3CC7Q

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2487u
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cc7Q00
1VQ4Q 3CCSQ 3CCVQ 2QA4Q 1VQPQ 3G71Q 1M90R 1K8AR 2OTLQ 3CCUQ 3CPWP 1Q81R 1W2BP 3CCEQ 1QVFP 3G6EQ 1VQOQ 1VQLQ 1NJIR 3CC2Q 1VQNQ 1N8RR 3CD6Q 1VQMQ 1KC8R 3CCQQ 1VQKQ 1M1KR 1VQ8Q 3I56Q 3CC4Q 1YI2Q 1KD1R 1JJ2P 1Q7YR 3CXCP 3CMEQ 1KQSP 1YITQ 1YHQQ 1S72Q 1VQ9Q 1YIJQ 1YJ9Q 3I55Q 3CC7Q 1YJWQ 1VQ5Q 1Q82R 1K73R 1K9MR 1VQ6Q 3OW2P 2OTJQ 1YJNQ 3CCRQ 1QVGP 3CMAQ 3CCJQ 1VQ7Q 3CCMQ 1Q86R 2QEXQ 3G4SQ 3CCLQ
chains in the Genus database with same CATH superfamily
3BY7A 1UGSB 2RM4A 4M75A 2A0FB 2LJ0A 1VQKT 1YWOA 1T0HA 2KY9A 3PNWC 2W0ZA 1YJNA 3EGUA 3HL8A 3ZFJA 4AT1B 4DEXA 1ZA2B 2K7AA 2RJEA 2D6FA 4M7DD 3EG1A 2KK4A 5KCOA 1KC8C 2HCKA 2EQJA 3GIBA 3NTKA 2RN8A 4Z8AA 2JM9A 1TUCA 2CP3A 4M75E 1C0MA 1IRXA 1MUZA 2OAWA 2L89A 2X4XA 1X69A 4LE9A 2LJ3A 2QI2A 5KE3A 3AHUA 2G6FX 3OYYA 2EQMA 2OTJQ 4PFPA 1UFFA 2FRWA 3MEWA 2ESWA 3CC4A 1M3BA 4XK8E 2EJGA 1AWXA 3M57A 3J7AF 2PVGB 4E7HA 3CCEQ 3X24B 1QVGS 3DLLA 3QSUA 2HDAA 2XHCA 1YFNA 3G4ST 3E19A 2M0YA 1N9SA 4ESRA 2LNVA 2HBWA 2E70A 3I5RA 1X6BA 2DKGA 1GXIE 1UTIA 3A8OB 5FU6B 2PQWA 5CQYA 3TU4K 2D1XA 2HNIA 4OMPA 3CC4Q 2AK5A 5GAOn 1VQ4A 1KC8U 5AYFA 1FMVA 4ORZA 2CS7A 3J81E 2LDMA 3GNGA 1VYUA 1F1BB 1IGUA 2NUTB 1PSFA 4M78D 1Q81C 1WFWA 2ZPHB 5GANj 2FVUA 3JB9D 2AZVA 3CD6T 3QXEB 4HCKA 2GNCA 4C8QD 4MDXA 1KK7A 3FLGA 2XU8A 4AG2C 1VQ5T 3ZL7C 2ZZDA 4A4EA 2RHYA 4ZTJA 1D3BB 3QDFA 2L3PA 1YHQQ 1VQPA 4PKCC 1Q82R 4PFZA 4M77A 2KRMA 3HKSA 4AG1C 2XDDA 1M8VA 1OZ2A 2GQVA 1IXDA 3I56A 2M1HA 3G6ET 2HQHA 3TQ7P 1UEBA 1KHIA 3FC3A 1WHMA 3UA7A 1M2VA 4XQ3A 3CCRA 1PD0A 4DBHA 5GMKl 1WHGA 1GCQC 2OI3A 1UGVA 1UUEA 4HCZA 4KRTA 2KAFA 4DBQA 2ROTA 3NTHA 5GMKj 5GAMg 2QEXT 3IQLA 3LYIA 4PLIA 3V7SA 1R0CB 1OOTA 2CSIA 2DIQA 4D8DA 2ZPGB 2CZ6B 3OYLA 1MNDA 4M77E 2JNGA 4II1A 1OQKA 1SSFA 1NBEB 3DLMA 2LJ1A 2IG0A 1JQQA 1VQOQ 1WQ7A 1H3ZA 1PKTA 1VQ7A 2KQWA 1Q81U 2LT1A 1AWOA 4JJNK 3MEVA 3NTIA 4OF1A 1QP2A 2DTHA 3CCRQ 3OYIA 1RAHB 1XJWB 3SB2A 4KUIA 4PNOA 1VQMT 3OBWA 4C92A 5C6SA 4J7FA 2LCLA 5D6YA 4IURA 3CCMA 2HD0A 4M7AA 3OMGA 3CCVA 1RAEB 2OTLA 2K6DA 4XTYA 2P84A 1M2OA 1OI1A 1G83A 3GLXA 4E7LA 4LDXA 2AHJB 1VQ7Q 1ZUKA 4B6MA 4OMNA 1WI7A 1BKBA 3QYGB 3HPWA 5GAOp 2QDLA 2F2WA 1JXOA 3EFSA 3DB3A 2JOYA 1UHFA 2CDTA 3UATA 1YJNT 4C92E 3ULRB 3RBBB 2O4XA 4BI3A 1UE9A 4RTYA 4M7AE 1RAGB 3OYBA 2QQSA 1B34B 1I07A 5GANe 1YITA 2P0KA 2OTLQ 4GLMA 3OW2S 4Z88A 1ZA1B 5FU6C 1W1FA 1NJIR 5M9OA 4HA8A 5HK3A 2RNAA 1VQ6T 1YCSB 3V8LA 4PJOG 5CKEA 1GFCA 1W2BS 4IUUA 2EJFA 3T9NA 4HVUA 3C94A 4KH0B 2GF7A 1FMKA 2V26A 2D8JA 3QWXX 2O31A 3EGDB 1VQLT 4R56A 3RESA 4HKEA 1WYXA 4XU2A 2DD5A 2DX1A 1QLYA 1NEGA 2H3EB 2EW3A 2FHDA 5LJ5j 1BI2A 5GMKe 4RG2A 1XQHA 3JSCA 3ER0A 2FPDA 4KGXB 2QGGA 4PFOA 2MMPA 1ZUYA 3QPHA 2KDSA 3PTAA 1YBYA 2LT4A 1Q95G 4JZ3A 4OB1B 3VU3C 1WJSA 4EPCA 4FL6A 1U3OA 2WSFE 3A98A 3QJYA 4Y91A 3SWNA 4CI0C 5D7UA 5GANd 2QYZA 4AFUC 1KQ1A 2VKNA 3WVDB 5LJ3j 2EVRA 1G3TA 1K0SA 2O01E 3JCMe 2ABLA 1VQ4T 3OYFA 4A4KA 2DPPB 3M0SA 5GMKi 3EHRA 1D09B 4LNPA 5KYYA 3HSBA 3M0TA 5IN1A 3VS4A 3CCUQ 2DMOA 4QVCA 5HKCA 1M1KR 1K9AA 3OYGA 3CCLA 1I5LA 2CH4W 1E6HA 2BZYA 4B9XA 3MHXA 2CT3A 1JRIA 1VQPT 4IIMA 1ZX6A 2CYZB 2YSQA 3VS2A 3GOXA 3I56T 1NYFA 2DILA 1M9SA 2HQXA 1O75A 2RMOA 2KYMA 5GAN2 1YN8A 2RQUA 1OEBA 2FZCB 2E5KA 3QDRB 2YUPA 3GBQA 1LJOA 4JS4A 1YI2A 2AKKA 3CCLQ 3BDUA 1UGPB 2HKQB 5CQXA 4J83A 3OYMA 4OMMA 3H0IA 3JCMd 1WA7A 3LGFA 3M56A 4CC3A 3H8ZA 1UGRB 5IXBA 4DQ2A 4ZTFA 2QQRA 3ME9A 4M75C 3CC7Q 3PE0A 3TCJA 3VKIA 1ACMB 3OSSC 3OW2P 2BIVA 4FYWB 2AIRB 5KYUA 4LDYA 3A5ZB 4M7DG 1KQSS 4QQDA 4Y28E 1K4US 3UPUA 2XIDA 2DO3A 1XOVA 2EIFA 1M3AA 1TXQA 4FYVB 5GAN6 2BZ8A 5FW9A 4KGZB 1W2BP 2E41A 3V7CA 2VB6A 4ZN1A 2LQ8A 5I21A 1YI2Q 4RG8A 5ECAA 2JTEA 3M54A 4F17A 3CCMT 3CCVT 3A8LB 2JW4A 4XAXB 3OW2A 1WLPB 1G8XA 1YNZA 3RNJA 1YIJA 4RTVA 1Q7YC 4QVZA 5CO7A 3EGXB 1ZUUA 1O9SA 2HKNA 2EGAA 4BDZA 1JEGA 2E64A 5LJ3e 3CEYA 1I5OB 1M4ZA 1TOVA 1FXXA 1YP5A 4K11A 1TUDA 1N6AA 3LH0A 3P8DA 1M90R 2EYZA 1EX4A 3JCMX 2RH2A 1RUWA 1YITT 3PFSA 5IH2A 2JS2A 1KD1R 2DAQA 4RUGA 4LXCA 3CCJT 1OU9A 2M16A 3LGLA 3JCMf 4NL3A 2DLPA 4M78G 4HCBA 1ZSZA 1BK2A 3HRSA 2D8HA 3OYHA 4BE2A 4C8QG 1QCOA 3M53A 5IAYA 3FB9A 4L59A 1WXUA 2DVEA 2DEUA 1Q7YU 8AT1B 4A4FA 3CQTA 5DLQE 3M58A 4MDWA 1AD5A 1X27A 3REBB 1K0XA 5GAMj 1WQWA 4MMLA 4A4HA 2X3WD 3A1PA 2DA9A 3I35A 1QMCA 1Y7XA 5LJ3d 4J9GA 3CBOA 5KYXB 4PJOA 5CIUA 1VQ9T 2C0TA 2KNBB 1A0NB 2KEAA 3EFRA 2ED0A 3JB9I 1BCOA 3I9QA 1RAAB 1YCYA 4HVWA 3O5ZA 3S6WA 3M59A 2KR3A 1LPLA 2E10A 2M9UA 5HCKA 2H3JA 2R57A 3E9FA 1N8RC 3EAEA 2QK0A 2VUBA 2DK3A 2DRKA 4JZ4A 5GJVB 1K1ZA 2FZGB 2EYYA 1KQSP 5KYWA 4BD3A 4PJOE 1IB8A 1Y71A 2O2OA 2OJ2A 2LTOA 3TVTA 4OGCA 2V8KA 4Z02A 2DJQA 4O5VA 2E3IA 5I2SA 5CKDA 4RTWA 1ABOA 4OGEA 1PM3A 1D0YA 2OTJA 1D0ZA 2EQKA 4EMHA 4JRPA 3J80E 3THKA 4PJLA 3I55Q 2DBKA 1KQSA 4C92C 1T3LA 3CCEA 2CGHA 3QZ9B 3OYKA 2A36A 4LDWA 4M7AC 2CZ1B 1K8AR 3EFOB 4KT0E 3VRZA 1UJ0A 4GBQA 4E47A 4JS5A 1I81A 3N5BB 1B34A 3NMZC 3FIFA 3CCSA 5J39A 1N8RU 1RADB 2DJZA 4WCIA 4BY6B 1YJWQ 1K9MC 2E65A 2X35A 2QA4T 4J9HA 1KG1A 1LNXA 2XDPA 4F16A 2RK1A 2DFUA 5CR2A 1SRMA 4BB7A 4ZGJB 4J6YA 3LWHA 4GLKA 3EGDA 3JCMQ 3C95A 2QG9B 3OS1A 2EKOA 1BI0A 1G5VA 4A53A 1AOJA 2E6ZA 3QUIA 1JO8A 2ENMA 2JJ9A 1VQ8A 3F70A 4EMKA 2PVDB 3MCAB 3OSVA 3CCSQ 1YHQA 3A8HB 2EYXA 3JCMh 5GAOl 2KT1A 3KBGA 4DOVA 2CP7A 1CKAA 2DZ9A 3CMAA 1YIJT 1IREB 2HAXA 1UHCA 4DA4A 2LX7A 2HSPA 1QWEA 2BKDN 4M7DA 1D1BA 2A37A 1K73R 4F7UB 2K2MA 2QQ9A 1ZLMA 3OYAA 5HK0A 2QASA 2HSEB 1D1AA 1ARKA 4JJDA 4OB3B 2DIGA 1K9MU 2EAYA 2VVKA 4B9WA 4F14A 1WXTA 2D9TA 1VQ8Q 1GL5A 1T0JA 3X26B 2K3YA 2RQRA 3G71A 3RIRA 3JCMb 1HJDA 4RTZA 1VQOA 3SWNC 3CMAQ 1IZ6A 1MMGA 4HT8A 4CC4B 1WXBA 4PL6A 1R77A 1AZGB 2JT4A 1SKUB 4OP0A 5FRMA 2A3LA 2KRSA 2QXFA 4ZNXA 5GAMd 1W4SA 3H9NA 1X43A 2GTJA 3CMEQ 3A8MB 4JPBW 4XTZA 2PNIA 2HQEA 2EGCA 2LVMA 2CZ0B 5I22A 1UB4A 5D6XA 4UC4A 4ZN3A 3G71Q 2V1QA 2RO0A 2LP5A 2P4TA 2EFIA 2RJCA 4OMQA 4VUBA 5DM7R 2RI3A 2ROLA 2D0NA 3H0HA 2CZ7B 1OPLA 2A08A 4M78A 4C5IA 2GGRA 1OPKA 1U5SA 2GQIA 2CT4A 4C8QA 3EG0A 1X2KA 2A7YA 2JS0A 1I4K1 3HP9A 1TG0A 3HRTA 1TUGB 2Z0WA 4LD9K 1ZHIA 4OB0B 3FDRA 4BY6C 5I11A 2QTVA 4LUDA 1Q86C 1VOMA 1NM7A 2YRVA 4BE0A 4QT7A 5IHIA 2FPEA 4CRIA 5GAN3 3TSWA 4M78E 4AFSC 1WPYA 2O9VA 2HMAA 4C8QE 1KSWA 2O9SA 2AZSA 1QKXA 4BI8B 4X1VA 2OTJT 2K3BA 4M75B 1KIKA 1MMAA 3KXTA 1ZSGA 2KSSA 3CCET 2DE0X 3LX7A 2YLBA 1WHJA 2EKHA 2JTMA 1U06A 1GBQA 4X9DA 3H41A 3KUFA 1BB9A 2WACA 2EBPA 5CKBA 3UDCA 2QQBA 3MO8A 3OB9A 2IPOB 4MZPA 2JMCA 2KE9A 1H3HA 3JCMc 3CCQA 1SEMA 3V8KA 3H6ZA 4EDUA 2KXCA 3OY9A 2FL7A 4F7UF 3CC4T 1KQ2A 3E2UA 2RPNA 1Q86U 3CC2Q 3P8HA 4OVAA 4QW2A 2NUZA 2GBQA 4JRQA 2RD1A 1NE8A 1AWWA 1AT1B 3CCUA 1BYMA 2LQNA 2L3RA 4E7SA 2YWWA 4RTTA 1H8KA 3OS5A 1RLQC 2RHIA 3C4SA 1YJ9A 4EMGA 5GAOr 5FRNA 2F1LA 1YHQT 1Q82C 1QQJA 4ZGEB 5GAN5 3CCQQ 1N27A 1ZSZC 1H92A 1WX6A 4C0DB 3EHQA 2VYTA 1Z9ZA 3BE3A 3UA6A 2FEIA 3RDVA 2PUKB 2DYIA 2PUOB 3CXCS 1VUBA 4JLIA 4OMFB 3RKXA 2LZ6B 2VC8A 2LQWA 2NYSA 3SDZA 2JTFA 1AWJA 2CKKA 3L1AA 2HL3A 4Q5WA 4DOWA 1WHHA 2F2VA 2M51A 4IUVA 4J9BA 1YJ9Q 1PD1A 1OU8A 4PJOC 4J5YA 1VQNA 2DXTA 2NUPA 2K57A 2AT1B 1RAFB 1WZOA 2CP6A 1VQOT 2J6FA 1HD3A 4LD6A 3CC7A 3VS1A 1ABQA 3EG9A 4M77B 2ZPEB 3CCRT 2KRNA 2DVJA 2KMTA 2YUOA 2E6NA 1VQKA 1M2VB 4WTOB 3WVEB 1Q82U 1HSQA 2JXBA 2RA2A 3QWYA 4RTUA 4XU0A 2FG0A 1RL2A 2LCSA 1HXDA 2CH4A 2KI7A 2KBTA 5L23A 2DZCA 2K3XA 2RI2A 4KULA 1VQNQ 8ATCB 2JZ2A 4QVDA 3EFOA 4RKUE 3JB9J 3V8JA 3E1SA 1VQ7T 1MMDA 4J9DA 1OYXA 2MYSA 4BE1A 3V7RA 4AFZC 2P4RA 4M75F 2CP0A 2L5QA 4N0AA 1YWPA 5GANf 1VA7A 2EPDA 2ECZA 4RCCA 1AHJB 2MI6A 4MZTA 1VQKQ 4C5GA 3OYJA 3JCMg 3OYDA 3OYCA 2OX7A 5LJ5e 1W70A 1JXMA 3L2ZA 2M0OA 3M5AA 4C92B 2HEQA 3OBYA 2OTLT 1X6GA 2YT6A 3BW1A 2G3RA 2QTXA 4M7AB 4HT9A 4QQGA 1SG5A 2VGNA 1KC8R 4LN2A 2QDYB 3L2UA 4XU3A 2EYQA 1IGQA 2DL3A 2FZKB 2YDLA 1RI9A 1GRIA 1G3SA 2P0PA 1BBZA 1PG5B 2NUTA 2XICA 2I2LA 1NG2A 4EMKC 2VXEA 5D6WA 3CXCP 4C0DC 3P8BB 3QYHB 4DEYA 3URGA 3CD6A 1FX7A 1G3WA 3KFVA 2DXBA 5FU7B 3M0UA 1U1SA 1D3BA 1QCNA 1UECA 4ANJA 3G4SQ 3S3OA 4PLLA 4KBMB 4EIKA 5LJ5d 2DXUA 4JLGA 2MCNA 1QP3A 2ZPFB 4E7ZA 3VYHB 1KJWA 2B86A 3RUXA 4KH1B 3VYGA 1I1JA 4JJCA 1NPRA 1UG1A 1NJIU 3RMQA 4RCBA 2CSQA 2MK5A 3CXCA 3NFCA 3CBMA 3GNFB 3CCUT 4CC7A 4E2FB 1B3QA 2X51A 1QKWA 1M1KC 1Q81R 1U8RA 4M75D 4M77C 1RACB 3CD6Q 1X75C 3PT9A 3NGPA 2XG8D 2QQAA 2RHUA 1VQ5Q 4M77F 5LL6S 4BI4A 1K76A 4LDUA 3D7SB 3ASKA 3X28B 3SWNB 4E7IA 4XTWA 3I55A 3FRNA 1MMNA 4JJBA 4Y92A 3G6EQ 3VS6A 1V29B 2IVWA 5LJ3g 1SPKA 2EYWA 2DD4A 3EH1A 4BUGA 1FYNA 5IXFA 3JCMP 3CCLT 1QVPA 1VQMA 1R0BG 1T3SA 2DERA 3UF4A 4A63B 1EZZB 2QEXQ 4JRKA 5EG2A 1FWZA 2LNHB 1YJWA 4M78C 2VV5A 2RHZA 1QVFP 5J3BA 3CC7T 2ZAEA 5FWBA 3WXMB 2VGMA 5GANh 5IHNA 4C8QC 4FW2A 1M1KU 3PIOA 1M3CA 5LJ5f 1PCXA 3SFMA 5J26A 2A28A 4FT2A 4R55A 4HXJA 2JN0A 2XKOC 4F04B 3PMTA 3HFNA 3Q1JA 1YI2T 4C92F 3CPFA 2MOXA 1VQMQ 2FRYA 2VASA 4X34A 2L3SA 1QVFA 4M7AF 2DBMA 1OX8A 2RK2A 2X9HA 4PJNA 3QIIA 3UWNA 3ZBDA 1BCMA 4KGVB 2KYBA 5LJ3f 5A0LA 1MNEA 1VIFA 1Q86R 1SHGA 5GMKh 1NZ9A 2L3QA 1VQ6A 1RAIB 3VS3A 2V8IA 3RKWA 4E6RA 2WSEE 3LWIA 3RKYA 5FROA 5KYUB 3VS0A 3HHTB 2DL8A 2RF0A 3E9GA 2K5FA 1YJNQ 5FU7C 1M90C 1VQLA 3JB9H 1PC0A 4M77D 2J06A 1FMWA 4N4IA 5GAMe 5GAN7 2O88A 1KD1C 1AZEA 3NHNA 3O8VA 2C0OA 4QKUA 2KVQG 4XTVA 1VQ6Q 4AMCA 3VUBA 2NLUA 2I0NA 4FU6A 9ATCB 3VS7A 3M9QA 3CMEA 2FB7A 3TSZA 4NL2A 1V1CA 4JUVA 1Y96B 3M55A 1VQLQ 7AT1B 2FPFA 1OV3A 1PSEA 3JV3A 4NS5A 4FM4B 3MPUB 1RABB 5A2QE 2V1RA 2DXCA 5CKHA 4KUDK 1Y07A 2LX9A 4IUQA 2CP5A 4M7DE 3QO3A 1TWBA 5KE2A 3BFMA 5KYNA 4X9CA 3GP8A 1SRLA 1N5ZA 1UDLA 4J9FA 1TTHB 2EGEA 1XNIA 4DBRA 5IT9E 4J9CA 1M90U 4BDYA 2MWOA 2SEMA 4C92D 4N4HA 1ZBJA 1ZSZB 1MV3A 1BIAA 2ZCFB 5DLOA 4FYYB 1KD1U 4M7AD 3X25B 3META 1LVKA 1JJ2S 2AKLA 1M27C 1BI3A 1Y0MA 3MEUA 1VQ4Q 2J05A 1U1TA 1ZQ1A 3M4GA 4JRIA 3QBYA 2YHTA 3L2RA 1E6GA 1TSFA 3JCMV 2P0QA 3AT1B 5GAOm 2DL4A 2E1HA 4A54A 4PJOB 2BTTA 4D6WA 4E7KA 2XMFA 1NYGA 1VQPQ 5LJ5h 2DRMA 5CK9A 2RI5A 1X6OA 4O6JA 2L2PA 3TEEA 3LH5A 1C6VX 3I55T 2X4YA 4F7UG 3I56Q 1QWFA 2F2XA 2C0IA 2X4WA 3A8GB 4FSSA 3OS0A 4FYXB 2RQTA 4LUEA 1K8AC 1JBMA 4RTXA 3MP1A 2KGTA 4L6V5 4Z89A 2E5QA 3HFOA 2YUQA 2GTOA 4C5EA 3FJPA 4J6WA 5LJ3h 5KYWB 2E12A 1QW1A 1M5Q1 1YJWT 4BACA 4ATOA 3QKJA 3PVQA 4L5GA 4N0AC 5L8RE 3RMSA 4C5HA 2RQWA 1D0XA 1N9RA 4AFQC 5KCHA 3UT1A 1IHVA 2HZYA 3PMIA 5KH6A 3EGXA 3JCMJ 1QVGP 2HBPA 3CC2A 4C0ZA 1OZ3A 5A0GA 5GMKm 1UJYA 5GAMf 1BU1A 2J6OA 3EH2A 2ED1A 3NPFA 1H641 3L42A 2YRCA 1EFNA 2CUBA 1I8FA 1V76A 4ELYC 1BI1A 1SF9A 3OMCA 2VXFA 3CCST 4FSXA 1RLPC 2NWMA 5IHKA 3CCMQ 2X4JA 3M4YA 5EC7A 3CCVQ 1QVGA 4IUPA 3C0CA 2YXYA 4C0GA 1K73C 1K8AU 3CCJA 4XTXA 5CVIA 2KXDA 4HVVA 1Q7YR 1M8MA 1XTDA 3L2VA 4DBFA 2PU9B 2OAUA 3SD4A 1W6XA 4FIBA 4IIOA 4PK4A 3QHSA 1TS9A 3M0QA 2ZGWA 2SRCA 1VQ8T 3CBPA 1J3TA 2DL5A 3EG2A 1MHNA 3HTRA 3SHWA 2FO0A 2DM1A 5CCAA 6AT1B 3BDLA 1BIBA 2ZPBB 1JJ2P 1Y57A 4EMKB 4J7IA 1YITQ 3HRUA 3CMAT 1JB0E 2V8JA 2X3XD 3CPWS 5KYXA 1B07A 1PNJA 2LCCA 4J8OA 3FJ5A 1NLOC 3GPLA 3CCJQ 2K79A 4XTUA 1GBRA 2L8DA 2BUDA 1S72A 1VQ9A 2VWFA 3MKDA 1LOJA 3INZA 3LLRA 4M7DB 3CMET 5I2MA 1OULA 3R6OA 2E3HA 4M75G 3ZEHA 3H0FA 2PVOB 4ZGDB 2F5TX 1Z9QA 2JVVA 1JJ2A 2CP2A 1MGQA 4IUTA 4J9EA 5GANg 3G71T 1WDXA 2R5MA 1LCKA 2DL7A 1K73U 3L2WA 4MZMA 1GCQA 2HL5C 1M30A 1P92A 3JRZA 1D1CA 1OX9A 2BE9B 2R5AA 4PJOF 3M0RA 5GAN8 2RJFA 3RR6A 2RB6A 2JUFA 2YRDA 5CKFA 1CKBA 1S72Q 2DTIA 1VQ9Q 2Y4XA 1WJQA 3OA6A 2MAMA 2YLCA 2B8AA 1X2QA 2DF6A 2XI9A 2DNUA 2K2VA 2QAZA 1CSKA 1M1GA 3DKMA 4WF2A 1WJRA 2W10A 2BZXA 2YUNA 1N8RR 3QJ6A 2DEQA 1PWTA 3QG1A 3VUZA 3VS5A 2XDBA 1HYOA 2IIMA 2KROA 2K5IA 1TH7A 1X01A 3OYNA 1KFZA 3G1JA 2JMAA 4J6XA 1M1FA 4LDVA 2BE7D 3DB4A 3MP6A 4D8KA 4M78B 3I5SA 5GAMh 2K5LA 2QA4A 2GFAA 2EJ9A 4C8QB 2RHXA 3MP8A 3TREA 1QVFS 3VV0A 1EIFA 1AEYA 1NJIC 2XK0A 4M4ZA 4CC2A 1KHCA 4RMOA 1WNLA 3RERA 4HCCA 2LRQA 3OYEA 2KT8A 5GAOq 1ZBXA 1PKSA 3G4SA 3L2QA 4ME7A 5FLXE 3C12A 4PJMA 2Y4YA 1S1NA 1VYVA 2H8HA 2QGFB 1K9MR 4M77G 2QA4Q 1HK9A 4FT4A 3CC2T 1PRMC 3S3MA 2DTOA 1WHLA 4F7UA 4XU1A 3CPWP 3G7ZA 3JAME 2O4XB 1AVZC 3MEAA 1PRLC 1W2BA 3SEMA 4J9IA 1G2BA 4PJOD 1C1AA 3QZ5B 2C06A 1Y96A 2PZ1A 4NOYA 2K9GA 1SSHA 2ATCB 2CREA 1NEBA 2J7IA 1SHFA 2RJDA 4P5NA 4OMLA 2D0QB 4E7JA 4M7DC 1WIEA 3CCQT 4MMKA 1VQ5A 3CPWA 5GJWB 4F7UE 5FWCA 4M7DF 4PJJA 1TU0B 2GFUA 1YIJQ 3OQ5A 1IO6A 2COWA 2LC4A 5HY6A 2EWNA 4N4GA 5DY9A 2MIOA 3G6EA 2F69A 1MV0B 1UGQB 1VIEA 1VYTA 2EQIA 3MJXA 2M02A 3JB9G 4C0FA 1E7OA 2ZPIB 2XD0A 5AT1B 3LW5E 4A4GA 3OS2A 1IHWA 3EG3A 2MWPA 3PVLA 1YJ9T 1WGSA 5C0MA 2K4YA 5LJ5g 3U23A 2JM8A 1G3YA 1JU5C 2COZA 2QEXA 4C92G 3R6NA 3X20B 2CUDA 3PGGA 2PTKA 2RQVA 3PIPA 2MPXC 4M7AG 5A0DA 5GAN4 2MF2A 1R8OB 1NPPA 3GF5A 5CAIA 4GY5A 2LQKA 4R0KA 4OMOA 2R58A 1S72T 2E4HA 2L0AA 1GFDA 2F5KA 1DJ7B 3S3NA 5KYYB 4ELZC 2WSCE 3FEOA 1QCFA 3VRYA 4FCYA 2DETA 1VQNT 3M0PA 4OB2B 4YTLA 3JCMW 3VJPA 4TVRA 3REAB 1WHKA 1B7TA 2DYBA 1GCPA 2NUPB 1RI0A 1PHTA 1I0CA 2LMJA 1NLPC 4V2SA 2Y90A 4M78F 4JDSA 4QQ6A 2J6KA 4FW1A 2COYA 2EQUA 3JB9F 4IKFA 3EG9B 2FYKA 2GCXA 4C8QF
chains in the Genus database with same CATH topology
1VQ4Q 3CCSQ 3CCVQ 2QA4Q 1VQPQ 3G71Q 1M90R 1K8AR 2OTLQ 3CCUQ 3CPWP 1Q81R 1W2BP 3CCEQ 1QVFP 3G6EQ 1VQOQ 1VQLQ 1NJIR 3CC2Q 1VQNQ 1N8RR 3CD6Q 1VQMQ 1KC8R 3CCQQ 1VQKQ 1M1KR 1VQ8Q 3I56Q 3CC4Q 1YI2Q 1KD1R 1JJ2P 1Q7YR 3CXCP 3CMEQ 1KQSP 1YITQ 1YHQQ 1S72Q 1VQ9Q 1YIJQ 1YJ9Q 3I55Q 3CC7Q 1YJWQ 1VQ5Q 1Q82R 1K73R 1K9MR 1VQ6Q 3OW2P 2OTJQ 1YJNQ 3CCRQ 1QVGP 3CMAQ 3CCJQ 1VQ7Q 3CCMQ 1Q86R 2QEXQ 3G4SQ 3CCLQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 Q;  3CCS Q;  3CCV Q;  2QA4 Q;  1VQP Q;  3G71 Q;  1M90 R;  1K8A R;  2OTL Q;  3CCU Q;  3CPW P;  1Q81 R;  1W2B P;  3CCE Q;  1QVF P;  3G6E Q;  1VQO Q;  1VQL Q;  1NJI R;  3CC2 Q;  1VQN Q;  1N8R R;  3CD6 Q;  1VQM Q;  1KC8 R;  3CCQ Q;  1VQK Q;  1M1K R;  1VQ8 Q;  3I56 Q;  3CC4 Q;  1YI2 Q;  1KD1 R;  1JJ2 P;  1Q7Y R;  3CXC P;  3CME Q;  1KQS P;  1YIT Q;  1YHQ Q;  1S72 Q;  1VQ9 Q;  1YIJ Q;  1YJ9 Q;  3I55 Q;  3CC7 Q;  1YJW Q;  1VQ5 Q;  1Q82 R;  1K73 R;  1K9M R;  1VQ6 Q;  3OW2 P;  2OTJ Q;  1YJN Q;  3CCR Q;  1QVG P;  3CMA Q;  3CCJ Q;  1VQ7 Q;  3CCM Q;  1Q86 R;  2QEX Q;  3G4S Q;  3CCL Q; 
#chains in the Genus database with same CATH topology
 3BY7 A;  1UGS B;  2RM4 A;  4M75 A;  2A0F B;  2LJ0 A;  1VQK T;  1YWO A;  1T0H A;  2KY9 A;  3PNW C;  2W0Z A;  1YJN A;  3EGU A;  3HL8 A;  3ZFJ A;  4AT1 B;  4DEX A;  1ZA2 B;  2K7A A;  2RJE A;  2D6F A;  4M7D D;  3EG1 A;  2KK4 A;  5KCO A;  1KC8 C;  2HCK A;  2EQJ A;  3GIB A;  3NTK A;  2RN8 A;  4Z8A A;  2JM9 A;  1TUC A;  2CP3 A;  4M75 E;  1C0M A;  1IRX A;  1MUZ A;  2OAW A;  2L89 A;  2X4X A;  1X69 A;  4LE9 A;  2LJ3 A;  2QI2 A;  5KE3 A;  3AHU A;  2G6F X;  3OYY A;  2EQM A;  2OTJ Q;  4PFP A;  1UFF A;  2FRW A;  3MEW A;  2ESW A;  3CC4 A;  1M3B A;  4XK8 E;  2EJG A;  1AWX A;  3M57 A;  3J7A F;  2PVG B;  4E7H A;  3CCE Q;  3X24 B;  1QVG S;  3DLL A;  3QSU A;  2HDA A;  2XHC A;  1YFN A;  3G4S T;  3E19 A;  2M0Y A;  1N9S A;  4ESR A;  2LNV A;  2HBW A;  2E70 A;  3I5R A;  1X6B A;  2DKG A;  1GXI E;  1UTI A;  3A8O B;  5FU6 B;  2PQW A;  5CQY A;  3TU4 K;  2D1X A;  2HNI A;  4OMP A;  3CC4 Q;  2AK5 A;  5GAO n;  1VQ4 A;  1KC8 U;  5AYF A;  1FMV A;  4ORZ A;  2CS7 A;  3J81 E;  2LDM A;  3GNG A;  1VYU A;  1F1B B;  1IGU A;  2NUT B;  1PSF A;  4M78 D;  1Q81 C;  1WFW A;  2ZPH B;  5GAN j;  2FVU A;  3JB9 D;  2AZV A;  3CD6 T;  3QXE B;  4HCK A;  2GNC A;  4C8Q D;  4MDX A;  1KK7 A;  3FLG A;  2XU8 A;  4AG2 C;  1VQ5 T;  3ZL7 C;  2ZZD A;  4A4E A;  2RHY A;  4ZTJ A;  1D3B B;  3QDF A;  2L3P A;  1YHQ Q;  1VQP A;  4PKC C;  1Q82 R;  4PFZ A;  4M77 A;  2KRM A;  3HKS A;  4AG1 C;  2XDD A;  1M8V A;  1OZ2 A;  2GQV A;  1IXD A;  3I56 A;  2M1H A;  3G6E T;  2HQH A;  3TQ7 P;  1UEB A;  1KHI A;  3FC3 A;  1WHM A;  3UA7 A;  1M2V A;  4XQ3 A;  3CCR A;  1PD0 A;  4DBH A;  5GMK l;  1WHG A;  1GCQ C;  2OI3 A;  1UGV A;  1UUE A;  4HCZ A;  4KRT A;  2KAF A;  4DBQ A;  2ROT A;  3NTH A;  5GMK j;  5GAM g;  2QEX T;  3IQL A;  3LYI A;  4PLI A;  3V7S A;  1R0C B;  1OOT A;  2CSI A;  2DIQ A;  4D8D A;  2ZPG B;  2CZ6 B;  3OYL A;  1MND A;  4M77 E;  2JNG A;  4II1 A;  1OQK A;  1SSF A;  1NBE B;  3DLM A;  2LJ1 A;  2IG0 A;  1JQQ A;  1VQO Q;  1WQ7 A;  1H3Z A;  1PKT A;  1VQ7 A;  2KQW A;  1Q81 U;  2LT1 A;  1AWO A;  4JJN K;  3MEV A;  3NTI A;  4OF1 A;  1QP2 A;  2DTH A;  3CCR Q;  3OYI A;  1RAH B;  1XJW B;  3SB2 A;  4KUI A;  4PNO A;  1VQM T;  3OBW A;  4C92 A;  5C6S A;  4J7F A;  2LCL A;  5D6Y A;  4IUR A;  3CCM A;  2HD0 A;  4M7A A;  3OMG A;  3CCV A;  1RAE B;  2OTL A;  2K6D A;  4XTY A;  2P84 A;  1M2O A;  1OI1 A;  1G83 A;  3GLX A;  4E7L A;  4LDX A;  2AHJ B;  1VQ7 Q;  1ZUK A;  4B6M A;  4OMN A;  1WI7 A;  1BKB A;  3QYG B;  3HPW A;  5GAO p;  2QDL A;  2F2W A;  1JXO A;  3EFS A;  3DB3 A;  2JOY A;  1UHF A;  2CDT A;  3UAT A;  1YJN T;  4C92 E;  3ULR B;  3RBB B;  2O4X A;  4BI3 A;  1UE9 A;  4RTY A;  4M7A E;  1RAG B;  3OYB A;  2QQS A;  1B34 B;  1I07 A;  5GAN e;  1YIT A;  2P0K A;  2OTL Q;  4GLM A;  3OW2 S;  4Z88 A;  1ZA1 B;  5FU6 C;  1W1F A;  1NJI R;  5M9O A;  4HA8 A;  5HK3 A;  2RNA A;  1VQ6 T;  1YCS B;  3V8L A;  4PJO G;  5CKE A;  1GFC A;  1W2B S;  4IUU A;  2EJF A;  3T9N A;  4HVU A;  3C94 A;  4KH0 B;  2GF7 A;  1FMK A;  2V26 A;  2D8J A;  3QWX X;  2O31 A;  3EGD B;  1VQL T;  4R56 A;  3RES A;  4HKE A;  1WYX A;  4XU2 A;  2DD5 A;  2DX1 A;  1QLY A;  1NEG A;  2H3E B;  2EW3 A;  2FHD A;  5LJ5 j;  1BI2 A;  5GMK e;  4RG2 A;  1XQH A;  3JSC A;  3ER0 A;  2FPD A;  4KGX B;  2QGG A;  4PFO A;  2MMP A;  1ZUY A;  3QPH A;  2KDS A;  3PTA A;  1YBY A;  2LT4 A;  1Q95 G;  4JZ3 A;  4OB1 B;  3VU3 C;  1WJS A;  4EPC A;  4FL6 A;  1U3O A;  2WSF E;  3A98 A;  3QJY A;  4Y91 A;  3SWN A;  4CI0 C;  5D7U A;  5GAN d;  2QYZ A;  4AFU C;  1KQ1 A;  2VKN A;  3WVD B;  5LJ3 j;  2EVR A;  1G3T A;  1K0S A;  2O01 E;  3JCM e;  2ABL A;  1VQ4 T;  3OYF A;  4A4K A;  2DPP B;  3M0S A;  5GMK i;  3EHR A;  1D09 B;  4LNP A;  5KYY A;  3HSB A;  3M0T A;  5IN1 A;  3VS4 A;  3CCU Q;  2DMO A;  4QVC A;  5HKC A;  1M1K R;  1K9A A;  3OYG A;  3CCL A;  1I5L A;  2CH4 W;  1E6H A;  2BZY A;  4B9X A;  3MHX A;  2CT3 A;  1JRI A;  1VQP T;  4IIM A;  1ZX6 A;  2CYZ B;  2YSQ A;  3VS2 A;  3GOX A;  3I56 T;  1NYF A;  2DIL A;  1M9S A;  2HQX A;  1O75 A;  2RMO A;  2KYM A;  5GAN 2;  1YN8 A;  2RQU A;  1OEB A;  2FZC B;  2E5K A;  3QDR B;  2YUP A;  3GBQ A;  1LJO A;  4JS4 A;  1YI2 A;  2AKK A;  3CCL Q;  3BDU A;  1UGP B;  2HKQ B;  5CQX A;  4J83 A;  3OYM A;  4OMM A;  3H0I A;  3JCM d;  1WA7 A;  3LGF A;  3M56 A;  4CC3 A;  3H8Z A;  1UGR B;  5IXB A;  4DQ2 A;  4ZTF A;  2QQR A;  3ME9 A;  4M75 C;  3CC7 Q;  3PE0 A;  3TCJ A;  3VKI A;  1ACM B;  3OSS C;  3OW2 P;  2BIV A;  4FYW B;  2AIR B;  5KYU A;  4LDY A;  3A5Z B;  4M7D G;  1KQS S;  4QQD A;  4Y28 E;  1K4U S;  3UPU A;  2XID A;  2DO3 A;  1XOV A;  2EIF A;  1M3A A;  1TXQ A;  4FYV B;  5GAN 6;  2BZ8 A;  5FW9 A;  4KGZ B;  1W2B P;  2E41 A;  3V7C A;  2VB6 A;  4ZN1 A;  2LQ8 A;  5I21 A;  1YI2 Q;  4RG8 A;  5ECA A;  2JTE A;  3M54 A;  4F17 A;  3CCM T;  3CCV T;  3A8L B;  2JW4 A;  4XAX B;  3OW2 A;  1WLP B;  1G8X A;  1YNZ A;  3RNJ A;  1YIJ A;  4RTV A;  1Q7Y C;  4QVZ A;  5CO7 A;  3EGX B;  1ZUU A;  1O9S A;  2HKN A;  2EGA A;  4BDZ A;  1JEG A;  2E64 A;  5LJ3 e;  3CEY A;  1I5O B;  1M4Z A;  1TOV A;  1FXX A;  1YP5 A;  4K11 A;  1TUD A;  1N6A A;  3LH0 A;  3P8D A;  1M90 R;  2EYZ A;  1EX4 A;  3JCM X;  2RH2 A;  1RUW A;  1YIT T;  3PFS A;  5IH2 A;  2JS2 A;  1KD1 R;  2DAQ A;  4RUG A;  4LXC A;  3CCJ T;  1OU9 A;  2M16 A;  3LGL A;  3JCM f;  4NL3 A;  2DLP A;  4M78 G;  4HCB A;  1ZSZ A;  1BK2 A;  3HRS A;  2D8H A;  3OYH A;  4BE2 A;  4C8Q G;  1QCO A;  3M53 A;  5IAY A;  3FB9 A;  4L59 A;  1WXU A;  2DVE A;  2DEU A;  1Q7Y U;  8AT1 B;  4A4F A;  3CQT A;  5DLQ E;  3M58 A;  4MDW A;  1AD5 A;  1X27 A;  3REB B;  1K0X A;  5GAM j;  1WQW A;  4MML A;  4A4H A;  2X3W D;  3A1P A;  2DA9 A;  3I35 A;  1QMC A;  1Y7X A;  5LJ3 d;  4J9G A;  3CBO A;  5KYX B;  4PJO A;  5CIU A;  1VQ9 T;  2C0T A;  2KNB B;  1A0N B;  2KEA A;  3EFR A;  2ED0 A;  3JB9 I;  1BCO A;  3I9Q A;  1RAA B;  1YCY A;  4HVW A;  3O5Z A;  3S6W A;  3M59 A;  2KR3 A;  1LPL A;  2E10 A;  2M9U A;  5HCK A;  2H3J A;  2R57 A;  3E9F A;  1N8R C;  3EAE A;  2QK0 A;  2VUB A;  2DK3 A;  2DRK A;  4JZ4 A;  5GJV B;  1K1Z A;  2FZG B;  2EYY A;  1KQS P;  5KYW A;  4BD3 A;  4PJO E;  1IB8 A;  1Y71 A;  2O2O A;  2OJ2 A;  2LTO A;  3TVT A;  4OGC A;  2V8K A;  4Z02 A;  2DJQ A;  4O5V A;  2E3I A;  5I2S A;  5CKD A;  4RTW A;  1ABO A;  4OGE A;  1PM3 A;  1D0Y A;  2OTJ A;  1D0Z A;  2EQK A;  4EMH A;  4JRP A;  3J80 E;  3THK A;  4PJL A;  3I55 Q;  2DBK A;  1KQS A;  4C92 C;  1T3L A;  3CCE A;  2CGH A;  3QZ9 B;  3OYK A;  2A36 A;  4LDW A;  4M7A C;  2CZ1 B;  1K8A R;  3EFO B;  4KT0 E;  3VRZ A;  1UJ0 A;  4GBQ A;  4E47 A;  4JS5 A;  1I81 A;  3N5B B;  1B34 A;  3NMZ C;  3FIF A;  3CCS A;  5J39 A;  1N8R U;  1RAD B;  2DJZ A;  4WCI A;  4BY6 B;  1YJW Q;  1K9M C;  2E65 A;  2X35 A;  2QA4 T;  4J9H A;  1KG1 A;  1LNX A;  2XDP A;  4F16 A;  2RK1 A;  2DFU A;  5CR2 A;  1SRM A;  4BB7 A;  4ZGJ B;  4J6Y A;  3LWH A;  4GLK A;  3EGD A;  3JCM Q;  3C95 A;  2QG9 B;  3OS1 A;  2EKO A;  1BI0 A;  1G5V A;  4A53 A;  1AOJ A;  2E6Z A;  3QUI A;  1JO8 A;  2ENM A;  2JJ9 A;  1VQ8 A;  3F70 A;  4EMK A;  2PVD B;  3MCA B;  3OSV A;  3CCS Q;  1YHQ A;  3A8H B;  2EYX A;  3JCM h;  5GAO l;  2KT1 A;  3KBG A;  4DOV A;  2CP7 A;  1CKA A;  2DZ9 A;  3CMA A;  1YIJ T;  1IRE B;  2HAX A;  1UHC A;  4DA4 A;  2LX7 A;  2HSP A;  1QWE A;  2BKD N;  4M7D A;  1D1B A;  2A37 A;  1K73 R;  4F7U B;  2K2M A;  2QQ9 A;  1ZLM A;  3OYA A;  5HK0 A;  2QAS A;  2HSE B;  1D1A A;  1ARK A;  4JJD A;  4OB3 B;  2DIG A;  1K9M U;  2EAY A;  2VVK A;  4B9W A;  4F14 A;  1WXT A;  2D9T A;  1VQ8 Q;  1GL5 A;  1T0J A;  3X26 B;  2K3Y A;  2RQR A;  3G71 A;  3RIR A;  3JCM b;  1HJD A;  4RTZ A;  1VQO A;  3SWN C;  3CMA Q;  1IZ6 A;  1MMG A;  4HT8 A;  4CC4 B;  1WXB A;  4PL6 A;  1R77 A;  1AZG B;  2JT4 A;  1SKU B;  4OP0 A;  5FRM A;  2A3L A;  2KRS A;  2QXF A;  4ZNX A;  5GAM d;  1W4S A;  3H9N A;  1X43 A;  2GTJ A;  3CME Q;  3A8M B;  4JPB W;  4XTZ A;  2PNI A;  2HQE A;  2EGC A;  2LVM A;  2CZ0 B;  5I22 A;  1UB4 A;  5D6X A;  4UC4 A;  4ZN3 A;  3G71 Q;  2V1Q A;  2RO0 A;  2LP5 A;  2P4T A;  2EFI A;  2RJC A;  4OMQ A;  4VUB A;  5DM7 R;  2RI3 A;  2ROL A;  2D0N A;  3H0H A;  2CZ7 B;  1OPL A;  2A08 A;  4M78 A;  4C5I A;  2GGR A;  1OPK A;  1U5S A;  2GQI A;  2CT4 A;  4C8Q A;  3EG0 A;  1X2K A;  2A7Y A;  2JS0 A;  1I4K 1;  3HP9 A;  1TG0 A;  3HRT A;  1TUG B;  2Z0W A;  4LD9 K;  1ZHI A;  4OB0 B;  3FDR A;  4BY6 C;  5I11 A;  2QTV A;  4LUD A;  1Q86 C;  1VOM A;  1NM7 A;  2YRV A;  4BE0 A;  4QT7 A;  5IHI A;  2FPE A;  4CRI A;  5GAN 3;  3TSW A;  4M78 E;  4AFS C;  1WPY A;  2O9V A;  2HMA A;  4C8Q E;  1KSW A;  2O9S A;  2AZS A;  1QKX A;  4BI8 B;  4X1V A;  2OTJ T;  2K3B A;  4M75 B;  1KIK A;  1MMA A;  3KXT A;  1ZSG A;  2KSS A;  3CCE T;  2DE0 X;  3LX7 A;  2YLB A;  1WHJ A;  2EKH A;  2JTM A;  1U06 A;  1GBQ A;  4X9D A;  3H41 A;  3KUF A;  1BB9 A;  2WAC A;  2EBP A;  5CKB A;  3UDC A;  2QQB A;  3MO8 A;  3OB9 A;  2IPO B;  4MZP A;  2JMC A;  2KE9 A;  1H3H A;  3JCM c;  3CCQ A;  1SEM A;  3V8K A;  3H6Z A;  4EDU A;  2KXC A;  3OY9 A;  2FL7 A;  4F7U F;  3CC4 T;  1KQ2 A;  3E2U A;  2RPN A;  1Q86 U;  3CC2 Q;  3P8H A;  4OVA A;  4QW2 A;  2NUZ A;  2GBQ A;  4JRQ A;  2RD1 A;  1NE8 A;  1AWW A;  1AT1 B;  3CCU A;  1BYM A;  2LQN A;  2L3R A;  4E7S A;  2YWW A;  4RTT A;  1H8K A;  3OS5 A;  1RLQ C;  2RHI A;  3C4S A;  1YJ9 A;  4EMG A;  5GAO r;  5FRN A;  2F1L A;  1YHQ T;  1Q82 C;  1QQJ A;  4ZGE B;  5GAN 5;  3CCQ Q;  1N27 A;  1ZSZ C;  1H92 A;  1WX6 A;  4C0D B;  3EHQ A;  2VYT A;  1Z9Z A;  3BE3 A;  3UA6 A;  2FEI A;  3RDV A;  2PUK B;  2DYI A;  2PUO B;  3CXC S;  1VUB A;  4JLI A;  4OMF B;  3RKX A;  2LZ6 B;  2VC8 A;  2LQW A;  2NYS A;  3SDZ A;  2JTF A;  1AWJ A;  2CKK A;  3L1A A;  2HL3 A;  4Q5W A;  4DOW A;  1WHH A;  2F2V A;  2M51 A;  4IUV A;  4J9B A;  1YJ9 Q;  1PD1 A;  1OU8 A;  4PJO C;  4J5Y A;  1VQN A;  2DXT A;  2NUP A;  2K57 A;  2AT1 B;  1RAF B;  1WZO A;  2CP6 A;  1VQO T;  2J6F A;  1HD3 A;  4LD6 A;  3CC7 A;  3VS1 A;  1ABQ A;  3EG9 A;  4M77 B;  2ZPE B;  3CCR T;  2KRN A;  2DVJ A;  2KMT A;  2YUO A;  2E6N A;  1VQK A;  1M2V B;  4WTO B;  3WVE B;  1Q82 U;  1HSQ A;  2JXB A;  2RA2 A;  3QWY A;  4RTU A;  4XU0 A;  2FG0 A;  1RL2 A;  2LCS A;  1HXD A;  2CH4 A;  2KI7 A;  2KBT A;  5L23 A;  2DZC A;  2K3X A;  2RI2 A;  4KUL A;  1VQN Q;  8ATC B;  2JZ2 A;  4QVD A;  3EFO A;  4RKU E;  3JB9 J;  3V8J A;  3E1S A;  1VQ7 T;  1MMD A;  4J9D A;  1OYX A;  2MYS A;  4BE1 A;  3V7R A;  4AFZ C;  2P4R A;  4M75 F;  2CP0 A;  2L5Q A;  4N0A A;  1YWP A;  5GAN f;  1VA7 A;  2EPD A;  2ECZ A;  4RCC A;  1AHJ B;  2MI6 A;  4MZT A;  1VQK Q;  4C5G A;  3OYJ A;  3JCM g;  3OYD A;  3OYC A;  2OX7 A;  5LJ5 e;  1W70 A;  1JXM A;  3L2Z A;  2M0O A;  3M5A A;  4C92 B;  2HEQ A;  3OBY A;  2OTL T;  1X6G A;  2YT6 A;  3BW1 A;  2G3R A;  2QTX A;  4M7A B;  4HT9 A;  4QQG A;  1SG5 A;  2VGN A;  1KC8 R;  4LN2 A;  2QDY B;  3L2U A;  4XU3 A;  2EYQ A;  1IGQ A;  2DL3 A;  2FZK B;  2YDL A;  1RI9 A;  1GRI A;  1G3S A;  2P0P A;  1BBZ A;  1PG5 B;  2NUT A;  2XIC A;  2I2L A;  1NG2 A;  4EMK C;  2VXE A;  5D6W A;  3CXC P;  4C0D C;  3P8B B;  3QYH B;  4DEY A;  3URG A;  3CD6 A;  1FX7 A;  1G3W A;  3KFV A;  2DXB A;  5FU7 B;  3M0U A;  1U1S A;  1D3B A;  1QCN A;  1UEC A;  4ANJ A;  3G4S Q;  3S3O A;  4PLL A;  4KBM B;  4EIK A;  5LJ5 d;  2DXU A;  4JLG A;  2MCN A;  1QP3 A;  2ZPF B;  4E7Z A;  3VYH B;  1KJW A;  2B86 A;  3RUX A;  4KH1 B;  3VYG A;  1I1J A;  4JJC A;  1NPR A;  1UG1 A;  1NJI U;  3RMQ A;  4RCB A;  2CSQ A;  2MK5 A;  3CXC A;  3NFC A;  3CBM A;  3GNF B;  3CCU T;  4CC7 A;  4E2F B;  1B3Q A;  2X51 A;  1QKW A;  1M1K C;  1Q81 R;  1U8R A;  4M75 D;  4M77 C;  1RAC B;  3CD6 Q;  1X75 C;  3PT9 A;  3NGP A;  2XG8 D;  2QQA A;  2RHU A;  1VQ5 Q;  4M77 F;  5LL6 S;  4BI4 A;  1K76 A;  4LDU A;  3D7S B;  3ASK A;  3X28 B;  3SWN B;  4E7I A;  4XTW A;  3I55 A;  3FRN A;  1MMN A;  4JJB A;  4Y92 A;  3G6E Q;  3VS6 A;  1V29 B;  2IVW A;  5LJ3 g;  1SPK A;  2EYW A;  2DD4 A;  3EH1 A;  4BUG A;  1FYN A;  5IXF A;  3JCM P;  3CCL T;  1QVP A;  1VQM A;  1R0B G;  1T3S A;  2DER A;  3UF4 A;  4A63 B;  1EZZ B;  2QEX Q;  4JRK A;  5EG2 A;  1FWZ A;  2LNH B;  1YJW A;  4M78 C;  2VV5 A;  2RHZ A;  1QVF P;  5J3B A;  3CC7 T;  2ZAE A;  5FWB A;  3WXM B;  2VGM A;  5GAN h;  5IHN A;  4C8Q C;  4FW2 A;  1M1K U;  3PIO A;  1M3C A;  5LJ5 f;  1PCX A;  3SFM A;  5J26 A;  2A28 A;  4FT2 A;  4R55 A;  4HXJ A;  2JN0 A;  2XKO C;  4F04 B;  3PMT A;  3HFN A;  3Q1J A;  1YI2 T;  4C92 F;  3CPF A;  2MOX A;  1VQM Q;  2FRY A;  2VAS A;  4X34 A;  2L3S A;  1QVF A;  4M7A F;  2DBM A;  1OX8 A;  2RK2 A;  2X9H A;  4PJN A;  3QII A;  3UWN A;  3ZBD A;  1BCM A;  4KGV B;  2KYB A;  5LJ3 f;  5A0L A;  1MNE A;  1VIF A;  1Q86 R;  1SHG A;  5GMK h;  1NZ9 A;  2L3Q A;  1VQ6 A;  1RAI B;  3VS3 A;  2V8I A;  3RKW A;  4E6R A;  2WSE E;  3LWI A;  3RKY A;  5FRO A;  5KYU B;  3VS0 A;  3HHT B;  2DL8 A;  2RF0 A;  3E9G A;  2K5F A;  1YJN Q;  5FU7 C;  1M90 C;  1VQL A;  3JB9 H;  1PC0 A;  4M77 D;  2J06 A;  1FMW A;  4N4I A;  5GAM e;  5GAN 7;  2O88 A;  1KD1 C;  1AZE A;  3NHN A;  3O8V A;  2C0O A;  4QKU A;  2KVQ G;  4XTV A;  1VQ6 Q;  4AMC A;  3VUB A;  2NLU A;  2I0N A;  4FU6 A;  9ATC B;  3VS7 A;  3M9Q A;  3CME A;  2FB7 A;  3TSZ A;  4NL2 A;  1V1C A;  4JUV A;  1Y96 B;  3M55 A;  1VQL Q;  7AT1 B;  2FPF A;  1OV3 A;  1PSE A;  3JV3 A;  4NS5 A;  4FM4 B;  3MPU B;  1RAB B;  5A2Q E;  2V1R A;  2DXC A;  5CKH A;  4KUD K;  1Y07 A;  2LX9 A;  4IUQ A;  2CP5 A;  4M7D E;  3QO3 A;  1TWB A;  5KE2 A;  3BFM A;  5KYN A;  4X9C A;  3GP8 A;  1SRL A;  1N5Z A;  1UDL A;  4J9F A;  1TTH B;  2EGE A;  1XNI A;  4DBR A;  5IT9 E;  4J9C A;  1M90 U;  4BDY A;  2MWO A;  2SEM A;  4C92 D;  4N4H A;  1ZBJ A;  1ZSZ B;  1MV3 A;  1BIA A;  2ZCF B;  5DLO A;  4FYY B;  1KD1 U;  4M7A D;  3X25 B;  3MET A;  1LVK A;  1JJ2 S;  2AKL A;  1M27 C;  1BI3 A;  1Y0M A;  3MEU A;  1VQ4 Q;  2J05 A;  1U1T A;  1ZQ1 A;  3M4G A;  4JRI A;  3QBY A;  2YHT A;  3L2R A;  1E6G A;  1TSF A;  3JCM V;  2P0Q A;  3AT1 B;  5GAO m;  2DL4 A;  2E1H A;  4A54 A;  4PJO B;  2BTT A;  4D6W A;  4E7K A;  2XMF A;  1NYG A;  1VQP Q;  5LJ5 h;  2DRM A;  5CK9 A;  2RI5 A;  1X6O A;  4O6J A;  2L2P A;  3TEE A;  3LH5 A;  1C6V X;  3I55 T;  2X4Y A;  4F7U G;  3I56 Q;  1QWF A;  2F2X A;  2C0I A;  2X4W A;  3A8G B;  4FSS A;  3OS0 A;  4FYX B;  2RQT A;  4LUE A;  1K8A C;  1JBM A;  4RTX A;  3MP1 A;  2KGT A;  4L6V 5;  4Z89 A;  2E5Q A;  3HFO A;  2YUQ A;  2GTO A;  4C5E A;  3FJP A;  4J6W A;  5LJ3 h;  5KYW B;  2E12 A;  1QW1 A;  1M5Q 1;  1YJW T;  4BAC A;  4ATO A;  3QKJ A;  3PVQ A;  4L5G A;  4N0A C;  5L8R E;  3RMS A;  4C5H A;  2RQW A;  1D0X A;  1N9R A;  4AFQ C;  5KCH A;  3UT1 A;  1IHV A;  2HZY A;  3PMI A;  5KH6 A;  3EGX A;  3JCM J;  1QVG P;  2HBP A;  3CC2 A;  4C0Z A;  1OZ3 A;  5A0G A;  5GMK m;  1UJY A;  5GAM f;  1BU1 A;  2J6O A;  3EH2 A;  2ED1 A;  3NPF A;  1H64 1;  3L42 A;  2YRC A;  1EFN A;  2CUB A;  1I8F A;  1V76 A;  4ELY C;  1BI1 A;  1SF9 A;  3OMC A;  2VXF A;  3CCS T;  4FSX A;  1RLP C;  2NWM A;  5IHK A;  3CCM Q;  2X4J A;  3M4Y A;  5EC7 A;  3CCV Q;  1QVG A;  4IUP A;  3C0C A;  2YXY A;  4C0G A;  1K73 C;  1K8A U;  3CCJ A;  4XTX A;  5CVI A;  2KXD A;  4HVV A;  1Q7Y R;  1M8M A;  1XTD A;  3L2V A;  4DBF A;  2PU9 B;  2OAU A;  3SD4 A;  1W6X A;  4FIB A;  4IIO A;  4PK4 A;  3QHS A;  1TS9 A;  3M0Q A;  2ZGW A;  2SRC A;  1VQ8 T;  3CBP A;  1J3T A;  2DL5 A;  3EG2 A;  1MHN A;  3HTR A;  3SHW A;  2FO0 A;  2DM1 A;  5CCA A;  6AT1 B;  3BDL A;  1BIB A;  2ZPB B;  1JJ2 P;  1Y57 A;  4EMK B;  4J7I A;  1YIT Q;  3HRU A;  3CMA T;  1JB0 E;  2V8J A;  2X3X D;  3CPW S;  5KYX A;  1B07 A;  1PNJ A;  2LCC A;  4J8O A;  3FJ5 A;  1NLO C;  3GPL A;  3CCJ Q;  2K79 A;  4XTU A;  1GBR A;  2L8D A;  2BUD A;  1S72 A;  1VQ9 A;  2VWF A;  3MKD A;  1LOJ A;  3INZ A;  3LLR A;  4M7D B;  3CME T;  5I2M A;  1OUL A;  3R6O A;  2E3H A;  4M75 G;  3ZEH A;  3H0F A;  2PVO B;  4ZGD B;  2F5T X;  1Z9Q A;  2JVV A;  1JJ2 A;  2CP2 A;  1MGQ A;  4IUT A;  4J9E A;  5GAN g;  3G71 T;  1WDX A;  2R5M A;  1LCK A;  2DL7 A;  1K73 U;  3L2W A;  4MZM A;  1GCQ A;  2HL5 C;  1M30 A;  1P92 A;  3JRZ A;  1D1C A;  1OX9 A;  2BE9 B;  2R5A A;  4PJO F;  3M0R A;  5GAN 8;  2RJF A;  3RR6 A;  2RB6 A;  2JUF A;  2YRD A;  5CKF A;  1CKB A;  1S72 Q;  2DTI A;  1VQ9 Q;  2Y4X A;  1WJQ A;  3OA6 A;  2MAM A;  2YLC A;  2B8A A;  1X2Q A;  2DF6 A;  2XI9 A;  2DNU A;  2K2V A;  2QAZ A;  1CSK A;  1M1G A;  3DKM A;  4WF2 A;  1WJR A;  2W10 A;  2BZX A;  2YUN A;  1N8R R;  3QJ6 A;  2DEQ A;  1PWT A;  3QG1 A;  3VUZ A;  3VS5 A;  2XDB A;  1HYO A;  2IIM A;  2KRO A;  2K5I A;  1TH7 A;  1X01 A;  3OYN A;  1KFZ A;  3G1J A;  2JMA A;  4J6X A;  1M1F A;  4LDV A;  2BE7 D;  3DB4 A;  3MP6 A;  4D8K A;  4M78 B;  3I5S A;  5GAM h;  2K5L A;  2QA4 A;  2GFA A;  2EJ9 A;  4C8Q B;  2RHX A;  3MP8 A;  3TRE A;  1QVF S;  3VV0 A;  1EIF A;  1AEY A;  1NJI C;  2XK0 A;  4M4Z A;  4CC2 A;  1KHC A;  4RMO A;  1WNL A;  3RER A;  4HCC A;  2LRQ A;  3OYE A;  2KT8 A;  5GAO q;  1ZBX A;  1PKS A;  3G4S A;  3L2Q A;  4ME7 A;  5FLX E;  3C12 A;  4PJM A;  2Y4Y A;  1S1N A;  1VYV A;  2H8H A;  2QGF B;  1K9M R;  4M77 G;  2QA4 Q;  1HK9 A;  4FT4 A;  3CC2 T;  1PRM C;  3S3M A;  2DTO A;  1WHL A;  4F7U A;  4XU1 A;  3CPW P;  3G7Z A;  3JAM E;  2O4X B;  1AVZ C;  3MEA A;  1PRL C;  1W2B A;  3SEM A;  4J9I A;  1G2B A;  4PJO D;  1C1A A;  3QZ5 B;  2C06 A;  1Y96 A;  2PZ1 A;  4NOY A;  2K9G A;  1SSH A;  2ATC B;  2CRE A;  1NEB A;  2J7I A;  1SHF A;  2RJD A;  4P5N A;  4OML A;  2D0Q B;  4E7J A;  4M7D C;  1WIE A;  3CCQ T;  4MMK A;  1VQ5 A;  3CPW A;  5GJW B;  4F7U E;  5FWC A;  4M7D F;  4PJJ A;  1TU0 B;  2GFU A;  1YIJ Q;  3OQ5 A;  1IO6 A;  2COW A;  2LC4 A;  5HY6 A;  2EWN A;  4N4G A;  5DY9 A;  2MIO A;  3G6E A;  2F69 A;  1MV0 B;  1UGQ B;  1VIE A;  1VYT A;  2EQI A;  3MJX A;  2M02 A;  3JB9 G;  4C0F A;  1E7O A;  2ZPI B;  2XD0 A;  5AT1 B;  3LW5 E;  4A4G A;  3OS2 A;  1IHW A;  3EG3 A;  2MWP A;  3PVL A;  1YJ9 T;  1WGS A;  5C0M A;  2K4Y A;  5LJ5 g;  3U23 A;  2JM8 A;  1G3Y A;  1JU5 C;  2COZ A;  2QEX A;  4C92 G;  3R6N A;  3X20 B;  2CUD A;  3PGG A;  2PTK A;  2RQV A;  3PIP A;  2MPX C;  4M7A G;  5A0D A;  5GAN 4;  2MF2 A;  1R8O B;  1NPP A;  3GF5 A;  5CAI A;  4GY5 A;  2LQK A;  4R0K A;  4OMO A;  2R58 A;  1S72 T;  2E4H A;  2L0A A;  1GFD A;  2F5K A;  1DJ7 B;  3S3N A;  5KYY B;  4ELZ C;  2WSC E;  3FEO A;  1QCF A;  3VRY A;  4FCY A;  2DET A;  1VQN T;  3M0P A;  4OB2 B;  4YTL A;  3JCM W;  3VJP A;  4TVR A;  3REA B;  1WHK A;  1B7T A;  2DYB A;  1GCP A;  2NUP B;  1RI0 A;  1PHT A;  1I0C A;  2LMJ A;  1NLP C;  4V2S A;  2Y90 A;  4M78 F;  4JDS A;  4QQ6 A;  2J6K A;  4FW1 A;  2COY A;  2EQU A;  3JB9 F;  4IKF A;  3EG9 B;  2FYK A;  2GCX A;  4C8Q F; 
#chains in the Genus database with same CATH homology
 1VQ4 Q;  3CCS Q;  3CCV Q;  2QA4 Q;  1VQP Q;  3G71 Q;  1M90 R;  1K8A R;  2OTL Q;  3CCU Q;  3CPW P;  1Q81 R;  1W2B P;  3CCE Q;  1QVF P;  3G6E Q;  1VQO Q;  1VQL Q;  1NJI R;  3CC2 Q;  1VQN Q;  1N8R R;  3CD6 Q;  1VQM Q;  1KC8 R;  3CCQ Q;  1VQK Q;  1M1K R;  1VQ8 Q;  3I56 Q;  3CC4 Q;  1YI2 Q;  1KD1 R;  1JJ2 P;  1Q7Y R;  3CXC P;  3CME Q;  1KQS P;  1YIT Q;  1YHQ Q;  1S72 Q;  1VQ9 Q;  1YIJ Q;  1YJ9 Q;  3I55 Q;  3CC7 Q;  1YJW Q;  1VQ5 Q;  1Q82 R;  1K73 R;  1K9M R;  1VQ6 Q;  3OW2 P;  2OTJ Q;  1YJN Q;  3CCR Q;  1QVG P;  3CMA Q;  3CCJ Q;  1VQ7 Q;  3CCM Q;  1Q86 R;  2QEX Q;  3G4S Q;  3CCL Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...