1YI2Q

Crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1yi2Q00
2QEXQ 3CCUQ 2QA4Q 1QVFP 1VQ6Q 1YIJQ 1Q86R 1VQ7Q 1Q81R 1VQOQ 1YJWQ 3CC2Q 3G6EQ 3CPWP 1M1KR 1KQSP 1VQKQ 1VQ4Q 3CC7Q 3I55Q 1VQPQ 1QVGP 1NJIR 1VQ8Q 1JJ2P 1YHQQ 1N8RR 1M90R 3I56Q 3G71Q 1VQ5Q 3CCMQ 1W2BP 1K9MR 1YJNQ 3CCJQ 1Q82R 3CMAQ 1K73R 3CCRQ 3CMEQ 1YI2Q 1K8AR 3CXCP 3CCLQ 1KC8R 3OW2P 1Q7YR 3CD6Q 1VQLQ 1YITQ 3G4SQ 1YJ9Q 1VQ9Q 3CCQQ 1KD1R 1VQNQ 3CCSQ 3CCVQ 2OTJQ 3CCEQ 3CC4Q 1S72Q 2OTLQ 1VQMQ
chains in the Genus database with same CATH superfamily
2NUPB 3E1SA 2DE0X 2B86A 5FWCA 2DA9A 4F7UF 3HTRA 4JRQA 2QA4T 2DD4A 3L2QA 2F2VA 3VS2A 1VQMA 2M0YA 2HD0A 3M54A 2X3WD 4VUBA 1H641 3EFSA 2O4XA 1IB8A 3CC2A 3RMSA 4HT8A 1NG2A 5CK9A 3PIOA 4QKUA 2CP3A 4DBRA 2RJCA 4KH0B 4PLIA 3C4SA 4O6JA 1VQLA 1BCMA 1UGVA 4KGZB 2COYA 4LDYA 3VS5A 1N8RC 3VUZA 5KE3A 2DTIA 1XQHA 2JM9A 1IREB 3MEWA 2O01E 4PJMA 2KT8A 1PD1A 2HMAA 4J7FA 1VQMQ 4XTZA 4KULA 2QQBA 3CCET 1N9SA 5KCHA 3CC2Q 2X4JA 4MZPA 1N9RA 1N27A 3VJPA 3JCMQ 1T3SA 4M78E 1QVGA 4ME7A 2XHCA 3MJXA 3H0IA 3LWIA 2RQVA 1Q82R 5ECAA 4B9WA 3OW2A 1VQLQ 5FRMA 2X35A 2EPDA 4DOVA 1NLPC 2VWFA 1VQ7T 1BU1A 2LQ8A 5A2QE 2OTLA 4DOWA 4M78C 5GAOl 1K9MR 1WYXA 2FHDA 3G6EA 1I1JA 2DL7A 2O9VA 4J9HA 3CXCA 5KYXA 1IXDA 2CP6A 1TXQA 3CBPA 1ZA1B 3LGFA 1LPLA 2JS0A 2RI3A 3KUFA 2BE9B 4DBQA 1VQ4T 2K3BA 4M7DA 2ZPEB 3CC7T 1PRLC 1SRLA 2K6DA 4J9IA 5GANd 3OS2A 4X9DA 2JMCA 3PGGA 4E47A 3CCMT 1W6XA 2AHJB 2X4XA 1U1TA 1AEYA 5EC7A 2OTLQ 2VUBA 3CMAA 2SRCA 1BIAA 3CD6A 2KT1A 2QEXT 5GMKi 3G6EQ 3NTKA 3V7RA 3WVEB 5LL6S 2YRDA 4IUUA 1IO6A 2FPEA 1VQPT 1EZZB 4RKUE 1O75A 1Z9QA 2YUQA 3A1PA 3V8LA 4AMCA 1Y7XA 1YWOA 1E6HA 1BKBA 2EQJA 1VQ5A 2J6OA 2EJ9A 3OYJA 3MKDA 2DPPB 1VYVA 3WVDB 2HAXA 3HHTB 2JVVA 1Q86U 2KI7A 2A08A 1TUGB 4C8QA 2MAMA 3H8ZA 4FSSA 3CMAQ 3SEMA 3CD6Q 2XD0A 2JN0A 3DLLA 2EIFA 2YUPA 3LYIA 3ZL7C 1KC8C 1K73U 4KUDK 2CDTA 2Y4XA 4HCKA 3S3OA 1JBMA 4RG2A 1X69A 4RTXA 3EH1A 5L23A 3OYIA 1JRIA 4DBFA 2KNBB 3CCUA 2RA2A 2XU8A 1BIBA 4OF1A 1VQ5Q 2AKLA 2PVOB 3KXTA 4QQDA 3META 1NJIU 2DVJA 2QQRA 1X2KA 5KYNA 5GAN2 3M57A 1Q7YU 1G83A 1MMGA 3V8JA 3OYKA 6AT1B 1YJWQ 1ZQ1A 1VQ6T 2AK5A 3CCSA 2CUBA 4JRIA 2MCNA 1PD0A 1KSWA 1ZUKA 4OB1B 2LJ1A 3SB2A 5I21A 2BKDN 3OS1A 1PKTA 5DLQE 1R0BG 3SD4A 4M7DE 3QHSA 2DMOA 2KRSA 2ABLA 3A98A 3CCUQ 2P84A 1YITA 2K2MA 2MOXA 3CCVA 1AHJB 5D7UA 1HK9A 1QW1A 4Y28E 5KE2A 3JCMg 2FRWA 3OQ5A 4R0KA 3CCSQ 3LLRA 4M7DC 2EYQA 1TOVA 4M77D 4QVDA 1WXUA 3L2VA 1T3LA 4XAXB 2DJQA 4BDZA 3BDUA 1KQSS 1AWJA 1CSKA 4HVUA 3UA6A 1J3TA 2LJ3A 3OYHA 1PSEA 2RQRA 4AFQC 1ABOA 2LCCA 2RJEA 2QGGA 1YITQ 2LZ6B 2DM1A 3H0HA 3JSCA 3CCVQ 4C8QE 3PT9A 3VS6A 1BBZA 1VQ9T 5FRNA 3VRZA 2KMTA 1QVFS 4M75D 2FPFA 2DZCA 2DETA 2E3IA 1FXXA 1QP3A 4RTUA 2F5KA 1VQ4Q 1U3OA 5GJWB 3X20B 3X26B 3DKMA 2HEQA 2RI2A 5CIUA 2LVMA 3D7SB 3CBMA 5CKEA 4E7SA 1D0YA 2L3SA 4C0FA 2DRKA 1R8OB 4BI8B 4QT7A 4O5VA 4X9CA 4C8QC 1FYNA 4M7AD 1MMAA 4J9FA 4ZTFA 2BZYA 3BW1A 1Q81U 1YIJA 2OI3A 1JEGA 2K3XA 2KRMA 2DD5A 3M9QA 2RB6A 5GAN4 9ATCB 1WFWA 1FWZA 1QWFA 5D6YA 2E1HA 2RF0A 4DEXA 5IHNA 4IIOA 1Q86R 1RAEB 4J9CA 2XG8D 4M77G 3TSWA 3CCQA 5FROA 3CPWS 2ENMA 3CC4A 3X25B 3OYDA 1SHGA 3RBBB 1KQ2A 4LDUA 2DEUA 4ATOA 2KRNA 5FU6C 3TEEA 1K73R 1P92A 1K76A 2ZAEA 1Q82C 5CKHA 1NEBA 2L5QA 1A0NB 1TG0A 1VYTA 2HBPA 2LRQA 2YWWA 1YIJQ 1W70A 2QAZA 4IUTA 5IXFA 5C6SA 2ECZA 4JJCA 2EVRA 4OMMA 3RKWA 3OYMA 1UTIA 1SEMA 4FYVB 1NJIR 2LCLA 4IUQA 1LJOA 1VOMA 2QG9B 4PFZA 4PJOA 1M1FA 3TU4K 2GQIA 2R58A 4PL6A 4QQGA 1Q7YR 1K9MC 3TQ7P 1X2QA 3CCQQ 3CC4Q 1WJSA 4BY6C 1Y07A 2LQWA 3OBYA 4FU6A 1WIEA 2ED1A 2NUTB 1B34A 1H8KA 1QLYA 3I9QA 4M7AG 2EFIA 1FMVA 4ZGDB 2VV5A 5GAOq 2CSIA 1D09B 1OU8A 1B7TA 4KGXB 3ZFJA 2FVUA 3EGXA 4YTLA 1WX6A 2FZCB 3OMCA 1R0CB 4C0DC 2LMJA 2JT4A 4EMKA 2LCSA 1VQMT 4M78B 3JCMd 3CC2T 1ZBJA 4N4IA 2IG0A 3L1AA 3OS0A 1H92A 2K2VA 4EPCA 2EGEA 4IUPA 4QVCA 1T0JA 1VIEA 3E19A 1PCXA 2KBTA 1WHMA 2E6ZA 3I56A 1VQLT 1C0MA 1D0XA 1XNIA 2K4YA 3CCLA 2ZPGB 4TVRA 5KYUB 1YBYA 3HKSA 2WACA 3VS1A 1KIKA 2E41A 1VIFA 3Q1JA 3QDRB 2DVEA 1Y0MA 3HFOA 1MV0B 3JRZA 2OAUA 2GBQA 1WXBA 2JUFA 3E9FA 4L59A 1M4ZA 1SRMA 2HSEB 4E7ZA 2X4WA 2YDLA 3G4SA 2WSFE 1YFNA 5FLXE 2DZ9A 3TSZA 3UATA 3I56Q 1AVZC 1M8MA 5KH6A 4UC4A 1AWOA 2HBWA 3CCLQ 1CKAA 4PFOA 3JCMP 2WSCE 4M77F 1OPLA 2O4XB 2RQWA 2DL5A 1M90U 4E7HA 1RAFB 4LDVA 5GMKe 4PJOE 3A8GB 3JCMV 1Q81R 2OTLT 5GANg 1KHIA 3JB9J 4KUIA 1S72A 3S3NA 3QSUA 1GRIA 1YNZA 3G6ET 2PVGB 3OYBA 1G3TA 2CT4A 2K5FA 1GBRA 1OU9A 2K3YA 3G4SQ 2F1LA 4M75F 2DAQA 4RTZA 3G7ZA 4J8OA 1TSFA 1V1CA 4PJOC 2LT1A 3ASKA 1WHJA 1ZA2B 2E5QA 3A8HB 2DBKA 5CVIA 1QVGP 1MV3A 4AFSC 3ZBDA 3O5ZA 2BIVA 1W1FA 4RMOA 1SPKA 2CSQA 3TCJA 2CS7A 2RHIA 3OW2P 1JXOA 2DIGA 1X43A 3MEUA 3CMAT 4RCCA 4M7AF 2OX7A 3CD6T 4M75A 2QDYB 2HSPA 1S72Q 2QASA 4ELZC 3M4YA 3VRYA 4IKFA 3NPFA 1UUEA 2HQHA 3VUBA 2MWPA 2F2WA 2F2XA 4ZGEB 4EMKC 1GL5A 4Z89A 3CXCP 1VQ5T 4N4GA 4KH1B 2H8HA 3MP1A 2E10A 3FJ5A 2ZZDA 5KYXB 3GP8A 4J6XA 3AHUA 2QYZA 4CC2A 4II1A 4F7UA 1PHTA 5CQXA 1YJWT 2X4YA 4JS4A 3OB9A 3PVLA 3CBOA 2ZPBB 2EKHA 3M53A 5HY6A 2SEMA 2P4TA 1W2BS 4M7DB 5D6WA 1QP2A 1NBEB 2J06A 3UDCA 5I2MA 3R6OA 2QGFB 4C92D 2QK0A 2Y4YA 2L2PA 1SKUB 5AYFA 3JB9I 2RQTA 1M2VA 3CCUT 1QMCA 4FL6A 3RESA 2GGRA 1TH7A 2G6FX 3MEAA 3MP8A 2BZ8A 4IIMA 1BK2A 1RAIB 3EGDA 3JCMe 1OEBA 1WDXA 3OY9A 3CCST 4OB2B 1OX8A 1ABQA 1Q86C 2KK4A 2E12A 4J9GA 1G5VA 2KE9A 2JNGA 1LVKA 3JCMJ 3PMTA 3A8MB 5GAOm 5KYYA 2PQWA 2DXUA 1VA7A 4KT0E 3V7SA 3KFVA 1K73C 4C8QB 4OMNA 1WZOA 2DK3A 1OPKA 4OGCA 2VVKA 1YITT 3TREA 2EYYA 1X75C 3BFMA 1KJWA 3CCVT 1M1GA 4P5NA 1WPYA 1VYUA 2CZ6B 2DIQA 1KD1U 3MCAB 3X28B 1ACMB 4C5HA 1M90R 1NJIC 4M4ZA 2COWA 4AFZC 4V2SA 3U23A 4D6WA 3VS3A 1VUBA 3NTHA 4LDXA 4PNOA 1OULA 3VYHB 3M56A 3GNFB 1Q7YC 2COZA 3HSBA 4C92G 1OQKA 2AT1B 3E2UA 3REBB 2KDSA 3OBWA 5IHKA 1ZHIA 1YCSB 1NYFA 1VQNA 5FU6B 1RABB 1PRMC 4A53A 2MWOA 3VV0A 4MMKA 4M75C 2Y90A 4PJJA 2VASA 4F7UE 3PIPA 4E7LA 3C0CA 2YSQA 3CEYA 3QPHA 4Y91A 2MMPA 3QJ6A 4HVWA 2DYBA 4KRTA 3UWNA 1WXTA 3SWNA 2V8KA 2GTJA 2EAYA 4HXJA 1D1BA 2GNCA 5GAMg 5GMKm 5LJ3d 4JLGA 1K4US 3VS0A 5CKBA 1I8FA 3EG9A 3M0RA 1QVPA 4ZGJB 3MO8A 4C5GA 4BY6B 3I35A 2EGCA 3M5AA 2B8AA 4C5IA 1VQNQ 2VB6A 4OMPA 2RNAA 5AT1B 5A0LA 1M3BA 3A8LB 1YJNA 1PWTA 2DL4A 2P4RA 1IHVA 1I81A 1YIJT 4F17A 2ZPIB 3REAB 1K9AA 2JTFA 4A4GA 5GAOr 4XU1A 3H6ZA 1M2OA 2KEAA 1Y71A 3EG1A 4C0DB 1RI9A 1GCQA 3S3MA 2V26A 3JCMf 1H3HA 2YUNA 2GFUA 3CCQT 4JJDA 3CC4T 3FC3A 3EFOB 3PE0A 4J5YA 1Q95G 2NLUA 5FWBA 3M0UA 1JJ2A 2XKOC 1RAAB 5IXBA 4LUDA 2XDDA 4N4HA 1YJNQ 4ZN3A 2LX9A 5J3BA 1UE9A 4Z8AA 4J9EA 2J05A 4BI4A 1NM7A 2AZSA 3QO3A 3FJPA 2QQ9A 2CGHA 1WHLA 1Q81C 1WGSA 2VC8A 1MMDA 3ER0A 1NZ9A 3O8VA 2FZKB 2J6KA 4LUEA 2CREA 2LQKA 4L6V5 4AG1C 4J6WA 2L3RA 2K57A 4M78D 3SFMA 1KQSA 1I0CA 3BDLA 2HL5C 3QUIA 1M8VA 2RD1A 2L89A 1KHCA 2RQUA 1I5OB 3BE3A 4C92F 3M0PA 1ZLMA 2E64A 3J7AF 1KD1R 4CC3A 2EQIA 2AZVA 5KCOA 2CT3A 5LJ5d 1QVFA 2CH4W 3JB9G 2DERA 1KC8U 3EFOA 5IAYA 3C94A 4HA8A 2JZ2A 3JCMb 2CKKA 2VGNA 1QCNA 2D1XA 1QQJA 2P0QA 3SWNC 3I56T 1EX4A 5J26A 3I55A 4HCCA 2A0FB 2RHXA 4PJOB 4CI0C 3CCLT 2R5MA 5GAN6 1NEGA 3NFCA 1AT1B 1UFFA 1ZSGA 5GANe 1G2BA 2KYBA 2ED0A 1B34B 1Y96B 1M1KU 5A0GA 5GAMd 1WLPB 2PNIA 2FRYA 2VXEA 1U06A 3M0TA 3RKXA 3G4ST 2J7IA 2HQEA 3EGXB 3SDZA 4L5GA 2I0NA 3GNGA 1GCQC 4M78G 3CPWA 1EIFA 4BE0A 4EMKB 5CQYA 3I55Q 2DL3A 2RJDA 2R5AA 2EQKA 3RIRA 2EGAA 2X3XD 2KYMA 3S6WA 7AT1B 1SSFA 2MIOA 5LJ3e 3M59A 4HCBA 2AIRB 1OI1A 2L0AA 3M0QA 1S72T 1HYOA 2HCKA 4B6MA 5CKFA 2RM4A 4KBMB 2V8JA 3V7CA 3FDRA 4JLIA 4JPBW 3VKIA 4FYXB 1UJYA 2GQVA 1VQ8A 1KK7A 1HSQA 2RMOA 1V29B 1YHQA 4ORZA 4XTXA 5GMKj 1JU5C 3CCJA 2NUZA 4MZTA 2A36A 2HDAA 1Y96A 2F69A 2PUOB 1YJ9A 2HZYA 1LNXA 2RJFA 3QXEB 1FMKA 5GAN8 2VYTA 2XK0A 1SG5A 2C06A 2QQAA 4BE1A 3LW5E 4MDWA 5EG2A 3GLXA 5GAN7 3OMGA 1BI0A 1X6BA 3H41A 2KSSA 2DYIA 2RPNA 1GBQA 2JOYA 2EQUA 4E6RA 1IGQA 1VQ8Q 1E7OA 2HL3A 3LGLA 1YHQQ 3EH2A 1WQ7A 1N6AA 3CCJQ 3HP9A 4LN2A 4OVAA 2M02A 4A4FA 3QG1A 4BACA 2QI2A 4NL3A 4GLMA 1YJ9Q 1RLQC 1GFCA 2EBPA 1WJRA 2KQWA 2KY9A 1PNJA 2CP0A 2JM8A 3EHRA 4PJLA 5GANf 4C92C 1KFZA 4LDWA 1XOVA 4FW2A 3UPUA 3GPLA 3OYFA 1KG1A 2K7AA 3INZA 5C0MA 1T0HA 2M0OA 2D6FA 2DTOA 2H3JA 1KC8R 2DILA 1FMWA 4WCIA 2LDMA 1K8AU 1UB4A 3OA6A 1MGQA 3R6NA 2I2LA 4C0GA 4M75B 1BI3A 4ZN1A 4ELYC 2IIMA 1PC0A 3RKYA 1VQOA 2RH2A 5LJ5e 5GMKh 1XTDA 2RI5A 4C8QD 1RL2A 2RHZA 5I22A 3FEOA 4M78F 3P8BB 1PSFA 1JO8A 4K11A 5LJ3f 1M3AA 3L2RA 1IRXA 3CMEA 2DXTA 4XQ3A 2A3LA 1M1KR 2OTJA 2YLCA 2IVWA 3J81E 1TS9A 4MDXA 1UG1A 4F7UB 3OS5A 4KGVB 3OYYA 4M7DG 2DNUA 8ATCB 2H3EB 3HL8A 2KXDA 2JW4A 3GIBA 4FIBA 1OZ2A 4M77A 2ZPFB 1IZ6A 1VQOQ 4FSXA 4QW2A 4JDSA 1G8XA 3NMZC 1F1BB 5GAMe 3EG3A 3VU3C 2FEIA 2C0OA 1YCYA 4C5EA 1M2VB 4JS5A 3X24B 1AZEA 3A5ZB 3CMEQ 1VQKA 3J80E 3H0FA 2YXYA 4BD3A 2ZPHB 2OTJQ 3G71A 2L3QA 5LJ3g 1AD5A 1VQNT 3EGDB 2HKQB 1N5ZA 1RACB 2DX1A 3E9GA 4FT2A 2DBMA 2FZGB 5IH2A 1BI1A 4AT1B 5I11A 3P8DA 3IQLA 1MNEA 1TU0B 3QIIA 5KYYB 4C8QG 4FW1A 3QWYA 4PJNA 1D3BB 4PKCC 4EMGA 4XTUA 4WF2A 1MNDA 2E6NA 4M7AA 1KD1C 3HRSA 4HCZA 2D0NA 1IGUA 2ESWA 4J7IA 1VQKQ 4B9XA 3NGPA 4JRPA 2QQSA 4RUGA 3G71Q 1W2BA 4FM4B 4FYWB 1YJNT 3VS4A 1D1CA 5I2SA 1UGRB 4N0AA 3M58A 3LWHA 3QDFA 2LT4A 2QTXA 2JMAA 2DO3A 2DKGA 2LX7A 3QWXX 4A54A 3JCMh 5LJ5f 4E7IA 4OMQA 1ZSZA 4FCYA 1AOJA 5HK3A 2EQMA 1I4K1 1LOJA 2D9TA 1K0XA 4LNPA 3CCRA 1YI2A 2DTHA 1TUDA 1PM3A 2FYKA 1ZX6A 3M0SA 3QJYA 2FB7A 2V1RA 2P0KA 1X6OA 1NLOC 4M77E 3SWNB 3QYGB 4OMFB 4HVVA 1S1NA 4EDUA 3DB3A 1QVGS 1PKSA 1SHFA 2LP5A 2CP2A 2MPXC 1K8AR 1XJWB 3JCMW 1D3BA 4C0ZA 5FU7C 5D6XA 2NUPA 2OAWA 2XICA 3OW2S 1ZUUA 3EG9B 3LH5A 1M5Q1 1GCPA 3NHNA 4E2FB 3QKJA 4XTWA 3T9NA 1NPPA 3OYNA 1WNLA 5GAMf 4M7DF 2JTMA 4M75E 4M77C 3H9NA 2W10A 2DFUA 2ROLA 3FLGA 5LJ5g 4XU0A 1SSHA 3CCRQ 1YI2Q 3SHWA 3TVTA 3UF4A 3CXCS 4XK8E 4RTWA 2CUDA 4LXCA 3PVQA 2IPOB 1C6VX 1R77A 1Y57A 2V8IA 3UA7A 3EG0A 5J39A 4M7AE 1JJ2P 4R56A 3L2WA 4PJOD 1V76A 1N8RU 1WI7A 4DQ2A 2AKKA 4OB0B 2A37A 2RK1A 3QBYA 2RO0A 3THKA 2GFAA 2ATCB 2JS2A 2EWNA 1M3CA 1E6GA 4OP0A 4CC7A 4C8QF 2QA4A 3BY7A 1ARKA 4ZTJA 4M7AC 3I55T 2C0IA 4J9DA 1I07A 5IT9E 1MMNA 2HQXA 3G1JA 3GOXA 2O31A 1OYXA 1QKXA 2LNVA 1MUZA 1KQSP 5GMKl 1UECA 3M4GA 2FG0A 2FL7A 1SF9A 4N0AC 1YJWA 3MEVA 5GAOp 2EW3A 2YHTA 4F04B 1RAHB 4BI3A 3VS7A 4BDYA 3JB9D 3PNWC 1RUWA 2QA4Q 1QVFP 2G3RA 4D8DA 1JXMA 4LD6A 1Z9ZA 2MF2A 1HXDA 1ZSZC 3RNJA 5GANj 3V8KA 1H3ZA 3CCEA 4BE2A 2PU9B 1WHGA 1BB9A 2M9UA 3EHQA 1X6GA 5GAN3 4OMOA 4X34A 2F5TX 4A4EA 4PJOG 3OSSC 2O9SA 3DB4A 1C1AA 4C92B 5HKCA 4XTYA 3RMQA 3M55A 2LC4A 2CH4A 4RTYA 2X9HA 1AWWA 2M16A 1M1KC 1RLPC 2CP5A 3FB9A 1JJ2S 1VQ7A 1VQ8T 1G3WA 2X51A 2KAFA 3GBQA 1YHQT 3CCJT 3JAME 4BUGA 3CCEQ 5LJ3j 2QXFA 2EYWA 2GTOA 1YJ9T 1RI0A 5HK0A 4X1VA 5GJVB 2K79A 3CPWP 2JJ9A 3QZ5B 1DJ7B 3JCMX 4BB7A 3HPWA 4FT4A 3A8OB 1BYMA 2LQNA 1VQ4A 3CC7A 2L3PA 3RR6A 2KR3A 1ZBXA 3CCMA 3OYCA 3N5BB 4OGEA 3ME9A 5GAOn 2CZ7B 1VQ7Q 1AZGB 3ULRB 1D0ZA 2DXBA 3NTIA 2QEXA 2D8HA 2GCXA 2QDLA 4E7JA 2CYZB 3RUXA 2EYZA 1QCOA 2K5IA 4J9BA 1VQPA 3ZEHA 2DXCA 4C92A 1UGSB 5GANh 2XIDA 4NOYA 4F16A 3EGUA 4A63B 2XDPA 3RDVA 4RG8A 2R57A 3L42A 2JXBA 1AWXA 1B07A 1D1AA 1U1SA 2KROA 4Z88A 3CC7Q 4DBHA 4LD9K 1N8RR 4J6YA 3CCMQ 4JZ4A 4D8KA 2EKOA 2V1QA 5A0DA 2MYSA 5M9OA 3VYGA 2YUOA 4PK4A 2M51A 2QEXQ 1UHCA 3EFRA 5GAN5 2PZ1A 2CZ1B 4PLLA 4CRIA 5KYWB 1TUCA 2KXCA 1UJ0A 3GF5A 1YWPA 1VQOT 1WA7A 2GF7A 1VQPQ 4HKEA 5DY9A 2NWMA 5LJ3h 1GXIE 2JTEA 1BI2A 2EJGA 4MMLA 2L8DA 3MHXA 3CMET 2FPDA 3LX7A 3LH0A 2Z0WA 2KVQG 3PTAA 4EMHA 4GBQA 3P8HA 2OTJT 1GFDA 4FYYB 4DEYA 5IHIA 1RAGB 4F14A 4ESRA 2KGTA 1VQ6A 4PJOF 1UHFA 5LJ5j 2XI9A 4QVZA 4RCBA 1OZ3A 2DRMA 3HFNA 1K8AC 1O9SA 3I5RA 2DLPA 3OSVA 2E65A 1QWEA 2FO0A 4M75G 2VKNA 8AT1B 2ZCFB 3F70A 1OV3A 1VQKT 2RHUA 3HRTA 4MZMA 2RK2A 1UGPB 2O88A 2ZGWA 1RADB 1FX7A 1X27A 4J83A 3G71T 3MPUB 1M90C 3I5SA 3OYGA 2W0ZA 1JB0E 5KYWA 4A4HA 2RHYA 1VQ6Q 2CZ0B 1X01A 1WHKA 3MP6A 4DA4A 4C92E 4IURA 1LCKA 5GAMj 1PG5B 3AT1B 1M27C 1OOTA 3PMIA 5FU7B 2CP7A 2ROTA 1IHWA 2E70A 2K5LA 2DEQA 4RTTA 4F7UG 4Q5WA 4M7DD 1BCOA 3JB9F 3URGA 2DF6A 2XDBA 2A28A 2WSEE 3UT1A 4R55A 4AG2C 1JQQA 1G3YA 1TWBA 2DL8A 2P0PA 1UDLA 2YRCA 3PFSA 4NS5A 3HRUA 4JJNK 4M77B 2YRVA 3OYEA 1WHHA 4Y92A 2E4HA 4IUVA 1VQ9A 3OYAA 5DM7R 2PTKA 2M1HA 4RTVA 2J6FA 4OB3B 2K9GA 1WQWA 3JV3A 3EAEA 4XU2A 1M30A 3FRNA 2NYSA 4CC4B 1Q82U 2BTTA 4OMLA 2QTVA 5LJ5h 2BUDA 5CKDA 4A4KA 3WXMB 2EYXA 1U8RA 1I5LA 4ANJA 5HCKA 2MI6A 4QQ6A 2D0QB 2PVDB 4XTVA 3CCRT 1OX9A 1YI2T 2LNHB 4GLKA 1VQ9Q 2VGMA 1M9SA 2NUTA 1HJDA 1K9MU 1QCFA 1U5SA 2A7YA 5CR2A 3EG2A 5CAIA 4PFPA 4WTOB 4M7AB 1ZUYA 3FIFA 1NE8A 1KQ1A 1CKBA 2E3HA 3C95A 4EIKA 4HT9A 2EJFA 1W2BP 3L2ZA 1G3SA 2HKNA 2XMFA 1B3QA 2VXFA 1UGQB 3QZ9B 1W4SA 4GY5A 1TTHB 1QKWA 3QYHB 2RN8A 5CCAA 1NPRA 5GAMh 3C12A 4M78A 3L2UA 4JJBA 4E7KA 1YP5A 1K1ZA 4XU3A 4ZNXA 2DJZA 2BZXA 3RERA 4Z02A 4AFUC 4LE9A 2MK5A 1K0SA 2OJ2A 1WJQA 1YN8A 4JRKA 4JZ3A 2C0TA 1MHNA 2LTOA 2HNIA 4NL2A 3JB9H 1ZSZB 2PUKB 5L8RE 5KYUA 2LJ0A 3CPFA 2BE7D 5DLOA 3OYLA 1HD3A 1NYGA 2YT6A 2D8JA 3JCMc 3CQTA 2E5KA 1EFNA 5IN1A 2YLBA 1UEBA 2O2OA 3DLMA 5CO7A 3KBGA 4JUVA 5FW9A
chains in the Genus database with same CATH topology
2QEXQ 3CCUQ 2QA4Q 1QVFP 1VQ6Q 1YIJQ 1Q86R 1VQ7Q 1Q81R 1VQOQ 1YJWQ 3CC2Q 3G6EQ 3CPWP 1M1KR 1KQSP 1VQKQ 1VQ4Q 3CC7Q 3I55Q 1VQPQ 1QVGP 1NJIR 1VQ8Q 1JJ2P 1YHQQ 1N8RR 1M90R 3I56Q 3G71Q 1VQ5Q 3CCMQ 1W2BP 1K9MR 1YJNQ 3CCJQ 1Q82R 3CMAQ 1K73R 3CCRQ 3CMEQ 1YI2Q 1K8AR 3CXCP 3CCLQ 1KC8R 3OW2P 1Q7YR 3CD6Q 1VQLQ 1YITQ 3G4SQ 1YJ9Q 1VQ9Q 3CCQQ 1KD1R 1VQNQ 3CCSQ 3CCVQ 2OTJQ 3CCEQ 3CC4Q 1S72Q 2OTLQ 1VQMQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX Q;  3CCU Q;  2QA4 Q;  1QVF P;  1VQ6 Q;  1YIJ Q;  1Q86 R;  1VQ7 Q;  1Q81 R;  1VQO Q;  1YJW Q;  3CC2 Q;  3G6E Q;  3CPW P;  1M1K R;  1KQS P;  1VQK Q;  1VQ4 Q;  3CC7 Q;  3I55 Q;  1VQP Q;  1QVG P;  1NJI R;  1VQ8 Q;  1JJ2 P;  1YHQ Q;  1N8R R;  1M90 R;  3I56 Q;  3G71 Q;  1VQ5 Q;  3CCM Q;  1W2B P;  1K9M R;  1YJN Q;  3CCJ Q;  1Q82 R;  3CMA Q;  1K73 R;  3CCR Q;  3CME Q;  1YI2 Q;  1K8A R;  3CXC P;  3CCL Q;  1KC8 R;  3OW2 P;  1Q7Y R;  3CD6 Q;  1VQL Q;  1YIT Q;  3G4S Q;  1YJ9 Q;  1VQ9 Q;  3CCQ Q;  1KD1 R;  1VQN Q;  3CCS Q;  3CCV Q;  2OTJ Q;  3CCE Q;  3CC4 Q;  1S72 Q;  2OTL Q;  1VQM Q; 
#chains in the Genus database with same CATH topology
 2NUP B;  3E1S A;  2DE0 X;  2B86 A;  5FWC A;  2DA9 A;  4F7U F;  3HTR A;  4JRQ A;  2QA4 T;  2DD4 A;  3L2Q A;  2F2V A;  3VS2 A;  1VQM A;  2M0Y A;  2HD0 A;  3M54 A;  2X3W D;  4VUB A;  1H64 1;  3EFS A;  2O4X A;  1IB8 A;  3CC2 A;  3RMS A;  4HT8 A;  1NG2 A;  5CK9 A;  3PIO A;  4QKU A;  2CP3 A;  4DBR A;  2RJC A;  4KH0 B;  4PLI A;  3C4S A;  4O6J A;  1VQL A;  1BCM A;  1UGV A;  4KGZ B;  2COY A;  4LDY A;  3VS5 A;  1N8R C;  3VUZ A;  5KE3 A;  2DTI A;  1XQH A;  2JM9 A;  1IRE B;  3MEW A;  2O01 E;  4PJM A;  2KT8 A;  1PD1 A;  2HMA A;  4J7F A;  1VQM Q;  4XTZ A;  4KUL A;  2QQB A;  3CCE T;  1N9S A;  5KCH A;  3CC2 Q;  2X4J A;  4MZP A;  1N9R A;  1N27 A;  3VJP A;  3JCM Q;  1T3S A;  4M78 E;  1QVG A;  4ME7 A;  2XHC A;  3MJX A;  3H0I A;  3LWI A;  2RQV A;  1Q82 R;  5ECA A;  4B9W A;  3OW2 A;  1VQL Q;  5FRM A;  2X35 A;  2EPD A;  4DOV A;  1NLP C;  2VWF A;  1VQ7 T;  1BU1 A;  2LQ8 A;  5A2Q E;  2OTL A;  4DOW A;  4M78 C;  5GAO l;  1K9M R;  1WYX A;  2FHD A;  3G6E A;  1I1J A;  2DL7 A;  2O9V A;  4J9H A;  3CXC A;  5KYX A;  1IXD A;  2CP6 A;  1TXQ A;  3CBP A;  1ZA1 B;  3LGF A;  1LPL A;  2JS0 A;  2RI3 A;  3KUF A;  2BE9 B;  4DBQ A;  1VQ4 T;  2K3B A;  4M7D A;  2ZPE B;  3CC7 T;  1PRL C;  1SRL A;  2K6D A;  4J9I A;  5GAN d;  3OS2 A;  4X9D A;  2JMC A;  3PGG A;  4E47 A;  3CCM T;  1W6X A;  2AHJ B;  2X4X A;  1U1T A;  1AEY A;  5EC7 A;  2OTL Q;  2VUB A;  3CMA A;  2SRC A;  1BIA A;  3CD6 A;  2KT1 A;  2QEX T;  5GMK i;  3G6E Q;  3NTK A;  3V7R A;  3WVE B;  5LL6 S;  2YRD A;  4IUU A;  1IO6 A;  2FPE A;  1VQP T;  1EZZ B;  4RKU E;  1O75 A;  1Z9Q A;  2YUQ A;  3A1P A;  3V8L A;  4AMC A;  1Y7X A;  1YWO A;  1E6H A;  1BKB A;  2EQJ A;  1VQ5 A;  2J6O A;  2EJ9 A;  3OYJ A;  3MKD A;  2DPP B;  1VYV A;  3WVD B;  2HAX A;  3HHT B;  2JVV A;  1Q86 U;  2KI7 A;  2A08 A;  1TUG B;  4C8Q A;  2MAM A;  3H8Z A;  4FSS A;  3CMA Q;  3SEM A;  3CD6 Q;  2XD0 A;  2JN0 A;  3DLL A;  2EIF A;  2YUP A;  3LYI A;  3ZL7 C;  1KC8 C;  1K73 U;  4KUD K;  2CDT A;  2Y4X A;  4HCK A;  3S3O A;  1JBM A;  4RG2 A;  1X69 A;  4RTX A;  3EH1 A;  5L23 A;  3OYI A;  1JRI A;  4DBF A;  2KNB B;  3CCU A;  2RA2 A;  2XU8 A;  1BIB A;  4OF1 A;  1VQ5 Q;  2AKL A;  2PVO B;  3KXT A;  4QQD A;  3MET A;  1NJI U;  2DVJ A;  2QQR A;  1X2K A;  5KYN A;  5GAN 2;  3M57 A;  1Q7Y U;  1G83 A;  1MMG A;  3V8J A;  3OYK A;  6AT1 B;  1YJW Q;  1ZQ1 A;  1VQ6 T;  2AK5 A;  3CCS A;  2CUB A;  4JRI A;  2MCN A;  1PD0 A;  1KSW A;  1ZUK A;  4OB1 B;  2LJ1 A;  3SB2 A;  5I21 A;  2BKD N;  3OS1 A;  1PKT A;  5DLQ E;  1R0B G;  3SD4 A;  4M7D E;  3QHS A;  2DMO A;  2KRS A;  2ABL A;  3A98 A;  3CCU Q;  2P84 A;  1YIT A;  2K2M A;  2MOX A;  3CCV A;  1AHJ B;  5D7U A;  1HK9 A;  1QW1 A;  4Y28 E;  5KE2 A;  3JCM g;  2FRW A;  3OQ5 A;  4R0K A;  3CCS Q;  3LLR A;  4M7D C;  2EYQ A;  1TOV A;  4M77 D;  4QVD A;  1WXU A;  3L2V A;  1T3L A;  4XAX B;  2DJQ A;  4BDZ A;  3BDU A;  1KQS S;  1AWJ A;  1CSK A;  4HVU A;  3UA6 A;  1J3T A;  2LJ3 A;  3OYH A;  1PSE A;  2RQR A;  4AFQ C;  1ABO A;  2LCC A;  2RJE A;  2QGG A;  1YIT Q;  2LZ6 B;  2DM1 A;  3H0H A;  3JSC A;  3CCV Q;  4C8Q E;  3PT9 A;  3VS6 A;  1BBZ A;  1VQ9 T;  5FRN A;  3VRZ A;  2KMT A;  1QVF S;  4M75 D;  2FPF A;  2DZC A;  2DET A;  2E3I A;  1FXX A;  1QP3 A;  4RTU A;  2F5K A;  1VQ4 Q;  1U3O A;  5GJW B;  3X20 B;  3X26 B;  3DKM A;  2HEQ A;  2RI2 A;  5CIU A;  2LVM A;  3D7S B;  3CBM A;  5CKE A;  4E7S A;  1D0Y A;  2L3S A;  4C0F A;  2DRK A;  1R8O B;  4BI8 B;  4QT7 A;  4O5V A;  4X9C A;  4C8Q C;  1FYN A;  4M7A D;  1MMA A;  4J9F A;  4ZTF A;  2BZY A;  3BW1 A;  1Q81 U;  1YIJ A;  2OI3 A;  1JEG A;  2K3X A;  2KRM A;  2DD5 A;  3M9Q A;  2RB6 A;  5GAN 4;  9ATC B;  1WFW A;  1FWZ A;  1QWF A;  5D6Y A;  2E1H A;  2RF0 A;  4DEX A;  5IHN A;  4IIO A;  1Q86 R;  1RAE B;  4J9C A;  2XG8 D;  4M77 G;  3TSW A;  3CCQ A;  5FRO A;  3CPW S;  2ENM A;  3CC4 A;  3X25 B;  3OYD A;  1SHG A;  3RBB B;  1KQ2 A;  4LDU A;  2DEU A;  4ATO A;  2KRN A;  5FU6 C;  3TEE A;  1K73 R;  1P92 A;  1K76 A;  2ZAE A;  1Q82 C;  5CKH A;  1NEB A;  2L5Q A;  1A0N B;  1TG0 A;  1VYT A;  2HBP A;  2LRQ A;  2YWW A;  1YIJ Q;  1W70 A;  2QAZ A;  4IUT A;  5IXF A;  5C6S A;  2ECZ A;  4JJC A;  2EVR A;  4OMM A;  3RKW A;  3OYM A;  1UTI A;  1SEM A;  4FYV B;  1NJI R;  2LCL A;  4IUQ A;  1LJO A;  1VOM A;  2QG9 B;  4PFZ A;  4PJO A;  1M1F A;  3TU4 K;  2GQI A;  2R58 A;  4PL6 A;  4QQG A;  1Q7Y R;  1K9M C;  3TQ7 P;  1X2Q A;  3CCQ Q;  3CC4 Q;  1WJS A;  4BY6 C;  1Y07 A;  2LQW A;  3OBY A;  4FU6 A;  1WIE A;  2ED1 A;  2NUT B;  1B34 A;  1H8K A;  1QLY A;  3I9Q A;  4M7A G;  2EFI A;  1FMV A;  4ZGD B;  2VV5 A;  5GAO q;  2CSI A;  1D09 B;  1OU8 A;  1B7T A;  4KGX B;  3ZFJ A;  2FVU A;  3EGX A;  4YTL A;  1WX6 A;  2FZC B;  3OMC A;  1R0C B;  4C0D C;  2LMJ A;  2JT4 A;  4EMK A;  2LCS A;  1VQM T;  4M78 B;  3JCM d;  3CC2 T;  1ZBJ A;  4N4I A;  2IG0 A;  3L1A A;  3OS0 A;  1H92 A;  2K2V A;  4EPC A;  2EGE A;  4IUP A;  4QVC A;  1T0J A;  1VIE A;  3E19 A;  1PCX A;  2KBT A;  1WHM A;  2E6Z A;  3I56 A;  1VQL T;  1C0M A;  1D0X A;  1XNI A;  2K4Y A;  3CCL A;  2ZPG B;  4TVR A;  5KYU B;  1YBY A;  3HKS A;  2WAC A;  3VS1 A;  1KIK A;  2E41 A;  1VIF A;  3Q1J A;  3QDR B;  2DVE A;  1Y0M A;  3HFO A;  1MV0 B;  3JRZ A;  2OAU A;  2GBQ A;  1WXB A;  2JUF A;  3E9F A;  4L59 A;  1M4Z A;  1SRM A;  2HSE B;  4E7Z A;  2X4W A;  2YDL A;  3G4S A;  2WSF E;  1YFN A;  5FLX E;  2DZ9 A;  3TSZ A;  3UAT A;  3I56 Q;  1AVZ C;  1M8M A;  5KH6 A;  4UC4 A;  1AWO A;  2HBW A;  3CCL Q;  1CKA A;  4PFO A;  3JCM P;  2WSC E;  4M77 F;  1OPL A;  2O4X B;  2RQW A;  2DL5 A;  1M90 U;  4E7H A;  1RAF B;  4LDV A;  5GMK e;  4PJO E;  3A8G B;  3JCM V;  1Q81 R;  2OTL T;  5GAN g;  1KHI A;  3JB9 J;  4KUI A;  1S72 A;  3S3N A;  3QSU A;  1GRI A;  1YNZ A;  3G6E T;  2PVG B;  3OYB A;  1G3T A;  2CT4 A;  2K5F A;  1GBR A;  1OU9 A;  2K3Y A;  3G4S Q;  2F1L A;  4M75 F;  2DAQ A;  4RTZ A;  3G7Z A;  4J8O A;  1TSF A;  1V1C A;  4PJO C;  2LT1 A;  3ASK A;  1WHJ A;  1ZA2 B;  2E5Q A;  3A8H B;  2DBK A;  5CVI A;  1QVG P;  1MV3 A;  4AFS C;  3ZBD A;  3O5Z A;  2BIV A;  1W1F A;  4RMO A;  1SPK A;  2CSQ A;  3TCJ A;  2CS7 A;  2RHI A;  3OW2 P;  1JXO A;  2DIG A;  1X43 A;  3MEU A;  3CMA T;  4RCC A;  4M7A F;  2OX7 A;  3CD6 T;  4M75 A;  2QDY B;  2HSP A;  1S72 Q;  2QAS A;  4ELZ C;  3M4Y A;  3VRY A;  4IKF A;  3NPF A;  1UUE A;  2HQH A;  3VUB A;  2MWP A;  2F2W A;  2F2X A;  4ZGE B;  4EMK C;  1GL5 A;  4Z89 A;  3CXC P;  1VQ5 T;  4N4G A;  4KH1 B;  2H8H A;  3MP1 A;  2E10 A;  3FJ5 A;  2ZZD A;  5KYX B;  3GP8 A;  4J6X A;  3AHU A;  2QYZ A;  4CC2 A;  4II1 A;  4F7U A;  1PHT A;  5CQX A;  1YJW T;  2X4Y A;  4JS4 A;  3OB9 A;  3PVL A;  3CBO A;  2ZPB B;  2EKH A;  3M53 A;  5HY6 A;  2SEM A;  2P4T A;  1W2B S;  4M7D B;  5D6W A;  1QP2 A;  1NBE B;  2J06 A;  3UDC A;  5I2M A;  3R6O A;  2QGF B;  4C92 D;  2QK0 A;  2Y4Y A;  2L2P A;  1SKU B;  5AYF A;  3JB9 I;  2RQT A;  1M2V A;  3CCU T;  1QMC A;  4FL6 A;  3RES A;  2GGR A;  1TH7 A;  2G6F X;  3MEA A;  3MP8 A;  2BZ8 A;  4IIM A;  1BK2 A;  1RAI B;  3EGD A;  3JCM e;  1OEB A;  1WDX A;  3OY9 A;  3CCS T;  4OB2 B;  1OX8 A;  1ABQ A;  1Q86 C;  2KK4 A;  2E12 A;  4J9G A;  1G5V A;  2KE9 A;  2JNG A;  1LVK A;  3JCM J;  3PMT A;  3A8M B;  5GAO m;  5KYY A;  2PQW A;  2DXU A;  1VA7 A;  4KT0 E;  3V7S A;  3KFV A;  1K73 C;  4C8Q B;  4OMN A;  1WZO A;  2DK3 A;  1OPK A;  4OGC A;  2VVK A;  1YIT T;  3TRE A;  2EYY A;  1X75 C;  3BFM A;  1KJW A;  3CCV T;  1M1G A;  4P5N A;  1WPY A;  1VYU A;  2CZ6 B;  2DIQ A;  1KD1 U;  3MCA B;  3X28 B;  1ACM B;  4C5H A;  1M90 R;  1NJI C;  4M4Z A;  2COW A;  4AFZ C;  4V2S A;  3U23 A;  4D6W A;  3VS3 A;  1VUB A;  3NTH A;  4LDX A;  4PNO A;  1OUL A;  3VYH B;  3M56 A;  3GNF B;  1Q7Y C;  2COZ A;  3HSB A;  4C92 G;  1OQK A;  2AT1 B;  3E2U A;  3REB B;  2KDS A;  3OBW A;  5IHK A;  1ZHI A;  1YCS B;  1NYF A;  1VQN A;  5FU6 B;  1RAB B;  1PRM C;  4A53 A;  2MWO A;  3VV0 A;  4MMK A;  4M75 C;  2Y90 A;  4PJJ A;  2VAS A;  4F7U E;  3PIP A;  4E7L A;  3C0C A;  2YSQ A;  3CEY A;  3QPH A;  4Y91 A;  2MMP A;  3QJ6 A;  4HVW A;  2DYB A;  4KRT A;  3UWN A;  1WXT A;  3SWN A;  2V8K A;  2GTJ A;  2EAY A;  4HXJ A;  1D1B A;  2GNC A;  5GAM g;  5GMK m;  5LJ3 d;  4JLG A;  1K4U S;  3VS0 A;  5CKB A;  1I8F A;  3EG9 A;  3M0R A;  1QVP A;  4ZGJ B;  3MO8 A;  4C5G A;  4BY6 B;  3I35 A;  2EGC A;  3M5A A;  2B8A A;  4C5I A;  1VQN Q;  2VB6 A;  4OMP A;  2RNA A;  5AT1 B;  5A0L A;  1M3B A;  3A8L B;  1YJN A;  1PWT A;  2DL4 A;  2P4R A;  1IHV A;  1I81 A;  1YIJ T;  4F17 A;  2ZPI B;  3REA B;  1K9A A;  2JTF A;  4A4G A;  5GAO r;  4XU1 A;  3H6Z A;  1M2O A;  2KEA A;  1Y71 A;  3EG1 A;  4C0D B;  1RI9 A;  1GCQ A;  3S3M A;  2V26 A;  3JCM f;  1H3H A;  2YUN A;  2GFU A;  3CCQ T;  4JJD A;  3CC4 T;  3FC3 A;  3EFO B;  3PE0 A;  4J5Y A;  1Q95 G;  2NLU A;  5FWB A;  3M0U A;  1JJ2 A;  2XKO C;  1RAA B;  5IXB A;  4LUD A;  2XDD A;  4N4H A;  1YJN Q;  4ZN3 A;  2LX9 A;  5J3B A;  1UE9 A;  4Z8A A;  4J9E A;  2J05 A;  4BI4 A;  1NM7 A;  2AZS A;  3QO3 A;  3FJP A;  2QQ9 A;  2CGH A;  1WHL A;  1Q81 C;  1WGS A;  2VC8 A;  1MMD A;  3ER0 A;  1NZ9 A;  3O8V A;  2FZK B;  2J6K A;  4LUE A;  2CRE A;  2LQK A;  4L6V 5;  4AG1 C;  4J6W A;  2L3R A;  2K57 A;  4M78 D;  3SFM A;  1KQS A;  1I0C A;  3BDL A;  2HL5 C;  3QUI A;  1M8V A;  2RD1 A;  2L89 A;  1KHC A;  2RQU A;  1I5O B;  3BE3 A;  4C92 F;  3M0P A;  1ZLM A;  2E64 A;  3J7A F;  1KD1 R;  4CC3 A;  2EQI A;  2AZV A;  5KCO A;  2CT3 A;  5LJ5 d;  1QVF A;  2CH4 W;  3JB9 G;  2DER A;  1KC8 U;  3EFO A;  5IAY A;  3C94 A;  4HA8 A;  2JZ2 A;  3JCM b;  2CKK A;  2VGN A;  1QCN A;  2D1X A;  1QQJ A;  2P0Q A;  3SWN C;  3I56 T;  1EX4 A;  5J26 A;  3I55 A;  4HCC A;  2A0F B;  2RHX A;  4PJO B;  4CI0 C;  3CCL T;  2R5M A;  5GAN 6;  1NEG A;  3NFC A;  1AT1 B;  1UFF A;  1ZSG A;  5GAN e;  1G2B A;  2KYB A;  2ED0 A;  1B34 B;  1Y96 B;  1M1K U;  5A0G A;  5GAM d;  1WLP B;  2PNI A;  2FRY A;  2VXE A;  1U06 A;  3M0T A;  3RKX A;  3G4S T;  2J7I A;  2HQE A;  3EGX B;  3SDZ A;  4L5G A;  2I0N A;  3GNG A;  1GCQ C;  4M78 G;  3CPW A;  1EIF A;  4BE0 A;  4EMK B;  5CQY A;  3I55 Q;  2DL3 A;  2RJD A;  2R5A A;  2EQK A;  3RIR A;  2EGA A;  2X3X D;  2KYM A;  3S6W A;  7AT1 B;  1SSF A;  2MIO A;  5LJ3 e;  3M59 A;  4HCB A;  2AIR B;  1OI1 A;  2L0A A;  3M0Q A;  1S72 T;  1HYO A;  2HCK A;  4B6M A;  5CKF A;  2RM4 A;  4KBM B;  2V8J A;  3V7C A;  3FDR A;  4JLI A;  4JPB W;  3VKI A;  4FYX B;  1UJY A;  2GQV A;  1VQ8 A;  1KK7 A;  1HSQ A;  2RMO A;  1V29 B;  1YHQ A;  4ORZ A;  4XTX A;  5GMK j;  1JU5 C;  3CCJ A;  2NUZ A;  4MZT A;  2A36 A;  2HDA A;  1Y96 A;  2F69 A;  2PUO B;  1YJ9 A;  2HZY A;  1LNX A;  2RJF A;  3QXE B;  1FMK A;  5GAN 8;  2VYT A;  2XK0 A;  1SG5 A;  2C06 A;  2QQA A;  4BE1 A;  3LW5 E;  4MDW A;  5EG2 A;  3GLX A;  5GAN 7;  3OMG A;  1BI0 A;  1X6B A;  3H41 A;  2KSS A;  2DYI A;  2RPN A;  1GBQ A;  2JOY A;  2EQU A;  4E6R A;  1IGQ A;  1VQ8 Q;  1E7O A;  2HL3 A;  3LGL A;  1YHQ Q;  3EH2 A;  1WQ7 A;  1N6A A;  3CCJ Q;  3HP9 A;  4LN2 A;  4OVA A;  2M02 A;  4A4F A;  3QG1 A;  4BAC A;  2QI2 A;  4NL3 A;  4GLM A;  1YJ9 Q;  1RLQ C;  1GFC A;  2EBP A;  1WJR A;  2KQW A;  2KY9 A;  1PNJ A;  2CP0 A;  2JM8 A;  3EHR A;  4PJL A;  5GAN f;  4C92 C;  1KFZ A;  4LDW A;  1XOV A;  4FW2 A;  3UPU A;  3GPL A;  3OYF A;  1KG1 A;  2K7A A;  3INZ A;  5C0M A;  1T0H A;  2M0O A;  2D6F A;  2DTO A;  2H3J A;  1KC8 R;  2DIL A;  1FMW A;  4WCI A;  2LDM A;  1K8A U;  1UB4 A;  3OA6 A;  1MGQ A;  3R6N A;  2I2L A;  4C0G A;  4M75 B;  1BI3 A;  4ZN1 A;  4ELY C;  2IIM A;  1PC0 A;  3RKY A;  1VQO A;  2RH2 A;  5LJ5 e;  5GMK h;  1XTD A;  2RI5 A;  4C8Q D;  1RL2 A;  2RHZ A;  5I22 A;  3FEO A;  4M78 F;  3P8B B;  1PSF A;  1JO8 A;  4K11 A;  5LJ3 f;  1M3A A;  3L2R A;  1IRX A;  3CME A;  2DXT A;  4XQ3 A;  2A3L A;  1M1K R;  2OTJ A;  2YLC A;  2IVW A;  3J81 E;  1TS9 A;  4MDX A;  1UG1 A;  4F7U B;  3OS5 A;  4KGV B;  3OYY A;  4M7D G;  2DNU A;  8ATC B;  2H3E B;  3HL8 A;  2KXD A;  2JW4 A;  3GIB A;  4FIB A;  1OZ2 A;  4M77 A;  2ZPF B;  1IZ6 A;  1VQO Q;  4FSX A;  4QW2 A;  4JDS A;  1G8X A;  3NMZ C;  1F1B B;  5GAM e;  3EG3 A;  3VU3 C;  2FEI A;  2C0O A;  1YCY A;  4C5E A;  1M2V B;  4JS5 A;  3X24 B;  1AZE A;  3A5Z B;  3CME Q;  1VQK A;  3J80 E;  3H0F A;  2YXY A;  4BD3 A;  2ZPH B;  2OTJ Q;  3G71 A;  2L3Q A;  5LJ3 g;  1AD5 A;  1VQN T;  3EGD B;  2HKQ B;  1N5Z A;  1RAC B;  2DX1 A;  3E9G A;  4FT2 A;  2DBM A;  2FZG B;  5IH2 A;  1BI1 A;  4AT1 B;  5I11 A;  3P8D A;  3IQL A;  1MNE A;  1TU0 B;  3QII A;  5KYY B;  4C8Q G;  4FW1 A;  3QWY A;  4PJN A;  1D3B B;  4PKC C;  4EMG A;  4XTU A;  4WF2 A;  1MND A;  2E6N A;  4M7A A;  1KD1 C;  3HRS A;  4HCZ A;  2D0N A;  1IGU A;  2ESW A;  4J7I A;  1VQK Q;  4B9X A;  3NGP A;  4JRP A;  2QQS A;  4RUG A;  3G71 Q;  1W2B A;  4FM4 B;  4FYW B;  1YJN T;  3VS4 A;  1D1C A;  5I2S A;  1UGR B;  4N0A A;  3M58 A;  3LWH A;  3QDF A;  2LT4 A;  2QTX A;  2JMA A;  2DO3 A;  2DKG A;  2LX7 A;  3QWX X;  4A54 A;  3JCM h;  5LJ5 f;  4E7I A;  4OMQ A;  1ZSZ A;  4FCY A;  1AOJ A;  5HK3 A;  2EQM A;  1I4K 1;  1LOJ A;  2D9T A;  1K0X A;  4LNP A;  3CCR A;  1YI2 A;  2DTH A;  1TUD A;  1PM3 A;  2FYK A;  1ZX6 A;  3M0S A;  3QJY A;  2FB7 A;  2V1R A;  2P0K A;  1X6O A;  1NLO C;  4M77 E;  3SWN B;  3QYG B;  4OMF B;  4HVV A;  1S1N A;  4EDU A;  3DB3 A;  1QVG S;  1PKS A;  1SHF A;  2LP5 A;  2CP2 A;  2MPX C;  1K8A R;  1XJW B;  3JCM W;  1D3B A;  4C0Z A;  5FU7 C;  5D6X A;  2NUP A;  2OAW A;  2XIC A;  3OW2 S;  1ZUU A;  3EG9 B;  3LH5 A;  1M5Q 1;  1GCP A;  3NHN A;  4E2F B;  3QKJ A;  4XTW A;  3T9N A;  1NPP A;  3OYN A;  1WNL A;  5GAM f;  4M7D F;  2JTM A;  4M75 E;  4M77 C;  3H9N A;  2W10 A;  2DFU A;  2ROL A;  3FLG A;  5LJ5 g;  4XU0 A;  1SSH A;  3CCR Q;  1YI2 Q;  3SHW A;  3TVT A;  3UF4 A;  3CXC S;  4XK8 E;  4RTW A;  2CUD A;  4LXC A;  3PVQ A;  2IPO B;  1C6V X;  1R77 A;  1Y57 A;  2V8I A;  3UA7 A;  3EG0 A;  5J39 A;  4M7A E;  1JJ2 P;  4R56 A;  3L2W A;  4PJO D;  1V76 A;  1N8R U;  1WI7 A;  4DQ2 A;  2AKK A;  4OB0 B;  2A37 A;  2RK1 A;  3QBY A;  2RO0 A;  3THK A;  2GFA A;  2ATC B;  2JS2 A;  2EWN A;  1M3C A;  1E6G A;  4OP0 A;  4CC7 A;  4C8Q F;  2QA4 A;  3BY7 A;  1ARK A;  4ZTJ A;  4M7A C;  3I55 T;  2C0I A;  4J9D A;  1I07 A;  5IT9 E;  1MMN A;  2HQX A;  3G1J A;  3GOX A;  2O31 A;  1OYX A;  1QKX A;  2LNV A;  1MUZ A;  1KQS P;  5GMK l;  1UEC A;  3M4G A;  2FG0 A;  2FL7 A;  1SF9 A;  4N0A C;  1YJW A;  3MEV A;  5GAO p;  2EW3 A;  2YHT A;  4F04 B;  1RAH B;  4BI3 A;  3VS7 A;  4BDY A;  3JB9 D;  3PNW C;  1RUW A;  2QA4 Q;  1QVF P;  2G3R A;  4D8D A;  1JXM A;  4LD6 A;  1Z9Z A;  2MF2 A;  1HXD A;  1ZSZ C;  3RNJ A;  5GAN j;  3V8K A;  1H3Z A;  3CCE A;  4BE2 A;  2PU9 B;  1WHG A;  1BB9 A;  2M9U A;  3EHQ A;  1X6G A;  5GAN 3;  4OMO A;  4X34 A;  2F5T X;  4A4E A;  4PJO G;  3OSS C;  2O9S A;  3DB4 A;  1C1A A;  4C92 B;  5HKC A;  4XTY A;  3RMQ A;  3M55 A;  2LC4 A;  2CH4 A;  4RTY A;  2X9H A;  1AWW A;  2M16 A;  1M1K C;  1RLP C;  2CP5 A;  3FB9 A;  1JJ2 S;  1VQ7 A;  1VQ8 T;  1G3W A;  2X51 A;  2KAF A;  3GBQ A;  1YHQ T;  3CCJ T;  3JAM E;  4BUG A;  3CCE Q;  5LJ3 j;  2QXF A;  2EYW A;  2GTO A;  1YJ9 T;  1RI0 A;  5HK0 A;  4X1V A;  5GJV B;  2K79 A;  3CPW P;  2JJ9 A;  3QZ5 B;  1DJ7 B;  3JCM X;  4BB7 A;  3HPW A;  4FT4 A;  3A8O B;  1BYM A;  2LQN A;  1VQ4 A;  3CC7 A;  2L3P A;  3RR6 A;  2KR3 A;  1ZBX A;  3CCM A;  3OYC A;  3N5B B;  4OGE A;  3ME9 A;  5GAO n;  2CZ7 B;  1VQ7 Q;  1AZG B;  3ULR B;  1D0Z A;  2DXB A;  3NTI A;  2QEX A;  2D8H A;  2GCX A;  2QDL A;  4E7J A;  2CYZ B;  3RUX A;  2EYZ A;  1QCO A;  2K5I A;  4J9B A;  1VQP A;  3ZEH A;  2DXC A;  4C92 A;  1UGS B;  5GAN h;  2XID A;  4NOY A;  4F16 A;  3EGU A;  4A63 B;  2XDP A;  3RDV A;  4RG8 A;  2R57 A;  3L42 A;  2JXB A;  1AWX A;  1B07 A;  1D1A A;  1U1S A;  2KRO A;  4Z88 A;  3CC7 Q;  4DBH A;  4LD9 K;  1N8R R;  4J6Y A;  3CCM Q;  4JZ4 A;  4D8K A;  2EKO A;  2V1Q A;  5A0D A;  2MYS A;  5M9O A;  3VYG A;  2YUO A;  4PK4 A;  2M51 A;  2QEX Q;  1UHC A;  3EFR A;  5GAN 5;  2PZ1 A;  2CZ1 B;  4PLL A;  4CRI A;  5KYW B;  1TUC A;  2KXC A;  1UJ0 A;  3GF5 A;  1YWP A;  1VQO T;  1WA7 A;  2GF7 A;  1VQP Q;  4HKE A;  5DY9 A;  2NWM A;  5LJ3 h;  1GXI E;  2JTE A;  1BI2 A;  2EJG A;  4MML A;  2L8D A;  3MHX A;  3CME T;  2FPD A;  3LX7 A;  3LH0 A;  2Z0W A;  2KVQ G;  3PTA A;  4EMH A;  4GBQ A;  3P8H A;  2OTJ T;  1GFD A;  4FYY B;  4DEY A;  5IHI A;  1RAG B;  4F14 A;  4ESR A;  2KGT A;  1VQ6 A;  4PJO F;  1UHF A;  5LJ5 j;  2XI9 A;  4QVZ A;  4RCB A;  1OZ3 A;  2DRM A;  3HFN A;  1K8A C;  1O9S A;  3I5R A;  2DLP A;  3OSV A;  2E65 A;  1QWE A;  2FO0 A;  4M75 G;  2VKN A;  8AT1 B;  2ZCF B;  3F70 A;  1OV3 A;  1VQK T;  2RHU A;  3HRT A;  4MZM A;  2RK2 A;  1UGP B;  2O88 A;  2ZGW A;  1RAD B;  1FX7 A;  1X27 A;  4J83 A;  3G71 T;  3MPU B;  1M90 C;  3I5S A;  3OYG A;  2W0Z A;  1JB0 E;  5KYW A;  4A4H A;  2RHY A;  1VQ6 Q;  2CZ0 B;  1X01 A;  1WHK A;  3MP6 A;  4DA4 A;  4C92 E;  4IUR A;  1LCK A;  5GAM j;  1PG5 B;  3AT1 B;  1M27 C;  1OOT A;  3PMI A;  5FU7 B;  2CP7 A;  2ROT A;  1IHW A;  2E70 A;  2K5L A;  2DEQ A;  4RTT A;  4F7U G;  4Q5W A;  4M7D D;  1BCO A;  3JB9 F;  3URG A;  2DF6 A;  2XDB A;  2A28 A;  2WSE E;  3UT1 A;  4R55 A;  4AG2 C;  1JQQ A;  1G3Y A;  1TWB A;  2DL8 A;  2P0P A;  1UDL A;  2YRC A;  3PFS A;  4NS5 A;  3HRU A;  4JJN K;  4M77 B;  2YRV A;  3OYE A;  1WHH A;  4Y92 A;  2E4H A;  4IUV A;  1VQ9 A;  3OYA A;  5DM7 R;  2PTK A;  2M1H A;  4RTV A;  2J6F A;  4OB3 B;  2K9G A;  1WQW A;  3JV3 A;  3EAE A;  4XU2 A;  1M30 A;  3FRN A;  2NYS A;  4CC4 B;  1Q82 U;  2BTT A;  4OML A;  2QTV A;  5LJ5 h;  2BUD A;  5CKD A;  4A4K A;  3WXM B;  2EYX A;  1U8R A;  1I5L A;  4ANJ A;  5HCK A;  2MI6 A;  4QQ6 A;  2D0Q B;  2PVD B;  4XTV A;  3CCR T;  1OX9 A;  1YI2 T;  2LNH B;  4GLK A;  1VQ9 Q;  2VGM A;  1M9S A;  2NUT A;  1HJD A;  1K9M U;  1QCF A;  1U5S A;  2A7Y A;  5CR2 A;  3EG2 A;  5CAI A;  4PFP A;  4WTO B;  4M7A B;  1ZUY A;  3FIF A;  1NE8 A;  1KQ1 A;  1CKB A;  2E3H A;  3C95 A;  4EIK A;  4HT9 A;  2EJF A;  1W2B P;  3L2Z A;  1G3S A;  2HKN A;  2XMF A;  1B3Q A;  2VXF A;  1UGQ B;  3QZ9 B;  1W4S A;  4GY5 A;  1TTH B;  1QKW A;  3QYH B;  2RN8 A;  5CCA A;  1NPR A;  5GAM h;  3C12 A;  4M78 A;  3L2U A;  4JJB A;  4E7K A;  1YP5 A;  1K1Z A;  4XU3 A;  4ZNX A;  2DJZ A;  2BZX A;  3RER A;  4Z02 A;  4AFU C;  4LE9 A;  2MK5 A;  1K0S A;  2OJ2 A;  1WJQ A;  1YN8 A;  4JRK A;  4JZ3 A;  2C0T A;  1MHN A;  2LTO A;  2HNI A;  4NL2 A;  3JB9 H;  1ZSZ B;  2PUK B;  5L8R E;  5KYU A;  2LJ0 A;  3CPF A;  2BE7 D;  5DLO A;  3OYL A;  1HD3 A;  1NYG A;  2YT6 A;  2D8J A;  3JCM c;  3CQT A;  2E5K A;  1EFN A;  5IN1 A;  2YLB A;  1UEB A;  2O2O A;  3DLM A;  5CO7 A;  3KBG A;  4JUV A;  5FW9 A; 
#chains in the Genus database with same CATH homology
 2QEX Q;  3CCU Q;  2QA4 Q;  1QVF P;  1VQ6 Q;  1YIJ Q;  1Q86 R;  1VQ7 Q;  1Q81 R;  1VQO Q;  1YJW Q;  3CC2 Q;  3G6E Q;  3CPW P;  1M1K R;  1KQS P;  1VQK Q;  1VQ4 Q;  3CC7 Q;  3I55 Q;  1VQP Q;  1QVG P;  1NJI R;  1VQ8 Q;  1JJ2 P;  1YHQ Q;  1N8R R;  1M90 R;  3I56 Q;  3G71 Q;  1VQ5 Q;  3CCM Q;  1W2B P;  1K9M R;  1YJN Q;  3CCJ Q;  1Q82 R;  3CMA Q;  1K73 R;  3CCR Q;  3CME Q;  1YI2 Q;  1K8A R;  3CXC P;  3CCL Q;  1KC8 R;  3OW2 P;  1Q7Y R;  3CD6 Q;  1VQL Q;  1YIT Q;  3G4S Q;  1YJ9 Q;  1VQ9 Q;  3CCQ Q;  1KD1 R;  1VQN Q;  3CCS Q;  3CCV Q;  2OTJ Q;  3CCE Q;  3CC4 Q;  1S72 Q;  2OTL Q;  1VQM Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...