1JBMA

Heptameric crystal structure of mth649, an sm-like archaeal protein from methanobacterium thermautotrophicum
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
78
structure length
78
Chain Sequence
VNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics
molecule keywords PUTATIVE SNRNP SM-LIKE PROTEIN
publication title The oligomerization and ligand-binding properties of Sm-like archaeal proteins (SmAPs)
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 14
structure length 78
sequence length 78
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2001-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1jbmA00
5GAOn 5GAMg 3JCMW 4XTWA 2EJGA 4EMHA 4F7UE 3V8KA 3V8LA 3FJPA 4C8QC 3RKYA 4M77A 4JRKA 3V7CA 4M78E 4M75G 4X9CA 4C92C 4QVDA 2DXUA 4NOYA 2RM4A 2DKGA 3SWNC 4F7UA 3JB9G 4HT8A 4XU2A 5GAMf 3JCMe 1BIBA 4HT9A 4M75E 5LJ5e 4PJOE 2DZCA 5GANj 2ZGWA 4C8QB 5GANd 4XU3A 1N9RA 4C8QD 2YLBA 4C92B 4M7AF 4XU1A 4J6WA 3JCMc 5GAN2 4M75A 4C92D 5GAOq 4NL2A 4PJOA 3EFRA 4XU0A 5GMKe 4EMKC 4X9DA 1MGQA 3V8JA 5GAN3 4XTUA 2E41A 1D3BA 4EMGA 2I2LA 5LJ3g 1B34A 2YLCA 4J6XA 3JCMd 5LJ5j 5GMKl 4XTXA 4RCBA 5LJ5d 4MMLA 5GAN8 3RUXA 4XTZA 3FIFA 2VC8A 1I81A 4XQ3A 3HFOA 4EMKB 4NL3A 5GAMh 1U1TA 2E65A 4PJOF 1KQ1A 3RESA 3AHUA 2FYKA 5GMKj 4PNOA 4C8QG 4M7AC 5LJ3f 5DY9A 4C92G 5GMKm 3JCMX 1WNLA 4M77C 4M78A 5GAN6 3JCMJ 1M8VA 1BIAA 4DQ2A 4QVCA 5I21A 4M7DF 4C8QE 5CAIA 3L1AA 2Y90A 5GAN4 4RCCA 3RKXA 5GANg 4C92E 4M7AB 2DEQA 2DTHA 3SB2A 4M77F 3QHSA 3SWNB 4C8QA 1WQWA 3JCMb 4M7AD 2K57A 3BFMA 2DVEA 4M7DA 4F7UF 4JRIA 5GANf 3BY7A 1I8FA 1LJOA 4M78F 4XTVA 4Y91A 4OP0A 4JLIA 3JCMg 3INZA 5LJ5g 1I4K1 3RKWA 1KQ2A 3L2ZA 4HA8A 5LJ3h 4WF2A 1U1SA 2VXFA 2DTOA 2VXEA 4M75F 4N0AC 1YCYA 2RD1A 4A53A 4M7DC 3BW1A 5GAMe 1JBMA 3JB9J 2EAYA 3JB9F 3RERA 4PJOB 1Y96B 2EJFA 4EMKA 3JCMf 5GAOl 2RB6A 5LJ5f 2E10A 4JUVA 4M7AG 3HFNA 5GMKh 1TH7A 4V2SA 3GIBA 2DZ9A 4M77G 3JCMQ 5GAN5 5GAOr 3JB9H 3JCMV 4M7DB 4M7DD 4M78C 4M7AE 3BDUA 5GANh 3RIRA 4F7UG 5GAOm 4J6YA 2RA2A 4M77B 2DJZA 1HK9A 3QO3A 4C92A 5GAMj 4M77D 1LOJA 5GAMd 4XTYA 4MMKA 4M75C 4M7AA 3SWNA 5GAOp 3JCMP 4F7UB 3QUIA 3JB9I 2DTIA 1I5LA 4M78B 2JN0A 5GMKi 4M78D 4PJOG 1WQ7A 1X01A 3FB9A 1M5Q1 3JCMh 2CGHA 5GAN7 5LJ3e 5LJ5h 4C8QF 2HNIA 4M75B 4J5YA 2DXTA 4M75D 3V7SA 3V7RA 4C92F 4PJOD 4M7DG 1JRIA 3M4GA 2E64A 3JB9D 3QSUA 1HXDA 3PGGA 1N9SA 3HSBA 1WPYA 1D3BB 1H641 1LNXA 1Y96A 2QTXA 2FB7A 4M7DE 1B34B 2YHTA 3EFSA 2EWNA 4A54A 4PJOC 3VU3C 4N0AA 5LJ3j 5LJ3d 2EJ9A 5GANe 4M77E 4M78G 2E1HA
chains in the Genus database with same CATH superfamily
2LDMA 3OYKA 3OYDA 1SEMA 4E47A 1S72T 4OB0B 4C92C 3CCQA 1KSWA 3GF5A 3PMTA 2C0TA 1UB4A 2LC4A 1FXXA 2ESWA 2ZGWA 2CP6A 2OTJQ 3VS3A 2EYQA 3EG9B 4D8DA 1VUBA 1P92A 1QCFA 3G6ET 1D09B 1S72Q 2RJDA 4XTXA 4PKCC 1O9SA 2ATCB 4TVRA 3CPWA 1G3TA 1YI2T 1LCKA 3MEWA 1VQ6A 3EH1A 5KYUB 3G6EQ 2DTHA 2K57A 2DNUA 4QQGA 3E2UA 3I55T 1TU0B 1ZSZB 2Z0WA 3JCMg 1Q82C 3BE3A 1YI2Q 1KQSS 3EGXB 2QK0A 2D6FA 2ZPHB 1QVGA 2XDPA 2K3YA 2QEXT 4ZTFA 2E10A 3CC4A 2PNIA 4A4KA 3REBB 3I55Q 2O9SA 2LNVA 2ZPFB 2FZCB 3BDUA 1M30A 1OU8A 3CMEA 2EYXA 4MMKA 4J7IA 1X43A 2NUTB 3FEOA 4CC7A 1I5LA 1SPKA 2PUOB 3UATA 2QEXQ 2X3XD 2YUOA 4M7DG 1M3CA 1H92A 1H641 2H3EB 2F5KA 4AMCA 1D1AA 2EVRA 4ZTJA 2FO0A 3JAME 1RI9A 2J7IA 5LJ3j 3EG2A 2NLUA 4BI8B 7AT1B 4M7DA 4KH0B 1SKUB 3V8LA 1QP3A 1FMWA 2CKKA 3CC7T 4A63B 2DKGA 4XU2A 5GAMf 1FX7A 1JXOA 2YT6A 3O8VA 5GANd 2O01E 2ECZA 5IT9E 2QXFA 2FPDA 2L3SA 3CC7Q 1M1KU 1ZUUA 4MMLA 1A0NB 5L8RE 4NL3A 1G2BA 4JJDA 2V26A 1R77A 4HVVA 2X35A 4M78A 2KNBB 1M8VA 4C8QE 2GCXA 5GAN4 1M90R 2HAXA 1X27A 2GQVA 3FC3A 1QP2A 3H9NA 1UHCA 3VUZA 1PSEA 3I5SA 2K3BA 3INZA 1Q7YU 2KK4A 1RAIB 5GJWB 2VXEA 1OULA 4M7DC 2M0YA 1TG0A 3JB9F 1KHIA 2RHIA 1QKWA 3G4ST 3HFNA 3OYEA 4D8KA 2XI9A 4C5GA 3JCMQ 1UE9A 5IHIA 4C0FA 4ESRA 3SWNA 3JCMP 1SSFA 2IG0A 1QVFP 3MJXA 3M0PA 2DXCA 3G4SQ 5DM7R 1UTIA 1FYNA 3EH2A 2KXDA 2DBKA 4PJOD 3M56A 3JB9D 2C0IA 3OSVA 2QTXA 1LVKA 2XU8A 3A8OB 1B34B 2E70A 2LTOA 3VU3C 1VQLA 2P84A 2EJGA 5AYFA 4F7UE 3FJPA 3RKYA 5FRNA 4NOYA 4PFPA 2RQWA 1WHKA 3I56A 1SF9A 2FL7A 1TSFA 1VQ4T 5CKEA 1BK2A 2QI2A 1G8XA 1U06A 2AZSA 4XAXB 1YP5A 2KRNA 4OB1B 2DD4A 4EMGA 2XDBA 1JU5C 2PTKA 3LX7A 8AT1B 3FIFA 4Y92A 1J3TA 2D8JA 1VQ4Q 2AIRB 5HK3A 2YUNA 2Y90A 2E6ZA 3RKXA 1GFCA 5CO7A 1R8OB 3RR6A 1K9MC 1T0JA 4GLKA 2QAZA 2CH4A 4L59A 2VB6A 1AD5A 4N4GA 3CMAA 4BY6C 5LJ3h 2DM1A 2HL5C 2F2XA 1VQ5A 4C0DC 5GAMe 1X6BA 1BU1A 2L89A 3E9GA 3JSCA 4JJNK 2KSSA 4J9EA 1CKAA 2CP2A 3OYIA 2J06A 5GAOm 4CRIA 1MV3A 1X6OA 1PHTA 1KD1C 4JLGA 2DTIA 2CUBA 1RADB 2DRKA 3VUBA 2DXBA 1H3ZA 3EHQA 1G3YA 3RMQA 3CCSA 5J26A 3GNFB 1C1AA 4Q5WA 1OU9A 1OOTA 3L2QA 3UT1A 4QT7A 1M2VA 4J9FA 4AFZC 2VASA 3MEVA 3C0CA 3DLLA 3CXCS 2YHTA 2J6OA 2EWNA 2OX7A 4N0AA 1X2KA 1FMKA 4PLIA 3JCMW 3DKMA 1H3HA 4FL6A 2VV5A 4FYWB 2RK2A 3VS2A 4F17A 3JB9G 1KQSP 1HJDA 4M75E 2ZPIB 5FRMA 3L2VA 1QQJA 1PD1A 4PJOA 1QWEA 2BIVA 2F1LA 3C94A 3OMGA 4J6XA 1XQHA 2EGAA 4RTYA 1IGUA 2KBTA 5D6WA 5FROA 3OYMA 2MAMA 2VVKA 3O5ZA 1X6GA 1PSFA 3EGDB 2KT1A 4J9BA 1C0MA 4IUUA 4RTUA 1AZEA 1LJOA 5ECAA 3TU4K 4JPBW 1VQ8A 1PD0A 2RF0A 3CEYA 3VRZA 1ZLMA 4N0AC 2OTLA 1JBMA 3X24B 3RERA 5GAOl 3MHXA 2K7AA 3IQLA 1KHCA 3UF4A 1VYVA 3SDZA 5KYUA 4F7UG 5A0GA 1VYTA 1HK9A 5GAMd 4K11A 1EZZB 1SHFA 3VS7A 2CREA 4BD3A 3H6ZA 2HNIA 2EKOA 2R57A 4BY6B 1PNJA 3VYHB 5KE2A 3HSBA 1SRMA 2A08A 1C6VX 1ZX6A 5CQYA 2OAWA 1OV3A 1UECA 3M57A 3OYNA 4M77E 1FWZA 2VKNA 1WXTA 3H0FA 3L2WA 1VQKA 2IIMA 1K8AC 2A28A 3WVEB 2KI7A 2HQXA 2PU9B 2ZPEB 2R5AA 2F2WA 2X4JA 4RTVA 4ELZC 2LP5A 2BKDN 1GL5A 1O75A 4RG2A 2C06A 1T3SA 2LQNA 3D7SB 3H41A 4KGVB 2BZYA 2YRDA 2H8HA 3EFRA 4XU0A 5GMKe 4X9DA 1WI7A 4E7JA 5GAN3 1Q82R 2E41A 2RI3A 1NJIU 5LJ5j 4XQ3A 2NWMA 2D1XA 2EQMA 2D8HA 2IPOB 3RNJA 2K6DA 4BI3A 4ATOA 3JCMJ 2DBMA 2KVQG 4QVCA 1ABQA 2RHUA 3A8LB 4IIMA 3DB3A 5CKHA 5GANg 1ZSZC 3OYAA 1PRLC 1N8RU 3M53A 1YIJA 5I2MA 3QJ6A 1PWTA 1KQ2A 3I56Q 2ZAEA 3A8MB 5D6YA 1M8MA 1YITT 4AFUC 3X28B 5FLXE 2HDAA 2FG0A 1SSHA 2EGCA 3ER0A 1JB0E 2EQIA 4IUPA 2DZ9A 4BE2A 8ATCB 4C92A 2OAUA 3CCVT 3QUIA 3CMAT 1YITQ 3OSSC 2JOYA 1QW1A 1WQ7A 1VQ5T 1M5Q1 3ASKA 2FRYA 3VS0A 4IUVA 4BDYA 1OZ3A 2DXTA 1EX4A 4JRQA 1NYGA 3OYJA 2QDLA 3ZEHA 2RMOA 1NZ9A 5FU6C 3CCVQ 1W2BA 1G5VA 3CMAQ 3M4YA 1OPLA 3NFCA 1VQ5Q 2P0QA 1YJNT 1YBYA 3WVDB 5IAYA 2MWOA 1VQMA 1HYOA 4M78E 3OMCA 4J9GA 4WTOB 3CCST 2KT8A 3M0RA 1F1BB 4HT9A 4MDWA 2HQEA 4C8QB 5HCKA 1VQPT 1NLPC 4F16A 2OTJT 1YJNQ 2LCSA 1MMAA 1B34A 1WHMA 3CCSQ 4PJJA 5I22A 3RDVA 2HD0A 3HFOA 2FPFA 1KQ1A 4L6V5 4N4HA 1D1CA 5LJ3f 1I5OB 1UJYA 1AT1B 1VQPQ 4JZ4A 2NYSA 3EFOB 3JCMb 1K76A 4IUQA 3J7AF 1OYXA 3CXCP 3HHTB 5A2QE 3TREA 2QDYB 4OMPA 4WF2A 1NPRA 4LDUA 2QGFB 2EGEA 4RG8A 2V1RA 3JRZA 1VYUA 2R58A 4X34A 2H3JA 4UC4A 3VS4A 2E5QA 4JS5A 1M1FA 3OB9A 2MK5A 4M77G 5GAOr 3JCMV 4M7AE 3U23A 4EDUA 1WDXA 2DJZA 1RAHB 4F7UB 2VUBA 3QYHB 5CVIA 1QVGS 1KC8U 5LJ5h 2EQJA 1E6HA 2BZ8A 4NS5A 4E7LA 4KRTA 3V7RA 1VIEA 1K4US 1JRIA 3NTHA 4QKUA 2KQWA 2HEQA 2M16A 1GFDA 4QQ6A 4L5GA 3LH0A 4BI4A 1AVZC 1NEBA 5LL6S 1AWOA 2AZVA 4PFZA 4X9CA 4CC4B 5FW9A 4J9HA 2COWA 4E6RA 3CCJT 1WX6A 2MWPA 3L2UA 2DAQA 1K9MR 3MO8A 3QXEB 4PLLA 1AHJB 2M9UA 2P0PA 4LUDA 1I0CA 2FHDA 3LWIA 2L3PA 3JV3A 4E7IA 3OYFA 1I81A 5FU6B 3HRUA 1MMDA 1U1TA 3CCJQ 2K2MA 2KMTA 1PKSA 4M77C 4DQ2A 2P4TA 1YJWA 5KCOA 3ULRB 3SB2A 1KD1R 2JTFA 1RAFB 1ZSGA 3WXMB 1K0XA 1KG1A 3DLMA 3KFVA 2KEAA 1VQNT 1B07A 2D0QB 3QDFA 5HK0A 4ZN3A 2AT1B 2LJ1A 4LD6A 1M90U 3P8BB 3UPUA 3M5AA 2CUDA 2CP5A 1M9SA 3I35A 4J9DA 3GIBA 4E7HA 2LT4A 3LYIA 3EGDA 3CCMT 1VQNQ 2SEMA 4OMOA 5IXFA 3JB9I 2KROA 2CT4A 2AKKA 3PT9A 1MUZA 1UDLA 4BE1A 4PL6A 5LJ3e 2Y4XA 1M1KR 2CP3A 4C8QF 4M75B 4J5YA 4OB3B 3CCLA 4IIOA 3T9NA 3PE0A 3CCMQ 4MZTA 1Q86C 2YRCA 1RL2A 3CCET 3TEEA 1JJ2A 2VGMA 5GAMg 4ZNXA 4XTWA 5IH2A 1Q95G 5FWBA 1SHGA 1YHQA 3QWXX 5KYWB 2A36A 5CKFA 4PFOA 2PVGB 2HL3A 2GF7A 2GFUA 1N9RA 2EBPA 4C8QD 4PJNA 3CCEQ 1IHWA 2KRSA 5I2SA 2YXYA 2RQRA 2JVVA 1WHLA 2EIFA 3CCUA 3MP8A 4Z02A 1NBEB 5CCAA 4CC3A 2YLCA 1YJ9A 4E7ZA 2RJCA 1MNEA 4ORZA 4PNOA 4F14A 2X4WA 2A7YA 4EIKA 5GAN6 2MMPA 3G71A 4Z8AA 3L1AA 2GBQA 4E7KA 2BTTA 4LE9A 3CPFA 2JTEA 1W70A 1E6GA 1YWPA 2AK5A 2ENMA 1PM3A 4F7UF 1JQQA 4JRIA 3VS6A 1GXIE 1I4K1 2WSFE 2K79A 2A37A 3CCQT 2FPEA 2NUZA 4HCBA 1XJWB 2DF6A 3VS5A 2O31A 3G7ZA 1ZA2B 3QYGB 4EPCA 2ZZDA 5GAN5 1IO6A 4BACA 2QA4A 1BKBA 1K8AR 3H0HA 4M77B 3QO3A 1VQ7A 1VQOA 3ZFJA 3CCQQ 5C6SA 3F70A 4DBFA 5GMKi 1YCSB 3JCMh 3UWNA 2DFUA 1VQ6T 5CKDA 1XNIA 1LPLA 2DD5A 2HKQB 4C0GA 4E2FB 2RJEA 2FB7A 3LGFA 1ARKA 3PMIA 3FDRA 5LJ3d 2RQVA 1B7TA 4FT2A 3CC2A 3NHNA 3MCAB 3G1JA 1SRLA 4JS4A 4GY5A 3A1PA 4RUGA 1GBQA 1VQ6Q 2PUKB 4HT8A 3CPWP 2DL7A 3C12A 4XU3A 3CC4T 3HRTA 1U3OA 5M9OA 2O2OA 3P8DA 1IGQA 2YRVA 4DOVA 2O4XB 3GNGA 1WA7A 3E9FA 4LDVA 3CMET 2JW4A 2RK1A 1TOVA 5GAN8 2F5TX 1PG5B 4EMKB 3OS2A 3KUFA 4C8QG 2D9TA 3OS5A 4OMLA 3CC4Q 5I21A 2LCLA 2RQTA 1QVGP 2COZA 2MOXA 4RCCA 4C92E 2DVJA 2E4HA 1M1KC 1E7OA 4LXCA 2ZCFB 3LGLA 4RTTA 4C8QA 3CMEQ 1WQWA 2AHJB 1WXBA 1G3SA 5D6XA 1KFZA 4BUGA 1MNDA 1Z9ZA 1N27A 2LRQA 1KIKA 2E3IA 2DTOA 4M75F 1K9AA 1NM7A 3MEUA 1U8RA 1K73U 5LJ5f 1YJWT 3QZ5B 3OYBA 1IB8A 2X4YA 1Q7YC 3CD6A 3H8ZA 5IHNA 2X51A 4LDYA 3R6OA 4HCZA 1ZA1B 2K2VA 1NPPA 3G6EA 1ZUKA 1WJSA 3EG9A 3QG1A 2DL3A 1SG5A 2NUPB 4X1VA 2KXCA 2B86A 4O6JA 4M78B 2J6FA 1MHNA 1YI2A 1YJWQ 1Y71A 4KT0E 3PTAA 4M75D 2ROLA 1Y0MA 3L42A 4LD9K 2E64A 5DLOA 3CCRA 1LNXA 1D1BA 2PQWA 4VUBA 4A54A 3H0IA 3HPWA 2EJ9A 3I55A 2DPPB 3QBYA 1ZBXA 3BDLA 2CSQA 1ZUYA 4C8QC 2LNHB 2F2VA 1VA7A 3PIPA 1AWXA 4C0ZA 2XIDA 4F7UA 1ZSZA 1BB9A 4ZGEB 3CCLT 1BIBA 2YDLA 1OZ2A 2X9HA 1AEYA 1X75C 2QEXA 3EGXA 2JMAA 1KJWA 4JJCA 1QLYA 4B6MA 1IHVA 3R6NA 1K0SA 3M0UA 4ELYC 1G83A 2CYZB 2BE7D 1RLQC 2VC8A 2M0OA 3CCLQ 4HCCA 1AWJA 4KULA 2L3QA 2NUTA 1WNLA 2E3HA 4JJBA 3QIIA 1Q82U 1RACB 3NPFA 3OW2A 2DERA 4J83A 3OS1A 4Y28E 4M7AB 1K1ZA 4M77F 1VQLT 1WHJA 1TUCA 3BY7A 5A0LA 2F69A 1RUWA 1XTDA 4BDZA 3CC7A 2EQKA 5CQXA 1Y96B 3I56T 4LN2A 4QW2A 4V2SA 2QQAA 1VQLQ 5KYNA 2QQSA 1W1FA 4M77D 1LOJA 4XTYA 4C5EA 3CBMA 2L3RA 2ZPBB 2MPXC 4DBRA 1EFNA 3FB9A 2JM9A 4F04B 3RBBB 2RN8A 2B8AA 2P4RA 3AT1B 1D3BB 3E19A 4M7DE 3NTKA 3C95A 2LJ0A 3DB4A 4CC2A 1QWFA 1QVFA 1V1CA 1OX9A 5KH6A 5GAOn 1BI2A 4A4FA 3V8KA 3RMSA 1BBZA 2DMOA 1QVPA 4M75G 2JM8A 1TS9A 3OYGA 1BI0A 2RM4A 3UA7A 2CZ1B 4OGCA 4IURA 1RLPC 5LJ5e 3G4SA 2QQRA 1Q81U 4E7SA 5GANj 2YLBA 2G6FX 2KYBA 2ROTA 1OEBA 4J6WA 4M75A 5GAOq 3OYCA 1WFWA 2XMFA 1FMVA 4FCYA 4OGEA 1HSQA 2I2LA 2ABLA 2MIOA 1YN8A 5KYYB 3M59A 4QQDA 1NE8A 2IVWA 3RESA 3X26B 4ZGDB 4KH1B 1M2VB 2MF2A 1BIAA 1RI0A 3ZBDA 4IUTA 4CI0C 3S3OA 1WHHA 2CSIA 3Q1JA 4DEYA 2MCNA 3BFMA 3J81E 2ED1A 1G3WA 1PKTA 2GGRA 4M78F 3S3NA 4OP0A 4Z89A 1T0HA 2JJ9A 2DO3A 4AG2C 1JXMA 1BCOA 3M54A 3QDRB 4PJOB 1Q86R 1RAAB 1BCMA 2DETA 3JCMf 2RB6A 5GMKh 4II1A 3OBWA 3JB9H 2KAFA 3UDCA 1ABOA 4M75C 5GAOp 2LVMA 2OI3A 1WXUA 4M78D 3QPHA 3HRSA 3CPWS 4KGXB 4FT4A 3M4GA 1GCQC 1N9SA 2LMJA 4MZPA 3CD6T 2XKOC 4BB7A 2LJ3A 1V29B 2JMCA 2X4XA 1HD3A 1VQ8T 4RMOA 1UGPB 4M77A 4QVDA 2OTLT 3PNWC 3QJYA 4AT1B 3EG0A 3CD6Q 2DZCA 2SRCA 5KYXB 4M7AF 2G3RA 3JCMc 3CCRT 2O9VA 4DBQA 1UEBA 2DIQA 3MKDA 5IN1A 1RAGB 1VQ8Q 4A4GA 2PVOB 2XG8D 5LJ3g 2KE9A 3GBQA 5LJ5d 2OTLQ 4JDSA 3OY9A 4FU6A 2RHZA 5J39A 4A4EA 1KQSA 1K9MU 2FYKA 3E1SA 1W6XA 3CCRQ 1PRMC 1M3AA 2L5QA 1GCPA 1WIEA 1KC8R 1NJIC 2COYA 1KK7A 4YTLA 2DEQA 2RI5A 3QHSA 1CKBA 3QKJA 3SHWA 2E12A 4XK8E 3PIOA 2FZKB 4M7AD 3OBYA 2KR3A 3GOXA 1VQKT 4LDXA 2O4XA 2V8JA 2CH4W 3M58A 2KGTA 2VXFA 1YCYA 1WHGA 1UUEA 2GTOA 2EAYA 4RKUE 1KD1U 1N8RC 4EMKA 2JXBA 2XHCA 4R0KA 3I5RA 5CR2A 3OA6A 4DOWA 2JS2A 5GANh 3RIRA 1VQKQ 4IKFA 2M02A 3OQ5A 2DL4A 4LNPA 4QVZA 3M55A 4JRPA 1PC0A 2WACA 1R0CB 2CDTA 2E6NA 4OVAA 3SFMA 2CGHA 2HSEB 2CZ6B 5FU7B 4J9IA 5CKBA 4FM4B 4HVWA 1AZGB 2CS7A 1HXDA 2RNAA 2L8DA 3REAB 4HCKA 4M4ZA 2M1HA 3OW2P 1QCNA 4FYXB 3EFSA 2J6KA 1YIJT 4M78G 1X69A 4J7FA 3TSZA 4AG1C 1Q81C 1GRIA 1TUGB 2NUPA 1I07A 4FW2A 5D7UA 1BI3A 3JCMe 3CBOA 4PJOE 1WGSA 4KBMB 1TXQA 4C92B 2W0ZA 1M4ZA 4RTZA 2M51A 1U5SA 1YIJQ 2L2PA 4AFSC 4OMFB 4EMKC 2O88A 3V8JA 1M2OA 9ATCB 1MMNA 1JJ2S 2JNGA 3MPUB 2LX7A 2YUPA 4B9WA 1Z9QA 2WSCE 2X3WD 4PJOF 3AHUA 3L2RA 4LUEA 5DY9A 1JO8A 3NTIA 5GMKm 1Q7YR 1N5ZA 2L0AA 2VYTA 1MMGA 1VOMA 4C5HA 2HZYA 1TWBA 3HTRA 1N6AA 2QQBA 2Y4YA 2KDSA 2LZ6B 3HKSA 2OJ2A 4OF1A 1AOJA 1M27C 2HBPA 5DLQE 1VQMT 2CT3A 1WYXA 1T3LA 2I0NA 2E5KA 2RQUA 4GBQA 2JUFA 3TQ7P 1ACMB 2HQHA 2PZ1A 2W10A 4M7AG 1M1GA 4RTXA 4KUDK 2RPNA 4OB2B 4M78C 3OS0A 1UGQB 1NLOC 1UFFA 4J8OA 3X20B 5GAMj 1VQMQ 1W2BP 4M7AA 3M0QA 4FYYB 2ED0A 4O5VA 2J05A 5HY6A 2YSQA 1X01A 3TCJA 3VV0A 5AT1B 3C4SA 4HVUA 2QGGA 2D0NA 3SEMA 3KBGA 1K8AU 3HP9A 3LH5A 1I1JA 1Y96A 2LQWA 2CZ7B 2EYYA 4Z88A 3A98A 1KC8C 1YFNA 1VQ9A 1WLPB 2FRWA 4BE0A 1PCXA 2CP0A 4FIBA 2DXUA 1IZ6A 1YITA 3SWNC 2EQUA 2KRMA 3A8GB 1NYFA 4XU1A 5GAN2 3VYGA 3I9QA 1D0ZA 3PFSA 4JZ3A 1MGQA 1D3BA 3META 3CCVA 3JCMd 2K4YA 3A5ZB 1D0XA 3PVQA 4RCBA 2K3XA 5GMKl 4XTZA 4ME7A 1UGSB 2EYWA 2EYZA 2QTVA 4M7AC 5CK9A 3JCMX 2HBWA 2DLPA 2GQIA 5CAIA 1X2QA 3QZ9B 4FSSA 2DRMA 1V76A 2JTMA 2DVEA 3HL8A 2HCKA 5KCHA 3EG1A 2RJFA 4A4HA 1YJNA 1IREB 1UGRB 2KYMA 6AT1B 5L23A 1OI1A 2BE9B 4A53A 1NEGA 5KYYA 3JB9J 4B9XA 3N5BB 2P0KA 1ZBJA 2XD0A 1RAEB 1TUDA 4JUVA 2V8IA 1VQPA 4M7DB 2QYZA 2BZXA 4KUIA 2OTJA 1RABB 4J6YA 1M90C 3CXCA 2RA2A 4GLMA 3KXTA 4OMNA 1MV0B 3ZL7C 2R5MA 2WSEE 2EW3A 1OPKA 4DBHA 2QQ9A 3VRYA 4PJOG 1S72A 2MI6A 1WJRA 2DE0X 1B3QA 2BUDA 4C92F 3PGGA 4N4IA 1UGVA 1YWOA 5A0DA 3X25B 3EFOA 4EMHA 1TTHB 2DX1A 4MZMA 4MDXA 3MP1A 3V7CA 3TVTA 2EKHA 3EAEA 4PK4A 1AWWA 3FLGA 1YNZA 5EC7A 2RI2A 3EHRA 4C92D 4NL2A 5HKCA 4HKEA 1K73R 1D0YA 2EPDA 4R56A 2HSPA 4XTUA 4P5NA 5FWCA 1OQKA 3MP6A 4ZGJB 1BI1A 4R55A 1CSKA 5GAMh 3A8HB 2E65A 5GMKj 3FJ5A 1S1NA 2MYSA 2YUQA 3OYHA 3LLRA 2V8KA 1UHFA 3SWNB 4PJMA 5KYXA 4ZN1A 5GANf 4PJOC 1I8FA 4XTVA 4JLIA 3EG3A 5LJ5g 3RKWA 2DIGA 4HA8A 2QG9B 2A3LA 3M9QA 4AFQC 1YHQT 1JEGA 2RD1A 3BW1A 4FYVB 2KY9A 3CCJA 4PJLA 3OW2S 4J9CA 4DEXA 1QMCA 2HKNA 4C0DB 2DYBA 4OMQA 1WZOA 3CCUT 2XK0A 5KE3A 1OX8A 2RHXA 3NGPA 3S3MA 1YJ9T 1R0BG 1YHQQ 1JJ2P 2LX9A 5GAN7 3OYLA 2LQ8A 3VJPA 2LQKA 3V7SA 3VS1A 3GLXA 2V1QA 2PVDB 3G71T 3CCUQ 2CP7A 3EGUA 5C0MA 1WJQA 2DA9A 1YJ9Q 1W4SA 1Y7XA 3GPLA 5J3BA 4LDWA 2E1HA 1QCOA 1VQNA 1QKXA 2RH2A 2GTJA 4WCIA 4JRKA 2CZ0B 3THKA 1NJIR 3TSWA 3G71Q 2A0FB 3UA6A 2XICA 2LT1A 4FSXA 3SD4A 3FRNA 2GNCA 1IXDA 2DILA 1DJ7B 1Y07A 2QA4T 3CCMA 1QVFS 1VQ9T 1VQ7T 2FEIA 1VQOT 2JZ2A 3RUXA 4RTWA 1N8RR 1M3BA 3S6WA 2AKLA 3J80E 2LCCA 4C92G 1XOVA 3OYYA 3QWYA 4C5IA 1Y57A 2DK3A 4M7DF 2QA4Q 2EFIA 2DEUA 4HXJA 1UG1A 3CBPA 5CIUA 2DL8A 1GBRA 1VQ7Q 1W2BS 5I11A 1VQ9Q 5GJVB 1VQOQ 2VWFA 3URGA 2K5IA 3LW5E 3M0SA 4OMMA 4D6WA 3GP8A 1EIFA 3CCEA 1H8KA 3CC2T 1BYMA 4Y91A 2K5LA 2C0OA 5EG2A 2DYIA 3L2ZA 3CQTA 1U1SA 2JT4A 1GCQA 1NG2A 3M0TA 4FW1A 2EJFA 2DL5A 2K5FA 2YWWA 2K9GA 3P8HA 1TH7A 5KYWA 1IRXA 4DA4A 2RHYA 2VGNA 4M7DD 1Q81R 3CC2Q 4KGZB 1ZHIA 2FVUA 2FZGB 5FU7C 2ZPGB 3ME9A 1ZQ1A 1Q86U 2XDDA 1K73C 2RO0A 2JN0A 1VIFA 1UJ0A 5IXBA 4ANJA 2GFAA 2QASA 1VQ4A 3QSUA 3NMZC 2DJQA 3LWHA 1WPYA 3PVLA 5IHKA 3VKIA 3MEAA 2JS0A 5GANe 2HMAA
chains in the Genus database with same CATH topology
4J7FA 3CC2A 1Q81C 1FWZA 2LDMA 3MCAB 3L2WA 1VQKA 3OYKA 3OYDA 4JS4A 1K8AC 4E47A 4GY5A 1S72T 4OB0B 3WVEB 4C92C 3CCQA 2HQXA 2PU9B 2ZPEB 2R5AA 2X4JA 3GF5A 2PUKB 3PMTA 4ELZC 1BI3A 1UB4A 4HT8A 3JCMe 2BKDN 3C12A 2LC4A 1O75A 3CBOA 4RG2A 4PJOE 1FXXA 2ZGWA 4XU3A 1WGSA 4KBMB 2C06A 4C92B 2EYQA 1M4ZA 3CC4T 3HRTA 1VUBA 3EFRA 4XU0A 5M9OA 4OMFB 1P92A 5GMKe 3P8DA 4EMKC 4X9DA 2YRVA 4E7JA 3V8JA 2O4XB 4DOVA 5GAN3 1JJ2S 3GNGA 2JNGA 2E41A 3E9FA 4LDVA 3G6ET 2RI3A 3CMET 1NJIU 5LJ5j 2RJDA 2RK1A 4XTXA 4PKCC 5GAN8 2F5TX 4B9WA 4XQ3A 4EMKB 2WSCE 2EQMA 1O9SA 4TVRA 4PJOF 3OS2A 3CPWA 3AHUA 1G3TA 3KUFA 4C8QG 3L2RA 1YI2T 2D9TA 3OS5A 5DY9A 3NTIA 4BI3A 3MEWA 5GMKm 4ATOA 3JCMJ 1VQ6A 2KVQG 4QVCA 5I21A 2VYTA 2LCLA 4C5HA 2RHUA 3A8LB 4RCCA 3DB3A 5CKHA 5GANg 4C92E 1M1KC 3OYAA 1N6AA 2QQBA 2Y4YA 2ZCFB 2DTHA 3LGLA 4C8QA 2KDSA 1WQWA 2AHJB 1N8RU 2K57A 1G3SA 3M53A 4QQGA 3I55T 3HKSA 1YIJA 5D6XA 5I2MA 3QJ6A 4OF1A 4BUGA 3JCMg 2LRQA 1N27A 1Q82C 2HBPA 5DLQE 1VQMT 1KQSS 1KQ2A 3A8MB 2DTOA 4M75F 5D6YA 1YITT 5FLXE 3X28B 2D6FA 2JUFA 2ZPHB 1QVGA 2XDPA 2K3YA 3MEUA 1U8RA 1K73U 3ER0A 5LJ5f 2E10A 2QEXT 1JB0E 4ZTFA 3QZ5B 3OYBA 1YJWT 4M7AG 1M1GA 3CC4A 4A4KA 4IUPA 4KUDK 2DZ9A 2X4YA 1Q7YC 3CD6A 3H8ZA 4LDYA 2LNVA 2ZPFB 4M78C 4OB2B 1UGQB 3BDUA 3R6OA 4HCZA 3OS0A 4BE2A 3X20B 4J8OA 5GAMj 2K2VA 4C92A 1NPPA 2OAUA 3G6EA 1WJSA 3QG1A 3CMEA 3CCVT 4MMKA 4M7AA 4O5VA 3QUIA 4J7IA 3FEOA 3CMAT 5HY6A 4O6JA 4M78B 1I5LA 3OSSC 2JOYA 1QW1A 1WQ7A 1X01A 1M5Q1 3ASKA 1VQ5T 3TCJA 3VV0A 1MHNA 2PUOB 3C4SA 1YI2A 1Y71A 4IUVA 4BDYA 4KT0E 4M78G 3PTAA 1OZ3A 2DXTA 4M75D 3KBGA 1K8AU 4M7DG 3L42A 4JRQA 3HP9A 4LD9K 3OYJA 2E64A 3ZEHA 5DLOA 3CCRA 1H641 1LNXA 1Y96A 1NZ9A 5FU6C 2CZ7B 1W2BA 1G5VA 4ZTJA 2PQWA 4VUBA 4A54A 3JAME 1KC8C 5LJ3j 3HPWA 2EJ9A 3M4YA 2NLUA 2DPPB 4BI8B 3I55A 4M7DA 3QBYA 3NFCA 1ZBXA 3BDLA 1VQ9A 2P0QA 1YJNT 1YBYA 3WVDB 3V8LA 1QP3A 2MWOA 4C8QC 5IAYA 4BE0A 1VQMA 4M78E 2CKKA 3PIPA 3OMCA 4FIBA 2DXUA 4C0ZA 3CC7T 1IZ6A 2XIDA 2DKGA 3CCST 3SWNC 2EQUA 4F7UA 1YITA 4XU2A 4ZGEB 3CCLT 5GAMf 3A8GB 1BIBA 4HT9A 1FX7A 1OZ2A 4MDWA 2HQEA 1X75C 3O8VA 4C8QB 2QEXA 5GANd 2O01E 4XU1A 5GAN2 3VYGA 1VQPT 3PFSA 2OTJT 1MGQA 4ELYC 2CYZB 1D3BA 3META 5IT9E 3CCVA 3JCMd 1B34A 2K4YA 3A5ZB 2QXFA 5GMKl 4RCBA 2K3XA 1M1KU 4MMLA 5L8RE 4XTZA 4ME7A 1YIJT 2VC8A 2HD0A 2M0OA 3HFOA 4NL3A 4HCCA 1UGSB 1KQ1A 4KULA 4L6V5 4N4HA 4M7AC 5LJ3f 5CK9A 2X35A 3JCMX 1WNLA 4M78A 1M8VA 3QIIA 1Q82U 4C8QE 5CAIA 2GCXA 5GAN4 3OW2A 3QZ9B 4J83A 3OS1A 4Y28E 4M7AB 2HAXA 2JTMA 4M77F 3JCMb 2GQVA 4IUQA 2DVEA 3HL8A 3FC3A 1QP2A 1VQLT 3J7AF 1OYXA 1PSEA 3BY7A 3VUZA 5KCHA 2RJFA 4A4HA 1YJNA 1IREB 1UGRB 2F69A 3INZA 3HHTB 5A0LA 5A2QE 1Q7YU 3TREA 2KK4A 2QDYB 1OI1A 1XTDA 4WF2A 4BDZA 1NPRA 2VXEA 3CC7A 4LDUA 4A53A 4M7DC 4RG8A 3JRZA 2EQKA 2R58A 3JB9J 1KHIA 4X34A 5CQXA 3JB9F 2H3JA 1Y96B 2RHIA 4UC4A 4B9XA 3I56T 3G4ST 3N5BB 2P0KA 2E5QA 2XD0A 4JUVA 4JS5A 3HFNA 1M1FA 2V8IA 4QW2A 3OYEA 3OB9A 4V2SA 2XI9A 4C5GA 4M77G 3JCMQ 2QQAA 5GAOr 1VQPA 4M7DB 3JCMV 4M7AE 4KUIA 2OTJA 4C0FA 4J6YA 1M90C 2QQSA 2RA2A 4EDUA 2DJZA 3CXCA 4M77D 1LOJA 4XTYA 3SWNA 3KXTA 4C5EA 3CBMA 4F7UB 1SSFA 2R5MA 2IG0A 2WSEE 3JCMP 2L3RA 2ZPBB 2QQ9A 2VUBA 4PJOG 1S72A 3FB9A 2MI6A 2DXCA 1WJRA 3QYHB 5CVIA 5DM7R 1QVGS 1KC8U 5LJ5h 2EQJA 2BUDA 4NS5A 4E7LA 2B8AA 3V7RA 4C92F 1VIEA 4PJOD 1JRIA 3NTHA 3M56A 3JB9D 3PGGA 4N4IA 3OSVA 2KQWA 1D3BB 2QTXA 2XU8A 2M16A 3A8OB 1B34B 3E19A 2E70A 3NTKA 4M7DE 3C95A 2LTOA 3DB4A 4PJOC 3VU3C 4QQ6A 1VQLA 1QVFA 4L5GA 3LH0A 5A0DA 3X25B 4BI4A 5KH6A 1BI2A 5GAOn 2EJGA 4A4FA 4EMHA 5AYFA 3V8KA 4MZMA 3FJPA 4F7UE 3MP1A 5LL6S 3RKYA 4MDXA 3RMSA 3V7CA 5FRNA 4M75G 1QVPA 4X9CA 3OYGA 4NOYA 1BI0A 2RM4A 2CZ1B 3EAEA 4OGCA 4IURA 3CCJT 3I56A 2MWPA 3FLGA 2FL7A 5LJ5e 2QQRA 3G4SA 1VQ4T 5GANj 1Q81U 5CKEA 2RI2A 2YLBA 2QI2A 2DAQA 3L2UA 4J6WA 3MO8A 3QXEB 4M75A 4PLLA 4C92D 5GAOq 4NL2A 1AHJB 3OYCA 4XAXB 5HKCA 4HKEA 2M9UA 2P0PA 4OGEA 4R56A 2FHDA 4XTUA 3LWIA 4OB1B 2DD4A 4EMGA 2XDBA 2I2LA 4P5NA 3LX7A 3MP6A 4ZGJB 4E7IA 1BI1A 3FIFA 3OYFA 1I81A 4R55A 5FU6B 3M59A 4QQDA 3HRUA 5GAMh 1U1TA 3A8HB 2E65A 1NE8A 2IVWA 3RESA 3X26B 4ZGDB 5GMKj 2MF2A 2KMTA 4M77C 5HK3A 1BIAA 4DQ2A 3OYHA 3LLRA 1RI0A 2P4TA 3ZBDA 2Y90A 1YJWA 2E6ZA 2V8KA 3RKXA 4IUTA 4CI0C 5CO7A 5KCOA 3S3OA 3SB2A 3SWNB 2JTFA 3Q1JA 1R8OB 3BFMA 3WXMB 1K9MC 4ZN1A 3J81E 4GLKA 1G3WA 5GANf 1I8FA 3DLMA 4M78F 4L59A 4XTVA 4OP0A 4JLIA 3S3NA 4N4GA 1VQNT 2D0QB 2DO3A 5LJ5g 5HK0A 3RKWA 3CMAA 4BY6C 2DIGA 4ZN3A 4HA8A 5LJ3h 2A3LA 3M9QA 1YHQT 1VQ5A 2RD1A 4LD6A 1M90U 4C0DC 3BW1A 3M54A 5GAMe 2KY9A 3QDRB 4PJOB 3CCJA 3P8BB 3JCMf 3UPUA 2RB6A 2L89A 3E9GA 3JSCA 3M5AA 5GMKh 4JJNK 2KSSA 3OW2S 4II1A 3OBWA 1M9SA 3GIBA 3JB9H 4C0DB 4E7HA 2LT4A 3LYIA 3CCMT 3OYIA 3CCUT 2XK0A 5GAOm 5KE3A 4CRIA 2KAFA 1X6OA 3UDCA 2RHXA 1KG1A 3S3MA 1YJ9T 4M75C 1KD1C 4JLGA 5GAOp 2LVMA 3JB9I 2DTIA 3PT9A 4M78D 2LX9A 3QPHA 3HRSA 3CPWS 1H3ZA 3VUBA 2DXBA 4PL6A 4BE1A 5GAN7 1G3YA 3RMQA 5LJ3e 2Y4XA 3OYLA 3CCSA 4C8QF 2LQ8A 4M75B 5J26A 4J5YA 4OB3B 2LQKA 3GNFB 3V7SA 3VJPA 4FT4A 3CCLA 4Q5WA 3L2QA 3GLXA 3UT1A 3T9NA 3M4GA 2PVDB 3G71T 1N9SA 4MZTA 4MZPA 1Q86C 3CD6T 2XKOC 3MEVA 5C0MA 1WJQA 3DLLA 3CXCS 2YHTA 4BB7A 1RL2A 1V29B 1W4SA 1Y7XA 2EWNA 3GPLA 5J3BA 4N0AA 3CCET 4LDWA 3TEEA 2E1HA 1JJ2A 4PLIA 2VGMA 2X4XA 5GAMg 3JCMW 3DKMA 4XTWA 1VQ8T 1VQNA 4FL6A 2VV5A 1UGPB 2RH2A 4RMOA 4M77A 4JRKA 2CZ0B 2RK2A 4QVDA 1YHQA 2OTLT 3PNWC 3JB9G 3QJYA 5CKFA 4M75E 2XICA 2ZPIB 2PVGB 5FRMA 2DZCA 2LT1A 2GF7A 2GFUA 4FSXA 3L2VA 3SD4A 1N9RA 4C8QD 4M7AF 2G3RA 3JCMc 3CCRT 3FRNA 4PJOA 5I2SA 1DJ7B 1Y07A 2BIVA 1UEBA 2QA4T 2JVVA 3CCMA 2DIQA 2EIFA 3CCUA 5IN1A 1QVFS 3C94A 4A4GA 2PVOB 3MP8A 4Z02A 2XG8D 1VQ9T 1VQ7T 3OMGA 5CCAA 5LJ3g 2YLCA 4J6XA 1VQOT 1YJ9A 2JZ2A 1XQHA 5LJ5d 4JDSA 3OY9A 4FU6A 2RHZA 3RUXA 5J39A 4A4EA 1KQSA 5D6WA 5FROA 2RJCA 3S6WA 1K9MU 2FYKA 3OYMA 4PNOA 2X4WA 3J80E 2LCCA 3E1SA 4C92G 2A7YA 2MAMA 1XOVA 3OYYA 4C5IA 5GAN6 1PSFA 2L5QA 2DK3A 2MMPA 3G71A 4M7DF 3L1AA 4E7KA 1NJIC 2EFIA 3CBPA 5CIUA 4YTLA 3CPFA 2DEQA 2RI5A 1W2BS 3QHSA 3QKJA 4M7AD 2E12A 4XK8E 3PIOA 4IUUA 3URGA 4D6WA 2K5IA 3LW5E 3GP8A 3CCEA 1EIFA 3OBYA 4F7UF 4JRIA 3CC2T 1BYMA 1LJOA 4Y91A 3GOXA 3TU4K 1VQKT 1VQ8A 4LDXA 2K5LA 2O4XA 2V8JA 1GXIE 1I4K1 5EG2A 2WSFE 3CEYA 3L2ZA 3CCQT 1U1SA 2VXFA 3M58A 4N0AC 4HCBA 1YCYA 2OTLA 1JBMA 2EAYA 4RKUE 3G7ZA 3X24B 1N8RC 1KD1U 2EJFA 4EMKA 3RERA 5GAOl 3QYGB 4EPCA 2XHCA 2K5FA 3MHXA 3P8HA 5CR2A 1TH7A 1KHCA 3OA6A 3SDZA 2ZZDA 5GAN5 4DA4A 4DOWA 2RHYA 2VGNA 4M7DD 4BACA 2QA4A 1BKBA 5GANh 3RIRA 4F7UG 4IKFA 1ZHIA 2FVUA 5A0GA 4M77B 1HK9A 3OQ5A 3QO3A 5GAMd 5FU7C 1VQ7A 1VQOA 3ZFJA 2ZPGB 3ME9A 1ZQ1A 5C6SA 1Q86U 2XDDA 1K73C 4QVZA 3M55A 4JRPA 3F70A 2WACA 2RO0A 2JN0A 5GMKi 2E6NA 3JCMh 4OVAA 3SFMA 2CGHA 1VIFA 3UWNA 5FU7B 2CZ6B 4BD3A 3H6ZA 2HNIA 5CKBA 4FM4B 1VQ6T 2GFAA 2CS7A 5CKDA 1XNIA 1VQ4A 2EKOA 3QSUA 2DD5A 1HXDA 2R57A 3VYHB 4BY6B 2L8DA 4C0GA 5KE2A 3LWHA 1WPYA 3HSBA 2RJEA 2FB7A 3LGFA 2M1HA 3PMIA 5CQYA 3VKIA 3MEAA 3EFSA 3FDRA 3M57A 3OYNA 5LJ3d 2F5KA 5GANe 4M77E 4FT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAO n;  5GAM g;  3JCM W;  4XTW A;  2EJG A;  4EMH A;  4F7U E;  3V8K A;  3V8L A;  3FJP A;  4C8Q C;  3RKY A;  4M77 A;  4JRK A;  3V7C A;  4M78 E;  4M75 G;  4X9C A;  4C92 C;  4QVD A;  2DXU A;  4NOY A;  2RM4 A;  2DKG A;  3SWN C;  4F7U A;  3JB9 G;  4HT8 A;  4XU2 A;  5GAM f;  3JCM e;  1BIB A;  4HT9 A;  4M75 E;  5LJ5 e;  4PJO E;  2DZC A;  5GAN j;  2ZGW A;  4C8Q B;  5GAN d;  4XU3 A;  1N9R A;  4C8Q D;  2YLB A;  4C92 B;  4M7A F;  4XU1 A;  4J6W A;  3JCM c;  5GAN 2;  4M75 A;  4C92 D;  5GAO q;  4NL2 A;  4PJO A;  3EFR A;  4XU0 A;  5GMK e;  4EMK C;  4X9D A;  1MGQ A;  3V8J A;  5GAN 3;  4XTU A;  2E41 A;  1D3B A;  4EMG A;  2I2L A;  5LJ3 g;  1B34 A;  2YLC A;  4J6X A;  3JCM d;  5LJ5 j;  5GMK l;  4XTX A;  4RCB A;  5LJ5 d;  4MML A;  5GAN 8;  3RUX A;  4XTZ A;  3FIF A;  2VC8 A;  1I81 A;  4XQ3 A;  3HFO A;  4EMK B;  4NL3 A;  5GAM h;  1U1T A;  2E65 A;  4PJO F;  1KQ1 A;  3RES A;  3AHU A;  2FYK A;  5GMK j;  4PNO A;  4C8Q G;  4M7A C;  5LJ3 f;  5DY9 A;  4C92 G;  5GMK m;  3JCM X;  1WNL A;  4M77 C;  4M78 A;  5GAN 6;  3JCM J;  1M8V A;  1BIA A;  4DQ2 A;  4QVC A;  5I21 A;  4M7D F;  4C8Q E;  5CAI A;  3L1A A;  2Y90 A;  5GAN 4;  4RCC A;  3RKX A;  5GAN g;  4C92 E;  4M7A B;  2DEQ A;  2DTH A;  3SB2 A;  4M77 F;  3QHS A;  3SWN B;  4C8Q A;  1WQW A;  3JCM b;  4M7A D;  2K57 A;  3BFM A;  2DVE A;  4M7D A;  4F7U F;  4JRI A;  5GAN f;  3BY7 A;  1I8F A;  1LJO A;  4M78 F;  4XTV A;  4Y91 A;  4OP0 A;  4JLI A;  3JCM g;  3INZ A;  5LJ5 g;  1I4K 1;  3RKW A;  1KQ2 A;  3L2Z A;  4HA8 A;  5LJ3 h;  4WF2 A;  1U1S A;  2VXF A;  2DTO A;  2VXE A;  4M75 F;  4N0A C;  1YCY A;  2RD1 A;  4A53 A;  4M7D C;  3BW1 A;  5GAM e;  1JBM A;  3JB9 J;  2EAY A;  3JB9 F;  3RER A;  4PJO B;  1Y96 B;  2EJF A;  4EMK A;  3JCM f;  5GAO l;  2RB6 A;  5LJ5 f;  2E10 A;  4JUV A;  4M7A G;  3HFN A;  5GMK h;  1TH7 A;  4V2S A;  3GIB A;  2DZ9 A;  4M77 G;  3JCM Q;  5GAN 5;  5GAO r;  3JB9 H;  3JCM V;  4M7D B;  4M7D D;  4M78 C;  4M7A E;  3BDU A;  5GAN h;  3RIR A;  4F7U G;  5GAO m;  4J6Y A;  2RA2 A;  4M77 B;  2DJZ A;  1HK9 A;  3QO3 A;  4C92 A;  5GAM j;  4M77 D;  1LOJ A;  5GAM d;  4XTY A;  4MMK A;  4M75 C;  4M7A A;  3SWN A;  5GAO p;  3JCM P;  4F7U B;  3QUI A;  3JB9 I;  2DTI A;  1I5L A;  4M78 B;  2JN0 A;  5GMK i;  4M78 D;  4PJO G;  1WQ7 A;  1X01 A;  3FB9 A;  1M5Q 1;  3JCM h;  2CGH A;  5GAN 7;  5LJ3 e;  5LJ5 h;  4C8Q F;  2HNI A;  4M75 B;  4J5Y A;  2DXT A;  4M75 D;  3V7S A;  3V7R A;  4C92 F;  4PJO D;  4M7D G;  1JRI A;  3M4G A;  2E64 A;  3JB9 D;  3QSU A;  1HXD A;  3PGG A;  1N9S A;  3HSB A;  1WPY A;  1D3B B;  1H64 1;  1LNX A;  1Y96 A;  2QTX A;  2FB7 A;  4M7D E;  1B34 B;  2YHT A;  3EFS A;  2EWN A;  4A54 A;  4PJO C;  3VU3 C;  4N0A A;  5LJ3 j;  5LJ3 d;  2EJ9 A;  5GAN e;  4M77 E;  4M78 G;  2E1H A; 
#chains in the Genus database with same CATH topology
 2LDM A;  3OYK A;  3OYD A;  1SEM A;  4E47 A;  1S72 T;  4OB0 B;  4C92 C;  3CCQ A;  1KSW A;  3GF5 A;  3PMT A;  2C0T A;  1UB4 A;  2LC4 A;  1FXX A;  2ESW A;  2ZGW A;  2CP6 A;  2OTJ Q;  3VS3 A;  2EYQ A;  3EG9 B;  4D8D A;  1VUB A;  1P92 A;  1QCF A;  3G6E T;  1D09 B;  1S72 Q;  2RJD A;  4XTX A;  4PKC C;  1O9S A;  2ATC B;  4TVR A;  3CPW A;  1G3T A;  1YI2 T;  1LCK A;  3MEW A;  1VQ6 A;  3EH1 A;  5KYU B;  3G6E Q;  2DTH A;  2K57 A;  2DNU A;  4QQG A;  3E2U A;  3I55 T;  1TU0 B;  1ZSZ B;  2Z0W A;  3JCM g;  1Q82 C;  3BE3 A;  1YI2 Q;  1KQS S;  3EGX B;  2QK0 A;  2D6F A;  2ZPH B;  1QVG A;  2XDP A;  2K3Y A;  2QEX T;  4ZTF A;  2E10 A;  3CC4 A;  2PNI A;  4A4K A;  3REB B;  3I55 Q;  2O9S A;  2LNV A;  2ZPF B;  2FZC B;  3BDU A;  1M30 A;  1OU8 A;  3CME A;  2EYX A;  4MMK A;  4J7I A;  1X43 A;  2NUT B;  3FEO A;  4CC7 A;  1I5L A;  1SPK A;  2PUO B;  3UAT A;  2QEX Q;  2X3X D;  2YUO A;  4M7D G;  1M3C A;  1H92 A;  1H64 1;  2H3E B;  2F5K A;  4AMC A;  1D1A A;  2EVR A;  4ZTJ A;  2FO0 A;  3JAM E;  1RI9 A;  2J7I A;  5LJ3 j;  3EG2 A;  2NLU A;  4BI8 B;  7AT1 B;  4M7D A;  4KH0 B;  1SKU B;  3V8L A;  1QP3 A;  1FMW A;  2CKK A;  3CC7 T;  4A63 B;  2DKG A;  4XU2 A;  5GAM f;  1FX7 A;  1JXO A;  2YT6 A;  3O8V A;  5GAN d;  2O01 E;  2ECZ A;  5IT9 E;  2QXF A;  2FPD A;  2L3S A;  3CC7 Q;  1M1K U;  1ZUU A;  4MML A;  1A0N B;  5L8R E;  4NL3 A;  1G2B A;  4JJD A;  2V26 A;  1R77 A;  4HVV A;  2X35 A;  4M78 A;  2KNB B;  1M8V A;  4C8Q E;  2GCX A;  5GAN 4;  1M90 R;  2HAX A;  1X27 A;  2GQV A;  3FC3 A;  1QP2 A;  3H9N A;  1UHC A;  3VUZ A;  1PSE A;  3I5S A;  2K3B A;  3INZ A;  1Q7Y U;  2KK4 A;  1RAI B;  5GJW B;  2VXE A;  1OUL A;  4M7D C;  2M0Y A;  1TG0 A;  3JB9 F;  1KHI A;  2RHI A;  1QKW A;  3G4S T;  3HFN A;  3OYE A;  4D8K A;  2XI9 A;  4C5G A;  3JCM Q;  1UE9 A;  5IHI A;  4C0F A;  4ESR A;  3SWN A;  3JCM P;  1SSF A;  2IG0 A;  1QVF P;  3MJX A;  3M0P A;  2DXC A;  3G4S Q;  5DM7 R;  1UTI A;  1FYN A;  3EH2 A;  2KXD A;  2DBK A;  4PJO D;  3M56 A;  3JB9 D;  2C0I A;  3OSV A;  2QTX A;  1LVK A;  2XU8 A;  3A8O B;  1B34 B;  2E70 A;  2LTO A;  3VU3 C;  1VQL A;  2P84 A;  2EJG A;  5AYF A;  4F7U E;  3FJP A;  3RKY A;  5FRN A;  4NOY A;  4PFP A;  2RQW A;  1WHK A;  3I56 A;  1SF9 A;  2FL7 A;  1TSF A;  1VQ4 T;  5CKE A;  1BK2 A;  2QI2 A;  1G8X A;  1U06 A;  2AZS A;  4XAX B;  1YP5 A;  2KRN A;  4OB1 B;  2DD4 A;  4EMG A;  2XDB A;  1JU5 C;  2PTK A;  3LX7 A;  8AT1 B;  3FIF A;  4Y92 A;  1J3T A;  2D8J A;  1VQ4 Q;  2AIR B;  5HK3 A;  2YUN A;  2Y90 A;  2E6Z A;  3RKX A;  1GFC A;  5CO7 A;  1R8O B;  3RR6 A;  1K9M C;  1T0J A;  4GLK A;  2QAZ A;  2CH4 A;  4L59 A;  2VB6 A;  1AD5 A;  4N4G A;  3CMA A;  4BY6 C;  5LJ3 h;  2DM1 A;  2HL5 C;  2F2X A;  1VQ5 A;  4C0D C;  5GAM e;  1X6B A;  1BU1 A;  2L89 A;  3E9G A;  3JSC A;  4JJN K;  2KSS A;  4J9E A;  1CKA A;  2CP2 A;  3OYI A;  2J06 A;  5GAO m;  4CRI A;  1MV3 A;  1X6O A;  1PHT A;  1KD1 C;  4JLG A;  2DTI A;  2CUB A;  1RAD B;  2DRK A;  3VUB A;  2DXB A;  1H3Z A;  3EHQ A;  1G3Y A;  3RMQ A;  3CCS A;  5J26 A;  3GNF B;  1C1A A;  4Q5W A;  1OU9 A;  1OOT A;  3L2Q A;  3UT1 A;  4QT7 A;  1M2V A;  4J9F A;  4AFZ C;  2VAS A;  3MEV A;  3C0C A;  3DLL A;  3CXC S;  2YHT A;  2J6O A;  2EWN A;  2OX7 A;  4N0A A;  1X2K A;  1FMK A;  4PLI A;  3JCM W;  3DKM A;  1H3H A;  4FL6 A;  2VV5 A;  4FYW B;  2RK2 A;  3VS2 A;  4F17 A;  3JB9 G;  1KQS P;  1HJD A;  4M75 E;  2ZPI B;  5FRM A;  3L2V A;  1QQJ A;  1PD1 A;  4PJO A;  1QWE A;  2BIV A;  2F1L A;  3C94 A;  3OMG A;  4J6X A;  1XQH A;  2EGA A;  4RTY A;  1IGU A;  2KBT A;  5D6W A;  5FRO A;  3OYM A;  2MAM A;  2VVK A;  3O5Z A;  1X6G A;  1PSF A;  3EGD B;  2KT1 A;  4J9B A;  1C0M A;  4IUU A;  4RTU A;  1AZE A;  1LJO A;  5ECA A;  3TU4 K;  4JPB W;  1VQ8 A;  1PD0 A;  2RF0 A;  3CEY A;  3VRZ A;  1ZLM A;  4N0A C;  2OTL A;  1JBM A;  3X24 B;  3RER A;  5GAO l;  3MHX A;  2K7A A;  3IQL A;  1KHC A;  3UF4 A;  1VYV A;  3SDZ A;  5KYU A;  4F7U G;  5A0G A;  1VYT A;  1HK9 A;  5GAM d;  4K11 A;  1EZZ B;  1SHF A;  3VS7 A;  2CRE A;  4BD3 A;  3H6Z A;  2HNI A;  2EKO A;  2R57 A;  4BY6 B;  1PNJ A;  3VYH B;  5KE2 A;  3HSB A;  1SRM A;  2A08 A;  1C6V X;  1ZX6 A;  5CQY A;  2OAW A;  1OV3 A;  1UEC A;  3M57 A;  3OYN A;  4M77 E;  1FWZ A;  2VKN A;  1WXT A;  3H0F A;  3L2W A;  1VQK A;  2IIM A;  1K8A C;  2A28 A;  3WVE B;  2KI7 A;  2HQX A;  2PU9 B;  2ZPE B;  2R5A A;  2F2W A;  2X4J A;  4RTV A;  4ELZ C;  2LP5 A;  2BKD N;  1GL5 A;  1O75 A;  4RG2 A;  2C06 A;  1T3S A;  2LQN A;  3D7S B;  3H41 A;  4KGV B;  2BZY A;  2YRD A;  2H8H A;  3EFR A;  4XU0 A;  5GMK e;  4X9D A;  1WI7 A;  4E7J A;  5GAN 3;  1Q82 R;  2E41 A;  2RI3 A;  1NJI U;  5LJ5 j;  4XQ3 A;  2NWM A;  2D1X A;  2EQM A;  2D8H A;  2IPO B;  3RNJ A;  2K6D A;  4BI3 A;  4ATO A;  3JCM J;  2DBM A;  2KVQ G;  4QVC A;  1ABQ A;  2RHU A;  3A8L B;  4IIM A;  3DB3 A;  5CKH A;  5GAN g;  1ZSZ C;  3OYA A;  1PRL C;  1N8R U;  3M53 A;  1YIJ A;  5I2M A;  3QJ6 A;  1PWT A;  1KQ2 A;  3I56 Q;  2ZAE A;  3A8M B;  5D6Y A;  1M8M A;  1YIT T;  4AFU C;  3X28 B;  5FLX E;  2HDA A;  2FG0 A;  1SSH A;  2EGC A;  3ER0 A;  1JB0 E;  2EQI A;  4IUP A;  2DZ9 A;  4BE2 A;  8ATC B;  4C92 A;  2OAU A;  3CCV T;  3QUI A;  3CMA T;  1YIT Q;  3OSS C;  2JOY A;  1QW1 A;  1WQ7 A;  1VQ5 T;  1M5Q 1;  3ASK A;  2FRY A;  3VS0 A;  4IUV A;  4BDY A;  1OZ3 A;  2DXT A;  1EX4 A;  4JRQ A;  1NYG A;  3OYJ A;  2QDL A;  3ZEH A;  2RMO A;  1NZ9 A;  5FU6 C;  3CCV Q;  1W2B A;  1G5V A;  3CMA Q;  3M4Y A;  1OPL A;  3NFC A;  1VQ5 Q;  2P0Q A;  1YJN T;  1YBY A;  3WVD B;  5IAY A;  2MWO A;  1VQM A;  1HYO A;  4M78 E;  3OMC A;  4J9G A;  4WTO B;  3CCS T;  2KT8 A;  3M0R A;  1F1B B;  4HT9 A;  4MDW A;  2HQE A;  4C8Q B;  5HCK A;  1VQP T;  1NLP C;  4F16 A;  2OTJ T;  1YJN Q;  2LCS A;  1MMA A;  1B34 A;  1WHM A;  3CCS Q;  4PJJ A;  5I22 A;  3RDV A;  2HD0 A;  3HFO A;  2FPF A;  1KQ1 A;  4L6V 5;  4N4H A;  1D1C A;  5LJ3 f;  1I5O B;  1UJY A;  1AT1 B;  1VQP Q;  4JZ4 A;  2NYS A;  3EFO B;  3JCM b;  1K76 A;  4IUQ A;  3J7A F;  1OYX A;  3CXC P;  3HHT B;  5A2Q E;  3TRE A;  2QDY B;  4OMP A;  4WF2 A;  1NPR A;  4LDU A;  2QGF B;  2EGE A;  4RG8 A;  2V1R A;  3JRZ A;  1VYU A;  2R58 A;  4X34 A;  2H3J A;  4UC4 A;  3VS4 A;  2E5Q A;  4JS5 A;  1M1F A;  3OB9 A;  2MK5 A;  4M77 G;  5GAO r;  3JCM V;  4M7A E;  3U23 A;  4EDU A;  1WDX A;  2DJZ A;  1RAH B;  4F7U B;  2VUB A;  3QYH B;  5CVI A;  1QVG S;  1KC8 U;  5LJ5 h;  2EQJ A;  1E6H A;  2BZ8 A;  4NS5 A;  4E7L A;  4KRT A;  3V7R A;  1VIE A;  1K4U S;  1JRI A;  3NTH A;  4QKU A;  2KQW A;  2HEQ A;  2M16 A;  1GFD A;  4QQ6 A;  4L5G A;  3LH0 A;  4BI4 A;  1AVZ C;  1NEB A;  5LL6 S;  1AWO A;  2AZV A;  4PFZ A;  4X9C A;  4CC4 B;  5FW9 A;  4J9H A;  2COW A;  4E6R A;  3CCJ T;  1WX6 A;  2MWP A;  3L2U A;  2DAQ A;  1K9M R;  3MO8 A;  3QXE B;  4PLL A;  1AHJ B;  2M9U A;  2P0P A;  4LUD A;  1I0C A;  2FHD A;  3LWI A;  2L3P A;  3JV3 A;  4E7I A;  3OYF A;  1I81 A;  5FU6 B;  3HRU A;  1MMD A;  1U1T A;  3CCJ Q;  2K2M A;  2KMT A;  1PKS A;  4M77 C;  4DQ2 A;  2P4T A;  1YJW A;  5KCO A;  3ULR B;  3SB2 A;  1KD1 R;  2JTF A;  1RAF B;  1ZSG A;  3WXM B;  1K0X A;  1KG1 A;  3DLM A;  3KFV A;  2KEA A;  1VQN T;  1B07 A;  2D0Q B;  3QDF A;  5HK0 A;  4ZN3 A;  2AT1 B;  2LJ1 A;  4LD6 A;  1M90 U;  3P8B B;  3UPU A;  3M5A A;  2CUD A;  2CP5 A;  1M9S A;  3I35 A;  4J9D A;  3GIB A;  4E7H A;  2LT4 A;  3LYI A;  3EGD A;  3CCM T;  1VQN Q;  2SEM A;  4OMO A;  5IXF A;  3JB9 I;  2KRO A;  2CT4 A;  2AKK A;  3PT9 A;  1MUZ A;  1UDL A;  4BE1 A;  4PL6 A;  5LJ3 e;  2Y4X A;  1M1K R;  2CP3 A;  4C8Q F;  4M75 B;  4J5Y A;  4OB3 B;  3CCL A;  4IIO A;  3T9N A;  3PE0 A;  3CCM Q;  4MZT A;  1Q86 C;  2YRC A;  1RL2 A;  3CCE T;  3TEE A;  1JJ2 A;  2VGM A;  5GAM g;  4ZNX A;  4XTW A;  5IH2 A;  1Q95 G;  5FWB A;  1SHG A;  1YHQ A;  3QWX X;  5KYW B;  2A36 A;  5CKF A;  4PFO A;  2PVG B;  2HL3 A;  2GF7 A;  2GFU A;  1N9R A;  2EBP A;  4C8Q D;  4PJN A;  3CCE Q;  1IHW A;  2KRS A;  5I2S A;  2YXY A;  2RQR A;  2JVV A;  1WHL A;  2EIF A;  3CCU A;  3MP8 A;  4Z02 A;  1NBE B;  5CCA A;  4CC3 A;  2YLC A;  1YJ9 A;  4E7Z A;  2RJC A;  1MNE A;  4ORZ A;  4PNO A;  4F14 A;  2X4W A;  2A7Y A;  4EIK A;  5GAN 6;  2MMP A;  3G71 A;  4Z8A A;  3L1A A;  2GBQ A;  4E7K A;  2BTT A;  4LE9 A;  3CPF A;  2JTE A;  1W70 A;  1E6G A;  1YWP A;  2AK5 A;  2ENM A;  1PM3 A;  4F7U F;  1JQQ A;  4JRI A;  3VS6 A;  1GXI E;  1I4K 1;  2WSF E;  2K79 A;  2A37 A;  3CCQ T;  2FPE A;  2NUZ A;  4HCB A;  1XJW B;  2DF6 A;  3VS5 A;  2O31 A;  3G7Z A;  1ZA2 B;  3QYG B;  4EPC A;  2ZZD A;  5GAN 5;  1IO6 A;  4BAC A;  2QA4 A;  1BKB A;  1K8A R;  3H0H A;  4M77 B;  3QO3 A;  1VQ7 A;  1VQO A;  3ZFJ A;  3CCQ Q;  5C6S A;  3F70 A;  4DBF A;  5GMK i;  1YCS B;  3JCM h;  3UWN A;  2DFU A;  1VQ6 T;  5CKD A;  1XNI A;  1LPL A;  2DD5 A;  2HKQ B;  4C0G A;  4E2F B;  2RJE A;  2FB7 A;  3LGF A;  1ARK A;  3PMI A;  3FDR A;  5LJ3 d;  2RQV A;  1B7T A;  4FT2 A;  3CC2 A;  3NHN A;  3MCA B;  3G1J A;  1SRL A;  4JS4 A;  4GY5 A;  3A1P A;  4RUG A;  1GBQ A;  1VQ6 Q;  2PUK B;  4HT8 A;  3CPW P;  2DL7 A;  3C12 A;  4XU3 A;  3CC4 T;  3HRT A;  1U3O A;  5M9O A;  2O2O A;  3P8D A;  1IGQ A;  2YRV A;  4DOV A;  2O4X B;  3GNG A;  1WA7 A;  3E9F A;  4LDV A;  3CME T;  2JW4 A;  2RK1 A;  1TOV A;  5GAN 8;  2F5T X;  1PG5 B;  4EMK B;  3OS2 A;  3KUF A;  4C8Q G;  2D9T A;  3OS5 A;  4OML A;  3CC4 Q;  5I21 A;  2LCL A;  2RQT A;  1QVG P;  2COZ A;  2MOX A;  4RCC A;  4C92 E;  2DVJ A;  2E4H A;  1M1K C;  1E7O A;  4LXC A;  2ZCF B;  3LGL A;  4RTT A;  4C8Q A;  3CME Q;  1WQW A;  2AHJ B;  1WXB A;  1G3S A;  5D6X A;  1KFZ A;  4BUG A;  1MND A;  1Z9Z A;  1N27 A;  2LRQ A;  1KIK A;  2E3I A;  2DTO A;  4M75 F;  1K9A A;  1NM7 A;  3MEU A;  1U8R A;  1K73 U;  5LJ5 f;  1YJW T;  3QZ5 B;  3OYB A;  1IB8 A;  2X4Y A;  1Q7Y C;  3CD6 A;  3H8Z A;  5IHN A;  2X51 A;  4LDY A;  3R6O A;  4HCZ A;  1ZA1 B;  2K2V A;  1NPP A;  3G6E A;  1ZUK A;  1WJS A;  3EG9 A;  3QG1 A;  2DL3 A;  1SG5 A;  2NUP B;  4X1V A;  2KXC A;  2B86 A;  4O6J A;  4M78 B;  2J6F A;  1MHN A;  1YI2 A;  1YJW Q;  1Y71 A;  4KT0 E;  3PTA A;  4M75 D;  2ROL A;  1Y0M A;  3L42 A;  4LD9 K;  2E64 A;  5DLO A;  3CCR A;  1LNX A;  1D1B A;  2PQW A;  4VUB A;  4A54 A;  3H0I A;  3HPW A;  2EJ9 A;  3I55 A;  2DPP B;  3QBY A;  1ZBX A;  3BDL A;  2CSQ A;  1ZUY A;  4C8Q C;  2LNH B;  2F2V A;  1VA7 A;  3PIP A;  1AWX A;  4C0Z A;  2XID A;  4F7U A;  1ZSZ A;  1BB9 A;  4ZGE B;  3CCL T;  1BIB A;  2YDL A;  1OZ2 A;  2X9H A;  1AEY A;  1X75 C;  2QEX A;  3EGX A;  2JMA A;  1KJW A;  4JJC A;  1QLY A;  4B6M A;  1IHV A;  3R6N A;  1K0S A;  3M0U A;  4ELY C;  1G83 A;  2CYZ B;  2BE7 D;  1RLQ C;  2VC8 A;  2M0O A;  3CCL Q;  4HCC A;  1AWJ A;  4KUL A;  2L3Q A;  2NUT A;  1WNL A;  2E3H A;  4JJB A;  3QII A;  1Q82 U;  1RAC B;  3NPF A;  3OW2 A;  2DER A;  4J83 A;  3OS1 A;  4Y28 E;  4M7A B;  1K1Z A;  4M77 F;  1VQL T;  1WHJ A;  1TUC A;  3BY7 A;  5A0L A;  2F69 A;  1RUW A;  1XTD A;  4BDZ A;  3CC7 A;  2EQK A;  5CQX A;  1Y96 B;  3I56 T;  4LN2 A;  4QW2 A;  4V2S A;  2QQA A;  1VQL Q;  5KYN A;  2QQS A;  1W1F A;  4M77 D;  1LOJ A;  4XTY A;  4C5E A;  3CBM A;  2L3R A;  2ZPB B;  2MPX C;  4DBR A;  1EFN A;  3FB9 A;  2JM9 A;  4F04 B;  3RBB B;  2RN8 A;  2B8A A;  2P4R A;  3AT1 B;  1D3B B;  3E19 A;  4M7D E;  3NTK A;  3C95 A;  2LJ0 A;  3DB4 A;  4CC2 A;  1QWF A;  1QVF A;  1V1C A;  1OX9 A;  5KH6 A;  5GAO n;  1BI2 A;  4A4F A;  3V8K A;  3RMS A;  1BBZ A;  2DMO A;  1QVP A;  4M75 G;  2JM8 A;  1TS9 A;  3OYG A;  1BI0 A;  2RM4 A;  3UA7 A;  2CZ1 B;  4OGC A;  4IUR A;  1RLP C;  5LJ5 e;  3G4S A;  2QQR A;  1Q81 U;  4E7S A;  5GAN j;  2YLB A;  2G6F X;  2KYB A;  2ROT A;  1OEB A;  4J6W A;  4M75 A;  5GAO q;  3OYC A;  1WFW A;  2XMF A;  1FMV A;  4FCY A;  4OGE A;  1HSQ A;  2I2L A;  2ABL A;  2MIO A;  1YN8 A;  5KYY B;  3M59 A;  4QQD A;  1NE8 A;  2IVW A;  3RES A;  3X26 B;  4ZGD B;  4KH1 B;  1M2V B;  2MF2 A;  1BIA A;  1RI0 A;  3ZBD A;  4IUT A;  4CI0 C;  3S3O A;  1WHH A;  2CSI A;  3Q1J A;  4DEY A;  2MCN A;  3BFM A;  3J81 E;  2ED1 A;  1G3W A;  1PKT A;  2GGR A;  4M78 F;  3S3N A;  4OP0 A;  4Z89 A;  1T0H A;  2JJ9 A;  2DO3 A;  4AG2 C;  1JXM A;  1BCO A;  3M54 A;  3QDR B;  4PJO B;  1Q86 R;  1RAA B;  1BCM A;  2DET A;  3JCM f;  2RB6 A;  5GMK h;  4II1 A;  3OBW A;  3JB9 H;  2KAF A;  3UDC A;  1ABO A;  4M75 C;  5GAO p;  2LVM A;  2OI3 A;  1WXU A;  4M78 D;  3QPH A;  3HRS A;  3CPW S;  4KGX B;  4FT4 A;  3M4G A;  1GCQ C;  1N9S A;  2LMJ A;  4MZP A;  3CD6 T;  2XKO C;  4BB7 A;  2LJ3 A;  1V29 B;  2JMC A;  2X4X A;  1HD3 A;  1VQ8 T;  4RMO A;  1UGP B;  4M77 A;  4QVD A;  2OTL T;  3PNW C;  3QJY A;  4AT1 B;  3EG0 A;  3CD6 Q;  2DZC A;  2SRC A;  5KYX B;  4M7A F;  2G3R A;  3JCM c;  3CCR T;  2O9V A;  4DBQ A;  1UEB A;  2DIQ A;  3MKD A;  5IN1 A;  1RAG B;  1VQ8 Q;  4A4G A;  2PVO B;  2XG8 D;  5LJ3 g;  2KE9 A;  3GBQ A;  5LJ5 d;  2OTL Q;  4JDS A;  3OY9 A;  4FU6 A;  2RHZ A;  5J39 A;  4A4E A;  1KQS A;  1K9M U;  2FYK A;  3E1S A;  1W6X A;  3CCR Q;  1PRM C;  1M3A A;  2L5Q A;  1GCP A;  1WIE A;  1KC8 R;  1NJI C;  2COY A;  1KK7 A;  4YTL A;  2DEQ A;  2RI5 A;  3QHS A;  1CKB A;  3QKJ A;  3SHW A;  2E12 A;  4XK8 E;  3PIO A;  2FZK B;  4M7A D;  3OBY A;  2KR3 A;  3GOX A;  1VQK T;  4LDX A;  2O4X A;  2V8J A;  2CH4 W;  3M58 A;  2KGT A;  2VXF A;  1YCY A;  1WHG A;  1UUE A;  2GTO A;  2EAY A;  4RKU E;  1KD1 U;  1N8R C;  4EMK A;  2JXB A;  2XHC A;  4R0K A;  3I5R A;  5CR2 A;  3OA6 A;  4DOW A;  2JS2 A;  5GAN h;  3RIR A;  1VQK Q;  4IKF A;  2M02 A;  3OQ5 A;  2DL4 A;  4LNP A;  4QVZ A;  3M55 A;  4JRP A;  1PC0 A;  2WAC A;  1R0C B;  2CDT A;  2E6N A;  4OVA A;  3SFM A;  2CGH A;  2HSE B;  2CZ6 B;  5FU7 B;  4J9I A;  5CKB A;  4FM4 B;  4HVW A;  1AZG B;  2CS7 A;  1HXD A;  2RNA A;  2L8D A;  3REA B;  4HCK A;  4M4Z A;  2M1H A;  3OW2 P;  1QCN A;  4FYX B;  3EFS A;  2J6K A;  1YIJ T;  4M78 G;  1X69 A;  4J7F A;  3TSZ A;  4AG1 C;  1Q81 C;  1GRI A;  1TUG B;  2NUP A;  1I07 A;  4FW2 A;  5D7U A;  1BI3 A;  3JCM e;  3CBO A;  4PJO E;  1WGS A;  4KBM B;  1TXQ A;  4C92 B;  2W0Z A;  1M4Z A;  4RTZ A;  2M51 A;  1U5S A;  1YIJ Q;  2L2P A;  4AFS C;  4OMF B;  4EMK C;  2O88 A;  3V8J A;  1M2O A;  9ATC B;  1MMN A;  1JJ2 S;  2JNG A;  3MPU B;  2LX7 A;  2YUP A;  4B9W A;  1Z9Q A;  2WSC E;  2X3W D;  4PJO F;  3AHU A;  3L2R A;  4LUE A;  5DY9 A;  1JO8 A;  3NTI A;  5GMK m;  1Q7Y R;  1N5Z A;  2L0A A;  2VYT A;  1MMG A;  1VOM A;  4C5H A;  2HZY A;  1TWB A;  3HTR A;  1N6A A;  2QQB A;  2Y4Y A;  2KDS A;  2LZ6 B;  3HKS A;  2OJ2 A;  4OF1 A;  1AOJ A;  1M27 C;  2HBP A;  5DLQ E;  1VQM T;  2CT3 A;  1WYX A;  1T3L A;  2I0N A;  2E5K A;  2RQU A;  4GBQ A;  2JUF A;  3TQ7 P;  1ACM B;  2HQH A;  2PZ1 A;  2W10 A;  4M7A G;  1M1G A;  4RTX A;  4KUD K;  2RPN A;  4OB2 B;  4M78 C;  3OS0 A;  1UGQ B;  1NLO C;  1UFF A;  4J8O A;  3X20 B;  5GAM j;  1VQM Q;  1W2B P;  4M7A A;  3M0Q A;  4FYY B;  2ED0 A;  4O5V A;  2J05 A;  5HY6 A;  2YSQ A;  1X01 A;  3TCJ A;  3VV0 A;  5AT1 B;  3C4S A;  4HVU A;  2QGG A;  2D0N A;  3SEM A;  3KBG A;  1K8A U;  3HP9 A;  3LH5 A;  1I1J A;  1Y96 A;  2LQW A;  2CZ7 B;  2EYY A;  4Z88 A;  3A98 A;  1KC8 C;  1YFN A;  1VQ9 A;  1WLP B;  2FRW A;  4BE0 A;  1PCX A;  2CP0 A;  4FIB A;  2DXU A;  1IZ6 A;  1YIT A;  3SWN C;  2EQU A;  2KRM A;  3A8G B;  1NYF A;  4XU1 A;  5GAN 2;  3VYG A;  3I9Q A;  1D0Z A;  3PFS A;  4JZ3 A;  1MGQ A;  1D3B A;  3MET A;  3CCV A;  3JCM d;  2K4Y A;  3A5Z B;  1D0X A;  3PVQ A;  4RCB A;  2K3X A;  5GMK l;  4XTZ A;  4ME7 A;  1UGS B;  2EYW A;  2EYZ A;  2QTV A;  4M7A C;  5CK9 A;  3JCM X;  2HBW A;  2DLP A;  2GQI A;  5CAI A;  1X2Q A;  3QZ9 B;  4FSS A;  2DRM A;  1V76 A;  2JTM A;  2DVE A;  3HL8 A;  2HCK A;  5KCH A;  3EG1 A;  2RJF A;  4A4H A;  1YJN A;  1IRE B;  1UGR B;  2KYM A;  6AT1 B;  5L23 A;  1OI1 A;  2BE9 B;  4A53 A;  1NEG A;  5KYY A;  3JB9 J;  4B9X A;  3N5B B;  2P0K A;  1ZBJ A;  2XD0 A;  1RAE B;  1TUD A;  4JUV A;  2V8I A;  1VQP A;  4M7D B;  2QYZ A;  2BZX A;  4KUI A;  2OTJ A;  1RAB B;  4J6Y A;  1M90 C;  3CXC A;  2RA2 A;  4GLM A;  3KXT A;  4OMN A;  1MV0 B;  3ZL7 C;  2R5M A;  2WSE E;  2EW3 A;  1OPK A;  4DBH A;  2QQ9 A;  3VRY A;  4PJO G;  1S72 A;  2MI6 A;  1WJR A;  2DE0 X;  1B3Q A;  2BUD A;  4C92 F;  3PGG A;  4N4I A;  1UGV A;  1YWO A;  5A0D A;  3X25 B;  3EFO A;  4EMH A;  1TTH B;  2DX1 A;  4MZM A;  4MDX A;  3MP1 A;  3V7C A;  3TVT A;  2EKH A;  3EAE A;  4PK4 A;  1AWW A;  3FLG A;  1YNZ A;  5EC7 A;  2RI2 A;  3EHR A;  4C92 D;  4NL2 A;  5HKC A;  4HKE A;  1K73 R;  1D0Y A;  2EPD A;  4R56 A;  2HSP A;  4XTU A;  4P5N A;  5FWC A;  1OQK A;  3MP6 A;  4ZGJ B;  1BI1 A;  4R55 A;  1CSK A;  5GAM h;  3A8H B;  2E65 A;  5GMK j;  3FJ5 A;  1S1N A;  2MYS A;  2YUQ A;  3OYH A;  3LLR A;  2V8K A;  1UHF A;  3SWN B;  4PJM A;  5KYX A;  4ZN1 A;  5GAN f;  4PJO C;  1I8F A;  4XTV A;  4JLI A;  3EG3 A;  5LJ5 g;  3RKW A;  2DIG A;  4HA8 A;  2QG9 B;  2A3L A;  3M9Q A;  4AFQ C;  1YHQ T;  1JEG A;  2RD1 A;  3BW1 A;  4FYV B;  2KY9 A;  3CCJ A;  4PJL A;  3OW2 S;  4J9C A;  4DEX A;  1QMC A;  2HKN A;  4C0D B;  2DYB A;  4OMQ A;  1WZO A;  3CCU T;  2XK0 A;  5KE3 A;  1OX8 A;  2RHX A;  3NGP A;  3S3M A;  1YJ9 T;  1R0B G;  1YHQ Q;  1JJ2 P;  2LX9 A;  5GAN 7;  3OYL A;  2LQ8 A;  3VJP A;  2LQK A;  3V7S A;  3VS1 A;  3GLX A;  2V1Q A;  2PVD B;  3G71 T;  3CCU Q;  2CP7 A;  3EGU A;  5C0M A;  1WJQ A;  2DA9 A;  1YJ9 Q;  1W4S A;  1Y7X A;  3GPL A;  5J3B A;  4LDW A;  2E1H A;  1QCO A;  1VQN A;  1QKX A;  2RH2 A;  2GTJ A;  4WCI A;  4JRK A;  2CZ0 B;  3THK A;  1NJI R;  3TSW A;  3G71 Q;  2A0F B;  3UA6 A;  2XIC A;  2LT1 A;  4FSX A;  3SD4 A;  3FRN A;  2GNC A;  1IXD A;  2DIL A;  1DJ7 B;  1Y07 A;  2QA4 T;  3CCM A;  1QVF S;  1VQ9 T;  1VQ7 T;  2FEI A;  1VQO T;  2JZ2 A;  3RUX A;  4RTW A;  1N8R R;  1M3B A;  3S6W A;  2AKL A;  3J80 E;  2LCC A;  4C92 G;  1XOV A;  3OYY A;  3QWY A;  4C5I A;  1Y57 A;  2DK3 A;  4M7D F;  2QA4 Q;  2EFI A;  2DEU A;  4HXJ A;  1UG1 A;  3CBP A;  5CIU A;  2DL8 A;  1GBR A;  1VQ7 Q;  1W2B S;  5I11 A;  1VQ9 Q;  5GJV B;  1VQO Q;  2VWF A;  3URG A;  2K5I A;  3LW5 E;  3M0S A;  4OMM A;  4D6W A;  3GP8 A;  1EIF A;  3CCE A;  1H8K A;  3CC2 T;  1BYM A;  4Y91 A;  2K5L A;  2C0O A;  5EG2 A;  2DYI A;  3L2Z A;  3CQT A;  1U1S A;  2JT4 A;  1GCQ A;  1NG2 A;  3M0T A;  4FW1 A;  2EJF A;  2DL5 A;  2K5F A;  2YWW A;  2K9G A;  3P8H A;  1TH7 A;  5KYW A;  1IRX A;  4DA4 A;  2RHY A;  2VGN A;  4M7D D;  1Q81 R;  3CC2 Q;  4KGZ B;  1ZHI A;  2FVU A;  2FZG B;  5FU7 C;  2ZPG B;  3ME9 A;  1ZQ1 A;  1Q86 U;  2XDD A;  1K73 C;  2RO0 A;  2JN0 A;  1VIF A;  1UJ0 A;  5IXB A;  4ANJ A;  2GFA A;  2QAS A;  1VQ4 A;  3QSU A;  3NMZ C;  2DJQ A;  3LWH A;  1WPY A;  3PVL A;  5IHK A;  3VKI A;  3MEA A;  2JS0 A;  5GAN e;  2HMA A; 
#chains in the Genus database with same CATH homology
 4J7F A;  3CC2 A;  1Q81 C;  1FWZ A;  2LDM A;  3MCA B;  3L2W A;  1VQK A;  3OYK A;  3OYD A;  4JS4 A;  1K8A C;  4E47 A;  4GY5 A;  1S72 T;  4OB0 B;  3WVE B;  4C92 C;  3CCQ A;  2HQX A;  2PU9 B;  2ZPE B;  2R5A A;  2X4J A;  3GF5 A;  2PUK B;  3PMT A;  4ELZ C;  1BI3 A;  1UB4 A;  4HT8 A;  3JCM e;  2BKD N;  3C12 A;  2LC4 A;  1O75 A;  3CBO A;  4RG2 A;  4PJO E;  1FXX A;  2ZGW A;  4XU3 A;  1WGS A;  4KBM B;  2C06 A;  4C92 B;  2EYQ A;  1M4Z A;  3CC4 T;  3HRT A;  1VUB A;  3EFR A;  4XU0 A;  5M9O A;  4OMF B;  1P92 A;  5GMK e;  3P8D A;  4EMK C;  4X9D A;  2YRV A;  4E7J A;  3V8J A;  2O4X B;  4DOV A;  5GAN 3;  1JJ2 S;  3GNG A;  2JNG A;  2E41 A;  3E9F A;  4LDV A;  3G6E T;  2RI3 A;  3CME T;  1NJI U;  5LJ5 j;  2RJD A;  2RK1 A;  4XTX A;  4PKC C;  5GAN 8;  2F5T X;  4B9W A;  4XQ3 A;  4EMK B;  2WSC E;  2EQM A;  1O9S A;  4TVR A;  4PJO F;  3OS2 A;  3CPW A;  3AHU A;  1G3T A;  3KUF A;  4C8Q G;  3L2R A;  1YI2 T;  2D9T A;  3OS5 A;  5DY9 A;  3NTI A;  4BI3 A;  3MEW A;  5GMK m;  4ATO A;  3JCM J;  1VQ6 A;  2KVQ G;  4QVC A;  5I21 A;  2VYT A;  2LCL A;  4C5H A;  2RHU A;  3A8L B;  4RCC A;  3DB3 A;  5CKH A;  5GAN g;  4C92 E;  1M1K C;  3OYA A;  1N6A A;  2QQB A;  2Y4Y A;  2ZCF B;  2DTH A;  3LGL A;  4C8Q A;  2KDS A;  1WQW A;  2AHJ B;  1N8R U;  2K57 A;  1G3S A;  3M53 A;  4QQG A;  3I55 T;  3HKS A;  1YIJ A;  5D6X A;  5I2M A;  3QJ6 A;  4OF1 A;  4BUG A;  3JCM g;  2LRQ A;  1N27 A;  1Q82 C;  2HBP A;  5DLQ E;  1VQM T;  1KQS S;  1KQ2 A;  3A8M B;  2DTO A;  4M75 F;  5D6Y A;  1YIT T;  5FLX E;  3X28 B;  2D6F A;  2JUF A;  2ZPH B;  1QVG A;  2XDP A;  2K3Y A;  3MEU A;  1U8R A;  1K73 U;  3ER0 A;  5LJ5 f;  2E10 A;  2QEX T;  1JB0 E;  4ZTF A;  3QZ5 B;  3OYB A;  1YJW T;  4M7A G;  1M1G A;  3CC4 A;  4A4K A;  4IUP A;  4KUD K;  2DZ9 A;  2X4Y A;  1Q7Y C;  3CD6 A;  3H8Z A;  4LDY A;  2LNV A;  2ZPF B;  4M78 C;  4OB2 B;  1UGQ B;  3BDU A;  3R6O A;  4HCZ A;  3OS0 A;  4BE2 A;  3X20 B;  4J8O A;  5GAM j;  2K2V A;  4C92 A;  1NPP A;  2OAU A;  3G6E A;  1WJS A;  3QG1 A;  3CME A;  3CCV T;  4MMK A;  4M7A A;  4O5V A;  3QUI A;  4J7I A;  3FEO A;  3CMA T;  5HY6 A;  4O6J A;  4M78 B;  1I5L A;  3OSS C;  2JOY A;  1QW1 A;  1WQ7 A;  1X01 A;  1M5Q 1;  3ASK A;  1VQ5 T;  3TCJ A;  3VV0 A;  1MHN A;  2PUO B;  3C4S A;  1YI2 A;  1Y71 A;  4IUV A;  4BDY A;  4KT0 E;  4M78 G;  3PTA A;  1OZ3 A;  2DXT A;  4M75 D;  3KBG A;  1K8A U;  4M7D G;  3L42 A;  4JRQ A;  3HP9 A;  4LD9 K;  3OYJ A;  2E64 A;  3ZEH A;  5DLO A;  3CCR A;  1H64 1;  1LNX A;  1Y96 A;  1NZ9 A;  5FU6 C;  2CZ7 B;  1W2B A;  1G5V A;  4ZTJ A;  2PQW A;  4VUB A;  4A54 A;  3JAM E;  1KC8 C;  5LJ3 j;  3HPW A;  2EJ9 A;  3M4Y A;  2NLU A;  2DPP B;  4BI8 B;  3I55 A;  4M7D A;  3QBY A;  3NFC A;  1ZBX A;  3BDL A;  1VQ9 A;  2P0Q A;  1YJN T;  1YBY A;  3WVD B;  3V8L A;  1QP3 A;  2MWO A;  4C8Q C;  5IAY A;  4BE0 A;  1VQM A;  4M78 E;  2CKK A;  3PIP A;  3OMC A;  4FIB A;  2DXU A;  4C0Z A;  3CC7 T;  1IZ6 A;  2XID A;  2DKG A;  3CCS T;  3SWN C;  2EQU A;  4F7U A;  1YIT A;  4XU2 A;  4ZGE B;  3CCL T;  5GAM f;  3A8G B;  1BIB A;  4HT9 A;  1FX7 A;  1OZ2 A;  4MDW A;  2HQE A;  1X75 C;  3O8V A;  4C8Q B;  2QEX A;  5GAN d;  2O01 E;  4XU1 A;  5GAN 2;  3VYG A;  1VQP T;  3PFS A;  2OTJ T;  1MGQ A;  4ELY C;  2CYZ B;  1D3B A;  3MET A;  5IT9 E;  3CCV A;  3JCM d;  1B34 A;  2K4Y A;  3A5Z B;  2QXF A;  5GMK l;  4RCB A;  2K3X A;  1M1K U;  4MML A;  5L8R E;  4XTZ A;  4ME7 A;  1YIJ T;  2VC8 A;  2HD0 A;  2M0O A;  3HFO A;  4NL3 A;  4HCC A;  1UGS B;  1KQ1 A;  4KUL A;  4L6V 5;  4N4H A;  4M7A C;  5LJ3 f;  5CK9 A;  2X35 A;  3JCM X;  1WNL A;  4M78 A;  1M8V A;  3QII A;  1Q82 U;  4C8Q E;  5CAI A;  2GCX A;  5GAN 4;  3OW2 A;  3QZ9 B;  4J83 A;  3OS1 A;  4Y28 E;  4M7A B;  2HAX A;  2JTM A;  4M77 F;  3JCM b;  2GQV A;  4IUQ A;  2DVE A;  3HL8 A;  3FC3 A;  1QP2 A;  1VQL T;  3J7A F;  1OYX A;  1PSE A;  3BY7 A;  3VUZ A;  5KCH A;  2RJF A;  4A4H A;  1YJN A;  1IRE B;  1UGR B;  2F69 A;  3INZ A;  3HHT B;  5A0L A;  5A2Q E;  1Q7Y U;  3TRE A;  2KK4 A;  2QDY B;  1OI1 A;  1XTD A;  4WF2 A;  4BDZ A;  1NPR A;  2VXE A;  3CC7 A;  4LDU A;  4A53 A;  4M7D C;  4RG8 A;  3JRZ A;  2EQK A;  2R58 A;  3JB9 J;  1KHI A;  4X34 A;  5CQX A;  3JB9 F;  2H3J A;  1Y96 B;  2RHI A;  4UC4 A;  4B9X A;  3I56 T;  3G4S T;  3N5B B;  2P0K A;  2E5Q A;  2XD0 A;  4JUV A;  4JS5 A;  3HFN A;  1M1F A;  2V8I A;  4QW2 A;  3OYE A;  3OB9 A;  4V2S A;  2XI9 A;  4C5G A;  4M77 G;  3JCM Q;  2QQA A;  5GAO r;  1VQP A;  4M7D B;  3JCM V;  4M7A E;  4KUI A;  2OTJ A;  4C0F A;  4J6Y A;  1M90 C;  2QQS A;  2RA2 A;  4EDU A;  2DJZ A;  3CXC A;  4M77 D;  1LOJ A;  4XTY A;  3SWN A;  3KXT A;  4C5E A;  3CBM A;  4F7U B;  1SSF A;  2R5M A;  2IG0 A;  2WSE E;  3JCM P;  2L3R A;  2ZPB B;  2QQ9 A;  2VUB A;  4PJO G;  1S72 A;  3FB9 A;  2MI6 A;  2DXC A;  1WJR A;  3QYH B;  5CVI A;  5DM7 R;  1QVG S;  1KC8 U;  5LJ5 h;  2EQJ A;  2BUD A;  4NS5 A;  4E7L A;  2B8A A;  3V7R A;  4C92 F;  1VIE A;  4PJO D;  1JRI A;  3NTH A;  3M56 A;  3JB9 D;  3PGG A;  4N4I A;  3OSV A;  2KQW A;  1D3B B;  2QTX A;  2XU8 A;  2M16 A;  3A8O B;  1B34 B;  3E19 A;  2E70 A;  3NTK A;  4M7D E;  3C95 A;  2LTO A;  3DB4 A;  4PJO C;  3VU3 C;  4QQ6 A;  1VQL A;  1QVF A;  4L5G A;  3LH0 A;  5A0D A;  3X25 B;  4BI4 A;  5KH6 A;  1BI2 A;  5GAO n;  2EJG A;  4A4F A;  4EMH A;  5AYF A;  3V8K A;  4MZM A;  3FJP A;  4F7U E;  3MP1 A;  5LL6 S;  3RKY A;  4MDX A;  3RMS A;  3V7C A;  5FRN A;  4M75 G;  1QVP A;  4X9C A;  3OYG A;  4NOY A;  1BI0 A;  2RM4 A;  2CZ1 B;  3EAE A;  4OGC A;  4IUR A;  3CCJ T;  3I56 A;  2MWP A;  3FLG A;  2FL7 A;  5LJ5 e;  2QQR A;  3G4S A;  1VQ4 T;  5GAN j;  1Q81 U;  5CKE A;  2RI2 A;  2YLB A;  2QI2 A;  2DAQ A;  3L2U A;  4J6W A;  3MO8 A;  3QXE B;  4M75 A;  4PLL A;  4C92 D;  5GAO q;  4NL2 A;  1AHJ B;  3OYC A;  4XAX B;  5HKC A;  4HKE A;  2M9U A;  2P0P A;  4OGE A;  4R56 A;  2FHD A;  4XTU A;  3LWI A;  4OB1 B;  2DD4 A;  4EMG A;  2XDB A;  2I2L A;  4P5N A;  3LX7 A;  3MP6 A;  4ZGJ B;  4E7I A;  1BI1 A;  3FIF A;  3OYF A;  1I81 A;  4R55 A;  5FU6 B;  3M59 A;  4QQD A;  3HRU A;  5GAM h;  1U1T A;  3A8H B;  2E65 A;  1NE8 A;  2IVW A;  3RES A;  3X26 B;  4ZGD B;  5GMK j;  2MF2 A;  2KMT A;  4M77 C;  5HK3 A;  1BIA A;  4DQ2 A;  3OYH A;  3LLR A;  1RI0 A;  2P4T A;  3ZBD A;  2Y90 A;  1YJW A;  2E6Z A;  2V8K A;  3RKX A;  4IUT A;  4CI0 C;  5CO7 A;  5KCO A;  3S3O A;  3SB2 A;  3SWN B;  2JTF A;  3Q1J A;  1R8O B;  3BFM A;  3WXM B;  1K9M C;  4ZN1 A;  3J81 E;  4GLK A;  1G3W A;  5GAN f;  1I8F A;  3DLM A;  4M78 F;  4L59 A;  4XTV A;  4OP0 A;  4JLI A;  3S3N A;  4N4G A;  1VQN T;  2D0Q B;  2DO3 A;  5LJ5 g;  5HK0 A;  3RKW A;  3CMA A;  4BY6 C;  2DIG A;  4ZN3 A;  4HA8 A;  5LJ3 h;  2A3L A;  3M9Q A;  1YHQ T;  1VQ5 A;  2RD1 A;  4LD6 A;  1M90 U;  4C0D C;  3BW1 A;  3M54 A;  5GAM e;  2KY9 A;  3QDR B;  4PJO B;  3CCJ A;  3P8B B;  3JCM f;  3UPU A;  2RB6 A;  2L89 A;  3E9G A;  3JSC A;  3M5A A;  5GMK h;  4JJN K;  2KSS A;  3OW2 S;  4II1 A;  3OBW A;  1M9S A;  3GIB A;  3JB9 H;  4C0D B;  4E7H A;  2LT4 A;  3LYI A;  3CCM T;  3OYI A;  3CCU T;  2XK0 A;  5GAO m;  5KE3 A;  4CRI A;  2KAF A;  1X6O A;  3UDC A;  2RHX A;  1KG1 A;  3S3M A;  1YJ9 T;  4M75 C;  1KD1 C;  4JLG A;  5GAO p;  2LVM A;  3JB9 I;  2DTI A;  3PT9 A;  4M78 D;  2LX9 A;  3QPH A;  3HRS A;  3CPW S;  1H3Z A;  3VUB A;  2DXB A;  4PL6 A;  4BE1 A;  5GAN 7;  1G3Y A;  3RMQ A;  5LJ3 e;  2Y4X A;  3OYL A;  3CCS A;  4C8Q F;  2LQ8 A;  4M75 B;  5J26 A;  4J5Y A;  4OB3 B;  2LQK A;  3GNF B;  3V7S A;  3VJP A;  4FT4 A;  3CCL A;  4Q5W A;  3L2Q A;  3GLX A;  3UT1 A;  3T9N A;  3M4G A;  2PVD B;  3G71 T;  1N9S A;  4MZT A;  4MZP A;  1Q86 C;  3CD6 T;  2XKO C;  3MEV A;  5C0M A;  1WJQ A;  3DLL A;  3CXC S;  2YHT A;  4BB7 A;  1RL2 A;  1V29 B;  1W4S A;  1Y7X A;  2EWN A;  3GPL A;  5J3B A;  4N0A A;  3CCE T;  4LDW A;  3TEE A;  2E1H A;  1JJ2 A;  4PLI A;  2VGM A;  2X4X A;  5GAM g;  3JCM W;  3DKM A;  4XTW A;  1VQ8 T;  1VQN A;  4FL6 A;  2VV5 A;  1UGP B;  2RH2 A;  4RMO A;  4M77 A;  4JRK A;  2CZ0 B;  2RK2 A;  4QVD A;  1YHQ A;  2OTL T;  3PNW C;  3JB9 G;  3QJY A;  5CKF A;  4M75 E;  2XIC A;  2ZPI B;  2PVG B;  5FRM A;  2DZC A;  2LT1 A;  2GF7 A;  2GFU A;  4FSX A;  3L2V A;  3SD4 A;  1N9R A;  4C8Q D;  4M7A F;  2G3R A;  3JCM c;  3CCR T;  3FRN A;  4PJO A;  5I2S A;  1DJ7 B;  1Y07 A;  2BIV A;  1UEB A;  2QA4 T;  2JVV A;  3CCM A;  2DIQ A;  2EIF A;  3CCU A;  5IN1 A;  1QVF S;  3C94 A;  4A4G A;  2PVO B;  3MP8 A;  4Z02 A;  2XG8 D;  1VQ9 T;  1VQ7 T;  3OMG A;  5CCA A;  5LJ3 g;  2YLC A;  4J6X A;  1VQO T;  1YJ9 A;  2JZ2 A;  1XQH A;  5LJ5 d;  4JDS A;  3OY9 A;  4FU6 A;  2RHZ A;  3RUX A;  5J39 A;  4A4E A;  1KQS A;  5D6W A;  5FRO A;  2RJC A;  3S6W A;  1K9M U;  2FYK A;  3OYM A;  4PNO A;  2X4W A;  3J80 E;  2LCC A;  3E1S A;  4C92 G;  2A7Y A;  2MAM A;  1XOV A;  3OYY A;  4C5I A;  5GAN 6;  1PSF A;  2L5Q A;  2DK3 A;  2MMP A;  3G71 A;  4M7D F;  3L1A A;  4E7K A;  1NJI C;  2EFI A;  3CBP A;  5CIU A;  4YTL A;  3CPF A;  2DEQ A;  2RI5 A;  1W2B S;  3QHS A;  3QKJ A;  4M7A D;  2E12 A;  4XK8 E;  3PIO A;  4IUU A;  3URG A;  4D6W A;  2K5I A;  3LW5 E;  3GP8 A;  3CCE A;  1EIF A;  3OBY A;  4F7U F;  4JRI A;  3CC2 T;  1BYM A;  1LJO A;  4Y91 A;  3GOX A;  3TU4 K;  1VQK T;  1VQ8 A;  4LDX A;  2K5L A;  2O4X A;  2V8J A;  1GXI E;  1I4K 1;  5EG2 A;  2WSF E;  3CEY A;  3L2Z A;  3CCQ T;  1U1S A;  2VXF A;  3M58 A;  4N0A C;  4HCB A;  1YCY A;  2OTL A;  1JBM A;  2EAY A;  4RKU E;  3G7Z A;  3X24 B;  1N8R C;  1KD1 U;  2EJF A;  4EMK A;  3RER A;  5GAO l;  3QYG B;  4EPC A;  2XHC A;  2K5F A;  3MHX A;  3P8H A;  5CR2 A;  1TH7 A;  1KHC A;  3OA6 A;  3SDZ A;  2ZZD A;  5GAN 5;  4DA4 A;  4DOW A;  2RHY A;  2VGN A;  4M7D D;  4BAC A;  2QA4 A;  1BKB A;  5GAN h;  3RIR A;  4F7U G;  4IKF A;  1ZHI A;  2FVU A;  5A0G A;  4M77 B;  1HK9 A;  3OQ5 A;  3QO3 A;  5GAM d;  5FU7 C;  1VQ7 A;  1VQO A;  3ZFJ A;  2ZPG B;  3ME9 A;  1ZQ1 A;  5C6S A;  1Q86 U;  2XDD A;  1K73 C;  4QVZ A;  3M55 A;  4JRP A;  3F70 A;  2WAC A;  2RO0 A;  2JN0 A;  5GMK i;  2E6N A;  3JCM h;  4OVA A;  3SFM A;  2CGH A;  1VIF A;  3UWN A;  5FU7 B;  2CZ6 B;  4BD3 A;  3H6Z A;  2HNI A;  5CKB A;  4FM4 B;  1VQ6 T;  2GFA A;  2CS7 A;  5CKD A;  1XNI A;  1VQ4 A;  2EKO A;  3QSU A;  2DD5 A;  1HXD A;  2R57 A;  3VYH B;  4BY6 B;  2L8D A;  4C0G A;  5KE2 A;  3LWH A;  1WPY A;  3HSB A;  2RJE A;  2FB7 A;  3LGF A;  2M1H A;  3PMI A;  5CQY A;  3VKI A;  3MEA A;  3EFS A;  3FDR A;  3M57 A;  3OYN A;  5LJ3 d;  2F5K A;  5GAN e;  4M77 E;  4FT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...