1JBMA

Heptameric crystal structure of mth649, an sm-like archaeal protein from methanobacterium thermautotrophicum
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
78
structure length
78
Chain Sequence
VNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The oligomerization and ligand-binding properties of Sm-like archaeal proteins (SmAPs)
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Structural genomics
molecule keywords PUTATIVE SNRNP SM-LIKE PROTEIN
total genus 14
structure length 78
sequence length 78
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2001-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1jbmA00
2YLBA 4XTZA 2E1HA 5LJ5d 4M7DE 2EJGA 4PJOB 3V8KA 4M78D 4X9CA 2DXUA 4C92D 4C8QC 5GAMf 5GANe 2DTIA 5GAOp 5GAN3 5GANf 4Y91A 1WNLA 4XTXA 1KQ1A 4M75E 4C92B 4EMHA 4M7AE 4M75B 4M7AB 4PJOG 1TH7A 1Y96B 5LJ3f 3BY7A 1M5Q1 3RKXA 5GMKm 4J6YA 1M8VA 3SWNB 1LOJA 5GANg 5LJ5f 3QO3A 4JRIA 1JRIA 4C92C 5CAIA 2E41A 3EFSA 2JN0A 4XU2A 4XQ3A 5GAOr 4M77D 4NL3A 4PNOA 3JCMc 2FB7A 5GANj 4J6XA 1MGQA 5LJ5g 3RERA 3JCMg 2ZGWA 1Y96A 3RUXA 2K57A 4NL2A 3JCMX 4J5YA 4C92F 4QVCA 3SWNA 2DZCA 3JB9J 3BW1A 5GAN7 4N0AC 3M4GA 4XTWA 5LJ3g 2RB6A 5GAMj 2Y90A 5GAMd 3JCMV 2DJZA 1LJOA 4EMKA 3L1AA 4M78F 5GAMe 4M7DC 3JCMJ 1LNXA 4A53A 1HK9A 1N9RA 2VC8A 3BDUA 4N0AA 4JRKA 5GAN5 3JB9G 3QSUA 4V2SA 1X01A 4EMGA 3GIBA 4M75G 4M7AG 3JB9D 1WQWA 4M78E 4X9DA 4C8QG 4JUVA 5GAOm 5GMKi 4MMKA 4C8QD 2DTHA 4M75D 4M7AD 3JCMf 4DQ2A 3SB2A 4M78C 5LJ5h 4M7DF 5GAOq 4M7DB 4PJOE 1BIBA 1WQ7A 3JB9I 2DVEA 2VXEA 2RM4A 5GANd 5GAMg 3RKYA 2RA2A 4XTVA 3V7SA 4M75A 1H641 5LJ3j 4C8QA 4M7AA 3L2ZA 4C92G 4F7UB 3FJPA 4MMLA 2DXTA 4F7UE 3JCMd 3PGGA 3V7CA 3JB9H 4M77G 5LJ3h 3AHUA 3EFRA 2E10A 5GAN4 3JCMb 4M78B 5GAN2 3FB9A 4WF2A 4J6WA 3QHSA 4A54A 4XU0A 3JCMh 1WPYA 2EAYA 5LJ3d 3JCMP 4M7DA 4PJOF 2FYKA 1N9SA 1I5LA 4M75C 4F7UA 4OP0A 4M7AC 3BFMA 1BIAA 2EWNA 4HT8A 4PJOD 2DTOA 5LJ5j 4M77A 1I4K1 5I21A 5GAOl 1U1TA 1B34B 2E65A 4M78G 3RKWA 2I2LA 4C8QE 4EMKC 4M77F 4F7UF 5GAN6 5GAN8 3V7RA 4C8QB 1D3BA 3V8LA 3V8JA 5GAOn 3JCMQ 3RESA 4HT9A 5GMKh 4F7UG 4PJOA 4PJOC 5DY9A 5LJ3e 2YHTA 1HXDA 3HFNA 2VXFA 4XTYA 4EMKB 4M78A 1U1SA 2QTXA 4QVDA 4C92E 4JLIA 4M77C 1I8FA 2YLCA 4C92A 4XTUA 1D3BB 4M7DG 2E64A 3SWNC 4RCBA 1I81A 3VU3C 5GAMh 3HSBA 4M7DD 3INZA 2DEQA 4M77E 2DKGA 4XU1A 4C8QF 4M75F 4M77B 4NOYA 4M7AF 3HFOA 3FIFA 4HA8A 3JB9F 5GMKe 1B34A 3QUIA 4XU3A 2RD1A 1YCYA 2CGHA 2HNIA 3RIRA 3JCMW 4RCCA 5GMKj 5GMKl 3JCMe 5GANh 1JBMA 5LJ5e 2EJ9A 1KQ2A 2DZ9A 2EJFA
chains in the Genus database with same CATH superfamily
2YLBA 4M7DE 5LJ5d 4M78D 3L2QA 3ULRB 4QQ6A 4C8QC 3CC2Q 3EHRA 4C92B 5FROA 5GMKm 1WJRA 4P5NA 4RG2A 5CVIA 2KROA 5CR2A 4XQ3A 3QYGB 3CCMA 1Q81C 1M90R 4JZ4A 3OY9A 1TS9A 1Q7YC 2DIQA 5GAMd 5LJ3g 1K8AR 3SHWA 4ESRA 3EG3A 1ABOA 1I0CA 3PMIA 1JJ2A 1BU1A 4OGEA 3CCLQ 3QSUA 1WA7A 3CCVQ 3CCVA 3PNWC 3JB9G 4X9DA 1NBEB 2VYTA 2AIRB 4KH0B 2DTHA 3VS7A 3MEUA 3JCMf 4J9DA 4M7DF 2JW4A 5GAOq 3M53A 4PL6A 4OMLA 4A63B 3L2UA 3RKYA 5M9OA 5KYYA 3A98A 5I2MA 2KGTA 4E7IA 3QBYA 1YJWQ 3CC7T 5KH6A 3EFOA 1PD1A 2KI7A 4J6WA 2DNUA 3HHTB 1QLYA 1N6AA 3P8HA 2B86A 4OP0A 4PJOD 2YDLA 4LN2A 1U1TA 2FEIA 1T3LA 3G4ST 4FSXA 1VQMA 1ZA1B 5GJWB 1UEBA 1GBRA 4HCKA 5GMKh 3PT9A 1MMAA 2RH2A 3HFNA 2DERA 2XIDA 4XTYA 3H8ZA 1U1SA 4IKFA 2QQSA 3QYHB 2DL8A 4J9HA 3G4SA 5D6YA 1D3BB 1VQPA 3INZA 1RAHB 2NUPA 2R58A 4KULA 1FXXA 1YNZA 4XU3A 2QASA 2GTJA 2JTMA 3C4SA 2C0IA 3GOXA 1C1AA 5LJ3j 1G2BA 1S72T 1VQKT 2DXUA 2HCKA 1M2VA 2DTIA 3M4YA 5GAOp 4B9XA 1S1NA 3CXCP 1V76A 5EG2A 3OYCA 5LJ3f 1G3WA 1LOJA 2RHUA 4JZ3A 1UJYA 3OB9A 1QCOA 4M7DA 5GAOr 1OI1A 1M1KR 1GFCA 4Z89A 4FT4A 2DYBA 5C0MA 2K4YA 4FYVB 1KD1C 2RI2A 2O01E 2HBWA 1JXOA 2LNVA 1WDXA 1Z9QA 3A5ZB 1QCNA 3BDUA 4JRKA 5ECAA 4EMGA 3NHNA 2EQUA 3CCJA 1ZSGA 1H3ZA 3GP8A 1TUDA 2LJ0A 2RO0A 4ZGDB 1VQOT 1IHWA 2KRSA 3MEWA 1KD1R 2CT3A 1MMDA 2JVVA 3E2UA 4WF2A 3CXCA 1VQOA 5CQYA 2EAYA 5HK0A 2DRKA 3EG1A 1YJWA 5I21A 2E65A 4C8QE 5HKCA 1IGQA 2CZ0B 3EHQA 4R55A 2K79A 5DY9A 5LJ3e 2V8JA 4Z02A 2DBMA 4QVDA 2RQVA 1SF9A 1K0XA 2JOYA 4IUUA 1D09B 2GBQA 3OYYA 3FLGA 4A4HA 2EQKA 1OV3A 2E6NA 2V8KA 1D0ZA 2KSSA 4AMCA 4OVAA 3RR6A 1FX7A 2RNAA 1Y0MA 3I55T 3NFCA 4HCBA 2FVUA 4ELZC 2HQHA 1YIJQ 1GCPA 3CEYA 4AFQC 2EPDA 1TOVA 1YN8A 1G3YA 2GF7A 5AT1B 4O6JA 3NTKA 1JXMA 4M77D 2RQTA 1QQJA 3JCMg 3VRYA 4E2FB 3HTRA 1YI2T 1T3SA 1O75A 4EMKA 4RTXA 3R6NA 1LCKA 3CC4Q 1JJ2P 2XICA 3CCET 2L3PA 4IIOA 1O9SA 2OTLT 4Z8AA 1N27A 2J7IA 3SB2A 3J7AF 2X3WD 3HRTA 3X28B 2DD4A 3LWHA 2L89A 2LNHB 2OAWA 2RQUA 1MNDA 1M3AA 2LCCA 3JCMd 4AFUC 2JM9A 5CKBA 4EIKA 3S3MA 2QGFB 3CCUQ 3JCMP 2DO3A 3I56A 4FIBA 3TU4K 4OMPA 8AT1B 3BFMA 1BIAA 4HT8A 2YUPA 4M77A 1NE8A 1YJNQ 4RTUA 4ELYC 4CC3A 3BE3A 4MDXA 1UHFA 5GAOn 1VQ6T 4HCZA 2DE0X 4IUPA 1RI9A 2XD0A 1D1AA 2VKNA 1OYXA 1VQOQ 1KQSS 2XDBA 1UGVA 4J7FA 5FW9A 4FW2A 3LH5A 1VQ9A 2RQWA 4D8KA 3RIRA 2BZXA 2QA4Q 2GQIA 5I22A 1KQ2A 2CP7A 3RBBB 2JUFA 3FJ5A 2O9VA 5GAN3 1RADB 5FRMA 1R8OB 2V8IA 1D1BA 2J6FA 3META 5CAIA 2E41A 1ZSZC 3OQ5A 1PHTA 4A4EA 2GCXA 2E5KA 2A3LA 4FM4B 4LE9A 1VQ4Q 4J5YA 5A0LA 5GAN7 4PJLA 3M4GA 4XTWA 5J39A 1G8XA 1XQHA 4A4GA 2XHCA 2X3XD 1IZ6A 1KQSP 3QPHA 1AWWA 2L3SA 2LX9A 1RAEB 3M0SA 4KRTA 1XNIA 4FYWB 1KK7A 2ZPBB 4ZN1A 3QWXX 3V7SA 1W6XA 2ZPGB 3DKMA 4C92G 3FJPA 1FYNA 5KCOA 2J05A 2MCNA 1RLPC 2EGEA 3PVQA 2J6KA 3JSCA 4X1VA 4PJOF 2EQIA 2AT1B 1VQ4A 1UDLA 2QDLA 1I5LA 1YWPA 3THKA 2SEMA 2EYYA 4L5GA 3RKWA 4EMKC 4C8QB 3Q1JA 1NPRA 1UFFA 1WHJA 1Q7YR 5CCAA 3CBMA 1OPLA 3U23A 4M78A 2LDMA 1C6VX 1YWOA 1PC0A 2AZSA 4C92A 2YXYA 2E64A 3DLMA 1I81A 3HSBA 4M7DD 2V1RA 4NOYA 3EG2A 3FIFA 1B34A 1RL2A 3E9FA 2RD1A 3RDVA 1W2BS 2FHDA 3A8OB 4R56A 3ZEHA 4X9CA 4WCIA 4MZPA 1OU8A 1NEBA 4Q5WA 3VYGA 4PJOG 1M1GA 1R77A 1VQ9Q 5HK3A 3O5ZA 1YJ9A 1N8RC 3A8GB 3CPWA 3QO3A 4KBMB 2JMAA 5LL6S 1JJ2S 1SPKA 3REAB 4OMOA 2FB7A 1HSQA 2F2XA 1R0BG 4OF1A 3OYEA 2DL3A 4DBRA 1VUBA 2BZYA 3LWIA 1W2BP 4RMOA 2YWWA 4HXJA 3CCMQ 3JCMJ 1N9RA 1SKUB 3PE0A 1ZHIA 1XJWB 3UATA 1WX6A 3VYHB 4BD3A 4XAXB 4F14A 3JRZA 1ZBJA 3OYAA 4XTVA 4MZTA 2CZ7B 3FEOA 1PRLC 1UB4A 2ROLA 4E7SA 2GQVA 4FT2A 2YRVA 1BCOA 1RI0A 1R0CB 4FSSA 2IG0A 2YRDA 2MIOA 1RAAB 1UJ0A 2DXBA 4DEXA 4MZMA 2VWFA 2LVMA 5KYUA 3G71Q 2CZ6B 4J83A 2X51A 3CBOA 4A4KA 2ZPHB 3P8BB 4C5IA 3X25B 3LGLA 1YP5A 3MP8A 1VQ6A 2OTLQ 3OYKA 2MWPA 3HKSA 3M0PA 4XTUA 2BIVA 3I55Q 4C8QF 2IPOB 1TSFA 3HFOA 4LDXA 2O4XA 3PGGA 2RN8A 4PJOB 2EJGA 2D9TA 5FU6C 4LUEA 5GAMf 2FZGB 1X75C 2E5QA 2PNIA 5IN1A 3BY7A 3QDRB 4PLLA 3CC7Q 2PZ1A 1D0YA 4TVRA 3X24B 3VJPA 3MP1A 4DEYA 5LJ5g 1RUWA 2E3HA 3JAME 3JV3A 3RMSA 3CQTA 3H0HA 2GGRA 1AD5A 1KC8R 2L3QA 1P92A 3TCJA 4BY6B 2K5FA 2PVGB 3GF5A 4C8QG 5D6XA 4M75D 2GFAA 2PVOB 4LDYA 1BIBA 2DVEA 1HYOA 3E19A 2PUOB 4ZGEB 3CXCS 4II1A 4M7AA 2QG9B 2MAMA 1Q82R 2K9GA 3DB3A 2B8AA 3LYIA 1VQLA 2QDYB 3EFRA 1MNEA 4J9CA 1VA7A 2WSEE 2LT4A 2HMAA 3VUBA 3CMAT 3WXMB 3H0FA 2YUQA 1GFDA 4RTYA 3PFSA 1YHQQ 1VQ8Q 4M77F 3GBQA 1JB0E 2JMCA 2V26A 2GFUA 3CC4T 3V8JA 2MYSA 4LNPA 3LLRA 2DLPA 1N8RU 1ARKA 4EMKB 1H8KA 1RLQC 5KYUB 2L3RA 4JLIA 1NLOC 2DILA 2YLCA 5EC7A 2FO0A 2NLUA 2DKGA 4AFZC 2ENMA 1VQ6Q 2F2WA 5L23A 4KGVB 1WIEA 2LTOA 1K9MU 1TUGB 2YRCA 1G3SA 1VQPQ 3G71T 1WJSA 5KYXA 4JDSA 3G4SQ 5GANf 2JS2A 3PVLA 2O4XB 4M75B 2ZPFB 3REBB 1TH7A 4J6YA 3MEAA 2YSQA 1JEGA 3LW5E 5D7UA 5D6WA 4F04B 3EGXA 2E12A 4QVCA 3C0CA 4BACA 2EYWA 4N0AC 3CD6A 4FW1A 1LJOA 3ZL7C 1YJNA 2VC8A 5GAN5 3VS1A 2YUOA 1QVGA 3C12A 1IGUA 2MF2A 2PUKB 3VS3A 4BI4A 2OAUA 2QTVA 2KNBB 4YTLA 3X26B 1V1CA 2PTKA 1QVFA 2A36A 1VQ8T 1SHGA 3OYHA 1GXIE 1E7OA 1PWTA 2CUDA 3A8MB 4JS4A 1QVGP 2XU8A 2GNCA 4FYXB 2CH4W 2L0AA 1W4SA 2LQWA 4MDWA 2XKOC 3VS0A 2RQRA 2EWNA 4C5GA 1I4K1 3EH2A 1VQNA 4JJCA 3QG1A 3M0RA 4M4ZA 2DIGA 3FC3A 4PJOC 4F7UG 1M1KU 1K8AC 3MJXA 4C0ZA 1VQNT 4R0KA 2M1HA 4QQGA 3OYLA 2FPDA 1ZLMA 1BCMA 2CUBA 4IIMA 1YHQT 4M7AF 4ZN3A 3CC2A 3KFVA 5GANh 3VS5A 2E1HA 1K9MC 2K5LA 4E7JA 2KAFA 2AK5A 3ASKA 5CK9A 2AZVA 1JQQA 4EDUA 4M75E 2QK0A 2RI3A 2RHXA 2CSQA 4JPBW 4LD6A 5DM7R 1NJIR 1ZUUA 3SWNB 2EGCA 2XK0A 2OTJA 3E1SA 1PSFA 3CBPA 2KE9A 4C0GA 1OZ3A 4NL3A 1BI2A 2BE7D 4D6WA 2J6OA 2X9HA 1XOVA 2EIFA 2ZPIB 2O31A 3I5SA 3L2RA 2EVRA 2L2PA 3JCMV 4V2SA 5I11A 3JB9D 2XI9A 2BTTA 1NEGA 2OTLA 3OYMA 3WVEB 5CKEA 2KQWA 5IHIA 4E6RA 3CCQT 2YT6A 2HKNA 4C8QA 3UT1A 3L2ZA 4BI3A 2Y4XA 2X4XA 3QJ6A 4GY5A 4MMLA 3KXTA 2R5AA 1M2OA 2M02A 2W10A 1I5OB 2ROTA 1OX8A 4M78B 5A2QE 2K5IA 4CC2A 3H0IA 5J26A 1UGQB 3S3NA 2X4YA 2JJ9A 3I56T 1QKWA 1K73C 1B34B 5GAN8 2I2LA 2K3BA 1WHMA 2HL3A 3CCLT 3C94A 1K76A 3O8VA 1EFNA 1KSWA 1ZSZB 2QTXA 2LX7A 4KGZB 4E47A 3PIPA 1NG2A 1OU9A 1NYGA 3VU3C 1QWFA 1OPKA 4XU1A 4C5HA 1LVKA 3CCUT 1X6GA 2DM1A 1WHLA 2CP6A 3M56A 3WVDB 2DL7A 3M9QA 3CPWS 1X2QA 4CC7A 1PG5B 4C92D 1BYMA 1K73U 6AT1B 2CREA 4EMHA 1Q95G 4M7AE 1I07A 1RACB 2FG0A 1YCSB 3OS5A 4X34A 1M8VA 4ORZA 2QEXT 1G5VA 2DK3A 2VV5A 4RKUE 4XU2A 2IVWA 4J9BA 1UGPB 1QVFP 1PKSA 1M3CA 4NL2A 2EW3A 4JJNK 3SWNA 2DZCA 3CCRA 2D8JA 1TTHB 1ZBXA 2XDPA 3GIBA 4FL6A 1WQWA 4BDZA 2NUTA 1W1FA 2KT8A 4PJOE 1M3BA 2VB6A 3UA6A 1PSEA 2NYSA 1KFZA 2M51A 2CP2A 4J7IA 3M58A 3A8HB 2KDSA 3CPWP 1AWXA 1VQ8A 3JB9H 4M77G 2E6ZA 1AWJA 3MP6A 2ABLA 5GAN2 2KVQG 1BB9A 3QHSA 5LJ3d 1WJQA 1M4ZA 3CPFA 1VQPT 5AYFA 2RHYA 1RABB 3UA7A 3V7RA 3CCEA 2LT1A 1Q81U 2CP3A 4PJOA 1M1FA 3QWYA 4N4GA 2C0OA 5I2SA 1SSFA 3S6WA 1K0SA 5HY6A 4PJMA 2LQ8A 1M90U 3I56Q 3PIOA 1WXUA 1YJ9T 1PCXA 3OYGA 1IO6A 1YCYA 2O9SA 2R5MA 5KCHA 1ZSZA 3OYIA 1UECA 1JU5C 4DA4A 1Q82C 1E6HA 2LC4A 1VQ5A 2R57A 2VUBA 3HP9A 2AHJB 4FYYB 4XTXA 1BBZA 1Q81R 2O88A 1SRMA 3M54A 1KJWA 2P4RA 1MUZA 5LJ5f 1GRIA 2JN0A 4LD9K 4PNOA 1F1BB 3L42A 4N4IA 2JXBA 1J3TA 2M0OA 1PNJA 2OJ2A 5GAMe 3OYBA 5FWCA 2A7YA 4BUGA 3QXEB 1TG0A 3CMAQ 3TSZA 1WQ7A 1WI7A 1PKTA 3OW2A 2FRYA 4K11A 1QVPA 1H641 1Q86C 2BZ8A 1YJNT 3S3OA 1GCQC 3GNFB 4F7UE 1Z9ZA 2CP0A 2EYZA 3V7CA 2QEXA 4PLIA 1QP2A 3JCMb 4A4FA 3CCJT 1WPYA 4OMMA 2DXCA 2VGNA 1UHCA 5LJ5j 1Q7YU 2FPEA 4M78G 2C06A 3EAEA 5GAN6 2DX1A 3OBWA 2G6FX 1TU0B 3FDRA 1FMKA 1WYXA 3RESA 4BDYA 1WHKA 4E7HA 4PFOA 3J81E 2M16A 2KYMA 3EG9B 1VQ5Q 4O5VA 1OQKA 5CKHA 2W0ZA 1OX9A 1VQ7T 1QWEA 2RHIA 4RTTA 2EBPA 1H3HA 3HPWA 2ED1A 4DBFA 1HJDA 2VGMA 3I5RA 2LQKA 8ATCB 1YHQA 1VQKA 2QQRA 3OYNA 5A0DA 3CC2T 2D6FA 1Y96B 1UG1A 5IT9E 4C92C 1GL5A 3EFSA 1KC8C 5GANj 1DJ7B 3RERA 1PRMC 1SHFA 4IUTA 4CRIA 3JCMX 1QP3A 3D7SB 3BW1A 4PFPA 1VQ4T 4XK8E 2Y90A 1OULA 2DAQA 2E3IA 1B07A 2OTJT 3ER0A 1YIJT 1FWZA 2KRNA 1YFNA 2LCLA 4JUVA 1AT1B 4LXCA 2ZAEA 4KT0E 4ZTJA 5KYWA 2L5QA 1VQ5T 1X6BA 1UUEA 2F1LA 5CO7A 2DVJA 3SEMA 3CD6Q 1KIKA 4J8OA 2KXDA 1YITA 4BB7A 2CH4A 1TWBA 1LPLA 3CMEA 1IXDA 1QMCA 2WACA 1FMVA 3OMGA 3MKDA 1RAIB 4GBQA 4E7LA 1M1KC 1FMWA 2RK2A 2OI3A 3R6OA 3CD6T 3TSWA 2WSFE 3MEVA 3NTHA 1AOJA 2EYXA 2HZYA 3MO8A 3EG0A 1I8FA 1WXTA 5IAYA 4LDUA 1GBQA 5IXFA 1YI2Q 4M77E 1K9MR 1I1JA 5C6SA 1S72A 4D8DA 2HNIA 2GTOA 5GMKj 3ZBDA 3JCMe 2CKKA 2IIMA 9ATCB 3P8DA 4XTZA 1T0HA 2COWA 3V8KA 2KEAA 3OSVA 5FRNA 2LQNA 2H3EB 1D1CA 2KR3A 4JRQA 2RI5A 1M9SA 1RAFB 4PJNA 2QQAA 1Q82U 4F16A 1BKBA 3OMCA 2HL5C 4OMQA 4OMFB 2RJCA 1JRIA 2RMOA 1RAGB 3URGA 2QQBA 4JLGA 1VYTA 2KYBA 1Y96A 2DA9A 1U3OA 2K57A 5IH2A 2MPXC 3NGPA 4RTVA 1D0XA 2HKQB 1ZQ1A 3M0QA 3DLLA 1HK9A 2QXFA 3LX7A 1M90C 1IHVA 4GLMA 3I35A 4M78C 4OB1B 1VIFA 4B9WA 5FU7C 5IHKA 3J80E 3CCRT 2CP5A 2YUNA 2HSPA 3NTIA 4BE0A 1VYVA 2K3YA 2LMJA 3CCMT 2AKKA 1X27A 1K4US 1AWOA 2QQ9A 3M5AA 2K2VA 5KE3A 3A8LB 2CZ1B 3IQLA 4Y92A 1E6GA 3AHUA 2DETA 2KBTA 3TREA 3CCSQ 1Q86R 2OX7A 4C0FA 1G3TA 1Y07A 2EQMA 4KUDK 3LGFA 1EIFA 3OBYA 1KD1U 1IRXA 5L8RE 5DLOA 3CCEQ 3V8LA 1KC8U 4LDVA 3CC7A 3L2VA 5CKDA 2KMTA 1HXDA 3OW2S 1UE9A 2LZ6B 2ECZA 2D0QB 3VS2A 4C92E 1SRLA 2F69A 3VUZA 3SWNC 2NUTB 4IURA 2HQEA 2DJQA 4RTWA 2OTJQ 2XDDA 2XMFA 4J9GA 3JCMW 2A0FB 5GMKl 1TUCA 4OGCA 2DZ9A 2EJFA 5GJVB 1NJIU 7AT1B 1UGRB 4C0DB 4DOVA 4DOWA 2EKHA 4C5EA 2COZA 4CC4B 4UC4A 1WGSA 2JNGA 5DLQE 3G6ET 5IHNA 1BI3A 3CC4A 4JS5A 2CT4A 4ATOA 2CSIA 1QW1A 1ZUYA 2CYZB 3M55A 1K9AA 1H92A 2F5TX 4J6XA 2Z0WA 2JS0A 2XG8D 1B3QA 1CSKA 3QZ9B 4C92F 1KHIA 2CDTA 3CCRQ 1AZGB 2RB6A 4OB2B 1CKBA 2DMOA 3CMEQ 4L6V5 4A53A 4N0AA 1MV3A 2QEXQ 1X6OA 1KHCA 5GAOm 1T0JA 2HDAA 4M7AD 2RPNA 3AT1B 4J9FA 3OYDA 2RM4A 3OS2A 3X20B 1VYUA 2RA2A 2DF6A 1HD3A 1GCQA 2EYQA 2HD0A 2DXTA 3I9QA 3M59A 1YITT 5LJ3h 4CI0C 2E10A 1OEBA 3FB9A 4A54A 2X4JA 2QGGA 3JCMh 4OB3B 1N9SA 2KRMA 1PM3A 2H8HA 1VQLQ 1WHGA 2X35A 2BUDA 1VQ7Q 1VOMA 2DD5A 1BI1A 1NYFA 4B6MA 3CCUA 3UPUA 2F2VA 3OSSC 1JO8A 4HT9A 1BK2A 3PMTA 4JJBA 4PJJA 4BE2A 3EFOB 3BDLA 4BE1A 4M77C 2I0NA 1XTDA 4QQDA 2LJ3A 2PU9B 3ME9A 1MMGA 3KBGA 3HRUA 2LCSA 4BY6C 2RJEA 2D1XA 5FLXE 4HA8A 4KGXB 4AT1B 3JB9F 5GMKe 3QUIA 2MMPA 3VS4A 1WLPB 2H3JA 2QI2A 3CCJQ 4IUQA 5KYYB 2MOXA 3CCQQ 1VQ7A 4Y91A 1KQ1A 1CKAA 1OOTA 3UF4A 4M7AB 2P0PA 2EFIA 1M8MA 2RK1A 4HVWA 2A28A 3CCVT 1YIJA 2P4TA 1ZUKA 1UTIA 2DL4A 3NPFA 3TVTA 5CQXA 3JB9J 2G3RA 3EG9A 3H9NA 2ESWA 3T9NA 3L1AA 4M78F 1C0MA 3I55A 3H6ZA 4J9IA 1X01A 2KK4A 4M78E 3QDFA 2F5KA 1G83A 3CMAA 2NUPB 2RJDA 3RNJA 3OS0A 4M7DB 4PKCC 3JB9I 1AEYA 4RG8A 2DRMA 2ED0A 1MV0B 3G7ZA 3CCSA 3SD4A 2D8HA 1V29B 2DL5A 3SFMA 3G1JA 3MPUB 1ZA2B 3CCQA 1YI2A 1Q86U 4QT7A 2LP5A 1TXQA 2PVDB 1KG1A 2K7AA 1M2VB 2SRCA 4HVVA 3TEEA 2P84A 3OYFA 4XU0A 3FRNA 3CCST 2FYKA 1VQMQ 1M30A 4FCYA 4HVUA 2DBKA 4M75C 4GLKA 2RF0A 4FU6A 2FPFA 4AG1C 4QVZA 4LDWA 4ZNXA 4RUGA 2AKLA 2COYA 4OMNA 4HCCA 2VXFA 3MHXA 3VS6A 1Y57A 3E9GA 1QCFA 3EGUA 3OA6A 2HBPA 4ZTFA 3F70A 4NS5A 1VQMT 4M7DG 3EGDB 4RCBA 4M75F 2WSCE 3LH0A 5KYWB 2JM8A 2HQXA 2QAZA 2MI6A 1JBMA 1QVFS 4IUVA 2QA4T 1W2BA 2LJ1A 1IREB 1PD0A 1SSHA 1EZZB 4E7ZA 2DFUA 4ANJA 5GANe 2E4HA 1NZ9A 2KT1A 3HRSA 3UDCA 1MHNA 1B7TA 2K6DA 3CCLA 4PK4A 3G6EA 3G6EQ 3EH1A 3RKXA 1X43A 2ZZDA 1OZ2A 1VQ9T 4JRIA 1SEMA 1VIEA 4DBHA 2JTEA 4F17A 2MK5A 3JCMc 1K8AU 1MGQA 2C0TA 1WXBA 2ZGWA 3QZ5B 3RUXA 4C0DC 1YJ9Q 1UGSB 4Y28E 1W70A 3KUFA 2HEQA 2D0NA 2DYIA 4M7DC 5CIUA 3SDZA 4M7AG 2PQWA 4DQ2A 2J06A 5LJ5h 2M9UA 5KYXB 2VXEA 4M75A 1YJWT 3A1PA 2VVKA 4F7UB 1YITQ 4ME7A 3L2WA 1X69A 4BI8B 2V1QA 3ZFJA 1U5SA 1AVZC 3HL8A 4ZGJB 1VQLT 1VQNQ 2EKOA 4QKUA 1U06A 3EGXB 4M7AC 1NLPC 4KUIA 3OS1A 2ZCFB 2BKDN 2DTOA 5GAOl 2JZ2A 1A0NB 4QW2A 4F7UF 5FU6B 3JCMQ 3QJYA 4J9EA 4VUBA 1YBYA 4N4HA 2DEUA 3M0UA 5FU7B 3GNGA 3NMZC 4HKEA 5KYNA 5KE2A 2A37A 2L8DA 1K1ZA 2O2OA 4AFSC 4EPCA 5GAMh 2NWMA 2X4WA 2RHZA 1SG5A 1QVGS 4M77B 4Z88A 4RCCA 2E70A 1NPPA 1VQKQ 3TQ7P 3EGDA 5A0GA 1KQSA 1NJIC 5CKFA 3VRZA 3VV0A 4PFZA 1Y71A 4KH1B 1WNLA 2HAXA 2RJFA 4AG2C 1AHJB 1BI0A 4JRPA 4RTZA 1M5Q1 2M0YA 5GANg 1EX4A 4LUDA 5IXBA 3DB4A 5HCKA 4E7KA 3MCAB 1K73R 1QKXA 1AZEA 2BE9B 2ATCB 5FWBA 5GAMj 2CS7A 2DJZA 1LNXA 2JT4A 3CMET 4WTOB 4M75G 3UWNA 5GMKi 4MMKA 4C8QD 3RMQA 1Y7XA 3M0TA 2QA4A 2HSEB 3N5BB 5GANd 2MWOA 1WHHA 2FZCB 2LRQA 2KY9A 1M27C 2DPPB 1MMNA 5GAN4 2P0QA 2KXCA 2VASA 4OB0B 5J3BA 2ZPEB 3PTAA 4JJDA 1IB8A 4F7UA 1U8RA 3G71A 1ABQA 2FRWA 3OW2P 1D3BA 2FL7A 3H41A 1NM7A 3GPLA 4L59A 1S72Q 2YHTA 3VKIA 3QKJA 1X2KA 1ZX6A 2EGAA 2K3XA 2A08A 2JTFA 2P0KA 2FZKB 4DBQA 1WFWA 3OYJA 2EQJA 2K2MA 2DEQA 3M57A 1N8RR 2NUZA 1WZOA 2QYZA 3C95A 1N5ZA 2CGHA 2Y4YA 3GLXA 3QIIA 1ACMB 5LJ5e 2EJ9A 5GAMg
chains in the Genus database with same CATH topology
2YLBA 1W2BS 1NJIU 3M56A 3WVDB 4M7DE 5LJ5d 3M9QA 1UGRB 2FHDA 3A8OB 4C0DB 4DOVA 4M78D 4DOWA 4R56A 3ZEHA 4X9CA 3L2QA 4QQ6A 4C92D 4C8QC 4C5EA 1BYMA 1K73U 4UC4A 1WGSA 2JNGA 4MZPA 5DLQE 3G6ET 4EMHA 4C92B 1BI3A 4Q5WA 4M7AE 3VYGA 3CC4A 4PJOG 1M1GA 3OS5A 4X34A 5FROA 5HK3A 5GMKm 1M8VA 1YJ9A 2QEXT 4JS5A 1G5VA 4ATOA 1N8RC 3A8GB 2DK3A 2VV5A 1QW1A 3QO3A 4KBMB 4RKUE 1WJRA 4P5NA 3CPWA 4RG2A 5LL6S 2CYZB 1JJ2S 5CVIA 3M55A 5CR2A 4XU2A 4XQ3A 2IVWA 2F5TX 2FB7A 3QYGB 4J6XA 3CCMA 1Q81C 1UGPB 2XG8D 4OF1A 3OYEA 4NL2A 3OY9A 3QZ9B 4C92F 1KHIA 3SWNA 2DZCA 4JJNK 1VUBA 3CCRA 1Q7YC 2DIQA 3LWIA 5GAMd 5LJ3g 2RB6A 1ZBXA 4RMOA 4OB2B 3PMIA 4L6V5 3JCMJ 1JJ2A 4A53A 4OGEA 1N9RA 4N0AA 3QSUA 3CCVA 3PNWC 3JB9G 2XDPA 1X6OA 4FL6A 3GIBA 1KHCA 1ZHIA 1WQWA 4X9DA 5GAOm 2VYTA 4BDZA 3VYHB 4BD3A 2DTHA 4M7AD 3MEUA 3JCMf 4XAXB 4M7DF 3JRZA 5GAOq 3OYDA 4PJOE 3M53A 4PL6A 2RM4A 3OS2A 3L2UA 3X20B 1VQ6T 1PSEA 5GAMg 3RKYA 5M9OA 2RA2A 3OYAA 4XTVA 4MZTA 2CZ7B 3FEOA 4J7IA 2EYQA 1UB4A 2HD0A 3M58A 5I2MA 2DXTA 2GQVA 3A8HB 2YRVA 4FT2A 4E7IA 3QBYA 2KDSA 3CC7T 3M59A 1YITT 1VQ8A 4M77G 3JB9H 2E6ZA 5LJ3h 3MP6A 1RI0A 2E10A 4CI0C 5KH6A 5GAN2 2IG0A 2KVQG 3FB9A 4J6WA 3QHSA 4A54A 2X4JA 3HHTB 3JCMh 1N6AA 5LJ3d 1WJQA 1M4ZA 3CPFA 3P8HA 4OB3B 2DXBA 1N9SA 4OP0A 1VQPT 4MZMA 5AYFA 4PJOD 2X35A 2LVMA 2BUDA 2RHYA 2CZ6B 2DD5A 1U1TA 4J83A 3CBOA 1BI1A 3G4ST 3V7RA 4A4KA 2LT1A 2ZPHB 3P8BB 4FSXA 4C5IA 3CCEA 3CCUA 1VQMA 3UPUA 1Q81U 1UEBA 3OSSC 3X25B 4HT9A 5GMKh 4PJOA 3LGLA 1M1FA 3PT9A 2RH2A 3HFNA 3MP8A 2XIDA 3PMTA 4N4GA 3OYKA 4XTYA 1VQ6A 5I2SA 4BE2A 3H8ZA 1U1SA 2MWPA 3BDLA 2QQSA 4IKFA 3QYHB 3G4SA 3HKSA 3CPWS 4BE1A 1SSFA 4M77C 5D6YA 3S6WA 1XTDA 4XTUA 1D3BB 5HY6A 4QQDA 2BIVA 2LQ8A 2PU9B 3ME9A 1M90U 3PIOA 1VQPA 3INZA 3KBGA 3HRUA 4C8QF 2R58A 4KULA 2RJEA 1FXXA 4BY6C 5FLXE 3HFOA 4HA8A 3OYGA 1YJ9T 5GMKe 3JB9F 3QUIA 4XU3A 1YCYA 2MMPA 2R5MA 2JTMA 5KCHA 3OYIA 2O4XA 3C4SA 4LDXA 3PGGA 3GOXA 5LJ3j 2H3JA 2QI2A 4DA4A 1S72T 1Q82C 4PJOB 2EJGA 2D9TA 4IUQA 5FU6C 2LC4A 1VQ5A 2R57A 1VQKT 2DXUA 2VUBA 3HP9A 5GAMf 2DTIA 3M4YA 2AHJB 5GAOp 1VQ7A 4Y91A 4XTXA 1KQ1A 1X75C 4B9XA 2E5QA 5EG2A 4M7AB 2P0PA 3OYCA 5LJ3f 5IN1A 1G3WA 3BY7A 3QDRB 2EFIA 3M54A 1LOJA 2RHUA 4PLLA 2RK1A 5LJ5f 4TVRA 3OB9A 3X24B 3CCVT 3VJPA 3MP1A 2JN0A 5GAOr 4LD9K 4M7DA 1OI1A 1YIJA 4PNOA 2P4TA 5LJ5g 4N4IA 3L42A 4FT4A 3JAME 5C0MA 3RMSA 2K4YA 5CQXA 3JB9J 2M0OA 1KD1C 2RI2A 2O01E 2G3RA 2LNVA 3T9NA 3L1AA 4M78F 1P92A 3TCJA 3A5ZB 5GAMe 3I55A 3BDUA 3OYBA 4BY6B 2K5FA 4JRKA 3H6ZA 1X01A 4EMGA 2PVGB 2EQUA 2KK4A 3GF5A 2A7YA 4M78E 4C8QG 3CCJA 3GP8A 1H3ZA 4BUGA 2F5KA 5D6XA 3QXEB 4M75D 2GFAA 3CMAA 2PVOB 2RJDA 4LDYA 3OS0A 4M7DB 1BIBA 1WQ7A 4PKCC 2DVEA 3JB9I 3OW2A 4RG8A 3E19A 2PUOB 4ZGEB 3CXCS 3G7ZA 3CCSA 4II1A 3SD4A 2RO0A 4ZGDB 1QVPA 1V29B 1H641 1VQOT 1Q86C 2MAMA 4M7AA 3SFMA 1YJNT 3DB3A 1YI2A 1Q86U 3CCQA 3S3OA 3GNFB 4F7UE 2B8AA 3LYIA 3MEWA 2PVDB 1VQLA 1KG1A 3V7CA 2QDYB 3EFRA 2JVVA 2QEXA 4PLIA 1QP2A 3JCMb 3TEEA 4A4FA 4WF2A 3CCJT 2WSEE 3OYFA 4XU0A 3CXCA 5CQYA 1VQOA 1WPYA 2LT4A 2EAYA 3FRNA 5HK0A 3VUBA 3CCST 2FYKA 3CMAT 2DXCA 3WXMB 2VGNA 4M75C 1YJWA 5LJ5j 1Q7YU 4GLKA 3PFSA 4FU6A 5I21A 2E65A 4M78G 4C8QE 5HKCA 3EAEA 5GAN6 4M77F 2C06A 4QVZA 3OBWA 1JB0E 2GFUA 3FDRA 2CZ0B 4LDWA 3CC4T 3V8JA 4R55A 3RESA 3LLRA 4HCCA 4BDYA 5DY9A 5LJ3e 2V8JA 4E7HA 2VXFA 3MHXA 1N8RU 4EMKB 3J81E 2M16A 4Z02A 2L3RA 3E9GA 4QVDA 3OA6A 4JLIA 2HBPA 4ZTFA 3F70A 2YLCA 4NS5A 2JOYA 1VQMT 4M7DG 4O5VA 4IUUA 4RCBA 5CKHA 2NLUA 2DKGA 3OYYA 1VQ7T 4M75F 2WSCE 2RHIA 3LH0A 2HQXA 3FLGA 2MI6A 4A4HA 2EQKA 2E6NA 1JBMA 3HPWA 2LTOA 1K9MU 1QVFS 2V8KA 4IUVA 2QA4T 1G3SA 2KSSA 1W2BA 1IREB 4OVAA 2VGMA 3G71T 1WJSA 1FX7A 5GANe 1NZ9A 3HRSA 4JDSA 2LQKA 3UDCA 5GANf 1YHQA 1MHNA 1VQKA 2QQRA 3I55T 3NFCA 4HCBA 2FVUA 2O4XB 4ELZC 3OYNA 5A0DA 3CCLA 4M75B 3G6EA 2ZPFB 3CC2T 2D6FA 1TH7A 1Y96B 3RKXA 4J6YA 3MEAA 2ZZDA 3CEYA 1OZ2A 1VQ9T 3LW5E 1G3YA 2GF7A 4JRIA 5IT9E 4C92C 1VIEA 4O6JA 3EFSA 3NTKA 1KC8C 4M77D 5GANj 1DJ7B 3JCMc 1K8AU 1MGQA 3RERA 5D6WA 3JCMg 2ZGWA 3QZ5B 4IUTA 4CRIA 3RUXA 4C0DC 3JCMX 2E12A 1QP3A 1UGSB 4QVCA 4BACA 3BW1A 1VQ4T 4Y28E 1YI2T 4N0AC 1O75A 3CD6A 3KUFA 4XK8E 2Y90A 2DAQA 1LJOA 2OTJT 4EMKA 3ER0A 4M7DC 5CIUA 1YIJT 1YJNA 1FWZA 2VC8A 5GAN5 2XICA 1QVGA 3CCET 3SDZA 4M7AG 1O9SA 2OTLT 2LCLA 2PQWA 4JUVA 3C12A 4KT0E 4ZTJA 1N27A 4DQ2A 2MF2A 3SB2A 2PUKB 5LJ5h 3J7AF 2M9UA 2L5QA 2VXEA 1VQ5T 4BI4A 2OAUA 3HRTA 3X28B 4M75A 2DD4A 3LWHA 4YTLA 3X26B 5CO7A 1YJWT 2L89A 1QVFA 4F7UB 4J8OA 1YITA 1VQ8T 4ME7A 3L2WA 4BI8B 3ZFJA 4BB7A 2LCCA 3JCMd 5CKBA 3OYHA 3S3MA 3CMEA 1GXIE 4JS4A 3A8MB 2XU8A 2WACA 3HL8A 4ZGJB 3JCMP 1VQLT 2EKOA 3OMGA 2DO3A 3I56A 1W4SA 4FIBA 4MDWA 2XKOC 3TU4K 4M7AC 4KUIA 3BFMA 1BIAA 2EWNA 3OS1A 2ZCFB 2BKDN 2DTOA 4HT8A 4M77A 4C5GA 1I4K1 5GAOl 2JZ2A 1NE8A 4QW2A 4E7LA 1M1KC 1VQNA 4F7UF 3QG1A 2RK2A 4ELYC 3R6OA 4MDXA 3CD6T 2WSFE 5FU6B 3MEVA 2DIGA 3NTHA 3JCMQ 3QJYA 4HCZA 4F7UG 5GAOn 3FC3A 4VUBA 4PJOC 4IUPA 2XD0A 1YBYA 4N4HA 1M1KU 1K8AC 5FU7B 3GNGA 1OYXA 4HKEA 3MO8A 4C0ZA 5KE2A 1KQSS 1VQNT 2XDBA 1I8FA 2M1HA 5IAYA 4LDUA 4QQGA 3OYLA 2L8DA 4J7FA 4EPCA 5GAMh 2X4WA 4M77E 1VQ9A 2RHZA 1QVGS 1YHQT 4M7AF 4M77B 4ZN3A 5C6SA 1S72A 3CC2A 2HNIA 3RIRA 4RCCA 5GMKj 3ZBDA 3JCMe 5GANh 2CKKA 2E70A 1NPPA 1KQ2A 3P8DA 4XTZA 2E1HA 1KQSA 5A0GA 1K9MC 2K5LA 3V8KA 2JUFA 4E7JA 2KAFA 1NJIC 5CKFA 3OSVA 5FRNA 3ASKA 5CK9A 3VV0A 4EDUA 5GAN3 4JRQA 1Y71A 2RI5A 1WNLA 1M9SA 2HAXA 2RJFA 4M75E 2QQAA 1Q82U 1AHJB 1BI0A 5FRMA 1BKBA 2RI3A 2RHXA 3OMCA 4JRPA 1R8OB 2V8IA 1M5Q1 4LD6A 5DM7R 3SWNB 5GANg 2XK0A 2OTJA 4OMFB 3E1SA 2RJCA 3META 1PSFA 1JRIA 5CAIA 2E41A 3DB4A 4E7KA 3CBPA 3MCAB 4C0GA 3URGA 2QQBA 4JLGA 3OQ5A 1OZ3A 4NL3A 1BI2A 4A4EA 2GCXA 2A3LA 1Y96A 4FM4B 2K57A 4D6WA 4J5YA 1XOVA 2EIFA 2ZPIB 5A0LA 5GAN7 3L2RA 3M4GA 4XTWA 5GAMj 1ZQ1A 3JCMV 2CS7A 2DJZA 5J39A 1LNXA 3DLLA 1HK9A 4V2SA 1XQHA 2QXFA 3LX7A 4A4GA 3CMET 1M90C 2XHCA 4M75G 3JB9D 1IZ6A 3UWNA 2XI9A 3QPHA 5GMKi 4MMKA 4C8QD 2LX9A 2OTLA 3OYMA 3WVEB 4M78C 1Y7XA 1VIFA 4OB1B 5CKEA 3RMQA 4B9WA 2KQWA 2QA4A 5FU7C 1XNIA 3CCRT 3J80E 3N5BB 3CCQT 2ZPBB 5GANd 4ZN1A 3NTIA 4BE0A 2K3YA 2MWOA 3V7SA 3CCMT 4C8QA 3UT1A 3L2ZA 2ZPGB 2QQ9A 3DKMA 4BI3A 3M5AA 2K2VA 2Y4XA 4C92G 2X4XA 3A8LB 3FJPA 3QJ6A 4GY5A 4MMLA 2LRQA 5KE3A 2CZ1B 2KY9A 2R5AA 3KXTA 2DPPB 5KCOA 3AHUA 5GAN4 2P0QA 4M78B 3TREA 5A2QE 2K5IA 4C0FA 1G3TA 5J26A 1UGQB 1Y07A 4OB0B 3JSCA 2EQMA 5J3BA 2ZPEB 4PJOF 3PTAA 3S3NA 1VQ4A 1I5LA 4F7UA 1U8RA 2X4YA 4KUDK 3I56T 3LGFA 3G71A 1EIFA 3OBYA 4L5GA 1KD1U 1K73C 1B34B 3RKWA 5L8RE 4EMKC 2I2LA 5GAN8 5DLOA 4C8QB 3Q1JA 1NPRA 1D3BA 2FL7A 3V8LA 1KC8U 4LDVA 3CCLT 3C94A 3GPLA 4L59A 3CC7A 5CCAA 3L2VA 5CKDA 2KMTA 1HXDA 2YHTA 3CBMA 3VKIA 3QKJA 3O8VA 3OW2S 4M78A 2QTXA 2K3XA 4E47A 2D0QB 2LDMA 4C92E 2JTFA 3PIPA 2P0KA 4C92A 2F69A 3VUZA 2E64A 3SWNC 3DLMA 1I81A 2HQEA 4IURA 3VU3C 2EQJA 3OYJA 2DEQA 3M57A 3HSBA 4M7DD 4XU1A 4NOYA 4C5HA 2XDDA 3FIFA 1B34A 1RL2A 3E9FA 2RD1A 3C95A 2CGHA 3CCUT 2Y4YA 5GMKl 3JCMW 3GLXA 3QIIA 5LJ5e 2EJ9A 4OGCA 2DZ9A 2EJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YLB A;  4XTZ A;  2E1H A;  5LJ5 d;  4M7D E;  2EJG A;  4PJO B;  3V8K A;  4M78 D;  4X9C A;  2DXU A;  4C92 D;  4C8Q C;  5GAM f;  5GAN e;  2DTI A;  5GAO p;  5GAN 3;  5GAN f;  4Y91 A;  1WNL A;  4XTX A;  1KQ1 A;  4M75 E;  4C92 B;  4EMH A;  4M7A E;  4M75 B;  4M7A B;  4PJO G;  1TH7 A;  1Y96 B;  5LJ3 f;  3BY7 A;  1M5Q 1;  3RKX A;  5GMK m;  4J6Y A;  1M8V A;  3SWN B;  1LOJ A;  5GAN g;  5LJ5 f;  3QO3 A;  4JRI A;  1JRI A;  4C92 C;  5CAI A;  2E41 A;  3EFS A;  2JN0 A;  4XU2 A;  4XQ3 A;  5GAO r;  4M77 D;  4NL3 A;  4PNO A;  3JCM c;  2FB7 A;  5GAN j;  4J6X A;  1MGQ A;  5LJ5 g;  3RER A;  3JCM g;  2ZGW A;  1Y96 A;  3RUX A;  2K57 A;  4NL2 A;  3JCM X;  4J5Y A;  4C92 F;  4QVC A;  3SWN A;  2DZC A;  3JB9 J;  3BW1 A;  5GAN 7;  4N0A C;  3M4G A;  4XTW A;  5LJ3 g;  2RB6 A;  5GAM j;  2Y90 A;  5GAM d;  3JCM V;  2DJZ A;  1LJO A;  4EMK A;  3L1A A;  4M78 F;  5GAM e;  4M7D C;  3JCM J;  1LNX A;  4A53 A;  1HK9 A;  1N9R A;  2VC8 A;  3BDU A;  4N0A A;  4JRK A;  5GAN 5;  3JB9 G;  3QSU A;  4V2S A;  1X01 A;  4EMG A;  3GIB A;  4M75 G;  4M7A G;  3JB9 D;  1WQW A;  4M78 E;  4X9D A;  4C8Q G;  4JUV A;  5GAO m;  5GMK i;  4MMK A;  4C8Q D;  2DTH A;  4M75 D;  4M7A D;  3JCM f;  4DQ2 A;  3SB2 A;  4M78 C;  5LJ5 h;  4M7D F;  5GAO q;  4M7D B;  4PJO E;  1BIB A;  1WQ7 A;  3JB9 I;  2DVE A;  2VXE A;  2RM4 A;  5GAN d;  5GAM g;  3RKY A;  2RA2 A;  4XTV A;  3V7S A;  4M75 A;  1H64 1;  5LJ3 j;  4C8Q A;  4M7A A;  3L2Z A;  4C92 G;  4F7U B;  3FJP A;  4MML A;  2DXT A;  4F7U E;  3JCM d;  3PGG A;  3V7C A;  3JB9 H;  4M77 G;  5LJ3 h;  3AHU A;  3EFR A;  2E10 A;  5GAN 4;  3JCM b;  4M78 B;  5GAN 2;  3FB9 A;  4WF2 A;  4J6W A;  3QHS A;  4A54 A;  4XU0 A;  3JCM h;  1WPY A;  2EAY A;  5LJ3 d;  3JCM P;  4M7D A;  4PJO F;  2FYK A;  1N9S A;  1I5L A;  4M75 C;  4F7U A;  4OP0 A;  4M7A C;  3BFM A;  1BIA A;  2EWN A;  4HT8 A;  4PJO D;  2DTO A;  5LJ5 j;  4M77 A;  1I4K 1;  5I21 A;  5GAO l;  1U1T A;  1B34 B;  2E65 A;  4M78 G;  3RKW A;  2I2L A;  4C8Q E;  4EMK C;  4M77 F;  4F7U F;  5GAN 6;  5GAN 8;  3V7R A;  4C8Q B;  1D3B A;  3V8L A;  3V8J A;  5GAO n;  3JCM Q;  3RES A;  4HT9 A;  5GMK h;  4F7U G;  4PJO A;  4PJO C;  5DY9 A;  5LJ3 e;  2YHT A;  1HXD A;  3HFN A;  2VXF A;  4XTY A;  4EMK B;  4M78 A;  1U1S A;  2QTX A;  4QVD A;  4C92 E;  4JLI A;  4M77 C;  1I8F A;  2YLC A;  4C92 A;  4XTU A;  1D3B B;  4M7D G;  2E64 A;  3SWN C;  4RCB A;  1I81 A;  3VU3 C;  5GAM h;  3HSB A;  4M7D D;  3INZ A;  2DEQ A;  4M77 E;  2DKG A;  4XU1 A;  4C8Q F;  4M75 F;  4M77 B;  4NOY A;  4M7A F;  3HFO A;  3FIF A;  4HA8 A;  3JB9 F;  5GMK e;  1B34 A;  3QUI A;  4XU3 A;  2RD1 A;  1YCY A;  2CGH A;  2HNI A;  3RIR A;  3JCM W;  4RCC A;  5GMK j;  5GMK l;  3JCM e;  5GAN h;  1JBM A;  5LJ5 e;  2EJ9 A;  1KQ2 A;  2DZ9 A;  2EJF A; 
#chains in the Genus database with same CATH topology
 2YLB A;  4M7D E;  5LJ5 d;  4M78 D;  3L2Q A;  3ULR B;  4QQ6 A;  4C8Q C;  3CC2 Q;  3EHR A;  4C92 B;  5FRO A;  5GMK m;  1WJR A;  4P5N A;  4RG2 A;  5CVI A;  2KRO A;  5CR2 A;  4XQ3 A;  3QYG B;  3CCM A;  1Q81 C;  1M90 R;  4JZ4 A;  3OY9 A;  1TS9 A;  1Q7Y C;  2DIQ A;  5GAM d;  5LJ3 g;  1K8A R;  3SHW A;  4ESR A;  3EG3 A;  1ABO A;  1I0C A;  3PMI A;  1JJ2 A;  1BU1 A;  4OGE A;  3CCL Q;  3QSU A;  1WA7 A;  3CCV Q;  3CCV A;  3PNW C;  3JB9 G;  4X9D A;  1NBE B;  2VYT A;  2AIR B;  4KH0 B;  2DTH A;  3VS7 A;  3MEU A;  3JCM f;  4J9D A;  4M7D F;  2JW4 A;  5GAO q;  3M53 A;  4PL6 A;  4OML A;  4A63 B;  3L2U A;  3RKY A;  5M9O A;  5KYY A;  3A98 A;  5I2M A;  2KGT A;  4E7I A;  3QBY A;  1YJW Q;  3CC7 T;  5KH6 A;  3EFO A;  1PD1 A;  2KI7 A;  4J6W A;  2DNU A;  3HHT B;  1QLY A;  1N6A A;  3P8H A;  2B86 A;  4OP0 A;  4PJO D;  2YDL A;  4LN2 A;  1U1T A;  2FEI A;  1T3L A;  3G4S T;  4FSX A;  1VQM A;  1ZA1 B;  5GJW B;  1UEB A;  1GBR A;  4HCK A;  5GMK h;  3PT9 A;  1MMA A;  2RH2 A;  3HFN A;  2DER A;  2XID A;  4XTY A;  3H8Z A;  1U1S A;  4IKF A;  2QQS A;  3QYH B;  2DL8 A;  4J9H A;  3G4S A;  5D6Y A;  1D3B B;  1VQP A;  3INZ A;  1RAH B;  2NUP A;  2R58 A;  4KUL A;  1FXX A;  1YNZ A;  4XU3 A;  2QAS A;  2GTJ A;  2JTM A;  3C4S A;  2C0I A;  3GOX A;  1C1A A;  5LJ3 j;  1G2B A;  1S72 T;  1VQK T;  2DXU A;  2HCK A;  1M2V A;  2DTI A;  3M4Y A;  5GAO p;  4B9X A;  1S1N A;  3CXC P;  1V76 A;  5EG2 A;  3OYC A;  5LJ3 f;  1G3W A;  1LOJ A;  2RHU A;  4JZ3 A;  1UJY A;  3OB9 A;  1QCO A;  4M7D A;  5GAO r;  1OI1 A;  1M1K R;  1GFC A;  4Z89 A;  4FT4 A;  2DYB A;  5C0M A;  2K4Y A;  4FYV B;  1KD1 C;  2RI2 A;  2O01 E;  2HBW A;  1JXO A;  2LNV A;  1WDX A;  1Z9Q A;  3A5Z B;  1QCN A;  3BDU A;  4JRK A;  5ECA A;  4EMG A;  3NHN A;  2EQU A;  3CCJ A;  1ZSG A;  1H3Z A;  3GP8 A;  1TUD A;  2LJ0 A;  2RO0 A;  4ZGD B;  1VQO T;  1IHW A;  2KRS A;  3MEW A;  1KD1 R;  2CT3 A;  1MMD A;  2JVV A;  3E2U A;  4WF2 A;  3CXC A;  1VQO A;  5CQY A;  2EAY A;  5HK0 A;  2DRK A;  3EG1 A;  1YJW A;  5I21 A;  2E65 A;  4C8Q E;  5HKC A;  1IGQ A;  2CZ0 B;  3EHQ A;  4R55 A;  2K79 A;  5DY9 A;  5LJ3 e;  2V8J A;  4Z02 A;  2DBM A;  4QVD A;  2RQV A;  1SF9 A;  1K0X A;  2JOY A;  4IUU A;  1D09 B;  2GBQ A;  3OYY A;  3FLG A;  4A4H A;  2EQK A;  1OV3 A;  2E6N A;  2V8K A;  1D0Z A;  2KSS A;  4AMC A;  4OVA A;  3RR6 A;  1FX7 A;  2RNA A;  1Y0M A;  3I55 T;  3NFC A;  4HCB A;  2FVU A;  4ELZ C;  2HQH A;  1YIJ Q;  1GCP A;  3CEY A;  4AFQ C;  2EPD A;  1TOV A;  1YN8 A;  1G3Y A;  2GF7 A;  5AT1 B;  4O6J A;  3NTK A;  1JXM A;  4M77 D;  2RQT A;  1QQJ A;  3JCM g;  3VRY A;  4E2F B;  3HTR A;  1YI2 T;  1T3S A;  1O75 A;  4EMK A;  4RTX A;  3R6N A;  1LCK A;  3CC4 Q;  1JJ2 P;  2XIC A;  3CCE T;  2L3P A;  4IIO A;  1O9S A;  2OTL T;  4Z8A A;  1N27 A;  2J7I A;  3SB2 A;  3J7A F;  2X3W D;  3HRT A;  3X28 B;  2DD4 A;  3LWH A;  2L89 A;  2LNH B;  2OAW A;  2RQU A;  1MND A;  1M3A A;  2LCC A;  3JCM d;  4AFU C;  2JM9 A;  5CKB A;  4EIK A;  3S3M A;  2QGF B;  3CCU Q;  3JCM P;  2DO3 A;  3I56 A;  4FIB A;  3TU4 K;  4OMP A;  8AT1 B;  3BFM A;  1BIA A;  4HT8 A;  2YUP A;  4M77 A;  1NE8 A;  1YJN Q;  4RTU A;  4ELY C;  4CC3 A;  3BE3 A;  4MDX A;  1UHF A;  5GAO n;  1VQ6 T;  4HCZ A;  2DE0 X;  4IUP A;  1RI9 A;  2XD0 A;  1D1A A;  2VKN A;  1OYX A;  1VQO Q;  1KQS S;  2XDB A;  1UGV A;  4J7F A;  5FW9 A;  4FW2 A;  3LH5 A;  1VQ9 A;  2RQW A;  4D8K A;  3RIR A;  2BZX A;  2QA4 Q;  2GQI A;  5I22 A;  1KQ2 A;  2CP7 A;  3RBB B;  2JUF A;  3FJ5 A;  2O9V A;  5GAN 3;  1RAD B;  5FRM A;  1R8O B;  2V8I A;  1D1B A;  2J6F A;  3MET A;  5CAI A;  2E41 A;  1ZSZ C;  3OQ5 A;  1PHT A;  4A4E A;  2GCX A;  2E5K A;  2A3L A;  4FM4 B;  4LE9 A;  1VQ4 Q;  4J5Y A;  5A0L A;  5GAN 7;  4PJL A;  3M4G A;  4XTW A;  5J39 A;  1G8X A;  1XQH A;  4A4G A;  2XHC A;  2X3X D;  1IZ6 A;  1KQS P;  3QPH A;  1AWW A;  2L3S A;  2LX9 A;  1RAE B;  3M0S A;  4KRT A;  1XNI A;  4FYW B;  1KK7 A;  2ZPB B;  4ZN1 A;  3QWX X;  3V7S A;  1W6X A;  2ZPG B;  3DKM A;  4C92 G;  3FJP A;  1FYN A;  5KCO A;  2J05 A;  2MCN A;  1RLP C;  2EGE A;  3PVQ A;  2J6K A;  3JSC A;  4X1V A;  4PJO F;  2EQI A;  2AT1 B;  1VQ4 A;  1UDL A;  2QDL A;  1I5L A;  1YWP A;  3THK A;  2SEM A;  2EYY A;  4L5G A;  3RKW A;  4EMK C;  4C8Q B;  3Q1J A;  1NPR A;  1UFF A;  1WHJ A;  1Q7Y R;  5CCA A;  3CBM A;  1OPL A;  3U23 A;  4M78 A;  2LDM A;  1C6V X;  1YWO A;  1PC0 A;  2AZS A;  4C92 A;  2YXY A;  2E64 A;  3DLM A;  1I81 A;  3HSB A;  4M7D D;  2V1R A;  4NOY A;  3EG2 A;  3FIF A;  1B34 A;  1RL2 A;  3E9F A;  2RD1 A;  3RDV A;  1W2B S;  2FHD A;  3A8O B;  4R56 A;  3ZEH A;  4X9C A;  4WCI A;  4MZP A;  1OU8 A;  1NEB A;  4Q5W A;  3VYG A;  4PJO G;  1M1G A;  1R77 A;  1VQ9 Q;  5HK3 A;  3O5Z A;  1YJ9 A;  1N8R C;  3A8G B;  3CPW A;  3QO3 A;  4KBM B;  2JMA A;  5LL6 S;  1JJ2 S;  1SPK A;  3REA B;  4OMO A;  2FB7 A;  1HSQ A;  2F2X A;  1R0B G;  4OF1 A;  3OYE A;  2DL3 A;  4DBR A;  1VUB A;  2BZY A;  3LWI A;  1W2B P;  4RMO A;  2YWW A;  4HXJ A;  3CCM Q;  3JCM J;  1N9R A;  1SKU B;  3PE0 A;  1ZHI A;  1XJW B;  3UAT A;  1WX6 A;  3VYH B;  4BD3 A;  4XAX B;  4F14 A;  3JRZ A;  1ZBJ A;  3OYA A;  4XTV A;  4MZT A;  2CZ7 B;  3FEO A;  1PRL C;  1UB4 A;  2ROL A;  4E7S A;  2GQV A;  4FT2 A;  2YRV A;  1BCO A;  1RI0 A;  1R0C B;  4FSS A;  2IG0 A;  2YRD A;  2MIO A;  1RAA B;  1UJ0 A;  2DXB A;  4DEX A;  4MZM A;  2VWF A;  2LVM A;  5KYU A;  3G71 Q;  2CZ6 B;  4J83 A;  2X51 A;  3CBO A;  4A4K A;  2ZPH B;  3P8B B;  4C5I A;  3X25 B;  3LGL A;  1YP5 A;  3MP8 A;  1VQ6 A;  2OTL Q;  3OYK A;  2MWP A;  3HKS A;  3M0P A;  4XTU A;  2BIV A;  3I55 Q;  4C8Q F;  2IPO B;  1TSF A;  3HFO A;  4LDX A;  2O4X A;  3PGG A;  2RN8 A;  4PJO B;  2EJG A;  2D9T A;  5FU6 C;  4LUE A;  5GAM f;  2FZG B;  1X75 C;  2E5Q A;  2PNI A;  5IN1 A;  3BY7 A;  3QDR B;  4PLL A;  3CC7 Q;  2PZ1 A;  1D0Y A;  4TVR A;  3X24 B;  3VJP A;  3MP1 A;  4DEY A;  5LJ5 g;  1RUW A;  2E3H A;  3JAM E;  3JV3 A;  3RMS A;  3CQT A;  3H0H A;  2GGR A;  1AD5 A;  1KC8 R;  2L3Q A;  1P92 A;  3TCJ A;  4BY6 B;  2K5F A;  2PVG B;  3GF5 A;  4C8Q G;  5D6X A;  4M75 D;  2GFA A;  2PVO B;  4LDY A;  1BIB A;  2DVE A;  1HYO A;  3E19 A;  2PUO B;  4ZGE B;  3CXC S;  4II1 A;  4M7A A;  2QG9 B;  2MAM A;  1Q82 R;  2K9G A;  3DB3 A;  2B8A A;  3LYI A;  1VQL A;  2QDY B;  3EFR A;  1MNE A;  4J9C A;  1VA7 A;  2WSE E;  2LT4 A;  2HMA A;  3VUB A;  3CMA T;  3WXM B;  3H0F A;  2YUQ A;  1GFD A;  4RTY A;  3PFS A;  1YHQ Q;  1VQ8 Q;  4M77 F;  3GBQ A;  1JB0 E;  2JMC A;  2V26 A;  2GFU A;  3CC4 T;  3V8J A;  2MYS A;  4LNP A;  3LLR A;  2DLP A;  1N8R U;  1ARK A;  4EMK B;  1H8K A;  1RLQ C;  5KYU B;  2L3R A;  4JLI A;  1NLO C;  2DIL A;  2YLC A;  5EC7 A;  2FO0 A;  2NLU A;  2DKG A;  4AFZ C;  2ENM A;  1VQ6 Q;  2F2W A;  5L23 A;  4KGV B;  1WIE A;  2LTO A;  1K9M U;  1TUG B;  2YRC A;  1G3S A;  1VQP Q;  3G71 T;  1WJS A;  5KYX A;  4JDS A;  3G4S Q;  5GAN f;  2JS2 A;  3PVL A;  2O4X B;  4M75 B;  2ZPF B;  3REB B;  1TH7 A;  4J6Y A;  3MEA A;  2YSQ A;  1JEG A;  3LW5 E;  5D7U A;  5D6W A;  4F04 B;  3EGX A;  2E12 A;  4QVC A;  3C0C A;  4BAC A;  2EYW A;  4N0A C;  3CD6 A;  4FW1 A;  1LJO A;  3ZL7 C;  1YJN A;  2VC8 A;  5GAN 5;  3VS1 A;  2YUO A;  1QVG A;  3C12 A;  1IGU A;  2MF2 A;  2PUK B;  3VS3 A;  4BI4 A;  2OAU A;  2QTV A;  2KNB B;  4YTL A;  3X26 B;  1V1C A;  2PTK A;  1QVF A;  2A36 A;  1VQ8 T;  1SHG A;  3OYH A;  1GXI E;  1E7O A;  1PWT A;  2CUD A;  3A8M B;  4JS4 A;  1QVG P;  2XU8 A;  2GNC A;  4FYX B;  2CH4 W;  2L0A A;  1W4S A;  2LQW A;  4MDW A;  2XKO C;  3VS0 A;  2RQR A;  2EWN A;  4C5G A;  1I4K 1;  3EH2 A;  1VQN A;  4JJC A;  3QG1 A;  3M0R A;  4M4Z A;  2DIG A;  3FC3 A;  4PJO C;  4F7U G;  1M1K U;  1K8A C;  3MJX A;  4C0Z A;  1VQN T;  4R0K A;  2M1H A;  4QQG A;  3OYL A;  2FPD A;  1ZLM A;  1BCM A;  2CUB A;  4IIM A;  1YHQ T;  4M7A F;  4ZN3 A;  3CC2 A;  3KFV A;  5GAN h;  3VS5 A;  2E1H A;  1K9M C;  2K5L A;  4E7J A;  2KAF A;  2AK5 A;  3ASK A;  5CK9 A;  2AZV A;  1JQQ A;  4EDU A;  4M75 E;  2QK0 A;  2RI3 A;  2RHX A;  2CSQ A;  4JPB W;  4LD6 A;  5DM7 R;  1NJI R;  1ZUU A;  3SWN B;  2EGC A;  2XK0 A;  2OTJ A;  3E1S A;  1PSF A;  3CBP A;  2KE9 A;  4C0G A;  1OZ3 A;  4NL3 A;  1BI2 A;  2BE7 D;  4D6W A;  2J6O A;  2X9H A;  1XOV A;  2EIF A;  2ZPI B;  2O31 A;  3I5S A;  3L2R A;  2EVR A;  2L2P A;  3JCM V;  4V2S A;  5I11 A;  3JB9 D;  2XI9 A;  2BTT A;  1NEG A;  2OTL A;  3OYM A;  3WVE B;  5CKE A;  2KQW A;  5IHI A;  4E6R A;  3CCQ T;  2YT6 A;  2HKN A;  4C8Q A;  3UT1 A;  3L2Z A;  4BI3 A;  2Y4X A;  2X4X A;  3QJ6 A;  4GY5 A;  4MML A;  3KXT A;  2R5A A;  1M2O A;  2M02 A;  2W10 A;  1I5O B;  2ROT A;  1OX8 A;  4M78 B;  5A2Q E;  2K5I A;  4CC2 A;  3H0I A;  5J26 A;  1UGQ B;  3S3N A;  2X4Y A;  2JJ9 A;  3I56 T;  1QKW A;  1K73 C;  1B34 B;  5GAN 8;  2I2L A;  2K3B A;  1WHM A;  2HL3 A;  3CCL T;  3C94 A;  1K76 A;  3O8V A;  1EFN A;  1KSW A;  1ZSZ B;  2QTX A;  2LX7 A;  4KGZ B;  4E47 A;  3PIP A;  1NG2 A;  1OU9 A;  1NYG A;  3VU3 C;  1QWF A;  1OPK A;  4XU1 A;  4C5H A;  1LVK A;  3CCU T;  1X6G A;  2DM1 A;  1WHL A;  2CP6 A;  3M56 A;  3WVD B;  2DL7 A;  3M9Q A;  3CPW S;  1X2Q A;  4CC7 A;  1PG5 B;  4C92 D;  1BYM A;  1K73 U;  6AT1 B;  2CRE A;  4EMH A;  1Q95 G;  4M7A E;  1I07 A;  1RAC B;  2FG0 A;  1YCS B;  3OS5 A;  4X34 A;  1M8V A;  4ORZ A;  2QEX T;  1G5V A;  2DK3 A;  2VV5 A;  4RKU E;  4XU2 A;  2IVW A;  4J9B A;  1UGP B;  1QVF P;  1PKS A;  1M3C A;  4NL2 A;  2EW3 A;  4JJN K;  3SWN A;  2DZC A;  3CCR A;  2D8J A;  1TTH B;  1ZBX A;  2XDP A;  3GIB A;  4FL6 A;  1WQW A;  4BDZ A;  2NUT A;  1W1F A;  2KT8 A;  4PJO E;  1M3B A;  2VB6 A;  3UA6 A;  1PSE A;  2NYS A;  1KFZ A;  2M51 A;  2CP2 A;  4J7I A;  3M58 A;  3A8H B;  2KDS A;  3CPW P;  1AWX A;  1VQ8 A;  3JB9 H;  4M77 G;  2E6Z A;  1AWJ A;  3MP6 A;  2ABL A;  5GAN 2;  2KVQ G;  1BB9 A;  3QHS A;  5LJ3 d;  1WJQ A;  1M4Z A;  3CPF A;  1VQP T;  5AYF A;  2RHY A;  1RAB B;  3UA7 A;  3V7R A;  3CCE A;  2LT1 A;  1Q81 U;  2CP3 A;  4PJO A;  1M1F A;  3QWY A;  4N4G A;  2C0O A;  5I2S A;  1SSF A;  3S6W A;  1K0S A;  5HY6 A;  4PJM A;  2LQ8 A;  1M90 U;  3I56 Q;  3PIO A;  1WXU A;  1YJ9 T;  1PCX A;  3OYG A;  1IO6 A;  1YCY A;  2O9S A;  2R5M A;  5KCH A;  1ZSZ A;  3OYI A;  1UEC A;  1JU5 C;  4DA4 A;  1Q82 C;  1E6H A;  2LC4 A;  1VQ5 A;  2R57 A;  2VUB A;  3HP9 A;  2AHJ B;  4FYY B;  4XTX A;  1BBZ A;  1Q81 R;  2O88 A;  1SRM A;  3M54 A;  1KJW A;  2P4R A;  1MUZ A;  5LJ5 f;  1GRI A;  2JN0 A;  4LD9 K;  4PNO A;  1F1B B;  3L42 A;  4N4I A;  2JXB A;  1J3T A;  2M0O A;  1PNJ A;  2OJ2 A;  5GAM e;  3OYB A;  5FWC A;  2A7Y A;  4BUG A;  3QXE B;  1TG0 A;  3CMA Q;  3TSZ A;  1WQ7 A;  1WI7 A;  1PKT A;  3OW2 A;  2FRY A;  4K11 A;  1QVP A;  1H64 1;  1Q86 C;  2BZ8 A;  1YJN T;  3S3O A;  1GCQ C;  3GNF B;  4F7U E;  1Z9Z A;  2CP0 A;  2EYZ A;  3V7C A;  2QEX A;  4PLI A;  1QP2 A;  3JCM b;  4A4F A;  3CCJ T;  1WPY A;  4OMM A;  2DXC A;  2VGN A;  1UHC A;  5LJ5 j;  1Q7Y U;  2FPE A;  4M78 G;  2C06 A;  3EAE A;  5GAN 6;  2DX1 A;  3OBW A;  2G6F X;  1TU0 B;  3FDR A;  1FMK A;  1WYX A;  3RES A;  4BDY A;  1WHK A;  4E7H A;  4PFO A;  3J81 E;  2M16 A;  2KYM A;  3EG9 B;  1VQ5 Q;  4O5V A;  1OQK A;  5CKH A;  2W0Z A;  1OX9 A;  1VQ7 T;  1QWE A;  2RHI A;  4RTT A;  2EBP A;  1H3H A;  3HPW A;  2ED1 A;  4DBF A;  1HJD A;  2VGM A;  3I5R A;  2LQK A;  8ATC B;  1YHQ A;  1VQK A;  2QQR A;  3OYN A;  5A0D A;  3CC2 T;  2D6F A;  1Y96 B;  1UG1 A;  5IT9 E;  4C92 C;  1GL5 A;  3EFS A;  1KC8 C;  5GAN j;  1DJ7 B;  3RER A;  1PRM C;  1SHF A;  4IUT A;  4CRI A;  3JCM X;  1QP3 A;  3D7S B;  3BW1 A;  4PFP A;  1VQ4 T;  4XK8 E;  2Y90 A;  1OUL A;  2DAQ A;  2E3I A;  1B07 A;  2OTJ T;  3ER0 A;  1YIJ T;  1FWZ A;  2KRN A;  1YFN A;  2LCL A;  4JUV A;  1AT1 B;  4LXC A;  2ZAE A;  4KT0 E;  4ZTJ A;  5KYW A;  2L5Q A;  1VQ5 T;  1X6B A;  1UUE A;  2F1L A;  5CO7 A;  2DVJ A;  3SEM A;  3CD6 Q;  1KIK A;  4J8O A;  2KXD A;  1YIT A;  4BB7 A;  2CH4 A;  1TWB A;  1LPL A;  3CME A;  1IXD A;  1QMC A;  2WAC A;  1FMV A;  3OMG A;  3MKD A;  1RAI B;  4GBQ A;  4E7L A;  1M1K C;  1FMW A;  2RK2 A;  2OI3 A;  3R6O A;  3CD6 T;  3TSW A;  2WSF E;  3MEV A;  3NTH A;  1AOJ A;  2EYX A;  2HZY A;  3MO8 A;  3EG0 A;  1I8F A;  1WXT A;  5IAY A;  4LDU A;  1GBQ A;  5IXF A;  1YI2 Q;  4M77 E;  1K9M R;  1I1J A;  5C6S A;  1S72 A;  4D8D A;  2HNI A;  2GTO A;  5GMK j;  3ZBD A;  3JCM e;  2CKK A;  2IIM A;  9ATC B;  3P8D A;  4XTZ A;  1T0H A;  2COW A;  3V8K A;  2KEA A;  3OSV A;  5FRN A;  2LQN A;  2H3E B;  1D1C A;  2KR3 A;  4JRQ A;  2RI5 A;  1M9S A;  1RAF B;  4PJN A;  2QQA A;  1Q82 U;  4F16 A;  1BKB A;  3OMC A;  2HL5 C;  4OMQ A;  4OMF B;  2RJC A;  1JRI A;  2RMO A;  1RAG B;  3URG A;  2QQB A;  4JLG A;  1VYT A;  2KYB A;  1Y96 A;  2DA9 A;  1U3O A;  2K57 A;  5IH2 A;  2MPX C;  3NGP A;  4RTV A;  1D0X A;  2HKQ B;  1ZQ1 A;  3M0Q A;  3DLL A;  1HK9 A;  2QXF A;  3LX7 A;  1M90 C;  1IHV A;  4GLM A;  3I35 A;  4M78 C;  4OB1 B;  1VIF A;  4B9W A;  5FU7 C;  5IHK A;  3J80 E;  3CCR T;  2CP5 A;  2YUN A;  2HSP A;  3NTI A;  4BE0 A;  1VYV A;  2K3Y A;  2LMJ A;  3CCM T;  2AKK A;  1X27 A;  1K4U S;  1AWO A;  2QQ9 A;  3M5A A;  2K2V A;  5KE3 A;  3A8L B;  2CZ1 B;  3IQL A;  4Y92 A;  1E6G A;  3AHU A;  2DET A;  2KBT A;  3TRE A;  3CCS Q;  1Q86 R;  2OX7 A;  4C0F A;  1G3T A;  1Y07 A;  2EQM A;  4KUD K;  3LGF A;  1EIF A;  3OBY A;  1KD1 U;  1IRX A;  5L8R E;  5DLO A;  3CCE Q;  3V8L A;  1KC8 U;  4LDV A;  3CC7 A;  3L2V A;  5CKD A;  2KMT A;  1HXD A;  3OW2 S;  1UE9 A;  2LZ6 B;  2ECZ A;  2D0Q B;  3VS2 A;  4C92 E;  1SRL A;  2F69 A;  3VUZ A;  3SWN C;  2NUT B;  4IUR A;  2HQE A;  2DJQ A;  4RTW A;  2OTJ Q;  2XDD A;  2XMF A;  4J9G A;  3JCM W;  2A0F B;  5GMK l;  1TUC A;  4OGC A;  2DZ9 A;  2EJF A;  5GJV B;  1NJI U;  7AT1 B;  1UGR B;  4C0D B;  4DOV A;  4DOW A;  2EKH A;  4C5E A;  2COZ A;  4CC4 B;  4UC4 A;  1WGS A;  2JNG A;  5DLQ E;  3G6E T;  5IHN A;  1BI3 A;  3CC4 A;  4JS5 A;  2CT4 A;  4ATO A;  2CSI A;  1QW1 A;  1ZUY A;  2CYZ B;  3M55 A;  1K9A A;  1H92 A;  2F5T X;  4J6X A;  2Z0W A;  2JS0 A;  2XG8 D;  1B3Q A;  1CSK A;  3QZ9 B;  4C92 F;  1KHI A;  2CDT A;  3CCR Q;  1AZG B;  2RB6 A;  4OB2 B;  1CKB A;  2DMO A;  3CME Q;  4L6V 5;  4A53 A;  4N0A A;  1MV3 A;  2QEX Q;  1X6O A;  1KHC A;  5GAO m;  1T0J A;  2HDA A;  4M7A D;  2RPN A;  3AT1 B;  4J9F A;  3OYD A;  2RM4 A;  3OS2 A;  3X20 B;  1VYU A;  2RA2 A;  2DF6 A;  1HD3 A;  1GCQ A;  2EYQ A;  2HD0 A;  2DXT A;  3I9Q A;  3M59 A;  1YIT T;  5LJ3 h;  4CI0 C;  2E10 A;  1OEB A;  3FB9 A;  4A54 A;  2X4J A;  2QGG A;  3JCM h;  4OB3 B;  1N9S A;  2KRM A;  1PM3 A;  2H8H A;  1VQL Q;  1WHG A;  2X35 A;  2BUD A;  1VQ7 Q;  1VOM A;  2DD5 A;  1BI1 A;  1NYF A;  4B6M A;  3CCU A;  3UPU A;  2F2V A;  3OSS C;  1JO8 A;  4HT9 A;  1BK2 A;  3PMT A;  4JJB A;  4PJJ A;  4BE2 A;  3EFO B;  3BDL A;  4BE1 A;  4M77 C;  2I0N A;  1XTD A;  4QQD A;  2LJ3 A;  2PU9 B;  3ME9 A;  1MMG A;  3KBG A;  3HRU A;  2LCS A;  4BY6 C;  2RJE A;  2D1X A;  5FLX E;  4HA8 A;  4KGX B;  4AT1 B;  3JB9 F;  5GMK e;  3QUI A;  2MMP A;  3VS4 A;  1WLP B;  2H3J A;  2QI2 A;  3CCJ Q;  4IUQ A;  5KYY B;  2MOX A;  3CCQ Q;  1VQ7 A;  4Y91 A;  1KQ1 A;  1CKA A;  1OOT A;  3UF4 A;  4M7A B;  2P0P A;  2EFI A;  1M8M A;  2RK1 A;  4HVW A;  2A28 A;  3CCV T;  1YIJ A;  2P4T A;  1ZUK A;  1UTI A;  2DL4 A;  3NPF A;  3TVT A;  5CQX A;  3JB9 J;  2G3R A;  3EG9 A;  3H9N A;  2ESW A;  3T9N A;  3L1A A;  4M78 F;  1C0M A;  3I55 A;  3H6Z A;  4J9I A;  1X01 A;  2KK4 A;  4M78 E;  3QDF A;  2F5K A;  1G83 A;  3CMA A;  2NUP B;  2RJD A;  3RNJ A;  3OS0 A;  4M7D B;  4PKC C;  3JB9 I;  1AEY A;  4RG8 A;  2DRM A;  2ED0 A;  1MV0 B;  3G7Z A;  3CCS A;  3SD4 A;  2D8H A;  1V29 B;  2DL5 A;  3SFM A;  3G1J A;  3MPU B;  1ZA2 B;  3CCQ A;  1YI2 A;  1Q86 U;  4QT7 A;  2LP5 A;  1TXQ A;  2PVD B;  1KG1 A;  2K7A A;  1M2V B;  2SRC A;  4HVV A;  3TEE A;  2P84 A;  3OYF A;  4XU0 A;  3FRN A;  3CCS T;  2FYK A;  1VQM Q;  1M30 A;  4FCY A;  4HVU A;  2DBK A;  4M75 C;  4GLK A;  2RF0 A;  4FU6 A;  2FPF A;  4AG1 C;  4QVZ A;  4LDW A;  4ZNX A;  4RUG A;  2AKL A;  2COY A;  4OMN A;  4HCC A;  2VXF A;  3MHX A;  3VS6 A;  1Y57 A;  3E9G A;  1QCF A;  3EGU A;  3OA6 A;  2HBP A;  4ZTF A;  3F70 A;  4NS5 A;  1VQM T;  4M7D G;  3EGD B;  4RCB A;  4M75 F;  2WSC E;  3LH0 A;  5KYW B;  2JM8 A;  2HQX A;  2QAZ A;  2MI6 A;  1JBM A;  1QVF S;  4IUV A;  2QA4 T;  1W2B A;  2LJ1 A;  1IRE B;  1PD0 A;  1SSH A;  1EZZ B;  4E7Z A;  2DFU A;  4ANJ A;  5GAN e;  2E4H A;  1NZ9 A;  2KT1 A;  3HRS A;  3UDC A;  1MHN A;  1B7T A;  2K6D A;  3CCL A;  4PK4 A;  3G6E A;  3G6E Q;  3EH1 A;  3RKX A;  1X43 A;  2ZZD A;  1OZ2 A;  1VQ9 T;  4JRI A;  1SEM A;  1VIE A;  4DBH A;  2JTE A;  4F17 A;  2MK5 A;  3JCM c;  1K8A U;  1MGQ A;  2C0T A;  1WXB A;  2ZGW A;  3QZ5 B;  3RUX A;  4C0D C;  1YJ9 Q;  1UGS B;  4Y28 E;  1W70 A;  3KUF A;  2HEQ A;  2D0N A;  2DYI A;  4M7D C;  5CIU A;  3SDZ A;  4M7A G;  2PQW A;  4DQ2 A;  2J06 A;  5LJ5 h;  2M9U A;  5KYX B;  2VXE A;  4M75 A;  1YJW T;  3A1P A;  2VVK A;  4F7U B;  1YIT Q;  4ME7 A;  3L2W A;  1X69 A;  4BI8 B;  2V1Q A;  3ZFJ A;  1U5S A;  1AVZ C;  3HL8 A;  4ZGJ B;  1VQL T;  1VQN Q;  2EKO A;  4QKU A;  1U06 A;  3EGX B;  4M7A C;  1NLP C;  4KUI A;  3OS1 A;  2ZCF B;  2BKD N;  2DTO A;  5GAO l;  2JZ2 A;  1A0N B;  4QW2 A;  4F7U F;  5FU6 B;  3JCM Q;  3QJY A;  4J9E A;  4VUB A;  1YBY A;  4N4H A;  2DEU A;  3M0U A;  5FU7 B;  3GNG A;  3NMZ C;  4HKE A;  5KYN A;  5KE2 A;  2A37 A;  2L8D A;  1K1Z A;  2O2O A;  4AFS C;  4EPC A;  5GAM h;  2NWM A;  2X4W A;  2RHZ A;  1SG5 A;  1QVG S;  4M77 B;  4Z88 A;  4RCC A;  2E70 A;  1NPP A;  1VQK Q;  3TQ7 P;  3EGD A;  5A0G A;  1KQS A;  1NJI C;  5CKF A;  3VRZ A;  3VV0 A;  4PFZ A;  1Y71 A;  4KH1 B;  1WNL A;  2HAX A;  2RJF A;  4AG2 C;  1AHJ B;  1BI0 A;  4JRP A;  4RTZ A;  1M5Q 1;  2M0Y A;  5GAN g;  1EX4 A;  4LUD A;  5IXB A;  3DB4 A;  5HCK A;  4E7K A;  3MCA B;  1K73 R;  1QKX A;  1AZE A;  2BE9 B;  2ATC B;  5FWB A;  5GAM j;  2CS7 A;  2DJZ A;  1LNX A;  2JT4 A;  3CME T;  4WTO B;  4M75 G;  3UWN A;  5GMK i;  4MMK A;  4C8Q D;  3RMQ A;  1Y7X A;  3M0T A;  2QA4 A;  2HSE B;  3N5B B;  5GAN d;  2MWO A;  1WHH A;  2FZC B;  2LRQ A;  2KY9 A;  1M27 C;  2DPP B;  1MMN A;  5GAN 4;  2P0Q A;  2KXC A;  2VAS A;  4OB0 B;  5J3B A;  2ZPE B;  3PTA A;  4JJD A;  1IB8 A;  4F7U A;  1U8R A;  3G71 A;  1ABQ A;  2FRW A;  3OW2 P;  1D3B A;  2FL7 A;  3H41 A;  1NM7 A;  3GPL A;  4L59 A;  1S72 Q;  2YHT A;  3VKI A;  3QKJ A;  1X2K A;  1ZX6 A;  2EGA A;  2K3X A;  2A08 A;  2JTF A;  2P0K A;  2FZK B;  4DBQ A;  1WFW A;  3OYJ A;  2EQJ A;  2K2M A;  2DEQ A;  3M57 A;  1N8R R;  2NUZ A;  1WZO A;  2QYZ A;  3C95 A;  1N5Z A;  2CGH A;  2Y4Y A;  3GLX A;  3QII A;  1ACM B;  5LJ5 e;  2EJ9 A;  5GAM g; 
#chains in the Genus database with same CATH homology
 2YLB A;  1W2B S;  1NJI U;  3M56 A;  3WVD B;  4M7D E;  5LJ5 d;  3M9Q A;  1UGR B;  2FHD A;  3A8O B;  4C0D B;  4DOV A;  4M78 D;  4DOW A;  4R56 A;  3ZEH A;  4X9C A;  3L2Q A;  4QQ6 A;  4C92 D;  4C8Q C;  4C5E A;  1BYM A;  1K73 U;  4UC4 A;  1WGS A;  2JNG A;  4MZP A;  5DLQ E;  3G6E T;  4EMH A;  4C92 B;  1BI3 A;  4Q5W A;  4M7A E;  3VYG A;  3CC4 A;  4PJO G;  1M1G A;  3OS5 A;  4X34 A;  5FRO A;  5HK3 A;  5GMK m;  1M8V A;  1YJ9 A;  2QEX T;  4JS5 A;  1G5V A;  4ATO A;  1N8R C;  3A8G B;  2DK3 A;  2VV5 A;  1QW1 A;  3QO3 A;  4KBM B;  4RKU E;  1WJR A;  4P5N A;  3CPW A;  4RG2 A;  5LL6 S;  2CYZ B;  1JJ2 S;  5CVI A;  3M55 A;  5CR2 A;  4XU2 A;  4XQ3 A;  2IVW A;  2F5T X;  2FB7 A;  3QYG B;  4J6X A;  3CCM A;  1Q81 C;  1UGP B;  2XG8 D;  4OF1 A;  3OYE A;  4NL2 A;  3OY9 A;  3QZ9 B;  4C92 F;  1KHI A;  3SWN A;  2DZC A;  4JJN K;  1VUB A;  3CCR A;  1Q7Y C;  2DIQ A;  3LWI A;  5GAM d;  5LJ3 g;  2RB6 A;  1ZBX A;  4RMO A;  4OB2 B;  3PMI A;  4L6V 5;  3JCM J;  1JJ2 A;  4A53 A;  4OGE A;  1N9R A;  4N0A A;  3QSU A;  3CCV A;  3PNW C;  3JB9 G;  2XDP A;  1X6O A;  4FL6 A;  3GIB A;  1KHC A;  1ZHI A;  1WQW A;  4X9D A;  5GAO m;  2VYT A;  4BDZ A;  3VYH B;  4BD3 A;  2DTH A;  4M7A D;  3MEU A;  3JCM f;  4XAX B;  4M7D F;  3JRZ A;  5GAO q;  3OYD A;  4PJO E;  3M53 A;  4PL6 A;  2RM4 A;  3OS2 A;  3L2U A;  3X20 B;  1VQ6 T;  1PSE A;  5GAM g;  3RKY A;  5M9O A;  2RA2 A;  3OYA A;  4XTV A;  4MZT A;  2CZ7 B;  3FEO A;  4J7I A;  2EYQ A;  1UB4 A;  2HD0 A;  3M58 A;  5I2M A;  2DXT A;  2GQV A;  3A8H B;  2YRV A;  4FT2 A;  4E7I A;  3QBY A;  2KDS A;  3CC7 T;  3M59 A;  1YIT T;  1VQ8 A;  4M77 G;  3JB9 H;  2E6Z A;  5LJ3 h;  3MP6 A;  1RI0 A;  2E10 A;  4CI0 C;  5KH6 A;  5GAN 2;  2IG0 A;  2KVQ G;  3FB9 A;  4J6W A;  3QHS A;  4A54 A;  2X4J A;  3HHT B;  3JCM h;  1N6A A;  5LJ3 d;  1WJQ A;  1M4Z A;  3CPF A;  3P8H A;  4OB3 B;  2DXB A;  1N9S A;  4OP0 A;  1VQP T;  4MZM A;  5AYF A;  4PJO D;  2X35 A;  2LVM A;  2BUD A;  2RHY A;  2CZ6 B;  2DD5 A;  1U1T A;  4J83 A;  3CBO A;  1BI1 A;  3G4S T;  3V7R A;  4A4K A;  2LT1 A;  2ZPH B;  3P8B B;  4FSX A;  4C5I A;  3CCE A;  3CCU A;  1VQM A;  3UPU A;  1Q81 U;  1UEB A;  3OSS C;  3X25 B;  4HT9 A;  5GMK h;  4PJO A;  3LGL A;  1M1F A;  3PT9 A;  2RH2 A;  3HFN A;  3MP8 A;  2XID A;  3PMT A;  4N4G A;  3OYK A;  4XTY A;  1VQ6 A;  5I2S A;  4BE2 A;  3H8Z A;  1U1S A;  2MWP A;  3BDL A;  2QQS A;  4IKF A;  3QYH B;  3G4S A;  3HKS A;  3CPW S;  4BE1 A;  1SSF A;  4M77 C;  5D6Y A;  3S6W A;  1XTD A;  4XTU A;  1D3B B;  5HY6 A;  4QQD A;  2BIV A;  2LQ8 A;  2PU9 B;  3ME9 A;  1M90 U;  3PIO A;  1VQP A;  3INZ A;  3KBG A;  3HRU A;  4C8Q F;  2R58 A;  4KUL A;  2RJE A;  1FXX A;  4BY6 C;  5FLX E;  3HFO A;  4HA8 A;  3OYG A;  1YJ9 T;  5GMK e;  3JB9 F;  3QUI A;  4XU3 A;  1YCY A;  2MMP A;  2R5M A;  2JTM A;  5KCH A;  3OYI A;  2O4X A;  3C4S A;  4LDX A;  3PGG A;  3GOX A;  5LJ3 j;  2H3J A;  2QI2 A;  4DA4 A;  1S72 T;  1Q82 C;  4PJO B;  2EJG A;  2D9T A;  4IUQ A;  5FU6 C;  2LC4 A;  1VQ5 A;  2R57 A;  1VQK T;  2DXU A;  2VUB A;  3HP9 A;  5GAM f;  2DTI A;  3M4Y A;  2AHJ B;  5GAO p;  1VQ7 A;  4Y91 A;  4XTX A;  1KQ1 A;  1X75 C;  4B9X A;  2E5Q A;  5EG2 A;  4M7A B;  2P0P A;  3OYC A;  5LJ3 f;  5IN1 A;  1G3W A;  3BY7 A;  3QDR B;  2EFI A;  3M54 A;  1LOJ A;  2RHU A;  4PLL A;  2RK1 A;  5LJ5 f;  4TVR A;  3OB9 A;  3X24 B;  3CCV T;  3VJP A;  3MP1 A;  2JN0 A;  5GAO r;  4LD9 K;  4M7D A;  1OI1 A;  1YIJ A;  4PNO A;  2P4T A;  5LJ5 g;  4N4I A;  3L42 A;  4FT4 A;  3JAM E;  5C0M A;  3RMS A;  2K4Y A;  5CQX A;  3JB9 J;  2M0O A;  1KD1 C;  2RI2 A;  2O01 E;  2G3R A;  2LNV A;  3T9N A;  3L1A A;  4M78 F;  1P92 A;  3TCJ A;  3A5Z B;  5GAM e;  3I55 A;  3BDU A;  3OYB A;  4BY6 B;  2K5F A;  4JRK A;  3H6Z A;  1X01 A;  4EMG A;  2PVG B;  2EQU A;  2KK4 A;  3GF5 A;  2A7Y A;  4M78 E;  4C8Q G;  3CCJ A;  3GP8 A;  1H3Z A;  4BUG A;  2F5K A;  5D6X A;  3QXE B;  4M75 D;  2GFA A;  3CMA A;  2PVO B;  2RJD A;  4LDY A;  3OS0 A;  4M7D B;  1BIB A;  1WQ7 A;  4PKC C;  2DVE A;  3JB9 I;  3OW2 A;  4RG8 A;  3E19 A;  2PUO B;  4ZGE B;  3CXC S;  3G7Z A;  3CCS A;  4II1 A;  3SD4 A;  2RO0 A;  4ZGD B;  1QVP A;  1V29 B;  1H64 1;  1VQO T;  1Q86 C;  2MAM A;  4M7A A;  3SFM A;  1YJN T;  3DB3 A;  1YI2 A;  1Q86 U;  3CCQ A;  3S3O A;  3GNF B;  4F7U E;  2B8A A;  3LYI A;  3MEW A;  2PVD B;  1VQL A;  1KG1 A;  3V7C A;  2QDY B;  3EFR A;  2JVV A;  2QEX A;  4PLI A;  1QP2 A;  3JCM b;  3TEE A;  4A4F A;  4WF2 A;  3CCJ T;  2WSE E;  3OYF A;  4XU0 A;  3CXC A;  5CQY A;  1VQO A;  1WPY A;  2LT4 A;  2EAY A;  3FRN A;  5HK0 A;  3VUB A;  3CCS T;  2FYK A;  3CMA T;  2DXC A;  3WXM B;  2VGN A;  4M75 C;  1YJW A;  5LJ5 j;  1Q7Y U;  4GLK A;  3PFS A;  4FU6 A;  5I21 A;  2E65 A;  4M78 G;  4C8Q E;  5HKC A;  3EAE A;  5GAN 6;  4M77 F;  2C06 A;  4QVZ A;  3OBW A;  1JB0 E;  2GFU A;  3FDR A;  2CZ0 B;  4LDW A;  3CC4 T;  3V8J A;  4R55 A;  3RES A;  3LLR A;  4HCC A;  4BDY A;  5DY9 A;  5LJ3 e;  2V8J A;  4E7H A;  2VXF A;  3MHX A;  1N8R U;  4EMK B;  3J81 E;  2M16 A;  4Z02 A;  2L3R A;  3E9G A;  4QVD A;  3OA6 A;  4JLI A;  2HBP A;  4ZTF A;  3F70 A;  2YLC A;  4NS5 A;  2JOY A;  1VQM T;  4M7D G;  4O5V A;  4IUU A;  4RCB A;  5CKH A;  2NLU A;  2DKG A;  3OYY A;  1VQ7 T;  4M75 F;  2WSC E;  2RHI A;  3LH0 A;  2HQX A;  3FLG A;  2MI6 A;  4A4H A;  2EQK A;  2E6N A;  1JBM A;  3HPW A;  2LTO A;  1K9M U;  1QVF S;  2V8K A;  4IUV A;  2QA4 T;  1G3S A;  2KSS A;  1W2B A;  1IRE B;  4OVA A;  2VGM A;  3G71 T;  1WJS A;  1FX7 A;  5GAN e;  1NZ9 A;  3HRS A;  4JDS A;  2LQK A;  3UDC A;  5GAN f;  1YHQ A;  1MHN A;  1VQK A;  2QQR A;  3I55 T;  3NFC A;  4HCB A;  2FVU A;  2O4X B;  4ELZ C;  3OYN A;  5A0D A;  3CCL A;  4M75 B;  3G6E A;  2ZPF B;  3CC2 T;  2D6F A;  1TH7 A;  1Y96 B;  3RKX A;  4J6Y A;  3MEA A;  2ZZD A;  3CEY A;  1OZ2 A;  1VQ9 T;  3LW5 E;  1G3Y A;  2GF7 A;  4JRI A;  5IT9 E;  4C92 C;  1VIE A;  4O6J A;  3EFS A;  3NTK A;  1KC8 C;  4M77 D;  5GAN j;  1DJ7 B;  3JCM c;  1K8A U;  1MGQ A;  3RER A;  5D6W A;  3JCM g;  2ZGW A;  3QZ5 B;  4IUT A;  4CRI A;  3RUX A;  4C0D C;  3JCM X;  2E12 A;  1QP3 A;  1UGS B;  4QVC A;  4BAC A;  3BW1 A;  1VQ4 T;  4Y28 E;  1YI2 T;  4N0A C;  1O75 A;  3CD6 A;  3KUF A;  4XK8 E;  2Y90 A;  2DAQ A;  1LJO A;  2OTJ T;  4EMK A;  3ER0 A;  4M7D C;  5CIU A;  1YIJ T;  1YJN A;  1FWZ A;  2VC8 A;  5GAN 5;  2XIC A;  1QVG A;  3CCE T;  3SDZ A;  4M7A G;  1O9S A;  2OTL T;  2LCL A;  2PQW A;  4JUV A;  3C12 A;  4KT0 E;  4ZTJ A;  1N27 A;  4DQ2 A;  2MF2 A;  3SB2 A;  2PUK B;  5LJ5 h;  3J7A F;  2M9U A;  2L5Q A;  2VXE A;  1VQ5 T;  4BI4 A;  2OAU A;  3HRT A;  3X28 B;  4M75 A;  2DD4 A;  3LWH A;  4YTL A;  3X26 B;  5CO7 A;  1YJW T;  2L89 A;  1QVF A;  4F7U B;  4J8O A;  1YIT A;  1VQ8 T;  4ME7 A;  3L2W A;  4BI8 B;  3ZFJ A;  4BB7 A;  2LCC A;  3JCM d;  5CKB A;  3OYH A;  3S3M A;  3CME A;  1GXI E;  4JS4 A;  3A8M B;  2XU8 A;  2WAC A;  3HL8 A;  4ZGJ B;  3JCM P;  1VQL T;  2EKO A;  3OMG A;  2DO3 A;  3I56 A;  1W4S A;  4FIB A;  4MDW A;  2XKO C;  3TU4 K;  4M7A C;  4KUI A;  3BFM A;  1BIA A;  2EWN A;  3OS1 A;  2ZCF B;  2BKD N;  2DTO A;  4HT8 A;  4M77 A;  4C5G A;  1I4K 1;  5GAO l;  2JZ2 A;  1NE8 A;  4QW2 A;  4E7L A;  1M1K C;  1VQN A;  4F7U F;  3QG1 A;  2RK2 A;  4ELY C;  3R6O A;  4MDX A;  3CD6 T;  2WSF E;  5FU6 B;  3MEV A;  2DIG A;  3NTH A;  3JCM Q;  3QJY A;  4HCZ A;  4F7U G;  5GAO n;  3FC3 A;  4VUB A;  4PJO C;  4IUP A;  2XD0 A;  1YBY A;  4N4H A;  1M1K U;  1K8A C;  5FU7 B;  3GNG A;  1OYX A;  4HKE A;  3MO8 A;  4C0Z A;  5KE2 A;  1KQS S;  1VQN T;  2XDB A;  1I8F A;  2M1H A;  5IAY A;  4LDU A;  4QQG A;  3OYL A;  2L8D A;  4J7F A;  4EPC A;  5GAM h;  2X4W A;  4M77 E;  1VQ9 A;  2RHZ A;  1QVG S;  1YHQ T;  4M7A F;  4M77 B;  4ZN3 A;  5C6S A;  1S72 A;  3CC2 A;  2HNI A;  3RIR A;  4RCC A;  5GMK j;  3ZBD A;  3JCM e;  5GAN h;  2CKK A;  2E70 A;  1NPP A;  1KQ2 A;  3P8D A;  4XTZ A;  2E1H A;  1KQS A;  5A0G A;  1K9M C;  2K5L A;  3V8K A;  2JUF A;  4E7J A;  2KAF A;  1NJI C;  5CKF A;  3OSV A;  5FRN A;  3ASK A;  5CK9 A;  3VV0 A;  4EDU A;  5GAN 3;  4JRQ A;  1Y71 A;  2RI5 A;  1WNL A;  1M9S A;  2HAX A;  2RJF A;  4M75 E;  2QQA A;  1Q82 U;  1AHJ B;  1BI0 A;  5FRM A;  1BKB A;  2RI3 A;  2RHX A;  3OMC A;  4JRP A;  1R8O B;  2V8I A;  1M5Q 1;  4LD6 A;  5DM7 R;  3SWN B;  5GAN g;  2XK0 A;  2OTJ A;  4OMF B;  3E1S A;  2RJC A;  3MET A;  1PSF A;  1JRI A;  5CAI A;  2E41 A;  3DB4 A;  4E7K A;  3CBP A;  3MCA B;  4C0G A;  3URG A;  2QQB A;  4JLG A;  3OQ5 A;  1OZ3 A;  4NL3 A;  1BI2 A;  4A4E A;  2GCX A;  2A3L A;  1Y96 A;  4FM4 B;  2K57 A;  4D6W A;  4J5Y A;  1XOV A;  2EIF A;  2ZPI B;  5A0L A;  5GAN 7;  3L2R A;  3M4G A;  4XTW A;  5GAM j;  1ZQ1 A;  3JCM V;  2CS7 A;  2DJZ A;  5J39 A;  1LNX A;  3DLL A;  1HK9 A;  4V2S A;  1XQH A;  2QXF A;  3LX7 A;  4A4G A;  3CME T;  1M90 C;  2XHC A;  4M75 G;  3JB9 D;  1IZ6 A;  3UWN A;  2XI9 A;  3QPH A;  5GMK i;  4MMK A;  4C8Q D;  2LX9 A;  2OTL A;  3OYM A;  3WVE B;  4M78 C;  1Y7X A;  1VIF A;  4OB1 B;  5CKE A;  3RMQ A;  4B9W A;  2KQW A;  2QA4 A;  5FU7 C;  1XNI A;  3CCR T;  3J80 E;  3N5B B;  3CCQ T;  2ZPB B;  5GAN d;  4ZN1 A;  3NTI A;  4BE0 A;  2K3Y A;  2MWO A;  3V7S A;  3CCM T;  4C8Q A;  3UT1 A;  3L2Z A;  2ZPG B;  2QQ9 A;  3DKM A;  4BI3 A;  3M5A A;  2K2V A;  2Y4X A;  4C92 G;  2X4X A;  3A8L B;  3FJP A;  3QJ6 A;  4GY5 A;  4MML A;  2LRQ A;  5KE3 A;  2CZ1 B;  2KY9 A;  2R5A A;  3KXT A;  2DPP B;  5KCO A;  3AHU A;  5GAN 4;  2P0Q A;  4M78 B;  3TRE A;  5A2Q E;  2K5I A;  4C0F A;  1G3T A;  5J26 A;  1UGQ B;  1Y07 A;  4OB0 B;  3JSC A;  2EQM A;  5J3B A;  2ZPE B;  4PJO F;  3PTA A;  3S3N A;  1VQ4 A;  1I5L A;  4F7U A;  1U8R A;  2X4Y A;  4KUD K;  3I56 T;  3LGF A;  3G71 A;  1EIF A;  3OBY A;  4L5G A;  1KD1 U;  1K73 C;  1B34 B;  3RKW A;  5L8R E;  4EMK C;  2I2L A;  5GAN 8;  5DLO A;  4C8Q B;  3Q1J A;  1NPR A;  1D3B A;  2FL7 A;  3V8L A;  1KC8 U;  4LDV A;  3CCL T;  3C94 A;  3GPL A;  4L59 A;  3CC7 A;  5CCA A;  3L2V A;  5CKD A;  2KMT A;  1HXD A;  2YHT A;  3CBM A;  3VKI A;  3QKJ A;  3O8V A;  3OW2 S;  4M78 A;  2QTX A;  2K3X A;  4E47 A;  2D0Q B;  2LDM A;  4C92 E;  2JTF A;  3PIP A;  2P0K A;  4C92 A;  2F69 A;  3VUZ A;  2E64 A;  3SWN C;  3DLM A;  1I81 A;  2HQE A;  4IUR A;  3VU3 C;  2EQJ A;  3OYJ A;  2DEQ A;  3M57 A;  3HSB A;  4M7D D;  4XU1 A;  4NOY A;  4C5H A;  2XDD A;  3FIF A;  1B34 A;  1RL2 A;  3E9F A;  2RD1 A;  3C95 A;  2CGH A;  3CCU T;  2Y4Y A;  5GMK l;  3JCM W;  3GLX A;  3QII A;  5LJ5 e;  2EJ9 A;  4OGC A;  2DZ9 A;  2EJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...