1JBMA

Heptameric crystal structure of mth649, an sm-like archaeal protein from methanobacterium thermautotrophicum
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
78
structure length
78
Chain Sequence
b'VNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE SNRNP SM-LIKE PROTEIN
molecule tags Structural genomics
source organism Methanothermobacter thermautotrophicus
publication title The oligomerization and ligand-binding properties of Sm-like archaeal proteins (SmAPs)
pubmed doi rcsb
total genus 14
structure length 78
sequence length 78
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2001-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1jbmA00
4C92D 1MGQA 4XU1A 3FB9A 3JCMW 3JB9F 5GANh 2DZCA 4M75G 4M7DB 1N9RA 2VC8A 1KQ2A 4M7DE 2DTOA 5GAN6 5GAN7 3GIBA 3SWNA 4M77F 4C8QB 1LNXA 1I8FA 4C92C 4J6XA 5LJ3g 4M77B 4NL2A 4XTWA 4M7AA 5GAMj 1U1SA 3JCMd 3HFNA 4XTUA 5LJ3f 5GAOn 3BDUA 3JCMb 4C8QA 1BIBA 5GMKi 5GMKl 4M7DG 5GAMh 4A53A 4M7DF 4C92A 4PJOE 5GAN4 4M7AD 4WF2A 1I81A 4PJOB 3BFMA 4M78A 3QUIA 4OP0A 5GAMe 3JCMV 4M7DD 2YHTA 3M4GA 2DJZA 4RCBA 4PJOA 1I4K1 3JB9J 4C92E 5GAOm 5GANj 5DY9A 4XU0A 3RKXA 4C8QC 3FJPA 2DXTA 4M75F 2Y90A 1JBMA 4M77C 5GAN3 2RM4A 4M77D 5LJ5g 3JB9H 5GANe 1I5LA 2K57A 4N0AA 1Y96B 3RKYA 3V7CA 5GANg 2E1HA 4M77A 2RB6A 2ZGWA 4M7AB 5GANf 5GAOp 3QSUA 4M75E 5GMKj 5LJ3j 1Y96A 2EAYA 3HSBA 4EMGA 3V8LA 5LJ5d 2DTIA 4M78C 5LJ3d 2E41A 2FYKA 3JCMX 4XTYA 3BW1A 4M78G 4J6WA 1D3BB 4M78F 3JCMQ 3QO3A 2VXEA 2CGHA 2YLCA 3L1AA 5GMKm 1LJOA 4F7UE 4PJOG 4M75D 4PNOA 2EWNA 3RIRA 4EMKB 2QTXA 1WPYA 3QHSA 4PJOF 3SB2A 3V8JA 4M7AE 5GAOq 2DTHA 4M78D 2DVEA 3HFOA 3FIFA 5I21A 4M75A 2DEQA 2E65A 3RESA 2DZ9A 5GMKe 5LJ3e 3JB9G 3AHUA 3JCMf 4X9CA 4XTXA 2EJFA 4F7UB 1LOJA 1B34B 4XU2A 5GANd 5LJ5j 1M8VA 1U1TA 4HA8A 4M77G 1TH7A 4RCCA 5LJ5h 1B34A 1HXDA 4XTVA 4C8QG 4F7UF 4M7AC 2RD1A 3SWNB 4F7UG 3EFRA 4MMKA 2HNIA 3JCMh 1WNLA 4M75B 4EMKC 1HK9A 3V7RA 3JB9I 4DQ2A 5GAMd 4JRKA 3BY7A 4M78B 3RKWA 4HT9A 3JCMc 4EMHA 5GAN5 1N9SA 4NOYA 3L2ZA 2EJGA 1YCYA 4M7DC 1WQ7A 2E10A 1M5Q1 4Y91A 2EJ9A 4C8QE 5LJ3h 4QVCA 5GMKh 3RUXA 4M78E 4V2SA 2YLBA 3SWNC 4XQ3A 4N0AC 4C92B 4XTZA 2RA2A 2VXFA 4JRIA 4JUVA 5GAMg 3JCMP 4M7AF 4XU3A 1BIAA 3JCMe 2I2LA 4M75C 5GAN8 2DKGA 2E64A 4C8QF 3VU3C 4A54A 4M7AG 5GAOr 4M7DA 4C92F 4HT8A 4C92G 5GAN2 2DXUA 4C8QD 3JCMJ 4PJOC 4JLIA 1X01A 4F7UA 3EFSA 2JN0A 5LJ5e 4MMLA 5GAMf 4J5YA 5GAOl 1JRIA 2FB7A 3INZA 4J6YA 4X9DA 1KQ1A 4M77E 4QVDA 5CAIA 1H641 5LJ5f 3V7SA 3RERA 3JB9D 4EMKA 3V8KA 1D3BA 1WQWA 3JCMg 4NL3A 4PJOD 3PGGA
chains in the Genus database with same CATH superfamily
2AK5A 3EFOA 3FB9A 3GOXA 4E7IA 4ZN1A 1GBQA 1K9AA 2O01E 3A5ZB 1YJWA 1H8KA 1BI3A 1I8FA 1VQ6T 1Q86R 2SRCA 4Z89A 1ZSZA 4M7DF 4M7AD 2F69A 1P92A 1NYFA 1OOTA 1WHMA 1SHGA 5GJWB 3I56Q 5IH2A 1YIJQ 2RQVA 3JV3A 2FPDA 1KJWA 1JJ2S 5IAYA 4N0AA 2OTLA 4M7AB 1Q81U 5LL6S 1UJ0A 3CC2A 2BUDA 1VQMA 1VQKT 4OVAA 3CXCA 2FRYA 4JS4A 3ZL7C 4ZTJA 4RG8A 2XU8A 4KT0E 4WCIA 2JW4A 1K0SA 2XDPA 2VB6A 5GAMf 3SB2A 1D0ZA 3CD6T 2DTHA 2LZ6B 4MZTA 5FWCA 2DEQA 4OB1B 2RHZA 3JCMf 1YJNA 4L59A 1VQ4Q 3C95A 1HXDA 4XTVA 4F7UG 1NEGA 3EFRA 3AT1B 2VVKA 4M4ZA 2ZPGB 2K7AA 3QJ6A 5KE3A 4FYYB 3UT1A 1NE8A 3VS0A 2DAQA 3FEOA 2M51A 1UUEA 1FMKA 1Q86U 3HP9A 1QCOA 2LRQA 3C0CA 4J7IA 1QVGP 1W2BS 4HVWA 4NS5A 1NEBA 4J5YA 2V1QA 1VYVA 1QVFS 2JT4A 1H641 3V8KA 2JVVA 3JRZA 1MMGA 1FX7A 4TVRA 3VS7A 1FWZA 1PHTA 3PVLA 3GIBA 5DLQE 2L89A 1N8RU 5FU6C 3CC7T 2FHDA 4OGCA 2OTLT 2RQTA 2HD0A 3TSZA 4E7HA 5GAOn 2J6KA 1D09B 1PKSA 2M0YA 2OI3A 1VQNQ 4WF2A 3CCLT 2K3BA 4RTXA 3JCMV 1UFFA 4XU0A 3G71Q 3G71A 1QVPA 1YN8A 1YJNT 1AT1B 2DA9A 3SD4A 3CMAA 3M55A 3VS6A 3M53A 2J6FA 3TU4K 3LLRA 3P8BB 4E7ZA 1KQSA 1CSKA 1EFNA 2W0ZA 4QW2A 2G6FX 4RTZA 1ZUYA 1Z9ZA 2RF0A 4E7LA 1YJWQ 2YLCA 3UA6A 1FMVA 4HCKA 2RHUA 4AMCA 1VQ5Q 2E65A 1M3BA 3OSSC 5GMKe 3CCRT 2CYZB 1RI9A 3EG3A 4F14A 5KYUB 1X6BA 1NLPC 3I5RA 2MCNA 2WSCE 4LXCA 4MMKA 2K3YA 3ZBDA 2DL4A 1PRLC 4JRKA 3BY7A 3MEAA 4PKCC 2XHCA 2EBPA 1M5Q1 1M27C 1NJIC 1D1AA 1VQ9T 3M54A 1ZUKA 4GLKA 3RUXA 2BTTA 8ATCB 3OYHA 4JUVA 2COYA 3PIOA 2D8HA 4M7AF 3JCMe 1AWOA 2QASA 1OU8A 3TCJA 1VQLQ 4R55A 2HKQB 2EQIA 1YFNA 4FIBA 2QGFB 2QYZA 2LT1A 2QGGA 4J83A 2HL3A 3JAME 3CBPA 3OSVA 3VS5A 1YI2Q 3CCRQ 3CCUQ 3J7AF 4J9FA 5IHKA 1ABOA 3ZEHA 2VGMA 4N4GA 4NL2A 4D8DA 1YJWT 2BZ8A 3THKA 3HFNA 3BDUA 2EQKA 2DMOA 4CC4B 5GAMh 1G5VA 4RKUE 3VYHB 2HBPA 3P8DA 3PMIA 1WXUA 3QYHB 1YJ9A 4QVZA 3OA6A 2IVWA 3GBQA 5KCOA 1UB4A 2Z0WA 1RAIB 1R0BG 3GNGA 2K57A 1GCQC 2DEUA 2WACA 5FW9A 4Y92A 1VQOA 3QSUA 1NLOC 2CUDA 1OZ2A 4AFSC 1TS9A 3WVDB 3QZ5B 2RH2A 1VQKA 3OYGA 3HL8A 1UGVA 2E5KA 2PUOB 3JCMX 4M78F 2VXEA 3L1AA 3META 4PJOG 4BE2A 1W70A 1X43A 4GBQA 4N4IA 2Y4YA 5LJ3e 1QW1A 5M9OA 5DM7R 3JB9G 2EJFA 4ANJA 1IXDA 1C1AA 4BI4A 4C5GA 2CZ0B 2CZ7B 3FJ5A 5FRMA 3OS0A 2KYMA 2RNAA 1XJWB 4B6MA 4CC3A 1I1JA 2DE0X 3TQ7P 1QLYA 4Y91A 3CC4T 3CCUT 3NTKA 1YI2T 1WYXA 3CBMA 4JRIA 2J06A 3CXCS 2DJQA 4CC7A 1AHJB 1M1GA 3VU3C 2R5MA 1JU5C 2E6ZA 4E47A 1VQ9A 3EFSA 5CKBA 1VOMA 3QBYA 2QG9B 1K9MR 2MI6A 5CAIA 1H3ZA 3RERA 4JJCA 2RQUA 3M9QA 3S3OA 1YJ9T 3JCMg 3DB3A 1VQ9Q 2CP5A 4KH0B 3SWNA 2JJ9A 4ELZC 1OZ3A 2XG8D 4M77B 4M7AA 2HBWA 1SSFA 3L2QA 1EIFA 2K2VA 2K5IA 2FG0A 2OX7A 1VYTA 4N4HA 5EC7A 4HXJA 1ZX6A 2RI3A 1OX8A 5ECAA 4DBFA 2NUPA 3EG9A 1M1KC 2XDBA 1N8RR 3GPLA 3RKXA 4MZMA 1VQ5T 1A0NB 4M77C 3VS3A 2HDAA 1M4ZA 1AOJA 1AVZC 2KR3A 2EYZA 3URGA 3GP8A 4M75E 1KC8C 2KI7A 1RABB 2NYSA 5FRNA 1TU0B 3M4YA 4ZNXA 2WSEE 1Y07A 1IREB 3QO3A 3MP6A 1VQ6Q 2M16A 2QQRA 4FM4B 4DA4A 2CP7A 3ZFJA 1R0CB 1FMWA 3CCUA 2AKLA 4X1VA 5IT9E 4XTXA 1JXOA 3MP1A 1K8AR 4LNPA 1M1FA 3G4SQ 2JM8A 3SWNB 2HNIA 4FL6A 4EMKC 1HK9A 4MDXA 1MMNA 4DQ2A 1B3QA 2X4YA 3EH2A 3L2VA 2A0FB 3NTIA 4X34A 4IUVA 3I5SA 3M59A 5KYWA 1IO6A 1M2OA 4PFZA 4OGEA 1JB0E 2YUQA 1ZQ1A 2DK3A 2RI5A 4JLIA 1MNEA 4DBRA 2P0KA 2VKNA 5GAOl 2L3SA 4B9WA 1UGQB 3REBB 4ORZA 1MV0B 2M02A 4RTYA 2KY9A 1PD0A 3KFVA 2FZGB 3ULRB 4DEXA 4QT7A 1BI1A 3J81E 2EYYA 2B86A 4C92A 1YITQ 2LT4A 3HRUA 2DD4A 4LDUA 3M4GA 1YHQA 2ABLA 5FU7C 1PNJA 2IIMA 1Q81C 3PT9A 1QCNA 2Y90A 3OS2A 1D1BA 1OQKA 2E3HA 2EGEA 2LMJA 4J7FA 3RDVA 3CCMA 3G7ZA 2LCCA 1WJQA 5GAOp 4Z02A 1ZA2B 2GFAA 1VQKQ 4EMGA 1YITT 2J05A 1J3TA 2E41A 3I55Q 1YWOA 1TOVA 4M7DE 3A8GB 1WHLA 4M78D 3OYFA 3HFOA 2M0OA 1VYUA 3H0HA 2V8JA 3EGDB 1U1TA 2CKKA 4FW1A 5C6SA 1SSHA 3L2UA 4JJNK 1Q86C 1KD1R 3V7RA 3VJPA 1N9SA 2O4XB 4QQ6A 4DOWA 3HRTA 2F2WA 2JUFA 3QXEB 1M9SA 4N0AC 5DLOA 4RTUA 2YUPA 2VXFA 1Q82U 3OYNA 2A37A 1ABQA 2X51A 2RMOA 3WVEB 1GL5A 4PJOC 4F7UA 8AT1B 1VQ8T 1I07A 1WHJA 5HKCA 1N6AA 1IZ6A 3MKDA 4EMKA 4J9DA 1M8VA 2DZCA 2DTOA 5FU7B 1T0HA 3CBOA 4HCZA 3U23A 1KQSP 3S3NA 3I55A 5LJ3f 1K73U 1BIBA 4IUQA 5GMKl 1KQSS 4J9HA 3RMQA 1U8RA 2MYSA 1K4US 2DFUA 2ZPEB 1TG0A 1XNIA 2LQ8A 2EVRA 1XQHA 2BZXA 3MP8A 1ZBJA 4FCYA 3LH5A 3JB9H 3G1JA 5HK3A 3RNJA 3V7CA 4K11A 4L5GA 1AZGB 4J9EA 2CT4A 3OYKA 5LJ3j 2EAYA 1WIEA 2K5FA 2D9TA 5LJ3d 4M78C 2K79A 3FLGA 2HQEA 3CCMT 4XAXB 2CGHA 1NJIU 2KGTA 3OS1A 5FROA 1PSFA 3NGPA 2QTXA 1MHNA 3V8JA 2C0TA 2J7IA 2KXCA 2HL5C 5A2QE 3M5AA 2O9SA 2CP3A 1QVGA 2NUTB 1VQPA 1YCSB 2GBQA 4HA8A 3CMEQ 1JEGA 2D6FA 2K5LA 3OY9A 3FC3A 4ZGDB 3OBYA 2P84A 6AT1B 2KRSA 2RHXA 3L2WA 5GAMd 3ME9A 4EMHA 1UJYA 1NBEB 2QEXA 4KRTA 1VQNA 3KUFA 1WHGA 2HKNA 3L42A 4ME7A 1BB9A 2HQXA 1AEYA 1OEBA 1VUBA 2AIRB 1UHCA 1X01A 2JN0A 1SF9A 1UG1A 2VASA 2YDLA 4LDYA 3VUZA 5KYYA 3GLXA 4M75G 5AT1B 2VC8A 1TTHB 1Z9QA 2QXFA 2ZPFB 4BDYA 1WHKA 1QP2A 4LN2A 2IPOB 1AD5A 4FSXA 3CD6A 3CCJA 4M78A 3C4SA 3H0FA 5CQXA 1B07A 1VQ4A 5J26A 4LDXA 1DJ7B 3DLMA 5LJ5g 5GANe 1HSQA 3CCET 1NYGA 4JRPA 2F2VA 4PK4A 3QDFA 2DVJA 4Z8AA 1ACMB 1KC8R 2QDYB 1IB8A 3CC2T 5LJ5d 4EPCA 2DTIA 2RHIA 5D7UA 3T9NA 2A08A 3ASKA 2KSSA 2YUOA 2A7YA 2EWNA 3OYBA 2LCSA 5GAOq 2X4XA 3A98A 3MEVA 5I21A 3RESA 3NHNA 3OS5A 4ESRA 5GANd 5LJ5j 3M56A 1O75A 5KYXA 1VQ8Q 2D8JA 2OJ2A 1WNLA 5HCKA 2CS7A 1I0CA 3OYYA 4O5VA 4RMOA 3JB9I 3NFCA 3UDCA 2QQSA 2K3XA 4JDSA 1AZEA 4LD9K 4E2FB 5I22A 2EJ9A 1KD1C 2CH4A 3SWNC 1GCQA 2DO3A 3M57A 3G4SA 5KYWB 4M7AG 3CCVA 1KD1U 1OV3A 2JS0A 4PJMA 4MMLA 1Q7YR 1OYXA 1RUWA 1H92A 1NG2A 4J9IA 1SG5A 3CMAT 4VUBA 1S72A 4NL3A 4PJOD 3HKSA 3CC4Q 1E6GA 2X4JA 3CEYA 1NM7A 2BE7D 2QA4T 4GLMA 3M0QA 1F1BB 1Q82C 1K1ZA 3I55T 4EDUA 4M7DG 7AT1B 1QWFA 3EFOB 4JS5A 2DL5A 3OW2S 4OP0A 3KBGA 5GAMe 3CCLA 1R77A 2PQWA 4AFZC 2CP6A 2EGCA 3RR6A 2DPPB 2DXTA 5CCAA 1YITA 4R0KA 1BK2A 2FZCB 4Q5WA 3G71T 4HCCA 1WXBA 4OMLA 5GANg 3RMSA 2ZGWA 5GANf 1E7OA 1X6GA 1BCMA 5CO7A 2HQHA 2E3IA 3IQLA 3H41A 3QIIA 1VQ7Q 1T3SA 3VYGA 2RJDA 1WPYA 4QQDA 3EAEA 1YI2A 1IHVA 3NTHA 2MIOA 1BI2A 1S72Q 2ED1A 2K2MA 1Q7YU 4ATOA 5LJ5h 2PVOB 3EGDA 3TVTA 2KROA 1O9SA 1W6XA 1GXIE 2PUKB 3DB4A 4IIOA 1VA7A 4D6WA 2XI9A 1PSEA 1UEBA 3CCJQ 4WTOB 2GCXA 2P0PA 3LYIA 4KGXB 1UE9A 1Q95G 2IG0A 4QVCA 4M78E 1U5SA 4C92B 5GAN8 2E64A 2COZA 2PVGB 1LCKA 4DOVA 2LCLA 3WXMB 5LJ5e 5D6WA 4BE1A 3MHXA 2KXDA 1U3OA 1ZUUA 1LVKA 4JJDA 3G4ST 5CKFA 2ZZDA 1MGQA 4XU1A 1VQOT 3OYJA 2L3QA 3MJXA 2CUBA 2FO0A 4KGZB 4M77F 1X75C 2F2XA 1U1SA 3JCMd 4KH1B 4UC4A 2YRVA 2ENMA 2JOYA 4PJOE 1I81A 1K76A 1UGPB 3PMTA 3LWHA 2DJZA 1M1KR 4FT2A 3A1PA 4R56A 4M75F 3M0RA 4ZN3A 2OAUA 1MV3A 2CSIA 3CCEA 2MAMA 4C0FA 4C5EA 3BW1A 5CQYA 2E4HA 3JCMQ 1NPPA 2ATCB 1UGSB 4OB2B 2C06A 4EIKA 2EKOA 1K9MC 3X28B 1VQOQ 1PKTA 4F7UB 1LOJA 3M58A 4J9GA 2OTJQ 1QKXA 4KULA 3JSCA 4RG2A 1KK7A 2FZKB 3A8HB 4M78B 1OX9A 5GAN5 4NOYA 2E10A 3X26B 1MMAA 1YNZA 4ZGJB 2RJEA 5KYXB 2HCKA 4XTZA 5C0MA 1BIAA 4ZGEB 1UECA 1JJ2A 2VV5A 3F70A 5HY6A 3CCVT 5GAN2 3S6WA 2AZVA 4AFQC 2DBKA 4AT1B 2GTJA 2DIGA 1YHQT 3L2RA 3DLLA 5I2SA 1SRMA 1S72T 1ZSZB 2DYBA 4AG2C 4M7DB 5GANh 1X6OA 2BE9B 3QWYA 2K9GA 1IGQA 1I5OB 1WA7A 2AHJB 2F5KA 2E5QA 4BI8B 3VS4A 2HMAA 1VQMQ 1B7TA 3CPWP 2V8IA 2GTOA 4DBQA 3BFMA 4F04B 2LQWA 2OTJT 3HTRA 4CI0C 1ZA1B 2YHTA 2FRWA 3E1SA 3SHWA 1Q81R 4DBHA 1OPLA 2XKOC 4C0DC 4BACA 2EIFA 5D6YA 3I56A 1QVGS 2X3WD 3TREA 1U06A 2DL7A 2KK4A 1M90R 1PC0A 4A4GA 2QQBA 3PFSA 2MOXA 2O2OA 2X4WA 1E6HA 2RO0A 5IXFA 2LTOA 3MCAB 1LJOA 4F7UE 2QA4Q 1Y7XA 2JZ2A 4HKEA 3RIRA 1KHCA 5CK9A 2EYWA 4M7AE 4LDWA 2EYXA 3FIFA 1YIJT 2KT8A 3S3MA 4IIMA 1XTDA 3SDZA 2X3XD 5AYFA 3FDRA 3CPWS 1AWXA 2JMAA 1WQ7A 2GFUA 1ZBXA 2QTVA 2B8AA 3SFMA 2C0OA 4V2SA 3MEUA 4XQ3A 5CKEA 1SRLA 4IKFA 2DXBA 2FVUA 1WHHA 1RAEB 2X35A 2WSFE 4M77E 2LJ0A 5LJ5f 1BKBA 3V7SA 2H3JA 2QA4A 1D3BA 1WQWA 3PVQA 2MF2A 3PGGA 3QKJA 1KFZA 2YXYA 3JB9F 1IHWA 2H3EB 1PRMC 2EKHA 2LX7A 1KSWA 3X24B 2KAFA 4PFOA 2NUZA 2CZ6B 2O9VA 2CREA 5GMKi 1IGUA 1G3SA 4DEYA 1M3AA 3CMEA 2O4XA 4LE9A 1QCFA 2DL8A 3JB9J 4C92E 4PJOA 2RPNA 2QAZA 1X69A 2XMFA 1YJNQ 3FJPA 1HYOA 2COWA 1VQ7T 2HSPA 4HVVA 3VS2A 1UTIA 1Y96B 4F16A 2E1HA 2DILA 2ZAEA 3I9QA 4OMNA 1YWPA 2KNBB 4FU6A 1K8AC 3V8LA 3VV0A 3EH1A 5FWBA 1GBRA 2OTLQ 4GY5A 3CC7Q 2L3PA 1G83A 2PZ1A 1VIFA 1MMDA 4KGVB 2A3LA 4RTWA 1SKUB 4RCCA 4HVUA 3UATA 3MPUB 4C8QG 3C94A 3FRNA 3LH0A 4LD6A 4OB3B 1RAGB 1OULA 1K8AU 2LQKA 2VGNA 1G2BA 1RL2A 1K73R 2DM1A 1D0XA 2MK5A 4CC2A 2V8KA 3QWXX 2EQJA 4OMOA 5GAOr 3QPHA 4C92F 1BCOA 4C8QD 3JCMJ 2M9UA 4MZPA 4X9DA 4JRQA 2EQMA 3J80E 1ZLMA 3CMET 2L3RA 4C0GA 2D0QB 1VQ4T 3JCMW 2E12A 1SPKA 4MDWA 1NJIR 2JMCA 4C8QB 2F1LA 5KE2A 3CCMQ 4C0ZA 2E70A 4ZTFA 2YRCA 3M0TA 2OAWA 3OW2A 1IRXA 2LC4A 3QUIA 4BY6C 2L5QA 3MO8A 4LUEA 2OTJA 3CCQQ 1VQ8A 1TSFA 1Q7YC 1HD3A 3Q1JA 4L6V5 1BI0A 1Y71A 2KYBA 3I56T 4II1A 3E19A 2LNVA 2R5AA 2QEXT 1N5ZA 3X25B 3CC7A 1K73C 2QK0A 2MWPA 1VQ7A 1D3BB 4P5NA 4E7JA 3CCEQ 2DNUA 3VRYA 1RI0A 4EMKB 4PJOF 1M3CA 4E6RA 4PLIA 4PJLA 1WDXA 3AHUA 3H0IA 2L8DA 4QKUA 4X9CA 4XU2A 1FYNA 1RAHB 2JS2A 1TH7A 3CCLQ 4F7UF 2D1XA 1ZSGA 1VQMT 1KHIA 2J6OA 2LP5A 3OYEA 2EJGA 1YCYA 4BI3A 5CKDA 5CVIA 4LUDA 1WZOA 2ROLA 3X20B 3NMZC 2HAXA 1T3LA 3CCJT 3JCMP 1WJSA 3EGUA 4KUDK 9ATCB 2LJ3A 3OQ5A 2I2LA 5D6XA 3R6OA 4A54A 2A28A 2LQNA 1MUZA 1R8OB 3A8OB 2NWMA 2DRMA 1VQPT 2VUBA 2FB7A 2VWFA 4E7SA 1KQ1A 1TUGB 1T0JA 1BU1A 4JJBA 1CKBA 1D1CA 1YP5A 4C92D 1QQJA 3CXCP 3LGFA 3C12A 2FL7A 2P4TA 1LNXA 3EHRA 3M0SA 2JXBA 3VKIA 3BDLA 5GAN4 1RADB 3OYCA 2LX9A 1C6VX 2RK2A 2EPDA 2P0QA 3QYGB 4OMMA 4OMFB 1Y0MA 5GANj 2RQWA 4BUGA 3OYIA 1V76A 3PIPA 3CD6Q 5GJVB 2RM4A 2CDTA 4PLLA 2BZYA 2XK0A 2FEIA 2EYQA 3LW5E 5FU6B 4M77A 1PD1A 2KMTA 4CRIA 1V1CA 3M0UA 1K0XA 2GNCA 5GMKj 1RACB 3CC4A 4BB7A 1WLPB 2C0IA 5I2MA 4IUUA 3VUBA 4PNOA 4A4FA 1SHFA 3CPFA 1X2QA 1M8MA 4M75A 2DZ9A 3M0PA 3OMCA 1OI1A 5A0GA 3CMAQ 4M77G 2V1RA 1N27A 2Y4XA 1VQLA 4A4HA 4FSSA 2LDMA 3BE3A 2NUPB 3EG9B 1SEMA 2LVMA 3L2ZA 1OPKA 3G6EQ 2DYIA 4IURA 3CCRA 2F5TX 1ZSZC 5GAMg 1RAFB 5A0LA 3OB9A 1G8XA 4C8QF 1X2KA 4AG1C 1C0MA 4D8KA 4KBMB 2PNIA 1VQ5A 3OYDA 3CCSA 3E9FA 2YRDA 4J6YA 4QVDA 3RBBB 3JB9D 1W2BP 2MPXC 4FW2A 5A0DA 3P8HA 1W4SA 1M2VA 1Y57A 1N9RA 2ESWA 2VYTA 5IHNA 5GAN7 1TXQA 2KT1A 3OMGA 5LJ3g 4XTWA 2DD5A 5GAMj 4C0DB 2PTKA 4AFUC 2EFIA 2EGAA 2JTFA 3CC2Q 1JQQA 2QEXQ 3UPUA 4M7DD 2CP0A 4RCBA 5DY9A 1XOVA 2O88A 5GAN3 1QMCA 5KYNA 2CZ1B 2DF6A 1TWBA 2H8HA 3RKYA 2M1HA 1UDLA 4OMPA 1N8RC 3H6ZA 2RHYA 1Y96A 3OBWA 1UGRB 4PL6A 1RAAB 2LNHB 3PNWC 1WXTA 5KYYB 3GF5A 2FYKA 4XTYA 3QDRB 4M78G 4E7KA 1KC8U 5GMKm 2KRMA 3GNFB 3QJYA 3CCSQ 5IHIA 2DVEA 4OB0B 1G3TA 1S1NA 1B34B 4C5HA 1JJ2P 3KXTA 1JO8A 2DX1A 3UF4A 3VRZA 1YJ9Q 4Z88A 1B34A 2D0NA 2SEMA 2KEAA 4PJNA 3SEMA 3MEWA 3JCMh 5KH6A 3D7SB 3G6EA 3QZ9B 1H3HA 2RJFA 1UHFA 4IUTA 4Y28E 2HZYA 2KQWA 3OW2P 3EGXA 2BKDN 3EG0A 5GMKh 4HCBA 1QP3A 1YBYA 4FYXB 1JXMA 2RA2A 5IXBA 2AT1B 4BE0A 2G3RA 1VQPQ 4HT8A 2DXUA 2GQVA 2NUTA 1QVFP 1FXXA 2AKKA 5J39A 4ELYC 3INZA 1VIEA 3EG2A 4F17A 1GFDA 1ZHIA 4JPBW 3H9NA 2HEQA 2QQ9A 2CT3A 2MWOA 1RLPC 1KQ2A 3CCST 4KUIA 4C92C 4LDVA 3DKMA 3QG1A 3LX7A 4XTUA 4FT4A 2R57A 3UA7A 2QDLA 4C8QA 5KCHA 1BBZA 2O31A 2GF7A 1I4K1 3EHQA 5GAOm 2CH4W 2JTEA 4C8QC 1JBMA 1YIJA 1X27A 2ECZA 1EZZB 1I5LA 1KIKA 4J9BA 3R6NA 5L23A 2RB6A 1NZ9A 2XICA 3H8ZA 3LGLA 3PE0A 1M90C 4XK8E 4FYVB 1QWEA 4IUPA 3N5BB 3CQTA 4J6WA 4JZ4A 3O8VA 3QHSA 4FYWB 2PU9B 2AZSA 3CCQT 1QVFA 2DIQA 2YT6A 2KRNA 1M30A 1HJDA 1V29B 1K9MU 4M7AC 4B9XA 4OMQA 2BIVA 5CIUA 2A36A 2HSEB 3PTAA 4RTVA 2FPFA 1M90U 3OYMA 1VQLT 1WJRA 3I35A 3HRSA 4BDZA 3OYLA 1TUCA 4HT9A 1EX4A 2RJCA 3JCMc 4M7DC 2LJ1A 2XIDA 4C8QE 5LJ3h 4RTTA 2YSQA 2I0NA 5EG2A 3G6ET 5KYUA 3ER0A 1G3YA 4XU3A 4A4EA 3HPWA 2XD0A 2NLUA 4M7DA 4JLGA 1PM3A 4C5IA 1AWJA 2KDSA 1PCXA 2E6NA 1OU9A 1JRIA 1GFCA 2QQAA 1BYMA 4YTLA 2ED0A 2KE9A 2CSQA 4PJJA 2DLPA 3TSWA 2JTMA 1Q82R 2RQRA 5CKHA 4OF1A 2RK1A 2JM9A 2W10A 5GAN6 2DL3A 4J9CA 2R58A 1WGSA 4J6XA 4JZ3A 2MMPA 3JCMb 3OYAA 5FLXE 1M2VB 2V26A 1LPLA 3O5ZA 4A53A 4PJOB 3REAB 2YUNA 2FPEA 2GQIA 2EQUA 2GGRA 5IN1A 2K4YA 1WX6A 3CCQA 2RN8A 4M77D 2PVDB 2ZPHB 2JNGA 1M1KU 2RI2A 1GRIA 2X9HA 3HHTB 1VQ6A 3E2UA 4O6JA 3LWIA 4QQGA 2KBTA 3HSBA 3NPFA 5CR2A 1VQNT 4BD3A 2DERA 1KG1A 4PFPA 3UWNA 4RUGA 1G3WA 1PWTA 4M75D 1W2BA 2ZCFB 1D0YA 1PG5B 3A8LB 2P4RA 5J3BA 2ZPIB 2DETA 2KVQG 5I11A 1YHQQ 5L8RE 2XDDA 2RD1A 1RLQC 4M75B 3VS1A 3CCVQ 2DBMA 3RKWA 1WFWA 2YWWA 3EG1A 3CPWA 2CP2A 3E9GA 1ARKA 4A63B 2DRKA 2QI2A 5HK0A 2K6DA 1CKAA 1AWWA 2YLBA 3A8MB 4A4KA 1W1FA 4M75C 2DKGA 2ROTA 1QKWA 1WI7A 4C92G 3EGXB 4J8OA 1NPRA 4BY6B 1GCPA 3TEEA 2L2PA 1TUDA 2ZPBB 2L0AA 1MNDA 2DXCA 2EW3A
chains in the Genus database with same CATH topology
4C92D 1MGQA 4XU1A 1VQOT 3FB9A 3GOXA 3OYJA 3LGFA 4E7IA 3C12A 2KY9A 4ZN1A 2FL7A 4M77F 2O01E 2P4TA 3A5ZB 1YJWA 1LNXA 1BI3A 1I8FA 1X75C 1BI1A 3J81E 1VQ6T 1U1SA 3JCMd 4UC4A 2YRVA 3VKIA 2JOYA 3S3NA 4PJOE 4M7DF 4C92A 3BDLA 5GAN4 4M7AD 2LT4A 1I81A 2F69A 2LX9A 3OYCA 1P92A 2RK2A 1UGPB 3PMTA 3HRUA 2DD4A 2P0QA 4LDUA 3LWHA 3QYGB 3M4GA 2DJZA 1YHQA 4OMFB 5FU7C 5GANj 4FT2A 4BUGA 4R56A 1Q81C 4M75F 3PT9A 3OYIA 3PIPA 2Y90A 3OS2A 1JJ2S 2RM4A 5IAYA 4PLLA 4ZN3A 2XK0A 2OAUA 4J7FA 2EYQA 4N0AA 3LW5E 3CCMA 3G7ZA 4M77A 5FU6B 2KMTA 2OTLA 2LCCA 4M7AB 3CCEA 1Q81U 2MAMA 5LL6S 1WJQA 4CRIA 5GAOp 4Z02A 5GMKj 2GFAA 3CC2A 2BUDA 1VQMA 1VQKT 4EMGA 1YITT 4OVAA 4C0FA 3CC4A 4BB7A 4C5EA 3CXCA 2E41A 4JS4A 5I2MA 3BW1A 4RG8A 4ZTJA 2XU8A 4IUUA 4KT0E 5CQYA 3JCMQ 2XDPA 1NPPA 1UGSB 3VUBA 4OB2B 2C06A 4M7DE 5GAMf 4PNOA 3A8GB 4A4FA 2EKOA 3SB2A 3CD6T 2DTHA 4M78D 3OYFA 4MZTA 3HFOA 3CPFA 1K9MC 3X28B 2M0OA 2DEQA 4M75A 2DZ9A 4OB1B 2RHZA 3JCMf 1YJNA 3OMCA 4L59A 4F7UB 1LOJA 1OI1A 2V8JA 3M58A 5A0GA 3C95A 4KULA 1U1TA 4M77G 3JSCA 1HXDA 4XTVA 2CKKA 4F7UG 1N27A 3EFRA 4RG2A 5C6SA 2Y4XA 3L2UA 1VQLA 4JJNK 2ZPGB 3QJ6A 4A4HA 2LDMA 1Q86C 3V7RA 3VJPA 5KE3A 3UT1A 2LVMA 5FRMA 3A8HB 4M78B 1NE8A 5GAN5 2DAQA 1N9SA 4NOYA 3L2ZA 2O4XB 3FEOA 4QQ6A 2E10A 4DOWA 3HRTA 3X26B 2JUFA 3QXEB 1Q86U 4ZGJB 1M9SA 2RJEA 4IURA 3CCRA 3HP9A 4N0AC 5DLOA 2F5TX 4XTZA 2VXFA 1Q82U 5C0MA 5GAMg 3OYNA 5A0LA 3OB9A 1BIAA 4ZGEB 3WVEB 4C8QF 2LRQA 1JJ2A 2VV5A 4J7IA 3F70A 5HY6A 3CCVT 5GAN2 3S6WA 4PJOC 4F7UA 1W2BS 4KBMB 1VQ8T 1VQ5A 3OYDA 4NS5A 4J5YA 3CCSA 3E9FA 4J6YA 1QVFS 4QVDA 1H641 2DIGA 3JB9D 5HKCA 1N6AA 3L2RA 5A0DA 1IZ6A 3P8HA 4EMKA 3V8KA 2JVVA 3DLLA 3JRZA 1FX7A 1W4SA 4TVRA 5I2SA 1M8VA 1S72T 4M7DB 5GANh 1X6OA 2DZCA 1N9RA 1FWZA 2DTOA 5FU7B 2VYTA 5GAN7 5DLQE 2L89A 1N8RU 3GIBA 5FU6C 3CC7T 2FHDA 4OGCA 2OTLT 1YHQT 3CBOA 3OMGA 2HD0A 4HCZA 5LJ3g 2AHJB 4XTWA 2F5KA 3I55A 4E7HA 2DD5A 2E5QA 5GAMj 5GAOn 4C0DB 5LJ3f 4BI8B 1K73U 1BIBA 2EFIA 4IUQA 2JTFA 5GMKl 1KQSS 2V8IA 3RMQA 4WF2A 3CCLT 1U8RA 3UPUA 3BFMA 2ZPEB 2OTJT 3JCMV 4M7DD 4CI0C 2YHTA 4RCBA 1XNIA 5DY9A 3E1SA 1XOVA 2LQ8A 1XQHA 4XU0A 3G71A 3MP8A 5GAN3 1QVPA 2XKOC 4C0DC 4BACA 2CZ1B 2EIFA 1YJNT 3SD4A 5HK3A 3JB9H 3CMAA 5D6YA 3M55A 3I56A 3RKYA 3M53A 3V7CA 2M1HA 1QVGS 3TU4K 1N8RC 3LLRA 4L5GA 3P8BB 3TREA 3H6ZA 1KQSA 2KK4A 2RHYA 5LJ3j 3OYKA 1Y96A 2EAYA 3OBWA 4A4GA 1UGRB 4PL6A 2QQBA 3PNWC 4QW2A 2K5FA 2D9TA 3PFSA 5LJ3d 4M78C 3GF5A 2FYKA 4XTYA 2X4WA 3FLGA 2HQEA 3QDRB 2RO0A 4M78G 3CCMT 2LTOA 4E7KA 3MCAB 4XAXB 4E7LA 1KC8U 2CGHA 2YLCA 5GMKm 1LJOA 4F7UE 3OS1A 1Y7XA 2JZ2A 1PSFA 4HKEA 1KHCA 2QTXA 1MHNA 3GNFB 3RIRA 5FROA 3V8JA 4LDWA 4M7AE 3QJYA 2RHUA 2DVEA 5A2QE 3FIFA 3M5AA 4OB0B 1YIJT 2E65A 3OSSC 5GMKe 3CCRT 1G3TA 1QVGA 2CYZB 1VQPA 1B34B 4C5HA 3KXTA 4HA8A 1B34A 3S3MA 2D6FA 2WSCE 2K5LA 3OY9A 3FC3A 4ZGDB 1XTDA 3OBYA 4MMKA 3SDZA 3MEWA 2K3YA 2RHXA 3JCMh 3ZBDA 5KH6A 5AYFA 3L2WA 3G6EA 3FDRA 5GAMd 3QZ9B 3ME9A 2RJFA 4IUTA 3BY7A 3MEAA 4JRKA 4PKCC 4Y28E 3CPWS 4EMHA 2XHCA 5CK9A 2QEXA 2KQWA 1WQ7A 2BKDN 2GFUA 1M5Q1 1ZBXA 1VQNA 1NJIC 2B8AA 1VQ9T 3SFMA 3M54A 1QP3A 1YBYA 4GLKA 3RUXA 5GMKh 3KUFA 4HCBA 4V2SA 3MEUA 4XQ3A 5CKEA 3L42A 4ME7A 3OYHA 2RA2A 4JUVA 3PIOA 4M7AF 4IKFA 2HQXA 3JCMe 2DXBA 4BE0A 3TCJA 4R55A 2FVUA 2G3RA 3OYMA 1VUBA 4HT8A 2DXUA 2X35A 4FIBA 2GQVA 1X01A 2JN0A 1FXXA 5J39A 2LT1A 4J83A 4ELYC 3INZA 2WSFE 4M77E 1VIEA 3JAME 5LJ5f 1BKBA 3V7SA 2H3JA 4LDYA 3VUZA 2QA4A 3CBPA 1ZHIA 1D3BA 1WQWA 3OSVA 2MF2A 3PGGA 2QQ9A 3QKJA 2MWOA 3JB9F 3GLXA 4M75G 1KQ2A 2VC8A 3J7AF 3CCST 2QXFA 4KUIA 3X24B 2ZPFB 2KAFA 4BDYA 3ZEHA 4C92C 2VGMA 4N4GA 4NL2A 4LDVA 1QP2A 1YJWT 2CZ6B 3DKMA 3HFNA 3LX7A 3QG1A 4FT4A 3BDUA 2R57A 2EQKA 4XTUA 4C8QA 5GMKi 5GAMh 1G5VA 5KCHA 4RKUE 4FSXA 3VYHB 3CCJA 3CD6A 2HBPA 3P8DA 3PMIA 4M78A 3C4SA 1G3SA 2GF7A 5CQXA 3QYHB 3CMEA 1YJ9A 2O4XA 4PJOA 1I4K1 3JB9J 4C92E 4QVZA 5GAOm 1VQ4A 4C8QC 5J26A 2IVWA 3FJPA 3OA6A 4LDXA 1DJ7B 1JBMA 1YIJA 5KCOA 3DLMA 1UB4A 5LJ5g 5GANe 1VQ7T 1I5LA 3GNGA 3CCET 2K57A 1Y96B 2E1HA 4JRPA 2RB6A 2WACA 1NZ9A 2XICA 1VQOA 4FU6A 3H8ZA 3QSUA 1OZ2A 3LGLA 1M90C 2QDYB 4XK8E 1K8AC 3V8LA 3WVDB 3CC2T 3QZ5B 5LJ5d 2RH2A 1VQKA 3OYGA 3HL8A 3VV0A 2DTIA 4EPCA 3JCMX 2PUOB 2RHIA 4IUPA 3N5BB 3T9NA 4J6WA 4M78F 3ASKA 2VXEA 2KSSA 3L1AA 3O8VA 3META 4PJOG 2A7YA 2EWNA 4GY5A 3OYBA 4BE2A 3QHSA 5GAOq 2X4XA 2PU9B 3MEVA 5I21A 3CCQT 3OS5A 1VIFA 4N4IA 3RESA 1QVFA 2Y4YA 5LJ3e 1QW1A 5M9OA 2A3LA 5DM7R 3JB9G 1K9MU 2DIQA 2EJFA 1NJIU 5GANd 5LJ5j 4BI4A 4C5GA 2CZ0B 4RCCA 2CZ7B 1V29B 4C8QG 3C94A 4B9XA 2BIVA 3FRNA 3LH0A 1O75A 3M56A 4LD6A 5CIUA 3OS0A 3PTAA 4OB3B 1WNLA 1M90U 2CS7A 3OYYA 2LQKA 4O5VA 4RMOA 3JB9I 2VGNA 3NFCA 1RL2A 1WJRA 3UDCA 3HRSA 1VQLT 4BDZA 2QQSA 3OYLA 4HT9A 2RJCA 2K3XA 3JCMc 4JDSA 4LD9K 4M7DC 4Y91A 2XIDA 2EJ9A 3CC4T 1KD1C 3CCUT 4C8QE 3NTKA 5LJ3h 1YI2T 5EG2A 3G6ET 3SWNC 2DO3A 3CBMA 3M57A 4JRIA 3ER0A 3CXCS 1G3YA 2V8KA 4XU3A 3G4SA 2EQJA 4A4EA 4M7AG 3HPWA 3CCVA 1AHJB 1M1GA 3VU3C 2NLUA 5GAOr 3QPHA 4C92F 1KD1U 2R5MA 2XD0A 4M7DA 2E6ZA 4JLGA 4C8QD 4E47A 4C5IA 3JCMJ 1VQ9A 2M9UA 3EFSA 5CKBA 2KDSA 4MMLA 2E6NA 4MZPA 3QBYA 1OYXA 1JRIA 2MI6A 4X9DA 5CAIA 2QQAA 3RERA 1H3ZA 3M9QA 4JRQA 2EQMA 3S3OA 3J80E 3CMET 1YJ9T 1BYMA 3CMAT 4VUBA 4YTLA 1S72A 4NL3A 4PJOD 3JCMg 3HKSA 2L3RA 4C0GA 2D0QB 1VQ4T 2JTMA 3DB3A 3JCMW 2E12A 5CKHA 4OF1A 2RK1A 5GAN6 3SWNA 2X4JA 3CEYA 4MDWA 4ELZC 1OZ3A 4C8QB 2QA4T 2R58A 1WGSA 2XG8D 4J6XA 4M77B 5KE2A 1Q82C 4C0ZA 2E70A 4M7AA 2MMPA 1SSFA 3L2QA 4ZTFA 3I55T 3JCMb 4EDUA 5FLXE 3OYAA 4M7DG 4A53A 1EIFA 3OW2A 4JS5A 2K2VA 2K5IA 4PJOB 2LC4A 4N4HA 3QUIA 4OP0A 2L5QA 3KBGA 2RI3A 4BY6C 5GAMe 3OW2S 3CCLA 3MO8A 2XDBA 2EQUA 2PQWA 1M1KC 2OTJA 5IN1A 1K8AU 3GPLA 2K4YA 3RKXA 4MZMA 1VQ5T 1VQ8A 2DPPB 2DXTA 5CCAA 4M77C 3CCQA 1YITA 4M77D 2PVDB 4Q5WA 3G71T 4HCCA 2ZPHB 1M4ZA 1Q7YC 2JNGA 1M1KU 2RI2A 3Q1JA 3HHTB 1BI0A 4L6V5 1Y71A 5GANg 3RMSA 3URGA 1VQ6A 2ZGWA 3I56T 4II1A 4O6JA 5GANf 3LWIA 3E19A 3GP8A 2LNVA 4M75E 2R5AA 1KC8C 2QEXT 4QQGA 3HSBA 5CO7A 3X25B 5CR2A 5FRNA 3CC7A 1K73C 3M4YA 1VQNT 4BD3A 2WSEE 1VQ7A 2MWPA 1KG1A 1Y07A 1IREB 3UWNA 1D3BB 4P5NA 4E7JA 3QO3A 3MP6A 1G3WA 3QIIA 2M16A 2QQRA 4FM4B 4M75D 1RI0A 4DA4A 3VYGA 2RJDA 2ZCFB 1WPYA 4PJOF 3A8LB 4QQDA 3ZFJA 4EMKB 3CCUA 3EAEA 4PLIA 1YI2A 3NTHA 3AHUA 1BI2A 5IT9E 2L8DA 4X9CA 4XTXA 5J3BA 4M7AC 2ZPIB 4XU2A 3MP1A 2KVQG 1Q7YU 4ATOA 1M1FA 1TH7A 5LJ5h 2PVOB 5L8RE 4F7UF 2XDDA 2RD1A 3SWNB 1VQMT 2HNIA 1O9SA 4FL6A 4M75B 4EMKC 1KHIA 1HK9A 4MDXA 1GXIE 4DQ2A 2PUKB 3DB4A 3RKWA 2X4YA 4D6WA 2XI9A 1PSEA 3OYEA 3L2VA 1UEBA 2EJGA 1YCYA 3CPWA 2GCXA 2P0PA 3E9GA 3LYIA 3NTIA 2QI2A 4BI3A 5CKDA 5HK0A 4X34A 2IG0A 5CVIA 4IUVA 4QVCA 3M59A 4M78E 3X20B 2HAXA 2YLBA 4C92B 3CCJT 3A8MB 1WJSA 4A4KA 3JCMP 4KUDK 4OGEA 3OQ5A 2I2LA 4M75C 5D6XA 2DKGA 2E64A 3R6OA 5GAN8 4A54A 1JB0E 1ZQ1A 2DK3A 3A8OB 1R8OB 2PVGB 4C92G 4DOVA 2RI5A 4J8OA 1NPRA 2LCLA 4JLIA 3WXMB 5LJ5e 5D6WA 4BY6B 4BE1A 2P0KA 1VQPT 2VUBA 3MHXA 5GAOl 2FB7A 1W2BA 3TEEA 1KQ1A 2ZPBB 3G4ST 4B9WA 1UGQB 5CKFA 2ZZDA 2DXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C92 D;  1MGQ A;  4XU1 A;  3FB9 A;  3JCM W;  3JB9 F;  5GAN h;  2DZC A;  4M75 G;  4M7D B;  1N9R A;  2VC8 A;  1KQ2 A;  4M7D E;  2DTO A;  5GAN 6;  5GAN 7;  3GIB A;  3SWN A;  4M77 F;  4C8Q B;  1LNX A;  1I8F A;  4C92 C;  4J6X A;  5LJ3 g;  4M77 B;  4NL2 A;  4XTW A;  4M7A A;  5GAM j;  1U1S A;  3JCM d;  3HFN A;  4XTU A;  5LJ3 f;  5GAO n;  3BDU A;  3JCM b;  4C8Q A;  1BIB A;  5GMK i;  5GMK l;  4M7D G;  5GAM h;  4A53 A;  4M7D F;  4C92 A;  4PJO E;  5GAN 4;  4M7A D;  4WF2 A;  1I81 A;  4PJO B;  3BFM A;  4M78 A;  3QUI A;  4OP0 A;  5GAM e;  3JCM V;  4M7D D;  2YHT A;  3M4G A;  2DJZ A;  4RCB A;  4PJO A;  1I4K 1;  3JB9 J;  4C92 E;  5GAO m;  5GAN j;  5DY9 A;  4XU0 A;  3RKX A;  4C8Q C;  3FJP A;  2DXT A;  4M75 F;  2Y90 A;  1JBM A;  4M77 C;  5GAN 3;  2RM4 A;  4M77 D;  5LJ5 g;  3JB9 H;  5GAN e;  1I5L A;  2K57 A;  4N0A A;  1Y96 B;  3RKY A;  3V7C A;  5GAN g;  2E1H A;  4M77 A;  2RB6 A;  2ZGW A;  4M7A B;  5GAN f;  5GAO p;  3QSU A;  4M75 E;  5GMK j;  5LJ3 j;  1Y96 A;  2EAY A;  3HSB A;  4EMG A;  3V8L A;  5LJ5 d;  2DTI A;  4M78 C;  5LJ3 d;  2E41 A;  2FYK A;  3JCM X;  4XTY A;  3BW1 A;  4M78 G;  4J6W A;  1D3B B;  4M78 F;  3JCM Q;  3QO3 A;  2VXE A;  2CGH A;  2YLC A;  3L1A A;  5GMK m;  1LJO A;  4F7U E;  4PJO G;  4M75 D;  4PNO A;  2EWN A;  3RIR A;  4EMK B;  2QTX A;  1WPY A;  3QHS A;  4PJO F;  3SB2 A;  3V8J A;  4M7A E;  5GAO q;  2DTH A;  4M78 D;  2DVE A;  3HFO A;  3FIF A;  5I21 A;  4M75 A;  2DEQ A;  2E65 A;  3RES A;  2DZ9 A;  5GMK e;  5LJ3 e;  3JB9 G;  3AHU A;  3JCM f;  4X9C A;  4XTX A;  2EJF A;  4F7U B;  1LOJ A;  1B34 B;  4XU2 A;  5GAN d;  5LJ5 j;  1M8V A;  1U1T A;  4HA8 A;  4M77 G;  1TH7 A;  4RCC A;  5LJ5 h;  1B34 A;  1HXD A;  4XTV A;  4C8Q G;  4F7U F;  4M7A C;  2RD1 A;  3SWN B;  4F7U G;  3EFR A;  4MMK A;  2HNI A;  3JCM h;  1WNL A;  4M75 B;  4EMK C;  1HK9 A;  3V7R A;  3JB9 I;  4DQ2 A;  5GAM d;  4JRK A;  3BY7 A;  4M78 B;  3RKW A;  4HT9 A;  3JCM c;  4EMH A;  5GAN 5;  1N9S A;  4NOY A;  3L2Z A;  2EJG A;  1YCY A;  4M7D C;  1WQ7 A;  2E10 A;  1M5Q 1;  4Y91 A;  2EJ9 A;  4C8Q E;  5LJ3 h;  4QVC A;  5GMK h;  3RUX A;  4M78 E;  4V2S A;  2YLB A;  3SWN C;  4XQ3 A;  4N0A C;  4C92 B;  4XTZ A;  2RA2 A;  2VXF A;  4JRI A;  4JUV A;  5GAM g;  3JCM P;  4M7A F;  4XU3 A;  1BIA A;  3JCM e;  2I2L A;  4M75 C;  5GAN 8;  2DKG A;  2E64 A;  4C8Q F;  3VU3 C;  4A54 A;  4M7A G;  5GAO r;  4M7D A;  4C92 F;  4HT8 A;  4C92 G;  5GAN 2;  2DXU A;  4C8Q D;  3JCM J;  4PJO C;  4JLI A;  1X01 A;  4F7U A;  3EFS A;  2JN0 A;  5LJ5 e;  4MML A;  5GAM f;  4J5Y A;  5GAO l;  1JRI A;  2FB7 A;  3INZ A;  4J6Y A;  4X9D A;  1KQ1 A;  4M77 E;  4QVD A;  5CAI A;  1H64 1;  5LJ5 f;  3V7S A;  3RER A;  3JB9 D;  4EMK A;  3V8K A;  1D3B A;  1WQW A;  3JCM g;  4NL3 A;  4PJO D;  3PGG A; 
#chains in the Genus database with same CATH topology
 2AK5 A;  3EFO A;  3FB9 A;  3GOX A;  4E7I A;  4ZN1 A;  1GBQ A;  1K9A A;  2O01 E;  3A5Z B;  1YJW A;  1H8K A;  1BI3 A;  1I8F A;  1VQ6 T;  1Q86 R;  2SRC A;  4Z89 A;  1ZSZ A;  4M7D F;  4M7A D;  2F69 A;  1P92 A;  1NYF A;  1OOT A;  1WHM A;  1SHG A;  5GJW B;  3I56 Q;  5IH2 A;  1YIJ Q;  2RQV A;  3JV3 A;  2FPD A;  1KJW A;  1JJ2 S;  5IAY A;  4N0A A;  2OTL A;  4M7A B;  1Q81 U;  5LL6 S;  1UJ0 A;  3CC2 A;  2BUD A;  1VQM A;  1VQK T;  4OVA A;  3CXC A;  2FRY A;  4JS4 A;  3ZL7 C;  4ZTJ A;  4RG8 A;  2XU8 A;  4KT0 E;  4WCI A;  2JW4 A;  1K0S A;  2XDP A;  2VB6 A;  5GAM f;  3SB2 A;  1D0Z A;  3CD6 T;  2DTH A;  2LZ6 B;  4MZT A;  5FWC A;  2DEQ A;  4OB1 B;  2RHZ A;  3JCM f;  1YJN A;  4L59 A;  1VQ4 Q;  3C95 A;  1HXD A;  4XTV A;  4F7U G;  1NEG A;  3EFR A;  3AT1 B;  2VVK A;  4M4Z A;  2ZPG B;  2K7A A;  3QJ6 A;  5KE3 A;  4FYY B;  3UT1 A;  1NE8 A;  3VS0 A;  2DAQ A;  3FEO A;  2M51 A;  1UUE A;  1FMK A;  1Q86 U;  3HP9 A;  1QCO A;  2LRQ A;  3C0C A;  4J7I A;  1QVG P;  1W2B S;  4HVW A;  4NS5 A;  1NEB A;  4J5Y A;  2V1Q A;  1VYV A;  1QVF S;  2JT4 A;  1H64 1;  3V8K A;  2JVV A;  3JRZ A;  1MMG A;  1FX7 A;  4TVR A;  3VS7 A;  1FWZ A;  1PHT A;  3PVL A;  3GIB A;  5DLQ E;  2L89 A;  1N8R U;  5FU6 C;  3CC7 T;  2FHD A;  4OGC A;  2OTL T;  2RQT A;  2HD0 A;  3TSZ A;  4E7H A;  5GAO n;  2J6K A;  1D09 B;  1PKS A;  2M0Y A;  2OI3 A;  1VQN Q;  4WF2 A;  3CCL T;  2K3B A;  4RTX A;  3JCM V;  1UFF A;  4XU0 A;  3G71 Q;  3G71 A;  1QVP A;  1YN8 A;  1YJN T;  1AT1 B;  2DA9 A;  3SD4 A;  3CMA A;  3M55 A;  3VS6 A;  3M53 A;  2J6F A;  3TU4 K;  3LLR A;  3P8B B;  4E7Z A;  1KQS A;  1CSK A;  1EFN A;  2W0Z A;  4QW2 A;  2G6F X;  4RTZ A;  1ZUY A;  1Z9Z A;  2RF0 A;  4E7L A;  1YJW Q;  2YLC A;  3UA6 A;  1FMV A;  4HCK A;  2RHU A;  4AMC A;  1VQ5 Q;  2E65 A;  1M3B A;  3OSS C;  5GMK e;  3CCR T;  2CYZ B;  1RI9 A;  3EG3 A;  4F14 A;  5KYU B;  1X6B A;  1NLP C;  3I5R A;  2MCN A;  2WSC E;  4LXC A;  4MMK A;  2K3Y A;  3ZBD A;  2DL4 A;  1PRL C;  4JRK A;  3BY7 A;  3MEA A;  4PKC C;  2XHC A;  2EBP A;  1M5Q 1;  1M27 C;  1NJI C;  1D1A A;  1VQ9 T;  3M54 A;  1ZUK A;  4GLK A;  3RUX A;  2BTT A;  8ATC B;  3OYH A;  4JUV A;  2COY A;  3PIO A;  2D8H A;  4M7A F;  3JCM e;  1AWO A;  2QAS A;  1OU8 A;  3TCJ A;  1VQL Q;  4R55 A;  2HKQ B;  2EQI A;  1YFN A;  4FIB A;  2QGF B;  2QYZ A;  2LT1 A;  2QGG A;  4J83 A;  2HL3 A;  3JAM E;  3CBP A;  3OSV A;  3VS5 A;  1YI2 Q;  3CCR Q;  3CCU Q;  3J7A F;  4J9F A;  5IHK A;  1ABO A;  3ZEH A;  2VGM A;  4N4G A;  4NL2 A;  4D8D A;  1YJW T;  2BZ8 A;  3THK A;  3HFN A;  3BDU A;  2EQK A;  2DMO A;  4CC4 B;  5GAM h;  1G5V A;  4RKU E;  3VYH B;  2HBP A;  3P8D A;  3PMI A;  1WXU A;  3QYH B;  1YJ9 A;  4QVZ A;  3OA6 A;  2IVW A;  3GBQ A;  5KCO A;  1UB4 A;  2Z0W A;  1RAI B;  1R0B G;  3GNG A;  2K57 A;  1GCQ C;  2DEU A;  2WAC A;  5FW9 A;  4Y92 A;  1VQO A;  3QSU A;  1NLO C;  2CUD A;  1OZ2 A;  4AFS C;  1TS9 A;  3WVD B;  3QZ5 B;  2RH2 A;  1VQK A;  3OYG A;  3HL8 A;  1UGV A;  2E5K A;  2PUO B;  3JCM X;  4M78 F;  2VXE A;  3L1A A;  3MET A;  4PJO G;  4BE2 A;  1W70 A;  1X43 A;  4GBQ A;  4N4I A;  2Y4Y A;  5LJ3 e;  1QW1 A;  5M9O A;  5DM7 R;  3JB9 G;  2EJF A;  4ANJ A;  1IXD A;  1C1A A;  4BI4 A;  4C5G A;  2CZ0 B;  2CZ7 B;  3FJ5 A;  5FRM A;  3OS0 A;  2KYM A;  2RNA A;  1XJW B;  4B6M A;  4CC3 A;  1I1J A;  2DE0 X;  3TQ7 P;  1QLY A;  4Y91 A;  3CC4 T;  3CCU T;  3NTK A;  1YI2 T;  1WYX A;  3CBM A;  4JRI A;  2J06 A;  3CXC S;  2DJQ A;  4CC7 A;  1AHJ B;  1M1G A;  3VU3 C;  2R5M A;  1JU5 C;  2E6Z A;  4E47 A;  1VQ9 A;  3EFS A;  5CKB A;  1VOM A;  3QBY A;  2QG9 B;  1K9M R;  2MI6 A;  5CAI A;  1H3Z A;  3RER A;  4JJC A;  2RQU A;  3M9Q A;  3S3O A;  1YJ9 T;  3JCM g;  3DB3 A;  1VQ9 Q;  2CP5 A;  4KH0 B;  3SWN A;  2JJ9 A;  4ELZ C;  1OZ3 A;  2XG8 D;  4M77 B;  4M7A A;  2HBW A;  1SSF A;  3L2Q A;  1EIF A;  2K2V A;  2K5I A;  2FG0 A;  2OX7 A;  1VYT A;  4N4H A;  5EC7 A;  4HXJ A;  1ZX6 A;  2RI3 A;  1OX8 A;  5ECA A;  4DBF A;  2NUP A;  3EG9 A;  1M1K C;  2XDB A;  1N8R R;  3GPL A;  3RKX A;  4MZM A;  1VQ5 T;  1A0N B;  4M77 C;  3VS3 A;  2HDA A;  1M4Z A;  1AOJ A;  1AVZ C;  2KR3 A;  2EYZ A;  3URG A;  3GP8 A;  4M75 E;  1KC8 C;  2KI7 A;  1RAB B;  2NYS A;  5FRN A;  1TU0 B;  3M4Y A;  4ZNX A;  2WSE E;  1Y07 A;  1IRE B;  3QO3 A;  3MP6 A;  1VQ6 Q;  2M16 A;  2QQR A;  4FM4 B;  4DA4 A;  2CP7 A;  3ZFJ A;  1R0C B;  1FMW A;  3CCU A;  2AKL A;  4X1V A;  5IT9 E;  4XTX A;  1JXO A;  3MP1 A;  1K8A R;  4LNP A;  1M1F A;  3G4S Q;  2JM8 A;  3SWN B;  2HNI A;  4FL6 A;  4EMK C;  1HK9 A;  4MDX A;  1MMN A;  4DQ2 A;  1B3Q A;  2X4Y A;  3EH2 A;  3L2V A;  2A0F B;  3NTI A;  4X34 A;  4IUV A;  3I5S A;  3M59 A;  5KYW A;  1IO6 A;  1M2O A;  4PFZ A;  4OGE A;  1JB0 E;  2YUQ A;  1ZQ1 A;  2DK3 A;  2RI5 A;  4JLI A;  1MNE A;  4DBR A;  2P0K A;  2VKN A;  5GAO l;  2L3S A;  4B9W A;  1UGQ B;  3REB B;  4ORZ A;  1MV0 B;  2M02 A;  4RTY A;  2KY9 A;  1PD0 A;  3KFV A;  2FZG B;  3ULR B;  4DEX A;  4QT7 A;  1BI1 A;  3J81 E;  2EYY A;  2B86 A;  4C92 A;  1YIT Q;  2LT4 A;  3HRU A;  2DD4 A;  4LDU A;  3M4G A;  1YHQ A;  2ABL A;  5FU7 C;  1PNJ A;  2IIM A;  1Q81 C;  3PT9 A;  1QCN A;  2Y90 A;  3OS2 A;  1D1B A;  1OQK A;  2E3H A;  2EGE A;  2LMJ A;  4J7F A;  3RDV A;  3CCM A;  3G7Z A;  2LCC A;  1WJQ A;  5GAO p;  4Z02 A;  1ZA2 B;  2GFA A;  1VQK Q;  4EMG A;  1YIT T;  2J05 A;  1J3T A;  2E41 A;  3I55 Q;  1YWO A;  1TOV A;  4M7D E;  3A8G B;  1WHL A;  4M78 D;  3OYF A;  3HFO A;  2M0O A;  1VYU A;  3H0H A;  2V8J A;  3EGD B;  1U1T A;  2CKK A;  4FW1 A;  5C6S A;  1SSH A;  3L2U A;  4JJN K;  1Q86 C;  1KD1 R;  3V7R A;  3VJP A;  1N9S A;  2O4X B;  4QQ6 A;  4DOW A;  3HRT A;  2F2W A;  2JUF A;  3QXE B;  1M9S A;  4N0A C;  5DLO A;  4RTU A;  2YUP A;  2VXF A;  1Q82 U;  3OYN A;  2A37 A;  1ABQ A;  2X51 A;  2RMO A;  3WVE B;  1GL5 A;  4PJO C;  4F7U A;  8AT1 B;  1VQ8 T;  1I07 A;  1WHJ A;  5HKC A;  1N6A A;  1IZ6 A;  3MKD A;  4EMK A;  4J9D A;  1M8V A;  2DZC A;  2DTO A;  5FU7 B;  1T0H A;  3CBO A;  4HCZ A;  3U23 A;  1KQS P;  3S3N A;  3I55 A;  5LJ3 f;  1K73 U;  1BIB A;  4IUQ A;  5GMK l;  1KQS S;  4J9H A;  3RMQ A;  1U8R A;  2MYS A;  1K4U S;  2DFU A;  2ZPE B;  1TG0 A;  1XNI A;  2LQ8 A;  2EVR A;  1XQH A;  2BZX A;  3MP8 A;  1ZBJ A;  4FCY A;  3LH5 A;  3JB9 H;  3G1J A;  5HK3 A;  3RNJ A;  3V7C A;  4K11 A;  4L5G A;  1AZG B;  4J9E A;  2CT4 A;  3OYK A;  5LJ3 j;  2EAY A;  1WIE A;  2K5F A;  2D9T A;  5LJ3 d;  4M78 C;  2K79 A;  3FLG A;  2HQE A;  3CCM T;  4XAX B;  2CGH A;  1NJI U;  2KGT A;  3OS1 A;  5FRO A;  1PSF A;  3NGP A;  2QTX A;  1MHN A;  3V8J A;  2C0T A;  2J7I A;  2KXC A;  2HL5 C;  5A2Q E;  3M5A A;  2O9S A;  2CP3 A;  1QVG A;  2NUT B;  1VQP A;  1YCS B;  2GBQ A;  4HA8 A;  3CME Q;  1JEG A;  2D6F A;  2K5L A;  3OY9 A;  3FC3 A;  4ZGD B;  3OBY A;  2P84 A;  6AT1 B;  2KRS A;  2RHX A;  3L2W A;  5GAM d;  3ME9 A;  4EMH A;  1UJY A;  1NBE B;  2QEX A;  4KRT A;  1VQN A;  3KUF A;  1WHG A;  2HKN A;  3L42 A;  4ME7 A;  1BB9 A;  2HQX A;  1AEY A;  1OEB A;  1VUB A;  2AIR B;  1UHC A;  1X01 A;  2JN0 A;  1SF9 A;  1UG1 A;  2VAS A;  2YDL A;  4LDY A;  3VUZ A;  5KYY A;  3GLX A;  4M75 G;  5AT1 B;  2VC8 A;  1TTH B;  1Z9Q A;  2QXF A;  2ZPF B;  4BDY A;  1WHK A;  1QP2 A;  4LN2 A;  2IPO B;  1AD5 A;  4FSX A;  3CD6 A;  3CCJ A;  4M78 A;  3C4S A;  3H0F A;  5CQX A;  1B07 A;  1VQ4 A;  5J26 A;  4LDX A;  1DJ7 B;  3DLM A;  5LJ5 g;  5GAN e;  1HSQ A;  3CCE T;  1NYG A;  4JRP A;  2F2V A;  4PK4 A;  3QDF A;  2DVJ A;  4Z8A A;  1ACM B;  1KC8 R;  2QDY B;  1IB8 A;  3CC2 T;  5LJ5 d;  4EPC A;  2DTI A;  2RHI A;  5D7U A;  3T9N A;  2A08 A;  3ASK A;  2KSS A;  2YUO A;  2A7Y A;  2EWN A;  3OYB A;  2LCS A;  5GAO q;  2X4X A;  3A98 A;  3MEV A;  5I21 A;  3RES A;  3NHN A;  3OS5 A;  4ESR A;  5GAN d;  5LJ5 j;  3M56 A;  1O75 A;  5KYX A;  1VQ8 Q;  2D8J A;  2OJ2 A;  1WNL A;  5HCK A;  2CS7 A;  1I0C A;  3OYY A;  4O5V A;  4RMO A;  3JB9 I;  3NFC A;  3UDC A;  2QQS A;  2K3X A;  4JDS A;  1AZE A;  4LD9 K;  4E2F B;  5I22 A;  2EJ9 A;  1KD1 C;  2CH4 A;  3SWN C;  1GCQ A;  2DO3 A;  3M57 A;  3G4S A;  5KYW B;  4M7A G;  3CCV A;  1KD1 U;  1OV3 A;  2JS0 A;  4PJM A;  4MML A;  1Q7Y R;  1OYX A;  1RUW A;  1H92 A;  1NG2 A;  4J9I A;  1SG5 A;  3CMA T;  4VUB A;  1S72 A;  4NL3 A;  4PJO D;  3HKS A;  3CC4 Q;  1E6G A;  2X4J A;  3CEY A;  1NM7 A;  2BE7 D;  2QA4 T;  4GLM A;  3M0Q A;  1F1B B;  1Q82 C;  1K1Z A;  3I55 T;  4EDU A;  4M7D G;  7AT1 B;  1QWF A;  3EFO B;  4JS5 A;  2DL5 A;  3OW2 S;  4OP0 A;  3KBG A;  5GAM e;  3CCL A;  1R77 A;  2PQW A;  4AFZ C;  2CP6 A;  2EGC A;  3RR6 A;  2DPP B;  2DXT A;  5CCA A;  1YIT A;  4R0K A;  1BK2 A;  2FZC B;  4Q5W A;  3G71 T;  4HCC A;  1WXB A;  4OML A;  5GAN g;  3RMS A;  2ZGW A;  5GAN f;  1E7O A;  1X6G A;  1BCM A;  5CO7 A;  2HQH A;  2E3I A;  3IQL A;  3H41 A;  3QII A;  1VQ7 Q;  1T3S A;  3VYG A;  2RJD A;  1WPY A;  4QQD A;  3EAE A;  1YI2 A;  1IHV A;  3NTH A;  2MIO A;  1BI2 A;  1S72 Q;  2ED1 A;  2K2M A;  1Q7Y U;  4ATO A;  5LJ5 h;  2PVO B;  3EGD A;  3TVT A;  2KRO A;  1O9S A;  1W6X A;  1GXI E;  2PUK B;  3DB4 A;  4IIO A;  1VA7 A;  4D6W A;  2XI9 A;  1PSE A;  1UEB A;  3CCJ Q;  4WTO B;  2GCX A;  2P0P A;  3LYI A;  4KGX B;  1UE9 A;  1Q95 G;  2IG0 A;  4QVC A;  4M78 E;  1U5S A;  4C92 B;  5GAN 8;  2E64 A;  2COZ A;  2PVG B;  1LCK A;  4DOV A;  2LCL A;  3WXM B;  5LJ5 e;  5D6W A;  4BE1 A;  3MHX A;  2KXD A;  1U3O A;  1ZUU A;  1LVK A;  4JJD A;  3G4S T;  5CKF A;  2ZZD A;  1MGQ A;  4XU1 A;  1VQO T;  3OYJ A;  2L3Q A;  3MJX A;  2CUB A;  2FO0 A;  4KGZ B;  4M77 F;  1X75 C;  2F2X A;  1U1S A;  3JCM d;  4KH1 B;  4UC4 A;  2YRV A;  2ENM A;  2JOY A;  4PJO E;  1I81 A;  1K76 A;  1UGP B;  3PMT A;  3LWH A;  2DJZ A;  1M1K R;  4FT2 A;  3A1P A;  4R56 A;  4M75 F;  3M0R A;  4ZN3 A;  2OAU A;  1MV3 A;  2CSI A;  3CCE A;  2MAM A;  4C0F A;  4C5E A;  3BW1 A;  5CQY A;  2E4H A;  3JCM Q;  1NPP A;  2ATC B;  1UGS B;  4OB2 B;  2C06 A;  4EIK A;  2EKO A;  1K9M C;  3X28 B;  1VQO Q;  1PKT A;  4F7U B;  1LOJ A;  3M58 A;  4J9G A;  2OTJ Q;  1QKX A;  4KUL A;  3JSC A;  4RG2 A;  1KK7 A;  2FZK B;  3A8H B;  4M78 B;  1OX9 A;  5GAN 5;  4NOY A;  2E10 A;  3X26 B;  1MMA A;  1YNZ A;  4ZGJ B;  2RJE A;  5KYX B;  2HCK A;  4XTZ A;  5C0M A;  1BIA A;  4ZGE B;  1UEC A;  1JJ2 A;  2VV5 A;  3F70 A;  5HY6 A;  3CCV T;  5GAN 2;  3S6W A;  2AZV A;  4AFQ C;  2DBK A;  4AT1 B;  2GTJ A;  2DIG A;  1YHQ T;  3L2R A;  3DLL A;  5I2S A;  1SRM A;  1S72 T;  1ZSZ B;  2DYB A;  4AG2 C;  4M7D B;  5GAN h;  1X6O A;  2BE9 B;  3QWY A;  2K9G A;  1IGQ A;  1I5O B;  1WA7 A;  2AHJ B;  2F5K A;  2E5Q A;  4BI8 B;  3VS4 A;  2HMA A;  1VQM Q;  1B7T A;  3CPW P;  2V8I A;  2GTO A;  4DBQ A;  3BFM A;  4F04 B;  2LQW A;  2OTJ T;  3HTR A;  4CI0 C;  1ZA1 B;  2YHT A;  2FRW A;  3E1S A;  3SHW A;  1Q81 R;  4DBH A;  1OPL A;  2XKO C;  4C0D C;  4BAC A;  2EIF A;  5D6Y A;  3I56 A;  1QVG S;  2X3W D;  3TRE A;  1U06 A;  2DL7 A;  2KK4 A;  1M90 R;  1PC0 A;  4A4G A;  2QQB A;  3PFS A;  2MOX A;  2O2O A;  2X4W A;  1E6H A;  2RO0 A;  5IXF A;  2LTO A;  3MCA B;  1LJO A;  4F7U E;  2QA4 Q;  1Y7X A;  2JZ2 A;  4HKE A;  3RIR A;  1KHC A;  5CK9 A;  2EYW A;  4M7A E;  4LDW A;  2EYX A;  3FIF A;  1YIJ T;  2KT8 A;  3S3M A;  4IIM A;  1XTD A;  3SDZ A;  2X3X D;  5AYF A;  3FDR A;  3CPW S;  1AWX A;  2JMA A;  1WQ7 A;  2GFU A;  1ZBX A;  2QTV A;  2B8A A;  3SFM A;  2C0O A;  4V2S A;  3MEU A;  4XQ3 A;  5CKE A;  1SRL A;  4IKF A;  2DXB A;  2FVU A;  1WHH A;  1RAE B;  2X35 A;  2WSF E;  4M77 E;  2LJ0 A;  5LJ5 f;  1BKB A;  3V7S A;  2H3J A;  2QA4 A;  1D3B A;  1WQW A;  3PVQ A;  2MF2 A;  3PGG A;  3QKJ A;  1KFZ A;  2YXY A;  3JB9 F;  1IHW A;  2H3E B;  1PRM C;  2EKH A;  2LX7 A;  1KSW A;  3X24 B;  2KAF A;  4PFO A;  2NUZ A;  2CZ6 B;  2O9V A;  2CRE A;  5GMK i;  1IGU A;  1G3S A;  4DEY A;  1M3A A;  3CME A;  2O4X A;  4LE9 A;  1QCF A;  2DL8 A;  3JB9 J;  4C92 E;  4PJO A;  2RPN A;  2QAZ A;  1X69 A;  2XMF A;  1YJN Q;  3FJP A;  1HYO A;  2COW A;  1VQ7 T;  2HSP A;  4HVV A;  3VS2 A;  1UTI A;  1Y96 B;  4F16 A;  2E1H A;  2DIL A;  2ZAE A;  3I9Q A;  4OMN A;  1YWP A;  2KNB B;  4FU6 A;  1K8A C;  3V8L A;  3VV0 A;  3EH1 A;  5FWB A;  1GBR A;  2OTL Q;  4GY5 A;  3CC7 Q;  2L3P A;  1G83 A;  2PZ1 A;  1VIF A;  1MMD A;  4KGV B;  2A3L A;  4RTW A;  1SKU B;  4RCC A;  4HVU A;  3UAT A;  3MPU B;  4C8Q G;  3C94 A;  3FRN A;  3LH0 A;  4LD6 A;  4OB3 B;  1RAG B;  1OUL A;  1K8A U;  2LQK A;  2VGN A;  1G2B A;  1RL2 A;  1K73 R;  2DM1 A;  1D0X A;  2MK5 A;  4CC2 A;  2V8K A;  3QWX X;  2EQJ A;  4OMO A;  5GAO r;  3QPH A;  4C92 F;  1BCO A;  4C8Q D;  3JCM J;  2M9U A;  4MZP A;  4X9D A;  4JRQ A;  2EQM A;  3J80 E;  1ZLM A;  3CME T;  2L3R A;  4C0G A;  2D0Q B;  1VQ4 T;  3JCM W;  2E12 A;  1SPK A;  4MDW A;  1NJI R;  2JMC A;  4C8Q B;  2F1L A;  5KE2 A;  3CCM Q;  4C0Z A;  2E70 A;  4ZTF A;  2YRC A;  3M0T A;  2OAW A;  3OW2 A;  1IRX A;  2LC4 A;  3QUI A;  4BY6 C;  2L5Q A;  3MO8 A;  4LUE A;  2OTJ A;  3CCQ Q;  1VQ8 A;  1TSF A;  1Q7Y C;  1HD3 A;  3Q1J A;  4L6V 5;  1BI0 A;  1Y71 A;  2KYB A;  3I56 T;  4II1 A;  3E19 A;  2LNV A;  2R5A A;  2QEX T;  1N5Z A;  3X25 B;  3CC7 A;  1K73 C;  2QK0 A;  2MWP A;  1VQ7 A;  1D3B B;  4P5N A;  4E7J A;  3CCE Q;  2DNU A;  3VRY A;  1RI0 A;  4EMK B;  4PJO F;  1M3C A;  4E6R A;  4PLI A;  4PJL A;  1WDX A;  3AHU A;  3H0I A;  2L8D A;  4QKU A;  4X9C A;  4XU2 A;  1FYN A;  1RAH B;  2JS2 A;  1TH7 A;  3CCL Q;  4F7U F;  2D1X A;  1ZSG A;  1VQM T;  1KHI A;  2J6O A;  2LP5 A;  3OYE A;  2EJG A;  1YCY A;  4BI3 A;  5CKD A;  5CVI A;  4LUD A;  1WZO A;  2ROL A;  3X20 B;  3NMZ C;  2HAX A;  1T3L A;  3CCJ T;  3JCM P;  1WJS A;  3EGU A;  4KUD K;  9ATC B;  2LJ3 A;  3OQ5 A;  2I2L A;  5D6X A;  3R6O A;  4A54 A;  2A28 A;  2LQN A;  1MUZ A;  1R8O B;  3A8O B;  2NWM A;  2DRM A;  1VQP T;  2VUB A;  2FB7 A;  2VWF A;  4E7S A;  1KQ1 A;  1TUG B;  1T0J A;  1BU1 A;  4JJB A;  1CKB A;  1D1C A;  1YP5 A;  4C92 D;  1QQJ A;  3CXC P;  3LGF A;  3C12 A;  2FL7 A;  2P4T A;  1LNX A;  3EHR A;  3M0S A;  2JXB A;  3VKI A;  3BDL A;  5GAN 4;  1RAD B;  3OYC A;  2LX9 A;  1C6V X;  2RK2 A;  2EPD A;  2P0Q A;  3QYG B;  4OMM A;  4OMF B;  1Y0M A;  5GAN j;  2RQW A;  4BUG A;  3OYI A;  1V76 A;  3PIP A;  3CD6 Q;  5GJV B;  2RM4 A;  2CDT A;  4PLL A;  2BZY A;  2XK0 A;  2FEI A;  2EYQ A;  3LW5 E;  5FU6 B;  4M77 A;  1PD1 A;  2KMT A;  4CRI A;  1V1C A;  3M0U A;  1K0X A;  2GNC A;  5GMK j;  1RAC B;  3CC4 A;  4BB7 A;  1WLP B;  2C0I A;  5I2M A;  4IUU A;  3VUB A;  4PNO A;  4A4F A;  1SHF A;  3CPF A;  1X2Q A;  1M8M A;  4M75 A;  2DZ9 A;  3M0P A;  3OMC A;  1OI1 A;  5A0G A;  3CMA Q;  4M77 G;  2V1R A;  1N27 A;  2Y4X A;  1VQL A;  4A4H A;  4FSS A;  2LDM A;  3BE3 A;  2NUP B;  3EG9 B;  1SEM A;  2LVM A;  3L2Z A;  1OPK A;  3G6E Q;  2DYI A;  4IUR A;  3CCR A;  2F5T X;  1ZSZ C;  5GAM g;  1RAF B;  5A0L A;  3OB9 A;  1G8X A;  4C8Q F;  1X2K A;  4AG1 C;  1C0M A;  4D8K A;  4KBM B;  2PNI A;  1VQ5 A;  3OYD A;  3CCS A;  3E9F A;  2YRD A;  4J6Y A;  4QVD A;  3RBB B;  3JB9 D;  1W2B P;  2MPX C;  4FW2 A;  5A0D A;  3P8H A;  1W4S A;  1M2V A;  1Y57 A;  1N9R A;  2ESW A;  2VYT A;  5IHN A;  5GAN 7;  1TXQ A;  2KT1 A;  3OMG A;  5LJ3 g;  4XTW A;  2DD5 A;  5GAM j;  4C0D B;  2PTK A;  4AFU C;  2EFI A;  2EGA A;  2JTF A;  3CC2 Q;  1JQQ A;  2QEX Q;  3UPU A;  4M7D D;  2CP0 A;  4RCB A;  5DY9 A;  1XOV A;  2O88 A;  5GAN 3;  1QMC A;  5KYN A;  2CZ1 B;  2DF6 A;  1TWB A;  2H8H A;  3RKY A;  2M1H A;  1UDL A;  4OMP A;  1N8R C;  3H6Z A;  2RHY A;  1Y96 A;  3OBW A;  1UGR B;  4PL6 A;  1RAA B;  2LNH B;  3PNW C;  1WXT A;  5KYY B;  3GF5 A;  2FYK A;  4XTY A;  3QDR B;  4M78 G;  4E7K A;  1KC8 U;  5GMK m;  2KRM A;  3GNF B;  3QJY A;  3CCS Q;  5IHI A;  2DVE A;  4OB0 B;  1G3T A;  1S1N A;  1B34 B;  4C5H A;  1JJ2 P;  3KXT A;  1JO8 A;  2DX1 A;  3UF4 A;  3VRZ A;  1YJ9 Q;  4Z88 A;  1B34 A;  2D0N A;  2SEM A;  2KEA A;  4PJN A;  3SEM A;  3MEW A;  3JCM h;  5KH6 A;  3D7S B;  3G6E A;  3QZ9 B;  1H3H A;  2RJF A;  1UHF A;  4IUT A;  4Y28 E;  2HZY A;  2KQW A;  3OW2 P;  3EGX A;  2BKD N;  3EG0 A;  5GMK h;  4HCB A;  1QP3 A;  1YBY A;  4FYX B;  1JXM A;  2RA2 A;  5IXB A;  2AT1 B;  4BE0 A;  2G3R A;  1VQP Q;  4HT8 A;  2DXU A;  2GQV A;  2NUT A;  1QVF P;  1FXX A;  2AKK A;  5J39 A;  4ELY C;  3INZ A;  1VIE A;  3EG2 A;  4F17 A;  1GFD A;  1ZHI A;  4JPB W;  3H9N A;  2HEQ A;  2QQ9 A;  2CT3 A;  2MWO A;  1RLP C;  1KQ2 A;  3CCS T;  4KUI A;  4C92 C;  4LDV A;  3DKM A;  3QG1 A;  3LX7 A;  4XTU A;  4FT4 A;  2R57 A;  3UA7 A;  2QDL A;  4C8Q A;  5KCH A;  1BBZ A;  2O31 A;  2GF7 A;  1I4K 1;  3EHQ A;  5GAO m;  2CH4 W;  2JTE A;  4C8Q C;  1JBM A;  1YIJ A;  1X27 A;  2ECZ A;  1EZZ B;  1I5L A;  1KIK A;  4J9B A;  3R6N A;  5L23 A;  2RB6 A;  1NZ9 A;  2XIC A;  3H8Z A;  3LGL A;  3PE0 A;  1M90 C;  4XK8 E;  4FYV B;  1QWE A;  4IUP A;  3N5B B;  3CQT A;  4J6W A;  4JZ4 A;  3O8V A;  3QHS A;  4FYW B;  2PU9 B;  2AZS A;  3CCQ T;  1QVF A;  2DIQ A;  2YT6 A;  2KRN A;  1M30 A;  1HJD A;  1V29 B;  1K9M U;  4M7A C;  4B9X A;  4OMQ A;  2BIV A;  5CIU A;  2A36 A;  2HSE B;  3PTA A;  4RTV A;  2FPF A;  1M90 U;  3OYM A;  1VQL T;  1WJR A;  3I35 A;  3HRS A;  4BDZ A;  3OYL A;  1TUC A;  4HT9 A;  1EX4 A;  2RJC A;  3JCM c;  4M7D C;  2LJ1 A;  2XID A;  4C8Q E;  5LJ3 h;  4RTT A;  2YSQ A;  2I0N A;  5EG2 A;  3G6E T;  5KYU A;  3ER0 A;  1G3Y A;  4XU3 A;  4A4E A;  3HPW A;  2XD0 A;  2NLU A;  4M7D A;  4JLG A;  1PM3 A;  4C5I A;  1AWJ A;  2KDS A;  1PCX A;  2E6N A;  1OU9 A;  1JRI A;  1GFC A;  2QQA A;  1BYM A;  4YTL A;  2ED0 A;  2KE9 A;  2CSQ A;  4PJJ A;  2DLP A;  3TSW A;  2JTM A;  1Q82 R;  2RQR A;  5CKH A;  4OF1 A;  2RK1 A;  2JM9 A;  2W10 A;  5GAN 6;  2DL3 A;  4J9C A;  2R58 A;  1WGS A;  4J6X A;  4JZ3 A;  2MMP A;  3JCM b;  3OYA A;  5FLX E;  1M2V B;  2V26 A;  1LPL A;  3O5Z A;  4A53 A;  4PJO B;  3REA B;  2YUN A;  2FPE A;  2GQI A;  2EQU A;  2GGR A;  5IN1 A;  2K4Y A;  1WX6 A;  3CCQ A;  2RN8 A;  4M77 D;  2PVD B;  2ZPH B;  2JNG A;  1M1K U;  2RI2 A;  1GRI A;  2X9H A;  3HHT B;  1VQ6 A;  3E2U A;  4O6J A;  3LWI A;  4QQG A;  2KBT A;  3HSB A;  3NPF A;  5CR2 A;  1VQN T;  4BD3 A;  2DER A;  1KG1 A;  4PFP A;  3UWN A;  4RUG A;  1G3W A;  1PWT A;  4M75 D;  1W2B A;  2ZCF B;  1D0Y A;  1PG5 B;  3A8L B;  2P4R A;  5J3B A;  2ZPI B;  2DET A;  2KVQ G;  5I11 A;  1YHQ Q;  5L8R E;  2XDD A;  2RD1 A;  1RLQ C;  4M75 B;  3VS1 A;  3CCV Q;  2DBM A;  3RKW A;  1WFW A;  2YWW A;  3EG1 A;  3CPW A;  2CP2 A;  3E9G A;  1ARK A;  4A63 B;  2DRK A;  2QI2 A;  5HK0 A;  2K6D A;  1CKA A;  1AWW A;  2YLB A;  3A8M B;  4A4K A;  1W1F A;  4M75 C;  2DKG A;  2ROT A;  1QKW A;  1WI7 A;  4C92 G;  3EGX B;  4J8O A;  1NPR A;  4BY6 B;  1GCP A;  3TEE A;  2L2P A;  1TUD A;  2ZPB B;  2L0A A;  1MND A;  2DXC A;  2EW3 A; 
#chains in the Genus database with same CATH homology
 4C92 D;  1MGQ A;  4XU1 A;  1VQO T;  3FB9 A;  3GOX A;  3OYJ A;  3LGF A;  4E7I A;  3C12 A;  2KY9 A;  4ZN1 A;  2FL7 A;  4M77 F;  2O01 E;  2P4T A;  3A5Z B;  1YJW A;  1LNX A;  1BI3 A;  1I8F A;  1X75 C;  1BI1 A;  3J81 E;  1VQ6 T;  1U1S A;  3JCM d;  4UC4 A;  2YRV A;  3VKI A;  2JOY A;  3S3N A;  4PJO E;  4M7D F;  4C92 A;  3BDL A;  5GAN 4;  4M7A D;  2LT4 A;  1I81 A;  2F69 A;  2LX9 A;  3OYC A;  1P92 A;  2RK2 A;  1UGP B;  3PMT A;  3HRU A;  2DD4 A;  2P0Q A;  4LDU A;  3LWH A;  3QYG B;  3M4G A;  2DJZ A;  1YHQ A;  4OMF B;  5FU7 C;  5GAN j;  4FT2 A;  4BUG A;  4R56 A;  1Q81 C;  4M75 F;  3PT9 A;  3OYI A;  3PIP A;  2Y90 A;  3OS2 A;  1JJ2 S;  2RM4 A;  5IAY A;  4PLL A;  4ZN3 A;  2XK0 A;  2OAU A;  4J7F A;  2EYQ A;  4N0A A;  3LW5 E;  3CCM A;  3G7Z A;  4M77 A;  5FU6 B;  2KMT A;  2OTL A;  2LCC A;  4M7A B;  3CCE A;  1Q81 U;  2MAM A;  5LL6 S;  1WJQ A;  4CRI A;  5GAO p;  4Z02 A;  5GMK j;  2GFA A;  3CC2 A;  2BUD A;  1VQM A;  1VQK T;  4EMG A;  1YIT T;  4OVA A;  4C0F A;  3CC4 A;  4BB7 A;  4C5E A;  3CXC A;  2E41 A;  4JS4 A;  5I2M A;  3BW1 A;  4RG8 A;  4ZTJ A;  2XU8 A;  4IUU A;  4KT0 E;  5CQY A;  3JCM Q;  2XDP A;  1NPP A;  1UGS B;  3VUB A;  4OB2 B;  2C06 A;  4M7D E;  5GAM f;  4PNO A;  3A8G B;  4A4F A;  2EKO A;  3SB2 A;  3CD6 T;  2DTH A;  4M78 D;  3OYF A;  4MZT A;  3HFO A;  3CPF A;  1K9M C;  3X28 B;  2M0O A;  2DEQ A;  4M75 A;  2DZ9 A;  4OB1 B;  2RHZ A;  3JCM f;  1YJN A;  3OMC A;  4L59 A;  4F7U B;  1LOJ A;  1OI1 A;  2V8J A;  3M58 A;  5A0G A;  3C95 A;  4KUL A;  1U1T A;  4M77 G;  3JSC A;  1HXD A;  4XTV A;  2CKK A;  4F7U G;  1N27 A;  3EFR A;  4RG2 A;  5C6S A;  2Y4X A;  3L2U A;  1VQL A;  4JJN K;  2ZPG B;  3QJ6 A;  4A4H A;  2LDM A;  1Q86 C;  3V7R A;  3VJP A;  5KE3 A;  3UT1 A;  2LVM A;  5FRM A;  3A8H B;  4M78 B;  1NE8 A;  5GAN 5;  2DAQ A;  1N9S A;  4NOY A;  3L2Z A;  2O4X B;  3FEO A;  4QQ6 A;  2E10 A;  4DOW A;  3HRT A;  3X26 B;  2JUF A;  3QXE B;  1Q86 U;  4ZGJ B;  1M9S A;  2RJE A;  4IUR A;  3CCR A;  3HP9 A;  4N0A C;  5DLO A;  2F5T X;  4XTZ A;  2VXF A;  1Q82 U;  5C0M A;  5GAM g;  3OYN A;  5A0L A;  3OB9 A;  1BIA A;  4ZGE B;  3WVE B;  4C8Q F;  2LRQ A;  1JJ2 A;  2VV5 A;  4J7I A;  3F70 A;  5HY6 A;  3CCV T;  5GAN 2;  3S6W A;  4PJO C;  4F7U A;  1W2B S;  4KBM B;  1VQ8 T;  1VQ5 A;  3OYD A;  4NS5 A;  4J5Y A;  3CCS A;  3E9F A;  4J6Y A;  1QVF S;  4QVD A;  1H64 1;  2DIG A;  3JB9 D;  5HKC A;  1N6A A;  3L2R A;  5A0D A;  1IZ6 A;  3P8H A;  4EMK A;  3V8K A;  2JVV A;  3DLL A;  3JRZ A;  1FX7 A;  1W4S A;  4TVR A;  5I2S A;  1M8V A;  1S72 T;  4M7D B;  5GAN h;  1X6O A;  2DZC A;  1N9R A;  1FWZ A;  2DTO A;  5FU7 B;  2VYT A;  5GAN 7;  5DLQ E;  2L89 A;  1N8R U;  3GIB A;  5FU6 C;  3CC7 T;  2FHD A;  4OGC A;  2OTL T;  1YHQ T;  3CBO A;  3OMG A;  2HD0 A;  4HCZ A;  5LJ3 g;  2AHJ B;  4XTW A;  2F5K A;  3I55 A;  4E7H A;  2DD5 A;  2E5Q A;  5GAM j;  5GAO n;  4C0D B;  5LJ3 f;  4BI8 B;  1K73 U;  1BIB A;  2EFI A;  4IUQ A;  2JTF A;  5GMK l;  1KQS S;  2V8I A;  3RMQ A;  4WF2 A;  3CCL T;  1U8R A;  3UPU A;  3BFM A;  2ZPE B;  2OTJ T;  3JCM V;  4M7D D;  4CI0 C;  2YHT A;  4RCB A;  1XNI A;  5DY9 A;  3E1S A;  1XOV A;  2LQ8 A;  1XQH A;  4XU0 A;  3G71 A;  3MP8 A;  5GAN 3;  1QVP A;  2XKO C;  4C0D C;  4BAC A;  2CZ1 B;  2EIF A;  1YJN T;  3SD4 A;  5HK3 A;  3JB9 H;  3CMA A;  5D6Y A;  3M55 A;  3I56 A;  3RKY A;  3M53 A;  3V7C A;  2M1H A;  1QVG S;  3TU4 K;  1N8R C;  3LLR A;  4L5G A;  3P8B B;  3TRE A;  3H6Z A;  1KQS A;  2KK4 A;  2RHY A;  5LJ3 j;  3OYK A;  1Y96 A;  2EAY A;  3OBW A;  4A4G A;  1UGR B;  4PL6 A;  2QQB A;  3PNW C;  4QW2 A;  2K5F A;  2D9T A;  3PFS A;  5LJ3 d;  4M78 C;  3GF5 A;  2FYK A;  4XTY A;  2X4W A;  3FLG A;  2HQE A;  3QDR B;  2RO0 A;  4M78 G;  3CCM T;  2LTO A;  4E7K A;  3MCA B;  4XAX B;  4E7L A;  1KC8 U;  2CGH A;  2YLC A;  5GMK m;  1LJO A;  4F7U E;  3OS1 A;  1Y7X A;  2JZ2 A;  1PSF A;  4HKE A;  1KHC A;  2QTX A;  1MHN A;  3GNF B;  3RIR A;  5FRO A;  3V8J A;  4LDW A;  4M7A E;  3QJY A;  2RHU A;  2DVE A;  5A2Q E;  3FIF A;  3M5A A;  4OB0 B;  1YIJ T;  2E65 A;  3OSS C;  5GMK e;  3CCR T;  1G3T A;  1QVG A;  2CYZ B;  1VQP A;  1B34 B;  4C5H A;  3KXT A;  4HA8 A;  1B34 A;  3S3M A;  2D6F A;  2WSC E;  2K5L A;  3OY9 A;  3FC3 A;  4ZGD B;  1XTD A;  3OBY A;  4MMK A;  3SDZ A;  3MEW A;  2K3Y A;  2RHX A;  3JCM h;  3ZBD A;  5KH6 A;  5AYF A;  3L2W A;  3G6E A;  3FDR A;  5GAM d;  3QZ9 B;  3ME9 A;  2RJF A;  4IUT A;  3BY7 A;  3MEA A;  4JRK A;  4PKC C;  4Y28 E;  3CPW S;  4EMH A;  2XHC A;  5CK9 A;  2QEX A;  2KQW A;  1WQ7 A;  2BKD N;  2GFU A;  1M5Q 1;  1ZBX A;  1VQN A;  1NJI C;  2B8A A;  1VQ9 T;  3SFM A;  3M54 A;  1QP3 A;  1YBY A;  4GLK A;  3RUX A;  5GMK h;  3KUF A;  4HCB A;  4V2S A;  3MEU A;  4XQ3 A;  5CKE A;  3L42 A;  4ME7 A;  3OYH A;  2RA2 A;  4JUV A;  3PIO A;  4M7A F;  4IKF A;  2HQX A;  3JCM e;  2DXB A;  4BE0 A;  3TCJ A;  4R55 A;  2FVU A;  2G3R A;  3OYM A;  1VUB A;  4HT8 A;  2DXU A;  2X35 A;  4FIB A;  2GQV A;  1X01 A;  2JN0 A;  1FXX A;  5J39 A;  2LT1 A;  4J83 A;  4ELY C;  3INZ A;  2WSF E;  4M77 E;  1VIE A;  3JAM E;  5LJ5 f;  1BKB A;  3V7S A;  2H3J A;  4LDY A;  3VUZ A;  2QA4 A;  3CBP A;  1ZHI A;  1D3B A;  1WQW A;  3OSV A;  2MF2 A;  3PGG A;  2QQ9 A;  3QKJ A;  2MWO A;  3JB9 F;  3GLX A;  4M75 G;  1KQ2 A;  2VC8 A;  3J7A F;  3CCS T;  2QXF A;  4KUI A;  3X24 B;  2ZPF B;  2KAF A;  4BDY A;  3ZEH A;  4C92 C;  2VGM A;  4N4G A;  4NL2 A;  4LDV A;  1QP2 A;  1YJW T;  2CZ6 B;  3DKM A;  3HFN A;  3LX7 A;  3QG1 A;  4FT4 A;  3BDU A;  2R57 A;  2EQK A;  4XTU A;  4C8Q A;  5GMK i;  5GAM h;  1G5V A;  5KCH A;  4RKU E;  4FSX A;  3VYH B;  3CCJ A;  3CD6 A;  2HBP A;  3P8D A;  3PMI A;  4M78 A;  3C4S A;  1G3S A;  2GF7 A;  5CQX A;  3QYH B;  3CME A;  1YJ9 A;  2O4X A;  4PJO A;  1I4K 1;  3JB9 J;  4C92 E;  4QVZ A;  5GAO m;  1VQ4 A;  4C8Q C;  5J26 A;  2IVW A;  3FJP A;  3OA6 A;  4LDX A;  1DJ7 B;  1JBM A;  1YIJ A;  5KCO A;  3DLM A;  1UB4 A;  5LJ5 g;  5GAN e;  1VQ7 T;  1I5L A;  3GNG A;  3CCE T;  2K57 A;  1Y96 B;  2E1H A;  4JRP A;  2RB6 A;  2WAC A;  1NZ9 A;  2XIC A;  1VQO A;  4FU6 A;  3H8Z A;  3QSU A;  1OZ2 A;  3LGL A;  1M90 C;  2QDY B;  4XK8 E;  1K8A C;  3V8L A;  3WVD B;  3CC2 T;  3QZ5 B;  5LJ5 d;  2RH2 A;  1VQK A;  3OYG A;  3HL8 A;  3VV0 A;  2DTI A;  4EPC A;  3JCM X;  2PUO B;  2RHI A;  4IUP A;  3N5B B;  3T9N A;  4J6W A;  4M78 F;  3ASK A;  2VXE A;  2KSS A;  3L1A A;  3O8V A;  3MET A;  4PJO G;  2A7Y A;  2EWN A;  4GY5 A;  3OYB A;  4BE2 A;  3QHS A;  5GAO q;  2X4X A;  2PU9 B;  3MEV A;  5I21 A;  3CCQ T;  3OS5 A;  1VIF A;  4N4I A;  3RES A;  1QVF A;  2Y4Y A;  5LJ3 e;  1QW1 A;  5M9O A;  2A3L A;  5DM7 R;  3JB9 G;  1K9M U;  2DIQ A;  2EJF A;  1NJI U;  5GAN d;  5LJ5 j;  4BI4 A;  4C5G A;  2CZ0 B;  4RCC A;  2CZ7 B;  1V29 B;  4C8Q G;  3C94 A;  4B9X A;  2BIV A;  3FRN A;  3LH0 A;  1O75 A;  3M56 A;  4LD6 A;  5CIU A;  3OS0 A;  3PTA A;  4OB3 B;  1WNL A;  1M90 U;  2CS7 A;  3OYY A;  2LQK A;  4O5V A;  4RMO A;  3JB9 I;  2VGN A;  3NFC A;  1RL2 A;  1WJR A;  3UDC A;  3HRS A;  1VQL T;  4BDZ A;  2QQS A;  3OYL A;  4HT9 A;  2RJC A;  2K3X A;  3JCM c;  4JDS A;  4LD9 K;  4M7D C;  4Y91 A;  2XID A;  2EJ9 A;  3CC4 T;  1KD1 C;  3CCU T;  4C8Q E;  3NTK A;  5LJ3 h;  1YI2 T;  5EG2 A;  3G6E T;  3SWN C;  2DO3 A;  3CBM A;  3M57 A;  4JRI A;  3ER0 A;  3CXC S;  1G3Y A;  2V8K A;  4XU3 A;  3G4S A;  2EQJ A;  4A4E A;  4M7A G;  3HPW A;  3CCV A;  1AHJ B;  1M1G A;  3VU3 C;  2NLU A;  5GAO r;  3QPH A;  4C92 F;  1KD1 U;  2R5M A;  2XD0 A;  4M7D A;  2E6Z A;  4JLG A;  4C8Q D;  4E47 A;  4C5I A;  3JCM J;  1VQ9 A;  2M9U A;  3EFS A;  5CKB A;  2KDS A;  4MML A;  2E6N A;  4MZP A;  3QBY A;  1OYX A;  1JRI A;  2MI6 A;  4X9D A;  5CAI A;  2QQA A;  3RER A;  1H3Z A;  3M9Q A;  4JRQ A;  2EQM A;  3S3O A;  3J80 E;  3CME T;  1YJ9 T;  1BYM A;  3CMA T;  4VUB A;  4YTL A;  1S72 A;  4NL3 A;  4PJO D;  3JCM g;  3HKS A;  2L3R A;  4C0G A;  2D0Q B;  1VQ4 T;  2JTM A;  3DB3 A;  3JCM W;  2E12 A;  5CKH A;  4OF1 A;  2RK1 A;  5GAN 6;  3SWN A;  2X4J A;  3CEY A;  4MDW A;  4ELZ C;  1OZ3 A;  4C8Q B;  2QA4 T;  2R58 A;  1WGS A;  2XG8 D;  4J6X A;  4M77 B;  5KE2 A;  1Q82 C;  4C0Z A;  2E70 A;  4M7A A;  2MMP A;  1SSF A;  3L2Q A;  4ZTF A;  3I55 T;  3JCM b;  4EDU A;  5FLX E;  3OYA A;  4M7D G;  4A53 A;  1EIF A;  3OW2 A;  4JS5 A;  2K2V A;  2K5I A;  4PJO B;  2LC4 A;  4N4H A;  3QUI A;  4OP0 A;  2L5Q A;  3KBG A;  2RI3 A;  4BY6 C;  5GAM e;  3OW2 S;  3CCL A;  3MO8 A;  2XDB A;  2EQU A;  2PQW A;  1M1K C;  2OTJ A;  5IN1 A;  1K8A U;  3GPL A;  2K4Y A;  3RKX A;  4MZM A;  1VQ5 T;  1VQ8 A;  2DPP B;  2DXT A;  5CCA A;  4M77 C;  3CCQ A;  1YIT A;  4M77 D;  2PVD B;  4Q5W A;  3G71 T;  4HCC A;  2ZPH B;  1M4Z A;  1Q7Y C;  2JNG A;  1M1K U;  2RI2 A;  3Q1J A;  3HHT B;  1BI0 A;  4L6V 5;  1Y71 A;  5GAN g;  3RMS A;  3URG A;  1VQ6 A;  2ZGW A;  3I56 T;  4II1 A;  4O6J A;  5GAN f;  3LWI A;  3E19 A;  3GP8 A;  2LNV A;  4M75 E;  2R5A A;  1KC8 C;  2QEX T;  4QQG A;  3HSB A;  5CO7 A;  3X25 B;  5CR2 A;  5FRN A;  3CC7 A;  1K73 C;  3M4Y A;  1VQN T;  4BD3 A;  2WSE E;  1VQ7 A;  2MWP A;  1KG1 A;  1Y07 A;  1IRE B;  3UWN A;  1D3B B;  4P5N A;  4E7J A;  3QO3 A;  3MP6 A;  1G3W A;  3QII A;  2M16 A;  2QQR A;  4FM4 B;  4M75 D;  1RI0 A;  4DA4 A;  3VYG A;  2RJD A;  2ZCF B;  1WPY A;  4PJO F;  3A8L B;  4QQD A;  3ZFJ A;  4EMK B;  3CCU A;  3EAE A;  4PLI A;  1YI2 A;  3NTH A;  3AHU A;  1BI2 A;  5IT9 E;  2L8D A;  4X9C A;  4XTX A;  5J3B A;  4M7A C;  2ZPI B;  4XU2 A;  3MP1 A;  2KVQ G;  1Q7Y U;  4ATO A;  1M1F A;  1TH7 A;  5LJ5 h;  2PVO B;  5L8R E;  4F7U F;  2XDD A;  2RD1 A;  3SWN B;  1VQM T;  2HNI A;  1O9S A;  4FL6 A;  4M75 B;  4EMK C;  1KHI A;  1HK9 A;  4MDX A;  1GXI E;  4DQ2 A;  2PUK B;  3DB4 A;  3RKW A;  2X4Y A;  4D6W A;  2XI9 A;  1PSE A;  3OYE A;  3L2V A;  1UEB A;  2EJG A;  1YCY A;  3CPW A;  2GCX A;  2P0P A;  3E9G A;  3LYI A;  3NTI A;  2QI2 A;  4BI3 A;  5CKD A;  5HK0 A;  4X34 A;  2IG0 A;  5CVI A;  4IUV A;  4QVC A;  3M59 A;  4M78 E;  3X20 B;  2HAX A;  2YLB A;  4C92 B;  3CCJ T;  3A8M B;  1WJS A;  4A4K A;  3JCM P;  4KUD K;  4OGE A;  3OQ5 A;  2I2L A;  4M75 C;  5D6X A;  2DKG A;  2E64 A;  3R6O A;  5GAN 8;  4A54 A;  1JB0 E;  1ZQ1 A;  2DK3 A;  3A8O B;  1R8O B;  2PVG B;  4C92 G;  4DOV A;  2RI5 A;  4J8O A;  1NPR A;  2LCL A;  4JLI A;  3WXM B;  5LJ5 e;  5D6W A;  4BY6 B;  4BE1 A;  2P0K A;  1VQP T;  2VUB A;  3MHX A;  5GAO l;  2FB7 A;  1W2B A;  3TEE A;  1KQ1 A;  2ZPB B;  3G4S T;  4B9W A;  1UGQ B;  5CKF A;  2ZZD A;  2DXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...