4ME7A

Crystal structure of bacillus subtilis toxin mazf in complex with cognate antitoxin maze
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
105
Chain Sequence
b'MIVKRGDVYFADLVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQIRTIDKQRLTDKITHLDDEMMDKVDEALQISLALID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA interferase EndoA
publication title Structural Basis of mRNA Recognition and Cleavage by Toxin MazF and Its Regulation by Antitoxin MazE in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase/hydrolase inhibitor
total genus 23
structure length 105
sequence length 115
chains with identical sequence B, C, D
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4me7A00
4ELZC 5HK0A 5CKDA 5CKEA 4ELYC 4MZPA 4MZTA 4MDXA 4OF1A 4MZMA 5HK3A 5CK9A 3HPWA 5HKCA 3TCJA 2C06A 5CCAA 5CKHA 5CKFA 4HKEA 5CQXA 4VUBA 3NFCA 5CKBA 2MF2A 5CO7A 2KMTA 3JRZA 5DLOA 3JSCA 5CQYA 2VUBA 3G7ZA 3VUBA 1VUBA 4ME7A 1M1FA 1X75C 1NE8A 5CR2A 1UB4A
chains in the Genus database with same CATH superfamily
1YN8A 3V7RA 5GAMe 4GY5A 1HJDA 2YUPA 4FW1A 2DA9A 2WSFE 3V8LA 2D8HA 2E10A 4AT1B 2XDDA 4PK4A 3NMZC 1C0MA 1R77A 1WGSA 1M1KC 2GFAA 1MGQA 1NPRA 1PWTA 2EBPA 2KROA 2BZYA 4BB7A 2LQWA 2VB6A 3JCMX 4P5NA 2RHUA 3G6ET 4MZPA 4R55A 3NTIA 5GAOp 5IHKA 3G71A 1M2OA 1K1ZA 2VYTA 2QASA 2XI9A 1NJIC 4FYVB 1RAAB 1Y07A 1NJIR 4VUBA 4Z88A 4RTTA 3JCMg 1YIJQ 2DBMA 3QUIA 3THKA 3RMQA 2V8IA 2DL3A 1Y96B 4A63B 2K4YA 2LQNA 4EMGA 3CEYA 2CP3A 6AT1B 4E7ZA 2XICA 3M59A 3CCJA 4M75G 3UA6A 2C06A 1VQ8T 1JXMA 1Q95G 4EMHA 4C0ZA 2ZPIB 1TUDA 3NTHA 4LUDA 1ZBJA 3EG9A 3EGXB 1I07A 1SRMA 1ACMB 1NEBA 3ER0A 4ME7A 1PC0A 1HYOA 4J8OA 4M75B 2NUTA 4A54A 1YFNA 2DL5A 5FROA 4E47A 2D9TA 2G3RA 3GF5A 2RB6A 2WSEE 4ANJA 3TVTA 1VQNQ 1UGSB 2M0OA 1M3BA 2DL4A 2LNHB 3TQ7P 1KJWA 1MHNA 1JQQA 4OB1B 4J9EA 4M77A 4C8QB 2V1QA 2K5FA 2EYQA 1D3BA 1YI2A 3BDUA 4E2FB 4M7AA 1M3CA 4IUUA 2DD4A 1Q81C 1UUEA 2P0QA 2QAZA 2R5MA 2K3XA 1MMNA 5GANj 2MI6A 3JB9I 1ZA2B 4OB0B 2D6FA 3HKSA 4J9GA 1M90C 3H6ZA 1TUGB 4OMNA 1AZGB 5LJ5j 1VQMA 2X4JA 1I0CA 1M90R 2ZPHB 4PLIA 2I2LA 4PKCC 1M1FA 1RADB 3AT1B 5LJ5f 4NS5A 3OBWA 3L2ZA 4ZTJA 4F17A 4BI8B 2L8DA 1CKBA 2P4TA 1MV3A 4EDUA 3KBGA 3CCSA 1XTDA 4LDXA 4C8QD 2QEXQ 2RH2A 1QVGS 2RI5A 3RMSA 3VYHB 3M0UA 3QDRB 2H3JA 1VQ6A 3P8HA 1QKXA 5GAOn 5DLQE 2FZCB 4C0FA 4A53A 2DBKA 3L2VA 1VQ4T 2FVUA 3EG3A 2MK5A 1VQ5Q 5LJ3g 1UGRB 3KUFA 3M56A 2EQMA 2YLCA 4C92D 3JCMW 1R8OB 5A0GA 2K3YA 3CC2A 5I21A 3FIFA 4M78C 4C5IA 4KH1B 1UJYA 1VQ9T 2ED0A 2DVJA 4JZ4A 2K6DA 4LUEA 1OOTA 2J6KA 4MZTA 1M2VA 4FYWB 4E6RA 4EMKC 5DY9A 3H8ZA 1J3TA 1FMKA 2VC8A 1NLOC 1UGPB 3X24B 2QA4A 2RI3A 1PRLC 2BE7D 2JTMA 4M7DB 1K0XA 2F2VA 5KYYB 1YCSB 4C92F 1VQPT 4HCCA 5CKEA 3A8HB 4FT4A 4OMMA 4BE1A 2KSSA 1IXDA 4AMCA 1VQ7A 3M0PA 1BI1A 3UF4A 2FB7A 2ZGWA 3U23A 2BUDA 4E7JA 1BIBA 3QJYA 3JCMQ 2ROLA 3GOXA 1MNEA 3CPWP 2VWFA 4OMQA 5FLXE 2O2OA 1SKUB 5CKDA 3X25B 1KQSA 2E70A 2GFUA 3VS6A 1K73C 4RG2A 2CT4A 1LCKA 4M7DD 2KMTA 4PL6A 4E7IA 1X6OA 3MEVA 4IIOA 1D0YA 1RAEB 4HA8A 1YBYA 4KULA 5GAMf 3INZA 1YJNQ 1G3WA 4Q5WA 1X01A 2CZ1B 1TXQA 2DAQA 1D09B 2DVEA 3CMAQ 3H9NA 1UJ0A 1AWJA 4ELYC 4EMKA 2L89A 1NEGA 5HY6A 2CP0A 4N4GA 4FYYB 2K3BA 4CC4B 2DX1A 4PJOE 2E65A 2AZVA 1EIFA 3CCVA 2RQUA 2RJFA 2NUPA 4HCKA 3OYIA 4DBRA 2RI2A 1GFDA 2QEXT 1VA7A 2RQVA 2FRYA 4KUDK 4A4GA 3G4SQ 3QPHA 4C0GA 2F1LA 2FYKA 3O5ZA 2NYSA 2O88A 1JU5C 4ESRA 2OTLT 2RNAA 1M8VA 3EH1A 1VYUA 2QQRA 2F2XA 5D6XA 3NPFA 2EGCA 1PSEA 4UC4A 1S72Q 4JRQA 1VIFA 4QKUA 2M0YA 4JJBA 1FX7A 1OEBA 4BDYA 1Q86C 3I56T 2LZ6B 1X2KA 2GQIA 2M9UA 4QW2A 3OMGA 3X20B 2KRNA 1GBQA 2OTJA 1I5LA 2PVDB 1VQLQ 3M55A 4C0DC 2CUBA 1LVKA 3OYDA 3EG9B 2O31A 1PHTA 3PIOA 3L2QA 1DJ7B 2NUTB 2IPOB 4M77G 3J7AF 2X4XA 1VQ6T 1AOJA 1KIKA 1JJ2P 4M7AG 3QDFA 1S1NA 4N0AC 2E4HA 2DKGA 4IURA 4AFUC 1VIEA 4M75E 2QTXA 4KGZB 1BB9A 1IHVA 1AEYA 3MO8A 5M9OA 3CCUA 1D3BB 3MCAB 4D8KA 2FZKB 4M7AB 4LN2A 2MAMA 4HVWA 4JRKA 4LE9A 2BE9B 3CCQT 2CP7A 2DD5A 4BACA 3JCMh 4F16A 1QVFA 1RAIB 1TTHB 1UHCA 3JB9F 2RHZA 2DTHA 2ZZDA 3L2RA 3CPWS 3CCMT 3GPLA 1I81A 3G7ZA 4JZ3A 2X9HA 1QMCA 2DZCA 2JZ2A 3J81E 2EKOA 4MMKA 4WF2A 1RAHB 2CS7A 3VRZA 1BKBA 2BTTA 1XNIA 3PFSA 4OGCA 4RKUE 4IIMA 5KYUA 3OS0A 4ZN1A 3OW2A 1KG1A 4OMLA 3S3NA 3BY7A 1M3AA 4C92A 5GANe 4GLMA 2DO3A 2YUQA 4XU3A 3JB9J 3AHUA 2X4WA 4OVAA 3CCRT 3NHNA 5KCHA 3CMEQ 1TS9A 1OPLA 2YT6A 2SEMA 1RABB 5CCAA 1PD0A 4F7UF 2KVQG 3RUXA 5FRMA 1YJWT 3JSCA 2YSQA 1SRLA 2CH4W 1K0SA 1NE8A 1IRXA 2WSCE 5HK0A 2K5LA 2DF6A 2HL3A 2ABLA 3C0CA 1M2VB 1Z9QA 3G6EQ 1WLPB 2P84A 1UECA 3WVDB 4LDWA 2RD1A 3MEWA 3CCVT 1VQOT 2DM1A 3V8JA 3M4YA 5GAN6 1WFWA 4OMOA 3G1JA 2DLPA 3PMIA 1BI0A 5A0DA 4DQ2A 2HMAA 1X6BA 1GCPA 2E41A 1OPKA 2JOYA 3M53A 4M7DE 2NUZA 5C6SA 5IXBA 5CKFA 4RTWA 3SEMA 1KD1U 2ZAEA 4II1A 2J6FA 3CBOA 1VQ8Q 4X34A 2HAXA 4CI0C 3FLGA 2EQUA 2CT3A 3RKYA 2RM4A 1WNLA 2QGGA 4JDSA 2RN8A 2RJDA 5FWBA 1JJ2S 1WXTA 1B07A 2FPFA 1NLPC 1ZQ1A 2EW3A 3QSUA 3HPWA 2XDPA 5LJ3h 2RQTA 5GAN2 1OULA 2DYIA 2OTJT 2IG0A 4PLLA 2FO0A 1E6GA 2QTVA 1WA7A 3OYLA 4DBFA 3EAEA 2W0ZA 2KRSA 4EMKB 1HSQA 1TUCA 1M27C 2GCXA 1MV0B 4KT0E 3UPUA 2V26A 2KGTA 2ROTA 3DB4A 2FPDA 2NUPB 4IUVA 3EG1A 1NG2A 4QQ6A 5L8RE 2QXFA 3JCMe 2VASA 5J26A 2LMJA 2DZ9A 2YDLA 2DXBA 1N8RU 5A2QE 5IN1A 2HQXA 2R5AA 2QGFB 3OYNA 3TREA 2I0NA 1E7OA 2KXDA 1YIJA 5FU7C 1KK7A 1KSWA 2EIFA 1QWEA 3HRUA 4J9DA 1H92A 1TOVA 2LCSA 1PKTA 2CGHA 1WQWA 4FIBA 4M78D 2Y4YA 2D0QB 3PVQA 4Y92A 2KR3A 2O9VA 3JCMJ 4PJMA 2HSPA 5HCKA 1WHJA 3RKWA 4BE2A 1YITT 2A28A 2C0IA 4IUTA 1TH7A 2E1HA 4E7KA 3I55T 4OMFB 3RERA 1ZUYA 5GJWB 3SWNC 3OSVA 1B3QA 2ESWA 3HFNA 4J9BA 2W10A 4PFPA 2PZ1A 3JRZA 1VQ4Q 3T9NA 1JEGA 1IGUA 1VOMA 4M78F 1VYTA 4AFZC 1VQNA 2OAUA 4A4KA 4IUPA 2D0NA 1VQ9Q 5IAYA 1ZHIA 2BZ8A 3CC4T 4V2SA 3PNWC 4L5GA 1WI7A 4DBQA 1NM7A 3JCMd 3M57A 2DTOA 2D8JA 1Y7XA 2HDAA 4IKFA 4WCIA 3MJXA 1RI0A 2LX9A 1HXDA 3E1SA 1VQPQ 4C8QG 2LDMA 2JN0A 1NPPA 2Y4XA 4M77E 1KQSP 5KYNA 5D6YA 1AT1B 1CSKA 4F7UA 4M7AE 2MOXA 4M4ZA 3VS0A 1GCQC 1K4US 4JRIA 2KYBA 3TU4K 4LXCA 2B86A 4OB2B 1Q82R 4C5HA 1K8AU 3MP1A 1WPYA 1RAGB 3A5ZB 2HZYA 2CSIA 2EAYA 2VV5A 1ZX6A 3Q1JA 5EG2A 4ZN3A 2EJGA 2DXTA 3H0HA 4PJNA 3SWNA 4RUGA 4C92G 2HKQB 4FL6A 4C0DB 2M02A 2LC4A 1YJ9T 5GANf 3LX7A 5KYUB 5LJ3e 2GNCA 1U8RA 2DYBA 3EFRA 4C92B 2QYZA 2HSEB 1P92A 1VQ5A 5J39A 1YHQA 1D0ZA 2RPNA 5J3BA 2G6FX 2KI7A 3SDZA 3UT1A 3NFCA 3JV3A 4QT7A 4D6WA 1BI3A 1M1GA 2R57A 2JTFA 3M4GA 4LDVA 1TWBA 4CC3A 1NYGA 1VUBA 2KT1A 2OI3A 5CR2A 1Q7YU 1RACB 2DILA 3C4SA 2OTLQ 4D8DA 2LP5A 3CD6T 1X69A 2DERA 1GCQA 4BUGA 4Z8AA 1H3HA 1FWZA 1FMWA 4RTZA 5CQYA 1ZSZC 4J7FA 4K11A 3VS1A 3ZEHA 2F2WA 3I56Q 2HKNA 2QQSA 5IHNA 4KGVB 4M7DG 3QWYA 4KGXB 4BE0A 3L42A 5CIUA 2EKHA 3CCLA 1MMGA 3CC7A 2MYSA 4QQGA 3WVEB 5LJ3d 3M5AA 2IVWA 2COWA 2H3EB 2ENMA 2XDBA 3VUBA 4FW2A 2ZPFB 3LYIA 5KE2A 1SSHA 1X43A 3M9QA 3UA7A 1MMAA 5L23A 2QDLA 1G3YA 2LJ0A 2JS2A 3G71T 4HVUA 1VQ6Q 3M0RA 1QVFP 1OX8A 1QW1A 3FJPA 3FJ5A 3DLMA 2FZGB 3LGFA 1D1BA 3TSZA 4PJOC 1UG1A 3BE3A 3HFOA 3NGPA 3RIRA 2QQ9A 1XJWB 1JB0E 3M0SA 1KQSS 2CREA 2E12A 3REBB 3G4SA 1C1AA 3JCMf 3CCQQ 3CCJT 2K2MA 1TG0A 1OU8A 1WHGA 4M78A 4ZGJB 4CRIA 1ZBXA 1GL5A 3EHQA 3CCMQ 4JS5A 3QYGB 1G8XA 1G5VA 2KAFA 4DEXA 4RTVA 1NZ9A 3SB2A 1S72A 2LT4A 1OZ3A 1UDLA 3ZBDA 2LVMA 1VQKA 3FB9A 4JS4A 2M16A 4AG2C 1BK2A 3VS4A 2QQAA 3FC3A 2E6NA 4PFZA 1VQ7Q 1RL2A 3A98A 3LWHA 1MMDA 3JB9G 4IUQA 1UE9A 1ABOA 1YI2T 1LJOA 5IXFA 1KD1R 3SFMA 2NLUA 1Q82U 5D7UA 3CCRQ 2EYZA 2EQKA 4RTXA 1YWOA 3E9GA 3TSWA 1XOVA 2MCNA 2BKDN 1VQMT 2ZPBB 1UHFA 1YJWQ 3LH5A 2JM8A 3I9QA 2DNUA 2VVKA 4M75C 3D7SB 3PMTA 3ASKA 2JJ9A 3MP6A 5GAN8 1SPKA 5FU6C 3MEUA 3TCJA 2HCKA 3FRNA 1SEMA 4NL3A 4DOVA 3CCST 2VUBA 2ATCB 2CP6A 2YWWA 3CCVQ 1W1FA 2M1HA 1VQOQ 1RLQC 1QLYA 2EGEA 2HQEA 2F5TX 5CAIA 1WHMA 2PNIA 2M51A 5DM7R 4Y28E 1N8RC 2C0TA 3JB9D 2KYMA 4F7UB 1N8RR 3E19A 1WXBA 1KFZA 1O9SA 1D1CA 3M0QA 2QK0A 5LJ3j 5IHIA 1BCMA 4HT9A 4X1VA 1OQKA 3H0FA 3CC2T 4HCZA 4XK8E 2OX7A 4HVVA 1K9MU 2YRDA 1QQJA 1QVFS 4C8QE 1W6XA 5LJ3f 1X6GA 3SWNB 3S6WA 4CC7A 1W2BA 2J7IA 3CC7T 4FU6A 4DA4A 4O5VA 3JB9H 2OTJQ 2QA4T 1F1BB 2HBWA 3JCMV 3NTKA 3EGDA 2LJ1A 3CCEA 2KNBB 1BYMA 3MKDA 2MPXC 1YP5A 5I11A 3OYHA 4OF1A 1GFCA 2RK1A 5KH6A 1D0XA 2L0AA 2LT1A 3C94A 4GBQA 2LCLA 1ZUUA 4C92E 3CXCA 1VQ7T 4HXJA 1RLPC 4KRTA 2DMOA 3OYGA 3CPWA 1YCYA 4JJNK 2R58A 2AK5A 1UFFA 3G6EA 2DXUA 3GNFB 2RQRA 2GQVA 1RAFB 4EPCA 3VS3A 4ZNXA 4FCYA 2AZSA 1V1CA 4N0AA 2CP2A 3GLXA 4AFQC 2EPDA 1WHLA 3SD4A 4LNPA 4RMOA 3QHSA 1WJQA 4J6WA 1JO8A 4FM4B 3M58A 4M7DC 3GP8A 4X9DA 1UGVA 4CC2A 2EYXA 3OQ5A 4QVCA 3PTAA 2LX7A 3PVLA 1YITQ 1VQ8A 4ZGEB 1K8AC 2JUFA 1WX6A 5HKCA 3ULRB 2ECZA 3I55Q 1JRIA 2KQWA 4DOWA 1K8AR 2CH4A 1VQKT 4ZGDB 2YRCA 1GXIE 1PNJA 4M77F 1I8FA 2ZCFB 4M7AF 1M4ZA 3KXTA 2DEQA 1K73U 3LLRA 3ZL7C 2HBPA 2E3IA 1BCOA 2KRMA 3EGUA 3JAME 4KBMB 2JMAA 3HHTB 1WDXA 3CC4Q 1OI1A 5CKHA 3X26B 2CUDA 1D1AA 4OGEA 5GAOl 3P8DA 2MIOA 2MWOA 2RF0A 1N6AA 2JT4A 1UGQB 4XAXB 4MDXA 3BDLA 2KT8A 1QWFA 3DLLA 5GAOr 5LJ5g 2XHCA 5KYXA 4M78G 2DEUA 4XU1A 2CKKA 8ATCB 3HRSA 1Q7YC 2XG8D 3R6OA 2EWNA 2LCCA 1Q7YR 2BIVA 3LGLA 3OYKA 4RG8A 2DTIA 4C5EA 1OX9A 2EQJA 2LRQA 1KHCA 4M78B 1SF9A 4L6V5 3EFOA 2JS0A 3LW5E 2QQBA 1OYXA 4J5YA 3FDRA 1JJ2A 2LTOA 2X35A 4A4FA 1LOJA 1Q86U 1QVPA 4J9HA 1WQ7A 4BD3A 5CKBA 1U1SA 4XTYA 5AT1B 5DLOA 3S3MA 1YJ9Q 1X75C 2AIRB 3URGA 3META 1CKAA 3CCUT 4QVDA 3MPUB 1VQ4A 2K9GA 1MNDA 4Y91A 2PUKB 2HEQA 2EYWA 1B34A 2SRCA 2RHXA 1Y71A 2RJCA 2RA2A 2YHTA 3S3OA 4XTWA 1AD5A 2JVVA 4BY6C 1VQ9A 1ZSGA 1UEBA 1KHIA 2DJZA 2JXBA 2P0PA 3CCET 2RJEA 5GMKh 1KC8U 2DL7A 3JCMP 3CD6Q 3C12A 3JCMc 1VQPA 2KY9A 4OMPA 1M1KR 4M77C 2KEAA 2XK0A 4M7AC 2VKNA 2Y90A 4XTXA 2ED1A 1WXUA 2K5IA 1G3SA 2EYYA 4LD6A 1YNZA 2BZXA 2CZ6B 4PJOD 4J83A 2HL5C 1IREB 1GBRA 3EG2A 2A36A 2L3SA 1AWWA 5GAN7 5GAMg 1EFNA 4F7UE 4XQ3A 3DB3A 3QZ9B 4LDUA 5IT9E 3OSSC 4L59A 3CPFA 2QI2A 3OYEA 2GTJA 2DK3A 1PM3A 3QKJA 3G71Q 3JCMb 1TU0B 1Q82C 4PJOF 2F69A 3BFMA 4JRPA 2A37A 5GAMd 2O9SA 4FT2A 3EGDB 3CQTA 1NBEB 1ABQA 2JW4A 5FU6B 1SSFA 3E9FA 1IHWA 1A0NB 2QEXA 1EX4A 4O6JA 5A0LA 1WIEA 5KCOA 4HKEA 2X4YA 2DETA 1WJRA 4R56A 2QDYB 4XTZA 3CCJQ 1EZZB 1HD3A 4JLIA 2P4RA 2OTLA 1I5OB 1M8MA 3CBPA 1Q81R 4MZMA 5GAOm 2PVGB 3V7CA 3I5SA 2K7AA 4N4IA 1R0BG 2A7YA 1QCNA 3I56A 3HL8A 4PJLA 4MMLA 5FW9A 4M75D 2DPPB 2XIDA 5CVIA 1H641 1I1JA 1NYFA 1PCXA 5I22A 5IH2A 2NWMA 3CBMA 2CZ0B 1YI2Q 3OYCA 1IO6A 3EFSA 3RKXA 5LL6S 1IZ6A 2L3RA 1SG5A 1K9MC 2O4XA 1FMVA 3OBYA 4JJCA 1T0JA 2GF7A 5GMKm 1K9MR 1M5Q1 2DRMA 1PG5B 3OYYA 2KE9A 3KFVA 4M75F 4BI3A 1VQMQ 1QVGA 3A8LB 4FSSA 3ZFJA 2P0KA 3M0TA 1JXOA 4J9CA 3PGGA 5HK3A 1RUWA 2F5KA 3VKIA 1PD1A 4F14A 5CQXA 1YIJT 2J06A 1YHQQ 3GBQA 4PNOA 3MP8A 2CZ7B 4C8QF 3QO3A 3EHRA 4GLKA 5GMKe 1N27A 4WTOB 3CCSQ 2YXYA 1HK9A 2RHYA 2K2VA 2JM9A 3OS1A 3CCQA 4B6MA 1OZ2A 4TVRA 4B9WA 5KYXB 1TSFA 1YJNA 1W70A 2XU8A 3CCMA 1W2BP 4YTLA 3CMAA 1T0HA 2KBTA 2J6OA 2LJ3A 2WACA 3BW1A 2YLBA 4MDWA 1UB4A 1ZLMA 1V76A 3EFOB 4XTVA 3VYGA 5KYWA 1M1KU 1VQNT 4A4HA 2V8JA 2EFIA 5EC7A 3QZ5B 3RESA 3RBBB 5CK9A 3CC2Q 5C0MA 2FEIA 4M78E 5I2SA 2PU9B 3HP9A 2PQWA 4BI4A 3CXCP 1FXXA 1ZSZA 3PE0A 3CCLQ 1NJIU 3CC7Q 3M54A 3CCRA 3OW2P 2O01E 1BU1A 2QA4Q 1H8KA 3MHXA 3QYHB 4RCCA 5GAN5 3A8GB 3V7SA 5GAMj 1X2QA 4DBHA 3UWNA 3OYMA 3DKMA 2XMFA 3L2UA 3X28B 1YJWA 2E5QA 1B7TA 1B34B 2EJFA 1SHGA 3RNJA 5GANh 2X51A 3OYAA 3SHWA 1K73R 3OS2A 4HCBA 4RTUA 1WHKA 3I5RA 4BDZA 5LJ5h 1KD1C 1G83A 1VQLA 2OAWA 1N9RA 2EGAA 3QBYA 4EIKA 3QWXX 5KE3A 2DIQA 2X3XD 3VRYA 1K9AA 2KXCA 1VQOA 1G3TA 4RCBA 3VS2A 4OB3B 2DIGA 2PVOB 4M7DF 2X3WD 4PJOA 2IIMA 1V29B 3P8BB 4Z02A 4R0KA 3MEAA 3HRTA 3REAB 2CYZB 3OYFA 1AWXA 3QIIA 5AYFA 1N9SA 4Z89A 2YUNA 2MMPA 1VQ5T 1YHQT 3LH0A 4XTUA 4NL2A 2DFUA 1UTIA 4J6XA 1U1TA 2GTOA 3OY9A 1Q81U 3F70A 1AWOA 5CO7A 2C0OA 4LDYA 1VQKQ 5GAN4 1U06A 4C8QC 3A8MB 3PIPA 1M90U 2EQIA 4F7UG 1Q86R 1X27A 4QVZA 3VJPA 1ZA1B 2HD0A 2E5KA 3UDCA 2K79A 1T3LA 1I4K1 1AVZC 1M30A 5FU7B 1KQ2A 2JNGA 1Z9ZA 4B9XA 2PTKA 3WXMB 1FYNA 1C6VX 2RMOA 2VGNA 4BY6B 3OS5A 4NOYA 5GAOq 3TEEA 2J05A 3OMCA 3H0IA 4E7LA 1Y96A 3EG0A 4C92C 1R0CB 3ME9A 1QP3A 1G2BA 3QXEB 2HNIA 2B8AA 2LNVA 1VYVA 1W2BS 3LWIA 1H3ZA 2CSQA 4FSXA 3V8KA 3R6NA 4XU2A 3OB9A 3EGXA 2DRKA 2KDSA 4JUVA 3CCLT 2A08A 4M77B 3CMEA 1KC8C 4RTYA 3E2UA 4PFOA 4OP0A 4M75A 1K76A 1KC8R 4J9IA 1LPLA 2ZPGB 4DEYA 4PJJA 4ZTFA 1PRMC 2CP5A 2DE0X 2Z0WA 3H41A 1IB8A 3I35A 2FRWA 2PUOB 2RK2A 1PSFA 1Y0MA 3CXCS 2DXCA 3L1AA 3UATA 2YRVA 1YJNT 4C8QA 3C95A 5GAMh 3OW2S 2DJQA 1YITA 7AT1B 3CMAT 2EJ9A 3I55A 4ELZC 5GMKi 2LQKA 1MUZA 3CCUQ 2VXEA 2AKKA 3N5BB 4M77D 3G4ST 2FPEA 3O8VA 4M7AD 1JBMA 2O4XB 2AT1B 8AT1B 2LQ8A 4LD9K 3VS5A 3J80E 3QJ6A 5GMKj 4JJDA 3CC4A 1ARKA 4HT8A 2VXFA 4KH0B 1QCFA 4E7HA 3HSBA 5LJ5e 3CCEQ 1S72T 2V8KA 1WHHA 3PT9A 4KUIA 4XU0A 2MF2A 3GNGA 2DL8A 1IGQA 3QG1A 1AZEA 1BI2A 4JPBW 4N4HA 5ECAA 2RO0A 2D1XA 4FYXB 4AFSC 2AKLA 1VQLT 1SHFA 3L2WA 5D6WA 3RR6A 2COZA 2K57A 2AHJB 1Y57A 2ZPEB 4J9FA 2GBQA 3OYBA 1WYXA 2CDTA 1OU9A 2A3LA 5GANg 3EH2A 4X9CA 4QQDA 2JMCA 2COYA 2L5QA 1M9SA 2E3HA 3VS7A 2HQHA 2JTEA 2EVRA 2XKOC 5KYWB 2E64A 1T3SA 2MWPA 2VGMA 1YJ9A 2A0FB 2YUOA 5GJVB 5FWCA 1PKSA 2GGRA 2H8HA 1WJSA 9ATCB 1KQ1A 2FL7A 3A1PA 1QCOA 4JLGA 4M7DA 2FHDA 1ZSZB 5GANd 2E6ZA 5KYYA 2FG0A 1QKWA 5I2MA 1AHJB 5GAN3 2RQWA 5FRNA 1O75A 1RI9A 5LJ5d 2L3QA 1ZUKA 3A8OB 1U5SA 3VV0A 3OYJA 5GMKl 4ATOA 4C5GA 3IQLA 4A4EA 1E6HA 1BBZA 1LNXA 4J6YA 1U3OA 2OJ2A 1GRIA 1WZOA 4F04B 3VU3C 2L2PA 3FEOA 2XD0A 3CD6A 4PJOG 1QP2A 1YWPA 3VUZA 2RHIA 3HTRA 4AG1C 1XQHA 3RDVA 2KK4A 2QG9B 1N5ZA 3GIBA 2V1RA 2L3PA 4PJOB 4ORZA 4E7SA 1W4SA 1BIAA 4J7IA 3OA6A 3CMET 1QVGP 1OV3A
chains in the Genus database with same CATH topology
4XU3A 4IUQA 3JB9J 3AHUA 2X4WA 4OVAA 3V7RA 5GAMe 3CCRT 1YI2T 1LJOA 5KCHA 4GY5A 3CBMA 3SFMA 2NLUA 1Q82U 2WSFE 3V8LA 2CZ0B 3OYCA 2E10A 3EFSA 5CCAA 2EQKA 4F7UF 2XDDA 3RKXA 5LL6S 2KVQG 3RUXA 1IZ6A 3E9GA 2L3RA 4E7IA 1WGSA 1M1KC 5FRMA 2GFAA 1K9MC 1YJWT 1XOVA 1MGQA 1NPRA 2BKDN 2O4XA 3JSCA 3OBYA 1VQMT 2GF7A 2ZPBB 5GMKm 4BB7A 1M5Q1 4M75F 1QVGA 3OYYA 4BI3A 1NE8A 3A8LB 3JCMX 4M75C 4P5NA 3PMTA 2WSCE 5HK0A 2K5LA 3ASKA 3MP6A 3ZFJA 2RHUA 2P0KA 4MZPA 4R55A 3G6ET 3NTIA 5GAOp 3G71A 5GAN8 3PGGA 2VYTA 5HK3A 2XI9A 1NJIC 5FU6C 2F5KA 3VKIA 3MEUA 3TCJA 1Y07A 3WVDB 5CQXA 1YIJT 3FRNA 4LDWA 4VUBA 2RD1A 4NL3A 3MEWA 3CCVT 4PNOA 3MP8A 2CZ7B 3JCMg 4C8QF 4DOVA 3CCST 1VQOT 3QO3A 4GLKA 5GMKe 3QUIA 2VUBA 3V8JA 3M4YA 1N27A 3RMQA 2M1HA 2V8IA 1HK9A 5GAN6 2RHYA 1Y96B 2K2VA 3OS1A 3CCQA 2K4YA 2HQEA 3PMIA 2F5TX 1BI0A 1OZ2A 5CAIA 4EMGA 3CEYA 5A0DA 4DQ2A 4TVRA 2E41A 5DM7R 2XICA 4B9WA 2JOYA 3M53A 3M59A 3CCJA 4M7DE 4M75G 4Y28E 5C6SA 1N8RC 2C06A 1VQ8T 1YJNA 4EMHA 5CKFA 2XU8A 3JB9D 4C0ZA 3CCMA 1KD1U 4F7UB 4II1A 2ZPIB 3CBOA 3NTHA 4YTLA 4X34A 3CMAA 3E19A 1O9SA 2HAXA 4CI0C 2WACA 3BW1A 3FLGA 2EQUA 2YLBA 3ER0A 2RM4A 4ME7A 3RKYA 1WNLA 5LJ3j 4J8OA 4MDWA 4JDSA 1UB4A 4M75B 4A54A 4HT9A 4E47A 5FROA 2D9TA 2RJDA 3CC2T 4HCZA 2G3RA 4XTVA 1JJ2S 3VYGA 4XK8E 3GF5A 1M1KU 1VQNT 4A4HA 2V8JA 1K9MU 2EFIA 1ZQ1A 2RB6A 2WSEE 3QZ5B 3RESA 3HPWA 4C8QE 2XDPA 5LJ3h 5CK9A 5LJ3f 3QSUA 1UGSB 2M0OA 3SWNB 5C0MA 4M78E 5I2SA 3S6WA 2PU9B 3HP9A 5GAN2 1W2BA 2OTJT 2PQWA 2IG0A 3CC7T 4FU6A 4BI4A 1FXXA 4DA4A 4O5VA 1MHNA 3JB9H 4PLLA 4OB1B 4M77A 4C8QB 2QA4T 2K5FA 2EYQA 3JCMV 1NJIU 1D3BA 3M54A 3NTKA 3BDUA 3CCRA 1YI2A 4M7AA 2O01E 3CCEA 4IUUA 2DD4A 3MHXA 1BYMA 3QYHB 1Q81C 3OYLA 4RCCA 2P0QA 3EAEA 2R5MA 2K3XA 5GAN5 5GANj 3OYHA 2MI6A 3A8GB 4OF1A 3V7SA 2RK1A 4EMKB 5GAMj 4OB0B 3JB9I 5KH6A 2D6FA 2LT1A 3C94A 2GCXA 3HKSA 2LCLA 3UWNA 3OYMA 3DKMA 1M90C 3H6ZA 4KT0E 3L2UA 3UPUA 3X28B 1YJWA 2E5QA 1B34B 2EJFA 5LJ5j 3DB4A 1VQMA 4C92E 5GANh 2X4JA 3CXCA 2ZPHB 1VQ7T 4IUVA 4QQ6A 4PLIA 2I2LA 5L8RE 3OYAA 2QXFA 3OS2A 3OYGA 4HCBA 3CPWA 3JCMe 5J26A 1YCYA 4JJNK 2R58A 2DZ9A 4PKCC 3G6EA 2DXBA 1M1FA 2DXUA 4BDZA 3GNFB 5LJ5h 5A2QE 5LJ5f 5IN1A 1N8RU 4NS5A 2HQXA 2R5AA 1KD1C 1VQLA 2GQVA 1N9RA 3L2ZA 3OBWA 3QBYA 4ZTJA 4EPCA 5KE3A 3OYNA 3TREA 4BI8B 2DIQA 2L8DA 1YIJA 5FU7C 2P4TA 4EDUA 4N0AA 3KBGA 3GLXA 3CCSA 2EIFA 1XTDA 1VQOA 3HRUA 1G3TA 4RCBA 4LDXA 3SD4A 4C8QD 2CGHA 1WQWA 4FIBA 4OB3B 4RMOA 2DIGA 1WJQA 2PVOB 2Y4YA 2D0QB 3QHSA 4J6WA 4M78D 4M7DF 4PJOA 2RH2A 1V29B 4FM4B 3M58A 3P8BB 4Z02A 2RI5A 3RMSA 1QVGS 3GP8A 4M7DC 3JCMJ 3VYHB 3QDRB 4X9DA 3MEAA 4BE2A 3RKWA 3HRTA 1YITT 2H3JA 1VQ6A 2CYZB 4QVCA 3OQ5A 4IUTA 1TH7A 3OYFA 3PTAA 2E1HA 3P8HA 3QIIA 4E7KA 3I55T 4OMFB 4ZGEB 1VQ8A 5AYFA 1N9SA 5GAOn 1K8AC 5DLQE 2JUFA 4C0FA 5HKCA 4A53A 3RERA 2MMPA 1VQ5T 1JRIA 2KQWA 4DOWA 1YHQT 3SWNC 3L2VA 3LH0A 3OSVA 4XTUA 1VQ4T 4J6XA 2FVUA 4NL2A 4ZGDB 1U1TA 3OY9A 1VQKT 3HFNA 1Q81U 3F70A 1UGRB 3KUFA 5LJ3g 1GXIE 5CO7A 3M56A 2EQMA 3JRZA 4M77F 4LDYA 3T9NA 1I8FA 5GAN4 2YLCA 2ZCFB 4C8QC 3A8MB 4C92D 4M78F 3PIPA 3JCMW 1R8OB 4M7AF 1M4ZA 5A0GA 2K3YA 3CC2A 5I21A 3FIFA 4M78C 3KXTA 1M90U 4F7UG 4QVZA 4C5IA 1VQNA 2DEQA 1VQ9T 1K73U 3VJPA 3LLRA 2OAUA 2HBPA 2HD0A 4A4KA 4MZTA 4IUPA 3UDCA 5IAYA 1ZHIA 3CC4T 4EMKC 5DY9A 1I4K1 3H8ZA 4V2SA 3JAME 5FU7B 4KBMB 1KQ2A 3PNWC 2JNGA 2VC8A 3HHTB 4L5GA 1OI1A 5CKHA 3X26B 4M7AD 1UGPB 3X24B 4B9XA 2QA4A 2RI3A 3JCMd 3M57A 3WXMB 4OGEA 2DTOA 5GAOl 1Y7XA 2VGNA 4BY6B 3P8DA 2MWOA 3OS5A 2JTMA 4NOYA 3TEEA 1N6AA 5GAOq 4M7DB 3OMCA 4E7LA 1Y96A 1UGQB 4IKFA 4C92F 1VQPT 4XAXB 4MDXA 4HCCA 1RI0A 4C92C 3BDLA 2LX9A 1HXDA 5CKEA 3DLLA 3E1SA 3ME9A 3A8HB 5GAOr 1QP3A 2LDMA 4C8QG 2JN0A 4FT4A 5LJ5g 2XHCA 1NPPA 3QXEB 2HNIA 2B8AA 4M78G 4BE1A 2Y4XA 4M77E 2KSSA 4XU1A 1VQ7A 2LNVA 5D6YA 1W2BS 2CKKA 3LWIA 3HRSA 4F7UA 1Q7YC 1H3ZA 2XG8D 4FSXA 3V8KA 4M7AE 1BI1A 3R6OA 2EWNA 4XU2A 3OB9A 2LCCA 4JRIA 2BIVA 2KDSA 3LGLA 4JUVA 3OYKA 3CCLT 3TU4K 4RG8A 2DTIA 2FB7A 2ZGWA 2BUDA 4M77B 4C5EA 4OB2B 4E7JA 1BIBA 3QJYA 4C5HA 3JCMQ 3GOXA 3CMEA 3MP1A 1KC8C 1WPYA 2EQJA 2LRQA 4OP0A 1K8AU 1KHCA 4M78B 4M75A 3A5ZB 4L6V5 2EAYA 3LW5E 5FLXE 2VV5A 2QQBA 2ZPGB 5CKDA 3Q1JA 1OYXA 5EG2A 4ZN3A 4J5YA 2EJGA 4ZTFA 2DXTA 3FDRA 1JJ2A 2LTOA 3X25B 2X35A 1KQSA 4A4FA 2E70A 1LOJA 2GFUA 1Q86U 3SWNA 1QVPA 4C92G 2PUOB 2RK2A 1PSFA 3CXCS 2DXCA 1WQ7A 3L1AA 4FL6A 4RG2A 2YRVA 4C0DB 1K73C 2LC4A 4BD3A 5CKBA 1U1SA 1YJ9T 5GANf 1YJNT 4M7DD 4XTYA 4C8QA 2KMTA 4PL6A 3LX7A 1X6OA 3MEVA 3C95A 5LJ3e 4HA8A 5GAMf 1YBYA 4KULA 5DLOA 5GAMh 3OW2S 3S3MA 1YITA 3INZA 1U8RA 1G3WA 4Q5WA 3CMAT 1X01A 2CZ1B 2EJ9A 1X75C 2DAQA 2DVEA 3I55A 3EFRA 4ELZC 4C92B 3URGA 3META 4ELYC 4EMKA 1P92A 3CCUT 2L89A 4QVDA 5GMKi 5J39A 1VQ5A 2LQKA 1YHQA 5HY6A 4N4GA 1VQ4A 4Y91A 4PJOE 2PUKB 2E65A 1EIFA 1B34A 3CCVA 5J3BA 2RJFA 2VXEA 2RHXA 3OYIA 3SDZA 3UT1A 2RI2A 3NFCA 3N5BB 1Y71A 2RJCA 2RA2A 4M77D 4D6WA 3G4ST 2QEXT 1BI3A 1M1GA 2R57A 2YHTA 3S3OA 3O8VA 4XTWA 1JBMA 2JTFA 2JVVA 3M4GA 4LDVA 2O4XB 4A4GA 4BY6C 1VQ9A 4KUDK 3QPHA 2LQ8A 4LD9K 1VUBA 3J80E 3QJ6A 1UEBA 4C0GA 5GMKj 1KHIA 2DJZA 2FYKA 5CR2A 1Q7YU 3CC4A 2P0PA 3CCET 2OTLT 4HT8A 2VXFA 3C4SA 1M8VA 2RJEA 4E7HA 3HSBA 5LJ5e 5GMKh 1KC8U 3CD6T 1S72T 2V8KA 2QQRA 5D6XA 3JCMP 4BUGA 3PT9A 1PSEA 1QVFS 4UC4A 3C12A 4KUIA 4XU0A 1FWZA 1VIFA 4JRQA 2MF2A 3GNGA 3JCMc 3QG1A 5CQYA 3CMET 1VQPA 1FX7A 2KY9A 4J7FA 3ZEHA 4BDYA 1Q86C 4M77C 3I56T 2XK0A 4M7AC 1BI2A 2Y90A 2M9UA 4N4HA 2RO0A 4QW2A 4XTXA 3OMGA 2QQSA 1VQLT 3X20B 2K5IA 4M7DG 4BE0A 3L2WA 5D6WA 2K57A 1G3SA 2OTJA 4LD6A 2PVDB 1I5LA 2AHJB 3L42A 2ZPEB 5CIUA 2CZ6B 3CCLA 3CC7A 4QQGA 3M55A 3WVEB 3OYBA 5LJ3d 4PJOD 3M5AA 4J83A 4C0DC 2IVWA 1IREB 2A3LA 3OYDA 2XDBA 3VUBA 5GANg 2ZPFB 3PIOA 4X9CA 5GAN7 3L2QA 4QQDA 5GAMg 3LYIA 2L5QA 4F7UE 1M9SA 5KE2A 4XQ3A 3DB3A 3QZ9B 1DJ7B 4LDUA 3M9QA 4M77G 3J7AF 5IT9E 2X4XA 1VQ6T 3OSSC 2XKOC 1G3YA 2E64A 2MWPA 4M7AG 4L59A 2VGMA 1YJ9A 3G71T 3CPFA 4N0AC 2QI2A 3OYEA 2DKGA 4IURA 1VIEA 4M75E 2DK3A 2QTXA 1QW1A 3QKJA 3FJPA 3JCMb 1WJSA 3DLMA 1Q82C 3LGFA 1KQ1A 2FL7A 4JLGA 4PJOF 4M7DA 2FHDA 2F69A 2E6ZA 3BFMA 5GANd 4JRPA 4PJOC 3MO8A 3HFOA 5I2MA 5GAMd 5M9OA 3RIRA 3CCUA 1D3BB 2QQ9A 3MCAB 1AHJB 4M7AB 4FT2A 1JB0E 5GAN3 5FRNA 2MAMA 1O75A 1KQSS 5LJ5d 2E12A 3A8OB 4JRKA 5FU6B 1SSFA 3E9FA 3CCQT 3VV0A 3OYJA 5GMKl 2QEXA 2DD5A 3G4SA 4BACA 4O6JA 3JCMh 5A0LA 3JCMf 1QVFA 4C5GA 4ATOA 5KCOA 4HKEA 2X4YA 1WJRA 4A4EA 3CCJT 3JB9F 4R56A 2QDYB 2RHZA 4XTZA 2DTHA 2ZZDA 3L2RA 3CPWS 3CCMT 3GPLA 1LNXA 1I81A 3G7ZA 4J6YA 4M78A 4ZGJB 4JLIA 4CRIA 1ZBXA 2OTLA 4JS5A 3QYGB 1G5VA 2KAFA 2JZ2A 2DZCA 3VU3C 3J81E 2EKOA 1NZ9A 3CBPA 3FEOA 4MMKA 4WF2A 3SB2A 4PJOG 2LT4A 4MZMA 1OZ3A 1S72A 5GAOm 3CD6A 1QP2A 2CS7A 3ZBDA 2PVGB 3VUZA 2LVMA 3V7CA 2RHIA 1VQKA 3FB9A 1BKBA 1XQHA 1XNIA 2M16A 3PFSA 4JS4A 2KK4A 4N4IA 4OGCA 2QQAA 3FC3A 2XD0A 3GIBA 2A7YA 3I56A 2E6NA 4RKUE 3OS0A 4ZN1A 3HL8A 4MMLA 1RL2A 4M75D 3OW2A 2DPPB 2XIDA 5CVIA 3LWHA 1H641 3BY7A 3S3NA 4PJOB 1KG1A 1W4SA 1BIAA 4J7IA 3OA6A 4C92A 5GANe 2DO3A 3JB9G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ELZ C;  5HK0 A;  5CKD A;  5CKE A;  4ELY C;  4MZP A;  4MZT A;  4MDX A;  4OF1 A;  4MZM A;  5HK3 A;  5CK9 A;  3HPW A;  5HKC A;  3TCJ A;  2C06 A;  5CCA A;  5CKH A;  5CKF A;  4HKE A;  5CQX A;  4VUB A;  3NFC A;  5CKB A;  2MF2 A;  5CO7 A;  2KMT A;  3JRZ A;  5DLO A;  3JSC A;  5CQY A;  2VUB A;  3G7Z A;  3VUB A;  1VUB A;  4ME7 A;  1M1F A;  1X75 C;  1NE8 A;  5CR2 A;  1UB4 A; 
#chains in the Genus database with same CATH topology
 1YN8 A;  3V7R A;  5GAM e;  4GY5 A;  1HJD A;  2YUP A;  4FW1 A;  2DA9 A;  2WSF E;  3V8L A;  2D8H A;  2E10 A;  4AT1 B;  2XDD A;  4PK4 A;  3NMZ C;  1C0M A;  1R77 A;  1WGS A;  1M1K C;  2GFA A;  1MGQ A;  1NPR A;  1PWT A;  2EBP A;  2KRO A;  2BZY A;  4BB7 A;  2LQW A;  2VB6 A;  3JCM X;  4P5N A;  2RHU A;  3G6E T;  4MZP A;  4R55 A;  3NTI A;  5GAO p;  5IHK A;  3G71 A;  1M2O A;  1K1Z A;  2VYT A;  2QAS A;  2XI9 A;  1NJI C;  4FYV B;  1RAA B;  1Y07 A;  1NJI R;  4VUB A;  4Z88 A;  4RTT A;  3JCM g;  1YIJ Q;  2DBM A;  3QUI A;  3THK A;  3RMQ A;  2V8I A;  2DL3 A;  1Y96 B;  4A63 B;  2K4Y A;  2LQN A;  4EMG A;  3CEY A;  2CP3 A;  6AT1 B;  4E7Z A;  2XIC A;  3M59 A;  3CCJ A;  4M75 G;  3UA6 A;  2C06 A;  1VQ8 T;  1JXM A;  1Q95 G;  4EMH A;  4C0Z A;  2ZPI B;  1TUD A;  3NTH A;  4LUD A;  1ZBJ A;  3EG9 A;  3EGX B;  1I07 A;  1SRM A;  1ACM B;  1NEB A;  3ER0 A;  4ME7 A;  1PC0 A;  1HYO A;  4J8O A;  4M75 B;  2NUT A;  4A54 A;  1YFN A;  2DL5 A;  5FRO A;  4E47 A;  2D9T A;  2G3R A;  3GF5 A;  2RB6 A;  2WSE E;  4ANJ A;  3TVT A;  1VQN Q;  1UGS B;  2M0O A;  1M3B A;  2DL4 A;  2LNH B;  3TQ7 P;  1KJW A;  1MHN A;  1JQQ A;  4OB1 B;  4J9E A;  4M77 A;  4C8Q B;  2V1Q A;  2K5F A;  2EYQ A;  1D3B A;  1YI2 A;  3BDU A;  4E2F B;  4M7A A;  1M3C A;  4IUU A;  2DD4 A;  1Q81 C;  1UUE A;  2P0Q A;  2QAZ A;  2R5M A;  2K3X A;  1MMN A;  5GAN j;  2MI6 A;  3JB9 I;  1ZA2 B;  4OB0 B;  2D6F A;  3HKS A;  4J9G A;  1M90 C;  3H6Z A;  1TUG B;  4OMN A;  1AZG B;  5LJ5 j;  1VQM A;  2X4J A;  1I0C A;  1M90 R;  2ZPH B;  4PLI A;  2I2L A;  4PKC C;  1M1F A;  1RAD B;  3AT1 B;  5LJ5 f;  4NS5 A;  3OBW A;  3L2Z A;  4ZTJ A;  4F17 A;  4BI8 B;  2L8D A;  1CKB A;  2P4T A;  1MV3 A;  4EDU A;  3KBG A;  3CCS A;  1XTD A;  4LDX A;  4C8Q D;  2QEX Q;  2RH2 A;  1QVG S;  2RI5 A;  3RMS A;  3VYH B;  3M0U A;  3QDR B;  2H3J A;  1VQ6 A;  3P8H A;  1QKX A;  5GAO n;  5DLQ E;  2FZC B;  4C0F A;  4A53 A;  2DBK A;  3L2V A;  1VQ4 T;  2FVU A;  3EG3 A;  2MK5 A;  1VQ5 Q;  5LJ3 g;  1UGR B;  3KUF A;  3M56 A;  2EQM A;  2YLC A;  4C92 D;  3JCM W;  1R8O B;  5A0G A;  2K3Y A;  3CC2 A;  5I21 A;  3FIF A;  4M78 C;  4C5I A;  4KH1 B;  1UJY A;  1VQ9 T;  2ED0 A;  2DVJ A;  4JZ4 A;  2K6D A;  4LUE A;  1OOT A;  2J6K A;  4MZT A;  1M2V A;  4FYW B;  4E6R A;  4EMK C;  5DY9 A;  3H8Z A;  1J3T A;  1FMK A;  2VC8 A;  1NLO C;  1UGP B;  3X24 B;  2QA4 A;  2RI3 A;  1PRL C;  2BE7 D;  2JTM A;  4M7D B;  1K0X A;  2F2V A;  5KYY B;  1YCS B;  4C92 F;  1VQP T;  4HCC A;  5CKE A;  3A8H B;  4FT4 A;  4OMM A;  4BE1 A;  2KSS A;  1IXD A;  4AMC A;  1VQ7 A;  3M0P A;  1BI1 A;  3UF4 A;  2FB7 A;  2ZGW A;  3U23 A;  2BUD A;  4E7J A;  1BIB A;  3QJY A;  3JCM Q;  2ROL A;  3GOX A;  1MNE A;  3CPW P;  2VWF A;  4OMQ A;  5FLX E;  2O2O A;  1SKU B;  5CKD A;  3X25 B;  1KQS A;  2E70 A;  2GFU A;  3VS6 A;  1K73 C;  4RG2 A;  2CT4 A;  1LCK A;  4M7D D;  2KMT A;  4PL6 A;  4E7I A;  1X6O A;  3MEV A;  4IIO A;  1D0Y A;  1RAE B;  4HA8 A;  1YBY A;  4KUL A;  5GAM f;  3INZ A;  1YJN Q;  1G3W A;  4Q5W A;  1X01 A;  2CZ1 B;  1TXQ A;  2DAQ A;  1D09 B;  2DVE A;  3CMA Q;  3H9N A;  1UJ0 A;  1AWJ A;  4ELY C;  4EMK A;  2L89 A;  1NEG A;  5HY6 A;  2CP0 A;  4N4G A;  4FYY B;  2K3B A;  4CC4 B;  2DX1 A;  4PJO E;  2E65 A;  2AZV A;  1EIF A;  3CCV A;  2RQU A;  2RJF A;  2NUP A;  4HCK A;  3OYI A;  4DBR A;  2RI2 A;  1GFD A;  2QEX T;  1VA7 A;  2RQV A;  2FRY A;  4KUD K;  4A4G A;  3G4S Q;  3QPH A;  4C0G A;  2F1L A;  2FYK A;  3O5Z A;  2NYS A;  2O88 A;  1JU5 C;  4ESR A;  2OTL T;  2RNA A;  1M8V A;  3EH1 A;  1VYU A;  2QQR A;  2F2X A;  5D6X A;  3NPF A;  2EGC A;  1PSE A;  4UC4 A;  1S72 Q;  4JRQ A;  1VIF A;  4QKU A;  2M0Y A;  4JJB A;  1FX7 A;  1OEB A;  4BDY A;  1Q86 C;  3I56 T;  2LZ6 B;  1X2K A;  2GQI A;  2M9U A;  4QW2 A;  3OMG A;  3X20 B;  2KRN A;  1GBQ A;  2OTJ A;  1I5L A;  2PVD B;  1VQL Q;  3M55 A;  4C0D C;  2CUB A;  1LVK A;  3OYD A;  3EG9 B;  2O31 A;  1PHT A;  3PIO A;  3L2Q A;  1DJ7 B;  2NUT B;  2IPO B;  4M77 G;  3J7A F;  2X4X A;  1VQ6 T;  1AOJ A;  1KIK A;  1JJ2 P;  4M7A G;  3QDF A;  1S1N A;  4N0A C;  2E4H A;  2DKG A;  4IUR A;  4AFU C;  1VIE A;  4M75 E;  2QTX A;  4KGZ B;  1BB9 A;  1IHV A;  1AEY A;  3MO8 A;  5M9O A;  3CCU A;  1D3B B;  3MCA B;  4D8K A;  2FZK B;  4M7A B;  4LN2 A;  2MAM A;  4HVW A;  4JRK A;  4LE9 A;  2BE9 B;  3CCQ T;  2CP7 A;  2DD5 A;  4BAC A;  3JCM h;  4F16 A;  1QVF A;  1RAI B;  1TTH B;  1UHC A;  3JB9 F;  2RHZ A;  2DTH A;  2ZZD A;  3L2R A;  3CPW S;  3CCM T;  3GPL A;  1I81 A;  3G7Z A;  4JZ3 A;  2X9H A;  1QMC A;  2DZC A;  2JZ2 A;  3J81 E;  2EKO A;  4MMK A;  4WF2 A;  1RAH B;  2CS7 A;  3VRZ A;  1BKB A;  2BTT A;  1XNI A;  3PFS A;  4OGC A;  4RKU E;  4IIM A;  5KYU A;  3OS0 A;  4ZN1 A;  3OW2 A;  1KG1 A;  4OML A;  3S3N A;  3BY7 A;  1M3A A;  4C92 A;  5GAN e;  4GLM A;  2DO3 A;  2YUQ A;  4XU3 A;  3JB9 J;  3AHU A;  2X4W A;  4OVA A;  3CCR T;  3NHN A;  5KCH A;  3CME Q;  1TS9 A;  1OPL A;  2YT6 A;  2SEM A;  1RAB B;  5CCA A;  1PD0 A;  4F7U F;  2KVQ G;  3RUX A;  5FRM A;  1YJW T;  3JSC A;  2YSQ A;  1SRL A;  2CH4 W;  1K0S A;  1NE8 A;  1IRX A;  2WSC E;  5HK0 A;  2K5L A;  2DF6 A;  2HL3 A;  2ABL A;  3C0C A;  1M2V B;  1Z9Q A;  3G6E Q;  1WLP B;  2P84 A;  1UEC A;  3WVD B;  4LDW A;  2RD1 A;  3MEW A;  3CCV T;  1VQO T;  2DM1 A;  3V8J A;  3M4Y A;  5GAN 6;  1WFW A;  4OMO A;  3G1J A;  2DLP A;  3PMI A;  1BI0 A;  5A0D A;  4DQ2 A;  2HMA A;  1X6B A;  1GCP A;  2E41 A;  1OPK A;  2JOY A;  3M53 A;  4M7D E;  2NUZ A;  5C6S A;  5IXB A;  5CKF A;  4RTW A;  3SEM A;  1KD1 U;  2ZAE A;  4II1 A;  2J6F A;  3CBO A;  1VQ8 Q;  4X34 A;  2HAX A;  4CI0 C;  3FLG A;  2EQU A;  2CT3 A;  3RKY A;  2RM4 A;  1WNL A;  2QGG A;  4JDS A;  2RN8 A;  2RJD A;  5FWB A;  1JJ2 S;  1WXT A;  1B07 A;  2FPF A;  1NLP C;  1ZQ1 A;  2EW3 A;  3QSU A;  3HPW A;  2XDP A;  5LJ3 h;  2RQT A;  5GAN 2;  1OUL A;  2DYI A;  2OTJ T;  2IG0 A;  4PLL A;  2FO0 A;  1E6G A;  2QTV A;  1WA7 A;  3OYL A;  4DBF A;  3EAE A;  2W0Z A;  2KRS A;  4EMK B;  1HSQ A;  1TUC A;  1M27 C;  2GCX A;  1MV0 B;  4KT0 E;  3UPU A;  2V26 A;  2KGT A;  2ROT A;  3DB4 A;  2FPD A;  2NUP B;  4IUV A;  3EG1 A;  1NG2 A;  4QQ6 A;  5L8R E;  2QXF A;  3JCM e;  2VAS A;  5J26 A;  2LMJ A;  2DZ9 A;  2YDL A;  2DXB A;  1N8R U;  5A2Q E;  5IN1 A;  2HQX A;  2R5A A;  2QGF B;  3OYN A;  3TRE A;  2I0N A;  1E7O A;  2KXD A;  1YIJ A;  5FU7 C;  1KK7 A;  1KSW A;  2EIF A;  1QWE A;  3HRU A;  4J9D A;  1H92 A;  1TOV A;  2LCS A;  1PKT A;  2CGH A;  1WQW A;  4FIB A;  4M78 D;  2Y4Y A;  2D0Q B;  3PVQ A;  4Y92 A;  2KR3 A;  2O9V A;  3JCM J;  4PJM A;  2HSP A;  5HCK A;  1WHJ A;  3RKW A;  4BE2 A;  1YIT T;  2A28 A;  2C0I A;  4IUT A;  1TH7 A;  2E1H A;  4E7K A;  3I55 T;  4OMF B;  3RER A;  1ZUY A;  5GJW B;  3SWN C;  3OSV A;  1B3Q A;  2ESW A;  3HFN A;  4J9B A;  2W10 A;  4PFP A;  2PZ1 A;  3JRZ A;  1VQ4 Q;  3T9N A;  1JEG A;  1IGU A;  1VOM A;  4M78 F;  1VYT A;  4AFZ C;  1VQN A;  2OAU A;  4A4K A;  4IUP A;  2D0N A;  1VQ9 Q;  5IAY A;  1ZHI A;  2BZ8 A;  3CC4 T;  4V2S A;  3PNW C;  4L5G A;  1WI7 A;  4DBQ A;  1NM7 A;  3JCM d;  3M57 A;  2DTO A;  2D8J A;  1Y7X A;  2HDA A;  4IKF A;  4WCI A;  3MJX A;  1RI0 A;  2LX9 A;  1HXD A;  3E1S A;  1VQP Q;  4C8Q G;  2LDM A;  2JN0 A;  1NPP A;  2Y4X A;  4M77 E;  1KQS P;  5KYN A;  5D6Y A;  1AT1 B;  1CSK A;  4F7U A;  4M7A E;  2MOX A;  4M4Z A;  3VS0 A;  1GCQ C;  1K4U S;  4JRI A;  2KYB A;  3TU4 K;  4LXC A;  2B86 A;  4OB2 B;  1Q82 R;  4C5H A;  1K8A U;  3MP1 A;  1WPY A;  1RAG B;  3A5Z B;  2HZY A;  2CSI A;  2EAY A;  2VV5 A;  1ZX6 A;  3Q1J A;  5EG2 A;  4ZN3 A;  2EJG A;  2DXT A;  3H0H A;  4PJN A;  3SWN A;  4RUG A;  4C92 G;  2HKQ B;  4FL6 A;  4C0D B;  2M02 A;  2LC4 A;  1YJ9 T;  5GAN f;  3LX7 A;  5KYU B;  5LJ3 e;  2GNC A;  1U8R A;  2DYB A;  3EFR A;  4C92 B;  2QYZ A;  2HSE B;  1P92 A;  1VQ5 A;  5J39 A;  1YHQ A;  1D0Z A;  2RPN A;  5J3B A;  2G6F X;  2KI7 A;  3SDZ A;  3UT1 A;  3NFC A;  3JV3 A;  4QT7 A;  4D6W A;  1BI3 A;  1M1G A;  2R57 A;  2JTF A;  3M4G A;  4LDV A;  1TWB A;  4CC3 A;  1NYG A;  1VUB A;  2KT1 A;  2OI3 A;  5CR2 A;  1Q7Y U;  1RAC B;  2DIL A;  3C4S A;  2OTL Q;  4D8D A;  2LP5 A;  3CD6 T;  1X69 A;  2DER A;  1GCQ A;  4BUG A;  4Z8A A;  1H3H A;  1FWZ A;  1FMW A;  4RTZ A;  5CQY A;  1ZSZ C;  4J7F A;  4K11 A;  3VS1 A;  3ZEH A;  2F2W A;  3I56 Q;  2HKN A;  2QQS A;  5IHN A;  4KGV B;  4M7D G;  3QWY A;  4KGX B;  4BE0 A;  3L42 A;  5CIU A;  2EKH A;  3CCL A;  1MMG A;  3CC7 A;  2MYS A;  4QQG A;  3WVE B;  5LJ3 d;  3M5A A;  2IVW A;  2COW A;  2H3E B;  2ENM A;  2XDB A;  3VUB A;  4FW2 A;  2ZPF B;  3LYI A;  5KE2 A;  1SSH A;  1X43 A;  3M9Q A;  3UA7 A;  1MMA A;  5L23 A;  2QDL A;  1G3Y A;  2LJ0 A;  2JS2 A;  3G71 T;  4HVU A;  1VQ6 Q;  3M0R A;  1QVF P;  1OX8 A;  1QW1 A;  3FJP A;  3FJ5 A;  3DLM A;  2FZG B;  3LGF A;  1D1B A;  3TSZ A;  4PJO C;  1UG1 A;  3BE3 A;  3HFO A;  3NGP A;  3RIR A;  2QQ9 A;  1XJW B;  1JB0 E;  3M0S A;  1KQS S;  2CRE A;  2E12 A;  3REB B;  3G4S A;  1C1A A;  3JCM f;  3CCQ Q;  3CCJ T;  2K2M A;  1TG0 A;  1OU8 A;  1WHG A;  4M78 A;  4ZGJ B;  4CRI A;  1ZBX A;  1GL5 A;  3EHQ A;  3CCM Q;  4JS5 A;  3QYG B;  1G8X A;  1G5V A;  2KAF A;  4DEX A;  4RTV A;  1NZ9 A;  3SB2 A;  1S72 A;  2LT4 A;  1OZ3 A;  1UDL A;  3ZBD A;  2LVM A;  1VQK A;  3FB9 A;  4JS4 A;  2M16 A;  4AG2 C;  1BK2 A;  3VS4 A;  2QQA A;  3FC3 A;  2E6N A;  4PFZ A;  1VQ7 Q;  1RL2 A;  3A98 A;  3LWH A;  1MMD A;  3JB9 G;  4IUQ A;  1UE9 A;  1ABO A;  1YI2 T;  1LJO A;  5IXF A;  1KD1 R;  3SFM A;  2NLU A;  1Q82 U;  5D7U A;  3CCR Q;  2EYZ A;  2EQK A;  4RTX A;  1YWO A;  3E9G A;  3TSW A;  1XOV A;  2MCN A;  2BKD N;  1VQM T;  2ZPB B;  1UHF A;  1YJW Q;  3LH5 A;  2JM8 A;  3I9Q A;  2DNU A;  2VVK A;  4M75 C;  3D7S B;  3PMT A;  3ASK A;  2JJ9 A;  3MP6 A;  5GAN 8;  1SPK A;  5FU6 C;  3MEU A;  3TCJ A;  2HCK A;  3FRN A;  1SEM A;  4NL3 A;  4DOV A;  3CCS T;  2VUB A;  2ATC B;  2CP6 A;  2YWW A;  3CCV Q;  1W1F A;  2M1H A;  1VQO Q;  1RLQ C;  1QLY A;  2EGE A;  2HQE A;  2F5T X;  5CAI A;  1WHM A;  2PNI A;  2M51 A;  5DM7 R;  4Y28 E;  1N8R C;  2C0T A;  3JB9 D;  2KYM A;  4F7U B;  1N8R R;  3E19 A;  1WXB A;  1KFZ A;  1O9S A;  1D1C A;  3M0Q A;  2QK0 A;  5LJ3 j;  5IHI A;  1BCM A;  4HT9 A;  4X1V A;  1OQK A;  3H0F A;  3CC2 T;  4HCZ A;  4XK8 E;  2OX7 A;  4HVV A;  1K9M U;  2YRD A;  1QQJ A;  1QVF S;  4C8Q E;  1W6X A;  5LJ3 f;  1X6G A;  3SWN B;  3S6W A;  4CC7 A;  1W2B A;  2J7I A;  3CC7 T;  4FU6 A;  4DA4 A;  4O5V A;  3JB9 H;  2OTJ Q;  2QA4 T;  1F1B B;  2HBW A;  3JCM V;  3NTK A;  3EGD A;  2LJ1 A;  3CCE A;  2KNB B;  1BYM A;  3MKD A;  2MPX C;  1YP5 A;  5I11 A;  3OYH A;  4OF1 A;  1GFC A;  2RK1 A;  5KH6 A;  1D0X A;  2L0A A;  2LT1 A;  3C94 A;  4GBQ A;  2LCL A;  1ZUU A;  4C92 E;  3CXC A;  1VQ7 T;  4HXJ A;  1RLP C;  4KRT A;  2DMO A;  3OYG A;  3CPW A;  1YCY A;  4JJN K;  2R58 A;  2AK5 A;  1UFF A;  3G6E A;  2DXU A;  3GNF B;  2RQR A;  2GQV A;  1RAF B;  4EPC A;  3VS3 A;  4ZNX A;  4FCY A;  2AZS A;  1V1C A;  4N0A A;  2CP2 A;  3GLX A;  4AFQ C;  2EPD A;  1WHL A;  3SD4 A;  4LNP A;  4RMO A;  3QHS A;  1WJQ A;  4J6W A;  1JO8 A;  4FM4 B;  3M58 A;  4M7D C;  3GP8 A;  4X9D A;  1UGV A;  4CC2 A;  2EYX A;  3OQ5 A;  4QVC A;  3PTA A;  2LX7 A;  3PVL A;  1YIT Q;  1VQ8 A;  4ZGE B;  1K8A C;  2JUF A;  1WX6 A;  5HKC A;  3ULR B;  2ECZ A;  3I55 Q;  1JRI A;  2KQW A;  4DOW A;  1K8A R;  2CH4 A;  1VQK T;  4ZGD B;  2YRC A;  1GXI E;  1PNJ A;  4M77 F;  1I8F A;  2ZCF B;  4M7A F;  1M4Z A;  3KXT A;  2DEQ A;  1K73 U;  3LLR A;  3ZL7 C;  2HBP A;  2E3I A;  1BCO A;  2KRM A;  3EGU A;  3JAM E;  4KBM B;  2JMA A;  3HHT B;  1WDX A;  3CC4 Q;  1OI1 A;  5CKH A;  3X26 B;  2CUD A;  1D1A A;  4OGE A;  5GAO l;  3P8D A;  2MIO A;  2MWO A;  2RF0 A;  1N6A A;  2JT4 A;  1UGQ B;  4XAX B;  4MDX A;  3BDL A;  2KT8 A;  1QWF A;  3DLL A;  5GAO r;  5LJ5 g;  2XHC A;  5KYX A;  4M78 G;  2DEU A;  4XU1 A;  2CKK A;  8ATC B;  3HRS A;  1Q7Y C;  2XG8 D;  3R6O A;  2EWN A;  2LCC A;  1Q7Y R;  2BIV A;  3LGL A;  3OYK A;  4RG8 A;  2DTI A;  4C5E A;  1OX9 A;  2EQJ A;  2LRQ A;  1KHC A;  4M78 B;  1SF9 A;  4L6V 5;  3EFO A;  2JS0 A;  3LW5 E;  2QQB A;  1OYX A;  4J5Y A;  3FDR A;  1JJ2 A;  2LTO A;  2X35 A;  4A4F A;  1LOJ A;  1Q86 U;  1QVP A;  4J9H A;  1WQ7 A;  4BD3 A;  5CKB A;  1U1S A;  4XTY A;  5AT1 B;  5DLO A;  3S3M A;  1YJ9 Q;  1X75 C;  2AIR B;  3URG A;  3MET A;  1CKA A;  3CCU T;  4QVD A;  3MPU B;  1VQ4 A;  2K9G A;  1MND A;  4Y91 A;  2PUK B;  2HEQ A;  2EYW A;  1B34 A;  2SRC A;  2RHX A;  1Y71 A;  2RJC A;  2RA2 A;  2YHT A;  3S3O A;  4XTW A;  1AD5 A;  2JVV A;  4BY6 C;  1VQ9 A;  1ZSG A;  1UEB A;  1KHI A;  2DJZ A;  2JXB A;  2P0P A;  3CCE T;  2RJE A;  5GMK h;  1KC8 U;  2DL7 A;  3JCM P;  3CD6 Q;  3C12 A;  3JCM c;  1VQP A;  2KY9 A;  4OMP A;  1M1K R;  4M77 C;  2KEA A;  2XK0 A;  4M7A C;  2VKN A;  2Y90 A;  4XTX A;  2ED1 A;  1WXU A;  2K5I A;  1G3S A;  2EYY A;  4LD6 A;  1YNZ A;  2BZX A;  2CZ6 B;  4PJO D;  4J83 A;  2HL5 C;  1IRE B;  1GBR A;  3EG2 A;  2A36 A;  2L3S A;  1AWW A;  5GAN 7;  5GAM g;  1EFN A;  4F7U E;  4XQ3 A;  3DB3 A;  3QZ9 B;  4LDU A;  5IT9 E;  3OSS C;  4L59 A;  3CPF A;  2QI2 A;  3OYE A;  2GTJ A;  2DK3 A;  1PM3 A;  3QKJ A;  3G71 Q;  3JCM b;  1TU0 B;  1Q82 C;  4PJO F;  2F69 A;  3BFM A;  4JRP A;  2A37 A;  5GAM d;  2O9S A;  4FT2 A;  3EGD B;  3CQT A;  1NBE B;  1ABQ A;  2JW4 A;  5FU6 B;  1SSF A;  3E9F A;  1IHW A;  1A0N B;  2QEX A;  1EX4 A;  4O6J A;  5A0L A;  1WIE A;  5KCO A;  4HKE A;  2X4Y A;  2DET A;  1WJR A;  4R56 A;  2QDY B;  4XTZ A;  3CCJ Q;  1EZZ B;  1HD3 A;  4JLI A;  2P4R A;  2OTL A;  1I5O B;  1M8M A;  3CBP A;  1Q81 R;  4MZM A;  5GAO m;  2PVG B;  3V7C A;  3I5S A;  2K7A A;  4N4I A;  1R0B G;  2A7Y A;  1QCN A;  3I56 A;  3HL8 A;  4PJL A;  4MML A;  5FW9 A;  4M75 D;  2DPP B;  2XID A;  5CVI A;  1H64 1;  1I1J A;  1NYF A;  1PCX A;  5I22 A;  5IH2 A;  2NWM A;  3CBM A;  2CZ0 B;  1YI2 Q;  3OYC A;  1IO6 A;  3EFS A;  3RKX A;  5LL6 S;  1IZ6 A;  2L3R A;  1SG5 A;  1K9M C;  2O4X A;  1FMV A;  3OBY A;  4JJC A;  1T0J A;  2GF7 A;  5GMK m;  1K9M R;  1M5Q 1;  2DRM A;  1PG5 B;  3OYY A;  2KE9 A;  3KFV A;  4M75 F;  4BI3 A;  1VQM Q;  1QVG A;  3A8L B;  4FSS A;  3ZFJ A;  2P0K A;  3M0T A;  1JXO A;  4J9C A;  3PGG A;  5HK3 A;  1RUW A;  2F5K A;  3VKI A;  1PD1 A;  4F14 A;  5CQX A;  1YIJ T;  2J06 A;  1YHQ Q;  3GBQ A;  4PNO A;  3MP8 A;  2CZ7 B;  4C8Q F;  3QO3 A;  3EHR A;  4GLK A;  5GMK e;  1N27 A;  4WTO B;  3CCS Q;  2YXY A;  1HK9 A;  2RHY A;  2K2V A;  2JM9 A;  3OS1 A;  3CCQ A;  4B6M A;  1OZ2 A;  4TVR A;  4B9W A;  5KYX B;  1TSF A;  1YJN A;  1W70 A;  2XU8 A;  3CCM A;  1W2B P;  4YTL A;  3CMA A;  1T0H A;  2KBT A;  2J6O A;  2LJ3 A;  2WAC A;  3BW1 A;  2YLB A;  4MDW A;  1UB4 A;  1ZLM A;  1V76 A;  3EFO B;  4XTV A;  3VYG A;  5KYW A;  1M1K U;  1VQN T;  4A4H A;  2V8J A;  2EFI A;  5EC7 A;  3QZ5 B;  3RES A;  3RBB B;  5CK9 A;  3CC2 Q;  5C0M A;  2FEI A;  4M78 E;  5I2S A;  2PU9 B;  3HP9 A;  2PQW A;  4BI4 A;  3CXC P;  1FXX A;  1ZSZ A;  3PE0 A;  3CCL Q;  1NJI U;  3CC7 Q;  3M54 A;  3CCR A;  3OW2 P;  2O01 E;  1BU1 A;  2QA4 Q;  1H8K A;  3MHX A;  3QYH B;  4RCC A;  5GAN 5;  3A8G B;  3V7S A;  5GAM j;  1X2Q A;  4DBH A;  3UWN A;  3OYM A;  3DKM A;  2XMF A;  3L2U A;  3X28 B;  1YJW A;  2E5Q A;  1B7T A;  1B34 B;  2EJF A;  1SHG A;  3RNJ A;  5GAN h;  2X51 A;  3OYA A;  3SHW A;  1K73 R;  3OS2 A;  4HCB A;  4RTU A;  1WHK A;  3I5R A;  4BDZ A;  5LJ5 h;  1KD1 C;  1G83 A;  1VQL A;  2OAW A;  1N9R A;  2EGA A;  3QBY A;  4EIK A;  3QWX X;  5KE3 A;  2DIQ A;  2X3X D;  3VRY A;  1K9A A;  2KXC A;  1VQO A;  1G3T A;  4RCB A;  3VS2 A;  4OB3 B;  2DIG A;  2PVO B;  4M7D F;  2X3W D;  4PJO A;  2IIM A;  1V29 B;  3P8B B;  4Z02 A;  4R0K A;  3MEA A;  3HRT A;  3REA B;  2CYZ B;  3OYF A;  1AWX A;  3QII A;  5AYF A;  1N9S A;  4Z89 A;  2YUN A;  2MMP A;  1VQ5 T;  1YHQ T;  3LH0 A;  4XTU A;  4NL2 A;  2DFU A;  1UTI A;  4J6X A;  1U1T A;  2GTO A;  3OY9 A;  1Q81 U;  3F70 A;  1AWO A;  5CO7 A;  2C0O A;  4LDY A;  1VQK Q;  5GAN 4;  1U06 A;  4C8Q C;  3A8M B;  3PIP A;  1M90 U;  2EQI A;  4F7U G;  1Q86 R;  1X27 A;  4QVZ A;  3VJP A;  1ZA1 B;  2HD0 A;  2E5K A;  3UDC A;  2K79 A;  1T3L A;  1I4K 1;  1AVZ C;  1M30 A;  5FU7 B;  1KQ2 A;  2JNG A;  1Z9Z A;  4B9X A;  2PTK A;  3WXM B;  1FYN A;  1C6V X;  2RMO A;  2VGN A;  4BY6 B;  3OS5 A;  4NOY A;  5GAO q;  3TEE A;  2J05 A;  3OMC A;  3H0I A;  4E7L A;  1Y96 A;  3EG0 A;  4C92 C;  1R0C B;  3ME9 A;  1QP3 A;  1G2B A;  3QXE B;  2HNI A;  2B8A A;  2LNV A;  1VYV A;  1W2B S;  3LWI A;  1H3Z A;  2CSQ A;  4FSX A;  3V8K A;  3R6N A;  4XU2 A;  3OB9 A;  3EGX A;  2DRK A;  2KDS A;  4JUV A;  3CCL T;  2A08 A;  4M77 B;  3CME A;  1KC8 C;  4RTY A;  3E2U A;  4PFO A;  4OP0 A;  4M75 A;  1K76 A;  1KC8 R;  4J9I A;  1LPL A;  2ZPG B;  4DEY A;  4PJJ A;  4ZTF A;  1PRM C;  2CP5 A;  2DE0 X;  2Z0W A;  3H41 A;  1IB8 A;  3I35 A;  2FRW A;  2PUO B;  2RK2 A;  1PSF A;  1Y0M A;  3CXC S;  2DXC A;  3L1A A;  3UAT A;  2YRV A;  1YJN T;  4C8Q A;  3C95 A;  5GAM h;  3OW2 S;  2DJQ A;  1YIT A;  7AT1 B;  3CMA T;  2EJ9 A;  3I55 A;  4ELZ C;  5GMK i;  2LQK A;  1MUZ A;  3CCU Q;  2VXE A;  2AKK A;  3N5B B;  4M77 D;  3G4S T;  2FPE A;  3O8V A;  4M7A D;  1JBM A;  2O4X B;  2AT1 B;  8AT1 B;  2LQ8 A;  4LD9 K;  3VS5 A;  3J80 E;  3QJ6 A;  5GMK j;  4JJD A;  3CC4 A;  1ARK A;  4HT8 A;  2VXF A;  4KH0 B;  1QCF A;  4E7H A;  3HSB A;  5LJ5 e;  3CCE Q;  1S72 T;  2V8K A;  1WHH A;  3PT9 A;  4KUI A;  4XU0 A;  2MF2 A;  3GNG A;  2DL8 A;  1IGQ A;  3QG1 A;  1AZE A;  1BI2 A;  4JPB W;  4N4H A;  5ECA A;  2RO0 A;  2D1X A;  4FYX B;  4AFS C;  2AKL A;  1VQL T;  1SHF A;  3L2W A;  5D6W A;  3RR6 A;  2COZ A;  2K57 A;  2AHJ B;  1Y57 A;  2ZPE B;  4J9F A;  2GBQ A;  3OYB A;  1WYX A;  2CDT A;  1OU9 A;  2A3L A;  5GAN g;  3EH2 A;  4X9C A;  4QQD A;  2JMC A;  2COY A;  2L5Q A;  1M9S A;  2E3H A;  3VS7 A;  2HQH A;  2JTE A;  2EVR A;  2XKO C;  5KYW B;  2E64 A;  1T3S A;  2MWP A;  2VGM A;  1YJ9 A;  2A0F B;  2YUO A;  5GJV B;  5FWC A;  1PKS A;  2GGR A;  2H8H A;  1WJS A;  9ATC B;  1KQ1 A;  2FL7 A;  3A1P A;  1QCO A;  4JLG A;  4M7D A;  2FHD A;  1ZSZ B;  5GAN d;  2E6Z A;  5KYY A;  2FG0 A;  1QKW A;  5I2M A;  1AHJ B;  5GAN 3;  2RQW A;  5FRN A;  1O75 A;  1RI9 A;  5LJ5 d;  2L3Q A;  1ZUK A;  3A8O B;  1U5S A;  3VV0 A;  3OYJ A;  5GMK l;  4ATO A;  4C5G A;  3IQL A;  4A4E A;  1E6H A;  1BBZ A;  1LNX A;  4J6Y A;  1U3O A;  2OJ2 A;  1GRI A;  1WZO A;  4F04 B;  3VU3 C;  2L2P A;  3FEO A;  2XD0 A;  3CD6 A;  4PJO G;  1QP2 A;  1YWP A;  3VUZ A;  2RHI A;  3HTR A;  4AG1 C;  1XQH A;  3RDV A;  2KK4 A;  2QG9 B;  1N5Z A;  3GIB A;  2V1R A;  2L3P A;  4PJO B;  4ORZ A;  4E7S A;  1W4S A;  1BIA A;  4J7I A;  3OA6 A;  3CME T;  1QVG P;  1OV3 A; 
#chains in the Genus database with same CATH homology
 4XU3 A;  4IUQ A;  3JB9 J;  3AHU A;  2X4W A;  4OVA A;  3V7R A;  5GAM e;  3CCR T;  1YI2 T;  1LJO A;  5KCH A;  4GY5 A;  3CBM A;  3SFM A;  2NLU A;  1Q82 U;  2WSF E;  3V8L A;  2CZ0 B;  3OYC A;  2E10 A;  3EFS A;  5CCA A;  2EQK A;  4F7U F;  2XDD A;  3RKX A;  5LL6 S;  2KVQ G;  3RUX A;  1IZ6 A;  3E9G A;  2L3R A;  4E7I A;  1WGS A;  1M1K C;  5FRM A;  2GFA A;  1K9M C;  1YJW T;  1XOV A;  1MGQ A;  1NPR A;  2BKD N;  2O4X A;  3JSC A;  3OBY A;  1VQM T;  2GF7 A;  2ZPB B;  5GMK m;  4BB7 A;  1M5Q 1;  4M75 F;  1QVG A;  3OYY A;  4BI3 A;  1NE8 A;  3A8L B;  3JCM X;  4M75 C;  4P5N A;  3PMT A;  2WSC E;  5HK0 A;  2K5L A;  3ASK A;  3MP6 A;  3ZFJ A;  2RHU A;  2P0K A;  4MZP A;  4R55 A;  3G6E T;  3NTI A;  5GAO p;  3G71 A;  5GAN 8;  3PGG A;  2VYT A;  5HK3 A;  2XI9 A;  1NJI C;  5FU6 C;  2F5K A;  3VKI A;  3MEU A;  3TCJ A;  1Y07 A;  3WVD B;  5CQX A;  1YIJ T;  3FRN A;  4LDW A;  4VUB A;  2RD1 A;  4NL3 A;  3MEW A;  3CCV T;  4PNO A;  3MP8 A;  2CZ7 B;  3JCM g;  4C8Q F;  4DOV A;  3CCS T;  1VQO T;  3QO3 A;  4GLK A;  5GMK e;  3QUI A;  2VUB A;  3V8J A;  3M4Y A;  1N27 A;  3RMQ A;  2M1H A;  2V8I A;  1HK9 A;  5GAN 6;  2RHY A;  1Y96 B;  2K2V A;  3OS1 A;  3CCQ A;  2K4Y A;  2HQE A;  3PMI A;  2F5T X;  1BI0 A;  1OZ2 A;  5CAI A;  4EMG A;  3CEY A;  5A0D A;  4DQ2 A;  4TVR A;  2E41 A;  5DM7 R;  2XIC A;  4B9W A;  2JOY A;  3M53 A;  3M59 A;  3CCJ A;  4M7D E;  4M75 G;  4Y28 E;  5C6S A;  1N8R C;  2C06 A;  1VQ8 T;  1YJN A;  4EMH A;  5CKF A;  2XU8 A;  3JB9 D;  4C0Z A;  3CCM A;  1KD1 U;  4F7U B;  4II1 A;  2ZPI B;  3CBO A;  3NTH A;  4YTL A;  4X34 A;  3CMA A;  3E19 A;  1O9S A;  2HAX A;  4CI0 C;  2WAC A;  3BW1 A;  3FLG A;  2EQU A;  2YLB A;  3ER0 A;  2RM4 A;  4ME7 A;  3RKY A;  1WNL A;  5LJ3 j;  4J8O A;  4MDW A;  4JDS A;  1UB4 A;  4M75 B;  4A54 A;  4HT9 A;  4E47 A;  5FRO A;  2D9T A;  2RJD A;  3CC2 T;  4HCZ A;  2G3R A;  4XTV A;  1JJ2 S;  3VYG A;  4XK8 E;  3GF5 A;  1M1K U;  1VQN T;  4A4H A;  2V8J A;  1K9M U;  2EFI A;  1ZQ1 A;  2RB6 A;  2WSE E;  3QZ5 B;  3RES A;  3HPW A;  4C8Q E;  2XDP A;  5LJ3 h;  5CK9 A;  5LJ3 f;  3QSU A;  1UGS B;  2M0O A;  3SWN B;  5C0M A;  4M78 E;  5I2S A;  3S6W A;  2PU9 B;  3HP9 A;  5GAN 2;  1W2B A;  2OTJ T;  2PQW A;  2IG0 A;  3CC7 T;  4FU6 A;  4BI4 A;  1FXX A;  4DA4 A;  4O5V A;  1MHN A;  3JB9 H;  4PLL A;  4OB1 B;  4M77 A;  4C8Q B;  2QA4 T;  2K5F A;  2EYQ A;  3JCM V;  1NJI U;  1D3B A;  3M54 A;  3NTK A;  3BDU A;  3CCR A;  1YI2 A;  4M7A A;  2O01 E;  3CCE A;  4IUU A;  2DD4 A;  3MHX A;  1BYM A;  3QYH B;  1Q81 C;  3OYL A;  4RCC A;  2P0Q A;  3EAE A;  2R5M A;  2K3X A;  5GAN 5;  5GAN j;  3OYH A;  2MI6 A;  3A8G B;  4OF1 A;  3V7S A;  2RK1 A;  4EMK B;  5GAM j;  4OB0 B;  3JB9 I;  5KH6 A;  2D6F A;  2LT1 A;  3C94 A;  2GCX A;  3HKS A;  2LCL A;  3UWN A;  3OYM A;  3DKM A;  1M90 C;  3H6Z A;  4KT0 E;  3L2U A;  3UPU A;  3X28 B;  1YJW A;  2E5Q A;  1B34 B;  2EJF A;  5LJ5 j;  3DB4 A;  1VQM A;  4C92 E;  5GAN h;  2X4J A;  3CXC A;  2ZPH B;  1VQ7 T;  4IUV A;  4QQ6 A;  4PLI A;  2I2L A;  5L8R E;  3OYA A;  2QXF A;  3OS2 A;  3OYG A;  4HCB A;  3CPW A;  3JCM e;  5J26 A;  1YCY A;  4JJN K;  2R58 A;  2DZ9 A;  4PKC C;  3G6E A;  2DXB A;  1M1F A;  2DXU A;  4BDZ A;  3GNF B;  5LJ5 h;  5A2Q E;  5LJ5 f;  5IN1 A;  1N8R U;  4NS5 A;  2HQX A;  2R5A A;  1KD1 C;  1VQL A;  2GQV A;  1N9R A;  3L2Z A;  3OBW A;  3QBY A;  4ZTJ A;  4EPC A;  5KE3 A;  3OYN A;  3TRE A;  4BI8 B;  2DIQ A;  2L8D A;  1YIJ A;  5FU7 C;  2P4T A;  4EDU A;  4N0A A;  3KBG A;  3GLX A;  3CCS A;  2EIF A;  1XTD A;  1VQO A;  3HRU A;  1G3T A;  4RCB A;  4LDX A;  3SD4 A;  4C8Q D;  2CGH A;  1WQW A;  4FIB A;  4OB3 B;  4RMO A;  2DIG A;  1WJQ A;  2PVO B;  2Y4Y A;  2D0Q B;  3QHS A;  4J6W A;  4M78 D;  4M7D F;  4PJO A;  2RH2 A;  1V29 B;  4FM4 B;  3M58 A;  3P8B B;  4Z02 A;  2RI5 A;  3RMS A;  1QVG S;  3GP8 A;  4M7D C;  3JCM J;  3VYH B;  3QDR B;  4X9D A;  3MEA A;  4BE2 A;  3RKW A;  3HRT A;  1YIT T;  2H3J A;  1VQ6 A;  2CYZ B;  4QVC A;  3OQ5 A;  4IUT A;  1TH7 A;  3OYF A;  3PTA A;  2E1H A;  3P8H A;  3QII A;  4E7K A;  3I55 T;  4OMF B;  4ZGE B;  1VQ8 A;  5AYF A;  1N9S A;  5GAO n;  1K8A C;  5DLQ E;  2JUF A;  4C0F A;  5HKC A;  4A53 A;  3RER A;  2MMP A;  1VQ5 T;  1JRI A;  2KQW A;  4DOW A;  1YHQ T;  3SWN C;  3L2V A;  3LH0 A;  3OSV A;  4XTU A;  1VQ4 T;  4J6X A;  2FVU A;  4NL2 A;  4ZGD B;  1U1T A;  3OY9 A;  1VQK T;  3HFN A;  1Q81 U;  3F70 A;  1UGR B;  3KUF A;  5LJ3 g;  1GXI E;  5CO7 A;  3M56 A;  2EQM A;  3JRZ A;  4M77 F;  4LDY A;  3T9N A;  1I8F A;  5GAN 4;  2YLC A;  2ZCF B;  4C8Q C;  3A8M B;  4C92 D;  4M78 F;  3PIP A;  3JCM W;  1R8O B;  4M7A F;  1M4Z A;  5A0G A;  2K3Y A;  3CC2 A;  5I21 A;  3FIF A;  4M78 C;  3KXT A;  1M90 U;  4F7U G;  4QVZ A;  4C5I A;  1VQN A;  2DEQ A;  1VQ9 T;  1K73 U;  3VJP A;  3LLR A;  2OAU A;  2HBP A;  2HD0 A;  4A4K A;  4MZT A;  4IUP A;  3UDC A;  5IAY A;  1ZHI A;  3CC4 T;  4EMK C;  5DY9 A;  1I4K 1;  3H8Z A;  4V2S A;  3JAM E;  5FU7 B;  4KBM B;  1KQ2 A;  3PNW C;  2JNG A;  2VC8 A;  3HHT B;  4L5G A;  1OI1 A;  5CKH A;  3X26 B;  4M7A D;  1UGP B;  3X24 B;  4B9X A;  2QA4 A;  2RI3 A;  3JCM d;  3M57 A;  3WXM B;  4OGE A;  2DTO A;  5GAO l;  1Y7X A;  2VGN A;  4BY6 B;  3P8D A;  2MWO A;  3OS5 A;  2JTM A;  4NOY A;  3TEE A;  1N6A A;  5GAO q;  4M7D B;  3OMC A;  4E7L A;  1Y96 A;  1UGQ B;  4IKF A;  4C92 F;  1VQP T;  4XAX B;  4MDX A;  4HCC A;  1RI0 A;  4C92 C;  3BDL A;  2LX9 A;  1HXD A;  5CKE A;  3DLL A;  3E1S A;  3ME9 A;  3A8H B;  5GAO r;  1QP3 A;  2LDM A;  4C8Q G;  2JN0 A;  4FT4 A;  5LJ5 g;  2XHC A;  1NPP A;  3QXE B;  2HNI A;  2B8A A;  4M78 G;  4BE1 A;  2Y4X A;  4M77 E;  2KSS A;  4XU1 A;  1VQ7 A;  2LNV A;  5D6Y A;  1W2B S;  2CKK A;  3LWI A;  3HRS A;  4F7U A;  1Q7Y C;  1H3Z A;  2XG8 D;  4FSX A;  3V8K A;  4M7A E;  1BI1 A;  3R6O A;  2EWN A;  4XU2 A;  3OB9 A;  2LCC A;  4JRI A;  2BIV A;  2KDS A;  3LGL A;  4JUV A;  3OYK A;  3CCL T;  3TU4 K;  4RG8 A;  2DTI A;  2FB7 A;  2ZGW A;  2BUD A;  4M77 B;  4C5E A;  4OB2 B;  4E7J A;  1BIB A;  3QJY A;  4C5H A;  3JCM Q;  3GOX A;  3CME A;  3MP1 A;  1KC8 C;  1WPY A;  2EQJ A;  2LRQ A;  4OP0 A;  1K8A U;  1KHC A;  4M78 B;  4M75 A;  3A5Z B;  4L6V 5;  2EAY A;  3LW5 E;  5FLX E;  2VV5 A;  2QQB A;  2ZPG B;  5CKD A;  3Q1J A;  1OYX A;  5EG2 A;  4ZN3 A;  4J5Y A;  2EJG A;  4ZTF A;  2DXT A;  3FDR A;  1JJ2 A;  2LTO A;  3X25 B;  2X35 A;  1KQS A;  4A4F A;  2E70 A;  1LOJ A;  2GFU A;  1Q86 U;  3SWN A;  1QVP A;  4C92 G;  2PUO B;  2RK2 A;  1PSF A;  3CXC S;  2DXC A;  1WQ7 A;  3L1A A;  4FL6 A;  4RG2 A;  2YRV A;  4C0D B;  1K73 C;  2LC4 A;  4BD3 A;  5CKB A;  1U1S A;  1YJ9 T;  5GAN f;  1YJN T;  4M7D D;  4XTY A;  4C8Q A;  2KMT A;  4PL6 A;  3LX7 A;  1X6O A;  3MEV A;  3C95 A;  5LJ3 e;  4HA8 A;  5GAM f;  1YBY A;  4KUL A;  5DLO A;  5GAM h;  3OW2 S;  3S3M A;  1YIT A;  3INZ A;  1U8R A;  1G3W A;  4Q5W A;  3CMA T;  1X01 A;  2CZ1 B;  2EJ9 A;  1X75 C;  2DAQ A;  2DVE A;  3I55 A;  3EFR A;  4ELZ C;  4C92 B;  3URG A;  3MET A;  4ELY C;  4EMK A;  1P92 A;  3CCU T;  2L89 A;  4QVD A;  5GMK i;  5J39 A;  1VQ5 A;  2LQK A;  1YHQ A;  5HY6 A;  4N4G A;  1VQ4 A;  4Y91 A;  4PJO E;  2PUK B;  2E65 A;  1EIF A;  1B34 A;  3CCV A;  5J3B A;  2RJF A;  2VXE A;  2RHX A;  3OYI A;  3SDZ A;  3UT1 A;  2RI2 A;  3NFC A;  3N5B B;  1Y71 A;  2RJC A;  2RA2 A;  4M77 D;  4D6W A;  3G4S T;  2QEX T;  1BI3 A;  1M1G A;  2R57 A;  2YHT A;  3S3O A;  3O8V A;  4XTW A;  1JBM A;  2JTF A;  2JVV A;  3M4G A;  4LDV A;  2O4X B;  4A4G A;  4BY6 C;  1VQ9 A;  4KUD K;  3QPH A;  2LQ8 A;  4LD9 K;  1VUB A;  3J80 E;  3QJ6 A;  1UEB A;  4C0G A;  5GMK j;  1KHI A;  2DJZ A;  2FYK A;  5CR2 A;  1Q7Y U;  3CC4 A;  2P0P A;  3CCE T;  2OTL T;  4HT8 A;  2VXF A;  3C4S A;  1M8V A;  2RJE A;  4E7H A;  3HSB A;  5LJ5 e;  5GMK h;  1KC8 U;  3CD6 T;  1S72 T;  2V8K A;  2QQR A;  5D6X A;  3JCM P;  4BUG A;  3PT9 A;  1PSE A;  1QVF S;  4UC4 A;  3C12 A;  4KUI A;  4XU0 A;  1FWZ A;  1VIF A;  4JRQ A;  2MF2 A;  3GNG A;  3JCM c;  3QG1 A;  5CQY A;  3CME T;  1VQP A;  1FX7 A;  2KY9 A;  4J7F A;  3ZEH A;  4BDY A;  1Q86 C;  4M77 C;  3I56 T;  2XK0 A;  4M7A C;  1BI2 A;  2Y90 A;  2M9U A;  4N4H A;  2RO0 A;  4QW2 A;  4XTX A;  3OMG A;  2QQS A;  1VQL T;  3X20 B;  2K5I A;  4M7D G;  4BE0 A;  3L2W A;  5D6W A;  2K57 A;  1G3S A;  2OTJ A;  4LD6 A;  2PVD B;  1I5L A;  2AHJ B;  3L42 A;  2ZPE B;  5CIU A;  2CZ6 B;  3CCL A;  3CC7 A;  4QQG A;  3M55 A;  3WVE B;  3OYB A;  5LJ3 d;  4PJO D;  3M5A A;  4J83 A;  4C0D C;  2IVW A;  1IRE B;  2A3L A;  3OYD A;  2XDB A;  3VUB A;  5GAN g;  2ZPF B;  3PIO A;  4X9C A;  5GAN 7;  3L2Q A;  4QQD A;  5GAM g;  3LYI A;  2L5Q A;  4F7U E;  1M9S A;  5KE2 A;  4XQ3 A;  3DB3 A;  3QZ9 B;  1DJ7 B;  4LDU A;  3M9Q A;  4M77 G;  3J7A F;  5IT9 E;  2X4X A;  1VQ6 T;  3OSS C;  2XKO C;  1G3Y A;  2E64 A;  2MWP A;  4M7A G;  4L59 A;  2VGM A;  1YJ9 A;  3G71 T;  3CPF A;  4N0A C;  2QI2 A;  3OYE A;  2DKG A;  4IUR A;  1VIE A;  4M75 E;  2DK3 A;  2QTX A;  1QW1 A;  3QKJ A;  3FJP A;  3JCM b;  1WJS A;  3DLM A;  1Q82 C;  3LGF A;  1KQ1 A;  2FL7 A;  4JLG A;  4PJO F;  4M7D A;  2FHD A;  2F69 A;  2E6Z A;  3BFM A;  5GAN d;  4JRP A;  4PJO C;  3MO8 A;  3HFO A;  5I2M A;  5GAM d;  5M9O A;  3RIR A;  3CCU A;  1D3B B;  2QQ9 A;  3MCA B;  1AHJ B;  4M7A B;  4FT2 A;  1JB0 E;  5GAN 3;  5FRN A;  2MAM A;  1O75 A;  1KQS S;  5LJ5 d;  2E12 A;  3A8O B;  4JRK A;  5FU6 B;  1SSF A;  3E9F A;  3CCQ T;  3VV0 A;  3OYJ A;  5GMK l;  2QEX A;  2DD5 A;  3G4S A;  4BAC A;  4O6J A;  3JCM h;  5A0L A;  3JCM f;  1QVF A;  4C5G A;  4ATO A;  5KCO A;  4HKE A;  2X4Y A;  1WJR A;  4A4E A;  3CCJ T;  3JB9 F;  4R56 A;  2QDY B;  2RHZ A;  4XTZ A;  2DTH A;  2ZZD A;  3L2R A;  3CPW S;  3CCM T;  3GPL A;  1LNX A;  1I81 A;  3G7Z A;  4J6Y A;  4M78 A;  4ZGJ B;  4JLI A;  4CRI A;  1ZBX A;  2OTL A;  4JS5 A;  3QYG B;  1G5V A;  2KAF A;  2JZ2 A;  2DZC A;  3VU3 C;  3J81 E;  2EKO A;  1NZ9 A;  3CBP A;  3FEO A;  4MMK A;  4WF2 A;  3SB2 A;  4PJO G;  2LT4 A;  4MZM A;  1OZ3 A;  1S72 A;  5GAO m;  3CD6 A;  1QP2 A;  2CS7 A;  3ZBD A;  2PVG B;  3VUZ A;  2LVM A;  3V7C A;  2RHI A;  1VQK A;  3FB9 A;  1BKB A;  1XQH A;  1XNI A;  2M16 A;  3PFS A;  4JS4 A;  2KK4 A;  4N4I A;  4OGC A;  2QQA A;  3FC3 A;  2XD0 A;  3GIB A;  2A7Y A;  3I56 A;  2E6N A;  4RKU E;  3OS0 A;  4ZN1 A;  3HL8 A;  4MML A;  1RL2 A;  4M75 D;  3OW2 A;  2DPP B;  2XID A;  5CVI A;  3LWH A;  1H64 1;  3BY7 A;  3S3N A;  4PJO B;  1KG1 A;  1W4S A;  1BIA A;  4J7I A;  3OA6 A;  4C92 A;  5GAN e;  2DO3 A;  3JB9 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...