5CK9A

E. coli mazf form i
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
110
structure length
106
Chain Sequence
VSRYVPDMGDLIWVDFDPTKAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endoribonuclease MazF
publication title Substrate Recognition and Activity Regulation of the Escherichia coli mRNA Endonuclease MazF.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 27
structure length 106
sequence length 110
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2015-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ck9A00
5HK0A 1VUBA 2VUBA 3NFCA 4ELYC 1UB4A 5CKHA 3JSCA 5CO7A 5CK9A 5CR2A 4OF1A 3VUBA 1M1FA 2KMTA 4MZTA 3JRZA 4MZPA 5CKFA 2C06A 5CKDA 1NE8A 4VUBA 5HKCA 5CCAA 5DLOA 4HKEA 3HPWA 5CQXA 5HK3A 4ME7A 2MF2A 3G7ZA 1X75C 4ELZC 4MZMA 4MDXA 5CQYA 3TCJA 5CKEA 5CKBA
chains in the Genus database with same CATH superfamily
2NUPA 2V8JA 2VXFA 2YHTA 4MMKA 2RA2A 3QSUA 2DD5A 4M78D 4FW1A 2DAQA 1QVFP 2RI3A 1RAFB 2GGRA 4LUDA 1M3AA 2Y4XA 4XU1A 2RF0A 1GRIA 2HAXA 1OX8A 4MZMA 2HNIA 5FRMA 1VQ6A 2DXTA 2F2VA 2E5QA 2LX9A 3RERA 5ECAA 1VQ7T 3OW2S 4PJOC 1D09B 3PMTA 1B7TA 3PMIA 5IH2A 3M55A 4OB3B 1FX7A 3OMGA 5KYXB 2DM1A 3OS1A 3VS0A 4XK8E 1VQ4A 1QVGP 5IHNA 3MJXA 4HT8A 2DEQA 1VYTA 4IIMA 4XU0A 2EIFA 1QVGA 2WACA 1VQOA 2E3IA 1ZSZC 4P5NA 1MNEA 1ZA2B 1W70A 1N8RU 1WFWA 4ZN3A 2HDAA 2KNBB 3RR6A 2G6FX 2DEUA 4PJMA 3VUZA 2NUTA 3CC7Q 1Q81R 2PTKA 3V8JA 1LVKA 2CGHA 2CZ1B 3OYDA 2A0FB 3CCVT 5GANg 5D6YA 5A0GA 3CCVQ 3F70A 4J6WA 1VUBA 1UGPB 1W2BS 1ARKA 1AZEA 3P8HA 1NPPA 3O8VA 2NUPB 1D1AA 1UJYA 3I56A 1IGQA 2MPXC 2MK5A 1RAAB 2J7IA 1VOMA 3VV0A 2F2XA 3VS1A 1UE9A 1GFDA 1W2BA 1UEBA 1Y7XA 3V8LA 1K9MC 4ZNXA 3TREA 3V7SA 2JTEA 2G3RA 4M7DG 2KR3A 4ANJA 3VUBA 2KVQG 1H641 4MZPA 3HSBA 2DRMA 3UDCA 2C06A 2AZVA 5HKCA 4E47A 4Z88A 4O5VA 5LJ3h 4LE9A 3M5AA 2KY9A 3KUFA 1G3YA 2DXCA 3A8MB 4A4HA 4GY5A 4C0ZA 4C8QC 2OJ2A 5L8RE 3S3OA 2DPPB 1Z9ZA 2FRYA 1WQWA 4J6XA 1K73U 1M2VA 1QWEA 3VYHB 1LJOA 2K2VA 1XOVA 4BE2A 2VGMA 4OMNA 2EYZA 2NUTB 2M1HA 2RK2A 3A8HB 2V8IA 4BACA 4GLMA 1NEBA 5LJ3f 1WHHA 3PVLA 4LDYA 3VYGA 2RI2A 3M0SA 1W6XA 1JB0E 2I2LA 4BY6C 2CH4A 1G2BA 5CO7A 3PNWC 2JTFA 1BCOA 1SSFA 1OZ3A 5KYYA 2D0QB 4MMLA 1VQ9T 3QHSA 4HVVA 4KH1B 1VQ9Q 2KE9A 3M59A 3S6WA 1VQ5T 1R77A 1R0CB 3E1SA 1VQ5Q 4DOWA 1WHMA 2K5LA 4PJOG 4FIBA 2XDBA 4LNPA 1X2KA 4J6YA 1M1GA 4BB7A 2GBQA 2RK1A 4HCKA 1TTHB 4C0GA 4EMKA 3QYGB 3CCSA 2IPOB 3G71A 3M0RA 4F04B 3QO3A 2EYWA 2XICA 3I55A 2LCCA 1GCQA 2JZ2A 4JUVA 1Q7YU 3CMAT 1Y71A 3CMAQ 1HK9A 2OI3A 3OYNA 4OP0A 1M1KR 2QK0A 2R57A 2VB6A 1M2VB 4RTXA 1U1SA 1MV0B 2KI7A 3OYIA 4RMOA 3JB9J 5CQXA 2EVRA 1UGVA 5GAMj 4BE1A 2HSEB 1PKTA 4LDVA 1YJNA 4M7AF 2QQ9A 4JRIA 2D0NA 5DM7R 4FYVB 2KRMA 3WVDB 4RTYA 2EYYA 2CZ0B 5GAMd 5KYYB 3RIRA 3SFMA 1S72A 1VQ4T 1VYUA 1SSHA 4Y92A 1VQNA 1VQ4Q 2YWWA 1RL2A 2KYMA 3CEYA 1H92A 1IB8A 1WA7A 2QGFB 1VQOT 3CCQA 1VQOQ 2MI6A 3OYYA 5EC7A 2Y90A 2CYZB 4J7IA 4XTUA 4PFOA 4DEYA 2FRWA 2BE7D 1M8MA 2P4TA 2NWMA 1TUCA 2CT3A 2OTJA 2JXBA 6AT1B 3OS0A 1TU0B 4C5GA 5FU6B 3OYCA 4EMKB 2FO0A 4J83A 5HK3A 4JDSA 2DXUA 2EKHA 1Q81U 1BI1A 2DL8A 1GFCA 4M78C 4C8QG 1UECA 1YCSB 2YLCA 2IG0A 2YUNA 4FM4B 2NLUA 2KQWA 3EGXA 1NBEB 3I56T 3UPUA 2RH2A 2LRQA 3I56Q 2F1LA 4V2SA 2DJQA 2EFIA 4KT0E 2VKNA 3QZ5B 4BI3A 1BI0A 2CDTA 3H41A 3KBGA 2KGTA 4JLIA 3EHQA 4A63B 4RTUA 3H0HA 1PSEA 2D8HA 2EQKA 1PKSA 1HJDA 1NLPC 5CKFA 3Q1JA 1UHFA 2X4JA 4RTVA 4VUBA 2JT4A 1D0ZA 1D3BA 5GANj 2EWNA 2XD0A 2COZA 2YSQA 1NJIR 2H3EB 1WXTA 4AG2C 2RD1A 2RHZA 1KC8R 2F5TX 1WHKA 2Z0WA 2M0YA 1XQHA 4N4IA 3D7SB 4M77A 1JU5C 1OU9A 5GANd 2LP5A 1PC0A 3M4YA 2MCNA 1VYVA 3OBWA 4OB2B 1RUWA 2Y4YA 2PU9B 3URGA 3X28B 5HCKA 2O01E 3E2UA 4RKUE 1HD3A 3L42A 2VWFA 3C12A 3EGXB 2ROTA 3UT1A 5GMKl 5GANe 3OYKA 4KRTA 2KT8A 2RJEA 4XU3A 5C0MA 4C0DC 3CCET 2YUPA 3QBYA 3CCEQ 1JXOA 2LQ8A 2QEXA 2NUZA 4FSXA 4OMQA 1KFZA 4M7AE 4GLKA 1BB9A 3DB4A 3HRSA 5GAN6 2DKGA 2LNVA 2O31A 3RDVA 1Q82C 3VRZA 3GBQA 1N8RR 2RB6A 2EQUA 5CR2A 1X6OA 3RBBB 2KBTA 4IUUA 3OS5A 5GMKj 4PLIA 4A53A 3CCST 3CCSQ 1D3BB 4QVDA 3E9FA 4JJDA 3LYIA 2ZPBB 4HCCA 2K3YA 2LX7A 3CC2A 3I55T 2YT6A 4LN2A 5I21A 2LJ0A 3I55Q 3HFOA 5KCOA 2YUQA 4TVRA 1MMAA 2A37A 2J06A 4ZN1A 2CP6A 2H3JA 2V26A 4M77B 1KQ2A 3GPLA 4C92G 4XTYA 4J9EA 2RPNA 2RQUA 4L59A 1M1KU 1EZZB 5FRNA 4JJBA 5LJ5g 1WXUA 2R5AA 3OYJA 4HVUA 4M7AD 2FVUA 1YJNT 3CCRA 3OYFA 1YJNQ 4KGXB 2QXFA 2XU8A 3VS2A 2A28A 2KK4A 2PZ1A 1BIAA 5CK9A 5KH6A 4K11A 3TSZA 3CPWS 4J7FA 1YP5A 1Y96A 3C94A 4QQ6A 1X6BA 1ZUYA 3I35A 2R5MA 1OPKA 1KHIA 4A4GA 1VQLA 1Y0MA 4J8OA 3RKXA 1S72T 3LGLA 2CUBA 1VQNT 3GP8A 1S72Q 3CCJA 1U5SA 1VQNQ 4ESRA 3CPWP 1V29B 3CCQT 4DBQA 2JVVA 2VUBA 5J3BA 3CPWA 3EAEA 2CUDA 3CCQQ 3LWHA 2LVMA 1TS9A 2K5IA 4M7DA 1YBYA 1K8AC 3CC4T 2DIQA 4BI4A 3CC4Q 5GAN5 1XJWB 3C0CA 3WXMB 1I81A 4BDYA 2HKQB 4D6WA 1PNJA 3NTHA 2KRNA 2DE0X 4ATOA 4ME7A 4C92E 2O88A 4CC4B 3RNJA 8AT1B 4MDXA 3UATA 5GAN4 1YHQT 5IN1A 1YHQQ 4X9CA 4E7ZA 4JRPA 4AFZC 4EPCA 1S1NA 3CCLA 4BUGA 1I07A 5AT1B 1M3BA 1QCNA 1JJ2S 4PJLA 1EX4A 5GAMh 2CT4A 3OB9A 3OYBA 5IHKA 2M0OA 3PFSA 3SWNA 4M75F 1KQSS 2HSPA 3UA7A 2O9SA 1AWJA 3OYLA 2DVJA 3A8OB 4JS5A 3JCMW 1FMVA 2K3BA 2P0PA 1YITA 3M53A 1JJ2A 2DMOA 1RACB 1Q95G 1XNIA 1C6VX 2HBPA 3RMQA 2L89A 4JJCA 3X25B 3QG1A 4OMFB 3LH0A 1KD1U 2DBMA 1PRLC 4BE0A 1KQSA 2LQKA 1Y96B 1HSQA 1G83A 3GLXA 1FMKA 1X2QA 2RQWA 5A0LA 4PK4A 2D9TA 5GAMf 1A0NB 2VV5A 2M02A 2L8DA 2QG9B 1IHWA 1RLPC 5C6SA 3OYMA 5FU7C 1Q86C 5L23A 3H0FA 4PJOA 2O4XA 3BDLA 1KC8U 4M7DB 5J26A 3ASKA 1LNXA 1K76A 2E6ZA 2E12A 1UGQB 3CXCS 1M27C 1ZSZA 2ECZA 3OMCA 2OTLA 3JB9F 2X3XD 2M51A 1Q7YC 1MMDA 2QYZA 1K1ZA 1I1JA 1T0JA 2KDSA 2XG8D 1AHJB 1VQ7Q 3FC3A 1JBMA 3JRZA 3INZA 4X1VA 1K9AA 3H8ZA 2LMJA 2QEXT 1QCOA 2L3SA 4ZTJA 1N9RA 2QEXQ 2GQIA 2A3LA 3M58A 3OW2P 3FRNA 3SWNB 2K6DA 1I8FA 3OW2A 5J39A 2AKLA 4HXJA 2W10A 2HCKA 3L2RA 3OYAA 1FYNA 5GANh 1M3CA 1RLQC 3GF5A 3FIFA 4PKCC 4C5IA 2FL7A 2CP3A 4L5GA 5GJWB 2BZ8A 4F7UG 2DO3A 3M4GA 2AHJB 3CC2T 2E6NA 2ZAEA 3IQLA 5HK0A 3EG0A 3CC2Q 1WNLA 3QZ9B 2I0NA 2RHIA 3MHXA 4IIOA 2KYBA 4PJOB 1WZOA 2O4XB 1VQKA 1J3TA 4OMMA 4E7LA 1W2BP 1OU8A 5GANf 2K2MA 1K9MR 1X75C 2LJ1A 1OYXA 3DLLA 4C8QA 3CCRT 1ZSZB 1SKUB 2RHXA 3I5SA 3CCRQ 1N9SA 2NYSA 3RESA 3QUIA 4EMHA 3RUXA 2F2WA 1RAEB 3JB9G 2CSQA 2OX7A 2DX1A 1SHGA 2K4YA 4M75E 1QWFA 1VQLT 2H8HA 2ZPHB 4RUGA 3CCMA 1VQLQ 3CCJT 2ZPGB 1YIJA 3CCJQ 4JZ3A 1AZGB 1QKWA 3NHNA 3LH5A 2VGNA 4RG8A 1X01A 2W0ZA 3CD6A 4LUEA 1BKBA 2JUFA 5GMKh 1WLPB 4F7UE 1SPKA 3M57A 1UGRB 1I4K1 3MEUA 1ZA1B 2J6OA 3OY9A 1FMWA 1WHLA 1ZBJA 4JRKA 4FT4A 5LJ5j 4CRIA 1W1FA 2JTMA 4JLGA 3M56A 4C5EA 1YJ9A 4PFPA 1VQPT 4YTLA 1E7OA 2JM9A 1PRMC 1VQPQ 1SEMA 2DTIA 4IUTA 4NS5A 1ZUKA 4DOVA 5LJ5d 4OF1A 3CBOA 3BE3A 2JMCA 1AWXA 1OX9A 2COWA 3TSWA 2FZKB 4KUIA 3M0UA 3DLMA 2CP0A 4M75D 4N4GA 1KIKA 3EHRA 1U06A 1IREB 3R6OA 4C8QB 2GNCA 1YITT 4N0AC 4IURA 1YITQ 5LJ5e 1SF9A 2EQMA 1ZQ1A 4XTWA 2HKNA 1ZSGA 1LOJA 1QMCA 1KSWA 3FDRA 4IUQA 1KQ1A 3CQTA 5CIUA 3HTRA 1M90C 7AT1B 2LNHB 1KHCA 2L0AA 3QYHB 1UB4A 1TWBA 4KUDK 4Z8AA 4BY6B 3FEOA 2JJ9A 3EG2A 3PIOA 3LGFA 1TUDA 5GMKm 2GFAA 4HCZA 2X51A 2KAFA 1OI1A 4OGCA 4HA8A 4UC4A 3JB9D 3LLRA 2OTLT 5GAOp 1VQ6T 1W4SA 2OTLQ 1VQ6Q 2QQSA 2DF6A 2L5QA 3THKA 3SD4A 3EGDA 3GOXA 2P0QA 3A8LB 5KCHA 4QKUA 1WHJA 2RM4A 1WDXA 2QTXA 2HBWA 4M78A 3A8GB 3TEEA 2A7YA 2D8JA 4R55A 1D0YA 3GNFB 2EJGA 3WVEB 5GMKi 1QCFA 9ATCB 1ZHIA 1OPLA 2QAZA 3CMEA 4MDWA 2EGCA 2OAWA 4II1A 2PUOB 2VASA 4J9CA 4QVZA 5I22A 1UFFA 2ATCB 5CCAA 3DB3A 3FJ5A 1R8OB 4C92C 3EFOA 4F14A 4HVWA 2M16A 1QLYA 2EQIA 4BI8B 2GCXA 1N27A 4XQ3A 1YCYA 4FU6A 2QA4A 2RQRA 1UHCA 1AWWA 4MZTA 3JB9I 4LXCA 4J9HA 1VQKT 1NPRA 5GAN8 3QWXX 1VQKQ 2K57A 3L2UA 2AT1B 1GBRA 1ABQA 4D8DA 3OYGA 1BI3A 2L2PA 2YUOA 1BK2A 5FWBA 1K9MU 3NPFA 2AK5A 1MMNA 2FB7A 2EYQA 3MEAA 3DKMA 3ER0A 3QPHA 2CZ6B 1N5ZA 1KD1R 4Q5WA 1BI2A 5AYFA 3EGDB 2DL4A 4PL6A 2BIVA 4M7AG 1WJRA 2GTJA 3CCMT 3MP6A 1BBZA 3CCMQ 2VC8A 3G7ZA 2BZYA 1YIJT 2C0OA 2EKOA 1LCKA 2BZXA 4M78B 1YIJQ 1VQMA 1MHNA 2EPDA 3CD6T 3NFCA 1OQKA 3CD6Q 2KSSA 2COYA 3H9NA 3ZFJA 1EFNA 3FB9A 2QQRA 4D8KA 3UF4A 1UG1A 3P8BB 1B07A 2ZPIB 3ULRB 4OGEA 2YDLA 3EFOB 1YJ9T 2MIOA 2XK0A 1NJIC 1YJ9Q 4B9XA 3HP9A 1KG1A 1XTDA 3MKDA 1U8RA 2DA9A 1KC8C 4E7KA 5LL6S 2KEAA 1UUEA 2DL3A 4OB1B 2FZCB 3RMSA 5KYWA 2GTOA 3PIPA 1WGSA 2QTVA 4FYXB 1Q82R 3JCMc 2FYKA 1VIEA 1TUGB 1AVZC 2DBKA 2RQVA 5I2MA 2FG0A 3JCMV 4ZTFA 5GAOr 1AOJA 1YWOA 1WX6A 2ED0A 4WF2A 1TH7A 4WTOB 2E5KA 2PQWA 2IVWA 2F69A 1PD1A 4PLLA 2JS2A 4RTTA 1GCPA 2ESWA 4E7IA 5I11A 2EQJA 1OZ2A 2RJCA 1JEGA 1G3SA 3G71T 3NGPA 3G71Q 2ZPFB 3X26B 1YN8A 2DXBA 3CCUA 1NG2A 3MCAB 2PNIA 3CBMA 1N8RC 2E10A 2E41A 5LJ5h 3MEWA 4C0DB 1YWPA 3CC7A 2K5FA 5FWCA 3JCMg 4A4FA 1HXDA 2DYBA 2E64A 1OEBA 3VS6A 2D1XA 4AT1B 5GAOl 1JRIA 4M4ZA 2C0IA 1OOTA 4ELYC 4IUVA 4E6RA 1PSFA 1BU1A 2RN8A 2CSIA 4M75C 1MV3A 2YRDA 1B34A 1FWZA 1K0XA 1IXDA 4HKEA 5FROA 5LJ5f 1NLOC 4LDXA 4FCYA 5KYWB 3H6ZA 3JCMX 4M77F 3R6NA 2DL5A 3HKSA 4LDUA 3L2ZA 2P4RA 4RTZA 1NYFA 1UDLA 5HY6A 5KE2A 2OAUA 2LQNA 1P92A 2CKKA 3REAB 5GAN7 2OTJT 2DIGA 3T9NA 2OTJQ 1WYXA 2HZYA 2WSCE 2PUKB 2XKOC 2LJ3A 4HCBA 1QKXA 3C95A 1ZLMA 2ENMA 4PJNA 4DA4A 2QA4T 1U3OA 2L3QA 5GAOq 1LPLA 1PD0A 3RKWA 1K73C 4C5HA 2E65A 2DVEA 1GBQA 2O2OA 3OYHA 2RNAA 3J81E 2QQBA 2MF2A 4F7UB 3TQ7P 2CZ7B 4ZGDB 2ABLA 1JJ2P 4AG1C 2KRSA 4A4KA 3QJ6A 2KROA 2XHCA 3AT1B 2AZSA 2LCLA 3M54A 2J6FA 4OMLA 3SDZA 2ED1A 4J9BA 1KQSP 3A98A 2ZCFB 5DLOA 1B34B 1BYMA 2P84A 2DZCA 4LD9K 4QVCA 1VQMT 5CQYA 1Q86R 2VXEA 4DBFA 3QWYA 2LTOA 1VQMQ 2RO0A 4XU2A 1WIEA 5CKHA 1TOVA 2JMAA 3OS2A 4DQ2A 1G5VA 3EFSA 4CI0C 2AKKA 2DNUA 3OA6A 1WXBA 3I5RA 1PCXA 1SHFA 1D1CA 2FEIA 2LCSA 3E19A 1QVFS 1M2OA 1NZ9A 3VS3A 3V7RA 4F16A 4J9FA 3MP8A 1X27A 4WCIA 3CMAA 3OSSC 2EW3A 5IXBA 2JOYA 2DK3A 3MO8A 2EJFA 2K9GA 1YFNA 3CXCP 2J6KA 3CXCA 1X43A 1QVFA 2L3RA 5FLXE 3N5BB 3EH2A 4LDWA 3JV3A 4M7DF 1VQ8A 1M4ZA 1Q82U 2CP2A 4EMGA 2QASA 5FU7B 1QVGS 4M75G 1U1TA 5D6XA 2P0KA 3SB2A 1MNDA 2A36A 1WJQA 3V7CA 2M9UA 4M77E 4E7SA 1WHGA 2E1HA 2DL7A 3ZBDA 3GIBA 3CCUT 3CCUQ 4RG2A 2FPDA 3PT9A 1M1FA 2K79A 2ROLA 3CC7T 3TVTA 1M8VA 1G3TA 4XAXB 1IGUA 3HPWA 5M9OA 1Q81C 2RJFA 2JN0A 4AMCA 3L1AA 4O6JA 5CKEA 5CKBA 2HL3A 1SRMA 4OMOA 2FPFA 2GFUA 3S3MA 1YNZA 1AD5A 4GBQA 3S3NA 3JCMb 2WSEE 2RHYA 2K3XA 2EAYA 3ME9A 3REBB 4M77D 4PJOF 4ORZA 4RTWA 1QP3A 1SRLA 2JS0A 2E3HA 4AFUC 2C0TA 2LT4A 2X4YA 4BDZA 1K8AU 2XI9A 4IUPA 2QI2A 1YJWA 3FLGA 4IKFA 4EIKA 4AFQC 4FL6A 4M7AA 5KYUA 5A2QE 2X4XA 4R0KA 2MAMA 1PM3A 2WSFE 3JAME 4J9GA 4AFSC 4B6MA 1PHTA 1PG5B 2LZ6B 1CKAA 4ZGJB 4N0AA 3JCMd 5LJ3g 4KBMB 1RAGB 3CCLT 1QQJA 3CCLQ 3EGUA 4C0FA 1MGQA 4QW2A 4M7AC 5GAOn 1F1BB 3G4SA 1QP2A 4FW2A 1D1BA 1N6AA 3JCMe 8ATCB 2EGAA 1WJSA 2E70A 4XTXA 2YXYA 3SEMA 1KK7A 2MWOA 1CKBA 2QDYB 1PWTA 3CCEA 1YI2A 3VS5A 4M7DE 2X9HA 1M5Q1 3HHTB 1H3ZA 2HMAA 1DJ7B 5FW9A 4L6V5 5EG2A 1M90R 2SEMA 4ELZC 3G6EA 3H0IA 4HT9A 3PE0A 1UTIA 3O5ZA 4X34A 2PVDB 1Q86U 1AT1B 4OVAA 3JCMP 4KH0B 3BY7A 3QJYA 3MEVA 3HRTA 1AWOA 4C8QF 1NE8A 4M7AB 4NL2A 1V76A 5KYUB 4JRQA 4A54A 3SHWA 2DLPA 3M9QA 3MP1A 4KGZB 2VYTA 2CS7A 1RABB 4BD3A 3X24B 5KYNA 4XTVA 3V8KA 2B8AA 2DETA 2DD4A 1RI0A 4NOYA 1NEGA 3G1JA 1M1KC 4C92A 2J05A 1SG5A 4OB0B 2L3PA 5FU6C 2K7AA 4M7DD 4EMKC 3X20B 1HYOA 4RCBA 1VQ8T 1E6GA 1VQ8Q 4XTZA 2DRKA 2HQXA 2LT1A 2RHUA 4FT2A 1GCQC 1M9SA 3UWNA 1C0MA 2V1QA 1NYGA 3VKIA 2KMTA 4LD6A 2RJDA 2X3WD 4PJOE 2RQTA 2XDPA 4X9DA 4J5YA 3KFVA 2DZ9A 4CC3A 1EIFA 2DTHA 3GNGA 3TCJA 5GAOm 3QDFA 2ZPEB 3A1PA 3HL8A 3CC4A 1ZBXA 2ZGWA 2EJ9A 1M30A 5GAMe 5GAN3 2BUDA 3BFMA 4Y28E 2FPEA 1I0CA 1WQ7A 3EG9A 2X35A 1Y07A 1BIBA 5GJVB 1WI7A 2HQHA 1T3SA 2RI5A 1YHQA 3M0QA 4JJNK 4DEXA 1K4US 1TSFA 2CP5A 3U23A 4FYWB 1IZ6A 2DYIA 1RAHB 3HRUA 2YRVA 4A4EA 4Z89A 3M0PA 2XMFA 1MMGA 4E7JA 4J9IA 1D0XA 2GF7A 2PVGB 4C92B 4PJOD 2A08A 2XIDA 2XDDA 1VIFA 2VVKA 3NTKA 2X4WA 1TXQA 4DBRA 3JSCA 3VU3C 5D6WA 1KJWA 3A5ZB 2KXDA 1NM7A 1JO8A 1YJWT 1KD1C 2ZZDA 3CBPA 1UGSB 1YJWQ 4PNOA 4Y91A 1NJIU 2R58A 1ACMB 2PVOB 3VS7A 2CP7A 1ZUUA 2KXCA 1GXIE 4C92F 4CC7A 1Z9QA 4KULA 2MYSA 2O9VA 2LQWA 2EYXA 3NTIA 4C8QE 4PJJA 4ZGEB 1X69A 2MOXA 2YLBA 4M78F 3KXTA 3EG1A 4QT7A 3EFRA 2DFUA 3EG9B 5DLQE 1C1AA 3G4ST 1QW1A 3VRYA 3G4SQ 1T3LA 4PFZA 4QQDA 2YRCA 3L2VA 3JB9H 1RAIB 4E7HA 1VQ7A 4KGVB 4E2FB 1UJ0A 1OULA 1YI2T 2HD0A 4M77C 1YI2Q 3L2QA 4EDUA 1AEYA 2HEQA 3OYEA 3TU4K 2BTTA 3G6ET 4FYYB 4NL3A 1TG0A 3M0TA 1Y57A 3G6EQ 5LJ3j 3PTAA 1K0SA 2FHDA 3MPUB 3L2WA 1M90U 3P8DA 3JCMh 1GL5A 3QDRB 3QXEB 5IHIA 2D6FA 4M75A 4R56A 1IO6A 4C8QD 5GAN2 3JCMQ 4J9DA 1G3WA 5LJ3d 3NMZC 2V1RA 3OBYA 3CCVA 3LWIA 4F7UA 3E9GA 1JXMA 4OMPA 2LC4A 3HFNA 4Z02A 1T0HA 5I2SA 4QQGA 2HQEA 4DBHA 1WPYA 5CVIA 1B3QA 2QDLA 2MMPA 3JCMf 5KE3A 5LJ3e 1O75A 2V8KA 4M78G 2JM8A 3ZL7C 4B9WA 1FXXA 5GMKe 1BCMA 1MUZA 2DILA 3BDUA 1K8AR 3PVQA 2LDMA 2DERA 3CMET 3QIIA 3CMEQ 2HL5C 2QQAA 1R0BG 1V1CA 2CREA 1OV3A 5CKDA 4F17A 2E4HA 3RKYA 3VS4A 3EG3A 3OSVA 2CH4W 2IIMA 1IHVA 2BE9B 5IAYA 1K73R 1I5OB 1H3HA 2QA4Q 1IRXA 4FSSA 3PGGA 4M75B 2RMOA 2DTOA 1RI9A 1E6HA 1VQPA 1O9SA 3OQ5A 3CPFA 5CAIA 4M78E 3ZEHA 5D7UA 1QVPA 1X6GA 2MWPA 3FJPA 2EGEA 1ABOA 2BKDN 3AHUA 2SRCA 4M7DC 1VA7A 2GQVA 3EH1A 3C4SA 3J80E 5KYXA 1H8KA 2QGGA 2FZGB 2F5KA 4RCCA 2KT1A 3JCMJ 2B86A 4JPBW 5DY9A 1G8XA 2JNGA 3J7AF 5IXFA 3META 1VQ9A 3VJPA 2DJZA 3QKJA 1CSKA 1VQ5A 5GAMg 3LX7A 4CC2A 2AIRB 4JZ4A 1RADB 4M77G 5A0DA 3UA6A 1I5LA 4F7UF 3I9QA 3LW5E 1ZX6A 1JQQA 3BW1A 4N4HA 2EBPA 5IT9E 1Q7YR 2JW4A 3SWNC 4JS4A 4C92D
chains in the Genus database with same CATH topology
1N27A 4XQ3A 4N0AA 1YCYA 5I21A 3JCMd 5LJ3g 3HFOA 4FU6A 2QA4A 2V8JA 2VXFA 2YHTA 5KCOA 4MMKA 2RA2A 4KBMB 4TVRA 3QSUA 2DD5A 3CCLT 4M78D 4ZN1A 2H3JA 4MZTA 4M77B 3JB9I 3GPLA 2DAQA 1KQ2A 4C92G 1VQKT 4XTYA 4C0FA 2RI3A 1MGQA 1NPRA 5GAN8 1M1KU 4L59A 4QW2A 2K57A 4M7AC 3L2UA 2Y4XA 4XU1A 5GAOn 5FRNA 5LJ5g 3OYGA 1BI3A 3G4SA 2HAXA 1QP2A 4MZMA 1N6AA 2HNIA 2R5AA 5FRMA 3OYJA 3JCMe 1VQ6A 2DXTA 4M7AD 2FVUA 1YJNT 1K9MU 3CCRA 1WJSA 2E70A 4XTXA 2E5QA 2FB7A 2EYQA 2LX9A 3MEAA 3OYFA 1VQ7T 3RERA 3DKMA 3ER0A 3QPHA 2CZ6B 2QXFA 3OW2S 2XU8A 2KK4A 4M7DB 2MWOA 1BIAA 4Q5WA 5CK9A 2QDYB 5KH6A 1BI2A 5AYFA 4PJOC 3CCEA 1YI2A 3CPWS 4J7FA 3PMTA 3C94A 1Y96A 4PL6A 4M7DE 4QQ6A 2BIVA 4M7AG 3PMIA 1WJRA 3M55A 1M5Q1 4OB3B 1FX7A 3OMGA 2R5MA 1KHIA 3HHTB 4A4GA 1VQLA 4J8OA 3RKXA 3OS1A 3CCMT 1S72T 1DJ7B 3LGLA 1VQ4A 3MP6A 4XK8E 1VQNT 3GP8A 4L6V5 3CCJA 4HT8A 5EG2A 2VC8A 3G7ZA 1YIJT 4ELZC 2DEQA 3G6EA 2EKOA 4XU0A 2EIFA 4HT9A 4M78B 1VQMA 1QVGA 2WACA 1VQOA 1MHNA 1V29B 3CCQT 2JVVA 3CD6T 2VUBA 3NFCA 5J3BA 3CPWA 3EAEA 4P5NA 2LVMA 3LWHA 2K5IA 2KSSA 2PVDB 4X34A 1Q86U 1YBYA 4OVAA 3ZFJA 1K8AC 4M7DA 3JCMP 3CC4T 1N8RU 3FB9A 4ZN3A 2DIQA 2QQRA 3BY7A 3QJYA 3MEVA 4BI4A 5GAN5 3WXMB 3HRTA 3VUZA 1I81A 4C8QF 4BDYA 3P8BB 1NE8A 4D6WA 3V8JA 2ZPIB 3NTHA 4M7AB 4NL2A 4OGEA 2CGHA 2CZ1B 4JRQA 3OYDA 4ATOA 4ME7A 3CCVT 4C92E 4A54A 5GANg 1YJ9T 5D6YA 2XK0A 5A0GA 3M9QA 3MP1A 1NJIC 4MDXA 3F70A 5GAN4 4J6WA 4B9XA 1YHQT 1VUBA 1UGPB 2VYTA 3HP9A 1W2BS 5IN1A 2CS7A 3P8HA 1XTDA 4X9CA 4BD3A 3X24B 1U8RA 1NPPA 4XTVA 3O8VA 3V8KA 4JRPA 1KC8C 4EPCA 3CCLA 2B8AA 4E7KA 3I56A 2DD4A 5LL6S 4BUGA 1RI0A 4NOYA 1JJ2S 4OB1B 1M1KC 4C92A 5GAMh 4OB0B 3RMSA 3VV0A 3PIPA 1WGSA 3OB9A 5FU6C 4M7DD 3OYBA 4EMKC 2M0OA 3X20B 4RCBA 1W2BA 1VQ8T 3PFSA 3SWNA 4M75F 1KQSS 1UEBA 4XTZA 1Y7XA 3JCMc 2FYKA 1VIEA 2HQXA 3V8LA 3OYLA 1K9MC 2LT1A 2RHUA 3A8OB 5I2MA 4JS5A 4FT2A 3TREA 3JCMW 2P0PA 3V7SA 1YITA 3JCMV 4ZTFA 5GAOr 2G3RA 1M9SA 3M53A 1JJ2A 4WF2A 4M7DG 1XNIA 3UWNA 2HBPA 1TH7A 3RMQA 2PQWA 2IVWA 2L89A 3X25B 2F69A 3VKIA 3VUBA 2KMTA 2KVQG 3QG1A 1H641 4LD6A 4OMFB 2RJDA 4MZPA 4PLLA 3HSBA 3LH0A 1KD1U 3UDCA 4PJOE 2C06A 4E7IA 4BE0A 1KQSA 2LQKA 1Y96B 2EQJA 5HKCA 2XDPA 1KG1A 4E47A 3GLXA 1OZ2A 4O5VA 4X9DA 2RJCA 5LJ3h 4J5YA 2DZ9A 1G3SA 1EIFA 2KY9A 3M5AA 2DTHA 5A0LA 3G71T 3KUFA 3GNGA 1G3YA 2D9TA 5GAMf 2DXCA 2ZPFB 3A8MB 3TCJA 2VV5A 3X26B 4A4HA 4GY5A 4C0ZA 2L8DA 2DXBA 4C8QC 5C6SA 3CCUA 5GAOm 3OYMA 5FU7C 1Q86C 5L8RE 3S3OA 2DPPB 3MCAB 3CBMA 2ZPEB 3CC4A 3HL8A 2O4XA 2E10A 3BDLA 1ZBXA 2E41A 1WQWA 2ZGWA 2EJ9A 4J6XA 5LJ5h 1K73U 1KC8U 5J26A 3MEWA 4C0DB 3VYHB 5GAMe 3ASKA 2K5FA 5GAN3 2BUDA 3CC7A 1LJOA 2K2VA 3BFMA 1XOVA 4Y28E 1LNXA 2VGMA 3JCMg 4BE2A 4A4FA 1HXDA 1WQ7A 2E64A 2E6ZA 2M1HA 2RK2A 2X35A 3A8HB 2E12A 1Y07A 1BIBA 1UGQB 2V8IA 3CXCS 4BACA 5GAOl 1JRIA 3JB9F 2RI5A 3OMCA 2OTLA 1YHQA 5LJ3f 1Q7YC 4JJNK 4LDYA 3VYGA 2RI2A 2KDSA 4ELYC 1JB0E 4IUVA 2I2LA 2XG8D 1AHJB 4BY6C 1PSFA 5CO7A 3PNWC 2JTFA 1IZ6A 3FC3A 1JBMA 1SSFA 1OZ3A 2YRVA 3HRUA 3JRZA 4M75C 4A4EA 3INZA 4E7JA 1B34A 1FWZA 3H8ZA 4HKEA 2QEXT 2GF7A 2PVGB 5FROA 4C92B 5LJ5f 2D0QB 4ZTJA 4LDXA 4MMLA 2XIDA 1N9RA 3H6ZA 4PJOD 2A3LA 2XDDA 3M58A 3JCMX 1VQ9T 4M77F 1VIFA 3QHSA 3FRNA 3SWNB 3M59A 1I8FA 3S6WA 1VQ5T 3OW2A 3NTKA 3HKSA 4LDUA 3E1SA 2X4WA 3L2ZA 4DOWA 5J39A 2K5LA 3JSCA 4PJOG 5HY6A 5KE2A 3VU3C 4FIBA 2XDBA 5D6WA 3L2RA 3A5ZB 3OYAA 5GANh 2OAUA 4J6YA 1YJWT 1P92A 1M1GA 1KD1C 2CKKA 2ZZDA 3CBPA 4BB7A 5GAN7 1UGSB 2RK1A 2OTJT 2DIGA 3T9NA 4PNOA 3GF5A 3FIFA 4C0GA 4EMKA 3QYGB 4Y91A 3CCSA 1NJIU 2R58A 2PVOB 2WSCE 4PKCC 4C5IA 2PUKB 3G71A 2FL7A 4L5GA 2XKOC 4F7UG 2DO3A 3M4GA 2AHJB 3CC2T 2E6NA 3QO3A 4HCBA 3C95A 2XICA 3I55A 5HK0A 1GXIE 2LCCA 4C92F 4KULA 2JZ2A 1WNLA 4JUVA 2QA4T 4DA4A 1Q7YU 3QZ9B 3CMAT 5GAOq 3NTIA 4C8QE 2RHIA 1Y71A 3MHXA 3RKWA 1HK9A 4C5HA 4ZGEB 1K73C 3OYNA 4OP0A 2YLBA 4M78F 4PJOB 2E65A 2O4XB 2DVEA 2R57A 3KXTA 1VQKA 3OYHA 1U1SA 4E7LA 3EFRA 3OYIA 3J81E 4RMOA 3JB9J 2QQBA 5GANf 5CQXA 5DLQE 3G4ST 2MF2A 1QW1A 1X75C 5GAMj 4BE1A 1OYXA 3DLLA 4C8QA 4F7UB 2CZ7B 3CCRT 4QQDA 4LDVA 4ZGDB 1YJNA 4M7AF 4A4KA 3L2VA 2QQ9A 2RHXA 3QJ6A 3JB9H 4JRIA 1N9SA 3RESA 3QUIA 4EMHA 4E7HA 2XHCA 5DM7R 1VQ7A 3RUXA 2LCLA 3M54A 3JB9G 3SDZA 3WVDB 1YI2T 2HD0A 4M77C 2CZ0B 2K4YA 3L2QA 4EDUA 2ZCFB 5GAMd 4M75E 5DLOA 1B34B 1VQLT 3RIRA 2ZPHB 3SFMA 1BYMA 1S72A 3OYEA 3CCMA 3TU4K 1VQ4T 3CCJT 1VQNA 2ZPGB 2DZCA 1RL2A 3CEYA 3G6ET 1YIJA 4NL3A 4LD9K 4QVCA 1VQMT 5CQYA 1VQOT 5LJ3j 2VXEA 3PTAA 2VGNA 2FHDA 2LTOA 4RG8A 3L2WA 1X01A 3CCQA 1M90U 2MI6A 3CD6A 3OYYA 3P8DA 2RO0A 1BKBA 2JUFA 3JCMh 4XU2A 5GMKh 2Y90A 3QDRB 3QXEB 5CKHA 4F7UE 3M57A 2CYZB 2D6FA 1UGRB 1I4K1 3MEUA 4J7IA 4M75A 4XTUA 4R56A 3OS2A 2P4TA 4DQ2A 1G5VA 3EFSA 4C8QD 5GAN2 3OY9A 4CI0C 2OTJA 3JCMQ 3OA6A 4JRKA 3OS0A 1G3WA 4FT4A 5LJ5j 5LJ3d 5FU6B 4C5GA 4CRIA 2JTMA 3OYCA 4JLGA 4EMKB 4J83A 5HK3A 4JDSA 3OBYA 3M56A 2DXUA 4C5EA 3CCVA 1YJ9A 3E19A 3LWIA 1BI1A 1NZ9A 1Q81U 1QVFS 3V7RA 1VQPT 4PJOA 4F7UA 4M78C 4C8QG 3MP8A 3E9GA 4YTLA 2LC4A 2YLCA 2IG0A 3HFNA 4FM4B 4Z02A 2NLUA 2DTIA 2KQWA 4IUTA 4NS5A 3CMAA 5I2SA 4QQGA 2HQEA 3OSSC 4DOVA 2JOYA 2DK3A 1WPYA 3MO8A 5CVIA 3I56T 5LJ5d 4OF1A 3UPUA 2EJFA 3CBOA 2MMPA 2RH2A 2LRQA 3JCMf 1N8RC 5KE3A 5LJ3e 3CXCA 1QVFA 2L3RA 1O75A 4KUIA 4V2SA 2V8KA 2EFIA 5FLXE 3N5BB 4KT0E 3DLMA 3QZ5B 4LDWA 4BI3A 4M78G 4M7DF 4M75D 1BI0A 1VQ8A 4N4GA 3KBGA 1H3ZA 1M4ZA 4B9WA 4JLIA 1FXXA 1IREB 5GMKe 1Q82U 3R6OA 4C8QB 1YITT 3BDUA 4EMGA 2LDMA 5FU7B 4N0AC 4IURA 1QVGS 5LJ5e 1PSEA 3CMET 2EQKA 4M75G 2EQMA 1ZQ1A 1U1TA 5D6XA 3QIIA 4XTWA 2P0KA 3SB2A 5CKFA 2QQAA 1WJQA 3V7CA 3Q1JA 2M9UA 2X4JA 5CKDA 1LOJA 4M77E 4VUBA 3RKYA 1D3BA 3OSVA 5GANj 2EWNA 2XD0A 2E1HA 3FDRA 4IUQA 1KQ1A 3ZBDA 2RD1A 2RHZA 3GIBA 5CIUA 5IAYA 1M90C 3CCUT 1KHCA 2F5TX 3QYHB 1UB4A 4KUDK 1XQHA 4N4IA 3FEOA 4BY6B 4RG2A 3PT9A 4M77A 1M1FA 5GANd 3PGGA 3CC7T 4M75B 3PIOA 3LGFA 3M4YA 5GMKm 2GFAA 4HCZA 1M8VA 3OBWA 1G3TA 4XAXB 4OB2B 2KAFA 1OI1A 2DTOA 4OGCA 2Y4YA 2PU9B 3URGA 3HPWA 4HA8A 5M9OA 3X28B 1Q81C 2RJFA 2JN0A 4UC4A 3JB9D 1VQPA 1O9SA 3L1AA 2O01E 3LLRA 3OQ5A 4O6JA 5GAOp 2OTLT 5CKEA 1VQ6T 5CKBA 1W4SA 4RKUE 3L42A 3CPFA 5CAIA 4M78E 3ZEHA 2QQSA 2L5QA 3SD4A 1QVPA 3C12A 2GFUA 3UT1A 5GMKl 5GANe 3OYKA 3S3MA 2MWPA 3GOXA 2P0QA 2RJEA 3A8LB 3FJPA 4XU3A 2BKDN 4M7DC 3AHUA 5C0MA 5KCHA 4C0DC 2GQVA 3CCET 3S3NA 3JCMb 3C4SA 3J80E 3QBYA 2RM4A 2WSEE 2RHYA 2LQ8A 2F5KA 4RCCA 2QEXA 2K3XA 3JCMJ 2EAYA 4FSXA 5DY9A 3ME9A 2JNGA 4M77D 4PJOF 3J7AF 2QTXA 3META 4M7AE 4M78A 1VQ9A 4GLKA 3A8GB 3TEEA 3DB4A 3HRSA 2DJZA 3QKJA 1QP3A 2A7YA 2DKGA 2LNVA 3VJPA 5GAN6 4R55A 1Q82C 1VQ5A 2LT4A 5GAMg 3GNFB 2EJGA 3WVEB 3LX7A 5GMKi 2RB6A 1ZHIA 2EQUA 2X4YA 3CMEA 4BDZA 4M77G 4MDWA 1K8AU 2XI9A 5A0DA 5CR2A 1I5LA 4II1A 1X6OA 4IUPA 2PUOB 4F7UF 2QI2A 4IUUA 3OS5A 5GMKj 3FLGA 3LW5E 4QVZA 1YJWA 4IKFA 4FL6A 4PLIA 4A53A 4M7AA 3BW1A 5CCAA 3CCST 3DB3A 5A2QE 2X4XA 4N4HA 1R8OB 4C92C 2M16A 1D3BB 4QVDA 2MAMA 2WSFE 3JAME 5IT9E 3E9FA 3LYIA 2ZPBB 3SWNC 2K3YA 4BI8B 4JS4A 3CC2A 4HCCA 4C92D 3I55T 4ZGJB 2GCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HK0 A;  1VUB A;  2VUB A;  3NFC A;  4ELY C;  1UB4 A;  5CKH A;  3JSC A;  5CO7 A;  5CK9 A;  5CR2 A;  4OF1 A;  3VUB A;  1M1F A;  2KMT A;  4MZT A;  3JRZ A;  4MZP A;  5CKF A;  2C06 A;  5CKD A;  1NE8 A;  4VUB A;  5HKC A;  5CCA A;  5DLO A;  4HKE A;  3HPW A;  5CQX A;  5HK3 A;  4ME7 A;  2MF2 A;  3G7Z A;  1X75 C;  4ELZ C;  4MZM A;  4MDX A;  5CQY A;  3TCJ A;  5CKE A;  5CKB A; 
#chains in the Genus database with same CATH topology
 2NUP A;  2V8J A;  2VXF A;  2YHT A;  4MMK A;  2RA2 A;  3QSU A;  2DD5 A;  4M78 D;  4FW1 A;  2DAQ A;  1QVF P;  2RI3 A;  1RAF B;  2GGR A;  4LUD A;  1M3A A;  2Y4X A;  4XU1 A;  2RF0 A;  1GRI A;  2HAX A;  1OX8 A;  4MZM A;  2HNI A;  5FRM A;  1VQ6 A;  2DXT A;  2F2V A;  2E5Q A;  2LX9 A;  3RER A;  5ECA A;  1VQ7 T;  3OW2 S;  4PJO C;  1D09 B;  3PMT A;  1B7T A;  3PMI A;  5IH2 A;  3M55 A;  4OB3 B;  1FX7 A;  3OMG A;  5KYX B;  2DM1 A;  3OS1 A;  3VS0 A;  4XK8 E;  1VQ4 A;  1QVG P;  5IHN A;  3MJX A;  4HT8 A;  2DEQ A;  1VYT A;  4IIM A;  4XU0 A;  2EIF A;  1QVG A;  2WAC A;  1VQO A;  2E3I A;  1ZSZ C;  4P5N A;  1MNE A;  1ZA2 B;  1W70 A;  1N8R U;  1WFW A;  4ZN3 A;  2HDA A;  2KNB B;  3RR6 A;  2G6F X;  2DEU A;  4PJM A;  3VUZ A;  2NUT A;  3CC7 Q;  1Q81 R;  2PTK A;  3V8J A;  1LVK A;  2CGH A;  2CZ1 B;  3OYD A;  2A0F B;  3CCV T;  5GAN g;  5D6Y A;  5A0G A;  3CCV Q;  3F70 A;  4J6W A;  1VUB A;  1UGP B;  1W2B S;  1ARK A;  1AZE A;  3P8H A;  1NPP A;  3O8V A;  2NUP B;  1D1A A;  1UJY A;  3I56 A;  1IGQ A;  2MPX C;  2MK5 A;  1RAA B;  2J7I A;  1VOM A;  3VV0 A;  2F2X A;  3VS1 A;  1UE9 A;  1GFD A;  1W2B A;  1UEB A;  1Y7X A;  3V8L A;  1K9M C;  4ZNX A;  3TRE A;  3V7S A;  2JTE A;  2G3R A;  4M7D G;  2KR3 A;  4ANJ A;  3VUB A;  2KVQ G;  1H64 1;  4MZP A;  3HSB A;  2DRM A;  3UDC A;  2C06 A;  2AZV A;  5HKC A;  4E47 A;  4Z88 A;  4O5V A;  5LJ3 h;  4LE9 A;  3M5A A;  2KY9 A;  3KUF A;  1G3Y A;  2DXC A;  3A8M B;  4A4H A;  4GY5 A;  4C0Z A;  4C8Q C;  2OJ2 A;  5L8R E;  3S3O A;  2DPP B;  1Z9Z A;  2FRY A;  1WQW A;  4J6X A;  1K73 U;  1M2V A;  1QWE A;  3VYH B;  1LJO A;  2K2V A;  1XOV A;  4BE2 A;  2VGM A;  4OMN A;  2EYZ A;  2NUT B;  2M1H A;  2RK2 A;  3A8H B;  2V8I A;  4BAC A;  4GLM A;  1NEB A;  5LJ3 f;  1WHH A;  3PVL A;  4LDY A;  3VYG A;  2RI2 A;  3M0S A;  1W6X A;  1JB0 E;  2I2L A;  4BY6 C;  2CH4 A;  1G2B A;  5CO7 A;  3PNW C;  2JTF A;  1BCO A;  1SSF A;  1OZ3 A;  5KYY A;  2D0Q B;  4MML A;  1VQ9 T;  3QHS A;  4HVV A;  4KH1 B;  1VQ9 Q;  2KE9 A;  3M59 A;  3S6W A;  1VQ5 T;  1R77 A;  1R0C B;  3E1S A;  1VQ5 Q;  4DOW A;  1WHM A;  2K5L A;  4PJO G;  4FIB A;  2XDB A;  4LNP A;  1X2K A;  4J6Y A;  1M1G A;  4BB7 A;  2GBQ A;  2RK1 A;  4HCK A;  1TTH B;  4C0G A;  4EMK A;  3QYG B;  3CCS A;  2IPO B;  3G71 A;  3M0R A;  4F04 B;  3QO3 A;  2EYW A;  2XIC A;  3I55 A;  2LCC A;  1GCQ A;  2JZ2 A;  4JUV A;  1Q7Y U;  3CMA T;  1Y71 A;  3CMA Q;  1HK9 A;  2OI3 A;  3OYN A;  4OP0 A;  1M1K R;  2QK0 A;  2R57 A;  2VB6 A;  1M2V B;  4RTX A;  1U1S A;  1MV0 B;  2KI7 A;  3OYI A;  4RMO A;  3JB9 J;  5CQX A;  2EVR A;  1UGV A;  5GAM j;  4BE1 A;  2HSE B;  1PKT A;  4LDV A;  1YJN A;  4M7A F;  2QQ9 A;  4JRI A;  2D0N A;  5DM7 R;  4FYV B;  2KRM A;  3WVD B;  4RTY A;  2EYY A;  2CZ0 B;  5GAM d;  5KYY B;  3RIR A;  3SFM A;  1S72 A;  1VQ4 T;  1VYU A;  1SSH A;  4Y92 A;  1VQN A;  1VQ4 Q;  2YWW A;  1RL2 A;  2KYM A;  3CEY A;  1H92 A;  1IB8 A;  1WA7 A;  2QGF B;  1VQO T;  3CCQ A;  1VQO Q;  2MI6 A;  3OYY A;  5EC7 A;  2Y90 A;  2CYZ B;  4J7I A;  4XTU A;  4PFO A;  4DEY A;  2FRW A;  2BE7 D;  1M8M A;  2P4T A;  2NWM A;  1TUC A;  2CT3 A;  2OTJ A;  2JXB A;  6AT1 B;  3OS0 A;  1TU0 B;  4C5G A;  5FU6 B;  3OYC A;  4EMK B;  2FO0 A;  4J83 A;  5HK3 A;  4JDS A;  2DXU A;  2EKH A;  1Q81 U;  1BI1 A;  2DL8 A;  1GFC A;  4M78 C;  4C8Q G;  1UEC A;  1YCS B;  2YLC A;  2IG0 A;  2YUN A;  4FM4 B;  2NLU A;  2KQW A;  3EGX A;  1NBE B;  3I56 T;  3UPU A;  2RH2 A;  2LRQ A;  3I56 Q;  2F1L A;  4V2S A;  2DJQ A;  2EFI A;  4KT0 E;  2VKN A;  3QZ5 B;  4BI3 A;  1BI0 A;  2CDT A;  3H41 A;  3KBG A;  2KGT A;  4JLI A;  3EHQ A;  4A63 B;  4RTU A;  3H0H A;  1PSE A;  2D8H A;  2EQK A;  1PKS A;  1HJD A;  1NLP C;  5CKF A;  3Q1J A;  1UHF A;  2X4J A;  4RTV A;  4VUB A;  2JT4 A;  1D0Z A;  1D3B A;  5GAN j;  2EWN A;  2XD0 A;  2COZ A;  2YSQ A;  1NJI R;  2H3E B;  1WXT A;  4AG2 C;  2RD1 A;  2RHZ A;  1KC8 R;  2F5T X;  1WHK A;  2Z0W A;  2M0Y A;  1XQH A;  4N4I A;  3D7S B;  4M77 A;  1JU5 C;  1OU9 A;  5GAN d;  2LP5 A;  1PC0 A;  3M4Y A;  2MCN A;  1VYV A;  3OBW A;  4OB2 B;  1RUW A;  2Y4Y A;  2PU9 B;  3URG A;  3X28 B;  5HCK A;  2O01 E;  3E2U A;  4RKU E;  1HD3 A;  3L42 A;  2VWF A;  3C12 A;  3EGX B;  2ROT A;  3UT1 A;  5GMK l;  5GAN e;  3OYK A;  4KRT A;  2KT8 A;  2RJE A;  4XU3 A;  5C0M A;  4C0D C;  3CCE T;  2YUP A;  3QBY A;  3CCE Q;  1JXO A;  2LQ8 A;  2QEX A;  2NUZ A;  4FSX A;  4OMQ A;  1KFZ A;  4M7A E;  4GLK A;  1BB9 A;  3DB4 A;  3HRS A;  5GAN 6;  2DKG A;  2LNV A;  2O31 A;  3RDV A;  1Q82 C;  3VRZ A;  3GBQ A;  1N8R R;  2RB6 A;  2EQU A;  5CR2 A;  1X6O A;  3RBB B;  2KBT A;  4IUU A;  3OS5 A;  5GMK j;  4PLI A;  4A53 A;  3CCS T;  3CCS Q;  1D3B B;  4QVD A;  3E9F A;  4JJD A;  3LYI A;  2ZPB B;  4HCC A;  2K3Y A;  2LX7 A;  3CC2 A;  3I55 T;  2YT6 A;  4LN2 A;  5I21 A;  2LJ0 A;  3I55 Q;  3HFO A;  5KCO A;  2YUQ A;  4TVR A;  1MMA A;  2A37 A;  2J06 A;  4ZN1 A;  2CP6 A;  2H3J A;  2V26 A;  4M77 B;  1KQ2 A;  3GPL A;  4C92 G;  4XTY A;  4J9E A;  2RPN A;  2RQU A;  4L59 A;  1M1K U;  1EZZ B;  5FRN A;  4JJB A;  5LJ5 g;  1WXU A;  2R5A A;  3OYJ A;  4HVU A;  4M7A D;  2FVU A;  1YJN T;  3CCR A;  3OYF A;  1YJN Q;  4KGX B;  2QXF A;  2XU8 A;  3VS2 A;  2A28 A;  2KK4 A;  2PZ1 A;  1BIA A;  5CK9 A;  5KH6 A;  4K11 A;  3TSZ A;  3CPW S;  4J7F A;  1YP5 A;  1Y96 A;  3C94 A;  4QQ6 A;  1X6B A;  1ZUY A;  3I35 A;  2R5M A;  1OPK A;  1KHI A;  4A4G A;  1VQL A;  1Y0M A;  4J8O A;  3RKX A;  1S72 T;  3LGL A;  2CUB A;  1VQN T;  3GP8 A;  1S72 Q;  3CCJ A;  1U5S A;  1VQN Q;  4ESR A;  3CPW P;  1V29 B;  3CCQ T;  4DBQ A;  2JVV A;  2VUB A;  5J3B A;  3CPW A;  3EAE A;  2CUD A;  3CCQ Q;  3LWH A;  2LVM A;  1TS9 A;  2K5I A;  4M7D A;  1YBY A;  1K8A C;  3CC4 T;  2DIQ A;  4BI4 A;  3CC4 Q;  5GAN 5;  1XJW B;  3C0C A;  3WXM B;  1I81 A;  4BDY A;  2HKQ B;  4D6W A;  1PNJ A;  3NTH A;  2KRN A;  2DE0 X;  4ATO A;  4ME7 A;  4C92 E;  2O88 A;  4CC4 B;  3RNJ A;  8AT1 B;  4MDX A;  3UAT A;  5GAN 4;  1YHQ T;  5IN1 A;  1YHQ Q;  4X9C A;  4E7Z A;  4JRP A;  4AFZ C;  4EPC A;  1S1N A;  3CCL A;  4BUG A;  1I07 A;  5AT1 B;  1M3B A;  1QCN A;  1JJ2 S;  4PJL A;  1EX4 A;  5GAM h;  2CT4 A;  3OB9 A;  3OYB A;  5IHK A;  2M0O A;  3PFS A;  3SWN A;  4M75 F;  1KQS S;  2HSP A;  3UA7 A;  2O9S A;  1AWJ A;  3OYL A;  2DVJ A;  3A8O B;  4JS5 A;  3JCM W;  1FMV A;  2K3B A;  2P0P A;  1YIT A;  3M53 A;  1JJ2 A;  2DMO A;  1RAC B;  1Q95 G;  1XNI A;  1C6V X;  2HBP A;  3RMQ A;  2L89 A;  4JJC A;  3X25 B;  3QG1 A;  4OMF B;  3LH0 A;  1KD1 U;  2DBM A;  1PRL C;  4BE0 A;  1KQS A;  2LQK A;  1Y96 B;  1HSQ A;  1G83 A;  3GLX A;  1FMK A;  1X2Q A;  2RQW A;  5A0L A;  4PK4 A;  2D9T A;  5GAM f;  1A0N B;  2VV5 A;  2M02 A;  2L8D A;  2QG9 B;  1IHW A;  1RLP C;  5C6S A;  3OYM A;  5FU7 C;  1Q86 C;  5L23 A;  3H0F A;  4PJO A;  2O4X A;  3BDL A;  1KC8 U;  4M7D B;  5J26 A;  3ASK A;  1LNX A;  1K76 A;  2E6Z A;  2E12 A;  1UGQ B;  3CXC S;  1M27 C;  1ZSZ A;  2ECZ A;  3OMC A;  2OTL A;  3JB9 F;  2X3X D;  2M51 A;  1Q7Y C;  1MMD A;  2QYZ A;  1K1Z A;  1I1J A;  1T0J A;  2KDS A;  2XG8 D;  1AHJ B;  1VQ7 Q;  3FC3 A;  1JBM A;  3JRZ A;  3INZ A;  4X1V A;  1K9A A;  3H8Z A;  2LMJ A;  2QEX T;  1QCO A;  2L3S A;  4ZTJ A;  1N9R A;  2QEX Q;  2GQI A;  2A3L A;  3M58 A;  3OW2 P;  3FRN A;  3SWN B;  2K6D A;  1I8F A;  3OW2 A;  5J39 A;  2AKL A;  4HXJ A;  2W10 A;  2HCK A;  3L2R A;  3OYA A;  1FYN A;  5GAN h;  1M3C A;  1RLQ C;  3GF5 A;  3FIF A;  4PKC C;  4C5I A;  2FL7 A;  2CP3 A;  4L5G A;  5GJW B;  2BZ8 A;  4F7U G;  2DO3 A;  3M4G A;  2AHJ B;  3CC2 T;  2E6N A;  2ZAE A;  3IQL A;  5HK0 A;  3EG0 A;  3CC2 Q;  1WNL A;  3QZ9 B;  2I0N A;  2RHI A;  3MHX A;  4IIO A;  2KYB A;  4PJO B;  1WZO A;  2O4X B;  1VQK A;  1J3T A;  4OMM A;  4E7L A;  1W2B P;  1OU8 A;  5GAN f;  2K2M A;  1K9M R;  1X75 C;  2LJ1 A;  1OYX A;  3DLL A;  4C8Q A;  3CCR T;  1ZSZ B;  1SKU B;  2RHX A;  3I5S A;  3CCR Q;  1N9S A;  2NYS A;  3RES A;  3QUI A;  4EMH A;  3RUX A;  2F2W A;  1RAE B;  3JB9 G;  2CSQ A;  2OX7 A;  2DX1 A;  1SHG A;  2K4Y A;  4M75 E;  1QWF A;  1VQL T;  2H8H A;  2ZPH B;  4RUG A;  3CCM A;  1VQL Q;  3CCJ T;  2ZPG B;  1YIJ A;  3CCJ Q;  4JZ3 A;  1AZG B;  1QKW A;  3NHN A;  3LH5 A;  2VGN A;  4RG8 A;  1X01 A;  2W0Z A;  3CD6 A;  4LUE A;  1BKB A;  2JUF A;  5GMK h;  1WLP B;  4F7U E;  1SPK A;  3M57 A;  1UGR B;  1I4K 1;  3MEU A;  1ZA1 B;  2J6O A;  3OY9 A;  1FMW A;  1WHL A;  1ZBJ A;  4JRK A;  4FT4 A;  5LJ5 j;  4CRI A;  1W1F A;  2JTM A;  4JLG A;  3M56 A;  4C5E A;  1YJ9 A;  4PFP A;  1VQP T;  4YTL A;  1E7O A;  2JM9 A;  1PRM C;  1VQP Q;  1SEM A;  2DTI A;  4IUT A;  4NS5 A;  1ZUK A;  4DOV A;  5LJ5 d;  4OF1 A;  3CBO A;  3BE3 A;  2JMC A;  1AWX A;  1OX9 A;  2COW A;  3TSW A;  2FZK B;  4KUI A;  3M0U A;  3DLM A;  2CP0 A;  4M75 D;  4N4G A;  1KIK A;  3EHR A;  1U06 A;  1IRE B;  3R6O A;  4C8Q B;  2GNC A;  1YIT T;  4N0A C;  4IUR A;  1YIT Q;  5LJ5 e;  1SF9 A;  2EQM A;  1ZQ1 A;  4XTW A;  2HKN A;  1ZSG A;  1LOJ A;  1QMC A;  1KSW A;  3FDR A;  4IUQ A;  1KQ1 A;  3CQT A;  5CIU A;  3HTR A;  1M90 C;  7AT1 B;  2LNH B;  1KHC A;  2L0A A;  3QYH B;  1UB4 A;  1TWB A;  4KUD K;  4Z8A A;  4BY6 B;  3FEO A;  2JJ9 A;  3EG2 A;  3PIO A;  3LGF A;  1TUD A;  5GMK m;  2GFA A;  4HCZ A;  2X51 A;  2KAF A;  1OI1 A;  4OGC A;  4HA8 A;  4UC4 A;  3JB9 D;  3LLR A;  2OTL T;  5GAO p;  1VQ6 T;  1W4S A;  2OTL Q;  1VQ6 Q;  2QQS A;  2DF6 A;  2L5Q A;  3THK A;  3SD4 A;  3EGD A;  3GOX A;  2P0Q A;  3A8L B;  5KCH A;  4QKU A;  1WHJ A;  2RM4 A;  1WDX A;  2QTX A;  2HBW A;  4M78 A;  3A8G B;  3TEE A;  2A7Y A;  2D8J A;  4R55 A;  1D0Y A;  3GNF B;  2EJG A;  3WVE B;  5GMK i;  1QCF A;  9ATC B;  1ZHI A;  1OPL A;  2QAZ A;  3CME A;  4MDW A;  2EGC A;  2OAW A;  4II1 A;  2PUO B;  2VAS A;  4J9C A;  4QVZ A;  5I22 A;  1UFF A;  2ATC B;  5CCA A;  3DB3 A;  3FJ5 A;  1R8O B;  4C92 C;  3EFO A;  4F14 A;  4HVW A;  2M16 A;  1QLY A;  2EQI A;  4BI8 B;  2GCX A;  1N27 A;  4XQ3 A;  1YCY A;  4FU6 A;  2QA4 A;  2RQR A;  1UHC A;  1AWW A;  4MZT A;  3JB9 I;  4LXC A;  4J9H A;  1VQK T;  1NPR A;  5GAN 8;  3QWX X;  1VQK Q;  2K57 A;  3L2U A;  2AT1 B;  1GBR A;  1ABQ A;  4D8D A;  3OYG A;  1BI3 A;  2L2P A;  2YUO A;  1BK2 A;  5FWB A;  1K9M U;  3NPF A;  2AK5 A;  1MMN A;  2FB7 A;  2EYQ A;  3MEA A;  3DKM A;  3ER0 A;  3QPH A;  2CZ6 B;  1N5Z A;  1KD1 R;  4Q5W A;  1BI2 A;  5AYF A;  3EGD B;  2DL4 A;  4PL6 A;  2BIV A;  4M7A G;  1WJR A;  2GTJ A;  3CCM T;  3MP6 A;  1BBZ A;  3CCM Q;  2VC8 A;  3G7Z A;  2BZY A;  1YIJ T;  2C0O A;  2EKO A;  1LCK A;  2BZX A;  4M78 B;  1YIJ Q;  1VQM A;  1MHN A;  2EPD A;  3CD6 T;  3NFC A;  1OQK A;  3CD6 Q;  2KSS A;  2COY A;  3H9N A;  3ZFJ A;  1EFN A;  3FB9 A;  2QQR A;  4D8K A;  3UF4 A;  1UG1 A;  3P8B B;  1B07 A;  2ZPI B;  3ULR B;  4OGE A;  2YDL A;  3EFO B;  1YJ9 T;  2MIO A;  2XK0 A;  1NJI C;  1YJ9 Q;  4B9X A;  3HP9 A;  1KG1 A;  1XTD A;  3MKD A;  1U8R A;  2DA9 A;  1KC8 C;  4E7K A;  5LL6 S;  2KEA A;  1UUE A;  2DL3 A;  4OB1 B;  2FZC B;  3RMS A;  5KYW A;  2GTO A;  3PIP A;  1WGS A;  2QTV A;  4FYX B;  1Q82 R;  3JCM c;  2FYK A;  1VIE A;  1TUG B;  1AVZ C;  2DBK A;  2RQV A;  5I2M A;  2FG0 A;  3JCM V;  4ZTF A;  5GAO r;  1AOJ A;  1YWO A;  1WX6 A;  2ED0 A;  4WF2 A;  1TH7 A;  4WTO B;  2E5K A;  2PQW A;  2IVW A;  2F69 A;  1PD1 A;  4PLL A;  2JS2 A;  4RTT A;  1GCP A;  2ESW A;  4E7I A;  5I11 A;  2EQJ A;  1OZ2 A;  2RJC A;  1JEG A;  1G3S A;  3G71 T;  3NGP A;  3G71 Q;  2ZPF B;  3X26 B;  1YN8 A;  2DXB A;  3CCU A;  1NG2 A;  3MCA B;  2PNI A;  3CBM A;  1N8R C;  2E10 A;  2E41 A;  5LJ5 h;  3MEW A;  4C0D B;  1YWP A;  3CC7 A;  2K5F A;  5FWC A;  3JCM g;  4A4F A;  1HXD A;  2DYB A;  2E64 A;  1OEB A;  3VS6 A;  2D1X A;  4AT1 B;  5GAO l;  1JRI A;  4M4Z A;  2C0I A;  1OOT A;  4ELY C;  4IUV A;  4E6R A;  1PSF A;  1BU1 A;  2RN8 A;  2CSI A;  4M75 C;  1MV3 A;  2YRD A;  1B34 A;  1FWZ A;  1K0X A;  1IXD A;  4HKE A;  5FRO A;  5LJ5 f;  1NLO C;  4LDX A;  4FCY A;  5KYW B;  3H6Z A;  3JCM X;  4M77 F;  3R6N A;  2DL5 A;  3HKS A;  4LDU A;  3L2Z A;  2P4R A;  4RTZ A;  1NYF A;  1UDL A;  5HY6 A;  5KE2 A;  2OAU A;  2LQN A;  1P92 A;  2CKK A;  3REA B;  5GAN 7;  2OTJ T;  2DIG A;  3T9N A;  2OTJ Q;  1WYX A;  2HZY A;  2WSC E;  2PUK B;  2XKO C;  2LJ3 A;  4HCB A;  1QKX A;  3C95 A;  1ZLM A;  2ENM A;  4PJN A;  4DA4 A;  2QA4 T;  1U3O A;  2L3Q A;  5GAO q;  1LPL A;  1PD0 A;  3RKW A;  1K73 C;  4C5H A;  2E65 A;  2DVE A;  1GBQ A;  2O2O A;  3OYH A;  2RNA A;  3J81 E;  2QQB A;  2MF2 A;  4F7U B;  3TQ7 P;  2CZ7 B;  4ZGD B;  2ABL A;  1JJ2 P;  4AG1 C;  2KRS A;  4A4K A;  3QJ6 A;  2KRO A;  2XHC A;  3AT1 B;  2AZS A;  2LCL A;  3M54 A;  2J6F A;  4OML A;  3SDZ A;  2ED1 A;  4J9B A;  1KQS P;  3A98 A;  2ZCF B;  5DLO A;  1B34 B;  1BYM A;  2P84 A;  2DZC A;  4LD9 K;  4QVC A;  1VQM T;  5CQY A;  1Q86 R;  2VXE A;  4DBF A;  3QWY A;  2LTO A;  1VQM Q;  2RO0 A;  4XU2 A;  1WIE A;  5CKH A;  1TOV A;  2JMA A;  3OS2 A;  4DQ2 A;  1G5V A;  3EFS A;  4CI0 C;  2AKK A;  2DNU A;  3OA6 A;  1WXB A;  3I5R A;  1PCX A;  1SHF A;  1D1C A;  2FEI A;  2LCS A;  3E19 A;  1QVF S;  1M2O A;  1NZ9 A;  3VS3 A;  3V7R A;  4F16 A;  4J9F A;  3MP8 A;  1X27 A;  4WCI A;  3CMA A;  3OSS C;  2EW3 A;  5IXB A;  2JOY A;  2DK3 A;  3MO8 A;  2EJF A;  2K9G A;  1YFN A;  3CXC P;  2J6K A;  3CXC A;  1X43 A;  1QVF A;  2L3R A;  5FLX E;  3N5B B;  3EH2 A;  4LDW A;  3JV3 A;  4M7D F;  1VQ8 A;  1M4Z A;  1Q82 U;  2CP2 A;  4EMG A;  2QAS A;  5FU7 B;  1QVG S;  4M75 G;  1U1T A;  5D6X A;  2P0K A;  3SB2 A;  1MND A;  2A36 A;  1WJQ A;  3V7C A;  2M9U A;  4M77 E;  4E7S A;  1WHG A;  2E1H A;  2DL7 A;  3ZBD A;  3GIB A;  3CCU T;  3CCU Q;  4RG2 A;  2FPD A;  3PT9 A;  1M1F A;  2K79 A;  2ROL A;  3CC7 T;  3TVT A;  1M8V A;  1G3T A;  4XAX B;  1IGU A;  3HPW A;  5M9O A;  1Q81 C;  2RJF A;  2JN0 A;  4AMC A;  3L1A A;  4O6J A;  5CKE A;  5CKB A;  2HL3 A;  1SRM A;  4OMO A;  2FPF A;  2GFU A;  3S3M A;  1YNZ A;  1AD5 A;  4GBQ A;  3S3N A;  3JCM b;  2WSE E;  2RHY A;  2K3X A;  2EAY A;  3ME9 A;  3REB B;  4M77 D;  4PJO F;  4ORZ A;  4RTW A;  1QP3 A;  1SRL A;  2JS0 A;  2E3H A;  4AFU C;  2C0T A;  2LT4 A;  2X4Y A;  4BDZ A;  1K8A U;  2XI9 A;  4IUP A;  2QI2 A;  1YJW A;  3FLG A;  4IKF A;  4EIK A;  4AFQ C;  4FL6 A;  4M7A A;  5KYU A;  5A2Q E;  2X4X A;  4R0K A;  2MAM A;  1PM3 A;  2WSF E;  3JAM E;  4J9G A;  4AFS C;  4B6M A;  1PHT A;  1PG5 B;  2LZ6 B;  1CKA A;  4ZGJ B;  4N0A A;  3JCM d;  5LJ3 g;  4KBM B;  1RAG B;  3CCL T;  1QQJ A;  3CCL Q;  3EGU A;  4C0F A;  1MGQ A;  4QW2 A;  4M7A C;  5GAO n;  1F1B B;  3G4S A;  1QP2 A;  4FW2 A;  1D1B A;  1N6A A;  3JCM e;  8ATC B;  2EGA A;  1WJS A;  2E70 A;  4XTX A;  2YXY A;  3SEM A;  1KK7 A;  2MWO A;  1CKB A;  2QDY B;  1PWT A;  3CCE A;  1YI2 A;  3VS5 A;  4M7D E;  2X9H A;  1M5Q 1;  3HHT B;  1H3Z A;  2HMA A;  1DJ7 B;  5FW9 A;  4L6V 5;  5EG2 A;  1M90 R;  2SEM A;  4ELZ C;  3G6E A;  3H0I A;  4HT9 A;  3PE0 A;  1UTI A;  3O5Z A;  4X34 A;  2PVD B;  1Q86 U;  1AT1 B;  4OVA A;  3JCM P;  4KH0 B;  3BY7 A;  3QJY A;  3MEV A;  3HRT A;  1AWO A;  4C8Q F;  1NE8 A;  4M7A B;  4NL2 A;  1V76 A;  5KYU B;  4JRQ A;  4A54 A;  3SHW A;  2DLP A;  3M9Q A;  3MP1 A;  4KGZ B;  2VYT A;  2CS7 A;  1RAB B;  4BD3 A;  3X24 B;  5KYN A;  4XTV A;  3V8K A;  2B8A A;  2DET A;  2DD4 A;  1RI0 A;  4NOY A;  1NEG A;  3G1J A;  1M1K C;  4C92 A;  2J05 A;  1SG5 A;  4OB0 B;  2L3P A;  5FU6 C;  2K7A A;  4M7D D;  4EMK C;  3X20 B;  1HYO A;  4RCB A;  1VQ8 T;  1E6G A;  1VQ8 Q;  4XTZ A;  2DRK A;  2HQX A;  2LT1 A;  2RHU A;  4FT2 A;  1GCQ C;  1M9S A;  3UWN A;  1C0M A;  2V1Q A;  1NYG A;  3VKI A;  2KMT A;  4LD6 A;  2RJD A;  2X3W D;  4PJO E;  2RQT A;  2XDP A;  4X9D A;  4J5Y A;  3KFV A;  2DZ9 A;  4CC3 A;  1EIF A;  2DTH A;  3GNG A;  3TCJ A;  5GAO m;  3QDF A;  2ZPE B;  3A1P A;  3HL8 A;  3CC4 A;  1ZBX A;  2ZGW A;  2EJ9 A;  1M30 A;  5GAM e;  5GAN 3;  2BUD A;  3BFM A;  4Y28 E;  2FPE A;  1I0C A;  1WQ7 A;  3EG9 A;  2X35 A;  1Y07 A;  1BIB A;  5GJV B;  1WI7 A;  2HQH A;  1T3S A;  2RI5 A;  1YHQ A;  3M0Q A;  4JJN K;  4DEX A;  1K4U S;  1TSF A;  2CP5 A;  3U23 A;  4FYW B;  1IZ6 A;  2DYI A;  1RAH B;  3HRU A;  2YRV A;  4A4E A;  4Z89 A;  3M0P A;  2XMF A;  1MMG A;  4E7J A;  4J9I A;  1D0X A;  2GF7 A;  2PVG B;  4C92 B;  4PJO D;  2A08 A;  2XID A;  2XDD A;  1VIF A;  2VVK A;  3NTK A;  2X4W A;  1TXQ A;  4DBR A;  3JSC A;  3VU3 C;  5D6W A;  1KJW A;  3A5Z B;  2KXD A;  1NM7 A;  1JO8 A;  1YJW T;  1KD1 C;  2ZZD A;  3CBP A;  1UGS B;  1YJW Q;  4PNO A;  4Y91 A;  1NJI U;  2R58 A;  1ACM B;  2PVO B;  3VS7 A;  2CP7 A;  1ZUU A;  2KXC A;  1GXI E;  4C92 F;  4CC7 A;  1Z9Q A;  4KUL A;  2MYS A;  2O9V A;  2LQW A;  2EYX A;  3NTI A;  4C8Q E;  4PJJ A;  4ZGE B;  1X69 A;  2MOX A;  2YLB A;  4M78 F;  3KXT A;  3EG1 A;  4QT7 A;  3EFR A;  2DFU A;  3EG9 B;  5DLQ E;  1C1A A;  3G4S T;  1QW1 A;  3VRY A;  3G4S Q;  1T3L A;  4PFZ A;  4QQD A;  2YRC A;  3L2V A;  3JB9 H;  1RAI B;  4E7H A;  1VQ7 A;  4KGV B;  4E2F B;  1UJ0 A;  1OUL A;  1YI2 T;  2HD0 A;  4M77 C;  1YI2 Q;  3L2Q A;  4EDU A;  1AEY A;  2HEQ A;  3OYE A;  3TU4 K;  2BTT A;  3G6E T;  4FYY B;  4NL3 A;  1TG0 A;  3M0T A;  1Y57 A;  3G6E Q;  5LJ3 j;  3PTA A;  1K0S A;  2FHD A;  3MPU B;  3L2W A;  1M90 U;  3P8D A;  3JCM h;  1GL5 A;  3QDR B;  3QXE B;  5IHI A;  2D6F A;  4M75 A;  4R56 A;  1IO6 A;  4C8Q D;  5GAN 2;  3JCM Q;  4J9D A;  1G3W A;  5LJ3 d;  3NMZ C;  2V1R A;  3OBY A;  3CCV A;  3LWI A;  4F7U A;  3E9G A;  1JXM A;  4OMP A;  2LC4 A;  3HFN A;  4Z02 A;  1T0H A;  5I2S A;  4QQG A;  2HQE A;  4DBH A;  1WPY A;  5CVI A;  1B3Q A;  2QDL A;  2MMP A;  3JCM f;  5KE3 A;  5LJ3 e;  1O75 A;  2V8K A;  4M78 G;  2JM8 A;  3ZL7 C;  4B9W A;  1FXX A;  5GMK e;  1BCM A;  1MUZ A;  2DIL A;  3BDU A;  1K8A R;  3PVQ A;  2LDM A;  2DER A;  3CME T;  3QII A;  3CME Q;  2HL5 C;  2QQA A;  1R0B G;  1V1C A;  2CRE A;  1OV3 A;  5CKD A;  4F17 A;  2E4H A;  3RKY A;  3VS4 A;  3EG3 A;  3OSV A;  2CH4 W;  2IIM A;  1IHV A;  2BE9 B;  5IAY A;  1K73 R;  1I5O B;  1H3H A;  2QA4 Q;  1IRX A;  4FSS A;  3PGG A;  4M75 B;  2RMO A;  2DTO A;  1RI9 A;  1E6H A;  1VQP A;  1O9S A;  3OQ5 A;  3CPF A;  5CAI A;  4M78 E;  3ZEH A;  5D7U A;  1QVP A;  1X6G A;  2MWP A;  3FJP A;  2EGE A;  1ABO A;  2BKD N;  3AHU A;  2SRC A;  4M7D C;  1VA7 A;  2GQV A;  3EH1 A;  3C4S A;  3J80 E;  5KYX A;  1H8K A;  2QGG A;  2FZG B;  2F5K A;  4RCC A;  2KT1 A;  3JCM J;  2B86 A;  4JPB W;  5DY9 A;  1G8X A;  2JNG A;  3J7A F;  5IXF A;  3MET A;  1VQ9 A;  3VJP A;  2DJZ A;  3QKJ A;  1CSK A;  1VQ5 A;  5GAM g;  3LX7 A;  4CC2 A;  2AIR B;  4JZ4 A;  1RAD B;  4M77 G;  5A0D A;  3UA6 A;  1I5L A;  4F7U F;  3I9Q A;  3LW5 E;  1ZX6 A;  1JQQ A;  3BW1 A;  4N4H A;  2EBP A;  5IT9 E;  1Q7Y R;  2JW4 A;  3SWN C;  4JS4 A;  4C92 D; 
#chains in the Genus database with same CATH homology
 1N27 A;  4XQ3 A;  4N0A A;  1YCY A;  5I21 A;  3JCM d;  5LJ3 g;  3HFO A;  4FU6 A;  2QA4 A;  2V8J A;  2VXF A;  2YHT A;  5KCO A;  4MMK A;  2RA2 A;  4KBM B;  4TVR A;  3QSU A;  2DD5 A;  3CCL T;  4M78 D;  4ZN1 A;  2H3J A;  4MZT A;  4M77 B;  3JB9 I;  3GPL A;  2DAQ A;  1KQ2 A;  4C92 G;  1VQK T;  4XTY A;  4C0F A;  2RI3 A;  1MGQ A;  1NPR A;  5GAN 8;  1M1K U;  4L59 A;  4QW2 A;  2K57 A;  4M7A C;  3L2U A;  2Y4X A;  4XU1 A;  5GAO n;  5FRN A;  5LJ5 g;  3OYG A;  1BI3 A;  3G4S A;  2HAX A;  1QP2 A;  4MZM A;  1N6A A;  2HNI A;  2R5A A;  5FRM A;  3OYJ A;  3JCM e;  1VQ6 A;  2DXT A;  4M7A D;  2FVU A;  1YJN T;  1K9M U;  3CCR A;  1WJS A;  2E70 A;  4XTX A;  2E5Q A;  2FB7 A;  2EYQ A;  2LX9 A;  3MEA A;  3OYF A;  1VQ7 T;  3RER A;  3DKM A;  3ER0 A;  3QPH A;  2CZ6 B;  2QXF A;  3OW2 S;  2XU8 A;  2KK4 A;  4M7D B;  2MWO A;  1BIA A;  4Q5W A;  5CK9 A;  2QDY B;  5KH6 A;  1BI2 A;  5AYF A;  4PJO C;  3CCE A;  1YI2 A;  3CPW S;  4J7F A;  3PMT A;  3C94 A;  1Y96 A;  4PL6 A;  4M7D E;  4QQ6 A;  2BIV A;  4M7A G;  3PMI A;  1WJR A;  3M55 A;  1M5Q 1;  4OB3 B;  1FX7 A;  3OMG A;  2R5M A;  1KHI A;  3HHT B;  4A4G A;  1VQL A;  4J8O A;  3RKX A;  3OS1 A;  3CCM T;  1S72 T;  1DJ7 B;  3LGL A;  1VQ4 A;  3MP6 A;  4XK8 E;  1VQN T;  3GP8 A;  4L6V 5;  3CCJ A;  4HT8 A;  5EG2 A;  2VC8 A;  3G7Z A;  1YIJ T;  4ELZ C;  2DEQ A;  3G6E A;  2EKO A;  4XU0 A;  2EIF A;  4HT9 A;  4M78 B;  1VQM A;  1QVG A;  2WAC A;  1VQO A;  1MHN A;  1V29 B;  3CCQ T;  2JVV A;  3CD6 T;  2VUB A;  3NFC A;  5J3B A;  3CPW A;  3EAE A;  4P5N A;  2LVM A;  3LWH A;  2K5I A;  2KSS A;  2PVD B;  4X34 A;  1Q86 U;  1YBY A;  4OVA A;  3ZFJ A;  1K8A C;  4M7D A;  3JCM P;  3CC4 T;  1N8R U;  3FB9 A;  4ZN3 A;  2DIQ A;  2QQR A;  3BY7 A;  3QJY A;  3MEV A;  4BI4 A;  5GAN 5;  3WXM B;  3HRT A;  3VUZ A;  1I81 A;  4C8Q F;  4BDY A;  3P8B B;  1NE8 A;  4D6W A;  3V8J A;  2ZPI B;  3NTH A;  4M7A B;  4NL2 A;  4OGE A;  2CGH A;  2CZ1 B;  4JRQ A;  3OYD A;  4ATO A;  4ME7 A;  3CCV T;  4C92 E;  4A54 A;  5GAN g;  1YJ9 T;  5D6Y A;  2XK0 A;  5A0G A;  3M9Q A;  3MP1 A;  1NJI C;  4MDX A;  3F70 A;  5GAN 4;  4J6W A;  4B9X A;  1YHQ T;  1VUB A;  1UGP B;  2VYT A;  3HP9 A;  1W2B S;  5IN1 A;  2CS7 A;  3P8H A;  1XTD A;  4X9C A;  4BD3 A;  3X24 B;  1U8R A;  1NPP A;  4XTV A;  3O8V A;  3V8K A;  4JRP A;  1KC8 C;  4EPC A;  3CCL A;  2B8A A;  4E7K A;  3I56 A;  2DD4 A;  5LL6 S;  4BUG A;  1RI0 A;  4NOY A;  1JJ2 S;  4OB1 B;  1M1K C;  4C92 A;  5GAM h;  4OB0 B;  3RMS A;  3VV0 A;  3PIP A;  1WGS A;  3OB9 A;  5FU6 C;  4M7D D;  3OYB A;  4EMK C;  2M0O A;  3X20 B;  4RCB A;  1W2B A;  1VQ8 T;  3PFS A;  3SWN A;  4M75 F;  1KQS S;  1UEB A;  4XTZ A;  1Y7X A;  3JCM c;  2FYK A;  1VIE A;  2HQX A;  3V8L A;  3OYL A;  1K9M C;  2LT1 A;  2RHU A;  3A8O B;  5I2M A;  4JS5 A;  4FT2 A;  3TRE A;  3JCM W;  2P0P A;  3V7S A;  1YIT A;  3JCM V;  4ZTF A;  5GAO r;  2G3R A;  1M9S A;  3M53 A;  1JJ2 A;  4WF2 A;  4M7D G;  1XNI A;  3UWN A;  2HBP A;  1TH7 A;  3RMQ A;  2PQW A;  2IVW A;  2L89 A;  3X25 B;  2F69 A;  3VKI A;  3VUB A;  2KMT A;  2KVQ G;  3QG1 A;  1H64 1;  4LD6 A;  4OMF B;  2RJD A;  4MZP A;  4PLL A;  3HSB A;  3LH0 A;  1KD1 U;  3UDC A;  4PJO E;  2C06 A;  4E7I A;  4BE0 A;  1KQS A;  2LQK A;  1Y96 B;  2EQJ A;  5HKC A;  2XDP A;  1KG1 A;  4E47 A;  3GLX A;  1OZ2 A;  4O5V A;  4X9D A;  2RJC A;  5LJ3 h;  4J5Y A;  2DZ9 A;  1G3S A;  1EIF A;  2KY9 A;  3M5A A;  2DTH A;  5A0L A;  3G71 T;  3KUF A;  3GNG A;  1G3Y A;  2D9T A;  5GAM f;  2DXC A;  2ZPF B;  3A8M B;  3TCJ A;  2VV5 A;  3X26 B;  4A4H A;  4GY5 A;  4C0Z A;  2L8D A;  2DXB A;  4C8Q C;  5C6S A;  3CCU A;  5GAO m;  3OYM A;  5FU7 C;  1Q86 C;  5L8R E;  3S3O A;  2DPP B;  3MCA B;  3CBM A;  2ZPE B;  3CC4 A;  3HL8 A;  2O4X A;  2E10 A;  3BDL A;  1ZBX A;  2E41 A;  1WQW A;  2ZGW A;  2EJ9 A;  4J6X A;  5LJ5 h;  1K73 U;  1KC8 U;  5J26 A;  3MEW A;  4C0D B;  3VYH B;  5GAM e;  3ASK A;  2K5F A;  5GAN 3;  2BUD A;  3CC7 A;  1LJO A;  2K2V A;  3BFM A;  1XOV A;  4Y28 E;  1LNX A;  2VGM A;  3JCM g;  4BE2 A;  4A4F A;  1HXD A;  1WQ7 A;  2E64 A;  2E6Z A;  2M1H A;  2RK2 A;  2X35 A;  3A8H B;  2E12 A;  1Y07 A;  1BIB A;  1UGQ B;  2V8I A;  3CXC S;  4BAC A;  5GAO l;  1JRI A;  3JB9 F;  2RI5 A;  3OMC A;  2OTL A;  1YHQ A;  5LJ3 f;  1Q7Y C;  4JJN K;  4LDY A;  3VYG A;  2RI2 A;  2KDS A;  4ELY C;  1JB0 E;  4IUV A;  2I2L A;  2XG8 D;  1AHJ B;  4BY6 C;  1PSF A;  5CO7 A;  3PNW C;  2JTF A;  1IZ6 A;  3FC3 A;  1JBM A;  1SSF A;  1OZ3 A;  2YRV A;  3HRU A;  3JRZ A;  4M75 C;  4A4E A;  3INZ A;  4E7J A;  1B34 A;  1FWZ A;  3H8Z A;  4HKE A;  2QEX T;  2GF7 A;  2PVG B;  5FRO A;  4C92 B;  5LJ5 f;  2D0Q B;  4ZTJ A;  4LDX A;  4MML A;  2XID A;  1N9R A;  3H6Z A;  4PJO D;  2A3L A;  2XDD A;  3M58 A;  3JCM X;  1VQ9 T;  4M77 F;  1VIF A;  3QHS A;  3FRN A;  3SWN B;  3M59 A;  1I8F A;  3S6W A;  1VQ5 T;  3OW2 A;  3NTK A;  3HKS A;  4LDU A;  3E1S A;  2X4W A;  3L2Z A;  4DOW A;  5J39 A;  2K5L A;  3JSC A;  4PJO G;  5HY6 A;  5KE2 A;  3VU3 C;  4FIB A;  2XDB A;  5D6W A;  3L2R A;  3A5Z B;  3OYA A;  5GAN h;  2OAU A;  4J6Y A;  1YJW T;  1P92 A;  1M1G A;  1KD1 C;  2CKK A;  2ZZD A;  3CBP A;  4BB7 A;  5GAN 7;  1UGS B;  2RK1 A;  2OTJ T;  2DIG A;  3T9N A;  4PNO A;  3GF5 A;  3FIF A;  4C0G A;  4EMK A;  3QYG B;  4Y91 A;  3CCS A;  1NJI U;  2R58 A;  2PVO B;  2WSC E;  4PKC C;  4C5I A;  2PUK B;  3G71 A;  2FL7 A;  4L5G A;  2XKO C;  4F7U G;  2DO3 A;  3M4G A;  2AHJ B;  3CC2 T;  2E6N A;  3QO3 A;  4HCB A;  3C95 A;  2XIC A;  3I55 A;  5HK0 A;  1GXI E;  2LCC A;  4C92 F;  4KUL A;  2JZ2 A;  1WNL A;  4JUV A;  2QA4 T;  4DA4 A;  1Q7Y U;  3QZ9 B;  3CMA T;  5GAO q;  3NTI A;  4C8Q E;  2RHI A;  1Y71 A;  3MHX A;  3RKW A;  1HK9 A;  4C5H A;  4ZGE B;  1K73 C;  3OYN A;  4OP0 A;  2YLB A;  4M78 F;  4PJO B;  2E65 A;  2O4X B;  2DVE A;  2R57 A;  3KXT A;  1VQK A;  3OYH A;  1U1S A;  4E7L A;  3EFR A;  3OYI A;  3J81 E;  4RMO A;  3JB9 J;  2QQB A;  5GAN f;  5CQX A;  5DLQ E;  3G4S T;  2MF2 A;  1QW1 A;  1X75 C;  5GAM j;  4BE1 A;  1OYX A;  3DLL A;  4C8Q A;  4F7U B;  2CZ7 B;  3CCR T;  4QQD A;  4LDV A;  4ZGD B;  1YJN A;  4M7A F;  4A4K A;  3L2V A;  2QQ9 A;  2RHX A;  3QJ6 A;  3JB9 H;  4JRI A;  1N9S A;  3RES A;  3QUI A;  4EMH A;  4E7H A;  2XHC A;  5DM7 R;  1VQ7 A;  3RUX A;  2LCL A;  3M54 A;  3JB9 G;  3SDZ A;  3WVD B;  1YI2 T;  2HD0 A;  4M77 C;  2CZ0 B;  2K4Y A;  3L2Q A;  4EDU A;  2ZCF B;  5GAM d;  4M75 E;  5DLO A;  1B34 B;  1VQL T;  3RIR A;  2ZPH B;  3SFM A;  1BYM A;  1S72 A;  3OYE A;  3CCM A;  3TU4 K;  1VQ4 T;  3CCJ T;  1VQN A;  2ZPG B;  2DZC A;  1RL2 A;  3CEY A;  3G6E T;  1YIJ A;  4NL3 A;  4LD9 K;  4QVC A;  1VQM T;  5CQY A;  1VQO T;  5LJ3 j;  2VXE A;  3PTA A;  2VGN A;  2FHD A;  2LTO A;  4RG8 A;  3L2W A;  1X01 A;  3CCQ A;  1M90 U;  2MI6 A;  3CD6 A;  3OYY A;  3P8D A;  2RO0 A;  1BKB A;  2JUF A;  3JCM h;  4XU2 A;  5GMK h;  2Y90 A;  3QDR B;  3QXE B;  5CKH A;  4F7U E;  3M57 A;  2CYZ B;  2D6F A;  1UGR B;  1I4K 1;  3MEU A;  4J7I A;  4M75 A;  4XTU A;  4R56 A;  3OS2 A;  2P4T A;  4DQ2 A;  1G5V A;  3EFS A;  4C8Q D;  5GAN 2;  3OY9 A;  4CI0 C;  2OTJ A;  3JCM Q;  3OA6 A;  4JRK A;  3OS0 A;  1G3W A;  4FT4 A;  5LJ5 j;  5LJ3 d;  5FU6 B;  4C5G A;  4CRI A;  2JTM A;  3OYC A;  4JLG A;  4EMK B;  4J83 A;  5HK3 A;  4JDS A;  3OBY A;  3M56 A;  2DXU A;  4C5E A;  3CCV A;  1YJ9 A;  3E19 A;  3LWI A;  1BI1 A;  1NZ9 A;  1Q81 U;  1QVF S;  3V7R A;  1VQP T;  4PJO A;  4F7U A;  4M78 C;  4C8Q G;  3MP8 A;  3E9G A;  4YTL A;  2LC4 A;  2YLC A;  2IG0 A;  3HFN A;  4FM4 B;  4Z02 A;  2NLU A;  2DTI A;  2KQW A;  4IUT A;  4NS5 A;  3CMA A;  5I2S A;  4QQG A;  2HQE A;  3OSS C;  4DOV A;  2JOY A;  2DK3 A;  1WPY A;  3MO8 A;  5CVI A;  3I56 T;  5LJ5 d;  4OF1 A;  3UPU A;  2EJF A;  3CBO A;  2MMP A;  2RH2 A;  2LRQ A;  3JCM f;  1N8R C;  5KE3 A;  5LJ3 e;  3CXC A;  1QVF A;  2L3R A;  1O75 A;  4KUI A;  4V2S A;  2V8K A;  2EFI A;  5FLX E;  3N5B B;  4KT0 E;  3DLM A;  3QZ5 B;  4LDW A;  4BI3 A;  4M78 G;  4M7D F;  4M75 D;  1BI0 A;  1VQ8 A;  4N4G A;  3KBG A;  1H3Z A;  1M4Z A;  4B9W A;  4JLI A;  1FXX A;  1IRE B;  5GMK e;  1Q82 U;  3R6O A;  4C8Q B;  1YIT T;  3BDU A;  4EMG A;  2LDM A;  5FU7 B;  4N0A C;  4IUR A;  1QVG S;  5LJ5 e;  1PSE A;  3CME T;  2EQK A;  4M75 G;  2EQM A;  1ZQ1 A;  1U1T A;  5D6X A;  3QII A;  4XTW A;  2P0K A;  3SB2 A;  5CKF A;  2QQA A;  1WJQ A;  3V7C A;  3Q1J A;  2M9U A;  2X4J A;  5CKD A;  1LOJ A;  4M77 E;  4VUB A;  3RKY A;  1D3B A;  3OSV A;  5GAN j;  2EWN A;  2XD0 A;  2E1H A;  3FDR A;  4IUQ A;  1KQ1 A;  3ZBD A;  2RD1 A;  2RHZ A;  3GIB A;  5CIU A;  5IAY A;  1M90 C;  3CCU T;  1KHC A;  2F5T X;  3QYH B;  1UB4 A;  4KUD K;  1XQH A;  4N4I A;  3FEO A;  4BY6 B;  4RG2 A;  3PT9 A;  4M77 A;  1M1F A;  5GAN d;  3PGG A;  3CC7 T;  4M75 B;  3PIO A;  3LGF A;  3M4Y A;  5GMK m;  2GFA A;  4HCZ A;  1M8V A;  3OBW A;  1G3T A;  4XAX B;  4OB2 B;  2KAF A;  1OI1 A;  2DTO A;  4OGC A;  2Y4Y A;  2PU9 B;  3URG A;  3HPW A;  4HA8 A;  5M9O A;  3X28 B;  1Q81 C;  2RJF A;  2JN0 A;  4UC4 A;  3JB9 D;  1VQP A;  1O9S A;  3L1A A;  2O01 E;  3LLR A;  3OQ5 A;  4O6J A;  5GAO p;  2OTL T;  5CKE A;  1VQ6 T;  5CKB A;  1W4S A;  4RKU E;  3L42 A;  3CPF A;  5CAI A;  4M78 E;  3ZEH A;  2QQS A;  2L5Q A;  3SD4 A;  1QVP A;  3C12 A;  2GFU A;  3UT1 A;  5GMK l;  5GAN e;  3OYK A;  3S3M A;  2MWP A;  3GOX A;  2P0Q A;  2RJE A;  3A8L B;  3FJP A;  4XU3 A;  2BKD N;  4M7D C;  3AHU A;  5C0M A;  5KCH A;  4C0D C;  2GQV A;  3CCE T;  3S3N A;  3JCM b;  3C4S A;  3J80 E;  3QBY A;  2RM4 A;  2WSE E;  2RHY A;  2LQ8 A;  2F5K A;  4RCC A;  2QEX A;  2K3X A;  3JCM J;  2EAY A;  4FSX A;  5DY9 A;  3ME9 A;  2JNG A;  4M77 D;  4PJO F;  3J7A F;  2QTX A;  3MET A;  4M7A E;  4M78 A;  1VQ9 A;  4GLK A;  3A8G B;  3TEE A;  3DB4 A;  3HRS A;  2DJZ A;  3QKJ A;  1QP3 A;  2A7Y A;  2DKG A;  2LNV A;  3VJP A;  5GAN 6;  4R55 A;  1Q82 C;  1VQ5 A;  2LT4 A;  5GAM g;  3GNF B;  2EJG A;  3WVE B;  3LX7 A;  5GMK i;  2RB6 A;  1ZHI A;  2EQU A;  2X4Y A;  3CME A;  4BDZ A;  4M77 G;  4MDW A;  1K8A U;  2XI9 A;  5A0D A;  5CR2 A;  1I5L A;  4II1 A;  1X6O A;  4IUP A;  2PUO B;  4F7U F;  2QI2 A;  4IUU A;  3OS5 A;  5GMK j;  3FLG A;  3LW5 E;  4QVZ A;  1YJW A;  4IKF A;  4FL6 A;  4PLI A;  4A53 A;  4M7A A;  3BW1 A;  5CCA A;  3CCS T;  3DB3 A;  5A2Q E;  2X4X A;  4N4H A;  1R8O B;  4C92 C;  2M16 A;  1D3B B;  4QVD A;  2MAM A;  2WSF E;  3JAM E;  5IT9 E;  3E9F A;  3LYI A;  2ZPB B;  3SWN C;  2K3Y A;  4BI8 B;  4JS4 A;  3CC2 A;  4HCC A;  4C92 D;  3I55 T;  4ZGJ B;  2GCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...