 1K73C 1K9MC 5GAOl 3I55A 1Q7YC 1YHQT 2K5LA 5GAN8 4M78A 2JZ2A 1R8OB 4XTVA 4EMGA 1BI0A 1KC8U 4V2SA 2QEXT 3CCLA 1N9SA 3TREA 1VIEA 2YRVA 1PSFA 2JNGA 2OTLT 1VQ6A 4LDYA 3JCMc 2O4XB 3H6ZA 3MHXA 2RD1A 3CMET 1VQ4A 5FRNA 3OS2A 2CS7A 2KDSA 4OB3B 1RL2A 2EQKA 3LH0A 5KCHA 1YI2T 1WQ7A 1XQHA 3JB9D 2KK4A 2DTIA 3Q1JA 2CKKA 1NPPA 2JVVA 3FJPA 4XTWA 1LJOA 4BI4A 4C92A 5GANe 3CCEA 4E7JA 2XI9A 2QEXA 3L2ZA 4HCBA 3VKIA 4E7KA 3CCSA 1NJIC 3SWNB 5GAN4 4M77C 3E9FA 3OYDA 3I56A 3CMEA 3CMAT 3RESA 3M55A 1VQ5T 1EIFA 3JCMh 4C8QA 4LDVA 4C5EA 3JCMg 1N27A 3OYCA 3X28B 2F5KA 4OGCA 3OMGA 4M77D 4QVDA 3KBGA 2V8JA 3HKSA 2L8DA 3QIIA 4A4GA 4M7AG 3G6ET 5GAN7 3CC7T 4M75E 1XNIA 2F69A 3QJYA 3UPUA 4GY5A 3A8MB 4D6WA 5C0MA 3JB9J 2O4XA 4M78G 4PJOC 3QPHA 3SFMA 1HXDA 1G3SA 2HD0A 4FM4B 2QA4A 1O75A 5DY9A 3QYHB 4C0DC 4XU2A 3HHTB 2XHCA 4NOYA 4C0GA 1W2BS 4RMOA 1Q82U 1N8RU 2HQXA 4PJOD 2BIVA 1LNXA 4N0AA 5CQYA 3RIRA 4M7AF 1YJNT 1KHCA 1UGPB 3SWNA 5GAMg 3ZEHA 2YLBA 3NTIA 3CCVT 2DEQA 4XQ3A 2IVWA 5FROA 3UWNA 1VQMA 1JJ2A 3CCJT 3J81E 4E7IA 2GF7A 1MHNA 5D6XA 1VQ7T 4ZN1A 5CVIA 1JRIA 3WVDB 4OGEA 2ZCFB 2PVOB 3JAME 3JCMW 3M59A 5KH6A 2GFAA 3OW2A 4OF1A 2R5AA 3EFRA 4UC4A 3CD6A 2CGHA 2F5TX 2DK3A 4J7FA 5LJ5h 4LDXA 3FC3A 4M7DF 5LJ5g 2LRQA 2XU8A 2LTOA 4FL6A 3CCJA 3L2UA 3S3OA 1VQNT 3L2VA 3OBYA 2MAMA 5CR2A 4IUUA 3VYHB 4EMKC 4E7LA 2DPPB 3RUXA 1UB4A 2ZPIB 4GLKA 1W4SA 2LCCA 2LQKA 1KQ2A 2FHDA 4OMFB 3RMQA 5LJ3h 5GAOn 1GXIE 2HAXA 4E7HA 5FU7C 4R56A 4FT2A 4M75B 3HPWA 5GMKe 3V7CA 2PQWA 1VQNA 2K57A 2K2VA 3QYGB 4J8OA 4LD6A 2KMTA 3OSVA 3G71T 3L42A 2EJ9A 3FIFA 3L2WA 4PLIA 2E64A 5GANg 2ZGWA 4M7DE 2JN0A 2RHZA 3LYIA 1VQ9A 3C12A 2HBPA 2WSCE 4LDUA 3ASKA 1KD1C 3JCMV 4JRQA 4M7AC 4RG8A 5KE2A 3GP8A 2MWOA 5LJ5d 5AYFA 2CZ6B 5HK3A 2E65A 4M78C 3X26B 2JTMA 5CKDA 3JCMb 1QVGA 2DXTA 5GAOp 2H3JA 2KVQG 4J6XA 3VU3C 1BI2A 4MMKA 1Q81C 3OYLA 4M7AD 1VQLA 4L6V5 4ELYC 2VXFA 4XK8E 3CCRT 1BIAA 4F7UA 4M75A 5L8RE 2P0PA 2XK0A 3J7AF 3MEUA 1I8FA 4OVAA 1WJQA 5LJ3d 4C5HA 1VQOA 2JUFA 2DTOA 2RJDA 3OS0A 4KUDK 3OYYA 3JCMf 2B8AA 1H3ZA 3CXCS 1YJWT 1WGSA 3JB9H 1M90U 3RKWA 2X4YA 4HT9A 4M77E 3PMIA 2M16A 3CCRA 5A0DA 3LLRA 4XU0A 3CCUT 2WSFE 4MZMA 2XD0A 3OMCA 1KQ1A 2DIGA 2WSEE 3BDUA 4M7DD 3RKXA 2EJFA 2RJEA 1JBMA 1WQWA 3F70A 3M58A 3OS5A 4BY6C 2VUBA 4DOVA 3HL8A 4ZGEB 3HRUA 2DIQA 3LWHA 1YJ9T 4JUVA 2E12A 3R6OA 4JLGA 2OTJA 2X4WA 3CC4A 5J26A 2XICA 4LD9K 4PJOE 4Z02A 3WVEB 1KC8C 2IG0A 2JTFA 2LQ8A 2QQ9A 1N6AA 3FDRA 2D9TA 5GMKl 2O01E 5I2MA 4M7DB 1BI3A 1K73U 1B34B 2M1HA 4A4KA 2FYKA 4F7UG 1YHQA 3C4SA 3P8BB 5LL6S 2ZPHB 4ZN3A 1QVFA 1X6OA 4N0AC 3OYKA 4MZTA 5C6SA 3CCMT 4BACA 2OTLA 1UEBA 4OB2B 4QQ6A 4BY6B 2XIDA 4JDSA 4XTYA 4RG2A 4BB7A 3G7ZA 1YI2A 2EAYA 3HSBA 2QQAA 3S3NA 1N9RA 3E19A 2LT1A 4BUGA 5A0GA 1G3YA 2FVUA 4DQ2A 3GLXA 5GMKh 4KT0E 4N4GA 3WXMB 2DZCA 4QVCA 3QZ5B 3CPFA 3OB9A 1DJ7B 3GOXA 1X01A 5LJ5f 4MDXA 3CCMA 1ZQ1A 4BE2A 5HK0A 3CMAA 1VQ5A 3RERA 3MEWA 4ZGJB 3CBOA 2XDPA 4Y28E 1SSFA 3CBMA 1B34A 4OP0A 3V8JA 4A53A 4QW2A 3CPWA 2LVMA 1M1GA 4ATOA 4M77B 5CO7A 4IUVA 3OYJA 4JRKA 4XTXA 4NL2A 2RK1A 1H641 3QXEB 5LJ3f 3G6EA 3CC7A 4PLLA 4C92G 4PNOA 5GAMh 3O8VA 1KG1A 1Q82C 4M78F 4IUPA 4OB1B 3RMSA 1N8RC 4ZGDB 3QZ9B 5CKEA 3FEOA 3BFMA 5GAOm 1M1KU 5EG2A 1OZ2A 3JCMd 4PJOB 3A8LB 4C8QG 1JJ2S 4EMHA 2G3RA 3BW1A 1YJNA 4FIBA 3X24B 4C92F 3FLGA 4C0DB 1YIJT 1KQSA 2DVEA 1VQKT 2P0KA 3CCVA 4L59A 3GNFB 3PGGA 3OW2S 1M1FA 2LNVA 4ME7A 1YCYA 4RCBA 3ER0A 4XTUA 1VQ7A 4M77A 4XU3A 2RHIA 3S3MA 2X35A 4J6YA 4M7AE 2YHTA 4C8QF 3QKJA 3OYNA 4M78E 1LOJA 4PL6A 2VGMA 2OAUA 4B9WA 4HCZA 5HY6A 4PKCC 1Y07A 2BKDN 3SDZA 4HCCA 2DAQA 4BE1A 2E1HA 3MO8A 5GAMd 5A2QE 4TVRA 3X25B 4WF2A 3SB2A 4QVZA 5D6WA 4PJOA 1OYXA 1Q7YU 3PMTA 3A8OB 4C0FA 4O6JA 5GANh 2P0QA 3OA6A 2PUOB 3PTAA 2M9UA 1I4K1 2QQBA 2EQJA 3M9QA 3JB9I 4IUTA 3V8KA 4IKFA 2Y90A 1K8AU 2KAFA 4BDYA 2QTXA 1QW1A 2RI3A 4EMKB 2RHUA 2RJCA 3OYIA 3OY9A 2LCLA 2K3YA 2ZZDA 5J39A 5FRMA 1FX7A 3JCMX 2FB7A 3G71A 1WJRA 2X4XA 3EAEA 5FU7B 1UGQB 1VUBA 1WPYA 3PIOA 1Y71A 3NFCA 3QBYA 2Y4XA 3PFSA 4O5VA 1NPRA 3OYAA 2BUDA 1QVGS 3DB3A 4LDWA 3AHUA 2DXBA 1U1TA 2RH2A 5CCAA 1OI1A 4M78D 3M5AA 3M53A 1YITT 3HFOA 4JS4A 3GNGA 4JLIA 5I2SA 4C92C 5IT9E 2VGNA 2MF2A 1M9SA 2RJFA 3HRTA 4B9XA 5GAN6 3JCMJ 1Q86U 1JB0E 2E41A 3LGLA 3MP1A 3UT1A 3C95A 1IZ6A 1FWZA 3P8HA 3C94A 2VC8A 3P8DA 4M7AB 2QDYB 4L5GA 2EYQA 2L3RA 4E47A 4C92D 1G3TA 4JRIA 3X20B 2PVDB 2RM4A 1HK9A 3PNWC 4M78B 4EMKA 5GANd 4C8QC 1VQ8T 2D6FA 3FB9A 2ZPGB 1M90C 2E10A 3LW5E 3M4GA 2C06A 1O9SA 2E6NA 5GAMj 2GQVA 4C0ZA 1PSEA 2FL7A 2M0OA 4C8QD 4CI0C 1IREB 4NL3A 1YJWA 2PU9B 3V8LA 3I55T 3L2RA 2CZ1B 2KY9A 1V29B 3CXCA 4KUIA 2EQMA 2KQWA 2K5IA 4C5IA 3CCUA 1BYMA 4XAXB 3CCLT 4XU1A 2R58A 2XG8D 3QO3A 5KCOA 2DXCA 2KSSA 4JS5A 3M54A 1K9MU 5LJ5e 1ZHIA 2DJZA 2E5QA 2VXEA 2MWPA 3JSCA 1BIBA 4M75G 1TH7A 4QQDA 5GAMf 5GAN2 1VQ4T 4J83A 2RO0A 3QJ6A 1YJ9A 4HA8A 4KULA 4M7AA 5LJ5j 3PT9A 4HT8A 3A8HB 4DOWA 1QVFS 3SWNC 3BY7A 3CCET 2XKOC 4MDWA 3QDRB 5CKHA 3DB4A 5CKBA 5LJ3e 3CCQT 1QVPA 1RI0A 2P4TA 1AHJB 2K5FA 2QXFA 3CCST 2RB6A 3I56T 3DLLA 1P92A 4KBMB 1Y96B 4F7UF 4M75F 2NLUA 3GPLA 2RK2A 5GAOr 1Y7XA 1D3BB 3M56A 3MP8A 5LJ3j 1QP2A 2Y4YA 2CYZB 4NS5A 4JJNK 1NJIU 4II1A 1QP3A 1FXXA 1KHIA 4RKUE 3OYEA 4BDZA 3LX7A 2DD5A 2EJGA 3GF5A 4A54A 3OYBA 4M7DA 2L5QA 2LX9A 3CCQA 4J7IA 4OB0B 4CRIA 2V8IA 4A4FA 5GANj 5D6YA 3GIBA 2RHXA 4A4EA 3CPWS 2QA4T 2EFIA 2V8KA 2ZPBB 4P5NA 3UDCA 1G5VA 3E1SA 1UGRB 3MP6A 5I21A 3JRZA 4FSXA 2CZ0B 3TU4K 4F7UE 2EIFA 2QQRA 5GANf 2E70A 4N4HA 3FRNA 2A7YA 1VIFA 2GFUA 1Y96A 2VV5A 2YLCA 2PVGB 1D3BA 4BD3A 2DO3A 4YTLA 2D0QB 1VQMT 1YBYA 2DTHA 1W2BA 1M1KC 2DD4A 4IURA 5DLQE 3URGA 4N4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V8K A;  5GMK m;  2Y90 A;  3JB9 H;  4Y91 A;  3RKW A;  4HT9 A;  2QTX A;  4M77 E;  4XTZ A;  3SWN B;  4M77 C;  4EMK B;  5GAN 4;  4XU0 A;  3RES A;  3QUI A;  3JCM h;  1KQ1 A;  4C8Q A;  3BDU A;  3V7S A;  3JCM g;  4M7D F;  5GAN 3;  4M7D D;  3RKX A;  2EJF A;  3JCM X;  1JBM A;  1WNL A;  1WQW A;  2FB7 A;  1MGQ A;  4M7D G;  2RA2 A;  1WPY A;  4M77 D;  2DZ9 A;  4QVD A;  4JUV A;  3L1A A;  2EWN A;  3QHS A;  4M7A G;  5GAN 7;  3AHU A;  4M75 E;  3V7R A;  1U1T A;  2I2L A;  4M75 C;  3JB9 J;  4M78 D;  4M78 G;  4PJO E;  4X9C A;  4PJO C;  3HFO A;  1HXD A;  5GMK l;  4JLI A;  4C92 E;  4M7D B;  3JCM P;  1B34 B;  4C92 C;  3RKY A;  1I81 A;  3JB9 G;  2FYK A;  5DY9 A;  4F7U G;  4M75 D;  5GAN 6;  3JCM J;  4XU2 A;  2E41 A;  4NOY A;  3EFS A;  4PJO D;  4M7A B;  2VC8 A;  4N0A C;  1LNX A;  4N0A A;  3RIR A;  4M7A F;  4C92 D;  4JRI A;  4XTY A;  4M78 B;  2RM4 A;  1HK9 A;  3SWN A;  4C8Q E;  4EMK A;  4MML A;  4X9D A;  4C8Q C;  2HNI A;  2YLB A;  5GAM g;  3JCM e;  3FB9 A;  2DEQ A;  2EAY A;  5GMK i;  3HSB A;  4XQ3 A;  1N9R A;  2E10 A;  3M4G A;  4J5Y A;  5LJ3 g;  3HFN A;  4DQ2 A;  4F7U B;  5GMK h;  5GAM j;  4QVC A;  4M77 G;  2DZC A;  3JB9 F;  4C8Q D;  1X01 A;  5LJ5 f;  4NL3 A;  1JRI A;  3V8L A;  3JCM W;  5GAN 5;  5GMK j;  1M5Q 1;  3RER A;  3EFR A;  4XU1 A;  2CGH A;  3QO3 A;  2DKG A;  5LJ5 h;  5LJ5 e;  2DJZ A;  4J6W A;  1B34 A;  2VXE A;  1U1S A;  4OP0 A;  1BIB A;  4M75 G;  1TH7 A;  3V8J A;  5GAM f;  4M77 B;  5LJ5 g;  5GAN 2;  4JRK A;  4PJO G;  4XTX A;  4NL2 A;  1H64 1;  4M77 F;  5LJ3 f;  4HA8 A;  4M7A A;  5LJ5 j;  4HT8 A;  4C92 G;  3SWN C;  3BY7 A;  4PNO A;  3RUX A;  4EMK C;  3JCM Q;  5GAM e;  5GAM h;  1I5L A;  4M78 F;  1KQ2 A;  1M8V A;  5LJ3 h;  5GAO n;  5LJ3 e;  2DXU A;  3BFM A;  4A53 A;  5GAO m;  4M75 B;  2RB6 A;  5CAI A;  5GMK e;  3V7C A;  1Y96 B;  4F7U F;  4M75 F;  3JCM d;  4PJO B;  4C8Q G;  5GAO r;  4EMH A;  4PJO F;  1D3B B;  2K57 A;  5LJ3 j;  3BW1 A;  4C92 B;  3QSU A;  2EJ9 A;  3FIF A;  4C92 F;  5GAN d;  2DVE A;  2E64 A;  2ZGW A;  5GAN g;  4M7D E;  2EJG A;  4M7D C;  3PGG A;  2JN0 A;  4A54 A;  4M7D A;  1YCY A;  4RCB A;  4RCC A;  5GAO q;  4XTU A;  5GAN j;  4M77 A;  4XU3 A;  3JCM V;  4C8Q B;  4J6Y A;  3GIB A;  3INZ A;  2YHT A;  4M7A E;  4M7A C;  5LJ5 d;  4C8Q F;  5GAO l;  4M78 E;  2E65 A;  1LOJ A;  4M78 C;  5GAN 8;  3JCM b;  4M78 A;  2DXT A;  5I21 A;  4XTV A;  4EMG A;  5GAO p;  4V2S A;  4J6X A;  3VU3 C;  1N9S A;  4MMK A;  4M7A D;  4F7U E;  2E1H A;  2VXF A;  3JCM c;  5GAM d;  1BIA A;  2RD1 A;  4F7U A;  4M75 A;  5GAN f;  4WF2 A;  3SB2 A;  1Y96 A;  4PJO A;  1I8F A;  2YLC A;  5LJ3 d;  1WQ7 A;  1D3B A;  2DTH A;  2DTO A;  2DTI A;  4C92 A;  5GAN h;  3FJP A;  4XTW A;  1LJO A;  5GAN e;  3JB9 D;  3JCM f;  1I4K 1;  3JB9 I;  3L2Z A; 
#chains in the Genus database with same CATH topology
 2QI2 A;  1KQS S;  2CH4 A;  1YJN Q;  2R57 A;  3CD6 T;  2HSP A;  2LT4 A;  2PUK B;  2VVK A;  3V7S A;  1R77 A;  3PIP A;  4M7D G;  2JMC A;  1X75 C;  1MGQ A;  2RA2 A;  2BZY A;  1S72 T;  4F17 A;  4ZTJ A;  1K0S A;  5HKC A;  4AFZ C;  4EDU A;  2JOY A;  3TCJ A;  2I2L A;  3VV0 A;  5IN1 A;  2F2V A;  2GCX A;  3JCM P;  3EFS A;  3UAT A;  3DKM A;  4Z8A A;  2DA9 A;  5KYW A;  3G4S A;  4X34 A;  2HNI A;  5KYY A;  2LDM A;  2MI6 A;  3M4Y A;  2DYB A;  1YN8 A;  3JB9 F;  1C6V X;  5CKF A;  2C0I A;  2LX7 A;  4A4H A;  1M5Q 1;  1JU5 C;  1NE8 A;  1WZO A;  2MMP A;  5FLX E;  5DLO A;  2AK5 A;  3PE0 A;  4PJO G;  4M77 F;  2E6Z A;  3LGF A;  2F1L A;  1VQO T;  2HQE A;  1VQP T;  2RQT A;  1YIT A;  1WHM A;  3A8G B;  2MCN A;  2DXU A;  3SD4 A;  4LNP A;  3VJP A;  5CAI A;  1QCO A;  2L3S A;  2X4J A;  3EHR A;  2BE9 B;  1U8R A;  3M0Q A;  2R5M A;  1VQ6 T;  4F14 A;  3CC4 T;  4JRP A;  1AZG B;  1ZBX A;  1RAF B;  3VUZ A;  3OBW A;  3QG1 A;  4FU6 A;  2NWM A;  5GAO l;  3I55 A;  1Q7Y C;  2K5L A;  1SF9 A;  1NG2 A;  1GFD A;  2JNG A;  2OTL T;  2O4X B;  3MPU B;  2KDS A;  2EQK A;  2BE7 D;  2KK4 A;  3Q1J A;  4C92 A;  2EKH A;  3CCE A;  4XTW A;  1LJO A;  1RAE B;  2Z0W A;  3CMA T;  3SWN B;  4M77 C;  3E9F A;  3JCM h;  4LDV A;  1FYN A;  2DL3 A;  3OMG A;  1SHF A;  3KBG A;  4A4G A;  2L8D A;  1XNI A;  4GY5 A;  4D6W A;  1CKB A;  3QPH A;  1HXD A;  1QCF A;  1K76 A;  4JZ3 A;  2HEQ A;  4CC2 A;  4C0G A;  4PJO D;  3U23 A;  1WHL A;  4N0A A;  5CQY A;  4M7A F;  1YJN T;  1KHC A;  1UGP B;  1MV0 B;  1JJ2 A;  4CC7 A;  4E6R A;  4E7I A;  5D6X A;  1VQ7 T;  3WVD B;  2ZCF B;  4F16 A;  3OW2 A;  1H3H A;  4OF1 A;  2FPE A;  2DNU A;  2R5A A;  2ED0 A;  2F5T X;  2VB6 A;  3FC3 A;  4M7D F;  2JS2 A;  2LRQ A;  3CCJ A;  5IH2 A;  2HKQ B;  4E7L A;  4EMK C;  2DPP B;  2NUT B;  1SKU B;  3VS0 A;  1PKS A;  2FHD A;  1JXO A;  5LJ3 h;  2NUP A;  2HAX A;  5FU7 C;  1GRI A;  5GMK e;  1I07 A;  3V7C A;  1M3A A;  1VQN A;  2K57 A;  2K2V A;  4J8O A;  2KMT A;  4FSS A;  2EJ9 A;  2ROL A;  4M4Z A;  5FWC A;  1JQQ A;  4LE9 A;  2ZGW A;  4M7D E;  2JN0 A;  4JPB W;  4M7A C;  2QDL A;  3GP8 A;  5AYF A;  5HK3 A;  1AWW A;  4M78 C;  3JCM b;  2DXT A;  1NEG A;  2H3J A;  3CQT A;  4J6X A;  3VU3 C;  4MMK A;  1FMK A;  1VQL A;  2VXF A;  4XK8 E;  2I0N A;  2P0P A;  3J7A F;  3VS1 A;  3MEU A;  5LJ3 d;  1NEB A;  2DTO A;  2RJD A;  1H3Z A;  2FPD A;  1M90 U;  3RKW A;  4FW2 A;  2FG0 A;  2M16 A;  5A0D A;  3LLR A;  4XU0 A;  2KXD A;  2WSF E;  3OMC A;  1AEY A;  2EJF A;  2K3B A;  2RJE A;  1RAC B;  3F70 A;  4BY6 C;  4DOV A;  2VUB A;  3HL8 A;  4ZGE B;  3HRU A;  1OUL A;  3R6O A;  1YJ9 Q;  2CDT A;  4AMC A;  2OTJ A;  5J26 A;  2XIC A;  3I55 Q;  1Z9Q A;  4J9I A;  4AFQ C;  4PJO E;  2LQ8 A;  2NUZ A;  5HCK A;  1N6A A;  4M7D B;  2FZC B;  1W2B P;  4A4K A;  3LH5 A;  1TUD A;  2FYK A;  4LN2 A;  1UJY A;  4BAC A;  1UEB A;  4BY6 B;  2XID A;  2RQW A;  4XTY A;  3CCE Q;  3S3N A;  3E19 A;  4BUG A;  1G3Y A;  3CCQ Q;  4QVC A;  2DZC A;  3GOX A;  3SHW A;  3OB9 A;  1X01 A;  2FZK B;  1ZQ1 A;  2DFU A;  1VQ5 A;  1B07 A;  2KNB B;  1E6G A;  3VS5 A;  4OP0 A;  4ATO A;  3JV3 A;  2LVM A;  4JRK A;  1H64 1;  2ED1 A;  1TUC A;  3CC7 A;  2EGE A;  4C92 G;  4PNO A;  2FEI A;  4OB1 B;  4E7S A;  4ZGD B;  5CKE A;  2RQR A;  3M0T A;  1QWF A;  2M51 A;  4PJO B;  1M3C A;  5ECA A;  2L2P A;  1MNE A;  2JS0 A;  2GGR A;  4RTX A;  4A63 B;  1KQS A;  4L59 A;  1IO6 A;  4M77 A;  3IQL A;  4XU3 A;  3VS3 A;  4C8Q F;  1NYG A;  3QKJ A;  4DEX A;  4LUE A;  1GCQ A;  5I22 A;  4HCZ A;  4PKC C;  3EGX B;  4OMP A;  2EGC A;  3SDZ A;  2X3W D;  2KI7 A;  2EGA A;  4ESR A;  4LXC A;  2E5K A;  1I1J A;  1ZUU A;  4O6J A;  1SG5 A;  2EQJ A;  4IUT A;  3V8K A;  2Y90 A;  1JXM A;  2RHU A;  2RJC A;  1WHG A;  2LCL A;  5J39 A;  2X4X A;  1C0M A;  2NUT A;  3NFC A;  2L3P A;  2Y4X A;  3PFS A;  1NPR A;  5L23 A;  3DB3 A;  4KH0 B;  3SEM A;  1C1A A;  3M5A A;  1YIT T;  3HFO A;  4JS4 A;  1VQL Q;  1M9S A;  2E41 A;  3MP1 A;  3LGL A;  1TXQ A;  1SPK A;  1MND A;  1X2K A;  1NLP C;  4L5G A;  4C92 D;  3QWX X;  1G3T A;  2ECZ A;  4EMK A;  1VA7 A;  4C8Q C;  2GBQ A;  2JW4 A;  4J9C A;  1PWT A;  2ZPG B;  2E10 A;  1M90 C;  1O9S A;  5GAM j;  4ANJ A;  1EFN A;  4C0Z A;  1PSE A;  2FL7 A;  4NL3 A;  1YJW A;  3I55 T;  3E2U A;  1V29 B;  3CCU A;  1PCX A;  1QWE A;  2XG8 D;  5FWB A;  1K9M U;  5LJ5 e;  2OTJ Q;  2VXE A;  1TH7 A;  2YRC A;  3NPF A;  1VQ4 Q;  4M7A A;  5LJ5 j;  4HT8 A;  3CCE T;  1PM3 A;  5CKH A;  3DB4 A;  4K11 A;  1TOV A;  2YT6 A;  5CKB A;  2QEX Q;  3CCQ T;  1G83 A;  1RI0 A;  2DL5 A;  1AHJ B;  9ATC B;  4KBM B;  6AT1 B;  3M56 A;  1OOT A;  2JXB A;  2CYZ B;  4JJN K;  1NJI U;  4OMQ A;  2G6F X;  3OYE A;  4BDZ A;  1IGU A;  1W6X A;  1X6B A;  2HKN A;  3EG0 A;  4M7D A;  2L5Q A;  3AT1 B;  4OB0 B;  2V8I A;  1X69 A;  1ZA1 B;  3NGP A;  2RHX A;  3GIB A;  2V8K A;  2C0T A;  3E1S A;  1UGR B;  5I21 A;  3TU4 K;  5KYX B;  1BK2 A;  2QQR A;  3CC7 Q;  2KE9 A;  2DMO A;  2A7Y A;  2GFU A;  2VV5 A;  4WTO B;  2EPD A;  4BD3 A;  2DO3 A;  4ZNX A;  1T0H A;  1PKT A;  2DD4 A;  4IUR A;  5DLQ E;  3URG A;  5GMK m;  5IAY A;  5KYW B;  4JJB A;  1TWB A;  3MET A;  2LC4 A;  5KYY B;  5GAN 3;  4FT4 A;  2RNA A;  2DZ9 A;  1YIJ A;  2CP0 A;  1VQK A;  3QHS A;  1UJ0 A;  3V7R A;  2W10 A;  1RI9 A;  4X1V A;  4R0K A;  4C92 E;  3ZFJ A;  3JB9 G;  3NTK A;  3EGD A;  1FMW A;  4HKE A;  3OS1 A;  3OYH A;  2VYT A;  3JCM e;  3OSS C;  5GMK i;  5LJ3 g;  2C0O A;  2AT1 B;  3L2Q A;  4M77 G;  3EGX A;  2K4Y A;  2ZPE B;  3MKD A;  2ESW A;  1ZBJ A;  2RI5 A;  3A1P A;  1KD1 U;  3S6W A;  1VOM A;  3A5Z B;  1VQL T;  1U1S A;  5KYU B;  2QQS A;  1M4Z A;  1JEG A;  1VQO Q;  2CZ7 B;  1R0B G;  4AT1 B;  1IHV A;  3JCM Q;  1WJS A;  1I5L A;  5KYN A;  1K73 R;  1R0C B;  3EG9 A;  3CCR Q;  3DLM A;  3E9G A;  4QKU A;  4BE0 A;  3VRY A;  4C92 B;  3QSU A;  3M57 A;  1OX9 A;  5IHI A;  3VYG A;  4R55 A;  2OTJ T;  1YJW Q;  1ZUK A;  3CC4 Q;  3CC2 A;  1D09 B;  3OYF A;  3BDL A;  3CCU Q;  1K73 C;  1K9M C;  1NJI R;  1R8O B;  4XTV A;  4EMG A;  1KC8 U;  1OPK A;  4V2S A;  2QEX T;  4RTT A;  1N9S A;  2MYS A;  4LDY A;  2RD1 A;  2JTE A;  1YNZ A;  2NYS A;  1GBQ A;  4PJJ A;  3JB9 D;  2CKK A;  1KQS P;  5GAN e;  3L2Z A;  3CCM Q;  3CCS A;  4JZ4 A;  1NJI C;  5GAN 4;  3CME A;  3I56 A;  3OYD A;  5D7U A;  1VQ5 T;  1EIF A;  4DBH A;  4C8Q A;  4AG1 C;  1SRL A;  4M77 D;  4QVD A;  4M7A G;  3CC7 T;  2V1R A;  2F69 A;  3QJY A;  4WCI A;  2YDL A;  4M78 G;  1QCN A;  2HD0 A;  4FM4 B;  2LJ0 A;  4NOY A;  1Q82 U;  1ZSZ C;  1N8R U;  1SHG A;  2HQX A;  4E2F B;  4PJL A;  3NTI A;  3C0C A;  2NUP B;  4XQ3 A;  5FRO A;  4PJN A;  1VQM A;  4DEY A;  3J81 E;  1MHN A;  1VQ7 Q;  1TS9 A;  5KYX A;  4OGE A;  2GFA A;  1WHH A;  3EG2 A;  3TVT A;  1YIJ Q;  2CGH A;  5LJ5 h;  3REA B;  4FL6 A;  2HSE B;  1LPL A;  1RUW A;  5CR2 A;  4IUU A;  3RUX A;  1UB4 A;  2J7I A;  1GXI E;  1EZZ B;  2D0N A;  3VS6 A;  4E7H A;  4R56 A;  2BZX A;  2BZ8 A;  2PQW A;  1RAG B;  2FPF A;  3QYG B;  1U5S A;  4LD6 A;  5IXF A;  3FIF A;  4PLI A;  4FW1 A;  4E7Z A;  3LYI A;  1VQ9 A;  2HBP A;  1RAB B;  3ASK A;  1KD1 C;  4JRQ A;  2P4R A;  5LJ5 d;  4AFU C;  3X26 B;  2YWW A;  2KVQ G;  1BI2 A;  4M7A D;  1Q7Y R;  4ELY C;  3PVQ A;  3CCR T;  1BIA A;  1SRM A;  4OVA A;  1KC8 R;  2KGT A;  3OYY A;  3JCM f;  1PRM C;  4KUD K;  3M0R A;  1YJW T;  1WGS A;  1ABO A;  2X4Y A;  4M77 E;  2CP5 A;  1UE9 A;  5KYU A;  3CCU T;  4M7D D;  2KXC A;  5GJV B;  1ACM B;  2DF6 A;  4PFO A;  1KC8 C;  2IG0 A;  2QQ9 A;  2DJQ A;  2O01 E;  1PC0 A;  4F7U G;  1YHQ A;  3P8B B;  1RAH B;  3CCM T;  2LJ1 A;  4OB2 B;  1YCS B;  1YI2 A;  1N9R A;  5A0G A;  2LT1 A;  2FVU A;  2CP7 A;  3CCS Q;  1AOJ A;  4KT0 E;  3QZ5 B;  1DJ7 B;  1QQJ A;  4MDX A;  4DBR A;  4BE2 A;  5HK0 A;  3RER A;  1D0Z A;  4Y28 E;  4A53 A;  1M1G A;  4M77 B;  5CO7 A;  2DIL A;  3BE3 A;  4XTX A;  5LJ3 f;  4D8D A;  2HCK A;  1KG1 A;  1Q82 C;  2AZV A;  4M78 F;  1N8R C;  2EW3 A;  3FEO A;  3BFM A;  5GAO m;  1M1K U;  4J9B A;  4HVU A;  1OZ2 A;  3JCM d;  3A8L B;  4C8Q G;  4EMH A;  2QGG A;  1H92 A;  2LQW A;  1VQM Q;  3FLG A;  1YIJ T;  1YP5 A;  1VQK T;  3CCV A;  3GNF B;  4ME7 A;  2P84 A;  2RQU A;  4XTU A;  4M7A E;  2YHT A;  2KYB A;  4M78 E;  4PL6 A;  2VGM A;  4B9W A;  5HY6 A;  4HCC A;  2E1H A;  3G4S Q;  3PMT A;  3A8O B;  5GAN h;  2PUO B;  1ZSZ A;  2CP6 A;  3RR6 A;  3QWY A;  4EMK B;  2RI3 A;  1FX7 A;  2XMF A;  3G71 A;  5FU7 B;  1UGQ B;  1VQ9 Q;  1Y71 A;  3QBY A;  4AFS C;  1RAD B;  3OYA A;  1UHC A;  1GL5 A;  2RH2 A;  1U1T A;  1OI1 A;  3EGU A;  3M53 A;  1PNJ A;  1YIT Q;  2QAS A;  4CC3 A;  2MF2 A;  2RJF A;  1QVF P;  3H41 A;  3C95 A;  3P8H A;  4M7A B;  1UFF A;  2QDY B;  4AG2 C;  4J9G A;  5GAN d;  1IB8 A;  4M78 B;  3PNW C;  4FYV B;  2JM9 A;  3FB9 A;  3LW5 E;  2BTT A;  2E6N A;  3A98 A;  2H8H A;  1KK7 A;  4C8Q D;  1IRE B;  2PU9 B;  2KY9 A;  3CXC A;  4C5I A;  2EQM A;  2KQW A;  4XU1 A;  1UDL A;  2A37 A;  5KCO A;  2KSS A;  3CPW P;  1ZHI A;  1BIB A;  2KRO A;  3PVL A;  2YUO A;  3A8H B;  4DOW A;  1QVF S;  1MUZ A;  1YHQ Q;  3QDR B;  3UA6 A;  3CCS T;  2RB6 A;  3I56 T;  4F7U F;  4M75 F;  3GPL A;  5GAO r;  2K2M A;  2VAS A;  2A28 A;  2QGF B;  4II1 A;  2MOX A;  3LX7 A;  1TUG B;  3OYB A;  2LX9 A;  4OMM A;  4J7I A;  1PHT A;  4A4E A;  3CPW S;  2EFI A;  1G5V A;  4P5N A;  2LCS A;  2YXY A;  3EG1 A;  2KT8 A;  4FYW B;  4F7U E;  4N4H A;  8ATC B;  1VIF A;  1D3B A;  4YTL A;  1M1K C;  1VQM T;  2DTH A;  2AIR B;  3EGD B;  3HTR A;  2A08 A;  4DA4 A;  1ZA2 B;  4DBF A;  1VYU A;  4XTZ A;  3OYG A;  2AKL A;  1Y0M A;  1G8X A;  1WNL A;  3CCJ Q;  2J6K A;  4M75 C;  3G4S T;  1KJW A;  4BI8 B;  2YUQ A;  1XTD A;  1PRL C;  3RKY A;  5M9O A;  2RPN A;  5FU6 C;  1S72 A;  1VYV A;  1VQN Q;  5KE3 A;  1IGQ A;  4C8Q E;  1UGS B;  4MML A;  1UG1 A;  5DM7 R;  2DL8 A;  4HVW A;  3EG9 B;  5CIU A;  1BI1 A;  4F7U B;  1VQ9 T;  2KBT A;  1NYF A;  1M90 R;  3G71 Q;  5GAN 5;  3N5B B;  4QQG A;  5FU6 B;  1TSF A;  2DKG A;  2L89 A;  1OX8 A;  1UEC A;  3HP9 A;  3GBQ A;  2MPX C;  4C5G A;  1Q81 U;  4EPC A;  3HRS A;  4Q5W A;  4IIO A;  5GAM e;  2A3L A;  1B7T A;  3LWI A;  1M8V A;  1D0X A;  1V76 A;  1D0Y A;  2K3X A;  3D7S B;  2ZPF B;  1VQP A;  4J9D A;  3ZBD A;  3I5S A;  3NTH A;  1VQ8 A;  2H3E B;  1X2Q A;  2KRS A;  2XDB A;  4RCC A;  2JT4 A;  5GAO q;  2WAC A;  5CQX A;  4C8Q B;  2AHJ B;  1WHJ A;  4FCY A;  2QYZ A;  1YHQ T;  4J9F A;  5GAN 8;  4M78 A;  2JZ2 A;  1BI0 A;  3CCL A;  2YRV A;  1PSF A;  1ARK A;  1VQ6 A;  3H6Z A;  5FRN A;  2GTJ A;  2RN8 A;  1YI2 T;  2L3Q A;  2DTI A;  1KQ2 A;  4E7J A;  4BI4 A;  2CUB A;  4HCB A;  1K4U S;  2HMA A;  3EH1 A;  1BBZ A;  3R6N A;  2DRK A;  3M55 A;  1VQ5 Q;  1OU9 A;  1RLP C;  4C5E A;  2GQI A;  3JCM g;  2F5K A;  1MMG A;  3QII A;  5FW9 A;  1J3T A;  2HQH A;  3JB9 J;  2LNH B;  3G1J A;  4RTW A;  3SFM A;  1G3S A;  2CP3 A;  1O75 A;  5DY9 A;  2KEA A;  3QYH B;  4C0D C;  4XU2 A;  3HHT B;  4RMO A;  1OV3 A;  1A0N B;  1LNX A;  2AZS A;  4J9E A;  3RIR A;  2CUD A;  3ZEH A;  2YLB A;  3CCV T;  1Q95 G;  1X43 A;  3CCJ T;  4FYY B;  5CVI A;  1JRI A;  4D8K A;  3JCM W;  2PVO B;  5KH6 A;  3EFR A;  2DK3 A;  4J7F A;  4LDX A;  1BB9 A;  4Z88 A;  3S3O A;  2FZG B;  1VQN T;  3L2V A;  3OBY A;  3VYH B;  5IHN A;  2ZPI B;  4GLK A;  1W4S A;  2LQK A;  2DVJ A;  1UHF A;  3I35 A;  1K9A A;  2L0A A;  4KRT A;  2QAZ A;  3G71 T;  3CXC P;  3EHQ A;  2E64 A;  2DX1 A;  2QK0 A;  5GAN g;  3ZL7 C;  2VKN A;  3C12 A;  1TU0 B;  3JCM V;  1K1Z A;  2X9H A;  5KE2 A;  5CKD A;  1Q81 C;  3OYL A;  1K9M R;  2ENM A;  4F7U A;  4M75 A;  2XK0 A;  1HD3 A;  1I8F A;  4C5H A;  1K0X A;  3CXC S;  2EBP A;  2LJ3 A;  1WXB A;  2PNI A;  3PMI A;  1WHK A;  5IXB A;  4MZM A;  1VQ8 Q;  1KQ1 A;  3BDU A;  3RKX A;  3OS5 A;  1JBM A;  3M58 A;  2EVR A;  2CSQ A;  2DIQ A;  1B3Q A;  4JUV A;  3TQ7 P;  1OU8 A;  2YUN A;  1GFC A;  4LD9 K;  4Z02 A;  3WVE B;  2A0F B;  3CCL Q;  1BCM A;  4KH1 B;  1BI3 A;  1D1C A;  1YFN A;  3C4S A;  5LL6 S;  1QVF A;  4N0A C;  4MZT A;  5C6S A;  1IRX A;  1MMA A;  4QQ6 A;  1M30 A;  1QMC A;  2FRY A;  4BB7 A;  2QQA A;  3WXM B;  2ZAE A;  5LJ5 f;  2MK5 A;  1Y57 A;  1MMN A;  2GNC A;  3CBO A;  1PD1 A;  1B34 A;  4OMN A;  1M2V B;  4QW2 A;  3CPW A;  4GBQ A;  2RK1 A;  1Z9Z A;  2GTO A;  3G6E A;  4PLL A;  5GAM h;  3O8V A;  1MMD A;  1ZLM A;  5EG2 A;  2E4H A;  4FIB A;  2DVE A;  1ZSZ B;  2P0K A;  1VQK Q;  3PGG A;  1M1F A;  2LNV A;  2J06 A;  1YCY A;  3ER0 A;  2B86 A;  2IIM A;  2X35 A;  4J6Y A;  2DE0 X;  1QVG P;  1LOJ A;  2PZ1 A;  3KFV A;  1KD1 R;  1X6G A;  2OAU A;  5GAM d;  3MO8 A;  5A2Q E;  4TVR A;  3X25 B;  3SB2 A;  4QVZ A;  1T0J A;  2X3X D;  1M27 C;  1GBR A;  2P0Q A;  3PTA A;  4RTZ A;  1I4K 1;  1H8K A;  2LQN A;  3M9Q A;  3JB9 I;  1HSQ A;  2V1Q A;  1K8A U;  2KAF A;  1QW1 A;  3H9N A;  2SRC A;  3JCM X;  1WJR A;  2IPO B;  4IIM A;  3EAE A;  3PIO A;  2D8H A;  1VUB A;  2OI3 A;  4O5V A;  1QVG S;  3AHU A;  2DXB A;  1M3B A;  4M78 D;  5IT9 E;  2VGN A;  4B9X A;  1WIE A;  3RDV A;  5GAN 6;  1YWO A;  1Q86 U;  1JB0 E;  3UT1 A;  1FWZ A;  2DL7 A;  1TTH B;  2EYQ A;  2L3R A;  1OQK A;  3X20 B;  4JRI A;  2PVD B;  2RM4 A;  1HK9 A;  1VQ8 T;  2D6F A;  2EYZ A;  2C06 A;  3M4G A;  2ATC B;  3CC2 Q;  2EYW A;  2GQV A;  4CI0 C;  1KFZ A;  3V8L A;  2CZ1 B;  2O9V A;  4XAX B;  3CCL T;  4OML A;  2R58 A;  3QO3 A;  2HDA A;  2DXC A;  4ORZ A;  4QQD A;  1I0C A;  2E5Q A;  2MWP A;  3JSC A;  2CH4 W;  2CP2 A;  4M75 G;  5GAN 2;  4Y92 A;  2RO0 A;  1FMV A;  3QJ6 A;  1YJ9 A;  2X51 A;  3I9Q A;  3PT9 A;  2D8J A;  3SWN C;  1EX4 A;  1VYT A;  2DL4 A;  2OAW A;  3NMZ C;  1QVP A;  2K5F A;  4LUD A;  1P92 A;  3CME Q;  1RAA B;  3I56 Q;  1Q82 R;  1N8R R;  1UTI A;  2NLU A;  2RK2 A;  1Y7X A;  1D3B B;  1QP2 A;  1WDX A;  2Y4Y A;  1FXX A;  1QP3 A;  2DD5 A;  4DBQ A;  3CCQ A;  2LMJ A;  3VS4 A;  4CRI A;  1KIK A;  5D6Y A;  2ZPB B;  3UDC A;  2A36 A;  3MP6 A;  1GCQ C;  4QT7 A;  1AWX A;  1GCP A;  4FSX A;  1WFW A;  1W70 A;  2YUP A;  3G6E Q;  2EIF A;  5GAN f;  3FRN A;  1Y96 A;  2YLC A;  2PVG B;  2VWF A;  1SEM A;  2E3H A;  4PFZ A;  1YBY A;  2FO0 A;  2K6D A;  4N4I A;  5A0L A;  4Y91 A;  2EYX A;  1M2V A;  3QUI A;  3TEE A;  4B6M A;  3H0I A;  3EH2 A;  5J3B A;  2EKO A;  3MCA B;  2KRM A;  1BCO A;  2KYM A;  2E3I A;  3L1A A;  3REB B;  2EWN A;  1K8A R;  4F04 B;  1BKB A;  4X9C A;  4VUB A;  4IUQ A;  3ME9 A;  2M02 A;  1I81 A;  3UA7 A;  4M75 D;  2RQV A;  3OQ5 A;  2PTK A;  4ELZ C;  3MJX A;  4PJM A;  2RHY A;  3NHN A;  1OZ3 A;  4X9D A;  3J80 E;  1K8A C;  4J5Y A;  1Q86 R;  3MEA A;  3HFN A;  1AT1 B;  1WXU A;  1G3W A;  5GMK j;  1NLO C;  4J6W A;  1LVK A;  3OYM A;  1AD5 A;  1MV3 A;  2XDD A;  3H8Z A;  2RI2 A;  1Q86 C;  1N5Z A;  3KXT A;  3VUB A;  2MIO A;  4ZTF A;  1LCK A;  5CK9 A;  3CC2 T;  4MZP A;  1D1B A;  1NZ9 A;  2K7A A;  1XOV A;  4PJO F;  1AWO A;  3CBP A;  2O9S A;  1I5O B;  3VRZ A;  1F1B B;  4M7D C;  1KSW A;  3MEV A;  2F2W A;  4BI3 A;  3M0P A;  3INZ A;  2EQU A;  3TSZ A;  3CEY A;  3T9N A;  3KUF A;  1IXD A;  3TRE A;  1QKX A;  1VIE A;  2DBM A;  2F2X A;  4RTV A;  2M0Y A;  2COW A;  3JCM c;  3CME T;  3MHX A;  1VQ4 A;  3OS2 A;  2CS7 A;  4OB3 B;  1RL2 A;  3LH0 A;  5KCH A;  1YI2 Q;  1WQ7 A;  1XQH A;  1V1C A;  1NPP A;  2JVV A;  3FJP A;  2XI9 A;  2QEX A;  3VKI A;  2HZY A;  1M1K R;  4E7K A;  2QTV A;  2DYI A;  3I5R A;  3RES A;  4CC4 B;  1N27 A;  3OYC A;  3X28 B;  4OGC A;  5GJW B;  2V8J A;  3HKS A;  3G6E T;  5GAN 7;  4M75 E;  4PFP A;  3UPU A;  1QKW A;  3A8M B;  5C0M A;  1HYO A;  2DLP A;  2O4X A;  4PJO C;  2QA4 A;  2RF0 A;  2CT4 A;  1JO8 A;  2KT1 A;  2XHC A;  1W2B S;  4FYX B;  2BIV A;  3O5Z A;  1OPL A;  2JM8 A;  7AT1 B;  3SWN A;  1QLY A;  5GAM g;  2AKK A;  2DEQ A;  3CCV Q;  2IVW A;  4JJC A;  3UWN A;  1WYX A;  2GF7 A;  4ZN1 A;  2FRW A;  2KRN A;  3JAM E;  2O88 A;  3M59 A;  3ULR B;  4UC4 A;  3CD6 A;  1WA7 A;  4JJD A;  1OEB A;  5LJ5 g;  2XU8 A;  2LTO A;  2YRD A;  3L2U A;  2MAM A;  1ZUY A;  2DEU A;  2LCC A;  1YWP A;  3RMQ A;  4OMF B;  5GAO n;  4KGZ B;  4FT2 A;  4M75 B;  1T3S A;  3HPW A;  3EG3 A;  1CKA A;  3OSV A;  3L42 A;  2CRE A;  3L2W A;  2RHZ A;  2WSC E;  1ZSG A;  4LDU A;  4RTY A;  4RG8 A;  2MWO A;  2CZ6 B;  3VS7 A;  4KGV B;  2E65 A;  2JTM A;  2LZ6 B;  1QVG A;  5GAO p;  2EYY A;  4RUG A;  1M2O A;  4L6V 5;  5L8R E;  1ZX6 A;  3UF4 A;  2O31 A;  1WJQ A;  1VQO A;  2CSI A;  5EC7 A;  2JUF A;  3OS0 A;  1SSH A;  2B8A A;  3JB9 H;  1NM7 A;  4HT9 A;  1ABQ A;  3CCR A;  2XD0 A;  2DIG A;  2WSE E;  1WQW A;  2D1X A;  1WXT A;  1AVZ C;  2QG9 B;  3LWH A;  1E6H A;  1YJ9 T;  2E12 A;  4JLG A;  2X4W A;  3CC4 A;  1IHW A;  2K79 A;  2OJ2 A;  1U06 A;  2JTF A;  4KGX B;  3FDR A;  2D9T A;  5GMK l;  5I2M A;  1K73 U;  1B34 B;  2M1H A;  2OX7 A;  2ZPH B;  4ZN3 A;  1X6O A;  3OYK A;  2K9G A;  2OTL A;  4JDS A;  4RTU A;  4RG2 A;  4Z89 A;  3G7Z A;  1PD0 A;  2EAY A;  3HSB A;  2DBK A;  1JJ2 P;  4DQ2 A;  3GLX A;  5GMK h;  4N4G A;  3CPF A;  2KR3 A;  3CCM A;  4HVV A;  3CMA A;  3OW2 P;  3EFO B;  3RNJ A;  3MEW A;  4ZGJ B;  2XDP A;  1WX6 A;  1SSF A;  3CBM A;  3V8J A;  4IUV A;  3OYJ A;  2DM1 A;  4NL2 A;  3QXE B;  2QA4 Q;  1T3L A;  1BU1 A;  4IUP A;  3RMS A;  2LP5 A;  3QZ9 B;  2COZ A;  1JJ2 S;  2G3R A;  3H0H A;  3BW1 A;  1YJN A;  3X24 B;  4C92 F;  4C0D B;  1AWJ A;  1UUE A;  8AT1 B;  3OW2 S;  4RCB A;  2DER A;  5I11 A;  2RMO A;  1VQ7 A;  3S3M A;  1X27 A;  2RHI A;  3CD6 Q;  3OYN A;  4OMO A;  1AZE A;  1HJD A;  1S72 Q;  1Y07 A;  2BKD N;  2CT3 A;  2DAQ A;  4BE1 A;  4WF2 A;  5D6W A;  4PJO A;  1Q81 R;  2DET A;  1OYX A;  1U3O A;  4C0F A;  3OA6 A;  2M9U A;  3THK A;  2QQB A;  4IKF A;  3TSW A;  4BDY A;  2QTX A;  4HCK A;  3OYI A;  3OY9 A;  1RLQ C;  2K3Y A;  2ZZD A;  5FRM A;  2FB7 A;  2J6F A;  1D1A A;  1WPY A;  2YSQ A;  2BUD A;  4LDW A;  5CCA A;  4HXJ A;  3GNG A;  4JLI A;  5I2S A;  4C92 C;  1NBE B;  1TG0 A;  3HRT A;  3VS2 A;  3JCM J;  3M0S A;  1RAI B;  2HBW A;  1IZ6 A;  3C94 A;  2VC8 A;  3P8D A;  4E47 A;  1VQP Q;  2ROT A;  1G2B A;  2V26 A;  5AT1 B;  1PG5 B;  2M0O A;  3FJ5 A;  3RBB B;  2J6O A;  2JJ9 A;  1WLP B;  3L2R A;  3M0U A;  4KUI A;  2K5I A;  1BYM A;  4J9H A;  4JS5 A;  3M54 A;  2DJZ A;  5GAM f;  1VQ6 Q;  1Q7Y U;  2HL3 A;  5IHK A;  1VQ4 T;  4J83 A;  4HA8 A;  2JMA A;  4KUL A;  2EQI A;  1UGV A;  3BY7 A;  2XKO C;  4MDW A;  4EIK A;  2DRM A;  5LJ3 e;  2O2O A;  1E7O A;  2P4T A;  2QXF A;  2OTL Q;  3DLL A;  1Y96 B;  2W0Z A;  5LJ3 j;  3MP8 A;  4GLM A;  4NS5 A;  1W1F A;  4PK4 A;  1KHI A;  4RKU E;  2EJG A;  3GF5 A;  1M8M A;  4A54 A;  4A4F A;  3CMA Q;  5GAN j;  3H0F A;  2QA4 T;  1XJW B;  2COY A;  3JRZ A;  2CZ0 B;  2SEM A;  2J05 A;  2E70 A;  2ABL A;  1CSK A;  3QDF A;  1S1N A;  2HL5 C;  1WI7 A;  2D0Q B;  1W2B A;  3EFO A; 
#chains in the Genus database with same CATH homology
 4DA4 A;  5A0L A;  5GMK m;  2QI2 A;  4Y91 A;  1KQS S;  5IAY A;  4XTZ A;  3MET A;  3OYG A;  2LC4 A;  2R57 A;  3QUI A;  3CD6 T;  2LT4 A;  2PUK B;  3TEE A;  3V7S A;  5GAN 3;  3PIP A;  4M7D G;  4FT4 A;  1WNL A;  1X75 C;  1MGQ A;  5J3B A;  2RA2 A;  2EKO A;  3MCA B;  2DZ9 A;  1YIJ A;  1S72 T;  4ZTJ A;  1VQK A;  5HKC A;  3L1A A;  2EWN A;  3QHS A;  4EDU A;  2JOY A;  3TCJ A;  2I2L A;  3V7R A;  4M75 C;  3G4S T;  4BI8 B;  1BKB A;  4X9C A;  4VUB A;  3VV0 A;  4IUQ A;  5IN1 A;  1XTD A;  3ME9 A;  4C92 E;  2GCX A;  3JCM P;  3ZFJ A;  3RKY A;  1I81 A;  3JB9 G;  3NTK A;  4M75 D;  5M9O A;  3OQ5 A;  5FU6 C;  3EFS A;  1S72 A;  4HKE A;  4ELZ C;  3DKM A;  3OS1 A;  3OYH A;  5KE3 A;  3G4S A;  4C8Q E;  2RHY A;  1UGS B;  2VYT A;  1OZ3 A;  4MML A;  2HNI A;  4X34 A;  4X9D A;  3JCM e;  3J80 E;  3OSS C;  5GMK i;  5DM7 R;  1K8A C;  2LDM A;  2MI6 A;  3M4Y A;  3MEA A;  4J5Y A;  5LJ3 g;  3HFN A;  5CIU A;  1BI1 A;  4F7U B;  3L2Q A;  1VQ9 T;  4M77 G;  3JB9 F;  2K4Y A;  5CKF A;  2ZPE B;  5GAN 5;  4A4H A;  1G3W A;  2RI5 A;  5GMK j;  1M5Q 1;  1KD1 U;  3N5B B;  4QQG A;  5FU6 B;  3S6W A;  1NE8 A;  2DKG A;  3A5Z B;  1VQL T;  2L89 A;  2MMP A;  1U1S A;  4J6W A;  2QQS A;  3OYM A;  5FLX E;  5DLO A;  3HP9 A;  4PJO G;  4C5G A;  4M77 F;  2E6Z A;  1M4Z A;  3LGF A;  2XDD A;  1Q81 U;  3H8Z A;  4EPC A;  1VQO T;  3HRS A;  2RI2 A;  4Q5W A;  2HQE A;  2CZ7 B;  1VQP T;  1Q86 C;  3JCM Q;  3KXT A;  5GAM e;  1WJS A;  3VUB A;  4ZTF A;  1I5L A;  2A3L A;  1YIT A;  3LWI A;  1M8V A;  5CK9 A;  3A8G B;  3CC2 T;  2DXU A;  3SD4 A;  4MZP A;  3VJP A;  1NZ9 A;  5CAI A;  3DLM A;  3E9G A;  2K3X A;  4BE0 A;  1XOV A;  4PJO F;  2ZPF B;  2X4J A;  4C92 B;  3QSU A;  1VQP A;  3CBP A;  3ZBD A;  1VQ8 A;  3NTH A;  3M57 A;  1U8R A;  3VYG A;  4M7D C;  2R5M A;  4R55 A;  1VQ6 T;  2OTJ T;  3CC4 T;  2XDB A;  4JRP A;  3CC2 A;  3MEV A;  4RCC A;  4BI3 A;  5GAO q;  1ZBX A;  2WAC A;  5CQX A;  3BDL A;  3OYF A;  3VUZ A;  3OBW A;  4C8Q B;  3INZ A;  2EQU A;  2AHJ B;  3QG1 A;  3CEY A;  4FU6 A;  3T9N A;  3KUF A;  1K73 C;  1K9M C;  5GAO l;  3I55 A;  1Q7Y C;  1YHQ T;  2K5L A;  5GAN 8;  4M78 A;  2JZ2 A;  1R8O B;  4XTV A;  4EMG A;  1BI0 A;  1KC8 U;  4V2S A;  2QEX T;  3CCL A;  1N9S A;  3TRE A;  1VIE A;  2YRV A;  1PSF A;  2JNG A;  2OTL T;  1VQ6 A;  4LDY A;  3JCM c;  2O4X B;  3H6Z A;  3MHX A;  2RD1 A;  3CME T;  1VQ4 A;  5FRN A;  3OS2 A;  2CS7 A;  2KDS A;  4OB3 B;  1RL2 A;  2EQK A;  3LH0 A;  5KCH A;  1YI2 T;  1WQ7 A;  1XQH A;  3JB9 D;  2KK4 A;  2DTI A;  3Q1J A;  2CKK A;  1NPP A;  2JVV A;  3FJP A;  4XTW A;  1LJO A;  4BI4 A;  4C92 A;  5GAN e;  3CCE A;  4E7J A;  2XI9 A;  2QEX A;  3L2Z A;  4HCB A;  3VKI A;  4E7K A;  3CCS A;  1NJI C;  3SWN B;  5GAN 4;  4M77 C;  3E9F A;  3OYD A;  3I56 A;  3CME A;  3CMA T;  3RES A;  3M55 A;  1VQ5 T;  1EIF A;  3JCM h;  4C8Q A;  4LDV A;  4C5E A;  3JCM g;  1N27 A;  3OYC A;  3X28 B;  2F5K A;  4OGC A;  3OMG A;  4M77 D;  4QVD A;  3KBG A;  2V8J A;  3HKS A;  2L8D A;  3QII A;  4A4G A;  4M7A G;  3G6E T;  5GAN 7;  3CC7 T;  4M75 E;  1XNI A;  2F69 A;  3QJY A;  3UPU A;  4GY5 A;  3A8M B;  4D6W A;  5C0M A;  3JB9 J;  2O4X A;  4M78 G;  4PJO C;  3QPH A;  3SFM A;  1HXD A;  1G3S A;  2HD0 A;  4FM4 B;  2QA4 A;  1O75 A;  5DY9 A;  3QYH B;  4C0D C;  4XU2 A;  3HHT B;  2XHC A;  4NOY A;  4C0G A;  1W2B S;  4RMO A;  1Q82 U;  1N8R U;  2HQX A;  4PJO D;  2BIV A;  1LNX A;  4N0A A;  5CQY A;  3RIR A;  4M7A F;  1YJN T;  1KHC A;  1UGP B;  3SWN A;  5GAM g;  3ZEH A;  2YLB A;  3NTI A;  3CCV T;  2DEQ A;  4XQ3 A;  2IVW A;  5FRO A;  3UWN A;  1VQM A;  1JJ2 A;  3CCJ T;  3J81 E;  4E7I A;  2GF7 A;  1MHN A;  5D6X A;  1VQ7 T;  4ZN1 A;  5CVI A;  1JRI A;  3WVD B;  4OGE A;  2ZCF B;  2PVO B;  3JAM E;  3JCM W;  3M59 A;  5KH6 A;  2GFA A;  3OW2 A;  4OF1 A;  2R5A A;  3EFR A;  4UC4 A;  3CD6 A;  2CGH A;  2F5T X;  2DK3 A;  4J7F A;  5LJ5 h;  4LDX A;  3FC3 A;  4M7D F;  5LJ5 g;  2LRQ A;  2XU8 A;  2LTO A;  4FL6 A;  3CCJ A;  3L2U A;  3S3O A;  1VQN T;  3L2V A;  3OBY A;  2MAM A;  5CR2 A;  4IUU A;  3VYH B;  4EMK C;  4E7L A;  2DPP B;  3RUX A;  1UB4 A;  2ZPI B;  4GLK A;  1W4S A;  2LCC A;  2LQK A;  1KQ2 A;  2FHD A;  4OMF B;  3RMQ A;  5LJ3 h;  5GAO n;  1GXI E;  2HAX A;  4E7H A;  5FU7 C;  4R56 A;  4FT2 A;  4M75 B;  3HPW A;  5GMK e;  3V7C A;  2PQW A;  1VQN A;  2K57 A;  2K2V A;  3QYG B;  4J8O A;  4LD6 A;  2KMT A;  3OSV A;  3G71 T;  3L42 A;  2EJ9 A;  3FIF A;  3L2W A;  4PLI A;  2E64 A;  5GAN g;  2ZGW A;  4M7D E;  2JN0 A;  2RHZ A;  3LYI A;  1VQ9 A;  3C12 A;  2HBP A;  2WSC E;  4LDU A;  3ASK A;  1KD1 C;  3JCM V;  4JRQ A;  4M7A C;  4RG8 A;  5KE2 A;  3GP8 A;  2MWO A;  5LJ5 d;  5AYF A;  2CZ6 B;  5HK3 A;  2E65 A;  4M78 C;  3X26 B;  2JTM A;  5CKD A;  3JCM b;  1QVG A;  2DXT A;  5GAO p;  2H3J A;  2KVQ G;  4J6X A;  3VU3 C;  1BI2 A;  4MMK A;  1Q81 C;  3OYL A;  4M7A D;  1VQL A;  4L6V 5;  4ELY C;  2VXF A;  4XK8 E;  3CCR T;  1BIA A;  4F7U A;  4M75 A;  5L8R E;  2P0P A;  2XK0 A;  3J7A F;  3MEU A;  1I8F A;  4OVA A;  1WJQ A;  5LJ3 d;  4C5H A;  1VQO A;  2JUF A;  2DTO A;  2RJD A;  3OS0 A;  4KUD K;  3OYY A;  3JCM f;  2B8A A;  1H3Z A;  3CXC S;  1YJW T;  1WGS A;  3JB9 H;  1M90 U;  3RKW A;  2X4Y A;  4HT9 A;  4M77 E;  3PMI A;  2M16 A;  3CCR A;  5A0D A;  3LLR A;  4XU0 A;  3CCU T;  2WSF E;  4MZM A;  2XD0 A;  3OMC A;  1KQ1 A;  2DIG A;  2WSE E;  3BDU A;  4M7D D;  3RKX A;  2EJF A;  2RJE A;  1JBM A;  1WQW A;  3F70 A;  3M58 A;  3OS5 A;  4BY6 C;  2VUB A;  4DOV A;  3HL8 A;  4ZGE B;  3HRU A;  2DIQ A;  3LWH A;  1YJ9 T;  4JUV A;  2E12 A;  3R6O A;  4JLG A;  2OTJ A;  2X4W A;  3CC4 A;  5J26 A;  2XIC A;  4LD9 K;  4PJO E;  4Z02 A;  3WVE B;  1KC8 C;  2IG0 A;  2JTF A;  2LQ8 A;  2QQ9 A;  1N6A A;  3FDR A;  2D9T A;  5GMK l;  2O01 E;  5I2M A;  4M7D B;  1BI3 A;  1K73 U;  1B34 B;  2M1H A;  4A4K A;  2FYK A;  4F7U G;  1YHQ A;  3C4S A;  3P8B B;  5LL6 S;  2ZPH B;  4ZN3 A;  1QVF A;  1X6O A;  4N0A C;  3OYK A;  4MZT A;  5C6S A;  3CCM T;  4BAC A;  2OTL A;  1UEB A;  4OB2 B;  4QQ6 A;  4BY6 B;  2XID A;  4JDS A;  4XTY A;  4RG2 A;  4BB7 A;  3G7Z A;  1YI2 A;  2EAY A;  3HSB A;  2QQA A;  3S3N A;  1N9R A;  3E19 A;  2LT1 A;  4BUG A;  5A0G A;  1G3Y A;  2FVU A;  4DQ2 A;  3GLX A;  5GMK h;  4KT0 E;  4N4G A;  3WXM B;  2DZC A;  4QVC A;  3QZ5 B;  3CPF A;  3OB9 A;  1DJ7 B;  3GOX A;  1X01 A;  5LJ5 f;  4MDX A;  3CCM A;  1ZQ1 A;  4BE2 A;  5HK0 A;  3CMA A;  1VQ5 A;  3RER A;  3MEW A;  4ZGJ B;  3CBO A;  2XDP A;  4Y28 E;  1SSF A;  3CBM A;  1B34 A;  4OP0 A;  3V8J A;  4A53 A;  4QW2 A;  3CPW A;  2LVM A;  1M1G A;  4ATO A;  4M77 B;  5CO7 A;  4IUV A;  3OYJ A;  4JRK A;  4XTX A;  4NL2 A;  2RK1 A;  1H64 1;  3QXE B;  5LJ3 f;  3G6E A;  3CC7 A;  4PLL A;  4C92 G;  4PNO A;  5GAM h;  3O8V A;  1KG1 A;  1Q82 C;  4M78 F;  4IUP A;  4OB1 B;  3RMS A;  1N8R C;  4ZGD B;  3QZ9 B;  5CKE A;  3FEO A;  3BFM A;  5GAO m;  1M1K U;  5EG2 A;  1OZ2 A;  3JCM d;  4PJO B;  3A8L B;  4C8Q G;  1JJ2 S;  4EMH A;  2G3R A;  3BW1 A;  1YJN A;  4FIB A;  3X24 B;  4C92 F;  3FLG A;  4C0D B;  1YIJ T;  1KQS A;  2DVE A;  1VQK T;  2P0K A;  3CCV A;  4L59 A;  3GNF B;  3PGG A;  3OW2 S;  1M1F A;  2LNV A;  4ME7 A;  1YCY A;  4RCB A;  3ER0 A;  4XTU A;  1VQ7 A;  4M77 A;  4XU3 A;  2RHI A;  3S3M A;  2X35 A;  4J6Y A;  4M7A E;  2YHT A;  4C8Q F;  3QKJ A;  3OYN A;  4M78 E;  1LOJ A;  4PL6 A;  2VGM A;  2OAU A;  4B9W A;  4HCZ A;  5HY6 A;  4PKC C;  1Y07 A;  2BKD N;  3SDZ A;  4HCC A;  2DAQ A;  4BE1 A;  2E1H A;  3MO8 A;  5GAM d;  5A2Q E;  4TVR A;  3X25 B;  4WF2 A;  3SB2 A;  4QVZ A;  5D6W A;  4PJO A;  1OYX A;  1Q7Y U;  3PMT A;  3A8O B;  4C0F A;  4O6J A;  5GAN h;  2P0Q A;  3OA6 A;  2PUO B;  3PTA A;  2M9U A;  1I4K 1;  2QQB A;  2EQJ A;  3M9Q A;  3JB9 I;  4IUT A;  3V8K A;  4IKF A;  2Y90 A;  1K8A U;  2KAF A;  4BDY A;  2QTX A;  1QW1 A;  2RI3 A;  4EMK B;  2RHU A;  2RJC A;  3OYI A;  3OY9 A;  2LCL A;  2K3Y A;  2ZZD A;  5J39 A;  5FRM A;  1FX7 A;  3JCM X;  2FB7 A;  3G71 A;  1WJR A;  2X4X A;  3EAE A;  5FU7 B;  1UGQ B;  1VUB A;  1WPY A;  3PIO A;  1Y71 A;  3NFC A;  3QBY A;  2Y4X A;  3PFS A;  4O5V A;  1NPR A;  3OYA A;  2BUD A;  1QVG S;  3DB3 A;  4LDW A;  3AHU A;  2DXB A;  1U1T A;  2RH2 A;  5CCA A;  1OI1 A;  4M78 D;  3M5A A;  3M53 A;  1YIT T;  3HFO A;  4JS4 A;  3GNG A;  4JLI A;  5I2S A;  4C92 C;  5IT9 E;  2VGN A;  2MF2 A;  1M9S A;  2RJF A;  3HRT A;  4B9X A;  5GAN 6;  3JCM J;  1Q86 U;  1JB0 E;  2E41 A;  3LGL A;  3MP1 A;  3UT1 A;  3C95 A;  1IZ6 A;  1FWZ A;  3P8H A;  3C94 A;  2VC8 A;  3P8D A;  4M7A B;  2QDY B;  4L5G A;  2EYQ A;  2L3R A;  4E47 A;  4C92 D;  1G3T A;  4JRI A;  3X20 B;  2PVD B;  2RM4 A;  1HK9 A;  3PNW C;  4M78 B;  4EMK A;  5GAN d;  4C8Q C;  1VQ8 T;  2D6F A;  3FB9 A;  2ZPG B;  1M90 C;  2E10 A;  3LW5 E;  3M4G A;  2C06 A;  1O9S A;  2E6N A;  5GAM j;  2GQV A;  4C0Z A;  1PSE A;  2FL7 A;  2M0O A;  4C8Q D;  4CI0 C;  1IRE B;  4NL3 A;  1YJW A;  2PU9 B;  3V8L A;  3I55 T;  3L2R A;  2CZ1 B;  2KY9 A;  1V29 B;  3CXC A;  4KUI A;  2EQM A;  2KQW A;  2K5I A;  4C5I A;  3CCU A;  1BYM A;  4XAX B;  3CCL T;  4XU1 A;  2R58 A;  2XG8 D;  3QO3 A;  5KCO A;  2DXC A;  2KSS A;  4JS5 A;  3M54 A;  1K9M U;  5LJ5 e;  1ZHI A;  2DJZ A;  2E5Q A;  2VXE A;  2MWP A;  3JSC A;  1BIB A;  4M75 G;  1TH7 A;  4QQD A;  5GAM f;  5GAN 2;  1VQ4 T;  4J83 A;  2RO0 A;  3QJ6 A;  1YJ9 A;  4HA8 A;  4KUL A;  4M7A A;  5LJ5 j;  3PT9 A;  4HT8 A;  3A8H B;  4DOW A;  1QVF S;  3SWN C;  3BY7 A;  3CCE T;  2XKO C;  4MDW A;  3QDR B;  5CKH A;  3DB4 A;  5CKB A;  5LJ3 e;  3CCQ T;  1QVP A;  1RI0 A;  2P4T A;  1AHJ B;  2K5F A;  2QXF A;  3CCS T;  2RB6 A;  3I56 T;  3DLL A;  1P92 A;  4KBM B;  1Y96 B;  4F7U F;  4M75 F;  2NLU A;  3GPL A;  2RK2 A;  5GAO r;  1Y7X A;  1D3B B;  3M56 A;  3MP8 A;  5LJ3 j;  1QP2 A;  2Y4Y A;  2CYZ B;  4NS5 A;  4JJN K;  1NJI U;  4II1 A;  1QP3 A;  1FXX A;  1KHI A;  4RKU E;  3OYE A;  4BDZ A;  3LX7 A;  2DD5 A;  2EJG A;  3GF5 A;  4A54 A;  3OYB A;  4M7D A;  2L5Q A;  2LX9 A;  3CCQ A;  4J7I A;  4OB0 B;  4CRI A;  2V8I A;  4A4F A;  5GAN j;  5D6Y A;  3GIB A;  2RHX A;  4A4E A;  3CPW S;  2QA4 T;  2EFI A;  2V8K A;  2ZPB B;  4P5N A;  3UDC A;  1G5V A;  3E1S A;  1UGR B;  3MP6 A;  5I21 A;  3JRZ A;  4FSX A;  2CZ0 B;  3TU4 K;  4F7U E;  2EIF A;  2QQR A;  5GAN f;  2E70 A;  4N4H A;  3FRN A;  2A7Y A;  1VIF A;  2GFU A;  1Y96 A;  2VV5 A;  2YLC A;  2PVG B;  1D3B A;  4BD3 A;  2DO3 A;  4YTL A;  2D0Q B;  1VQM T;  1YBY A;  2DTH A;  1W2B A;  1M1K C;  2DD4 A;  4IUR A;  5DLQ E;  3URG A;  4N4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...