1YI2Q

Crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1yi2Q00
1VQ8Q 1K8AR 3CPWP 1NJIR 3CMEQ 1JJ2P 1S72Q 3G71Q 3I55Q 1VQ7Q 3G6EQ 1VQMQ 3G4SQ 2QA4Q 3CC4Q 3CCMQ 3CXCP 1YHQQ 3CCLQ 1YJWQ 1VQOQ 1K9MR 3CMAQ 1YIJQ 1VQ4Q 1VQPQ 1Q82R 1VQKQ 1KD1R 3CCQQ 1YI2Q 1Q81R 1VQLQ 1VQ6Q 3CD6Q 1Q86R 1VQ5Q 1W2BP 1M90R 2OTLQ 1K73R 3CCJQ 1VQNQ 2OTJQ 1M1KR 3CCVQ 3CCUQ 3CCRQ 1YJNQ 3I56Q 3CCSQ 1VQ9Q 1KC8R 1QVGP 3CCEQ 1QVFP 2QEXQ 1Q7YR 3CC2Q 3OW2P 1N8RR 3CC7Q 1YITQ 1KQSP 1YJ9Q
chains in the Genus database with same CATH superfamily
2D0NA 3TSZA 2VC8A 1BU1A 1B3QA 1I1JA 3M0SA 1N8RU 4M7DF 1QP3A 3CPWA 2KMTA 4ANJA 3OYBA 1VQ4T 1SHGA 2A7YA 2NUPB 1YBYA 4J83A 1VQLA 1UJ0A 3MP1A 4OB0B 1K73R 4BY6C 1M1KR 3PIOA 5GAMd 2DERA 3TQ7P 2PU9B 1PSFA 3J81E 2KK4A 2F1LA 2CZ1B 4M77B 2F2WA 1VQ5T 4GLMA 2DXUA 3CCQA 2OTLQ 2RI2A 5GMKi 3L2WA 1O9SA 2ZPHB 3JCMf 2VGNA 3CQTA 1VYTA 4F14A 4PJMA 1M2VB 4HCKA 3REAB 5LJ3d 4BI4A 3CC4T 4KUIA 1VQMQ 2LT1A 3J7AF 4M75E 2RHIA 4X9CA 1BI3A 3OYMA 2OAWA 5HY6A 2L3RA 4C0FA 1VOMA 4MMLA 4EMKC 3OYKA 3PMIA 2KNBB 3VRYA 2NUZA 4PJJA 1SKUB 4C92E 2RQUA 1Q7YC 4E7ZA 5J3BA 2QG9B 2HQEA 1QVFA 3OYGA 2JS2A 2HQXA 3LH5A 4RCCA 3EAEA 3M55A 2MPXC 2EGCA 4IUPA 3LH0A 3JB9H 1Q86R 3WXMB 3CCUT 3JCMP 3OYCA 1M30A 3L42A 2M1HA 5I22A 1QQJA 4J6WA 2E3HA 3CCRA 1KFZA 5D7UA 2VVKA 5CQYA 1WXUA 1BI0A 2V1RA 4ZGJB 5KYUA 1YJ9Q 1SHFA 3VKIA 2J06A 1NG2A 1TUCA 5GMKm 2L8DA 4ZTFA 2L5QA 2K3BA 4E7IA 1KD1R 4KH0B 2HQHA 3KBGA 3WVDB 2LZ6B 4HCZA 4PLIA 2M02A 4O6JA 4M77F 2FZKB 1A0NB 4QT7A 4OMFB 4BDYA 5GAOl 1E6GA 2FZCB 1VQ8T 1WZOA 4LE9A 3M59A 1K8AR 2LVMA 1JXMA 1RAHB 4FSSA 1RI0A 1G83A 4E7SA 3ZL7C 1VQPT 2GFUA 4ATOA 2PVOB 3CD6A 2DL5A 1SG5A 6AT1B 4FW1A 1QVGP 1OZ3A 2B86A 4AFSC 2QEXA 1YITT 2CSIA 2LT4A 2HZYA 2QTXA 2KXCA 2ZPBB 1LNXA 2BUDA 2DJZA 3CXCS 5GAOp 1WGSA 2ENMA 2J7IA 1WPYA 3M5AA 3TEEA 3DB4A 3VS6A 3HHTB 4ZGEB 4K11A 1N8RR 4IURA 1JQQA 3HSBA 2E70A 4KUDK 4XTUA 5HCKA 2OI3A 3SWNC 4FYXB 3BY7A 2D8JA 2K79A 3KUFA 2HAXA 2R5MA 4C5GA 3LGFA 2C06A 4Z89A 1VQKA 1TG0A 4C0DC 3S3MA 2CGHA 4PJOC 1TUDA 2FPFA 3OY9A 2EKHA 2ZCFB 1XOVA 4OB1B 3PMTA 4LD9K 2COYA 3GNGA 4E7KA 3RKYA 2JW4A 3CC7A 2JZ2A 1WHKA 2HKQB 3KXTA 1D3BB 4BY6B 1G5VA 2KYBA 2HEQA 2VUBA 2XK0A 4BE1A 3MHXA 1VYVA 3RIRA 2RQRA 1WJRA 2K5LA 2OTJT 2EJ9A 2RHUA 2CKKA 3CCEQ 2Y4YA 4JLGA 2RI5A 1U3OA 2DIQA 3META 1B34A 2K2VA 3UF4A 2EAYA 4BD3A 5GANd 5GAMh 4OMPA 4D8KA 2HSEB 1HYOA 1M4ZA 1N27A 5LJ5e 1WJSA 2YHTA 2XU8A 1JB0E 2DA9A 1YI2T 2X9HA 2DRMA 1VQ6Q 2ZGWA 4B9XA 2OTLA 1WDXA 1YN8A 4M7AG 1I5OB 4C0GA 2DE0X 2XI9A 4F7UB 3QO3A 1TOVA 1H641 4EMKB 3O8VA 1S72Q 1YFNA 3G6ET 1VQMA 5GAMe 4WTOB 2KXDA 3LGLA 5LJ3h 4DQ2A 2A0FB 3OQ5A 1PD0A 3CCVQ 3DKMA 3R6NA 2DVEA 2MMPA 2YDLA 2RQVA 2Y90A 2JOYA 1UFFA 1VQ7T 1NLOC 2QGGA 3CCLQ 3L1AA 4M7DG 2DXCA 1WNLA 3EG0A 1HXDA 4NOYA 3OYEA 2HKNA 2V26A 4J6XA 5KYXB 3M0UA 5LJ3e 1Q7YR 1D0XA 4AFZC 2BE7D 5KE2A 4D8DA 1IRXA 2EQUA 3PVQA 1YJ9A 1BBZA 4M78E 4FYYB 4BE0A 5CKHA 1VQOT 2G3RA 4MDWA 1X2QA 4QQDA 2RJDA 3V8JA 1E6HA 1UB4A 4N4HA 3CCST 2QYZA 1K73C 3EG2A 1M1KC 2K6DA 2PNIA 5ECAA 3TSWA 4OMLA 3NMZC 1XNIA 3OBYA 2YRDA 2YSQA 4AG1C 4J7FA 2JM9A 4C8QA 2O9VA 2LQNA 2DL7A 4PJOD 1UG1A 3JCMh 5IXBA 2ED1A 1JJ2A 2FPDA 4CC2A 3RDVA 1RUWA 4JS4A 3EH2A 1WQWA 1FMWA 4M75C 3OS2A 1BIAA 1VQ9T 4ZTJA 1X43A 3JCMQ 1VIFA 1G3SA 2RNAA 4NL2A 2PUOB 2X51A 2LC4A 4C92C 2RPNA 4HVUA 4NL3A 2LJ1A 2AK5A 3C12A 1WQ7A 1OEBA 4DOVA 3I9QA 5C0MA 2DX1A 3CCJT 1VQ5A 5GAN4 3SWNB 1Y96A 1M90U 4QVCA 3QDFA 4C0DB 4A4KA 2RI3A 2ROTA 1AWXA 5KYWA 5HK0A 4PJOB 1J3TA 5IH2A 3G6EQ 4RTVA 1NJIU 4ZN3A 2CUDA 2L0AA 5CVIA 1Q86C 1W1FA 2ED0A 3JV3A 1M9SA 1BYMA 2LX9A 4QQ6A 2JUFA 2DMOA 4PKCC 1KK7A 1G3TA 3JCMX 1KQ2A 3I55T 3CCMT 1D1BA 1VQ7Q 4LXCA 2GF7A 2PTKA 1TU0B 3ZEHA 1I5LA 3EGXA 2K7AA 3M4YA 4RTXA 1ZQ1A 3CCEA 1MV3A 1TXQA 3UPUA 2D6FA 5KE3A 3JB9D 2RHXA 2XDPA 3X24B 4DBFA 1K8AC 1W6XA 3NTKA 4DOWA 3SEMA 2LQKA 2RH2A 4HCCA 1VQOQ 1SRMA 5IHKA 1W2BS 2X3XD 3FJ5A 1PHTA 3H8ZA 1VQ6A 4FYVB 4FIBA 5LJ5f 1PC0A 4FYWB 1G2BA 1NPPA 1AT1B 2DO3A 1W2BA 4LDWA 4C8QG 3TCJA 1KQSP 2DTIA 3CMET 1O75A 3O5ZA 2CP7A 4TVRA 2P84A 1YHQQ 4BI3A 1R8OB 4QKUA 4Y28E 1UUEA 3MPUB 1GBRA 4PJOF 1FXXA 4PFPA 5FWBA 5GANe 3LLRA 2OJ2A 3CCVA 5GAMf 3GF5A 4EIKA 3QG1A 5FWCA 3ZFJA 1UEBA 1N8RC 3MEAA 4N4IA 1WJQA 4M75D 2WSCE 2H8HA 2DBKA 4MZTA 5FRMA 3A5ZB 3REBB 2CH4A 3CCLA 1YIJQ 1WIEA 2KQWA 4J6YA 1RABB 4M7AE 4C92D 1SF9A 1V1CA 3PT9A 4X34A 1K9MU 3V8LA 2FZGB 5C6SA 4FCYA 1AWJA 1CKAA 4RG2A 4GBQA 2EFIA 1OI1A 2H3JA 5LJ3f 5CAIA 3HFNA 2JMAA 1ZLMA 3CMAQ 5CO7A 3SFMA 3DLMA 3EG1A 2ZPFB 2EW3A 1LOJA 4PFOA 5LJ5d 3INZA 5GAN6 4HA8A 2YRVA 3OS0A 4OP0A 3CPWS 1GRIA 4PJLA 4M75B 2GGRA 4M7DE 2FEIA 3I55Q 3QBYA 2QA4T 1ZSZA 2ZAEA 3EFRA 2KROA 3QIIA 3A8MB 1OZ2A 1V76A 5DY9A 3AHUA 1QKWA 2C0IA 4C92B 1D09B 3I56T 3A8OB 4IUUA 2QTVA 4EPCA 2KGTA 2LP5A 4BE2A 5GAOr 3OYLA 2MYSA 4JJBA 1AWWA 1H3HA 1T0HA 3SDZA 1BK2A 2HL5C 4HVWA 3V7CA 4J9DA 4JRKA 2D0QB 1WHLA 2AT1B 2XKOC 3EG9A 4RTYA 3MEWA 3PE0A 4L59A 5GAN3 1X01A 2QAZA 2X4XA 3H0IA 3CC2Q 1ZX6A 1TTHB 3VS7A 5FU7B 2DXBA 2EYWA 1TUGB 4R55A 2CT4A 4AT1B 2QI2A 2VKNA 3VS3A 4RMOA 3G6EA 1R0BG 4M78C 1K0XA 4BI8B 3SD4A 1QVFS 2Y4XA 4WCIA 4C5IA 3OYYA 4N0AC 5IAYA 2DPPB 4AG2C 1UGSB 2EVRA 1QVGA 2F2VA 2QDYB 3QYHB 2FRWA 4O5VA 2C0TA 1ZSGA 2MI6A 5FU6C 2L3PA 2DM1A 3EGDA 1VQ7A 4M75F 3TU4K 4KGZB 1UHCA 2JN0A 2RO0A 1FMVA 4QQGA 3J80E 2YT6A 2CUBA 2LJ0A 2E10A 3L2RA 1TSFA 1RAGB 2KEAA 1UGRB 4XU3A 2K4YA 3GOXA 4J5YA 4XAXB 5CK9A 5GJWB 5IXFA 1VQOA 1Q82R 1ACMB 1IGQA 3DLLA 4DA4A 2W10A 4OGEA 1DJ7B 2KY9A 2RQTA 3M0TA 2RB6A 2CP3A 4PLLA 1YWOA 4KRTA 3UDCA 4M7AA 4J9CA 1GBQA 1UTIA 2CS7A 1HK9A 2EYZA 3EH1A 1NYGA 5L23A 1K9MR 4Y92A 1YHQA 4KT0E 1VQ4Q 2L2PA 1I4K1 4CRIA 5I11A 1YJNT 5KH6A 5KYYB 3BE3A 2XHCA 2A08A 2YWWA 3U23A 2A28A 3OMGA 2JTMA 2F5KA 2QQAA 5GANf 3G4ST 3PVLA 5EG2A 2KSSA 2CP5A 3F70A 3FC3A 3L2ZA 4OMNA 4JRIA 4KGXB 1YIJA 2GTJA 1VQ5Q 3M0QA 4C8QE 4M7DA 3E19A 2R58A 4ZNXA 2RA2A 1QLYA 3V8KA 2LCCA 3RBBB 3CEYA 2RHZA 2GTOA 7AT1B 3QUIA 3M4GA 1M2OA 1VA7A 4RUGA 2LCLA 2CSQA 2MCNA 3CC4Q 2E6ZA 3CBMA 5LJ5j 2RMOA 3CMAA 1B7TA 4A53A 1NE8A 3C95A 1OV3A 3C94A 3RR6A 3JCMg 3EGXB 4GLKA 2DNUA 2NUTB 5D6WA 1N9RA 3JCMJ 4M78D 1BI1A 2O31A 3AT1B 5CKBA 1WXTA 5LJ5h 2XG8D 1F1BB 3I55A 2A36A 1QCNA 5GAMj 2M0OA 3SB2A 1M3AA 1K4US 1EZZB 1R0CB 1I81A 2O01E 2O4XA 3CCUQ 4PJOG 2KAFA 4JDSA 4E7JA 4RCBA 1IGUA 3FJPA 2EBPA 4XU1A 3EFOB 4XTZA 1CSKA 2CREA 3LW5E 4J7IA 4MZMA 5IN1A 3QZ9B 3HRUA 2DD4A 5J39A 4OB3B 2EKOA 1UHFA 1WHHA 3PIPA 4E7LA 2O9SA 4JJNK 3E2UA 4OMOA 3QHSA 4M7AC 2CT3A 2E12A 1BB9A 2E5QA 4M78B 5CQXA 5LJ3j 3CC2A 1TS9A 3HKSA 4EDUA 1VQ8Q 1IB8A 5GJVB 1QP2A 5A0LA 3CXCP 1JXOA 3CCQT 1VQPQ 1NLPC 3H0HA 2P4TA 3VS2A 2ZPEB 1RADB 2DXTA 2QQRA 5FU6B 4A4GA 4AMCA 2GBQA 2KRNA 1YITQ 4FT4A 4ESRA 3NTIA 3EHRA 4RTWA 1IZ6A 4RTTA 4M77A 3S3OA 4M7DC 1YJWT 4HCBA 3NGPA 4II1A 4M4ZA 3D7SB 1MUZA 3JCMV 5I21A 1GCQA 3L2QA 4MDXA 2COWA 3QWXX 1I0CA 4LD6A 1PCXA 3OYJA 3EGUA 1M2VA 3ULRB 4E7HA 2M0YA 1PM3A 2JJ9A 3M56A 3PFSA 2MAMA 2E1HA 3QKJA 4JLIA 4E6RA 1E7OA 1KSWA 1SPKA 1NM7A 4B6MA 3IQLA 2JT4A 3H9NA 3CCRT 4BB7A 3M9QA 2WACA 2V8IA 3UATA 3LWHA 1UGVA 4ZN1A 4B9WA 4LDXA 5J26A 4A4EA 1JJ2S 1FMKA 4CC3A 1WXBA 1NJIC 2DKGA 2ZZDA 4M78F 4F7UF 1BKBA 1GFDA 2PVGB 1C1AA 4JZ4A 2E65A 1VQ4A 1D1CA 1EX4A 2D9TA 2OTJQ 5IHNA 2BTTA 4R56A 2DYBA 2L3QA 1JBMA 1X27A 2XIDA 1KC8U 2XDDA 4FSXA 5DLOA 3FEOA 1PSEA 4LUEA 2BE9B 3CD6T 1X6GA 1OYXA 1YCYA 3OSVA 1N9SA 1SEMA 1YI2Q 2CP0A 1KHIA 3QZ5B 1PKSA 2K5FA 3I5RA 1MNEA 5IT9E 3OW2S 2QEXT 3VS5A 5HK3A 2JTEA 2KRSA 1PRLC 3MP6A 2P0QA 4IUQA 2QK0A 1PD1A 1QW1A 4QVZA 1QVPA 1W4SA 2MK5A 3HFOA 2ATCB 4C5EA 3OW2A 1V29B 2DFUA 1KQSA 2DZCA 4MMKA 3CC4A 3BDUA 2LQ8A 1QWEA 1H8KA 5AT1B 3RMSA 1ZA1B 2DL3A 3V7RA 1IHWA 2K3YA 2M16A 4JUVA 2QASA 1AZGB 2E5KA 4FU6A 4M77G 2MF2A 4NS5A 3MP8A 1M8MA 1PRMC 2DEUA 5GAOm 2J6FA 2PUKB 1RLPC 5KYUB 2JVVA 1WA7A 1YJWQ 1MGQA 1VQKT 3BFMA 2YRCA 5KYNA 2LMJA 1Q82C 2CP2A 2CZ6B 3CCUA 5GANj 3JAME 1PWTA 1OU9A 2KRMA 1SRLA 3VJPA 3NFCA 3URGA 4Z8AA 1RI9A 2XD0A 1YWPA 2AKLA 2KT1A 1Z9ZA 4M7AB 1QWFA 2VGMA 1NPRA 1K9MC 5GANh 9ATCB 2RK2A 2CZ7B 3A8GB 4EMHA 4ELZC 4J9GA 3ER0A 2BZXA 4XTWA 3CCSQ 3FRNA 3CPFA 4C8QC 2J6OA 2ESWA 1D3BA 3NPFA 2EGEA 4J9FA 1VQ8A 3RUXA 1OPKA 2NYSA 2YUNA 2EPDA 2JMCA 5CCAA 3MEVA 1VQPA 1OULA 2OTLT 2CYZB 2EGAA 1VQ9Q 1Q86U 4JJCA 4M7DB 2X35A 5GAOq 1EIFA 2AZSA 2PVDB 3P8DA 1YITA 4DEXA 1MMGA 2DL4A 4DBHA 3G71T 1JRIA 1VQMT 3C4SA 1C0MA 3HTRA 1M1FA 4RTUA 3X26B 2HBWA 3VYGA 2LQWA 3CCJQ 4F7UA 3VUZA 1GFCA 1KD1U 4J9HA 4OVAA 4PK4A 4EMKA 3WVEB 4XTVA 3OYFA 4KH1B 2R57A 2LCSA 3C0CA 2YXYA 3OS5A 4JJDA 2BZ8A 2K57A 4P5NA 3P8HA 1BI2A 3JCMc 2HNIA 2V8KA 1K8AU 3A8HB 3MKDA 2JXBA 2PQWA 3R6OA 2KVQG 3VS0A 2F69A 3OSSC 1U06A 1UECA 2NWMA 3ASKA 4OGCA 4DBQA 4LN2A 4RG8A 2P4RA 1KC8R 3MO8A 2Z0WA 3HP9A 4XQ3A 4ELYC 2O4XB 2RJEA 1YJ9T 1LCKA 2X4JA 1W70A 3L2UA 1QMCA 3L2VA 5A2QE 1B34B 1M8VA 5FRNA 3UA6A 4E47A 3CCMQ 2K2MA 1N6AA 4JRQA 2CH4W 2FPEA 2A37A 5KYXA 1GCPA 2E3IA 1W2BP 1M90R 2GQVA 1ZHIA 3NTHA 3X25B 2OTJA 4XK8E 1WX6A 4XTXA 2FVUA 5GAOn 2QQSA 2V8JA 2RJCA 1RL2A 3HRTA 2JM8A 1NJIR 1EFNA 3X28B 2VXEA 3JB9F 2RK1A 1T3LA 2FG0A 1YI2A 1X69A 4IUVA 5GMKe 4YTLA 1CKBA 1AWOA 3ME9A 1M3BA 1U5SA 3ZBDA 2MWPA 3JSCA 3CMEQ 2HDAA 1VUBA 2HD0A 1UE9A 4C8QD 1NEGA 5LJ5g 1X6OA 2DVJA 1X2KA 1QVGS 3OYNA 5DM7R 2LRQA 1Q81U 1MMAA 4MZPA 3JCMW 8AT1B 1WHGA 1H3ZA 2A3LA 1PKTA 2LDMA 4GY5A 1ARKA 3G71Q 5CKFA 3S6WA 2MOXA 4IKFA 4X9DA 3EG3A 4DBRA 4D6WA 3VU3C 2E6NA 4M78G 2KE9A 5D6XA 1YJWA 1HD3A 3SWNA 4E2FB 2LX7A 4F7UG 3EHQA 3P8BB 1XJWB 5GAMg 2C0OA 2SRCA 3UA7A 4CI0C 2DK3A 4C92F 1OX9A 4PJOA 1KIKA 3CPWP 4JRPA 2QDLA 2X4YA 1UGQB 1BCOA 3FDRA 4C8QB 3OB9A 2HL3A 3OA6A 2GQIA 2XMFA 2YLCA 1IHVA 3HRSA 4M77E 3CCET 3VYHB 3CCSA 3QXEB 1B07A 1ZUYA 2RJFA 1ZSZC 5CKEA 5LJ3g 1BIBA 3LWIA 1HSQA 2W0ZA 2ZPGB 3G7ZA 2QA4Q 3PNWC 1RACB 3LX7A 1VQ6T 3QYGB 1H92A 4XU2A 1PNJA 4FT2A 3H41A 2RF0A 5I2MA 4LDYA 3I56Q 2O88A 1P92A 2ROLA 2RM4A 1VQ9A 2KT8A 3JCMd 1U1SA 3I35A 1Y96B 1Q7YU 1XQHA 1S72T 3TREA 3RMQA 1S1NA 2D1XA 1LJOA 2OAUA 1VYUA 1G3YA 5KYWB 2ECZA 1R77A 1T0JA 1KG1A 3CCVT 4F17A 4LDUA 3H6ZA 1ZA2B 4PJNA 3CCJA 1QVFP 2IVWA 3M53A 1U1TA 1WLPB 4JZ3A 2X3WD 3QJYA 4Y91A 2M9UA 3OMCA 3OYHA 1MHNA 2YUOA 4VUBA 2QQ9A 2I2LA 2EQJA 3CCLT 1UDLA 3VS1A 4ME7A 3E1SA 3OYDA 3CXCA 3E9FA 2FO0A 5DLQE 4C8QF 1AZEA 3NHNA 4BACA 2DIGA 2B8AA 1AVZC 2L3SA 3CBPA 1OQKA 2EYXA 2RHYA 5D6YA 2FHDA 2DAQA 2VXFA 4V2SA 5FROA 5FW9A 2HMAA 2AIRB 1X75C 3CCMA 3BDLA 3I5SA 2GCXA 2VB6A 1K76A 4CC7A 2IPOB 1VQNT 5M9OA 3KFVA 3M58A 2K5IA 3S3NA 1WHMA 1SSFA 8ATCB 3VS4A 1FYNA 2LTOA 1C6VX 4KBMB 1M5Q1 2DBMA 3CBOA 1KJWA 4Q5WA 2WSEE 2RD1A 4OB2B 2DTHA 4OMQA 1KQ1A 1ABQA 1Q81R 1VQLT 2HCKA 4OF1A 2G6FX 3RERA 2XICA 3SHWA 2PZ1A 1K9AA 4M75A 1UJYA 3OYIA 1YNZA 2CZ0B 3VRZA 1D1AA 3OS1A 4XTYA 4RKUE 3CMEA 4PNOA 2NUPA 3LYIA 4C92A 4J8OA 2EIFA 2KR3A 4FL6A 2E4HA 4A4FA 2LNVA 1Z9QA 2XDBA 1YJNQ 2AZVA 1AHJB 2YUQA 3N5BB 2P0KA 4JS5A 2E64A 4A4HA 2DTOA 5GAN7 2FL7A 3G71A 4PFZA 3FB9A 3G4SQ 4HKEA 1JU5C 2CDTA 2DLPA 1YCSB 1NYFA 3PTAA 1OX8A 2OX7A 2KYMA 4J9BA 4A63B 1TWBA 1MNDA 3T9NA 2FYKA 3JB9I 1KC8C 4BDZA 2BZYA 2DF6A 1OOTA 3GNFB 2BIVA 4QW2A 5GANg 4J9EA 5FLXE 1MMNA 1Q95G 2RQWA 1RAIB 2GNCA 3A1PA 3FLGA 2M51A 4IIOA 1IXDA 1GL5A 1TH7A 1ZSZB 5CIUA 4J9IA 2WSFE 3JB9G 4L6V5 2IG0A 4OMMA 1OU8A 2EQMA 1M90C 1AEYA 2X4WA 2ZPIB 1N5ZA 1Y57A 1IREB 4RTZA 3M0RA 2EYQA 2I0NA 4F7UE 2E41A 1XTDA 2EWNA 3UT1A 2QA4A 3GIBA 4R0KA 5EC7A 2V1QA 1VQNQ 3EG9B 4EMGA 5IHIA 2J6KA 2QGFB 4IUTA 1WHJA 1M1GA 3E9GA 2D8HA 3I56A 5L8RE 2MWOA 1MV0B 2R5AA 2DEQA 2DILA 3QSUA 1FX7A 3M54A 4UC4A 4KULA 1YHQT 3V7SA 5AYFA 3A8LB 3OBWA 4C5HA 2YLBA 2KBTA 3H0FA 1VQLQ 4HT9A 4ZGDB 4HT8A 4M75G 2H3EB 1KQSS 3TVTA 4L5GA 3JB9J 3GLXA 3EFSA 5GMKl 2DRKA 4FW2A 3GPLA 4C92G 1BCMA 1QCOA 4LUDA 1NEBA 4Z88A 3RESA 4CC4B 5KCOA 1FWZA 4M7AD 1YIJT 3GBQA 3VV0A 3JCMe 3CCQQ 2JTFA 4Z02A 3EGDB 1I07A 5KYYA 1RLQC 2VYTA 4BUGA 5A0DA 5CR2A 4QVDA 1QCFA 2DYIA 4M77C 5GAN5 1LVKA 1K73U 1M1KU 1K1ZA 1G8XA 3VUBA 2ABLA 2AKKA 1PG5B 2HSPA 1NBEB 4AFUC 4IIMA 1T3SA 1M27C 1OPLA 1UGPB 1K0SA 3CMAT 4XU0A 1GCQC 2DD5A 5FU7C 3JRZA 5LL6S 4LDVA 1GXIE 3BW1A 1RAAB 3Q1JA 2DZ9A 4X1VA 5CKDA 1ZBXA 3FIFA 3CC7T 2NLUA 2QQBA 4M7DD 2LJ3A 4DEYA 4C0ZA 1JJ2P 1G3WA 2AHJB 4F16A 1JO8A 3QJ6A 4A54A 4N4GA 4ORZA 1KD1C 3MEUA 1KHCA 3THKA 2NUTA 1ABOA 3CCRQ 2EQKA 2SEMA 3X20B 2MIOA 3DB3A 1D0YA 1I8FA 1HJDA 1AOJA 1WI7A 4HXJA 1ZUUA 2DETA 4F04B 1VIEA 3RNJA 2VASA 3JCMb 1ZBJA 4PJOE 1NZ9A 2K3XA 5GAN8 2QXFA 4PL6A 2F2XA 3CC2T 3UWNA 4WF2A 1YJNA 3EFOA 4AFQC 3OW2P 1Y71A 2JS0A 1Y7XA 4FM4B 2DL8A 4HVVA 3QPHA 1YP5A 2J05A 2KDSA 1S72A 2K9GA 3A98A 2EQIA 3G4SA 3OYAA 2EYYA 2LNHB 3CD6Q 3RKWA 1RAEB 1Y07A 2KI7A 2RN8A 1QKXA 4M78A 1Q82U 1Y0MA 1AD5A 3M0PA 2QEXQ 1M3CA 1MMDA 1WYXA 2BKDN 4JPBW 2COZA 2JNGA 1WFWA 4N0AA 3QWYA 2YUPA 5I2SA 2FRYA 3M57A 2HBPA 1ZUKA 1IO6A 3RKXA 1RAFB 3MCAB 4M7AF 2CP6A 5GMKj 1U8RA 1JEGA 2EJFA 1SSHA 2O2OA 1D0ZA 3QDRB 5A0GA 3HL8A 2EJGA 2FB7A 2GFAA 3MJXA 4LNPA 1X6BA 2F5TX 4KGVB 2VWFA 1LPLA 4M77D 5KCHA 5GMKh 1VQKQ 2VV5A 1Q81C 3PGGA 2L89A 1VQNA 3G1JA 2P0PA 3GP8A 5GAN2 2IIMA 2DJQA 3HPWA 3CC7Q 5HKCA
chains in the Genus database with same CATH topology
1VQ8Q 1K8AR 3CPWP 1NJIR 3CMEQ 1JJ2P 1S72Q 3G71Q 3I55Q 1VQ7Q 3G6EQ 1VQMQ 3G4SQ 2QA4Q 3CC4Q 3CCMQ 3CXCP 1YHQQ 3CCLQ 1YJWQ 1VQOQ 1K9MR 3CMAQ 1YIJQ 1VQ4Q 1VQPQ 1Q82R 1VQKQ 1KD1R 3CCQQ 1YI2Q 1Q81R 1VQLQ 1VQ6Q 3CD6Q 1Q86R 1VQ5Q 1W2BP 1M90R 2OTLQ 1K73R 3CCJQ 1VQNQ 2OTJQ 1M1KR 3CCVQ 3CCUQ 3CCRQ 1YJNQ 3I56Q 3CCSQ 1VQ9Q 1KC8R 1QVGP 3CCEQ 1QVFP 2QEXQ 1Q7YR 3CC2Q 3OW2P 1N8RR 3CC7Q 1YITQ 1KQSP 1YJ9Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ8 Q;  1K8A R;  3CPW P;  1NJI R;  3CME Q;  1JJ2 P;  1S72 Q;  3G71 Q;  3I55 Q;  1VQ7 Q;  3G6E Q;  1VQM Q;  3G4S Q;  2QA4 Q;  3CC4 Q;  3CCM Q;  3CXC P;  1YHQ Q;  3CCL Q;  1YJW Q;  1VQO Q;  1K9M R;  3CMA Q;  1YIJ Q;  1VQ4 Q;  1VQP Q;  1Q82 R;  1VQK Q;  1KD1 R;  3CCQ Q;  1YI2 Q;  1Q81 R;  1VQL Q;  1VQ6 Q;  3CD6 Q;  1Q86 R;  1VQ5 Q;  1W2B P;  1M90 R;  2OTL Q;  1K73 R;  3CCJ Q;  1VQN Q;  2OTJ Q;  1M1K R;  3CCV Q;  3CCU Q;  3CCR Q;  1YJN Q;  3I56 Q;  3CCS Q;  1VQ9 Q;  1KC8 R;  1QVG P;  3CCE Q;  1QVF P;  2QEX Q;  1Q7Y R;  3CC2 Q;  3OW2 P;  1N8R R;  3CC7 Q;  1YIT Q;  1KQS P;  1YJ9 Q; 
#chains in the Genus database with same CATH topology
 2D0N A;  3TSZ A;  2VC8 A;  1BU1 A;  1B3Q A;  1I1J A;  3M0S A;  1N8R U;  4M7D F;  1QP3 A;  3CPW A;  2KMT A;  4ANJ A;  3OYB A;  1VQ4 T;  1SHG A;  2A7Y A;  2NUP B;  1YBY A;  4J83 A;  1VQL A;  1UJ0 A;  3MP1 A;  4OB0 B;  1K73 R;  4BY6 C;  1M1K R;  3PIO A;  5GAM d;  2DER A;  3TQ7 P;  2PU9 B;  1PSF A;  3J81 E;  2KK4 A;  2F1L A;  2CZ1 B;  4M77 B;  2F2W A;  1VQ5 T;  4GLM A;  2DXU A;  3CCQ A;  2OTL Q;  2RI2 A;  5GMK i;  3L2W A;  1O9S A;  2ZPH B;  3JCM f;  2VGN A;  3CQT A;  1VYT A;  4F14 A;  4PJM A;  1M2V B;  4HCK A;  3REA B;  5LJ3 d;  4BI4 A;  3CC4 T;  4KUI A;  1VQM Q;  2LT1 A;  3J7A F;  4M75 E;  2RHI A;  4X9C A;  1BI3 A;  3OYM A;  2OAW A;  5HY6 A;  2L3R A;  4C0F A;  1VOM A;  4MML A;  4EMK C;  3OYK A;  3PMI A;  2KNB B;  3VRY A;  2NUZ A;  4PJJ A;  1SKU B;  4C92 E;  2RQU A;  1Q7Y C;  4E7Z A;  5J3B A;  2QG9 B;  2HQE A;  1QVF A;  3OYG A;  2JS2 A;  2HQX A;  3LH5 A;  4RCC A;  3EAE A;  3M55 A;  2MPX C;  2EGC A;  4IUP A;  3LH0 A;  3JB9 H;  1Q86 R;  3WXM B;  3CCU T;  3JCM P;  3OYC A;  1M30 A;  3L42 A;  2M1H A;  5I22 A;  1QQJ A;  4J6W A;  2E3H A;  3CCR A;  1KFZ A;  5D7U A;  2VVK A;  5CQY A;  1WXU A;  1BI0 A;  2V1R A;  4ZGJ B;  5KYU A;  1YJ9 Q;  1SHF A;  3VKI A;  2J06 A;  1NG2 A;  1TUC A;  5GMK m;  2L8D A;  4ZTF A;  2L5Q A;  2K3B A;  4E7I A;  1KD1 R;  4KH0 B;  2HQH A;  3KBG A;  3WVD B;  2LZ6 B;  4HCZ A;  4PLI A;  2M02 A;  4O6J A;  4M77 F;  2FZK B;  1A0N B;  4QT7 A;  4OMF B;  4BDY A;  5GAO l;  1E6G A;  2FZC B;  1VQ8 T;  1WZO A;  4LE9 A;  3M59 A;  1K8A R;  2LVM A;  1JXM A;  1RAH B;  4FSS A;  1RI0 A;  1G83 A;  4E7S A;  3ZL7 C;  1VQP T;  2GFU A;  4ATO A;  2PVO B;  3CD6 A;  2DL5 A;  1SG5 A;  6AT1 B;  4FW1 A;  1QVG P;  1OZ3 A;  2B86 A;  4AFS C;  2QEX A;  1YIT T;  2CSI A;  2LT4 A;  2HZY A;  2QTX A;  2KXC A;  2ZPB B;  1LNX A;  2BUD A;  2DJZ A;  3CXC S;  5GAO p;  1WGS A;  2ENM A;  2J7I A;  1WPY A;  3M5A A;  3TEE A;  3DB4 A;  3VS6 A;  3HHT B;  4ZGE B;  4K11 A;  1N8R R;  4IUR A;  1JQQ A;  3HSB A;  2E70 A;  4KUD K;  4XTU A;  5HCK A;  2OI3 A;  3SWN C;  4FYX B;  3BY7 A;  2D8J A;  2K79 A;  3KUF A;  2HAX A;  2R5M A;  4C5G A;  3LGF A;  2C06 A;  4Z89 A;  1VQK A;  1TG0 A;  4C0D C;  3S3M A;  2CGH A;  4PJO C;  1TUD A;  2FPF A;  3OY9 A;  2EKH A;  2ZCF B;  1XOV A;  4OB1 B;  3PMT A;  4LD9 K;  2COY A;  3GNG A;  4E7K A;  3RKY A;  2JW4 A;  3CC7 A;  2JZ2 A;  1WHK A;  2HKQ B;  3KXT A;  1D3B B;  4BY6 B;  1G5V A;  2KYB A;  2HEQ A;  2VUB A;  2XK0 A;  4BE1 A;  3MHX A;  1VYV A;  3RIR A;  2RQR A;  1WJR A;  2K5L A;  2OTJ T;  2EJ9 A;  2RHU A;  2CKK A;  3CCE Q;  2Y4Y A;  4JLG A;  2RI5 A;  1U3O A;  2DIQ A;  3MET A;  1B34 A;  2K2V A;  3UF4 A;  2EAY A;  4BD3 A;  5GAN d;  5GAM h;  4OMP A;  4D8K A;  2HSE B;  1HYO A;  1M4Z A;  1N27 A;  5LJ5 e;  1WJS A;  2YHT A;  2XU8 A;  1JB0 E;  2DA9 A;  1YI2 T;  2X9H A;  2DRM A;  1VQ6 Q;  2ZGW A;  4B9X A;  2OTL A;  1WDX A;  1YN8 A;  4M7A G;  1I5O B;  4C0G A;  2DE0 X;  2XI9 A;  4F7U B;  3QO3 A;  1TOV A;  1H64 1;  4EMK B;  3O8V A;  1S72 Q;  1YFN A;  3G6E T;  1VQM A;  5GAM e;  4WTO B;  2KXD A;  3LGL A;  5LJ3 h;  4DQ2 A;  2A0F B;  3OQ5 A;  1PD0 A;  3CCV Q;  3DKM A;  3R6N A;  2DVE A;  2MMP A;  2YDL A;  2RQV A;  2Y90 A;  2JOY A;  1UFF A;  1VQ7 T;  1NLO C;  2QGG A;  3CCL Q;  3L1A A;  4M7D G;  2DXC A;  1WNL A;  3EG0 A;  1HXD A;  4NOY A;  3OYE A;  2HKN A;  2V26 A;  4J6X A;  5KYX B;  3M0U A;  5LJ3 e;  1Q7Y R;  1D0X A;  4AFZ C;  2BE7 D;  5KE2 A;  4D8D A;  1IRX A;  2EQU A;  3PVQ A;  1YJ9 A;  1BBZ A;  4M78 E;  4FYY B;  4BE0 A;  5CKH A;  1VQO T;  2G3R A;  4MDW A;  1X2Q A;  4QQD A;  2RJD A;  3V8J A;  1E6H A;  1UB4 A;  4N4H A;  3CCS T;  2QYZ A;  1K73 C;  3EG2 A;  1M1K C;  2K6D A;  2PNI A;  5ECA A;  3TSW A;  4OML A;  3NMZ C;  1XNI A;  3OBY A;  2YRD A;  2YSQ A;  4AG1 C;  4J7F A;  2JM9 A;  4C8Q A;  2O9V A;  2LQN A;  2DL7 A;  4PJO D;  1UG1 A;  3JCM h;  5IXB A;  2ED1 A;  1JJ2 A;  2FPD A;  4CC2 A;  3RDV A;  1RUW A;  4JS4 A;  3EH2 A;  1WQW A;  1FMW A;  4M75 C;  3OS2 A;  1BIA A;  1VQ9 T;  4ZTJ A;  1X43 A;  3JCM Q;  1VIF A;  1G3S A;  2RNA A;  4NL2 A;  2PUO B;  2X51 A;  2LC4 A;  4C92 C;  2RPN A;  4HVU A;  4NL3 A;  2LJ1 A;  2AK5 A;  3C12 A;  1WQ7 A;  1OEB A;  4DOV A;  3I9Q A;  5C0M A;  2DX1 A;  3CCJ T;  1VQ5 A;  5GAN 4;  3SWN B;  1Y96 A;  1M90 U;  4QVC A;  3QDF A;  4C0D B;  4A4K A;  2RI3 A;  2ROT A;  1AWX A;  5KYW A;  5HK0 A;  4PJO B;  1J3T A;  5IH2 A;  3G6E Q;  4RTV A;  1NJI U;  4ZN3 A;  2CUD A;  2L0A A;  5CVI A;  1Q86 C;  1W1F A;  2ED0 A;  3JV3 A;  1M9S A;  1BYM A;  2LX9 A;  4QQ6 A;  2JUF A;  2DMO A;  4PKC C;  1KK7 A;  1G3T A;  3JCM X;  1KQ2 A;  3I55 T;  3CCM T;  1D1B A;  1VQ7 Q;  4LXC A;  2GF7 A;  2PTK A;  1TU0 B;  3ZEH A;  1I5L A;  3EGX A;  2K7A A;  3M4Y A;  4RTX A;  1ZQ1 A;  3CCE A;  1MV3 A;  1TXQ A;  3UPU A;  2D6F A;  5KE3 A;  3JB9 D;  2RHX A;  2XDP A;  3X24 B;  4DBF A;  1K8A C;  1W6X A;  3NTK A;  4DOW A;  3SEM A;  2LQK A;  2RH2 A;  4HCC A;  1VQO Q;  1SRM A;  5IHK A;  1W2B S;  2X3X D;  3FJ5 A;  1PHT A;  3H8Z A;  1VQ6 A;  4FYV B;  4FIB A;  5LJ5 f;  1PC0 A;  4FYW B;  1G2B A;  1NPP A;  1AT1 B;  2DO3 A;  1W2B A;  4LDW A;  4C8Q G;  3TCJ A;  1KQS P;  2DTI A;  3CME T;  1O75 A;  3O5Z A;  2CP7 A;  4TVR A;  2P84 A;  1YHQ Q;  4BI3 A;  1R8O B;  4QKU A;  4Y28 E;  1UUE A;  3MPU B;  1GBR A;  4PJO F;  1FXX A;  4PFP A;  5FWB A;  5GAN e;  3LLR A;  2OJ2 A;  3CCV A;  5GAM f;  3GF5 A;  4EIK A;  3QG1 A;  5FWC A;  3ZFJ A;  1UEB A;  1N8R C;  3MEA A;  4N4I A;  1WJQ A;  4M75 D;  2WSC E;  2H8H A;  2DBK A;  4MZT A;  5FRM A;  3A5Z B;  3REB B;  2CH4 A;  3CCL A;  1YIJ Q;  1WIE A;  2KQW A;  4J6Y A;  1RAB B;  4M7A E;  4C92 D;  1SF9 A;  1V1C A;  3PT9 A;  4X34 A;  1K9M U;  3V8L A;  2FZG B;  5C6S A;  4FCY A;  1AWJ A;  1CKA A;  4RG2 A;  4GBQ A;  2EFI A;  1OI1 A;  2H3J A;  5LJ3 f;  5CAI A;  3HFN A;  2JMA A;  1ZLM A;  3CMA Q;  5CO7 A;  3SFM A;  3DLM A;  3EG1 A;  2ZPF B;  2EW3 A;  1LOJ A;  4PFO A;  5LJ5 d;  3INZ A;  5GAN 6;  4HA8 A;  2YRV A;  3OS0 A;  4OP0 A;  3CPW S;  1GRI A;  4PJL A;  4M75 B;  2GGR A;  4M7D E;  2FEI A;  3I55 Q;  3QBY A;  2QA4 T;  1ZSZ A;  2ZAE A;  3EFR A;  2KRO A;  3QII A;  3A8M B;  1OZ2 A;  1V76 A;  5DY9 A;  3AHU A;  1QKW A;  2C0I A;  4C92 B;  1D09 B;  3I56 T;  3A8O B;  4IUU A;  2QTV A;  4EPC A;  2KGT A;  2LP5 A;  4BE2 A;  5GAO r;  3OYL A;  2MYS A;  4JJB A;  1AWW A;  1H3H A;  1T0H A;  3SDZ A;  1BK2 A;  2HL5 C;  4HVW A;  3V7C A;  4J9D A;  4JRK A;  2D0Q B;  1WHL A;  2AT1 B;  2XKO C;  3EG9 A;  4RTY A;  3MEW A;  3PE0 A;  4L59 A;  5GAN 3;  1X01 A;  2QAZ A;  2X4X A;  3H0I A;  3CC2 Q;  1ZX6 A;  1TTH B;  3VS7 A;  5FU7 B;  2DXB A;  2EYW A;  1TUG B;  4R55 A;  2CT4 A;  4AT1 B;  2QI2 A;  2VKN A;  3VS3 A;  4RMO A;  3G6E A;  1R0B G;  4M78 C;  1K0X A;  4BI8 B;  3SD4 A;  1QVF S;  2Y4X A;  4WCI A;  4C5I A;  3OYY A;  4N0A C;  5IAY A;  2DPP B;  4AG2 C;  1UGS B;  2EVR A;  1QVG A;  2F2V A;  2QDY B;  3QYH B;  2FRW A;  4O5V A;  2C0T A;  1ZSG A;  2MI6 A;  5FU6 C;  2L3P A;  2DM1 A;  3EGD A;  1VQ7 A;  4M75 F;  3TU4 K;  4KGZ B;  1UHC A;  2JN0 A;  2RO0 A;  1FMV A;  4QQG A;  3J80 E;  2YT6 A;  2CUB A;  2LJ0 A;  2E10 A;  3L2R A;  1TSF A;  1RAG B;  2KEA A;  1UGR B;  4XU3 A;  2K4Y A;  3GOX A;  4J5Y A;  4XAX B;  5CK9 A;  5GJW B;  5IXF A;  1VQO A;  1Q82 R;  1ACM B;  1IGQ A;  3DLL A;  4DA4 A;  2W10 A;  4OGE A;  1DJ7 B;  2KY9 A;  2RQT A;  3M0T A;  2RB6 A;  2CP3 A;  4PLL A;  1YWO A;  4KRT A;  3UDC A;  4M7A A;  4J9C A;  1GBQ A;  1UTI A;  2CS7 A;  1HK9 A;  2EYZ A;  3EH1 A;  1NYG A;  5L23 A;  1K9M R;  4Y92 A;  1YHQ A;  4KT0 E;  1VQ4 Q;  2L2P A;  1I4K 1;  4CRI A;  5I11 A;  1YJN T;  5KH6 A;  5KYY B;  3BE3 A;  2XHC A;  2A08 A;  2YWW A;  3U23 A;  2A28 A;  3OMG A;  2JTM A;  2F5K A;  2QQA A;  5GAN f;  3G4S T;  3PVL A;  5EG2 A;  2KSS A;  2CP5 A;  3F70 A;  3FC3 A;  3L2Z A;  4OMN A;  4JRI A;  4KGX B;  1YIJ A;  2GTJ A;  1VQ5 Q;  3M0Q A;  4C8Q E;  4M7D A;  3E19 A;  2R58 A;  4ZNX A;  2RA2 A;  1QLY A;  3V8K A;  2LCC A;  3RBB B;  3CEY A;  2RHZ A;  2GTO A;  7AT1 B;  3QUI A;  3M4G A;  1M2O A;  1VA7 A;  4RUG A;  2LCL A;  2CSQ A;  2MCN A;  3CC4 Q;  2E6Z A;  3CBM A;  5LJ5 j;  2RMO A;  3CMA A;  1B7T A;  4A53 A;  1NE8 A;  3C95 A;  1OV3 A;  3C94 A;  3RR6 A;  3JCM g;  3EGX B;  4GLK A;  2DNU A;  2NUT B;  5D6W A;  1N9R A;  3JCM J;  4M78 D;  1BI1 A;  2O31 A;  3AT1 B;  5CKB A;  1WXT A;  5LJ5 h;  2XG8 D;  1F1B B;  3I55 A;  2A36 A;  1QCN A;  5GAM j;  2M0O A;  3SB2 A;  1M3A A;  1K4U S;  1EZZ B;  1R0C B;  1I81 A;  2O01 E;  2O4X A;  3CCU Q;  4PJO G;  2KAF A;  4JDS A;  4E7J A;  4RCB A;  1IGU A;  3FJP A;  2EBP A;  4XU1 A;  3EFO B;  4XTZ A;  1CSK A;  2CRE A;  3LW5 E;  4J7I A;  4MZM A;  5IN1 A;  3QZ9 B;  3HRU A;  2DD4 A;  5J39 A;  4OB3 B;  2EKO A;  1UHF A;  1WHH A;  3PIP A;  4E7L A;  2O9S A;  4JJN K;  3E2U A;  4OMO A;  3QHS A;  4M7A C;  2CT3 A;  2E12 A;  1BB9 A;  2E5Q A;  4M78 B;  5CQX A;  5LJ3 j;  3CC2 A;  1TS9 A;  3HKS A;  4EDU A;  1VQ8 Q;  1IB8 A;  5GJV B;  1QP2 A;  5A0L A;  3CXC P;  1JXO A;  3CCQ T;  1VQP Q;  1NLP C;  3H0H A;  2P4T A;  3VS2 A;  2ZPE B;  1RAD B;  2DXT A;  2QQR A;  5FU6 B;  4A4G A;  4AMC A;  2GBQ A;  2KRN A;  1YIT Q;  4FT4 A;  4ESR A;  3NTI A;  3EHR A;  4RTW A;  1IZ6 A;  4RTT A;  4M77 A;  3S3O A;  4M7D C;  1YJW T;  4HCB A;  3NGP A;  4II1 A;  4M4Z A;  3D7S B;  1MUZ A;  3JCM V;  5I21 A;  1GCQ A;  3L2Q A;  4MDX A;  2COW A;  3QWX X;  1I0C A;  4LD6 A;  1PCX A;  3OYJ A;  3EGU A;  1M2V A;  3ULR B;  4E7H A;  2M0Y A;  1PM3 A;  2JJ9 A;  3M56 A;  3PFS A;  2MAM A;  2E1H A;  3QKJ A;  4JLI A;  4E6R A;  1E7O A;  1KSW A;  1SPK A;  1NM7 A;  4B6M A;  3IQL A;  2JT4 A;  3H9N A;  3CCR T;  4BB7 A;  3M9Q A;  2WAC A;  2V8I A;  3UAT A;  3LWH A;  1UGV A;  4ZN1 A;  4B9W A;  4LDX A;  5J26 A;  4A4E A;  1JJ2 S;  1FMK A;  4CC3 A;  1WXB A;  1NJI C;  2DKG A;  2ZZD A;  4M78 F;  4F7U F;  1BKB A;  1GFD A;  2PVG B;  1C1A A;  4JZ4 A;  2E65 A;  1VQ4 A;  1D1C A;  1EX4 A;  2D9T A;  2OTJ Q;  5IHN A;  2BTT A;  4R56 A;  2DYB A;  2L3Q A;  1JBM A;  1X27 A;  2XID A;  1KC8 U;  2XDD A;  4FSX A;  5DLO A;  3FEO A;  1PSE A;  4LUE A;  2BE9 B;  3CD6 T;  1X6G A;  1OYX A;  1YCY A;  3OSV A;  1N9S A;  1SEM A;  1YI2 Q;  2CP0 A;  1KHI A;  3QZ5 B;  1PKS A;  2K5F A;  3I5R A;  1MNE A;  5IT9 E;  3OW2 S;  2QEX T;  3VS5 A;  5HK3 A;  2JTE A;  2KRS A;  1PRL C;  3MP6 A;  2P0Q A;  4IUQ A;  2QK0 A;  1PD1 A;  1QW1 A;  4QVZ A;  1QVP A;  1W4S A;  2MK5 A;  3HFO A;  2ATC B;  4C5E A;  3OW2 A;  1V29 B;  2DFU A;  1KQS A;  2DZC A;  4MMK A;  3CC4 A;  3BDU A;  2LQ8 A;  1QWE A;  1H8K A;  5AT1 B;  3RMS A;  1ZA1 B;  2DL3 A;  3V7R A;  1IHW A;  2K3Y A;  2M16 A;  4JUV A;  2QAS A;  1AZG B;  2E5K A;  4FU6 A;  4M77 G;  2MF2 A;  4NS5 A;  3MP8 A;  1M8M A;  1PRM C;  2DEU A;  5GAO m;  2J6F A;  2PUK B;  1RLP C;  5KYU B;  2JVV A;  1WA7 A;  1YJW Q;  1MGQ A;  1VQK T;  3BFM A;  2YRC A;  5KYN A;  2LMJ A;  1Q82 C;  2CP2 A;  2CZ6 B;  3CCU A;  5GAN j;  3JAM E;  1PWT A;  1OU9 A;  2KRM A;  1SRL A;  3VJP A;  3NFC A;  3URG A;  4Z8A A;  1RI9 A;  2XD0 A;  1YWP A;  2AKL A;  2KT1 A;  1Z9Z A;  4M7A B;  1QWF A;  2VGM A;  1NPR A;  1K9M C;  5GAN h;  9ATC B;  2RK2 A;  2CZ7 B;  3A8G B;  4EMH A;  4ELZ C;  4J9G A;  3ER0 A;  2BZX A;  4XTW A;  3CCS Q;  3FRN A;  3CPF A;  4C8Q C;  2J6O A;  2ESW A;  1D3B A;  3NPF A;  2EGE A;  4J9F A;  1VQ8 A;  3RUX A;  1OPK A;  2NYS A;  2YUN A;  2EPD A;  2JMC A;  5CCA A;  3MEV A;  1VQP A;  1OUL A;  2OTL T;  2CYZ B;  2EGA A;  1VQ9 Q;  1Q86 U;  4JJC A;  4M7D B;  2X35 A;  5GAO q;  1EIF A;  2AZS A;  2PVD B;  3P8D A;  1YIT A;  4DEX A;  1MMG A;  2DL4 A;  4DBH A;  3G71 T;  1JRI A;  1VQM T;  3C4S A;  1C0M A;  3HTR A;  1M1F A;  4RTU A;  3X26 B;  2HBW A;  3VYG A;  2LQW A;  3CCJ Q;  4F7U A;  3VUZ A;  1GFC A;  1KD1 U;  4J9H A;  4OVA A;  4PK4 A;  4EMK A;  3WVE B;  4XTV A;  3OYF A;  4KH1 B;  2R57 A;  2LCS A;  3C0C A;  2YXY A;  3OS5 A;  4JJD A;  2BZ8 A;  2K57 A;  4P5N A;  3P8H A;  1BI2 A;  3JCM c;  2HNI A;  2V8K A;  1K8A U;  3A8H B;  3MKD A;  2JXB A;  2PQW A;  3R6O A;  2KVQ G;  3VS0 A;  2F69 A;  3OSS C;  1U06 A;  1UEC A;  2NWM A;  3ASK A;  4OGC A;  4DBQ A;  4LN2 A;  4RG8 A;  2P4R A;  1KC8 R;  3MO8 A;  2Z0W A;  3HP9 A;  4XQ3 A;  4ELY C;  2O4X B;  2RJE A;  1YJ9 T;  1LCK A;  2X4J A;  1W70 A;  3L2U A;  1QMC A;  3L2V A;  5A2Q E;  1B34 B;  1M8V A;  5FRN A;  3UA6 A;  4E47 A;  3CCM Q;  2K2M A;  1N6A A;  4JRQ A;  2CH4 W;  2FPE A;  2A37 A;  5KYX A;  1GCP A;  2E3I A;  1W2B P;  1M90 R;  2GQV A;  1ZHI A;  3NTH A;  3X25 B;  2OTJ A;  4XK8 E;  1WX6 A;  4XTX A;  2FVU A;  5GAO n;  2QQS A;  2V8J A;  2RJC A;  1RL2 A;  3HRT A;  2JM8 A;  1NJI R;  1EFN A;  3X28 B;  2VXE A;  3JB9 F;  2RK1 A;  1T3L A;  2FG0 A;  1YI2 A;  1X69 A;  4IUV A;  5GMK e;  4YTL A;  1CKB A;  1AWO A;  3ME9 A;  1M3B A;  1U5S A;  3ZBD A;  2MWP A;  3JSC A;  3CME Q;  2HDA A;  1VUB A;  2HD0 A;  1UE9 A;  4C8Q D;  1NEG A;  5LJ5 g;  1X6O A;  2DVJ A;  1X2K A;  1QVG S;  3OYN A;  5DM7 R;  2LRQ A;  1Q81 U;  1MMA A;  4MZP A;  3JCM W;  8AT1 B;  1WHG A;  1H3Z A;  2A3L A;  1PKT A;  2LDM A;  4GY5 A;  1ARK A;  3G71 Q;  5CKF A;  3S6W A;  2MOX A;  4IKF A;  4X9D A;  3EG3 A;  4DBR A;  4D6W A;  3VU3 C;  2E6N A;  4M78 G;  2KE9 A;  5D6X A;  1YJW A;  1HD3 A;  3SWN A;  4E2F B;  2LX7 A;  4F7U G;  3EHQ A;  3P8B B;  1XJW B;  5GAM g;  2C0O A;  2SRC A;  3UA7 A;  4CI0 C;  2DK3 A;  4C92 F;  1OX9 A;  4PJO A;  1KIK A;  3CPW P;  4JRP A;  2QDL A;  2X4Y A;  1UGQ B;  1BCO A;  3FDR A;  4C8Q B;  3OB9 A;  2HL3 A;  3OA6 A;  2GQI A;  2XMF A;  2YLC A;  1IHV A;  3HRS A;  4M77 E;  3CCE T;  3VYH B;  3CCS A;  3QXE B;  1B07 A;  1ZUY A;  2RJF A;  1ZSZ C;  5CKE A;  5LJ3 g;  1BIB A;  3LWI A;  1HSQ A;  2W0Z A;  2ZPG B;  3G7Z A;  2QA4 Q;  3PNW C;  1RAC B;  3LX7 A;  1VQ6 T;  3QYG B;  1H92 A;  4XU2 A;  1PNJ A;  4FT2 A;  3H41 A;  2RF0 A;  5I2M A;  4LDY A;  3I56 Q;  2O88 A;  1P92 A;  2ROL A;  2RM4 A;  1VQ9 A;  2KT8 A;  3JCM d;  1U1S A;  3I35 A;  1Y96 B;  1Q7Y U;  1XQH A;  1S72 T;  3TRE A;  3RMQ A;  1S1N A;  2D1X A;  1LJO A;  2OAU A;  1VYU A;  1G3Y A;  5KYW B;  2ECZ A;  1R77 A;  1T0J A;  1KG1 A;  3CCV T;  4F17 A;  4LDU A;  3H6Z A;  1ZA2 B;  4PJN A;  3CCJ A;  1QVF P;  2IVW A;  3M53 A;  1U1T A;  1WLP B;  4JZ3 A;  2X3W D;  3QJY A;  4Y91 A;  2M9U A;  3OMC A;  3OYH A;  1MHN A;  2YUO A;  4VUB A;  2QQ9 A;  2I2L A;  2EQJ A;  3CCL T;  1UDL A;  3VS1 A;  4ME7 A;  3E1S A;  3OYD A;  3CXC A;  3E9F A;  2FO0 A;  5DLQ E;  4C8Q F;  1AZE A;  3NHN A;  4BAC A;  2DIG A;  2B8A A;  1AVZ C;  2L3S A;  3CBP A;  1OQK A;  2EYX A;  2RHY A;  5D6Y A;  2FHD A;  2DAQ A;  2VXF A;  4V2S A;  5FRO A;  5FW9 A;  2HMA A;  2AIR B;  1X75 C;  3CCM A;  3BDL A;  3I5S A;  2GCX A;  2VB6 A;  1K76 A;  4CC7 A;  2IPO B;  1VQN T;  5M9O A;  3KFV A;  3M58 A;  2K5I A;  3S3N A;  1WHM A;  1SSF A;  8ATC B;  3VS4 A;  1FYN A;  2LTO A;  1C6V X;  4KBM B;  1M5Q 1;  2DBM A;  3CBO A;  1KJW A;  4Q5W A;  2WSE E;  2RD1 A;  4OB2 B;  2DTH A;  4OMQ A;  1KQ1 A;  1ABQ A;  1Q81 R;  1VQL T;  2HCK A;  4OF1 A;  2G6F X;  3RER A;  2XIC A;  3SHW A;  2PZ1 A;  1K9A A;  4M75 A;  1UJY A;  3OYI A;  1YNZ A;  2CZ0 B;  3VRZ A;  1D1A A;  3OS1 A;  4XTY A;  4RKU E;  3CME A;  4PNO A;  2NUP A;  3LYI A;  4C92 A;  4J8O A;  2EIF A;  2KR3 A;  4FL6 A;  2E4H A;  4A4F A;  2LNV A;  1Z9Q A;  2XDB A;  1YJN Q;  2AZV A;  1AHJ B;  2YUQ A;  3N5B B;  2P0K A;  4JS5 A;  2E64 A;  4A4H A;  2DTO A;  5GAN 7;  2FL7 A;  3G71 A;  4PFZ A;  3FB9 A;  3G4S Q;  4HKE A;  1JU5 C;  2CDT A;  2DLP A;  1YCS B;  1NYF A;  3PTA A;  1OX8 A;  2OX7 A;  2KYM A;  4J9B A;  4A63 B;  1TWB A;  1MND A;  3T9N A;  2FYK A;  3JB9 I;  1KC8 C;  4BDZ A;  2BZY A;  2DF6 A;  1OOT A;  3GNF B;  2BIV A;  4QW2 A;  5GAN g;  4J9E A;  5FLX E;  1MMN A;  1Q95 G;  2RQW A;  1RAI B;  2GNC A;  3A1P A;  3FLG A;  2M51 A;  4IIO A;  1IXD A;  1GL5 A;  1TH7 A;  1ZSZ B;  5CIU A;  4J9I A;  2WSF E;  3JB9 G;  4L6V 5;  2IG0 A;  4OMM A;  1OU8 A;  2EQM A;  1M90 C;  1AEY A;  2X4W A;  2ZPI B;  1N5Z A;  1Y57 A;  1IRE B;  4RTZ A;  3M0R A;  2EYQ A;  2I0N A;  4F7U E;  2E41 A;  1XTD A;  2EWN A;  3UT1 A;  2QA4 A;  3GIB A;  4R0K A;  5EC7 A;  2V1Q A;  1VQN Q;  3EG9 B;  4EMG A;  5IHI A;  2J6K A;  2QGF B;  4IUT A;  1WHJ A;  1M1G A;  3E9G A;  2D8H A;  3I56 A;  5L8R E;  2MWO A;  1MV0 B;  2R5A A;  2DEQ A;  2DIL A;  3QSU A;  1FX7 A;  3M54 A;  4UC4 A;  4KUL A;  1YHQ T;  3V7S A;  5AYF A;  3A8L B;  3OBW A;  4C5H A;  2YLB A;  2KBT A;  3H0F A;  1VQL Q;  4HT9 A;  4ZGD B;  4HT8 A;  4M75 G;  2H3E B;  1KQS S;  3TVT A;  4L5G A;  3JB9 J;  3GLX A;  3EFS A;  5GMK l;  2DRK A;  4FW2 A;  3GPL A;  4C92 G;  1BCM A;  1QCO A;  4LUD A;  1NEB A;  4Z88 A;  3RES A;  4CC4 B;  5KCO A;  1FWZ A;  4M7A D;  1YIJ T;  3GBQ A;  3VV0 A;  3JCM e;  3CCQ Q;  2JTF A;  4Z02 A;  3EGD B;  1I07 A;  5KYY A;  1RLQ C;  2VYT A;  4BUG A;  5A0D A;  5CR2 A;  4QVD A;  1QCF A;  2DYI A;  4M77 C;  5GAN 5;  1LVK A;  1K73 U;  1M1K U;  1K1Z A;  1G8X A;  3VUB A;  2ABL A;  2AKK A;  1PG5 B;  2HSP A;  1NBE B;  4AFU C;  4IIM A;  1T3S A;  1M27 C;  1OPL A;  1UGP B;  1K0S A;  3CMA T;  4XU0 A;  1GCQ C;  2DD5 A;  5FU7 C;  3JRZ A;  5LL6 S;  4LDV A;  1GXI E;  3BW1 A;  1RAA B;  3Q1J A;  2DZ9 A;  4X1V A;  5CKD A;  1ZBX A;  3FIF A;  3CC7 T;  2NLU A;  2QQB A;  4M7D D;  2LJ3 A;  4DEY A;  4C0Z A;  1JJ2 P;  1G3W A;  2AHJ B;  4F16 A;  1JO8 A;  3QJ6 A;  4A54 A;  4N4G A;  4ORZ A;  1KD1 C;  3MEU A;  1KHC A;  3THK A;  2NUT A;  1ABO A;  3CCR Q;  2EQK A;  2SEM A;  3X20 B;  2MIO A;  3DB3 A;  1D0Y A;  1I8F A;  1HJD A;  1AOJ A;  1WI7 A;  4HXJ A;  1ZUU A;  2DET A;  4F04 B;  1VIE A;  3RNJ A;  2VAS A;  3JCM b;  1ZBJ A;  4PJO E;  1NZ9 A;  2K3X A;  5GAN 8;  2QXF A;  4PL6 A;  2F2X A;  3CC2 T;  3UWN A;  4WF2 A;  1YJN A;  3EFO A;  4AFQ C;  3OW2 P;  1Y71 A;  2JS0 A;  1Y7X A;  4FM4 B;  2DL8 A;  4HVV A;  3QPH A;  1YP5 A;  2J05 A;  2KDS A;  1S72 A;  2K9G A;  3A98 A;  2EQI A;  3G4S A;  3OYA A;  2EYY A;  2LNH B;  3CD6 Q;  3RKW A;  1RAE B;  1Y07 A;  2KI7 A;  2RN8 A;  1QKX A;  4M78 A;  1Q82 U;  1Y0M A;  1AD5 A;  3M0P A;  2QEX Q;  1M3C A;  1MMD A;  1WYX A;  2BKD N;  4JPB W;  2COZ A;  2JNG A;  1WFW A;  4N0A A;  3QWY A;  2YUP A;  5I2S A;  2FRY A;  3M57 A;  2HBP A;  1ZUK A;  1IO6 A;  3RKX A;  1RAF B;  3MCA B;  4M7A F;  2CP6 A;  5GMK j;  1U8R A;  1JEG A;  2EJF A;  1SSH A;  2O2O A;  1D0Z A;  3QDR B;  5A0G A;  3HL8 A;  2EJG A;  2FB7 A;  2GFA A;  3MJX A;  4LNP A;  1X6B A;  2F5T X;  4KGV B;  2VWF A;  1LPL A;  4M77 D;  5KCH A;  5GMK h;  1VQK Q;  2VV5 A;  1Q81 C;  3PGG A;  2L89 A;  1VQN A;  3G1J A;  2P0P A;  3GP8 A;  5GAN 2;  2IIM A;  2DJQ A;  3HPW A;  3CC7 Q;  5HKC A; 
#chains in the Genus database with same CATH homology
 1VQ8 Q;  1K8A R;  3CPW P;  1NJI R;  3CME Q;  1JJ2 P;  1S72 Q;  3G71 Q;  3I55 Q;  1VQ7 Q;  3G6E Q;  1VQM Q;  3G4S Q;  2QA4 Q;  3CC4 Q;  3CCM Q;  3CXC P;  1YHQ Q;  3CCL Q;  1YJW Q;  1VQO Q;  1K9M R;  3CMA Q;  1YIJ Q;  1VQ4 Q;  1VQP Q;  1Q82 R;  1VQK Q;  1KD1 R;  3CCQ Q;  1YI2 Q;  1Q81 R;  1VQL Q;  1VQ6 Q;  3CD6 Q;  1Q86 R;  1VQ5 Q;  1W2B P;  1M90 R;  2OTL Q;  1K73 R;  3CCJ Q;  1VQN Q;  2OTJ Q;  1M1K R;  3CCV Q;  3CCU Q;  3CCR Q;  1YJN Q;  3I56 Q;  3CCS Q;  1VQ9 Q;  1KC8 R;  1QVG P;  3CCE Q;  1QVF P;  2QEX Q;  1Q7Y R;  3CC2 Q;  3OW2 P;  1N8R R;  3CC7 Q;  1YIT Q;  1KQS P;  1YJ9 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...