2DBKA

Solution structures of the sh3 domain of human crk-like protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
88
structure length
88
Chain Sequence
b'GSSGSSGPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDENESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Crk-like protein
publication title Solution structures of the SH3 domain of human Crk-like protein
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 5
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dbkA01
2G6FX 4J9IA 4LUDA 2JMCA 2RQTA 1U3OA 2HCKA 1NYGA 1RUWA 1OV3A 1OEBA 2LJ0A 2BZYA 3M0UA 2H8HA 2C0TA 1TUCA 4F16A 2J7IA 3ULRB 2A28A 5GJVB 2EQIA 3EG2A 2DL3A 1X69A 2DL5A 1I1JA 1AWOA 2GTOA 1GFDA 2J6OA 2ESWA 2D8HA 2YUNA 1IO6A 3UA6A 3M0SA 4JZ3A 1CKAA 1ARKA 2J06A 2FPDA 1W70A 4IIOA 1PKSA 2LMJA 3LH5A 4OMMA 5IHNA 4AG2C 3EHQA 3VS0A 3NPFA 1CSKA 1UECA 3TSWA 3ZL7C 4AFQC 1SRMA 5IHKA 2JT4A 1AWXA 1UJYA 1T0HA 2EPDA 3VS1A 1I0CA 1YN8A 1OOTA 2YSQA 4J9HA 2CSQA 1E7OA 3R6NA 1UE9A 4RTUA 1KIKA 3I5RA 1M3AA 2CT3A 2VVKA 2A36A 2HBWA 1CKBA 2SEMA 2F2XA 2ED0A 2VKNA 1NEGA 5EC7A 1G2BA 2KXDA 4D8DA 2J05A 1U06A 3VS3A 1VYUA 2D0NA 2KEAA 3VRYA 2DILA 4CC4B 4JJCA 2DYBA 2M51A 4RTYA 2ROLA 4OMLA 1SHGA 1LCKA 1Z9ZA 1NYFA 4RTZA 4E6RA 2AKLA 2W10A 4RTTA 3UA7A 4ORZA 2DL7A 4AFSC 2LZ6B 2KYMA 1GCQA 2RQRA 1U5SA 2EBPA 1NLOC 2HSPA 1MUZA 1M30A 4LN2A 2DL4A 4LUEA 1QCFA 1PKTA 5GJWB 1MV0B 5I22A 2MOXA 3THKA 3EG1A 2F2WA 3H0HA 1K9AA 4OMQA 2QDLA 2L3PA 2X3XD 1WX6A 1Y57A 3TSZA 2LX7A 2RMOA 2I0NA 4OMNA 4M4ZA 3PE0A 3U23A 1HSQA 5IH2A 1PNJA 2DM1A 1YNZA 2ED1A 1UJ0A 2EGCA 2PZ1A 3VS6A 4JJDA 1AD5A 2K9GA 1SPKA 4K11A 3EG0A 3FJ5A 3QWXX 2K3BA 4RTVA 1ZBJA 2RN8A 2X3WD 2O88A 3VS7A 2EGEA 2BTTA 5FW9A 2KT8A 1JO8A 3VS2A 2RPNA 2AZVA 2FO0A 4HVWA 1WI7A 1M3CA 1TUDA 1X6BA 4J9BA 2LCSA 1K0SA 2KE9A 2GBQA 4A63B 2D8JA 2CT4A 4LNPA 2A08A 1MV3A 2KGTA 1RI9A 2LQNA 2DBKA 1ZLMA 1GBRA 5IHIA 3QWYA 1AZEA 2FEIA 5HCKA 1ZUYA 2CUDA 1KJWA 2D1XA 2GGRA 2M0YA 1H8KA 4AFUC 2EYYA 3UATA 1ZUKA 2CREA 2B86A 4CC3A 1UFFA 2FPFA 1K4US 1JU5C 2ENMA 5L23A 3M0PA 1UHCA 2JM8A 1QWFA 1GBQA 1OPKA 2A37A 1UG1A 4RUGA 2DJQA 4F17A 3IQLA 4RTXA 1GFCA 1WFWA 3NGPA 4J9GA 1E6GA 2DE0X 2CDTA 2DX1A 2P4RA 1WIEA 2DLPA 1YWPA 1ABQA 3M0RA 3PVQA 4RTWA 1T3LA 2L0AA 1PRMC 1S1NA 4OMOA 1WYXA 2ECZA 2JS0A 3NHNA 1PHTA 2OAWA 2JW4A 1T3SA 3REAB 2EVRA 2OJ2A 1M8MA 1GRIA 4R0KA 4Z89A 2BZ8A 2PTKA 1BB9A 2OI3A 3NMZC 1Y0MA 1XOVA 3JV3A 1E6HA 4ZNXA 2F2VA 2YT6A 4J9CA 1AEYA 2L3QA 1AOJA 1NM7A 2GQIA 2K79A 5IXBA 2AK5A 2CH4A 2DNUA 2JMAA 3UF4A 1WXBA 2DRMA 4AG1C 4CC7A 1JXOA 1QKXA 2RQWA 1NLPC 4JZ4A 4J9EA 1X2QA 2V1RA 2RNAA 3M0QA 1UUEA 1AVZC 2FRWA 4HXJA 4Y92A 2KR3A 1N5ZA 2KRSA 2AZSA 3EHRA 1AWJA 2XMFA 4GBQA 1AWWA 2ROTA 1K0XA 3CQTA 5FWCA 1GL5A 2HEQA 2AKKA 1YWOA 4Z8AA 1X27A 3GBQA 3VRZA 4D8KA 1PWTA 3EGUA 2ABLA 2JTEA 1BK2A 2KT1A 2YUPA 2HDAA 2DBMA 1NEBA 1FYNA 2DRKA 2NWMA 2KXCA 2KRMA 1PRLC 3VS4A 2JS2A 2KRNA 1Z9QA 1SEMA 1QWEA 1VYVA 3H41A 1WXUA 3KFVA 4F14A 1JXMA 2EYZA 3PVLA 4HVUA 1H92A 2EGAA 2EW3A 3I9QA 4EIKA 1W6XA 1TG0A 1VA7A 2CSIA 2SRCA 4DEYA 2O9VA 2L3SA 4KRTA 4CC2A 4IIMA 3RNJA 2VWFA 2E5KA 2JM9A 2KNBB 3I5SA 2KROA 2DA9A 4X1VA 1UGVA 2PNIA 4Z88A 1UDLA 2K2MA 2YUOA 2MCNA 2GNCA 2MIOA 1H3HA 1ZX6A 1FMKA 1YP5A 4J9FA 2RQVA 3H0IA 1K1ZA 1KSWA 1GCQC 3A98A 4J9DA 2L2PA 2LNHB 2RF0A 5ECAA 2FRYA 2DL8A 2FPEA 4HVVA 2KYBA 1K76A 2C0IA 4JPBW 3C0CA 2KBTA 1QLYA 2FG0A 3M0TA 4AFZC 1HJDA 1AZGB 2DF6A 1RLPC 3EG3A 3RBBB 2DVJA 5IXFA 1V1CA 4ESRA 2LP5A 2O31A 2LQWA 5FWBA 2EYWA 4DEXA 2NUZA 2K6DA 2YUQA 1J3TA 1KFZA 1B07A 1X2KA 1QKWA 1OPLA 4LE9A 2K7AA 2GTJA 4WCIA 1WDXA 1G83A 1X6GA 2V1QA 3O5ZA 1X43A 2RQUA 3REBB 1T0JA 3SHWA 3SEMA 1W1FA 1UHFA 2JXBA 2EKHA 1M3BA 1A0NB 1SHFA 2EYXA 1HD3A 1I07A 1BBZA 2O2OA 2IIMA 4OMPA 1M27C 2J6FA 2C0OA 1JEGA 2CUBA 1ABOA 1JQQA 1SSHA 1RLQC 1EFNA 1VYTA 2YDLA 1ZSGA 4JJBA 1BU1A 2J6KA 2W0ZA 2DMOA 1GCPA 1YCSB 3I35A 1ZUUA 2LJ1A 2O9SA 1WLPB 4FSSA 4QT7A 2BZXA 3TVTA 1NG2A 2LJ3A 1UTIA 1WA7A 1WXTA 4HCKA 2CH4W 3VS5A 5I11A 4GLMA 3H0FA 1SRLA 1B3QA
chains in the Genus database with same CATH superfamily
4J9IA 4LUDA 1TOVA 4VUBA 4II1A 2HCKA 4M75C 1M90U 1NYGA 2YRVA 4A54A 1K73R 2LDMA 2MAMA 1YIJQ 3L42A 3M0UA 2YLCA 2H8HA 3RKWA 2C0TA 5KE3A 3RMSA 2A28A 2CZ1B 1IHVA 2F1LA 2K3YA 3CBOA 3RIRA 2DL5A 2DTHA 3ZBDA 1AWOA 3I55Q 1RABB 2GTOA 1GFDA 3CCEA 2D8HA 4YTLA 4A4KA 3OW2A 3JRZA 2DIQA 5FU7C 1W70A 2JOYA 3HFOA 5CIUA 2I2LA 2YHTA 2QXFA 3EHQA 4BDZA 1CSKA 3TSWA 3ZL7C 1SRMA 1BIBA 5KE2A 2XG8D 4DOWA 2YLBA 4RCCA 3QZ9B 3L2UA 1YI2T 3OQ5A 5CKFA 2X35A 2G3RA 2L3RA 1K8AU 1E7OA 2M02A 1UE9A 2LQ8A 1M1KC 3GPLA 1KIKA 4HCBA 3I5RA 1M3AA 1VQLA 4PJOA 4PL6A 2CS7A 2VVKA 1QQJA 2HBWA 1CKBA 4M78A 2DZ9A 3JSCA 1FXXA 4BB7A 1YJ9T 1MMNA 1I5OB 3MEAA 2X51A 2MF2A 1NJIC 2EAYA 1VYUA 1PSFA 2DYBA 4PNOA 2KDSA 4FM4B 1LCKA 4LDVA 1NYFA 4FT4A 2EWNA 3QG1A 4C8QE 2DL7A 3PIPA 1QP2A 2KYMA 3G4SQ 2GCXA 4J8OA 3HRSA 1M30A 1OZ2A 2P84A 2M1HA 1M1KR 4EMKC 2DL4A 4LUEA 3CBMA 1QCFA 1QW1A 4F7UG 1YIJA 4A4GA 1AHJB 4LDXA 3DLMA 5CKDA 2RJEA 2X3XD 1YJNQ 1WX6A 3EG9A 3OYBA 1MGQA 2DAQA 3MPUB 1NJIR 3I55A 2COYA 1D1AA 4QQGA 3L1AA 1Y07A 4PFOA 1HSQA 5IH2A 2VGMA 2HBPA 1UJ0A 2PZ1A 3X26B 1AD5A 1VIEA 3JAME 2K3BA 3EFSA 1ZBJA 2R5AA 3V8KA 5IT9E 3VS7A 1BCOA 2BTTA 3OYIA 2MK5A 3EH1A 2QEXQ 3GF5A 1M3CA 4E7JA 1G3WA 1VQ4Q 1WJRA 4HT9A 2NLUA 2ZZDA 2XI9A 2HMAA 1D0YA 2LCSA 2LTOA 2GBQA 1D3BA 2WSEE 3OA6A 3J7AF 3QXEB 2YWWA 5FRMA 1U8RA 1ZLMA 3MP6A 3DB4A 2QQBA 5IHIA 1AZEA 3CCVQ 4PJOB 1QVGA 5CQXA 3CPFA 1DJ7B 2CUDA 1KQSA 4M78B 3SDZA 2MI6A 3CCQT 5GAMh 2B86A 2CP6A 1VQ7T 2KY9A 3OYLA 2A37A 3CCRQ 3UT1A 4F17A 3CMET 4ME7A 4MZPA 3G4SA 2DE0X 3Q1JA 1QCOA 3JB9G 5CKBA 2DLPA 1MMDA 1YWPA 2CP0A 3M0RA 1SF9A 4MZTA 3ZEHA 1WHHA 1WYXA 5M9OA 5CQYA 2OAWA 4Y91A 2HKQB 5LJ5g 2OJ2A 2QGGA 4AMCA 5GMKl 1YJNA 1M8MA 5AT1B 2DEQA 2HL3A 1GRIA 1K9MC 3CC7T 1I4K1 1ZHIA 2X9HA 1RAIB 2KVQG 2PTKA 1BB9A 1R0BG 4ANJA 3JV3A 3OS2A 1NZ9A 1WHGA 3EG9B 4KGVB 2GQIA 5I2SA 1I8FA 2K79A 1Y96A 1WXBA 4JJNK 2QQRA 1TU0B 2JUFA 3OYEA 4MMKA 1Y71A 3LW5E 3SWNC 1H3ZA 3PFSA 3M0QA 1KQ1A 1XJWB 2QEXA 2K2VA 5GAN7 1VQ4A 4M7DE 2KR3A 1VQOT 3V8JA 3EFRA 2AZSA 3OMGA 2DO3A 5HK0A 1VIFA 2HL5C 5FWCA 3CCUT 1K9MR 3PMTA 1D3BB 2DKGA 1YWOA 3CCVA 1VQNT 2DERA 2GF7A 1NE8A 1PD1A 4BY6C 3X20B 4PK4A 1KK7A 2VC8A 2L8DA 1PWTA 4E7SA 1F1BB 5KH6A 2QQ9A 3A8LB 4LXCA 2KXCA 2XDDA 1SEMA 2DXBA 3CCRA 2EQUA 3H41A 1VYVA 1WXUA 3KFVA 4F14A 5LJ3g 5GAN3 4PJLA 3CCSQ 4HVUA 1QMCA 1Q95G 2EW3A 1D0ZA 2RI5A 1W6XA 1VA7A 2CSIA 4DEYA 2O9VA 3PIOA 4M75E 2L3SA 4FSXA 1ZSZC 3RNJA 3QKJA 2BE7D 3I5SA 2KROA 2DA9A 1UGVA 4M7AF 3EAEA 1UDLA 2NUPA 5CO7A 2MCNA 3HRTA 4M77D 4JRIA 2MIOA 3CC4Q 2DPPB 3E9FA 1YP5A 1UEBA 4J9FA 2E3HA 1RADB 4PJOG 5J39A 3HTRA 3RERA 4LD6A 2RI2A 3LX7A 4M78G 1VQKQ 2LNHB 2FRYA 2KYBA 5L8RE 1K76A 2C0IA 3G6ET 2WACA 1XNIA 2K5IA 3ZFJA 1ZA2B 2DF6A 3GLXA 2XDPA 3EG3A 2XU8A 3P8HA 2E10A 3LLRA 2EYWA 2YUQA 3INZA 4ZGEB 1Y96B 2KSSA 2ZPIB 1B07A 1QKWA 1FWZA 3CMAQ 2GTJA 1X6GA 5KYWA 5GAOr 2FZCB 1R8OB 4M77C 2E5QA 1JBMA 2DYIA 3O5ZA 4C92D 1WQWA 2RD1A 2RQUA 3SHWA 1M2OA 3BE3A 5GMKi 4WF2A 4OB2B 3SD4A 2WSFE 2JXBA 3OY9A 3CCJT 1SHFA 1RAEB 2QGFB 5GMKj 2O2OA 3QSUA 4NL3A 2CUBA 1JQQA 3M57A 1RLQC 1FMWA 2HAXA 4M7AA 5DLQE 4DBFA 4OGEA 3M54A 4C5IA 3N5BB 5GAMd 4M7DG 2DMOA 1GCPA 5I2MA 1KC8C 3G71Q 2HSEB 3I35A 1ZUUA 3E1SA 2LJ1A 1WLPB 4BDYA 2CH4W 2GFUA 1QVFA 3CCSA 4R56A 3CPWS 1G5VA 4GLMA 4C92C 3I56T 2G6FX 2JMCA 2EFIA 2LCCA 2JJ9A 2RHZA 2CP5A 2QK0A 4Z02A 1PG5B 4KULA 2QQAA 4Y28E 1ZBXA 1TUCA 4F16A 3ULRB 5GJVB 2D9TA 2MYSA 1YITT 2NUTA 2DL3A 3EGXA 3SWNA 3CC4A 1TXQA 1I1JA 3H8ZA 1VQ5T 4C8QF 4FCYA 2J6OA 2ESWA 2YUNA 1IO6A 3UA6A 4JZ3A 1VQKA 1CKAA 3RKYA 2J06A 2FPDA 3CCLT 3J80E 3CC2Q 4AG2C 2O4XB 4JRPA 1KC8R 3VS0A 3FB9A 2CZ0B 5IHKA 3QYHB 3VJPA 3VUZA 5CCAA 4J6YA 3CBPA 3QBYA 3EGDA 2A0FB 1T0HA 3AT1B 2X4XA 2EKOA 3A8OB 2XIDA 2CSQA 3CMAA 5GAN4 2CP2A 5GANd 2Y4XA 2QTXA 2PVOB 4DBQA 1OX8A 4LDWA 5KYWB 1VQPQ 4DOVA 2F2XA 2ZPEB 5LJ5h 3OYGA 4A4EA 1VOMA 2KXDA 3E2UA 2J05A 1JJ2S 2KEAA 2M51A 4OMFB 1LJOA 4JRQA 4OMLA 1VQ8Q 1Q86U 2E64A 4RTZA 5GAOl 4E6RA 3G71A 4C8QA 2W10A 4RTTA 4M7AB 4RCBA 4AFSC 1BI0A 1VQ9Q 4JLIA 3OYJA 1BKBA 4JLGA 3BDLA 2RQRA 4HKEA 2HSPA 2RM4A 3FEOA 1MUZA 4LN2A 1KG1A 4E2FB 5I21A 1PKTA 3OBWA 4IUQA 2HQXA 4TVRA 3S6WA 2DXTA 2QQSA 2CKKA 2E4HA 4KGXB 3EG1A 3M5AA 2QA4Q 2QDLA 3PNWC 4XTWA 3OMCA 1OX9A 4XU2A 2E6NA 1OI1A 4NOYA 2VYTA 4KGZB 4OMNA 3MJXA 4EMHA 4C5HA 3OB9A 2X4YA 5GANg 2DM1A 2PU9B 2NUTB 3EGXB 4B9WA 2EGCA 4M77A 1I5LA 3CC2A 4X9CA 5LJ5e 1SPKA 3FJ5A 4KT0E 1P92A 2RN8A 3RUXA 3ASKA 5KYYA 5FW9A 3C12A 3VS2A 3QZ5B 1Q82C 2AZVA 5FRNA 1WI7A 2CYZB 5LJ3h 1VQMT 3KBGA 4J9BA 2FZGB 2KI7A 3EGDB 2MWOA 2KE9A 4A63B 2OAUA 1NJIU 3CPWP 4LNPA 2RH2A 3FC3A 2OTLT 2KGTA 2LQNA 2DBKA 1VQPA 1GBRA 3QWYA 3V8LA 2FEIA 3D7SB 5HCKA 5KYXA 1QVGS 4V2SA 3QHSA 4BUGA 2M0YA 1KQSS 2GQVA 3JCMW 2EYYA 4MDWA 1ZUKA 2CREA 4QQ6A 4M7DF 2QG9B 4E7LA 5IN1A 3MEVA 1VQ8A 2FYKA 2FPFA 2ENMA 5FU6B 1QWFA 2F5KA 2DJQA 2HQHA 2M0OA 4GY5A 1Q82R 1GFCA 1VQ9A 1PM3A 1YI2Q 1E6GA 4LDYA 1BCMA 1WIEA 4C8QB 2DJZA 2PQWA 3URGA 2PUOB 1T3LA 2L0AA 4LDUA 2ECZA 3OSSC 1IHWA 2FHDA 2JS0A 4LD9K 1YJ9Q 1D1BA 1IZ6A 3GIBA 1FMVA 2OI3A 3M59A 2YT6A 2RK1A 4RMOA 1AOJA 3VKIA 4M75F 1PCXA 2CH4A 2DNUA 3HRUA 2KQWA 2XKOC 3UDCA 1JJ2P 4N4IA 4M7AG 1K8AC 2RQWA 1TH7A 3GOXA 1NLPC 4J9EA 2Y90A 2RNAA 3CEYA 5AYFA 4M7DA 5CAIA 4HXJA 4Y92A 5KYYB 2EJGA 3JCMV 3EHRA 4M77E 2HKNA 1AWJA 2K3XA 4GBQA 1AWWA 5D6WA 3RR6A 1U1TA 1K0XA 3VU3C 4MDXA 4BI3A 3PMIA 4Z8AA 1X27A 5LJ5d 2RHYA 1SKUB 4FYXB 5GAMj 3JCMJ 1WPYA 4J6XA 1BK2A 4FU6A 2HDAA 1NEBA 1FYNA 3M55A 1K8AR 3H9NA 2JS2A 3T9NA 2RO0A 1QWEA 2RHUA 3PVLA 3JCMX 1YI2A 3MP8A 4C92E 2KMTA 4EIKA 4M75A 4A53A 2SRCA 1H641 3RDVA 1KHIA 2VWFA 4PFZA 3TEEA 2E5KA 2PNIA 4O5VA 4Z88A 4KBMB 3V7CA 3OS0A 1YJ9A 4XTXA 1X6OA 1ZX6A 3JCMQ 1FMKA 3L2RA 1BIAA 2RQVA 2XD0A 3VYGA 1KSWA 1GCQC 3LYIA 4J9DA 1OULA 3CCQQ 2L2PA 2MMPA 5ECAA 2CZ7B 4HA8A 1VQ7Q 2FG0A 1QVGP 1HJDA 3F70A 1AZGB 1RLPC 2CZ6B 3RBBB 5IXFA 1KQSP 3CMEQ 3QDFA 3MEUA 2DEUA 4FW1A 2CP7A 4AT1B 2K6DA 4KH1B 3L2WA 1KFZA 3J81E 1RAFB 4C8QG 2K5FA 5LJ3d 2V1QA 3KUFA 5GAOq 3QO3A 4XQ3A 5C6SA 4M7DB 1UHFA 2GFAA 2K4YA 3CC7Q 1M3BA 2EYXA 3OYYA 2OTJT 5GAMe 1M27C 2C0OA 1PC0A 3OYFA 2EJ9A 3CD6T 2YDLA 5GAN6 1BI1A 4JJBA 2J6KA 4A4HA 5GAOp 5GANh 4A4FA 1D1CA 2E6ZA 3CCMT 1YJWT 4M77G 2NYSA 4FSSA 4QT7A 7AT1B 1UTIA 2BE9B 1LPLA 1UGRB 1QVFS 5I11A 1S72T 3NTKA 1B3QA 1VQOQ 2DXCA 4EMKA 2RQTA 1RUWA 1OEBA 2LJ0A 2EYQA 2BZYA 3H6ZA 1M5Q1 1IGQA 5C0MA 4M75B 4J5YA 1B34A 2EQIA 3CCUQ 2DZCA 3EG2A 1VQNQ 1X69A 3WVDB 4EDUA 4Q5WA 1C0MA 2IPOB 3CCQA 3HFNA 4BI8B 3HKSA 4FYYB 2JN0A 4IIOA 1PKSA 2LMJA 5IHNA 4C0GA 1VQ7A 4C0DC 2E3IA 2COWA 4C0ZA 4DBRA 3CMEA 5FU7B 3JCMd 2PUKB 2A7YA 3OYAA 2LNVA 2JT4A 3CC4T 1AWXA 5GANe 2LVMA 2EPDA 1I0CA 1YN8A 4BE0A 2YSQA 2JNGA 1C1AA 4RTUA 1WZOA 5D6YA 4N4GA 2A36A 4XTVA 2ED0A 3CC7A 1ZQ1A 2EQMA 1NEGA 2VKNA 1KD1C 1FX7A 8ATCB 1G2BA 3GNGA 4D8DA 1M1GA 1W2BA 3G6EQ 4FYVB 3VS3A 2D0NA 4CC4B 3VRYA 2DILA 1N9RA 1RAAB 1IB8A 3CMAT 3E9GA 1IRXA 5A0GA 2ROLA 3MP1A 1SHGA 3DKMA 4C5EA 2YRCA 3UA7A 3QYGB 2QYZA 4DQ2A 2LZ6B 4XTZA 1GCQA 2K5LA 5DY9A 1VQOA 1BI3A 2X4WA 2OX7A 1TWBA 4BACA 1Q81U 3JCMg 4PJJA 5I22A 2MOXA 2F2WA 2LCLA 2QASA 3H0HA 4OMQA 2O01E 1TTHB 4EMKB 2BIVA 2HZYA 3P8DA 3CCJQ 3CCUA 1Y57A 1KD1R 1VQNA 2RMOA 3AHUA 1B34B 1W4SA 4M78D 1EZZB 1YNZA 2ED1A 1VQ6T 3VS6A 4JJDA 2DD4A 1SG5A 3NTIA 2K9GA 3LGLA 2VUBA 6AT1B 4RTVA 4JS5A 5KYUA 4PJMA 3S3OA 2EGEA 4QW2A 1JO8A 2JZ2A 3I56Q 2EIFA 3BFMA 2RPNA 1YHQT 2DVEA 2FO0A 4HVWA 1TUDA 2NUPB 2JVVA 3M58A 2LRQA 3ER0A 4HCCA 2MWPA 4QVCA 4O6JA 1UGSB 4OB3B 5J26A 3OW2S 4RKUE 2D8JA 1QVFP 2CT4A 5GAMf 1N8RU 1MV3A 1YITQ 4M75G 1RI9A 2ZAEA 3JB9H 1C6VX 4M78C 1VQ5Q 4KUIA 1K73U 5LJ5j 2H3JA 3L2QA 1ZUYA 3CCLQ 3G6EA 2QAZA 3CCET 2ZCFB 3UATA 4CC3A 4FT2A 2KAFA 3SFMA 1O9SA 4M77F 1UFFA 1K4US 1JU5C 4FIBA 2HD0A 3M0PA 2JM8A 3PT9A 4JDSA 3OYDA 1UG1A 4RUGA 2RJCA 4BD3A 3IQLA 4RTXA 2IVWA 3JB9I 3NGPA 4J9GA 4DA4A 2EQKA 1PSEA 2IG0A 1EIFA 1MNEA 1ABQA 1IGUA 3PVQA 1LVKA 5A2QE 1ZSZA 4OMOA 3TCJA 3MEWA 2C06A 1GXIE 2JW4A 1T3SA 3CXCA 1VQLT 4IURA 4OF1A 3REAB 3G1JA 5GAN2 3P8BB 4Z89A 3OYKA 2BZ8A 1XOVA 3QPHA 5IAYA 4J9CA 1WHKA 4E7IA 1NPRA 1I81A 3UWNA 4C92F 1NM7A 4IUUA 5GANf 5EG2A 2AK5A 5HKCA 4CI0C 2JMAA 3FJPA 2FZKB 3UF4A 2RHXA 4CC7A 1X75C 5KYNA 1QKXA 4N0AC 4X34A 1MMAA 5HY6A 1X2QA 3I56A 1UUEA 3M4YA 4F7UE 3OYNA 4ZGDB 5LJ3j 1G3YA 1AVZC 2FRWA 5KYUB 3SWNB 4HCZA 2KRSA 4IUPA 1Q7YC 1XQHA 1EX4A 2ROTA 2P4TA 1YIJT 1BI2A 3CQTA 1VQ5A 1M1KU 1M8VA 2HEQA 2AKKA 3LGFA 3CCLA 1Q86C 3I55T 2VXFA 2HNIA 3V7SA 4D8KA 1RAHB 2L5QA 2ABLA 2JTEA 4BY6B 1D09B 2DBMA 4PJNA 3RESA 2KRMA 4RG2A 1PRLC 2KRNA 1Z9QA 3WXMB 4WTOB 2RB6A 1JXMA 2EYZA 3OS5A 2LQKA 4C92A 1VQMQ 2EGAA 3GNFB 4P5NA 3HPWA 2BKDN 3OSVA 4E7KA 1Q7YR 4KRTA 2AT1B 2X4JA 2OTLQ 2JM9A 2KNBB 2FL7A 4XU0A 2YUOA 1ZSZB 5GMKm 4C0DB 1RAGB 3OW2P 4XU3A 1M90C 4MZMA 2E65A 3H0IA 1Q86R 3RMQA 5A0DA 1O75A 1JB0E 2DL8A 2FPEA 4HVVA 4OB0B 4HT8A 4JPBW 4PLLA 2KBTA 1QLYA 1WJQA 1R0CB 2DVJA 2LP5A 2QA4A 1OU8A 2AHJB 5LL6S 2O31A 5LJ3e 2LQWA 4DEXA 4GLKA 2NUZA 1QP3A 8AT1B 1J3TA 2R58A 1WJSA 3LH0A 1JJ2A 3FDRA 1WGSA 4LE9A 4IUVA 3G4ST 5DM7R 2K7AA 1WDXA 1G83A 3QJ6A 2DXUA 2K57A 1X43A 1T0JA 3SEMA 3JCMh 1W1FA 3OS1A 4M77B 3META 1M90R 2EKHA 2EQJA 1YJNT 1I07A 4B6MA 2IIMA 4OMPA 2LC4A 1JEGA 4XTUA 4E7HA 3S3MA 2XHCA 1G3SA 2W0ZA 3VV0A 1WNLA 4J83A 3DLLA 2DTOA 1YCSB 3TU4K 2O9SA 1ACMB 4E7ZA 2B8AA 1NG2A 2LJ3A 1YFNA 4L6V5 1VQMA 3H0FA 2QEXT 1U3OA 1VQ4T 1OV3A 2ZPBB 2RJDA 2VV5A 4C92B 2OTLA 3M4GA 5KYXB 2J7IA 3S3NA 1NPPA 4UC4A 5KCHA 4N0AA 4N4HA 5DLOA 4B9XA 3C4SA 4BE2A 5HK3A 3NFCA 3SB2A 3CCVT 3M0SA 1ARKA 3JCMe 3TQ7P 2JTFA 9ATCB 1K9MU 4OMMA 3LH5A 1LNXA 2VXEA 3NPFA 4ZTJA 4AFQC 1UECA 3V7RA 1WHMA 3O8VA 3VYHB 4J6WA 4M7AD 2LT4A 1M1FA 3CCRT 1UJYA 1V29B 2V8JA 5LJ5f 1MHNA 1HXDA 1LOJA 5CVIA 4OP0A 1OOTA 2A3LA 4J9HA 3X25B 3BY7A 4JS4A 3R6NA 2L89A 2CT3A 4PJOE 2DETA 2SEMA 4M78E 5A0LA 5EC7A 1ZA1B 1AT1B 1U06A 2ZGWA 1W2BS 4JJCA 3OYHA 5GANj 4RTYA 4M7AC 2QTVA 1Z9ZA 4PLIA 2PVGB 1G3TA 2AKLA 3UPUA 4ORZA 3FIFA 2LT1A 2D6FA 2ZPGB 2AIRB 2DIGA 1D0XA 1U5SA 2EBPA 1NLOC 5D7UA 5GAN5 4NL2A 2F69A 3PGGA 4OB1B 2WSCE 1M9SA 1N6AA 5GJWB 1MV0B 3THKA 1N27A 4EPCA 4L59A 1K9AA 1UGPB 4L5GA 4X9DA 2Z0WA 2L3PA 4ZTFA 2E12A 2OTJQ 3TSZA 4J7IA 2LX7A 2I0NA 2DK3A 4M4ZA 1QCNA 2ZPFB 3PE0A 3U23A 3CD6Q 2RJFA 1PNJA 3JB9D 2H3EB 3R6OA 5GAOn 2CP3A 5LJ3f 3VUBA 3GP8A 1MNDA 2P0KA 3CCMQ 1YJWQ 1RL2A 4K11A 3EG0A 1HK9A 3QWXX 4XU1A 2X3WD 2V8IA 2KK4A 2O88A 2KT8A 4MMLA 1M2VA 3HP9A 2LX9A 1S72Q 1KHCA 3HL8A 5J3BA 1M4ZA 1X6BA 4C8QD 3CCST 3QJYA 1KD1U 4QQDA 1K0SA 4C92G 2A08A 3A8MB 3EFOA 3OYMA 2JTMA 2Y4YA 1KJWA 2D1XA 2GGRA 5FLXE 1H8KA 4F7UF 4AFUC 2E70A 2MPXC 5FU6C 1OYXA 1VQKT 3JCMc 3JCMP 4EMGA 1V76A 2DFUA 5GAOm 5L23A 1UHCA 1GBQA 1OPKA 4C8QC 4ELYC 1WFWA 2VB6A 2CGHA 2O4XA 1IREB 1KC8U 2CDTA 2DX1A 2P4RA 5FROA 3JB9J 2VASA 3M56A 4RTWA 4XK8E 1PRMC 3E19A 1S1NA 2V26A 1B7TA 1UGQB 2HQEA 3FRNA 3NHNA 1PHTA 2EVRA 3JCMf 3CXCS 3MO8A 1UB4A 2OTJA 2P0PA 3QIIA 2FVUA 4R0KA 1TUGB 2DTIA 3NMZC 1Y0MA 3CD6A 1E6HA 2E41A 4ZNXA 2F2VA 4QKUA 1OU9A 1AEYA 2L3QA 5KCOA 3L2VA 2YXYA 2V8KA 3CCMA 5IXBA 1YJWA 4KUDK 2DRMA 1W2BP 1TS9A 4AG1C 1U1SA 1XTDA 1JXOA 1RACB 2XK0A 3EH2A 2COZA 3MCAB 3G71T 3A5ZB 4JZ4A 3LWHA 2V1RA 1G8XA 1S72A 1IXDA 4F7UA 4FL6A 4PJOD 3WVEB 1QVPA 3BDUA 2BUDA 2XICA 4FYWB 1N5ZA 1M2VB 2EJFA 4BE1A 1YBYA 2XMFA 5D6XA 2FB7A 4F04B 4JUVA 1R77A 3KXTA 2R57A 3ME9A 1WQ7A 1YCYA 2QDYB 1GL5A 2QI2A 3G7ZA 2RA2A 3TREA 2E1HA 2RI3A 4C0FA 3X28B 3JB9F 5GMKh 1VQ6Q 4IKFA 1Y7XA 3A8GB 3GBQA 1RI0A 3EFOB 3VRZA 5CKEA 3C95A 3DB3A 4J7FA 3EGUA 4JRKA 2KT1A 2YUPA 3CC2T 1PD0A 2ATCB 2DRKA 2NWMA 4CRIA 1X01A 4PJOC 4E47A 3VS4A 4R55A 1YHQQ 1OQKA 1Q81C 2M9UA 3X24B 4ELZC 1H92A 4ZN3A 4FW2A 4C5GA 2M16A 3I9QA 1TG0A 3L2ZA 3M53A 3JCMb 5CK9A 1BYMA 4XTYA 4CC2A 4IIMA 3RKXA 4ZGJB 3LWIA 4M7DD 4X1VA 2K2MA 2YRDA 2GNCA 2ZPHB 1H3HA 3MKDA 3A8HB 4PKCC 1VQPT 3BW1A 1VUBA 2RK2A 3C94A 1JRIA 1WHJA 1K1ZA 3CCEQ 3A98A 5GAMg 2RF0A 3PTAA 3HSBA 4BI4A 3C0CA 3A1PA 4AFZC 3M0TA 5GMKe 3MHXA 1V1CA 4ESRA 1VQ8T 5FWBA 2DD5A 3CCJA 5CR2A 1Q7YU 1Q81R 2D0QB 2VGNA 4NS5A 1KQ2A 1OZ3A 1VQ9T 1X2KA 1N8RC 1MMGA 4IUTA 1OPLA 2RHIA 4M7DC 1N9SA 3M9QA 3FLGA 4WCIA 3NTHA 1WHLA 3QDRB 4F7UB 1Q82U 1K73C 3REBB 1VQLQ 4M75D 2QA4T 4ZN1A 1A0NB 1HD3A 1BBZA 4DBHA 4QVDA 4XAXB 1TSFA 1VQ6A 2J6FA 1HYOA 3OYCA 2P0QA 1ABOA 1SSHA 3CXCP 4RG8A 1EFNA 1VYTA 3QUIA 1ZSGA 3HHTB 4OGCA 1BU1A 4QVZA 2R5MA 4M7AE 2XDBA 1NBEB 5CKHA 1SSFA 4PFPA 2F5TX 1YITA 4KH0B 5GAN8 4PJOF 2BZXA 2PVDB 3TVTA 1WA7A 1WXTA 4HCKA 1YHQA 4ATOA 3VS5A 4M78F 3CPWA 3OBYA 1N8RR 4OVAA 4D6WA 1SRLA 3VS1A
chains in the Genus database with same CATH topology
2G6FX 4J9IA 4LUDA 2JMCA 2RQTA 1U3OA 2HCKA 1NYGA 1RUWA 1OV3A 1OEBA 2LJ0A 2BZYA 3M0UA 2H8HA 2C0TA 1TUCA 4F16A 2J7IA 3ULRB 2A28A 5GJVB 2EQIA 3EG2A 2DL3A 1X69A 2DL5A 1I1JA 1AWOA 2GTOA 1GFDA 2J6OA 2ESWA 2D8HA 2YUNA 1IO6A 3UA6A 3M0SA 4JZ3A 1CKAA 1ARKA 2J06A 2FPDA 1W70A 4IIOA 1PKSA 2LMJA 3LH5A 4OMMA 5IHNA 4AG2C 3EHQA 3VS0A 3NPFA 1CSKA 1UECA 3TSWA 3ZL7C 4AFQC 1SRMA 5IHKA 2JT4A 1AWXA 1UJYA 1T0HA 2EPDA 3VS1A 1I0CA 1YN8A 1OOTA 2YSQA 4J9HA 2CSQA 1E7OA 3R6NA 1UE9A 4RTUA 1KIKA 3I5RA 1M3AA 2CT3A 2VVKA 2A36A 2HBWA 1CKBA 2SEMA 2F2XA 2ED0A 2VKNA 1NEGA 5EC7A 1G2BA 2KXDA 4D8DA 2J05A 1U06A 3VS3A 1VYUA 2D0NA 2KEAA 3VRYA 2DILA 4CC4B 4JJCA 2DYBA 2M51A 4RTYA 2ROLA 4OMLA 1SHGA 1LCKA 1Z9ZA 1NYFA 4RTZA 4E6RA 2AKLA 2W10A 4RTTA 3UA7A 4ORZA 2DL7A 4AFSC 2LZ6B 2KYMA 1GCQA 2RQRA 1U5SA 2EBPA 1NLOC 2HSPA 1MUZA 1M30A 4LN2A 2DL4A 4LUEA 1QCFA 1PKTA 5GJWB 1MV0B 5I22A 2MOXA 3THKA 3EG1A 2F2WA 3H0HA 1K9AA 4OMQA 2QDLA 2L3PA 2X3XD 1WX6A 1Y57A 3TSZA 2LX7A 2RMOA 2I0NA 4OMNA 4M4ZA 3PE0A 3U23A 1HSQA 5IH2A 1PNJA 2DM1A 1YNZA 2ED1A 1UJ0A 2EGCA 2PZ1A 3VS6A 4JJDA 1AD5A 2K9GA 1SPKA 4K11A 3EG0A 3FJ5A 3QWXX 2K3BA 4RTVA 1ZBJA 2RN8A 2X3WD 2O88A 3VS7A 2EGEA 2BTTA 5FW9A 2KT8A 1JO8A 3VS2A 2RPNA 2AZVA 2FO0A 4HVWA 1WI7A 1M3CA 1TUDA 1X6BA 4J9BA 2LCSA 1K0SA 2KE9A 2GBQA 4A63B 2D8JA 2CT4A 4LNPA 2A08A 1MV3A 2KGTA 1RI9A 2LQNA 2DBKA 1ZLMA 1GBRA 5IHIA 3QWYA 1AZEA 2FEIA 5HCKA 1ZUYA 2CUDA 1KJWA 2D1XA 2GGRA 2M0YA 1H8KA 4AFUC 2EYYA 3UATA 1ZUKA 2CREA 2B86A 4CC3A 1UFFA 2FPFA 1K4US 1JU5C 2ENMA 5L23A 3M0PA 1UHCA 2JM8A 1QWFA 1GBQA 1OPKA 2A37A 1UG1A 4RUGA 2DJQA 4F17A 3IQLA 4RTXA 1GFCA 1WFWA 3NGPA 4J9GA 1E6GA 2DE0X 2CDTA 2DX1A 2P4RA 1WIEA 2DLPA 1YWPA 1ABQA 3M0RA 3PVQA 4RTWA 1T3LA 2L0AA 1PRMC 1S1NA 4OMOA 1WYXA 2ECZA 2JS0A 3NHNA 1PHTA 2OAWA 2JW4A 1T3SA 3REAB 2EVRA 2OJ2A 1M8MA 1GRIA 4R0KA 4Z89A 2BZ8A 2PTKA 1BB9A 2OI3A 3NMZC 1Y0MA 1XOVA 3JV3A 1E6HA 4ZNXA 2F2VA 2YT6A 4J9CA 1AEYA 2L3QA 1AOJA 1NM7A 2GQIA 2K79A 5IXBA 2AK5A 2CH4A 2DNUA 2JMAA 3UF4A 1WXBA 2DRMA 4AG1C 4CC7A 1JXOA 1QKXA 2RQWA 1NLPC 4JZ4A 4J9EA 1X2QA 2V1RA 2RNAA 3M0QA 1UUEA 1AVZC 2FRWA 4HXJA 4Y92A 2KR3A 1N5ZA 2KRSA 2AZSA 3EHRA 1AWJA 2XMFA 4GBQA 1AWWA 2ROTA 1K0XA 3CQTA 5FWCA 1GL5A 2HEQA 2AKKA 1YWOA 4Z8AA 1X27A 3GBQA 3VRZA 4D8KA 1PWTA 3EGUA 2ABLA 2JTEA 1BK2A 2KT1A 2YUPA 2HDAA 2DBMA 1NEBA 1FYNA 2DRKA 2NWMA 2KXCA 2KRMA 1PRLC 3VS4A 2JS2A 2KRNA 1Z9QA 1SEMA 1QWEA 1VYVA 3H41A 1WXUA 3KFVA 4F14A 1JXMA 2EYZA 3PVLA 4HVUA 1H92A 2EGAA 2EW3A 3I9QA 4EIKA 1W6XA 1TG0A 1VA7A 2CSIA 2SRCA 4DEYA 2O9VA 2L3SA 4KRTA 4CC2A 4IIMA 3RNJA 2VWFA 2E5KA 2JM9A 2KNBB 3I5SA 2KROA 2DA9A 4X1VA 1UGVA 2PNIA 4Z88A 1UDLA 2K2MA 2YUOA 2MCNA 2GNCA 2MIOA 1H3HA 1ZX6A 1FMKA 1YP5A 4J9FA 2RQVA 3H0IA 1K1ZA 1KSWA 1GCQC 3A98A 4J9DA 2L2PA 2LNHB 2RF0A 5ECAA 2FRYA 2DL8A 2FPEA 4HVVA 2KYBA 1K76A 2C0IA 4JPBW 3C0CA 2KBTA 1QLYA 2FG0A 3M0TA 4AFZC 1HJDA 1AZGB 2DF6A 1RLPC 3EG3A 3RBBB 2DVJA 5IXFA 1V1CA 4ESRA 2LP5A 2O31A 2LQWA 5FWBA 2EYWA 4DEXA 2NUZA 2K6DA 2YUQA 1J3TA 1KFZA 1B07A 1X2KA 1QKWA 1OPLA 4LE9A 2K7AA 2GTJA 4WCIA 1WDXA 1G83A 1X6GA 2V1QA 3O5ZA 1X43A 2RQUA 3REBB 1T0JA 3SHWA 3SEMA 1W1FA 1UHFA 2JXBA 2EKHA 1M3BA 1A0NB 1SHFA 2EYXA 1HD3A 1I07A 1BBZA 2O2OA 2IIMA 4OMPA 1M27C 2J6FA 2C0OA 1JEGA 2CUBA 1ABOA 1JQQA 1SSHA 1RLQC 1EFNA 1VYTA 2YDLA 1ZSGA 4JJBA 1BU1A 2J6KA 2W0ZA 2DMOA 1GCPA 1YCSB 3I35A 1ZUUA 2LJ1A 2O9SA 1WLPB 4FSSA 4QT7A 2BZXA 3TVTA 1NG2A 2LJ3A 1UTIA 1WA7A 1WXTA 4HCKA 2CH4W 3VS5A 5I11A 4GLMA 3H0FA 1SRLA 1B3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G6F X;  4J9I A;  4LUD A;  2JMC A;  2RQT A;  1U3O A;  2HCK A;  1NYG A;  1RUW A;  1OV3 A;  1OEB A;  2LJ0 A;  2BZY A;  3M0U A;  2H8H A;  2C0T A;  1TUC A;  4F16 A;  2J7I A;  3ULR B;  2A28 A;  5GJV B;  2EQI A;  3EG2 A;  2DL3 A;  1X69 A;  2DL5 A;  1I1J A;  1AWO A;  2GTO A;  1GFD A;  2J6O A;  2ESW A;  2D8H A;  2YUN A;  1IO6 A;  3UA6 A;  3M0S A;  4JZ3 A;  1CKA A;  1ARK A;  2J06 A;  2FPD A;  1W70 A;  4IIO A;  1PKS A;  2LMJ A;  3LH5 A;  4OMM A;  5IHN A;  4AG2 C;  3EHQ A;  3VS0 A;  3NPF A;  1CSK A;  1UEC A;  3TSW A;  3ZL7 C;  4AFQ C;  1SRM A;  5IHK A;  2JT4 A;  1AWX A;  1UJY A;  1T0H A;  2EPD A;  3VS1 A;  1I0C A;  1YN8 A;  1OOT A;  2YSQ A;  4J9H A;  2CSQ A;  1E7O A;  3R6N A;  1UE9 A;  4RTU A;  1KIK A;  3I5R A;  1M3A A;  2CT3 A;  2VVK A;  2A36 A;  2HBW A;  1CKB A;  2SEM A;  2F2X A;  2ED0 A;  2VKN A;  1NEG A;  5EC7 A;  1G2B A;  2KXD A;  4D8D A;  2J05 A;  1U06 A;  3VS3 A;  1VYU A;  2D0N A;  2KEA A;  3VRY A;  2DIL A;  4CC4 B;  4JJC A;  2DYB A;  2M51 A;  4RTY A;  2ROL A;  4OML A;  1SHG A;  1LCK A;  1Z9Z A;  1NYF A;  4RTZ A;  4E6R A;  2AKL A;  2W10 A;  4RTT A;  3UA7 A;  4ORZ A;  2DL7 A;  4AFS C;  2LZ6 B;  2KYM A;  1GCQ A;  2RQR A;  1U5S A;  2EBP A;  1NLO C;  2HSP A;  1MUZ A;  1M30 A;  4LN2 A;  2DL4 A;  4LUE A;  1QCF A;  1PKT A;  5GJW B;  1MV0 B;  5I22 A;  2MOX A;  3THK A;  3EG1 A;  2F2W A;  3H0H A;  1K9A A;  4OMQ A;  2QDL A;  2L3P A;  2X3X D;  1WX6 A;  1Y57 A;  3TSZ A;  2LX7 A;  2RMO A;  2I0N A;  4OMN A;  4M4Z A;  3PE0 A;  3U23 A;  1HSQ A;  5IH2 A;  1PNJ A;  2DM1 A;  1YNZ A;  2ED1 A;  1UJ0 A;  2EGC A;  2PZ1 A;  3VS6 A;  4JJD A;  1AD5 A;  2K9G A;  1SPK A;  4K11 A;  3EG0 A;  3FJ5 A;  3QWX X;  2K3B A;  4RTV A;  1ZBJ A;  2RN8 A;  2X3W D;  2O88 A;  3VS7 A;  2EGE A;  2BTT A;  5FW9 A;  2KT8 A;  1JO8 A;  3VS2 A;  2RPN A;  2AZV A;  2FO0 A;  4HVW A;  1WI7 A;  1M3C A;  1TUD A;  1X6B A;  4J9B A;  2LCS A;  1K0S A;  2KE9 A;  2GBQ A;  4A63 B;  2D8J A;  2CT4 A;  4LNP A;  2A08 A;  1MV3 A;  2KGT A;  1RI9 A;  2LQN A;  2DBK A;  1ZLM A;  1GBR A;  5IHI A;  3QWY A;  1AZE A;  2FEI A;  5HCK A;  1ZUY A;  2CUD A;  1KJW A;  2D1X A;  2GGR A;  2M0Y A;  1H8K A;  4AFU C;  2EYY A;  3UAT A;  1ZUK A;  2CRE A;  2B86 A;  4CC3 A;  1UFF A;  2FPF A;  1K4U S;  1JU5 C;  2ENM A;  5L23 A;  3M0P A;  1UHC A;  2JM8 A;  1QWF A;  1GBQ A;  1OPK A;  2A37 A;  1UG1 A;  4RUG A;  2DJQ A;  4F17 A;  3IQL A;  4RTX A;  1GFC A;  1WFW A;  3NGP A;  4J9G A;  1E6G A;  2DE0 X;  2CDT A;  2DX1 A;  2P4R A;  1WIE A;  2DLP A;  1YWP A;  1ABQ A;  3M0R A;  3PVQ A;  4RTW A;  1T3L A;  2L0A A;  1PRM C;  1S1N A;  4OMO A;  1WYX A;  2ECZ A;  2JS0 A;  3NHN A;  1PHT A;  2OAW A;  2JW4 A;  1T3S A;  3REA B;  2EVR A;  2OJ2 A;  1M8M A;  1GRI A;  4R0K A;  4Z89 A;  2BZ8 A;  2PTK A;  1BB9 A;  2OI3 A;  3NMZ C;  1Y0M A;  1XOV A;  3JV3 A;  1E6H A;  4ZNX A;  2F2V A;  2YT6 A;  4J9C A;  1AEY A;  2L3Q A;  1AOJ A;  1NM7 A;  2GQI A;  2K79 A;  5IXB A;  2AK5 A;  2CH4 A;  2DNU A;  2JMA A;  3UF4 A;  1WXB A;  2DRM A;  4AG1 C;  4CC7 A;  1JXO A;  1QKX A;  2RQW A;  1NLP C;  4JZ4 A;  4J9E A;  1X2Q A;  2V1R A;  2RNA A;  3M0Q A;  1UUE A;  1AVZ C;  2FRW A;  4HXJ A;  4Y92 A;  2KR3 A;  1N5Z A;  2KRS A;  2AZS A;  3EHR A;  1AWJ A;  2XMF A;  4GBQ A;  1AWW A;  2ROT A;  1K0X A;  3CQT A;  5FWC A;  1GL5 A;  2HEQ A;  2AKK A;  1YWO A;  4Z8A A;  1X27 A;  3GBQ A;  3VRZ A;  4D8K A;  1PWT A;  3EGU A;  2ABL A;  2JTE A;  1BK2 A;  2KT1 A;  2YUP A;  2HDA A;  2DBM A;  1NEB A;  1FYN A;  2DRK A;  2NWM A;  2KXC A;  2KRM A;  1PRL C;  3VS4 A;  2JS2 A;  2KRN A;  1Z9Q A;  1SEM A;  1QWE A;  1VYV A;  3H41 A;  1WXU A;  3KFV A;  4F14 A;  1JXM A;  2EYZ A;  3PVL A;  4HVU A;  1H92 A;  2EGA A;  2EW3 A;  3I9Q A;  4EIK A;  1W6X A;  1TG0 A;  1VA7 A;  2CSI A;  2SRC A;  4DEY A;  2O9V A;  2L3S A;  4KRT A;  4CC2 A;  4IIM A;  3RNJ A;  2VWF A;  2E5K A;  2JM9 A;  2KNB B;  3I5S A;  2KRO A;  2DA9 A;  4X1V A;  1UGV A;  2PNI A;  4Z88 A;  1UDL A;  2K2M A;  2YUO A;  2MCN A;  2GNC A;  2MIO A;  1H3H A;  1ZX6 A;  1FMK A;  1YP5 A;  4J9F A;  2RQV A;  3H0I A;  1K1Z A;  1KSW A;  1GCQ C;  3A98 A;  4J9D A;  2L2P A;  2LNH B;  2RF0 A;  5ECA A;  2FRY A;  2DL8 A;  2FPE A;  4HVV A;  2KYB A;  1K76 A;  2C0I A;  4JPB W;  3C0C A;  2KBT A;  1QLY A;  2FG0 A;  3M0T A;  4AFZ C;  1HJD A;  1AZG B;  2DF6 A;  1RLP C;  3EG3 A;  3RBB B;  2DVJ A;  5IXF A;  1V1C A;  4ESR A;  2LP5 A;  2O31 A;  2LQW A;  5FWB A;  2EYW A;  4DEX A;  2NUZ A;  2K6D A;  2YUQ A;  1J3T A;  1KFZ A;  1B07 A;  1X2K A;  1QKW A;  1OPL A;  4LE9 A;  2K7A A;  2GTJ A;  4WCI A;  1WDX A;  1G83 A;  1X6G A;  2V1Q A;  3O5Z A;  1X43 A;  2RQU A;  3REB B;  1T0J A;  3SHW A;  3SEM A;  1W1F A;  1UHF A;  2JXB A;  2EKH A;  1M3B A;  1A0N B;  1SHF A;  2EYX A;  1HD3 A;  1I07 A;  1BBZ A;  2O2O A;  2IIM A;  4OMP A;  1M27 C;  2J6F A;  2C0O A;  1JEG A;  2CUB A;  1ABO A;  1JQQ A;  1SSH A;  1RLQ C;  1EFN A;  1VYT A;  2YDL A;  1ZSG A;  4JJB A;  1BU1 A;  2J6K A;  2W0Z A;  2DMO A;  1GCP A;  1YCS B;  3I35 A;  1ZUU A;  2LJ1 A;  2O9S A;  1WLP B;  4FSS A;  4QT7 A;  2BZX A;  3TVT A;  1NG2 A;  2LJ3 A;  1UTI A;  1WA7 A;  1WXT A;  4HCK A;  2CH4 W;  3VS5 A;  5I11 A;  4GLM A;  3H0F A;  1SRL A;  1B3Q A; 
#chains in the Genus database with same CATH topology
 4J9I A;  4LUD A;  1TOV A;  4VUB A;  4II1 A;  2HCK A;  4M75 C;  1M90 U;  1NYG A;  2YRV A;  4A54 A;  1K73 R;  2LDM A;  2MAM A;  1YIJ Q;  3L42 A;  3M0U A;  2YLC A;  2H8H A;  3RKW A;  2C0T A;  5KE3 A;  3RMS A;  2A28 A;  2CZ1 B;  1IHV A;  2F1L A;  2K3Y A;  3CBO A;  3RIR A;  2DL5 A;  2DTH A;  3ZBD A;  1AWO A;  3I55 Q;  1RAB B;  2GTO A;  1GFD A;  3CCE A;  2D8H A;  4YTL A;  4A4K A;  3OW2 A;  3JRZ A;  2DIQ A;  5FU7 C;  1W70 A;  2JOY A;  3HFO A;  5CIU A;  2I2L A;  2YHT A;  2QXF A;  3EHQ A;  4BDZ A;  1CSK A;  3TSW A;  3ZL7 C;  1SRM A;  1BIB A;  5KE2 A;  2XG8 D;  4DOW A;  2YLB A;  4RCC A;  3QZ9 B;  3L2U A;  1YI2 T;  3OQ5 A;  5CKF A;  2X35 A;  2G3R A;  2L3R A;  1K8A U;  1E7O A;  2M02 A;  1UE9 A;  2LQ8 A;  1M1K C;  3GPL A;  1KIK A;  4HCB A;  3I5R A;  1M3A A;  1VQL A;  4PJO A;  4PL6 A;  2CS7 A;  2VVK A;  1QQJ A;  2HBW A;  1CKB A;  4M78 A;  2DZ9 A;  3JSC A;  1FXX A;  4BB7 A;  1YJ9 T;  1MMN A;  1I5O B;  3MEA A;  2X51 A;  2MF2 A;  1NJI C;  2EAY A;  1VYU A;  1PSF A;  2DYB A;  4PNO A;  2KDS A;  4FM4 B;  1LCK A;  4LDV A;  1NYF A;  4FT4 A;  2EWN A;  3QG1 A;  4C8Q E;  2DL7 A;  3PIP A;  1QP2 A;  2KYM A;  3G4S Q;  2GCX A;  4J8O A;  3HRS A;  1M30 A;  1OZ2 A;  2P84 A;  2M1H A;  1M1K R;  4EMK C;  2DL4 A;  4LUE A;  3CBM A;  1QCF A;  1QW1 A;  4F7U G;  1YIJ A;  4A4G A;  1AHJ B;  4LDX A;  3DLM A;  5CKD A;  2RJE A;  2X3X D;  1YJN Q;  1WX6 A;  3EG9 A;  3OYB A;  1MGQ A;  2DAQ A;  3MPU B;  1NJI R;  3I55 A;  2COY A;  1D1A A;  4QQG A;  3L1A A;  1Y07 A;  4PFO A;  1HSQ A;  5IH2 A;  2VGM A;  2HBP A;  1UJ0 A;  2PZ1 A;  3X26 B;  1AD5 A;  1VIE A;  3JAM E;  2K3B A;  3EFS A;  1ZBJ A;  2R5A A;  3V8K A;  5IT9 E;  3VS7 A;  1BCO A;  2BTT A;  3OYI A;  2MK5 A;  3EH1 A;  2QEX Q;  3GF5 A;  1M3C A;  4E7J A;  1G3W A;  1VQ4 Q;  1WJR A;  4HT9 A;  2NLU A;  2ZZD A;  2XI9 A;  2HMA A;  1D0Y A;  2LCS A;  2LTO A;  2GBQ A;  1D3B A;  2WSE E;  3OA6 A;  3J7A F;  3QXE B;  2YWW A;  5FRM A;  1U8R A;  1ZLM A;  3MP6 A;  3DB4 A;  2QQB A;  5IHI A;  1AZE A;  3CCV Q;  4PJO B;  1QVG A;  5CQX A;  3CPF A;  1DJ7 B;  2CUD A;  1KQS A;  4M78 B;  3SDZ A;  2MI6 A;  3CCQ T;  5GAM h;  2B86 A;  2CP6 A;  1VQ7 T;  2KY9 A;  3OYL A;  2A37 A;  3CCR Q;  3UT1 A;  4F17 A;  3CME T;  4ME7 A;  4MZP A;  3G4S A;  2DE0 X;  3Q1J A;  1QCO A;  3JB9 G;  5CKB A;  2DLP A;  1MMD A;  1YWP A;  2CP0 A;  3M0R A;  1SF9 A;  4MZT A;  3ZEH A;  1WHH A;  1WYX A;  5M9O A;  5CQY A;  2OAW A;  4Y91 A;  2HKQ B;  5LJ5 g;  2OJ2 A;  2QGG A;  4AMC A;  5GMK l;  1YJN A;  1M8M A;  5AT1 B;  2DEQ A;  2HL3 A;  1GRI A;  1K9M C;  3CC7 T;  1I4K 1;  1ZHI A;  2X9H A;  1RAI B;  2KVQ G;  2PTK A;  1BB9 A;  1R0B G;  4ANJ A;  3JV3 A;  3OS2 A;  1NZ9 A;  1WHG A;  3EG9 B;  4KGV B;  2GQI A;  5I2S A;  1I8F A;  2K79 A;  1Y96 A;  1WXB A;  4JJN K;  2QQR A;  1TU0 B;  2JUF A;  3OYE A;  4MMK A;  1Y71 A;  3LW5 E;  3SWN C;  1H3Z A;  3PFS A;  3M0Q A;  1KQ1 A;  1XJW B;  2QEX A;  2K2V A;  5GAN 7;  1VQ4 A;  4M7D E;  2KR3 A;  1VQO T;  3V8J A;  3EFR A;  2AZS A;  3OMG A;  2DO3 A;  5HK0 A;  1VIF A;  2HL5 C;  5FWC A;  3CCU T;  1K9M R;  3PMT A;  1D3B B;  2DKG A;  1YWO A;  3CCV A;  1VQN T;  2DER A;  2GF7 A;  1NE8 A;  1PD1 A;  4BY6 C;  3X20 B;  4PK4 A;  1KK7 A;  2VC8 A;  2L8D A;  1PWT A;  4E7S A;  1F1B B;  5KH6 A;  2QQ9 A;  3A8L B;  4LXC A;  2KXC A;  2XDD A;  1SEM A;  2DXB A;  3CCR A;  2EQU A;  3H41 A;  1VYV A;  1WXU A;  3KFV A;  4F14 A;  5LJ3 g;  5GAN 3;  4PJL A;  3CCS Q;  4HVU A;  1QMC A;  1Q95 G;  2EW3 A;  1D0Z A;  2RI5 A;  1W6X A;  1VA7 A;  2CSI A;  4DEY A;  2O9V A;  3PIO A;  4M75 E;  2L3S A;  4FSX A;  1ZSZ C;  3RNJ A;  3QKJ A;  2BE7 D;  3I5S A;  2KRO A;  2DA9 A;  1UGV A;  4M7A F;  3EAE A;  1UDL A;  2NUP A;  5CO7 A;  2MCN A;  3HRT A;  4M77 D;  4JRI A;  2MIO A;  3CC4 Q;  2DPP B;  3E9F A;  1YP5 A;  1UEB A;  4J9F A;  2E3H A;  1RAD B;  4PJO G;  5J39 A;  3HTR A;  3RER A;  4LD6 A;  2RI2 A;  3LX7 A;  4M78 G;  1VQK Q;  2LNH B;  2FRY A;  2KYB A;  5L8R E;  1K76 A;  2C0I A;  3G6E T;  2WAC A;  1XNI A;  2K5I A;  3ZFJ A;  1ZA2 B;  2DF6 A;  3GLX A;  2XDP A;  3EG3 A;  2XU8 A;  3P8H A;  2E10 A;  3LLR A;  2EYW A;  2YUQ A;  3INZ A;  4ZGE B;  1Y96 B;  2KSS A;  2ZPI B;  1B07 A;  1QKW A;  1FWZ A;  3CMA Q;  2GTJ A;  1X6G A;  5KYW A;  5GAO r;  2FZC B;  1R8O B;  4M77 C;  2E5Q A;  1JBM A;  2DYI A;  3O5Z A;  4C92 D;  1WQW A;  2RD1 A;  2RQU A;  3SHW A;  1M2O A;  3BE3 A;  5GMK i;  4WF2 A;  4OB2 B;  3SD4 A;  2WSF E;  2JXB A;  3OY9 A;  3CCJ T;  1SHF A;  1RAE B;  2QGF B;  5GMK j;  2O2O A;  3QSU A;  4NL3 A;  2CUB A;  1JQQ A;  3M57 A;  1RLQ C;  1FMW A;  2HAX A;  4M7A A;  5DLQ E;  4DBF A;  4OGE A;  3M54 A;  4C5I A;  3N5B B;  5GAM d;  4M7D G;  2DMO A;  1GCP A;  5I2M A;  1KC8 C;  3G71 Q;  2HSE B;  3I35 A;  1ZUU A;  3E1S A;  2LJ1 A;  1WLP B;  4BDY A;  2CH4 W;  2GFU A;  1QVF A;  3CCS A;  4R56 A;  3CPW S;  1G5V A;  4GLM A;  4C92 C;  3I56 T;  2G6F X;  2JMC A;  2EFI A;  2LCC A;  2JJ9 A;  2RHZ A;  2CP5 A;  2QK0 A;  4Z02 A;  1PG5 B;  4KUL A;  2QQA A;  4Y28 E;  1ZBX A;  1TUC A;  4F16 A;  3ULR B;  5GJV B;  2D9T A;  2MYS A;  1YIT T;  2NUT A;  2DL3 A;  3EGX A;  3SWN A;  3CC4 A;  1TXQ A;  1I1J A;  3H8Z A;  1VQ5 T;  4C8Q F;  4FCY A;  2J6O A;  2ESW A;  2YUN A;  1IO6 A;  3UA6 A;  4JZ3 A;  1VQK A;  1CKA A;  3RKY A;  2J06 A;  2FPD A;  3CCL T;  3J80 E;  3CC2 Q;  4AG2 C;  2O4X B;  4JRP A;  1KC8 R;  3VS0 A;  3FB9 A;  2CZ0 B;  5IHK A;  3QYH B;  3VJP A;  3VUZ A;  5CCA A;  4J6Y A;  3CBP A;  3QBY A;  3EGD A;  2A0F B;  1T0H A;  3AT1 B;  2X4X A;  2EKO A;  3A8O B;  2XID A;  2CSQ A;  3CMA A;  5GAN 4;  2CP2 A;  5GAN d;  2Y4X A;  2QTX A;  2PVO B;  4DBQ A;  1OX8 A;  4LDW A;  5KYW B;  1VQP Q;  4DOV A;  2F2X A;  2ZPE B;  5LJ5 h;  3OYG A;  4A4E A;  1VOM A;  2KXD A;  3E2U A;  2J05 A;  1JJ2 S;  2KEA A;  2M51 A;  4OMF B;  1LJO A;  4JRQ A;  4OML A;  1VQ8 Q;  1Q86 U;  2E64 A;  4RTZ A;  5GAO l;  4E6R A;  3G71 A;  4C8Q A;  2W10 A;  4RTT A;  4M7A B;  4RCB A;  4AFS C;  1BI0 A;  1VQ9 Q;  4JLI A;  3OYJ A;  1BKB A;  4JLG A;  3BDL A;  2RQR A;  4HKE A;  2HSP A;  2RM4 A;  3FEO A;  1MUZ A;  4LN2 A;  1KG1 A;  4E2F B;  5I21 A;  1PKT A;  3OBW A;  4IUQ A;  2HQX A;  4TVR A;  3S6W A;  2DXT A;  2QQS A;  2CKK A;  2E4H A;  4KGX B;  3EG1 A;  3M5A A;  2QA4 Q;  2QDL A;  3PNW C;  4XTW A;  3OMC A;  1OX9 A;  4XU2 A;  2E6N A;  1OI1 A;  4NOY A;  2VYT A;  4KGZ B;  4OMN A;  3MJX A;  4EMH A;  4C5H A;  3OB9 A;  2X4Y A;  5GAN g;  2DM1 A;  2PU9 B;  2NUT B;  3EGX B;  4B9W A;  2EGC A;  4M77 A;  1I5L A;  3CC2 A;  4X9C A;  5LJ5 e;  1SPK A;  3FJ5 A;  4KT0 E;  1P92 A;  2RN8 A;  3RUX A;  3ASK A;  5KYY A;  5FW9 A;  3C12 A;  3VS2 A;  3QZ5 B;  1Q82 C;  2AZV A;  5FRN A;  1WI7 A;  2CYZ B;  5LJ3 h;  1VQM T;  3KBG A;  4J9B A;  2FZG B;  2KI7 A;  3EGD B;  2MWO A;  2KE9 A;  4A63 B;  2OAU A;  1NJI U;  3CPW P;  4LNP A;  2RH2 A;  3FC3 A;  2OTL T;  2KGT A;  2LQN A;  2DBK A;  1VQP A;  1GBR A;  3QWY A;  3V8L A;  2FEI A;  3D7S B;  5HCK A;  5KYX A;  1QVG S;  4V2S A;  3QHS A;  4BUG A;  2M0Y A;  1KQS S;  2GQV A;  3JCM W;  2EYY A;  4MDW A;  1ZUK A;  2CRE A;  4QQ6 A;  4M7D F;  2QG9 B;  4E7L A;  5IN1 A;  3MEV A;  1VQ8 A;  2FYK A;  2FPF A;  2ENM A;  5FU6 B;  1QWF A;  2F5K A;  2DJQ A;  2HQH A;  2M0O A;  4GY5 A;  1Q82 R;  1GFC A;  1VQ9 A;  1PM3 A;  1YI2 Q;  1E6G A;  4LDY A;  1BCM A;  1WIE A;  4C8Q B;  2DJZ A;  2PQW A;  3URG A;  2PUO B;  1T3L A;  2L0A A;  4LDU A;  2ECZ A;  3OSS C;  1IHW A;  2FHD A;  2JS0 A;  4LD9 K;  1YJ9 Q;  1D1B A;  1IZ6 A;  3GIB A;  1FMV A;  2OI3 A;  3M59 A;  2YT6 A;  2RK1 A;  4RMO A;  1AOJ A;  3VKI A;  4M75 F;  1PCX A;  2CH4 A;  2DNU A;  3HRU A;  2KQW A;  2XKO C;  3UDC A;  1JJ2 P;  4N4I A;  4M7A G;  1K8A C;  2RQW A;  1TH7 A;  3GOX A;  1NLP C;  4J9E A;  2Y90 A;  2RNA A;  3CEY A;  5AYF A;  4M7D A;  5CAI A;  4HXJ A;  4Y92 A;  5KYY B;  2EJG A;  3JCM V;  3EHR A;  4M77 E;  2HKN A;  1AWJ A;  2K3X A;  4GBQ A;  1AWW A;  5D6W A;  3RR6 A;  1U1T A;  1K0X A;  3VU3 C;  4MDX A;  4BI3 A;  3PMI A;  4Z8A A;  1X27 A;  5LJ5 d;  2RHY A;  1SKU B;  4FYX B;  5GAM j;  3JCM J;  1WPY A;  4J6X A;  1BK2 A;  4FU6 A;  2HDA A;  1NEB A;  1FYN A;  3M55 A;  1K8A R;  3H9N A;  2JS2 A;  3T9N A;  2RO0 A;  1QWE A;  2RHU A;  3PVL A;  3JCM X;  1YI2 A;  3MP8 A;  4C92 E;  2KMT A;  4EIK A;  4M75 A;  4A53 A;  2SRC A;  1H64 1;  3RDV A;  1KHI A;  2VWF A;  4PFZ A;  3TEE A;  2E5K A;  2PNI A;  4O5V A;  4Z88 A;  4KBM B;  3V7C A;  3OS0 A;  1YJ9 A;  4XTX A;  1X6O A;  1ZX6 A;  3JCM Q;  1FMK A;  3L2R A;  1BIA A;  2RQV A;  2XD0 A;  3VYG A;  1KSW A;  1GCQ C;  3LYI A;  4J9D A;  1OUL A;  3CCQ Q;  2L2P A;  2MMP A;  5ECA A;  2CZ7 B;  4HA8 A;  1VQ7 Q;  2FG0 A;  1QVG P;  1HJD A;  3F70 A;  1AZG B;  1RLP C;  2CZ6 B;  3RBB B;  5IXF A;  1KQS P;  3CME Q;  3QDF A;  3MEU A;  2DEU A;  4FW1 A;  2CP7 A;  4AT1 B;  2K6D A;  4KH1 B;  3L2W A;  1KFZ A;  3J81 E;  1RAF B;  4C8Q G;  2K5F A;  5LJ3 d;  2V1Q A;  3KUF A;  5GAO q;  3QO3 A;  4XQ3 A;  5C6S A;  4M7D B;  1UHF A;  2GFA A;  2K4Y A;  3CC7 Q;  1M3B A;  2EYX A;  3OYY A;  2OTJ T;  5GAM e;  1M27 C;  2C0O A;  1PC0 A;  3OYF A;  2EJ9 A;  3CD6 T;  2YDL A;  5GAN 6;  1BI1 A;  4JJB A;  2J6K A;  4A4H A;  5GAO p;  5GAN h;  4A4F A;  1D1C A;  2E6Z A;  3CCM T;  1YJW T;  4M77 G;  2NYS A;  4FSS A;  4QT7 A;  7AT1 B;  1UTI A;  2BE9 B;  1LPL A;  1UGR B;  1QVF S;  5I11 A;  1S72 T;  3NTK A;  1B3Q A;  1VQO Q;  2DXC A;  4EMK A;  2RQT A;  1RUW A;  1OEB A;  2LJ0 A;  2EYQ A;  2BZY A;  3H6Z A;  1M5Q 1;  1IGQ A;  5C0M A;  4M75 B;  4J5Y A;  1B34 A;  2EQI A;  3CCU Q;  2DZC A;  3EG2 A;  1VQN Q;  1X69 A;  3WVD B;  4EDU A;  4Q5W A;  1C0M A;  2IPO B;  3CCQ A;  3HFN A;  4BI8 B;  3HKS A;  4FYY B;  2JN0 A;  4IIO A;  1PKS A;  2LMJ A;  5IHN A;  4C0G A;  1VQ7 A;  4C0D C;  2E3I A;  2COW A;  4C0Z A;  4DBR A;  3CME A;  5FU7 B;  3JCM d;  2PUK B;  2A7Y A;  3OYA A;  2LNV A;  2JT4 A;  3CC4 T;  1AWX A;  5GAN e;  2LVM A;  2EPD A;  1I0C A;  1YN8 A;  4BE0 A;  2YSQ A;  2JNG A;  1C1A A;  4RTU A;  1WZO A;  5D6Y A;  4N4G A;  2A36 A;  4XTV A;  2ED0 A;  3CC7 A;  1ZQ1 A;  2EQM A;  1NEG A;  2VKN A;  1KD1 C;  1FX7 A;  8ATC B;  1G2B A;  3GNG A;  4D8D A;  1M1G A;  1W2B A;  3G6E Q;  4FYV B;  3VS3 A;  2D0N A;  4CC4 B;  3VRY A;  2DIL A;  1N9R A;  1RAA B;  1IB8 A;  3CMA T;  3E9G A;  1IRX A;  5A0G A;  2ROL A;  3MP1 A;  1SHG A;  3DKM A;  4C5E A;  2YRC A;  3UA7 A;  3QYG B;  2QYZ A;  4DQ2 A;  2LZ6 B;  4XTZ A;  1GCQ A;  2K5L A;  5DY9 A;  1VQO A;  1BI3 A;  2X4W A;  2OX7 A;  1TWB A;  4BAC A;  1Q81 U;  3JCM g;  4PJJ A;  5I22 A;  2MOX A;  2F2W A;  2LCL A;  2QAS A;  3H0H A;  4OMQ A;  2O01 E;  1TTH B;  4EMK B;  2BIV A;  2HZY A;  3P8D A;  3CCJ Q;  3CCU A;  1Y57 A;  1KD1 R;  1VQN A;  2RMO A;  3AHU A;  1B34 B;  1W4S A;  4M78 D;  1EZZ B;  1YNZ A;  2ED1 A;  1VQ6 T;  3VS6 A;  4JJD A;  2DD4 A;  1SG5 A;  3NTI A;  2K9G A;  3LGL A;  2VUB A;  6AT1 B;  4RTV A;  4JS5 A;  5KYU A;  4PJM A;  3S3O A;  2EGE A;  4QW2 A;  1JO8 A;  2JZ2 A;  3I56 Q;  2EIF A;  3BFM A;  2RPN A;  1YHQ T;  2DVE A;  2FO0 A;  4HVW A;  1TUD A;  2NUP B;  2JVV A;  3M58 A;  2LRQ A;  3ER0 A;  4HCC A;  2MWP A;  4QVC A;  4O6J A;  1UGS B;  4OB3 B;  5J26 A;  3OW2 S;  4RKU E;  2D8J A;  1QVF P;  2CT4 A;  5GAM f;  1N8R U;  1MV3 A;  1YIT Q;  4M75 G;  1RI9 A;  2ZAE A;  3JB9 H;  1C6V X;  4M78 C;  1VQ5 Q;  4KUI A;  1K73 U;  5LJ5 j;  2H3J A;  3L2Q A;  1ZUY A;  3CCL Q;  3G6E A;  2QAZ A;  3CCE T;  2ZCF B;  3UAT A;  4CC3 A;  4FT2 A;  2KAF A;  3SFM A;  1O9S A;  4M77 F;  1UFF A;  1K4U S;  1JU5 C;  4FIB A;  2HD0 A;  3M0P A;  2JM8 A;  3PT9 A;  4JDS A;  3OYD A;  1UG1 A;  4RUG A;  2RJC A;  4BD3 A;  3IQL A;  4RTX A;  2IVW A;  3JB9 I;  3NGP A;  4J9G A;  4DA4 A;  2EQK A;  1PSE A;  2IG0 A;  1EIF A;  1MNE A;  1ABQ A;  1IGU A;  3PVQ A;  1LVK A;  5A2Q E;  1ZSZ A;  4OMO A;  3TCJ A;  3MEW A;  2C06 A;  1GXI E;  2JW4 A;  1T3S A;  3CXC A;  1VQL T;  4IUR A;  4OF1 A;  3REA B;  3G1J A;  5GAN 2;  3P8B B;  4Z89 A;  3OYK A;  2BZ8 A;  1XOV A;  3QPH A;  5IAY A;  4J9C A;  1WHK A;  4E7I A;  1NPR A;  1I81 A;  3UWN A;  4C92 F;  1NM7 A;  4IUU A;  5GAN f;  5EG2 A;  2AK5 A;  5HKC A;  4CI0 C;  2JMA A;  3FJP A;  2FZK B;  3UF4 A;  2RHX A;  4CC7 A;  1X75 C;  5KYN A;  1QKX A;  4N0A C;  4X34 A;  1MMA A;  5HY6 A;  1X2Q A;  3I56 A;  1UUE A;  3M4Y A;  4F7U E;  3OYN A;  4ZGD B;  5LJ3 j;  1G3Y A;  1AVZ C;  2FRW A;  5KYU B;  3SWN B;  4HCZ A;  2KRS A;  4IUP A;  1Q7Y C;  1XQH A;  1EX4 A;  2ROT A;  2P4T A;  1YIJ T;  1BI2 A;  3CQT A;  1VQ5 A;  1M1K U;  1M8V A;  2HEQ A;  2AKK A;  3LGF A;  3CCL A;  1Q86 C;  3I55 T;  2VXF A;  2HNI A;  3V7S A;  4D8K A;  1RAH B;  2L5Q A;  2ABL A;  2JTE A;  4BY6 B;  1D09 B;  2DBM A;  4PJN A;  3RES A;  2KRM A;  4RG2 A;  1PRL C;  2KRN A;  1Z9Q A;  3WXM B;  4WTO B;  2RB6 A;  1JXM A;  2EYZ A;  3OS5 A;  2LQK A;  4C92 A;  1VQM Q;  2EGA A;  3GNF B;  4P5N A;  3HPW A;  2BKD N;  3OSV A;  4E7K A;  1Q7Y R;  4KRT A;  2AT1 B;  2X4J A;  2OTL Q;  2JM9 A;  2KNB B;  2FL7 A;  4XU0 A;  2YUO A;  1ZSZ B;  5GMK m;  4C0D B;  1RAG B;  3OW2 P;  4XU3 A;  1M90 C;  4MZM A;  2E65 A;  3H0I A;  1Q86 R;  3RMQ A;  5A0D A;  1O75 A;  1JB0 E;  2DL8 A;  2FPE A;  4HVV A;  4OB0 B;  4HT8 A;  4JPB W;  4PLL A;  2KBT A;  1QLY A;  1WJQ A;  1R0C B;  2DVJ A;  2LP5 A;  2QA4 A;  1OU8 A;  2AHJ B;  5LL6 S;  2O31 A;  5LJ3 e;  2LQW A;  4DEX A;  4GLK A;  2NUZ A;  1QP3 A;  8AT1 B;  1J3T A;  2R58 A;  1WJS A;  3LH0 A;  1JJ2 A;  3FDR A;  1WGS A;  4LE9 A;  4IUV A;  3G4S T;  5DM7 R;  2K7A A;  1WDX A;  1G83 A;  3QJ6 A;  2DXU A;  2K57 A;  1X43 A;  1T0J A;  3SEM A;  3JCM h;  1W1F A;  3OS1 A;  4M77 B;  3MET A;  1M90 R;  2EKH A;  2EQJ A;  1YJN T;  1I07 A;  4B6M A;  2IIM A;  4OMP A;  2LC4 A;  1JEG A;  4XTU A;  4E7H A;  3S3M A;  2XHC A;  1G3S A;  2W0Z A;  3VV0 A;  1WNL A;  4J83 A;  3DLL A;  2DTO A;  1YCS B;  3TU4 K;  2O9S A;  1ACM B;  4E7Z A;  2B8A A;  1NG2 A;  2LJ3 A;  1YFN A;  4L6V 5;  1VQM A;  3H0F A;  2QEX T;  1U3O A;  1VQ4 T;  1OV3 A;  2ZPB B;  2RJD A;  2VV5 A;  4C92 B;  2OTL A;  3M4G A;  5KYX B;  2J7I A;  3S3N A;  1NPP A;  4UC4 A;  5KCH A;  4N0A A;  4N4H A;  5DLO A;  4B9X A;  3C4S A;  4BE2 A;  5HK3 A;  3NFC A;  3SB2 A;  3CCV T;  3M0S A;  1ARK A;  3JCM e;  3TQ7 P;  2JTF A;  9ATC B;  1K9M U;  4OMM A;  3LH5 A;  1LNX A;  2VXE A;  3NPF A;  4ZTJ A;  4AFQ C;  1UEC A;  3V7R A;  1WHM A;  3O8V A;  3VYH B;  4J6W A;  4M7A D;  2LT4 A;  1M1F A;  3CCR T;  1UJY A;  1V29 B;  2V8J A;  5LJ5 f;  1MHN A;  1HXD A;  1LOJ A;  5CVI A;  4OP0 A;  1OOT A;  2A3L A;  4J9H A;  3X25 B;  3BY7 A;  4JS4 A;  3R6N A;  2L89 A;  2CT3 A;  4PJO E;  2DET A;  2SEM A;  4M78 E;  5A0L A;  5EC7 A;  1ZA1 B;  1AT1 B;  1U06 A;  2ZGW A;  1W2B S;  4JJC A;  3OYH A;  5GAN j;  4RTY A;  4M7A C;  2QTV A;  1Z9Z A;  4PLI A;  2PVG B;  1G3T A;  2AKL A;  3UPU A;  4ORZ A;  3FIF A;  2LT1 A;  2D6F A;  2ZPG B;  2AIR B;  2DIG A;  1D0X A;  1U5S A;  2EBP A;  1NLO C;  5D7U A;  5GAN 5;  4NL2 A;  2F69 A;  3PGG A;  4OB1 B;  2WSC E;  1M9S A;  1N6A A;  5GJW B;  1MV0 B;  3THK A;  1N27 A;  4EPC A;  4L59 A;  1K9A A;  1UGP B;  4L5G A;  4X9D A;  2Z0W A;  2L3P A;  4ZTF A;  2E12 A;  2OTJ Q;  3TSZ A;  4J7I A;  2LX7 A;  2I0N A;  2DK3 A;  4M4Z A;  1QCN A;  2ZPF B;  3PE0 A;  3U23 A;  3CD6 Q;  2RJF A;  1PNJ A;  3JB9 D;  2H3E B;  3R6O A;  5GAO n;  2CP3 A;  5LJ3 f;  3VUB A;  3GP8 A;  1MND A;  2P0K A;  3CCM Q;  1YJW Q;  1RL2 A;  4K11 A;  3EG0 A;  1HK9 A;  3QWX X;  4XU1 A;  2X3W D;  2V8I A;  2KK4 A;  2O88 A;  2KT8 A;  4MML A;  1M2V A;  3HP9 A;  2LX9 A;  1S72 Q;  1KHC A;  3HL8 A;  5J3B A;  1M4Z A;  1X6B A;  4C8Q D;  3CCS T;  3QJY A;  1KD1 U;  4QQD A;  1K0S A;  4C92 G;  2A08 A;  3A8M B;  3EFO A;  3OYM A;  2JTM A;  2Y4Y A;  1KJW A;  2D1X A;  2GGR A;  5FLX E;  1H8K A;  4F7U F;  4AFU C;  2E70 A;  2MPX C;  5FU6 C;  1OYX A;  1VQK T;  3JCM c;  3JCM P;  4EMG A;  1V76 A;  2DFU A;  5GAO m;  5L23 A;  1UHC A;  1GBQ A;  1OPK A;  4C8Q C;  4ELY C;  1WFW A;  2VB6 A;  2CGH A;  2O4X A;  1IRE B;  1KC8 U;  2CDT A;  2DX1 A;  2P4R A;  5FRO A;  3JB9 J;  2VAS A;  3M56 A;  4RTW A;  4XK8 E;  1PRM C;  3E19 A;  1S1N A;  2V26 A;  1B7T A;  1UGQ B;  2HQE A;  3FRN A;  3NHN A;  1PHT A;  2EVR A;  3JCM f;  3CXC S;  3MO8 A;  1UB4 A;  2OTJ A;  2P0P A;  3QII A;  2FVU A;  4R0K A;  1TUG B;  2DTI A;  3NMZ C;  1Y0M A;  3CD6 A;  1E6H A;  2E41 A;  4ZNX A;  2F2V A;  4QKU A;  1OU9 A;  1AEY A;  2L3Q A;  5KCO A;  3L2V A;  2YXY A;  2V8K A;  3CCM A;  5IXB A;  1YJW A;  4KUD K;  2DRM A;  1W2B P;  1TS9 A;  4AG1 C;  1U1S A;  1XTD A;  1JXO A;  1RAC B;  2XK0 A;  3EH2 A;  2COZ A;  3MCA B;  3G71 T;  3A5Z B;  4JZ4 A;  3LWH A;  2V1R A;  1G8X A;  1S72 A;  1IXD A;  4F7U A;  4FL6 A;  4PJO D;  3WVE B;  1QVP A;  3BDU A;  2BUD A;  2XIC A;  4FYW B;  1N5Z A;  1M2V B;  2EJF A;  4BE1 A;  1YBY A;  2XMF A;  5D6X A;  2FB7 A;  4F04 B;  4JUV A;  1R77 A;  3KXT A;  2R57 A;  3ME9 A;  1WQ7 A;  1YCY A;  2QDY B;  1GL5 A;  2QI2 A;  3G7Z A;  2RA2 A;  3TRE A;  2E1H A;  2RI3 A;  4C0F A;  3X28 B;  3JB9 F;  5GMK h;  1VQ6 Q;  4IKF A;  1Y7X A;  3A8G B;  3GBQ A;  1RI0 A;  3EFO B;  3VRZ A;  5CKE A;  3C95 A;  3DB3 A;  4J7F A;  3EGU A;  4JRK A;  2KT1 A;  2YUP A;  3CC2 T;  1PD0 A;  2ATC B;  2DRK A;  2NWM A;  4CRI A;  1X01 A;  4PJO C;  4E47 A;  3VS4 A;  4R55 A;  1YHQ Q;  1OQK A;  1Q81 C;  2M9U A;  3X24 B;  4ELZ C;  1H92 A;  4ZN3 A;  4FW2 A;  4C5G A;  2M16 A;  3I9Q A;  1TG0 A;  3L2Z A;  3M53 A;  3JCM b;  5CK9 A;  1BYM A;  4XTY A;  4CC2 A;  4IIM A;  3RKX A;  4ZGJ B;  3LWI A;  4M7D D;  4X1V A;  2K2M A;  2YRD A;  2GNC A;  2ZPH B;  1H3H A;  3MKD A;  3A8H B;  4PKC C;  1VQP T;  3BW1 A;  1VUB A;  2RK2 A;  3C94 A;  1JRI A;  1WHJ A;  1K1Z A;  3CCE Q;  3A98 A;  5GAM g;  2RF0 A;  3PTA A;  3HSB A;  4BI4 A;  3C0C A;  3A1P A;  4AFZ C;  3M0T A;  5GMK e;  3MHX A;  1V1C A;  4ESR A;  1VQ8 T;  5FWB A;  2DD5 A;  3CCJ A;  5CR2 A;  1Q7Y U;  1Q81 R;  2D0Q B;  2VGN A;  4NS5 A;  1KQ2 A;  1OZ3 A;  1VQ9 T;  1X2K A;  1N8R C;  1MMG A;  4IUT A;  1OPL A;  2RHI A;  4M7D C;  1N9S A;  3M9Q A;  3FLG A;  4WCI A;  3NTH A;  1WHL A;  3QDR B;  4F7U B;  1Q82 U;  1K73 C;  3REB B;  1VQL Q;  4M75 D;  2QA4 T;  4ZN1 A;  1A0N B;  1HD3 A;  1BBZ A;  4DBH A;  4QVD A;  4XAX B;  1TSF A;  1VQ6 A;  2J6F A;  1HYO A;  3OYC A;  2P0Q A;  1ABO A;  1SSH A;  3CXC P;  4RG8 A;  1EFN A;  1VYT A;  3QUI A;  1ZSG A;  3HHT B;  4OGC A;  1BU1 A;  4QVZ A;  2R5M A;  4M7A E;  2XDB A;  1NBE B;  5CKH A;  1SSF A;  4PFP A;  2F5T X;  1YIT A;  4KH0 B;  5GAN 8;  4PJO F;  2BZX A;  2PVD B;  3TVT A;  1WA7 A;  1WXT A;  4HCK A;  1YHQ A;  4ATO A;  3VS5 A;  4M78 F;  3CPW A;  3OBY A;  1N8R R;  4OVA A;  4D6W A;  1SRL A;  3VS1 A; 
#chains in the Genus database with same CATH homology
 2G6F X;  4J9I A;  4LUD A;  2JMC A;  2RQT A;  1U3O A;  2HCK A;  1NYG A;  1RUW A;  1OV3 A;  1OEB A;  2LJ0 A;  2BZY A;  3M0U A;  2H8H A;  2C0T A;  1TUC A;  4F16 A;  2J7I A;  3ULR B;  2A28 A;  5GJV B;  2EQI A;  3EG2 A;  2DL3 A;  1X69 A;  2DL5 A;  1I1J A;  1AWO A;  2GTO A;  1GFD A;  2J6O A;  2ESW A;  2D8H A;  2YUN A;  1IO6 A;  3UA6 A;  3M0S A;  4JZ3 A;  1CKA A;  1ARK A;  2J06 A;  2FPD A;  1W70 A;  4IIO A;  1PKS A;  2LMJ A;  3LH5 A;  4OMM A;  5IHN A;  4AG2 C;  3EHQ A;  3VS0 A;  3NPF A;  1CSK A;  1UEC A;  3TSW A;  3ZL7 C;  4AFQ C;  1SRM A;  5IHK A;  2JT4 A;  1AWX A;  1UJY A;  1T0H A;  2EPD A;  3VS1 A;  1I0C A;  1YN8 A;  1OOT A;  2YSQ A;  4J9H A;  2CSQ A;  1E7O A;  3R6N A;  1UE9 A;  4RTU A;  1KIK A;  3I5R A;  1M3A A;  2CT3 A;  2VVK A;  2A36 A;  2HBW A;  1CKB A;  2SEM A;  2F2X A;  2ED0 A;  2VKN A;  1NEG A;  5EC7 A;  1G2B A;  2KXD A;  4D8D A;  2J05 A;  1U06 A;  3VS3 A;  1VYU A;  2D0N A;  2KEA A;  3VRY A;  2DIL A;  4CC4 B;  4JJC A;  2DYB A;  2M51 A;  4RTY A;  2ROL A;  4OML A;  1SHG A;  1LCK A;  1Z9Z A;  1NYF A;  4RTZ A;  4E6R A;  2AKL A;  2W10 A;  4RTT A;  3UA7 A;  4ORZ A;  2DL7 A;  4AFS C;  2LZ6 B;  2KYM A;  1GCQ A;  2RQR A;  1U5S A;  2EBP A;  1NLO C;  2HSP A;  1MUZ A;  1M30 A;  4LN2 A;  2DL4 A;  4LUE A;  1QCF A;  1PKT A;  5GJW B;  1MV0 B;  5I22 A;  2MOX A;  3THK A;  3EG1 A;  2F2W A;  3H0H A;  1K9A A;  4OMQ A;  2QDL A;  2L3P A;  2X3X D;  1WX6 A;  1Y57 A;  3TSZ A;  2LX7 A;  2RMO A;  2I0N A;  4OMN A;  4M4Z A;  3PE0 A;  3U23 A;  1HSQ A;  5IH2 A;  1PNJ A;  2DM1 A;  1YNZ A;  2ED1 A;  1UJ0 A;  2EGC A;  2PZ1 A;  3VS6 A;  4JJD A;  1AD5 A;  2K9G A;  1SPK A;  4K11 A;  3EG0 A;  3FJ5 A;  3QWX X;  2K3B A;  4RTV A;  1ZBJ A;  2RN8 A;  2X3W D;  2O88 A;  3VS7 A;  2EGE A;  2BTT A;  5FW9 A;  2KT8 A;  1JO8 A;  3VS2 A;  2RPN A;  2AZV A;  2FO0 A;  4HVW A;  1WI7 A;  1M3C A;  1TUD A;  1X6B A;  4J9B A;  2LCS A;  1K0S A;  2KE9 A;  2GBQ A;  4A63 B;  2D8J A;  2CT4 A;  4LNP A;  2A08 A;  1MV3 A;  2KGT A;  1RI9 A;  2LQN A;  2DBK A;  1ZLM A;  1GBR A;  5IHI A;  3QWY A;  1AZE A;  2FEI A;  5HCK A;  1ZUY A;  2CUD A;  1KJW A;  2D1X A;  2GGR A;  2M0Y A;  1H8K A;  4AFU C;  2EYY A;  3UAT A;  1ZUK A;  2CRE A;  2B86 A;  4CC3 A;  1UFF A;  2FPF A;  1K4U S;  1JU5 C;  2ENM A;  5L23 A;  3M0P A;  1UHC A;  2JM8 A;  1QWF A;  1GBQ A;  1OPK A;  2A37 A;  1UG1 A;  4RUG A;  2DJQ A;  4F17 A;  3IQL A;  4RTX A;  1GFC A;  1WFW A;  3NGP A;  4J9G A;  1E6G A;  2DE0 X;  2CDT A;  2DX1 A;  2P4R A;  1WIE A;  2DLP A;  1YWP A;  1ABQ A;  3M0R A;  3PVQ A;  4RTW A;  1T3L A;  2L0A A;  1PRM C;  1S1N A;  4OMO A;  1WYX A;  2ECZ A;  2JS0 A;  3NHN A;  1PHT A;  2OAW A;  2JW4 A;  1T3S A;  3REA B;  2EVR A;  2OJ2 A;  1M8M A;  1GRI A;  4R0K A;  4Z89 A;  2BZ8 A;  2PTK A;  1BB9 A;  2OI3 A;  3NMZ C;  1Y0M A;  1XOV A;  3JV3 A;  1E6H A;  4ZNX A;  2F2V A;  2YT6 A;  4J9C A;  1AEY A;  2L3Q A;  1AOJ A;  1NM7 A;  2GQI A;  2K79 A;  5IXB A;  2AK5 A;  2CH4 A;  2DNU A;  2JMA A;  3UF4 A;  1WXB A;  2DRM A;  4AG1 C;  4CC7 A;  1JXO A;  1QKX A;  2RQW A;  1NLP C;  4JZ4 A;  4J9E A;  1X2Q A;  2V1R A;  2RNA A;  3M0Q A;  1UUE A;  1AVZ C;  2FRW A;  4HXJ A;  4Y92 A;  2KR3 A;  1N5Z A;  2KRS A;  2AZS A;  3EHR A;  1AWJ A;  2XMF A;  4GBQ A;  1AWW A;  2ROT A;  1K0X A;  3CQT A;  5FWC A;  1GL5 A;  2HEQ A;  2AKK A;  1YWO A;  4Z8A A;  1X27 A;  3GBQ A;  3VRZ A;  4D8K A;  1PWT A;  3EGU A;  2ABL A;  2JTE A;  1BK2 A;  2KT1 A;  2YUP A;  2HDA A;  2DBM A;  1NEB A;  1FYN A;  2DRK A;  2NWM A;  2KXC A;  2KRM A;  1PRL C;  3VS4 A;  2JS2 A;  2KRN A;  1Z9Q A;  1SEM A;  1QWE A;  1VYV A;  3H41 A;  1WXU A;  3KFV A;  4F14 A;  1JXM A;  2EYZ A;  3PVL A;  4HVU A;  1H92 A;  2EGA A;  2EW3 A;  3I9Q A;  4EIK A;  1W6X A;  1TG0 A;  1VA7 A;  2CSI A;  2SRC A;  4DEY A;  2O9V A;  2L3S A;  4KRT A;  4CC2 A;  4IIM A;  3RNJ A;  2VWF A;  2E5K A;  2JM9 A;  2KNB B;  3I5S A;  2KRO A;  2DA9 A;  4X1V A;  1UGV A;  2PNI A;  4Z88 A;  1UDL A;  2K2M A;  2YUO A;  2MCN A;  2GNC A;  2MIO A;  1H3H A;  1ZX6 A;  1FMK A;  1YP5 A;  4J9F A;  2RQV A;  3H0I A;  1K1Z A;  1KSW A;  1GCQ C;  3A98 A;  4J9D A;  2L2P A;  2LNH B;  2RF0 A;  5ECA A;  2FRY A;  2DL8 A;  2FPE A;  4HVV A;  2KYB A;  1K76 A;  2C0I A;  4JPB W;  3C0C A;  2KBT A;  1QLY A;  2FG0 A;  3M0T A;  4AFZ C;  1HJD A;  1AZG B;  2DF6 A;  1RLP C;  3EG3 A;  3RBB B;  2DVJ A;  5IXF A;  1V1C A;  4ESR A;  2LP5 A;  2O31 A;  2LQW A;  5FWB A;  2EYW A;  4DEX A;  2NUZ A;  2K6D A;  2YUQ A;  1J3T A;  1KFZ A;  1B07 A;  1X2K A;  1QKW A;  1OPL A;  4LE9 A;  2K7A A;  2GTJ A;  4WCI A;  1WDX A;  1G83 A;  1X6G A;  2V1Q A;  3O5Z A;  1X43 A;  2RQU A;  3REB B;  1T0J A;  3SHW A;  3SEM A;  1W1F A;  1UHF A;  2JXB A;  2EKH A;  1M3B A;  1A0N B;  1SHF A;  2EYX A;  1HD3 A;  1I07 A;  1BBZ A;  2O2O A;  2IIM A;  4OMP A;  1M27 C;  2J6F A;  2C0O A;  1JEG A;  2CUB A;  1ABO A;  1JQQ A;  1SSH A;  1RLQ C;  1EFN A;  1VYT A;  2YDL A;  1ZSG A;  4JJB A;  1BU1 A;  2J6K A;  2W0Z A;  2DMO A;  1GCP A;  1YCS B;  3I35 A;  1ZUU A;  2LJ1 A;  2O9S A;  1WLP B;  4FSS A;  4QT7 A;  2BZX A;  3TVT A;  1NG2 A;  2LJ3 A;  1UTI A;  1WA7 A;  1WXT A;  4HCK A;  2CH4 W;  3VS5 A;  5I11 A;  4GLM A;  3H0F A;  1SRL A;  1B3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...