2FVUA

Structure of the yeast sir3 bah domain
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
216
structure length
190
Chain Sequence
HMTMAKTLKDLDGWQVIITDNVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Regulatory protein SIR3
publication title Structure and function of the Saccharomyces cerevisiae Sir3 BAH domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 43
structure length 190
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2fvuA01
1ZBXA 1M4ZA 4DA4A 1ZHIA 2FL7A 4JJNK 4BB7A 4DOWA 1W4SA 2FVUA 4LD9K 3TU4K 4FT4A 4KUIA 3PT9A 4KULA 4DOVA 3PTAA 4FSXA 4KUDK 4FT2A
chains in the Genus database with same CATH superfamily
1D0YA 1YI2A 4XTZA 1U3OA 1N8RU 3MEVA 2O4XA 4L6V5 5I21A 2L2PA 1IHVA 1G2BA 3E9GA 2EKHA 1FMVA 1VQ4Q 3CC7A 2L5QA 1Y7XA 4DBFA 3M56A 3EFOB 1WQWA 2OI3A 1AEYA 2K2VA 3PMIA 2VXFA 2KR3A 1D3BA 1YHQQ 3ZL7C 2O88A 4A4HA 1VYUA 4MMKA 3ME9A 5J3BA 2DJQA 5GMKl 4X9DA 1JBMA 3CXCP 2M16A 3WXMB 1YIJA 2M02A 3Q1JA 4M75G 1OZ3A 4E2FB 2PU9B 3JCMh 3OYAA 5GAN3 1LNXA 3VYGA 1IGQA 2Y4YA 2KRSA 4QW2A 2LQNA 3V7CA 4F7UE 1BI3A 3TREA 1YJ9A 1PNJA 2ZAEA 5D6XA 1G3SA 5CK9A 4PJOB 2QASA 4HCZA 4V2SA 3G4ST 1MMNA 2AZSA 3GNFB 2RJEA 4F04B 3LW5E 1YJNT 3TVTA 3CXCA 2ZPGB 4HCKA 1KK7A 2LMJA 3LWHA 1IHWA 2JTMA 1AWWA 2HQXA 4PKCC 2MMPA 2RQVA 2HEQA 1RI0A 1Y57A 1ABQA 1PKSA 4A4GA 2A08A 5GAOr 4OMFB 3A5ZB 5A2QE 2DZ9A 4CC3A 3FRNA 1J3TA 4FSXA 2OTLQ 4C92F 5GAOn 4GLMA 4J9GA 3KUFA 1OX9A 2BIVA 5J39A 2JJ9A 2WSFE 4X1VA 2C0TA 3DB3A 3CC2Q 4J9DA 1OEBA 3A8GB 3BDUA 3RUXA 4B9XA 1T3SA 1YI2T 2YUOA 1SHGA 2KEAA 3CPWS 4DEXA 3QKJA 3GLXA 3QZ5B 4C0ZA 5LJ5d 3VS7A 1UB4A 3CMEA 3JCMe 3OYGA 2YUNA 2ABLA 4ELZC 3SWNC 2A3LA 2YT6A 2NWMA 3JB9I 2EBPA 4J9CA 4F7UA 1VQOA 2X9HA 2DIGA 3X20B 2XI9A 2DA9A 4M7DF 2CZ1B 2KROA 2GNCA 4DA4A 4AFQC 1NJIU 1YIJT 2K3YA 2E41A 1HSQA 3HTRA 2J6FA 4DOWA 3EGXA 4Z8AA 1Q81R 1K8AC 4C8QG 1M5Q1 2LNVA 3QWYA 4PJNA 2L3RA 1SF9A 3VS4A 2PNIA 1K73U 3JCMb 1YJ9T 2KQWA 4JLGA 2Z0WA 1VQPT 3HFOA 4RG8A 4FIBA 2KMTA 5HKCA 4Y28E 4DEYA 4ME7A 3I55Q 1WHMA 1I5LA 2OAUA 3EG9A 3SWNA 4CI0C 4J9FA 3CBPA 1X2QA 4HKEA 5C0MA 3REAB 2MF2A 1WXBA 1NE8A 2JTFA 2FPEA 4C92G 1VUBA 2HBPA 2VWFA 3RMSA 3ZEHA 4Z89A 1EFNA 2D1XA 2DBKA 1T0HA 2XK0A 2QK0A 4KRTA 2VB6A 4A4EA 4KH1B 3JCMQ 3MJXA 2J6KA 4LE9A 1RLQC 1FWZA 4FU6A 1KC8C 5FLXE 5GAOp 4XU1A 3JCMV 1ZBJA 1MMAA 2VKNA 3NHNA 2QI2A 2E6ZA 1PRLC 4EIKA 2QGFB 1OPKA 2ED0A 5GMKh 1KIKA 1W4SA 3E9FA 2L89A 3OSVA 2O4XB 5LJ3d 3RIRA 2FG0A 4BI3A 4NS5A 4FM4B 4OMMA 1VQLA 1YJWQ 3D7SB 2HSEB 1M90C 1KD1U 3M5AA 2RF0A 1KQSA 3CCEA 1TUCA 2E12A 2IIMA 3EGDA 1D3BB 5DM7R 3OS5A 2R58A 3P8BB 4UC4A 1VQOT 3JCMg 1G3WA 1X6BA 1OU8A 2QXFA 3CCMA 2YXYA 4J5YA 1O75A 2CS7A 4FYWB 1JU5C 4EPCA 3JAME 3QXEB 1SRMA 2Y4XA 3VS2A 1VIEA 2X4JA 3V7RA 4JRQA 2LNHB 4RG2A 2RPNA 2H8HA 5CVIA 1WXTA 2RJFA 2O9VA 2D6FA 3RERA 3OYCA 1YBYA 1QQJA 2BKDN 1WFWA 2J05A 2JS2A 2M9UA 1ZSZC 1VQ8A 3HPWA 3PE0A 2DKGA 2P0PA 1WHHA 4C8QD 2CP6A 3NTKA 2DVJA 3R6OA 4XU3A 1NPRA 1ZA2B 2RM4A 4QQ6A 1I5OB 4JJDA 2XIDA 4PJMA 3I56T 1JB0E 3CCUQ 1EZZB 1WHJA 2IG0A 5C6SA 3A8MB 3FJPA 5GMKe 4B9WA 4PJJA 2DILA 2MAMA 1ZBXA 4XTWA 4M78D 3O5ZA 3GOXA 1K8AU 1X6OA 1MHNA 2DYIA 1WDXA 1TWBA 3OW2P 3KBGA 4LDXA 1ZSZA 1VQNA 1PKTA 2V8JA 1KG1A 4QT7A 4CC2A 1E6GA 1SG5A 2NUPB 4M7AG 3EFRA 4M77G 4P5NA 1QP3A 3OB9A 2YSQA 3CCSA 1YCYA 5IHIA 5EC7A 5HY6A 3AHUA 4EMKC 4RTTA 3L2ZA 2CGHA 1M2VA 3LLRA 4LD9K 1N8RC 3MPUB 1I0CA 3OW2A 3PVLA 1Q86R 2RQRA 4JDSA 2R5AA 4F7UB 4RMOA 1YNZA 3VS1A 2KXDA 1UGQB 3GPLA 2BZYA 2P4RA 2DERA 1Z9ZA 1Q7YR 2VVKA 2CH4W 3OSSC 2DEUA 3JRZA 4OVAA 4AT1B 2ENMA 1YJWT 4PJOG 3EGXB 3I35A 4LD6A 2FB7A 1OX8A 4L5GA 4ATOA 1K0SA 4XTXA 5CKDA 1AWOA 4YTLA 3M0QA 3ASKA 2CZ7B 2L3PA 1MGQA 4JS4A 4O5VA 4GLKA 4EMKA 1VQKQ 3NPFA 2YRVA 1ZUUA 2ROTA 2RHZA 4OB3B 3EG9B 5D6WA 3SWNB 2HNIA 2F1LA 2JNGA 3RMQA 2GQVA 3LH5A 3GF5A 1C0MA 2DD5A 1IRXA 2EVRA 3MCAB 4RUGA 1Q82R 2EPDA 2RD1A 1PC0A 2FZGB 2ED1A 3J7AF 1YITA 1HJDA 2MYSA 2K3XA 3MKDA 4L59A 1YP5A 2YLCA 3LGFA 1Q7YU 4X34A 4N0AC 2MIOA 3G1JA 4BE0A 1RAHB 4C5EA 2PZ1A 2L3SA 1QW1A 1GFCA 2CZ0B 2F69A 4PLLA 5IAYA 1QLYA 4AFZC 1LOJA 2QGGA 5IHKA 3G4SQ 1VQNT 4E6RA 1HD3A 2DEQA 4HCBA 1AZGB 1BCOA 2F5TX 2EQKA 3SD4A 3GNGA 1VQ9Q 1SSHA 4J9BA 1JQQA 2AZVA 2KDSA 4MZPA 1E7OA 4D8KA 2RQUA 4QVCA 3CCST 3C94A 5CCAA 1B3QA 2YRCA 1TH7A 2KYMA 5FWBA 2KBTA 2LZ6B 1H641 1KQ2A 2COYA 1G3TA 4OMQA 3CCQT 2FO0A 1QVFA 4DBHA 2EWNA 4Z88A 4JRPA 3EGDB 4M7AD 2CUDA 3M58A 3MEAA 1BI1A 4N0AA 3OS2A 3X26B 1VIFA 3H9NA 4Q5WA 3CMAA 2LTOA 3EG1A 2RB6A 2VV5A 1I4K1 2IPOB 1KJWA 2A37A 5D7UA 2GFAA 3P8DA 2X3WD 2K5LA 1M1FA 2AIRB 1R0CB 2LRQA 4IUPA 3JCMd 1NJIC 1MV3A 3CCLT 3M0UA 3QJYA 6AT1B 1YI2Q 2J7IA 4JS5A 3TU4K 4IUTA 4LDVA 1JO8A 3JCMW 1X69A 3SB2A 1QMCA 5GANe 2X4XA 1VQMA 3G6EA 1SKUB 2EFIA 2ZZDA 5CQYA 1K73C 3X28B 1Y96A 1AD5A 1M9SA 4J8OA 1VQ5T 2LDMA 5L8RE 1ZA1B 2MOXA 2E5KA 1VQKT 3BFMA 4GBQA 4XAXB 4BACA 1NBEB 1YIJQ 1YITT 2YUQA 1U1TA 3QYGB 2L0AA 1H8KA 2F5KA 1YFNA 4KBMB 2GBQA 1M8MA 2JOYA 1WHKA 5GAOq 1RLPC 2V8KA 3BE3A 1AWJA 1I81A 1ZSZB 3MP8A 3VJPA 1YJ9Q 1WHLA 2CSIA 1VQPQ 2X4YA 4ORZA 2DJZA 1H92A 2DXCA 3LWIA 2E70A 2SEMA 2QQRA 3CPFA 2K6DA 2DZCA 3OYYA 1O9SA 1K76A 3CEYA 3U23A 4ZN1A 1VQ4A 2DXUA 2EYXA 1SEMA 1M2VB 4C8QE 2CUBA 4AFSC 2EJ9A 1VQ9T 5CKBA 1R8OB 2O9SA 4BE2A 3OYFA 2EGEA 4J7FA 2J06A 1KHIA 3CQTA 2OAWA 4F7UF 1KHCA 4C0GA 1G5VA 1KD1C 4ZNXA 3FLGA 3CPWP 2LCLA 5KCHA 2KVQG 3MHXA 3R6NA 4LDUA 2DVEA 2CP7A 5GMKm 4MDWA 4ELYC 1FMWA 4M78E 2KE9A 2CYZB 5IHNA 1VQ7T 5DLQE 2DTIA 2MCNA 4EMKB 3JB9D 3MO8A 4C8QC 1BKBA 1FXXA 2CH4A 3G6ET 4FT4A 3CMEQ 5FRNA 4RTUA 2OTJA 2O2OA 4HVUA 3O8VA 1RADB 1TG0A 2P4TA 1TXQA 1VQOQ 4D6WA 4TVRA 1XTDA 4PNOA 2F2VA 3QG1A 4XU0A 1ZX6A 1BIBA 2KNBB 1G83A 3J81E 2ZCFB 3OYLA 2KAFA 3CC7T 4M78C 4QQDA 1FMKA 3OYNA 4AG1C 2X51A 2RHYA 4C5IA 2K5IA 2QQ9A 1HK9A 1DJ7B 4E7ZA 4IIMA 4N4HA 5CR2A 1BU1A 1WXUA 2G3RA 3RESA 2D0NA 4C8QA 4PK4A 3VS0A 4JPBW 1QCFA 3HHTB 2NUZA 4F14A 3SDZA 1S72A 2DRKA 1I8FA 2QYZA 2MWOA 4A4KA 2DRMA 1QKWA 3CBMA 4BY6C 1NPPA 2LP5A 4C0FA 1XOVA 1V29B 2HKQB 2DFUA 1M1KR 1QVPA 5CQXA 1AOJA 2LCCA 3E19A 1VQ6A 4M75D 3I56Q 4M78A 3QDRB 4QVDA 1V76A 2WSEE 5HK0A 2DL5A 2MWPA 4HCCA 2CP0A 2O31A 1WLPB 2ZPFB 3M4GA 3PGGA 2XKOC 3CCVA 3DB4A 5GAN2 5CKFA 5CIUA 1PHTA 3HFNA 2A0FB 2XHCA 5IT9E 2XMFA 5IXBA 1PG5B 4Y91A 3NGPA 4D8DA 5GANf 4OP0A 2FYKA 1WA7A 2RA2A 1TS9A 1K9MR 1WPYA 2V1RA 4ZGDB 2RJCA 1Q81U 3JCMP 1SSFA 4J6YA 2J6OA 1K0XA 2QEXA 2QA4A 2JXBA 1M8VA 2DPPB 5FROA 1WIEA 4ZGJB 3VS5A 1N6AA 1Y96B 5CKEA 4K11A 1UUEA 1QCOA 3A1PA 3I5SA 4X9CA 1W2BS 2HAXA 3GP8A 2RHIA 2DL3A 3CCEQ 4ZTFA 5CKHA 1UE9A 3EAEA 2QQBA 4CC7A 1M1KU 2FEIA 1VYTA 3CCMQ 1UGVA 1SRLA 4M7DG 2LQ8A 5GAN6 3CMET 2DO3A 2YUPA 2CT3A 3KFVA 1WJSA 3G7ZA 2FRYA 4M7AE 1ZHIA 2JMCA 4A54A 4M77E 1QVGS 2DXBA 1RAAB 4ESRA 3QUIA 2R5MA 2YRDA 3J80E 2FZCB 1WJRA 1AHJB 1Q7YC 2LJ0A 4BI8B 3M0SA 3PNWC 4JRIA 2KYBA 2NUTA 3CC4A 3H6ZA 2E10A 2D9TA 1K9MU 1ZUYA 2CREA 2JUFA 4BI4A 1KQSS 2EJGA 2EGAA 3JV3A 1UJ0A 2PVDB 3NMZC 5DLOA 1IGUA 2EYQA 3HRUA 2AHJB 1OULA 4PJOE 3META 2DNUA 1R0BG 4M7AC 1TUGB 4ZN3A 1VQ6T 4M77C 1M30A 1YN8A 3CCJA 4IUUA 2RHUA 5LJ5e 3E2UA 3EH2A 5GMKj 5GAOl 3LH0A 4CRIA 1VOMA 1PCXA 1UGRB 1Q82C 1ZLMA 1LCKA 4BD3A 2A28A 1VQNQ 4O6JA 2MPXC 3TEEA 2G6FX 3OMGA 2C0OA 4LXCA 4OB2B 2DE0X 4QKUA 2EQUA 3QIIA 1BK2A 5IH2A 4HXJA 1N27A 1T3LA 4C92D 2VUBA 3CCSQ 2QAZA 2ESWA 4M7AA 2QA4T 1M2OA 1CKAA 4M77A 4ZGEB 2I0NA 4EMHA 2PVOB 4Y92A 1FX7A 3CCQQ 2V26A 5FRMA 3RDVA 3BDLA 1UFFA 1C1AA 2D0QB 2QQSA 3OS0A 2JVVA 2B86A 1K4US 1WHGA 5GAN4 4ANJA 2X4WA 5GAOm 5GAMf 5KYXA 1X2KA 1VQLT 4LNPA 2JT4A 3BY7A 3F70A 4OMOA 3QBYA 1RAIB 1JJ2S 1QCNA 4E47A 2COZA 5EG2A 3CCET 4FW1A 2JMAA 2BTTA 3EHRA 3CCRA 2WSCE 1B34A 2KRMA 3UA6A 4PFOA 3M0PA 3CCLQ 2DMOA 5GMKi 3CD6A 3CCMT 4PJOA 4JJBA 4C8QB 1E6HA 1M90R 4RCBA 2RK2A 4M7DD 3RR6A 2DIQA 3L2UA 5A0LA 2HQEA 2ZGWA 3CC4T 1B7TA 3QZ9B 1D0ZA 1IXDA 2LCSA 1Y07A 1I1JA 2DLPA 2F2WA 2RMOA 4E7JA 1A0NB 2W0ZA 1VQ5Q 1BCMA 2HL5C 2EJFA 1G8XA 4LN2A 4LUDA 1ABOA 1VQ8T 3PFSA 4M78B 3HRSA 4NL3A 1R77A 1YITQ 5LJ3e 2GCXA 3A8OB 1MMDA 2A7YA 4KUIA 3CCJT 1K9AA 3UPUA 2K57A 3HP9A 2JZ2A 2GGRA 5I2MA 1KSWA 4RCCA 1Q86U 5KYYA 2GTJA 4RTZA 2RQTA 3VS6A 3JCMc 3RKYA 1QKXA 5GANh 4RTWA 3EFSA 4JZ3A 4BY6B 2LJ1A 1MUZA 2O01E 4FT2A 1NEGA 3H0FA 5IXFA 4B6MA 2HL3A 3DKMA 4C0DC 2RNAA 3NTIA 2JS0A 4AFUC 1JEGA 2M51A 2LC4A 3VUZA 1N5ZA 5FU6C 5KYNA 2RN8A 4M75E 3CMAQ 2BUDA 2ATCB 3L2QA 5FW9A 2KRNA 1Y0MA 4BB7A 3OYKA 2HCKA 4NL2A 2XDPA 1Q82U 2PUKB 4M77D 2ZPHB 1BBZA 1VA7A 1VQ7Q 3FJ5A 4XTVA 1N8RR 3V8JA 1ZSGA 3RKWA 3QJ6A 1YJNA 1TTHB 2NUTB 1AVZC 4WCIA 4F16A 3G6EQ 2V1QA 5GANj 4XQ3A 3JSCA 3LGLA 1QVFS 2LT4A 4PLIA 2CP5A 4M75C 1JXOA 4GY5A 2F2XA 4F17A 5LJ5f 1AT1B 1SPKA 2YHTA 1OPLA 2E65A 1MNDA 3M57A 4VUBA 4DQ2A 3OY9A 4PJOD 4MZTA 3CC7Q 3VYHB 2B8AA 1NZ9A 2BE9B 2KSSA 3QYHB 1UDLA 1V1CA 2LVMA 3REBB 4IURA 4XK8E 3C12A 3RBBB 2RQWA 3OYEA 1M1GA 2DTHA 3WVEB 2HD0A 3SEMA 3C95A 3V8KA 4FYYB 4FL6A 4OMPA 1JXMA 3VU3C 2X35A 3HL8A 2CP2A 3G71A 2L8DA 1NYFA 3EHQA 1TSFA 2YDLA 2GQIA 4E7LA 8AT1B 2A36A 3VKIA 3OYJA 4KGZB 3P8HA 2LJ3A 4M75A 4J83A 3S6WA 4EMGA 2RI5A 2JM9A 5KE3A 3VRYA 4M7AB 4M77B 4N4GA 1Y71A 2EW3A 5CO7A 3QDFA 3OYHA 4R55A 4JZ4A 3OA6A 1Q81C 3PVQA 3EGUA 2MK5A 3ZBDA 1UTIA 1S1NA 4OF1A 5GJVB 3H8ZA 3UDCA 1OQKA 5GAMh 1BI2A 1YCSB 2HKNA 5LL6S 3OQ5A 1OV3A 5GAN8 5KYXB 4JRKA 4RTYA 3JB9J 4KT0E 2E64A 1M1KC 1XNIA 1TOVA 3M9QA 2BE7D 3X25B 1NLOC 1YHQA 1B34B 2DX1A 3MEUA 3UATA 4C5HA 4J7IA 4R0KA 1VQPA 2DL7A 1IB8A 3CMAT 1GL5A 3A8HB 2M0OA 5KYWA 4JUVA 4C8QF 1PSEA 3FDRA 4PFPA 4HT9A 2VGNA 2XDDA 2QG9B 1QWFA 2DAQA 5KE2A 2E5QA 3V8LA 2AT1B 1X75C 3CXCS 2OTJQ 1U1SA 4NOYA 2XD0A 1NLPC 5LJ3f 4WTOB 4C92E 2D8JA 3MEWA 1K1ZA 1K9MC 5GJWB 3QSUA 1B07A 2EIFA 2EGCA 1RUWA 1VQMT 1WX6A 1NJIR 5A0DA 4M78F 3LX7A 4QQGA 3CPWA 4LDYA 1ZQ1A 3OYIA 1BI0A 1N9RA 4IKFA 5GANg 4IUVA 4OB1B 5KYUA 2E3HA 3T9NA 3THKA 1VYVA 5GAMj 1K73R 4J6WA 5GAN5 3NTHA 2LT1A 5KYYB 2PTKA 2ROLA 5FU7C 3G71T 3VUBA 2FRWA 1M3BA 2NUPA 1CKBA 2IVWA 1S72Q 2OTLA 2AKLA 4C92C 5I11A 1M3CA 2DTOA 5GAMe 2E6NA 2P0KA 4J6XA 1GCQC 5HK3A 4M7DE 4IIOA 3CC2A 5GAN7 4LUEA 1CSKA 1OI1A 1D09B 2PUOB 3L2VA 1VQ6Q 3RKXA 2LQKA 2JM8A 3INZA 2JN0A 3RNJA 1ACMB 3QWXX 4F7UG 2X3XD 5FWCA 1VQ4T 3CCVQ 1UECA 4R56A 1WI7A 3CBOA 3EG3A 2DK3A 2D8HA 1QP2A 1NM7A 1OU9A 2COWA 1YHQT 2DETA 4C92A 1PD0A 2E4HA 3N5BB 2VASA 2XDBA 2MI6A 3QHSA 4M7DC 4BDZA 1W2BP 1GCQA 3M55A 4KUDK 1X43A 1Z9QA 3H0HA 4ZTJA 4C0DB 4OGEA 1BYMA 3M53A 4QVZA 3UF4A 2QEXQ 2QA4Q 2I2LA 3KXTA 1X27A 2ZPEB 3PIPA 4M78G 2RO0A 1KD1R 2K7AA 1X6GA 1QVGP 5FU6B 5LJ5h 1BB9A 4OMNA 3OBYA 2FHDA 3VV0A 5L23A 1LJOA 3I56A 3I55A 4HVWA 1GXIE 1GCPA 3GBQA 1KFZA 4HT8A 1W2BA 1VQLQ 1W1FA 3MP6A 2GFUA 2NLUA 3TSWA 2OTJT 2FPFA 1NG2A 2K5FA 4DBRA 4M7DA 4KULA 3PTAA 1HXDA 4FCYA 3M0RA 1KQSP 2RHXA 1WQ7A 2RH2A 3M54A 1ZUKA 1QVGA 1UGPB 1UEBA 4KGXB 1HYOA 4JJNK 3CC4Q 2JTEA 2OTLT 4II1A 5AYFA 2V8IA 4JJCA 1PSFA 1Q86C 2CZ6B 2DD4A 2CP3A 4M75B 7AT1B 3PIOA 4A4FA 3L2RA 1D0XA 2HSPA 3DLMA 2JW4A 3CC2T 4J9EA 1WGSA 4DBQA 1VQ8Q 5GAMg 4M7AF 1IREB 1GFDA 4M77F 1S72T 2KK4A 2BZXA 2P0QA 3CCJQ 3L2WA 3TQ7P 1RABB 5LJ5j 2XU8A 2NYSA 3LYIA 1YJWA 1K8AR 2EQMA 3E1SA 3H41A 1AZEA 1U5SA 3EH1A 3BW1A 2YLBA 2QDYB 3JCMX 2KT8A 2C0IA 1EIFA 3A8LB 2VYTA 3SFMA 3AT1B 3M59A 3X24B 4E7KA 2CKKA 3CCVT 4BE1A 3TSZA 1TU0B 3S3NA 4PJOF 5KYWB 3DLLA 3L42A 4XU2A 3UT1A 1IO6A 4FYVB 4E7HA 4E7IA 1WJQA 3OS1A 1RAFB 4CC4B 1RAEB 3C0CA 1MNEA 1PD1A 4MZMA 2EYWA 5I2SA 1UHCA 4KH0B 3FEOA 3C4SA 3OBWA 5LJ3h 1UGSB 1XQHA 4A53A 2HBWA 1JJ2P 2M0YA 5DY9A 1GBRA 4BDYA 2RJDA 4PJOC 2KGTA 1KQ1A 2HMAA 3I55T 4FSSA 5KH6A 2OJ2A 2QEXT 2M1HA 2DL8A 5ECAA 1M3AA 3M4YA 2VXEA 4E7SA 1RACB 3EFOA 4PFZA 2EAYA 8ATCB 1D1BA 3HKSA 2HDAA 1X01A 2DL4A 2XG8D 1U8RA 3CCRQ 1KC8R 2DXTA 2KY9A 5KYUB 1F1BB 4MMLA 3CD6Q 3I9QA 3EG2A 3CCUA 1H3ZA 3JCMJ 3TCJA 1JJ2A 1OZ2A 2K3BA 2HQHA 2W10A 4RTVA 3JCMf 2SRCA 2PVGB 1IZ6A 5GANd 3GIBA 2EQIA 1LVKA 1UJYA 2DBMA 2CDTA 4Z02A 1LPLA 2ZPIB 1TUDA 3CCQA 3V7SA 3S3OA 1RL2A 2AK5A 3OYDA 3S3MA 2L3QA 2WACA 3PT9A 1BIAA 2RI2A 1I07A 3L1AA 3FIFA 4JLIA 2E1HA 3OW2S 5LJ3j 2ZPBB 1WZOA 4XTUA 3I5RA 4OMLA 4AMCA 1OYXA 3M0TA 4M4ZA 3PMTA 1OOTA 1T0JA 5FU7B 5CAIA 2DYBA 5IN1A 1AWXA 1W6XA 1UG1A 2PQWA 1N9SA 1Q95G 1GRIA 3UA7A 1KC8U 4C92B 2YWWA 3CCLA 1WNLA 4FYXB 1PRMC 2KT1A 1W70A 3JB9F 2FZKB 3MP1A 3SHWA 2EQJA 1YWOA 4LDWA 1RAGB 1MV0B 3UWNA 5LJ5g 2HZYA 5AT1B 1NYGA 2Y90A 1NEBA 4HA8A 3JB9H 4OGCA 5KCOA 1VQ5A 4KGVB 2AKKA 3VRZA 1WYXA 2QTVA 1M90U 1VQKA 5J26A 5HCKA 4PL6A 2KI7A 2P84A 2E3IA 1PWTA 2KXCA 4N4IA 1SHFA 2H3EB 3FC3A 2EKOA 4A63B 2CT4A 4RKUE 3H0IA 4DOVA 3ULRB 3FB9A 3HSBA 4M7DB 5A0GA 3ZFJA 4J9IA 1QVFP 1ARKA 3CCUT 4XTYA 1RI9A 1YWPA 3A98A 4AG2C 1YJNQ 1D1CA 3IQLA 2OX7A 3OMCA 5D6YA 2LX9A 4WF2A 1C6VX 3HRTA 3CCRT 4C5GA 4IUQA 2VGMA 3CD6T 1P92A 5I22A 3G4SA 4M75F 2C06A 3EG0A 1JRIA 2RK1A 2GTOA 2XICA 5M9OA 1VQ9A 1G3YA 2GF7A 3QPHA 3VS3A 1VQMQ 1QWEA 1XJWB 2FVUA 2CSQA 9ATCB 3NFCA 2RI3A 3JB9G 1M27C 2H3JA 2K79A 3ER0A 1FYNA 2DM1A 3QO3A 5GAMd 2DF6A 4MDXA 1U06A 4J9HA 4EDUA 1M4ZA 2EYZA 4HVVA 4BUGA 3G71Q 2VC8A 4PJLA 3OYMA 1PM3A 2FL7A 2K4YA 2LX7A 1VQ7A 1EX4A 4OB0B 2K9GA 1MMGA 2QTXA 2R57A 3URGA 1D1AA 2LQWA 2ECZA 5LJ3g 3WVDB 4RTXA 1UHFA 4FW2A 2FPDA 1GBQA 1H3HA 2EYYA 3OYBA 2QQAA 2QDLA 2K2MA 2BZ8A
chains in the Genus database with same CATH topology
4JS4A 4O5VA 2E10A 2D9TA 4GLKA 4EMKA 1K9MU 5HK3A 4M7DE 1YI2A 2JUFA 2YRVA 4XTZA 4BI4A 3CC2A 5GAN7 1KQSS 2EJGA 2RHZA 1OI1A 1N8RU 4OB3B 3MEVA 2O4XA 4L6V5 5D6WA 3SWNB 5I21A 2HNIA 2PUOB 3L2VA 3RKXA 2JNGA 3E9GA 2PVDB 3RMQA 5DLOA 2EYQA 2LQKA 2GQVA 3GF5A 3HRUA 3INZA 2DD5A 2AHJB 2JN0A 4PJOE 3META 3CC7A 4M7AC 2L5QA 1Y7XA 4ZN3A 1VQ6T 3MCAB 4M77C 4F7UG 3M56A 2RD1A 1WQWA 3CCJA 1VQ4T 2K2VA 4IUUA 1VQKA 3PMIA 2RHUA 2VXFA 3J7AF 4R56A 3CBOA 1D3BA 5LJ5e 1YITA 5GMKj 2DK3A 4A4HA 3LH0A 5GAOl 4CRIA 2K3XA 3ME9A 4L59A 4MMKA 5J3BA 1QP2A 1UGRB 5GMKl 4X9DA 1JBMA 2YLCA 3LGFA 1Q7YU 2M16A 3WXMB 1YIJA 1YHQT 1Q82C 4X34A 4C92A 3Q1JA 4M75G 1OZ3A 4BD3A 3N5BB 4N0AC 2XDBA 2MI6A 3QHSA 4O6JA 4BE0A 4M7DC 2PU9B 3JCMh 3TEEA 4C5EA 5GAN3 1LNXA 3VYGA 3OYAA 1QW1A 3OMGA 4BDZA 3M55A 4KUDK 2CZ0B 2F69A 2Y4YA 4PLLA 4QW2A 5IAYA 1LOJA 4OB2B 1VQNT 3V7CA 4ZTJA 2EQUA 4F7UE 4C0DB 1BI3A 4OGEA 3QIIA 2DEQA 3M53A 4QVZA 3TREA 5D6XA 1YJ9A 1BYMA 1G3SA 5CK9A 1N27A 2F5TX 2I2LA 3KXTA 4HCBA 4C92D 4PJOB 2EQKA 2VUBA 4HCZA 3SD4A 4V2SA 2ZPEB 3G4ST 3PIPA 3GNGA 4M78G 3GNFB 2RJEA 2RO0A 2KDSA 4MZPA 4M7AA 2QA4T 3LW5E 1YJNT 4M77A 4ZGEB 4EMHA 4QVCA 3CCST 2PVOB 5FU6B 5LJ5h 1FX7A 3C94A 5CCAA 3CXCA 3OBYA 2FHDA 3VV0A 1TH7A 5FRMA 1LJOA 3I56A 2ZPGB 3I55A 3BDLA 3LWHA 1H641 1KQ2A 2JTMA 2D0QB 1GXIE 1G3TA 2QQSA 3OS0A 2HQXA 3CCQT 2JVVA 4HT8A 1W2BA 4PKCC 2MMPA 3MP6A 2GFUA 2NLUA 1QVFA 2EWNA 5GAN4 4JRPA 4M7AD 2X4WA 2OTJT 1RI0A 3M58A 3MEAA 5GAOm 5GAMf 2K5FA 1BI1A 4N0AA 3OS2A 1VQLT 4A4GA 3BY7A 3F70A 4M7DA 3X26B 1VIFA 3QBYA 4KULA 4Q5WA 1HXDA 3PTAA 3CMAA 4OMFB 2LTOA 3A5ZB 5GAOr 1JJ2S 5A2QE 4E47A 2DZ9A 2RB6A 5EG2A 3FRNA 3CCET 2VV5A 4FSXA 1I4K1 2RHXA 1WQ7A 2RH2A 3CCRA 2WSCE 1B34A 3M54A 2GFAA 3P8DA 4C92F 1QVGA 1UGPB 5GMKi 5GAOn 1UEBA 2K5LA 3CD6A 1M1FA 3KUFA 3CCMT 4PJOA 2BIVA 4JJNK 2LRQA 4C8QB 4IUPA 5J39A 3JCMd 2WSFE 2OTLT 1NJIC 4II1A 2RK2A 4RCBA 5AYFA 3CCLT 4M7DD 3QJYA 2V8IA 1Q86C 1PSFA 2CZ6B 2DD4A 2DIQA 3L2UA 3DB3A 4M75B 5A0LA 2HQEA 2ZGWA 3CC4T 4JS5A 3TU4K 3QZ9B 4IUTA 3PIOA 4A4FA 3A8GB 1Y07A 3BDUA 4LDVA 3L2RA 3RUXA 4B9XA 3DLMA 1YI2T 3JCMW 3CC2T 3SB2A 5GANe 4E7JA 1WGSA 2X4XA 3G6EA 1VQMA 5GAMg 3CPWS 5CQYA 2EFIA 2ZZDA 3QKJA 1K73C 4M7AF 2EJFA 1IREB 3GLXA 4M77F 3QZ5B 1S72T 3X28B 4C0ZA 2KK4A 1Y96A 5LJ5d 1M9SA 1UB4A 2P0QA 4J8OA 3PFSA 2LDMA 3JCMe 5L8RE 3OYGA 3CMEA 1VQ5T 1VQ8T 4M78B 4ELZC 3HRSA 4NL3A 3L2WA 3SWNC 2A3LA 2GCXA 5LJ3e 1VQKT 3A8OB 3BFMA 5LJ5j 2A7YA 4XAXB 2XU8A 4KUIA 3JB9I 3LYIA 3CCJT 4BACA 1YJWA 4F7UA 2EQMA 3E1SA 1VQOA 3BW1A 2DIGA 2YLBA 1YITT 2QDYB 3X20B 2XI9A 3UPUA 2K57A 1U1TA 3JCMX 3QYGB 3HP9A 2JZ2A 4M7DF 1EIFA 2CZ1B 5I2MA 4DA4A 3A8LB 2F5KA 1NJIU 1YIJT 4KBMB 2K3YA 2VYTA 2E41A 4RCCA 3SFMA 1Q86U 3M59A 4DOWA 1K8AC 3X24B 4C8QG 4E7KA 2JOYA 2CKKA 3JCMc 3RKYA 1M5Q1 2LNVA 5GANh 5GAOq 3CCVT 4BE1A 2V8KA 3MP8A 1I81A 2L3RA 3VJPA 3S3NA 4PJOF 3DLLA 2X4YA 3L42A 4XU2A 3UT1A 3EFSA 4E7HA 4E7IA 1WJQA 3OS1A 2DJZA 2DXCA 4BY6B 1K73U 3LWIA 3JCMb 1YJ9T 2E70A 2KQWA 4JLGA 4MZMA 2QQRA 1VQPT 2O01E 3CPFA 3HFOA 5I2SA 4FT2A 4RG8A 3FEOA 2DZCA 3C4SA 1O9SA 2KMTA 3OBWA 3OYYA 4FIBA 1UGSB 5LJ3h 5HKCA 4Y28E 1XQHA 4ME7A 4A53A 3CEYA 1I5LA 2OAUA 3DKMA 5DY9A 3SWNA 4C0DC 4ZN1A 1VQ4A 2DXUA 4BDYA 2RJDA 4CI0C 4PJOC 3CBPA 4HKEA 3NTIA 5C0MA 1KQ1A 3I55T 2MF2A 5KH6A 2LC4A 3VUZA 2QEXT 4C8QE 1NE8A 2JTFA 2M1HA 4C92G 1VUBA 2EJ9A 2HBPA 3M4YA 2VXEA 5FU6C 1VQ9T 5CKBA 1R8OB 2EAYA 4BE2A 4M75E 3RMSA 3HKSA 3OYFA 3ZEHA 2BUDA 4J7FA 1X01A 1KHIA 4F7UF 2XK0A 2XG8D 1KHCA 3L2QA 1U8RA 2DXTA 2KY9A 4C0GA 4BB7A 3OYKA 1KD1C 1G5VA 4MMLA 4NL2A 2XDPA 3FLGA 3CCUA 1Q82U 1H3ZA 4A4EA 2PUKB 3JCMJ 4M77D 3JCMQ 2ZPHB 2LCLA 3TCJA 1OZ2A 2KVQG 5KCHA 3MHXA 1JJ2A 4LDUA 2DVEA 5GMKm 4MDWA 1FWZA 4XTVA 4ELYC 4FU6A 4M78E 3V8JA 1KC8C 3JCMf 2CYZB 5FLXE 2PVGB 5GAOp 1IZ6A 5GANd 4XU1A 3QJ6A 3RKWA 1YJNA 1VQ7T 3GIBA 3JCMV 5DLQE 2DTIA 4EMKB 3JB9D 2QI2A 2E6ZA 5GANj 3MO8A 4C8QC 4XQ3A 4Z02A 3JSCA 5GMKh 3LGLA 2ZPIB 1BKBA 1QVFS 2LT4A 1FXXA 1W4SA 3E9FA 2L89A 3V7SA 3CCQA 3OSVA 1RL2A 2O4XB 4PLIA 3S3OA 5LJ3d 3OYDA 4FT4A 3G6ET 3S3MA 4M75C 2WACA 5FRNA 3PT9A 3RIRA 4GY5A 1BIAA 2RI2A 2OTJA 3L1AA 4BI3A 3FIFA 4JLIA 5LJ5f 4NS5A 2E1HA 4FM4B 3OW2S 3O8VA 2YHTA 5LJ3j 1VQLA 2ZPBB 2E65A 4XTUA 3M57A 2P4TA 4VUBA 4DQ2A 3OY9A 4D6WA 4PJOD 1OYXA 4MZTA 4TVRA 1M90C 1KD1U 3VYHB 1XTDA 2B8AA 3M5AA 4PNOA 1NZ9A 1KQSA 3PMTA 3QG1A 4XU0A 3CCEA 2E12A 2KSSA 1BIBA 3QYHB 1D3BB 5DM7R 3OS5A 2R58A 3P8BB 4UC4A 1VQOT 3J81E 2LVMA 2ZCFB 3JCMg 1G3WA 2KAFA 5FU7B 3OYLA 3CC7T 5CAIA 2QXFA 4M78C 4IURA 4XK8E 5IN1A 3CCMA 3C12A 4J5YA 4QQDA 2PQWA 3OYNA 1N9SA 1O75A 3OYEA 2CS7A 1M1GA 2DTHA 1KC8U 2RHYA 3WVEB 2HD0A 4C5IA 4C92B 1WNLA 3C95A 3V8KA 3CCLA 2K5IA 2QQ9A 1HK9A 4FL6A 1DJ7B 3JB9F 4EPCA 3VU3C 2X35A 3HL8A 3QXEB 4N4HA 3JAME 2L8DA 3MP1A 2EQJA 3G71A 5CR2A 4LDWA 2Y4XA 1VIEA 2X4JA 2G3RA 3RESA 4C8QA 3UWNA 3V7RA 4JRQA 4RG2A 5CVIA 4E7LA 5LJ5g 3HHTB 3VKIA 3OYJA 2RJFA 2D6FA 3RERA 3SDZA 2Y90A 3P8HA 1S72A 4M75A 4HA8A 4J83A 3JB9H 3S6WA 4EMGA 4OGCA 2RI5A 3OYCA 1YBYA 1I8FA 5KE3A 2M9UA 2BKDN 5KCOA 2MWOA 1VQ5A 4A4KA 1VQ8A 4M7AB 3HPWA 4M77B 4N4GA 1Y71A 1M90U 3CBMA 4BY6C 2DKGA 5CO7A 1NPPA 2P0PA 5J26A 4C8QD 3NTKA 4C0FA 4PL6A 1XOVA 1V29B 3R6OA 4R55A 3OYHA 3OA6A 1Q81C 1QVPA 5CQXA 2LCCA 3E19A 4N4IA 3ZBDA 4M75D 1VQ6A 4XU3A 1NPRA 4OF1A 4M78A 3H8ZA 3UDCA 2RM4A 3QDRB 4QQ6A 4QVDA 5GAMh 2XIDA 1BI2A 3FC3A 5LL6S 2WSEE 3OQ5A 2EKOA 5GAN8 4RKUE 3I56T 4JRKA 5HK0A 1JB0E 3JB9J 4KT0E 4DOVA 2E64A 2MWPA 3FB9A 2IG0A 4HCCA 3HSBA 1M1KC 1XNIA 4M7DB 2ZPFB 5C6SA 3M4GA 3PGGA 2XKOC 3A8MB 5A0GA 3M9QA 3FJPA 5GMKe 3CCVA 3ZFJA 4B9WA 3X25B 1YHQA 2MAMA 3DB4A 5GAN2 5CKFA 3CCUT 1B34B 1ZBXA 4XTWA 4M78D 4XTYA 5CIUA 3HFNA 3MEUA 4C5HA 3GOXA 4J7IA 1K8AU 1X6OA 2XHCA 5IT9E 1MHNA 1VQPA 3OMCA 3CMAT 3KBGA 4Y91A 3A8HB 5D6YA 4LDXA 2LX9A 2M0OA 4WF2A 1VQNA 4JUVA 5GANf 3HRTA 4OP0A 4C8QF 2FYKA 3CCRT 1PSEA 2V8JA 2RA2A 3FDRA 4C5GA 4IUQA 4HT9A 2VGNA 1KG1A 2XDDA 2VGMA 2DAQA 5KE2A 1P92A 3CD6T 4M7AG 1WPYA 2E5QA 3G4SA 3EFRA 4ZGDB 3V8LA 2RJCA 4M75F 1Q81U 3JCMP 4M77G 1SSFA 4P5NA 1QP3A 3OB9A 4J6YA 1X75C 3CXCS 2QEXA 2QA4A 2C06A 1M8VA 2DPPB 1JRIA 1U1SA 2RK1A 4NOYA 2XD0A 2XICA 3CCSA 5LJ3f 5FROA 1YCYA 4C92E 5M9OA 4ZGJB 1VQ9A 1G3YA 1N6AA 2GF7A 3MEWA 3QPHA 5HY6A 1Y96B 5CKEA 3AHUA 4EMKC 1K9MC 3QSUA 4X9CA 1W2BS 3L2ZA 2CGHA 2EIFA 2RHIA 3GP8A 2HAXA 4ZTFA 2FVUA 5CKHA 3LLRA 3EAEA 4LD9K 2QQBA 1N8RC 1M1KU 3NFCA 2RI3A 3JB9G 1VQMT 2H3JA 3OW2A 5A0DA 4M78F 4JDSA 2R5AA 3LX7A 4F7UB 3ER0A 4RMOA 4QQGA 3CPWA 4M7DG 3QO3A 2LQ8A 1ZQ1A 4LDYA 5GAMd 1UGQB 1BI0A 5GAN6 3OYIA 4MDXA 3CMET 3GPLA 1N9RA 4IKFA 5GANg 2DO3A 4IUVA 4EDUA 1M4ZA 1WJSA 3G7ZA 4OB1B 4BUGA 4M7AE 2VC8A 3OYMA 1ZHIA 3T9NA 4A54A 4M77E 2FL7A 1QVGS 3OSSC 2DXBA 3JRZA 2K4YA 4OVAA 5GAMj 4J6WA 5GAN5 1VQ7A 1YJWT 3NTHA 2LT1A 3QUIA 2R5MA 4OB0B 4PJOG 4LD6A 5FU7C 2FB7A 3G71T 2QTXA 2R57A 3URGA 3VUBA 3J80E 4L5GA 5LJ3g 1WJRA 4ATOA 2IVWA 1AHJB 4XTXA 5CKDA 3WVDB 4YTLA 1Q7YC 2OTLA 4C92C 3ASKA 4BI8B 3PNWC 2QQAA 4JRIA 2DTOA 3OYBA 2CZ7B 5GAMe 2E6NA 2P0KA 3CC4A 4J6XA 1MGQA 3H6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZBX A;  1M4Z A;  4DA4 A;  1ZHI A;  2FL7 A;  4JJN K;  4BB7 A;  4DOW A;  1W4S A;  2FVU A;  4LD9 K;  3TU4 K;  4FT4 A;  4KUI A;  3PT9 A;  4KUL A;  4DOV A;  3PTA A;  4FSX A;  4KUD K;  4FT2 A; 
#chains in the Genus database with same CATH topology
 1D0Y A;  1YI2 A;  4XTZ A;  1U3O A;  1N8R U;  3MEV A;  2O4X A;  4L6V 5;  5I21 A;  2L2P A;  1IHV A;  1G2B A;  3E9G A;  2EKH A;  1FMV A;  1VQ4 Q;  3CC7 A;  2L5Q A;  1Y7X A;  4DBF A;  3M56 A;  3EFO B;  1WQW A;  2OI3 A;  1AEY A;  2K2V A;  3PMI A;  2VXF A;  2KR3 A;  1D3B A;  1YHQ Q;  3ZL7 C;  2O88 A;  4A4H A;  1VYU A;  4MMK A;  3ME9 A;  5J3B A;  2DJQ A;  5GMK l;  4X9D A;  1JBM A;  3CXC P;  2M16 A;  3WXM B;  1YIJ A;  2M02 A;  3Q1J A;  4M75 G;  1OZ3 A;  4E2F B;  2PU9 B;  3JCM h;  3OYA A;  5GAN 3;  1LNX A;  3VYG A;  1IGQ A;  2Y4Y A;  2KRS A;  4QW2 A;  2LQN A;  3V7C A;  4F7U E;  1BI3 A;  3TRE A;  1YJ9 A;  1PNJ A;  2ZAE A;  5D6X A;  1G3S A;  5CK9 A;  4PJO B;  2QAS A;  4HCZ A;  4V2S A;  3G4S T;  1MMN A;  2AZS A;  3GNF B;  2RJE A;  4F04 B;  3LW5 E;  1YJN T;  3TVT A;  3CXC A;  2ZPG B;  4HCK A;  1KK7 A;  2LMJ A;  3LWH A;  1IHW A;  2JTM A;  1AWW A;  2HQX A;  4PKC C;  2MMP A;  2RQV A;  2HEQ A;  1RI0 A;  1Y57 A;  1ABQ A;  1PKS A;  4A4G A;  2A08 A;  5GAO r;  4OMF B;  3A5Z B;  5A2Q E;  2DZ9 A;  4CC3 A;  3FRN A;  1J3T A;  4FSX A;  2OTL Q;  4C92 F;  5GAO n;  4GLM A;  4J9G A;  3KUF A;  1OX9 A;  2BIV A;  5J39 A;  2JJ9 A;  2WSF E;  4X1V A;  2C0T A;  3DB3 A;  3CC2 Q;  4J9D A;  1OEB A;  3A8G B;  3BDU A;  3RUX A;  4B9X A;  1T3S A;  1YI2 T;  2YUO A;  1SHG A;  2KEA A;  3CPW S;  4DEX A;  3QKJ A;  3GLX A;  3QZ5 B;  4C0Z A;  5LJ5 d;  3VS7 A;  1UB4 A;  3CME A;  3JCM e;  3OYG A;  2YUN A;  2ABL A;  4ELZ C;  3SWN C;  2A3L A;  2YT6 A;  2NWM A;  3JB9 I;  2EBP A;  4J9C A;  4F7U A;  1VQO A;  2X9H A;  2DIG A;  3X20 B;  2XI9 A;  2DA9 A;  4M7D F;  2CZ1 B;  2KRO A;  2GNC A;  4DA4 A;  4AFQ C;  1NJI U;  1YIJ T;  2K3Y A;  2E41 A;  1HSQ A;  3HTR A;  2J6F A;  4DOW A;  3EGX A;  4Z8A A;  1Q81 R;  1K8A C;  4C8Q G;  1M5Q 1;  2LNV A;  3QWY A;  4PJN A;  2L3R A;  1SF9 A;  3VS4 A;  2PNI A;  1K73 U;  3JCM b;  1YJ9 T;  2KQW A;  4JLG A;  2Z0W A;  1VQP T;  3HFO A;  4RG8 A;  4FIB A;  2KMT A;  5HKC A;  4Y28 E;  4DEY A;  4ME7 A;  3I55 Q;  1WHM A;  1I5L A;  2OAU A;  3EG9 A;  3SWN A;  4CI0 C;  4J9F A;  3CBP A;  1X2Q A;  4HKE A;  5C0M A;  3REA B;  2MF2 A;  1WXB A;  1NE8 A;  2JTF A;  2FPE A;  4C92 G;  1VUB A;  2HBP A;  2VWF A;  3RMS A;  3ZEH A;  4Z89 A;  1EFN A;  2D1X A;  2DBK A;  1T0H A;  2XK0 A;  2QK0 A;  4KRT A;  2VB6 A;  4A4E A;  4KH1 B;  3JCM Q;  3MJX A;  2J6K A;  4LE9 A;  1RLQ C;  1FWZ A;  4FU6 A;  1KC8 C;  5FLX E;  5GAO p;  4XU1 A;  3JCM V;  1ZBJ A;  1MMA A;  2VKN A;  3NHN A;  2QI2 A;  2E6Z A;  1PRL C;  4EIK A;  2QGF B;  1OPK A;  2ED0 A;  5GMK h;  1KIK A;  1W4S A;  3E9F A;  2L89 A;  3OSV A;  2O4X B;  5LJ3 d;  3RIR A;  2FG0 A;  4BI3 A;  4NS5 A;  4FM4 B;  4OMM A;  1VQL A;  1YJW Q;  3D7S B;  2HSE B;  1M90 C;  1KD1 U;  3M5A A;  2RF0 A;  1KQS A;  3CCE A;  1TUC A;  2E12 A;  2IIM A;  3EGD A;  1D3B B;  5DM7 R;  3OS5 A;  2R58 A;  3P8B B;  4UC4 A;  1VQO T;  3JCM g;  1G3W A;  1X6B A;  1OU8 A;  2QXF A;  3CCM A;  2YXY A;  4J5Y A;  1O75 A;  2CS7 A;  4FYW B;  1JU5 C;  4EPC A;  3JAM E;  3QXE B;  1SRM A;  2Y4X A;  3VS2 A;  1VIE A;  2X4J A;  3V7R A;  4JRQ A;  2LNH B;  4RG2 A;  2RPN A;  2H8H A;  5CVI A;  1WXT A;  2RJF A;  2O9V A;  2D6F A;  3RER A;  3OYC A;  1YBY A;  1QQJ A;  2BKD N;  1WFW A;  2J05 A;  2JS2 A;  2M9U A;  1ZSZ C;  1VQ8 A;  3HPW A;  3PE0 A;  2DKG A;  2P0P A;  1WHH A;  4C8Q D;  2CP6 A;  3NTK A;  2DVJ A;  3R6O A;  4XU3 A;  1NPR A;  1ZA2 B;  2RM4 A;  4QQ6 A;  1I5O B;  4JJD A;  2XID A;  4PJM A;  3I56 T;  1JB0 E;  3CCU Q;  1EZZ B;  1WHJ A;  2IG0 A;  5C6S A;  3A8M B;  3FJP A;  5GMK e;  4B9W A;  4PJJ A;  2DIL A;  2MAM A;  1ZBX A;  4XTW A;  4M78 D;  3O5Z A;  3GOX A;  1K8A U;  1X6O A;  1MHN A;  2DYI A;  1WDX A;  1TWB A;  3OW2 P;  3KBG A;  4LDX A;  1ZSZ A;  1VQN A;  1PKT A;  2V8J A;  1KG1 A;  4QT7 A;  4CC2 A;  1E6G A;  1SG5 A;  2NUP B;  4M7A G;  3EFR A;  4M77 G;  4P5N A;  1QP3 A;  3OB9 A;  2YSQ A;  3CCS A;  1YCY A;  5IHI A;  5EC7 A;  5HY6 A;  3AHU A;  4EMK C;  4RTT A;  3L2Z A;  2CGH A;  1M2V A;  3LLR A;  4LD9 K;  1N8R C;  3MPU B;  1I0C A;  3OW2 A;  3PVL A;  1Q86 R;  2RQR A;  4JDS A;  2R5A A;  4F7U B;  4RMO A;  1YNZ A;  3VS1 A;  2KXD A;  1UGQ B;  3GPL A;  2BZY A;  2P4R A;  2DER A;  1Z9Z A;  1Q7Y R;  2VVK A;  2CH4 W;  3OSS C;  2DEU A;  3JRZ A;  4OVA A;  4AT1 B;  2ENM A;  1YJW T;  4PJO G;  3EGX B;  3I35 A;  4LD6 A;  2FB7 A;  1OX8 A;  4L5G A;  4ATO A;  1K0S A;  4XTX A;  5CKD A;  1AWO A;  4YTL A;  3M0Q A;  3ASK A;  2CZ7 B;  2L3P A;  1MGQ A;  4JS4 A;  4O5V A;  4GLK A;  4EMK A;  1VQK Q;  3NPF A;  2YRV A;  1ZUU A;  2ROT A;  2RHZ A;  4OB3 B;  3EG9 B;  5D6W A;  3SWN B;  2HNI A;  2F1L A;  2JNG A;  3RMQ A;  2GQV A;  3LH5 A;  3GF5 A;  1C0M A;  2DD5 A;  1IRX A;  2EVR A;  3MCA B;  4RUG A;  1Q82 R;  2EPD A;  2RD1 A;  1PC0 A;  2FZG B;  2ED1 A;  3J7A F;  1YIT A;  1HJD A;  2MYS A;  2K3X A;  3MKD A;  4L59 A;  1YP5 A;  2YLC A;  3LGF A;  1Q7Y U;  4X34 A;  4N0A C;  2MIO A;  3G1J A;  4BE0 A;  1RAH B;  4C5E A;  2PZ1 A;  2L3S A;  1QW1 A;  1GFC A;  2CZ0 B;  2F69 A;  4PLL A;  5IAY A;  1QLY A;  4AFZ C;  1LOJ A;  2QGG A;  5IHK A;  3G4S Q;  1VQN T;  4E6R A;  1HD3 A;  2DEQ A;  4HCB A;  1AZG B;  1BCO A;  2F5T X;  2EQK A;  3SD4 A;  3GNG A;  1VQ9 Q;  1SSH A;  4J9B A;  1JQQ A;  2AZV A;  2KDS A;  4MZP A;  1E7O A;  4D8K A;  2RQU A;  4QVC A;  3CCS T;  3C94 A;  5CCA A;  1B3Q A;  2YRC A;  1TH7 A;  2KYM A;  5FWB A;  2KBT A;  2LZ6 B;  1H64 1;  1KQ2 A;  2COY A;  1G3T A;  4OMQ A;  3CCQ T;  2FO0 A;  1QVF A;  4DBH A;  2EWN A;  4Z88 A;  4JRP A;  3EGD B;  4M7A D;  2CUD A;  3M58 A;  3MEA A;  1BI1 A;  4N0A A;  3OS2 A;  3X26 B;  1VIF A;  3H9N A;  4Q5W A;  3CMA A;  2LTO A;  3EG1 A;  2RB6 A;  2VV5 A;  1I4K 1;  2IPO B;  1KJW A;  2A37 A;  5D7U A;  2GFA A;  3P8D A;  2X3W D;  2K5L A;  1M1F A;  2AIR B;  1R0C B;  2LRQ A;  4IUP A;  3JCM d;  1NJI C;  1MV3 A;  3CCL T;  3M0U A;  3QJY A;  6AT1 B;  1YI2 Q;  2J7I A;  4JS5 A;  3TU4 K;  4IUT A;  4LDV A;  1JO8 A;  3JCM W;  1X69 A;  3SB2 A;  1QMC A;  5GAN e;  2X4X A;  1VQM A;  3G6E A;  1SKU B;  2EFI A;  2ZZD A;  5CQY A;  1K73 C;  3X28 B;  1Y96 A;  1AD5 A;  1M9S A;  4J8O A;  1VQ5 T;  2LDM A;  5L8R E;  1ZA1 B;  2MOX A;  2E5K A;  1VQK T;  3BFM A;  4GBQ A;  4XAX B;  4BAC A;  1NBE B;  1YIJ Q;  1YIT T;  2YUQ A;  1U1T A;  3QYG B;  2L0A A;  1H8K A;  2F5K A;  1YFN A;  4KBM B;  2GBQ A;  1M8M A;  2JOY A;  1WHK A;  5GAO q;  1RLP C;  2V8K A;  3BE3 A;  1AWJ A;  1I81 A;  1ZSZ B;  3MP8 A;  3VJP A;  1YJ9 Q;  1WHL A;  2CSI A;  1VQP Q;  2X4Y A;  4ORZ A;  2DJZ A;  1H92 A;  2DXC A;  3LWI A;  2E70 A;  2SEM A;  2QQR A;  3CPF A;  2K6D A;  2DZC A;  3OYY A;  1O9S A;  1K76 A;  3CEY A;  3U23 A;  4ZN1 A;  1VQ4 A;  2DXU A;  2EYX A;  1SEM A;  1M2V B;  4C8Q E;  2CUB A;  4AFS C;  2EJ9 A;  1VQ9 T;  5CKB A;  1R8O B;  2O9S A;  4BE2 A;  3OYF A;  2EGE A;  4J7F A;  2J06 A;  1KHI A;  3CQT A;  2OAW A;  4F7U F;  1KHC A;  4C0G A;  1G5V A;  1KD1 C;  4ZNX A;  3FLG A;  3CPW P;  2LCL A;  5KCH A;  2KVQ G;  3MHX A;  3R6N A;  4LDU A;  2DVE A;  2CP7 A;  5GMK m;  4MDW A;  4ELY C;  1FMW A;  4M78 E;  2KE9 A;  2CYZ B;  5IHN A;  1VQ7 T;  5DLQ E;  2DTI A;  2MCN A;  4EMK B;  3JB9 D;  3MO8 A;  4C8Q C;  1BKB A;  1FXX A;  2CH4 A;  3G6E T;  4FT4 A;  3CME Q;  5FRN A;  4RTU A;  2OTJ A;  2O2O A;  4HVU A;  3O8V A;  1RAD B;  1TG0 A;  2P4T A;  1TXQ A;  1VQO Q;  4D6W A;  4TVR A;  1XTD A;  4PNO A;  2F2V A;  3QG1 A;  4XU0 A;  1ZX6 A;  1BIB A;  2KNB B;  1G83 A;  3J81 E;  2ZCF B;  3OYL A;  2KAF A;  3CC7 T;  4M78 C;  4QQD A;  1FMK A;  3OYN A;  4AG1 C;  2X51 A;  2RHY A;  4C5I A;  2K5I A;  2QQ9 A;  1HK9 A;  1DJ7 B;  4E7Z A;  4IIM A;  4N4H A;  5CR2 A;  1BU1 A;  1WXU A;  2G3R A;  3RES A;  2D0N A;  4C8Q A;  4PK4 A;  3VS0 A;  4JPB W;  1QCF A;  3HHT B;  2NUZ A;  4F14 A;  3SDZ A;  1S72 A;  2DRK A;  1I8F A;  2QYZ A;  2MWO A;  4A4K A;  2DRM A;  1QKW A;  3CBM A;  4BY6 C;  1NPP A;  2LP5 A;  4C0F A;  1XOV A;  1V29 B;  2HKQ B;  2DFU A;  1M1K R;  1QVP A;  5CQX A;  1AOJ A;  2LCC A;  3E19 A;  1VQ6 A;  4M75 D;  3I56 Q;  4M78 A;  3QDR B;  4QVD A;  1V76 A;  2WSE E;  5HK0 A;  2DL5 A;  2MWP A;  4HCC A;  2CP0 A;  2O31 A;  1WLP B;  2ZPF B;  3M4G A;  3PGG A;  2XKO C;  3CCV A;  3DB4 A;  5GAN 2;  5CKF A;  5CIU A;  1PHT A;  3HFN A;  2A0F B;  2XHC A;  5IT9 E;  2XMF A;  5IXB A;  1PG5 B;  4Y91 A;  3NGP A;  4D8D A;  5GAN f;  4OP0 A;  2FYK A;  1WA7 A;  2RA2 A;  1TS9 A;  1K9M R;  1WPY A;  2V1R A;  4ZGD B;  2RJC A;  1Q81 U;  3JCM P;  1SSF A;  4J6Y A;  2J6O A;  1K0X A;  2QEX A;  2QA4 A;  2JXB A;  1M8V A;  2DPP B;  5FRO A;  1WIE A;  4ZGJ B;  3VS5 A;  1N6A A;  1Y96 B;  5CKE A;  4K11 A;  1UUE A;  1QCO A;  3A1P A;  3I5S A;  4X9C A;  1W2B S;  2HAX A;  3GP8 A;  2RHI A;  2DL3 A;  3CCE Q;  4ZTF A;  5CKH A;  1UE9 A;  3EAE A;  2QQB A;  4CC7 A;  1M1K U;  2FEI A;  1VYT A;  3CCM Q;  1UGV A;  1SRL A;  4M7D G;  2LQ8 A;  5GAN 6;  3CME T;  2DO3 A;  2YUP A;  2CT3 A;  3KFV A;  1WJS A;  3G7Z A;  2FRY A;  4M7A E;  1ZHI A;  2JMC A;  4A54 A;  4M77 E;  1QVG S;  2DXB A;  1RAA B;  4ESR A;  3QUI A;  2R5M A;  2YRD A;  3J80 E;  2FZC B;  1WJR A;  1AHJ B;  1Q7Y C;  2LJ0 A;  4BI8 B;  3M0S A;  3PNW C;  4JRI A;  2KYB A;  2NUT A;  3CC4 A;  3H6Z A;  2E10 A;  2D9T A;  1K9M U;  1ZUY A;  2CRE A;  2JUF A;  4BI4 A;  1KQS S;  2EJG A;  2EGA A;  3JV3 A;  1UJ0 A;  2PVD B;  3NMZ C;  5DLO A;  1IGU A;  2EYQ A;  3HRU A;  2AHJ B;  1OUL A;  4PJO E;  3MET A;  2DNU A;  1R0B G;  4M7A C;  1TUG B;  4ZN3 A;  1VQ6 T;  4M77 C;  1M30 A;  1YN8 A;  3CCJ A;  4IUU A;  2RHU A;  5LJ5 e;  3E2U A;  3EH2 A;  5GMK j;  5GAO l;  3LH0 A;  4CRI A;  1VOM A;  1PCX A;  1UGR B;  1Q82 C;  1ZLM A;  1LCK A;  4BD3 A;  2A28 A;  1VQN Q;  4O6J A;  2MPX C;  3TEE A;  2G6F X;  3OMG A;  2C0O A;  4LXC A;  4OB2 B;  2DE0 X;  4QKU A;  2EQU A;  3QII A;  1BK2 A;  5IH2 A;  4HXJ A;  1N27 A;  1T3L A;  4C92 D;  2VUB A;  3CCS Q;  2QAZ A;  2ESW A;  4M7A A;  2QA4 T;  1M2O A;  1CKA A;  4M77 A;  4ZGE B;  2I0N A;  4EMH A;  2PVO B;  4Y92 A;  1FX7 A;  3CCQ Q;  2V26 A;  5FRM A;  3RDV A;  3BDL A;  1UFF A;  1C1A A;  2D0Q B;  2QQS A;  3OS0 A;  2JVV A;  2B86 A;  1K4U S;  1WHG A;  5GAN 4;  4ANJ A;  2X4W A;  5GAO m;  5GAM f;  5KYX A;  1X2K A;  1VQL T;  4LNP A;  2JT4 A;  3BY7 A;  3F70 A;  4OMO A;  3QBY A;  1RAI B;  1JJ2 S;  1QCN A;  4E47 A;  2COZ A;  5EG2 A;  3CCE T;  4FW1 A;  2JMA A;  2BTT A;  3EHR A;  3CCR A;  2WSC E;  1B34 A;  2KRM A;  3UA6 A;  4PFO A;  3M0P A;  3CCL Q;  2DMO A;  5GMK i;  3CD6 A;  3CCM T;  4PJO A;  4JJB A;  4C8Q B;  1E6H A;  1M90 R;  4RCB A;  2RK2 A;  4M7D D;  3RR6 A;  2DIQ A;  3L2U A;  5A0L A;  2HQE A;  2ZGW A;  3CC4 T;  1B7T A;  3QZ9 B;  1D0Z A;  1IXD A;  2LCS A;  1Y07 A;  1I1J A;  2DLP A;  2F2W A;  2RMO A;  4E7J A;  1A0N B;  2W0Z A;  1VQ5 Q;  1BCM A;  2HL5 C;  2EJF A;  1G8X A;  4LN2 A;  4LUD A;  1ABO A;  1VQ8 T;  3PFS A;  4M78 B;  3HRS A;  4NL3 A;  1R77 A;  1YIT Q;  5LJ3 e;  2GCX A;  3A8O B;  1MMD A;  2A7Y A;  4KUI A;  3CCJ T;  1K9A A;  3UPU A;  2K57 A;  3HP9 A;  2JZ2 A;  2GGR A;  5I2M A;  1KSW A;  4RCC A;  1Q86 U;  5KYY A;  2GTJ A;  4RTZ A;  2RQT A;  3VS6 A;  3JCM c;  3RKY A;  1QKX A;  5GAN h;  4RTW A;  3EFS A;  4JZ3 A;  4BY6 B;  2LJ1 A;  1MUZ A;  2O01 E;  4FT2 A;  1NEG A;  3H0F A;  5IXF A;  4B6M A;  2HL3 A;  3DKM A;  4C0D C;  2RNA A;  3NTI A;  2JS0 A;  4AFU C;  1JEG A;  2M51 A;  2LC4 A;  3VUZ A;  1N5Z A;  5FU6 C;  5KYN A;  2RN8 A;  4M75 E;  3CMA Q;  2BUD A;  2ATC B;  3L2Q A;  5FW9 A;  2KRN A;  1Y0M A;  4BB7 A;  3OYK A;  2HCK A;  4NL2 A;  2XDP A;  1Q82 U;  2PUK B;  4M77 D;  2ZPH B;  1BBZ A;  1VA7 A;  1VQ7 Q;  3FJ5 A;  4XTV A;  1N8R R;  3V8J A;  1ZSG A;  3RKW A;  3QJ6 A;  1YJN A;  1TTH B;  2NUT B;  1AVZ C;  4WCI A;  4F16 A;  3G6E Q;  2V1Q A;  5GAN j;  4XQ3 A;  3JSC A;  3LGL A;  1QVF S;  2LT4 A;  4PLI A;  2CP5 A;  4M75 C;  1JXO A;  4GY5 A;  2F2X A;  4F17 A;  5LJ5 f;  1AT1 B;  1SPK A;  2YHT A;  1OPL A;  2E65 A;  1MND A;  3M57 A;  4VUB A;  4DQ2 A;  3OY9 A;  4PJO D;  4MZT A;  3CC7 Q;  3VYH B;  2B8A A;  1NZ9 A;  2BE9 B;  2KSS A;  3QYH B;  1UDL A;  1V1C A;  2LVM A;  3REB B;  4IUR A;  4XK8 E;  3C12 A;  3RBB B;  2RQW A;  3OYE A;  1M1G A;  2DTH A;  3WVE B;  2HD0 A;  3SEM A;  3C95 A;  3V8K A;  4FYY B;  4FL6 A;  4OMP A;  1JXM A;  3VU3 C;  2X35 A;  3HL8 A;  2CP2 A;  3G71 A;  2L8D A;  1NYF A;  3EHQ A;  1TSF A;  2YDL A;  2GQI A;  4E7L A;  8AT1 B;  2A36 A;  3VKI A;  3OYJ A;  4KGZ B;  3P8H A;  2LJ3 A;  4M75 A;  4J83 A;  3S6W A;  4EMG A;  2RI5 A;  2JM9 A;  5KE3 A;  3VRY A;  4M7A B;  4M77 B;  4N4G A;  1Y71 A;  2EW3 A;  5CO7 A;  3QDF A;  3OYH A;  4R55 A;  4JZ4 A;  3OA6 A;  1Q81 C;  3PVQ A;  3EGU A;  2MK5 A;  3ZBD A;  1UTI A;  1S1N A;  4OF1 A;  5GJV B;  3H8Z A;  3UDC A;  1OQK A;  5GAM h;  1BI2 A;  1YCS B;  2HKN A;  5LL6 S;  3OQ5 A;  1OV3 A;  5GAN 8;  5KYX B;  4JRK A;  4RTY A;  3JB9 J;  4KT0 E;  2E64 A;  1M1K C;  1XNI A;  1TOV A;  3M9Q A;  2BE7 D;  3X25 B;  1NLO C;  1YHQ A;  1B34 B;  2DX1 A;  3MEU A;  3UAT A;  4C5H A;  4J7I A;  4R0K A;  1VQP A;  2DL7 A;  1IB8 A;  3CMA T;  1GL5 A;  3A8H B;  2M0O A;  5KYW A;  4JUV A;  4C8Q F;  1PSE A;  3FDR A;  4PFP A;  4HT9 A;  2VGN A;  2XDD A;  2QG9 B;  1QWF A;  2DAQ A;  5KE2 A;  2E5Q A;  3V8L A;  2AT1 B;  1X75 C;  3CXC S;  2OTJ Q;  1U1S A;  4NOY A;  2XD0 A;  1NLP C;  5LJ3 f;  4WTO B;  4C92 E;  2D8J A;  3MEW A;  1K1Z A;  1K9M C;  5GJW B;  3QSU A;  1B07 A;  2EIF A;  2EGC A;  1RUW A;  1VQM T;  1WX6 A;  1NJI R;  5A0D A;  4M78 F;  3LX7 A;  4QQG A;  3CPW A;  4LDY A;  1ZQ1 A;  3OYI A;  1BI0 A;  1N9R A;  4IKF A;  5GAN g;  4IUV A;  4OB1 B;  5KYU A;  2E3H A;  3T9N A;  3THK A;  1VYV A;  5GAM j;  1K73 R;  4J6W A;  5GAN 5;  3NTH A;  2LT1 A;  5KYY B;  2PTK A;  2ROL A;  5FU7 C;  3G71 T;  3VUB A;  2FRW A;  1M3B A;  2NUP A;  1CKB A;  2IVW A;  1S72 Q;  2OTL A;  2AKL A;  4C92 C;  5I11 A;  1M3C A;  2DTO A;  5GAM e;  2E6N A;  2P0K A;  4J6X A;  1GCQ C;  5HK3 A;  4M7D E;  4IIO A;  3CC2 A;  5GAN 7;  4LUE A;  1CSK A;  1OI1 A;  1D09 B;  2PUO B;  3L2V A;  1VQ6 Q;  3RKX A;  2LQK A;  2JM8 A;  3INZ A;  2JN0 A;  3RNJ A;  1ACM B;  3QWX X;  4F7U G;  2X3X D;  5FWC A;  1VQ4 T;  3CCV Q;  1UEC A;  4R56 A;  1WI7 A;  3CBO A;  3EG3 A;  2DK3 A;  2D8H A;  1QP2 A;  1NM7 A;  1OU9 A;  2COW A;  1YHQ T;  2DET A;  4C92 A;  1PD0 A;  2E4H A;  3N5B B;  2VAS A;  2XDB A;  2MI6 A;  3QHS A;  4M7D C;  4BDZ A;  1W2B P;  1GCQ A;  3M55 A;  4KUD K;  1X43 A;  1Z9Q A;  3H0H A;  4ZTJ A;  4C0D B;  4OGE A;  1BYM A;  3M53 A;  4QVZ A;  3UF4 A;  2QEX Q;  2QA4 Q;  2I2L A;  3KXT A;  1X27 A;  2ZPE B;  3PIP A;  4M78 G;  2RO0 A;  1KD1 R;  2K7A A;  1X6G A;  1QVG P;  5FU6 B;  5LJ5 h;  1BB9 A;  4OMN A;  3OBY A;  2FHD A;  3VV0 A;  5L23 A;  1LJO A;  3I56 A;  3I55 A;  4HVW A;  1GXI E;  1GCP A;  3GBQ A;  1KFZ A;  4HT8 A;  1W2B A;  1VQL Q;  1W1F A;  3MP6 A;  2GFU A;  2NLU A;  3TSW A;  2OTJ T;  2FPF A;  1NG2 A;  2K5F A;  4DBR A;  4M7D A;  4KUL A;  3PTA A;  1HXD A;  4FCY A;  3M0R A;  1KQS P;  2RHX A;  1WQ7 A;  2RH2 A;  3M54 A;  1ZUK A;  1QVG A;  1UGP B;  1UEB A;  4KGX B;  1HYO A;  4JJN K;  3CC4 Q;  2JTE A;  2OTL T;  4II1 A;  5AYF A;  2V8I A;  4JJC A;  1PSF A;  1Q86 C;  2CZ6 B;  2DD4 A;  2CP3 A;  4M75 B;  7AT1 B;  3PIO A;  4A4F A;  3L2R A;  1D0X A;  2HSP A;  3DLM A;  2JW4 A;  3CC2 T;  4J9E A;  1WGS A;  4DBQ A;  1VQ8 Q;  5GAM g;  4M7A F;  1IRE B;  1GFD A;  4M77 F;  1S72 T;  2KK4 A;  2BZX A;  2P0Q A;  3CCJ Q;  3L2W A;  3TQ7 P;  1RAB B;  5LJ5 j;  2XU8 A;  2NYS A;  3LYI A;  1YJW A;  1K8A R;  2EQM A;  3E1S A;  3H41 A;  1AZE A;  1U5S A;  3EH1 A;  3BW1 A;  2YLB A;  2QDY B;  3JCM X;  2KT8 A;  2C0I A;  1EIF A;  3A8L B;  2VYT A;  3SFM A;  3AT1 B;  3M59 A;  3X24 B;  4E7K A;  2CKK A;  3CCV T;  4BE1 A;  3TSZ A;  1TU0 B;  3S3N A;  4PJO F;  5KYW B;  3DLL A;  3L42 A;  4XU2 A;  3UT1 A;  1IO6 A;  4FYV B;  4E7H A;  4E7I A;  1WJQ A;  3OS1 A;  1RAF B;  4CC4 B;  1RAE B;  3C0C A;  1MNE A;  1PD1 A;  4MZM A;  2EYW A;  5I2S A;  1UHC A;  4KH0 B;  3FEO A;  3C4S A;  3OBW A;  5LJ3 h;  1UGS B;  1XQH A;  4A53 A;  2HBW A;  1JJ2 P;  2M0Y A;  5DY9 A;  1GBR A;  4BDY A;  2RJD A;  4PJO C;  2KGT A;  1KQ1 A;  2HMA A;  3I55 T;  4FSS A;  5KH6 A;  2OJ2 A;  2QEX T;  2M1H A;  2DL8 A;  5ECA A;  1M3A A;  3M4Y A;  2VXE A;  4E7S A;  1RAC B;  3EFO A;  4PFZ A;  2EAY A;  8ATC B;  1D1B A;  3HKS A;  2HDA A;  1X01 A;  2DL4 A;  2XG8 D;  1U8R A;  3CCR Q;  1KC8 R;  2DXT A;  2KY9 A;  5KYU B;  1F1B B;  4MML A;  3CD6 Q;  3I9Q A;  3EG2 A;  3CCU A;  1H3Z A;  3JCM J;  3TCJ A;  1JJ2 A;  1OZ2 A;  2K3B A;  2HQH A;  2W10 A;  4RTV A;  3JCM f;  2SRC A;  2PVG B;  1IZ6 A;  5GAN d;  3GIB A;  2EQI A;  1LVK A;  1UJY A;  2DBM A;  2CDT A;  4Z02 A;  1LPL A;  2ZPI B;  1TUD A;  3CCQ A;  3V7S A;  3S3O A;  1RL2 A;  2AK5 A;  3OYD A;  3S3M A;  2L3Q A;  2WAC A;  3PT9 A;  1BIA A;  2RI2 A;  1I07 A;  3L1A A;  3FIF A;  4JLI A;  2E1H A;  3OW2 S;  5LJ3 j;  2ZPB B;  1WZO A;  4XTU A;  3I5R A;  4OML A;  4AMC A;  1OYX A;  3M0T A;  4M4Z A;  3PMT A;  1OOT A;  1T0J A;  5FU7 B;  5CAI A;  2DYB A;  5IN1 A;  1AWX A;  1W6X A;  1UG1 A;  2PQW A;  1N9S A;  1Q95 G;  1GRI A;  3UA7 A;  1KC8 U;  4C92 B;  2YWW A;  3CCL A;  1WNL A;  4FYX B;  1PRM C;  2KT1 A;  1W70 A;  3JB9 F;  2FZK B;  3MP1 A;  3SHW A;  2EQJ A;  1YWO A;  4LDW A;  1RAG B;  1MV0 B;  3UWN A;  5LJ5 g;  2HZY A;  5AT1 B;  1NYG A;  2Y90 A;  1NEB A;  4HA8 A;  3JB9 H;  4OGC A;  5KCO A;  1VQ5 A;  4KGV B;  2AKK A;  3VRZ A;  1WYX A;  2QTV A;  1M90 U;  1VQK A;  5J26 A;  5HCK A;  4PL6 A;  2KI7 A;  2P84 A;  2E3I A;  1PWT A;  2KXC A;  4N4I A;  1SHF A;  2H3E B;  3FC3 A;  2EKO A;  4A63 B;  2CT4 A;  4RKU E;  3H0I A;  4DOV A;  3ULR B;  3FB9 A;  3HSB A;  4M7D B;  5A0G A;  3ZFJ A;  4J9I A;  1QVF P;  1ARK A;  3CCU T;  4XTY A;  1RI9 A;  1YWP A;  3A98 A;  4AG2 C;  1YJN Q;  1D1C A;  3IQL A;  2OX7 A;  3OMC A;  5D6Y A;  2LX9 A;  4WF2 A;  1C6V X;  3HRT A;  3CCR T;  4C5G A;  4IUQ A;  2VGM A;  3CD6 T;  1P92 A;  5I22 A;  3G4S A;  4M75 F;  2C06 A;  3EG0 A;  1JRI A;  2RK1 A;  2GTO A;  2XIC A;  5M9O A;  1VQ9 A;  1G3Y A;  2GF7 A;  3QPH A;  3VS3 A;  1VQM Q;  1QWE A;  1XJW B;  2FVU A;  2CSQ A;  9ATC B;  3NFC A;  2RI3 A;  3JB9 G;  1M27 C;  2H3J A;  2K79 A;  3ER0 A;  1FYN A;  2DM1 A;  3QO3 A;  5GAM d;  2DF6 A;  4MDX A;  1U06 A;  4J9H A;  4EDU A;  1M4Z A;  2EYZ A;  4HVV A;  4BUG A;  3G71 Q;  2VC8 A;  4PJL A;  3OYM A;  1PM3 A;  2FL7 A;  2K4Y A;  2LX7 A;  1VQ7 A;  1EX4 A;  4OB0 B;  2K9G A;  1MMG A;  2QTX A;  2R57 A;  3URG A;  1D1A A;  2LQW A;  2ECZ A;  5LJ3 g;  3WVD B;  4RTX A;  1UHF A;  4FW2 A;  2FPD A;  1GBQ A;  1H3H A;  2EYY A;  3OYB A;  2QQA A;  2QDL A;  2K2M A;  2BZ8 A; 
#chains in the Genus database with same CATH homology
 4JS4 A;  4O5V A;  2E10 A;  2D9T A;  4GLK A;  4EMK A;  1K9M U;  5HK3 A;  4M7D E;  1YI2 A;  2JUF A;  2YRV A;  4XTZ A;  4BI4 A;  3CC2 A;  5GAN 7;  1KQS S;  2EJG A;  2RHZ A;  1OI1 A;  1N8R U;  4OB3 B;  3MEV A;  2O4X A;  4L6V 5;  5D6W A;  3SWN B;  5I21 A;  2HNI A;  2PUO B;  3L2V A;  3RKX A;  2JNG A;  3E9G A;  2PVD B;  3RMQ A;  5DLO A;  2EYQ A;  2LQK A;  2GQV A;  3GF5 A;  3HRU A;  3INZ A;  2DD5 A;  2AHJ B;  2JN0 A;  4PJO E;  3MET A;  3CC7 A;  4M7A C;  2L5Q A;  1Y7X A;  4ZN3 A;  1VQ6 T;  3MCA B;  4M77 C;  4F7U G;  3M56 A;  2RD1 A;  1WQW A;  3CCJ A;  1VQ4 T;  2K2V A;  4IUU A;  1VQK A;  3PMI A;  2RHU A;  2VXF A;  3J7A F;  4R56 A;  3CBO A;  1D3B A;  5LJ5 e;  1YIT A;  5GMK j;  2DK3 A;  4A4H A;  3LH0 A;  5GAO l;  4CRI A;  2K3X A;  3ME9 A;  4L59 A;  4MMK A;  5J3B A;  1QP2 A;  1UGR B;  5GMK l;  4X9D A;  1JBM A;  2YLC A;  3LGF A;  1Q7Y U;  2M16 A;  3WXM B;  1YIJ A;  1YHQ T;  1Q82 C;  4X34 A;  4C92 A;  3Q1J A;  4M75 G;  1OZ3 A;  4BD3 A;  3N5B B;  4N0A C;  2XDB A;  2MI6 A;  3QHS A;  4O6J A;  4BE0 A;  4M7D C;  2PU9 B;  3JCM h;  3TEE A;  4C5E A;  5GAN 3;  1LNX A;  3VYG A;  3OYA A;  1QW1 A;  3OMG A;  4BDZ A;  3M55 A;  4KUD K;  2CZ0 B;  2F69 A;  2Y4Y A;  4PLL A;  4QW2 A;  5IAY A;  1LOJ A;  4OB2 B;  1VQN T;  3V7C A;  4ZTJ A;  2EQU A;  4F7U E;  4C0D B;  1BI3 A;  4OGE A;  3QII A;  2DEQ A;  3M53 A;  4QVZ A;  3TRE A;  5D6X A;  1YJ9 A;  1BYM A;  1G3S A;  5CK9 A;  1N27 A;  2F5T X;  2I2L A;  3KXT A;  4HCB A;  4C92 D;  4PJO B;  2EQK A;  2VUB A;  4HCZ A;  3SD4 A;  4V2S A;  2ZPE B;  3G4S T;  3PIP A;  3GNG A;  4M78 G;  3GNF B;  2RJE A;  2RO0 A;  2KDS A;  4MZP A;  4M7A A;  2QA4 T;  3LW5 E;  1YJN T;  4M77 A;  4ZGE B;  4EMH A;  4QVC A;  3CCS T;  2PVO B;  5FU6 B;  5LJ5 h;  1FX7 A;  3C94 A;  5CCA A;  3CXC A;  3OBY A;  2FHD A;  3VV0 A;  1TH7 A;  5FRM A;  1LJO A;  3I56 A;  2ZPG B;  3I55 A;  3BDL A;  3LWH A;  1H64 1;  1KQ2 A;  2JTM A;  2D0Q B;  1GXI E;  1G3T A;  2QQS A;  3OS0 A;  2HQX A;  3CCQ T;  2JVV A;  4HT8 A;  1W2B A;  4PKC C;  2MMP A;  3MP6 A;  2GFU A;  2NLU A;  1QVF A;  2EWN A;  5GAN 4;  4JRP A;  4M7A D;  2X4W A;  2OTJ T;  1RI0 A;  3M58 A;  3MEA A;  5GAO m;  5GAM f;  2K5F A;  1BI1 A;  4N0A A;  3OS2 A;  1VQL T;  4A4G A;  3BY7 A;  3F70 A;  4M7D A;  3X26 B;  1VIF A;  3QBY A;  4KUL A;  4Q5W A;  1HXD A;  3PTA A;  3CMA A;  4OMF B;  2LTO A;  3A5Z B;  5GAO r;  1JJ2 S;  5A2Q E;  4E47 A;  2DZ9 A;  2RB6 A;  5EG2 A;  3FRN A;  3CCE T;  2VV5 A;  4FSX A;  1I4K 1;  2RHX A;  1WQ7 A;  2RH2 A;  3CCR A;  2WSC E;  1B34 A;  3M54 A;  2GFA A;  3P8D A;  4C92 F;  1QVG A;  1UGP B;  5GMK i;  5GAO n;  1UEB A;  2K5L A;  3CD6 A;  1M1F A;  3KUF A;  3CCM T;  4PJO A;  2BIV A;  4JJN K;  2LRQ A;  4C8Q B;  4IUP A;  5J39 A;  3JCM d;  2WSF E;  2OTL T;  1NJI C;  4II1 A;  2RK2 A;  4RCB A;  5AYF A;  3CCL T;  4M7D D;  3QJY A;  2V8I A;  1Q86 C;  1PSF A;  2CZ6 B;  2DD4 A;  2DIQ A;  3L2U A;  3DB3 A;  4M75 B;  5A0L A;  2HQE A;  2ZGW A;  3CC4 T;  4JS5 A;  3TU4 K;  3QZ9 B;  4IUT A;  3PIO A;  4A4F A;  3A8G B;  1Y07 A;  3BDU A;  4LDV A;  3L2R A;  3RUX A;  4B9X A;  3DLM A;  1YI2 T;  3JCM W;  3CC2 T;  3SB2 A;  5GAN e;  4E7J A;  1WGS A;  2X4X A;  3G6E A;  1VQM A;  5GAM g;  3CPW S;  5CQY A;  2EFI A;  2ZZD A;  3QKJ A;  1K73 C;  4M7A F;  2EJF A;  1IRE B;  3GLX A;  4M77 F;  3QZ5 B;  1S72 T;  3X28 B;  4C0Z A;  2KK4 A;  1Y96 A;  5LJ5 d;  1M9S A;  1UB4 A;  2P0Q A;  4J8O A;  3PFS A;  2LDM A;  3JCM e;  5L8R E;  3OYG A;  3CME A;  1VQ5 T;  1VQ8 T;  4M78 B;  4ELZ C;  3HRS A;  4NL3 A;  3L2W A;  3SWN C;  2A3L A;  2GCX A;  5LJ3 e;  1VQK T;  3A8O B;  3BFM A;  5LJ5 j;  2A7Y A;  4XAX B;  2XU8 A;  4KUI A;  3JB9 I;  3LYI A;  3CCJ T;  4BAC A;  1YJW A;  4F7U A;  2EQM A;  3E1S A;  1VQO A;  3BW1 A;  2DIG A;  2YLB A;  1YIT T;  2QDY B;  3X20 B;  2XI9 A;  3UPU A;  2K57 A;  1U1T A;  3JCM X;  3QYG B;  3HP9 A;  2JZ2 A;  4M7D F;  1EIF A;  2CZ1 B;  5I2M A;  4DA4 A;  3A8L B;  2F5K A;  1NJI U;  1YIJ T;  4KBM B;  2K3Y A;  2VYT A;  2E41 A;  4RCC A;  3SFM A;  1Q86 U;  3M59 A;  4DOW A;  1K8A C;  3X24 B;  4C8Q G;  4E7K A;  2JOY A;  2CKK A;  3JCM c;  3RKY A;  1M5Q 1;  2LNV A;  5GAN h;  5GAO q;  3CCV T;  4BE1 A;  2V8K A;  3MP8 A;  1I81 A;  2L3R A;  3VJP A;  3S3N A;  4PJO F;  3DLL A;  2X4Y A;  3L42 A;  4XU2 A;  3UT1 A;  3EFS A;  4E7H A;  4E7I A;  1WJQ A;  3OS1 A;  2DJZ A;  2DXC A;  4BY6 B;  1K73 U;  3LWI A;  3JCM b;  1YJ9 T;  2E70 A;  2KQW A;  4JLG A;  4MZM A;  2QQR A;  1VQP T;  2O01 E;  3CPF A;  3HFO A;  5I2S A;  4FT2 A;  4RG8 A;  3FEO A;  2DZC A;  3C4S A;  1O9S A;  2KMT A;  3OBW A;  3OYY A;  4FIB A;  1UGS B;  5LJ3 h;  5HKC A;  4Y28 E;  1XQH A;  4ME7 A;  4A53 A;  3CEY A;  1I5L A;  2OAU A;  3DKM A;  5DY9 A;  3SWN A;  4C0D C;  4ZN1 A;  1VQ4 A;  2DXU A;  4BDY A;  2RJD A;  4CI0 C;  4PJO C;  3CBP A;  4HKE A;  3NTI A;  5C0M A;  1KQ1 A;  3I55 T;  2MF2 A;  5KH6 A;  2LC4 A;  3VUZ A;  2QEX T;  4C8Q E;  1NE8 A;  2JTF A;  2M1H A;  4C92 G;  1VUB A;  2EJ9 A;  2HBP A;  3M4Y A;  2VXE A;  5FU6 C;  1VQ9 T;  5CKB A;  1R8O B;  2EAY A;  4BE2 A;  4M75 E;  3RMS A;  3HKS A;  3OYF A;  3ZEH A;  2BUD A;  4J7F A;  1X01 A;  1KHI A;  4F7U F;  2XK0 A;  2XG8 D;  1KHC A;  3L2Q A;  1U8R A;  2DXT A;  2KY9 A;  4C0G A;  4BB7 A;  3OYK A;  1KD1 C;  1G5V A;  4MML A;  4NL2 A;  2XDP A;  3FLG A;  3CCU A;  1Q82 U;  1H3Z A;  4A4E A;  2PUK B;  3JCM J;  4M77 D;  3JCM Q;  2ZPH B;  2LCL A;  3TCJ A;  1OZ2 A;  2KVQ G;  5KCH A;  3MHX A;  1JJ2 A;  4LDU A;  2DVE A;  5GMK m;  4MDW A;  1FWZ A;  4XTV A;  4ELY C;  4FU6 A;  4M78 E;  3V8J A;  1KC8 C;  3JCM f;  2CYZ B;  5FLX E;  2PVG B;  5GAO p;  1IZ6 A;  5GAN d;  4XU1 A;  3QJ6 A;  3RKW A;  1YJN A;  1VQ7 T;  3GIB A;  3JCM V;  5DLQ E;  2DTI A;  4EMK B;  3JB9 D;  2QI2 A;  2E6Z A;  5GAN j;  3MO8 A;  4C8Q C;  4XQ3 A;  4Z02 A;  3JSC A;  5GMK h;  3LGL A;  2ZPI B;  1BKB A;  1QVF S;  2LT4 A;  1FXX A;  1W4S A;  3E9F A;  2L89 A;  3V7S A;  3CCQ A;  3OSV A;  1RL2 A;  2O4X B;  4PLI A;  3S3O A;  5LJ3 d;  3OYD A;  4FT4 A;  3G6E T;  3S3M A;  4M75 C;  2WAC A;  5FRN A;  3PT9 A;  3RIR A;  4GY5 A;  1BIA A;  2RI2 A;  2OTJ A;  3L1A A;  4BI3 A;  3FIF A;  4JLI A;  5LJ5 f;  4NS5 A;  2E1H A;  4FM4 B;  3OW2 S;  3O8V A;  2YHT A;  5LJ3 j;  1VQL A;  2ZPB B;  2E65 A;  4XTU A;  3M57 A;  2P4T A;  4VUB A;  4DQ2 A;  3OY9 A;  4D6W A;  4PJO D;  1OYX A;  4MZT A;  4TVR A;  1M90 C;  1KD1 U;  3VYH B;  1XTD A;  2B8A A;  3M5A A;  4PNO A;  1NZ9 A;  1KQS A;  3PMT A;  3QG1 A;  4XU0 A;  3CCE A;  2E12 A;  2KSS A;  1BIB A;  3QYH B;  1D3B B;  5DM7 R;  3OS5 A;  2R58 A;  3P8B B;  4UC4 A;  1VQO T;  3J81 E;  2LVM A;  2ZCF B;  3JCM g;  1G3W A;  2KAF A;  5FU7 B;  3OYL A;  3CC7 T;  5CAI A;  2QXF A;  4M78 C;  4IUR A;  4XK8 E;  5IN1 A;  3CCM A;  3C12 A;  4J5Y A;  4QQD A;  2PQW A;  3OYN A;  1N9S A;  1O75 A;  3OYE A;  2CS7 A;  1M1G A;  2DTH A;  1KC8 U;  2RHY A;  3WVE B;  2HD0 A;  4C5I A;  4C92 B;  1WNL A;  3C95 A;  3V8K A;  3CCL A;  2K5I A;  2QQ9 A;  1HK9 A;  4FL6 A;  1DJ7 B;  3JB9 F;  4EPC A;  3VU3 C;  2X35 A;  3HL8 A;  3QXE B;  4N4H A;  3JAM E;  2L8D A;  3MP1 A;  2EQJ A;  3G71 A;  5CR2 A;  4LDW A;  2Y4X A;  1VIE A;  2X4J A;  2G3R A;  3RES A;  4C8Q A;  3UWN A;  3V7R A;  4JRQ A;  4RG2 A;  5CVI A;  4E7L A;  5LJ5 g;  3HHT B;  3VKI A;  3OYJ A;  2RJF A;  2D6F A;  3RER A;  3SDZ A;  2Y90 A;  3P8H A;  1S72 A;  4M75 A;  4HA8 A;  4J83 A;  3JB9 H;  3S6W A;  4EMG A;  4OGC A;  2RI5 A;  3OYC A;  1YBY A;  1I8F A;  5KE3 A;  2M9U A;  2BKD N;  5KCO A;  2MWO A;  1VQ5 A;  4A4K A;  1VQ8 A;  4M7A B;  3HPW A;  4M77 B;  4N4G A;  1Y71 A;  1M90 U;  3CBM A;  4BY6 C;  2DKG A;  5CO7 A;  1NPP A;  2P0P A;  5J26 A;  4C8Q D;  3NTK A;  4C0F A;  4PL6 A;  1XOV A;  1V29 B;  3R6O A;  4R55 A;  3OYH A;  3OA6 A;  1Q81 C;  1QVP A;  5CQX A;  2LCC A;  3E19 A;  4N4I A;  3ZBD A;  4M75 D;  1VQ6 A;  4XU3 A;  1NPR A;  4OF1 A;  4M78 A;  3H8Z A;  3UDC A;  2RM4 A;  3QDR B;  4QQ6 A;  4QVD A;  5GAM h;  2XID A;  1BI2 A;  3FC3 A;  5LL6 S;  2WSE E;  3OQ5 A;  2EKO A;  5GAN 8;  4RKU E;  3I56 T;  4JRK A;  5HK0 A;  1JB0 E;  3JB9 J;  4KT0 E;  4DOV A;  2E64 A;  2MWP A;  3FB9 A;  2IG0 A;  4HCC A;  3HSB A;  1M1K C;  1XNI A;  4M7D B;  2ZPF B;  5C6S A;  3M4G A;  3PGG A;  2XKO C;  3A8M B;  5A0G A;  3M9Q A;  3FJP A;  5GMK e;  3CCV A;  3ZFJ A;  4B9W A;  3X25 B;  1YHQ A;  2MAM A;  3DB4 A;  5GAN 2;  5CKF A;  3CCU T;  1B34 B;  1ZBX A;  4XTW A;  4M78 D;  4XTY A;  5CIU A;  3HFN A;  3MEU A;  4C5H A;  3GOX A;  4J7I A;  1K8A U;  1X6O A;  2XHC A;  5IT9 E;  1MHN A;  1VQP A;  3OMC A;  3CMA T;  3KBG A;  4Y91 A;  3A8H B;  5D6Y A;  4LDX A;  2LX9 A;  2M0O A;  4WF2 A;  1VQN A;  4JUV A;  5GAN f;  3HRT A;  4OP0 A;  4C8Q F;  2FYK A;  3CCR T;  1PSE A;  2V8J A;  2RA2 A;  3FDR A;  4C5G A;  4IUQ A;  4HT9 A;  2VGN A;  1KG1 A;  2XDD A;  2VGM A;  2DAQ A;  5KE2 A;  1P92 A;  3CD6 T;  4M7A G;  1WPY A;  2E5Q A;  3G4S A;  3EFR A;  4ZGD B;  3V8L A;  2RJC A;  4M75 F;  1Q81 U;  3JCM P;  4M77 G;  1SSF A;  4P5N A;  1QP3 A;  3OB9 A;  4J6Y A;  1X75 C;  3CXC S;  2QEX A;  2QA4 A;  2C06 A;  1M8V A;  2DPP B;  1JRI A;  1U1S A;  2RK1 A;  4NOY A;  2XD0 A;  2XIC A;  3CCS A;  5LJ3 f;  5FRO A;  1YCY A;  4C92 E;  5M9O A;  4ZGJ B;  1VQ9 A;  1G3Y A;  1N6A A;  2GF7 A;  3MEW A;  3QPH A;  5HY6 A;  1Y96 B;  5CKE A;  3AHU A;  4EMK C;  1K9M C;  3QSU A;  4X9C A;  1W2B S;  3L2Z A;  2CGH A;  2EIF A;  2RHI A;  3GP8 A;  2HAX A;  4ZTF A;  2FVU A;  5CKH A;  3LLR A;  3EAE A;  4LD9 K;  2QQB A;  1N8R C;  1M1K U;  3NFC A;  2RI3 A;  3JB9 G;  1VQM T;  2H3J A;  3OW2 A;  5A0D A;  4M78 F;  4JDS A;  2R5A A;  3LX7 A;  4F7U B;  3ER0 A;  4RMO A;  4QQG A;  3CPW A;  4M7D G;  3QO3 A;  2LQ8 A;  1ZQ1 A;  4LDY A;  5GAM d;  1UGQ B;  1BI0 A;  5GAN 6;  3OYI A;  4MDX A;  3CME T;  3GPL A;  1N9R A;  4IKF A;  5GAN g;  2DO3 A;  4IUV A;  4EDU A;  1M4Z A;  1WJS A;  3G7Z A;  4OB1 B;  4BUG A;  4M7A E;  2VC8 A;  3OYM A;  1ZHI A;  3T9N A;  4A54 A;  4M77 E;  2FL7 A;  1QVG S;  3OSS C;  2DXB A;  3JRZ A;  2K4Y A;  4OVA A;  5GAM j;  4J6W A;  5GAN 5;  1VQ7 A;  1YJW T;  3NTH A;  2LT1 A;  3QUI A;  2R5M A;  4OB0 B;  4PJO G;  4LD6 A;  5FU7 C;  2FB7 A;  3G71 T;  2QTX A;  2R57 A;  3URG A;  3VUB A;  3J80 E;  4L5G A;  5LJ3 g;  1WJR A;  4ATO A;  2IVW A;  1AHJ B;  4XTX A;  5CKD A;  3WVD B;  4YTL A;  1Q7Y C;  2OTL A;  4C92 C;  3ASK A;  4BI8 B;  3PNW C;  2QQA A;  4JRI A;  2DTO A;  3OYB A;  2CZ7 B;  5GAM e;  2E6N A;  2P0K A;  3CC4 A;  4J6X A;  1MGQ A;  3H6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...