2ZAEA

Crystal structure of protein ph1601p in complex with protein ph1771p of archaeal ribonuclease p from pyrococcus horikoshii ot3
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
GSYQEIIGRTWIFRGAHRGRVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGDRIWKVPKDVSIFEFEADDGTKIKIPGERLVGRPEMRLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an archaeal homolog of the human protein complex Rpp21-Rpp29 that is a key core component for the assembly of active ribonuclease P.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
molecule keywords Ribonuclease P protein component 1
total genus 24
structure length 105
sequence length 105
chains with identical sequence C
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2007-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01868 UPF0086 Domain of unknown function UPF0086
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.210 Mainly Beta Roll SH3 type barrels. Ribonuclease P/MRP, subunit p29 2zaeA00
2ZAEA 1TS9A 1PC0A 1V76A 2KI7A 1OQKA 1TSFA
chains in the Genus database with same CATH superfamily
2RQRA 4XTYA 3I5RA 2M9UA 4PJOB 4VUBA 2QTXA 1VQ5Q 3HRSA 4IIOA 3A8OB 2LQ8A 2D1XA 2QA4A 4PLIA 1M90U 1TS9A 4B9WA 1M1KR 2KAFA 5KYUB 1N8RU 3T9NA 3CCLQ 5I21A 4RTVA 1Q86R 2QA4T 3F70A 1G3SA 1RLPC 1YIJA 4XTVA 1BU1A 5J26A 2VGNA 5HKCA 4C8QB 1B34B 4JLGA 1QCFA 1UFFA 1NLOC 1WA7A 3JRZA 4F7UA 2KT8A 4M7DA 2KGTA 1TXQA 1R0BG 1M1GA 1H3HA 4MDWA 5CKFA 1Q82R 2KK4A 1UUEA 3ASKA 2QEXA 3JCMf 3P8DA 1KHIA 4NL3A 5KYXA 3FEOA 2E6ZA 1HJDA 3TU4K 1G2BA 3NHNA 2K6DA 2DMOA 4JJBA 3WVEB 1YNZA 1ZUYA 2DYBA 2V8IA 1K76A 3LH5A 1M2VA 2JMAA 1VQ6Q 4E7LA 2E12A 4KUDK 4EMKA 5GANf 4RTUA 3SB2A 2IIMA 2GF7A 5GAMj 2KBTA 1G3YA 1W2BS 3JB9H 4RKUE 1MGQA 3TEEA 4R56A 1Q86U 5D6WA 1ZBXA 1VQLQ 3QDFA 1RL2A 4F14A 1MNEA 2LJ1A 2AZSA 1OU8A 2QEXQ 3FRNA 1JJ2P 3MEAA 1VQNA 3I55T 3JB9G 3UATA 5GANh 3BFMA 3THKA 2LCSA 4D6WA 1ACMB 3CCRT 1LCKA 2KQWA 1KIKA 1D0YA 4JZ3A 1VQ4A 1HK9A 1VYTA 2ZGWA 4MMKA 1OPKA 4A4KA 3VS0A 1MMDA 1VQ6T 2RJEA 5CR2A 4NOYA 2JTEA 4RMOA 3MEVA 1BCOA 3X28B 4ZTFA 4PJLA 2XDPA 3CCVQ 3LX7A 1CKBA 2A7YA 2QI2A 2NUTA 1PCXA 2OAUA 2FZCB 2KVQG 1RAFB 4ZNXA 2JW4A 3JB9J 1QW1A 4X9DA 2DFUA 8AT1B 4QQDA 2K5FA 4KBMB 4N0AA 4QVZA 5LJ3f 3BW1A 2CH4W 4C8QC 3CCLT 4RUGA 1OI1A 3EGXB 4RTXA 3L1AA 1LVKA 3PVLA 3EH1A 4E7KA 3J80E 4KGXB 2LRQA 2X9HA 2FHDA 4MZMA 2DIGA 1K4US 2KR3A 3A8GB 4J6WA 2CZ1B 2D6FA 2R5MA 1WHLA 1GBQA 3CCQT 4BDYA 4C92E 4M78C 2CUBA 3MP1A 2DRMA 2YUNA 1JQQA 3PNWC 4M77A 4PJOC 1YJWQ 2CH4A 2CSIA 3VYHB 4DBRA 3SD4A 4ZGJB 1X2KA 1YCSB 2ZPBB 5I2MA 4FYYB 4ESRA 5GAN4 3M54A 5FROA 2RN8A 2KDSA 2ZPFB 4EMHA 3FDRA 5GAN8 1W6XA 2XHCA 5FU6B 2JNGA 2KNBB 2DO3A 3LH0A 3SEMA 1K8AC 2CP7A 4GLKA 2DL7A 3CMAA 2M1HA 1YJNT 4FCYA 3OYKA 1I1JA 2FEIA 1B7TA 2FPFA 1WXBA 1S72A 4V2SA 4C8QA 1F1BB 1WQWA 3CPWS 3QUIA 2J6FA 5CQXA 2O88A 1PG5B 3LWHA 1H8KA 4LE9A 1NEBA 1UDLA 1Y96A 5LJ3g 2LQWA 1M90R 2M02A 2JTMA 2CP3A 1WJRA 2RQUA 2NUPB 2LP5A 4D8DA 3OYGA 1RABB 2COZA 2KMTA 2I2LA 3CD6A 3HKSA 3VKIA 3UWNA 5C6SA 1D0XA 3OS1A 4M75G 1AZEA 3E9FA 4F16A 2HD0A 4XAXB 4C8QF 2JXBA 4HVVA 2QGGA 2FB7A 3L2RA 1SSFA 1K0SA 1M1FA 3INZA 4J7IA 1M1KC 2D0NA 1GCPA 3CEYA 1YJNQ 4FSXA 4FIBA 1QVFA 3GPLA 4M77D 1KQSP 3CD6T 4M7DG 1KFZA 1C1AA 1YCYA 1OEBA 1VUBA 2ZZDA 1IHVA 1AWOA 2J6KA 1MV0B 3OYIA 1FMWA 2BIVA 1WZOA 1VQNT 2OTJT 5KYWB 2DVJA 3TSWA 4LDVA 1BCMA 3CPFA 5IXFA 3R6NA 2QK0A 2M16A 1X2QA 3CCMA 1AEYA 4CI0C 3OYBA 2HDAA 4M75A 2E1HA 2LTOA 1BB9A 2YUOA 5EG2A 1S1NA 3CCLA 3CC7T 1H3ZA 4PJJA 1K73C 3RIRA 4HT8A 1SPKA 4A53A 4AG1C 4ZN1A 2QDYB 2KT1A 2L2PA 1RI9A 4C0DB 3M58A 4X34A 1OX8A 4DQ2A 3CMEQ 2EQMA 1UJ0A 3RESA 1AD5A 1ZUUA 3O8VA 4M7DE 1MMAA 4CC2A 5LJ3e 4TVRA 4DOWA 2E5QA 5KCHA 3L2VA 3OYDA 1RAEB 1O9SA 3Q1JA 4II1A 3QZ5B 2EJGA 4ME7A 5CKHA 3HTRA 1ARKA 4ZGEB 2IVWA 1OQKA 4M77F 3M55A 1N5ZA 1UJYA 3CBPA 3EAEA 5FWBA 4E7JA 4M7AE 1ZSZB 1VYUA 1M3BA 2NLUA 4M75B 3S6WA 1EZZB 1ZUKA 2E4HA 2FRYA 2C06A 1OOTA 4P5NA 4LDYA 3RERA 2F5TX 1JJ2S 4M78D 1E6HA 1TG0A 5CK9A 1DJ7B 1MMNA 2MWOA 2CDTA 2NWMA 3OW2A 1S72Q 2L5QA 1P92A 2RQVA 2JVVA 1K8AU 1Z9ZA 4BE1A 1GXIE 1RAAB 5GAN7 1FMVA 5GAN5 1OULA 2CZ7B 4FT2A 1KC8U 4M7DF 2OTJQ 1TSFA 3JCMX 1GL5A 2K57A 2V26A 1YBYA 4M77C 2QTVA 2EJFA 4BB7A 2X4XA 4X1VA 1EIFA 2C0IA 5I11A 3X20B 4M75C 3L2ZA 3BDUA 4EPCA 2PVDB 2KRSA 4J9CA 1MV3A 1KD1R 4XTXA 2VXFA 4RTZA 1RAGB 2EQIA 2ZPHB 2F2WA 5CKBA 3VYGA 2VUBA 4C0GA 2E41A 2DL8A 3A5ZB 3G71A 4AMCA 3CCST 4PJOD 1YITA 3TSZA 1U1SA 3CCET 3FJPA 1JBMA 3M53A 3JCMV 2CS7A 2VWFA 3G71Q 1WJSA 1T0HA 2BE9B 2EBPA 4HCKA 5IHNA 2W10A 2RM4A 3WVDB 2IPOB 4A63B 2VB6A 4N4GA 2CP0A 2LQKA 1OZ3A 4QT7A 4OVAA 4BY6B 4CC7A 4LDXA 5FU6C 1T3LA 1W2BA 2PVGB 1BBZA 1PWTA 1SHFA 2K2MA 4AFQC 4L5GA 2MWPA 2D9TA 3HL8A 1AWJA 4XU2A 5GAOn 1TOVA 2CUDA 4IUPA 3CC7Q 3X26B 1K1ZA 4EMKB 3PIOA 2HQHA 5I2SA 2LCCA 4Y91A 1M9SA 1TUDA 4M78B 1M2VB 1SSHA 1K73U 1ZA2B 1QKWA 2DRKA 7AT1B 2V1QA 2EPDA 2RO0A 2DE0X 4RTWA 3CQTA 1PNJA 1Q82C 2COWA 2EYQA 1CSKA 3QWYA 3QPHA 2CP2A 2NUPA 3H8ZA 4FSSA 4XK8E 4B9XA 8ATCB 4M78E 3LGLA 1T0JA 5GAOp 4EMGA 4YTLA 4ZTJA 1GFDA 1XNIA 2DPPB 1ZBJA 2RQWA 2C0TA 1PD1A 1B07A 2K2VA 2OJ2A 1N9SA 1LPLA 3G4SQ 2A3LA 1WX6A 5L8RE 3QBYA 2F1LA 3R6OA 3ULRB 1VQ5A 3MPUB 3SWNA 4PJOE 3MP8A 4KULA 4M78G 3QSUA 2F5KA 1WHKA 4C92C 2RF0A 4CC3A 3EFRA 4RCCA 2DVEA 2YRCA 3MEUA 3MEWA 4OMOA 4OMFB 5D7UA 1U1TA 2SRCA 5CQYA 2VYTA 5M9OA 4M7DD 5DY9A 3HFNA 1AVZC 1K0XA 2OX7A 1ZSGA 1BIAA 3L2UA 1KQSS 2V8JA 5IAYA 3RBBB 3M0UA 5GMKj 3JB9F 3CCJA 2PUOB 4HCZA 4PJOA 2PTKA 3QYHB 3G71T 4LDWA 4J6YA 3CPWA 2GCXA 2M0YA 5GMKm 2A37A 1JXOA 1D1AA 3EGDA 2BTTA 1D0ZA 4PJOF 2BZXA 4OF1A 4M7AC 3LWIA 3CCQA 3CMAQ 1VQ4T 4O5VA 1X69A 4IUQA 1YITQ 1VQ7T 1BI0A 3CC2T 4FT4A 5LJ3j 1V29B 4IUTA 1KSWA 3G4ST 3OSVA 1RACB 1BI1A 4L59A 3OYAA 2JT4A 5FRNA 1Q7YC 3BY7A 1I4K1 5GAOq 2D8HA 4C8QD 4Y92A 4HCBA 5KYWA 2QA4Q 1UE9A 1KD1C 2RJCA 3CMAT 3G6ET 3RDVA 1VA7A 5CCAA 1J3TA 1S72T 4M78A 1QQJA 3QJYA 4BE2A 1ZQ1A 1NYGA 2MI6A 2MAMA 1R8OB 3U23A 2YRVA 2D0QB 3CCVA 2MIOA 1PC0A 2EIFA 3G6EA 4PLLA 3C95A 4N4IA 5D6YA 2JN0A 4KH0B 1ZSZC 5HK3A 4J9IA 2OTLA 4F7UG 2FPDA 1VQPQ 3G6EQ 3UPUA 2XI9A 3KFVA 1VQKQ 1IB8A 2XDDA 3CCVT 3CCJQ 5GAN6 1UGSB 1KD1U 2RB6A 2ZPIB 3JCMe 2KYBA 1GCQA 2WACA 3KXTA 2L89A 3DKMA 4RG8A 4MZTA 2V1RA 1M5Q1 1K9MC 1R77A 1Y0MA 2LMJA 1YITT 3GNFB 4JJNK 1VQLA 4ATOA 1OX9A 2H3EB 1PRMC 4IIMA 1HD3A 2EJ9A 2E64A 1YJ9Q 1VQMQ 5GAMf 4EMKC 3JV3A 4JS5A 2DX1A 1KC8R 4M7AF 1I5LA 4KGZB 4J9DA 4J9EA 1K9MU 3NTIA 2RQTA 2E70A 1FX7A 2E6NA 2K9GA 2EAYA 2AT1B 2JS2A 2NYSA 3X25B 5GMKi 2K7AA 2EYZA 4C0ZA 3A8LB 1VQLT 2DBMA 3OA6A 4PJOG 2L3PA 3VS4A 1G83A 3CCMT 5CVIA 2FZGB 2P0QA 3OW2S 2EQUA 1LJOA 4ELZC 2E3IA 4OGEA 2K79A 1RAHB 1GFCA 1K9AA 2JJ9A 1YI2A 4JLIA 4M78F 4AG2C 1BYMA 3PE0A 4BDZA 1SF9A 2CP6A 3CCMQ 1WNLA 4LXCA 3EG1A 2K3XA 3H41A 5IXBA 3NGPA 2FVUA 3JCMc 3JCMh 3I55A 1NBEB 3URGA 1SEMA 4HKEA 4D8KA 3SHWA 3FC3A 4XU1A 2QGFB 3A8HB 9ATCB 2HZYA 2DTIA 1M1KU 2LDMA 2BKDN 3ZBDA 3EHQA 3OQ5A 3HFOA 1VQ7Q 4J9BA 1Q81C 3H0HA 5GAMg 2JS0A 1M4ZA 3PFSA 3VRYA 3NMZC 4FM4B 2P0PA 3GP8A 1E6GA 1KC8C 2A08A 2RHUA 2QYZA 5KYXB 2AKLA 3J7AF 1MHNA 3TVTA 2MOXA 2ZPEB 3DB3A 2FL7A 2RJDA 3VS2A 4M7DC 1YWPA 2KRMA 2EWNA 3QDRB 1YJ9T 4WF2A 2F2VA 4OMMA 5C0MA 2J6OA 4E6RA 4OP0A 2EQJA 3UDCA 4DA4A 3EH2A 1ABQA 1M3AA 2RHXA 1CKAA 1VQ9A 3S3MA 4PL6A 4RTTA 4JUVA 1QLYA 1QMCA 3MHXA 1V1CA 1TU0B 1WPYA 2DXUA 3S3OA 4OGCA 2HEQA 2HKQB 4JJCA 1RAIB 3OSSC 1M30A 1KQSA 4F17A 3OYEA 3P8HA 4RTYA 1SHGA 3CC4A 3QHSA 2E10A 2B86A 1QWEA 2OAWA 4Z88A 3QKJA 4BI8B 5GMKl 1VQ7A 2L0AA 2RD1A 3HRTA 5A0LA 4OB2B 1U8RA 4DEXA 2K3BA 3M57A 2QQ9A 2MK5A 2DL3A 1V76A 3JCMJ 4PFZA 3JCMg 3FJ5A 4UC4A 1PKTA 5A2QE 2YXYA 1WJQA 1QCOA 3ZL7C 4C8QG 4JS4A 2D8JA 1N8RC 1IGQA 2QQSA 1IHWA 2CREA 3GOXA 2RHIA 4WTOB 2FYKA 3RR6A 1FYNA 2HAXA 3UT1A 3A98A 5GAMh 1YHQT 4QKUA 1KHCA 2COYA 5GAOr 5IN1A 3M0RA 3CC4Q 1YI2Q 2HQXA 4E7HA 1U06A 5FLXE 3DLLA 2KE9A 1A0NB 4XQ3A 1U5SA 3L42A 1ZA1B 2AIRB 4HXJA 2G6FX 4PKCC 1M2OA 1Q86C 3JCMb 2AZVA 1MMGA 5FU7C 3EFSA 1ZX6A 2O2OA 5GAN2 1VQ9Q 4M7AB 1X43A 3I55Q 1M27C 3AT1B 1HXDA 1EFNA 2EVRA 4PNOA 3EGUA 4E7ZA 4KGVB 3EGDB 2BZYA 4PK4A 3QXEB 5IT9E 1VQ4Q 3BE3A 4DOVA 4DBFA 1YJWT 5KH6A 1QP3A 4O6JA 3V7CA 1UTIA 4C5IA 2EYWA 5CO7A 3AHUA 3CPWP 1QVGS 2NUTB 1GCQC 3EFOB 2PUKB 1Y71A 3C94A 2F2XA 2HBWA 2CP5A 4JZ4A 1G5VA 1TH7A 3JCMW 2J7IA 2QXFA 3VRZA 1VQ8A 2HCKA 2DEUA 3CCSA 2HQEA 2HNIA 2BE7D 2V8KA 1MNDA 2KEAA 1VQ9T 3CBMA 3GLXA 4BE0A 4LNPA 2GTOA 5A0GA 5FW9A 2DERA 4C92B 2JTFA 1VQ8T 3RKYA 3PMIA 4FU6A 1OZ2A 3QO3A 3EG9B 2LNVA 3OB9A 1WYXA 1UG1A 3VUZA 2RMOA 1UGQB 3OBYA 2RI3A 2L3SA 2FO0A 5GMKh 2O31A 2HL5C 2DD4A 1MUZA 2EFIA 4DBHA 3E1SA 3S3NA 5LJ5j 1O75A 1BI3A 4C8QE 4M77B 3EHRA 2RHZA 1M8VA 1UGPB 3I56A 4F04B 1FWZA 5IH2A 2DF6A 2DIQA 3NTKA 4Z89A 5KE3A 2P4TA 1AWWA 4FL6A 4M77E 2JMCA 5FWCA 1JB0E 1I81A 2P84A 2SEMA 3FB9A 5HK0A 3CC4T 4EIKA 1XQHA 2R58A 3I9QA 3RMSA 3M0TA 1XJWB 3EGXA 1M90C 1JRIA 2EGEA 3MJXA 1YWOA 2DKGA 1NJIR 3TREA 2DK3A 3UA7A 1K8AR 4N4HA 2DTOA 5KYUA 1VQMA 3NPFA 1U3OA 4GY5A 4QVDA 1OV3A 2HSEB 3NTHA 1WI7A 3D7SB 4A4FA 4M7AA 1NEGA 4NL2A 5GANg 3QYGB 2RI2A 3HRUA 3VS3A 5L23A 4BY6C 3CCSQ 2K3YA 4C92G 3VS6A 2X3WD 4BUGA 2LJ3A 2O9VA 1WDXA 4C5GA 1Q7YU 2OTLT 1D09B 2X4WA 2LJ0A 3M0PA 4CC4B 4GLMA 1YIJQ 5GAOm 2MYSA 4B6MA 3RMQA 2YHTA 2JOYA 1RADB 1BI2A 3VJPA 3VU3C 1QCNA 1R0CB 2ROTA 3META 1AZGB 5IHKA 1WHMA 3L2QA 4J5YA 5LJ3d 2O9SA 5CAIA 2EGAA 2VASA 2W0ZA 3LW5E 4ORZA 4F7UB 2EKHA 5KE2A 5AYFA 2CSQA 4LN2A 3LYIA 1UEBA 1VQNQ 3FIFA 2PQWA 2VKNA 1Y96B 4CRIA 3P8BB 3X24B 1I0CA 4HVWA 3JB9I 1RLQC 2DEQA 3KBGA 3E2UA 4R0KA 2H3JA 1KQ1A 2WSEE 4RCBA 3TQ7P 1OU9A 4KH1B 1K9MR 3JCMQ 2ED1A 2PZ1A 2IG0A 4XTZA 3O5ZA 1EX4A 2DETA 5ECAA 3H0IA 3PVQA 2ATCB 3QIIA 3MP6A 4OB0B 4J9GA 4IKFA 1PRLC 2HL3A 3CMEA 2MF2A 1ZHIA 4J7FA 3ME9A 2CGHA 3VUBA 3CCRQ 3BDLA 5GANe 1E7OA 1ZLMA 3M5AA 2VGMA 2JZ2A 2KSSA 2YUQA 4JRKA 4AT1B 1NYFA 3V8KA 3OW2P 2X4YA 4RG2A 5GAMe 2I0NA 4E2FB 4R55A 2CYZB 3M0SA 4N0AC 1NPPA 3HP9A 4OMPA 5GJWB 1X01A 3I56Q 2CT3A 1PSFA 1VQPA 3CCUQ 2XIDA 1D1CA 4NS5A 2LT1A 1WHGA 5LJ5h 1VQOA 2GFAA 2AHJB 4XTUA 4HA8A 2XDBA 3G4SA 1Q82U 2M51A 4X9CA 3CCEQ 2DTHA 4J6XA 1FXXA 1VQPT 3CCRA 2E65A 2WSCE 2X3XD 3CCUT 3H9NA 3OMCA 4F7UF 2LX9A 5LJ5f 4OB1B 3VS7A 1FMKA 3MCAB 3VV0A 1VQKA 3JCMd 2H8HA 1QP2A 2QQBA 2BZ8A 5CKEA 1SKUB 5LJ5d 3V8JA 3EG0A 1YN8A 2O4XA 1HSQA 3CCUA 2RHYA 4HT9A 1G8XA 3L2WA 5GMKe 4LD9K 1N8RR 1H641 2XICA 2RK2A 2MPXC 4A4HA 4J83A 4OMNA 1QWFA 1TWBA 4KRTA 2YWWA 2GQVA 3OYHA 1AT1B 3NFCA 5KYYB 1PKSA 4M75F 2GBQA 1X6OA 3V7SA 4KUIA 1PM3A 1X75C 2EGCA 5EC7A 1IGUA 5D6XA 4AFZC 4LDUA 3I56T 3CD6Q 5DM7R 2CZ0B 3HPWA 1NG2A 1KQ2A 1N6AA 1IRXA 3PT9A 1QVFS 5DLQE 1VQOQ 2KROA 1B3QA 2DXBA 2ENMA 3I35A 3G1JA 1TUCA 2MMPA 2P4RA 4OB3B 4A4GA 3E9GA 3MO8A 1QKXA 1VQ6A 2A36A 3RKWA 3EG3A 3JCMP 3RUXA 3HSBA 2ECZA 4WCIA 5GAN3 5J39A 2LVMA 1Q7YR 1W4SA 3OMGA 4J8OA 2KI7A 2QEXT 2AK5A 1D1BA 1YJNA 4PJMA 3LLRA 4Y28E 3CCQQ 1TUGB 1BK2A 4M75D 4K11A 4JJDA 1NE8A 2LQNA 4J9FA 3TCJA 1QVPA 1UGRB 4M7AG 3C4SA 4E47A 1WGSA 2X4JA 4C92A 4LUDA 4FW1A 4JRIA 3ZFJA 2F69A 2QQRA 2RI5A 4FYWB 1JU5C 2Z0WA 3A8MB 3EG9A 5IHIA 2C0OA 1YIJT 4LD6A 3RNJA 4QVCA 2GFUA 1YJ9A 1B34A 3CMET 1NJIC 1BKBA 4Z02A 1I8FA 4JRQA 3JAME 3GBQA 4XTWA 3SWNB 2DNUA 4A4EA 2PU9B 4HCCA 2XU8A 1YP5A 1PSEA 2YLBA 1X27A 4ZGDB 2YRDA 4Z8AA 4BI3A 2VV5A 1OPLA 1ZSZA 1ABOA 5GAOl 6AT1B 2B8AA 3CCEA 3C0CA 1IXDA 4QW2A 1Q81R 2OI3A 4BACA 1UGVA 2RPNA 2CKKA 1VQKT 4JRPA 3QG1A 3EG2A 3J81E 4FW2A 4BD3A 5LJ3h 3CXCP 1AWXA 1VOMA 1GBRA 1VIEA 2GGRA 4MDXA 1IO6A 1YHQA 5A0DA 2VXEA 3OYYA 2KXDA 2KRNA 3CXCS 1GRIA 2Y4XA 1N27A 1UHFA 2RJFA 1NLPC 2DLPA 1NJIU 2JUFA 5HCKA 1KK7A 2XD0A 1WIEA 3QJ6A 4DBQA 2DD5A 2K4YA 4DEYA 2DYIA 5GANd 2LT4A 1M8MA 3GNGA 1BIBA 2XKOC 1UECA 4FYVB 3PMTA 2DM1A 2L3QA 1Y57A 3SWNC 3M56A 3OYFA 5KCOA 2DXTA 1W2BP 3QWXX 4OMQA 2P0KA 1SRMA 3MKDA 2K5LA 2AKKA 1VQOT 2KY9A 1WXTA 1QVFP 4C92D 5DLOA 3M4YA 3FLGA 1C0MA 1X6BA 2DL4A 3CBOA 2LX7A 4XU3A 4F7UE 3OS5A 1WXUA 5CKDA 4HVUA 2LC4A 2G3RA 1XTDA 2ED0A 1Y07A 1UHCA 2KYMA 3CXCA 4BI4A 1Q81U 3CC7A 3HHTB 3DLMA 2VVKA 3JB9D 2HMAA 2RH2A 1Y7XA 1JJ2A 1W1FA 1XOVA 2LCLA 4FYXB 1K73R 2HBPA 4KT0E 2DL5A 1IREB 5LJ5e 4AFSC 1TTHB 1VYVA 2A0FB 1QVGP 1JO8A 3WXMB 2ZAEA 2CT4A 1NZ9A 4EDUA 1G3TA 4XU0A 1AOJA 1W70A 1NM7A 2OTJA 4C0FA 1WHHA 2GTJA 2ABLA 2ROLA 5LL6S 2EW3A 1G3WA 4JDSA 2DZCA 2DZ9A 3LGFA 3PGGA 3I5SA 1OYXA 2Y4YA 1T3SA 2YLCA 4PFPA 3VS1A 3OYLA 1KG1A 3PTAA 3UF4A 3V8LA 3GIBA 4PJNA 1RI0A 4MZPA 5HY6A 2EYXA 3REAB 2K5IA 5J3BA 2YUPA 3C12A 3M0QA 1AHJB 1PHTA 2HSPA 1KJWA 4JPBW 3OS0A 3EFOA 4AFUC 2RNAA 3CC2Q 3A1PA 1YFNA 2QASA 4OMLA 4ANJA 2DXCA 4C5HA 1LOJA 2LZ6B 3SFMA 2QDLA 2YSQA 2YT6A 2FRWA 2O4XB 5CIUA 1C6VX 2X51A 2ZPGB 2VC8A 2EQKA 3REBB 4ZN3A 1YJWA 5LJ5g 1QVGA 1UB4A 1VQ5T 3RKXA 2J05A 2JM8A 2DA9A 2DJZA 2X35A 4C5EA 2E5KA 4M7AD 4GBQA 4C92F 1NPRA 2DJQA 1WLPB 2KXCA 4QQGA 1VQ8Q 1WQ7A 2EYYA 1VIFA 2RA2A 3M9QA 1N9RA 2DAQA 1D3BB 3OY9A 2QG9B 3JSCA 5FU7B 3GF5A 3OYNA 3ZEHA 2XMFA 3E19A 4J9HA 4Q5WA 1D3BA 4IURA 2HKNA 4QQ6A 4M7DB 5GJVB 3PIPA 1M3CA 4MMLA 2RK1A 2XK0A 3H0FA 2GQIA 4A54A 3VS5A 2PNIA 2R5AA 4M77G 4E7IA 4L6V5 3CCJT 2A28A 5I22A 2WSFE 2QQAA 3DB4A 3UA6A 2BUDA 2LNHB 3OBWA 4IUVA 1Z9QA 3KUFA 5GANj 3OYCA 4LUEA 1RUWA 2O01E 3ER0A 2FPEA 5KYYA 3QZ9B 2PVOB 2QAZA 2L3RA 4ELYC 2J06A 2CZ6B 4M75E 1X6GA 1YHQQ 3OYJA 3H6ZA 1JEGA 3V7RA 3N5BB 2XG8D 3IQLA 3CC2A 1LNXA 2E3HA 1YI2T 5KYNA 5GAMd 1H92A 2FG0A 2M0OA 2MCNA 3G7ZA 1HYOA 1WHJA 2ESWA 1Q95G 3SDZA 2L8DA 1IZ6A 3OYMA 1JXMA 2Y90A 2GNCA 4PFOA 5AT1B 1I5OB 1SRLA 4IUUA 1I07A 2ZCFB 2YDLA 5FRMA 3M4GA 2OTLQ 4C0DC 2FZKB 2JM9A 4E7SA 2NUZA 1VQMT 2R57A 2DILA 1PD0A 2EKOA 3M59A 1SG5A 4M4ZA 1WFWA 3OS2A 2DBKA
chains in the Genus database with same CATH topology
2ZAEA 1TS9A 1PC0A 1V76A 2KI7A 1OQKA 1TSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZAE A;  1TS9 A;  1PC0 A;  1V76 A;  2KI7 A;  1OQK A;  1TSF A; 
#chains in the Genus database with same CATH topology
 2RQR A;  4XTY A;  3I5R A;  2M9U A;  4PJO B;  4VUB A;  2QTX A;  1VQ5 Q;  3HRS A;  4IIO A;  3A8O B;  2LQ8 A;  2D1X A;  2QA4 A;  4PLI A;  1M90 U;  1TS9 A;  4B9W A;  1M1K R;  2KAF A;  5KYU B;  1N8R U;  3T9N A;  3CCL Q;  5I21 A;  4RTV A;  1Q86 R;  2QA4 T;  3F70 A;  1G3S A;  1RLP C;  1YIJ A;  4XTV A;  1BU1 A;  5J26 A;  2VGN A;  5HKC A;  4C8Q B;  1B34 B;  4JLG A;  1QCF A;  1UFF A;  1NLO C;  1WA7 A;  3JRZ A;  4F7U A;  2KT8 A;  4M7D A;  2KGT A;  1TXQ A;  1R0B G;  1M1G A;  1H3H A;  4MDW A;  5CKF A;  1Q82 R;  2KK4 A;  1UUE A;  3ASK A;  2QEX A;  3JCM f;  3P8D A;  1KHI A;  4NL3 A;  5KYX A;  3FEO A;  2E6Z A;  1HJD A;  3TU4 K;  1G2B A;  3NHN A;  2K6D A;  2DMO A;  4JJB A;  3WVE B;  1YNZ A;  1ZUY A;  2DYB A;  2V8I A;  1K76 A;  3LH5 A;  1M2V A;  2JMA A;  1VQ6 Q;  4E7L A;  2E12 A;  4KUD K;  4EMK A;  5GAN f;  4RTU A;  3SB2 A;  2IIM A;  2GF7 A;  5GAM j;  2KBT A;  1G3Y A;  1W2B S;  3JB9 H;  4RKU E;  1MGQ A;  3TEE A;  4R56 A;  1Q86 U;  5D6W A;  1ZBX A;  1VQL Q;  3QDF A;  1RL2 A;  4F14 A;  1MNE A;  2LJ1 A;  2AZS A;  1OU8 A;  2QEX Q;  3FRN A;  1JJ2 P;  3MEA A;  1VQN A;  3I55 T;  3JB9 G;  3UAT A;  5GAN h;  3BFM A;  3THK A;  2LCS A;  4D6W A;  1ACM B;  3CCR T;  1LCK A;  2KQW A;  1KIK A;  1D0Y A;  4JZ3 A;  1VQ4 A;  1HK9 A;  1VYT A;  2ZGW A;  4MMK A;  1OPK A;  4A4K A;  3VS0 A;  1MMD A;  1VQ6 T;  2RJE A;  5CR2 A;  4NOY A;  2JTE A;  4RMO A;  3MEV A;  1BCO A;  3X28 B;  4ZTF A;  4PJL A;  2XDP A;  3CCV Q;  3LX7 A;  1CKB A;  2A7Y A;  2QI2 A;  2NUT A;  1PCX A;  2OAU A;  2FZC B;  2KVQ G;  1RAF B;  4ZNX A;  2JW4 A;  3JB9 J;  1QW1 A;  4X9D A;  2DFU A;  8AT1 B;  4QQD A;  2K5F A;  4KBM B;  4N0A A;  4QVZ A;  5LJ3 f;  3BW1 A;  2CH4 W;  4C8Q C;  3CCL T;  4RUG A;  1OI1 A;  3EGX B;  4RTX A;  3L1A A;  1LVK A;  3PVL A;  3EH1 A;  4E7K A;  3J80 E;  4KGX B;  2LRQ A;  2X9H A;  2FHD A;  4MZM A;  2DIG A;  1K4U S;  2KR3 A;  3A8G B;  4J6W A;  2CZ1 B;  2D6F A;  2R5M A;  1WHL A;  1GBQ A;  3CCQ T;  4BDY A;  4C92 E;  4M78 C;  2CUB A;  3MP1 A;  2DRM A;  2YUN A;  1JQQ A;  3PNW C;  4M77 A;  4PJO C;  1YJW Q;  2CH4 A;  2CSI A;  3VYH B;  4DBR A;  3SD4 A;  4ZGJ B;  1X2K A;  1YCS B;  2ZPB B;  5I2M A;  4FYY B;  4ESR A;  5GAN 4;  3M54 A;  5FRO A;  2RN8 A;  2KDS A;  2ZPF B;  4EMH A;  3FDR A;  5GAN 8;  1W6X A;  2XHC A;  5FU6 B;  2JNG A;  2KNB B;  2DO3 A;  3LH0 A;  3SEM A;  1K8A C;  2CP7 A;  4GLK A;  2DL7 A;  3CMA A;  2M1H A;  1YJN T;  4FCY A;  3OYK A;  1I1J A;  2FEI A;  1B7T A;  2FPF A;  1WXB A;  1S72 A;  4V2S A;  4C8Q A;  1F1B B;  1WQW A;  3CPW S;  3QUI A;  2J6F A;  5CQX A;  2O88 A;  1PG5 B;  3LWH A;  1H8K A;  4LE9 A;  1NEB A;  1UDL A;  1Y96 A;  5LJ3 g;  2LQW A;  1M90 R;  2M02 A;  2JTM A;  2CP3 A;  1WJR A;  2RQU A;  2NUP B;  2LP5 A;  4D8D A;  3OYG A;  1RAB B;  2COZ A;  2KMT A;  2I2L A;  3CD6 A;  3HKS A;  3VKI A;  3UWN A;  5C6S A;  1D0X A;  3OS1 A;  4M75 G;  1AZE A;  3E9F A;  4F16 A;  2HD0 A;  4XAX B;  4C8Q F;  2JXB A;  4HVV A;  2QGG A;  2FB7 A;  3L2R A;  1SSF A;  1K0S A;  1M1F A;  3INZ A;  4J7I A;  1M1K C;  2D0N A;  1GCP A;  3CEY A;  1YJN Q;  4FSX A;  4FIB A;  1QVF A;  3GPL A;  4M77 D;  1KQS P;  3CD6 T;  4M7D G;  1KFZ A;  1C1A A;  1YCY A;  1OEB A;  1VUB A;  2ZZD A;  1IHV A;  1AWO A;  2J6K A;  1MV0 B;  3OYI A;  1FMW A;  2BIV A;  1WZO A;  1VQN T;  2OTJ T;  5KYW B;  2DVJ A;  3TSW A;  4LDV A;  1BCM A;  3CPF A;  5IXF A;  3R6N A;  2QK0 A;  2M16 A;  1X2Q A;  3CCM A;  1AEY A;  4CI0 C;  3OYB A;  2HDA A;  4M75 A;  2E1H A;  2LTO A;  1BB9 A;  2YUO A;  5EG2 A;  1S1N A;  3CCL A;  3CC7 T;  1H3Z A;  4PJJ A;  1K73 C;  3RIR A;  4HT8 A;  1SPK A;  4A53 A;  4AG1 C;  4ZN1 A;  2QDY B;  2KT1 A;  2L2P A;  1RI9 A;  4C0D B;  3M58 A;  4X34 A;  1OX8 A;  4DQ2 A;  3CME Q;  2EQM A;  1UJ0 A;  3RES A;  1AD5 A;  1ZUU A;  3O8V A;  4M7D E;  1MMA A;  4CC2 A;  5LJ3 e;  4TVR A;  4DOW A;  2E5Q A;  5KCH A;  3L2V A;  3OYD A;  1RAE B;  1O9S A;  3Q1J A;  4II1 A;  3QZ5 B;  2EJG A;  4ME7 A;  5CKH A;  3HTR A;  1ARK A;  4ZGE B;  2IVW A;  1OQK A;  4M77 F;  3M55 A;  1N5Z A;  1UJY A;  3CBP A;  3EAE A;  5FWB A;  4E7J A;  4M7A E;  1ZSZ B;  1VYU A;  1M3B A;  2NLU A;  4M75 B;  3S6W A;  1EZZ B;  1ZUK A;  2E4H A;  2FRY A;  2C06 A;  1OOT A;  4P5N A;  4LDY A;  3RER A;  2F5T X;  1JJ2 S;  4M78 D;  1E6H A;  1TG0 A;  5CK9 A;  1DJ7 B;  1MMN A;  2MWO A;  2CDT A;  2NWM A;  3OW2 A;  1S72 Q;  2L5Q A;  1P92 A;  2RQV A;  2JVV A;  1K8A U;  1Z9Z A;  4BE1 A;  1GXI E;  1RAA B;  5GAN 7;  1FMV A;  5GAN 5;  1OUL A;  2CZ7 B;  4FT2 A;  1KC8 U;  4M7D F;  2OTJ Q;  1TSF A;  3JCM X;  1GL5 A;  2K57 A;  2V26 A;  1YBY A;  4M77 C;  2QTV A;  2EJF A;  4BB7 A;  2X4X A;  4X1V A;  1EIF A;  2C0I A;  5I11 A;  3X20 B;  4M75 C;  3L2Z A;  3BDU A;  4EPC A;  2PVD B;  2KRS A;  4J9C A;  1MV3 A;  1KD1 R;  4XTX A;  2VXF A;  4RTZ A;  1RAG B;  2EQI A;  2ZPH B;  2F2W A;  5CKB A;  3VYG A;  2VUB A;  4C0G A;  2E41 A;  2DL8 A;  3A5Z B;  3G71 A;  4AMC A;  3CCS T;  4PJO D;  1YIT A;  3TSZ A;  1U1S A;  3CCE T;  3FJP A;  1JBM A;  3M53 A;  3JCM V;  2CS7 A;  2VWF A;  3G71 Q;  1WJS A;  1T0H A;  2BE9 B;  2EBP A;  4HCK A;  5IHN A;  2W10 A;  2RM4 A;  3WVD B;  2IPO B;  4A63 B;  2VB6 A;  4N4G A;  2CP0 A;  2LQK A;  1OZ3 A;  4QT7 A;  4OVA A;  4BY6 B;  4CC7 A;  4LDX A;  5FU6 C;  1T3L A;  1W2B A;  2PVG B;  1BBZ A;  1PWT A;  1SHF A;  2K2M A;  4AFQ C;  4L5G A;  2MWP A;  2D9T A;  3HL8 A;  1AWJ A;  4XU2 A;  5GAO n;  1TOV A;  2CUD A;  4IUP A;  3CC7 Q;  3X26 B;  1K1Z A;  4EMK B;  3PIO A;  2HQH A;  5I2S A;  2LCC A;  4Y91 A;  1M9S A;  1TUD A;  4M78 B;  1M2V B;  1SSH A;  1K73 U;  1ZA2 B;  1QKW A;  2DRK A;  7AT1 B;  2V1Q A;  2EPD A;  2RO0 A;  2DE0 X;  4RTW A;  3CQT A;  1PNJ A;  1Q82 C;  2COW A;  2EYQ A;  1CSK A;  3QWY A;  3QPH A;  2CP2 A;  2NUP A;  3H8Z A;  4FSS A;  4XK8 E;  4B9X A;  8ATC B;  4M78 E;  3LGL A;  1T0J A;  5GAO p;  4EMG A;  4YTL A;  4ZTJ A;  1GFD A;  1XNI A;  2DPP B;  1ZBJ A;  2RQW A;  2C0T A;  1PD1 A;  1B07 A;  2K2V A;  2OJ2 A;  1N9S A;  1LPL A;  3G4S Q;  2A3L A;  1WX6 A;  5L8R E;  3QBY A;  2F1L A;  3R6O A;  3ULR B;  1VQ5 A;  3MPU B;  3SWN A;  4PJO E;  3MP8 A;  4KUL A;  4M78 G;  3QSU A;  2F5K A;  1WHK A;  4C92 C;  2RF0 A;  4CC3 A;  3EFR A;  4RCC A;  2DVE A;  2YRC A;  3MEU A;  3MEW A;  4OMO A;  4OMF B;  5D7U A;  1U1T A;  2SRC A;  5CQY A;  2VYT A;  5M9O A;  4M7D D;  5DY9 A;  3HFN A;  1AVZ C;  1K0X A;  2OX7 A;  1ZSG A;  1BIA A;  3L2U A;  1KQS S;  2V8J A;  5IAY A;  3RBB B;  3M0U A;  5GMK j;  3JB9 F;  3CCJ A;  2PUO B;  4HCZ A;  4PJO A;  2PTK A;  3QYH B;  3G71 T;  4LDW A;  4J6Y A;  3CPW A;  2GCX A;  2M0Y A;  5GMK m;  2A37 A;  1JXO A;  1D1A A;  3EGD A;  2BTT A;  1D0Z A;  4PJO F;  2BZX A;  4OF1 A;  4M7A C;  3LWI A;  3CCQ A;  3CMA Q;  1VQ4 T;  4O5V A;  1X69 A;  4IUQ A;  1YIT Q;  1VQ7 T;  1BI0 A;  3CC2 T;  4FT4 A;  5LJ3 j;  1V29 B;  4IUT A;  1KSW A;  3G4S T;  3OSV A;  1RAC B;  1BI1 A;  4L59 A;  3OYA A;  2JT4 A;  5FRN A;  1Q7Y C;  3BY7 A;  1I4K 1;  5GAO q;  2D8H A;  4C8Q D;  4Y92 A;  4HCB A;  5KYW A;  2QA4 Q;  1UE9 A;  1KD1 C;  2RJC A;  3CMA T;  3G6E T;  3RDV A;  1VA7 A;  5CCA A;  1J3T A;  1S72 T;  4M78 A;  1QQJ A;  3QJY A;  4BE2 A;  1ZQ1 A;  1NYG A;  2MI6 A;  2MAM A;  1R8O B;  3U23 A;  2YRV A;  2D0Q B;  3CCV A;  2MIO A;  1PC0 A;  2EIF A;  3G6E A;  4PLL A;  3C95 A;  4N4I A;  5D6Y A;  2JN0 A;  4KH0 B;  1ZSZ C;  5HK3 A;  4J9I A;  2OTL A;  4F7U G;  2FPD A;  1VQP Q;  3G6E Q;  3UPU A;  2XI9 A;  3KFV A;  1VQK Q;  1IB8 A;  2XDD A;  3CCV T;  3CCJ Q;  5GAN 6;  1UGS B;  1KD1 U;  2RB6 A;  2ZPI B;  3JCM e;  2KYB A;  1GCQ A;  2WAC A;  3KXT A;  2L89 A;  3DKM A;  4RG8 A;  4MZT A;  2V1R A;  1M5Q 1;  1K9M C;  1R77 A;  1Y0M A;  2LMJ A;  1YIT T;  3GNF B;  4JJN K;  1VQL A;  4ATO A;  1OX9 A;  2H3E B;  1PRM C;  4IIM A;  1HD3 A;  2EJ9 A;  2E64 A;  1YJ9 Q;  1VQM Q;  5GAM f;  4EMK C;  3JV3 A;  4JS5 A;  2DX1 A;  1KC8 R;  4M7A F;  1I5L A;  4KGZ B;  4J9D A;  4J9E A;  1K9M U;  3NTI A;  2RQT A;  2E70 A;  1FX7 A;  2E6N A;  2K9G A;  2EAY A;  2AT1 B;  2JS2 A;  2NYS A;  3X25 B;  5GMK i;  2K7A A;  2EYZ A;  4C0Z A;  3A8L B;  1VQL T;  2DBM A;  3OA6 A;  4PJO G;  2L3P A;  3VS4 A;  1G83 A;  3CCM T;  5CVI A;  2FZG B;  2P0Q A;  3OW2 S;  2EQU A;  1LJO A;  4ELZ C;  2E3I A;  4OGE A;  2K79 A;  1RAH B;  1GFC A;  1K9A A;  2JJ9 A;  1YI2 A;  4JLI A;  4M78 F;  4AG2 C;  1BYM A;  3PE0 A;  4BDZ A;  1SF9 A;  2CP6 A;  3CCM Q;  1WNL A;  4LXC A;  3EG1 A;  2K3X A;  3H41 A;  5IXB A;  3NGP A;  2FVU A;  3JCM c;  3JCM h;  3I55 A;  1NBE B;  3URG A;  1SEM A;  4HKE A;  4D8K A;  3SHW A;  3FC3 A;  4XU1 A;  2QGF B;  3A8H B;  9ATC B;  2HZY A;  2DTI A;  1M1K U;  2LDM A;  2BKD N;  3ZBD A;  3EHQ A;  3OQ5 A;  3HFO A;  1VQ7 Q;  4J9B A;  1Q81 C;  3H0H A;  5GAM g;  2JS0 A;  1M4Z A;  3PFS A;  3VRY A;  3NMZ C;  4FM4 B;  2P0P A;  3GP8 A;  1E6G A;  1KC8 C;  2A08 A;  2RHU A;  2QYZ A;  5KYX B;  2AKL A;  3J7A F;  1MHN A;  3TVT A;  2MOX A;  2ZPE B;  3DB3 A;  2FL7 A;  2RJD A;  3VS2 A;  4M7D C;  1YWP A;  2KRM A;  2EWN A;  3QDR B;  1YJ9 T;  4WF2 A;  2F2V A;  4OMM A;  5C0M A;  2J6O A;  4E6R A;  4OP0 A;  2EQJ A;  3UDC A;  4DA4 A;  3EH2 A;  1ABQ A;  1M3A A;  2RHX A;  1CKA A;  1VQ9 A;  3S3M A;  4PL6 A;  4RTT A;  4JUV A;  1QLY A;  1QMC A;  3MHX A;  1V1C A;  1TU0 B;  1WPY A;  2DXU A;  3S3O A;  4OGC A;  2HEQ A;  2HKQ B;  4JJC A;  1RAI B;  3OSS C;  1M30 A;  1KQS A;  4F17 A;  3OYE A;  3P8H A;  4RTY A;  1SHG A;  3CC4 A;  3QHS A;  2E10 A;  2B86 A;  1QWE A;  2OAW A;  4Z88 A;  3QKJ A;  4BI8 B;  5GMK l;  1VQ7 A;  2L0A A;  2RD1 A;  3HRT A;  5A0L A;  4OB2 B;  1U8R A;  4DEX A;  2K3B A;  3M57 A;  2QQ9 A;  2MK5 A;  2DL3 A;  1V76 A;  3JCM J;  4PFZ A;  3JCM g;  3FJ5 A;  4UC4 A;  1PKT A;  5A2Q E;  2YXY A;  1WJQ A;  1QCO A;  3ZL7 C;  4C8Q G;  4JS4 A;  2D8J A;  1N8R C;  1IGQ A;  2QQS A;  1IHW A;  2CRE A;  3GOX A;  2RHI A;  4WTO B;  2FYK A;  3RR6 A;  1FYN A;  2HAX A;  3UT1 A;  3A98 A;  5GAM h;  1YHQ T;  4QKU A;  1KHC A;  2COY A;  5GAO r;  5IN1 A;  3M0R A;  3CC4 Q;  1YI2 Q;  2HQX A;  4E7H A;  1U06 A;  5FLX E;  3DLL A;  2KE9 A;  1A0N B;  4XQ3 A;  1U5S A;  3L42 A;  1ZA1 B;  2AIR B;  4HXJ A;  2G6F X;  4PKC C;  1M2O A;  1Q86 C;  3JCM b;  2AZV A;  1MMG A;  5FU7 C;  3EFS A;  1ZX6 A;  2O2O A;  5GAN 2;  1VQ9 Q;  4M7A B;  1X43 A;  3I55 Q;  1M27 C;  3AT1 B;  1HXD A;  1EFN A;  2EVR A;  4PNO A;  3EGU A;  4E7Z A;  4KGV B;  3EGD B;  2BZY A;  4PK4 A;  3QXE B;  5IT9 E;  1VQ4 Q;  3BE3 A;  4DOV A;  4DBF A;  1YJW T;  5KH6 A;  1QP3 A;  4O6J A;  3V7C A;  1UTI A;  4C5I A;  2EYW A;  5CO7 A;  3AHU A;  3CPW P;  1QVG S;  2NUT B;  1GCQ C;  3EFO B;  2PUK B;  1Y71 A;  3C94 A;  2F2X A;  2HBW A;  2CP5 A;  4JZ4 A;  1G5V A;  1TH7 A;  3JCM W;  2J7I A;  2QXF A;  3VRZ A;  1VQ8 A;  2HCK A;  2DEU A;  3CCS A;  2HQE A;  2HNI A;  2BE7 D;  2V8K A;  1MND A;  2KEA A;  1VQ9 T;  3CBM A;  3GLX A;  4BE0 A;  4LNP A;  2GTO A;  5A0G A;  5FW9 A;  2DER A;  4C92 B;  2JTF A;  1VQ8 T;  3RKY A;  3PMI A;  4FU6 A;  1OZ2 A;  3QO3 A;  3EG9 B;  2LNV A;  3OB9 A;  1WYX A;  1UG1 A;  3VUZ A;  2RMO A;  1UGQ B;  3OBY A;  2RI3 A;  2L3S A;  2FO0 A;  5GMK h;  2O31 A;  2HL5 C;  2DD4 A;  1MUZ A;  2EFI A;  4DBH A;  3E1S A;  3S3N A;  5LJ5 j;  1O75 A;  1BI3 A;  4C8Q E;  4M77 B;  3EHR A;  2RHZ A;  1M8V A;  1UGP B;  3I56 A;  4F04 B;  1FWZ A;  5IH2 A;  2DF6 A;  2DIQ A;  3NTK A;  4Z89 A;  5KE3 A;  2P4T A;  1AWW A;  4FL6 A;  4M77 E;  2JMC A;  5FWC A;  1JB0 E;  1I81 A;  2P84 A;  2SEM A;  3FB9 A;  5HK0 A;  3CC4 T;  4EIK A;  1XQH A;  2R58 A;  3I9Q A;  3RMS A;  3M0T A;  1XJW B;  3EGX A;  1M90 C;  1JRI A;  2EGE A;  3MJX A;  1YWO A;  2DKG A;  1NJI R;  3TRE A;  2DK3 A;  3UA7 A;  1K8A R;  4N4H A;  2DTO A;  5KYU A;  1VQM A;  3NPF A;  1U3O A;  4GY5 A;  4QVD A;  1OV3 A;  2HSE B;  3NTH A;  1WI7 A;  3D7S B;  4A4F A;  4M7A A;  1NEG A;  4NL2 A;  5GAN g;  3QYG B;  2RI2 A;  3HRU A;  3VS3 A;  5L23 A;  4BY6 C;  3CCS Q;  2K3Y A;  4C92 G;  3VS6 A;  2X3W D;  4BUG A;  2LJ3 A;  2O9V A;  1WDX A;  4C5G A;  1Q7Y U;  2OTL T;  1D09 B;  2X4W A;  2LJ0 A;  3M0P A;  4CC4 B;  4GLM A;  1YIJ Q;  5GAO m;  2MYS A;  4B6M A;  3RMQ A;  2YHT A;  2JOY A;  1RAD B;  1BI2 A;  3VJP A;  3VU3 C;  1QCN A;  1R0C B;  2ROT A;  3MET A;  1AZG B;  5IHK A;  1WHM A;  3L2Q A;  4J5Y A;  5LJ3 d;  2O9S A;  5CAI A;  2EGA A;  2VAS A;  2W0Z A;  3LW5 E;  4ORZ A;  4F7U B;  2EKH A;  5KE2 A;  5AYF A;  2CSQ A;  4LN2 A;  3LYI A;  1UEB A;  1VQN Q;  3FIF A;  2PQW A;  2VKN A;  1Y96 B;  4CRI A;  3P8B B;  3X24 B;  1I0C A;  4HVW A;  3JB9 I;  1RLQ C;  2DEQ A;  3KBG A;  3E2U A;  4R0K A;  2H3J A;  1KQ1 A;  2WSE E;  4RCB A;  3TQ7 P;  1OU9 A;  4KH1 B;  1K9M R;  3JCM Q;  2ED1 A;  2PZ1 A;  2IG0 A;  4XTZ A;  3O5Z A;  1EX4 A;  2DET A;  5ECA A;  3H0I A;  3PVQ A;  2ATC B;  3QII A;  3MP6 A;  4OB0 B;  4J9G A;  4IKF A;  1PRL C;  2HL3 A;  3CME A;  2MF2 A;  1ZHI A;  4J7F A;  3ME9 A;  2CGH A;  3VUB A;  3CCR Q;  3BDL A;  5GAN e;  1E7O A;  1ZLM A;  3M5A A;  2VGM A;  2JZ2 A;  2KSS A;  2YUQ A;  4JRK A;  4AT1 B;  1NYF A;  3V8K A;  3OW2 P;  2X4Y A;  4RG2 A;  5GAM e;  2I0N A;  4E2F B;  4R55 A;  2CYZ B;  3M0S A;  4N0A C;  1NPP A;  3HP9 A;  4OMP A;  5GJW B;  1X01 A;  3I56 Q;  2CT3 A;  1PSF A;  1VQP A;  3CCU Q;  2XID A;  1D1C A;  4NS5 A;  2LT1 A;  1WHG A;  5LJ5 h;  1VQO A;  2GFA A;  2AHJ B;  4XTU A;  4HA8 A;  2XDB A;  3G4S A;  1Q82 U;  2M51 A;  4X9C A;  3CCE Q;  2DTH A;  4J6X A;  1FXX A;  1VQP T;  3CCR A;  2E65 A;  2WSC E;  2X3X D;  3CCU T;  3H9N A;  3OMC A;  4F7U F;  2LX9 A;  5LJ5 f;  4OB1 B;  3VS7 A;  1FMK A;  3MCA B;  3VV0 A;  1VQK A;  3JCM d;  2H8H A;  1QP2 A;  2QQB A;  2BZ8 A;  5CKE A;  1SKU B;  5LJ5 d;  3V8J A;  3EG0 A;  1YN8 A;  2O4X A;  1HSQ A;  3CCU A;  2RHY A;  4HT9 A;  1G8X A;  3L2W A;  5GMK e;  4LD9 K;  1N8R R;  1H64 1;  2XIC A;  2RK2 A;  2MPX C;  4A4H A;  4J83 A;  4OMN A;  1QWF A;  1TWB A;  4KRT A;  2YWW A;  2GQV A;  3OYH A;  1AT1 B;  3NFC A;  5KYY B;  1PKS A;  4M75 F;  2GBQ A;  1X6O A;  3V7S A;  4KUI A;  1PM3 A;  1X75 C;  2EGC A;  5EC7 A;  1IGU A;  5D6X A;  4AFZ C;  4LDU A;  3I56 T;  3CD6 Q;  5DM7 R;  2CZ0 B;  3HPW A;  1NG2 A;  1KQ2 A;  1N6A A;  1IRX A;  3PT9 A;  1QVF S;  5DLQ E;  1VQO Q;  2KRO A;  1B3Q A;  2DXB A;  2ENM A;  3I35 A;  3G1J A;  1TUC A;  2MMP A;  2P4R A;  4OB3 B;  4A4G A;  3E9G A;  3MO8 A;  1QKX A;  1VQ6 A;  2A36 A;  3RKW A;  3EG3 A;  3JCM P;  3RUX A;  3HSB A;  2ECZ A;  4WCI A;  5GAN 3;  5J39 A;  2LVM A;  1Q7Y R;  1W4S A;  3OMG A;  4J8O A;  2KI7 A;  2QEX T;  2AK5 A;  1D1B A;  1YJN A;  4PJM A;  3LLR A;  4Y28 E;  3CCQ Q;  1TUG B;  1BK2 A;  4M75 D;  4K11 A;  4JJD A;  1NE8 A;  2LQN A;  4J9F A;  3TCJ A;  1QVP A;  1UGR B;  4M7A G;  3C4S A;  4E47 A;  1WGS A;  2X4J A;  4C92 A;  4LUD A;  4FW1 A;  4JRI A;  3ZFJ A;  2F69 A;  2QQR A;  2RI5 A;  4FYW B;  1JU5 C;  2Z0W A;  3A8M B;  3EG9 A;  5IHI A;  2C0O A;  1YIJ T;  4LD6 A;  3RNJ A;  4QVC A;  2GFU A;  1YJ9 A;  1B34 A;  3CME T;  1NJI C;  1BKB A;  4Z02 A;  1I8F A;  4JRQ A;  3JAM E;  3GBQ A;  4XTW A;  3SWN B;  2DNU A;  4A4E A;  2PU9 B;  4HCC A;  2XU8 A;  1YP5 A;  1PSE A;  2YLB A;  1X27 A;  4ZGD B;  2YRD A;  4Z8A A;  4BI3 A;  2VV5 A;  1OPL A;  1ZSZ A;  1ABO A;  5GAO l;  6AT1 B;  2B8A A;  3CCE A;  3C0C A;  1IXD A;  4QW2 A;  1Q81 R;  2OI3 A;  4BAC A;  1UGV A;  2RPN A;  2CKK A;  1VQK T;  4JRP A;  3QG1 A;  3EG2 A;  3J81 E;  4FW2 A;  4BD3 A;  5LJ3 h;  3CXC P;  1AWX A;  1VOM A;  1GBR A;  1VIE A;  2GGR A;  4MDX A;  1IO6 A;  1YHQ A;  5A0D A;  2VXE A;  3OYY A;  2KXD A;  2KRN A;  3CXC S;  1GRI A;  2Y4X A;  1N27 A;  1UHF A;  2RJF A;  1NLP C;  2DLP A;  1NJI U;  2JUF A;  5HCK A;  1KK7 A;  2XD0 A;  1WIE A;  3QJ6 A;  4DBQ A;  2DD5 A;  2K4Y A;  4DEY A;  2DYI A;  5GAN d;  2LT4 A;  1M8M A;  3GNG A;  1BIB A;  2XKO C;  1UEC A;  4FYV B;  3PMT A;  2DM1 A;  2L3Q A;  1Y57 A;  3SWN C;  3M56 A;  3OYF A;  5KCO A;  2DXT A;  1W2B P;  3QWX X;  4OMQ A;  2P0K A;  1SRM A;  3MKD A;  2K5L A;  2AKK A;  1VQO T;  2KY9 A;  1WXT A;  1QVF P;  4C92 D;  5DLO A;  3M4Y A;  3FLG A;  1C0M A;  1X6B A;  2DL4 A;  3CBO A;  2LX7 A;  4XU3 A;  4F7U E;  3OS5 A;  1WXU A;  5CKD A;  4HVU A;  2LC4 A;  2G3R A;  1XTD A;  2ED0 A;  1Y07 A;  1UHC A;  2KYM A;  3CXC A;  4BI4 A;  1Q81 U;  3CC7 A;  3HHT B;  3DLM A;  2VVK A;  3JB9 D;  2HMA A;  2RH2 A;  1Y7X A;  1JJ2 A;  1W1F A;  1XOV A;  2LCL A;  4FYX B;  1K73 R;  2HBP A;  4KT0 E;  2DL5 A;  1IRE B;  5LJ5 e;  4AFS C;  1TTH B;  1VYV A;  2A0F B;  1QVG P;  1JO8 A;  3WXM B;  2ZAE A;  2CT4 A;  1NZ9 A;  4EDU A;  1G3T A;  4XU0 A;  1AOJ A;  1W70 A;  1NM7 A;  2OTJ A;  4C0F A;  1WHH A;  2GTJ A;  2ABL A;  2ROL A;  5LL6 S;  2EW3 A;  1G3W A;  4JDS A;  2DZC A;  2DZ9 A;  3LGF A;  3PGG A;  3I5S A;  1OYX A;  2Y4Y A;  1T3S A;  2YLC A;  4PFP A;  3VS1 A;  3OYL A;  1KG1 A;  3PTA A;  3UF4 A;  3V8L A;  3GIB A;  4PJN A;  1RI0 A;  4MZP A;  5HY6 A;  2EYX A;  3REA B;  2K5I A;  5J3B A;  2YUP A;  3C12 A;  3M0Q A;  1AHJ B;  1PHT A;  2HSP A;  1KJW A;  4JPB W;  3OS0 A;  3EFO A;  4AFU C;  2RNA A;  3CC2 Q;  3A1P A;  1YFN A;  2QAS A;  4OML A;  4ANJ A;  2DXC A;  4C5H A;  1LOJ A;  2LZ6 B;  3SFM A;  2QDL A;  2YSQ A;  2YT6 A;  2FRW A;  2O4X B;  5CIU A;  1C6V X;  2X51 A;  2ZPG B;  2VC8 A;  2EQK A;  3REB B;  4ZN3 A;  1YJW A;  5LJ5 g;  1QVG A;  1UB4 A;  1VQ5 T;  3RKX A;  2J05 A;  2JM8 A;  2DA9 A;  2DJZ A;  2X35 A;  4C5E A;  2E5K A;  4M7A D;  4GBQ A;  4C92 F;  1NPR A;  2DJQ A;  1WLP B;  2KXC A;  4QQG A;  1VQ8 Q;  1WQ7 A;  2EYY A;  1VIF A;  2RA2 A;  3M9Q A;  1N9R A;  2DAQ A;  1D3B B;  3OY9 A;  2QG9 B;  3JSC A;  5FU7 B;  3GF5 A;  3OYN A;  3ZEH A;  2XMF A;  3E19 A;  4J9H A;  4Q5W A;  1D3B A;  4IUR A;  2HKN A;  4QQ6 A;  4M7D B;  5GJV B;  3PIP A;  1M3C A;  4MML A;  2RK1 A;  2XK0 A;  3H0F A;  2GQI A;  4A54 A;  3VS5 A;  2PNI A;  2R5A A;  4M77 G;  4E7I A;  4L6V 5;  3CCJ T;  2A28 A;  5I22 A;  2WSF E;  2QQA A;  3DB4 A;  3UA6 A;  2BUD A;  2LNH B;  3OBW A;  4IUV A;  1Z9Q A;  3KUF A;  5GAN j;  3OYC A;  4LUE A;  1RUW A;  2O01 E;  3ER0 A;  2FPE A;  5KYY A;  3QZ9 B;  2PVO B;  2QAZ A;  2L3R A;  4ELY C;  2J06 A;  2CZ6 B;  4M75 E;  1X6G A;  1YHQ Q;  3OYJ A;  3H6Z A;  1JEG A;  3V7R A;  3N5B B;  2XG8 D;  3IQL A;  3CC2 A;  1LNX A;  2E3H A;  1YI2 T;  5KYN A;  5GAM d;  1H92 A;  2FG0 A;  2M0O A;  2MCN A;  3G7Z A;  1HYO A;  1WHJ A;  2ESW A;  1Q95 G;  3SDZ A;  2L8D A;  1IZ6 A;  3OYM A;  1JXM A;  2Y90 A;  2GNC A;  4PFO A;  5AT1 B;  1I5O B;  1SRL A;  4IUU A;  1I07 A;  2ZCF B;  2YDL A;  5FRM A;  3M4G A;  2OTL Q;  4C0D C;  2FZK B;  2JM9 A;  4E7S A;  2NUZ A;  1VQM T;  2R57 A;  2DIL A;  1PD0 A;  2EKO A;  3M59 A;  1SG5 A;  4M4Z A;  1WFW A;  3OS2 A;  2DBK A; 
#chains in the Genus database with same CATH homology
 2ZAE A;  1TS9 A;  1PC0 A;  1V76 A;  2KI7 A;  1OQK A;  1TSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...