5CK9A

E. coli mazf form i
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
110
structure length
106
Chain Sequence
b'VSRYVPDMGDLIWVDFDPTKAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease MazF
molecule tags Hydrolase
source organism Escherichia coli k-12
publication title Substrate Recognition and Activity Regulation of the Escherichia coli mRNA Endonuclease MazF.
pubmed doi rcsb
total genus 27
structure length 106
sequence length 110
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2015-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ck9A00
4HKEA 5CKDA 5HK3A 1M1FA 3NFCA 4ELZC 5CO7A 1NE8A 5CQXA 2VUBA 3HPWA 4ME7A 1UB4A 4OF1A 5CKBA 4MZPA 5HK0A 2C06A 1X75C 5HKCA 5CQYA 4MZMA 4VUBA 5CKFA 2MF2A 3TCJA 5DLOA 5CKEA 4ELYC 5CKHA 4MDXA 3VUBA 5CK9A 4MZTA 3JRZA 3G7ZA 5CCAA 5CR2A 2KMTA 1VUBA 3JSCA
chains in the Genus database with same CATH superfamily
3MP8A 5IHNA 2CP5A 2ZPHB 3Q1JA 1KFZA 1B7TA 2IVWA 5A0LA 5IH2A 3CD6T 2RPNA 3V7RA 2K9GA 3CCVQ 2KE9A 3E2UA 1I5LA 4M75B 3VRZA 1O9SA 3GOXA 4XTUA 2HQHA 3M57A 1N8RC 4II1A 3CCRT 1B3QA 1ZBXA 2D9TA 4M7AB 2BZ8A 3NFCA 2XDDA 5CO7A 1VQ8Q 3MHXA 1WHKA 3JAME 5GAMe 2FEIA 1VIFA 1S72A 2EYWA 2DA9A 1GCPA 1NYFA 2RK2A 5GAOp 3JCMf 1K9MU 1XTDA 1YJWA 3X24B 2D1XA 3EG2A 1MMDA 4KGXB 3LW5E 1I07A 5KYXA 1R8OB 1Z9ZA 4BY6B 3JCMd 5DLOA 2CH4W 1SSFA 2O01E 3NMZC 5KCOA 1NLOC 3OYYA 1MMAA 4KUIA 3M58A 2CH4A 1VQNA 2ZGWA 1LCKA 5D6XA 2ATCB 4EMHA 1R77A 2X4XA 3HHTB 1JXOA 1SKUB 1H3ZA 4M7DE 4HA8A 2EQIA 4ZN1A 3TSZA 4TVRA 4HCBA 4M78F 2EGAA 2KMTA 1N9RA 4E7KA 1WDXA 3OB9A 4J9HA 2DIQA 3QZ9B 2EGCA 2RO0A 1YCYA 3CC7T 4ME7A 2DFUA 2JNGA 3ASKA 4M78B 3EHRA 2QEXA 5GMKl 1ABOA 1VYVA 2F1LA 2F2WA 4C0FA 4M7AF 1EFNA 3OYKA 2OTLQ 2NUTA 4E7ZA 3JB9G 4RG8A 2FYKA 4R0KA 1Q95G 3OYGA 3TSWA 3VS2A 2DIGA 1YP5A 3JCMc 2MAMA 3ULRB 4JDSA 2L3QA 1Q81U 5J39A 4QVCA 2LJ3A 4AMCA 5GAOl 4OGCA 3LGLA 5CKHA 1S1NA 1WNLA 1M3AA 2RQRA 2DZCA 3FJ5A 3C4SA 4NL2A 5I22A 2HBPA 1Y96B 3M0SA 3PE0A 1MV0B 4AG2C 1I5OB 5FRMA 4J83A 1KQSS 3G6EA 4RG2A 4PJLA 3META 5LJ3d 3TVTA 2E65A 5CKEA 4M75G 4M7AD 2DERA 4N0AC 1G3TA 3OYJA 4L59A 1OYXA 3OYBA 2FL7A 3CC7A 3RR6A 1UTIA 3A8MB 1RAHB 2FRWA 3MJXA 1WHLA 3L42A 3DB3A 2CP6A 2QASA 4N4HA 1D0XA 2EBPA 3A5ZB 1X69A 1YHQA 1OPKA 4ORZA 3S3NA 3SWNB 4N0AA 2QA4Q 1JJ2A 4UC4A 4PJOA 4D8KA 5HK3A 3H41A 1H92A 2XDBA 2QEXT 2VUBA 4WCIA 1VQKA 1OZ3A 1TSFA 1RABB 1B34A 3L2WA 1UUEA 3A8GB 5KYYB 2C06A 4M7DF 5HKCA 3CC4T 1IGQA 1RAIB 1QVGS 2YDLA 1WYXA 2K2MA 2PZ1A 1QQJA 3LX7A 4J5YA 2RQVA 3I5SA 1VUBA 3PIPA 2CSIA 3CCUA 1VQ6A 1M90C 1XQHA 1TUDA 4M77C 2XICA 2YRDA 4X1VA 2NYSA 5LJ5h 3CD6Q 3CMEA 1VQOT 3OA6A 4M75A 2LCLA 3GF5A 2EQUA 4C92D 2DJZA 2LJ1A 1K0XA 2RK1A 1YCSB 1VQ4A 2FZKB 1XNIA 4RTWA 2Y90A 1ZSGA 5GAMh 5I21A 2GGRA 3CBPA 3QG1A 5LJ3h 3JSCA 2X4JA 4ZNXA 4Z8AA 3G71Q 2EKOA 2DILA 1WPYA 5GANg 2VC8A 2ED1A 4M78A 3UPUA 2HCKA 4M78G 4PLIA 4QW2A 4FM4B 4ZGEB 1W4SA 4L5GA 5KCHA 1VQ7Q 1YJWT 1VQ7T 3EG3A 3JB9H 4C0GA 1Q7YU 2E4HA 1XJWB 1QMCA 2L3PA 1G3YA 2QEXQ 3QDFA 1QWFA 1SSHA 3C95A 2GTJA 1VIEA 5J3BA 4VUBA 4QQDA 4XTVA 2J6FA 2QDLA 1A0NB 4IIMA 2PVDB 4BE2A 3JCMe 1PD1A 3TEEA 3M53A 2FPDA 4JS4A 3QYGB 5DM7R 3EGUA 4C5EA 2MWPA 1ZUKA 5GAMf 2M51A 3G1JA 1M2VB 1VQLQ 4PNOA 5GAN5 2RM4A 2QTXA 1QVFP 3URGA 1VQOA 4OMQA 4KGVB 2R5AA 2VB6A 4DEYA 5FLXE 2HL5C 1M8VA 1T3SA 1RLQC 4M4ZA 5GANd 3G71T 8AT1B 1ZLMA 1HD3A 4KH1B 1MNDA 4DBHA 1NYGA 3FIFA 1EZZB 4M77A 1I8FA 2DL7A 3JB9I 4C8QA 3JCMJ 1KC8R 2KEAA 3ZFJA 4A63B 2EJFA 3EAEA 5GAOq 3RKYA 2LNHB 4BY6C 5DY9A 1KHCA 4KGZB 1KD1U 4Z02A 2RHZA 4BI3A 2L89A 4F7UA 2KXCA 4ZGJB 1BB9A 3MCAB 4PKCC 3QBYA 2XIDA 2HQEA 1FX7A 1MHNA 1YITT 3TREA 3R6NA 2MWOA 5I2MA 2ZPEB 2DXTA 1M90R 4LUEA 1Y7XA 3L2QA 1RI9A 4C8QB 4BE0A 2ZZDA 1PD0A 2O31A 1M3BA 2KRSA 4CC4B 5FROA 5FWBA 1RADB 1IXDA 1OZ2A 4IUUA 5CVIA 2J05A 3CCVA 2AZVA 3M0QA 1JBMA 3P8DA 1OI1A 1H8KA 1D0ZA 2CUDA 1X01A 3I5RA 4A53A 2FRYA 2F69A 1WI7A 1ZSZC 5KE2A 2DD5A 4IUPA 3UATA 3RMQA 2GFUA 4D6WA 4PJOD 1TU0B 5I2SA 4J8OA 5GANe 1YJNQ 1QCOA 2NUPB 2RN8A 1ZSZB 4OMPA 2LQNA 2YLBA 3OYNA 1BCMA 2AZSA 1JEGA 2HEQA 4P5NA 5LJ3g 2Y4YA 2NUTB 1VQKT 4WF2A 1YITA 1FMVA 4JLIA 1OU9A 1HYOA 1U1SA 4BDZA 2KR3A 4F14A 3VS1A 2DXBA 4C0DC 1JRIA 4LDVA 5LJ5g 4ELZC 3HL8A 3CCUQ 4HCCA 1YITQ 3RIRA 3GNFB 1NPRA 3EG9A 3EHQA 2LZ6B 3EGXA 4Z89A 1MMNA 5CK9A 1JXMA 2EPDA 2G6FX 1ZSZA 3OW2A 1YN8A 1X6BA 4M7DC 4DOVA 1VYUA 2VASA 3OYMA 2EQMA 4PL6A 1N27A 1W2BA 5C0MA 2QTVA 1Y0MA 2FO0A 4DBQA 4MZPA 2MPXC 2DMOA 3QO3A 2JVVA 5CQYA 4LXCA 2YLCA 3H0HA 2RJDA 3U23A 3G6ET 4BACA 2JS2A 1Q81C 4AFQC 2X4YA 1GBQA 3CPFA 4GLKA 1AD5A 1RAFB 3OYEA 2LQ8A 4HXJA 2HL3A 3KXTA 1X2QA 1D1BA 1IB8A 1WQWA 4C92G 2VXEA 3ZEHA 4AFZC 1KIKA 5KYXB 2RI3A 2F2VA 2DAQA 1GCQA 1QCFA 2P0PA 3THKA 2D0QB 1AZEA 2OI3A 4CC2A 4AT1B 2GBQA 1K8AR 1RAEB 4PFOA 1VQ7A 1YI2Q 4OMOA 1ZBJA 2WSFE 4E7JA 4JRKA 4F7UF 2EYYA 4XAXB 2QK0A 2COZA 5GAMd 2CSQA 2RHYA 2HSEB 1IZ6A 2KK4A 2QDYB 3CBMA 4M7DD 1NZ9A 1G3WA 4CC3A 5GAOr 1E6GA 3OYHA 4ZTFA 2EAYA 4DA4A 5GMKi 3QHSA 5IN1A 1YFNA 4LDXA 3SEMA 5IXFA 3H0IA 4ESRA 2K3BA 2HQXA 2OTLA 1LPLA 2GQVA 2R5MA 4BB7A 4PJJA 3CPWA 1VQ4T 1DJ7B 1W70A 1KG1A 1N5ZA 3P8HA 4FCYA 3M5AA 2MI6A 2KT8A 4C92F 4E47A 4MMKA 3CCET 5FRNA 2BZYA 3CCSA 4M75D 1TUCA 1FYNA 2GNCA 3FRNA 3M0UA 1HJDA 4C92C 1YJ9Q 1W1FA 2RJFA 2LVMA 3MEUA 4MZTA 3CCSQ 3ZL7C 3M56A 5GMKe 4NL3A 4A54A 2CZ6B 2HBWA 1WJSA 3SB2A 1ZX6A 3F70A 1M8MA 4RCBA 4DOWA 2L5QA 2EYXA 3EG1A 4JJDA 1UGVA 5GAMj 4FSSA 4M7AE 2EIFA 2E3HA 2QGFB 3PMTA 4KULA 2DVEA 2DPPB 4ATOA 2QAZA 2JN0A 3M4GA 1OQKA 1C6VX 5EC7A 1N8RR 4JJBA 2M02A 1LVKA 4V2SA 1TXQA 2NUPA 2KYMA 2QG9B 3UF4A 4O6JA 4M75C 3BFMA 3OSVA 2COWA 1WIEA 3QDRB 2F5KA 3JCMg 2VYTA 3QSUA 2F2XA 3OBYA 4IURA 2QA4A 1V29B 3JV3A 1TH7A 1VQ4Q 3KBGA 3G4SA 2CP2A 1PSEA 4F16A 3EFRA 1VQLA 1IREB 3JRZA 3CMEQ 1BI3A 3KUFA 5LJ3f 3I55A 3CCQQ 1VQ8A 2FG0A 2EYZA 4M75F 1H641 2D0NA 3R6OA 1Q86C 4JUVA 1XOVA 2OX7A 2M0OA 2FZGB 1UFFA 3E9FA 2ROLA 1GRIA 4PJOC 3NPFA 3OW2S 1RUWA 3H9NA 3CCLQ 1OU8A 1VQ5T 2XD0A 1Y71A 2O4XA 1O75A 2KXDA 3A1PA 2DBMA 2K6DA 2K2VA 2E64A 3NGPA 1UB4A 5CKBA 2NWMA 3EGXB 2PQWA 3TCJA 1S72T 1I4K1 2CP3A 1RI0A 2VWFA 3O5ZA 3M0RA 1LJOA 2R57A 3HRSA 2IIMA 2XG8D 3UWNA 1D1AA 2KGTA 1ZA1B 4C92A 1Q86R 5LJ5d 1WHMA 4OGEA 1K9AA 2FZCB 1JB0E 4F04B 4GY5A 2KY9A 1K76A 4JRIA 3PVLA 4PJOE 4QVZA 1UJYA 1WJQA 2YT6A 5DLQE 3PNWC 4E6RA 4E7IA 1VQNT 2K4YA 4J6WA 1I81A 4J9DA 4LDWA 3RUXA 2DETA 4CRIA 1Q7YC 1AT1B 2V1QA 3OBWA 2H3EB 5KYWB 1KD1C 1ZA2B 3EFOB 1PKSA 3OMGA 3GP8A 4OB1B 4EIKA 3MPUB 1MMGA 3MP1A 4DBFA 1M1KC 2HAXA 2P0QA 2LQWA 1NG2A 5LJ5e 4M75E 1WFWA 2YUOA 1VOMA 2QQSA 1RL2A 2HKNA 1OOTA 1H3HA 3OYIA 2DE0X 1JQQA 5M9OA 2K57A 2JMCA 3A8OB 2QQRA 2QGGA 2DZ9A 4EMKC 3CMAQ 4XQ3A 2V26A 2D6FA 4Y92A 2MF2A 2RI5A 2XU8A 3QXEB 2FVUA 5LJ5j 4FSXA 2YXYA 3OS1A 3M4YA 2NUZA 3GPLA 2DTIA 4IIOA 5AT1B 2CS7A 1OV3A 3REBB 2LRQA 3CC2T 5GAN6 2EJGA 3LWIA 5GAN3 5CKFA 2ROTA 2JZ2A 1VQ9A 2KT1A 1AWXA 4BDYA 2V1RA 2RJEA 2X3WD 3DKMA 5GMKm 4OVAA 3OYFA 1NE8A 4GLMA 4J7FA 1VQ6Q 4MMLA 2L3SA 1YJNT 1IGUA 5GAN2 1K73C 2DK3A 2E6NA 3BY7A 3A8LB 3X28B 4FT4A 2GTOA 2LQKA 2ZPFB 3QYHB 1N6AA 1M9SA 1NEBA 2DBKA 3EH2A 1QKXA 3G7ZA 1V76A 1K8AC 2LX9A 3EFSA 2L0AA 2RQTA 3CPWS 3T9NA 2XK0A 3H6ZA 5J26A 5KYUA 2DD4A 1BIAA 4PJOG 4GBQA 2JTFA 2BE9B 1UGQB 1M2VA 4WTOB 2A3LA 4J9FA 3CXCS 4BI4A 1SPKA 2KRMA 4ELYC 3FC3A 4HCZA 3V7SA 3CCLA 1AWOA 4JJCA 4MDXA 1U8RA 2OTLT 2RHIA 3ER0A 6AT1B 3WVEB 1JJ2P 4LD9K 4KT0E 4LNPA 1OEBA 2QI2A 2HMAA 1YHQQ 1OULA 1SEMA 1KD1R 2JW4A 1T0JA 3L2VA 1M1KR 3L2ZA 1K73R 2DYBA 3S6WA 1PNJA 4X34A 1TG0A 4FL6A 4YTLA 3UDCA 3M0TA 3LH0A 4JZ4A 4B9WA 4NOYA 2HNIA 2DKGA 1LNXA 2DXUA 3HFNA 4J9GA 1M90U 2A36A 3L2UA 2SRCA 2ZPGB 1KHIA 2OAWA 1X43A 2WACA 1YHQT 1NM7A 2PUOB 2COYA 2GFAA 2P4TA 3I35A 4M77D 2C0IA 3CCMA 2DTOA 2P84A 4M7AG 2CZ0B 4KUDK 3FJPA 3HFOA 4OF1A 3QWXX 2XKOC 3LWHA 4JRQA 1I1JA 4PFZA 2OTJT 2K5LA 1BBZA 2XDPA 2RA2A 1CKBA 2D8JA 3VS6A 3CCST 1AZGB 4R56A 4PLLA 1U1TA 2EQKA 2FPEA 4O5VA 2RB6A 5FW9A 1ZQ1A 1KQSA 1VQLT 2KYBA 3G4SQ 2KVQG 3UT1A 1S72Q 5GAOn 3NTHA 2DL3A 2CP7A 1BK2A 1X6OA 4JZ3A 4HCKA 2DEQA 3LH5A 5D6YA 4HKEA 5D6WA 1UGSB 3JB9D 5A2QE 4CI0C 2O88A 4RMOA 1N9SA 4XU0A 2DEUA 1M27C 1YWPA 2CZ1B 1X75C 1I0CA 2X9HA 1UEBA 4EMKB 1PG5B 1TTHB 3VUBA 1VQKQ 2HDAA 2VGMA 2DNUA 4J6XA 1OX9A 2CKKA 4AFSC 2VXFA 2IG0A 2J7IA 4RCCA 4LE9A 3S3OA 1YBYA 3LGFA 4XU2A 4OMMA 2CGHA 5GMKj 1M5Q1 1WLPB 4FT2A 3CC4Q 4RTXA 1GL5A 1WHGA 1UECA 1BI1A 1UG1A 2K3XA 4RTTA 1WA7A 5A0DA 2BIVA 1TOVA 3CMAA 4IUTA 2LCSA 4JPBW 4C8QC 1WXBA 3JCMh 1E7OA 3RNJA 3A8HB 3CC7Q 2ENMA 3M0PA 5FU7B 4FW1A 4F7UG 1VQOQ 1Z9QA 2QQ9A 1SRMA 4OMNA 1AWJA 1VQPA 2E10A 2ECZA 2DM1A 4PFPA 3E1SA 2W10A 4RTVA 2EYQA 2YRVA 4IKFA 1WZOA 3CMAT 2J6KA 2HZYA 3BDLA 1KC8C 3BE3A 2BUDA 5FU6C 4XTYA 2R58A 4DBRA 3CXCA 1G2BA 5IXBA 1ZHIA 4OMFB 2GF7A 3WVDB 2DO3A 4D8DA 4PK4A 1V1CA 3CCMT 2ED0A 1WHHA 3VRYA 1Y96A 1D09B 2DLPA 2D8HA 2DRMA 2HSPA 3BDUA 5GAN4 1U06A 4NS5A 1Q82U 4X9CA 1KC8U 1FXXA 3M59A 5GAN7 2JS0A 1RLPC 1E6HA 3RKXA 2DXCA 4Y91A 1K73U 3HPWA 3RESA 4FYYB 4Y28E 3JCMP 1EX4A 1FWZA 2KBTA 2YUPA 3V7CA 2LNVA 4JJNK 1EIFA 1NJIU 2LCCA 3L1AA 2EVRA 3CCLT 3G71A 4LUDA 4PJOF 3O8VA 3LYIA 1PRLC 4OB0B 2AKKA 2O2OA 1QWEA 5GAN8 3QJ6A 1NPPA 4OP0A 4A4GA 1QLYA 1WJRA 2DVJA 2EFIA 3KFVA 2E6ZA 2MK5A 3OYAA 2X35A 5KYYA 3QZ5B 4N4IA 1YIJQ 3J81E 3I56A 2B86A 2HD0A 1K1ZA 3MEAA 2LP5A 2A7YA 3CCMQ 1UHCA 3JCMV 2AIRB 1TUGB 4MZMA 5I11A 5LJ5f 4C5GA 3MEVA 2XMFA 1PCXA 1SHGA 3PMIA 3FB9A 1BCOA 1VQ9T 1C0MA 1VQMT 1PKTA 2YRCA 3I56Q 3RERA 2O9SA 1VQMA 1MGQA 4Q5WA 1R0CB 3CC2A 2XI9A 2C0TA 1T3LA 2KAFA 5GANh 5CAIA 1ZUYA 1UHFA 2JJ9A 3DLMA 2GQIA 2I0NA 5CIUA 4CC7A 4PJMA 4A4KA 1CKAA 4R55A 1WQ7A 3JCMX 2DL8A 3I56T 4XK8E 3INZA 3DB4A 3VKIA 3FDRA 2WSEE 2VVKA 1YI2A 1UGRB 4C8QE 1FMWA 1G83A 1GFDA 2JUFA 4XTWA 4QQGA 7AT1B 4F7UB 3NTKA 4IUVA 4J7IA 3G6EQ 3EGDA 2LJ0A 3JCMb 1MNEA 1KK7A 2YWWA 4M7DG 1YWOA 2BKDN 1BIBA 4QT7A 5IHIA 1K9MC 3CCRQ 3CCUT 1M2OA 4HVWA 2JOYA 5GJWB 3SD4A 3J80E 3C0CA 3OYCA 3JB9J 1AOJA 3HKSA 4KH0B 3FLGA 4EDUA 2AKLA 4C8QG 2K7AA 1JJ2S 5KH6A 5KYWA 3AHUA 1C1AA 4RTZA 2FB7A 2QYZA 1JO8A 1QCNA 2K5FA 3VV0A 2KDSA 3QJYA 3CCJA 2ZAEA 1KQSP 3EGDB 2LDMA 2YUQA 4HT9A 4F17A 3E19A 1Q86U 2E3IA 1B34B 3RDVA 2RMOA 4XTZA 3OS2A 3CPWP 2JXBA 3HP9A 1VQ5A 3UA7A 2DL4A 2RQUA 3RMSA 4ZN3A 5LJ3e 1K9MR 3BW1A 1UGPB 2JTEA 4E7HA 3OMCA 4LD6A 3OY9A 2RJCA 4MDWA 2G3RA 1LOJA 3A98A 3OYDA 2PVGB 2LT4A 1D0YA 3GNGA 3OSSC 1NEGA 2MMPA 1AWWA 1U5SA 1J3TA 2EJ9A 4KRTA 2V8KA 3RBBB 1BU1A 5GAMg 4E7SA 3VU3C 2X4WA 2RD1A 2HKQB 2CT4A 1WXTA 4X9DA 3QWYA 1N8RU 3MEWA 2QA4T 4M7AA 1NJIC 2RI2A 5EG2A 3X26B 1UJ0A 3SFMA 2CP0A 1VA7A 3OS5A 4A4EA 3VS3A 4J6YA 4AFUC 2V8IA 3C12A 2BTTA 5CCAA 3I55T 3PTAA 1ACMB 1KQ2A 1VQNQ 2DF6A 1Y07A 1IO6A 2M1HA 2J6OA 3CCJT 5CQXA 3QKJA 4E7LA 1QP2A 1X6GA 3HTRA 2AK5A 1HK9A 2KI7A 3H8ZA 2H3JA 4XU3A 2FPFA 1YIJA 4L6V5 4C0DB 4HVVA 2B8AA 1ABQA 5FU6B 1G3SA 1SF9A 4XTXA 3VS5A 1VQ5Q 4LDYA 4DQ2A 1WHJA 4ZTJA 4C92B 2PUKB 1Y57A 4C5HA 4OB2B 4ANJA 5IT9E 2LT1A 2O4XB 2CZ7B 3VS4A 3OW2P 5A0GA 1X2KA 3V8JA 1G5VA 1K8AU 2YHTA 3CMET 3M54A 2K5IA 1D1CA 2J06A 5KE3A 1QVGA 1HXDA 4M7DB 3MKDA 2CT3A 5HCKA 2Z0WA 4QQ6A 1G8XA 1Q7YR 1K0SA 4M77G 5GMKh 3EG9B 1PC0A 2ZPIB 4A4FA 3QIIA 1PRMC 3CC4A 2VV5A 3UA6A 1PWTA 3SHWA 5LJ3j 3CCQA 4M77F 2A28A 3PIOA 2E5KA 3M55A 5CKDA 3LLRA 4XU1A 4E2FB 3CCJQ 1BYMA 1QVFS 2KQWA 4M78C 2OTJQ 2OAUA 2XHCA 4QKUA 4M7DA 3ME9A 5HY6A 2A08A 4PJNA 4FYVB 2KRNA 2RQWA 1WX6A 2DJQA 2I2LA 2MOXA 5IHKA 2EW3A 2GCXA 2PU9B 3JB9F 4M78D 1PSFA 3VYHB 2X3XD 1NLPC 2PNIA 2RH2A 3OS0A 3VYGA 3VJPA 4J9BA 3HRTA 1WGSA 5D7UA 1VQMQ 3HRUA 5KYNA 3ZBDA 4RTUA 4BD3A 1YJ9A 1U3OA 1VQ6T 2E41A 3L2RA 3TQ7P 1CSKA 3SDZA 1OPLA 3I9QA 3NTIA 1SG5A 1AVZC 1KQ1A 2H8HA 3CCEA 1YJ9T 3GIBA 1D3BA 1KJWA 1W6XA 3VS7A 1TS9A 3SWNA 2E70A 3E9GA 4RUGA 1VQ9Q 2Y4XA 4C8QD 3CCEQ 2K3YA 3HSBA 4C5IA 5GANf 8ATCB 1QVFA 5FWCA 1BI0A 3GBQA 1RAGB 1PHTA 3NHNA 2CYZB 3CEYA 2NLUA 5L23A 3PVQA 2RNAA 3C94A 1T0HA 2F5TX 2M0YA 5CR2A 3JCMQ 1YIJT 2EGEA 3EFOA 2DYIA 2E1HA 4BI8B 4EMGA 2MYSA 3J7AF 1QVGP 3OQ5A 3PT9A 3M9QA 4B6MA 2FHDA 5GJVB 1VQPT 1YJWQ 3AT1B 3MP6A 3CD6A 2AHJB 1QW1A 3CQTA 4N4GA 4HVUA 4F7UE 1F1BB 3CCQT 4JRPA 1TWBA 2JMAA 5GAOm 1IHVA 4M77B 1BI2A 3P8BB 3WXMB 1Q82C 2RHUA 3IQLA 4RTYA 2P0KA 1Q81R 1K4US 2K79A 2DRKA 2OTJA 4M77E 2LC4A 2E12A 2JM8A 3PGGA 3I55Q 2M16A 2JTMA 1GFCA 5LL6S 1ARKA 4LN2A 4BE1A 1M1KU 2L3RA 5GANj 2A37A 3CXCP 2MIOA 3CCVT 2DX1A 1HSQA 4B9XA 2DL5A 1OX8A 1R0BG 2O9VA 2EKHA 2RF0A 9ATCB 3VUZA 4AG1C 4BUGA 2KSSA 5C6SA 3SWNC 3N5BB 2BE7D 2CUBA 2EQJA 2E5QA 4J9CA 1GCQC 4FIBA 3CCRA 3V8KA 1M1FA 4DEXA 2LTOA 1KSWA 1WXUA 1M3CA 1MV3A 1D3BB 3FEOA 1W2BS 5IAYA 3CBOA 4FU6A 4Z88A 3JCMW 1BKBA 3V8LA 1QVPA 1VQPQ 4OB3B 1GXIE 2RHXA 1AEYA 4K11A 1RACB 1QP3A 1PM3A 3PFSA 5AYFA 4RKUE 1SHFA 2LMJA 3D7SB 3H0FA 4QVDA 4IUQA 4JLGA 2PVOB 1X27A 1IHWA 1M4ZA 1IRXA 4FW2A 3EH1A 1YJNA 2A0FB 5L8RE 2CREA 2MCNA 3S3MA 1NJIR 3GLXA 2KROA 2LX7A 1QKWA 2P4RA 4EMKA 3TU4K 1VQ8T 1JU5C 1GBRA 2ESWA 2V8JA 2ZCFB 3VS0A 3REAB 4A4HA 3CC2Q 2VKNA 2JT4A 3G4ST 3X25B 4HT8A 1YI2T 1RAAB 1Q82R 1AHJB 2M9UA 3X20B 1FMKA 1MUZA 4ZGDB 4M7AC 3OYLA 2QXFA 4FYXB 2L8DA 2C0OA 4M78E 5ECAA 1ZUUA 2YUNA 2WSCE 4JS5A 4C8QF 2QQBA 1P92A 4J9IA 1NBEB 4LDUA 1UE9A 2X51A 3EG0A 5FU7C 5KYUB 2W0ZA 3MO8A 2PTKA 1M30A 2OJ2A 4C92E 2JM9A 4KBMB 2DTHA 3DLLA 2ZPBB 2SEMA 1W2BP 4J9EA 1M1GA 2KNBB 2YSQA 4C0ZA 4PJOB 2ABLA 2CDTA 1SRLA 4FYWB 2VGNA 3QUIA 5HK0A 4EPCA 1YNZA 1UDLA 2EWNA 2QQAA 2BZXA 2IPOB 3RKWA 1B07A 1VYTA 2AT1B 4OMLA 3QPHA 2L2PA
chains in the Genus database with same CATH topology
3MP8A 5KE2A 2LX9A 2QA4T 4M7AA 1NJIC 3EFSA 2DD5A 4IUPA 3CPWS 2RI2A 3T9NA 2XK0A 2ZPHB 3H6ZA 5EG2A 2GFUA 3Q1JA 3RMQA 5J26A 3X26B 4D6WA 2DD4A 1BIAA 3SFMA 4PJOD 2IVWA 5I2SA 4J8OA 5A0LA 3CD6T 3V7RA 5GANe 4PJOG 2JTFA 1UGQB 2A3LA 3OS5A 4A4EA 2YLBA 3OYNA 3CXCS 1I5LA 4M75B 4P5NA 4BI4A 4ELYC 1O9SA 5LJ3g 3FC3A 2Y4YA 4HCZA 3V7SA 3CCLA 4MDXA 1U8RA 2OTLT 2RHIA 3ER0A 4J6YA 3GOXA 2V8IA 4XTUA 3WVEB 4WF2A 3C12A 1VQKT 1YITA 4JLIA 5CCAA 3I55T 3PTAA 4KT0E 4LD9K 1U1SA 2QI2A 4BDZA 3M57A 2DXBA 4C0DC 1N8RC 1JRIA 4II1A 1KQ2A 4LDVA 1ZBXA 2D9TA 3CCRT 4M7AB 2XDDA 1Y07A 3NFCA 4ELZC 3HL8A 5CO7A 2M1HA 3L2ZA 5LJ5g 3L2VA 3MHXA 3CCJT 4HCCA 5CQXA 3S6WA 4X34A 4FL6A 4YTLA 3UDCA 3JAME 3QKJA 3LH0A 3RIRA 4B9WA 5GAMe 4E7LA 1QP2A 1VIFA 4NOYA 2HNIA 1HK9A 2DKGA 1NPRA 2H3JA 3GNFB 1LNXA 3H8ZA 1S72A 2DXUA 3HFNA 4XU3A 1M90U 5CK9A 2RK2A 5GAOp 3L2UA 1YIJA 4L6V5 3JCMf 2ZPGB 4C0DB 3OW2A 1K9MU 4M7DC 1KHIA 4DOVA 1XTDA 3CD6A 2B8AA 2WACA 1YJWA 5FU6B 3OYMA 1G3SA 2EQMA 4XTXA 1YHQT 2PUOB 3X24B 4PL6A 1N27A 2GFAA 2P4TA 4LDYA 4M77D 4DQ2A 4ZTJA 3CCMA 2DTOA 1W2BA 4C92B 5C0MA 4M7AG 2PUKB 2CZ0B 4C5HA 4OB2B 3FJPA 3HFOA 3LW5E 4OF1A 4KUDK 5IT9E 2XKOC 2LT1A 2O4XB 4MZPA 3LWHA 4JRQA 1R8OB 2CZ7B 2OTJT 3QO3A 2JVVA 2K5LA 5CQYA 4BY6B 3JCMd 5A0GA 2YLCA 5DLOA 1SSFA 2O01E 3V8JA 2RJDA 2XDPA 5KCOA 3G6ET 2RA2A 4BACA 1K8AU 1G5VA 1Q81C 2YHTA 3CMET 3M54A 3OYYA 2X4YA 3CCST 2K5IA 4R56A 5KE3A 4KUIA 3M58A 4PLLA 1QVGA 1HXDA 4M7DB 1U1TA 3CPFA 4GLKA 2EQKA 4QQ6A 4O5VA 3OYEA 1VQNA 2LQ8A 4M77G 5GMKh 2ZGWA 2RB6A 5D6XA 4EMHA 1ZQ1A 1KQSA 2ZPIB 2X4XA 3HHTB 1VQLT 3KXTA 4A4FA 1WQWA 4C92G 3QIIA 1H3ZA 2VXEA 3ZEHA 4M7DE 2KVQG 3CC4A 4HA8A 2VV5A 3UT1A 5GAOn 3NTHA 2RI3A 2DAQA 4ZN1A 5LJ3j 3CCQA 4M77F 4TVRA 3PIOA 1X6OA 4HCBA 4M78F 2P0PA 2D0QB 2KMTA 2DEQA 5D6YA 3M55A 4HKEA 5CKDA 5D6WA 1N9RA 1UGSB 4E7KA 3JB9D 5A2QE 3OB9A 3LLRA 4XU1A 2DIQA 3QZ9B 4CI0C 1BYMA 2RO0A 1YCYA 1QVFS 3CC7T 4RMOA 1N9SA 4ME7A 4XU0A 2JNGA 3ASKA 4M78B 1VQ7A 2CZ1B 2KQWA 2WSFE 4M78C 4E7JA 2OAUA 1X75C 2XHCA 5GMKl 2QEXA 4JRKA 4F7UF 1UEBA 4XAXB 4M7DA 4C0FA 4EMKB 4M7AF 3ME9A 5GAMd 2RHYA 5HY6A 3VUBA 3OYKA 1IZ6A 2KK4A 2QDYB 3CBMA 4M7DD 1NZ9A 2VGMA 4J6XA 1G3WA 2CKKA 3JB9G 4RG8A 2FYKA 5GAOr 3OYHA 4ZTFA 2VXFA 2EAYA 4DA4A 5GMKi 3QHSA 5IN1A 2IG0A 3OYGA 4LDXA 2I2LA 4RCCA 3S3OA 2DIGA 1YBYA 3LGFA 2HQXA 3JCMc 2GCXA 2PU9B 2MAMA 4XU2A 2OTLA 4JDSA 2CGHA 1Q81U 5J39A 4QVCA 5GMKj 3JB9F 4M78D 2R5MA 2GQVA 1M5Q1 4FT2A 1PSFA 3VYHB 4BB7A 5GAOl 3CPWA 1VQ4T 1DJ7B 4OGCA 2RH2A 3LGLA 5CKHA 1BI1A 3OS0A 1WNLA 3VYGA 1KG1A 2K3XA 3VJPA 2DZCA 3HRTA 3C4SA 2BIVA 3P8HA 4NL2A 1WGSA 5A0DA 3M5AA 3HRUA 2HBPA 1Y96B 2MI6A 4C92F 3ZBDA 4IUTA 3CMAA 4BD3A 1YJ9A 4C8QC 4E47A 4MMKA 3CCET 3JCMh 5FRNA 3A8HB 1VQ6T 3CCSA 2E41A 3L2RA 4M75D 5FRMA 4J83A 1KQSS 5FU7B 4F7UG 3G6EA 3SDZA 2QQ9A 4RG2A 3NTIA 1VQPA 2E10A 3FRNA 3E1SA 3META 5LJ3d 4C92C 1KQ1A 3CCEA 2E65A 5CKEA 4M75G 1YJ9T 3GIBA 4M7AD 1D3BA 2EYQA 2YRVA 4IKFA 3CMAT 2RJFA 2LVMA 3MEUA 4N0AC 4MZTA 3BDLA 1KC8C 3M56A 5GMKe 4NL3A 2BUDA 5FU6C 4A54A 2CZ6B 1G3TA 1WJSA 4XTYA 2R58A 3SB2A 2E70A 3SWNA 3OYJA 3E9GA 4L59A 2Y4XA 3F70A 4C8QD 3CXCA 4RCBA 4DOWA 1ZHIA 2K3YA 1OYXA 3OYBA 2L5QA 2FL7A 3CC7A 4OMFB 2GF7A 3HSBA 3A8MB 3WVDB 4C5IA 2DO3A 5GANf 1QVFA 1BI0A 3L42A 3DB3A 3CCMT 4N4HA 5GAMj 2CYZB 4M7AE 2EIFA 3A5ZB 1Y96A 3CEYA 3PMTA 4KULA 2NLUA 1YHQA 2DVEA 3C94A 2DPPB 4ATOA 3BDUA 2JN0A 5GAN4 3M4GA 2F5TX 5CR2A 3JCMQ 3S3NA 4NS5A 1YIJT 1Q82U 4X9CA 1KC8U 1FXXA 3M59A 3SWNB 4N0AA 1JJ2A 4V2SA 4UC4A 4PJOA 5GAN7 5HK3A 2E1HA 4BI8B 4EMGA 2XDBA 3RKXA 2DXCA 4Y91A 2QEXT 3J7AF 1K73U 2VUBA 3OQ5A 4O6JA 3HPWA 1VQKA 4M75C 3PT9A 3BFMA 1OZ3A 3OSVA 3RESA 3M9QA 1B34A 3L2WA 3A8GB 3QDRB 4Y28E 2F5KA 3JCMP 1FWZA 2VYTA 3JCMg 2C06A 3QSUA 5HKCA 2FHDA 3OBYA 4IURA 2QA4A 4M7DF 1V29B 3V7CA 1TH7A 3CC4T 2LNVA 3KBGA 1VQPT 3G4SA 4JJNK 1QVGS 1PSEA 3EFRA 1VQLA 1IREB 3MP6A 2AHJB 1QW1A 1EIFA 3JRZA 1BI3A 3KUFA 3LX7A 4J5YA 4N4GA 5LJ3f 2LCCA 1VUBA 3PIPA 3I55A 3L1AA 1NJIU 4F7UE 3CCUA 1VQ8A 1VQ6A 3CCQT 4JRPA 1M90C 3CCLT 1XQHA 3G71A 4PJOF 3O8VA 5GAOm 4M77C 3LYIA 2XICA 4M75F 4M77B 1BI2A 4OB0B 3P8BB 1H641 3WXMB 1Q82C 3R6OA 2RHUA 5LJ5h 3CMEA 5GAN8 1Q86C 4JUVA 2P0KA 1XOVA 3QJ6A 2M0OA 4M75A 3OA6A 1VQOT 2LCLA 3GF5A 2EQUA 4C92D 2DJZA 3E9FA 2RK1A 1NPPA 4OP0A 4A4GA 1VQ4A 1WJRA 1XNIA 2EFIA 4PJOC 2OTJA 4M77E 2LC4A 2Y90A 2E6ZA 2E12A 3OW2S 3OYAA 3PGGA 2M16A 2X35A 5GAMh 2JTMA 3QZ5B 5I21A 5LL6S 3CBPA 3QG1A 5LJ3h 3JSCA 2X4JA 4N4IA 1VQ5T 3J81E 3I56A 2XD0A 1Y71A 2EKOA 2O4XA 4BE1A 1M1KU 1O75A 2L3RA 5GANj 2HD0A 1WPYA 5GANg 2VC8A 3MEAA 4M78A 3CCVT 2K2VA 2E64A 1UB4A 2A7YA 5CKBA 3UPUA 4B9XA 4M78G 4PLIA 4QW2A 4FM4B 3JCMV 4ZGEB 4MZMA 2PQWA 3TCJA 3VUZA 1W4SA 5LJ5f 4BUGA 4C5GA 1S72T 3MEVA 1I4K1 4L5GA 5KCHA 1RI0A 1YJWT 1VQ7T 2KSSA 3JB9H 1LJOA 3PMIA 2R57A 3FB9A 3HRSA 3SWNC 3N5BB 4C0GA 5C6SA 2XG8D 1VQ9T 1VQMT 2EQJA 2E5QA 3UWNA 3RERA 4FIBA 3CCRA 1Q7YU 3V8KA 1M1FA 1VQMA 1MGQA 2LTOA 4C92A 4Q5WA 5LJ5d 1G3YA 3CC2A 1D3BB 3FEOA 2XI9A 4OGEA 1W2BS 2KAFA 1JB0E 4GY5A 2KY9A 3C95A 1VIEA 5J3BA 5GANh 5CAIA 4JRIA 5IAYA 4VUBA 3CBOA 4FU6A 3DLMA 3JCMW 1BKBA 3V8LA 1QVPA 4QQDA 4XTVA 4PJOE 5CIUA 4A4KA 4OB3B 4BE2A 2PVDB 4QVZA 1WJQA 1GXIE 2RHXA 3JCMe 4R55A 1WQ7A 3TEEA 3M53A 4JS4A 3QYGB 5DLQE 3PNWC 3JCMX 5DM7R 4C5EA 4E7IA 1VQNT 2MWPA 3I56T 2K4YA 4XK8E 3INZA 4J6WA 3DB4A 3VKIA 1QP3A 1I81A 3FDRA 2WSEE 5GAMf 1YI2A 3PFSA 1UGRB 4C8QE 5AYFA 4LDWA 4RKUE 2JUFA 4XTWA 3RUXA 4QQGA 4CRIA 1Q7YC 4F7UB 4PNOA 5GAN5 2RM4A 3NTKA 3OBWA 2QTXA 4QVDA 4IUVA 4IUQA 4JLGA 2PVOB 1KD1C 3URGA 4J7IA 1VQOA 1M4ZA 3OMGA 3GP8A 3JCMb 1YJNA 4OB1B 5L8RE 3S3MA 2R5AA 3MP1A 4M7DG 3GLXA 1M1KC 2HAXA 5FLXE 2BKDN 1BIBA 2P0QA 1M8VA 4EMKA 5LJ5e 3TU4K 5GANd 1K9MC 3G71T 4M75E 3CCUT 1VQ8T 2V8JA 2JOYA 2ZCFB 2QQSA 3FIFA 4M77A 1I8FA 3SD4A 1RL2A 4A4HA 3J80E 3JB9I 3G4ST 3OYCA 4C8QA 3JCMJ 3X25B 3OYIA 4HT8A 1YI2T 3JB9J 3HKSA 4EDUA 1AHJB 2M9UA 3FLGA 3ZFJA 5M9OA 4C8QG 3X20B 2EJFA 2K57A 1JJ2S 3A8OB 2QQRA 5KH6A 3AHUA 3EAEA 4ZGDB 2DZ9A 4EMKC 3OYLA 2QXFA 5GAOq 2FB7A 4M7AC 4XQ3A 2L8DA 3RKYA 4BY6C 4E7HA 5DY9A 2D6FA 2K5FA 1KHCA 2KDSA 2MF2A 4M78E 3VV0A 3QJYA 2RI5A 2XU8A 3CCJA 4Z02A 1KD1U 2RHZA 2LDMA 3QXEB 4BI3A 2FVUA 2L89A 5LJ5j 4F7UA 4HT9A 2WSCE 4FSXA 4ZGJB 3OS1A 3M4YA 4JS5A 3E19A 3MCAB 4PKCC 3QBYA 3GPLA 2DTIA 2XIDA 2HQEA 2QQBA 1FX7A 1P92A 4C8QF 1Q86U 1MHNA 1B34B 2CS7A 1YITT 4XTZA 3OS2A 2LRQA 3TREA 3CC2T 3HP9A 4LDUA 5GAN6 2MWOA 2EJGA 2ZPEB 5FU7C 5I2MA 5GAN3 2DXTA 5CKFA 3LWIA 1VQ5A 3MO8A 3RMSA 1Y7XA 4ZN3A 3L2QA 2JZ2A 4C92E 5LJ3e 4C8QB 1VQ9A 4KBMB 1UGPB 2DTHA 3BW1A 2ZPBB 3DLLA 2ZZDA 4BDYA 3OMCA 4BE0A 2RJEA 4LD6A 3OY9A 3DKMA 5GMKm 2RJCA 4OVAA 4MDWA 2G3RA 5FROA 3OYFA 1M1GA 1LOJA 4C0ZA 1NE8A 4PJOB 4J7FA 3OYDA 2PVGB 2LT4A 3GNGA 3OSSC 4MMLA 2MMPA 1OZ2A 4IUUA 2EJ9A 1YJNT 5CVIA 2VGNA 5GAN2 2V8KA 2DK3A 3QUIA 2E6NA 3BY7A 3CCVA 3A8LB 1K73C 3X28B 4FT4A 4EPCA 5HK0A 2LQKA 5GAMg 3VU3C 1JBMA 2EWNA 2ZPFB 2X4WA 1OI1A 3P8DA 3QYHB 2QQAA 1N6AA 2RD1A 1X01A 1M9SA 4X9DA 3RKWA 4A53A 3G7ZA 2F69A 1N8RU 1K8AC 3QPHA 3MEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HKE A;  5CKD A;  5HK3 A;  1M1F A;  3NFC A;  4ELZ C;  5CO7 A;  1NE8 A;  5CQX A;  2VUB A;  3HPW A;  4ME7 A;  1UB4 A;  4OF1 A;  5CKB A;  4MZP A;  5HK0 A;  2C06 A;  1X75 C;  5HKC A;  5CQY A;  4MZM A;  4VUB A;  5CKF A;  2MF2 A;  3TCJ A;  5DLO A;  5CKE A;  4ELY C;  5CKH A;  4MDX A;  3VUB A;  5CK9 A;  4MZT A;  3JRZ A;  3G7Z A;  5CCA A;  5CR2 A;  2KMT A;  1VUB A;  3JSC A; 
#chains in the Genus database with same CATH topology
 3MP8 A;  5IHN A;  2CP5 A;  2ZPH B;  3Q1J A;  1KFZ A;  1B7T A;  2IVW A;  5A0L A;  5IH2 A;  3CD6 T;  2RPN A;  3V7R A;  2K9G A;  3CCV Q;  2KE9 A;  3E2U A;  1I5L A;  4M75 B;  3VRZ A;  1O9S A;  3GOX A;  4XTU A;  2HQH A;  3M57 A;  1N8R C;  4II1 A;  3CCR T;  1B3Q A;  1ZBX A;  2D9T A;  4M7A B;  2BZ8 A;  3NFC A;  2XDD A;  5CO7 A;  1VQ8 Q;  3MHX A;  1WHK A;  3JAM E;  5GAM e;  2FEI A;  1VIF A;  1S72 A;  2EYW A;  2DA9 A;  1GCP A;  1NYF A;  2RK2 A;  5GAO p;  3JCM f;  1K9M U;  1XTD A;  1YJW A;  3X24 B;  2D1X A;  3EG2 A;  1MMD A;  4KGX B;  3LW5 E;  1I07 A;  5KYX A;  1R8O B;  1Z9Z A;  4BY6 B;  3JCM d;  5DLO A;  2CH4 W;  1SSF A;  2O01 E;  3NMZ C;  5KCO A;  1NLO C;  3OYY A;  1MMA A;  4KUI A;  3M58 A;  2CH4 A;  1VQN A;  2ZGW A;  1LCK A;  5D6X A;  2ATC B;  4EMH A;  1R77 A;  2X4X A;  3HHT B;  1JXO A;  1SKU B;  1H3Z A;  4M7D E;  4HA8 A;  2EQI A;  4ZN1 A;  3TSZ A;  4TVR A;  4HCB A;  4M78 F;  2EGA A;  2KMT A;  1N9R A;  4E7K A;  1WDX A;  3OB9 A;  4J9H A;  2DIQ A;  3QZ9 B;  2EGC A;  2RO0 A;  1YCY A;  3CC7 T;  4ME7 A;  2DFU A;  2JNG A;  3ASK A;  4M78 B;  3EHR A;  2QEX A;  5GMK l;  1ABO A;  1VYV A;  2F1L A;  2F2W A;  4C0F A;  4M7A F;  1EFN A;  3OYK A;  2OTL Q;  2NUT A;  4E7Z A;  3JB9 G;  4RG8 A;  2FYK A;  4R0K A;  1Q95 G;  3OYG A;  3TSW A;  3VS2 A;  2DIG A;  1YP5 A;  3JCM c;  2MAM A;  3ULR B;  4JDS A;  2L3Q A;  1Q81 U;  5J39 A;  4QVC A;  2LJ3 A;  4AMC A;  5GAO l;  4OGC A;  3LGL A;  5CKH A;  1S1N A;  1WNL A;  1M3A A;  2RQR A;  2DZC A;  3FJ5 A;  3C4S A;  4NL2 A;  5I22 A;  2HBP A;  1Y96 B;  3M0S A;  3PE0 A;  1MV0 B;  4AG2 C;  1I5O B;  5FRM A;  4J83 A;  1KQS S;  3G6E A;  4RG2 A;  4PJL A;  3MET A;  5LJ3 d;  3TVT A;  2E65 A;  5CKE A;  4M75 G;  4M7A D;  2DER A;  4N0A C;  1G3T A;  3OYJ A;  4L59 A;  1OYX A;  3OYB A;  2FL7 A;  3CC7 A;  3RR6 A;  1UTI A;  3A8M B;  1RAH B;  2FRW A;  3MJX A;  1WHL A;  3L42 A;  3DB3 A;  2CP6 A;  2QAS A;  4N4H A;  1D0X A;  2EBP A;  3A5Z B;  1X69 A;  1YHQ A;  1OPK A;  4ORZ A;  3S3N A;  3SWN B;  4N0A A;  2QA4 Q;  1JJ2 A;  4UC4 A;  4PJO A;  4D8K A;  5HK3 A;  3H41 A;  1H92 A;  2XDB A;  2QEX T;  2VUB A;  4WCI A;  1VQK A;  1OZ3 A;  1TSF A;  1RAB B;  1B34 A;  3L2W A;  1UUE A;  3A8G B;  5KYY B;  2C06 A;  4M7D F;  5HKC A;  3CC4 T;  1IGQ A;  1RAI B;  1QVG S;  2YDL A;  1WYX A;  2K2M A;  2PZ1 A;  1QQJ A;  3LX7 A;  4J5Y A;  2RQV A;  3I5S A;  1VUB A;  3PIP A;  2CSI A;  3CCU A;  1VQ6 A;  1M90 C;  1XQH A;  1TUD A;  4M77 C;  2XIC A;  2YRD A;  4X1V A;  2NYS A;  5LJ5 h;  3CD6 Q;  3CME A;  1VQO T;  3OA6 A;  4M75 A;  2LCL A;  3GF5 A;  2EQU A;  4C92 D;  2DJZ A;  2LJ1 A;  1K0X A;  2RK1 A;  1YCS B;  1VQ4 A;  2FZK B;  1XNI A;  4RTW A;  2Y90 A;  1ZSG A;  5GAM h;  5I21 A;  2GGR A;  3CBP A;  3QG1 A;  5LJ3 h;  3JSC A;  2X4J A;  4ZNX A;  4Z8A A;  3G71 Q;  2EKO A;  2DIL A;  1WPY A;  5GAN g;  2VC8 A;  2ED1 A;  4M78 A;  3UPU A;  2HCK A;  4M78 G;  4PLI A;  4QW2 A;  4FM4 B;  4ZGE B;  1W4S A;  4L5G A;  5KCH A;  1VQ7 Q;  1YJW T;  1VQ7 T;  3EG3 A;  3JB9 H;  4C0G A;  1Q7Y U;  2E4H A;  1XJW B;  1QMC A;  2L3P A;  1G3Y A;  2QEX Q;  3QDF A;  1QWF A;  1SSH A;  3C95 A;  2GTJ A;  1VIE A;  5J3B A;  4VUB A;  4QQD A;  4XTV A;  2J6F A;  2QDL A;  1A0N B;  4IIM A;  2PVD B;  4BE2 A;  3JCM e;  1PD1 A;  3TEE A;  3M53 A;  2FPD A;  4JS4 A;  3QYG B;  5DM7 R;  3EGU A;  4C5E A;  2MWP A;  1ZUK A;  5GAM f;  2M51 A;  3G1J A;  1M2V B;  1VQL Q;  4PNO A;  5GAN 5;  2RM4 A;  2QTX A;  1QVF P;  3URG A;  1VQO A;  4OMQ A;  4KGV B;  2R5A A;  2VB6 A;  4DEY A;  5FLX E;  2HL5 C;  1M8V A;  1T3S A;  1RLQ C;  4M4Z A;  5GAN d;  3G71 T;  8AT1 B;  1ZLM A;  1HD3 A;  4KH1 B;  1MND A;  4DBH A;  1NYG A;  3FIF A;  1EZZ B;  4M77 A;  1I8F A;  2DL7 A;  3JB9 I;  4C8Q A;  3JCM J;  1KC8 R;  2KEA A;  3ZFJ A;  4A63 B;  2EJF A;  3EAE A;  5GAO q;  3RKY A;  2LNH B;  4BY6 C;  5DY9 A;  1KHC A;  4KGZ B;  1KD1 U;  4Z02 A;  2RHZ A;  4BI3 A;  2L89 A;  4F7U A;  2KXC A;  4ZGJ B;  1BB9 A;  3MCA B;  4PKC C;  3QBY A;  2XID A;  2HQE A;  1FX7 A;  1MHN A;  1YIT T;  3TRE A;  3R6N A;  2MWO A;  5I2M A;  2ZPE B;  2DXT A;  1M90 R;  4LUE A;  1Y7X A;  3L2Q A;  1RI9 A;  4C8Q B;  4BE0 A;  2ZZD A;  1PD0 A;  2O31 A;  1M3B A;  2KRS A;  4CC4 B;  5FRO A;  5FWB A;  1RAD B;  1IXD A;  1OZ2 A;  4IUU A;  5CVI A;  2J05 A;  3CCV A;  2AZV A;  3M0Q A;  1JBM A;  3P8D A;  1OI1 A;  1H8K A;  1D0Z A;  2CUD A;  1X01 A;  3I5R A;  4A53 A;  2FRY A;  2F69 A;  1WI7 A;  1ZSZ C;  5KE2 A;  2DD5 A;  4IUP A;  3UAT A;  3RMQ A;  2GFU A;  4D6W A;  4PJO D;  1TU0 B;  5I2S A;  4J8O A;  5GAN e;  1YJN Q;  1QCO A;  2NUP B;  2RN8 A;  1ZSZ B;  4OMP A;  2LQN A;  2YLB A;  3OYN A;  1BCM A;  2AZS A;  1JEG A;  2HEQ A;  4P5N A;  5LJ3 g;  2Y4Y A;  2NUT B;  1VQK T;  4WF2 A;  1YIT A;  1FMV A;  4JLI A;  1OU9 A;  1HYO A;  1U1S A;  4BDZ A;  2KR3 A;  4F14 A;  3VS1 A;  2DXB A;  4C0D C;  1JRI A;  4LDV A;  5LJ5 g;  4ELZ C;  3HL8 A;  3CCU Q;  4HCC A;  1YIT Q;  3RIR A;  3GNF B;  1NPR A;  3EG9 A;  3EHQ A;  2LZ6 B;  3EGX A;  4Z89 A;  1MMN A;  5CK9 A;  1JXM A;  2EPD A;  2G6F X;  1ZSZ A;  3OW2 A;  1YN8 A;  1X6B A;  4M7D C;  4DOV A;  1VYU A;  2VAS A;  3OYM A;  2EQM A;  4PL6 A;  1N27 A;  1W2B A;  5C0M A;  2QTV A;  1Y0M A;  2FO0 A;  4DBQ A;  4MZP A;  2MPX C;  2DMO A;  3QO3 A;  2JVV A;  5CQY A;  4LXC A;  2YLC A;  3H0H A;  2RJD A;  3U23 A;  3G6E T;  4BAC A;  2JS2 A;  1Q81 C;  4AFQ C;  2X4Y A;  1GBQ A;  3CPF A;  4GLK A;  1AD5 A;  1RAF B;  3OYE A;  2LQ8 A;  4HXJ A;  2HL3 A;  3KXT A;  1X2Q A;  1D1B A;  1IB8 A;  1WQW A;  4C92 G;  2VXE A;  3ZEH A;  4AFZ C;  1KIK A;  5KYX B;  2RI3 A;  2F2V A;  2DAQ A;  1GCQ A;  1QCF A;  2P0P A;  3THK A;  2D0Q B;  1AZE A;  2OI3 A;  4CC2 A;  4AT1 B;  2GBQ A;  1K8A R;  1RAE B;  4PFO A;  1VQ7 A;  1YI2 Q;  4OMO A;  1ZBJ A;  2WSF E;  4E7J A;  4JRK A;  4F7U F;  2EYY A;  4XAX B;  2QK0 A;  2COZ A;  5GAM d;  2CSQ A;  2RHY A;  2HSE B;  1IZ6 A;  2KK4 A;  2QDY B;  3CBM A;  4M7D D;  1NZ9 A;  1G3W A;  4CC3 A;  5GAO r;  1E6G A;  3OYH A;  4ZTF A;  2EAY A;  4DA4 A;  5GMK i;  3QHS A;  5IN1 A;  1YFN A;  4LDX A;  3SEM A;  5IXF A;  3H0I A;  4ESR A;  2K3B A;  2HQX A;  2OTL A;  1LPL A;  2GQV A;  2R5M A;  4BB7 A;  4PJJ A;  3CPW A;  1VQ4 T;  1DJ7 B;  1W70 A;  1KG1 A;  1N5Z A;  3P8H A;  4FCY A;  3M5A A;  2MI6 A;  2KT8 A;  4C92 F;  4E47 A;  4MMK A;  3CCE T;  5FRN A;  2BZY A;  3CCS A;  4M75 D;  1TUC A;  1FYN A;  2GNC A;  3FRN A;  3M0U A;  1HJD A;  4C92 C;  1YJ9 Q;  1W1F A;  2RJF A;  2LVM A;  3MEU A;  4MZT A;  3CCS Q;  3ZL7 C;  3M56 A;  5GMK e;  4NL3 A;  4A54 A;  2CZ6 B;  2HBW A;  1WJS A;  3SB2 A;  1ZX6 A;  3F70 A;  1M8M A;  4RCB A;  4DOW A;  2L5Q A;  2EYX A;  3EG1 A;  4JJD A;  1UGV A;  5GAM j;  4FSS A;  4M7A E;  2EIF A;  2E3H A;  2QGF B;  3PMT A;  4KUL A;  2DVE A;  2DPP B;  4ATO A;  2QAZ A;  2JN0 A;  3M4G A;  1OQK A;  1C6V X;  5EC7 A;  1N8R R;  4JJB A;  2M02 A;  1LVK A;  4V2S A;  1TXQ A;  2NUP A;  2KYM A;  2QG9 B;  3UF4 A;  4O6J A;  4M75 C;  3BFM A;  3OSV A;  2COW A;  1WIE A;  3QDR B;  2F5K A;  3JCM g;  2VYT A;  3QSU A;  2F2X A;  3OBY A;  4IUR A;  2QA4 A;  1V29 B;  3JV3 A;  1TH7 A;  1VQ4 Q;  3KBG A;  3G4S A;  2CP2 A;  1PSE A;  4F16 A;  3EFR A;  1VQL A;  1IRE B;  3JRZ A;  3CME Q;  1BI3 A;  3KUF A;  5LJ3 f;  3I55 A;  3CCQ Q;  1VQ8 A;  2FG0 A;  2EYZ A;  4M75 F;  1H64 1;  2D0N A;  3R6O A;  1Q86 C;  4JUV A;  1XOV A;  2OX7 A;  2M0O A;  2FZG B;  1UFF A;  3E9F A;  2ROL A;  1GRI A;  4PJO C;  3NPF A;  3OW2 S;  1RUW A;  3H9N A;  3CCL Q;  1OU8 A;  1VQ5 T;  2XD0 A;  1Y71 A;  2O4X A;  1O75 A;  2KXD A;  3A1P A;  2DBM A;  2K6D A;  2K2V A;  2E64 A;  3NGP A;  1UB4 A;  5CKB A;  2NWM A;  3EGX B;  2PQW A;  3TCJ A;  1S72 T;  1I4K 1;  2CP3 A;  1RI0 A;  2VWF A;  3O5Z A;  3M0R A;  1LJO A;  2R57 A;  3HRS A;  2IIM A;  2XG8 D;  3UWN A;  1D1A A;  2KGT A;  1ZA1 B;  4C92 A;  1Q86 R;  5LJ5 d;  1WHM A;  4OGE A;  1K9A A;  2FZC B;  1JB0 E;  4F04 B;  4GY5 A;  2KY9 A;  1K76 A;  4JRI A;  3PVL A;  4PJO E;  4QVZ A;  1UJY A;  1WJQ A;  2YT6 A;  5DLQ E;  3PNW C;  4E6R A;  4E7I A;  1VQN T;  2K4Y A;  4J6W A;  1I81 A;  4J9D A;  4LDW A;  3RUX A;  2DET A;  4CRI A;  1Q7Y C;  1AT1 B;  2V1Q A;  3OBW A;  2H3E B;  5KYW B;  1KD1 C;  1ZA2 B;  3EFO B;  1PKS A;  3OMG A;  3GP8 A;  4OB1 B;  4EIK A;  3MPU B;  1MMG A;  3MP1 A;  4DBF A;  1M1K C;  2HAX A;  2P0Q A;  2LQW A;  1NG2 A;  5LJ5 e;  4M75 E;  1WFW A;  2YUO A;  1VOM A;  2QQS A;  1RL2 A;  2HKN A;  1OOT A;  1H3H A;  3OYI A;  2DE0 X;  1JQQ A;  5M9O A;  2K57 A;  2JMC A;  3A8O B;  2QQR A;  2QGG A;  2DZ9 A;  4EMK C;  3CMA Q;  4XQ3 A;  2V26 A;  2D6F A;  4Y92 A;  2MF2 A;  2RI5 A;  2XU8 A;  3QXE B;  2FVU A;  5LJ5 j;  4FSX A;  2YXY A;  3OS1 A;  3M4Y A;  2NUZ A;  3GPL A;  2DTI A;  4IIO A;  5AT1 B;  2CS7 A;  1OV3 A;  3REB B;  2LRQ A;  3CC2 T;  5GAN 6;  2EJG A;  3LWI A;  5GAN 3;  5CKF A;  2ROT A;  2JZ2 A;  1VQ9 A;  2KT1 A;  1AWX A;  4BDY A;  2V1R A;  2RJE A;  2X3W D;  3DKM A;  5GMK m;  4OVA A;  3OYF A;  1NE8 A;  4GLM A;  4J7F A;  1VQ6 Q;  4MML A;  2L3S A;  1YJN T;  1IGU A;  5GAN 2;  1K73 C;  2DK3 A;  2E6N A;  3BY7 A;  3A8L B;  3X28 B;  4FT4 A;  2GTO A;  2LQK A;  2ZPF B;  3QYH B;  1N6A A;  1M9S A;  1NEB A;  2DBK A;  3EH2 A;  1QKX A;  3G7Z A;  1V76 A;  1K8A C;  2LX9 A;  3EFS A;  2L0A A;  2RQT A;  3CPW S;  3T9N A;  2XK0 A;  3H6Z A;  5J26 A;  5KYU A;  2DD4 A;  1BIA A;  4PJO G;  4GBQ A;  2JTF A;  2BE9 B;  1UGQ B;  1M2V A;  4WTO B;  2A3L A;  4J9F A;  3CXC S;  4BI4 A;  1SPK A;  2KRM A;  4ELY C;  3FC3 A;  4HCZ A;  3V7S A;  3CCL A;  1AWO A;  4JJC A;  4MDX A;  1U8R A;  2OTL T;  2RHI A;  3ER0 A;  6AT1 B;  3WVE B;  1JJ2 P;  4LD9 K;  4KT0 E;  4LNP A;  1OEB A;  2QI2 A;  2HMA A;  1YHQ Q;  1OUL A;  1SEM A;  1KD1 R;  2JW4 A;  1T0J A;  3L2V A;  1M1K R;  3L2Z A;  1K73 R;  2DYB A;  3S6W A;  1PNJ A;  4X34 A;  1TG0 A;  4FL6 A;  4YTL A;  3UDC A;  3M0T A;  3LH0 A;  4JZ4 A;  4B9W A;  4NOY A;  2HNI A;  2DKG A;  1LNX A;  2DXU A;  3HFN A;  4J9G A;  1M90 U;  2A36 A;  3L2U A;  2SRC A;  2ZPG B;  1KHI A;  2OAW A;  1X43 A;  2WAC A;  1YHQ T;  1NM7 A;  2PUO B;  2COY A;  2GFA A;  2P4T A;  3I35 A;  4M77 D;  2C0I A;  3CCM A;  2DTO A;  2P84 A;  4M7A G;  2CZ0 B;  4KUD K;  3FJP A;  3HFO A;  4OF1 A;  3QWX X;  2XKO C;  3LWH A;  4JRQ A;  1I1J A;  4PFZ A;  2OTJ T;  2K5L A;  1BBZ A;  2XDP A;  2RA2 A;  1CKB A;  2D8J A;  3VS6 A;  3CCS T;  1AZG B;  4R56 A;  4PLL A;  1U1T A;  2EQK A;  2FPE A;  4O5V A;  2RB6 A;  5FW9 A;  1ZQ1 A;  1KQS A;  1VQL T;  2KYB A;  3G4S Q;  2KVQ G;  3UT1 A;  1S72 Q;  5GAO n;  3NTH A;  2DL3 A;  2CP7 A;  1BK2 A;  1X6O A;  4JZ3 A;  4HCK A;  2DEQ A;  3LH5 A;  5D6Y A;  4HKE A;  5D6W A;  1UGS B;  3JB9 D;  5A2Q E;  4CI0 C;  2O88 A;  4RMO A;  1N9S A;  4XU0 A;  2DEU A;  1M27 C;  1YWP A;  2CZ1 B;  1X75 C;  1I0C A;  2X9H A;  1UEB A;  4EMK B;  1PG5 B;  1TTH B;  3VUB A;  1VQK Q;  2HDA A;  2VGM A;  2DNU A;  4J6X A;  1OX9 A;  2CKK A;  4AFS C;  2VXF A;  2IG0 A;  2J7I A;  4RCC A;  4LE9 A;  3S3O A;  1YBY A;  3LGF A;  4XU2 A;  4OMM A;  2CGH A;  5GMK j;  1M5Q 1;  1WLP B;  4FT2 A;  3CC4 Q;  4RTX A;  1GL5 A;  1WHG A;  1UEC A;  1BI1 A;  1UG1 A;  2K3X A;  4RTT A;  1WA7 A;  5A0D A;  2BIV A;  1TOV A;  3CMA A;  4IUT A;  2LCS A;  4JPB W;  4C8Q C;  1WXB A;  3JCM h;  1E7O A;  3RNJ A;  3A8H B;  3CC7 Q;  2ENM A;  3M0P A;  5FU7 B;  4FW1 A;  4F7U G;  1VQO Q;  1Z9Q A;  2QQ9 A;  1SRM A;  4OMN A;  1AWJ A;  1VQP A;  2E10 A;  2ECZ A;  2DM1 A;  4PFP A;  3E1S A;  2W10 A;  4RTV A;  2EYQ A;  2YRV A;  4IKF A;  1WZO A;  3CMA T;  2J6K A;  2HZY A;  3BDL A;  1KC8 C;  3BE3 A;  2BUD A;  5FU6 C;  4XTY A;  2R58 A;  4DBR A;  3CXC A;  1G2B A;  5IXB A;  1ZHI A;  4OMF B;  2GF7 A;  3WVD B;  2DO3 A;  4D8D A;  4PK4 A;  1V1C A;  3CCM T;  2ED0 A;  1WHH A;  3VRY A;  1Y96 A;  1D09 B;  2DLP A;  2D8H A;  2DRM A;  2HSP A;  3BDU A;  5GAN 4;  1U06 A;  4NS5 A;  1Q82 U;  4X9C A;  1KC8 U;  1FXX A;  3M59 A;  5GAN 7;  2JS0 A;  1RLP C;  1E6H A;  3RKX A;  2DXC A;  4Y91 A;  1K73 U;  3HPW A;  3RES A;  4FYY B;  4Y28 E;  3JCM P;  1EX4 A;  1FWZ A;  2KBT A;  2YUP A;  3V7C A;  2LNV A;  4JJN K;  1EIF A;  1NJI U;  2LCC A;  3L1A A;  2EVR A;  3CCL T;  3G71 A;  4LUD A;  4PJO F;  3O8V A;  3LYI A;  1PRL C;  4OB0 B;  2AKK A;  2O2O A;  1QWE A;  5GAN 8;  3QJ6 A;  1NPP A;  4OP0 A;  4A4G A;  1QLY A;  1WJR A;  2DVJ A;  2EFI A;  3KFV A;  2E6Z A;  2MK5 A;  3OYA A;  2X35 A;  5KYY A;  3QZ5 B;  4N4I A;  1YIJ Q;  3J81 E;  3I56 A;  2B86 A;  2HD0 A;  1K1Z A;  3MEA A;  2LP5 A;  2A7Y A;  3CCM Q;  1UHC A;  3JCM V;  2AIR B;  1TUG B;  4MZM A;  5I11 A;  5LJ5 f;  4C5G A;  3MEV A;  2XMF A;  1PCX A;  1SHG A;  3PMI A;  3FB9 A;  1BCO A;  1VQ9 T;  1C0M A;  1VQM T;  1PKT A;  2YRC A;  3I56 Q;  3RER A;  2O9S A;  1VQM A;  1MGQ A;  4Q5W A;  1R0C B;  3CC2 A;  2XI9 A;  2C0T A;  1T3L A;  2KAF A;  5GAN h;  5CAI A;  1ZUY A;  1UHF A;  2JJ9 A;  3DLM A;  2GQI A;  2I0N A;  5CIU A;  4CC7 A;  4PJM A;  4A4K A;  1CKA A;  4R55 A;  1WQ7 A;  3JCM X;  2DL8 A;  3I56 T;  4XK8 E;  3INZ A;  3DB4 A;  3VKI A;  3FDR A;  2WSE E;  2VVK A;  1YI2 A;  1UGR B;  4C8Q E;  1FMW A;  1G83 A;  1GFD A;  2JUF A;  4XTW A;  4QQG A;  7AT1 B;  4F7U B;  3NTK A;  4IUV A;  4J7I A;  3G6E Q;  3EGD A;  2LJ0 A;  3JCM b;  1MNE A;  1KK7 A;  2YWW A;  4M7D G;  1YWO A;  2BKD N;  1BIB A;  4QT7 A;  5IHI A;  1K9M C;  3CCR Q;  3CCU T;  1M2O A;  4HVW A;  2JOY A;  5GJW B;  3SD4 A;  3J80 E;  3C0C A;  3OYC A;  3JB9 J;  1AOJ A;  3HKS A;  4KH0 B;  3FLG A;  4EDU A;  2AKL A;  4C8Q G;  2K7A A;  1JJ2 S;  5KH6 A;  5KYW A;  3AHU A;  1C1A A;  4RTZ A;  2FB7 A;  2QYZ A;  1JO8 A;  1QCN A;  2K5F A;  3VV0 A;  2KDS A;  3QJY A;  3CCJ A;  2ZAE A;  1KQS P;  3EGD B;  2LDM A;  2YUQ A;  4HT9 A;  4F17 A;  3E19 A;  1Q86 U;  2E3I A;  1B34 B;  3RDV A;  2RMO A;  4XTZ A;  3OS2 A;  3CPW P;  2JXB A;  3HP9 A;  1VQ5 A;  3UA7 A;  2DL4 A;  2RQU A;  3RMS A;  4ZN3 A;  5LJ3 e;  1K9M R;  3BW1 A;  1UGP B;  2JTE A;  4E7H A;  3OMC A;  4LD6 A;  3OY9 A;  2RJC A;  4MDW A;  2G3R A;  1LOJ A;  3A98 A;  3OYD A;  2PVG B;  2LT4 A;  1D0Y A;  3GNG A;  3OSS C;  1NEG A;  2MMP A;  1AWW A;  1U5S A;  1J3T A;  2EJ9 A;  4KRT A;  2V8K A;  3RBB B;  1BU1 A;  5GAM g;  4E7S A;  3VU3 C;  2X4W A;  2RD1 A;  2HKQ B;  2CT4 A;  1WXT A;  4X9D A;  3QWY A;  1N8R U;  3MEW A;  2QA4 T;  4M7A A;  1NJI C;  2RI2 A;  5EG2 A;  3X26 B;  1UJ0 A;  3SFM A;  2CP0 A;  1VA7 A;  3OS5 A;  4A4E A;  3VS3 A;  4J6Y A;  4AFU C;  2V8I A;  3C12 A;  2BTT A;  5CCA A;  3I55 T;  3PTA A;  1ACM B;  1KQ2 A;  1VQN Q;  2DF6 A;  1Y07 A;  1IO6 A;  2M1H A;  2J6O A;  3CCJ T;  5CQX A;  3QKJ A;  4E7L A;  1QP2 A;  1X6G A;  3HTR A;  2AK5 A;  1HK9 A;  2KI7 A;  3H8Z A;  2H3J A;  4XU3 A;  2FPF A;  1YIJ A;  4L6V 5;  4C0D B;  4HVV A;  2B8A A;  1ABQ A;  5FU6 B;  1G3S A;  1SF9 A;  4XTX A;  3VS5 A;  1VQ5 Q;  4LDY A;  4DQ2 A;  1WHJ A;  4ZTJ A;  4C92 B;  2PUK B;  1Y57 A;  4C5H A;  4OB2 B;  4ANJ A;  5IT9 E;  2LT1 A;  2O4X B;  2CZ7 B;  3VS4 A;  3OW2 P;  5A0G A;  1X2K A;  3V8J A;  1G5V A;  1K8A U;  2YHT A;  3CME T;  3M54 A;  2K5I A;  1D1C A;  2J06 A;  5KE3 A;  1QVG A;  1HXD A;  4M7D B;  3MKD A;  2CT3 A;  5HCK A;  2Z0W A;  4QQ6 A;  1G8X A;  1Q7Y R;  1K0S A;  4M77 G;  5GMK h;  3EG9 B;  1PC0 A;  2ZPI B;  4A4F A;  3QII A;  1PRM C;  3CC4 A;  2VV5 A;  3UA6 A;  1PWT A;  3SHW A;  5LJ3 j;  3CCQ A;  4M77 F;  2A28 A;  3PIO A;  2E5K A;  3M55 A;  5CKD A;  3LLR A;  4XU1 A;  4E2F B;  3CCJ Q;  1BYM A;  1QVF S;  2KQW A;  4M78 C;  2OTJ Q;  2OAU A;  2XHC A;  4QKU A;  4M7D A;  3ME9 A;  5HY6 A;  2A08 A;  4PJN A;  4FYV B;  2KRN A;  2RQW A;  1WX6 A;  2DJQ A;  2I2L A;  2MOX A;  5IHK A;  2EW3 A;  2GCX A;  2PU9 B;  3JB9 F;  4M78 D;  1PSF A;  3VYH B;  2X3X D;  1NLP C;  2PNI A;  2RH2 A;  3OS0 A;  3VYG A;  3VJP A;  4J9B A;  3HRT A;  1WGS A;  5D7U A;  1VQM Q;  3HRU A;  5KYN A;  3ZBD A;  4RTU A;  4BD3 A;  1YJ9 A;  1U3O A;  1VQ6 T;  2E41 A;  3L2R A;  3TQ7 P;  1CSK A;  3SDZ A;  1OPL A;  3I9Q A;  3NTI A;  1SG5 A;  1AVZ C;  1KQ1 A;  2H8H A;  3CCE A;  1YJ9 T;  3GIB A;  1D3B A;  1KJW A;  1W6X A;  3VS7 A;  1TS9 A;  3SWN A;  2E70 A;  3E9G A;  4RUG A;  1VQ9 Q;  2Y4X A;  4C8Q D;  3CCE Q;  2K3Y A;  3HSB A;  4C5I A;  5GAN f;  8ATC B;  1QVF A;  5FWC A;  1BI0 A;  3GBQ A;  1RAG B;  1PHT A;  3NHN A;  2CYZ B;  3CEY A;  2NLU A;  5L23 A;  3PVQ A;  2RNA A;  3C94 A;  1T0H A;  2F5T X;  2M0Y A;  5CR2 A;  3JCM Q;  1YIJ T;  2EGE A;  3EFO A;  2DYI A;  2E1H A;  4BI8 B;  4EMG A;  2MYS A;  3J7A F;  1QVG P;  3OQ5 A;  3PT9 A;  3M9Q A;  4B6M A;  2FHD A;  5GJV B;  1VQP T;  1YJW Q;  3AT1 B;  3MP6 A;  3CD6 A;  2AHJ B;  1QW1 A;  3CQT A;  4N4G A;  4HVU A;  4F7U E;  1F1B B;  3CCQ T;  4JRP A;  1TWB A;  2JMA A;  5GAO m;  1IHV A;  4M77 B;  1BI2 A;  3P8B B;  3WXM B;  1Q82 C;  2RHU A;  3IQL A;  4RTY A;  2P0K A;  1Q81 R;  1K4U S;  2K79 A;  2DRK A;  2OTJ A;  4M77 E;  2LC4 A;  2E12 A;  2JM8 A;  3PGG A;  3I55 Q;  2M16 A;  2JTM A;  1GFC A;  5LL6 S;  1ARK A;  4LN2 A;  4BE1 A;  1M1K U;  2L3R A;  5GAN j;  2A37 A;  3CXC P;  2MIO A;  3CCV T;  2DX1 A;  1HSQ A;  4B9X A;  2DL5 A;  1OX8 A;  1R0B G;  2O9V A;  2EKH A;  2RF0 A;  9ATC B;  3VUZ A;  4AG1 C;  4BUG A;  2KSS A;  5C6S A;  3SWN C;  3N5B B;  2BE7 D;  2CUB A;  2EQJ A;  2E5Q A;  4J9C A;  1GCQ C;  4FIB A;  3CCR A;  3V8K A;  1M1F A;  4DEX A;  2LTO A;  1KSW A;  1WXU A;  1M3C A;  1MV3 A;  1D3B B;  3FEO A;  1W2B S;  5IAY A;  3CBO A;  4FU6 A;  4Z88 A;  3JCM W;  1BKB A;  3V8L A;  1QVP A;  1VQP Q;  4OB3 B;  1GXI E;  2RHX A;  1AEY A;  4K11 A;  1RAC B;  1QP3 A;  1PM3 A;  3PFS A;  5AYF A;  4RKU E;  1SHF A;  2LMJ A;  3D7S B;  3H0F A;  4QVD A;  4IUQ A;  4JLG A;  2PVO B;  1X27 A;  1IHW A;  1M4Z A;  1IRX A;  4FW2 A;  3EH1 A;  1YJN A;  2A0F B;  5L8R E;  2CRE A;  2MCN A;  3S3M A;  1NJI R;  3GLX A;  2KRO A;  2LX7 A;  1QKW A;  2P4R A;  4EMK A;  3TU4 K;  1VQ8 T;  1JU5 C;  1GBR A;  2ESW A;  2V8J A;  2ZCF B;  3VS0 A;  3REA B;  4A4H A;  3CC2 Q;  2VKN A;  2JT4 A;  3G4S T;  3X25 B;  4HT8 A;  1YI2 T;  1RAA B;  1Q82 R;  1AHJ B;  2M9U A;  3X20 B;  1FMK A;  1MUZ A;  4ZGD B;  4M7A C;  3OYL A;  2QXF A;  4FYX B;  2L8D A;  2C0O A;  4M78 E;  5ECA A;  1ZUU A;  2YUN A;  2WSC E;  4JS5 A;  4C8Q F;  2QQB A;  1P92 A;  4J9I A;  1NBE B;  4LDU A;  1UE9 A;  2X51 A;  3EG0 A;  5FU7 C;  5KYU B;  2W0Z A;  3MO8 A;  2PTK A;  1M30 A;  2OJ2 A;  4C92 E;  2JM9 A;  4KBM B;  2DTH A;  3DLL A;  2ZPB B;  2SEM A;  1W2B P;  4J9E A;  1M1G A;  2KNB B;  2YSQ A;  4C0Z A;  4PJO B;  2ABL A;  2CDT A;  1SRL A;  4FYW B;  2VGN A;  3QUI A;  5HK0 A;  4EPC A;  1YNZ A;  1UDL A;  2EWN A;  2QQA A;  2BZX A;  2IPO B;  3RKW A;  1B07 A;  1VYT A;  2AT1 B;  4OML A;  3QPH A;  2L2P A; 
#chains in the Genus database with same CATH homology
 3MP8 A;  5KE2 A;  2LX9 A;  2QA4 T;  4M7A A;  1NJI C;  3EFS A;  2DD5 A;  4IUP A;  3CPW S;  2RI2 A;  3T9N A;  2XK0 A;  2ZPH B;  3H6Z A;  5EG2 A;  2GFU A;  3Q1J A;  3RMQ A;  5J26 A;  3X26 B;  4D6W A;  2DD4 A;  1BIA A;  3SFM A;  4PJO D;  2IVW A;  5I2S A;  4J8O A;  5A0L A;  3CD6 T;  3V7R A;  5GAN e;  4PJO G;  2JTF A;  1UGQ B;  2A3L A;  3OS5 A;  4A4E A;  2YLB A;  3OYN A;  3CXC S;  1I5L A;  4M75 B;  4P5N A;  4BI4 A;  4ELY C;  1O9S A;  5LJ3 g;  3FC3 A;  2Y4Y A;  4HCZ A;  3V7S A;  3CCL A;  4MDX A;  1U8R A;  2OTL T;  2RHI A;  3ER0 A;  4J6Y A;  3GOX A;  2V8I A;  4XTU A;  3WVE B;  4WF2 A;  3C12 A;  1VQK T;  1YIT A;  4JLI A;  5CCA A;  3I55 T;  3PTA A;  4KT0 E;  4LD9 K;  1U1S A;  2QI2 A;  4BDZ A;  3M57 A;  2DXB A;  4C0D C;  1N8R C;  1JRI A;  4II1 A;  1KQ2 A;  4LDV A;  1ZBX A;  2D9T A;  3CCR T;  4M7A B;  2XDD A;  1Y07 A;  3NFC A;  4ELZ C;  3HL8 A;  5CO7 A;  2M1H A;  3L2Z A;  5LJ5 g;  3L2V A;  3MHX A;  3CCJ T;  4HCC A;  5CQX A;  3S6W A;  4X34 A;  4FL6 A;  4YTL A;  3UDC A;  3JAM E;  3QKJ A;  3LH0 A;  3RIR A;  4B9W A;  5GAM e;  4E7L A;  1QP2 A;  1VIF A;  4NOY A;  2HNI A;  1HK9 A;  2DKG A;  1NPR A;  2H3J A;  3GNF B;  1LNX A;  3H8Z A;  1S72 A;  2DXU A;  3HFN A;  4XU3 A;  1M90 U;  5CK9 A;  2RK2 A;  5GAO p;  3L2U A;  1YIJ A;  4L6V 5;  3JCM f;  2ZPG B;  4C0D B;  3OW2 A;  1K9M U;  4M7D C;  1KHI A;  4DOV A;  1XTD A;  3CD6 A;  2B8A A;  2WAC A;  1YJW A;  5FU6 B;  3OYM A;  1G3S A;  2EQM A;  4XTX A;  1YHQ T;  2PUO B;  3X24 B;  4PL6 A;  1N27 A;  2GFA A;  2P4T A;  4LDY A;  4M77 D;  4DQ2 A;  4ZTJ A;  3CCM A;  2DTO A;  1W2B A;  4C92 B;  5C0M A;  4M7A G;  2PUK B;  2CZ0 B;  4C5H A;  4OB2 B;  3FJP A;  3HFO A;  3LW5 E;  4OF1 A;  4KUD K;  5IT9 E;  2XKO C;  2LT1 A;  2O4X B;  4MZP A;  3LWH A;  4JRQ A;  1R8O B;  2CZ7 B;  2OTJ T;  3QO3 A;  2JVV A;  2K5L A;  5CQY A;  4BY6 B;  3JCM d;  5A0G A;  2YLC A;  5DLO A;  1SSF A;  2O01 E;  3V8J A;  2RJD A;  2XDP A;  5KCO A;  3G6E T;  2RA2 A;  4BAC A;  1K8A U;  1G5V A;  1Q81 C;  2YHT A;  3CME T;  3M54 A;  3OYY A;  2X4Y A;  3CCS T;  2K5I A;  4R56 A;  5KE3 A;  4KUI A;  3M58 A;  4PLL A;  1QVG A;  1HXD A;  4M7D B;  1U1T A;  3CPF A;  4GLK A;  2EQK A;  4QQ6 A;  4O5V A;  3OYE A;  1VQN A;  2LQ8 A;  4M77 G;  5GMK h;  2ZGW A;  2RB6 A;  5D6X A;  4EMH A;  1ZQ1 A;  1KQS A;  2ZPI B;  2X4X A;  3HHT B;  1VQL T;  3KXT A;  4A4F A;  1WQW A;  4C92 G;  3QII A;  1H3Z A;  2VXE A;  3ZEH A;  4M7D E;  2KVQ G;  3CC4 A;  4HA8 A;  2VV5 A;  3UT1 A;  5GAO n;  3NTH A;  2RI3 A;  2DAQ A;  4ZN1 A;  5LJ3 j;  3CCQ A;  4M77 F;  4TVR A;  3PIO A;  1X6O A;  4HCB A;  4M78 F;  2P0P A;  2D0Q B;  2KMT A;  2DEQ A;  5D6Y A;  3M55 A;  4HKE A;  5CKD A;  5D6W A;  1N9R A;  1UGS B;  4E7K A;  3JB9 D;  5A2Q E;  3OB9 A;  3LLR A;  4XU1 A;  2DIQ A;  3QZ9 B;  4CI0 C;  1BYM A;  2RO0 A;  1YCY A;  1QVF S;  3CC7 T;  4RMO A;  1N9S A;  4ME7 A;  4XU0 A;  2JNG A;  3ASK A;  4M78 B;  1VQ7 A;  2CZ1 B;  2KQW A;  2WSF E;  4M78 C;  4E7J A;  2OAU A;  1X75 C;  2XHC A;  5GMK l;  2QEX A;  4JRK A;  4F7U F;  1UEB A;  4XAX B;  4M7D A;  4C0F A;  4EMK B;  4M7A F;  3ME9 A;  5GAM d;  2RHY A;  5HY6 A;  3VUB A;  3OYK A;  1IZ6 A;  2KK4 A;  2QDY B;  3CBM A;  4M7D D;  1NZ9 A;  2VGM A;  4J6X A;  1G3W A;  2CKK A;  3JB9 G;  4RG8 A;  2FYK A;  5GAO r;  3OYH A;  4ZTF A;  2VXF A;  2EAY A;  4DA4 A;  5GMK i;  3QHS A;  5IN1 A;  2IG0 A;  3OYG A;  4LDX A;  2I2L A;  4RCC A;  3S3O A;  2DIG A;  1YBY A;  3LGF A;  2HQX A;  3JCM c;  2GCX A;  2PU9 B;  2MAM A;  4XU2 A;  2OTL A;  4JDS A;  2CGH A;  1Q81 U;  5J39 A;  4QVC A;  5GMK j;  3JB9 F;  4M78 D;  2R5M A;  2GQV A;  1M5Q 1;  4FT2 A;  1PSF A;  3VYH B;  4BB7 A;  5GAO l;  3CPW A;  1VQ4 T;  1DJ7 B;  4OGC A;  2RH2 A;  3LGL A;  5CKH A;  1BI1 A;  3OS0 A;  1WNL A;  3VYG A;  1KG1 A;  2K3X A;  3VJP A;  2DZC A;  3HRT A;  3C4S A;  2BIV A;  3P8H A;  4NL2 A;  1WGS A;  5A0D A;  3M5A A;  3HRU A;  2HBP A;  1Y96 B;  2MI6 A;  4C92 F;  3ZBD A;  4IUT A;  3CMA A;  4BD3 A;  1YJ9 A;  4C8Q C;  4E47 A;  4MMK A;  3CCE T;  3JCM h;  5FRN A;  3A8H B;  1VQ6 T;  3CCS A;  2E41 A;  3L2R A;  4M75 D;  5FRM A;  4J83 A;  1KQS S;  5FU7 B;  4F7U G;  3G6E A;  3SDZ A;  2QQ9 A;  4RG2 A;  3NTI A;  1VQP A;  2E10 A;  3FRN A;  3E1S A;  3MET A;  5LJ3 d;  4C92 C;  1KQ1 A;  3CCE A;  2E65 A;  5CKE A;  4M75 G;  1YJ9 T;  3GIB A;  4M7A D;  1D3B A;  2EYQ A;  2YRV A;  4IKF A;  3CMA T;  2RJF A;  2LVM A;  3MEU A;  4N0A C;  4MZT A;  3BDL A;  1KC8 C;  3M56 A;  5GMK e;  4NL3 A;  2BUD A;  5FU6 C;  4A54 A;  2CZ6 B;  1G3T A;  1WJS A;  4XTY A;  2R58 A;  3SB2 A;  2E70 A;  3SWN A;  3OYJ A;  3E9G A;  4L59 A;  2Y4X A;  3F70 A;  4C8Q D;  3CXC A;  4RCB A;  4DOW A;  1ZHI A;  2K3Y A;  1OYX A;  3OYB A;  2L5Q A;  2FL7 A;  3CC7 A;  4OMF B;  2GF7 A;  3HSB A;  3A8M B;  3WVD B;  4C5I A;  2DO3 A;  5GAN f;  1QVF A;  1BI0 A;  3L42 A;  3DB3 A;  3CCM T;  4N4H A;  5GAM j;  2CYZ B;  4M7A E;  2EIF A;  3A5Z B;  1Y96 A;  3CEY A;  3PMT A;  4KUL A;  2NLU A;  1YHQ A;  2DVE A;  3C94 A;  2DPP B;  4ATO A;  3BDU A;  2JN0 A;  5GAN 4;  3M4G A;  2F5T X;  5CR2 A;  3JCM Q;  3S3N A;  4NS5 A;  1YIJ T;  1Q82 U;  4X9C A;  1KC8 U;  1FXX A;  3M59 A;  3SWN B;  4N0A A;  1JJ2 A;  4V2S A;  4UC4 A;  4PJO A;  5GAN 7;  5HK3 A;  2E1H A;  4BI8 B;  4EMG A;  2XDB A;  3RKX A;  2DXC A;  4Y91 A;  2QEX T;  3J7A F;  1K73 U;  2VUB A;  3OQ5 A;  4O6J A;  3HPW A;  1VQK A;  4M75 C;  3PT9 A;  3BFM A;  1OZ3 A;  3OSV A;  3RES A;  3M9Q A;  1B34 A;  3L2W A;  3A8G B;  3QDR B;  4Y28 E;  2F5K A;  3JCM P;  1FWZ A;  2VYT A;  3JCM g;  2C06 A;  3QSU A;  5HKC A;  2FHD A;  3OBY A;  4IUR A;  2QA4 A;  4M7D F;  1V29 B;  3V7C A;  1TH7 A;  3CC4 T;  2LNV A;  3KBG A;  1VQP T;  3G4S A;  4JJN K;  1QVG S;  1PSE A;  3EFR A;  1VQL A;  1IRE B;  3MP6 A;  2AHJ B;  1QW1 A;  1EIF A;  3JRZ A;  1BI3 A;  3KUF A;  3LX7 A;  4J5Y A;  4N4G A;  5LJ3 f;  2LCC A;  1VUB A;  3PIP A;  3I55 A;  3L1A A;  1NJI U;  4F7U E;  3CCU A;  1VQ8 A;  1VQ6 A;  3CCQ T;  4JRP A;  1M90 C;  3CCL T;  1XQH A;  3G71 A;  4PJO F;  3O8V A;  5GAO m;  4M77 C;  3LYI A;  2XIC A;  4M75 F;  4M77 B;  1BI2 A;  4OB0 B;  3P8B B;  1H64 1;  3WXM B;  1Q82 C;  3R6O A;  2RHU A;  5LJ5 h;  3CME A;  5GAN 8;  1Q86 C;  4JUV A;  2P0K A;  1XOV A;  3QJ6 A;  2M0O A;  4M75 A;  3OA6 A;  1VQO T;  2LCL A;  3GF5 A;  2EQU A;  4C92 D;  2DJZ A;  3E9F A;  2RK1 A;  1NPP A;  4OP0 A;  4A4G A;  1VQ4 A;  1WJR A;  1XNI A;  2EFI A;  4PJO C;  2OTJ A;  4M77 E;  2LC4 A;  2Y90 A;  2E6Z A;  2E12 A;  3OW2 S;  3OYA A;  3PGG A;  2M16 A;  2X35 A;  5GAM h;  2JTM A;  3QZ5 B;  5I21 A;  5LL6 S;  3CBP A;  3QG1 A;  5LJ3 h;  3JSC A;  2X4J A;  4N4I A;  1VQ5 T;  3J81 E;  3I56 A;  2XD0 A;  1Y71 A;  2EKO A;  2O4X A;  4BE1 A;  1M1K U;  1O75 A;  2L3R A;  5GAN j;  2HD0 A;  1WPY A;  5GAN g;  2VC8 A;  3MEA A;  4M78 A;  3CCV T;  2K2V A;  2E64 A;  1UB4 A;  2A7Y A;  5CKB A;  3UPU A;  4B9X A;  4M78 G;  4PLI A;  4QW2 A;  4FM4 B;  3JCM V;  4ZGE B;  4MZM A;  2PQW A;  3TCJ A;  3VUZ A;  1W4S A;  5LJ5 f;  4BUG A;  4C5G A;  1S72 T;  3MEV A;  1I4K 1;  4L5G A;  5KCH A;  1RI0 A;  1YJW T;  1VQ7 T;  2KSS A;  3JB9 H;  1LJO A;  3PMI A;  2R57 A;  3FB9 A;  3HRS A;  3SWN C;  3N5B B;  4C0G A;  5C6S A;  2XG8 D;  1VQ9 T;  1VQM T;  2EQJ A;  2E5Q A;  3UWN A;  3RER A;  4FIB A;  3CCR A;  1Q7Y U;  3V8K A;  1M1F A;  1VQM A;  1MGQ A;  2LTO A;  4C92 A;  4Q5W A;  5LJ5 d;  1G3Y A;  3CC2 A;  1D3B B;  3FEO A;  2XI9 A;  4OGE A;  1W2B S;  2KAF A;  1JB0 E;  4GY5 A;  2KY9 A;  3C95 A;  1VIE A;  5J3B A;  5GAN h;  5CAI A;  4JRI A;  5IAY A;  4VUB A;  3CBO A;  4FU6 A;  3DLM A;  3JCM W;  1BKB A;  3V8L A;  1QVP A;  4QQD A;  4XTV A;  4PJO E;  5CIU A;  4A4K A;  4OB3 B;  4BE2 A;  2PVD B;  4QVZ A;  1WJQ A;  1GXI E;  2RHX A;  3JCM e;  4R55 A;  1WQ7 A;  3TEE A;  3M53 A;  4JS4 A;  3QYG B;  5DLQ E;  3PNW C;  3JCM X;  5DM7 R;  4C5E A;  4E7I A;  1VQN T;  2MWP A;  3I56 T;  2K4Y A;  4XK8 E;  3INZ A;  4J6W A;  3DB4 A;  3VKI A;  1QP3 A;  1I81 A;  3FDR A;  2WSE E;  5GAM f;  1YI2 A;  3PFS A;  1UGR B;  4C8Q E;  5AYF A;  4LDW A;  4RKU E;  2JUF A;  4XTW A;  3RUX A;  4QQG A;  4CRI A;  1Q7Y C;  4F7U B;  4PNO A;  5GAN 5;  2RM4 A;  3NTK A;  3OBW A;  2QTX A;  4QVD A;  4IUV A;  4IUQ A;  4JLG A;  2PVO B;  1KD1 C;  3URG A;  4J7I A;  1VQO A;  1M4Z A;  3OMG A;  3GP8 A;  3JCM b;  1YJN A;  4OB1 B;  5L8R E;  3S3M A;  2R5A A;  3MP1 A;  4M7D G;  3GLX A;  1M1K C;  2HAX A;  5FLX E;  2BKD N;  1BIB A;  2P0Q A;  1M8V A;  4EMK A;  5LJ5 e;  3TU4 K;  5GAN d;  1K9M C;  3G71 T;  4M75 E;  3CCU T;  1VQ8 T;  2V8J A;  2JOY A;  2ZCF B;  2QQS A;  3FIF A;  4M77 A;  1I8F A;  3SD4 A;  1RL2 A;  4A4H A;  3J80 E;  3JB9 I;  3G4S T;  3OYC A;  4C8Q A;  3JCM J;  3X25 B;  3OYI A;  4HT8 A;  1YI2 T;  3JB9 J;  3HKS A;  4EDU A;  1AHJ B;  2M9U A;  3FLG A;  3ZFJ A;  5M9O A;  4C8Q G;  3X20 B;  2EJF A;  2K57 A;  1JJ2 S;  3A8O B;  2QQR A;  5KH6 A;  3AHU A;  3EAE A;  4ZGD B;  2DZ9 A;  4EMK C;  3OYL A;  2QXF A;  5GAO q;  2FB7 A;  4M7A C;  4XQ3 A;  2L8D A;  3RKY A;  4BY6 C;  4E7H A;  5DY9 A;  2D6F A;  2K5F A;  1KHC A;  2KDS A;  2MF2 A;  4M78 E;  3VV0 A;  3QJY A;  2RI5 A;  2XU8 A;  3CCJ A;  4Z02 A;  1KD1 U;  2RHZ A;  2LDM A;  3QXE B;  4BI3 A;  2FVU A;  2L89 A;  5LJ5 j;  4F7U A;  4HT9 A;  2WSC E;  4FSX A;  4ZGJ B;  3OS1 A;  3M4Y A;  4JS5 A;  3E19 A;  3MCA B;  4PKC C;  3QBY A;  3GPL A;  2DTI A;  2XID A;  2HQE A;  2QQB A;  1FX7 A;  1P92 A;  4C8Q F;  1Q86 U;  1MHN A;  1B34 B;  2CS7 A;  1YIT T;  4XTZ A;  3OS2 A;  2LRQ A;  3TRE A;  3CC2 T;  3HP9 A;  4LDU A;  5GAN 6;  2MWO A;  2EJG A;  2ZPE B;  5FU7 C;  5I2M A;  5GAN 3;  2DXT A;  5CKF A;  3LWI A;  1VQ5 A;  3MO8 A;  3RMS A;  1Y7X A;  4ZN3 A;  3L2Q A;  2JZ2 A;  4C92 E;  5LJ3 e;  4C8Q B;  1VQ9 A;  4KBM B;  1UGP B;  2DTH A;  3BW1 A;  2ZPB B;  3DLL A;  2ZZD A;  4BDY A;  3OMC A;  4BE0 A;  2RJE A;  4LD6 A;  3OY9 A;  3DKM A;  5GMK m;  2RJC A;  4OVA A;  4MDW A;  2G3R A;  5FRO A;  3OYF A;  1M1G A;  1LOJ A;  4C0Z A;  1NE8 A;  4PJO B;  4J7F A;  3OYD A;  2PVG B;  2LT4 A;  3GNG A;  3OSS C;  4MML A;  2MMP A;  1OZ2 A;  4IUU A;  2EJ9 A;  1YJN T;  5CVI A;  2VGN A;  5GAN 2;  2V8K A;  2DK3 A;  3QUI A;  2E6N A;  3BY7 A;  3CCV A;  3A8L B;  1K73 C;  3X28 B;  4FT4 A;  4EPC A;  5HK0 A;  2LQK A;  5GAM g;  3VU3 C;  1JBM A;  2EWN A;  2ZPF B;  2X4W A;  1OI1 A;  3P8D A;  3QYH B;  2QQA A;  1N6A A;  2RD1 A;  1X01 A;  1M9S A;  4X9D A;  3RKW A;  4A53 A;  3G7Z A;  2F69 A;  1N8R U;  1K8A C;  3QPH A;  3MEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...