2DBKA

Solution structures of the sh3 domain of human crk-like protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
88
structure length
88
Chain Sequence
GSSGSSGPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDENESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Crk-like protein
publication title Solution structures of the SH3 domain of human Crk-like protein
rcsb
source organism Homo sapiens
total genus 5
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dbkA01
2A37A 4AFQC 1AWJA 3NGPA 3R6NA 2KGTA 2RF0A 2CSQA 1T0JA 2HSPA 1VYTA 2B86A 2JS2A 3M0UA 2LX7A 2GTJA 1H92A 2HDAA 2KRNA 2ED0A 3SHWA 3M0SA 1SEMA 2M0YA 1CKAA 1HSQA 2EQIA 1WDXA 2J06A 4JJDA 3I9QA 2H8HA 1SRLA 2JMCA 1I07A 2AKKA 1LCKA 1UGVA 3A98A 2RPNA 3EG0A 3TVTA 2K7AA 1S1NA 2A28A 1PRMC 1WIEA 1FMKA 1RI9A 4F14A 2GQIA 2V1QA 2EW3A 2KBTA 1Z9ZA 4WCIA 2EYXA 1QLYA 2K2MA 1JQQA 2OJ2A 1X2QA 1V1CA 1RLPC 2O9SA 2CUBA 4J9BA 4CC3A 4GLMA 1KSWA 1MUZA 1JO8A 4HVVA 4FSSA 2MOXA 3VS0A 4Z89A 4RTTA 1UJ0A 2JM8A 4D8DA 2CH4A 2HEQA 4OMPA 3FJ5A 1GBRA 4JZ4A 4J9EA 3GBQA 2GGRA 5EC7A 4A63B 3PVQA 1T3SA 1M30A 4Z8AA 4CC4B 4CC7A 2OI3A 5I22A 4ZNXA 4AG2C 1AWWA 1TUCA 1NM7A 1BB9A 1X27A 2YUNA 3H0IA 4Z88A 5FWCA 3VRYA 1PRLC 3PE0A 3QWXX 2W0ZA 1M3CA 1YP5A 2DVJA 3I5RA 2L3SA 4LNPA 2EBPA 3VS6A 5IHKA 1K1ZA 5IXFA 1W70A 2FG0A 1QWEA 2ED1A 3NHNA 2DL5A 4EIKA 3EHQA 3PVLA 1PKSA 2EGEA 2VWFA 1NLPC 4JJCA 1ZX6A 4K11A 2LP5A 4RTVA 2KXDA 1AVZC 5IXBA 2AKLA 1JXOA 2EYYA 1GRIA 2KR3A 2KT8A 1BK2A 1TUDA 1SPKA 4OMMA 1ZLMA 2DF6A 2KEAA 2KRSA 3U23A 1YCSB 1CKBA 2VVKA 1GL5A 1UTIA 2V1RA 1QWFA 4J9FA 1WXBA 5FW9A 1U3OA 1SSHA 1RLQC 1K0SA 1AEYA 1N5ZA 2DYBA 4DEXA 1GCPA 2J6KA 1KIKA 1M27C 1QCFA 2F2WA 1VYUA 2FEIA 1GCQC 2QDLA 3EG1A 1GCQA 1JXMA 2X3WD 1HD3A 1OOTA 4J9GA 2YUPA 3NPFA 3H0FA 1SHGA 2G6FX 3TSWA 2ROTA 1PHTA 2LNHB 3VS5A 1SRMA 4D8KA 2YDLA 4OMNA 2AZVA 2C0IA 1X6GA 2BZXA 1AWXA 1OPLA 2F2VA 2LCSA 5HCKA 1E6HA 1QKXA 4RTXA 4HCKA 2L3QA 2JT4A 2MIOA 3M0QA 1ZUUA 2FPFA 2JTEA 2K6DA 3KFVA 4ORZA 3RBBB 4LN2A 2GNCA 2NUZA 3LH5A 2LZ6B 1ABOA 1G83A 4DEYA 1G2BA 4JZ3A 3VS2A 3JV3A 1MV3A 4RUGA 1TG0A 1M3AA 4RTZA 2EGAA 2KT1A 5IHNA 3H0HA 2CREA 1WLPB 4IIMA 1UFFA 2A36A 2RQVA 4RTWA 2CDTA 1HJDA 2DBKA 3EHRA 2L2PA 2RQTA 1CSKA 4F16A 2K3BA 1WI7A 2PTKA 1ABQA 1AOJA 1K76A 1VA7A 2DE0X 1GFDA 1PWTA 2XMFA 3RNJA 4J9IA 1K4US 1QKWA 1W1FA 2CH4W 2MCNA 3UATA 1U5SA 5IH2A 2DL7A 3I35A 1M8MA 4Y92A 2FRWA 1KJWA 4HXJA 2C0OA 2EYWA 1T3LA 2CUDA 3VS7A 1NEGA 2EKHA 4KRTA 1ZSGA 1UG1A 4LUEA 2DX1A 4AFSC 2JW4A 3M0PA 1YWOA 2KNBB 2KYBA 4IIOA 2O31A 2DA9A 2P4RA 3M0RA 4JJBA 4CC2A 1I1JA 1AZEA 2GBQA 2KXCA 2O88A 1MV0B 1E7OA 4AG1C 3VS4A 2YUOA 1WX6A 2J6FA 4OMLA 3UA7A 1VYVA 1X69A 3EGUA 3C0CA 3ZL7C 1RUWA 1H8KA 2RNAA 1NYFA 3ULRB 1A0NB 4AFUC 4AFZC 2I0NA 1Y0MA 2JM9A 2BZ8A 2RN8A 2NWMA 1K9AA 2RQUA 1GBQA 2E5KA 1X6BA 2X3XD 2D8JA 2EPDA 1AZGB 1UHCA 2KE9A 2FO0A 3UF4A 2ENMA 2O2OA 2EVRA 5ECAA 2DBMA 2OAWA 2LJ3A 1WYXA 2IIMA 2SRCA 2BTTA 2DJQA 3H41A 2HBWA 1B07A 2EYZA 3UA6A 2YSQA 3EG3A 1UECA 5GJWB 3REAB 2FRYA 2C0TA 2ECZA 1WA7A 4J9CA 2KROA 1WXTA 1NG2A 2FPEA 2D8HA 1UDLA 3SEMA 4QT7A 2JS0A 1GFCA 5I11A 4OMOA 4HVUA 1YN8A 1ZUKA 2KYMA 1WFWA 2CSIA 2ESWA 2DMOA 3THKA 1FYNA 4J9DA 1BBZA 2VKNA 4M4ZA 1J3TA 4RTUA 1OPKA 1ZUYA 2DNUA 1UJYA 2GTOA 1YNZA 3REBB 2EGCA 1T0HA 2CT3A 4X1VA 1H3HA 1X43A 1EFNA 2M51A 3O5ZA 2PNIA 2L0AA 1OEBA 5FWBA 4E6RA 1ARKA 1M3BA 1NLOC 2K9GA 4HVWA 1AWOA 1Z9QA 4RTYA 4LUDA 1K0XA 4J9HA 2JMAA 2KRMA 2DRKA 4GBQA 1UHFA 2FPDA 1I0CA 2D1XA 3VRZA 1B3QA 1XOVA 5L23A 4ESRA 2SEMA 2ABLA 1NYGA 2ROLA 1U06A 4F17A 2F2XA 2DRMA 2YT6A 1PNJA 2D0NA 1JEGA 1SHFA 1NEBA 3NMZC 1Y57A 2DLPA 2J7IA 3VS1A 2CT4A 1W6XA 2BZYA 2RQRA 3IQLA 3EG2A 1AD5A 1JU5C 3TSZA 2RMOA 2W10A 4JPBW 1ZBJA 1UUEA 3QWYA 1BU1A 2LMJA 2AZSA 5GJVB 2L3PA 1E6GA 1IO6A 3CQTA 4LE9A 2DL8A 2PZ1A 2DM1A 2DL4A 1WXUA 2LJ1A 2LJ0A 3I5SA 5IHIA 2LQNA 2YUQA 1OV3A 2HCKA 1YWPA 2K79A 2AK5A 2J6OA 2RQWA 2JXBA 3VS3A 4OMQA 2DL3A 1PKTA 1UE9A 2DILA 2J05A 3M0TA 2LQWA 4R0KA 2O9VA 2A08A 1X2KA 1KFZA
chains in the Genus database with same CATH superfamily
4AFQC 3GIBA 1AWJA 4LXCA 1ZA2B 3CMET 2CSQA 5GAOn 2CP7A 4Y28E 2P84A 2HSPA 3L2VA 2B86A 2E12A 1D1AA 2LCLA 2LX7A 3RKXA 2GTJA 3X28B 2F1LA 2ED0A 2VUBA 1DJ7B 1SEMA 2DFUA 3CC2T 4ATOA 5L8RE 5I21A 3KBGA 5GAOr 4JJDA 1RAGB 1KQSS 2H8HA 5GAN4 4PJJA 3CPFA 1QVGS 1I07A 4E47A 5A0GA 3CCJT 1MMDA 3A98A 3OS5A 4C8QG 1EX4A 2K57A 2FZGB 4J6XA 2EWNA 2A28A 1PRMC 3M4YA 3JCMe 1FMKA 3CC2A 4HCCA 2V1QA 4XTWA 4BACA 1Z9ZA 2MWPA 2QASA 1UGPB 2CUBA 4GLMA 1KSWA 4M75D 1JO8A 1OZ3A 4XU1A 2HEQA 1O75A 4OMPA 1QMCA 1V29B 1GBRA 2E3IA 2LTOA 4GLKA 4IUUA 1VQMT 3E9FA 4A63B 1Q7YC 3JCMX 1XTDA 4M78C 5CKEA 4EMGA 4IUVA 2Y4YA 4AG2C 3OW2A 1AWWA 1TUCA 1NM7A 2XI9A 3EFOA 4XU2A 5FWCA 1PRLC 1RAAB 1YI2T 1FMVA 2W0ZA 1YP5A 3I5RA 2L3SA 5CO7A 4E7JA 2EBPA 3INZA 3HRSA 4XAXB 2KQWA 1VQMA 2DL5A 2KMTA 1WJSA 4EIKA 3J7AF 4ZGDB 4M77D 4EMHA 2LP5A 1HK9A 5GAN2 2KXDA 3C95A 4JLIA 5IXBA 2AKLA 2D9TA 1WGSA 2EYYA 4C5EA 1YI2A 1SPKA 3OS0A 4DBRA 2JNGA 2KRSA 1YCSB 3PMTA 1GL5A 2VXFA 1QWFA 2XDDA 2MMPA 3I56T 5FW9A 1SSHA 3OYCA 3L2ZA 2DYBA 4DEXA 3CEYA 2VYTA 4D6WA 1B34A 3JB9D 5KE3A 4J9GA 3CXCA 4X9CA 4Q5WA 2DIQA 4M77F 2M0OA 1RAIB 4ANJA 4M7AE 5LJ3h 3I56A 1G3YA 5GAN6 3VS5A 3BE3A 2QA4T 3OA6A 2YDLA 1KD1U 2AZVA 4BDZA 3CCEA 1OX8A 2MYSA 4DBFA 3ZBDA 2F2VA 2CP0A 5HCKA 4LDVA 1E6HA 4A4EA 3LGLA 1QKXA 2PVDB 2ZZDA 4Z02A 1QCOA 2L5QA 4PJOB 2QA4A 3JCMg 1KQ2A 4ORZA 3J80E 1NPRA 3JB9F 3E2UA 1ABOA 3RUXA 2M02A 3SWNA 4C8QA 4JZ3A 1WPYA 4JRKA 1R0BG 2KDSA 1ZSZB 2HQXA 3FLGA 1UEBA 3HSBA 1M3AA 1TU0B 4MMKA 4RTZA 5IT9E 2EGAA 2OTJQ 2CP3A 3CCLA 3H0HA 1FXXA 4XTZA 4IIMA 3MKDA 3CCQQ 2L2PA 1QVGP 2RQTA 1VQ9T 4NOYA 1KHCA 1ABQA 4IUTA 1I81A 1PWTA 4L59A 4LD9K 3CCSA 4ZN1A 5CVIA 3CCMQ 4M77G 5GAMh 1JJ2P 4E7SA 1M8MA 2FRWA 4HXJA 3ZFJA 1BI3A 1T3LA 2M16A 3VS7A 4L5GA 2LQ8A 2EKHA 5AYFA 2COWA 1X6OA 1VUBA 1VQ9A 3CC7A 1LJOA 2JW4A 5GMKm 2E41A 1QP3A 1YWOA 4IIOA 3CBMA 3A5ZB 4CC2A 4JJBA 4OMFB 1E7OA 3PMIA 1XQHA 3G4SQ 3JCMb 1NPPA 3CCRQ 2J6FA 4UC4A 1ZA1B 5KYWB 3JB9G 2BE9B 1YJWT 4GY5A 3RKWA 3ZL7C 1RUWA 2DD5A 2EAYA 1PD0A 2IVWA 1YIJT 2MWOA 4JLGA 4AFZC 3QJYA 2F69A 3CD6A 2DZ9A 2GFAA 1WJRA 3KXTA 4KH1B 3NTKA 3EGXB 3N5BB 3LWHA 1Q81R 4M7DB 1M8VA 3T9NA 1X6BA 1VQKA 1YJWA 3MP6A 1YJNA 2L8DA 2KE9A 2OTLQ 3JB9J 3META 4B9WA 4CRIA 4E7LA 4ZTJA 1YIJA 2O4XA 4NS5A 3OYEA 1YITT 2LRQA 1Y07A 5C6SA 2NUPB 4C0DB 3X25B 2IIMA 3D7SB 1LPLA 3H41A 4OGCA 4ZGEB 2EYZA 3UA6A 5KYXA 2YSQA 1UECA 1Q81C 2E1HA 1M1GA 2FRYA 2C06A 4J9CA 3EFSA 3EAEA 1JB0E 1H3ZA 1WXTA 4CI0C 4LDYA 2WSFE 2QGGA 2KYMA 2ESWA 3THKA 4F7UA 1FYNA 4RTUA 1ZUYA 4XTVA 1VQLT 2QEXQ 3G71Q 4X1VA 3ASKA 1H3HA 1VQ8Q 2M51A 3O5ZA 4PLIA 4PJMA 3M54A 2MI6A 3HFNA 1KG1A 2L0AA 5FWBA 2FL7A 1ARKA 4ZGJB 2BIVA 2RHIA 2K9GA 1K8AR 1NZ9A 5KE2A 1Z9QA 3QYGB 3TU4K 2K5FA 1K0XA 1QVFA 5GANh 1VQ5Q 4C8QE 1ACMB 1M90C 1VQNT 2G3RA 2DRKA 2X4WA 1B7TA 1QCNA 1G8XA 1I0CA 3VRZA 3OYMA 1XOVA 1D3BB 1G3WA 4M77A 5A0LA 3UT1A 1NYGA 3G7ZA 1U06A 2O01E 1VQ7T 1TS9A 2LC4A 2VC8A 1OQKA 5CCAA 3RMQA 1SHFA 3C94A 1Q82R 1K8AC 3AT1B 3OYBA 5CKDA 4PKCC 2RQRA 1W2BA 1AD5A 2QTVA 3HL8A 2RHYA 2PVOB 2VGNA 2FHDA 1BU1A 2AZSA 4PJOC 5GJVB 3LH0A 3CQTA 1YFNA 1XNIA 5CR2A 2LJ1A 4M78B 5GMKh 2LJ0A 3I5SA 5IHIA 2HCKA 3VS3A 2RQWA 1QP2A 4NL3A 1BCMA 1Q82C 2DILA 5J26A 4J9BA 2A08A 1X2KA 1PSEA 5KYUA 3NGPA 3R6NA 3DLLA 2KGTA 2RF0A 2H3JA 5LJ5h 2Z0WA 1OI1A 3GP8A 5FU7C 4Y91A 3OW2P 3L42A 2VASA 2EFIA 3M0SA 2M0YA 2EJ9A 3MP1A 3URGA 3JCMP 2DO3A 5LL6S 2RB6A 5CIUA 1LOJA 5FLXE 2XICA 2JMCA 1Q7YU 5I2MA 2ZPHB 1VQOQ 1LCKA 1UGVA 8AT1B 2RPNA 3A8LB 3TVTA 3FC3A 2E3HA 3LW5E 1S1NA 4FM4B 3MO8A 3CPWA 5KYNA 4XU0A 3OBWA 4C8QD 2EW3A 1QLYA 4J6YA 3OYAA 3CC4Q 1X2QA 3CBOA 2FVUA 3QHSA 1VQPQ 1RAHB 2JZ2A 1MUZA 4LDWA 4FSSA 4RTTA 2CH4A 2A3LA 2OX7A 3FJ5A 3M55A 5EC7A 3PVQA 1U1SA 3SFMA 1BYMA 3CXCP 2QQAA 4CC7A 1MNDA 2OI3A 5I22A 4ZNXA 3RDVA 1M4ZA 5GANd 3H0IA 3VRYA 3QWXX 2E4HA 1IREB 2DVJA 4LNPA 3QIIA 2H3EB 1TOVA 5IHKA 5IXFA 2ZPEB 3EHQA 1RI0A 4JJCA 3GNFB 1ZX6A 2DTHA 3OYYA 3H6ZA 1AVZC 3OYLA 1W4SA 4J7FA 2PVGB 2D0QB 1GRIA 1AHJB 1K9MR 1BK2A 1WHLA 4OMMA 3DB4A 3G6EA 2KEAA 3V8KA 1SKUB 2RJCA 3U23A 1CKBA 3EH1A 5GMKj 4M77E 2V1RA 5IAYA 5I2SA 2CZ7B 2MPXC 5DLQE 3HKSA 1KIKA 2FEIA 2QDLA 1GCQC 2PQWA 4OB2B 2X4YA 1MGQA 1UGQB 5LJ5j 5M9OA 1JXMA 3L1AA 3A8HB 4C92C 2KSSA 1K9MC 3PT9A 2R5MA 4FYYB 1YJ9Q 3SDZA 3M57A 2G6FX 1K73R 5GAOp 3BDLA 2ROTA 4M7DF 2X4XA 1SRMA 3OS1A 5LJ5d 1G5VA 1IGQA 1AT1B 2ATCB 3UPUA 3QG1A 4FU6A 4OMNA 4XK8E 4C5HA 4HCBA 1VQ6Q 1RAEB 2C0IA 2HNIA 2QTXA 1AWXA 1KHIA 3CMEA 1IHWA 2OTJT 1X01A 4BI4A 3MJXA 4RTXA 1PM3A 4JDSA 4HCKA 3RIRA 4XTYA 6AT1B 3QZ9B 1IRXA 1ZUUA 4BB7A 1JJ2S 3JB9H 4KUDK 1K73C 2K3YA 4DA4A 3CCMT 3MEWA 3V7SA 2RJEA 1G83A 4DEYA 1QVPA 3CCJA 4ELYC 2X35A 4M75C 4RUGA 1GXIE 1OU9A 3OYDA 4BDYA 4BE1A 1C6VX 5IHNA 4A4FA 1BI0A 2FZCB 2RQVA 3WXMB 2CDTA 3I55T 2WSEE 4FW2A 1CSKA 3R6OA 3RR6A 2DE0X 1K76A 2VV5A 1PC0A 2F5TX 4FIBA 3G4ST 3SD4A 3CCRT 2DIGA 3CMAQ 3UATA 5GMKi 1YHQQ 2DL7A 4MDWA 2C0OA 2EYWA 4M7DG 4KT0E 4R56A 2CUDA 4ELZC 4XQ3A 3I55A 2HAXA 4KRTA 1ZSGA 2RI2A 1M1FA 4F7UF 4FT2A 2LX9A 2LDMA 4OF1A 2QQRA 3M0PA 2KYBA 1ZBXA 2EYQA 2P4RA 3M0RA 1I1JA 2GBQA 2QQBA 2YUOA 3OYKA 2OTLT 3JCMV 2DK3A 4OMLA 1WQWA 2VB6A 1Y7XA 4KULA 4II1A 3EGUA 4O6JA 1S72Q 2MF2A 1NYFA 2YXYA 2FYKA 4AFUC 2WSCE 4PJOA 4PFOA 2JM9A 5KH6A 1Q81U 2RI3A 3MCAB 4ZTFA 2RN8A 3X26B 2RJDA 2CKKA 2RQUA 3JCMc 5CAIA 1QVFP 2X3XD 1VQ4Q 1ZSZA 1UHCA 2FO0A 2O2OA 2EVRA 2DZCA 1H641 2NUTB 1UB4A 3S3NA 1D0YA 3RKYA 2QEXT 4X34A 3G1JA 3G71T 4BY6C 1VQ8T 1YBYA 1N8RR 2SRCA 3TREA 2DJQA 5D6WA 2RI5A 4J6WA 2HBWA 3VU3C 1B07A 1PD1A 4F7UG 2E6ZA 3QSUA 2C0TA 1WA7A 1M90U 3PTAA 1NBEB 4FT4A 1MHNA 1VQ5T 1UDLA 5LJ3f 3SEMA 4XTUA 1W2BP 2RK1A 4EMKC 5I11A 2K5LA 4A54A 5D7UA 2QEXA 1WFWA 4A4KA 1OZ2A 2DMOA 4PFZA 1BBZA 2VKNA 2ZPFB 1TUGB 2DPPB 5FU7B 1N8RC 2CT3A 1FMWA 1X43A 4TVRA 1K8AU 3CC2Q 4ZN3A 4E7ZA 2PNIA 1OEBA 3S6WA 1M3BA 3V8LA 2P0KA 4OB3B 5KYWA 2V26A 2E65A 4J9HA 2KRMA 1M5Q1 2DXTA 1TXQA 4RCBA 5IN1A 3CCUT 3JCMh 3MHXA 2CZ0B 1UHFA 4BE0A 3OYGA 1B3QA 3TEEA 2DJZA 3OSSC 2RH2A 1Q82U 1SF9A 3RERA 3EGXA 4M7DA 4OB0B 2D0NA 1M2VB 1JEGA 4J83A 3QPHA 1Y57A 5GAOl 3OW2S 2DLPA 3JCMQ 3VS1A 2CT4A 4AMCA 3CCVT 1W6XA 3HHTB 3CCUA 2BZYA 2JJ9A 4LD6A 2YWWA 4HA8A 3IQLA 3EG2A 1VQMQ 1F1BB 3OBYA 1LVKA 4M7AC 5GAMf 3CPWP 2EJGA 2NUPA 3O8VA 4N0AC 3RESA 2DVEA 1E6GA 1IO6A 1FWZA 2DL8A 2NLUA 2CP5A 2QG9B 2YUQA 1YI2Q 1BKBA 1YWPA 2J6OA 5A2QE 2E10A 3CCVA 2DKGA 3M0TA 4FSXA 1VQOT 4R0KA 2I2LA 2A37A 2MAMA 1T0JA 3A8MB 4OP0A 1VYTA 2BKDN 2PUOB 3VUBA 1WZOA 1H92A 3OSVA 3SHWA 3EGDB 2HD0A 5CKBA 1VQPT 3L2RA 2COYA 3I56Q 3GF5A 2HKQB 3CXCS 4VUBA 2WACA 2DEQA 2QDYB 2AKKA 1YITA 2RJFA 4KUIA 4NL2A 3CCEQ 2BUDA 1N9SA 3S3OA 2YRCA 1WIEA 4YTLA 1RI9A 1D3BA 4F14A 2GQIA 2OAUA 3V8JA 1WHGA 2KBTA 4WCIA 4C92B 2EYXA 2COZA 3TCJA 3E9GA 2QA4Q 1V1CA 4B6MA 3H9NA 2O9SA 2QGFB 2MOXA 4KGXB 2JM8A 4HCZA 1TWBA 4JZ4A 4J9EA 2RD1A 1NJIR 8ATCB 3PFSA 5HK3A 4JS4A 4Z8AA 1VQLA 2E70A 3CCLQ 1M2OA 2DXBA 3HTRA 4M78A 1BB9A 1X27A 3MEAA 1N27A 2YUNA 2PUKB 1TSFA 1M1KR 5HKCA 1M3CA 3BY7A 3QYHB 4QQDA 4BD3A 1W70A 3JCMd 3CCSQ 1BI1A 1QWEA 2ED1A 3NHNA 3FIFA 3PVLA 3EG9B 1PKSA 2EGEA 1VQNA 1K9MU 1MMNA 1NJIC 3QZ5B 4M75B 3VJPA 1JXOA 1I4K1 2YRVA 1BCOA 3L2WA 2DEUA 5GANf 2YRDA 3DKMA 4V2SA 1VQ7A 1YJ9T 2KAFA 2JTFA 1VQ9Q 3CC7Q 1ZLMA 2DF6A 3RMSA 5J3BA 5FRMA 1M1KC 3PGGA 3VUZA 1UTIA 2R57A 4J9FA 1M9SA 5FROA 1VQ6T 1RLQC 3DB3A 1K0SA 2K5IA 4RG2A 4M7DE 1AEYA 4E7HA 4PJOD 2JVVA 2DETA 1M27C 2F2WA 1VYUA 2XD0A 2EQKA 1K73U 1HD3A 1OOTA 2M9UA 3NPFA 1KQSA 3H0FA 2ZGWA 3GNGA 2CP2A 4WTOB 2L89A 1N6AA 2LNHB 1UGSB 3CD6Q 1KC8R 3OYNA 4QQGA 4C0FA 4D8KA 5KCHA 2PU9B 3GOXA 1X6GA 2BZXA 5GAN7 1VQKQ 4DOVA 1YJWQ 1YJNQ 2JT4A 3FRNA 3NFCA 1TTHB 2MIOA 4L6V5 2FPFA 2JTEA 2K6DA 4PJOF 4XU3A 5LJ5f 4PNOA 3SWNC 4LN2A 2GNCA 4C8QC 1KC8C 3LH5A 3F70A 1RAFB 3UDCA 2VXEA 1YHQT 1G2BA 2QYZA 3MEVA 2CP6A 3MEUA 3VS2A 2FB7A 3JV3A 4BI3A 3HRTA 2V8IA 1WLPB 1UFFA 4RTWA 4HT9A 3PIOA 3EHRA 2K3BA 1KQ1A 4F7UE 4BY6B 2PTKA 1VA7A 1R77A 3Q1JA 1RABB 4J9IA 1K4US 2DXCA 1QKWA 1IGUA 1W1FA 3CBPA 1U5SA 5IH2A 1PCXA 3I35A 1KJWA 1Y96B 4IUPA 1S72T 1JRIA 4QKUA 4EMKB 1MMAA 3M9QA 3E1SA 3OB9A 3C12A 4R55A 1UG1A 5KYYB 4M7DD 2DX1A 1QVFS 2HQHA 2KY9A 4F04B 5LJ3e 3JCMW 5FU6C 1R0CB 5CQXA 1MV0B 4AG1C 4PJOG 1VQ4T 1IZ6A 1C1AA 1WX6A 2RA2A 3JSCA 3UA7A 2RK2A 2GQVA 4FYVB 1BIBA 3MPUB 1IHVA 1VYVA 1EIFA 1OYXA 2CZ6B 2HZYA 3A8GB 4BE2A 3ULRB 1YCYA 2A7YA 2GCXA 1Y0MA 3LX7A 4E7IA 2BZ8A 2JOYA 1W2BS 1ZHIA 2NWMA 5A0DA 2KVQG 1GBQA 2E5KA 2E64A 4RG8A 2D8JA 2EPDA 3UF4A 2VGMA 5CKHA 4C92D 5FRNA 1D1BA 1N8RU 2K2VA 2OAWA 4M7AB 2P0PA 2XHCA 1WYXA 3QJ6A 1PG5B 2ZPBB 3V7RA 3CCQT 2RHZA 3EG3A 5GJWB 2FZKB 1P92A 3QDFA 4FYWB 3VV0A 2E5QA 2KROA 3ME9A 2DAQA 5GAMe 2FPEA 2D8HA 4QT7A 2OTJA 5GAOm 4OMOA 4FCYA 3BDUA 2HMAA 1Q7YR 1YN8A 2JUFA 3CCQA 1J3TA 4AT1B 1IXDA 1C0MA 3JRZA 2DNUA 2X9HA 2GTOA 1YNZA 2EGCA 4C92F 4OVAA 3CCMA 4EPCA 2DXUA 3FEOA 3GPLA 2LT4A 3SB2A 4KBMB 3CPWS 4HVWA 4N4GA 1AWOA 2RM4A 1RACB 1SSFA 3C4SA 4M78D 4C5GA 2XIDA 2LVMA 1QQJA 4M77C 2FPDA 2CGHA 1PSFA 4ESRA 2ABLA 3FJPA 3G4SA 4JRPA 2AHJB 2EJFA 3CCRA 2F2XA 2DRMA 5GAN8 5LJ3g 3NMZC 3H8ZA 2Y90A 2MK5A 4MDXA 3J81E 2YHTA 4ME7A 3VKIA 2V8JA 4M75F 1SG5A 3EH2A 3LYIA 2NUTA 3TSZA 2P0QA 4QVCA 1ZBJA 3DLMA 2XKOC 1UUEA 5C0MA 7AT1B 4C5IA 4QQ6A 2DM1A 1WXUA 1D1CA 2IPOB 2QQSA 3EFOB 4M78F 4DBHA 1OV3A 3TQ7P 2K79A 2JXBA 3G6EQ 2DL3A 2K3XA 2OTLA 4C92G 3A8OB 2EQUA 3LLRA 2J05A 2LQWA 2LCCA 3L2UA 1KFZA 3GLXA 5KCOA 3CCET 1WQ7A 1Q86R 3OYJA 2JS2A 4BI8B 3M0UA 2GFUA 4XTXA 4P5NA 2HDAA 2KRNA 4N4IA 2AT1B 4QVDA 1CKAA 1BI2A 1HSQA 1U8RA 2EQIA 1WDXA 1N9RA 2J06A 3I9QA 1SRLA 5EG2A 2CZ1B 1OULA 5GANe 5GAMg 2A0FB 5D6XA 2HQEA 1Q86C 3EG0A 3CMEQ 5HY6A 2K7AA 3OMCA 3G71A 3BFMA 1VQ8A 1B34B 3CCLT 3QKJA 3FDRA 3LWIA 4M75G 1EZZB 2QXFA 5CKFA 4A4GA 2K2MA 1JQQA 2OJ2A 1JBMA 1RLPC 4JJNK 5D6YA 3VYGA 1M2VA 2LQKA 3OMGA 4CC3A 1VQ5A 3CCST 1NJIU 4HVVA 3VS0A 4M78G 4Z89A 1UJ0A 1U1TA 4D8DA 2LNVA 3GBQA 2GGRA 3CCJQ 1ZQ1A 1RL2A 1T3SA 1KQSP 3OS2A 1M30A 4CC4B 1M1KU 3CC7T 2LT1A 2KK4A 3X20B 2BE7D 4Z88A 3PE0A 5GMKe 3NTHA 2X4JA 4N4HA 3QUIA 4MZTA 3SWNB 4C8QB 3VS6A 1K1ZA 2FG0A 2VWFA 1NLPC 1RADB 3MP8A 1OX9A 4K11A 4RTVA 1O9SA 3L2QA 3OY9A 5LJ5e 5GAN5 2HKNA 2KR3A 4IURA 2KT8A 3I55Q 3OYHA 1TUDA 2HSEB 3EGDA 2HBPA 3P8HA 3CD6T 2DTOA 2VVKA 3JCMf 2RO0A 3PNWC 4MZPA 1WXBA 4FYXB 1U3OA 2QAZA 4HKEA 9ATCB 4M7AD 1VQKT 1N5ZA 3WVDB 4OGEA 1YJNT 4FL6A 1GCPA 2J6KA 5HK0A 1D0ZA 1MNEA 1QCFA 4J5YA 5DY9A 4RMOA 3EG1A 4E2FB 1GCQA 2X3WD 2QQ9A 1OU8A 2YUPA 1KC8U 2ZAEA 5DLOA 3S3MA 2KI7A 5AT1B 4C92A 1SHGA 5LJ3j 3TSWA 3CC4T 1PHTA 5J39A 2QK0A 4PJOE 5CK9A 2RHXA 5FU6B 1VQOA 5LJ3d 1OPLA 1IB8A 2LCSA 1KD1R 4KGZB 2YLBA 3EFRA 5GANg 2DD4A 2L3QA 4M7AF 2XDPA 3M0QA 3JB9I 3CC4A 3KFVA 4J7IA 1VQPA 2XK0A 1WNLA 2RHUA 4BUGA 3RBBB 3M5AA 3HRUA 2NUZA 2LZ6B 2ZPGB 2ZPIB 3M58A 1WHMA 3BW1A 3OQ5A 3EG9A 1M90R 4DOWA 3FB9A 1MV3A 5DM7R 1TG0A 1D09B 1HYOA 1KD1C 4M75A 2O4XB 4IKFA 1G3TA 2K4YA 2KT1A 5GAOq 2CREA 2A36A 2JTMA 4KH0B 2F5KA 2DTIA 1HJDA 2DBKA 3QO3A 4F16A 1WI7A 2QI2A 1AOJA 1GFDA 1XJWB 5KYXB 2XMFA 3M53A 3RNJA 3ZEHA 4QW2A 3PIPA 2YLCA 4LDXA 5GAMj 2CH4W 2MCNA 1WHKA 2EQJA 4Y92A 4WF2A 3NTIA 1NEGA 5CQYA 4C0ZA 2NYSA 4F7UB 4E7KA 5GAMd 4LUEA 5LJ5g 4AFSC 2CYZB 2DYIA 4PFPA 2KNBB 1X75C 2EKOA 2O31A 2DA9A 4OB1B 3QDRB 4M7AG 1AZEA 3M4GA 2KXCA 4MMLA 4RKUE 2O88A 3UWNA 3VS4A 4X9DA 2GF7A 2XDBA 4PL6A 1R8OB 2L3RA 1BIAA 3VYHB 4LDUA 2XG8D 1X69A 4JS5A 1I5LA 3C0CA 4C0GA 1H8KA 2B8AA 2RNAA 4PJNA 3CCUQ 3P8DA 1A0NB 1YJ9A 2M1HA 2I0NA 1KK7A 1Y71A 4M77B 4JUVA 3HFOA 1QVGA 1VQ6A 1K9AA 1ZSZC 2DERA 4IUQA 1AZGB 2HL5C 1JJ2A 3CCVQ 2ENMA 4PLLA 2P4TA 1LNXA 5ECAA 3JAME 2DBMA 5GMKl 2LJ3A 3LGFA 3ER0A 1YIJQ 2EQMA 2BTTA 4A53A 3OYIA 1NE8A 4FW1A 2HL3A 4C92E 4HT8A 3REAB 1I8FA 4DBQA 1I5OB 2ZCFB 2ECZA 4DQ2A 2IG0A 4EDUA 3QBYA 1NG2A 2Y4XA 3CMAT 2E6NA 2JS0A 2V8KA 1GFCA 1Y96A 5KYUB 1VOMA 4HVUA 4EMKA 3M56A 1ZUKA 2CSIA 1YITQ 3QXEB 4J9DA 4M4ZA 1G3SA 5KYYA 4KGVB 1OPKA 1UJYA 3REBB 1T0HA 1EFNA 5GAN3 2XU8A 3CMAA 4E6RA 4PK4A 1WHJA 1YHQA 2JN0A 3AHUA 2CS7A 1NLOC 3X24B 1TH7A 2AIRB 1Q95G 3M59A 4JRQA 4RTYA 1FX7A 3V7CA 4LUDA 5GANj 4A4HA 4QVZA 4PJLA 2R58A 3WVEB 2JMAA 3A1PA 1MMGA 4GBQA 3E19A 4M75E 2X51A 2D1XA 5L23A 1VQLQ 2SEMA 1QW1A 4O5VA 2ROLA 2D6FA 4B9XA 1HXDA 4M7DC 3G6ET 4JRIA 4F17A 3P8BB 2YT6A 1PNJA 1VIEA 4C8QF 4M78E 1NEBA 2J7IA 3HP9A 3JCMJ 1S72A 1V76A 1JU5C 1UGRB 4RCCA 1VQNQ 2RMOA 2W10A 4C0DC 4JPBW 4M7AA 1WJQA 3QWYA 2R5AA 3KUFA 2LMJA 2L3PA 4N0AA 1WHHA 4LE9A 2PZ1A 2DL4A 1D0XA 2LQNA 1VIFA 3OYFA 1VQ7Q 2AK5A 1VQ4A 4MZMA 4OMQA 1PKTA 2EIFA 3HPWA 4J8OA 1UE9A 1Q86U 2O9VA
chains in the Genus database with same CATH topology
2A37A 4AFQC 1AWJA 3NGPA 3R6NA 2KGTA 2RF0A 2CSQA 1T0JA 2HSPA 1VYTA 2B86A 2JS2A 3M0UA 2LX7A 2GTJA 1H92A 2HDAA 2KRNA 2ED0A 3SHWA 3M0SA 1SEMA 2M0YA 1CKAA 1HSQA 2EQIA 1WDXA 2J06A 4JJDA 3I9QA 2H8HA 1SRLA 2JMCA 1I07A 2AKKA 1LCKA 1UGVA 3A98A 2RPNA 3EG0A 3TVTA 2K7AA 1S1NA 2A28A 1PRMC 1WIEA 1FMKA 1RI9A 4F14A 2GQIA 2V1QA 2EW3A 2KBTA 1Z9ZA 4WCIA 2EYXA 1QLYA 2K2MA 1JQQA 2OJ2A 1X2QA 1V1CA 1RLPC 2O9SA 2CUBA 4J9BA 4CC3A 4GLMA 1KSWA 1MUZA 1JO8A 4HVVA 4FSSA 2MOXA 3VS0A 4Z89A 4RTTA 1UJ0A 2JM8A 4D8DA 2CH4A 2HEQA 4OMPA 3FJ5A 1GBRA 4JZ4A 4J9EA 3GBQA 2GGRA 5EC7A 4A63B 3PVQA 1T3SA 1M30A 4Z8AA 4CC4B 4CC7A 2OI3A 5I22A 4ZNXA 4AG2C 1AWWA 1TUCA 1NM7A 1BB9A 1X27A 2YUNA 3H0IA 4Z88A 5FWCA 3VRYA 1PRLC 3PE0A 3QWXX 2W0ZA 1M3CA 1YP5A 2DVJA 3I5RA 2L3SA 4LNPA 2EBPA 3VS6A 5IHKA 1K1ZA 5IXFA 1W70A 2FG0A 1QWEA 2ED1A 3NHNA 2DL5A 4EIKA 3EHQA 3PVLA 1PKSA 2EGEA 2VWFA 1NLPC 4JJCA 1ZX6A 4K11A 2LP5A 4RTVA 2KXDA 1AVZC 5IXBA 2AKLA 1JXOA 2EYYA 1GRIA 2KR3A 2KT8A 1BK2A 1TUDA 1SPKA 4OMMA 1ZLMA 2DF6A 2KEAA 2KRSA 3U23A 1YCSB 1CKBA 2VVKA 1GL5A 1UTIA 2V1RA 1QWFA 4J9FA 1WXBA 5FW9A 1U3OA 1SSHA 1RLQC 1K0SA 1AEYA 1N5ZA 2DYBA 4DEXA 1GCPA 2J6KA 1KIKA 1M27C 1QCFA 2F2WA 1VYUA 2FEIA 1GCQC 2QDLA 3EG1A 1GCQA 1JXMA 2X3WD 1HD3A 1OOTA 4J9GA 2YUPA 3NPFA 3H0FA 1SHGA 2G6FX 3TSWA 2ROTA 1PHTA 2LNHB 3VS5A 1SRMA 4D8KA 2YDLA 4OMNA 2AZVA 2C0IA 1X6GA 2BZXA 1AWXA 1OPLA 2F2VA 2LCSA 5HCKA 1E6HA 1QKXA 4RTXA 4HCKA 2L3QA 2JT4A 2MIOA 3M0QA 1ZUUA 2FPFA 2JTEA 2K6DA 3KFVA 4ORZA 3RBBB 4LN2A 2GNCA 2NUZA 3LH5A 2LZ6B 1ABOA 1G83A 4DEYA 1G2BA 4JZ3A 3VS2A 3JV3A 1MV3A 4RUGA 1TG0A 1M3AA 4RTZA 2EGAA 2KT1A 5IHNA 3H0HA 2CREA 1WLPB 4IIMA 1UFFA 2A36A 2RQVA 4RTWA 2CDTA 1HJDA 2DBKA 3EHRA 2L2PA 2RQTA 1CSKA 4F16A 2K3BA 1WI7A 2PTKA 1ABQA 1AOJA 1K76A 1VA7A 2DE0X 1GFDA 1PWTA 2XMFA 3RNJA 4J9IA 1K4US 1QKWA 1W1FA 2CH4W 2MCNA 3UATA 1U5SA 5IH2A 2DL7A 3I35A 1M8MA 4Y92A 2FRWA 1KJWA 4HXJA 2C0OA 2EYWA 1T3LA 2CUDA 3VS7A 1NEGA 2EKHA 4KRTA 1ZSGA 1UG1A 4LUEA 2DX1A 4AFSC 2JW4A 3M0PA 1YWOA 2KNBB 2KYBA 4IIOA 2O31A 2DA9A 2P4RA 3M0RA 4JJBA 4CC2A 1I1JA 1AZEA 2GBQA 2KXCA 2O88A 1MV0B 1E7OA 4AG1C 3VS4A 2YUOA 1WX6A 2J6FA 4OMLA 3UA7A 1VYVA 1X69A 3EGUA 3C0CA 3ZL7C 1RUWA 1H8KA 2RNAA 1NYFA 3ULRB 1A0NB 4AFUC 4AFZC 2I0NA 1Y0MA 2JM9A 2BZ8A 2RN8A 2NWMA 1K9AA 2RQUA 1GBQA 2E5KA 1X6BA 2X3XD 2D8JA 2EPDA 1AZGB 1UHCA 2KE9A 2FO0A 3UF4A 2ENMA 2O2OA 2EVRA 5ECAA 2DBMA 2OAWA 2LJ3A 1WYXA 2IIMA 2SRCA 2BTTA 2DJQA 3H41A 2HBWA 1B07A 2EYZA 3UA6A 2YSQA 3EG3A 1UECA 5GJWB 3REAB 2FRYA 2C0TA 2ECZA 1WA7A 4J9CA 2KROA 1WXTA 1NG2A 2FPEA 2D8HA 1UDLA 3SEMA 4QT7A 2JS0A 1GFCA 5I11A 4OMOA 4HVUA 1YN8A 1ZUKA 2KYMA 1WFWA 2CSIA 2ESWA 2DMOA 3THKA 1FYNA 4J9DA 1BBZA 2VKNA 4M4ZA 1J3TA 4RTUA 1OPKA 1ZUYA 2DNUA 1UJYA 2GTOA 1YNZA 3REBB 2EGCA 1T0HA 2CT3A 4X1VA 1H3HA 1X43A 1EFNA 2M51A 3O5ZA 2PNIA 2L0AA 1OEBA 5FWBA 4E6RA 1ARKA 1M3BA 1NLOC 2K9GA 4HVWA 1AWOA 1Z9QA 4RTYA 4LUDA 1K0XA 4J9HA 2JMAA 2KRMA 2DRKA 4GBQA 1UHFA 2FPDA 1I0CA 2D1XA 3VRZA 1B3QA 1XOVA 5L23A 4ESRA 2SEMA 2ABLA 1NYGA 2ROLA 1U06A 4F17A 2F2XA 2DRMA 2YT6A 1PNJA 2D0NA 1JEGA 1SHFA 1NEBA 3NMZC 1Y57A 2DLPA 2J7IA 3VS1A 2CT4A 1W6XA 2BZYA 2RQRA 3IQLA 3EG2A 1AD5A 1JU5C 3TSZA 2RMOA 2W10A 4JPBW 1ZBJA 1UUEA 3QWYA 1BU1A 2LMJA 2AZSA 5GJVB 2L3PA 1E6GA 1IO6A 3CQTA 4LE9A 2DL8A 2PZ1A 2DM1A 2DL4A 1WXUA 2LJ1A 2LJ0A 3I5SA 5IHIA 2LQNA 2YUQA 1OV3A 2HCKA 1YWPA 2K79A 2AK5A 2J6OA 2RQWA 2JXBA 3VS3A 4OMQA 2DL3A 1PKTA 1UE9A 2DILA 2J05A 3M0TA 2LQWA 4R0KA 2O9VA 2A08A 1X2KA 1KFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A37 A;  4AFQ C;  1AWJ A;  3NGP A;  3R6N A;  2KGT A;  2RF0 A;  2CSQ A;  1T0J A;  2HSP A;  1VYT A;  2B86 A;  2JS2 A;  3M0U A;  2LX7 A;  2GTJ A;  1H92 A;  2HDA A;  2KRN A;  2ED0 A;  3SHW A;  3M0S A;  1SEM A;  2M0Y A;  1CKA A;  1HSQ A;  2EQI A;  1WDX A;  2J06 A;  4JJD A;  3I9Q A;  2H8H A;  1SRL A;  2JMC A;  1I07 A;  2AKK A;  1LCK A;  1UGV A;  3A98 A;  2RPN A;  3EG0 A;  3TVT A;  2K7A A;  1S1N A;  2A28 A;  1PRM C;  1WIE A;  1FMK A;  1RI9 A;  4F14 A;  2GQI A;  2V1Q A;  2EW3 A;  2KBT A;  1Z9Z A;  4WCI A;  2EYX A;  1QLY A;  2K2M A;  1JQQ A;  2OJ2 A;  1X2Q A;  1V1C A;  1RLP C;  2O9S A;  2CUB A;  4J9B A;  4CC3 A;  4GLM A;  1KSW A;  1MUZ A;  1JO8 A;  4HVV A;  4FSS A;  2MOX A;  3VS0 A;  4Z89 A;  4RTT A;  1UJ0 A;  2JM8 A;  4D8D A;  2CH4 A;  2HEQ A;  4OMP A;  3FJ5 A;  1GBR A;  4JZ4 A;  4J9E A;  3GBQ A;  2GGR A;  5EC7 A;  4A63 B;  3PVQ A;  1T3S A;  1M30 A;  4Z8A A;  4CC4 B;  4CC7 A;  2OI3 A;  5I22 A;  4ZNX A;  4AG2 C;  1AWW A;  1TUC A;  1NM7 A;  1BB9 A;  1X27 A;  2YUN A;  3H0I A;  4Z88 A;  5FWC A;  3VRY A;  1PRL C;  3PE0 A;  3QWX X;  2W0Z A;  1M3C A;  1YP5 A;  2DVJ A;  3I5R A;  2L3S A;  4LNP A;  2EBP A;  3VS6 A;  5IHK A;  1K1Z A;  5IXF A;  1W70 A;  2FG0 A;  1QWE A;  2ED1 A;  3NHN A;  2DL5 A;  4EIK A;  3EHQ A;  3PVL A;  1PKS A;  2EGE A;  2VWF A;  1NLP C;  4JJC A;  1ZX6 A;  4K11 A;  2LP5 A;  4RTV A;  2KXD A;  1AVZ C;  5IXB A;  2AKL A;  1JXO A;  2EYY A;  1GRI A;  2KR3 A;  2KT8 A;  1BK2 A;  1TUD A;  1SPK A;  4OMM A;  1ZLM A;  2DF6 A;  2KEA A;  2KRS A;  3U23 A;  1YCS B;  1CKB A;  2VVK A;  1GL5 A;  1UTI A;  2V1R A;  1QWF A;  4J9F A;  1WXB A;  5FW9 A;  1U3O A;  1SSH A;  1RLQ C;  1K0S A;  1AEY A;  1N5Z A;  2DYB A;  4DEX A;  1GCP A;  2J6K A;  1KIK A;  1M27 C;  1QCF A;  2F2W A;  1VYU A;  2FEI A;  1GCQ C;  2QDL A;  3EG1 A;  1GCQ A;  1JXM A;  2X3W D;  1HD3 A;  1OOT A;  4J9G A;  2YUP A;  3NPF A;  3H0F A;  1SHG A;  2G6F X;  3TSW A;  2ROT A;  1PHT A;  2LNH B;  3VS5 A;  1SRM A;  4D8K A;  2YDL A;  4OMN A;  2AZV A;  2C0I A;  1X6G A;  2BZX A;  1AWX A;  1OPL A;  2F2V A;  2LCS A;  5HCK A;  1E6H A;  1QKX A;  4RTX A;  4HCK A;  2L3Q A;  2JT4 A;  2MIO A;  3M0Q A;  1ZUU A;  2FPF A;  2JTE A;  2K6D A;  3KFV A;  4ORZ A;  3RBB B;  4LN2 A;  2GNC A;  2NUZ A;  3LH5 A;  2LZ6 B;  1ABO A;  1G83 A;  4DEY A;  1G2B A;  4JZ3 A;  3VS2 A;  3JV3 A;  1MV3 A;  4RUG A;  1TG0 A;  1M3A A;  4RTZ A;  2EGA A;  2KT1 A;  5IHN A;  3H0H A;  2CRE A;  1WLP B;  4IIM A;  1UFF A;  2A36 A;  2RQV A;  4RTW A;  2CDT A;  1HJD A;  2DBK A;  3EHR A;  2L2P A;  2RQT A;  1CSK A;  4F16 A;  2K3B A;  1WI7 A;  2PTK A;  1ABQ A;  1AOJ A;  1K76 A;  1VA7 A;  2DE0 X;  1GFD A;  1PWT A;  2XMF A;  3RNJ A;  4J9I A;  1K4U S;  1QKW A;  1W1F A;  2CH4 W;  2MCN A;  3UAT A;  1U5S A;  5IH2 A;  2DL7 A;  3I35 A;  1M8M A;  4Y92 A;  2FRW A;  1KJW A;  4HXJ A;  2C0O A;  2EYW A;  1T3L A;  2CUD A;  3VS7 A;  1NEG A;  2EKH A;  4KRT A;  1ZSG A;  1UG1 A;  4LUE A;  2DX1 A;  4AFS C;  2JW4 A;  3M0P A;  1YWO A;  2KNB B;  2KYB A;  4IIO A;  2O31 A;  2DA9 A;  2P4R A;  3M0R A;  4JJB A;  4CC2 A;  1I1J A;  1AZE A;  2GBQ A;  2KXC A;  2O88 A;  1MV0 B;  1E7O A;  4AG1 C;  3VS4 A;  2YUO A;  1WX6 A;  2J6F A;  4OML A;  3UA7 A;  1VYV A;  1X69 A;  3EGU A;  3C0C A;  3ZL7 C;  1RUW A;  1H8K A;  2RNA A;  1NYF A;  3ULR B;  1A0N B;  4AFU C;  4AFZ C;  2I0N A;  1Y0M A;  2JM9 A;  2BZ8 A;  2RN8 A;  2NWM A;  1K9A A;  2RQU A;  1GBQ A;  2E5K A;  1X6B A;  2X3X D;  2D8J A;  2EPD A;  1AZG B;  1UHC A;  2KE9 A;  2FO0 A;  3UF4 A;  2ENM A;  2O2O A;  2EVR A;  5ECA A;  2DBM A;  2OAW A;  2LJ3 A;  1WYX A;  2IIM A;  2SRC A;  2BTT A;  2DJQ A;  3H41 A;  2HBW A;  1B07 A;  2EYZ A;  3UA6 A;  2YSQ A;  3EG3 A;  1UEC A;  5GJW B;  3REA B;  2FRY A;  2C0T A;  2ECZ A;  1WA7 A;  4J9C A;  2KRO A;  1WXT A;  1NG2 A;  2FPE A;  2D8H A;  1UDL A;  3SEM A;  4QT7 A;  2JS0 A;  1GFC A;  5I11 A;  4OMO A;  4HVU A;  1YN8 A;  1ZUK A;  2KYM A;  1WFW A;  2CSI A;  2ESW A;  2DMO A;  3THK A;  1FYN A;  4J9D A;  1BBZ A;  2VKN A;  4M4Z A;  1J3T A;  4RTU A;  1OPK A;  1ZUY A;  2DNU A;  1UJY A;  2GTO A;  1YNZ A;  3REB B;  2EGC A;  1T0H A;  2CT3 A;  4X1V A;  1H3H A;  1X43 A;  1EFN A;  2M51 A;  3O5Z A;  2PNI A;  2L0A A;  1OEB A;  5FWB A;  4E6R A;  1ARK A;  1M3B A;  1NLO C;  2K9G A;  4HVW A;  1AWO A;  1Z9Q A;  4RTY A;  4LUD A;  1K0X A;  4J9H A;  2JMA A;  2KRM A;  2DRK A;  4GBQ A;  1UHF A;  2FPD A;  1I0C A;  2D1X A;  3VRZ A;  1B3Q A;  1XOV A;  5L23 A;  4ESR A;  2SEM A;  2ABL A;  1NYG A;  2ROL A;  1U06 A;  4F17 A;  2F2X A;  2DRM A;  2YT6 A;  1PNJ A;  2D0N A;  1JEG A;  1SHF A;  1NEB A;  3NMZ C;  1Y57 A;  2DLP A;  2J7I A;  3VS1 A;  2CT4 A;  1W6X A;  2BZY A;  2RQR A;  3IQL A;  3EG2 A;  1AD5 A;  1JU5 C;  3TSZ A;  2RMO A;  2W10 A;  4JPB W;  1ZBJ A;  1UUE A;  3QWY A;  1BU1 A;  2LMJ A;  2AZS A;  5GJV B;  2L3P A;  1E6G A;  1IO6 A;  3CQT A;  4LE9 A;  2DL8 A;  2PZ1 A;  2DM1 A;  2DL4 A;  1WXU A;  2LJ1 A;  2LJ0 A;  3I5S A;  5IHI A;  2LQN A;  2YUQ A;  1OV3 A;  2HCK A;  1YWP A;  2K79 A;  2AK5 A;  2J6O A;  2RQW A;  2JXB A;  3VS3 A;  4OMQ A;  2DL3 A;  1PKT A;  1UE9 A;  2DIL A;  2J05 A;  3M0T A;  2LQW A;  4R0K A;  2O9V A;  2A08 A;  1X2K A;  1KFZ A; 
#chains in the Genus database with same CATH topology
 4AFQ C;  3GIB A;  1AWJ A;  4LXC A;  1ZA2 B;  3CME T;  2CSQ A;  5GAO n;  2CP7 A;  4Y28 E;  2P84 A;  2HSP A;  3L2V A;  2B86 A;  2E12 A;  1D1A A;  2LCL A;  2LX7 A;  3RKX A;  2GTJ A;  3X28 B;  2F1L A;  2ED0 A;  2VUB A;  1DJ7 B;  1SEM A;  2DFU A;  3CC2 T;  4ATO A;  5L8R E;  5I21 A;  3KBG A;  5GAO r;  4JJD A;  1RAG B;  1KQS S;  2H8H A;  5GAN 4;  4PJJ A;  3CPF A;  1QVG S;  1I07 A;  4E47 A;  5A0G A;  3CCJ T;  1MMD A;  3A98 A;  3OS5 A;  4C8Q G;  1EX4 A;  2K57 A;  2FZG B;  4J6X A;  2EWN A;  2A28 A;  1PRM C;  3M4Y A;  3JCM e;  1FMK A;  3CC2 A;  4HCC A;  2V1Q A;  4XTW A;  4BAC A;  1Z9Z A;  2MWP A;  2QAS A;  1UGP B;  2CUB A;  4GLM A;  1KSW A;  4M75 D;  1JO8 A;  1OZ3 A;  4XU1 A;  2HEQ A;  1O75 A;  4OMP A;  1QMC A;  1V29 B;  1GBR A;  2E3I A;  2LTO A;  4GLK A;  4IUU A;  1VQM T;  3E9F A;  4A63 B;  1Q7Y C;  3JCM X;  1XTD A;  4M78 C;  5CKE A;  4EMG A;  4IUV A;  2Y4Y A;  4AG2 C;  3OW2 A;  1AWW A;  1TUC A;  1NM7 A;  2XI9 A;  3EFO A;  4XU2 A;  5FWC A;  1PRL C;  1RAA B;  1YI2 T;  1FMV A;  2W0Z A;  1YP5 A;  3I5R A;  2L3S A;  5CO7 A;  4E7J A;  2EBP A;  3INZ A;  3HRS A;  4XAX B;  2KQW A;  1VQM A;  2DL5 A;  2KMT A;  1WJS A;  4EIK A;  3J7A F;  4ZGD B;  4M77 D;  4EMH A;  2LP5 A;  1HK9 A;  5GAN 2;  2KXD A;  3C95 A;  4JLI A;  5IXB A;  2AKL A;  2D9T A;  1WGS A;  2EYY A;  4C5E A;  1YI2 A;  1SPK A;  3OS0 A;  4DBR A;  2JNG A;  2KRS A;  1YCS B;  3PMT A;  1GL5 A;  2VXF A;  1QWF A;  2XDD A;  2MMP A;  3I56 T;  5FW9 A;  1SSH A;  3OYC A;  3L2Z A;  2DYB A;  4DEX A;  3CEY A;  2VYT A;  4D6W A;  1B34 A;  3JB9 D;  5KE3 A;  4J9G A;  3CXC A;  4X9C A;  4Q5W A;  2DIQ A;  4M77 F;  2M0O A;  1RAI B;  4ANJ A;  4M7A E;  5LJ3 h;  3I56 A;  1G3Y A;  5GAN 6;  3VS5 A;  3BE3 A;  2QA4 T;  3OA6 A;  2YDL A;  1KD1 U;  2AZV A;  4BDZ A;  3CCE A;  1OX8 A;  2MYS A;  4DBF A;  3ZBD A;  2F2V A;  2CP0 A;  5HCK A;  4LDV A;  1E6H A;  4A4E A;  3LGL A;  1QKX A;  2PVD B;  2ZZD A;  4Z02 A;  1QCO A;  2L5Q A;  4PJO B;  2QA4 A;  3JCM g;  1KQ2 A;  4ORZ A;  3J80 E;  1NPR A;  3JB9 F;  3E2U A;  1ABO A;  3RUX A;  2M02 A;  3SWN A;  4C8Q A;  4JZ3 A;  1WPY A;  4JRK A;  1R0B G;  2KDS A;  1ZSZ B;  2HQX A;  3FLG A;  1UEB A;  3HSB A;  1M3A A;  1TU0 B;  4MMK A;  4RTZ A;  5IT9 E;  2EGA A;  2OTJ Q;  2CP3 A;  3CCL A;  3H0H A;  1FXX A;  4XTZ A;  4IIM A;  3MKD A;  3CCQ Q;  2L2P A;  1QVG P;  2RQT A;  1VQ9 T;  4NOY A;  1KHC A;  1ABQ A;  4IUT A;  1I81 A;  1PWT A;  4L59 A;  4LD9 K;  3CCS A;  4ZN1 A;  5CVI A;  3CCM Q;  4M77 G;  5GAM h;  1JJ2 P;  4E7S A;  1M8M A;  2FRW A;  4HXJ A;  3ZFJ A;  1BI3 A;  1T3L A;  2M16 A;  3VS7 A;  4L5G A;  2LQ8 A;  2EKH A;  5AYF A;  2COW A;  1X6O A;  1VUB A;  1VQ9 A;  3CC7 A;  1LJO A;  2JW4 A;  5GMK m;  2E41 A;  1QP3 A;  1YWO A;  4IIO A;  3CBM A;  3A5Z B;  4CC2 A;  4JJB A;  4OMF B;  1E7O A;  3PMI A;  1XQH A;  3G4S Q;  3JCM b;  1NPP A;  3CCR Q;  2J6F A;  4UC4 A;  1ZA1 B;  5KYW B;  3JB9 G;  2BE9 B;  1YJW T;  4GY5 A;  3RKW A;  3ZL7 C;  1RUW A;  2DD5 A;  2EAY A;  1PD0 A;  2IVW A;  1YIJ T;  2MWO A;  4JLG A;  4AFZ C;  3QJY A;  2F69 A;  3CD6 A;  2DZ9 A;  2GFA A;  1WJR A;  3KXT A;  4KH1 B;  3NTK A;  3EGX B;  3N5B B;  3LWH A;  1Q81 R;  4M7D B;  1M8V A;  3T9N A;  1X6B A;  1VQK A;  1YJW A;  3MP6 A;  1YJN A;  2L8D A;  2KE9 A;  2OTL Q;  3JB9 J;  3MET A;  4B9W A;  4CRI A;  4E7L A;  4ZTJ A;  1YIJ A;  2O4X A;  4NS5 A;  3OYE A;  1YIT T;  2LRQ A;  1Y07 A;  5C6S A;  2NUP B;  4C0D B;  3X25 B;  2IIM A;  3D7S B;  1LPL A;  3H41 A;  4OGC A;  4ZGE B;  2EYZ A;  3UA6 A;  5KYX A;  2YSQ A;  1UEC A;  1Q81 C;  2E1H A;  1M1G A;  2FRY A;  2C06 A;  4J9C A;  3EFS A;  3EAE A;  1JB0 E;  1H3Z A;  1WXT A;  4CI0 C;  4LDY A;  2WSF E;  2QGG A;  2KYM A;  2ESW A;  3THK A;  4F7U A;  1FYN A;  4RTU A;  1ZUY A;  4XTV A;  1VQL T;  2QEX Q;  3G71 Q;  4X1V A;  3ASK A;  1H3H A;  1VQ8 Q;  2M51 A;  3O5Z A;  4PLI A;  4PJM A;  3M54 A;  2MI6 A;  3HFN A;  1KG1 A;  2L0A A;  5FWB A;  2FL7 A;  1ARK A;  4ZGJ B;  2BIV A;  2RHI A;  2K9G A;  1K8A R;  1NZ9 A;  5KE2 A;  1Z9Q A;  3QYG B;  3TU4 K;  2K5F A;  1K0X A;  1QVF A;  5GAN h;  1VQ5 Q;  4C8Q E;  1ACM B;  1M90 C;  1VQN T;  2G3R A;  2DRK A;  2X4W A;  1B7T A;  1QCN A;  1G8X A;  1I0C A;  3VRZ A;  3OYM A;  1XOV A;  1D3B B;  1G3W A;  4M77 A;  5A0L A;  3UT1 A;  1NYG A;  3G7Z A;  1U06 A;  2O01 E;  1VQ7 T;  1TS9 A;  2LC4 A;  2VC8 A;  1OQK A;  5CCA A;  3RMQ A;  1SHF A;  3C94 A;  1Q82 R;  1K8A C;  3AT1 B;  3OYB A;  5CKD A;  4PKC C;  2RQR A;  1W2B A;  1AD5 A;  2QTV A;  3HL8 A;  2RHY A;  2PVO B;  2VGN A;  2FHD A;  1BU1 A;  2AZS A;  4PJO C;  5GJV B;  3LH0 A;  3CQT A;  1YFN A;  1XNI A;  5CR2 A;  2LJ1 A;  4M78 B;  5GMK h;  2LJ0 A;  3I5S A;  5IHI A;  2HCK A;  3VS3 A;  2RQW A;  1QP2 A;  4NL3 A;  1BCM A;  1Q82 C;  2DIL A;  5J26 A;  4J9B A;  2A08 A;  1X2K A;  1PSE A;  5KYU A;  3NGP A;  3R6N A;  3DLL A;  2KGT A;  2RF0 A;  2H3J A;  5LJ5 h;  2Z0W A;  1OI1 A;  3GP8 A;  5FU7 C;  4Y91 A;  3OW2 P;  3L42 A;  2VAS A;  2EFI A;  3M0S A;  2M0Y A;  2EJ9 A;  3MP1 A;  3URG A;  3JCM P;  2DO3 A;  5LL6 S;  2RB6 A;  5CIU A;  1LOJ A;  5FLX E;  2XIC A;  2JMC A;  1Q7Y U;  5I2M A;  2ZPH B;  1VQO Q;  1LCK A;  1UGV A;  8AT1 B;  2RPN A;  3A8L B;  3TVT A;  3FC3 A;  2E3H A;  3LW5 E;  1S1N A;  4FM4 B;  3MO8 A;  3CPW A;  5KYN A;  4XU0 A;  3OBW A;  4C8Q D;  2EW3 A;  1QLY A;  4J6Y A;  3OYA A;  3CC4 Q;  1X2Q A;  3CBO A;  2FVU A;  3QHS A;  1VQP Q;  1RAH B;  2JZ2 A;  1MUZ A;  4LDW A;  4FSS A;  4RTT A;  2CH4 A;  2A3L A;  2OX7 A;  3FJ5 A;  3M55 A;  5EC7 A;  3PVQ A;  1U1S A;  3SFM A;  1BYM A;  3CXC P;  2QQA A;  4CC7 A;  1MND A;  2OI3 A;  5I22 A;  4ZNX A;  3RDV A;  1M4Z A;  5GAN d;  3H0I A;  3VRY A;  3QWX X;  2E4H A;  1IRE B;  2DVJ A;  4LNP A;  3QII A;  2H3E B;  1TOV A;  5IHK A;  5IXF A;  2ZPE B;  3EHQ A;  1RI0 A;  4JJC A;  3GNF B;  1ZX6 A;  2DTH A;  3OYY A;  3H6Z A;  1AVZ C;  3OYL A;  1W4S A;  4J7F A;  2PVG B;  2D0Q B;  1GRI A;  1AHJ B;  1K9M R;  1BK2 A;  1WHL A;  4OMM A;  3DB4 A;  3G6E A;  2KEA A;  3V8K A;  1SKU B;  2RJC A;  3U23 A;  1CKB A;  3EH1 A;  5GMK j;  4M77 E;  2V1R A;  5IAY A;  5I2S A;  2CZ7 B;  2MPX C;  5DLQ E;  3HKS A;  1KIK A;  2FEI A;  2QDL A;  1GCQ C;  2PQW A;  4OB2 B;  2X4Y A;  1MGQ A;  1UGQ B;  5LJ5 j;  5M9O A;  1JXM A;  3L1A A;  3A8H B;  4C92 C;  2KSS A;  1K9M C;  3PT9 A;  2R5M A;  4FYY B;  1YJ9 Q;  3SDZ A;  3M57 A;  2G6F X;  1K73 R;  5GAO p;  3BDL A;  2ROT A;  4M7D F;  2X4X A;  1SRM A;  3OS1 A;  5LJ5 d;  1G5V A;  1IGQ A;  1AT1 B;  2ATC B;  3UPU A;  3QG1 A;  4FU6 A;  4OMN A;  4XK8 E;  4C5H A;  4HCB A;  1VQ6 Q;  1RAE B;  2C0I A;  2HNI A;  2QTX A;  1AWX A;  1KHI A;  3CME A;  1IHW A;  2OTJ T;  1X01 A;  4BI4 A;  3MJX A;  4RTX A;  1PM3 A;  4JDS A;  4HCK A;  3RIR A;  4XTY A;  6AT1 B;  3QZ9 B;  1IRX A;  1ZUU A;  4BB7 A;  1JJ2 S;  3JB9 H;  4KUD K;  1K73 C;  2K3Y A;  4DA4 A;  3CCM T;  3MEW A;  3V7S A;  2RJE A;  1G83 A;  4DEY A;  1QVP A;  3CCJ A;  4ELY C;  2X35 A;  4M75 C;  4RUG A;  1GXI E;  1OU9 A;  3OYD A;  4BDY A;  4BE1 A;  1C6V X;  5IHN A;  4A4F A;  1BI0 A;  2FZC B;  2RQV A;  3WXM B;  2CDT A;  3I55 T;  2WSE E;  4FW2 A;  1CSK A;  3R6O A;  3RR6 A;  2DE0 X;  1K76 A;  2VV5 A;  1PC0 A;  2F5T X;  4FIB A;  3G4S T;  3SD4 A;  3CCR T;  2DIG A;  3CMA Q;  3UAT A;  5GMK i;  1YHQ Q;  2DL7 A;  4MDW A;  2C0O A;  2EYW A;  4M7D G;  4KT0 E;  4R56 A;  2CUD A;  4ELZ C;  4XQ3 A;  3I55 A;  2HAX A;  4KRT A;  1ZSG A;  2RI2 A;  1M1F A;  4F7U F;  4FT2 A;  2LX9 A;  2LDM A;  4OF1 A;  2QQR A;  3M0P A;  2KYB A;  1ZBX A;  2EYQ A;  2P4R A;  3M0R A;  1I1J A;  2GBQ A;  2QQB A;  2YUO A;  3OYK A;  2OTL T;  3JCM V;  2DK3 A;  4OML A;  1WQW A;  2VB6 A;  1Y7X A;  4KUL A;  4II1 A;  3EGU A;  4O6J A;  1S72 Q;  2MF2 A;  1NYF A;  2YXY A;  2FYK A;  4AFU C;  2WSC E;  4PJO A;  4PFO A;  2JM9 A;  5KH6 A;  1Q81 U;  2RI3 A;  3MCA B;  4ZTF A;  2RN8 A;  3X26 B;  2RJD A;  2CKK A;  2RQU A;  3JCM c;  5CAI A;  1QVF P;  2X3X D;  1VQ4 Q;  1ZSZ A;  1UHC A;  2FO0 A;  2O2O A;  2EVR A;  2DZC A;  1H64 1;  2NUT B;  1UB4 A;  3S3N A;  1D0Y A;  3RKY A;  2QEX T;  4X34 A;  3G1J A;  3G71 T;  4BY6 C;  1VQ8 T;  1YBY A;  1N8R R;  2SRC A;  3TRE A;  2DJQ A;  5D6W A;  2RI5 A;  4J6W A;  2HBW A;  3VU3 C;  1B07 A;  1PD1 A;  4F7U G;  2E6Z A;  3QSU A;  2C0T A;  1WA7 A;  1M90 U;  3PTA A;  1NBE B;  4FT4 A;  1MHN A;  1VQ5 T;  1UDL A;  5LJ3 f;  3SEM A;  4XTU A;  1W2B P;  2RK1 A;  4EMK C;  5I11 A;  2K5L A;  4A54 A;  5D7U A;  2QEX A;  1WFW A;  4A4K A;  1OZ2 A;  2DMO A;  4PFZ A;  1BBZ A;  2VKN A;  2ZPF B;  1TUG B;  2DPP B;  5FU7 B;  1N8R C;  2CT3 A;  1FMW A;  1X43 A;  4TVR A;  1K8A U;  3CC2 Q;  4ZN3 A;  4E7Z A;  2PNI A;  1OEB A;  3S6W A;  1M3B A;  3V8L A;  2P0K A;  4OB3 B;  5KYW A;  2V26 A;  2E65 A;  4J9H A;  2KRM A;  1M5Q 1;  2DXT A;  1TXQ A;  4RCB A;  5IN1 A;  3CCU T;  3JCM h;  3MHX A;  2CZ0 B;  1UHF A;  4BE0 A;  3OYG A;  1B3Q A;  3TEE A;  2DJZ A;  3OSS C;  2RH2 A;  1Q82 U;  1SF9 A;  3RER A;  3EGX A;  4M7D A;  4OB0 B;  2D0N A;  1M2V B;  1JEG A;  4J83 A;  3QPH A;  1Y57 A;  5GAO l;  3OW2 S;  2DLP A;  3JCM Q;  3VS1 A;  2CT4 A;  4AMC A;  3CCV T;  1W6X A;  3HHT B;  3CCU A;  2BZY A;  2JJ9 A;  4LD6 A;  2YWW A;  4HA8 A;  3IQL A;  3EG2 A;  1VQM Q;  1F1B B;  3OBY A;  1LVK A;  4M7A C;  5GAM f;  3CPW P;  2EJG A;  2NUP A;  3O8V A;  4N0A C;  3RES A;  2DVE A;  1E6G A;  1IO6 A;  1FWZ A;  2DL8 A;  2NLU A;  2CP5 A;  2QG9 B;  2YUQ A;  1YI2 Q;  1BKB A;  1YWP A;  2J6O A;  5A2Q E;  2E10 A;  3CCV A;  2DKG A;  3M0T A;  4FSX A;  1VQO T;  4R0K A;  2I2L A;  2A37 A;  2MAM A;  1T0J A;  3A8M B;  4OP0 A;  1VYT A;  2BKD N;  2PUO B;  3VUB A;  1WZO A;  1H92 A;  3OSV A;  3SHW A;  3EGD B;  2HD0 A;  5CKB A;  1VQP T;  3L2R A;  2COY A;  3I56 Q;  3GF5 A;  2HKQ B;  3CXC S;  4VUB A;  2WAC A;  2DEQ A;  2QDY B;  2AKK A;  1YIT A;  2RJF A;  4KUI A;  4NL2 A;  3CCE Q;  2BUD A;  1N9S A;  3S3O A;  2YRC A;  1WIE A;  4YTL A;  1RI9 A;  1D3B A;  4F14 A;  2GQI A;  2OAU A;  3V8J A;  1WHG A;  2KBT A;  4WCI A;  4C92 B;  2EYX A;  2COZ A;  3TCJ A;  3E9G A;  2QA4 Q;  1V1C A;  4B6M A;  3H9N A;  2O9S A;  2QGF B;  2MOX A;  4KGX B;  2JM8 A;  4HCZ A;  1TWB A;  4JZ4 A;  4J9E A;  2RD1 A;  1NJI R;  8ATC B;  3PFS A;  5HK3 A;  4JS4 A;  4Z8A A;  1VQL A;  2E70 A;  3CCL Q;  1M2O A;  2DXB A;  3HTR A;  4M78 A;  1BB9 A;  1X27 A;  3MEA A;  1N27 A;  2YUN A;  2PUK B;  1TSF A;  1M1K R;  5HKC A;  1M3C A;  3BY7 A;  3QYH B;  4QQD A;  4BD3 A;  1W70 A;  3JCM d;  3CCS Q;  1BI1 A;  1QWE A;  2ED1 A;  3NHN A;  3FIF A;  3PVL A;  3EG9 B;  1PKS A;  2EGE A;  1VQN A;  1K9M U;  1MMN A;  1NJI C;  3QZ5 B;  4M75 B;  3VJP A;  1JXO A;  1I4K 1;  2YRV A;  1BCO A;  3L2W A;  2DEU A;  5GAN f;  2YRD A;  3DKM A;  4V2S A;  1VQ7 A;  1YJ9 T;  2KAF A;  2JTF A;  1VQ9 Q;  3CC7 Q;  1ZLM A;  2DF6 A;  3RMS A;  5J3B A;  5FRM A;  1M1K C;  3PGG A;  3VUZ A;  1UTI A;  2R57 A;  4J9F A;  1M9S A;  5FRO A;  1VQ6 T;  1RLQ C;  3DB3 A;  1K0S A;  2K5I A;  4RG2 A;  4M7D E;  1AEY A;  4E7H A;  4PJO D;  2JVV A;  2DET A;  1M27 C;  2F2W A;  1VYU A;  2XD0 A;  2EQK A;  1K73 U;  1HD3 A;  1OOT A;  2M9U A;  3NPF A;  1KQS A;  3H0F A;  2ZGW A;  3GNG A;  2CP2 A;  4WTO B;  2L89 A;  1N6A A;  2LNH B;  1UGS B;  3CD6 Q;  1KC8 R;  3OYN A;  4QQG A;  4C0F A;  4D8K A;  5KCH A;  2PU9 B;  3GOX A;  1X6G A;  2BZX A;  5GAN 7;  1VQK Q;  4DOV A;  1YJW Q;  1YJN Q;  2JT4 A;  3FRN A;  3NFC A;  1TTH B;  2MIO A;  4L6V 5;  2FPF A;  2JTE A;  2K6D A;  4PJO F;  4XU3 A;  5LJ5 f;  4PNO A;  3SWN C;  4LN2 A;  2GNC A;  4C8Q C;  1KC8 C;  3LH5 A;  3F70 A;  1RAF B;  3UDC A;  2VXE A;  1YHQ T;  1G2B A;  2QYZ A;  3MEV A;  2CP6 A;  3MEU A;  3VS2 A;  2FB7 A;  3JV3 A;  4BI3 A;  3HRT A;  2V8I A;  1WLP B;  1UFF A;  4RTW A;  4HT9 A;  3PIO A;  3EHR A;  2K3B A;  1KQ1 A;  4F7U E;  4BY6 B;  2PTK A;  1VA7 A;  1R77 A;  3Q1J A;  1RAB B;  4J9I A;  1K4U S;  2DXC A;  1QKW A;  1IGU A;  1W1F A;  3CBP A;  1U5S A;  5IH2 A;  1PCX A;  3I35 A;  1KJW A;  1Y96 B;  4IUP A;  1S72 T;  1JRI A;  4QKU A;  4EMK B;  1MMA A;  3M9Q A;  3E1S A;  3OB9 A;  3C12 A;  4R55 A;  1UG1 A;  5KYY B;  4M7D D;  2DX1 A;  1QVF S;  2HQH A;  2KY9 A;  4F04 B;  5LJ3 e;  3JCM W;  5FU6 C;  1R0C B;  5CQX A;  1MV0 B;  4AG1 C;  4PJO G;  1VQ4 T;  1IZ6 A;  1C1A A;  1WX6 A;  2RA2 A;  3JSC A;  3UA7 A;  2RK2 A;  2GQV A;  4FYV B;  1BIB A;  3MPU B;  1IHV A;  1VYV A;  1EIF A;  1OYX A;  2CZ6 B;  2HZY A;  3A8G B;  4BE2 A;  3ULR B;  1YCY A;  2A7Y A;  2GCX A;  1Y0M A;  3LX7 A;  4E7I A;  2BZ8 A;  2JOY A;  1W2B S;  1ZHI A;  2NWM A;  5A0D A;  2KVQ G;  1GBQ A;  2E5K A;  2E64 A;  4RG8 A;  2D8J A;  2EPD A;  3UF4 A;  2VGM A;  5CKH A;  4C92 D;  5FRN A;  1D1B A;  1N8R U;  2K2V A;  2OAW A;  4M7A B;  2P0P A;  2XHC A;  1WYX A;  3QJ6 A;  1PG5 B;  2ZPB B;  3V7R A;  3CCQ T;  2RHZ A;  3EG3 A;  5GJW B;  2FZK B;  1P92 A;  3QDF A;  4FYW B;  3VV0 A;  2E5Q A;  2KRO A;  3ME9 A;  2DAQ A;  5GAM e;  2FPE A;  2D8H A;  4QT7 A;  2OTJ A;  5GAO m;  4OMO A;  4FCY A;  3BDU A;  2HMA A;  1Q7Y R;  1YN8 A;  2JUF A;  3CCQ A;  1J3T A;  4AT1 B;  1IXD A;  1C0M A;  3JRZ A;  2DNU A;  2X9H A;  2GTO A;  1YNZ A;  2EGC A;  4C92 F;  4OVA A;  3CCM A;  4EPC A;  2DXU A;  3FEO A;  3GPL A;  2LT4 A;  3SB2 A;  4KBM B;  3CPW S;  4HVW A;  4N4G A;  1AWO A;  2RM4 A;  1RAC B;  1SSF A;  3C4S A;  4M78 D;  4C5G A;  2XID A;  2LVM A;  1QQJ A;  4M77 C;  2FPD A;  2CGH A;  1PSF A;  4ESR A;  2ABL A;  3FJP A;  3G4S A;  4JRP A;  2AHJ B;  2EJF A;  3CCR A;  2F2X A;  2DRM A;  5GAN 8;  5LJ3 g;  3NMZ C;  3H8Z A;  2Y90 A;  2MK5 A;  4MDX A;  3J81 E;  2YHT A;  4ME7 A;  3VKI A;  2V8J A;  4M75 F;  1SG5 A;  3EH2 A;  3LYI A;  2NUT A;  3TSZ A;  2P0Q A;  4QVC A;  1ZBJ A;  3DLM A;  2XKO C;  1UUE A;  5C0M A;  7AT1 B;  4C5I A;  4QQ6 A;  2DM1 A;  1WXU A;  1D1C A;  2IPO B;  2QQS A;  3EFO B;  4M78 F;  4DBH A;  1OV3 A;  3TQ7 P;  2K79 A;  2JXB A;  3G6E Q;  2DL3 A;  2K3X A;  2OTL A;  4C92 G;  3A8O B;  2EQU A;  3LLR A;  2J05 A;  2LQW A;  2LCC A;  3L2U A;  1KFZ A;  3GLX A;  5KCO A;  3CCE T;  1WQ7 A;  1Q86 R;  3OYJ A;  2JS2 A;  4BI8 B;  3M0U A;  2GFU A;  4XTX A;  4P5N A;  2HDA A;  2KRN A;  4N4I A;  2AT1 B;  4QVD A;  1CKA A;  1BI2 A;  1HSQ A;  1U8R A;  2EQI A;  1WDX A;  1N9R A;  2J06 A;  3I9Q A;  1SRL A;  5EG2 A;  2CZ1 B;  1OUL A;  5GAN e;  5GAM g;  2A0F B;  5D6X A;  2HQE A;  1Q86 C;  3EG0 A;  3CME Q;  5HY6 A;  2K7A A;  3OMC A;  3G71 A;  3BFM A;  1VQ8 A;  1B34 B;  3CCL T;  3QKJ A;  3FDR A;  3LWI A;  4M75 G;  1EZZ B;  2QXF A;  5CKF A;  4A4G A;  2K2M A;  1JQQ A;  2OJ2 A;  1JBM A;  1RLP C;  4JJN K;  5D6Y A;  3VYG A;  1M2V A;  2LQK A;  3OMG A;  4CC3 A;  1VQ5 A;  3CCS T;  1NJI U;  4HVV A;  3VS0 A;  4M78 G;  4Z89 A;  1UJ0 A;  1U1T A;  4D8D A;  2LNV A;  3GBQ A;  2GGR A;  3CCJ Q;  1ZQ1 A;  1RL2 A;  1T3S A;  1KQS P;  3OS2 A;  1M30 A;  4CC4 B;  1M1K U;  3CC7 T;  2LT1 A;  2KK4 A;  3X20 B;  2BE7 D;  4Z88 A;  3PE0 A;  5GMK e;  3NTH A;  2X4J A;  4N4H A;  3QUI A;  4MZT A;  3SWN B;  4C8Q B;  3VS6 A;  1K1Z A;  2FG0 A;  2VWF A;  1NLP C;  1RAD B;  3MP8 A;  1OX9 A;  4K11 A;  4RTV A;  1O9S A;  3L2Q A;  3OY9 A;  5LJ5 e;  5GAN 5;  2HKN A;  2KR3 A;  4IUR A;  2KT8 A;  3I55 Q;  3OYH A;  1TUD A;  2HSE B;  3EGD A;  2HBP A;  3P8H A;  3CD6 T;  2DTO A;  2VVK A;  3JCM f;  2RO0 A;  3PNW C;  4MZP A;  1WXB A;  4FYX B;  1U3O A;  2QAZ A;  4HKE A;  9ATC B;  4M7A D;  1VQK T;  1N5Z A;  3WVD B;  4OGE A;  1YJN T;  4FL6 A;  1GCP A;  2J6K A;  5HK0 A;  1D0Z A;  1MNE A;  1QCF A;  4J5Y A;  5DY9 A;  4RMO A;  3EG1 A;  4E2F B;  1GCQ A;  2X3W D;  2QQ9 A;  1OU8 A;  2YUP A;  1KC8 U;  2ZAE A;  5DLO A;  3S3M A;  2KI7 A;  5AT1 B;  4C92 A;  1SHG A;  5LJ3 j;  3TSW A;  3CC4 T;  1PHT A;  5J39 A;  2QK0 A;  4PJO E;  5CK9 A;  2RHX A;  5FU6 B;  1VQO A;  5LJ3 d;  1OPL A;  1IB8 A;  2LCS A;  1KD1 R;  4KGZ B;  2YLB A;  3EFR A;  5GAN g;  2DD4 A;  2L3Q A;  4M7A F;  2XDP A;  3M0Q A;  3JB9 I;  3CC4 A;  3KFV A;  4J7I A;  1VQP A;  2XK0 A;  1WNL A;  2RHU A;  4BUG A;  3RBB B;  3M5A A;  3HRU A;  2NUZ A;  2LZ6 B;  2ZPG B;  2ZPI B;  3M58 A;  1WHM A;  3BW1 A;  3OQ5 A;  3EG9 A;  1M90 R;  4DOW A;  3FB9 A;  1MV3 A;  5DM7 R;  1TG0 A;  1D09 B;  1HYO A;  1KD1 C;  4M75 A;  2O4X B;  4IKF A;  1G3T A;  2K4Y A;  2KT1 A;  5GAO q;  2CRE A;  2A36 A;  2JTM A;  4KH0 B;  2F5K A;  2DTI A;  1HJD A;  2DBK A;  3QO3 A;  4F16 A;  1WI7 A;  2QI2 A;  1AOJ A;  1GFD A;  1XJW B;  5KYX B;  2XMF A;  3M53 A;  3RNJ A;  3ZEH A;  4QW2 A;  3PIP A;  2YLC A;  4LDX A;  5GAM j;  2CH4 W;  2MCN A;  1WHK A;  2EQJ A;  4Y92 A;  4WF2 A;  3NTI A;  1NEG A;  5CQY A;  4C0Z A;  2NYS A;  4F7U B;  4E7K A;  5GAM d;  4LUE A;  5LJ5 g;  4AFS C;  2CYZ B;  2DYI A;  4PFP A;  2KNB B;  1X75 C;  2EKO A;  2O31 A;  2DA9 A;  4OB1 B;  3QDR B;  4M7A G;  1AZE A;  3M4G A;  2KXC A;  4MML A;  4RKU E;  2O88 A;  3UWN A;  3VS4 A;  4X9D A;  2GF7 A;  2XDB A;  4PL6 A;  1R8O B;  2L3R A;  1BIA A;  3VYH B;  4LDU A;  2XG8 D;  1X69 A;  4JS5 A;  1I5L A;  3C0C A;  4C0G A;  1H8K A;  2B8A A;  2RNA A;  4PJN A;  3CCU Q;  3P8D A;  1A0N B;  1YJ9 A;  2M1H A;  2I0N A;  1KK7 A;  1Y71 A;  4M77 B;  4JUV A;  3HFO A;  1QVG A;  1VQ6 A;  1K9A A;  1ZSZ C;  2DER A;  4IUQ A;  1AZG B;  2HL5 C;  1JJ2 A;  3CCV Q;  2ENM A;  4PLL A;  2P4T A;  1LNX A;  5ECA A;  3JAM E;  2DBM A;  5GMK l;  2LJ3 A;  3LGF A;  3ER0 A;  1YIJ Q;  2EQM A;  2BTT A;  4A53 A;  3OYI A;  1NE8 A;  4FW1 A;  2HL3 A;  4C92 E;  4HT8 A;  3REA B;  1I8F A;  4DBQ A;  1I5O B;  2ZCF B;  2ECZ A;  4DQ2 A;  2IG0 A;  4EDU A;  3QBY A;  1NG2 A;  2Y4X A;  3CMA T;  2E6N A;  2JS0 A;  2V8K A;  1GFC A;  1Y96 A;  5KYU B;  1VOM A;  4HVU A;  4EMK A;  3M56 A;  1ZUK A;  2CSI A;  1YIT Q;  3QXE B;  4J9D A;  4M4Z A;  1G3S A;  5KYY A;  4KGV B;  1OPK A;  1UJY A;  3REB B;  1T0H A;  1EFN A;  5GAN 3;  2XU8 A;  3CMA A;  4E6R A;  4PK4 A;  1WHJ A;  1YHQ A;  2JN0 A;  3AHU A;  2CS7 A;  1NLO C;  3X24 B;  1TH7 A;  2AIR B;  1Q95 G;  3M59 A;  4JRQ A;  4RTY A;  1FX7 A;  3V7C A;  4LUD A;  5GAN j;  4A4H A;  4QVZ A;  4PJL A;  2R58 A;  3WVE B;  2JMA A;  3A1P A;  1MMG A;  4GBQ A;  3E19 A;  4M75 E;  2X51 A;  2D1X A;  5L23 A;  1VQL Q;  2SEM A;  1QW1 A;  4O5V A;  2ROL A;  2D6F A;  4B9X A;  1HXD A;  4M7D C;  3G6E T;  4JRI A;  4F17 A;  3P8B B;  2YT6 A;  1PNJ A;  1VIE A;  4C8Q F;  4M78 E;  1NEB A;  2J7I A;  3HP9 A;  3JCM J;  1S72 A;  1V76 A;  1JU5 C;  1UGR B;  4RCC A;  1VQN Q;  2RMO A;  2W10 A;  4C0D C;  4JPB W;  4M7A A;  1WJQ A;  3QWY A;  2R5A A;  3KUF A;  2LMJ A;  2L3P A;  4N0A A;  1WHH A;  4LE9 A;  2PZ1 A;  2DL4 A;  1D0X A;  2LQN A;  1VIF A;  3OYF A;  1VQ7 Q;  2AK5 A;  1VQ4 A;  4MZM A;  4OMQ A;  1PKT A;  2EIF A;  3HPW A;  4J8O A;  1UE9 A;  1Q86 U;  2O9V A; 
#chains in the Genus database with same CATH homology
 2A37 A;  4AFQ C;  1AWJ A;  3NGP A;  3R6N A;  2KGT A;  2RF0 A;  2CSQ A;  1T0J A;  2HSP A;  1VYT A;  2B86 A;  2JS2 A;  3M0U A;  2LX7 A;  2GTJ A;  1H92 A;  2HDA A;  2KRN A;  2ED0 A;  3SHW A;  3M0S A;  1SEM A;  2M0Y A;  1CKA A;  1HSQ A;  2EQI A;  1WDX A;  2J06 A;  4JJD A;  3I9Q A;  2H8H A;  1SRL A;  2JMC A;  1I07 A;  2AKK A;  1LCK A;  1UGV A;  3A98 A;  2RPN A;  3EG0 A;  3TVT A;  2K7A A;  1S1N A;  2A28 A;  1PRM C;  1WIE A;  1FMK A;  1RI9 A;  4F14 A;  2GQI A;  2V1Q A;  2EW3 A;  2KBT A;  1Z9Z A;  4WCI A;  2EYX A;  1QLY A;  2K2M A;  1JQQ A;  2OJ2 A;  1X2Q A;  1V1C A;  1RLP C;  2O9S A;  2CUB A;  4J9B A;  4CC3 A;  4GLM A;  1KSW A;  1MUZ A;  1JO8 A;  4HVV A;  4FSS A;  2MOX A;  3VS0 A;  4Z89 A;  4RTT A;  1UJ0 A;  2JM8 A;  4D8D A;  2CH4 A;  2HEQ A;  4OMP A;  3FJ5 A;  1GBR A;  4JZ4 A;  4J9E A;  3GBQ A;  2GGR A;  5EC7 A;  4A63 B;  3PVQ A;  1T3S A;  1M30 A;  4Z8A A;  4CC4 B;  4CC7 A;  2OI3 A;  5I22 A;  4ZNX A;  4AG2 C;  1AWW A;  1TUC A;  1NM7 A;  1BB9 A;  1X27 A;  2YUN A;  3H0I A;  4Z88 A;  5FWC A;  3VRY A;  1PRL C;  3PE0 A;  3QWX X;  2W0Z A;  1M3C A;  1YP5 A;  2DVJ A;  3I5R A;  2L3S A;  4LNP A;  2EBP A;  3VS6 A;  5IHK A;  1K1Z A;  5IXF A;  1W70 A;  2FG0 A;  1QWE A;  2ED1 A;  3NHN A;  2DL5 A;  4EIK A;  3EHQ A;  3PVL A;  1PKS A;  2EGE A;  2VWF A;  1NLP C;  4JJC A;  1ZX6 A;  4K11 A;  2LP5 A;  4RTV A;  2KXD A;  1AVZ C;  5IXB A;  2AKL A;  1JXO A;  2EYY A;  1GRI A;  2KR3 A;  2KT8 A;  1BK2 A;  1TUD A;  1SPK A;  4OMM A;  1ZLM A;  2DF6 A;  2KEA A;  2KRS A;  3U23 A;  1YCS B;  1CKB A;  2VVK A;  1GL5 A;  1UTI A;  2V1R A;  1QWF A;  4J9F A;  1WXB A;  5FW9 A;  1U3O A;  1SSH A;  1RLQ C;  1K0S A;  1AEY A;  1N5Z A;  2DYB A;  4DEX A;  1GCP A;  2J6K A;  1KIK A;  1M27 C;  1QCF A;  2F2W A;  1VYU A;  2FEI A;  1GCQ C;  2QDL A;  3EG1 A;  1GCQ A;  1JXM A;  2X3W D;  1HD3 A;  1OOT A;  4J9G A;  2YUP A;  3NPF A;  3H0F A;  1SHG A;  2G6F X;  3TSW A;  2ROT A;  1PHT A;  2LNH B;  3VS5 A;  1SRM A;  4D8K A;  2YDL A;  4OMN A;  2AZV A;  2C0I A;  1X6G A;  2BZX A;  1AWX A;  1OPL A;  2F2V A;  2LCS A;  5HCK A;  1E6H A;  1QKX A;  4RTX A;  4HCK A;  2L3Q A;  2JT4 A;  2MIO A;  3M0Q A;  1ZUU A;  2FPF A;  2JTE A;  2K6D A;  3KFV A;  4ORZ A;  3RBB B;  4LN2 A;  2GNC A;  2NUZ A;  3LH5 A;  2LZ6 B;  1ABO A;  1G83 A;  4DEY A;  1G2B A;  4JZ3 A;  3VS2 A;  3JV3 A;  1MV3 A;  4RUG A;  1TG0 A;  1M3A A;  4RTZ A;  2EGA A;  2KT1 A;  5IHN A;  3H0H A;  2CRE A;  1WLP B;  4IIM A;  1UFF A;  2A36 A;  2RQV A;  4RTW A;  2CDT A;  1HJD A;  2DBK A;  3EHR A;  2L2P A;  2RQT A;  1CSK A;  4F16 A;  2K3B A;  1WI7 A;  2PTK A;  1ABQ A;  1AOJ A;  1K76 A;  1VA7 A;  2DE0 X;  1GFD A;  1PWT A;  2XMF A;  3RNJ A;  4J9I A;  1K4U S;  1QKW A;  1W1F A;  2CH4 W;  2MCN A;  3UAT A;  1U5S A;  5IH2 A;  2DL7 A;  3I35 A;  1M8M A;  4Y92 A;  2FRW A;  1KJW A;  4HXJ A;  2C0O A;  2EYW A;  1T3L A;  2CUD A;  3VS7 A;  1NEG A;  2EKH A;  4KRT A;  1ZSG A;  1UG1 A;  4LUE A;  2DX1 A;  4AFS C;  2JW4 A;  3M0P A;  1YWO A;  2KNB B;  2KYB A;  4IIO A;  2O31 A;  2DA9 A;  2P4R A;  3M0R A;  4JJB A;  4CC2 A;  1I1J A;  1AZE A;  2GBQ A;  2KXC A;  2O88 A;  1MV0 B;  1E7O A;  4AG1 C;  3VS4 A;  2YUO A;  1WX6 A;  2J6F A;  4OML A;  3UA7 A;  1VYV A;  1X69 A;  3EGU A;  3C0C A;  3ZL7 C;  1RUW A;  1H8K A;  2RNA A;  1NYF A;  3ULR B;  1A0N B;  4AFU C;  4AFZ C;  2I0N A;  1Y0M A;  2JM9 A;  2BZ8 A;  2RN8 A;  2NWM A;  1K9A A;  2RQU A;  1GBQ A;  2E5K A;  1X6B A;  2X3X D;  2D8J A;  2EPD A;  1AZG B;  1UHC A;  2KE9 A;  2FO0 A;  3UF4 A;  2ENM A;  2O2O A;  2EVR A;  5ECA A;  2DBM A;  2OAW A;  2LJ3 A;  1WYX A;  2IIM A;  2SRC A;  2BTT A;  2DJQ A;  3H41 A;  2HBW A;  1B07 A;  2EYZ A;  3UA6 A;  2YSQ A;  3EG3 A;  1UEC A;  5GJW B;  3REA B;  2FRY A;  2C0T A;  2ECZ A;  1WA7 A;  4J9C A;  2KRO A;  1WXT A;  1NG2 A;  2FPE A;  2D8H A;  1UDL A;  3SEM A;  4QT7 A;  2JS0 A;  1GFC A;  5I11 A;  4OMO A;  4HVU A;  1YN8 A;  1ZUK A;  2KYM A;  1WFW A;  2CSI A;  2ESW A;  2DMO A;  3THK A;  1FYN A;  4J9D A;  1BBZ A;  2VKN A;  4M4Z A;  1J3T A;  4RTU A;  1OPK A;  1ZUY A;  2DNU A;  1UJY A;  2GTO A;  1YNZ A;  3REB B;  2EGC A;  1T0H A;  2CT3 A;  4X1V A;  1H3H A;  1X43 A;  1EFN A;  2M51 A;  3O5Z A;  2PNI A;  2L0A A;  1OEB A;  5FWB A;  4E6R A;  1ARK A;  1M3B A;  1NLO C;  2K9G A;  4HVW A;  1AWO A;  1Z9Q A;  4RTY A;  4LUD A;  1K0X A;  4J9H A;  2JMA A;  2KRM A;  2DRK A;  4GBQ A;  1UHF A;  2FPD A;  1I0C A;  2D1X A;  3VRZ A;  1B3Q A;  1XOV A;  5L23 A;  4ESR A;  2SEM A;  2ABL A;  1NYG A;  2ROL A;  1U06 A;  4F17 A;  2F2X A;  2DRM A;  2YT6 A;  1PNJ A;  2D0N A;  1JEG A;  1SHF A;  1NEB A;  3NMZ C;  1Y57 A;  2DLP A;  2J7I A;  3VS1 A;  2CT4 A;  1W6X A;  2BZY A;  2RQR A;  3IQL A;  3EG2 A;  1AD5 A;  1JU5 C;  3TSZ A;  2RMO A;  2W10 A;  4JPB W;  1ZBJ A;  1UUE A;  3QWY A;  1BU1 A;  2LMJ A;  2AZS A;  5GJV B;  2L3P A;  1E6G A;  1IO6 A;  3CQT A;  4LE9 A;  2DL8 A;  2PZ1 A;  2DM1 A;  2DL4 A;  1WXU A;  2LJ1 A;  2LJ0 A;  3I5S A;  5IHI A;  2LQN A;  2YUQ A;  1OV3 A;  2HCK A;  1YWP A;  2K79 A;  2AK5 A;  2J6O A;  2RQW A;  2JXB A;  3VS3 A;  4OMQ A;  2DL3 A;  1PKT A;  1UE9 A;  2DIL A;  2J05 A;  3M0T A;  2LQW A;  4R0K A;  2O9V A;  2A08 A;  1X2K A;  1KFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...