2FVUA

Structure of the yeast sir3 bah domain
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
216
structure length
190
Chain Sequence
HMTMAKTLKDLDGWQVIITDNVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the Saccharomyces cerevisiae Sir3 BAH domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Regulatory protein SIR3
total genus 43
structure length 190
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2fvuA01
1ZHIA 2FL7A 4LD9K 1W4SA 3PTAA 4DOWA 1ZBXA 4DOVA 4FSXA 4FT4A 3TU4K 4DA4A 4BB7A 4FT2A 4KULA 2FVUA 1M4ZA 4JJNK 4KUDK 4KUIA 3PT9A
chains in the Genus database with same CATH superfamily
4XU1A 4X9DA 1FMKA 2RI5A 3A98A 4J83A 2LT1A 1NLOC 1UJ0A 3OB9A 2QQSA 3L42A 3M9QA 5FRNA 3EGUA 3HFOA 2RK2A 1N27A 3EG0A 5FROA 2MPXC 4EDUA 1HXDA 2O4XB 3GBQA 1JQQA 1QVPA 4CI0C 4BE1A 1QWFA 3E19A 1Q81U 3L2UA 3CC2T 3M54A 4FSXA 4MZMA 4OGEA 3QBYA 4RTZA 1BBZA 3QO3A 2AHJB 3JB9G 3CCQT 4E7ZA 2RHIA 2MMPA 2A08A 3EG3A 2DEQA 1VQ6A 1QVGP 4HXJA 4WCIA 1JJ2P 1ZSZC 1T3SA 2JN0A 2RHZA 3VUBA 4C0ZA 2VC8A 5IT9E 1Y57A 2QEXT 2E3IA 1SG5A 2FEIA 3TU4K 4M7DD 4Y91A 1WNLA 3JCMf 4FIBA 1I0CA 3GNGA 2HD0A 2KT8A 4IUTA 2DL5A 3Q1JA 3CCST 2MWPA 2YLCA 5D7UA 1VQ9Q 3TCJA 1VUBA 2KGTA 1YJWA 5I22A 4M75E 2RO0A 2A7YA 2DAQA 3HRTA 9ATCB 2OTJQ 3JB9J 3JSCA 3V8LA 3CC2A 2DL8A 1SF9A 2O4XA 2WSEE 3GF5A 3O8VA 1YCYA 4BY6C 1ZSGA 4C0GA 2LDMA 3F70A 4L5GA 5KYXA 2CSIA 2GBQA 5I11A 5HK3A 4OMOA 5C0MA 3CMEQ 4Z88A 4CC7A 3CCLA 4M7DA 2KYMA 3LGLA 3LWIA 3WVDB 5IHNA 1WIEA 3H0FA 3QJYA 3JB9H 2CDTA 1UGPB 3OYEA 4XU3A 1FMWA 1RAFB 4M75F 2JVVA 3CC4Q 4J8OA 3VYHB 4BD3A 4ORZA 2QA4T 2HQHA 1MMNA 1GFCA 1XJWB 3LH5A 2SEMA 3C4SA 1UTIA 3MHXA 1WHJA 3ZEHA 1WLPB 4XTUA 2CH4W 1VQPT 5GAN8 3QKJA 1AWOA 2NUPA 2GQIA 4KUDK 2DD5A 4LDUA 4EMKA 5J39A 1WHGA 3G4ST 2EJGA 4IUPA 5CKEA 2R58A 3OYCA 2DJZA 3OYHA 1K73R 2J6FA 1IXDA 2JS0A 4PJJA 1Q81C 2RMOA 1R0BG 1KG1A 2EBPA 3QDFA 1Q82C 2QDLA 1SSHA 4OMPA 3OMGA 1YJ9Q 3PIPA 1UFFA 3SDZA 3HHTB 1D3BB 2D1XA 2KK4A 2HL3A 4M77G 3HL8A 4JZ4A 3JCMd 2L89A 2E65A 2M16A 4Y92A 4PJOF 2V1QA 2CZ6B 4C92C 2LTOA 3CEYA 1RLQC 1TUGB 2FZCB 1YJWQ 1BIAA 2PVDB 2IG0A 3M55A 1I8FA 4RUGA 3HRUA 1VQ7Q 1OU9A 2OJ2A 2MIOA 2GCXA 3OBWA 2DL4A 2DRKA 2KNBB 2X9HA 2DYIA 2PUKB 4GLKA 1QCOA 3RKXA 2EYYA 3KUFA 1WXTA 3OSSC 5GANj 2D8HA 1QMCA 1Q86C 4E7IA 1B07A 2PVGB 1LJOA 2DBKA 3I5RA 1VYUA 1XQHA 2LQNA 3EFOA 1QVGS 4HCBA 1RUWA 3OW2S 1EX4A 1YNZA 4WF2A 3V7SA 4C8QE 2WSFE 4ZN1A 2YHTA 3OYIA 1BCMA 4B6MA 1MMGA 1S1NA 2RNAA 2A36A 5GMKm 4LD6A 1HD3A 2OTJA 5CR2A 3M0UA 2G3RA 4HKEA 4HVVA 4OMLA 1RADB 1Q86U 3M53A 4M75G 3I55A 3OY9A 4M75C 2CZ0B 1Q82R 2DA9A 1ABOA 2DXCA 3FJPA 3CCET 1K0SA 2BKDN 4K11A 4JLGA 3JCMP 2YT6A 3MKDA 2JXBA 2AIRB 1QWEA 3PNWC 4C92D 4DEYA 1MHNA 2E41A 4QW2A 3CC7A 2DIQA 2DVEA 1YP5A 2LP5A 4J6YA 2I0NA 2M9UA 3RESA 3CD6A 3CCVQ 4M78E 2BIVA 4J9IA 3M0QA 1NEGA 4M7AF 5AT1B 4RTWA 2M0YA 4C92F 2X4WA 2DNUA 3X26B 4ELZC 2VV5A 1X2KA 4PJMA 4LUEA 5I2SA 2EQIA 3I9QA 4CC3A 4CC2A 2O9VA 3VS2A 5LJ3d 1W1FA 3U23A 1CKBA 1D3BA 3CC4A 1NEBA 4BI4A 1BCOA 4JRPA 3JCMe 3JCMQ 3RDVA 2KQWA 3VS7A 4ZTJA 3NGPA 3M57A 3CPWP 3ER0A 3CCVA 3M0SA 3S3NA 3PVQA 2K3BA 5D6YA 1M1KC 4OB0B 1M5Q1 3BE3A 1V29B 1YBYA 1E6HA 5GAN2 1WGSA 1TH7A 3EHRA 1SSFA 4Q5WA 2K3YA 2DX1A 4E7KA 1VQOT 4A4GA 1N6AA 4FW1A 1UGVA 1CSKA 3RIRA 2E12A 1MMAA 3CXCP 4C5HA 1B34A 1NJIU 1Y0MA 1NZ9A 3OYYA 3EG1A 4KGXB 4C92B 1ZUYA 2C0OA 4E7JA 2K79A 1V76A 1S72T 3SB2A 2JOYA 4QT7A 4JRQA 3SEMA 4C0DB 1PC0A 3X20B 2KXCA 2ROTA 5IH2A 1TXQA 2CP7A 3RNJA 4D6WA 4XU0A 1U1SA 2IPOB 4HVWA 1VQNT 1B7TA 1U5SA 2FPEA 1WQ7A 3RKYA 2FB7A 2HMAA 2Y4XA 3EGXB 3UF4A 3TSWA 1K73U 4XTZA 2KRSA 1VQPQ 2E5QA 2EYXA 3FRNA 2P0PA 3M5AA 4JDSA 3LX7A 5FU6C 2RN8A 3L2WA 1VQKQ 2EGEA 2HSPA 5KE2A 1XOVA 5A0LA 1KD1C 1WDXA 1OV3A 4ATOA 2DZ9A 2HQEA 3VS6A 3CCEQ 3J81E 2KDSA 1YJNQ 2ZPIB 2CP2A 4M78F 3HSBA 2ZPEB 2DIGA 2MI6A 1PD0A 1BB9A 3EAEA 4M7AE 1UUEA 2V1RA 3CBPA 1ARKA 2AZSA 4M7AC 1K76A 1R8OB 4EPCA 2LT4A 2FPDA 1K0XA 2LRQA 2DJQA 2ROLA 5HY6A 2E4HA 4M7DF 4R0KA 3R6OA 2DE0X 2WACA 2W10A 4B9WA 1AOJA 4BUGA 4ZTFA 4M77B 4QKUA 4CC4B 4JPBW 3LWHA 2BUDA 3A8GB 3G6ET 1FX7A 2DZCA 4DOWA 1N9RA 4PJOD 3JB9I 1X69A 2C06A 1TU0B 1FWZA 3MP6A 2EYQA 4FU6A 2RB6A 4A4EA 4LXCA 1OOTA 3VS3A 3I35A 1U3OA 4J9EA 3S3MA 4OMFB 3OS1A 1VQLA 3ZL7C 1KC8R 1JEGA 1UJYA 2E64A 2QK0A 1C0MA 2OTLA 4X34A 5EG2A 3EG2A 4DBFA 5DM7R 2DLPA 4O5VA 1YITA 1NYGA 3QJ6A 1MGQA 3EH2A 3OYKA 4OB2B 1AEYA 2QG9B 3E9GA 4J6XA 5GAOm 2KR3A 4HT9A 1PRLC 2EYWA 1JO8A 1QVGA 4KRTA 1D09B 2BTTA 1NJIC 3OW2P 3G4SQ 1N8RU 3I5SA 2EQKA 5GAN7 3GPLA 2C0TA 4BDZA 1VQNA 3CCLT 2V26A 3QYGB 1YWOA 2A28A 3JV3A 1YHQQ 1M90U 3UPUA 5LJ3j 2ZZDA 1RACB 4E7LA 2LX9A 4EMHA 2BZYA 4M75D 2VGNA 2ENMA 1WJRA 1PCXA 3RR6A 4CRIA 4IIOA 4DBQA 2DETA 2L3SA 4J7FA 1PRMC 2QA4Q 1C6VX 5M9OA 4M78G 5A0GA 4IKFA 4J9GA 2AKLA 2HBWA 3NMZC 1OEBA 1JRIA 4MMKA 2GTJA 4IIMA 1HJDA 2NWMA 2LQWA 1ZQ1A 4FYVB 1KQ2A 3RERA 7AT1B 3PMIA 4FYYB 1IGQA 4IUQA 1H8KA 1I5LA 1VQ8A 2F5KA 3A8OB 4NOYA 1RLPC 1JXOA 5A0DA 5GMKh 2I2LA 4J9CA 4N0AC 1KC8C 2P4RA 4JS4A 1VQ6Q 3GLXA 2D9TA 3INZA 3CCVT 2DF6A 2D0QB 1WQWA 3C0CA 6AT1B 2EPDA 2F2WA 2K5FA 4OMNA 2KEAA 2DXUA 5C6SA 2ZCFB 2CKKA 1GFDA 1PKTA 3LLRA 5KE3A 2O01E 1N5ZA 2BZXA 3BFMA 2J6OA 3EFSA 2DFUA 1B34B 2RQRA 4A63B 1R77A 4M7DE 3J7AF 1RL2A 4VUBA 1X6OA 4E47A 2JT4A 1LPLA 4JRIA 3KFVA 1OX9A 4AFZC 4FYXB 4OMMA 3M0TA 4KGZB 1AT1B 4RTXA 3G1JA 3DLMA 2QGFB 3RMSA 1QP3A 1KQSA 3G7ZA 2FG0A 2JJ9A 1BK2A 3VS5A 2J7IA 2RQTA 3A8LB 5CO7A 3ME9A 1BIBA 2LC4A 5KYWA 1VQ4A 1ZX6A 2ABLA 1GBRA 2X35A 4RMOA 1VQOA 2PNIA 1SKUB 3AT1B 1YI2A 3MEAA 4F17A 2F2VA 1BKBA 1D1AA 3NHNA 2H3EB 4PFOA 5GJVB 2COWA 3CD6Q 3GIBA 2HKQB 2VYTA 1K9MC 4OVAA 2R5MA 5GMKj 2Y4YA 3WVEB 3GP8A 1D0YA 3E1SA 2JTEA 4BACA 2ZPBB 1SHGA 2FRYA 2V8JA 4A53A 2F1LA 1I4K1 4RG2A 4OB1B 3LH0A 4M7DC 2QQ9A 3JCMX 1JJ2A 1ZA2B 2KI7A 3JCMb 5LJ3g 4O6JA 3G71Q 1U1TA 3SWNC 3OS0A 2DM1A 3CMAA 1IREB 1B3QA 3JB9F 1Z9ZA 5KYYA 4KBMB 4HCKA 2R5AA 3M58A 2RD1A 1I07A 4RTUA 2LQ8A 1JBMA 5GMKl 3ZBDA 2V8IA 3S6WA 4AMCA 2CYZB 4M77F 1MMDA 1VQPA 2NUTA 3OW2A 4JJNK 4OGCA 2QDYB 3MEWA 4KGVB 4QQGA 4N4GA 2PQWA 2A3LA 1NE8A 5GAMe 5L23A 4F16A 5GAMd 5GAN6 4AFUC 3VRYA 3JRZA 5GJWB 1O75A 3DB4A 1VQ4T 3OA6A 2OX7A 3DKMA 3FIFA 3DLLA 1NYFA 4EMGA 1K73C 4XU2A 4RTTA 1M2VA 4N0AA 2RA2A 3CCMQ 3UDCA 4E7SA 3DB3A 3HFNA 2QTVA 1HYOA 4RTYA 5LJ5e 3OYBA 5LJ5d 2RF0A 1QCNA 4QVCA 2YUQA 2JMAA 1YIJQ 1ZLMA 4LDYA 1PWTA 2DVJA 2YLBA 2ZAEA 2RJEA 3HRSA 4HVUA 2IIMA 2CP0A 4D8KA 2EKHA 2KROA 2DEUA 2EJFA 3UWNA 3T9NA 5AYFA 1M2OA 4PJOG 4M77C 2LCSA 3L2RA 1WYXA 4N4HA 4GLMA 1BU1A 1PSEA 4FYWB 1W2BA 3JCMW 1I1JA 2QEXA 5KYYB 3A8HB 2E6NA 1E7OA 2L5QA 3AHUA 1D1CA 3M59A 1AHJB 3MEUA 3VU3C 1PG5B 1Q95G 3CBOA 3FLGA 4M7AB 1NLPC 3CCMT 5IHKA 2ECZA 3CXCS 4M75B 4KH0B 1JU5C 1BYMA 1VQLQ 2K57A 1TWBA 1Y7XA 1OULA 4EMKC 4M77E 5IN1A 2DXBA 1Q86R 4ZGJB 2COYA 1UHCA 8AT1B 5I21A 1IGUA 3I56Q 1D0XA 3GNFB 3MPUB 3V7CA 5FU6B 1AWXA 2JTFA 4FCYA 2O88A 3OQ5A 4NL2A 3OYLA 1IHVA 3VRZA 4C8QB 2FL7A 4JS5A 3CXCA 2VXFA 1VQ6T 5GANg 2XKOC 1GBQA 3CCQQ 2QYZA 2KMTA 2KE9A 4IUVA 2DTHA 2K7AA 1W2BP 4XTXA 3CC2Q 1YIJT 3D7SB 5GAMj 2Z0WA 4F14A 4RG8A 2M02A 2P0KA 3E2UA 4IURA 1P92A 3G71T 2CGHA 2LJ1A 2O2OA 3QUIA 1ZA1B 2EFIA 5IXBA 2L3RA 2EAYA 3O5ZA 2KBTA 1RAIB 2ZGWA 4M7AA 1NM7A 1M2VB 1A0NB 4RCBA 5HK0A 2PTKA 2X3WD 5KYWB 2BE9B 3REAB 1W70A 5FRMA 3OYFA 2NUPB 2CSQA 5KYXB 5LL6S 3I55T 4F7UF 1VQ5T 1G3WA 2ZPFB 5KYNA 1QQJA 1M3AA 5D6XA 4UC4A 3OSVA 4C8QC 2DD4A 5GANf 5CKDA 3VS4A 3CC7T 3FDRA 1KFZA 3LGFA 3SD4A 2K5LA 4L6V5 3WXMB 1C1AA 1Y96A 2QA4A 3CCRT 3OYAA 5LJ3e 2CS7A 4PJNA 1OI1A 5KYUA 4LDXA 4PLLA 3I56A 2O31A 1N9SA 3VV0A 1WHLA 3RBBB 5FLXE 4X9CA 4PLIA 1YJ9A 1VQ8Q 3EG9B 1VQLT 1KQSP 2QASA 2LX7A 2DBMA 1S72A 3CPWS 2CZ1B 1H3ZA 2M0OA 1YITT 5FW9A 1TSFA 2K5IA 3NTHA 1OYXA 1NPPA 3ASKA 2CUDA 2FO0A 1QVFA 4PJLA 3X25B 3G6EQ 3C12A 2EGAA 1ABQA 1Q82U 5LJ3h 1M4ZA 2GGRA 3BW1A 2PUOB 2G6FX 3QYHB 3C94A 2SRCA 3JB9D 1UECA 2E6ZA 2XDPA 2EQJA 2RJDA 2LMJA 2DYBA 2P4TA 3J80E 1F1BB 3THKA 4GY5A 1J3TA 3CMAQ 3TVTA 4M7AD 4DA4A 2J6KA 4JJBA 2KRMA 1K1ZA 2JM9A 2KVQG 1WHKA 3CPFA 4MZPA 3ULRB 2LNVA 3EH1A 2MYSA 2KXDA 1NJIR 3CMEA 5CKBA 4PFPA 4C8QF 3L2VA 2BZ8A 2HDAA 2QXFA 5LJ5f 3JCMc 4B9XA 3CCSA 2LVMA 4OB3B 4PJOE 2B86A 1OQKA 3P8DA 4DBRA 2J06A 4ZGEB 2FVUA 4N4IA 5FWBA 1YHQT 2A37A 2E70A 1PNJA 2GFAA 5FU7C 3HTRA 3PMTA 2E10A 1WX6A 3VS1A 3QPHA 2CH4A 5CKFA 5GAOr 4J5YA 3CCEA 1PHTA 3X24B 1Y96B 4PJOC 3CQTA 2E3HA 4WTOB 3MP8A 4II1A 2EVRA 2RHYA 1G3YA 4BI8B 2JUFA 1MNEA 2KAFA 1ZSZA 4AT1B 1UGSB 2DK3A 4C5GA 2XG8D 3QZ9B 2XDDA 1VIEA 2ZPHB 2XHCA 1Q7YC 5GAMf 2EKOA 2M51A 2GQVA 3BDLA 2YWWA 3L2QA 1JJ2S 1WXBA 4M77A 4F7UE 1IRXA 2HSEB 4JJCA 4ZGDB 5J3BA 5LJ5h 1YIJA 2F2XA 4PKCC 1D0ZA 2VGMA 1R0CB 1KHCA 2NUZA 4Y28E 5D6WA 4M78A 4DOVA 3BY7A 3VS0A 2RQVA 2DXTA 1OX8A 1T0HA 3A5ZB 2Y90A 2KSSA 3H41A 5GAN4 2XI9A 4JZ3A 4V2SA 3LYIA 2XU8A 1YI2Q 4M77D 2AZVA 4J6WA 2OTLT 3QSUA 1QVFP 1QW1A 2D6FA 4FM4B 1TG0A 2XK0A 1XTDA 1X75C 2OI3A 2J05A 3IQLA 2GTOA 2HNIA 1VOMA 2CREA 3FC3A 2VKNA 3C95A 2DMOA 4M78C 3FB9A 1VA7A 1VQ7A 1W4SA 1ZBXA 1Q7YU 2DO3A 3CCJA 3VYGA 2H8HA 1IHWA 4C92A 3NTIA 1AZEA 1UB4A 5GAOq 4F7UB 1WZOA 2K3XA 1VQNQ 2YRDA 1K9MU 1X43A 1FYNA 4M78B 1KQ1A 1PM3A 1TUDA 2VWFA 3UATA 1VQMA 4F7UG 2L2PA 1NBEB 1TOVA 1TUCA 2DILA 2A0FB 3QDRB 4LE9A 1S72Q 1G5VA 2LNHB 4AG2C 1M8MA 5GAOn 4M7DG 2H3JA 1OZ3A 4EIKA 5KCOA 1ZSZB 2JW4A 3EG9A 3NFCA 4RCCA 5KH6A 2JNGA 1YJNA 5GAN5 3MEVA 4J9HA 1M3BA 1JXMA 1QKWA 2MF2A 3OS2A 3OMCA 4A4FA 4D8DA 3V8KA 1X6GA 1KJWA 3OBYA 1AWJA 2ATCB 3A1PA 3RUXA 2V8KA 3FEOA 4Z8AA 1H3HA 5CCAA 3MJXA 3FJ5A 4KUIA 4BDYA 2WSCE 3JAME 2FRWA 2HL5C 2QGGA 2QI2A 1WI7A 2HQXA 4IUUA 3CCLQ 3CBMA 4C8QG 1MNDA 1RAEB 2YRCA 3RKWA 1WJSA 2RQWA 1Y07A 1MV0B 2K2MA 2KRNA 4F7UA 2DKGA 5GAOl 1YJ9T 2L0AA 1G83A 4J9FA 3CCJT 4PL6A 2YXYA 2ZPGB 4AFQC 4C8QA 2CT4A 3L1AA 2HZYA 1PD1A 4C0FA 1WFWA 2XD0A 4XAXB 4C8QD 4HCZA 2CT3A 4PJOB 3QIIA 1M30A 1EZZB 1VQOQ 2RI3A 3KBGA 1VQ9A 5CQXA 3UT1A 3V8JA 1TS9A 5GMKi 2DL3A 5FU7B 4A4HA 1BI1A 3G4SA 2F69A 1GCPA 2MCNA 2AK5A 1GCQC 2L3PA 1OPKA 2YUOA 5CVIA 4QQ6A 3REBB 1GCQA 4FT4A 4C92G 3URGA 2DL7A 1RI0A 1X27A 1UDLA 2E1HA 2E5KA 2K4YA 1Z9QA 3OYGA 1BI3A 2EJ9A 4JJDA 2NUTB 1KSWA 4C92E 4QVDA 1ACMB 2DPPB 2KYBA 2YUNA 5GANe 3CCUT 5GANd 2YDLA 2RJFA 3CMET 3BDUA 1N8RC 2LZ6B 4PFZA 2GFUA 3SWNA 5ECAA 1D1BA 2OTLQ 2GNCA 5CQYA 3CCUQ 1SEMA 4J9BA 2PZ1A 5DLQE 5L8RE 1M1KR 5KCHA 1H92A 1EIFA 1YJNT 3PE0A 4XQ3A 1K9MR 2QTXA 5KYUB 2RHXA 2FYKA 1UG1A 3MP1A 4OP0A 2ESWA 1VQ9T 1Q81R 1VQKT 3JCMh 3CCSQ 1T0JA 1X01A 2L3QA 2W0ZA 2CP5A 4MDWA 3EHQA 3L2ZA 3NTKA 2XDBA 2HBPA 2L8DA 5DLOA 2X51A 2HKNA 4C0DC 3H9NA 3H8ZA 2VXEA 1OZ2A 4MZTA 2R57A 4FT2A 4XK8E 2RK1A 1XNIA 1RABB 1G3TA 3CCJQ 2B8AA 3PT9A 4M75A 3S3OA 4LD9K 3PTAA 2DRMA 1YI2T 2CZ7B 5LJ5g 2YUPA 3UA6A 3PVLA 2DTIA 1QKXA 2LQKA 4PJOA 2EW3A 4LDWA 1AWWA 5GAOp 4DBHA 2XIDA 1GRIA 2PU9B 1SRMA 2VUBA 3VKIA 2MK5A 4M4ZA 2ED0A 4XTVA 3OYJA 5LJ5j 1BI2A 1M9SA 1FMVA 2JMCA 2EQMA 1YJWT 1RAGB 1GL5A 5IXFA 3TQ7P 2BE7D 3CC4T 1YFNA 3QZ5B 3SFMA 3UA7A 3EFRA 5A2QE 1WA7A 3ZFJA 2CP6A 2VB6A 1UGQB 2EYZA 1K9AA 2JZ2A 5GAMg 4XTWA 4R56A 1M3CA 2D0NA 5I2MA 1IZ6A 4BE2A 2HCKA 2JTMA 3QHSA 3P8BB 1KQSS 1X6BA 4J7IA 1UEBA 1WJQA 4QQDA 4DQ2A 1LCKA 1I81A 1WHHA 5CAIA 2RJCA 2YRVA 1YITQ 2FZGB 4BI3A 2K2VA 1G8XA 2RQUA 3H0IA 5IAYA 4ESRA 4FL6A 3QWYA 4BE0A 2O9SA 1DJ7B 4M78D 3MCAB 2DERA 2X4YA 1IO6A 4EMKB 2JS2A 3PGGA 4LNPA 1AVZC 2EWNA 1M1KU 2MAMA 1QLYA 3EFOB 1W6XA 3G71A 1PKSA 4GBQA 2X4XA 3MO8A 2RPNA 3CMAT 3OYDA 3M4YA 2AT1B 2LJ3A 2P84A 3JCMJ 5DY9A 2X3XD 4ZNXA 1K8AU 2QQBA 2GF7A 3M0RA 4C5IA 4C5EA 1OU8A 4HT8A 4E6RA 1CKAA 3CC7Q 3LW5E 1KC8U 1Y71A 1VQ5A 1GXIE 5FWCA 2OTJT 3HKSA 3E9FA 4Z02A 4QVZA 4M7AG 2RM4A 1M1FA 3TEEA 5CIUA 2P0QA 5CKHA 1KIKA 2COZA 1M27C 2QQAA 3X28B 2VVKA 1G3SA 1G2BA 1X2QA 5HCKA 2K6DA 1VQ7T 1VIFA 4MMLA 1VQ4Q 4F04B 3OYNA 4OMQA 4AG1C 1KD1R 2RHUA 2AKKA 4A54A 3HPWA 1VYTA 5GAMh 1N8RR 3R6NA 2FPFA 1LOJA 1HSQA 2QEXQ 2QAZA 4NS5A 1AD5A 4ZN3A 2VASA 4MDXA 1U06A 4NL3A 1M90C 4HA8A 1WXUA 4Z89A 2NYSA 1VQMT 1K8AR 2KT1A 3JCMg 4R55A 3OYMA 1O9SA 2F5TX 3M0PA 4ME7A 3M4GA 3KXTA 1K4US 4DEXA 2JM8A 2QQRA 1VQMQ 2EGCA 4PK4A 4RKUE 2K9GA 5LJ3f 2LCLA 1SHFA 2RH2A 8ATCB 4PNOA 5GMKe 3I55Q 4E7HA 1RAAB 3EGDB 3P8HA 4KT0E 2HEQA 4JLIA 1VQKA 1H641 3TREA 2XICA 4HCCA 3RMQA 1E6GA 3M56A 3CCUA 1LVKA 3CCMA 2PVOB 3SWNB 5CK9A 3PIOA 1SPKA 5HKCA 4BB7A 3A8MB 1LNXA 1AZGB 1NG2A 1M8VA 2X4JA 1UGRB 1TTHB 4FW2A 4M7DB 3V7RA 1MUZA 3H0HA 3NPFA 5GANh 4A4KA 3CD6T 2RI2A 3G6EA 1WPYA 1OPLA 4BY6B 3OS5A 2DTOA 3JCMV 2D8JA 3GOXA 3META 3VUZA 1ZUKA 1PSFA 2FHDA 2FZKB 1WHMA 4LDVA 1QP2A 4KULA 1Q7YR 3N5BB 1YN8A 2HAXA 1SRLA 3CPWA 1YHQA 1I5OB 1K8AC 3HP9A 1ZHIA 2M1HA 4J9DA 4LN2A 1QVFS 1EFNA 1ZUUA 1ZBJA 1FXXA 3I56T 2MWOA 3SHWA 4KH1B 5IHIA 4ELYC 1M1GA 1QCFA 4LUDA 4X1VA 3VJPA 2OAWA 3CCQA 1JB0E 1VQ8T 1KD1U 1BI0A 2OAUA 3QXEB 1T3LA 1VYVA 4TVRA 2CP3A 1U8RA 1UE9A 2XMFA 1IB8A 2KY9A 4FSSA 1RI9A 2LJ0A 1KHIA 1MV3A 2NLUA 5J26A 2YSQA 1KK7A 4OF1A 3CCRQ 3QWXX 4ANJA 2ED1A 3PFSA 2CUBA 2EIFA 4P5NA 4E2FB 4JUVA 2LCCA 4YTLA 5EC7A 1RAHB 4RTVA 1YCSB 2C0IA 4AFSC 3CCRA 2EQUA 1V1CA 1YWPA 2MOXA 3H6ZA 3QG1A 1VQ5Q 4L59A 1W2BS 1NPRA 2IVWA 3EGDA 1HK9A 1M90R 1UHFA 5GAN3 4XTYA 3EGXA 4JRKA 3TSZA
chains in the Genus database with same CATH topology
2DPPB 2L3RA 2EAYA 3EAEA 5GANe 4XU1A 3CCUT 4M7AE 5GANd 2RJFA 3CMET 4X9DA 3CBPA 3BDUA 1N8RC 4M7AC 2RI5A 2ZGWA 1R8OB 4EPCA 2LT4A 4J83A 4M7AA 2GFUA 2LRQA 2LT1A 3SWNA 3OB9A 5HY6A 4M7DF 2QQSA 4RCBA 5HK0A 5CQYA 3L42A 3R6OA 2WACA 4B9WA 3M9QA 5DLQE 5FRNA 4BUGA 5L8RE 5KCHA 3HFOA 1EIFA 1N27A 2RK2A 5FROA 4ZTFA 4M77B 5FRMA 3OYFA 1YJNT 4EDUA 4XQ3A 1HXDA 2O4XB 3I55T 1QVPA 2BUDA 2QTXA 3A8GB 5LL6S 4CI0C 4F7UF 3LWHA 3G6ET 1FX7A 3E19A 2DZCA 4DOWA 1Q81U 1N9RA 2RHXA 4C92E 3L2UA 2FYKA 1VQ5T 4PJOD 3JB9I 3CC2T 1G3WA 3M54A 4FSXA 2ZPFB 4MZMA 5D6XA 4OGEA 3OSVA 3QBYA 2DD4A 3MP1A 4UC4A 4OP0A 4C8QC 5CKDA 5GANf 2C06A 1FWZA 3MP6A 2EYQA 3QO3A 4FU6A 1VQ9T 2AHJB 3CC7T 3JB9G 2RB6A 3FDRA 3LGFA 3SD4A 4A4EA 3CCQT 1VQKT 2RHIA 2MMPA 3JCMh 2DEQA 3S3MA 2K5LA 4L6V5 3WXMB 1VQ6A 1X01A 4OMFB 3OS1A 1Y96A 1VQLA 2QA4A 2E64A 4MDWA 2OTLA 4X34A 3L2ZA 5EG2A 3NTKA 3CCRT 2XDBA 3OYAA 5LJ3e 2CS7A 2HBPA 2L8DA 5DLOA 5DM7R 4O5VA 1YITA 2JN0A 2RHZA 4C0DC 1OI1A 3VUBA 4C0ZA 3QJ6A 1MGQA 4LDXA 2VC8A 4PLLA 5IT9E 3I56A 2QEXT 3H8ZA 2VXEA 4OB2B 3OYKA 1N9SA 1OZ2A 3VV0A 4MZTA 3TU4K 4M7DD 2R57A 4FT2A 4Y91A 1WNLA 5FLXE 3JCMf 3E9GA 4FIBA 4J6XA 4PLIA 2RK1A 4X9CA 4XK8E 5GAOm 1YJ9A 3GNGA 4HT9A 2HD0A 1VQLT 4IUTA 1XNIA 3Q1JA 1G3TA 3CCST 1S72A 2B8AA 3PT9A 2MWPA 3CPWS 2CZ1B 2YLCA 1H3ZA 4M75A 1QVGA 3S3OA 4LD9K 3PTAA 1YI2T 1NJIC 2CZ7B 2M0OA 5LJ5g 1YITT 2DTIA 3TCJA 1VUBA 1YJWA 2K5IA 2LQKA 3NTHA 1OYXA 1NPPA 4LDWA 4PJOA 3ASKA 2RO0A 2A7YA 4M75E 2DAQA 1N8RU 3HRTA 1QVFA 2EQKA 5GAN7 3GPLA 3X25B 5GAOp 3C12A 4BDZA 3CCLT 1VQNA 3QYGB 2XIDA 1Q82U 5LJ3h 1M90U 1M4ZA 3JB9J 3JSCA 5LJ3j 2ZZDA 3BW1A 3UPUA 3V8LA 3CC2A 2PU9B 2PUOB 4E7LA 2LX9A 3QYHB 2O4XA 3C94A 2WSEE 4EMHA 2VUBA 3JB9D 3VKIA 2VGNA 2E6ZA 3GF5A 1WJRA 2XDPA 2EQJA 1YCYA 3O8VA 2RJDA 4M75D 4XTVA 4BY6C 4CRIA 1KG1A 4C0GA 2LDMA 3F70A 3OYJA 4J7FA 5LJ5j 1BI2A 2P4TA 4L5GA 1M9SA 5M9OA 3J80E 2EQMA 4M78G 5A0GA 1YJWT 4GY5A 4IKFA 3CC4T 4M7AD 3SFMA 3QZ5B 5HK3A 4DA4A 1JRIA 5C0MA 4MMKA 3EFRA 5A2QE 3CCLA 4M7DA 3LGLA 3LWIA 3WVDB 2KVQG 3CPFA 3ZFJA 4MZPA 3QJYA 1ZQ1A 2LNVA 1KQ2A 3JB9H 3RERA 1UGPB 3PMIA 3OYEA 4XU3A 4IUQA 3CMEA 4M75F 2JVVA 1UGQB 5CKBA 1I5LA 1VQ8A 2F5KA 3A8OB 4J8OA 4NOYA 5A0DA 5GMKh 2I2LA 2JZ2A 3VYHB 4BD3A 4C8QF 3L2VA 2QA4T 5GAMg 4N0AC 4XTWA 1KC8C 2QXFA 5LJ5f 4JS4A 3JCMc 4B9XA 3CCSA 3GLXA 4R56A 2LVMA 3C4SA 4OB3B 3MHXA 3ZEHA 4PJOE 3P8DA 5I2MA 4XTUA 2FVUA 1IZ6A 2D9TA 4ZGEB 4BE2A 3INZA 1VQPT 5GAN8 3CCVT 3QKJA 4N4IA 2JTMA 3QHSA 3P8BB 1KQSS 2D0QB 1YHQT 1WQWA 4KUDK 2E70A 2GFAA 2DD5A 4J7IA 1UEBA 5FU7C 1WJQA 4LDUA 4QQDA 4DQ2A 4EMKA 5J39A 1I81A 3G4ST 2EJGA 4IUPA 3PMTA 5CKEA 2E10A 2K5FA 2R58A 5CAIA 2RJCA 3QPHA 3OYCA 2DJZA 2DXUA 2YRVA 5CKFA 2ZCFB 2CKKA 4J5YA 4BI3A 5C6SA 3CCEA 5GAOr 3OYHA 3LLRA 2K2VA 3X24B 1Y96B 5KE3A 4PJOC 2O01E 5IAYA 4FL6A 3BFMA 3EFSA 3MP8A 1B34B 4BE0A 4II1A 1DJ7B 3MCAB 4M78D 1Q81C 2X4YA 4M7DE 3J7AF 1RL2A 2RHYA 1X6OA 4VUBA 1Q82C 4E47A 1G3YA 4BI8B 3OMGA 4EMKB 3PIPA 2JUFA 2KAFA 4JRIA 3SDZA 3HHTB 1D3BB 3PGGA 2KK4A 1UGSB 2EWNA 2MAMA 3HL8A 4M77G 1M1KU 3JCMd 2L89A 2DK3A 2E65A 2M16A 3G71A 4PJOF 2CZ6B 4C5GA 4C92C 2XG8D 2LTOA 3CEYA 3QZ9B 1VIEA 2X4XA 2ZPHB 3MO8A 2XHCA 2XDDA 3CMAT 3OYDA 3DLMA 1Q7YC 4E7IA 5GAMf 2EKOA 3M4YA 2GQVA 3RMSA 3BDLA 1QP3A 1KQSA 1BIAA 2PVDB 3L2QA 2IG0A 3G7ZA 3JCMJ 3M55A 1I8FA 5DY9A 3HRUA 1JJ2S 1K8AU 4M77A 4F7UE 3A8LB 2GCXA 3OBWA 5CO7A 4ZGDB 3ME9A 1BIBA 2LC4A 5J3BA 2QQBA 2PUKB 2GF7A 4C5IA 4GLKA 4C5EA 5LJ5h 1VQ4A 4HT8A 2X35A 3RKXA 4RMOA 3KUFA 1VQOA 3LW5E 1YIJA 3OSSC 1KC8U 1Y71A 1YI2A 5GANj 3MEAA 4PKCC 1VQ5A 2VGMA 2OTJT 1GXIE 1Q86C 3HKSA 1KHCA 4DOVA 4Y28E 1BKBA 2PVGB 3E9FA 1LJOA 4M78A 5D6WA 4Z02A 3BY7A 4QVZA 4M7AG 2RM4A 1XQHA 1M1FA 3TEEA 2DXTA 5CIUA 1QVGS 3A5ZB 2Y90A 3OW2S 4HCBA 2P0QA 2KSSA 4WF2A 5CKHA 3GIBA 2VYTA 5GAN4 1K9MC 2XI9A 3V7SA 4OVAA 2QQAA 4V2SA 3LYIA 2XU8A 3X28B 4M77D 4C8QE 2WSFE 4ZN1A 2YHTA 2R5MA 1G3SA 4J6WA 5GMKj 2OTLT 2Y4YA 3WVEB 3QSUA 3OYIA 3GP8A 3E1SA 4BACA 2ZPBB 1VQ7T 1VIFA 1QW1A 2V8JA 4A53A 5GMKm 2D6FA 1I4K1 4LD6A 4MMLA 4RG2A 4FM4B 2XK0A 3OYNA 2OTJA 4OB1B 1XTDA 3LH0A 4QVDA 5CR2A 2RHUA 4M7DC 1X75C 2G3RA 4HKEA 3HPWA 4A54A 2QQ9A 3JCMX 1JJ2A 5GAMh 1Q86U 3M53A 1LOJA 4M75G 3JCMb 3I55A 4NS5A 5LJ3g 3OY9A 4M75C 4O6JA 2CZ0B 2HNIA 4ZN3A 4MDXA 4NL3A 1M90C 1U1TA 4HA8A 3SWNC 3FC3A 3OS0A 2DXCA 3FJPA 3CCET 2BKDN 3C95A 4M78C 3CMAA 1IREB 3FB9A 4JLGA 3JCMP 3JB9F 1VQMT 1VQ7A 1W4SA 4KBMB 4R55A 3JCMg 3OYMA 1ZBXA 1Q7YU 1O9SA 2F5TX 3PNWC 2R5AA 2DO3A 4C92D 3M58A 4ME7A 2RD1A 1MHNA 3CCJA 2LQ8A 1JBMA 2E41A 3M4GA 4QW2A 3ZBDA 5GMKl 3KXTA 3CC7A 2V8IA 3VYGA 2QQRA 2DIQA 4RKUE 3S6WA 2DVEA 4C92A 5LJ3f 3NTIA 2LCLA 2CYZB 4M77F 4J6YA 1VQPA 2RH2A 3OW2A 4JJNK 4PNOA 4OGCA 1UB4A 2QDYB 3MEWA 4F7UB 5GMKe 5GAOq 4E7HA 3P8HA 4QQGA 2M9UA 4KT0E 2K3XA 3RESA 4JLIA 1K9MU 3CD6A 1VQKA 4N4GA 1H641 2PQWA 2A3LA 2XICA 3TREA 1NE8A 4HCCA 3M56A 1KQ1A 2BIVA 4M78E 4M78B 3RMQA 5GAMe 5GAMd 3CCUA 1VQMA 4F7UG 3CCMA 5GAN6 2PVOB 3SWNB 5CK9A 4M7AF 3JRZA 1O75A 3DB4A 4C92F 3PIOA 1VQ4T 2X4WA 3X26B 3OA6A 5HKCA 4BB7A 4ELZC 3DKMA 3A8MB 3FIFA 1LNXA 3QDRB 3DLLA 1G5VA 4EMGA 2VV5A 1K73C 1M8VA 5GAOn 4M7DG 2H3JA 1OZ3A 5I2SA 2X4JA 4XU2A 1UGRB 4N0AA 5LJ3d 4M7DB 2RA2A 3V7RA 5KCOA 3UDCA 1D3BA 3NFCA 4RCCA 3CC4A 4BI4A 5KH6A 2JNGA 5GANh 4JRPA 3JCMe 1YJNA 3DB3A 3HFNA 4A4KA 3CD6T 3JCMQ 3MEVA 5LJ5e 5GAN5 2RI2A 3OYBA 2KQWA 5LJ5d 3G6EA 4ZTJA 2MF2A 3M57A 3OS2A 3ER0A 1WPYA 4QVCA 4BY6B 3OS5A 3CCVA 2DTOA 3JCMV 3OMCA 3S3NA 4A4FA 3GOXA 3META 4LDYA 3VUZA 5D6YA 2YLBA 3V8KA 1M1KC 1PSFA 2FHDA 2RJEA 3OBYA 1M5Q1 3HRSA 4LDVA 4OB0B 1QP2A 4KULA 3RUXA 1V29B 1YBYA 3N5BB 2EJFA 2HAXA 2V8KA 3UWNA 3T9NA 1WGSA 3FEOA 5AYFA 5GAN2 3CPWA 1TH7A 1SSFA 4Q5WA 5CCAA 4PJOG 4M77C 3L2RA 1YHQA 4KUIA 2K3YA 4N4HA 4BDYA 2WSCE 3JAME 4E7KA 3HP9A 1K8AC 1PSEA 2QI2A 2HQXA 4A4GA 1N6AA 1ZHIA 3JCMW 1VQOT 1W2BA 4IUUA 2M1HA 3CBMA 4C8QG 1QVFS 3RIRA 1FXXA 3I56T 2E12A 2MWOA 3A8HB 2QEXA 4BE1A 2E6NA 3RKWA 2L5QA 4C5HA 1WJSA 1Y07A 3AHUA 4ELYC 3M59A 1AHJB 1B34A 1M1GA 3MEUA 3VU3C 1NJIU 3CBOA 3FLGA 4M7AB 4F7UA 1NZ9A 2DKGA 3OYYA 5GAOl 1YJ9T 3CCMT 4E7JA 4C92B 3CXCS 3CCJT 4M75B 3VJPA 1S72T 1BYMA 3SB2A 2K57A 4PL6A 2JOYA 3CCQA 4JRQA 1JB0E 2ZPGB 1VQ8T 1Y7XA 4C0DB 1KD1U 4C8QA 3X20B 3L1AA 4EMKC 1BI0A 2OAUA 4M77E 4C0FA 5IN1A 2DXBA 3QXEB 2XD0A 4TVRA 1U8RA 4XAXB 4C8QD 4ZGJB 4HCZA 4D6WA 4XU0A 1U1SA 2KY9A 5I21A 4PJOB 1VQNT 3QIIA 3GNFB 3V7CA 1WQ7A 5FU6B 2FB7A 3RKYA 1KHIA 2JTFA 2Y4XA 2NLUA 3OQ5A 5J26A 4NL2A 3OYLA 4OF1A 1K73U 4XTZA 2RI3A 2E5QA 3KBGA 1VQ9A 4C8QB 3FRNA 5CQXA 2P0PA 3UT1A 3V8JA 3M5AA 4JDSA 3PFSA 5GMKi 3LX7A 2FL7A 2EIFA 4P5NA 4JS5A 5FU7B 4A4HA 3CXCA 1BI1A 3G4SA 2F69A 2VXFA 4JUVA 5GANg 2XKOC 2LCCA 1VQ6T 4YTLA 5FU6C 3L2WA 5KE2A 1XOVA 5A0LA 1KD1C 2KMTA 5CVIA 4IUVA 4QQ6A 3CCRA 2DTHA 4FT4A 2EQUA 4C92G 3URGA 4ATOA 2DZ9A 4XTXA 1RI0A 2HQEA 1YIJT 5GAMj 3H6ZA 3QG1A 4RG8A 2E1HA 2P0KA 2K4YA 4L59A 3J81E 1W2BS 1NPRA 2IVWA 2KDSA 4IURA 1HK9A 1P92A 3OYGA 1BI3A 2EJ9A 2ZPIB 5GAN3 2CGHA 4XTYA 3QUIA 3G71T 4M78F 3HSBA 2ZPEB 2DIGA 4JRKA 2MI6A 2EFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZHI A;  2FL7 A;  4LD9 K;  1W4S A;  3PTA A;  4DOW A;  1ZBX A;  4DOV A;  4FSX A;  4FT4 A;  3TU4 K;  4DA4 A;  4BB7 A;  4FT2 A;  4KUL A;  2FVU A;  1M4Z A;  4JJN K;  4KUD K;  4KUI A;  3PT9 A; 
#chains in the Genus database with same CATH topology
 4XU1 A;  4X9D A;  1FMK A;  2RI5 A;  3A98 A;  4J83 A;  2LT1 A;  1NLO C;  1UJ0 A;  3OB9 A;  2QQS A;  3L42 A;  3M9Q A;  5FRN A;  3EGU A;  3HFO A;  2RK2 A;  1N27 A;  3EG0 A;  5FRO A;  2MPX C;  4EDU A;  1HXD A;  2O4X B;  3GBQ A;  1JQQ A;  1QVP A;  4CI0 C;  4BE1 A;  1QWF A;  3E19 A;  1Q81 U;  3L2U A;  3CC2 T;  3M54 A;  4FSX A;  4MZM A;  4OGE A;  3QBY A;  4RTZ A;  1BBZ A;  3QO3 A;  2AHJ B;  3JB9 G;  3CCQ T;  4E7Z A;  2RHI A;  2MMP A;  2A08 A;  3EG3 A;  2DEQ A;  1VQ6 A;  1QVG P;  4HXJ A;  4WCI A;  1JJ2 P;  1ZSZ C;  1T3S A;  2JN0 A;  2RHZ A;  3VUB A;  4C0Z A;  2VC8 A;  5IT9 E;  1Y57 A;  2QEX T;  2E3I A;  1SG5 A;  2FEI A;  3TU4 K;  4M7D D;  4Y91 A;  1WNL A;  3JCM f;  4FIB A;  1I0C A;  3GNG A;  2HD0 A;  2KT8 A;  4IUT A;  2DL5 A;  3Q1J A;  3CCS T;  2MWP A;  2YLC A;  5D7U A;  1VQ9 Q;  3TCJ A;  1VUB A;  2KGT A;  1YJW A;  5I22 A;  4M75 E;  2RO0 A;  2A7Y A;  2DAQ A;  3HRT A;  9ATC B;  2OTJ Q;  3JB9 J;  3JSC A;  3V8L A;  3CC2 A;  2DL8 A;  1SF9 A;  2O4X A;  2WSE E;  3GF5 A;  3O8V A;  1YCY A;  4BY6 C;  1ZSG A;  4C0G A;  2LDM A;  3F70 A;  4L5G A;  5KYX A;  2CSI A;  2GBQ A;  5I11 A;  5HK3 A;  4OMO A;  5C0M A;  3CME Q;  4Z88 A;  4CC7 A;  3CCL A;  4M7D A;  2KYM A;  3LGL A;  3LWI A;  3WVD B;  5IHN A;  1WIE A;  3H0F A;  3QJY A;  3JB9 H;  2CDT A;  1UGP B;  3OYE A;  4XU3 A;  1FMW A;  1RAF B;  4M75 F;  2JVV A;  3CC4 Q;  4J8O A;  3VYH B;  4BD3 A;  4ORZ A;  2QA4 T;  2HQH A;  1MMN A;  1GFC A;  1XJW B;  3LH5 A;  2SEM A;  3C4S A;  1UTI A;  3MHX A;  1WHJ A;  3ZEH A;  1WLP B;  4XTU A;  2CH4 W;  1VQP T;  5GAN 8;  3QKJ A;  1AWO A;  2NUP A;  2GQI A;  4KUD K;  2DD5 A;  4LDU A;  4EMK A;  5J39 A;  1WHG A;  3G4S T;  2EJG A;  4IUP A;  5CKE A;  2R58 A;  3OYC A;  2DJZ A;  3OYH A;  1K73 R;  2J6F A;  1IXD A;  2JS0 A;  4PJJ A;  1Q81 C;  2RMO A;  1R0B G;  1KG1 A;  2EBP A;  3QDF A;  1Q82 C;  2QDL A;  1SSH A;  4OMP A;  3OMG A;  1YJ9 Q;  3PIP A;  1UFF A;  3SDZ A;  3HHT B;  1D3B B;  2D1X A;  2KK4 A;  2HL3 A;  4M77 G;  3HL8 A;  4JZ4 A;  3JCM d;  2L89 A;  2E65 A;  2M16 A;  4Y92 A;  4PJO F;  2V1Q A;  2CZ6 B;  4C92 C;  2LTO A;  3CEY A;  1RLQ C;  1TUG B;  2FZC B;  1YJW Q;  1BIA A;  2PVD B;  2IG0 A;  3M55 A;  1I8F A;  4RUG A;  3HRU A;  1VQ7 Q;  1OU9 A;  2OJ2 A;  2MIO A;  2GCX A;  3OBW A;  2DL4 A;  2DRK A;  2KNB B;  2X9H A;  2DYI A;  2PUK B;  4GLK A;  1QCO A;  3RKX A;  2EYY A;  3KUF A;  1WXT A;  3OSS C;  5GAN j;  2D8H A;  1QMC A;  1Q86 C;  4E7I A;  1B07 A;  2PVG B;  1LJO A;  2DBK A;  3I5R A;  1VYU A;  1XQH A;  2LQN A;  3EFO A;  1QVG S;  4HCB A;  1RUW A;  3OW2 S;  1EX4 A;  1YNZ A;  4WF2 A;  3V7S A;  4C8Q E;  2WSF E;  4ZN1 A;  2YHT A;  3OYI A;  1BCM A;  4B6M A;  1MMG A;  1S1N A;  2RNA A;  2A36 A;  5GMK m;  4LD6 A;  1HD3 A;  2OTJ A;  5CR2 A;  3M0U A;  2G3R A;  4HKE A;  4HVV A;  4OML A;  1RAD B;  1Q86 U;  3M53 A;  4M75 G;  3I55 A;  3OY9 A;  4M75 C;  2CZ0 B;  1Q82 R;  2DA9 A;  1ABO A;  2DXC A;  3FJP A;  3CCE T;  1K0S A;  2BKD N;  4K11 A;  4JLG A;  3JCM P;  2YT6 A;  3MKD A;  2JXB A;  2AIR B;  1QWE A;  3PNW C;  4C92 D;  4DEY A;  1MHN A;  2E41 A;  4QW2 A;  3CC7 A;  2DIQ A;  2DVE A;  1YP5 A;  2LP5 A;  4J6Y A;  2I0N A;  2M9U A;  3RES A;  3CD6 A;  3CCV Q;  4M78 E;  2BIV A;  4J9I A;  3M0Q A;  1NEG A;  4M7A F;  5AT1 B;  4RTW A;  2M0Y A;  4C92 F;  2X4W A;  2DNU A;  3X26 B;  4ELZ C;  2VV5 A;  1X2K A;  4PJM A;  4LUE A;  5I2S A;  2EQI A;  3I9Q A;  4CC3 A;  4CC2 A;  2O9V A;  3VS2 A;  5LJ3 d;  1W1F A;  3U23 A;  1CKB A;  1D3B A;  3CC4 A;  1NEB A;  4BI4 A;  1BCO A;  4JRP A;  3JCM e;  3JCM Q;  3RDV A;  2KQW A;  3VS7 A;  4ZTJ A;  3NGP A;  3M57 A;  3CPW P;  3ER0 A;  3CCV A;  3M0S A;  3S3N A;  3PVQ A;  2K3B A;  5D6Y A;  1M1K C;  4OB0 B;  1M5Q 1;  3BE3 A;  1V29 B;  1YBY A;  1E6H A;  5GAN 2;  1WGS A;  1TH7 A;  3EHR A;  1SSF A;  4Q5W A;  2K3Y A;  2DX1 A;  4E7K A;  1VQO T;  4A4G A;  1N6A A;  4FW1 A;  1UGV A;  1CSK A;  3RIR A;  2E12 A;  1MMA A;  3CXC P;  4C5H A;  1B34 A;  1NJI U;  1Y0M A;  1NZ9 A;  3OYY A;  3EG1 A;  4KGX B;  4C92 B;  1ZUY A;  2C0O A;  4E7J A;  2K79 A;  1V76 A;  1S72 T;  3SB2 A;  2JOY A;  4QT7 A;  4JRQ A;  3SEM A;  4C0D B;  1PC0 A;  3X20 B;  2KXC A;  2ROT A;  5IH2 A;  1TXQ A;  2CP7 A;  3RNJ A;  4D6W A;  4XU0 A;  1U1S A;  2IPO B;  4HVW A;  1VQN T;  1B7T A;  1U5S A;  2FPE A;  1WQ7 A;  3RKY A;  2FB7 A;  2HMA A;  2Y4X A;  3EGX B;  3UF4 A;  3TSW A;  1K73 U;  4XTZ A;  2KRS A;  1VQP Q;  2E5Q A;  2EYX A;  3FRN A;  2P0P A;  3M5A A;  4JDS A;  3LX7 A;  5FU6 C;  2RN8 A;  3L2W A;  1VQK Q;  2EGE A;  2HSP A;  5KE2 A;  1XOV A;  5A0L A;  1KD1 C;  1WDX A;  1OV3 A;  4ATO A;  2DZ9 A;  2HQE A;  3VS6 A;  3CCE Q;  3J81 E;  2KDS A;  1YJN Q;  2ZPI B;  2CP2 A;  4M78 F;  3HSB A;  2ZPE B;  2DIG A;  2MI6 A;  1PD0 A;  1BB9 A;  3EAE A;  4M7A E;  1UUE A;  2V1R A;  3CBP A;  1ARK A;  2AZS A;  4M7A C;  1K76 A;  1R8O B;  4EPC A;  2LT4 A;  2FPD A;  1K0X A;  2LRQ A;  2DJQ A;  2ROL A;  5HY6 A;  2E4H A;  4M7D F;  4R0K A;  3R6O A;  2DE0 X;  2WAC A;  2W10 A;  4B9W A;  1AOJ A;  4BUG A;  4ZTF A;  4M77 B;  4QKU A;  4CC4 B;  4JPB W;  3LWH A;  2BUD A;  3A8G B;  3G6E T;  1FX7 A;  2DZC A;  4DOW A;  1N9R A;  4PJO D;  3JB9 I;  1X69 A;  2C06 A;  1TU0 B;  1FWZ A;  3MP6 A;  2EYQ A;  4FU6 A;  2RB6 A;  4A4E A;  4LXC A;  1OOT A;  3VS3 A;  3I35 A;  1U3O A;  4J9E A;  3S3M A;  4OMF B;  3OS1 A;  1VQL A;  3ZL7 C;  1KC8 R;  1JEG A;  1UJY A;  2E64 A;  2QK0 A;  1C0M A;  2OTL A;  4X34 A;  5EG2 A;  3EG2 A;  4DBF A;  5DM7 R;  2DLP A;  4O5V A;  1YIT A;  1NYG A;  3QJ6 A;  1MGQ A;  3EH2 A;  3OYK A;  4OB2 B;  1AEY A;  2QG9 B;  3E9G A;  4J6X A;  5GAO m;  2KR3 A;  4HT9 A;  1PRL C;  2EYW A;  1JO8 A;  1QVG A;  4KRT A;  1D09 B;  2BTT A;  1NJI C;  3OW2 P;  3G4S Q;  1N8R U;  3I5S A;  2EQK A;  5GAN 7;  3GPL A;  2C0T A;  4BDZ A;  1VQN A;  3CCL T;  2V26 A;  3QYG B;  1YWO A;  2A28 A;  3JV3 A;  1YHQ Q;  1M90 U;  3UPU A;  5LJ3 j;  2ZZD A;  1RAC B;  4E7L A;  2LX9 A;  4EMH A;  2BZY A;  4M75 D;  2VGN A;  2ENM A;  1WJR A;  1PCX A;  3RR6 A;  4CRI A;  4IIO A;  4DBQ A;  2DET A;  2L3S A;  4J7F A;  1PRM C;  2QA4 Q;  1C6V X;  5M9O A;  4M78 G;  5A0G A;  4IKF A;  4J9G A;  2AKL A;  2HBW A;  3NMZ C;  1OEB A;  1JRI A;  4MMK A;  2GTJ A;  4IIM A;  1HJD A;  2NWM A;  2LQW A;  1ZQ1 A;  4FYV B;  1KQ2 A;  3RER A;  7AT1 B;  3PMI A;  4FYY B;  1IGQ A;  4IUQ A;  1H8K A;  1I5L A;  1VQ8 A;  2F5K A;  3A8O B;  4NOY A;  1RLP C;  1JXO A;  5A0D A;  5GMK h;  2I2L A;  4J9C A;  4N0A C;  1KC8 C;  2P4R A;  4JS4 A;  1VQ6 Q;  3GLX A;  2D9T A;  3INZ A;  3CCV T;  2DF6 A;  2D0Q B;  1WQW A;  3C0C A;  6AT1 B;  2EPD A;  2F2W A;  2K5F A;  4OMN A;  2KEA A;  2DXU A;  5C6S A;  2ZCF B;  2CKK A;  1GFD A;  1PKT A;  3LLR A;  5KE3 A;  2O01 E;  1N5Z A;  2BZX A;  3BFM A;  2J6O A;  3EFS A;  2DFU A;  1B34 B;  2RQR A;  4A63 B;  1R77 A;  4M7D E;  3J7A F;  1RL2 A;  4VUB A;  1X6O A;  4E47 A;  2JT4 A;  1LPL A;  4JRI A;  3KFV A;  1OX9 A;  4AFZ C;  4FYX B;  4OMM A;  3M0T A;  4KGZ B;  1AT1 B;  4RTX A;  3G1J A;  3DLM A;  2QGF B;  3RMS A;  1QP3 A;  1KQS A;  3G7Z A;  2FG0 A;  2JJ9 A;  1BK2 A;  3VS5 A;  2J7I A;  2RQT A;  3A8L B;  5CO7 A;  3ME9 A;  1BIB A;  2LC4 A;  5KYW A;  1VQ4 A;  1ZX6 A;  2ABL A;  1GBR A;  2X35 A;  4RMO A;  1VQO A;  2PNI A;  1SKU B;  3AT1 B;  1YI2 A;  3MEA A;  4F17 A;  2F2V A;  1BKB A;  1D1A A;  3NHN A;  2H3E B;  4PFO A;  5GJV B;  2COW A;  3CD6 Q;  3GIB A;  2HKQ B;  2VYT A;  1K9M C;  4OVA A;  2R5M A;  5GMK j;  2Y4Y A;  3WVE B;  3GP8 A;  1D0Y A;  3E1S A;  2JTE A;  4BAC A;  2ZPB B;  1SHG A;  2FRY A;  2V8J A;  4A53 A;  2F1L A;  1I4K 1;  4RG2 A;  4OB1 B;  3LH0 A;  4M7D C;  2QQ9 A;  3JCM X;  1JJ2 A;  1ZA2 B;  2KI7 A;  3JCM b;  5LJ3 g;  4O6J A;  3G71 Q;  1U1T A;  3SWN C;  3OS0 A;  2DM1 A;  3CMA A;  1IRE B;  1B3Q A;  3JB9 F;  1Z9Z A;  5KYY A;  4KBM B;  4HCK A;  2R5A A;  3M58 A;  2RD1 A;  1I07 A;  4RTU A;  2LQ8 A;  1JBM A;  5GMK l;  3ZBD A;  2V8I A;  3S6W A;  4AMC A;  2CYZ B;  4M77 F;  1MMD A;  1VQP A;  2NUT A;  3OW2 A;  4JJN K;  4OGC A;  2QDY B;  3MEW A;  4KGV B;  4QQG A;  4N4G A;  2PQW A;  2A3L A;  1NE8 A;  5GAM e;  5L23 A;  4F16 A;  5GAM d;  5GAN 6;  4AFU C;  3VRY A;  3JRZ A;  5GJW B;  1O75 A;  3DB4 A;  1VQ4 T;  3OA6 A;  2OX7 A;  3DKM A;  3FIF A;  3DLL A;  1NYF A;  4EMG A;  1K73 C;  4XU2 A;  4RTT A;  1M2V A;  4N0A A;  2RA2 A;  3CCM Q;  3UDC A;  4E7S A;  3DB3 A;  3HFN A;  2QTV A;  1HYO A;  4RTY A;  5LJ5 e;  3OYB A;  5LJ5 d;  2RF0 A;  1QCN A;  4QVC A;  2YUQ A;  2JMA A;  1YIJ Q;  1ZLM A;  4LDY A;  1PWT A;  2DVJ A;  2YLB A;  2ZAE A;  2RJE A;  3HRS A;  4HVU A;  2IIM A;  2CP0 A;  4D8K A;  2EKH A;  2KRO A;  2DEU A;  2EJF A;  3UWN A;  3T9N A;  5AYF A;  1M2O A;  4PJO G;  4M77 C;  2LCS A;  3L2R A;  1WYX A;  4N4H A;  4GLM A;  1BU1 A;  1PSE A;  4FYW B;  1W2B A;  3JCM W;  1I1J A;  2QEX A;  5KYY B;  3A8H B;  2E6N A;  1E7O A;  2L5Q A;  3AHU A;  1D1C A;  3M59 A;  1AHJ B;  3MEU A;  3VU3 C;  1PG5 B;  1Q95 G;  3CBO A;  3FLG A;  4M7A B;  1NLP C;  3CCM T;  5IHK A;  2ECZ A;  3CXC S;  4M75 B;  4KH0 B;  1JU5 C;  1BYM A;  1VQL Q;  2K57 A;  1TWB A;  1Y7X A;  1OUL A;  4EMK C;  4M77 E;  5IN1 A;  2DXB A;  1Q86 R;  4ZGJ B;  2COY A;  1UHC A;  8AT1 B;  5I21 A;  1IGU A;  3I56 Q;  1D0X A;  3GNF B;  3MPU B;  3V7C A;  5FU6 B;  1AWX A;  2JTF A;  4FCY A;  2O88 A;  3OQ5 A;  4NL2 A;  3OYL A;  1IHV A;  3VRZ A;  4C8Q B;  2FL7 A;  4JS5 A;  3CXC A;  2VXF A;  1VQ6 T;  5GAN g;  2XKO C;  1GBQ A;  3CCQ Q;  2QYZ A;  2KMT A;  2KE9 A;  4IUV A;  2DTH A;  2K7A A;  1W2B P;  4XTX A;  3CC2 Q;  1YIJ T;  3D7S B;  5GAM j;  2Z0W A;  4F14 A;  4RG8 A;  2M02 A;  2P0K A;  3E2U A;  4IUR A;  1P92 A;  3G71 T;  2CGH A;  2LJ1 A;  2O2O A;  3QUI A;  1ZA1 B;  2EFI A;  5IXB A;  2L3R A;  2EAY A;  3O5Z A;  2KBT A;  1RAI B;  2ZGW A;  4M7A A;  1NM7 A;  1M2V B;  1A0N B;  4RCB A;  5HK0 A;  2PTK A;  2X3W D;  5KYW B;  2BE9 B;  3REA B;  1W70 A;  5FRM A;  3OYF A;  2NUP B;  2CSQ A;  5KYX B;  5LL6 S;  3I55 T;  4F7U F;  1VQ5 T;  1G3W A;  2ZPF B;  5KYN A;  1QQJ A;  1M3A A;  5D6X A;  4UC4 A;  3OSV A;  4C8Q C;  2DD4 A;  5GAN f;  5CKD A;  3VS4 A;  3CC7 T;  3FDR A;  1KFZ A;  3LGF A;  3SD4 A;  2K5L A;  4L6V 5;  3WXM B;  1C1A A;  1Y96 A;  2QA4 A;  3CCR T;  3OYA A;  5LJ3 e;  2CS7 A;  4PJN A;  1OI1 A;  5KYU A;  4LDX A;  4PLL A;  3I56 A;  2O31 A;  1N9S A;  3VV0 A;  1WHL A;  3RBB B;  5FLX E;  4X9C A;  4PLI A;  1YJ9 A;  1VQ8 Q;  3EG9 B;  1VQL T;  1KQS P;  2QAS A;  2LX7 A;  2DBM A;  1S72 A;  3CPW S;  2CZ1 B;  1H3Z A;  2M0O A;  1YIT T;  5FW9 A;  1TSF A;  2K5I A;  3NTH A;  1OYX A;  1NPP A;  3ASK A;  2CUD A;  2FO0 A;  1QVF A;  4PJL A;  3X25 B;  3G6E Q;  3C12 A;  2EGA A;  1ABQ A;  1Q82 U;  5LJ3 h;  1M4Z A;  2GGR A;  3BW1 A;  2PUO B;  2G6F X;  3QYH B;  3C94 A;  2SRC A;  3JB9 D;  1UEC A;  2E6Z A;  2XDP A;  2EQJ A;  2RJD A;  2LMJ A;  2DYB A;  2P4T A;  3J80 E;  1F1B B;  3THK A;  4GY5 A;  1J3T A;  3CMA Q;  3TVT A;  4M7A D;  4DA4 A;  2J6K A;  4JJB A;  2KRM A;  1K1Z A;  2JM9 A;  2KVQ G;  1WHK A;  3CPF A;  4MZP A;  3ULR B;  2LNV A;  3EH1 A;  2MYS A;  2KXD A;  1NJI R;  3CME A;  5CKB A;  4PFP A;  4C8Q F;  3L2V A;  2BZ8 A;  2HDA A;  2QXF A;  5LJ5 f;  3JCM c;  4B9X A;  3CCS A;  2LVM A;  4OB3 B;  4PJO E;  2B86 A;  1OQK A;  3P8D A;  4DBR A;  2J06 A;  4ZGE B;  2FVU A;  4N4I A;  5FWB A;  1YHQ T;  2A37 A;  2E70 A;  1PNJ A;  2GFA A;  5FU7 C;  3HTR A;  3PMT A;  2E10 A;  1WX6 A;  3VS1 A;  3QPH A;  2CH4 A;  5CKF A;  5GAO r;  4J5Y A;  3CCE A;  1PHT A;  3X24 B;  1Y96 B;  4PJO C;  3CQT A;  2E3H A;  4WTO B;  3MP8 A;  4II1 A;  2EVR A;  2RHY A;  1G3Y A;  4BI8 B;  2JUF A;  1MNE A;  2KAF A;  1ZSZ A;  4AT1 B;  1UGS B;  2DK3 A;  4C5G A;  2XG8 D;  3QZ9 B;  2XDD A;  1VIE A;  2ZPH B;  2XHC A;  1Q7Y C;  5GAM f;  2EKO A;  2M51 A;  2GQV A;  3BDL A;  2YWW A;  3L2Q A;  1JJ2 S;  1WXB A;  4M77 A;  4F7U E;  1IRX A;  2HSE B;  4JJC A;  4ZGD B;  5J3B A;  5LJ5 h;  1YIJ A;  2F2X A;  4PKC C;  1D0Z A;  2VGM A;  1R0C B;  1KHC A;  2NUZ A;  4Y28 E;  5D6W A;  4M78 A;  4DOV A;  3BY7 A;  3VS0 A;  2RQV A;  2DXT A;  1OX8 A;  1T0H A;  3A5Z B;  2Y90 A;  2KSS A;  3H41 A;  5GAN 4;  2XI9 A;  4JZ3 A;  4V2S A;  3LYI A;  2XU8 A;  1YI2 Q;  4M77 D;  2AZV A;  4J6W A;  2OTL T;  3QSU A;  1QVF P;  1QW1 A;  2D6F A;  4FM4 B;  1TG0 A;  2XK0 A;  1XTD A;  1X75 C;  2OI3 A;  2J05 A;  3IQL A;  2GTO A;  2HNI A;  1VOM A;  2CRE A;  3FC3 A;  2VKN A;  3C95 A;  2DMO A;  4M78 C;  3FB9 A;  1VA7 A;  1VQ7 A;  1W4S A;  1ZBX A;  1Q7Y U;  2DO3 A;  3CCJ A;  3VYG A;  2H8H A;  1IHW A;  4C92 A;  3NTI A;  1AZE A;  1UB4 A;  5GAO q;  4F7U B;  1WZO A;  2K3X A;  1VQN Q;  2YRD A;  1K9M U;  1X43 A;  1FYN A;  4M78 B;  1KQ1 A;  1PM3 A;  1TUD A;  2VWF A;  3UAT A;  1VQM A;  4F7U G;  2L2P A;  1NBE B;  1TOV A;  1TUC A;  2DIL A;  2A0F B;  3QDR B;  4LE9 A;  1S72 Q;  1G5V A;  2LNH B;  4AG2 C;  1M8M A;  5GAO n;  4M7D G;  2H3J A;  1OZ3 A;  4EIK A;  5KCO A;  1ZSZ B;  2JW4 A;  3EG9 A;  3NFC A;  4RCC A;  5KH6 A;  2JNG A;  1YJN A;  5GAN 5;  3MEV A;  4J9H A;  1M3B A;  1JXM A;  1QKW A;  2MF2 A;  3OS2 A;  3OMC A;  4A4F A;  4D8D A;  3V8K A;  1X6G A;  1KJW A;  3OBY A;  1AWJ A;  2ATC B;  3A1P A;  3RUX A;  2V8K A;  3FEO A;  4Z8A A;  1H3H A;  5CCA A;  3MJX A;  3FJ5 A;  4KUI A;  4BDY A;  2WSC E;  3JAM E;  2FRW A;  2HL5 C;  2QGG A;  2QI2 A;  1WI7 A;  2HQX A;  4IUU A;  3CCL Q;  3CBM A;  4C8Q G;  1MND A;  1RAE B;  2YRC A;  3RKW A;  1WJS A;  2RQW A;  1Y07 A;  1MV0 B;  2K2M A;  2KRN A;  4F7U A;  2DKG A;  5GAO l;  1YJ9 T;  2L0A A;  1G83 A;  4J9F A;  3CCJ T;  4PL6 A;  2YXY A;  2ZPG B;  4AFQ C;  4C8Q A;  2CT4 A;  3L1A A;  2HZY A;  1PD1 A;  4C0F A;  1WFW A;  2XD0 A;  4XAX B;  4C8Q D;  4HCZ A;  2CT3 A;  4PJO B;  3QII A;  1M30 A;  1EZZ B;  1VQO Q;  2RI3 A;  3KBG A;  1VQ9 A;  5CQX A;  3UT1 A;  3V8J A;  1TS9 A;  5GMK i;  2DL3 A;  5FU7 B;  4A4H A;  1BI1 A;  3G4S A;  2F69 A;  1GCP A;  2MCN A;  2AK5 A;  1GCQ C;  2L3P A;  1OPK A;  2YUO A;  5CVI A;  4QQ6 A;  3REB B;  1GCQ A;  4FT4 A;  4C92 G;  3URG A;  2DL7 A;  1RI0 A;  1X27 A;  1UDL A;  2E1H A;  2E5K A;  2K4Y A;  1Z9Q A;  3OYG A;  1BI3 A;  2EJ9 A;  4JJD A;  2NUT B;  1KSW A;  4C92 E;  4QVD A;  1ACM B;  2DPP B;  2KYB A;  2YUN A;  5GAN e;  3CCU T;  5GAN d;  2YDL A;  2RJF A;  3CME T;  3BDU A;  1N8R C;  2LZ6 B;  4PFZ A;  2GFU A;  3SWN A;  5ECA A;  1D1B A;  2OTL Q;  2GNC A;  5CQY A;  3CCU Q;  1SEM A;  4J9B A;  2PZ1 A;  5DLQ E;  5L8R E;  1M1K R;  5KCH A;  1H92 A;  1EIF A;  1YJN T;  3PE0 A;  4XQ3 A;  1K9M R;  2QTX A;  5KYU B;  2RHX A;  2FYK A;  1UG1 A;  3MP1 A;  4OP0 A;  2ESW A;  1VQ9 T;  1Q81 R;  1VQK T;  3JCM h;  3CCS Q;  1T0J A;  1X01 A;  2L3Q A;  2W0Z A;  2CP5 A;  4MDW A;  3EHQ A;  3L2Z A;  3NTK A;  2XDB A;  2HBP A;  2L8D A;  5DLO A;  2X51 A;  2HKN A;  4C0D C;  3H9N A;  3H8Z A;  2VXE A;  1OZ2 A;  4MZT A;  2R57 A;  4FT2 A;  4XK8 E;  2RK1 A;  1XNI A;  1RAB B;  1G3T A;  3CCJ Q;  2B8A A;  3PT9 A;  4M75 A;  3S3O A;  4LD9 K;  3PTA A;  2DRM A;  1YI2 T;  2CZ7 B;  5LJ5 g;  2YUP A;  3UA6 A;  3PVL A;  2DTI A;  1QKX A;  2LQK A;  4PJO A;  2EW3 A;  4LDW A;  1AWW A;  5GAO p;  4DBH A;  2XID A;  1GRI A;  2PU9 B;  1SRM A;  2VUB A;  3VKI A;  2MK5 A;  4M4Z A;  2ED0 A;  4XTV A;  3OYJ A;  5LJ5 j;  1BI2 A;  1M9S A;  1FMV A;  2JMC A;  2EQM A;  1YJW T;  1RAG B;  1GL5 A;  5IXF A;  3TQ7 P;  2BE7 D;  3CC4 T;  1YFN A;  3QZ5 B;  3SFM A;  3UA7 A;  3EFR A;  5A2Q E;  1WA7 A;  3ZFJ A;  2CP6 A;  2VB6 A;  1UGQ B;  2EYZ A;  1K9A A;  2JZ2 A;  5GAM g;  4XTW A;  4R56 A;  1M3C A;  2D0N A;  5I2M A;  1IZ6 A;  4BE2 A;  2HCK A;  2JTM A;  3QHS A;  3P8B B;  1KQS S;  1X6B A;  4J7I A;  1UEB A;  1WJQ A;  4QQD A;  4DQ2 A;  1LCK A;  1I81 A;  1WHH A;  5CAI A;  2RJC A;  2YRV A;  1YIT Q;  2FZG B;  4BI3 A;  2K2V A;  1G8X A;  2RQU A;  3H0I A;  5IAY A;  4ESR A;  4FL6 A;  3QWY A;  4BE0 A;  2O9S A;  1DJ7 B;  4M78 D;  3MCA B;  2DER A;  2X4Y A;  1IO6 A;  4EMK B;  2JS2 A;  3PGG A;  4LNP A;  1AVZ C;  2EWN A;  1M1K U;  2MAM A;  1QLY A;  3EFO B;  1W6X A;  3G71 A;  1PKS A;  4GBQ A;  2X4X A;  3MO8 A;  2RPN A;  3CMA T;  3OYD A;  3M4Y A;  2AT1 B;  2LJ3 A;  2P84 A;  3JCM J;  5DY9 A;  2X3X D;  4ZNX A;  1K8A U;  2QQB A;  2GF7 A;  3M0R A;  4C5I A;  4C5E A;  1OU8 A;  4HT8 A;  4E6R A;  1CKA A;  3CC7 Q;  3LW5 E;  1KC8 U;  1Y71 A;  1VQ5 A;  1GXI E;  5FWC A;  2OTJ T;  3HKS A;  3E9F A;  4Z02 A;  4QVZ A;  4M7A G;  2RM4 A;  1M1F A;  3TEE A;  5CIU A;  2P0Q A;  5CKH A;  1KIK A;  2COZ A;  1M27 C;  2QQA A;  3X28 B;  2VVK A;  1G3S A;  1G2B A;  1X2Q A;  5HCK A;  2K6D A;  1VQ7 T;  1VIF A;  4MML A;  1VQ4 Q;  4F04 B;  3OYN A;  4OMQ A;  4AG1 C;  1KD1 R;  2RHU A;  2AKK A;  4A54 A;  3HPW A;  1VYT A;  5GAM h;  1N8R R;  3R6N A;  2FPF A;  1LOJ A;  1HSQ A;  2QEX Q;  2QAZ A;  4NS5 A;  1AD5 A;  4ZN3 A;  2VAS A;  4MDX A;  1U06 A;  4NL3 A;  1M90 C;  4HA8 A;  1WXU A;  4Z89 A;  2NYS A;  1VQM T;  1K8A R;  2KT1 A;  3JCM g;  4R55 A;  3OYM A;  1O9S A;  2F5T X;  3M0P A;  4ME7 A;  3M4G A;  3KXT A;  1K4U S;  4DEX A;  2JM8 A;  2QQR A;  1VQM Q;  2EGC A;  4PK4 A;  4RKU E;  2K9G A;  5LJ3 f;  2LCL A;  1SHF A;  2RH2 A;  8ATC B;  4PNO A;  5GMK e;  3I55 Q;  4E7H A;  1RAA B;  3EGD B;  3P8H A;  4KT0 E;  2HEQ A;  4JLI A;  1VQK A;  1H64 1;  3TRE A;  2XIC A;  4HCC A;  3RMQ A;  1E6G A;  3M56 A;  3CCU A;  1LVK A;  3CCM A;  2PVO B;  3SWN B;  5CK9 A;  3PIO A;  1SPK A;  5HKC A;  4BB7 A;  3A8M B;  1LNX A;  1AZG B;  1NG2 A;  1M8V A;  2X4J A;  1UGR B;  1TTH B;  4FW2 A;  4M7D B;  3V7R A;  1MUZ A;  3H0H A;  3NPF A;  5GAN h;  4A4K A;  3CD6 T;  2RI2 A;  3G6E A;  1WPY A;  1OPL A;  4BY6 B;  3OS5 A;  2DTO A;  3JCM V;  2D8J A;  3GOX A;  3MET A;  3VUZ A;  1ZUK A;  1PSF A;  2FHD A;  2FZK B;  1WHM A;  4LDV A;  1QP2 A;  4KUL A;  1Q7Y R;  3N5B B;  1YN8 A;  2HAX A;  1SRL A;  3CPW A;  1YHQ A;  1I5O B;  1K8A C;  3HP9 A;  1ZHI A;  2M1H A;  4J9D A;  4LN2 A;  1QVF S;  1EFN A;  1ZUU A;  1ZBJ A;  1FXX A;  3I56 T;  2MWO A;  3SHW A;  4KH1 B;  5IHI A;  4ELY C;  1M1G A;  1QCF A;  4LUD A;  4X1V A;  3VJP A;  2OAW A;  3CCQ A;  1JB0 E;  1VQ8 T;  1KD1 U;  1BI0 A;  2OAU A;  3QXE B;  1T3L A;  1VYV A;  4TVR A;  2CP3 A;  1U8R A;  1UE9 A;  2XMF A;  1IB8 A;  2KY9 A;  4FSS A;  1RI9 A;  2LJ0 A;  1KHI A;  1MV3 A;  2NLU A;  5J26 A;  2YSQ A;  1KK7 A;  4OF1 A;  3CCR Q;  3QWX X;  4ANJ A;  2ED1 A;  3PFS A;  2CUB A;  2EIF A;  4P5N A;  4E2F B;  4JUV A;  2LCC A;  4YTL A;  5EC7 A;  1RAH B;  4RTV A;  1YCS B;  2C0I A;  4AFS C;  3CCR A;  2EQU A;  1V1C A;  1YWP A;  2MOX A;  3H6Z A;  3QG1 A;  1VQ5 Q;  4L59 A;  1W2B S;  1NPR A;  2IVW A;  3EGD A;  1HK9 A;  1M90 R;  1UHF A;  5GAN 3;  4XTY A;  3EGX A;  4JRK A;  3TSZ A; 
#chains in the Genus database with same CATH homology
 2DPP B;  2L3R A;  2EAY A;  3EAE A;  5GAN e;  4XU1 A;  3CCU T;  4M7A E;  5GAN d;  2RJF A;  3CME T;  4X9D A;  3CBP A;  3BDU A;  1N8R C;  4M7A C;  2RI5 A;  2ZGW A;  1R8O B;  4EPC A;  2LT4 A;  4J83 A;  4M7A A;  2GFU A;  2LRQ A;  2LT1 A;  3SWN A;  3OB9 A;  5HY6 A;  4M7D F;  2QQS A;  4RCB A;  5HK0 A;  5CQY A;  3L42 A;  3R6O A;  2WAC A;  4B9W A;  3M9Q A;  5DLQ E;  5FRN A;  4BUG A;  5L8R E;  5KCH A;  3HFO A;  1EIF A;  1N27 A;  2RK2 A;  5FRO A;  4ZTF A;  4M77 B;  5FRM A;  3OYF A;  1YJN T;  4EDU A;  4XQ3 A;  1HXD A;  2O4X B;  3I55 T;  1QVP A;  2BUD A;  2QTX A;  3A8G B;  5LL6 S;  4CI0 C;  4F7U F;  3LWH A;  3G6E T;  1FX7 A;  3E19 A;  2DZC A;  4DOW A;  1Q81 U;  1N9R A;  2RHX A;  4C92 E;  3L2U A;  2FYK A;  1VQ5 T;  4PJO D;  3JB9 I;  3CC2 T;  1G3W A;  3M54 A;  4FSX A;  2ZPF B;  4MZM A;  5D6X A;  4OGE A;  3OSV A;  3QBY A;  2DD4 A;  3MP1 A;  4UC4 A;  4OP0 A;  4C8Q C;  5CKD A;  5GAN f;  2C06 A;  1FWZ A;  3MP6 A;  2EYQ A;  3QO3 A;  4FU6 A;  1VQ9 T;  2AHJ B;  3CC7 T;  3JB9 G;  2RB6 A;  3FDR A;  3LGF A;  3SD4 A;  4A4E A;  3CCQ T;  1VQK T;  2RHI A;  2MMP A;  3JCM h;  2DEQ A;  3S3M A;  2K5L A;  4L6V 5;  3WXM B;  1VQ6 A;  1X01 A;  4OMF B;  3OS1 A;  1Y96 A;  1VQL A;  2QA4 A;  2E64 A;  4MDW A;  2OTL A;  4X34 A;  3L2Z A;  5EG2 A;  3NTK A;  3CCR T;  2XDB A;  3OYA A;  5LJ3 e;  2CS7 A;  2HBP A;  2L8D A;  5DLO A;  5DM7 R;  4O5V A;  1YIT A;  2JN0 A;  2RHZ A;  4C0D C;  1OI1 A;  3VUB A;  4C0Z A;  3QJ6 A;  1MGQ A;  4LDX A;  2VC8 A;  4PLL A;  5IT9 E;  3I56 A;  2QEX T;  3H8Z A;  2VXE A;  4OB2 B;  3OYK A;  1N9S A;  1OZ2 A;  3VV0 A;  4MZT A;  3TU4 K;  4M7D D;  2R57 A;  4FT2 A;  4Y91 A;  1WNL A;  5FLX E;  3JCM f;  3E9G A;  4FIB A;  4J6X A;  4PLI A;  2RK1 A;  4X9C A;  4XK8 E;  5GAO m;  1YJ9 A;  3GNG A;  4HT9 A;  2HD0 A;  1VQL T;  4IUT A;  1XNI A;  3Q1J A;  1G3T A;  3CCS T;  1S72 A;  2B8A A;  3PT9 A;  2MWP A;  3CPW S;  2CZ1 B;  2YLC A;  1H3Z A;  4M75 A;  1QVG A;  3S3O A;  4LD9 K;  3PTA A;  1YI2 T;  1NJI C;  2CZ7 B;  2M0O A;  5LJ5 g;  1YIT T;  2DTI A;  3TCJ A;  1VUB A;  1YJW A;  2K5I A;  2LQK A;  3NTH A;  1OYX A;  1NPP A;  4LDW A;  4PJO A;  3ASK A;  2RO0 A;  2A7Y A;  4M75 E;  2DAQ A;  1N8R U;  3HRT A;  1QVF A;  2EQK A;  5GAN 7;  3GPL A;  3X25 B;  5GAO p;  3C12 A;  4BDZ A;  3CCL T;  1VQN A;  3QYG B;  2XID A;  1Q82 U;  5LJ3 h;  1M90 U;  1M4Z A;  3JB9 J;  3JSC A;  5LJ3 j;  2ZZD A;  3BW1 A;  3UPU A;  3V8L A;  3CC2 A;  2PU9 B;  2PUO B;  4E7L A;  2LX9 A;  3QYH B;  2O4X A;  3C94 A;  2WSE E;  4EMH A;  2VUB A;  3JB9 D;  3VKI A;  2VGN A;  2E6Z A;  3GF5 A;  1WJR A;  2XDP A;  2EQJ A;  1YCY A;  3O8V A;  2RJD A;  4M75 D;  4XTV A;  4BY6 C;  4CRI A;  1KG1 A;  4C0G A;  2LDM A;  3F70 A;  3OYJ A;  4J7F A;  5LJ5 j;  1BI2 A;  2P4T A;  4L5G A;  1M9S A;  5M9O A;  3J80 E;  2EQM A;  4M78 G;  5A0G A;  1YJW T;  4GY5 A;  4IKF A;  3CC4 T;  4M7A D;  3SFM A;  3QZ5 B;  5HK3 A;  4DA4 A;  1JRI A;  5C0M A;  4MMK A;  3EFR A;  5A2Q E;  3CCL A;  4M7D A;  3LGL A;  3LWI A;  3WVD B;  2KVQ G;  3CPF A;  3ZFJ A;  4MZP A;  3QJY A;  1ZQ1 A;  2LNV A;  1KQ2 A;  3JB9 H;  3RER A;  1UGP B;  3PMI A;  3OYE A;  4XU3 A;  4IUQ A;  3CME A;  4M75 F;  2JVV A;  1UGQ B;  5CKB A;  1I5L A;  1VQ8 A;  2F5K A;  3A8O B;  4J8O A;  4NOY A;  5A0D A;  5GMK h;  2I2L A;  2JZ2 A;  3VYH B;  4BD3 A;  4C8Q F;  3L2V A;  2QA4 T;  5GAM g;  4N0A C;  4XTW A;  1KC8 C;  2QXF A;  5LJ5 f;  4JS4 A;  3JCM c;  4B9X A;  3CCS A;  3GLX A;  4R56 A;  2LVM A;  3C4S A;  4OB3 B;  3MHX A;  3ZEH A;  4PJO E;  3P8D A;  5I2M A;  4XTU A;  2FVU A;  1IZ6 A;  2D9T A;  4ZGE B;  4BE2 A;  3INZ A;  1VQP T;  5GAN 8;  3CCV T;  3QKJ A;  4N4I A;  2JTM A;  3QHS A;  3P8B B;  1KQS S;  2D0Q B;  1YHQ T;  1WQW A;  4KUD K;  2E70 A;  2GFA A;  2DD5 A;  4J7I A;  1UEB A;  5FU7 C;  1WJQ A;  4LDU A;  4QQD A;  4DQ2 A;  4EMK A;  5J39 A;  1I81 A;  3G4S T;  2EJG A;  4IUP A;  3PMT A;  5CKE A;  2E10 A;  2K5F A;  2R58 A;  5CAI A;  2RJC A;  3QPH A;  3OYC A;  2DJZ A;  2DXU A;  2YRV A;  5CKF A;  2ZCF B;  2CKK A;  4J5Y A;  4BI3 A;  5C6S A;  3CCE A;  5GAO r;  3OYH A;  3LLR A;  2K2V A;  3X24 B;  1Y96 B;  5KE3 A;  4PJO C;  2O01 E;  5IAY A;  4FL6 A;  3BFM A;  3EFS A;  3MP8 A;  1B34 B;  4BE0 A;  4II1 A;  1DJ7 B;  3MCA B;  4M78 D;  1Q81 C;  2X4Y A;  4M7D E;  3J7A F;  1RL2 A;  2RHY A;  1X6O A;  4VUB A;  1Q82 C;  4E47 A;  1G3Y A;  4BI8 B;  3OMG A;  4EMK B;  3PIP A;  2JUF A;  2KAF A;  4JRI A;  3SDZ A;  3HHT B;  1D3B B;  3PGG A;  2KK4 A;  1UGS B;  2EWN A;  2MAM A;  3HL8 A;  4M77 G;  1M1K U;  3JCM d;  2L89 A;  2DK3 A;  2E65 A;  2M16 A;  3G71 A;  4PJO F;  2CZ6 B;  4C5G A;  4C92 C;  2XG8 D;  2LTO A;  3CEY A;  3QZ9 B;  1VIE A;  2X4X A;  2ZPH B;  3MO8 A;  2XHC A;  2XDD A;  3CMA T;  3OYD A;  3DLM A;  1Q7Y C;  4E7I A;  5GAM f;  2EKO A;  3M4Y A;  2GQV A;  3RMS A;  3BDL A;  1QP3 A;  1KQS A;  1BIA A;  2PVD B;  3L2Q A;  2IG0 A;  3G7Z A;  3JCM J;  3M55 A;  1I8F A;  5DY9 A;  3HRU A;  1JJ2 S;  1K8A U;  4M77 A;  4F7U E;  3A8L B;  2GCX A;  3OBW A;  5CO7 A;  4ZGD B;  3ME9 A;  1BIB A;  2LC4 A;  5J3B A;  2QQB A;  2PUK B;  2GF7 A;  4C5I A;  4GLK A;  4C5E A;  5LJ5 h;  1VQ4 A;  4HT8 A;  2X35 A;  3RKX A;  4RMO A;  3KUF A;  1VQO A;  3LW5 E;  1YIJ A;  3OSS C;  1KC8 U;  1Y71 A;  1YI2 A;  5GAN j;  3MEA A;  4PKC C;  1VQ5 A;  2VGM A;  2OTJ T;  1GXI E;  1Q86 C;  3HKS A;  1KHC A;  4DOV A;  4Y28 E;  1BKB A;  2PVG B;  3E9F A;  1LJO A;  4M78 A;  5D6W A;  4Z02 A;  3BY7 A;  4QVZ A;  4M7A G;  2RM4 A;  1XQH A;  1M1F A;  3TEE A;  2DXT A;  5CIU A;  1QVG S;  3A5Z B;  2Y90 A;  3OW2 S;  4HCB A;  2P0Q A;  2KSS A;  4WF2 A;  5CKH A;  3GIB A;  2VYT A;  5GAN 4;  1K9M C;  2XI9 A;  3V7S A;  4OVA A;  2QQA A;  4V2S A;  3LYI A;  2XU8 A;  3X28 B;  4M77 D;  4C8Q E;  2WSF E;  4ZN1 A;  2YHT A;  2R5M A;  1G3S A;  4J6W A;  5GMK j;  2OTL T;  2Y4Y A;  3WVE B;  3QSU A;  3OYI A;  3GP8 A;  3E1S A;  4BAC A;  2ZPB B;  1VQ7 T;  1VIF A;  1QW1 A;  2V8J A;  4A53 A;  5GMK m;  2D6F A;  1I4K 1;  4LD6 A;  4MML A;  4RG2 A;  4FM4 B;  2XK0 A;  3OYN A;  2OTJ A;  4OB1 B;  1XTD A;  3LH0 A;  4QVD A;  5CR2 A;  2RHU A;  4M7D C;  1X75 C;  2G3R A;  4HKE A;  3HPW A;  4A54 A;  2QQ9 A;  3JCM X;  1JJ2 A;  5GAM h;  1Q86 U;  3M53 A;  1LOJ A;  4M75 G;  3JCM b;  3I55 A;  4NS5 A;  5LJ3 g;  3OY9 A;  4M75 C;  4O6J A;  2CZ0 B;  2HNI A;  4ZN3 A;  4MDX A;  4NL3 A;  1M90 C;  1U1T A;  4HA8 A;  3SWN C;  3FC3 A;  3OS0 A;  2DXC A;  3FJP A;  3CCE T;  2BKD N;  3C95 A;  4M78 C;  3CMA A;  1IRE B;  3FB9 A;  4JLG A;  3JCM P;  3JB9 F;  1VQM T;  1VQ7 A;  1W4S A;  4KBM B;  4R55 A;  3JCM g;  3OYM A;  1ZBX A;  1Q7Y U;  1O9S A;  2F5T X;  3PNW C;  2R5A A;  2DO3 A;  4C92 D;  3M58 A;  4ME7 A;  2RD1 A;  1MHN A;  3CCJ A;  2LQ8 A;  1JBM A;  2E41 A;  3M4G A;  4QW2 A;  3ZBD A;  5GMK l;  3KXT A;  3CC7 A;  2V8I A;  3VYG A;  2QQR A;  2DIQ A;  4RKU E;  3S6W A;  2DVE A;  4C92 A;  5LJ3 f;  3NTI A;  2LCL A;  2CYZ B;  4M77 F;  4J6Y A;  1VQP A;  2RH2 A;  3OW2 A;  4JJN K;  4PNO A;  4OGC A;  1UB4 A;  2QDY B;  3MEW A;  4F7U B;  5GMK e;  5GAO q;  4E7H A;  3P8H A;  4QQG A;  2M9U A;  4KT0 E;  2K3X A;  3RES A;  4JLI A;  1K9M U;  3CD6 A;  1VQK A;  4N4G A;  1H64 1;  2PQW A;  2A3L A;  2XIC A;  3TRE A;  1NE8 A;  4HCC A;  3M56 A;  1KQ1 A;  2BIV A;  4M78 E;  4M78 B;  3RMQ A;  5GAM e;  5GAM d;  3CCU A;  1VQM A;  4F7U G;  3CCM A;  5GAN 6;  2PVO B;  3SWN B;  5CK9 A;  4M7A F;  3JRZ A;  1O75 A;  3DB4 A;  4C92 F;  3PIO A;  1VQ4 T;  2X4W A;  3X26 B;  3OA6 A;  5HKC A;  4BB7 A;  4ELZ C;  3DKM A;  3A8M B;  3FIF A;  1LNX A;  3QDR B;  3DLL A;  1G5V A;  4EMG A;  2VV5 A;  1K73 C;  1M8V A;  5GAO n;  4M7D G;  2H3J A;  1OZ3 A;  5I2S A;  2X4J A;  4XU2 A;  1UGR B;  4N0A A;  5LJ3 d;  4M7D B;  2RA2 A;  3V7R A;  5KCO A;  3UDC A;  1D3B A;  3NFC A;  4RCC A;  3CC4 A;  4BI4 A;  5KH6 A;  2JNG A;  5GAN h;  4JRP A;  3JCM e;  1YJN A;  3DB3 A;  3HFN A;  4A4K A;  3CD6 T;  3JCM Q;  3MEV A;  5LJ5 e;  5GAN 5;  2RI2 A;  3OYB A;  2KQW A;  5LJ5 d;  3G6E A;  4ZTJ A;  2MF2 A;  3M57 A;  3OS2 A;  3ER0 A;  1WPY A;  4QVC A;  4BY6 B;  3OS5 A;  3CCV A;  2DTO A;  3JCM V;  3OMC A;  3S3N A;  4A4F A;  3GOX A;  3MET A;  4LDY A;  3VUZ A;  5D6Y A;  2YLB A;  3V8K A;  1M1K C;  1PSF A;  2FHD A;  2RJE A;  3OBY A;  1M5Q 1;  3HRS A;  4LDV A;  4OB0 B;  1QP2 A;  4KUL A;  3RUX A;  1V29 B;  1YBY A;  3N5B B;  2EJF A;  2HAX A;  2V8K A;  3UWN A;  3T9N A;  1WGS A;  3FEO A;  5AYF A;  5GAN 2;  3CPW A;  1TH7 A;  1SSF A;  4Q5W A;  5CCA A;  4PJO G;  4M77 C;  3L2R A;  1YHQ A;  4KUI A;  2K3Y A;  4N4H A;  4BDY A;  2WSC E;  3JAM E;  4E7K A;  3HP9 A;  1K8A C;  1PSE A;  2QI2 A;  2HQX A;  4A4G A;  1N6A A;  1ZHI A;  3JCM W;  1VQO T;  1W2B A;  4IUU A;  2M1H A;  3CBM A;  4C8Q G;  1QVF S;  3RIR A;  1FXX A;  3I56 T;  2E12 A;  2MWO A;  3A8H B;  2QEX A;  4BE1 A;  2E6N A;  3RKW A;  2L5Q A;  4C5H A;  1WJS A;  1Y07 A;  3AHU A;  4ELY C;  3M59 A;  1AHJ B;  1B34 A;  1M1G A;  3MEU A;  3VU3 C;  1NJI U;  3CBO A;  3FLG A;  4M7A B;  4F7U A;  1NZ9 A;  2DKG A;  3OYY A;  5GAO l;  1YJ9 T;  3CCM T;  4E7J A;  4C92 B;  3CXC S;  3CCJ T;  4M75 B;  3VJP A;  1S72 T;  1BYM A;  3SB2 A;  2K57 A;  4PL6 A;  2JOY A;  3CCQ A;  4JRQ A;  1JB0 E;  2ZPG B;  1VQ8 T;  1Y7X A;  4C0D B;  1KD1 U;  4C8Q A;  3X20 B;  3L1A A;  4EMK C;  1BI0 A;  2OAU A;  4M77 E;  4C0F A;  5IN1 A;  2DXB A;  3QXE B;  2XD0 A;  4TVR A;  1U8R A;  4XAX B;  4C8Q D;  4ZGJ B;  4HCZ A;  4D6W A;  4XU0 A;  1U1S A;  2KY9 A;  5I21 A;  4PJO B;  1VQN T;  3QII A;  3GNF B;  3V7C A;  1WQ7 A;  5FU6 B;  2FB7 A;  3RKY A;  1KHI A;  2JTF A;  2Y4X A;  2NLU A;  3OQ5 A;  5J26 A;  4NL2 A;  3OYL A;  4OF1 A;  1K73 U;  4XTZ A;  2RI3 A;  2E5Q A;  3KBG A;  1VQ9 A;  4C8Q B;  3FRN A;  5CQX A;  2P0P A;  3UT1 A;  3V8J A;  3M5A A;  4JDS A;  3PFS A;  5GMK i;  3LX7 A;  2FL7 A;  2EIF A;  4P5N A;  4JS5 A;  5FU7 B;  4A4H A;  3CXC A;  1BI1 A;  3G4S A;  2F69 A;  2VXF A;  4JUV A;  5GAN g;  2XKO C;  2LCC A;  1VQ6 T;  4YTL A;  5FU6 C;  3L2W A;  5KE2 A;  1XOV A;  5A0L A;  1KD1 C;  2KMT A;  5CVI A;  4IUV A;  4QQ6 A;  3CCR A;  2DTH A;  4FT4 A;  2EQU A;  4C92 G;  3URG A;  4ATO A;  2DZ9 A;  4XTX A;  1RI0 A;  2HQE A;  1YIJ T;  5GAM j;  3H6Z A;  3QG1 A;  4RG8 A;  2E1H A;  2P0K A;  2K4Y A;  4L59 A;  3J81 E;  1W2B S;  1NPR A;  2IVW A;  2KDS A;  4IUR A;  1HK9 A;  1P92 A;  3OYG A;  1BI3 A;  2EJ9 A;  2ZPI B;  5GAN 3;  2CGH A;  4XTY A;  3QUI A;  3G71 T;  4M78 F;  3HSB A;  2ZPE B;  2DIG A;  4JRK A;  2MI6 A;  2EFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...