1JBMA

Heptameric crystal structure of mth649, an sm-like archaeal protein from methanobacterium thermautotrophicum
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
78
structure length
78
Chain Sequence
b'VNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE SNRNP SM-LIKE PROTEIN
publication title The oligomerization and ligand-binding properties of Sm-like archaeal proteins (SmAPs)
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Structural genomics
total genus 14
structure length 78
sequence length 78
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2001-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1jbmA00
4M78A 4M77C 5GAMh 5GAMd 5GAMg 2DKGA 4V2SA 2E65A 3SWNC 5LJ3h 5LJ3d 1LNXA 5GAMe 5LJ3g 2RM4A 5GMKh 5GANj 1I4K1 2YHTA 4RCBA 2DZCA 2VC8A 3BW1A 4XTXA 4M75E 4M78C 4M7DE 3JB9D 4N0AA 2FB7A 3JB9I 4PJOG 4M7AD 3V7RA 2Y90A 4PJOB 4XTWA 2DTOA 3BDUA 4M77D 4RCCA 4C8QE 5GAN7 4F7UA 5GAN4 3JCMc 4XQ3A 3RKYA 1LOJA 4PJOF 3FB9A 5GAOq 4EMHA 4M7AC 4Y91A 4QVDA 3QSUA 4N0AC 4C92B 1U1TA 5GAOm 3RUXA 5GAN3 3EFSA 4XU1A 5I21A 3RIRA 4M78D 4C92F 1WPYA 5LJ5j 3GIBA 2DZ9A 3RKXA 2JN0A 4M7DA 3BFMA 1X01A 4NOYA 3JCMX 3M4GA 1Y96A 4JRIA 2E64A 5GMKm 3V8LA 2DJZA 2E10A 3JB9G 1YCYA 1M5Q1 4M7AG 4M7DC 4J5YA 3JCMf 3JCMe 2FYKA 4M75A 4M7AB 2DVEA 5GAOr 3JB9F 3RERA 2QTXA 4PJOE 4M77G 4EMKA 2EWNA 5LJ5f 4X9DA 2DTIA 4M77B 5LJ3j 4M7AF 3AHUA 4DQ2A 5GAN6 3SWNB 3EFRA 2YLCA 4M77F 4C92E 2RA2A 4C8QA 3V7SA 1I8FA 4PNOA 4M75C 1JBMA 4C92A 1U1SA 5GANf 5GANe 4M78G 2EAYA 3VU3C 4EMKC 1M8VA 4M78B 4MMLA 3RKWA 2DXUA 3SB2A 2VXFA 4M7DD 2E1HA 1WNLA 4M78F 5DY9A 2K57A 3V7CA 4C8QC 2DTHA 3JCMP 3QHSA 2YLBA 3JCMh 1I5LA 1LJOA 4A54A 3JCMd 3JB9H 1KQ2A 3JCMg 4J6YA 4M7AE 4QVCA 4XTYA 4EMGA 3PGGA 4M75D 5GMKi 3RESA 5LJ5h 5LJ5d 4M77E 4HT8A 5LJ5g 3JCMV 5GAMj 4XU3A 4F7UG 2EJFA 4XU0A 4PJOA 4C8QG 5LJ5e 4F7UB 5GAN5 1MGQA 2DEQA 4HA8A 1H641 5GANh 5GMKj 1D3BB 4C8QD 4F7UF 5GANd 1WQ7A 5GANg 4JRKA 1WQWA 4XTUA 3HSBA 4M78E 1BIAA 5GAOl 1B34B 4J6WA 2RD1A 3FIFA 1N9RA 2VXEA 3L2ZA 4M7DG 3INZA 4PJOC 4M7DB 3QUIA 5GAOp 1Y96B 4HT9A 4WF2A 5GAMf 4M7DF 5GMKl 4XTZA 4C92C 5LJ3f 5LJ3e 4NL3A 3JB9J 3BY7A 5GMKe 4M75G 1HK9A 3L1AA 4XU2A 2DXTA 3QO3A 3V8JA 2ZGWA 4M75B 1HXDA 4A53A 3HFOA 4XTVA 4EMKB 4J6XA 3HFNA 4M7AA 4OP0A 4X9CA 4JUVA 4NL2A 2HNIA 4M75F 4F7UE 3JCMW 4PJOD 2CGHA 2I2LA 4M77A 1I81A 3JCMQ 3FJPA 1TH7A 2EJ9A 4C92G 3SWNA 4C8QB 1D3BA 3V8KA 5GAN2 1KQ1A 3JCMb 3JCMJ 1BIBA 4JLIA 5GAOn 2EJGA 2RB6A 1N9SA 4MMKA 1B34A 2E41A 4C92D 1JRIA 4C8QF 5CAIA 5GAN8
chains in the Genus database with same CATH superfamily
2L5QA 3ZFJA 2QEXT 4V2SA 2K5FA 3BW1A 2KT1A 2WACA 1KJWA 4OMFB 1ZQ1A 3TU4K 2DILA 1BCOA 2CP7A 2A3LA 1OYXA 2GQVA 2QTVA 1OQKA 1YJ9A 3QWYA 1AHJB 3NFCA 4J8OA 3QSUA 1WPYA 4MZPA 3JCMX 1YITA 3JB9G 3C95A 5CQYA 5GAOr 1N8RU 1W2BS 4J9EA 2OX7A 2P4TA 1GCPA 1R77A 2M16A 2YLCA 4A4FA 2W10A 2OJ2A 4J7FA 2CUBA 1VQOA 1UFFA 1M8VA 3SFMA 2V26A 4J9BA 2HQHA 3L2QA 5IHKA 1Y07A 4M7DD 1PKSA 2FPDA 1T0JA 2AZSA 2YUNA 2DK3A 5CQXA 1S72Q 1WXTA 1NYFA 4A54A 4M75D 5LJ5h 3PMIA 1OZ3A 1YJ9T 2R5AA 3NPFA 1M3CA 3CC2Q 2J06A 3HSBA 1CSKA 3CCRQ 1B34B 1YITT 1OU9A 5D6XA 3M4YA 4FT2A 4RTYA 4ZGDB 3MP6A 3EGXA 3E2UA 3UWNA 4PKCC 1WHHA 1IB8A 3GBQA 3TSWA 4A4HA 3EG9B 1XOVA 3EH1A 1VQOT 4PJOD 1V29B 4OB1B 4QKUA 1VQMQ 1WFWA 3GNGA 2AZVA 2RB6A 1B34A 3EFOB 2J7IA 2YRVA 2AT1B 1Q7YU 2DKGA 1UJ0A 5CKDA 3UF4A 3CEYA 3LWIA 5LJ3g 2FZCB 1KC8R 2EQKA 3MKDA 4B9WA 4C0FA 3OMGA 2IPOB 1WHGA 3MP8A 3HL8A 1QP3A 3E19A 4C8QE 1WJSA 5CCAA 3FJ5A 3PIOA 1OI1A 2KXCA 4C92F 2O88A 3M4GA 4OF1A 1LPLA 3CPWP 1Y71A 3RERA 4X1VA 2V8JA 3LLRA 4MDXA 4EMKA 2AK5A 2KR3A 2BE9B 2LQKA 2RQWA 2RJDA 2KRMA 4PJNA 2RA2A 1NLOC 1I8FA 1UGVA 1YI2T 3ZEHA 2K3BA 3LH0A 1GRIA 2ECZA 2VVKA 3QJYA 3CCSA 2E70A 4O5VA 3M56A 2ED0A 2QXFA 1G8XA 4M77E 4ME7A 2VASA 2MAMA 4ESRA 4XTUA 3RR6A 2KT8A 2CDTA 4QQGA 1IGUA 3VS5A 1D0ZA 3F70A 3FDRA 2V1RA 1KFZA 2BZ8A 1U3OA 2ZPEB 3CC7A 4CC7A 3PNWC 5I2MA 3L1AA 1YFNA 2XHCA 2EPDA 4IURA 2O9VA 2DXBA 2MK5A 1TH7A 4KH1B 2YRDA 3JCMJ 5GAOn 1N8RR 5GMKi 3KFVA 5FWBA 2DD5A 1VQPQ 1ABQA 4HKEA 2DX1A 5A0DA 3CC4Q 3VS7A 4M78C 1NJIC 4EIKA 2EYXA 3A8OB 2O4XB 2KGTA 5LL6S 4JRPA 2JXBA 2LT4A 5GAN4 1GCQA 1H3HA 3H0HA 4BD3A 3S3OA 2DPPB 1VA7A 2D9TA 5A0GA 4E6RA 1NG2A 1T3LA 2JN0A 3BFMA 2DAQA 4AFZC 1ZSZA 1R0BG 1SHFA 4LDWA 2W0ZA 1UECA 3OBYA 1O9SA 4A63B 1VQ9A 2DA9A 3AHUA 4HCKA 3I55T 2BIVA 3QYGB 4C5IA 3OYKA 2RI2A 3C12A 1UUEA 3QYHB 1G2BA 4OB2B 4M78G 4M78B 2QDLA 3PT9A 3M58A 2QEXQ 4RTWA 1WHMA 4AMCA 3VJPA 1OZ2A 1SRLA 4ZTFA 4BDYA 2VGNA 4E7SA 2F2XA 1Q7YR 1RL2A 3TQ7P 1Y7XA 4P5NA 2GNCA 5LJ5g 1J3TA 3PVQA 3PTAA 2QASA 1VQ6T 4D8KA 4F7UF 1WQ7A 2EGEA 2EQIA 3VS1A 4E47A 1Y96B 2AKKA 2NWMA 4WF2A 4L59A 3VS0A 4GLMA 3CCUT 1VQ9T 5GMKl 1RUWA 5LJ3f 3M57A 3MEAA 2LVMA 1HK9A 2GCXA 2MYSA 4XU2A 1YJWT 2KQWA 4KH0B 4BE0A 2CGHA 2CZ7B 2RH2A 3MO8A 1BI1A 2EJ9A 3GPLA 4BDZA 4X34A 4K11A 5CKFA 1N9SA 3UATA 1IRXA 2A37A 1WYXA 3LYIA 1K9AA 5GAMd 3SEMA 2YHTA 3UA6A 3Q1JA 2PZ1A 3OYYA 1E6HA 4M7AD 5KH6A 1YJ9Q 3CD6A 3H9NA 2DTOA 2P0KA 4FU6A 5DLOA 3TVTA 4EMHA 4Y91A 3CCEA 3ULRB 1V76A 1YITQ 3P8DA 3EFSA 3CCJA 2M0OA 4AFSC 5HCKA 4OMLA 2NUZA 4VUBA 4JRIA 1K4US 2JZ2A 4XK8E 1G3WA 2RHYA 3OS2A 1N27A 2DXCA 3JB9F 4PJLA 1NZ9A 4NS5A 1VQOQ 5LJ3j 1D1BA 1CKAA 2CUDA 1RAFB 4LDVA 3L2WA 2K2MA 2RI5A 5GANe 1ABOA 1GXIE 4FIBA 1VQ8A 2DL3A 3RKWA 2HMAA 2KBTA 3OYAA 4RMOA 2CP5A 4AFQC 4C8QC 3CD6T 1LCKA 3LH5A 4N4IA 2QAZA 3QG1A 1IO6A 1D09B 3CMEA 1ZLMA 4HT8A 3CCET 1NJIU 1MMNA 2X9HA 3L2UA 3CCJT 1EIFA 1RLQC 4KGVB 4HA8A 5GANd 4AFUC 3NMZC 1D1AA 4EPCA 2A28A 2HL3A 1X69A 3T9NA 1AD5A 3CPWA 2ZPGB 2PVGB 1ZA1B 4PJMA 1TSFA 2F2WA 2DYIA 4X9CA 4B6MA 4JUVA 3H0IA 3A5ZB 2NUTA 2RF0A 1WIEA 4C8QB 2EYYA 1XNIA 2JS2A 2MCNA 1RI9A 1UGSB 1YI2Q 4ZN3A 2J05A 2PUKB 4M77C 5GAMh 1QVPA 5D7UA 2RQVA 5FRNA 2LJ1A 3ASKA 3CMET 1NEGA 4RTZA 1SSFA 1YP5A 2HL5C 2JTMA 1IZ6A 3EGDA 5FU7C 2AKLA 3X20B 4RCCA 2LCLA 5GAOq 5I2SA 3DLLA 2K6DA 2OTJA 1I1JA 2K9GA 3OA6A 1I07A 3RKXA 1VYUA 1X01A 2C0IA 4C0GA 3OY9A 4J9CA 1ZX6A 3FLGA 1HSQA 1DJ7B 2Y4XA 4M77G 5LJ5f 4X9DA 2RJEA 4M77B 4BUGA 1QCFA 3CCSQ 1UJYA 2GGRA 3AT1B 3J81E 3OYIA 5GJVB 1SHGA 3MEWA 3V7CA 5FU7B 3OSVA 4C0DC 3GLXA 3LW5E 3NTKA 4O6JA 1W4SA 2WSCE 4JS4A 2OTJT 2X4WA 3X25B 5LJ5e 1UDLA 5GANh 3G4SA 1VYVA 1R0CB 3HRTA 4JLGA 1GBRA 3CC7Q 2FPFA 3O5ZA 1PC0A 1UGRB 2K5IA 3GOXA 1YWOA 1WA7A 2A0FB 2L2PA 4PFZA 3LWHA 2M1HA 2C0TA 1MMAA 2PVDB 2XU8A 1HXDA 4OMNA 2HNIA 2EQUA 1I81A 2IIMA 3L42A 3M0QA 3M54A 3QPHA 1VIEA 5KE3A 2DVJA 4Y28E 1OX8A 4M7DE 2YUPA 4ZNXA 1RACB 4FT4A 1NBEB 2YSQA 1KK7A 2O31A 2LJ3A 4M75E 1M3AA 1AWJA 4DBQA 3G4ST 4F7UA 2E3HA 1OU8A 3CCMT 4N0AC 2CSQA 4N4GA 1NJIR 2D6FA 1QCNA 3PIPA 2GTOA 3H8ZA 2E64A 1VQ9Q 4BE1A 2FRYA 2E10A 3META 3JCMe 3VYHB 4A4EA 1K8AU 4PJOE 1QQJA 3DKMA 2E6NA 5I11A 2H3JA 3OW2P 2OI3A 5KYUB 5IAYA 4QQ6A 1WHLA 2KDSA 1G5VA 2MOXA 4M78F 1JQQA 3CPWS 2K2VA 3I35A 3JCMd 1KSWA 1N5ZA 2NUPB 1VQKA 3C4SA 1K1ZA 4KRTA 5J3BA 2P0PA 1M1FA 3GP8A 3I9QA 3M55A 1SF9A 5GAN5 1Z9QA 1PWTA 3D7SB 4JJDA 2DE0X 2MF2A 2QGGA 4JZ3A 5GAOp 2CZ6B 3CBPA 3ZBDA 4FYVB 1G3SA 2ZPHB 2QQAA 3WVDB 2NUPA 2PUOB 4XAXB 3A8MB 1KD1C 2CYZB 1K9MC 3HFNA 1YHQA 3OYDA 4HCBA 3G6EA 1CKBA 1MV3A 5GAMg 3SWNC 1VQKT 1OX9A 3EG2A 3CD6Q 4KT0E 1HYOA 3HRUA 1WJQA 4ZGEB 1OPLA 2HEQA 4BI4A 3CCEQ 3OB9A 2J6OA 1D0YA 3CCJQ 1VQ5A 3RKYA 3EG3A 4IIOA 3RDVA 1TU0B 5HKCA 4TVRA 1G3YA 4JRQA 5EC7A 3DB3A 2DZ9A 4NOYA 5KYXB 3P8HA 1QWEA 2COYA 3ME9A 1JO8A 2RI3A 1UGPB 3S6WA 1YI2A 2QQBA 1YHQT 4RUGA 1M5Q1 4ZN1A 4PK4A 2QTXA 1KQSP 2DTIA 2CP3A 3EG9A 1UGQB 2DF6A 1VQ8Q 3FC3A 3WVEB 2SEMA 3SWNB 3G6ET 5HK3A 4OGCA 3VU3C 3EFOA 4MMLA 4LDYA 1R8OB 4BB7A 3L2RA 5FRMA 4C5HA 1MMDA 2JM9A 2L3SA 1XTDA 3JCMP 3CMEQ 3JCMh 1I5LA 2FHDA 2DL5A 4J6YA 1VQ5T 3EH2A 2DIQA 3MEVA 1M27C 3UT1A 1RAGB 2ENMA 4L6V5 1E6GA 5KCHA 1BK2A 3TCJA 3VKIA 5GMKj 2O2OA 1S1NA 5GANg 2EVRA 2E5QA 4AG1C 5GAOl 1IHVA 3INZA 3PFSA 4QT7A 2YDLA 3C0CA 2O9SA 4XTZA 2JT4A 5FU6C 2PTKA 5IXBA 3CCVA 1MNDA 1QP2A 3UPUA 2XICA 2E12A 2RMOA 1K73C 5GAN2 5J39A 1WX6A 2EJGA 4C92D 4C8QF 2FEIA 2E41A 4II1A 1VQNA 2MI6A 4J9HA 4KUDK 2AIRB 4J9DA 2E65A 2FZGB 2XDDA 4LXCA 2RM4A 3OYCA 1I4K1 4E7KA 1NM7A 1WDXA 2DD4A 2HCKA 2XI9A 4QVZA 2DL4A 2DLPA 2FRWA 2M0YA 2O01E 4EDUA 2LDMA 2OTJQ 1BYMA 5C0MA 2BZYA 1EX4A 2QK0A 1U1TA 5FU6B 5GAN3 3I55A 3CCVT 2ZPIB 1KHCA 1FMKA 2YRCA 2K79A 4LNPA 1RAIB 1YJNA 1BB9A 4BI3A 1RABB 1GFCA 4M7DC 3GNFB 3ZL7C 2DJQA 1FMWA 2EWNA 1ZUUA 1M9SA 1KD1U 1VQNT 4M77F 1K9MU 4GY5A 4MDWA 4M75C 1JBMA 1VQ6A 2LQNA 2COZA 2Z0WA 5DY9A 4GLKA 4J9GA 3OYFA 2YXYA 3QWXX 4M7AE 3MEUA 2DRMA 4BI8B 3RESA 2O4XA 3G4SQ 1EFNA 3CCUA 4J9IA 2ZPBB 4BE2A 1YJWA 1T0HA 5IXFA 3DB4A 3KUFA 2AHJB 3OYMA 4M7DG 4PJOC 2VXEA 3M5AA 1YJNT 4M7DB 1PSFA 5GAMf 1U06A 5CIUA 1FX7A 1KG1A 4C5GA 2JMAA 4M75G 1X75C 2X35A 2DL7A 4M75B 1PKTA 4ELYC 3OW2A 3HFOA 3I56T 3JCMW 5HY6A 4FW1A 2DL8A 3N5BB 3G7ZA 3A8HB 2OAWA 3OS5A 2EGAA 2RJCA 3RMSA 1VQ4A 5IN1A 4M78A 4E7HA 2MWOA 5GAMe 3PMTA 3EHRA 4RTUA 4RCBA 1ZUYA 5M9OA 4OMOA 2CP6A 4PJOG 4PLLA 4PJOB 4R56A 2QQ9A 3URGA 1ZSGA 4E7IA 5DLQE 3EHQA 4FYWB 4F17A 2RHXA 2YUQA 3GIBA 1TOVA 5FLXE 3SHWA 2FG0A 3FEOA 1Y96A 2HBPA 4OMMA 3U23A 1P92A 1YCYA 5CVIA 3EG1A 5KCOA 4DQ2A 1VQ4T 3EFRA 3V7SA 2OAUA 1VQ7A 2HQEA 5GANf 2RQTA 1PRMC 4KULA 1FXXA 1QKWA 3REAB 1GL5A 1WLPB 1K73U 3HP9A 1VQKQ 2KEAA 3E9GA 1PM3A 3QDRB 1AEYA 3QHSA 3VRZA 4J9FA 2V8IA 2FO0A 3JCMg 1TS9A 2R58A 2XK0A 2E3IA 2V8KA 3JCMV 2DBKA 1H3ZA 2XKOC 1Q86C 4J7IA 3TEEA 1H641 2DM1A 3JV3A 4BY6C 1IGQA 2LX7A 5L23A 3VRYA 1NE8A 1YHQQ 1KQSA 1PG5B 5KYYB 1AOJA 2DXTA 1YBYA 2MPXC 3OYLA 1VQ7T 2D0QB 2L8DA 4C92G 3G6EQ 1JJ2A 3CXCA 3QKJA 3MJXA 3CPFA 4L5GA 2WSEE 2Y4YA 2JMCA 4OB0B 1UB4A 1C0MA 2L89A 1KD1R 8AT1B 1D0XA 2YT6A 1K9MR 5GANj 1SPKA 2HZYA 1K8AC 2ZAEA 3HKSA 2D1XA 3JB9D 1HJDA 1VQ5Q 3X26B 4BY6B 4PL6A 2K4YA 1VQMT 2COWA 3JCMc 2RQRA 2XD0A 2RHIA 1QVGA 7AT1B 3EAEA 4HCZA 3I5RA 4E7JA 2NYSA 2XIDA 2X4YA 5KE2A 3OQ5A 2KAFA 4OGEA 5GMKm 3VUBA 5KYWB 4J5YA 1TWBA 3THKA 5L8RE 4PJJA 3GF5A 2HAXA 5GAN6 2DFUA 4C5EA 4C8QA 2M51A 1TUGB 2BKDN 1Q81C 3QIIA 3SB2A 3OS0A 3QBYA 3NTHA 2A08A 2QYZA 3A8GB 4Q5WA 2FL7A 1WHKA 1QVFA 2P0QA 1JU5C 3VS6A 3OW2S 4J83A 1B07A 2X3XD 1Q82C 3JAME 2CT4A 2RK2A 3LX7A 2VGMA 2JVVA 2LC4A 1BIAA 2RD1A 2ZZDA 3FIFA 6AT1B 5IH2A 3CCVQ 2A36A 3OYNA 1EZZB 1ZA2B 4D6WA 1YN8A 4NL3A 4MZMA 4CI0C 2LX9A 4IUTA 2DNUA 2QA4A 1M90C 4M77A 1VQNQ 5GJWB 5CK9A 1BI3A 3V8KA 1UHCA 1AZGB 2PQWA 3A8LB 1X6BA 3TREA 5CAIA 4M7AC 5GAN8 3I5SA 1ZBXA 3CCMA 4R55A 4GBQA 2CREA 4YTLA 2LZ6B 1K73R 3RNJA 1X43A 1OPKA 4A4GA 1XQHA 1K76A 3FB9A 3BDLA 3I55Q 2ROTA 4DA4A 3RUXA 1MUZA 1Q86U 2C0OA 3CBOA 3RIRA 5LJ5j 2RNAA 1YJNQ 2K5LA 2GFAA 1MHNA 3OS1A 2HSPA 4ZTJA 2F69A 2QA4T 3OYGA 4DBFA 4Z89A 4M7AG 4FW2A 4LUDA 3JCMf 4M7AB 3VUZA 3DLMA 1VQLA 2FPEA 4C0ZA 3CCQA 4Z8AA 1AWOA 1VQ6Q 2CT3A 2VV5A 2VUBA 2E6ZA 1Q95G 3JSCA 3SD4A 2GF7A 2E1HA 1U5SA 2QQSA 2LMJA 3CMAA 1SEMA 1Z9ZA 3CCUQ 1KQSS 4AG2C 1BU1A 1KQ2A 1YJWQ 1C1AA 1OULA 1TG0A 2ZPFB 2JUFA 2BTTA 2WSFE 1JJ2S 2LNVA 3CXCS 1KIKA 5ECAA 2L3PA 4JRKA 1WQWA 1JB0E 2CH4W 1TUDA 2G6FX 3MPUB 4UC4A 2KYBA 4IIMA 2MIOA 5CR2A 4M7DF 1Y0MA 1VQLT 4DOWA 4Z88A 3J80E 3CCQT 2EIFA 4A53A 4J6XA 2EQJA 1PCXA 4M75F 4NL2A 4CC2A 2RK1A 2PU9B 3H0FA 3TSZA 1VQ4Q 2GFUA 1QVGS 5AYFA 5KYUA 1KQ1A 4MMKA 1IHWA 3CMAT 4RTXA 1Q81U 4JS5A 3KXTA 1N6AA 1BI0A 1H92A 2VC8A 2QI2A 1G3TA 4N0AA 1SSHA 2Y90A 4PJOF 1NEBA 2JS0A 1Q82U 2DMOA 3OBWA 2D8HA 4IUUA 4N4HA 4B9XA 1NPPA 2HSEB 4M78D 5IT9E 3M0TA 4Z02A 4LE9A 2MWPA 3RMQA 2CS7A 4IUQA 2DEUA 1QW1A 3EGXB 2DJZA 3JRZA 1QVFS 4PLIA 3HTRA 3S3MA 3C94A 5CKHA 2C06A 1VQ7Q 1GFDA 5AT1B 2CP0A 4DOVA 4C92E 1RAHB 4PNOA 1M90U 4LUEA 1M2VB 2EAYA 4EMKC 2LCCA 1FMVA 2ROLA 2CP2A 1NYGA 2XDPA 3M0PA 2JTFA 1X6OA 2YLBA 1I5OB 1LJOA 2X4JA 1JXOA 2MMPA 4JJBA 4CRIA 2LTOA 2K3YA 3LGFA 2EW3A 1W70A 4RG2A 1M2VA 2RO0A 2IVWA 1JJ2P 1WI7A 3CXCP 2X3WD 3P8BB 3QUIA 2XDBA 5KYXA 2F5TX 4RG8A 1BI2A 5IHNA 1PD1A 2CH4A 2X4XA 1D1CA 2CKKA 5GMKe 1Q86R 2DERA 3QO3A 2DYBA 2HQXA 2GQIA 3PVLA 3V8JA 2DBMA 3G71A 4QW2A 1M1GA 4EMKB 4HCCA 3G1JA 2EFIA 3JCMQ 1IXDA 3SWNA 4HXJA 1PRLC 1QKXA 3QDFA 2JTEA 1QVGP 3UDCA 2EYQA 1IREB 2RN8A 4E7ZA 3OYEA 1YWPA 4HVVA 1OEBA 3OYBA 2V1QA 2NLUA 3V7RA 5C6SA 1G83A 5GAN7 3OYHA 1YIJA 1W2BP 3CQTA 2QG9B 3VS4A 2JJ9A 1K8AR 2H3EB 4ATOA 1GCQC 1M30A 2EYWA 2H8HA 1RADB 3G71T 3H6ZA 1NPRA 1M1KC 4WCIA 1M4ZA 1T3SA 4RKUE 5DM7R 1AT1B 4LD9K 2DVEA 2G3RA 2LQWA 1ZSZC 1QVFP 2HBWA 1LVKA 1ARKA 3HPWA 1U1SA 2ED1A 4FCYA 2DXUA 4FL6A 4IKFA 2OTLA 3EG0A 2KI7A 3E9FA 4OMPA 1JXMA 2LNHB 2RPNA 3CCLA 1X2QA 3VS3A 2D0NA 1PHTA 4QVCA 4EMGA 4F14A 1YIJT 1Q81R 4XU3A 2EJFA 4XU0A 4C8QD 1FYNA 3OYJA 3CCST 3I56A 3X28B 1WZOA 3A1PA 1OOTA 1RAEB 2R57A 4IUPA 1ZSZB 2F1LA 2JM8A 2YUOA 2L3QA 2QA4Q 1Q82R 3BY7A 3H41A 1PD0A 1VUBA 2KE9A 2KK4A 2ZGWA 4JJCA 2ABLA 4CC3A 4OP0A 4F7UE 9ATCB 1AVZC 3RBBB 2BE7D 5CKEA 3M0UA 3CCMQ 4RTVA 1BKBA 2DETA 2OTLT 4HT9A 3CC7T 1JRIA 5IHIA 1AWXA 3CCLT 1HD3A 4HVUA 2EGCA 2E5KA 3NTIA 5CO7A 5GMKh 2EQMA 3M53A 3IQLA 3MP1A 1M90R 2F2VA 4XTXA 2XMFA 1UEBA 3HRSA 3JB9I 5KYNA 5FW9A 4OMQA 3QXEB 3BDUA 4M77D 2KROA 4XQ3A 1LOJA 2LT1A 8ATCB 5GAOm 1PNJA 3MCAB 1NLPC 2E4HA 1YNZA 4ZGJB 4M7DA 2KMTA 1GBQA 1TXQA 2A7YA 1VQLQ 5D6YA 1K0XA 2YWWA 3CCQQ 1U8RA 2K7AA 3X24B 3HHTB 3MHXA 4M75A 2HKQB 5CKBA 4M7AF 2FZKB 2RQUA 4DEYA 4PFOA 1QLYA 3CMAQ 2P84A 1VOMA 3OSSC 3UA7A 4DBHA 3NGPA 2GTJA 2ESWA 3JB9H 4KBMB 3FRNA 3PGGA 2KRNA 1WJRA 5GAMj 4CC4B 1S72A 1X27A 4PJOA 1F1BB 2DEQA 2RJFA 4ORZA 1AWWA 3OMCA 5A2QE 3L2ZA 1WHJA 2LCSA 3CC2A 2P4RA 3S3NA 3CCRA 2JOYA 1B7TA 4C92C 5LJ3e 4KGXB 2J6KA 2VKNA 1XJWB 1VIFA 4LN2A 2FVUA 2PNIA 4XTVA 1M1KU 3KBGA 1KC8C 1W1FA 3FJPA 2L3RA 2KXDA 2QGFB 4DBRA 1VQMA 4FM4B 2J6FA 2KYMA 1ZUKA 1C6VX 1BCMA 1FWZA 5LJ3d 1TUCA 1ZHIA 4RTTA 1S72T 1WXBA 4LDXA 1SRMA 2EYZA 4ELZC 2FB7A 4D8DA 1SG5A 5FROA 4A4KA 3E1SA 3CC2T 4QVDA 4C92B 2CSIA 3CCRT 1AZEA 4XU1A 1M2OA 5J26A 1V1CA 1MMGA 5HK0A 4OVAA 2QDYB 2K3XA 2CZ1B 4E2FB 4JPBW 2R5MA 3V8LA 3M0RA 1UHFA 2B86A 5KYYA 4PFPA 1MNEA 4AT1B 3BE3A 2NUTB 4JDSA 2M02A 2RHUA 5FWCA 4C92A 1PSEA 3EGUA 3O8VA 1QWFA 1W6XA 1WGSA 2HKNA 4LD6A 1ACMB 2LQ8A 1O75A 1H8KA 4FYXB 2I0NA 4MZTA 4FSXA 4JJNK 2ZCFB 4XTYA 1VYTA 3EGDB 3R6NA 5D6WA 1W2BA 2D8JA 4C8QG 1VQ8T 2EKOA 3J7AF 1MGQA 2RHZA 3REBB 4OB3B 1UTIA 1D3BB 1B3QA 2VB6A 2KRSA 3M9QA 2EKHA 1JEGA 3G71Q 4F16A 1N8RC 3JB9J 5KYWA 4BACA 4E7LA 2X51A 1WXUA 2LRQA 2KNBB 4Y92A 4LDUA 1UE9A 2I2LA 4FSSA 1D3BA 4M4ZA 1BIBA 2VYTA 2KSSA 2VWFA 4IUVA 4F04B 5LJ3h 1LNXA 2DO3A 2DZCA 2QQRA 2HDAA 2EBPA 1I0CA 1YIJQ 3VYGA 1VQPA 4XTWA 1M3BA 3CC4A 2M9UA 2LP5A 2F5KA 2LJ0A 1Y57A 2JNGA 3CBMA 1UG1A 5I21A 3R6OA 4KUIA 3VV0A 3WXMB 2XG8D 3SDZA 4DEXA 5I22A 3A98A 1K0SA 5EG2A 3VS2A 1OV3A 2FYKA 1E7OA 2GBQA 4HVWA 3L2VA 1A0NB 1BBZA 2SRCA 1Q7YC 1RI0A 1KC8U 2OTLQ 2KVQG 3ER0A 1X2KA 1M1KR 2VXFA 3CCLQ 1WNLA 2K57A 1X6GA 2DTHA 1QCOA 2B8AA 2BZXA 1RAAB 2DIGA 3QJ6A 1VQPT 3CC4T 2QEXA 4FYYB 2CZ0B 5LJ5d 1RLPC 4F7UG 3I56Q 4F7UB 2DRKA 5A0LA 3QZ9B 4C0DB 3M59A 2JW4A 1YCSB 4M78E 1MV0B 4KGZB 2BUDA 4WTOB 4J6WA 1N9RA 1M8MA 1TTHB 4JZ4A 4QQDA 2KY9A 1SKUB 2IG0A 1QMCA 2PVOB 4M7AA 2ATCB 1ZBJA 4R0KA 1KHIA 3QZ5B 4ANJA 2HD0A 3JCMb 4JLIA 3NHNA 3PE0A 3LGLA 3M0SA 2L0AA
chains in the Genus database with same CATH topology
5IN1A 4M78A 4M77C 5GAMh 1QVPA 2L5QA 3ZFJA 4E7HA 2MWOA 2QEXT 3UDCA 5FRNA 4V2SA 2EYQA 1IREB 3OYEA 5GAMe 3ASKA 2K5FA 3CMET 3PMTA 1SSFA 4RCBA 3BW1A 2WACA 4OMFB 1ZQ1A 2JTMA 5M9OA 3OYBA 3TU4K 1IZ6A 4PJOG 2NLUA 4PLLA 3V7RA 5C6SA 5FU7C 4PJOB 3X20B 4R56A 2A3LA 1OYXA 4RCCA 2QQ9A 2GQVA 5GAN7 2LCLA 3URGA 5GAOq 5I2SA 3OYHA 3DLLA 1YIJA 1YJ9A 3QSUA 1AHJB 3NFCA 4J8OA 5DLQE 4E7IA 2OTJA 3OA6A 2RHXA 4ATOA 1WPYA 3GIBA 3RKXA 5FLXE 4MZPA 1X01A 3JCMX 3FEOA 1Y96A 1YITA 3G71T 3H6ZA 4C0GA 2HBPA 3OY9A 1NPRA 3JB9G 1M1KC 3FLGA 1P92A 1YCYA 3C95A 1M4ZA 4RKUE 5CQYA 5DM7R 1DJ7B 2Y4XA 5GAOr 1N8RU 4LD9K 2DVEA 5CVIA 1W2BS 2G3RA 4M77G 5KCOA 4X9DA 2RJEA 4M77B 5LJ5f 4BUGA 4DQ2A 2P4TA 1VQ4T 3EFRA 2M16A 2YLCA 4A4FA 3V7SA 2OAUA 1VQ7A 3HPWA 2HQEA 1U1SA 4J7FA 5GANf 1VQOA 4KULA 1FXXA 1M8VA 3SFMA 2DXUA 1K73U 3J81E 3OYIA 3L2QA 4M7DD 1Y07A 4FL6A 3MEWA 3HP9A 4IKFA 3V7CA 2OTLA 5FU7B 3OSVA 3E9FA 3E9GA 3GLXA 3QDRB 4C0DC 3LW5E 3QHSA 2DK3A 3NTKA 5CQXA 3CCLA 2V8IA 4O6JA 4A54A 1W4SA 2R58A 2XK0A 3JCMg 2WSCE 4QVCA 4EMGA 4M75D 5LJ5h 1YIJT 3PMIA 2V8KA 4JS4A 1OZ3A 3JCMV 1YJ9T 4XU3A 2OTJT 2EJFA 4XU0A 2R5AA 2X4WA 1H3ZA 3X25B 5LJ5e 2XKOC 1Q86C 4J7IA 3TEEA 1H641 5GANh 3G4SA 4C8QD 3OYJA 3HRTA 3CCST 3HSBA 3I56A 4JLGA 3X28B 1YITT 4BY6C 1B34B 3GOXA 2K5IA 1UGRB 5D6XA 2R57A 4IUPA 3M4YA 4FT2A 1NE8A 4ZGDB 3MP6A 3LWHA 1KQSA 3BY7A 2M1HA 3UWNA 1VUBA 2DXTA 2PVDB 4PKCC 2ZGWA 1YBYA 2KK4A 2XU8A 3OYLA 1HXDA 1VQ7T 4OP0A 4F7UE 4A4HA 2HNIA 2D0QB 1XOVA 2EQUA 2L8DA 1VQOT 1V29B 4OB1B 4PJOD 1I81A 3L42A 4C92G 3GNGA 1JJ2A 3CXCA 3M54A 3QPHA 1VIEA 5CKEA 3QKJA 5KE3A 1BKBA 3CPFA 4L5GA 2RB6A 2WSEE 2Y4YA 4Y28E 1B34A 2OTLT 3CC7T 1JRIA 4HT9A 4M7DE 4OB0B 3CCLT 1UB4A 2YRVA 4FT4A 1Q7YU 2DKGA 2L89A 5CKDA 3NTIA 3CEYA 3LWIA 5CO7A 5LJ3g 5GMKh 5GANj 2EQMA 3M53A 1K8AC 3MP1A 3HKSA 4XTXA 4M75E 3JB9D 2EQKA 1UEBA 3HRSA 3X26B 3JB9I 3G4ST 4B9WA 4C0FA 4BY6B 3OMGA 4PL6A 2K4YA 1VQMT 3QXEB 3BDUA 3HL8A 3MP8A 1QP3A 3E19A 4M77D 4C8QE 1WJSA 4F7UA 3JCMc 4XQ3A 5CCAA 1LOJA 2LT1A 2XD0A 3PIOA 3CCMT 2RHIA 1QVGA 4N0AC 5GAOm 1OI1A 3EAEA 3RMSA 4HCZA 4E7JA 4C92F 2XIDA 3MCAB 4N4GA 2X4YA 4ZGJB 5KE2A 4M7DA 3OQ5A 2KAFA 2D6FA 3M4GA 4OGEA 2KMTA 3PIPA 3H8ZA 2E64A 2A7YA 5GMKm 4BE1A 5D6YA 3VUBA 2E10A 4OF1A 1U8RA 3X24B 3META 3HHTB 4J5YA 3MHXA 3JCMe 4M75A 1Y71A 3VYHB 4A4EA 1K8AU 3RERA 4PJOE 2V8JA 3LLRA 4MDXA 4EMKA 2LQKA 3DKMA 2E6NA 5CKBA 4M7AF 2RJDA 5L8RE 2H3JA 3GF5A 5GAN6 2HAXA 2RA2A 4C5EA 4C8QA 4QQ6A 1I8FA 5IAYA 2KDSA 2BKDN 1Q81C 1G5VA 1YI2T 3QIIA 3ZEHA 3LH0A 3SB2A 3OS0A 3OSSC 4M78F 3CPWS 3QBYA 3QJYA 3CCSA 2K2VA 3NTHA 2E70A 3A8GB 4Q5WA 2FL7A 3JB9H 4O5VA 4KBMB 3JCMd 3M56A 1QVFA 2P0QA 3FRNA 1VQKA 3C4SA 3OW2S 2QXFA 4J83A 3PGGA 5J3BA 2P0PA 4M77E 1WJRA 5GAMj 1Q82C 1M1FA 3JAME 1S72A 4PJOA 3GP8A 4ME7A 3M55A 2MAMA 5GAN5 2DEQA 2RJFA 2RK2A 3LX7A 2VGMA 2JVVA 3OMCA 4XTUA 2LC4A 5A2QE 1BIAA 4QQGA 2MF2A 2RD1A 2ZZDA 3FIFA 3L2ZA 3CC2A 3F70A 5GAOp 2CZ6B 3CBPA 3OYNA 3FDRA 3S3NA 4D6WA 3CCRA 3ZBDA 2ZPEB 2JOYA 4C92C 4NL3A 5LJ3e 3CC7A 3PNWC 1G3SA 2ZPHB 4MZMA 5I2MA 2QQAA 1VIFA 4CI0C 2FVUA 3WVDB 3L1AA 2PUOB 2LX9A 4IUTA 4XAXB 3A8MB 1KD1C 2CYZB 2XHCA 4XTVA 2QA4A 1K9MC 3HFNA 1M1KU 4IURA 1YHQA 3KBGA 1KC8C 1M90C 2DXBA 4M77A 5CK9A 3FJPA 1TH7A 1BI3A 2L3RA 3V8KA 3OYDA 2PQWA 3A8LB 3JCMJ 5GAOn 3TREA 4HCBA 5CAIA 4M7AC 5GAN8 5GMKi 1VQMA 4FM4B 3G6EA 1ZBXA 5GAMg 3CCMA 3SWNC 1FWZA 1VQKT 5LJ3d 4R55A 1ZHIA 2DD5A 4KT0E 4HKEA 5A0DA 1S72T 4M78C 1NJIC 4YTLA 4LDXA 4ELZC 3A8OB 2O4XB 3HRUA 1WJQA 2FB7A 4ZGEB 4BI4A 5LL6S 4JRPA 3OB9A 2LT4A 5GAN4 1VQ5A 5FROA 3RKYA 1XQHA 4A4GA 3FB9A 3BDLA 4A4KA 3E1SA 5HKCA 4TVRA 1G3YA 4QVDA 4JRQA 3CC2T 4DA4A 4BD3A 4C92B 3S3OA 2DPPB 3RUXA 3CCRT 1Q86U 4XU1A 2D9TA 3CBOA 3RIRA 5A0GA 5J26A 5LJ5j 3DB3A 2DZ9A 2K5LA 2JN0A 2GFAA 3BFMA 4NOYA 1MHNA 5HK0A 3OS1A 4OVAA 2DAQA 2QDYB 3P8HA 2K3XA 2CZ1B 3ME9A 2RI3A 4ZTJA 1UGPB 3S6WA 2R5MA 2F69A 1YI2A 3V8LA 2QA4T 3OYGA 2QQBA 1YHQT 1M5Q1 4LDWA 4ZN1A 4M7AG 3OBYA 1O9SA 3JCMf 4M7AB 3VUZA 3DLMA 1VQ9A 2QTXA 1VQLA 4C0ZA 2DTIA 3CCQA 3AHUA 1UGQB 4JDSA 2RHUA 3I55T 2BIVA 3QYGB 3SWNB 3WVEB 4C5IA 5HK3A 2RI2A 3OYKA 3G6ET 2VV5A 2VUBA 4OGCA 3C12A 4C92A 2E6ZA 3QYHB 4OB2B 4M78G 1PSEA 3VU3C 3JSCA 3O8VA 4M78B 4MMLA 4LDYA 3SD4A 1R8OB 3M58A 1WGSA 2GF7A 3PT9A 2E1HA 4BB7A 4C5HA 3L2RA 5FRMA 4LD6A 2QQSA 1XTDA 3JCMP 2LQ8A 1O75A 3CMAA 1KQSS 3VJPA 1OZ2A 4ZTFA 4BDYA 3JCMh 1I5LA 2FHDA 2VGNA 4MZTA 4J6YA 1KQ2A 4FSXA 4JJNK 2ZCFB 1VQ5T 4XTYA 2DIQA 3MEVA 2ZPFB 1RL2A 5D6WA 1Y7XA 2JUFA 4P5NA 3UT1A 5LJ5g 1W2BA 3PTAA 4C8QG 1VQ8T 2EKOA 2WSFE 1VQ6T 4L6V5 1JJ2S 1MGQA 2RHZA 5KCHA 3J7AF 2LNVA 3CXCS 4OB3B 3TCJA 3VKIA 5GMKj 1D3BB 4F7UF 1WQ7A 5GANg 4JRKA 1WQWA 1JB0E 2E5QA 5GAOl 3M9QA 3INZA 4E47A 3PFSA 4UC4A 1Y96B 4WF2A 4L59A 5CR2A 4M7DF 1N8RC 3CCUT 1VQ9T 5GMKl 4XTZA 1VQLT 5LJ3f 5FU6C 3M57A 3JB9J 4BACA 3MEAA 4DOWA 2LVMA 3J80E 3CCQT 3CCVA 1HK9A 2EIFA 2GCXA 4XU2A 4E7LA 2LRQA 1YJWT 2KQWA 4A53A 4J6XA 1QP2A 2EQJA 4BE0A 4NL2A 4M75F 4LDUA 2RK1A 3UPUA 2CGHA 2I2LA 2CZ7B 2PU9B 2RH2A 2XICA 1BI1A 2E12A 2EJ9A 3MO8A 3GPLA 1D3BA 2GFUA 1QVGS 5AYFA 5GAN2 1K73C 4BDZA 1KQ1A 4X34A 1BIBA 5J39A 5CKFA 2EJGA 4C92D 1N9SA 4MMKA 2VYTA 2E41A 4II1A 4C8QF 2KSSA 3CMAT 1VQNA 2MI6A 3LYIA 4KUDK 5GAMd 4IUVA 2E65A 1Q81U 5LJ3h 2XDDA 4JS5A 1LNXA 2RM4A 3KXTA 1N6AA 1I4K1 2DO3A 1BI0A 2YHTA 3OYCA 4E7KA 2DD4A 2DZCA 2QI2A 2QQRA 2VC8A 2XI9A 4QVZA 1G3TA 3Q1JA 2O01E 4N0AA 3VYGA 3OYYA 4EDUA 4M7AD 5KH6A 1VQPA 2LDMA 2Y90A 3CD6A 4XTWA 2DTOA 3CC4A 1BYMA 2M9UA 2P0KA 5C0MA 4FU6A 5DLOA 4PJOF 4EMHA 2F5KA 4Y91A 3CCEA 1Q82U 2JNGA 1U1TA 3CBMA 3OBWA 5FU6B 4IUUA 4N4HA 4B9XA 3P8DA 1NPPA 5GAN3 3EFSA 5I21A 3CCJA 2M0OA 3R6OA 4M78D 5IT9E 4KUIA 3I55A 3VV0A 4Z02A 3CCVT 2MWPA 2ZPIB 2CS7A 4JRIA 4VUBA 2XG8D 1KHCA 3RMQA 4IUQA 2JZ2A 3SDZA 3WXMB 1QW1A 2DJZA 3JRZA 4XK8E 1YJNA 4BI3A 1QVFS 3FC3A 1G3WA 5EG2A 2RHYA 4PLIA 3OS2A 4M7DC 3GNFB 1N27A 2FYKA 3S3MA 3C94A 2DXCA 5CKHA 3JB9F 2C06A 1NZ9A 2EWNA 4NS5A 3L2VA 5LJ3j 1M9SA 1KD1U 1VQNT 4DOVA 4LDVA 4M77F 4C92E 1K9MU 4GY5A 4MDWA 1Q7YC 4PNOA 1RI0A 1JBMA 4M75C 3L2WA 1KC8U 1M90U 2KVQG 2RI5A 2EAYA 3ER0A 4FIBA 2LCCA 4EMKC 5GANe 1GXIE 1VQ8A 3RKWA 1VQ6A 2VXFA 3OYAA 4RMOA 1WNLA 5DY9A 2K57A 4C8QC 2DTHA 2XDPA 2B8AA 4GLKA 2JTFA 2DIGA 1X6OA 3QJ6A 3OYFA 1VQPT 3CD6T 2YLBA 1LJOA 2X4JA 3CC4T 2QEXA 4M7AE 3MEUA 4N4IA 4BI8B 2MMPA 3QG1A 2CZ0B 3RESA 2O4XA 5LJ5d 3CMEA 4HT8A 3CCET 3CCUA 4CRIA 4F7UG 2LTOA 2K3YA 1NJIU 3L2UA 3LGFA 4F7UB 3CCJT 1EIFA 5A0LA 2ZPBB 3QZ9B 4BE2A 4HA8A 1YJWA 4C0DB 5GANd 3DB4A 3M59A 4RG2A 4M78E 3KUFA 2AHJB 2BUDA 4J6WA 2RO0A 3OYMA 2IVWA 1N9RA 2VXEA 4EPCA 4M7DG 4PJOC 3M5AA 1YJNT 4M7DB 3T9NA 3P8BB 3QUIA 1PSFA 5GAMf 2XDBA 2F5TX 3CPWA 4RG8A 2ZPGB 1BI2A 5CIUA 1FX7A 2PVGB 4C5GA 2KY9A 4QQDA 2X4XA 1KG1A 2CKKA 5GMKe 4M75G 1X75C 2X35A 2IG0A 2HQXA 3QO3A 4M75B 3V8JA 4ELYC 3OW2A 3G71A 2PVOB 4QW2A 3HFOA 4M7AA 1M1GA 4EMKB 4HCCA 3I56T 4X9CA 4JUVA 3JCMW 5HY6A 2EFIA 3JCMQ 3A5ZB 1KHIA 3SWNA 4C8QB 3N5BB 3QZ5B 1XNIA 3G7ZA 2HD0A 3JCMb 3A8HB 4JLIA 1UGSB 3OS5A 4ZN3A 3LGLA 2RJCA 2PUKB 1VQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M78 A;  4M77 C;  5GAM h;  5GAM d;  5GAM g;  2DKG A;  4V2S A;  2E65 A;  3SWN C;  5LJ3 h;  5LJ3 d;  1LNX A;  5GAM e;  5LJ3 g;  2RM4 A;  5GMK h;  5GAN j;  1I4K 1;  2YHT A;  4RCB A;  2DZC A;  2VC8 A;  3BW1 A;  4XTX A;  4M75 E;  4M78 C;  4M7D E;  3JB9 D;  4N0A A;  2FB7 A;  3JB9 I;  4PJO G;  4M7A D;  3V7R A;  2Y90 A;  4PJO B;  4XTW A;  2DTO A;  3BDU A;  4M77 D;  4RCC A;  4C8Q E;  5GAN 7;  4F7U A;  5GAN 4;  3JCM c;  4XQ3 A;  3RKY A;  1LOJ A;  4PJO F;  3FB9 A;  5GAO q;  4EMH A;  4M7A C;  4Y91 A;  4QVD A;  3QSU A;  4N0A C;  4C92 B;  1U1T A;  5GAO m;  3RUX A;  5GAN 3;  3EFS A;  4XU1 A;  5I21 A;  3RIR A;  4M78 D;  4C92 F;  1WPY A;  5LJ5 j;  3GIB A;  2DZ9 A;  3RKX A;  2JN0 A;  4M7D A;  3BFM A;  1X01 A;  4NOY A;  3JCM X;  3M4G A;  1Y96 A;  4JRI A;  2E64 A;  5GMK m;  3V8L A;  2DJZ A;  2E10 A;  3JB9 G;  1YCY A;  1M5Q 1;  4M7A G;  4M7D C;  4J5Y A;  3JCM f;  3JCM e;  2FYK A;  4M75 A;  4M7A B;  2DVE A;  5GAO r;  3JB9 F;  3RER A;  2QTX A;  4PJO E;  4M77 G;  4EMK A;  2EWN A;  5LJ5 f;  4X9D A;  2DTI A;  4M77 B;  5LJ3 j;  4M7A F;  3AHU A;  4DQ2 A;  5GAN 6;  3SWN B;  3EFR A;  2YLC A;  4M77 F;  4C92 E;  2RA2 A;  4C8Q A;  3V7S A;  1I8F A;  4PNO A;  4M75 C;  1JBM A;  4C92 A;  1U1S A;  5GAN f;  5GAN e;  4M78 G;  2EAY A;  3VU3 C;  4EMK C;  1M8V A;  4M78 B;  4MML A;  3RKW A;  2DXU A;  3SB2 A;  2VXF A;  4M7D D;  2E1H A;  1WNL A;  4M78 F;  5DY9 A;  2K57 A;  3V7C A;  4C8Q C;  2DTH A;  3JCM P;  3QHS A;  2YLB A;  3JCM h;  1I5L A;  1LJO A;  4A54 A;  3JCM d;  3JB9 H;  1KQ2 A;  3JCM g;  4J6Y A;  4M7A E;  4QVC A;  4XTY A;  4EMG A;  3PGG A;  4M75 D;  5GMK i;  3RES A;  5LJ5 h;  5LJ5 d;  4M77 E;  4HT8 A;  5LJ5 g;  3JCM V;  5GAM j;  4XU3 A;  4F7U G;  2EJF A;  4XU0 A;  4PJO A;  4C8Q G;  5LJ5 e;  4F7U B;  5GAN 5;  1MGQ A;  2DEQ A;  4HA8 A;  1H64 1;  5GAN h;  5GMK j;  1D3B B;  4C8Q D;  4F7U F;  5GAN d;  1WQ7 A;  5GAN g;  4JRK A;  1WQW A;  4XTU A;  3HSB A;  4M78 E;  1BIA A;  5GAO l;  1B34 B;  4J6W A;  2RD1 A;  3FIF A;  1N9R A;  2VXE A;  3L2Z A;  4M7D G;  3INZ A;  4PJO C;  4M7D B;  3QUI A;  5GAO p;  1Y96 B;  4HT9 A;  4WF2 A;  5GAM f;  4M7D F;  5GMK l;  4XTZ A;  4C92 C;  5LJ3 f;  5LJ3 e;  4NL3 A;  3JB9 J;  3BY7 A;  5GMK e;  4M75 G;  1HK9 A;  3L1A A;  4XU2 A;  2DXT A;  3QO3 A;  3V8J A;  2ZGW A;  4M75 B;  1HXD A;  4A53 A;  3HFO A;  4XTV A;  4EMK B;  4J6X A;  3HFN A;  4M7A A;  4OP0 A;  4X9C A;  4JUV A;  4NL2 A;  2HNI A;  4M75 F;  4F7U E;  3JCM W;  4PJO D;  2CGH A;  2I2L A;  4M77 A;  1I81 A;  3JCM Q;  3FJP A;  1TH7 A;  2EJ9 A;  4C92 G;  3SWN A;  4C8Q B;  1D3B A;  3V8K A;  5GAN 2;  1KQ1 A;  3JCM b;  3JCM J;  1BIB A;  4JLI A;  5GAO n;  2EJG A;  2RB6 A;  1N9S A;  4MMK A;  1B34 A;  2E41 A;  4C92 D;  1JRI A;  4C8Q F;  5CAI A;  5GAN 8; 
#chains in the Genus database with same CATH topology
 2L5Q A;  3ZFJ A;  2QEX T;  4V2S A;  2K5F A;  3BW1 A;  2KT1 A;  2WAC A;  1KJW A;  4OMF B;  1ZQ1 A;  3TU4 K;  2DIL A;  1BCO A;  2CP7 A;  2A3L A;  1OYX A;  2GQV A;  2QTV A;  1OQK A;  1YJ9 A;  3QWY A;  1AHJ B;  3NFC A;  4J8O A;  3QSU A;  1WPY A;  4MZP A;  3JCM X;  1YIT A;  3JB9 G;  3C95 A;  5CQY A;  5GAO r;  1N8R U;  1W2B S;  4J9E A;  2OX7 A;  2P4T A;  1GCP A;  1R77 A;  2M16 A;  2YLC A;  4A4F A;  2W10 A;  2OJ2 A;  4J7F A;  2CUB A;  1VQO A;  1UFF A;  1M8V A;  3SFM A;  2V26 A;  4J9B A;  2HQH A;  3L2Q A;  5IHK A;  1Y07 A;  4M7D D;  1PKS A;  2FPD A;  1T0J A;  2AZS A;  2YUN A;  2DK3 A;  5CQX A;  1S72 Q;  1WXT A;  1NYF A;  4A54 A;  4M75 D;  5LJ5 h;  3PMI A;  1OZ3 A;  1YJ9 T;  2R5A A;  3NPF A;  1M3C A;  3CC2 Q;  2J06 A;  3HSB A;  1CSK A;  3CCR Q;  1B34 B;  1YIT T;  1OU9 A;  5D6X A;  3M4Y A;  4FT2 A;  4RTY A;  4ZGD B;  3MP6 A;  3EGX A;  3E2U A;  3UWN A;  4PKC C;  1WHH A;  1IB8 A;  3GBQ A;  3TSW A;  4A4H A;  3EG9 B;  1XOV A;  3EH1 A;  1VQO T;  4PJO D;  1V29 B;  4OB1 B;  4QKU A;  1VQM Q;  1WFW A;  3GNG A;  2AZV A;  2RB6 A;  1B34 A;  3EFO B;  2J7I A;  2YRV A;  2AT1 B;  1Q7Y U;  2DKG A;  1UJ0 A;  5CKD A;  3UF4 A;  3CEY A;  3LWI A;  5LJ3 g;  2FZC B;  1KC8 R;  2EQK A;  3MKD A;  4B9W A;  4C0F A;  3OMG A;  2IPO B;  1WHG A;  3MP8 A;  3HL8 A;  1QP3 A;  3E19 A;  4C8Q E;  1WJS A;  5CCA A;  3FJ5 A;  3PIO A;  1OI1 A;  2KXC A;  4C92 F;  2O88 A;  3M4G A;  4OF1 A;  1LPL A;  3CPW P;  1Y71 A;  3RER A;  4X1V A;  2V8J A;  3LLR A;  4MDX A;  4EMK A;  2AK5 A;  2KR3 A;  2BE9 B;  2LQK A;  2RQW A;  2RJD A;  2KRM A;  4PJN A;  2RA2 A;  1NLO C;  1I8F A;  1UGV A;  1YI2 T;  3ZEH A;  2K3B A;  3LH0 A;  1GRI A;  2ECZ A;  2VVK A;  3QJY A;  3CCS A;  2E70 A;  4O5V A;  3M56 A;  2ED0 A;  2QXF A;  1G8X A;  4M77 E;  4ME7 A;  2VAS A;  2MAM A;  4ESR A;  4XTU A;  3RR6 A;  2KT8 A;  2CDT A;  4QQG A;  1IGU A;  3VS5 A;  1D0Z A;  3F70 A;  3FDR A;  2V1R A;  1KFZ A;  2BZ8 A;  1U3O A;  2ZPE B;  3CC7 A;  4CC7 A;  3PNW C;  5I2M A;  3L1A A;  1YFN A;  2XHC A;  2EPD A;  4IUR A;  2O9V A;  2DXB A;  2MK5 A;  1TH7 A;  4KH1 B;  2YRD A;  3JCM J;  5GAO n;  1N8R R;  5GMK i;  3KFV A;  5FWB A;  2DD5 A;  1VQP Q;  1ABQ A;  4HKE A;  2DX1 A;  5A0D A;  3CC4 Q;  3VS7 A;  4M78 C;  1NJI C;  4EIK A;  2EYX A;  3A8O B;  2O4X B;  2KGT A;  5LL6 S;  4JRP A;  2JXB A;  2LT4 A;  5GAN 4;  1GCQ A;  1H3H A;  3H0H A;  4BD3 A;  3S3O A;  2DPP B;  1VA7 A;  2D9T A;  5A0G A;  4E6R A;  1NG2 A;  1T3L A;  2JN0 A;  3BFM A;  2DAQ A;  4AFZ C;  1ZSZ A;  1R0B G;  1SHF A;  4LDW A;  2W0Z A;  1UEC A;  3OBY A;  1O9S A;  4A63 B;  1VQ9 A;  2DA9 A;  3AHU A;  4HCK A;  3I55 T;  2BIV A;  3QYG B;  4C5I A;  3OYK A;  2RI2 A;  3C12 A;  1UUE A;  3QYH B;  1G2B A;  4OB2 B;  4M78 G;  4M78 B;  2QDL A;  3PT9 A;  3M58 A;  2QEX Q;  4RTW A;  1WHM A;  4AMC A;  3VJP A;  1OZ2 A;  1SRL A;  4ZTF A;  4BDY A;  2VGN A;  4E7S A;  2F2X A;  1Q7Y R;  1RL2 A;  3TQ7 P;  1Y7X A;  4P5N A;  2GNC A;  5LJ5 g;  1J3T A;  3PVQ A;  3PTA A;  2QAS A;  1VQ6 T;  4D8K A;  4F7U F;  1WQ7 A;  2EGE A;  2EQI A;  3VS1 A;  4E47 A;  1Y96 B;  2AKK A;  2NWM A;  4WF2 A;  4L59 A;  3VS0 A;  4GLM A;  3CCU T;  1VQ9 T;  5GMK l;  1RUW A;  5LJ3 f;  3M57 A;  3MEA A;  2LVM A;  1HK9 A;  2GCX A;  2MYS A;  4XU2 A;  1YJW T;  2KQW A;  4KH0 B;  4BE0 A;  2CGH A;  2CZ7 B;  2RH2 A;  3MO8 A;  1BI1 A;  2EJ9 A;  3GPL A;  4BDZ A;  4X34 A;  4K11 A;  5CKF A;  1N9S A;  3UAT A;  1IRX A;  2A37 A;  1WYX A;  3LYI A;  1K9A A;  5GAM d;  3SEM A;  2YHT A;  3UA6 A;  3Q1J A;  2PZ1 A;  3OYY A;  1E6H A;  4M7A D;  5KH6 A;  1YJ9 Q;  3CD6 A;  3H9N A;  2DTO A;  2P0K A;  4FU6 A;  5DLO A;  3TVT A;  4EMH A;  4Y91 A;  3CCE A;  3ULR B;  1V76 A;  1YIT Q;  3P8D A;  3EFS A;  3CCJ A;  2M0O A;  4AFS C;  5HCK A;  4OML A;  2NUZ A;  4VUB A;  4JRI A;  1K4U S;  2JZ2 A;  4XK8 E;  1G3W A;  2RHY A;  3OS2 A;  1N27 A;  2DXC A;  3JB9 F;  4PJL A;  1NZ9 A;  4NS5 A;  1VQO Q;  5LJ3 j;  1D1B A;  1CKA A;  2CUD A;  1RAF B;  4LDV A;  3L2W A;  2K2M A;  2RI5 A;  5GAN e;  1ABO A;  1GXI E;  4FIB A;  1VQ8 A;  2DL3 A;  3RKW A;  2HMA A;  2KBT A;  3OYA A;  4RMO A;  2CP5 A;  4AFQ C;  4C8Q C;  3CD6 T;  1LCK A;  3LH5 A;  4N4I A;  2QAZ A;  3QG1 A;  1IO6 A;  1D09 B;  3CME A;  1ZLM A;  4HT8 A;  3CCE T;  1NJI U;  1MMN A;  2X9H A;  3L2U A;  3CCJ T;  1EIF A;  1RLQ C;  4KGV B;  4HA8 A;  5GAN d;  4AFU C;  3NMZ C;  1D1A A;  4EPC A;  2A28 A;  2HL3 A;  1X69 A;  3T9N A;  1AD5 A;  3CPW A;  2ZPG B;  2PVG B;  1ZA1 B;  4PJM A;  1TSF A;  2F2W A;  2DYI A;  4X9C A;  4B6M A;  4JUV A;  3H0I A;  3A5Z B;  2NUT A;  2RF0 A;  1WIE A;  4C8Q B;  2EYY A;  1XNI A;  2JS2 A;  2MCN A;  1RI9 A;  1UGS B;  1YI2 Q;  4ZN3 A;  2J05 A;  2PUK B;  4M77 C;  5GAM h;  1QVP A;  5D7U A;  2RQV A;  5FRN A;  2LJ1 A;  3ASK A;  3CME T;  1NEG A;  4RTZ A;  1SSF A;  1YP5 A;  2HL5 C;  2JTM A;  1IZ6 A;  3EGD A;  5FU7 C;  2AKL A;  3X20 B;  4RCC A;  2LCL A;  5GAO q;  5I2S A;  3DLL A;  2K6D A;  2OTJ A;  1I1J A;  2K9G A;  3OA6 A;  1I07 A;  3RKX A;  1VYU A;  1X01 A;  2C0I A;  4C0G A;  3OY9 A;  4J9C A;  1ZX6 A;  3FLG A;  1HSQ A;  1DJ7 B;  2Y4X A;  4M77 G;  5LJ5 f;  4X9D A;  2RJE A;  4M77 B;  4BUG A;  1QCF A;  3CCS Q;  1UJY A;  2GGR A;  3AT1 B;  3J81 E;  3OYI A;  5GJV B;  1SHG A;  3MEW A;  3V7C A;  5FU7 B;  3OSV A;  4C0D C;  3GLX A;  3LW5 E;  3NTK A;  4O6J A;  1W4S A;  2WSC E;  4JS4 A;  2OTJ T;  2X4W A;  3X25 B;  5LJ5 e;  1UDL A;  5GAN h;  3G4S A;  1VYV A;  1R0C B;  3HRT A;  4JLG A;  1GBR A;  3CC7 Q;  2FPF A;  3O5Z A;  1PC0 A;  1UGR B;  2K5I A;  3GOX A;  1YWO A;  1WA7 A;  2A0F B;  2L2P A;  4PFZ A;  3LWH A;  2M1H A;  2C0T A;  1MMA A;  2PVD B;  2XU8 A;  1HXD A;  4OMN A;  2HNI A;  2EQU A;  1I81 A;  2IIM A;  3L42 A;  3M0Q A;  3M54 A;  3QPH A;  1VIE A;  5KE3 A;  2DVJ A;  4Y28 E;  1OX8 A;  4M7D E;  2YUP A;  4ZNX A;  1RAC B;  4FT4 A;  1NBE B;  2YSQ A;  1KK7 A;  2O31 A;  2LJ3 A;  4M75 E;  1M3A A;  1AWJ A;  4DBQ A;  3G4S T;  4F7U A;  2E3H A;  1OU8 A;  3CCM T;  4N0A C;  2CSQ A;  4N4G A;  1NJI R;  2D6F A;  1QCN A;  3PIP A;  2GTO A;  3H8Z A;  2E64 A;  1VQ9 Q;  4BE1 A;  2FRY A;  2E10 A;  3MET A;  3JCM e;  3VYH B;  4A4E A;  1K8A U;  4PJO E;  1QQJ A;  3DKM A;  2E6N A;  5I11 A;  2H3J A;  3OW2 P;  2OI3 A;  5KYU B;  5IAY A;  4QQ6 A;  1WHL A;  2KDS A;  1G5V A;  2MOX A;  4M78 F;  1JQQ A;  3CPW S;  2K2V A;  3I35 A;  3JCM d;  1KSW A;  1N5Z A;  2NUP B;  1VQK A;  3C4S A;  1K1Z A;  4KRT A;  5J3B A;  2P0P A;  1M1F A;  3GP8 A;  3I9Q A;  3M55 A;  1SF9 A;  5GAN 5;  1Z9Q A;  1PWT A;  3D7S B;  4JJD A;  2DE0 X;  2MF2 A;  2QGG A;  4JZ3 A;  5GAO p;  2CZ6 B;  3CBP A;  3ZBD A;  4FYV B;  1G3S A;  2ZPH B;  2QQA A;  3WVD B;  2NUP A;  2PUO B;  4XAX B;  3A8M B;  1KD1 C;  2CYZ B;  1K9M C;  3HFN A;  1YHQ A;  3OYD A;  4HCB A;  3G6E A;  1CKB A;  1MV3 A;  5GAM g;  3SWN C;  1VQK T;  1OX9 A;  3EG2 A;  3CD6 Q;  4KT0 E;  1HYO A;  3HRU A;  1WJQ A;  4ZGE B;  1OPL A;  2HEQ A;  4BI4 A;  3CCE Q;  3OB9 A;  2J6O A;  1D0Y A;  3CCJ Q;  1VQ5 A;  3RKY A;  3EG3 A;  4IIO A;  3RDV A;  1TU0 B;  5HKC A;  4TVR A;  1G3Y A;  4JRQ A;  5EC7 A;  3DB3 A;  2DZ9 A;  4NOY A;  5KYX B;  3P8H A;  1QWE A;  2COY A;  3ME9 A;  1JO8 A;  2RI3 A;  1UGP B;  3S6W A;  1YI2 A;  2QQB A;  1YHQ T;  4RUG A;  1M5Q 1;  4ZN1 A;  4PK4 A;  2QTX A;  1KQS P;  2DTI A;  2CP3 A;  3EG9 A;  1UGQ B;  2DF6 A;  1VQ8 Q;  3FC3 A;  3WVE B;  2SEM A;  3SWN B;  3G6E T;  5HK3 A;  4OGC A;  3VU3 C;  3EFO A;  4MML A;  4LDY A;  1R8O B;  4BB7 A;  3L2R A;  5FRM A;  4C5H A;  1MMD A;  2JM9 A;  2L3S A;  1XTD A;  3JCM P;  3CME Q;  3JCM h;  1I5L A;  2FHD A;  2DL5 A;  4J6Y A;  1VQ5 T;  3EH2 A;  2DIQ A;  3MEV A;  1M27 C;  3UT1 A;  1RAG B;  2ENM A;  4L6V 5;  1E6G A;  5KCH A;  1BK2 A;  3TCJ A;  3VKI A;  5GMK j;  2O2O A;  1S1N A;  5GAN g;  2EVR A;  2E5Q A;  4AG1 C;  5GAO l;  1IHV A;  3INZ A;  3PFS A;  4QT7 A;  2YDL A;  3C0C A;  2O9S A;  4XTZ A;  2JT4 A;  5FU6 C;  2PTK A;  5IXB A;  3CCV A;  1MND A;  1QP2 A;  3UPU A;  2XIC A;  2E12 A;  2RMO A;  1K73 C;  5GAN 2;  5J39 A;  1WX6 A;  2EJG A;  4C92 D;  4C8Q F;  2FEI A;  2E41 A;  4II1 A;  1VQN A;  2MI6 A;  4J9H A;  4KUD K;  2AIR B;  4J9D A;  2E65 A;  2FZG B;  2XDD A;  4LXC A;  2RM4 A;  3OYC A;  1I4K 1;  4E7K A;  1NM7 A;  1WDX A;  2DD4 A;  2HCK A;  2XI9 A;  4QVZ A;  2DL4 A;  2DLP A;  2FRW A;  2M0Y A;  2O01 E;  4EDU A;  2LDM A;  2OTJ Q;  1BYM A;  5C0M A;  2BZY A;  1EX4 A;  2QK0 A;  1U1T A;  5FU6 B;  5GAN 3;  3I55 A;  3CCV T;  2ZPI B;  1KHC A;  1FMK A;  2YRC A;  2K79 A;  4LNP A;  1RAI B;  1YJN A;  1BB9 A;  4BI3 A;  1RAB B;  1GFC A;  4M7D C;  3GNF B;  3ZL7 C;  2DJQ A;  1FMW A;  2EWN A;  1ZUU A;  1M9S A;  1KD1 U;  1VQN T;  4M77 F;  1K9M U;  4GY5 A;  4MDW A;  4M75 C;  1JBM A;  1VQ6 A;  2LQN A;  2COZ A;  2Z0W A;  5DY9 A;  4GLK A;  4J9G A;  3OYF A;  2YXY A;  3QWX X;  4M7A E;  3MEU A;  2DRM A;  4BI8 B;  3RES A;  2O4X A;  3G4S Q;  1EFN A;  3CCU A;  4J9I A;  2ZPB B;  4BE2 A;  1YJW A;  1T0H A;  5IXF A;  3DB4 A;  3KUF A;  2AHJ B;  3OYM A;  4M7D G;  4PJO C;  2VXE A;  3M5A A;  1YJN T;  4M7D B;  1PSF A;  5GAM f;  1U06 A;  5CIU A;  1FX7 A;  1KG1 A;  4C5G A;  2JMA A;  4M75 G;  1X75 C;  2X35 A;  2DL7 A;  4M75 B;  1PKT A;  4ELY C;  3OW2 A;  3HFO A;  3I56 T;  3JCM W;  5HY6 A;  4FW1 A;  2DL8 A;  3N5B B;  3G7Z A;  3A8H B;  2OAW A;  3OS5 A;  2EGA A;  2RJC A;  3RMS A;  1VQ4 A;  5IN1 A;  4M78 A;  4E7H A;  2MWO A;  5GAM e;  3PMT A;  3EHR A;  4RTU A;  4RCB A;  1ZUY A;  5M9O A;  4OMO A;  2CP6 A;  4PJO G;  4PLL A;  4PJO B;  4R56 A;  2QQ9 A;  3URG A;  1ZSG A;  4E7I A;  5DLQ E;  3EHQ A;  4FYW B;  4F17 A;  2RHX A;  2YUQ A;  3GIB A;  1TOV A;  5FLX E;  3SHW A;  2FG0 A;  3FEO A;  1Y96 A;  2HBP A;  4OMM A;  3U23 A;  1P92 A;  1YCY A;  5CVI A;  3EG1 A;  5KCO A;  4DQ2 A;  1VQ4 T;  3EFR A;  3V7S A;  2OAU A;  1VQ7 A;  2HQE A;  5GAN f;  2RQT A;  1PRM C;  4KUL A;  1FXX A;  1QKW A;  3REA B;  1GL5 A;  1WLP B;  1K73 U;  3HP9 A;  1VQK Q;  2KEA A;  3E9G A;  1PM3 A;  3QDR B;  1AEY A;  3QHS A;  3VRZ A;  4J9F A;  2V8I A;  2FO0 A;  3JCM g;  1TS9 A;  2R58 A;  2XK0 A;  2E3I A;  2V8K A;  3JCM V;  2DBK A;  1H3Z A;  2XKO C;  1Q86 C;  4J7I A;  3TEE A;  1H64 1;  2DM1 A;  3JV3 A;  4BY6 C;  1IGQ A;  2LX7 A;  5L23 A;  3VRY A;  1NE8 A;  1YHQ Q;  1KQS A;  1PG5 B;  5KYY B;  1AOJ A;  2DXT A;  1YBY A;  2MPX C;  3OYL A;  1VQ7 T;  2D0Q B;  2L8D A;  4C92 G;  3G6E Q;  1JJ2 A;  3CXC A;  3QKJ A;  3MJX A;  3CPF A;  4L5G A;  2WSE E;  2Y4Y A;  2JMC A;  4OB0 B;  1UB4 A;  1C0M A;  2L89 A;  1KD1 R;  8AT1 B;  1D0X A;  2YT6 A;  1K9M R;  5GAN j;  1SPK A;  2HZY A;  1K8A C;  2ZAE A;  3HKS A;  2D1X A;  3JB9 D;  1HJD A;  1VQ5 Q;  3X26 B;  4BY6 B;  4PL6 A;  2K4Y A;  1VQM T;  2COW A;  3JCM c;  2RQR A;  2XD0 A;  2RHI A;  1QVG A;  7AT1 B;  3EAE A;  4HCZ A;  3I5R A;  4E7J A;  2NYS A;  2XID A;  2X4Y A;  5KE2 A;  3OQ5 A;  2KAF A;  4OGE A;  5GMK m;  3VUB A;  5KYW B;  4J5Y A;  1TWB A;  3THK A;  5L8R E;  4PJJ A;  3GF5 A;  2HAX A;  5GAN 6;  2DFU A;  4C5E A;  4C8Q A;  2M51 A;  1TUG B;  2BKD N;  1Q81 C;  3QII A;  3SB2 A;  3OS0 A;  3QBY A;  3NTH A;  2A08 A;  2QYZ A;  3A8G B;  4Q5W A;  2FL7 A;  1WHK A;  1QVF A;  2P0Q A;  1JU5 C;  3VS6 A;  3OW2 S;  4J83 A;  1B07 A;  2X3X D;  1Q82 C;  3JAM E;  2CT4 A;  2RK2 A;  3LX7 A;  2VGM A;  2JVV A;  2LC4 A;  1BIA A;  2RD1 A;  2ZZD A;  3FIF A;  6AT1 B;  5IH2 A;  3CCV Q;  2A36 A;  3OYN A;  1EZZ B;  1ZA2 B;  4D6W A;  1YN8 A;  4NL3 A;  4MZM A;  4CI0 C;  2LX9 A;  4IUT A;  2DNU A;  2QA4 A;  1M90 C;  4M77 A;  1VQN Q;  5GJW B;  5CK9 A;  1BI3 A;  3V8K A;  1UHC A;  1AZG B;  2PQW A;  3A8L B;  1X6B A;  3TRE A;  5CAI A;  4M7A C;  5GAN 8;  3I5S A;  1ZBX A;  3CCM A;  4R55 A;  4GBQ A;  2CRE A;  4YTL A;  2LZ6 B;  1K73 R;  3RNJ A;  1X43 A;  1OPK A;  4A4G A;  1XQH A;  1K76 A;  3FB9 A;  3BDL A;  3I55 Q;  2ROT A;  4DA4 A;  3RUX A;  1MUZ A;  1Q86 U;  2C0O A;  3CBO A;  3RIR A;  5LJ5 j;  2RNA A;  1YJN Q;  2K5L A;  2GFA A;  1MHN A;  3OS1 A;  2HSP A;  4ZTJ A;  2F69 A;  2QA4 T;  3OYG A;  4DBF A;  4Z89 A;  4M7A G;  4FW2 A;  4LUD A;  3JCM f;  4M7A B;  3VUZ A;  3DLM A;  1VQL A;  2FPE A;  4C0Z A;  3CCQ A;  4Z8A A;  1AWO A;  1VQ6 Q;  2CT3 A;  2VV5 A;  2VUB A;  2E6Z A;  1Q95 G;  3JSC A;  3SD4 A;  2GF7 A;  2E1H A;  1U5S A;  2QQS A;  2LMJ A;  3CMA A;  1SEM A;  1Z9Z A;  3CCU Q;  1KQS S;  4AG2 C;  1BU1 A;  1KQ2 A;  1YJW Q;  1C1A A;  1OUL A;  1TG0 A;  2ZPF B;  2JUF A;  2BTT A;  2WSF E;  1JJ2 S;  2LNV A;  3CXC S;  1KIK A;  5ECA A;  2L3P A;  4JRK A;  1WQW A;  1JB0 E;  2CH4 W;  1TUD A;  2G6F X;  3MPU B;  4UC4 A;  2KYB A;  4IIM A;  2MIO A;  5CR2 A;  4M7D F;  1Y0M A;  1VQL T;  4DOW A;  4Z88 A;  3J80 E;  3CCQ T;  2EIF A;  4A53 A;  4J6X A;  2EQJ A;  1PCX A;  4M75 F;  4NL2 A;  4CC2 A;  2RK1 A;  2PU9 B;  3H0F A;  3TSZ A;  1VQ4 Q;  2GFU A;  1QVG S;  5AYF A;  5KYU A;  1KQ1 A;  4MMK A;  1IHW A;  3CMA T;  4RTX A;  1Q81 U;  4JS5 A;  3KXT A;  1N6A A;  1BI0 A;  1H92 A;  2VC8 A;  2QI2 A;  1G3T A;  4N0A A;  1SSH A;  2Y90 A;  4PJO F;  1NEB A;  2JS0 A;  1Q82 U;  2DMO A;  3OBW A;  2D8H A;  4IUU A;  4N4H A;  4B9X A;  1NPP A;  2HSE B;  4M78 D;  5IT9 E;  3M0T A;  4Z02 A;  4LE9 A;  2MWP A;  3RMQ A;  2CS7 A;  4IUQ A;  2DEU A;  1QW1 A;  3EGX B;  2DJZ A;  3JRZ A;  1QVF S;  4PLI A;  3HTR A;  3S3M A;  3C94 A;  5CKH A;  2C06 A;  1VQ7 Q;  1GFD A;  5AT1 B;  2CP0 A;  4DOV A;  4C92 E;  1RAH B;  4PNO A;  1M90 U;  4LUE A;  1M2V B;  2EAY A;  4EMK C;  2LCC A;  1FMV A;  2ROL A;  2CP2 A;  1NYG A;  2XDP A;  3M0P A;  2JTF A;  1X6O A;  2YLB A;  1I5O B;  1LJO A;  2X4J A;  1JXO A;  2MMP A;  4JJB A;  4CRI A;  2LTO A;  2K3Y A;  3LGF A;  2EW3 A;  1W70 A;  4RG2 A;  1M2V A;  2RO0 A;  2IVW A;  1JJ2 P;  1WI7 A;  3CXC P;  2X3W D;  3P8B B;  3QUI A;  2XDB A;  5KYX A;  2F5T X;  4RG8 A;  1BI2 A;  5IHN A;  1PD1 A;  2CH4 A;  2X4X A;  1D1C A;  2CKK A;  5GMK e;  1Q86 R;  2DER A;  3QO3 A;  2DYB A;  2HQX A;  2GQI A;  3PVL A;  3V8J A;  2DBM A;  3G71 A;  4QW2 A;  1M1G A;  4EMK B;  4HCC A;  3G1J A;  2EFI A;  3JCM Q;  1IXD A;  3SWN A;  4HXJ A;  1PRL C;  1QKX A;  3QDF A;  2JTE A;  1QVG P;  3UDC A;  2EYQ A;  1IRE B;  2RN8 A;  4E7Z A;  3OYE A;  1YWP A;  4HVV A;  1OEB A;  3OYB A;  2V1Q A;  2NLU A;  3V7R A;  5C6S A;  1G83 A;  5GAN 7;  3OYH A;  1YIJ A;  1W2B P;  3CQT A;  2QG9 B;  3VS4 A;  2JJ9 A;  1K8A R;  2H3E B;  4ATO A;  1GCQ C;  1M30 A;  2EYW A;  2H8H A;  1RAD B;  3G71 T;  3H6Z A;  1NPR A;  1M1K C;  4WCI A;  1M4Z A;  1T3S A;  4RKU E;  5DM7 R;  1AT1 B;  4LD9 K;  2DVE A;  2G3R A;  2LQW A;  1ZSZ C;  1QVF P;  2HBW A;  1LVK A;  1ARK A;  3HPW A;  1U1S A;  2ED1 A;  4FCY A;  2DXU A;  4FL6 A;  4IKF A;  2OTL A;  3EG0 A;  2KI7 A;  3E9F A;  4OMP A;  1JXM A;  2LNH B;  2RPN A;  3CCL A;  1X2Q A;  3VS3 A;  2D0N A;  1PHT A;  4QVC A;  4EMG A;  4F14 A;  1YIJ T;  1Q81 R;  4XU3 A;  2EJF A;  4XU0 A;  4C8Q D;  1FYN A;  3OYJ A;  3CCS T;  3I56 A;  3X28 B;  1WZO A;  3A1P A;  1OOT A;  1RAE B;  2R57 A;  4IUP A;  1ZSZ B;  2F1L A;  2JM8 A;  2YUO A;  2L3Q A;  2QA4 Q;  1Q82 R;  3BY7 A;  3H41 A;  1PD0 A;  1VUB A;  2KE9 A;  2KK4 A;  2ZGW A;  4JJC A;  2ABL A;  4CC3 A;  4OP0 A;  4F7U E;  9ATC B;  1AVZ C;  3RBB B;  2BE7 D;  5CKE A;  3M0U A;  3CCM Q;  4RTV A;  1BKB A;  2DET A;  2OTL T;  4HT9 A;  3CC7 T;  1JRI A;  5IHI A;  1AWX A;  3CCL T;  1HD3 A;  4HVU A;  2EGC A;  2E5K A;  3NTI A;  5CO7 A;  5GMK h;  2EQM A;  3M53 A;  3IQL A;  3MP1 A;  1M90 R;  2F2V A;  4XTX A;  2XMF A;  1UEB A;  3HRS A;  3JB9 I;  5KYN A;  5FW9 A;  4OMQ A;  3QXE B;  3BDU A;  4M77 D;  2KRO A;  4XQ3 A;  1LOJ A;  2LT1 A;  8ATC B;  5GAO m;  1PNJ A;  3MCA B;  1NLP C;  2E4H A;  1YNZ A;  4ZGJ B;  4M7D A;  2KMT A;  1GBQ A;  1TXQ A;  2A7Y A;  1VQL Q;  5D6Y A;  1K0X A;  2YWW A;  3CCQ Q;  1U8R A;  2K7A A;  3X24 B;  3HHT B;  3MHX A;  4M75 A;  2HKQ B;  5CKB A;  4M7A F;  2FZK B;  2RQU A;  4DEY A;  4PFO A;  1QLY A;  3CMA Q;  2P84 A;  1VOM A;  3OSS C;  3UA7 A;  4DBH A;  3NGP A;  2GTJ A;  2ESW A;  3JB9 H;  4KBM B;  3FRN A;  3PGG A;  2KRN A;  1WJR A;  5GAM j;  4CC4 B;  1S72 A;  1X27 A;  4PJO A;  1F1B B;  2DEQ A;  2RJF A;  4ORZ A;  1AWW A;  3OMC A;  5A2Q E;  3L2Z A;  1WHJ A;  2LCS A;  3CC2 A;  2P4R A;  3S3N A;  3CCR A;  2JOY A;  1B7T A;  4C92 C;  5LJ3 e;  4KGX B;  2J6K A;  2VKN A;  1XJW B;  1VIF A;  4LN2 A;  2FVU A;  2PNI A;  4XTV A;  1M1K U;  3KBG A;  1KC8 C;  1W1F A;  3FJP A;  2L3R A;  2KXD A;  2QGF B;  4DBR A;  1VQM A;  4FM4 B;  2J6F A;  2KYM A;  1ZUK A;  1C6V X;  1BCM A;  1FWZ A;  5LJ3 d;  1TUC A;  1ZHI A;  4RTT A;  1S72 T;  1WXB A;  4LDX A;  1SRM A;  2EYZ A;  4ELZ C;  2FB7 A;  4D8D A;  1SG5 A;  5FRO A;  4A4K A;  3E1S A;  3CC2 T;  4QVD A;  4C92 B;  2CSI A;  3CCR T;  1AZE A;  4XU1 A;  1M2O A;  5J26 A;  1V1C A;  1MMG A;  5HK0 A;  4OVA A;  2QDY B;  2K3X A;  2CZ1 B;  4E2F B;  4JPB W;  2R5M A;  3V8L A;  3M0R A;  1UHF A;  2B86 A;  5KYY A;  4PFP A;  1MNE A;  4AT1 B;  3BE3 A;  2NUT B;  4JDS A;  2M02 A;  2RHU A;  5FWC A;  4C92 A;  1PSE A;  3EGU A;  3O8V A;  1QWF A;  1W6X A;  1WGS A;  2HKN A;  4LD6 A;  1ACM B;  2LQ8 A;  1O75 A;  1H8K A;  4FYX B;  2I0N A;  4MZT A;  4FSX A;  4JJN K;  2ZCF B;  4XTY A;  1VYT A;  3EGD B;  3R6N A;  5D6W A;  1W2B A;  2D8J A;  4C8Q G;  1VQ8 T;  2EKO A;  3J7A F;  1MGQ A;  2RHZ A;  3REB B;  4OB3 B;  1UTI A;  1D3B B;  1B3Q A;  2VB6 A;  2KRS A;  3M9Q A;  2EKH A;  1JEG A;  3G71 Q;  4F16 A;  1N8R C;  3JB9 J;  5KYW A;  4BAC A;  4E7L A;  2X51 A;  1WXU A;  2LRQ A;  2KNB B;  4Y92 A;  4LDU A;  1UE9 A;  2I2L A;  4FSS A;  1D3B A;  4M4Z A;  1BIB A;  2VYT A;  2KSS A;  2VWF A;  4IUV A;  4F04 B;  5LJ3 h;  1LNX A;  2DO3 A;  2DZC A;  2QQR A;  2HDA A;  2EBP A;  1I0C A;  1YIJ Q;  3VYG A;  1VQP A;  4XTW A;  1M3B A;  3CC4 A;  2M9U A;  2LP5 A;  2F5K A;  2LJ0 A;  1Y57 A;  2JNG A;  3CBM A;  1UG1 A;  5I21 A;  3R6O A;  4KUI A;  3VV0 A;  3WXM B;  2XG8 D;  3SDZ A;  4DEX A;  5I22 A;  3A98 A;  1K0S A;  5EG2 A;  3VS2 A;  1OV3 A;  2FYK A;  1E7O A;  2GBQ A;  4HVW A;  3L2V A;  1A0N B;  1BBZ A;  2SRC A;  1Q7Y C;  1RI0 A;  1KC8 U;  2OTL Q;  2KVQ G;  3ER0 A;  1X2K A;  1M1K R;  2VXF A;  3CCL Q;  1WNL A;  2K57 A;  1X6G A;  2DTH A;  1QCO A;  2B8A A;  2BZX A;  1RAA B;  2DIG A;  3QJ6 A;  1VQP T;  3CC4 T;  2QEX A;  4FYY B;  2CZ0 B;  5LJ5 d;  1RLP C;  4F7U G;  3I56 Q;  4F7U B;  2DRK A;  5A0L A;  3QZ9 B;  4C0D B;  3M59 A;  2JW4 A;  1YCS B;  4M78 E;  1MV0 B;  4KGZ B;  2BUD A;  4WTO B;  4J6W A;  1N9R A;  1M8M A;  1TTH B;  4JZ4 A;  4QQD A;  2KY9 A;  1SKU B;  2IG0 A;  1QMC A;  2PVO B;  4M7A A;  2ATC B;  1ZBJ A;  4R0K A;  1KHI A;  3QZ5 B;  4ANJ A;  2HD0 A;  3JCM b;  4JLI A;  3NHN A;  3PE0 A;  3LGL A;  3M0S A;  2L0A A; 
#chains in the Genus database with same CATH homology
 5IN1 A;  4M78 A;  4M77 C;  5GAM h;  1QVP A;  2L5Q A;  3ZFJ A;  4E7H A;  2MWO A;  2QEX T;  3UDC A;  5FRN A;  4V2S A;  2EYQ A;  1IRE B;  3OYE A;  5GAM e;  3ASK A;  2K5F A;  3CME T;  3PMT A;  1SSF A;  4RCB A;  3BW1 A;  2WAC A;  4OMF B;  1ZQ1 A;  2JTM A;  5M9O A;  3OYB A;  3TU4 K;  1IZ6 A;  4PJO G;  2NLU A;  4PLL A;  3V7R A;  5C6S A;  5FU7 C;  4PJO B;  3X20 B;  4R56 A;  2A3L A;  1OYX A;  4RCC A;  2QQ9 A;  2GQV A;  5GAN 7;  2LCL A;  3URG A;  5GAO q;  5I2S A;  3OYH A;  3DLL A;  1YIJ A;  1YJ9 A;  3QSU A;  1AHJ B;  3NFC A;  4J8O A;  5DLQ E;  4E7I A;  2OTJ A;  3OA6 A;  2RHX A;  4ATO A;  1WPY A;  3GIB A;  3RKX A;  5FLX E;  4MZP A;  1X01 A;  3JCM X;  3FEO A;  1Y96 A;  1YIT A;  3G71 T;  3H6Z A;  4C0G A;  2HBP A;  3OY9 A;  1NPR A;  3JB9 G;  1M1K C;  3FLG A;  1P92 A;  1YCY A;  3C95 A;  1M4Z A;  4RKU E;  5CQY A;  5DM7 R;  1DJ7 B;  2Y4X A;  5GAO r;  1N8R U;  4LD9 K;  2DVE A;  5CVI A;  1W2B S;  2G3R A;  4M77 G;  5KCO A;  4X9D A;  2RJE A;  4M77 B;  5LJ5 f;  4BUG A;  4DQ2 A;  2P4T A;  1VQ4 T;  3EFR A;  2M16 A;  2YLC A;  4A4F A;  3V7S A;  2OAU A;  1VQ7 A;  3HPW A;  2HQE A;  1U1S A;  4J7F A;  5GAN f;  1VQO A;  4KUL A;  1FXX A;  1M8V A;  3SFM A;  2DXU A;  1K73 U;  3J81 E;  3OYI A;  3L2Q A;  4M7D D;  1Y07 A;  4FL6 A;  3MEW A;  3HP9 A;  4IKF A;  3V7C A;  2OTL A;  5FU7 B;  3OSV A;  3E9F A;  3E9G A;  3GLX A;  3QDR B;  4C0D C;  3LW5 E;  3QHS A;  2DK3 A;  3NTK A;  5CQX A;  3CCL A;  2V8I A;  4O6J A;  4A54 A;  1W4S A;  2R58 A;  2XK0 A;  3JCM g;  2WSC E;  4QVC A;  4EMG A;  4M75 D;  5LJ5 h;  1YIJ T;  3PMI A;  2V8K A;  4JS4 A;  1OZ3 A;  3JCM V;  1YJ9 T;  4XU3 A;  2OTJ T;  2EJF A;  4XU0 A;  2R5A A;  2X4W A;  1H3Z A;  3X25 B;  5LJ5 e;  2XKO C;  1Q86 C;  4J7I A;  3TEE A;  1H64 1;  5GAN h;  3G4S A;  4C8Q D;  3OYJ A;  3HRT A;  3CCS T;  3HSB A;  3I56 A;  4JLG A;  3X28 B;  1YIT T;  4BY6 C;  1B34 B;  3GOX A;  2K5I A;  1UGR B;  5D6X A;  2R57 A;  4IUP A;  3M4Y A;  4FT2 A;  1NE8 A;  4ZGD B;  3MP6 A;  3LWH A;  1KQS A;  3BY7 A;  2M1H A;  3UWN A;  1VUB A;  2DXT A;  2PVD B;  4PKC C;  2ZGW A;  1YBY A;  2KK4 A;  2XU8 A;  3OYL A;  1HXD A;  1VQ7 T;  4OP0 A;  4F7U E;  4A4H A;  2HNI A;  2D0Q B;  1XOV A;  2EQU A;  2L8D A;  1VQO T;  1V29 B;  4OB1 B;  4PJO D;  1I81 A;  3L42 A;  4C92 G;  3GNG A;  1JJ2 A;  3CXC A;  3M54 A;  3QPH A;  1VIE A;  5CKE A;  3QKJ A;  5KE3 A;  1BKB A;  3CPF A;  4L5G A;  2RB6 A;  2WSE E;  2Y4Y A;  4Y28 E;  1B34 A;  2OTL T;  3CC7 T;  1JRI A;  4HT9 A;  4M7D E;  4OB0 B;  3CCL T;  1UB4 A;  2YRV A;  4FT4 A;  1Q7Y U;  2DKG A;  2L89 A;  5CKD A;  3NTI A;  3CEY A;  3LWI A;  5CO7 A;  5LJ3 g;  5GMK h;  5GAN j;  2EQM A;  3M53 A;  1K8A C;  3MP1 A;  3HKS A;  4XTX A;  4M75 E;  3JB9 D;  2EQK A;  1UEB A;  3HRS A;  3X26 B;  3JB9 I;  3G4S T;  4B9W A;  4C0F A;  4BY6 B;  3OMG A;  4PL6 A;  2K4Y A;  1VQM T;  3QXE B;  3BDU A;  3HL8 A;  3MP8 A;  1QP3 A;  3E19 A;  4M77 D;  4C8Q E;  1WJS A;  4F7U A;  3JCM c;  4XQ3 A;  5CCA A;  1LOJ A;  2LT1 A;  2XD0 A;  3PIO A;  3CCM T;  2RHI A;  1QVG A;  4N0A C;  5GAO m;  1OI1 A;  3EAE A;  3RMS A;  4HCZ A;  4E7J A;  4C92 F;  2XID A;  3MCA B;  4N4G A;  2X4Y A;  4ZGJ B;  5KE2 A;  4M7D A;  3OQ5 A;  2KAF A;  2D6F A;  3M4G A;  4OGE A;  2KMT A;  3PIP A;  3H8Z A;  2E64 A;  2A7Y A;  5GMK m;  4BE1 A;  5D6Y A;  3VUB A;  2E10 A;  4OF1 A;  1U8R A;  3X24 B;  3MET A;  3HHT B;  4J5Y A;  3MHX A;  3JCM e;  4M75 A;  1Y71 A;  3VYH B;  4A4E A;  1K8A U;  3RER A;  4PJO E;  2V8J A;  3LLR A;  4MDX A;  4EMK A;  2LQK A;  3DKM A;  2E6N A;  5CKB A;  4M7A F;  2RJD A;  5L8R E;  2H3J A;  3GF5 A;  5GAN 6;  2HAX A;  2RA2 A;  4C5E A;  4C8Q A;  4QQ6 A;  1I8F A;  5IAY A;  2KDS A;  2BKD N;  1Q81 C;  1G5V A;  1YI2 T;  3QII A;  3ZEH A;  3LH0 A;  3SB2 A;  3OS0 A;  3OSS C;  4M78 F;  3CPW S;  3QBY A;  3QJY A;  3CCS A;  2K2V A;  3NTH A;  2E70 A;  3A8G B;  4Q5W A;  2FL7 A;  3JB9 H;  4O5V A;  4KBM B;  3JCM d;  3M56 A;  1QVF A;  2P0Q A;  3FRN A;  1VQK A;  3C4S A;  3OW2 S;  2QXF A;  4J83 A;  3PGG A;  5J3B A;  2P0P A;  4M77 E;  1WJR A;  5GAM j;  1Q82 C;  1M1F A;  3JAM E;  1S72 A;  4PJO A;  3GP8 A;  4ME7 A;  3M55 A;  2MAM A;  5GAN 5;  2DEQ A;  2RJF A;  2RK2 A;  3LX7 A;  2VGM A;  2JVV A;  3OMC A;  4XTU A;  2LC4 A;  5A2Q E;  1BIA A;  4QQG A;  2MF2 A;  2RD1 A;  2ZZD A;  3FIF A;  3L2Z A;  3CC2 A;  3F70 A;  5GAO p;  2CZ6 B;  3CBP A;  3OYN A;  3FDR A;  3S3N A;  4D6W A;  3CCR A;  3ZBD A;  2ZPE B;  2JOY A;  4C92 C;  4NL3 A;  5LJ3 e;  3CC7 A;  3PNW C;  1G3S A;  2ZPH B;  4MZM A;  5I2M A;  2QQA A;  1VIF A;  4CI0 C;  2FVU A;  3WVD B;  3L1A A;  2PUO B;  2LX9 A;  4IUT A;  4XAX B;  3A8M B;  1KD1 C;  2CYZ B;  2XHC A;  4XTV A;  2QA4 A;  1K9M C;  3HFN A;  1M1K U;  4IUR A;  1YHQ A;  3KBG A;  1KC8 C;  1M90 C;  2DXB A;  4M77 A;  5CK9 A;  3FJP A;  1TH7 A;  1BI3 A;  2L3R A;  3V8K A;  3OYD A;  2PQW A;  3A8L B;  3JCM J;  5GAO n;  3TRE A;  4HCB A;  5CAI A;  4M7A C;  5GAN 8;  5GMK i;  1VQM A;  4FM4 B;  3G6E A;  1ZBX A;  5GAM g;  3CCM A;  3SWN C;  1FWZ A;  1VQK T;  5LJ3 d;  4R55 A;  1ZHI A;  2DD5 A;  4KT0 E;  4HKE A;  5A0D A;  1S72 T;  4M78 C;  1NJI C;  4YTL A;  4LDX A;  4ELZ C;  3A8O B;  2O4X B;  3HRU A;  1WJQ A;  2FB7 A;  4ZGE B;  4BI4 A;  5LL6 S;  4JRP A;  3OB9 A;  2LT4 A;  5GAN 4;  1VQ5 A;  5FRO A;  3RKY A;  1XQH A;  4A4G A;  3FB9 A;  3BDL A;  4A4K A;  3E1S A;  5HKC A;  4TVR A;  1G3Y A;  4QVD A;  4JRQ A;  3CC2 T;  4DA4 A;  4BD3 A;  4C92 B;  3S3O A;  2DPP B;  3RUX A;  3CCR T;  1Q86 U;  4XU1 A;  2D9T A;  3CBO A;  3RIR A;  5A0G A;  5J26 A;  5LJ5 j;  3DB3 A;  2DZ9 A;  2K5L A;  2JN0 A;  2GFA A;  3BFM A;  4NOY A;  1MHN A;  5HK0 A;  3OS1 A;  4OVA A;  2DAQ A;  2QDY B;  3P8H A;  2K3X A;  2CZ1 B;  3ME9 A;  2RI3 A;  4ZTJ A;  1UGP B;  3S6W A;  2R5M A;  2F69 A;  1YI2 A;  3V8L A;  2QA4 T;  3OYG A;  2QQB A;  1YHQ T;  1M5Q 1;  4LDW A;  4ZN1 A;  4M7A G;  3OBY A;  1O9S A;  3JCM f;  4M7A B;  3VUZ A;  3DLM A;  1VQ9 A;  2QTX A;  1VQL A;  4C0Z A;  2DTI A;  3CCQ A;  3AHU A;  1UGQ B;  4JDS A;  2RHU A;  3I55 T;  2BIV A;  3QYG B;  3SWN B;  3WVE B;  4C5I A;  5HK3 A;  2RI2 A;  3OYK A;  3G6E T;  2VV5 A;  2VUB A;  4OGC A;  3C12 A;  4C92 A;  2E6Z A;  3QYH B;  4OB2 B;  4M78 G;  1PSE A;  3VU3 C;  3JSC A;  3O8V A;  4M78 B;  4MML A;  4LDY A;  3SD4 A;  1R8O B;  3M58 A;  1WGS A;  2GF7 A;  3PT9 A;  2E1H A;  4BB7 A;  4C5H A;  3L2R A;  5FRM A;  4LD6 A;  2QQS A;  1XTD A;  3JCM P;  2LQ8 A;  1O75 A;  3CMA A;  1KQS S;  3VJP A;  1OZ2 A;  4ZTF A;  4BDY A;  3JCM h;  1I5L A;  2FHD A;  2VGN A;  4MZT A;  4J6Y A;  1KQ2 A;  4FSX A;  4JJN K;  2ZCF B;  1VQ5 T;  4XTY A;  2DIQ A;  3MEV A;  2ZPF B;  1RL2 A;  5D6W A;  1Y7X A;  2JUF A;  4P5N A;  3UT1 A;  5LJ5 g;  1W2B A;  3PTA A;  4C8Q G;  1VQ8 T;  2EKO A;  2WSF E;  1VQ6 T;  4L6V 5;  1JJ2 S;  1MGQ A;  2RHZ A;  5KCH A;  3J7A F;  2LNV A;  3CXC S;  4OB3 B;  3TCJ A;  3VKI A;  5GMK j;  1D3B B;  4F7U F;  1WQ7 A;  5GAN g;  4JRK A;  1WQW A;  1JB0 E;  2E5Q A;  5GAO l;  3M9Q A;  3INZ A;  4E47 A;  3PFS A;  4UC4 A;  1Y96 B;  4WF2 A;  4L59 A;  5CR2 A;  4M7D F;  1N8R C;  3CCU T;  1VQ9 T;  5GMK l;  4XTZ A;  1VQL T;  5LJ3 f;  5FU6 C;  3M57 A;  3JB9 J;  4BAC A;  3MEA A;  4DOW A;  2LVM A;  3J80 E;  3CCQ T;  3CCV A;  1HK9 A;  2EIF A;  2GCX A;  4XU2 A;  4E7L A;  2LRQ A;  1YJW T;  2KQW A;  4A53 A;  4J6X A;  1QP2 A;  2EQJ A;  4BE0 A;  4NL2 A;  4M75 F;  4LDU A;  2RK1 A;  3UPU A;  2CGH A;  2I2L A;  2CZ7 B;  2PU9 B;  2RH2 A;  2XIC A;  1BI1 A;  2E12 A;  2EJ9 A;  3MO8 A;  3GPL A;  1D3B A;  2GFU A;  1QVG S;  5AYF A;  5GAN 2;  1K73 C;  4BDZ A;  1KQ1 A;  4X34 A;  1BIB A;  5J39 A;  5CKF A;  2EJG A;  4C92 D;  1N9S A;  4MMK A;  2VYT A;  2E41 A;  4II1 A;  4C8Q F;  2KSS A;  3CMA T;  1VQN A;  2MI6 A;  3LYI A;  4KUD K;  5GAM d;  4IUV A;  2E65 A;  1Q81 U;  5LJ3 h;  2XDD A;  4JS5 A;  1LNX A;  2RM4 A;  3KXT A;  1N6A A;  1I4K 1;  2DO3 A;  1BI0 A;  2YHT A;  3OYC A;  4E7K A;  2DD4 A;  2DZC A;  2QI2 A;  2QQR A;  2VC8 A;  2XI9 A;  4QVZ A;  1G3T A;  3Q1J A;  2O01 E;  4N0A A;  3VYG A;  3OYY A;  4EDU A;  4M7A D;  5KH6 A;  1VQP A;  2LDM A;  2Y90 A;  3CD6 A;  4XTW A;  2DTO A;  3CC4 A;  1BYM A;  2M9U A;  2P0K A;  5C0M A;  4FU6 A;  5DLO A;  4PJO F;  4EMH A;  2F5K A;  4Y91 A;  3CCE A;  1Q82 U;  2JNG A;  1U1T A;  3CBM A;  3OBW A;  5FU6 B;  4IUU A;  4N4H A;  4B9X A;  3P8D A;  1NPP A;  5GAN 3;  3EFS A;  5I21 A;  3CCJ A;  2M0O A;  3R6O A;  4M78 D;  5IT9 E;  4KUI A;  3I55 A;  3VV0 A;  4Z02 A;  3CCV T;  2MWP A;  2ZPI B;  2CS7 A;  4JRI A;  4VUB A;  2XG8 D;  1KHC A;  3RMQ A;  4IUQ A;  2JZ2 A;  3SDZ A;  3WXM B;  1QW1 A;  2DJZ A;  3JRZ A;  4XK8 E;  1YJN A;  4BI3 A;  1QVF S;  3FC3 A;  1G3W A;  5EG2 A;  2RHY A;  4PLI A;  3OS2 A;  4M7D C;  3GNF B;  1N27 A;  2FYK A;  3S3M A;  3C94 A;  2DXC A;  5CKH A;  3JB9 F;  2C06 A;  1NZ9 A;  2EWN A;  4NS5 A;  3L2V A;  5LJ3 j;  1M9S A;  1KD1 U;  1VQN T;  4DOV A;  4LDV A;  4M77 F;  4C92 E;  1K9M U;  4GY5 A;  4MDW A;  1Q7Y C;  4PNO A;  1RI0 A;  1JBM A;  4M75 C;  3L2W A;  1KC8 U;  1M90 U;  2KVQ G;  2RI5 A;  2EAY A;  3ER0 A;  4FIB A;  2LCC A;  4EMK C;  5GAN e;  1GXI E;  1VQ8 A;  3RKW A;  1VQ6 A;  2VXF A;  3OYA A;  4RMO A;  1WNL A;  5DY9 A;  2K57 A;  4C8Q C;  2DTH A;  2XDP A;  2B8A A;  4GLK A;  2JTF A;  2DIG A;  1X6O A;  3QJ6 A;  3OYF A;  1VQP T;  3CD6 T;  2YLB A;  1LJO A;  2X4J A;  3CC4 T;  2QEX A;  4M7A E;  3MEU A;  4N4I A;  4BI8 B;  2MMP A;  3QG1 A;  2CZ0 B;  3RES A;  2O4X A;  5LJ5 d;  3CME A;  4HT8 A;  3CCE T;  3CCU A;  4CRI A;  4F7U G;  2LTO A;  2K3Y A;  1NJI U;  3L2U A;  3LGF A;  4F7U B;  3CCJ T;  1EIF A;  5A0L A;  2ZPB B;  3QZ9 B;  4BE2 A;  4HA8 A;  1YJW A;  4C0D B;  5GAN d;  3DB4 A;  3M59 A;  4RG2 A;  4M78 E;  3KUF A;  2AHJ B;  2BUD A;  4J6W A;  2RO0 A;  3OYM A;  2IVW A;  1N9R A;  2VXE A;  4EPC A;  4M7D G;  4PJO C;  3M5A A;  1YJN T;  4M7D B;  3T9N A;  3P8B B;  3QUI A;  1PSF A;  5GAM f;  2XDB A;  2F5T X;  3CPW A;  4RG8 A;  2ZPG B;  1BI2 A;  5CIU A;  1FX7 A;  2PVG B;  4C5G A;  2KY9 A;  4QQD A;  2X4X A;  1KG1 A;  2CKK A;  5GMK e;  4M75 G;  1X75 C;  2X35 A;  2IG0 A;  2HQX A;  3QO3 A;  4M75 B;  3V8J A;  4ELY C;  3OW2 A;  3G71 A;  2PVO B;  4QW2 A;  3HFO A;  4M7A A;  1M1G A;  4EMK B;  4HCC A;  3I56 T;  4X9C A;  4JUV A;  3JCM W;  5HY6 A;  2EFI A;  3JCM Q;  3A5Z B;  1KHI A;  3SWN A;  4C8Q B;  3N5B B;  3QZ5 B;  1XNI A;  3G7Z A;  2HD0 A;  3JCM b;  3A8H B;  4JLI A;  1UGS B;  3OS5 A;  4ZN3 A;  3LGL A;  2RJC A;  2PUK B;  1VQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...