1JBMA

Heptameric crystal structure of mth649, an sm-like archaeal protein from methanobacterium thermautotrophicum
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
78
structure length
78
Chain Sequence
VNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The oligomerization and ligand-binding properties of Sm-like archaeal proteins (SmAPs)
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Structural genomics
molecule keywords PUTATIVE SNRNP SM-LIKE PROTEIN
total genus 14
structure length 78
sequence length 78
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2001-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1jbmA00
1LJOA 4F7UB 3JB9D 5DY9A 3RKXA 5GAMd 4J6XA 4J6YA 4EMGA 4C8QF 1HXDA 4M7AG 1WNLA 4PNOA 4M78C 1JBMA 1Y96B 3V8KA 4EMKB 4QVDA 4V2SA 4XQ3A 4M77C 1N9RA 4PJOD 2HNIA 2RA2A 2EJGA 2DTIA 4RCCA 5GAOl 3JCMP 1N9SA 2EAYA 1I4K1 2FB7A 3HFOA 4M75E 4X9DA 1H641 4XTXA 5GAOr 3V8LA 2Y90A 3PGGA 4M7DD 4C92F 4C8QD 3JB9J 3M4GA 5GANf 5GMKh 3JB9F 4QVCA 4C92E 4F7UA 4M75G 5GMKl 4NL3A 2YHTA 5GMKe 4F7UE 5GAN2 4A53A 3JCMb 3L2ZA 4C8QB 5GAN4 1LOJA 4M7DB 3VU3C 3JCMf 4F7UF 3JCMJ 2K57A 5GAN3 4OP0A 4DQ2A 2DEQA 4PJOB 2I2LA 2YLBA 3RKWA 1I81A 5LJ5e 3JCMW 5LJ3f 2EJ9A 4XTWA 3BFMA 5GAMf 3JCMX 1I8FA 5GAN7 3JCMd 1YCYA 3JB9G 1MGQA 2DTHA 4Y91A 3FJPA 1JRIA 4C92G 4J5YA 4M78G 4MMLA 2DVEA 4M77E 5GAMh 4XU0A 1U1TA 5GAOq 1I5LA 1B34A 4M7AF 5GMKm 4M77F 3EFRA 4M77D 4XU1A 3RKYA 5GAMj 4M7AA 5GAMe 5LJ3e 2DKGA 5GAN6 3BY7A 5LJ5f 1WQ7A 2E64A 3RUXA 3SB2A 3GIBA 3V7RA 5LJ5d 3V8JA 1X01A 5CAIA 3V7CA 4EMKC 5I21A 4JRIA 2DXUA 2CGHA 5GMKi 3JCMe 4RCBA 4JUVA 4XTZA 4A54A 4C92D 5LJ3j 4M78F 4N0AC 5GANj 4XTVA 4EMHA 3V7SA 1HK9A 3JCMh 5GAMg 4F7UG 4NOYA 3HSBA 4XU2A 4M7AC 1D3BB 3RESA 3RERA 4N0AA 4PJOE 3HFNA 4M75F 4NL2A 5LJ3h 1BIAA 3JCMc 5LJ5h 4C8QE 4EMKA 5GAOp 2EJFA 3QSUA 4M7DE 1M5Q1 1WPYA 2RM4A 2ZGWA 4JLIA 4M75D 4WF2A 3INZA 3AHUA 4M7DF 1D3BA 3L1AA 1Y96A 4M77B 2VXEA 1M8VA 1KQ2A 4M7DG 4PJOF 1TH7A 2E1HA 2JN0A 1U1SA 5GANh 3BDUA 4XU3A 4M78D 4X9CA 3FIFA 5GAOn 5GAOm 4PJOG 5LJ3g 4M7DC 4M7AB 3QO3A 4HA8A 5GANg 4M7AD 1LNXA 2DZCA 2YLCA 3JCMV 5GMKj 3JB9H 2QTXA 4M75A 2E10A 3JCMg 4MMKA 3SWNA 4C92C 4C8QC 5LJ5j 2DXTA 3JCMQ 3JB9I 4M78B 4C92B 3FB9A 4PJOC 1B34B 3QHSA 2FYKA 3SWNB 4M7AE 2VC8A 2DJZA 5LJ3d 3BW1A 2E65A 4M75C 4JRKA 4XTUA 2VXFA 3SWNC 4M78A 4C92A 5GANe 5GANd 4HT8A 2RD1A 4M75B 3RIRA 1BIBA 4HT9A 4PJOA 4M78E 4M77G 5LJ5g 2DZ9A 3EFSA 4J6WA 4XTYA 4C8QG 1KQ1A 5GAN5 4M7DA 1WQWA 4C8QA 2E41A 3QUIA 5GAN8 2EWNA 2RB6A 4M77A 2DTOA
chains in the Genus database with same CATH superfamily
2V8KA 1RI0A 4C8QF 1XTDA 2WSCE 4L59A 1JO8A 2J6FA 3JB9J 3QJYA 1FMWA 2ED0A 4HKEA 1QMCA 1NEGA 3M0TA 1NYFA 1J3TA 1WHKA 5GAN4 3MEUA 3OYKA 1WHLA 1PG5B 2NYSA 1PRLC 1LCKA 3FJPA 4M78G 1KHIA 2OTJA 4M77D 3TSZA 1PD0A 4RKUE 1H3ZA 1T0JA 1VOMA 3CCUT 5CVIA 4UC4A 3GOXA 4JJDA 3FLGA 3NMZC 2EGCA 2DA9A 3O8VA 3CCQA 1UG1A 2A28A 1ZA2B 2XICA 2QEXA 4R56A 3CCMQ 4QVZA 3ULRB 1Y71A 3CCLA 1UB4A 4M7DE 3MCAB 2EKHA 4JLIA 4R55A 1Q82U 3OMGA 1ZUKA 1VYVA 1YITA 3SD4A 3X20B 5FROA 1AD5A 4AT1B 1AVZC 2X4JA 2FZCB 4AMCA 7AT1B 1YHQQ 1LNXA 5GMKj 1PD1A 2YDLA 5AYFA 4KGZB 4GLMA 3HRUA 1TUDA 2DL5A 5GANd 2J06A 3CC7T 4M78E 2W10A 4M7DA 1WQWA 3L2VA 4J9FA 2MWPA 2O01E 5AT1B 2QQ9A 4C5HA 3G4SQ 2DXBA 4PJOD 1NPPA 2AIRB 3JCMP 3PIOA 2JS0A 1TXQA 5CIUA 1UHFA 1HD3A 1X6OA 4Q5WA 2KEAA 2K3XA 2YHTA 2QI2A 5GMKe 1RAIB 4HCBA 3L2ZA 1KD1C 3LGFA 4DA4A 3OSVA 3L2RA 3G4ST 3ZFJA 1YI2Q 1Q86C 1D1BA 4J8OA 4XTWA 2KI7A 1OZ2A 2KGTA 2MCNA 2KBTA 2L2PA 5L8RE 1M1FA 1X6GA 1PHTA 1UTIA 2RF0A 4ZGEB 3GIBA 3CXCP 2E64A 5D7UA 5KH6A 1LVKA 2L8DA 3OBYA 2K2MA 1PSFA 3VKIA 4RCBA 3I56A 2AZSA 3P8HA 4XTZA 2K5FA 3VRYA 3QG1A 4N0AC 2DL3A 5GAMg 3HSBA 4AFZC 1YIJQ 3M58A 1K76A 3RERA 2EYQA 1X69A 2RQRA 2LJ1A 1M8MA 3VS5A 1D0YA 1JXOA 2BTTA 1YHQA 2LJ3A 2YUQA 1NEBA 1JB0E 1V76A 4FT2A 5CK9A 3FIFA 3T9NA 3CXCS 1OI1A 1AWWA 3JCMV 4M75A 2XMFA 1OX8A 4RTXA 1I1JA 3DLLA 1KFZA 2HEQA 3EG0A 1O9SA 3QYGB 5GANe 1OX9A 4LE9A 1G3WA 2CUBA 3H41A 3CCST 4QW2A 5CKHA 2ZPEB 3EFSA 5IHIA 4E7ZA 3REAB 2F69A 4OB3B 2RMOA 1G83A 2HNIA 2EQMA 2A0FB 1NPRA 2Y90A 1HSQA 3KUFA 2C0TA 1C1AA 1AZGB 1Y07A 2MAMA 4DBQA 5KYWA 3CCEQ 1QQJA 3UDCA 5LJ5e 2EJ9A 5GAMf 1SRMA 1MGQA 4BI4A 1NYGA 1B7TA 3CC2T 4XU0A 2VV5A 4OB1B 2DL7A 4M7AA 5C6SA 3X26B 2LDMA 4C0FA 1VQ8T 2LVMA 2RHIA 3MO8A 2Y4XA 4EMHA 2L0AA 1FYNA 1S72Q 3M57A 1UECA 1VYUA 2BE7D 3WVDB 3A8MB 2QG9B 2X51A 3NTKA 2KNBB 5CKEA 4KH1B 2EJFA 4GBQA 3QYHB 4HVWA 3DB4A 2OI3A 2NUZA 4N4IA 3CCMA 1M1KR 3OY9A 3A1PA 1QVGA 4IUUA 1KQ2A 1BI0A 2EYYA 4PJOF 1VA7A 2VASA 1KK7A 2D1XA 1X75C 1AWOA 4HA8A 2DZCA 1VQOA 2EYWA 4C92C 3CC4T 1Y7XA 3OQ5A 2DYBA 1B34B 1VQPQ 2HL3A 1O75A 2BUDA 2PUKB 4HT8A 2CS7A 2RQWA 4HT9A 4M77G 3CPWA 1G5VA 1NJIU 3SEMA 1KQ1A 2XKOC 4IUTA 4RG2A 4D8KA 5EG2A 1LJOA 5A0GA 4N4GA 2O31A 1VQPA 2D0QB 1WJQA 1N5ZA 4C5GA 1BCOA 3OBWA 4QT7A 2E6NA 1ABQA 2EAYA 2FB7A 3OW2A 5GAOr 4JZ4A 2HKNA 1X43A 2CZ0B 2KROA 2EYZA 5GMKl 3S6WA 2EGAA 5GAN2 1M90U 2GGRA 1VQKQ 4ATOA 1N8RR 1YJWA 3VV0A 1UHCA 4MZPA 4PJOB 3P8BB 1RI9A 4E7SA 2FZKB 1I8FA 3JB9G 3ZEHA 2FVUA 2COZA 1KC8C 4HCCA 2HAXA 2DVEA 4M77E 4M4ZA 4M77F 4JLGA 2AK5A 2GNCA 1JJ2P 5GAN6 4BD3A 5LJ5d 2CP2A 2DXUA 5KCHA 2RNAA 3NTHA 4PJNA 2DVJA 3PMIA 5GANj 1YJNQ 4E6RA 1UJ0A 5D6WA 3E9FA 4N0AA 2ECZA 1VQOT 4ZTJA 2K5IA 2JZ2A 1BKBA 2RM4A 3LLRA 4KT0E 4IKFA 2ENMA 3L1AA 4M77B 2KXDA 2VXEA 3C4SA 4DBFA 3FC3A 1QCNA 2E1HA 2JN0A 2PTKA 3KFVA 2R5AA 1YIJT 4YTLA 1MMAA 2OJ2A 3J80E 2QTXA 2F2XA 2QDLA 1UFFA 2R5MA 2KRNA 3QHSA 3OYNA 4J9CA 2E65A 1QKWA 4JRKA 2VGNA 1T0HA 3RIRA 1CSKA 4DBHA 5LJ5g 2COWA 2DZ9A 4OMNA 2HCKA 2MIOA 2KRMA 5KYWB 3M0UA 5LL6S 4M77A 4ESRA 3RKXA 2QQAA 4CRIA 2C0OA 2K3YA 2YUPA 3CCRT 4ZGJB 4XQ3A 2FO0A 3X28B 1XNIA 4JRPA 4M75G 4BI3A 1U06A 4OMLA 3NTIA 2J7IA 4FM4B 2DAQA 2LCSA 2XDPA 2K57A 3M54A 2X9HA 4FL6A 2JVVA 2YLBA 1SHGA 3QKJA 2XK0A 2E5KA 1QVFA 1DJ7B 5CQXA 3HKSA 1JXMA 1YBYA 1EZZB 2X35A 2QGGA 2J6OA 1E6HA 4K11A 2F5KA 3VYHB 5GJWB 2CP7A 2KQWA 3EG3A 1BK2A 1Y0MA 5LJ5f 2K7AA 2CGHA 3LGLA 3KXTA 4C92D 3JV3A 1YNZA 2E3IA 1OU9A 1BYMA 2VWFA 5CCAA 5I2MA 4Y92A 4XU2A 1OYXA 2DD5A 5KCOA 4BACA 1M30A 3PT9A 1U8RA 2GQIA 5A0LA 2XIDA 4C8QE 4E7JA 3QSUA 1AWXA 2ZPFB 3UA7A 1C0MA 2KT1A 2PU9B 4DOWA 5IHNA 2D6FA 4QQDA 1FXXA 1KG1A 1PWTA 3C95A 2F2WA 4FYVB 1VQKA 3EGXA 4M7AD 3DKMA 4RTUA 5IHKA 5GANf 3S3NA 4RMOA 4C92B 1GCQC 1X6BA 2DX1A 2A3LA 2FYKA 3SWNB 1OULA 4M7AE 3SWNC 4PFOA 1ZHIA 4BE2A 4CI0C 4OMQA 2LX7A 2P84A 1PNJA 4OMPA 3META 3CD6A 1X2KA 3I55A 2JUFA 2YSQA 2OTLA 1S1NA 1PM3A 1UGVA 2X4YA 4D6WA 1YIJA 4XTXA 1VQLT 3M4GA 1KIKA 3EG9B 4C92E 1RAGB 2ED1A 2OX7A 2EQIA 4M7DB 3M55A 1UGSB 2A36A 1VQLA 2CREA 2X3XD 2I2LA 2H3EB 1N8RU 2XHCA 3MHXA 5IH2A 1SRLA 3MP1A 3VUBA 1ZSZA 2KYMA 2L3SA 2OTLT 9ATCB 1M27C 2XD0A 1W6XA 1Q81C 1D09B 1TSFA 3IQLA 4Y28E 4O5VA 1IGQA 3BY7A 1WQ7A 1VQNQ 3QDFA 4ZN3A 1X01A 1K9MR 2DLPA 2LQKA 5C0MA 4F7UG 1VQ4A 1VQ5A 1IREB 5IXFA 2IPOB 3VRZA 4M7AC 1SPKA 4LDWA 4E7HA 2PVDB 1KC8R 4O6JA 3TQ7P 2CP5A 4NS5A 4BB7A 4C0DC 2RJCA 2VKNA 3OS1A 1NE8A 2E6ZA 1IGUA 2Y4YA 3E9GA 4FW1A 4B6MA 5FLXE 1G3TA 4RTVA 2E10A 1FMVA 4MMKA 3CCLT 3I9QA 1VQPT 1M3AA 1VIFA 2LT4A 3Q1JA 4PFPA 1QKXA 1OU8A 2D9TA 4DBRA 1K73U 2IIMA 1W2BA 1RL2A 1ABOA 4J6WA 1EFNA 1M4ZA 2KAFA 5KE2A 4KUDK 4OF1A 2DTOA 3JB9D 4GLKA 1QVFP 4M7AG 1HXDA 3UWNA 3I55T 3QXEB 3L2QA 4EMKB 1G3SA 2W0ZA 1QLYA 5IN1A 5GAOl 3OMCA 2DRKA 4BY6C 3V8LA 3EGDB 2PZ1A 2X4XA 2LQNA 2RI2A 2ZZDA 2QQBA 1WX6A 2D0NA 2NUTB 3VU3C 3JCMJ 2JNGA 2A08A 2FRYA 1KQSS 1BCMA 1WZOA 1ZX6A 2JJ9A 2M0YA 5GAN7 4LDYA 2ATCB 2SEMA 1YCYA 3CCRA 2CZ1B 1Q86U 3PE0A 4C92G 2JM9A 2RHYA 4MMLA 1WXTA 2V8JA 4ZGDB 2QQSA 3L2UA 2OTJQ 2RHZA 3AT1B 1VQ8A 1AEYA 4FW2A 2E3HA 3MP6A 4RTTA 1BI1A 5CAIA 4LD9K 2F2VA 3V7CA 3OYGA 5GMKi 1B3QA 2YT6A 3M56A 2ZPHB 1VQ7Q 1YJNT 1Q86R 2V1RA 3VS2A 4A4HA 5HK0A 4IUVA 2ROLA 2LNHB 4N4HA 3JCMc 1RAHB 1UGPB 1MV3A 3A8HB 4M75D 1OPKA 4KH0B 3R6NA 4RG8A 2NUPA 3FDRA 2DD4A 3DLMA 1TH7A 1U1SA 2VYTA 1Q7YU 2DBMA 2WSFE 1WJSA 2X4WA 2GCXA 8ATCB 1M8VA 1NG2A 3JRZA 3JCMQ 3EHRA 3FRNA 1FMKA 3FB9A 2D8JA 1M2VB 1GCPA 4IUQA 2EGEA 4JRQA 4L5GA 1BIBA 5L23A 1YJNA 2FL7A 4XTYA 3CCSA 2E41A 1ARKA 3H8ZA 3QUIA 1D0XA 1WHMA 1VQ4T 1VQ5T 2LC4A 2QGFB 1ZUYA 1W2BS 2DETA 3CPWP 2RJEA 1K1ZA 1VIEA 2V26A 3G6EQ 2EJGA 1IB8A 1H641 3PGGA 1YJWT 2ABLA 2AKLA 5KYXA 1QP2A 5D6YA 3J7AF 2QXFA 1HYOA 2R58A 2KE9A 1Q7YR 1NLOC 3GP8A 3TEEA 3HP9A 3SDZA 2FPEA 5CKFA 2RK1A 2RJFA 3HL8A 2JTFA 2QEXT 3ME9A 5KE3A 2EIFA 2HBPA 3RKYA 3FEOA 1H3HA 1K0SA 4LUDA 2VUBA 1WJRA 2HDAA 3V7RA 4JS4A 4A4KA 4MDXA 1YP5A 2RI5A 4Z8AA 1K9MU 1VQ8Q 2ESWA 3L2WA 1GXIE 1BI3A 3V7SA 1HK9A 2FPDA 4J9EA 3EH2A 3OYHA 3S3MA 2QEXQ 2P0QA 1RADB 2K79A 3G4SA 3M0RA 3EGUA 5GAOp 2RH2A 1WPYA 2P4RA 1W4SA 4C0ZA 4E47A 3AHUA 3CPWS 4OGEA 3INZA 2VVKA 2DNUA 4M7DF 5CO7A 4II1A 2K9GA 2PUOB 1R0CB 1VUBA 4A4FA 2DIGA 3NPFA 5LJ3g 1YWPA 1XQHA 1VQKT 3EFOA 4FSSA 3MEWA 4J9IA 4RTYA 3OYMA 4CC4B 2E4HA 1UE9A 3CCRQ 5FRNA 2EQJA 3CQTA 4OMFB 5J39A 2AKKA 2RN8A 1G3YA 1I0CA 1RAAB 2FRWA 2QQRA 2J6KA 4FYYB 2YWWA 1M3CA 3H9NA 2RB6A 2EVRA 3CC2A 3NFCA 2DJQA 4J9GA 3TREA 1JBMA 1V1CA 1UGRB 1IRXA 1ACMB 2M9UA 4J9HA 1IHWA 2FG0A 2RO0A 4QQGA 1VQ6A 1ZSZC 3OW2S 3OB9A 2P0KA 3EAEA 1JJ2A 1VYTA 3UPUA 1NLPC 1I81A 1VQMT 2HQHA 1GFDA 3QIIA 2HL5C 4J5YA 3OYBA 1M2VA 1U1TA 5CKBA 2BKDN 2HQXA 1KQSP 1RACB 4C0DB 2LCCA 5ECAA 3V8JA 3CEYA 2HSEB 2AZVA 4AFUC 4Z89A 2MWOA 4ANJA 4XTVA 3I5RA 1E6GA 1D3BB 1QCOA 3CC4Q 3CMEQ 2RHUA 1XJWB 2DPPB 3M0PA 3MPUB 2BZ8A 3MKDA 3PIPA 1YCSB 2JOYA 1OPLA 4M7DG 2CH4A 3BDUA 5I2SA 3HTRA 3UATA 1TG0A 5CKDA 4PJLA 1Q7YC 1LPLA 3OS2A 3ZL7C 1M2OA 3JB9H 4C8QC 1E7OA 1T3SA 2DXTA 3UF4A 2L3QA 2HQEA 5HCKA 1NZ9A 3RBBB 4C92A 3L42A 2E5QA 1QP3A 1YFNA 4Z88A 4OB2B 2H8HA 1TWBA 3LX7A 2Z0WA 2QAZA 1UDLA 4RUGA 2QA4Q 2JTEA 1Q95G 2C0IA 1CKBA 4IUPA 2BIVA 4PNOA 3WXMB 3PTAA 4V2SA 3D7SB 2RA2A 3LWIA 3H0HA 1WLPB 1I4K1 2OTLQ 1VQ9Q 2DIQA 2PVOB 3JB9F 1GL5A 1JQQA 5FW9A 4FU6A 1B07A 3M4YA 1MUZA 4C5EA 5DLQE 1NM7A 4DQ2A 1M3BA 3JCMW 5LJ3f 3BFMA 3QZ5B 3OYJA 5CQYA 3GLXA 4LUEA 1YHQT 4X34A 5GAMh 2LMJA 1B34A 2LP5A 1FWZA 3CCJT 1I07A 1RLQC 2C06A 4E7LA 4E7KA 5KYYA 5HK3A 3E1SA 3CCUQ 2YRVA 1VQ9A 1IZ6A 4LDUA 4OGCA 1WHHA 4NL2A 4OVAA 3OYEA 3OYDA 3M0QA 2M0OA 1ZBXA 1WYXA 4WF2A 2SRCA 2RQUA 4ZNXA 1QVGP 3JSCA 3J81E 4PLIA 3CMAQ 4X9CA 8AT1B 4PJOG 3RMQA 2CP0A 3RNJA 4LDVA 3QO3A 1TUCA 2XU8A 4ELZC 4M7DC 3JCMg 3EHQA 3NGPA 4M78B 3MP8A 1NJIC 3I5SA 3QJ6A 4HXJA 3EFOB 2QA4A 4HCZA 5HY6A 3CCEA 3NHNA 3VS6A 1VQNA 4PKCC 2I0NA 2EWNA 5GANg 3CD6T 5DY9A 4J6YA 1CKAA 4M78C 2CZ7B 5FWCA 1SEMA 2MOXA 1KJWA 4M77C 4X9DA 4AG1C 1K8AR 4PJJA 3CC7A 1N27A 1YN8A 3CCVQ 2CH4W 4F7UA 1IHVA 2FPFA 1GBRA 2V1QA 3OS5A 3I55Q 2BZXA 3FJ5A 1KC8U 3H0FA 1ZUUA 4HCKA 2DTHA 1N8RC 2PVGB 3E2UA 4M7AF 5GMKm 4A63B 3RUXA 4AFQC 1MV0B 1WFWA 1Q81U 2MYSA 5KYNA 1VQ6Q 1X2QA 2JM8A 1IO6A 2DK3A 4EMKC 1HJDA 5FU7C 2NUTA 2WSEE 4M78F 5KYXB 1UJYA 4PJMA 2BE9B 3OYIA 1AOJA 2CSQA 3LH0A 4JJNK 5LJ5h 3EGDA 1Q82C 1YJ9Q 2RI3A 3H0IA 4OMMA 3CC4A 1SSHA 1M1GA 3TVTA 1UUEA 4HVUA 5FU6B 3RDVA 2YUNA 2X3WD 1M1KC 2EW3A 4PL6A 5KYUA 2QK0A 1Z9ZA 3VS0A 2E12A 3CCMT 3JB9I 4PLLA 2V8IA 2DILA 4F14A 4JS5A 1YITQ 2CUDA 5LJ3d 2O4XA 4ZN1A 2LCLA 1KD1R 5GJVB 1SG5A 1K73C 4E7IA 5GAN5 2GFAA 4EDUA 4CC3A 4EMGA 1PSEA 3PVLA 2CT3A 5IAYA 3I56T 4IIMA 2KMTA 3CBOA 4LNPA 1VQ7T 3G6EA 3LW5E 2FZGB 1VQOQ 2YRDA 3EH1A 1OZ3A 3CC7Q 2M1HA 3M53A 1SKUB 2P4TA 3CCVT 1U5SA 2PQWA 4FYXB 1KD1U 4XK8E 2K3BA 2JXBA 2AHJB 4ME7A 3JCMb 3VJPA 5KYYB 2XDBA 2KSSA 3CCVA 3M5AA 2XG8D 3M0SA 3VUZA 1WXBA 3GNGA 3TU4K 1I5LA 1EIFA 1GBQA 1WHJA 4FT4A 3X25B 4XAXB 5KYUB 1K8AU 3M59A 2DKGA 3OYYA 4IIOA 3CPFA 1PKTA 2KVQG 1F1BB 2E70A 4JUVA 1AWJA 3OSSC 1PC0A 3HHTB 1N6AA 2L89A 3REBB 4F04B 1FX7A 4EMKA 1Z9QA 3F70A 1M5Q1 2DL8A 2ZGWA 4QQ6A 4BDYA 1EX4A 3CCSQ 2KY9A 4IURA 2MMPA 1M90R 4M78D 5EC7A 1VQMQ 4BY6B 5GAOm 4KBMB 2OAUA 4D8DA 1OEBA 1QVPA 1WIEA 2CSIA 4KULA 2LRQA 2EBPA 1R0BG 2GTJA 4BUGA 2GFUA 4LN2A 1K73R 1YITT 2DJZA 2VXFA 2K2VA 1K9AA 1R8OB 2QASA 3A8OB 4C8QA 2JMCA 1S72A 5FWBA 1YI2A 3CCQT 3VS1A 4JZ3A 4F7UB 1WGSA 1UEBA 5GAMd 2DO3A 5I11A 4EPCA 4QVDA 3CCLQ 2O9SA 4BE1A 4JJBA 1N9SA 3PVQA 3EG2A 3CC2Q 4M7DD 1K0XA 2M02A 1ZBJA 4BI8B 1W2BP 2L3RA 2EQKA 3DB3A 2COYA 2EPDA 4NL3A 1PCXA 4E2FB 2DE0X 1MMNA 1WHGA 1LOJA 2RHXA 4J9DA 2B8AA 5GAN3 1M90C 3VS7A 3RKWA 2VB6A 1Q82R 5J3BA 2OAWA 2K6DA 1TOVA 1MHNA 2R57A 2LT1A 1GFCA 3VYGA 1D1CA 3EFRA 4FIBA 5GAMe 2YUOA 2O2OA 3HRSA 4KRTA 2DEUA 2HSPA 5J26A 3G7ZA 4FSXA 1K9MC 3CBPA 2AT1B 2NWMA 2KR3A 3N5BB 3ER0A 2K5LA 3LH5A 3MJXA 3A5ZB 5HKCA 1D3BA 1PRMC 4F17A 4AG2C 3CMEA 1P92A 2JW4A 3SHWA 4Z02A 3EG1A 1OOTA 1RLPC 1BU1A 2F1LA 1WA7A 1ZQ1A 1M9SA 3C12A 4JJCA 5A0DA 3SWNA 5M9OA 5FU7B 1QWEA 2DXCA 3BW1A 4MZTA 2CT4A 1YJWQ 4M78A 3EGXB 2RD1A 1D1AA 2JS2A 1SF9A 3GPLA 4C8QG 4CC2A 2YRCA 2EQUA 2FEIA 3BDLA 4B9WA 1NJIR 3G1JA 3LWHA 3CCUA 3CXCA 3PMTA 5A2QE 2LZ6B 1N9RA 1UGQB 3UA6A 5IXBA 2CDTA 4M75E 3SFMA 1G2BA 3PNWC 2HBWA 4C92F 4ZTFA 1RABB 4QVCA 3G71A 3OYFA 1ZSGA 2IG0A 1SSFA 1BB9A 4JPBW 3OYLA 4A53A 4C8QB 4C0GA 4J7IA 4KGXB 1QW1A 4F7UF 1I5OB 1D0ZA 2DEQA 5I22A 2DBKA 2G3RA 1ZA1B 1JJ2S 2JT4A 3G71Q 2CZ6B 3URGA 1G8XA 5GAOq 4C5IA 2CKKA 1XOVA 2HZYA 1OV3A 3UT1A 5LJ3e 2GTOA 2A37A 2JMAA 2LTOA 4R0KA 2EYXA 2O9VA 1K8AC 3X24B 4GY5A 1W70A 2VGMA 2KK4A 5LJ3j 5FU6C 3KBGA 4NOYA 3OYCA 2GBQA 1KQSA 3RESA 3RR6A 1YJ9T 3CCJQ 1PKSA 3ASKA 1R77A 2LNVA 4EIKA 2RK2A 1MMGA 3CBMA 3PFSA 2WACA 3M9QA 2ZPGB 2DF6A 2IVWA 2ZPBB 4KGVB 4XU3A 3QDRB 2EFIA 5GAOn 2KXCA 1TTHB 1RUWA 4M7AB 2G6FX 4FYWB 3CD6Q 2RJDA 1MNEA 3OYAA 1AHJB 1ZSZB 4PJOC 2HMAA 3G71T 1SHFA 4M75C 1T3LA 2ROTA 4VUBA 2MK5A 3TSWA 2KRSA 1A0NB 4WCIA 3QZ9B 1VQNT 2FHDA 2DL4A 1WI7A 3OW2P 1QVGS 3CCET 1VQ4Q 1VQ5Q 2KT8A 2QA4T 2ZAEA 4BE0A 4MDWA 3EG9A 2ZCFB 3I56Q 2MI6A 2DMOA 1TUGB 1Q81R 1Y96B 2O88A 2L5QA 3HFOA 2JTMA 4WTOB 5GMKh 2DYIA 2XDDA 2GQVA 2L3PA 4F7UE 3GBQA 3RMSA 4PK4A 1VQ6T 3A8LB 4OP0A 2DFUA 3CMAT 3CMAA 2O4XB 4Y91A 4ELYC 3CMET 4HVVA 2LJ0A 2DERA 3JAME 3SB2A 3BE3A 2RPNA 4OB0B 4MZMA 2DRMA 1W1FA 4RTWA 4A54A 2CYZB 4OMOA 3CCJA 1KHCA 4A4GA 3S3OA 3QBYA 1C6VX 4AFSC 3HFNA 2OTJT 3OA6A 4LXCA 2HD0A 2M51A 2QDYB 3MEVA 5FRMA 3I35A 3THKA 1TU0B 1MNDA 4JDSA 4J9BA 2QTVA 2PNIA 1GCQA 2RQVA 5DLOA 1X27A 2CP6A 5LJ5j 5DM7R 2D8HA 1ZLMA 2GF7A 2VC8A 2P0PA 4J7FA 1VQLQ 4BDZA 3R6OA 2LQ8A 4M75B 3QWXX 3GNFB 3HPWA 4LDXA 2XI9A 2MF2A 3WVEB 1JEGA 2LQWA 1BI2A 3CCQQ 3HRTA 1GRIA 4J6XA 3VS4A 1YI2T 4TVRA 1WNLA 2DM1A 3V8KA 4FCYA 1S72T 1AZEA 4RCCA 2F5TX 2DTIA 3E19A 4C8QD 4DEYA 1YWOA 1QVFS 1RAEB 3C0CA 3JCMf 1QCFA 2A7YA 5CR2A 1Y57A 4DEXA 3H6ZA 4PFZA 4A4EA 1V29B 3G6ET 3JCMX 2J05A 3JCMd 2HKQB 1JRIA 1VQ9T 3P8DA 1AT1B 4XU1A 3MEAA 5GAMj 2NLUA 1OQKA 3QPHA 3C94A 3VS3A 2H3JA 6AT1B 5I21A 4JRIA 5IT9E 3TCJA 3JCMe 2ZPIB 2NUPB 1K4US 1RAFB 3QWYA 1NBEB 2EKOA 2MPXC 3JCMh 4DOVA 3O5ZA 1WXUA 4PJOE 1JU5C 4M75F 5LJ3h 1BIAA 2KYBA 2B86A 1BBZA 2CP3A 4L6V5 3A98A 1VQMA 4LD6A 4B9XA 1Y96A 1TS9A 3GF5A 4RTZA 5GANh 4F16A 2KDSA 4ORZA 4QKUA 3ZBDA 2YLCA 1M1KU 3OS0A 1H8KA 1QWFA 2K4YA 1H92A 2M16A 2RQTA 2QYZA 2LX9A 4KUIA 4J83A 2BZYA 4XTUA 2YXYA 4P5NA 1YJ9A 3LYIA 3A8GB 4X1VA 1MMDA 4PJOA 4CC7A 1U3OA 1IXDA 1VQ7A 5D6XA 1KSWA 3U23A 5GAN8 1WDXA
chains in the Genus database with same CATH topology
4F7UB 1WGSA 2V8KA 3NFCA 1UEBA 1RI0A 3RKXA 2QQAA 5GAMd 3CC2A 2DO3A 4C8QF 4CRIA 2K3YA 1XTDA 1JBMA 3TREA 2WSCE 4EPCA 4QVDA 4ZGJB 3CCRT 4XQ3A 4BE1A 4L59A 1N9SA 1UGRB 3X28B 2M9UA 1XNIA 4M7DD 4JRPA 3QJYA 3JB9J 4HKEA 2RO0A 4BI8B 2L3RA 2EQKA 4M75G 3DB3A 4QQGA 1VQ6A 4NL3A 4BI3A 5GAN4 3MEUA 3OYKA 3OW2S 3NTIA 1LOJA 3OB9A 4FM4B 2DAQA 2RHXA 2P0KA 3EAEA 1JJ2A 2B8AA 2XDPA 2K57A 3M54A 5GAN3 3UPUA 1M90C 4FL6A 2JVVA 2YLBA 3RKWA 1I81A 3QKJA 2XK0A 1VQMT 5J3BA 1QVFA 1DJ7B 5CQXA 3HKSA 1YBYA 2X35A 3FJPA 3QIIA 4J5YA 4M78G 3OYBA 1MHNA 2F5KA 1KHIA 2R57A 1U1TA 3VYHB 2LT1A 2KQWA 5CKBA 3VYGA 2OTJA 3EFRA 4M77D 2BKDN 4FIBA 5GAMe 2HQXA 4C0DB 5LJ5f 3HRSA 4RKUE 2LCCA 1H3ZA 3V8JA 3CPWS 3CEYA 3CCUT 5CVIA 5J26A 2CGHA 3LGLA 4UC4A 3GOXA 3G7ZA 3FLGA 4FSXA 4C92D 3KXTA 2MWOA 4XTVA 1BYMA 3O8VA 5CCAA 3CCQA 1K9MC 3CBPA 5I2MA 4XU2A 1OYXA 1D3BB 2DD5A 2XICA 2QEXA 5KCOA 4R56A 4BACA 1YI2T 4QVZA 3PT9A 1U8RA 3N5BB 3CCLA 1Y71A 2RHUA 3ER0A 1UB4A 2K5LA 5A0LA 2XIDA 4C8QE 4E7JA 3A5ZB 3QSUA 2DPPB 3MCAB 2ZPFB 4M7DE 5HKCA 4JLIA 4R55A 1Q82U 3OMGA 1D3BA 1YITA 3PIPA 3SD4A 2PU9B 2JOYA 3CMEA 1P92A 3X20B 5FROA 4DOWA 4M7DG 2D6FA 4QQDA 4Z02A 3BDUA 5I2SA 1FXXA 1KG1A 3C95A 2X4JA 1ZQ1A 5CKDA 1VQKA 1Q7YC 4M7AD 3DKMA 1LNXA 1M9SA 3OS2A 5GMKj 3C12A 5A0DA 4C8QC 5GANf 3JB9H 3SWNA 2DXTA 5AYFA 5M9OA 4RMOA 3S3NA 4C92B 5FU7B 2HQEA 3AHUA 2A3LA 2FYKA 3SWNB 4M7AE 1NZ9A 2DXCA 3BW1A 3HRUA 4MZTA 4C92A 3L42A 3SWNC 2E5QA 4M78A 5GANd 3CC7T 1QP3A 2RD1A 1ZHIA 4OB2B 4BE2A 4M78E 3GPLA 4CI0C 4C8QG 3LX7A 3META 4M7DA 1WQWA 3L2VA 3CD6A 2EQUA 3BDLA 4B9WA 3I55A 2MWPA 2JUFA 3LWHA 2O01E 4IUPA 3CCUA 2OTLA 2BIVA 2QQ9A 3CXCA 4PNOA 3WXMB 4C5HA 3PTAA 3PMTA 5A2QE 4V2SA 2DXBA 2X4YA 1N9RA 4PJOD 1UGQB 4D6WA 2RA2A 1NPPA 3LWIA 3JCMP 1YIJA 4M75E 1I4K1 4XTXA 3PIOA 3SFMA 5CIUA 1VQLT 1X6OA 3PNWC 4Q5WA 4C92F 4ZTFA 3M4GA 2DIQA 2PVOB 3JB9F 4QVCA 4C92E 3OYFA 3G71A 2IG0A 1SSFA 2K3XA 4FU6A 3OYLA 2YHTA 3M4YA 2QI2A 5GMKe 4C5EA 4A53A 5DLQE 3L2ZA 4C8QB 4HCBA 4C0GA 1KD1C 3M55A 1UGSB 4J7IA 4M7DB 3LGFA 4DA4A 1QW1A 4F7UF 3OSVA 3L2RA 1VQLA 4DQ2A 2DEQA 2I2LA 3G4ST 3ZFJA 1Q86C 4J8OA 3JCMW 1N8RU 2XHCA 5LJ3f 4XTWA 3BFMA 3QZ5B 3OYJA 2G3RA 3MHXA 5CQYA 1OZ2A 3GLXA 1YHQT 4X34A 1JJ2S 3MP1A 2CZ6B 3URGA 3VUBA 2OTLT 5L8RE 5GAOq 5GAMh 1M1FA 4C5IA 2CKKA 2XD0A 1B34A 1XOVA 1Q81C 4C0ZA 1FWZA 3CCJT 4Y28E 3UT1A 5LJ3e 4ZGEB 4O5VA 3BY7A 4E47A 1WQ7A 2E64A 2LTOA 3GIBA 2C06A 4E7LA 4E7KA 4ZN3A 1X01A 5KH6A 2L8DA 3OBYA 1K8AC 3X24B 5HK3A 4GY5A 3E1SA 1PSFA 3VKIA 2VGMA 2KK4A 4RCBA 3I56A 2LQKA 3P8HA 4XTZA 2K5FA 2YRVA 5C0MA 5LJ3j 1VQ9A 3QG1A 4N0AC 1IZ6A 3KBGA 5FU6C 5GAMg 3HSBA 4F7UG 4NOYA 1VQ4A 3OYCA 1VQ5A 1IREB 1KQSA 4LDUA 4OGCA 3M58A 4M7AC 3RESA 3RERA 4LDWA 4E7HA 4NL2A 4OVAA 2EYQA 2PVDB 1YJ9T 4O6JA 3OYDA 3OYEA 3ASKA 2M0OA 4NS5A 1ZBXA 2LNVA 4BB7A 2RK2A 2RJCA 4WF2A 4C0DC 3OS1A 3CBMA 3PFSA 1VQMA 2WACA 3M9QA 1NE8A 2ZPGB 3JSCA 2E6ZA 2IVWA 3J81E 1JB0E 2ZPBB 2Y4YA 4FT2A 4PLIA 4XU3A 3QDRB 4X9CA 5CK9A 3E9GA 3FIFA 2EFIA 3T9NA 5GAOn 4PJOG 3RMQA 3CXCS 4M7DC 4M7AB 1OI1A 4LDVA 3QO3A 5FLXE 1G3TA 2XU8A 3JCMV 2RJDA 4ELZC 4M75A 2E10A 3JCMg 4MMKA 3OYAA 3CCLT 1AHJB 4M78B 1VQPT 4PJOC 1VIFA 2LT4A 3Q1JA 3DLLA 3G71T 4M75C 1O9SA 2D9TA 3MP8A 3QYGB 5GANe 1NJIC 1K73U 4VUBA 3QJ6A 2QA4A 1G3WA 4HCZA 5HY6A 3CCST 4QW2A 1W2BA 5CKHA 3CCEA 1RL2A 2ZPEB 3EFSA 4J6WA 3QZ9B 1VQNT 2FHDA 4PKCC 1VQNA 1M4ZA 2KAFA 1QVGS 5KE2A 3CCET 4KUDK 4OF1A 2EWNA 5GANg 2QA4T 3CD6T 2DTOA 4BE0A 4MDWA 3JB9D 4GLKA 5DY9A 2F69A 4OB3B 2ZCFB 4J6YA 2MI6A 1HXDA 3UWNA 3I55T 4M7AG 4M78C 3QXEB 3L2QA 1Y96B 2CZ7B 4EMKB 1G3SA 4M77C 2HNIA 5IN1A 2L5QA 3OMCA 4BY6C 2EQMA 5GAOl 3HFOA 4X9DA 1NPRA 2JTMA 2Y90A 3V8LA 2X4XA 3KUFA 3CC7A 1N27A 5GMKh 2RI2A 1Y07A 4F7UA 2ZZDA 2XDDA 2QQBA 2GQVA 4F7UE 2MAMA 3RMSA 3VU3C 1G5VA 3JCMJ 2JNGA 1VQ6T 3UDCA 3A8LB 3OS5A 4OP0A 3CMAT 1KQSS 3CMAA 1KC8U 5LJ5e 2EJ9A 5GAMf 5GAN7 4LDYA 2O4XB 1YCYA 3CCRA 1MGQA 2CZ1B 2DTHA 4Y91A 1Q86U 4C92G 4ELYC 1N8RC 4BI4A 3CMET 2RHYA 4MMLA 3CC2T 2V8JA 4XU0A 4ZGDB 2QQSA 2PVGB 3L2UA 2VV5A 4M7AF 5GMKm 4OB1B 2RHZA 1VQ8A 4M7AA 3JAME 5C6SA 3MP6A 3RUXA 3X26B 3SB2A 1Q81U 1BI1A 5CAIA 2LDMA 4C0FA 3V7CA 4EMKC 2DK3A 3OYGA 4LD9K 5GMKi 4OB0B 1VQ8T 4MZMA 5FU7C 4A54A 2LVMA 2RHIA 3MO8A 2WSEE 2Y4XA 4M78F 4EMHA 2CYZB 3CCJA 3M56A 1KHCA 2ZPHB 3M57A 4A4GA 3S3OA 3WVDB 3OYIA 1YJNT 3QBYA 4A4HA 5HK0A 3A8MB 3NTKA 3HFNA 3LH0A 4IUVA 4JJNK 2OTJT 5CKEA 4N4HA 3JCMc 5LJ5h 3OA6A 1Q82C 1UGPB 2EJFA 3QYHB 2RI3A 2HD0A 3A8HB 4M75D 3DB4A 2QDYB 3MEVA 5FRMA 4N4IA 3CCMA 3CC4A 4RG8A 1M1GA 3FDRA 3OY9A 2DD4A 1QVGA 4IUUA 1KQ2A 1BI0A 3DLMA 1TH7A 4PJOF 1U1SA 2VYTA 1Q7YU 4JDSA 5FU6B 2WSFE 1X75C 1WJSA 1M1KC 4PL6A 5DLOA 4HA8A 2X4WA 2DZCA 2GCXA 1VQOA 1M8VA 3JRZA 2E12A 5LJ5j 4C92C 3JCMQ 3CC4T 3CCMT 3JB9I 3CCQT 5DM7R 1Y7XA 3OQ5A 3FRNA 3FB9A 2V8IA 1B34B 4PLLA 2GF7A 4JS5A 1O75A 2VC8A 2BUDA 2P0PA 2PUKB 2O4XA 5LJ3d 4IUQA 4J7FA 4JRQA 4BDZA 4HT8A 3R6OA 2CS7A 2LQ8A 4L5GA 4M75B 1BIBA 2LCLA 3GNFB 4ZN1A 4HT9A 3HPWA 1YJNA 4M77G 2XI9A 3CPWA 4LDXA 2FL7A 1K73C 1NJIU 2MF2A 4XTYA 3WVEB 3CCSA 1KQ1A 5GAN5 4E7IA 2XKOC 4IUTA 2GFAA 1BI2A 2E41A 4RG2A 4EDUA 3H8ZA 3QUIA 5EG2A 1VQ4T 1VQ5T 2LC4A 1W2BS 1LJOA 3HRTA 4N4GA 5A0GA 1VQPA 2D0QB 1WJQA 2RJEA 4J6XA 4C5GA 1PSEA 1WNLA 4TVRA 4EMGA 5IAYA 3OBWA 3V8KA 2KMTA 1VIEA 3CBOA 3I56T 1S72T 1VQ7T 2E6NA 3G6EA 4BDYA 3LW5E 4RCCA 2EJGA 2DTIA 2F5TX 2EAYA 2FB7A 1H641 3E19A 3OW2A 5GAOr 1OZ3A 3PGGA 1YJWT 4C8QD 2M1HA 3M53A 2P4TA 2CZ0B 3CCVT 2PQWA 1KD1U 4XK8E 1QP2A 5D6YA 5GMKl 3J7AF 2QXFA 3S6WA 1QVFS 5GAN2 2AHJB 4ME7A 3JCMb 1M90U 3VJPA 2R58A 3JCMf 2A7YA 2XDBA 4ATOA 5CR2A 2KSSA 1YJWA 3CCVA 3GP8A 3VV0A 4MZPA 4PJOB 3TEEA 3M5AA 2XG8D 3H6ZA 3HP9A 3P8BB 3SDZA 4A4EA 1V29B 3VUZA 3G6ET 3JCMX 1I8FA 2RK1A 5CKFA 3ZEHA 3JCMd 2FVUA 3GNGA 3JB9G 1KC8C 2RJFA 4HCCA 1JRIA 3HL8A 2JTFA 3TU4K 2QEXT 2HAXA 2DVEA 4M77E 1I5LA 1EIFA 1VQ9T 3ME9A 3P8DA 4FT4A 5KE3A 2EIFA 3X25B 2HBPA 3FEOA 4JLGA 4M77F 3MEAA 4XAXB 4XU1A 2VUBA 3RKYA 2NLUA 5GAMj 3M59A 1K8AU 2DKGA 3OYYA 3QPHA 1WJRA 3C94A 4BD3A 5GAN6 3CPFA 3V7RA 2KVQG 5LJ5d 4A4KA 4JS4A 4MDXA 2H3JA 5I21A 4JRIA 5IT9E 2DXUA 2RI5A 3TCJA 5KCHA 2E70A 2ZPIB 3JCMe 1K9MU 4JUVA 3NTHA 3L2WA 1GXIE 3OSSC 2EKOA 3PMIA 5GANj 1BI3A 3V7SA 1HK9A 3JCMh 1YHQA 3HHTB 4DOVA 3OYHA 3S3MA 5D6WA 1N6AA 2L89A 3E9FA 4N0AA 4M75F 5LJ3h 2P0QA 4PJOE 1FX7A 1BIAA 3G4SA 1VQOT 4ZTJA 4L6V5 2K5IA 4EMKA 5GAOp 2RH2A 2JZ2A 3F70A 1BKBA 1M5Q1 1W4SA 1WPYA 2RM4A 2ZGWA 3LLRA 3INZA 4LD6A 4KT0E 4OGEA 4QQ6A 4B9XA 3L1AA 5CO7A 1Y96A 4M77B 4IKFA 4M7DF 4II1A 2KY9A 2VXEA 2PUOB 3GF5A 3C4SA 3FC3A 2E1HA 2JN0A 5GANh 4IURA 2MMPA 2KDSA 4M78D 1VUBA 4A4FA 2DIGA 4BY6B 4KBMB 5LJ3g 5GAOm 1XQHA 2R5AA 1VQKT 2OAUA 1YIJT 3MEWA 4YTLA 3ZBDA 3OYMA 1QVPA 2YLCA 3J80E 1M1KU 2QTXA 4KULA 2LRQA 3OS0A 2K4YA 4BUGA 2M16A 2R5MA 2GFUA 2LX9A 3QHSA 4KUIA 5FRNA 2EQJA 1YITT 4J83A 2DJZA 3OYNA 4OMFB 2E65A 4XTUA 4JRKA 4P5NA 2VXFA 2VGNA 1YJ9A 2K2VA 3LYIA 3A8GB 3RIRA 5J39A 1R8OB 4PJOA 1G3YA 5LJ5g 2DZ9A 2QQRA 3A8OB 4C8QA 1S72A 5D6XA 1VQ7A 5GAN8 1YI2A 5LL6S 2RB6A 4M77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LJO A;  4F7U B;  3JB9 D;  5DY9 A;  3RKX A;  5GAM d;  4J6X A;  4J6Y A;  4EMG A;  4C8Q F;  1HXD A;  4M7A G;  1WNL A;  4PNO A;  4M78 C;  1JBM A;  1Y96 B;  3V8K A;  4EMK B;  4QVD A;  4V2S A;  4XQ3 A;  4M77 C;  1N9R A;  4PJO D;  2HNI A;  2RA2 A;  2EJG A;  2DTI A;  4RCC A;  5GAO l;  3JCM P;  1N9S A;  2EAY A;  1I4K 1;  2FB7 A;  3HFO A;  4M75 E;  4X9D A;  1H64 1;  4XTX A;  5GAO r;  3V8L A;  2Y90 A;  3PGG A;  4M7D D;  4C92 F;  4C8Q D;  3JB9 J;  3M4G A;  5GAN f;  5GMK h;  3JB9 F;  4QVC A;  4C92 E;  4F7U A;  4M75 G;  5GMK l;  4NL3 A;  2YHT A;  5GMK e;  4F7U E;  5GAN 2;  4A53 A;  3JCM b;  3L2Z A;  4C8Q B;  5GAN 4;  1LOJ A;  4M7D B;  3VU3 C;  3JCM f;  4F7U F;  3JCM J;  2K57 A;  5GAN 3;  4OP0 A;  4DQ2 A;  2DEQ A;  4PJO B;  2I2L A;  2YLB A;  3RKW A;  1I81 A;  5LJ5 e;  3JCM W;  5LJ3 f;  2EJ9 A;  4XTW A;  3BFM A;  5GAM f;  3JCM X;  1I8F A;  5GAN 7;  3JCM d;  1YCY A;  3JB9 G;  1MGQ A;  2DTH A;  4Y91 A;  3FJP A;  1JRI A;  4C92 G;  4J5Y A;  4M78 G;  4MML A;  2DVE A;  4M77 E;  5GAM h;  4XU0 A;  1U1T A;  5GAO q;  1I5L A;  1B34 A;  4M7A F;  5GMK m;  4M77 F;  3EFR A;  4M77 D;  4XU1 A;  3RKY A;  5GAM j;  4M7A A;  5GAM e;  5LJ3 e;  2DKG A;  5GAN 6;  3BY7 A;  5LJ5 f;  1WQ7 A;  2E64 A;  3RUX A;  3SB2 A;  3GIB A;  3V7R A;  5LJ5 d;  3V8J A;  1X01 A;  5CAI A;  3V7C A;  4EMK C;  5I21 A;  4JRI A;  2DXU A;  2CGH A;  5GMK i;  3JCM e;  4RCB A;  4JUV A;  4XTZ A;  4A54 A;  4C92 D;  5LJ3 j;  4M78 F;  4N0A C;  5GAN j;  4XTV A;  4EMH A;  3V7S A;  1HK9 A;  3JCM h;  5GAM g;  4F7U G;  4NOY A;  3HSB A;  4XU2 A;  4M7A C;  1D3B B;  3RES A;  3RER A;  4N0A A;  4PJO E;  3HFN A;  4M75 F;  4NL2 A;  5LJ3 h;  1BIA A;  3JCM c;  5LJ5 h;  4C8Q E;  4EMK A;  5GAO p;  2EJF A;  3QSU A;  4M7D E;  1M5Q 1;  1WPY A;  2RM4 A;  2ZGW A;  4JLI A;  4M75 D;  4WF2 A;  3INZ A;  3AHU A;  4M7D F;  1D3B A;  3L1A A;  1Y96 A;  4M77 B;  2VXE A;  1M8V A;  1KQ2 A;  4M7D G;  4PJO F;  1TH7 A;  2E1H A;  2JN0 A;  1U1S A;  5GAN h;  3BDU A;  4XU3 A;  4M78 D;  4X9C A;  3FIF A;  5GAO n;  5GAO m;  4PJO G;  5LJ3 g;  4M7D C;  4M7A B;  3QO3 A;  4HA8 A;  5GAN g;  4M7A D;  1LNX A;  2DZC A;  2YLC A;  3JCM V;  5GMK j;  3JB9 H;  2QTX A;  4M75 A;  2E10 A;  3JCM g;  4MMK A;  3SWN A;  4C92 C;  4C8Q C;  5LJ5 j;  2DXT A;  3JCM Q;  3JB9 I;  4M78 B;  4C92 B;  3FB9 A;  4PJO C;  1B34 B;  3QHS A;  2FYK A;  3SWN B;  4M7A E;  2VC8 A;  2DJZ A;  5LJ3 d;  3BW1 A;  2E65 A;  4M75 C;  4JRK A;  4XTU A;  2VXF A;  3SWN C;  4M78 A;  4C92 A;  5GAN e;  5GAN d;  4HT8 A;  2RD1 A;  4M75 B;  3RIR A;  1BIB A;  4HT9 A;  4PJO A;  4M78 E;  4M77 G;  5LJ5 g;  2DZ9 A;  3EFS A;  4J6W A;  4XTY A;  4C8Q G;  1KQ1 A;  5GAN 5;  4M7D A;  1WQW A;  4C8Q A;  2E41 A;  3QUI A;  5GAN 8;  2EWN A;  2RB6 A;  4M77 A;  2DTO A; 
#chains in the Genus database with same CATH topology
 2V8K A;  1RI0 A;  4C8Q F;  1XTD A;  2WSC E;  4L59 A;  1JO8 A;  2J6F A;  3JB9 J;  3QJY A;  1FMW A;  2ED0 A;  4HKE A;  1QMC A;  1NEG A;  3M0T A;  1NYF A;  1J3T A;  1WHK A;  5GAN 4;  3MEU A;  3OYK A;  1WHL A;  1PG5 B;  2NYS A;  1PRL C;  1LCK A;  3FJP A;  4M78 G;  1KHI A;  2OTJ A;  4M77 D;  3TSZ A;  1PD0 A;  4RKU E;  1H3Z A;  1T0J A;  1VOM A;  3CCU T;  5CVI A;  4UC4 A;  3GOX A;  4JJD A;  3FLG A;  3NMZ C;  2EGC A;  2DA9 A;  3O8V A;  3CCQ A;  1UG1 A;  2A28 A;  1ZA2 B;  2XIC A;  2QEX A;  4R56 A;  3CCM Q;  4QVZ A;  3ULR B;  1Y71 A;  3CCL A;  1UB4 A;  4M7D E;  3MCA B;  2EKH A;  4JLI A;  4R55 A;  1Q82 U;  3OMG A;  1ZUK A;  1VYV A;  1YIT A;  3SD4 A;  3X20 B;  5FRO A;  1AD5 A;  4AT1 B;  1AVZ C;  2X4J A;  2FZC B;  4AMC A;  7AT1 B;  1YHQ Q;  1LNX A;  5GMK j;  1PD1 A;  2YDL A;  5AYF A;  4KGZ B;  4GLM A;  3HRU A;  1TUD A;  2DL5 A;  5GAN d;  2J06 A;  3CC7 T;  4M78 E;  2W10 A;  4M7D A;  1WQW A;  3L2V A;  4J9F A;  2MWP A;  2O01 E;  5AT1 B;  2QQ9 A;  4C5H A;  3G4S Q;  2DXB A;  4PJO D;  1NPP A;  2AIR B;  3JCM P;  3PIO A;  2JS0 A;  1TXQ A;  5CIU A;  1UHF A;  1HD3 A;  1X6O A;  4Q5W A;  2KEA A;  2K3X A;  2YHT A;  2QI2 A;  5GMK e;  1RAI B;  4HCB A;  3L2Z A;  1KD1 C;  3LGF A;  4DA4 A;  3OSV A;  3L2R A;  3G4S T;  3ZFJ A;  1YI2 Q;  1Q86 C;  1D1B A;  4J8O A;  4XTW A;  2KI7 A;  1OZ2 A;  2KGT A;  2MCN A;  2KBT A;  2L2P A;  5L8R E;  1M1F A;  1X6G A;  1PHT A;  1UTI A;  2RF0 A;  4ZGE B;  3GIB A;  3CXC P;  2E64 A;  5D7U A;  5KH6 A;  1LVK A;  2L8D A;  3OBY A;  2K2M A;  1PSF A;  3VKI A;  4RCB A;  3I56 A;  2AZS A;  3P8H A;  4XTZ A;  2K5F A;  3VRY A;  3QG1 A;  4N0A C;  2DL3 A;  5GAM g;  3HSB A;  4AFZ C;  1YIJ Q;  3M58 A;  1K76 A;  3RER A;  2EYQ A;  1X69 A;  2RQR A;  2LJ1 A;  1M8M A;  3VS5 A;  1D0Y A;  1JXO A;  2BTT A;  1YHQ A;  2LJ3 A;  2YUQ A;  1NEB A;  1JB0 E;  1V76 A;  4FT2 A;  5CK9 A;  3FIF A;  3T9N A;  3CXC S;  1OI1 A;  1AWW A;  3JCM V;  4M75 A;  2XMF A;  1OX8 A;  4RTX A;  1I1J A;  3DLL A;  1KFZ A;  2HEQ A;  3EG0 A;  1O9S A;  3QYG B;  5GAN e;  1OX9 A;  4LE9 A;  1G3W A;  2CUB A;  3H41 A;  3CCS T;  4QW2 A;  5CKH A;  2ZPE B;  3EFS A;  5IHI A;  4E7Z A;  3REA B;  2F69 A;  4OB3 B;  2RMO A;  1G83 A;  2HNI A;  2EQM A;  2A0F B;  1NPR A;  2Y90 A;  1HSQ A;  3KUF A;  2C0T A;  1C1A A;  1AZG B;  1Y07 A;  2MAM A;  4DBQ A;  5KYW A;  3CCE Q;  1QQJ A;  3UDC A;  5LJ5 e;  2EJ9 A;  5GAM f;  1SRM A;  1MGQ A;  4BI4 A;  1NYG A;  1B7T A;  3CC2 T;  4XU0 A;  2VV5 A;  4OB1 B;  2DL7 A;  4M7A A;  5C6S A;  3X26 B;  2LDM A;  4C0F A;  1VQ8 T;  2LVM A;  2RHI A;  3MO8 A;  2Y4X A;  4EMH A;  2L0A A;  1FYN A;  1S72 Q;  3M57 A;  1UEC A;  1VYU A;  2BE7 D;  3WVD B;  3A8M B;  2QG9 B;  2X51 A;  3NTK A;  2KNB B;  5CKE A;  4KH1 B;  2EJF A;  4GBQ A;  3QYH B;  4HVW A;  3DB4 A;  2OI3 A;  2NUZ A;  4N4I A;  3CCM A;  1M1K R;  3OY9 A;  3A1P A;  1QVG A;  4IUU A;  1KQ2 A;  1BI0 A;  2EYY A;  4PJO F;  1VA7 A;  2VAS A;  1KK7 A;  2D1X A;  1X75 C;  1AWO A;  4HA8 A;  2DZC A;  1VQO A;  2EYW A;  4C92 C;  3CC4 T;  1Y7X A;  3OQ5 A;  2DYB A;  1B34 B;  1VQP Q;  2HL3 A;  1O75 A;  2BUD A;  2PUK B;  4HT8 A;  2CS7 A;  2RQW A;  4HT9 A;  4M77 G;  3CPW A;  1G5V A;  1NJI U;  3SEM A;  1KQ1 A;  2XKO C;  4IUT A;  4RG2 A;  4D8K A;  5EG2 A;  1LJO A;  5A0G A;  4N4G A;  2O31 A;  1VQP A;  2D0Q B;  1WJQ A;  1N5Z A;  4C5G A;  1BCO A;  3OBW A;  4QT7 A;  2E6N A;  1ABQ A;  2EAY A;  2FB7 A;  3OW2 A;  5GAO r;  4JZ4 A;  2HKN A;  1X43 A;  2CZ0 B;  2KRO A;  2EYZ A;  5GMK l;  3S6W A;  2EGA A;  5GAN 2;  1M90 U;  2GGR A;  1VQK Q;  4ATO A;  1N8R R;  1YJW A;  3VV0 A;  1UHC A;  4MZP A;  4PJO B;  3P8B B;  1RI9 A;  4E7S A;  2FZK B;  1I8F A;  3JB9 G;  3ZEH A;  2FVU A;  2COZ A;  1KC8 C;  4HCC A;  2HAX A;  2DVE A;  4M77 E;  4M4Z A;  4M77 F;  4JLG A;  2AK5 A;  2GNC A;  1JJ2 P;  5GAN 6;  4BD3 A;  5LJ5 d;  2CP2 A;  2DXU A;  5KCH A;  2RNA A;  3NTH A;  4PJN A;  2DVJ A;  3PMI A;  5GAN j;  1YJN Q;  4E6R A;  1UJ0 A;  5D6W A;  3E9F A;  4N0A A;  2ECZ A;  1VQO T;  4ZTJ A;  2K5I A;  2JZ2 A;  1BKB A;  2RM4 A;  3LLR A;  4KT0 E;  4IKF A;  2ENM A;  3L1A A;  4M77 B;  2KXD A;  2VXE A;  3C4S A;  4DBF A;  3FC3 A;  1QCN A;  2E1H A;  2JN0 A;  2PTK A;  3KFV A;  2R5A A;  1YIJ T;  4YTL A;  1MMA A;  2OJ2 A;  3J80 E;  2QTX A;  2F2X A;  2QDL A;  1UFF A;  2R5M A;  2KRN A;  3QHS A;  3OYN A;  4J9C A;  2E65 A;  1QKW A;  4JRK A;  2VGN A;  1T0H A;  3RIR A;  1CSK A;  4DBH A;  5LJ5 g;  2COW A;  2DZ9 A;  4OMN A;  2HCK A;  2MIO A;  2KRM A;  5KYW B;  3M0U A;  5LL6 S;  4M77 A;  4ESR A;  3RKX A;  2QQA A;  4CRI A;  2C0O A;  2K3Y A;  2YUP A;  3CCR T;  4ZGJ B;  4XQ3 A;  2FO0 A;  3X28 B;  1XNI A;  4JRP A;  4M75 G;  4BI3 A;  1U06 A;  4OML A;  3NTI A;  2J7I A;  4FM4 B;  2DAQ A;  2LCS A;  2XDP A;  2K57 A;  3M54 A;  2X9H A;  4FL6 A;  2JVV A;  2YLB A;  1SHG A;  3QKJ A;  2XK0 A;  2E5K A;  1QVF A;  1DJ7 B;  5CQX A;  3HKS A;  1JXM A;  1YBY A;  1EZZ B;  2X35 A;  2QGG A;  2J6O A;  1E6H A;  4K11 A;  2F5K A;  3VYH B;  5GJW B;  2CP7 A;  2KQW A;  3EG3 A;  1BK2 A;  1Y0M A;  5LJ5 f;  2K7A A;  2CGH A;  3LGL A;  3KXT A;  4C92 D;  3JV3 A;  1YNZ A;  2E3I A;  1OU9 A;  1BYM A;  2VWF A;  5CCA A;  5I2M A;  4Y92 A;  4XU2 A;  1OYX A;  2DD5 A;  5KCO A;  4BAC A;  1M30 A;  3PT9 A;  1U8R A;  2GQI A;  5A0L A;  2XID A;  4C8Q E;  4E7J A;  3QSU A;  1AWX A;  2ZPF B;  3UA7 A;  1C0M A;  2KT1 A;  2PU9 B;  4DOW A;  5IHN A;  2D6F A;  4QQD A;  1FXX A;  1KG1 A;  1PWT A;  3C95 A;  2F2W A;  4FYV B;  1VQK A;  3EGX A;  4M7A D;  3DKM A;  4RTU A;  5IHK A;  5GAN f;  3S3N A;  4RMO A;  4C92 B;  1GCQ C;  1X6B A;  2DX1 A;  2A3L A;  2FYK A;  3SWN B;  1OUL A;  4M7A E;  3SWN C;  4PFO A;  1ZHI A;  4BE2 A;  4CI0 C;  4OMQ A;  2LX7 A;  2P84 A;  1PNJ A;  4OMP A;  3MET A;  3CD6 A;  1X2K A;  3I55 A;  2JUF A;  2YSQ A;  2OTL A;  1S1N A;  1PM3 A;  1UGV A;  2X4Y A;  4D6W A;  1YIJ A;  4XTX A;  1VQL T;  3M4G A;  1KIK A;  3EG9 B;  4C92 E;  1RAG B;  2ED1 A;  2OX7 A;  2EQI A;  4M7D B;  3M55 A;  1UGS B;  2A36 A;  1VQL A;  2CRE A;  2X3X D;  2I2L A;  2H3E B;  1N8R U;  2XHC A;  3MHX A;  5IH2 A;  1SRL A;  3MP1 A;  3VUB A;  1ZSZ A;  2KYM A;  2L3S A;  2OTL T;  9ATC B;  1M27 C;  2XD0 A;  1W6X A;  1Q81 C;  1D09 B;  1TSF A;  3IQL A;  4Y28 E;  4O5V A;  1IGQ A;  3BY7 A;  1WQ7 A;  1VQN Q;  3QDF A;  4ZN3 A;  1X01 A;  1K9M R;  2DLP A;  2LQK A;  5C0M A;  4F7U G;  1VQ4 A;  1VQ5 A;  1IRE B;  5IXF A;  2IPO B;  3VRZ A;  4M7A C;  1SPK A;  4LDW A;  4E7H A;  2PVD B;  1KC8 R;  4O6J A;  3TQ7 P;  2CP5 A;  4NS5 A;  4BB7 A;  4C0D C;  2RJC A;  2VKN A;  3OS1 A;  1NE8 A;  2E6Z A;  1IGU A;  2Y4Y A;  3E9G A;  4FW1 A;  4B6M A;  5FLX E;  1G3T A;  4RTV A;  2E10 A;  1FMV A;  4MMK A;  3CCL T;  3I9Q A;  1VQP T;  1M3A A;  1VIF A;  2LT4 A;  3Q1J A;  4PFP A;  1QKX A;  1OU8 A;  2D9T A;  4DBR A;  1K73 U;  2IIM A;  1W2B A;  1RL2 A;  1ABO A;  4J6W A;  1EFN A;  1M4Z A;  2KAF A;  5KE2 A;  4KUD K;  4OF1 A;  2DTO A;  3JB9 D;  4GLK A;  1QVF P;  4M7A G;  1HXD A;  3UWN A;  3I55 T;  3QXE B;  3L2Q A;  4EMK B;  1G3S A;  2W0Z A;  1QLY A;  5IN1 A;  5GAO l;  3OMC A;  2DRK A;  4BY6 C;  3V8L A;  3EGD B;  2PZ1 A;  2X4X A;  2LQN A;  2RI2 A;  2ZZD A;  2QQB A;  1WX6 A;  2D0N A;  2NUT B;  3VU3 C;  3JCM J;  2JNG A;  2A08 A;  2FRY A;  1KQS S;  1BCM A;  1WZO A;  1ZX6 A;  2JJ9 A;  2M0Y A;  5GAN 7;  4LDY A;  2ATC B;  2SEM A;  1YCY A;  3CCR A;  2CZ1 B;  1Q86 U;  3PE0 A;  4C92 G;  2JM9 A;  2RHY A;  4MML A;  1WXT A;  2V8J A;  4ZGD B;  2QQS A;  3L2U A;  2OTJ Q;  2RHZ A;  3AT1 B;  1VQ8 A;  1AEY A;  4FW2 A;  2E3H A;  3MP6 A;  4RTT A;  1BI1 A;  5CAI A;  4LD9 K;  2F2V A;  3V7C A;  3OYG A;  5GMK i;  1B3Q A;  2YT6 A;  3M56 A;  2ZPH B;  1VQ7 Q;  1YJN T;  1Q86 R;  2V1R A;  3VS2 A;  4A4H A;  5HK0 A;  4IUV A;  2ROL A;  2LNH B;  4N4H A;  3JCM c;  1RAH B;  1UGP B;  1MV3 A;  3A8H B;  4M75 D;  1OPK A;  4KH0 B;  3R6N A;  4RG8 A;  2NUP A;  3FDR A;  2DD4 A;  3DLM A;  1TH7 A;  1U1S A;  2VYT A;  1Q7Y U;  2DBM A;  2WSF E;  1WJS A;  2X4W A;  2GCX A;  8ATC B;  1M8V A;  1NG2 A;  3JRZ A;  3JCM Q;  3EHR A;  3FRN A;  1FMK A;  3FB9 A;  2D8J A;  1M2V B;  1GCP A;  4IUQ A;  2EGE A;  4JRQ A;  4L5G A;  1BIB A;  5L23 A;  1YJN A;  2FL7 A;  4XTY A;  3CCS A;  2E41 A;  1ARK A;  3H8Z A;  3QUI A;  1D0X A;  1WHM A;  1VQ4 T;  1VQ5 T;  2LC4 A;  2QGF B;  1ZUY A;  1W2B S;  2DET A;  3CPW P;  2RJE A;  1K1Z A;  1VIE A;  2V26 A;  3G6E Q;  2EJG A;  1IB8 A;  1H64 1;  3PGG A;  1YJW T;  2ABL A;  2AKL A;  5KYX A;  1QP2 A;  5D6Y A;  3J7A F;  2QXF A;  1HYO A;  2R58 A;  2KE9 A;  1Q7Y R;  1NLO C;  3GP8 A;  3TEE A;  3HP9 A;  3SDZ A;  2FPE A;  5CKF A;  2RK1 A;  2RJF A;  3HL8 A;  2JTF A;  2QEX T;  3ME9 A;  5KE3 A;  2EIF A;  2HBP A;  3RKY A;  3FEO A;  1H3H A;  1K0S A;  4LUD A;  2VUB A;  1WJR A;  2HDA A;  3V7R A;  4JS4 A;  4A4K A;  4MDX A;  1YP5 A;  2RI5 A;  4Z8A A;  1K9M U;  1VQ8 Q;  2ESW A;  3L2W A;  1GXI E;  1BI3 A;  3V7S A;  1HK9 A;  2FPD A;  4J9E A;  3EH2 A;  3OYH A;  3S3M A;  2QEX Q;  2P0Q A;  1RAD B;  2K79 A;  3G4S A;  3M0R A;  3EGU A;  5GAO p;  2RH2 A;  1WPY A;  2P4R A;  1W4S A;  4C0Z A;  4E47 A;  3AHU A;  3CPW S;  4OGE A;  3INZ A;  2VVK A;  2DNU A;  4M7D F;  5CO7 A;  4II1 A;  2K9G A;  2PUO B;  1R0C B;  1VUB A;  4A4F A;  2DIG A;  3NPF A;  5LJ3 g;  1YWP A;  1XQH A;  1VQK T;  3EFO A;  4FSS A;  3MEW A;  4J9I A;  4RTY A;  3OYM A;  4CC4 B;  2E4H A;  1UE9 A;  3CCR Q;  5FRN A;  2EQJ A;  3CQT A;  4OMF B;  5J39 A;  2AKK A;  2RN8 A;  1G3Y A;  1I0C A;  1RAA B;  2FRW A;  2QQR A;  2J6K A;  4FYY B;  2YWW A;  1M3C A;  3H9N A;  2RB6 A;  2EVR A;  3CC2 A;  3NFC A;  2DJQ A;  4J9G A;  3TRE A;  1JBM A;  1V1C A;  1UGR B;  1IRX A;  1ACM B;  2M9U A;  4J9H A;  1IHW A;  2FG0 A;  2RO0 A;  4QQG A;  1VQ6 A;  1ZSZ C;  3OW2 S;  3OB9 A;  2P0K A;  3EAE A;  1JJ2 A;  1VYT A;  3UPU A;  1NLP C;  1I81 A;  1VQM T;  2HQH A;  1GFD A;  3QII A;  2HL5 C;  4J5Y A;  3OYB A;  1M2V A;  1U1T A;  5CKB A;  2BKD N;  2HQX A;  1KQS P;  1RAC B;  4C0D B;  2LCC A;  5ECA A;  3V8J A;  3CEY A;  2HSE B;  2AZV A;  4AFU C;  4Z89 A;  2MWO A;  4ANJ A;  4XTV A;  3I5R A;  1E6G A;  1D3B B;  1QCO A;  3CC4 Q;  3CME Q;  2RHU A;  1XJW B;  2DPP B;  3M0P A;  3MPU B;  2BZ8 A;  3MKD A;  3PIP A;  1YCS B;  2JOY A;  1OPL A;  4M7D G;  2CH4 A;  3BDU A;  5I2S A;  3HTR A;  3UAT A;  1TG0 A;  5CKD A;  4PJL A;  1Q7Y C;  1LPL A;  3OS2 A;  3ZL7 C;  1M2O A;  3JB9 H;  4C8Q C;  1E7O A;  1T3S A;  2DXT A;  3UF4 A;  2L3Q A;  2HQE A;  5HCK A;  1NZ9 A;  3RBB B;  4C92 A;  3L42 A;  2E5Q A;  1QP3 A;  1YFN A;  4Z88 A;  4OB2 B;  2H8H A;  1TWB A;  3LX7 A;  2Z0W A;  2QAZ A;  1UDL A;  4RUG A;  2QA4 Q;  2JTE A;  1Q95 G;  2C0I A;  1CKB A;  4IUP A;  2BIV A;  4PNO A;  3WXM B;  3PTA A;  4V2S A;  3D7S B;  2RA2 A;  3LWI A;  3H0H A;  1WLP B;  1I4K 1;  2OTL Q;  1VQ9 Q;  2DIQ A;  2PVO B;  3JB9 F;  1GL5 A;  1JQQ A;  5FW9 A;  4FU6 A;  1B07 A;  3M4Y A;  1MUZ A;  4C5E A;  5DLQ E;  1NM7 A;  4DQ2 A;  1M3B A;  3JCM W;  5LJ3 f;  3BFM A;  3QZ5 B;  3OYJ A;  5CQY A;  3GLX A;  4LUE A;  1YHQ T;  4X34 A;  5GAM h;  2LMJ A;  1B34 A;  2LP5 A;  1FWZ A;  3CCJ T;  1I07 A;  1RLQ C;  2C06 A;  4E7L A;  4E7K A;  5KYY A;  5HK3 A;  3E1S A;  3CCU Q;  2YRV A;  1VQ9 A;  1IZ6 A;  4LDU A;  4OGC A;  1WHH A;  4NL2 A;  4OVA A;  3OYE A;  3OYD A;  3M0Q A;  2M0O A;  1ZBX A;  1WYX A;  4WF2 A;  2SRC A;  2RQU A;  4ZNX A;  1QVG P;  3JSC A;  3J81 E;  4PLI A;  3CMA Q;  4X9C A;  8AT1 B;  4PJO G;  3RMQ A;  2CP0 A;  3RNJ A;  4LDV A;  3QO3 A;  1TUC A;  2XU8 A;  4ELZ C;  4M7D C;  3JCM g;  3EHQ A;  3NGP A;  4M78 B;  3MP8 A;  1NJI C;  3I5S A;  3QJ6 A;  4HXJ A;  3EFO B;  2QA4 A;  4HCZ A;  5HY6 A;  3CCE A;  3NHN A;  3VS6 A;  1VQN A;  4PKC C;  2I0N A;  2EWN A;  5GAN g;  3CD6 T;  5DY9 A;  4J6Y A;  1CKA A;  4M78 C;  2CZ7 B;  5FWC A;  1SEM A;  2MOX A;  1KJW A;  4M77 C;  4X9D A;  4AG1 C;  1K8A R;  4PJJ A;  3CC7 A;  1N27 A;  1YN8 A;  3CCV Q;  2CH4 W;  4F7U A;  1IHV A;  2FPF A;  1GBR A;  2V1Q A;  3OS5 A;  3I55 Q;  2BZX A;  3FJ5 A;  1KC8 U;  3H0F A;  1ZUU A;  4HCK A;  2DTH A;  1N8R C;  2PVG B;  3E2U A;  4M7A F;  5GMK m;  4A63 B;  3RUX A;  4AFQ C;  1MV0 B;  1WFW A;  1Q81 U;  2MYS A;  5KYN A;  1VQ6 Q;  1X2Q A;  2JM8 A;  1IO6 A;  2DK3 A;  4EMK C;  1HJD A;  5FU7 C;  2NUT A;  2WSE E;  4M78 F;  5KYX B;  1UJY A;  4PJM A;  2BE9 B;  3OYI A;  1AOJ A;  2CSQ A;  3LH0 A;  4JJN K;  5LJ5 h;  3EGD A;  1Q82 C;  1YJ9 Q;  2RI3 A;  3H0I A;  4OMM A;  3CC4 A;  1SSH A;  1M1G A;  3TVT A;  1UUE A;  4HVU A;  5FU6 B;  3RDV A;  2YUN A;  2X3W D;  1M1K C;  2EW3 A;  4PL6 A;  5KYU A;  2QK0 A;  1Z9Z A;  3VS0 A;  2E12 A;  3CCM T;  3JB9 I;  4PLL A;  2V8I A;  2DIL A;  4F14 A;  4JS5 A;  1YIT Q;  2CUD A;  5LJ3 d;  2O4X A;  4ZN1 A;  2LCL A;  1KD1 R;  5GJV B;  1SG5 A;  1K73 C;  4E7I A;  5GAN 5;  2GFA A;  4EDU A;  4CC3 A;  4EMG A;  1PSE A;  3PVL A;  2CT3 A;  5IAY A;  3I56 T;  4IIM A;  2KMT A;  3CBO A;  4LNP A;  1VQ7 T;  3G6E A;  3LW5 E;  2FZG B;  1VQO Q;  2YRD A;  3EH1 A;  1OZ3 A;  3CC7 Q;  2M1H A;  3M53 A;  1SKU B;  2P4T A;  3CCV T;  1U5S A;  2PQW A;  4FYX B;  1KD1 U;  4XK8 E;  2K3B A;  2JXB A;  2AHJ B;  4ME7 A;  3JCM b;  3VJP A;  5KYY B;  2XDB A;  2KSS A;  3CCV A;  3M5A A;  2XG8 D;  3M0S A;  3VUZ A;  1WXB A;  3GNG A;  3TU4 K;  1I5L A;  1EIF A;  1GBQ A;  1WHJ A;  4FT4 A;  3X25 B;  4XAX B;  5KYU B;  1K8A U;  3M59 A;  2DKG A;  3OYY A;  4IIO A;  3CPF A;  1PKT A;  2KVQ G;  1F1B B;  2E70 A;  4JUV A;  1AWJ A;  3OSS C;  1PC0 A;  3HHT B;  1N6A A;  2L89 A;  3REB B;  4F04 B;  1FX7 A;  4EMK A;  1Z9Q A;  3F70 A;  1M5Q 1;  2DL8 A;  2ZGW A;  4QQ6 A;  4BDY A;  1EX4 A;  3CCS Q;  2KY9 A;  4IUR A;  2MMP A;  1M90 R;  4M78 D;  5EC7 A;  1VQM Q;  4BY6 B;  5GAO m;  4KBM B;  2OAU A;  4D8D A;  1OEB A;  1QVP A;  1WIE A;  2CSI A;  4KUL A;  2LRQ A;  2EBP A;  1R0B G;  2GTJ A;  4BUG A;  2GFU A;  4LN2 A;  1K73 R;  1YIT T;  2DJZ A;  2VXF A;  2K2V A;  1K9A A;  1R8O B;  2QAS A;  3A8O B;  4C8Q A;  2JMC A;  1S72 A;  5FWB A;  1YI2 A;  3CCQ T;  3VS1 A;  4JZ3 A;  4F7U B;  1WGS A;  1UEB A;  5GAM d;  2DO3 A;  5I11 A;  4EPC A;  4QVD A;  3CCL Q;  2O9S A;  4BE1 A;  4JJB A;  1N9S A;  3PVQ A;  3EG2 A;  3CC2 Q;  4M7D D;  1K0X A;  2M02 A;  1ZBJ A;  4BI8 B;  1W2B P;  2L3R A;  2EQK A;  3DB3 A;  2COY A;  2EPD A;  4NL3 A;  1PCX A;  4E2F B;  2DE0 X;  1MMN A;  1WHG A;  1LOJ A;  2RHX A;  4J9D A;  2B8A A;  5GAN 3;  1M90 C;  3VS7 A;  3RKW A;  2VB6 A;  1Q82 R;  5J3B A;  2OAW A;  2K6D A;  1TOV A;  1MHN A;  2R57 A;  2LT1 A;  1GFC A;  3VYG A;  1D1C A;  3EFR A;  4FIB A;  5GAM e;  2YUO A;  2O2O A;  3HRS A;  4KRT A;  2DEU A;  2HSP A;  5J26 A;  3G7Z A;  4FSX A;  1K9M C;  3CBP A;  2AT1 B;  2NWM A;  2KR3 A;  3N5B B;  3ER0 A;  2K5L A;  3LH5 A;  3MJX A;  3A5Z B;  5HKC A;  1D3B A;  1PRM C;  4F17 A;  4AG2 C;  3CME A;  1P92 A;  2JW4 A;  3SHW A;  4Z02 A;  3EG1 A;  1OOT A;  1RLP C;  1BU1 A;  2F1L A;  1WA7 A;  1ZQ1 A;  1M9S A;  3C12 A;  4JJC A;  5A0D A;  3SWN A;  5M9O A;  5FU7 B;  1QWE A;  2DXC A;  3BW1 A;  4MZT A;  2CT4 A;  1YJW Q;  4M78 A;  3EGX B;  2RD1 A;  1D1A A;  2JS2 A;  1SF9 A;  3GPL A;  4C8Q G;  4CC2 A;  2YRC A;  2EQU A;  2FEI A;  3BDL A;  4B9W A;  1NJI R;  3G1J A;  3LWH A;  3CCU A;  3CXC A;  3PMT A;  5A2Q E;  2LZ6 B;  1N9R A;  1UGQ B;  3UA6 A;  5IXB A;  2CDT A;  4M75 E;  3SFM A;  1G2B A;  3PNW C;  2HBW A;  4C92 F;  4ZTF A;  1RAB B;  4QVC A;  3G71 A;  3OYF A;  1ZSG A;  2IG0 A;  1SSF A;  1BB9 A;  4JPB W;  3OYL A;  4A53 A;  4C8Q B;  4C0G A;  4J7I A;  4KGX B;  1QW1 A;  4F7U F;  1I5O B;  1D0Z A;  2DEQ A;  5I22 A;  2DBK A;  2G3R A;  1ZA1 B;  1JJ2 S;  2JT4 A;  3G71 Q;  2CZ6 B;  3URG A;  1G8X A;  5GAO q;  4C5I A;  2CKK A;  1XOV A;  2HZY A;  1OV3 A;  3UT1 A;  5LJ3 e;  2GTO A;  2A37 A;  2JMA A;  2LTO A;  4R0K A;  2EYX A;  2O9V A;  1K8A C;  3X24 B;  4GY5 A;  1W70 A;  2VGM A;  2KK4 A;  5LJ3 j;  5FU6 C;  3KBG A;  4NOY A;  3OYC A;  2GBQ A;  1KQS A;  3RES A;  3RR6 A;  1YJ9 T;  3CCJ Q;  1PKS A;  3ASK A;  1R77 A;  2LNV A;  4EIK A;  2RK2 A;  1MMG A;  3CBM A;  3PFS A;  2WAC A;  3M9Q A;  2ZPG B;  2DF6 A;  2IVW A;  2ZPB B;  4KGV B;  4XU3 A;  3QDR B;  2EFI A;  5GAO n;  2KXC A;  1TTH B;  1RUW A;  4M7A B;  2G6F X;  4FYW B;  3CD6 Q;  2RJD A;  1MNE A;  3OYA A;  1AHJ B;  1ZSZ B;  4PJO C;  2HMA A;  3G71 T;  1SHF A;  4M75 C;  1T3L A;  2ROT A;  4VUB A;  2MK5 A;  3TSW A;  2KRS A;  1A0N B;  4WCI A;  3QZ9 B;  1VQN T;  2FHD A;  2DL4 A;  1WI7 A;  3OW2 P;  1QVG S;  3CCE T;  1VQ4 Q;  1VQ5 Q;  2KT8 A;  2QA4 T;  2ZAE A;  4BE0 A;  4MDW A;  3EG9 A;  2ZCF B;  3I56 Q;  2MI6 A;  2DMO A;  1TUG B;  1Q81 R;  1Y96 B;  2O88 A;  2L5Q A;  3HFO A;  2JTM A;  4WTO B;  5GMK h;  2DYI A;  2XDD A;  2GQV A;  2L3P A;  4F7U E;  3GBQ A;  3RMS A;  4PK4 A;  1VQ6 T;  3A8L B;  4OP0 A;  2DFU A;  3CMA T;  3CMA A;  2O4X B;  4Y91 A;  4ELY C;  3CME T;  4HVV A;  2LJ0 A;  2DER A;  3JAM E;  3SB2 A;  3BE3 A;  2RPN A;  4OB0 B;  4MZM A;  2DRM A;  1W1F A;  4RTW A;  4A54 A;  2CYZ B;  4OMO A;  3CCJ A;  1KHC A;  4A4G A;  3S3O A;  3QBY A;  1C6V X;  4AFS C;  3HFN A;  2OTJ T;  3OA6 A;  4LXC A;  2HD0 A;  2M51 A;  2QDY B;  3MEV A;  5FRM A;  3I35 A;  3THK A;  1TU0 B;  1MND A;  4JDS A;  4J9B A;  2QTV A;  2PNI A;  1GCQ A;  2RQV A;  5DLO A;  1X27 A;  2CP6 A;  5LJ5 j;  5DM7 R;  2D8H A;  1ZLM A;  2GF7 A;  2VC8 A;  2P0P A;  4J7F A;  1VQL Q;  4BDZ A;  3R6O A;  2LQ8 A;  4M75 B;  3QWX X;  3GNF B;  3HPW A;  4LDX A;  2XI9 A;  2MF2 A;  3WVE B;  1JEG A;  2LQW A;  1BI2 A;  3CCQ Q;  3HRT A;  1GRI A;  4J6X A;  3VS4 A;  1YI2 T;  4TVR A;  1WNL A;  2DM1 A;  3V8K A;  4FCY A;  1S72 T;  1AZE A;  4RCC A;  2F5T X;  2DTI A;  3E19 A;  4C8Q D;  4DEY A;  1YWO A;  1QVF S;  1RAE B;  3C0C A;  3JCM f;  1QCF A;  2A7Y A;  5CR2 A;  1Y57 A;  4DEX A;  3H6Z A;  4PFZ A;  4A4E A;  1V29 B;  3G6E T;  3JCM X;  2J05 A;  3JCM d;  2HKQ B;  1JRI A;  1VQ9 T;  3P8D A;  1AT1 B;  4XU1 A;  3MEA A;  5GAM j;  2NLU A;  1OQK A;  3QPH A;  3C94 A;  3VS3 A;  2H3J A;  6AT1 B;  5I21 A;  4JRI A;  5IT9 E;  3TCJ A;  3JCM e;  2ZPI B;  2NUP B;  1K4U S;  1RAF B;  3QWY A;  1NBE B;  2EKO A;  2MPX C;  3JCM h;  4DOV A;  3O5Z A;  1WXU A;  4PJO E;  1JU5 C;  4M75 F;  5LJ3 h;  1BIA A;  2KYB A;  2B86 A;  1BBZ A;  2CP3 A;  4L6V 5;  3A98 A;  1VQM A;  4LD6 A;  4B9X A;  1Y96 A;  1TS9 A;  3GF5 A;  4RTZ A;  5GAN h;  4F16 A;  2KDS A;  4ORZ A;  4QKU A;  3ZBD A;  2YLC A;  1M1K U;  3OS0 A;  1H8K A;  1QWF A;  2K4Y A;  1H92 A;  2M16 A;  2RQT A;  2QYZ A;  2LX9 A;  4KUI A;  4J83 A;  2BZY A;  4XTU A;  2YXY A;  4P5N A;  1YJ9 A;  3LYI A;  3A8G B;  4X1V A;  1MMD A;  4PJO A;  4CC7 A;  1U3O A;  1IXD A;  1VQ7 A;  5D6X A;  1KSW A;  3U23 A;  5GAN 8;  1WDX A; 
#chains in the Genus database with same CATH homology
 4F7U B;  1WGS A;  2V8K A;  3NFC A;  1UEB A;  1RI0 A;  3RKX A;  2QQA A;  5GAM d;  3CC2 A;  2DO3 A;  4C8Q F;  4CRI A;  2K3Y A;  1XTD A;  1JBM A;  3TRE A;  2WSC E;  4EPC A;  4QVD A;  4ZGJ B;  3CCR T;  4XQ3 A;  4BE1 A;  4L59 A;  1N9S A;  1UGR B;  3X28 B;  2M9U A;  1XNI A;  4M7D D;  4JRP A;  3QJY A;  3JB9 J;  4HKE A;  2RO0 A;  4BI8 B;  2L3R A;  2EQK A;  4M75 G;  3DB3 A;  4QQG A;  1VQ6 A;  4NL3 A;  4BI3 A;  5GAN 4;  3MEU A;  3OYK A;  3OW2 S;  3NTI A;  1LOJ A;  3OB9 A;  4FM4 B;  2DAQ A;  2RHX A;  2P0K A;  3EAE A;  1JJ2 A;  2B8A A;  2XDP A;  2K57 A;  3M54 A;  5GAN 3;  3UPU A;  1M90 C;  4FL6 A;  2JVV A;  2YLB A;  3RKW A;  1I81 A;  3QKJ A;  2XK0 A;  1VQM T;  5J3B A;  1QVF A;  1DJ7 B;  5CQX A;  3HKS A;  1YBY A;  2X35 A;  3FJP A;  3QII A;  4J5Y A;  4M78 G;  3OYB A;  1MHN A;  2F5K A;  1KHI A;  2R57 A;  1U1T A;  3VYH B;  2LT1 A;  2KQW A;  5CKB A;  3VYG A;  2OTJ A;  3EFR A;  4M77 D;  2BKD N;  4FIB A;  5GAM e;  2HQX A;  4C0D B;  5LJ5 f;  3HRS A;  4RKU E;  2LCC A;  1H3Z A;  3V8J A;  3CPW S;  3CEY A;  3CCU T;  5CVI A;  5J26 A;  2CGH A;  3LGL A;  4UC4 A;  3GOX A;  3G7Z A;  3FLG A;  4FSX A;  4C92 D;  3KXT A;  2MWO A;  4XTV A;  1BYM A;  3O8V A;  5CCA A;  3CCQ A;  1K9M C;  3CBP A;  5I2M A;  4XU2 A;  1OYX A;  1D3B B;  2DD5 A;  2XIC A;  2QEX A;  5KCO A;  4R56 A;  4BAC A;  1YI2 T;  4QVZ A;  3PT9 A;  1U8R A;  3N5B B;  3CCL A;  1Y71 A;  2RHU A;  3ER0 A;  1UB4 A;  2K5L A;  5A0L A;  2XID A;  4C8Q E;  4E7J A;  3A5Z B;  3QSU A;  2DPP B;  3MCA B;  2ZPF B;  4M7D E;  5HKC A;  4JLI A;  4R55 A;  1Q82 U;  3OMG A;  1D3B A;  1YIT A;  3PIP A;  3SD4 A;  2PU9 B;  2JOY A;  3CME A;  1P92 A;  3X20 B;  5FRO A;  4DOW A;  4M7D G;  2D6F A;  4QQD A;  4Z02 A;  3BDU A;  5I2S A;  1FXX A;  1KG1 A;  3C95 A;  2X4J A;  1ZQ1 A;  5CKD A;  1VQK A;  1Q7Y C;  4M7A D;  3DKM A;  1LNX A;  1M9S A;  3OS2 A;  5GMK j;  3C12 A;  5A0D A;  4C8Q C;  5GAN f;  3JB9 H;  3SWN A;  2DXT A;  5AYF A;  5M9O A;  4RMO A;  3S3N A;  4C92 B;  5FU7 B;  2HQE A;  3AHU A;  2A3L A;  2FYK A;  3SWN B;  4M7A E;  1NZ9 A;  2DXC A;  3BW1 A;  3HRU A;  4MZT A;  4C92 A;  3L42 A;  3SWN C;  2E5Q A;  4M78 A;  5GAN d;  3CC7 T;  1QP3 A;  2RD1 A;  1ZHI A;  4OB2 B;  4BE2 A;  4M78 E;  3GPL A;  4CI0 C;  4C8Q G;  3LX7 A;  3MET A;  4M7D A;  1WQW A;  3L2V A;  3CD6 A;  2EQU A;  3BDL A;  4B9W A;  3I55 A;  2MWP A;  2JUF A;  3LWH A;  2O01 E;  4IUP A;  3CCU A;  2OTL A;  2BIV A;  2QQ9 A;  3CXC A;  4PNO A;  3WXM B;  4C5H A;  3PTA A;  3PMT A;  5A2Q E;  4V2S A;  2DXB A;  2X4Y A;  1N9R A;  4PJO D;  1UGQ B;  4D6W A;  2RA2 A;  1NPP A;  3LWI A;  3JCM P;  1YIJ A;  4M75 E;  1I4K 1;  4XTX A;  3PIO A;  3SFM A;  5CIU A;  1VQL T;  1X6O A;  3PNW C;  4Q5W A;  4C92 F;  4ZTF A;  3M4G A;  2DIQ A;  2PVO B;  3JB9 F;  4QVC A;  4C92 E;  3OYF A;  3G71 A;  2IG0 A;  1SSF A;  2K3X A;  4FU6 A;  3OYL A;  2YHT A;  3M4Y A;  2QI2 A;  5GMK e;  4C5E A;  4A53 A;  5DLQ E;  3L2Z A;  4C8Q B;  4HCB A;  4C0G A;  1KD1 C;  3M55 A;  1UGS B;  4J7I A;  4M7D B;  3LGF A;  4DA4 A;  1QW1 A;  4F7U F;  3OSV A;  3L2R A;  1VQL A;  4DQ2 A;  2DEQ A;  2I2L A;  3G4S T;  3ZFJ A;  1Q86 C;  4J8O A;  3JCM W;  1N8R U;  2XHC A;  5LJ3 f;  4XTW A;  3BFM A;  3QZ5 B;  3OYJ A;  2G3R A;  3MHX A;  5CQY A;  1OZ2 A;  3GLX A;  1YHQ T;  4X34 A;  1JJ2 S;  3MP1 A;  2CZ6 B;  3URG A;  3VUB A;  2OTL T;  5L8R E;  5GAO q;  5GAM h;  1M1F A;  4C5I A;  2CKK A;  2XD0 A;  1B34 A;  1XOV A;  1Q81 C;  4C0Z A;  1FWZ A;  3CCJ T;  4Y28 E;  3UT1 A;  5LJ3 e;  4ZGE B;  4O5V A;  3BY7 A;  4E47 A;  1WQ7 A;  2E64 A;  2LTO A;  3GIB A;  2C06 A;  4E7L A;  4E7K A;  4ZN3 A;  1X01 A;  5KH6 A;  2L8D A;  3OBY A;  1K8A C;  3X24 B;  5HK3 A;  4GY5 A;  3E1S A;  1PSF A;  3VKI A;  2VGM A;  2KK4 A;  4RCB A;  3I56 A;  2LQK A;  3P8H A;  4XTZ A;  2K5F A;  2YRV A;  5C0M A;  5LJ3 j;  1VQ9 A;  3QG1 A;  4N0A C;  1IZ6 A;  3KBG A;  5FU6 C;  5GAM g;  3HSB A;  4F7U G;  4NOY A;  1VQ4 A;  3OYC A;  1VQ5 A;  1IRE B;  1KQS A;  4LDU A;  4OGC A;  3M58 A;  4M7A C;  3RES A;  3RER A;  4LDW A;  4E7H A;  4NL2 A;  4OVA A;  2EYQ A;  2PVD B;  1YJ9 T;  4O6J A;  3OYD A;  3OYE A;  3ASK A;  2M0O A;  4NS5 A;  1ZBX A;  2LNV A;  4BB7 A;  2RK2 A;  2RJC A;  4WF2 A;  4C0D C;  3OS1 A;  3CBM A;  3PFS A;  1VQM A;  2WAC A;  3M9Q A;  1NE8 A;  2ZPG B;  3JSC A;  2E6Z A;  2IVW A;  3J81 E;  1JB0 E;  2ZPB B;  2Y4Y A;  4FT2 A;  4PLI A;  4XU3 A;  3QDR B;  4X9C A;  5CK9 A;  3E9G A;  3FIF A;  2EFI A;  3T9N A;  5GAO n;  4PJO G;  3RMQ A;  3CXC S;  4M7D C;  4M7A B;  1OI1 A;  4LDV A;  3QO3 A;  5FLX E;  1G3T A;  2XU8 A;  3JCM V;  2RJD A;  4ELZ C;  4M75 A;  2E10 A;  3JCM g;  4MMK A;  3OYA A;  3CCL T;  1AHJ B;  4M78 B;  1VQP T;  4PJO C;  1VIF A;  2LT4 A;  3Q1J A;  3DLL A;  3G71 T;  4M75 C;  1O9S A;  2D9T A;  3MP8 A;  3QYG B;  5GAN e;  1NJI C;  1K73 U;  4VUB A;  3QJ6 A;  2QA4 A;  1G3W A;  4HCZ A;  5HY6 A;  3CCS T;  4QW2 A;  1W2B A;  5CKH A;  3CCE A;  1RL2 A;  2ZPE B;  3EFS A;  4J6W A;  3QZ9 B;  1VQN T;  2FHD A;  4PKC C;  1VQN A;  1M4Z A;  2KAF A;  1QVG S;  5KE2 A;  3CCE T;  4KUD K;  4OF1 A;  2EWN A;  5GAN g;  2QA4 T;  3CD6 T;  2DTO A;  4BE0 A;  4MDW A;  3JB9 D;  4GLK A;  5DY9 A;  2F69 A;  4OB3 B;  2ZCF B;  4J6Y A;  2MI6 A;  1HXD A;  3UWN A;  3I55 T;  4M7A G;  4M78 C;  3QXE B;  3L2Q A;  1Y96 B;  2CZ7 B;  4EMK B;  1G3S A;  4M77 C;  2HNI A;  5IN1 A;  2L5Q A;  3OMC A;  4BY6 C;  2EQM A;  5GAO l;  3HFO A;  4X9D A;  1NPR A;  2JTM A;  2Y90 A;  3V8L A;  2X4X A;  3KUF A;  3CC7 A;  1N27 A;  5GMK h;  2RI2 A;  1Y07 A;  4F7U A;  2ZZD A;  2XDD A;  2QQB A;  2GQV A;  4F7U E;  2MAM A;  3RMS A;  3VU3 C;  1G5V A;  3JCM J;  2JNG A;  1VQ6 T;  3UDC A;  3A8L B;  3OS5 A;  4OP0 A;  3CMA T;  1KQS S;  3CMA A;  1KC8 U;  5LJ5 e;  2EJ9 A;  5GAM f;  5GAN 7;  4LDY A;  2O4X B;  1YCY A;  3CCR A;  1MGQ A;  2CZ1 B;  2DTH A;  4Y91 A;  1Q86 U;  4C92 G;  4ELY C;  1N8R C;  4BI4 A;  3CME T;  2RHY A;  4MML A;  3CC2 T;  2V8J A;  4XU0 A;  4ZGD B;  2QQS A;  2PVG B;  3L2U A;  2VV5 A;  4M7A F;  5GMK m;  4OB1 B;  2RHZ A;  1VQ8 A;  4M7A A;  3JAM E;  5C6S A;  3MP6 A;  3RUX A;  3X26 B;  3SB2 A;  1Q81 U;  1BI1 A;  5CAI A;  2LDM A;  4C0F A;  3V7C A;  4EMK C;  2DK3 A;  3OYG A;  4LD9 K;  5GMK i;  4OB0 B;  1VQ8 T;  4MZM A;  5FU7 C;  4A54 A;  2LVM A;  2RHI A;  3MO8 A;  2WSE E;  2Y4X A;  4M78 F;  4EMH A;  2CYZ B;  3CCJ A;  3M56 A;  1KHC A;  2ZPH B;  3M57 A;  4A4G A;  3S3O A;  3WVD B;  3OYI A;  1YJN T;  3QBY A;  4A4H A;  5HK0 A;  3A8M B;  3NTK A;  3HFN A;  3LH0 A;  4IUV A;  4JJN K;  2OTJ T;  5CKE A;  4N4H A;  3JCM c;  5LJ5 h;  3OA6 A;  1Q82 C;  1UGP B;  2EJF A;  3QYH B;  2RI3 A;  2HD0 A;  3A8H B;  4M75 D;  3DB4 A;  2QDY B;  3MEV A;  5FRM A;  4N4I A;  3CCM A;  3CC4 A;  4RG8 A;  1M1G A;  3FDR A;  3OY9 A;  2DD4 A;  1QVG A;  4IUU A;  1KQ2 A;  1BI0 A;  3DLM A;  1TH7 A;  4PJO F;  1U1S A;  2VYT A;  1Q7Y U;  4JDS A;  5FU6 B;  2WSF E;  1X75 C;  1WJS A;  1M1K C;  4PL6 A;  5DLO A;  4HA8 A;  2X4W A;  2DZC A;  2GCX A;  1VQO A;  1M8V A;  3JRZ A;  2E12 A;  5LJ5 j;  4C92 C;  3JCM Q;  3CC4 T;  3CCM T;  3JB9 I;  3CCQ T;  5DM7 R;  1Y7X A;  3OQ5 A;  3FRN A;  3FB9 A;  2V8I A;  1B34 B;  4PLL A;  2GF7 A;  4JS5 A;  1O75 A;  2VC8 A;  2BUD A;  2P0P A;  2PUK B;  2O4X A;  5LJ3 d;  4IUQ A;  4J7F A;  4JRQ A;  4BDZ A;  4HT8 A;  3R6O A;  2CS7 A;  2LQ8 A;  4L5G A;  4M75 B;  1BIB A;  2LCL A;  3GNF B;  4ZN1 A;  4HT9 A;  3HPW A;  1YJN A;  4M77 G;  2XI9 A;  3CPW A;  4LDX A;  2FL7 A;  1K73 C;  1NJI U;  2MF2 A;  4XTY A;  3WVE B;  3CCS A;  1KQ1 A;  5GAN 5;  4E7I A;  2XKO C;  4IUT A;  2GFA A;  1BI2 A;  2E41 A;  4RG2 A;  4EDU A;  3H8Z A;  3QUI A;  5EG2 A;  1VQ4 T;  1VQ5 T;  2LC4 A;  1W2B S;  1LJO A;  3HRT A;  4N4G A;  5A0G A;  1VQP A;  2D0Q B;  1WJQ A;  2RJE A;  4J6X A;  4C5G A;  1PSE A;  1WNL A;  4TVR A;  4EMG A;  5IAY A;  3OBW A;  3V8K A;  2KMT A;  1VIE A;  3CBO A;  3I56 T;  1S72 T;  1VQ7 T;  2E6N A;  3G6E A;  4BDY A;  3LW5 E;  4RCC A;  2EJG A;  2DTI A;  2F5T X;  2EAY A;  2FB7 A;  1H64 1;  3E19 A;  3OW2 A;  5GAO r;  1OZ3 A;  3PGG A;  1YJW T;  4C8Q D;  2M1H A;  3M53 A;  2P4T A;  2CZ0 B;  3CCV T;  2PQW A;  1KD1 U;  4XK8 E;  1QP2 A;  5D6Y A;  5GMK l;  3J7A F;  2QXF A;  3S6W A;  1QVF S;  5GAN 2;  2AHJ B;  4ME7 A;  3JCM b;  1M90 U;  3VJP A;  2R58 A;  3JCM f;  2A7Y A;  2XDB A;  4ATO A;  5CR2 A;  2KSS A;  1YJW A;  3CCV A;  3GP8 A;  3VV0 A;  4MZP A;  4PJO B;  3TEE A;  3M5A A;  2XG8 D;  3H6Z A;  3HP9 A;  3P8B B;  3SDZ A;  4A4E A;  1V29 B;  3VUZ A;  3G6E T;  3JCM X;  1I8F A;  2RK1 A;  5CKF A;  3ZEH A;  3JCM d;  2FVU A;  3GNG A;  3JB9 G;  1KC8 C;  2RJF A;  4HCC A;  1JRI A;  3HL8 A;  2JTF A;  3TU4 K;  2QEX T;  2HAX A;  2DVE A;  4M77 E;  1I5L A;  1EIF A;  1VQ9 T;  3ME9 A;  3P8D A;  4FT4 A;  5KE3 A;  2EIF A;  3X25 B;  2HBP A;  3FEO A;  4JLG A;  4M77 F;  3MEA A;  4XAX B;  4XU1 A;  2VUB A;  3RKY A;  2NLU A;  5GAM j;  3M59 A;  1K8A U;  2DKG A;  3OYY A;  3QPH A;  1WJR A;  3C94 A;  4BD3 A;  5GAN 6;  3CPF A;  3V7R A;  2KVQ G;  5LJ5 d;  4A4K A;  4JS4 A;  4MDX A;  2H3J A;  5I21 A;  4JRI A;  5IT9 E;  2DXU A;  2RI5 A;  3TCJ A;  5KCH A;  2E70 A;  2ZPI B;  3JCM e;  1K9M U;  4JUV A;  3NTH A;  3L2W A;  1GXI E;  3OSS C;  2EKO A;  3PMI A;  5GAN j;  1BI3 A;  3V7S A;  1HK9 A;  3JCM h;  1YHQ A;  3HHT B;  4DOV A;  3OYH A;  3S3M A;  5D6W A;  1N6A A;  2L89 A;  3E9F A;  4N0A A;  4M75 F;  5LJ3 h;  2P0Q A;  4PJO E;  1FX7 A;  1BIA A;  3G4S A;  1VQO T;  4ZTJ A;  4L6V 5;  2K5I A;  4EMK A;  5GAO p;  2RH2 A;  2JZ2 A;  3F70 A;  1BKB A;  1M5Q 1;  1W4S A;  1WPY A;  2RM4 A;  2ZGW A;  3LLR A;  3INZ A;  4LD6 A;  4KT0 E;  4OGE A;  4QQ6 A;  4B9X A;  3L1A A;  5CO7 A;  1Y96 A;  4M77 B;  4IKF A;  4M7D F;  4II1 A;  2KY9 A;  2VXE A;  2PUO B;  3GF5 A;  3C4S A;  3FC3 A;  2E1H A;  2JN0 A;  5GAN h;  4IUR A;  2MMP A;  2KDS A;  4M78 D;  1VUB A;  4A4F A;  2DIG A;  4BY6 B;  4KBM B;  5LJ3 g;  5GAO m;  1XQH A;  2R5A A;  1VQK T;  2OAU A;  1YIJ T;  3MEW A;  4YTL A;  3ZBD A;  3OYM A;  1QVP A;  2YLC A;  3J80 E;  1M1K U;  2QTX A;  4KUL A;  2LRQ A;  3OS0 A;  2K4Y A;  4BUG A;  2M16 A;  2R5M A;  2GFU A;  2LX9 A;  3QHS A;  4KUI A;  5FRN A;  2EQJ A;  1YIT T;  4J83 A;  2DJZ A;  3OYN A;  4OMF B;  2E65 A;  4XTU A;  4JRK A;  4P5N A;  2VXF A;  2VGN A;  1YJ9 A;  2K2V A;  3LYI A;  3A8G B;  3RIR A;  5J39 A;  1R8O B;  4PJO A;  1G3Y A;  5LJ5 g;  2DZ9 A;  2QQR A;  3A8O B;  4C8Q A;  1S72 A;  5D6X A;  1VQ7 A;  5GAN 8;  1YI2 A;  5LL6 S;  2RB6 A;  4M77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...