2FVUA

Structure of the yeast sir3 bah domain
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
216
structure length
190
Chain Sequence
HMTMAKTLKDLDGWQVIITDNVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the Saccharomyces cerevisiae Sir3 BAH domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Regulatory protein SIR3
total genus 43
structure length 190
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2fvuA01
4DOVA 3PT9A 1ZBXA 1W4SA 3PTAA 4FSXA 4FT2A 4LD9K 2FVUA 1ZHIA 4KULA 2FL7A 4KUIA 4KUDK 1M4ZA 4FT4A 4DOWA 4DA4A 4BB7A 4JJNK 3TU4K
chains in the Genus database with same CATH superfamily
5FU7C 4AFQC 4NL3A 2J7IA 1G3WA 3O8VA 1B34B 4KH0B 3E1SA 5DM7R 2BIVA 4RTTA 4QQDA 4JS4A 1UFFA 1VQ5A 2YRVA 2RJEA 1TUCA 3OQ5A 1Q86R 2CH4A 3MHXA 1UG1A 2P0KA 2ROTA 3JAME 3RIRA 2FRYA 4RKUE 3X24B 1KQ2A 1YHQT 4AG2C 2DRMA 1BB9A 5KYXA 4M7AE 2AK5A 1YI2Q 2G6FX 1YI2T 1KQ1A 2K2VA 2EJGA 2OTLQ 1Q86U 2CP0A 1VQMA 2QQBA 4MZTA 1V76A 3CCVQ 3CD6Q 1OPKA 1FMVA 3QWYA 3X28B 4JZ3A 1X43A 3JB9D 2LCCA 2HBWA 1N8RR 2DIQA 7AT1B 2V26A 1Q82C 1YWPA 2LZ6B 1SRMA 3R6NA 4XTVA 3V8LA 5KYUB 2F5TX 1MUZA 1WA7A 4J6XA 1K0SA 3PVQA 3QUIA 3I56Q 4FIBA 2COYA 1Q7YU 4PLLA 4JS5A 5LJ5g 2D0QB 2DXUA 3ME9A 2EKOA 2LMJA 1VQ6Q 2EGEA 1I4K1 3VU3C 3PNWC 5KYWA 1GBRA 4OMNA 2L8DA 1MNDA 2QI2A 1K76A 2RHIA 2D0NA 1OZ3A 1QCFA 3DB4A 1IGQA 4BI3A 2LRQA 3CCRT 2YLCA 2HAXA 2YSQA 2EFIA 3OBWA 2NYSA 1VQKQ 1VQ4Q 4RTXA 1NJIU 1JJ2S 5CKEA 4JPBW 2F1LA 1AOJA 2KNBB 2QDLA 3G6ET 1K8AC 2EAYA 2JOYA 3VYHB 4ME7A 2D6FA 1A0NB 5D6XA 1D3BB 3OS2A 2DTOA 4HVVA 2E3HA 3KXTA 3JRZA 1NEBA 2KI7A 5GANf 2HKQB 3RERA 4EMGA 1BI1A 1VQ6T 2HBPA 2PUOB 3MKDA 1MV3A 2O4XA 2RM4A 2KY9A 1YJ9Q 2OTLA 1KD1U 2D9TA 2X3WD 3CXCP 4FT2A 4M7AD 3OYDA 2BKDN 3QSUA 4C92D 4M77C 3SWNB 1CKAA 4Z88A 3CCLQ 2LCSA 3FC3A 2DO3A 1VIFA 1GL5A 2QGGA 3KUFA 3U23A 3EGUA 1D0XA 1MNEA 4Z02A 3C94A 2HQEA 3VRZA 4FSSA 4M77F 1T0JA 1T3LA 2KSSA 2LQWA 1Q86C 1ZHIA 2RI3A 2E41A 1TTHB 1OZ2A 2C0IA 2DMOA 4PKCC 4C0DC 2RHZA 2W10A 3L42A 5GAOr 2XMFA 1Q81U 3M0RA 2VWFA 2DXBA 3EH2A 1YCYA 1AWWA 1UGPB 1M90C 1VQ6A 2VV5A 3HPWA 5L8RE 4FYWB 3M0SA 1TSFA 1BK2A 3CMET 3EG0A 2BZXA 3G71Q 1PNJA 1OX9A 4UC4A 3CC2Q 3CCRQ 5C0MA 1GFCA 5CKBA 2NUTB 1QVFA 4NL2A 3G1JA 3CBOA 3VYGA 2GQVA 3BDLA 4J83A 4BE1A 3GIBA 2ABLA 1YJWA 4F04B 5GMKe 3ZL7C 2Y4XA 2NLUA 4M77A 2K57A 4KGXB 5GAN4 1YJNQ 3CXCA 4BI4A 5LJ5j 3JB9G 1K9MR 3UT1A 2PNIA 2YUOA 2J6FA 4C8QA 3JCMb 2PVDB 1SRLA 1RAHB 3TEEA 5HK0A 2DL5A 4A4GA 3E9FA 2V8JA 2RNAA 3VKIA 1SSHA 1HXDA 4M77B 1GBQA 3NHNA 5A2QE 1YJ9T 1VQPT 3M0QA 1C6VX 2M16A 4BDYA 2CP6A 1JJ2A 2K9GA 2V8IA 5GAOl 1YFNA 2J06A 2FG0A 3OS0A 4BI8B 2DL7A 1HYOA 5GAN3 1PC0A 2HDAA 1YJ9A 2B86A 1O75A 3OYKA 4FYYB 4O5VA 1ZBXA 2E5QA 4X9CA 1TUGB 3UWNA 5KYYA 1G2BA 2O31A 2MMPA 5CKDA 4BE0A 1TU0B 4AT1B 3I35A 1GCQA 1ZUYA 4XU0A 2EJ9A 2MK5A 4RG2A 3VS7A 2A36A 2DD5A 1RL2A 3CC4Q 3OW2A 1VQLQ 4L5GA 4PLIA 1VQLT 2EYXA 1G8XA 5FRMA 1JQQA 1R77A 2JNGA 4MMKA 4M7DB 4JUVA 2MWPA 4KRTA 2OAUA 5GANg 3LW5E 1UJ0A 2FYKA 3L2RA 3OYLA 5IXBA 2HKNA 4N4HA 1H3HA 1GCPA 3EFOA 3OMGA 1WFWA 4C8QG 1T3SA 3P8DA 1PRMC 1FMKA 1G3TA 4QT7A 1D1BA 1RAAB 1NE8A 2D8HA 3H6ZA 3HHTB 2LP5A 1VQ8A 3BDUA 5LJ5h 2DF6A 2EW3A 1Y96B 4R56A 2MCNA 1U5SA 1C0MA 1B7TA 2LC4A 3RMSA 4C92C 3CCET 1KSWA 2XKOC 5L23A 4F7UA 6AT1B 4M75G 3AT1B 4M7DD 1OX8A 1I5LA 2KYMA 3G4ST 5GAMj 3L2UA 5I11A 3QJ6A 1I5OB 4QVCA 2JUFA 1V1CA 1BBZA 4LUDA 4E7JA 2DFUA 1VQ4T 2XDPA 1UDLA 2BUDA 3BY7A 4N4GA 2ECZA 2HL3A 1QVGS 1WHMA 4BY6B 2YT6A 2DILA 1PKSA 3H0FA 5FWCA 4KUIA 1MMNA 1QVGA 4QKUA 3EG9A 2JM8A 2JN0A 1AD5A 1LOJA 2VVKA 2FRWA 1UHCA 2RK1A 3EGXA 1PHTA 3OMCA 4A4KA 1VQMQ 1VQMT 5HY6A 4JRIA 2DTHA 2QK0A 3HRTA 4YTLA 5FLXE 2NUPA 1B34A 4JRPA 4C5IA 2DJQA 1YIJQ 3CCSQ 1PWTA 2NWMA 1D3BA 3FJ5A 1I8FA 2I2LA 2D1XA 3SHWA 2CZ7B 4QVDA 1BI0A 2EQIA 3OW2S 1W1FA 2CDTA 2QASA 4HA8A 3GOXA 1I0CA 3PE0A 4D8KA 3PTAA 3VUBA 3A8GB 3PIOA 2VYTA 3KFVA 1ZQ1A 4E7SA 4ZN3A 3V8JA 1PD0A 1WHJA 2FPFA 2E5KA 1QP3A 4KH1B 2WSFE 1W6XA 1HJDA 1TWBA 1YN8A 1NJIR 3CXCS 2E1HA 4PJNA 1MV0B 2QQSA 2QQRA 2IG0A 2RHUA 4LDUA 4M77E 2DM1A 4XTUA 4D6WA 4M75C 2HEQA 1KQSA 4RMOA 2FVUA 5GMKj 1RABB 3UA7A 1PG5B 3BE3A 2JTFA 2DD4A 4M78F 1ACMB 2K5LA 4A4FA 1E7OA 1G3SA 1LCKA 2MIOA 1V29B 3JCMf 3A98A 3FB9A 4DBFA 1QWEA 2YRCA 2E6NA 2ZCFB 3QXEB 4FU6A 4C92G 3OSSC 2EYWA 3RKWA 3X25B 5C6SA 2F69A 3OYFA 3FRNA 1KHIA 1DJ7B 1OYXA 2VUBA 2K5FA 3EHQA 2ED1A 2WACA 4RTZA 4R55A 3CCUQ 2RJCA 3CCUT 1UGVA 2E12A 2LTOA 1NEGA 1UGQB 3RESA 1ZBJA 2R5AA 1OOTA 3MPUB 3CCVT 4M7AA 4F17A 3X26B 3A1PA 4A4EA 1KHCA 5I22A 1N27A 3A5ZB 4EDUA 1MMDA 5HKCA 1RAGB 1X6OA 1VQKT 4MZPA 1H3ZA 3QDFA 5CIUA 2YUPA 4DEYA 2ED0A 3JCMJ 2RHXA 4M75F 1K9AA 1PRLC 4RUGA 1YIJA 3CCSA 1EFNA 1M9SA 4X1VA 2E3IA 5IT9E 1WJQA 3V7CA 4OMLA 2GBQA 2X3XD 1W2BA 1UB4A 2H3JA 3G71T 1VQ9Q 2AT1B 1NYGA 1Y96A 4ELYC 3TREA 1E6HA 1WX6A 1ZSZA 1BI3A 3TQ7P 3M54A 4ZGJB 4RG8A 4N0AC 4JJCA 1S72Q 4M78B 1IXDA 3CCVA 2KXDA 3OA6A 1UHFA 2OTJA 3H8ZA 3GNGA 5KYYB 4JJDA 1WZOA 3CC2A 4M75A 2YRDA 5GAOq 2W0ZA 3M57A 2K5IA 3UPUA 3M55A 3MP6A 4M75B 2CUBA 1GXIE 3SD4A 1KFZA 3QKJA 1K9MC 3FJPA 4WF2A 1M1GA 1RACB 4ESRA 2DXTA 1ZSZC 1LPLA 5GJWB 2DX1A 2JS2A 2B8AA 2GFUA 2DVEA 4QW2A 4C5HA 4E7LA 1K73R 2MF2A 1X69A 3QBYA 2KVQG 2PUKB 1NBEB 4M7AG 4HXJA 5A0LA 4M7AB 3EFSA 1JJ2P 2ZGWA 2XHCA 3VRYA 5HK3A 1RLPC 1RADB 3RR6A 4LD9K 4HCBA 1WLPB 2R58A 3WXMB 1CSKA 2Z0WA 3M9QA 2OTJT 5KCOA 1H641 4WTOB 2ROLA 3JCMP 4C0ZA 2QEXQ 2ZAEA 1I1JA 1WQWA 4IKFA 2KEAA 4A53A 1IREB 2LT1A 2L3RA 1LNXA 3CCEA 1RAEB 1IO6A 3CC4T 3S3NA 2DRKA 1IB8A 1ABQA 4IUQA 3PMIA 3VS2A 4C92F 3G4SA 3MEUA 1VQPQ 4PJOE 4QQGA 1U1SA 1R0CB 3OS5A 2EPDA 4A54A 1OULA 3CCQA 4C8QF 1VA7A 4ELZC 2EVRA 3CC4A 1FXXA 5D6YA 4M78E 2VKNA 1PSEA 2DA9A 3REBB 2XIDA 1NLOC 1IRXA 2FB7A 2JW4A 1Y0MA 2DERA 1HK9A 3EG9B 3CC7A 4ZNXA 3ZBDA 3UA6A 1YITQ 1K8AU 2CP2A 4M7DA 1QWFA 4C5EA 2QDYB 4XTWA 4C92A 3EG1A 4M77G 1BI2A 2OJ2A 2A08A 4OMMA 5GAN7 3NMZC 1NG2A 2X4XA 1VQ8Q 1KQSS 3OYCA 3O5ZA 4B9XA 5FRNA 2BZYA 4B9WA 4J6WA 1K73C 3OYYA 3META 2GTOA 1YBYA 3TSZA 1K8AR 5D7UA 2CH4W 4BY6C 2FO0A 2YUQA 2LJ1A 4V2SA 1M3BA 2JZ2A 3CCMT 3ZFJA 1VQOA 3JV3A 2E4HA 3EGXB 2JMCA 2JVVA 1JXOA 1VIEA 2ZPBB 2DK3A 4K11A 2D8JA 5CVIA 4M7DF 4OP0A 2DLPA 1IHVA 1Z9QA 4HCCA 1EX4A 4F14A 2H8HA 3OYBA 2AIRB 3H41A 4PJLA 1VQOT 1YJWQ 2QAZA 2CYZB 2FPEA 2RH2A 3EFRA 5IN1A 2DTIA 3I55A 2HSEB 3EGDB 3JCMc 1Q81C 3DLLA 2EYYA 4WCIA 1E6GA 1QW1A 1SSFA 1X75C 1D1AA 4FW1A 1YWOA 1UECA 1M3CA 2RJFA 1G3YA 2E65A 1WHLA 4L6V5 2E64A 3CCMA 1X27A 3C0CA 2ZPEB 3CCJA 3FLGA 4IUPA 4RCCA 3OY9A 5GANj 1R0BG 5GMKi 4BDZA 2RQTA 2IIMA 3PGGA 4DBQA 4F16A 3JB9J 2XG8D 1FYNA 5FROA 2L3QA 3JB9I 2L3PA 3GBQA 2AKLA 2X4WA 2CZ6B 3C95A 1AWOA 4JLIA 4KGZB 4JJBA 3HL8A 1Y7XA 1AHJB 1YITA 4M7DC 5GMKl 5CKFA 1KIKA 1TG0A 1GCQC 2P0PA 3QYGB 2A7YA 2XICA 3OBYA 3QG1A 4BUGA 2HQXA 4IUTA 1M90U 1MMAA 1WQ7A 5GANh 2KE9A 3JSCA 1VUBA 2YDLA 2JM9A 1N8RC 3R6OA 4OB3B 1EIFA 2KMTA 2RA2A 1OV3A 3RBBB 1Y07A 3CCST 1NJIC 2R57A 4FL6A 3L2VA 4RTUA 4IURA 4XTZA 4AFZC 4F7UE 2X9HA 3IQLA 4Z8AA 2DVJA 4KBMB 4XU3A 3FEOA 1UEBA 2XI9A 4J9CA 5GANe 1TUDA 4PJOF 3A8MB 2IVWA 1ARKA 3SWNC 1QMCA 5GAOn 2P0QA 3CD6T 2K2MA 4ORZA 4PJOG 1Y71A 4CC4B 5KE3A 1QCNA 1WGSA 4XK8E 3TSWA 3C12A 1O9SA 3JB9F 2VXFA 4CC2A 1WNLA 5GMKh 1PD1A 2V8KA 1UGRB 3EHRA 3I5SA 3RKXA 1QVFP 3EGDA 3M0TA 2DBMA 2GNCA 5J39A 3S6WA 4HCKA 1Z9ZA 3M5AA 2VB6A 1IGUA 2L2PA 2RD1A 2PTKA 4JZ4A 1JBMA 5AYFA 4M77D 1W4SA 3G6EA 2KYBA 3REAB 2KAFA 1VQKA 2A0FB 1VQ4A 4OGEA 2P4RA 4OGCA 4ZGEB 3M4YA 4CRIA 2EQKA 4C8QC 2ESWA 2WSEE 3OB9A 4N0AA 1YCSB 4M75D 1Q82R 4M7DG 1JB0E 5GAMg 2OAWA 3NGPA 4IIMA 2HSPA 2XDBA 3SWNA 2OTLT 1NM7A 2COWA 3H0IA 1VQ7Q 2J6OA 2RK2A 4XU2A 2RI2A 2VGMA 4M78D 2X4JA 5IH2A 2M9UA 4QVZA 1NPPA 2MAMA 2KBTA 1S72A 2CP3A 4J9DA 2EGAA 3MEVA 1ZX6A 3KBGA 4M7AC 3OYJA 3J7AF 3CPWA 4R0KA 2PVGB 1TS9A 1XJWB 1IZ6A 3VUZA 4C5GA 3ASKA 3UF4A 2O9SA 2E70A 5LJ3j 1VQNQ 3QPHA 2ZPHB 3BFMA 2CP5A 3VS1A 1TOVA 3ULRB 2FZGB 3X20B 1FMWA 3H0HA 3GF5A 2JMAA 3PVLA 4J8OA 2DEQA 1VQ9T 2O01E 1B07A 3M4GA 2L89A 4ZTJA 1AT1B 1D09B 4EMHA 2LVMA 2RQVA 5GAN2 4A63B 3CC7T 3EFOB 3QHSA 2HNIA 2O4XB 1QKXA 1UUEA 3CBMA 3JCMX 2ZPFB 3CCLT 3FIFA 3CEYA 5KYNA 1KK7A 1TXQA 2DETA 3CCRA 2DL8A 1WJSA 1YIJT 4MDWA 1AWXA 4BD3A 1M2OA 1W2BP 1QVFS 2EGCA 3PT9A 4HT9A 1ZSGA 2KGTA 2BE7D 1OI1A 2P84A 5CK9A 1YJNA 1WHHA 2K7AA 3VJPA 1X6BA 2PU9B 4J6YA 5KYXB 2O2OA 3QWXX 4RTYA 4FW2A 1K73U 1CKBA 3G6EQ 5KYUA 3CMAQ 2DNUA 3E19A 3JCMQ 1M1KC 3FDRA 4DOVA 5CO7A 5CQYA 5CAIA 4J9EA 4A4HA 1HSQA 3LGLA 3PIPA 3CC2T 2F2VA 3M53A 2F2WA 2MWOA 3G7ZA 3CCQQ 4OF1A 3CCUA 5KYWB 2CKKA 3EH1A 2DEUA 1VQ7A 1UGSB 2QEXT 3EG2A 2LCLA 2RMOA 4CI0C 2EQMA 2K79A 3S3OA 3M58A 4PFPA 4BACA 2DZCA 8ATCB 1KC8R 1G5VA 2QA4T 2QA4Q 9ATCB 4TVRA 3ER0A 4PNOA 2M0OA 2HD0A 1HD3A 3RMQA 1QQJA 3J80E 2NUTA 5IHNA 1B3QA 1ZUUA 1BCMA 5I21A 8AT1B 3MCAB 3H9NA 1Q81R 1OU8A 1N9RA 3M0PA 4QQ6A 4HVWA 3CPWS 3L2WA 2HL5C 3T9NA 4C0GA 4FSXA 3EAEA 3V8KA 1KC8C 5GANd 3I9QA 1X01A 4C92B 2EQUA 5D6WA 2FL7A 1ABOA 3QZ5B 3LWHA 2RJDA 2MOXA 4DA4A 4HKEA 4C0DB 1KJWA 3CPWP 2I0NA 2M0YA 3JCMe 4PJOD 3DKMA 1RI0A 3RDVA 5LJ5e 1PM3A 3NPFA 3QYHB 1WXBA 1NZ9A 4IUVA 4DEXA 5LJ3g 3WVEB 4Y91A 2RF0A 1M2VA 2QYZA 1XNIA 2FZCB 2YLBA 3GP8A 5EG2A 1EZZB 3RKYA 4J9HA 2QTVA 1BCOA 4Q5WA 3NFCA 2RHYA 2DXCA 1QP2A 4PJMA 5CQXA 3VS3A 5KE2A 2SRCA 2KR3A 2KRSA 5FU6B 4C8QE 3CMAA 2J05A 2CGHA 1WI7A 1YNZA 4RTWA 3NTKA 1YHQA 5GAMh 2LJ0A 4DOWA 2O88A 4ANJA 2X35A 4IUUA 3INZA 4DQ2A 5HCKA 4LD6A 1I07A 3CD6A 4ATOA 4M78G 1J3TA 2KXCA 2EWNA 1UTIA 2JT4A 4LDVA 3CCEQ 4BB7A 2K3BA 4J9BA 2K6DA 1KD1C 1PSFA 2GGRA 4KGVB 1JXMA 2LX7A 5I2MA 1RLQC 2F2XA 3VS6A 3CMEQ 3G4SQ 3E2UA 1N9SA 3OYHA 3I56A 2C06A 1RI9A 2CSIA 2KT8A 2VASA 1K1ZA 1M1KR 2RB6A 4J5YA 3L1AA 3CCQT 3HSBA 2L5QA 1SF9A 4JRKA 5GMKm 5GAN8 2LX9A 4PFZA 2X4YA 2CP7A 3JB9H 3E9GA 1BKBA 2MI6A 4EIKA 2QG9B 4OMPA 4E2FB 1BYMA 2GFAA 3VV0A 4IIOA 1VQ8T 3I56T 2YUNA 5GAMf 4PJOB 2R5MA 2O9VA 1M8MA 5LL6S 2P4TA 1YP5A 3L2QA 1TH7A 3N5BB 3JCMh 1JO8A 2YWWA 5J3BA 2ZZDA 4J9GA 2LQ8A 3WVDB 1Q7YR 4F7UB 1M3AA 1JU5C 4BE2A 5M9OA 1IHWA 1ZUKA 5KCHA 3HFNA 2DJZA 1C1AA 3GNFB 1RAIB 2KROA 1M5Q1 2RO0A 5DLQE 2A37A 2DBKA 2EBPA 2LJ3A 4P5NA 2DAQA 4FYVB 1YHQQ 1SPKA 2V1QA 3OYNA 1Q95G 2AZSA 3GPLA 1BIBA 1Q7YC 4C8QD 1XOVA 4J7IA 1VQNT 1WDXA 2A28A 3M56A 1T0HA 1NLPC 3D7SB 3QO3A 1GRIA 3VS5A 2FHDA 3CCLA 2HZYA 3OYAA 1VQ5Q 1ZA1B 4CC3A 2XU8A 2BTTA 3MEAA 2RI5A 1WHKA 2PZ1A 4LE9A 2BE9B 1M1FA 2ENMA 2YXYA 3BW1A 4RTVA 3LH5A 4LN2A 3LWIA 1JRIA 4OVAA 1G83A 1XQHA 2K3XA 4XTXA 5A0DA 2QGFB 4JJNK 3LX7A 1YI2A 2FPDA 3CCJQ 2NUZA 5LJ3d 5GAOm 2FEIA 4OB2B 3VS0A 4DBHA 4HCZA 3J81E 3THKA 2L0AA 2CUDA 3PFSA 5FW9A 1BU1A 5FWBA 4PK4A 4M4ZA 3G71A 1VQNA 1GFDA 1SHGA 4LXCA 1AVZC 3TU4K 2LQKA 2H3EB 1QVPA 2V1RA 4OB1B 4GBQA 2E10A 3V7SA 2EQJA 3PMTA 2VXEA 3OYIA 5EC7A 2CS7A 4OMOA 3QDRB 2RN8A 3HFOA 3SDZA 3HKSA 4O6JA 4C92E 2RQUA 4FT4A 2CZ0B 1M30A 4E7ZA 3M0UA 3S3MA 5FU7B 2DYBA 5LJ5f 2OTJQ 1KQSP 4AG1C 3LH0A 1UJYA 2C0OA 2J6KA 2SEMA 2M1HA 4EMKB 2GF7A 5GAN6 2NUPB 4ZN1A 2PVOB 4X9DA 2E6ZA 2HMAA 1WJRA 4EMKA 1WXUA 1WPYA 1F1BB 3SB2A 2ZPIB 2KT1A 3MP1A 1ZA2B 1WXTA 3AHUA 3A8HB 2KK4A 2OX7A 3OYEA 2KRNA 4FM4B 5LJ3e 2CT4A 3TVTA 1KC8U 1M27C 3VS4A 1S72T 3SEMA 4FYXB 4ZTFA 2DL3A 4MZMA 2QQ9A 4AFUC 1Q82U 4C8QB 2DZ9A 2LNVA 3CQTA 4DBRA 4HT8A 4X34A 5GAN5 4E7IA 2QEXA 4J9FA 1W70A 4M78A 2AHJB 1VQ9A 2M02A 4XAXB 3CBPA 1NYFA 2K3YA 2RPNA 3OYMA 2M51A 2CREA 1U3OA 4XU1A 1M2VB 5GAMe 2QA4A 2EYQA 4JLGA 4LNPA 3CMAT 1VYTA 3C4SA 2KDSA 1FX7A 1MHNA 1SG5A 2PQWA 1JEGA 4M7DE 5LJ3f 4HVUA 5IHKA 2GCXA 1OEBA 1N8RU 4XTYA 4B6MA 4J9IA 3UATA 3EG3A 4FCYA 2HQHA 5A0GA 3LGFA 4KUDK 3LYIA 3MEWA 2Y90A 2QQAA 1MMGA 4GLKA 1N6AA 4L59A 4Z89A 1YJNT 1AWJA 3MO8A 5AT1B 2KRMA 2EYZA 4M7AF 2Y4YA 4E7HA 1NPRA 5FU6C 2CZ1B 1VYUA 5GAOp 1D1CA 1M90R 2ATCB 4LDXA 1KG1A 2JS0A 2BZ8A 1FWZA 2COZA 4M78C 2EKHA 1LJOA 5IXFA 1BIAA 4PJJA 3RNJA 4M75E 2DE0X 1N5ZA 4RCBA 4EMKC 3JCMd 2VGNA 1SHFA 4II1A 4LUEA 3DB3A 2FZKB 2AZVA 2YHTA 4Y92A 1M8VA 4PL6A 1OQKA 1VQ7T 2KQWA 2K4YA 4NS5A 1K4US 3OW2P 5DLOA 3JCMV 3L2ZA 5GAMd 4PFOA 2XDDA 1VQOQ 2LNHB 1ZSZB 4PJOC 4J7FA 4F7UG 1U06A 2C0TA 4GLMA 3JCMg 4OB0B 2XK0A 1WHGA 2EJFA 2OI3A 3ZEHA 2DIGA 2JTMA 5CR2A 1I81A 3M59A 4C0FA 3P8HA 3OS1A 1UE9A 1ZLMA 1P92A 2MYSA 2QXFA 5LJ5d 1X2QA 3RUXA 1Y57A 3HTRA 4AFSC 3UDCA 4MMLA 1VQPA 1D0ZA 4Y28E 3GLXA 3P8BB 2G3RA 3QIIA 4AMCA 1QLYA 3A8OB 2EIFA 4OMQA 3LLRA 2RQWA 1U1TA 3MP8A 5CKHA 5ECAA 4F7UF 5I2SA 4MDXA 2GQIA 1QCOA 1WYXA 1AEYA 3HRSA 2LDMA 4LDYA 2RQRA 4EPCA 4GY5A 2DL4A 3CPFA 5IAYA 2LQNA 4E7KA 4KT0E 4OMFB 3MJXA 3F70A 3CC7Q 3SFMA 1WIEA 3I55T 2DPPB 4JDSA 3CMEA 2JJ9A 5J26A 4ZGDB 2JTEA 3TCJA 2DYIA 1VYVA 2LT4A 2GTJA 4PJOA 5LJ3h 1S1NA 1AZEA 5KH6A 1AZGB 1YJWT 2X51A 3HRUA 1X6GA 3QZ9B 1PKTA 3I5RA 5GJVB 4NOYA 4KULA 3JCMW 3NTHA 3HP9A 3A8LB 4XQ3A 1VQLA 3OYGA 3URGA 1K0XA 2DKGA 2AKKA 1QKWA 3OSVA 2F5KA 2CSQA 1SEMA 2XD0A 2IPOB 4E6RA 1MGQA 2L3SA 2CT3A 1W2BS 1D0YA 1H92A 1LVKA 3V7RA 1SKUB 2MPXC 2A3LA 1OU9A 1VQ5T 4D8DA 5IHIA 1M4ZA 2VC8A 1YITT 1RAFB 1OPLA 2JXBA 4CC7A 1RUWA 4VUBA 3Q1JA 4LDWA 1K9MU 3NTIA 3I55Q 2QTXA 1XTDA 1KD1R 5DY9A 3CCJT 4N4IA 1H8KA 1X2KA 3QJYA 1R8OB 3DLMA 1QVGP 1PCXA 2ZPGB 1VOMA 4E47A 4JRQA 1M1KU 2HCKA 2WSCE 1U8RA 5CCAA 3CCMQ
chains in the Genus database with same CATH topology
2RK1A 3N5BB 2XICA 5FU7C 3JCMh 3OMCA 3OBYA 4A4KA 4NL3A 3QG1A 4BUGA 5J3BA 1G3WA 2HQXA 2ZZDA 1VQMT 3O8VA 2LQ8A 1B34B 5HY6A 3WVDB 3E1SA 4IUTA 4F7UB 4JRIA 1M90U 2DTHA 3HRTA 1WQ7A 4BE2A 5M9OA 5GANh 3JSCA 5DM7R 2BIVA 4YTLA 5FLXE 1VUBA 3HFNA 5KCHA 1B34A 4QQDA 2DJZA 4JS4A 1VQ5A 4JRPA 3R6OA 4OB3B 1N8RC 2YRVA 4C5IA 1EIFA 2KMTA 2RJEA 2RA2A 3OQ5A 3GNFB 3MHXA 1Y07A 1D3BA 2P0KA 3CCST 1I8FA 1M5Q1 2I2LA 2R57A 2RO0A 2CZ7B 4FL6A 1NJIC 3JAME 5DLQE 4QVDA 3L2VA 3RIRA 4RKUE 1BI0A 4IURA 4XTZA 4P5NA 3OW2S 2DAQA 3X24B 4F7UE 1KQ2A 1YHQT 4HA8A 3GOXA 4KBMB 3PTAA 3OYNA 4XU3A 3VUBA 4M7AE 3A8GB 3FEOA 1YI2T 1KQ1A 1BIBA 1UEBA 3GPLA 2XI9A 3PIOA 1Q7YC 2VYTA 4C8QD 1XOVA 5GANe 1ZQ1A 2K2VA 4J7IA 4ZN3A 1VQNT 3V8JA 2EJGA 4PJOF 3A8MB 1Q86U 1QP3A 2WSFE 1VQMA 2IVWA 3M56A 3SWNC 5GAOn 2P0QA 2QQBA 4MZTA 3CD6T 4PJOG 3QO3A 1Y71A 3CXCS 5KE3A 2E1HA 2FHDA 3CCLA 1WGSA 2QQRA 2QQSA 2RHUA 2IG0A 4LDUA 4M77E 4XK8E 3X28B 3C12A 1O9SA 3OYAA 3JB9F 4XTUA 2VXFA 4D6WA 4M75C 1WNLA 2XU8A 5GMKh 3JB9D 2V8KA 2LCCA 3MEAA 1KQSA 2RI5A 1UGRB 2DIQA 4RMOA 2FVUA 5GMKj 1Q82C 3RKXA 1M1FA 3BW1A 4XTVA 3V8LA 2JTFA 2DD4A 5J39A 3LWIA 1JRIA 4M78F 4OVAA 3S6WA 1XQHA 2K3XA 2K5LA 2F5TX 4XTXA 4A4FA 5A0DA 3M5AA 3LX7A 4JJNK 1YI2A 4J6XA 2RD1A 1G3SA 3QUIA 1V29B 5LJ3d 3JCMf 1JBMA 3FB9A 4FIBA 5GAOm 5AYFA 4M77D 1W4SA 4OB2B 2E6NA 4PLLA 3G6EA 4JS5A 1Q7YU 5LJ5g 2D0QB 2ZCFB 4HCZA 2KAFA 3QXEB 4FU6A 3J81E 2DXUA 3ME9A 1VQ4A 4OGEA 4C92G 3PFSA 2EKOA 4OGCA 4ZGEB 3M4YA 4CRIA 3OSSC 3RKWA 2EQKA 3X25B 4C8QC 5C6SA 2WSEE 3OB9A 2F69A 3G71A 1VQNA 3OYFA 3FRNA 1I4K1 4N0AA 1KHIA 4M75D 3VU3C 4M7DG 1DJ7B 1OYXA 2VUBA 3PNWC 2K5FA 1JB0E 5GAMg 3TU4K 2WACA 2LQKA 4R55A 2RJCA 2XDBA 1QVPA 3CCUT 2E12A 3SWNA 2LTOA 4OB1B 2OTLT 2L8DA 1UGQB 2E10A 3RESA 2QI2A 3V7SA 2RHIA 2EQJA 3PMTA 2VXEA 3OYIA 2RK2A 1OZ3A 2R5AA 4XU2A 2CS7A 2RI2A 3CCVT 3DB4A 3QDRB 3HFOA 4M7AA 2VGMA 4M78D 2X4JA 3X26B 4A4EA 3SDZA 3HKSA 4O6JA 4C92E 1KHCA 2M9UA 4QVZA 1N27A 1NPPA 2CZ0B 2LRQA 3A5ZB 4FT4A 4BI3A 2MAMA 4EDUA 3CCRT 1S72A 2YLCA 5HKCA 3S3MA 5FU7B 2HAXA 1X6OA 2EFIA 3MEVA 3OBWA 4MZPA 5LJ5f 1VQKT 1H3ZA 3KBGA 4M7AC 3OYJA 5CIUA 3J7AF 1NJIU 1JJ2S 3LH0A 5CKEA 3CPWA 2PVGB 3JCMJ 1IZ6A 2RHXA 2M1HA 3VUZA 4C5GA 4EMKB 3ASKA 4M75F 5LJ3j 2E70A 2GF7A 5GAN6 3QPHA 4ZN1A 1YIJA 3G6ET 1K8AC 2PVOB 4X9DA 2EAYA 2ZPHB 3CCSA 2JOYA 1M9SA 2E6ZA 3BFMA 3VYHB 4ME7A 2D6FA 1WJRA 4EMKA 5D6XA 1D3BB 3X20B 3OS2A 1WPYA 5IT9E 1WJQA 3V7CA 2DTOA 3SB2A 3GF5A 1W2BA 1UB4A 3JRZA 3KXTA 2H3JA 4J8OA 5GANf 2ZPIB 3G71T 3MP1A 2DEQA 1VQ9T 2O01E 1Y96A 4EMGA 4ELYC 3RERA 3TREA 3AHUA 3A8HB 2KK4A 3OYEA 3M4GA 1BI1A 1BI3A 2L89A 4FM4B 5LJ3e 4ZTJA 3M54A 1VQ6T 2HBPA 4ZGJB 2PUOB 2LVMA 4EMHA 5GAN2 2O4XA 2RM4A 4RG8A 4N0AC 2KY9A 1KC8U 2OTLA 1KD1U 2D9TA 1S72T 4FT2A 4M78B 3CC7T 4ZTFA 4M7AD 3OYDA 2BKDN 3QHSA 2HNIA 2O4XB 3JCMX 3QSUA 3CBMA 3CCVA 2ZPFB 4MZMA 4C92D 3OA6A 2OTJA 4M77C 3SWNB 3H8ZA 3CCLT 3FIFA 3GNGA 3CEYA 2QQ9A 3FC3A 4M75A 3CCRA 5GAOq 3CC2A 2DO3A 1VIFA 1WJSA 3M57A 2K5IA 1YIJT 1Q82U 4MDWA 4C8QB 3UPUA 3M55A 2DZ9A 2LNVA 3KUFA 3MP6A 4M75B 4BD3A 1QVFS 4HT8A 3PT9A 4HT9A 1GXIE 4Z02A 4X34A 5GAN5 3C94A 1OI1A 4E7IA 3SD4A 2HQEA 3QKJA 1K9MC 5CK9A 4M77F 4M78A 2QEXA 3FJPA 4WF2A 1YJNA 2AHJB 1M1GA 1VQ9A 2KSSA 4XAXB 3VJPA 1Q86C 2PU9B 1ZHIA 4J6YA 2DXTA 2RI3A 2E41A 2B8AA 3CBPA 2GFUA 1OZ2A 2K3YA 2DVEA 3OYMA 4PKCC 4C0DC 4QW2A 4C5HA 4E7LA 2RHZA 4XU1A 2QA4A 5GAMe 1K73U 2EYQA 2MF2A 3L42A 3QBYA 5GAOr 4JLGA 3E19A 3CMAT 1Q81U 3JCMQ 1M1KC 2KVQG 2PUKB 3C4SA 2KDSA 1FX7A 1MHNA 1YCYA 2DXBA 1UGPB 3FDRA 5CO7A 2PQWA 4DOVA 1M90C 4M7AG 1VQ6A 2VV5A 3HPWA 5CQYA 5L8RE 5LJ3f 5A0LA 5CAIA 4M7AB 4M7DE 3EFSA 4A4HA 3CMET 3LGLA 3PIPA 2GCXA 2ZGWA 3CC2T 2XHCA 4UC4A 5HK3A 1N8RU 5C0MA 3M53A 4XTYA 5CKBA 4LD9K 2MWOA 4HCBA 1QVFA 4NL2A 2R58A 3CBOA 3WXMB 3VYGA 3G7ZA 2GQVA 5A0GA 3BDLA 3LGFA 4J83A 3M9QA 4OF1A 4BE1A 3CCUA 4KUDK 3GIBA 3LYIA 2OTJT 3MEWA 2Y90A 2QQAA 5KCOA 4GLKA 1N6AA 1YJWA 1H641 2CKKA 5GMKe 4L59A 2Y4XA 1VQ7A 2NLUA 1UGSB 4M77A 2QEXT 1YJNT 2LCLA 2K57A 5GAN4 4C0ZA 3JCMP 3CXCA 3MO8A 4M7AF 4BI4A 4CI0C 2EQMA 2Y4YA 5LJ5j 4E7HA 1NPRA 1WQWA 3S3OA 4IKFA 3JB9G 5FU6C 3UT1A 2CZ1B 3M58A 1IREB 4A53A 4BACA 2DZCA 2LT1A 2L3RA 5GAOp 1LNXA 3CCEA 1G5VA 2QA4T 4C8QA 4LDXA 3JCMb 4TVRA 3ER0A 2PVDB 4PNOA 3CC4T 1KG1A 3S3NA 2M0OA 2HD0A 3TEEA 5HK0A 1FWZA 3RMQA 4M78C 4IUQA 3PMIA 3J80E 4A4GA 3E9FA 1LJOA 2V8JA 3VKIA 4C92F 1HXDA 1BIAA 3G4SA 4M77B 3MEUA 4M75E 5A2QE 5I21A 1YJ9T 3MCAB 4RCBA 4EMKC 1VQPT 4PJOE 4QQGA 1N9RA 1U1SA 2M16A 3OS5A 4QQ6A 4BDYA 3JCMd 2VGNA 4A54A 1JJ2A 3CPWS 3CCQA 4II1A 3L2WA 2V8IA 3DB3A 4C8QF 3T9NA 2YHTA 4FSXA 4C0GA 3EAEA 4PL6A 4ELZC 3V8KA 5GAOl 3CC4A 1M8VA 1VQ7T 2KQWA 1FXXA 2K4YA 4M78E 5D6YA 5GANd 1X01A 4NS5A 1PSEA 1KC8C 4C92B 2EQUA 5D6WA 2FL7A 2XIDA 3OS0A 4BI8B 3QZ5B 3LWHA 5DLOA 3JCMV 3L2ZA 5GAMd 2RJDA 2FB7A 5GAN3 2XDDA 4PJOC 4J7FA 1YJ9A 1HK9A 4F7UG 4DA4A 4HKEA 3JCMg 4C0DB 3CC7A 3ZBDA 1O75A 4OB0B 3OYKA 2XK0A 3JCMe 2EJFA 3DKMA 3ZEHA 4PJOD 1RI0A 2DIGA 2JTMA 5CR2A 1K8AU 1I81A 4O5VA 5LJ5e 3M59A 4C0FA 3P8HA 1ZBXA 2E5QA 3OS1A 4X9CA 4M7DA 3QYHB 4C5EA 3UWNA 1P92A 2QDYB 4XTWA 2QXFA 4C92A 4M77G 1BI2A 5LJ5d 3RUXA 1NZ9A 4IUVA 5LJ3g 3WVEB 4BE0A 2MMPA 4Y91A 3UDCA 4MMLA 5CKDA 1VQPA 4Y28E 5GAN7 3GLXA 3P8BB 2G3RA 1XNIA 3QIIA 4XU0A 2X4XA 3A8OB 2EJ9A 2YLBA 4RG2A 5EG2A 3GP8A 2EIFA 1KQSS 3RKYA 3LLRA 3OYCA 2DD5A 1U1TA 3MP8A 4B9XA 5FRNA 5CKHA 4B9WA 1RL2A 4Q5WA 3NFCA 4J6WA 4F7UF 5I2SA 1K73C 4MDXA 3OW2A 3OYYA 3META 4L5GA 4PLIA 1VQLT 1YBYA 2RHYA 2DXCA 1QP2A 4BY6C 3HRSA 5FRMA 2LDMA 4LDYA 4EPCA 4GY5A 5CQXA 4V2SA 2JNGA 5KE2A 2JZ2A 3CPFA 5IAYA 4MMKA 3CCMT 3ZFJA 4E7KA 1VQOA 5FU6B 4KT0E 4OMFB 4JUVA 4M7DB 2MWPA 4C8QE 3CMAA 2OAUA 5GANg 2CGHA 3F70A 3SFMA 2JVVA 3LW5E 3NTKA 2FYKA 1VIEA 1YHQA 3I55T 3OYLA 3L2RA 2DPPB 4JDSA 5GAMh 2ZPBB 2DK3A 5CVIA 4DOWA 4N4HA 4M7DF 4OP0A 3CMEA 5J26A 4ZGDB 4HCCA 3OMGA 3TCJA 4C8QG 2LT4A 2X35A 4IUUA 3P8DA 3OYBA 4PJOA 3INZA 5LJ3h 4DQ2A 1G3TA 5KH6A 1YJWT 1VQOT 1NE8A 3H6ZA 3HHTB 1VQ8A 2CYZB 3BDUA 3HRUA 4LD6A 3QZ9B 5LJ5h 3CD6A 1Y96B 4ATOA 2RH2A 3EFRA 4NOYA 4KULA 5IN1A 4R56A 3JCMW 2DTIA 3NTHA 4M78G 3I55A 3HP9A 3A8LB 4XQ3A 1VQLA 3OYGA 3URGA 2EWNA 3JCMc 1Q81C 2LC4A 3RMSA 4C92C 2DKGA 3CCET 3DLLA 3OSVA 2XKOC 4LDVA 2F5KA 4BB7A 1QW1A 1SSFA 1KD1C 4F7UA 1PSFA 1X75C 2XD0A 1MGQA 4M75G 1W2BS 4M7DD 2RJFA 5I2MA 1G3YA 2E65A 4L6V5 1I5LA 3V7RA 2E64A 3G4ST 5GAMj 2A3LA 3CCMA 3L2UA 2ZPEB 3CCJA 3FLGA 1N9SA 3OYHA 1VQ5T 3QJ6A 3I56A 2C06A 4IUPA 4RCCA 1M4ZA 4QVCA 3OY9A 5GANj 2JUFA 2RB6A 4J5YA 5GMKi 3L1AA 2VC8A 3CCQT 4BDZA 4E7JA 1YITT 3HSBA 2L5QA 3PGGA 4JRKA 5GMKm 5GAN8 2LX9A 1VQ4T 3JB9J 2X4YA 2XG8D 3JB9H 3E9GA 1BKBA 4VUBA 2XDPA 2MI6A 5FROA 2BUDA 3BY7A 3Q1JA 4LDWA 3JB9I 1K9MU 4N4GA 3NTIA 1BYMA 2QTXA 2GFAA 3VV0A 1QVGS 1XTDA 2X4WA 5DY9A 2CZ6B 3CCJT 4N4IA 4BY6B 1VQ8T 3I56T 3C95A 3QJYA 1R8OB 3DLMA 5GAMf 4JLIA 4PJOB 4KUIA 2R5MA 3HL8A 1Y7XA 1AHJB 2ZPGB 1YITA 4E47A 1QVGA 4JRQA 4M7DC 1M1KU 1VQKA 5GMKl 5CKFA 5LL6S 2WSCE 2P4TA 3L2QA 1U8RA 1TH7A 5CCAA 2P0PA 3QYGB 2A7YA 2JN0A 1LOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DOV A;  3PT9 A;  1ZBX A;  1W4S A;  3PTA A;  4FSX A;  4FT2 A;  4LD9 K;  2FVU A;  1ZHI A;  4KUL A;  2FL7 A;  4KUI A;  4KUD K;  1M4Z A;  4FT4 A;  4DOW A;  4DA4 A;  4BB7 A;  4JJN K;  3TU4 K; 
#chains in the Genus database with same CATH topology
 5FU7 C;  4AFQ C;  4NL3 A;  2J7I A;  1G3W A;  3O8V A;  1B34 B;  4KH0 B;  3E1S A;  5DM7 R;  2BIV A;  4RTT A;  4QQD A;  4JS4 A;  1UFF A;  1VQ5 A;  2YRV A;  2RJE A;  1TUC A;  3OQ5 A;  1Q86 R;  2CH4 A;  3MHX A;  1UG1 A;  2P0K A;  2ROT A;  3JAM E;  3RIR A;  2FRY A;  4RKU E;  3X24 B;  1KQ2 A;  1YHQ T;  4AG2 C;  2DRM A;  1BB9 A;  5KYX A;  4M7A E;  2AK5 A;  1YI2 Q;  2G6F X;  1YI2 T;  1KQ1 A;  2K2V A;  2EJG A;  2OTL Q;  1Q86 U;  2CP0 A;  1VQM A;  2QQB A;  4MZT A;  1V76 A;  3CCV Q;  3CD6 Q;  1OPK A;  1FMV A;  3QWY A;  3X28 B;  4JZ3 A;  1X43 A;  3JB9 D;  2LCC A;  2HBW A;  1N8R R;  2DIQ A;  7AT1 B;  2V26 A;  1Q82 C;  1YWP A;  2LZ6 B;  1SRM A;  3R6N A;  4XTV A;  3V8L A;  5KYU B;  2F5T X;  1MUZ A;  1WA7 A;  4J6X A;  1K0S A;  3PVQ A;  3QUI A;  3I56 Q;  4FIB A;  2COY A;  1Q7Y U;  4PLL A;  4JS5 A;  5LJ5 g;  2D0Q B;  2DXU A;  3ME9 A;  2EKO A;  2LMJ A;  1VQ6 Q;  2EGE A;  1I4K 1;  3VU3 C;  3PNW C;  5KYW A;  1GBR A;  4OMN A;  2L8D A;  1MND A;  2QI2 A;  1K76 A;  2RHI A;  2D0N A;  1OZ3 A;  1QCF A;  3DB4 A;  1IGQ A;  4BI3 A;  2LRQ A;  3CCR T;  2YLC A;  2HAX A;  2YSQ A;  2EFI A;  3OBW A;  2NYS A;  1VQK Q;  1VQ4 Q;  4RTX A;  1NJI U;  1JJ2 S;  5CKE A;  4JPB W;  2F1L A;  1AOJ A;  2KNB B;  2QDL A;  3G6E T;  1K8A C;  2EAY A;  2JOY A;  3VYH B;  4ME7 A;  2D6F A;  1A0N B;  5D6X A;  1D3B B;  3OS2 A;  2DTO A;  4HVV A;  2E3H A;  3KXT A;  3JRZ A;  1NEB A;  2KI7 A;  5GAN f;  2HKQ B;  3RER A;  4EMG A;  1BI1 A;  1VQ6 T;  2HBP A;  2PUO B;  3MKD A;  1MV3 A;  2O4X A;  2RM4 A;  2KY9 A;  1YJ9 Q;  2OTL A;  1KD1 U;  2D9T A;  2X3W D;  3CXC P;  4FT2 A;  4M7A D;  3OYD A;  2BKD N;  3QSU A;  4C92 D;  4M77 C;  3SWN B;  1CKA A;  4Z88 A;  3CCL Q;  2LCS A;  3FC3 A;  2DO3 A;  1VIF A;  1GL5 A;  2QGG A;  3KUF A;  3U23 A;  3EGU A;  1D0X A;  1MNE A;  4Z02 A;  3C94 A;  2HQE A;  3VRZ A;  4FSS A;  4M77 F;  1T0J A;  1T3L A;  2KSS A;  2LQW A;  1Q86 C;  1ZHI A;  2RI3 A;  2E41 A;  1TTH B;  1OZ2 A;  2C0I A;  2DMO A;  4PKC C;  4C0D C;  2RHZ A;  2W10 A;  3L42 A;  5GAO r;  2XMF A;  1Q81 U;  3M0R A;  2VWF A;  2DXB A;  3EH2 A;  1YCY A;  1AWW A;  1UGP B;  1M90 C;  1VQ6 A;  2VV5 A;  3HPW A;  5L8R E;  4FYW B;  3M0S A;  1TSF A;  1BK2 A;  3CME T;  3EG0 A;  2BZX A;  3G71 Q;  1PNJ A;  1OX9 A;  4UC4 A;  3CC2 Q;  3CCR Q;  5C0M A;  1GFC A;  5CKB A;  2NUT B;  1QVF A;  4NL2 A;  3G1J A;  3CBO A;  3VYG A;  2GQV A;  3BDL A;  4J83 A;  4BE1 A;  3GIB A;  2ABL A;  1YJW A;  4F04 B;  5GMK e;  3ZL7 C;  2Y4X A;  2NLU A;  4M77 A;  2K57 A;  4KGX B;  5GAN 4;  1YJN Q;  3CXC A;  4BI4 A;  5LJ5 j;  3JB9 G;  1K9M R;  3UT1 A;  2PNI A;  2YUO A;  2J6F A;  4C8Q A;  3JCM b;  2PVD B;  1SRL A;  1RAH B;  3TEE A;  5HK0 A;  2DL5 A;  4A4G A;  3E9F A;  2V8J A;  2RNA A;  3VKI A;  1SSH A;  1HXD A;  4M77 B;  1GBQ A;  3NHN A;  5A2Q E;  1YJ9 T;  1VQP T;  3M0Q A;  1C6V X;  2M16 A;  4BDY A;  2CP6 A;  1JJ2 A;  2K9G A;  2V8I A;  5GAO l;  1YFN A;  2J06 A;  2FG0 A;  3OS0 A;  4BI8 B;  2DL7 A;  1HYO A;  5GAN 3;  1PC0 A;  2HDA A;  1YJ9 A;  2B86 A;  1O75 A;  3OYK A;  4FYY B;  4O5V A;  1ZBX A;  2E5Q A;  4X9C A;  1TUG B;  3UWN A;  5KYY A;  1G2B A;  2O31 A;  2MMP A;  5CKD A;  4BE0 A;  1TU0 B;  4AT1 B;  3I35 A;  1GCQ A;  1ZUY A;  4XU0 A;  2EJ9 A;  2MK5 A;  4RG2 A;  3VS7 A;  2A36 A;  2DD5 A;  1RL2 A;  3CC4 Q;  3OW2 A;  1VQL Q;  4L5G A;  4PLI A;  1VQL T;  2EYX A;  1G8X A;  5FRM A;  1JQQ A;  1R77 A;  2JNG A;  4MMK A;  4M7D B;  4JUV A;  2MWP A;  4KRT A;  2OAU A;  5GAN g;  3LW5 E;  1UJ0 A;  2FYK A;  3L2R A;  3OYL A;  5IXB A;  2HKN A;  4N4H A;  1H3H A;  1GCP A;  3EFO A;  3OMG A;  1WFW A;  4C8Q G;  1T3S A;  3P8D A;  1PRM C;  1FMK A;  1G3T A;  4QT7 A;  1D1B A;  1RAA B;  1NE8 A;  2D8H A;  3H6Z A;  3HHT B;  2LP5 A;  1VQ8 A;  3BDU A;  5LJ5 h;  2DF6 A;  2EW3 A;  1Y96 B;  4R56 A;  2MCN A;  1U5S A;  1C0M A;  1B7T A;  2LC4 A;  3RMS A;  4C92 C;  3CCE T;  1KSW A;  2XKO C;  5L23 A;  4F7U A;  6AT1 B;  4M75 G;  3AT1 B;  4M7D D;  1OX8 A;  1I5L A;  2KYM A;  3G4S T;  5GAM j;  3L2U A;  5I11 A;  3QJ6 A;  1I5O B;  4QVC A;  2JUF A;  1V1C A;  1BBZ A;  4LUD A;  4E7J A;  2DFU A;  1VQ4 T;  2XDP A;  1UDL A;  2BUD A;  3BY7 A;  4N4G A;  2ECZ A;  2HL3 A;  1QVG S;  1WHM A;  4BY6 B;  2YT6 A;  2DIL A;  1PKS A;  3H0F A;  5FWC A;  4KUI A;  1MMN A;  1QVG A;  4QKU A;  3EG9 A;  2JM8 A;  2JN0 A;  1AD5 A;  1LOJ A;  2VVK A;  2FRW A;  1UHC A;  2RK1 A;  3EGX A;  1PHT A;  3OMC A;  4A4K A;  1VQM Q;  1VQM T;  5HY6 A;  4JRI A;  2DTH A;  2QK0 A;  3HRT A;  4YTL A;  5FLX E;  2NUP A;  1B34 A;  4JRP A;  4C5I A;  2DJQ A;  1YIJ Q;  3CCS Q;  1PWT A;  2NWM A;  1D3B A;  3FJ5 A;  1I8F A;  2I2L A;  2D1X A;  3SHW A;  2CZ7 B;  4QVD A;  1BI0 A;  2EQI A;  3OW2 S;  1W1F A;  2CDT A;  2QAS A;  4HA8 A;  3GOX A;  1I0C A;  3PE0 A;  4D8K A;  3PTA A;  3VUB A;  3A8G B;  3PIO A;  2VYT A;  3KFV A;  1ZQ1 A;  4E7S A;  4ZN3 A;  3V8J A;  1PD0 A;  1WHJ A;  2FPF A;  2E5K A;  1QP3 A;  4KH1 B;  2WSF E;  1W6X A;  1HJD A;  1TWB A;  1YN8 A;  1NJI R;  3CXC S;  2E1H A;  4PJN A;  1MV0 B;  2QQS A;  2QQR A;  2IG0 A;  2RHU A;  4LDU A;  4M77 E;  2DM1 A;  4XTU A;  4D6W A;  4M75 C;  2HEQ A;  1KQS A;  4RMO A;  2FVU A;  5GMK j;  1RAB B;  3UA7 A;  1PG5 B;  3BE3 A;  2JTF A;  2DD4 A;  4M78 F;  1ACM B;  2K5L A;  4A4F A;  1E7O A;  1G3S A;  1LCK A;  2MIO A;  1V29 B;  3JCM f;  3A98 A;  3FB9 A;  4DBF A;  1QWE A;  2YRC A;  2E6N A;  2ZCF B;  3QXE B;  4FU6 A;  4C92 G;  3OSS C;  2EYW A;  3RKW A;  3X25 B;  5C6S A;  2F69 A;  3OYF A;  3FRN A;  1KHI A;  1DJ7 B;  1OYX A;  2VUB A;  2K5F A;  3EHQ A;  2ED1 A;  2WAC A;  4RTZ A;  4R55 A;  3CCU Q;  2RJC A;  3CCU T;  1UGV A;  2E12 A;  2LTO A;  1NEG A;  1UGQ B;  3RES A;  1ZBJ A;  2R5A A;  1OOT A;  3MPU B;  3CCV T;  4M7A A;  4F17 A;  3X26 B;  3A1P A;  4A4E A;  1KHC A;  5I22 A;  1N27 A;  3A5Z B;  4EDU A;  1MMD A;  5HKC A;  1RAG B;  1X6O A;  1VQK T;  4MZP A;  1H3Z A;  3QDF A;  5CIU A;  2YUP A;  4DEY A;  2ED0 A;  3JCM J;  2RHX A;  4M75 F;  1K9A A;  1PRL C;  4RUG A;  1YIJ A;  3CCS A;  1EFN A;  1M9S A;  4X1V A;  2E3I A;  5IT9 E;  1WJQ A;  3V7C A;  4OML A;  2GBQ A;  2X3X D;  1W2B A;  1UB4 A;  2H3J A;  3G71 T;  1VQ9 Q;  2AT1 B;  1NYG A;  1Y96 A;  4ELY C;  3TRE A;  1E6H A;  1WX6 A;  1ZSZ A;  1BI3 A;  3TQ7 P;  3M54 A;  4ZGJ B;  4RG8 A;  4N0A C;  4JJC A;  1S72 Q;  4M78 B;  1IXD A;  3CCV A;  2KXD A;  3OA6 A;  1UHF A;  2OTJ A;  3H8Z A;  3GNG A;  5KYY B;  4JJD A;  1WZO A;  3CC2 A;  4M75 A;  2YRD A;  5GAO q;  2W0Z A;  3M57 A;  2K5I A;  3UPU A;  3M55 A;  3MP6 A;  4M75 B;  2CUB A;  1GXI E;  3SD4 A;  1KFZ A;  3QKJ A;  1K9M C;  3FJP A;  4WF2 A;  1M1G A;  1RAC B;  4ESR A;  2DXT A;  1ZSZ C;  1LPL A;  5GJW B;  2DX1 A;  2JS2 A;  2B8A A;  2GFU A;  2DVE A;  4QW2 A;  4C5H A;  4E7L A;  1K73 R;  2MF2 A;  1X69 A;  3QBY A;  2KVQ G;  2PUK B;  1NBE B;  4M7A G;  4HXJ A;  5A0L A;  4M7A B;  3EFS A;  1JJ2 P;  2ZGW A;  2XHC A;  3VRY A;  5HK3 A;  1RLP C;  1RAD B;  3RR6 A;  4LD9 K;  4HCB A;  1WLP B;  2R58 A;  3WXM B;  1CSK A;  2Z0W A;  3M9Q A;  2OTJ T;  5KCO A;  1H64 1;  4WTO B;  2ROL A;  3JCM P;  4C0Z A;  2QEX Q;  2ZAE A;  1I1J A;  1WQW A;  4IKF A;  2KEA A;  4A53 A;  1IRE B;  2LT1 A;  2L3R A;  1LNX A;  3CCE A;  1RAE B;  1IO6 A;  3CC4 T;  3S3N A;  2DRK A;  1IB8 A;  1ABQ A;  4IUQ A;  3PMI A;  3VS2 A;  4C92 F;  3G4S A;  3MEU A;  1VQP Q;  4PJO E;  4QQG A;  1U1S A;  1R0C B;  3OS5 A;  2EPD A;  4A54 A;  1OUL A;  3CCQ A;  4C8Q F;  1VA7 A;  4ELZ C;  2EVR A;  3CC4 A;  1FXX A;  5D6Y A;  4M78 E;  2VKN A;  1PSE A;  2DA9 A;  3REB B;  2XID A;  1NLO C;  1IRX A;  2FB7 A;  2JW4 A;  1Y0M A;  2DER A;  1HK9 A;  3EG9 B;  3CC7 A;  4ZNX A;  3ZBD A;  3UA6 A;  1YIT Q;  1K8A U;  2CP2 A;  4M7D A;  1QWF A;  4C5E A;  2QDY B;  4XTW A;  4C92 A;  3EG1 A;  4M77 G;  1BI2 A;  2OJ2 A;  2A08 A;  4OMM A;  5GAN 7;  3NMZ C;  1NG2 A;  2X4X A;  1VQ8 Q;  1KQS S;  3OYC A;  3O5Z A;  4B9X A;  5FRN A;  2BZY A;  4B9W A;  4J6W A;  1K73 C;  3OYY A;  3MET A;  2GTO A;  1YBY A;  3TSZ A;  1K8A R;  5D7U A;  2CH4 W;  4BY6 C;  2FO0 A;  2YUQ A;  2LJ1 A;  4V2S A;  1M3B A;  2JZ2 A;  3CCM T;  3ZFJ A;  1VQO A;  3JV3 A;  2E4H A;  3EGX B;  2JMC A;  2JVV A;  1JXO A;  1VIE A;  2ZPB B;  2DK3 A;  4K11 A;  2D8J A;  5CVI A;  4M7D F;  4OP0 A;  2DLP A;  1IHV A;  1Z9Q A;  4HCC A;  1EX4 A;  4F14 A;  2H8H A;  3OYB A;  2AIR B;  3H41 A;  4PJL A;  1VQO T;  1YJW Q;  2QAZ A;  2CYZ B;  2FPE A;  2RH2 A;  3EFR A;  5IN1 A;  2DTI A;  3I55 A;  2HSE B;  3EGD B;  3JCM c;  1Q81 C;  3DLL A;  2EYY A;  4WCI A;  1E6G A;  1QW1 A;  1SSF A;  1X75 C;  1D1A A;  4FW1 A;  1YWO A;  1UEC A;  1M3C A;  2RJF A;  1G3Y A;  2E65 A;  1WHL A;  4L6V 5;  2E64 A;  3CCM A;  1X27 A;  3C0C A;  2ZPE B;  3CCJ A;  3FLG A;  4IUP A;  4RCC A;  3OY9 A;  5GAN j;  1R0B G;  5GMK i;  4BDZ A;  2RQT A;  2IIM A;  3PGG A;  4DBQ A;  4F16 A;  3JB9 J;  2XG8 D;  1FYN A;  5FRO A;  2L3Q A;  3JB9 I;  2L3P A;  3GBQ A;  2AKL A;  2X4W A;  2CZ6 B;  3C95 A;  1AWO A;  4JLI A;  4KGZ B;  4JJB A;  3HL8 A;  1Y7X A;  1AHJ B;  1YIT A;  4M7D C;  5GMK l;  5CKF A;  1KIK A;  1TG0 A;  1GCQ C;  2P0P A;  3QYG B;  2A7Y A;  2XIC A;  3OBY A;  3QG1 A;  4BUG A;  2HQX A;  4IUT A;  1M90 U;  1MMA A;  1WQ7 A;  5GAN h;  2KE9 A;  3JSC A;  1VUB A;  2YDL A;  2JM9 A;  1N8R C;  3R6O A;  4OB3 B;  1EIF A;  2KMT A;  2RA2 A;  1OV3 A;  3RBB B;  1Y07 A;  3CCS T;  1NJI C;  2R57 A;  4FL6 A;  3L2V A;  4RTU A;  4IUR A;  4XTZ A;  4AFZ C;  4F7U E;  2X9H A;  3IQL A;  4Z8A A;  2DVJ A;  4KBM B;  4XU3 A;  3FEO A;  1UEB A;  2XI9 A;  4J9C A;  5GAN e;  1TUD A;  4PJO F;  3A8M B;  2IVW A;  1ARK A;  3SWN C;  1QMC A;  5GAO n;  2P0Q A;  3CD6 T;  2K2M A;  4ORZ A;  4PJO G;  1Y71 A;  4CC4 B;  5KE3 A;  1QCN A;  1WGS A;  4XK8 E;  3TSW A;  3C12 A;  1O9S A;  3JB9 F;  2VXF A;  4CC2 A;  1WNL A;  5GMK h;  1PD1 A;  2V8K A;  1UGR B;  3EHR A;  3I5S A;  3RKX A;  1QVF P;  3EGD A;  3M0T A;  2DBM A;  2GNC A;  5J39 A;  3S6W A;  4HCK A;  1Z9Z A;  3M5A A;  2VB6 A;  1IGU A;  2L2P A;  2RD1 A;  2PTK A;  4JZ4 A;  1JBM A;  5AYF A;  4M77 D;  1W4S A;  3G6E A;  2KYB A;  3REA B;  2KAF A;  1VQK A;  2A0F B;  1VQ4 A;  4OGE A;  2P4R A;  4OGC A;  4ZGE B;  3M4Y A;  4CRI A;  2EQK A;  4C8Q C;  2ESW A;  2WSE E;  3OB9 A;  4N0A A;  1YCS B;  4M75 D;  1Q82 R;  4M7D G;  1JB0 E;  5GAM g;  2OAW A;  3NGP A;  4IIM A;  2HSP A;  2XDB A;  3SWN A;  2OTL T;  1NM7 A;  2COW A;  3H0I A;  1VQ7 Q;  2J6O A;  2RK2 A;  4XU2 A;  2RI2 A;  2VGM A;  4M78 D;  2X4J A;  5IH2 A;  2M9U A;  4QVZ A;  1NPP A;  2MAM A;  2KBT A;  1S72 A;  2CP3 A;  4J9D A;  2EGA A;  3MEV A;  1ZX6 A;  3KBG A;  4M7A C;  3OYJ A;  3J7A F;  3CPW A;  4R0K A;  2PVG B;  1TS9 A;  1XJW B;  1IZ6 A;  3VUZ A;  4C5G A;  3ASK A;  3UF4 A;  2O9S A;  2E70 A;  5LJ3 j;  1VQN Q;  3QPH A;  2ZPH B;  3BFM A;  2CP5 A;  3VS1 A;  1TOV A;  3ULR B;  2FZG B;  3X20 B;  1FMW A;  3H0H A;  3GF5 A;  2JMA A;  3PVL A;  4J8O A;  2DEQ A;  1VQ9 T;  2O01 E;  1B07 A;  3M4G A;  2L89 A;  4ZTJ A;  1AT1 B;  1D09 B;  4EMH A;  2LVM A;  2RQV A;  5GAN 2;  4A63 B;  3CC7 T;  3EFO B;  3QHS A;  2HNI A;  2O4X B;  1QKX A;  1UUE A;  3CBM A;  3JCM X;  2ZPF B;  3CCL T;  3FIF A;  3CEY A;  5KYN A;  1KK7 A;  1TXQ A;  2DET A;  3CCR A;  2DL8 A;  1WJS A;  1YIJ T;  4MDW A;  1AWX A;  4BD3 A;  1M2O A;  1W2B P;  1QVF S;  2EGC A;  3PT9 A;  4HT9 A;  1ZSG A;  2KGT A;  2BE7 D;  1OI1 A;  2P84 A;  5CK9 A;  1YJN A;  1WHH A;  2K7A A;  3VJP A;  1X6B A;  2PU9 B;  4J6Y A;  5KYX B;  2O2O A;  3QWX X;  4RTY A;  4FW2 A;  1K73 U;  1CKB A;  3G6E Q;  5KYU A;  3CMA Q;  2DNU A;  3E19 A;  3JCM Q;  1M1K C;  3FDR A;  4DOV A;  5CO7 A;  5CQY A;  5CAI A;  4J9E A;  4A4H A;  1HSQ A;  3LGL A;  3PIP A;  3CC2 T;  2F2V A;  3M53 A;  2F2W A;  2MWO A;  3G7Z A;  3CCQ Q;  4OF1 A;  3CCU A;  5KYW B;  2CKK A;  3EH1 A;  2DEU A;  1VQ7 A;  1UGS B;  2QEX T;  3EG2 A;  2LCL A;  2RMO A;  4CI0 C;  2EQM A;  2K79 A;  3S3O A;  3M58 A;  4PFP A;  4BAC A;  2DZC A;  8ATC B;  1KC8 R;  1G5V A;  2QA4 T;  2QA4 Q;  9ATC B;  4TVR A;  3ER0 A;  4PNO A;  2M0O A;  2HD0 A;  1HD3 A;  3RMQ A;  1QQJ A;  3J80 E;  2NUT A;  5IHN A;  1B3Q A;  1ZUU A;  1BCM A;  5I21 A;  8AT1 B;  3MCA B;  3H9N A;  1Q81 R;  1OU8 A;  1N9R A;  3M0P A;  4QQ6 A;  4HVW A;  3CPW S;  3L2W A;  2HL5 C;  3T9N A;  4C0G A;  4FSX A;  3EAE A;  3V8K A;  1KC8 C;  5GAN d;  3I9Q A;  1X01 A;  4C92 B;  2EQU A;  5D6W A;  2FL7 A;  1ABO A;  3QZ5 B;  3LWH A;  2RJD A;  2MOX A;  4DA4 A;  4HKE A;  4C0D B;  1KJW A;  3CPW P;  2I0N A;  2M0Y A;  3JCM e;  4PJO D;  3DKM A;  1RI0 A;  3RDV A;  5LJ5 e;  1PM3 A;  3NPF A;  3QYH B;  1WXB A;  1NZ9 A;  4IUV A;  4DEX A;  5LJ3 g;  3WVE B;  4Y91 A;  2RF0 A;  1M2V A;  2QYZ A;  1XNI A;  2FZC B;  2YLB A;  3GP8 A;  5EG2 A;  1EZZ B;  3RKY A;  4J9H A;  2QTV A;  1BCO A;  4Q5W A;  3NFC A;  2RHY A;  2DXC A;  1QP2 A;  4PJM A;  5CQX A;  3VS3 A;  5KE2 A;  2SRC A;  2KR3 A;  2KRS A;  5FU6 B;  4C8Q E;  3CMA A;  2J05 A;  2CGH A;  1WI7 A;  1YNZ A;  4RTW A;  3NTK A;  1YHQ A;  5GAM h;  2LJ0 A;  4DOW A;  2O88 A;  4ANJ A;  2X35 A;  4IUU A;  3INZ A;  4DQ2 A;  5HCK A;  4LD6 A;  1I07 A;  3CD6 A;  4ATO A;  4M78 G;  1J3T A;  2KXC A;  2EWN A;  1UTI A;  2JT4 A;  4LDV A;  3CCE Q;  4BB7 A;  2K3B A;  4J9B A;  2K6D A;  1KD1 C;  1PSF A;  2GGR A;  4KGV B;  1JXM A;  2LX7 A;  5I2M A;  1RLQ C;  2F2X A;  3VS6 A;  3CME Q;  3G4S Q;  3E2U A;  1N9S A;  3OYH A;  3I56 A;  2C06 A;  1RI9 A;  2CSI A;  2KT8 A;  2VAS A;  1K1Z A;  1M1K R;  2RB6 A;  4J5Y A;  3L1A A;  3CCQ T;  3HSB A;  2L5Q A;  1SF9 A;  4JRK A;  5GMK m;  5GAN 8;  2LX9 A;  4PFZ A;  2X4Y A;  2CP7 A;  3JB9 H;  3E9G A;  1BKB A;  2MI6 A;  4EIK A;  2QG9 B;  4OMP A;  4E2F B;  1BYM A;  2GFA A;  3VV0 A;  4IIO A;  1VQ8 T;  3I56 T;  2YUN A;  5GAM f;  4PJO B;  2R5M A;  2O9V A;  1M8M A;  5LL6 S;  2P4T A;  1YP5 A;  3L2Q A;  1TH7 A;  3N5B B;  3JCM h;  1JO8 A;  2YWW A;  5J3B A;  2ZZD A;  4J9G A;  2LQ8 A;  3WVD B;  1Q7Y R;  4F7U B;  1M3A A;  1JU5 C;  4BE2 A;  5M9O A;  1IHW A;  1ZUK A;  5KCH A;  3HFN A;  2DJZ A;  1C1A A;  3GNF B;  1RAI B;  2KRO A;  1M5Q 1;  2RO0 A;  5DLQ E;  2A37 A;  2DBK A;  2EBP A;  2LJ3 A;  4P5N A;  2DAQ A;  4FYV B;  1YHQ Q;  1SPK A;  2V1Q A;  3OYN A;  1Q95 G;  2AZS A;  3GPL A;  1BIB A;  1Q7Y C;  4C8Q D;  1XOV A;  4J7I A;  1VQN T;  1WDX A;  2A28 A;  3M56 A;  1T0H A;  1NLP C;  3D7S B;  3QO3 A;  1GRI A;  3VS5 A;  2FHD A;  3CCL A;  2HZY A;  3OYA A;  1VQ5 Q;  1ZA1 B;  4CC3 A;  2XU8 A;  2BTT A;  3MEA A;  2RI5 A;  1WHK A;  2PZ1 A;  4LE9 A;  2BE9 B;  1M1F A;  2ENM A;  2YXY A;  3BW1 A;  4RTV A;  3LH5 A;  4LN2 A;  3LWI A;  1JRI A;  4OVA A;  1G83 A;  1XQH A;  2K3X A;  4XTX A;  5A0D A;  2QGF B;  4JJN K;  3LX7 A;  1YI2 A;  2FPD A;  3CCJ Q;  2NUZ A;  5LJ3 d;  5GAO m;  2FEI A;  4OB2 B;  3VS0 A;  4DBH A;  4HCZ A;  3J81 E;  3THK A;  2L0A A;  2CUD A;  3PFS A;  5FW9 A;  1BU1 A;  5FWB A;  4PK4 A;  4M4Z A;  3G71 A;  1VQN A;  1GFD A;  1SHG A;  4LXC A;  1AVZ C;  3TU4 K;  2LQK A;  2H3E B;  1QVP A;  2V1R A;  4OB1 B;  4GBQ A;  2E10 A;  3V7S A;  2EQJ A;  3PMT A;  2VXE A;  3OYI A;  5EC7 A;  2CS7 A;  4OMO A;  3QDR B;  2RN8 A;  3HFO A;  3SDZ A;  3HKS A;  4O6J A;  4C92 E;  2RQU A;  4FT4 A;  2CZ0 B;  1M30 A;  4E7Z A;  3M0U A;  3S3M A;  5FU7 B;  2DYB A;  5LJ5 f;  2OTJ Q;  1KQS P;  4AG1 C;  3LH0 A;  1UJY A;  2C0O A;  2J6K A;  2SEM A;  2M1H A;  4EMK B;  2GF7 A;  5GAN 6;  2NUP B;  4ZN1 A;  2PVO B;  4X9D A;  2E6Z A;  2HMA A;  1WJR A;  4EMK A;  1WXU A;  1WPY A;  1F1B B;  3SB2 A;  2ZPI B;  2KT1 A;  3MP1 A;  1ZA2 B;  1WXT A;  3AHU A;  3A8H B;  2KK4 A;  2OX7 A;  3OYE A;  2KRN A;  4FM4 B;  5LJ3 e;  2CT4 A;  3TVT A;  1KC8 U;  1M27 C;  3VS4 A;  1S72 T;  3SEM A;  4FYX B;  4ZTF A;  2DL3 A;  4MZM A;  2QQ9 A;  4AFU C;  1Q82 U;  4C8Q B;  2DZ9 A;  2LNV A;  3CQT A;  4DBR A;  4HT8 A;  4X34 A;  5GAN 5;  4E7I A;  2QEX A;  4J9F A;  1W70 A;  4M78 A;  2AHJ B;  1VQ9 A;  2M02 A;  4XAX B;  3CBP A;  1NYF A;  2K3Y A;  2RPN A;  3OYM A;  2M51 A;  2CRE A;  1U3O A;  4XU1 A;  1M2V B;  5GAM e;  2QA4 A;  2EYQ A;  4JLG A;  4LNP A;  3CMA T;  1VYT A;  3C4S A;  2KDS A;  1FX7 A;  1MHN A;  1SG5 A;  2PQW A;  1JEG A;  4M7D E;  5LJ3 f;  4HVU A;  5IHK A;  2GCX A;  1OEB A;  1N8R U;  4XTY A;  4B6M A;  4J9I A;  3UAT A;  3EG3 A;  4FCY A;  2HQH A;  5A0G A;  3LGF A;  4KUD K;  3LYI A;  3MEW A;  2Y90 A;  2QQA A;  1MMG A;  4GLK A;  1N6A A;  4L59 A;  4Z89 A;  1YJN T;  1AWJ A;  3MO8 A;  5AT1 B;  2KRM A;  2EYZ A;  4M7A F;  2Y4Y A;  4E7H A;  1NPR A;  5FU6 C;  2CZ1 B;  1VYU A;  5GAO p;  1D1C A;  1M90 R;  2ATC B;  4LDX A;  1KG1 A;  2JS0 A;  2BZ8 A;  1FWZ A;  2COZ A;  4M78 C;  2EKH A;  1LJO A;  5IXF A;  1BIA A;  4PJJ A;  3RNJ A;  4M75 E;  2DE0 X;  1N5Z A;  4RCB A;  4EMK C;  3JCM d;  2VGN A;  1SHF A;  4II1 A;  4LUE A;  3DB3 A;  2FZK B;  2AZV A;  2YHT A;  4Y92 A;  1M8V A;  4PL6 A;  1OQK A;  1VQ7 T;  2KQW A;  2K4Y A;  4NS5 A;  1K4U S;  3OW2 P;  5DLO A;  3JCM V;  3L2Z A;  5GAM d;  4PFO A;  2XDD A;  1VQO Q;  2LNH B;  1ZSZ B;  4PJO C;  4J7F A;  4F7U G;  1U06 A;  2C0T A;  4GLM A;  3JCM g;  4OB0 B;  2XK0 A;  1WHG A;  2EJF A;  2OI3 A;  3ZEH A;  2DIG A;  2JTM A;  5CR2 A;  1I81 A;  3M59 A;  4C0F A;  3P8H A;  3OS1 A;  1UE9 A;  1ZLM A;  1P92 A;  2MYS A;  2QXF A;  5LJ5 d;  1X2Q A;  3RUX A;  1Y57 A;  3HTR A;  4AFS C;  3UDC A;  4MML A;  1VQP A;  1D0Z A;  4Y28 E;  3GLX A;  3P8B B;  2G3R A;  3QII A;  4AMC A;  1QLY A;  3A8O B;  2EIF A;  4OMQ A;  3LLR A;  2RQW A;  1U1T A;  3MP8 A;  5CKH A;  5ECA A;  4F7U F;  5I2S A;  4MDX A;  2GQI A;  1QCO A;  1WYX A;  1AEY A;  3HRS A;  2LDM A;  4LDY A;  2RQR A;  4EPC A;  4GY5 A;  2DL4 A;  3CPF A;  5IAY A;  2LQN A;  4E7K A;  4KT0 E;  4OMF B;  3MJX A;  3F70 A;  3CC7 Q;  3SFM A;  1WIE A;  3I55 T;  2DPP B;  4JDS A;  3CME A;  2JJ9 A;  5J26 A;  4ZGD B;  2JTE A;  3TCJ A;  2DYI A;  1VYV A;  2LT4 A;  2GTJ A;  4PJO A;  5LJ3 h;  1S1N A;  1AZE A;  5KH6 A;  1AZG B;  1YJW T;  2X51 A;  3HRU A;  1X6G A;  3QZ9 B;  1PKT A;  3I5R A;  5GJV B;  4NOY A;  4KUL A;  3JCM W;  3NTH A;  3HP9 A;  3A8L B;  4XQ3 A;  1VQL A;  3OYG A;  3URG A;  1K0X A;  2DKG A;  2AKK A;  1QKW A;  3OSV A;  2F5K A;  2CSQ A;  1SEM A;  2XD0 A;  2IPO B;  4E6R A;  1MGQ A;  2L3S A;  2CT3 A;  1W2B S;  1D0Y A;  1H92 A;  1LVK A;  3V7R A;  1SKU B;  2MPX C;  2A3L A;  1OU9 A;  1VQ5 T;  4D8D A;  5IHI A;  1M4Z A;  2VC8 A;  1YIT T;  1RAF B;  1OPL A;  2JXB A;  4CC7 A;  1RUW A;  4VUB A;  3Q1J A;  4LDW A;  1K9M U;  3NTI A;  3I55 Q;  2QTX A;  1XTD A;  1KD1 R;  5DY9 A;  3CCJ T;  4N4I A;  1H8K A;  1X2K A;  3QJY A;  1R8O B;  3DLM A;  1QVG P;  1PCX A;  2ZPG B;  1VOM A;  4E47 A;  4JRQ A;  1M1K U;  2HCK A;  2WSC E;  1U8R A;  5CCA A;  3CCM Q; 
#chains in the Genus database with same CATH homology
 2RK1 A;  3N5B B;  2XIC A;  5FU7 C;  3JCM h;  3OMC A;  3OBY A;  4A4K A;  4NL3 A;  3QG1 A;  4BUG A;  5J3B A;  1G3W A;  2HQX A;  2ZZD A;  1VQM T;  3O8V A;  2LQ8 A;  1B34 B;  5HY6 A;  3WVD B;  3E1S A;  4IUT A;  4F7U B;  4JRI A;  1M90 U;  2DTH A;  3HRT A;  1WQ7 A;  4BE2 A;  5M9O A;  5GAN h;  3JSC A;  5DM7 R;  2BIV A;  4YTL A;  5FLX E;  1VUB A;  3HFN A;  5KCH A;  1B34 A;  4QQD A;  2DJZ A;  4JS4 A;  1VQ5 A;  4JRP A;  3R6O A;  4OB3 B;  1N8R C;  2YRV A;  4C5I A;  1EIF A;  2KMT A;  2RJE A;  2RA2 A;  3OQ5 A;  3GNF B;  3MHX A;  1Y07 A;  1D3B A;  2P0K A;  3CCS T;  1I8F A;  1M5Q 1;  2I2L A;  2R57 A;  2RO0 A;  2CZ7 B;  4FL6 A;  1NJI C;  3JAM E;  5DLQ E;  4QVD A;  3L2V A;  3RIR A;  4RKU E;  1BI0 A;  4IUR A;  4XTZ A;  4P5N A;  3OW2 S;  2DAQ A;  3X24 B;  4F7U E;  1KQ2 A;  1YHQ T;  4HA8 A;  3GOX A;  4KBM B;  3PTA A;  3OYN A;  4XU3 A;  3VUB A;  4M7A E;  3A8G B;  3FEO A;  1YI2 T;  1KQ1 A;  1BIB A;  1UEB A;  3GPL A;  2XI9 A;  3PIO A;  1Q7Y C;  2VYT A;  4C8Q D;  1XOV A;  5GAN e;  1ZQ1 A;  2K2V A;  4J7I A;  4ZN3 A;  1VQN T;  3V8J A;  2EJG A;  4PJO F;  3A8M B;  1Q86 U;  1QP3 A;  2WSF E;  1VQM A;  2IVW A;  3M56 A;  3SWN C;  5GAO n;  2P0Q A;  2QQB A;  4MZT A;  3CD6 T;  4PJO G;  3QO3 A;  1Y71 A;  3CXC S;  5KE3 A;  2E1H A;  2FHD A;  3CCL A;  1WGS A;  2QQR A;  2QQS A;  2RHU A;  2IG0 A;  4LDU A;  4M77 E;  4XK8 E;  3X28 B;  3C12 A;  1O9S A;  3OYA A;  3JB9 F;  4XTU A;  2VXF A;  4D6W A;  4M75 C;  1WNL A;  2XU8 A;  5GMK h;  3JB9 D;  2V8K A;  2LCC A;  3MEA A;  1KQS A;  2RI5 A;  1UGR B;  2DIQ A;  4RMO A;  2FVU A;  5GMK j;  1Q82 C;  3RKX A;  1M1F A;  3BW1 A;  4XTV A;  3V8L A;  2JTF A;  2DD4 A;  5J39 A;  3LWI A;  1JRI A;  4M78 F;  4OVA A;  3S6W A;  1XQH A;  2K3X A;  2K5L A;  2F5T X;  4XTX A;  4A4F A;  5A0D A;  3M5A A;  3LX7 A;  4JJN K;  1YI2 A;  4J6X A;  2RD1 A;  1G3S A;  3QUI A;  1V29 B;  5LJ3 d;  3JCM f;  1JBM A;  3FB9 A;  4FIB A;  5GAO m;  5AYF A;  4M77 D;  1W4S A;  4OB2 B;  2E6N A;  4PLL A;  3G6E A;  4JS5 A;  1Q7Y U;  5LJ5 g;  2D0Q B;  2ZCF B;  4HCZ A;  2KAF A;  3QXE B;  4FU6 A;  3J81 E;  2DXU A;  3ME9 A;  1VQ4 A;  4OGE A;  4C92 G;  3PFS A;  2EKO A;  4OGC A;  4ZGE B;  3M4Y A;  4CRI A;  3OSS C;  3RKW A;  2EQK A;  3X25 B;  4C8Q C;  5C6S A;  2WSE E;  3OB9 A;  2F69 A;  3G71 A;  1VQN A;  3OYF A;  3FRN A;  1I4K 1;  4N0A A;  1KHI A;  4M75 D;  3VU3 C;  4M7D G;  1DJ7 B;  1OYX A;  2VUB A;  3PNW C;  2K5F A;  1JB0 E;  5GAM g;  3TU4 K;  2WAC A;  2LQK A;  4R55 A;  2RJC A;  2XDB A;  1QVP A;  3CCU T;  2E12 A;  3SWN A;  2LTO A;  4OB1 B;  2OTL T;  2L8D A;  1UGQ B;  2E10 A;  3RES A;  2QI2 A;  3V7S A;  2RHI A;  2EQJ A;  3PMT A;  2VXE A;  3OYI A;  2RK2 A;  1OZ3 A;  2R5A A;  4XU2 A;  2CS7 A;  2RI2 A;  3CCV T;  3DB4 A;  3QDR B;  3HFO A;  4M7A A;  2VGM A;  4M78 D;  2X4J A;  3X26 B;  4A4E A;  3SDZ A;  3HKS A;  4O6J A;  4C92 E;  1KHC A;  2M9U A;  4QVZ A;  1N27 A;  1NPP A;  2CZ0 B;  2LRQ A;  3A5Z B;  4FT4 A;  4BI3 A;  2MAM A;  4EDU A;  3CCR T;  1S72 A;  2YLC A;  5HKC A;  3S3M A;  5FU7 B;  2HAX A;  1X6O A;  2EFI A;  3MEV A;  3OBW A;  4MZP A;  5LJ5 f;  1VQK T;  1H3Z A;  3KBG A;  4M7A C;  3OYJ A;  5CIU A;  3J7A F;  1NJI U;  1JJ2 S;  3LH0 A;  5CKE A;  3CPW A;  2PVG B;  3JCM J;  1IZ6 A;  2RHX A;  2M1H A;  3VUZ A;  4C5G A;  4EMK B;  3ASK A;  4M75 F;  5LJ3 j;  2E70 A;  2GF7 A;  5GAN 6;  3QPH A;  4ZN1 A;  1YIJ A;  3G6E T;  1K8A C;  2PVO B;  4X9D A;  2EAY A;  2ZPH B;  3CCS A;  2JOY A;  1M9S A;  2E6Z A;  3BFM A;  3VYH B;  4ME7 A;  2D6F A;  1WJR A;  4EMK A;  5D6X A;  1D3B B;  3X20 B;  3OS2 A;  1WPY A;  5IT9 E;  1WJQ A;  3V7C A;  2DTO A;  3SB2 A;  3GF5 A;  1W2B A;  1UB4 A;  3JRZ A;  3KXT A;  2H3J A;  4J8O A;  5GAN f;  2ZPI B;  3G71 T;  3MP1 A;  2DEQ A;  1VQ9 T;  2O01 E;  1Y96 A;  4EMG A;  4ELY C;  3RER A;  3TRE A;  3AHU A;  3A8H B;  2KK4 A;  3OYE A;  3M4G A;  1BI1 A;  1BI3 A;  2L89 A;  4FM4 B;  5LJ3 e;  4ZTJ A;  3M54 A;  1VQ6 T;  2HBP A;  4ZGJ B;  2PUO B;  2LVM A;  4EMH A;  5GAN 2;  2O4X A;  2RM4 A;  4RG8 A;  4N0A C;  2KY9 A;  1KC8 U;  2OTL A;  1KD1 U;  2D9T A;  1S72 T;  4FT2 A;  4M78 B;  3CC7 T;  4ZTF A;  4M7A D;  3OYD A;  2BKD N;  3QHS A;  2HNI A;  2O4X B;  3JCM X;  3QSU A;  3CBM A;  3CCV A;  2ZPF B;  4MZM A;  4C92 D;  3OA6 A;  2OTJ A;  4M77 C;  3SWN B;  3H8Z A;  3CCL T;  3FIF A;  3GNG A;  3CEY A;  2QQ9 A;  3FC3 A;  4M75 A;  3CCR A;  5GAO q;  3CC2 A;  2DO3 A;  1VIF A;  1WJS A;  3M57 A;  2K5I A;  1YIJ T;  1Q82 U;  4MDW A;  4C8Q B;  3UPU A;  3M55 A;  2DZ9 A;  2LNV A;  3KUF A;  3MP6 A;  4M75 B;  4BD3 A;  1QVF S;  4HT8 A;  3PT9 A;  4HT9 A;  1GXI E;  4Z02 A;  4X34 A;  5GAN 5;  3C94 A;  1OI1 A;  4E7I A;  3SD4 A;  2HQE A;  3QKJ A;  1K9M C;  5CK9 A;  4M77 F;  4M78 A;  2QEX A;  3FJP A;  4WF2 A;  1YJN A;  2AHJ B;  1M1G A;  1VQ9 A;  2KSS A;  4XAX B;  3VJP A;  1Q86 C;  2PU9 B;  1ZHI A;  4J6Y A;  2DXT A;  2RI3 A;  2E41 A;  2B8A A;  3CBP A;  2GFU A;  1OZ2 A;  2K3Y A;  2DVE A;  3OYM A;  4PKC C;  4C0D C;  4QW2 A;  4C5H A;  4E7L A;  2RHZ A;  4XU1 A;  2QA4 A;  5GAM e;  1K73 U;  2EYQ A;  2MF2 A;  3L42 A;  3QBY A;  5GAO r;  4JLG A;  3E19 A;  3CMA T;  1Q81 U;  3JCM Q;  1M1K C;  2KVQ G;  2PUK B;  3C4S A;  2KDS A;  1FX7 A;  1MHN A;  1YCY A;  2DXB A;  1UGP B;  3FDR A;  5CO7 A;  2PQW A;  4DOV A;  1M90 C;  4M7A G;  1VQ6 A;  2VV5 A;  3HPW A;  5CQY A;  5L8R E;  5LJ3 f;  5A0L A;  5CAI A;  4M7A B;  4M7D E;  3EFS A;  4A4H A;  3CME T;  3LGL A;  3PIP A;  2GCX A;  2ZGW A;  3CC2 T;  2XHC A;  4UC4 A;  5HK3 A;  1N8R U;  5C0M A;  3M53 A;  4XTY A;  5CKB A;  4LD9 K;  2MWO A;  4HCB A;  1QVF A;  4NL2 A;  2R58 A;  3CBO A;  3WXM B;  3VYG A;  3G7Z A;  2GQV A;  5A0G A;  3BDL A;  3LGF A;  4J83 A;  3M9Q A;  4OF1 A;  4BE1 A;  3CCU A;  4KUD K;  3GIB A;  3LYI A;  2OTJ T;  3MEW A;  2Y90 A;  2QQA A;  5KCO A;  4GLK A;  1N6A A;  1YJW A;  1H64 1;  2CKK A;  5GMK e;  4L59 A;  2Y4X A;  1VQ7 A;  2NLU A;  1UGS B;  4M77 A;  2QEX T;  1YJN T;  2LCL A;  2K57 A;  5GAN 4;  4C0Z A;  3JCM P;  3CXC A;  3MO8 A;  4M7A F;  4BI4 A;  4CI0 C;  2EQM A;  2Y4Y A;  5LJ5 j;  4E7H A;  1NPR A;  1WQW A;  3S3O A;  4IKF A;  3JB9 G;  5FU6 C;  3UT1 A;  2CZ1 B;  3M58 A;  1IRE B;  4A53 A;  4BAC A;  2DZC A;  2LT1 A;  2L3R A;  5GAO p;  1LNX A;  3CCE A;  1G5V A;  2QA4 T;  4C8Q A;  4LDX A;  3JCM b;  4TVR A;  3ER0 A;  2PVD B;  4PNO A;  3CC4 T;  1KG1 A;  3S3N A;  2M0O A;  2HD0 A;  3TEE A;  5HK0 A;  1FWZ A;  3RMQ A;  4M78 C;  4IUQ A;  3PMI A;  3J80 E;  4A4G A;  3E9F A;  1LJO A;  2V8J A;  3VKI A;  4C92 F;  1HXD A;  1BIA A;  3G4S A;  4M77 B;  3MEU A;  4M75 E;  5A2Q E;  5I21 A;  1YJ9 T;  3MCA B;  4RCB A;  4EMK C;  1VQP T;  4PJO E;  4QQG A;  1N9R A;  1U1S A;  2M16 A;  3OS5 A;  4QQ6 A;  4BDY A;  3JCM d;  2VGN A;  4A54 A;  1JJ2 A;  3CPW S;  3CCQ A;  4II1 A;  3L2W A;  2V8I A;  3DB3 A;  4C8Q F;  3T9N A;  2YHT A;  4FSX A;  4C0G A;  3EAE A;  4PL6 A;  4ELZ C;  3V8K A;  5GAO l;  3CC4 A;  1M8V A;  1VQ7 T;  2KQW A;  1FXX A;  2K4Y A;  4M78 E;  5D6Y A;  5GAN d;  1X01 A;  4NS5 A;  1PSE A;  1KC8 C;  4C92 B;  2EQU A;  5D6W A;  2FL7 A;  2XID A;  3OS0 A;  4BI8 B;  3QZ5 B;  3LWH A;  5DLO A;  3JCM V;  3L2Z A;  5GAM d;  2RJD A;  2FB7 A;  5GAN 3;  2XDD A;  4PJO C;  4J7F A;  1YJ9 A;  1HK9 A;  4F7U G;  4DA4 A;  4HKE A;  3JCM g;  4C0D B;  3CC7 A;  3ZBD A;  1O75 A;  4OB0 B;  3OYK A;  2XK0 A;  3JCM e;  2EJF A;  3DKM A;  3ZEH A;  4PJO D;  1RI0 A;  2DIG A;  2JTM A;  5CR2 A;  1K8A U;  1I81 A;  4O5V A;  5LJ5 e;  3M59 A;  4C0F A;  3P8H A;  1ZBX A;  2E5Q A;  3OS1 A;  4X9C A;  4M7D A;  3QYH B;  4C5E A;  3UWN A;  1P92 A;  2QDY B;  4XTW A;  2QXF A;  4C92 A;  4M77 G;  1BI2 A;  5LJ5 d;  3RUX A;  1NZ9 A;  4IUV A;  5LJ3 g;  3WVE B;  4BE0 A;  2MMP A;  4Y91 A;  3UDC A;  4MML A;  5CKD A;  1VQP A;  4Y28 E;  5GAN 7;  3GLX A;  3P8B B;  2G3R A;  1XNI A;  3QII A;  4XU0 A;  2X4X A;  3A8O B;  2EJ9 A;  2YLB A;  4RG2 A;  5EG2 A;  3GP8 A;  2EIF A;  1KQS S;  3RKY A;  3LLR A;  3OYC A;  2DD5 A;  1U1T A;  3MP8 A;  4B9X A;  5FRN A;  5CKH A;  4B9W A;  1RL2 A;  4Q5W A;  3NFC A;  4J6W A;  4F7U F;  5I2S A;  1K73 C;  4MDX A;  3OW2 A;  3OYY A;  3MET A;  4L5G A;  4PLI A;  1VQL T;  1YBY A;  2RHY A;  2DXC A;  1QP2 A;  4BY6 C;  3HRS A;  5FRM A;  2LDM A;  4LDY A;  4EPC A;  4GY5 A;  5CQX A;  4V2S A;  2JNG A;  5KE2 A;  2JZ2 A;  3CPF A;  5IAY A;  4MMK A;  3CCM T;  3ZFJ A;  4E7K A;  1VQO A;  5FU6 B;  4KT0 E;  4OMF B;  4JUV A;  4M7D B;  2MWP A;  4C8Q E;  3CMA A;  2OAU A;  5GAN g;  2CGH A;  3F70 A;  3SFM A;  2JVV A;  3LW5 E;  3NTK A;  2FYK A;  1VIE A;  1YHQ A;  3I55 T;  3OYL A;  3L2R A;  2DPP B;  4JDS A;  5GAM h;  2ZPB B;  2DK3 A;  5CVI A;  4DOW A;  4N4H A;  4M7D F;  4OP0 A;  3CME A;  5J26 A;  4ZGD B;  4HCC A;  3OMG A;  3TCJ A;  4C8Q G;  2LT4 A;  2X35 A;  4IUU A;  3P8D A;  3OYB A;  4PJO A;  3INZ A;  5LJ3 h;  4DQ2 A;  1G3T A;  5KH6 A;  1YJW T;  1VQO T;  1NE8 A;  3H6Z A;  3HHT B;  1VQ8 A;  2CYZ B;  3BDU A;  3HRU A;  4LD6 A;  3QZ9 B;  5LJ5 h;  3CD6 A;  1Y96 B;  4ATO A;  2RH2 A;  3EFR A;  4NOY A;  4KUL A;  5IN1 A;  4R56 A;  3JCM W;  2DTI A;  3NTH A;  4M78 G;  3I55 A;  3HP9 A;  3A8L B;  4XQ3 A;  1VQL A;  3OYG A;  3URG A;  2EWN A;  3JCM c;  1Q81 C;  2LC4 A;  3RMS A;  4C92 C;  2DKG A;  3CCE T;  3DLL A;  3OSV A;  2XKO C;  4LDV A;  2F5K A;  4BB7 A;  1QW1 A;  1SSF A;  1KD1 C;  4F7U A;  1PSF A;  1X75 C;  2XD0 A;  1MGQ A;  4M75 G;  1W2B S;  4M7D D;  2RJF A;  5I2M A;  1G3Y A;  2E65 A;  4L6V 5;  1I5L A;  3V7R A;  2E64 A;  3G4S T;  5GAM j;  2A3L A;  3CCM A;  3L2U A;  2ZPE B;  3CCJ A;  3FLG A;  1N9S A;  3OYH A;  1VQ5 T;  3QJ6 A;  3I56 A;  2C06 A;  4IUP A;  4RCC A;  1M4Z A;  4QVC A;  3OY9 A;  5GAN j;  2JUF A;  2RB6 A;  4J5Y A;  5GMK i;  3L1A A;  2VC8 A;  3CCQ T;  4BDZ A;  4E7J A;  1YIT T;  3HSB A;  2L5Q A;  3PGG A;  4JRK A;  5GMK m;  5GAN 8;  2LX9 A;  1VQ4 T;  3JB9 J;  2X4Y A;  2XG8 D;  3JB9 H;  3E9G A;  1BKB A;  4VUB A;  2XDP A;  2MI6 A;  5FRO A;  2BUD A;  3BY7 A;  3Q1J A;  4LDW A;  3JB9 I;  1K9M U;  4N4G A;  3NTI A;  1BYM A;  2QTX A;  2GFA A;  3VV0 A;  1QVG S;  1XTD A;  2X4W A;  5DY9 A;  2CZ6 B;  3CCJ T;  4N4I A;  4BY6 B;  1VQ8 T;  3I56 T;  3C95 A;  3QJY A;  1R8O B;  3DLM A;  5GAM f;  4JLI A;  4PJO B;  4KUI A;  2R5M A;  3HL8 A;  1Y7X A;  1AHJ B;  2ZPG B;  1YIT A;  4E47 A;  1QVG A;  4JRQ A;  4M7D C;  1M1K U;  1VQK A;  5GMK l;  5CKF A;  5LL6 S;  2WSC E;  2P4T A;  3L2Q A;  1U8R A;  1TH7 A;  5CCA A;  2P0P A;  3QYG B;  2A7Y A;  2JN0 A;  1LOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...