5LJ3f

Structure of the core of the yeast spliceosome immediately after branching
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
72
Chain Sequence
PVNPKPFLKGLVNHRVGVKLKFNSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Splicing
molecule keywords U5 snRNA (small nuclear RNA)
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
total genus 8
structure length 72
sequence length 72
chains with identical sequence q
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
f PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj3f00
4M77A 5GAMf 4M75D 3SB2A 5LJ5g 3BFMA 3V7SA 2FYKA 2Y90A 4M75E 5GAN5 5LJ3h 3JB9F 5GAOm 2DKGA 4XQ3A 3RKYA 4PJOE 1N9SA 3INZA 4F7UG 5GANd 5LJ3f 4M77E 5GMKh 1KQ2A 1JRIA 1YCYA 4XU3A 4EMHA 3JB9G 2DEQA 4HT8A 2DTIA 4N0AC 3JCMg 2EJGA 4J5YA 3JB9H 5GAMj 3RKWA 4NL3A 4C92A 1U1SA 4M7DA 3VU3C 3L2ZA 4C8QA 5LJ5d 4OP0A 3JB9D 2E64A 3V8LA 4M75B 4M7AF 1M8VA 3FJPA 2ZGWA 1M5Q1 4M75A 1JBMA 1LNXA 4J6WA 5I21A 5GAMh 5LJ3j 2RA2A 4C92E 4M7DE 5GAMe 4C8QE 1I8FA 5GMKj 2I2LA 3SWNA 5LJ3g 3JCMd 1WQ7A 5GAOq 3V7CA 4M78C 3QHSA 1HXDA 1Y96B 2DVEA 3BY7A 4EMKA 1WQWA 3V7RA 5DY9A 5GMKm 4XU0A 1Y96A 2QTXA 1D3BA 4M78F 4F7UB 3JCMP 3FIFA 1I5LA 5LJ3e 3HFOA 4F7UA 3RIRA 3JB9J 3EFSA 4XTXA 4NL2A 4QVCA 4DQ2A 5GAOr 2K57A 4PJOF 2E10A 5GMKe 4HA8A 4M78G 3JCMV 3BW1A 4M77F 4RCBA 4C92B 3RKXA 4M7AC 3QSUA 3V8KA 1I81A 2EJFA 4C8QB 5GANh 1WPYA 5GAN3 3HSBA 4M7DB 4F7UE 3HFNA 2FB7A 5GANf 5GAMg 3BDUA 3M4GA 2EWNA 4M78D 4Y91A 5GAOp 4PJOA 5GAOn 2DTOA 4PNOA 4XTWA 2VC8A 2DTHA 4N0AA 1H641 5GAN4 5CAIA 4HT9A 2CGHA 4X9DA 4M7AG 2DXTA 3SWNB 3QO3A 2DJZA 2VXEA 4J6XA 4MMLA 4EMKB 5LJ5f 2DXUA 4EMGA 2YHTA 1D3BB 4XTVA 4A54A 1I4K1 4M7AD 3FB9A 4V2SA 5GANj 3JCMX 4PJOC 4M75F 2RD1A 1B34A 4XTYA 5GAMd 4M77C 1BIAA 5GMKi 3JB9I 4XTZA 4XU2A 4A53A 2DZCA 3JCMf 4M78A 3EFRA 5GAOl 4QVDA 4RCCA 2YLCA 3PGGA 2E1HA 5LJ3d 5LJ5j 1HK9A 2JN0A 4PJOG 5GANe 3AHUA 1U1TA 4M77G 3RESA 3JCMc 4JRKA 4M78E 4F7UF 1X01A 2RM4A 4M7AB 5LJ5h 4M7AA 4PJOD 4JUVA 4C92C 4M7DC 1WNLA 4M77D 4C8QC 4WF2A 3JCMW 5LJ5e 4C92F 1TH7A 4M7DF 5GAN7 4M75C 4C8QF 2HNIA 2E41A 4J6YA 3V8JA 5GAN6 5GAN8 1B34B 2EJ9A 4M7AE 3RUXA 3JCMh 1MGQA 1KQ1A 1LOJA 4C92G 2VXFA 4M7DG 4XU1A 1LJOA 4M78B 3SWNC 4C8QG 3JCMb 4MMKA 2DZ9A 3JCMe 5GANg 5GMKl 5GAN2 4JLIA 3JCMQ 1BIBA 4M75G 4EMKC 3GIBA 3RERA 2E65A 3L1AA 4JRIA 2EAYA 4PJOB 1N9RA 4C92D 2RB6A 4NOYA 4XTUA 3JCMJ 4M77B 4C8QD 4M7DD 4X9CA 3QUIA 2YLBA
chains in the Genus database with same CATH superfamily
2DFUA 2C06A 3X24B 1SSFA 1M1KR 1YBYA 2SRCA 1Q95G 3DLMA 3QJYA 1D0ZA 1MMNA 1QVGP 1WHGA 5KYYB 2AT1B 2CZ6B 1N9SA 1C0MA 4F7UG 5GMKh 1X69A 2JTFA 1VQ8A 2CYZB 4EMHA 1WHJA 1R0BG 4RTWA 1K73C 1AWJA 3L2ZA 3PMTA 2HKQB 3FRNA 5J39A 1JBMA 1E6GA 2AZSA 3E1SA 2KSSA 1M1KU 3JCMd 1AOJA 2KROA 1WXTA 3H0FA 5DY9A 1M3BA 2CKKA 2XD0A 1Y7XA 2FRYA 2OAWA 3CCQA 4E7KA 4PKCC 3RIRA 1NZ9A 5KYUB 2I0NA 3V8KA 2J6KA 1VQ4A 2IIMA 2F2VA 5CKDA 5GAOn 2DTOA 3L2UA 2LCSA 5FRNA 2P4TA 2EIFA 3MP6A 4JLGA 1YIJA 1ZHIA 1VQ6T 3SDZA 4MMLA 1MMAA 2F69A 4KGXB 5FU7C 4V2SA 2PZ1A 2KRSA 1OOTA 3I56T 4BACA 1AZGB 4A53A 2KXCA 2LX7A 4M78A 3E2UA 4OMLA 2LVMA 1KC8R 1NEGA 1JXOA 1VQOT 5LJ5j 3CCMQ 1PHTA 1U1TA 2LQNA 1JQQA 3EAEA 3CD6Q 1FMKA 1RAGB 2EQMA 4ORZA 3JCMW 3I35A 3MO8A 4IIMA 4PJLA 3Q1JA 3V8JA 1IZ6A 2CZ1B 2O4XB 1XTDA 3ZEHA 4A4EA 1NM7A 4M7DG 2DZ9A 4KT0E 1TG0A 4BY6C 2RJFA 4M7DD 2RI2A 3VKIA 1VQ7A 2WSEE 5IHIA 3CPWP 2R5MA 5LJ3h 3OYAA 4FYWB 2LNVA 2R57A 3OS2A 4A63B 4HCBA 4HT8A 2FHDA 2XDPA 2XKOC 4J9DA 5FU6B 3NMZC 4C8QA 2RO0A 3PT9A 3D7SB 4F16A 1YJ9T 4ZN3A 2ENMA 3MJXA 3OBYA 3OYHA 1YHQQ 3F70A 3CCQQ 1I5OB 1GBQA 1D0YA 2A7YA 2DD5A 1KHCA 4DEXA 3SD4A 3JCMP 2CSQA 3HFOA 3EG1A 4XTXA 1VQ4Q 2C0TA 4C5EA 4KRTA 3OMCA 1Q81R 2RQWA 2LRQA 2FB7A 3CC7Q 5GAMg 2VC8A 1RACB 1C1AA 1N27A 2DXTA 3SWNB 2EGAA 4KH1B 4EMGA 1VQ5A 4F17A 4LDVA 4IUQA 2VASA 2G6FX 2OX7A 4GBQA 2QEXQ 4M77C 1Q81U 1D1AA 4XTZA 4EDUA 2EVRA 1YWOA 2O88A 1WIEA 1D1BA 2LCCA 2JN0A 3KUFA 2CP5A 1ACMB 3QPHA 3RESA 4RKUE 3MHXA 1H8KA 4PL6A 2QK0A 2JS2A 4JPBW 4J6YA 5GAN6 1GRIA 4M7AE 1LOJA 4JZ3A 1UFFA 5CKFA 2F5TX 1AVZC 4JRIA 2M1HA 1AT1B 4PJOA 2A36A 4J9CA 3OYCA 1NEBA 5HCKA 1G83A 2A3LA 5LJ3f 1A0NB 4AG1C 3OSVA 2OTJQ 5I22A 3A8MB 2M9UA 3G71A 3OQ5A 1ZUYA 2H3EB 2SEMA 2ZPEB 1YFNA 2JTMA 1M30A 2OI3A 5CKHA 3RR6A 2XDDA 4LN2A 4GLKA 1JO8A 5IXFA 3S3MA 2HBWA 2RJDA 4FYVB 1GFDA 1UEBA 2C0OA 5GMKm 3V7RA 2DLPA 2VVKA 3I5SA 3CCVT 1RUWA 4NL2A 3REBB 5KCOA 4Z88A 1AWOA 5CK9A 1Q7YC 2AK5A 4M7DB 2ZPFB 4RUGA 1ZSGA 2JUFA 3CCEA 5CKBA 3CCUT 5KYNA 1GCPA 2DXCA 4XTWA 3TSZA 4AG2C 1BU1A 3CC4T 4KUDK 1SSHA 3OYEA 1YJWQ 3FB9A 4MZTA 4M75F 1B34A 4RTYA 2A08A 1Q82C 2QGFB 2DK3A 2GF7A 4HXJA 4RCCA 3VRZA 1VQMT 5LJ3d 1R77A 2W0ZA 2LC4A 2IPOB 1W4SA 2M16A 2K3BA 3KFVA 2LJ1A 4BI8B 1KQSA 1MNDA 3CC2A 2VYTA 4BDZA 4FSSA 8AT1B 4LD6A 3A8HB 3CCRQ 3LX7A 2YT6A 1BYMA 3HRUA 2PUKB 2EQJA 2FZCB 4M75G 2NUTA 2P0QA 4PJOB 3CEYA 1LCKA 4X9CA 2L3SA 3L2QA 4M75D 1K9MR 1M1KC 1UGSB 3G71Q 4HCCA 2DETA 5EG2A 3OW2S 3RKYA 4B9XA 1Q86R 1JRIA 3A8LB 3LYIA 4E7JA 3QKJA 3JB9G 5KYXA 3G4SA 2JMAA 1OU9A 3VU3C 1M8VA 3JB9D 4M7AF 1ZSZC 1RL2A 2LQKA 2K79A 2YRVA 2COWA 1VQLA 3CPFA 1K9MU 3MEWA 3VRYA 4JJDA 1OV3A 4ESRA 1PM3A 3A5ZB 1Q86U 1RAEB 4OMNA 3CCEQ 2BZYA 2X9HA 1VYTA 1NPPA 3JCMV 1VQPA 2X4YA 2ABLA 5HY6A 2CH4A 2DO3A 1CSKA 3BDUA 5GAOp 3UWNA 2QA4A 5J26A 1XQHA 3S6WA 4ZGJB 4HT9A 4M7AG 1VQNA 1UUEA 1JEGA 3CCJT 1D3BB 2QQBA 4M7AD 1VQ9A 1O75A 1AD5A 5GMKi 4IUUA 1K0SA 1NYGA 3TCJA 3C94A 2GFUA 4QVDA 3H8ZA 2LT4A 3EGXB 1UDLA 3L42A 3CC2Q 4YTLA 1QP2A 2DXBA 4M78E 2KAFA 1X01A 1B3QA 3CCLQ 2BUDA 2ED0A 1RI9A 4HVWA 2RNAA 1VYUA 3QZ5B 2XK0A 3N5BB 2D8JA 3JCMh 2NUPB 5FW9A 4GY5A 2ZCFB 2NUTB 4JLIA 4Q5WA 3FLGA 2YLBA 1MHNA 2GNCA 2HL3A 2JMCA 2VUBA 5LJ5g 4GLMA 3VS4A 4E2FB 2YSQA 5GAOm 1YJNQ 1DJ7B 3EG9B 2ZPBB 1TSFA 1HD3A 2JNGA 2H3JA 4AFQC 2ZPGB 5A2QE 4C92A 1U1SA 2DM1A 2FPDA 1FX7A 2HBPA 4Y92A 1VQ8T 5I21A 2ECZA 3EHQA 1UGQB 4C8QE 1SHGA 1JJ2P 3OW2P 5GAOq 1KSWA 2NWMA 4EMKA 1VQPQ 4A4HA 4XU0A 2QTXA 2XI9A 5CIUA 3OB9A 4DQ2A 2D6FA 3U23A 2QA4Q 3BW1A 1PKTA 2CZ0B 2DF6A 1Q81C 1I81A 3P8BB 2GQVA 8ATCB 1QP3A 5IT9E 1IGQA 4BB7A 2DIGA 3BDLA 5KCHA 5FWCA 2DTHA 5IHKA 2RPNA 4QVZA 1OX8A 5FU6C 4P5NA 2BZXA 3VYHB 1GL5A 4A54A 2L8DA 2PVGB 2L5QA 2K2MA 2V8KA 3PE0A 4XTYA 4EIKA 1UTIA 2DZCA 1WXBA 1YIJT 4C0ZA 3WVDB 1M4ZA 1W6XA 2F2XA 2X4XA 4ATOA 5IAYA 3GP8A 1IHVA 3TREA 2RM4A 3UA6A 1VQKA 2CP3A 2YUOA 2VV5A 3NPFA 1Q82R 3QYHB 4J9BA 4DA4A 1OPLA 3SWNC 3M9QA 5GAN2 1QWEA 2RJCA 4XAXB 4AMCA 2W10A 2EQIA 1PSEA 1Z9ZA 5IN1A 1I1JA 1QCOA 2E3HA 2JOYA 3META 3CCMA 2ZPHB 2WACA 4PJOE 1YITT 2A0FB 3CD6A 1VQ7T 1RAHB 2CP2A 3GLXA 4EPCA 3R6OA 4D6WA 2JM9A 2E64A 4AFSC 1WDXA 3C12A 1K0XA 1RAIB 1PCXA 2B86A 5J3BA 2HQXA 1R0CB 2DMOA 2QG9B 3MEAA 3FJ5A 4E7LA 4ZNXA 4M78G 1HSQA 5GAN3 2OAUA 3GBQA 3HFNA 3WXMB 4M78D 4PNOA 4XK8E 3OYJA 3M55A 4L59A 4IURA 4JS4A 4OB3B 4JJNK 2LX9A 1YHQA 3AT1B 4RG8A 2DAQA 2DEUA 1QCFA 1VQ5T 2KR3A 4KULA 2NUZA 1VQKQ 5GANe 2YDLA 4OB2B 2CP6A 4E7ZA 2KRMA 4C5IA 1GCQA 3CC7A 4M7DC 1UJ0A 4M7DF 2HNIA 1WHMA 4J9GA 1U8RA 5I11A 2MMPA 4C8QG 1YN8A 4DBRA 2QEXA 4RTXA 4NOYA 1HYOA 4C8QD 1NG2A 5GAMf 1EIFA 3SEMA 1EFNA 3QJ6A 2J06A 1K9MC 5CQXA 2FZGB 1QCNA 1YCYA 2MOXA 1Q86C 3QXEB 3OSSC 5FROA 1J3TA 1HJDA 2COYA 4E7SA 3NTKA 1X75C 3I5RA 2PQWA 3FJPA 4AFZC 5D6YA 2CT4A 2HSPA 2E4HA 1SG5A 4BE1A 1HXDA 1AEYA 2GBQA 2EYYA 3LH5A 3M0RA 3VUBA 1PSFA 3EFSA 2K57A 4PJOF 1VYVA 2P84A 2QQ9A 2OTJA 1X2KA 4Y91A 4DOWA 2OTLT 4DBFA 5FRMA 1N6AA 4JZ4A 4B9WA 3VV0A 4CC7A 1M90U 5FWBA 3KBGA 1X43A 1I0CA 1Y07A 2HQHA 2FL7A 1BI1A 4FW2A 1IREB 5C6SA 1PNJA 5GANj 3QBYA 5GAMd 1BIAA 2PVOB 4J9FA 3EFRA 3O8VA 4JDSA 3G6EQ 1YCSB 1AWWA 2DL3A 2QDLA 4PJOG 1Y57A 3CBMA 1X2QA 2KDSA 2M0YA 3CXCS 2Y4YA 2KT8A 3VS1A 2K6DA 4PJOD 4JRPA 4N4IA 3LGLA 2FO0A 1X6GA 4KGZB 4C0FA 4OMOA 3GPLA 1BCMA 2KXDA 3CXCA 2DL8A 4M78B 4MMKA 3JCMe 4HCZA 1YJWA 1UE9A 2A28A 2FEIA 3CBPA 3QUIA 1Y0MA 3HPWA 3M4YA 2FYKA 4Z8AA 2GTJA 5CQYA 2ZZDA 2K7AA 1IRXA 3CMAT 1M9SA 2K3YA 2ATCB 2JT4A 4N0AC 2V26A 4PLIA 4IUTA 4IKFA 1M5Q1 5D7UA 3CCRA 3G4ST 4A4FA 4C92E 2ZAEA 4OMFB 4BUGA 1S72Q 3OA6A 2FVUA 3I55T 1VQLT 4HA8A 2AKLA 3A8OB 1OX9A 1NBEB 3O5ZA 3RKXA 2KEAA 4C8QB 1PWTA 1IO6A 3M56A 2EWNA 1MV3A 2HAXA 5GAN4 1QKWA 2JM8A 4OMMA 1YI2T 2D9TA 4ELYC 2BIVA 1SRLA 2D0NA 4IUPA 1UG1A 4KBMB 1G3WA 2QA4T 3TU4K 4JJCA 5IHNA 2CT3A 1VQNT 3J7AF 2X51A 3S3OA 5HKCA 4R55A 1NLOC 3EFOA 3PVQA 1HK9A 1VQ9T 2LJ3A 4JRKA 3CCSA 4X1VA 1NJIR 1AWXA 1MUZA 2J7IA 4M75C 3EG2A 1KQSS 1WI7A 3RUXA 3M59A 3DB4A 4XU1A 1LJOA 4AFUC 4LDYA 2NYSA 4QW2A 1RAFB 3CXCP 3RERA 4J7FA 3QG1A 1W2BS 4M77A 2IG0A 1G8XA 3CMET 1NJIU 3JB9F 4JJBA 1GFCA 4Z89A 2QTVA 2CUBA 4C0GA 1KK7A 3HP9A 2NLUA 4XU3A 2KI7A 2JTEA 3CCLA 2MF2A 5I2SA 3M54A 4HVVA 1W2BA 5HK3A 3I56Q 2RH2A 2MI6A 1BI0A 1UGVA 2MAMA 2ESWA 1CKBA 1QVFS 2AKKA 2AHJB 1VQOQ 4D8KA 2Z0WA 1SKUB 1Z9QA 4LDXA 5LJ3g 2KQWA 3V7CA 4QQGA 3H6ZA 1I5LA 1WLPB 1ABQA 1PD0A 2XICA 2HDAA 1QVFA 4UC4A 2K2VA 5GMKe 3OYDA 2KVQG 1YJNA 3IQLA 4M7AC 3QSUA 1M1FA 5A0GA 2P0KA 5CAIA 1KFZA 2EBPA 2RJEA 1PG5B 4CI0C 5LJ5f 4PJMA 3JB9I 1ZBXA 1SPKA 3CCSQ 4CC2A 3EFOB 3ER0A 2LCLA 3PGGA 1LVKA 2LQWA 2XDBA 1YJ9Q 1WJSA 3CQTA 4JUVA 4E7HA 4FIBA 2JZ2A 2HL5C 5A0LA 2PUOB 1TUCA 1B34B 1LPLA 4C92G 5GMKl 3CCVA 4IIOA 2K4YA 1N9RA 4C92D 2RB6A 3JCMJ 4M77B 1PRLC 2MWPA 2XG8D 2FRWA 1T0HA 2OJ2A 2Y90A 1I07A 3CCUA 3PTAA 3ME9A 1KQSP 2P0PA 2CSIA 3C4SA 1MNEA 1OEBA 3JB9H 3M53A 1NYFA 3CCMT 1KIKA 4L6V5 5LJ5d 1BI3A 1NPRA 3CD6T 3VYGA 4CC3A 2V8IA 4BI4A 2CH4W 2WSFE 1WJQA 1K1ZA 5GMKj 1Y96A 1M90C 5LJ3e 3EGDA 5KYXB 4QVCA 1G3YA 4K11A 4J9HA 5GAOr 1K8AR 2RHUA 3ZFJA 4JRQA 3NHNA 2QAZA 2KBTA 1UJYA 3JRZA 4Y28E 1H92A 1UECA 5KE3A 1FMWA 4C0DB 2VXEA 4J6XA 1VUBA 1ZSZA 1QVGS 1M2VA 1FWZA 4TVRA 5IXBA 4FCYA 2HCKA 2RMOA 3OS0A 1TS9A 1WHHA 2LT1A 1K8AU 2KRNA 2YUNA 2RQTA 3PIOA 1QKXA 1M3AA 4FT4A 2GGRA 4RTVA 1YHQT 1Y71A 3AHUA 3CCQT 2EYWA 1QVGA 1PRMC 2RQUA 4OVAA 1UHFA 2E5QA 1NE8A 5KYYA 1VQ4T 1TH7A 1FYNA 4C5HA 2EJ9A 3PMIA 3CCVQ 3J81E 1YNZA 5GANg 3CC7T 3G1JA 3FC3A 2AIRB 3MPUB 1H3ZA 3CCUQ 4XTUA 1WX6A 3LLRA 5AT1B 1JXMA 2MPXC 1RADB 2L2PA 3NTHA 1T0JA 3CC4Q 2DRKA 5GJVB 4XQ3A 3OYIA 1B07A 2QEXT 3TQ7P 1KQ2A 1BCOA 3LGFA 4DOVA 4LDUA 3JAME 5AYFA 3M0UA 3RKWA 2HMAA 2FZKB 4NL3A 2EYQA 3EHRA 1KD1R 2CREA 3EH1A 1LNXA 1VQMQ 2L3RA 5GAMh 5LJ3j 1X27A 1VOMA 4F14A 1I8FA 3QYGB 2MIOA 2DYBA 4M78C 3OYMA 1Y96B 2DVEA 2EYXA 3THKA 4M78F 1G3TA 3EGDB 2GTOA 3REAB 3UDCA 2EQUA 4R0KA 2VWFA 4RCBA 4C92B 3TSWA 1KD1U 2DBKA 3OMGA 4ELZC 3J80E 2D1XA 4LD9K 1FMVA 1UB4A 2LZ6B 3RNJA 4FYYB 4FT2A 4LNPA 2JS0A 2H8HA 4FL6A 2D0QB 3CPWS 3QDFA 3QO3A 4LXCA 2V1QA 1M2VB 4EMKB 1BBZA 2DXUA 2YRCA 2YHTA 2OTJT 2EKHA 3UA7A 3VS5A 4FYXB 1K4US 1BKBA 5GAOl 4MDXA 2BE9B 2JW4A 2LQ8A 3CPWA 2E3IA 2YLCA 2DVJA 1V29B 1WGSA 4J83A 3EG3A 1WA7A 1ZUKA 4PJNA 3I9QA 1XNIA 3HRSA 3VJPA 3MEUA 4FSXA 1WNLA 2L0AA 2QGGA 2L89A 3M58A 4C8QC 2CUDA 1NJIC 2DX1A 3VS2A 2K5LA 1KG1A 4ME7A 5CVIA 3MCAB 4C8QF 4X34A 2E41A 4D8DA 1M3CA 2VXFA 1N8RR 4LUDA 2C0IA 3KXTA 3GF5A 3L1AA 2IVWA 1PC0A 3H0HA 1D0XA 3OBWA 1IGUA 2DRMA 4PK4A 2EYZA 2DL5A 2G3RA 1M27C 5LL6S 3G6EA 2J6FA 3OYFA 5CCAA 1YJWT 3M57A 4RTTA 5CO7A 3ZL7C 4M77E 3OYLA 3CCJQ 1WXUA 2LMJA 3R6NA 3OYKA 2KYMA 4HVUA 2DEQA 2DTIA 3JCMg 3VS7A 4J5YA 1N8RU 2PNIA 1G3SA 5IH2A 4OP0A 2WSCE 3NGPA 1WFWA 2DE0X 4PLLA 2BKDN 2QQSA 3SWNA 1OZ2A 4ANJA 4AT1B 3X20B 1QQJA 2YRDA 3FIFA 3E9GA 3CCRT 4F7UA 2DA9A 4QQ6A 2BTTA 4VUBA 3PVLA 1JB0E 4PFOA 1MMDA 1ZLMA 3CBOA 3NFCA 3VS0A 5DLOA 1QVPA 3M4GA 2JJ9A 2RHIA 3G71T 2DJQA 4O6JA 2KT1A 4KH0B 1TTHB 2MWOA 4XTVA 1M90R 2K5IA 2M02A 3T9NA 2EQKA 3JCMX 4PJOC 3EG0A 3FDRA 2KE9A 1OYXA 1KC8U 2P4RA 2Y4XA 1C6VX 1S72A 2HZYA 1YITA 4OGCA 1XOVA 4QKUA 3SHWA 2EW3A 3L2WA 1VQ8Q 4MDWA 2F2WA 3VS6A 4B6MA 4ZGDB 3CCET 3OS1A 4KUIA 3CCST 3QIIA 3PFSA 2CS7A 1KQ1A 2QDYB 3MEVA 1OPKA 3JCMQ 2F1LA 2FG0A 3JSCA 1SHFA 3PIPA 2KGTA 1QWFA 2YUPA 4M75E 2CDTA 5FLXE 3QDRB 2VKNA 1SEMA 4RTUA 3M5AA 2FPFA 3G7ZA 1KHIA 2EJGA 2DYIA 1IB8A 4RG2A 2D8HA 1V1CA 2O9SA 4HKEA 2J6OA 7AT1B 3CC2T 4M7DA 3M0SA 1YIJQ 5GJWB 1K9AA 3SFMA 3OYBA 2ZGWA 2R5AA 3HKSA 3CCLT 4BE0A 3ULRB 1F1BB 2O9VA 1SRMA 2X4WA 3P8DA 2RI5A 1VA7A 4F7UB 1TUDA 3JB9J 3FEOA 2HQEA 2E10A 4OF1A 2VGMA 4M77F 1K8AC 4LUEA 1VQ6A 1O9SA 2RK1A 1ZA1B 3EH2A 2V1RA 2B8AA 2O01E 4N4HA 5D6WA 2F5KA 5HK0A 3I56A 2DJZA 1YJNT 1X6OA 3LWHA 4OMQA 1VQOA 1ABOA 3MKDA 1YITQ 2YWWA 1VQ7Q 9ATCB 1OULA 2CP0A 4ZGEB 1T3SA 2BZ8A 3A8GB 2RQVA 4M77G 1R8OB 3GNGA 2M0OA 1W70A 1B7TA 1VQPT 5LJ5h 4II1A 2DD4A 1TUGB 4M77D 3A1PA 5DLQE 2EKOA 2K3XA 2K9GA 1U5SA 1G2BA 1MGQA 2A37A 3QWYA 3JCMb 1YP5A 4C0DC 1BIBA 5KYWA 1UGPB 3GIBA 2HSEB 3X25B 2PTKA 3A98A 3RBBB 1XJWB 3SB2A 4ZN1A 1D1CA 2DERA 3H9NA 3P8HA 1H3HA 2QYZA 1OZ3A 3H0IA 4QT7A 2AZVA 1YJ9A 2OTLA 1BK2A 4BD3A 1K73R 4OGEA 5CR2A 2DNUA 1PD1A 1QW1A 3HTRA 4CC4B 4NS5A 2LDMA 4L5GA 1KD1C 3X28B 3QWXX 5FU7B 1VQ5Q 2CP7A 4J6WA 2RA2A 5GAMe 4E47A 1M1GA 1N5ZA 1BB9A 3E19A 2R58A 3DKMA 1D3BA 3TVTA 2GFAA 1VQ6Q 1K73U 2X3WD 1KJWA 3HL8A 2QQAA 2EJFA 4LDWA 5GANh 5A0DA 1WPYA 1U06A 2EGCA 1IXDA 5CKEA 3EGUA 3EGXA 2GCXA 5D6XA 4OB1B 4N0AA 1FXXA 2RHZA 2CGHA 3M0TA 3RMQA 2CZ7B 1AHJB 4FM4B 2YUQA 3JV3A 4JS5A 1YWPA 4BY6B 1I4K1 3OY9A 2KY9A 1RABB 2HD0A 2PVDB 4A4GA 2GQIA 2NUPA 1PKSA 3L2VA 4XU2A 1E7OA 4MZPA 1EZZB 1K76A 1WHLA 4ZTFA 3CMAA 2O2OA 1GBRA 2L3QA 2QXFA 4BDYA 1RLQC 2XHCA 4Z02A 4ZTJA 1JJ2S 4C92C 3C95A 2RHYA 4WF2A 4RTZA 3GOXA 4C92F 6AT1B 4M4ZA 1U3OA 3EG9A 2O31A 1SF9A 2L3PA 4FU6A 2DILA 4PFPA 2E12A 3ZBDA 1N8RC 5KYWB 4QQDA 4EMKC 2LJ0A 1JJ2A 2V8JA 3E9FA 5DM7R 3OW2A 3I55A 2OTLQ 1UHCA 5EC7A 1EX4A 4J8OA 1ZX6A 3OYNA 3OS5A 2DKGA 4F04B 3HRTA 3INZA 4BE2A 2DBMA 1YI2A 5GAMj 2RQRA 1WZOA 1V76A 3DB3A 4CRIA 2DL4A 1VQKT 3NTIA 1ZBJA 3PNWC 5C0MA 2FPEA 2DIQA 4M75A 4MZMA 2ED1A 1JU5C 2KYBA 2I2LA 1WQ7A 2RHXA 3BY7A 1T3LA 4O5VA 3ASKA 1UGRB 3BE3A 1M8MA 3H41A 4FW1A 4J9IA 2XMFA 2X3XD 3CC4A 3OYYA 2PU9B 1ZUUA 1KC8C 3UF4A 4F7UE 2KMTA 3M0QA 5GANf 1W2BP 2RK2A 1H641 1QMCA 1WYXA 1S1NA 3QZ9B 2ROLA 1VQMA 2X4JA 3VS3A 1G5VA 3CMAQ 2RD1A 3CMEA 4OMPA 3DLLA 1NLPC 2E1HA 1QVFP 3S3NA 2XU8A 4RMOA 2LNHB 2DPPB 3G4SQ 2HEQA 4M7AA 2RN8A 4WCIA 1CKAA 1TXQA 3M0PA 1WHKA 3X26B 3LH0A 1TOVA 3LW5E 2BE7D 2JVVA 5GAN7 5GAN8 1M2OA 1VIEA 2VB6A 3RMSA 1W1FA 3I55Q 1VQLQ 5ECAA 4A4KA 1MMGA 1WJRA 2HKNA 1MV0B 2E65A 2KNBB 2LTOA 3LWIA 2EFIA 3UT1A 3HHTB 2E6ZA 3BFMA 1TWBA 3V7SA 5GAN5 4OB0B 4DBQA 1YI2Q 5I2MA 2RI3A 5GANd 1QLYA 2EGEA 1OI1A 4N4GA 2K5FA 2E5KA 2DL7A 3G6ET 4PFZA 1VQNQ 2J05A 3MP1A 3GNFB 3V8LA 4M75B 1ARKA 4E7IA 5M9OA 2E6NA 4PJJA 1VQ9Q 2E70A 4M7DE 1ZQ1A 4IUVA 5KH6A 4KGVB 3QHSA 1OQKA 4HCKA 1WQWA 2QQRA 4E6RA 5L23A 2MYSA 3URGA 2MCNA 2EPDA 2KK4A 1Q7YR 2QI2A 3TEEA 1GCQC 5KYUA 3HSBA 3CCJA 3MP8A 2VGNA 5L8RE 1P92A 3OYGA 3L2RA 1ZA2B 4C5GA 4X9DA 1GXIE 2QASA 3UPUA 1TU0B 3UATA 3CMEQ 1OU8A 1X6BA 1VIFA 1AZEA 1Q7YU 4LE9A 3VUZA 3JCMf 2LP5A 1E6HA 4WTOB 2YXYA 3JCMc 4F7UF 2MK5A 4R56A 1RAAB 4M7AB 2RF0A 1S72T 1ZSZB 1IHWA 2JXBA 2ROTA 5LJ5e 1RI0A 4DBHA 2X35A 1D09B 2M51A 1Q82U 1BI2A 4J9EA 3RDVA 1RLPC 2COZA 2O4XA 3WVEB 4J7IA 2XIDA 4DEYA 2EAYA 3C0CA 4BI3A 5KE2A 2ZPIB
chains in the Genus database with same CATH topology
1MHNA 4M77A 3X24B 2C06A 1SSFA 2IG0A 2VUBA 5LJ5g 1YBYA 3CMET 4M75E 1NJIU 3DLMA 3JB9F 3QJYA 5FLXE 3QDRB 5GAOm 2CZ6B 1N9SA 4F7UG 4C0GA 1DJ7B 3HP9A 3M5AA 5GMKh 2NLUA 2JTFA 4XU3A 1VQ8A 2CYZB 3G7ZA 2ZPBB 4EMHA 3CCLA 1KHIA 2EJGA 2MF2A 5I2SA 4RG2A 2JNGA 1K73C 2H3JA 3M54A 1W2BA 5HK3A 2ZPGB 5A2QE 4C92A 1U1SA 2RH2A 4HKEA 4M7DA 2MI6A 3L2ZA 3PMTA 3CC2T 1BI0A 2MAMA 3FRNA 3SFMA 5J39A 3OYBA 1FX7A 2ZGWA 2HBPA 1QVFS 2AHJB 1JBMA 1VQ8T 2R5AA 3HKSA 5I21A 3CCLT 4BE0A 3E1SA 2KSSA 1M1KU 4LDXA 1UGQB 3P8DA 2X4WA 4C8QE 5LJ3g 2KQWA 3JCMd 5GAOq 3V7CA 4QQGA 2RI5A 3H6ZA 4EMKA 5DY9A 2CKKA 4XU0A 2QTXA 2XI9A 5CIUA 4A4HA 1Y7XA 4F7UB 1I5LA 2XD0A 3CCQA 3OB9A 4E7KA 3JB9J 4PKCC 3RIRA 2XICA 3FEOA 4DQ2A 2D6FA 2HQEA 1QVFA 2E10A 2K2VA 1NZ9A 4UC4A 2KVQG 5GMKe 3BW1A 2VGMA 4OF1A 4M77F 2CZ0B 3OYDA 1YJNA 1K8AC 4M7AC 1Q81C 3V8KA 1I81A 1VQ6A 1O9SA 2RK1A 3QSUA 1M1FA 3P8BB 1VQ4A 2GQVA 5A0GA 2P0KA 1QP3A 2B8AA 2O01E 5CKDA 5IT9E 4BB7A 4N4HA 5D6WA 2DIGA 2DTOA 2F5KA 3BDLA 5KCHA 2DTHA 5GAOn 3L2UA 5CAIA 5FRNA 5HK0A 3I56A 2P4TA 2RJEA 4QVZA 2EIFA 2DJZA 3MP6A 4JLGA 5FU6C 1ZHIA 4P5NA 1YIJA 1YJNT 1X6OA 3SDZA 4CI0C 4MMLA 3VYHB 3LWHA 5LJ5f 1VQ6T 2F69A 4A54A 1VQOA 2L8DA 2PVGB 5FU7C 2L5QA 4V2SA 2V8KA 4XTYA 3JB9I 1ZBXA 3I56T 4BACA 4A53A 2DZCA 1YIJT 4M78A 4ZGEB 4C0ZA 2LVMA 3ER0A 2LCLA 3PGGA 3WVDB 1VQOT 3A8GB 5LJ5j 1M4ZA 2XDBA 1U1TA 4M77G 2X4XA 4ATOA 5IAYA 1R8OB 3EAEA 3GNGA 3GP8A 3TREA 2EQMA 2M0OA 2RM4A 1WJSA 1VQPT 5LJ5h 4JUVA 4II1A 2DD4A 4E7HA 4FIBA 1VQKA 4M77D 3JCMW 2JZ2A 3MO8A 5DLQE 2EKOA 2K3XA 3Q1JA 5A0LA 2VV5A 2PUOB 3V8JA 1IZ6A 1B34B 2CZ1B 2O4XB 3QYHB 1MGQA 4C92G 1XTDA 3ZEHA 4DA4A 4A4EA 4M7DG 3JCMb 3SWNC 2DZ9A 3M9QA 5GAN2 5GMKl 4C0DC 4KT0E 1BIBA 3GIBA 1UGPB 2RJCA 4BY6C 4XAXB 2RJFA 3X25B 2K4YA 1N9RA 4C92D 2RB6A 3CCVA 4M7DD 3JCMJ 2RI2A 4M77B 3VKIA 2MWPA 1VQ7A 2WSEE 1PSEA 2XG8D 5IN1A 3SB2A 4ZN1A 3P8HA 2Y90A 2R5MA 5LJ3h 2JOYA 3META 1OZ3A 3CCUA 3PTAA 2ZPHB 3CCMA 3OYAA 2WACA 4PJOE 2LNVA 2R57A 3ME9A 3OS2A 1YITT 1YJ9A 2OTLA 3CD6A 4BD3A 4HCBA 2P0PA 4HT8A 1VQ7T 2FHDA 2XDPA 2XKOC 3C4SA 3GLXA 4OGEA 4EPCA 3R6OA 5CR2A 4D6WA 3JB9H 5FU6B 3M53A 1QW1A 3CCMT 4C8QA 2RO0A 3PT9A 4L6V5 5LJ5d 2E64A 2LDMA 4NS5A 4L5GA 1KD1C 3X28B 5FU7B 3C12A 1BI3A 1NPRA 1YJ9T 4ZN3A 3CD6T 3OBYA 4J6WA 3VYGA 3OYHA 2V8IA 4BI4A 2WSFE 1WJQA 2RA2A 3F70A 5GAMe 5GMKj 5J3BA 2HQXA 4E47A 2A7YA 2DD5A 1KHCA 1M1GA 3E19A 2R58A 3DKMA 1Y96A 3SD4A 1D3BA 3JCMP 1M90C 2GFAA 5LJ3e 3MEAA 3HFOA 1K73U 4XTXA 4QVCA 1G3YA 4C5EA 4E7LA 3HL8A 5GAOr 3OMCA 2RHUA 4M78G 3ZFJA 4JRQA 2QQAA 2EJFA 4LDWA 5GANh 5A0DA 1WPYA 2OAUA 5GAN3 3HFNA 3WXMB 2LRQA 2FB7A 5CKEA 5GAMg 2GCXA 4M78D 5D6XA 3JRZA 4Y28E 4PNOA 2VC8A 4N0AA 4OB1B 1FXXA 2RHZA 4XK8E 2CGHA 3OYJA 3RMQA 2CZ7B 3M55A 1AHJB 1N27A 2DXTA 3SWNB 4FM4B 5KE3A 4C0DB 2VXEA 4L59A 4J6XA 4JS5A 1VUBA 4IURA 4EMGA 1VQ5A 4BY6B 4JS4A 4OB3B 1QVGS 1I4K1 4LDVA 1FWZA 2KY9A 4IUQA 4TVRA 3OY9A 2LX9A 4JJNK 1YHQA 2HD0A 3OS0A 2PVDB 4A4GA 2LT1A 1K8AU 4M77C 1Q81U 3PIOA 4XTZA 4EDUA 4RG8A 4XU2A 3L2VA 2DAQA 4MZPA 4FT4A 4ZTFA 3CMAA 1VQ5T 4KULA 2LCCA 2JN0A 1YHQT 2QXFA 5GANe 1Y71A 3KUFA 3CCQT 4BDYA 3AHUA 4OB2B 2XHCA 3QPHA 3RESA 1QVGA 4OVAA 4Z02A 4RKUE 4ZTJA 3MHXA 4C5IA 1JJ2S 2E5QA 4C92C 4PL6A 3C95A 3CC7A 4M7DC 2RHYA 4WF2A 1NE8A 1VQ4T 3GOXA 4C92F 1TH7A 4M7DF 2HNIA 4J6YA 5GAN6 4C5HA 1U8RA 2EJ9A 3PMIA 4M7AE 1LOJA 4FU6A 3J81E 2MMPA 4C8QG 2E12A 3ZBDA 5GANg 1N8RC 3CC7T 4QQDA 5CKFA 2F5TX 4EMKC 3FC3A 2QEXA 4JRIA 2M1HA 1JJ2A 2V8JA 3E9FA 5DM7R 3OW2A 4NOYA 3I55A 4XTUA 4PJOA 1H3ZA 4C8QD 5GAMf 3LLRA 1EIFA 3OYCA 3QJ6A 4J8OA 3OYNA 3NTHA 1K9MC 3OS5A 5CQXA 2DKGA 4XQ3A 3OYIA 2QEXT 2A3LA 3HRTA 3INZA 5LJ3f 1KQ2A 3OSVA 1YCYA 1Q86C 3A8MB 3LGFA 2M9UA 3OSSC 3QXEB 5FROA 4LDUA 4DOVA 3JAME 3OQ5A 3G71A 5AYFA 1YI2A 5GAMj 3RKWA 4NL3A 3NTKA 1X75C 2EYQA 2ZPEB 3DB3A 4CRIA 1VQKT 3NTIA 3PNWC 2PQWA 5C0MA 3FJPA 2DIQA 2JTMA 4M75A 4MZMA 1LNXA 2L3RA 5CKHA 5LJ3j 5GAMh 2XDDA 4GLKA 5D6YA 3S3MA 1I8FA 2I2LA 3QYGB 1WQ7A 2RHXA 2RJDA 4M78C 4BE1A 3OYMA 1HXDA 1UEBA 1Y96B 2DVEA 3BY7A 3V7RA 5GMKm 3ASKA 4M78F 1G3TA 4O5VA 1UGRB 3VUBA 1PSFA 3CCVT 3EFSA 4NL2A 5KCOA 3UDCA 2EQUA 2K57A 4PJOF 3CC4A 3OYYA 4RCBA 4C92B 2PU9B 5CK9A 1Q7YC 1KD1U 4M7DB 2ZPFB 3OMGA 1KC8C 4F7UE 2JUFA 4ELZC 5CKBA 3CCEA 2QQ9A 3J80E 3CCUT 2OTJA 2KMTA 5GANf 4LD9K 4Y91A 1UB4A 2RK2A 2DXCA 4DOWA 2OTLT 4XTWA 1H641 4FT2A 4KUDK 4FL6A 2D0QB 3CPWS 3CC4T 5FRMA 1N6AA 3QO3A 4B9WA 3VV0A 3QZ9B 1M90U 4EMKB 2DXUA 1VQMA 2YHTA 2X4JA 3KBGA 2OTJT 1Y07A 3OYEA 1G5VA 3FB9A 4MZTA 2FL7A 1BI1A 5C6SA 1IREB 5GANj 4M75F 2RD1A 3QBYA 1B34A 5GAMd 1BIAA 1Q82C 2PVOB 3CMEA 2DK3A 2GF7A 1BKBA 3EFRA 3O8VA 4JDSA 5GAOl 3DLLA 4MDXA 2LQ8A 4RCCA 3CPWA 2YLCA 1VQMT 2E1HA 1V29B 3S3NA 5LJ3d 4PJOG 2XU8A 2KDSA 3CBMA 4RMOA 3CXCS 1WGSA 2LC4A 1W4SA 4J83A 2Y4YA 2M16A 2DPPB 4BI8B 1KQSA 4M7AA 4JRPA 4PJOD 3CC2A 1XNIA 3HRSA 2VYTA 3MEUA 3M58A 1WNLA 4FSXA 4N4IA 2L89A 3VJPA 3X26B 3LH0A 4C8QC 4BDZA 1NJIC 3LW5E 3LGLA 2K5LA 1KG1A 2JVVA 4ME7A 5CVIA 3MCAB 4C0FA 4LD6A 4X34A 4C8QF 2E41A 5GAN8 5GAN7 3GPLA 1VIEA 3RMSA 3A8HB 3LX7A 3CXCA 2VXFA 4A4KA 4M78B 3HRUA 2PUKB 1BYMA 4MMKA 2EQJA 3JCMe 1WJRA 4HCZA 3KXTA 3GF5A 4M75G 1YJWA 2E65A 2P0QA 3L1AA 4PJOB 2IVWA 3CBPA 2LTOA 3CEYA 3OBWA 3LWIA 4X9CA 3QUIA 3L2QA 2EFIA 3UT1A 2G3RA 3HPWA 3HHTB 4M75D 3M4YA 2E6ZA 3BFMA 5LL6S 3V7SA 3G6EA 2FYKA 1UGSB 5GAN5 1M1KC 4OB0B 4HCCA 3OYFA 5CQYA 2ZZDA 5EG2A 5CCAA 3OW2S 1YJWT 3M57A 3RKYA 5CO7A 3CMAT 1M9SA 2RI3A 5I2MA 5GANd 2K3YA 4M77E 4B9XA 3OYLA 1JRIA 3A8LB 3LYIA 1OI1A 3OYKA 3QKJA 4E7JA 4N4GA 2DEQA 3JB9G 2DTIA 4N0AC 3JCMg 3G4SA 2K5FA 4PLIA 4J5YA 1N8RU 4IUTA 1G3SA 3G6ET 3MP1A 3VU3C 3GNFB 4IKFA 4OP0A 3JB9D 4M7AF 3V8LA 4M75B 1M8VA 4E7IA 1RL2A 2LQKA 5M9OA 1M5Q1 2WSCE 3CCRA 2YRVA 4PLLA 2E6NA 4A4FA 3G4ST 4C92E 3CPFA 1VQLA 1K9MU 2BKDN 2E70A 2QQSA 4M7DE 1ZQ1A 4IUVA 3SWNA 5KH6A 1OZ2A 3MEWA 3QHSA 4OMFB 4BUGA 1WQWA 3A5ZB 3X20B 1Q86U 2QQRA 3OA6A 3FIFA 3CCRT 3E9GA 4F7UA 2FVUA 4QQ6A 3URGA 3I55T 1VQLT 1NPPA 4VUBA 3A8OB 1JB0E 2KK4A 3CBOA 4HA8A 2X4YA 3JCMV 1VQPA 2QI2A 3RKXA 3TEEA 3NFCA 4C8QB 5DLOA 5HY6A 3HSBA 3CCJA 3MP8A 2VGNA 5L8RE 1P92A 1QVPA 2DO3A 3BDUA 3M56A 2EWNA 3M4GA 3UWNA 5GAOp 5J26A 3OYGA 2QA4A 2HAXA 5GAN4 2RHIA 1XQHA 3S6WA 4ZGJB 3L2RA 3G71T 4HT9A 4C5GA 4O6JA 4X9DA 1VQNA 4M7AG 3UPUA 4BE2A 1GXIE 1YI2T 2D9TA 4ELYC 2BIVA 2MWOA 3CCJT 1D3BB 4XTVA 2QQBA 4IUPA 2K5IA 3TU4K 4KBMB 1G3WA 3T9NA 2QA4T 1O75A 1VQ9A 4M7AD 2EQKA 3JCMX 4PJOC 3FDRA 1VIFA 1Q7YU 5GMKi 4IUUA 1VQNT 1OYXA 3J7AF 1KC8U 3VUZA 3JCMf 3TCJA 2Y4XA 3C94A 2GFUA 4QVDA 3S3OA 1S72A 5HKCA 3H8ZA 4R55A 1YITA 2LT4A 4OGCA 1XOVA 1HK9A 3L42A 1QP2A 4YTLA 1VQ9T 2DXBA 3JCMc 4JRKA 2KAFA 4M78E 1X01A 4F7UF 4MDWA 4R56A 4M7AB 3L2WA 3CCSA 2BUDA 1S72T 4ZGDB 5LJ5e 1RI0A 3CCET 2X35A 3QZ5B 4M75C 2XK0A 3OS1A 3N5BB 1Q82U 1KQSS 4KUIA 1BI2A 3CCST 3QIIA 3PFSA 3RUXA 3M59A 2CS7A 1KQ1A 3JCMh 2QDYB 3DB4A 3MEVA 2O4XA 3WVEB 4XU1A 1LJOA 4GY5A 2ZCFB 4J7IA 4LDYA 2XIDA 4QW2A 4JLIA 4Q5WA 3JCMQ 3RERA 3JSCA 4J7FA 2EAYA 3FLGA 3PIPA 4BI3A 5KE2A 3QG1A 1W2BS 2ZPIB 2YLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M77 A;  5GAM f;  4M75 D;  3SB2 A;  5LJ5 g;  3BFM A;  3V7S A;  2FYK A;  2Y90 A;  4M75 E;  5GAN 5;  5LJ3 h;  3JB9 F;  5GAO m;  2DKG A;  4XQ3 A;  3RKY A;  4PJO E;  1N9S A;  3INZ A;  4F7U G;  5GAN d;  5LJ3 f;  4M77 E;  5GMK h;  1KQ2 A;  1JRI A;  1YCY A;  4XU3 A;  4EMH A;  3JB9 G;  2DEQ A;  4HT8 A;  2DTI A;  4N0A C;  3JCM g;  2EJG A;  4J5Y A;  3JB9 H;  5GAM j;  3RKW A;  4NL3 A;  4C92 A;  1U1S A;  4M7D A;  3VU3 C;  3L2Z A;  4C8Q A;  5LJ5 d;  4OP0 A;  3JB9 D;  2E64 A;  3V8L A;  4M75 B;  4M7A F;  1M8V A;  3FJP A;  2ZGW A;  1M5Q 1;  4M75 A;  1JBM A;  1LNX A;  4J6W A;  5I21 A;  5GAM h;  5LJ3 j;  2RA2 A;  4C92 E;  4M7D E;  5GAM e;  4C8Q E;  1I8F A;  5GMK j;  2I2L A;  3SWN A;  5LJ3 g;  3JCM d;  1WQ7 A;  5GAO q;  3V7C A;  4M78 C;  3QHS A;  1HXD A;  1Y96 B;  2DVE A;  3BY7 A;  4EMK A;  1WQW A;  3V7R A;  5DY9 A;  5GMK m;  4XU0 A;  1Y96 A;  2QTX A;  1D3B A;  4M78 F;  4F7U B;  3JCM P;  3FIF A;  1I5L A;  5LJ3 e;  3HFO A;  4F7U A;  3RIR A;  3JB9 J;  3EFS A;  4XTX A;  4NL2 A;  4QVC A;  4DQ2 A;  5GAO r;  2K57 A;  4PJO F;  2E10 A;  5GMK e;  4HA8 A;  4M78 G;  3JCM V;  3BW1 A;  4M77 F;  4RCB A;  4C92 B;  3RKX A;  4M7A C;  3QSU A;  3V8K A;  1I81 A;  2EJF A;  4C8Q B;  5GAN h;  1WPY A;  5GAN 3;  3HSB A;  4M7D B;  4F7U E;  3HFN A;  2FB7 A;  5GAN f;  5GAM g;  3BDU A;  3M4G A;  2EWN A;  4M78 D;  4Y91 A;  5GAO p;  4PJO A;  5GAO n;  2DTO A;  4PNO A;  4XTW A;  2VC8 A;  2DTH A;  4N0A A;  1H64 1;  5GAN 4;  5CAI A;  4HT9 A;  2CGH A;  4X9D A;  4M7A G;  2DXT A;  3SWN B;  3QO3 A;  2DJZ A;  2VXE A;  4J6X A;  4MML A;  4EMK B;  5LJ5 f;  2DXU A;  4EMG A;  2YHT A;  1D3B B;  4XTV A;  4A54 A;  1I4K 1;  4M7A D;  3FB9 A;  4V2S A;  5GAN j;  3JCM X;  4PJO C;  4M75 F;  2RD1 A;  1B34 A;  4XTY A;  5GAM d;  4M77 C;  1BIA A;  5GMK i;  3JB9 I;  4XTZ A;  4XU2 A;  4A53 A;  2DZC A;  3JCM f;  4M78 A;  3EFR A;  5GAO l;  4QVD A;  4RCC A;  2YLC A;  3PGG A;  2E1H A;  5LJ3 d;  5LJ5 j;  1HK9 A;  2JN0 A;  4PJO G;  5GAN e;  3AHU A;  1U1T A;  4M77 G;  3RES A;  3JCM c;  4JRK A;  4M78 E;  4F7U F;  1X01 A;  2RM4 A;  4M7A B;  5LJ5 h;  4M7A A;  4PJO D;  4JUV A;  4C92 C;  4M7D C;  1WNL A;  4M77 D;  4C8Q C;  4WF2 A;  3JCM W;  5LJ5 e;  4C92 F;  1TH7 A;  4M7D F;  5GAN 7;  4M75 C;  4C8Q F;  2HNI A;  2E41 A;  4J6Y A;  3V8J A;  5GAN 6;  5GAN 8;  1B34 B;  2EJ9 A;  4M7A E;  3RUX A;  3JCM h;  1MGQ A;  1KQ1 A;  1LOJ A;  4C92 G;  2VXF A;  4M7D G;  4XU1 A;  1LJO A;  4M78 B;  3SWN C;  4C8Q G;  3JCM b;  4MMK A;  2DZ9 A;  3JCM e;  5GAN g;  5GMK l;  5GAN 2;  4JLI A;  3JCM Q;  1BIB A;  4M75 G;  4EMK C;  3GIB A;  3RER A;  2E65 A;  3L1A A;  4JRI A;  2EAY A;  4PJO B;  1N9R A;  4C92 D;  2RB6 A;  4NOY A;  4XTU A;  3JCM J;  4M77 B;  4C8Q D;  4M7D D;  4X9C A;  3QUI A;  2YLB A; 
#chains in the Genus database with same CATH topology
 2DFU A;  2C06 A;  3X24 B;  1SSF A;  1M1K R;  1YBY A;  2SRC A;  1Q95 G;  3DLM A;  3QJY A;  1D0Z A;  1MMN A;  1QVG P;  1WHG A;  5KYY B;  2AT1 B;  2CZ6 B;  1N9S A;  1C0M A;  4F7U G;  5GMK h;  1X69 A;  2JTF A;  1VQ8 A;  2CYZ B;  4EMH A;  1WHJ A;  1R0B G;  4RTW A;  1K73 C;  1AWJ A;  3L2Z A;  3PMT A;  2HKQ B;  3FRN A;  5J39 A;  1JBM A;  1E6G A;  2AZS A;  3E1S A;  2KSS A;  1M1K U;  3JCM d;  1AOJ A;  2KRO A;  1WXT A;  3H0F A;  5DY9 A;  1M3B A;  2CKK A;  2XD0 A;  1Y7X A;  2FRY A;  2OAW A;  3CCQ A;  4E7K A;  4PKC C;  3RIR A;  1NZ9 A;  5KYU B;  2I0N A;  3V8K A;  2J6K A;  1VQ4 A;  2IIM A;  2F2V A;  5CKD A;  5GAO n;  2DTO A;  3L2U A;  2LCS A;  5FRN A;  2P4T A;  2EIF A;  3MP6 A;  4JLG A;  1YIJ A;  1ZHI A;  1VQ6 T;  3SDZ A;  4MML A;  1MMA A;  2F69 A;  4KGX B;  5FU7 C;  4V2S A;  2PZ1 A;  2KRS A;  1OOT A;  3I56 T;  4BAC A;  1AZG B;  4A53 A;  2KXC A;  2LX7 A;  4M78 A;  3E2U A;  4OML A;  2LVM A;  1KC8 R;  1NEG A;  1JXO A;  1VQO T;  5LJ5 j;  3CCM Q;  1PHT A;  1U1T A;  2LQN A;  1JQQ A;  3EAE A;  3CD6 Q;  1FMK A;  1RAG B;  2EQM A;  4ORZ A;  3JCM W;  3I35 A;  3MO8 A;  4IIM A;  4PJL A;  3Q1J A;  3V8J A;  1IZ6 A;  2CZ1 B;  2O4X B;  1XTD A;  3ZEH A;  4A4E A;  1NM7 A;  4M7D G;  2DZ9 A;  4KT0 E;  1TG0 A;  4BY6 C;  2RJF A;  4M7D D;  2RI2 A;  3VKI A;  1VQ7 A;  2WSE E;  5IHI A;  3CPW P;  2R5M A;  5LJ3 h;  3OYA A;  4FYW B;  2LNV A;  2R57 A;  3OS2 A;  4A63 B;  4HCB A;  4HT8 A;  2FHD A;  2XDP A;  2XKO C;  4J9D A;  5FU6 B;  3NMZ C;  4C8Q A;  2RO0 A;  3PT9 A;  3D7S B;  4F16 A;  1YJ9 T;  4ZN3 A;  2ENM A;  3MJX A;  3OBY A;  3OYH A;  1YHQ Q;  3F70 A;  3CCQ Q;  1I5O B;  1GBQ A;  1D0Y A;  2A7Y A;  2DD5 A;  1KHC A;  4DEX A;  3SD4 A;  3JCM P;  2CSQ A;  3HFO A;  3EG1 A;  4XTX A;  1VQ4 Q;  2C0T A;  4C5E A;  4KRT A;  3OMC A;  1Q81 R;  2RQW A;  2LRQ A;  2FB7 A;  3CC7 Q;  5GAM g;  2VC8 A;  1RAC B;  1C1A A;  1N27 A;  2DXT A;  3SWN B;  2EGA A;  4KH1 B;  4EMG A;  1VQ5 A;  4F17 A;  4LDV A;  4IUQ A;  2VAS A;  2G6F X;  2OX7 A;  4GBQ A;  2QEX Q;  4M77 C;  1Q81 U;  1D1A A;  4XTZ A;  4EDU A;  2EVR A;  1YWO A;  2O88 A;  1WIE A;  1D1B A;  2LCC A;  2JN0 A;  3KUF A;  2CP5 A;  1ACM B;  3QPH A;  3RES A;  4RKU E;  3MHX A;  1H8K A;  4PL6 A;  2QK0 A;  2JS2 A;  4JPB W;  4J6Y A;  5GAN 6;  1GRI A;  4M7A E;  1LOJ A;  4JZ3 A;  1UFF A;  5CKF A;  2F5T X;  1AVZ C;  4JRI A;  2M1H A;  1AT1 B;  4PJO A;  2A36 A;  4J9C A;  3OYC A;  1NEB A;  5HCK A;  1G83 A;  2A3L A;  5LJ3 f;  1A0N B;  4AG1 C;  3OSV A;  2OTJ Q;  5I22 A;  3A8M B;  2M9U A;  3G71 A;  3OQ5 A;  1ZUY A;  2H3E B;  2SEM A;  2ZPE B;  1YFN A;  2JTM A;  1M30 A;  2OI3 A;  5CKH A;  3RR6 A;  2XDD A;  4LN2 A;  4GLK A;  1JO8 A;  5IXF A;  3S3M A;  2HBW A;  2RJD A;  4FYV B;  1GFD A;  1UEB A;  2C0O A;  5GMK m;  3V7R A;  2DLP A;  2VVK A;  3I5S A;  3CCV T;  1RUW A;  4NL2 A;  3REB B;  5KCO A;  4Z88 A;  1AWO A;  5CK9 A;  1Q7Y C;  2AK5 A;  4M7D B;  2ZPF B;  4RUG A;  1ZSG A;  2JUF A;  3CCE A;  5CKB A;  3CCU T;  5KYN A;  1GCP A;  2DXC A;  4XTW A;  3TSZ A;  4AG2 C;  1BU1 A;  3CC4 T;  4KUD K;  1SSH A;  3OYE A;  1YJW Q;  3FB9 A;  4MZT A;  4M75 F;  1B34 A;  4RTY A;  2A08 A;  1Q82 C;  2QGF B;  2DK3 A;  2GF7 A;  4HXJ A;  4RCC A;  3VRZ A;  1VQM T;  5LJ3 d;  1R77 A;  2W0Z A;  2LC4 A;  2IPO B;  1W4S A;  2M16 A;  2K3B A;  3KFV A;  2LJ1 A;  4BI8 B;  1KQS A;  1MND A;  3CC2 A;  2VYT A;  4BDZ A;  4FSS A;  8AT1 B;  4LD6 A;  3A8H B;  3CCR Q;  3LX7 A;  2YT6 A;  1BYM A;  3HRU A;  2PUK B;  2EQJ A;  2FZC B;  4M75 G;  2NUT A;  2P0Q A;  4PJO B;  3CEY A;  1LCK A;  4X9C A;  2L3S A;  3L2Q A;  4M75 D;  1K9M R;  1M1K C;  1UGS B;  3G71 Q;  4HCC A;  2DET A;  5EG2 A;  3OW2 S;  3RKY A;  4B9X A;  1Q86 R;  1JRI A;  3A8L B;  3LYI A;  4E7J A;  3QKJ A;  3JB9 G;  5KYX A;  3G4S A;  2JMA A;  1OU9 A;  3VU3 C;  1M8V A;  3JB9 D;  4M7A F;  1ZSZ C;  1RL2 A;  2LQK A;  2K79 A;  2YRV A;  2COW A;  1VQL A;  3CPF A;  1K9M U;  3MEW A;  3VRY A;  4JJD A;  1OV3 A;  4ESR A;  1PM3 A;  3A5Z B;  1Q86 U;  1RAE B;  4OMN A;  3CCE Q;  2BZY A;  2X9H A;  1VYT A;  1NPP A;  3JCM V;  1VQP A;  2X4Y A;  2ABL A;  5HY6 A;  2CH4 A;  2DO3 A;  1CSK A;  3BDU A;  5GAO p;  3UWN A;  2QA4 A;  5J26 A;  1XQH A;  3S6W A;  4ZGJ B;  4HT9 A;  4M7A G;  1VQN A;  1UUE A;  1JEG A;  3CCJ T;  1D3B B;  2QQB A;  4M7A D;  1VQ9 A;  1O75 A;  1AD5 A;  5GMK i;  4IUU A;  1K0S A;  1NYG A;  3TCJ A;  3C94 A;  2GFU A;  4QVD A;  3H8Z A;  2LT4 A;  3EGX B;  1UDL A;  3L42 A;  3CC2 Q;  4YTL A;  1QP2 A;  2DXB A;  4M78 E;  2KAF A;  1X01 A;  1B3Q A;  3CCL Q;  2BUD A;  2ED0 A;  1RI9 A;  4HVW A;  2RNA A;  1VYU A;  3QZ5 B;  2XK0 A;  3N5B B;  2D8J A;  3JCM h;  2NUP B;  5FW9 A;  4GY5 A;  2ZCF B;  2NUT B;  4JLI A;  4Q5W A;  3FLG A;  2YLB A;  1MHN A;  2GNC A;  2HL3 A;  2JMC A;  2VUB A;  5LJ5 g;  4GLM A;  3VS4 A;  4E2F B;  2YSQ A;  5GAO m;  1YJN Q;  1DJ7 B;  3EG9 B;  2ZPB B;  1TSF A;  1HD3 A;  2JNG A;  2H3J A;  4AFQ C;  2ZPG B;  5A2Q E;  4C92 A;  1U1S A;  2DM1 A;  2FPD A;  1FX7 A;  2HBP A;  4Y92 A;  1VQ8 T;  5I21 A;  2ECZ A;  3EHQ A;  1UGQ B;  4C8Q E;  1SHG A;  1JJ2 P;  3OW2 P;  5GAO q;  1KSW A;  2NWM A;  4EMK A;  1VQP Q;  4A4H A;  4XU0 A;  2QTX A;  2XI9 A;  5CIU A;  3OB9 A;  4DQ2 A;  2D6F A;  3U23 A;  2QA4 Q;  3BW1 A;  1PKT A;  2CZ0 B;  2DF6 A;  1Q81 C;  1I81 A;  3P8B B;  2GQV A;  8ATC B;  1QP3 A;  5IT9 E;  1IGQ A;  4BB7 A;  2DIG A;  3BDL A;  5KCH A;  5FWC A;  2DTH A;  5IHK A;  2RPN A;  4QVZ A;  1OX8 A;  5FU6 C;  4P5N A;  2BZX A;  3VYH B;  1GL5 A;  4A54 A;  2L8D A;  2PVG B;  2L5Q A;  2K2M A;  2V8K A;  3PE0 A;  4XTY A;  4EIK A;  1UTI A;  2DZC A;  1WXB A;  1YIJ T;  4C0Z A;  3WVD B;  1M4Z A;  1W6X A;  2F2X A;  2X4X A;  4ATO A;  5IAY A;  3GP8 A;  1IHV A;  3TRE A;  2RM4 A;  3UA6 A;  1VQK A;  2CP3 A;  2YUO A;  2VV5 A;  3NPF A;  1Q82 R;  3QYH B;  4J9B A;  4DA4 A;  1OPL A;  3SWN C;  3M9Q A;  5GAN 2;  1QWE A;  2RJC A;  4XAX B;  4AMC A;  2W10 A;  2EQI A;  1PSE A;  1Z9Z A;  5IN1 A;  1I1J A;  1QCO A;  2E3H A;  2JOY A;  3MET A;  3CCM A;  2ZPH B;  2WAC A;  4PJO E;  1YIT T;  2A0F B;  3CD6 A;  1VQ7 T;  1RAH B;  2CP2 A;  3GLX A;  4EPC A;  3R6O A;  4D6W A;  2JM9 A;  2E64 A;  4AFS C;  1WDX A;  3C12 A;  1K0X A;  1RAI B;  1PCX A;  2B86 A;  5J3B A;  2HQX A;  1R0C B;  2DMO A;  2QG9 B;  3MEA A;  3FJ5 A;  4E7L A;  4ZNX A;  4M78 G;  1HSQ A;  5GAN 3;  2OAU A;  3GBQ A;  3HFN A;  3WXM B;  4M78 D;  4PNO A;  4XK8 E;  3OYJ A;  3M55 A;  4L59 A;  4IUR A;  4JS4 A;  4OB3 B;  4JJN K;  2LX9 A;  1YHQ A;  3AT1 B;  4RG8 A;  2DAQ A;  2DEU A;  1QCF A;  1VQ5 T;  2KR3 A;  4KUL A;  2NUZ A;  1VQK Q;  5GAN e;  2YDL A;  4OB2 B;  2CP6 A;  4E7Z A;  2KRM A;  4C5I A;  1GCQ A;  3CC7 A;  4M7D C;  1UJ0 A;  4M7D F;  2HNI A;  1WHM A;  4J9G A;  1U8R A;  5I11 A;  2MMP A;  4C8Q G;  1YN8 A;  4DBR A;  2QEX A;  4RTX A;  4NOY A;  1HYO A;  4C8Q D;  1NG2 A;  5GAM f;  1EIF A;  3SEM A;  1EFN A;  3QJ6 A;  2J06 A;  1K9M C;  5CQX A;  2FZG B;  1QCN A;  1YCY A;  2MOX A;  1Q86 C;  3QXE B;  3OSS C;  5FRO A;  1J3T A;  1HJD A;  2COY A;  4E7S A;  3NTK A;  1X75 C;  3I5R A;  2PQW A;  3FJP A;  4AFZ C;  5D6Y A;  2CT4 A;  2HSP A;  2E4H A;  1SG5 A;  4BE1 A;  1HXD A;  1AEY A;  2GBQ A;  2EYY A;  3LH5 A;  3M0R A;  3VUB A;  1PSF A;  3EFS A;  2K57 A;  4PJO F;  1VYV A;  2P84 A;  2QQ9 A;  2OTJ A;  1X2K A;  4Y91 A;  4DOW A;  2OTL T;  4DBF A;  5FRM A;  1N6A A;  4JZ4 A;  4B9W A;  3VV0 A;  4CC7 A;  1M90 U;  5FWB A;  3KBG A;  1X43 A;  1I0C A;  1Y07 A;  2HQH A;  2FL7 A;  1BI1 A;  4FW2 A;  1IRE B;  5C6S A;  1PNJ A;  5GAN j;  3QBY A;  5GAM d;  1BIA A;  2PVO B;  4J9F A;  3EFR A;  3O8V A;  4JDS A;  3G6E Q;  1YCS B;  1AWW A;  2DL3 A;  2QDL A;  4PJO G;  1Y57 A;  3CBM A;  1X2Q A;  2KDS A;  2M0Y A;  3CXC S;  2Y4Y A;  2KT8 A;  3VS1 A;  2K6D A;  4PJO D;  4JRP A;  4N4I A;  3LGL A;  2FO0 A;  1X6G A;  4KGZ B;  4C0F A;  4OMO A;  3GPL A;  1BCM A;  2KXD A;  3CXC A;  2DL8 A;  4M78 B;  4MMK A;  3JCM e;  4HCZ A;  1YJW A;  1UE9 A;  2A28 A;  2FEI A;  3CBP A;  3QUI A;  1Y0M A;  3HPW A;  3M4Y A;  2FYK A;  4Z8A A;  2GTJ A;  5CQY A;  2ZZD A;  2K7A A;  1IRX A;  3CMA T;  1M9S A;  2K3Y A;  2ATC B;  2JT4 A;  4N0A C;  2V26 A;  4PLI A;  4IUT A;  4IKF A;  1M5Q 1;  5D7U A;  3CCR A;  3G4S T;  4A4F A;  4C92 E;  2ZAE A;  4OMF B;  4BUG A;  1S72 Q;  3OA6 A;  2FVU A;  3I55 T;  1VQL T;  4HA8 A;  2AKL A;  3A8O B;  1OX9 A;  1NBE B;  3O5Z A;  3RKX A;  2KEA A;  4C8Q B;  1PWT A;  1IO6 A;  3M56 A;  2EWN A;  1MV3 A;  2HAX A;  5GAN 4;  1QKW A;  2JM8 A;  4OMM A;  1YI2 T;  2D9T A;  4ELY C;  2BIV A;  1SRL A;  2D0N A;  4IUP A;  1UG1 A;  4KBM B;  1G3W A;  2QA4 T;  3TU4 K;  4JJC A;  5IHN A;  2CT3 A;  1VQN T;  3J7A F;  2X51 A;  3S3O A;  5HKC A;  4R55 A;  1NLO C;  3EFO A;  3PVQ A;  1HK9 A;  1VQ9 T;  2LJ3 A;  4JRK A;  3CCS A;  4X1V A;  1NJI R;  1AWX A;  1MUZ A;  2J7I A;  4M75 C;  3EG2 A;  1KQS S;  1WI7 A;  3RUX A;  3M59 A;  3DB4 A;  4XU1 A;  1LJO A;  4AFU C;  4LDY A;  2NYS A;  4QW2 A;  1RAF B;  3CXC P;  3RER A;  4J7F A;  3QG1 A;  1W2B S;  4M77 A;  2IG0 A;  1G8X A;  3CME T;  1NJI U;  3JB9 F;  4JJB A;  1GFC A;  4Z89 A;  2QTV A;  2CUB A;  4C0G A;  1KK7 A;  3HP9 A;  2NLU A;  4XU3 A;  2KI7 A;  2JTE A;  3CCL A;  2MF2 A;  5I2S A;  3M54 A;  4HVV A;  1W2B A;  5HK3 A;  3I56 Q;  2RH2 A;  2MI6 A;  1BI0 A;  1UGV A;  2MAM A;  2ESW A;  1CKB A;  1QVF S;  2AKK A;  2AHJ B;  1VQO Q;  4D8K A;  2Z0W A;  1SKU B;  1Z9Q A;  4LDX A;  5LJ3 g;  2KQW A;  3V7C A;  4QQG A;  3H6Z A;  1I5L A;  1WLP B;  1ABQ A;  1PD0 A;  2XIC A;  2HDA A;  1QVF A;  4UC4 A;  2K2V A;  5GMK e;  3OYD A;  2KVQ G;  1YJN A;  3IQL A;  4M7A C;  3QSU A;  1M1F A;  5A0G A;  2P0K A;  5CAI A;  1KFZ A;  2EBP A;  2RJE A;  1PG5 B;  4CI0 C;  5LJ5 f;  4PJM A;  3JB9 I;  1ZBX A;  1SPK A;  3CCS Q;  4CC2 A;  3EFO B;  3ER0 A;  2LCL A;  3PGG A;  1LVK A;  2LQW A;  2XDB A;  1YJ9 Q;  1WJS A;  3CQT A;  4JUV A;  4E7H A;  4FIB A;  2JZ2 A;  2HL5 C;  5A0L A;  2PUO B;  1TUC A;  1B34 B;  1LPL A;  4C92 G;  5GMK l;  3CCV A;  4IIO A;  2K4Y A;  1N9R A;  4C92 D;  2RB6 A;  3JCM J;  4M77 B;  1PRL C;  2MWP A;  2XG8 D;  2FRW A;  1T0H A;  2OJ2 A;  2Y90 A;  1I07 A;  3CCU A;  3PTA A;  3ME9 A;  1KQS P;  2P0P A;  2CSI A;  3C4S A;  1MNE A;  1OEB A;  3JB9 H;  3M53 A;  1NYF A;  3CCM T;  1KIK A;  4L6V 5;  5LJ5 d;  1BI3 A;  1NPR A;  3CD6 T;  3VYG A;  4CC3 A;  2V8I A;  4BI4 A;  2CH4 W;  2WSF E;  1WJQ A;  1K1Z A;  5GMK j;  1Y96 A;  1M90 C;  5LJ3 e;  3EGD A;  5KYX B;  4QVC A;  1G3Y A;  4K11 A;  4J9H A;  5GAO r;  1K8A R;  2RHU A;  3ZFJ A;  4JRQ A;  3NHN A;  2QAZ A;  2KBT A;  1UJY A;  3JRZ A;  4Y28 E;  1H92 A;  1UEC A;  5KE3 A;  1FMW A;  4C0D B;  2VXE A;  4J6X A;  1VUB A;  1ZSZ A;  1QVG S;  1M2V A;  1FWZ A;  4TVR A;  5IXB A;  4FCY A;  2HCK A;  2RMO A;  3OS0 A;  1TS9 A;  1WHH A;  2LT1 A;  1K8A U;  2KRN A;  2YUN A;  2RQT A;  3PIO A;  1QKX A;  1M3A A;  4FT4 A;  2GGR A;  4RTV A;  1YHQ T;  1Y71 A;  3AHU A;  3CCQ T;  2EYW A;  1QVG A;  1PRM C;  2RQU A;  4OVA A;  1UHF A;  2E5Q A;  1NE8 A;  5KYY A;  1VQ4 T;  1TH7 A;  1FYN A;  4C5H A;  2EJ9 A;  3PMI A;  3CCV Q;  3J81 E;  1YNZ A;  5GAN g;  3CC7 T;  3G1J A;  3FC3 A;  2AIR B;  3MPU B;  1H3Z A;  3CCU Q;  4XTU A;  1WX6 A;  3LLR A;  5AT1 B;  1JXM A;  2MPX C;  1RAD B;  2L2P A;  3NTH A;  1T0J A;  3CC4 Q;  2DRK A;  5GJV B;  4XQ3 A;  3OYI A;  1B07 A;  2QEX T;  3TQ7 P;  1KQ2 A;  1BCO A;  3LGF A;  4DOV A;  4LDU A;  3JAM E;  5AYF A;  3M0U A;  3RKW A;  2HMA A;  2FZK B;  4NL3 A;  2EYQ A;  3EHR A;  1KD1 R;  2CRE A;  3EH1 A;  1LNX A;  1VQM Q;  2L3R A;  5GAM h;  5LJ3 j;  1X27 A;  1VOM A;  4F14 A;  1I8F A;  3QYG B;  2MIO A;  2DYB A;  4M78 C;  3OYM A;  1Y96 B;  2DVE A;  2EYX A;  3THK A;  4M78 F;  1G3T A;  3EGD B;  2GTO A;  3REA B;  3UDC A;  2EQU A;  4R0K A;  2VWF A;  4RCB A;  4C92 B;  3TSW A;  1KD1 U;  2DBK A;  3OMG A;  4ELZ C;  3J80 E;  2D1X A;  4LD9 K;  1FMV A;  1UB4 A;  2LZ6 B;  3RNJ A;  4FYY B;  4FT2 A;  4LNP A;  2JS0 A;  2H8H A;  4FL6 A;  2D0Q B;  3CPW S;  3QDF A;  3QO3 A;  4LXC A;  2V1Q A;  1M2V B;  4EMK B;  1BBZ A;  2DXU A;  2YRC A;  2YHT A;  2OTJ T;  2EKH A;  3UA7 A;  3VS5 A;  4FYX B;  1K4U S;  1BKB A;  5GAO l;  4MDX A;  2BE9 B;  2JW4 A;  2LQ8 A;  3CPW A;  2E3I A;  2YLC A;  2DVJ A;  1V29 B;  1WGS A;  4J83 A;  3EG3 A;  1WA7 A;  1ZUK A;  4PJN A;  3I9Q A;  1XNI A;  3HRS A;  3VJP A;  3MEU A;  4FSX A;  1WNL A;  2L0A A;  2QGG A;  2L89 A;  3M58 A;  4C8Q C;  2CUD A;  1NJI C;  2DX1 A;  3VS2 A;  2K5L A;  1KG1 A;  4ME7 A;  5CVI A;  3MCA B;  4C8Q F;  4X34 A;  2E41 A;  4D8D A;  1M3C A;  2VXF A;  1N8R R;  4LUD A;  2C0I A;  3KXT A;  3GF5 A;  3L1A A;  2IVW A;  1PC0 A;  3H0H A;  1D0X A;  3OBW A;  1IGU A;  2DRM A;  4PK4 A;  2EYZ A;  2DL5 A;  2G3R A;  1M27 C;  5LL6 S;  3G6E A;  2J6F A;  3OYF A;  5CCA A;  1YJW T;  3M57 A;  4RTT A;  5CO7 A;  3ZL7 C;  4M77 E;  3OYL A;  3CCJ Q;  1WXU A;  2LMJ A;  3R6N A;  3OYK A;  2KYM A;  4HVU A;  2DEQ A;  2DTI A;  3JCM g;  3VS7 A;  4J5Y A;  1N8R U;  2PNI A;  1G3S A;  5IH2 A;  4OP0 A;  2WSC E;  3NGP A;  1WFW A;  2DE0 X;  4PLL A;  2BKD N;  2QQS A;  3SWN A;  1OZ2 A;  4ANJ A;  4AT1 B;  3X20 B;  1QQJ A;  2YRD A;  3FIF A;  3E9G A;  3CCR T;  4F7U A;  2DA9 A;  4QQ6 A;  2BTT A;  4VUB A;  3PVL A;  1JB0 E;  4PFO A;  1MMD A;  1ZLM A;  3CBO A;  3NFC A;  3VS0 A;  5DLO A;  1QVP A;  3M4G A;  2JJ9 A;  2RHI A;  3G71 T;  2DJQ A;  4O6J A;  2KT1 A;  4KH0 B;  1TTH B;  2MWO A;  4XTV A;  1M90 R;  2K5I A;  2M02 A;  3T9N A;  2EQK A;  3JCM X;  4PJO C;  3EG0 A;  3FDR A;  2KE9 A;  1OYX A;  1KC8 U;  2P4R A;  2Y4X A;  1C6V X;  1S72 A;  2HZY A;  1YIT A;  4OGC A;  1XOV A;  4QKU A;  3SHW A;  2EW3 A;  3L2W A;  1VQ8 Q;  4MDW A;  2F2W A;  3VS6 A;  4B6M A;  4ZGD B;  3CCE T;  3OS1 A;  4KUI A;  3CCS T;  3QII A;  3PFS A;  2CS7 A;  1KQ1 A;  2QDY B;  3MEV A;  1OPK A;  3JCM Q;  2F1L A;  2FG0 A;  3JSC A;  1SHF A;  3PIP A;  2KGT A;  1QWF A;  2YUP A;  4M75 E;  2CDT A;  5FLX E;  3QDR B;  2VKN A;  1SEM A;  4RTU A;  3M5A A;  2FPF A;  3G7Z A;  1KHI A;  2EJG A;  2DYI A;  1IB8 A;  4RG2 A;  2D8H A;  1V1C A;  2O9S A;  4HKE A;  2J6O A;  7AT1 B;  3CC2 T;  4M7D A;  3M0S A;  1YIJ Q;  5GJW B;  1K9A A;  3SFM A;  3OYB A;  2ZGW A;  2R5A A;  3HKS A;  3CCL T;  4BE0 A;  3ULR B;  1F1B B;  2O9V A;  1SRM A;  2X4W A;  3P8D A;  2RI5 A;  1VA7 A;  4F7U B;  1TUD A;  3JB9 J;  3FEO A;  2HQE A;  2E10 A;  4OF1 A;  2VGM A;  4M77 F;  1K8A C;  4LUE A;  1VQ6 A;  1O9S A;  2RK1 A;  1ZA1 B;  3EH2 A;  2V1R A;  2B8A A;  2O01 E;  4N4H A;  5D6W A;  2F5K A;  5HK0 A;  3I56 A;  2DJZ A;  1YJN T;  1X6O A;  3LWH A;  4OMQ A;  1VQO A;  1ABO A;  3MKD A;  1YIT Q;  2YWW A;  1VQ7 Q;  9ATC B;  1OUL A;  2CP0 A;  4ZGE B;  1T3S A;  2BZ8 A;  3A8G B;  2RQV A;  4M77 G;  1R8O B;  3GNG A;  2M0O A;  1W70 A;  1B7T A;  1VQP T;  5LJ5 h;  4II1 A;  2DD4 A;  1TUG B;  4M77 D;  3A1P A;  5DLQ E;  2EKO A;  2K3X A;  2K9G A;  1U5S A;  1G2B A;  1MGQ A;  2A37 A;  3QWY A;  3JCM b;  1YP5 A;  4C0D C;  1BIB A;  5KYW A;  1UGP B;  3GIB A;  2HSE B;  3X25 B;  2PTK A;  3A98 A;  3RBB B;  1XJW B;  3SB2 A;  4ZN1 A;  1D1C A;  2DER A;  3H9N A;  3P8H A;  1H3H A;  2QYZ A;  1OZ3 A;  3H0I A;  4QT7 A;  2AZV A;  1YJ9 A;  2OTL A;  1BK2 A;  4BD3 A;  1K73 R;  4OGE A;  5CR2 A;  2DNU A;  1PD1 A;  1QW1 A;  3HTR A;  4CC4 B;  4NS5 A;  2LDM A;  4L5G A;  1KD1 C;  3X28 B;  3QWX X;  5FU7 B;  1VQ5 Q;  2CP7 A;  4J6W A;  2RA2 A;  5GAM e;  4E47 A;  1M1G A;  1N5Z A;  1BB9 A;  3E19 A;  2R58 A;  3DKM A;  1D3B A;  3TVT A;  2GFA A;  1VQ6 Q;  1K73 U;  2X3W D;  1KJW A;  3HL8 A;  2QQA A;  2EJF A;  4LDW A;  5GAN h;  5A0D A;  1WPY A;  1U06 A;  2EGC A;  1IXD A;  5CKE A;  3EGU A;  3EGX A;  2GCX A;  5D6X A;  4OB1 B;  4N0A A;  1FXX A;  2RHZ A;  2CGH A;  3M0T A;  3RMQ A;  2CZ7 B;  1AHJ B;  4FM4 B;  2YUQ A;  3JV3 A;  4JS5 A;  1YWP A;  4BY6 B;  1I4K 1;  3OY9 A;  2KY9 A;  1RAB B;  2HD0 A;  2PVD B;  4A4G A;  2GQI A;  2NUP A;  1PKS A;  3L2V A;  4XU2 A;  1E7O A;  4MZP A;  1EZZ B;  1K76 A;  1WHL A;  4ZTF A;  3CMA A;  2O2O A;  1GBR A;  2L3Q A;  2QXF A;  4BDY A;  1RLQ C;  2XHC A;  4Z02 A;  4ZTJ A;  1JJ2 S;  4C92 C;  3C95 A;  2RHY A;  4WF2 A;  4RTZ A;  3GOX A;  4C92 F;  6AT1 B;  4M4Z A;  1U3O A;  3EG9 A;  2O31 A;  1SF9 A;  2L3P A;  4FU6 A;  2DIL A;  4PFP A;  2E12 A;  3ZBD A;  1N8R C;  5KYW B;  4QQD A;  4EMK C;  2LJ0 A;  1JJ2 A;  2V8J A;  3E9F A;  5DM7 R;  3OW2 A;  3I55 A;  2OTL Q;  1UHC A;  5EC7 A;  1EX4 A;  4J8O A;  1ZX6 A;  3OYN A;  3OS5 A;  2DKG A;  4F04 B;  3HRT A;  3INZ A;  4BE2 A;  2DBM A;  1YI2 A;  5GAM j;  2RQR A;  1WZO A;  1V76 A;  3DB3 A;  4CRI A;  2DL4 A;  1VQK T;  3NTI A;  1ZBJ A;  3PNW C;  5C0M A;  2FPE A;  2DIQ A;  4M75 A;  4MZM A;  2ED1 A;  1JU5 C;  2KYB A;  2I2L A;  1WQ7 A;  2RHX A;  3BY7 A;  1T3L A;  4O5V A;  3ASK A;  1UGR B;  3BE3 A;  1M8M A;  3H41 A;  4FW1 A;  4J9I A;  2XMF A;  2X3X D;  3CC4 A;  3OYY A;  2PU9 B;  1ZUU A;  1KC8 C;  3UF4 A;  4F7U E;  2KMT A;  3M0Q A;  5GAN f;  1W2B P;  2RK2 A;  1H64 1;  1QMC A;  1WYX A;  1S1N A;  3QZ9 B;  2ROL A;  1VQM A;  2X4J A;  3VS3 A;  1G5V A;  3CMA Q;  2RD1 A;  3CME A;  4OMP A;  3DLL A;  1NLP C;  2E1H A;  1QVF P;  3S3N A;  2XU8 A;  4RMO A;  2LNH B;  2DPP B;  3G4S Q;  2HEQ A;  4M7A A;  2RN8 A;  4WCI A;  1CKA A;  1TXQ A;  3M0P A;  1WHK A;  3X26 B;  3LH0 A;  1TOV A;  3LW5 E;  2BE7 D;  2JVV A;  5GAN 7;  5GAN 8;  1M2O A;  1VIE A;  2VB6 A;  3RMS A;  1W1F A;  3I55 Q;  1VQL Q;  5ECA A;  4A4K A;  1MMG A;  1WJR A;  2HKN A;  1MV0 B;  2E65 A;  2KNB B;  2LTO A;  3LWI A;  2EFI A;  3UT1 A;  3HHT B;  2E6Z A;  3BFM A;  1TWB A;  3V7S A;  5GAN 5;  4OB0 B;  4DBQ A;  1YI2 Q;  5I2M A;  2RI3 A;  5GAN d;  1QLY A;  2EGE A;  1OI1 A;  4N4G A;  2K5F A;  2E5K A;  2DL7 A;  3G6E T;  4PFZ A;  1VQN Q;  2J05 A;  3MP1 A;  3GNF B;  3V8L A;  4M75 B;  1ARK A;  4E7I A;  5M9O A;  2E6N A;  4PJJ A;  1VQ9 Q;  2E70 A;  4M7D E;  1ZQ1 A;  4IUV A;  5KH6 A;  4KGV B;  3QHS A;  1OQK A;  4HCK A;  1WQW A;  2QQR A;  4E6R A;  5L23 A;  2MYS A;  3URG A;  2MCN A;  2EPD A;  2KK4 A;  1Q7Y R;  2QI2 A;  3TEE A;  1GCQ C;  5KYU A;  3HSB A;  3CCJ A;  3MP8 A;  2VGN A;  5L8R E;  1P92 A;  3OYG A;  3L2R A;  1ZA2 B;  4C5G A;  4X9D A;  1GXI E;  2QAS A;  3UPU A;  1TU0 B;  3UAT A;  3CME Q;  1OU8 A;  1X6B A;  1VIF A;  1AZE A;  1Q7Y U;  4LE9 A;  3VUZ A;  3JCM f;  2LP5 A;  1E6H A;  4WTO B;  2YXY A;  3JCM c;  4F7U F;  2MK5 A;  4R56 A;  1RAA B;  4M7A B;  2RF0 A;  1S72 T;  1ZSZ B;  1IHW A;  2JXB A;  2ROT A;  5LJ5 e;  1RI0 A;  4DBH A;  2X35 A;  1D09 B;  2M51 A;  1Q82 U;  1BI2 A;  4J9E A;  3RDV A;  1RLP C;  2COZ A;  2O4X A;  3WVE B;  4J7I A;  2XID A;  4DEY A;  2EAY A;  3C0C A;  4BI3 A;  5KE2 A;  2ZPI B; 
#chains in the Genus database with same CATH homology
 1MHN A;  4M77 A;  3X24 B;  2C06 A;  1SSF A;  2IG0 A;  2VUB A;  5LJ5 g;  1YBY A;  3CME T;  4M75 E;  1NJI U;  3DLM A;  3JB9 F;  3QJY A;  5FLX E;  3QDR B;  5GAO m;  2CZ6 B;  1N9S A;  4F7U G;  4C0G A;  1DJ7 B;  3HP9 A;  3M5A A;  5GMK h;  2NLU A;  2JTF A;  4XU3 A;  1VQ8 A;  2CYZ B;  3G7Z A;  2ZPB B;  4EMH A;  3CCL A;  1KHI A;  2EJG A;  2MF2 A;  5I2S A;  4RG2 A;  2JNG A;  1K73 C;  2H3J A;  3M54 A;  1W2B A;  5HK3 A;  2ZPG B;  5A2Q E;  4C92 A;  1U1S A;  2RH2 A;  4HKE A;  4M7D A;  2MI6 A;  3L2Z A;  3PMT A;  3CC2 T;  1BI0 A;  2MAM A;  3FRN A;  3SFM A;  5J39 A;  3OYB A;  1FX7 A;  2ZGW A;  2HBP A;  1QVF S;  2AHJ B;  1JBM A;  1VQ8 T;  2R5A A;  3HKS A;  5I21 A;  3CCL T;  4BE0 A;  3E1S A;  2KSS A;  1M1K U;  4LDX A;  1UGQ B;  3P8D A;  2X4W A;  4C8Q E;  5LJ3 g;  2KQW A;  3JCM d;  5GAO q;  3V7C A;  4QQG A;  2RI5 A;  3H6Z A;  4EMK A;  5DY9 A;  2CKK A;  4XU0 A;  2QTX A;  2XI9 A;  5CIU A;  4A4H A;  1Y7X A;  4F7U B;  1I5L A;  2XD0 A;  3CCQ A;  3OB9 A;  4E7K A;  3JB9 J;  4PKC C;  3RIR A;  2XIC A;  3FEO A;  4DQ2 A;  2D6F A;  2HQE A;  1QVF A;  2E10 A;  2K2V A;  1NZ9 A;  4UC4 A;  2KVQ G;  5GMK e;  3BW1 A;  2VGM A;  4OF1 A;  4M77 F;  2CZ0 B;  3OYD A;  1YJN A;  1K8A C;  4M7A C;  1Q81 C;  3V8K A;  1I81 A;  1VQ6 A;  1O9S A;  2RK1 A;  3QSU A;  1M1F A;  3P8B B;  1VQ4 A;  2GQV A;  5A0G A;  2P0K A;  1QP3 A;  2B8A A;  2O01 E;  5CKD A;  5IT9 E;  4BB7 A;  4N4H A;  5D6W A;  2DIG A;  2DTO A;  2F5K A;  3BDL A;  5KCH A;  2DTH A;  5GAO n;  3L2U A;  5CAI A;  5FRN A;  5HK0 A;  3I56 A;  2P4T A;  2RJE A;  4QVZ A;  2EIF A;  2DJZ A;  3MP6 A;  4JLG A;  5FU6 C;  1ZHI A;  4P5N A;  1YIJ A;  1YJN T;  1X6O A;  3SDZ A;  4CI0 C;  4MML A;  3VYH B;  3LWH A;  5LJ5 f;  1VQ6 T;  2F69 A;  4A54 A;  1VQO A;  2L8D A;  2PVG B;  5FU7 C;  2L5Q A;  4V2S A;  2V8K A;  4XTY A;  3JB9 I;  1ZBX A;  3I56 T;  4BAC A;  4A53 A;  2DZC A;  1YIJ T;  4M78 A;  4ZGE B;  4C0Z A;  2LVM A;  3ER0 A;  2LCL A;  3PGG A;  3WVD B;  1VQO T;  3A8G B;  5LJ5 j;  1M4Z A;  2XDB A;  1U1T A;  4M77 G;  2X4X A;  4ATO A;  5IAY A;  1R8O B;  3EAE A;  3GNG A;  3GP8 A;  3TRE A;  2EQM A;  2M0O A;  2RM4 A;  1WJS A;  1VQP T;  5LJ5 h;  4JUV A;  4II1 A;  2DD4 A;  4E7H A;  4FIB A;  1VQK A;  4M77 D;  3JCM W;  2JZ2 A;  3MO8 A;  5DLQ E;  2EKO A;  2K3X A;  3Q1J A;  5A0L A;  2VV5 A;  2PUO B;  3V8J A;  1IZ6 A;  1B34 B;  2CZ1 B;  2O4X B;  3QYH B;  1MGQ A;  4C92 G;  1XTD A;  3ZEH A;  4DA4 A;  4A4E A;  4M7D G;  3JCM b;  3SWN C;  2DZ9 A;  3M9Q A;  5GAN 2;  5GMK l;  4C0D C;  4KT0 E;  1BIB A;  3GIB A;  1UGP B;  2RJC A;  4BY6 C;  4XAX B;  2RJF A;  3X25 B;  2K4Y A;  1N9R A;  4C92 D;  2RB6 A;  3CCV A;  4M7D D;  3JCM J;  2RI2 A;  4M77 B;  3VKI A;  2MWP A;  1VQ7 A;  2WSE E;  1PSE A;  2XG8 D;  5IN1 A;  3SB2 A;  4ZN1 A;  3P8H A;  2Y90 A;  2R5M A;  5LJ3 h;  2JOY A;  3MET A;  1OZ3 A;  3CCU A;  3PTA A;  2ZPH B;  3CCM A;  3OYA A;  2WAC A;  4PJO E;  2LNV A;  2R57 A;  3ME9 A;  3OS2 A;  1YIT T;  1YJ9 A;  2OTL A;  3CD6 A;  4BD3 A;  4HCB A;  2P0P A;  4HT8 A;  1VQ7 T;  2FHD A;  2XDP A;  2XKO C;  3C4S A;  3GLX A;  4OGE A;  4EPC A;  3R6O A;  5CR2 A;  4D6W A;  3JB9 H;  5FU6 B;  3M53 A;  1QW1 A;  3CCM T;  4C8Q A;  2RO0 A;  3PT9 A;  4L6V 5;  5LJ5 d;  2E64 A;  2LDM A;  4NS5 A;  4L5G A;  1KD1 C;  3X28 B;  5FU7 B;  3C12 A;  1BI3 A;  1NPR A;  1YJ9 T;  4ZN3 A;  3CD6 T;  3OBY A;  4J6W A;  3VYG A;  3OYH A;  2V8I A;  4BI4 A;  2WSF E;  1WJQ A;  2RA2 A;  3F70 A;  5GAM e;  5GMK j;  5J3B A;  2HQX A;  4E47 A;  2A7Y A;  2DD5 A;  1KHC A;  1M1G A;  3E19 A;  2R58 A;  3DKM A;  1Y96 A;  3SD4 A;  1D3B A;  3JCM P;  1M90 C;  2GFA A;  5LJ3 e;  3MEA A;  3HFO A;  1K73 U;  4XTX A;  4QVC A;  1G3Y A;  4C5E A;  4E7L A;  3HL8 A;  5GAO r;  3OMC A;  2RHU A;  4M78 G;  3ZFJ A;  4JRQ A;  2QQA A;  2EJF A;  4LDW A;  5GAN h;  5A0D A;  1WPY A;  2OAU A;  5GAN 3;  3HFN A;  3WXM B;  2LRQ A;  2FB7 A;  5CKE A;  5GAM g;  2GCX A;  4M78 D;  5D6X A;  3JRZ A;  4Y28 E;  4PNO A;  2VC8 A;  4N0A A;  4OB1 B;  1FXX A;  2RHZ A;  4XK8 E;  2CGH A;  3OYJ A;  3RMQ A;  2CZ7 B;  3M55 A;  1AHJ B;  1N27 A;  2DXT A;  3SWN B;  4FM4 B;  5KE3 A;  4C0D B;  2VXE A;  4L59 A;  4J6X A;  4JS5 A;  1VUB A;  4IUR A;  4EMG A;  1VQ5 A;  4BY6 B;  4JS4 A;  4OB3 B;  1QVG S;  1I4K 1;  4LDV A;  1FWZ A;  2KY9 A;  4IUQ A;  4TVR A;  3OY9 A;  2LX9 A;  4JJN K;  1YHQ A;  2HD0 A;  3OS0 A;  2PVD B;  4A4G A;  2LT1 A;  1K8A U;  4M77 C;  1Q81 U;  3PIO A;  4XTZ A;  4EDU A;  4RG8 A;  4XU2 A;  3L2V A;  2DAQ A;  4MZP A;  4FT4 A;  4ZTF A;  3CMA A;  1VQ5 T;  4KUL A;  2LCC A;  2JN0 A;  1YHQ T;  2QXF A;  5GAN e;  1Y71 A;  3KUF A;  3CCQ T;  4BDY A;  3AHU A;  4OB2 B;  2XHC A;  3QPH A;  3RES A;  1QVG A;  4OVA A;  4Z02 A;  4RKU E;  4ZTJ A;  3MHX A;  4C5I A;  1JJ2 S;  2E5Q A;  4C92 C;  4PL6 A;  3C95 A;  3CC7 A;  4M7D C;  2RHY A;  4WF2 A;  1NE8 A;  1VQ4 T;  3GOX A;  4C92 F;  1TH7 A;  4M7D F;  2HNI A;  4J6Y A;  5GAN 6;  4C5H A;  1U8R A;  2EJ9 A;  3PMI A;  4M7A E;  1LOJ A;  4FU6 A;  3J81 E;  2MMP A;  4C8Q G;  2E12 A;  3ZBD A;  5GAN g;  1N8R C;  3CC7 T;  4QQD A;  5CKF A;  2F5T X;  4EMK C;  3FC3 A;  2QEX A;  4JRI A;  2M1H A;  1JJ2 A;  2V8J A;  3E9F A;  5DM7 R;  3OW2 A;  4NOY A;  3I55 A;  4XTU A;  4PJO A;  1H3Z A;  4C8Q D;  5GAM f;  3LLR A;  1EIF A;  3OYC A;  3QJ6 A;  4J8O A;  3OYN A;  3NTH A;  1K9M C;  3OS5 A;  5CQX A;  2DKG A;  4XQ3 A;  3OYI A;  2QEX T;  2A3L A;  3HRT A;  3INZ A;  5LJ3 f;  1KQ2 A;  3OSV A;  1YCY A;  1Q86 C;  3A8M B;  3LGF A;  2M9U A;  3OSS C;  3QXE B;  5FRO A;  4LDU A;  4DOV A;  3JAM E;  3OQ5 A;  3G71 A;  5AYF A;  1YI2 A;  5GAM j;  3RKW A;  4NL3 A;  3NTK A;  1X75 C;  2EYQ A;  2ZPE B;  3DB3 A;  4CRI A;  1VQK T;  3NTI A;  3PNW C;  2PQW A;  5C0M A;  3FJP A;  2DIQ A;  2JTM A;  4M75 A;  4MZM A;  1LNX A;  2L3R A;  5CKH A;  5LJ3 j;  5GAM h;  2XDD A;  4GLK A;  5D6Y A;  3S3M A;  1I8F A;  2I2L A;  3QYG B;  1WQ7 A;  2RHX A;  2RJD A;  4M78 C;  4BE1 A;  3OYM A;  1HXD A;  1UEB A;  1Y96 B;  2DVE A;  3BY7 A;  3V7R A;  5GMK m;  3ASK A;  4M78 F;  1G3T A;  4O5V A;  1UGR B;  3VUB A;  1PSF A;  3CCV T;  3EFS A;  4NL2 A;  5KCO A;  3UDC A;  2EQU A;  2K57 A;  4PJO F;  3CC4 A;  3OYY A;  4RCB A;  4C92 B;  2PU9 B;  5CK9 A;  1Q7Y C;  1KD1 U;  4M7D B;  2ZPF B;  3OMG A;  1KC8 C;  4F7U E;  2JUF A;  4ELZ C;  5CKB A;  3CCE A;  2QQ9 A;  3J80 E;  3CCU T;  2OTJ A;  2KMT A;  5GAN f;  4LD9 K;  4Y91 A;  1UB4 A;  2RK2 A;  2DXC A;  4DOW A;  2OTL T;  4XTW A;  1H64 1;  4FT2 A;  4KUD K;  4FL6 A;  2D0Q B;  3CPW S;  3CC4 T;  5FRM A;  1N6A A;  3QO3 A;  4B9W A;  3VV0 A;  3QZ9 B;  1M90 U;  4EMK B;  2DXU A;  1VQM A;  2YHT A;  2X4J A;  3KBG A;  2OTJ T;  1Y07 A;  3OYE A;  1G5V A;  3FB9 A;  4MZT A;  2FL7 A;  1BI1 A;  5C6S A;  1IRE B;  5GAN j;  4M75 F;  2RD1 A;  3QBY A;  1B34 A;  5GAM d;  1BIA A;  1Q82 C;  2PVO B;  3CME A;  2DK3 A;  2GF7 A;  1BKB A;  3EFR A;  3O8V A;  4JDS A;  5GAO l;  3DLL A;  4MDX A;  2LQ8 A;  4RCC A;  3CPW A;  2YLC A;  1VQM T;  2E1H A;  1V29 B;  3S3N A;  5LJ3 d;  4PJO G;  2XU8 A;  2KDS A;  3CBM A;  4RMO A;  3CXC S;  1WGS A;  2LC4 A;  1W4S A;  4J83 A;  2Y4Y A;  2M16 A;  2DPP B;  4BI8 B;  1KQS A;  4M7A A;  4JRP A;  4PJO D;  3CC2 A;  1XNI A;  3HRS A;  2VYT A;  3MEU A;  3M58 A;  1WNL A;  4FSX A;  4N4I A;  2L89 A;  3VJP A;  3X26 B;  3LH0 A;  4C8Q C;  4BDZ A;  1NJI C;  3LW5 E;  3LGL A;  2K5L A;  1KG1 A;  2JVV A;  4ME7 A;  5CVI A;  3MCA B;  4C0F A;  4LD6 A;  4X34 A;  4C8Q F;  2E41 A;  5GAN 8;  5GAN 7;  3GPL A;  1VIE A;  3RMS A;  3A8H B;  3LX7 A;  3CXC A;  2VXF A;  4A4K A;  4M78 B;  3HRU A;  2PUK B;  1BYM A;  4MMK A;  2EQJ A;  3JCM e;  1WJR A;  4HCZ A;  3KXT A;  3GF5 A;  4M75 G;  1YJW A;  2E65 A;  2P0Q A;  3L1A A;  4PJO B;  2IVW A;  3CBP A;  2LTO A;  3CEY A;  3OBW A;  3LWI A;  4X9C A;  3QUI A;  3L2Q A;  2EFI A;  3UT1 A;  2G3R A;  3HPW A;  3HHT B;  4M75 D;  3M4Y A;  2E6Z A;  3BFM A;  5LL6 S;  3V7S A;  3G6E A;  2FYK A;  1UGS B;  5GAN 5;  1M1K C;  4OB0 B;  4HCC A;  3OYF A;  5CQY A;  2ZZD A;  5EG2 A;  5CCA A;  3OW2 S;  1YJW T;  3M57 A;  3RKY A;  5CO7 A;  3CMA T;  1M9S A;  2RI3 A;  5I2M A;  5GAN d;  2K3Y A;  4M77 E;  4B9X A;  3OYL A;  1JRI A;  3A8L B;  3LYI A;  1OI1 A;  3OYK A;  3QKJ A;  4E7J A;  4N4G A;  2DEQ A;  3JB9 G;  2DTI A;  4N0A C;  3JCM g;  3G4S A;  2K5F A;  4PLI A;  4J5Y A;  1N8R U;  4IUT A;  1G3S A;  3G6E T;  3MP1 A;  3VU3 C;  3GNF B;  4IKF A;  4OP0 A;  3JB9 D;  4M7A F;  3V8L A;  4M75 B;  1M8V A;  4E7I A;  1RL2 A;  2LQK A;  5M9O A;  1M5Q 1;  2WSC E;  3CCR A;  2YRV A;  4PLL A;  2E6N A;  4A4F A;  3G4S T;  4C92 E;  3CPF A;  1VQL A;  1K9M U;  2BKD N;  2E70 A;  2QQS A;  4M7D E;  1ZQ1 A;  4IUV A;  3SWN A;  5KH6 A;  1OZ2 A;  3MEW A;  3QHS A;  4OMF B;  4BUG A;  1WQW A;  3A5Z B;  3X20 B;  1Q86 U;  2QQR A;  3OA6 A;  3FIF A;  3CCR T;  3E9G A;  4F7U A;  2FVU A;  4QQ6 A;  3URG A;  3I55 T;  1VQL T;  1NPP A;  4VUB A;  3A8O B;  1JB0 E;  2KK4 A;  3CBO A;  4HA8 A;  2X4Y A;  3JCM V;  1VQP A;  2QI2 A;  3RKX A;  3TEE A;  3NFC A;  4C8Q B;  5DLO A;  5HY6 A;  3HSB A;  3CCJ A;  3MP8 A;  2VGN A;  5L8R E;  1P92 A;  1QVP A;  2DO3 A;  3BDU A;  3M56 A;  2EWN A;  3M4G A;  3UWN A;  5GAO p;  5J26 A;  3OYG A;  2QA4 A;  2HAX A;  5GAN 4;  2RHI A;  1XQH A;  3S6W A;  4ZGJ B;  3L2R A;  3G71 T;  4HT9 A;  4C5G A;  4O6J A;  4X9D A;  1VQN A;  4M7A G;  3UPU A;  4BE2 A;  1GXI E;  1YI2 T;  2D9T A;  4ELY C;  2BIV A;  2MWO A;  3CCJ T;  1D3B B;  4XTV A;  2QQB A;  4IUP A;  2K5I A;  3TU4 K;  4KBM B;  1G3W A;  3T9N A;  2QA4 T;  1O75 A;  1VQ9 A;  4M7A D;  2EQK A;  3JCM X;  4PJO C;  3FDR A;  1VIF A;  1Q7Y U;  5GMK i;  4IUU A;  1VQN T;  1OYX A;  3J7A F;  1KC8 U;  3VUZ A;  3JCM f;  3TCJ A;  2Y4X A;  3C94 A;  2GFU A;  4QVD A;  3S3O A;  1S72 A;  5HKC A;  3H8Z A;  4R55 A;  1YIT A;  2LT4 A;  4OGC A;  1XOV A;  1HK9 A;  3L42 A;  1QP2 A;  4YTL A;  1VQ9 T;  2DXB A;  3JCM c;  4JRK A;  2KAF A;  4M78 E;  1X01 A;  4F7U F;  4MDW A;  4R56 A;  4M7A B;  3L2W A;  3CCS A;  2BUD A;  1S72 T;  4ZGD B;  5LJ5 e;  1RI0 A;  3CCE T;  2X35 A;  3QZ5 B;  4M75 C;  2XK0 A;  3OS1 A;  3N5B B;  1Q82 U;  1KQS S;  4KUI A;  1BI2 A;  3CCS T;  3QII A;  3PFS A;  3RUX A;  3M59 A;  2CS7 A;  1KQ1 A;  3JCM h;  2QDY B;  3DB4 A;  3MEV A;  2O4X A;  3WVE B;  4XU1 A;  1LJO A;  4GY5 A;  2ZCF B;  4J7I A;  4LDY A;  2XID A;  4QW2 A;  4JLI A;  4Q5W A;  3JCM Q;  3RER A;  3JSC A;  4J7F A;  2EAY A;  3FLG A;  3PIP A;  4BI3 A;  5KE2 A;  3QG1 A;  1W2B S;  2ZPI B;  2YLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...