3CC7Q

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2487u
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3cc7Q00
1YI2Q 3G4SQ 3CCVQ 1VQ7Q 3I55Q 1Q7YR 2OTJQ 1NJIR 3CMEQ 1YJNQ 1JJ2P 1M1KR 1YJ9Q 1VQMQ 1VQOQ 3OW2P 1Q86R 1QVFP 1YJWQ 1VQ4Q 1VQ5Q 1VQKQ 1VQ9Q 3CC2Q 3CCLQ 3CCEQ 1VQ8Q 3CPWP 3CC4Q 3CCJQ 3CCQQ 1YHQQ 1K73R 1K8AR 3G71Q 2QEXQ 1VQNQ 3CCMQ 1VQPQ 1VQLQ 1YITQ 1Q81R 1VQ6Q 3CD6Q 1S72Q 3CCRQ 3CMAQ 1KQSP 2QA4Q 3CCSQ 3CC7Q 1QVGP 1KD1R 3G6EQ 1KC8R 1N8RR 1W2BP 1K9MR 1M90R 3CCUQ 3CXCP 3I56Q 1YIJQ 2OTLQ 1Q82R
chains in the Genus database with same CATH superfamily
2F2WA 3M59A 2RB6A 1AZGB 4M77E 1X2KA 1TXQA 1VQMQ 2K5LA 1TUGB 1K1ZA 2DL8A 2SEMA 3L2RA 2E64A 1PSEA 4KUIA 3X26B 2CP2A 1OU8A 1FMVA 5GMKl 4CC2A 2VASA 2EWNA 2AT1B 1X6BA 1CSKA 5LJ3f 2HNIA 3EGXA 2RA2A 4QQDA 5LJ3g 3EG0A 2L2PA 2ED0A 3EGXB 2RK1A 1X43A 2MMPA 1OX8A 1GCQA 1UG1A 2KE9A 1K0XA 2R5AA 1VQ4Q 5GAOn 4DBRA 2V1QA 1YHQQ 3EFOB 3KXTA 4JJBA 2YUPA 3I55T 1NM7A 4AG2C 4JRQA 2C06A 1G3YA 4K11A 4J6WA 3CCLT 4J5YA 2RK2A 4AG1C 2DL5A 4OF1A 2EQJA 2FB7A 4OMQA 2VXEA 5KYUA 4F7UF 2AKLA 1M4ZA 3JCMd 5KYUB 2QGGA 5HK3A 2K2MA 4CC7A 1WHGA 2QYZA 1QCOA 4OMOA 3GPLA 2WACA 3CMET 2GQIA 1BIBA 1N8RR 1SG5A 4BDYA 1ZBJA 4LUEA 1VQ8T 3MP6A 2RQTA 1NJIU 4ZN1A 2DYBA 2ZPIB 2LRQA 3JAME 3CCEA 2KGTA 3EG1A 1WHJA 2M9UA 3AT1B 5KYNA 4M75F 1U3OA 3BFMA 5IT9E 3CCRA 2I0NA 3RESA 1PD1A 1H3HA 2RQRA 3OY9A 3ULRB 2H8HA 2RJDA 5IHNA 4EDUA 1YJNA 1VQNQ 2MYSA 2HBPA 4M4ZA 2L3PA 1ZUUA 2E6NA 3CQTA 2NWMA 3F70A 4XTUA 4IUPA 2X51A 4RTUA 4HVWA 3TSZA 5DLQE 2KRMA 1WDXA 3CC7Q 4WF2A 4ZTJA 4M7DG 1KQSA 3C94A 3OW2S 1UGVA 5IHIA 3JCMh 4RTWA 3RMSA 2D8JA 1VYTA 3CXCA 2E65A 1MMAA 4ZN3A 2V8JA 4A4KA 2LVMA 2CSQA 3EAEA 2A0FB 3FRNA 4M7DE 2WSFE 2ABLA 3VS5A 1KD1U 3NPFA 1XNIA 3E9FA 3EG3A 3EHQA 5D6YA 1KQ1A 3LGFA 2GQVA 4YTLA 1S72T 4J7IA 2EQKA 3CMAT 3E2UA 4KH1B 3UA7A 1S1NA 4R0KA 4QQ6A 1OZ2A 2E6ZA 8AT1B 5FU7C 4Y28E 2R57A 1NJIC 1G2BA 2FYKA 4PJNA 1IGUA 2EQUA 4X9CA 5AT1B 4XAXB 1JJ2S 1QLYA 3MO8A 2HMAA 4JZ3A 2OTJQ 1KHCA 2E3IA 5GANe 3G71T 2DEUA 3SWNA 1PCXA 2F69A 2LX7A 2JS0A 3SWNB 5GMKh 1E6HA 4C8QC 2MIOA 1QP2A 1NZ9A 3VYHB 4GLMA 2C0OA 1WXUA 2DD5A 2XG8D 1K9MR 3CCVA 5AYFA 3V7RA 1JXMA 3O5ZA 1YIJQ 1N27A 2YLCA 4L6V5 3LYIA 2EBPA 2P0KA 3OW2P 2A08A 1VQKQ 4PJOF 1PNJA 2HSPA 2JN0A 1AD5A 3OYEA 2M0YA 4FYVB 4PJLA 1YITQ 4KH0B 2BZYA 3I56T 2C0IA 4HCKA 2CH4A 3QKJA 2JTFA 4M78G 1JU5C 5CQXA 1ABOA 4HVVA 4OVAA 1X75C 2CS7A 4FSXA 3UA6A 1YI2Q 4E7HA 1VQPT 1W2BA 2KNBB 3X28B 4C92E 3CC4A 1QWFA 1KD1C 1C1AA 4FW1A 4DEXA 2K5IA 2CDTA 3PT9A 4E7ZA 3G6EA 2P84A 1NG2A 3V7SA 2KK4A 1ZSZA 1KC8U 4Y92A 1Q82R 3CCQT 1ZSZB 1JJ2P 3X20B 3CC2Q 1VQ9Q 5GAN7 4Q5WA 3CD6A 2KSSA 1RAIB 4MZTA 2KT8A 3SD4A 1SSFA 5CKFA 4HKEA 4XTYA 2PVDB 4FU6A 2E1HA 3QO3A 2A7YA 1OX9A 2E5KA 4E7JA 1K8AR 2O88A 4JJDA 2DBMA 2IIMA 1BI0A 1V1CA 5GAN4 3M57A 4XTXA 2A37A 3JB9H 5KYYB 2SRCA 2Y4XA 3QSUA 2CYZB 2LDMA 1QVPA 2RM4A 3H0IA 2VV5A 2EKOA 4XTVA 3M54A 3QG1A 2Y4YA 1R8OB 4LDXA 2CP0A 4BDZA 2QI2A 5FU6C 4E6RA 5FU7B 4JLGA 2KYBA 1J3TA 3IQLA 1Q7YC 2IG0A 5CKDA 1BI3A 1LPLA 5GMKe 4C92C 1M2VA 3CBOA 5IH2A 3JCMX 3CCSQ 3RBBB 1M2VB 4JS4A 5GMKi 3O8VA 4HCBA 2CP6A 3S3OA 3OSVA 1TH7A 1YJ9Q 3X25B 1YJWQ 1PM3A 3JB9D 3OBWA 1EZZB 3ZFJA 1N8RC 2JT4A 3QZ5B 1VQ6A 4R55A 5DM7R 2VXFA 1XOVA 2EQMA 2GFAA 3CXCS 2AIRB 1GCPA 5CR2A 2QA4Q 2PQWA 4X9DA 3M0UA 3CCUQ 4M7AD 4B9WA 2MF2A 1WHLA 2RHXA 1OZ3A 3G1JA 3RMQA 2O9SA 2QQSA 2CZ6B 1MMNA 2D0NA 3KFVA 3A8OB 1WHHA 2K3YA 4JS5A 3VS1A 4HT9A 3C0CA 2FPEA 3N5BB 4KGVB 1K9MU 1TTHB 1RL2A 1VQKT 1E6GA 2FVUA 3L2WA 2AKKA 2EYWA 1LVKA 1M1KU 1AHJB 1NEBA 5C6SA 3M58A 1TUCA 1YNZA 2RQUA 5KE3A 4CRIA 2F2XA 2NUZA 2H3EB 4HVUA 4BE0A 4J7FA 2YSQA 2YHTA 2JTEA 4BE2A 1X6GA 2VVKA 1MV3A 3OYKA 4XU1A 2MPXC 4QVCA 3RUXA 4A4FA 3I55Q 4ZNXA 2JUFA 3CCLQ 1BKBA 2V1RA 1V29B 2YRVA 4PJJA 1RLQC 4C8QF 2GGRA 2QAZA 1JXOA 2X3XD 1XQHA 5LL6S 4Y91A 4M7AA 2KQWA 2XDDA 5IN1A 3OYGA 4PK4A 4M7AB 1BI2A 2MOXA 2O4XA 2D9TA 3G4SA 5EC7A 4HCZA 3EFRA 5I22A 5FRMA 4MDXA 4N4GA 5IHKA 3CMEQ 5GAOl 5FWCA 2K7AA 1K4US 3OYJA 1YP5A 2PVOB 1GCQC 3FDRA 2EKHA 3VV0A 3OS2A 1VQ8Q 4E7SA 1HYOA 3EG9A 1P92A 3INZA 5EG2A 2DD4A 2YUOA 1W2BS 1M5Q1 3EG9B 1VYUA 1Y71A 1GL5A 2YUQA 2RJFA 1M90R 2DYIA 1WHKA 1N6AA 2RJEA 4M7DF 2DFUA 2KAFA 1SRMA 5KCHA 1IGQA 3PFSA 4FW2A 2JS2A 4FYYB 5GAMd 2O2OA 2DRMA 4C0DB 3JB9I 1UHFA 4HXJA 3TSWA 4OMLA 4ME7A 4XTZA 1R77A 2LP5A 4JLIA 1GFDA 3MEAA 1D0XA 4L59A 2MAMA 1VQ5A 5FRNA 1WZOA 2ROLA 3REAB 1NPRA 1KJWA 3A8HB 3CCMA 5KH6A 3FJ5A 3KBGA 4C0GA 1K0SA 1CKAA 2LJ1A 3OYDA 1HXDA 3MEVA 2L3SA 1MUZA 3MEWA 1GRIA 4EMKA 5J26A 1VQ7A 1OV3A 4Z88A 2XICA 3JCMf 4F7UA 3JCMV 3I35A 3QHSA 4LN2A 4PNOA 3JCMg 4EMKB 1BK2A 1F1BB 4F7UB 4XK8E 2EPDA 1TS9A 3VS0A 5LJ5d 1SSHA 2LCLA 1Q82C 2EIFA 4FT4A 1S72Q 1VIEA 1YN8A 2L0AA 1RAFB 3MP1A 4V2SA 5GAMh 3SHWA 2LC4A 3EH1A 1HJDA 5C0MA 3OA6A 2NUTA 2RHUA 1FMWA 4M75B 2LCSA 2RI2A 1QCNA 4TVRA 3RDVA 2OI3A 4II1A 1JO8A 1ZBXA 2NUTB 3G71Q 3CEYA 4OB3B 4D8DA 3V8LA 1T3LA 4C92F 4XU3A 3THKA 1Y07A 3FJPA 2HQXA 2YUNA 3M9QA 2EFIA 2E10A 1K8AC 1RAEB 3CCET 5I2SA 1M1FA 4IUUA 3ZEHA 3CCRT 3EFOA 3CCJA 3OYCA 1GFCA 2CUDA 2QEXA 1U5SA 3OS0A 3LGLA 4NL3A 3GIBA 1UGRB 3NFCA 4BY6C 4ELZC 2CUBA 1ARKA 4JRIA 1YJNT 5J3BA 1H3ZA 2OTLA 1ZA1B 1V76A 3UDCA 3I56Q 3H41A 1O9SA 2L3QA 2V8KA 1Q7YR 1QVGA 1VUBA 4N0AC 5LJ5h 3MHXA 4GY5A 4NOYA 3NMZC 3MJXA 4BI3A 1BCMA 2LJ0A 5I21A 5HK0A 1A0NB 3TVTA 3PMTA 1VQPQ 1WJSA 1YFNA 2M51A 2BE7D 2D1XA 4QW2A 2D0QB 5GAN5 4NS5A 3V7CA 1MNDA 1PHTA 3LWHA 4BACA 2PZ1A 2DETA 1JB0E 2QK0A 3GLXA 3LLRA 3OB9A 3HFNA 1W6XA 2YLBA 4LDUA 2DPPB 3E9GA 4AFQC 1GXIE 3CCQQ 2LQ8A 4M77C 1NLPC 3VUBA 1NYFA 4BB7A 5GAMj 1UGSB 3C95A 1W70A 4JUVA 4KRTA 2DJQA 1VQLA 1M90U 1Q81C 2COWA 2H3JA 1Q86R 1PSFA 4MZPA 3JCMb 5I2MA 5FLXE 2PU9B 1Y0MA 1E7OA 2GBQA 2K5FA 2CZ1B 4DBFA 3C4SA 5LJ3d 2Z0WA 1H641 1ZX6A 4PJOB 5GAMe 4KBMB 3M4GA 5CIUA 3E19A 3FB9A 4A63B 1BU1A 2ATCB 5CKBA 1QVFA 1JEGA 1M3AA 3VS2A 3OMGA 2VGNA 3I5RA 2ZPHB 3CCVT 1B3QA 3URGA 2G6FX 3C12A 3WVDB 2YXYA 2XDPA 4CC3A 5LJ5j 2FG0A 1ZUYA 2M02A 2JNGA 3CPWS 2YRCA 3QBYA 1AEYA 1G3SA 3QDFA 1OQKA 2VC8A 4ATOA 4J6XA 1Q95G 1RAGB 2C0TA 4DOWA 3M0RA 3NTHA 2JMAA 4E7LA 2ED1A 2XKOC 2VUBA 3DB3A 1RUWA 2QASA 3JB9G 5HKCA 1M8VA 4FT2A 4J9CA 1VQOA 3CC4T 4ORZA 2ENMA 3VS3A 4XU0A 2LJ3A 5CKHA 2FPDA 3QYHB 2RI3A 4AFZC 5LJ5e 1M90C 2E4HA 3VKIA 3DLMA 4ZGEB 2NUPA 4M7AG 2PVGB 2XK0A 4LE9A 4DEYA 4XQ3A 4ZGDB 3J80E 2DZCA 2NUPB 2A28A 2VGMA 3VU3C 1WQ7A 1M8MA 1B34B 3HKSA 1O75A 2XHCA 5D7UA 2WSEE 3MEUA 4IUVA 4F16A 1M27C 4JRKA 3CD6T 5CVIA 1IRXA 1M3BA 3VS7A 4QQGA 3L2QA 2K6DA 1OPLA 3PVLA 3J81E 4JPBW 1QWEA 4FYXB 1WGSA 2FZCB 2DLPA 2LX9A 1PD0A 1Q7YU 4M7DC 1ZSGA 2E3HA 4WCIA 4AMCA 2LQWA 2R58A 3LWIA 3CPWP 2LQNA 2JM9A 3CMAA 3QYGB 4Z02A 2HL3A 4M78E 1OOTA 1NPPA 3RNJA 1PG5B 2DM1A 4LD9K 4PLLA 4PKCC 2JMCA 1N8RU 3A98A 2PUKB 1U06A 1U1TA 4RCBA 2LTOA 1VQMA 2RQWA 2RD1A 1WXBA 3AHUA 3QUIA 3HSBA 2DJZA 2Y90A 2OX7A 3X24B 3JCMe 1UGPB 1UB4A 2DTIA 4C8QD 1C0MA 1SF9A 1U8RA 1T0JA 4Z89A 5GJVB 3P8BB 4GLKA 4F7UG 1CKBA 1VQ4A 4Z8AA 3EG2A 3LX7A 3S3NA 2X9HA 1OEBA 1VQ6T 1YHQA 5LJ3j 1LNXA 2LCCA 5KYYA 2B86A 4EMHA 3HPWA 3M0PA 3L2UA 2J7IA 4F7UE 4AFUC 1C6VX 2DNUA 2J05A 5J39A 2XU8A 1WXTA 2EYZA 4OP0A 3A8GB 1D1BA 3SDZA 1R0CB 4NL2A 4M77F 3OYLA 1QQJA 3A8MB 1MHNA 2DXTA 1IHWA 1WIEA 2QDLA 4OB0B 5L8RE 1QW1A 5A0GA 1X2QA 1HSQA 3A1PA 5FW9A 4B9XA 1WHMA 1QP3A 4RUGA 2ECZA 4LDYA 4M78C 1I0CA 4C8QA 4F14A 3OYMA 1Z9QA 4OB2B 2F2VA 4C8QB 2ZPEB 1M30A 4HT8A 1KQSS 4F17A 2KR3A 1K73R 4RCCA 5CO7A 1EFNA 1H8KA 2ZPGB 5GAN8 1UHCA 1VQNA 2X4XA 1QVFS 1PWTA 2FEIA 4X34A 5DY9A 2DIGA 1FXXA 2W0ZA 3LH0A 3EGDB 4KGXB 2JOYA 2V26A 5A2QE 2MI6A 3QWYA 3RIRA 2BZXA 1VOMA 2NLUA 2RMOA 3META 4J9IA 1TU0B 1JBMA 2F5KA 2X4JA 2X3WD 1Q81R 4O6JA 1QCFA 3CC7A 2CZ0B 3G4ST 1Q86C 2RI5A 1RADB 2CT4A 2QG9B 2ZAEA 2DEQA 5GAMf 5GAMg 4M7DB 4OB1B 1PRMC 1D0YA 3HRSA 2JZ2A 2M0OA 3RERA 4C5GA 3CCEQ 3QXEB 3DB4A 2DK3A 1VA7A 3CCRQ 3TEEA 2ZPFB 4C92D 5HCKA 1M2OA 4EPCA 3OQ5A 5IXFA 2EYYA 1WJQA 2DZ9A 2J6OA 5IAYA 2VKNA 2GTJA 1YJNQ 2AK5A 3GP8A 2P4RA 1SRLA 1TUDA 3M4YA 2DVJA 4BE1A 2CT3A 1ABQA 1KQSP 3HHTB 2DVEA 2XD0A 2FRYA 3SB2A 1FMKA 1RAAB 2L5QA 1VQ5T 4HCCA 2AZSA 2JM8A 2OTJA 1EX4A 2KEAA 3CXCP 5FWBA 3OSSC 4LDWA 2YWWA 3PIOA 1Q82U 1GBRA 5LJ5f 3PNWC 4CI0C 1AT1B 3CCMT 1QVFP 5LJ5g 2QQBA 2DF6A 2DL7A 1PKTA 3QDRB 3JCMW 3GOXA 4PLIA 2E41A 2HD0A 1N5ZA 2EJ9A 2ZZDA 1VQ7T 2CH4W 2JTMA 5A0LA 4ZGJB 4IUTA 1YIJA 2FO0A 3ER0A 4BUGA 1VQKA 3RKYA 1WYXA 1IXDA 5FU6B 1YWPA 2VB6A 3MPUB 3EGUA 4C92A 4OGCA 1YITA 2ZCFB 1K8AU 4C92B 4M75D 4DBHA 2HSEB 1TG0A 2WSCE 1WJRA 1B07A 4OMNA 1KQ2A 1YI2A 4J8OA 1I07A 1DJ7B 1AWOA 1ZA2B 2EQIA 3PGGA 3VRZA 2LNHB 3WVEB 4EIKA 8ATCB 1UJ0A 4MDWA 3VS6A 1AOJA 1HK9A 2KDSA 1PKSA 4IIOA 3M53A 4J9GA 4KGZB 3QJ6A 1UJYA 3GBQA 4X1VA 4PJMA 2EGCA 2OAWA 2J6FA 2QQAA 2KYMA 4ZTFA 1M3CA 2FZKB 4WTOB 4D8KA 5GMKm 4IIMA 3JCMP 3CCJT 3CCVQ 2O9VA 3JB9F 3CC2A 1VQ9A 2QEXT 2YT6A 2PNIA 1WQWA 3PTAA 3NHNA 2HAXA 3PE0A 2RO0A 3M0SA 1H92A 4JDSA 1Y57A 2OTLT 1OPKA 4RTYA 2G3RA 4MMLA 3I5SA 2XMFA 1QKXA 4LD6A 4DA4A 1W2BP 2BIVA 4F04B 1QMCA 3TU4K 4M75A 4FSSA 5GANd 2XDBA 1M9SA 3PVQA 3UF4A 1ACMB 3CC4Q 2LT4A 3OYIA 4UC4A 1Q81U 1AZEA 1UEBA 1WA7A 1U1SA 3L42A 4VUBA 2A3LA 2P0PA 3D7SB 4J9DA 3G6EQ 2HZYA 3JV3A 3GNFB 1G83A 2VWFA 4M78F 3P8DA 3BE3A 3H0FA 4RTTA 2HKQB 4JRPA 2V8IA 3TREA 2F1LA 1TSFA 4RG8A 4XTWA 1VQLT 3CD6Q 3CCSA 1LCKA 5A0DA 1LOJA 2QGFB 2RNAA 3FC3A 4A4EA 5CK9A 1UE9A 2MWOA 2OJ2A 1YJ9A 4HA8A 3FIFA 1YJWA 1OULA 4MMKA 3BDUA 3G7ZA 3HRUA 2K3XA 2HQEA 1X6OA 4PJOD 3OMCA 3JRZA 3SWNC 2DXBA 2KRNA 4GBQA 3REBB 3VRYA 4A4HA 2QA4A 3CCUA 5GANh 1K73C 4C5IA 3UPUA 2ROTA 5GAN6 1B7TA 4J9BA 3UWNA 1BIAA 1HD3A 3EH2A 5KCOA 3SEMA 2J06A 4DBQA 2DBKA 1RABB 1UFFA 4JZ4A 1D3BA 2AHJB 2I2LA 2QQRA 1D3BB 2ESWA 1KC8R 3BY7A 3OYAA 3S6WA 4C8QG 3M56A 1R0BG 4QVZA 4OMMA 2CREA 2CGHA 1AWJA 5KE2A 1VQ6Q 1M1GA 1UUEA 2J6KA 2DIQA 4AT1B 2RPNA 4FCYA 1VQOT 1I8FA 1N9SA 3R6OA 4QKUA 1WX6A 3I55A 4C8QE 4PJOA 2RHIA 3HL8A 3CCLA 2YRDA 1ZSZC 4FL6A 4N4IA 1AWXA 2MCNA 4KULA 1XJWB 2LQKA 4PFOA 3H8ZA 3JCMc 1BB9A 3OYHA 2K3BA 9ATCB 5CAIA 1IB8A 4C0ZA 1X69A 4KT0E 3CMEA 3OYNA 5GAOr 5GAN2 1VQ8A 4QVDA 2DKGA 1OYXA 1NE8A 2NYSA 3EFSA 1NLOC 1Y96A 4ANJA 3PIPA 3E1SA 3H0HA 2PUOB 1KG1A 5GANj 4M77D 1RI9A 1Y96B 2QTVA 2KT1A 4E47A 3HRTA 3M0QA 4IURA 3OS5A 3QWXX 1G5VA 3ASKA 3TQ7P 4DQ2A 2XIDA 4ELYC 2AZVA 2EJGA 4AFSC 1IO6A 4RTXA 2DA9A 3A5ZB 4A4GA 4BY6B 2DX1A 1UDLA 1D1AA 3G6ET 2CZ7B 1WLPB 3OYYA 2PTKA 5LJ3h 2FPFA 4N0AA 1VQMT 3JB9J 1B34A 2RH2A 4A53A 1SHFA 3WXMB 3G4SQ 3Q1JA 1ZHIA 2DTOA 3RKWA 1K76A 2EAYA 2RJCA 2E5QA 4OMPA 4BI4A 2A36A 3UT1A 4M7AE 2X35A 1JQQA 2EGEA 4J6YA 7AT1B 4J9HA 1VQ4T 2JJ9A 1IHVA 1YHQT 1I81A 2MK5A 5D6XA 2CSIA 2DAQA 1M1KR 4DOVA 4M77A 2L8DA 4OGEA 3M0TA 2K2VA 2CP3A 3VS4A 4C92G 4M77B 2K57A 4XU2A 1S72A 2FRWA 1D09B 3QIIA 2XI9A 1WPYA 3JSCA 4PFZA 3MP8A 3NTIA 3T9NA 1TWBA 4N4HA 1NEGA 2B8AA 3QJYA 1VIFA 4E7KA 2BKDN 3DLLA 1AWWA 3EHRA 2IPOB 1FWZA 1VQ5Q 3R6NA 4J9FA 2DMOA 3G71A 1IREB 2OAUA 3OBYA 3CCMQ 1QVGS 3MKDA 2BTTA 1X27A 1RACB 2FZGB 3DKMA 3GNGA 5ECAA 2EGAA 2DTHA 3L1AA 1K9AA 4ESRA 2K9GA 3M55A 5IXBA 2DE0X 3CBMA 4C0FA 1D0ZA 3OS1A 1VQ7Q 2DXUA 4RG2A 3V8KA 2RHZA 1FYNA 1Q86U 2HKNA 1G3TA 1G3WA 2KROA 1KK7A 2BZ8A 3S3MA 2GTOA 1EIFA 2LMJA 1VQNT 1QKWA 1MMDA 1NBEB 3UATA 2KVQG 1BYMA 4FYWB 1PC0A 1PRLC 3I56A 3FEOA 4M7AC 6AT1B 2DXCA 1I5OB 3M5AA 5GMKj 1XTDA 2QDYB 4M75G 1SKUB 2E70A 4M7DD 1JRIA 1T0HA 1IZ6A 2BUDA 1VQPA 1NYGA 4BD3A 3CC7T 4KUDK 3BDLA 2FL7A 4D6WA 3BW1A 1X01A 4R56A 4E7IA 3HTRA 1RI0A 1UGQB 2M1HA 5DLOA 5LJ3e 2RQVA 5KYXA 2GCXA 1SPKA 4M75E 3LH5A 4C5HA 2D6FA 5KYXB 1TOVA 2O01E 2KBTA 3CCQA 3FLGA 3CCJQ 1UTIA 2DERA 4C0DC 2QEXQ 4LDVA 5KYWA 4IKFA 4RTVA 5CQYA 1YCSB 1GBQA 3V8JA 3TCJA 4CC4B 2LT1A 1QVGP 5KYWB 2QQ9A 4IUQA 5CCAA 2OTLQ 3EGDA 4QT7A 2EYQA 2GF7A 3RKXA 3NTKA 1OI1A 1W4SA 3GF5A 3HP9A 4E2FB 4RKUE 4RTZA 2EVRA 2LZ6B 1KC8C 1I1JA 4B6MA 2M16A 2DO3A 2K4YA 2JVVA 2OTJT 3OYFA 4M7DA 4P5NA 1VYVA 1BI1A 2DL3A 2RF0A 3H9NA 1ZLMA 4EMKC 5GAN3 2F5TX 1YWOA 1OU9A 1WFWA 4J83A 4LXCA 1YIJT 3SFMA 2HQHA 3J7AF 3VUZA 1KFZA 5GAOm 1YCYA 2RHYA 2KXCA 3CPFA 2X4YA 5L23A 5GAOp 1I5LA 5M9OA 4MZMA 4JJNK 4PFPA 3U23A 1VQLQ 3H6ZA 1MNEA 4M78D 2CP5A 3KUFA 1T3SA 4C5EA 1YITT 2CP7A 2YDLA 5GJWB 3NGPA 4M75C 2COZA 2COYA 5GAOq 3P8HA 2RN8A 1YI2T 1KIKA 2D8HA 2DILA 2JXBA 1ZQ1A 4PJOG 2KXDA 2DL4A 2QXFA 1SEMA 3QZ9B 2ZPBB 5CKEA 3ME9A 2P0QA 3RR6A 2JW4A 4PL6A 1MV0B 3QPHA 4FIBA 5GANf 5GANg 3CC2T 2KRSA 1VQ9T 4PJOE 2R5MA 1MGQA 2O4XB 2BE9B 3LW5E 1NJIR 3OYBA 5HY6A 2KY9A 2EW3A 1SHGA 3OW2A 1I4K1 2W10A 4M78A 1BBZA 2CKKA 1G8XA 2E12A 2L3RA 4M78B 2EJFA 3I9QA 4JJCA 4LUDA 1UECA 3VYGA 1VQOQ 3ZBDA 1K9MC 2L89A 2LNVA 1KSWA 1W1FA 3CPWA 4L5GA 1M1KC 4BI8B 5I11A 1RAHB 1WI7A 3L2VA 4RMOA 2HDAA 4J9EA 2IVWA 3CBPA 2HCKA 1FX7A 2KI7A 3PMIA 2ZGWA 3ZL7C 5FROA 1RLPC 2VYTA 3A8LB 3CCST 2GFUA 1JJ2A 1K73U 3JCMQ 3MCAB 1MMGA 2HBWA 3L2ZA 2O31A 5D6WA 1YJ9T 1KD1R 1YJWT 2P4TA 4M7AF 4OMFB 3VJPA 2X4WA 1LJOA 2DRKA 2K79A 1N9RA 1YBYA 3HFOA 4EMGA 2HL5C 2KMTA 2HEQA 4FM4B 4M77G 4PJOC 1Y7XA 1D1CA 4A54A 2GNCA 2QA4T 2EYXA 3JCMJ 3CCUT 1BCOA 2QTXA 3CMAQ 4LNPA 1KHIA 2FHDA 2MWPA 1ZUKA 1WNLA 1AVZC 1Z9ZA 4O5VA
chains in the Genus database with same CATH topology
1YI2Q 3G4SQ 3CCVQ 1VQ7Q 3I55Q 1Q7YR 2OTJQ 1NJIR 3CMEQ 1YJNQ 1JJ2P 1M1KR 1YJ9Q 1VQMQ 1VQOQ 3OW2P 1Q86R 1QVFP 1YJWQ 1VQ4Q 1VQ5Q 1VQKQ 1VQ9Q 3CC2Q 3CCLQ 3CCEQ 1VQ8Q 3CPWP 3CC4Q 3CCJQ 3CCQQ 1YHQQ 1K73R 1K8AR 3G71Q 2QEXQ 1VQNQ 3CCMQ 1VQPQ 1VQLQ 1YITQ 1Q81R 1VQ6Q 3CD6Q 1S72Q 3CCRQ 3CMAQ 1KQSP 2QA4Q 3CCSQ 3CC7Q 1QVGP 1KD1R 3G6EQ 1KC8R 1N8RR 1W2BP 1K9MR 1M90R 3CCUQ 3CXCP 3I56Q 1YIJQ 2OTLQ 1Q82R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 Q;  3G4S Q;  3CCV Q;  1VQ7 Q;  3I55 Q;  1Q7Y R;  2OTJ Q;  1NJI R;  3CME Q;  1YJN Q;  1JJ2 P;  1M1K R;  1YJ9 Q;  1VQM Q;  1VQO Q;  3OW2 P;  1Q86 R;  1QVF P;  1YJW Q;  1VQ4 Q;  1VQ5 Q;  1VQK Q;  1VQ9 Q;  3CC2 Q;  3CCL Q;  3CCE Q;  1VQ8 Q;  3CPW P;  3CC4 Q;  3CCJ Q;  3CCQ Q;  1YHQ Q;  1K73 R;  1K8A R;  3G71 Q;  2QEX Q;  1VQN Q;  3CCM Q;  1VQP Q;  1VQL Q;  1YIT Q;  1Q81 R;  1VQ6 Q;  3CD6 Q;  1S72 Q;  3CCR Q;  3CMA Q;  1KQS P;  2QA4 Q;  3CCS Q;  3CC7 Q;  1QVG P;  1KD1 R;  3G6E Q;  1KC8 R;  1N8R R;  1W2B P;  1K9M R;  1M90 R;  3CCU Q;  3CXC P;  3I56 Q;  1YIJ Q;  2OTL Q;  1Q82 R; 
#chains in the Genus database with same CATH topology
 2F2W A;  3M59 A;  2RB6 A;  1AZG B;  4M77 E;  1X2K A;  1TXQ A;  1VQM Q;  2K5L A;  1TUG B;  1K1Z A;  2DL8 A;  2SEM A;  3L2R A;  2E64 A;  1PSE A;  4KUI A;  3X26 B;  2CP2 A;  1OU8 A;  1FMV A;  5GMK l;  4CC2 A;  2VAS A;  2EWN A;  2AT1 B;  1X6B A;  1CSK A;  5LJ3 f;  2HNI A;  3EGX A;  2RA2 A;  4QQD A;  5LJ3 g;  3EG0 A;  2L2P A;  2ED0 A;  3EGX B;  2RK1 A;  1X43 A;  2MMP A;  1OX8 A;  1GCQ A;  1UG1 A;  2KE9 A;  1K0X A;  2R5A A;  1VQ4 Q;  5GAO n;  4DBR A;  2V1Q A;  1YHQ Q;  3EFO B;  3KXT A;  4JJB A;  2YUP A;  3I55 T;  1NM7 A;  4AG2 C;  4JRQ A;  2C06 A;  1G3Y A;  4K11 A;  4J6W A;  3CCL T;  4J5Y A;  2RK2 A;  4AG1 C;  2DL5 A;  4OF1 A;  2EQJ A;  2FB7 A;  4OMQ A;  2VXE A;  5KYU A;  4F7U F;  2AKL A;  1M4Z A;  3JCM d;  5KYU B;  2QGG A;  5HK3 A;  2K2M A;  4CC7 A;  1WHG A;  2QYZ A;  1QCO A;  4OMO A;  3GPL A;  2WAC A;  3CME T;  2GQI A;  1BIB A;  1N8R R;  1SG5 A;  4BDY A;  1ZBJ A;  4LUE A;  1VQ8 T;  3MP6 A;  2RQT A;  1NJI U;  4ZN1 A;  2DYB A;  2ZPI B;  2LRQ A;  3JAM E;  3CCE A;  2KGT A;  3EG1 A;  1WHJ A;  2M9U A;  3AT1 B;  5KYN A;  4M75 F;  1U3O A;  3BFM A;  5IT9 E;  3CCR A;  2I0N A;  3RES A;  1PD1 A;  1H3H A;  2RQR A;  3OY9 A;  3ULR B;  2H8H A;  2RJD A;  5IHN A;  4EDU A;  1YJN A;  1VQN Q;  2MYS A;  2HBP A;  4M4Z A;  2L3P A;  1ZUU A;  2E6N A;  3CQT A;  2NWM A;  3F70 A;  4XTU A;  4IUP A;  2X51 A;  4RTU A;  4HVW A;  3TSZ A;  5DLQ E;  2KRM A;  1WDX A;  3CC7 Q;  4WF2 A;  4ZTJ A;  4M7D G;  1KQS A;  3C94 A;  3OW2 S;  1UGV A;  5IHI A;  3JCM h;  4RTW A;  3RMS A;  2D8J A;  1VYT A;  3CXC A;  2E65 A;  1MMA A;  4ZN3 A;  2V8J A;  4A4K A;  2LVM A;  2CSQ A;  3EAE A;  2A0F B;  3FRN A;  4M7D E;  2WSF E;  2ABL A;  3VS5 A;  1KD1 U;  3NPF A;  1XNI A;  3E9F A;  3EG3 A;  3EHQ A;  5D6Y A;  1KQ1 A;  3LGF A;  2GQV A;  4YTL A;  1S72 T;  4J7I A;  2EQK A;  3CMA T;  3E2U A;  4KH1 B;  3UA7 A;  1S1N A;  4R0K A;  4QQ6 A;  1OZ2 A;  2E6Z A;  8AT1 B;  5FU7 C;  4Y28 E;  2R57 A;  1NJI C;  1G2B A;  2FYK A;  4PJN A;  1IGU A;  2EQU A;  4X9C A;  5AT1 B;  4XAX B;  1JJ2 S;  1QLY A;  3MO8 A;  2HMA A;  4JZ3 A;  2OTJ Q;  1KHC A;  2E3I A;  5GAN e;  3G71 T;  2DEU A;  3SWN A;  1PCX A;  2F69 A;  2LX7 A;  2JS0 A;  3SWN B;  5GMK h;  1E6H A;  4C8Q C;  2MIO A;  1QP2 A;  1NZ9 A;  3VYH B;  4GLM A;  2C0O A;  1WXU A;  2DD5 A;  2XG8 D;  1K9M R;  3CCV A;  5AYF A;  3V7R A;  1JXM A;  3O5Z A;  1YIJ Q;  1N27 A;  2YLC A;  4L6V 5;  3LYI A;  2EBP A;  2P0K A;  3OW2 P;  2A08 A;  1VQK Q;  4PJO F;  1PNJ A;  2HSP A;  2JN0 A;  1AD5 A;  3OYE A;  2M0Y A;  4FYV B;  4PJL A;  1YIT Q;  4KH0 B;  2BZY A;  3I56 T;  2C0I A;  4HCK A;  2CH4 A;  3QKJ A;  2JTF A;  4M78 G;  1JU5 C;  5CQX A;  1ABO A;  4HVV A;  4OVA A;  1X75 C;  2CS7 A;  4FSX A;  3UA6 A;  1YI2 Q;  4E7H A;  1VQP T;  1W2B A;  2KNB B;  3X28 B;  4C92 E;  3CC4 A;  1QWF A;  1KD1 C;  1C1A A;  4FW1 A;  4DEX A;  2K5I A;  2CDT A;  3PT9 A;  4E7Z A;  3G6E A;  2P84 A;  1NG2 A;  3V7S A;  2KK4 A;  1ZSZ A;  1KC8 U;  4Y92 A;  1Q82 R;  3CCQ T;  1ZSZ B;  1JJ2 P;  3X20 B;  3CC2 Q;  1VQ9 Q;  5GAN 7;  4Q5W A;  3CD6 A;  2KSS A;  1RAI B;  4MZT A;  2KT8 A;  3SD4 A;  1SSF A;  5CKF A;  4HKE A;  4XTY A;  2PVD B;  4FU6 A;  2E1H A;  3QO3 A;  2A7Y A;  1OX9 A;  2E5K A;  4E7J A;  1K8A R;  2O88 A;  4JJD A;  2DBM A;  2IIM A;  1BI0 A;  1V1C A;  5GAN 4;  3M57 A;  4XTX A;  2A37 A;  3JB9 H;  5KYY B;  2SRC A;  2Y4X A;  3QSU A;  2CYZ B;  2LDM A;  1QVP A;  2RM4 A;  3H0I A;  2VV5 A;  2EKO A;  4XTV A;  3M54 A;  3QG1 A;  2Y4Y A;  1R8O B;  4LDX A;  2CP0 A;  4BDZ A;  2QI2 A;  5FU6 C;  4E6R A;  5FU7 B;  4JLG A;  2KYB A;  1J3T A;  3IQL A;  1Q7Y C;  2IG0 A;  5CKD A;  1BI3 A;  1LPL A;  5GMK e;  4C92 C;  1M2V A;  3CBO A;  5IH2 A;  3JCM X;  3CCS Q;  3RBB B;  1M2V B;  4JS4 A;  5GMK i;  3O8V A;  4HCB A;  2CP6 A;  3S3O A;  3OSV A;  1TH7 A;  1YJ9 Q;  3X25 B;  1YJW Q;  1PM3 A;  3JB9 D;  3OBW A;  1EZZ B;  3ZFJ A;  1N8R C;  2JT4 A;  3QZ5 B;  1VQ6 A;  4R55 A;  5DM7 R;  2VXF A;  1XOV A;  2EQM A;  2GFA A;  3CXC S;  2AIR B;  1GCP A;  5CR2 A;  2QA4 Q;  2PQW A;  4X9D A;  3M0U A;  3CCU Q;  4M7A D;  4B9W A;  2MF2 A;  1WHL A;  2RHX A;  1OZ3 A;  3G1J A;  3RMQ A;  2O9S A;  2QQS A;  2CZ6 B;  1MMN A;  2D0N A;  3KFV A;  3A8O B;  1WHH A;  2K3Y A;  4JS5 A;  3VS1 A;  4HT9 A;  3C0C A;  2FPE A;  3N5B B;  4KGV B;  1K9M U;  1TTH B;  1RL2 A;  1VQK T;  1E6G A;  2FVU A;  3L2W A;  2AKK A;  2EYW A;  1LVK A;  1M1K U;  1AHJ B;  1NEB A;  5C6S A;  3M58 A;  1TUC A;  1YNZ A;  2RQU A;  5KE3 A;  4CRI A;  2F2X A;  2NUZ A;  2H3E B;  4HVU A;  4BE0 A;  4J7F A;  2YSQ A;  2YHT A;  2JTE A;  4BE2 A;  1X6G A;  2VVK A;  1MV3 A;  3OYK A;  4XU1 A;  2MPX C;  4QVC A;  3RUX A;  4A4F A;  3I55 Q;  4ZNX A;  2JUF A;  3CCL Q;  1BKB A;  2V1R A;  1V29 B;  2YRV A;  4PJJ A;  1RLQ C;  4C8Q F;  2GGR A;  2QAZ A;  1JXO A;  2X3X D;  1XQH A;  5LL6 S;  4Y91 A;  4M7A A;  2KQW A;  2XDD A;  5IN1 A;  3OYG A;  4PK4 A;  4M7A B;  1BI2 A;  2MOX A;  2O4X A;  2D9T A;  3G4S A;  5EC7 A;  4HCZ A;  3EFR A;  5I22 A;  5FRM A;  4MDX A;  4N4G A;  5IHK A;  3CME Q;  5GAO l;  5FWC A;  2K7A A;  1K4U S;  3OYJ A;  1YP5 A;  2PVO B;  1GCQ C;  3FDR A;  2EKH A;  3VV0 A;  3OS2 A;  1VQ8 Q;  4E7S A;  1HYO A;  3EG9 A;  1P92 A;  3INZ A;  5EG2 A;  2DD4 A;  2YUO A;  1W2B S;  1M5Q 1;  3EG9 B;  1VYU A;  1Y71 A;  1GL5 A;  2YUQ A;  2RJF A;  1M90 R;  2DYI A;  1WHK A;  1N6A A;  2RJE A;  4M7D F;  2DFU A;  2KAF A;  1SRM A;  5KCH A;  1IGQ A;  3PFS A;  4FW2 A;  2JS2 A;  4FYY B;  5GAM d;  2O2O A;  2DRM A;  4C0D B;  3JB9 I;  1UHF A;  4HXJ A;  3TSW A;  4OML A;  4ME7 A;  4XTZ A;  1R77 A;  2LP5 A;  4JLI A;  1GFD A;  3MEA A;  1D0X A;  4L59 A;  2MAM A;  1VQ5 A;  5FRN A;  1WZO A;  2ROL A;  3REA B;  1NPR A;  1KJW A;  3A8H B;  3CCM A;  5KH6 A;  3FJ5 A;  3KBG A;  4C0G A;  1K0S A;  1CKA A;  2LJ1 A;  3OYD A;  1HXD A;  3MEV A;  2L3S A;  1MUZ A;  3MEW A;  1GRI A;  4EMK A;  5J26 A;  1VQ7 A;  1OV3 A;  4Z88 A;  2XIC A;  3JCM f;  4F7U A;  3JCM V;  3I35 A;  3QHS A;  4LN2 A;  4PNO A;  3JCM g;  4EMK B;  1BK2 A;  1F1B B;  4F7U B;  4XK8 E;  2EPD A;  1TS9 A;  3VS0 A;  5LJ5 d;  1SSH A;  2LCL A;  1Q82 C;  2EIF A;  4FT4 A;  1S72 Q;  1VIE A;  1YN8 A;  2L0A A;  1RAF B;  3MP1 A;  4V2S A;  5GAM h;  3SHW A;  2LC4 A;  3EH1 A;  1HJD A;  5C0M A;  3OA6 A;  2NUT A;  2RHU A;  1FMW A;  4M75 B;  2LCS A;  2RI2 A;  1QCN A;  4TVR A;  3RDV A;  2OI3 A;  4II1 A;  1JO8 A;  1ZBX A;  2NUT B;  3G71 Q;  3CEY A;  4OB3 B;  4D8D A;  3V8L A;  1T3L A;  4C92 F;  4XU3 A;  3THK A;  1Y07 A;  3FJP A;  2HQX A;  2YUN A;  3M9Q A;  2EFI A;  2E10 A;  1K8A C;  1RAE B;  3CCE T;  5I2S A;  1M1F A;  4IUU A;  3ZEH A;  3CCR T;  3EFO A;  3CCJ A;  3OYC A;  1GFC A;  2CUD A;  2QEX A;  1U5S A;  3OS0 A;  3LGL A;  4NL3 A;  3GIB A;  1UGR B;  3NFC A;  4BY6 C;  4ELZ C;  2CUB A;  1ARK A;  4JRI A;  1YJN T;  5J3B A;  1H3Z A;  2OTL A;  1ZA1 B;  1V76 A;  3UDC A;  3I56 Q;  3H41 A;  1O9S A;  2L3Q A;  2V8K A;  1Q7Y R;  1QVG A;  1VUB A;  4N0A C;  5LJ5 h;  3MHX A;  4GY5 A;  4NOY A;  3NMZ C;  3MJX A;  4BI3 A;  1BCM A;  2LJ0 A;  5I21 A;  5HK0 A;  1A0N B;  3TVT A;  3PMT A;  1VQP Q;  1WJS A;  1YFN A;  2M51 A;  2BE7 D;  2D1X A;  4QW2 A;  2D0Q B;  5GAN 5;  4NS5 A;  3V7C A;  1MND A;  1PHT A;  3LWH A;  4BAC A;  2PZ1 A;  2DET A;  1JB0 E;  2QK0 A;  3GLX A;  3LLR A;  3OB9 A;  3HFN A;  1W6X A;  2YLB A;  4LDU A;  2DPP B;  3E9G A;  4AFQ C;  1GXI E;  3CCQ Q;  2LQ8 A;  4M77 C;  1NLP C;  3VUB A;  1NYF A;  4BB7 A;  5GAM j;  1UGS B;  3C95 A;  1W70 A;  4JUV A;  4KRT A;  2DJQ A;  1VQL A;  1M90 U;  1Q81 C;  2COW A;  2H3J A;  1Q86 R;  1PSF A;  4MZP A;  3JCM b;  5I2M A;  5FLX E;  2PU9 B;  1Y0M A;  1E7O A;  2GBQ A;  2K5F A;  2CZ1 B;  4DBF A;  3C4S A;  5LJ3 d;  2Z0W A;  1H64 1;  1ZX6 A;  4PJO B;  5GAM e;  4KBM B;  3M4G A;  5CIU A;  3E19 A;  3FB9 A;  4A63 B;  1BU1 A;  2ATC B;  5CKB A;  1QVF A;  1JEG A;  1M3A A;  3VS2 A;  3OMG A;  2VGN A;  3I5R A;  2ZPH B;  3CCV T;  1B3Q A;  3URG A;  2G6F X;  3C12 A;  3WVD B;  2YXY A;  2XDP A;  4CC3 A;  5LJ5 j;  2FG0 A;  1ZUY A;  2M02 A;  2JNG A;  3CPW S;  2YRC A;  3QBY A;  1AEY A;  1G3S A;  3QDF A;  1OQK A;  2VC8 A;  4ATO A;  4J6X A;  1Q95 G;  1RAG B;  2C0T A;  4DOW A;  3M0R A;  3NTH A;  2JMA A;  4E7L A;  2ED1 A;  2XKO C;  2VUB A;  3DB3 A;  1RUW A;  2QAS A;  3JB9 G;  5HKC A;  1M8V A;  4FT2 A;  4J9C A;  1VQO A;  3CC4 T;  4ORZ A;  2ENM A;  3VS3 A;  4XU0 A;  2LJ3 A;  5CKH A;  2FPD A;  3QYH B;  2RI3 A;  4AFZ C;  5LJ5 e;  1M90 C;  2E4H A;  3VKI A;  3DLM A;  4ZGE B;  2NUP A;  4M7A G;  2PVG B;  2XK0 A;  4LE9 A;  4DEY A;  4XQ3 A;  4ZGD B;  3J80 E;  2DZC A;  2NUP B;  2A28 A;  2VGM A;  3VU3 C;  1WQ7 A;  1M8M A;  1B34 B;  3HKS A;  1O75 A;  2XHC A;  5D7U A;  2WSE E;  3MEU A;  4IUV A;  4F16 A;  1M27 C;  4JRK A;  3CD6 T;  5CVI A;  1IRX A;  1M3B A;  3VS7 A;  4QQG A;  3L2Q A;  2K6D A;  1OPL A;  3PVL A;  3J81 E;  4JPB W;  1QWE A;  4FYX B;  1WGS A;  2FZC B;  2DLP A;  2LX9 A;  1PD0 A;  1Q7Y U;  4M7D C;  1ZSG A;  2E3H A;  4WCI A;  4AMC A;  2LQW A;  2R58 A;  3LWI A;  3CPW P;  2LQN A;  2JM9 A;  3CMA A;  3QYG B;  4Z02 A;  2HL3 A;  4M78 E;  1OOT A;  1NPP A;  3RNJ A;  1PG5 B;  2DM1 A;  4LD9 K;  4PLL A;  4PKC C;  2JMC A;  1N8R U;  3A98 A;  2PUK B;  1U06 A;  1U1T A;  4RCB A;  2LTO A;  1VQM A;  2RQW A;  2RD1 A;  1WXB A;  3AHU A;  3QUI A;  3HSB A;  2DJZ A;  2Y90 A;  2OX7 A;  3X24 B;  3JCM e;  1UGP B;  1UB4 A;  2DTI A;  4C8Q D;  1C0M A;  1SF9 A;  1U8R A;  1T0J A;  4Z89 A;  5GJV B;  3P8B B;  4GLK A;  4F7U G;  1CKB A;  1VQ4 A;  4Z8A A;  3EG2 A;  3LX7 A;  3S3N A;  2X9H A;  1OEB A;  1VQ6 T;  1YHQ A;  5LJ3 j;  1LNX A;  2LCC A;  5KYY A;  2B86 A;  4EMH A;  3HPW A;  3M0P A;  3L2U A;  2J7I A;  4F7U E;  4AFU C;  1C6V X;  2DNU A;  2J05 A;  5J39 A;  2XU8 A;  1WXT A;  2EYZ A;  4OP0 A;  3A8G B;  1D1B A;  3SDZ A;  1R0C B;  4NL2 A;  4M77 F;  3OYL A;  1QQJ A;  3A8M B;  1MHN A;  2DXT A;  1IHW A;  1WIE A;  2QDL A;  4OB0 B;  5L8R E;  1QW1 A;  5A0G A;  1X2Q A;  1HSQ A;  3A1P A;  5FW9 A;  4B9X A;  1WHM A;  1QP3 A;  4RUG A;  2ECZ A;  4LDY A;  4M78 C;  1I0C A;  4C8Q A;  4F14 A;  3OYM A;  1Z9Q A;  4OB2 B;  2F2V A;  4C8Q B;  2ZPE B;  1M30 A;  4HT8 A;  1KQS S;  4F17 A;  2KR3 A;  1K73 R;  4RCC A;  5CO7 A;  1EFN A;  1H8K A;  2ZPG B;  5GAN 8;  1UHC A;  1VQN A;  2X4X A;  1QVF S;  1PWT A;  2FEI A;  4X34 A;  5DY9 A;  2DIG A;  1FXX A;  2W0Z A;  3LH0 A;  3EGD B;  4KGX B;  2JOY A;  2V26 A;  5A2Q E;  2MI6 A;  3QWY A;  3RIR A;  2BZX A;  1VOM A;  2NLU A;  2RMO A;  3MET A;  4J9I A;  1TU0 B;  1JBM A;  2F5K A;  2X4J A;  2X3W D;  1Q81 R;  4O6J A;  1QCF A;  3CC7 A;  2CZ0 B;  3G4S T;  1Q86 C;  2RI5 A;  1RAD B;  2CT4 A;  2QG9 B;  2ZAE A;  2DEQ A;  5GAM f;  5GAM g;  4M7D B;  4OB1 B;  1PRM C;  1D0Y A;  3HRS A;  2JZ2 A;  2M0O A;  3RER A;  4C5G A;  3CCE Q;  3QXE B;  3DB4 A;  2DK3 A;  1VA7 A;  3CCR Q;  3TEE A;  2ZPF B;  4C92 D;  5HCK A;  1M2O A;  4EPC A;  3OQ5 A;  5IXF A;  2EYY A;  1WJQ A;  2DZ9 A;  2J6O A;  5IAY A;  2VKN A;  2GTJ A;  1YJN Q;  2AK5 A;  3GP8 A;  2P4R A;  1SRL A;  1TUD A;  3M4Y A;  2DVJ A;  4BE1 A;  2CT3 A;  1ABQ A;  1KQS P;  3HHT B;  2DVE A;  2XD0 A;  2FRY A;  3SB2 A;  1FMK A;  1RAA B;  2L5Q A;  1VQ5 T;  4HCC A;  2AZS A;  2JM8 A;  2OTJ A;  1EX4 A;  2KEA A;  3CXC P;  5FWB A;  3OSS C;  4LDW A;  2YWW A;  3PIO A;  1Q82 U;  1GBR A;  5LJ5 f;  3PNW C;  4CI0 C;  1AT1 B;  3CCM T;  1QVF P;  5LJ5 g;  2QQB A;  2DF6 A;  2DL7 A;  1PKT A;  3QDR B;  3JCM W;  3GOX A;  4PLI A;  2E41 A;  2HD0 A;  1N5Z A;  2EJ9 A;  2ZZD A;  1VQ7 T;  2CH4 W;  2JTM A;  5A0L A;  4ZGJ B;  4IUT A;  1YIJ A;  2FO0 A;  3ER0 A;  4BUG A;  1VQK A;  3RKY A;  1WYX A;  1IXD A;  5FU6 B;  1YWP A;  2VB6 A;  3MPU B;  3EGU A;  4C92 A;  4OGC A;  1YIT A;  2ZCF B;  1K8A U;  4C92 B;  4M75 D;  4DBH A;  2HSE B;  1TG0 A;  2WSC E;  1WJR A;  1B07 A;  4OMN A;  1KQ2 A;  1YI2 A;  4J8O A;  1I07 A;  1DJ7 B;  1AWO A;  1ZA2 B;  2EQI A;  3PGG A;  3VRZ A;  2LNH B;  3WVE B;  4EIK A;  8ATC B;  1UJ0 A;  4MDW A;  3VS6 A;  1AOJ A;  1HK9 A;  2KDS A;  1PKS A;  4IIO A;  3M53 A;  4J9G A;  4KGZ B;  3QJ6 A;  1UJY A;  3GBQ A;  4X1V A;  4PJM A;  2EGC A;  2OAW A;  2J6F A;  2QQA A;  2KYM A;  4ZTF A;  1M3C A;  2FZK B;  4WTO B;  4D8K A;  5GMK m;  4IIM A;  3JCM P;  3CCJ T;  3CCV Q;  2O9V A;  3JB9 F;  3CC2 A;  1VQ9 A;  2QEX T;  2YT6 A;  2PNI A;  1WQW A;  3PTA A;  3NHN A;  2HAX A;  3PE0 A;  2RO0 A;  3M0S A;  1H92 A;  4JDS A;  1Y57 A;  2OTL T;  1OPK A;  4RTY A;  2G3R A;  4MML A;  3I5S A;  2XMF A;  1QKX A;  4LD6 A;  4DA4 A;  1W2B P;  2BIV A;  4F04 B;  1QMC A;  3TU4 K;  4M75 A;  4FSS A;  5GAN d;  2XDB A;  1M9S A;  3PVQ A;  3UF4 A;  1ACM B;  3CC4 Q;  2LT4 A;  3OYI A;  4UC4 A;  1Q81 U;  1AZE A;  1UEB A;  1WA7 A;  1U1S A;  3L42 A;  4VUB A;  2A3L A;  2P0P A;  3D7S B;  4J9D A;  3G6E Q;  2HZY A;  3JV3 A;  3GNF B;  1G83 A;  2VWF A;  4M78 F;  3P8D A;  3BE3 A;  3H0F A;  4RTT A;  2HKQ B;  4JRP A;  2V8I A;  3TRE A;  2F1L A;  1TSF A;  4RG8 A;  4XTW A;  1VQL T;  3CD6 Q;  3CCS A;  1LCK A;  5A0D A;  1LOJ A;  2QGF B;  2RNA A;  3FC3 A;  4A4E A;  5CK9 A;  1UE9 A;  2MWO A;  2OJ2 A;  1YJ9 A;  4HA8 A;  3FIF A;  1YJW A;  1OUL A;  4MMK A;  3BDU A;  3G7Z A;  3HRU A;  2K3X A;  2HQE A;  1X6O A;  4PJO D;  3OMC A;  3JRZ A;  3SWN C;  2DXB A;  2KRN A;  4GBQ A;  3REB B;  3VRY A;  4A4H A;  2QA4 A;  3CCU A;  5GAN h;  1K73 C;  4C5I A;  3UPU A;  2ROT A;  5GAN 6;  1B7T A;  4J9B A;  3UWN A;  1BIA A;  1HD3 A;  3EH2 A;  5KCO A;  3SEM A;  2J06 A;  4DBQ A;  2DBK A;  1RAB B;  1UFF A;  4JZ4 A;  1D3B A;  2AHJ B;  2I2L A;  2QQR A;  1D3B B;  2ESW A;  1KC8 R;  3BY7 A;  3OYA A;  3S6W A;  4C8Q G;  3M56 A;  1R0B G;  4QVZ A;  4OMM A;  2CRE A;  2CGH A;  1AWJ A;  5KE2 A;  1VQ6 Q;  1M1G A;  1UUE A;  2J6K A;  2DIQ A;  4AT1 B;  2RPN A;  4FCY A;  1VQO T;  1I8F A;  1N9S A;  3R6O A;  4QKU A;  1WX6 A;  3I55 A;  4C8Q E;  4PJO A;  2RHI A;  3HL8 A;  3CCL A;  2YRD A;  1ZSZ C;  4FL6 A;  4N4I A;  1AWX A;  2MCN A;  4KUL A;  1XJW B;  2LQK A;  4PFO A;  3H8Z A;  3JCM c;  1BB9 A;  3OYH A;  2K3B A;  9ATC B;  5CAI A;  1IB8 A;  4C0Z A;  1X69 A;  4KT0 E;  3CME A;  3OYN A;  5GAO r;  5GAN 2;  1VQ8 A;  4QVD A;  2DKG A;  1OYX A;  1NE8 A;  2NYS A;  3EFS A;  1NLO C;  1Y96 A;  4ANJ A;  3PIP A;  3E1S A;  3H0H A;  2PUO B;  1KG1 A;  5GAN j;  4M77 D;  1RI9 A;  1Y96 B;  2QTV A;  2KT1 A;  4E47 A;  3HRT A;  3M0Q A;  4IUR A;  3OS5 A;  3QWX X;  1G5V A;  3ASK A;  3TQ7 P;  4DQ2 A;  2XID A;  4ELY C;  2AZV A;  2EJG A;  4AFS C;  1IO6 A;  4RTX A;  2DA9 A;  3A5Z B;  4A4G A;  4BY6 B;  2DX1 A;  1UDL A;  1D1A A;  3G6E T;  2CZ7 B;  1WLP B;  3OYY A;  2PTK A;  5LJ3 h;  2FPF A;  4N0A A;  1VQM T;  3JB9 J;  1B34 A;  2RH2 A;  4A53 A;  1SHF A;  3WXM B;  3G4S Q;  3Q1J A;  1ZHI A;  2DTO A;  3RKW A;  1K76 A;  2EAY A;  2RJC A;  2E5Q A;  4OMP A;  4BI4 A;  2A36 A;  3UT1 A;  4M7A E;  2X35 A;  1JQQ A;  2EGE A;  4J6Y A;  7AT1 B;  4J9H A;  1VQ4 T;  2JJ9 A;  1IHV A;  1YHQ T;  1I81 A;  2MK5 A;  5D6X A;  2CSI A;  2DAQ A;  1M1K R;  4DOV A;  4M77 A;  2L8D A;  4OGE A;  3M0T A;  2K2V A;  2CP3 A;  3VS4 A;  4C92 G;  4M77 B;  2K57 A;  4XU2 A;  1S72 A;  2FRW A;  1D09 B;  3QII A;  2XI9 A;  1WPY A;  3JSC A;  4PFZ A;  3MP8 A;  3NTI A;  3T9N A;  1TWB A;  4N4H A;  1NEG A;  2B8A A;  3QJY A;  1VIF A;  4E7K A;  2BKD N;  3DLL A;  1AWW A;  3EHR A;  2IPO B;  1FWZ A;  1VQ5 Q;  3R6N A;  4J9F A;  2DMO A;  3G71 A;  1IRE B;  2OAU A;  3OBY A;  3CCM Q;  1QVG S;  3MKD A;  2BTT A;  1X27 A;  1RAC B;  2FZG B;  3DKM A;  3GNG A;  5ECA A;  2EGA A;  2DTH A;  3L1A A;  1K9A A;  4ESR A;  2K9G A;  3M55 A;  5IXB A;  2DE0 X;  3CBM A;  4C0F A;  1D0Z A;  3OS1 A;  1VQ7 Q;  2DXU A;  4RG2 A;  3V8K A;  2RHZ A;  1FYN A;  1Q86 U;  2HKN A;  1G3T A;  1G3W A;  2KRO A;  1KK7 A;  2BZ8 A;  3S3M A;  2GTO A;  1EIF A;  2LMJ A;  1VQN T;  1QKW A;  1MMD A;  1NBE B;  3UAT A;  2KVQ G;  1BYM A;  4FYW B;  1PC0 A;  1PRL C;  3I56 A;  3FEO A;  4M7A C;  6AT1 B;  2DXC A;  1I5O B;  3M5A A;  5GMK j;  1XTD A;  2QDY B;  4M75 G;  1SKU B;  2E70 A;  4M7D D;  1JRI A;  1T0H A;  1IZ6 A;  2BUD A;  1VQP A;  1NYG A;  4BD3 A;  3CC7 T;  4KUD K;  3BDL A;  2FL7 A;  4D6W A;  3BW1 A;  1X01 A;  4R56 A;  4E7I A;  3HTR A;  1RI0 A;  1UGQ B;  2M1H A;  5DLO A;  5LJ3 e;  2RQV A;  5KYX A;  2GCX A;  1SPK A;  4M75 E;  3LH5 A;  4C5H A;  2D6F A;  5KYX B;  1TOV A;  2O01 E;  2KBT A;  3CCQ A;  3FLG A;  3CCJ Q;  1UTI A;  2DER A;  4C0D C;  2QEX Q;  4LDV A;  5KYW A;  4IKF A;  4RTV A;  5CQY A;  1YCS B;  1GBQ A;  3V8J A;  3TCJ A;  4CC4 B;  2LT1 A;  1QVG P;  5KYW B;  2QQ9 A;  4IUQ A;  5CCA A;  2OTL Q;  3EGD A;  4QT7 A;  2EYQ A;  2GF7 A;  3RKX A;  3NTK A;  1OI1 A;  1W4S A;  3GF5 A;  3HP9 A;  4E2F B;  4RKU E;  4RTZ A;  2EVR A;  2LZ6 B;  1KC8 C;  1I1J A;  4B6M A;  2M16 A;  2DO3 A;  2K4Y A;  2JVV A;  2OTJ T;  3OYF A;  4M7D A;  4P5N A;  1VYV A;  1BI1 A;  2DL3 A;  2RF0 A;  3H9N A;  1ZLM A;  4EMK C;  5GAN 3;  2F5T X;  1YWO A;  1OU9 A;  1WFW A;  4J83 A;  4LXC A;  1YIJ T;  3SFM A;  2HQH A;  3J7A F;  3VUZ A;  1KFZ A;  5GAO m;  1YCY A;  2RHY A;  2KXC A;  3CPF A;  2X4Y A;  5L23 A;  5GAO p;  1I5L A;  5M9O A;  4MZM A;  4JJN K;  4PFP A;  3U23 A;  1VQL Q;  3H6Z A;  1MNE A;  4M78 D;  2CP5 A;  3KUF A;  1T3S A;  4C5E A;  1YIT T;  2CP7 A;  2YDL A;  5GJW B;  3NGP A;  4M75 C;  2COZ A;  2COY A;  5GAO q;  3P8H A;  2RN8 A;  1YI2 T;  1KIK A;  2D8H A;  2DIL A;  2JXB A;  1ZQ1 A;  4PJO G;  2KXD A;  2DL4 A;  2QXF A;  1SEM A;  3QZ9 B;  2ZPB B;  5CKE A;  3ME9 A;  2P0Q A;  3RR6 A;  2JW4 A;  4PL6 A;  1MV0 B;  3QPH A;  4FIB A;  5GAN f;  5GAN g;  3CC2 T;  2KRS A;  1VQ9 T;  4PJO E;  2R5M A;  1MGQ A;  2O4X B;  2BE9 B;  3LW5 E;  1NJI R;  3OYB A;  5HY6 A;  2KY9 A;  2EW3 A;  1SHG A;  3OW2 A;  1I4K 1;  2W10 A;  4M78 A;  1BBZ A;  2CKK A;  1G8X A;  2E12 A;  2L3R A;  4M78 B;  2EJF A;  3I9Q A;  4JJC A;  4LUD A;  1UEC A;  3VYG A;  1VQO Q;  3ZBD A;  1K9M C;  2L89 A;  2LNV A;  1KSW A;  1W1F A;  3CPW A;  4L5G A;  1M1K C;  4BI8 B;  5I11 A;  1RAH B;  1WI7 A;  3L2V A;  4RMO A;  2HDA A;  4J9E A;  2IVW A;  3CBP A;  2HCK A;  1FX7 A;  2KI7 A;  3PMI A;  2ZGW A;  3ZL7 C;  5FRO A;  1RLP C;  2VYT A;  3A8L B;  3CCS T;  2GFU A;  1JJ2 A;  1K73 U;  3JCM Q;  3MCA B;  1MMG A;  2HBW A;  3L2Z A;  2O31 A;  5D6W A;  1YJ9 T;  1KD1 R;  1YJW T;  2P4T A;  4M7A F;  4OMF B;  3VJP A;  2X4W A;  1LJO A;  2DRK A;  2K79 A;  1N9R A;  1YBY A;  3HFO A;  4EMG A;  2HL5 C;  2KMT A;  2HEQ A;  4FM4 B;  4M77 G;  4PJO C;  1Y7X A;  1D1C A;  4A54 A;  2GNC A;  2QA4 T;  2EYX A;  3JCM J;  3CCU T;  1BCO A;  2QTX A;  3CMA Q;  4LNP A;  1KHI A;  2FHD A;  2MWP A;  1ZUK A;  1WNL A;  1AVZ C;  1Z9Z A;  4O5V A; 
#chains in the Genus database with same CATH homology
 1YI2 Q;  3G4S Q;  3CCV Q;  1VQ7 Q;  3I55 Q;  1Q7Y R;  2OTJ Q;  1NJI R;  3CME Q;  1YJN Q;  1JJ2 P;  1M1K R;  1YJ9 Q;  1VQM Q;  1VQO Q;  3OW2 P;  1Q86 R;  1QVF P;  1YJW Q;  1VQ4 Q;  1VQ5 Q;  1VQK Q;  1VQ9 Q;  3CC2 Q;  3CCL Q;  3CCE Q;  1VQ8 Q;  3CPW P;  3CC4 Q;  3CCJ Q;  3CCQ Q;  1YHQ Q;  1K73 R;  1K8A R;  3G71 Q;  2QEX Q;  1VQN Q;  3CCM Q;  1VQP Q;  1VQL Q;  1YIT Q;  1Q81 R;  1VQ6 Q;  3CD6 Q;  1S72 Q;  3CCR Q;  3CMA Q;  1KQS P;  2QA4 Q;  3CCS Q;  3CC7 Q;  1QVG P;  1KD1 R;  3G6E Q;  1KC8 R;  1N8R R;  1W2B P;  1K9M R;  1M90 R;  3CCU Q;  3CXC P;  3I56 Q;  1YIJ Q;  2OTL Q;  1Q82 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...