2PNIA

Solution structure and ligand-binding site of the sh3 domain of the p85alpha subunit of phosphatidylinositol 3-kinase
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
86
structure length
86
Chain Sequence
GSMSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEAKPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL 3-KINASE P85-ALPHA SUBUNIT SH3 DOMAIN
publication title Solution structure and ligand-binding site of the SH3 domain of the p85 alpha subunit of phosphatidylinositol 3-kinase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Phosphotransferase
total genus 7
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1993-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2pniA00
1OPKA 4ORZA 4JJCA 1PKSA 4D8DA 1VYVA 2ECZA 3A98A 2EYYA 1M30A 5IHIA 5I11A 2M51A 2B86A 1M3BA 4OMLA 1X69A 4RTUA 2L3PA 2HSPA 4CC2A 2O88A 3THKA 2ED0A 2YUPA 2RNAA 2CSIA 1SHGA 2KXDA 3IQLA 4HVWA 3M0PA 4RTTA 2L3SA 2CUBA 2ED1A 3EG2A 1MUZA 1E7OA 1CKAA 1W6XA 2KR3A 4AFZC 2HDAA 2D8HA 2RPNA 2EGAA 3EHQA 3RBBB 1YCSB 3FJ5A 1JXMA 2ABLA 1GCPA 2DVJA 2P4RA 1M8MA 1SPKA 1PWTA 3UA6A 1VYTA 2MOXA 2KRNA 2BZXA 1V1CA 2PZ1A 1K76A 1PRMC 1H3HA 3REBB 4OMNA 2NUZA 2OI3A 2ROLA 4RTWA 4J9IA 1PNJA 2EQIA 1S1NA 5ECAA 2RF0A 1RLQC 1GBRA 2YUNA 2JT4A 2HCKA 2W10A 1GL5A 1TUDA 2FG0A 4HVVA 1M27C 5FWCA 4J9EA 4Z8AA 4JZ4A 1FMKA 2DYBA 1AVZC 2L2PA 1J3TA 3PVLA 2YT6A 4RTVA 1BB9A 1ZX6A 2JW4A 3RNJA 2DRMA 3I9QA 3UA7A 2D0NA 1XOVA 2VKNA 2DA9A 2J6KA 2KEAA 3M0RA 1QCFA 3GBQA 3H0FA 3EG3A 1WXUA 1KSWA 2IIMA 1NEBA 4IIOA 1UHCA 2M0YA 3H0HA 2JTEA 1ZBJA 3I5RA 4D8KA 4HCKA 4R0KA 2NWMA 4DEYA 4J9CA 2DL4A 1UUEA 2LX7A 2GGRA 2A08A 2AK5A 2GTOA 2OAWA 1AEYA 1KFZA 1HSQA 1TUCA 2LQWA 2F2WA 1AZGB 1JU5C 1UHFA 4X1VA 1NYGA 1X43A 3EGUA 1K0XA 5L23A 1TG0A 2JS2A 4Z88A 2DM1A 1QKWA 3KFVA 3REAB 2EGCA 1SRMA 2J6FA 2MCNA 2KBTA 1ABOA 2LMJA 1GFDA 1NEGA 2JXBA 2L0AA 2KT8A 2SEMA 4LNPA 4LUDA 1K1ZA 3TSWA 2FPFA 1PHTA 5I22A 2O31A 2J06A 2VVKA 2ESWA 2KE9A 1LCKA 1UE9A 4KRTA 1W1FA 2K2MA 2BZ8A 2C0OA 1PRLC 1PKTA 4GLMA 2DNUA 2DE0X 2RQVA 3M0SA 4CC3A 4LUEA 1AWJA 4RTXA 5GJVB 1X6GA 1YNZA 3EHRA 1G83A 2DL3A 4ZNXA 4J9FA 2JS0A 2GNCA 2ENMA 1KJWA 4Y92A 1UGVA 1SRLA 1UTIA 4J9DA 1YP5A 3C0CA 1QWFA 1NG2A 3UF4A 2O9VA 2DX1A 3QWYA 4DEXA 5EC7A 3TSZA 2E5KA 1E6GA 2KYMA 4Z89A 1T0JA 1M3AA 1RLPC 2KYBA 3I35A 2CH4W 4JJBA 2CSQA 1YN8A 4JZ3A 1WI7A 1ZUYA 1VYUA 2X3XD 3NHNA 4OMPA 4CC7A 4CC4B 3EG0A 1NLOC 1M3CA 3JV3A 1ZUKA 1JQQA 3SHWA 2JMAA 2FEIA 2DL8A 1FYNA 2AKLA 1EFNA 2RQTA 2DF6A 2YUOA 2LJ1A 2OJ2A 3QWXX 1HJDA 3U23A 4RTYA 1W70A 2JM8A 4HVUA 2D8JA 2YSQA 4JPBW 2MIOA 1K0SA 1NYFA 2O2OA 1HD3A 2W0ZA 5IHKA 2EBPA 1BU1A 1KIKA 1AOJA 2CDTA 2RMOA 1WA7A 3NPFA 2C0IA 5IXFA 1SHFA 1B3QA 4OMQA 3ZL7C 4OMOA 2CT4A 1OEBA 2FPEA 4AFUC 2FPDA 1X2KA 3VRZA 2K3BA 2YDLA 2CT3A 2LJ0A 2LQNA 2PTKA 3NGPA 1Y57A 5IHNA 1ZUUA 2CREA 1UG1A 1QKXA 2JMCA 3NMZC 4LE9A 4AG2C 2SRCA 1E6HA 2DL5A 1JXOA 3VS0A 2XMFA 2GQIA 1UJ0A 2DBMA 1A0NB 4RTZA 1ZSGA 1BBZA 1T0HA 1UJYA 5FWBA 2ROTA 2AZVA 3H0IA 1G2BA 3UATA 4LN2A 1AD5A 1YWOA 2I0NA 3R6NA 2D1XA 1ARKA 2DLPA 4F16A 1B07A 2EVRA 2GTJA 3VS3A 1AWXA 2DRKA 3EG1A 4M4ZA 2RN8A 5HCKA 2DJQA 1GRIA 3PE0A 1H8KA 2J6OA 2BTTA 2K7AA 4RUGA 2DL7A 3M0TA 2X3WD 2DILA 2O9SA 3SEMA 4K11A 1I0CA 1N5ZA 2J7IA 1UFFA 1AWWA 2LJ3A 1WXTA 2FRWA 2RQWA 1GCQA 3VS2A 1NLPC 1MV3A 2DMOA 3CQTA 1VA7A 1GCQC 2EYXA 3M0UA 4QT7A 2KGTA 2HEQA 4AFQC 4IIMA 1RI9A 1U06A 2AKKA 2RQUA 4F17A 4F14A 1U3OA 1K9AA 1UDLA 2VWFA 1UECA 4AFSC 1QWEA 1WFWA 3VS7A 4A63B 2EYWA 1RUWA 1WDXA 4E6RA 2EYZA 1GBQA 1H92A 2H8HA 4GBQA 3ULRB 1CKBA 4J9BA 2A36A 1Y0MA 2FRYA 2V1QA 1MV0B 4WCIA 2KNBB 5FW9A 2CUDA 1JEGA 3VS1A 3VRYA 5GJWB 4J9HA 1JO8A 1SSHA 4JJDA 2RQRA 1NM7A 2F2VA 5IXBA 2AZSA 1OOTA 2A37A 2KRSA 2LNHB 1IO6A 3VS4A 1WX6A 2LCSA 1BK2A 2LP5A 2K79A 1YWPA 1I07A 1AZEA 1T3LA 4AG1C 2QDLA 2JM9A 1T3SA 1GFCA 2GBQA 1Z9ZA 2KROA 1OPLA 1CSKA 3I5SA 1WLPB 2PNIA 2J05A 2KRMA 1K4US 1ZLMA 2EW3A 1X2QA 2CH4A 2K9GA 2KXCA 3O5ZA 2YUQA 2HBWA 2EPDA 4OMMA 2F2XA 1WIEA 1AWOA 1WYXA 2C0TA 1X27A 4FSSA 2DBKA 5IH2A 4EIKA 2LZ6B 2L3QA 2EGEA 2BZYA 3M0QA 1U5SA 1Z9QA 2V1RA 3TVTA 4ESRA 3VS5A 2EKHA 2A28A 1ABQA 2FO0A 3H41A 4HXJA 3LH5A 1OV3A 1I1JA 2K6DA 1X6BA 1QLYA 3VS6A 2G6FX 2KT1A 1SEMA 1WXBA 3PVQA 4J9GA
chains in the Genus database with same CATH superfamily
1N9SA 4HT8A 1NPPA 4JJCA 2FZKB 2RK2A 3QIIA 4M7AA 2ECZA 1M30A 3ER0A 3G71Q 3MEUA 1SF9A 4RTUA 2P84A 1M1KR 2CS7A 1VQKA 3EFSA 2ED0A 1Q95G 4P5NA 2RNAA 4HVWA 1WQ7A 3CCEQ 2RH2A 2L3SA 4L6V5 4RCBA 1U1TA 2VASA 1NJIU 1MUZA 3S3OA 3SB2A 3EHQA 2YRVA 3FJ5A 1KG1A 1JXMA 3OYNA 2ABLA 4C5EA 2DVJA 1M8MA 3UA6A 5A0GA 4E7IA 4M77C 2E6NA 3NFCA 2LCLA 2MOXA 1M90C 2PZ1A 1V1CA 2Z0WA 2KQWA 1H3HA 1G3TA 2PQWA 3I56A 3OS2A 1QCOA 4N0AA 2MMPA 4Y28E 3OYEA 3MPUB 2W10A 4FU6A 4OB1B 1WHHA 3M58A 1GL5A 1FMWA 5AT1B 5FWCA 4RCCA 3JB9I 5GAN2 4Z8AA 4JZ4A 1FMKA 2NUTA 1AVZC 3HTRA 4RTVA 1UGQB 2JW4A 1XQHA 5LJ3e 2DRMA 3MP1A 2DO3A 1WQWA 2D0NA 2DA9A 2KEAA 4UC4A 3EG3A 1KSWA 1D1CA 2F1LA 5I21A 2IIMA 3F70A 3H0HA 4D8KA 2RJFA 2NWMA 2LVMA 5HY6A 5GAMd 4B9WA 5GANj 1UUEA 2LX7A 3JB9J 3G4ST 3P8BB 4M7AG 4M75G 1KFZA 1VQLA 2F2WA 1WHLA 3M55A 3P8HA 3JB9F 1KHCA 1K0XA 3OY9A 1VQNA 2BIVA 5KYXA 1TG0A 1S72A 1LNXA 4KULA 2ZPEB 2LC4A 2EFIA 2VXFA 1GFDA 2L0AA 2SEMA 2DD5A 1Q86C 5FLXE 2FPFA 1PHTA 3QO3A 2O31A 2E64A 2KE9A 3MJXA 2XIDA 1KHIA 1M9SA 2C0OA 2LTOA 3OQ5A 2E3IA 1VQ6Q 2DNUA 2QDYB 3OA6A 1HK9A 1RACB 2RQVA 2OTLQ 3H8ZA 1YJWT 1AWJA 5J26A 3Q1JA 4C92E 2QXFA 1G83A 1VOMA 2JS0A 2GNCA 2EQKA 4OMFB 3M4GA 4J9DA 1UTIA 1N8RU 4BACA 2YHTA 5GAN7 2ZPHB 3KUFA 1BIBA 1YITQ 1F1BB 3V7CA 4OGEA 4PJOA 3RR6A 1YN8A 3NHNA 4C92B 9ATCB 2PU9B 3SHWA 2DL8A 2HD0A 2AKLA 3JCMf 3RDVA 1VQMQ 2YUOA 3LYIA 2OJ2A 3QWXX 1HJDA 3U23A 3X24B 1YHQQ 1RADB 3C94A 2X9HA 1JJ2P 3P8DA 1VQPA 2HQEA 3G6EA 2O2OA 5IHKA 2EBPA 1BU1A 1KIKA 3PMIA 1W2BA 1SSFA 3CCJQ 3ZL7C 1B3QA 4OMQA 4M78A 1R77A 2E6ZA 4RKUE 1H641 2QA4Q 2FPEA 3LWIA 3BDUA 4AFUC 2EWNA 2CT3A 4E7HA 1D1AA 3QZ5B 2BE9B 4C0DB 1JXOA 2QASA 4EMHA 3LLRA 1QVFP 4FIBA 4F7UA 2E65A 1YCYA 4FCYA 1VIEA 4XTVA 1VQ5Q 1QW1A 2DLPA 3JB9D 2GTJA 3HRSA 5FU7C 3JRZA 2DRKA 1OI1A 2DXTA 1PCXA 4M7DG 4M4ZA 1TH7A 2R58A 3JCMJ 1IXDA 3CMAT 3PE0A 1H8KA 5GAOr 1WZOA 4PJOG 3DLLA 3FEOA 1ZHIA 4HA8A 2J7IA 2RJCA 3VU3C 3VS2A 3CBPA 1MV3A 1EZZB 2DMOA 1Y71A 1X01A 1VA7A 3JCMQ 4MMKA 2E4HA 3M0UA 4QT7A 3G71A 2EJFA 2LX9A 1ZQ1A 1H3ZA 2AKKA 2ZGWA 4FSXA 4F14A 1IHWA 2VWFA 4XTXA 4XTYA 2DAQA 3CCEA 2QAZA 4M78G 4QKUA 4KT0E 3C12A 1GBQA 1VQ9Q 1VQ8Q 1UGPB 3ULRB 4HT9A 3QDRB 4E7KA 2IVWA 5LJ5d 3JCMP 4FW2A 1FX7A 1D09B 5GMKj 4E7JA 4LD9K 1Q82U 1TTHB 3CCLT 2X51A 3JCMe 1OOTA 2DEUA 7AT1B 4F04B 3VS4A 1JJ2S 2VB6A 3ASKA 3NTIA 2LP5A 3QSUA 2K4YA 4F7UG 3LGFA 1AZEA 2QDLA 3QG1A 2JM9A 1T3SA 3HP9A 4PJJA 1CSKA 1WLPB 2KRMA 1ZLMA 2COZA 2EW3A 3V7SA 2K9GA 1VQ7Q 1AWOA 1X27A 4EIKA 1MMNA 1U5SA 3BY7A 3OYKA 2HQXA 3X25B 4A4FA 1KD1C 4MZPA 3JCMV 1QVFS 4ME7A 3N5BB 2A28A 2OTJQ 3CCRQ 1ABQA 2FO0A 2GCXA 5GANf 3BE3A 1K8AR 3PIOA 3OYAA 2RD1A 3VS6A 2G6FX 4C0FA 4CRIA 4LD6A 4M77F 2WSEE 4ORZA 1NPRA 2XDDA 4AMCA 1PKSA 3CCVQ 3A98A 2EYYA 4PKCC 5FRMA 3ZBDA 1G3SA 4M7DF 5IHIA 1Q81R 2M51A 2B86A 1M3BA 2KAFA 3MEAA 4M75C 4M7AC 4OMLA 3LGLA 5CR2A 1EIFA 4J5YA 1XNIA 1K9MR 3QPHA 3THKA 2DZCA 3CEYA 1VQKT 3HKSA 1P92A 5CKDA 4RTTA 1E7OA 2KR3A 2VYTA 2RPNA 2EGAA 4Z02A 1YCSB 2OTLA 2K5IA 1PSFA 1PWTA 4A53A 4C92A 3CPWP 1KQ1A 1G3WA 1JB0E 2KRNA 4ATOA 1PRMC 4X9DA 4M77B 3CCSQ 4J9IA 3OYGA 5ECAA 5I2MA 3I56T 1BI3A 4DA4A 2HCKA 2COWA 1WJQA 2HMAA 2YRCA 1TUDA 1YJNQ 2FG0A 2ZCFB 5GAOp 2YRDA 4N0AC 1M1KC 4LDVA 4J9EA 2AIRB 2DFUA 4E2FB 2DVEA 4EMGA 2R5MA 1YITA 1RAGB 2L2PA 5GAN5 1JJ2A 1RAHB 3X26B 3I9QA 2FL7A 2KI7A 1Y96B 2J6KA 3JCMh 5KYWB 3GBQA 3OYHA 5GAMe 1NEBA 4IIOA 3OB9A 1UHCA 3CCMQ 1VQMA 2M0YA 2JTEA 1IREB 2MWPA 3I5RA 1YHQA 1NZ9A 4E7LA 3S6WA 2QEXQ 3QHSA 4J9CA 2JTFA 5CQYA 1Q7YR 4FT2A 2AK5A 2GTOA 3EG9B 1HSQA 2RHZA 1TWBA 2XG8D 3CC7Q 1UHFA 3CCJA 1X43A 1VQLT 1QVFA 1KC8R 3CCUQ 4JLIA 2DXUA 2LRQA 4N4GA 1VQNT 4BY6C 1S72T 2MCNA 2KBTA 3EGXB 5FROA 1I5OB 2LMJA 2KY9A 3HRTA 3FIFA 1TU0B 2ZPBB 4E7SA 4C8QE 4EPCA 5GANe 1K1ZA 3PTAA 3TSWA 5HK0A 3EGDB 3HHTB 2QQ9A 3AHUA 1ZSZC 2J06A 2X4XA 2ESWA 4C92G 1LCKA 4KRTA 2YWWA 2BZ8A 1ACMB 1PKTA 5L8RE 5A2QE 1VQ5A 1D3BB 4EDUA 2CYZB 4RTXA 1R8OB 2CKKA 3CMEQ 1K73C 4M77D 1X6GA 3NTKA 2ZPFB 3TU4K 4RG2A 2ZPIB 2JNGA 2VC8A 1UGSB 4J6WA 1YI2Q 4A4GA 4C8QB 1KJWA 4KUIA 1Q7YU 1PG5B 1HXDA 1UGVA 2HQHA 1YP5A 4ZN1A 5GAOl 3OYJA 2CP6A 1RAAB 5LJ5f 5EC7A 1E6GA 3G7ZA 4IUTA 1KC8U 3SWNA 3A8HB 3CPWS 5GAMj 2M1HA 3RKXA 3WVEB 4M7DC 3M59A 1KQ2A 2L8DA 3CC2Q 4JJBA 2CSQA 2CZ6B 5IT9E 2KMTA 1BI2A 4R56A 4CC7A 2LQKA 2OX7A 3JV3A 1ZUKA 4PJOC 2K5LA 2HBPA 2QYZA 3HPWA 1ZBXA 4BUGA 5CAIA 1IGQA 2CP5A 4LDWA 2M0OA 5A0DA 2QGGA 4RTYA 2QI2A 1W70A 2X4JA 2QTXA 2MIOA 4IUPA 1K0SA 3L42A 2LT1A 2JJ9A 1R0BG 1VQ8A 3JSCA 5D6XA 1VQPT 1W2BS 4Y91A 2CDTA 2RMOA 3G6ET 3SFMA 3NPFA 1YJ9T 3L2WA 5IXFA 4NOYA 5KYYA 2CT4A 1BI1A 1OEBA 3VRZA 1PM3A 4M78C 1JRIA 4L5GA 1N8RR 2PTKA 1QQJA 3J7AF 5IHNA 2V8KA 1ZUUA 3VJPA 2QQBA 3A8GB 3NMZC 4LE9A 4HCCA 3OYDA 2XMFA 1UJ0A 2DBMA 1A0NB 4RTZA 4HKEA 5FWBA 3EAEA 1YFNA 4J6XA 1G2BA 3UATA 1TXQA 2I0NA 1X6OA 4ELYC 1VQ7A 2DD4A 2RK1A 1ARKA 4KH0B 3UPUA 3LH0A 4F16A 4C8QD 3VYGA 5D6YA 3DLMA 4J7IA 4JDSA 1YIJQ 3FDRA 5GANh 2RN8A 5FU7B 5HCKA 4ZN3A 1M90R 2OTJA 3CCRA 3S3NA 5GANg 1QVGP 3WXMB 1R0CB 3OS5A 3M0TA 3GNFB 3O8VA 1UEBA 3SEMA 1OYXA 2MAMA 5LL6S 2RHIA 4OVAA 3PFSA 2RQWA 3CC4Q 2L89A 4X34A 2Y90A 4BE1A 4V2SA 2JTMA 4PLIA 1FXXA 3EFOB 3V8JA 5GAOn 2COYA 3CPWA 2V26A 3R6OA 3G71T 1HYOA 1OQKA 5GAOq 2RQUA 5D7UA 3PIPA 2EJ9A 5KYUA 5LJ5e 2E1HA 3H6ZA 2EYWA 1QVPA 4E6RA 3CCET 5HK3A 3OMCA 2LNVA 4GBQA 3VV0A 1Y0MA 1VQOQ 1VUBA 1MV0B 4WCIA 5FW9A 3VS1A 3MKDA 2QQSA 1RI0A 1Y96A 1M90U 2RQRA 2MYSA 2AZSA 2XK0A 1I8FA 2A37A 1YJ9A 5LJ3h 3CCSA 1VQ4Q 3EFRA 1WX6A 3EH2A 4FM4B 2M02A 4MDXA 1BK2A 1OZ3A 5LJ3g 2DIQA 1YJNA 4BI3A 1KQSP 4AG1C 3CD6Q 3VYHB 1GFCA 1Q86R 1Z9ZA 1OPLA 3I5SA 3EG9A 4DOWA 4JS4A 2PNIA 5GMKe 3QJYA 3HL8A 1O75A 1K4US 2LCCA 2CH4A 3RKYA 2OAUA 1TUGB 2EQJA 4OMMA 3VUZA 1WYXA 2K3YA 2C0TA 3E19A 5IH2A 4M7AF 4M75F 3OW2P 2LZ6B 2EGEA 2BZYA 2DIGA 5CQXA 2XU8A 5FU6C 3EGXA 2GQVA 3CCMA 1Z9QA 2XDPA 3HRUA 8ATCB 3VS5A 2EKHA 4HCZA 5KE3A 2QEXA 3I55Q 4LDXA 1WPYA 3M53A 4M75E 4MZTA 1Q82R 2Y4YA 2GFAA 2KT1A 4JRKA 3TEEA 3CC7A 2EYQA 4J9GA 3CCUA 1YBYA 1OPKA 2E5QA 3MHXA 1D1BA 4OB0B 3JCMW 5LJ5j 1WHMA 3DKMA 4ZGEB 3OSVA 1FMVA 5I11A 1QVGS 4OB3B 1M8VA 2JUFA 4II1A 4C8QA 4OP0A 5GMKi 2HSPA 2MK5A 4DOVA 1Q86U 4JRQA 1O9SA 3CBOA 2VGMA 4PJMA 1SHGA 4M75B 3IQLA 2YLCA 3M0PA 2ZZDA 2CUBA 2ED1A 1UGRB 3EG2A 1W6XA 1BCMA 4AFZC 2HDAA 3DB3A 1K8AC 4ZGJB 4XTUA 3OBWA 2P4RA 1IGUA 4RMOA 1VQ6T 2DEQA 2E12A 2F5KA 3CMEA 1VYTA 2OTLT 1ZA2B 1RAIB 2JZ2A 3BDLA 1WGSA 1EX4A 3M4YA 3CXCP 2BZXA 1K76A 1PSEA 2JOYA 3REBB 3CCQQ 4C92C 4OMNA 2NUZA 2ROLA 3QJ6A 1IHVA 1MMAA 1S1NA 2RF0A 3C95A 4E7ZA 2JT4A 1Q81C 4HVVA 2X35A 1K9MC 3MEWA 3E9FA 5GAMf 2LDMA 4NL2A 1IB8A 3CC2A 1BIAA 1J3TA 2H3JA 3PVLA 5J3BA 1YITT 1ZX6A 3UA7A 1N6AA 3FRNA 4LDYA 1XOVA 2PVOB 5HKCA 2F5TX 4D6WA 1X75C 5DY9A 5KE2A 3MP8A 4FYXB 1WXUA 2K3XA 4XTWA 3S3MA 2NUTB 4MZMA 1ZBJA 1VQMT 1YHQT 4PK4A 1M4ZA 4HCBA 2GGRA 2A08A 2A0FB 2OAWA 1TUCA 2LQWA 1PC0A 1JU5C 3M5AA 4DQ2A 4X1VA 2KVQG 2WSFE 2IG0A 3CCJT 4Z88A 3OMGA 3KFVA 1QKWA 3REAB 2EGCA 1SRMA 2QA4T 4DBHA 2J6FA 4EMKC 3PT9A 1ABOA 2RB6A 4M7AD 4M75D 5CO7A 1NEGA 3RMSA 1M1GA 4Q5WA 4BY6B 2KT8A 2XKOC 1LPLA 4LUDA 2QGFB 4X9CA 5KYXB 2HKNA 4PJLA 3X28B 5I22A 3CBMA 2CP2A 1NJIC 4CI0C 3FLGA 3JCMc 1QVGA 4FT4A 2MI6A 1AHJB 1TS9A 1PRLC 5CKBA 4GLMA 5KYNA 4M77E 1ZSZB 2DXCA 2DE0X 4PJOF 1N27A 4CC3A 4LUEA 1VQ5T 5GJVB 2WACA 2EAYA 1B34B 3EHRA 5GAN8 3OYFA 2DL3A 4ZNXA 4FYVB 1BKBA 1KC8C 4M7DE 2VUBA 3QKJA 2RA2A 2XDBA 1VQ6A 3QXEB 2ENMA 3M9QA 1PD1A 1SRLA 4ZGDB 3C0CA 1QWFA 2HNIA 3TSZA 2KYMA 2RJEA 2EKOA 1JBMA 3QDFA 2FVUA 2QK0A 4QQGA 3CXCS 3I35A 4VUBA 2CH4W 3LWHA 4FYYB 3L2RA 3CC4A 3SWNC 1WI7A 1ZUYA 1VYUA 4OMPA 4M78F 4CC4B 3EG0A 1NLOC 2DYIA 1U1SA 4FW1A 3GOXA 4M7DB 1G3YA 3ZEHA 2ZPGB 2JMAA 4AT1B 2FEIA 2XD0A 1FYNA 4IURA 1EFNA 2RQTA 2DF6A 3HSBA 5D6WA 3WVDB 2HL5C 3E9GA 4PJOB 3GNGA 1WHGA 3MEVA 1KK7A 4JPBW 3G4SQ 4C0ZA 2WSCE 3A8OB 5CK9A 2W0ZA 1HD3A 3A8MB 3JCMg 1VQ9T 1VQ8T 1KQSA 4JLGA 1AOJA 1VQOA 4F7UF 4XU2A 3VUBA 3JCMb 4OMOA 1N9RA 4MDWA 4IUVA 4XAXB 1X2KA 2K3BA 2YDLA 2YLBA 2LJ0A 4O5VA 1VQ4A 4JRIA 2PVDB 3FJPA 3E2UA 4BDYA 4M78B 4AG2C 3JB9G 2SRCA 2A3LA 2DL5A 2QA4A 1M2OA 1M5Q1 2NUPB 3CD6A 1ZSGA 1UJYA 2QQAA 4N4IA 3L2UA 3UT1A 5M9OA 2ROTA 2AZVA 1XTDA 2D0QB 1AD5A 1RAFB 1YWOA 3R6NA 2D1XA 1YJWQ 1VQ7T 1B07A 2DPPB 2NYSA 1AWXA 2M16A 1UB4A 1KD1U 1WJRA 2VGNA 1OX9A 2DJQA 1N8RC 1GRIA 2OTJT 3I55A 3CCRT 1D0ZA 2BTTA 2K7AA 4M75A 1W4SA 2DL7A 4RUGA 2X3WD 4RG8A 2O9SA 5C6SA 2B8AA 4K11A 1I0CA 1N5ZA 5CVIA 2LJ3A 1WXTA 4M7DD 2FRWA 2O4XB 2R57A 1GCQA 1NLPC 1TSFA 3J81E 4R55A 2XICA 3OBYA 3CCVT 4PJOD 2D6FA 2NLUA 2K2VA 3CXCA 4F17A 1U3OA 2DTIA 4PJNA 2RI5A 4L59A 1UDLA 1TOVA 5KH6A 5CKFA 3SD4A 1UECA 4AFSC 3HFNA 1QWEA 4C5GA 3J80E 1WFWA 3VS7A 5GAN4 4XU3A 1G5VA 1RUWA 1SKUB 2V8IA 1WDXA 2EYZA 1H92A 5GMKm 2P0KA 2H8HA 2HL3A 1CKBA 2EQMA 4ZTFA 2E70A 3L2ZA 2V1QA 1V76A 2CUDA 2X4YA 3L2VA 2RHYA 4J9HA 1JO8A 1SSHA 2EIFA 2QG9B 4JJDA 1VQ9A 2JVVA 2F2VA 4E47A 2FYKA 4M78D 3OYIA 2DXBA 3CCQA 2KRSA 1MNEA 2RJDA 2O01E 4PFPA 3CCST 2JN0A 2CZ0B 2K79A 5GAMh 1YWPA 1I07A 4XQ3A 1I5LA 1T3LA 4J6YA 2FZCB 1LJOA 1M1KU 1YJNT 4XK8E 2GBQA 4BB7A 2KROA 5GAMg 2CGHA 2J05A 1X2QA 4A54A 3O5ZA 2HBWA 2EPDA 2F2XA 3LW5E 4A4HA 3RESA 2L3QA 3NTHA 1Y7XA 3GP8A 2DK3A 2V1RA 1K73R 1IRXA 2RI2A 2QQRA 5EG2A 3CMAQ 3CCMT 4ESRA 4FYWB 2BE7D 5FU6B 3OS0A 4JRPA 4C5IA 2X4WA 2QEXT 4HXJA 3LH5A 2K6DA 4PFOA 1QLYA 3L1AA 3LX7A 1WXBA 2P0PA 1C6VX 4PL6A 3FC3A 3CC7T 1ZSZA 5C0MA 2XHCA 3CCUT 4D8DA 4LXCA 1VYVA 4C92F 1B34A 2A7YA 2GF7A 4C5HA 1LVKA 4J83A 2QTVA 1X69A 2HSEB 2L3PA 3PGGA 5GANd 4KUDK 4GLKA 4CC2A 2HAXA 2O88A 2YUPA 3CCVA 5GAN6 2CSIA 2KXDA 2V8JA 4QVDA 4C8QC 1M2VB 1QMCA 2H3EB 4IUUA 1CKAA 2KK4A 4M77A 1BCOA 2D8HA 3RBBB 5DLOA 4PFZA 4WTOB 3GF5A 1GCPA 4KGXB 4A4KA 1G8XA 4ZTJA 3CCLQ 3QBYA 1SPKA 1Q82C 1OX8A 2FHDA 3GLXA 1K73U 5LJ3j 4M7DA 3CMET 2I2LA 3OYBA 2AT1B 1AT1B 2KDSA 2OI3A 2ZAEA 2XI9A 4RTWA 1I4K1 5CKEA 2E3HA 1MGQA 1Y07A 1PNJA 2EQIA 1YI2T 2D9TA 1RLQC 1MHNA 1GBRA 2YUNA 3KBGA 1QP2A 5KYWA 1M27C 4ANJA 3G1JA 5CKHA 4QQDA 2EQUA 2DYBA 2HZYA 1C1AA 2YT6A 1BB9A 3CC2T 3RNJA 1SG5A 2VKNA 4GY5A 1ZA1B 3M0RA 1QCFA 3H0FA 4B9XA 5LJ3d 3A5ZB 4HCKA 3BW1A 4R0KA 4DEYA 3G4SA 2NUPA 2DL4A 2DERA 3PMTA 1AEYA 4QQ6A 2LT4A 1AZGB 4BI8B 4BE0A 1NYGA 3EGUA 1OU8A 2YXYA 3OYYA 5L23A 3EGDA 4KH1B 2JS2A 2DM1A 1MMDA 2CP0A 4M7AE 3V8KA 5CCAA 5DM7R 3MO8A 3PNWC 2JXBA 4DBFA 4IKFA 1D3BA 4BE2A 1VQKQ 4LNPA 1C0MA 4M77G 2PUOB 4EMKB 2BKDN 2KSSA 5GAOm 2VVKA 1UE9A 3ZFJA 4NL3A 1W1FA 2K2MA 4TVRA 3URGA 2O4XA 3KXTA 1YJWA 3M0SA 1BI0A 4M7AB 1YNZA 2ATCB 5I2SA 2HKQB 4J7FA 4OF1A 2LQ8A 3A8LB 1WHKA 4J9FA 2VXEA 4N4HA 3GIBA 4C92D 2M9UA 1YIJT 2MPXC 3I56Q 4Y92A 1BYMA 4XTZA 2DTHA 1QCNA 4DBQA 2G3RA 2CP3A 1NG2A 3UF4A 2O9VA 4LDUA 2DX1A 3QWYA 4DEXA 2E5KA 3INZA 4Z89A 1T0JA 4JJNK 1M3AA 2IPOB 3TREA 1YI2A 1RLPC 4FL6A 5LJ5h 2BUDA 2KYBA 1D0YA 3JCMX 4JZ3A 2E41A 3CC4T 2X3XD 5LJ5g 1M3CA 2K5FA 1GXIE 2DKGA 1JQQA 3SWNB 3META 3OS1A 3OSSC 3OYLA 2LJ1A 8AT1B 4IUQA 3OYCA 2JM8A 4HVUA 2D8JA 2YSQA 1DJ7B 1NYFA 1KQSS 2DTOA 1VQLQ 2PUKB 1WA7A 2RO0A 2C0IA 2R5AA 1SHFA 2FZGB 2RHUA 1VQOT 3BFMA 1VQNQ 1S72Q 5GMKh 3RUXA 5GMKl 3E1SA 2FPDA 3CPFA 4C0DC 2P0QA 2LQNA 4ELZC 3NGPA 4XU1A 1Y57A 3OW2S 4DBRA 2CREA 1WNLA 1VQ4T 1UG1A 3RERA 2P4TA 1QKXA 1NBEB 2JMCA 1E6HA 4C8QG 5KYYB 3VS0A 2GQIA 1BBZA 1RL2A 1T0HA 1RABB 1XJWB 4MMLA 3CD6T 2MF2A 3H0IA 3H9NA 4NS5A 4KBMB 4LN2A 4BDZA 2GFUA 2CZ7B 2K57A 1RAEB 3VKIA 2PVGB 3OYMA 1WHJA 2EVRA 3VS3A 4YTLA 2Y4XA 3QUIA 4QVCA 4JUVA 1OU9A 1I81A 3EG1A 3C4SA 2L5QA 3CMAA 3V7RA 1M1FA 1Q7YC 2MWOA 2J6OA 4PLLA 3RIRA 6AT1B 5KCHA 1NE8A 1VIFA 1M2VA 3I55T 5DLQE 2DILA 3EFOA 3FB9A 1YIJA 1U8RA 3QYGB 4B6MA 1UFFA 2EJGA 1AWWA 5J39A 3L2QA 3QYHB 5IAYA 4PJOE 2FB7A 2CZ1B 3CQTA 3A1PA 2RI3A 4JS5A 1GCQC 2EYXA 4PNOA 1FWZA 3M57A 2KGTA 2HEQA 4AFQC 4IIMA 1RI9A 4XU0A 1U06A 2AHJB 4OGCA 1K9AA 3T9NA 1IZ6A 2VV5A 5IN1A 4A63B 5KCOA 1LOJA 1VQPQ 3ME9A 2RM4A 4QVZA 4J9BA 3G6EQ 3JB9H 2A36A 4OB2B 1YJ9Q 1K8AU 1PD0A 3TQ7P 3HFOA 2FRYA 2KNBB 3RKWA 3CCLA 3UWNA 1JEGA 5KYUB 3VRYA 1MNDA 5LJ3f 5GJWB 1KD1R 4M78E 2F69A 2RHXA 4QW2A 2DETA 1OZ2A 1NM7A 5IXBA 3TCJA 4C0GA 2LNHB 1IO6A 3CCQT 3UDCA 2LCSA 3AT1B 2E10A 5GAN3 1Q81U 1D0XA 3D7SB 3V8LA 3JAME 1B7TA 3JCMd 1K9MU 1W2BP 1V29B 3EH1A 4KGVB 4J8OA 1OULA 3QZ9B 4O6JA 3OW2A 3MP6A 4KGZB 3SDZA 3MCAB 2L3RA 4F7UE 2KXCA 2YUQA 1NJIR 1WJSA 1WIEA 3M54A 3RMQA 2DZ9A 4FSSA 2DBKA 3M0QA 3M56A 4A4EA 1MMGA 3TVTA 4BD3A 2C06A 2DJZA 3X20B 2CP7A 3GPLA 4C8QF 5FRNA 4EMKA 5AYFA 3H41A 1OV3A 1I1JA 5A0LA 1X6BA 3DB4A 4BI4A 1SEMA 3PVQA 4F7UB 1QP3A 4WF2A 5CIUA
chains in the Genus database with same CATH topology
1OPKA 4ORZA 4JJCA 1PKSA 4D8DA 1VYVA 2ECZA 3A98A 2EYYA 1M30A 5IHIA 5I11A 2M51A 2B86A 1M3BA 4OMLA 1X69A 4RTUA 2L3PA 2HSPA 4CC2A 2O88A 3THKA 2ED0A 2YUPA 2RNAA 2CSIA 1SHGA 2KXDA 3IQLA 4HVWA 3M0PA 4RTTA 2L3SA 2CUBA 2ED1A 3EG2A 1MUZA 1E7OA 1CKAA 1W6XA 2KR3A 4AFZC 2HDAA 2D8HA 2RPNA 2EGAA 3EHQA 3RBBB 1YCSB 3FJ5A 1JXMA 2ABLA 1GCPA 2DVJA 2P4RA 1M8MA 1SPKA 1PWTA 3UA6A 1VYTA 2MOXA 2KRNA 2BZXA 1V1CA 2PZ1A 1K76A 1PRMC 1H3HA 3REBB 4OMNA 2NUZA 2OI3A 2ROLA 4RTWA 4J9IA 1PNJA 2EQIA 1S1NA 5ECAA 2RF0A 1RLQC 1GBRA 2YUNA 2JT4A 2HCKA 2W10A 1GL5A 1TUDA 2FG0A 4HVVA 1M27C 5FWCA 4J9EA 4Z8AA 4JZ4A 1FMKA 2DYBA 1AVZC 2L2PA 1J3TA 3PVLA 2YT6A 4RTVA 1BB9A 1ZX6A 2JW4A 3RNJA 2DRMA 3I9QA 3UA7A 2D0NA 1XOVA 2VKNA 2DA9A 2J6KA 2KEAA 3M0RA 1QCFA 3GBQA 3H0FA 3EG3A 1WXUA 1KSWA 2IIMA 1NEBA 4IIOA 1UHCA 2M0YA 3H0HA 2JTEA 1ZBJA 3I5RA 4D8KA 4HCKA 4R0KA 2NWMA 4DEYA 4J9CA 2DL4A 1UUEA 2LX7A 2GGRA 2A08A 2AK5A 2GTOA 2OAWA 1AEYA 1KFZA 1HSQA 1TUCA 2LQWA 2F2WA 1AZGB 1JU5C 1UHFA 4X1VA 1NYGA 1X43A 3EGUA 1K0XA 5L23A 1TG0A 2JS2A 4Z88A 2DM1A 1QKWA 3KFVA 3REAB 2EGCA 1SRMA 2J6FA 2MCNA 2KBTA 1ABOA 2LMJA 1GFDA 1NEGA 2JXBA 2L0AA 2KT8A 2SEMA 4LNPA 4LUDA 1K1ZA 3TSWA 2FPFA 1PHTA 5I22A 2O31A 2J06A 2VVKA 2ESWA 2KE9A 1LCKA 1UE9A 4KRTA 1W1FA 2K2MA 2BZ8A 2C0OA 1PRLC 1PKTA 4GLMA 2DNUA 2DE0X 2RQVA 3M0SA 4CC3A 4LUEA 1AWJA 4RTXA 5GJVB 1X6GA 1YNZA 3EHRA 1G83A 2DL3A 4ZNXA 4J9FA 2JS0A 2GNCA 2ENMA 1KJWA 4Y92A 1UGVA 1SRLA 1UTIA 4J9DA 1YP5A 3C0CA 1QWFA 1NG2A 3UF4A 2O9VA 2DX1A 3QWYA 4DEXA 5EC7A 3TSZA 2E5KA 1E6GA 2KYMA 4Z89A 1T0JA 1M3AA 1RLPC 2KYBA 3I35A 2CH4W 4JJBA 2CSQA 1YN8A 4JZ3A 1WI7A 1ZUYA 1VYUA 2X3XD 3NHNA 4OMPA 4CC7A 4CC4B 3EG0A 1NLOC 1M3CA 3JV3A 1ZUKA 1JQQA 3SHWA 2JMAA 2FEIA 2DL8A 1FYNA 2AKLA 1EFNA 2RQTA 2DF6A 2YUOA 2LJ1A 2OJ2A 3QWXX 1HJDA 3U23A 4RTYA 1W70A 2JM8A 4HVUA 2D8JA 2YSQA 4JPBW 2MIOA 1K0SA 1NYFA 2O2OA 1HD3A 2W0ZA 5IHKA 2EBPA 1BU1A 1KIKA 1AOJA 2CDTA 2RMOA 1WA7A 3NPFA 2C0IA 5IXFA 1SHFA 1B3QA 4OMQA 3ZL7C 4OMOA 2CT4A 1OEBA 2FPEA 4AFUC 2FPDA 1X2KA 3VRZA 2K3BA 2YDLA 2CT3A 2LJ0A 2LQNA 2PTKA 3NGPA 1Y57A 5IHNA 1ZUUA 2CREA 1UG1A 1QKXA 2JMCA 3NMZC 4LE9A 4AG2C 2SRCA 1E6HA 2DL5A 1JXOA 3VS0A 2XMFA 2GQIA 1UJ0A 2DBMA 1A0NB 4RTZA 1ZSGA 1BBZA 1T0HA 1UJYA 5FWBA 2ROTA 2AZVA 3H0IA 1G2BA 3UATA 4LN2A 1AD5A 1YWOA 2I0NA 3R6NA 2D1XA 1ARKA 2DLPA 4F16A 1B07A 2EVRA 2GTJA 3VS3A 1AWXA 2DRKA 3EG1A 4M4ZA 2RN8A 5HCKA 2DJQA 1GRIA 3PE0A 1H8KA 2J6OA 2BTTA 2K7AA 4RUGA 2DL7A 3M0TA 2X3WD 2DILA 2O9SA 3SEMA 4K11A 1I0CA 1N5ZA 2J7IA 1UFFA 1AWWA 2LJ3A 1WXTA 2FRWA 2RQWA 1GCQA 3VS2A 1NLPC 1MV3A 2DMOA 3CQTA 1VA7A 1GCQC 2EYXA 3M0UA 4QT7A 2KGTA 2HEQA 4AFQC 4IIMA 1RI9A 1U06A 2AKKA 2RQUA 4F17A 4F14A 1U3OA 1K9AA 1UDLA 2VWFA 1UECA 4AFSC 1QWEA 1WFWA 3VS7A 4A63B 2EYWA 1RUWA 1WDXA 4E6RA 2EYZA 1GBQA 1H92A 2H8HA 4GBQA 3ULRB 1CKBA 4J9BA 2A36A 1Y0MA 2FRYA 2V1QA 1MV0B 4WCIA 2KNBB 5FW9A 2CUDA 1JEGA 3VS1A 3VRYA 5GJWB 4J9HA 1JO8A 1SSHA 4JJDA 2RQRA 1NM7A 2F2VA 5IXBA 2AZSA 1OOTA 2A37A 2KRSA 2LNHB 1IO6A 3VS4A 1WX6A 2LCSA 1BK2A 2LP5A 2K79A 1YWPA 1I07A 1AZEA 1T3LA 4AG1C 2QDLA 2JM9A 1T3SA 1GFCA 2GBQA 1Z9ZA 2KROA 1OPLA 1CSKA 3I5SA 1WLPB 2PNIA 2J05A 2KRMA 1K4US 1ZLMA 2EW3A 1X2QA 2CH4A 2K9GA 2KXCA 3O5ZA 2YUQA 2HBWA 2EPDA 4OMMA 2F2XA 1WIEA 1AWOA 1WYXA 2C0TA 1X27A 4FSSA 2DBKA 5IH2A 4EIKA 2LZ6B 2L3QA 2EGEA 2BZYA 3M0QA 1U5SA 1Z9QA 2V1RA 3TVTA 4ESRA 3VS5A 2EKHA 2A28A 1ABQA 2FO0A 3H41A 4HXJA 3LH5A 1OV3A 1I1JA 2K6DA 1X6BA 1QLYA 3VS6A 2G6FX 2KT1A 1SEMA 1WXBA 3PVQA 4J9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OPK A;  4ORZ A;  4JJC A;  1PKS A;  4D8D A;  1VYV A;  2ECZ A;  3A98 A;  2EYY A;  1M30 A;  5IHI A;  5I11 A;  2M51 A;  2B86 A;  1M3B A;  4OML A;  1X69 A;  4RTU A;  2L3P A;  2HSP A;  4CC2 A;  2O88 A;  3THK A;  2ED0 A;  2YUP A;  2RNA A;  2CSI A;  1SHG A;  2KXD A;  3IQL A;  4HVW A;  3M0P A;  4RTT A;  2L3S A;  2CUB A;  2ED1 A;  3EG2 A;  1MUZ A;  1E7O A;  1CKA A;  1W6X A;  2KR3 A;  4AFZ C;  2HDA A;  2D8H A;  2RPN A;  2EGA A;  3EHQ A;  3RBB B;  1YCS B;  3FJ5 A;  1JXM A;  2ABL A;  1GCP A;  2DVJ A;  2P4R A;  1M8M A;  1SPK A;  1PWT A;  3UA6 A;  1VYT A;  2MOX A;  2KRN A;  2BZX A;  1V1C A;  2PZ1 A;  1K76 A;  1PRM C;  1H3H A;  3REB B;  4OMN A;  2NUZ A;  2OI3 A;  2ROL A;  4RTW A;  4J9I A;  1PNJ A;  2EQI A;  1S1N A;  5ECA A;  2RF0 A;  1RLQ C;  1GBR A;  2YUN A;  2JT4 A;  2HCK A;  2W10 A;  1GL5 A;  1TUD A;  2FG0 A;  4HVV A;  1M27 C;  5FWC A;  4J9E A;  4Z8A A;  4JZ4 A;  1FMK A;  2DYB A;  1AVZ C;  2L2P A;  1J3T A;  3PVL A;  2YT6 A;  4RTV A;  1BB9 A;  1ZX6 A;  2JW4 A;  3RNJ A;  2DRM A;  3I9Q A;  3UA7 A;  2D0N A;  1XOV A;  2VKN A;  2DA9 A;  2J6K A;  2KEA A;  3M0R A;  1QCF A;  3GBQ A;  3H0F A;  3EG3 A;  1WXU A;  1KSW A;  2IIM A;  1NEB A;  4IIO A;  1UHC A;  2M0Y A;  3H0H A;  2JTE A;  1ZBJ A;  3I5R A;  4D8K A;  4HCK A;  4R0K A;  2NWM A;  4DEY A;  4J9C A;  2DL4 A;  1UUE A;  2LX7 A;  2GGR A;  2A08 A;  2AK5 A;  2GTO A;  2OAW A;  1AEY A;  1KFZ A;  1HSQ A;  1TUC A;  2LQW A;  2F2W A;  1AZG B;  1JU5 C;  1UHF A;  4X1V A;  1NYG A;  1X43 A;  3EGU A;  1K0X A;  5L23 A;  1TG0 A;  2JS2 A;  4Z88 A;  2DM1 A;  1QKW A;  3KFV A;  3REA B;  2EGC A;  1SRM A;  2J6F A;  2MCN A;  2KBT A;  1ABO A;  2LMJ A;  1GFD A;  1NEG A;  2JXB A;  2L0A A;  2KT8 A;  2SEM A;  4LNP A;  4LUD A;  1K1Z A;  3TSW A;  2FPF A;  1PHT A;  5I22 A;  2O31 A;  2J06 A;  2VVK A;  2ESW A;  2KE9 A;  1LCK A;  1UE9 A;  4KRT A;  1W1F A;  2K2M A;  2BZ8 A;  2C0O A;  1PRL C;  1PKT A;  4GLM A;  2DNU A;  2DE0 X;  2RQV A;  3M0S A;  4CC3 A;  4LUE A;  1AWJ A;  4RTX A;  5GJV B;  1X6G A;  1YNZ A;  3EHR A;  1G83 A;  2DL3 A;  4ZNX A;  4J9F A;  2JS0 A;  2GNC A;  2ENM A;  1KJW A;  4Y92 A;  1UGV A;  1SRL A;  1UTI A;  4J9D A;  1YP5 A;  3C0C A;  1QWF A;  1NG2 A;  3UF4 A;  2O9V A;  2DX1 A;  3QWY A;  4DEX A;  5EC7 A;  3TSZ A;  2E5K A;  1E6G A;  2KYM A;  4Z89 A;  1T0J A;  1M3A A;  1RLP C;  2KYB A;  3I35 A;  2CH4 W;  4JJB A;  2CSQ A;  1YN8 A;  4JZ3 A;  1WI7 A;  1ZUY A;  1VYU A;  2X3X D;  3NHN A;  4OMP A;  4CC7 A;  4CC4 B;  3EG0 A;  1NLO C;  1M3C A;  3JV3 A;  1ZUK A;  1JQQ A;  3SHW A;  2JMA A;  2FEI A;  2DL8 A;  1FYN A;  2AKL A;  1EFN A;  2RQT A;  2DF6 A;  2YUO A;  2LJ1 A;  2OJ2 A;  3QWX X;  1HJD A;  3U23 A;  4RTY A;  1W70 A;  2JM8 A;  4HVU A;  2D8J A;  2YSQ A;  4JPB W;  2MIO A;  1K0S A;  1NYF A;  2O2O A;  1HD3 A;  2W0Z A;  5IHK A;  2EBP A;  1BU1 A;  1KIK A;  1AOJ A;  2CDT A;  2RMO A;  1WA7 A;  3NPF A;  2C0I A;  5IXF A;  1SHF A;  1B3Q A;  4OMQ A;  3ZL7 C;  4OMO A;  2CT4 A;  1OEB A;  2FPE A;  4AFU C;  2FPD A;  1X2K A;  3VRZ A;  2K3B A;  2YDL A;  2CT3 A;  2LJ0 A;  2LQN A;  2PTK A;  3NGP A;  1Y57 A;  5IHN A;  1ZUU A;  2CRE A;  1UG1 A;  1QKX A;  2JMC A;  3NMZ C;  4LE9 A;  4AG2 C;  2SRC A;  1E6H A;  2DL5 A;  1JXO A;  3VS0 A;  2XMF A;  2GQI A;  1UJ0 A;  2DBM A;  1A0N B;  4RTZ A;  1ZSG A;  1BBZ A;  1T0H A;  1UJY A;  5FWB A;  2ROT A;  2AZV A;  3H0I A;  1G2B A;  3UAT A;  4LN2 A;  1AD5 A;  1YWO A;  2I0N A;  3R6N A;  2D1X A;  1ARK A;  2DLP A;  4F16 A;  1B07 A;  2EVR A;  2GTJ A;  3VS3 A;  1AWX A;  2DRK A;  3EG1 A;  4M4Z A;  2RN8 A;  5HCK A;  2DJQ A;  1GRI A;  3PE0 A;  1H8K A;  2J6O A;  2BTT A;  2K7A A;  4RUG A;  2DL7 A;  3M0T A;  2X3W D;  2DIL A;  2O9S A;  3SEM A;  4K11 A;  1I0C A;  1N5Z A;  2J7I A;  1UFF A;  1AWW A;  2LJ3 A;  1WXT A;  2FRW A;  2RQW A;  1GCQ A;  3VS2 A;  1NLP C;  1MV3 A;  2DMO A;  3CQT A;  1VA7 A;  1GCQ C;  2EYX A;  3M0U A;  4QT7 A;  2KGT A;  2HEQ A;  4AFQ C;  4IIM A;  1RI9 A;  1U06 A;  2AKK A;  2RQU A;  4F17 A;  4F14 A;  1U3O A;  1K9A A;  1UDL A;  2VWF A;  1UEC A;  4AFS C;  1QWE A;  1WFW A;  3VS7 A;  4A63 B;  2EYW A;  1RUW A;  1WDX A;  4E6R A;  2EYZ A;  1GBQ A;  1H92 A;  2H8H A;  4GBQ A;  3ULR B;  1CKB A;  4J9B A;  2A36 A;  1Y0M A;  2FRY A;  2V1Q A;  1MV0 B;  4WCI A;  2KNB B;  5FW9 A;  2CUD A;  1JEG A;  3VS1 A;  3VRY A;  5GJW B;  4J9H A;  1JO8 A;  1SSH A;  4JJD A;  2RQR A;  1NM7 A;  2F2V A;  5IXB A;  2AZS A;  1OOT A;  2A37 A;  2KRS A;  2LNH B;  1IO6 A;  3VS4 A;  1WX6 A;  2LCS A;  1BK2 A;  2LP5 A;  2K79 A;  1YWP A;  1I07 A;  1AZE A;  1T3L A;  4AG1 C;  2QDL A;  2JM9 A;  1T3S A;  1GFC A;  2GBQ A;  1Z9Z A;  2KRO A;  1OPL A;  1CSK A;  3I5S A;  1WLP B;  2PNI A;  2J05 A;  2KRM A;  1K4U S;  1ZLM A;  2EW3 A;  1X2Q A;  2CH4 A;  2K9G A;  2KXC A;  3O5Z A;  2YUQ A;  2HBW A;  2EPD A;  4OMM A;  2F2X A;  1WIE A;  1AWO A;  1WYX A;  2C0T A;  1X27 A;  4FSS A;  2DBK A;  5IH2 A;  4EIK A;  2LZ6 B;  2L3Q A;  2EGE A;  2BZY A;  3M0Q A;  1U5S A;  1Z9Q A;  2V1R A;  3TVT A;  4ESR A;  3VS5 A;  2EKH A;  2A28 A;  1ABQ A;  2FO0 A;  3H41 A;  4HXJ A;  3LH5 A;  1OV3 A;  1I1J A;  2K6D A;  1X6B A;  1QLY A;  3VS6 A;  2G6F X;  2KT1 A;  1SEM A;  1WXB A;  3PVQ A;  4J9G A; 
#chains in the Genus database with same CATH topology
 1N9S A;  4HT8 A;  1NPP A;  4JJC A;  2FZK B;  2RK2 A;  3QII A;  4M7A A;  2ECZ A;  1M30 A;  3ER0 A;  3G71 Q;  3MEU A;  1SF9 A;  4RTU A;  2P84 A;  1M1K R;  2CS7 A;  1VQK A;  3EFS A;  2ED0 A;  1Q95 G;  4P5N A;  2RNA A;  4HVW A;  1WQ7 A;  3CCE Q;  2RH2 A;  2L3S A;  4L6V 5;  4RCB A;  1U1T A;  2VAS A;  1NJI U;  1MUZ A;  3S3O A;  3SB2 A;  3EHQ A;  2YRV A;  3FJ5 A;  1KG1 A;  1JXM A;  3OYN A;  2ABL A;  4C5E A;  2DVJ A;  1M8M A;  3UA6 A;  5A0G A;  4E7I A;  4M77 C;  2E6N A;  3NFC A;  2LCL A;  2MOX A;  1M90 C;  2PZ1 A;  1V1C A;  2Z0W A;  2KQW A;  1H3H A;  1G3T A;  2PQW A;  3I56 A;  3OS2 A;  1QCO A;  4N0A A;  2MMP A;  4Y28 E;  3OYE A;  3MPU B;  2W10 A;  4FU6 A;  4OB1 B;  1WHH A;  3M58 A;  1GL5 A;  1FMW A;  5AT1 B;  5FWC A;  4RCC A;  3JB9 I;  5GAN 2;  4Z8A A;  4JZ4 A;  1FMK A;  2NUT A;  1AVZ C;  3HTR A;  4RTV A;  1UGQ B;  2JW4 A;  1XQH A;  5LJ3 e;  2DRM A;  3MP1 A;  2DO3 A;  1WQW A;  2D0N A;  2DA9 A;  2KEA A;  4UC4 A;  3EG3 A;  1KSW A;  1D1C A;  2F1L A;  5I21 A;  2IIM A;  3F70 A;  3H0H A;  4D8K A;  2RJF A;  2NWM A;  2LVM A;  5HY6 A;  5GAM d;  4B9W A;  5GAN j;  1UUE A;  2LX7 A;  3JB9 J;  3G4S T;  3P8B B;  4M7A G;  4M75 G;  1KFZ A;  1VQL A;  2F2W A;  1WHL A;  3M55 A;  3P8H A;  3JB9 F;  1KHC A;  1K0X A;  3OY9 A;  1VQN A;  2BIV A;  5KYX A;  1TG0 A;  1S72 A;  1LNX A;  4KUL A;  2ZPE B;  2LC4 A;  2EFI A;  2VXF A;  1GFD A;  2L0A A;  2SEM A;  2DD5 A;  1Q86 C;  5FLX E;  2FPF A;  1PHT A;  3QO3 A;  2O31 A;  2E64 A;  2KE9 A;  3MJX A;  2XID A;  1KHI A;  1M9S A;  2C0O A;  2LTO A;  3OQ5 A;  2E3I A;  1VQ6 Q;  2DNU A;  2QDY B;  3OA6 A;  1HK9 A;  1RAC B;  2RQV A;  2OTL Q;  3H8Z A;  1YJW T;  1AWJ A;  5J26 A;  3Q1J A;  4C92 E;  2QXF A;  1G83 A;  1VOM A;  2JS0 A;  2GNC A;  2EQK A;  4OMF B;  3M4G A;  4J9D A;  1UTI A;  1N8R U;  4BAC A;  2YHT A;  5GAN 7;  2ZPH B;  3KUF A;  1BIB A;  1YIT Q;  1F1B B;  3V7C A;  4OGE A;  4PJO A;  3RR6 A;  1YN8 A;  3NHN A;  4C92 B;  9ATC B;  2PU9 B;  3SHW A;  2DL8 A;  2HD0 A;  2AKL A;  3JCM f;  3RDV A;  1VQM Q;  2YUO A;  3LYI A;  2OJ2 A;  3QWX X;  1HJD A;  3U23 A;  3X24 B;  1YHQ Q;  1RAD B;  3C94 A;  2X9H A;  1JJ2 P;  3P8D A;  1VQP A;  2HQE A;  3G6E A;  2O2O A;  5IHK A;  2EBP A;  1BU1 A;  1KIK A;  3PMI A;  1W2B A;  1SSF A;  3CCJ Q;  3ZL7 C;  1B3Q A;  4OMQ A;  4M78 A;  1R77 A;  2E6Z A;  4RKU E;  1H64 1;  2QA4 Q;  2FPE A;  3LWI A;  3BDU A;  4AFU C;  2EWN A;  2CT3 A;  4E7H A;  1D1A A;  3QZ5 B;  2BE9 B;  4C0D B;  1JXO A;  2QAS A;  4EMH A;  3LLR A;  1QVF P;  4FIB A;  4F7U A;  2E65 A;  1YCY A;  4FCY A;  1VIE A;  4XTV A;  1VQ5 Q;  1QW1 A;  2DLP A;  3JB9 D;  2GTJ A;  3HRS A;  5FU7 C;  3JRZ A;  2DRK A;  1OI1 A;  2DXT A;  1PCX A;  4M7D G;  4M4Z A;  1TH7 A;  2R58 A;  3JCM J;  1IXD A;  3CMA T;  3PE0 A;  1H8K A;  5GAO r;  1WZO A;  4PJO G;  3DLL A;  3FEO A;  1ZHI A;  4HA8 A;  2J7I A;  2RJC A;  3VU3 C;  3VS2 A;  3CBP A;  1MV3 A;  1EZZ B;  2DMO A;  1Y71 A;  1X01 A;  1VA7 A;  3JCM Q;  4MMK A;  2E4H A;  3M0U A;  4QT7 A;  3G71 A;  2EJF A;  2LX9 A;  1ZQ1 A;  1H3Z A;  2AKK A;  2ZGW A;  4FSX A;  4F14 A;  1IHW A;  2VWF A;  4XTX A;  4XTY A;  2DAQ A;  3CCE A;  2QAZ A;  4M78 G;  4QKU A;  4KT0 E;  3C12 A;  1GBQ A;  1VQ9 Q;  1VQ8 Q;  1UGP B;  3ULR B;  4HT9 A;  3QDR B;  4E7K A;  2IVW A;  5LJ5 d;  3JCM P;  4FW2 A;  1FX7 A;  1D09 B;  5GMK j;  4E7J A;  4LD9 K;  1Q82 U;  1TTH B;  3CCL T;  2X51 A;  3JCM e;  1OOT A;  2DEU A;  7AT1 B;  4F04 B;  3VS4 A;  1JJ2 S;  2VB6 A;  3ASK A;  3NTI A;  2LP5 A;  3QSU A;  2K4Y A;  4F7U G;  3LGF A;  1AZE A;  2QDL A;  3QG1 A;  2JM9 A;  1T3S A;  3HP9 A;  4PJJ A;  1CSK A;  1WLP B;  2KRM A;  1ZLM A;  2COZ A;  2EW3 A;  3V7S A;  2K9G A;  1VQ7 Q;  1AWO A;  1X27 A;  4EIK A;  1MMN A;  1U5S A;  3BY7 A;  3OYK A;  2HQX A;  3X25 B;  4A4F A;  1KD1 C;  4MZP A;  3JCM V;  1QVF S;  4ME7 A;  3N5B B;  2A28 A;  2OTJ Q;  3CCR Q;  1ABQ A;  2FO0 A;  2GCX A;  5GAN f;  3BE3 A;  1K8A R;  3PIO A;  3OYA A;  2RD1 A;  3VS6 A;  2G6F X;  4C0F A;  4CRI A;  4LD6 A;  4M77 F;  2WSE E;  4ORZ A;  1NPR A;  2XDD A;  4AMC A;  1PKS A;  3CCV Q;  3A98 A;  2EYY A;  4PKC C;  5FRM A;  3ZBD A;  1G3S A;  4M7D F;  5IHI A;  1Q81 R;  2M51 A;  2B86 A;  1M3B A;  2KAF A;  3MEA A;  4M75 C;  4M7A C;  4OML A;  3LGL A;  5CR2 A;  1EIF A;  4J5Y A;  1XNI A;  1K9M R;  3QPH A;  3THK A;  2DZC A;  3CEY A;  1VQK T;  3HKS A;  1P92 A;  5CKD A;  4RTT A;  1E7O A;  2KR3 A;  2VYT A;  2RPN A;  2EGA A;  4Z02 A;  1YCS B;  2OTL A;  2K5I A;  1PSF A;  1PWT A;  4A53 A;  4C92 A;  3CPW P;  1KQ1 A;  1G3W A;  1JB0 E;  2KRN A;  4ATO A;  1PRM C;  4X9D A;  4M77 B;  3CCS Q;  4J9I A;  3OYG A;  5ECA A;  5I2M A;  3I56 T;  1BI3 A;  4DA4 A;  2HCK A;  2COW A;  1WJQ A;  2HMA A;  2YRC A;  1TUD A;  1YJN Q;  2FG0 A;  2ZCF B;  5GAO p;  2YRD A;  4N0A C;  1M1K C;  4LDV A;  4J9E A;  2AIR B;  2DFU A;  4E2F B;  2DVE A;  4EMG A;  2R5M A;  1YIT A;  1RAG B;  2L2P A;  5GAN 5;  1JJ2 A;  1RAH B;  3X26 B;  3I9Q A;  2FL7 A;  2KI7 A;  1Y96 B;  2J6K A;  3JCM h;  5KYW B;  3GBQ A;  3OYH A;  5GAM e;  1NEB A;  4IIO A;  3OB9 A;  1UHC A;  3CCM Q;  1VQM A;  2M0Y A;  2JTE A;  1IRE B;  2MWP A;  3I5R A;  1YHQ A;  1NZ9 A;  4E7L A;  3S6W A;  2QEX Q;  3QHS A;  4J9C A;  2JTF A;  5CQY A;  1Q7Y R;  4FT2 A;  2AK5 A;  2GTO A;  3EG9 B;  1HSQ A;  2RHZ A;  1TWB A;  2XG8 D;  3CC7 Q;  1UHF A;  3CCJ A;  1X43 A;  1VQL T;  1QVF A;  1KC8 R;  3CCU Q;  4JLI A;  2DXU A;  2LRQ A;  4N4G A;  1VQN T;  4BY6 C;  1S72 T;  2MCN A;  2KBT A;  3EGX B;  5FRO A;  1I5O B;  2LMJ A;  2KY9 A;  3HRT A;  3FIF A;  1TU0 B;  2ZPB B;  4E7S A;  4C8Q E;  4EPC A;  5GAN e;  1K1Z A;  3PTA A;  3TSW A;  5HK0 A;  3EGD B;  3HHT B;  2QQ9 A;  3AHU A;  1ZSZ C;  2J06 A;  2X4X A;  2ESW A;  4C92 G;  1LCK A;  4KRT A;  2YWW A;  2BZ8 A;  1ACM B;  1PKT A;  5L8R E;  5A2Q E;  1VQ5 A;  1D3B B;  4EDU A;  2CYZ B;  4RTX A;  1R8O B;  2CKK A;  3CME Q;  1K73 C;  4M77 D;  1X6G A;  3NTK A;  2ZPF B;  3TU4 K;  4RG2 A;  2ZPI B;  2JNG A;  2VC8 A;  1UGS B;  4J6W A;  1YI2 Q;  4A4G A;  4C8Q B;  1KJW A;  4KUI A;  1Q7Y U;  1PG5 B;  1HXD A;  1UGV A;  2HQH A;  1YP5 A;  4ZN1 A;  5GAO l;  3OYJ A;  2CP6 A;  1RAA B;  5LJ5 f;  5EC7 A;  1E6G A;  3G7Z A;  4IUT A;  1KC8 U;  3SWN A;  3A8H B;  3CPW S;  5GAM j;  2M1H A;  3RKX A;  3WVE B;  4M7D C;  3M59 A;  1KQ2 A;  2L8D A;  3CC2 Q;  4JJB A;  2CSQ A;  2CZ6 B;  5IT9 E;  2KMT A;  1BI2 A;  4R56 A;  4CC7 A;  2LQK A;  2OX7 A;  3JV3 A;  1ZUK A;  4PJO C;  2K5L A;  2HBP A;  2QYZ A;  3HPW A;  1ZBX A;  4BUG A;  5CAI A;  1IGQ A;  2CP5 A;  4LDW A;  2M0O A;  5A0D A;  2QGG A;  4RTY A;  2QI2 A;  1W70 A;  2X4J A;  2QTX A;  2MIO A;  4IUP A;  1K0S A;  3L42 A;  2LT1 A;  2JJ9 A;  1R0B G;  1VQ8 A;  3JSC A;  5D6X A;  1VQP T;  1W2B S;  4Y91 A;  2CDT A;  2RMO A;  3G6E T;  3SFM A;  3NPF A;  1YJ9 T;  3L2W A;  5IXF A;  4NOY A;  5KYY A;  2CT4 A;  1BI1 A;  1OEB A;  3VRZ A;  1PM3 A;  4M78 C;  1JRI A;  4L5G A;  1N8R R;  2PTK A;  1QQJ A;  3J7A F;  5IHN A;  2V8K A;  1ZUU A;  3VJP A;  2QQB A;  3A8G B;  3NMZ C;  4LE9 A;  4HCC A;  3OYD A;  2XMF A;  1UJ0 A;  2DBM A;  1A0N B;  4RTZ A;  4HKE A;  5FWB A;  3EAE A;  1YFN A;  4J6X A;  1G2B A;  3UAT A;  1TXQ A;  2I0N A;  1X6O A;  4ELY C;  1VQ7 A;  2DD4 A;  2RK1 A;  1ARK A;  4KH0 B;  3UPU A;  3LH0 A;  4F16 A;  4C8Q D;  3VYG A;  5D6Y A;  3DLM A;  4J7I A;  4JDS A;  1YIJ Q;  3FDR A;  5GAN h;  2RN8 A;  5FU7 B;  5HCK A;  4ZN3 A;  1M90 R;  2OTJ A;  3CCR A;  3S3N A;  5GAN g;  1QVG P;  3WXM B;  1R0C B;  3OS5 A;  3M0T A;  3GNF B;  3O8V A;  1UEB A;  3SEM A;  1OYX A;  2MAM A;  5LL6 S;  2RHI A;  4OVA A;  3PFS A;  2RQW A;  3CC4 Q;  2L89 A;  4X34 A;  2Y90 A;  4BE1 A;  4V2S A;  2JTM A;  4PLI A;  1FXX A;  3EFO B;  3V8J A;  5GAO n;  2COY A;  3CPW A;  2V26 A;  3R6O A;  3G71 T;  1HYO A;  1OQK A;  5GAO q;  2RQU A;  5D7U A;  3PIP A;  2EJ9 A;  5KYU A;  5LJ5 e;  2E1H A;  3H6Z A;  2EYW A;  1QVP A;  4E6R A;  3CCE T;  5HK3 A;  3OMC A;  2LNV A;  4GBQ A;  3VV0 A;  1Y0M A;  1VQO Q;  1VUB A;  1MV0 B;  4WCI A;  5FW9 A;  3VS1 A;  3MKD A;  2QQS A;  1RI0 A;  1Y96 A;  1M90 U;  2RQR A;  2MYS A;  2AZS A;  2XK0 A;  1I8F A;  2A37 A;  1YJ9 A;  5LJ3 h;  3CCS A;  1VQ4 Q;  3EFR A;  1WX6 A;  3EH2 A;  4FM4 B;  2M02 A;  4MDX A;  1BK2 A;  1OZ3 A;  5LJ3 g;  2DIQ A;  1YJN A;  4BI3 A;  1KQS P;  4AG1 C;  3CD6 Q;  3VYH B;  1GFC A;  1Q86 R;  1Z9Z A;  1OPL A;  3I5S A;  3EG9 A;  4DOW A;  4JS4 A;  2PNI A;  5GMK e;  3QJY A;  3HL8 A;  1O75 A;  1K4U S;  2LCC A;  2CH4 A;  3RKY A;  2OAU A;  1TUG B;  2EQJ A;  4OMM A;  3VUZ A;  1WYX A;  2K3Y A;  2C0T A;  3E19 A;  5IH2 A;  4M7A F;  4M75 F;  3OW2 P;  2LZ6 B;  2EGE A;  2BZY A;  2DIG A;  5CQX A;  2XU8 A;  5FU6 C;  3EGX A;  2GQV A;  3CCM A;  1Z9Q A;  2XDP A;  3HRU A;  8ATC B;  3VS5 A;  2EKH A;  4HCZ A;  5KE3 A;  2QEX A;  3I55 Q;  4LDX A;  1WPY A;  3M53 A;  4M75 E;  4MZT A;  1Q82 R;  2Y4Y A;  2GFA A;  2KT1 A;  4JRK A;  3TEE A;  3CC7 A;  2EYQ A;  4J9G A;  3CCU A;  1YBY A;  1OPK A;  2E5Q A;  3MHX A;  1D1B A;  4OB0 B;  3JCM W;  5LJ5 j;  1WHM A;  3DKM A;  4ZGE B;  3OSV A;  1FMV A;  5I11 A;  1QVG S;  4OB3 B;  1M8V A;  2JUF A;  4II1 A;  4C8Q A;  4OP0 A;  5GMK i;  2HSP A;  2MK5 A;  4DOV A;  1Q86 U;  4JRQ A;  1O9S A;  3CBO A;  2VGM A;  4PJM A;  1SHG A;  4M75 B;  3IQL A;  2YLC A;  3M0P A;  2ZZD A;  2CUB A;  2ED1 A;  1UGR B;  3EG2 A;  1W6X A;  1BCM A;  4AFZ C;  2HDA A;  3DB3 A;  1K8A C;  4ZGJ B;  4XTU A;  3OBW A;  2P4R A;  1IGU A;  4RMO A;  1VQ6 T;  2DEQ A;  2E12 A;  2F5K A;  3CME A;  1VYT A;  2OTL T;  1ZA2 B;  1RAI B;  2JZ2 A;  3BDL A;  1WGS A;  1EX4 A;  3M4Y A;  3CXC P;  2BZX A;  1K76 A;  1PSE A;  2JOY A;  3REB B;  3CCQ Q;  4C92 C;  4OMN A;  2NUZ A;  2ROL A;  3QJ6 A;  1IHV A;  1MMA A;  1S1N A;  2RF0 A;  3C95 A;  4E7Z A;  2JT4 A;  1Q81 C;  4HVV A;  2X35 A;  1K9M C;  3MEW A;  3E9F A;  5GAM f;  2LDM A;  4NL2 A;  1IB8 A;  3CC2 A;  1BIA A;  1J3T A;  2H3J A;  3PVL A;  5J3B A;  1YIT T;  1ZX6 A;  3UA7 A;  1N6A A;  3FRN A;  4LDY A;  1XOV A;  2PVO B;  5HKC A;  2F5T X;  4D6W A;  1X75 C;  5DY9 A;  5KE2 A;  3MP8 A;  4FYX B;  1WXU A;  2K3X A;  4XTW A;  3S3M A;  2NUT B;  4MZM A;  1ZBJ A;  1VQM T;  1YHQ T;  4PK4 A;  1M4Z A;  4HCB A;  2GGR A;  2A08 A;  2A0F B;  2OAW A;  1TUC A;  2LQW A;  1PC0 A;  1JU5 C;  3M5A A;  4DQ2 A;  4X1V A;  2KVQ G;  2WSF E;  2IG0 A;  3CCJ T;  4Z88 A;  3OMG A;  3KFV A;  1QKW A;  3REA B;  2EGC A;  1SRM A;  2QA4 T;  4DBH A;  2J6F A;  4EMK C;  3PT9 A;  1ABO A;  2RB6 A;  4M7A D;  4M75 D;  5CO7 A;  1NEG A;  3RMS A;  1M1G A;  4Q5W A;  4BY6 B;  2KT8 A;  2XKO C;  1LPL A;  4LUD A;  2QGF B;  4X9C A;  5KYX B;  2HKN A;  4PJL A;  3X28 B;  5I22 A;  3CBM A;  2CP2 A;  1NJI C;  4CI0 C;  3FLG A;  3JCM c;  1QVG A;  4FT4 A;  2MI6 A;  1AHJ B;  1TS9 A;  1PRL C;  5CKB A;  4GLM A;  5KYN A;  4M77 E;  1ZSZ B;  2DXC A;  2DE0 X;  4PJO F;  1N27 A;  4CC3 A;  4LUE A;  1VQ5 T;  5GJV B;  2WAC A;  2EAY A;  1B34 B;  3EHR A;  5GAN 8;  3OYF A;  2DL3 A;  4ZNX A;  4FYV B;  1BKB A;  1KC8 C;  4M7D E;  2VUB A;  3QKJ A;  2RA2 A;  2XDB A;  1VQ6 A;  3QXE B;  2ENM A;  3M9Q A;  1PD1 A;  1SRL A;  4ZGD B;  3C0C A;  1QWF A;  2HNI A;  3TSZ A;  2KYM A;  2RJE A;  2EKO A;  1JBM A;  3QDF A;  2FVU A;  2QK0 A;  4QQG A;  3CXC S;  3I35 A;  4VUB A;  2CH4 W;  3LWH A;  4FYY B;  3L2R A;  3CC4 A;  3SWN C;  1WI7 A;  1ZUY A;  1VYU A;  4OMP A;  4M78 F;  4CC4 B;  3EG0 A;  1NLO C;  2DYI A;  1U1S A;  4FW1 A;  3GOX A;  4M7D B;  1G3Y A;  3ZEH A;  2ZPG B;  2JMA A;  4AT1 B;  2FEI A;  2XD0 A;  1FYN A;  4IUR A;  1EFN A;  2RQT A;  2DF6 A;  3HSB A;  5D6W A;  3WVD B;  2HL5 C;  3E9G A;  4PJO B;  3GNG A;  1WHG A;  3MEV A;  1KK7 A;  4JPB W;  3G4S Q;  4C0Z A;  2WSC E;  3A8O B;  5CK9 A;  2W0Z A;  1HD3 A;  3A8M B;  3JCM g;  1VQ9 T;  1VQ8 T;  1KQS A;  4JLG A;  1AOJ A;  1VQO A;  4F7U F;  4XU2 A;  3VUB A;  3JCM b;  4OMO A;  1N9R A;  4MDW A;  4IUV A;  4XAX B;  1X2K A;  2K3B A;  2YDL A;  2YLB A;  2LJ0 A;  4O5V A;  1VQ4 A;  4JRI A;  2PVD B;  3FJP A;  3E2U A;  4BDY A;  4M78 B;  4AG2 C;  3JB9 G;  2SRC A;  2A3L A;  2DL5 A;  2QA4 A;  1M2O A;  1M5Q 1;  2NUP B;  3CD6 A;  1ZSG A;  1UJY A;  2QQA A;  4N4I A;  3L2U A;  3UT1 A;  5M9O A;  2ROT A;  2AZV A;  1XTD A;  2D0Q B;  1AD5 A;  1RAF B;  1YWO A;  3R6N A;  2D1X A;  1YJW Q;  1VQ7 T;  1B07 A;  2DPP B;  2NYS A;  1AWX A;  2M16 A;  1UB4 A;  1KD1 U;  1WJR A;  2VGN A;  1OX9 A;  2DJQ A;  1N8R C;  1GRI A;  2OTJ T;  3I55 A;  3CCR T;  1D0Z A;  2BTT A;  2K7A A;  4M75 A;  1W4S A;  2DL7 A;  4RUG A;  2X3W D;  4RG8 A;  2O9S A;  5C6S A;  2B8A A;  4K11 A;  1I0C A;  1N5Z A;  5CVI A;  2LJ3 A;  1WXT A;  4M7D D;  2FRW A;  2O4X B;  2R57 A;  1GCQ A;  1NLP C;  1TSF A;  3J81 E;  4R55 A;  2XIC A;  3OBY A;  3CCV T;  4PJO D;  2D6F A;  2NLU A;  2K2V A;  3CXC A;  4F17 A;  1U3O A;  2DTI A;  4PJN A;  2RI5 A;  4L59 A;  1UDL A;  1TOV A;  5KH6 A;  5CKF A;  3SD4 A;  1UEC A;  4AFS C;  3HFN A;  1QWE A;  4C5G A;  3J80 E;  1WFW A;  3VS7 A;  5GAN 4;  4XU3 A;  1G5V A;  1RUW A;  1SKU B;  2V8I A;  1WDX A;  2EYZ A;  1H92 A;  5GMK m;  2P0K A;  2H8H A;  2HL3 A;  1CKB A;  2EQM A;  4ZTF A;  2E70 A;  3L2Z A;  2V1Q A;  1V76 A;  2CUD A;  2X4Y A;  3L2V A;  2RHY A;  4J9H A;  1JO8 A;  1SSH A;  2EIF A;  2QG9 B;  4JJD A;  1VQ9 A;  2JVV A;  2F2V A;  4E47 A;  2FYK A;  4M78 D;  3OYI A;  2DXB A;  3CCQ A;  2KRS A;  1MNE A;  2RJD A;  2O01 E;  4PFP A;  3CCS T;  2JN0 A;  2CZ0 B;  2K79 A;  5GAM h;  1YWP A;  1I07 A;  4XQ3 A;  1I5L A;  1T3L A;  4J6Y A;  2FZC B;  1LJO A;  1M1K U;  1YJN T;  4XK8 E;  2GBQ A;  4BB7 A;  2KRO A;  5GAM g;  2CGH A;  2J05 A;  1X2Q A;  4A54 A;  3O5Z A;  2HBW A;  2EPD A;  2F2X A;  3LW5 E;  4A4H A;  3RES A;  2L3Q A;  3NTH A;  1Y7X A;  3GP8 A;  2DK3 A;  2V1R A;  1K73 R;  1IRX A;  2RI2 A;  2QQR A;  5EG2 A;  3CMA Q;  3CCM T;  4ESR A;  4FYW B;  2BE7 D;  5FU6 B;  3OS0 A;  4JRP A;  4C5I A;  2X4W A;  2QEX T;  4HXJ A;  3LH5 A;  2K6D A;  4PFO A;  1QLY A;  3L1A A;  3LX7 A;  1WXB A;  2P0P A;  1C6V X;  4PL6 A;  3FC3 A;  3CC7 T;  1ZSZ A;  5C0M A;  2XHC A;  3CCU T;  4D8D A;  4LXC A;  1VYV A;  4C92 F;  1B34 A;  2A7Y A;  2GF7 A;  4C5H A;  1LVK A;  4J83 A;  2QTV A;  1X69 A;  2HSE B;  2L3P A;  3PGG A;  5GAN d;  4KUD K;  4GLK A;  4CC2 A;  2HAX A;  2O88 A;  2YUP A;  3CCV A;  5GAN 6;  2CSI A;  2KXD A;  2V8J A;  4QVD A;  4C8Q C;  1M2V B;  1QMC A;  2H3E B;  4IUU A;  1CKA A;  2KK4 A;  4M77 A;  1BCO A;  2D8H A;  3RBB B;  5DLO A;  4PFZ A;  4WTO B;  3GF5 A;  1GCP A;  4KGX B;  4A4K A;  1G8X A;  4ZTJ A;  3CCL Q;  3QBY A;  1SPK A;  1Q82 C;  1OX8 A;  2FHD A;  3GLX A;  1K73 U;  5LJ3 j;  4M7D A;  3CME T;  2I2L A;  3OYB A;  2AT1 B;  1AT1 B;  2KDS A;  2OI3 A;  2ZAE A;  2XI9 A;  4RTW A;  1I4K 1;  5CKE A;  2E3H A;  1MGQ A;  1Y07 A;  1PNJ A;  2EQI A;  1YI2 T;  2D9T A;  1RLQ C;  1MHN A;  1GBR A;  2YUN A;  3KBG A;  1QP2 A;  5KYW A;  1M27 C;  4ANJ A;  3G1J A;  5CKH A;  4QQD A;  2EQU A;  2DYB A;  2HZY A;  1C1A A;  2YT6 A;  1BB9 A;  3CC2 T;  3RNJ A;  1SG5 A;  2VKN A;  4GY5 A;  1ZA1 B;  3M0R A;  1QCF A;  3H0F A;  4B9X A;  5LJ3 d;  3A5Z B;  4HCK A;  3BW1 A;  4R0K A;  4DEY A;  3G4S A;  2NUP A;  2DL4 A;  2DER A;  3PMT A;  1AEY A;  4QQ6 A;  2LT4 A;  1AZG B;  4BI8 B;  4BE0 A;  1NYG A;  3EGU A;  1OU8 A;  2YXY A;  3OYY A;  5L23 A;  3EGD A;  4KH1 B;  2JS2 A;  2DM1 A;  1MMD A;  2CP0 A;  4M7A E;  3V8K A;  5CCA A;  5DM7 R;  3MO8 A;  3PNW C;  2JXB A;  4DBF A;  4IKF A;  1D3B A;  4BE2 A;  1VQK Q;  4LNP A;  1C0M A;  4M77 G;  2PUO B;  4EMK B;  2BKD N;  2KSS A;  5GAO m;  2VVK A;  1UE9 A;  3ZFJ A;  4NL3 A;  1W1F A;  2K2M A;  4TVR A;  3URG A;  2O4X A;  3KXT A;  1YJW A;  3M0S A;  1BI0 A;  4M7A B;  1YNZ A;  2ATC B;  5I2S A;  2HKQ B;  4J7F A;  4OF1 A;  2LQ8 A;  3A8L B;  1WHK A;  4J9F A;  2VXE A;  4N4H A;  3GIB A;  4C92 D;  2M9U A;  1YIJ T;  2MPX C;  3I56 Q;  4Y92 A;  1BYM A;  4XTZ A;  2DTH A;  1QCN A;  4DBQ A;  2G3R A;  2CP3 A;  1NG2 A;  3UF4 A;  2O9V A;  4LDU A;  2DX1 A;  3QWY A;  4DEX A;  2E5K A;  3INZ A;  4Z89 A;  1T0J A;  4JJN K;  1M3A A;  2IPO B;  3TRE A;  1YI2 A;  1RLP C;  4FL6 A;  5LJ5 h;  2BUD A;  2KYB A;  1D0Y A;  3JCM X;  4JZ3 A;  2E41 A;  3CC4 T;  2X3X D;  5LJ5 g;  1M3C A;  2K5F A;  1GXI E;  2DKG A;  1JQQ A;  3SWN B;  3MET A;  3OS1 A;  3OSS C;  3OYL A;  2LJ1 A;  8AT1 B;  4IUQ A;  3OYC A;  2JM8 A;  4HVU A;  2D8J A;  2YSQ A;  1DJ7 B;  1NYF A;  1KQS S;  2DTO A;  1VQL Q;  2PUK B;  1WA7 A;  2RO0 A;  2C0I A;  2R5A A;  1SHF A;  2FZG B;  2RHU A;  1VQO T;  3BFM A;  1VQN Q;  1S72 Q;  5GMK h;  3RUX A;  5GMK l;  3E1S A;  2FPD A;  3CPF A;  4C0D C;  2P0Q A;  2LQN A;  4ELZ C;  3NGP A;  4XU1 A;  1Y57 A;  3OW2 S;  4DBR A;  2CRE A;  1WNL A;  1VQ4 T;  1UG1 A;  3RER A;  2P4T A;  1QKX A;  1NBE B;  2JMC A;  1E6H A;  4C8Q G;  5KYY B;  3VS0 A;  2GQI A;  1BBZ A;  1RL2 A;  1T0H A;  1RAB B;  1XJW B;  4MML A;  3CD6 T;  2MF2 A;  3H0I A;  3H9N A;  4NS5 A;  4KBM B;  4LN2 A;  4BDZ A;  2GFU A;  2CZ7 B;  2K57 A;  1RAE B;  3VKI A;  2PVG B;  3OYM A;  1WHJ A;  2EVR A;  3VS3 A;  4YTL A;  2Y4X A;  3QUI A;  4QVC A;  4JUV A;  1OU9 A;  1I81 A;  3EG1 A;  3C4S A;  2L5Q A;  3CMA A;  3V7R A;  1M1F A;  1Q7Y C;  2MWO A;  2J6O A;  4PLL A;  3RIR A;  6AT1 B;  5KCH A;  1NE8 A;  1VIF A;  1M2V A;  3I55 T;  5DLQ E;  2DIL A;  3EFO A;  3FB9 A;  1YIJ A;  1U8R A;  3QYG B;  4B6M A;  1UFF A;  2EJG A;  1AWW A;  5J39 A;  3L2Q A;  3QYH B;  5IAY A;  4PJO E;  2FB7 A;  2CZ1 B;  3CQT A;  3A1P A;  2RI3 A;  4JS5 A;  1GCQ C;  2EYX A;  4PNO A;  1FWZ A;  3M57 A;  2KGT A;  2HEQ A;  4AFQ C;  4IIM A;  1RI9 A;  4XU0 A;  1U06 A;  2AHJ B;  4OGC A;  1K9A A;  3T9N A;  1IZ6 A;  2VV5 A;  5IN1 A;  4A63 B;  5KCO A;  1LOJ A;  1VQP Q;  3ME9 A;  2RM4 A;  4QVZ A;  4J9B A;  3G6E Q;  3JB9 H;  2A36 A;  4OB2 B;  1YJ9 Q;  1K8A U;  1PD0 A;  3TQ7 P;  3HFO A;  2FRY A;  2KNB B;  3RKW A;  3CCL A;  3UWN A;  1JEG A;  5KYU B;  3VRY A;  1MND A;  5LJ3 f;  5GJW B;  1KD1 R;  4M78 E;  2F69 A;  2RHX A;  4QW2 A;  2DET A;  1OZ2 A;  1NM7 A;  5IXB A;  3TCJ A;  4C0G A;  2LNH B;  1IO6 A;  3CCQ T;  3UDC A;  2LCS A;  3AT1 B;  2E10 A;  5GAN 3;  1Q81 U;  1D0X A;  3D7S B;  3V8L A;  3JAM E;  1B7T A;  3JCM d;  1K9M U;  1W2B P;  1V29 B;  3EH1 A;  4KGV B;  4J8O A;  1OUL A;  3QZ9 B;  4O6J A;  3OW2 A;  3MP6 A;  4KGZ B;  3SDZ A;  3MCA B;  2L3R A;  4F7U E;  2KXC A;  2YUQ A;  1NJI R;  1WJS A;  1WIE A;  3M54 A;  3RMQ A;  2DZ9 A;  4FSS A;  2DBK A;  3M0Q A;  3M56 A;  4A4E A;  1MMG A;  3TVT A;  4BD3 A;  2C06 A;  2DJZ A;  3X20 B;  2CP7 A;  3GPL A;  4C8Q F;  5FRN A;  4EMK A;  5AYF A;  3H41 A;  1OV3 A;  1I1J A;  5A0L A;  1X6B A;  3DB4 A;  4BI4 A;  1SEM A;  3PVQ A;  4F7U B;  1QP3 A;  4WF2 A;  5CIU A; 
#chains in the Genus database with same CATH homology
 1OPK A;  4ORZ A;  4JJC A;  1PKS A;  4D8D A;  1VYV A;  2ECZ A;  3A98 A;  2EYY A;  1M30 A;  5IHI A;  5I11 A;  2M51 A;  2B86 A;  1M3B A;  4OML A;  1X69 A;  4RTU A;  2L3P A;  2HSP A;  4CC2 A;  2O88 A;  3THK A;  2ED0 A;  2YUP A;  2RNA A;  2CSI A;  1SHG A;  2KXD A;  3IQL A;  4HVW A;  3M0P A;  4RTT A;  2L3S A;  2CUB A;  2ED1 A;  3EG2 A;  1MUZ A;  1E7O A;  1CKA A;  1W6X A;  2KR3 A;  4AFZ C;  2HDA A;  2D8H A;  2RPN A;  2EGA A;  3EHQ A;  3RBB B;  1YCS B;  3FJ5 A;  1JXM A;  2ABL A;  1GCP A;  2DVJ A;  2P4R A;  1M8M A;  1SPK A;  1PWT A;  3UA6 A;  1VYT A;  2MOX A;  2KRN A;  2BZX A;  1V1C A;  2PZ1 A;  1K76 A;  1PRM C;  1H3H A;  3REB B;  4OMN A;  2NUZ A;  2OI3 A;  2ROL A;  4RTW A;  4J9I A;  1PNJ A;  2EQI A;  1S1N A;  5ECA A;  2RF0 A;  1RLQ C;  1GBR A;  2YUN A;  2JT4 A;  2HCK A;  2W10 A;  1GL5 A;  1TUD A;  2FG0 A;  4HVV A;  1M27 C;  5FWC A;  4J9E A;  4Z8A A;  4JZ4 A;  1FMK A;  2DYB A;  1AVZ C;  2L2P A;  1J3T A;  3PVL A;  2YT6 A;  4RTV A;  1BB9 A;  1ZX6 A;  2JW4 A;  3RNJ A;  2DRM A;  3I9Q A;  3UA7 A;  2D0N A;  1XOV A;  2VKN A;  2DA9 A;  2J6K A;  2KEA A;  3M0R A;  1QCF A;  3GBQ A;  3H0F A;  3EG3 A;  1WXU A;  1KSW A;  2IIM A;  1NEB A;  4IIO A;  1UHC A;  2M0Y A;  3H0H A;  2JTE A;  1ZBJ A;  3I5R A;  4D8K A;  4HCK A;  4R0K A;  2NWM A;  4DEY A;  4J9C A;  2DL4 A;  1UUE A;  2LX7 A;  2GGR A;  2A08 A;  2AK5 A;  2GTO A;  2OAW A;  1AEY A;  1KFZ A;  1HSQ A;  1TUC A;  2LQW A;  2F2W A;  1AZG B;  1JU5 C;  1UHF A;  4X1V A;  1NYG A;  1X43 A;  3EGU A;  1K0X A;  5L23 A;  1TG0 A;  2JS2 A;  4Z88 A;  2DM1 A;  1QKW A;  3KFV A;  3REA B;  2EGC A;  1SRM A;  2J6F A;  2MCN A;  2KBT A;  1ABO A;  2LMJ A;  1GFD A;  1NEG A;  2JXB A;  2L0A A;  2KT8 A;  2SEM A;  4LNP A;  4LUD A;  1K1Z A;  3TSW A;  2FPF A;  1PHT A;  5I22 A;  2O31 A;  2J06 A;  2VVK A;  2ESW A;  2KE9 A;  1LCK A;  1UE9 A;  4KRT A;  1W1F A;  2K2M A;  2BZ8 A;  2C0O A;  1PRL C;  1PKT A;  4GLM A;  2DNU A;  2DE0 X;  2RQV A;  3M0S A;  4CC3 A;  4LUE A;  1AWJ A;  4RTX A;  5GJV B;  1X6G A;  1YNZ A;  3EHR A;  1G83 A;  2DL3 A;  4ZNX A;  4J9F A;  2JS0 A;  2GNC A;  2ENM A;  1KJW A;  4Y92 A;  1UGV A;  1SRL A;  1UTI A;  4J9D A;  1YP5 A;  3C0C A;  1QWF A;  1NG2 A;  3UF4 A;  2O9V A;  2DX1 A;  3QWY A;  4DEX A;  5EC7 A;  3TSZ A;  2E5K A;  1E6G A;  2KYM A;  4Z89 A;  1T0J A;  1M3A A;  1RLP C;  2KYB A;  3I35 A;  2CH4 W;  4JJB A;  2CSQ A;  1YN8 A;  4JZ3 A;  1WI7 A;  1ZUY A;  1VYU A;  2X3X D;  3NHN A;  4OMP A;  4CC7 A;  4CC4 B;  3EG0 A;  1NLO C;  1M3C A;  3JV3 A;  1ZUK A;  1JQQ A;  3SHW A;  2JMA A;  2FEI A;  2DL8 A;  1FYN A;  2AKL A;  1EFN A;  2RQT A;  2DF6 A;  2YUO A;  2LJ1 A;  2OJ2 A;  3QWX X;  1HJD A;  3U23 A;  4RTY A;  1W70 A;  2JM8 A;  4HVU A;  2D8J A;  2YSQ A;  4JPB W;  2MIO A;  1K0S A;  1NYF A;  2O2O A;  1HD3 A;  2W0Z A;  5IHK A;  2EBP A;  1BU1 A;  1KIK A;  1AOJ A;  2CDT A;  2RMO A;  1WA7 A;  3NPF A;  2C0I A;  5IXF A;  1SHF A;  1B3Q A;  4OMQ A;  3ZL7 C;  4OMO A;  2CT4 A;  1OEB A;  2FPE A;  4AFU C;  2FPD A;  1X2K A;  3VRZ A;  2K3B A;  2YDL A;  2CT3 A;  2LJ0 A;  2LQN A;  2PTK A;  3NGP A;  1Y57 A;  5IHN A;  1ZUU A;  2CRE A;  1UG1 A;  1QKX A;  2JMC A;  3NMZ C;  4LE9 A;  4AG2 C;  2SRC A;  1E6H A;  2DL5 A;  1JXO A;  3VS0 A;  2XMF A;  2GQI A;  1UJ0 A;  2DBM A;  1A0N B;  4RTZ A;  1ZSG A;  1BBZ A;  1T0H A;  1UJY A;  5FWB A;  2ROT A;  2AZV A;  3H0I A;  1G2B A;  3UAT A;  4LN2 A;  1AD5 A;  1YWO A;  2I0N A;  3R6N A;  2D1X A;  1ARK A;  2DLP A;  4F16 A;  1B07 A;  2EVR A;  2GTJ A;  3VS3 A;  1AWX A;  2DRK A;  3EG1 A;  4M4Z A;  2RN8 A;  5HCK A;  2DJQ A;  1GRI A;  3PE0 A;  1H8K A;  2J6O A;  2BTT A;  2K7A A;  4RUG A;  2DL7 A;  3M0T A;  2X3W D;  2DIL A;  2O9S A;  3SEM A;  4K11 A;  1I0C A;  1N5Z A;  2J7I A;  1UFF A;  1AWW A;  2LJ3 A;  1WXT A;  2FRW A;  2RQW A;  1GCQ A;  3VS2 A;  1NLP C;  1MV3 A;  2DMO A;  3CQT A;  1VA7 A;  1GCQ C;  2EYX A;  3M0U A;  4QT7 A;  2KGT A;  2HEQ A;  4AFQ C;  4IIM A;  1RI9 A;  1U06 A;  2AKK A;  2RQU A;  4F17 A;  4F14 A;  1U3O A;  1K9A A;  1UDL A;  2VWF A;  1UEC A;  4AFS C;  1QWE A;  1WFW A;  3VS7 A;  4A63 B;  2EYW A;  1RUW A;  1WDX A;  4E6R A;  2EYZ A;  1GBQ A;  1H92 A;  2H8H A;  4GBQ A;  3ULR B;  1CKB A;  4J9B A;  2A36 A;  1Y0M A;  2FRY A;  2V1Q A;  1MV0 B;  4WCI A;  2KNB B;  5FW9 A;  2CUD A;  1JEG A;  3VS1 A;  3VRY A;  5GJW B;  4J9H A;  1JO8 A;  1SSH A;  4JJD A;  2RQR A;  1NM7 A;  2F2V A;  5IXB A;  2AZS A;  1OOT A;  2A37 A;  2KRS A;  2LNH B;  1IO6 A;  3VS4 A;  1WX6 A;  2LCS A;  1BK2 A;  2LP5 A;  2K79 A;  1YWP A;  1I07 A;  1AZE A;  1T3L A;  4AG1 C;  2QDL A;  2JM9 A;  1T3S A;  1GFC A;  2GBQ A;  1Z9Z A;  2KRO A;  1OPL A;  1CSK A;  3I5S A;  1WLP B;  2PNI A;  2J05 A;  2KRM A;  1K4U S;  1ZLM A;  2EW3 A;  1X2Q A;  2CH4 A;  2K9G A;  2KXC A;  3O5Z A;  2YUQ A;  2HBW A;  2EPD A;  4OMM A;  2F2X A;  1WIE A;  1AWO A;  1WYX A;  2C0T A;  1X27 A;  4FSS A;  2DBK A;  5IH2 A;  4EIK A;  2LZ6 B;  2L3Q A;  2EGE A;  2BZY A;  3M0Q A;  1U5S A;  1Z9Q A;  2V1R A;  3TVT A;  4ESR A;  3VS5 A;  2EKH A;  2A28 A;  1ABQ A;  2FO0 A;  3H41 A;  4HXJ A;  3LH5 A;  1OV3 A;  1I1J A;  2K6D A;  1X6B A;  1QLY A;  3VS6 A;  2G6F X;  2KT1 A;  1SEM A;  1WXB A;  3PVQ A;  4J9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...