4ME7A

Crystal structure of bacillus subtilis toxin mazf in complex with cognate antitoxin maze
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
105
Chain Sequence
MIVKRGDVYFADLVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQIRTIDKQRLTDKITHLDDEMMDKVDEALQISLALID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of mRNA Recognition and Cleavage by Toxin MazF and Its Regulation by Antitoxin MazE in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords mRNA interferase EndoA
total genus 23
structure length 105
sequence length 115
chains with identical sequence B, C, D
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4me7A00
1VUBA 4MDXA 4ME7A 5CKHA 3JRZA 5CQYA 4MZMA 5CQXA 1NE8A 4MZTA 5CK9A 2KMTA 5HKCA 3NFCA 5CKEA 3G7ZA 4VUBA 4ELYC 4MZPA 3VUBA 2VUBA 3HPWA 2C06A 5CKBA 5HK3A 4ELZC 5CCAA 5DLOA 5CO7A 3TCJA 3JSCA 5CR2A 1X75C 5CKDA 4HKEA 1UB4A 4OF1A 5HK0A 5CKFA 2MF2A 1M1FA
chains in the Genus database with same CATH superfamily
4AG2C 5IHIA 4F16A 1Y57A 2FPEA 1M5Q1 1SEMA 1SSFA 2CUBA 2AZVA 4BB7A 2MCNA 4KULA 2P0KA 4C92A 2DKGA 1VQLQ 1PG5B 1O9SA 1K9MC 2V8JA 4L5GA 2KEAA 2OX7A 1PKSA 4ZN1A 3A98A 2YSQA 3CCLA 3H9NA 3JCMd 3RERA 5D7UA 2ZPFB 4NL3A 1TS9A 2E4HA 2XKOC 1MMNA 1OV3A 3QSUA 1OI1A 2EYXA 5FU6B 3G71T 5I22A 3JB9F 4BUGA 3H41A 2RNAA 2E64A 2O88A 2KE9A 2O31A 2D8HA 2F69A 3J80E 1AOJA 1ZA2B 3OB9A 2SRCA 2MWOA 4J9IA 2K5LA 4M78B 4C8QC 2BKDN 4KBMB 3I56Q 4C92C 5GAN3 4E7IA 2RI5A 1X2KA 3E9GA 4C8QE 2DAQA 3NMZC 2OI3A 1Q86C 5CAIA 2R58A 3CMEQ 3CEYA 1BI0A 3FEOA 2LMJA 1WHHA 4OGEA 1MNEA 3I56A 2M02A 4M77E 5KCHA 3H8ZA 3FJ5A 1TUCA 4RKUE 2RHZA 3VS6A 2QQSA 4M75A 1PRMC 2AK5A 2EYYA 1YITT 3P8HA 5GAMe 2DIGA 2K9GA 1WHLA 2K5FA 4IUPA 1I8FA 3VV0A 1LCKA 2DTOA 3JB9I 1AZEA 2XK0A 3CBOA 3CCJT 1S1NA 2COYA 4AT1B 3QJYA 1HK9A 2NYSA 4PFPA 1JQQA 2ZAEA 2ROTA 1YJWQ 3JCMX 1KHIA 2QQBA 1YIJT 4RTWA 2J7IA 3M0UA 3NTHA 4B9WA 3OA6A 1OOTA 3HKSA 2M9UA 2RQVA 1M2VB 5DLQE 2A3LA 2QK0A 4D6WA 1GBRA 3OYLA 1BI1A 5KYXB 4PJOC 1WNLA 2PQWA 3VS1A 1GBQA 1X6OA 1N5ZA 1VQOQ 3X24B 2PZ1A 3I9QA 1SG5A 1I81A 2HNIA 1UDLA 4E7LA 2CP0A 3GNGA 4JS4A 1U3OA 1T3LA 3CPWP 3PIPA 4JLGA 3LH0A 5FU7B 3EG9B 2J05A 4XU2A 4LXCA 4JS5A 5J39A 2DJQA 2VXFA 4M78C 4C8QB 1BI2A 2EIFA 4ELZC 3EHRA 3H0IA 2RQUA 2DXUA 1G5VA 5GAN6 2K3BA 2G6FX 2YRVA 2J6FA 1VQMQ 2XDPA 1VQ6T 4IKFA 3FJPA 1YFNA 3UA7A 3NFCA 1KFZA 4IUQA 2OTLT 2SEMA 2KROA 4LUEA 2AT1B 1AVZC 4LDXA 2VXEA 2RJCA 4IURA 3CCUA 4JZ3A 3OBWA 4A4GA 2OTJT 5KYWA 1X69A 2FPFA 3JCMP 3J7AF 1OU8A 1QCNA 1IO6A 2Y4XA 1FXXA 5IXBA 2RI2A 3M4YA 2EBPA 2AIRB 3PVQA 5KYWB 3HFNA 4DOWA 5LJ3h 3JCMb 2DILA 2RA2A 4IUVA 1G3YA 1ZQ1A 4PJOF 1XNIA 3SWNA 4XU0A 4M7DG 4M75D 4KGXB 2L0AA 4M77B 4XU3A 4O6JA 1QQJA 4JRIA 3A8HB 1UHCA 3EGDA 3A8GB 4ANJA 2K6DA 3HRTA 2DRMA 1XTDA 1Y71A 5D6WA 3OYEA 2X3XD 3CMAA 5A0LA 1U06A 4HT8A 3OY9A 5GMKl 1H3HA 1YCYA 3QZ5B 3GNFB 5CIUA 2HAXA 1QW1A 1ZSZA 3VS4A 3RKXA 3HTRA 4E7KA 2E70A 2DO3A 5FLXE 3JSCA 4F17A 1Y7XA 1C1AA 2AZSA 5GAOr 3JCMV 2QG9B 4OMNA 4EMKC 4EIKA 3OYJA 4M78G 1MMDA 3VS7A 1FX7A 3IQLA 1YWPA 2AKLA 1G3TA 4OMMA 3CCLT 2LRQA 1B34A 1K4US 1PWTA 4A4HA 3REBB 1YN8A 3X28B 1YJNQ 3EG3A 1VA7A 4AFUC 3LW5E 4LDUA 1ZX6A 3VYGA 4C92G 2EJ9A 3C94A 4LUDA 4Z89A 2FB7A 3EG1A 3PNWC 5FW9A 3CCQQ 4ELYC 2JZ2A 1B34B 4Q5WA 3NTKA 1AWJA 1OULA 1PHTA 4C5HA 3RIRA 4FT2A 2CDTA 1VQNA 4J9EA 2R57A 1YITQ 4A53A 5GANg 2D8JA 1VQ6A 1IXDA 1BIBA 2DXBA 2DVEA 4J5YA 5GANf 1CSKA 4BE2A 4E7SA 3MP1A 4M77C 3CCJQ 4C92D 1M3BA 3OYMA 1VQ9Q 4M78F 2M16A 4M7DA 1G83A 4XTXA 2VKNA 1N6AA 4FYYB 4RTZA 2MMPA 1VQNQ 3UT1A 2PTKA 4HA8A 1WFWA 1JJ2P 1W2BP 2EQKA 1YHQQ 2DYBA 2RN8A 1OX9A 2XG8D 3T9NA 1N8RC 2EWNA 4FCYA 3RESA 2QA4T 5GAMg 4PJLA 1OPKA 2QAZA 2L3SA 1B7TA 1R0BG 5GAOl 2C0OA 2RB6A 1X01A 1K1ZA 2RJFA 1OPLA 2DXCA 2RHYA 3L1AA 3P8DA 4RCCA 1M27C 2JM8A 4A4FA 3UPUA 1MHNA 2CREA 4GLMA 4QQGA 2QEXA 3TVTA 5LJ5j 3CCVQ 3M0PA 5C6SA 2O4XB 3C95A 2OAUA 3M4GA 4ATOA 4C8QA 2LJ3A 1SF9A 2KRSA 1MGQA 2NUPB 3CCST 4M4ZA 3JCMh 3CBPA 2RM4A 2A36A 4BI8B 1Y07A 2LQNA 3VS0A 3QIIA 1WXTA 2ZPGB 3GF5A 5GMKm 2WSFE 5IXFA 1YJWT 5EG2A 1KHCA 3OW2A 2QGFB 1WXBA 1QMCA 4B6MA 5GAOn 3CCRT 2RMOA 1WQWA 4PJNA 2ZGWA 2RK1A 3HRUA 1PC0A 3OSSC 3OS1A 3QWXX 4DBQA 3VS5A 1K73R 2E12A 2QXFA 1VOMA 1IGQA 2W10A 4N4HA 3META 4DBHA 2FZCB 4M7DE 1QLYA 2C06A 2JNGA 3M57A 3C0CA 1WJQA 1PRLC 7AT1B 1WHJA 1JRIA 1BIAA 5DM7R 1IB8A 1D3BB 4M7AE 3HSBA 4AFSC 4JUVA 1QVPA 2QI2A 4HVWA 3MEUA 3EFOA 2DTIA 4MMLA 1VQ7A 3QZ9B 1RI0A 4IUUA 2EYZA 4JDSA 5GAMd 2W0ZA 4OGCA 4QKUA 3CMET 3EFRA 1NLOC 4ZGJB 3OBYA 1F1BB 3H6ZA 3OYKA 3L2QA 1YCSB 4JJCA 2EAYA 2LVMA 4E7ZA 1SRMA 2COWA 1D1CA 4OMPA 3MKDA 1Y0MA 5CKHA 3L2ZA 2P84A 2OTJA 1W70A 1WJRA 2P4TA 4Z88A 4YTLA 4JJNK 2X3WD 3FC3A 1M90C 1SSHA 1W1FA 3DB3A 4ZTJA 3RKWA 5CKEA 1MV3A 3F70A 4HVVA 3HPWA 1FMVA 5D6YA 4E6RA 3AHUA 2KXCA 1NEBA 2KSSA 1Y96A 1JEGA 1VIFA 2ESWA 4PJJA 2RK2A 2RD1A 2FG0A 5I11A 2DTHA 3PFSA 5GMKh 2HKQB 1CKBA 5L8RE 3OYHA 2BE9B 1D1AA 4LN2A 2KR3A 4J6XA 3QPHA 2QDLA 2VB6A 2LCLA 1VYUA 3EGXA 2R5MA 1Q95G 2H3JA 1K8AR 4XTUA 2DYIA 3L2VA 3PMIA 1MNDA 1I5LA 3EFSA 3FRNA 3OS0A 1MUZA 4C0GA 2A08A 1KQSS 2V26A 2PNIA 4C5IA 3NGPA 5LJ3d 2ROLA 5GMKj 1IZ6A 3MJXA 4C8QG 2M0YA 1I5OB 2QGGA 5GMKe 2O4XA 1G2BA 1HJDA 3SD4A 3E9FA 5GAN4 2I2LA 1C6VX 1OU9A 2CKKA 4PJOB 3KUFA 4HCZA 1Q81C 2NUZA 4KRTA 2EKOA 1NBEB 2YRDA 1ZA1B 2DZCA 2DBKA 3GIBA 4MDXA 2DIQA 3G6ET 5KYYB 2F2VA 3MO8A 4LD6A 1IHWA 4PFZA 3QDRB 5AT1B 1QVGS 1NYFA 4PJOE 1NG2A 4PL6A 1KQSA 1Z9ZA 2LC4A 2ZPIB 4FL6A 1QKWA 1VQMT 5CO7A 2MAMA 3QYGB 3WVDB 4JZ4A 2O9SA 3SHWA 1H92A 1BCOA 2OTLQ 1FMWA 2LP5A 4AFQC 1QCFA 3OMGA 2DL8A 4M7AB 4CRIA 2F5TX 2RH2A 1AHJB 2E41A 4RG2A 1RL2A 5FROA 1IHVA 2JS2A 3JV3A 1JU5C 2F2WA 2DF6A 3OYCA 1P92A 3QWYA 1H8KA 5KYNA 1YJ9A 3TQ7P 4R56A 3CC7A 2JS0A 1MMAA 1NEGA 2LT4A 1YBYA 4VUBA 2HSEB 1M4ZA 1VQ4T 1WGSA 4XTVA 1RABB 4OB3B 2COZA 2DFUA 1TTHB 1LOJA 2DEQA 5HK0A 2X4JA 3CPFA 1Q81U 3CMAT 3JB9D 3EGDB 5FWCA 3OYIA 1WPYA 4QVDA 4KUDK 3LWHA 4OMFB 1GCQC 2Y4YA 4JRPA 1YIJQ 1ABQA 2JW4A 1T3SA 2DETA 3ASKA 1T0HA 3MP6A 4FU6A 5KYUB 2HEQA 3CCEA 2XICA 1K9MU 1VUBA 1WXUA 5IH2A 1QVFS 3TU4K 2D6FA 3CCMT 1TSFA 2WSCE 2QEXT 2MPXC 5GAN5 5CK9A 2HD0A 3M0TA 1TOVA 5GMKi 2LNVA 3ZEHA 1WI7A 3BDLA 1LJOA 5M9OA 5CVIA 4E7HA 1GL5A 4IIOA 2L3QA 2DNUA 1OQKA 1NYGA 2H8HA 2F1LA 4OF1A 4BI3A 1LNXA 2BZXA 1JJ2A 1KG1A 1HSQA 3JCMc 2DERA 4M75G 3OW2S 3OYNA 1UGVA 4FT4A 4XK8E 2MK5A 2E1HA 4J7FA 3QXEB 4WF2A 4IUTA 1W6XA 5FRNA 2F5KA 4PLIA 2ED0A 4N4GA 1LPLA 3GBQA 3I5RA 2L3PA 3QDFA 4LDVA 4X9CA 4HCBA 1Q7YR 3THKA 1N8RR 2VYTA 4OMLA 3RMQA 3OYAA 2QA4A 3A8LB 3SWNB 3BW1A 2RQWA 1GRIA 1D0ZA 1EIFA 3CD6A 4M77D 2JTEA 3REAB 1UHFA 5GJWB 3KXTA 2XDBA 5KYUA 2B86A 1NPPA 3NTIA 4DBFA 5GJVB 4F04B 1KQ1A 5CKBA 1Q86U 3TEEA 2K3YA 5GANd 1M8MA 1W2BS 1S72A 4Z8AA 4X9DA 4LNPA 3CQTA 2FO0A 2IIMA 5LL6S 1I07A 4GBQA 1BB9A 2O2OA 3MCAB 1J3TA 3JB9G 1TWBA 2DMOA 2LQ8A 3CCMQ 3BDUA 3QO3A 4QVZA 3M0RA 1IGUA 5CKFA 1RUWA 5IT9E 3V8LA 2LQKA 4CC7A 4FYXB 1QP3A 3QBYA 1I4K1 1ZSGA 4JRQA 3ZL7C 2DL4A 2X35A 4PLLA 2GBQA 2K3XA 1UG1A 2KRMA 1NM7A 3CCVT 1K9AA 5GAMh 1BK2A 3SEMA 1RLPC 3KFVA 4EMGA 2KQWA 4FYWB 3EGXB 2WSEE 2GTOA 2Y90A 1BCMA 3V7CA 5KYXA 1ZHIA 1X2QA 1M90R 2FZKB 2KDSA 4D8DA 1RADB 1YJNT 9ATCB 2HL5C 3G4SA 1VQKA 1M1KC 1TU0B 4ZGDB 1NJIR 1K0SA 3LH5A 1VQ8T 5DY9A 2NWMA 1WX6A 4HCKA 3I35A 2ZPHB 2CZ1B 5KCOA 2JJ9A 5I2MA 2M0OA 3MHXA 3I55Q 3CCSQ 2KBTA 3HP9A 3OYYA 4BE0A 1VQ8A 2YHTA 1YI2A 2HQXA 4QT7A 2E5KA 2MIOA 4Y92A 4EMKA 3VUZA 5I21A 2BZ8A 5LJ3f 1V29B 1GFCA 3P8BB 2CP7A 1KD1C 3PIOA 4J83A 3TSWA 5GAOp 3JCMQ 4J9HA 4ZNXA 4F7UF 2LJ0A 1M8VA 1M90U 1D0XA 3OYDA 2DX1A 2RI3A 1WDXA 4J9BA 3BFMA 4C0FA 1RACB 4C5GA 3SDZA 3MPUB 2CZ6B 2L89A 1U1TA 2EJGA 2ENMA 4J9GA 5ECAA 3TSZA 3ULRB 1VQOT 4PKCC 2LDMA 2VWFA 3G7ZA 2FVUA 3V8KA 3Q1JA 1M1KU 2VV5A 3X26B 2EFIA 3FIFA 2EQIA 1X43A 3JAME 1UUEA 3RMSA 1RAEB 2RQRA 3OYGA 2E5QA 1RAFB 4LE9A 3CC4T 5LJ5h 3U23A 3CCET 2LCSA 2A0FB 3EG9A 1ZUYA 3M53A 1M30A 1JJ2S 4Y28E 1UGSB 4M78D 1VQPT 4J9FA 3RBBB 2M1HA 2NUPA 4KGVB 4C0DC 4RTVA 4CC2A 1YI2T 2CH4W 4FIBA 3OQ5A 1IRXA 2KRNA 4CC3A 3CC7Q 2EGCA 4RUGA 1M1KR 2L3RA 4OMQA 1YJ9Q 1M2OA 3CC2T 3JRZA 2EJFA 2DD4A 2KVQG 1V76A 2E10A 2ZPBB 3ZFJA 2JTMA 1VQ5T 4M7AD 2RHXA 4J6YA 2PVGB 4EPCA 3CPWS 4M78A 3BE3A 5KE3A 2CP6A 5GAN2 2CP5A 1RAIB 3RKYA 1N8RU 1Q82U 1BBZA 1TUGB 2I0NA 3EH1A 2JM9A 1T0JA 3LGFA 2CZ7B 3CC2A 4Y91A 2OTLA 1QWEA 2GF7A 1QKXA 1N9SA 5LJ3e 4DA4A 1HXDA 2H3EB 5A0DA 1JB0E 4AMCA 5IHNA 2K79A 4RMOA 4PNOA 4RTUA 3G71A 2L5QA 4A4EA 3R6OA 3G6EQ 4FSXA 1VIEA 2PVOB 3J81E 5LJ3j 2DK3A 3CD6T 4PK4A 1ZBJA 2ZPEB 4R55A 3PVLA 2HBWA 3OSVA 3S3OA 4CI0C 1FMKA 1VQ7T 4N4IA 2KNBB 2YDLA 5AYFA 1MV0B 1R8OB 2JXBA 2K2VA 3DKMA 2V8IA 4RCBA 2MYSA 2PVDB 2BZYA 4M78E 6AT1B 5GAMj 4II1A 5CR2A 1BU1A 2ZZDA 2QASA 2E6ZA 3TREA 5L23A 2EPDA 1VQPQ 1EFNA 1ZSZB 2KT1A 2YUOA 4MDWA 1NLPC 1AWWA 2EQMA 1D1BA 4E7JA 4FW1A 1KD1U 4M7AC 3E1SA 3DB4A 1GFDA 2CH4A 1U8RA 1Q7YC 2A37A 1SHGA 2DE0X 1WIEA 2AKKA 4M7DC 1BKBA 2FRWA 5LJ5e 1KD1R 4BY6C 1PKTA 4M77A 3QHSA 3RR6A 3L42A 3OMCA 2NLUA 3JCMJ 4N0AC 3CCMA 4JJBA 1UJ0A 2RHIA 1WA7A 3R6NA 5FRMA 3CCRQ 3S3MA 2RJDA 2ZCFB 4L6V5 1HD3A 1YNZA 3TCJA 1PSFA 1K8AC 4BD3A 1KSWA 1ZBXA 1S72Q 2XMFA 4LD9K 1BI3A 4XTWA 2KYBA 1VQ4Q 5KH6A 4WTOB 4M7AF 5GANh 3GPLA 3FDRA 4D8KA 1WHKA 3S6WA 2KMTA 2GFAA 4NL2A 3AT1B 3JB9J 1VQ5A 3M9QA 2BIVA 2RHUA 4M77F 2FYKA 5KE2A 1KC8U 2XD0A 1DJ7B 4Z02A 1VQ7Q 2NUTA 3L2WA 3FB9A 1GCQA 4DEXA 3EG0A 5C0MA 2MF2A 1JXMA 2CT4A 3VJPA 3G6EA 3JCMW 2HL3A 1D0YA 1MMGA 3G71Q 4N0AA 2QTVA 2IPOB 4J9DA 1Q82R 2V1RA 1E7OA 1G3SA 2P0PA 3N5BB 2B8AA 4M7DD 2K4YA 3G4ST 1VQKT 1WHGA 1K73C 3OYFA 3M59A 2O01E 3CC4A 1E6HA 1YWOA 2D0QB 2IVWA 3QJ6A 3I56T 4B9XA 4J7IA 2WACA 3H0FA 2CSQA 5A2QE 4DQ2A 4ZTFA 3EG2A 2DL3A 2E6NA 2EGAA 2GCXA 4IIMA 3JB9H 1KC8R 1TG0A 2DJZA 1M2VA 3X20B 1K76A 5I2SA 2FL7A 3A1PA 3I55T 5GAMf 3GLXA 1ABOA 2EQJA 5CKDA 3SWNC 2KK4A 2X4WA 2YLBA 1K8AU 4M7DF 3BY7A 2KAFA 3GOXA 2HDAA 2DZ9A 1AD5A 3LYIA 1O75A 4OB1B 3JCMf 4A54A 1PD1A 4F7UE 1WQ7A 1AZGB 5GAN7 2EQUA 2EKHA 1QCOA 2MWPA 3QKJA 2C0TA 4C5EA 4ZGEB 4BI4A 3HFOA 2OAWA 5EC7A 3JCMg 3M58A 1KIKA 4OVAA 2HZYA 4RTTA 4E2FB 5CQYA 2YT6A 1H3ZA 3WXMB 3M56A 1ACMB 3RUXA 1QVGP 1D3BA 4XTZA 3X25B 5LJ5g 4KH1B 1PM3A 1NJIC 1Q81R 1I1JA 2CYZB 1AEYA 2V8KA 1QP2A 2K57A 3I5SA 2X51A 2QQ9A 1M9SA 2RF0A 4MZMA 2RPNA 1C0MA 2VASA 4ZN3A 5HK3A 1ZUUA 5KYYA 1G8XA 3CC4Q 2HQHA 4AFZC 1ZLMA 5IN1A 1VQ9A 1BYMA 2DVJA 1YP5A 1FYNA 1OYXA 3EH2A 3E19A 4PJOA 3CCJA 2GGRA 2J06A 1M1GA 1OZ2A 1X27A 1YI2Q 1VQ8Q 3A8OB 3CBMA 1R0CB 1KQ2A 1GCPA 3VKIA 1NJIU 2Z0WA 3CCSA 1AWOA 2GQVA 1RLQC 3UATA 2VUBA 2R5AA 3EHQA 1VQ6Q 3QUIA 3H0HA 4M75B 4QQ6A 4TVRA 1YITA 3CXCP 1KC8C 4E47A 1ZSZC 2X4XA 4GY5A 1VQ5Q 1M1FA 1QVGA 1R77A 2DXTA 5J3BA 3PMTA 3CXCA 1VQLT 4BE1A 1VQ4A 2EW3A 3V8JA 1K0XA 4MMKA 2KY9A 1JXOA 3MP8A 2XDDA 4HT9A 4ESRA 3DLLA 1UB4A 3C12A 4JPBW 1XJWB 2EGEA 2J6KA 3PE0A 3CCRA 2JMCA 1YJNA 2JT4A 2YUQA 3INZA 3PT9A 4NOYA 2D0NA 1U5SA 1UGPB 3UWNA 1B3QA 1KK7A 2VVKA 4HXJA 2K7AA 1U1SA 8ATCB 5J26A 5FU6C 3QYHB 3UF4A 5GAOm 3SB2A 2FHDA 2JN0A 4F7UG 2DD5A 4CC4B 1UGQB 2IG0A 2J6OA 4LDWA 1AT1B 1D09B 3KBGA 1Q86R 2D9TA 4KUIA 4UC4A 4QVCA 2A7YA 2JVVA 3VYHB 1OZ3A 2DL7A 3EAEA 4C92E 5A0GA 4MZPA 3VUBA 1VQPA 2RQTA 3MEWA 2JOYA 2KT8A 1UE9A 4FYVB 2O9VA 2DM1A 3CPWA 2JUFA 1G3WA 3PTAA 2FEIA 1WJSA 4C0ZA 1OEBA 2FZGB 3PGGA 4C8QD 4EDUA 2EYQA 1GXIE 3EGUA 3ME9A 2X4YA 4NS5A 2V1QA 4XU1A 2PUKB 4KGZB 2YXYA 4C0DB 2XU8A 2AHJB 2MI6A 4RG8A 4EMHA 1UGRB 1KJWA 1N9RA 2CP2A 1A0NB 4J6WA 2FPDA 3VRYA 3CCUQ 1EZZB 3CC7T 8AT1B 1I0CA 2KXDA 2D1XA 2CUDA 1QVFA 2YWWA 3CC2Q 3ER0A 2LX7A 2PU9B 3OYBA 5DLOA 4M7AA 4J8OA 4HKEA 4FM4B 1VQMA 4R0KA 4PJOD 1K9MR 1E6GA 1N27A 2DRKA 1IREB 2QQRA 4HVUA 4QQDA 3OS5A 4J9CA 1ZUKA 2CGHA 3URGA 2KGTA 3HHTB 2HCKA 1ARKA 4OMOA 4C8QF 1X6GA 2GTJA 3GP8A 1Q82C 1SRLA 4F14A 1VQOA 3VS2A 1TH7A 1PD0A 3RDVA 1EX4A 1SKUB 2DBMA 1OX8A 3CCVA 2HBPA 1PCXA 5CCAA 2QEXQ 2EYWA 1FWZA 1HYOA 3OW2P 1WYXA 4ORZA 5FWBA 1YJWA 3LX7A 1CKAA 2K5IA 4XQ3A 4QW2A 2JMAA 4MZTA 2LCCA 4RTYA 3VU3C 1AWXA 3M5AA 1LVKA 4AG1C 4JRKA 4M7DB 1WLPB 2LTOA 3VRZA 1QVFP 5LJ5f 2LT1A 4DOVA 4BY6B 4A4KA 4DEYA 5GAN8 2GQIA 4O5VA 1YHQA 4GLKA 5HCKA 1M3AA 2KI7A 3DLMA 2LNHB 5CQXA 2FRYA 1NZ9A 1YJ9T 2GFUA 3V7SA 3VS3A 3LGLA 4BDYA 1Z9QA 4DBRA 1WHMA 4F7UA 2QTXA 3UA6A 3SFMA 3O5ZA 3CMEA 4OB0B 1JO8A 1Q7YU 3I55A 5LJ3g 2XI9A 4PJOG 4M75E 2PUOB 3NPFA 2G3RA 3RNJA 2QDYB 1TUDA 3MEAA 2XHCA 4X34A 3M0QA 3EFOB 4FW2A 1UFFA 2DA9A 4C92B 1JBMA 1UEBA 4JJDA 4EMKB 2ED1A 2P0QA 3QG1A 2HKNA 3L2RA 2YRCA 4V2SA 3G4SQ 1VQKQ 5GAOq 5GANj 4XTYA 4M77G 1VYVA 3O8VA 4M75F 1W2BA 1RAAB 3CCQA 2ATCB 1RAGB 2E3HA 2BUDA 5HY6A 2BTTA 3G1JA 3LWIA 3CXCS 2LJ1A 3JCMe 3CCLQ 3CCQT 2ABLA 5FU7C 3OS2A 2EVRA 1RI9A 3M0SA 2VC8A 1B07A 1XQHA 2C0IA 1VQLA 1X6BA 2OJ2A 1TXQA 2K2MA 5LJ5d 5IHKA 2HQEA 5D6XA 3D7SB 1PSEA 2CP3A 3NHNA 2GNCA 2VGNA 2BE7D 2QYZA 2RO0A 3M54A 4PFOA 4M7AG 3HL8A 1V1CA 4OB2B 4XAXB 4A63B 2X9HA 4BDZA 2OTJQ 3CMAQ 2HMAA 2QQAA 4WCIA 2JTFA 1VQ9T 2A28A 3A8MB 3L2UA 3CCUT 4HCCA 2LZ6B 5GANe 2E3IA 1UECA 2YLCA 1KQSP 3FLGA 4F7UB 1M3CA 1Y96B 2CT3A 1VQNT 2CS7A 1QWFA 1PNJA 2LX9A 4ME7A 1W4SA 4KT0E 4LDYA 2NUTB 1S72T 3CD6Q 1H641 4KH0B 3WVEB 1YHQT 2CSIA 2P4RA 2QA4Q 3UDCA 4FSSA 2CZ0B 4X1VA 2DPPB 1K73U 4JLIA 3V7RA 1UJYA 4BACA 5IAYA 1RAHB 3HRSA 1WZOA 3A5ZB 2DEUA 2MOXA 1NPRA 4P5NA 2ECZA 2KYMA 3ZBDA 2L2PA 2L8DA 4K11A 3LLRA 3S3NA 1UTIA 2F2XA 2E65A 4PJMA 2HSPA 2LQWA 1VYTA 3C4SA 1NE8A 3M55A 4C92F 3E2UA 5HKCA 1SPKA 2YUNA 3MEVA 4L59A 2YUPA 2XIDA 2M51A 3CCEQ 4M75C 1SHFA 2VGMA 1X75C 1XOVA 4OP0A 1YIJA 2DLPA 2RJEA 2DL5A 4RTXA
chains in the Genus database with same CATH topology
5I2MA 2DXTA 5J3BA 3PMTA 4BI8B 1Y07A 2M0OA 3MHXA 3CXCA 3QIIA 1VQLT 3HP9A 2ZPGB 4BE1A 3GF5A 3OYYA 1M5Q1 5GMKm 4BE0A 1SSFA 1VQ8A 2YHTA 1YI2A 2WSFE 2HQXA 4BB7A 1VQ4A 1YJWT 5EG2A 1KHCA 3OW2A 4KULA 2P0KA 3V8JA 4EMKA 4C92A 2DKGA 4MMKA 3VUZA 2KY9A 5I21A 3MP8A 1O9SA 2XDDA 5LJ3f 1K9MC 4HT9A 5GAOn 3CCRT 3DLLA 1V29B 1WQWA 2V8JA 4L5GA 1UB4A 3C12A 3P8BB 2ZGWA 2RK1A 3HRUA 1KD1C 4ZN1A 4J83A 3PIOA 3OSSC 3CCLA 3OS1A 3CCRA 3JCMd 5GAOp 1YJNA 3JCMQ 4F7UF 3INZA 2E12A 3PT9A 4NOYA 2QXFA 3RERA 1UGPB 1M8VA 2ZPFB 4NL3A 3UWNA 1M90U 4N4HA 3META 3OYDA 2XKOC 2RI3A 2C06A 3QSUA 1OI1A 4M7DE 1U1SA 2JNGA 5FU6B 3G71T 3BFMA 4C0FA 3M57A 5J26A 4C5GA 5FU6C 2HAXA 3SDZA 3QYHB 3JB9F 5GAOm 1WJQA 3SB2A 2FHDA 4BUGA 5DM7R 1JRIA 1BIAA 2JN0A 4F7UG 2DD5A 2CZ6B 2L89A 1D3BB 4M7AE 1U1TA 2E64A 3HSBA 2EJGA 1UGQB 2IG0A 4JUVA 1QVPA 2QI2A 4LDWA 3MEUA 2F69A 3J80E 3KBGA 2DTIA 4MMLA 1VQOT 1VQ7A 3QZ9B 4PKCC 1RI0A 4IUUA 2D9TA 2LDMA 4JDSA 4KUIA 2A7YA 4UC4A 2JVVA 3OB9A 3VYHB 4OGCA 4QVCA 1OZ3A 3G7ZA 4C92E 3EAEA 2FVUA 5A0GA 2MWOA 3CMET 4MZPA 3VUBA 3EFRA 1VQPA 2K5LA 3V8KA 3Q1JA 4M78B 2BKDN 4C8QC 4ZGJB 4KBMB 1M1KU 3OBYA 2VV5A 4C92C 3X26B 2EFIA 2JOYA 3FIFA 3H6ZA 2RI5A 3MEWA 5GAN3 3OYKA 3L2QA 2EAYA 4E7IA 3E9GA 4C8QE 2DAQA 3JAME 3CPWA 1Q86C 2JUFA 2LVMA 1G3WA 5CAIA 2R58A 3PTAA 3RMSA 3CEYA 1BI0A 3FEOA 1WJSA 3OYGA 4C0ZA 2E5QA 4OGEA 5CKHA 3L2ZA 3CC4T 5LJ5h 2OTJA 1WJRA 2P4TA 4YTLA 4JJNK 3CCET 3I56A 4M77E 3M53A 5KCHA 3FC3A 1JJ2S 3H8ZA 3PGGA 4RKUE 4C8QD 4EDUA 4Y28E 3DB3A 4ZTJA 1M90C 1UGSB 2EYQA 2RHZA 4M78D 3RKWA 1VQPT 5CKEA 1GXIE 2QQSA 3F70A 3HPWA 2M1HA 3ME9A 4M75A 2X4YA 4NS5A 5D6YA 3AHUA 4XU1A 4C0DC 2PUKB 1YI2T 4FIBA 1YITT 2KSSA 4C0DB 1Y96A 3OQ5A 2XU8A 3P8HA 5GAMe 1VIFA 2DIGA 2AHJB 2MI6A 4RG8A 2RK2A 2RD1A 2L3RA 4EMHA 1UGRB 1N9RA 2DTHA 3CC2T 2K5FA 4IUPA 4J6WA 3PFSA 1I8FA 5GMKh 3JRZA 5L8RE 2EJFA 3VV0A 3OYHA 2DTOA 3JB9I 2DD4A 5GAMd 3CC7T 2KVQG 4J6XA 2E10A 2ZPBB 3QPHA 3ZFJA 2XK0A 2JTMA 2LCLA 1VQ5T 4M7AD 2RHXA 4J6YA 2PVGB 4EPCA 1QVFA 3CPWS 4M78A 3CBOA 2R5MA 5KE3A 2H3JA 3CCJT 3ER0A 5GAN2 2PU9B 4XTUA 3RKYA 3OYBA 1N8RU 3L2VA 3PMIA 5DLOA 4M7AA 1Q82U 3QJYA 4J8OA 1HK9A 4HKEA 1I5LA 4FM4B 1VQMA 3EFSA 3LGFA 2CZ7B 3JCMX 3FRNA 1KHIA 3OS0A 3CC2A 4PJOD 4Y91A 4C0GA 2QQBA 1KQSS 2OTLA 2GF7A 1N27A 4C5IA 1YIJT 3NTHA 5LJ3d 4B9WA 3OA6A 1IREB 1N9SA 2QQRA 3HKSA 5GMKj 5LJ3e 4DA4A 1IZ6A 1HXDA 4C8QG 2M9UA 5A0DA 1JB0E 5DLQE 4QQDA 2A3LA 3OS5A 5GMKe 2O4XA 2CGHA 3URGA 4RMOA 4PNOA 4D6WA 3G71A 3HHTB 3SD4A 3E9FA 2L5QA 4A4EA 5GAN4 3OYLA 3R6OA 2I2LA 4FSXA 1BI1A 1VIEA 2PVOB 4PJOC 1WNLA 3J81E 2PQWA 5LJ3j 2DK3A 2CKKA 3CD6T 4PJOB 3KUFA 4HCZA 1Q81C 1VQKA 1X6OA 3X24B 4C8QF 2ZPEB 2EKOA 4R55A 1I81A 3GP8A 2DZCA 1Q82C 2HNIA 3GIBA 4E7LA 3OSVA 3GNGA 3S3OA 4MDXA 4JS4A 2DIQA 3G6ET 4CI0C 3PIPA 1VQOA 1VQ7T 3MO8A 4N4IA 4JLGA 3LH0A 4LD6A 5AYFA 5FU7B 1QVGS 3QDRB 4XU2A 4JS5A 1TH7A 5J39A 1R8OB 4PJOE 2K2VA 4PL6A 2VXFA 4M78C 4C8QB 1BI2A 3DKMA 1KQSA 2V8IA 2EIFA 4RCBA 3CCVA 2LC4A 2HBPA 2PVDB 2ZPIB 4FL6A 4M78E 4ELZC 5CCAA 1VQMT 5CO7A 2MAMA 2DXUA 1FWZA 3QYGB 5GAMj 4II1A 5CR2A 1G5VA 5GAN6 3WVDB 2ZZDA 2E6ZA 3TREA 2YRVA 1YJWA 3LX7A 4MDWA 3OMGA 2K5IA 2XDPA 4M7AB 4XQ3A 1VQ6T 2EQMA 4E7JA 4CRIA 1KD1U 4QW2A 4M7AC 4IKFA 1QVGA 4MZTA 3FJPA 3E1SA 2LCCA 3DB4A 3NFCA 4IUQA 2F5TX 2OTLT 2RH2A 3VU3C 1U8RA 1Q7YC 1AHJB 3M5AA 2E41A 4RG2A 4LDXA 1RL2A 2VXEA 5FROA 2RJCA 4JRKA 1BKBA 4M7DC 4M7DB 4IURA 2LTOA 5LJ5e 4BY6C 5LJ5f 3CCUA 3OYCA 2LT1A 4M77A 4BY6B 4A4KA 1P92A 4DOVA 5GAN8 3QHSA 3OBWA 4A4GA 4O5VA 1YHQA 4GLKA 3L42A 3OMCA 2OTJT 2NLUA 3JCMJ 4N0AC 1YJ9A 3CCMA 3JCMP 3J7AF 3DLMA 4R56A 2RHIA 3CC7A 5CQXA 5FRMA 3S3MA 2RJDA 1NZ9A 2Y4XA 1FXXA 2LT4A 2ZCFB 1YJ9T 2GFUA 1YBYA 4L6V5 4VUBA 3V7SA 1M4ZA 2RI2A 3M4YA 3LGLA 4BDYA 1VQ4T 3HFNA 1WGSA 4XTVA 4DOWA 5LJ3h 4OB3B 4F7UA 3JCMb 2RA2A 4IUVA 3TCJA 1G3YA 1ZQ1A 1PSFA 1K8AC 4BD3A 4PJOF 1LOJA 1XNIA 2DEQA 1ZBXA 5HK0A 3SWNA 2X4JA 2QTXA 4LD9K 1BI3A 3CPFA 4XTWA 4M75D 4XU0A 3SFMA 1Q81U 3CMAT 4M7DG 4M77B 4XU3A 3JB9D 4O6JA 3OYIA 4JRIA 3A8HB 5KH6A 3A8GB 3CMEA 1WPYA 4M7AF 4OB0B 4QVDA 3HRTA 4KUDK 1XTDA 1Y71A 5GANh 3LWHA 5D6WA 3OYEA 3GPLA 3FDRA 1Q7YU 3I55A 3CMAA 3S6WA 5A0LA 5LJ3g 2KMTA 4HT8A 4OMFB 3OY9A 2GFAA 2Y4YA 5GMKl 2XI9A 4NL2A 1YCYA 4M75E 2PUOB 3GNFB 3QZ5B 5CIUA 1QW1A 4PJOG 4JRPA 2G3RA 2BIVA 2QDYB 3M9QA 3JB9J 2RHUA 3RKXA 1VQ5A 3MEAA 2FYKA 2E70A 2XHCA 3ASKA 4M77F 1DJ7B 4X34A 5KE2A 4E7KA 1KC8U 4Z02A 2DO3A 3MP6A 5FLXE 3JSCA 3L2WA 4FU6A 4C92B 1Y7XA 3FB9A 1JBMA 3CCEA 5GAOr 1UEBA 4EMKB 2XICA 3JCMV 2P0QA 3QG1A 4EMKC 2MF2A 5C0MA 3OYJA 3L2RA 3VJPA 3G6EA 1K9MU 3JCMW 4V2SA 1VUBA 4M78G 1QVFS 5GAOq 3TU4K 4N0AA 2D6FA 3CCMT 5GANj 4XTYA 1FX7A 2WSCE 4M77G 3O8VA 2QEXT 5GAN5 5CK9A 2HD0A 1G3TA 4M75F 1G3SA 1W2BA 5GMKi 3CCQA 2LNVA 3ZEHA 2P0PA 3BDLA 3CCLT 2LRQA 1LJOA 3N5BB 2B8AA 4M7DD 2BUDA 1B34A 2K4YA 5HY6A 5M9OA 3G4ST 1VQKT 5CVIA 1K73C 3OYFA 3M59A 4A4HA 4E7HA 2O01E 3LWIA 3CXCS 3CC4A 3JCMe 3X28B 4BI3A 2D0QB 4OF1A 2IVWA 1LNXA 3QJ6A 3LW5E 4LDUA 1JJ2A 3JCMc 1KG1A 3VYGA 3CCQT 4M75G 3OW2S 4C92G 3OYNA 3I56T 4B9XA 4FT4A 4J7IA 2WACA 4XK8E 5FU7C 2EJ9A 3C94A 5A2QE 4DQ2A 3OS2A 4ZTFA 4J7FA 2E1HA 2FB7A 2E6NA 2GCXA 3QXEB 4WF2A 4IUTA 5FRNA 3JB9H 2VC8A 1VQLA 1XQHA 3PNWC 2F5KA 4ELYC 2JZ2A 2DJZA 4PLIA 4N4GA 3X20B 5I2SA 2FL7A 1B34B 5LJ5d 4Q5WA 4LDVA 2HQEA 3NTKA 4X9CA 5D6XA 3I55T 4HCBA 5GAMf 4C5HA 1PSEA 3GLXA 5CKDA 2EQJA 2VYTA 3RIRA 3RMQA 3SWNC 2KK4A 3OYAA 2X4WA 2YLBA 4FT2A 2QA4A 3A8LB 1K8AU 3BY7A 2KAFA 3SWNB 4M7DF 3BW1A 2VGNA 3GOXA 2RO0A 2DZ9A 1VQNA 3M54A 2R57A 1EIFA 3LYIA 3CD6A 4M7AG 1O75A 4M77D 4A53A 5GANg 3HL8A 4OB1B 3JCMf 4A54A 3KXTA 2XDBA 4OB2B 4XAXB 1VQ6A 4F7UE 1WQ7A 1NPPA 3NTIA 4BDZA 1KQ1A 5GAN7 1BIBA 2EQUA 2DXBA 2QQAA 1VQ9T 2JTFA 5CKBA 2DVEA 2MWPA 3A8MB 3L2UA 3QKJA 3CCUT 4C5EA 4ZGEB 3TEEA 1Q86U 4HCCA 2K3YA 4BI4A 3HFOA 5GANe 2YLCA 4J5YA 5GANf 5GANd 3FLGA 3JCMg 4F7UB 1Y96B 3M58A 4BE2A 1W2BS 3MP1A 4M77C 4OVAA 1VQNT 2CS7A 1S72A 4C92D 3OYMA 2LX9A 4M78F 4X9DA 4ME7A 2M16A 4M7DA 5CQYA 4XTXA 1W4SA 4KT0E 5LL6S 3WXMB 1H3ZA 3M56A 4LDYA 1N6AA 3RUXA 1D3BA 1S72T 1H641 2MMPA 4XTZA 3X25B 3WVEB 5LJ5g 1YHQT 3MCAB 3UT1A 4HA8A 3JB9G 1NJIC 3UDCA 2CZ0B 2CYZB 2DPPB 1K73U 2LQ8A 4JLIA 2EQKA 3BDUA 3V7RA 4BACA 2V8KA 3QO3A 5IAYA 2XG8D 1QP2A 4QVZA 3T9NA 1N8RC 2EWNA 2K57A 5CKFA 3RESA 2QA4T 5IT9E 3V8LA 2QQ9A 2LQKA 1M9SA 5GAMg 1QP3A 3HRSA 3QBYA 3A5ZB 4MZMA 1I4K1 1NPRA 4P5NA 3ZBDA 4JRQA 5GAOl 2X35A 4PLLA 2K3XA 2RB6A 1X01A 2L8DA 4ZN3A 5HK3A 2RJFA 2DXCA 3LLRA 2RHYA 3L1AA 3P8DA 4RCCA 3CCVT 2ZPHB 5GAMh 5IN1A 4EMGA 2KQWA 2WSEE 4A4FA 3V7CA 2Y90A 3UPUA 1MHNA 3S3NA 1VQ9A 1BYMA 4QQGA 1ZHIA 2E65A 1OYXA 2KDSA 3E19A 3CCJA 4PJOA 2QEXA 1M1GA 1OZ2A 5LJ5j 3C4SA 1NE8A 3A8OB 3M55A 4C92F 3CBMA 5C6SA 1YJNT 1KQ2A 2O4XB 3VKIA 5HKCA 3C95A 3G4SA 3CCSA 1NJIU 3MEVA 1M1KC 4L59A 2GQVA 4ZGDB 2XD0A 2VUBA 2OAUA 2R5AA 3M4GA 2XIDA 4ATOA 4C8QA 3QUIA 4M75C 1VQ8T 1MGQA 4M75B 4QQ6A 5DY9A 3CCST 2VGMA 4TVRA 1X75C 3JCMh 1XOVA 1YITA 3CBPA 1KC8C 4OP0A 4E47A 2X4XA 4GY5A 2RJEA 1YIJA 2RM4A 2CZ1B 1M1FA 5KCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VUB A;  4MDX A;  4ME7 A;  5CKH A;  3JRZ A;  5CQY A;  4MZM A;  5CQX A;  1NE8 A;  4MZT A;  5CK9 A;  2KMT A;  5HKC A;  3NFC A;  5CKE A;  3G7Z A;  4VUB A;  4ELY C;  4MZP A;  3VUB A;  2VUB A;  3HPW A;  2C06 A;  5CKB A;  5HK3 A;  4ELZ C;  5CCA A;  5DLO A;  5CO7 A;  3TCJ A;  3JSC A;  5CR2 A;  1X75 C;  5CKD A;  4HKE A;  1UB4 A;  4OF1 A;  5HK0 A;  5CKF A;  2MF2 A;  1M1F A; 
#chains in the Genus database with same CATH topology
 4AG2 C;  5IHI A;  4F16 A;  1Y57 A;  2FPE A;  1M5Q 1;  1SEM A;  1SSF A;  2CUB A;  2AZV A;  4BB7 A;  2MCN A;  4KUL A;  2P0K A;  4C92 A;  2DKG A;  1VQL Q;  1PG5 B;  1O9S A;  1K9M C;  2V8J A;  4L5G A;  2KEA A;  2OX7 A;  1PKS A;  4ZN1 A;  3A98 A;  2YSQ A;  3CCL A;  3H9N A;  3JCM d;  3RER A;  5D7U A;  2ZPF B;  4NL3 A;  1TS9 A;  2E4H A;  2XKO C;  1MMN A;  1OV3 A;  3QSU A;  1OI1 A;  2EYX A;  5FU6 B;  3G71 T;  5I22 A;  3JB9 F;  4BUG A;  3H41 A;  2RNA A;  2E64 A;  2O88 A;  2KE9 A;  2O31 A;  2D8H A;  2F69 A;  3J80 E;  1AOJ A;  1ZA2 B;  3OB9 A;  2SRC A;  2MWO A;  4J9I A;  2K5L A;  4M78 B;  4C8Q C;  2BKD N;  4KBM B;  3I56 Q;  4C92 C;  5GAN 3;  4E7I A;  2RI5 A;  1X2K A;  3E9G A;  4C8Q E;  2DAQ A;  3NMZ C;  2OI3 A;  1Q86 C;  5CAI A;  2R58 A;  3CME Q;  3CEY A;  1BI0 A;  3FEO A;  2LMJ A;  1WHH A;  4OGE A;  1MNE A;  3I56 A;  2M02 A;  4M77 E;  5KCH A;  3H8Z A;  3FJ5 A;  1TUC A;  4RKU E;  2RHZ A;  3VS6 A;  2QQS A;  4M75 A;  1PRM C;  2AK5 A;  2EYY A;  1YIT T;  3P8H A;  5GAM e;  2DIG A;  2K9G A;  1WHL A;  2K5F A;  4IUP A;  1I8F A;  3VV0 A;  1LCK A;  2DTO A;  3JB9 I;  1AZE A;  2XK0 A;  3CBO A;  3CCJ T;  1S1N A;  2COY A;  4AT1 B;  3QJY A;  1HK9 A;  2NYS A;  4PFP A;  1JQQ A;  2ZAE A;  2ROT A;  1YJW Q;  3JCM X;  1KHI A;  2QQB A;  1YIJ T;  4RTW A;  2J7I A;  3M0U A;  3NTH A;  4B9W A;  3OA6 A;  1OOT A;  3HKS A;  2M9U A;  2RQV A;  1M2V B;  5DLQ E;  2A3L A;  2QK0 A;  4D6W A;  1GBR A;  3OYL A;  1BI1 A;  5KYX B;  4PJO C;  1WNL A;  2PQW A;  3VS1 A;  1GBQ A;  1X6O A;  1N5Z A;  1VQO Q;  3X24 B;  2PZ1 A;  3I9Q A;  1SG5 A;  1I81 A;  2HNI A;  1UDL A;  4E7L A;  2CP0 A;  3GNG A;  4JS4 A;  1U3O A;  1T3L A;  3CPW P;  3PIP A;  4JLG A;  3LH0 A;  5FU7 B;  3EG9 B;  2J05 A;  4XU2 A;  4LXC A;  4JS5 A;  5J39 A;  2DJQ A;  2VXF A;  4M78 C;  4C8Q B;  1BI2 A;  2EIF A;  4ELZ C;  3EHR A;  3H0I A;  2RQU A;  2DXU A;  1G5V A;  5GAN 6;  2K3B A;  2G6F X;  2YRV A;  2J6F A;  1VQM Q;  2XDP A;  1VQ6 T;  4IKF A;  3FJP A;  1YFN A;  3UA7 A;  3NFC A;  1KFZ A;  4IUQ A;  2OTL T;  2SEM A;  2KRO A;  4LUE A;  2AT1 B;  1AVZ C;  4LDX A;  2VXE A;  2RJC A;  4IUR A;  3CCU A;  4JZ3 A;  3OBW A;  4A4G A;  2OTJ T;  5KYW A;  1X69 A;  2FPF A;  3JCM P;  3J7A F;  1OU8 A;  1QCN A;  1IO6 A;  2Y4X A;  1FXX A;  5IXB A;  2RI2 A;  3M4Y A;  2EBP A;  2AIR B;  3PVQ A;  5KYW B;  3HFN A;  4DOW A;  5LJ3 h;  3JCM b;  2DIL A;  2RA2 A;  4IUV A;  1G3Y A;  1ZQ1 A;  4PJO F;  1XNI A;  3SWN A;  4XU0 A;  4M7D G;  4M75 D;  4KGX B;  2L0A A;  4M77 B;  4XU3 A;  4O6J A;  1QQJ A;  4JRI A;  3A8H B;  1UHC A;  3EGD A;  3A8G B;  4ANJ A;  2K6D A;  3HRT A;  2DRM A;  1XTD A;  1Y71 A;  5D6W A;  3OYE A;  2X3X D;  3CMA A;  5A0L A;  1U06 A;  4HT8 A;  3OY9 A;  5GMK l;  1H3H A;  1YCY A;  3QZ5 B;  3GNF B;  5CIU A;  2HAX A;  1QW1 A;  1ZSZ A;  3VS4 A;  3RKX A;  3HTR A;  4E7K A;  2E70 A;  2DO3 A;  5FLX E;  3JSC A;  4F17 A;  1Y7X A;  1C1A A;  2AZS A;  5GAO r;  3JCM V;  2QG9 B;  4OMN A;  4EMK C;  4EIK A;  3OYJ A;  4M78 G;  1MMD A;  3VS7 A;  1FX7 A;  3IQL A;  1YWP A;  2AKL A;  1G3T A;  4OMM A;  3CCL T;  2LRQ A;  1B34 A;  1K4U S;  1PWT A;  4A4H A;  3REB B;  1YN8 A;  3X28 B;  1YJN Q;  3EG3 A;  1VA7 A;  4AFU C;  3LW5 E;  4LDU A;  1ZX6 A;  3VYG A;  4C92 G;  2EJ9 A;  3C94 A;  4LUD A;  4Z89 A;  2FB7 A;  3EG1 A;  3PNW C;  5FW9 A;  3CCQ Q;  4ELY C;  2JZ2 A;  1B34 B;  4Q5W A;  3NTK A;  1AWJ A;  1OUL A;  1PHT A;  4C5H A;  3RIR A;  4FT2 A;  2CDT A;  1VQN A;  4J9E A;  2R57 A;  1YIT Q;  4A53 A;  5GAN g;  2D8J A;  1VQ6 A;  1IXD A;  1BIB A;  2DXB A;  2DVE A;  4J5Y A;  5GAN f;  1CSK A;  4BE2 A;  4E7S A;  3MP1 A;  4M77 C;  3CCJ Q;  4C92 D;  1M3B A;  3OYM A;  1VQ9 Q;  4M78 F;  2M16 A;  4M7D A;  1G83 A;  4XTX A;  2VKN A;  1N6A A;  4FYY B;  4RTZ A;  2MMP A;  1VQN Q;  3UT1 A;  2PTK A;  4HA8 A;  1WFW A;  1JJ2 P;  1W2B P;  2EQK A;  1YHQ Q;  2DYB A;  2RN8 A;  1OX9 A;  2XG8 D;  3T9N A;  1N8R C;  2EWN A;  4FCY A;  3RES A;  2QA4 T;  5GAM g;  4PJL A;  1OPK A;  2QAZ A;  2L3S A;  1B7T A;  1R0B G;  5GAO l;  2C0O A;  2RB6 A;  1X01 A;  1K1Z A;  2RJF A;  1OPL A;  2DXC A;  2RHY A;  3L1A A;  3P8D A;  4RCC A;  1M27 C;  2JM8 A;  4A4F A;  3UPU A;  1MHN A;  2CRE A;  4GLM A;  4QQG A;  2QEX A;  3TVT A;  5LJ5 j;  3CCV Q;  3M0P A;  5C6S A;  2O4X B;  3C95 A;  2OAU A;  3M4G A;  4ATO A;  4C8Q A;  2LJ3 A;  1SF9 A;  2KRS A;  1MGQ A;  2NUP B;  3CCS T;  4M4Z A;  3JCM h;  3CBP A;  2RM4 A;  2A36 A;  4BI8 B;  1Y07 A;  2LQN A;  3VS0 A;  3QII A;  1WXT A;  2ZPG B;  3GF5 A;  5GMK m;  2WSF E;  5IXF A;  1YJW T;  5EG2 A;  1KHC A;  3OW2 A;  2QGF B;  1WXB A;  1QMC A;  4B6M A;  5GAO n;  3CCR T;  2RMO A;  1WQW A;  4PJN A;  2ZGW A;  2RK1 A;  3HRU A;  1PC0 A;  3OSS C;  3OS1 A;  3QWX X;  4DBQ A;  3VS5 A;  1K73 R;  2E12 A;  2QXF A;  1VOM A;  1IGQ A;  2W10 A;  4N4H A;  3MET A;  4DBH A;  2FZC B;  4M7D E;  1QLY A;  2C06 A;  2JNG A;  3M57 A;  3C0C A;  1WJQ A;  1PRL C;  7AT1 B;  1WHJ A;  1JRI A;  1BIA A;  5DM7 R;  1IB8 A;  1D3B B;  4M7A E;  3HSB A;  4AFS C;  4JUV A;  1QVP A;  2QI2 A;  4HVW A;  3MEU A;  3EFO A;  2DTI A;  4MML A;  1VQ7 A;  3QZ9 B;  1RI0 A;  4IUU A;  2EYZ A;  4JDS A;  5GAM d;  2W0Z A;  4OGC A;  4QKU A;  3CME T;  3EFR A;  1NLO C;  4ZGJ B;  3OBY A;  1F1B B;  3H6Z A;  3OYK A;  3L2Q A;  1YCS B;  4JJC A;  2EAY A;  2LVM A;  4E7Z A;  1SRM A;  2COW A;  1D1C A;  4OMP A;  3MKD A;  1Y0M A;  5CKH A;  3L2Z A;  2P84 A;  2OTJ A;  1W70 A;  1WJR A;  2P4T A;  4Z88 A;  4YTL A;  4JJN K;  2X3W D;  3FC3 A;  1M90 C;  1SSH A;  1W1F A;  3DB3 A;  4ZTJ A;  3RKW A;  5CKE A;  1MV3 A;  3F70 A;  4HVV A;  3HPW A;  1FMV A;  5D6Y A;  4E6R A;  3AHU A;  2KXC A;  1NEB A;  2KSS A;  1Y96 A;  1JEG A;  1VIF A;  2ESW A;  4PJJ A;  2RK2 A;  2RD1 A;  2FG0 A;  5I11 A;  2DTH A;  3PFS A;  5GMK h;  2HKQ B;  1CKB A;  5L8R E;  3OYH A;  2BE9 B;  1D1A A;  4LN2 A;  2KR3 A;  4J6X A;  3QPH A;  2QDL A;  2VB6 A;  2LCL A;  1VYU A;  3EGX A;  2R5M A;  1Q95 G;  2H3J A;  1K8A R;  4XTU A;  2DYI A;  3L2V A;  3PMI A;  1MND A;  1I5L A;  3EFS A;  3FRN A;  3OS0 A;  1MUZ A;  4C0G A;  2A08 A;  1KQS S;  2V26 A;  2PNI A;  4C5I A;  3NGP A;  5LJ3 d;  2ROL A;  5GMK j;  1IZ6 A;  3MJX A;  4C8Q G;  2M0Y A;  1I5O B;  2QGG A;  5GMK e;  2O4X A;  1G2B A;  1HJD A;  3SD4 A;  3E9F A;  5GAN 4;  2I2L A;  1C6V X;  1OU9 A;  2CKK A;  4PJO B;  3KUF A;  4HCZ A;  1Q81 C;  2NUZ A;  4KRT A;  2EKO A;  1NBE B;  2YRD A;  1ZA1 B;  2DZC A;  2DBK A;  3GIB A;  4MDX A;  2DIQ A;  3G6E T;  5KYY B;  2F2V A;  3MO8 A;  4LD6 A;  1IHW A;  4PFZ A;  3QDR B;  5AT1 B;  1QVG S;  1NYF A;  4PJO E;  1NG2 A;  4PL6 A;  1KQS A;  1Z9Z A;  2LC4 A;  2ZPI B;  4FL6 A;  1QKW A;  1VQM T;  5CO7 A;  2MAM A;  3QYG B;  3WVD B;  4JZ4 A;  2O9S A;  3SHW A;  1H92 A;  1BCO A;  2OTL Q;  1FMW A;  2LP5 A;  4AFQ C;  1QCF A;  3OMG A;  2DL8 A;  4M7A B;  4CRI A;  2F5T X;  2RH2 A;  1AHJ B;  2E41 A;  4RG2 A;  1RL2 A;  5FRO A;  1IHV A;  2JS2 A;  3JV3 A;  1JU5 C;  2F2W A;  2DF6 A;  3OYC A;  1P92 A;  3QWY A;  1H8K A;  5KYN A;  1YJ9 A;  3TQ7 P;  4R56 A;  3CC7 A;  2JS0 A;  1MMA A;  1NEG A;  2LT4 A;  1YBY A;  4VUB A;  2HSE B;  1M4Z A;  1VQ4 T;  1WGS A;  4XTV A;  1RAB B;  4OB3 B;  2COZ A;  2DFU A;  1TTH B;  1LOJ A;  2DEQ A;  5HK0 A;  2X4J A;  3CPF A;  1Q81 U;  3CMA T;  3JB9 D;  3EGD B;  5FWC A;  3OYI A;  1WPY A;  4QVD A;  4KUD K;  3LWH A;  4OMF B;  1GCQ C;  2Y4Y A;  4JRP A;  1YIJ Q;  1ABQ A;  2JW4 A;  1T3S A;  2DET A;  3ASK A;  1T0H A;  3MP6 A;  4FU6 A;  5KYU B;  2HEQ A;  3CCE A;  2XIC A;  1K9M U;  1VUB A;  1WXU A;  5IH2 A;  1QVF S;  3TU4 K;  2D6F A;  3CCM T;  1TSF A;  2WSC E;  2QEX T;  2MPX C;  5GAN 5;  5CK9 A;  2HD0 A;  3M0T A;  1TOV A;  5GMK i;  2LNV A;  3ZEH A;  1WI7 A;  3BDL A;  1LJO A;  5M9O A;  5CVI A;  4E7H A;  1GL5 A;  4IIO A;  2L3Q A;  2DNU A;  1OQK A;  1NYG A;  2H8H A;  2F1L A;  4OF1 A;  4BI3 A;  1LNX A;  2BZX A;  1JJ2 A;  1KG1 A;  1HSQ A;  3JCM c;  2DER A;  4M75 G;  3OW2 S;  3OYN A;  1UGV A;  4FT4 A;  4XK8 E;  2MK5 A;  2E1H A;  4J7F A;  3QXE B;  4WF2 A;  4IUT A;  1W6X A;  5FRN A;  2F5K A;  4PLI A;  2ED0 A;  4N4G A;  1LPL A;  3GBQ A;  3I5R A;  2L3P A;  3QDF A;  4LDV A;  4X9C A;  4HCB A;  1Q7Y R;  3THK A;  1N8R R;  2VYT A;  4OML A;  3RMQ A;  3OYA A;  2QA4 A;  3A8L B;  3SWN B;  3BW1 A;  2RQW A;  1GRI A;  1D0Z A;  1EIF A;  3CD6 A;  4M77 D;  2JTE A;  3REA B;  1UHF A;  5GJW B;  3KXT A;  2XDB A;  5KYU A;  2B86 A;  1NPP A;  3NTI A;  4DBF A;  5GJV B;  4F04 B;  1KQ1 A;  5CKB A;  1Q86 U;  3TEE A;  2K3Y A;  5GAN d;  1M8M A;  1W2B S;  1S72 A;  4Z8A A;  4X9D A;  4LNP A;  3CQT A;  2FO0 A;  2IIM A;  5LL6 S;  1I07 A;  4GBQ A;  1BB9 A;  2O2O A;  3MCA B;  1J3T A;  3JB9 G;  1TWB A;  2DMO A;  2LQ8 A;  3CCM Q;  3BDU A;  3QO3 A;  4QVZ A;  3M0R A;  1IGU A;  5CKF A;  1RUW A;  5IT9 E;  3V8L A;  2LQK A;  4CC7 A;  4FYX B;  1QP3 A;  3QBY A;  1I4K 1;  1ZSG A;  4JRQ A;  3ZL7 C;  2DL4 A;  2X35 A;  4PLL A;  2GBQ A;  2K3X A;  1UG1 A;  2KRM A;  1NM7 A;  3CCV T;  1K9A A;  5GAM h;  1BK2 A;  3SEM A;  1RLP C;  3KFV A;  4EMG A;  2KQW A;  4FYW B;  3EGX B;  2WSE E;  2GTO A;  2Y90 A;  1BCM A;  3V7C A;  5KYX A;  1ZHI A;  1X2Q A;  1M90 R;  2FZK B;  2KDS A;  4D8D A;  1RAD B;  1YJN T;  9ATC B;  2HL5 C;  3G4S A;  1VQK A;  1M1K C;  1TU0 B;  4ZGD B;  1NJI R;  1K0S A;  3LH5 A;  1VQ8 T;  5DY9 A;  2NWM A;  1WX6 A;  4HCK A;  3I35 A;  2ZPH B;  2CZ1 B;  5KCO A;  2JJ9 A;  5I2M A;  2M0O A;  3MHX A;  3I55 Q;  3CCS Q;  2KBT A;  3HP9 A;  3OYY A;  4BE0 A;  1VQ8 A;  2YHT A;  1YI2 A;  2HQX A;  4QT7 A;  2E5K A;  2MIO A;  4Y92 A;  4EMK A;  3VUZ A;  5I21 A;  2BZ8 A;  5LJ3 f;  1V29 B;  1GFC A;  3P8B B;  2CP7 A;  1KD1 C;  3PIO A;  4J83 A;  3TSW A;  5GAO p;  3JCM Q;  4J9H A;  4ZNX A;  4F7U F;  2LJ0 A;  1M8V A;  1M90 U;  1D0X A;  3OYD A;  2DX1 A;  2RI3 A;  1WDX A;  4J9B A;  3BFM A;  4C0F A;  1RAC B;  4C5G A;  3SDZ A;  3MPU B;  2CZ6 B;  2L89 A;  1U1T A;  2EJG A;  2ENM A;  4J9G A;  5ECA A;  3TSZ A;  3ULR B;  1VQO T;  4PKC C;  2LDM A;  2VWF A;  3G7Z A;  2FVU A;  3V8K A;  3Q1J A;  1M1K U;  2VV5 A;  3X26 B;  2EFI A;  3FIF A;  2EQI A;  1X43 A;  3JAM E;  1UUE A;  3RMS A;  1RAE B;  2RQR A;  3OYG A;  2E5Q A;  1RAF B;  4LE9 A;  3CC4 T;  5LJ5 h;  3U23 A;  3CCE T;  2LCS A;  2A0F B;  3EG9 A;  1ZUY A;  3M53 A;  1M30 A;  1JJ2 S;  4Y28 E;  1UGS B;  4M78 D;  1VQP T;  4J9F A;  3RBB B;  2M1H A;  2NUP A;  4KGV B;  4C0D C;  4RTV A;  4CC2 A;  1YI2 T;  2CH4 W;  4FIB A;  3OQ5 A;  1IRX A;  2KRN A;  4CC3 A;  3CC7 Q;  2EGC A;  4RUG A;  1M1K R;  2L3R A;  4OMQ A;  1YJ9 Q;  1M2O A;  3CC2 T;  3JRZ A;  2EJF A;  2DD4 A;  2KVQ G;  1V76 A;  2E10 A;  2ZPB B;  3ZFJ A;  2JTM A;  1VQ5 T;  4M7A D;  2RHX A;  4J6Y A;  2PVG B;  4EPC A;  3CPW S;  4M78 A;  3BE3 A;  5KE3 A;  2CP6 A;  5GAN 2;  2CP5 A;  1RAI B;  3RKY A;  1N8R U;  1Q82 U;  1BBZ A;  1TUG B;  2I0N A;  3EH1 A;  2JM9 A;  1T0J A;  3LGF A;  2CZ7 B;  3CC2 A;  4Y91 A;  2OTL A;  1QWE A;  2GF7 A;  1QKX A;  1N9S A;  5LJ3 e;  4DA4 A;  1HXD A;  2H3E B;  5A0D A;  1JB0 E;  4AMC A;  5IHN A;  2K79 A;  4RMO A;  4PNO A;  4RTU A;  3G71 A;  2L5Q A;  4A4E A;  3R6O A;  3G6E Q;  4FSX A;  1VIE A;  2PVO B;  3J81 E;  5LJ3 j;  2DK3 A;  3CD6 T;  4PK4 A;  1ZBJ A;  2ZPE B;  4R55 A;  3PVL A;  2HBW A;  3OSV A;  3S3O A;  4CI0 C;  1FMK A;  1VQ7 T;  4N4I A;  2KNB B;  2YDL A;  5AYF A;  1MV0 B;  1R8O B;  2JXB A;  2K2V A;  3DKM A;  2V8I A;  4RCB A;  2MYS A;  2PVD B;  2BZY A;  4M78 E;  6AT1 B;  5GAM j;  4II1 A;  5CR2 A;  1BU1 A;  2ZZD A;  2QAS A;  2E6Z A;  3TRE A;  5L23 A;  2EPD A;  1VQP Q;  1EFN A;  1ZSZ B;  2KT1 A;  2YUO A;  4MDW A;  1NLP C;  1AWW A;  2EQM A;  1D1B A;  4E7J A;  4FW1 A;  1KD1 U;  4M7A C;  3E1S A;  3DB4 A;  1GFD A;  2CH4 A;  1U8R A;  1Q7Y C;  2A37 A;  1SHG A;  2DE0 X;  1WIE A;  2AKK A;  4M7D C;  1BKB A;  2FRW A;  5LJ5 e;  1KD1 R;  4BY6 C;  1PKT A;  4M77 A;  3QHS A;  3RR6 A;  3L42 A;  3OMC A;  2NLU A;  3JCM J;  4N0A C;  3CCM A;  4JJB A;  1UJ0 A;  2RHI A;  1WA7 A;  3R6N A;  5FRM A;  3CCR Q;  3S3M A;  2RJD A;  2ZCF B;  4L6V 5;  1HD3 A;  1YNZ A;  3TCJ A;  1PSF A;  1K8A C;  4BD3 A;  1KSW A;  1ZBX A;  1S72 Q;  2XMF A;  4LD9 K;  1BI3 A;  4XTW A;  2KYB A;  1VQ4 Q;  5KH6 A;  4WTO B;  4M7A F;  5GAN h;  3GPL A;  3FDR A;  4D8K A;  1WHK A;  3S6W A;  2KMT A;  2GFA A;  4NL2 A;  3AT1 B;  3JB9 J;  1VQ5 A;  3M9Q A;  2BIV A;  2RHU A;  4M77 F;  2FYK A;  5KE2 A;  1KC8 U;  2XD0 A;  1DJ7 B;  4Z02 A;  1VQ7 Q;  2NUT A;  3L2W A;  3FB9 A;  1GCQ A;  4DEX A;  3EG0 A;  5C0M A;  2MF2 A;  1JXM A;  2CT4 A;  3VJP A;  3G6E A;  3JCM W;  2HL3 A;  1D0Y A;  1MMG A;  3G71 Q;  4N0A A;  2QTV A;  2IPO B;  4J9D A;  1Q82 R;  2V1R A;  1E7O A;  1G3S A;  2P0P A;  3N5B B;  2B8A A;  4M7D D;  2K4Y A;  3G4S T;  1VQK T;  1WHG A;  1K73 C;  3OYF A;  3M59 A;  2O01 E;  3CC4 A;  1E6H A;  1YWO A;  2D0Q B;  2IVW A;  3QJ6 A;  3I56 T;  4B9X A;  4J7I A;  2WAC A;  3H0F A;  2CSQ A;  5A2Q E;  4DQ2 A;  4ZTF A;  3EG2 A;  2DL3 A;  2E6N A;  2EGA A;  2GCX A;  4IIM A;  3JB9 H;  1KC8 R;  1TG0 A;  2DJZ A;  1M2V A;  3X20 B;  1K76 A;  5I2S A;  2FL7 A;  3A1P A;  3I55 T;  5GAM f;  3GLX A;  1ABO A;  2EQJ A;  5CKD A;  3SWN C;  2KK4 A;  2X4W A;  2YLB A;  1K8A U;  4M7D F;  3BY7 A;  2KAF A;  3GOX A;  2HDA A;  2DZ9 A;  1AD5 A;  3LYI A;  1O75 A;  4OB1 B;  3JCM f;  4A54 A;  1PD1 A;  4F7U E;  1WQ7 A;  1AZG B;  5GAN 7;  2EQU A;  2EKH A;  1QCO A;  2MWP A;  3QKJ A;  2C0T A;  4C5E A;  4ZGE B;  4BI4 A;  3HFO A;  2OAW A;  5EC7 A;  3JCM g;  3M58 A;  1KIK A;  4OVA A;  2HZY A;  4RTT A;  4E2F B;  5CQY A;  2YT6 A;  1H3Z A;  3WXM B;  3M56 A;  1ACM B;  3RUX A;  1QVG P;  1D3B A;  4XTZ A;  3X25 B;  5LJ5 g;  4KH1 B;  1PM3 A;  1NJI C;  1Q81 R;  1I1J A;  2CYZ B;  1AEY A;  2V8K A;  1QP2 A;  2K57 A;  3I5S A;  2X51 A;  2QQ9 A;  1M9S A;  2RF0 A;  4MZM A;  2RPN A;  1C0M A;  2VAS A;  4ZN3 A;  5HK3 A;  1ZUU A;  5KYY A;  1G8X A;  3CC4 Q;  2HQH A;  4AFZ C;  1ZLM A;  5IN1 A;  1VQ9 A;  1BYM A;  2DVJ A;  1YP5 A;  1FYN A;  1OYX A;  3EH2 A;  3E19 A;  4PJO A;  3CCJ A;  2GGR A;  2J06 A;  1M1G A;  1OZ2 A;  1X27 A;  1YI2 Q;  1VQ8 Q;  3A8O B;  3CBM A;  1R0C B;  1KQ2 A;  1GCP A;  3VKI A;  1NJI U;  2Z0W A;  3CCS A;  1AWO A;  2GQV A;  1RLQ C;  3UAT A;  2VUB A;  2R5A A;  3EHQ A;  1VQ6 Q;  3QUI A;  3H0H A;  4M75 B;  4QQ6 A;  4TVR A;  1YIT A;  3CXC P;  1KC8 C;  4E47 A;  1ZSZ C;  2X4X A;  4GY5 A;  1VQ5 Q;  1M1F A;  1QVG A;  1R77 A;  2DXT A;  5J3B A;  3PMT A;  3CXC A;  1VQL T;  4BE1 A;  1VQ4 A;  2EW3 A;  3V8J A;  1K0X A;  4MMK A;  2KY9 A;  1JXO A;  3MP8 A;  2XDD A;  4HT9 A;  4ESR A;  3DLL A;  1UB4 A;  3C12 A;  4JPB W;  1XJW B;  2EGE A;  2J6K A;  3PE0 A;  3CCR A;  2JMC A;  1YJN A;  2JT4 A;  2YUQ A;  3INZ A;  3PT9 A;  4NOY A;  2D0N A;  1U5S A;  1UGP B;  3UWN A;  1B3Q A;  1KK7 A;  2VVK A;  4HXJ A;  2K7A A;  1U1S A;  8ATC B;  5J26 A;  5FU6 C;  3QYH B;  3UF4 A;  5GAO m;  3SB2 A;  2FHD A;  2JN0 A;  4F7U G;  2DD5 A;  4CC4 B;  1UGQ B;  2IG0 A;  2J6O A;  4LDW A;  1AT1 B;  1D09 B;  3KBG A;  1Q86 R;  2D9T A;  4KUI A;  4UC4 A;  4QVC A;  2A7Y A;  2JVV A;  3VYH B;  1OZ3 A;  2DL7 A;  3EAE A;  4C92 E;  5A0G A;  4MZP A;  3VUB A;  1VQP A;  2RQT A;  3MEW A;  2JOY A;  2KT8 A;  1UE9 A;  4FYV B;  2O9V A;  2DM1 A;  3CPW A;  2JUF A;  1G3W A;  3PTA A;  2FEI A;  1WJS A;  4C0Z A;  1OEB A;  2FZG B;  3PGG A;  4C8Q D;  4EDU A;  2EYQ A;  1GXI E;  3EGU A;  3ME9 A;  2X4Y A;  4NS5 A;  2V1Q A;  4XU1 A;  2PUK B;  4KGZ B;  2YXY A;  4C0D B;  2XU8 A;  2AHJ B;  2MI6 A;  4RG8 A;  4EMH A;  1UGR B;  1KJW A;  1N9R A;  2CP2 A;  1A0N B;  4J6W A;  2FPD A;  3VRY A;  3CCU Q;  1EZZ B;  3CC7 T;  8AT1 B;  1I0C A;  2KXD A;  2D1X A;  2CUD A;  1QVF A;  2YWW A;  3CC2 Q;  3ER0 A;  2LX7 A;  2PU9 B;  3OYB A;  5DLO A;  4M7A A;  4J8O A;  4HKE A;  4FM4 B;  1VQM A;  4R0K A;  4PJO D;  1K9M R;  1E6G A;  1N27 A;  2DRK A;  1IRE B;  2QQR A;  4HVU A;  4QQD A;  3OS5 A;  4J9C A;  1ZUK A;  2CGH A;  3URG A;  2KGT A;  3HHT B;  2HCK A;  1ARK A;  4OMO A;  4C8Q F;  1X6G A;  2GTJ A;  3GP8 A;  1Q82 C;  1SRL A;  4F14 A;  1VQO A;  3VS2 A;  1TH7 A;  1PD0 A;  3RDV A;  1EX4 A;  1SKU B;  2DBM A;  1OX8 A;  3CCV A;  2HBP A;  1PCX A;  5CCA A;  2QEX Q;  2EYW A;  1FWZ A;  1HYO A;  3OW2 P;  1WYX A;  4ORZ A;  5FWB A;  1YJW A;  3LX7 A;  1CKA A;  2K5I A;  4XQ3 A;  4QW2 A;  2JMA A;  4MZT A;  2LCC A;  4RTY A;  3VU3 C;  1AWX A;  3M5A A;  1LVK A;  4AG1 C;  4JRK A;  4M7D B;  1WLP B;  2LTO A;  3VRZ A;  1QVF P;  5LJ5 f;  2LT1 A;  4DOV A;  4BY6 B;  4A4K A;  4DEY A;  5GAN 8;  2GQI A;  4O5V A;  1YHQ A;  4GLK A;  5HCK A;  1M3A A;  2KI7 A;  3DLM A;  2LNH B;  5CQX A;  2FRY A;  1NZ9 A;  1YJ9 T;  2GFU A;  3V7S A;  3VS3 A;  3LGL A;  4BDY A;  1Z9Q A;  4DBR A;  1WHM A;  4F7U A;  2QTX A;  3UA6 A;  3SFM A;  3O5Z A;  3CME A;  4OB0 B;  1JO8 A;  1Q7Y U;  3I55 A;  5LJ3 g;  2XI9 A;  4PJO G;  4M75 E;  2PUO B;  3NPF A;  2G3R A;  3RNJ A;  2QDY B;  1TUD A;  3MEA A;  2XHC A;  4X34 A;  3M0Q A;  3EFO B;  4FW2 A;  1UFF A;  2DA9 A;  4C92 B;  1JBM A;  1UEB A;  4JJD A;  4EMK B;  2ED1 A;  2P0Q A;  3QG1 A;  2HKN A;  3L2R A;  2YRC A;  4V2S A;  3G4S Q;  1VQK Q;  5GAO q;  5GAN j;  4XTY A;  4M77 G;  1VYV A;  3O8V A;  4M75 F;  1W2B A;  1RAA B;  3CCQ A;  2ATC B;  1RAG B;  2E3H A;  2BUD A;  5HY6 A;  2BTT A;  3G1J A;  3LWI A;  3CXC S;  2LJ1 A;  3JCM e;  3CCL Q;  3CCQ T;  2ABL A;  5FU7 C;  3OS2 A;  2EVR A;  1RI9 A;  3M0S A;  2VC8 A;  1B07 A;  1XQH A;  2C0I A;  1VQL A;  1X6B A;  2OJ2 A;  1TXQ A;  2K2M A;  5LJ5 d;  5IHK A;  2HQE A;  5D6X A;  3D7S B;  1PSE A;  2CP3 A;  3NHN A;  2GNC A;  2VGN A;  2BE7 D;  2QYZ A;  2RO0 A;  3M54 A;  4PFO A;  4M7A G;  3HL8 A;  1V1C A;  4OB2 B;  4XAX B;  4A63 B;  2X9H A;  4BDZ A;  2OTJ Q;  3CMA Q;  2HMA A;  2QQA A;  4WCI A;  2JTF A;  1VQ9 T;  2A28 A;  3A8M B;  3L2U A;  3CCU T;  4HCC A;  2LZ6 B;  5GAN e;  2E3I A;  1UEC A;  2YLC A;  1KQS P;  3FLG A;  4F7U B;  1M3C A;  1Y96 B;  2CT3 A;  1VQN T;  2CS7 A;  1QWF A;  1PNJ A;  2LX9 A;  4ME7 A;  1W4S A;  4KT0 E;  4LDY A;  2NUT B;  1S72 T;  3CD6 Q;  1H64 1;  4KH0 B;  3WVE B;  1YHQ T;  2CSI A;  2P4R A;  2QA4 Q;  3UDC A;  4FSS A;  2CZ0 B;  4X1V A;  2DPP B;  1K73 U;  4JLI A;  3V7R A;  1UJY A;  4BAC A;  5IAY A;  1RAH B;  3HRS A;  1WZO A;  3A5Z B;  2DEU A;  2MOX A;  1NPR A;  4P5N A;  2ECZ A;  2KYM A;  3ZBD A;  2L2P A;  2L8D A;  4K11 A;  3LLR A;  3S3N A;  1UTI A;  2F2X A;  2E65 A;  4PJM A;  2HSP A;  2LQW A;  1VYT A;  3C4S A;  1NE8 A;  3M55 A;  4C92 F;  3E2U A;  5HKC A;  1SPK A;  2YUN A;  3MEV A;  4L59 A;  2YUP A;  2XID A;  2M51 A;  3CCE Q;  4M75 C;  1SHF A;  2VGM A;  1X75 C;  1XOV A;  4OP0 A;  1YIJ A;  2DLP A;  2RJE A;  2DL5 A;  4RTX A; 
#chains in the Genus database with same CATH homology
 5I2M A;  2DXT A;  5J3B A;  3PMT A;  4BI8 B;  1Y07 A;  2M0O A;  3MHX A;  3CXC A;  3QII A;  1VQL T;  3HP9 A;  2ZPG B;  4BE1 A;  3GF5 A;  3OYY A;  1M5Q 1;  5GMK m;  4BE0 A;  1SSF A;  1VQ8 A;  2YHT A;  1YI2 A;  2WSF E;  2HQX A;  4BB7 A;  1VQ4 A;  1YJW T;  5EG2 A;  1KHC A;  3OW2 A;  4KUL A;  2P0K A;  3V8J A;  4EMK A;  4C92 A;  2DKG A;  4MMK A;  3VUZ A;  2KY9 A;  5I21 A;  3MP8 A;  1O9S A;  2XDD A;  5LJ3 f;  1K9M C;  4HT9 A;  5GAO n;  3CCR T;  3DLL A;  1V29 B;  1WQW A;  2V8J A;  4L5G A;  1UB4 A;  3C12 A;  3P8B B;  2ZGW A;  2RK1 A;  3HRU A;  1KD1 C;  4ZN1 A;  4J83 A;  3PIO A;  3OSS C;  3CCL A;  3OS1 A;  3CCR A;  3JCM d;  5GAO p;  1YJN A;  3JCM Q;  4F7U F;  3INZ A;  2E12 A;  3PT9 A;  4NOY A;  2QXF A;  3RER A;  1UGP B;  1M8V A;  2ZPF B;  4NL3 A;  3UWN A;  1M90 U;  4N4H A;  3MET A;  3OYD A;  2XKO C;  2RI3 A;  2C06 A;  3QSU A;  1OI1 A;  4M7D E;  1U1S A;  2JNG A;  5FU6 B;  3G71 T;  3BFM A;  4C0F A;  3M57 A;  5J26 A;  4C5G A;  5FU6 C;  2HAX A;  3SDZ A;  3QYH B;  3JB9 F;  5GAO m;  1WJQ A;  3SB2 A;  2FHD A;  4BUG A;  5DM7 R;  1JRI A;  1BIA A;  2JN0 A;  4F7U G;  2DD5 A;  2CZ6 B;  2L89 A;  1D3B B;  4M7A E;  1U1T A;  2E64 A;  3HSB A;  2EJG A;  1UGQ B;  2IG0 A;  4JUV A;  1QVP A;  2QI2 A;  4LDW A;  3MEU A;  2F69 A;  3J80 E;  3KBG A;  2DTI A;  4MML A;  1VQO T;  1VQ7 A;  3QZ9 B;  4PKC C;  1RI0 A;  4IUU A;  2D9T A;  2LDM A;  4JDS A;  4KUI A;  2A7Y A;  4UC4 A;  2JVV A;  3OB9 A;  3VYH B;  4OGC A;  4QVC A;  1OZ3 A;  3G7Z A;  4C92 E;  3EAE A;  2FVU A;  5A0G A;  2MWO A;  3CME T;  4MZP A;  3VUB A;  3EFR A;  1VQP A;  2K5L A;  3V8K A;  3Q1J A;  4M78 B;  2BKD N;  4C8Q C;  4ZGJ B;  4KBM B;  1M1K U;  3OBY A;  2VV5 A;  4C92 C;  3X26 B;  2EFI A;  2JOY A;  3FIF A;  3H6Z A;  2RI5 A;  3MEW A;  5GAN 3;  3OYK A;  3L2Q A;  2EAY A;  4E7I A;  3E9G A;  4C8Q E;  2DAQ A;  3JAM E;  3CPW A;  1Q86 C;  2JUF A;  2LVM A;  1G3W A;  5CAI A;  2R58 A;  3PTA A;  3RMS A;  3CEY A;  1BI0 A;  3FEO A;  1WJS A;  3OYG A;  4C0Z A;  2E5Q A;  4OGE A;  5CKH A;  3L2Z A;  3CC4 T;  5LJ5 h;  2OTJ A;  1WJR A;  2P4T A;  4YTL A;  4JJN K;  3CCE T;  3I56 A;  4M77 E;  3M53 A;  5KCH A;  3FC3 A;  1JJ2 S;  3H8Z A;  3PGG A;  4RKU E;  4C8Q D;  4EDU A;  4Y28 E;  3DB3 A;  4ZTJ A;  1M90 C;  1UGS B;  2EYQ A;  2RHZ A;  4M78 D;  3RKW A;  1VQP T;  5CKE A;  1GXI E;  2QQS A;  3F70 A;  3HPW A;  2M1H A;  3ME9 A;  4M75 A;  2X4Y A;  4NS5 A;  5D6Y A;  3AHU A;  4XU1 A;  4C0D C;  2PUK B;  1YI2 T;  4FIB A;  1YIT T;  2KSS A;  4C0D B;  1Y96 A;  3OQ5 A;  2XU8 A;  3P8H A;  5GAM e;  1VIF A;  2DIG A;  2AHJ B;  2MI6 A;  4RG8 A;  2RK2 A;  2RD1 A;  2L3R A;  4EMH A;  1UGR B;  1N9R A;  2DTH A;  3CC2 T;  2K5F A;  4IUP A;  4J6W A;  3PFS A;  1I8F A;  5GMK h;  3JRZ A;  5L8R E;  2EJF A;  3VV0 A;  3OYH A;  2DTO A;  3JB9 I;  2DD4 A;  5GAM d;  3CC7 T;  2KVQ G;  4J6X A;  2E10 A;  2ZPB B;  3QPH A;  3ZFJ A;  2XK0 A;  2JTM A;  2LCL A;  1VQ5 T;  4M7A D;  2RHX A;  4J6Y A;  2PVG B;  4EPC A;  1QVF A;  3CPW S;  4M78 A;  3CBO A;  2R5M A;  5KE3 A;  2H3J A;  3CCJ T;  3ER0 A;  5GAN 2;  2PU9 B;  4XTU A;  3RKY A;  3OYB A;  1N8R U;  3L2V A;  3PMI A;  5DLO A;  4M7A A;  1Q82 U;  3QJY A;  4J8O A;  1HK9 A;  4HKE A;  1I5L A;  4FM4 B;  1VQM A;  3EFS A;  3LGF A;  2CZ7 B;  3JCM X;  3FRN A;  1KHI A;  3OS0 A;  3CC2 A;  4PJO D;  4Y91 A;  4C0G A;  2QQB A;  1KQS S;  2OTL A;  2GF7 A;  1N27 A;  4C5I A;  1YIJ T;  3NTH A;  5LJ3 d;  4B9W A;  3OA6 A;  1IRE B;  1N9S A;  2QQR A;  3HKS A;  5GMK j;  5LJ3 e;  4DA4 A;  1IZ6 A;  1HXD A;  4C8Q G;  2M9U A;  5A0D A;  1JB0 E;  5DLQ E;  4QQD A;  2A3L A;  3OS5 A;  5GMK e;  2O4X A;  2CGH A;  3URG A;  4RMO A;  4PNO A;  4D6W A;  3G71 A;  3HHT B;  3SD4 A;  3E9F A;  2L5Q A;  4A4E A;  5GAN 4;  3OYL A;  3R6O A;  2I2L A;  4FSX A;  1BI1 A;  1VIE A;  2PVO B;  4PJO C;  1WNL A;  3J81 E;  2PQW A;  5LJ3 j;  2DK3 A;  2CKK A;  3CD6 T;  4PJO B;  3KUF A;  4HCZ A;  1Q81 C;  1VQK A;  1X6O A;  3X24 B;  4C8Q F;  2ZPE B;  2EKO A;  4R55 A;  1I81 A;  3GP8 A;  2DZC A;  1Q82 C;  2HNI A;  3GIB A;  4E7L A;  3OSV A;  3GNG A;  3S3O A;  4MDX A;  4JS4 A;  2DIQ A;  3G6E T;  4CI0 C;  3PIP A;  1VQO A;  1VQ7 T;  3MO8 A;  4N4I A;  4JLG A;  3LH0 A;  4LD6 A;  5AYF A;  5FU7 B;  1QVG S;  3QDR B;  4XU2 A;  4JS5 A;  1TH7 A;  5J39 A;  1R8O B;  4PJO E;  2K2V A;  4PL6 A;  2VXF A;  4M78 C;  4C8Q B;  1BI2 A;  3DKM A;  1KQS A;  2V8I A;  2EIF A;  4RCB A;  3CCV A;  2LC4 A;  2HBP A;  2PVD B;  2ZPI B;  4FL6 A;  4M78 E;  4ELZ C;  5CCA A;  1VQM T;  5CO7 A;  2MAM A;  2DXU A;  1FWZ A;  3QYG B;  5GAM j;  4II1 A;  5CR2 A;  1G5V A;  5GAN 6;  3WVD B;  2ZZD A;  2E6Z A;  3TRE A;  2YRV A;  1YJW A;  3LX7 A;  4MDW A;  3OMG A;  2K5I A;  2XDP A;  4M7A B;  4XQ3 A;  1VQ6 T;  2EQM A;  4E7J A;  4CRI A;  1KD1 U;  4QW2 A;  4M7A C;  4IKF A;  1QVG A;  4MZT A;  3FJP A;  3E1S A;  2LCC A;  3DB4 A;  3NFC A;  4IUQ A;  2F5T X;  2OTL T;  2RH2 A;  3VU3 C;  1U8R A;  1Q7Y C;  1AHJ B;  3M5A A;  2E41 A;  4RG2 A;  4LDX A;  1RL2 A;  2VXE A;  5FRO A;  2RJC A;  4JRK A;  1BKB A;  4M7D C;  4M7D B;  4IUR A;  2LTO A;  5LJ5 e;  4BY6 C;  5LJ5 f;  3CCU A;  3OYC A;  2LT1 A;  4M77 A;  4BY6 B;  4A4K A;  1P92 A;  4DOV A;  5GAN 8;  3QHS A;  3OBW A;  4A4G A;  4O5V A;  1YHQ A;  4GLK A;  3L42 A;  3OMC A;  2OTJ T;  2NLU A;  3JCM J;  4N0A C;  1YJ9 A;  3CCM A;  3JCM P;  3J7A F;  3DLM A;  4R56 A;  2RHI A;  3CC7 A;  5CQX A;  5FRM A;  3S3M A;  2RJD A;  1NZ9 A;  2Y4X A;  1FXX A;  2LT4 A;  2ZCF B;  1YJ9 T;  2GFU A;  1YBY A;  4L6V 5;  4VUB A;  3V7S A;  1M4Z A;  2RI2 A;  3M4Y A;  3LGL A;  4BDY A;  1VQ4 T;  3HFN A;  1WGS A;  4XTV A;  4DOW A;  5LJ3 h;  4OB3 B;  4F7U A;  3JCM b;  2RA2 A;  4IUV A;  3TCJ A;  1G3Y A;  1ZQ1 A;  1PSF A;  1K8A C;  4BD3 A;  4PJO F;  1LOJ A;  1XNI A;  2DEQ A;  1ZBX A;  5HK0 A;  3SWN A;  2X4J A;  2QTX A;  4LD9 K;  1BI3 A;  3CPF A;  4XTW A;  4M75 D;  4XU0 A;  3SFM A;  1Q81 U;  3CMA T;  4M7D G;  4M77 B;  4XU3 A;  3JB9 D;  4O6J A;  3OYI A;  4JRI A;  3A8H B;  5KH6 A;  3A8G B;  3CME A;  1WPY A;  4M7A F;  4OB0 B;  4QVD A;  3HRT A;  4KUD K;  1XTD A;  1Y71 A;  5GAN h;  3LWH A;  5D6W A;  3OYE A;  3GPL A;  3FDR A;  1Q7Y U;  3I55 A;  3CMA A;  3S6W A;  5A0L A;  5LJ3 g;  2KMT A;  4HT8 A;  4OMF B;  3OY9 A;  2GFA A;  2Y4Y A;  5GMK l;  2XI9 A;  4NL2 A;  1YCY A;  4M75 E;  2PUO B;  3GNF B;  3QZ5 B;  5CIU A;  1QW1 A;  4PJO G;  4JRP A;  2G3R A;  2BIV A;  2QDY B;  3M9Q A;  3JB9 J;  2RHU A;  3RKX A;  1VQ5 A;  3MEA A;  2FYK A;  2E70 A;  2XHC A;  3ASK A;  4M77 F;  1DJ7 B;  4X34 A;  5KE2 A;  4E7K A;  1KC8 U;  4Z02 A;  2DO3 A;  3MP6 A;  5FLX E;  3JSC A;  3L2W A;  4FU6 A;  4C92 B;  1Y7X A;  3FB9 A;  1JBM A;  3CCE A;  5GAO r;  1UEB A;  4EMK B;  2XIC A;  3JCM V;  2P0Q A;  3QG1 A;  4EMK C;  2MF2 A;  5C0M A;  3OYJ A;  3L2R A;  3VJP A;  3G6E A;  1K9M U;  3JCM W;  4V2S A;  1VUB A;  4M78 G;  1QVF S;  5GAO q;  3TU4 K;  4N0A A;  2D6F A;  3CCM T;  5GAN j;  4XTY A;  1FX7 A;  2WSC E;  4M77 G;  3O8V A;  2QEX T;  5GAN 5;  5CK9 A;  2HD0 A;  1G3T A;  4M75 F;  1G3S A;  1W2B A;  5GMK i;  3CCQ A;  2LNV A;  3ZEH A;  2P0P A;  3BDL A;  3CCL T;  2LRQ A;  1LJO A;  3N5B B;  2B8A A;  4M7D D;  2BUD A;  1B34 A;  2K4Y A;  5HY6 A;  5M9O A;  3G4S T;  1VQK T;  5CVI A;  1K73 C;  3OYF A;  3M59 A;  4A4H A;  4E7H A;  2O01 E;  3LWI A;  3CXC S;  3CC4 A;  3JCM e;  3X28 B;  4BI3 A;  2D0Q B;  4OF1 A;  2IVW A;  1LNX A;  3QJ6 A;  3LW5 E;  4LDU A;  1JJ2 A;  3JCM c;  1KG1 A;  3VYG A;  3CCQ T;  4M75 G;  3OW2 S;  4C92 G;  3OYN A;  3I56 T;  4B9X A;  4FT4 A;  4J7I A;  2WAC A;  4XK8 E;  5FU7 C;  2EJ9 A;  3C94 A;  5A2Q E;  4DQ2 A;  3OS2 A;  4ZTF A;  4J7F A;  2E1H A;  2FB7 A;  2E6N A;  2GCX A;  3QXE B;  4WF2 A;  4IUT A;  5FRN A;  3JB9 H;  2VC8 A;  1VQL A;  1XQH A;  3PNW C;  2F5K A;  4ELY C;  2JZ2 A;  2DJZ A;  4PLI A;  4N4G A;  3X20 B;  5I2S A;  2FL7 A;  1B34 B;  5LJ5 d;  4Q5W A;  4LDV A;  2HQE A;  3NTK A;  4X9C A;  5D6X A;  3I55 T;  4HCB A;  5GAM f;  4C5H A;  1PSE A;  3GLX A;  5CKD A;  2EQJ A;  2VYT A;  3RIR A;  3RMQ A;  3SWN C;  2KK4 A;  3OYA A;  2X4W A;  2YLB A;  4FT2 A;  2QA4 A;  3A8L B;  1K8A U;  3BY7 A;  2KAF A;  3SWN B;  4M7D F;  3BW1 A;  2VGN A;  3GOX A;  2RO0 A;  2DZ9 A;  1VQN A;  3M54 A;  2R57 A;  1EIF A;  3LYI A;  3CD6 A;  4M7A G;  1O75 A;  4M77 D;  4A53 A;  5GAN g;  3HL8 A;  4OB1 B;  3JCM f;  4A54 A;  3KXT A;  2XDB A;  4OB2 B;  4XAX B;  1VQ6 A;  4F7U E;  1WQ7 A;  1NPP A;  3NTI A;  4BDZ A;  1KQ1 A;  5GAN 7;  1BIB A;  2EQU A;  2DXB A;  2QQA A;  1VQ9 T;  2JTF A;  5CKB A;  2DVE A;  2MWP A;  3A8M B;  3L2U A;  3QKJ A;  3CCU T;  4C5E A;  4ZGE B;  3TEE A;  1Q86 U;  4HCC A;  2K3Y A;  4BI4 A;  3HFO A;  5GAN e;  2YLC A;  4J5Y A;  5GAN f;  5GAN d;  3FLG A;  3JCM g;  4F7U B;  1Y96 B;  3M58 A;  4BE2 A;  1W2B S;  3MP1 A;  4M77 C;  4OVA A;  1VQN T;  2CS7 A;  1S72 A;  4C92 D;  3OYM A;  2LX9 A;  4M78 F;  4X9D A;  4ME7 A;  2M16 A;  4M7D A;  5CQY A;  4XTX A;  1W4S A;  4KT0 E;  5LL6 S;  3WXM B;  1H3Z A;  3M56 A;  4LDY A;  1N6A A;  3RUX A;  1D3B A;  1S72 T;  1H64 1;  2MMP A;  4XTZ A;  3X25 B;  3WVE B;  5LJ5 g;  1YHQ T;  3MCA B;  3UT1 A;  4HA8 A;  3JB9 G;  1NJI C;  3UDC A;  2CZ0 B;  2CYZ B;  2DPP B;  1K73 U;  2LQ8 A;  4JLI A;  2EQK A;  3BDU A;  3V7R A;  4BAC A;  2V8K A;  3QO3 A;  5IAY A;  2XG8 D;  1QP2 A;  4QVZ A;  3T9N A;  1N8R C;  2EWN A;  2K57 A;  5CKF A;  3RES A;  2QA4 T;  5IT9 E;  3V8L A;  2QQ9 A;  2LQK A;  1M9S A;  5GAM g;  1QP3 A;  3HRS A;  3QBY A;  3A5Z B;  4MZM A;  1I4K 1;  1NPR A;  4P5N A;  3ZBD A;  4JRQ A;  5GAO l;  2X35 A;  4PLL A;  2K3X A;  2RB6 A;  1X01 A;  2L8D A;  4ZN3 A;  5HK3 A;  2RJF A;  2DXC A;  3LLR A;  2RHY A;  3L1A A;  3P8D A;  4RCC A;  3CCV T;  2ZPH B;  5GAM h;  5IN1 A;  4EMG A;  2KQW A;  2WSE E;  4A4F A;  3V7C A;  2Y90 A;  3UPU A;  1MHN A;  3S3N A;  1VQ9 A;  1BYM A;  4QQG A;  1ZHI A;  2E65 A;  1OYX A;  2KDS A;  3E19 A;  3CCJ A;  4PJO A;  2QEX A;  1M1G A;  1OZ2 A;  5LJ5 j;  3C4S A;  1NE8 A;  3A8O B;  3M55 A;  4C92 F;  3CBM A;  5C6S A;  1YJN T;  1KQ2 A;  2O4X B;  3VKI A;  5HKC A;  3C95 A;  3G4S A;  3CCS A;  1NJI U;  3MEV A;  1M1K C;  4L59 A;  2GQV A;  4ZGD B;  2XD0 A;  2VUB A;  2OAU A;  2R5A A;  3M4G A;  2XID A;  4ATO A;  4C8Q A;  3QUI A;  4M75 C;  1VQ8 T;  1MGQ A;  4M75 B;  4QQ6 A;  5DY9 A;  3CCS T;  2VGM A;  4TVR A;  1X75 C;  3JCM h;  1XOV A;  1YIT A;  3CBP A;  1KC8 C;  4OP0 A;  4E47 A;  2X4X A;  4GY5 A;  2RJE A;  1YIJ A;  2RM4 A;  2CZ1 B;  1M1F A;  5KCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...