2ZAEA

Crystal structure of protein ph1601p in complex with protein ph1771p of archaeal ribonuclease p from pyrococcus horikoshii ot3
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
GSYQEIIGRTWIFRGAHRGRVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGDRIWKVPKDVSIFEFEADDGTKIKIPGERLVGRPEMRLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease P protein component 1
publication title Structure of an archaeal homolog of the human protein complex Rpp21-Rpp29 that is a key core component for the assembly of active ribonuclease P.
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 24
structure length 105
sequence length 105
chains with identical sequence C
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2007-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01868 UPF0086 Domain of unknown function UPF0086
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.210 Mainly Beta Roll SH3 type barrels. Ribonuclease P/MRP, subunit p29 2zaeA00
1OQKA 1PC0A 1V76A 2KI7A 1TSFA 1TS9A 2ZAEA
chains in the Genus database with same CATH superfamily
4IUVA 1YWPA 1YJWT 4CC4B 1R8OB 2LTOA 1WJRA 2VGNA 5DM7R 3L42A 4A4KA 4L59A 1I0CA 2EBPA 2RI3A 3JCMW 2MWPA 3LYIA 3AHUA 3H41A 1V29B 3CCJA 4AFQC 2RHXA 3RIRA 4QQGA 4A53A 2D1XA 3CCMQ 3CCVA 4PJOE 3JCMJ 1D0YA 3CCEQ 4C8QG 2K57A 3A8OB 1UUEA 2VUBA 2RHZA 3TQ7P 1XQHA 4C0FA 1HJDA 1VQNA 1AD5A 2CH4W 1FMKA 2MI6A 2L8DA 1Q86R 1M2OA 3OYNA 2PZ1A 3MKDA 2EGAA 2EWNA 3CCQA 2DBMA 5GAMf 2VV5A 1QVFS 2O2OA 2X3WD 4JDSA 4M7DC 4N0AA 3PE0A 2X9HA 2CT4A 2OTJT 4AT1B 1N8RR 1YFNA 4IIOA 3BE3A 1JXOA 1CSKA 2EJFA 2O4XA 3OQ5A 1MMDA 1SPKA 1V76A 4A63B 5FW9A 1QVFP 1I4K1 2FHDA 4J7IA 1VQOQ 3M0SA 4Q5WA 3NMZC 1GXIE 5KYYA 1PC0A 2AZVA 3PMTA 2QEXA 2HQHA 2B86A 1ZQ1A 5CR2A 2AHJB 2M1HA 4C92C 3SWNA 4ZN3A 4M7DD 3OSSC 4HCCA 1ARKA 3NHNA 3VKIA 1WPYA 1BI0A 1Q81R 3GNGA 5C0MA 2A36A 1UHCA 3I5RA 4JJCA 1N27A 1Z9QA 2KY9A 5D6WA 2J6OA 3QYHB 3QIIA 3RUXA 2B8AA 3TEEA 2D8JA 4N4HA 1IGQA 2K6DA 1E7OA 5FRMA 4M75E 3QO3A 1ZLMA 2PTKA 2L89A 1LPLA 1JJ2A 1ZSZB 4J6WA 4R56A 4IUPA 1Q82U 3EG9A 5LJ3h 5CCAA 4M78B 4C92G 3J80E 2DIQA 2M51A 3QHSA 4XU1A 3MP1A 1K76A 1YCSB 2CGHA 3FJ5A 4DBQA 1NYFA 1KD1U 5GANe 1GBRA 3A5ZB 2WSEE 3JV3A 5LJ5d 4AFZC 3QSUA 2EPDA 3SEMA 3NTIA 4DBFA 3JCMb 3LLRA 2ESWA 4ELZC 1YCYA 3GBQA 1VQLQ 3VJPA 3CCUQ 1O75A 1PKTA 4M78F 2OI3A 1KQSA 1Q7YC 3FIFA 4OMOA 2M9UA 1R0BG 2KR3A 2SRCA 1NYGA 2LCSA 4LN2A 5CVIA 2DETA 1TH7A 1GCPA 1I1JA 4LDVA 4VUBA 3LGFA 2DPPB 4ZN1A 4FT2A 4E7IA 5IT9E 3CMEA 3E2UA 2DL7A 4FCYA 2HBWA 1XNIA 2CH4A 3M9QA 2GFAA 4J8OA 2KDSA 4C0ZA 1JB0E 3OA6A 3LWHA 4C5GA 2VYTA 1G3WA 4HT8A 1I07A 1ZA1B 4J9GA 5D6YA 2P84A 1BI1A 5GANh 1K0SA 1ZA2B 2Z0WA 5LJ5f 1VQKT 3OW2S 1WFWA 2CP0A 1X2KA 3I55A 5KYWA 2L3QA 5KYUA 2H3JA 1BBZA 3H8ZA 2QA4T 3OYGA 1VOMA 4M7AD 2NUTA 2MWOA 3OS1A 2KE9A 1DJ7B 4YTLA 2O9SA 2IPOB 1BK2A 3JCMP 2NUPB 1SF9A 5M9OA 2DEUA 1V1CA 3OW2P 2V8JA 3OYDA 2LDMA 1QLYA 1Q82R 2EYXA 2K3XA 3RESA 3ZFJA 3I56A 1VYTA 5KE3A 1FYNA 3PNWC 4J9DA 4Z88A 1KD1R 2AKKA 1W2BP 4FYYB 2DTHA 1CKAA 2J05A 4ZTJA 3GP8A 2OTLT 2C0TA 3PMIA 1E6HA 4LDWA 1S1NA 1VQPA 1IZ6A 2DEQA 3JCMg 1G3TA 4OB1B 4FSSA 3CC7T 3BDUA 3M58A 1OEBA 4HT9A 4CC2A 2WACA 3L2QA 2LT1A 5CIUA 1MMGA 4A4HA 1KC8U 1YIJT 5A0DA 2HZYA 4KH1B 1M8MA 4IUTA 3L2WA 4LUDA 3UATA 1KHCA 2F1LA 5IN1A 4LDYA 4C8QB 3UA6A 2YLBA 3OYHA 1K9MR 1VYVA 3CCLT 4NOYA 1HD3A 2PUOB 2LC4A 3QZ9B 3QJYA 3L2VA 3H0FA 1QWEA 4AFUC 2DL5A 1TXQA 5GMKe 2YUNA 3JB9H 3VUZA 1M5Q1 4LD9K 2A0FB 2GCXA 1N9SA 3G4ST 4C8QF 2CP7A 5I11A 2PU9B 1WYXA 4CC7A 2EYZA 2ECZA 1X75C 2XIDA 4ESRA 2OAUA 4EIKA 3EG1A 3O5ZA 1HXDA 1M3AA 3BFMA 4M75D 2A7YA 1OYXA 3ULRB 1K1ZA 2MK5A 5CKBA 2MAMA 2HQXA 4BI3A 1Q95G 2JMCA 1I8FA 1JRIA 2RPNA 1PWTA 2ZPIB 3GIBA 1S72T 4AFSC 2HQEA 2P0KA 5FU7C 1N9RA 1VQ4Q 2QDYB 2HSPA 3CBOA 2A37A 2CSQA 3M56A 4EMGA 1YJNQ 5J26A 4M7AA 2Y4XA 4M7DB 2IG0A 4N0AC 1YITA 1VIEA 4QT7A 3FLGA 3CCJT 4RTWA 2K5FA 3CCRA 2OJ2A 3CC7Q 3OYFA 2F2VA 1ZUUA 3QWXX 2HKQB 2DBKA 2E6ZA 4Y28E 4JLGA 4F14A 5GMKh 3CCVT 2QQ9A 2DL3A 1WLPB 2FPFA 1KG1A 1QKXA 4PFPA 4IUUA 1TU0B 4PJOA 1VQNT 4M7DF 2DILA 4II1A 5GAOm 1K0XA 2LQKA 1EFNA 2QDLA 5DY9A 4XU3A 3G71A 2QTXA 4ME7A 1UEBA 4A4GA 2KXDA 1X6GA 2QGGA 4C92B 3EGXB 2WSCE 3SWNC 3CC4Q 5LJ3j 4ZGJB 3RMSA 4RTVA 2L2PA 1Q7YU 1VQ5A 4HKEA 2X4WA 2ZCFB 2F2WA 1K8AC 3BDLA 1ZHIA 1QWFA 1SRMA 2F5TX 1E6GA 3JCMV 1IO6A 3RKWA 4J6YA 2SEMA 3CMAQ 1W6XA 2RB6A 3EG2A 4FT4A 4C92F 4ELYC 4DA4A 3HRUA 2BUDA 4PNOA 1WJQA 2VGMA 4E7LA 4E6RA 2BIVA 3PGGA 4KUDK 2QEXT 5EG2A 4HA8A 3RKYA 5GAOn 3NPFA 3IQLA 2COZA 2BZXA 3F70A 1D0XA 4M77E 4FYVB 1OU8A 3AT1B 5FWBA 1ZUKA 2KQWA 2L3SA 1S72Q 1VIFA 3X25B 4F7UE 1D3BB 4J9BA 4AMCA 2LNVA 4A4FA 2EFIA 2LRQA 1PCXA 1VQMQ 5IHKA 3VS1A 2K3YA 4QVDA 2RK1A 2F69A 5GAOq 2CP2A 3H9NA 2P4RA 1AT1B 1OOTA 1PSEA 3EH2A 2RQWA 2QG9B 2QGFB 1Q81U 3A98A 4JS4A 5GANj 3QPHA 1NE8A 3MEWA 5CO7A 3RDVA 2XICA 2FRWA 2Y4YA 4M75A 4E7ZA 3A8HB 3BW1A 3JB9G 1YHQA 2GBQA 2QYZA 1VQ7Q 2FZKB 1QVPA 3M0UA 1UB4A 4HCZA 3JSCA 3QDFA 4HCKA 5D7UA 1K73C 2KROA 1G8XA 3JCMc 3CCQQ 3OYCA 1QVFA 3L2ZA 4JJDA 1KSWA 3VS3A 3LX7A 4GBQA 4DEXA 4B9WA 1ZSZA 2RA2A 5GAMe 4BD3A 4FW1A 4OGCA 2ROLA 2ZPEB 3CCSQ 2EYYA 4E7HA 4WTOB 3TSZA 6AT1B 2E64A 2O01E 1M90C 1M1KC 1OPLA 1Q7YR 2RK2A 4KGZB 3CC2Q 1UGQB 2BKDN 3CQTA 1GCQA 2MMPA 3UT1A 2XMFA 2QK0A 4JJBA 2EKOA 3ZEHA 1B34A 3CMET 3RR6A 1QW1A 1JQQA 3MHXA 4EDUA 4BDZA 5A0GA 1VQ9A 1Y71A 3M0QA 2MOXA 2DMOA 1UE9A 1YI2A 5AT1B 1O9SA 2A08A 2M0YA 2R58A 2LJ1A 2RI5A 2DL4A 3CBPA 2EQMA 3VRYA 1N6AA 3G6EA 1JXMA 4HCBA 1WXBA 1QVGS 2KGTA 2R5MA 3M0TA 2V8IA 2YUPA 4C0DC 5GANg 3GF5A 4D8KA 4L5GA 5IHNA 2YRDA 3OBWA 3I55T 1RACB 5GAMh 1NLOC 1OU9A 3I5SA 3MEAA 4PLIA 2BE7D 3CCMA 2W0ZA 1D1CA 3I9QA 1PRMC 3EFOB 4J6XA 3CCEA 2LJ0A 1WHKA 2GNCA 2QQSA 2E1HA 1AZGB 1QVGP 1AWXA 1MGQA 1SKUB 2VWFA 1G3SA 4MDXA 2LCLA 2D9TA 3VS5A 4M7DG 1VQ6Q 3SD4A 2CP3A 1ZUYA 4X1VA 2K4YA 1WNLA 2RN8A 1EX4A 1YJWQ 2DVEA 3VYHB 3OB9A 4PJJA 1X6BA 2DF6A 2E3HA 2DXBA 5GAOp 1QCOA 2ZPHB 2DTOA 1KQ1A 3I56T 2OX7A 1Y07A 3OYKA 1UGPB 1PD1A 5LJ3f 2VVKA 5CK9A 2ZPGB 2GQVA 1QCNA 2DZ9A 3RNJA 4JRPA 1Y96A 1UHFA 4RTYA 1TUGB 3HFNA 1VQPT 4O5VA 2IVWA 2G3RA 2EQJA 2MPXC 1VQOA 4C0GA 2DRKA 2HAXA 4F17A 1X2QA 2DRMA 2K2MA 3CMEQ 4JPBW 2KMTA 1WIEA 1T3SA 1C6VX 4LDXA 5GAOl 1GBQA 1BCOA 4M78E 3EGDA 3M0RA 1MV3A 1U06A 5FROA 2OTJQ 4XAXB 4XK8E 5LL6S 4KUIA 3M4GA 5GMKj 4J9CA 1BIAA 2KXCA 5EC7A 3M59A 3JAME 2BTTA 2YDLA 2GFUA 3P8BB 3OW2A 5FU7B 2L5QA 3UF4A 1KIKA 5GMKl 2XHCA 2YRCA 3WVDB 2JTMA 2F5KA 4EMKA 5LJ5e 2ATCB 1FXXA 1X43A 4K11A 4M7AC 1OZ2A 1K9MU 1JJ2S 5L23A 2LQ8A 4RTZA 4IKFA 2CP6A 1RAGB 1T0HA 1W2BA 4JRIA 2RM4A 1YJ9A 3C95A 2O4XB 1TSFA 3CXCS 3OMGA 2NWMA 1JBMA 4OB3B 1JEGA 4RTTA 4GLMA 2FZGB 3C4SA 4AG1C 4PJOC 3L2RA 3I35A 3QUIA 1VQ8A 4LD6A 5KYYB 2KT1A 1MV0B 4KULA 1D09B 1VQLA 1N8RC 2BE9B 3UA7A 3CCUA 5J3BA 4ZTFA 3NGPA 3DB4A 3SWNB 1UECA 1KQSS 1SHFA 4KT0E 4JJNK 2GTOA 3VV0A 2A28A 5GAN3 3CXCP 3HRSA 4M7AG 1RLPC 2KYMA 1IGUA 1VYUA 3E19A 3LH5A 3VS6A 2JM9A 1YITT 1I5OB 1MUZA 2KNBB 3JCMX 2OAWA 1UDLA 1U3OA 4E2FB 5GAN2 4ANJA 2ENMA 3CCRT 2CKKA 3OS0A 5L8RE 4R0KA 1NJIU 5LJ5h 1M2VB 3HPWA 2J6FA 4PJOD 1OULA 4F16A 4HVWA 2FVUA 2DD5A 4OMMA 2QQAA 2V8KA 1EIFA 3G71T 2HMAA 1RAHB 2CDTA 3EG9B 2RJCA 3TREA 1YNZA 1UGSB 3EFRA 1SEMA 1VQ5T 3EHRA 1RAIB 3JB9I 1P92A 1AWOA 1X6OA 1TUCA 2X4XA 3S3MA 1K8AR 2KRMA 3VU3C 2K3BA 3M57A 1C1AA 2FPDA 2RF0A 3J7AF 3JB9F 1BIBA 5FWCA 1ABOA 2KAFA 2KRNA 3PIOA 3VS7A 3MCAB 1BYMA 4X34A 2EQKA 1RLQC 2DM1A 4O6JA 3P8HA 2DZCA 2KI7A 4M75C 4BE2A 3QJ6A 4FL6A 3QYGB 1VQKQ 2AIRB 2KK4A 2NLUA 1H8KA 1AEYA 4M77A 2MYSA 4C8QE 3RERA 4J9IA 5A2QE 1ABQA 2QA4Q 3DKMA 1CKBA 4F7UA 4WF2A 1PNJA 1A0NB 3EG3A 2MF2A 2EQIA 1KHIA 2PVGB 3JCMd 2GTJA 2V26A 4ZGDB 1SG5A 4GY5A 2RJEA 2EVRA 1AVZC 4RUGA 1U8RA 2DK3A 2DAQA 1D3BA 2CZ1B 2YLCA 5IXFA 1HSQA 3M4YA 4PJMA 4RG8A 4XTZA 5KYWB 4MZMA 4M75G 1YHQT 2L3PA 4LXCA 1WHLA 1Y57A 1GCQC 1BI3A 5GAMj 4JS5A 2NUTB 4LNPA 4FSXA 3OBYA 1NJIR 4QKUA 2HL5C 3UWNA 3EGUA 2OTLQ 2YUOA 3KUFA 2EW3A 2V1RA 1MNEA 3RMQA 3J81E 3THKA 1K73R 4QW2A 2DX1A 2QASA 2RNAA 3PTAA 2K5IA 2DTIA 1M4ZA 1B07A 2J6KA 2I0NA 5KYXA 3GPLA 3M53A 4M78D 2FB7A 3VUBA 2DKGA 2GF7A 4RCBA 1AHJB 5ECAA 4OMNA 3VYGA 2VC8A 4M7DE 5J39A 3H0IA 1F1BB 4C0DB 1YIJQ 2ED0A 1U5SA 1M90R 2BZYA 1M1KR 3JCMf 4MZTA 1JO8A 4BDYA 2O9VA 3HTRA 1RAAB 3X24B 3RKXA 3L1AA 2YWWA 4J83A 3M5AA 4FM4B 2XI9A 1Q82C 5GAOr 3CCLQ 3A8LB 4Z89A 1VQ9T 1B7TA 1YI2T 4XTXA 1AZEA 4LDUA 2E5QA 1VQ4A 4LE9A 1C0MA 3CD6A 1IXDA 5GMKm 1Y0MA 2L0AA 3DLMA 4C92E 2NYSA 1FMWA 4NL2A 2CYZB 3G6ET 1YJNA 4PJLA 1YN8A 3G4SQ 5HK0A 3PFSA 2AT1B 1TS9A 2DNUA 2DXTA 2G6FX 1MHNA 3RBBB 1PG5B 2RO0A 4TVRA 2LQNA 2AK5A 3LWIA 2LVMA 3CCMT 1UGVA 2F2XA 5GAMg 3CCET 1QMCA 2JS0A 2ZAEA 2K2VA 1UJ0A 1X27A 2A3LA 5D6XA 3TSWA 1OZ3A 2DERA 2COWA 1B3QA 5IXBA 1SSFA 3QDRB 4QVZA 3V7RA 3CC4A 4JZ4A 1M30A 1RI9A 1GL5A 4HVVA 3G1JA 3GLXA 1W70A 4EPCA 3CCJQ 4PFZA 4DQ2A 2JW4A 5HK3A 2J7IA 2AZSA 2RQVA 5GJVB 3LW5E 3CMAA 4JRKA 3CCVQ 4OP0A 4ATOA 2L3RA 2JMAA 1XJWB 3NFCA 1HK9A 4LUEA 1VQNQ 1WHJA 4L6V5 2WSFE 4XU2A 4EMKC 1VQOT 5GAN5 3REBB 4M7AB 2HKNA 1Z9ZA 2VXEA 3OYLA 3OYJA 3U23A 3V8JA 2JNGA 5I2MA 1KK7A 2PUKB 3R6OA 9ATCB 3ZL7C 3E9GA 4J9EA 1YI2Q 4F04B 4BI4A 2BZ8A 3QKJA 1W4SA 4J7FA 1D1BA 1PSFA 4M78A 3NTKA 5LJ5j 1VQMA 2LX9A 3HFOA 2YSQA 2MCNA 1BCMA 2JS2A 3G6EQ 5IH2A 4PJOB 4M7AF 3M0PA 1QVGA 1T3LA 4DOWA 4N4GA 2I2LA 1YP5A 1UFFA 1D0ZA 8ATCB 2X51A 1NM7A 1OX8A 2DJQA 2DFUA 2E12A 2LP5A 1PM3A 4J5YA 4DEYA 2YRVA 2QEXQ 1BKBA 4C8QD 5AYFA 2RQRA 1TUDA 5FRNA 2E4HA 3GOXA 2LCCA 2YT6A 4ORZA 2H8HA 3CPWS 3QZ5B 5LJ3d 4PJOF 1VQ7A 4QQ6A 1G83A 5GMKi 1YJ9T 2P0QA 2DIGA 1KC8C 4D8DA 1QP3A 2E65A 3V8KA 2COYA 1XTDA 2X3XD 3UDCA 4IURA 3QXEB 3EH1A 5CKEA 2QXFA 4BE0A 1NPPA 2XK0A 4BY6C 4BE1A 4X9DA 3CPWP 1VQ8T 5GAN4 4OF1A 2C06A 1VQLT 1NEBA 2HD0A 2KVQG 4RTXA 3TCJA 3CCSA 3CCUT 3H6ZA 2FO0A 1R77A 2RQTA 2FEIA 5LJ3e 4CRIA 2VKNA 5FLXE 2DE0X 3WVEB 3CC2A 4BACA 2LQWA 4KRTA 2JXBA 1TWBA 4WCIA 1FX7A 1I5LA 2AKLA 2DLPA 2ZPBB 5KYNA 3O8VA 2KRSA 4GLKA 3WXMB 1IHVA 4HXJA 1SSHA 3EFSA 1WI7A 1R0CB 2VB6A 2E10A 2Y90A 2FYKA 5KE2A 2JTEA 5LJ5g 4PK4A 2D0QB 4ZGEB 2HCKA 4FYXB 1G5VA 3DLLA 3OSVA 4BUGA 3OYEA 2NUPA 4QVCA 4M75B 2E5KA 3EAEA 4OVAA 4E7JA 3JCMQ 5GANd 1NEGA 2RD1A 8AT1B 1I81A 2PQWA 2FZCB 4J9FA 1X01A 1M2VA 1UTIA 5DLOA 4M77C 1M8VA 2YXYA 3KFVA 1RAFB 4FU6A 4MZPA 1M27C 1RI0A 4MMKA 3D7SB 2FRYA 1QP2A 4C92D 4M75F 2KYBA 3HSBA 1NPRA 3MJXA 1GFDA 1YJ9Q 3INZA 2K79A 1VQ6A 2HSEB 3GNFB 3VS0A 3CXCA 1SHGA 2QQBA 1YJWA 4XQ3A 1K8AU 3FJPA 1RABB 2JM8A 1BI2A 4QQDA 3T9NA 1OV3A 4PLLA 1VQ8Q 4M77D 3SB2A 4OMFB 1WXTA 4PFOA 1QKWA 1B34B 2KT8A 3FB9A 3I55Q 2DJZA 4M77G 2RQUA 2K7AA 4F7UG 1IRXA 4C8QA 3NTHA 2EYWA 1RADB 1Q86C 2E3IA 3DB3A 5GANf 3LH0A 2XDBA 3HP9A 4N4IA 2DL8A 1NBEB 2DD4A 1WX6A 1WHGA 1RL2A 2FPEA 3OS5A 3ME9A 3FEOA 1PD0A 4E47A 1G2BA 3ASKA 2RHYA 5CKFA 1H641 1U1SA 1JJ2P 4HVUA 3I56Q 1WJSA 1H3HA 3S3OA 4FIBA 1M3BA 1WHHA 2W10A 2OTJA 1WXUA 2LMJA 1HYOA 1N5ZA 4NS5A 3SFMA 2DA9A 1LOJA 3V7CA 2XD0A 2HEQA 4A4EA 2JVVA 1VQPQ 2JJ9A 1NG2A 2ABLA 5GJWB 5IAYA 4CC3A 4X9CA 1OPKA 4XU0A 1WQWA 1WA7A 2RMOA 3VS2A 1AWJA 1ZBJA 1KQSP 2O88A 3OS2A 1K73U 4Z02A 1W2BS 3A8MB 4Y92A 1Q81C 3TU4K 1H92A 1RUWA 5I22A 4M7DA 4PJOG 3V7SA 1AWWA 2JZ2A 4DOVA 3OMCA 5HCKA 2QI2A 1Y96B 1OX9A 5KCOA 3N5BB 3CBMA 3URGA 4FW2A 4OB2B 4IIMA 2EGEA 5CAIA 2K5LA 4KH0B 1MNDA 1FWZA 4MMLA 2LNHB 1OI1A 2D0NA 1M90U 1M1KU 4OMQA 2X4YA 2CZ0B 2CZ7B 1VQ4T 3H0HA 3QG1A 4A54A 2XDPA 3CD6T 3SHWA 1YJNT 3EGDB 2YUQA 4C92A 4C5HA 3EGXA 2EJ9A 4C5IA 4ZNXA 1LCKA 1LNXA 2DXCA 4MDWA 2DYBA 1K4US 3ZBDA 5HKCA 1KJWA 2R57A 3LGLA 5CQXA 1VUBA 1SRLA 2ED1A 3HKSA 2HDAA 4OGEA 3HL8A 2LJ3A 4EMKB 3G7ZA 3PT9A 4D6WA 4KBMB 4XTVA 3A8GB 4PKCC 4JZ3A 2QQRA 1WGSA 2CREA 2RH2A 5FU6B 5DLQE 3MPUB 3QWYA 2DVJA 3BY7A 3MO8A 4XTUA 4E7SA 3Q1JA 3CC4T 4IUQA 1GRIA 1AOJA 1G3YA 2V1QA 4C5EA 1ZSZC 3REAB 3CPFA 1UGRB 1YITQ 1PRLC 2EAYA 4EMHA 1XOVA 2E41A 4M78C 3E1SA 3HHTB 1ZBXA 2PNIA 3CCRQ 1PHTA 5GAN6 1K9AA 4M4ZA 1M9SA 2RHUA 3CMAT 2KEAA 5I21A 4V2SA 2FL7A 3P8DA 3R6NA 5KYUB 1BU1A 3VS4A 1ACMB 4XTWA 2EYQA 2XG8D 4KGVB 2RJFA 3EG0A 1WHMA 3FRNA 3OY9A 3G71Q 2FG0A 2CUDA 1ZSGA 3M55A 5HY6A 1UG1A 4B6MA 3JCMe 4PL6A 2CS7A 2VXFA 3S3NA 5GAN8 4UC4A 2IIMA 3OYIA 4J9HA 4XTYA 3OYMA 3M54A 5KCHA 3X20B 1VQKA 2EIFA 2EJGA 2RJDA 3MEVA 3S6WA 4RMOA 3CEYA 1VQ5Q 1TOVA 4RTUA 3OYBA 4NL3A 3VRZA 1D1AA 2JN0A 3X28B 1PKSA 5CKHA 2QA4A 1OQKA 4E7KA 3CD6Q 1VQMT 4M78G 2HL3A 2PVDB 1YBYA 4BB7A 2RHIA 3META 3TVTA 4BY6B 5C6SA 2YHTA 1VA7A 3MP6A 2JTFA 3X26B 4BI8B 2ROTA 2P4TA 2R5AA 2D6FA 1LJOA 3OYYA 2X4JA 1GFCA 1MMAA 2QTVA 4FYWB 2J06A 2EQUA 3QBYA 4P5NA 2KBTA 1NZ9A 4OB0B 1UJYA 2CZ6B 4JRQA 2VASA 2O31A 2XKOC 2DO3A 1KD1C 1YWOA 2M16A 2RI2A 1Y7XA 1VQ7T 1FMVA 1TTHB 1QCFA 2JUFA 2OTLA 5CKDA 1LVKA 3CCQT 1KC8R 1BB9A 3JCMh 3FC3A 2QAZA 4PJNA 1M1GA 1T0JA 2PVOB 3E9FA 5GAN7 3PVQA 2X35A 1U1TA 1IHWA 1MMNA 3CCST 1Q86U 3CC7A 7AT1B 1WQ7A 2C0IA 3JRZA 4DBRA 1YIJA 5IHIA 3C94A 2C0OA 4M77B 2CUBA 4OMLA 4Y91A 3CC2T 4B9XA 1YHQQ 2JT4A 3PVLA 1IREB 1NLPC 1ZX6A 4F7UB 1WZOA 2CT3A 3MEUA 1EZZB 1K9MC 1W1FA 3V8LA 4RKUE 4RCCA 2EKHA 2XU8A 4JLIA 3CCLA 2HBPA 3C12A 2CP5A 2GQIA 2K9GA 5I2SA 2NUZA 1N8RU 3FDRA 3OYAA 1WDXA 3KXTA 1JU5C 1QQJA 2M02A 1M3CA 2CSIA 2EGCA 2H3EB 3EFOA 3KBGA 2ZPFB 4KGXB 2P0PA 3A1PA 2ZZDA 3L2UA 3HRTA 4M77F 2E6NA 2E70A 2JOYA 3ER0A 2LX7A 4F7UF 2KSSA 3G4SA 2D8HA 1H3ZA 2MIOA 1M1FA 4OMPA 2LZ6B 1KFZA 1J3TA 3PIPA 3EHQA 2HNIA 4R55A 2GGRA 4DBHA 3MP8A 3UPUA 1KQ2A 4JUVA 5GAMd 2LT4A 5A0LA 5FU6C 1X69A 2DXUA 5CQYA 4C8QC 3JB9D 1RAEB 5KYXB 3CPWA 4AG2C 3JB9J 1VQ9Q 1TG0A 4CI0C 5KH6A 3C0CA 2M0OA 1S72A 4RG2A 1NJIC 2ZGWA 3SDZA 4Z8AA 1VQ6T 4M7AE 5LJ3g 1IB8A 2XDDA 2DYIA
chains in the Genus database with same CATH topology
1OQKA 1PC0A 1V76A 2KI7A 1TSFA 1TS9A 2ZAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQK A;  1PC0 A;  1V76 A;  2KI7 A;  1TSF A;  1TS9 A;  2ZAE A; 
#chains in the Genus database with same CATH topology
 4IUV A;  1YWP A;  1YJW T;  4CC4 B;  1R8O B;  2LTO A;  1WJR A;  2VGN A;  5DM7 R;  3L42 A;  4A4K A;  4L59 A;  1I0C A;  2EBP A;  2RI3 A;  3JCM W;  2MWP A;  3LYI A;  3AHU A;  3H41 A;  1V29 B;  3CCJ A;  4AFQ C;  2RHX A;  3RIR A;  4QQG A;  4A53 A;  2D1X A;  3CCM Q;  3CCV A;  4PJO E;  3JCM J;  1D0Y A;  3CCE Q;  4C8Q G;  2K57 A;  3A8O B;  1UUE A;  2VUB A;  2RHZ A;  3TQ7 P;  1XQH A;  4C0F A;  1HJD A;  1VQN A;  1AD5 A;  2CH4 W;  1FMK A;  2MI6 A;  2L8D A;  1Q86 R;  1M2O A;  3OYN A;  2PZ1 A;  3MKD A;  2EGA A;  2EWN A;  3CCQ A;  2DBM A;  5GAM f;  2VV5 A;  1QVF S;  2O2O A;  2X3W D;  4JDS A;  4M7D C;  4N0A A;  3PE0 A;  2X9H A;  2CT4 A;  2OTJ T;  4AT1 B;  1N8R R;  1YFN A;  4IIO A;  3BE3 A;  1JXO A;  1CSK A;  2EJF A;  2O4X A;  3OQ5 A;  1MMD A;  1SPK A;  1V76 A;  4A63 B;  5FW9 A;  1QVF P;  1I4K 1;  2FHD A;  4J7I A;  1VQO Q;  3M0S A;  4Q5W A;  3NMZ C;  1GXI E;  5KYY A;  1PC0 A;  2AZV A;  3PMT A;  2QEX A;  2HQH A;  2B86 A;  1ZQ1 A;  5CR2 A;  2AHJ B;  2M1H A;  4C92 C;  3SWN A;  4ZN3 A;  4M7D D;  3OSS C;  4HCC A;  1ARK A;  3NHN A;  3VKI A;  1WPY A;  1BI0 A;  1Q81 R;  3GNG A;  5C0M A;  2A36 A;  1UHC A;  3I5R A;  4JJC A;  1N27 A;  1Z9Q A;  2KY9 A;  5D6W A;  2J6O A;  3QYH B;  3QII A;  3RUX A;  2B8A A;  3TEE A;  2D8J A;  4N4H A;  1IGQ A;  2K6D A;  1E7O A;  5FRM A;  4M75 E;  3QO3 A;  1ZLM A;  2PTK A;  2L89 A;  1LPL A;  1JJ2 A;  1ZSZ B;  4J6W A;  4R56 A;  4IUP A;  1Q82 U;  3EG9 A;  5LJ3 h;  5CCA A;  4M78 B;  4C92 G;  3J80 E;  2DIQ A;  2M51 A;  3QHS A;  4XU1 A;  3MP1 A;  1K76 A;  1YCS B;  2CGH A;  3FJ5 A;  4DBQ A;  1NYF A;  1KD1 U;  5GAN e;  1GBR A;  3A5Z B;  2WSE E;  3JV3 A;  5LJ5 d;  4AFZ C;  3QSU A;  2EPD A;  3SEM A;  3NTI A;  4DBF A;  3JCM b;  3LLR A;  2ESW A;  4ELZ C;  1YCY A;  3GBQ A;  1VQL Q;  3VJP A;  3CCU Q;  1O75 A;  1PKT A;  4M78 F;  2OI3 A;  1KQS A;  1Q7Y C;  3FIF A;  4OMO A;  2M9U A;  1R0B G;  2KR3 A;  2SRC A;  1NYG A;  2LCS A;  4LN2 A;  5CVI A;  2DET A;  1TH7 A;  1GCP A;  1I1J A;  4LDV A;  4VUB A;  3LGF A;  2DPP B;  4ZN1 A;  4FT2 A;  4E7I A;  5IT9 E;  3CME A;  3E2U A;  2DL7 A;  4FCY A;  2HBW A;  1XNI A;  2CH4 A;  3M9Q A;  2GFA A;  4J8O A;  2KDS A;  4C0Z A;  1JB0 E;  3OA6 A;  3LWH A;  4C5G A;  2VYT A;  1G3W A;  4HT8 A;  1I07 A;  1ZA1 B;  4J9G A;  5D6Y A;  2P84 A;  1BI1 A;  5GAN h;  1K0S A;  1ZA2 B;  2Z0W A;  5LJ5 f;  1VQK T;  3OW2 S;  1WFW A;  2CP0 A;  1X2K A;  3I55 A;  5KYW A;  2L3Q A;  5KYU A;  2H3J A;  1BBZ A;  3H8Z A;  2QA4 T;  3OYG A;  1VOM A;  4M7A D;  2NUT A;  2MWO A;  3OS1 A;  2KE9 A;  1DJ7 B;  4YTL A;  2O9S A;  2IPO B;  1BK2 A;  3JCM P;  2NUP B;  1SF9 A;  5M9O A;  2DEU A;  1V1C A;  3OW2 P;  2V8J A;  3OYD A;  2LDM A;  1QLY A;  1Q82 R;  2EYX A;  2K3X A;  3RES A;  3ZFJ A;  3I56 A;  1VYT A;  5KE3 A;  1FYN A;  3PNW C;  4J9D A;  4Z88 A;  1KD1 R;  2AKK A;  1W2B P;  4FYY B;  2DTH A;  1CKA A;  2J05 A;  4ZTJ A;  3GP8 A;  2OTL T;  2C0T A;  3PMI A;  1E6H A;  4LDW A;  1S1N A;  1VQP A;  1IZ6 A;  2DEQ A;  3JCM g;  1G3T A;  4OB1 B;  4FSS A;  3CC7 T;  3BDU A;  3M58 A;  1OEB A;  4HT9 A;  4CC2 A;  2WAC A;  3L2Q A;  2LT1 A;  5CIU A;  1MMG A;  4A4H A;  1KC8 U;  1YIJ T;  5A0D A;  2HZY A;  4KH1 B;  1M8M A;  4IUT A;  3L2W A;  4LUD A;  3UAT A;  1KHC A;  2F1L A;  5IN1 A;  4LDY A;  4C8Q B;  3UA6 A;  2YLB A;  3OYH A;  1K9M R;  1VYV A;  3CCL T;  4NOY A;  1HD3 A;  2PUO B;  2LC4 A;  3QZ9 B;  3QJY A;  3L2V A;  3H0F A;  1QWE A;  4AFU C;  2DL5 A;  1TXQ A;  5GMK e;  2YUN A;  3JB9 H;  3VUZ A;  1M5Q 1;  4LD9 K;  2A0F B;  2GCX A;  1N9S A;  3G4S T;  4C8Q F;  2CP7 A;  5I11 A;  2PU9 B;  1WYX A;  4CC7 A;  2EYZ A;  2ECZ A;  1X75 C;  2XID A;  4ESR A;  2OAU A;  4EIK A;  3EG1 A;  3O5Z A;  1HXD A;  1M3A A;  3BFM A;  4M75 D;  2A7Y A;  1OYX A;  3ULR B;  1K1Z A;  2MK5 A;  5CKB A;  2MAM A;  2HQX A;  4BI3 A;  1Q95 G;  2JMC A;  1I8F A;  1JRI A;  2RPN A;  1PWT A;  2ZPI B;  3GIB A;  1S72 T;  4AFS C;  2HQE A;  2P0K A;  5FU7 C;  1N9R A;  1VQ4 Q;  2QDY B;  2HSP A;  3CBO A;  2A37 A;  2CSQ A;  3M56 A;  4EMG A;  1YJN Q;  5J26 A;  4M7A A;  2Y4X A;  4M7D B;  2IG0 A;  4N0A C;  1YIT A;  1VIE A;  4QT7 A;  3FLG A;  3CCJ T;  4RTW A;  2K5F A;  3CCR A;  2OJ2 A;  3CC7 Q;  3OYF A;  2F2V A;  1ZUU A;  3QWX X;  2HKQ B;  2DBK A;  2E6Z A;  4Y28 E;  4JLG A;  4F14 A;  5GMK h;  3CCV T;  2QQ9 A;  2DL3 A;  1WLP B;  2FPF A;  1KG1 A;  1QKX A;  4PFP A;  4IUU A;  1TU0 B;  4PJO A;  1VQN T;  4M7D F;  2DIL A;  4II1 A;  5GAO m;  1K0X A;  2LQK A;  1EFN A;  2QDL A;  5DY9 A;  4XU3 A;  3G71 A;  2QTX A;  4ME7 A;  1UEB A;  4A4G A;  2KXD A;  1X6G A;  2QGG A;  4C92 B;  3EGX B;  2WSC E;  3SWN C;  3CC4 Q;  5LJ3 j;  4ZGJ B;  3RMS A;  4RTV A;  2L2P A;  1Q7Y U;  1VQ5 A;  4HKE A;  2X4W A;  2ZCF B;  2F2W A;  1K8A C;  3BDL A;  1ZHI A;  1QWF A;  1SRM A;  2F5T X;  1E6G A;  3JCM V;  1IO6 A;  3RKW A;  4J6Y A;  2SEM A;  3CMA Q;  1W6X A;  2RB6 A;  3EG2 A;  4FT4 A;  4C92 F;  4ELY C;  4DA4 A;  3HRU A;  2BUD A;  4PNO A;  1WJQ A;  2VGM A;  4E7L A;  4E6R A;  2BIV A;  3PGG A;  4KUD K;  2QEX T;  5EG2 A;  4HA8 A;  3RKY A;  5GAO n;  3NPF A;  3IQL A;  2COZ A;  2BZX A;  3F70 A;  1D0X A;  4M77 E;  4FYV B;  1OU8 A;  3AT1 B;  5FWB A;  1ZUK A;  2KQW A;  2L3S A;  1S72 Q;  1VIF A;  3X25 B;  4F7U E;  1D3B B;  4J9B A;  4AMC A;  2LNV A;  4A4F A;  2EFI A;  2LRQ A;  1PCX A;  1VQM Q;  5IHK A;  3VS1 A;  2K3Y A;  4QVD A;  2RK1 A;  2F69 A;  5GAO q;  2CP2 A;  3H9N A;  2P4R A;  1AT1 B;  1OOT A;  1PSE A;  3EH2 A;  2RQW A;  2QG9 B;  2QGF B;  1Q81 U;  3A98 A;  4JS4 A;  5GAN j;  3QPH A;  1NE8 A;  3MEW A;  5CO7 A;  3RDV A;  2XIC A;  2FRW A;  2Y4Y A;  4M75 A;  4E7Z A;  3A8H B;  3BW1 A;  3JB9 G;  1YHQ A;  2GBQ A;  2QYZ A;  1VQ7 Q;  2FZK B;  1QVP A;  3M0U A;  1UB4 A;  4HCZ A;  3JSC A;  3QDF A;  4HCK A;  5D7U A;  1K73 C;  2KRO A;  1G8X A;  3JCM c;  3CCQ Q;  3OYC A;  1QVF A;  3L2Z A;  4JJD A;  1KSW A;  3VS3 A;  3LX7 A;  4GBQ A;  4DEX A;  4B9W A;  1ZSZ A;  2RA2 A;  5GAM e;  4BD3 A;  4FW1 A;  4OGC A;  2ROL A;  2ZPE B;  3CCS Q;  2EYY A;  4E7H A;  4WTO B;  3TSZ A;  6AT1 B;  2E64 A;  2O01 E;  1M90 C;  1M1K C;  1OPL A;  1Q7Y R;  2RK2 A;  4KGZ B;  3CC2 Q;  1UGQ B;  2BKD N;  3CQT A;  1GCQ A;  2MMP A;  3UT1 A;  2XMF A;  2QK0 A;  4JJB A;  2EKO A;  3ZEH A;  1B34 A;  3CME T;  3RR6 A;  1QW1 A;  1JQQ A;  3MHX A;  4EDU A;  4BDZ A;  5A0G A;  1VQ9 A;  1Y71 A;  3M0Q A;  2MOX A;  2DMO A;  1UE9 A;  1YI2 A;  5AT1 B;  1O9S A;  2A08 A;  2M0Y A;  2R58 A;  2LJ1 A;  2RI5 A;  2DL4 A;  3CBP A;  2EQM A;  3VRY A;  1N6A A;  3G6E A;  1JXM A;  4HCB A;  1WXB A;  1QVG S;  2KGT A;  2R5M A;  3M0T A;  2V8I A;  2YUP A;  4C0D C;  5GAN g;  3GF5 A;  4D8K A;  4L5G A;  5IHN A;  2YRD A;  3OBW A;  3I55 T;  1RAC B;  5GAM h;  1NLO C;  1OU9 A;  3I5S A;  3MEA A;  4PLI A;  2BE7 D;  3CCM A;  2W0Z A;  1D1C A;  3I9Q A;  1PRM C;  3EFO B;  4J6X A;  3CCE A;  2LJ0 A;  1WHK A;  2GNC A;  2QQS A;  2E1H A;  1AZG B;  1QVG P;  1AWX A;  1MGQ A;  1SKU B;  2VWF A;  1G3S A;  4MDX A;  2LCL A;  2D9T A;  3VS5 A;  4M7D G;  1VQ6 Q;  3SD4 A;  2CP3 A;  1ZUY A;  4X1V A;  2K4Y A;  1WNL A;  2RN8 A;  1EX4 A;  1YJW Q;  2DVE A;  3VYH B;  3OB9 A;  4PJJ A;  1X6B A;  2DF6 A;  2E3H A;  2DXB A;  5GAO p;  1QCO A;  2ZPH B;  2DTO A;  1KQ1 A;  3I56 T;  2OX7 A;  1Y07 A;  3OYK A;  1UGP B;  1PD1 A;  5LJ3 f;  2VVK A;  5CK9 A;  2ZPG B;  2GQV A;  1QCN A;  2DZ9 A;  3RNJ A;  4JRP A;  1Y96 A;  1UHF A;  4RTY A;  1TUG B;  3HFN A;  1VQP T;  4O5V A;  2IVW A;  2G3R A;  2EQJ A;  2MPX C;  1VQO A;  4C0G A;  2DRK A;  2HAX A;  4F17 A;  1X2Q A;  2DRM A;  2K2M A;  3CME Q;  4JPB W;  2KMT A;  1WIE A;  1T3S A;  1C6V X;  4LDX A;  5GAO l;  1GBQ A;  1BCO A;  4M78 E;  3EGD A;  3M0R A;  1MV3 A;  1U06 A;  5FRO A;  2OTJ Q;  4XAX B;  4XK8 E;  5LL6 S;  4KUI A;  3M4G A;  5GMK j;  4J9C A;  1BIA A;  2KXC A;  5EC7 A;  3M59 A;  3JAM E;  2BTT A;  2YDL A;  2GFU A;  3P8B B;  3OW2 A;  5FU7 B;  2L5Q A;  3UF4 A;  1KIK A;  5GMK l;  2XHC A;  2YRC A;  3WVD B;  2JTM A;  2F5K A;  4EMK A;  5LJ5 e;  2ATC B;  1FXX A;  1X43 A;  4K11 A;  4M7A C;  1OZ2 A;  1K9M U;  1JJ2 S;  5L23 A;  2LQ8 A;  4RTZ A;  4IKF A;  2CP6 A;  1RAG B;  1T0H A;  1W2B A;  4JRI A;  2RM4 A;  1YJ9 A;  3C95 A;  2O4X B;  1TSF A;  3CXC S;  3OMG A;  2NWM A;  1JBM A;  4OB3 B;  1JEG A;  4RTT A;  4GLM A;  2FZG B;  3C4S A;  4AG1 C;  4PJO C;  3L2R A;  3I35 A;  3QUI A;  1VQ8 A;  4LD6 A;  5KYY B;  2KT1 A;  1MV0 B;  4KUL A;  1D09 B;  1VQL A;  1N8R C;  2BE9 B;  3UA7 A;  3CCU A;  5J3B A;  4ZTF A;  3NGP A;  3DB4 A;  3SWN B;  1UEC A;  1KQS S;  1SHF A;  4KT0 E;  4JJN K;  2GTO A;  3VV0 A;  2A28 A;  5GAN 3;  3CXC P;  3HRS A;  4M7A G;  1RLP C;  2KYM A;  1IGU A;  1VYU A;  3E19 A;  3LH5 A;  3VS6 A;  2JM9 A;  1YIT T;  1I5O B;  1MUZ A;  2KNB B;  3JCM X;  2OAW A;  1UDL A;  1U3O A;  4E2F B;  5GAN 2;  4ANJ A;  2ENM A;  3CCR T;  2CKK A;  3OS0 A;  5L8R E;  4R0K A;  1NJI U;  5LJ5 h;  1M2V B;  3HPW A;  2J6F A;  4PJO D;  1OUL A;  4F16 A;  4HVW A;  2FVU A;  2DD5 A;  4OMM A;  2QQA A;  2V8K A;  1EIF A;  3G71 T;  2HMA A;  1RAH B;  2CDT A;  3EG9 B;  2RJC A;  3TRE A;  1YNZ A;  1UGS B;  3EFR A;  1SEM A;  1VQ5 T;  3EHR A;  1RAI B;  3JB9 I;  1P92 A;  1AWO A;  1X6O A;  1TUC A;  2X4X A;  3S3M A;  1K8A R;  2KRM A;  3VU3 C;  2K3B A;  3M57 A;  1C1A A;  2FPD A;  2RF0 A;  3J7A F;  3JB9 F;  1BIB A;  5FWC A;  1ABO A;  2KAF A;  2KRN A;  3PIO A;  3VS7 A;  3MCA B;  1BYM A;  4X34 A;  2EQK A;  1RLQ C;  2DM1 A;  4O6J A;  3P8H A;  2DZC A;  2KI7 A;  4M75 C;  4BE2 A;  3QJ6 A;  4FL6 A;  3QYG B;  1VQK Q;  2AIR B;  2KK4 A;  2NLU A;  1H8K A;  1AEY A;  4M77 A;  2MYS A;  4C8Q E;  3RER A;  4J9I A;  5A2Q E;  1ABQ A;  2QA4 Q;  3DKM A;  1CKB A;  4F7U A;  4WF2 A;  1PNJ A;  1A0N B;  3EG3 A;  2MF2 A;  2EQI A;  1KHI A;  2PVG B;  3JCM d;  2GTJ A;  2V26 A;  4ZGD B;  1SG5 A;  4GY5 A;  2RJE A;  2EVR A;  1AVZ C;  4RUG A;  1U8R A;  2DK3 A;  2DAQ A;  1D3B A;  2CZ1 B;  2YLC A;  5IXF A;  1HSQ A;  3M4Y A;  4PJM A;  4RG8 A;  4XTZ A;  5KYW B;  4MZM A;  4M75 G;  1YHQ T;  2L3P A;  4LXC A;  1WHL A;  1Y57 A;  1GCQ C;  1BI3 A;  5GAM j;  4JS5 A;  2NUT B;  4LNP A;  4FSX A;  3OBY A;  1NJI R;  4QKU A;  2HL5 C;  3UWN A;  3EGU A;  2OTL Q;  2YUO A;  3KUF A;  2EW3 A;  2V1R A;  1MNE A;  3RMQ A;  3J81 E;  3THK A;  1K73 R;  4QW2 A;  2DX1 A;  2QAS A;  2RNA A;  3PTA A;  2K5I A;  2DTI A;  1M4Z A;  1B07 A;  2J6K A;  2I0N A;  5KYX A;  3GPL A;  3M53 A;  4M78 D;  2FB7 A;  3VUB A;  2DKG A;  2GF7 A;  4RCB A;  1AHJ B;  5ECA A;  4OMN A;  3VYG A;  2VC8 A;  4M7D E;  5J39 A;  3H0I A;  1F1B B;  4C0D B;  1YIJ Q;  2ED0 A;  1U5S A;  1M90 R;  2BZY A;  1M1K R;  3JCM f;  4MZT A;  1JO8 A;  4BDY A;  2O9V A;  3HTR A;  1RAA B;  3X24 B;  3RKX A;  3L1A A;  2YWW A;  4J83 A;  3M5A A;  4FM4 B;  2XI9 A;  1Q82 C;  5GAO r;  3CCL Q;  3A8L B;  4Z89 A;  1VQ9 T;  1B7T A;  1YI2 T;  4XTX A;  1AZE A;  4LDU A;  2E5Q A;  1VQ4 A;  4LE9 A;  1C0M A;  3CD6 A;  1IXD A;  5GMK m;  1Y0M A;  2L0A A;  3DLM A;  4C92 E;  2NYS A;  1FMW A;  4NL2 A;  2CYZ B;  3G6E T;  1YJN A;  4PJL A;  1YN8 A;  3G4S Q;  5HK0 A;  3PFS A;  2AT1 B;  1TS9 A;  2DNU A;  2DXT A;  2G6F X;  1MHN A;  3RBB B;  1PG5 B;  2RO0 A;  4TVR A;  2LQN A;  2AK5 A;  3LWI A;  2LVM A;  3CCM T;  1UGV A;  2F2X A;  5GAM g;  3CCE T;  1QMC A;  2JS0 A;  2ZAE A;  2K2V A;  1UJ0 A;  1X27 A;  2A3L A;  5D6X A;  3TSW A;  1OZ3 A;  2DER A;  2COW A;  1B3Q A;  5IXB A;  1SSF A;  3QDR B;  4QVZ A;  3V7R A;  3CC4 A;  4JZ4 A;  1M30 A;  1RI9 A;  1GL5 A;  4HVV A;  3G1J A;  3GLX A;  1W70 A;  4EPC A;  3CCJ Q;  4PFZ A;  4DQ2 A;  2JW4 A;  5HK3 A;  2J7I A;  2AZS A;  2RQV A;  5GJV B;  3LW5 E;  3CMA A;  4JRK A;  3CCV Q;  4OP0 A;  4ATO A;  2L3R A;  2JMA A;  1XJW B;  3NFC A;  1HK9 A;  4LUE A;  1VQN Q;  1WHJ A;  4L6V 5;  2WSF E;  4XU2 A;  4EMK C;  1VQO T;  5GAN 5;  3REB B;  4M7A B;  2HKN A;  1Z9Z A;  2VXE A;  3OYL A;  3OYJ A;  3U23 A;  3V8J A;  2JNG A;  5I2M A;  1KK7 A;  2PUK B;  3R6O A;  9ATC B;  3ZL7 C;  3E9G A;  4J9E A;  1YI2 Q;  4F04 B;  4BI4 A;  2BZ8 A;  3QKJ A;  1W4S A;  4J7F A;  1D1B A;  1PSF A;  4M78 A;  3NTK A;  5LJ5 j;  1VQM A;  2LX9 A;  3HFO A;  2YSQ A;  2MCN A;  1BCM A;  2JS2 A;  3G6E Q;  5IH2 A;  4PJO B;  4M7A F;  3M0P A;  1QVG A;  1T3L A;  4DOW A;  4N4G A;  2I2L A;  1YP5 A;  1UFF A;  1D0Z A;  8ATC B;  2X51 A;  1NM7 A;  1OX8 A;  2DJQ A;  2DFU A;  2E12 A;  2LP5 A;  1PM3 A;  4J5Y A;  4DEY A;  2YRV A;  2QEX Q;  1BKB A;  4C8Q D;  5AYF A;  2RQR A;  1TUD A;  5FRN A;  2E4H A;  3GOX A;  2LCC A;  2YT6 A;  4ORZ A;  2H8H A;  3CPW S;  3QZ5 B;  5LJ3 d;  4PJO F;  1VQ7 A;  4QQ6 A;  1G83 A;  5GMK i;  1YJ9 T;  2P0Q A;  2DIG A;  1KC8 C;  4D8D A;  1QP3 A;  2E65 A;  3V8K A;  2COY A;  1XTD A;  2X3X D;  3UDC A;  4IUR A;  3QXE B;  3EH1 A;  5CKE A;  2QXF A;  4BE0 A;  1NPP A;  2XK0 A;  4BY6 C;  4BE1 A;  4X9D A;  3CPW P;  1VQ8 T;  5GAN 4;  4OF1 A;  2C06 A;  1VQL T;  1NEB A;  2HD0 A;  2KVQ G;  4RTX A;  3TCJ A;  3CCS A;  3CCU T;  3H6Z A;  2FO0 A;  1R77 A;  2RQT A;  2FEI A;  5LJ3 e;  4CRI A;  2VKN A;  5FLX E;  2DE0 X;  3WVE B;  3CC2 A;  4BAC A;  2LQW A;  4KRT A;  2JXB A;  1TWB A;  4WCI A;  1FX7 A;  1I5L A;  2AKL A;  2DLP A;  2ZPB B;  5KYN A;  3O8V A;  2KRS A;  4GLK A;  3WXM B;  1IHV A;  4HXJ A;  1SSH A;  3EFS A;  1WI7 A;  1R0C B;  2VB6 A;  2E10 A;  2Y90 A;  2FYK A;  5KE2 A;  2JTE A;  5LJ5 g;  4PK4 A;  2D0Q B;  4ZGE B;  2HCK A;  4FYX B;  1G5V A;  3DLL A;  3OSV A;  4BUG A;  3OYE A;  2NUP A;  4QVC A;  4M75 B;  2E5K A;  3EAE A;  4OVA A;  4E7J A;  3JCM Q;  5GAN d;  1NEG A;  2RD1 A;  8AT1 B;  1I81 A;  2PQW A;  2FZC B;  4J9F A;  1X01 A;  1M2V A;  1UTI A;  5DLO A;  4M77 C;  1M8V A;  2YXY A;  3KFV A;  1RAF B;  4FU6 A;  4MZP A;  1M27 C;  1RI0 A;  4MMK A;  3D7S B;  2FRY A;  1QP2 A;  4C92 D;  4M75 F;  2KYB A;  3HSB A;  1NPR A;  3MJX A;  1GFD A;  1YJ9 Q;  3INZ A;  2K79 A;  1VQ6 A;  2HSE B;  3GNF B;  3VS0 A;  3CXC A;  1SHG A;  2QQB A;  1YJW A;  4XQ3 A;  1K8A U;  3FJP A;  1RAB B;  2JM8 A;  1BI2 A;  4QQD A;  3T9N A;  1OV3 A;  4PLL A;  1VQ8 Q;  4M77 D;  3SB2 A;  4OMF B;  1WXT A;  4PFO A;  1QKW A;  1B34 B;  2KT8 A;  3FB9 A;  3I55 Q;  2DJZ A;  4M77 G;  2RQU A;  2K7A A;  4F7U G;  1IRX A;  4C8Q A;  3NTH A;  2EYW A;  1RAD B;  1Q86 C;  2E3I A;  3DB3 A;  5GAN f;  3LH0 A;  2XDB A;  3HP9 A;  4N4I A;  2DL8 A;  1NBE B;  2DD4 A;  1WX6 A;  1WHG A;  1RL2 A;  2FPE A;  3OS5 A;  3ME9 A;  3FEO A;  1PD0 A;  4E47 A;  1G2B A;  3ASK A;  2RHY A;  5CKF A;  1H64 1;  1U1S A;  1JJ2 P;  4HVU A;  3I56 Q;  1WJS A;  1H3H A;  3S3O A;  4FIB A;  1M3B A;  1WHH A;  2W10 A;  2OTJ A;  1WXU A;  2LMJ A;  1HYO A;  1N5Z A;  4NS5 A;  3SFM A;  2DA9 A;  1LOJ A;  3V7C A;  2XD0 A;  2HEQ A;  4A4E A;  2JVV A;  1VQP Q;  2JJ9 A;  1NG2 A;  2ABL A;  5GJW B;  5IAY A;  4CC3 A;  4X9C A;  1OPK A;  4XU0 A;  1WQW A;  1WA7 A;  2RMO A;  3VS2 A;  1AWJ A;  1ZBJ A;  1KQS P;  2O88 A;  3OS2 A;  1K73 U;  4Z02 A;  1W2B S;  3A8M B;  4Y92 A;  1Q81 C;  3TU4 K;  1H92 A;  1RUW A;  5I22 A;  4M7D A;  4PJO G;  3V7S A;  1AWW A;  2JZ2 A;  4DOV A;  3OMC A;  5HCK A;  2QI2 A;  1Y96 B;  1OX9 A;  5KCO A;  3N5B B;  3CBM A;  3URG A;  4FW2 A;  4OB2 B;  4IIM A;  2EGE A;  5CAI A;  2K5L A;  4KH0 B;  1MND A;  1FWZ A;  4MML A;  2LNH B;  1OI1 A;  2D0N A;  1M90 U;  1M1K U;  4OMQ A;  2X4Y A;  2CZ0 B;  2CZ7 B;  1VQ4 T;  3H0H A;  3QG1 A;  4A54 A;  2XDP A;  3CD6 T;  3SHW A;  1YJN T;  3EGD B;  2YUQ A;  4C92 A;  4C5H A;  3EGX A;  2EJ9 A;  4C5I A;  4ZNX A;  1LCK A;  1LNX A;  2DXC A;  4MDW A;  2DYB A;  1K4U S;  3ZBD A;  5HKC A;  1KJW A;  2R57 A;  3LGL A;  5CQX A;  1VUB A;  1SRL A;  2ED1 A;  3HKS A;  2HDA A;  4OGE A;  3HL8 A;  2LJ3 A;  4EMK B;  3G7Z A;  3PT9 A;  4D6W A;  4KBM B;  4XTV A;  3A8G B;  4PKC C;  4JZ3 A;  2QQR A;  1WGS A;  2CRE A;  2RH2 A;  5FU6 B;  5DLQ E;  3MPU B;  3QWY A;  2DVJ A;  3BY7 A;  3MO8 A;  4XTU A;  4E7S A;  3Q1J A;  3CC4 T;  4IUQ A;  1GRI A;  1AOJ A;  1G3Y A;  2V1Q A;  4C5E A;  1ZSZ C;  3REA B;  3CPF A;  1UGR B;  1YIT Q;  1PRL C;  2EAY A;  4EMH A;  1XOV A;  2E41 A;  4M78 C;  3E1S A;  3HHT B;  1ZBX A;  2PNI A;  3CCR Q;  1PHT A;  5GAN 6;  1K9A A;  4M4Z A;  1M9S A;  2RHU A;  3CMA T;  2KEA A;  5I21 A;  4V2S A;  2FL7 A;  3P8D A;  3R6N A;  5KYU B;  1BU1 A;  3VS4 A;  1ACM B;  4XTW A;  2EYQ A;  2XG8 D;  4KGV B;  2RJF A;  3EG0 A;  1WHM A;  3FRN A;  3OY9 A;  3G71 Q;  2FG0 A;  2CUD A;  1ZSG A;  3M55 A;  5HY6 A;  1UG1 A;  4B6M A;  3JCM e;  4PL6 A;  2CS7 A;  2VXF A;  3S3N A;  5GAN 8;  4UC4 A;  2IIM A;  3OYI A;  4J9H A;  4XTY A;  3OYM A;  3M54 A;  5KCH A;  3X20 B;  1VQK A;  2EIF A;  2EJG A;  2RJD A;  3MEV A;  3S6W A;  4RMO A;  3CEY A;  1VQ5 Q;  1TOV A;  4RTU A;  3OYB A;  4NL3 A;  3VRZ A;  1D1A A;  2JN0 A;  3X28 B;  1PKS A;  5CKH A;  2QA4 A;  1OQK A;  4E7K A;  3CD6 Q;  1VQM T;  4M78 G;  2HL3 A;  2PVD B;  1YBY A;  4BB7 A;  2RHI A;  3MET A;  3TVT A;  4BY6 B;  5C6S A;  2YHT A;  1VA7 A;  3MP6 A;  2JTF A;  3X26 B;  4BI8 B;  2ROT A;  2P4T A;  2R5A A;  2D6F A;  1LJO A;  3OYY A;  2X4J A;  1GFC A;  1MMA A;  2QTV A;  4FYW B;  2J06 A;  2EQU A;  3QBY A;  4P5N A;  2KBT A;  1NZ9 A;  4OB0 B;  1UJY A;  2CZ6 B;  4JRQ A;  2VAS A;  2O31 A;  2XKO C;  2DO3 A;  1KD1 C;  1YWO A;  2M16 A;  2RI2 A;  1Y7X A;  1VQ7 T;  1FMV A;  1TTH B;  1QCF A;  2JUF A;  2OTL A;  5CKD A;  1LVK A;  3CCQ T;  1KC8 R;  1BB9 A;  3JCM h;  3FC3 A;  2QAZ A;  4PJN A;  1M1G A;  1T0J A;  2PVO B;  3E9F A;  5GAN 7;  3PVQ A;  2X35 A;  1U1T A;  1IHW A;  1MMN A;  3CCS T;  1Q86 U;  3CC7 A;  7AT1 B;  1WQ7 A;  2C0I A;  3JRZ A;  4DBR A;  1YIJ A;  5IHI A;  3C94 A;  2C0O A;  4M77 B;  2CUB A;  4OML A;  4Y91 A;  3CC2 T;  4B9X A;  1YHQ Q;  2JT4 A;  3PVL A;  1IRE B;  1NLP C;  1ZX6 A;  4F7U B;  1WZO A;  2CT3 A;  3MEU A;  1EZZ B;  1K9M C;  1W1F A;  3V8L A;  4RKU E;  4RCC A;  2EKH A;  2XU8 A;  4JLI A;  3CCL A;  2HBP A;  3C12 A;  2CP5 A;  2GQI A;  2K9G A;  5I2S A;  2NUZ A;  1N8R U;  3FDR A;  3OYA A;  1WDX A;  3KXT A;  1JU5 C;  1QQJ A;  2M02 A;  1M3C A;  2CSI A;  2EGC A;  2H3E B;  3EFO A;  3KBG A;  2ZPF B;  4KGX B;  2P0P A;  3A1P A;  2ZZD A;  3L2U A;  3HRT A;  4M77 F;  2E6N A;  2E70 A;  2JOY A;  3ER0 A;  2LX7 A;  4F7U F;  2KSS A;  3G4S A;  2D8H A;  1H3Z A;  2MIO A;  1M1F A;  4OMP A;  2LZ6 B;  1KFZ A;  1J3T A;  3PIP A;  3EHQ A;  2HNI A;  4R55 A;  2GGR A;  4DBH A;  3MP8 A;  3UPU A;  1KQ2 A;  4JUV A;  5GAM d;  2LT4 A;  5A0L A;  5FU6 C;  1X69 A;  2DXU A;  5CQY A;  4C8Q C;  3JB9 D;  1RAE B;  5KYX B;  3CPW A;  4AG2 C;  3JB9 J;  1VQ9 Q;  1TG0 A;  4CI0 C;  5KH6 A;  3C0C A;  2M0O A;  1S72 A;  4RG2 A;  1NJI C;  2ZGW A;  3SDZ A;  4Z8A A;  1VQ6 T;  4M7A E;  5LJ3 g;  1IB8 A;  2XDD A;  2DYI A; 
#chains in the Genus database with same CATH homology
 1OQK A;  1PC0 A;  1V76 A;  2KI7 A;  1TSF A;  1TS9 A;  2ZAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...