2ZAEA

Crystal structure of protein ph1601p in complex with protein ph1771p of archaeal ribonuclease p from pyrococcus horikoshii ot3
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
b'GSYQEIIGRTWIFRGAHRGRVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGDRIWKVPKDVSIFEFEADDGTKIKIPGERLVGRPEMRLKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease P protein component 1
publication title Structure of an archaeal homolog of the human protein complex Rpp21-Rpp29 that is a key core component for the assembly of active ribonuclease P.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 24
structure length 105
sequence length 105
chains with identical sequence C
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2007-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01868 UPF0086 Domain of unknown function UPF0086
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.210 Mainly Beta Roll SH3 type barrels. Ribonuclease P/MRP, subunit p29 2zaeA00
1V76A 1TSFA 2ZAEA 2KI7A 1OQKA 1TS9A 1PC0A
chains in the Genus database with same CATH superfamily
2L89A 3PIPA 2KYBA 1M5Q1 4PJOA 2K3YA 1KD1U 3CCQT 3M57A 4BB7A 4B9XA 1NJIU 3MPUB 1ZUYA 1JJ2P 4ESRA 3QHSA 2DMOA 2A7YA 4PFOA 4LUEA 1KFZA 1RAHB 3VJPA 2E4HA 1WJRA 2OJ2A 3S3OA 2X3WD 1ZA2B 2IVWA 1VQ7Q 2P0QA 5GAN5 3L2RA 4C8QA 1TUCA 1OPLA 1WQ7A 5GAN2 3UATA 3I55A 2KRMA 3X25B 1VQ6Q 4FIBA 1MV0B 1LPLA 4BE1A 4Z02A 2MPXC 3M0PA 1VQ4Q 5LJ3g 4JZ3A 1MMDA 1NLOC 3QYHB 3OW2P 2QA4A 1JJ2S 1WA7A 2CH4W 2QTXA 4C0DC 3CC7T 4CI0C 5I2SA 2VXFA 1K76A 2EW3A 5A0LA 1KC8R 4GBQA 1SKUB 3VV0A 4J9HA 1CSKA 2E5QA 2K5LA 2FVUA 1VQ9T 1MUZA 2CUDA 3CCSQ 2YLBA 1M4ZA 4E7ZA 2XICA 4CC7A 3H41A 4E7KA 3ZEHA 4UC4A 3QG1A 1BCOA 1GRIA 2LX9A 4BY6C 4LDWA 1RL2A 2LCLA 1M90R 2JW4A 3DKMA 3JCMe 2FG0A 5GANd 1D0XA 2CP5A 2EQKA 3M4YA 1G3TA 3CPWA 3OS0A 4E7IA 2LVMA 2KXDA 4CRIA 4KUIA 3VS0A 3CD6T 4J5YA 1LCKA 2E3HA 3PTAA 4QVCA 5I21A 3JCMh 2HMAA 4GY5A 2ZPIB 4RTXA 1Q81R 1VQPQ 2OAWA 2HQXA 2ZPHB 4K11A 5LJ5e 4AFZC 3CCLA 3I35A 3LYIA 3OMGA 2OTLQ 1WYXA 2KYMA 3SHWA 1PRMC 1JEGA 3CC4Q 4MMKA 4ZGJB 4JDSA 4PJOG 2QQRA 3PMIA 1PRLC 2EKOA 1LVKA 1VQ5Q 5LJ5h 2CZ7B 5LJ3f 4M7AE 1FWZA 3TEEA 2M0OA 5J39A 1X69A 1Y07A 4OP0A 1N6AA 1IZ6A 4FYYB 3LW5E 4J7FA 4C8QG 1Q81U 4JPBW 3OMCA 4XU2A 1ZA1B 1YJWT 1KSWA 4MZPA 5KE2A 2QI2A 3RBBB 2DK3A 2XI9A 3CC2A 1Q7YU 2DD5A 2MK5A 1ACMB 4AMCA 2DZCA 1GL5A 2ZPEB 3DLLA 2LMJA 3C0CA 4PLIA 3EG2A 3VS3A 2DTHA 3G7ZA 3SWNA 3RR6A 4XTVA 2L3QA 3QZ5B 2E10A 2YUOA 1TS9A 1G8XA 5KYNA 1Q86C 2BTTA 2KRNA 5LJ3e 1VQKA 3E19A 1VQ7T 4HKEA 3OYJA 4MZMA 2CKKA 2KI7A 5GAMd 4ZTJA 1GBRA 3VS4A 4BI4A 5KH6A 1VQ6T 1UJYA 1IO6A 2D9TA 1EIFA 2YT6A 1VQ4T 1FX7A 1TUDA 2C06A 1SRMA 4RG8A 2QA4Q 4M7DE 2E12A 3X20B 5LJ3h 2DFUA 3CCMQ 1RI9A 4IUUA 3RUXA 3JRZA 3PVQA 4C92D 2RQWA 2JTFA 3CXCS 2DPPB 2V8KA 3FJPA 1JJ2A 2VXEA 2COYA 2LNVA 3FLGA 2O4XB 3JCMX 1QLYA 3RIRA 3EHQA 2EYWA 2M51A 2KT1A 3SFMA 4R55A 2JTMA 1OQKA 2DERA 4KBMB 5KYYB 1UHCA 1SPKA 4M75D 3KBGA 3TSWA 4FU6A 3IQLA 4M4ZA 3TQ7P 1QVGP 2RK1A 9ATCB 1VQPT 2BE7D 4FSXA 4A4FA 3QWYA 1OPKA 1N27A 4LE9A 2RPNA 1YCSB 3QJ6A 1R77A 3R6OA 1RAFB 1VQNA 1UE9A 2QASA 2FRWA 1LJOA 2KGTA 3CC4T 2JMAA 4M78D 2GF7A 1QVFP 3E9FA 1C6VX 2JM9A 1M1KR 5IHNA 3I56A 1VQ5T 2YLCA 1NYFA 4X9CA 1U5SA 2GNCA 2DTIA 1Y0MA 2XIDA 2ENMA 2KK4A 3CCVT 5FLXE 3FIFA 1QCFA 4EPCA 3H8ZA 1SEMA 2VWFA 5IXBA 1QVFS 3TCJA 4LN2A 3L42A 4C92B 2CREA 4PFZA 2KXCA 3RERA 2B8AA 3A5ZB 5GAOl 1ZUUA 3G1JA 5CO7A 5FW9A 2K3BA 3G71A 4B6MA 2BKDN 3GIBA 2ESWA 4A4EA 4L6V5 1UGQB 5KYWA 2MOXA 2PVDB 1M27C 1BI3A 6AT1B 3I55T 4FL6A 1VQMQ 1WJQA 2CZ1B 5KYUB 2X9HA 4M75B 3CMAQ 2YXYA 2QA4T 4JS4A 2OI3A 5FWBA 2M0YA 4JRPA 2GCXA 3CCMT 5L23A 1KIKA 2M02A 1OYXA 4PFPA 1YI2A 2CP2A 3EG9B 1OULA 4M78B 2PTKA 2VASA 1NPRA 2E5KA 4PJMA 2J05A 3NMZC 2QDLA 2CP7A 4ZN1A 3LGFA 4OF1A 3E1SA 1H641 1RAGB 1AZGB 4D8KA 4PJLA 1G3YA 2BZYA 2G6FX 4OMLA 1J3TA 1ZSZA 1IXDA 5GAOp 4J9BA 3X28B 2RQRA 1FMVA 1H3ZA 5AYFA 3UA7A 5GMKl 4RCBA 1E7OA 1Q86U 4C92G 2VGNA 1NLPC 1AEYA 1D3BB 4NS5A 4AFUC 4WF2A 4AG2C 1QP3A 3CXCA 5GMKh 5FU7B 4PJOC 1O9SA 2DF6A 3VS7A 4FT4A 3V8JA 2LX7A 5IH2A 1K4US 4Z89A 2E1HA 4AG1C 2OAUA 4F7UB 1QCOA 3CCLT 1UDLA 3V8KA 2GQIA 3PNWC 2DRMA 3MHXA 4C8QC 2P0PA 2RH2A 4M75G 2M16A 3CMEA 2EGCA 3CPWP 5LJ3d 2XMFA 3VS5A 4IUPA 1YP5A 3RKYA 2YRCA 1D1BA 3MEUA 1W6XA 3CC7Q 4OMQA 4ZN3A 2DKGA 3M56A 2COZA 1K8AR 4LDYA 4BDYA 3CC2T 1JBMA 3ZFJA 2A0FB 1H92A 1VQ9Q 4JS5A 2EJFA 4HA8A 4HCCA 2MWOA 1BI1A 2EYYA 2FO0A 1FMKA 2EQMA 3P8HA 1F1BB 2JN0A 2ROTA 4J9GA 3C94A 4PLLA 1VQLA 1GXIE 4PJOF 3VS2A 1NEGA 2XU8A 1M2VB 1U3OA 4OMMA 1VQKT 2C0OA 4CC3A 3UT1A 4CC2A 1QVFA 2P4TA 2CP0A 5KCHA 4C8QF 5KE3A 1VQMT 4QQGA 1YJ9A 2R57A 2GTOA 3CMAT 2RB6A 3CPFA 2DL8A 3CD6Q 3INZA 3QSUA 1N8RC 3OYIA 3M0TA 1TUGB 3H6ZA 4P5NA 1BK2A 3UA6A 4FW1A 2RQVA 2JTEA 3EFOA 3C12A 4OGEA 1JRIA 1VQOA 1MMGA 2H8HA 1TWBA 4C5GA 2LQKA 3TVTA 3VYGA 1W70A 2JXBA 1KD1R 3HRTA 5CQYA 3CCJQ 2LCCA 2XDPA 3S6WA 2XK0A 4AT1B 1NE8A 1NJIR 4N4GA 4J6WA 1YIJA 3BW1A 3THKA 2WSFE 4HT8A 2K79A 2EGAA 2DA9A 4MMLA 3M54A 2QAZA 2LNHB 4JJDA 1BIBA 3BDUA 1B3QA 2YHTA 4A4KA 2HSPA 1VQ8A 2FB7A 4M7AD 2FZKB 1PC0A 2A37A 2LC4A 3SWNC 1NBEB 3MP6A 4LUDA 4J83A 2AT1B 2GQVA 1UHFA 2H3JA 2HQHA 2VUBA 3HRUA 3TSZA 3A1PA 1K73C 4Q5WA 3OYEA 1YWPA 1M8MA 1EX4A 2DBKA 4KGZB 1UB4A 3QBYA 4NL2A 3M0SA 3NTKA 2HNIA 3OBYA 1DJ7B 2QQAA 1K1ZA 2DL3A 2PQWA 2M1HA 2VYTA 3DB3A 1JO8A 5GAOr 2KT8A 2HD0A 1IREB 2RO0A 2O9VA 4DOWA 3VUBA 2DXCA 4RMOA 3MCAB 4OMPA 2Z0WA 1R8OB 1Z9QA 2V26A 3MO8A 2X35A 4XU3A 4FYXB 3UPUA 1YJNA 4M7DD 1UGVA 2QGFB 3D7SB 1M9SA 5GAOn 4JUVA 4BACA 3LGLA 1RACB 3G4SQ 4PJJA 1WHLA 1XNIA 2JZ2A 2L5QA 3OY9A 3FC3A 4A4GA 4IUVA 4ATOA 1PSEA 4PJOE 1M3AA 2HQEA 2MI6A 4E7HA 2YUQA 4Y28E 2X3XD 4M7AB 2EQIA 3VU3C 3VKIA 3CCUA 1O75A 2YUPA 2DIGA 2PNIA 1JXMA 8ATCB 2QEXA 5J26A 1V29B 4IUQA 4FCYA 1MHNA 2EJ9A 1N9RA 2DL4A 4C8QE 3QKJA 5EC7A 5J3BA 1OZ2A 2JJ9A 2VGMA 1Q7YR 1V76A 2CP6A 4D6WA 5IXFA 1WFWA 5CIUA 2XDDA 3MEWA 1I81A 2RHIA 2YUNA 4R56A 2LRQA 3BY7A 1ARKA 3OB9A 3EGUA 3OA6A 3CCJT 4EMKC 4RTTA 1IHVA 3JCMc 4C92C 5C6SA 2AK5A 1OU8A 1G5VA 1OU9A 2FRYA 2RI2A 1XTDA 3QO3A 4BE0A 3CCVQ 1UEBA 4XK8E 1MMNA 2D8JA 4DBQA 1WLPB 2R5AA 2KNBB 4JRKA 4DQ2A 1PNJA 2LP5A 3BFMA 3T9NA 2ZCFB 1Y96B 2X4WA 1WHJA 1LNXA 2EYZA 1YCYA 4FYWB 2FZGB 4KH0B 4M7DB 2GFAA 5A0GA 2E64A 3N5BB 2O31A 1IGQA 4M75C 1UGRB 2BUDA 2HEQA 1N8RU 2CSQA 1AWWA 3SDZA 2AIRB 2JUFA 3NPFA 5I11A 1QQJA 2VVKA 1AD5A 5A0DA 1WDXA 1ZSGA 3CCEA 3X24B 1VIFA 1SRLA 2JVVA 3ASKA 1K0SA 1Y7XA 3I55Q 2DZ9A 1X2QA 2CDTA 4M78C 2NLUA 3L1AA 4RUGA 2NUTB 4C92F 2L0AA 2LT4A 3M0QA 3GNFB 3VS1A 1SG5A 3F70A 3CXCP 1YITA 2E6NA 2QK0A 1Q82C 2BZ8A 1W1FA 2HSEB 5DLQE 2RJCA 1PCXA 3OYFA 1X75C 3UWNA 2CT4A 2HDAA 2QQBA 1QW1A 4BD3A 1UG1A 2LQNA 2L3RA 2O4XA 4LD9K 2JMCA 1M3CA 3JCMQ 3VRYA 2P84A 3MKDA 1WXTA 5FRMA 4QQDA 3JAME 5KYYA 4M75F 1BYMA 2DBMA 3G4ST 1ZSZC 1K9MC 3EHRA 4OMOA 1QWFA 1OX8A 1I5OB 3EGXB 1E6GA 3OSVA 2HAXA 3L2WA 4LDXA 1NG2A 1AHJB 3HSBA 4ZNXA 2X51A 4JJCA 3A8HB 2RHXA 2KDSA 4A4HA 4M78F 1GCQA 1WHHA 2YSQA 1RLPC 1D09B 4IURA 5CKDA 1TTHB 3BE3A 4XTYA 1BIAA 3A8OB 1WHKA 2R58A 3CCLQ 5GJVB 2ED0A 1N5ZA 2OTJA 3ULRB 5FU6B 4BY6B 2PVOB 1JB0E 2K9GA 1BBZA 2F69A 3JCMW 1CKAA 2RF0A 3V8LA 1SSHA 3LX7A 3META 4EMKA 3EFSA 3CCQA 2JT4A 4C92A 3RMQA 5KYXB 3NHNA 3SEMA 2RHUA 5GAN6 2YRDA 2K6DA 3JV3A 4XQ3A 3O5ZA 3PGGA 3CC2Q 2RQTA 3GNGA 3Q1JA 1QP2A 4KH1B 2D1XA 2KSSA 2RQUA 2EGEA 3EG1A 2EWNA 4X34A 1KQ2A 3H0IA 3CCRA 3S3NA 1B7TA 2QG9B 4JLIA 1C0MA 5IAYA 5KYUA 4M75A 4XTUA 1XQHA 4XAXB 3H0FA 2RNAA 3C95A 2RJDA 1VQKQ 1AOJA 3EFRA 5GMKm 2X4JA 5DM7R 1X6GA 1V1CA 1PKSA 2CGHA 5GANj 3NFCA 3I5RA 4A63B 2DLPA 2F2XA 2K5IA 2W0ZA 3EG9A 2QDYB 4ANJA 4M78A 3OS5A 4M77D 1Y71A 1PSFA 5GMKj 1AWXA 4J9IA 3JB9J 1H8KA 1YWOA 2PUOB 1Q86R 1T3LA 1VOMA 3LLRA 3OYHA 1HD3A 3TREA 3LWIA 4AFSC 2FPDA 3QIIA 3JB9D 1B34B 4PNOA 1HXDA 1I1JA 1PD1A 3M53A 1QVPA 5IN1A 4LDVA 3SD4A 1MMAA 4C5IA 4HCKA 1UGPB 3G6EA 4BI8B 4PKCC 2EJGA 1FXXA 4HVUA 1H3HA 3UF4A 1D3BA 5ECAA 2NUPB 2LJ3A 1NEBA 1YHQA 3EG0A 2NYSA 3A8LB 1X43A 2BZXA 3HP9A 3OYKA 3VUZA 2V8JA 4F7UA 2K4YA 3KXTA 4BE2A 3OYAA 5CAIA 4M75E 1K0XA 1S72A 1UJ0A 2CH4A 2O2OA 2MIOA 5C0MA 4WTOB 3L2QA 1KK7A 3L2ZA 2ZZDA 3RMSA 2ZPFB 2X4YA 1YFNA 1X01A 4WCIA 2DJZA 1Q82U 1K9AA 1SHFA 3LH0A 3GOXA 1RUWA 3V7CA 1WXBA 1VQNQ 3A8MB 4HVWA 4LXCA 2HL3A 4D8DA 2CZ0B 4VUBA 5HKCA 3MJXA 2VC8A 4ZGEB 2D0NA 1VIEA 2DNUA 3I56Q 2DM1A 4C5EA 2DVEA 4QVDA 2KQWA 2CUBA 4M77B 5GAMj 1WX6A 1KC8C 2DIQA 3QWXX 1Z9ZA 1WQWA 3M9QA 1VQ7A 4J9DA 2K57A 1K9MU 2EBPA 3QDFA 3M0UA 1M2VA 5GAN7 1VQ6A 1RADB 4KGVB 3CBMA 1X6BA 1AT1B 4KRTA 1RAEB 1CKBA 4M78G 4C0FA 1VQ4A 3CBPA 4XTZA 4OB3B 4IIOA 3NGPA 4II1A 1M90C 3FJ5A 5CR2A 1ZBJA 3G71Q 2DYIA 4GLKA 4DA4A 3E2UA 2AZSA 1IHWA 2RA2A 2E65A 3VYHB 3ZL7C 3GP8A 3CCSA 2F2VA 3GPLA 4KUDK 2IG0A 4RTYA 4A54A 4EIKA 2XG8D 1YBYA 5M9OA 3GBQA 4J6XA 3HL8A 3QXEB 1Q81C 2YDLA 2C0TA 1U06A 1ZX6A 3P8BB 4ZTFA 1R0BG 4RG2A 1EFNA 2FPFA 4LD6A 1G3WA 4F7UG 5A2QE 4DBRA 1OX9A 3QYGB 4MDXA 2LQ8A 2QQ9A 1S1NA 3WVEB 3CBOA 4ZGDB 2XKOC 3JCMg 2O01E 1YI2Q 3O8VA 4FT2A 1KQSP 2ZPBB 2CZ6B 2L3PA 3RKWA 3L2UA 3J80E 3HFNA 3OYNA 1NM7A 2E70A 1VQPA 1TXQA 4M77G 2QTVA 5CVIA 2VKNA 4M7DC 2WSEE 1IB8A 3P8DA 1I07A 2I2LA 2JNGA 1HJDA 2OTLA 1KQSS 1VUBA 5LJ5g 3CC4A 4ME7A 4J9EA 2KE9A 3OYYA 3JB9G 4Y91A 4Y92A 2RI3A 4BDZA 1VQ5A 3HRSA 2FHDA 2HL5C 4XTWA 4KT0E 2D8HA 4PJNA 3HTRA 2GTJA 1SSFA 3GLXA 3URGA 3SB2A 4OB0B 2RK2A 1RAIB 1VQNT 1TOVA 2CS7A 2EQUA 4OMNA 3A98A 2Y90A 2FEIA 2VB6A 3RNJA 2D0QB 3I56T 3JB9H 3CMEQ 2E6ZA 3OQ5A 1BB9A 3M5AA 4Z8AA 1SHGA 2EYXA 4OB2B 1PD0A 1T0HA 1WJSA 3EGDB 2CYZB 4M7DF 2J06A 2LZ6B 2NWMA 3M4GA 3WVDB 3QJYA 3LWHA 3R6NA 2EFIA 2K3XA 3FB9A 2QYZA 3JCMf 4PJOB 5GMKi 2ATCB 3DLMA 2KR3A 2HKQB 2JM8A 4AFQC 3CCRT 4BI3A 2WSCE 3VRZA 2FL7A 2LDMA 4E6RA 2DILA 2DXTA 1UFFA 5CKBA 1VA7A 1VQLQ 1QKWA 3G71T 3CCMA 1VYUA 4C8QB 3EH2A 2MAMA 5LJ5j 4M7AA 5CKHA 4RKUE 4LDUA 2RJEA 5LJ5f 3MEVA 4J6YA 4J8OA 1YN8A 2SRCA 2RN8A 1G2BA 3OW2S 1MNDA 1YJ9Q 2E41A 5FU6C 1HK9A 4IKFA 2DTOA 3M0RA 1GCQC 3OYLA 4FSSA 1GBQA 3OYDA 1ABOA 3REBB 4PK4A 2QXFA 1A0NB 5HK3A 4JJNK 2AZVA 1B07A 1X2KA 3UDCA 2DEQA 1KC8U 4L59A 5AT1B 3RDVA 1VQOQ 3E9GA 1YI2T 3OYMA 1M1KC 1C1AA 1FMWA 4HCBA 2DO3A 2A36A 2LTOA 2RJFA 3G6ET 1PHTA 2Y4XA 4OVAA 1G83A 1D1AA 1M30A 1N8RR 2GFUA 4IUTA 2D6FA 3QZ9B 1Y96A 2DXBA 1YIJQ 5D6YA 1YHQT 1M90U 2DXUA 4M7DA 5FWCA 5CKFA 4ELZC 3OS2A 4J7IA 4JJBA 4C5HA 5LJ3j 2EKHA 1WIEA 2V1QA 4F16A 1Y57A 2DL7A 1W4SA 3MP8A 4NL3A 3OS1A 1NYGA 2XD0A 4JRQA 2EYQA 1S72T 3MEAA 1VQ8Q 3RESA 2J7IA 4V2SA 5FROA 3MP1A 1X6OA 1BKBA 2V8IA 3J81E 4JLGA 2KMTA 1PM3A 1I0CA 5FRNA 4O6JA 5GAN4 2PZ1A 1KJWA 1ZQ1A 4EMHA 2NUTA 1M2OA 1KQSA 2F1LA 1HYOA 1QKXA 2K2VA 1JU5C 5L8RE 1GFCA 1WHMA 3FRNA 3I9QA 3CMET 4M7AG 2DD4A 2HBWA 1XJWB 1D1CA 2AHJB 4Z88A 1RAAB 1TG0A 1K73R 1HSQA 3ER0A 2ZPGB 4DBFA 3SWNB 1VQMA 4MZTA 1VYTA 1ZBXA 1G3SA 1QMCA 2CSIA 1PWTA 1IRXA 1UECA 3CMAA 2O88A 3EGXA 2DYBA 3OYBA 1M8VA 1YJNQ 1RI0A 1TU0B 3NTHA 2KVQG 2IIMA 4DOVA 2KRSA 1VQLT 3EG3A 3ME9A 4QT7A 5DLOA 2EPDA 2NUZA 5FU7C 2XHCA 3V7RA 1PKTA 1QCNA 1OOTA 4QVZA 4ELYC 3CCST 4N4HA 1OEBA 1T3SA 1FYNA 4F17A 1MGQA 4LNPA 1YJ9T 1K73U 2DL5A 2WACA 1I8FA 2ROLA 4C0DB 3HKSA 2Y4YA 3CCUQ 4M7DG 3L2VA 2VV5A 4OB1B 2PUKB 2QEXQ 3VS6A 4JRIA 2DETA 5GAOm 7AT1B 1Q95G 1U8RA 1OV3A 5GANg 4M77C 2R5MA 1VQOT 4FM4B 4RCCA 5KYXA 3OW2A 1MNEA 2MF2A 2KAFA 1NPPA 1MV3A 1TH7A 2A3LA 4XU0A 2ED1A 1BCMA 2XDBA 2BE9B 4L5GA 4DEYA 5D6XA 3BDLA 1YIJT 4N4IA 2P0KA 2OTLT 1K8AC 3EH1A 2X4XA 2EQJA 4TVRA 2DVJA 4F7UF 1NZ9A 3QDRB 1QVGS 1I5LA 3PMTA 3X26B 1AVZC 5GAN8 5GJWB 3PVLA 2KROA 8AT1B 1VQ8T 2YRVA 1W2BP 4J9FA 2QGGA 1AWOA 2H3EB 2RM4A 3CC7A 1OI1A 3OSSC 5IHKA 1U1TA 2DRKA 3FDRA 1RABB 2MMPA 4M77F 4HXJA 4EMKB 5D6WA 4MDWA 1XOVA 3CCEQ 1VQ9A 1GFDA 4N0AC 4HCZA 3GF5A 2C0IA 2PVGB 1W2BS 4FYVB 2E3IA 4XTXA 4EDUA 2BIVA 1M1KU 4HT9A 1SF9A 2ECZA 3JB9F 1EZZB 1WXUA 3PE0A 2KBTA 2RI5A 1YITQ 1B34A 5GANf 2EAYA 1E6HA 2LJ0A 2L2PA 1M1FA 5EG2A 5GAN3 4RTUA 2OX7A 5CCAA 3QUIA 4E47A 3JCMd 5GAMg 3HFOA 1ZLMA 4C92E 2NUPA 1KD1C 3V7SA 1AWJA 5I22A 2HBPA 3CD6A 1OZ3A 2RHZA 1YJNT 1NJIC 3TU4K 2JOYA 5HK0A 5KYWB 1KQ1A 2MWPA 3JSCA 3WXMB 2J6FA 5LL6S 4KGXB 1Q82R 3OBWA 1JQQA 3A8GB 2L8DA 3DB4A 1WGSA 2AKKA 1R0CB 4R0KA 5LJ5d 2L3SA 5CK9A 3OYGA 2HCKA 1WI7A 3CCJA 2RHYA 3HHTB 3JCMV 3KUFA 5GANe 1YNZA 2K2MA 3CCUT 5HCKA 2QEXT 3M59A 5GMKe 2M9UA 1TSFA 1X27A 2KY9A 3RKXA 1M3BA 1ZHIA 2W10A 4OGCA 1K9MR 1WNLA 2V1RA 1YJWA 4RTZA 4M77A 3C4SA 2OTJQ 5GANh 2MCNA 1JXOA 1KG1A 4M78E 5HY6A 1N9SA 3JCMP 4DBHA 1IGUA 3H9NA 4KULA 1ZSZB 4YTLA 3PFSA 2J6OA 2F2WA 3CCQQ 2SEMA 2HKNA 3AT1B 1UTIA 4QKUA 2FPEA 3FEOA 2AKLA 1PG5B 5CKEA 3CEYA 1M1GA 5DY9A 1T0JA 2LJ1A 3NTIA 5GAMf 1WHGA 2DAQA 5GAOq 3PIOA 2EIFA 4RTVA 4NOYA 4OMFB 1BI0A 2K5FA 4E7LA 3ZBDA 2B86A 3CCRQ 4QQ6A 4C0ZA 2CT3A 2ABLA 4F7UE 4M7AC 5IHIA 5I2MA 1ABQA 1RLQC 4C0GA 1KHIA 3EAEA 4O5VA 2I0NA 4EMGA 4J9CA 1WPYA 4GLMA 2A28A 3CCET 3CPWS 2JS0A 3J7AF 4B9WA 1QVGA 2LCSA 1WZOA 4HVVA 4N0AA 2RD1A 3PT9A 2P4RA 3S3MA 2IPOB 2F5TX 5CQXA 4DEXA 2LT1A 2K7AA 4M77E 5GAMe 3H0HA 1YITT 4F04B 3G4SA 1U1SA 1AZEA 1P92A 1Q7YC 2LQWA 3CQTA 1KHCA 5IT9E 3HPWA 1VYVA 3QPHA 2HZYA 1K8AU 2COWA 2RMOA 4PJOD 5KCOA 1GCPA 4ORZA 1W2BA 3JB9I 5GAMh 4X1VA 2G3RA 4A53A 1BI2A 4IIMA 2EVRA 1BU1A 1UUEA 2FYKA 3AHUA 3G6EQ 2O9SA 2ZGWA 4FW2A 2PU9B 1D0YA 2F5KA 4XU1A 2KEAA 5D7UA 3KFVA 3JCMb 4C8QD 4M7AF 1I4K1 2GGRA 2J6KA 2DEUA 2DX1A 1YHQQ 4F14A 1ZUKA 4BUGA 3REAB 2CP3A 4QW2A 4JZ4A 2GBQA 1QWEA 4E2FB 2FZCB 3EFOB 1D0ZA 1LOJA 4RTWA 2ZAEA 4E7SA 1S72Q 4E7JA 3OYCA 3JCMJ 1UGSB 3U23A 2A08A 3LH5A 2DJQA 3M58A 4CC4B 3CCVA 1YJWQ 2OTJT 3M55A 2JS2A 4X9DA 3EGDA 3I5SA 2QQSA 2MYSA 2YWWA 2DE0X 4PL6A
chains in the Genus database with same CATH topology
1V76A 1TSFA 2ZAEA 2KI7A 1OQKA 1TS9A 1PC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V76 A;  1TSF A;  2ZAE A;  2KI7 A;  1OQK A;  1TS9 A;  1PC0 A; 
#chains in the Genus database with same CATH topology
 2L89 A;  3PIP A;  2KYB A;  1M5Q 1;  4PJO A;  2K3Y A;  1KD1 U;  3CCQ T;  3M57 A;  4BB7 A;  4B9X A;  1NJI U;  3MPU B;  1ZUY A;  1JJ2 P;  4ESR A;  3QHS A;  2DMO A;  2A7Y A;  4PFO A;  4LUE A;  1KFZ A;  1RAH B;  3VJP A;  2E4H A;  1WJR A;  2OJ2 A;  3S3O A;  2X3W D;  1ZA2 B;  2IVW A;  1VQ7 Q;  2P0Q A;  5GAN 5;  3L2R A;  4C8Q A;  1TUC A;  1OPL A;  1WQ7 A;  5GAN 2;  3UAT A;  3I55 A;  2KRM A;  3X25 B;  1VQ6 Q;  4FIB A;  1MV0 B;  1LPL A;  4BE1 A;  4Z02 A;  2MPX C;  3M0P A;  1VQ4 Q;  5LJ3 g;  4JZ3 A;  1MMD A;  1NLO C;  3QYH B;  3OW2 P;  2QA4 A;  1JJ2 S;  1WA7 A;  2CH4 W;  2QTX A;  4C0D C;  3CC7 T;  4CI0 C;  5I2S A;  2VXF A;  1K76 A;  2EW3 A;  5A0L A;  1KC8 R;  4GBQ A;  1SKU B;  3VV0 A;  4J9H A;  1CSK A;  2E5Q A;  2K5L A;  2FVU A;  1VQ9 T;  1MUZ A;  2CUD A;  3CCS Q;  2YLB A;  1M4Z A;  4E7Z A;  2XIC A;  4CC7 A;  3H41 A;  4E7K A;  3ZEH A;  4UC4 A;  3QG1 A;  1BCO A;  1GRI A;  2LX9 A;  4BY6 C;  4LDW A;  1RL2 A;  2LCL A;  1M90 R;  2JW4 A;  3DKM A;  3JCM e;  2FG0 A;  5GAN d;  1D0X A;  2CP5 A;  2EQK A;  3M4Y A;  1G3T A;  3CPW A;  3OS0 A;  4E7I A;  2LVM A;  2KXD A;  4CRI A;  4KUI A;  3VS0 A;  3CD6 T;  4J5Y A;  1LCK A;  2E3H A;  3PTA A;  4QVC A;  5I21 A;  3JCM h;  2HMA A;  4GY5 A;  2ZPI B;  4RTX A;  1Q81 R;  1VQP Q;  2OAW A;  2HQX A;  2ZPH B;  4K11 A;  5LJ5 e;  4AFZ C;  3CCL A;  3I35 A;  3LYI A;  3OMG A;  2OTL Q;  1WYX A;  2KYM A;  3SHW A;  1PRM C;  1JEG A;  3CC4 Q;  4MMK A;  4ZGJ B;  4JDS A;  4PJO G;  2QQR A;  3PMI A;  1PRL C;  2EKO A;  1LVK A;  1VQ5 Q;  5LJ5 h;  2CZ7 B;  5LJ3 f;  4M7A E;  1FWZ A;  3TEE A;  2M0O A;  5J39 A;  1X69 A;  1Y07 A;  4OP0 A;  1N6A A;  1IZ6 A;  4FYY B;  3LW5 E;  4J7F A;  4C8Q G;  1Q81 U;  4JPB W;  3OMC A;  4XU2 A;  1ZA1 B;  1YJW T;  1KSW A;  4MZP A;  5KE2 A;  2QI2 A;  3RBB B;  2DK3 A;  2XI9 A;  3CC2 A;  1Q7Y U;  2DD5 A;  2MK5 A;  1ACM B;  4AMC A;  2DZC A;  1GL5 A;  2ZPE B;  3DLL A;  2LMJ A;  3C0C A;  4PLI A;  3EG2 A;  3VS3 A;  2DTH A;  3G7Z A;  3SWN A;  3RR6 A;  4XTV A;  2L3Q A;  3QZ5 B;  2E10 A;  2YUO A;  1TS9 A;  1G8X A;  5KYN A;  1Q86 C;  2BTT A;  2KRN A;  5LJ3 e;  1VQK A;  3E19 A;  1VQ7 T;  4HKE A;  3OYJ A;  4MZM A;  2CKK A;  2KI7 A;  5GAM d;  4ZTJ A;  1GBR A;  3VS4 A;  4BI4 A;  5KH6 A;  1VQ6 T;  1UJY A;  1IO6 A;  2D9T A;  1EIF A;  2YT6 A;  1VQ4 T;  1FX7 A;  1TUD A;  2C06 A;  1SRM A;  4RG8 A;  2QA4 Q;  4M7D E;  2E12 A;  3X20 B;  5LJ3 h;  2DFU A;  3CCM Q;  1RI9 A;  4IUU A;  3RUX A;  3JRZ A;  3PVQ A;  4C92 D;  2RQW A;  2JTF A;  3CXC S;  2DPP B;  2V8K A;  3FJP A;  1JJ2 A;  2VXE A;  2COY A;  2LNV A;  3FLG A;  2O4X B;  3JCM X;  1QLY A;  3RIR A;  3EHQ A;  2EYW A;  2M51 A;  2KT1 A;  3SFM A;  4R55 A;  2JTM A;  1OQK A;  2DER A;  4KBM B;  5KYY B;  1UHC A;  1SPK A;  4M75 D;  3KBG A;  3TSW A;  4FU6 A;  3IQL A;  4M4Z A;  3TQ7 P;  1QVG P;  2RK1 A;  9ATC B;  1VQP T;  2BE7 D;  4FSX A;  4A4F A;  3QWY A;  1OPK A;  1N27 A;  4LE9 A;  2RPN A;  1YCS B;  3QJ6 A;  1R77 A;  3R6O A;  1RAF B;  1VQN A;  1UE9 A;  2QAS A;  2FRW A;  1LJO A;  2KGT A;  3CC4 T;  2JMA A;  4M78 D;  2GF7 A;  1QVF P;  3E9F A;  1C6V X;  2JM9 A;  1M1K R;  5IHN A;  3I56 A;  1VQ5 T;  2YLC A;  1NYF A;  4X9C A;  1U5S A;  2GNC A;  2DTI A;  1Y0M A;  2XID A;  2ENM A;  2KK4 A;  3CCV T;  5FLX E;  3FIF A;  1QCF A;  4EPC A;  3H8Z A;  1SEM A;  2VWF A;  5IXB A;  1QVF S;  3TCJ A;  4LN2 A;  3L42 A;  4C92 B;  2CRE A;  4PFZ A;  2KXC A;  3RER A;  2B8A A;  3A5Z B;  5GAO l;  1ZUU A;  3G1J A;  5CO7 A;  5FW9 A;  2K3B A;  3G71 A;  4B6M A;  2BKD N;  3GIB A;  2ESW A;  4A4E A;  4L6V 5;  1UGQ B;  5KYW A;  2MOX A;  2PVD B;  1M27 C;  1BI3 A;  6AT1 B;  3I55 T;  4FL6 A;  1VQM Q;  1WJQ A;  2CZ1 B;  5KYU B;  2X9H A;  4M75 B;  3CMA Q;  2YXY A;  2QA4 T;  4JS4 A;  2OI3 A;  5FWB A;  2M0Y A;  4JRP A;  2GCX A;  3CCM T;  5L23 A;  1KIK A;  2M02 A;  1OYX A;  4PFP A;  1YI2 A;  2CP2 A;  3EG9 B;  1OUL A;  4M78 B;  2PTK A;  2VAS A;  1NPR A;  2E5K A;  4PJM A;  2J05 A;  3NMZ C;  2QDL A;  2CP7 A;  4ZN1 A;  3LGF A;  4OF1 A;  3E1S A;  1H64 1;  1RAG B;  1AZG B;  4D8K A;  4PJL A;  1G3Y A;  2BZY A;  2G6F X;  4OML A;  1J3T A;  1ZSZ A;  1IXD A;  5GAO p;  4J9B A;  3X28 B;  2RQR A;  1FMV A;  1H3Z A;  5AYF A;  3UA7 A;  5GMK l;  4RCB A;  1E7O A;  1Q86 U;  4C92 G;  2VGN A;  1NLP C;  1AEY A;  1D3B B;  4NS5 A;  4AFU C;  4WF2 A;  4AG2 C;  1QP3 A;  3CXC A;  5GMK h;  5FU7 B;  4PJO C;  1O9S A;  2DF6 A;  3VS7 A;  4FT4 A;  3V8J A;  2LX7 A;  5IH2 A;  1K4U S;  4Z89 A;  2E1H A;  4AG1 C;  2OAU A;  4F7U B;  1QCO A;  3CCL T;  1UDL A;  3V8K A;  2GQI A;  3PNW C;  2DRM A;  3MHX A;  4C8Q C;  2P0P A;  2RH2 A;  4M75 G;  2M16 A;  3CME A;  2EGC A;  3CPW P;  5LJ3 d;  2XMF A;  3VS5 A;  4IUP A;  1YP5 A;  3RKY A;  2YRC A;  1D1B A;  3MEU A;  1W6X A;  3CC7 Q;  4OMQ A;  4ZN3 A;  2DKG A;  3M56 A;  2COZ A;  1K8A R;  4LDY A;  4BDY A;  3CC2 T;  1JBM A;  3ZFJ A;  2A0F B;  1H92 A;  1VQ9 Q;  4JS5 A;  2EJF A;  4HA8 A;  4HCC A;  2MWO A;  1BI1 A;  2EYY A;  2FO0 A;  1FMK A;  2EQM A;  3P8H A;  1F1B B;  2JN0 A;  2ROT A;  4J9G A;  3C94 A;  4PLL A;  1VQL A;  1GXI E;  4PJO F;  3VS2 A;  1NEG A;  2XU8 A;  1M2V B;  1U3O A;  4OMM A;  1VQK T;  2C0O A;  4CC3 A;  3UT1 A;  4CC2 A;  1QVF A;  2P4T A;  2CP0 A;  5KCH A;  4C8Q F;  5KE3 A;  1VQM T;  4QQG A;  1YJ9 A;  2R57 A;  2GTO A;  3CMA T;  2RB6 A;  3CPF A;  2DL8 A;  3CD6 Q;  3INZ A;  3QSU A;  1N8R C;  3OYI A;  3M0T A;  1TUG B;  3H6Z A;  4P5N A;  1BK2 A;  3UA6 A;  4FW1 A;  2RQV A;  2JTE A;  3EFO A;  3C12 A;  4OGE A;  1JRI A;  1VQO A;  1MMG A;  2H8H A;  1TWB A;  4C5G A;  2LQK A;  3TVT A;  3VYG A;  1W70 A;  2JXB A;  1KD1 R;  3HRT A;  5CQY A;  3CCJ Q;  2LCC A;  2XDP A;  3S6W A;  2XK0 A;  4AT1 B;  1NE8 A;  1NJI R;  4N4G A;  4J6W A;  1YIJ A;  3BW1 A;  3THK A;  2WSF E;  4HT8 A;  2K79 A;  2EGA A;  2DA9 A;  4MML A;  3M54 A;  2QAZ A;  2LNH B;  4JJD A;  1BIB A;  3BDU A;  1B3Q A;  2YHT A;  4A4K A;  2HSP A;  1VQ8 A;  2FB7 A;  4M7A D;  2FZK B;  1PC0 A;  2A37 A;  2LC4 A;  3SWN C;  1NBE B;  3MP6 A;  4LUD A;  4J83 A;  2AT1 B;  2GQV A;  1UHF A;  2H3J A;  2HQH A;  2VUB A;  3HRU A;  3TSZ A;  3A1P A;  1K73 C;  4Q5W A;  3OYE A;  1YWP A;  1M8M A;  1EX4 A;  2DBK A;  4KGZ B;  1UB4 A;  3QBY A;  4NL2 A;  3M0S A;  3NTK A;  2HNI A;  3OBY A;  1DJ7 B;  2QQA A;  1K1Z A;  2DL3 A;  2PQW A;  2M1H A;  2VYT A;  3DB3 A;  1JO8 A;  5GAO r;  2KT8 A;  2HD0 A;  1IRE B;  2RO0 A;  2O9V A;  4DOW A;  3VUB A;  2DXC A;  4RMO A;  3MCA B;  4OMP A;  2Z0W A;  1R8O B;  1Z9Q A;  2V26 A;  3MO8 A;  2X35 A;  4XU3 A;  4FYX B;  3UPU A;  1YJN A;  4M7D D;  1UGV A;  2QGF B;  3D7S B;  1M9S A;  5GAO n;  4JUV A;  4BAC A;  3LGL A;  1RAC B;  3G4S Q;  4PJJ A;  1WHL A;  1XNI A;  2JZ2 A;  2L5Q A;  3OY9 A;  3FC3 A;  4A4G A;  4IUV A;  4ATO A;  1PSE A;  4PJO E;  1M3A A;  2HQE A;  2MI6 A;  4E7H A;  2YUQ A;  4Y28 E;  2X3X D;  4M7A B;  2EQI A;  3VU3 C;  3VKI A;  3CCU A;  1O75 A;  2YUP A;  2DIG A;  2PNI A;  1JXM A;  8ATC B;  2QEX A;  5J26 A;  1V29 B;  4IUQ A;  4FCY A;  1MHN A;  2EJ9 A;  1N9R A;  2DL4 A;  4C8Q E;  3QKJ A;  5EC7 A;  5J3B A;  1OZ2 A;  2JJ9 A;  2VGM A;  1Q7Y R;  1V76 A;  2CP6 A;  4D6W A;  5IXF A;  1WFW A;  5CIU A;  2XDD A;  3MEW A;  1I81 A;  2RHI A;  2YUN A;  4R56 A;  2LRQ A;  3BY7 A;  1ARK A;  3OB9 A;  3EGU A;  3OA6 A;  3CCJ T;  4EMK C;  4RTT A;  1IHV A;  3JCM c;  4C92 C;  5C6S A;  2AK5 A;  1OU8 A;  1G5V A;  1OU9 A;  2FRY A;  2RI2 A;  1XTD A;  3QO3 A;  4BE0 A;  3CCV Q;  1UEB A;  4XK8 E;  1MMN A;  2D8J A;  4DBQ A;  1WLP B;  2R5A A;  2KNB B;  4JRK A;  4DQ2 A;  1PNJ A;  2LP5 A;  3BFM A;  3T9N A;  2ZCF B;  1Y96 B;  2X4W A;  1WHJ A;  1LNX A;  2EYZ A;  1YCY A;  4FYW B;  2FZG B;  4KH0 B;  4M7D B;  2GFA A;  5A0G A;  2E64 A;  3N5B B;  2O31 A;  1IGQ A;  4M75 C;  1UGR B;  2BUD A;  2HEQ A;  1N8R U;  2CSQ A;  1AWW A;  3SDZ A;  2AIR B;  2JUF A;  3NPF A;  5I11 A;  1QQJ A;  2VVK A;  1AD5 A;  5A0D A;  1WDX A;  1ZSG A;  3CCE A;  3X24 B;  1VIF A;  1SRL A;  2JVV A;  3ASK A;  1K0S A;  1Y7X A;  3I55 Q;  2DZ9 A;  1X2Q A;  2CDT A;  4M78 C;  2NLU A;  3L1A A;  4RUG A;  2NUT B;  4C92 F;  2L0A A;  2LT4 A;  3M0Q A;  3GNF B;  3VS1 A;  1SG5 A;  3F70 A;  3CXC P;  1YIT A;  2E6N A;  2QK0 A;  1Q82 C;  2BZ8 A;  1W1F A;  2HSE B;  5DLQ E;  2RJC A;  1PCX A;  3OYF A;  1X75 C;  3UWN A;  2CT4 A;  2HDA A;  2QQB A;  1QW1 A;  4BD3 A;  1UG1 A;  2LQN A;  2L3R A;  2O4X A;  4LD9 K;  2JMC A;  1M3C A;  3JCM Q;  3VRY A;  2P84 A;  3MKD A;  1WXT A;  5FRM A;  4QQD A;  3JAM E;  5KYY A;  4M75 F;  1BYM A;  2DBM A;  3G4S T;  1ZSZ C;  1K9M C;  3EHR A;  4OMO A;  1QWF A;  1OX8 A;  1I5O B;  3EGX B;  1E6G A;  3OSV A;  2HAX A;  3L2W A;  4LDX A;  1NG2 A;  1AHJ B;  3HSB A;  4ZNX A;  2X51 A;  4JJC A;  3A8H B;  2RHX A;  2KDS A;  4A4H A;  4M78 F;  1GCQ A;  1WHH A;  2YSQ A;  1RLP C;  1D09 B;  4IUR A;  5CKD A;  1TTH B;  3BE3 A;  4XTY A;  1BIA A;  3A8O B;  1WHK A;  2R58 A;  3CCL Q;  5GJV B;  2ED0 A;  1N5Z A;  2OTJ A;  3ULR B;  5FU6 B;  4BY6 B;  2PVO B;  1JB0 E;  2K9G A;  1BBZ A;  2F69 A;  3JCM W;  1CKA A;  2RF0 A;  3V8L A;  1SSH A;  3LX7 A;  3MET A;  4EMK A;  3EFS A;  3CCQ A;  2JT4 A;  4C92 A;  3RMQ A;  5KYX B;  3NHN A;  3SEM A;  2RHU A;  5GAN 6;  2YRD A;  2K6D A;  3JV3 A;  4XQ3 A;  3O5Z A;  3PGG A;  3CC2 Q;  2RQT A;  3GNG A;  3Q1J A;  1QP2 A;  4KH1 B;  2D1X A;  2KSS A;  2RQU A;  2EGE A;  3EG1 A;  2EWN A;  4X34 A;  1KQ2 A;  3H0I A;  3CCR A;  3S3N A;  1B7T A;  2QG9 B;  4JLI A;  1C0M A;  5IAY A;  5KYU A;  4M75 A;  4XTU A;  1XQH A;  4XAX B;  3H0F A;  2RNA A;  3C95 A;  2RJD A;  1VQK Q;  1AOJ A;  3EFR A;  5GMK m;  2X4J A;  5DM7 R;  1X6G A;  1V1C A;  1PKS A;  2CGH A;  5GAN j;  3NFC A;  3I5R A;  4A63 B;  2DLP A;  2F2X A;  2K5I A;  2W0Z A;  3EG9 A;  2QDY B;  4ANJ A;  4M78 A;  3OS5 A;  4M77 D;  1Y71 A;  1PSF A;  5GMK j;  1AWX A;  4J9I A;  3JB9 J;  1H8K A;  1YWO A;  2PUO B;  1Q86 R;  1T3L A;  1VOM A;  3LLR A;  3OYH A;  1HD3 A;  3TRE A;  3LWI A;  4AFS C;  2FPD A;  3QII A;  3JB9 D;  1B34 B;  4PNO A;  1HXD A;  1I1J A;  1PD1 A;  3M53 A;  1QVP A;  5IN1 A;  4LDV A;  3SD4 A;  1MMA A;  4C5I A;  4HCK A;  1UGP B;  3G6E A;  4BI8 B;  4PKC C;  2EJG A;  1FXX A;  4HVU A;  1H3H A;  3UF4 A;  1D3B A;  5ECA A;  2NUP B;  2LJ3 A;  1NEB A;  1YHQ A;  3EG0 A;  2NYS A;  3A8L B;  1X43 A;  2BZX A;  3HP9 A;  3OYK A;  3VUZ A;  2V8J A;  4F7U A;  2K4Y A;  3KXT A;  4BE2 A;  3OYA A;  5CAI A;  4M75 E;  1K0X A;  1S72 A;  1UJ0 A;  2CH4 A;  2O2O A;  2MIO A;  5C0M A;  4WTO B;  3L2Q A;  1KK7 A;  3L2Z A;  2ZZD A;  3RMS A;  2ZPF B;  2X4Y A;  1YFN A;  1X01 A;  4WCI A;  2DJZ A;  1Q82 U;  1K9A A;  1SHF A;  3LH0 A;  3GOX A;  1RUW A;  3V7C A;  1WXB A;  1VQN Q;  3A8M B;  4HVW A;  4LXC A;  2HL3 A;  4D8D A;  2CZ0 B;  4VUB A;  5HKC A;  3MJX A;  2VC8 A;  4ZGE B;  2D0N A;  1VIE A;  2DNU A;  3I56 Q;  2DM1 A;  4C5E A;  2DVE A;  4QVD A;  2KQW A;  2CUB A;  4M77 B;  5GAM j;  1WX6 A;  1KC8 C;  2DIQ A;  3QWX X;  1Z9Z A;  1WQW A;  3M9Q A;  1VQ7 A;  4J9D A;  2K57 A;  1K9M U;  2EBP A;  3QDF A;  3M0U A;  1M2V A;  5GAN 7;  1VQ6 A;  1RAD B;  4KGV B;  3CBM A;  1X6B A;  1AT1 B;  4KRT A;  1RAE B;  1CKB A;  4M78 G;  4C0F A;  1VQ4 A;  3CBP A;  4XTZ A;  4OB3 B;  4IIO A;  3NGP A;  4II1 A;  1M90 C;  3FJ5 A;  5CR2 A;  1ZBJ A;  3G71 Q;  2DYI A;  4GLK A;  4DA4 A;  3E2U A;  2AZS A;  1IHW A;  2RA2 A;  2E65 A;  3VYH B;  3ZL7 C;  3GP8 A;  3CCS A;  2F2V A;  3GPL A;  4KUD K;  2IG0 A;  4RTY A;  4A54 A;  4EIK A;  2XG8 D;  1YBY A;  5M9O A;  3GBQ A;  4J6X A;  3HL8 A;  3QXE B;  1Q81 C;  2YDL A;  2C0T A;  1U06 A;  1ZX6 A;  3P8B B;  4ZTF A;  1R0B G;  4RG2 A;  1EFN A;  2FPF A;  4LD6 A;  1G3W A;  4F7U G;  5A2Q E;  4DBR A;  1OX9 A;  3QYG B;  4MDX A;  2LQ8 A;  2QQ9 A;  1S1N A;  3WVE B;  3CBO A;  4ZGD B;  2XKO C;  3JCM g;  2O01 E;  1YI2 Q;  3O8V A;  4FT2 A;  1KQS P;  2ZPB B;  2CZ6 B;  2L3P A;  3RKW A;  3L2U A;  3J80 E;  3HFN A;  3OYN A;  1NM7 A;  2E70 A;  1VQP A;  1TXQ A;  4M77 G;  2QTV A;  5CVI A;  2VKN A;  4M7D C;  2WSE E;  1IB8 A;  3P8D A;  1I07 A;  2I2L A;  2JNG A;  1HJD A;  2OTL A;  1KQS S;  1VUB A;  5LJ5 g;  3CC4 A;  4ME7 A;  4J9E A;  2KE9 A;  3OYY A;  3JB9 G;  4Y91 A;  4Y92 A;  2RI3 A;  4BDZ A;  1VQ5 A;  3HRS A;  2FHD A;  2HL5 C;  4XTW A;  4KT0 E;  2D8H A;  4PJN A;  3HTR A;  2GTJ A;  1SSF A;  3GLX A;  3URG A;  3SB2 A;  4OB0 B;  2RK2 A;  1RAI B;  1VQN T;  1TOV A;  2CS7 A;  2EQU A;  4OMN A;  3A98 A;  2Y90 A;  2FEI A;  2VB6 A;  3RNJ A;  2D0Q B;  3I56 T;  3JB9 H;  3CME Q;  2E6Z A;  3OQ5 A;  1BB9 A;  3M5A A;  4Z8A A;  1SHG A;  2EYX A;  4OB2 B;  1PD0 A;  1T0H A;  1WJS A;  3EGD B;  2CYZ B;  4M7D F;  2J06 A;  2LZ6 B;  2NWM A;  3M4G A;  3WVD B;  3QJY A;  3LWH A;  3R6N A;  2EFI A;  2K3X A;  3FB9 A;  2QYZ A;  3JCM f;  4PJO B;  5GMK i;  2ATC B;  3DLM A;  2KR3 A;  2HKQ B;  2JM8 A;  4AFQ C;  3CCR T;  4BI3 A;  2WSC E;  3VRZ A;  2FL7 A;  2LDM A;  4E6R A;  2DIL A;  2DXT A;  1UFF A;  5CKB A;  1VA7 A;  1VQL Q;  1QKW A;  3G71 T;  3CCM A;  1VYU A;  4C8Q B;  3EH2 A;  2MAM A;  5LJ5 j;  4M7A A;  5CKH A;  4RKU E;  4LDU A;  2RJE A;  5LJ5 f;  3MEV A;  4J6Y A;  4J8O A;  1YN8 A;  2SRC A;  2RN8 A;  1G2B A;  3OW2 S;  1MND A;  1YJ9 Q;  2E41 A;  5FU6 C;  1HK9 A;  4IKF A;  2DTO A;  3M0R A;  1GCQ C;  3OYL A;  4FSS A;  1GBQ A;  3OYD A;  1ABO A;  3REB B;  4PK4 A;  2QXF A;  1A0N B;  5HK3 A;  4JJN K;  2AZV A;  1B07 A;  1X2K A;  3UDC A;  2DEQ A;  1KC8 U;  4L59 A;  5AT1 B;  3RDV A;  1VQO Q;  3E9G A;  1YI2 T;  3OYM A;  1M1K C;  1C1A A;  1FMW A;  4HCB A;  2DO3 A;  2A36 A;  2LTO A;  2RJF A;  3G6E T;  1PHT A;  2Y4X A;  4OVA A;  1G83 A;  1D1A A;  1M30 A;  1N8R R;  2GFU A;  4IUT A;  2D6F A;  3QZ9 B;  1Y96 A;  2DXB A;  1YIJ Q;  5D6Y A;  1YHQ T;  1M90 U;  2DXU A;  4M7D A;  5FWC A;  5CKF A;  4ELZ C;  3OS2 A;  4J7I A;  4JJB A;  4C5H A;  5LJ3 j;  2EKH A;  1WIE A;  2V1Q A;  4F16 A;  1Y57 A;  2DL7 A;  1W4S A;  3MP8 A;  4NL3 A;  3OS1 A;  1NYG A;  2XD0 A;  4JRQ A;  2EYQ A;  1S72 T;  3MEA A;  1VQ8 Q;  3RES A;  2J7I A;  4V2S A;  5FRO A;  3MP1 A;  1X6O A;  1BKB A;  2V8I A;  3J81 E;  4JLG A;  2KMT A;  1PM3 A;  1I0C A;  5FRN A;  4O6J A;  5GAN 4;  2PZ1 A;  1KJW A;  1ZQ1 A;  4EMH A;  2NUT A;  1M2O A;  1KQS A;  2F1L A;  1HYO A;  1QKX A;  2K2V A;  1JU5 C;  5L8R E;  1GFC A;  1WHM A;  3FRN A;  3I9Q A;  3CME T;  4M7A G;  2DD4 A;  2HBW A;  1XJW B;  1D1C A;  2AHJ B;  4Z88 A;  1RAA B;  1TG0 A;  1K73 R;  1HSQ A;  3ER0 A;  2ZPG B;  4DBF A;  3SWN B;  1VQM A;  4MZT A;  1VYT A;  1ZBX A;  1G3S A;  1QMC A;  2CSI A;  1PWT A;  1IRX A;  1UEC A;  3CMA A;  2O88 A;  3EGX A;  2DYB A;  3OYB A;  1M8V A;  1YJN Q;  1RI0 A;  1TU0 B;  3NTH A;  2KVQ G;  2IIM A;  4DOV A;  2KRS A;  1VQL T;  3EG3 A;  3ME9 A;  4QT7 A;  5DLO A;  2EPD A;  2NUZ A;  5FU7 C;  2XHC A;  3V7R A;  1PKT A;  1QCN A;  1OOT A;  4QVZ A;  4ELY C;  3CCS T;  4N4H A;  1OEB A;  1T3S A;  1FYN A;  4F17 A;  1MGQ A;  4LNP A;  1YJ9 T;  1K73 U;  2DL5 A;  2WAC A;  1I8F A;  2ROL A;  4C0D B;  3HKS A;  2Y4Y A;  3CCU Q;  4M7D G;  3L2V A;  2VV5 A;  4OB1 B;  2PUK B;  2QEX Q;  3VS6 A;  4JRI A;  2DET A;  5GAO m;  7AT1 B;  1Q95 G;  1U8R A;  1OV3 A;  5GAN g;  4M77 C;  2R5M A;  1VQO T;  4FM4 B;  4RCC A;  5KYX A;  3OW2 A;  1MNE A;  2MF2 A;  2KAF A;  1NPP A;  1MV3 A;  1TH7 A;  2A3L A;  4XU0 A;  2ED1 A;  1BCM A;  2XDB A;  2BE9 B;  4L5G A;  4DEY A;  5D6X A;  3BDL A;  1YIJ T;  4N4I A;  2P0K A;  2OTL T;  1K8A C;  3EH1 A;  2X4X A;  2EQJ A;  4TVR A;  2DVJ A;  4F7U F;  1NZ9 A;  3QDR B;  1QVG S;  1I5L A;  3PMT A;  3X26 B;  1AVZ C;  5GAN 8;  5GJW B;  3PVL A;  2KRO A;  8AT1 B;  1VQ8 T;  2YRV A;  1W2B P;  4J9F A;  2QGG A;  1AWO A;  2H3E B;  2RM4 A;  3CC7 A;  1OI1 A;  3OSS C;  5IHK A;  1U1T A;  2DRK A;  3FDR A;  1RAB B;  2MMP A;  4M77 F;  4HXJ A;  4EMK B;  5D6W A;  4MDW A;  1XOV A;  3CCE Q;  1VQ9 A;  1GFD A;  4N0A C;  4HCZ A;  3GF5 A;  2C0I A;  2PVG B;  1W2B S;  4FYV B;  2E3I A;  4XTX A;  4EDU A;  2BIV A;  1M1K U;  4HT9 A;  1SF9 A;  2ECZ A;  3JB9 F;  1EZZ B;  1WXU A;  3PE0 A;  2KBT A;  2RI5 A;  1YIT Q;  1B34 A;  5GAN f;  2EAY A;  1E6H A;  2LJ0 A;  2L2P A;  1M1F A;  5EG2 A;  5GAN 3;  4RTU A;  2OX7 A;  5CCA A;  3QUI A;  4E47 A;  3JCM d;  5GAM g;  3HFO A;  1ZLM A;  4C92 E;  2NUP A;  1KD1 C;  3V7S A;  1AWJ A;  5I22 A;  2HBP A;  3CD6 A;  1OZ3 A;  2RHZ A;  1YJN T;  1NJI C;  3TU4 K;  2JOY A;  5HK0 A;  5KYW B;  1KQ1 A;  2MWP A;  3JSC A;  3WXM B;  2J6F A;  5LL6 S;  4KGX B;  1Q82 R;  3OBW A;  1JQQ A;  3A8G B;  2L8D A;  3DB4 A;  1WGS A;  2AKK A;  1R0C B;  4R0K A;  5LJ5 d;  2L3S A;  5CK9 A;  3OYG A;  2HCK A;  1WI7 A;  3CCJ A;  2RHY A;  3HHT B;  3JCM V;  3KUF A;  5GAN e;  1YNZ A;  2K2M A;  3CCU T;  5HCK A;  2QEX T;  3M59 A;  5GMK e;  2M9U A;  1TSF A;  1X27 A;  2KY9 A;  3RKX A;  1M3B A;  1ZHI A;  2W10 A;  4OGC A;  1K9M R;  1WNL A;  2V1R A;  1YJW A;  4RTZ A;  4M77 A;  3C4S A;  2OTJ Q;  5GAN h;  2MCN A;  1JXO A;  1KG1 A;  4M78 E;  5HY6 A;  1N9S A;  3JCM P;  4DBH A;  1IGU A;  3H9N A;  4KUL A;  1ZSZ B;  4YTL A;  3PFS A;  2J6O A;  2F2W A;  3CCQ Q;  2SEM A;  2HKN A;  3AT1 B;  1UTI A;  4QKU A;  2FPE A;  3FEO A;  2AKL A;  1PG5 B;  5CKE A;  3CEY A;  1M1G A;  5DY9 A;  1T0J A;  2LJ1 A;  3NTI A;  5GAM f;  1WHG A;  2DAQ A;  5GAO q;  3PIO A;  2EIF A;  4RTV A;  4NOY A;  4OMF B;  1BI0 A;  2K5F A;  4E7L A;  3ZBD A;  2B86 A;  3CCR Q;  4QQ6 A;  4C0Z A;  2CT3 A;  2ABL A;  4F7U E;  4M7A C;  5IHI A;  5I2M A;  1ABQ A;  1RLQ C;  4C0G A;  1KHI A;  3EAE A;  4O5V A;  2I0N A;  4EMG A;  4J9C A;  1WPY A;  4GLM A;  2A28 A;  3CCE T;  3CPW S;  2JS0 A;  3J7A F;  4B9W A;  1QVG A;  2LCS A;  1WZO A;  4HVV A;  4N0A A;  2RD1 A;  3PT9 A;  2P4R A;  3S3M A;  2IPO B;  2F5T X;  5CQX A;  4DEX A;  2LT1 A;  2K7A A;  4M77 E;  5GAM e;  3H0H A;  1YIT T;  4F04 B;  3G4S A;  1U1S A;  1AZE A;  1P92 A;  1Q7Y C;  2LQW A;  3CQT A;  1KHC A;  5IT9 E;  3HPW A;  1VYV A;  3QPH A;  2HZY A;  1K8A U;  2COW A;  2RMO A;  4PJO D;  5KCO A;  1GCP A;  4ORZ A;  1W2B A;  3JB9 I;  5GAM h;  4X1V A;  2G3R A;  4A53 A;  1BI2 A;  4IIM A;  2EVR A;  1BU1 A;  1UUE A;  2FYK A;  3AHU A;  3G6E Q;  2O9S A;  2ZGW A;  4FW2 A;  2PU9 B;  1D0Y A;  2F5K A;  4XU1 A;  2KEA A;  5D7U A;  3KFV A;  3JCM b;  4C8Q D;  4M7A F;  1I4K 1;  2GGR A;  2J6K A;  2DEU A;  2DX1 A;  1YHQ Q;  4F14 A;  1ZUK A;  4BUG A;  3REA B;  2CP3 A;  4QW2 A;  4JZ4 A;  2GBQ A;  1QWE A;  4E2F B;  2FZC B;  3EFO B;  1D0Z A;  1LOJ A;  4RTW A;  2ZAE A;  4E7S A;  1S72 Q;  4E7J A;  3OYC A;  3JCM J;  1UGS B;  3U23 A;  2A08 A;  3LH5 A;  2DJQ A;  3M58 A;  4CC4 B;  3CCV A;  1YJW Q;  2OTJ T;  3M55 A;  2JS2 A;  4X9D A;  3EGD A;  3I5S A;  2QQS A;  2MYS A;  2YWW A;  2DE0 X;  4PL6 A; 
#chains in the Genus database with same CATH homology
 1V76 A;  1TSF A;  2ZAE A;  2KI7 A;  1OQK A;  1TS9 A;  1PC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...