3CC7Q

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2487u
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cc7Q00
1VQKQ 3CMEQ 1VQ4Q 1N8RR 1VQNQ 1VQMQ 1KD1R 1VQ8Q 3G4SQ 1VQOQ 1KC8R 2OTLQ 1VQ6Q 3CCEQ 3I56Q 3G6EQ 1M90R 1Q81R 3CCLQ 2QA4Q 1JJ2P 1YIJQ 1YJ9Q 1K9MR 1Q86R 3CCQQ 1QVGP 1YHQQ 1VQ5Q 1VQPQ 3CC2Q 3G71Q 1VQLQ 3OW2P 3CC7Q 1YJWQ 1VQ7Q 1K8AR 2QEXQ 3CCVQ 3CCRQ 3CMAQ 3CXCP 3I55Q 3CPWP 1YI2Q 1S72Q 3CCUQ 1Q7YR 1YJNQ 1QVFP 2OTJQ 1VQ9Q 1M1KR 3CCMQ 1KQSP 3CCJQ 1YITQ 3CCSQ 1W2BP 1Q82R 3CD6Q 3CC4Q 1NJIR 1K73R
chains in the Genus database with same CATH superfamily
1YWOA 1TSFA 2LJ1A 1UJYA 1OI1A 4CC3A 2PVDB 3PE0A 1M4ZA 1D3BA 1PRLC 1X01A 1BI3A 2EKOA 2QA4Q 1H92A 5GAN7 2YXYA 4A63B 2NUPA 1BB9A 8AT1B 1N5ZA 4CC4B 2E10A 3TREA 2D6FA 4J9IA 4E7ZA 2XHCA 4JZ3A 1YBYA 1S72T 1IREB 3UA7A 1WGSA 3HHTB 1AZGB 2E65A 2DYIA 4F7UB 2QQ9A 2ZGWA 4KBMB 4PLIA 2C06A 1WDXA 2K5LA 4LDYA 5CKDA 3O8VA 1VQ5A 2NUTB 3E1SA 2K79A 4B9XA 2IIMA 2EYXA 1AZEA 4BY6B 1WXUA 1TOVA 1M1KU 3LLRA 4RTYA 1CKBA 2HBPA 3HFOA 2AIRB 4L59A 2CP0A 1BI0A 1VQ5Q 3I56T 3DB3A 1NM7A 4LD6A 1QP3A 4BUGA 1JRIA 4J7FA 2E1HA 4M7AB 2ED0A 2DTIA 2VV5A 2HZYA 5KYWB 4MZTA 5GAOp 1FMWA 3CCLT 4OB1B 4M78C 2RI3A 2CT4A 3MEVA 4HVWA 1H8KA 1K73C 1ZLMA 1W70A 2HBWA 2LQ8A 2X4WA 3H9NA 2GFUA 5CR2A 2CDTA 4J9GA 1MV3A 3CCVQ 4FYWB 2A7YA 1Q7YR 3BY7A 3S3MA 1M8MA 1WX6A 4FYYB 4LD9K 3OB9A 3JCMc 3VKIA 2OTLA 1Q7YC 2IVWA 1JJ2A 5LL6S 2RHZA 2NUTA 2DVEA 5FW9A 3CBOA 3H6ZA 1UHCA 2FHDA 3MP6A 2JVVA 3SWNC 4J9BA 3CCJA 5I2SA 3CD6T 2X4YA 4K11A 5CVIA 2XK0A 2JOYA 3OS2A 1NPRA 4M75F 3OA6A 1VYUA 2DYBA 2V26A 1WFWA 1YCYA 2BIVA 4M78F 1VQ4Q 2QYZA 5LJ3e 2BZYA 1G3YA 5GJWB 2RK1A 1MGQA 3LYIA 4JRKA 3OY9A 2NUPB 2QEXT 4JRPA 2QEXA 3JCMJ 2EGEA 2ZCFB 2DXCA 1WJQA 4C92D 1I0CA 3CCMT 3V8LA 2ZPFB 1GRIA 5D6WA 4M75A 3VS6A 2MPXC 1VYVA 4M75B 3JB9H 2CZ1B 2R5AA 4M77A 3OMCA 2JNGA 1I07A 1YI2A 1R0BG 3FEOA 1VOMA 1YJWQ 1B34A 3VS5A 5GAN5 2EQIA 3CPWP 4OMNA 2CZ0B 1TXQA 2RD1A 2RNAA 3QHSA 2DBMA 4E7JA 3GIBA 3EGDB 3M55A 1NG2A 1KHIA 2E12A 4DOWA 5CCAA 1E7OA 1K76A 2EIFA 4V2SA 3C94A 4HKEA 3RESA 1ZSZC 2EQJA 4M78D 2COZA 2AKLA 3E2UA 2O4XB 3G71Q 4M7AD 2DJQA 4KGXB 3JCMX 3CCUQ 4BI3A 3D7SB 5D7UA 3QIIA 1Q82R 4E6RA 3CCRT 4F7UG 1I1JA 2HQXA 1KC8U 4C0ZA 3NTKA 4RUGA 2K3BA 4FU6A 1GFCA 3RUXA 1YJWT 3JB9D 3OW2S 2QQAA 2R57A 3VU3C 2X4XA 3A98A 3L2WA 1WYXA 1QVFP 4RTXA 4ATOA 4C0FA 1K0XA 2DE0X 4RG2A 1KD1R 2LT4A 1OEBA 4C5EA 3VS1A 4B6MA 2QQRA 3DKMA 2LJ3A 1Q86C 4M77B 3CQTA 3HSBA 1QVGP 2JZ2A 2F2WA 3MEUA 5L8RE 4CRIA 2DJZA 5GAOm 3CCRQ 1ZBXA 1EZZB 1J3TA 3GLXA 1FYNA 2P0KA 2OI3A 3RDVA 2LQWA 4UC4A 3NTIA 5DLOA 3EFSA 5CKHA 1M30A 1BCOA 1N8RR 1UGRB 3PMTA 3OYLA 3EH2A 2KY9A 2A3LA 2OAUA 1XNIA 3L2QA 2JXBA 1MV0B 3EG3A 5FRMA 3OYEA 3OW2P 1EFNA 1M3BA 1UE9A 4KGVB 2COYA 4PK4A 2KE9A 1FX7A 1KJWA 4HCZA 3IQLA 2NUZA 2CUDA 2V8KA 5IXBA 2YRVA 3PNWC 3LX7A 4QVCA 3TVTA 2PNIA 4XTUA 3PTAA 2CZ7B 4N4HA 3OMGA 1K9MR 3NHNA 1UUEA 3BFMA 1JQQA 2C0TA 2WSFE 4FCYA 1H3ZA 2HQEA 1VQ6A 4AG1C 3ASKA 1RL2A 4PJJA 4IUVA 3FLGA 3ZBDA 4PL6A 1YJ9A 3UF4A 3EFOA 2V1QA 1ZSGA 2X3XD 4AFQC 1YITA 1ACMB 1NEBA 4NOYA 2YUNA 5CKBA 1WI7A 4RTTA 1QCNA 2OTLT 3QG1A 3G6ET 2QA4T 3JCMb 2RO0A 5IXFA 4HCKA 2KYMA 4P5NA 1W2BA 1VQLQ 2HEQA 4PJOA 2FZCB 4KH0B 5GAMd 3CC4T 1C1AA 2RPNA 2WSEE 2FPEA 3CBMA 3FIFA 1AD5A 4D6WA 2EQKA 1WQ7A 2BE9B 5KYUB 4FT2A 2G6FX 2JW4A 1GXIE 2RHXA 3JV3A 4QW2A 4AFZC 5DY9A 2HD0A 2DM1A 1VQOA 2BUDA 3L42A 4AG2C 1X2KA 4RTVA 4EMKC 4BDZA 3QDRB 1BIBA 4OB2B 2SRCA 2J06A 1VQ7A 1U3OA 2YRCA 3C12A 1D0ZA 2CP6A 4C5HA 2DETA 3ULRB 3OYKA 4OB3B 1U8RA 2GBQA 2DRKA 3JCMQ 2E4HA 3M0UA 3CC7A 3CC7T 1B34B 1VQ5T 3CCEQ 3I56Q 1WLPB 1R77A 1YI2T 2RI2A 3JCMg 5FU7B 4JLIA 4N0AA 4XU3A 3CMAQ 4XTVA 4RTWA 1K9MC 3I55T 1T3SA 2KK4A 1BCMA 2FO0A 2DPPB 3M53A 1WPYA 1KD1U 2E70A 3JCMV 1KC8R 2A37A 1VQPA 4JUVA 3FJ5A 1T0JA 3L1AA 1OULA 2YUPA 1BK2A 2FPDA 1YHQQ 4DA4A 2FB7A 2QGFB 4XK8E 2JN0A 4PJLA 5HY6A 3M5AA 1KQSA 4M7DB 3CC4A 1RABB 3OYNA 1ZBJA 3SHWA 4N4GA 3CMEA 1QWEA 2RA2A 4A53A 1AVZC 3CBPA 5GAN6 1QKWA 3P8HA 3L2RA 2MOXA 2GGRA 2ZPIB 2A28A 1YHQA 2JM8A 1GCQC 3ZEHA 2F2XA 2JUFA 3F70A 4LDVA 2DL7A 1E6GA 1D1AA 2VWFA 3HFNA 5IHIA 4R0KA 3I55Q 3LWIA 4C8QC 1W2BP 3THKA 4IIMA 2QQBA 1VUBA 1WHJA 3SEMA 3J7AF 2ED1A 1YHQT 5GAMe 4BB7A 3OYBA 2LQKA 3MEAA 3CCQQ 2FVUA 2CSQA 2HQHA 1FMKA 4E7IA 4BE1A 2ESWA 2KEAA 1P92A 4M77F 4PJOG 2E64A 3NMZC 3LGLA 4GLKA 3KBGA 1G2BA 1IGQA 2QDLA 1I8FA 3CCSA 3H41A 1YIJT 3JSCA 3UATA 2BZXA 1Y96A 2K4YA 3CCQA 2HSPA 2B8AA 2AZVA 2FYKA 5GANh 4PJOB 3PFSA 3X24B 4C8QB 1VQ8T 1Q82C 3EG2A 2ROTA 4C8QA 4C8QE 1G3WA 2QA4A 1M1GA 1YJNQ 2LC4A 2FPFA 1FMVA 3CCSQ 4F04B 1PM3A 3GOXA 2JMCA 3EG9B 3RKWA 2PQWA 2YUQA 4JS4A 2H3JA 3WVDB 3G71A 5CKFA 1QVFA 4EPCA 3GF5A 2GQIA 2K7AA 5GMKj 3CCUA 1UGPB 2DMOA 1Y57A 3VRZA 1OPLA 1N9SA 3MPUB 2PTKA 4O6JA 1CSKA 2VC8A 3A8MB 5FWCA 4F14A 3EGDA 1RAAB 1NJIU 1LNXA 1QMCA 3META 2DXBA 4E2FB 1PKTA 3QZ5B 5I21A 3OYHA 2LCSA 2RK2A 2E5QA 4C92C 3SWNB 4A4KA 4M7DD 1KQ1A 2KXDA 2XICA 3O5ZA 4PJOC 3OYDA 4JPBW 3X28B 2HSEB 3HRTA 4LE9A 2MCNA 3ER0A 2AK5A 5KCHA 2EJGA 2MI6A 4NS5A 3HRUA 4BE0A 3CCJT 3RKXA 2I0NA 1PD1A 4OB0B 3OYCA 2VXEA 2HKNA 3G1JA 1RAEB 2G3RA 1Y7XA 1WNLA 3QKJA 2FL7A 4EMKA 2JJ9A 2VKNA 1FXXA 2DZ9A 1TU0B 1VQ9A 2NWMA 3X20B 2GTOA 5C0MA 3JCMh 2E6ZA 3CMET 4MZPA 4OMOA 2E3HA 3VV0A 1S72A 3ME9A 2BE7D 4N0AC 4OP0A 2MAMA 3MO8A 3JB9J 1M2VA 2O2OA 4HXJA 3E9GA 5KYNA 3CCJQ 4LDUA 1Q82U 1K73R 1VA7A 2LT1A 3A8GB 1OZ3A 3EG0A 1BI1A 2F5TX 4R56A 1X75C 2QTVA 4XAXB 2P4RA 4OF1A 4R55A 1W1FA 1OX9A 1ZUKA 2OTJA 1BU1A 1UTIA 2DNUA 1UGSB 1QVGA 2HAXA 1M1KR 4O5VA 4J8OA 4XTYA 4JJBA 1RAFB 1ZUYA 3LW5E 5GAOn 4QVDA 4C5IA 3RMQA 3G4SQ 3VUBA 3CCLQ 1BYMA 3V8JA 1TG0A 4A4EA 4GBQA 5IHNA 3MHXA 3CPWA 1X27A 3BW1A 5LJ5g 2D0QB 1UB4A 1VQKA 5KE2A 1I5OB 3OYJA 1TUCA 4M4ZA 5KE3A 2HL5C 4E7LA 2RHYA 1PRMC 3RKYA 4II1A 4PLLA 3FC3A 1VQNT 2XDPA 2OAWA 4VUBA 5CKEA 3UA6A 1JXOA 3PVLA 4TVRA 4C92F 2GNCA 3OYFA 1MHNA 3HP9A 2DAQA 5KYXA 3EAEA 2VYTA 1VQOQ 4PJOE 1O9SA 1JJ2S 2P4TA 1JO8A 4JZ4A 2DTOA 2JS0A 2ABLA 1VQNA 1RAGB 4Q5WA 2DX1A 1SKUB 4FT4A 2K2MA 3TEEA 4EMGA 1QQJA 1VQ7Q 3H0HA 1PCXA 1C6VX 2E5KA 2YSQA 1Q95G 4EMHA 2XMFA 2C0OA 3EGXB 2FEIA 3CCMQ 3CC7Q 2GTJA 2XKOC 4WF2A 2R58A 3SDZA 1OQKA 2A0FB 5FU6C 1VQNQ 3CC2T 2Y4XA 2HCKA 3CMAA 2RJEA 2XI9A 3VS7A 1ZSZB 2LTOA 5KCOA 3CCMA 4J9HA 4PKCC 5KYYB 3EG9A 3GNGA 1RUWA 5GMKm 4LUDA 5GAN8 1HJDA 2YHTA 2QAZA 1NZ9A 4F7UF 2NYSA 3R6NA 4F16A 2O4XA 1EX4A 1YCSB 3M54A 2CH4A 3DLMA 3HTRA 1VQ6T 2M0YA 4M77E 3J81E 4C0DB 2DBKA 5GAN3 1G3TA 2RQWA 5GAOr 4C0DC 4CC2A 4J83A 4M7DE 2HDAA 1UECA 2CP5A 1T3LA 5CK9A 1R0CB 2DEQA 4OMFB 2FRYA 2RQUA 4AFUC 1WJSA 3AHUA 3FB9A 2LX9A 4ME7A 4HA8A 4C8QF 5GAN4 4FW2A 3A8HB 2EYQA 1LOJA 1IO6A 1ARKA 1ZX6A 2O88A 5LJ5e 4LDWA 2X35A 3R6OA 3CCVT 5GANj 2FRWA 1M3AA 4MMKA 5AYFA 1V76A 5LJ5f 3SWNA 1K8AC 1VQ6Q 4LXCA 2K3YA 2F5KA 2EW3A 3OS1A 3L2UA 3WVEB 3QYHB 1SSFA 1N8RU 4DBQA 1LCKA 2QQSA 1IZ6A 3GP8A 3CXCP 8ATCB 1WHKA 2L3QA 3KUFA 2DIQA 2W10A 2LVMA 2DVJA 2YWWA 4Z89A 4FW1A 5IN1A 3JB9G 1XJWB 4M75C 2BZ8A 2X51A 2QDYB 2EYYA 3C0CA 2MF2A 1D3BB 2MMPA 4ZN3A 1ABOA 1NEGA 3JCMd 3G7ZA 1AT1B 4M78B 2VGNA 3AT1B 1DJ7B 1VQLA 1AWXA 4LDXA 3QPHA 1QLYA 2IPOB 3RNJA 2LCCA 1QKXA 5CO7A 3SB2A 4OMLA 5GAOq 2LZ6B 3A1PA 2DKGA 3MP1A 3P8DA 2PVGB 1WZOA 5GJVB 5I2MA 3J80E 1RLPC 3OS5A 4ZN1A 1U1TA 3KXTA 2EGAA 2KAFA 3NTHA 1G83A 2L3PA 2JS2A 5GMKh 1YIJA 4Z88A 2D8HA 1VQPT 2KYBA 2OX7A 2CH4W 5CAIA 4J9EA 5A0GA 1IGUA 1GCQA 1SHGA 1MMGA 1N6AA 1X69A 1OOTA 4DBFA 3LH0A 4X9CA 2X4JA 1VQMT 1MNEA 1M1KC 4RCCA 1GCPA 4NL2A 4PJNA 1UJ0A 3G71T 5FU6B 3CXCA 4PJOD 1UGVA 2DRMA 2RQVA 1GFDA 1SRMA 3EHRA 2DL3A 3VUZA 3S3NA 2OTLQ 2V8IA 3G6EQ 1HK9A 3KFVA 4M7AG 2KT8A 4A4GA 1KIKA 2RJDA 2LRQA 2ROLA 3I5SA 4XU0A 3TU4K 1VQPQ 1D1CA 2L5QA 2DILA 1XTDA 2KT1A 1K73U 3M0TA 1VQLT 3CC4Q 3M58A 2DZCA 3CMEQ 3LGFA 3LWHA 1QCOA 2M0OA 1KHCA 2D9TA 2DF6A 5L23A 3I5RA 1GL5A 2Y90A 2GQVA 3CCVA 1Q86R 1Q7YU 1LVKA 4M7DC 1OX8A 4QVZA 2HNIA 1SF9A 2DL5A 1KD1C 5KYXB 2A36A 1SEMA 2H3EB 2LMJA 3VRYA 4RG8A 3OYAA 2KDSA 1W2BS 2XD0A 4ZTFA 4DOVA 2YDLA 1PG5B 2K5FA 1V29B 1IHWA 2I2LA 2EPDA 2ZPBB 2V1RA 2KVQG 2F1LA 1NJIC 2J6OA 5IH2A 3CXCS 5FRNA 3EGUA 5LJ5h 2YLBA 2VASA 4L6V5 5HKCA 1WJRA 1YI2Q 1N27A 4XTWA 2VGMA 1G3SA 2PUOB 2BTTA 3V7RA 5A0DA 1IHVA 3OQ5A 3G4ST 1K4US 4ELYC 3URGA 2L0AA 4KUIA 4GY5A 4M7DA 1I5LA 3FJPA 3JB9I 4HVVA 5EC7A 2J6KA 2MK5A 1IB8A 2MIOA 2DL8A 1YFNA 2YUOA 3OSVA 1D09B 2CP2A 1Z9ZA 2WACA 1ZQ1A 3OYIA 2K9GA 2DIGA 1JXMA 3OSSC 1OU8A 4RMOA 1M90R 1TWBA 5GAN2 1YJWA 3M57A 3M56A 5KH6A 4M75D 4J6WA 1AWOA 4JJNK 2DERA 2SEMA 2COWA 3SD4A 2JT4A 4EDUA 3MJXA 2L3SA 3OYMA 2EVRA 4ORZA 4E7SA 2QK0A 3DLLA 1ABQA 1WA7A 1W6XA 4IIOA 4JJCA 3NGPA 2JMAA 4M75E 1ZUUA 4MZMA 4X9DA 1K8AR 2L89A 4M7DF 4HCCA 1Q81C 1NLPC 2DTHA 4EMKB 2CUBA 5IAYA 5FROA 3GPLA 3RERA 1G5VA 2GF7A 1E6HA 4FM4B 4BACA 3VS2A 1JEGA 2EYWA 2RI5A 3QO3A 4OMQA 3L2VA 1YJ9T 2EGCA 5C6SA 2DA9A 2DK3A 4M77G 4M7DG 4J9CA 2ECZA 1KK7A 4XQ3A 4PFPA 2LNVA 5LJ3f 4JRQA 1OYXA 2EBPA 1UG1A 1D0XA 3CCET 3JCMe 4AMCA 4QQDA 2RJFA 1X6BA 1S72Q 3CC2A 4QKUA 1B07A 2HMAA 3MKDA 3VYGA 4J5YA 4RCBA 1RADB 3CPFA 4BE2A 5FLXE 2QGGA 2KMTA 4IUPA 1EIFA 1YJ9Q 6AT1B 3EH1A 2CZ6B 1NLOC 2R5MA 7AT1B 1KQSS 2LJ0A 4C8QD 1AWJA 1PWTA 1O75A 2KQWA 1ZA1B 1U06A 1RACB 2DXTA 1R8OB 3QJ6A 2LDMA 1HD3A 2M1HA 3X26B 1TUDA 4OMMA 3RMSA 3ZFJA 2XU8A 2ZAEA 1SRLA 3CCUT 3EG1A 4AT1B 2KGTA 3V7SA 2EQUA 3CCLA 1PKSA 4IUTA 2A08A 3L2ZA 4C8QG 2PZ1A 3QUIA 1OPKA 3NPFA 5KYYA 1Y71A 2C0IA 2RQRA 3OYYA 1H641 4KRTA 1SPKA 2NLUA 5M9OA 1Y07A 4PFOA 1BKBA 2M51A 2EJ9A 3H0IA 3PIOA 2JTMA 3CCQT 3C95A 2DFUA 1B7TA 4D8KA 3A8OB 1M2VB 3PMIA 3QXEB 1K9AA 2CKKA 1XOVA 1YIJQ 3T9NA 1D1BA 2RB6A 4BY6C 4L5GA 3A8LB 2L3RA 5DM7R 2W0ZA 5GAMj 3SFMA 1SSHA 2E41A 3TSWA 2IG0A 4FIBA 4OGCA 5J26A 3CPWS 1VQ4T 5A2QE 1RAIB 5GAMh 1YJNT 3JAME 1VQMQ 1WHLA 1ZHIA 3QWYA 4YTLA 5FU7C 1UEBA 4X1VA 2MWOA 1M3CA 1M90U 5GMKe 2M02A 2XDBA 2JM9A 2K57A 1XQHA 3OYGA 3X25B 4IKFA 3MP8A 3JCMW 4QQ6A 1MMNA 4PFZA 4ZGJB 2CP3A 1X6GA 4C0GA 3EGXA 3CCEA 2LX7A 1N8RC 3G6EA 2WSCE 3JB9F 3PT9A 4ZGEB 4JDSA 1K9MU 1MNDA 3HKSA 1QW1A 2FZKB 1AHJB 1M27C 1Z9QA 2X9HA 2AHJB 4KUDK 2O9VA 2RF0A 4KULA 2PU9B 2XDDA 5CIUA 1HXDA 2M9UA 4JS5A 1OZ2A 4NL3A 4A54A 3JCMP 2KRSA 3RBBB 1BIAA 3OS0A 1Q81R 2VXFA 5I22A 3M0SA 4ANJA 1YWPA 3H8ZA 1M2OA 2ATCB 5DLQE 4F17A 3REAB 5EG2A 2MYSA 1PSFA 1X6OA 1HSQA 4Y28E 3CEYA 3S6WA 2DD5A 5KYWA 1BBZA 2EWNA 4KH1B 2B86A 4E7KA 2AT1B 1RLQC 3PIPA 2LQNA 2EAYA 3VS4A 2CREA 1VQ4A 5HCKA 1KQ2A 3RR6A 2ZPHB 2P84A 1X43A 4HCBA 4B9WA 3GBQA 5J3BA 5LJ3h 4HT9A 4LN2A 1GBRA 5CQYA 2RMOA 3INZA 4J9DA 3H0FA 3V7CA 3E19A 4MDWA 2L2PA 4DBRA 3QSUA 3I9QA 2QASA 5IT9E 1VIEA 4HVUA 2LCLA 1NE8A 2J05A 1Y0MA 3NFCA 1YN8A 2K5IA 1PHTA 5GMKl 1A0NB 3UDCA 2RHIA 2E3IA 3EFOB 2Y4YA 2H8HA 2L8DA 1M5Q1 1OU9A 1U5SA 1YNZA 2KRMA 3M9QA 2EKHA 2DO3A 4FYXB 5HK3A 5GAOl 1M90C 3U23A 2CS7A 1W4SA 2RN8A 1UFFA 2E6NA 1T0HA 1QVGS 2F69A 4KT0E 1YJNA 2ZZDA 4PNOA 3M0RA 2ENMA 4A4HA 1UGQB 4XTZA 2QXFA 1N9RA 3BDLA 3WXMB 4ZTJA 4M7AC 2D1XA 2EFIA 1Q86U 4Z8AA 4XU2A 5I11A 2K2VA 1MUZA 1VIFA 1NYGA 2DD4A 2HKQB 4ELZC 1C0MA 1KG1A 4C92G 3Q1JA 3QWXX 4M77C 2RJCA 1SHFA 1MMAA 4DEXA 3BDUA 4FYVB 1HYOA 2KRNA 3OBWA 1NJIR 1TTHB 2OTJT 1VQ9T 1PC0A 2O31A 2PUKB 4XU1A 4RKUE 5LJ3g 1K1ZA 1WXBA 2Z0WA 3EHQA 1TUGB 4RTZA 4A4FA 1JU5C 4BD3A 1OV3A 3M0QA 4AFSC 3JRZA 3HPWA 2KBTA 5GAMg 4C5GA 3JCMf 1VQ7T 3TCJA 1H3HA 4JLGA 1PSEA 2CT3A 4J6YA 4LNPA 3CD6A 1VYTA 3UPUA 1SG5A 1WHGA 2LP5A 1QVPA 3DB4A 1KSWA 3QYGB 5GAMf 3CC2Q 1KC8C 4CI0C 4PJOF 4FSXA 5KYUA 2OTJQ 1QVFS 4M7AE 1VQ9Q 1U1SA 3CD6Q 2FG0A 4N4IA 4RTUA 3V8KA 1JBMA 2XIDA 2YT6A 4IUQA 3VS3A 5AT1B 2XG8D 4ZGDB 1JJ2P 4F7UA 3G4SA 2DEUA 3QJYA 2KI7A 4HT8A 1AWWA 2DLPA 2QEXQ 3VYHB 1QCFA 3HRSA 4OGEA 3PVQA 4OMPA 3M4YA 3BE3A 1I81A 1K0SA 3QZ9B 2VB6A 1VQKQ 4D8DA 2EQMA 2QTXA 3ZL7C 2KNBB 1JB0E 2EYZA 1M9SA 4F7UE 1Q81U 2GCXA 4ZNXA 2AZSA 2K6DA 2AKKA 5J39A 1GBQA 3CMAT 2M16A 5FWBA 3EFRA 1D0YA 2ZPEB 3QBYA 2LNHB 3OW2A 2ZPGB 4E47A 4J7IA 2KSSA 5HK0A 5LJ5j 1B3QA 2J7IA 1M8VA 4BI8B 4M78G 2VUBA 4BI4A 4KGZB 4M78E 1MMDA 4ESRA 1RI0A 3MCAB 3M59A 1X2QA 2CSIA 4QQGA 2VVKA 2F2VA 1QP2A 2O01E 4FSSA 1IRXA 2YLCA 1F1BB 1VQKT 1KFZA 5LJ5d 4C92A 5D6XA 1LPLA 3FDRA 4JRIA 3TSZA 2P0QA 4M78A 4J9FA 1WHHA 2CGHA 5A0LA 4WCIA 4M7AF 1IXDA 4DQ2A 2MWPA 4CC7A 2RM4A 3N5BB 4IUUA 1WHMA 4DBHA 3UWNA 3A5ZB 3LH5A 1VQMA 1BI2A 3I56A 4C92B 4E7HA 3S3OA 2KR3A 2EJFA 3UT1A 2X3WD 1ZA2B 2RQTA 1G8XA 1VQ8A 2QG9B 1Y96B 2DL4A 2OJ2A 4Y92A 2GFAA 5GMKi 1WIEA 2O9SA 3C4SA 1NBEB 1LJOA 2BKDN 4Y91A 3P8BB 3CCRA 2FZGB 2JTFA 4M7AA 3I35A 4J6XA 3VJPA 4WTOB 2HL3A 1TH7A 1YP5A 2V8JA 5LJ3d 1VQ8Q 1V1CA 3FRNA 3HL8A 2KROA 2J6FA 3M0PA 5GANf 3CCST 1CKAA 4FL6A 1FWZA 2YRDA 4BDYA 5ECAA 4X34A 1KQSP 1QWFA 5GANe 1AOJA 5GANd 2RHUA 4PJMA 4XTXA 4MDXA 1YITT 1UDLA 1NYFA 9ATCB 2P0PA 4Z02A 4OVAA 3E9FA 1PNJA 2K3XA 3I55A 1PD0A 1WQWA 4C92E 4GLMA 4M77D 4MMLA 1S1NA 4LUEA 1K8AU 1RAHB 1UHFA 2D0NA 3RIRA 3PGGA 3QDFA 3M4GA 3OBYA 3VS0A 2RH2A 4JJDA 3REBB 5IHKA 1I4K1 5GANg 1M1FA 3MEWA 2DXUA 4QT7A 2CP7A 5LJ3j 4DEYA 1ZSZA 2JTEA 5CQXA 4M75G 3GNFB 1AEYA 1TS9A 1RI9A 4EIKA 1WXTA 2PVOB 5D6YA 4IURA 2QI2A 3TQ7P 2D8JA 2KXCA 1YITQ 1NPPA 1VQOT 2CYZB
chains in the Genus database with same CATH topology
1VQKQ 3CMEQ 1VQ4Q 1N8RR 1VQNQ 1VQMQ 1KD1R 1VQ8Q 3G4SQ 1VQOQ 1KC8R 2OTLQ 1VQ6Q 3CCEQ 3I56Q 3G6EQ 1M90R 1Q81R 3CCLQ 2QA4Q 1JJ2P 1YIJQ 1YJ9Q 1K9MR 1Q86R 3CCQQ 1QVGP 1YHQQ 1VQ5Q 1VQPQ 3CC2Q 3G71Q 1VQLQ 3OW2P 3CC7Q 1YJWQ 1VQ7Q 1K8AR 2QEXQ 3CCVQ 3CCRQ 3CMAQ 3CXCP 3I55Q 3CPWP 1YI2Q 1S72Q 3CCUQ 1Q7YR 1YJNQ 1QVFP 2OTJQ 1VQ9Q 1M1KR 3CCMQ 1KQSP 3CCJQ 1YITQ 3CCSQ 1W2BP 1Q82R 3CD6Q 3CC4Q 1NJIR 1K73R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQK Q;  3CME Q;  1VQ4 Q;  1N8R R;  1VQN Q;  1VQM Q;  1KD1 R;  1VQ8 Q;  3G4S Q;  1VQO Q;  1KC8 R;  2OTL Q;  1VQ6 Q;  3CCE Q;  3I56 Q;  3G6E Q;  1M90 R;  1Q81 R;  3CCL Q;  2QA4 Q;  1JJ2 P;  1YIJ Q;  1YJ9 Q;  1K9M R;  1Q86 R;  3CCQ Q;  1QVG P;  1YHQ Q;  1VQ5 Q;  1VQP Q;  3CC2 Q;  3G71 Q;  1VQL Q;  3OW2 P;  3CC7 Q;  1YJW Q;  1VQ7 Q;  1K8A R;  2QEX Q;  3CCV Q;  3CCR Q;  3CMA Q;  3CXC P;  3I55 Q;  3CPW P;  1YI2 Q;  1S72 Q;  3CCU Q;  1Q7Y R;  1YJN Q;  1QVF P;  2OTJ Q;  1VQ9 Q;  1M1K R;  3CCM Q;  1KQS P;  3CCJ Q;  1YIT Q;  3CCS Q;  1W2B P;  1Q82 R;  3CD6 Q;  3CC4 Q;  1NJI R;  1K73 R; 
#chains in the Genus database with same CATH topology
 1YWO A;  1TSF A;  2LJ1 A;  1UJY A;  1OI1 A;  4CC3 A;  2PVD B;  3PE0 A;  1M4Z A;  1D3B A;  1PRL C;  1X01 A;  1BI3 A;  2EKO A;  2QA4 Q;  1H92 A;  5GAN 7;  2YXY A;  4A63 B;  2NUP A;  1BB9 A;  8AT1 B;  1N5Z A;  4CC4 B;  2E10 A;  3TRE A;  2D6F A;  4J9I A;  4E7Z A;  2XHC A;  4JZ3 A;  1YBY A;  1S72 T;  1IRE B;  3UA7 A;  1WGS A;  3HHT B;  1AZG B;  2E65 A;  2DYI A;  4F7U B;  2QQ9 A;  2ZGW A;  4KBM B;  4PLI A;  2C06 A;  1WDX A;  2K5L A;  4LDY A;  5CKD A;  3O8V A;  1VQ5 A;  2NUT B;  3E1S A;  2K79 A;  4B9X A;  2IIM A;  2EYX A;  1AZE A;  4BY6 B;  1WXU A;  1TOV A;  1M1K U;  3LLR A;  4RTY A;  1CKB A;  2HBP A;  3HFO A;  2AIR B;  4L59 A;  2CP0 A;  1BI0 A;  1VQ5 Q;  3I56 T;  3DB3 A;  1NM7 A;  4LD6 A;  1QP3 A;  4BUG A;  1JRI A;  4J7F A;  2E1H A;  4M7A B;  2ED0 A;  2DTI A;  2VV5 A;  2HZY A;  5KYW B;  4MZT A;  5GAO p;  1FMW A;  3CCL T;  4OB1 B;  4M78 C;  2RI3 A;  2CT4 A;  3MEV A;  4HVW A;  1H8K A;  1K73 C;  1ZLM A;  1W70 A;  2HBW A;  2LQ8 A;  2X4W A;  3H9N A;  2GFU A;  5CR2 A;  2CDT A;  4J9G A;  1MV3 A;  3CCV Q;  4FYW B;  2A7Y A;  1Q7Y R;  3BY7 A;  3S3M A;  1M8M A;  1WX6 A;  4FYY B;  4LD9 K;  3OB9 A;  3JCM c;  3VKI A;  2OTL A;  1Q7Y C;  2IVW A;  1JJ2 A;  5LL6 S;  2RHZ A;  2NUT A;  2DVE A;  5FW9 A;  3CBO A;  3H6Z A;  1UHC A;  2FHD A;  3MP6 A;  2JVV A;  3SWN C;  4J9B A;  3CCJ A;  5I2S A;  3CD6 T;  2X4Y A;  4K11 A;  5CVI A;  2XK0 A;  2JOY A;  3OS2 A;  1NPR A;  4M75 F;  3OA6 A;  1VYU A;  2DYB A;  2V26 A;  1WFW A;  1YCY A;  2BIV A;  4M78 F;  1VQ4 Q;  2QYZ A;  5LJ3 e;  2BZY A;  1G3Y A;  5GJW B;  2RK1 A;  1MGQ A;  3LYI A;  4JRK A;  3OY9 A;  2NUP B;  2QEX T;  4JRP A;  2QEX A;  3JCM J;  2EGE A;  2ZCF B;  2DXC A;  1WJQ A;  4C92 D;  1I0C A;  3CCM T;  3V8L A;  2ZPF B;  1GRI A;  5D6W A;  4M75 A;  3VS6 A;  2MPX C;  1VYV A;  4M75 B;  3JB9 H;  2CZ1 B;  2R5A A;  4M77 A;  3OMC A;  2JNG A;  1I07 A;  1YI2 A;  1R0B G;  3FEO A;  1VOM A;  1YJW Q;  1B34 A;  3VS5 A;  5GAN 5;  2EQI A;  3CPW P;  4OMN A;  2CZ0 B;  1TXQ A;  2RD1 A;  2RNA A;  3QHS A;  2DBM A;  4E7J A;  3GIB A;  3EGD B;  3M55 A;  1NG2 A;  1KHI A;  2E12 A;  4DOW A;  5CCA A;  1E7O A;  1K76 A;  2EIF A;  4V2S A;  3C94 A;  4HKE A;  3RES A;  1ZSZ C;  2EQJ A;  4M78 D;  2COZ A;  2AKL A;  3E2U A;  2O4X B;  3G71 Q;  4M7A D;  2DJQ A;  4KGX B;  3JCM X;  3CCU Q;  4BI3 A;  3D7S B;  5D7U A;  3QII A;  1Q82 R;  4E6R A;  3CCR T;  4F7U G;  1I1J A;  2HQX A;  1KC8 U;  4C0Z A;  3NTK A;  4RUG A;  2K3B A;  4FU6 A;  1GFC A;  3RUX A;  1YJW T;  3JB9 D;  3OW2 S;  2QQA A;  2R57 A;  3VU3 C;  2X4X A;  3A98 A;  3L2W A;  1WYX A;  1QVF P;  4RTX A;  4ATO A;  4C0F A;  1K0X A;  2DE0 X;  4RG2 A;  1KD1 R;  2LT4 A;  1OEB A;  4C5E A;  3VS1 A;  4B6M A;  2QQR A;  3DKM A;  2LJ3 A;  1Q86 C;  4M77 B;  3CQT A;  3HSB A;  1QVG P;  2JZ2 A;  2F2W A;  3MEU A;  5L8R E;  4CRI A;  2DJZ A;  5GAO m;  3CCR Q;  1ZBX A;  1EZZ B;  1J3T A;  3GLX A;  1FYN A;  2P0K A;  2OI3 A;  3RDV A;  2LQW A;  4UC4 A;  3NTI A;  5DLO A;  3EFS A;  5CKH A;  1M30 A;  1BCO A;  1N8R R;  1UGR B;  3PMT A;  3OYL A;  3EH2 A;  2KY9 A;  2A3L A;  2OAU A;  1XNI A;  3L2Q A;  2JXB A;  1MV0 B;  3EG3 A;  5FRM A;  3OYE A;  3OW2 P;  1EFN A;  1M3B A;  1UE9 A;  4KGV B;  2COY A;  4PK4 A;  2KE9 A;  1FX7 A;  1KJW A;  4HCZ A;  3IQL A;  2NUZ A;  2CUD A;  2V8K A;  5IXB A;  2YRV A;  3PNW C;  3LX7 A;  4QVC A;  3TVT A;  2PNI A;  4XTU A;  3PTA A;  2CZ7 B;  4N4H A;  3OMG A;  1K9M R;  3NHN A;  1UUE A;  3BFM A;  1JQQ A;  2C0T A;  2WSF E;  4FCY A;  1H3Z A;  2HQE A;  1VQ6 A;  4AG1 C;  3ASK A;  1RL2 A;  4PJJ A;  4IUV A;  3FLG A;  3ZBD A;  4PL6 A;  1YJ9 A;  3UF4 A;  3EFO A;  2V1Q A;  1ZSG A;  2X3X D;  4AFQ C;  1YIT A;  1ACM B;  1NEB A;  4NOY A;  2YUN A;  5CKB A;  1WI7 A;  4RTT A;  1QCN A;  2OTL T;  3QG1 A;  3G6E T;  2QA4 T;  3JCM b;  2RO0 A;  5IXF A;  4HCK A;  2KYM A;  4P5N A;  1W2B A;  1VQL Q;  2HEQ A;  4PJO A;  2FZC B;  4KH0 B;  5GAM d;  3CC4 T;  1C1A A;  2RPN A;  2WSE E;  2FPE A;  3CBM A;  3FIF A;  1AD5 A;  4D6W A;  2EQK A;  1WQ7 A;  2BE9 B;  5KYU B;  4FT2 A;  2G6F X;  2JW4 A;  1GXI E;  2RHX A;  3JV3 A;  4QW2 A;  4AFZ C;  5DY9 A;  2HD0 A;  2DM1 A;  1VQO A;  2BUD A;  3L42 A;  4AG2 C;  1X2K A;  4RTV A;  4EMK C;  4BDZ A;  3QDR B;  1BIB A;  4OB2 B;  2SRC A;  2J06 A;  1VQ7 A;  1U3O A;  2YRC A;  3C12 A;  1D0Z A;  2CP6 A;  4C5H A;  2DET A;  3ULR B;  3OYK A;  4OB3 B;  1U8R A;  2GBQ A;  2DRK A;  3JCM Q;  2E4H A;  3M0U A;  3CC7 A;  3CC7 T;  1B34 B;  1VQ5 T;  3CCE Q;  3I56 Q;  1WLP B;  1R77 A;  1YI2 T;  2RI2 A;  3JCM g;  5FU7 B;  4JLI A;  4N0A A;  4XU3 A;  3CMA Q;  4XTV A;  4RTW A;  1K9M C;  3I55 T;  1T3S A;  2KK4 A;  1BCM A;  2FO0 A;  2DPP B;  3M53 A;  1WPY A;  1KD1 U;  2E70 A;  3JCM V;  1KC8 R;  2A37 A;  1VQP A;  4JUV A;  3FJ5 A;  1T0J A;  3L1A A;  1OUL A;  2YUP A;  1BK2 A;  2FPD A;  1YHQ Q;  4DA4 A;  2FB7 A;  2QGF B;  4XK8 E;  2JN0 A;  4PJL A;  5HY6 A;  3M5A A;  1KQS A;  4M7D B;  3CC4 A;  1RAB B;  3OYN A;  1ZBJ A;  3SHW A;  4N4G A;  3CME A;  1QWE A;  2RA2 A;  4A53 A;  1AVZ C;  3CBP A;  5GAN 6;  1QKW A;  3P8H A;  3L2R A;  2MOX A;  2GGR A;  2ZPI B;  2A28 A;  1YHQ A;  2JM8 A;  1GCQ C;  3ZEH A;  2F2X A;  2JUF A;  3F70 A;  4LDV A;  2DL7 A;  1E6G A;  1D1A A;  2VWF A;  3HFN A;  5IHI A;  4R0K A;  3I55 Q;  3LWI A;  4C8Q C;  1W2B P;  3THK A;  4IIM A;  2QQB A;  1VUB A;  1WHJ A;  3SEM A;  3J7A F;  2ED1 A;  1YHQ T;  5GAM e;  4BB7 A;  3OYB A;  2LQK A;  3MEA A;  3CCQ Q;  2FVU A;  2CSQ A;  2HQH A;  1FMK A;  4E7I A;  4BE1 A;  2ESW A;  2KEA A;  1P92 A;  4M77 F;  4PJO G;  2E64 A;  3NMZ C;  3LGL A;  4GLK A;  3KBG A;  1G2B A;  1IGQ A;  2QDL A;  1I8F A;  3CCS A;  3H41 A;  1YIJ T;  3JSC A;  3UAT A;  2BZX A;  1Y96 A;  2K4Y A;  3CCQ A;  2HSP A;  2B8A A;  2AZV A;  2FYK A;  5GAN h;  4PJO B;  3PFS A;  3X24 B;  4C8Q B;  1VQ8 T;  1Q82 C;  3EG2 A;  2ROT A;  4C8Q A;  4C8Q E;  1G3W A;  2QA4 A;  1M1G A;  1YJN Q;  2LC4 A;  2FPF A;  1FMV A;  3CCS Q;  4F04 B;  1PM3 A;  3GOX A;  2JMC A;  3EG9 B;  3RKW A;  2PQW A;  2YUQ A;  4JS4 A;  2H3J A;  3WVD B;  3G71 A;  5CKF A;  1QVF A;  4EPC A;  3GF5 A;  2GQI A;  2K7A A;  5GMK j;  3CCU A;  1UGP B;  2DMO A;  1Y57 A;  3VRZ A;  1OPL A;  1N9S A;  3MPU B;  2PTK A;  4O6J A;  1CSK A;  2VC8 A;  3A8M B;  5FWC A;  4F14 A;  3EGD A;  1RAA B;  1NJI U;  1LNX A;  1QMC A;  3MET A;  2DXB A;  4E2F B;  1PKT A;  3QZ5 B;  5I21 A;  3OYH A;  2LCS A;  2RK2 A;  2E5Q A;  4C92 C;  3SWN B;  4A4K A;  4M7D D;  1KQ1 A;  2KXD A;  2XIC A;  3O5Z A;  4PJO C;  3OYD A;  4JPB W;  3X28 B;  2HSE B;  3HRT A;  4LE9 A;  2MCN A;  3ER0 A;  2AK5 A;  5KCH A;  2EJG A;  2MI6 A;  4NS5 A;  3HRU A;  4BE0 A;  3CCJ T;  3RKX A;  2I0N A;  1PD1 A;  4OB0 B;  3OYC A;  2VXE A;  2HKN A;  3G1J A;  1RAE B;  2G3R A;  1Y7X A;  1WNL A;  3QKJ A;  2FL7 A;  4EMK A;  2JJ9 A;  2VKN A;  1FXX A;  2DZ9 A;  1TU0 B;  1VQ9 A;  2NWM A;  3X20 B;  2GTO A;  5C0M A;  3JCM h;  2E6Z A;  3CME T;  4MZP A;  4OMO A;  2E3H A;  3VV0 A;  1S72 A;  3ME9 A;  2BE7 D;  4N0A C;  4OP0 A;  2MAM A;  3MO8 A;  3JB9 J;  1M2V A;  2O2O A;  4HXJ A;  3E9G A;  5KYN A;  3CCJ Q;  4LDU A;  1Q82 U;  1K73 R;  1VA7 A;  2LT1 A;  3A8G B;  1OZ3 A;  3EG0 A;  1BI1 A;  2F5T X;  4R56 A;  1X75 C;  2QTV A;  4XAX B;  2P4R A;  4OF1 A;  4R55 A;  1W1F A;  1OX9 A;  1ZUK A;  2OTJ A;  1BU1 A;  1UTI A;  2DNU A;  1UGS B;  1QVG A;  2HAX A;  1M1K R;  4O5V A;  4J8O A;  4XTY A;  4JJB A;  1RAF B;  1ZUY A;  3LW5 E;  5GAO n;  4QVD A;  4C5I A;  3RMQ A;  3G4S Q;  3VUB A;  3CCL Q;  1BYM A;  3V8J A;  1TG0 A;  4A4E A;  4GBQ A;  5IHN A;  3MHX A;  3CPW A;  1X27 A;  3BW1 A;  5LJ5 g;  2D0Q B;  1UB4 A;  1VQK A;  5KE2 A;  1I5O B;  3OYJ A;  1TUC A;  4M4Z A;  5KE3 A;  2HL5 C;  4E7L A;  2RHY A;  1PRM C;  3RKY A;  4II1 A;  4PLL A;  3FC3 A;  1VQN T;  2XDP A;  2OAW A;  4VUB A;  5CKE A;  3UA6 A;  1JXO A;  3PVL A;  4TVR A;  4C92 F;  2GNC A;  3OYF A;  1MHN A;  3HP9 A;  2DAQ A;  5KYX A;  3EAE A;  2VYT A;  1VQO Q;  4PJO E;  1O9S A;  1JJ2 S;  2P4T A;  1JO8 A;  4JZ4 A;  2DTO A;  2JS0 A;  2ABL A;  1VQN A;  1RAG B;  4Q5W A;  2DX1 A;  1SKU B;  4FT4 A;  2K2M A;  3TEE A;  4EMG A;  1QQJ A;  1VQ7 Q;  3H0H A;  1PCX A;  1C6V X;  2E5K A;  2YSQ A;  1Q95 G;  4EMH A;  2XMF A;  2C0O A;  3EGX B;  2FEI A;  3CCM Q;  3CC7 Q;  2GTJ A;  2XKO C;  4WF2 A;  2R58 A;  3SDZ A;  1OQK A;  2A0F B;  5FU6 C;  1VQN Q;  3CC2 T;  2Y4X A;  2HCK A;  3CMA A;  2RJE A;  2XI9 A;  3VS7 A;  1ZSZ B;  2LTO A;  5KCO A;  3CCM A;  4J9H A;  4PKC C;  5KYY B;  3EG9 A;  3GNG A;  1RUW A;  5GMK m;  4LUD A;  5GAN 8;  1HJD A;  2YHT A;  2QAZ A;  1NZ9 A;  4F7U F;  2NYS A;  3R6N A;  4F16 A;  2O4X A;  1EX4 A;  1YCS B;  3M54 A;  2CH4 A;  3DLM A;  3HTR A;  1VQ6 T;  2M0Y A;  4M77 E;  3J81 E;  4C0D B;  2DBK A;  5GAN 3;  1G3T A;  2RQW A;  5GAO r;  4C0D C;  4CC2 A;  4J83 A;  4M7D E;  2HDA A;  1UEC A;  2CP5 A;  1T3L A;  5CK9 A;  1R0C B;  2DEQ A;  4OMF B;  2FRY A;  2RQU A;  4AFU C;  1WJS A;  3AHU A;  3FB9 A;  2LX9 A;  4ME7 A;  4HA8 A;  4C8Q F;  5GAN 4;  4FW2 A;  3A8H B;  2EYQ A;  1LOJ A;  1IO6 A;  1ARK A;  1ZX6 A;  2O88 A;  5LJ5 e;  4LDW A;  2X35 A;  3R6O A;  3CCV T;  5GAN j;  2FRW A;  1M3A A;  4MMK A;  5AYF A;  1V76 A;  5LJ5 f;  3SWN A;  1K8A C;  1VQ6 Q;  4LXC A;  2K3Y A;  2F5K A;  2EW3 A;  3OS1 A;  3L2U A;  3WVE B;  3QYH B;  1SSF A;  1N8R U;  4DBQ A;  1LCK A;  2QQS A;  1IZ6 A;  3GP8 A;  3CXC P;  8ATC B;  1WHK A;  2L3Q A;  3KUF A;  2DIQ A;  2W10 A;  2LVM A;  2DVJ A;  2YWW A;  4Z89 A;  4FW1 A;  5IN1 A;  3JB9 G;  1XJW B;  4M75 C;  2BZ8 A;  2X51 A;  2QDY B;  2EYY A;  3C0C A;  2MF2 A;  1D3B B;  2MMP A;  4ZN3 A;  1ABO A;  1NEG A;  3JCM d;  3G7Z A;  1AT1 B;  4M78 B;  2VGN A;  3AT1 B;  1DJ7 B;  1VQL A;  1AWX A;  4LDX A;  3QPH A;  1QLY A;  2IPO B;  3RNJ A;  2LCC A;  1QKX A;  5CO7 A;  3SB2 A;  4OML A;  5GAO q;  2LZ6 B;  3A1P A;  2DKG A;  3MP1 A;  3P8D A;  2PVG B;  1WZO A;  5GJV B;  5I2M A;  3J80 E;  1RLP C;  3OS5 A;  4ZN1 A;  1U1T A;  3KXT A;  2EGA A;  2KAF A;  3NTH A;  1G83 A;  2L3P A;  2JS2 A;  5GMK h;  1YIJ A;  4Z88 A;  2D8H A;  1VQP T;  2KYB A;  2OX7 A;  2CH4 W;  5CAI A;  4J9E A;  5A0G A;  1IGU A;  1GCQ A;  1SHG A;  1MMG A;  1N6A A;  1X69 A;  1OOT A;  4DBF A;  3LH0 A;  4X9C A;  2X4J A;  1VQM T;  1MNE A;  1M1K C;  4RCC A;  1GCP A;  4NL2 A;  4PJN A;  1UJ0 A;  3G71 T;  5FU6 B;  3CXC A;  4PJO D;  1UGV A;  2DRM A;  2RQV A;  1GFD A;  1SRM A;  3EHR A;  2DL3 A;  3VUZ A;  3S3N A;  2OTL Q;  2V8I A;  3G6E Q;  1HK9 A;  3KFV A;  4M7A G;  2KT8 A;  4A4G A;  1KIK A;  2RJD A;  2LRQ A;  2ROL A;  3I5S A;  4XU0 A;  3TU4 K;  1VQP Q;  1D1C A;  2L5Q A;  2DIL A;  1XTD A;  2KT1 A;  1K73 U;  3M0T A;  1VQL T;  3CC4 Q;  3M58 A;  2DZC A;  3CME Q;  3LGF A;  3LWH A;  1QCO A;  2M0O A;  1KHC A;  2D9T A;  2DF6 A;  5L23 A;  3I5R A;  1GL5 A;  2Y90 A;  2GQV A;  3CCV A;  1Q86 R;  1Q7Y U;  1LVK A;  4M7D C;  1OX8 A;  4QVZ A;  2HNI A;  1SF9 A;  2DL5 A;  1KD1 C;  5KYX B;  2A36 A;  1SEM A;  2H3E B;  2LMJ A;  3VRY A;  4RG8 A;  3OYA A;  2KDS A;  1W2B S;  2XD0 A;  4ZTF A;  4DOV A;  2YDL A;  1PG5 B;  2K5F A;  1V29 B;  1IHW A;  2I2L A;  2EPD A;  2ZPB B;  2V1R A;  2KVQ G;  2F1L A;  1NJI C;  2J6O A;  5IH2 A;  3CXC S;  5FRN A;  3EGU A;  5LJ5 h;  2YLB A;  2VAS A;  4L6V 5;  5HKC A;  1WJR A;  1YI2 Q;  1N27 A;  4XTW A;  2VGM A;  1G3S A;  2PUO B;  2BTT A;  3V7R A;  5A0D A;  1IHV A;  3OQ5 A;  3G4S T;  1K4U S;  4ELY C;  3URG A;  2L0A A;  4KUI A;  4GY5 A;  4M7D A;  1I5L A;  3FJP A;  3JB9 I;  4HVV A;  5EC7 A;  2J6K A;  2MK5 A;  1IB8 A;  2MIO A;  2DL8 A;  1YFN A;  2YUO A;  3OSV A;  1D09 B;  2CP2 A;  1Z9Z A;  2WAC A;  1ZQ1 A;  3OYI A;  2K9G A;  2DIG A;  1JXM A;  3OSS C;  1OU8 A;  4RMO A;  1M90 R;  1TWB A;  5GAN 2;  1YJW A;  3M57 A;  3M56 A;  5KH6 A;  4M75 D;  4J6W A;  1AWO A;  4JJN K;  2DER A;  2SEM A;  2COW A;  3SD4 A;  2JT4 A;  4EDU A;  3MJX A;  2L3S A;  3OYM A;  2EVR A;  4ORZ A;  4E7S A;  2QK0 A;  3DLL A;  1ABQ A;  1WA7 A;  1W6X A;  4IIO A;  4JJC A;  3NGP A;  2JMA A;  4M75 E;  1ZUU A;  4MZM A;  4X9D A;  1K8A R;  2L89 A;  4M7D F;  4HCC A;  1Q81 C;  1NLP C;  2DTH A;  4EMK B;  2CUB A;  5IAY A;  5FRO A;  3GPL A;  3RER A;  1G5V A;  2GF7 A;  1E6H A;  4FM4 B;  4BAC A;  3VS2 A;  1JEG A;  2EYW A;  2RI5 A;  3QO3 A;  4OMQ A;  3L2V A;  1YJ9 T;  2EGC A;  5C6S A;  2DA9 A;  2DK3 A;  4M77 G;  4M7D G;  4J9C A;  2ECZ A;  1KK7 A;  4XQ3 A;  4PFP A;  2LNV A;  5LJ3 f;  4JRQ A;  1OYX A;  2EBP A;  1UG1 A;  1D0X A;  3CCE T;  3JCM e;  4AMC A;  4QQD A;  2RJF A;  1X6B A;  1S72 Q;  3CC2 A;  4QKU A;  1B07 A;  2HMA A;  3MKD A;  3VYG A;  4J5Y A;  4RCB A;  1RAD B;  3CPF A;  4BE2 A;  5FLX E;  2QGG A;  2KMT A;  4IUP A;  1EIF A;  1YJ9 Q;  6AT1 B;  3EH1 A;  2CZ6 B;  1NLO C;  2R5M A;  7AT1 B;  1KQS S;  2LJ0 A;  4C8Q D;  1AWJ A;  1PWT A;  1O75 A;  2KQW A;  1ZA1 B;  1U06 A;  1RAC B;  2DXT A;  1R8O B;  3QJ6 A;  2LDM A;  1HD3 A;  2M1H A;  3X26 B;  1TUD A;  4OMM A;  3RMS A;  3ZFJ A;  2XU8 A;  2ZAE A;  1SRL A;  3CCU T;  3EG1 A;  4AT1 B;  2KGT A;  3V7S A;  2EQU A;  3CCL A;  1PKS A;  4IUT A;  2A08 A;  3L2Z A;  4C8Q G;  2PZ1 A;  3QUI A;  1OPK A;  3NPF A;  5KYY A;  1Y71 A;  2C0I A;  2RQR A;  3OYY A;  1H64 1;  4KRT A;  1SPK A;  2NLU A;  5M9O A;  1Y07 A;  4PFO A;  1BKB A;  2M51 A;  2EJ9 A;  3H0I A;  3PIO A;  2JTM A;  3CCQ T;  3C95 A;  2DFU A;  1B7T A;  4D8K A;  3A8O B;  1M2V B;  3PMI A;  3QXE B;  1K9A A;  2CKK A;  1XOV A;  1YIJ Q;  3T9N A;  1D1B A;  2RB6 A;  4BY6 C;  4L5G A;  3A8L B;  2L3R A;  5DM7 R;  2W0Z A;  5GAM j;  3SFM A;  1SSH A;  2E41 A;  3TSW A;  2IG0 A;  4FIB A;  4OGC A;  5J26 A;  3CPW S;  1VQ4 T;  5A2Q E;  1RAI B;  5GAM h;  1YJN T;  3JAM E;  1VQM Q;  1WHL A;  1ZHI A;  3QWY A;  4YTL A;  5FU7 C;  1UEB A;  4X1V A;  2MWO A;  1M3C A;  1M90 U;  5GMK e;  2M02 A;  2XDB A;  2JM9 A;  2K57 A;  1XQH A;  3OYG A;  3X25 B;  4IKF A;  3MP8 A;  3JCM W;  4QQ6 A;  1MMN A;  4PFZ A;  4ZGJ B;  2CP3 A;  1X6G A;  4C0G A;  3EGX A;  3CCE A;  2LX7 A;  1N8R C;  3G6E A;  2WSC E;  3JB9 F;  3PT9 A;  4ZGE B;  4JDS A;  1K9M U;  1MND A;  3HKS A;  1QW1 A;  2FZK B;  1AHJ B;  1M27 C;  1Z9Q A;  2X9H A;  2AHJ B;  4KUD K;  2O9V A;  2RF0 A;  4KUL A;  2PU9 B;  2XDD A;  5CIU A;  1HXD A;  2M9U A;  4JS5 A;  1OZ2 A;  4NL3 A;  4A54 A;  3JCM P;  2KRS A;  3RBB B;  1BIA A;  3OS0 A;  1Q81 R;  2VXF A;  5I22 A;  3M0S A;  4ANJ A;  1YWP A;  3H8Z A;  1M2O A;  2ATC B;  5DLQ E;  4F17 A;  3REA B;  5EG2 A;  2MYS A;  1PSF A;  1X6O A;  1HSQ A;  4Y28 E;  3CEY A;  3S6W A;  2DD5 A;  5KYW A;  1BBZ A;  2EWN A;  4KH1 B;  2B86 A;  4E7K A;  2AT1 B;  1RLQ C;  3PIP A;  2LQN A;  2EAY A;  3VS4 A;  2CRE A;  1VQ4 A;  5HCK A;  1KQ2 A;  3RR6 A;  2ZPH B;  2P84 A;  1X43 A;  4HCB A;  4B9W A;  3GBQ A;  5J3B A;  5LJ3 h;  4HT9 A;  4LN2 A;  1GBR A;  5CQY A;  2RMO A;  3INZ A;  4J9D A;  3H0F A;  3V7C A;  3E19 A;  4MDW A;  2L2P A;  4DBR A;  3QSU A;  3I9Q A;  2QAS A;  5IT9 E;  1VIE A;  4HVU A;  2LCL A;  1NE8 A;  2J05 A;  1Y0M A;  3NFC A;  1YN8 A;  2K5I A;  1PHT A;  5GMK l;  1A0N B;  3UDC A;  2RHI A;  2E3I A;  3EFO B;  2Y4Y A;  2H8H A;  2L8D A;  1M5Q 1;  1OU9 A;  1U5S A;  1YNZ A;  2KRM A;  3M9Q A;  2EKH A;  2DO3 A;  4FYX B;  5HK3 A;  5GAO l;  1M90 C;  3U23 A;  2CS7 A;  1W4S A;  2RN8 A;  1UFF A;  2E6N A;  1T0H A;  1QVG S;  2F69 A;  4KT0 E;  1YJN A;  2ZZD A;  4PNO A;  3M0R A;  2ENM A;  4A4H A;  1UGQ B;  4XTZ A;  2QXF A;  1N9R A;  3BDL A;  3WXM B;  4ZTJ A;  4M7A C;  2D1X A;  2EFI A;  1Q86 U;  4Z8A A;  4XU2 A;  5I11 A;  2K2V A;  1MUZ A;  1VIF A;  1NYG A;  2DD4 A;  2HKQ B;  4ELZ C;  1C0M A;  1KG1 A;  4C92 G;  3Q1J A;  3QWX X;  4M77 C;  2RJC A;  1SHF A;  1MMA A;  4DEX A;  3BDU A;  4FYV B;  1HYO A;  2KRN A;  3OBW A;  1NJI R;  1TTH B;  2OTJ T;  1VQ9 T;  1PC0 A;  2O31 A;  2PUK B;  4XU1 A;  4RKU E;  5LJ3 g;  1K1Z A;  1WXB A;  2Z0W A;  3EHQ A;  1TUG B;  4RTZ A;  4A4F A;  1JU5 C;  4BD3 A;  1OV3 A;  3M0Q A;  4AFS C;  3JRZ A;  3HPW A;  2KBT A;  5GAM g;  4C5G A;  3JCM f;  1VQ7 T;  3TCJ A;  1H3H A;  4JLG A;  1PSE A;  2CT3 A;  4J6Y A;  4LNP A;  3CD6 A;  1VYT A;  3UPU A;  1SG5 A;  1WHG A;  2LP5 A;  1QVP A;  3DB4 A;  1KSW A;  3QYG B;  5GAM f;  3CC2 Q;  1KC8 C;  4CI0 C;  4PJO F;  4FSX A;  5KYU A;  2OTJ Q;  1QVF S;  4M7A E;  1VQ9 Q;  1U1S A;  3CD6 Q;  2FG0 A;  4N4I A;  4RTU A;  3V8K A;  1JBM A;  2XID A;  2YT6 A;  4IUQ A;  3VS3 A;  5AT1 B;  2XG8 D;  4ZGD B;  1JJ2 P;  4F7U A;  3G4S A;  2DEU A;  3QJY A;  2KI7 A;  4HT8 A;  1AWW A;  2DLP A;  2QEX Q;  3VYH B;  1QCF A;  3HRS A;  4OGE A;  3PVQ A;  4OMP A;  3M4Y A;  3BE3 A;  1I81 A;  1K0S A;  3QZ9 B;  2VB6 A;  1VQK Q;  4D8D A;  2EQM A;  2QTX A;  3ZL7 C;  2KNB B;  1JB0 E;  2EYZ A;  1M9S A;  4F7U E;  1Q81 U;  2GCX A;  4ZNX A;  2AZS A;  2K6D A;  2AKK A;  5J39 A;  1GBQ A;  3CMA T;  2M16 A;  5FWB A;  3EFR A;  1D0Y A;  2ZPE B;  3QBY A;  2LNH B;  3OW2 A;  2ZPG B;  4E47 A;  4J7I A;  2KSS A;  5HK0 A;  5LJ5 j;  1B3Q A;  2J7I A;  1M8V A;  4BI8 B;  4M78 G;  2VUB A;  4BI4 A;  4KGZ B;  4M78 E;  1MMD A;  4ESR A;  1RI0 A;  3MCA B;  3M59 A;  1X2Q A;  2CSI A;  4QQG A;  2VVK A;  2F2V A;  1QP2 A;  2O01 E;  4FSS A;  1IRX A;  2YLC A;  1F1B B;  1VQK T;  1KFZ A;  5LJ5 d;  4C92 A;  5D6X A;  1LPL A;  3FDR A;  4JRI A;  3TSZ A;  2P0Q A;  4M78 A;  4J9F A;  1WHH A;  2CGH A;  5A0L A;  4WCI A;  4M7A F;  1IXD A;  4DQ2 A;  2MWP A;  4CC7 A;  2RM4 A;  3N5B B;  4IUU A;  1WHM A;  4DBH A;  3UWN A;  3A5Z B;  3LH5 A;  1VQM A;  1BI2 A;  3I56 A;  4C92 B;  4E7H A;  3S3O A;  2KR3 A;  2EJF A;  3UT1 A;  2X3W D;  1ZA2 B;  2RQT A;  1G8X A;  1VQ8 A;  2QG9 B;  1Y96 B;  2DL4 A;  2OJ2 A;  4Y92 A;  2GFA A;  5GMK i;  1WIE A;  2O9S A;  3C4S A;  1NBE B;  1LJO A;  2BKD N;  4Y91 A;  3P8B B;  3CCR A;  2FZG B;  2JTF A;  4M7A A;  3I35 A;  4J6X A;  3VJP A;  4WTO B;  2HL3 A;  1TH7 A;  1YP5 A;  2V8J A;  5LJ3 d;  1VQ8 Q;  1V1C A;  3FRN A;  3HL8 A;  2KRO A;  2J6F A;  3M0P A;  5GAN f;  3CCS T;  1CKA A;  4FL6 A;  1FWZ A;  2YRD A;  4BDY A;  5ECA A;  4X34 A;  1KQS P;  1QWF A;  5GAN e;  1AOJ A;  5GAN d;  2RHU A;  4PJM A;  4XTX A;  4MDX A;  1YIT T;  1UDL A;  1NYF A;  9ATC B;  2P0P A;  4Z02 A;  4OVA A;  3E9F A;  1PNJ A;  2K3X A;  3I55 A;  1PD0 A;  1WQW A;  4C92 E;  4GLM A;  4M77 D;  4MML A;  1S1N A;  4LUE A;  1K8A U;  1RAH B;  1UHF A;  2D0N A;  3RIR A;  3PGG A;  3QDF A;  3M4G A;  3OBY A;  3VS0 A;  2RH2 A;  4JJD A;  3REB B;  5IHK A;  1I4K 1;  5GAN g;  1M1F A;  3MEW A;  2DXU A;  4QT7 A;  2CP7 A;  5LJ3 j;  4DEY A;  1ZSZ A;  2JTE A;  5CQX A;  4M75 G;  3GNF B;  1AEY A;  1TS9 A;  1RI9 A;  4EIK A;  1WXT A;  2PVO B;  5D6Y A;  4IUR A;  2QI2 A;  3TQ7 P;  2D8J A;  2KXC A;  1YIT Q;  1NPP A;  1VQO T;  2CYZ B; 
#chains in the Genus database with same CATH homology
 1VQK Q;  3CME Q;  1VQ4 Q;  1N8R R;  1VQN Q;  1VQM Q;  1KD1 R;  1VQ8 Q;  3G4S Q;  1VQO Q;  1KC8 R;  2OTL Q;  1VQ6 Q;  3CCE Q;  3I56 Q;  3G6E Q;  1M90 R;  1Q81 R;  3CCL Q;  2QA4 Q;  1JJ2 P;  1YIJ Q;  1YJ9 Q;  1K9M R;  1Q86 R;  3CCQ Q;  1QVG P;  1YHQ Q;  1VQ5 Q;  1VQP Q;  3CC2 Q;  3G71 Q;  1VQL Q;  3OW2 P;  3CC7 Q;  1YJW Q;  1VQ7 Q;  1K8A R;  2QEX Q;  3CCV Q;  3CCR Q;  3CMA Q;  3CXC P;  3I55 Q;  3CPW P;  1YI2 Q;  1S72 Q;  3CCU Q;  1Q7Y R;  1YJN Q;  1QVF P;  2OTJ Q;  1VQ9 Q;  1M1K R;  3CCM Q;  1KQS P;  3CCJ Q;  1YIT Q;  3CCS Q;  1W2B P;  1Q82 R;  3CD6 Q;  3CC4 Q;  1NJI R;  1K73 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...