5CK9A

E. coli mazf form i
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
110
structure length
106
Chain Sequence
VSRYVPDMGDLIWVDFDPTKAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease MazF
publication title Substrate Recognition and Activity Regulation of the Escherichia coli mRNA Endonuclease MazF.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Hydrolase
total genus 27
structure length 106
sequence length 110
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2015-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ck9A00
1NE8A 4VUBA 5HKCA 4MZTA 5HK3A 5CR2A 1UB4A 3JSCA 4MZPA 2MF2A 1VUBA 4ELZC 5CKHA 4ELYC 5CKFA 4MDXA 5CKDA 5CKEA 4MZMA 3NFCA 5CQXA 5CKBA 1M1FA 5CQYA 3TCJA 5CO7A 2KMTA 2VUBA 3VUBA 5DLOA 4ME7A 5CCAA 1X75C 3JRZA 5CK9A 5HK0A 4OF1A 3HPWA 4HKEA 3G7ZA 2C06A
chains in the Genus database with same CATH superfamily
4VUBA 3FDRA 2COWA 2QA4A 4MZTA 3WVEB 1YCYA 1AWOA 1WHLA 3P8DA 1YP5A 1CSKA 1DJ7B 2K4YA 2NLUA 2XMFA 1MV3A 5LJ3d 2DVJA 2EW3A 1LCKA 1WA7A 2HMAA 1M1KC 2DNUA 4IIMA 2NUPA 2AK5A 1KQ1A 3JB9F 2B86A 3J7AF 5KYWB 2I2LA 2CGHA 4E2FB 4M75F 4EDUA 1JU5C 2PUOB 2RB6A 1AWXA 4M77E 4C0DB 1NJIR 3V7CA 4QQGA 4HA8A 3OYDA 4ZGEB 1X27A 1RAGB 3HFOA 4A4FA 3META 5A0DA 2CSIA 4YTLA 4RUGA 4HKEA 1YI2T 4Y92A 3JCMg 1VQKT 3JB9J 2DKGA 2NYSA 3PE0A 1C6VX 2ROTA 5FRNA 2K2MA 1Y07A 3L2QA 4FYXB 5IT9E 3G4SQ 3I35A 3L42A 4GBQA 2LNVA 3EH1A 1YN8A 2HNIA 1LNXA 1Y7XA 1OX8A 2HQEA 4ORZA 3VS5A 1YIJA 4JRPA 5LJ5f 4M77G 1K9AA 4XTVA 1SHFA 1T0JA 3MJXA 4OMLA 1YJNT 4EMHA 1N8RC 3HRTA 2KRSA 1VQOA 1Y0MA 3CPWA 2PQWA 5GJVB 3PGGA 4ME7A 2D0NA 2EKOA 5GANf 3CCUQ 2DXTA 4C92C 4BDZA 1YITQ 2PU9B 3RBBB 2HDAA 5KH6A 2E3HA 2O01E 1GBQA 1WQWA 4C92D 4M78C 4LDWA 5M9OA 1B07A 2EJFA 3X20B 1N6AA 2LCLA 6AT1B 1KG1A 4PJOG 2FHDA 2K9GA 4PL6A 4M78D 2DIGA 4R56A 3M0UA 1QQJA 1AWJA 2R5AA 2KRNA 3V8JA 3BDLA 2QXFA 4J8OA 1X01A 2AKLA 1NYFA 2QQSA 2RHXA 2RO0A 3DKMA 2GTOA 1Z9QA 2DBKA 1JJ2P 3QZ5B 3CCEQ 2P0KA 3OMCA 3EGXA 1M27C 4GY5A 3AT1B 1QWFA 1UHCA 1X2QA 5J3BA 2HL3A 4J9CA 4QT7A 1AZEA 5IAYA 1VQ9Q 4J7IA 1SF9A 2QQ9A 3OS0A 5LJ5j 1VQ7T 3A8LB 4R55A 4AG2C 4TVRA 1TXQA 2XI9A 3VS4A 1UTIA 2HEQA 2M0OA 3N5BB 4AG1C 2RQUA 3CCVT 2NUTA 4FT2A 2E6ZA 2RHZA 5CQYA 5A2QE 5GANj 4OMPA 2ZZDA 3VJPA 2L5QA 1U5SA 3HPWA 4M77A 4R0KA 1QMCA 3OYEA 2J6FA 2XK0A 1B7TA 2XHCA 3EH2A 3NMZC 1YHQQ 4ELZC 1KQSS 4OB0B 2YXYA 2AHJB 3RKXA 3FRNA 2Z0WA 5KYXB 2X9HA 1M1KU 4KBMB 2P4TA 4DBRA 1QCFA 3OA6A 4OF1A 1GBRA 3CCSQ 5GAOq 3LWHA 1U1SA 4OMFB 1I0CA 3LH5A 3G4SA 2RNAA 4M7DE 4Q5WA 1VQ6A 2FZGB 1HD3A 4J9EA 4QVCA 1IHWA 4A4GA 5L8RE 4M7AF 2BIVA 5AT1B 3MO8A 2HSEB 1I4K1 1XQHA 3BDUA 2FPFA 3C95A 4CC2A 1EZZB 2HBPA 2J7IA 1HYOA 2E12A 2QG9B 3M5AA 3CCUA 1XJWB 2EVRA 4J6YA 4L59A 3L2ZA 5HY6A 3P8HA 1QVFA 1VQ8A 9ATCB 1PSFA 2P0PA 1M4ZA 3VS3A 3VYHB 2QYZA 4JJCA 2K3XA 2KR3A 3CCRQ 2VXFA 2DZCA 4M7DG 2NUTB 2YUQA 1VA7A 1FX7A 2M02A 3IQLA 1OI1A 1AVZC 1NEGA 1PC0A 2YDLA 5LJ5h 3L2WA 3CMAA 2FO0A 1N9RA 2CP6A 1VQ4T 2EQIA 1BK2A 1NYGA 1S72T 1U1TA 4M77B 2JXBA 4J7FA 2KK4A 2OX7A 5IH2A 4F7UE 1EIFA 4AT1B 3CCEA 1HSQA 5GANh 3E9GA 3CCMA 5EG2A 2MI6A 3SFMA 2J6OA 2BKDN 1VQMT 3QXEB 3ULRB 1W1FA 1W2BA 1VQ9A 3TSZA 1K73C 1X75C 4XU1A 2IPOB 1WGSA 4BDYA 2CZ7B 4PJOB 3KXTA 1FMKA 1B34A 1R0BG 2ZPGB 3LLRA 1Q7YC 2MAMA 3I5RA 5GMKi 1VQNQ 2B8AA 5CKHA 1LOJA 1UEBA 1PCXA 1SEMA 2G6FX 4ESRA 1Q86C 2E5KA 1I07A 1VQ5T 2CUBA 3QWYA 4BI3A 4L5GA 4C8QC 4PK4A 1YHQA 4J9IA 2CSQA 2DE0X 4XTZA 3JCMV 2EPDA 3I56Q 4KH1B 4HT9A 3PVLA 3CCQQ 1QVGA 2K7AA 3VU3C 1CKBA 2GBQA 1WJRA 3ZFJA 5GAOl 5IN1A 4LDYA 1M2VA 2LTOA 1OX9A 2YWWA 2D6FA 3VS2A 3CCSA 2QA4T 3A98A 2DILA 2CP3A 4M7DA 2L2PA 1MUZA 2RK1A 3OYKA 4M75C 4FW2A 1PWTA 2KI7A 3JB9D 4JJNK 1O75A 2P84A 3OYCA 2AIRB 2VGNA 1P92A 5LJ5g 4M75D 2F1LA 1M1FA 1IHVA 5KCOA 1WIEA 4JPBW 4Y91A 4LN2A 4J9BA 4II1A 5J26A 1TSFA 2M16A 2DVEA 3TSWA 3QWXX 4RTXA 4BY6C 2ZPFB 2H3EB 1YJWQ 4E7KA 2K2VA 2WSEE 4J9GA 3OYMA 3CCRA 3JRZA 5FWCA 2FVUA 3PTAA 4PJNA 1RAHB 1ZSZB 3NPFA 4XU2A 2KROA 1RI0A 4IUQA 2MF2A 4F7UA 1YJ9A 4AFSC 3TREA 1S1NA 2RMOA 1UJ0A 3M9QA 2MPXC 3GBQA 4XQ3A 5GAOn 3JAME 4AFUC 4DEYA 1SSHA 5GAN5 1FMVA 2EGAA 2FZKB 4J9HA 1WXTA 3EHQA 1QCOA 4X9DA 2JVVA 4RTTA 5GAN6 1UDLA 2AT1B 3JSCA 1M2VB 3CPWS 2YRDA 2VB6A 1GFCA 5GANd 1I8FA 2E6NA 5J39A 2RPNA 2YSQA 2RI5A 1H8KA 3OSSC 4M7DB 1QLYA 1TWBA 3MP6A 3FC3A 2OTJQ 3SWNB 3MP8A 2VXEA 1VQNA 4AMCA 2DO3A 3U23A 1H641 2E4HA 3S3NA 2E41A 3M59A 3V7RA 2IIMA 3I5SA 4WCIA 1I81A 2BUDA 4A53A 1K73U 1IB8A 1JXMA 2W10A 1D3BA 1VQPQ 1FYNA 5KE2A 2LCSA 4C8QE 2IG0A 1LPLA 3I56A 3AHUA 3CCQA 2JN0A 1D0ZA 2YUOA 4C5GA 2RHYA 4BUGA 1PRMC 3E9FA 4ZGDB 1Q7YU 2X3WD 2MYSA 2GQIA 5GJWB 3OSVA 1H92A 2RD1A 2XDDA 4FCYA 1MNDA 2EKHA 1M1KR 4NL3A 1U8RA 4PJOD 2EQMA 4QVZA 5LJ3g 4PKCC 1X6GA 3NFCA 2EWNA 2L89A 3A8GB 2RQWA 1WYXA 5DY9A 3S6WA 2DXBA 2E1HA 1JEGA 2DL8A 2E65A 2HSPA 5AYFA 2JMCA 2L3QA 2DZ9A 3SB2A 1PHTA 1ZUKA 2CZ1B 2V1QA 3JCMW 5GMKm 2ZGWA 5GAN7 3OB9A 2EAYA 3JV3A 3BW1A 1BB9A 1YWPA 2CH4A 2LJ0A 5FW9A 2CZ6B 3G6ET 2V8JA 4XU0A 3OYAA 3EG9A 1WHKA 1YJWA 3HKSA 3CPWP 2DF6A 1BCMA 4HVVA 3JCMP 3G71T 2COZA 1XNIA 2YRVA 1G2BA 3CD6A 2RH2A 2EQKA 2Y4YA 4FYVB 3QBYA 2DJQA 4M7AC 3CCLQ 1VQLT 1N8RR 3UF4A 4OB3B 1M3CA 2F5TX 2OI3A 1Q81U 2AZSA 2X4YA 5I2SA 4M7AD 1VOMA 1MMGA 3OW2A 1VQ6T 1ZBXA 1D3BB 5D6XA 2QEXA 3INZA 2SEMA 2CKKA 4HVWA 5CIUA 1RI9A 1X6BA 3MCAB 1ZBJA 1M9SA 4JRQA 3RERA 1FMWA 3FIFA 4RTVA 5FU6B 2KDSA 3EFRA 1TS9A 5KCHA 3CC2Q 1QVFS 1VQ8T 4NOYA 1R0CB 1WX6A 2KGTA 2MWPA 3A8OB 1V1CA 2OTJA 3UDCA 3X28B 3CBOA 2JS0A 4HCCA 3PT9A 4A4HA 3ME9A 3JCMJ 2P0QA 1RAIB 1E7OA 2V8KA 4E7IA 3VS6A 2DL4A 5LL6S 3JB9H 3CMAT 4C8QA 4B6MA 4XTUA 1KFZA 2LNHB 1MMAA 3OYNA 2EQJA 3ASKA 4X1VA 4FYWB 3M0TA 3EG2A 3CCMT 4UC4A 2MIOA 4DQ2A 2DM1A 3QZ9B 2D8HA 2K5LA 4QQDA 1OZ2A 3TEEA 1WPYA 4JRKA 1W2BS 2R57A 2VV5A 3DB3A 2OTLA 4GLKA 3LYIA 3GPLA 1AD5A 2H8HA 2FB7A 2V8IA 5CKEA 2MK5A 3OQ5A 1T3LA 4LXCA 1QP2A 5DLQE 2NUPB 1YI2Q 2ZPBB 2LX7A 1VQKQ 3PMIA 4M77F 3CC7T 5GAOp 1RAFB 1N27A 3CC4A 3EAEA 3JB9I 1WHHA 3MPUB 3EG0A 4RTZA 2DLPA 2XICA 1HK9A 1N9SA 1KC8C 1T0HA 2AKKA 3ZEHA 1UGPB 2HQXA 4BE2A 2D0QB 3QDRB 1G3TA 4JS4A 4LDXA 4E7LA 1QVGS 2X4XA 3JCMX 1ABOA 2X35A 3FB9A 4DBQA 1YJNQ 2A0FB 4PJOF 4O6JA 1QVFP 2DTIA 4NS5A 3QIIA 3CCLA 3BE3A 3M0RA 1JBMA 4BI8B 4BB7A 3CCJT 3D7SB 2NWMA 4F14A 3SEMA 4XTWA 2RK2A 1OULA 2DTHA 3DB4A 2FYKA 2ZCFB 1T3SA 1Q82U 8AT1B 2CS7A 3G7ZA 3C12A 4E7JA 2A28A 4OB1B 4MMLA 2DD5A 2MWOA 5CKFA 4B9WA 1AT1B 3VRYA 1XTDA 3HP9A 2MOXA 3KFVA 3QHSA 3QG1A 3LWIA 1SPKA 1RABB 1RL2A 2KNBB 4KGVB 1D0YA 2VWFA 3QSUA 2KE9A 2C0OA 1QKXA 1WXUA 2GNCA 4N4GA 1C0MA 1RAAB 1K76A 3URGA 1YWOA 4C0DC 1GCQC 4KULA 2ECZA 2YRCA 4KRTA 3OYIA 1GCPA 4N4HA 5DM7R 2K5FA 3V8LA 1VQ7Q 2DYBA 4D6WA 1BIAA 5IHKA 4HT8A 4E7SA 3SDZA 2QK0A 2RHIA 1K73R 3H8ZA 4J6WA 3CCVQ 1OOTA 4CI0C 2PNIA 1NG2A 3EGXB 3MEAA 3CEYA 2CZ0B 2F69A 4LD9K 1YITA 1Q7YR 3CMET 3O8VA 4C92E 4RCCA 1JJ2A 1SG5A 2Y90A 4ZNXA 1BKBA 1QVGP 4N0AC 1Q86R 4M78E 2DEUA 2CREA 4PJMA 2DBMA 3E1SA 2OJ2A 2J05A 2DMOA 3MEWA 1YI2A 2C0TA 5D7UA 4A54A 2VVKA 3TQ7P 1UECA 3BFMA 2OAWA 1O9SA 3E2UA 1OZ3A 1W6XA 3HTRA 4B9XA 1OQKA 1R77A 4E7HA 3J80E 3Q1JA 1AHJB 1BI2A 3L2RA 1M30A 3R6OA 1ZQ1A 1AOJA 4C92G 1WJSA 4ZN1A 1KQSP 2ZPIB 1X6OA 1BYMA 1IGQA 4MMKA 5GAN4 1YJNA 4V2SA 4JZ3A 4M78G 3I55T 1WHJA 2QTVA 2RI2A 4M7DF 4K11A 1YBYA 1D09B 1NJIU 1ZSGA 1Y71A 2LVMA 1KC8U 2E10A 2HZYA 4E47A 2KY9A 4OVAA 1ZLMA 4PJLA 2QDYB 5CKDA 4EMKC 4RTYA 5EC7A 1TUCA 3JCMf 4F7UG 4PJJA 2JNGA 2I0NA 3A1PA 4LDVA 5HK0A 5CVIA 4IUPA 2PVDB 3VYGA 4WF2A 1PKTA 4PLIA 2XG8D 2D1XA 2ZPEB 2M1HA 1H3HA 1NE8A 2F2XA 3M54A 4XU3A 1VQ4Q 3RR6A 3H0HA 1S72Q 5FU7B 4HCKA 3HRSA 1NLPC 4BACA 2ZAEA 4KT0E 1MV0B 1AEYA 2PZ1A 5L23A 3EFOA 2BZYA 4QKUA 3M57A 1ZX6A 2DERA 3C4SA 1VQMQ 2BE9B 5GAN8 1N5ZA 3CD6T 4DEXA 1JXOA 2PVGB 2HAXA 1RLQC 1UUEA 1VYVA 4FSXA 3X26B 3OBWA 4NL2A 2XDPA 1RACB 1OEBA 3KBGA 2CT4A 2QAZA 3CCVA 3OW2S 1TOVA 3VS0A 5IHIA 1WJQA 5GAOm 3NGPA 2QEXT 4C92A 2BTTA 4PFZA 4RTUA 3X24B 5GANg 1Q81C 2L3SA 2ENMA 4M78A 2A37A 1K9MC 1VQ5Q 2DFUA 3VV0A 2KMTA 2LQ8A 2E5QA 2JOYA 2X4JA 3TVTA 4Z88A 3UA7A 1B34B 1KHIA 3MHXA 2HKNA 4J6XA 4ZN3A 2DETA 3PNWC 5KYYA 1NPPA 3CBPA 2C0IA 4X9CA 5GAN3 1KHCA 2QDLA 5D6YA 2QA4Q 4Z8AA 2RQVA 1QWEA 3ER0A 1IZ6A 1M5Q1 4JJDA 2GGRA 1YIJT 4OB2B 2CH4W 2FPDA 3OYHA 1PKSA 2MMPA 1I5OB 5KYUA 2RJCA 4CRIA 1VQOT 4JLIA 1UGVA 1TTHB 2KQWA 1UFFA 1X2KA 2HD0A 2JUFA 2L8DA 4HXJA 2CDTA 1PM3A 4M77C 4RTWA 2QGGA 2OTLT 5IXBA 1M1GA 1QKWA 4XTXA 4M77D 1CKAA 3HRUA 2FZCB 3HFNA 4KUDK 3OYYA 2DL3A 2DPPB 1VIFA 1BI3A 3CC4T 1UGRB 1RAEB 3OW2P 4X34A 4C92B 2DX1A 1VQ4A 5GMKh 2EYQA 5GAMd 3M58A 1WFWA 4PJOC 3V7SA 2JT4A 3UWNA 4M78B 1UJYA 1PD0A 1ARKA 2EYZA 2R5MA 1K1ZA 5CAIA 1FXXA 3C94A 4ATOA 1TUGB 5CO7A 1VQMA 4OGCA 3RDVA 2JW4A 3OYGA 5KYYB 3JCMh 1BU1A 2LQKA 2NUZA 4HCZA 4M75E 4D8KA 3CBMA 4ZTJA 5GAMe 4F7UB 1V29B 2DL7A 2QGFB 3RMSA 5I11A 3CPFA 1TH7A 1M8MA 2IVWA 4IUVA 4MDWA 2LJ1A 4C8QG 3OYLA 2L0AA 1ZHIA 3NTIA 2QTXA 3UT1A 4A63B 2QASA 4FSSA 5KYUB 5HKCA 4QQ6A 2DEQA 1VQ5A 3VS7A 1ZA1B 5A0GA 3NTHA 2F2VA 1Q82C 2GFUA 4J9FA 2JMAA 1PSEA 2K3BA 3JB9G 2RA2A 5A0LA 2JM9A 4DA4A 3OS5A 3CXCA 4M75G 1G3SA 3GNFB 3RIRA 3ZBDA 3QJ6A 3H6ZA 4P5NA 1G8XA 1K8AC 5C0MA 3A8MB 3PFSA 3G4ST 1IREB 1G3YA 1BBZA 3QUIA 5FRMA 4IUTA 5HK3A 2CP7A 4KGXB 1K9MU 1OPKA 4J83A 1XOVA 3OS2A 2WSCE 4OP0A 3QJYA 2FL7A 2A3LA 2J6KA 1ZUYA 2LP5A 1OYXA 1PD1A 2M51A 2CUDA 1ZSZC 2DA9A 3CCUT 5I21A 1YITT 2DD4A 3A5ZB 2AZVA 4LUDA 4OMNA 1JJ2S 1KK7A 2YHTA 1ABQA 3REAB 2QQAA 3EFSA 2FG0A 3L2VA 3TCJA 3MKDA 4EMKA 1KC8R 1M90U 3VUBA 5DLOA 2KT8A 5LJ3e 3G6EQ 2LT4A 1Q95G 1M8VA 4C5IA 1KD1C 3G71Q 2KXDA 1UB4A 2EJ9A 2VGMA 1VQPA 4JZ4A 4WTOB 3LGLA 4LNPA 1YNZA 4ELYC 4L6V5 1WNLA 4RG8A 2A08A 1BI0A 1VQLQ 2FPEA 3DLLA 4LE9A 4A4KA 3CCET 3L1AA 4PJOE 3L2UA 4M7DC 1J3TA 4JRIA 1MHNA 3VRZA 3NTKA 4FL6A 1VQ6Q 3EG9B 3SWNC 1W70A 5I2MA 4M7DD 1VQ9T 1SRMA 1PG5B 3S3OA 5FROA 1JRIA 2EJGA 4M75A 3OYBA 1NPRA 1RUWA 1NLOC 1UGQB 2ATCB 4F17A 2MCNA 5KYXA 1GRIA 2RI3A 3H9NA 2HL5C 2Y4XA 3M0SA 1PRLC 1VQ8Q 4C5HA 4C0FA 1H3ZA 3HSBA 3JCMd 1NJIC 3M4YA 4C5EA 1WZOA 4QVDA 5GMKe 5GAMf 4MDXA 4C0GA 2CP5A 4RKUE 5GAOr 1HJDA 2LMJA 1YHQT 1IRXA 4IIOA 3T9NA 3THKA 5KYNA 3EGDA 3RNJA 1HXDA 2O88A 1UE9A 2X51A 3MEUA 3CMAQ 4IURA 2KSSA 2XD0A 1IXDA 3RKWA 1WHGA 1ACMB 3UA6A 2LDMA 2O9SA 2LQWA 3JCMe 3CCST 3EHRA 2ABLA 4EMKB 2A36A 4M7AE 3CCMQ 3NHNA 4KH0B 4PNOA 2KXCA 2VUBA 2EBPA 2LZ6B 4C0ZA 4C8QB 4BI4A 4FIBA 2YUPA 3HHTB 1GXIE 1MMNA 1GFDA 2LCCA 2HQHA 2BZXA 2CT3A 1Z9ZA 2KAFA 4OMMA 1ZUUA 2RQRA 3CC7Q 1C1AA 3J81E 1K8AU 2O4XA 4RMOA 2KEAA 1TG0A 5CK9A 2RJDA 1I5LA 2QQBA 3CC2A 1ZA2B 3FJ5A 2X4WA 2GTJA 3OY9A 4M75B 1W2BP 1R8OB 7AT1B 4M7AG 4PFPA 4MZPA 1G3WA 2O2OA 5GAMj 3G6EA 2GF7A 3CCRT 3FJPA 1QW1A 2EQUA 3QKJA 2PTKA 4J9DA 3GNGA 3G71A 1IGUA 3REBB 3LX7A 4JDSA 1YJ9T 2HCKA 4N4IA 1KQ2A 2DAQA 5LJ3f 3LW5E 1VQLA 2E3IA 1VYUA 3CCJQ 5FU6C 4PJOA 1F1BB 1FWZA 4EIKA 2DRMA 2ED0A 4BY6B 1Y57A 5I22A 1RADB 4OMQA 4HCBA 3EGDB 4QW2A 1Y96A 1SKUB 4OMOA 2DXUA 3EGUA 1UGSB 1KD1U 2WSFE 2RM4A 2V1RA 1QCNA 1AWWA 4ANJA 3LH0A 2K6DA 2CYZB 2EFIA 1WXBA 3VKIA 2EYWA 4AFQC 1VQKA 1G5VA 1V76A 1EX4A 2R58A 2V26A 8ATCB 1VQNT 1QVPA 2ED1A 2EYXA 2LC4A 3KUFA 3ZL7C 1VYTA 4XTYA 1SSFA 3M0QA 4KGZB 2JM8A 3H0IA 2VYTA 1B3QA 4JUVA 4O5VA 4RCBA 1A0NB 1YCSB 1JO8A 3RKYA 1NZ9A 4M4ZA 3OYJA 2C06A 2KRMA 1K0SA 1N8RU 3JCMc 4EMGA 2LRQA 3P8BB 2YLCA 4FU6A 2RQTA 2EGEA 3I56T 1D1BA 2O4XB 3CCQT 5IHNA 2O9VA 1YJ9Q 1YFNA 4DOVA 2L3PA 1M3BA 2D8JA 1RLPC 2RJFA 2JTEA 3E19A 4M7AA 5LJ3j 4ZTFA 1OU9A 4BD3A 1W4SA 3CMEQ 3PIOA 2PVOB 1KIKA 1OV3A 1WDXA 5HCKA 3M55A 2KYBA 1SHGA 2LT1A 1Q81R 3DLMA 3JCMb 5GAMh 2HBWA 3S3MA 4JJBA 2DRKA 1WLPB 1K9MR 3M4GA 4C92F 2YUNA 1SRLA 1E6GA 2ZPHB 5GAN2 2HKQB 4HVUA 2EYYA 4E7ZA 3A8HB 1ZSZA 2BZ8A 2CP2A 3CC7A 2RJEA 2XIDA 3PIPA 4M78F 1Y96B 2QI2A 1GL5A 4IUUA 1MNEA 2FEIA 1IO6A 2M9UA 3OS1A 3M53A 5CCAA 1YJWT 3O5ZA 4CC3A 3RESA 4IKFA 2FRWA 2DJZA 2F2WA 3PMTA 4F7UF 5CR2A 1PNJA 2X3XD 3CXCS 3GOXA 1M90R 4LUEA 4C8QD 1G83A 1UHFA 1VUBA 4AFZC 3EG1A 1VQ7A 3MEVA 2DIQA 3I55Q 4A4EA 4MZMA 5GMKj 1WHMA 2DYIA 4FW1A 3CCJA 2DL5A 1U3OA 1JQQA 3X25B 2XU8A 4DBHA 4D8DA 3EG3A 1BI1A 2K3YA 2QQRA 2YT6A 4PLLA 3OYFA 3SWNA 3RUXA 2KYMA 2DTOA 1U06A 2JTMA 3RMQA 2RF0A 1UG1A 5CKBA 1VIEA 4M7AB 1D1CA 3MP1A 3OBYA 1KQSA 4DOWA 4BE1A 2XDBA 3H41A 2KT1A 2LJ3A 2JJ9A 2FRYA 2OTJT 2CP0A 3FLGA 5FWBA 2GQVA 5LJ3h 4JLGA 4Y28E 4F04B 2SRCA 2KBTA 1KJWA 1OU8A 2BE7D 2W0ZA 3F70A 5GAMg 1VQPT 1NBEB 4J5YA 3CD6Q 1M90C 3V8KA 3QPHA 2JS2A 2COYA 4FYYB 2DK3A 3GP8A 1NM7A 2ROLA 4BE0A 2XKOC 4LDUA 2RHUA 5CQXA 4GLMA 1BIBA 3EFOB 5LJ5d 2QEXQ 3VUZA 3CMEA 4OGEA 2M0YA 3TU4K 2GFAA 1M3AA 4Z02A 1BCOA 1M2OA 3CXCP 3GLXA 1E6HA 3UPUA 3C0CA 1LJOA 2OAUA 2LQNA 2VKNA 2F5KA 3VS1A 4RG2A 2K57A 1Q82R 3I9QA 2D9TA 3M0PA 3QYGB 4XK8E 5C6SA 1X69A 4F16A 5LJ5e 1AZGB 2YLBA 2K79A 1LVKA 1S72A 3WXMB 2EIFA 2LX9A 4XAXB 4LD6A 2KVQG 1K8AR 2L3RA 1X43A 1JB0E 2J06A 5KYWA 5GANe 1YIJQ 2JTFA 4CC7A 1K0XA 3SHWA 3G1JA 2E64A 3UATA 2WACA 1GCQA 4DBFA 5FLXE 1VQOQ 2A7YA 5GMKl 1OPLA 3CCLT 3BY7A 1D1AA 3JCMQ 3I55A 2EGCA 3GIBA 1MGQA 2RN8A 1Q86U 1K4US 4ZGJB 3M56A 5D6WA 3LGFA 2H3JA 5FU7C 4EPCA 2O31A 3PVQA 3CQTA 2OTLQ 1D0XA 2P4RA 2E70A 3HL8A 3H0FA 4PFOA 2K5IA 1WQ7A 2VASA 4FM4B 4E6RA 4N0AA 3OMGA 1QP3A 1KSWA 2GCXA 5ECAA 1TU0B 3CC4Q 3WVDB 4JS5A 1WI7A 1KD1R 3CC2T 1I1JA 1MMDA 5IXFA 4KUIA 2DXCA 3QYHB 5KE3A 3QDFA 1NEBA 2JZ2A 2PUKB 2G3RA 4FT4A 1EFNA 4Z89A 1TUDA 3R6NA 3FEOA 3QO3A 3GF5A 4CC4B 4C8QF 2ESWA 3SD4A 2VC8A
chains in the Genus database with same CATH topology
1RI0A 1AHJB 1BI2A 4VUBA 3FDRA 3L2RA 2QA4A 4MZTA 4IUQA 3R6OA 2MF2A 3WVEB 1YCYA 1ZQ1A 2LDMA 4F7UA 1YJ9A 3JCMe 3TREA 1WJSA 3P8DA 4C92G 4ZN1A 3CCST 4EMKB 1DJ7B 2ZPIB 4M7AE 1X6OA 2K4YA 3M9QA 4XQ3A 1BYMA 5GAOn 3JAME 2NLUA 4MMKA 5GAN4 4PNOA 5LJ3d 2VUBA 5GAN5 1YJNA 4V2SA 4M78G 3I55T 2RI2A 4M7DF 4C0ZA 1M1KC 3OYBA 1YBYA 4C8QB 4X9DA 1NJIU 2JVVA 1KQ1A 4BI4A 3JB9F 1Y71A 5GAN6 2LVMA 1KC8U 4FIBA 3FC3A 3J7AF 3HHTB 2I2LA 1GXIE 2CGHA 2E10A 4E47A 2LCCA 3JSCA 4M75F 3CPWS 2KY9A 5GANd 2KAFA 4OVAA 1I8FA 4EDUA 2PUOB 2RB6A 2E6NA 2QDYB 5J39A 5CKDA 4M77E 4EMKC 4C0DB 3JCMf 2RI5A 4QQGA 3V7CA 4HA8A 4F7UG 3J81E 3OYDA 2O4XA 1K8AU 2JNGA 4ZGEB 4RMOA 3OSSC 4M7DB 4LDVA 5CK9A 3HFOA 5HK0A 2RJDA 3MP6A 5CVIA 4A4FA 3META 2PVDB 2QQBA 4IUPA 3VYGA 4WF2A 5A0DA 1I5LA 3CC2A 3SWNB 3MP8A 4PLIA 2XG8D 4YTLA 2VXEA 1VQNA 4HKEA 2ZPEB 1YI2T 3JCMg 1VQKT 2M1HA 2X4WA 2DO3A 1NE8A 3OY9A 4M75B 3JB9J 1H641 3M54A 1R8OB 2DKGA 4XU3A 4M7AG 4MZPA 1G3WA 3S3NA 5GAMj 3G6EA 2E41A 2GF7A 3M59A 3V7RA 3CCRT 5FU7B 1I81A 2BUDA 3HRSA 4A53A 1K73U 5FRNA 3FJPA 1QW1A 1D3BA 2EQUA 3QKJA 4BACA 1Y07A 5KE2A 4C8QE 2IG0A 3I56A 3GNGA 3L2QA 3G71A 3AHUA 5IT9E 3CCQA 2JN0A 4KT0E 3L42A 4C5GA 2RHYA 4BUGA 2LNVA 3E9FA 3LX7A 4ZGDB 3M57A 2HNIA 4JDSA 1YJ9T 1Q7YU 1LNXA 4N4IA 1Y7XA 2HQEA 2DAQA 1KQ2A 3OSVA 5LJ3f 3C4SA 2RD1A 3LW5E 1VQLA 1YIJA 4JRPA 2XDDA 5LJ5f 5GAN8 5FU6C 3CD6T 4PJOA 4M77G 4NL3A 4XTVA 1FWZA 1U8RA 2PVGB 4BY6B 2HAXA 1YJNT 4PJOD 2EQMA 4EMHA 4FSXA 3HRTA 1N8RC 4QVZA 5LJ3g 3X26B 3OBWA 4HCBA 4PKCC 4NL2A 3NFCA 4QW2A 1VQOA 1Y96A 2EWNA 2L89A 2XDPA 3A8GB 3CPWA 2PQWA 2DXUA 3KBGA 3PGGA 4ME7A 5DY9A 2EKOA 5GANf 1UGSB 3CCVA 3OW2S 1KD1U 2WSFE 2DXTA 3S6WA 4C92C 4BDZA 2PU9B 2DXBA 1WJQA 2RM4A 2E1HA 5GAOm 5KH6A 2QEXT 4C92A 2O01E 2E65A 3X24B 5GANg 1WQWA 4C92D 3LH0A 1Q81C 4M78C 5AYFA 2CYZB 2EFIA 1VQNT 4LDWA 3VKIA 5M9OA 2EJFA 3X20B 1N6AA 1VQKA 1G5VA 4M78A 2DZ9A 3SB2A 2LCLA 1KG1A 1K9MC 4PJOG 2FHDA 3VV0A 2CZ1B 2R58A 4PL6A 3JCMW 5GMKm 1QVPA 2ZGWA 2DIGA 4M78D 5GAN7 2KMTA 3OB9A 2EAYA 2LQ8A 2E5QA 2LC4A 3KUFA 2JOYA 2X4JA 4XTYA 1SSFA 3BW1A 4R56A 2VYTA 4JUVA 4O5VA 4RCBA 1B34B 1KHIA 2R5AA 3MHXA 4J6XA 3RKYA 2CZ6B 3G6ET 4ZN3A 2V8JA 1NZ9A 3V8JA 3BDLA 4XU0A 3PNWC 2QXFA 4J8OA 3OYJA 2C06A 1X01A 3OYAA 1N8RU 2QQSA 3JCMc 1YJWA 1NPPA 2RHXA 2RO0A 4EMGA 3HKSA 2LRQA 3CBPA 3DKMA 3P8BB 4X9CA 2YLCA 4FU6A 5GAN3 3JCMP 3I56T 3G71T 3QZ5B 2P0KA 2O4XB 3OMCA 3CCQT 1XNIA 1KHCA 5D6YA 2YRVA 3ER0A 4GY5A 3CD6A 2RH2A 2EQKA 2Y4YA 1IZ6A 1M5Q1 5J3BA 3QBYA 4M7AC 4DOVA 1VQLT 1YIJT 2RJFA 4OB2B 5IAYA 3E19A 4OB3B 4M7AA 2F5TX 1Q81U 3OYHA 2MMPA 5LJ3j 4ZTFA 4J7IA 2X4YA 2QQ9A 3OS0A 4BD3A 5I2SA 5LJ5j 4M7AD 1VQ7T 2RJCA 3A8LB 4R55A 3OW2A 4TVRA 1VQ6T 4CRIA 2XI9A 1VQOT 1W4SA 4JLIA 3PIOA 1ZBXA 1D3BB 2PVOB 2M0OA 3N5BB 2KQWA 5D6XA 2QEXA 2HD0A 2JUFA 3M55A 3CCVT 2LT1A 3INZA 3DLMA 4FT2A 2CKKA 2E6ZA 2L8DA 2RHZA 5CQYA 3JCMb 5A2QE 5CIUA 5GANj 5GAMh 3S3MA 2ZZDA 4M77C 4E7HA 3MCAB 3VJPA 1M9SA 4JRQA 3RERA 2L5QA 2OTLT 3J80E 3M4GA 3HPWA 4C92F 4M77A 1M1GA 2ZPHB 5GAN2 3FIFA 3OYEA 4XTXA 4M77D 2KDSA 3A8HB 5FU6B 3EFRA 3HRUA 2XK0A 5KCHA 3CC7A 1QVFS 2RJEA 2XIDA 2XHCA 3PIPA 1VQ8T 3HFNA 4NOYA 3A8OB 2MWPA 3OYYA 4M78F 4KUDK 1Y96B 2QI2A 4ELZC 4IUUA 4OB0B 1KQSS 2OTJA 2DPPB 1VIFA 3UDCA 2AHJB 3RKXA 3X28B 3CBOA 1BI3A 3CC4T 3FRNA 1UGRB 1M1KU 2M9UA 4HCCA 3PT9A 4A4HA 3ME9A 3OS1A 3JCMJ 2P0QA 3M53A 5CCAA 4KBMB 2P4TA 4X34A 4C92B 2V8KA 1YJWT 1VQ4A 3OA6A 4OF1A 5GMKh 4E7IA 2EYQA 5GAMd 3M58A 5LL6S 3RESA 4IKFA 3JB9H 3CMAT 5GAOq 4C8QA 3LWHA 4PJOC 3V7SA 1U1SA 3UWNA 2DJZA 4OMFB 3PMTA 5CR2A 4M78B 4F7UF 4XTUA 3CXCS 3GOXA 4C8QD 2R5MA 1VUBA 5CAIA 3G4SA 1FXXA 3OYNA 2EQJA 3ASKA 3C94A 1VQ7A 4ATOA 3MEVA 2DIQA 4M7DE 4A4EA 4MZMA 4Q5WA 5GMKj 1VQ6A 4QVCA 5CO7A 1VQMA 4OGCA 4A4GA 3CCMT 5L8RE 3CCJA 4M7AF 4UC4A 2BIVA 3OYGA 3X25B 3JCMh 2XU8A 2LQKA 3MO8A 4HCZA 4DQ2A 3QZ9B 4M75E 1I4K1 1XQHA 1BI1A 3CBMA 2K3YA 3BDUA 2QQRA 2K5LA 4PLLA 4QQDA 3OYFA 1OZ2A 3SWNA 3TEEA 4F7UB 5GAMe 1WPYA 4JRKA 3RUXA 4ZTJA 1V29B 2R57A 3C95A 1W2BS 2VV5A 3DB3A 2HBPA 3RMSA 3CPFA 2OTLA 1TH7A 2DTOA 4GLKA 3LYIA 2E12A 2JTMA 3GPLA 2IVWA 3RMQA 3M5AA 4IUVA 4MDWA 3CCUA 4J6YA 4L59A 2FB7A 4C8QG 3OYLA 3L2ZA 2V8IA 5CKEA 5HY6A 3P8HA 1QVFA 5CKBA 1VIEA 1ZHIA 3OQ5A 3NTIA 1VQ8A 2QTXA 1QP2A 4M7AB 3UT1A 1PSFA 2P0PA 3MP1A 3OBYA 5DLQE 1KQSA 2ZPBB 3PMIA 1M4ZA 4M77F 4DOWA 5GAOp 3CC7T 4BE1A 2XDBA 1N27A 3VYHB 3CC4A 3EAEA 3JB9I 2K3XA 5HKCA 2OTJT 4QQ6A 2XICA 2DEQA 2VXFA 1VQ5A 1HK9A 1N9SA 2DZCA 3FLGA 5A0GA 3NTHA 4M7DG 1Q82C 2GQVA 1FX7A 5LJ3h 1KC8C 2GFUA 4JLGA 3ZEHA 4Y28E 1UGPB 1OI1A 2HQXA 4BE2A 1PSEA 3L2WA 5LJ5h 2RA2A 2D0QB 5A0LA 3JB9G 3CMAA 1N9RA 4DA4A 1VQ4T 3QDRB 3OS5A 1S72T 3CXCA 1U1TA 1G3TA 4M75G 1G3SA 3GNFB 4M77B 4JS4A 3RIRA 3F70A 3ZBDA 3QJ6A 4J7FA 4LDXA 2KK4A 5GAMg 4F7UE 1EIFA 3H6ZA 4J5YA 4P5NA 4E7LA 1VQPT 1QVGS 1K8AC 5C0MA 2X4XA 3JCMX 3A8MB 2X35A 3PFSA 3CCEA 1M90C 5GANh 3G4ST 1IREB 3FB9A 3V8KA 1G3YA 3QUIA 3E9GA 4PJOF 4O6JA 5EG2A 3CCMA 3QPHA 5FRMA 4IUTA 5HK3A 2MI6A 3SFMA 2DTIA 1K9MU 2DK3A 4NS5A 3GP8A 3QIIA 4J83A 2BKDN 3CCLA 1VQMT 1JBMA 3QXEB 2XKOC 1XOVA 4BB7A 4BI8B 3CCJT 3OS2A 4BE0A 4LDUA 1W2BA 1VQ9A 2RHUA 5CQXA 2WSCE 4OP0A 3QJYA 2FL7A 1BIBA 5LJ5d 2A3LA 1K73C 4XTWA 1X75C 2RK2A 3VUZA 3CMEA 4XU1A 2DTHA 4OGEA 3DB4A 2FYKA 1WGSA 4BDYA 1OYXA 2ZCFB 1Q82U 3TU4K 2GFAA 2CZ7B 4PJOB 3CCUT 3KXTA 2CS7A 3G7ZA 1B34A 5I21A 1YITT 2DD4A 2ZPGB 3C12A 3LLRA 4Z02A 1Q7YC 4E7JA 3A5ZB 2MAMA 4OB1B 3GLXA 5GMKi 1JJ2S 3UPUA 4MMLA 2B8AA 2DD5A 2MWOA 2YHTA 1LJOA 5CKHA 2OAUA 1LOJA 5CKFA 4B9WA 1UEBA 2F5KA 2QQAA 3EFSA 4RG2A 1XTDA 3L2VA 2K57A 3TCJA 1Q86C 2D9TA 4EMKA 3HP9A 1M90U 3QYGB 4XK8E 3VUBA 5DLOA 5LJ3e 3QHSA 3QG1A 2LT4A 3LWIA 5C6SA 1VQ5T 5LJ5e 1RL2A 1M8VA 2YLBA 4BI3A 4L5GA 4C5IA 4C8QC 1YHQA 1S72A 3WXMB 3QSUA 1KD1C 3JCMV 4XTZA 2EIFA 4HT9A 2LX9A 4XAXB 1QVGA 1UB4A 2EJ9A 4N4GA 2VGMA 4LD6A 2KVQG 3VU3C 1VQPA 1WJRA 2L3RA 3LGLA 3ZFJA 5GAOl 5IN1A 1JB0E 3URGA 4ELYC 4LDYA 4L6V5 5GANe 1WNLA 4RG8A 1BI0A 2LTOA 2JTFA 2E64A 4C0DC 3DLLA 4KULA 4A4KA 3CCET 2D6FA 3L1AA 3CCSA 3OYIA 4PJOE 3L2UA 2WACA 4M7DC 2QA4T 4JRIA 4N4HA 5DM7R 1MHNA 2K5FA 3V8LA 3NTKA 4D6WA 4FL6A 5FLXE 1BIAA 3SWNC 4M7DA 2A7YA 5GMKl 3CCLT 4HT8A 3BY7A 5I2MA 2RK1A 3SDZA 2RHIA 3JCMQ 3H8ZA 4J6WA 3I55A 3OYKA 4M7DD 1VQ9T 4M75C 3GIBA 1MGQA 4CI0C 1Q86U 3S3OA 5FROA 3JB9D 1JRIA 2EJGA 1O75A 3M56A 4M75A 3LGFA 5D6WA 3MEAA 3CEYA 4ZGJB 1NPRA 2H3JA 2CZ0B 2VGNA 3OYCA 2F69A 5FU7C 4LD9K 1P92A 1UGQB 4EPCA 1YITA 3CMET 3O8VA 5LJ5g 4M75D 4C92E 1M1FA 4RCCA 1JJ2A 2Y90A 5KCOA 2E70A 2RI3A 3HL8A 1BKBA 2K5IA 4N0AC 2Y4XA 1WQ7A 4FM4B 4Y91A 4M78E 4N0AA 4C0FA 3OMGA 1QP3A 4C5HA 1H3ZA 4II1A 3HSBA 5J26A 3JCMd 3E1SA 2GCXA 2M16A 2DVEA 1NJIC 3M4YA 4C5EA 3MEWA 3WVDB 4QVDA 5GMKe 4JS5A 1YI2A 4BY6C 5GAMf 4MDXA 3CC2T 4C0GA 4A54A 2ZPFB 4RKUE 5GAOr 4E7KA 4KUIA 2K2VA 2DXCA 3QYHB 1YHQT 5KE3A 2WSEE 3OYMA 3T9NA 2JZ2A 3CCRA 3BFMA 2PUKB 1O9SA 1HXDA 3JRZA 4JJNK 2G3RA 3MEUA 4FT4A 4IURA 2KSSA 2FVUA 3PTAA 3FEOA 3QO3A 2XD0A 1OZ3A 3GF5A 4B9XA 4XU2A 4C8QF 3RKWA 3Q1JA 3SD4A 2VC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NE8 A;  4VUB A;  5HKC A;  4MZT A;  5HK3 A;  5CR2 A;  1UB4 A;  3JSC A;  4MZP A;  2MF2 A;  1VUB A;  4ELZ C;  5CKH A;  4ELY C;  5CKF A;  4MDX A;  5CKD A;  5CKE A;  4MZM A;  3NFC A;  5CQX A;  5CKB A;  1M1F A;  5CQY A;  3TCJ A;  5CO7 A;  2KMT A;  2VUB A;  3VUB A;  5DLO A;  4ME7 A;  5CCA A;  1X75 C;  3JRZ A;  5CK9 A;  5HK0 A;  4OF1 A;  3HPW A;  4HKE A;  3G7Z A;  2C06 A; 
#chains in the Genus database with same CATH topology
 4VUB A;  3FDR A;  2COW A;  2QA4 A;  4MZT A;  3WVE B;  1YCY A;  1AWO A;  1WHL A;  3P8D A;  1YP5 A;  1CSK A;  1DJ7 B;  2K4Y A;  2NLU A;  2XMF A;  1MV3 A;  5LJ3 d;  2DVJ A;  2EW3 A;  1LCK A;  1WA7 A;  2HMA A;  1M1K C;  2DNU A;  4IIM A;  2NUP A;  2AK5 A;  1KQ1 A;  3JB9 F;  2B86 A;  3J7A F;  5KYW B;  2I2L A;  2CGH A;  4E2F B;  4M75 F;  4EDU A;  1JU5 C;  2PUO B;  2RB6 A;  1AWX A;  4M77 E;  4C0D B;  1NJI R;  3V7C A;  4QQG A;  4HA8 A;  3OYD A;  4ZGE B;  1X27 A;  1RAG B;  3HFO A;  4A4F A;  3MET A;  5A0D A;  2CSI A;  4YTL A;  4RUG A;  4HKE A;  1YI2 T;  4Y92 A;  3JCM g;  1VQK T;  3JB9 J;  2DKG A;  2NYS A;  3PE0 A;  1C6V X;  2ROT A;  5FRN A;  2K2M A;  1Y07 A;  3L2Q A;  4FYX B;  5IT9 E;  3G4S Q;  3I35 A;  3L42 A;  4GBQ A;  2LNV A;  3EH1 A;  1YN8 A;  2HNI A;  1LNX A;  1Y7X A;  1OX8 A;  2HQE A;  4ORZ A;  3VS5 A;  1YIJ A;  4JRP A;  5LJ5 f;  4M77 G;  1K9A A;  4XTV A;  1SHF A;  1T0J A;  3MJX A;  4OML A;  1YJN T;  4EMH A;  1N8R C;  3HRT A;  2KRS A;  1VQO A;  1Y0M A;  3CPW A;  2PQW A;  5GJV B;  3PGG A;  4ME7 A;  2D0N A;  2EKO A;  5GAN f;  3CCU Q;  2DXT A;  4C92 C;  4BDZ A;  1YIT Q;  2PU9 B;  3RBB B;  2HDA A;  5KH6 A;  2E3H A;  2O01 E;  1GBQ A;  1WQW A;  4C92 D;  4M78 C;  4LDW A;  5M9O A;  1B07 A;  2EJF A;  3X20 B;  1N6A A;  2LCL A;  6AT1 B;  1KG1 A;  4PJO G;  2FHD A;  2K9G A;  4PL6 A;  4M78 D;  2DIG A;  4R56 A;  3M0U A;  1QQJ A;  1AWJ A;  2R5A A;  2KRN A;  3V8J A;  3BDL A;  2QXF A;  4J8O A;  1X01 A;  2AKL A;  1NYF A;  2QQS A;  2RHX A;  2RO0 A;  3DKM A;  2GTO A;  1Z9Q A;  2DBK A;  1JJ2 P;  3QZ5 B;  3CCE Q;  2P0K A;  3OMC A;  3EGX A;  1M27 C;  4GY5 A;  3AT1 B;  1QWF A;  1UHC A;  1X2Q A;  5J3B A;  2HL3 A;  4J9C A;  4QT7 A;  1AZE A;  5IAY A;  1VQ9 Q;  4J7I A;  1SF9 A;  2QQ9 A;  3OS0 A;  5LJ5 j;  1VQ7 T;  3A8L B;  4R55 A;  4AG2 C;  4TVR A;  1TXQ A;  2XI9 A;  3VS4 A;  1UTI A;  2HEQ A;  2M0O A;  3N5B B;  4AG1 C;  2RQU A;  3CCV T;  2NUT A;  4FT2 A;  2E6Z A;  2RHZ A;  5CQY A;  5A2Q E;  5GAN j;  4OMP A;  2ZZD A;  3VJP A;  2L5Q A;  1U5S A;  3HPW A;  4M77 A;  4R0K A;  1QMC A;  3OYE A;  2J6F A;  2XK0 A;  1B7T A;  2XHC A;  3EH2 A;  3NMZ C;  1YHQ Q;  4ELZ C;  1KQS S;  4OB0 B;  2YXY A;  2AHJ B;  3RKX A;  3FRN A;  2Z0W A;  5KYX B;  2X9H A;  1M1K U;  4KBM B;  2P4T A;  4DBR A;  1QCF A;  3OA6 A;  4OF1 A;  1GBR A;  3CCS Q;  5GAO q;  3LWH A;  1U1S A;  4OMF B;  1I0C A;  3LH5 A;  3G4S A;  2RNA A;  4M7D E;  4Q5W A;  1VQ6 A;  2FZG B;  1HD3 A;  4J9E A;  4QVC A;  1IHW A;  4A4G A;  5L8R E;  4M7A F;  2BIV A;  5AT1 B;  3MO8 A;  2HSE B;  1I4K 1;  1XQH A;  3BDU A;  2FPF A;  3C95 A;  4CC2 A;  1EZZ B;  2HBP A;  2J7I A;  1HYO A;  2E12 A;  2QG9 B;  3M5A A;  3CCU A;  1XJW B;  2EVR A;  4J6Y A;  4L59 A;  3L2Z A;  5HY6 A;  3P8H A;  1QVF A;  1VQ8 A;  9ATC B;  1PSF A;  2P0P A;  1M4Z A;  3VS3 A;  3VYH B;  2QYZ A;  4JJC A;  2K3X A;  2KR3 A;  3CCR Q;  2VXF A;  2DZC A;  4M7D G;  2NUT B;  2YUQ A;  1VA7 A;  1FX7 A;  2M02 A;  3IQL A;  1OI1 A;  1AVZ C;  1NEG A;  1PC0 A;  2YDL A;  5LJ5 h;  3L2W A;  3CMA A;  2FO0 A;  1N9R A;  2CP6 A;  1VQ4 T;  2EQI A;  1BK2 A;  1NYG A;  1S72 T;  1U1T A;  4M77 B;  2JXB A;  4J7F A;  2KK4 A;  2OX7 A;  5IH2 A;  4F7U E;  1EIF A;  4AT1 B;  3CCE A;  1HSQ A;  5GAN h;  3E9G A;  3CCM A;  5EG2 A;  2MI6 A;  3SFM A;  2J6O A;  2BKD N;  1VQM T;  3QXE B;  3ULR B;  1W1F A;  1W2B A;  1VQ9 A;  3TSZ A;  1K73 C;  1X75 C;  4XU1 A;  2IPO B;  1WGS A;  4BDY A;  2CZ7 B;  4PJO B;  3KXT A;  1FMK A;  1B34 A;  1R0B G;  2ZPG B;  3LLR A;  1Q7Y C;  2MAM A;  3I5R A;  5GMK i;  1VQN Q;  2B8A A;  5CKH A;  1LOJ A;  1UEB A;  1PCX A;  1SEM A;  2G6F X;  4ESR A;  1Q86 C;  2E5K A;  1I07 A;  1VQ5 T;  2CUB A;  3QWY A;  4BI3 A;  4L5G A;  4C8Q C;  4PK4 A;  1YHQ A;  4J9I A;  2CSQ A;  2DE0 X;  4XTZ A;  3JCM V;  2EPD A;  3I56 Q;  4KH1 B;  4HT9 A;  3PVL A;  3CCQ Q;  1QVG A;  2K7A A;  3VU3 C;  1CKB A;  2GBQ A;  1WJR A;  3ZFJ A;  5GAO l;  5IN1 A;  4LDY A;  1M2V A;  2LTO A;  1OX9 A;  2YWW A;  2D6F A;  3VS2 A;  3CCS A;  2QA4 T;  3A98 A;  2DIL A;  2CP3 A;  4M7D A;  2L2P A;  1MUZ A;  2RK1 A;  3OYK A;  4M75 C;  4FW2 A;  1PWT A;  2KI7 A;  3JB9 D;  4JJN K;  1O75 A;  2P84 A;  3OYC A;  2AIR B;  2VGN A;  1P92 A;  5LJ5 g;  4M75 D;  2F1L A;  1M1F A;  1IHV A;  5KCO A;  1WIE A;  4JPB W;  4Y91 A;  4LN2 A;  4J9B A;  4II1 A;  5J26 A;  1TSF A;  2M16 A;  2DVE A;  3TSW A;  3QWX X;  4RTX A;  4BY6 C;  2ZPF B;  2H3E B;  1YJW Q;  4E7K A;  2K2V A;  2WSE E;  4J9G A;  3OYM A;  3CCR A;  3JRZ A;  5FWC A;  2FVU A;  3PTA A;  4PJN A;  1RAH B;  1ZSZ B;  3NPF A;  4XU2 A;  2KRO A;  1RI0 A;  4IUQ A;  2MF2 A;  4F7U A;  1YJ9 A;  4AFS C;  3TRE A;  1S1N A;  2RMO A;  1UJ0 A;  3M9Q A;  2MPX C;  3GBQ A;  4XQ3 A;  5GAO n;  3JAM E;  4AFU C;  4DEY A;  1SSH A;  5GAN 5;  1FMV A;  2EGA A;  2FZK B;  4J9H A;  1WXT A;  3EHQ A;  1QCO A;  4X9D A;  2JVV A;  4RTT A;  5GAN 6;  1UDL A;  2AT1 B;  3JSC A;  1M2V B;  3CPW S;  2YRD A;  2VB6 A;  1GFC A;  5GAN d;  1I8F A;  2E6N A;  5J39 A;  2RPN A;  2YSQ A;  2RI5 A;  1H8K A;  3OSS C;  4M7D B;  1QLY A;  1TWB A;  3MP6 A;  3FC3 A;  2OTJ Q;  3SWN B;  3MP8 A;  2VXE A;  1VQN A;  4AMC A;  2DO3 A;  3U23 A;  1H64 1;  2E4H A;  3S3N A;  2E41 A;  3M59 A;  3V7R A;  2IIM A;  3I5S A;  4WCI A;  1I81 A;  2BUD A;  4A53 A;  1K73 U;  1IB8 A;  1JXM A;  2W10 A;  1D3B A;  1VQP Q;  1FYN A;  5KE2 A;  2LCS A;  4C8Q E;  2IG0 A;  1LPL A;  3I56 A;  3AHU A;  3CCQ A;  2JN0 A;  1D0Z A;  2YUO A;  4C5G A;  2RHY A;  4BUG A;  1PRM C;  3E9F A;  4ZGD B;  1Q7Y U;  2X3W D;  2MYS A;  2GQI A;  5GJW B;  3OSV A;  1H92 A;  2RD1 A;  2XDD A;  4FCY A;  1MND A;  2EKH A;  1M1K R;  4NL3 A;  1U8R A;  4PJO D;  2EQM A;  4QVZ A;  5LJ3 g;  4PKC C;  1X6G A;  3NFC A;  2EWN A;  2L89 A;  3A8G B;  2RQW A;  1WYX A;  5DY9 A;  3S6W A;  2DXB A;  2E1H A;  1JEG A;  2DL8 A;  2E65 A;  2HSP A;  5AYF A;  2JMC A;  2L3Q A;  2DZ9 A;  3SB2 A;  1PHT A;  1ZUK A;  2CZ1 B;  2V1Q A;  3JCM W;  5GMK m;  2ZGW A;  5GAN 7;  3OB9 A;  2EAY A;  3JV3 A;  3BW1 A;  1BB9 A;  1YWP A;  2CH4 A;  2LJ0 A;  5FW9 A;  2CZ6 B;  3G6E T;  2V8J A;  4XU0 A;  3OYA A;  3EG9 A;  1WHK A;  1YJW A;  3HKS A;  3CPW P;  2DF6 A;  1BCM A;  4HVV A;  3JCM P;  3G71 T;  2COZ A;  1XNI A;  2YRV A;  1G2B A;  3CD6 A;  2RH2 A;  2EQK A;  2Y4Y A;  4FYV B;  3QBY A;  2DJQ A;  4M7A C;  3CCL Q;  1VQL T;  1N8R R;  3UF4 A;  4OB3 B;  1M3C A;  2F5T X;  2OI3 A;  1Q81 U;  2AZS A;  2X4Y A;  5I2S A;  4M7A D;  1VOM A;  1MMG A;  3OW2 A;  1VQ6 T;  1ZBX A;  1D3B B;  5D6X A;  2QEX A;  3INZ A;  2SEM A;  2CKK A;  4HVW A;  5CIU A;  1RI9 A;  1X6B A;  3MCA B;  1ZBJ A;  1M9S A;  4JRQ A;  3RER A;  1FMW A;  3FIF A;  4RTV A;  5FU6 B;  2KDS A;  3EFR A;  1TS9 A;  5KCH A;  3CC2 Q;  1QVF S;  1VQ8 T;  4NOY A;  1R0C B;  1WX6 A;  2KGT A;  2MWP A;  3A8O B;  1V1C A;  2OTJ A;  3UDC A;  3X28 B;  3CBO A;  2JS0 A;  4HCC A;  3PT9 A;  4A4H A;  3ME9 A;  3JCM J;  2P0Q A;  1RAI B;  1E7O A;  2V8K A;  4E7I A;  3VS6 A;  2DL4 A;  5LL6 S;  3JB9 H;  3CMA T;  4C8Q A;  4B6M A;  4XTU A;  1KFZ A;  2LNH B;  1MMA A;  3OYN A;  2EQJ A;  3ASK A;  4X1V A;  4FYW B;  3M0T A;  3EG2 A;  3CCM T;  4UC4 A;  2MIO A;  4DQ2 A;  2DM1 A;  3QZ9 B;  2D8H A;  2K5L A;  4QQD A;  1OZ2 A;  3TEE A;  1WPY A;  4JRK A;  1W2B S;  2R57 A;  2VV5 A;  3DB3 A;  2OTL A;  4GLK A;  3LYI A;  3GPL A;  1AD5 A;  2H8H A;  2FB7 A;  2V8I A;  5CKE A;  2MK5 A;  3OQ5 A;  1T3L A;  4LXC A;  1QP2 A;  5DLQ E;  2NUP B;  1YI2 Q;  2ZPB B;  2LX7 A;  1VQK Q;  3PMI A;  4M77 F;  3CC7 T;  5GAO p;  1RAF B;  1N27 A;  3CC4 A;  3EAE A;  3JB9 I;  1WHH A;  3MPU B;  3EG0 A;  4RTZ A;  2DLP A;  2XIC A;  1HK9 A;  1N9S A;  1KC8 C;  1T0H A;  2AKK A;  3ZEH A;  1UGP B;  2HQX A;  4BE2 A;  2D0Q B;  3QDR B;  1G3T A;  4JS4 A;  4LDX A;  4E7L A;  1QVG S;  2X4X A;  3JCM X;  1ABO A;  2X35 A;  3FB9 A;  4DBQ A;  1YJN Q;  2A0F B;  4PJO F;  4O6J A;  1QVF P;  2DTI A;  4NS5 A;  3QII A;  3CCL A;  3BE3 A;  3M0R A;  1JBM A;  4BI8 B;  4BB7 A;  3CCJ T;  3D7S B;  2NWM A;  4F14 A;  3SEM A;  4XTW A;  2RK2 A;  1OUL A;  2DTH A;  3DB4 A;  2FYK A;  2ZCF B;  1T3S A;  1Q82 U;  8AT1 B;  2CS7 A;  3G7Z A;  3C12 A;  4E7J A;  2A28 A;  4OB1 B;  4MML A;  2DD5 A;  2MWO A;  5CKF A;  4B9W A;  1AT1 B;  3VRY A;  1XTD A;  3HP9 A;  2MOX A;  3KFV A;  3QHS A;  3QG1 A;  3LWI A;  1SPK A;  1RAB B;  1RL2 A;  2KNB B;  4KGV B;  1D0Y A;  2VWF A;  3QSU A;  2KE9 A;  2C0O A;  1QKX A;  1WXU A;  2GNC A;  4N4G A;  1C0M A;  1RAA B;  1K76 A;  3URG A;  1YWO A;  4C0D C;  1GCQ C;  4KUL A;  2ECZ A;  2YRC A;  4KRT A;  3OYI A;  1GCP A;  4N4H A;  5DM7 R;  2K5F A;  3V8L A;  1VQ7 Q;  2DYB A;  4D6W A;  1BIA A;  5IHK A;  4HT8 A;  4E7S A;  3SDZ A;  2QK0 A;  2RHI A;  1K73 R;  3H8Z A;  4J6W A;  3CCV Q;  1OOT A;  4CI0 C;  2PNI A;  1NG2 A;  3EGX B;  3MEA A;  3CEY A;  2CZ0 B;  2F69 A;  4LD9 K;  1YIT A;  1Q7Y R;  3CME T;  3O8V A;  4C92 E;  4RCC A;  1JJ2 A;  1SG5 A;  2Y90 A;  4ZNX A;  1BKB A;  1QVG P;  4N0A C;  1Q86 R;  4M78 E;  2DEU A;  2CRE A;  4PJM A;  2DBM A;  3E1S A;  2OJ2 A;  2J05 A;  2DMO A;  3MEW A;  1YI2 A;  2C0T A;  5D7U A;  4A54 A;  2VVK A;  3TQ7 P;  1UEC A;  3BFM A;  2OAW A;  1O9S A;  3E2U A;  1OZ3 A;  1W6X A;  3HTR A;  4B9X A;  1OQK A;  1R77 A;  4E7H A;  3J80 E;  3Q1J A;  1AHJ B;  1BI2 A;  3L2R A;  1M30 A;  3R6O A;  1ZQ1 A;  1AOJ A;  4C92 G;  1WJS A;  4ZN1 A;  1KQS P;  2ZPI B;  1X6O A;  1BYM A;  1IGQ A;  4MMK A;  5GAN 4;  1YJN A;  4V2S A;  4JZ3 A;  4M78 G;  3I55 T;  1WHJ A;  2QTV A;  2RI2 A;  4M7D F;  4K11 A;  1YBY A;  1D09 B;  1NJI U;  1ZSG A;  1Y71 A;  2LVM A;  1KC8 U;  2E10 A;  2HZY A;  4E47 A;  2KY9 A;  4OVA A;  1ZLM A;  4PJL A;  2QDY B;  5CKD A;  4EMK C;  4RTY A;  5EC7 A;  1TUC A;  3JCM f;  4F7U G;  4PJJ A;  2JNG A;  2I0N A;  3A1P A;  4LDV A;  5HK0 A;  5CVI A;  4IUP A;  2PVD B;  3VYG A;  4WF2 A;  1PKT A;  4PLI A;  2XG8 D;  2D1X A;  2ZPE B;  2M1H A;  1H3H A;  1NE8 A;  2F2X A;  3M54 A;  4XU3 A;  1VQ4 Q;  3RR6 A;  3H0H A;  1S72 Q;  5FU7 B;  4HCK A;  3HRS A;  1NLP C;  4BAC A;  2ZAE A;  4KT0 E;  1MV0 B;  1AEY A;  2PZ1 A;  5L23 A;  3EFO A;  2BZY A;  4QKU A;  3M57 A;  1ZX6 A;  2DER A;  3C4S A;  1VQM Q;  2BE9 B;  5GAN 8;  1N5Z A;  3CD6 T;  4DEX A;  1JXO A;  2PVG B;  2HAX A;  1RLQ C;  1UUE A;  1VYV A;  4FSX A;  3X26 B;  3OBW A;  4NL2 A;  2XDP A;  1RAC B;  1OEB A;  3KBG A;  2CT4 A;  2QAZ A;  3CCV A;  3OW2 S;  1TOV A;  3VS0 A;  5IHI A;  1WJQ A;  5GAO m;  3NGP A;  2QEX T;  4C92 A;  2BTT A;  4PFZ A;  4RTU A;  3X24 B;  5GAN g;  1Q81 C;  2L3S A;  2ENM A;  4M78 A;  2A37 A;  1K9M C;  1VQ5 Q;  2DFU A;  3VV0 A;  2KMT A;  2LQ8 A;  2E5Q A;  2JOY A;  2X4J A;  3TVT A;  4Z88 A;  3UA7 A;  1B34 B;  1KHI A;  3MHX A;  2HKN A;  4J6X A;  4ZN3 A;  2DET A;  3PNW C;  5KYY A;  1NPP A;  3CBP A;  2C0I A;  4X9C A;  5GAN 3;  1KHC A;  2QDL A;  5D6Y A;  2QA4 Q;  4Z8A A;  2RQV A;  1QWE A;  3ER0 A;  1IZ6 A;  1M5Q 1;  4JJD A;  2GGR A;  1YIJ T;  4OB2 B;  2CH4 W;  2FPD A;  3OYH A;  1PKS A;  2MMP A;  1I5O B;  5KYU A;  2RJC A;  4CRI A;  1VQO T;  4JLI A;  1UGV A;  1TTH B;  2KQW A;  1UFF A;  1X2K A;  2HD0 A;  2JUF A;  2L8D A;  4HXJ A;  2CDT A;  1PM3 A;  4M77 C;  4RTW A;  2QGG A;  2OTL T;  5IXB A;  1M1G A;  1QKW A;  4XTX A;  4M77 D;  1CKA A;  3HRU A;  2FZC B;  3HFN A;  4KUD K;  3OYY A;  2DL3 A;  2DPP B;  1VIF A;  1BI3 A;  3CC4 T;  1UGR B;  1RAE B;  3OW2 P;  4X34 A;  4C92 B;  2DX1 A;  1VQ4 A;  5GMK h;  2EYQ A;  5GAM d;  3M58 A;  1WFW A;  4PJO C;  3V7S A;  2JT4 A;  3UWN A;  4M78 B;  1UJY A;  1PD0 A;  1ARK A;  2EYZ A;  2R5M A;  1K1Z A;  5CAI A;  1FXX A;  3C94 A;  4ATO A;  1TUG B;  5CO7 A;  1VQM A;  4OGC A;  3RDV A;  2JW4 A;  3OYG A;  5KYY B;  3JCM h;  1BU1 A;  2LQK A;  2NUZ A;  4HCZ A;  4M75 E;  4D8K A;  3CBM A;  4ZTJ A;  5GAM e;  4F7U B;  1V29 B;  2DL7 A;  2QGF B;  3RMS A;  5I11 A;  3CPF A;  1TH7 A;  1M8M A;  2IVW A;  4IUV A;  4MDW A;  2LJ1 A;  4C8Q G;  3OYL A;  2L0A A;  1ZHI A;  3NTI A;  2QTX A;  3UT1 A;  4A63 B;  2QAS A;  4FSS A;  5KYU B;  5HKC A;  4QQ6 A;  2DEQ A;  1VQ5 A;  3VS7 A;  1ZA1 B;  5A0G A;  3NTH A;  2F2V A;  1Q82 C;  2GFU A;  4J9F A;  2JMA A;  1PSE A;  2K3B A;  3JB9 G;  2RA2 A;  5A0L A;  2JM9 A;  4DA4 A;  3OS5 A;  3CXC A;  4M75 G;  1G3S A;  3GNF B;  3RIR A;  3ZBD A;  3QJ6 A;  3H6Z A;  4P5N A;  1G8X A;  1K8A C;  5C0M A;  3A8M B;  3PFS A;  3G4S T;  1IRE B;  1G3Y A;  1BBZ A;  3QUI A;  5FRM A;  4IUT A;  5HK3 A;  2CP7 A;  4KGX B;  1K9M U;  1OPK A;  4J83 A;  1XOV A;  3OS2 A;  2WSC E;  4OP0 A;  3QJY A;  2FL7 A;  2A3L A;  2J6K A;  1ZUY A;  2LP5 A;  1OYX A;  1PD1 A;  2M51 A;  2CUD A;  1ZSZ C;  2DA9 A;  3CCU T;  5I21 A;  1YIT T;  2DD4 A;  3A5Z B;  2AZV A;  4LUD A;  4OMN A;  1JJ2 S;  1KK7 A;  2YHT A;  1ABQ A;  3REA B;  2QQA A;  3EFS A;  2FG0 A;  3L2V A;  3TCJ A;  3MKD A;  4EMK A;  1KC8 R;  1M90 U;  3VUB A;  5DLO A;  2KT8 A;  5LJ3 e;  3G6E Q;  2LT4 A;  1Q95 G;  1M8V A;  4C5I A;  1KD1 C;  3G71 Q;  2KXD A;  1UB4 A;  2EJ9 A;  2VGM A;  1VQP A;  4JZ4 A;  4WTO B;  3LGL A;  4LNP A;  1YNZ A;  4ELY C;  4L6V 5;  1WNL A;  4RG8 A;  2A08 A;  1BI0 A;  1VQL Q;  2FPE A;  3DLL A;  4LE9 A;  4A4K A;  3CCE T;  3L1A A;  4PJO E;  3L2U A;  4M7D C;  1J3T A;  4JRI A;  1MHN A;  3VRZ A;  3NTK A;  4FL6 A;  1VQ6 Q;  3EG9 B;  3SWN C;  1W70 A;  5I2M A;  4M7D D;  1VQ9 T;  1SRM A;  1PG5 B;  3S3O A;  5FRO A;  1JRI A;  2EJG A;  4M75 A;  3OYB A;  1NPR A;  1RUW A;  1NLO C;  1UGQ B;  2ATC B;  4F17 A;  2MCN A;  5KYX A;  1GRI A;  2RI3 A;  3H9N A;  2HL5 C;  2Y4X A;  3M0S A;  1PRL C;  1VQ8 Q;  4C5H A;  4C0F A;  1H3Z A;  3HSB A;  3JCM d;  1NJI C;  3M4Y A;  4C5E A;  1WZO A;  4QVD A;  5GMK e;  5GAM f;  4MDX A;  4C0G A;  2CP5 A;  4RKU E;  5GAO r;  1HJD A;  2LMJ A;  1YHQ T;  1IRX A;  4IIO A;  3T9N A;  3THK A;  5KYN A;  3EGD A;  3RNJ A;  1HXD A;  2O88 A;  1UE9 A;  2X51 A;  3MEU A;  3CMA Q;  4IUR A;  2KSS A;  2XD0 A;  1IXD A;  3RKW A;  1WHG A;  1ACM B;  3UA6 A;  2LDM A;  2O9S A;  2LQW A;  3JCM e;  3CCS T;  3EHR A;  2ABL A;  4EMK B;  2A36 A;  4M7A E;  3CCM Q;  3NHN A;  4KH0 B;  4PNO A;  2KXC A;  2VUB A;  2EBP A;  2LZ6 B;  4C0Z A;  4C8Q B;  4BI4 A;  4FIB A;  2YUP A;  3HHT B;  1GXI E;  1MMN A;  1GFD A;  2LCC A;  2HQH A;  2BZX A;  2CT3 A;  1Z9Z A;  2KAF A;  4OMM A;  1ZUU A;  2RQR A;  3CC7 Q;  1C1A A;  3J81 E;  1K8A U;  2O4X A;  4RMO A;  2KEA A;  1TG0 A;  5CK9 A;  2RJD A;  1I5L A;  2QQB A;  3CC2 A;  1ZA2 B;  3FJ5 A;  2X4W A;  2GTJ A;  3OY9 A;  4M75 B;  1W2B P;  1R8O B;  7AT1 B;  4M7A G;  4PFP A;  4MZP A;  1G3W A;  2O2O A;  5GAM j;  3G6E A;  2GF7 A;  3CCR T;  3FJP A;  1QW1 A;  2EQU A;  3QKJ A;  2PTK A;  4J9D A;  3GNG A;  3G71 A;  1IGU A;  3REB B;  3LX7 A;  4JDS A;  1YJ9 T;  2HCK A;  4N4I A;  1KQ2 A;  2DAQ A;  5LJ3 f;  3LW5 E;  1VQL A;  2E3I A;  1VYU A;  3CCJ Q;  5FU6 C;  4PJO A;  1F1B B;  1FWZ A;  4EIK A;  2DRM A;  2ED0 A;  4BY6 B;  1Y57 A;  5I22 A;  1RAD B;  4OMQ A;  4HCB A;  3EGD B;  4QW2 A;  1Y96 A;  1SKU B;  4OMO A;  2DXU A;  3EGU A;  1UGS B;  1KD1 U;  2WSF E;  2RM4 A;  2V1R A;  1QCN A;  1AWW A;  4ANJ A;  3LH0 A;  2K6D A;  2CYZ B;  2EFI A;  1WXB A;  3VKI A;  2EYW A;  4AFQ C;  1VQK A;  1G5V A;  1V76 A;  1EX4 A;  2R58 A;  2V26 A;  8ATC B;  1VQN T;  1QVP A;  2ED1 A;  2EYX A;  2LC4 A;  3KUF A;  3ZL7 C;  1VYT A;  4XTY A;  1SSF A;  3M0Q A;  4KGZ B;  2JM8 A;  3H0I A;  2VYT A;  1B3Q A;  4JUV A;  4O5V A;  4RCB A;  1A0N B;  1YCS B;  1JO8 A;  3RKY A;  1NZ9 A;  4M4Z A;  3OYJ A;  2C06 A;  2KRM A;  1K0S A;  1N8R U;  3JCM c;  4EMG A;  2LRQ A;  3P8B B;  2YLC A;  4FU6 A;  2RQT A;  2EGE A;  3I56 T;  1D1B A;  2O4X B;  3CCQ T;  5IHN A;  2O9V A;  1YJ9 Q;  1YFN A;  4DOV A;  2L3P A;  1M3B A;  2D8J A;  1RLP C;  2RJF A;  2JTE A;  3E19 A;  4M7A A;  5LJ3 j;  4ZTF A;  1OU9 A;  4BD3 A;  1W4S A;  3CME Q;  3PIO A;  2PVO B;  1KIK A;  1OV3 A;  1WDX A;  5HCK A;  3M55 A;  2KYB A;  1SHG A;  2LT1 A;  1Q81 R;  3DLM A;  3JCM b;  5GAM h;  2HBW A;  3S3M A;  4JJB A;  2DRK A;  1WLP B;  1K9M R;  3M4G A;  4C92 F;  2YUN A;  1SRL A;  1E6G A;  2ZPH B;  5GAN 2;  2HKQ B;  4HVU A;  2EYY A;  4E7Z A;  3A8H B;  1ZSZ A;  2BZ8 A;  2CP2 A;  3CC7 A;  2RJE A;  2XID A;  3PIP A;  4M78 F;  1Y96 B;  2QI2 A;  1GL5 A;  4IUU A;  1MNE A;  2FEI A;  1IO6 A;  2M9U A;  3OS1 A;  3M53 A;  5CCA A;  1YJW T;  3O5Z A;  4CC3 A;  3RES A;  4IKF A;  2FRW A;  2DJZ A;  2F2W A;  3PMT A;  4F7U F;  5CR2 A;  1PNJ A;  2X3X D;  3CXC S;  3GOX A;  1M90 R;  4LUE A;  4C8Q D;  1G83 A;  1UHF A;  1VUB A;  4AFZ C;  3EG1 A;  1VQ7 A;  3MEV A;  2DIQ A;  3I55 Q;  4A4E A;  4MZM A;  5GMK j;  1WHM A;  2DYI A;  4FW1 A;  3CCJ A;  2DL5 A;  1U3O A;  1JQQ A;  3X25 B;  2XU8 A;  4DBH A;  4D8D A;  3EG3 A;  1BI1 A;  2K3Y A;  2QQR A;  2YT6 A;  4PLL A;  3OYF A;  3SWN A;  3RUX A;  2KYM A;  2DTO A;  1U06 A;  2JTM A;  3RMQ A;  2RF0 A;  1UG1 A;  5CKB A;  1VIE A;  4M7A B;  1D1C A;  3MP1 A;  3OBY A;  1KQS A;  4DOW A;  4BE1 A;  2XDB A;  3H41 A;  2KT1 A;  2LJ3 A;  2JJ9 A;  2FRY A;  2OTJ T;  2CP0 A;  3FLG A;  5FWB A;  2GQV A;  5LJ3 h;  4JLG A;  4Y28 E;  4F04 B;  2SRC A;  2KBT A;  1KJW A;  1OU8 A;  2BE7 D;  2W0Z A;  3F70 A;  5GAM g;  1VQP T;  1NBE B;  4J5Y A;  3CD6 Q;  1M90 C;  3V8K A;  3QPH A;  2JS2 A;  2COY A;  4FYY B;  2DK3 A;  3GP8 A;  1NM7 A;  2ROL A;  4BE0 A;  2XKO C;  4LDU A;  2RHU A;  5CQX A;  4GLM A;  1BIB A;  3EFO B;  5LJ5 d;  2QEX Q;  3VUZ A;  3CME A;  4OGE A;  2M0Y A;  3TU4 K;  2GFA A;  1M3A A;  4Z02 A;  1BCO A;  1M2O A;  3CXC P;  3GLX A;  1E6H A;  3UPU A;  3C0C A;  1LJO A;  2OAU A;  2LQN A;  2VKN A;  2F5K A;  3VS1 A;  4RG2 A;  2K57 A;  1Q82 R;  3I9Q A;  2D9T A;  3M0P A;  3QYG B;  4XK8 E;  5C6S A;  1X69 A;  4F16 A;  5LJ5 e;  1AZG B;  2YLB A;  2K79 A;  1LVK A;  1S72 A;  3WXM B;  2EIF A;  2LX9 A;  4XAX B;  4LD6 A;  2KVQ G;  1K8A R;  2L3R A;  1X43 A;  1JB0 E;  2J06 A;  5KYW A;  5GAN e;  1YIJ Q;  2JTF A;  4CC7 A;  1K0X A;  3SHW A;  3G1J A;  2E64 A;  3UAT A;  2WAC A;  1GCQ A;  4DBF A;  5FLX E;  1VQO Q;  2A7Y A;  5GMK l;  1OPL A;  3CCL T;  3BY7 A;  1D1A A;  3JCM Q;  3I55 A;  2EGC A;  3GIB A;  1MGQ A;  2RN8 A;  1Q86 U;  1K4U S;  4ZGJ B;  3M56 A;  5D6W A;  3LGF A;  2H3J A;  5FU7 C;  4EPC A;  2O31 A;  3PVQ A;  3CQT A;  2OTL Q;  1D0X A;  2P4R A;  2E70 A;  3HL8 A;  3H0F A;  4PFO A;  2K5I A;  1WQ7 A;  2VAS A;  4FM4 B;  4E6R A;  4N0A A;  3OMG A;  1QP3 A;  1KSW A;  2GCX A;  5ECA A;  1TU0 B;  3CC4 Q;  3WVD B;  4JS5 A;  1WI7 A;  1KD1 R;  3CC2 T;  1I1J A;  1MMD A;  5IXF A;  4KUI A;  2DXC A;  3QYH B;  5KE3 A;  3QDF A;  1NEB A;  2JZ2 A;  2PUK B;  2G3R A;  4FT4 A;  1EFN A;  4Z89 A;  1TUD A;  3R6N A;  3FEO A;  3QO3 A;  3GF5 A;  4CC4 B;  4C8Q F;  2ESW A;  3SD4 A;  2VC8 A; 
#chains in the Genus database with same CATH homology
 1RI0 A;  1AHJ B;  1BI2 A;  4VUB A;  3FDR A;  3L2R A;  2QA4 A;  4MZT A;  4IUQ A;  3R6O A;  2MF2 A;  3WVE B;  1YCY A;  1ZQ1 A;  2LDM A;  4F7U A;  1YJ9 A;  3JCM e;  3TRE A;  1WJS A;  3P8D A;  4C92 G;  4ZN1 A;  3CCS T;  4EMK B;  1DJ7 B;  2ZPI B;  4M7A E;  1X6O A;  2K4Y A;  3M9Q A;  4XQ3 A;  1BYM A;  5GAO n;  3JAM E;  2NLU A;  4MMK A;  5GAN 4;  4PNO A;  5LJ3 d;  2VUB A;  5GAN 5;  1YJN A;  4V2S A;  4M78 G;  3I55 T;  2RI2 A;  4M7D F;  4C0Z A;  1M1K C;  3OYB A;  1YBY A;  4C8Q B;  4X9D A;  1NJI U;  2JVV A;  1KQ1 A;  4BI4 A;  3JB9 F;  1Y71 A;  5GAN 6;  2LVM A;  1KC8 U;  4FIB A;  3FC3 A;  3J7A F;  3HHT B;  2I2L A;  1GXI E;  2CGH A;  2E10 A;  4E47 A;  2LCC A;  3JSC A;  4M75 F;  3CPW S;  2KY9 A;  5GAN d;  2KAF A;  4OVA A;  1I8F A;  4EDU A;  2PUO B;  2RB6 A;  2E6N A;  2QDY B;  5J39 A;  5CKD A;  4M77 E;  4EMK C;  4C0D B;  3JCM f;  2RI5 A;  4QQG A;  3V7C A;  4HA8 A;  4F7U G;  3J81 E;  3OYD A;  2O4X A;  1K8A U;  2JNG A;  4ZGE B;  4RMO A;  3OSS C;  4M7D B;  4LDV A;  5CK9 A;  3HFO A;  5HK0 A;  2RJD A;  3MP6 A;  5CVI A;  4A4F A;  3MET A;  2PVD B;  2QQB A;  4IUP A;  3VYG A;  4WF2 A;  5A0D A;  1I5L A;  3CC2 A;  3SWN B;  3MP8 A;  4PLI A;  2XG8 D;  4YTL A;  2VXE A;  1VQN A;  4HKE A;  2ZPE B;  1YI2 T;  3JCM g;  1VQK T;  2M1H A;  2X4W A;  2DO3 A;  1NE8 A;  3OY9 A;  4M75 B;  3JB9 J;  1H64 1;  3M54 A;  1R8O B;  2DKG A;  4XU3 A;  4M7A G;  4MZP A;  1G3W A;  3S3N A;  5GAM j;  3G6E A;  2E41 A;  2GF7 A;  3M59 A;  3V7R A;  3CCR T;  5FU7 B;  1I81 A;  2BUD A;  3HRS A;  4A53 A;  1K73 U;  5FRN A;  3FJP A;  1QW1 A;  1D3B A;  2EQU A;  3QKJ A;  4BAC A;  1Y07 A;  5KE2 A;  4C8Q E;  2IG0 A;  3I56 A;  3GNG A;  3L2Q A;  3G71 A;  3AHU A;  5IT9 E;  3CCQ A;  2JN0 A;  4KT0 E;  3L42 A;  4C5G A;  2RHY A;  4BUG A;  2LNV A;  3E9F A;  3LX7 A;  4ZGD B;  3M57 A;  2HNI A;  4JDS A;  1YJ9 T;  1Q7Y U;  1LNX A;  4N4I A;  1Y7X A;  2HQE A;  2DAQ A;  1KQ2 A;  3OSV A;  5LJ3 f;  3C4S A;  2RD1 A;  3LW5 E;  1VQL A;  1YIJ A;  4JRP A;  2XDD A;  5LJ5 f;  5GAN 8;  5FU6 C;  3CD6 T;  4PJO A;  4M77 G;  4NL3 A;  4XTV A;  1FWZ A;  1U8R A;  2PVG B;  4BY6 B;  2HAX A;  1YJN T;  4PJO D;  2EQM A;  4EMH A;  4FSX A;  3HRT A;  1N8R C;  4QVZ A;  5LJ3 g;  3X26 B;  3OBW A;  4HCB A;  4PKC C;  4NL2 A;  3NFC A;  4QW2 A;  1VQO A;  1Y96 A;  2EWN A;  2L89 A;  2XDP A;  3A8G B;  3CPW A;  2PQW A;  2DXU A;  3KBG A;  3PGG A;  4ME7 A;  5DY9 A;  2EKO A;  5GAN f;  1UGS B;  3CCV A;  3OW2 S;  1KD1 U;  2WSF E;  2DXT A;  3S6W A;  4C92 C;  4BDZ A;  2PU9 B;  2DXB A;  1WJQ A;  2RM4 A;  2E1H A;  5GAO m;  5KH6 A;  2QEX T;  4C92 A;  2O01 E;  2E65 A;  3X24 B;  5GAN g;  1WQW A;  4C92 D;  3LH0 A;  1Q81 C;  4M78 C;  5AYF A;  2CYZ B;  2EFI A;  1VQN T;  4LDW A;  3VKI A;  5M9O A;  2EJF A;  3X20 B;  1N6A A;  1VQK A;  1G5V A;  4M78 A;  2DZ9 A;  3SB2 A;  2LCL A;  1KG1 A;  1K9M C;  4PJO G;  2FHD A;  3VV0 A;  2CZ1 B;  2R58 A;  4PL6 A;  3JCM W;  5GMK m;  1QVP A;  2ZGW A;  2DIG A;  4M78 D;  5GAN 7;  2KMT A;  3OB9 A;  2EAY A;  2LQ8 A;  2E5Q A;  2LC4 A;  3KUF A;  2JOY A;  2X4J A;  4XTY A;  1SSF A;  3BW1 A;  4R56 A;  2VYT A;  4JUV A;  4O5V A;  4RCB A;  1B34 B;  1KHI A;  2R5A A;  3MHX A;  4J6X A;  3RKY A;  2CZ6 B;  3G6E T;  4ZN3 A;  2V8J A;  1NZ9 A;  3V8J A;  3BDL A;  4XU0 A;  3PNW C;  2QXF A;  4J8O A;  3OYJ A;  2C06 A;  1X01 A;  3OYA A;  1N8R U;  2QQS A;  3JCM c;  1YJW A;  1NPP A;  2RHX A;  2RO0 A;  4EMG A;  3HKS A;  2LRQ A;  3CBP A;  3DKM A;  3P8B B;  4X9C A;  2YLC A;  4FU6 A;  5GAN 3;  3JCM P;  3I56 T;  3G71 T;  3QZ5 B;  2P0K A;  2O4X B;  3OMC A;  3CCQ T;  1XNI A;  1KHC A;  5D6Y A;  2YRV A;  3ER0 A;  4GY5 A;  3CD6 A;  2RH2 A;  2EQK A;  2Y4Y A;  1IZ6 A;  1M5Q 1;  5J3B A;  3QBY A;  4M7A C;  4DOV A;  1VQL T;  1YIJ T;  2RJF A;  4OB2 B;  5IAY A;  3E19 A;  4OB3 B;  4M7A A;  2F5T X;  1Q81 U;  3OYH A;  2MMP A;  5LJ3 j;  4ZTF A;  4J7I A;  2X4Y A;  2QQ9 A;  3OS0 A;  4BD3 A;  5I2S A;  5LJ5 j;  4M7A D;  1VQ7 T;  2RJC A;  3A8L B;  4R55 A;  3OW2 A;  4TVR A;  1VQ6 T;  4CRI A;  2XI9 A;  1VQO T;  1W4S A;  4JLI A;  3PIO A;  1ZBX A;  1D3B B;  2PVO B;  2M0O A;  3N5B B;  2KQW A;  5D6X A;  2QEX A;  2HD0 A;  2JUF A;  3M55 A;  3CCV T;  2LT1 A;  3INZ A;  3DLM A;  4FT2 A;  2CKK A;  2E6Z A;  2L8D A;  2RHZ A;  5CQY A;  3JCM b;  5A2Q E;  5CIU A;  5GAN j;  5GAM h;  3S3M A;  2ZZD A;  4M77 C;  4E7H A;  3MCA B;  3VJP A;  1M9S A;  4JRQ A;  3RER A;  2L5Q A;  2OTL T;  3J80 E;  3M4G A;  3HPW A;  4C92 F;  4M77 A;  1M1G A;  2ZPH B;  5GAN 2;  3FIF A;  3OYE A;  4XTX A;  4M77 D;  2KDS A;  3A8H B;  5FU6 B;  3EFR A;  3HRU A;  2XK0 A;  5KCH A;  3CC7 A;  1QVF S;  2RJE A;  2XID A;  2XHC A;  3PIP A;  1VQ8 T;  3HFN A;  4NOY A;  3A8O B;  2MWP A;  3OYY A;  4M78 F;  4KUD K;  1Y96 B;  2QI2 A;  4ELZ C;  4IUU A;  4OB0 B;  1KQS S;  2OTJ A;  2DPP B;  1VIF A;  3UDC A;  2AHJ B;  3RKX A;  3X28 B;  3CBO A;  1BI3 A;  3CC4 T;  3FRN A;  1UGR B;  1M1K U;  2M9U A;  4HCC A;  3PT9 A;  4A4H A;  3ME9 A;  3OS1 A;  3JCM J;  2P0Q A;  3M53 A;  5CCA A;  4KBM B;  2P4T A;  4X34 A;  4C92 B;  2V8K A;  1YJW T;  1VQ4 A;  3OA6 A;  4OF1 A;  5GMK h;  4E7I A;  2EYQ A;  5GAM d;  3M58 A;  5LL6 S;  3RES A;  4IKF A;  3JB9 H;  3CMA T;  5GAO q;  4C8Q A;  3LWH A;  4PJO C;  3V7S A;  1U1S A;  3UWN A;  2DJZ A;  4OMF B;  3PMT A;  5CR2 A;  4M78 B;  4F7U F;  4XTU A;  3CXC S;  3GOX A;  4C8Q D;  2R5M A;  1VUB A;  5CAI A;  3G4S A;  1FXX A;  3OYN A;  2EQJ A;  3ASK A;  3C94 A;  1VQ7 A;  4ATO A;  3MEV A;  2DIQ A;  4M7D E;  4A4E A;  4MZM A;  4Q5W A;  5GMK j;  1VQ6 A;  4QVC A;  5CO7 A;  1VQM A;  4OGC A;  4A4G A;  3CCM T;  5L8R E;  3CCJ A;  4M7A F;  4UC4 A;  2BIV A;  3OYG A;  3X25 B;  3JCM h;  2XU8 A;  2LQK A;  3MO8 A;  4HCZ A;  4DQ2 A;  3QZ9 B;  4M75 E;  1I4K 1;  1XQH A;  1BI1 A;  3CBM A;  2K3Y A;  3BDU A;  2QQR A;  2K5L A;  4PLL A;  4QQD A;  3OYF A;  1OZ2 A;  3SWN A;  3TEE A;  4F7U B;  5GAM e;  1WPY A;  4JRK A;  3RUX A;  4ZTJ A;  1V29 B;  2R57 A;  3C95 A;  1W2B S;  2VV5 A;  3DB3 A;  2HBP A;  3RMS A;  3CPF A;  2OTL A;  1TH7 A;  2DTO A;  4GLK A;  3LYI A;  2E12 A;  2JTM A;  3GPL A;  2IVW A;  3RMQ A;  3M5A A;  4IUV A;  4MDW A;  3CCU A;  4J6Y A;  4L59 A;  2FB7 A;  4C8Q G;  3OYL A;  3L2Z A;  2V8I A;  5CKE A;  5HY6 A;  3P8H A;  1QVF A;  5CKB A;  1VIE A;  1ZHI A;  3OQ5 A;  3NTI A;  1VQ8 A;  2QTX A;  1QP2 A;  4M7A B;  3UT1 A;  1PSF A;  2P0P A;  3MP1 A;  3OBY A;  5DLQ E;  1KQS A;  2ZPB B;  3PMI A;  1M4Z A;  4M77 F;  4DOW A;  5GAO p;  3CC7 T;  4BE1 A;  2XDB A;  1N27 A;  3VYH B;  3CC4 A;  3EAE A;  3JB9 I;  2K3X A;  5HKC A;  2OTJ T;  4QQ6 A;  2XIC A;  2DEQ A;  2VXF A;  1VQ5 A;  1HK9 A;  1N9S A;  2DZC A;  3FLG A;  5A0G A;  3NTH A;  4M7D G;  1Q82 C;  2GQV A;  1FX7 A;  5LJ3 h;  1KC8 C;  2GFU A;  4JLG A;  3ZEH A;  4Y28 E;  1UGP B;  1OI1 A;  2HQX A;  4BE2 A;  1PSE A;  3L2W A;  5LJ5 h;  2RA2 A;  2D0Q B;  5A0L A;  3JB9 G;  3CMA A;  1N9R A;  4DA4 A;  1VQ4 T;  3QDR B;  3OS5 A;  1S72 T;  3CXC A;  1U1T A;  1G3T A;  4M75 G;  1G3S A;  3GNF B;  4M77 B;  4JS4 A;  3RIR A;  3F70 A;  3ZBD A;  3QJ6 A;  4J7F A;  4LDX A;  2KK4 A;  5GAM g;  4F7U E;  1EIF A;  3H6Z A;  4J5Y A;  4P5N A;  4E7L A;  1VQP T;  1QVG S;  1K8A C;  5C0M A;  2X4X A;  3JCM X;  3A8M B;  2X35 A;  3PFS A;  3CCE A;  1M90 C;  5GAN h;  3G4S T;  1IRE B;  3FB9 A;  3V8K A;  1G3Y A;  3QUI A;  3E9G A;  4PJO F;  4O6J A;  5EG2 A;  3CCM A;  3QPH A;  5FRM A;  4IUT A;  5HK3 A;  2MI6 A;  3SFM A;  2DTI A;  1K9M U;  2DK3 A;  4NS5 A;  3GP8 A;  3QII A;  4J83 A;  2BKD N;  3CCL A;  1VQM T;  1JBM A;  3QXE B;  2XKO C;  1XOV A;  4BB7 A;  4BI8 B;  3CCJ T;  3OS2 A;  4BE0 A;  4LDU A;  1W2B A;  1VQ9 A;  2RHU A;  5CQX A;  2WSC E;  4OP0 A;  3QJY A;  2FL7 A;  1BIB A;  5LJ5 d;  2A3L A;  1K73 C;  4XTW A;  1X75 C;  2RK2 A;  3VUZ A;  3CME A;  4XU1 A;  2DTH A;  4OGE A;  3DB4 A;  2FYK A;  1WGS A;  4BDY A;  1OYX A;  2ZCF B;  1Q82 U;  3TU4 K;  2GFA A;  2CZ7 B;  4PJO B;  3CCU T;  3KXT A;  2CS7 A;  3G7Z A;  1B34 A;  5I21 A;  1YIT T;  2DD4 A;  2ZPG B;  3C12 A;  3LLR A;  4Z02 A;  1Q7Y C;  4E7J A;  3A5Z B;  2MAM A;  4OB1 B;  3GLX A;  5GMK i;  1JJ2 S;  3UPU A;  4MML A;  2B8A A;  2DD5 A;  2MWO A;  2YHT A;  1LJO A;  5CKH A;  2OAU A;  1LOJ A;  5CKF A;  4B9W A;  1UEB A;  2F5K A;  2QQA A;  3EFS A;  4RG2 A;  1XTD A;  3L2V A;  2K57 A;  3TCJ A;  1Q86 C;  2D9T A;  4EMK A;  3HP9 A;  1M90 U;  3QYG B;  4XK8 E;  3VUB A;  5DLO A;  5LJ3 e;  3QHS A;  3QG1 A;  2LT4 A;  3LWI A;  5C6S A;  1VQ5 T;  5LJ5 e;  1RL2 A;  1M8V A;  2YLB A;  4BI3 A;  4L5G A;  4C5I A;  4C8Q C;  1YHQ A;  1S72 A;  3WXM B;  3QSU A;  1KD1 C;  3JCM V;  4XTZ A;  2EIF A;  4HT9 A;  2LX9 A;  4XAX B;  1QVG A;  1UB4 A;  2EJ9 A;  4N4G A;  2VGM A;  4LD6 A;  2KVQ G;  3VU3 C;  1VQP A;  1WJR A;  2L3R A;  3LGL A;  3ZFJ A;  5GAO l;  5IN1 A;  1JB0 E;  3URG A;  4ELY C;  4LDY A;  4L6V 5;  5GAN e;  1WNL A;  4RG8 A;  1BI0 A;  2LTO A;  2JTF A;  2E64 A;  4C0D C;  3DLL A;  4KUL A;  4A4K A;  3CCE T;  2D6F A;  3L1A A;  3CCS A;  3OYI A;  4PJO E;  3L2U A;  2WAC A;  4M7D C;  2QA4 T;  4JRI A;  4N4H A;  5DM7 R;  1MHN A;  2K5F A;  3V8L A;  3NTK A;  4D6W A;  4FL6 A;  5FLX E;  1BIA A;  3SWN C;  4M7D A;  2A7Y A;  5GMK l;  3CCL T;  4HT8 A;  3BY7 A;  5I2M A;  2RK1 A;  3SDZ A;  2RHI A;  3JCM Q;  3H8Z A;  4J6W A;  3I55 A;  3OYK A;  4M7D D;  1VQ9 T;  4M75 C;  3GIB A;  1MGQ A;  4CI0 C;  1Q86 U;  3S3O A;  5FRO A;  3JB9 D;  1JRI A;  2EJG A;  1O75 A;  3M56 A;  4M75 A;  3LGF A;  5D6W A;  3MEA A;  3CEY A;  4ZGJ B;  1NPR A;  2H3J A;  2CZ0 B;  2VGN A;  3OYC A;  2F69 A;  5FU7 C;  4LD9 K;  1P92 A;  1UGQ B;  4EPC A;  1YIT A;  3CME T;  3O8V A;  5LJ5 g;  4M75 D;  4C92 E;  1M1F A;  4RCC A;  1JJ2 A;  2Y90 A;  5KCO A;  2E70 A;  2RI3 A;  3HL8 A;  1BKB A;  2K5I A;  4N0A C;  2Y4X A;  1WQ7 A;  4FM4 B;  4Y91 A;  4M78 E;  4N0A A;  4C0F A;  3OMG A;  1QP3 A;  4C5H A;  1H3Z A;  4II1 A;  3HSB A;  5J26 A;  3JCM d;  3E1S A;  2GCX A;  2M16 A;  2DVE A;  1NJI C;  3M4Y A;  4C5E A;  3MEW A;  3WVD B;  4QVD A;  5GMK e;  4JS5 A;  1YI2 A;  4BY6 C;  5GAM f;  4MDX A;  3CC2 T;  4C0G A;  4A54 A;  2ZPF B;  4RKU E;  5GAO r;  4E7K A;  4KUI A;  2K2V A;  2DXC A;  3QYH B;  1YHQ T;  5KE3 A;  2WSE E;  3OYM A;  3T9N A;  2JZ2 A;  3CCR A;  3BFM A;  2PUK B;  1O9S A;  1HXD A;  3JRZ A;  4JJN K;  2G3R A;  3MEU A;  4FT4 A;  4IUR A;  2KSS A;  2FVU A;  3PTA A;  3FEO A;  3QO3 A;  2XD0 A;  1OZ3 A;  3GF5 A;  4B9X A;  4XU2 A;  4C8Q F;  3RKW A;  3Q1J A;  3SD4 A;  2VC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...