2PNIA

Solution structure and ligand-binding site of the sh3 domain of the p85alpha subunit of phosphatidylinositol 3-kinase
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
86
structure length
86
Chain Sequence
GSMSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEAKPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and ligand-binding site of the SH3 domain of the p85 alpha subunit of phosphatidylinositol 3-kinase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Phosphotransferase
molecule keywords PHOSPHATIDYLINOSITOL 3-KINASE P85-ALPHA SUBUNIT SH3 DOMAIN
total genus 7
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1993-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2pniA00
3FJ5A 2C0TA 2D8HA 4GLMA 4HCKA 2KRNA 2ECZA 2FO0A 5GJVB 5I22A 1NLPC 2PNIA 2GTJA 4A63B 3EGUA 1U3OA 4RTVA 3RBBB 2KROA 1ZBJA 4JPBW 1KFZA 4JJCA 2CUDA 2RPNA 2L2PA 2DL4A 3EG2A 2KBTA 4AFUC 1AZEA 1IO6A 5IHKA 1KSWA 1M3CA 1E6GA 1KIKA 1OOTA 1UHCA 2KNBB 3VRYA 1SHGA 2KYMA 3VS7A 1K9AA 3IQLA 4LNPA 1T0HA 4CC4B 4LUDA 2VVKA 3PE0A 3UF4A 1QKWA 2DRKA 3SHWA 2DRMA 1WI7A 3UA6A 2B86A 2AZVA 1WDXA 4WCIA 1AD5A 1AWOA 2NUZA 4J9CA 2JS2A 1HD3A 1GRIA 2KE9A 2JM9A 2JTEA 2DYBA 2EYWA 2DL3A 3NGPA 2LCSA 3VS2A 4ZNXA 2DL8A 1M27C 3THKA 2RQTA 1AWJA 2RN8A 3O5ZA 2LP5A 2OJ2A 1WA7A 3KFVA 1S1NA 2J05A 3NMZC 3VS3A 1PWTA 3C0CA 1QWEA 3M0QA 2CDTA 1NYFA 1UDLA 2CT3A 2YT6A 2ENMA 5FW9A 1AOJA 4X1VA 2J6OA 2F2WA 1SEMA 2YSQA 3I5RA 4K11A 2CSQA 4Z89A 1SHFA 1G83A 1AWWA 2A37A 2CH4W 3M0SA 2EYYA 1SPKA 1ZSGA 4KRTA 2DBMA 2P4RA 3QWXX 2LX7A 1N5ZA 2F2XA 2XMFA 3PVQA 1W6XA 3VS6A 2HEQA 2G6FX 2K3BA 2KT8A 5IHNA 3I35A 2DE0X 1UJ0A 4ORZA 1UE9A 4OMNA 4RTWA 1NYGA 2F2VA 4J9EA 2KRSA 1UFFA 2ABLA 1GFCA 3ULRB 1OV3A 1NEGA 1YCSB 1ZUKA 1TUCA 4FSSA 2CUBA 1I1JA 1K1ZA 2D0NA 1X69A 1UECA 2RNAA 2W0ZA 2OAWA 1AZGB 1K4US 1W70A 2LJ3A 3EHQA 1WIEA 2PZ1A 1Z9ZA 1WLPB 4Z8AA 1OPLA 2K9GA 1BK2A 4OMOA 1UJYA 1X2KA 1M3AA 3JV3A 2K79A 1XOVA 2EYZA 1ZLMA 2L3QA 2IIMA 4J9HA 2QDLA 4LUEA 1PKSA 2EGAA 2JM8A 1RLQC 1GCPA 2OI3A 2LQNA 2KR3A 4M4ZA 1J3TA 2JS0A 2CT4A 1UG1A 2AK5A 2HCKA 2LJ0A 2DJQA 2PTKA 4JZ4A 1ZUYA 2VWFA 2KEAA 4HVWA 4OMQA 1BB9A 5IH2A 2ROTA 4RTTA 1PKTA 4IIMA 4AFSC 2K2MA 2KYBA 4CC2A 3VS0A 3H0IA 2BZYA 3UATA 1X6GA 2RMOA 2O9SA 1JXOA 1AWXA 2YUOA 4R0KA 2LJ1A 2CH4A 1FMKA 3VS4A 1I0CA 1E6HA 1VYTA 2DM1A 2JXBA 2VKNA 2EKHA 3GBQA 2GTOA 1Y0MA 4QT7A 3LH5A 3PVLA 1ABOA 2KRMA 2LZ6B 2K6DA 3QWYA 4J9BA 1NM7A 4HXJA 1A0NB 5EC7A 4JJBA 5I11A 4F14A 1B3QA 2BZ8A 1V1CA 1H8KA 2J6FA 4RTZA 2DILA 2LMJA 3I9QA 3M0RA 1QCFA 2L3PA 3RNJA 1M30A 1WX6A 1CKBA 2NWMA 3ZL7C 2YUPA 1PRLC 2YUNA 1B07A 1YP5A 1GCQA 2LNHB 4CC7A 3EG1A 3REBB 1UGVA 2C0OA 1QLYA 1U5SA 4AG1C 1RLPC 1MV3A 1JEGA 2RF0A 1JQQA 1JO8A 1WYXA 3H0FA 2EBPA 3M0UA 4D8KA 2HDAA 4RTXA 5L23A 2KXCA 1ZX6A 2GQIA 1RI9A 1X2QA 1T0JA 3H41A 2KXDA 2J7IA 1AEYA 4CC3A 5IXBA 5ECAA 1SSHA 4ESRA 4IIOA 1MUZA 3CQTA 4F16A 2X3XD 1W1FA 1M3BA 1LCKA 2SRCA 1BBZA 1GCQC 1X6BA 2M0YA 4OMMA 1ARKA 1KJWA 2DA9A 2FPDA 1JU5C 1X43A 4HVVA 4AG2C 5FWCA 3VRZA 2GNCA 2V1RA 4LN2A 1K0XA 4LE9A 3TSWA 1SRMA 3M0TA 1PNJA 1ABQA 2K7AA 1YN8A 4F17A 2A08A 2J6KA 1HSQA 1GBRA 2MIOA 4AFQC 2DNUA 3I5SA 3EG0A 2FPFA 4JJDA 2BZXA 1VYUA 2SEMA 1GL5A 3VS1A 3UA7A 4J9IA 1OEBA 2L3SA 1U06A 3NPFA 2FPEA 1YWOA 4RTYA 1Z9QA 2ED1A 2GBQA 2W10A 1T3LA 2DX1A 1QKXA 1WXTA 1PHTA 2EGEA 2HSPA 3M0PA 1WXUA 3NHNA 1RUWA 2FG0A 2L0AA 4EIKA 1NEBA 2EYXA 3VS5A 3EG3A 3U23A 1T3SA 1QWFA 2A36A 1H3HA 2C0IA 2EGCA 2KGTA 2RQUA 4HVUA 1NLOC 1SRLA 2RQRA 1K0SA 1WFWA 4J9DA 4DEYA 2EW3A 1H92A 2O88A 2O9VA 2DL5A 1K76A 2O31A 1M8MA 1TUDA 3A98A 1VYVA 2MOXA 3R6NA 2ROLA 1YNZA 2EPDA 2LQWA 5IHIA 2CREA 1PRMC 1WXBA 4Y92A 1UUEA 3EHRA 2KT1A 1BU1A 4JZ3A 2FEIA 2D8JA 1GFDA 3TVTA 1JXMA 1G2BA 2V1QA 4RTUA 2DL7A 3H0HA 2GGRA 4GBQA 2EQIA 5IXFA 1E7OA 1AVZC 1MV0B 1TG0A 2BTTA 4RUGA 4D8DA 2FRYA 2I0NA 4DEXA 2X3WD 1ZUUA 2D1XA 2AZSA 2JW4A 2M51A 4AFZC 1UHFA 3REAB 2DF6A 1NG2A 2MCNA 2CSIA 2O2OA 2HBWA 2ESWA 2FRWA 3TSZA 4OMLA 1VA7A 2YUQA 2AKKA 2DLPA 1EFNA 2JMCA 1X27A 4Z88A 2YDLA 2AKLA 2J06A 4E6RA 1Y57A 4OMPA 2A28A 2RQWA 2JT4A 2H8HA 5HCKA 2DVJA 1UTIA 5FWBA 2RQVA 2DBKA 4J9GA 2DMOA 5GJWB 1CSKA 4J9FA 1GBQA 1HJDA 1YWPA 2ED0A 1OPKA 2JMAA 1FYNA 1I07A 2EVRA 2E5KA 3SEMA 1CKAA
chains in the Genus database with same CATH superfamily
3FJ5A 7AT1B 2EFIA 4QQGA 1OZ2A 3RMQA 1S72A 1QMCA 2YLCA 1IB8A 4XTXA 4JPBW 3TCJA 4XK8E 1KFZA 4PJJA 2RPNA 3CXCA 1IO6A 4XTVA 3RDVA 2O01E 1YI2Q 3MO8A 1E6GA 1KIKA 1PSEA 1OOTA 4WF2A 3X24B 1NZ9A 3VRYA 3LLRA 4YTLA 2KYMA 3VS7A 3IQLA 5I2SA 3CXCS 3OS2A 2LT1A 4CC4B 4XTWA 2VVKA 2OTJQ 1VQPA 4EPCA 4DBFA 1WI7A 4M78D 1WJRA 1KD1R 8AT1B 1WDXA 4WCIA 1AWOA 2NUZA 5FROA 1GRIA 5DM7R 2KE9A 3AHUA 4LDUA 1VQ7T 3NGPA 2A0FB 1C1AA 2JOYA 3OYBA 5FU7B 2RQTA 2EQUA 1WA7A 1R0BG 2M9UA 4JUVA 4PJOC 2F1LA 2CDTA 1NYFA 1QVPA 1UDLA 3A8MB 3M4GA 2YT6A 1VQ5Q 4X1VA 2J6OA 2XKOC 5M9OA 4O5VA 4RG8A 1KQSP 4Z89A 2MWOA 1SHFA 2QG9B 4XTYA 3I55Q 3FB9A 2YWWA 2R58A 4PJNA 1OX8A 3X26B 2EYQA 4E47A 3QZ9B 3LWIA 5KE3A 2CZ7B 5HK3A 2DAQA 1D3BA 3CD6Q 3V7SA 3OW2S 5FLXE 2KY9A 4A4EA 3CCLT 5GMKl 1WHLA 2EJ9A 5EG2A 3DLMA 1VQMT 2QA4A 3I35A 3CMAA 3CBMA 2DE0X 1UJ0A 4ORZA 1UE9A 3JB9I 3HRUA 4OMNA 1NYGA 2CKKA 1UFFA 3ULRB 1NEGA 5KYUA 2BKDN 2PVDB 1TUCA 3VV0A 2EKOA 4AMCA 1X69A 2VXFA 1IRXA 2PVOB 1K4US 1WIEA 2PZ1A 1Z9ZA 2QQRA 4EDUA 1WLPB 1EIFA 1YJNT 3SWNC 1VQ6A 2D6FA 3KBGA 4A4FA 4OMOA 4BY6B 1UJYA 1GXIE 3JAME 4J9HA 1VQLA 4M75C 1WHMA 1ZSZB 2MK5A 2JM8A 4CRIA 4M4ZA 2JS0A 2CT4A 2LX9A 1BI2A 2HCKA 4MZPA 3TU4K 4HT8A 4JZ4A 4Y28E 2VYTA 4FL6A 1K73U 3A8GB 2KK4A 2KEAA 5IH2A 3CCMQ 1M5Q1 2K3YA 2MYSA 3OYLA 2WSCE 1W2BS 4EMGA 2DD4A 5LJ5f 1N9RA 4PJOF 4ZN1A 1Y96A 3UATA 2PQWA 1QVGP 1VQ8T 3CC4A 3JCMd 2YUOA 3BE3A 1OYXA 2DPPB 4M78F 3FIFA 2PU9B 1PD0A 2DM1A 2K4YA 5LJ5h 2VKNA 5GAMd 2GTOA 1Y0MA 4RCCA 3G6EQ 3L2VA 1FXXA 4QT7A 2OX7A 2RHZA 1M2VA 4MDWA 1WZOA 4A4GA 1VQ6T 3JRZA 2ZCFB 2PUOB 3I56Q 2IG0A 4JS4A 4J9BA 2LVMA 1ZSZC 4ZGEB 2F69A 3H8ZA 1MGQA 3BY7A 2VC8A 4JJBA 2BZ8A 1O9SA 5GAN3 2J6FA 3I9QA 3RNJA 4ELYC 3A1PA 3TQ7P 4UC4A 2L89A 3NTKA 2YUNA 1B07A 4M77D 3MPUB 3CC7Q 5GMKh 3FRNA 2CP2A 4FYYB 4CC7A 1UGVA 5CAIA 1QLYA 2X9HA 1MMAA 1BI0A 2QQ9A 1JEGA 1JQQA 1N27A 1K8AR 3M0UA 2QQAA 2GQIA 4BD3A 1QCNA 3D7SB 4QQDA 2J7IA 4ZGJB 4C8QB 4M77C 1Q82C 2X3XD 4M75F 4PJLA 2SRCA 1BBZA 1GCQC 4OMMA 4Q5WA 1KJWA 4C92A 1JU5C 1X43A 3CCUT 3CCUA 1VQ4Q 4HVVA 3EFOB 1M90U 5FWCA 5DLQE 2JTMA 2DTHA 4M7AC 4MMKA 4DBRA 1K0XA 3TSWA 3RUXA 2K7AA 2RJEA 2NUPB 4XTUA 4VUBA 2A08A 3CC7A 2P0PA 3JB9G 2JVVA 4F04B 1GBRA 1D1BA 2YRVA 4NL3A 2XK0A 3EG0A 1U1SA 3HP9A 2DERA 2XD0A 3CMET 5GAOq 2FZKB 4DA4A 1OU8A 1VYUA 4J9IA 1M1KC 2V8JA 5CO7A 1TTHB 3L2WA 1YFNA 2FPEA 3PIPA 4RTYA 5D6XA 4C92G 2O4XB 3S3MA 1Q81R 2JUFA 2E3HA 2EJGA 1UEBA 2GBQA 3OYDA 1T3LA 3LYIA 2X4WA 3E9FA 1N8RC 5GAOm 2DXTA 1D1CA 1VQPT 4BDZA 3NHNA 2FG0A 2L0AA 4EIKA 3U23A 4OF1A 1T3SA 3HRSA 4C92E 1I4K1 1JJ2A 4KULA 4C8QF 3PTAA 4EMKB 1YIJT 1YJWA 2RQRA 3JCMb 1K0SA 2EJFA 3HFNA 2RM4A 3VUZA 4KGVB 3CXCP 1JJ2P 1ZA2B 1O75A 1RAAB 1UGQB 4HKEA 1JB0E 4XU0A 3I55T 2CP6A 2LQWA 1M1KR 1OQKA 1TWBA 2CGHA 2C06A 3EHRA 1Q7YU 2M1HA 2IPOB 2P4TA 5GAMg 4JZ3A 4FCYA 3E19A 1JXMA 3CPFA 3R6OA 3CC4Q 1G2BA 4GBQA 2E12A 3QBYA 2ZGWA 2E64A 2FRYA 6AT1B 4MZTA 2X3WD 1ZUUA 2D1XA 5GAN5 4AFZC 1UHFA 2D9TA 1VQMA 4M77A 5KYXA 3ME9A 1M2VB 2CSIA 2O2OA 2HBWA 2ESWA 4V2SA 3QDRB 1VA7A 4BUGA 2AKKA 4L59A 4Z88A 1EFNA 5KE2A 2YXYA 3HTRA 1R0CB 1Y57A 2RHUA 2RQWA 4FYWB 5FWBA 1MMDA 1M90C 2DBKA 3MJXA 3DB4A 1OPKA 1Y96B 4E7JA 4M77F 1C0MA 1C6VX 4N0AA 4M7DG 3CCQT 2IVWA 2C0TA 1YI2T 2D8HA 2FL7A 3BW1A 1PG5B 1UGSB 2KRNA 5D6YA 2ECZA 1LJOA 3VYGA 5I22A 1IZ6A 2DTOA 2PNIA 2GTJA 3EGUA 3Q1JA 1M1GA 1ZBJA 3MP1A 2DEUA 3OYJA 3FC3A 1D0YA 2EQKA 4IUUA 5HKCA 4AFUC 2KBTA 2KDSA 3ZFJA 4M75D 3L2UA 1KSWA 2K5IA 5LL6S 1M3CA 1OX9A 1UHCA 2KNBB 1SHGA 4M78G 1K9AA 4LNPA 1VOMA 4JRPA 4LUDA 2VV5A 1EX4A 4N4GA 2HKNA 3OYCA 5FU6B 3QSUA 2M02A 2B86A 3H9NA 1K9MR 3FJPA 5GAOn 4DQ2A 1AD5A 1YJWT 1WHHA 1NPPA 3MEUA 2DYBA 3EFRA 1K8AU 2BE9B 1RADB 2E5QA 5LJ3g 3VS2A 3JCMP 3G4SQ 5AYFA 3O8VA 3THKA 2ZAEA 3O5ZA 4M7DD 4HCCA 1S1NA 1QWEA 1QCOA 1PCXA 3DB3A 2CT3A 3M58A 4M7DE 1RABB 2ENMA 5FW9A 2RH2A 5I21A 3TEEA 2F2WA 1SEMA 2YSQA 4F7UE 4M77E 3L2ZA 2K57A 5LJ3f 3TREA 2RJDA 1ZSGA 3J80E 4KRTA 2OTLQ 1Q81C 4FW2A 5J26A 3QWXX 4EMKA 3CCJQ 1Y7XA 3CCVQ 1N5ZA 4E7KA 4GLKA 3PVQA 2RB6A 1KD1U 4B9WA 5A0DA 4PJOD 1VQ5T 2G6FX 2RHYA 2RA2A 2KT8A 3LX7A 1Y71A 2FZGB 3KUFA 3G6EA 3T9NA 1XTDA 2KRSA 1YJNA 2EIFA 1ZUKA 5GAMj 3PFSA 1M1FA 2GQVA 5FRMA 1TS9A 4L5GA 1UECA 2W0ZA 3LH0A 1W70A 2NUPA 1RI0A 1NE8A 4KBMB 2K9GA 4JRQA 1BCMA 3EG9A 4BI3A 1OI1A 1BK2A 2DJZA 4OB2B 1WJSA 3WVEB 2OTLT 4M78A 3RESA 4M7AB 3JCMh 1X2KA 1M3AA 2K79A 2HL3A 2G3RA 1WPYA 2L3QA 3SWNB 2FZCB 1EZZB 4II1A 1PKSA 3CC7T 3VU3C 2OI3A 2KR3A 1J3TA 3JCMf 3NTHA 2LJ0A 1VQ4T 4KUDK 1QVFP 3A5ZB 3HFOA 1ZUYA 1K73C 1Q82R 4HVWA 5A0GA 4IIMA 2HBPA 2KYBA 4RMOA 2NUTA 2HQHA 2QXFA 3GF5A 4DBHA 3SWNA 2JNGA 1YJ9Q 1IGUA 4A53A 2LJ1A 3CCET 3QJ6A 4BI8B 1I0CA 1VYTA 2JXBA 5IN1A 3OY9A 2EKHA 2MAMA 3GBQA 4MMLA 1VQKA 2HZYA 3LH5A 5GANg 3RKWA 2HNIA 3PVLA 4OB1B 2DK3A 2RJFA 1G8XA 2KRMA 1S72Q 1NJIC 2QGFB 1NM7A 1VQ8Q 1LVKA 4GY5A 3CCMA 5EC7A 3INZA 1FX7A 3VYHB 2F5TX 1VQKQ 4R56A 1M2OA 1K9MU 3C95A 3CCUQ 2VXEA 4JS5A 2AHJB 2DILA 5KCHA 3AT1B 1PSFA 4M7AG 2L3PA 1M30A 1WX6A 1CKBA 4E7IA 4QVZA 2YUPA 3G71A 5IAYA 1X6OA 2LNHB 1KQ2A 4AG1C 1MV3A 5GANe 5A0LA 5HY6A 1BYMA 4D8KA 4BE1A 2KAFA 1IHWA 2CZ0B 1T0JA 3H41A 4PFZA 1YIJQ 5GANh 2GFUA 4OB3B 5IXBA 3CC4T 1SSHA 5GAOl 1VQMQ 2ZPBB 1N6AA 4M7AA 1VQ9T 1VQ8A 3ZEHA 1M3BA 4AT1B 1LCKA 1KK7A 4M7DC 1H3ZA 3L1AA 5GANf 3V8LA 3G4SA 2QGGA 4AG2C 2Z0WA 3VRZA 4ZTFA 5LJ5g 2V1RA 1WHKA 4J6XA 1YITA 1B34B 1SRMA 3M0TA 1SF9A 4F17A 3E9GA 5GMKj 1OU9A 3M9QA 4M75G 2DTIA 3V7RA 3QHSA 2KI7A 4AFQC 4QQ6A 3I5SA 1YIJA 2H3EB 1D1AA 1QP2A 5KYUB 3CCEA 4OVAA 3EGXA 2SEMA 3SD4A 4FSXA 4J6WA 1OEBA 2L3SA 1IREB 5GAOr 1WHJA 2Y4XA 4OGCA 2XHCA 2ED1A 2YLBA 2HSPA 2FB7A 4XTZA 2LC4A 4QVDA 1LNXA 1RAEB 2A36A 3URGA 4M75A 2EGCA 2QTXA 4LXCA 1NLOC 1SRLA 4PL6A 4J6YA 4JJNK 1N8RR 4J9DA 4DEYA 2EW3A 1HK9A 1H92A 1PC0A 2O9VA 1K76A 2O31A 4BY6C 1TUDA 3ASKA 1VIEA 3FLGA 2MOXA 2RHIA 2EPDA 5D6WA 3EH2A 4D6WA 2KT1A 5CQXA 1KD1C 1GFDA 3CPWA 1KQSA 3H0HA 2K5LA 4M78B 2EQIA 2F5KA 5IXFA 4PNOA 1E7OA 2BTTA 1Q81U 2NYSA 4OMFB 5KYNA 3GP8A 2M51A 1VQ5A 3REAB 3CPWS 2DF6A 4RG2A 1KQSS 2FRWA 2P0KA 2DETA 4C5HA 3OYFA 2A7YA 3C12A 2DLPA 4ME7A 3S6WA 1FMVA 5IT9E 2YDLA 2XDDA 4E6RA 4N4IA 5L8RE 4M78C 4OMPA 2A28A 1TU0B 2H8HA 4R55A 3JCMW 4E7HA 1UTIA 2E6ZA 1TH7A 3M53A 2M16A 1HJDA 1JRIA 4KH0B 4OP0A 4PLIA 1I8FA 2CP3A 2VB6A 4C8QC 2JMAA 4OGEA 2EVRA 3G4ST 2E5KA 4F7UF 3SEMA 1K8AC 4GLMA 4HCKA 4M7DF 3NTIA 3JB9H 5GJVB 1H641 1NLPC 2OAUA 2R57A 4IKFA 1ZHIA 3E1SA 2M0OA 1U3OA 2KROA 1KHIA 2COYA 3UWNA 3OYAA 2CUDA 5GMKe 2L2PA 2DL4A 3I55A 2XG8D 3CCSQ 1AZEA 1KC8U 2DYIA 3OB9A 3MP6A 1VIFA 2GFAA 3M57A 1PD1A 3M4YA 4ZTJA 3BFMA 4IUQA 2DZ9A 3PE0A 3OBYA 2QA4Q 3JCMc 2DRKA 3SHWA 1Y07A 1UB4A 3PMTA 3CCMT 3N5BB 3UA6A 5GAN7 4F7UG 3OYNA 3JCMX 1HD3A 2D0QB 1YHQQ 4ANJA 1BIAA 2JTEA 2EYWA 5KYXB 2DL3A 2LCSA 3J81E 2DVEA 4ZNXA 1D0XA 1Q86R 1X01A 2BIVA 2DL8A 1M27C 5CCAA 1AWJA 2LP5A 1LOJA 3OSSC 2J05A 3NMZC 1PWTA 3M0QA 2RD1A 2BUDA 3QZ5B 3X25B 1AOJA 2X35A 3I5RA 3P8DA 4K11A 3CCRQ 4PKCC 2B8AA 5LJ5j 1AWWA 4FT2A 3M0SA 2AT1B 2Y4YA 1BCOA 2DBMA 2P4RA 2E41A 3OQ5A 3QDFA 2COWA 5GAMe 3J7AF 1M8VA 1W6XA 3MEWA 2HEQA 3SB2A 3P8HA 4E7ZA 2E3IA 2CP7A 4M75B 5IHNA 1VQPQ 5CIUA 2OTLA 4J9EA 2ABLA 3OW2A 1OV3A 2EQJA 4OB0B 5CKBA 4DBQA 2D0NA 4F7UB 3JSCA 1M9SA 4N4HA 1Q7YC 1VQ6Q 4LD9K 1AZGB 2OAWA 4M78E 2L3RA 4HCZA 3EHQA 1W2BP 4C0ZA 4Y91A 2JJ9A 1OPLA 4Z8AA 2KSSA 3OYGA 3OBWA 1ZBXA 3RMSA 1QVGS 4IUVA 1VQLT 2LTOA 5KYYB 1N9SA 2E10A 3HL8A 3MKDA 3FEOA 4X34A 3OS1A 4XAXB 1OZ3A 1RAFB 3JV3A 2RO0A 2EYZA 5GANd 2HQXA 1U1TA 1ZLMA 5LJ3j 4A4KA 4ZGDB 2IIMA 2DXCA 4B6MA 3OMGA 4LUEA 5KH6A 2EGAA 4RKUE 3CPWP 1GCPA 2WSEE 3L2QA 5GAN4 2V8KA 2YRCA 2V26A 3QG1A 2DJQA 2PTKA 4FT4A 3L2RA 1KHCA 2VWFA 4C0GA 5KYYA 4M7AF 3UT1A 2ROTA 4RTTA 1D0ZA 1PKTA 4AFSC 4ZN3A 3EAEA 1WHGA 2AIRB 2K2MA 4CC2A 3VS0A 3H0IA 2BZYA 1X6GA 5FU6C 2ZPHB 1JXOA 2O9SA 3QXEB 3RKYA 5GMKi 4R0KA 5C0MA 2CH4A 4IUTA 2MF2A 3VS4A 1YCYA 4KT0E 1E6HA 4EMKC 3OYEA 4LDWA 3V7CA 1YHQA 1QVFS 4TVRA 4J7FA 3GPLA 2YRDA 4BE2A 2CS7A 1HYOA 3BDUA 3NFCA 3GIBA 4EMHA 1MMNA 1A0NB 3PT9A 2DKGA 2I2LA 5I11A 4F14A 1JJ2S 3EGDA 3DKMA 1B3QA 1WQ7A 4C5EA 1H8KA 2XIDA 4RTZA 2LMJA 1QCFA 2QQBA 1R8OB 1TXQA 3SFMA 3LGLA 5LJ5e 1RAIB 1UGRB 4FYVB 1YP5A 5GAN2 3BDLA 3LWHA 3EG1A 5DLOA 1MHNA 1TSFA 3A8OB 1FMWA 1U5SA 3OS5A 1JBMA 2RF0A 1VQ7A 2EWNA 1VQKT 3H0FA 2EBPA 3EGDB 4NL2A 5L23A 4RTXA 2KXCA 3S3OA 1RL2A 3CCLA 3JCMV 3CMAQ 3G7ZA 2RK2A 1AEYA 2O4XA 2QK0A 1G3WA 4PLLA 2QEXT 4ESRA 1MUZA 3CQTA 4F16A 5FRNA 1UGPB 1W1FA 1YBYA 2LQ8A 1PM3A 1WNLA 3G6ET 1ARKA 2M0YA 4X9CA 2XDBA 2FPDA 3JB9J 1Q7YR 9ATCB 2MI6A 1VQNA 1Q95G 2XICA 3MP8A 3JCMe 2GNCA 4LN2A 1PNJA 1ABQA 1YN8A 4M7DB 2A3LA 2RI3A 3LW5E 3FDRA 5GAN6 2COZA 3EGXB 1FWZA 1HSQA 3M59A 2DNUA 2QTVA 2FVUA 3OA6A 2FPFA 2E65A 5CKFA 1R77A 1NBEB 4FM4B 2BZXA 3V8KA 2RHXA 4HCBA 3VJPA 3UA7A 3GOXA 3QIIA 2DEQA 1Z9QA 4RCBA 2HD0A 4PJOA 2W10A 4M7DA 2DX1A 1HXDA 3HRTA 1PHTA 2EGEA 2WACA 3M0PA 1WXUA 1K9MC 1NEBA 2EYXA 3RERA 3EG3A 4XU2A 1QWFA 1H3HA 1YI2A 1G5VA 2C0IA 2KGTA 2RQUA 1IXDA 2DIGA 2LNVA 2WSFE 1NPRA 3CCEQ 2X4JA 3X28B 4J5YA 3A98A 1AT1B 4BE0A 1VYVA 4M75E 2DO3A 1M4ZA 2ROLA 1YNZA 2HQEA 2CREA 3H6ZA 5I2MA 1WJQA 4C8QD 1UUEA 3HKSA 1BU1A 4C0DB 2HL5C 4DOVA 1YITQ 2D8JA 2V8IA 2V1QA 4C8QE 4JRKA 1MNDA 1WGSA 1VQOT 3CC2T 4PFOA 1KQ1A 1TG0A 5GANj 1M1KU 4D8DA 4RUGA 2I0NA 2R5MA 2AZSA 2JW4A 3LGFA 4BDYA 3PIOA 2E4HA 3JCMJ 1BI1A 2HAXA 1XJWB 2AKLA 4FYXB 3G1JA 3M55A 1BIBA 2Y90A 2JT4A 5HCKA 2ATCB 2RQVA 1K73R 4J9GA 1ZQ1A 2DMOA 5KYWA 1G3TA 4IUPA 3M56A 4C92F 1CKAA 2XI9A 1AHJB 3MCAB 2FO0A 4FW1A 4C92D 1QW1A 1BI3A 2XU8A 1QQJA 4A63B 4RTVA 3RBBB 2EAYA 2HSEB 3CCRT 1I5OB 1D3BB 4JJCA 4C92B 2X4XA 1I81A 2HKQB 3EG2A 4PJOG 5IHKA 4A4HA 1MNEA 4PJOE 3A8LB 3CCJT 1SSFA 4C5IA 3QKJA 3RR6A 1T0HA 3RIRA 3UF4A 1QKWA 4J7IA 2VUBA 2DRMA 4JLIA 1VQLQ 5CR2A 2QASA 2AZVA 2JTFA 2MWPA 4J9CA 2JS2A 3GNFB 3M5AA 2ZPGB 2JM9A 2MPXC 5A2QE 4M7AD 4ELZC 3DLLA 3GNGA 3OSVA 5LJ3e 3EFSA 4M7AE 2RN8A 2OJ2A 1NJIU 3KFVA 3SDZA 3VS3A 4BI4A 3C0CA 1S72T 4NOYA 1YITT 3CEYA 1VQOA 4C8QA 2CSQA 2KVQG 5CKHA 2OTJT 2OTJA 1G83A 2A37A 2CH4W 2EYYA 1SPKA 4PJOB 4Z02A 1G3SA 2LX7A 2BE7D 3JCMg 2ZPFB 4LDYA 2F2XA 2XMFA 1P92A 3OYYA 4DOWA 4N0AC 3I56A 3VS6A 3HSBA 1VQNT 2RK1A 2LCLA 1WQWA 2K3BA 1VQNQ 5KCOA 2CYZB 4BACA 5HK0A 4RTWA 3ER0A 2F2VA 1GFCA 4C8QG 1YCSB 3QYHB 4C0FA 4LD6A 2QAZA 4FSSA 2CUBA 1I1JA 3CMEQ 3VKIA 1K1ZA 5CK9A 1RAGB 3OMCA 1B34A 2RNAA 1VQ7Q 4HA8A 2LJ3A 1G3YA 1VQ4A 1TUGB 3C4SA 3M54A 5J39A 4QKUA 3CMEA 3OYHA 3CMAT 3CCJA 2K5FA 4FIBA 2K2VA 5GMKm 1XOVA 4L6V5 2QDLA 1RLQC 2LQNA 4CI0C 2QEXQ 2XDPA 5CKEA 1UG1A 2AK5A 4PK4A 4E7SA 3OYKA 2VASA 1F1BB 4XU1A 3CCST 3QO3A 1ZSZA 4B9XA 1U8RA 4PJMA 2E1HA 4OMQA 3CCVA 1BB9A 3CCVT 4O6JA 1XNIA 2X51A 3MHXA 4KGZB 3CD6T 2CP5A 4C92C 5KYWB 1Q86C 2CZ1B 3UDCA 1X75C 3G71Q 2RMOA 1ACMB 1AWXA 2QEXA 2E70A 3HPWA 3PMIA 1FMKA 4ATOA 2R5AA 4E2FB 1TOVA 4C0DC 2X4YA 2EQMA 2QI2A 5AT1B 3META 2CZ6B 4KGXB 1NJIR 1KC8R 2FHDA 1ABOA 1RAHB 2DXBA 2LDMA 2LZ6B 3QUIA 2K6DA 5LJ3h 4E7LA 3QWYA 4M77G 4LDVA 3UPUA 2RI5A 4HXJA 1XQHA 3F70A 3VUBA 2ZZDA 4F7UA 3MEAA 2LRQA 1I5LA 1VQ9A 5GAMf 4J8OA 4MDXA 2FYKA 1V1CA 2ZPIB 2DXUA 3M0RA 1V76A 1N8RU 4HT9A 3CCQA 3RKXA 1MMGA 4X9DA 5J3BA 2NWMA 4FU6A 3ZL7C 2JZ2A 1PRLC 4P5NA 1GCQA 1YJNQ 5FU7C 1KC8C 3REBB 2C0OA 2NLUA 5CVIA 3CBPA 1RLPC 2DIQA 1JO8A 1WYXA 4C5GA 4KH1B 1W4SA 3CCQQ 2HDAA 3EH1A 1ZX6A 3MEVA 4J83A 3PGGA 1RI9A 2CP0A 1X2QA 2L5QA 2KXDA 2DFUA 3X20B 1OULA 2HMAA 3I56T 1YJ9T 3QYGB 4CC3A 1YJWQ 2LT4A 5ECAA 2VGMA 3CCLQ 4IIOA 2RJCA 3JB9F 2H3JA 3CC2A 3ZBDA 2E6NA 1V29B 1X6BA 2QA4T 2DA9A 4QVCA 2DZCA 3P8BB 2QQSA 3JB9D 8ATCB 4XU3A 2LQKA 1ZA1B 3WXMB 3CBOA 4WTOB 4LE9A 3OS0A 1SKUB 1VQOQ 3CC2Q 3CCRA 2J6KA 2MIOA 3EG9B 3OYMA 3KXTA 1QP3A 4JJDA 5D7UA 3A8HB 1SG5A 2MMPA 5GAOp 1Q86U 4LDXA 1GL5A 3VS1A 1QVFA 3CD6A 1U06A 3NPFA 4JDSA 1YWOA 2ZPEB 5CKDA 3CCSA 3G71T 3HHTB 3L42A 1QKXA 1WXTA 5C6SA 1VUBA 2P84A 1RUWA 4MZMA 4QW2A 1BKBA 3VS5A 5GAMh 3EFOA 2QYZA 1IGQA 4HVUA 4PFPA 2NUTB 2K3XA 2P0QA 1WFWA 1RACB 2O88A 2L8DA 2DL5A 4KUIA 1M8MA 4XQ3A 3JCMQ 3R6NA 1D09B 1W2BA 2DD5A 2YHTA 5IHIA 2GF7A 5DY9A 2GCXA 4M77B 1PRMC 1WXBA 2KQWA 5LJ3d 1YJ9A 4Y92A 1LPLA 2KMTA 1KG1A 4BB7A 2FEIA 3TVTA 3WVDB 4RTUA 2DL7A 3OYIA 3V8JA 3C94A 2GGRA 4JLGA 4NS5A 5LJ5d 4IURA 3PNWC 2JN0A 1AVZC 1MV0B 2LCCA 2RI2A 3QPHA 4DEXA 2VGNA 1DJ7B 5CQYA 1NG2A 2MCNA 1QVGA 3TSZA 4OMLA 2YUQA 3GLXA 5GAN8 2JMCA 1X27A 1B7TA 2QDYB 2J06A 3E2UA 1M90R 1YHQT 2DVJA 3QJYA 1Q82U 3S3NA 4JRIA 5GJWB 3OW2P 1VQ9Q 1CSKA 4J9FA 1GBQA 1YWPA 2ED0A 1IHVA 4A54A 2PUKB 1FYNA 2PVGB 1I07A
chains in the Genus database with same CATH topology
3FJ5A 2C0TA 2D8HA 4GLMA 4HCKA 2KRNA 2ECZA 2FO0A 5GJVB 5I22A 1NLPC 2PNIA 2GTJA 4A63B 3EGUA 1U3OA 4RTVA 3RBBB 2KROA 1ZBJA 4JPBW 1KFZA 4JJCA 2CUDA 2RPNA 2L2PA 2DL4A 3EG2A 2KBTA 4AFUC 1AZEA 1IO6A 5IHKA 1KSWA 1M3CA 1E6GA 1KIKA 1OOTA 1UHCA 2KNBB 3VRYA 1SHGA 2KYMA 3VS7A 1K9AA 3IQLA 4LNPA 1T0HA 4CC4B 4LUDA 2VVKA 3PE0A 3UF4A 1QKWA 2DRKA 3SHWA 2DRMA 1WI7A 3UA6A 2B86A 2AZVA 1WDXA 4WCIA 1AD5A 1AWOA 2NUZA 4J9CA 2JS2A 1HD3A 1GRIA 2KE9A 2JM9A 2JTEA 2DYBA 2EYWA 2DL3A 3NGPA 2LCSA 3VS2A 4ZNXA 2DL8A 1M27C 3THKA 2RQTA 1AWJA 2RN8A 3O5ZA 2LP5A 2OJ2A 1WA7A 3KFVA 1S1NA 2J05A 3NMZC 3VS3A 1PWTA 3C0CA 1QWEA 3M0QA 2CDTA 1NYFA 1UDLA 2CT3A 2YT6A 2ENMA 5FW9A 1AOJA 4X1VA 2J6OA 2F2WA 1SEMA 2YSQA 3I5RA 4K11A 2CSQA 4Z89A 1SHFA 1G83A 1AWWA 2A37A 2CH4W 3M0SA 2EYYA 1SPKA 1ZSGA 4KRTA 2DBMA 2P4RA 3QWXX 2LX7A 1N5ZA 2F2XA 2XMFA 3PVQA 1W6XA 3VS6A 2HEQA 2G6FX 2K3BA 2KT8A 5IHNA 3I35A 2DE0X 1UJ0A 4ORZA 1UE9A 4OMNA 4RTWA 1NYGA 2F2VA 4J9EA 2KRSA 1UFFA 2ABLA 1GFCA 3ULRB 1OV3A 1NEGA 1YCSB 1ZUKA 1TUCA 4FSSA 2CUBA 1I1JA 1K1ZA 2D0NA 1X69A 1UECA 2RNAA 2W0ZA 2OAWA 1AZGB 1K4US 1W70A 2LJ3A 3EHQA 1WIEA 2PZ1A 1Z9ZA 1WLPB 4Z8AA 1OPLA 2K9GA 1BK2A 4OMOA 1UJYA 1X2KA 1M3AA 3JV3A 2K79A 1XOVA 2EYZA 1ZLMA 2L3QA 2IIMA 4J9HA 2QDLA 4LUEA 1PKSA 2EGAA 2JM8A 1RLQC 1GCPA 2OI3A 2LQNA 2KR3A 4M4ZA 1J3TA 2JS0A 2CT4A 1UG1A 2AK5A 2HCKA 2LJ0A 2DJQA 2PTKA 4JZ4A 1ZUYA 2VWFA 2KEAA 4HVWA 4OMQA 1BB9A 5IH2A 2ROTA 4RTTA 1PKTA 4IIMA 4AFSC 2K2MA 2KYBA 4CC2A 3VS0A 3H0IA 2BZYA 3UATA 1X6GA 2RMOA 2O9SA 1JXOA 1AWXA 2YUOA 4R0KA 2LJ1A 2CH4A 1FMKA 3VS4A 1I0CA 1E6HA 1VYTA 2DM1A 2JXBA 2VKNA 2EKHA 3GBQA 2GTOA 1Y0MA 4QT7A 3LH5A 3PVLA 1ABOA 2KRMA 2LZ6B 2K6DA 3QWYA 4J9BA 1NM7A 4HXJA 1A0NB 5EC7A 4JJBA 5I11A 4F14A 1B3QA 2BZ8A 1V1CA 1H8KA 2J6FA 4RTZA 2DILA 2LMJA 3I9QA 3M0RA 1QCFA 2L3PA 3RNJA 1M30A 1WX6A 1CKBA 2NWMA 3ZL7C 2YUPA 1PRLC 2YUNA 1B07A 1YP5A 1GCQA 2LNHB 4CC7A 3EG1A 3REBB 1UGVA 2C0OA 1QLYA 1U5SA 4AG1C 1RLPC 1MV3A 1JEGA 2RF0A 1JQQA 1JO8A 1WYXA 3H0FA 2EBPA 3M0UA 4D8KA 2HDAA 4RTXA 5L23A 2KXCA 1ZX6A 2GQIA 1RI9A 1X2QA 1T0JA 3H41A 2KXDA 2J7IA 1AEYA 4CC3A 5IXBA 5ECAA 1SSHA 4ESRA 4IIOA 1MUZA 3CQTA 4F16A 2X3XD 1W1FA 1M3BA 1LCKA 2SRCA 1BBZA 1GCQC 1X6BA 2M0YA 4OMMA 1ARKA 1KJWA 2DA9A 2FPDA 1JU5C 1X43A 4HVVA 4AG2C 5FWCA 3VRZA 2GNCA 2V1RA 4LN2A 1K0XA 4LE9A 3TSWA 1SRMA 3M0TA 1PNJA 1ABQA 2K7AA 1YN8A 4F17A 2A08A 2J6KA 1HSQA 1GBRA 2MIOA 4AFQC 2DNUA 3I5SA 3EG0A 2FPFA 4JJDA 2BZXA 1VYUA 2SEMA 1GL5A 3VS1A 3UA7A 4J9IA 1OEBA 2L3SA 1U06A 3NPFA 2FPEA 1YWOA 4RTYA 1Z9QA 2ED1A 2GBQA 2W10A 1T3LA 2DX1A 1QKXA 1WXTA 1PHTA 2EGEA 2HSPA 3M0PA 1WXUA 3NHNA 1RUWA 2FG0A 2L0AA 4EIKA 1NEBA 2EYXA 3VS5A 3EG3A 3U23A 1T3SA 1QWFA 2A36A 1H3HA 2C0IA 2EGCA 2KGTA 2RQUA 4HVUA 1NLOC 1SRLA 2RQRA 1K0SA 1WFWA 4J9DA 4DEYA 2EW3A 1H92A 2O88A 2O9VA 2DL5A 1K76A 2O31A 1M8MA 1TUDA 3A98A 1VYVA 2MOXA 3R6NA 2ROLA 1YNZA 2EPDA 2LQWA 5IHIA 2CREA 1PRMC 1WXBA 4Y92A 1UUEA 3EHRA 2KT1A 1BU1A 4JZ3A 2FEIA 2D8JA 1GFDA 3TVTA 1JXMA 1G2BA 2V1QA 4RTUA 2DL7A 3H0HA 2GGRA 4GBQA 2EQIA 5IXFA 1E7OA 1AVZC 1MV0B 1TG0A 2BTTA 4RUGA 4D8DA 2FRYA 2I0NA 4DEXA 2X3WD 1ZUUA 2D1XA 2AZSA 2JW4A 2M51A 4AFZC 1UHFA 3REAB 2DF6A 1NG2A 2MCNA 2CSIA 2O2OA 2HBWA 2ESWA 2FRWA 3TSZA 4OMLA 1VA7A 2YUQA 2AKKA 2DLPA 1EFNA 2JMCA 1X27A 4Z88A 2YDLA 2AKLA 2J06A 4E6RA 1Y57A 4OMPA 2A28A 2RQWA 2JT4A 2H8HA 5HCKA 2DVJA 1UTIA 5FWBA 2RQVA 2DBKA 4J9GA 2DMOA 5GJWB 1CSKA 4J9FA 1GBQA 1HJDA 1YWPA 2ED0A 1OPKA 2JMAA 1FYNA 1I07A 2EVRA 2E5KA 3SEMA 1CKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FJ5 A;  2C0T A;  2D8H A;  4GLM A;  4HCK A;  2KRN A;  2ECZ A;  2FO0 A;  5GJV B;  5I22 A;  1NLP C;  2PNI A;  2GTJ A;  4A63 B;  3EGU A;  1U3O A;  4RTV A;  3RBB B;  2KRO A;  1ZBJ A;  4JPB W;  1KFZ A;  4JJC A;  2CUD A;  2RPN A;  2L2P A;  2DL4 A;  3EG2 A;  2KBT A;  4AFU C;  1AZE A;  1IO6 A;  5IHK A;  1KSW A;  1M3C A;  1E6G A;  1KIK A;  1OOT A;  1UHC A;  2KNB B;  3VRY A;  1SHG A;  2KYM A;  3VS7 A;  1K9A A;  3IQL A;  4LNP A;  1T0H A;  4CC4 B;  4LUD A;  2VVK A;  3PE0 A;  3UF4 A;  1QKW A;  2DRK A;  3SHW A;  2DRM A;  1WI7 A;  3UA6 A;  2B86 A;  2AZV A;  1WDX A;  4WCI A;  1AD5 A;  1AWO A;  2NUZ A;  4J9C A;  2JS2 A;  1HD3 A;  1GRI A;  2KE9 A;  2JM9 A;  2JTE A;  2DYB A;  2EYW A;  2DL3 A;  3NGP A;  2LCS A;  3VS2 A;  4ZNX A;  2DL8 A;  1M27 C;  3THK A;  2RQT A;  1AWJ A;  2RN8 A;  3O5Z A;  2LP5 A;  2OJ2 A;  1WA7 A;  3KFV A;  1S1N A;  2J05 A;  3NMZ C;  3VS3 A;  1PWT A;  3C0C A;  1QWE A;  3M0Q A;  2CDT A;  1NYF A;  1UDL A;  2CT3 A;  2YT6 A;  2ENM A;  5FW9 A;  1AOJ A;  4X1V A;  2J6O A;  2F2W A;  1SEM A;  2YSQ A;  3I5R A;  4K11 A;  2CSQ A;  4Z89 A;  1SHF A;  1G83 A;  1AWW A;  2A37 A;  2CH4 W;  3M0S A;  2EYY A;  1SPK A;  1ZSG A;  4KRT A;  2DBM A;  2P4R A;  3QWX X;  2LX7 A;  1N5Z A;  2F2X A;  2XMF A;  3PVQ A;  1W6X A;  3VS6 A;  2HEQ A;  2G6F X;  2K3B A;  2KT8 A;  5IHN A;  3I35 A;  2DE0 X;  1UJ0 A;  4ORZ A;  1UE9 A;  4OMN A;  4RTW A;  1NYG A;  2F2V A;  4J9E A;  2KRS A;  1UFF A;  2ABL A;  1GFC A;  3ULR B;  1OV3 A;  1NEG A;  1YCS B;  1ZUK A;  1TUC A;  4FSS A;  2CUB A;  1I1J A;  1K1Z A;  2D0N A;  1X69 A;  1UEC A;  2RNA A;  2W0Z A;  2OAW A;  1AZG B;  1K4U S;  1W70 A;  2LJ3 A;  3EHQ A;  1WIE A;  2PZ1 A;  1Z9Z A;  1WLP B;  4Z8A A;  1OPL A;  2K9G A;  1BK2 A;  4OMO A;  1UJY A;  1X2K A;  1M3A A;  3JV3 A;  2K79 A;  1XOV A;  2EYZ A;  1ZLM A;  2L3Q A;  2IIM A;  4J9H A;  2QDL A;  4LUE A;  1PKS A;  2EGA A;  2JM8 A;  1RLQ C;  1GCP A;  2OI3 A;  2LQN A;  2KR3 A;  4M4Z A;  1J3T A;  2JS0 A;  2CT4 A;  1UG1 A;  2AK5 A;  2HCK A;  2LJ0 A;  2DJQ A;  2PTK A;  4JZ4 A;  1ZUY A;  2VWF A;  2KEA A;  4HVW A;  4OMQ A;  1BB9 A;  5IH2 A;  2ROT A;  4RTT A;  1PKT A;  4IIM A;  4AFS C;  2K2M A;  2KYB A;  4CC2 A;  3VS0 A;  3H0I A;  2BZY A;  3UAT A;  1X6G A;  2RMO A;  2O9S A;  1JXO A;  1AWX A;  2YUO A;  4R0K A;  2LJ1 A;  2CH4 A;  1FMK A;  3VS4 A;  1I0C A;  1E6H A;  1VYT A;  2DM1 A;  2JXB A;  2VKN A;  2EKH A;  3GBQ A;  2GTO A;  1Y0M A;  4QT7 A;  3LH5 A;  3PVL A;  1ABO A;  2KRM A;  2LZ6 B;  2K6D A;  3QWY A;  4J9B A;  1NM7 A;  4HXJ A;  1A0N B;  5EC7 A;  4JJB A;  5I11 A;  4F14 A;  1B3Q A;  2BZ8 A;  1V1C A;  1H8K A;  2J6F A;  4RTZ A;  2DIL A;  2LMJ A;  3I9Q A;  3M0R A;  1QCF A;  2L3P A;  3RNJ A;  1M30 A;  1WX6 A;  1CKB A;  2NWM A;  3ZL7 C;  2YUP A;  1PRL C;  2YUN A;  1B07 A;  1YP5 A;  1GCQ A;  2LNH B;  4CC7 A;  3EG1 A;  3REB B;  1UGV A;  2C0O A;  1QLY A;  1U5S A;  4AG1 C;  1RLP C;  1MV3 A;  1JEG A;  2RF0 A;  1JQQ A;  1JO8 A;  1WYX A;  3H0F A;  2EBP A;  3M0U A;  4D8K A;  2HDA A;  4RTX A;  5L23 A;  2KXC A;  1ZX6 A;  2GQI A;  1RI9 A;  1X2Q A;  1T0J A;  3H41 A;  2KXD A;  2J7I A;  1AEY A;  4CC3 A;  5IXB A;  5ECA A;  1SSH A;  4ESR A;  4IIO A;  1MUZ A;  3CQT A;  4F16 A;  2X3X D;  1W1F A;  1M3B A;  1LCK A;  2SRC A;  1BBZ A;  1GCQ C;  1X6B A;  2M0Y A;  4OMM A;  1ARK A;  1KJW A;  2DA9 A;  2FPD A;  1JU5 C;  1X43 A;  4HVV A;  4AG2 C;  5FWC A;  3VRZ A;  2GNC A;  2V1R A;  4LN2 A;  1K0X A;  4LE9 A;  3TSW A;  1SRM A;  3M0T A;  1PNJ A;  1ABQ A;  2K7A A;  1YN8 A;  4F17 A;  2A08 A;  2J6K A;  1HSQ A;  1GBR A;  2MIO A;  4AFQ C;  2DNU A;  3I5S A;  3EG0 A;  2FPF A;  4JJD A;  2BZX A;  1VYU A;  2SEM A;  1GL5 A;  3VS1 A;  3UA7 A;  4J9I A;  1OEB A;  2L3S A;  1U06 A;  3NPF A;  2FPE A;  1YWO A;  4RTY A;  1Z9Q A;  2ED1 A;  2GBQ A;  2W10 A;  1T3L A;  2DX1 A;  1QKX A;  1WXT A;  1PHT A;  2EGE A;  2HSP A;  3M0P A;  1WXU A;  3NHN A;  1RUW A;  2FG0 A;  2L0A A;  4EIK A;  1NEB A;  2EYX A;  3VS5 A;  3EG3 A;  3U23 A;  1T3S A;  1QWF A;  2A36 A;  1H3H A;  2C0I A;  2EGC A;  2KGT A;  2RQU A;  4HVU A;  1NLO C;  1SRL A;  2RQR A;  1K0S A;  1WFW A;  4J9D A;  4DEY A;  2EW3 A;  1H92 A;  2O88 A;  2O9V A;  2DL5 A;  1K76 A;  2O31 A;  1M8M A;  1TUD A;  3A98 A;  1VYV A;  2MOX A;  3R6N A;  2ROL A;  1YNZ A;  2EPD A;  2LQW A;  5IHI A;  2CRE A;  1PRM C;  1WXB A;  4Y92 A;  1UUE A;  3EHR A;  2KT1 A;  1BU1 A;  4JZ3 A;  2FEI A;  2D8J A;  1GFD A;  3TVT A;  1JXM A;  1G2B A;  2V1Q A;  4RTU A;  2DL7 A;  3H0H A;  2GGR A;  4GBQ A;  2EQI A;  5IXF A;  1E7O A;  1AVZ C;  1MV0 B;  1TG0 A;  2BTT A;  4RUG A;  4D8D A;  2FRY A;  2I0N A;  4DEX A;  2X3W D;  1ZUU A;  2D1X A;  2AZS A;  2JW4 A;  2M51 A;  4AFZ C;  1UHF A;  3REA B;  2DF6 A;  1NG2 A;  2MCN A;  2CSI A;  2O2O A;  2HBW A;  2ESW A;  2FRW A;  3TSZ A;  4OML A;  1VA7 A;  2YUQ A;  2AKK A;  2DLP A;  1EFN A;  2JMC A;  1X27 A;  4Z88 A;  2YDL A;  2AKL A;  2J06 A;  4E6R A;  1Y57 A;  4OMP A;  2A28 A;  2RQW A;  2JT4 A;  2H8H A;  5HCK A;  2DVJ A;  1UTI A;  5FWB A;  2RQV A;  2DBK A;  4J9G A;  2DMO A;  5GJW B;  1CSK A;  4J9F A;  1GBQ A;  1HJD A;  1YWP A;  2ED0 A;  1OPK A;  2JMA A;  1FYN A;  1I07 A;  2EVR A;  2E5K A;  3SEM A;  1CKA A; 
#chains in the Genus database with same CATH topology
 3FJ5 A;  7AT1 B;  2EFI A;  4QQG A;  1OZ2 A;  3RMQ A;  1S72 A;  1QMC A;  2YLC A;  1IB8 A;  4XTX A;  4JPB W;  3TCJ A;  4XK8 E;  1KFZ A;  4PJJ A;  2RPN A;  3CXC A;  1IO6 A;  4XTV A;  3RDV A;  2O01 E;  1YI2 Q;  3MO8 A;  1E6G A;  1KIK A;  1PSE A;  1OOT A;  4WF2 A;  3X24 B;  1NZ9 A;  3VRY A;  3LLR A;  4YTL A;  2KYM A;  3VS7 A;  3IQL A;  5I2S A;  3CXC S;  3OS2 A;  2LT1 A;  4CC4 B;  4XTW A;  2VVK A;  2OTJ Q;  1VQP A;  4EPC A;  4DBF A;  1WI7 A;  4M78 D;  1WJR A;  1KD1 R;  8AT1 B;  1WDX A;  4WCI A;  1AWO A;  2NUZ A;  5FRO A;  1GRI A;  5DM7 R;  2KE9 A;  3AHU A;  4LDU A;  1VQ7 T;  3NGP A;  2A0F B;  1C1A A;  2JOY A;  3OYB A;  5FU7 B;  2RQT A;  2EQU A;  1WA7 A;  1R0B G;  2M9U A;  4JUV A;  4PJO C;  2F1L A;  2CDT A;  1NYF A;  1QVP A;  1UDL A;  3A8M B;  3M4G A;  2YT6 A;  1VQ5 Q;  4X1V A;  2J6O A;  2XKO C;  5M9O A;  4O5V A;  4RG8 A;  1KQS P;  4Z89 A;  2MWO A;  1SHF A;  2QG9 B;  4XTY A;  3I55 Q;  3FB9 A;  2YWW A;  2R58 A;  4PJN A;  1OX8 A;  3X26 B;  2EYQ A;  4E47 A;  3QZ9 B;  3LWI A;  5KE3 A;  2CZ7 B;  5HK3 A;  2DAQ A;  1D3B A;  3CD6 Q;  3V7S A;  3OW2 S;  5FLX E;  2KY9 A;  4A4E A;  3CCL T;  5GMK l;  1WHL A;  2EJ9 A;  5EG2 A;  3DLM A;  1VQM T;  2QA4 A;  3I35 A;  3CMA A;  3CBM A;  2DE0 X;  1UJ0 A;  4ORZ A;  1UE9 A;  3JB9 I;  3HRU A;  4OMN A;  1NYG A;  2CKK A;  1UFF A;  3ULR B;  1NEG A;  5KYU A;  2BKD N;  2PVD B;  1TUC A;  3VV0 A;  2EKO A;  4AMC A;  1X69 A;  2VXF A;  1IRX A;  2PVO B;  1K4U S;  1WIE A;  2PZ1 A;  1Z9Z A;  2QQR A;  4EDU A;  1WLP B;  1EIF A;  1YJN T;  3SWN C;  1VQ6 A;  2D6F A;  3KBG A;  4A4F A;  4OMO A;  4BY6 B;  1UJY A;  1GXI E;  3JAM E;  4J9H A;  1VQL A;  4M75 C;  1WHM A;  1ZSZ B;  2MK5 A;  2JM8 A;  4CRI A;  4M4Z A;  2JS0 A;  2CT4 A;  2LX9 A;  1BI2 A;  2HCK A;  4MZP A;  3TU4 K;  4HT8 A;  4JZ4 A;  4Y28 E;  2VYT A;  4FL6 A;  1K73 U;  3A8G B;  2KK4 A;  2KEA A;  5IH2 A;  3CCM Q;  1M5Q 1;  2K3Y A;  2MYS A;  3OYL A;  2WSC E;  1W2B S;  4EMG A;  2DD4 A;  5LJ5 f;  1N9R A;  4PJO F;  4ZN1 A;  1Y96 A;  3UAT A;  2PQW A;  1QVG P;  1VQ8 T;  3CC4 A;  3JCM d;  2YUO A;  3BE3 A;  1OYX A;  2DPP B;  4M78 F;  3FIF A;  2PU9 B;  1PD0 A;  2DM1 A;  2K4Y A;  5LJ5 h;  2VKN A;  5GAM d;  2GTO A;  1Y0M A;  4RCC A;  3G6E Q;  3L2V A;  1FXX A;  4QT7 A;  2OX7 A;  2RHZ A;  1M2V A;  4MDW A;  1WZO A;  4A4G A;  1VQ6 T;  3JRZ A;  2ZCF B;  2PUO B;  3I56 Q;  2IG0 A;  4JS4 A;  4J9B A;  2LVM A;  1ZSZ C;  4ZGE B;  2F69 A;  3H8Z A;  1MGQ A;  3BY7 A;  2VC8 A;  4JJB A;  2BZ8 A;  1O9S A;  5GAN 3;  2J6F A;  3I9Q A;  3RNJ A;  4ELY C;  3A1P A;  3TQ7 P;  4UC4 A;  2L89 A;  3NTK A;  2YUN A;  1B07 A;  4M77 D;  3MPU B;  3CC7 Q;  5GMK h;  3FRN A;  2CP2 A;  4FYY B;  4CC7 A;  1UGV A;  5CAI A;  1QLY A;  2X9H A;  1MMA A;  1BI0 A;  2QQ9 A;  1JEG A;  1JQQ A;  1N27 A;  1K8A R;  3M0U A;  2QQA A;  2GQI A;  4BD3 A;  1QCN A;  3D7S B;  4QQD A;  2J7I A;  4ZGJ B;  4C8Q B;  4M77 C;  1Q82 C;  2X3X D;  4M75 F;  4PJL A;  2SRC A;  1BBZ A;  1GCQ C;  4OMM A;  4Q5W A;  1KJW A;  4C92 A;  1JU5 C;  1X43 A;  3CCU T;  3CCU A;  1VQ4 Q;  4HVV A;  3EFO B;  1M90 U;  5FWC A;  5DLQ E;  2JTM A;  2DTH A;  4M7A C;  4MMK A;  4DBR A;  1K0X A;  3TSW A;  3RUX A;  2K7A A;  2RJE A;  2NUP B;  4XTU A;  4VUB A;  2A08 A;  3CC7 A;  2P0P A;  3JB9 G;  2JVV A;  4F04 B;  1GBR A;  1D1B A;  2YRV A;  4NL3 A;  2XK0 A;  3EG0 A;  1U1S A;  3HP9 A;  2DER A;  2XD0 A;  3CME T;  5GAO q;  2FZK B;  4DA4 A;  1OU8 A;  1VYU A;  4J9I A;  1M1K C;  2V8J A;  5CO7 A;  1TTH B;  3L2W A;  1YFN A;  2FPE A;  3PIP A;  4RTY A;  5D6X A;  4C92 G;  2O4X B;  3S3M A;  1Q81 R;  2JUF A;  2E3H A;  2EJG A;  1UEB A;  2GBQ A;  3OYD A;  1T3L A;  3LYI A;  2X4W A;  3E9F A;  1N8R C;  5GAO m;  2DXT A;  1D1C A;  1VQP T;  4BDZ A;  3NHN A;  2FG0 A;  2L0A A;  4EIK A;  3U23 A;  4OF1 A;  1T3S A;  3HRS A;  4C92 E;  1I4K 1;  1JJ2 A;  4KUL A;  4C8Q F;  3PTA A;  4EMK B;  1YIJ T;  1YJW A;  2RQR A;  3JCM b;  1K0S A;  2EJF A;  3HFN A;  2RM4 A;  3VUZ A;  4KGV B;  3CXC P;  1JJ2 P;  1ZA2 B;  1O75 A;  1RAA B;  1UGQ B;  4HKE A;  1JB0 E;  4XU0 A;  3I55 T;  2CP6 A;  2LQW A;  1M1K R;  1OQK A;  1TWB A;  2CGH A;  2C06 A;  3EHR A;  1Q7Y U;  2M1H A;  2IPO B;  2P4T A;  5GAM g;  4JZ3 A;  4FCY A;  3E19 A;  1JXM A;  3CPF A;  3R6O A;  3CC4 Q;  1G2B A;  4GBQ A;  2E12 A;  3QBY A;  2ZGW A;  2E64 A;  2FRY A;  6AT1 B;  4MZT A;  2X3W D;  1ZUU A;  2D1X A;  5GAN 5;  4AFZ C;  1UHF A;  2D9T A;  1VQM A;  4M77 A;  5KYX A;  3ME9 A;  1M2V B;  2CSI A;  2O2O A;  2HBW A;  2ESW A;  4V2S A;  3QDR B;  1VA7 A;  4BUG A;  2AKK A;  4L59 A;  4Z88 A;  1EFN A;  5KE2 A;  2YXY A;  3HTR A;  1R0C B;  1Y57 A;  2RHU A;  2RQW A;  4FYW B;  5FWB A;  1MMD A;  1M90 C;  2DBK A;  3MJX A;  3DB4 A;  1OPK A;  1Y96 B;  4E7J A;  4M77 F;  1C0M A;  1C6V X;  4N0A A;  4M7D G;  3CCQ T;  2IVW A;  2C0T A;  1YI2 T;  2D8H A;  2FL7 A;  3BW1 A;  1PG5 B;  1UGS B;  2KRN A;  5D6Y A;  2ECZ A;  1LJO A;  3VYG A;  5I22 A;  1IZ6 A;  2DTO A;  2PNI A;  2GTJ A;  3EGU A;  3Q1J A;  1M1G A;  1ZBJ A;  3MP1 A;  2DEU A;  3OYJ A;  3FC3 A;  1D0Y A;  2EQK A;  4IUU A;  5HKC A;  4AFU C;  2KBT A;  2KDS A;  3ZFJ A;  4M75 D;  3L2U A;  1KSW A;  2K5I A;  5LL6 S;  1M3C A;  1OX9 A;  1UHC A;  2KNB B;  1SHG A;  4M78 G;  1K9A A;  4LNP A;  1VOM A;  4JRP A;  4LUD A;  2VV5 A;  1EX4 A;  4N4G A;  2HKN A;  3OYC A;  5FU6 B;  3QSU A;  2M02 A;  2B86 A;  3H9N A;  1K9M R;  3FJP A;  5GAO n;  4DQ2 A;  1AD5 A;  1YJW T;  1WHH A;  1NPP A;  3MEU A;  2DYB A;  3EFR A;  1K8A U;  2BE9 B;  1RAD B;  2E5Q A;  5LJ3 g;  3VS2 A;  3JCM P;  3G4S Q;  5AYF A;  3O8V A;  3THK A;  2ZAE A;  3O5Z A;  4M7D D;  4HCC A;  1S1N A;  1QWE A;  1QCO A;  1PCX A;  3DB3 A;  2CT3 A;  3M58 A;  4M7D E;  1RAB B;  2ENM A;  5FW9 A;  2RH2 A;  5I21 A;  3TEE A;  2F2W A;  1SEM A;  2YSQ A;  4F7U E;  4M77 E;  3L2Z A;  2K57 A;  5LJ3 f;  3TRE A;  2RJD A;  1ZSG A;  3J80 E;  4KRT A;  2OTL Q;  1Q81 C;  4FW2 A;  5J26 A;  3QWX X;  4EMK A;  3CCJ Q;  1Y7X A;  3CCV Q;  1N5Z A;  4E7K A;  4GLK A;  3PVQ A;  2RB6 A;  1KD1 U;  4B9W A;  5A0D A;  4PJO D;  1VQ5 T;  2G6F X;  2RHY A;  2RA2 A;  2KT8 A;  3LX7 A;  1Y71 A;  2FZG B;  3KUF A;  3G6E A;  3T9N A;  1XTD A;  2KRS A;  1YJN A;  2EIF A;  1ZUK A;  5GAM j;  3PFS A;  1M1F A;  2GQV A;  5FRM A;  1TS9 A;  4L5G A;  1UEC A;  2W0Z A;  3LH0 A;  1W70 A;  2NUP A;  1RI0 A;  1NE8 A;  4KBM B;  2K9G A;  4JRQ A;  1BCM A;  3EG9 A;  4BI3 A;  1OI1 A;  1BK2 A;  2DJZ A;  4OB2 B;  1WJS A;  3WVE B;  2OTL T;  4M78 A;  3RES A;  4M7A B;  3JCM h;  1X2K A;  1M3A A;  2K79 A;  2HL3 A;  2G3R A;  1WPY A;  2L3Q A;  3SWN B;  2FZC B;  1EZZ B;  4II1 A;  1PKS A;  3CC7 T;  3VU3 C;  2OI3 A;  2KR3 A;  1J3T A;  3JCM f;  3NTH A;  2LJ0 A;  1VQ4 T;  4KUD K;  1QVF P;  3A5Z B;  3HFO A;  1ZUY A;  1K73 C;  1Q82 R;  4HVW A;  5A0G A;  4IIM A;  2HBP A;  2KYB A;  4RMO A;  2NUT A;  2HQH A;  2QXF A;  3GF5 A;  4DBH A;  3SWN A;  2JNG A;  1YJ9 Q;  1IGU A;  4A53 A;  2LJ1 A;  3CCE T;  3QJ6 A;  4BI8 B;  1I0C A;  1VYT A;  2JXB A;  5IN1 A;  3OY9 A;  2EKH A;  2MAM A;  3GBQ A;  4MML A;  1VQK A;  2HZY A;  3LH5 A;  5GAN g;  3RKW A;  2HNI A;  3PVL A;  4OB1 B;  2DK3 A;  2RJF A;  1G8X A;  2KRM A;  1S72 Q;  1NJI C;  2QGF B;  1NM7 A;  1VQ8 Q;  1LVK A;  4GY5 A;  3CCM A;  5EC7 A;  3INZ A;  1FX7 A;  3VYH B;  2F5T X;  1VQK Q;  4R56 A;  1M2O A;  1K9M U;  3C95 A;  3CCU Q;  2VXE A;  4JS5 A;  2AHJ B;  2DIL A;  5KCH A;  3AT1 B;  1PSF A;  4M7A G;  2L3P A;  1M30 A;  1WX6 A;  1CKB A;  4E7I A;  4QVZ A;  2YUP A;  3G71 A;  5IAY A;  1X6O A;  2LNH B;  1KQ2 A;  4AG1 C;  1MV3 A;  5GAN e;  5A0L A;  5HY6 A;  1BYM A;  4D8K A;  4BE1 A;  2KAF A;  1IHW A;  2CZ0 B;  1T0J A;  3H41 A;  4PFZ A;  1YIJ Q;  5GAN h;  2GFU A;  4OB3 B;  5IXB A;  3CC4 T;  1SSH A;  5GAO l;  1VQM Q;  2ZPB B;  1N6A A;  4M7A A;  1VQ9 T;  1VQ8 A;  3ZEH A;  1M3B A;  4AT1 B;  1LCK A;  1KK7 A;  4M7D C;  1H3Z A;  3L1A A;  5GAN f;  3V8L A;  3G4S A;  2QGG A;  4AG2 C;  2Z0W A;  3VRZ A;  4ZTF A;  5LJ5 g;  2V1R A;  1WHK A;  4J6X A;  1YIT A;  1B34 B;  1SRM A;  3M0T A;  1SF9 A;  4F17 A;  3E9G A;  5GMK j;  1OU9 A;  3M9Q A;  4M75 G;  2DTI A;  3V7R A;  3QHS A;  2KI7 A;  4AFQ C;  4QQ6 A;  3I5S A;  1YIJ A;  2H3E B;  1D1A A;  1QP2 A;  5KYU B;  3CCE A;  4OVA A;  3EGX A;  2SEM A;  3SD4 A;  4FSX A;  4J6W A;  1OEB A;  2L3S A;  1IRE B;  5GAO r;  1WHJ A;  2Y4X A;  4OGC A;  2XHC A;  2ED1 A;  2YLB A;  2HSP A;  2FB7 A;  4XTZ A;  2LC4 A;  4QVD A;  1LNX A;  1RAE B;  2A36 A;  3URG A;  4M75 A;  2EGC A;  2QTX A;  4LXC A;  1NLO C;  1SRL A;  4PL6 A;  4J6Y A;  4JJN K;  1N8R R;  4J9D A;  4DEY A;  2EW3 A;  1HK9 A;  1H92 A;  1PC0 A;  2O9V A;  1K76 A;  2O31 A;  4BY6 C;  1TUD A;  3ASK A;  1VIE A;  3FLG A;  2MOX A;  2RHI A;  2EPD A;  5D6W A;  3EH2 A;  4D6W A;  2KT1 A;  5CQX A;  1KD1 C;  1GFD A;  3CPW A;  1KQS A;  3H0H A;  2K5L A;  4M78 B;  2EQI A;  2F5K A;  5IXF A;  4PNO A;  1E7O A;  2BTT A;  1Q81 U;  2NYS A;  4OMF B;  5KYN A;  3GP8 A;  2M51 A;  1VQ5 A;  3REA B;  3CPW S;  2DF6 A;  4RG2 A;  1KQS S;  2FRW A;  2P0K A;  2DET A;  4C5H A;  3OYF A;  2A7Y A;  3C12 A;  2DLP A;  4ME7 A;  3S6W A;  1FMV A;  5IT9 E;  2YDL A;  2XDD A;  4E6R A;  4N4I A;  5L8R E;  4M78 C;  4OMP A;  2A28 A;  1TU0 B;  2H8H A;  4R55 A;  3JCM W;  4E7H A;  1UTI A;  2E6Z A;  1TH7 A;  3M53 A;  2M16 A;  1HJD A;  1JRI A;  4KH0 B;  4OP0 A;  4PLI A;  1I8F A;  2CP3 A;  2VB6 A;  4C8Q C;  2JMA A;  4OGE A;  2EVR A;  3G4S T;  2E5K A;  4F7U F;  3SEM A;  1K8A C;  4GLM A;  4HCK A;  4M7D F;  3NTI A;  3JB9 H;  5GJV B;  1H64 1;  1NLP C;  2OAU A;  2R57 A;  4IKF A;  1ZHI A;  3E1S A;  2M0O A;  1U3O A;  2KRO A;  1KHI A;  2COY A;  3UWN A;  3OYA A;  2CUD A;  5GMK e;  2L2P A;  2DL4 A;  3I55 A;  2XG8 D;  3CCS Q;  1AZE A;  1KC8 U;  2DYI A;  3OB9 A;  3MP6 A;  1VIF A;  2GFA A;  3M57 A;  1PD1 A;  3M4Y A;  4ZTJ A;  3BFM A;  4IUQ A;  2DZ9 A;  3PE0 A;  3OBY A;  2QA4 Q;  3JCM c;  2DRK A;  3SHW A;  1Y07 A;  1UB4 A;  3PMT A;  3CCM T;  3N5B B;  3UA6 A;  5GAN 7;  4F7U G;  3OYN A;  3JCM X;  1HD3 A;  2D0Q B;  1YHQ Q;  4ANJ A;  1BIA A;  2JTE A;  2EYW A;  5KYX B;  2DL3 A;  2LCS A;  3J81 E;  2DVE A;  4ZNX A;  1D0X A;  1Q86 R;  1X01 A;  2BIV A;  2DL8 A;  1M27 C;  5CCA A;  1AWJ A;  2LP5 A;  1LOJ A;  3OSS C;  2J05 A;  3NMZ C;  1PWT A;  3M0Q A;  2RD1 A;  2BUD A;  3QZ5 B;  3X25 B;  1AOJ A;  2X35 A;  3I5R A;  3P8D A;  4K11 A;  3CCR Q;  4PKC C;  2B8A A;  5LJ5 j;  1AWW A;  4FT2 A;  3M0S A;  2AT1 B;  2Y4Y A;  1BCO A;  2DBM A;  2P4R A;  2E41 A;  3OQ5 A;  3QDF A;  2COW A;  5GAM e;  3J7A F;  1M8V A;  1W6X A;  3MEW A;  2HEQ A;  3SB2 A;  3P8H A;  4E7Z A;  2E3I A;  2CP7 A;  4M75 B;  5IHN A;  1VQP Q;  5CIU A;  2OTL A;  4J9E A;  2ABL A;  3OW2 A;  1OV3 A;  2EQJ A;  4OB0 B;  5CKB A;  4DBQ A;  2D0N A;  4F7U B;  3JSC A;  1M9S A;  4N4H A;  1Q7Y C;  1VQ6 Q;  4LD9 K;  1AZG B;  2OAW A;  4M78 E;  2L3R A;  4HCZ A;  3EHQ A;  1W2B P;  4C0Z A;  4Y91 A;  2JJ9 A;  1OPL A;  4Z8A A;  2KSS A;  3OYG A;  3OBW A;  1ZBX A;  3RMS A;  1QVG S;  4IUV A;  1VQL T;  2LTO A;  5KYY B;  1N9S A;  2E10 A;  3HL8 A;  3MKD A;  3FEO A;  4X34 A;  3OS1 A;  4XAX B;  1OZ3 A;  1RAF B;  3JV3 A;  2RO0 A;  2EYZ A;  5GAN d;  2HQX A;  1U1T A;  1ZLM A;  5LJ3 j;  4A4K A;  4ZGD B;  2IIM A;  2DXC A;  4B6M A;  3OMG A;  4LUE A;  5KH6 A;  2EGA A;  4RKU E;  3CPW P;  1GCP A;  2WSE E;  3L2Q A;  5GAN 4;  2V8K A;  2YRC A;  2V26 A;  3QG1 A;  2DJQ A;  2PTK A;  4FT4 A;  3L2R A;  1KHC A;  2VWF A;  4C0G A;  5KYY A;  4M7A F;  3UT1 A;  2ROT A;  4RTT A;  1D0Z A;  1PKT A;  4AFS C;  4ZN3 A;  3EAE A;  1WHG A;  2AIR B;  2K2M A;  4CC2 A;  3VS0 A;  3H0I A;  2BZY A;  1X6G A;  5FU6 C;  2ZPH B;  1JXO A;  2O9S A;  3QXE B;  3RKY A;  5GMK i;  4R0K A;  5C0M A;  2CH4 A;  4IUT A;  2MF2 A;  3VS4 A;  1YCY A;  4KT0 E;  1E6H A;  4EMK C;  3OYE A;  4LDW A;  3V7C A;  1YHQ A;  1QVF S;  4TVR A;  4J7F A;  3GPL A;  2YRD A;  4BE2 A;  2CS7 A;  1HYO A;  3BDU A;  3NFC A;  3GIB A;  4EMH A;  1MMN A;  1A0N B;  3PT9 A;  2DKG A;  2I2L A;  5I11 A;  4F14 A;  1JJ2 S;  3EGD A;  3DKM A;  1B3Q A;  1WQ7 A;  4C5E A;  1H8K A;  2XID A;  4RTZ A;  2LMJ A;  1QCF A;  2QQB A;  1R8O B;  1TXQ A;  3SFM A;  3LGL A;  5LJ5 e;  1RAI B;  1UGR B;  4FYV B;  1YP5 A;  5GAN 2;  3BDL A;  3LWH A;  3EG1 A;  5DLO A;  1MHN A;  1TSF A;  3A8O B;  1FMW A;  1U5S A;  3OS5 A;  1JBM A;  2RF0 A;  1VQ7 A;  2EWN A;  1VQK T;  3H0F A;  2EBP A;  3EGD B;  4NL2 A;  5L23 A;  4RTX A;  2KXC A;  3S3O A;  1RL2 A;  3CCL A;  3JCM V;  3CMA Q;  3G7Z A;  2RK2 A;  1AEY A;  2O4X A;  2QK0 A;  1G3W A;  4PLL A;  2QEX T;  4ESR A;  1MUZ A;  3CQT A;  4F16 A;  5FRN A;  1UGP B;  1W1F A;  1YBY A;  2LQ8 A;  1PM3 A;  1WNL A;  3G6E T;  1ARK A;  2M0Y A;  4X9C A;  2XDB A;  2FPD A;  3JB9 J;  1Q7Y R;  9ATC B;  2MI6 A;  1VQN A;  1Q95 G;  2XIC A;  3MP8 A;  3JCM e;  2GNC A;  4LN2 A;  1PNJ A;  1ABQ A;  1YN8 A;  4M7D B;  2A3L A;  2RI3 A;  3LW5 E;  3FDR A;  5GAN 6;  2COZ A;  3EGX B;  1FWZ A;  1HSQ A;  3M59 A;  2DNU A;  2QTV A;  2FVU A;  3OA6 A;  2FPF A;  2E65 A;  5CKF A;  1R77 A;  1NBE B;  4FM4 B;  2BZX A;  3V8K A;  2RHX A;  4HCB A;  3VJP A;  3UA7 A;  3GOX A;  3QII A;  2DEQ A;  1Z9Q A;  4RCB A;  2HD0 A;  4PJO A;  2W10 A;  4M7D A;  2DX1 A;  1HXD A;  3HRT A;  1PHT A;  2EGE A;  2WAC A;  3M0P A;  1WXU A;  1K9M C;  1NEB A;  2EYX A;  3RER A;  3EG3 A;  4XU2 A;  1QWF A;  1H3H A;  1YI2 A;  1G5V A;  2C0I A;  2KGT A;  2RQU A;  1IXD A;  2DIG A;  2LNV A;  2WSF E;  1NPR A;  3CCE Q;  2X4J A;  3X28 B;  4J5Y A;  3A98 A;  1AT1 B;  4BE0 A;  1VYV A;  4M75 E;  2DO3 A;  1M4Z A;  2ROL A;  1YNZ A;  2HQE A;  2CRE A;  3H6Z A;  5I2M A;  1WJQ A;  4C8Q D;  1UUE A;  3HKS A;  1BU1 A;  4C0D B;  2HL5 C;  4DOV A;  1YIT Q;  2D8J A;  2V8I A;  2V1Q A;  4C8Q E;  4JRK A;  1MND A;  1WGS A;  1VQO T;  3CC2 T;  4PFO A;  1KQ1 A;  1TG0 A;  5GAN j;  1M1K U;  4D8D A;  4RUG A;  2I0N A;  2R5M A;  2AZS A;  2JW4 A;  3LGF A;  4BDY A;  3PIO A;  2E4H A;  3JCM J;  1BI1 A;  2HAX A;  1XJW B;  2AKL A;  4FYX B;  3G1J A;  3M55 A;  1BIB A;  2Y90 A;  2JT4 A;  5HCK A;  2ATC B;  2RQV A;  1K73 R;  4J9G A;  1ZQ1 A;  2DMO A;  5KYW A;  1G3T A;  4IUP A;  3M56 A;  4C92 F;  1CKA A;  2XI9 A;  1AHJ B;  3MCA B;  2FO0 A;  4FW1 A;  4C92 D;  1QW1 A;  1BI3 A;  2XU8 A;  1QQJ A;  4A63 B;  4RTV A;  3RBB B;  2EAY A;  2HSE B;  3CCR T;  1I5O B;  1D3B B;  4JJC A;  4C92 B;  2X4X A;  1I81 A;  2HKQ B;  3EG2 A;  4PJO G;  5IHK A;  4A4H A;  1MNE A;  4PJO E;  3A8L B;  3CCJ T;  1SSF A;  4C5I A;  3QKJ A;  3RR6 A;  1T0H A;  3RIR A;  3UF4 A;  1QKW A;  4J7I A;  2VUB A;  2DRM A;  4JLI A;  1VQL Q;  5CR2 A;  2QAS A;  2AZV A;  2JTF A;  2MWP A;  4J9C A;  2JS2 A;  3GNF B;  3M5A A;  2ZPG B;  2JM9 A;  2MPX C;  5A2Q E;  4M7A D;  4ELZ C;  3DLL A;  3GNG A;  3OSV A;  5LJ3 e;  3EFS A;  4M7A E;  2RN8 A;  2OJ2 A;  1NJI U;  3KFV A;  3SDZ A;  3VS3 A;  4BI4 A;  3C0C A;  1S72 T;  4NOY A;  1YIT T;  3CEY A;  1VQO A;  4C8Q A;  2CSQ A;  2KVQ G;  5CKH A;  2OTJ T;  2OTJ A;  1G83 A;  2A37 A;  2CH4 W;  2EYY A;  1SPK A;  4PJO B;  4Z02 A;  1G3S A;  2LX7 A;  2BE7 D;  3JCM g;  2ZPF B;  4LDY A;  2F2X A;  2XMF A;  1P92 A;  3OYY A;  4DOW A;  4N0A C;  3I56 A;  3VS6 A;  3HSB A;  1VQN T;  2RK1 A;  2LCL A;  1WQW A;  2K3B A;  1VQN Q;  5KCO A;  2CYZ B;  4BAC A;  5HK0 A;  4RTW A;  3ER0 A;  2F2V A;  1GFC A;  4C8Q G;  1YCS B;  3QYH B;  4C0F A;  4LD6 A;  2QAZ A;  4FSS A;  2CUB A;  1I1J A;  3CME Q;  3VKI A;  1K1Z A;  5CK9 A;  1RAG B;  3OMC A;  1B34 A;  2RNA A;  1VQ7 Q;  4HA8 A;  2LJ3 A;  1G3Y A;  1VQ4 A;  1TUG B;  3C4S A;  3M54 A;  5J39 A;  4QKU A;  3CME A;  3OYH A;  3CMA T;  3CCJ A;  2K5F A;  4FIB A;  2K2V A;  5GMK m;  1XOV A;  4L6V 5;  2QDL A;  1RLQ C;  2LQN A;  4CI0 C;  2QEX Q;  2XDP A;  5CKE A;  1UG1 A;  2AK5 A;  4PK4 A;  4E7S A;  3OYK A;  2VAS A;  1F1B B;  4XU1 A;  3CCS T;  3QO3 A;  1ZSZ A;  4B9X A;  1U8R A;  4PJM A;  2E1H A;  4OMQ A;  3CCV A;  1BB9 A;  3CCV T;  4O6J A;  1XNI A;  2X51 A;  3MHX A;  4KGZ B;  3CD6 T;  2CP5 A;  4C92 C;  5KYW B;  1Q86 C;  2CZ1 B;  3UDC A;  1X75 C;  3G71 Q;  2RMO A;  1ACM B;  1AWX A;  2QEX A;  2E70 A;  3HPW A;  3PMI A;  1FMK A;  4ATO A;  2R5A A;  4E2F B;  1TOV A;  4C0D C;  2X4Y A;  2EQM A;  2QI2 A;  5AT1 B;  3MET A;  2CZ6 B;  4KGX B;  1NJI R;  1KC8 R;  2FHD A;  1ABO A;  1RAH B;  2DXB A;  2LDM A;  2LZ6 B;  3QUI A;  2K6D A;  5LJ3 h;  4E7L A;  3QWY A;  4M77 G;  4LDV A;  3UPU A;  2RI5 A;  4HXJ A;  1XQH A;  3F70 A;  3VUB A;  2ZZD A;  4F7U A;  3MEA A;  2LRQ A;  1I5L A;  1VQ9 A;  5GAM f;  4J8O A;  4MDX A;  2FYK A;  1V1C A;  2ZPI B;  2DXU A;  3M0R A;  1V76 A;  1N8R U;  4HT9 A;  3CCQ A;  3RKX A;  1MMG A;  4X9D A;  5J3B A;  2NWM A;  4FU6 A;  3ZL7 C;  2JZ2 A;  1PRL C;  4P5N A;  1GCQ A;  1YJN Q;  5FU7 C;  1KC8 C;  3REB B;  2C0O A;  2NLU A;  5CVI A;  3CBP A;  1RLP C;  2DIQ A;  1JO8 A;  1WYX A;  4C5G A;  4KH1 B;  1W4S A;  3CCQ Q;  2HDA A;  3EH1 A;  1ZX6 A;  3MEV A;  4J83 A;  3PGG A;  1RI9 A;  2CP0 A;  1X2Q A;  2L5Q A;  2KXD A;  2DFU A;  3X20 B;  1OUL A;  2HMA A;  3I56 T;  1YJ9 T;  3QYG B;  4CC3 A;  1YJW Q;  2LT4 A;  5ECA A;  2VGM A;  3CCL Q;  4IIO A;  2RJC A;  3JB9 F;  2H3J A;  3CC2 A;  3ZBD A;  2E6N A;  1V29 B;  1X6B A;  2QA4 T;  2DA9 A;  4QVC A;  2DZC A;  3P8B B;  2QQS A;  3JB9 D;  8ATC B;  4XU3 A;  2LQK A;  1ZA1 B;  3WXM B;  3CBO A;  4WTO B;  4LE9 A;  3OS0 A;  1SKU B;  1VQO Q;  3CC2 Q;  3CCR A;  2J6K A;  2MIO A;  3EG9 B;  3OYM A;  3KXT A;  1QP3 A;  4JJD A;  5D7U A;  3A8H B;  1SG5 A;  2MMP A;  5GAO p;  1Q86 U;  4LDX A;  1GL5 A;  3VS1 A;  1QVF A;  3CD6 A;  1U06 A;  3NPF A;  4JDS A;  1YWO A;  2ZPE B;  5CKD A;  3CCS A;  3G71 T;  3HHT B;  3L42 A;  1QKX A;  1WXT A;  5C6S A;  1VUB A;  2P84 A;  1RUW A;  4MZM A;  4QW2 A;  1BKB A;  3VS5 A;  5GAM h;  3EFO A;  2QYZ A;  1IGQ A;  4HVU A;  4PFP A;  2NUT B;  2K3X A;  2P0Q A;  1WFW A;  1RAC B;  2O88 A;  2L8D A;  2DL5 A;  4KUI A;  1M8M A;  4XQ3 A;  3JCM Q;  3R6N A;  1D09 B;  1W2B A;  2DD5 A;  2YHT A;  5IHI A;  2GF7 A;  5DY9 A;  2GCX A;  4M77 B;  1PRM C;  1WXB A;  2KQW A;  5LJ3 d;  1YJ9 A;  4Y92 A;  1LPL A;  2KMT A;  1KG1 A;  4BB7 A;  2FEI A;  3TVT A;  3WVD B;  4RTU A;  2DL7 A;  3OYI A;  3V8J A;  3C94 A;  2GGR A;  4JLG A;  4NS5 A;  5LJ5 d;  4IUR A;  3PNW C;  2JN0 A;  1AVZ C;  1MV0 B;  2LCC A;  2RI2 A;  3QPH A;  4DEX A;  2VGN A;  1DJ7 B;  5CQY A;  1NG2 A;  2MCN A;  1QVG A;  3TSZ A;  4OML A;  2YUQ A;  3GLX A;  5GAN 8;  2JMC A;  1X27 A;  1B7T A;  2QDY B;  2J06 A;  3E2U A;  1M90 R;  1YHQ T;  2DVJ A;  3QJY A;  1Q82 U;  3S3N A;  4JRI A;  5GJW B;  3OW2 P;  1VQ9 Q;  1CSK A;  4J9F A;  1GBQ A;  1YWP A;  2ED0 A;  1IHV A;  4A54 A;  2PUK B;  1FYN A;  2PVG B;  1I07 A; 
#chains in the Genus database with same CATH homology
 3FJ5 A;  2C0T A;  2D8H A;  4GLM A;  4HCK A;  2KRN A;  2ECZ A;  2FO0 A;  5GJV B;  5I22 A;  1NLP C;  2PNI A;  2GTJ A;  4A63 B;  3EGU A;  1U3O A;  4RTV A;  3RBB B;  2KRO A;  1ZBJ A;  4JPB W;  1KFZ A;  4JJC A;  2CUD A;  2RPN A;  2L2P A;  2DL4 A;  3EG2 A;  2KBT A;  4AFU C;  1AZE A;  1IO6 A;  5IHK A;  1KSW A;  1M3C A;  1E6G A;  1KIK A;  1OOT A;  1UHC A;  2KNB B;  3VRY A;  1SHG A;  2KYM A;  3VS7 A;  1K9A A;  3IQL A;  4LNP A;  1T0H A;  4CC4 B;  4LUD A;  2VVK A;  3PE0 A;  3UF4 A;  1QKW A;  2DRK A;  3SHW A;  2DRM A;  1WI7 A;  3UA6 A;  2B86 A;  2AZV A;  1WDX A;  4WCI A;  1AD5 A;  1AWO A;  2NUZ A;  4J9C A;  2JS2 A;  1HD3 A;  1GRI A;  2KE9 A;  2JM9 A;  2JTE A;  2DYB A;  2EYW A;  2DL3 A;  3NGP A;  2LCS A;  3VS2 A;  4ZNX A;  2DL8 A;  1M27 C;  3THK A;  2RQT A;  1AWJ A;  2RN8 A;  3O5Z A;  2LP5 A;  2OJ2 A;  1WA7 A;  3KFV A;  1S1N A;  2J05 A;  3NMZ C;  3VS3 A;  1PWT A;  3C0C A;  1QWE A;  3M0Q A;  2CDT A;  1NYF A;  1UDL A;  2CT3 A;  2YT6 A;  2ENM A;  5FW9 A;  1AOJ A;  4X1V A;  2J6O A;  2F2W A;  1SEM A;  2YSQ A;  3I5R A;  4K11 A;  2CSQ A;  4Z89 A;  1SHF A;  1G83 A;  1AWW A;  2A37 A;  2CH4 W;  3M0S A;  2EYY A;  1SPK A;  1ZSG A;  4KRT A;  2DBM A;  2P4R A;  3QWX X;  2LX7 A;  1N5Z A;  2F2X A;  2XMF A;  3PVQ A;  1W6X A;  3VS6 A;  2HEQ A;  2G6F X;  2K3B A;  2KT8 A;  5IHN A;  3I35 A;  2DE0 X;  1UJ0 A;  4ORZ A;  1UE9 A;  4OMN A;  4RTW A;  1NYG A;  2F2V A;  4J9E A;  2KRS A;  1UFF A;  2ABL A;  1GFC A;  3ULR B;  1OV3 A;  1NEG A;  1YCS B;  1ZUK A;  1TUC A;  4FSS A;  2CUB A;  1I1J A;  1K1Z A;  2D0N A;  1X69 A;  1UEC A;  2RNA A;  2W0Z A;  2OAW A;  1AZG B;  1K4U S;  1W70 A;  2LJ3 A;  3EHQ A;  1WIE A;  2PZ1 A;  1Z9Z A;  1WLP B;  4Z8A A;  1OPL A;  2K9G A;  1BK2 A;  4OMO A;  1UJY A;  1X2K A;  1M3A A;  3JV3 A;  2K79 A;  1XOV A;  2EYZ A;  1ZLM A;  2L3Q A;  2IIM A;  4J9H A;  2QDL A;  4LUE A;  1PKS A;  2EGA A;  2JM8 A;  1RLQ C;  1GCP A;  2OI3 A;  2LQN A;  2KR3 A;  4M4Z A;  1J3T A;  2JS0 A;  2CT4 A;  1UG1 A;  2AK5 A;  2HCK A;  2LJ0 A;  2DJQ A;  2PTK A;  4JZ4 A;  1ZUY A;  2VWF A;  2KEA A;  4HVW A;  4OMQ A;  1BB9 A;  5IH2 A;  2ROT A;  4RTT A;  1PKT A;  4IIM A;  4AFS C;  2K2M A;  2KYB A;  4CC2 A;  3VS0 A;  3H0I A;  2BZY A;  3UAT A;  1X6G A;  2RMO A;  2O9S A;  1JXO A;  1AWX A;  2YUO A;  4R0K A;  2LJ1 A;  2CH4 A;  1FMK A;  3VS4 A;  1I0C A;  1E6H A;  1VYT A;  2DM1 A;  2JXB A;  2VKN A;  2EKH A;  3GBQ A;  2GTO A;  1Y0M A;  4QT7 A;  3LH5 A;  3PVL A;  1ABO A;  2KRM A;  2LZ6 B;  2K6D A;  3QWY A;  4J9B A;  1NM7 A;  4HXJ A;  1A0N B;  5EC7 A;  4JJB A;  5I11 A;  4F14 A;  1B3Q A;  2BZ8 A;  1V1C A;  1H8K A;  2J6F A;  4RTZ A;  2DIL A;  2LMJ A;  3I9Q A;  3M0R A;  1QCF A;  2L3P A;  3RNJ A;  1M30 A;  1WX6 A;  1CKB A;  2NWM A;  3ZL7 C;  2YUP A;  1PRL C;  2YUN A;  1B07 A;  1YP5 A;  1GCQ A;  2LNH B;  4CC7 A;  3EG1 A;  3REB B;  1UGV A;  2C0O A;  1QLY A;  1U5S A;  4AG1 C;  1RLP C;  1MV3 A;  1JEG A;  2RF0 A;  1JQQ A;  1JO8 A;  1WYX A;  3H0F A;  2EBP A;  3M0U A;  4D8K A;  2HDA A;  4RTX A;  5L23 A;  2KXC A;  1ZX6 A;  2GQI A;  1RI9 A;  1X2Q A;  1T0J A;  3H41 A;  2KXD A;  2J7I A;  1AEY A;  4CC3 A;  5IXB A;  5ECA A;  1SSH A;  4ESR A;  4IIO A;  1MUZ A;  3CQT A;  4F16 A;  2X3X D;  1W1F A;  1M3B A;  1LCK A;  2SRC A;  1BBZ A;  1GCQ C;  1X6B A;  2M0Y A;  4OMM A;  1ARK A;  1KJW A;  2DA9 A;  2FPD A;  1JU5 C;  1X43 A;  4HVV A;  4AG2 C;  5FWC A;  3VRZ A;  2GNC A;  2V1R A;  4LN2 A;  1K0X A;  4LE9 A;  3TSW A;  1SRM A;  3M0T A;  1PNJ A;  1ABQ A;  2K7A A;  1YN8 A;  4F17 A;  2A08 A;  2J6K A;  1HSQ A;  1GBR A;  2MIO A;  4AFQ C;  2DNU A;  3I5S A;  3EG0 A;  2FPF A;  4JJD A;  2BZX A;  1VYU A;  2SEM A;  1GL5 A;  3VS1 A;  3UA7 A;  4J9I A;  1OEB A;  2L3S A;  1U06 A;  3NPF A;  2FPE A;  1YWO A;  4RTY A;  1Z9Q A;  2ED1 A;  2GBQ A;  2W10 A;  1T3L A;  2DX1 A;  1QKX A;  1WXT A;  1PHT A;  2EGE A;  2HSP A;  3M0P A;  1WXU A;  3NHN A;  1RUW A;  2FG0 A;  2L0A A;  4EIK A;  1NEB A;  2EYX A;  3VS5 A;  3EG3 A;  3U23 A;  1T3S A;  1QWF A;  2A36 A;  1H3H A;  2C0I A;  2EGC A;  2KGT A;  2RQU A;  4HVU A;  1NLO C;  1SRL A;  2RQR A;  1K0S A;  1WFW A;  4J9D A;  4DEY A;  2EW3 A;  1H92 A;  2O88 A;  2O9V A;  2DL5 A;  1K76 A;  2O31 A;  1M8M A;  1TUD A;  3A98 A;  1VYV A;  2MOX A;  3R6N A;  2ROL A;  1YNZ A;  2EPD A;  2LQW A;  5IHI A;  2CRE A;  1PRM C;  1WXB A;  4Y92 A;  1UUE A;  3EHR A;  2KT1 A;  1BU1 A;  4JZ3 A;  2FEI A;  2D8J A;  1GFD A;  3TVT A;  1JXM A;  1G2B A;  2V1Q A;  4RTU A;  2DL7 A;  3H0H A;  2GGR A;  4GBQ A;  2EQI A;  5IXF A;  1E7O A;  1AVZ C;  1MV0 B;  1TG0 A;  2BTT A;  4RUG A;  4D8D A;  2FRY A;  2I0N A;  4DEX A;  2X3W D;  1ZUU A;  2D1X A;  2AZS A;  2JW4 A;  2M51 A;  4AFZ C;  1UHF A;  3REA B;  2DF6 A;  1NG2 A;  2MCN A;  2CSI A;  2O2O A;  2HBW A;  2ESW A;  2FRW A;  3TSZ A;  4OML A;  1VA7 A;  2YUQ A;  2AKK A;  2DLP A;  1EFN A;  2JMC A;  1X27 A;  4Z88 A;  2YDL A;  2AKL A;  2J06 A;  4E6R A;  1Y57 A;  4OMP A;  2A28 A;  2RQW A;  2JT4 A;  2H8H A;  5HCK A;  2DVJ A;  1UTI A;  5FWB A;  2RQV A;  2DBK A;  4J9G A;  2DMO A;  5GJW B;  1CSK A;  4J9F A;  1GBQ A;  1HJD A;  1YWP A;  2ED0 A;  1OPK A;  2JMA A;  1FYN A;  1I07 A;  2EVR A;  2E5K A;  3SEM A;  1CKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...