1JBMA

Heptameric crystal structure of mth649, an sm-like archaeal protein from methanobacterium thermautotrophicum
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
78
structure length
78
Chain Sequence
VNVQRPLDALGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEELEDGEVTRRLGTVLIRGDNIVYISRGKLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE SNRNP SM-LIKE PROTEIN
publication title The oligomerization and ligand-binding properties of Sm-like archaeal proteins (SmAPs)
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Structural genomics
total genus 14
structure length 78
sequence length 78
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2001-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1jbmA00
5DY9A 3V7CA 4NL2A 4PJOF 5GAMg 1YCYA 5GAN4 4M78D 4F7UF 3JB9F 4M77E 1WPYA 4XTYA 3JB9H 5GANh 4PJOD 4M7DG 3SWNA 5GAN3 3BDUA 4C8QB 4M78E 3JB9D 5GANe 4MMKA 1H641 1Y96B 5GAN2 3FJPA 5GAOq 1KQ2A 3FIFA 4EMGA 3M4GA 4X9DA 2E65A 5GAN5 4PJOE 1HXDA 2EAYA 3EFRA 3JB9J 4F7UE 4J6WA 3JCMg 2FB7A 3SB2A 4M7AF 3L1AA 1I8FA 1B34A 4HT9A 3SWNB 3PGGA 3QHSA 4DQ2A 2HNIA 4M7DC 2RM4A 4M77A 2RD1A 4M7AD 1N9RA 4V2SA 2EWNA 3RKWA 5LJ5j 1I4K1 3BY7A 4M75D 4XU0A 4M78A 1BIBA 5LJ5f 4C92D 1D3BA 4M7AE 4PJOA 4JRKA 4F7UA 3VU3C 1JBMA 5GMKl 5GANg 2DZ9A 4M77G 4M77B 5LJ5d 3SWNC 2E1HA 1I81A 4XTUA 4EMHA 4M7DB 2I2LA 5GMKj 4XQ3A 4M78G 1D3BB 5LJ3j 4PJOG 5GAN6 5LJ5h 5GAOn 4J5YA 5GAOl 1U1TA 4XU1A 5CAIA 1X01A 2VXEA 4F7UB 4F7UG 5LJ3f 4QVDA 3JB9G 2EJGA 5LJ5e 5GAOp 4XTXA 4NL3A 1TH7A 4M7AA 2VXFA 2DTHA 4M77C 4C8QF 4XTVA 3L2ZA 2VC8A 4M75F 5LJ3d 4WF2A 4XU2A 2Y90A 3V8KA 4C92F 5GANd 2ZGWA 4M78C 4JLIA 2DZCA 2DTOA 4C8QD 5GMKh 2RB6A 2E64A 2DVEA 4HA8A 3JCMP 4PJOC 3JCMV 5LJ3h 4EMKA 5GMKe 4M7AG 1HK9A 1B34B 2FYKA 3RKXA 4C8QE 3EFSA 3JCMb 2EJFA 2QTXA 4M75E 3QSUA 5LJ3e 3FB9A 4C92E 4J6XA 3AHUA 3V8LA 5GAMj 4M78B 3BW1A 4A53A 2YLBA 5LJ5g 4EMKB 5GAMf 2K57A 4PJOB 1U1SA 5I21A 3JCMQ 4N0AA 3JCMc 3RESA 4Y91A 4M7AC 1MGQA 1BIAA 1KQ1A 4PNOA 2E41A 5GAMd 3V8JA 3GIBA 4M7DF 2JN0A 4XU3A 4HT8A 4C8QA 2CGHA 4M77D 1Y96A 4M75A 2E10A 3RIRA 4JRIA 4JUVA 4C92A 4M7DD 3RKYA 5GMKi 5GAMh 3QUIA 4MMLA 4EMKC 5LJ3g 4C92C 3JCMf 4QVCA 1LNXA 4XTWA 1JRIA 4OP0A 4M7AB 5GAMe 4M7DE 2DXTA 1LOJA 3BFMA 4C8QG 1WNLA 4M75G 2EJ9A 4M75B 3JCMd 3HSBA 1WQWA 4XTZA 4C92G 4A54A 4C92B 3HFNA 2DKGA 5GAOr 4RCBA 3V7SA 3JB9I 2DTIA 3QO3A 5GMKm 3HFOA 2DJZA 2YLCA 2RA2A 2YHTA 3INZA 4N0AC 3RUXA 3JCMh 2DEQA 3V7RA 3JCMX 5GAN7 5GANj 1M8VA 4J6YA 4X9CA 1LJOA 2DXUA 5GAN8 5GANf 3JCMJ 3JCMe 4M77F 1I5LA 1WQ7A 4C8QC 4NOYA 3RERA 1M5Q1 4M75C 4M7DA 5GAOm 1N9SA 4RCCA 4M78F 3JCMW
chains in the Genus database with same CATH superfamily
3D7SB 4EPCA 2YRCA 3R6OA 3DKMA 2XMFA 4TVRA 2EGAA 4LD9K 1WX6A 4C8QB 2LTOA 2LCCA 2NUPA 2CZ0B 5KE3A 2RQUA 3A98A 4BY6B 1KQSP 2RH2A 3QHSA 3X26B 3LGLA 1KFZA 2QEXT 1VQNT 2P0PA 1HJDA 3C95A 5LJ5f 4C92D 3OA6A 2FVUA 2X9HA 1WXTA 3CBOA 4C0DB 1VQ6A 3META 4M78G 3EH1A 3TCJA 1FMKA 4DA4A 4F7UG 1VQ8T 4E7ZA 1N8RC 4M7AA 2AKKA 4M77C 1M27C 4Y92A 3CC7A 4Z8AA 4RTUA 3JCMP 2DVEA 4PJOC 1M1KR 3OMCA 2NUTA 1LVKA 1AD5A 1P92A 5KYXA 1JU5C 2DYIA 3CMAA 3CEYA 3CCQQ 3CCET 2B86A 2QASA 3UPUA 2RJCA 1G3YA 4FM4B 1V1CA 4C5EA 1IHVA 1OZ2A 1QVFA 1WJRA 3MJXA 3H9NA 3M55A 1YIJA 3TQ7P 4M7DD 4O6JA 1QWFA 4MMLA 3RMSA 4GLKA 3OS1A 5IH2A 3MKDA 3CCUQ 3S3NA 3EFOB 4ZTJA 1WA7A 2CREA 4C92G 2QA4Q 3NHNA 2O2OA 1JJ2A 3CBPA 2RA2A 3INZA 2M02A 2QXFA 2LQ8A 2I0NA 4M77F 2RJDA 5CKFA 5GANd 3HHTB 5DY9A 3CMEA 4FYXB 4J7IA 1OQKA 1OU9A 1QLYA 3ASKA 4PJOF 4LN2A 1RAIB 4KBMB 2MOXA 3ZFJA 2A3LA 1YJ9T 2FG0A 3FJPA 1TS9A 3EFRA 1NJIC 1D09B 1OPLA 2CP2A 3I56A 3OW2S 4GLMA 1UG1A 2JMCA 2JM8A 3RKWA 3CCLT 1BIBA 3CXCP 2B8AA 4AT1B 2HZYA 2ZPIB 2I2LA 3UATA 2HQEA 3QKJA 1Q82U 5KCHA 1PRLC 3BE3A 4YTLA 3L2VA 4BE0A 2QK0A 4J9FA 3G6EQ 2DZCA 3QDFA 2HBWA 2QAZA 3GOXA 4M7AG 3CCSA 1B34B 3PIPA 3EFSA 3CCVT 1YI2T 4DOWA 5FRMA 2DD4A 4JJNK 1IGUA 1KQ1A 3MEVA 4HVUA 5FWBA 5GAMd 2KDSA 2K2MA 2LQKA 1VQOA 2L5QA 3M56A 1S1NA 1XTDA 5LJ3g 2CSIA 4CC7A 2FZGB 2BE9B 1H3ZA 1W2BA 2F1LA 2XU8A 4RCBA 3M0SA 4DBHA 4ATOA 3UDCA 2DF6A 3L2UA 4IUVA 1KG1A 2V8JA 5CQXA 2YSQA 1GBRA 3OYMA 3LGFA 3FDRA 4LDXA 3CBMA 1SF9A 4M78E 1PWTA 1TUGB 4MMKA 2CYZB 1YWOA 4B6MA 1AWXA 4F7UE 1B07A 2PTKA 3H8ZA 4OGCA 1BCMA 2KSSA 5FU7B 3QBYA 2CH4A 3VS4A 2X4XA 2HNIA 3VV0A 2F5TX 3E9GA 1FWZA 4FYWB 2CP6A 3TEEA 3P8DA 2DZ9A 3M0UA 3G4ST 1AWWA 4JLGA 3A8HB 5FU6C 4DBQA 5LJ5h 5GAOn 3OYAA 3M9QA 1Q86U 4RTTA 4DBFA 1QMCA 1M90R 1F1BB 1T3SA 3O8VA 4C8QD 1VQ9T 3CCUA 1X69A 3CMAT 1S72T 3RKXA 1JJ2P 2QTXA 4C92E 1QCNA 4M78B 2LVMA 2A0FB 1VQMQ 3NTIA 3I5RA 3PT9A 3RESA 2DXBA 2F5KA 4BD3A 1TG0A 1VQ7T 3EFOA 1CSKA 1SHGA 4IUPA 4F16A 1SSFA 2CUBA 1JRIA 4C5IA 2JNGA 2J05A 2NUZA 1E6HA 4AFSC 1ABOA 1RLPC 2YHTA 3JCMX 4PFOA 1I5LA 1VQ4A 3M0RA 4NOYA 1M5Q1 5A0GA 2QDLA 2FZKB 1XJWB 1Y57A 3CPWS 2CP7A 2L3RA 1M1KU 1VQ5A 5GAOq 2LNVA 5GAN5 1WXBA 1QQJA 3HP9A 3QIIA 3JCMg 1YITQ 4RKUE 3SB2A 5DLOA 2XDBA 3G6EA 1W1FA 2KBTA 2RD1A 4E7HA 2JM9A 2QQBA 4M7AE 3G7ZA 4LUEA 3REBB 2K3XA 2X4YA 4LDWA 3SEMA 4M77B 2FO0A 2K5LA 3CD6A 3L2WA 2KQWA 2MWPA 5LJ5e 1TH7A 1JQQA 2LCSA 1AZGB 2NUPB 5CKHA 2ZGWA 2DTOA 4Z89A 3CC4Q 2DXCA 5HK3A 3CC2A 3OYYA 2E70A 4JPBW 3DLLA 1Q7YR 2EVRA 1AHJB 2KAFA 3PE0A 2V8IA 8AT1B 3I55Q 4PJLA 2QQSA 2HEQA 2VWFA 1NPRA 2K57A 1QCFA 5KCOA 3OYLA 2EYQA 1UE9A 2YDLA 2E41A 1W70A 3F70A 3CCJQ 5KYWB 1H8KA 4N4GA 2ED0A 2RI5A 1KQSA 2L0AA 2LX7A 1MNEA 4M7AB 1Z9ZA 2CH4W 1T0JA 4CI0C 2EQJA 2CP3A 2LDMA 1YJWA 2WSCE 4C0ZA 1B7TA 1VQ6Q 2CZ6B 1G3SA 2QI2A 1ZBJA 2NUTB 2G6FX 4EIKA 2DL8A 1QVGS 5KYXB 2K79A 4KH0B 2GQVA 1YBYA 4E7IA 2L89A 4IURA 4N4IA 4Z02A 1M30A 2RQTA 4A4EA 1QKWA 3V7CA 1K8AR 1X27A 2K2VA 2COYA 2RK1A 3CC7Q 3JB9F 2LJ3A 1BI2A 5C0MA 2E6NA 1OI1A 1Q81C 2XDPA 5I2MA 5J3BA 3BDUA 1Q82R 4EMGA 2RO0A 4KH1B 4E7KA 1D1CA 2FRWA 2MI6A 1N9RA 4AMCA 3C94A 4OF1A 3QWXX 1VA7A 5CKDA 4A4FA 3CCQT 3U23A 3OYDA 1VQPA 3EH2A 3CPFA 3TSZA 2E1HA 2DETA 4D8DA 1MHNA 3JAME 1D3BB 3M54A 2V1RA 3PFSA 2VXEA 1X6OA 4F04B 5GAOp 1OEBA 1UECA 2X3XD 1VOMA 2J6FA 1K1ZA 4LXCA 5LJ3d 3CCUT 1WHMA 2Y90A 2O88A 2HKNA 2YWWA 4F14A 1GL5A 3ME9A 1UB4A 2E64A 2QA4T 1UGRB 4B9WA 1R0BG 1N5ZA 3CMEQ 3FB9A 1Y0MA 3QPHA 4J6XA 2Y4XA 1WLPB 1ZA2B 3NTKA 4CC4B 4KGXB 3KFVA 2Z0WA 3N5BB 1IRXA 4IIOA 4XU3A 1UHCA 3JRZA 2A7YA 5GMKi 2RF0A 4AG1C 2F2VA 4OMMA 5CCAA 2QGGA 3EGXA 3Q1JA 3CXCA 1YITA 5CVIA 2EQMA 2COZA 3V7RA 2DBMA 2DERA 5GAN8 4ANJA 2QQ9A 5GAOm 4RCCA 5IXBA 1UTIA 3X25B 4NL2A 3GPLA 2SRCA 5FRNA 1YNZA 1BI1A 5D6WA 1K73R 4PLIA 4M78D 1MMGA 5IN1A 4ORZA 3CCSQ 4OMNA 2EAYA 1IB8A 2K9GA 3LH5A 4FW2A 2PVDB 3OBYA 2JVVA 3ZEHA 2E6ZA 2ZPBB 5CIUA 2E4HA 3MP6A 2FEIA 3P8BB 4LDVA 4M77A 3HKSA 4KUDK 4V2SA 5FU6B 5A0DA 5AYFA 1YJNQ 4PJOA 2G3RA 1VQOQ 3EGDB 1I81A 1NYGA 3I55A 1WJQA 1VYUA 2M51A 2K5FA 2XK0A 4JRQA 4LNPA 1TOVA 4R0KA 3HRUA 2HSPA 3CCJA 2VXFA 4L6V5 2VB6A 4EDUA 3NTHA 1PHTA 4BI4A 5DM7R 1KD1R 2GTOA 2ZPEB 2DD5A 3J7AF 2LT4A 2DLPA 2MWOA 4ZN3A 2PVGB 3M53A 4BI3A 2KROA 5KYWA 3A8LB 3MEUA 5I21A 2D1XA 1NLOC 1U5SA 3QDRB 4DEYA 4M77D 3RDVA 2JOYA 2FPFA 4JRIA 2GFUA 3QUIA 4EMKC 1G3TA 2DL4A 2LQNA 2FHDA 3BFMA 3EHQA 4HCKA 4J8OA 1WNLA 2FL7A 3JCMd 3HSBA 4XTZA 1K0XA 3HFNA 1BI0A 2DAQA 2C0TA 2RJFA 1Q95G 3OW2P 3PIOA 2VKNA 1IO6A 2ABLA 1LJOA 2SEMA 1G83A 1WHKA 5HY6A 1CKBA 1U8RA 2RN8A 1DJ7B 4J7FA 1H3HA 1N9SA 3EAEA 2GTJA 4OB0B 4AG2C 1R77A 2EYYA 2LZ6B 1SG5A 1TTHB 4XTYA 3OYEA 1Q7YU 2LJ1A 2VASA 2HQHA 4CC3A 2JMAA 4FYVB 5IXFA 1OX9A 4J9DA 5A2QE 4M7DC 4M7AD 1M1GA 4E47A 1Z9QA 3KBGA 1K9MR 1I4K1 1IHWA 4PKCC 3G71A 1D3BA 2CZ1B 4E7LA 2JS0A 1VQMT 1JBMA 4M77G 1AVZC 4XTUA 4A63B 2PQWA 2DBKA 3E19A 1ZQ1A 2XHCA 4PJOG 1ACMB 4XU1A 2DIQA 3E2UA 4B9XA 2KVQG 2KXCA 1VQ4Q 4VUBA 2GF7A 2GBQA 2P4TA 4GBQA 1K8AU 3P8HA 1PRMC 2YUNA 2YLBA 5LJ5g 4HXJA 1VQ5Q 1KHCA 3MCAB 1M90C 1KC8C 1ARKA 2H3JA 4M7DF 2O01E 1ZUKA 4LE9A 2DEUA 3OYNA 1NPPA 2OJ2A 4P5NA 2HKQB 1NYFA 1AWOA 1LOJA 3GBQA 1C1AA 4RTYA 3EHRA 3MP8A 1GFCA 4LDYA 2K4YA 2DTIA 2CP0A 2F69A 3VUZA 5GANj 4C0GA 2DEQA 2M0OA 4ZGDB 5CQYA 2QQAA 2DXUA 3CD6Q 1A0NB 4OMOA 5J26A 2CSQA 2EYZA 4X1VA 3RERA 5GJWB 1N8RR 2MIOA 1YJNA 1T3LA 2ZPGB 1X2KA 3LLRA 2AZSA 1RACB 2A08A 2DYBA 4ZNXA 2EKOA 3CC2Q 1H641 3VJPA 1QP3A 2YXYA 4X9DA 5IT9E 1ZSZC 3H0HA 3FRNA 4BI8B 3CC4T 3PGGA 3EGDA 5KE2A 3J80E 1QCOA 1NEBA 3RMQA 4XU0A 2DIGA 4BACA 3DB3A 3H6ZA 4OMPA 3I55T 1SRMA 3M59A 2QEXQ 1VQKA 4AFZC 1WZOA 4MDWA 1KJWA 1K9AA 2VV5A 4L59A 1YJWQ 1VQLA 2W0ZA 1W6XA 1T0HA 3L2ZA 2QG9B 1D0YA 1VQ8Q 3V8KA 1WHLA 3OYKA 2CDTA 1QVPA 4PFPA 1VQ6T 1X75C 3QXEB 1WI7A 3JCMb 1K73U 4OMFB 1YHQA 3AHUA 2YUPA 5GAMj 1RABB 4A53A 2OTLA 5I11A 3JCMQ 4Y91A 3EG2A 1G3WA 2O31A 2JJ9A 3CC7T 1NJIR 4HT8A 5D7UA 3VRYA 2YRVA 3CPWP 4KRTA 4A4GA 2ZPFB 3DB4A 1RI0A 1VQPQ 3VS6A 4JDSA 2L3SA 1UGQB 5KYYA 2HDAA 4J9BA 2R57A 4FT4A 4N0AC 1Q81U 4HCZA 2DL7A 1MNDA 5GANf 3EG1A 2XICA 3QG1A 3JCMJ 1YIJT 3PVLA 4QKUA 4C8QC 4M75C 1OPKA 2C0IA 3OB9A 3C12A 2IIMA 2EQKA 1OULA 3RR6A 3FC3A 1NZ9A 4M77E 3JB9H 2CUDA 3M5AA 1KD1U 3J81E 3CCRA 2HL5C 3KUFA 3VYHB 1AWJA 2DL5A 3VYGA 4PJOE 1FXXA 3OYFA 1YJ9Q 4C0DC 3L1AA 1GCQC 3EG0A 3MO8A 3EGXB 3CMET 2HBPA 2ATCB 5J39A 4JJCA 4RTZA 3L2QA 1D0ZA 1Q82C 4FYYB 1V29B 1O9SA 2QTVA 3OYHA 3SWNC 2AKLA 2MCNA 1UFFA 4JJBA 2M9UA 1RAEB 1QVFS 3AT1B 3I56T 2RMOA 1IREB 1ZLMA 2AT1B 3UT1A 1M8MA 2D0NA 2EJGA 4J9IA 4C8QF 4XTVA 4M75F 2VC8A 1X6GA 2RK2A 3C0CA 3RNJA 2HSEB 4ZGJB 1PKTA 4RUGA 2XG8D 3M0QA 3OS5A 1M4ZA 3CCMA 1MMNA 2GQIA 1JXMA 2AIRB 3BW1A 4EMKB 5GAMf 4PJOB 1KSWA 1OU8A 1YI2Q 1QVGP 1PD0A 3NFCA 8ATCB 3L2RA 3ZL7C 1ZUUA 2DMOA 2CGHA 3LH0A 1Y96A 2OTJA 2CKKA 4JUVA 2PU9B 3CCST 4O5VA 1K9MU 1BBZA 4FT2A 2JT4A 3GP8A 2ED1A 2DE0X 2E12A 2DXTA 1EIFA 3OS2A 1D1AA 2KYBA 3S3MA 1RAFB 3VS0A 4QQDA 4A54A 2YRDA 3JV3A 2OAUA 5GMKm 4RTVA 1XQHA 1WDXA 2E5KA 3RUXA 1M8VA 1VQOT 3UA7A 1JEGA 1R8OB 1RLQC 2MK5A 2M1HA 2QEXA 1VQNA 2JTFA 4ME7A 2CS7A 1K76A 2GFAA 5GAN2 3M4GA 3NGPA 4FIBA 2P4RA 3H41A 1YCSB 3SDZA 1VQ8A 3BDLA 4KT0E 1RADB 1EZZB 1FX7A 5CR2A 1N6AA 1Q86C 2EKHA 5LJ5d 1WHGA 2QDYB 4EMHA 5GMKj 3TVTA 2KT8A 2KR3A 5GAN6 1X43A 3CCEA 4LD6A 5CO7A 3E9FA 3JB9G 2NWMA 2P84A 2IG0A 1PCXA 4J9HA 3OW2A 1W2BS 2YT6A 1WJSA 2C0OA 1N8RU 3SD4A 3JCMV 4RMOA 2A28A 3I5SA 1C0MA 1M3AA 1VQ9Q 1LPLA 1JB0E 3VRZA 3O5ZA 5HK0A 2XI9A 2CT3A 4PLLA 2XKOC 4XAXB 4OVAA 3V8JA 1M2VA 1BYMA 3VS3A 2JXBA 2E10A 2V1QA 4BDZA 3JSCA 1FYNA 1UJYA 4QVCA 3G71Q 2PNIA 4ZGEB 1FMWA 2AZVA 4K11A 2RI3A 1NE8A 1NBEB 1YP5A 1YJ9A 2HCKA 2PZ1A 2IPOB 2DJZA 3HFOA 2NLUA 2X3WD 2RQRA 4X9CA 1UGVA 4R56A 2JZ2A 1M1KC 2DO3A 4LUDA 2DILA 3GF5A 5HCKA 1HSQA 2D8JA 1D1BA 3G1JA 3CCLA 1FMVA 1WPYA 2VVKA 5FU7C 5GANh 1PD1A 3GLXA 3HRSA 3PVQA 2E65A 2DM1A 5KYUB 3VKIA 4BE2A 2YUQA 3TREA 4J6WA 2FB7A 5M9OA 1VQ4T 1I8FA 3OSVA 3UA6A 1H92A 2EWNA 1G5VA 3X28B 2RHXA 1NJIU 2X35A 1EX4A 1Y7XA 1VQ5T 3LX7A 4JJDA 3CCVA 1YI2A 5LJ3j 4C0FA 1SHFA 5GAOl 4ESRA 4QVDA 3G6ET 3X24B 4NL3A 1XOVA 4E6RA 2E3HA 1KIKA 4RG8A 1IGQA 2RNAA 3FEOA 3RBBB 4IUTA 1ZBXA 4M78C 3UF4A 5AT1B 3OY9A 1AEYA 1MMAA 4PL6A 4GY5A 4EMKA 1TUDA 1AOJA 1I0CA 2E3IA 1PC0A 5FLXE 3CD6T 2HQXA 3X20B 2RQVA 4BDYA 1Q81R 4FL6A 2JTMA 1RAHB 4PNOA 3QYHB 1W4SA 3QYGB 3CC2T 4J9GA 5L23A 1WHJA 2BZYA 5GAMh 1J3TA 3MPUB 2JW4A 1LCKA 2EJ9A 4M75B 2RHUA 3OS0A 1VQKQ 4DEXA 2KGTA 3QO3A 3NMZC 2BZXA 1NLPC 4J6YA 4ELZC 2A37A 3OSSC 1VQLQ 4M7DA 1E7OA 1Y71A 4M78F 4C92C 3JCMW 3M0PA 3QWYA 4HVWA 4PK4A 4F7UF 2R5MA 2X51A 4CRIA 4PJOD 1YJWT 4E7JA 1AZEA 5GANe 3G4SA 1RI9A 1YHQQ 3OBWA 4ELYC 2OTLQ 4ZN1A 4HT9A 3SWNB 5IHIA 1TU0B 4BE1A 1OYXA 2DJQA 2MPXC 1BK2A 1TXQA 5KYYB 3REAB 4MZTA 2X4WA 2K3BA 1VQ9A 3A8OB 5EC7A 4BB7A 1S72A 1YFNA 4RTWA 3CPWA 2LJ0A 3ER0A 1TSFA 5L8RE 3OYJA 1RUWA 5LJ3f 1KQSS 4CC2A 2L2PA 2F2WA 4KUIA 4WF2A 4C92F 2HL3A 1VQ7A 1VQPT 2QYZA 3PMTA 4BUGA 1GRIA 2FYKA 3QSUA 4DOVA 2WACA 7AT1B 1BCOA 1PNJA 5D6YA 2WSEE 3CCRQ 1U1SA 2R58A 2PUOB 4M7AC 2JUFA 2FZCB 2HMAA 4OGEA 1ABQA 1U3OA 3NPFA 2LCLA 3VS5A 2KNBB 2DK3A 1CKAA 3OYGA 2EGEA 4XTWA 4OP0A 5GAMe 2P0QA 2L3QA 2LRQA 3EGUA 2K3YA 3LWIA 4FSSA 1WQWA 4D6WA 3L42A 4PFZA 2W10A 2DKGA 1BB9A 2QQRA 2EPDA 1ZSZA 4X34A 1PG5B 2EQUA 1MMDA 2RHYA 3ULRB 2D8HA 2V8KA 5FWCA 2KXDA 1HD3A 2RHIA 2ROLA 1YCYA 5GAN4 5KYUA 2XDDA 2O4XA 1WFWA 1SRLA 2LC4A 1UGSB 4M7DG 5GAN3 2LP5A 4FU6A 4D8KA 1YITT 1Y96B 1G8XA 1G2BA 1BI3A 2OX7A 3GNFB 1UGPB 2AK5A 3JB9J 3CCMQ 1ZUYA 3QJYA 1YN8A 3QJ6A 4M7AF 2LNHB 2J7IA 2H8HA 4A4HA 3WXMB 3A5ZB 4MZPA 2L8DA 3SHWA 1QVGA 1Y07A 2OTJQ 1OV3A 3MEAA 3MHXA 1WXUA 1MV3A 4PJJA 5CKBA 2DNUA 2MAMA 1OX8A 1U1TA 5CAIA 4XTXA 4LDUA 4JS4A 3THKA 3HRTA 4JLIA 2O9VA 1UHFA 5GMKh 1WYXA 4PJNA 3A8GB 3CXCS 1RL2A 2H3EB 2KE9A 3H0FA 3VS1A 1QP2A 3S6WA 2BTTA 2GNCA 4UC4A 1VQNQ 1I1JA 2YUOA 1BKBA 2ZAEA 3CCJT 4N0AA 2KI7A 1PSFA 1YWPA 2ZCFB 1BIAA 3GIBA 4C8QA 1VIFA 4M75A 2LX9A 3JCMf 1LNXA 3MEWA 2COWA 1KHIA 3TU4K 1VUBA 3JB9I 2M16A 2R5AA 2ESWA 4FSXA 2YLCA 1ZSGA 2IVWA 2KYMA 4JZ3A 3WVEB 5C6SA 3CCEQ 1GCQA 2E5QA 5IHKA 2ZPHB 1Q7YC 5LL6S 3EG3A 3CCQA 4RG2A 2GCXA 3TSWA 3VUBA 2P0KA 1M9SA 2HD0A 1M2VB 3SWNA 4OMLA 4QT7A 4J9CA 1QVFP 4JS5A 3SFMA 1GFDA 1MV0B 2VGNA 2EBPA 3I35A 3E1SA 1TWBA 1PKSA 2DRMA 3MP1A 3LWHA 2K5IA 2RM4A 1KC8R 1WHHA 3BY7A 3R6NA 2XD0A 3GNGA 4M75D 4HKEA 2ENMA 2WSFE 2DL3A 3HPWA 4JRKA 4BY6C 2QA4A 2KMTA 1SPKA 4AFQC 1OOTA 2D9TA 5FW9A 4XQ3A 2PVOB 1NM7A 4FW1A 3PTAA 4F7UB 1ZHIA 1PSEA 2XIDA 1N27A 2DTHA 1K8AC 2J6OA 3G71T 4HVVA 2VYTA 4C5GA 4JRPA 2BE7D 1UJ0A 5KH6A 2BIVA 3C4SA 4XK8E 2X4JA 5LJ3h 5GMKe 1RAGB 2EJFA 4OB3B 3CCLQ 1GCPA 3V8LA 5I2SA 1X6BA 5D6XA 2LQWA 1ZA1B 1VYTA 4DBRA 1I5OB 2VGMA 1X2QA 4Y28E 2D6FA 2AHJB 2RJEA 1C6VX 1MUZA 3RKYA 1QWEA 3EG9B 2DVJA 2DRKA 4M7DE 1UEBA 1D0XA 4IUQA 4C8QG 3FJ5A 1JJ2S 4M75G 4C92B 2D0QB 3VS2A 4HCCA 5GAOr 3LYIA 4Q5WA 2L3PA 5FROA 3OQ5A 1BU1A 2DX1A 3CCVQ 3DLMA 2CT4A 4PJMA 1GXIE 4RTXA 1M3BA 4M4ZA 2RQWA 3I9QA 2RPNA 4NS5A 5CKEA 5HKCA 2A36A 3HL8A 3WVDB 1V76A 2GGRA 1K4US 1RAAB 3H0IA 3JB9D 1KQ2A 2EQIA 4KGZB 4KULA 3IQLA 2F2XA 4OB2B 2K7AA 2OAWA 1B34A 1HYOA 1YJNT 1JO8A 4DQ2A 1R0CB 2KRMA 5IHNA 1W2BP 3M4YA 2J06A 3M57A 1JXOA 5GMKl 3VU3C 5GANg 2Y4YA 4OB1B 1EFNA 4M7DB 3FLGA 2PUKB 2J6KA 4J5YA 2JTEA 1IZ6A 2BZ8A 3LW5E 1PM3A 1K73C 3QZ9B 4QW2A 2RB6A 4J83A 4HA8A 4ZTFA 5EG2A 4JZ4A 1VQKT 1HK9A 1M1FA 2EIFA 5LJ3e 3URGA 2FRYA 9ATCB 3OYBA 1VQLT 2DFUA 2RHZA 4J9EA 3G4SQ 3QZ5B 4FCYA 2OI3A 2JS2A 2JN0A 2VUBA 3HTRA 3RIRA 3OYIA 2O9SA 1QW1A 2EGCA 1YHQT 2EFIA 2OTLT 3UWNA 5KYNA 1KK7A 1GBQA 2HAXA 3CMAQ 5IAYA 1NEGA 1S72Q 4KGVB 3JCMh 6AT1B 4F17A 4IIMA 1KD1C 1WIEA 4HCBA 5GJVB 4QQGA 1YIJQ 5GAMg 4IUUA 1B3QA 3A1PA 4OMQA 1VQ7Q 3M0TA 2CZ7B 4A4KA 1VQMA 1VIEA 1K0SA 3FIFA 1HXDA 2KRSA 4L5GA 2DA9A 1E6GA 1SEMA 2C06A 2K6DA 2ECZA 4E2FB 1NG2A 3KXTA 2KRNA 4Z88A 5LJ5j 2EYXA 2CP5A 4M78A 2BUDA 3CCRT 1ZSZB 1O75A 2M0YA 4F7UA 2MF2A 1TUCA 3PMIA 3PNWC 3T9NA 3M58A 2MMPA 1WGSA 5I22A 5CK9A 1I07A 1X01A 3ZBDA 5A0LA 2O4XB 2MYSA 1XNIA 4WTOB 3OYCA 3I56Q 2KT1A 2NYSA 4XU2A 2QGFB 1M2OA 3VS7A 2EYWA 1UDLA 4C8QE 1IXDA 4M75E 1M3CA 1U06A 2RI2A 2EW3A 5ECAA 2BKDN 3S3OA 4IKFA 3A8MB 5DLQE 2V26A 3EG9A 3JCMc 1K9MC 3CQTA 4II1A 4WCIA 4AFUC 1MGQA 1QKXA 1SKUB 2FPEA 4C92A 3OMGA 2ZZDA 4N4HA 1M90U 4MDXA 2KY9A 1KC8U 4R55A 1UUEA 4MZMA 2FPDA 4C5HA 3CCMT 2KK4A 2ROTA 4QVZA 2DPPB 1SSHA 4QQ6A 1Q86R 1VYVA 3V7SA 2LT1A 1AT1B 5GAN7 1ZX6A 3JCMe 2OTJT 4E7SA 1WQ7A 3CC4A 2LMJA 2KEAA 1OZ3A
chains in the Genus database with same CATH topology
4A4EA 3V7CA 3C12A 2RHIA 4EPCA 2EQKA 1YCYA 2K2VA 2RK1A 3R6OA 5GAN4 3DKMA 2XDDA 3FC3A 4E7IA 1NZ9A 3JB9F 2O4XA 4M77E 4TVRA 2LC4A 3M5AA 1KD1U 3J81E 3JB9H 1UGSB 1BI2A 5C0MA 4LD9K 2E6NA 1OI1A 1Q81C 2XDPA 5I2MA 5J3BA 3BDUA 3KUFA 4FU6A 4C8QB 5GAN3 2LTOA 3VYHB 2LCCA 1Y96B 1YITT 1BI3A 2CZ0B 3GNFB 3VYGA 4EMGA 1UGPB 2RO0A 4PJOE 3JB9J 5KE3A 1FXXA 4E7KA 4BY6B 3OYFA 3QJYA 3QJ6A 4C0DC 4M7AF 3L1AA 2RH2A 3QHSA 3MO8A 3X26B 2MI6A 4A4HA 3LGLA 3CMET 1N9RA 2HBPA 3C94A 4OF1A 2P0PA 2QEXT 3WXMB 5J39A 1VQNT 3A5ZB 3C95A 4MZPA 5LJ5f 4C92D 2L8DA 4A4FA 5CKDA 3OA6A 2FVUA 3L2QA 1Y07A 3CCQT 3OYDA 1Q82C 1VQPA 3CBOA 1V29B 1O9SA 4C0DB 3MEAA 3MHXA 3OYHA 3CPFA 1VQ6A 3SWNC 2E1HA 5CKBA 3META 2M9UA 4M78G 1MHNA 1QVFS 3JAME 1D3BB 3I56T 1IREB 2MAMA 3M54A 3TCJA 3UT1A 1U1TA 3PFSA 2VXEA 4F7UG 5CAIA 4DA4A 1VQ8T 1X6OA 2EJGA 1N8RC 5GAOp 4XTXA 4LDUA 4M7AA 4M77C 4C8QF 4JS4A 4XTVA 4M75F 2VC8A 5LJ3d 3HRTA 3CCUT 2Y90A 2RK2A 3CC7A 4JLIA 4ZGJB 5GMKh 3ME9A 1UB4A 2E64A 2DVEA 3A8GB 3CXCS 1UGRB 2QA4T 3JCMP 4B9WA 1RL2A 4PJOC 3OMCA 1QP2A 3S6WA 2XG8D 1P92A 4UC4A 3FB9A 3QPHA 3OS5A 1M4ZA 3CMAA 4J6XA 3CEYA 3CCMA 3CCET 2Y4XA 3NTKA 3BW1A 1BKBA 3UPUA 4EMKB 2RJCA 1G3YA 4FM4B 5GAMf 4PJOB 3CCJT 4N0AA 3NFCA 4C5EA 1PSFA 2ZCFB 3L2RA 1BIAA 1OZ2A 1QVFA 3GIBA 1WJRA 3N5BB 4XU3A 4C8QA 3M55A 2CGHA 3JRZA 1VIFA 1Y96A 3LH0A 2A7YA 4M75A 2CKKA 1YIJA 2OTJA 4JUVA 4M7DD 2PU9B 5GMKi 3CCST 4O6JA 4O5VA 4MMLA 1K9MU 3RMSA 2LX9A 4FT2A 3JCMf 3GP8A 1LNXA 3MEWA 4GLKA 3OS1A 2E12A 2DXTA 1EIFA 5CCAA 3S3NA 3OS2A 4ZTJA 1KHIA 3S3MA 3TU4K 4QQDA 4C92G 3Q1JA 4A54A 3CXCA 1VUBA 5CVIA 1YITA 3JB9I 2M16A 2EQMA 2OAUA 2R5AA 5GMKm 1XQHA 3CBPA 4FSXA 2YLCA 2RA2A 3RUXA 3INZA 3V7RA 1JJ2A 1M8VA 2QXFA 2LQ8A 2IVWA 3WVEB 5C6SA 5GAN8 4M77F 2RJDA 2QQ9A 1VQOT 2E5QA 5CKFA 2ZPHB 5GAOm 1Q7YC 1R8OB 4RCCA 5GANd 3HHTB 5LL6S 5DY9A 3CMEA 3X25B 4NL2A 3GPLA 4J7IA 4PJOF 5FRNA 2M1HA 1BI1A 3ASKA 5D6WA 2QEXA 4PLIA 1VQNA 4M78D 2JTFA 4ME7A 3CCQA 4KBMB 4RG2A 2CS7A 2GCXA 5IN1A 2P0KA 1M9SA 2HD0A 3VUBA 3SWNA 3ZFJA 2A3LA 2GFAA 1YJ9T 5GAN2 4JS5A 3FJPA 3SFMA 3M4GA 2VGNA 2EAYA 3EFRA 4FIBA 3E1SA 2PVDB 1NJIC 3OBYA 2JVVA 3I56A 3OW2S 3ZEHA 2E6ZA 2ZPBB 3MP1A 3SDZA 5CIUA 3LWHA 2K5IA 1VQ8A 3BDLA 3MP6A 2RM4A 3P8BB 4LDVA 4M77A 3HKSA 4KUDK 4V2SA 3RKWA 5FU6B 4KT0E 3BY7A 5A0DA 2XD0A 3GNGA 4M75D 5AYFA 3CCLT 1BIBA 4HKEA 2WSFE 2B8AA 3HPWA 4PJOA 4JRKA 2G3RA 1FX7A 5CR2A 4BY6C 1N6AA 2QA4A 2KMTA 1Q86C 5LJ5d 1I81A 2QDYB 3I55A 1WJQA 2ZPIB 4EMHA 2D9TA 2I2LA 5GMKj 2K5FA 4XQ3A 2PVOB 2XK0A 2HQEA 4JRQA 3QKJA 1Q82U 5GAN6 3CCEA 5KCHA 4LD6A 3PTAA 5CO7A 1ZHIA 1PSEA 3E9FA 4F7UB 3JB9G 3HRUA 2XIDA 3CCJA 2VXFA 4L6V5 1N27A 2DTHA 1K8AC 4YTLA 3L2VA 3G71T 4BE0A 2IG0A 2VYTA 4C5GA 4EDUA 4JRPA 3NTHA 3OW2A 2DZCA 5KH6A 2BIVA 3C4SA 4XK8E 4BI4A 5DM7R 1W2BS 2X4JA 1WJSA 3GOXA 1N8RU 3SD4A 3JCMV 5LJ3h 4M7AG 5GMKe 3CCSA 4Z02A 1B34B 2ZPEB 2DD5A 4RMOA 3PIPA 3J7AF 3EFSA 2EJFA 2LT4A 3CCVT 4OB3B 1YI2T 2MWOA 4ZN3A 3V8LA 2PVGB 1JB0E 3M53A 5I2SA 4BI3A 5D6XA 5HK0A 4DOWA 2XI9A 3A8LB 5FRMA 2DD4A 3MEUA 4JJNK 4PLLA 5I21A 2XKOC 2VGMA 4XAXB 1KQ1A 3MEVA 4OVAA 5GAMd 2KDSA 3QDRB 3V8JA 1BYMA 4Y28E 2D6FA 2LQKA 2AHJB 4M77D 2RJEA 2E10A 2JOYA 4BDZA 4JRIA 1VQOA 2L5QA 3M56A 2GFUA 3RKYA 3JSCA 1XTDA 3QUIA 4EMKC 1G3TA 5LJ3g 4QVCA 4ZGEB 2FHDA 1UEBA 4M7DE 3BFMA 4IUQA 4J8OA 4C8QG 1JJ2S 1WNLA 4M75G 2FL7A 3JCMd 1W2BA 2RI3A 3HSBA 4XTZA 1NE8A 1H3ZA 4C92B 2D0QB 3HFNA 4HCCA 2XU8A 1BI0A 2DAQA 4RCBA 5GAOr 1YJ9A 3LYIA 2RJFA 4Q5WA 5FROA 3HFOA 2DJZA 3OQ5A 3PIOA 2NLUA 3DLMA 4ATOA 3UDCA 4X9CA 1LJOA 3L2UA 1GXIE 4IUVA 4R56A 2JZ2A 5HY6A 2V8JA 5CQXA 1U8RA 1KG1A 1M1KC 2DO3A 3GF5A 1DJ7B 4J7FA 4NS5A 1N9SA 3EAEA 4OB0B 5CKEA 5HKCA 3HL8A 3WVDB 3OYMA 3LGFA 3CCLA 1WPYA 4XTYA 5FU7C 5GANh 3OYEA 3FDRA 4LDXA 3CBMA 3GLXA 1Q7YU 4M78E 3HRSA 3JB9D 4MMKA 1KQ2A 2E65A 2CYZB 3VKIA 4BE2A 4F7UE 3H8ZA 4KULA 4J6WA 3TREA 3CCRA 4OGCA 4OB2B 2FB7A 5M9OA 1VQ4T 1B34A 1I8FA 2KSSA 5FU7B 3QBYA 1YJNT 3OSVA 2X4XA 4DQ2A 2HNIA 3VV0A 5A2QE 4M7DC 2F5TX 3E9GA 4M7AD 1FWZA 1M1GA 2EWNA 3KBGA 4E47A 1I4K1 1G5VA 4PKCC 3X28B 2RHXA 3G71A 3M4YA 1NJIU 2X35A 1D3BA 3TEEA 2CZ1B 1Y7XA 3M57A 3P8DA 4E7LA 5GMKl 3VU3C 1JBMA 5GANg 1VQMT 2Y4YA 2DZ9A 3LX7A 4M77G 4OB1B 1VQ5T 4XTUA 3G4ST 4M7DB 3FLGA 2PQWA 4JLGA 3E19A 3A8HB 2PUKB 1ZQ1A 3CCVA 5FU6C 2XHCA 1YI2A 5LJ3j 4PJOG 4C0FA 5LJ5h 5GAOn 4J5YA 3OYAA 5GAOl 4XU1A 3M9QA 2DIQA 4QVDA 3G6ET 3X24B 1Q86U 1IZ6A 4B9XA 4NL3A 1XOVA 2KVQG 3LW5E 1K73C 4RG8A 3FEOA 3QZ9B 4IUTA 4QW2A 1ZBXA 4M78C 3OY9A 3O8VA 4C8QD 1VQ9T 2RB6A 4J83A 4HA8A 4VUBA 4PL6A 2GF7A 5EG2A 3CCUA 4ZTFA 1VQKT 4GY5A 4EMKA 2P4TA 3CMAT 1HK9A 1S72T 1M1FA 3RKXA 1K8AU 2QTXA 2EIFA 5LJ3e 3P8HA 4C92E 3URGA 5FLXE 3CD6T 2HQXA 3OYBA 4M78B 2LVMA 3X20B 1VQLT 2YLBA 5LJ5g 4BDYA 1KHCA 4FL6A 3NTIA 2JTMA 2RHZA 3MCAB 3PT9A 1KC8C 3RESA 1M90C 3QZ5B 2DXBA 2F5KA 4BD3A 4PNOA 2H3JA 3QYHB 1VQ7T 4M7DF 2JN0A 2VUBA 2O01E 1W4SA 3QYGB 3RIRA 3CC2T 3OYNA 1NPPA 4IUPA 3OYIA 4P5NA 5GAMh 1SSFA 1QW1A 1JRIA 4C5IA 1YHQT 1LOJA 2EFIA 2JNGA 2EJ9A 4M75B 2OTLT 2RHUA 3UWNA 3OS0A 3MP8A 4LDYA 2HAXA 2K4YA 2DTIA 3QO3A 5IAYA 2F69A 3VUZA 2YHTA 5GANj 3JCMh 4C0GA 2DEQA 2M0OA 4ZGDB 3JCMX 1OZ3A 5CQYA 4J6YA 2QQAA 4ELZC 2DXUA 1I5LA 1KD1C 3OSSC 5J26A 1VQ4A 4NOYA 3RERA 1M5Q1 4M7DA 1YJNA 1Y71A 4M78F 4C92C 5A0GA 3JCMW 4HCBA 4QQGA 2ZPGB 3LLRA 5GAMg 4IUUA 4F7UF 3CPWS 2R5MA 2EKOA 4CRIA 4PJOD 2CZ7B 2L3RA 1YJWT 4E7JA 4A4KA 1M1KU 1VQMA 1VQ5A 5GANe 5GAOq 1H641 1VIEA 3VJPA 1QP3A 3FIFA 4X9DA 2LNVA 5GAN5 3G4SA 1HXDA 4L5GA 3QIIA 3HP9A 5IT9E 3JCMg 3OBWA 4ELYC 4RKUE 3FRNA 3SB2A 4BI8B 3CC4T 4ZN1A 2C06A 4HT9A 3SWNB 3PGGA 5DLOA 2XDBA 3G6EA 4BE1A 5KE2A 3KXTA 3J80E 1OYXA 2RD1A 4E7HA 5LJ5j 3RMQA 4XU0A 4M78A 2DIGA 4MZTA 2QQBA 2X4WA 2BUDA 4BACA 4M7AE 3G7ZA 3DB3A 3H6ZA 3I55T 1VQ9A 3CCRT 2K3XA 1O75A 4F7UA 2X4YA 3M59A 4LDWA 3A8OB 4M77B 1VQKA 2MF2A 4BB7A 3PMIA 3PNWC 1S72A 4MDWA 3T9NA 3M58A 3CPWA 3ER0A 2MMPA 2VV5A 1WGSA 2K5LA 5CK9A 3CD6A 3L2WA 4L59A 5L8RE 1X01A 2KQWA 3ZBDA 2MWPA 5LJ3f 5A0LA 3OYJA 2O4XB 5LJ5e 1VQLA 1TH7A 1XNIA 3OYCA 1KQSS 3L2ZA 4KUIA 5CKHA 4WF2A 4XU2A 3V8KA 4C92F 2ZGWA 1VQ7A 2DTOA 1VQPT 3PMTA 3OYKA 2DXCA 1QVPA 5HK3A 3CC2A 3OYYA 1VQ6T 1X75C 2E70A 3QXEB 4BUGA 3DLLA 2FYKA 4C8QE 3JCMb 1AHJB 4M75E 2KAFA 4DOVA 1K73U 3QSUA 2V8IA 4OMFB 2RI2A 2WACA 1YHQA 3AHUA 5GAMj 5D6YA 2WSEE 4A53A 2BKDN 2QQSA 2OTLA 1NPRA 3S3OA 2K57A 4IKFA 3A8MB 5DLQE 1U1SA 3JCMQ 3JCMc 2R58A 2PUOB 4Y91A 5KCOA 2EYQA 3OYLA 1K9MC 4M7AC 4II1A 1G3WA 1MGQA 2JUFA 3CC7T 2E41A 4HT8A 3F70A 1QVGA 4OGEA 4N4GA 4C92A 4M7DG 2LCLA 2YRVA 2RI5A 2ZZDA 3OMGA 4N4HA 1M90U 2DK3A 2KY9A 3OYGA 1KC8U 4R55A 1KQSA 4MDXA 4MZMA 4A4GA 4XTWA 4OP0A 4C5HA 2ZPFB 4M7AB 3DB4A 5GAMe 2P0QA 3CCMT 2LRQA 2KK4A 1RI0A 4CI0C 2EQJA 2K3YA 4QVZA 3LWIA 1WQWA 2LDMA 3L42A 2DPPB 4D6WA 4JDSA 1YJWA 2WSCE 4C0ZA 2DKGA 4QQ6A 1UGQB 2CZ6B 2QQRA 3V7SA 2R57A 2LT1A 1G3SA 4FT4A 2QI2A 4N0AC 1Q81U 5GAN7 4HCZA 5GANf 3JCMJ 2XICA 3QG1A 1YIJT 4X34A 3JCMe 1QVGS 2OTJT 1WQ7A 2EQUA 4C8QC 3CC4A 2RHYA 4M75C 2GQVA 1YBYA 2V8KA 2L89A 4IURA 4N4IA 3OB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DY9 A;  3V7C A;  4NL2 A;  4PJO F;  5GAM g;  1YCY A;  5GAN 4;  4M78 D;  4F7U F;  3JB9 F;  4M77 E;  1WPY A;  4XTY A;  3JB9 H;  5GAN h;  4PJO D;  4M7D G;  3SWN A;  5GAN 3;  3BDU A;  4C8Q B;  4M78 E;  3JB9 D;  5GAN e;  4MMK A;  1H64 1;  1Y96 B;  5GAN 2;  3FJP A;  5GAO q;  1KQ2 A;  3FIF A;  4EMG A;  3M4G A;  4X9D A;  2E65 A;  5GAN 5;  4PJO E;  1HXD A;  2EAY A;  3EFR A;  3JB9 J;  4F7U E;  4J6W A;  3JCM g;  2FB7 A;  3SB2 A;  4M7A F;  3L1A A;  1I8F A;  1B34 A;  4HT9 A;  3SWN B;  3PGG A;  3QHS A;  4DQ2 A;  2HNI A;  4M7D C;  2RM4 A;  4M77 A;  2RD1 A;  4M7A D;  1N9R A;  4V2S A;  2EWN A;  3RKW A;  5LJ5 j;  1I4K 1;  3BY7 A;  4M75 D;  4XU0 A;  4M78 A;  1BIB A;  5LJ5 f;  4C92 D;  1D3B A;  4M7A E;  4PJO A;  4JRK A;  4F7U A;  3VU3 C;  1JBM A;  5GMK l;  5GAN g;  2DZ9 A;  4M77 G;  4M77 B;  5LJ5 d;  3SWN C;  2E1H A;  1I81 A;  4XTU A;  4EMH A;  4M7D B;  2I2L A;  5GMK j;  4XQ3 A;  4M78 G;  1D3B B;  5LJ3 j;  4PJO G;  5GAN 6;  5LJ5 h;  5GAO n;  4J5Y A;  5GAO l;  1U1T A;  4XU1 A;  5CAI A;  1X01 A;  2VXE A;  4F7U B;  4F7U G;  5LJ3 f;  4QVD A;  3JB9 G;  2EJG A;  5LJ5 e;  5GAO p;  4XTX A;  4NL3 A;  1TH7 A;  4M7A A;  2VXF A;  2DTH A;  4M77 C;  4C8Q F;  4XTV A;  3L2Z A;  2VC8 A;  4M75 F;  5LJ3 d;  4WF2 A;  4XU2 A;  2Y90 A;  3V8K A;  4C92 F;  5GAN d;  2ZGW A;  4M78 C;  4JLI A;  2DZC A;  2DTO A;  4C8Q D;  5GMK h;  2RB6 A;  2E64 A;  2DVE A;  4HA8 A;  3JCM P;  4PJO C;  3JCM V;  5LJ3 h;  4EMK A;  5GMK e;  4M7A G;  1HK9 A;  1B34 B;  2FYK A;  3RKX A;  4C8Q E;  3EFS A;  3JCM b;  2EJF A;  2QTX A;  4M75 E;  3QSU A;  5LJ3 e;  3FB9 A;  4C92 E;  4J6X A;  3AHU A;  3V8L A;  5GAM j;  4M78 B;  3BW1 A;  4A53 A;  2YLB A;  5LJ5 g;  4EMK B;  5GAM f;  2K57 A;  4PJO B;  1U1S A;  5I21 A;  3JCM Q;  4N0A A;  3JCM c;  3RES A;  4Y91 A;  4M7A C;  1MGQ A;  1BIA A;  1KQ1 A;  4PNO A;  2E41 A;  5GAM d;  3V8J A;  3GIB A;  4M7D F;  2JN0 A;  4XU3 A;  4HT8 A;  4C8Q A;  2CGH A;  4M77 D;  1Y96 A;  4M75 A;  2E10 A;  3RIR A;  4JRI A;  4JUV A;  4C92 A;  4M7D D;  3RKY A;  5GMK i;  5GAM h;  3QUI A;  4MML A;  4EMK C;  5LJ3 g;  4C92 C;  3JCM f;  4QVC A;  1LNX A;  4XTW A;  1JRI A;  4OP0 A;  4M7A B;  5GAM e;  4M7D E;  2DXT A;  1LOJ A;  3BFM A;  4C8Q G;  1WNL A;  4M75 G;  2EJ9 A;  4M75 B;  3JCM d;  3HSB A;  1WQW A;  4XTZ A;  4C92 G;  4A54 A;  4C92 B;  3HFN A;  2DKG A;  5GAO r;  4RCB A;  3V7S A;  3JB9 I;  2DTI A;  3QO3 A;  5GMK m;  3HFO A;  2DJZ A;  2YLC A;  2RA2 A;  2YHT A;  3INZ A;  4N0A C;  3RUX A;  3JCM h;  2DEQ A;  3V7R A;  3JCM X;  5GAN 7;  5GAN j;  1M8V A;  4J6Y A;  4X9C A;  1LJO A;  2DXU A;  5GAN 8;  5GAN f;  3JCM J;  3JCM e;  4M77 F;  1I5L A;  1WQ7 A;  4C8Q C;  4NOY A;  3RER A;  1M5Q 1;  4M75 C;  4M7D A;  5GAO m;  1N9S A;  4RCC A;  4M78 F;  3JCM W; 
#chains in the Genus database with same CATH topology
 3D7S B;  4EPC A;  2YRC A;  3R6O A;  3DKM A;  2XMF A;  4TVR A;  2EGA A;  4LD9 K;  1WX6 A;  4C8Q B;  2LTO A;  2LCC A;  2NUP A;  2CZ0 B;  5KE3 A;  2RQU A;  3A98 A;  4BY6 B;  1KQS P;  2RH2 A;  3QHS A;  3X26 B;  3LGL A;  1KFZ A;  2QEX T;  1VQN T;  2P0P A;  1HJD A;  3C95 A;  5LJ5 f;  4C92 D;  3OA6 A;  2FVU A;  2X9H A;  1WXT A;  3CBO A;  4C0D B;  1VQ6 A;  3MET A;  4M78 G;  3EH1 A;  3TCJ A;  1FMK A;  4DA4 A;  4F7U G;  1VQ8 T;  4E7Z A;  1N8R C;  4M7A A;  2AKK A;  4M77 C;  1M27 C;  4Y92 A;  3CC7 A;  4Z8A A;  4RTU A;  3JCM P;  2DVE A;  4PJO C;  1M1K R;  3OMC A;  2NUT A;  1LVK A;  1AD5 A;  1P92 A;  5KYX A;  1JU5 C;  2DYI A;  3CMA A;  3CEY A;  3CCQ Q;  3CCE T;  2B86 A;  2QAS A;  3UPU A;  2RJC A;  1G3Y A;  4FM4 B;  1V1C A;  4C5E A;  1IHV A;  1OZ2 A;  1QVF A;  1WJR A;  3MJX A;  3H9N A;  3M55 A;  1YIJ A;  3TQ7 P;  4M7D D;  4O6J A;  1QWF A;  4MML A;  3RMS A;  4GLK A;  3OS1 A;  5IH2 A;  3MKD A;  3CCU Q;  3S3N A;  3EFO B;  4ZTJ A;  1WA7 A;  2CRE A;  4C92 G;  2QA4 Q;  3NHN A;  2O2O A;  1JJ2 A;  3CBP A;  2RA2 A;  3INZ A;  2M02 A;  2QXF A;  2LQ8 A;  2I0N A;  4M77 F;  2RJD A;  5CKF A;  5GAN d;  3HHT B;  5DY9 A;  3CME A;  4FYX B;  4J7I A;  1OQK A;  1OU9 A;  1QLY A;  3ASK A;  4PJO F;  4LN2 A;  1RAI B;  4KBM B;  2MOX A;  3ZFJ A;  2A3L A;  1YJ9 T;  2FG0 A;  3FJP A;  1TS9 A;  3EFR A;  1NJI C;  1D09 B;  1OPL A;  2CP2 A;  3I56 A;  3OW2 S;  4GLM A;  1UG1 A;  2JMC A;  2JM8 A;  3RKW A;  3CCL T;  1BIB A;  3CXC P;  2B8A A;  4AT1 B;  2HZY A;  2ZPI B;  2I2L A;  3UAT A;  2HQE A;  3QKJ A;  1Q82 U;  5KCH A;  1PRL C;  3BE3 A;  4YTL A;  3L2V A;  4BE0 A;  2QK0 A;  4J9F A;  3G6E Q;  2DZC A;  3QDF A;  2HBW A;  2QAZ A;  3GOX A;  4M7A G;  3CCS A;  1B34 B;  3PIP A;  3EFS A;  3CCV T;  1YI2 T;  4DOW A;  5FRM A;  2DD4 A;  4JJN K;  1IGU A;  1KQ1 A;  3MEV A;  4HVU A;  5FWB A;  5GAM d;  2KDS A;  2K2M A;  2LQK A;  1VQO A;  2L5Q A;  3M56 A;  1S1N A;  1XTD A;  5LJ3 g;  2CSI A;  4CC7 A;  2FZG B;  2BE9 B;  1H3Z A;  1W2B A;  2F1L A;  2XU8 A;  4RCB A;  3M0S A;  4DBH A;  4ATO A;  3UDC A;  2DF6 A;  3L2U A;  4IUV A;  1KG1 A;  2V8J A;  5CQX A;  2YSQ A;  1GBR A;  3OYM A;  3LGF A;  3FDR A;  4LDX A;  3CBM A;  1SF9 A;  4M78 E;  1PWT A;  1TUG B;  4MMK A;  2CYZ B;  1YWO A;  4B6M A;  1AWX A;  4F7U E;  1B07 A;  2PTK A;  3H8Z A;  4OGC A;  1BCM A;  2KSS A;  5FU7 B;  3QBY A;  2CH4 A;  3VS4 A;  2X4X A;  2HNI A;  3VV0 A;  2F5T X;  3E9G A;  1FWZ A;  4FYW B;  2CP6 A;  3TEE A;  3P8D A;  2DZ9 A;  3M0U A;  3G4S T;  1AWW A;  4JLG A;  3A8H B;  5FU6 C;  4DBQ A;  5LJ5 h;  5GAO n;  3OYA A;  3M9Q A;  1Q86 U;  4RTT A;  4DBF A;  1QMC A;  1M90 R;  1F1B B;  1T3S A;  3O8V A;  4C8Q D;  1VQ9 T;  3CCU A;  1X69 A;  3CMA T;  1S72 T;  3RKX A;  1JJ2 P;  2QTX A;  4C92 E;  1QCN A;  4M78 B;  2LVM A;  2A0F B;  1VQM Q;  3NTI A;  3I5R A;  3PT9 A;  3RES A;  2DXB A;  2F5K A;  4BD3 A;  1TG0 A;  1VQ7 T;  3EFO A;  1CSK A;  1SHG A;  4IUP A;  4F16 A;  1SSF A;  2CUB A;  1JRI A;  4C5I A;  2JNG A;  2J05 A;  2NUZ A;  1E6H A;  4AFS C;  1ABO A;  1RLP C;  2YHT A;  3JCM X;  4PFO A;  1I5L A;  1VQ4 A;  3M0R A;  4NOY A;  1M5Q 1;  5A0G A;  2QDL A;  2FZK B;  1XJW B;  1Y57 A;  3CPW S;  2CP7 A;  2L3R A;  1M1K U;  1VQ5 A;  5GAO q;  2LNV A;  5GAN 5;  1WXB A;  1QQJ A;  3HP9 A;  3QII A;  3JCM g;  1YIT Q;  4RKU E;  3SB2 A;  5DLO A;  2XDB A;  3G6E A;  1W1F A;  2KBT A;  2RD1 A;  4E7H A;  2JM9 A;  2QQB A;  4M7A E;  3G7Z A;  4LUE A;  3REB B;  2K3X A;  2X4Y A;  4LDW A;  3SEM A;  4M77 B;  2FO0 A;  2K5L A;  3CD6 A;  3L2W A;  2KQW A;  2MWP A;  5LJ5 e;  1TH7 A;  1JQQ A;  2LCS A;  1AZG B;  2NUP B;  5CKH A;  2ZGW A;  2DTO A;  4Z89 A;  3CC4 Q;  2DXC A;  5HK3 A;  3CC2 A;  3OYY A;  2E70 A;  4JPB W;  3DLL A;  1Q7Y R;  2EVR A;  1AHJ B;  2KAF A;  3PE0 A;  2V8I A;  8AT1 B;  3I55 Q;  4PJL A;  2QQS A;  2HEQ A;  2VWF A;  1NPR A;  2K57 A;  1QCF A;  5KCO A;  3OYL A;  2EYQ A;  1UE9 A;  2YDL A;  2E41 A;  1W70 A;  3F70 A;  3CCJ Q;  5KYW B;  1H8K A;  4N4G A;  2ED0 A;  2RI5 A;  1KQS A;  2L0A A;  2LX7 A;  1MNE A;  4M7A B;  1Z9Z A;  2CH4 W;  1T0J A;  4CI0 C;  2EQJ A;  2CP3 A;  2LDM A;  1YJW A;  2WSC E;  4C0Z A;  1B7T A;  1VQ6 Q;  2CZ6 B;  1G3S A;  2QI2 A;  1ZBJ A;  2NUT B;  2G6F X;  4EIK A;  2DL8 A;  1QVG S;  5KYX B;  2K79 A;  4KH0 B;  2GQV A;  1YBY A;  4E7I A;  2L89 A;  4IUR A;  4N4I A;  4Z02 A;  1M30 A;  2RQT A;  4A4E A;  1QKW A;  3V7C A;  1K8A R;  1X27 A;  2K2V A;  2COY A;  2RK1 A;  3CC7 Q;  3JB9 F;  2LJ3 A;  1BI2 A;  5C0M A;  2E6N A;  1OI1 A;  1Q81 C;  2XDP A;  5I2M A;  5J3B A;  3BDU A;  1Q82 R;  4EMG A;  2RO0 A;  4KH1 B;  4E7K A;  1D1C A;  2FRW A;  2MI6 A;  1N9R A;  4AMC A;  3C94 A;  4OF1 A;  3QWX X;  1VA7 A;  5CKD A;  4A4F A;  3CCQ T;  3U23 A;  3OYD A;  1VQP A;  3EH2 A;  3CPF A;  3TSZ A;  2E1H A;  2DET A;  4D8D A;  1MHN A;  3JAM E;  1D3B B;  3M54 A;  2V1R A;  3PFS A;  2VXE A;  1X6O A;  4F04 B;  5GAO p;  1OEB A;  1UEC A;  2X3X D;  1VOM A;  2J6F A;  1K1Z A;  4LXC A;  5LJ3 d;  3CCU T;  1WHM A;  2Y90 A;  2O88 A;  2HKN A;  2YWW A;  4F14 A;  1GL5 A;  3ME9 A;  1UB4 A;  2E64 A;  2QA4 T;  1UGR B;  4B9W A;  1R0B G;  1N5Z A;  3CME Q;  3FB9 A;  1Y0M A;  3QPH A;  4J6X A;  2Y4X A;  1WLP B;  1ZA2 B;  3NTK A;  4CC4 B;  4KGX B;  3KFV A;  2Z0W A;  3N5B B;  1IRX A;  4IIO A;  4XU3 A;  1UHC A;  3JRZ A;  2A7Y A;  5GMK i;  2RF0 A;  4AG1 C;  2F2V A;  4OMM A;  5CCA A;  2QGG A;  3EGX A;  3Q1J A;  3CXC A;  1YIT A;  5CVI A;  2EQM A;  2COZ A;  3V7R A;  2DBM A;  2DER A;  5GAN 8;  4ANJ A;  2QQ9 A;  5GAO m;  4RCC A;  5IXB A;  1UTI A;  3X25 B;  4NL2 A;  3GPL A;  2SRC A;  5FRN A;  1YNZ A;  1BI1 A;  5D6W A;  1K73 R;  4PLI A;  4M78 D;  1MMG A;  5IN1 A;  4ORZ A;  3CCS Q;  4OMN A;  2EAY A;  1IB8 A;  2K9G A;  3LH5 A;  4FW2 A;  2PVD B;  3OBY A;  2JVV A;  3ZEH A;  2E6Z A;  2ZPB B;  5CIU A;  2E4H A;  3MP6 A;  2FEI A;  3P8B B;  4LDV A;  4M77 A;  3HKS A;  4KUD K;  4V2S A;  5FU6 B;  5A0D A;  5AYF A;  1YJN Q;  4PJO A;  2G3R A;  1VQO Q;  3EGD B;  1I81 A;  1NYG A;  3I55 A;  1WJQ A;  1VYU A;  2M51 A;  2K5F A;  2XK0 A;  4JRQ A;  4LNP A;  1TOV A;  4R0K A;  3HRU A;  2HSP A;  3CCJ A;  2VXF A;  4L6V 5;  2VB6 A;  4EDU A;  3NTH A;  1PHT A;  4BI4 A;  5DM7 R;  1KD1 R;  2GTO A;  2ZPE B;  2DD5 A;  3J7A F;  2LT4 A;  2DLP A;  2MWO A;  4ZN3 A;  2PVG B;  3M53 A;  4BI3 A;  2KRO A;  5KYW A;  3A8L B;  3MEU A;  5I21 A;  2D1X A;  1NLO C;  1U5S A;  3QDR B;  4DEY A;  4M77 D;  3RDV A;  2JOY A;  2FPF A;  4JRI A;  2GFU A;  3QUI A;  4EMK C;  1G3T A;  2DL4 A;  2LQN A;  2FHD A;  3BFM A;  3EHQ A;  4HCK A;  4J8O A;  1WNL A;  2FL7 A;  3JCM d;  3HSB A;  4XTZ A;  1K0X A;  3HFN A;  1BI0 A;  2DAQ A;  2C0T A;  2RJF A;  1Q95 G;  3OW2 P;  3PIO A;  2VKN A;  1IO6 A;  2ABL A;  1LJO A;  2SEM A;  1G83 A;  1WHK A;  5HY6 A;  1CKB A;  1U8R A;  2RN8 A;  1DJ7 B;  4J7F A;  1H3H A;  1N9S A;  3EAE A;  2GTJ A;  4OB0 B;  4AG2 C;  1R77 A;  2EYY A;  2LZ6 B;  1SG5 A;  1TTH B;  4XTY A;  3OYE A;  1Q7Y U;  2LJ1 A;  2VAS A;  2HQH A;  4CC3 A;  2JMA A;  4FYV B;  5IXF A;  1OX9 A;  4J9D A;  5A2Q E;  4M7D C;  4M7A D;  1M1G A;  4E47 A;  1Z9Q A;  3KBG A;  1K9M R;  1I4K 1;  1IHW A;  4PKC C;  3G71 A;  1D3B A;  2CZ1 B;  4E7L A;  2JS0 A;  1VQM T;  1JBM A;  4M77 G;  1AVZ C;  4XTU A;  4A63 B;  2PQW A;  2DBK A;  3E19 A;  1ZQ1 A;  2XHC A;  4PJO G;  1ACM B;  4XU1 A;  2DIQ A;  3E2U A;  4B9X A;  2KVQ G;  2KXC A;  1VQ4 Q;  4VUB A;  2GF7 A;  2GBQ A;  2P4T A;  4GBQ A;  1K8A U;  3P8H A;  1PRM C;  2YUN A;  2YLB A;  5LJ5 g;  4HXJ A;  1VQ5 Q;  1KHC A;  3MCA B;  1M90 C;  1KC8 C;  1ARK A;  2H3J A;  4M7D F;  2O01 E;  1ZUK A;  4LE9 A;  2DEU A;  3OYN A;  1NPP A;  2OJ2 A;  4P5N A;  2HKQ B;  1NYF A;  1AWO A;  1LOJ A;  3GBQ A;  1C1A A;  4RTY A;  3EHR A;  3MP8 A;  1GFC A;  4LDY A;  2K4Y A;  2DTI A;  2CP0 A;  2F69 A;  3VUZ A;  5GAN j;  4C0G A;  2DEQ A;  2M0O A;  4ZGD B;  5CQY A;  2QQA A;  2DXU A;  3CD6 Q;  1A0N B;  4OMO A;  5J26 A;  2CSQ A;  2EYZ A;  4X1V A;  3RER A;  5GJW B;  1N8R R;  2MIO A;  1YJN A;  1T3L A;  2ZPG B;  1X2K A;  3LLR A;  2AZS A;  1RAC B;  2A08 A;  2DYB A;  4ZNX A;  2EKO A;  3CC2 Q;  1H64 1;  3VJP A;  1QP3 A;  2YXY A;  4X9D A;  5IT9 E;  1ZSZ C;  3H0H A;  3FRN A;  4BI8 B;  3CC4 T;  3PGG A;  3EGD A;  5KE2 A;  3J80 E;  1QCO A;  1NEB A;  3RMQ A;  4XU0 A;  2DIG A;  4BAC A;  3DB3 A;  3H6Z A;  4OMP A;  3I55 T;  1SRM A;  3M59 A;  2QEX Q;  1VQK A;  4AFZ C;  1WZO A;  4MDW A;  1KJW A;  1K9A A;  2VV5 A;  4L59 A;  1YJW Q;  1VQL A;  2W0Z A;  1W6X A;  1T0H A;  3L2Z A;  2QG9 B;  1D0Y A;  1VQ8 Q;  3V8K A;  1WHL A;  3OYK A;  2CDT A;  1QVP A;  4PFP A;  1VQ6 T;  1X75 C;  3QXE B;  1WI7 A;  3JCM b;  1K73 U;  4OMF B;  1YHQ A;  3AHU A;  2YUP A;  5GAM j;  1RAB B;  4A53 A;  2OTL A;  5I11 A;  3JCM Q;  4Y91 A;  3EG2 A;  1G3W A;  2O31 A;  2JJ9 A;  3CC7 T;  1NJI R;  4HT8 A;  5D7U A;  3VRY A;  2YRV A;  3CPW P;  4KRT A;  4A4G A;  2ZPF B;  3DB4 A;  1RI0 A;  1VQP Q;  3VS6 A;  4JDS A;  2L3S A;  1UGQ B;  5KYY A;  2HDA A;  4J9B A;  2R57 A;  4FT4 A;  4N0A C;  1Q81 U;  4HCZ A;  2DL7 A;  1MND A;  5GAN f;  3EG1 A;  2XIC A;  3QG1 A;  3JCM J;  1YIJ T;  3PVL A;  4QKU A;  4C8Q C;  4M75 C;  1OPK A;  2C0I A;  3OB9 A;  3C12 A;  2IIM A;  2EQK A;  1OUL A;  3RR6 A;  3FC3 A;  1NZ9 A;  4M77 E;  3JB9 H;  2CUD A;  3M5A A;  1KD1 U;  3J81 E;  3CCR A;  2HL5 C;  3KUF A;  3VYH B;  1AWJ A;  2DL5 A;  3VYG A;  4PJO E;  1FXX A;  3OYF A;  1YJ9 Q;  4C0D C;  3L1A A;  1GCQ C;  3EG0 A;  3MO8 A;  3EGX B;  3CME T;  2HBP A;  2ATC B;  5J39 A;  4JJC A;  4RTZ A;  3L2Q A;  1D0Z A;  1Q82 C;  4FYY B;  1V29 B;  1O9S A;  2QTV A;  3OYH A;  3SWN C;  2AKL A;  2MCN A;  1UFF A;  4JJB A;  2M9U A;  1RAE B;  1QVF S;  3AT1 B;  3I56 T;  2RMO A;  1IRE B;  1ZLM A;  2AT1 B;  3UT1 A;  1M8M A;  2D0N A;  2EJG A;  4J9I A;  4C8Q F;  4XTV A;  4M75 F;  2VC8 A;  1X6G A;  2RK2 A;  3C0C A;  3RNJ A;  2HSE B;  4ZGJ B;  1PKT A;  4RUG A;  2XG8 D;  3M0Q A;  3OS5 A;  1M4Z A;  3CCM A;  1MMN A;  2GQI A;  1JXM A;  2AIR B;  3BW1 A;  4EMK B;  5GAM f;  4PJO B;  1KSW A;  1OU8 A;  1YI2 Q;  1QVG P;  1PD0 A;  3NFC A;  8ATC B;  3L2R A;  3ZL7 C;  1ZUU A;  2DMO A;  2CGH A;  3LH0 A;  1Y96 A;  2OTJ A;  2CKK A;  4JUV A;  2PU9 B;  3CCS T;  4O5V A;  1K9M U;  1BBZ A;  4FT2 A;  2JT4 A;  3GP8 A;  2ED1 A;  2DE0 X;  2E12 A;  2DXT A;  1EIF A;  3OS2 A;  1D1A A;  2KYB A;  3S3M A;  1RAF B;  3VS0 A;  4QQD A;  4A54 A;  2YRD A;  3JV3 A;  2OAU A;  5GMK m;  4RTV A;  1XQH A;  1WDX A;  2E5K A;  3RUX A;  1M8V A;  1VQO T;  3UA7 A;  1JEG A;  1R8O B;  1RLQ C;  2MK5 A;  2M1H A;  2QEX A;  1VQN A;  2JTF A;  4ME7 A;  2CS7 A;  1K76 A;  2GFA A;  5GAN 2;  3M4G A;  3NGP A;  4FIB A;  2P4R A;  3H41 A;  1YCS B;  3SDZ A;  1VQ8 A;  3BDL A;  4KT0 E;  1RAD B;  1EZZ B;  1FX7 A;  5CR2 A;  1N6A A;  1Q86 C;  2EKH A;  5LJ5 d;  1WHG A;  2QDY B;  4EMH A;  5GMK j;  3TVT A;  2KT8 A;  2KR3 A;  5GAN 6;  1X43 A;  3CCE A;  4LD6 A;  5CO7 A;  3E9F A;  3JB9 G;  2NWM A;  2P84 A;  2IG0 A;  1PCX A;  4J9H A;  3OW2 A;  1W2B S;  2YT6 A;  1WJS A;  2C0O A;  1N8R U;  3SD4 A;  3JCM V;  4RMO A;  2A28 A;  3I5S A;  1C0M A;  1M3A A;  1VQ9 Q;  1LPL A;  1JB0 E;  3VRZ A;  3O5Z A;  5HK0 A;  2XI9 A;  2CT3 A;  4PLL A;  2XKO C;  4XAX B;  4OVA A;  3V8J A;  1M2V A;  1BYM A;  3VS3 A;  2JXB A;  2E10 A;  2V1Q A;  4BDZ A;  3JSC A;  1FYN A;  1UJY A;  4QVC A;  3G71 Q;  2PNI A;  4ZGE B;  1FMW A;  2AZV A;  4K11 A;  2RI3 A;  1NE8 A;  1NBE B;  1YP5 A;  1YJ9 A;  2HCK A;  2PZ1 A;  2IPO B;  2DJZ A;  3HFO A;  2NLU A;  2X3W D;  2RQR A;  4X9C A;  1UGV A;  4R56 A;  2JZ2 A;  1M1K C;  2DO3 A;  4LUD A;  2DIL A;  3GF5 A;  5HCK A;  1HSQ A;  2D8J A;  1D1B A;  3G1J A;  3CCL A;  1FMV A;  1WPY A;  2VVK A;  5FU7 C;  5GAN h;  1PD1 A;  3GLX A;  3HRS A;  3PVQ A;  2E65 A;  2DM1 A;  5KYU B;  3VKI A;  4BE2 A;  2YUQ A;  3TRE A;  4J6W A;  2FB7 A;  5M9O A;  1VQ4 T;  1I8F A;  3OSV A;  3UA6 A;  1H92 A;  2EWN A;  1G5V A;  3X28 B;  2RHX A;  1NJI U;  2X35 A;  1EX4 A;  1Y7X A;  1VQ5 T;  3LX7 A;  4JJD A;  3CCV A;  1YI2 A;  5LJ3 j;  4C0F A;  1SHF A;  5GAO l;  4ESR A;  4QVD A;  3G6E T;  3X24 B;  4NL3 A;  1XOV A;  4E6R A;  2E3H A;  1KIK A;  4RG8 A;  1IGQ A;  2RNA A;  3FEO A;  3RBB B;  4IUT A;  1ZBX A;  4M78 C;  3UF4 A;  5AT1 B;  3OY9 A;  1AEY A;  1MMA A;  4PL6 A;  4GY5 A;  4EMK A;  1TUD A;  1AOJ A;  1I0C A;  2E3I A;  1PC0 A;  5FLX E;  3CD6 T;  2HQX A;  3X20 B;  2RQV A;  4BDY A;  1Q81 R;  4FL6 A;  2JTM A;  1RAH B;  4PNO A;  3QYH B;  1W4S A;  3QYG B;  3CC2 T;  4J9G A;  5L23 A;  1WHJ A;  2BZY A;  5GAM h;  1J3T A;  3MPU B;  2JW4 A;  1LCK A;  2EJ9 A;  4M75 B;  2RHU A;  3OS0 A;  1VQK Q;  4DEX A;  2KGT A;  3QO3 A;  3NMZ C;  2BZX A;  1NLP C;  4J6Y A;  4ELZ C;  2A37 A;  3OSS C;  1VQL Q;  4M7D A;  1E7O A;  1Y71 A;  4M78 F;  4C92 C;  3JCM W;  3M0P A;  3QWY A;  4HVW A;  4PK4 A;  4F7U F;  2R5M A;  2X51 A;  4CRI A;  4PJO D;  1YJW T;  4E7J A;  1AZE A;  5GAN e;  3G4S A;  1RI9 A;  1YHQ Q;  3OBW A;  4ELY C;  2OTL Q;  4ZN1 A;  4HT9 A;  3SWN B;  5IHI A;  1TU0 B;  4BE1 A;  1OYX A;  2DJQ A;  2MPX C;  1BK2 A;  1TXQ A;  5KYY B;  3REA B;  4MZT A;  2X4W A;  2K3B A;  1VQ9 A;  3A8O B;  5EC7 A;  4BB7 A;  1S72 A;  1YFN A;  4RTW A;  3CPW A;  2LJ0 A;  3ER0 A;  1TSF A;  5L8R E;  3OYJ A;  1RUW A;  5LJ3 f;  1KQS S;  4CC2 A;  2L2P A;  2F2W A;  4KUI A;  4WF2 A;  4C92 F;  2HL3 A;  1VQ7 A;  1VQP T;  2QYZ A;  3PMT A;  4BUG A;  1GRI A;  2FYK A;  3QSU A;  4DOV A;  2WAC A;  7AT1 B;  1BCO A;  1PNJ A;  5D6Y A;  2WSE E;  3CCR Q;  1U1S A;  2R58 A;  2PUO B;  4M7A C;  2JUF A;  2FZC B;  2HMA A;  4OGE A;  1ABQ A;  1U3O A;  3NPF A;  2LCL A;  3VS5 A;  2KNB B;  2DK3 A;  1CKA A;  3OYG A;  2EGE A;  4XTW A;  4OP0 A;  5GAM e;  2P0Q A;  2L3Q A;  2LRQ A;  3EGU A;  2K3Y A;  3LWI A;  4FSS A;  1WQW A;  4D6W A;  3L42 A;  4PFZ A;  2W10 A;  2DKG A;  1BB9 A;  2QQR A;  2EPD A;  1ZSZ A;  4X34 A;  1PG5 B;  2EQU A;  1MMD A;  2RHY A;  3ULR B;  2D8H A;  2V8K A;  5FWC A;  2KXD A;  1HD3 A;  2RHI A;  2ROL A;  1YCY A;  5GAN 4;  5KYU A;  2XDD A;  2O4X A;  1WFW A;  1SRL A;  2LC4 A;  1UGS B;  4M7D G;  5GAN 3;  2LP5 A;  4FU6 A;  4D8K A;  1YIT T;  1Y96 B;  1G8X A;  1G2B A;  1BI3 A;  2OX7 A;  3GNF B;  1UGP B;  2AK5 A;  3JB9 J;  3CCM Q;  1ZUY A;  3QJY A;  1YN8 A;  3QJ6 A;  4M7A F;  2LNH B;  2J7I A;  2H8H A;  4A4H A;  3WXM B;  3A5Z B;  4MZP A;  2L8D A;  3SHW A;  1QVG A;  1Y07 A;  2OTJ Q;  1OV3 A;  3MEA A;  3MHX A;  1WXU A;  1MV3 A;  4PJJ A;  5CKB A;  2DNU A;  2MAM A;  1OX8 A;  1U1T A;  5CAI A;  4XTX A;  4LDU A;  4JS4 A;  3THK A;  3HRT A;  4JLI A;  2O9V A;  1UHF A;  5GMK h;  1WYX A;  4PJN A;  3A8G B;  3CXC S;  1RL2 A;  2H3E B;  2KE9 A;  3H0F A;  3VS1 A;  1QP2 A;  3S6W A;  2BTT A;  2GNC A;  4UC4 A;  1VQN Q;  1I1J A;  2YUO A;  1BKB A;  2ZAE A;  3CCJ T;  4N0A A;  2KI7 A;  1PSF A;  1YWP A;  2ZCF B;  1BIA A;  3GIB A;  4C8Q A;  1VIF A;  4M75 A;  2LX9 A;  3JCM f;  1LNX A;  3MEW A;  2COW A;  1KHI A;  3TU4 K;  1VUB A;  3JB9 I;  2M16 A;  2R5A A;  2ESW A;  4FSX A;  2YLC A;  1ZSG A;  2IVW A;  2KYM A;  4JZ3 A;  3WVE B;  5C6S A;  3CCE Q;  1GCQ A;  2E5Q A;  5IHK A;  2ZPH B;  1Q7Y C;  5LL6 S;  3EG3 A;  3CCQ A;  4RG2 A;  2GCX A;  3TSW A;  3VUB A;  2P0K A;  1M9S A;  2HD0 A;  1M2V B;  3SWN A;  4OML A;  4QT7 A;  4J9C A;  1QVF P;  4JS5 A;  3SFM A;  1GFD A;  1MV0 B;  2VGN A;  2EBP A;  3I35 A;  3E1S A;  1TWB A;  1PKS A;  2DRM A;  3MP1 A;  3LWH A;  2K5I A;  2RM4 A;  1KC8 R;  1WHH A;  3BY7 A;  3R6N A;  2XD0 A;  3GNG A;  4M75 D;  4HKE A;  2ENM A;  2WSF E;  2DL3 A;  3HPW A;  4JRK A;  4BY6 C;  2QA4 A;  2KMT A;  1SPK A;  4AFQ C;  1OOT A;  2D9T A;  5FW9 A;  4XQ3 A;  2PVO B;  1NM7 A;  4FW1 A;  3PTA A;  4F7U B;  1ZHI A;  1PSE A;  2XID A;  1N27 A;  2DTH A;  1K8A C;  2J6O A;  3G71 T;  4HVV A;  2VYT A;  4C5G A;  4JRP A;  2BE7 D;  1UJ0 A;  5KH6 A;  2BIV A;  3C4S A;  4XK8 E;  2X4J A;  5LJ3 h;  5GMK e;  1RAG B;  2EJF A;  4OB3 B;  3CCL Q;  1GCP A;  3V8L A;  5I2S A;  1X6B A;  5D6X A;  2LQW A;  1ZA1 B;  1VYT A;  4DBR A;  1I5O B;  2VGM A;  1X2Q A;  4Y28 E;  2D6F A;  2AHJ B;  2RJE A;  1C6V X;  1MUZ A;  3RKY A;  1QWE A;  3EG9 B;  2DVJ A;  2DRK A;  4M7D E;  1UEB A;  1D0X A;  4IUQ A;  4C8Q G;  3FJ5 A;  1JJ2 S;  4M75 G;  4C92 B;  2D0Q B;  3VS2 A;  4HCC A;  5GAO r;  3LYI A;  4Q5W A;  2L3P A;  5FRO A;  3OQ5 A;  1BU1 A;  2DX1 A;  3CCV Q;  3DLM A;  2CT4 A;  4PJM A;  1GXI E;  4RTX A;  1M3B A;  4M4Z A;  2RQW A;  3I9Q A;  2RPN A;  4NS5 A;  5CKE A;  5HKC A;  2A36 A;  3HL8 A;  3WVD B;  1V76 A;  2GGR A;  1K4U S;  1RAA B;  3H0I A;  3JB9 D;  1KQ2 A;  2EQI A;  4KGZ B;  4KUL A;  3IQL A;  2F2X A;  4OB2 B;  2K7A A;  2OAW A;  1B34 A;  1HYO A;  1YJN T;  1JO8 A;  4DQ2 A;  1R0C B;  2KRM A;  5IHN A;  1W2B P;  3M4Y A;  2J06 A;  3M57 A;  1JXO A;  5GMK l;  3VU3 C;  5GAN g;  2Y4Y A;  4OB1 B;  1EFN A;  4M7D B;  3FLG A;  2PUK B;  2J6K A;  4J5Y A;  2JTE A;  1IZ6 A;  2BZ8 A;  3LW5 E;  1PM3 A;  1K73 C;  3QZ9 B;  4QW2 A;  2RB6 A;  4J83 A;  4HA8 A;  4ZTF A;  5EG2 A;  4JZ4 A;  1VQK T;  1HK9 A;  1M1F A;  2EIF A;  5LJ3 e;  3URG A;  2FRY A;  9ATC B;  3OYB A;  1VQL T;  2DFU A;  2RHZ A;  4J9E A;  3G4S Q;  3QZ5 B;  4FCY A;  2OI3 A;  2JS2 A;  2JN0 A;  2VUB A;  3HTR A;  3RIR A;  3OYI A;  2O9S A;  1QW1 A;  2EGC A;  1YHQ T;  2EFI A;  2OTL T;  3UWN A;  5KYN A;  1KK7 A;  1GBQ A;  2HAX A;  3CMA Q;  5IAY A;  1NEG A;  1S72 Q;  4KGV B;  3JCM h;  6AT1 B;  4F17 A;  4IIM A;  1KD1 C;  1WIE A;  4HCB A;  5GJV B;  4QQG A;  1YIJ Q;  5GAM g;  4IUU A;  1B3Q A;  3A1P A;  4OMQ A;  1VQ7 Q;  3M0T A;  2CZ7 B;  4A4K A;  1VQM A;  1VIE A;  1K0S A;  3FIF A;  1HXD A;  2KRS A;  4L5G A;  2DA9 A;  1E6G A;  1SEM A;  2C06 A;  2K6D A;  2ECZ A;  4E2F B;  1NG2 A;  3KXT A;  2KRN A;  4Z88 A;  5LJ5 j;  2EYX A;  2CP5 A;  4M78 A;  2BUD A;  3CCR T;  1ZSZ B;  1O75 A;  2M0Y A;  4F7U A;  2MF2 A;  1TUC A;  3PMI A;  3PNW C;  3T9N A;  3M58 A;  2MMP A;  1WGS A;  5I22 A;  5CK9 A;  1I07 A;  1X01 A;  3ZBD A;  5A0L A;  2O4X B;  2MYS A;  1XNI A;  4WTO B;  3OYC A;  3I56 Q;  2KT1 A;  2NYS A;  4XU2 A;  2QGF B;  1M2O A;  3VS7 A;  2EYW A;  1UDL A;  4C8Q E;  1IXD A;  4M75 E;  1M3C A;  1U06 A;  2RI2 A;  2EW3 A;  5ECA A;  2BKD N;  3S3O A;  4IKF A;  3A8M B;  5DLQ E;  2V26 A;  3EG9 A;  3JCM c;  1K9M C;  3CQT A;  4II1 A;  4WCI A;  4AFU C;  1MGQ A;  1QKX A;  1SKU B;  2FPE A;  4C92 A;  3OMG A;  2ZZD A;  4N4H A;  1M90 U;  4MDX A;  2KY9 A;  1KC8 U;  4R55 A;  1UUE A;  4MZM A;  2FPD A;  4C5H A;  3CCM T;  2KK4 A;  2ROT A;  4QVZ A;  2DPP B;  1SSH A;  4QQ6 A;  1Q86 R;  1VYV A;  3V7S A;  2LT1 A;  1AT1 B;  5GAN 7;  1ZX6 A;  3JCM e;  2OTJ T;  4E7S A;  1WQ7 A;  3CC4 A;  2LMJ A;  2KEA A;  1OZ3 A; 
#chains in the Genus database with same CATH homology
 4A4E A;  3V7C A;  3C12 A;  2RHI A;  4EPC A;  2EQK A;  1YCY A;  2K2V A;  2RK1 A;  3R6O A;  5GAN 4;  3DKM A;  2XDD A;  3FC3 A;  4E7I A;  1NZ9 A;  3JB9 F;  2O4X A;  4M77 E;  4TVR A;  2LC4 A;  3M5A A;  1KD1 U;  3J81 E;  3JB9 H;  1UGS B;  1BI2 A;  5C0M A;  4LD9 K;  2E6N A;  1OI1 A;  1Q81 C;  2XDP A;  5I2M A;  5J3B A;  3BDU A;  3KUF A;  4FU6 A;  4C8Q B;  5GAN 3;  2LTO A;  3VYH B;  2LCC A;  1Y96 B;  1YIT T;  1BI3 A;  2CZ0 B;  3GNF B;  3VYG A;  4EMG A;  1UGP B;  2RO0 A;  4PJO E;  3JB9 J;  5KE3 A;  1FXX A;  4E7K A;  4BY6 B;  3OYF A;  3QJY A;  3QJ6 A;  4C0D C;  4M7A F;  3L1A A;  2RH2 A;  3QHS A;  3MO8 A;  3X26 B;  2MI6 A;  4A4H A;  3LGL A;  3CME T;  1N9R A;  2HBP A;  3C94 A;  4OF1 A;  2P0P A;  2QEX T;  3WXM B;  5J39 A;  1VQN T;  3A5Z B;  3C95 A;  4MZP A;  5LJ5 f;  4C92 D;  2L8D A;  4A4F A;  5CKD A;  3OA6 A;  2FVU A;  3L2Q A;  1Y07 A;  3CCQ T;  3OYD A;  1Q82 C;  1VQP A;  3CBO A;  1V29 B;  1O9S A;  4C0D B;  3MEA A;  3MHX A;  3OYH A;  3CPF A;  1VQ6 A;  3SWN C;  2E1H A;  5CKB A;  3MET A;  2M9U A;  4M78 G;  1MHN A;  1QVF S;  3JAM E;  1D3B B;  3I56 T;  1IRE B;  2MAM A;  3M54 A;  3TCJ A;  3UT1 A;  1U1T A;  3PFS A;  2VXE A;  4F7U G;  5CAI A;  4DA4 A;  1VQ8 T;  1X6O A;  2EJG A;  1N8R C;  5GAO p;  4XTX A;  4LDU A;  4M7A A;  4M77 C;  4C8Q F;  4JS4 A;  4XTV A;  4M75 F;  2VC8 A;  5LJ3 d;  3HRT A;  3CCU T;  2Y90 A;  2RK2 A;  3CC7 A;  4JLI A;  4ZGJ B;  5GMK h;  3ME9 A;  1UB4 A;  2E64 A;  2DVE A;  3A8G B;  3CXC S;  1UGR B;  2QA4 T;  3JCM P;  4B9W A;  1RL2 A;  4PJO C;  3OMC A;  1QP2 A;  3S6W A;  2XG8 D;  1P92 A;  4UC4 A;  3FB9 A;  3QPH A;  3OS5 A;  1M4Z A;  3CMA A;  4J6X A;  3CEY A;  3CCM A;  3CCE T;  2Y4X A;  3NTK A;  3BW1 A;  1BKB A;  3UPU A;  4EMK B;  2RJC A;  1G3Y A;  4FM4 B;  5GAM f;  4PJO B;  3CCJ T;  4N0A A;  3NFC A;  4C5E A;  1PSF A;  2ZCF B;  3L2R A;  1BIA A;  1OZ2 A;  1QVF A;  3GIB A;  1WJR A;  3N5B B;  4XU3 A;  4C8Q A;  3M55 A;  2CGH A;  3JRZ A;  1VIF A;  1Y96 A;  3LH0 A;  2A7Y A;  4M75 A;  2CKK A;  1YIJ A;  2OTJ A;  4JUV A;  4M7D D;  2PU9 B;  5GMK i;  3CCS T;  4O6J A;  4O5V A;  4MML A;  1K9M U;  3RMS A;  2LX9 A;  4FT2 A;  3JCM f;  3GP8 A;  1LNX A;  3MEW A;  4GLK A;  3OS1 A;  2E12 A;  2DXT A;  1EIF A;  5CCA A;  3S3N A;  3OS2 A;  4ZTJ A;  1KHI A;  3S3M A;  3TU4 K;  4QQD A;  4C92 G;  3Q1J A;  4A54 A;  3CXC A;  1VUB A;  5CVI A;  1YIT A;  3JB9 I;  2M16 A;  2EQM A;  2OAU A;  2R5A A;  5GMK m;  1XQH A;  3CBP A;  4FSX A;  2YLC A;  2RA2 A;  3RUX A;  3INZ A;  3V7R A;  1JJ2 A;  1M8V A;  2QXF A;  2LQ8 A;  2IVW A;  3WVE B;  5C6S A;  5GAN 8;  4M77 F;  2RJD A;  2QQ9 A;  1VQO T;  2E5Q A;  5CKF A;  2ZPH B;  5GAO m;  1Q7Y C;  1R8O B;  4RCC A;  5GAN d;  3HHT B;  5LL6 S;  5DY9 A;  3CME A;  3X25 B;  4NL2 A;  3GPL A;  4J7I A;  4PJO F;  5FRN A;  2M1H A;  1BI1 A;  3ASK A;  5D6W A;  2QEX A;  4PLI A;  1VQN A;  4M78 D;  2JTF A;  4ME7 A;  3CCQ A;  4KBM B;  4RG2 A;  2CS7 A;  2GCX A;  5IN1 A;  2P0K A;  1M9S A;  2HD0 A;  3VUB A;  3SWN A;  3ZFJ A;  2A3L A;  2GFA A;  1YJ9 T;  5GAN 2;  4JS5 A;  3FJP A;  3SFM A;  3M4G A;  2VGN A;  2EAY A;  3EFR A;  4FIB A;  3E1S A;  2PVD B;  1NJI C;  3OBY A;  2JVV A;  3I56 A;  3OW2 S;  3ZEH A;  2E6Z A;  2ZPB B;  3MP1 A;  3SDZ A;  5CIU A;  3LWH A;  2K5I A;  1VQ8 A;  3BDL A;  3MP6 A;  2RM4 A;  3P8B B;  4LDV A;  4M77 A;  3HKS A;  4KUD K;  4V2S A;  3RKW A;  5FU6 B;  4KT0 E;  3BY7 A;  5A0D A;  2XD0 A;  3GNG A;  4M75 D;  5AYF A;  3CCL T;  1BIB A;  4HKE A;  2WSF E;  2B8A A;  3HPW A;  4PJO A;  4JRK A;  2G3R A;  1FX7 A;  5CR2 A;  4BY6 C;  1N6A A;  2QA4 A;  2KMT A;  1Q86 C;  5LJ5 d;  1I81 A;  2QDY B;  3I55 A;  1WJQ A;  2ZPI B;  4EMH A;  2D9T A;  2I2L A;  5GMK j;  2K5F A;  4XQ3 A;  2PVO B;  2XK0 A;  2HQE A;  4JRQ A;  3QKJ A;  1Q82 U;  5GAN 6;  3CCE A;  5KCH A;  4LD6 A;  3PTA A;  5CO7 A;  1ZHI A;  1PSE A;  3E9F A;  4F7U B;  3JB9 G;  3HRU A;  2XID A;  3CCJ A;  2VXF A;  4L6V 5;  1N27 A;  2DTH A;  1K8A C;  4YTL A;  3L2V A;  3G71 T;  4BE0 A;  2IG0 A;  2VYT A;  4C5G A;  4EDU A;  4JRP A;  3NTH A;  3OW2 A;  2DZC A;  5KH6 A;  2BIV A;  3C4S A;  4XK8 E;  4BI4 A;  5DM7 R;  1W2B S;  2X4J A;  1WJS A;  3GOX A;  1N8R U;  3SD4 A;  3JCM V;  5LJ3 h;  4M7A G;  5GMK e;  3CCS A;  4Z02 A;  1B34 B;  2ZPE B;  2DD5 A;  4RMO A;  3PIP A;  3J7A F;  3EFS A;  2EJF A;  2LT4 A;  3CCV T;  4OB3 B;  1YI2 T;  2MWO A;  4ZN3 A;  3V8L A;  2PVG B;  1JB0 E;  3M53 A;  5I2S A;  4BI3 A;  5D6X A;  5HK0 A;  4DOW A;  2XI9 A;  3A8L B;  5FRM A;  2DD4 A;  3MEU A;  4JJN K;  4PLL A;  5I21 A;  2XKO C;  2VGM A;  4XAX B;  1KQ1 A;  3MEV A;  4OVA A;  5GAM d;  2KDS A;  3QDR B;  3V8J A;  1BYM A;  4Y28 E;  2D6F A;  2LQK A;  2AHJ B;  4M77 D;  2RJE A;  2E10 A;  2JOY A;  4BDZ A;  4JRI A;  1VQO A;  2L5Q A;  3M56 A;  2GFU A;  3RKY A;  3JSC A;  1XTD A;  3QUI A;  4EMK C;  1G3T A;  5LJ3 g;  4QVC A;  4ZGE B;  2FHD A;  1UEB A;  4M7D E;  3BFM A;  4IUQ A;  4J8O A;  4C8Q G;  1JJ2 S;  1WNL A;  4M75 G;  2FL7 A;  3JCM d;  1W2B A;  2RI3 A;  3HSB A;  4XTZ A;  1NE8 A;  1H3Z A;  4C92 B;  2D0Q B;  3HFN A;  4HCC A;  2XU8 A;  1BI0 A;  2DAQ A;  4RCB A;  5GAO r;  1YJ9 A;  3LYI A;  2RJF A;  4Q5W A;  5FRO A;  3HFO A;  2DJZ A;  3OQ5 A;  3PIO A;  2NLU A;  3DLM A;  4ATO A;  3UDC A;  4X9C A;  1LJO A;  3L2U A;  1GXI E;  4IUV A;  4R56 A;  2JZ2 A;  5HY6 A;  2V8J A;  5CQX A;  1U8R A;  1KG1 A;  1M1K C;  2DO3 A;  3GF5 A;  1DJ7 B;  4J7F A;  4NS5 A;  1N9S A;  3EAE A;  4OB0 B;  5CKE A;  5HKC A;  3HL8 A;  3WVD B;  3OYM A;  3LGF A;  3CCL A;  1WPY A;  4XTY A;  5FU7 C;  5GAN h;  3OYE A;  3FDR A;  4LDX A;  3CBM A;  3GLX A;  1Q7Y U;  4M78 E;  3HRS A;  3JB9 D;  4MMK A;  1KQ2 A;  2E65 A;  2CYZ B;  3VKI A;  4BE2 A;  4F7U E;  3H8Z A;  4KUL A;  4J6W A;  3TRE A;  3CCR A;  4OGC A;  4OB2 B;  2FB7 A;  5M9O A;  1VQ4 T;  1B34 A;  1I8F A;  2KSS A;  5FU7 B;  3QBY A;  1YJN T;  3OSV A;  2X4X A;  4DQ2 A;  2HNI A;  3VV0 A;  5A2Q E;  4M7D C;  2F5T X;  3E9G A;  4M7A D;  1FWZ A;  1M1G A;  2EWN A;  3KBG A;  4E47 A;  1I4K 1;  1G5V A;  4PKC C;  3X28 B;  2RHX A;  3G71 A;  3M4Y A;  1NJI U;  2X35 A;  1D3B A;  3TEE A;  2CZ1 B;  1Y7X A;  3M57 A;  3P8D A;  4E7L A;  5GMK l;  3VU3 C;  1JBM A;  5GAN g;  1VQM T;  2Y4Y A;  2DZ9 A;  3LX7 A;  4M77 G;  4OB1 B;  1VQ5 T;  4XTU A;  3G4S T;  4M7D B;  3FLG A;  2PQW A;  4JLG A;  3E19 A;  3A8H B;  2PUK B;  1ZQ1 A;  3CCV A;  5FU6 C;  2XHC A;  1YI2 A;  5LJ3 j;  4PJO G;  4C0F A;  5LJ5 h;  5GAO n;  4J5Y A;  3OYA A;  5GAO l;  4XU1 A;  3M9Q A;  2DIQ A;  4QVD A;  3G6E T;  3X24 B;  1Q86 U;  1IZ6 A;  4B9X A;  4NL3 A;  1XOV A;  2KVQ G;  3LW5 E;  1K73 C;  4RG8 A;  3FEO A;  3QZ9 B;  4IUT A;  4QW2 A;  1ZBX A;  4M78 C;  3OY9 A;  3O8V A;  4C8Q D;  1VQ9 T;  2RB6 A;  4J83 A;  4HA8 A;  4VUB A;  4PL6 A;  2GF7 A;  5EG2 A;  3CCU A;  4ZTF A;  1VQK T;  4GY5 A;  4EMK A;  2P4T A;  3CMA T;  1HK9 A;  1S72 T;  1M1F A;  3RKX A;  1K8A U;  2QTX A;  2EIF A;  5LJ3 e;  3P8H A;  4C92 E;  3URG A;  5FLX E;  3CD6 T;  2HQX A;  3OYB A;  4M78 B;  2LVM A;  3X20 B;  1VQL T;  2YLB A;  5LJ5 g;  4BDY A;  1KHC A;  4FL6 A;  3NTI A;  2JTM A;  2RHZ A;  3MCA B;  3PT9 A;  1KC8 C;  3RES A;  1M90 C;  3QZ5 B;  2DXB A;  2F5K A;  4BD3 A;  4PNO A;  2H3J A;  3QYH B;  1VQ7 T;  4M7D F;  2JN0 A;  2VUB A;  2O01 E;  1W4S A;  3QYG B;  3RIR A;  3CC2 T;  3OYN A;  1NPP A;  4IUP A;  3OYI A;  4P5N A;  5GAM h;  1SSF A;  1QW1 A;  1JRI A;  4C5I A;  1YHQ T;  1LOJ A;  2EFI A;  2JNG A;  2EJ9 A;  4M75 B;  2OTL T;  2RHU A;  3UWN A;  3OS0 A;  3MP8 A;  4LDY A;  2HAX A;  2K4Y A;  2DTI A;  3QO3 A;  5IAY A;  2F69 A;  3VUZ A;  2YHT A;  5GAN j;  3JCM h;  4C0G A;  2DEQ A;  2M0O A;  4ZGD B;  3JCM X;  1OZ3 A;  5CQY A;  4J6Y A;  2QQA A;  4ELZ C;  2DXU A;  1I5L A;  1KD1 C;  3OSS C;  5J26 A;  1VQ4 A;  4NOY A;  3RER A;  1M5Q 1;  4M7D A;  1YJN A;  1Y71 A;  4M78 F;  4C92 C;  5A0G A;  3JCM W;  4HCB A;  4QQG A;  2ZPG B;  3LLR A;  5GAM g;  4IUU A;  4F7U F;  3CPW S;  2R5M A;  2EKO A;  4CRI A;  4PJO D;  2CZ7 B;  2L3R A;  1YJW T;  4E7J A;  4A4K A;  1M1K U;  1VQM A;  1VQ5 A;  5GAN e;  5GAO q;  1H64 1;  1VIE A;  3VJP A;  1QP3 A;  3FIF A;  4X9D A;  2LNV A;  5GAN 5;  3G4S A;  1HXD A;  4L5G A;  3QII A;  3HP9 A;  5IT9 E;  3JCM g;  3OBW A;  4ELY C;  4RKU E;  3FRN A;  3SB2 A;  4BI8 B;  3CC4 T;  4ZN1 A;  2C06 A;  4HT9 A;  3SWN B;  3PGG A;  5DLO A;  2XDB A;  3G6E A;  4BE1 A;  5KE2 A;  3KXT A;  3J80 E;  1OYX A;  2RD1 A;  4E7H A;  5LJ5 j;  3RMQ A;  4XU0 A;  4M78 A;  2DIG A;  4MZT A;  2QQB A;  2X4W A;  2BUD A;  4BAC A;  4M7A E;  3G7Z A;  3DB3 A;  3H6Z A;  3I55 T;  1VQ9 A;  3CCR T;  2K3X A;  1O75 A;  4F7U A;  2X4Y A;  3M59 A;  4LDW A;  3A8O B;  4M77 B;  1VQK A;  2MF2 A;  4BB7 A;  3PMI A;  3PNW C;  1S72 A;  4MDW A;  3T9N A;  3M58 A;  3CPW A;  3ER0 A;  2MMP A;  2VV5 A;  1WGS A;  2K5L A;  5CK9 A;  3CD6 A;  3L2W A;  4L59 A;  5L8R E;  1X01 A;  2KQW A;  3ZBD A;  2MWP A;  5LJ3 f;  5A0L A;  3OYJ A;  2O4X B;  5LJ5 e;  1VQL A;  1TH7 A;  1XNI A;  3OYC A;  1KQS S;  3L2Z A;  4KUI A;  5CKH A;  4WF2 A;  4XU2 A;  3V8K A;  4C92 F;  2ZGW A;  1VQ7 A;  2DTO A;  1VQP T;  3PMT A;  3OYK A;  2DXC A;  1QVP A;  5HK3 A;  3CC2 A;  3OYY A;  1VQ6 T;  1X75 C;  2E70 A;  3QXE B;  4BUG A;  3DLL A;  2FYK A;  4C8Q E;  3JCM b;  1AHJ B;  4M75 E;  2KAF A;  4DOV A;  1K73 U;  3QSU A;  2V8I A;  4OMF B;  2RI2 A;  2WAC A;  1YHQ A;  3AHU A;  5GAM j;  5D6Y A;  2WSE E;  4A53 A;  2BKD N;  2QQS A;  2OTL A;  1NPR A;  3S3O A;  2K57 A;  4IKF A;  3A8M B;  5DLQ E;  1U1S A;  3JCM Q;  3JCM c;  2R58 A;  2PUO B;  4Y91 A;  5KCO A;  2EYQ A;  3OYL A;  1K9M C;  4M7A C;  4II1 A;  1G3W A;  1MGQ A;  2JUF A;  3CC7 T;  2E41 A;  4HT8 A;  3F70 A;  1QVG A;  4OGE A;  4N4G A;  4C92 A;  4M7D G;  2LCL A;  2YRV A;  2RI5 A;  2ZZD A;  3OMG A;  4N4H A;  1M90 U;  2DK3 A;  2KY9 A;  3OYG A;  1KC8 U;  4R55 A;  1KQS A;  4MDX A;  4MZM A;  4A4G A;  4XTW A;  4OP0 A;  4C5H A;  2ZPF B;  4M7A B;  3DB4 A;  5GAM e;  2P0Q A;  3CCM T;  2LRQ A;  2KK4 A;  1RI0 A;  4CI0 C;  2EQJ A;  2K3Y A;  4QVZ A;  3LWI A;  1WQW A;  2LDM A;  3L42 A;  2DPP B;  4D6W A;  4JDS A;  1YJW A;  2WSC E;  4C0Z A;  2DKG A;  4QQ6 A;  1UGQ B;  2CZ6 B;  2QQR A;  3V7S A;  2R57 A;  2LT1 A;  1G3S A;  4FT4 A;  2QI2 A;  4N0A C;  1Q81 U;  5GAN 7;  4HCZ A;  5GAN f;  3JCM J;  2XIC A;  3QG1 A;  1YIJ T;  4X34 A;  3JCM e;  1QVG S;  2OTJ T;  1WQ7 A;  2EQU A;  4C8Q C;  3CC4 A;  2RHY A;  4M75 C;  2GQV A;  1YBY A;  2V8K A;  2L89 A;  4IUR A;  4N4I A;  3OB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...