2FVUA

Structure of the yeast sir3 bah domain
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
216
structure length
190
Chain Sequence
b'HMTMAKTLKDLDGWQVIITDNVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein SIR3
publication title Structure and function of the Saccharomyces cerevisiae Sir3 BAH domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 43
structure length 190
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2fvuA01
4JJNK 1M4ZA 1ZHIA 4FSXA 4DOWA 4BB7A 4DOVA 1W4SA 3PT9A 3TU4K 4KUDK 4KULA 4LD9K 1ZBXA 4FT2A 3PTAA 4FT4A 4KUIA 2FL7A 2FVUA 4DA4A
chains in the Genus database with same CATH superfamily
2GNCA 3BE3A 3V7RA 4M75A 3G71T 2RQWA 2OX7A 2M51A 4PLLA 1VUBA 1MGQA 2OAUA 4IUVA 1OYXA 1EFNA 3UDCA 4BI4A 5EG2A 1F1BB 4J8OA 3AT1B 4B9XA 4O6JA 3JCMe 1YN8A 3PNWC 4RTZA 1W70A 1CSKA 2RJFA 2VGNA 3QDFA 4F14A 1UGSB 5FU7B 2LVMA 1HSQA 2BUDA 1K4US 3LH0A 4HCZA 3M53A 4LNPA 3S3OA 4J6YA 4KT0E 4JPBW 2SRCA 5GMKh 2JN0A 2ROLA 5GAOq 1VQOT 1NEGA 3MEUA 3X28B 1YIJT 1UGQB 3OA6A 4PJLA 4M77B 3L2ZA 2D6FA 2KXDA 4E7HA 2CUDA 2EWNA 2PNIA 3CCVQ 3QKJA 4HVUA 4CRIA 3PGGA 2KRNA 2O01E 2MPXC 1KG1A 1NPRA 1NYFA 4L6V5 4J9DA 3TSWA 3M0QA 5GAN5 1IGUA 2V1QA 3DB4A 4A4KA 2FRYA 2Z0WA 4ZNXA 4QKUA 2YUPA 1RLQC 5GANe 1EZZB 1JO8A 2OTLQ 3MCAB 5DY9A 3EGXB 2DFUA 1WXUA 2L8DA 4A63B 4ZTFA 5LJ5g 3OY9A 5GAMg 2JS2A 1NG2A 1WQWA 3DLLA 1SKUB 3JB9I 1CKBA 1PC0A 2AHJB 2RN8A 4M77D 2AZSA 4M7AE 3ZFJA 1FX7A 3CCSA 4OMFB 3D7SB 3VV0A 1WZOA 1LVKA 4EMGA 1WHHA 2A28A 1O75A 1VQLA 1ABQA 1U8RA 2DRMA 1WHGA 3UPUA 1VQ5A 2RH2A 3CCRT 2E4HA 4E7JA 3OS0A 1KD1C 3OYFA 3JB9G 4FW2A 2EQKA 5GMKl 3G4ST 1AZGB 2ZCFB 2RK1A 4O5VA 3Q1JA 4MZTA 1O9SA 2LMJA 1C6VX 4Y28E 3JB9F 2GGRA 4ME7A 1QP3A 4QT7A 2BE7D 3BY7A 2KT1A 1X75C 1I5LA 1OV3A 5LJ3g 3M56A 2X4WA 2ZPHB 2HEQA 2A0FB 2GFAA 5L23A 2XKOC 5CCAA 3BDUA 5A0DA 5IXFA 3J81E 3OB9A 2KE9A 3EG3A 3OYKA 2MWOA 2K57A 3V8JA 4BACA 1ZSZA 1AOJA 2E65A 4C0DB 1FYNA 2B8AA 4QQDA 5HK3A 1VQKQ 3OYGA 1SPKA 2YSQA 3EGDB 1BIAA 5KYWB 1D3BA 5D6WA 4XU3A 4C5IA 2QA4A 1G8XA 3SFMA 1VQ9T 2CZ1B 1K76A 2VXFA 3QYGB 1Y71A 2K79A 4X34A 3PVLA 4KUDK 2JNGA 1KJWA 1B3QA 2DAQA 4ZTJA 1XOVA 4M7AA 2E41A 2HCKA 2LC4A 2DZ9A 4E7SA 1G3YA 1JXOA 3M0PA 4M78B 2KVQG 3EG2A 4FCYA 1LNXA 3L2WA 1T0HA 3A8GB 2QQRA 3GF5A 1PG5B 3EHQA 1WHJA 5I2MA 1U3OA 1LJOA 3SD4A 1QMCA 3QO3A 1YIJQ 2L3PA 1Q95G 3PMTA 3QUIA 2WSEE 4IURA 4OMQA 2CT4A 1D1CA 1XQHA 3OS5A 4EDUA 5M9OA 2RHZA 2MF2A 1V1CA 4FW1A 4ZGDB 3GP8A 1YBYA 2F2WA 2X3WD 3LWIA 1D09B 1AWJA 1Y07A 3H6ZA 3SWNA 4D6WA 4PJOB 3FEOA 1NJIC 2E3HA 1K73U 2ZPEB 4J9HA 5GMKj 2F5TX 2QASA 2JVVA 5CO7A 3ZL7C 2DJQA 4M78D 1Q86C 1PD0A 4JRPA 2RPNA 2DXCA 3EFOA 2X51A 5KCHA 2EJ9A 2QTVA 4F04B 4OB2B 1BB9A 2O2OA 4PK4A 3OMGA 3FJPA 4AT1B 2RO0A 1K0SA 1I1JA 4J9GA 1H92A 3A8HB 2DD4A 1KHIA 2GBQA 1H3HA 1U1TA 2DO3A 1QVGS 2QG9B 4VUBA 4HA8A 1MMGA 2OTJA 2L2PA 2DL8A 2CP7A 4C92B 3CPFA 3CCEA 1M8VA 4PJMA 5L8RE 3CCJT 4PJOD 2MIOA 2QYZA 2ZPGB 3CCMT 1IO6A 4XAXB 2HZYA 3EHRA 4JJDA 2GFUA 4XK8E 3S6WA 5GANd 5A2QE 4A4HA 3OYIA 4Z8AA 1BI2A 1H3ZA 2RQUA 3EG9B 4C8QG 3GBQA 5GAN7 1FMVA 3CCUA 3TCJA 2F2VA 2DYIA 1K9MR 4C8QF 2NUTA 1WI7A 2BTTA 3KXTA 4OMOA 2MK5A 5GAN6 2OTJT 4R55A 1M2OA 1VQ4T 3DB3A 3OBWA 2RMOA 4GBQA 3VYHB 2DTHA 1VQPA 4EPCA 2DMOA 1SSFA 5KYXB 2CZ6B 2ZZDA 1VQ7Q 5KE2A 4JRQA 1Q81C 3BDLA 2EQUA 1YI2Q 4F7UE 2IVWA 3CCVA 1RAGB 1NPPA 4XU0A 4OB0B 2DL7A 3JB9J 1QVGP 5GAOn 3EAEA 4A53A 2BE9B 2XDDA 2KROA 2JJ9A 2O4XA 3P8DA 1GCQA 1JRIA 3M5AA 4DEXA 2AKLA 1M5Q1 2RI2A 3X24B 4MMLA 3CC7Q 4KGVB 4PJNA 1RI0A 1MV0B 2EKHA 1Q86U 1UB4A 2VVKA 1M27C 4N4IA 3LH5A 3A8LB 2J7IA 3VU3C 3PTAA 4M7DE 1YCSB 2NYSA 4WF2A 2LQ8A 5KYYA 3QJYA 5I2SA 2E3IA 5DLOA 2A7YA 2QEXQ 3SHWA 1OX9A 2EYWA 1GRIA 3CCVT 2YT6A 2JM8A 2NUPB 5IT9E 3G6EQ 1ACMB 2K4YA 3OYDA 2WSCE 1SSHA 4AFZC 1U1SA 3EG1A 4J7IA 4EIKA 3VYGA 1TS9A 1S1NA 3M58A 3GIBA 1JJ2S 2NWMA 4F17A 2OTLT 2IIMA 3VS3A 3E9GA 4JRIA 1Y96A 2YUQA 4CC7A 3KBGA 2KSSA 3E19A 3C12A 4M75E 2C06A 1AWWA 1SEMA 3PVQA 3M54A 2CYZB 4ELYC 1VQ6Q 4LN2A 3HTRA 1NEBA 4FYXB 2AK5A 4AFSC 2E5QA 1B7TA 2EQMA 1YJWT 4RTYA 3C95A 2JMCA 1TUCA 2D0QB 3JB9H 5D7UA 1G3WA 1SHFA 2OAWA 1QCNA 2RJDA 3RMSA 2CP6A 4QVCA 2HAXA 3JCMh 2HBPA 1AD5A 2LQWA 3A8OB 3OYCA 3CMAA 3JCMJ 1PSEA 3FDRA 3LW5E 3N5BB 2HSEB 2EW3A 3EFRA 1TOVA 5CQYA 3CCJQ 1Z9ZA 5IN1A 3JB9D 4QVZA 2LX7A 1VIFA 2K2VA 2V1RA 1NE8A 5I11A 2NLUA 3OSSC 3R6OA 1VQKA 3CBMA 1Y7XA 1M2VB 1ZBXA 1BK2A 4FT4A 2CT3A 1TWBA 2PU9B 1N8RC 3OYLA 3LLRA 2VB6A 4E7IA 2DPPB 1X6BA 4KGZB 4EMHA 2DEUA 4M7DC 3TREA 2JT4A 2KI7A 2X4JA 4LDVA 4ESRA 2R5MA 4FYYB 1JJ2P 2D8HA 2JTFA 5GANh 2DILA 2FYKA 4DQ2A 4C0FA 3CCQQ 1VQ4Q 3VS7A 2LCLA 1IREB 2P4TA 5CKHA 4RUGA 1TXQA 2VWFA 4RTVA 4IUTA 2A08A 1VQOA 1KD1R 1YIJA 4F16A 2D1XA 2J05A 3M55A 1KQSS 1VQKT 1R8OB 1D1BA 1Z9QA 4BI8B 3O8VA 3QZ9B 2DJZA 4BE1A 3CC2T 1HD3A 1IHWA 4HVWA 4J7FA 2M0OA 2M16A 4XU1A 3VS0A 1KQ2A 3VUZA 1YITQ 5FW9A 4M75C 2LZ6B 3TU4K 3P8BB 1OU8A 2O88A 1K8AC 3RKXA 1JU5C 3QWXX 1PWTA 2HBWA 5HK0A 2YRVA 4F7UG 4EMKA 4KGXB 1YJNQ 3NHNA 2K3BA 2XHCA 1ZUYA 1OPKA 3OS1A 4EMKC 3A5ZB 4F7UF 3CQTA 1X69A 2DD5A 5LJ5f 4Y91A 1M3BA 2ECZA 2LJ3A 5HCKA 4D8DA 5GAMf 4FIBA 4LUDA 5FWCA 1WNLA 2V8KA 1K9MU 1WFWA 2PVOB 3QWYA 1TG0A 1OOTA 2W10A 4C5GA 2K5LA 3SEMA 4JJBA 3U23A 4M7DG 2EJGA 1ZHIA 3TSZA 2CS7A 3RMQA 1FWZA 1Y0MA 2VKNA 1OQKA 4B6MA 3A1PA 3PFSA 4M7DF 2FZKB 3I5RA 3NFCA 3CCRA 4JZ3A 3UWNA 3RIRA 3L42A 1PHTA 4RG2A 1N8RU 5KE3A 1H641 2LJ1A 5IHKA 1KQSP 1V29B 1X6OA 4C8QB 3G4SA 2LRQA 3INZA 2CP2A 4OB1B 3GPLA 4FYWB 1M1FA 4JZ4A 5GAOl 2KRSA 3A8MB 2ED0A 2J6OA 4NS5A 1I07A 3JSCA 1ZBJA 1QVGA 1YJWQ 1VQ8T 1MNDA 1C0MA 1YJ9T 4AG1C 3EH1A 5KYUA 3I56Q 3CMEQ 1D0XA 4IUPA 3QG1A 1MMDA 3H0HA 5LJ3f 3T9NA 4M75G 2J06A 4QQ6A 4OMNA 2BIVA 4MDWA 1W1FA 1NJIR 1WHKA 2I0NA 3QZ5B 4P5NA 3H0FA 1VQ7A 3JCMX 2D8JA 4M75F 3F70A 3NTHA 1HK9A 2YUOA 1Q86R 2DETA 1BCMA 4C8QD 4LUEA 2DNUA 2KYBA 3WVEB 4KRTA 4J9IA 2KY9A 4RTTA 4X9CA 3NTKA 1WGSA 2AKKA 2QQ9A 1OX8A 1N27A 2XICA 1RADB 1QVFP 4CC2A 2ATCB 1K8AU 1VQ9A 2YRDA 3CC7A 2QQAA 2ZPIB 2LNVA 5GJWB 1KC8C 3BFMA 5I22A 1LPLA 3REAB 2E6ZA 1E6GA 1KQ1A 2DL5A 1RLPC 2RF0A 1T3LA 1BIBA 2RNAA 1AVZC 3J80E 2K5IA 3L1AA 5EC7A 2YHTA 1QCFA 2EPDA 2DBKA 1VQ7T 2K9GA 4OB3B 5AYFA 2HDAA 1I8FA 2AIRB 2CSIA 3H8ZA 2ROTA 1YI2T 3VS6A 5D6XA 1K9AA 2RQRA 3FJ5A 1ZSZC 1WIEA 4N0AA 3G6EA 3I5SA 4HCKA 3VS1A 3C4SA 3CC2Q 3CXCP 4JJCA 4N0AC 5GANj 5IHNA 2C0OA 2X4XA 2VV5A 3OMCA 3CC7T 5FU7C 2CP5A 2DM1A 4E7LA 4MZMA 2DEQA 2DXUA 2I2LA 3PMIA 3LWHA 2E12A 1UHFA 3CCLT 1GCPA 2X9HA 4XQ3A 3WVDB 4M77A 5CK9A 1M4ZA 3E1SA 4A4EA 4J9CA 5C0MA 2RHIA 4M7AC 2CZ7B 2RK2A 1E6HA 1Q81R 2QEXT 3V8LA 2X3XD 1TU0B 4A4FA 1T0JA 1S72Q 3A98A 2F1LA 2QXFA 3G6ET 4NL3A 1QLYA 2GF7A 3CPWS 2CZ0B 3CCJA 2KXCA 5HKCA 1SF9A 2K3XA 1AHJB 1JJ2A 1VQNT 3M9QA 3M0UA 5AT1B 3V8KA 1JEGA 3P8HA 1N9SA 3NTIA 5CKEA 4NOYA 3CCMA 1OEBA 5LJ5e 1IZ6A 1JBMA 2ED1A 3H41A 4IUQA 4KBMB 1PKSA 5GAMe 3PIPA 1KD1U 3SWNC 8ATCB 5KYYB 2L3QA 1B34A 4FM4B 2FVUA 2KR3A 3LX7A 3QXEB 2EYQA 2LQKA 2CP0A 4OMLA 3RESA 2X4YA 1VQ6T 4CC4B 2HQHA 1VQMQ 1B07A 4HCCA 2EKOA 3QDRB 1VOMA 2DA9A 3GNFB 3UATA 2JTMA 1M9SA 3G1JA 1FMKA 2RI5A 1NZ9A 3HKSA 1VQ8Q 4MDXA 3E9FA 1YJ9Q 4GLKA 4DA4A 3CCQA 1VQ4A 1WX6A 4AMCA 3O5ZA 4JLIA 3E2UA 4JRKA 4IIMA 4CC3A 1ZA2B 4PJOE 1I0CA 3L2QA 4M7AG 1TUGB 3J7AF 4AFQC 2YUNA 1NYGA 4LD9K 4OF1A 3LGLA 3FIFA 2ESWA 4JS4A 4M7AF 2CH4A 1OU9A 1VYTA 5LJ3e 3HL8A 4CI0C 2JS0A 1YITA 3CPWP 4LXCA 2XD0A 2FZCB 1MHNA 2G6FX 1M3AA 5IHIA 4DBQA 4HXJA 3VRYA 3ZEHA 5CAIA 4F7UB 1G3TA 1OZ3A 3QPHA 4IKFA 1SRMA 4C92D 2KBTA 5J39A 3RERA 2E6NA 3CCQT 1YJNA 2Y4XA 4C0DC 5KYWA 4DOVA 4OMPA 4XTYA 1VYUA 1KQSA 1QWFA 2EQIA 3CCSQ 1N8RR 4RCCA 4M7DB 2ZAEA 5DLQE 2CREA 4BUGA 2EYZA 2JUFA 2QQSA 2LJ0A 3CC4Q 4JJNK 3SDZA 3LYIA 1QVPA 5GAN3 1RAFB 5GAN8 4FSSA 2EGEA 5GAMj 1NJIU 1YITT 2QGFB 3JV3A 2J6FA 3NPFA 4M78A 2KT8A 1RAEB 2EQJA 2GTOA 1AWXA 3M0RA 2COZA 1GCQC 1YCYA 3QIIA 2OTLA 2LX9A 1KFZA 2OI3A 1BI3A 2LT1A 1YJNT 3CCLQ 1UG1A 3JCMQ 9ATCB 2R58A 4J9FA 2RA2A 4C5HA 1Y57A 3TQ7P 4ZN1A 1X43A 2LT4A 2PVDB 1KIKA 1RL2A 3REBB 1YJWA 2KDSA 1ZUKA 1SRLA 2YLBA 3CMEA 5J26A 3JAME 4PJOA 4DEYA 1ABOA 3H0IA 4M75B 3JCMg 1UGVA 1QCOA 1P92A 2LP5A 4FYVB 4L59A 2LNHB 4PJOC 3X20B 5GAN2 1WHLA 2DX1A 3HHTB 2IG0A 1K8AR 3MEAA 2WACA 3JCMP 4LDWA 1VQNQ 1WXBA 1ZLMA 3NGPA 3G7ZA 1H8KA 2QTXA 1G83A 2YWWA 5GMKm 3OSVA 1NBEB 4RCBA 4QVDA 4B9WA 2O9VA 2MMPA 1GFCA 2DTIA 1W2BS 4Z89A 1BI0A 1PCXA 2PUOB 4C92A 2XK0A 1PKTA 3RNJA 1YHQT 1YFNA 3I56T 3CMET 3M4YA 2QGGA 2P0QA 3GOXA 1V76A 1AZEA 4Z88A 3OBYA 1RI9A 2X35A 3ZBDA 4N4GA 5GANg 1NM7A 2JMAA 2DLPA 1BU1A 3OW2S 1T3SA 1TH7A 5HY6A 2HKQB 4J6WA 4HT9A 1Q82C 3EG9A 4QW2A 4HKEA 1Q81U 1UTIA 1M8MA 2G3RA 2QAZA 5LJ5d 5GAMd 1GXIE 1IGQA 3CC2A 5KYNA 2HSPA 2KYMA 2IPOB 1KSWA 3MP1A 4PL6A 4RKUE 3M0SA 1A0NB 2FG0A 4OGCA 2EGCA 1UGPB 2CKKA 5KYXA 2PZ1A 1OZ2A 2KMTA 1MMNA 1X27A 4HCBA 5A0LA 2CDTA 1Q7YR 1UDLA 3QHSA 2V8IA 4V2SA 1WXTA 3IQLA 4Z02A 5IH2A 1LCKA 1W4SA 1QW1A 2J6KA 1MUZA 4N4HA 1W2BP 2DZCA 4ZGEB 4AFUC 3MP6A 1BBZA 1M90R 5J3BA 3L2UA 1HJDA 4XTXA 2K6DA 3I55T 2HD0A 4X1VA 2NUZA 3CCEQ 1YWOA 4OMMA 2BKDN 1KC8R 2GCXA 2QQBA 1K0XA 1I81A 3C94A 5LJ3d 3OW2P 2VYTA 2DRKA 2H3JA 2MAMA 3VJPA 1RAIB 3SB2A 4Q5WA 2A36A 3OYMA 3UA6A 3FRNA 1GBRA 1W6XA 4DOWA 4C5EA 2ZPFB 1VQMA 2NUPA 1ZSZB 2RHYA 1U06A 2KNBB 2L3SA 3CCUQ 2FO0A 1N9RA 5FROA 2CGHA 3RR6A 2F69A 2GQVA 2HKNA 1S72T 2A37A 4OGEA 1D3BB 1VQ8A 1U5SA 2EBPA 3TVTA 1YJ9A 4KUIA 3VKIA 1R77A 2P84A 3CPWA 3PIOA 4JDSA 1QVFS 1Q82U 1VQPQ 2EGAA 1WJSA 2V8JA 2KGTA 3JCMb 4BY6C 3OYAA 1CKAA 4II1A 5DM7R 1UJYA 3JCMV 3THKA 1C1AA 4M7AB 4NL2A 1UHCA 4ANJA 1G2BA 2E1HA 3OS2A 1GBQA 2F5KA 2HNIA 1AEYA 3M59A 2D0NA 1R0CB 3QBYA 2RQTA 5CVIA 2FPFA 2DXBA 2PVGB 1VQMT 2RJEA 3PE0A 1KHCA 1VIEA 2MWPA 3PT9A 5GJVB 2HL3A 2L5QA 3VUBA 5CKBA 4KULA 4C0ZA 5FU6C 1QKXA 4KH0B 3L2RA 4LDXA 3HSBA 4M77E 1YHQQ 1UECA 2WSFE 4E6RA 2D9TA 4XTZA 3CXCS 2QDYB 1SHGA 1D0YA 4E2FB 4YTLA 2LCSA 2ABLA 1M2VA 3SWNB 3HPWA 4PNOA 1Q7YC 1QP2A 5LL6S 4XTWA 4M7AD 4BDZA 2A3LA 5CIUA 1B34B 5A0GA 5GAN4 4PFOA 2DKGA 4RG8A 3EFOB 3R6NA 1YI2A 3MJXA 5CKFA 3TEEA 1RAAB 3I9QA 1X2KA 3CC4A 5GAOr 4C8QE 2LDMA 1M90C 3RKYA 2YRCA 2FEIA 1MNEA 1ZUUA 3OYHA 2XDPA 1M1KR 2F2XA 1M30A 4J9EA 2EFIA 4HVVA 4E7ZA 5GMKi 2Y4YA 2PUKB 2L0AA 1PM3A 1KK7A 4PKCC 1K73C 5LJ5h 1OULA 5GAMh 3CCLA 2LQNA 5GMKe 2XG8D 2CUBA 1JB0E 1I5OB 4J5YA 3M0TA 2W0ZA 2K7AA 2KEAA 3MEWA 4XU2A 2QEXA 1D1AA 3CCST 5KH6A 2EAYA 2XMFA 5FRMA 1ZX6A 3MEVA 3CC4T 3CMAQ 1AWOA 1VQLT 2CH4W 2E70A 1IB8A 2AZVA 4BE0A 3I55Q 2DF6A 2NUTB 1VQ5T 4ZGJB 1VQNA 2JM9A 4XTVA 2C0IA 4PJJA 1TUDA 2RD1A 1X2QA 1J3TA 5FLXE 3C0CA 5IAYA 3RUXA 3CD6Q 4LE9A 1ZQ1A 2L89A 2V26A 2H8HA 3DKMA 2EJFA 2C0TA 1VQ6A 1RUWA 3G71Q 3HFNA 4M77C 1BYMA 1RACB 1WLPB 3VS2A 5LJ3h 1BKBA 1WJQA 4IUUA 1E7OA 3UF4A 2JTEA 2YXYA 5C6SA 3RBBB 5FWBA 4JUVA 3QYHB 2O4XB 7AT1B 1Q7YU 3FC3A 3EFSA 3EGXA 2O31A 3M4GA 2B86A 2GQIA 2DVJA 3EG0A 4LD6A 4L5GA 4C8QA 4FU6A 2FHDA 1VQOQ 2VC8A 3X26B 2SEMA 4C8QC 1ARKA 1M1GA 1M90U 3VS4A 3MPUB 2XIDA 2FPEA 1XJWB 4FL6A 2CSQA 2MCNA 2K5FA 1W2BA 3RDVA 6AT1B 2QA4T 3KFVA 4M78E 4X9DA 1WYXA 4PFPA 4MMKA 1YNZA 5CKDA 2YDLA 3V7SA 1KC8U 2DE0X 4DBRA 4WCIA 4AG2C 1M1KC 4GY5A 3MP8A 3OYEA 3JCMd 2KQWA 1TTHB 4LDUA 1JQQA 1WDXA 2DERA 4R0KA 3OW2A 1WHMA 2JOYA 4RTXA 1K1ZA 3VS5A 4WTOB 1EIFA 2FPDA 1Y96B 3OYYA 2FZGB 4E7KA 2DVEA 4GLMA 2HQXA 5IXBA 2LCCA 5D6YA 3LGFA 3BW1A 3MHXA 2DIGA 3H9NA 4M77G 3ER0A 4ELZC 1X6GA 2PTKA 1ZA1B 1EX4A 2M0YA 1RABB 1UE9A 2CP3A 2RQVA 4M77F 1BI1A 1WQ7A 1GFDA 4PFZA 4BI3A 1N5ZA 2M9UA 2HQEA 3CCRQ 4BD3A 1M3CA 3HP9A 1IXDA 2VASA 4QQGA 2COYA 2P0KA 3G4SQ 1QWEA 1Q82R 4C92E 3FLGA 1FXXA 4BB7A 2P0PA 3UT1A 2XDBA 3EGDA 4Y92A 2ENMA 2KAFA 3OYJA 1UEBA 3GNGA 1MV3A 3NMZC 1PSFA 1AT1B 1G3SA 2XI9A 2EYYA 2R57A 3CCET 2L3RA 4OVAA 2JW4A 1VQLQ 2ZGWA 2E64A 4A4GA 1WPYA 3M57A 1DJ7B 2HMAA 2GTJA 5LJ5j 4ORZA 3JCMf 2PQWA 1VQ5Q 2QI2A 2KRMA 2MI6A 1N6AA 3S3MA 2RJCA 4M78C 2FRWA 4FT2A 2R5AA 1PD1A 3JCMc 1WA7A 3EH2A 4BDYA 2MYSA 4DBHA 3QJ6A 3CCUT 3OYBA 2DK3A 5GAOm 3HRSA 3JRZA 1M1KU 2M02A 1ZSGA 1VQ9Q 4XTUA 4J83A 2DBMA 4M7DD 2H3EB 3UA7A 1YHQA 3I56A 5FRNA 2K3YA 1QVFA 3CEYA 2EYXA 1XNIA 3MO8A 1VQPT 2LTOA 4ZN3A 3QSUA 2YLCA 5GANf 2QK0A 1UFFA 2RI3A 4C0GA 5KCOA 1QQJA 2RM4A 4EMKB 3RKWA 2OJ2A 3OQ5A 3FB9A 1I4K1 2K2MA 2FL7A 5LJ3j 4RMOA 4MZPA 2COWA 4DBFA 3HFOA 2P4RA 4JLGA 2RHUA 3CBOA 2RB6A 3HRUA 1JXMA 3URGA 4UC4A 2QA4Q 1VYVA 1SG5A 1NLPC 3S3NA 2DIQA 8AT1B 4ATOA 4TVRA 1D0ZA 4C92C 1WJRA 4M75D 4BY6B 2DTOA 3CXCA 1R0BG 1UGRB 1QKWA 3CBPA 3X25B 3META 3VRZA 4FSXA 1UJ0A 2DYBA 4M78G 1LOJA 4HT8A 2DL4A 1YWPA 1GL5A 3DLMA 3MKDA 4LDYA 4RTWA 2QDLA 1HYOA 4M78F 1K9MC 2FB7A 2ZPBB 2MOXA 4F7UA 1IRXA 3I55A 1PRMC 5FU6B 2O9SA 3AHUA 1UUEA 2EVRA 5CQXA 1VA7A 3KUFA 5I21A 5KYUB 4R56A 2DXTA 4K11A 3CCMQ 4PJOG 1YP5A 4RTUA 1G5VA 2JZ2A 1NLOC 3CD6A 4PLIA 2XU8A 2E10A 2BZXA 1XTDA 4J6XA 4OP0A 4A54A 4PJOF 2VUBA 4M7DA 5ECAA 3I35A 3G71A 2VGMA 1OPLA 2JXBA 5GAOp 4E47A 1MMAA 1HXDA 2DL3A 1BCOA 3WXMB 2E5KA 1OI1A 4KH1B 2EIFA 1S72A 2RHXA 3CMAT 1PRLC 5CR2A 2OTJQ 1X01A 4D8KA 3GLXA 2KK4A 4BE2A 3L2VA 2VXEA 3ULRB 1RAHB 1TSFA 2BZYA 4C92G 3ME9A 1IHVA 4JS5A 2M1HA 1PNJA 1K73R 4IIOA 2AT1B 2Y90A 4C92F 3V7CA 3EGUA 3HRTA 2BZ8A 3JCMW 3OYNA 2HL5C 3CD6T 4J9BA 1FMWA 3ASKA 4M4ZA
chains in the Genus database with same CATH topology
5GMKe 2XG8D 3CCQA 5IT9E 1VQ4A 1JB0E 2K4YA 3V7RA 4M75A 4J5YA 3G71T 3OYDA 2WSCE 4PLLA 1VUBA 1MGQA 2OAUA 1U1SA 4J7IA 4IUVA 3VYGA 1OYXA 4JLIA 3UDCA 4BI4A 4JRKA 3MEWA 4XU2A 5EG2A 2QEXA 4PJOE 3M58A 3GIBA 1JJ2S 4J8OA 4B9XA 3JCMe 4O6JA 2OTLT 3CCST 3PNWC 2RJFA 5KH6A 3L2QA 3E9GA 2EAYA 5FRMA 2VGNA 1Y96A 4JRIA 4M7AG 3J7AF 3KBGA 3RERA 2KSSA 3E19A 3MEVA 3CC4T 4LD9K 1UGSB 3C12A 2LVMA 3LGLA 4M75E 2E70A 4OF1A 5FU7B 3FIFA 2C06A 2BUDA 4JS4A 3LH0A 4BE0A 4HCZA 3M53A 4M7AF 3S3OA 3M54A 2CYZB 4J6YA 5LJ3e 3HL8A 4KT0E 4ELYC 5GMKh 2JN0A 5GAOq 4CI0C 1VQOT 3MEUA 1VQ5T 3X28B 2E5QA 1YITA 2EQMA 4ZGJB 1YJWT 2XD0A 1YIJT 1VQNA 1MHNA 3C95A 1UGQB 4XTVA 3OA6A 2D0QB 3JB9H 3ZEHA 1G3WA 2RD1A 2RJDA 3L2ZA 4M77B 3RMSA 4F7UB 4QVCA 1G3TA 1OZ3A 5CAIA 2D6FA 4E7HA 3QPHA 2HAXA 4IKFA 3JCMh 5FLXE 2EWNA 2HBPA 3A8OB 4C92D 5IAYA 3OYCA 3CMAA 3JCMJ 3RUXA 5J39A 1PSEA 2E6NA 1ZQ1A 3QKJA 4CRIA 3CCQT 1YJNA 3FDRA 3LW5E 3PGGA 2Y4XA 3N5BB 2L89A 2O01E 3DKMA 2EJFA 1NPRA 4L6V5 1KG1A 4C0DC 1VQ6A 1K9MU 3EFRA 5CQYA 3HFNA 4M77C 5GAN5 1BYMA 5IN1A 3DB4A 4DOVA 4A4KA 3JB9D 4QVZA 4XTYA 5LJ3h 1BKBA 1KQSA 5GANe 1WJQA 1VIFA 4IUUA 2K2VA 1NE8A 2NLUA 3MCAB 5DY9A 3OSSC 3R6OA 5C6SA 1VQKA 3CBMA 1Y7XA 4RCCA 4M7DB 1ZBXA 4JUVA 2L8DA 4ZTFA 3QYHB 2O4XB 4FT4A 5DLQE 4BUGA 5LJ5g 3OY9A 2JUFA 5GAMg 2QQSA 1Q7YU 4JJNK 2PU9B 3SDZA 3FC3A 3EFSA 1WQWA 1QVPA 3LYIA 1N8RC 3M4GA 3DLLA 3OYLA 5GAN3 3LLRA 5GAN8 4LD6A 4L5GA 4C8QA 4FU6A 2FHDA 5GAMj 3JB9I 4E7IA 1NJIU 2DPPB 1YITT 2AHJB 4EMHA 2VC8A 4M7DC 3TREA 4M78A 4M77D 3X26B 2EQJA 2X4JA 4C8QC 4M7AE 3ZFJA 4LDVA 1FX7A 1YCYA 3QIIA 2OTLA 3CCSA 2R5MA 4OMFB 3VV0A 1M1GA 2JTFA 2LX9A 5GANh 1M90U 2XIDA 4EMGA 2FYKA 4FL6A 2LT1A 1BI3A 1YJNT 4DQ2A 4C0FA 1O75A 3JCMQ 1VQLA 2K5FA 2R58A 2RA2A 1W2BA 4C5HA 2QA4T 4M78E 2LCLA 4X9DA 4ZN1A 1IREB 2P4TA 5CKHA 1U8RA 4MMKA 4IUTA 5CKDA 3V7SA 1VQOA 1KC8U 2LT4A 2PVDB 3UPUA 1VQ5A 2RH2A 1RL2A 1YJWA 2KDSA 1YIJA 3CCRT 1M1KC 4GY5A 3MP8A 4E7JA 3M55A 2YLBA 1KQSS 1R8OB 3OS0A 3CMEA 5J26A 1VQKT 3OYEA 3JAME 4PJOA 3JCMd 2KQWA 4BI8B 3O8VA 3QZ9B 4M75B 3JCMg 3OYFA 3JB9G 2DJZA 2EQKA 1KD1C 5GMKl 3G4ST 4LDUA 1P92A 2ZCFB 4BE1A 3CC2T 2RK1A 4L59A 3Q1JA 4O5VA 4PJOC 4MZTA 3X20B 3OW2A 1O9SA 2JOYA 5GAN2 4J7FA 2M0OA 3HHTB 4Y28E 2M16A 3JB9F 2IG0A 3MEAA 4ME7A 2WACA 3JCMP 4XU1A 1QP3A 1KQ2A 3VUZA 1EIFA 3BY7A 1Y96B 4LDWA 3OYYA 1X75C 4M75C 1I5LA 4E7KA 5LJ3g 3TU4K 3P8BB 3M56A 2X4WA 2DVEA 1K8AC 2ZPHB 3G7ZA 3RKXA 2QTXA 2HQXA 5HK0A 2LCCA 5D6YA 3LGFA 2YRVA 3BW1A 3MHXA 2DIGA 4M77G 5GMKm 2GFAA 4F7UG 4EMKA 3ER0A 3OSVA 4ELZC 4RCBA 2XKOC 4QVDA 5CCAA 1VQ7A 3BDUA 4B9WA 2XHCA 3JCMX 3OS1A 5A0DA 4EMKC 3J81E 2MMPA 2DTIA 3A5ZB 3OB9A 1W2BS 4M77F 4F7UF 1BI1A 1BI0A 2DD5A 2PUOB 4C92A 5LJ5f 2XK0A 4Y91A 1WQ7A 3OYKA 5GAMf 2MWOA 2K57A 3V8JA 4FIBA 4BACA 4BI3A 1WNLA 2V8KA 1YHQT 2E65A 2M9UA 4C0DB 2HQEA 3I56T 2B8AA 3M4YA 2PVOB 3CMET 2P0QA 4BD3A 3GOXA 4QQDA 5HK3A 3HP9A 3OYGA 3OBYA 2X35A 5GANg 3ZBDA 4N4GA 4QQGA 4C5GA 2K5LA 2P0KA 4M7DG 1BIAA 2EJGA 1D3BA 1ZHIA 2CS7A 4C92E 3RMQA 1FWZA 3FLGA 5D6WA 1FXXA 4BB7A 4XU3A 2P0PA 3UT1A 4C5IA 3OW2S 2QA4A 2XDBA 3SFMA 1VQ9T 1TH7A 5HY6A 2CZ1B 3PFSA 4J6WA 4M7DF 4HT9A 1Q82C 2VXFA 4QW2A 2KAFA 3QYGB 3OYJA 1Y71A 4HKEA 1UEBA 1Q81U 3GNGA 4X34A 4KUDK 3NFCA 2G3RA 2JNGA 3CCRA 1PSFA 1G3SA 3UWNA 2DAQA 2XI9A 3RIRA 3L42A 4ZTJA 1XOVA 4RG2A 5LJ5d 5KE3A 1N8RU 4M7AA 2E41A 1H641 5GAMd 2LC4A 1GXIE 2DZ9A 2R57A 1V29B 1X6OA 4C8QB 3CCET 1G3YA 2L3RA 4OVAA 2LRQA 3G4SA 3CC2A 3INZA 2ZGWA 2E64A 4A4GA 1WPYA 4OB1B 3M57A 2KVQG 4M78B 3MP1A 4PL6A 3GPLA 1DJ7B 1LNXA 3L2WA 1M1FA 4RKUE 5LJ5j 1VQLT 3A8GB 5GAOl 3JCMf 3A8MB 2QQRA 4OGCA 3GF5A 1UGPB 2CKKA 4NS5A 2PQWA 3JSCA 5I2MA 2QI2A 2MI6A 1QVGA 1N6AA 1LJOA 3SD4A 3S3MA 2RJCA 1OZ2A 3QO3A 2KMTA 1VQ8T 4HCBA 5A0LA 1YJ9T 3PMTA 3QUIA 4M78C 4IUPA 2WSEE 4IURA 4FT2A 2R5AA 3QHSA 3QG1A 2V8IA 3JCMc 5LJ3f 3T9NA 4M75G 1XQHA 3OS5A 4QQ6A 4EDUA 2RHZA 5M9OA 2BIVA 4MDWA 4BDYA 4M7AD 4V2SA 2MF2A 4ZGDB 3GP8A 3QJ6A 3CCUT 1YBYA 3QZ5B 3OYBA 2DK3A 3LWIA 5GAOm 4Z02A 3HRSA 3JRZA 4P5NA 1M1KU 1Y07A 3H6ZA 4XTUA 3SWNA 4J83A 4D6WA 4M75F 1W4SA 1QW1A 3F70A 3FEOA 1HK9A 3NTHA 1NJIC 4PJOB 4N4HA 2DZCA 4ZGEB 1K73U 3MP6A 4M7DD 2ZPEB 5J3BA 3L2UA 5GMKj 2F5TX 4C8QD 4XTXA 1YHQA 3I56A 2JVVA 5FRNA 5CO7A 2K3YA 4M78D 1QVFA 3CEYA 3I55T 1XNIA 1Q86C 2HD0A 3MO8A 2DXCA 3WVEB 4JRPA 5KCHA 2EJ9A 2KY9A 4X9CA 1VQPT 2LTOA 3NTKA 1WGSA 2QQ9A 2XICA 4ZN3A 1N27A 2BKDN 4OB2B 3QSUA 3OMGA 2GCXA 3FJPA 2YLCA 2QQBA 2RO0A 5GANf 1K8AU 1VQ9A 3A8HB 1I81A 2DD4A 2QQAA 2RI3A 3C94A 5LJ3d 3CC7A 2VYTA 2ZPIB 1KHIA 2H3JA 4C0GA 2MAMA 5KCOA 2LNVA 1KC8C 3VJPA 3BFMA 2RM4A 3SB2A 4EMKB 1U1TA 2DO3A 3RKWA 4Q5WA 1QVGS 2E6ZA 3OQ5A 4VUBA 3FB9A 4HA8A 1I4K1 2OTJA 2FL7A 5LJ3j 4RMOA 1KQ1A 3OYMA 4MZPA 1BIBA 3FRNA 4C92B 3CPFA 3CCEA 1M8VA 3HFOA 4DOWA 5L8RE 2K5IA 3L1AA 3J80E 2YHTA 4JLGA 2RHUA 2ZPFB 2RB6A 3CBOA 3HRUA 3URGA 4C5EA 3CCJT 1VQMA 4PJOD 2RHYA 4UC4A 1VQ7T 4OB3B 5AYFA 1N9RA 2ZPGB 2CGHA 5FROA 3CCMT 3S3NA 2F69A 1I8FA 2GQVA 2DIQA 4XAXB 1S72T 4ATOA 3H8ZA 4OGEA 4TVRA 1YI2T 4C92C 1WJRA 4M75D 2GFUA 5D6XA 4BY6B 2DTOA 1D3BB 1VQ8A 4XK8E 3S6WA 5GANd 3CXCA 1YJ9A 5A2QE 4KUIA 3VKIA 1UGRB 3CBPA 4N0AA 4A4HA 3G6EA 3CPWA 3OYIA 3X25B 3PIOA 4JDSA 3C4SA 3META 1BI2A 4FSXA 1QVFS 1H3ZA 4C8QG 1Q82U 2V8JA 1WJSA 4N0AC 5GAN7 5GANj 3JCMb 4BY6C 3OYAA 4M78G 1LOJA 3CCUA 2X4XA 3OMCA 2VV5A 3TCJA 3CC7T 4II1A 4HT8A 5FU7C 5DM7R 3JCMV 4M7AB 4C8QF 3DLMA 4MZMA 4NL2A 3KXTA 4E7LA 4LDYA 2DEQA 2E1HA 2DXUA 3OS2A 2I2LA 2F5KA 3PMIA 4M78F 3LWHA 2E12A 5GAN6 2HNIA 2OTJT 4R55A 3CCLT 1K9MC 2FB7A 3M59A 2ZPBB 3QBYA 1VQ4T 4XQ3A 3WVDB 4M77A 5CVIA 3DB3A 4F7UA 5CK9A 1M4ZA 3OBWA 3VYHB 3E1SA 4A4EA 3I55A 2DXBA 5FU6B 2DTHA 3AHUA 2PVGB 5C0MA 2RHIA 1VQMT 2RJEA 4M7AC 1VQPA 1KHCA 2CZ7B 1VIEA 4EPCA 5CQXA 2MWPA 1SSFA 2RK2A 2CZ6B 2QEXT 3KUFA 3V8LA 5I21A 3PT9A 4R56A 2ZZDA 2DXTA 5KE2A 2L5QA 3VUBA 4JRQA 5CKBA 4A4FA 4KULA 4PJOG 4C0ZA 1Q81C 5FU6C 3BDLA 3L2RA 4LDXA 3HSBA 2EQUA 4M77E 4F7UE 2IVWA 2WSFE 3CCVA 1G5VA 2JZ2A 1NPPA 2D9TA 4XU0A 3CD6A 4XTZA 4PLIA 2XU8A 4OB0B 3CXCS 2E10A 3JB9J 2QXFA 2QDYB 3G6ET 1XTDA 5GAOn 4J6XA 4OP0A 3EAEA 4A54A 4YTLA 4A53A 4PJOF 4NL3A 2VUBA 2XDDA 4M7DA 3SWNB 2GF7A 3CPWS 3HPWA 2O4XA 2CZ0B 3P8DA 4PNOA 3G71A 1Q7YC 2VGMA 3CCJA 1JRIA 3M5AA 1QP2A 4E47A 5LL6S 2K3XA 4XTWA 5HKCA 1AHJB 5GAOp 4BDZA 1M5Q1 1JJ2A 2A3LA 1VQNT 3M9QA 2RI2A 3V8KA 5CIUA 1HXDA 3P8HA 1N9SA 1B34B 3NTIA 5CKEA 4NOYA 4MMLA 3WXMB 3X24B 5A0GA 5GAN4 3CCMA 1OI1A 2DKGA 1IZ6A 1JBMA 4RG8A 1RI0A 5LJ5e 4IUQA 4KBMB 5GAMe 3PIPA 2EIFA 1S72A 1KD1U 3SWNC 1UB4A 1YI2A 1Q86U 2RHXA 4N4IA 5CKFA 3TEEA 3A8LB 3CMAT 1B34A 4FM4B 3VU3C 3PTAA 5CR2A 4M7DE 2FVUA 3CC4A 3LX7A 1X01A 3QXEB 4C8QE 2EYQA 3GLXA 2LQKA 2KK4A 2LDMA 4BE2A 5GAOr 3L2VA 1M90C 3RKYA 2VXEA 4WF2A 2LQ8A 2X4YA 3RESA 1VQ6T 3QJYA 3OYHA 2XDPA 5I2SA 4C92G 5DLOA 2A7YA 4HCCA 3CCLA 2EKOA 2EFIA 3ME9A 4JS5A 3QDRB 2M1HA 3GNFB 5GMKi 2Y4YA 2PUKB 2JTMA 1M9SA 2Y90A 4C92F 2RI5A 3V7CA 3HRTA 3JCMW 1NZ9A 4PKCC 3CCVT 1K73C 3OYNA 3HKSA 3CD6T 5LJ5h 3ASKA 3E9FA 4MDXA 5GAMh 4GLKA 4DA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JJN K;  1M4Z A;  1ZHI A;  4FSX A;  4DOW A;  4BB7 A;  4DOV A;  1W4S A;  3PT9 A;  3TU4 K;  4KUD K;  4KUL A;  4LD9 K;  1ZBX A;  4FT2 A;  3PTA A;  4FT4 A;  4KUI A;  2FL7 A;  2FVU A;  4DA4 A; 
#chains in the Genus database with same CATH topology
 2GNC A;  3BE3 A;  3V7R A;  4M75 A;  3G71 T;  2RQW A;  2OX7 A;  2M51 A;  4PLL A;  1VUB A;  1MGQ A;  2OAU A;  4IUV A;  1OYX A;  1EFN A;  3UDC A;  4BI4 A;  5EG2 A;  1F1B B;  4J8O A;  3AT1 B;  4B9X A;  4O6J A;  3JCM e;  1YN8 A;  3PNW C;  4RTZ A;  1W70 A;  1CSK A;  2RJF A;  2VGN A;  3QDF A;  4F14 A;  1UGS B;  5FU7 B;  2LVM A;  1HSQ A;  2BUD A;  1K4U S;  3LH0 A;  4HCZ A;  3M53 A;  4LNP A;  3S3O A;  4J6Y A;  4KT0 E;  4JPB W;  2SRC A;  5GMK h;  2JN0 A;  2ROL A;  5GAO q;  1VQO T;  1NEG A;  3MEU A;  3X28 B;  1YIJ T;  1UGQ B;  3OA6 A;  4PJL A;  4M77 B;  3L2Z A;  2D6F A;  2KXD A;  4E7H A;  2CUD A;  2EWN A;  2PNI A;  3CCV Q;  3QKJ A;  4HVU A;  4CRI A;  3PGG A;  2KRN A;  2O01 E;  2MPX C;  1KG1 A;  1NPR A;  1NYF A;  4L6V 5;  4J9D A;  3TSW A;  3M0Q A;  5GAN 5;  1IGU A;  2V1Q A;  3DB4 A;  4A4K A;  2FRY A;  2Z0W A;  4ZNX A;  4QKU A;  2YUP A;  1RLQ C;  5GAN e;  1EZZ B;  1JO8 A;  2OTL Q;  3MCA B;  5DY9 A;  3EGX B;  2DFU A;  1WXU A;  2L8D A;  4A63 B;  4ZTF A;  5LJ5 g;  3OY9 A;  5GAM g;  2JS2 A;  1NG2 A;  1WQW A;  3DLL A;  1SKU B;  3JB9 I;  1CKB A;  1PC0 A;  2AHJ B;  2RN8 A;  4M77 D;  2AZS A;  4M7A E;  3ZFJ A;  1FX7 A;  3CCS A;  4OMF B;  3D7S B;  3VV0 A;  1WZO A;  1LVK A;  4EMG A;  1WHH A;  2A28 A;  1O75 A;  1VQL A;  1ABQ A;  1U8R A;  2DRM A;  1WHG A;  3UPU A;  1VQ5 A;  2RH2 A;  3CCR T;  2E4H A;  4E7J A;  3OS0 A;  1KD1 C;  3OYF A;  3JB9 G;  4FW2 A;  2EQK A;  5GMK l;  3G4S T;  1AZG B;  2ZCF B;  2RK1 A;  4O5V A;  3Q1J A;  4MZT A;  1O9S A;  2LMJ A;  1C6V X;  4Y28 E;  3JB9 F;  2GGR A;  4ME7 A;  1QP3 A;  4QT7 A;  2BE7 D;  3BY7 A;  2KT1 A;  1X75 C;  1I5L A;  1OV3 A;  5LJ3 g;  3M56 A;  2X4W A;  2ZPH B;  2HEQ A;  2A0F B;  2GFA A;  5L23 A;  2XKO C;  5CCA A;  3BDU A;  5A0D A;  5IXF A;  3J81 E;  3OB9 A;  2KE9 A;  3EG3 A;  3OYK A;  2MWO A;  2K57 A;  3V8J A;  4BAC A;  1ZSZ A;  1AOJ A;  2E65 A;  4C0D B;  1FYN A;  2B8A A;  4QQD A;  5HK3 A;  1VQK Q;  3OYG A;  1SPK A;  2YSQ A;  3EGD B;  1BIA A;  5KYW B;  1D3B A;  5D6W A;  4XU3 A;  4C5I A;  2QA4 A;  1G8X A;  3SFM A;  1VQ9 T;  2CZ1 B;  1K76 A;  2VXF A;  3QYG B;  1Y71 A;  2K79 A;  4X34 A;  3PVL A;  4KUD K;  2JNG A;  1KJW A;  1B3Q A;  2DAQ A;  4ZTJ A;  1XOV A;  4M7A A;  2E41 A;  2HCK A;  2LC4 A;  2DZ9 A;  4E7S A;  1G3Y A;  1JXO A;  3M0P A;  4M78 B;  2KVQ G;  3EG2 A;  4FCY A;  1LNX A;  3L2W A;  1T0H A;  3A8G B;  2QQR A;  3GF5 A;  1PG5 B;  3EHQ A;  1WHJ A;  5I2M A;  1U3O A;  1LJO A;  3SD4 A;  1QMC A;  3QO3 A;  1YIJ Q;  2L3P A;  1Q95 G;  3PMT A;  3QUI A;  2WSE E;  4IUR A;  4OMQ A;  2CT4 A;  1D1C A;  1XQH A;  3OS5 A;  4EDU A;  5M9O A;  2RHZ A;  2MF2 A;  1V1C A;  4FW1 A;  4ZGD B;  3GP8 A;  1YBY A;  2F2W A;  2X3W D;  3LWI A;  1D09 B;  1AWJ A;  1Y07 A;  3H6Z A;  3SWN A;  4D6W A;  4PJO B;  3FEO A;  1NJI C;  2E3H A;  1K73 U;  2ZPE B;  4J9H A;  5GMK j;  2F5T X;  2QAS A;  2JVV A;  5CO7 A;  3ZL7 C;  2DJQ A;  4M78 D;  1Q86 C;  1PD0 A;  4JRP A;  2RPN A;  2DXC A;  3EFO A;  2X51 A;  5KCH A;  2EJ9 A;  2QTV A;  4F04 B;  4OB2 B;  1BB9 A;  2O2O A;  4PK4 A;  3OMG A;  3FJP A;  4AT1 B;  2RO0 A;  1K0S A;  1I1J A;  4J9G A;  1H92 A;  3A8H B;  2DD4 A;  1KHI A;  2GBQ A;  1H3H A;  1U1T A;  2DO3 A;  1QVG S;  2QG9 B;  4VUB A;  4HA8 A;  1MMG A;  2OTJ A;  2L2P A;  2DL8 A;  2CP7 A;  4C92 B;  3CPF A;  3CCE A;  1M8V A;  4PJM A;  5L8R E;  3CCJ T;  4PJO D;  2MIO A;  2QYZ A;  2ZPG B;  3CCM T;  1IO6 A;  4XAX B;  2HZY A;  3EHR A;  4JJD A;  2GFU A;  4XK8 E;  3S6W A;  5GAN d;  5A2Q E;  4A4H A;  3OYI A;  4Z8A A;  1BI2 A;  1H3Z A;  2RQU A;  3EG9 B;  4C8Q G;  3GBQ A;  5GAN 7;  1FMV A;  3CCU A;  3TCJ A;  2F2V A;  2DYI A;  1K9M R;  4C8Q F;  2NUT A;  1WI7 A;  2BTT A;  3KXT A;  4OMO A;  2MK5 A;  5GAN 6;  2OTJ T;  4R55 A;  1M2O A;  1VQ4 T;  3DB3 A;  3OBW A;  2RMO A;  4GBQ A;  3VYH B;  2DTH A;  1VQP A;  4EPC A;  2DMO A;  1SSF A;  5KYX B;  2CZ6 B;  2ZZD A;  1VQ7 Q;  5KE2 A;  4JRQ A;  1Q81 C;  3BDL A;  2EQU A;  1YI2 Q;  4F7U E;  2IVW A;  3CCV A;  1RAG B;  1NPP A;  4XU0 A;  4OB0 B;  2DL7 A;  3JB9 J;  1QVG P;  5GAO n;  3EAE A;  4A53 A;  2BE9 B;  2XDD A;  2KRO A;  2JJ9 A;  2O4X A;  3P8D A;  1GCQ A;  1JRI A;  3M5A A;  4DEX A;  2AKL A;  1M5Q 1;  2RI2 A;  3X24 B;  4MML A;  3CC7 Q;  4KGV B;  4PJN A;  1RI0 A;  1MV0 B;  2EKH A;  1Q86 U;  1UB4 A;  2VVK A;  1M27 C;  4N4I A;  3LH5 A;  3A8L B;  2J7I A;  3VU3 C;  3PTA A;  4M7D E;  1YCS B;  2NYS A;  4WF2 A;  2LQ8 A;  5KYY A;  3QJY A;  5I2S A;  2E3I A;  5DLO A;  2A7Y A;  2QEX Q;  3SHW A;  1OX9 A;  2EYW A;  1GRI A;  3CCV T;  2YT6 A;  2JM8 A;  2NUP B;  5IT9 E;  3G6E Q;  1ACM B;  2K4Y A;  3OYD A;  2WSC E;  1SSH A;  4AFZ C;  1U1S A;  3EG1 A;  4J7I A;  4EIK A;  3VYG A;  1TS9 A;  1S1N A;  3M58 A;  3GIB A;  1JJ2 S;  2NWM A;  4F17 A;  2OTL T;  2IIM A;  3VS3 A;  3E9G A;  4JRI A;  1Y96 A;  2YUQ A;  4CC7 A;  3KBG A;  2KSS A;  3E19 A;  3C12 A;  4M75 E;  2C06 A;  1AWW A;  1SEM A;  3PVQ A;  3M54 A;  2CYZ B;  4ELY C;  1VQ6 Q;  4LN2 A;  3HTR A;  1NEB A;  4FYX B;  2AK5 A;  4AFS C;  2E5Q A;  1B7T A;  2EQM A;  1YJW T;  4RTY A;  3C95 A;  2JMC A;  1TUC A;  2D0Q B;  3JB9 H;  5D7U A;  1G3W A;  1SHF A;  2OAW A;  1QCN A;  2RJD A;  3RMS A;  2CP6 A;  4QVC A;  2HAX A;  3JCM h;  2HBP A;  1AD5 A;  2LQW A;  3A8O B;  3OYC A;  3CMA A;  3JCM J;  1PSE A;  3FDR A;  3LW5 E;  3N5B B;  2HSE B;  2EW3 A;  3EFR A;  1TOV A;  5CQY A;  3CCJ Q;  1Z9Z A;  5IN1 A;  3JB9 D;  4QVZ A;  2LX7 A;  1VIF A;  2K2V A;  2V1R A;  1NE8 A;  5I11 A;  2NLU A;  3OSS C;  3R6O A;  1VQK A;  3CBM A;  1Y7X A;  1M2V B;  1ZBX A;  1BK2 A;  4FT4 A;  2CT3 A;  1TWB A;  2PU9 B;  1N8R C;  3OYL A;  3LLR A;  2VB6 A;  4E7I A;  2DPP B;  1X6B A;  4KGZ B;  4EMH A;  2DEU A;  4M7D C;  3TRE A;  2JT4 A;  2KI7 A;  2X4J A;  4LDV A;  4ESR A;  2R5M A;  4FYY B;  1JJ2 P;  2D8H A;  2JTF A;  5GAN h;  2DIL A;  2FYK A;  4DQ2 A;  4C0F A;  3CCQ Q;  1VQ4 Q;  3VS7 A;  2LCL A;  1IRE B;  2P4T A;  5CKH A;  4RUG A;  1TXQ A;  2VWF A;  4RTV A;  4IUT A;  2A08 A;  1VQO A;  1KD1 R;  1YIJ A;  4F16 A;  2D1X A;  2J05 A;  3M55 A;  1KQS S;  1VQK T;  1R8O B;  1D1B A;  1Z9Q A;  4BI8 B;  3O8V A;  3QZ9 B;  2DJZ A;  4BE1 A;  3CC2 T;  1HD3 A;  1IHW A;  4HVW A;  4J7F A;  2M0O A;  2M16 A;  4XU1 A;  3VS0 A;  1KQ2 A;  3VUZ A;  1YIT Q;  5FW9 A;  4M75 C;  2LZ6 B;  3TU4 K;  3P8B B;  1OU8 A;  2O88 A;  1K8A C;  3RKX A;  1JU5 C;  3QWX X;  1PWT A;  2HBW A;  5HK0 A;  2YRV A;  4F7U G;  4EMK A;  4KGX B;  1YJN Q;  3NHN A;  2K3B A;  2XHC A;  1ZUY A;  1OPK A;  3OS1 A;  4EMK C;  3A5Z B;  4F7U F;  3CQT A;  1X69 A;  2DD5 A;  5LJ5 f;  4Y91 A;  1M3B A;  2ECZ A;  2LJ3 A;  5HCK A;  4D8D A;  5GAM f;  4FIB A;  4LUD A;  5FWC A;  1WNL A;  2V8K A;  1K9M U;  1WFW A;  2PVO B;  3QWY A;  1TG0 A;  1OOT A;  2W10 A;  4C5G A;  2K5L A;  3SEM A;  4JJB A;  3U23 A;  4M7D G;  2EJG A;  1ZHI A;  3TSZ A;  2CS7 A;  3RMQ A;  1FWZ A;  1Y0M A;  2VKN A;  1OQK A;  4B6M A;  3A1P A;  3PFS A;  4M7D F;  2FZK B;  3I5R A;  3NFC A;  3CCR A;  4JZ3 A;  3UWN A;  3RIR A;  3L42 A;  1PHT A;  4RG2 A;  1N8R U;  5KE3 A;  1H64 1;  2LJ1 A;  5IHK A;  1KQS P;  1V29 B;  1X6O A;  4C8Q B;  3G4S A;  2LRQ A;  3INZ A;  2CP2 A;  4OB1 B;  3GPL A;  4FYW B;  1M1F A;  4JZ4 A;  5GAO l;  2KRS A;  3A8M B;  2ED0 A;  2J6O A;  4NS5 A;  1I07 A;  3JSC A;  1ZBJ A;  1QVG A;  1YJW Q;  1VQ8 T;  1MND A;  1C0M A;  1YJ9 T;  4AG1 C;  3EH1 A;  5KYU A;  3I56 Q;  3CME Q;  1D0X A;  4IUP A;  3QG1 A;  1MMD A;  3H0H A;  5LJ3 f;  3T9N A;  4M75 G;  2J06 A;  4QQ6 A;  4OMN A;  2BIV A;  4MDW A;  1W1F A;  1NJI R;  1WHK A;  2I0N A;  3QZ5 B;  4P5N A;  3H0F A;  1VQ7 A;  3JCM X;  2D8J A;  4M75 F;  3F70 A;  3NTH A;  1HK9 A;  2YUO A;  1Q86 R;  2DET A;  1BCM A;  4C8Q D;  4LUE A;  2DNU A;  2KYB A;  3WVE B;  4KRT A;  4J9I A;  2KY9 A;  4RTT A;  4X9C A;  3NTK A;  1WGS A;  2AKK A;  2QQ9 A;  1OX8 A;  1N27 A;  2XIC A;  1RAD B;  1QVF P;  4CC2 A;  2ATC B;  1K8A U;  1VQ9 A;  2YRD A;  3CC7 A;  2QQA A;  2ZPI B;  2LNV A;  5GJW B;  1KC8 C;  3BFM A;  5I22 A;  1LPL A;  3REA B;  2E6Z A;  1E6G A;  1KQ1 A;  2DL5 A;  1RLP C;  2RF0 A;  1T3L A;  1BIB A;  2RNA A;  1AVZ C;  3J80 E;  2K5I A;  3L1A A;  5EC7 A;  2YHT A;  1QCF A;  2EPD A;  2DBK A;  1VQ7 T;  2K9G A;  4OB3 B;  5AYF A;  2HDA A;  1I8F A;  2AIR B;  2CSI A;  3H8Z A;  2ROT A;  1YI2 T;  3VS6 A;  5D6X A;  1K9A A;  2RQR A;  3FJ5 A;  1ZSZ C;  1WIE A;  4N0A A;  3G6E A;  3I5S A;  4HCK A;  3VS1 A;  3C4S A;  3CC2 Q;  3CXC P;  4JJC A;  4N0A C;  5GAN j;  5IHN A;  2C0O A;  2X4X A;  2VV5 A;  3OMC A;  3CC7 T;  5FU7 C;  2CP5 A;  2DM1 A;  4E7L A;  4MZM A;  2DEQ A;  2DXU A;  2I2L A;  3PMI A;  3LWH A;  2E12 A;  1UHF A;  3CCL T;  1GCP A;  2X9H A;  4XQ3 A;  3WVD B;  4M77 A;  5CK9 A;  1M4Z A;  3E1S A;  4A4E A;  4J9C A;  5C0M A;  2RHI A;  4M7A C;  2CZ7 B;  2RK2 A;  1E6H A;  1Q81 R;  2QEX T;  3V8L A;  2X3X D;  1TU0 B;  4A4F A;  1T0J A;  1S72 Q;  3A98 A;  2F1L A;  2QXF A;  3G6E T;  4NL3 A;  1QLY A;  2GF7 A;  3CPW S;  2CZ0 B;  3CCJ A;  2KXC A;  5HKC A;  1SF9 A;  2K3X A;  1AHJ B;  1JJ2 A;  1VQN T;  3M9Q A;  3M0U A;  5AT1 B;  3V8K A;  1JEG A;  3P8H A;  1N9S A;  3NTI A;  5CKE A;  4NOY A;  3CCM A;  1OEB A;  5LJ5 e;  1IZ6 A;  1JBM A;  2ED1 A;  3H41 A;  4IUQ A;  4KBM B;  1PKS A;  5GAM e;  3PIP A;  1KD1 U;  3SWN C;  8ATC B;  5KYY B;  2L3Q A;  1B34 A;  4FM4 B;  2FVU A;  2KR3 A;  3LX7 A;  3QXE B;  2EYQ A;  2LQK A;  2CP0 A;  4OML A;  3RES A;  2X4Y A;  1VQ6 T;  4CC4 B;  2HQH A;  1VQM Q;  1B07 A;  4HCC A;  2EKO A;  3QDR B;  1VOM A;  2DA9 A;  3GNF B;  3UAT A;  2JTM A;  1M9S A;  3G1J A;  1FMK A;  2RI5 A;  1NZ9 A;  3HKS A;  1VQ8 Q;  4MDX A;  3E9F A;  1YJ9 Q;  4GLK A;  4DA4 A;  3CCQ A;  1VQ4 A;  1WX6 A;  4AMC A;  3O5Z A;  4JLI A;  3E2U A;  4JRK A;  4IIM A;  4CC3 A;  1ZA2 B;  4PJO E;  1I0C A;  3L2Q A;  4M7A G;  1TUG B;  3J7A F;  4AFQ C;  2YUN A;  1NYG A;  4LD9 K;  4OF1 A;  3LGL A;  3FIF A;  2ESW A;  4JS4 A;  4M7A F;  2CH4 A;  1OU9 A;  1VYT A;  5LJ3 e;  3HL8 A;  4CI0 C;  2JS0 A;  1YIT A;  3CPW P;  4LXC A;  2XD0 A;  2FZC B;  1MHN A;  2G6F X;  1M3A A;  5IHI A;  4DBQ A;  4HXJ A;  3VRY A;  3ZEH A;  5CAI A;  4F7U B;  1G3T A;  1OZ3 A;  3QPH A;  4IKF A;  1SRM A;  4C92 D;  2KBT A;  5J39 A;  3RER A;  2E6N A;  3CCQ T;  1YJN A;  2Y4X A;  4C0D C;  5KYW A;  4DOV A;  4OMP A;  4XTY A;  1VYU A;  1KQS A;  1QWF A;  2EQI A;  3CCS Q;  1N8R R;  4RCC A;  4M7D B;  2ZAE A;  5DLQ E;  2CRE A;  4BUG A;  2EYZ A;  2JUF A;  2QQS A;  2LJ0 A;  3CC4 Q;  4JJN K;  3SDZ A;  3LYI A;  1QVP A;  5GAN 3;  1RAF B;  5GAN 8;  4FSS A;  2EGE A;  5GAM j;  1NJI U;  1YIT T;  2QGF B;  3JV3 A;  2J6F A;  3NPF A;  4M78 A;  2KT8 A;  1RAE B;  2EQJ A;  2GTO A;  1AWX A;  3M0R A;  2COZ A;  1GCQ C;  1YCY A;  3QII A;  2OTL A;  2LX9 A;  1KFZ A;  2OI3 A;  1BI3 A;  2LT1 A;  1YJN T;  3CCL Q;  1UG1 A;  3JCM Q;  9ATC B;  2R58 A;  4J9F A;  2RA2 A;  4C5H A;  1Y57 A;  3TQ7 P;  4ZN1 A;  1X43 A;  2LT4 A;  2PVD B;  1KIK A;  1RL2 A;  3REB B;  1YJW A;  2KDS A;  1ZUK A;  1SRL A;  2YLB A;  3CME A;  5J26 A;  3JAM E;  4PJO A;  4DEY A;  1ABO A;  3H0I A;  4M75 B;  3JCM g;  1UGV A;  1QCO A;  1P92 A;  2LP5 A;  4FYV B;  4L59 A;  2LNH B;  4PJO C;  3X20 B;  5GAN 2;  1WHL A;  2DX1 A;  3HHT B;  2IG0 A;  1K8A R;  3MEA A;  2WAC A;  3JCM P;  4LDW A;  1VQN Q;  1WXB A;  1ZLM A;  3NGP A;  3G7Z A;  1H8K A;  2QTX A;  1G83 A;  2YWW A;  5GMK m;  3OSV A;  1NBE B;  4RCB A;  4QVD A;  4B9W A;  2O9V A;  2MMP A;  1GFC A;  2DTI A;  1W2B S;  4Z89 A;  1BI0 A;  1PCX A;  2PUO B;  4C92 A;  2XK0 A;  1PKT A;  3RNJ A;  1YHQ T;  1YFN A;  3I56 T;  3CME T;  3M4Y A;  2QGG A;  2P0Q A;  3GOX A;  1V76 A;  1AZE A;  4Z88 A;  3OBY A;  1RI9 A;  2X35 A;  3ZBD A;  4N4G A;  5GAN g;  1NM7 A;  2JMA A;  2DLP A;  1BU1 A;  3OW2 S;  1T3S A;  1TH7 A;  5HY6 A;  2HKQ B;  4J6W A;  4HT9 A;  1Q82 C;  3EG9 A;  4QW2 A;  4HKE A;  1Q81 U;  1UTI A;  1M8M A;  2G3R A;  2QAZ A;  5LJ5 d;  5GAM d;  1GXI E;  1IGQ A;  3CC2 A;  5KYN A;  2HSP A;  2KYM A;  2IPO B;  1KSW A;  3MP1 A;  4PL6 A;  4RKU E;  3M0S A;  1A0N B;  2FG0 A;  4OGC A;  2EGC A;  1UGP B;  2CKK A;  5KYX A;  2PZ1 A;  1OZ2 A;  2KMT A;  1MMN A;  1X27 A;  4HCB A;  5A0L A;  2CDT A;  1Q7Y R;  1UDL A;  3QHS A;  2V8I A;  4V2S A;  1WXT A;  3IQL A;  4Z02 A;  5IH2 A;  1LCK A;  1W4S A;  1QW1 A;  2J6K A;  1MUZ A;  4N4H A;  1W2B P;  2DZC A;  4ZGE B;  4AFU C;  3MP6 A;  1BBZ A;  1M90 R;  5J3B A;  3L2U A;  1HJD A;  4XTX A;  2K6D A;  3I55 T;  2HD0 A;  4X1V A;  2NUZ A;  3CCE Q;  1YWO A;  4OMM A;  2BKD N;  1KC8 R;  2GCX A;  2QQB A;  1K0X A;  1I81 A;  3C94 A;  5LJ3 d;  3OW2 P;  2VYT A;  2DRK A;  2H3J A;  2MAM A;  3VJP A;  1RAI B;  3SB2 A;  4Q5W A;  2A36 A;  3OYM A;  3UA6 A;  3FRN A;  1GBR A;  1W6X A;  4DOW A;  4C5E A;  2ZPF B;  1VQM A;  2NUP A;  1ZSZ B;  2RHY A;  1U06 A;  2KNB B;  2L3S A;  3CCU Q;  2FO0 A;  1N9R A;  5FRO A;  2CGH A;  3RR6 A;  2F69 A;  2GQV A;  2HKN A;  1S72 T;  2A37 A;  4OGE A;  1D3B B;  1VQ8 A;  1U5S A;  2EBP A;  3TVT A;  1YJ9 A;  4KUI A;  3VKI A;  1R77 A;  2P84 A;  3CPW A;  3PIO A;  4JDS A;  1QVF S;  1Q82 U;  1VQP Q;  2EGA A;  1WJS A;  2V8J A;  2KGT A;  3JCM b;  4BY6 C;  3OYA A;  1CKA A;  4II1 A;  5DM7 R;  1UJY A;  3JCM V;  3THK A;  1C1A A;  4M7A B;  4NL2 A;  1UHC A;  4ANJ A;  1G2B A;  2E1H A;  3OS2 A;  1GBQ A;  2F5K A;  2HNI A;  1AEY A;  3M59 A;  2D0N A;  1R0C B;  3QBY A;  2RQT A;  5CVI A;  2FPF A;  2DXB A;  2PVG B;  1VQM T;  2RJE A;  3PE0 A;  1KHC A;  1VIE A;  2MWP A;  3PT9 A;  5GJV B;  2HL3 A;  2L5Q A;  3VUB A;  5CKB A;  4KUL A;  4C0Z A;  5FU6 C;  1QKX A;  4KH0 B;  3L2R A;  4LDX A;  3HSB A;  4M77 E;  1YHQ Q;  1UEC A;  2WSF E;  4E6R A;  2D9T A;  4XTZ A;  3CXC S;  2QDY B;  1SHG A;  1D0Y A;  4E2F B;  4YTL A;  2LCS A;  2ABL A;  1M2V A;  3SWN B;  3HPW A;  4PNO A;  1Q7Y C;  1QP2 A;  5LL6 S;  4XTW A;  4M7A D;  4BDZ A;  2A3L A;  5CIU A;  1B34 B;  5A0G A;  5GAN 4;  4PFO A;  2DKG A;  4RG8 A;  3EFO B;  3R6N A;  1YI2 A;  3MJX A;  5CKF A;  3TEE A;  1RAA B;  3I9Q A;  1X2K A;  3CC4 A;  5GAO r;  4C8Q E;  2LDM A;  1M90 C;  3RKY A;  2YRC A;  2FEI A;  1MNE A;  1ZUU A;  3OYH A;  2XDP A;  1M1K R;  2F2X A;  1M30 A;  4J9E A;  2EFI A;  4HVV A;  4E7Z A;  5GMK i;  2Y4Y A;  2PUK B;  2L0A A;  1PM3 A;  1KK7 A;  4PKC C;  1K73 C;  5LJ5 h;  1OUL A;  5GAM h;  3CCL A;  2LQN A;  5GMK e;  2XG8 D;  2CUB A;  1JB0 E;  1I5O B;  4J5Y A;  3M0T A;  2W0Z A;  2K7A A;  2KEA A;  3MEW A;  4XU2 A;  2QEX A;  1D1A A;  3CCS T;  5KH6 A;  2EAY A;  2XMF A;  5FRM A;  1ZX6 A;  3MEV A;  3CC4 T;  3CMA Q;  1AWO A;  1VQL T;  2CH4 W;  2E70 A;  1IB8 A;  2AZV A;  4BE0 A;  3I55 Q;  2DF6 A;  2NUT B;  1VQ5 T;  4ZGJ B;  1VQN A;  2JM9 A;  4XTV A;  2C0I A;  4PJJ A;  1TUD A;  2RD1 A;  1X2Q A;  1J3T A;  5FLX E;  3C0C A;  5IAY A;  3RUX A;  3CD6 Q;  4LE9 A;  1ZQ1 A;  2L89 A;  2V26 A;  2H8H A;  3DKM A;  2EJF A;  2C0T A;  1VQ6 A;  1RUW A;  3G71 Q;  3HFN A;  4M77 C;  1BYM A;  1RAC B;  1WLP B;  3VS2 A;  5LJ3 h;  1BKB A;  1WJQ A;  4IUU A;  1E7O A;  3UF4 A;  2JTE A;  2YXY A;  5C6S A;  3RBB B;  5FWB A;  4JUV A;  3QYH B;  2O4X B;  7AT1 B;  1Q7Y U;  3FC3 A;  3EFS A;  3EGX A;  2O31 A;  3M4G A;  2B86 A;  2GQI A;  2DVJ A;  3EG0 A;  4LD6 A;  4L5G A;  4C8Q A;  4FU6 A;  2FHD A;  1VQO Q;  2VC8 A;  3X26 B;  2SEM A;  4C8Q C;  1ARK A;  1M1G A;  1M90 U;  3VS4 A;  3MPU B;  2XID A;  2FPE A;  1XJW B;  4FL6 A;  2CSQ A;  2MCN A;  2K5F A;  1W2B A;  3RDV A;  6AT1 B;  2QA4 T;  3KFV A;  4M78 E;  4X9D A;  1WYX A;  4PFP A;  4MMK A;  1YNZ A;  5CKD A;  2YDL A;  3V7S A;  1KC8 U;  2DE0 X;  4DBR A;  4WCI A;  4AG2 C;  1M1K C;  4GY5 A;  3MP8 A;  3OYE A;  3JCM d;  2KQW A;  1TTH B;  4LDU A;  1JQQ A;  1WDX A;  2DER A;  4R0K A;  3OW2 A;  1WHM A;  2JOY A;  4RTX A;  1K1Z A;  3VS5 A;  4WTO B;  1EIF A;  2FPD A;  1Y96 B;  3OYY A;  2FZG B;  4E7K A;  2DVE A;  4GLM A;  2HQX A;  5IXB A;  2LCC A;  5D6Y A;  3LGF A;  3BW1 A;  3MHX A;  2DIG A;  3H9N A;  4M77 G;  3ER0 A;  4ELZ C;  1X6G A;  2PTK A;  1ZA1 B;  1EX4 A;  2M0Y A;  1RAB B;  1UE9 A;  2CP3 A;  2RQV A;  4M77 F;  1BI1 A;  1WQ7 A;  1GFD A;  4PFZ A;  4BI3 A;  1N5Z A;  2M9U A;  2HQE A;  3CCR Q;  4BD3 A;  1M3C A;  3HP9 A;  1IXD A;  2VAS A;  4QQG A;  2COY A;  2P0K A;  3G4S Q;  1QWE A;  1Q82 R;  4C92 E;  3FLG A;  1FXX A;  4BB7 A;  2P0P A;  3UT1 A;  2XDB A;  3EGD A;  4Y92 A;  2ENM A;  2KAF A;  3OYJ A;  1UEB A;  3GNG A;  1MV3 A;  3NMZ C;  1PSF A;  1AT1 B;  1G3S A;  2XI9 A;  2EYY A;  2R57 A;  3CCE T;  2L3R A;  4OVA A;  2JW4 A;  1VQL Q;  2ZGW A;  2E64 A;  4A4G A;  1WPY A;  3M57 A;  1DJ7 B;  2HMA A;  2GTJ A;  5LJ5 j;  4ORZ A;  3JCM f;  2PQW A;  1VQ5 Q;  2QI2 A;  2KRM A;  2MI6 A;  1N6A A;  3S3M A;  2RJC A;  4M78 C;  2FRW A;  4FT2 A;  2R5A A;  1PD1 A;  3JCM c;  1WA7 A;  3EH2 A;  4BDY A;  2MYS A;  4DBH A;  3QJ6 A;  3CCU T;  3OYB A;  2DK3 A;  5GAO m;  3HRS A;  3JRZ A;  1M1K U;  2M02 A;  1ZSG A;  1VQ9 Q;  4XTU A;  4J83 A;  2DBM A;  4M7D D;  2H3E B;  3UA7 A;  1YHQ A;  3I56 A;  5FRN A;  2K3Y A;  1QVF A;  3CEY A;  2EYX A;  1XNI A;  3MO8 A;  1VQP T;  2LTO A;  4ZN3 A;  3QSU A;  2YLC A;  5GAN f;  2QK0 A;  1UFF A;  2RI3 A;  4C0G A;  5KCO A;  1QQJ A;  2RM4 A;  4EMK B;  3RKW A;  2OJ2 A;  3OQ5 A;  3FB9 A;  1I4K 1;  2K2M A;  2FL7 A;  5LJ3 j;  4RMO A;  4MZP A;  2COW A;  4DBF A;  3HFO A;  2P4R A;  4JLG A;  2RHU A;  3CBO A;  2RB6 A;  3HRU A;  1JXM A;  3URG A;  4UC4 A;  2QA4 Q;  1VYV A;  1SG5 A;  1NLP C;  3S3N A;  2DIQ A;  8AT1 B;  4ATO A;  4TVR A;  1D0Z A;  4C92 C;  1WJR A;  4M75 D;  4BY6 B;  2DTO A;  3CXC A;  1R0B G;  1UGR B;  1QKW A;  3CBP A;  3X25 B;  3MET A;  3VRZ A;  4FSX A;  1UJ0 A;  2DYB A;  4M78 G;  1LOJ A;  4HT8 A;  2DL4 A;  1YWP A;  1GL5 A;  3DLM A;  3MKD A;  4LDY A;  4RTW A;  2QDL A;  1HYO A;  4M78 F;  1K9M C;  2FB7 A;  2ZPB B;  2MOX A;  4F7U A;  1IRX A;  3I55 A;  1PRM C;  5FU6 B;  2O9S A;  3AHU A;  1UUE A;  2EVR A;  5CQX A;  1VA7 A;  3KUF A;  5I21 A;  5KYU B;  4R56 A;  2DXT A;  4K11 A;  3CCM Q;  4PJO G;  1YP5 A;  4RTU A;  1G5V A;  2JZ2 A;  1NLO C;  3CD6 A;  4PLI A;  2XU8 A;  2E10 A;  2BZX A;  1XTD A;  4J6X A;  4OP0 A;  4A54 A;  4PJO F;  2VUB A;  4M7D A;  5ECA A;  3I35 A;  3G71 A;  2VGM A;  1OPL A;  2JXB A;  5GAO p;  4E47 A;  1MMA A;  1HXD A;  2DL3 A;  1BCO A;  3WXM B;  2E5K A;  1OI1 A;  4KH1 B;  2EIF A;  1S72 A;  2RHX A;  3CMA T;  1PRL C;  5CR2 A;  2OTJ Q;  1X01 A;  4D8K A;  3GLX A;  2KK4 A;  4BE2 A;  3L2V A;  2VXE A;  3ULR B;  1RAH B;  1TSF A;  2BZY A;  4C92 G;  3ME9 A;  1IHV A;  4JS5 A;  2M1H A;  1PNJ A;  1K73 R;  4IIO A;  2AT1 B;  2Y90 A;  4C92 F;  3V7C A;  3EGU A;  3HRT A;  2BZ8 A;  3JCM W;  3OYN A;  2HL5 C;  3CD6 T;  4J9B A;  1FMW A;  3ASK A;  4M4Z A; 
#chains in the Genus database with same CATH homology
 5GMK e;  2XG8 D;  3CCQ A;  5IT9 E;  1VQ4 A;  1JB0 E;  2K4Y A;  3V7R A;  4M75 A;  4J5Y A;  3G71 T;  3OYD A;  2WSC E;  4PLL A;  1VUB A;  1MGQ A;  2OAU A;  1U1S A;  4J7I A;  4IUV A;  3VYG A;  1OYX A;  4JLI A;  3UDC A;  4BI4 A;  4JRK A;  3MEW A;  4XU2 A;  5EG2 A;  2QEX A;  4PJO E;  3M58 A;  3GIB A;  1JJ2 S;  4J8O A;  4B9X A;  3JCM e;  4O6J A;  2OTL T;  3CCS T;  3PNW C;  2RJF A;  5KH6 A;  3L2Q A;  3E9G A;  2EAY A;  5FRM A;  2VGN A;  1Y96 A;  4JRI A;  4M7A G;  3J7A F;  3KBG A;  3RER A;  2KSS A;  3E19 A;  3MEV A;  3CC4 T;  4LD9 K;  1UGS B;  3C12 A;  2LVM A;  3LGL A;  4M75 E;  2E70 A;  4OF1 A;  5FU7 B;  3FIF A;  2C06 A;  2BUD A;  4JS4 A;  3LH0 A;  4BE0 A;  4HCZ A;  3M53 A;  4M7A F;  3S3O A;  3M54 A;  2CYZ B;  4J6Y A;  5LJ3 e;  3HL8 A;  4KT0 E;  4ELY C;  5GMK h;  2JN0 A;  5GAO q;  4CI0 C;  1VQO T;  3MEU A;  1VQ5 T;  3X28 B;  2E5Q A;  1YIT A;  2EQM A;  4ZGJ B;  1YJW T;  2XD0 A;  1YIJ T;  1VQN A;  1MHN A;  3C95 A;  1UGQ B;  4XTV A;  3OA6 A;  2D0Q B;  3JB9 H;  3ZEH A;  1G3W A;  2RD1 A;  2RJD A;  3L2Z A;  4M77 B;  3RMS A;  4F7U B;  4QVC A;  1G3T A;  1OZ3 A;  5CAI A;  2D6F A;  4E7H A;  3QPH A;  2HAX A;  4IKF A;  3JCM h;  5FLX E;  2EWN A;  2HBP A;  3A8O B;  4C92 D;  5IAY A;  3OYC A;  3CMA A;  3JCM J;  3RUX A;  5J39 A;  1PSE A;  2E6N A;  1ZQ1 A;  3QKJ A;  4CRI A;  3CCQ T;  1YJN A;  3FDR A;  3LW5 E;  3PGG A;  2Y4X A;  3N5B B;  2L89 A;  2O01 E;  3DKM A;  2EJF A;  1NPR A;  4L6V 5;  1KG1 A;  4C0D C;  1VQ6 A;  1K9M U;  3EFR A;  5CQY A;  3HFN A;  4M77 C;  5GAN 5;  1BYM A;  5IN1 A;  3DB4 A;  4DOV A;  4A4K A;  3JB9 D;  4QVZ A;  4XTY A;  5LJ3 h;  1BKB A;  1KQS A;  5GAN e;  1WJQ A;  1VIF A;  4IUU A;  2K2V A;  1NE8 A;  2NLU A;  3MCA B;  5DY9 A;  3OSS C;  3R6O A;  5C6S A;  1VQK A;  3CBM A;  1Y7X A;  4RCC A;  4M7D B;  1ZBX A;  4JUV A;  2L8D A;  4ZTF A;  3QYH B;  2O4X B;  4FT4 A;  5DLQ E;  4BUG A;  5LJ5 g;  3OY9 A;  2JUF A;  5GAM g;  2QQS A;  1Q7Y U;  4JJN K;  2PU9 B;  3SDZ A;  3FC3 A;  3EFS A;  1WQW A;  1QVP A;  3LYI A;  1N8R C;  3M4G A;  3DLL A;  3OYL A;  5GAN 3;  3LLR A;  5GAN 8;  4LD6 A;  4L5G A;  4C8Q A;  4FU6 A;  2FHD A;  5GAM j;  3JB9 I;  4E7I A;  1NJI U;  2DPP B;  1YIT T;  2AHJ B;  4EMH A;  2VC8 A;  4M7D C;  3TRE A;  4M78 A;  4M77 D;  3X26 B;  2EQJ A;  2X4J A;  4C8Q C;  4M7A E;  3ZFJ A;  4LDV A;  1FX7 A;  1YCY A;  3QII A;  2OTL A;  3CCS A;  2R5M A;  4OMF B;  3VV0 A;  1M1G A;  2JTF A;  2LX9 A;  5GAN h;  1M90 U;  2XID A;  4EMG A;  2FYK A;  4FL6 A;  2LT1 A;  1BI3 A;  1YJN T;  4DQ2 A;  4C0F A;  1O75 A;  3JCM Q;  1VQL A;  2K5F A;  2R58 A;  2RA2 A;  1W2B A;  4C5H A;  2QA4 T;  4M78 E;  2LCL A;  4X9D A;  4ZN1 A;  1IRE B;  2P4T A;  5CKH A;  1U8R A;  4MMK A;  4IUT A;  5CKD A;  3V7S A;  1VQO A;  1KC8 U;  2LT4 A;  2PVD B;  3UPU A;  1VQ5 A;  2RH2 A;  1RL2 A;  1YJW A;  2KDS A;  1YIJ A;  3CCR T;  1M1K C;  4GY5 A;  3MP8 A;  4E7J A;  3M55 A;  2YLB A;  1KQS S;  1R8O B;  3OS0 A;  3CME A;  5J26 A;  1VQK T;  3OYE A;  3JAM E;  4PJO A;  3JCM d;  2KQW A;  4BI8 B;  3O8V A;  3QZ9 B;  4M75 B;  3JCM g;  3OYF A;  3JB9 G;  2DJZ A;  2EQK A;  1KD1 C;  5GMK l;  3G4S T;  4LDU A;  1P92 A;  2ZCF B;  4BE1 A;  3CC2 T;  2RK1 A;  4L59 A;  3Q1J A;  4O5V A;  4PJO C;  4MZT A;  3X20 B;  3OW2 A;  1O9S A;  2JOY A;  5GAN 2;  4J7F A;  2M0O A;  3HHT B;  4Y28 E;  2M16 A;  3JB9 F;  2IG0 A;  3MEA A;  4ME7 A;  2WAC A;  3JCM P;  4XU1 A;  1QP3 A;  1KQ2 A;  3VUZ A;  1EIF A;  3BY7 A;  1Y96 B;  4LDW A;  3OYY A;  1X75 C;  4M75 C;  1I5L A;  4E7K A;  5LJ3 g;  3TU4 K;  3P8B B;  3M56 A;  2X4W A;  2DVE A;  1K8A C;  2ZPH B;  3G7Z A;  3RKX A;  2QTX A;  2HQX A;  5HK0 A;  2LCC A;  5D6Y A;  3LGF A;  2YRV A;  3BW1 A;  3MHX A;  2DIG A;  4M77 G;  5GMK m;  2GFA A;  4F7U G;  4EMK A;  3ER0 A;  3OSV A;  4ELZ C;  4RCB A;  2XKO C;  4QVD A;  5CCA A;  1VQ7 A;  3BDU A;  4B9W A;  2XHC A;  3JCM X;  3OS1 A;  5A0D A;  4EMK C;  3J81 E;  2MMP A;  2DTI A;  3A5Z B;  3OB9 A;  1W2B S;  4M77 F;  4F7U F;  1BI1 A;  1BI0 A;  2DD5 A;  2PUO B;  4C92 A;  5LJ5 f;  2XK0 A;  4Y91 A;  1WQ7 A;  3OYK A;  5GAM f;  2MWO A;  2K57 A;  3V8J A;  4FIB A;  4BAC A;  4BI3 A;  1WNL A;  2V8K A;  1YHQ T;  2E65 A;  2M9U A;  4C0D B;  2HQE A;  3I56 T;  2B8A A;  3M4Y A;  2PVO B;  3CME T;  2P0Q A;  4BD3 A;  3GOX A;  4QQD A;  5HK3 A;  3HP9 A;  3OYG A;  3OBY A;  2X35 A;  5GAN g;  3ZBD A;  4N4G A;  4QQG A;  4C5G A;  2K5L A;  2P0K A;  4M7D G;  1BIA A;  2EJG A;  1D3B A;  1ZHI A;  2CS7 A;  4C92 E;  3RMQ A;  1FWZ A;  3FLG A;  5D6W A;  1FXX A;  4BB7 A;  4XU3 A;  2P0P A;  3UT1 A;  4C5I A;  3OW2 S;  2QA4 A;  2XDB A;  3SFM A;  1VQ9 T;  1TH7 A;  5HY6 A;  2CZ1 B;  3PFS A;  4J6W A;  4M7D F;  4HT9 A;  1Q82 C;  2VXF A;  4QW2 A;  2KAF A;  3QYG B;  3OYJ A;  1Y71 A;  4HKE A;  1UEB A;  1Q81 U;  3GNG A;  4X34 A;  4KUD K;  3NFC A;  2G3R A;  2JNG A;  3CCR A;  1PSF A;  1G3S A;  3UWN A;  2DAQ A;  2XI9 A;  3RIR A;  3L42 A;  4ZTJ A;  1XOV A;  4RG2 A;  5LJ5 d;  5KE3 A;  1N8R U;  4M7A A;  2E41 A;  1H64 1;  5GAM d;  2LC4 A;  1GXI E;  2DZ9 A;  2R57 A;  1V29 B;  1X6O A;  4C8Q B;  3CCE T;  1G3Y A;  2L3R A;  4OVA A;  2LRQ A;  3G4S A;  3CC2 A;  3INZ A;  2ZGW A;  2E64 A;  4A4G A;  1WPY A;  4OB1 B;  3M57 A;  2KVQ G;  4M78 B;  3MP1 A;  4PL6 A;  3GPL A;  1DJ7 B;  1LNX A;  3L2W A;  1M1F A;  4RKU E;  5LJ5 j;  1VQL T;  3A8G B;  5GAO l;  3JCM f;  3A8M B;  2QQR A;  4OGC A;  3GF5 A;  1UGP B;  2CKK A;  4NS5 A;  2PQW A;  3JSC A;  5I2M A;  2QI2 A;  2MI6 A;  1QVG A;  1N6A A;  1LJO A;  3SD4 A;  3S3M A;  2RJC A;  1OZ2 A;  3QO3 A;  2KMT A;  1VQ8 T;  4HCB A;  5A0L A;  1YJ9 T;  3PMT A;  3QUI A;  4M78 C;  4IUP A;  2WSE E;  4IUR A;  4FT2 A;  2R5A A;  3QHS A;  3QG1 A;  2V8I A;  3JCM c;  5LJ3 f;  3T9N A;  4M75 G;  1XQH A;  3OS5 A;  4QQ6 A;  4EDU A;  2RHZ A;  5M9O A;  2BIV A;  4MDW A;  4BDY A;  4M7A D;  4V2S A;  2MF2 A;  4ZGD B;  3GP8 A;  3QJ6 A;  3CCU T;  1YBY A;  3QZ5 B;  3OYB A;  2DK3 A;  3LWI A;  5GAO m;  4Z02 A;  3HRS A;  3JRZ A;  4P5N A;  1M1K U;  1Y07 A;  3H6Z A;  4XTU A;  3SWN A;  4J83 A;  4D6W A;  4M75 F;  1W4S A;  1QW1 A;  3F70 A;  3FEO A;  1HK9 A;  3NTH A;  1NJI C;  4PJO B;  4N4H A;  2DZC A;  4ZGE B;  1K73 U;  3MP6 A;  4M7D D;  2ZPE B;  5J3B A;  3L2U A;  5GMK j;  2F5T X;  4C8Q D;  4XTX A;  1YHQ A;  3I56 A;  2JVV A;  5FRN A;  5CO7 A;  2K3Y A;  4M78 D;  1QVF A;  3CEY A;  3I55 T;  1XNI A;  1Q86 C;  2HD0 A;  3MO8 A;  2DXC A;  3WVE B;  4JRP A;  5KCH A;  2EJ9 A;  2KY9 A;  4X9C A;  1VQP T;  2LTO A;  3NTK A;  1WGS A;  2QQ9 A;  2XIC A;  4ZN3 A;  1N27 A;  2BKD N;  4OB2 B;  3QSU A;  3OMG A;  2GCX A;  3FJP A;  2YLC A;  2QQB A;  2RO0 A;  5GAN f;  1K8A U;  1VQ9 A;  3A8H B;  1I81 A;  2DD4 A;  2QQA A;  2RI3 A;  3C94 A;  5LJ3 d;  3CC7 A;  2VYT A;  2ZPI B;  1KHI A;  2H3J A;  4C0G A;  2MAM A;  5KCO A;  2LNV A;  1KC8 C;  3VJP A;  3BFM A;  2RM4 A;  3SB2 A;  4EMK B;  1U1T A;  2DO3 A;  3RKW A;  4Q5W A;  1QVG S;  2E6Z A;  3OQ5 A;  4VUB A;  3FB9 A;  4HA8 A;  1I4K 1;  2OTJ A;  2FL7 A;  5LJ3 j;  4RMO A;  1KQ1 A;  3OYM A;  4MZP A;  1BIB A;  3FRN A;  4C92 B;  3CPF A;  3CCE A;  1M8V A;  3HFO A;  4DOW A;  5L8R E;  2K5I A;  3L1A A;  3J80 E;  2YHT A;  4JLG A;  2RHU A;  2ZPF B;  2RB6 A;  3CBO A;  3HRU A;  3URG A;  4C5E A;  3CCJ T;  1VQM A;  4PJO D;  2RHY A;  4UC4 A;  1VQ7 T;  4OB3 B;  5AYF A;  1N9R A;  2ZPG B;  2CGH A;  5FRO A;  3CCM T;  3S3N A;  2F69 A;  1I8F A;  2GQV A;  2DIQ A;  4XAX B;  1S72 T;  4ATO A;  3H8Z A;  4OGE A;  4TVR A;  1YI2 T;  4C92 C;  1WJR A;  4M75 D;  2GFU A;  5D6X A;  4BY6 B;  2DTO A;  1D3B B;  1VQ8 A;  4XK8 E;  3S6W A;  5GAN d;  3CXC A;  1YJ9 A;  5A2Q E;  4KUI A;  3VKI A;  1UGR B;  3CBP A;  4N0A A;  4A4H A;  3G6E A;  3CPW A;  3OYI A;  3X25 B;  3PIO A;  4JDS A;  3C4S A;  3MET A;  1BI2 A;  4FSX A;  1QVF S;  1H3Z A;  4C8Q G;  1Q82 U;  2V8J A;  1WJS A;  4N0A C;  5GAN 7;  5GAN j;  3JCM b;  4BY6 C;  3OYA A;  4M78 G;  1LOJ A;  3CCU A;  2X4X A;  3OMC A;  2VV5 A;  3TCJ A;  3CC7 T;  4II1 A;  4HT8 A;  5FU7 C;  5DM7 R;  3JCM V;  4M7A B;  4C8Q F;  3DLM A;  4MZM A;  4NL2 A;  3KXT A;  4E7L A;  4LDY A;  2DEQ A;  2E1H A;  2DXU A;  3OS2 A;  2I2L A;  2F5K A;  3PMI A;  4M78 F;  3LWH A;  2E12 A;  5GAN 6;  2HNI A;  2OTJ T;  4R55 A;  3CCL T;  1K9M C;  2FB7 A;  3M59 A;  2ZPB B;  3QBY A;  1VQ4 T;  4XQ3 A;  3WVD B;  4M77 A;  5CVI A;  3DB3 A;  4F7U A;  5CK9 A;  1M4Z A;  3OBW A;  3VYH B;  3E1S A;  4A4E A;  3I55 A;  2DXB A;  5FU6 B;  2DTH A;  3AHU A;  2PVG B;  5C0M A;  2RHI A;  1VQM T;  2RJE A;  4M7A C;  1VQP A;  1KHC A;  2CZ7 B;  1VIE A;  4EPC A;  5CQX A;  2MWP A;  1SSF A;  2RK2 A;  2CZ6 B;  2QEX T;  3KUF A;  3V8L A;  5I21 A;  3PT9 A;  4R56 A;  2ZZD A;  2DXT A;  5KE2 A;  2L5Q A;  3VUB A;  4JRQ A;  5CKB A;  4A4F A;  4KUL A;  4PJO G;  4C0Z A;  1Q81 C;  5FU6 C;  3BDL A;  3L2R A;  4LDX A;  3HSB A;  2EQU A;  4M77 E;  4F7U E;  2IVW A;  2WSF E;  3CCV A;  1G5V A;  2JZ2 A;  1NPP A;  2D9T A;  4XU0 A;  3CD6 A;  4XTZ A;  4PLI A;  2XU8 A;  4OB0 B;  3CXC S;  2E10 A;  3JB9 J;  2QXF A;  2QDY B;  3G6E T;  1XTD A;  5GAO n;  4J6X A;  4OP0 A;  3EAE A;  4A54 A;  4YTL A;  4A53 A;  4PJO F;  4NL3 A;  2VUB A;  2XDD A;  4M7D A;  3SWN B;  2GF7 A;  3CPW S;  3HPW A;  2O4X A;  2CZ0 B;  3P8D A;  4PNO A;  3G71 A;  1Q7Y C;  2VGM A;  3CCJ A;  1JRI A;  3M5A A;  1QP2 A;  4E47 A;  5LL6 S;  2K3X A;  4XTW A;  5HKC A;  1AHJ B;  5GAO p;  4BDZ A;  1M5Q 1;  1JJ2 A;  2A3L A;  1VQN T;  3M9Q A;  2RI2 A;  3V8K A;  5CIU A;  1HXD A;  3P8H A;  1N9S A;  1B34 B;  3NTI A;  5CKE A;  4NOY A;  4MML A;  3WXM B;  3X24 B;  5A0G A;  5GAN 4;  3CCM A;  1OI1 A;  2DKG A;  1IZ6 A;  1JBM A;  4RG8 A;  1RI0 A;  5LJ5 e;  4IUQ A;  4KBM B;  5GAM e;  3PIP A;  2EIF A;  1S72 A;  1KD1 U;  3SWN C;  1UB4 A;  1YI2 A;  1Q86 U;  2RHX A;  4N4I A;  5CKF A;  3TEE A;  3A8L B;  3CMA T;  1B34 A;  4FM4 B;  3VU3 C;  3PTA A;  5CR2 A;  4M7D E;  2FVU A;  3CC4 A;  3LX7 A;  1X01 A;  3QXE B;  4C8Q E;  2EYQ A;  3GLX A;  2LQK A;  2KK4 A;  2LDM A;  4BE2 A;  5GAO r;  3L2V A;  1M90 C;  3RKY A;  2VXE A;  4WF2 A;  2LQ8 A;  2X4Y A;  3RES A;  1VQ6 T;  3QJY A;  3OYH A;  2XDP A;  5I2S A;  4C92 G;  5DLO A;  2A7Y A;  4HCC A;  3CCL A;  2EKO A;  2EFI A;  3ME9 A;  4JS5 A;  3QDR B;  2M1H A;  3GNF B;  5GMK i;  2Y4Y A;  2PUK B;  2JTM A;  1M9S A;  2Y90 A;  4C92 F;  2RI5 A;  3V7C A;  3HRT A;  3JCM W;  1NZ9 A;  4PKC C;  3CCV T;  1K73 C;  3OYN A;  3HKS A;  3CD6 T;  5LJ5 h;  3ASK A;  3E9F A;  4MDX A;  5GAM h;  4GLK A;  4DA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...