2PNIA

Solution structure and ligand-binding site of the sh3 domain of the p85alpha subunit of phosphatidylinositol 3-kinase
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
86
structure length
86
Chain Sequence
GSMSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEAKPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotransferase
molecule keywords PHOSPHATIDYLINOSITOL 3-KINASE P85-ALPHA SUBUNIT SH3 DOMAIN
publication title Solution structure and ligand-binding site of the SH3 domain of the p85 alpha subunit of phosphatidylinositol 3-kinase.
pubmed doi rcsb
source organism Bos taurus
total genus 7
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1993-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2pniA00
2L2PA 4M4ZA 1SHGA 1AZEA 2AZVA 4F16A 2HBWA 2BTTA 1GCQA 2DE0X 2G6FX 2X3WD 5GJVB 2MCNA 4CC2A 3M0PA 2RQVA 1JU5C 2LQNA 2KRNA 2EVRA 1ZLMA 4AG2C 1PHTA 1X2QA 4RTWA 1KFZA 1VYUA 2V1QA 1G83A 4HVVA 1W70A 1AEYA 2I0NA 2JW4A 3UA7A 3NMZC 1Y57A 2M0YA 3H0IA 1BBZA 3EG2A 3JV3A 2BZXA 1WYXA 2DYBA 1VYTA 3REAB 2D0NA 2L3PA 4AFUC 2DL8A 1AWOA 4GBQA 2JS2A 3RBBB 2J6FA 2RMOA 1JXMA 1T0JA 2ED0A 1E6GA 4J9BA 1K1ZA 3I5SA 4IIMA 1GRIA 1QWEA 2OI3A 3VS2A 2DJQA 3IQLA 5ECAA 1NG2A 1X6BA 1X2KA 2RF0A 3TSWA 4ZNXA 1QWFA 1YWPA 1UDLA 2VVKA 2BZYA 2EW3A 4IIOA 1G2BA 2J7IA 1YN8A 2JXBA 4J9HA 2JMCA 2LJ1A 2F2VA 3QWYA 2ABLA 2KT8A 2MOXA 1Y0MA 3SHWA 1EFNA 2KRMA 1AVZC 2LJ3A 2A37A 1Z9ZA 2CSIA 1M27C 1U06A 1UJ0A 2DILA 1H8KA 1AWWA 2KT1A 1TUCA 4R0KA 4RTVA 2LZ6B 1SHFA 3ULRB 1HSQA 2BZ8A 2W0ZA 1I1JA 1YNZA 1JO8A 4AG1C 2L0AA 2OJ2A 2KXCA 2GTJA 2DVJA 1AWXA 4RTZA 2EYWA 5IH2A 4J9IA 1BB9A 3KFVA 5I11A 5GJWB 1GFDA 1AZGB 1T3SA 2CUDA 2EGEA 2RQTA 1X6GA 2DBMA 2A36A 1K76A 1AOJA 1UHFA 3VS7A 2CREA 2EGAA 1M3AA 1RUWA 4HVWA 4CC3A 1UHCA 3GBQA 3PVLA 3M0QA 1JQQA 2FRYA 1M3BA 2KR3A 1WXBA 2D8JA 4J9FA 4HXJA 2CSQA 3R6NA 2EYYA 1K9AA 5FWCA 5HCKA 2YUNA 3M0SA 2AKLA 2L3QA 2RNAA 3VS5A 2JM8A 3RNJA 2C0IA 2O9VA 2RQRA 3UATA 4Z89A 1E7OA 3VRYA 4Y92A 2E5KA 1GCQC 1PKTA 4QT7A 1MUZA 1ZUYA 1UECA 5IHNA 4KRTA 1B07A 1S1NA 4DEXA 4DEYA 2C0TA 2K79A 4RTYA 4K11A 4D8KA 2J05A 2FPDA 4JJBA 4LN2A 3FJ5A 1M8MA 3NPFA 3VS3A 2AKKA 1FMKA 1QCFA 2IIMA 2PNIA 2DF6A 1YWOA 2CH4A 3EG3A 1BK2A 2FO0A 2JMAA 3TVTA 1OPKA 2PZ1A 3C0CA 4JPBW 2KNBB 4RUGA 2H8HA 2HDAA 1LCKA 2F2XA 1KJWA 4F17A 2CUBA 1X43A 2KBTA 1YCSB 1ZX6A 2JT4A 2K2MA 1WXUA 2XMFA 3ZL7C 1WDXA 2L3SA 1SPKA 5IXFA 1TG0A 1K0XA 3THKA 1V1CA 3REBB 3VS1A 3UF4A 2PTKA 2EYXA 2K6DA 4OMLA 2DRMA 1IO6A 2EPDA 1AWJA 4HVUA 1TUDA 2GQIA 4OMQA 1VYVA 1CSKA 2J06A 4WCIA 2YUPA 4JZ4A 4JJCA 2HSPA 2ROTA 3M0UA 3I5RA 1FYNA 2CT3A 4JZ3A 1OEBA 2RQWA 2DL5A 1JXOA 3U23A 1B3QA 1NYFA 1ZUKA 1GFCA 1HJDA 1PRMC 4AFZC 4J9EA 1W1FA 2KXDA 2QDLA 1OPLA 1UE9A 4RTUA 4OMNA 2ECZA 2KEAA 2RQUA 2EKHA 4RTXA 2CDTA 3I35A 1AD5A 3TSZA 2DM1A 4GLMA 1QKXA 2YDLA 1SRLA 1RLPC 2O88A 2FRWA 2X3XD 3H0FA 2DLPA 1OV3A 2FG0A 4LNPA 1CKBA 1H92A 2D1XA 1KIKA 2A28A 2GNCA 1T3LA 2DL4A 2HEQA 4HCKA 1H3HA 3A98A 1SEMA 4E6RA 1UGVA 1NLPC 2LJ0A 4J9GA 1W6XA 2LP5A 2NWMA 2P4RA 2F2WA 3VRZA 2LX7A 1HD3A 5FWBA 1KSWA 1NM7A 2JM9A 2KROA 2GGRA 5IHKA 1MV3A 2JS0A 3QWXX 1J3TA 1PNJA 4A63B 1WI7A 2ENMA 2DRKA 1T0HA 1GBQA 4LUDA 2V1RA 1CKAA 2KRSA 3M0TA 2DL7A 5IXBA 1ZUUA 2VWFA 1NEBA 1RI9A 1UG1A 2DL3A 5FW9A 3VS0A 1WFWA 1N5ZA 2AK5A 2YT6A 2O2OA 2LQWA 3H0HA 2W10A 1WLPB 4LUEA 4Z8AA 1E6HA 2RPNA 2SEMA 3EG1A 4CC7A 3I9QA 4AFSC 1WXTA 2LMJA 3NGPA 5L23A 5IHIA 1OOTA 2ED1A 1BU1A 1ARKA 1SRMA 1NYGA 2M51A 4J9DA 4OMOA 2KE9A 1MV0B 2A08A 2AZSA 1QKWA 2ROLA 1M30A 4OMPA 3VS6A 3EG0A 3SEMA 1WA7A 2O31A 2GBQA 1NLOC 1PRLC 2YUOA 2YUQA 1ZBJA 1WIEA 2D8HA 2B86A 1ABQA 1UUEA 2O9SA 4AFQC 2KYBA 1WX6A 2HCKA 2JTEA 3LH5A 1GBRA 4EIKA 3EHQA 3PVQA 1K0SA 1VA7A 2DX1A 2C0OA 4F14A 2VKNA 2DNUA 1ABOA 4ESRA 2J6KA 2EBPA 4FSSA 2K7AA 1Z9QA 4Z88A 2DBKA 2GTOA 1I0CA 2FPFA 3M0RA 2RN8A 5EC7A 1X27A 4ORZA 1GL5A 2YSQA 4RTTA 1UTIA 1M3CA 3NHNA 2EYZA 3PE0A 4D8DA 1X69A 2EGCA 2FPEA 2EQIA 2CT4A 2J6OA 1GCPA 1UFFA 1YP5A 1U5SA 1PWTA 1SSHA 1ZSGA 5I22A 1U3OA 2ESWA 1A0NB 2NUZA 4X1VA 4J9CA 4LE9A 2LNHB 1PKSA 2FEIA 1UJYA 4JJDA 2MIOA 2DA9A 3CQTA 2OAWA 3UA6A 2KGTA 3EHRA 3VS4A 1I07A 4OMMA 2CH4W 2SRCA 3EGUA 2K3BA 1QLYA 2LCSA 1K4US 1NEGA 2K9GA 2DMOA 1RLQC 1JEGA 1XOVA 4CC4B 3H41A 2KYMA 3O5ZA
chains in the Genus database with same CATH superfamily
3AT1B 5IAYA 3MP8A 4MZTA 3G4SA 3V7SA 2DTIA 3M0PA 2NUPA 3DLLA 4C5EA 1ZLMA 3OA6A 1TUGB 1VQ7T 2RI2A 3HTRA 4J5YA 4XAXB 2RJCA 2I0NA 4BD3A 4FW1A 2LQKA 3JV3A 2BZXA 1WYXA 3HRSA 1U8RA 4DOWA 1YJNT 1VYTA 4OMFB 1D09B 1M9SA 3E19A 2A7YA 2VC8A 2DL8A 4GBQA 4DBFA 5GAMg 2VV5A 3OSSC 1VQMQ 4LD9K 1JXMA 1C6VX 1T0JA 3MEVA 3JCMe 4J9BA 4M77E 3L2ZA 2B8AA 3OYGA 1NBEB 5D6XA 3EH1A 4XTYA 3WXMB 1QWEA 2OI3A 4N4GA 2DJQA 4ATOA 3HL8A 1X2KA 4FT4A 2NUTA 3KBGA 1WJRA 4RG8A 1Q81C 3TSWA 1P92A 1ZSZC 1YN8A 2LT1A 2JXBA 1QVFS 4XU2A 4J9HA 4M75F 4FCYA 1X01A 3QPHA 1EFNA 2QI2A 1AVZC 1PM3A 2A37A 2O4XB 5FU6B 5GAOp 4E7ZA 1QVPA 4XTZA 2DILA 5GAMj 1SF9A 1Q86U 3EGDB 2KDSA 2LZ6B 5KYXA 3G4ST 2YRVA 2BZ8A 1JJ2S 3CMAA 2W0ZA 1I1JA 4AG1C 1YIJA 1QW1A 1YJWA 2P4TA 5GAMd 2GTJA 5LL6S 3OYDA 3I55A 2EWNA 5KH6A 1M1GA 3NTHA 3RESA 1N9SA 2CUDA 2RJFA 2DETA 1BKBA 2EGEA 2DEQA 1YJNQ 1NE8A 1DJ7B 3VS7A 2EGAA 1UHCA 3PVLA 2MAMA 1M3BA 2MMPA 4PJLA 4JRIA 5C0MA 2YUNA 5GAOl 5CQXA 2AKLA 3JRZA 1VQOT 4KBMB 2L3QA 4E2FB 2RNAA 2DAQA 2MF2A 1BI3A 2ZPGB 4Q5WA 3OW2S 5GAOn 5GAMe 3HFOA 2E5KA 3UWNA 4F04B 1KC8C 1TXQA 1ZUYA 4KRTA 4DEXA 1S1NA 1Y71A 1W2BP 2XG8D 3QUIA 2K79A 3DB3A 3HRUA 4RTYA 3PFSA 4D8KA 2J05A 4JJBA 1K73C 3GF5A 3MCAB 2DPPB 2IPOB 4PJOD 1B34B 4J83A 1FMKA 5KYWB 4KUDK 3M4GA 1YWOA 4KGXB 3PGGA 4A53A 5KYNA 3C0CA 2KNBB 2H8HA 2HDAA 2LDMA 4B6MA 4F17A 2CUBA 1X43A 4XTXA 5GAN2 5GMKe 1Q7YR 2DFUA 4JRKA 1VQ6T 1D1AA 1WQ7A 3REBB 3VS1A 3CMAT 2FL7A 5GAN3 3PMTA 3OYBA 1RACB 2A3LA 2NLUA 3JCMh 1YJWT 3CCUA 1JBMA 3EG9B 1QVGP 2CP2A 4OMLA 4D6WA 3I55T 2VUBA 2EPDA 1WQWA 1AWJA 4JS4A 4PFPA 4OMQA 2V8IA 2J06A 4C5IA 3CMEA 4OGCA 5CK9A 2ROTA 3X24B 1R0BG 1XNIA 2CT3A 2VXEA 4JZ3A 2P84A 2GF7A 1VQOQ 1B3QA 4M77D 1ZUKA 1N8RC 4AFZC 5FRMA 3CXCS 2QDLA 4OMNA 3MJXA 4C5GA 5IT9E 3CBMA 1TOVA 2I2LA 3PIOA 1AD5A 3TSZA 2DM1A 1ZBXA 1SRLA 1WPYA 4BUGA 3EGXB 2XDBA 1YHQT 3UT1A 1UGSB 2D1XA 2HQXA 1H92A 2QG9B 3TQ7P 4M77A 3CBPA 1M90C 2GNCA 3JCMQ 2R5AA 4HCKA 1H3HA 1R77A 3A98A 3QG1A 3HSBA 1NLPC 1MNDA 2LP5A 3G1JA 2P4RA 4M77G 1KSWA 1NM7A 4LDYA 3CCMA 3E2UA 4BY6B 1BI0A 1LJOA 5IHKA 3M56A 1Q82U 1VQ6Q 3CMAQ 4RCCA 1PNJA 1WI7A 2ENMA 2V1RA 1BI2A 3S3MA 1MNEA 2L5QA 3F70A 2DXBA 4M78B 5LJ5e 2RHXA 3CCUT 3VJPA 4QVCA 1Y07A 2FZKB 2CGHA 2COWA 1I5OB 1TU0B 4Z8AA 1TWBA 3OB9A 2EQJA 3E1SA 3V8JA 4RCBA 3CMET 3FC3A 2SEMA 2PVGB 3GOXA 3I9QA 4C0DC 2K3XA 4IUUA 3NGPA 5IHIA 4JDSA 1SRMA 2M51A 5C6SA 3BE3A 3SWNB 1MV0B 3L2WA 2AZSA 1QKWA 4BI8B 2F5TX 1WA7A 2YUOA 3CCVA 1YHQQ 4M7AC 3QBYA 2X4XA 5D7UA 4EPCA 3J81E 1U1SA 2RM4A 2D8HA 2B86A 3MHXA 4F7UB 2OTJT 2F69A 1Q81U 1VQPA 3LH5A 1G3YA 3RR6A 1Q86R 3EHQA 1O9SA 3PVQA 3OS0A 3BY7A 1VA7A 1VOMA 2QQBA 1Y7XA 2VKNA 2DNUA 2M9UA 2O4XA 4J7IA 4M78E 2EBPA 4FW2A 2COYA 3CCMT 4RMOA 1I0CA 3CCET 3SD4A 5EC7A 4X9DA 4ORZA 4RG2A 3LWIA 2KMTA 2EYZA 2JTFA 1HYOA 2FPEA 1V76A 1ZSZB 4HT8A 4M75D 2JZ2A 3CCQA 2V26A 3JB9G 3CMEQ 1YP5A 1U5SA 1F1BB 1PWTA 1SSHA 3G71A 3HPWA 2ESWA 5HY6A 2L3RA 2F1LA 1XQHA 3P8DA 1SKUB 2QA4A 3CD6A 2M0OA 1PKSA 2X4WA 1UJYA 3VUZA 4F7UE 3OBWA 2L8DA 2OAWA 2E12A 5DLQE 4N0AC 2LVMA 1WHJA 2CH4W 3QYHB 1OX9A 2SRCA 2RK2A 2K3BA 3JB9I 2OTJQ 3CCVT 4DQ2A 1RLQC 1H641 4CC4B 4M75G 1IB8A 3QJYA 1AZEA 2JJ9A 2YRCA 5GANg 1D3BB 1GCQA 5FU7C 1B34A 1ZHIA 4PJNA 3RKWA 1K73U 3QIIA 2MCNA 1KQSP 5KYWA 3DLMA 2RQVA 1JU5C 2KRNA 2HQEA 4KGZB 3CCEQ 4EMGA 2HL5C 4FM4B 1VYUA 1MHNA 4ZN1A 1G83A 2NYSA 1W70A 2KK4A 2JW4A 4BDYA 4UC4A 3KUFA 1LPLA 1N9RA 1I81A 3NMZC 1QCNA 5M9OA 2M0YA 1TTHB 2PVOB 3EG2A 2IG0A 3LLRA 2RHUA 3C12A 2DYBA 2MWPA 1W2BA 3DKMA 1VQ9T 3X28B 3EG9A 2L3PA 3QZ5B 3PNWC 4E7KA 2MYSA 3CCJA 3FLGA 3CCQT 4Y91A 5GANj 4M77F 2ED0A 1E6GA 5A0GA 2DXUA 2K4YA 4BE1A 3G71T 4J7FA 2DKGA 4IIMA 3VS2A 1NG2A 2ZAEA 5GAN6 1QP2A 5GANd 3WVDB 1QWFA 3CD6T 1YWPA 1YI2A 3GNFB 4M7DB 1UDLA 1N8RU 1BCMA 3INZA 1M1KU 2JMCA 2ABLA 3FRNA 2MOXA 1KD1R 2ZCFB 1QVGA 1XTDA 2KRMA 2AT1B 1Z9ZA 1M27C 2KY9A 8AT1B 2QEXA 4E7LA 3OYLA 1IXDA 3EGXA 1BCOA 3QJ6A 1H8KA 2KT1A 1TUCA 4PFOA 3M57A 3ULRB 1IZ6A 1C1AA 3FB9A 2DJZA 1YNZA 1JO8A 1FX7A 2RB6A 1VQ5A 5KE2A 2L0AA 2OJ2A 1M90U 3PTAA 5GANe 1AWXA 5CVIA 5KYYA 2CP7A 4NOYA 2EYWA 5IH2A 1BB9A 2GQVA 2OTLA 2QYZA 1RADB 1G3SA 2RHYA 1GFDA 1T3SA 1D0YA 4OP0A 2LT4A 3OYMA 3EFRA 1X6GA 3M53A 1VQ9Q 1HXDA 1UHFA 2CREA 5CKBA 5CKDA 1M3AA 5CKEA 2BKDN 3GBQA 3QKJA 3UDCA 3GIBA 2D8JA 1RL2A 4ZGEB 2CSQA 4M78A 2EYYA 4M7DE 5FWCA 3FIFA 3M0SA 3CCJT 1FXXA 3EH2A 4GLKA 4M78G 3C95A 2O9VA 3N5BB 4JLGA 1W4SA 2RQRA 1KHIA 3M59A 3VRYA 2DIGA 2DXTA 4MZMA 2YLBA 3RMSA 5IHNA 1UECA 2CZ6B 3X26B 1WHHA 2LTOA 4LN2A 3FJ5A 3BDLA 1FMVA 1Q81R 1VQLA 1M8MA 3SWNA 1VQ8A 2VGMA 3JB9F 2RO0A 4MMKA 5DM7R 2DF6A 1ZQ1A 2CH4A 3EG3A 4LDVA 3ZFJA 1X75C 1IREB 3LGFA 1OPKA 3TVTA 4R56A 4N4HA 2EIFA 2E65A 4F7UA 1LCKA 5GAN5 2QEXT 2F2XA 1IGUA 1KJWA 1BIAA 2DYIA 4C0DB 2XMFA 3ZL7C 2OX7A 5IXFA 1TG0A 4F7UG 3V8KA 3BW1A 3GNGA 2K6DA 2YXYA 3OYJA 4JJNK 1IO6A 4E7HA 1M2VB 1G8XA 5LJ3f 1PSFA 1YJ9A 1VYVA 4JUVA 2OTLT 2OAUA 4WCIA 4E7JA 2YUPA 3MKDA 2HSPA 3LW5E 3X25B 3I5RA 1O75A 2R58A 2FYKA 1KG1A 8ATCB 3U23A 1NYFA 1ZSZA 1JB0E 3JCMX 1M8VA 4C92B 1K9MC 1OPLA 4X34A 3PMIA 2ECZA 2P0QA 2RQUA 4RTXA 3I35A 1VQ7Q 4C0GA 5LJ3g 1QMCA 1MMGA 1RLPC 2O88A 4NL2A 4P5NA 2DLPA 2FG0A 4PLIA 1VQ4A 3URGA 2DERA 1KC8R 5AT1B 4OVAA 2GFUA 1VQNA 3LYIA 1K73R 2HEQA 1KQ2A 3SFMA 5D6YA 2QEXQ 1UGVA 3CC2A 2NWMA 3CC4A 3VRZA 1HD3A 2JM9A 2KROA 2LCCA 4XTUA 3H6ZA 1J3TA 3JCMc 4A63B 1D3BA 1WJQA 5LJ3j 3I56A 1CKAA 2KRSA 3M0TA 2MI6A 3J7AF 1D0XA 4A4EA 1JRIA 2VWFA 5LJ3d 4J6YA 4MZPA 4C92E 1NJIC 1WFWA 4ELZC 2QTXA 2YT6A 3MEWA 2BE7D 1YJ9T 2W10A 2COZA 2V8JA 4EMKB 4M7DD 2L89A 2RPNA 4DOVA 2DZCA 2RI3A 3BDUA 3G4SQ 1VIFA 3M4YA 4B9WA 4C8QB 2E10A 2QGGA 1NYGA 1UEBA 1KQSA 2A08A 1M30A 3EG0A 3SEMA 1NLOC 4OB1B 1NPRA 2JN0A 1M5Q1 2YUQA 1ZBJA 2EJ9A 1YIJT 4E47A 4L6V5 4ME7A 1UUEA 4AFQC 4M7DA 1WX6A 2HCKA 4PJOC 1PD0A 3RDVA 1VQ4T 4EIKA 4O5VA 3EAEA 1VQNT 1K8AC 2XDDA 2E41A 2PQWA 4M7DG 3FEOA 2C0OA 3JB9J 1ACMB 4X9CA 4M78F 1M90R 4PL6A 2K57A 4FSSA 5KCHA 1M1KC 1Y96B 2K5IA 2DBKA 3ZBDA 4A4KA 2O01E 5CAIA 3M0RA 1X27A 2G3RA 1GL5A 2XK0A 1M3CA 3E9GA 2HKNA 4XU1A 2EQIA 4QQDA 3MEAA 2DTOA 3G6EA 5HKCA 2ZPBB 1G3WA 1MMAA 4C8QE 3GLXA 2Y4YA 4DBHA 3HP9A 3P8BB 3CCRA 2RJEA 2LNHB 3QYGB 1OZ3A 4M77C 2MK5A 2KVQG 4F7UF 4ANJA 3QO3A 1LVKA 4JJDA 2MIOA 3CEYA 3O8VA 5J3BA 3UA6A 1RAHB 4PJJA 1YIJQ 1YJWQ 1I07A 2LQ8A 3I55Q 3EGUA 3RIRA 1RAAB 1K4US 3HFNA 1XOVA 3O5ZA 2DVEA 4OGEA 1YCYA 1XJWB 5GAMh 1SHGA 2AZVA 4F16A 4JS5A 2EFIA 2XD0A 1EZZB 3RUXA 1PC0A 3T9NA 2DTHA 2EVRA 4AG2C 3CC7A 1PHTA 1X2QA 4FL6A 4EMHA 3CPWP 2DO3A 1YITA 3JCMV 2K2VA 2V1QA 4A4FA 3OSVA 4KUIA 4HVVA 1AEYA 2VXFA 3UA7A 2Z0WA 1D0ZA 1Y57A 3EFSA 3ER0A 3H0IA 1R0CB 1BBZA 4C92D 2CP6A 3OY9A 2QQRA 3ASKA 2EAYA 1I8FA 2XICA 4PK4A 5GMKh 1TH7A 1H3ZA 3QHSA 3JB9D 1QVFP 1M2VA 5A0LA 2J6FA 2RMOA 2M02A 1SG5A 3AHUA 3RERA 1GRIA 1MMNA 5ECAA 2XDPA 3MP6A 2RF0A 3CCRT 4ZNXA 1YFNA 3JCMP 4C92A 2CP5A 2VVKA 2FZCB 3L2QA 1JJ2P 2EW3A 1UGRB 1VQKA 1G2BA 2J7IA 3EGDA 2E70A 1S72A 1K9MU 5FU6C 2FVUA 2EJGA 2LJ1A 2F2VA 1RI0A 4C92G 3CCUQ 1Y0MA 2LRQA 2A0FB 2PUOB 3LGLA 3SHWA 3OMGA 2LJ3A 4XU3A 1MGQA 2CSIA 2CZ1B 4V2SA 3FDRA 1OYXA 3M5AA 4OB0B 1AWWA 2QGFB 4R0KA 4RTVA 4ZGDB 1SHFA 3CCSA 4WTOB 4A4HA 5GAOq 1HSQA 2EQKA 1WHGA 4BI4A 3QZ9B 1IGQA 5J26A 2KXCA 2HD0A 1KQ1A 1WHLA 2IVWA 1YITT 4QKUA 2AHJB 3KFVA 2CZ7B 4O6JA 5CO7A 3A8OB 2X4JA 3OW2P 2WSCE 2RQTA 2A36A 4HCCA 1K76A 1AOJA 4AT1B 4C8QD 1RUWA 4ELYC 4CC3A 2HMAA 1LNXA 2FRYA 3H9NA 4NS5A 1N6AA 1OZ2A 1QQJA 4J9FA 3R6NA 4M75C 4M7DF 4IUQA 4N0AA 5HCKA 4MMLA 1NJIU 5LJ5h 2JM8A 3RNJA 1VQPT 3CCRQ 4EMKA 4Z89A 4LD6A 5FROA 1I5LA 3CCMQ 3PT9A 1GCQC 3ZEHA 1C0MA 3OYCA 1PKTA 3VYGA 2GCXA 4DEYA 2C0TA 4Y28E 1AT1B 1UGQB 4C8QA 4K11A 2FPDA 2RK1A 3NPFA 1S72T 2AKKA 2JNGA 5GAN4 4GY5A 1VQMA 5GAOm 4C8QG 2PNIA 2EKOA 5KYUB 4IUTA 3L42A 2Y4XA 2FO0A 2CKKA 4JLIA 2PZ1A 3OS5A 2ZPIB 3RMQA 4JPBW 2P0KA 2HZYA 4RUGA 2HKQB 2F5KA 1IRXA 2KBTA 1YCSB 2HQHA 1ZX6A 2JT4A 2K2MA 1VUBA 1W2BS 3S3OA 2DEUA 4DBQA 1WDXA 5A2QE 1SPKA 4PFZA 4IKFA 3L2UA 3THKA 3JCMW 1V1CA 3CXCP 2PTKA 1K8AU 1OQKA 3ME9A 1B7TA 2QA4T 2DRMA 4XU0A 4A54A 1Y96A 1TUDA 4EDUA 2GQIA 4QVZA 1CSKA 1BIBA 2H3EB 4JJCA 3CCVQ 1TS9A 3M0UA 1EIFA 3JCMf 1FYNA 2X4YA 2HNIA 1D1BA 1OEBA 5L8RE 2RQWA 3OBYA 4PJOB 3LX7A 4KGVB 1GFCA 1PRMC 1G3TA 1VQPQ 2KXDA 3OYAA 5GMKi 4RTUA 4C0FA 2QQ9A 1QVGS 1Q82R 4M78D 3X20B 4GLMA 4BDZA 1QKXA 1HK9A 2YDLA 3WVEB 1MMDA 3CPFA 4QQ6A 3JCMg 2FRWA 1SSFA 2X3XD 3H0FA 3OS1A 3JAME 3Q1JA 2X9HA 4LNPA 1G5VA 2HBPA 2A28A 2WSEE 4C5HA 2E64A 4BY6C 1OU8A 2DIQA 3VYHB 4IUVA 1T3LA 2DL4A 1SEMA 4E6RA 3LH0A 1D1CA 3CCQQ 4J9GA 4XK8E 2F2WA 2LX7A 5FWBA 4QW2A 3C94A 2E3HA 4E7IA 3G71Q 2ZZDA 2GGRA 2JS0A 1EX4A 2WACA 3SB2A 4M77B 1GBQA 2DRKA 4LUDA 2QA4Q 2QK0A 3CD6Q 3UPUA 4II1A 2DL7A 2RHIA 5IXBA 2M1HA 1ZUUA 1NEBA 4PJOE 3VS0A 4C92F 1ZA1B 2ZPHB 4BE0A 4BACA 2D6FA 1YI2T 2FB7A 2M16A 2D9TA 4LUEA 3JCMd 1E6HA 3GP8A 4KH0B 2HSEB 2K5FA 3JB9H 3R6OA 3SWNC 5D6WA 4CC7A 5GAMf 4AFSC 1WXTA 3QDFA 1OOTA 2ED1A 4ZTJA 3FJPA 3NFCA 1ARKA 4J9DA 4FYWB 4OMOA 4OMPA 4PLLA 3VS6A 1K9MR 3L2VA 2O31A 3CPWA 1PRLC 2E6NA 2QQAA 5GMKl 1VQ5T 2QASA 2QAZA 3J80E 1VQOA 2KYBA 3CPWS 2XI9A 2JTEA 4M7AB 1GBRA 4HKEA 1K0SA 2XU8A 2MPXC 4F14A 2RHZA 1RAEB 1QVFA 4HT9A 3CCJQ 4ESRA 2D0QB 2K5LA 1BI1A 4OB3B 4R55A 2K7AA 3A5ZB 1OX8A 4JRPA 4Z88A 3EFOB 2ZGWA 1V29B 2FPFA 2RN8A 3HRTA 2YSQA 3DB4A 3CCLA 4VUBA 5KCOA 3M54A 1X69A 2EGCA 2WSFE 1YI2Q 2CT4A 4BE2A 2J6OA 2BIVA 4BB7A 2PVDB 1JJ2A 1BYMA 4C8QF 1WGSA 1GCPA 1ZSGA 2E3IA 5GANh 5I22A 1U3OA 1UB4A 2E6ZA 1NJIR 4LDWA 1VQ6A 1VQLT 4N4IA 1VQ8T 2DK3A 4OB2B 1U1TA 4X1VA 4BI3A 2FEIA 4XTWA 2RH2A 1AHJB 2CZ0B 4LDXA 4L59A 4MDWA 2AIRB 2ATCB 2DA9A 2KQWA 4M7AE 2KGTA 3VS4A 1VQ5Q 2KAFA 4OMMA 2PU9B 3TCJA 2E5QA 5CIUA 5I2SA 3MP1A 2LCSA 3VUBA 1NEGA 2X35A 4LXCA 2DMOA 1JEGA 2OTLQ 3H41A 3V7RA 2KYMA 5GMKj 2L2PA 3OW2A 2XIDA 4M4ZA 3QXEB 2HBWA 1OU9A 3TREA 1QCOA 2BTTA 2VGNA 2DE0X 2G6FX 2X3WD 5GJVB 4M75B 4CC2A 2LCLA 5I21A 2LQNA 5KYUA 2JTMA 4RTWA 1KFZA 1YHQA 1K8AR 5FU7B 2DD4A 1QP3A 5LJ5f 1M4ZA 4J6XA 5GAOr 4CI0C 2Y90A 3P8HA 1N8RR 2H3JA 2GFAA 3M9QA 5DLOA 1M1KR 4KT0E 2E1HA 3CCLT 2KSSA 1KQSS 4FSXA 1YBYA 3REAB 2D0NA 2VB6A 5LJ3e 4AFUC 1VQLQ 3OYIA 2XKOC 1AWOA 2JS2A 1VQ8Q 3RBBB 4HCBA 3A8MB 3OYHA 3V8LA 2CS7A 5LJ5g 1K1ZA 1WNLA 3I5SA 4M7DC 3IQLA 1X6BA 4PJOA 3CC2T 3A8GB 3CC4T 4JRQA 2BZYA 2CP0A 4IIOA 2MWOA 5A0DA 4PJOG 1RABB 1WHMA 2DD5A 3QWYA 2KT8A 3CXCA 4M75E 4FIBA 3I56T 2ZPEB 4HA8A 2PUKB 2QTVA 3KXTA 2FZGB 4XQ3A 1YJ9Q 1N27A 3MEUA 1Q7YC 1U06A 1UJ0A 1R8OB 2XHCA 3A1PA 5LJ5j 2YRDA 4DBRA 2BE9B 4IURA 2DVJA 1OI1A 3L2RA 4RTZA 2OTJA 2RA2A 5LJ5d 2P0PA 4J9IA 3OYNA 3D7SB 5I2MA 3VKIA 4L5GA 5I11A 2C06A 5GJWB 3CCLQ 1AZGB 5FLXE 3S3NA 2DBMA 5GAN8 1X6OA 3LWHA 1KD1U 5AYFA 4HVWA 7AT1B 3M0QA 1JQQA 3OS2A 3RKYA 3MO8A 2KR3A 1M2OA 1WXBA 5KYYB 1PCXA 1VQ4Q 4HXJA 1PSEA 3HKSA 2EJFA 1WJSA 1VQNQ 3CCEA 1K9AA 3QDRB 3GPLA 2E4HA 3VS5A 1OULA 3CC2Q 2C0IA 3UATA 3C4SA 2KI7A 3CC4Q 1E7OA 3HHTB 4KULA 2X51A 4Y92A 3S6WA 4OF1A 4M7AD 3M58A 1KK7A 4QT7A 1MUZA 9ATCB 1B07A 4B9XA 3G7ZA 3I56Q 3JSCA 5CCAA 2LNVA 3H8ZA 3PIPA 3MPUB 3VS3A 1IHVA 2NUPB 1QCFA 2IIMA 1IHWA 4A4GA 4LDUA 5GAN7 1BK2A 2JMAA 1RAFB 4PJMA 3G6ET 3NTKA 3QSUA 1RAGB 2EQMA 4FU6A 4QVDA 4M7AA 2R5MA 1WXUA 5LJ3h 2L3SA 1K0XA 4ZGJB 1ZA2B 1RAIB 3UF4A 4QQGA 6AT1B 4M7AG 2EYXA 2JVVA 3OMCA 2QXFA 3EFOA 4HVUA 5HK0A 4JZ4A 4E7SA 1NZ9A 4C92C 4NL3A 5HK3A 2DL5A 2DXCA 1JXOA 2NUTB 1HJDA 3OYFA 4J9EA 4PNOA 1W1FA 3BFMA 2QQSA 1UE9A 3TEEA 2KEAA 4XTVA 5GMKm 2EKHA 1NPPA 2CDTA 5CKHA 3OQ5A 3RKXA 1VQ9A 3CC7T 1Q86C 2R57A 1FWZA 1OV3A 3L1AA 1PG5B 1CKBA 5KYXB 1KIKA 5CQYA 2CYZB 4PKCC 2EQUA 3TU4K 3VV0A 3G6EQ 2YWWA 4ZTFA 2YLCA 2LJ0A 1W6XA 5GANf 1MV3A 1Q95G 2V8KA 3QWXX 1T0HA 4FT2A 4M75A 3V7CA 4PJOF 1RI9A 1WHKA 1UG1A 2DL3A 5FW9A 4EMKC 1UGPB 2YHTA 1KC8U 1N5ZA 2AK5A 3H0HA 2O2OA 2LQWA 1WLPB 2BUDA 2ZPFB 4DA4A 1VQKT 2DZ9A 3NTIA 4C8QC 4Z02A 3CBOA 2RJDA 4YTLA 1WZOA 2LC4A 3A8HB 5CR2A 1PD1A 3EG1A 4ZN3A 4WF2A 2VYTA 2LMJA 5L23A 1BU1A 3VU3C 2KE9A 2ROLA 4FYYB 4HCZA 3CC7Q 3CCST 2GBQA 1YITQ 3OYEA 1LOJA 1WIEA 4MDXA 1ABQA 2O9SA 2HAXA 3OYYA 2LX9A 1FMWA 3A8LB 2DX1A 1VQ7A 3OYKA 5DY9A 1ABOA 3JCMJ 2J6KA 3E9FA 2EYQA 1Z9QA 2GTOA 4RKUE 2JUFA 2JOYA 1Q7YU 4RTTA 1UTIA 3NHNA 1TSFA 3PE0A 2K3YA 4D8DA 1YJNA 4FYXB 2RD1A 5FRNA 1GXIE 1KHCA 1VQKQ 1S72Q 4KH1B 1UFFA 4FYVB 5CKFA 2RI5A 2FHDA 1A0NB 5EG2A 2NUZA 1I4K1 4CRIA 1VQMT 4J9CA 4LE9A 4J8OA 4IUPA 5J39A 3CCSQ 2HL3A 3META 4TVRA 1KD1C 4M7AF 4J6WA 3CQTA 2CP3A 3EHRA 3JCMb 4M78C 5IN1A 3M55A 1M1FA 4AMCA 4C0ZA 2QDYB 5KE3A 1QLYA 1VIEA 2K9GA 2VASA 3SDZA 1Q82C
chains in the Genus database with same CATH topology
2L2PA 4M4ZA 1SHGA 1AZEA 2AZVA 4F16A 2HBWA 2BTTA 1GCQA 2DE0X 2G6FX 2X3WD 5GJVB 2MCNA 4CC2A 3M0PA 2RQVA 1JU5C 2LQNA 2KRNA 2EVRA 1ZLMA 4AG2C 1PHTA 1X2QA 4RTWA 1KFZA 1VYUA 2V1QA 1G83A 4HVVA 1W70A 1AEYA 2I0NA 2JW4A 3UA7A 3NMZC 1Y57A 2M0YA 3H0IA 1BBZA 3EG2A 3JV3A 2BZXA 1WYXA 2DYBA 1VYTA 3REAB 2D0NA 2L3PA 4AFUC 2DL8A 1AWOA 4GBQA 2JS2A 3RBBB 2J6FA 2RMOA 1JXMA 1T0JA 2ED0A 1E6GA 4J9BA 1K1ZA 3I5SA 4IIMA 1GRIA 1QWEA 2OI3A 3VS2A 2DJQA 3IQLA 5ECAA 1NG2A 1X6BA 1X2KA 2RF0A 3TSWA 4ZNXA 1QWFA 1YWPA 1UDLA 2VVKA 2BZYA 2EW3A 4IIOA 1G2BA 2J7IA 1YN8A 2JXBA 4J9HA 2JMCA 2LJ1A 2F2VA 3QWYA 2ABLA 2KT8A 2MOXA 1Y0MA 3SHWA 1EFNA 2KRMA 1AVZC 2LJ3A 2A37A 1Z9ZA 2CSIA 1M27C 1U06A 1UJ0A 2DILA 1H8KA 1AWWA 2KT1A 1TUCA 4R0KA 4RTVA 2LZ6B 1SHFA 3ULRB 1HSQA 2BZ8A 2W0ZA 1I1JA 1YNZA 1JO8A 4AG1C 2L0AA 2OJ2A 2KXCA 2GTJA 2DVJA 1AWXA 4RTZA 2EYWA 5IH2A 4J9IA 1BB9A 3KFVA 5I11A 5GJWB 1GFDA 1AZGB 1T3SA 2CUDA 2EGEA 2RQTA 1X6GA 2DBMA 2A36A 1K76A 1AOJA 1UHFA 3VS7A 2CREA 2EGAA 1M3AA 1RUWA 4HVWA 4CC3A 1UHCA 3GBQA 3PVLA 3M0QA 1JQQA 2FRYA 1M3BA 2KR3A 1WXBA 2D8JA 4J9FA 4HXJA 2CSQA 3R6NA 2EYYA 1K9AA 5FWCA 5HCKA 2YUNA 3M0SA 2AKLA 2L3QA 2RNAA 3VS5A 2JM8A 3RNJA 2C0IA 2O9VA 2RQRA 3UATA 4Z89A 1E7OA 3VRYA 4Y92A 2E5KA 1GCQC 1PKTA 4QT7A 1MUZA 1ZUYA 1UECA 5IHNA 4KRTA 1B07A 1S1NA 4DEXA 4DEYA 2C0TA 2K79A 4RTYA 4K11A 4D8KA 2J05A 2FPDA 4JJBA 4LN2A 3FJ5A 1M8MA 3NPFA 3VS3A 2AKKA 1FMKA 1QCFA 2IIMA 2PNIA 2DF6A 1YWOA 2CH4A 3EG3A 1BK2A 2FO0A 2JMAA 3TVTA 1OPKA 2PZ1A 3C0CA 4JPBW 2KNBB 4RUGA 2H8HA 2HDAA 1LCKA 2F2XA 1KJWA 4F17A 2CUBA 1X43A 2KBTA 1YCSB 1ZX6A 2JT4A 2K2MA 1WXUA 2XMFA 3ZL7C 1WDXA 2L3SA 1SPKA 5IXFA 1TG0A 1K0XA 3THKA 1V1CA 3REBB 3VS1A 3UF4A 2PTKA 2EYXA 2K6DA 4OMLA 2DRMA 1IO6A 2EPDA 1AWJA 4HVUA 1TUDA 2GQIA 4OMQA 1VYVA 1CSKA 2J06A 4WCIA 2YUPA 4JZ4A 4JJCA 2HSPA 2ROTA 3M0UA 3I5RA 1FYNA 2CT3A 4JZ3A 1OEBA 2RQWA 2DL5A 1JXOA 3U23A 1B3QA 1NYFA 1ZUKA 1GFCA 1HJDA 1PRMC 4AFZC 4J9EA 1W1FA 2KXDA 2QDLA 1OPLA 1UE9A 4RTUA 4OMNA 2ECZA 2KEAA 2RQUA 2EKHA 4RTXA 2CDTA 3I35A 1AD5A 3TSZA 2DM1A 4GLMA 1QKXA 2YDLA 1SRLA 1RLPC 2O88A 2FRWA 2X3XD 3H0FA 2DLPA 1OV3A 2FG0A 4LNPA 1CKBA 1H92A 2D1XA 1KIKA 2A28A 2GNCA 1T3LA 2DL4A 2HEQA 4HCKA 1H3HA 3A98A 1SEMA 4E6RA 1UGVA 1NLPC 2LJ0A 4J9GA 1W6XA 2LP5A 2NWMA 2P4RA 2F2WA 3VRZA 2LX7A 1HD3A 5FWBA 1KSWA 1NM7A 2JM9A 2KROA 2GGRA 5IHKA 1MV3A 2JS0A 3QWXX 1J3TA 1PNJA 4A63B 1WI7A 2ENMA 2DRKA 1T0HA 1GBQA 4LUDA 2V1RA 1CKAA 2KRSA 3M0TA 2DL7A 5IXBA 1ZUUA 2VWFA 1NEBA 1RI9A 1UG1A 2DL3A 5FW9A 3VS0A 1WFWA 1N5ZA 2AK5A 2YT6A 2O2OA 2LQWA 3H0HA 2W10A 1WLPB 4LUEA 4Z8AA 1E6HA 2RPNA 2SEMA 3EG1A 4CC7A 3I9QA 4AFSC 1WXTA 2LMJA 3NGPA 5L23A 5IHIA 1OOTA 2ED1A 1BU1A 1ARKA 1SRMA 1NYGA 2M51A 4J9DA 4OMOA 2KE9A 1MV0B 2A08A 2AZSA 1QKWA 2ROLA 1M30A 4OMPA 3VS6A 3EG0A 3SEMA 1WA7A 2O31A 2GBQA 1NLOC 1PRLC 2YUOA 2YUQA 1ZBJA 1WIEA 2D8HA 2B86A 1ABQA 1UUEA 2O9SA 4AFQC 2KYBA 1WX6A 2HCKA 2JTEA 3LH5A 1GBRA 4EIKA 3EHQA 3PVQA 1K0SA 1VA7A 2DX1A 2C0OA 4F14A 2VKNA 2DNUA 1ABOA 4ESRA 2J6KA 2EBPA 4FSSA 2K7AA 1Z9QA 4Z88A 2DBKA 2GTOA 1I0CA 2FPFA 3M0RA 2RN8A 5EC7A 1X27A 4ORZA 1GL5A 2YSQA 4RTTA 1UTIA 1M3CA 3NHNA 2EYZA 3PE0A 4D8DA 1X69A 2EGCA 2FPEA 2EQIA 2CT4A 2J6OA 1GCPA 1UFFA 1YP5A 1U5SA 1PWTA 1SSHA 1ZSGA 5I22A 1U3OA 2ESWA 1A0NB 2NUZA 4X1VA 4J9CA 4LE9A 2LNHB 1PKSA 2FEIA 1UJYA 4JJDA 2MIOA 2DA9A 3CQTA 2OAWA 3UA6A 2KGTA 3EHRA 3VS4A 1I07A 4OMMA 2CH4W 2SRCA 3EGUA 2K3BA 1QLYA 2LCSA 1K4US 1NEGA 2K9GA 2DMOA 1RLQC 1JEGA 1XOVA 4CC4B 3H41A 2KYMA 3O5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L2P A;  4M4Z A;  1SHG A;  1AZE A;  2AZV A;  4F16 A;  2HBW A;  2BTT A;  1GCQ A;  2DE0 X;  2G6F X;  2X3W D;  5GJV B;  2MCN A;  4CC2 A;  3M0P A;  2RQV A;  1JU5 C;  2LQN A;  2KRN A;  2EVR A;  1ZLM A;  4AG2 C;  1PHT A;  1X2Q A;  4RTW A;  1KFZ A;  1VYU A;  2V1Q A;  1G83 A;  4HVV A;  1W70 A;  1AEY A;  2I0N A;  2JW4 A;  3UA7 A;  3NMZ C;  1Y57 A;  2M0Y A;  3H0I A;  1BBZ A;  3EG2 A;  3JV3 A;  2BZX A;  1WYX A;  2DYB A;  1VYT A;  3REA B;  2D0N A;  2L3P A;  4AFU C;  2DL8 A;  1AWO A;  4GBQ A;  2JS2 A;  3RBB B;  2J6F A;  2RMO A;  1JXM A;  1T0J A;  2ED0 A;  1E6G A;  4J9B A;  1K1Z A;  3I5S A;  4IIM A;  1GRI A;  1QWE A;  2OI3 A;  3VS2 A;  2DJQ A;  3IQL A;  5ECA A;  1NG2 A;  1X6B A;  1X2K A;  2RF0 A;  3TSW A;  4ZNX A;  1QWF A;  1YWP A;  1UDL A;  2VVK A;  2BZY A;  2EW3 A;  4IIO A;  1G2B A;  2J7I A;  1YN8 A;  2JXB A;  4J9H A;  2JMC A;  2LJ1 A;  2F2V A;  3QWY A;  2ABL A;  2KT8 A;  2MOX A;  1Y0M A;  3SHW A;  1EFN A;  2KRM A;  1AVZ C;  2LJ3 A;  2A37 A;  1Z9Z A;  2CSI A;  1M27 C;  1U06 A;  1UJ0 A;  2DIL A;  1H8K A;  1AWW A;  2KT1 A;  1TUC A;  4R0K A;  4RTV A;  2LZ6 B;  1SHF A;  3ULR B;  1HSQ A;  2BZ8 A;  2W0Z A;  1I1J A;  1YNZ A;  1JO8 A;  4AG1 C;  2L0A A;  2OJ2 A;  2KXC A;  2GTJ A;  2DVJ A;  1AWX A;  4RTZ A;  2EYW A;  5IH2 A;  4J9I A;  1BB9 A;  3KFV A;  5I11 A;  5GJW B;  1GFD A;  1AZG B;  1T3S A;  2CUD A;  2EGE A;  2RQT A;  1X6G A;  2DBM A;  2A36 A;  1K76 A;  1AOJ A;  1UHF A;  3VS7 A;  2CRE A;  2EGA A;  1M3A A;  1RUW A;  4HVW A;  4CC3 A;  1UHC A;  3GBQ A;  3PVL A;  3M0Q A;  1JQQ A;  2FRY A;  1M3B A;  2KR3 A;  1WXB A;  2D8J A;  4J9F A;  4HXJ A;  2CSQ A;  3R6N A;  2EYY A;  1K9A A;  5FWC A;  5HCK A;  2YUN A;  3M0S A;  2AKL A;  2L3Q A;  2RNA A;  3VS5 A;  2JM8 A;  3RNJ A;  2C0I A;  2O9V A;  2RQR A;  3UAT A;  4Z89 A;  1E7O A;  3VRY A;  4Y92 A;  2E5K A;  1GCQ C;  1PKT A;  4QT7 A;  1MUZ A;  1ZUY A;  1UEC A;  5IHN A;  4KRT A;  1B07 A;  1S1N A;  4DEX A;  4DEY A;  2C0T A;  2K79 A;  4RTY A;  4K11 A;  4D8K A;  2J05 A;  2FPD A;  4JJB A;  4LN2 A;  3FJ5 A;  1M8M A;  3NPF A;  3VS3 A;  2AKK A;  1FMK A;  1QCF A;  2IIM A;  2PNI A;  2DF6 A;  1YWO A;  2CH4 A;  3EG3 A;  1BK2 A;  2FO0 A;  2JMA A;  3TVT A;  1OPK A;  2PZ1 A;  3C0C A;  4JPB W;  2KNB B;  4RUG A;  2H8H A;  2HDA A;  1LCK A;  2F2X A;  1KJW A;  4F17 A;  2CUB A;  1X43 A;  2KBT A;  1YCS B;  1ZX6 A;  2JT4 A;  2K2M A;  1WXU A;  2XMF A;  3ZL7 C;  1WDX A;  2L3S A;  1SPK A;  5IXF A;  1TG0 A;  1K0X A;  3THK A;  1V1C A;  3REB B;  3VS1 A;  3UF4 A;  2PTK A;  2EYX A;  2K6D A;  4OML A;  2DRM A;  1IO6 A;  2EPD A;  1AWJ A;  4HVU A;  1TUD A;  2GQI A;  4OMQ A;  1VYV A;  1CSK A;  2J06 A;  4WCI A;  2YUP A;  4JZ4 A;  4JJC A;  2HSP A;  2ROT A;  3M0U A;  3I5R A;  1FYN A;  2CT3 A;  4JZ3 A;  1OEB A;  2RQW A;  2DL5 A;  1JXO A;  3U23 A;  1B3Q A;  1NYF A;  1ZUK A;  1GFC A;  1HJD A;  1PRM C;  4AFZ C;  4J9E A;  1W1F A;  2KXD A;  2QDL A;  1OPL A;  1UE9 A;  4RTU A;  4OMN A;  2ECZ A;  2KEA A;  2RQU A;  2EKH A;  4RTX A;  2CDT A;  3I35 A;  1AD5 A;  3TSZ A;  2DM1 A;  4GLM A;  1QKX A;  2YDL A;  1SRL A;  1RLP C;  2O88 A;  2FRW A;  2X3X D;  3H0F A;  2DLP A;  1OV3 A;  2FG0 A;  4LNP A;  1CKB A;  1H92 A;  2D1X A;  1KIK A;  2A28 A;  2GNC A;  1T3L A;  2DL4 A;  2HEQ A;  4HCK A;  1H3H A;  3A98 A;  1SEM A;  4E6R A;  1UGV A;  1NLP C;  2LJ0 A;  4J9G A;  1W6X A;  2LP5 A;  2NWM A;  2P4R A;  2F2W A;  3VRZ A;  2LX7 A;  1HD3 A;  5FWB A;  1KSW A;  1NM7 A;  2JM9 A;  2KRO A;  2GGR A;  5IHK A;  1MV3 A;  2JS0 A;  3QWX X;  1J3T A;  1PNJ A;  4A63 B;  1WI7 A;  2ENM A;  2DRK A;  1T0H A;  1GBQ A;  4LUD A;  2V1R A;  1CKA A;  2KRS A;  3M0T A;  2DL7 A;  5IXB A;  1ZUU A;  2VWF A;  1NEB A;  1RI9 A;  1UG1 A;  2DL3 A;  5FW9 A;  3VS0 A;  1WFW A;  1N5Z A;  2AK5 A;  2YT6 A;  2O2O A;  2LQW A;  3H0H A;  2W10 A;  1WLP B;  4LUE A;  4Z8A A;  1E6H A;  2RPN A;  2SEM A;  3EG1 A;  4CC7 A;  3I9Q A;  4AFS C;  1WXT A;  2LMJ A;  3NGP A;  5L23 A;  5IHI A;  1OOT A;  2ED1 A;  1BU1 A;  1ARK A;  1SRM A;  1NYG A;  2M51 A;  4J9D A;  4OMO A;  2KE9 A;  1MV0 B;  2A08 A;  2AZS A;  1QKW A;  2ROL A;  1M30 A;  4OMP A;  3VS6 A;  3EG0 A;  3SEM A;  1WA7 A;  2O31 A;  2GBQ A;  1NLO C;  1PRL C;  2YUO A;  2YUQ A;  1ZBJ A;  1WIE A;  2D8H A;  2B86 A;  1ABQ A;  1UUE A;  2O9S A;  4AFQ C;  2KYB A;  1WX6 A;  2HCK A;  2JTE A;  3LH5 A;  1GBR A;  4EIK A;  3EHQ A;  3PVQ A;  1K0S A;  1VA7 A;  2DX1 A;  2C0O A;  4F14 A;  2VKN A;  2DNU A;  1ABO A;  4ESR A;  2J6K A;  2EBP A;  4FSS A;  2K7A A;  1Z9Q A;  4Z88 A;  2DBK A;  2GTO A;  1I0C A;  2FPF A;  3M0R A;  2RN8 A;  5EC7 A;  1X27 A;  4ORZ A;  1GL5 A;  2YSQ A;  4RTT A;  1UTI A;  1M3C A;  3NHN A;  2EYZ A;  3PE0 A;  4D8D A;  1X69 A;  2EGC A;  2FPE A;  2EQI A;  2CT4 A;  2J6O A;  1GCP A;  1UFF A;  1YP5 A;  1U5S A;  1PWT A;  1SSH A;  1ZSG A;  5I22 A;  1U3O A;  2ESW A;  1A0N B;  2NUZ A;  4X1V A;  4J9C A;  4LE9 A;  2LNH B;  1PKS A;  2FEI A;  1UJY A;  4JJD A;  2MIO A;  2DA9 A;  3CQT A;  2OAW A;  3UA6 A;  2KGT A;  3EHR A;  3VS4 A;  1I07 A;  4OMM A;  2CH4 W;  2SRC A;  3EGU A;  2K3B A;  1QLY A;  2LCS A;  1K4U S;  1NEG A;  2K9G A;  2DMO A;  1RLQ C;  1JEG A;  1XOV A;  4CC4 B;  3H41 A;  2KYM A;  3O5Z A; 
#chains in the Genus database with same CATH topology
 3AT1 B;  5IAY A;  3MP8 A;  4MZT A;  3G4S A;  3V7S A;  2DTI A;  3M0P A;  2NUP A;  3DLL A;  4C5E A;  1ZLM A;  3OA6 A;  1TUG B;  1VQ7 T;  2RI2 A;  3HTR A;  4J5Y A;  4XAX B;  2RJC A;  2I0N A;  4BD3 A;  4FW1 A;  2LQK A;  3JV3 A;  2BZX A;  1WYX A;  3HRS A;  1U8R A;  4DOW A;  1YJN T;  1VYT A;  4OMF B;  1D09 B;  1M9S A;  3E19 A;  2A7Y A;  2VC8 A;  2DL8 A;  4GBQ A;  4DBF A;  5GAM g;  2VV5 A;  3OSS C;  1VQM Q;  4LD9 K;  1JXM A;  1C6V X;  1T0J A;  3MEV A;  3JCM e;  4J9B A;  4M77 E;  3L2Z A;  2B8A A;  3OYG A;  1NBE B;  5D6X A;  3EH1 A;  4XTY A;  3WXM B;  1QWE A;  2OI3 A;  4N4G A;  2DJQ A;  4ATO A;  3HL8 A;  1X2K A;  4FT4 A;  2NUT A;  3KBG A;  1WJR A;  4RG8 A;  1Q81 C;  3TSW A;  1P92 A;  1ZSZ C;  1YN8 A;  2LT1 A;  2JXB A;  1QVF S;  4XU2 A;  4J9H A;  4M75 F;  4FCY A;  1X01 A;  3QPH A;  1EFN A;  2QI2 A;  1AVZ C;  1PM3 A;  2A37 A;  2O4X B;  5FU6 B;  5GAO p;  4E7Z A;  1QVP A;  4XTZ A;  2DIL A;  5GAM j;  1SF9 A;  1Q86 U;  3EGD B;  2KDS A;  2LZ6 B;  5KYX A;  3G4S T;  2YRV A;  2BZ8 A;  1JJ2 S;  3CMA A;  2W0Z A;  1I1J A;  4AG1 C;  1YIJ A;  1QW1 A;  1YJW A;  2P4T A;  5GAM d;  2GTJ A;  5LL6 S;  3OYD A;  3I55 A;  2EWN A;  5KH6 A;  1M1G A;  3NTH A;  3RES A;  1N9S A;  2CUD A;  2RJF A;  2DET A;  1BKB A;  2EGE A;  2DEQ A;  1YJN Q;  1NE8 A;  1DJ7 B;  3VS7 A;  2EGA A;  1UHC A;  3PVL A;  2MAM A;  1M3B A;  2MMP A;  4PJL A;  4JRI A;  5C0M A;  2YUN A;  5GAO l;  5CQX A;  2AKL A;  3JRZ A;  1VQO T;  4KBM B;  2L3Q A;  4E2F B;  2RNA A;  2DAQ A;  2MF2 A;  1BI3 A;  2ZPG B;  4Q5W A;  3OW2 S;  5GAO n;  5GAM e;  3HFO A;  2E5K A;  3UWN A;  4F04 B;  1KC8 C;  1TXQ A;  1ZUY A;  4KRT A;  4DEX A;  1S1N A;  1Y71 A;  1W2B P;  2XG8 D;  3QUI A;  2K79 A;  3DB3 A;  3HRU A;  4RTY A;  3PFS A;  4D8K A;  2J05 A;  4JJB A;  1K73 C;  3GF5 A;  3MCA B;  2DPP B;  2IPO B;  4PJO D;  1B34 B;  4J83 A;  1FMK A;  5KYW B;  4KUD K;  3M4G A;  1YWO A;  4KGX B;  3PGG A;  4A53 A;  5KYN A;  3C0C A;  2KNB B;  2H8H A;  2HDA A;  2LDM A;  4B6M A;  4F17 A;  2CUB A;  1X43 A;  4XTX A;  5GAN 2;  5GMK e;  1Q7Y R;  2DFU A;  4JRK A;  1VQ6 T;  1D1A A;  1WQ7 A;  3REB B;  3VS1 A;  3CMA T;  2FL7 A;  5GAN 3;  3PMT A;  3OYB A;  1RAC B;  2A3L A;  2NLU A;  3JCM h;  1YJW T;  3CCU A;  1JBM A;  3EG9 B;  1QVG P;  2CP2 A;  4OML A;  4D6W A;  3I55 T;  2VUB A;  2EPD A;  1WQW A;  1AWJ A;  4JS4 A;  4PFP A;  4OMQ A;  2V8I A;  2J06 A;  4C5I A;  3CME A;  4OGC A;  5CK9 A;  2ROT A;  3X24 B;  1R0B G;  1XNI A;  2CT3 A;  2VXE A;  4JZ3 A;  2P84 A;  2GF7 A;  1VQO Q;  1B3Q A;  4M77 D;  1ZUK A;  1N8R C;  4AFZ C;  5FRM A;  3CXC S;  2QDL A;  4OMN A;  3MJX A;  4C5G A;  5IT9 E;  3CBM A;  1TOV A;  2I2L A;  3PIO A;  1AD5 A;  3TSZ A;  2DM1 A;  1ZBX A;  1SRL A;  1WPY A;  4BUG A;  3EGX B;  2XDB A;  1YHQ T;  3UT1 A;  1UGS B;  2D1X A;  2HQX A;  1H92 A;  2QG9 B;  3TQ7 P;  4M77 A;  3CBP A;  1M90 C;  2GNC A;  3JCM Q;  2R5A A;  4HCK A;  1H3H A;  1R77 A;  3A98 A;  3QG1 A;  3HSB A;  1NLP C;  1MND A;  2LP5 A;  3G1J A;  2P4R A;  4M77 G;  1KSW A;  1NM7 A;  4LDY A;  3CCM A;  3E2U A;  4BY6 B;  1BI0 A;  1LJO A;  5IHK A;  3M56 A;  1Q82 U;  1VQ6 Q;  3CMA Q;  4RCC A;  1PNJ A;  1WI7 A;  2ENM A;  2V1R A;  1BI2 A;  3S3M A;  1MNE A;  2L5Q A;  3F70 A;  2DXB A;  4M78 B;  5LJ5 e;  2RHX A;  3CCU T;  3VJP A;  4QVC A;  1Y07 A;  2FZK B;  2CGH A;  2COW A;  1I5O B;  1TU0 B;  4Z8A A;  1TWB A;  3OB9 A;  2EQJ A;  3E1S A;  3V8J A;  4RCB A;  3CME T;  3FC3 A;  2SEM A;  2PVG B;  3GOX A;  3I9Q A;  4C0D C;  2K3X A;  4IUU A;  3NGP A;  5IHI A;  4JDS A;  1SRM A;  2M51 A;  5C6S A;  3BE3 A;  3SWN B;  1MV0 B;  3L2W A;  2AZS A;  1QKW A;  4BI8 B;  2F5T X;  1WA7 A;  2YUO A;  3CCV A;  1YHQ Q;  4M7A C;  3QBY A;  2X4X A;  5D7U A;  4EPC A;  3J81 E;  1U1S A;  2RM4 A;  2D8H A;  2B86 A;  3MHX A;  4F7U B;  2OTJ T;  2F69 A;  1Q81 U;  1VQP A;  3LH5 A;  1G3Y A;  3RR6 A;  1Q86 R;  3EHQ A;  1O9S A;  3PVQ A;  3OS0 A;  3BY7 A;  1VA7 A;  1VOM A;  2QQB A;  1Y7X A;  2VKN A;  2DNU A;  2M9U A;  2O4X A;  4J7I A;  4M78 E;  2EBP A;  4FW2 A;  2COY A;  3CCM T;  4RMO A;  1I0C A;  3CCE T;  3SD4 A;  5EC7 A;  4X9D A;  4ORZ A;  4RG2 A;  3LWI A;  2KMT A;  2EYZ A;  2JTF A;  1HYO A;  2FPE A;  1V76 A;  1ZSZ B;  4HT8 A;  4M75 D;  2JZ2 A;  3CCQ A;  2V26 A;  3JB9 G;  3CME Q;  1YP5 A;  1U5S A;  1F1B B;  1PWT A;  1SSH A;  3G71 A;  3HPW A;  2ESW A;  5HY6 A;  2L3R A;  2F1L A;  1XQH A;  3P8D A;  1SKU B;  2QA4 A;  3CD6 A;  2M0O A;  1PKS A;  2X4W A;  1UJY A;  3VUZ A;  4F7U E;  3OBW A;  2L8D A;  2OAW A;  2E12 A;  5DLQ E;  4N0A C;  2LVM A;  1WHJ A;  2CH4 W;  3QYH B;  1OX9 A;  2SRC A;  2RK2 A;  2K3B A;  3JB9 I;  2OTJ Q;  3CCV T;  4DQ2 A;  1RLQ C;  1H64 1;  4CC4 B;  4M75 G;  1IB8 A;  3QJY A;  1AZE A;  2JJ9 A;  2YRC A;  5GAN g;  1D3B B;  1GCQ A;  5FU7 C;  1B34 A;  1ZHI A;  4PJN A;  3RKW A;  1K73 U;  3QII A;  2MCN A;  1KQS P;  5KYW A;  3DLM A;  2RQV A;  1JU5 C;  2KRN A;  2HQE A;  4KGZ B;  3CCE Q;  4EMG A;  2HL5 C;  4FM4 B;  1VYU A;  1MHN A;  4ZN1 A;  1G83 A;  2NYS A;  1W70 A;  2KK4 A;  2JW4 A;  4BDY A;  4UC4 A;  3KUF A;  1LPL A;  1N9R A;  1I81 A;  3NMZ C;  1QCN A;  5M9O A;  2M0Y A;  1TTH B;  2PVO B;  3EG2 A;  2IG0 A;  3LLR A;  2RHU A;  3C12 A;  2DYB A;  2MWP A;  1W2B A;  3DKM A;  1VQ9 T;  3X28 B;  3EG9 A;  2L3P A;  3QZ5 B;  3PNW C;  4E7K A;  2MYS A;  3CCJ A;  3FLG A;  3CCQ T;  4Y91 A;  5GAN j;  4M77 F;  2ED0 A;  1E6G A;  5A0G A;  2DXU A;  2K4Y A;  4BE1 A;  3G71 T;  4J7F A;  2DKG A;  4IIM A;  3VS2 A;  1NG2 A;  2ZAE A;  5GAN 6;  1QP2 A;  5GAN d;  3WVD B;  1QWF A;  3CD6 T;  1YWP A;  1YI2 A;  3GNF B;  4M7D B;  1UDL A;  1N8R U;  1BCM A;  3INZ A;  1M1K U;  2JMC A;  2ABL A;  3FRN A;  2MOX A;  1KD1 R;  2ZCF B;  1QVG A;  1XTD A;  2KRM A;  2AT1 B;  1Z9Z A;  1M27 C;  2KY9 A;  8AT1 B;  2QEX A;  4E7L A;  3OYL A;  1IXD A;  3EGX A;  1BCO A;  3QJ6 A;  1H8K A;  2KT1 A;  1TUC A;  4PFO A;  3M57 A;  3ULR B;  1IZ6 A;  1C1A A;  3FB9 A;  2DJZ A;  1YNZ A;  1JO8 A;  1FX7 A;  2RB6 A;  1VQ5 A;  5KE2 A;  2L0A A;  2OJ2 A;  1M90 U;  3PTA A;  5GAN e;  1AWX A;  5CVI A;  5KYY A;  2CP7 A;  4NOY A;  2EYW A;  5IH2 A;  1BB9 A;  2GQV A;  2OTL A;  2QYZ A;  1RAD B;  1G3S A;  2RHY A;  1GFD A;  1T3S A;  1D0Y A;  4OP0 A;  2LT4 A;  3OYM A;  3EFR A;  1X6G A;  3M53 A;  1VQ9 Q;  1HXD A;  1UHF A;  2CRE A;  5CKB A;  5CKD A;  1M3A A;  5CKE A;  2BKD N;  3GBQ A;  3QKJ A;  3UDC A;  3GIB A;  2D8J A;  1RL2 A;  4ZGE B;  2CSQ A;  4M78 A;  2EYY A;  4M7D E;  5FWC A;  3FIF A;  3M0S A;  3CCJ T;  1FXX A;  3EH2 A;  4GLK A;  4M78 G;  3C95 A;  2O9V A;  3N5B B;  4JLG A;  1W4S A;  2RQR A;  1KHI A;  3M59 A;  3VRY A;  2DIG A;  2DXT A;  4MZM A;  2YLB A;  3RMS A;  5IHN A;  1UEC A;  2CZ6 B;  3X26 B;  1WHH A;  2LTO A;  4LN2 A;  3FJ5 A;  3BDL A;  1FMV A;  1Q81 R;  1VQL A;  1M8M A;  3SWN A;  1VQ8 A;  2VGM A;  3JB9 F;  2RO0 A;  4MMK A;  5DM7 R;  2DF6 A;  1ZQ1 A;  2CH4 A;  3EG3 A;  4LDV A;  3ZFJ A;  1X75 C;  1IRE B;  3LGF A;  1OPK A;  3TVT A;  4R56 A;  4N4H A;  2EIF A;  2E65 A;  4F7U A;  1LCK A;  5GAN 5;  2QEX T;  2F2X A;  1IGU A;  1KJW A;  1BIA A;  2DYI A;  4C0D B;  2XMF A;  3ZL7 C;  2OX7 A;  5IXF A;  1TG0 A;  4F7U G;  3V8K A;  3BW1 A;  3GNG A;  2K6D A;  2YXY A;  3OYJ A;  4JJN K;  1IO6 A;  4E7H A;  1M2V B;  1G8X A;  5LJ3 f;  1PSF A;  1YJ9 A;  1VYV A;  4JUV A;  2OTL T;  2OAU A;  4WCI A;  4E7J A;  2YUP A;  3MKD A;  2HSP A;  3LW5 E;  3X25 B;  3I5R A;  1O75 A;  2R58 A;  2FYK A;  1KG1 A;  8ATC B;  3U23 A;  1NYF A;  1ZSZ A;  1JB0 E;  3JCM X;  1M8V A;  4C92 B;  1K9M C;  1OPL A;  4X34 A;  3PMI A;  2ECZ A;  2P0Q A;  2RQU A;  4RTX A;  3I35 A;  1VQ7 Q;  4C0G A;  5LJ3 g;  1QMC A;  1MMG A;  1RLP C;  2O88 A;  4NL2 A;  4P5N A;  2DLP A;  2FG0 A;  4PLI A;  1VQ4 A;  3URG A;  2DER A;  1KC8 R;  5AT1 B;  4OVA A;  2GFU A;  1VQN A;  3LYI A;  1K73 R;  2HEQ A;  1KQ2 A;  3SFM A;  5D6Y A;  2QEX Q;  1UGV A;  3CC2 A;  2NWM A;  3CC4 A;  3VRZ A;  1HD3 A;  2JM9 A;  2KRO A;  2LCC A;  4XTU A;  3H6Z A;  1J3T A;  3JCM c;  4A63 B;  1D3B A;  1WJQ A;  5LJ3 j;  3I56 A;  1CKA A;  2KRS A;  3M0T A;  2MI6 A;  3J7A F;  1D0X A;  4A4E A;  1JRI A;  2VWF A;  5LJ3 d;  4J6Y A;  4MZP A;  4C92 E;  1NJI C;  1WFW A;  4ELZ C;  2QTX A;  2YT6 A;  3MEW A;  2BE7 D;  1YJ9 T;  2W10 A;  2COZ A;  2V8J A;  4EMK B;  4M7D D;  2L89 A;  2RPN A;  4DOV A;  2DZC A;  2RI3 A;  3BDU A;  3G4S Q;  1VIF A;  3M4Y A;  4B9W A;  4C8Q B;  2E10 A;  2QGG A;  1NYG A;  1UEB A;  1KQS A;  2A08 A;  1M30 A;  3EG0 A;  3SEM A;  1NLO C;  4OB1 B;  1NPR A;  2JN0 A;  1M5Q 1;  2YUQ A;  1ZBJ A;  2EJ9 A;  1YIJ T;  4E47 A;  4L6V 5;  4ME7 A;  1UUE A;  4AFQ C;  4M7D A;  1WX6 A;  2HCK A;  4PJO C;  1PD0 A;  3RDV A;  1VQ4 T;  4EIK A;  4O5V A;  3EAE A;  1VQN T;  1K8A C;  2XDD A;  2E41 A;  2PQW A;  4M7D G;  3FEO A;  2C0O A;  3JB9 J;  1ACM B;  4X9C A;  4M78 F;  1M90 R;  4PL6 A;  2K57 A;  4FSS A;  5KCH A;  1M1K C;  1Y96 B;  2K5I A;  2DBK A;  3ZBD A;  4A4K A;  2O01 E;  5CAI A;  3M0R A;  1X27 A;  2G3R A;  1GL5 A;  2XK0 A;  1M3C A;  3E9G A;  2HKN A;  4XU1 A;  2EQI A;  4QQD A;  3MEA A;  2DTO A;  3G6E A;  5HKC A;  2ZPB B;  1G3W A;  1MMA A;  4C8Q E;  3GLX A;  2Y4Y A;  4DBH A;  3HP9 A;  3P8B B;  3CCR A;  2RJE A;  2LNH B;  3QYG B;  1OZ3 A;  4M77 C;  2MK5 A;  2KVQ G;  4F7U F;  4ANJ A;  3QO3 A;  1LVK A;  4JJD A;  2MIO A;  3CEY A;  3O8V A;  5J3B A;  3UA6 A;  1RAH B;  4PJJ A;  1YIJ Q;  1YJW Q;  1I07 A;  2LQ8 A;  3I55 Q;  3EGU A;  3RIR A;  1RAA B;  1K4U S;  3HFN A;  1XOV A;  3O5Z A;  2DVE A;  4OGE A;  1YCY A;  1XJW B;  5GAM h;  1SHG A;  2AZV A;  4F16 A;  4JS5 A;  2EFI A;  2XD0 A;  1EZZ B;  3RUX A;  1PC0 A;  3T9N A;  2DTH A;  2EVR A;  4AG2 C;  3CC7 A;  1PHT A;  1X2Q A;  4FL6 A;  4EMH A;  3CPW P;  2DO3 A;  1YIT A;  3JCM V;  2K2V A;  2V1Q A;  4A4F A;  3OSV A;  4KUI A;  4HVV A;  1AEY A;  2VXF A;  3UA7 A;  2Z0W A;  1D0Z A;  1Y57 A;  3EFS A;  3ER0 A;  3H0I A;  1R0C B;  1BBZ A;  4C92 D;  2CP6 A;  3OY9 A;  2QQR A;  3ASK A;  2EAY A;  1I8F A;  2XIC A;  4PK4 A;  5GMK h;  1TH7 A;  1H3Z A;  3QHS A;  3JB9 D;  1QVF P;  1M2V A;  5A0L A;  2J6F A;  2RMO A;  2M02 A;  1SG5 A;  3AHU A;  3RER A;  1GRI A;  1MMN A;  5ECA A;  2XDP A;  3MP6 A;  2RF0 A;  3CCR T;  4ZNX A;  1YFN A;  3JCM P;  4C92 A;  2CP5 A;  2VVK A;  2FZC B;  3L2Q A;  1JJ2 P;  2EW3 A;  1UGR B;  1VQK A;  1G2B A;  2J7I A;  3EGD A;  2E70 A;  1S72 A;  1K9M U;  5FU6 C;  2FVU A;  2EJG A;  2LJ1 A;  2F2V A;  1RI0 A;  4C92 G;  3CCU Q;  1Y0M A;  2LRQ A;  2A0F B;  2PUO B;  3LGL A;  3SHW A;  3OMG A;  2LJ3 A;  4XU3 A;  1MGQ A;  2CSI A;  2CZ1 B;  4V2S A;  3FDR A;  1OYX A;  3M5A A;  4OB0 B;  1AWW A;  2QGF B;  4R0K A;  4RTV A;  4ZGD B;  1SHF A;  3CCS A;  4WTO B;  4A4H A;  5GAO q;  1HSQ A;  2EQK A;  1WHG A;  4BI4 A;  3QZ9 B;  1IGQ A;  5J26 A;  2KXC A;  2HD0 A;  1KQ1 A;  1WHL A;  2IVW A;  1YIT T;  4QKU A;  2AHJ B;  3KFV A;  2CZ7 B;  4O6J A;  5CO7 A;  3A8O B;  2X4J A;  3OW2 P;  2WSC E;  2RQT A;  2A36 A;  4HCC A;  1K76 A;  1AOJ A;  4AT1 B;  4C8Q D;  1RUW A;  4ELY C;  4CC3 A;  2HMA A;  1LNX A;  2FRY A;  3H9N A;  4NS5 A;  1N6A A;  1OZ2 A;  1QQJ A;  4J9F A;  3R6N A;  4M75 C;  4M7D F;  4IUQ A;  4N0A A;  5HCK A;  4MML A;  1NJI U;  5LJ5 h;  2JM8 A;  3RNJ A;  1VQP T;  3CCR Q;  4EMK A;  4Z89 A;  4LD6 A;  5FRO A;  1I5L A;  3CCM Q;  3PT9 A;  1GCQ C;  3ZEH A;  1C0M A;  3OYC A;  1PKT A;  3VYG A;  2GCX A;  4DEY A;  2C0T A;  4Y28 E;  1AT1 B;  1UGQ B;  4C8Q A;  4K11 A;  2FPD A;  2RK1 A;  3NPF A;  1S72 T;  2AKK A;  2JNG A;  5GAN 4;  4GY5 A;  1VQM A;  5GAO m;  4C8Q G;  2PNI A;  2EKO A;  5KYU B;  4IUT A;  3L42 A;  2Y4X A;  2FO0 A;  2CKK A;  4JLI A;  2PZ1 A;  3OS5 A;  2ZPI B;  3RMQ A;  4JPB W;  2P0K A;  2HZY A;  4RUG A;  2HKQ B;  2F5K A;  1IRX A;  2KBT A;  1YCS B;  2HQH A;  1ZX6 A;  2JT4 A;  2K2M A;  1VUB A;  1W2B S;  3S3O A;  2DEU A;  4DBQ A;  1WDX A;  5A2Q E;  1SPK A;  4PFZ A;  4IKF A;  3L2U A;  3THK A;  3JCM W;  1V1C A;  3CXC P;  2PTK A;  1K8A U;  1OQK A;  3ME9 A;  1B7T A;  2QA4 T;  2DRM A;  4XU0 A;  4A54 A;  1Y96 A;  1TUD A;  4EDU A;  2GQI A;  4QVZ A;  1CSK A;  1BIB A;  2H3E B;  4JJC A;  3CCV Q;  1TS9 A;  3M0U A;  1EIF A;  3JCM f;  1FYN A;  2X4Y A;  2HNI A;  1D1B A;  1OEB A;  5L8R E;  2RQW A;  3OBY A;  4PJO B;  3LX7 A;  4KGV B;  1GFC A;  1PRM C;  1G3T A;  1VQP Q;  2KXD A;  3OYA A;  5GMK i;  4RTU A;  4C0F A;  2QQ9 A;  1QVG S;  1Q82 R;  4M78 D;  3X20 B;  4GLM A;  4BDZ A;  1QKX A;  1HK9 A;  2YDL A;  3WVE B;  1MMD A;  3CPF A;  4QQ6 A;  3JCM g;  2FRW A;  1SSF A;  2X3X D;  3H0F A;  3OS1 A;  3JAM E;  3Q1J A;  2X9H A;  4LNP A;  1G5V A;  2HBP A;  2A28 A;  2WSE E;  4C5H A;  2E64 A;  4BY6 C;  1OU8 A;  2DIQ A;  3VYH B;  4IUV A;  1T3L A;  2DL4 A;  1SEM A;  4E6R A;  3LH0 A;  1D1C A;  3CCQ Q;  4J9G A;  4XK8 E;  2F2W A;  2LX7 A;  5FWB A;  4QW2 A;  3C94 A;  2E3H A;  4E7I A;  3G71 Q;  2ZZD A;  2GGR A;  2JS0 A;  1EX4 A;  2WAC A;  3SB2 A;  4M77 B;  1GBQ A;  2DRK A;  4LUD A;  2QA4 Q;  2QK0 A;  3CD6 Q;  3UPU A;  4II1 A;  2DL7 A;  2RHI A;  5IXB A;  2M1H A;  1ZUU A;  1NEB A;  4PJO E;  3VS0 A;  4C92 F;  1ZA1 B;  2ZPH B;  4BE0 A;  4BAC A;  2D6F A;  1YI2 T;  2FB7 A;  2M16 A;  2D9T A;  4LUE A;  3JCM d;  1E6H A;  3GP8 A;  4KH0 B;  2HSE B;  2K5F A;  3JB9 H;  3R6O A;  3SWN C;  5D6W A;  4CC7 A;  5GAM f;  4AFS C;  1WXT A;  3QDF A;  1OOT A;  2ED1 A;  4ZTJ A;  3FJP A;  3NFC A;  1ARK A;  4J9D A;  4FYW B;  4OMO A;  4OMP A;  4PLL A;  3VS6 A;  1K9M R;  3L2V A;  2O31 A;  3CPW A;  1PRL C;  2E6N A;  2QQA A;  5GMK l;  1VQ5 T;  2QAS A;  2QAZ A;  3J80 E;  1VQO A;  2KYB A;  3CPW S;  2XI9 A;  2JTE A;  4M7A B;  1GBR A;  4HKE A;  1K0S A;  2XU8 A;  2MPX C;  4F14 A;  2RHZ A;  1RAE B;  1QVF A;  4HT9 A;  3CCJ Q;  4ESR A;  2D0Q B;  2K5L A;  1BI1 A;  4OB3 B;  4R55 A;  2K7A A;  3A5Z B;  1OX8 A;  4JRP A;  4Z88 A;  3EFO B;  2ZGW A;  1V29 B;  2FPF A;  2RN8 A;  3HRT A;  2YSQ A;  3DB4 A;  3CCL A;  4VUB A;  5KCO A;  3M54 A;  1X69 A;  2EGC A;  2WSF E;  1YI2 Q;  2CT4 A;  4BE2 A;  2J6O A;  2BIV A;  4BB7 A;  2PVD B;  1JJ2 A;  1BYM A;  4C8Q F;  1WGS A;  1GCP A;  1ZSG A;  2E3I A;  5GAN h;  5I22 A;  1U3O A;  1UB4 A;  2E6Z A;  1NJI R;  4LDW A;  1VQ6 A;  1VQL T;  4N4I A;  1VQ8 T;  2DK3 A;  4OB2 B;  1U1T A;  4X1V A;  4BI3 A;  2FEI A;  4XTW A;  2RH2 A;  1AHJ B;  2CZ0 B;  4LDX A;  4L59 A;  4MDW A;  2AIR B;  2ATC B;  2DA9 A;  2KQW A;  4M7A E;  2KGT A;  3VS4 A;  1VQ5 Q;  2KAF A;  4OMM A;  2PU9 B;  3TCJ A;  2E5Q A;  5CIU A;  5I2S A;  3MP1 A;  2LCS A;  3VUB A;  1NEG A;  2X35 A;  4LXC A;  2DMO A;  1JEG A;  2OTL Q;  3H41 A;  3V7R A;  2KYM A;  5GMK j;  2L2P A;  3OW2 A;  2XID A;  4M4Z A;  3QXE B;  2HBW A;  1OU9 A;  3TRE A;  1QCO A;  2BTT A;  2VGN A;  2DE0 X;  2G6F X;  2X3W D;  5GJV B;  4M75 B;  4CC2 A;  2LCL A;  5I21 A;  2LQN A;  5KYU A;  2JTM A;  4RTW A;  1KFZ A;  1YHQ A;  1K8A R;  5FU7 B;  2DD4 A;  1QP3 A;  5LJ5 f;  1M4Z A;  4J6X A;  5GAO r;  4CI0 C;  2Y90 A;  3P8H A;  1N8R R;  2H3J A;  2GFA A;  3M9Q A;  5DLO A;  1M1K R;  4KT0 E;  2E1H A;  3CCL T;  2KSS A;  1KQS S;  4FSX A;  1YBY A;  3REA B;  2D0N A;  2VB6 A;  5LJ3 e;  4AFU C;  1VQL Q;  3OYI A;  2XKO C;  1AWO A;  2JS2 A;  1VQ8 Q;  3RBB B;  4HCB A;  3A8M B;  3OYH A;  3V8L A;  2CS7 A;  5LJ5 g;  1K1Z A;  1WNL A;  3I5S A;  4M7D C;  3IQL A;  1X6B A;  4PJO A;  3CC2 T;  3A8G B;  3CC4 T;  4JRQ A;  2BZY A;  2CP0 A;  4IIO A;  2MWO A;  5A0D A;  4PJO G;  1RAB B;  1WHM A;  2DD5 A;  3QWY A;  2KT8 A;  3CXC A;  4M75 E;  4FIB A;  3I56 T;  2ZPE B;  4HA8 A;  2PUK B;  2QTV A;  3KXT A;  2FZG B;  4XQ3 A;  1YJ9 Q;  1N27 A;  3MEU A;  1Q7Y C;  1U06 A;  1UJ0 A;  1R8O B;  2XHC A;  3A1P A;  5LJ5 j;  2YRD A;  4DBR A;  2BE9 B;  4IUR A;  2DVJ A;  1OI1 A;  3L2R A;  4RTZ A;  2OTJ A;  2RA2 A;  5LJ5 d;  2P0P A;  4J9I A;  3OYN A;  3D7S B;  5I2M A;  3VKI A;  4L5G A;  5I11 A;  2C06 A;  5GJW B;  3CCL Q;  1AZG B;  5FLX E;  3S3N A;  2DBM A;  5GAN 8;  1X6O A;  3LWH A;  1KD1 U;  5AYF A;  4HVW A;  7AT1 B;  3M0Q A;  1JQQ A;  3OS2 A;  3RKY A;  3MO8 A;  2KR3 A;  1M2O A;  1WXB A;  5KYY B;  1PCX A;  1VQ4 Q;  4HXJ A;  1PSE A;  3HKS A;  2EJF A;  1WJS A;  1VQN Q;  3CCE A;  1K9A A;  3QDR B;  3GPL A;  2E4H A;  3VS5 A;  1OUL A;  3CC2 Q;  2C0I A;  3UAT A;  3C4S A;  2KI7 A;  3CC4 Q;  1E7O A;  3HHT B;  4KUL A;  2X51 A;  4Y92 A;  3S6W A;  4OF1 A;  4M7A D;  3M58 A;  1KK7 A;  4QT7 A;  1MUZ A;  9ATC B;  1B07 A;  4B9X A;  3G7Z A;  3I56 Q;  3JSC A;  5CCA A;  2LNV A;  3H8Z A;  3PIP A;  3MPU B;  3VS3 A;  1IHV A;  2NUP B;  1QCF A;  2IIM A;  1IHW A;  4A4G A;  4LDU A;  5GAN 7;  1BK2 A;  2JMA A;  1RAF B;  4PJM A;  3G6E T;  3NTK A;  3QSU A;  1RAG B;  2EQM A;  4FU6 A;  4QVD A;  4M7A A;  2R5M A;  1WXU A;  5LJ3 h;  2L3S A;  1K0X A;  4ZGJ B;  1ZA2 B;  1RAI B;  3UF4 A;  4QQG A;  6AT1 B;  4M7A G;  2EYX A;  2JVV A;  3OMC A;  2QXF A;  3EFO A;  4HVU A;  5HK0 A;  4JZ4 A;  4E7S A;  1NZ9 A;  4C92 C;  4NL3 A;  5HK3 A;  2DL5 A;  2DXC A;  1JXO A;  2NUT B;  1HJD A;  3OYF A;  4J9E A;  4PNO A;  1W1F A;  3BFM A;  2QQS A;  1UE9 A;  3TEE A;  2KEA A;  4XTV A;  5GMK m;  2EKH A;  1NPP A;  2CDT A;  5CKH A;  3OQ5 A;  3RKX A;  1VQ9 A;  3CC7 T;  1Q86 C;  2R57 A;  1FWZ A;  1OV3 A;  3L1A A;  1PG5 B;  1CKB A;  5KYX B;  1KIK A;  5CQY A;  2CYZ B;  4PKC C;  2EQU A;  3TU4 K;  3VV0 A;  3G6E Q;  2YWW A;  4ZTF A;  2YLC A;  2LJ0 A;  1W6X A;  5GAN f;  1MV3 A;  1Q95 G;  2V8K A;  3QWX X;  1T0H A;  4FT2 A;  4M75 A;  3V7C A;  4PJO F;  1RI9 A;  1WHK A;  1UG1 A;  2DL3 A;  5FW9 A;  4EMK C;  1UGP B;  2YHT A;  1KC8 U;  1N5Z A;  2AK5 A;  3H0H A;  2O2O A;  2LQW A;  1WLP B;  2BUD A;  2ZPF B;  4DA4 A;  1VQK T;  2DZ9 A;  3NTI A;  4C8Q C;  4Z02 A;  3CBO A;  2RJD A;  4YTL A;  1WZO A;  2LC4 A;  3A8H B;  5CR2 A;  1PD1 A;  3EG1 A;  4ZN3 A;  4WF2 A;  2VYT A;  2LMJ A;  5L23 A;  1BU1 A;  3VU3 C;  2KE9 A;  2ROL A;  4FYY B;  4HCZ A;  3CC7 Q;  3CCS T;  2GBQ A;  1YIT Q;  3OYE A;  1LOJ A;  1WIE A;  4MDX A;  1ABQ A;  2O9S A;  2HAX A;  3OYY A;  2LX9 A;  1FMW A;  3A8L B;  2DX1 A;  1VQ7 A;  3OYK A;  5DY9 A;  1ABO A;  3JCM J;  2J6K A;  3E9F A;  2EYQ A;  1Z9Q A;  2GTO A;  4RKU E;  2JUF A;  2JOY A;  1Q7Y U;  4RTT A;  1UTI A;  3NHN A;  1TSF A;  3PE0 A;  2K3Y A;  4D8D A;  1YJN A;  4FYX B;  2RD1 A;  5FRN A;  1GXI E;  1KHC A;  1VQK Q;  1S72 Q;  4KH1 B;  1UFF A;  4FYV B;  5CKF A;  2RI5 A;  2FHD A;  1A0N B;  5EG2 A;  2NUZ A;  1I4K 1;  4CRI A;  1VQM T;  4J9C A;  4LE9 A;  4J8O A;  4IUP A;  5J39 A;  3CCS Q;  2HL3 A;  3MET A;  4TVR A;  1KD1 C;  4M7A F;  4J6W A;  3CQT A;  2CP3 A;  3EHR A;  3JCM b;  4M78 C;  5IN1 A;  3M55 A;  1M1F A;  4AMC A;  4C0Z A;  2QDY B;  5KE3 A;  1QLY A;  1VIE A;  2K9G A;  2VAS A;  3SDZ A;  1Q82 C; 
#chains in the Genus database with same CATH homology
 2L2P A;  4M4Z A;  1SHG A;  1AZE A;  2AZV A;  4F16 A;  2HBW A;  2BTT A;  1GCQ A;  2DE0 X;  2G6F X;  2X3W D;  5GJV B;  2MCN A;  4CC2 A;  3M0P A;  2RQV A;  1JU5 C;  2LQN A;  2KRN A;  2EVR A;  1ZLM A;  4AG2 C;  1PHT A;  1X2Q A;  4RTW A;  1KFZ A;  1VYU A;  2V1Q A;  1G83 A;  4HVV A;  1W70 A;  1AEY A;  2I0N A;  2JW4 A;  3UA7 A;  3NMZ C;  1Y57 A;  2M0Y A;  3H0I A;  1BBZ A;  3EG2 A;  3JV3 A;  2BZX A;  1WYX A;  2DYB A;  1VYT A;  3REA B;  2D0N A;  2L3P A;  4AFU C;  2DL8 A;  1AWO A;  4GBQ A;  2JS2 A;  3RBB B;  2J6F A;  2RMO A;  1JXM A;  1T0J A;  2ED0 A;  1E6G A;  4J9B A;  1K1Z A;  3I5S A;  4IIM A;  1GRI A;  1QWE A;  2OI3 A;  3VS2 A;  2DJQ A;  3IQL A;  5ECA A;  1NG2 A;  1X6B A;  1X2K A;  2RF0 A;  3TSW A;  4ZNX A;  1QWF A;  1YWP A;  1UDL A;  2VVK A;  2BZY A;  2EW3 A;  4IIO A;  1G2B A;  2J7I A;  1YN8 A;  2JXB A;  4J9H A;  2JMC A;  2LJ1 A;  2F2V A;  3QWY A;  2ABL A;  2KT8 A;  2MOX A;  1Y0M A;  3SHW A;  1EFN A;  2KRM A;  1AVZ C;  2LJ3 A;  2A37 A;  1Z9Z A;  2CSI A;  1M27 C;  1U06 A;  1UJ0 A;  2DIL A;  1H8K A;  1AWW A;  2KT1 A;  1TUC A;  4R0K A;  4RTV A;  2LZ6 B;  1SHF A;  3ULR B;  1HSQ A;  2BZ8 A;  2W0Z A;  1I1J A;  1YNZ A;  1JO8 A;  4AG1 C;  2L0A A;  2OJ2 A;  2KXC A;  2GTJ A;  2DVJ A;  1AWX A;  4RTZ A;  2EYW A;  5IH2 A;  4J9I A;  1BB9 A;  3KFV A;  5I11 A;  5GJW B;  1GFD A;  1AZG B;  1T3S A;  2CUD A;  2EGE A;  2RQT A;  1X6G A;  2DBM A;  2A36 A;  1K76 A;  1AOJ A;  1UHF A;  3VS7 A;  2CRE A;  2EGA A;  1M3A A;  1RUW A;  4HVW A;  4CC3 A;  1UHC A;  3GBQ A;  3PVL A;  3M0Q A;  1JQQ A;  2FRY A;  1M3B A;  2KR3 A;  1WXB A;  2D8J A;  4J9F A;  4HXJ A;  2CSQ A;  3R6N A;  2EYY A;  1K9A A;  5FWC A;  5HCK A;  2YUN A;  3M0S A;  2AKL A;  2L3Q A;  2RNA A;  3VS5 A;  2JM8 A;  3RNJ A;  2C0I A;  2O9V A;  2RQR A;  3UAT A;  4Z89 A;  1E7O A;  3VRY A;  4Y92 A;  2E5K A;  1GCQ C;  1PKT A;  4QT7 A;  1MUZ A;  1ZUY A;  1UEC A;  5IHN A;  4KRT A;  1B07 A;  1S1N A;  4DEX A;  4DEY A;  2C0T A;  2K79 A;  4RTY A;  4K11 A;  4D8K A;  2J05 A;  2FPD A;  4JJB A;  4LN2 A;  3FJ5 A;  1M8M A;  3NPF A;  3VS3 A;  2AKK A;  1FMK A;  1QCF A;  2IIM A;  2PNI A;  2DF6 A;  1YWO A;  2CH4 A;  3EG3 A;  1BK2 A;  2FO0 A;  2JMA A;  3TVT A;  1OPK A;  2PZ1 A;  3C0C A;  4JPB W;  2KNB B;  4RUG A;  2H8H A;  2HDA A;  1LCK A;  2F2X A;  1KJW A;  4F17 A;  2CUB A;  1X43 A;  2KBT A;  1YCS B;  1ZX6 A;  2JT4 A;  2K2M A;  1WXU A;  2XMF A;  3ZL7 C;  1WDX A;  2L3S A;  1SPK A;  5IXF A;  1TG0 A;  1K0X A;  3THK A;  1V1C A;  3REB B;  3VS1 A;  3UF4 A;  2PTK A;  2EYX A;  2K6D A;  4OML A;  2DRM A;  1IO6 A;  2EPD A;  1AWJ A;  4HVU A;  1TUD A;  2GQI A;  4OMQ A;  1VYV A;  1CSK A;  2J06 A;  4WCI A;  2YUP A;  4JZ4 A;  4JJC A;  2HSP A;  2ROT A;  3M0U A;  3I5R A;  1FYN A;  2CT3 A;  4JZ3 A;  1OEB A;  2RQW A;  2DL5 A;  1JXO A;  3U23 A;  1B3Q A;  1NYF A;  1ZUK A;  1GFC A;  1HJD A;  1PRM C;  4AFZ C;  4J9E A;  1W1F A;  2KXD A;  2QDL A;  1OPL A;  1UE9 A;  4RTU A;  4OMN A;  2ECZ A;  2KEA A;  2RQU A;  2EKH A;  4RTX A;  2CDT A;  3I35 A;  1AD5 A;  3TSZ A;  2DM1 A;  4GLM A;  1QKX A;  2YDL A;  1SRL A;  1RLP C;  2O88 A;  2FRW A;  2X3X D;  3H0F A;  2DLP A;  1OV3 A;  2FG0 A;  4LNP A;  1CKB A;  1H92 A;  2D1X A;  1KIK A;  2A28 A;  2GNC A;  1T3L A;  2DL4 A;  2HEQ A;  4HCK A;  1H3H A;  3A98 A;  1SEM A;  4E6R A;  1UGV A;  1NLP C;  2LJ0 A;  4J9G A;  1W6X A;  2LP5 A;  2NWM A;  2P4R A;  2F2W A;  3VRZ A;  2LX7 A;  1HD3 A;  5FWB A;  1KSW A;  1NM7 A;  2JM9 A;  2KRO A;  2GGR A;  5IHK A;  1MV3 A;  2JS0 A;  3QWX X;  1J3T A;  1PNJ A;  4A63 B;  1WI7 A;  2ENM A;  2DRK A;  1T0H A;  1GBQ A;  4LUD A;  2V1R A;  1CKA A;  2KRS A;  3M0T A;  2DL7 A;  5IXB A;  1ZUU A;  2VWF A;  1NEB A;  1RI9 A;  1UG1 A;  2DL3 A;  5FW9 A;  3VS0 A;  1WFW A;  1N5Z A;  2AK5 A;  2YT6 A;  2O2O A;  2LQW A;  3H0H A;  2W10 A;  1WLP B;  4LUE A;  4Z8A A;  1E6H A;  2RPN A;  2SEM A;  3EG1 A;  4CC7 A;  3I9Q A;  4AFS C;  1WXT A;  2LMJ A;  3NGP A;  5L23 A;  5IHI A;  1OOT A;  2ED1 A;  1BU1 A;  1ARK A;  1SRM A;  1NYG A;  2M51 A;  4J9D A;  4OMO A;  2KE9 A;  1MV0 B;  2A08 A;  2AZS A;  1QKW A;  2ROL A;  1M30 A;  4OMP A;  3VS6 A;  3EG0 A;  3SEM A;  1WA7 A;  2O31 A;  2GBQ A;  1NLO C;  1PRL C;  2YUO A;  2YUQ A;  1ZBJ A;  1WIE A;  2D8H A;  2B86 A;  1ABQ A;  1UUE A;  2O9S A;  4AFQ C;  2KYB A;  1WX6 A;  2HCK A;  2JTE A;  3LH5 A;  1GBR A;  4EIK A;  3EHQ A;  3PVQ A;  1K0S A;  1VA7 A;  2DX1 A;  2C0O A;  4F14 A;  2VKN A;  2DNU A;  1ABO A;  4ESR A;  2J6K A;  2EBP A;  4FSS A;  2K7A A;  1Z9Q A;  4Z88 A;  2DBK A;  2GTO A;  1I0C A;  2FPF A;  3M0R A;  2RN8 A;  5EC7 A;  1X27 A;  4ORZ A;  1GL5 A;  2YSQ A;  4RTT A;  1UTI A;  1M3C A;  3NHN A;  2EYZ A;  3PE0 A;  4D8D A;  1X69 A;  2EGC A;  2FPE A;  2EQI A;  2CT4 A;  2J6O A;  1GCP A;  1UFF A;  1YP5 A;  1U5S A;  1PWT A;  1SSH A;  1ZSG A;  5I22 A;  1U3O A;  2ESW A;  1A0N B;  2NUZ A;  4X1V A;  4J9C A;  4LE9 A;  2LNH B;  1PKS A;  2FEI A;  1UJY A;  4JJD A;  2MIO A;  2DA9 A;  3CQT A;  2OAW A;  3UA6 A;  2KGT A;  3EHR A;  3VS4 A;  1I07 A;  4OMM A;  2CH4 W;  2SRC A;  3EGU A;  2K3B A;  1QLY A;  2LCS A;  1K4U S;  1NEG A;  2K9G A;  2DMO A;  1RLQ C;  1JEG A;  1XOV A;  4CC4 B;  3H41 A;  2KYM A;  3O5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...