2RB6A

X-ray structure of the protein q8ei81. northeast structural genomics consortium target sor78a
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
57
structure length
57
Chain Sequence
SSQYIMSTKDGKMITSDSKPKLDKTTGMYLYYDEDGREVMIKQEDVTQIIERLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title X-Ray structure of the protein Q8EI81.
rcsb
source organism Shewanella oneidensis
molecule tags Structural genomics, unknown function
total genus 7
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06004 DUF903 Bacterial protein of unknown function (DUF903)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2rb6A00
3JB9D 5GAMg 4PJOG 3GIBA 1B34B 2DJZA 5GAMe 5GAOp 4M77A 4M75G 3FJPA 1KQ1A 4M75B 2Y90A 3V7SA 4PJOC 4XU2A 3INZA 1TH7A 4MMKA 5CAIA 5GMKl 4C8QF 5GAOl 1LJOA 4M7DD 2DTIA 3EFRA 5GANf 3BW1A 3BY7A 3JCMh 5GAN7 2DVEA 5LJ5f 2DTHA 2DTOA 2RB6A 1JBMA 2HNIA 2YHTA 3RERA 3QHSA 4PJOE 4XU0A 4HT9A 5GAOn 3RKWA 4X9CA 4XU1A 4N0AA 5GANg 4EMHA 3AHUA 2FYKA 4J6YA 5LJ5g 4M77C 5GANe 4PJOD 4XTUA 1N9SA 2CGHA 1Y96B 4C8QA 4M75D 3L1AA 4XTWA 4Y91A 5LJ5e 3V8JA 4M77E 2DXUA 3JCMc 3QO3A 5I21A 1WQ7A 4J5YA 4OP0A 2EJ9A 4M7AF 4PJOB 2JN0A 4XTVA 4N0AC 4X9DA 4HA8A 4EMKC 4F7UF 5LJ3g 3JCMX 1MGQA 1I5LA 1LNXA 5GMKe 5LJ3e 3QUIA 4XTXA 3V8LA 4C8QC 1HK9A 2DEQA 1N9RA 3SWNB 2DKGA 2DZCA 1LOJA 3JCMb 3JB9F 1WNLA 2RD1A 4JUVA 3JCMf 1I81A 2EJFA 2RM4A 4M77G 5DY9A 4PNOA 4M77B 4C8QE 4M7AA 4EMKA 1JRIA 4F7UA 3SB2A 3EFSA 4M78C 4M78F 2DXTA 4M7DF 4V2SA 2K57A 2E10A 1U1TA 3JCMg 3RUXA 2EJGA 4XU3A 5GAMj 3JCMJ 3RKXA 4DQ2A 4JRKA 4C92F 3JCMe 4EMGA 1BIAA 3JB9J 5LJ3j 1HXDA 4XTYA 4M78E 4M7AG 3V7CA 1KQ2A 1X01A 3M4GA 5GAMd 3L2ZA 4WF2A 4A53A 2YLBA 3BDUA 5GAOr 4M7AC 4QVCA 2E41A 3VU3C 4M75F 2E1HA 3HFOA 4M77D 4M78A 4C8QB 3JCMV 4C8QG 5GAN5 4M7DA 2VC8A 4NL3A 3JCMQ 1WPYA 4NL2A 3HFNA 4C92A 4QVDA 4M7AE 5GANj 4XTZA 4F7UE 5GAOq 3JCMP 2YLCA 5LJ5j 3BFMA 5GMKm 5GAOm 5GAMh 4HT8A 1U1SA 4JLIA 1B34A 4M78G 3RESA 3V8KA 5LJ3h 5GANd 4J6XA 1BIBA 4M75A 5LJ5d 1WQWA 4M7DC 4C92G 3JB9H 2QTXA 1YCYA 4C8QD 5GAN3 5GAN4 2VXFA 2ZGWA 4J6WA 2FB7A 2VXEA 4C92C 5GMKi 2EWNA 5GAN6 5GMKj 4M7DE 3FB9A 4MMLA 4XQ3A 4M7AB 3RIRA 4EMKB 5GAN8 4F7UG 4PJOF 4F7UB 5GANh 2I2LA 2DZ9A 4JRIA 5LJ3d 4C92E 5LJ5h 2EAYA 4M75C 4M78D 3RKYA 1Y96A 3JB9G 1D3BA 3JCMW 3SWNC 4C92D 3JB9I 4NOYA 4RCBA 5GAN2 3FIFA 3PGGA 4M75E 3QSUA 2RA2A 4M77F 4PJOA 2E64A 4M7DG 5GMKh 4A54A 4M78B 4M7AD 4M7DB 1H641 1M8VA 5GAMf 1D3BB 2E65A 1M5Q1 4RCCA 3V7RA 5LJ3f 3JCMd 1I4K1 4C92B 3HSBA 3SWNA 1I8FA
chains in the Genus database with same CATH superfamily
4LDXA 4ZTJA 4J7IA 1PRMC 3QG1A 5IAYA 1WHMA 4B9WA 2DETA 4KULA 1T3LA 1M90U 4AFQC 4OB2B 3CC2A 1KQSP 3MPUB 3ER0A 4FYWB 4DOWA 5LJ5g 5GANe 3V8JA 2FL7A 3GBQA 3QO3A 1WDXA 5IHNA 2NWMA 3JAME 1AWOA 2ZPEB 4HCKA 1VQ5A 5EC7A 4C0FA 4LE9A 2C0OA 2HKNA 2QAZA 3EFSA 3ZEHA 4WTOB 2J6KA 1NEBA 2ROTA 2EJGA 2K79A 1QCNA 3RKXA 1R77A 3QKJA 2DERA 1PD1A 2A37A 5KYUB 1IGQA 4A4EA 5GAMd 4PL6A 3BDUA 1ZUKA 4ZN3A 2A0FB 4XK8E 1LPLA 1UDLA 4M7DA 2M51A 2CP7A 2CH4A 2VV5A 4XTZA 4Z88A 5KH6A 4HT8A 1ZA2B 4ZN1A 2KRMA 2GQVA 1VQ6Q 1RAHB 5CQXA 5HCKA 3WVEB 2DMOA 4M7DE 1PHTA 1Q86C 5GANh 1VOMA 2P0KA 7AT1B 1VQ6T 3HL8A 2MPXC 3QSUA 4LD9K 3M0SA 4PFZA 5GAMf 3EG1A 1SSHA 2K5LA 4QVZA 1XOVA 3JB9D 3CC2Q 4FYYB 1ZQ1A 3MEAA 1UG1A 3QZ9B 4AG1C 4CI0C 1QQJA 2K5FA 1VYVA 4LDUA 4RTVA 1PC0A 1KFZA 1VQMQ 3A8GB 3QHSA 1RUWA 4HT9A 3CC2T 2K5IA 2FYKA 3GP8A 2KROA 1RAGB 2QI2A 3S3MA 4C8QA 4Y91A 1YFNA 1SHFA 4FCYA 2EQMA 1S72A 1VQMT 2K3XA 1G3YA 1M30A 2NYSA 4IUTA 4X9DA 2RN8A 1OU8A 4BE2A 3QUIA 1MHNA 1VUBA 2QG9B 1GXIE 1O75A 2RD1A 3ASKA 4LUEA 3LYIA 2X51A 2LQNA 2DBKA 2RHYA 2RM4A 4C8QE 1YJWA 2QEXA 1UGVA 4F7UA 2E4HA 1HD3A 4AFUC 3OA6A 3NGPA 1KD1U 1TTHB 1B3QA 1BBZA 2RHXA 2DNUA 1MMNA 2DD4A 2VKNA 3UATA 1PWTA 1H3ZA 2F5TX 2R58A 2EYXA 5GAN5 3CXCP 3OYIA 4PJJA 2D9TA 3JCMQ 4QVDA 5CKBA 1RLPC 4F7UE 5CKEA 3JCMP 2KXCA 1NJIU 3CD6Q 2Y4YA 3RESA 4OGCA 2E12A 2CYZB 1FXXA 1HSQA 5CKDA 1Z9QA 4A4KA 4J9CA 1EIFA 4ZNXA 1KG1A 3CCEQ 4O5VA 1VQ7A 3CD6T 2DK3A 2EGEA 2O4XB 2L89A 4M78D 4A63B 1K9MR 3CPFA 2Z0WA 4NOYA 3PGGA 2GQIA 2CP0A 3LWHA 3FDRA 2YUQA 4C0DC 3CCET 3BDLA 1Q7YC 1H641 3OYHA 1RAAB 2RJEA 2DE0X 1BK2A 2XG8D 2LDMA 5GAMg 1Q95G 2MIOA 1KQ1A 3R6OA 2NUTB 5CVIA 1TOVA 2DTIA 3EFRA 2DVEA 2WSEE 1K8AC 3EGDA 3UPUA 2HNIA 1S72Q 3EG9A 4BUGA 2ZZDA 1PNJA 1W70A 2EQJA 4XTUA 1NJIC 5IT9E 3LGFA 1WHLA 1BI1A 1M2VA 3C0CA 4PKCC 5CO7A 1S72T 4XTVA 4HA8A 1R0CB 2AZSA 1I5LA 1VQ8Q 5KCOA 2HL5C 3MO8A 3LH0A 2P0QA 3C94A 2XKOC 2CS7A 1G2BA 3L2RA 1SG5A 2EJFA 2OTJA 1MV3A 1VQ8T 1WHKA 3FJ5A 3RUXA 3E9FA 1P92A 1EFNA 1M8MA 4E7ZA 1SRMA 3NHNA 2E70A 2RO0A 3NPFA 2D0QB 3H41A 1D1CA 1Q86R 2D0NA 4K11A 2YRVA 2L3SA 1U1SA 1E6GA 5GANd 4J6XA 1WXUA 2DL4A 2XD0A 5FU6C 1WQWA 1I1JA 3OBWA 1ZA1B 1PM3A 1YIJQ 2ZGWA 2VUBA 2VXEA 4HKEA 1OOTA 3VUZA 1QVPA 4M75C 1AOJA 2IG0A 1D0XA 4C5EA 3JB9I 1YIJT 4OF1A 3OW2P 2J6OA 1VQ9T 3I55A 3CCRQ 2K2MA 4AT1B 4OB3B 3A1PA 1Y07A 2LQWA 3S3NA 1AZEA 1OZ3A 3CMEQ 1W2BA 2RHIA 2DYBA 3ULRB 5FW9A 1MMDA 4Z02A 5GAOp 1ZBJA 2C0TA 5CAIA 1E7OA 3CCRT 5GAN7 5GANf 3CMET 1WJSA 4BDYA 2XK0A 2V8IA 3M0UA 3M0RA 3CCVQ 4X9CA 4J6YA 4DBRA 2L5QA 3PVQA 1VQKA 1Y0MA 3OYBA 2DRMA 3EG2A 2CZ7B 3CCVT 3CCMA 4PFOA 3JCMX 4CC3A 5GMKe 2K7AA 1HK9A 2MF2A 4JUVA 4A4FA 4M7AA 5FWBA 4M78F 2FHDA 4D8DA 4DEXA 2E10A 3JB9J 2LTOA 2LCSA 2JM8A 4ME7A 3A5ZB 4A53A 2BE9B 2ZAEA 1WXTA 2HSEB 4M75F 2E1HA 3QWYA 4ORZA 3X28B 2DRKA 3L2VA 4M7AE 4RTTA 2KSSA 5LJ5j 2DEUA 4LUDA 5LJ3h 2NLUA 1U8RA 2QTXA 1VA7A 1H92A 1IHWA 2LP5A 5IN1A 3NTIA 1K4US 3I55Q 2HZYA 8ATCB 2I2LA 3CPWS 1BI2A 3JCMW 3RR6A 2XU8A 2PNIA 1VQ4A 1Y57A 1JJ2S 5GMKh 2KXDA 2HQHA 2NUPA 3CC4T 1NM7A 2RJDA 5C6SA 1WXBA 2D8JA 3M58A 1D09B 5GJVB 2HQXA 1VQKQ 4BDZA 3IQLA 3CBMA 4LDWA 3MEUA 4XU0A 1WLPB 1N8RU 3OYEA 5GANg 3OYNA 1OX8A 3VUBA 4IIOA 3JCMc 1WJRA 1WQ7A 4PJOB 4E7IA 2L0AA 1SPKA 2PVGB 4AFSC 4PK4A 3M53A 1IZ6A 3M0PA 5A0LA 2JT4A 1JJ2P 1K0SA 2DZCA 1LOJA 2AK5A 3HTRA 1YJNT 2E6ZA 2EYYA 2KYMA 2DXTA 1UGPB 3QDFA 1H8KA 1O9SA 1RL2A 4CC7A 3J80E 4M7AG 2CZ0B 3OYFA 1YITQ 1KK7A 4RMOA 4RTWA 3HFOA 3MP6A 2EGCA 4X1VA 2A28A 4C92A 1YHQA 1QP3A 3GLXA 3QBYA 1Q81R 4JLIA 2HBWA 2LT1A 4EDUA 1VQPA 1YITT 2DILA 4LXCA 1CSKA 4M7DC 3I9QA 3OBYA 1LCKA 2COYA 2OTLA 3HRTA 1VQ4Q 2KT1A 3RBBB 2V8JA 3LX7A 2X35A 4C92E 3DKMA 2CSIA 3OYMA 1X2KA 1XJWB 2CT3A 2BZXA 4IUQA 3UWNA 2G6FX 1VQ4T 2E64A 2RK2A 4A54A 1WZOA 4OMPA 2RNAA 1OV3A 3H8ZA 1I4K1 2RQTA 3G4SQ 3HSBA 1ZSZB 1KQSS 4FU6A 4JJBA 1KC8R 3G71A 4IUUA 4M75G 1UB4A 4C5GA 3WXMB 3BY7A 4J9DA 1YBYA 4C0ZA 5FRNA 3G4ST 2J6FA 4FSXA 3OB9A 4XU1A 2DA9A 4PLLA 1VQLQ 2CGHA 3EFOA 1K76A 4FYVB 2DAQA 1JQQA 1FWZA 1K9MC 2A7YA 4JPBW 3E1SA 2K3YA 3EHQA 3OYYA 1VQLT 4C8QC 2DIQA 1FMWA 3EGXB 1XTDA 1FX7A 5DY9A 5FRMA 3EH2A 2CSQA 4O6JA 5I22A 4M7DF 2KMTA 3OYKA 5FLXE 5GAMj 1BKBA 1BIAA 1YHQQ 2FPDA 1HXDA 1Q86U 3V7CA 4AMCA 1X6BA 5GJWB 5KYWB 4KRTA 2COZA 4PJMA 2OTLQ 3CCLA 2VC8A 2VYTA 2DPPB 2VVKA 4AFZC 3LGLA 1TG0A 2FPEA 4VUBA 1YHQT 4FT2A 2FZGB 2XDDA 1IRXA 3CCSQ 1QKWA 3TEEA 4OB0B 1K73R 3VS3A 1ZUUA 4C92G 3VS2A 3THKA 2ECZA 2KYBA 4J6WA 1W1FA 4AG2C 1T3SA 2CDTA 3FB9A 2MAMA 3RIRA 2M0OA 2OX7A 1WI7A 3CCST 2LT4A 2DVJA 1NLPC 1UJ0A 2EYQA 1X27A 2GCXA 1VQOA 2JW4A 5LJ3f 4BACA 4GY5A 2RQUA 2X4XA 1WFWA 4L6V5 1VIEA 4M77A 2EYZA 2OJ2A 4II1A 2QQSA 4RUGA 1CKAA 4C8QF 2K2VA 5M9OA 2J05A 1ABQA 3A8MB 1TUGB 2DL3A 3M5AA 3VS4A 2DTHA 2E3HA 1YWPA 3I35A 3RERA 2JTFA 1G83A 1MNDA 1OULA 2MYSA 3TREA 1AZGB 1UFFA 4BY6C 2EGAA 2KVQG 4IUPA 4M77E 4ELZC 5DLOA 5FU7C 3PNWC 2DFUA 2GBQA 2HDAA 4FW1A 2AT1B 2J7IA 2RMOA 5A0GA 1WYXA 4F7UF 5D6XA 2EQIA 1LNXA 3X24B 3OY9A 3V8LA 4BI8B 3SWNB 2QQ9A 2DX1A 1PRLC 4KGVB 4MZPA 1TUCA 4PNOA 2PTKA 1GFDA 5D7UA 3CXCS 1XQHA 1ZBXA 2RHUA 2H3JA 3AT1B 2XMFA 3OSSC 3JCMJ 1VQ5Q 3JCMe 4E2FB 3M4GA 1YJ9A 4OMLA 2GGRA 1YWOA 4C5IA 2R57A 2ROLA 4E7LA 4RG2A 2MI6A 2HKQB 1U3OA 2ATCB 3ZFJA 4E6RA 3GOXA 3M9QA 1VQ5T 1IO6A 2O9VA 1IHVA 2F2VA 1Q7YU 2E5KA 3V8KA 1RAFB 3FLGA 1YNZA 3CMAA 1YCYA 4ANJA 4FYXB 2KEAA 3M56A 1GCQC 2KQWA 4JRIA 2FRWA 1UHFA 1R0BG 5HY6A 1K8AU 1D3BA 4D8KA 1YI2A 2RQWA 4RCBA 5GAN2 3CC7A 2XDBA 4Y92A 4M7DG 2QQRA 1OU9A 1M5Q1 3VS6A 1M3CA 1G3SA 2MWOA 3REBB 3GIBA 1CKBA 2LMJA 3VYHB 3P8HA 3H9NA 1RAEB 1G8XA 3JCMh 4DA4A 3RMSA 1M2OA 3NFCA 2DLPA 3SFMA 3MP1A 2JJ9A 4C0DB 2ESWA 4P5NA 4JRPA 4M75D 3P8BB 2LJ0A 4WCIA 4MZTA 2LNVA 3OSVA 1QMCA 4XTXA 1WIEA 2J06A 2OAWA 4LDYA 2DKGA 2WACA 4KBMB 3RMQA 2RQVA 3MJXA 4QQDA 1YJ9Q 4BD3A 2R5MA 3SB2A 2X4JA 4RTXA 4V2SA 2EQKA 3P8DA 2K57A 4EMGA 1M3BA 3CCJA 3A8OB 2CT4A 4J9IA 4FT4A 5A0DA 1YJWQ 1Q81U 2YWWA 2QEXQ 1UEBA 4M7AC 1S1NA 2YUOA 4C8QG 3CMAQ 4ZGEB 5C0MA 3OYAA 2JS2A 5GANj 1D0ZA 2KI7A 3OS5A 2JTMA 2KRNA 1YJWT 3TSZA 2QEXT 2EFIA 3CMAT 1YI2Q 3OW2S 3A8LB 4HCCA 1KHIA 2EYWA 2ED1A 3CC7Q 1MNEA 4XQ3A 3OS0A 4F7UG 3OYGA 3M54A 3PE0A 2DO3A 5KCHA 4C92D 2FEIA 3OQ5A 1YI2T 4CC2A 1QVFS 2RI3A 2R5AA 3MKDA 2DL5A 1KC8U 1OEBA 3CC7T 5FU6B 1VQ7Q 5I2SA 1GCQA 1NYFA 4M78B 2M16A 2E65A 2K3BA 3KUFA 4RCCA 1M90R 5KYYB 1AWWA 4OMOA 2COWA 2HEQA 1B34B 3FJPA 4M75B 1VQ7T 1Q81C 1LJOA 1X6GA 1D0YA 2RB6A 4N4GA 2VGNA 3AHUA 2RK1A 3QJYA 1QP2A 2EKOA 5L23A 1NYGA 1VQNA 1KHCA 5KYXB 2YT6A 4MDXA 4PJNA 2DXUA 3BE3A 2QA4A 1J3TA 2KY9A 2LCCA 4M7AF 3VS5A 4RKUE 3X20B 1QVFP 5LJ3e 1BCMA 4CRIA 2DJQA 3REAB 4J83A 3CBOA 3I56A 2O4XA 3CCQA 1KC8C 4HVWA 4XTYA 1PD0A 1TWBA 2OTJQ 3JRZA 1SEMA 1K73U 2GFAA 1JO8A 1WPYA 2DIGA 2RH2A 3HFNA 2BKDN 1NLOC 3N5BB 2X4WA 4ATOA 2DBMA 2NUTA 3QDRB 4KH0B 1NZ9A 2OTJT 3OS2A 2VXFA 2A08A 3PTAA 3PMIA 5LL6S 4C92C 2EWNA 5D6YA 2DYIA 1YN8A 1M1KR 2HL3A 2XI9A 4EMKB 4MZMA 3CEYA 2M1HA 4LD6A 4N4IA 3H0FA 3CPWA 5KYNA 1X43A 2C0IA 2AZVA 5FROA 4QKUA 4QW2A 3FEOA 3PIPA 2HAXA 1JJ2A 3CCUA 2P84A 1X2QA 3DB4A 2XHCA 3JCMd 4GLMA 3M0TA 4OMFB 2CH4W 2LX7A 2LJ3A 4KH1B 2QDYB 2AKLA 4YTLA 2DM1A 2QGFB 1UGSB 4M7DD 1VQNQ 3GPLA 3KXTA 3G1JA 5IHIA 1K73C 2DTOA 2QA4Q 1UE9A 1Q82R 1DJ7B 3QXEB 4E7SA 3I55T 1Y96B 1NBEB 2PUOB 1M1GA 3VRYA 2W0ZA 1RLQC 1ZLMA 2QA4T 2L3RA 3M59A 2B86A 4C5HA 2YRCA 2PU9B 3RNJA 1KD1R 2VGMA 4ESRA 3SHWA 1IREB 2HQEA 3JCMf 2C06A 3CCMQ 1OPLA 1JRIA 1XNIA 1U1TA 2M9UA 4C92F 1VQKT 3QYHB 4M78E 3LWIA 1SKUB 1I5OB 2JMCA 1TSFA 2D1XA 4J9EA 3CCMT 2EBPA 3F70A 4NL2A 3OYDA 1T0HA 1KSWA 5GAOm 4GLKA 1SF9A 2W10A 3CBPA 2V1RA 4E7KA 2QK0A 1K9AA 4C8QD 1U06A 3D7SB 5ECAA 4EIKA 3CCUQ 2XDPA 4R56A 2YUNA 2PUKB 2LQKA 4B9XA 1D1BA 2EAYA 2M02A 3E9GA 4LNPA 3RKYA 3VYGA 3META 2GTOA 2PZ1A 4GBQA 1WHHA 3WVDB 3HKSA 2RA2A 3LH5A 2IVWA 4M7DB 2YSQA 1OYXA 1ZSGA 4F16A 4ELYC 3V7RA 2ENMA 1I8FA 1KQSA 1K9MU 4HVUA 4KUDK 2DJZA 9ATCB 1X6OA 1F1BB 4XU2A 3DB3A 3VS0A 3RDVA 1QVGS 4F17A 1I0CA 3OMGA 3L2UA 4M77C 2O31A 1VYUA 2BZYA 2JVVA 1BI0A 4XTWA 1AT1B 3E2UA 5FWCA 2EW3A 1UGRB 1N5ZA 2HD0A 3KFVA 2JN0A 4CC4B 4L5GA 4FM4B 3MEWA 3HPWA 2RI2A 3HHTB 2EIFA 4R55A 2QXFA 1IB8A 2CP3A 2VASA 1C1AA 3MEVA 2K4YA 3JCMg 1H3HA 5LJ3j 2QQBA 4JS4A 4J8OA 2P4RA 2ABLA 3HRSA 1QVGP 5GAOr 4QVCA 2E41A 2O88A 2GFUA 4C8QB 1C6VX 3UDCA 4L59A 1VYTA 2YLCA 5GMKm 5KE2A 3ZBDA 1RADB 3L42A 4OMQA 3S3OA 2L2PA 2HMAA 5CCAA 2KRSA 5GMKj 2MCNA 3UA7A 2CUDA 1WGSA 4ZGJB 6AT1B 5GAN8 4MMLA 2CP2A 4J9HA 4F7UB 2B8AA 1VQPQ 5LJ3d 4PLIA 2DXBA 2I0NA 2X4YA 4E47A 2P0PA 1I07A 2M0YA 4IUVA 5CKHA 4RG8A 2Y4XA 4M77F 4PJOA 3MP8A 1K1ZA 1D3BB 3TVTA 1VQPT 1FMVA 1QKXA 3EH1A 2OTLT 4OGEA 4OVAA 1VQMA 5CR2A 2HBPA 1AVZC 1X69A 4JLGA 3TQ7P 2DL8A 2LX9A 4PJOE 1NPPA 1M3AA 2V8KA 4N0AA 3G71Q 4EMHA 2V1QA 4J9FA 1N9SA 3MCAB 4BI3A 1YP5A 3SDZA 1PKTA 1Y71A 1M4ZA 4JJDA 4DBHA 2O2OA 2JUFA 1MGQA 3G71T 1E6HA 1GFCA 2FZCB 1M90C 1I81A 3CXCA 1ARKA 2KDSA 4XAXB 4BY6B 2PQWA 2BE7D 2X3XD 3H0HA 1PSEA 2FPFA 3QWXX 2XICA 2EVRA 3EGDB 5FU7B 5DM7R 3EG9B 1KQ2A 1WHGA 3CD6A 2KGTA 4NL3A 2CZ6B 1M2VB 2JOYA 1ZSZA 1M1KU 3CCEA 5KE3A 5HKCA 4HVVA 1AD5A 1QW1A 3CCLQ 2QQAA 2YRDA 2MWPA 5J39A 2F2XA 3PT9A 1ZHIA 2DZ9A 4BE0A 4FL6A 3CCLT 3SWNC 2RJFA 2JXBA 1QWFA 1VIFA 4M7AD 2MK5A 1MUZA 4LN2A 1HYOA 1PG5B 1M27C 1G3TA 1N8RR 2ZPHB 3C12A 3EGXA 3QZ5B 4PJOG 2RHZA 4J9BA 2CREA 3PIOA 4E7JA 1Q82U 3INZA 1VQOQ 3LW5E 4X34A 3VJPA 4LDVA 4RTUA 2LRQA 1GRIA 2YHTA 2NUZA 1RABB 1UUEA 5KYWA 1VQ8A 1M1KC 5LJ5e 5IHKA 1VQOT 4JJNK 2EPDA 2SEMA 2V26A 4RTYA 2EJ9A 2RF0A 3LLRA 2RJCA 5LJ3g 1N6AA 4QQGA 4J9GA 1PKSA 2G3RA 1N9RA 2KNBB 4PJLA 1R8OB 2KBTA 2E3IA 1W6XA 5AYFA 5KYUA 4OMMA 4M77G 4D6WA 2DD5A 2AKKA 3X25B 4XU3A 1PSFA 2LVMA 3E19A 4DQ2A 4BE1A 4IKFA 3FRNA 4HXJA 1TS9A 3T9NA 4B6MA 3VU3C 3OS1A 1Q82C 2ZPIB 4IURA 3I5SA 1YIJA 1VQ9A 2CZ1B 2MOXA 2AHJB 3FC3A 1HJDA 4HCZA 3VKIA 2RPNA 3OW2A 5HK0A 4PFPA 1WA7A 3G7ZA 1KD1C 4FW2A 3KBGA 3TU4K 4M7AB 3CCRA 1YJ9T 3GNFB 3M57A 5LJ5h 1OZ2A 1WHJA 3CMEA 3X26B 2E5QA 1OX9A 4C0GA 3L2QA 3FIFA 1QVFA 4BB7A 4TVRA 1EZZB 4KGXB 5AT1B 4F04B 2DL7A 3QYGB 2A3LA 2LCLA 5J26A 3QIIA 3SWNA 3CCVA 2JM9A 1QWEA 3CQTA 3V7SA 3VS1A 1TH7A 2FRYA 5GAOl 4HCBA 3BW1A 2KAFA 2F69A 2CUBA 1GL5A 1U5SA 4KUIA 5GAOn 1X75C 4F14A 4KGZB 2CP5A 2BTTA 2BIVA 4QT7A 2GF7A 3PMTA 5I11A 1SHGA 4J5YA 1TXQA 2NUPB 1M9SA 3H0IA 2IPOB 2DEQA 3JCMb 3JB9F 2FZKB 1V76A 1JU5C 4Z8AA 2K9GA 3UT1A 1UECA 1NPRA 1ZX6A 1WJQA 3A8HB 4M78C 1N27A 3VS7A 1JEGA 3C95A 3EG3A 3TCJA 1VQ9Q 4JRKA 3OYLA 1AWXA 2KT8A 2KR3A 2CP6A 1AWJA 3L2ZA 1QCFA 2YLBA 3OMCA 1ABOA 2CKKA 5EG2A 2LC4A 2YDLA 2DXCA 3I5RA 3CCJQ 5CKFA 1ACMB 3O5ZA 3CC4A 1RAIB 3PFSA 5CQYA 4JZ4A 2HSPA 3R6NA 1QLYA 1SRLA 2P4TA 1UTIA 2K6DA 1GBRA 1RACB 4Y28E 5GAN6 4JJCA 3CCJT 2X9HA 2L3QA 1MMGA 1T0JA 2LZ6B 4QQ6A 3JSCA 4J7FA 5A2QE 3NTHA 4ZGDB 2DF6A 1BI3A 1MV0B 3JV3A 2SRCA 3S6WA 5IXFA 1W2BS 1EX4A 4C92B 1ZUYA 2KK4A 4DEYA 5GAMe 1RI9A 4UC4A 2Y90A 4DBQA 5GMKl 4JZ3A 4MMKA 1OI1A 3HRUA 1YJNA 2FVUA 2HCKA 2EKHA 2F1LA 2QTVA 4PJOD 2RQRA 1K0XA 5CK9A 1KIKA 4JDSA 5J3BA 1WX6A 1TUDA 5I21A 2ZPFB 4EMKC 3C4SA 2EQUA 2D8HA 1W2BP 4E7HA 5I2MA 1YITA 2PVOB 2JMAA 3EHRA 4OB1B 4ZTFA 1B7TA 1IGUA 5HK3A 1VQNT 1Q7YR 4WF2A 3CC4Q 3NTKA 2XIDA 4M77D 3G6EA 3I56Q 4M78A 4RTZA 3EFOB 5IXBA 3OYCA 1A0NB 1AEYA 4EPCA 1D1AA 3CCQQ 4DBFA 5KYYA 2LJ1A 5GAOq 1NE8A 3BFMA 5GAMh 4DOVA 1SSFA 1UHCA 1B34A 1V1CA 3SEMA 4M75A 5LJ5d 2JS0A 1FYNA 1K8AR 3JB9H 5GAN4 3I56T 4OMNA 3CCQT 1AHJB 1NJIR 2MMPA 2H8HA 8AT1B 1MMAA 3L2WA 1PCXA 1UGQB 2QDLA 3ME9A 1LVKA 4FSSA 3JB9G 3G4SA 1G3WA 2JTEA 4MDWA 5KYXA 3DLMA 4M75E 3UF4A 4JRQA 2ED0A 2L3PA 2QASA 3NMZC 4Q5WA 4KT0E 3VRZA 1M8VA 2A36A 1KJWA 4JS5A 3CPWP 2F2WA 4N4HA 2IIMA 1YJNQ 3EGUA 1GCPA 4Z89A 2E6NA 3GNGA 1IXDA 1VQLA 4PJOC 1GBQA 2X3WD 2WSFE 3QPHA 5DLQE 3URGA 3EG0A 2GTJA 1QVGA 2ZPBB 5LJ5f 3Q1JA 3TSWA 2BUDA 1JBMA 3H6ZA 2RI5A 2YXYA 5L8RE 3RKWA 2VWFA 1W4SA 3MHXA 3M55A 2D6FA 5IH2A 3O8VA 3L1AA 1C0MA 2YUPA 3CCUT 2KE9A 2LQ8A 1V29B 2ZCFB 1Z9ZA 4OP0A 4FIBA 1TU0B 4N0AC 3UA6A 1M1FA 2FG0A 2VB6A 1Y7XA 1FMKA 4BI4A 1UJYA 1WNLA 2WSCE 4NS5A 1BB9A 2O9SA 3M0QA 4M77B 3ZL7C 4A4HA 1OQKA 2H3EB 3PVLA 4EMKA 3G6EQ 1N8RC 2BZ8A 1JXMA 3M4YA 2QYZA 3OYJA 4R0KA 3HP9A 1X01A 2PVDB 1JXOA 1NG2A 3CCSA 3VV0A 4IIMA 1BCOA 2FO0A 3JCMV 2OI3A 3G6ET 2LNHB 2QGGA 5CIUA 3J81E 3GF5A 1NEGA 5D6WA 2AIRB 2ZPGB 3U23A 4M78G 1BIBA 4M4ZA 1OPKA 2GNCA 2F5KA 4A4GA 5GAN3 2FB7A 3QJ6A 5GMKi 1ZSZC 1RI0A 4PJOF 1B07A 3SD4A 3J7AF 1Y96A 1BU1A 1JB0E 3A98A 1BYMA 1VQ6A 2JZ2A 1G5VA 2JNGA 2OAUA 3EAEA 3DLLA 2L8DA 1QCOA 1YCSB 2O01E
chains in the Genus database with same CATH topology
1G3TA 4LDXA 4ZTJA 4J7IA 3M58A 2ZPHB 3C12A 3QZ5B 4PJOG 2RHZA 1Q82U 1B34B 3PIOA 4E7JA 2HQXA 3QG1A 5IAYA 3FJPA 4M75B 3INZA 4B9WA 1VQ7T 1Q81C 3LW5E 4KULA 1LJOA 4X34A 3VJPA 4LDVA 4BDZA 1M90U 2LRQA 3CBMA 2RB6A 2YHTA 4LDWA 4N4GA 4OB2B 3MEUA 4XU0A 1N8RU 2VGNA 3OYEA 3CC2A 3ER0A 5GANg 3OYNA 3AHUA 4DOWA 5LJ5g 5GANe 1VQ8A 1M1KC 5LJ5e 2RK1A 3QJYA 1QP2A 3VUBA 3V8JA 2EKOA 1VQOT 2FL7A 4JJNK 1VQNA 1KHCA 4MDXA 2DXUA 3JCMc 3QO3A 2QA4A 1WJRA 1WQ7A 2KY9A 2LCCA 2EJ9A 4M7AF 4PJOB 3LLRA 4E7IA 4RKUE 2RJCA 3X20B 5LJ3g 1N6AA 2PVGB 3JAME 3M53A 5LJ3e 1IZ6A 5A0LA 4QQGA 4CRIA 2G3RA 2ZPEB 1N9RA 1VQ5A 2DZCA 1LOJA 4C0FA 1R8OB 3CCRA 5AYFA 1YJNT 2E6ZA 4J83A 4M77G 4D6WA 3CBOA 3EFSA 3I56A 3ZEHA 2DXTA 2O4XA 2DD5A 1UGPB 3CCQA 1KC8C 3X25B 2EJGA 4XU3A 1PSFA 2LVMA 3E19A 1O9SA 3RKXA 4DQ2A 3QKJA 4BE1A 4IKFA 1RL2A 3J80E 3FRNA 4XTYA 4M7AG 2CZ0B 4A4EA 3T9NA 3OYFA 5GAMd 4PL6A 3BDUA 4RMOA 4ZN3A 3VU3C 4XK8E 3HFOA 3JRZA 3OS1A 4M7DA 1Q82C 1K73U 3MP6A 2ZPIB 4IURA 2GFAA 1YIJA 1WPYA 2DIGA 3HFNA 2RH2A 2VV5A 4C92A 1VQ9A 4XTZA 2BKDN 1QP3A 3GLXA 3QBYA 5KH6A 2CZ1B 1YHQA 3N5BB 2X4WA 4HT8A 4ATOA 4JLIA 2LT1A 4EDUA 1VQPA 1YITT 2AHJB 3FC3A 4ZN1A 3QDRB 1NZ9A 4HCZA 2OTLA 3OBYA 3VKIA 3OS2A 2GQVA 4M7DC 3OW2A 2VXFA 2OTJT 5HK0A 3HRTA 3PTAA 3PMIA 3G7ZA 5CQXA 5LL6S 4C92C 1KD1C 2EWNA 5D6YA 3WVEB 4M7DE 3KBGA 3TU4K 4M7AB 1Q86C 2XI9A 4EMKB 2V8JA 3LX7A 3CEYA 2M1HA 4LD6A 2X35A 3GNFB 4N4IA 4MZMA 3M57A 5GANh 1YJ9T 4C92E 5LJ5h 3CPWA 3DKMA 1OZ2A 3CMEA 3OYMA 2P0KA 3X26B 2E5QA 4C0GA 3L2QA 1VQ6T 5FROA 3FIFA 4IUQA 3HL8A 3UWNA 4BB7A 4QW2A 1QVFA 3FEOA 3QSUA 3PIPA 2HAXA 4TVRA 1VQ4T 4LD9K 1JJ2A 3CCUA 2E64A 2RK2A 4A54A 5GAMf 3DB4A 3QYGB 2A3LA 2XHCA 2LCLA 3H8ZA 5J26A 1I4K1 4OMFB 3JCMd 3QIIA 3SWNA 2K5LA 3HSBA 4QVZA 1XOVA 3JB9D 1KQSS 3CCVA 1ZQ1A 4FU6A 3MEAA 4CI0C 3QZ9B 3G71A 4IUUA 2QDYB 4M75G 1UB4A 2K5FA 4LDUA 3V7SA 4YTLA 1TH7A 5GAOl 1UGSB 4C5GA 4HCBA 4M7DD 3WXMB 3BW1A 3BY7A 1YBYA 3GPLA 4C0ZA 3KXTA 5FRNA 2KAFA 1K73C 2DTOA 2F69A 3A8GB 3G4ST 3QHSA 4KUIA 5GAOn 4HT9A 4FSXA 1X75C 1DJ7B 3OB9A 4XU1A 3CC2T 2K5IA 3QXEB 2FYKA 3GP8A 4PLLA 3I55T 2QI2A 2CGHA 3S3MA 1Y96B 4C8QA 4Y91A 2BIVA 2PUOB 2DAQA 2GF7A 1M1GA 3PMTA 1FWZA 2EQMA 1S72A 1VQMT 2K3XA 1G3YA 4J5YA 2L3RA 3M59A 2QA4T 2A7YA 4C5HA 1K9MC 4IUTA 4X9DA 2PU9B 1M9SA 3E1SA 4BE2A 2K3YA 3QUIA 3OYYA 1VQLT 1MHNA 1VUBA 2DIQA 2VGMA 2DEQA 4C8QC 1GXIE 3JCMb 3JB9F 1O75A 2RD1A 1IREB 3ASKA 3LYIA 2HQEA 3JCMf 1XTDA 2RHYA 1FX7A 2RM4A 5DY9A 3UT1A 4C8QE 1YJWA 2QEXA 2C06A 1NPRA 1JRIA 1XNIA 5FRMA 4F7UA 1WJQA 4O6JA 3A8HB 4M78C 4M7DF 1N27A 3OA6A 1U1TA 2KMTA 3OYKA 1KD1U 2M9UA 3C95A 3TCJA 5FLXE 5GAMj 1BKBA 4JRKA 2RHXA 4C92F 1BIAA 3OYLA 1VQKT 1HXDA 1Q86U 3QYHB 2DD4A 4M78E 3LWIA 3V7CA 3L2ZA 2YLBA 3OMCA 2CKKA 1H3ZA 2F5TX 2R58A 5EG2A 5GAN5 3CCMT 3CCLA 2VC8A 2LC4A 3F70A 2VYTA 3OYIA 2D9TA 2DPPB 3JCMQ 4NL2A 2DXCA 4QVDA 3OYDA 3LGLA 5CKBA 5CKFA 4F7UE 3JCMP 5CKEA 4VUBA 1YHQT 1NJIU 5GAOm 4FT2A 2Y4YA 3RESA 4GLKA 2XDDA 3CC4A 3CBPA 4OGCA 3TEEA 3PFSA 4OB0B 4E7KA 2E12A 5CQYA 2CYZB 4C92G 2P4TA 4C8QD 1FXXA 5CKDA 4J6WA 4A4KA 4Y28E 5GAN6 1EIFA 3CCJT 1KG1A 3FB9A 2MAMA 3RIRA 2M0OA 2XDPA 4O5VA 4R56A 1VQ7A 3CD6T 2DK3A 4B9XA 2O4XB 2LQKA 2PUKB 2EAYA 2L89A 3E9GA 4M78D 3RKYA 4QQ6A 3VYGA 3CCST 3JSCA 4J7FA 3META 5A2QE 3NTHA 3CPFA 2LT4A 4ZGDB 4NOYA 1BI3A 3PGGA 3WVDB 3HKSA 2RA2A 3LWHA 3FDRA 2IVWA 2EYQA 4C0DC 2GCXA 3CCET 3BDLA 1Q7YC 4M7DB 1H641 1VQOA 3S6WA 1OYXA 4ELYC 3OYHA 2RJEA 3V7RA 5LJ3f 1W2BS 4C92B 4BACA 1I8FA 1KQSA 2KK4A 1K9MU 4GY5A 2X4XA 2LDMA 2XG8D 4PJOE 5GAMg 4KUDK 4L6V5 2DJZA 1VIEA 5GAMe 4M77A 1X6OA 1KQ1A 3R6OA 2Y90A 4UC4A 4XU2A 5CVIA 4II1A 3DB3A 4MMKA 2QQSA 4C8QF 5M9OA 5GMKl 2K2VA 3A8MB 2DTIA 3EFRA 1OI1A 2DVEA 2WSEE 3M5AA 2DTHA 3HRUA 1YJNA 2FVUA 3UPUA 2HNIA 1QVGS 1K8AC 3RERA 2JTFA 4BUGA 2ZZDA 3OMGA 4PJOD 3TREA 3L2UA 4M77C 2EQJA 4XTUA 1NJIC 5IT9E 2JVVA 4XTWA 1BI0A 4BY6C 2KVQG 3LGFA 1BI1A 5CK9A 4IUPA 4PKCC 4JDSA 1UGRB 4M77E 4ELZC 5DLOA 5FU7C 5J3BA 3PNWC 5CO7A 5I21A 2HD0A 1S72T 2ZPFB 5A0GA 2JN0A 4XTVA 3C4SA 4EMKC 4HA8A 1I5LA 4F7UF 5D6XA 1LNXA 3X24B 4L5GA 4FM4B 3MEWA 5KCOA 2EQUA 3OY9A 3MO8A 3V8LA 4BI8B 3LH0A 2P0QA 3SWNB 3C94A 2XKOC 2CS7A 2QQ9A 2RI2A 3HPWA 3HHTB 2EIFA 4MZPA 5I2MA 4R55A 3L2RA 2EJFA 4E7HA 2QXFA 1YITA 4PNOA 2PVOB 3CXCS 1XQHA 1ZBXA 3MEVA 2OTJA 2K4YA 2H3JA 2RHUA 1VQ8T 3JCMg 3RUXA 3E9FA 3OSSC 4OB1B 1P92A 3JCMJ 3JCMe 4ZTFA 5HK3A 2QQBA 5LJ3j 4JS4A 4J8OA 1VQNT 3M4GA 1YJ9A 2E70A 4WF2A 3HRSA 5GAOr 4C5IA 4QVCA 2E41A 2R57A 2RO0A 3NTKA 2XIDA 2GFUA 4M77D 4C8QB 4M78A 3G6EA 3OYCA 4RG2A 2MI6A 4E7LA 2D0QB 4EPCA 3UDCA 3ZFJA 4L59A 3GOXA 3M9QA 1VQ5T 5GAOq 1NE8A 2YLCA 2YRVA 3BFMA 5GMKm 5KE2A 3ZBDA 5GAMh 4DOVA 1Q7YU 1SSFA 1U1SA 1B34A 3V8KA 5GANd 3L42A 4J6XA 4M75A 2XD0A 3FLGA 5FU6C 5LJ5d 1WQWA 3CMAA 3S3OA 3OBWA 3JB9H 1YCYA 5CCAA 5GAN4 3I56T 2ZGWA 3CCQT 2VUBA 2VXEA 5GMKj 1AHJB 1WGSA 4ZGJB 2MMPA 5GAN8 3M56A 4MMLA 4HKEA 4F7UB 2B8AA 2KQWA 4JRIA 5LJ3d 4PLIA 3VUZA 2DXBA 1QVPA 4M75C 3L2WA 2IG0A 1UGQB 2X4YA 3ME9A 5HY6A 1K8AU 4C5EA 3JB9G 1D3BA 3G4SA 1G3WA 4E47A 4MDWA 3JB9I 2P0PA 4RCBA 5GAN2 4OF1A 1YI2A 1YIJT 3DLMA 4M75E 1VQ9T 4IUVA 5CKHA 4RG8A 4JRQA 2Y4XA 3I55A 3CC7A 2XDBA 4M77F 4PJOA 3MP8A 4OB3B 4M7DG 1Y07A 2QQRA 4KT0E 4Q5WA 3S3NA 1M8VA 1D3BB 1OZ3A 1VQPT 1W2BA 1M5Q1 4JS5A 4N4HA 2OTLT 2RHIA 4OGEA 4OVAA 1VQMA 5CR2A 1G3SA 2E6NA 2HBPA 2MWOA 3GIBA 4Z02A 5GAOp 3GNGA 4JLGA 1VQLA 4PJOC 3VYHB 5CAIA 3P8HA 3CCRT 3QPHA 2WSFE 5DLQE 2LX9A 3URGA 5GAN7 5GANf 3JCMh 3CMET 1QVGA 1WJSA 2ZPBB 5LJ5f 3RMSA 4DA4A 3Q1JA 4BDYA 2BUDA 1JBMA 1NPPA 2V8IA 2XK0A 3MP1A 3NFCA 3H6ZA 2RI5A 3SFMA 5L8RE 3RKWA 4C0DB 4X9CA 4P5NA 1W4SA 2V8KA 3MHXA 4N0AA 4EMHA 4J6YA 3M55A 2D6FA 4JRPA 1N9SA 2L5QA 3O8VA 3L1AA 3MCAB 4M75D 3P8BB 3CCUT 1VQKA 4BI3A 3SDZA 3OYBA 2LQ8A 1Y71A 1V29B 1M4ZA 2ZCFB 2CZ7B 4OP0A 4MZTA 2JUFA 4FIBA 3CCVT 3CCMA 4N0AC 2LNVA 1M1FA 1MGQA 3OSVA 3JCMX 5GMKe 3G71T 4XTXA 1Y7XA 1HK9A 2MF2A 4LDYA 2DKGA 4BI4A 2WACA 4KBMB 3RMQA 1WNLA 2WSCE 4JUVA 4NS5A 4QQDA 4BD3A 1M90C 1I81A 4A4FA 4M77B 4M7AA 4A4HA 3CXCA 4EMKA 1N8RC 2KDSA 4XAXB 2R5MA 3SB2A 4BY6B 2PQWA 2X4JA 2FHDA 2EQKA 3P8DA 3M4YA 2K57A 4M78F 4V2SA 2E10A 1PSEA 3OYJA 2XICA 5FU7B 4EMGA 5DM7R 2LTOA 3HP9A 3CCJA 3A8OB 3JB9J 1KQ2A 1X01A 4ME7A 3CD6A 2PVDB 3A5ZB 4FT4A 4A53A 5A0DA 1Q81U 1UEBA 3CCSA 4M7AC 3VV0A 4M75F 2E1HA 4C8QG 3X28B 3JCMV 3G6ET 4ZGEB 5C0MA 3J81E 5CIUA 4NL3A 3OYAA 3GF5A 2CZ6B 2JOYA 3L2VA 5D6WA 4M7AE 5GANj 2KSSA 2ZPGB 3OS5A 5LJ5j 2JTMA 1M1KU 3CCEA 5KE3A 5HKCA 4M78G 5LJ3h 1BIBA 1YJWT 2QEXT 1QW1A 2EFIA 2F5KA 2NLUA 2QQAA 4A4GA 1U8RA 2QTXA 5GAN3 3CMAT 2MWPA 5J39A 3OW2S 2FB7A 3A8LB 3QJ6A 4HCCA 5IN1A 3NTIA 5GMKi 1KHIA 3PT9A 4XQ3A 1ZHIA 1RI0A 3OS0A 4F7UG 4PJOF 2I2LA 2DZ9A 4BE0A 3OYGA 3SD4A 3CPWS 1Y96A 4FL6A 3J7AF 1JB0E 3M54A 2DO3A 3CCLT 1BYMA 1BI2A 3JCMW 3SWNC 5KCHA 1VQ6A 4C92D 2XU8A 3OQ5A 2RJFA 1YI2T 2JZ2A 1G5VA 1VQ4A 1QVFS 2RI3A 2R5AA 2JNGA 1KC8U 2OAUA 3EAEA 3CC7T 5FU6B 3DLLA 2L8DA 1VIFA 5I2SA 5GMKh 1JJ2S 4M78B 4M7AD 2M16A 2E65A 3CC4T 2RJDA 3KUFA 4RCCA 5C6SA 2O01E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JB9 D;  5GAM g;  4PJO G;  3GIB A;  1B34 B;  2DJZ A;  5GAM e;  5GAO p;  4M77 A;  4M75 G;  3FJP A;  1KQ1 A;  4M75 B;  2Y90 A;  3V7S A;  4PJO C;  4XU2 A;  3INZ A;  1TH7 A;  4MMK A;  5CAI A;  5GMK l;  4C8Q F;  5GAO l;  1LJO A;  4M7D D;  2DTI A;  3EFR A;  5GAN f;  3BW1 A;  3BY7 A;  3JCM h;  5GAN 7;  2DVE A;  5LJ5 f;  2DTH A;  2DTO A;  2RB6 A;  1JBM A;  2HNI A;  2YHT A;  3RER A;  3QHS A;  4PJO E;  4XU0 A;  4HT9 A;  5GAO n;  3RKW A;  4X9C A;  4XU1 A;  4N0A A;  5GAN g;  4EMH A;  3AHU A;  2FYK A;  4J6Y A;  5LJ5 g;  4M77 C;  5GAN e;  4PJO D;  4XTU A;  1N9S A;  2CGH A;  1Y96 B;  4C8Q A;  4M75 D;  3L1A A;  4XTW A;  4Y91 A;  5LJ5 e;  3V8J A;  4M77 E;  2DXU A;  3JCM c;  3QO3 A;  5I21 A;  1WQ7 A;  4J5Y A;  4OP0 A;  2EJ9 A;  4M7A F;  4PJO B;  2JN0 A;  4XTV A;  4N0A C;  4X9D A;  4HA8 A;  4EMK C;  4F7U F;  5LJ3 g;  3JCM X;  1MGQ A;  1I5L A;  1LNX A;  5GMK e;  5LJ3 e;  3QUI A;  4XTX A;  3V8L A;  4C8Q C;  1HK9 A;  2DEQ A;  1N9R A;  3SWN B;  2DKG A;  2DZC A;  1LOJ A;  3JCM b;  3JB9 F;  1WNL A;  2RD1 A;  4JUV A;  3JCM f;  1I81 A;  2EJF A;  2RM4 A;  4M77 G;  5DY9 A;  4PNO A;  4M77 B;  4C8Q E;  4M7A A;  4EMK A;  1JRI A;  4F7U A;  3SB2 A;  3EFS A;  4M78 C;  4M78 F;  2DXT A;  4M7D F;  4V2S A;  2K57 A;  2E10 A;  1U1T A;  3JCM g;  3RUX A;  2EJG A;  4XU3 A;  5GAM j;  3JCM J;  3RKX A;  4DQ2 A;  4JRK A;  4C92 F;  3JCM e;  4EMG A;  1BIA A;  3JB9 J;  5LJ3 j;  1HXD A;  4XTY A;  4M78 E;  4M7A G;  3V7C A;  1KQ2 A;  1X01 A;  3M4G A;  5GAM d;  3L2Z A;  4WF2 A;  4A53 A;  2YLB A;  3BDU A;  5GAO r;  4M7A C;  4QVC A;  2E41 A;  3VU3 C;  4M75 F;  2E1H A;  3HFO A;  4M77 D;  4M78 A;  4C8Q B;  3JCM V;  4C8Q G;  5GAN 5;  4M7D A;  2VC8 A;  4NL3 A;  3JCM Q;  1WPY A;  4NL2 A;  3HFN A;  4C92 A;  4QVD A;  4M7A E;  5GAN j;  4XTZ A;  4F7U E;  5GAO q;  3JCM P;  2YLC A;  5LJ5 j;  3BFM A;  5GMK m;  5GAO m;  5GAM h;  4HT8 A;  1U1S A;  4JLI A;  1B34 A;  4M78 G;  3RES A;  3V8K A;  5LJ3 h;  5GAN d;  4J6X A;  1BIB A;  4M75 A;  5LJ5 d;  1WQW A;  4M7D C;  4C92 G;  3JB9 H;  2QTX A;  1YCY A;  4C8Q D;  5GAN 3;  5GAN 4;  2VXF A;  2ZGW A;  4J6W A;  2FB7 A;  2VXE A;  4C92 C;  5GMK i;  2EWN A;  5GAN 6;  5GMK j;  4M7D E;  3FB9 A;  4MML A;  4XQ3 A;  4M7A B;  3RIR A;  4EMK B;  5GAN 8;  4F7U G;  4PJO F;  4F7U B;  5GAN h;  2I2L A;  2DZ9 A;  4JRI A;  5LJ3 d;  4C92 E;  5LJ5 h;  2EAY A;  4M75 C;  4M78 D;  3RKY A;  1Y96 A;  3JB9 G;  1D3B A;  3JCM W;  3SWN C;  4C92 D;  3JB9 I;  4NOY A;  4RCB A;  5GAN 2;  3FIF A;  3PGG A;  4M75 E;  3QSU A;  2RA2 A;  4M77 F;  4PJO A;  2E64 A;  4M7D G;  5GMK h;  4A54 A;  4M78 B;  4M7A D;  4M7D B;  1H64 1;  1M8V A;  5GAM f;  1D3B B;  2E65 A;  1M5Q 1;  4RCC A;  3V7R A;  5LJ3 f;  3JCM d;  1I4K 1;  4C92 B;  3HSB A;  3SWN A;  1I8F A; 
#chains in the Genus database with same CATH topology
 4LDX A;  4ZTJ A;  4J7I A;  1PRM C;  3QG1 A;  5IAY A;  1WHM A;  4B9W A;  2DET A;  4KUL A;  1T3L A;  1M90 U;  4AFQ C;  4OB2 B;  3CC2 A;  1KQS P;  3MPU B;  3ER0 A;  4FYW B;  4DOW A;  5LJ5 g;  5GAN e;  3V8J A;  2FL7 A;  3GBQ A;  3QO3 A;  1WDX A;  5IHN A;  2NWM A;  3JAM E;  1AWO A;  2ZPE B;  4HCK A;  1VQ5 A;  5EC7 A;  4C0F A;  4LE9 A;  2C0O A;  2HKN A;  2QAZ A;  3EFS A;  3ZEH A;  4WTO B;  2J6K A;  1NEB A;  2ROT A;  2EJG A;  2K79 A;  1QCN A;  3RKX A;  1R77 A;  3QKJ A;  2DER A;  1PD1 A;  2A37 A;  5KYU B;  1IGQ A;  4A4E A;  5GAM d;  4PL6 A;  3BDU A;  1ZUK A;  4ZN3 A;  2A0F B;  4XK8 E;  1LPL A;  1UDL A;  4M7D A;  2M51 A;  2CP7 A;  2CH4 A;  2VV5 A;  4XTZ A;  4Z88 A;  5KH6 A;  4HT8 A;  1ZA2 B;  4ZN1 A;  2KRM A;  2GQV A;  1VQ6 Q;  1RAH B;  5CQX A;  5HCK A;  3WVE B;  2DMO A;  4M7D E;  1PHT A;  1Q86 C;  5GAN h;  1VOM A;  2P0K A;  7AT1 B;  1VQ6 T;  3HL8 A;  2MPX C;  3QSU A;  4LD9 K;  3M0S A;  4PFZ A;  5GAM f;  3EG1 A;  1SSH A;  2K5L A;  4QVZ A;  1XOV A;  3JB9 D;  3CC2 Q;  4FYY B;  1ZQ1 A;  3MEA A;  1UG1 A;  3QZ9 B;  4AG1 C;  4CI0 C;  1QQJ A;  2K5F A;  1VYV A;  4LDU A;  4RTV A;  1PC0 A;  1KFZ A;  1VQM Q;  3A8G B;  3QHS A;  1RUW A;  4HT9 A;  3CC2 T;  2K5I A;  2FYK A;  3GP8 A;  2KRO A;  1RAG B;  2QI2 A;  3S3M A;  4C8Q A;  4Y91 A;  1YFN A;  1SHF A;  4FCY A;  2EQM A;  1S72 A;  1VQM T;  2K3X A;  1G3Y A;  1M30 A;  2NYS A;  4IUT A;  4X9D A;  2RN8 A;  1OU8 A;  4BE2 A;  3QUI A;  1MHN A;  1VUB A;  2QG9 B;  1GXI E;  1O75 A;  2RD1 A;  3ASK A;  4LUE A;  3LYI A;  2X51 A;  2LQN A;  2DBK A;  2RHY A;  2RM4 A;  4C8Q E;  1YJW A;  2QEX A;  1UGV A;  4F7U A;  2E4H A;  1HD3 A;  4AFU C;  3OA6 A;  3NGP A;  1KD1 U;  1TTH B;  1B3Q A;  1BBZ A;  2RHX A;  2DNU A;  1MMN A;  2DD4 A;  2VKN A;  3UAT A;  1PWT A;  1H3Z A;  2F5T X;  2R58 A;  2EYX A;  5GAN 5;  3CXC P;  3OYI A;  4PJJ A;  2D9T A;  3JCM Q;  4QVD A;  5CKB A;  1RLP C;  4F7U E;  5CKE A;  3JCM P;  2KXC A;  1NJI U;  3CD6 Q;  2Y4Y A;  3RES A;  4OGC A;  2E12 A;  2CYZ B;  1FXX A;  1HSQ A;  5CKD A;  1Z9Q A;  4A4K A;  4J9C A;  1EIF A;  4ZNX A;  1KG1 A;  3CCE Q;  4O5V A;  1VQ7 A;  3CD6 T;  2DK3 A;  2EGE A;  2O4X B;  2L89 A;  4M78 D;  4A63 B;  1K9M R;  3CPF A;  2Z0W A;  4NOY A;  3PGG A;  2GQI A;  2CP0 A;  3LWH A;  3FDR A;  2YUQ A;  4C0D C;  3CCE T;  3BDL A;  1Q7Y C;  1H64 1;  3OYH A;  1RAA B;  2RJE A;  2DE0 X;  1BK2 A;  2XG8 D;  2LDM A;  5GAM g;  1Q95 G;  2MIO A;  1KQ1 A;  3R6O A;  2NUT B;  5CVI A;  1TOV A;  2DTI A;  3EFR A;  2DVE A;  2WSE E;  1K8A C;  3EGD A;  3UPU A;  2HNI A;  1S72 Q;  3EG9 A;  4BUG A;  2ZZD A;  1PNJ A;  1W70 A;  2EQJ A;  4XTU A;  1NJI C;  5IT9 E;  3LGF A;  1WHL A;  1BI1 A;  1M2V A;  3C0C A;  4PKC C;  5CO7 A;  1S72 T;  4XTV A;  4HA8 A;  1R0C B;  2AZS A;  1I5L A;  1VQ8 Q;  5KCO A;  2HL5 C;  3MO8 A;  3LH0 A;  2P0Q A;  3C94 A;  2XKO C;  2CS7 A;  1G2B A;  3L2R A;  1SG5 A;  2EJF A;  2OTJ A;  1MV3 A;  1VQ8 T;  1WHK A;  3FJ5 A;  3RUX A;  3E9F A;  1P92 A;  1EFN A;  1M8M A;  4E7Z A;  1SRM A;  3NHN A;  2E70 A;  2RO0 A;  3NPF A;  2D0Q B;  3H41 A;  1D1C A;  1Q86 R;  2D0N A;  4K11 A;  2YRV A;  2L3S A;  1U1S A;  1E6G A;  5GAN d;  4J6X A;  1WXU A;  2DL4 A;  2XD0 A;  5FU6 C;  1WQW A;  1I1J A;  3OBW A;  1ZA1 B;  1PM3 A;  1YIJ Q;  2ZGW A;  2VUB A;  2VXE A;  4HKE A;  1OOT A;  3VUZ A;  1QVP A;  4M75 C;  1AOJ A;  2IG0 A;  1D0X A;  4C5E A;  3JB9 I;  1YIJ T;  4OF1 A;  3OW2 P;  2J6O A;  1VQ9 T;  3I55 A;  3CCR Q;  2K2M A;  4AT1 B;  4OB3 B;  3A1P A;  1Y07 A;  2LQW A;  3S3N A;  1AZE A;  1OZ3 A;  3CME Q;  1W2B A;  2RHI A;  2DYB A;  3ULR B;  5FW9 A;  1MMD A;  4Z02 A;  5GAO p;  1ZBJ A;  2C0T A;  5CAI A;  1E7O A;  3CCR T;  5GAN 7;  5GAN f;  3CME T;  1WJS A;  4BDY A;  2XK0 A;  2V8I A;  3M0U A;  3M0R A;  3CCV Q;  4X9C A;  4J6Y A;  4DBR A;  2L5Q A;  3PVQ A;  1VQK A;  1Y0M A;  3OYB A;  2DRM A;  3EG2 A;  2CZ7 B;  3CCV T;  3CCM A;  4PFO A;  3JCM X;  4CC3 A;  5GMK e;  2K7A A;  1HK9 A;  2MF2 A;  4JUV A;  4A4F A;  4M7A A;  5FWB A;  4M78 F;  2FHD A;  4D8D A;  4DEX A;  2E10 A;  3JB9 J;  2LTO A;  2LCS A;  2JM8 A;  4ME7 A;  3A5Z B;  4A53 A;  2BE9 B;  2ZAE A;  1WXT A;  2HSE B;  4M75 F;  2E1H A;  3QWY A;  4ORZ A;  3X28 B;  2DRK A;  3L2V A;  4M7A E;  4RTT A;  2KSS A;  5LJ5 j;  2DEU A;  4LUD A;  5LJ3 h;  2NLU A;  1U8R A;  2QTX A;  1VA7 A;  1H92 A;  1IHW A;  2LP5 A;  5IN1 A;  3NTI A;  1K4U S;  3I55 Q;  2HZY A;  8ATC B;  2I2L A;  3CPW S;  1BI2 A;  3JCM W;  3RR6 A;  2XU8 A;  2PNI A;  1VQ4 A;  1Y57 A;  1JJ2 S;  5GMK h;  2KXD A;  2HQH A;  2NUP A;  3CC4 T;  1NM7 A;  2RJD A;  5C6S A;  1WXB A;  2D8J A;  3M58 A;  1D09 B;  5GJV B;  2HQX A;  1VQK Q;  4BDZ A;  3IQL A;  3CBM A;  4LDW A;  3MEU A;  4XU0 A;  1WLP B;  1N8R U;  3OYE A;  5GAN g;  3OYN A;  1OX8 A;  3VUB A;  4IIO A;  3JCM c;  1WJR A;  1WQ7 A;  4PJO B;  4E7I A;  2L0A A;  1SPK A;  2PVG B;  4AFS C;  4PK4 A;  3M53 A;  1IZ6 A;  3M0P A;  5A0L A;  2JT4 A;  1JJ2 P;  1K0S A;  2DZC A;  1LOJ A;  2AK5 A;  3HTR A;  1YJN T;  2E6Z A;  2EYY A;  2KYM A;  2DXT A;  1UGP B;  3QDF A;  1H8K A;  1O9S A;  1RL2 A;  4CC7 A;  3J80 E;  4M7A G;  2CZ0 B;  3OYF A;  1YIT Q;  1KK7 A;  4RMO A;  4RTW A;  3HFO A;  3MP6 A;  2EGC A;  4X1V A;  2A28 A;  4C92 A;  1YHQ A;  1QP3 A;  3GLX A;  3QBY A;  1Q81 R;  4JLI A;  2HBW A;  2LT1 A;  4EDU A;  1VQP A;  1YIT T;  2DIL A;  4LXC A;  1CSK A;  4M7D C;  3I9Q A;  3OBY A;  1LCK A;  2COY A;  2OTL A;  3HRT A;  1VQ4 Q;  2KT1 A;  3RBB B;  2V8J A;  3LX7 A;  2X35 A;  4C92 E;  3DKM A;  2CSI A;  3OYM A;  1X2K A;  1XJW B;  2CT3 A;  2BZX A;  4IUQ A;  3UWN A;  2G6F X;  1VQ4 T;  2E64 A;  2RK2 A;  4A54 A;  1WZO A;  4OMP A;  2RNA A;  1OV3 A;  3H8Z A;  1I4K 1;  2RQT A;  3G4S Q;  3HSB A;  1ZSZ B;  1KQS S;  4FU6 A;  4JJB A;  1KC8 R;  3G71 A;  4IUU A;  4M75 G;  1UB4 A;  4C5G A;  3WXM B;  3BY7 A;  4J9D A;  1YBY A;  4C0Z A;  5FRN A;  3G4S T;  2J6F A;  4FSX A;  3OB9 A;  4XU1 A;  2DA9 A;  4PLL A;  1VQL Q;  2CGH A;  3EFO A;  1K76 A;  4FYV B;  2DAQ A;  1JQQ A;  1FWZ A;  1K9M C;  2A7Y A;  4JPB W;  3E1S A;  2K3Y A;  3EHQ A;  3OYY A;  1VQL T;  4C8Q C;  2DIQ A;  1FMW A;  3EGX B;  1XTD A;  1FX7 A;  5DY9 A;  5FRM A;  3EH2 A;  2CSQ A;  4O6J A;  5I22 A;  4M7D F;  2KMT A;  3OYK A;  5FLX E;  5GAM j;  1BKB A;  1BIA A;  1YHQ Q;  2FPD A;  1HXD A;  1Q86 U;  3V7C A;  4AMC A;  1X6B A;  5GJW B;  5KYW B;  4KRT A;  2COZ A;  4PJM A;  2OTL Q;  3CCL A;  2VC8 A;  2VYT A;  2DPP B;  2VVK A;  4AFZ C;  3LGL A;  1TG0 A;  2FPE A;  4VUB A;  1YHQ T;  4FT2 A;  2FZG B;  2XDD A;  1IRX A;  3CCS Q;  1QKW A;  3TEE A;  4OB0 B;  1K73 R;  3VS3 A;  1ZUU A;  4C92 G;  3VS2 A;  3THK A;  2ECZ A;  2KYB A;  4J6W A;  1W1F A;  4AG2 C;  1T3S A;  2CDT A;  3FB9 A;  2MAM A;  3RIR A;  2M0O A;  2OX7 A;  1WI7 A;  3CCS T;  2LT4 A;  2DVJ A;  1NLP C;  1UJ0 A;  2EYQ A;  1X27 A;  2GCX A;  1VQO A;  2JW4 A;  5LJ3 f;  4BAC A;  4GY5 A;  2RQU A;  2X4X A;  1WFW A;  4L6V 5;  1VIE A;  4M77 A;  2EYZ A;  2OJ2 A;  4II1 A;  2QQS A;  4RUG A;  1CKA A;  4C8Q F;  2K2V A;  5M9O A;  2J05 A;  1ABQ A;  3A8M B;  1TUG B;  2DL3 A;  3M5A A;  3VS4 A;  2DTH A;  2E3H A;  1YWP A;  3I35 A;  3RER A;  2JTF A;  1G83 A;  1MND A;  1OUL A;  2MYS A;  3TRE A;  1AZG B;  1UFF A;  4BY6 C;  2EGA A;  2KVQ G;  4IUP A;  4M77 E;  4ELZ C;  5DLO A;  5FU7 C;  3PNW C;  2DFU A;  2GBQ A;  2HDA A;  4FW1 A;  2AT1 B;  2J7I A;  2RMO A;  5A0G A;  1WYX A;  4F7U F;  5D6X A;  2EQI A;  1LNX A;  3X24 B;  3OY9 A;  3V8L A;  4BI8 B;  3SWN B;  2QQ9 A;  2DX1 A;  1PRL C;  4KGV B;  4MZP A;  1TUC A;  4PNO A;  2PTK A;  1GFD A;  5D7U A;  3CXC S;  1XQH A;  1ZBX A;  2RHU A;  2H3J A;  3AT1 B;  2XMF A;  3OSS C;  3JCM J;  1VQ5 Q;  3JCM e;  4E2F B;  3M4G A;  1YJ9 A;  4OML A;  2GGR A;  1YWO A;  4C5I A;  2R57 A;  2ROL A;  4E7L A;  4RG2 A;  2MI6 A;  2HKQ B;  1U3O A;  2ATC B;  3ZFJ A;  4E6R A;  3GOX A;  3M9Q A;  1VQ5 T;  1IO6 A;  2O9V A;  1IHV A;  2F2V A;  1Q7Y U;  2E5K A;  3V8K A;  1RAF B;  3FLG A;  1YNZ A;  3CMA A;  1YCY A;  4ANJ A;  4FYX B;  2KEA A;  3M56 A;  1GCQ C;  2KQW A;  4JRI A;  2FRW A;  1UHF A;  1R0B G;  5HY6 A;  1K8A U;  1D3B A;  4D8K A;  1YI2 A;  2RQW A;  4RCB A;  5GAN 2;  3CC7 A;  2XDB A;  4Y92 A;  4M7D G;  2QQR A;  1OU9 A;  1M5Q 1;  3VS6 A;  1M3C A;  1G3S A;  2MWO A;  3REB B;  3GIB A;  1CKB A;  2LMJ A;  3VYH B;  3P8H A;  3H9N A;  1RAE B;  1G8X A;  3JCM h;  4DA4 A;  3RMS A;  1M2O A;  3NFC A;  2DLP A;  3SFM A;  3MP1 A;  2JJ9 A;  4C0D B;  2ESW A;  4P5N A;  4JRP A;  4M75 D;  3P8B B;  2LJ0 A;  4WCI A;  4MZT A;  2LNV A;  3OSV A;  1QMC A;  4XTX A;  1WIE A;  2J06 A;  2OAW A;  4LDY A;  2DKG A;  2WAC A;  4KBM B;  3RMQ A;  2RQV A;  3MJX A;  4QQD A;  1YJ9 Q;  4BD3 A;  2R5M A;  3SB2 A;  2X4J A;  4RTX A;  4V2S A;  2EQK A;  3P8D A;  2K57 A;  4EMG A;  1M3B A;  3CCJ A;  3A8O B;  2CT4 A;  4J9I A;  4FT4 A;  5A0D A;  1YJW Q;  1Q81 U;  2YWW A;  2QEX Q;  1UEB A;  4M7A C;  1S1N A;  2YUO A;  4C8Q G;  3CMA Q;  4ZGE B;  5C0M A;  3OYA A;  2JS2 A;  5GAN j;  1D0Z A;  2KI7 A;  3OS5 A;  2JTM A;  2KRN A;  1YJW T;  3TSZ A;  2QEX T;  2EFI A;  3CMA T;  1YI2 Q;  3OW2 S;  3A8L B;  4HCC A;  1KHI A;  2EYW A;  2ED1 A;  3CC7 Q;  1MNE A;  4XQ3 A;  3OS0 A;  4F7U G;  3OYG A;  3M54 A;  3PE0 A;  2DO3 A;  5KCH A;  4C92 D;  2FEI A;  3OQ5 A;  1YI2 T;  4CC2 A;  1QVF S;  2RI3 A;  2R5A A;  3MKD A;  2DL5 A;  1KC8 U;  1OEB A;  3CC7 T;  5FU6 B;  1VQ7 Q;  5I2S A;  1GCQ A;  1NYF A;  4M78 B;  2M16 A;  2E65 A;  2K3B A;  3KUF A;  4RCC A;  1M90 R;  5KYY B;  1AWW A;  4OMO A;  2COW A;  2HEQ A;  1B34 B;  3FJP A;  4M75 B;  1VQ7 T;  1Q81 C;  1LJO A;  1X6G A;  1D0Y A;  2RB6 A;  4N4G A;  2VGN A;  3AHU A;  2RK1 A;  3QJY A;  1QP2 A;  2EKO A;  5L23 A;  1NYG A;  1VQN A;  1KHC A;  5KYX B;  2YT6 A;  4MDX A;  4PJN A;  2DXU A;  3BE3 A;  2QA4 A;  1J3T A;  2KY9 A;  2LCC A;  4M7A F;  3VS5 A;  4RKU E;  3X20 B;  1QVF P;  5LJ3 e;  1BCM A;  4CRI A;  2DJQ A;  3REA B;  4J83 A;  3CBO A;  3I56 A;  2O4X A;  3CCQ A;  1KC8 C;  4HVW A;  4XTY A;  1PD0 A;  1TWB A;  2OTJ Q;  3JRZ A;  1SEM A;  1K73 U;  2GFA A;  1JO8 A;  1WPY A;  2DIG A;  2RH2 A;  3HFN A;  2BKD N;  1NLO C;  3N5B B;  2X4W A;  4ATO A;  2DBM A;  2NUT A;  3QDR B;  4KH0 B;  1NZ9 A;  2OTJ T;  3OS2 A;  2VXF A;  2A08 A;  3PTA A;  3PMI A;  5LL6 S;  4C92 C;  2EWN A;  5D6Y A;  2DYI A;  1YN8 A;  1M1K R;  2HL3 A;  2XI9 A;  4EMK B;  4MZM A;  3CEY A;  2M1H A;  4LD6 A;  4N4I A;  3H0F A;  3CPW A;  5KYN A;  1X43 A;  2C0I A;  2AZV A;  5FRO A;  4QKU A;  4QW2 A;  3FEO A;  3PIP A;  2HAX A;  1JJ2 A;  3CCU A;  2P84 A;  1X2Q A;  3DB4 A;  2XHC A;  3JCM d;  4GLM A;  3M0T A;  4OMF B;  2CH4 W;  2LX7 A;  2LJ3 A;  4KH1 B;  2QDY B;  2AKL A;  4YTL A;  2DM1 A;  2QGF B;  1UGS B;  4M7D D;  1VQN Q;  3GPL A;  3KXT A;  3G1J A;  5IHI A;  1K73 C;  2DTO A;  2QA4 Q;  1UE9 A;  1Q82 R;  1DJ7 B;  3QXE B;  4E7S A;  3I55 T;  1Y96 B;  1NBE B;  2PUO B;  1M1G A;  3VRY A;  2W0Z A;  1RLQ C;  1ZLM A;  2QA4 T;  2L3R A;  3M59 A;  2B86 A;  4C5H A;  2YRC A;  2PU9 B;  3RNJ A;  1KD1 R;  2VGM A;  4ESR A;  3SHW A;  1IRE B;  2HQE A;  3JCM f;  2C06 A;  3CCM Q;  1OPL A;  1JRI A;  1XNI A;  1U1T A;  2M9U A;  4C92 F;  1VQK T;  3QYH B;  4M78 E;  3LWI A;  1SKU B;  1I5O B;  2JMC A;  1TSF A;  2D1X A;  4J9E A;  3CCM T;  2EBP A;  3F70 A;  4NL2 A;  3OYD A;  1T0H A;  1KSW A;  5GAO m;  4GLK A;  1SF9 A;  2W10 A;  3CBP A;  2V1R A;  4E7K A;  2QK0 A;  1K9A A;  4C8Q D;  1U06 A;  3D7S B;  5ECA A;  4EIK A;  3CCU Q;  2XDP A;  4R56 A;  2YUN A;  2PUK B;  2LQK A;  4B9X A;  1D1B A;  2EAY A;  2M02 A;  3E9G A;  4LNP A;  3RKY A;  3VYG A;  3MET A;  2GTO A;  2PZ1 A;  4GBQ A;  1WHH A;  3WVD B;  3HKS A;  2RA2 A;  3LH5 A;  2IVW A;  4M7D B;  2YSQ A;  1OYX A;  1ZSG A;  4F16 A;  4ELY C;  3V7R A;  2ENM A;  1I8F A;  1KQS A;  1K9M U;  4HVU A;  4KUD K;  2DJZ A;  9ATC B;  1X6O A;  1F1B B;  4XU2 A;  3DB3 A;  3VS0 A;  3RDV A;  1QVG S;  4F17 A;  1I0C A;  3OMG A;  3L2U A;  4M77 C;  2O31 A;  1VYU A;  2BZY A;  2JVV A;  1BI0 A;  4XTW A;  1AT1 B;  3E2U A;  5FWC A;  2EW3 A;  1UGR B;  1N5Z A;  2HD0 A;  3KFV A;  2JN0 A;  4CC4 B;  4L5G A;  4FM4 B;  3MEW A;  3HPW A;  2RI2 A;  3HHT B;  2EIF A;  4R55 A;  2QXF A;  1IB8 A;  2CP3 A;  2VAS A;  1C1A A;  3MEV A;  2K4Y A;  3JCM g;  1H3H A;  5LJ3 j;  2QQB A;  4JS4 A;  4J8O A;  2P4R A;  2ABL A;  3HRS A;  1QVG P;  5GAO r;  4QVC A;  2E41 A;  2O88 A;  2GFU A;  4C8Q B;  1C6V X;  3UDC A;  4L59 A;  1VYT A;  2YLC A;  5GMK m;  5KE2 A;  3ZBD A;  1RAD B;  3L42 A;  4OMQ A;  3S3O A;  2L2P A;  2HMA A;  5CCA A;  2KRS A;  5GMK j;  2MCN A;  3UA7 A;  2CUD A;  1WGS A;  4ZGJ B;  6AT1 B;  5GAN 8;  4MML A;  2CP2 A;  4J9H A;  4F7U B;  2B8A A;  1VQP Q;  5LJ3 d;  4PLI A;  2DXB A;  2I0N A;  2X4Y A;  4E47 A;  2P0P A;  1I07 A;  2M0Y A;  4IUV A;  5CKH A;  4RG8 A;  2Y4X A;  4M77 F;  4PJO A;  3MP8 A;  1K1Z A;  1D3B B;  3TVT A;  1VQP T;  1FMV A;  1QKX A;  3EH1 A;  2OTL T;  4OGE A;  4OVA A;  1VQM A;  5CR2 A;  2HBP A;  1AVZ C;  1X69 A;  4JLG A;  3TQ7 P;  2DL8 A;  2LX9 A;  4PJO E;  1NPP A;  1M3A A;  2V8K A;  4N0A A;  3G71 Q;  4EMH A;  2V1Q A;  4J9F A;  1N9S A;  3MCA B;  4BI3 A;  1YP5 A;  3SDZ A;  1PKT A;  1Y71 A;  1M4Z A;  4JJD A;  4DBH A;  2O2O A;  2JUF A;  1MGQ A;  3G71 T;  1E6H A;  1GFC A;  2FZC B;  1M90 C;  1I81 A;  3CXC A;  1ARK A;  2KDS A;  4XAX B;  4BY6 B;  2PQW A;  2BE7 D;  2X3X D;  3H0H A;  1PSE A;  2FPF A;  3QWX X;  2XIC A;  2EVR A;  3EGD B;  5FU7 B;  5DM7 R;  3EG9 B;  1KQ2 A;  1WHG A;  3CD6 A;  2KGT A;  4NL3 A;  2CZ6 B;  1M2V B;  2JOY A;  1ZSZ A;  1M1K U;  3CCE A;  5KE3 A;  5HKC A;  4HVV A;  1AD5 A;  1QW1 A;  3CCL Q;  2QQA A;  2YRD A;  2MWP A;  5J39 A;  2F2X A;  3PT9 A;  1ZHI A;  2DZ9 A;  4BE0 A;  4FL6 A;  3CCL T;  3SWN C;  2RJF A;  2JXB A;  1QWF A;  1VIF A;  4M7A D;  2MK5 A;  1MUZ A;  4LN2 A;  1HYO A;  1PG5 B;  1M27 C;  1G3T A;  1N8R R;  2ZPH B;  3C12 A;  3EGX A;  3QZ5 B;  4PJO G;  2RHZ A;  4J9B A;  2CRE A;  3PIO A;  4E7J A;  1Q82 U;  3INZ A;  1VQO Q;  3LW5 E;  4X34 A;  3VJP A;  4LDV A;  4RTU A;  2LRQ A;  1GRI A;  2YHT A;  2NUZ A;  1RAB B;  1UUE A;  5KYW A;  1VQ8 A;  1M1K C;  5LJ5 e;  5IHK A;  1VQO T;  4JJN K;  2EPD A;  2SEM A;  2V26 A;  4RTY A;  2EJ9 A;  2RF0 A;  3LLR A;  2RJC A;  5LJ3 g;  1N6A A;  4QQG A;  4J9G A;  1PKS A;  2G3R A;  1N9R A;  2KNB B;  4PJL A;  1R8O B;  2KBT A;  2E3I A;  1W6X A;  5AYF A;  5KYU A;  4OMM A;  4M77 G;  4D6W A;  2DD5 A;  2AKK A;  3X25 B;  4XU3 A;  1PSF A;  2LVM A;  3E19 A;  4DQ2 A;  4BE1 A;  4IKF A;  3FRN A;  4HXJ A;  1TS9 A;  3T9N A;  4B6M A;  3VU3 C;  3OS1 A;  1Q82 C;  2ZPI B;  4IUR A;  3I5S A;  1YIJ A;  1VQ9 A;  2CZ1 B;  2MOX A;  2AHJ B;  3FC3 A;  1HJD A;  4HCZ A;  3VKI A;  2RPN A;  3OW2 A;  5HK0 A;  4PFP A;  1WA7 A;  3G7Z A;  1KD1 C;  4FW2 A;  3KBG A;  3TU4 K;  4M7A B;  3CCR A;  1YJ9 T;  3GNF B;  3M57 A;  5LJ5 h;  1OZ2 A;  1WHJ A;  3CME A;  3X26 B;  2E5Q A;  1OX9 A;  4C0G A;  3L2Q A;  3FIF A;  1QVF A;  4BB7 A;  4TVR A;  1EZZ B;  4KGX B;  5AT1 B;  4F04 B;  2DL7 A;  3QYG B;  2A3L A;  2LCL A;  5J26 A;  3QII A;  3SWN A;  3CCV A;  2JM9 A;  1QWE A;  3CQT A;  3V7S A;  3VS1 A;  1TH7 A;  2FRY A;  5GAO l;  4HCB A;  3BW1 A;  2KAF A;  2F69 A;  2CUB A;  1GL5 A;  1U5S A;  4KUI A;  5GAO n;  1X75 C;  4F14 A;  4KGZ B;  2CP5 A;  2BTT A;  2BIV A;  4QT7 A;  2GF7 A;  3PMT A;  5I11 A;  1SHG A;  4J5Y A;  1TXQ A;  2NUP B;  1M9S A;  3H0I A;  2IPO B;  2DEQ A;  3JCM b;  3JB9 F;  2FZK B;  1V76 A;  1JU5 C;  4Z8A A;  2K9G A;  3UT1 A;  1UEC A;  1NPR A;  1ZX6 A;  1WJQ A;  3A8H B;  4M78 C;  1N27 A;  3VS7 A;  1JEG A;  3C95 A;  3EG3 A;  3TCJ A;  1VQ9 Q;  4JRK A;  3OYL A;  1AWX A;  2KT8 A;  2KR3 A;  2CP6 A;  1AWJ A;  3L2Z A;  1QCF A;  2YLB A;  3OMC A;  1ABO A;  2CKK A;  5EG2 A;  2LC4 A;  2YDL A;  2DXC A;  3I5R A;  3CCJ Q;  5CKF A;  1ACM B;  3O5Z A;  3CC4 A;  1RAI B;  3PFS A;  5CQY A;  4JZ4 A;  2HSP A;  3R6N A;  1QLY A;  1SRL A;  2P4T A;  1UTI A;  2K6D A;  1GBR A;  1RAC B;  4Y28 E;  5GAN 6;  4JJC A;  3CCJ T;  2X9H A;  2L3Q A;  1MMG A;  1T0J A;  2LZ6 B;  4QQ6 A;  3JSC A;  4J7F A;  5A2Q E;  3NTH A;  4ZGD B;  2DF6 A;  1BI3 A;  1MV0 B;  3JV3 A;  2SRC A;  3S6W A;  5IXF A;  1W2B S;  1EX4 A;  4C92 B;  1ZUY A;  2KK4 A;  4DEY A;  5GAM e;  1RI9 A;  4UC4 A;  2Y90 A;  4DBQ A;  5GMK l;  4JZ3 A;  4MMK A;  1OI1 A;  3HRU A;  1YJN A;  2FVU A;  2HCK A;  2EKH A;  2F1L A;  2QTV A;  4PJO D;  2RQR A;  1K0X A;  5CK9 A;  1KIK A;  4JDS A;  5J3B A;  1WX6 A;  1TUD A;  5I21 A;  2ZPF B;  4EMK C;  3C4S A;  2EQU A;  2D8H A;  1W2B P;  4E7H A;  5I2M A;  1YIT A;  2PVO B;  2JMA A;  3EHR A;  4OB1 B;  4ZTF A;  1B7T A;  1IGU A;  5HK3 A;  1VQN T;  1Q7Y R;  4WF2 A;  3CC4 Q;  3NTK A;  2XID A;  4M77 D;  3G6E A;  3I56 Q;  4M78 A;  4RTZ A;  3EFO B;  5IXB A;  3OYC A;  1A0N B;  1AEY A;  4EPC A;  1D1A A;  3CCQ Q;  4DBF A;  5KYY A;  2LJ1 A;  5GAO q;  1NE8 A;  3BFM A;  5GAM h;  4DOV A;  1SSF A;  1UHC A;  1B34 A;  1V1C A;  3SEM A;  4M75 A;  5LJ5 d;  2JS0 A;  1FYN A;  1K8A R;  3JB9 H;  5GAN 4;  3I56 T;  4OMN A;  3CCQ T;  1AHJ B;  1NJI R;  2MMP A;  2H8H A;  8AT1 B;  1MMA A;  3L2W A;  1PCX A;  1UGQ B;  2QDL A;  3ME9 A;  1LVK A;  4FSS A;  3JB9 G;  3G4S A;  1G3W A;  2JTE A;  4MDW A;  5KYX A;  3DLM A;  4M75 E;  3UF4 A;  4JRQ A;  2ED0 A;  2L3P A;  2QAS A;  3NMZ C;  4Q5W A;  4KT0 E;  3VRZ A;  1M8V A;  2A36 A;  1KJW A;  4JS5 A;  3CPW P;  2F2W A;  4N4H A;  2IIM A;  1YJN Q;  3EGU A;  1GCP A;  4Z89 A;  2E6N A;  3GNG A;  1IXD A;  1VQL A;  4PJO C;  1GBQ A;  2X3W D;  2WSF E;  3QPH A;  5DLQ E;  3URG A;  3EG0 A;  2GTJ A;  1QVG A;  2ZPB B;  5LJ5 f;  3Q1J A;  3TSW A;  2BUD A;  1JBM A;  3H6Z A;  2RI5 A;  2YXY A;  5L8R E;  3RKW A;  2VWF A;  1W4S A;  3MHX A;  3M55 A;  2D6F A;  5IH2 A;  3O8V A;  3L1A A;  1C0M A;  2YUP A;  3CCU T;  2KE9 A;  2LQ8 A;  1V29 B;  2ZCF B;  1Z9Z A;  4OP0 A;  4FIB A;  1TU0 B;  4N0A C;  3UA6 A;  1M1F A;  2FG0 A;  2VB6 A;  1Y7X A;  1FMK A;  4BI4 A;  1UJY A;  1WNL A;  2WSC E;  4NS5 A;  1BB9 A;  2O9S A;  3M0Q A;  4M77 B;  3ZL7 C;  4A4H A;  1OQK A;  2H3E B;  3PVL A;  4EMK A;  3G6E Q;  1N8R C;  2BZ8 A;  1JXM A;  3M4Y A;  2QYZ A;  3OYJ A;  4R0K A;  3HP9 A;  1X01 A;  2PVD B;  1JXO A;  1NG2 A;  3CCS A;  3VV0 A;  4IIM A;  1BCO A;  2FO0 A;  3JCM V;  2OI3 A;  3G6E T;  2LNH B;  2QGG A;  5CIU A;  3J81 E;  3GF5 A;  1NEG A;  5D6W A;  2AIR B;  2ZPG B;  3U23 A;  4M78 G;  1BIB A;  4M4Z A;  1OPK A;  2GNC A;  2F5K A;  4A4G A;  5GAN 3;  2FB7 A;  3QJ6 A;  5GMK i;  1ZSZ C;  1RI0 A;  4PJO F;  1B07 A;  3SD4 A;  3J7A F;  1Y96 A;  1BU1 A;  1JB0 E;  3A98 A;  1BYM A;  1VQ6 A;  2JZ2 A;  1G5V A;  2JNG A;  2OAU A;  3EAE A;  3DLL A;  2L8D A;  1QCO A;  1YCS B;  2O01 E; 
#chains in the Genus database with same CATH homology
 1G3T A;  4LDX A;  4ZTJ A;  4J7I A;  3M58 A;  2ZPH B;  3C12 A;  3QZ5 B;  4PJO G;  2RHZ A;  1Q82 U;  1B34 B;  3PIO A;  4E7J A;  2HQX A;  3QG1 A;  5IAY A;  3FJP A;  4M75 B;  3INZ A;  4B9W A;  1VQ7 T;  1Q81 C;  3LW5 E;  4KUL A;  1LJO A;  4X34 A;  3VJP A;  4LDV A;  4BDZ A;  1M90 U;  2LRQ A;  3CBM A;  2RB6 A;  2YHT A;  4LDW A;  4N4G A;  4OB2 B;  3MEU A;  4XU0 A;  1N8R U;  2VGN A;  3OYE A;  3CC2 A;  3ER0 A;  5GAN g;  3OYN A;  3AHU A;  4DOW A;  5LJ5 g;  5GAN e;  1VQ8 A;  1M1K C;  5LJ5 e;  2RK1 A;  3QJY A;  1QP2 A;  3VUB A;  3V8J A;  2EKO A;  1VQO T;  2FL7 A;  4JJN K;  1VQN A;  1KHC A;  4MDX A;  2DXU A;  3JCM c;  3QO3 A;  2QA4 A;  1WJR A;  1WQ7 A;  2KY9 A;  2LCC A;  2EJ9 A;  4M7A F;  4PJO B;  3LLR A;  4E7I A;  4RKU E;  2RJC A;  3X20 B;  5LJ3 g;  1N6A A;  2PVG B;  3JAM E;  3M53 A;  5LJ3 e;  1IZ6 A;  5A0L A;  4QQG A;  4CRI A;  2G3R A;  2ZPE B;  1N9R A;  1VQ5 A;  2DZC A;  1LOJ A;  4C0F A;  1R8O B;  3CCR A;  5AYF A;  1YJN T;  2E6Z A;  4J83 A;  4M77 G;  4D6W A;  3CBO A;  3EFS A;  3I56 A;  3ZEH A;  2DXT A;  2O4X A;  2DD5 A;  1UGP B;  3CCQ A;  1KC8 C;  3X25 B;  2EJG A;  4XU3 A;  1PSF A;  2LVM A;  3E19 A;  1O9S A;  3RKX A;  4DQ2 A;  3QKJ A;  4BE1 A;  4IKF A;  1RL2 A;  3J80 E;  3FRN A;  4XTY A;  4M7A G;  2CZ0 B;  4A4E A;  3T9N A;  3OYF A;  5GAM d;  4PL6 A;  3BDU A;  4RMO A;  4ZN3 A;  3VU3 C;  4XK8 E;  3HFO A;  3JRZ A;  3OS1 A;  4M7D A;  1Q82 C;  1K73 U;  3MP6 A;  2ZPI B;  4IUR A;  2GFA A;  1YIJ A;  1WPY A;  2DIG A;  3HFN A;  2RH2 A;  2VV5 A;  4C92 A;  1VQ9 A;  4XTZ A;  2BKD N;  1QP3 A;  3GLX A;  3QBY A;  5KH6 A;  2CZ1 B;  1YHQ A;  3N5B B;  2X4W A;  4HT8 A;  4ATO A;  4JLI A;  2LT1 A;  4EDU A;  1VQP A;  1YIT T;  2AHJ B;  3FC3 A;  4ZN1 A;  3QDR B;  1NZ9 A;  4HCZ A;  2OTL A;  3OBY A;  3VKI A;  3OS2 A;  2GQV A;  4M7D C;  3OW2 A;  2VXF A;  2OTJ T;  5HK0 A;  3HRT A;  3PTA A;  3PMI A;  3G7Z A;  5CQX A;  5LL6 S;  4C92 C;  1KD1 C;  2EWN A;  5D6Y A;  3WVE B;  4M7D E;  3KBG A;  3TU4 K;  4M7A B;  1Q86 C;  2XI9 A;  4EMK B;  2V8J A;  3LX7 A;  3CEY A;  2M1H A;  4LD6 A;  2X35 A;  3GNF B;  4N4I A;  4MZM A;  3M57 A;  5GAN h;  1YJ9 T;  4C92 E;  5LJ5 h;  3CPW A;  3DKM A;  1OZ2 A;  3CME A;  3OYM A;  2P0K A;  3X26 B;  2E5Q A;  4C0G A;  3L2Q A;  1VQ6 T;  5FRO A;  3FIF A;  4IUQ A;  3HL8 A;  3UWN A;  4BB7 A;  4QW2 A;  1QVF A;  3FEO A;  3QSU A;  3PIP A;  2HAX A;  4TVR A;  1VQ4 T;  4LD9 K;  1JJ2 A;  3CCU A;  2E64 A;  2RK2 A;  4A54 A;  5GAM f;  3DB4 A;  3QYG B;  2A3L A;  2XHC A;  2LCL A;  3H8Z A;  5J26 A;  1I4K 1;  4OMF B;  3JCM d;  3QII A;  3SWN A;  2K5L A;  3HSB A;  4QVZ A;  1XOV A;  3JB9 D;  1KQS S;  3CCV A;  1ZQ1 A;  4FU6 A;  3MEA A;  4CI0 C;  3QZ9 B;  3G71 A;  4IUU A;  2QDY B;  4M75 G;  1UB4 A;  2K5F A;  4LDU A;  3V7S A;  4YTL A;  1TH7 A;  5GAO l;  1UGS B;  4C5G A;  4HCB A;  4M7D D;  3WXM B;  3BW1 A;  3BY7 A;  1YBY A;  3GPL A;  4C0Z A;  3KXT A;  5FRN A;  2KAF A;  1K73 C;  2DTO A;  2F69 A;  3A8G B;  3G4S T;  3QHS A;  4KUI A;  5GAO n;  4HT9 A;  4FSX A;  1X75 C;  1DJ7 B;  3OB9 A;  4XU1 A;  3CC2 T;  2K5I A;  3QXE B;  2FYK A;  3GP8 A;  4PLL A;  3I55 T;  2QI2 A;  2CGH A;  3S3M A;  1Y96 B;  4C8Q A;  4Y91 A;  2BIV A;  2PUO B;  2DAQ A;  2GF7 A;  1M1G A;  3PMT A;  1FWZ A;  2EQM A;  1S72 A;  1VQM T;  2K3X A;  1G3Y A;  4J5Y A;  2L3R A;  3M59 A;  2QA4 T;  2A7Y A;  4C5H A;  1K9M C;  4IUT A;  4X9D A;  2PU9 B;  1M9S A;  3E1S A;  4BE2 A;  2K3Y A;  3QUI A;  3OYY A;  1VQL T;  1MHN A;  1VUB A;  2DIQ A;  2VGM A;  2DEQ A;  4C8Q C;  1GXI E;  3JCM b;  3JB9 F;  1O75 A;  2RD1 A;  1IRE B;  3ASK A;  3LYI A;  2HQE A;  3JCM f;  1XTD A;  2RHY A;  1FX7 A;  2RM4 A;  5DY9 A;  3UT1 A;  4C8Q E;  1YJW A;  2QEX A;  2C06 A;  1NPR A;  1JRI A;  1XNI A;  5FRM A;  4F7U A;  1WJQ A;  4O6J A;  3A8H B;  4M78 C;  4M7D F;  1N27 A;  3OA6 A;  1U1T A;  2KMT A;  3OYK A;  1KD1 U;  2M9U A;  3C95 A;  3TCJ A;  5FLX E;  5GAM j;  1BKB A;  4JRK A;  2RHX A;  4C92 F;  1BIA A;  3OYL A;  1VQK T;  1HXD A;  1Q86 U;  3QYH B;  2DD4 A;  4M78 E;  3LWI A;  3V7C A;  3L2Z A;  2YLB A;  3OMC A;  2CKK A;  1H3Z A;  2F5T X;  2R58 A;  5EG2 A;  5GAN 5;  3CCM T;  3CCL A;  2VC8 A;  2LC4 A;  3F70 A;  2VYT A;  3OYI A;  2D9T A;  2DPP B;  3JCM Q;  4NL2 A;  2DXC A;  4QVD A;  3OYD A;  3LGL A;  5CKB A;  5CKF A;  4F7U E;  3JCM P;  5CKE A;  4VUB A;  1YHQ T;  1NJI U;  5GAO m;  4FT2 A;  2Y4Y A;  3RES A;  4GLK A;  2XDD A;  3CC4 A;  3CBP A;  4OGC A;  3TEE A;  3PFS A;  4OB0 B;  4E7K A;  2E12 A;  5CQY A;  2CYZ B;  4C92 G;  2P4T A;  4C8Q D;  1FXX A;  5CKD A;  4J6W A;  4A4K A;  4Y28 E;  5GAN 6;  1EIF A;  3CCJ T;  1KG1 A;  3FB9 A;  2MAM A;  3RIR A;  2M0O A;  2XDP A;  4O5V A;  4R56 A;  1VQ7 A;  3CD6 T;  2DK3 A;  4B9X A;  2O4X B;  2LQK A;  2PUK B;  2EAY A;  2L89 A;  3E9G A;  4M78 D;  3RKY A;  4QQ6 A;  3VYG A;  3CCS T;  3JSC A;  4J7F A;  3MET A;  5A2Q E;  3NTH A;  3CPF A;  2LT4 A;  4ZGD B;  4NOY A;  1BI3 A;  3PGG A;  3WVD B;  3HKS A;  2RA2 A;  3LWH A;  3FDR A;  2IVW A;  2EYQ A;  4C0D C;  2GCX A;  3CCE T;  3BDL A;  1Q7Y C;  4M7D B;  1H64 1;  1VQO A;  3S6W A;  1OYX A;  4ELY C;  3OYH A;  2RJE A;  3V7R A;  5LJ3 f;  1W2B S;  4C92 B;  4BAC A;  1I8F A;  1KQS A;  2KK4 A;  1K9M U;  4GY5 A;  2X4X A;  2LDM A;  2XG8 D;  4PJO E;  5GAM g;  4KUD K;  4L6V 5;  2DJZ A;  1VIE A;  5GAM e;  4M77 A;  1X6O A;  1KQ1 A;  3R6O A;  2Y90 A;  4UC4 A;  4XU2 A;  5CVI A;  4II1 A;  3DB3 A;  4MMK A;  2QQS A;  4C8Q F;  5M9O A;  5GMK l;  2K2V A;  3A8M B;  2DTI A;  3EFR A;  1OI1 A;  2DVE A;  2WSE E;  3M5A A;  2DTH A;  3HRU A;  1YJN A;  2FVU A;  3UPU A;  2HNI A;  1QVG S;  1K8A C;  3RER A;  2JTF A;  4BUG A;  2ZZD A;  3OMG A;  4PJO D;  3TRE A;  3L2U A;  4M77 C;  2EQJ A;  4XTU A;  1NJI C;  5IT9 E;  2JVV A;  4XTW A;  1BI0 A;  4BY6 C;  2KVQ G;  3LGF A;  1BI1 A;  5CK9 A;  4IUP A;  4PKC C;  4JDS A;  1UGR B;  4M77 E;  4ELZ C;  5DLO A;  5FU7 C;  5J3B A;  3PNW C;  5CO7 A;  5I21 A;  2HD0 A;  1S72 T;  2ZPF B;  5A0G A;  2JN0 A;  4XTV A;  3C4S A;  4EMK C;  4HA8 A;  1I5L A;  4F7U F;  5D6X A;  1LNX A;  3X24 B;  4L5G A;  4FM4 B;  3MEW A;  5KCO A;  2EQU A;  3OY9 A;  3MO8 A;  3V8L A;  4BI8 B;  3LH0 A;  2P0Q A;  3SWN B;  3C94 A;  2XKO C;  2CS7 A;  2QQ9 A;  2RI2 A;  3HPW A;  3HHT B;  2EIF A;  4MZP A;  5I2M A;  4R55 A;  3L2R A;  2EJF A;  4E7H A;  2QXF A;  1YIT A;  4PNO A;  2PVO B;  3CXC S;  1XQH A;  1ZBX A;  3MEV A;  2OTJ A;  2K4Y A;  2H3J A;  2RHU A;  1VQ8 T;  3JCM g;  3RUX A;  3E9F A;  3OSS C;  4OB1 B;  1P92 A;  3JCM J;  3JCM e;  4ZTF A;  5HK3 A;  2QQB A;  5LJ3 j;  4JS4 A;  4J8O A;  1VQN T;  3M4G A;  1YJ9 A;  2E70 A;  4WF2 A;  3HRS A;  5GAO r;  4C5I A;  4QVC A;  2E41 A;  2R57 A;  2RO0 A;  3NTK A;  2XID A;  2GFU A;  4M77 D;  4C8Q B;  4M78 A;  3G6E A;  3OYC A;  4RG2 A;  2MI6 A;  4E7L A;  2D0Q B;  4EPC A;  3UDC A;  3ZFJ A;  4L59 A;  3GOX A;  3M9Q A;  1VQ5 T;  5GAO q;  1NE8 A;  2YLC A;  2YRV A;  3BFM A;  5GMK m;  5KE2 A;  3ZBD A;  5GAM h;  4DOV A;  1Q7Y U;  1SSF A;  1U1S A;  1B34 A;  3V8K A;  5GAN d;  3L42 A;  4J6X A;  4M75 A;  2XD0 A;  3FLG A;  5FU6 C;  5LJ5 d;  1WQW A;  3CMA A;  3S3O A;  3OBW A;  3JB9 H;  1YCY A;  5CCA A;  5GAN 4;  3I56 T;  2ZGW A;  3CCQ T;  2VUB A;  2VXE A;  5GMK j;  1AHJ B;  1WGS A;  4ZGJ B;  2MMP A;  5GAN 8;  3M56 A;  4MML A;  4HKE A;  4F7U B;  2B8A A;  2KQW A;  4JRI A;  5LJ3 d;  4PLI A;  3VUZ A;  2DXB A;  1QVP A;  4M75 C;  3L2W A;  2IG0 A;  1UGQ B;  2X4Y A;  3ME9 A;  5HY6 A;  1K8A U;  4C5E A;  3JB9 G;  1D3B A;  3G4S A;  1G3W A;  4E47 A;  4MDW A;  3JB9 I;  2P0P A;  4RCB A;  5GAN 2;  4OF1 A;  1YI2 A;  1YIJ T;  3DLM A;  4M75 E;  1VQ9 T;  4IUV A;  5CKH A;  4RG8 A;  4JRQ A;  2Y4X A;  3I55 A;  3CC7 A;  2XDB A;  4M77 F;  4PJO A;  3MP8 A;  4OB3 B;  4M7D G;  1Y07 A;  2QQR A;  4KT0 E;  4Q5W A;  3S3N A;  1M8V A;  1D3B B;  1OZ3 A;  1VQP T;  1W2B A;  1M5Q 1;  4JS5 A;  4N4H A;  2OTL T;  2RHI A;  4OGE A;  4OVA A;  1VQM A;  5CR2 A;  1G3S A;  2E6N A;  2HBP A;  2MWO A;  3GIB A;  4Z02 A;  5GAO p;  3GNG A;  4JLG A;  1VQL A;  4PJO C;  3VYH B;  5CAI A;  3P8H A;  3CCR T;  3QPH A;  2WSF E;  5DLQ E;  2LX9 A;  3URG A;  5GAN 7;  5GAN f;  3JCM h;  3CME T;  1QVG A;  1WJS A;  2ZPB B;  5LJ5 f;  3RMS A;  4DA4 A;  3Q1J A;  4BDY A;  2BUD A;  1JBM A;  1NPP A;  2V8I A;  2XK0 A;  3MP1 A;  3NFC A;  3H6Z A;  2RI5 A;  3SFM A;  5L8R E;  3RKW A;  4C0D B;  4X9C A;  4P5N A;  1W4S A;  2V8K A;  3MHX A;  4N0A A;  4EMH A;  4J6Y A;  3M55 A;  2D6F A;  4JRP A;  1N9S A;  2L5Q A;  3O8V A;  3L1A A;  3MCA B;  4M75 D;  3P8B B;  3CCU T;  1VQK A;  4BI3 A;  3SDZ A;  3OYB A;  2LQ8 A;  1Y71 A;  1V29 B;  1M4Z A;  2ZCF B;  2CZ7 B;  4OP0 A;  4MZT A;  2JUF A;  4FIB A;  3CCV T;  3CCM A;  4N0A C;  2LNV A;  1M1F A;  1MGQ A;  3OSV A;  3JCM X;  5GMK e;  3G71 T;  4XTX A;  1Y7X A;  1HK9 A;  2MF2 A;  4LDY A;  2DKG A;  4BI4 A;  2WAC A;  4KBM B;  3RMQ A;  1WNL A;  2WSC E;  4JUV A;  4NS5 A;  4QQD A;  4BD3 A;  1M90 C;  1I81 A;  4A4F A;  4M77 B;  4M7A A;  4A4H A;  3CXC A;  4EMK A;  1N8R C;  2KDS A;  4XAX B;  2R5M A;  3SB2 A;  4BY6 B;  2PQW A;  2X4J A;  2FHD A;  2EQK A;  3P8D A;  3M4Y A;  2K57 A;  4M78 F;  4V2S A;  2E10 A;  1PSE A;  3OYJ A;  2XIC A;  5FU7 B;  4EMG A;  5DM7 R;  2LTO A;  3HP9 A;  3CCJ A;  3A8O B;  3JB9 J;  1KQ2 A;  1X01 A;  4ME7 A;  3CD6 A;  2PVD B;  3A5Z B;  4FT4 A;  4A53 A;  5A0D A;  1Q81 U;  1UEB A;  3CCS A;  4M7A C;  3VV0 A;  4M75 F;  2E1H A;  4C8Q G;  3X28 B;  3JCM V;  3G6E T;  4ZGE B;  5C0M A;  3J81 E;  5CIU A;  4NL3 A;  3OYA A;  3GF5 A;  2CZ6 B;  2JOY A;  3L2V A;  5D6W A;  4M7A E;  5GAN j;  2KSS A;  2ZPG B;  3OS5 A;  5LJ5 j;  2JTM A;  1M1K U;  3CCE A;  5KE3 A;  5HKC A;  4M78 G;  5LJ3 h;  1BIB A;  1YJW T;  2QEX T;  1QW1 A;  2EFI A;  2F5K A;  2NLU A;  2QQA A;  4A4G A;  1U8R A;  2QTX A;  5GAN 3;  3CMA T;  2MWP A;  5J39 A;  3OW2 S;  2FB7 A;  3A8L B;  3QJ6 A;  4HCC A;  5IN1 A;  3NTI A;  5GMK i;  1KHI A;  3PT9 A;  4XQ3 A;  1ZHI A;  1RI0 A;  3OS0 A;  4F7U G;  4PJO F;  2I2L A;  2DZ9 A;  4BE0 A;  3OYG A;  3SD4 A;  3CPW S;  1Y96 A;  4FL6 A;  3J7A F;  1JB0 E;  3M54 A;  2DO3 A;  3CCL T;  1BYM A;  1BI2 A;  3JCM W;  3SWN C;  5KCH A;  1VQ6 A;  4C92 D;  2XU8 A;  3OQ5 A;  2RJF A;  1YI2 T;  2JZ2 A;  1G5V A;  1VQ4 A;  1QVF S;  2RI3 A;  2R5A A;  2JNG A;  1KC8 U;  2OAU A;  3EAE A;  3CC7 T;  5FU6 B;  3DLL A;  2L8D A;  1VIF A;  5I2S A;  5GMK h;  1JJ2 S;  4M78 B;  4M7A D;  2M16 A;  2E65 A;  3CC4 T;  2RJD A;  3KUF A;  4RCC A;  5C6S A;  2O01 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...