4ME7A

Crystal structure of bacillus subtilis toxin mazf in complex with cognate antitoxin maze
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
105
Chain Sequence
MIVKRGDVYFADLVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQIRTIDKQRLTDKITHLDDEMMDKVDEALQISLALID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords mRNA interferase EndoA
publication title Structural Basis of mRNA Recognition and Cleavage by Toxin MazF and Its Regulation by Antitoxin MazE in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
total genus 23
structure length 105
sequence length 115
chains with identical sequence B, C, D
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4me7A00
5HK0A 4MZMA 4OF1A 5HK3A 4ELYC 4VUBA 5CCAA 5CO7A 3HPWA 4HKEA 5CQXA 4MZPA 5HKCA 5CKDA 1VUBA 5CKFA 1UB4A 3JSCA 3TCJA 2VUBA 5CR2A 4MDXA 4MZTA 1M1FA 1X75C 5CQYA 5CKHA 3G7ZA 4ELZC 5CKBA 2C06A 2KMTA 4ME7A 5CKEA 3JRZA 5CK9A 5DLOA 3VUBA 3NFCA 2MF2A 1NE8A
chains in the Genus database with same CATH superfamily
4IUVA 2ECZA 2XHCA 3DLMA 2D8JA 2EWNA 1ABOA 2YRVA 5FU6C 2EYQA 2HNIA 1M9SA 5CKFA 1AWJA 2J05A 3EGDB 2K3YA 3EAEA 4JRPA 4AMCA 2O2OA 2KI7A 3QHSA 4MZTA 4OMMA 4OMQA 5KYYB 4N4IA 3JCMf 1NM7A 3CD6T 2P0KA 1OU9A 5AYFA 3CCLQ 4M75B 2FRWA 2E64A 4XTUA 4J9CA 2HQEA 1VA7A 1PSEA 2MYSA 1WXUA 1XJWB 3I55T 3EGUA 5KH6A 2YRDA 4BY6C 4X34A 3FC3A 1UGVA 2NUPB 3BW1A 2EKOA 3GIBA 3CCRQ 2QEXA 1RAFB 6AT1B 2EGAA 3QWXX 2COYA 4TVRA 1AVZC 3URGA 4OVAA 4FSXA 4B6MA 4E47A 1UUEA 2RHZA 3GNFB 2KBTA 3OYYA 3VRYA 3R6OA 4LDXA 2FRYA 2L3RA 1M2VB 2JMAA 1GFCA 1TUCA 2VYTA 1KQ2A 3JRZA 2FG0A 2RQVA 2HDAA 3M0UA 5D6XA 1GBQA 1WXBA 2CKKA 4M77F 4M7AG 3TSWA 2KVQG 5FROA 1RABB 1G3TA 3JCMg 2RA2A 4M7AF 2YXYA 1GL5A 5A0DA 2OTLQ 2RQWA 3M54A 1ZSGA 1KD1R 3NGPA 4RTXA 5A0GA 3CD6A 2DETA 1AEYA 5GAOm 3ZBDA 2KR3A 4DEYA 1W2BS 1XNIA 2DA9A 1YITQ 1EZZB 1Q7YC 1D0YA 1VQ6T 1JJ2A 4PFOA 2K9GA 1BI3A 4WCIA 1K9MU 2EKHA 3WXMB 3WVEB 2CSIA 1ZUUA 3VUBA 1N6AA 4A53A 3EFSA 4IUUA 4HCCA 2CP0A 3VYGA 1S1NA 1IO6A 3A8HB 3HHTB 4FM4B 3JB9J 1G5VA 4FSSA 2JT4A 2JS0A 4J83A 4J9FA 2DM1A 1VQPQ 2LJ1A 4CC4B 1QVPA 2CP3A 3GOXA 4AFUC 5GAOr 2MAMA 2SRCA 1DJ7B 3CCJA 1VQOQ 1ZLMA 3TU4K 1N9RA 1IREB 4C5HA 1HJDA 1UGSB 1WDXA 4FU6A 4CC2A 4NL2A 1UHFA 3GP8A 1VQKT 4XK8E 3OA6A 1GFDA 3A8OB 2NWMA 3PMIA 1PRMC 4KUDK 1Q86U 1NJIC 4RG8A 3QDFA 3JCMX 5EC7A 2L3PA 4QW2A 1T3SA 1UB4A 3OW2S 2RF0A 4C8QD 4C0FA 1V1CA 3RMQA 4IUQA 4E7IA 3CCLT 2LQKA 4EMKB 1VQ6A 2PVGB 2KXDA 4OGEA 4M7DD 1G3SA 2H3JA 2QA4Q 4DBQA 1D1BA 2DF6A 2CZ0B 2K6DA 1E6HA 1G83A 5GAN2 3OS5A 1WQWA 4XU1A 3CCRT 4M78F 2OAWA 1IRXA 2X3XD 2VGMA 1YBYA 3M0PA 1Q7YR 1VQ4T 1HK9A 2ROTA 1SSHA 2JW4A 3CPWA 2KNBB 2P0PA 4IUTA 2M0YA 4OB2B 5KYYA 2VB6A 2O01E 3CCQQ 2F69A 2OTJQ 2NYSA 4AFZC 4FCYA 4M75A 4PJOD 1LJOA 3F70A 1GBRA 5GAOl 3CXCP 3CQTA 2ZGWA 3VUZA 4M75C 2LTOA 2NUPA 2JTEA 3NFCA 1C6VX 3LW5E 2XK0A 1M30A 3L1AA 3VS2A 1BKBA 2EYWA 1QVGS 5I2MA 5KCOA 4M7DC 2OTLT 4QT7A 1I1JA 3QIIA 3P8DA 1U3OA 1WI7A 1BI1A 2ZAEA 3V7CA 4ZTFA 5IXFA 3CCLA 4FYVB 5EG2A 2FEIA 1ZUYA 3M0SA 3OS2A 2RJCA 4C5GA 2HKNA 1M2VA 4ELYC 2O9SA 1PM3A 4C92B 1BI2A 2PUOB 1WGSA 4XQ3A 2E12A 2DXUA 3E9GA 3HP9A 3VU3C 3CCRA 4L59A 3NMZC 1BU1A 3CBPA 3OS1A 4FW2A 1PG5B 4M75E 4RCCA 4F04B 1VQ4A 4L6V5 3PVQA 2HD0A 4ZNXA 4R0KA 2QQ9A 2EQMA 4PL6A 1YWPA 2A08A 2IPOB 3V8LA 1KFZA 3L42A 1UG1A 5FU6B 3ULRB 3HRSA 2CH4W 1AD5A 5KE2A 2YT6A 1X43A 3WVDB 5GAN6 1VQPT 3BE3A 2QEXQ 1VQLQ 1YWOA 3FJPA 4C8QG 4XU3A 2NLUA 1FMKA 1EFNA 2X4WA 3RMSA 1RACB 2DEQA 4D8KA 2A0FB 1SKUB 5AT1B 1VQOT 4CC7A 2COZA 4AFSC 2K4YA 3L2VA 1C0MA 1M1KU 2KXCA 4KULA 4M7DG 1JEGA 4JJDA 2M02A 4YTLA 2OTLA 1QP2A 4LXCA 1NEBA 1V29B 1YHQQ 2HBPA 4QKUA 2NUTB 3R6NA 2FZGB 1T0JA 3HFOA 3OYAA 1YITA 2E4HA 4PJMA 1ZBJA 4MDWA 4JJCA 1R0CB 3UPUA 4PJOG 1ACMB 2EJ9A 3EHQA 4O6JA 3U23A 3OYLA 2J7IA 1AWWA 3HSBA 3JB9D 3VS0A 2C0TA 2QA4T 1NLOC 2IIMA 4EMHA 2RH2A 5D6WA 4J9IA 2EQUA 4AT1B 4ESRA 4X9DA 2CT3A 3VS7A 3I55Q 1YIJT 1D1AA 3HKSA 4BDZA 1XOVA 3JCMd 5FW9A 4RTYA 4OMPA 1G2BA 1KC8C 1SF9A 1VQPA 1SEMA 1AHJB 2DRMA 3AHUA 3ER0A 2IG0A 2GQVA 3ZL7C 3CCQT 3JB9H 2X35A 2OTJT 1FWZA 2AIRB 2GBQA 3FIFA 4EMKA 3BY7A 1VQOA 1KHIA 1PKTA 1UEBA 2AKLA 4LD9K 1I0CA 3QSUA 1VQMQ 3VS6A 3TSZA 1X6BA 2EVRA 4JZ4A 4N0AA 2MI6A 3MHXA 4EMKC 1G3YA 3JCMb 3CCMQ 5GANe 2D0QB 3A8GB 2LDMA 3ME9A 5CK9A 1ZSZC 3M5AA 1Y57A 2F5KA 2RHXA 1QCOA 4KGXB 4N0AC 2YRCA 5HK3A 4A4HA 4J5YA 1YN8A 3M59A 5FRNA 1OULA 4HVUA 3H0HA 2VVKA 2M51A 2HKQB 1CKBA 3EFRA 1WHKA 4F7UF 2JOYA 2LNVA 5HCKA 2C0OA 1H3HA 1UJ0A 1RLQC 4A4EA 4ZGEB 1KQSP 5KYXB 2MIOA 1OPKA 4FW1A 2LT4A 2QA4A 2P0QA 1M4ZA 4KRTA 1NBEB 1TWBA 1VIEA 2DXCA 5IHKA 4IURA 2DL4A 1M3AA 5CAIA 4OP0A 4M77D 1TG0A 1I07A 2G6FX 3QBYA 5KYWA 5GAN5 1VQ6Q 2EJGA 2PNIA 1GCPA 1K0SA 4OMOA 2L89A 2QGGA 4M7AD 1QW1A 4UC4A 2HSEB 3PIPA 3CCQA 2OTJA 2RI2A 3JCMP 1YI2Q 3AT1B 3H6ZA 5LJ3e 1TUGB 1VQLT 2KY9A 4N4GA 1RADB 3VS5A 2H8HA 4RG2A 3TREA 1ZA1B 3QXEB 2RJEA 4Y91A 3UWNA 4J9DA 2V8IA 2I0NA 3H0IA 2LT1A 3LX7A 5J39A 1IGQA 3VYHB 3JB9G 1RI9A 5D7UA 4PJJA 2QXFA 1B3QA 1VQ9Q 3JB9F 5C0MA 3MCAB 3EG2A 1KD1C 1MNEA 3DKMA 2VWFA 3CXCA 2JZ2A 3V7RA 1VQ8Q 1WHGA 2A37A 1VQKQ 2IVWA 3X25B 8AT1B 2YLCA 1K0XA 5M9OA 5GANg 2DBMA 4RUGA 2CZ6B 3SHWA 2FL7A 4M7AC 2QQSA 5KYUB 1JJ2S 1Y0MA 1Q86C 1JQQA 1BCMA 1WHHA 2LVMA 4BE1A 4OB0B 3SDZA 2HZYA 4NOYA 2JVVA 5I22A 1QVFA 4OMFB 1QWFA 4C8QB 1ZX6A 1Q82U 1D0XA 4C92E 2V1RA 2WSCE 1N5ZA 1PHTA 1ABQA 2GTOA 3H0FA 4OB3B 5LJ5e 5FWBA 2RK2A 2FPFA 3HFNA 2NUTA 2DRKA 1I8FA 3ZEHA 4M7DB 3T9NA 2DFUA 2CP6A 1VQLA 2LMJA 2D6FA 2RN8A 3CBMA 2D1XA 5D6YA 1VQ4Q 4J8OA 1Q81U 5GJWB 3E19A 2AT1B 1U5SA 4EMGA 2P4RA 4Z02A 2L0AA 1VQMT 2KGTA 2DKGA 2FPEA 1ZUKA 2HL3A 2DBKA 1VIFA 2EAYA 2EQKA 1RAIB 1Y07A 1Y7XA 3VJPA 4ZN1A 3BFMA 3EG1A 3CCMT 1YHQA 1YJWT 4DBRA 1T0HA 1JBMA 2LC4A 3ASKA 2JXBA 4PJOB 4M78D 1NYGA 3A8LB 4M77G 5GMKh 5LJ3g 2DO3A 3SWNC 5LJ5f 2M1HA 2KT8A 4FIBA 2F1LA 1I4K1 4M4ZA 5LL6S 3S3NA 5GMKm 2JJ9A 5GAN7 1VQ5T 1AZGB 2KMTA 5FWCA 4JZ3A 4DOVA 2DTOA 4Y92A 2XI9A 1X69A 4GY5A 2VXFA 5GMKj 1YCSB 1E7OA 1AT1B 1VOMA 2HAXA 4HCZA 2F2VA 4QVCA 4EPCA 2QASA 3I55A 2DXBA 5L8RE 1CSKA 5ECAA 2MPXC 3OYDA 1WNLA 1Q86R 3CPWS 4RMOA 5J26A 2ED0A 2C06A 3I35A 4IIMA 2KSSA 1GXIE 3M57A 2KRSA 3LLRA 4E2FB 3PIOA 1KIKA 2A3LA 2FHDA 4BE2A 1QMCA 1YI2T 2DL8A 2XDDA 3OYFA 1VQMA 2AKKA 4JUVA 5KYXA 2CP5A 1K73U 1TXQA 2F5TX 4DBFA 2Y4YA 3ZFJA 3A1PA 3CCMA 3G6ET 2YHTA 1D0ZA 2RI5A 5LJ5g 2JTMA 2QTVA 1M8MA 4HT9A 3GBQA 3M56A 4CRIA 3EG9B 4OF1A 3FLGA 3TQ7P 1OZ2A 1I81A 3C0CA 3CC7Q 2A7YA 3HPWA 3V8JA 1VQ9T 3CEYA 2Y90A 3V7SA 3MEWA 2VXEA 2E5QA 5GMKi 4ORZA 1QP3A 2RD1A 2DJZA 1VQ8T 2W0ZA 4ZGDB 1KSWA 3EGXA 3S3MA 4FYYB 1VQ5A 1UGQB 4R56A 2FZKB 1K9AA 4RCBA 3PT9A 5KCHA 4K11A 4EDUA 2JM8A 3MO8A 5HY6A 2XIDA 3X20B 3RKYA 3QDRB 3CPFA 1AWOA 2P4TA 2PZ1A 3QO3A 2R5MA 3I9QA 2D8HA 1KQSA 1ZSZB 3M58A 5IN1A 3LGLA 1YP5A 4M78G 2DMOA 1UFFA 1YI2A 2K2MA 2RMOA 4J9BA 1WIEA 1WX6A 3CCUT 2YLBA 1IHWA 2R5AA 4V2SA 1YIJQ 3H8ZA 2EBPA 2V26A 5KYUA 4KH1B 4Y28E 4J6YA 4DBHA 3EG3A 1YJNT 4LNPA 5GMKl 4FYXB 4FL6A 4C0DC 1VQ9A 1D09B 4C8QA 3I5RA 4KGZB 1J3TA 2KAFA 1BIBA 2DX1A 3MP8A 4QQDA 2J6KA 3LWHA 4Q5WA 2ESWA 5DLQE 2K5FA 5IH2A 1W4SA 1VQ8A 2E70A 1VQKA 4C8QC 3C94A 4E7KA 1H3ZA 4QQGA 2KYBA 4M7DA 1BB9A 1MMDA 2L5QA 1PKSA 5KYWB 5FLXE 2XICA 4PJLA 1RL2A 4JLGA 2XD0A 1ZQ1A 3A8MB 1S72Q 4E7JA 1VQNQ 1N27A 1YJ9Q 2QTXA 1PNJA 4RTZA 1M1KR 1WZOA 1NLPC 2AZVA 3L2WA 5GJVB 3HTRA 1NYFA 2YUOA 1VUBA 1R0BG 4PJOA 5I11A 1AZEA 1GRIA 3OQ5A 2WSEE 3QYHB 1KK7A 1OOTA 2OI3A 4PJOC 1M90U 3QZ5B 4C8QE 1RI0A 1NPPA 4GBQA 2RQTA 1LCKA 2E1HA 2I2LA 3CCET 4M77B 3CMEQ 1WJSA 1YJNA 4AG1C 2VASA 1WJQA 4M7DE 1RAEB 4M7AB 2EIFA 2LQWA 2MCNA 1RLPC 2J06A 4J7FA 2QYZA 5CKEA 1RAGB 3N5BB 4MMLA 2QG9B 3FJ5A 3CC7T 9ATCB 4BE0A 2X9HA 2K3XA 2RI3A 1WYXA 2ED1A 1Q95G 4J9HA 1MMAA 3LWIA 2EFIA 3E2UA 4ATOA 1OEBA 4LD6A 3OMGA 4WF2A 5GAMe 3SB2A 4A4FA 1IHVA 4PJOE 1X01A 1T3LA 4Z8AA 1WFWA 2RK1A 4QVDA 1B34B 2O4XA 2QQBA 5CO7A 1H8KA 1OYXA 4JPBW 4HCBA 4BD3A 3G71T 2JM9A 2V8JA 3L2UA 2K2VA 3EG9A 2VUBA 4BI8B 4GLMA 1PD1A 3S3OA 2GGRA 4RKUE 3QJ6A 2L3SA 3A98A 3VRZA 4LDYA 3UA6A 1NJIU 4D8DA 2BE9B 2DE0X 1WHMA 3CMAT 2EGEA 2J6FA 3SWNB 1WLPB 4LDVA 3META 1Q82C 1O75A 2QQAA 1JXMA 2L3QA 5GAMf 3G4ST 5GANj 1K76A 5DY9A 1QKXA 1MMNA 1HD3A 2KDSA 2O88A 1H641 4E7HA 2E41A 1MMGA 2ZZDA 4RTUA 5J3BA 1UJYA 2RQRA 2HSPA 4E7SA 3V8KA 3BDUA 2CYZB 3C4SA 3CC7A 3E1SA 1Q81C 3SD4A 2K5LA 3OYEA 4Z89A 2RPNA 1ZSZA 2K7AA 5CR2A 4J9GA 3SFMA 3OB9A 3S6WA 2LP5A 3MJXA 3CXCS 1EX4A 1WXTA 2KQWA 4J6XA 1WPYA 4GLKA 2WSFE 3NHNA 3RR6A 3CC4Q 1YJWQ 5GAN8 4KH0B 2AK5A 3JAME 2HCKA 4IIOA 1N8RU 4PFPA 2O9VA 2DD4A 3JV3A 1QCNA 1SG5A 3JCMh 2DVEA 1S72T 1VQNT 1YJ9T 3G71A 4F7UG 1BBZA 3EH2A 4M78B 3OBWA 2BTTA 3UA7A 3L2QA 1IXDA 2DILA 1QVFS 2RHUA 3REAB 1U06A 2KYMA 1A0NB 1VQ5Q 1GCQC 3UT1A 1BI0A 2EQJA 4ZTJA 5LJ5d 2ZCFB 2RB6A 5GAMg 2OJ2A 2E3IA 2QK0A 2K79A 2HQXA 1YNZA 4J9EA 3CCVT 3CMAA 4AG2C 2K5IA 2K57A 4II1A 1Z9ZA 2DTHA 2ZPGB 1BIAA 3VS1A 3RUXA 1TOVA 5GANf 3IQLA 4C92D 1YIJA 4JJBA 2VKNA 1JRIA 2W10A 1V76A 1PC0A 1K9MC 1OU8A 3FEOA 3CMET 5IXBA 5KE3A 1W2BP 1WQ7A 1YFNA 1W70A 4XTWA 4PFZA 3THKA 3EGXB 2GCXA 3J80E 1Q82R 2KRNA 3M0QA 2LRQA 2RJDA 2XDPA 3H9NA 2CP7A 4C5EA 1JO8A 2Z0WA 2XKOC 1QWEA 4N4HA 3KFVA 1K73C 1HXDA 2EQIA 2LX7A 4BI3A 3G6EQ 5GAN3 2X4JA 3QJYA 3O8VA 2PQWA 4IKFA 4A54A 2VC8A 1Q81R 3UF4A 2EGCA 3JCMQ 1S72A 1W6XA 1VQNA 1YJ9A 4OMNA 1U1TA 2HBWA 4M77A 3EHRA 3VV0A 1OZ3A 1VYVA 1K1ZA 5LJ5j 1M2OA 4Z88A 2MMPA 3O5ZA 4M7AA 4M77C 3JCMV 2YDLA 3X24B 1IGUA 3GNGA 5LJ3f 2GFUA 4JRIA 4C5IA 5DM7R 4C0DB 2O31A 4A4GA 4B9WA 1NEGA 1NPRA 2M16A 1N9SA 1F1BB 4QQ6A 2Y4XA 4XU0A 5FU7C 2EYXA 2DYIA 1UDLA 1PRLC 2BE7D 4KGVB 3CBOA 3CMEA 1YCYA 5HKCA 3L2ZA 2DXTA 2A36A 5C6SA 3M9QA 1B34A 2KEAA 2JTFA 3OW2P 2CUDA 7AT1B 1U8RA 2JNGA 2COWA 3CCUQ 1HYOA 1K8AU 1B7TA 1ZHIA 1Y71A 2R58A 3NTIA 4BUGA 1PCXA 1OV3A 2X4XA 3M0RA 3L2RA 4M77E 3QG1A 2L2PA 4VUBA 1QLYA 1K9MR 1U1SA 1OX8A 1WHJA 2EYYA 3A5ZB 4X9CA 1YJNQ 4M7AE 3QPHA 3JCMc 3UDCA 1KC8U 2XDBA 3JCMW 4F16A 2KT1A 3SWNA 2C0IA 2FPDA 3RKWA 3CC4T 2RNAA 3VS3A 4HA8A 4C92G 1WA7A 1K73R 4L5GA 2RQUA 2JN0A 4C92F 4PK4A 1D3BB 2BZ8A 5CIUA 2FO0A 4JDSA 1R8OB 3CCSQ 3QYGB 2E5KA 2B86A 3M53A 2X4YA 2KK4A 4LDUA 1FMVA 1MHNA 1KQSS 1JB0E 3I56Q 2PTKA 3CCJT 3QWYA 1TU0B 2LX9A 1VYTA 2M9UA 2ATCB 3EG0A 5CCAA 2RHYA 2E65A 3P8HA 2KE9A 1QVGP 2E6ZA 4RTWA 4HXJA 3JSCA 3OYIA 1LNXA 2DVJA 1JXOA 3TEEA 3OYHA 4ANJA 2LCLA 1NE8A 4M78A 3QKJA 4LDWA 1M90C 2PUKB 2CDTA 2V8KA 5L23A 3DB4A 2LJ3A 4LUDA 3CC2Q 2EPDA 3CCEQ 4M78C 1FMWA 1SSFA 3PMTA 2O4XB 2KROA 3EFOB 4A4KA 4F7UB 5CKBA 2ZPFB 5DLOA 4E7ZA 3CC4A 1YJWA 2CT4A 2DEUA 2DL5A 1TSFA 3PVLA 2GF7A 1IB8A 4PJNA 2PVDB 3PE0A 1SHFA 4PKCC 4E7LA 3PFSA 3MKDA 5GMKe 3P8BB 5I21A 3UATA 1RAHB 4RTTA 1I5OB 1M1KC 3NTKA 2NUZA 3LH0A 3OY9A 3RERA 2XU8A 5GAN4 3DB3A 1M1GA 4DOWA 4F17A 1KHCA 2QDLA 2FVUA 1KD1U 4OB1B 3INZA 4M78E 4XTXA 1C1AA 1M27C 3G71Q 1Y96B 1SPKA 4BI4A 4ELZC 1X2QA 2CREA 2P84A 4JLIA 4PLIA 2FZCB 1X27A 3RBBB 1WHLA 3CMAQ 4M75D 3LH5A 5CKDA 2FB7A 1B07A 3RNJA 4HT8A 2LQNA 3G4SQ 3VKIA 2ROLA 3OMCA 3SEMA 3G6EA 2DERA 2DTIA 1W2BA 2DIQA 5A0LA 2HEQA 1M90R 2PVOB 5GAMd 1RUWA 2V1QA 2CSQA 2JUFA 1HSQA 2PU9B 4FT4A 3EGDA 1W1FA 2DYBA 2DIGA 1UGPB 2DZ9A 4MMKA 4DA4A 1TH7A 2DL7A 2L8DA 4X1VA 1M3CA 2GTJA 1LOJA 3CCST 2DJQA 4F14A 1VQ7Q 1N8RC 2HQHA 5FRMA 1M1FA 2XMFA 4LE9A 1D1CA 1PSFA 3VS4A 3I56T 3RDVA 3DLLA 2QAZA 2H3EB 3HL8A 2GFAA 5GAOp 4ZN3A 4R55A 1Z9QA 5GAMh 2F2XA 2LNHB 4HKEA 1MNDA 3CCVQ 1TS9A 2BUDA 1X75C 4A63B 1D3BA 3CCUA 2GQIA 3Q1JA 1KQ1A 1QVFP 2RM4A 1LVKA 2YUPA 3LGFA 3TCJA 2BZXA 3FRNA 1YITT 3JB9I 1UECA 2CS7A 1Q7YU 3CC2T 2B8AA 5GAMj 5CQXA 2ZPHB 1JU5C 1NJIR 2DK3A 3G1JA 1FX7A 2EJFA 1TTHB 2OAUA 4DQ2A 3MP6A 2QQRA 3FB9A 2VGNA 5IHNA 1M8VA 5GANd 5CQYA 3OW2A 4XAXB 4KUIA 1XTDA 3NPFA 3OYKA 4ME7A 2MOXA 3OYCA 2MF2A 3OSSC 1OI1A 2G3RA 3M4GA 2X3WD 5FU7B 2DZCA 2WACA 3CCSA 2DD5A 1FYNA 4JS5A 1UTIA 2MWOA 4M75G 2VV5A 4O5VA 3I56A 4M75F 2M0OA 1MGQA 4C8QF 3M0TA 2JS2A 3OS0A 3MPUB 3EFOA 4J7IA 4JRKA 4F7UA 1BK2A 3KBGA 4HCKA 5GANh 4CC3A 3MEAA 3REBB 4BY6B 4M7DF 3RIRA 4WTOB 1H92A 2F2WA 1N8RR 1R77A 4D6WA 3PNWC 4ZGJB 4RTVA 3C95A 1ARKA 1TUDA 3KUFA 1G8XA 2EW3A 3GLXA 4KT0E 5KYNA 5GAOq 2CZ7B 1UHCA 1RAAB 1X6OA 1SRLA 2QGFB 2J6OA 1QCFA 5LJ3d 3CC2A 3CCEA 4AFQC 2RO0A 1QVGA 1JJ2P 2LZ6B 2AZSA 1I5LA 3G7ZA 3J7AF 4OMLA 5CVIA 4XTVA 2R57A 4JRQA 4PJOF 3CD6Q 3I5SA 8ATCB 4QVZA 3NTHA 1Y96A 2ABLA 2XG8D 2MWPA 1K8AC 3C12A 2D0NA 1OQKA 4FYWB 2SEMA 2BZYA 3EH1A 3RESA 4XTZA 2ENMA 1UGRB 2QI2A 2A28A 4MDXA 4BB7A 4F7UE 2YUNA 3MEUA 3OYNA 1X2KA 1OX9A 2D9TA 2LCCA 4EIKA 4XTYA 2DL3A 4C0ZA 5IHIA 3QZ9B 2LJ0A 3FDRA 2ZPIB 1AWXA 1FXXA 4B9XA 3OYMA 4JJNK 2MK5A 5LJ3h 4E6RA 2CZ1B 3BDLA 1M3BA 4MZMA 3OYBA 1NZ9A 1ZBXA 1VQ7T 3MEVA 3HRUA 4PLLA 3X28B 4KBMB 2HL5C 1GCQA 2RJFA 4CI0C 2BKDN 1IZ6A 2QDYB 1XQHA 3M4YA 4IUPA 4FT2A 3KXTA 4C0GA 2GNCA 2CGHA 3QUIA 1SRMA 3J81E 3CCJQ 4LN2A 5LJ3j 2FYKA 2ZPEB 2LCSA 2HMAA 5I2SA 3OBYA 3G4SA 2DAQA 2X51A 4XU2A 4JS4A 3TVTA 2YWWA 2K3BA 4PNOA 1CKAA 2BIVA 2CP2A 1G3WA 4HVWA 4P5NA 4NS5A 2YUQA 3H41A 1NG2A 2RHIA 3OSVA 3RKXA 2E6NA 1K4US 1E6GA 5IAYA 1P92A 5A2QE 1BYMA 1AOJA 2OX7A 5CKHA 1M5Q1 1KG1A 1X6GA 2CUBA 3CPWP 4HVVA 3GF5A 5LJ5h 3JCMJ 2JMCA 5HK0A 3PTAA 4BACA 1K8AR 4NL3A 1PWTA 1LPLA 3M55A 3PGGA 1VQ7A 2CH4A 2QEXT 2E3HA 2LQ8A 3OYGA 1ZA2B 2KRMA 3MP1A 4LUEA 1QQJA 4C92A 1MUZA 3D7SB 3HRTA 1QKWA 3LYIA 4DEXA 5IT9E 1O9SA 3JCMe 3X26B 2ZPBB 1UE9A 3E9FA 1KC8R 4BDYA 4C92C 1BCOA 1SHGA 1VYUA 3OYJA 4J6WA 1WJRA 3GPLA 4MZPA 4OGCA 5GAOn 2EYZA 3CCVA 1MV0B 1YHQT 2AHJB 2DPPB 1PD0A 2E10A 2YSQA 2DLPA 2DNUA 1OPLA 1MV3A 1KJWA 1EIFA
chains in the Genus database with same CATH topology
3ER0A 2IG0A 1YJWA 4IUVA 2GQVA 3CCQT 3JB9H 2X35A 2OTJT 2XHCA 1FWZA 2GF7A 3DLMA 3FIFA 2EWNA 3BY7A 4EMKA 1VQOA 2PVDB 1KHIA 3L2WA 1UEBA 2YRVA 4LD9K 5FU6C 1VUBA 2EYQA 3QSUA 2HNIA 1M9SA 5CKFA 4PJOA 4PKCC 4E7LA 3PFSA 2K3YA 3EAEA 5GMKe 3P8BB 5I21A 4JRPA 4MZTA 2MI6A 3MHXA 3QHSA 4N0AA 3OQ5A 2WSEE 3QYHB 4EMKC 4N4IA 3JCMf 1M1KC 1G3YA 3NTKA 3CC2A 3CD6T 3JCMb 5GANe 2D0QB 2P0KA 5AYFA 3A8GB 2LDMA 3LH0A 3ME9A 3OY9A 5CK9A 3QZ5B 4C8QE 1M90U 1RI0A 3M5AA 2XU8A 4M75B 5GAN4 3RERA 3DB3A 2F5KA 2RHXA 2E64A 1NPPA 1M1GA 4XTUA 4N0AC 2HQEA 5HK3A 4DOWA 4A4HA 2E1HA 1PSEA 4J5YA 2I2LA 3M59A 3CCET 5FRNA 3I55T 1KHCA 4M77B 5KH6A 2FVUA 1KD1U 4OB1B 1WJSA 3INZA 1YJNA 4BY6C 4X34A 4M78E 3FC3A 1WJQA 4M7DE 3BW1A 4XTXA 2EKOA 3GIBA 1Y96B 4M7AB 2EIFA 3EFRA 2QEXA 4F7UF 2JOYA 2LNVA 4BI4A 4ELZC 4J7FA 5CKEA 3N5BB 4MMLA 4A4EA 4TVRA 4ZGEB 3URGA 4OVAA 3CC7T 4JLIA 4PLIA 2LT4A 2QA4A 4BE0A 4FSXA 2P0QA 1M4ZA 2K3XA 2RI3A 4E47A 2RHZA 3GNFB 4M75D 5CKDA 1VIEA 3LWIA 2EFIA 3OYYA 2DXCA 2FB7A 4LD6A 3OMGA 4ATOA 4WF2A 4IURA 4HT8A 3R6OA 4LDXA 5GAMe 3SB2A 4OP0A 5CAIA 2L3RA 4M77D 3VKIA 3QBYA 4A4FA 2VYTA 5GAN5 4PJOE 1KQ2A 1X01A 2EJGA 3JRZA 2RK1A 4QVDA 2L89A 3OMCA 1B34B 2O4XA 3G6EA 4M7AD 1QW1A 2QQBA 4UC4A 3PIPA 5D6XA 2CKKA 4M77F 3CCQA 2DTIA 5CO7A 2OTJA 1OYXA 4HCBA 4BD3A 2RI2A 2DIQA 5A0LA 3G71T 1W2BA 3JCMP 4M7AG 2V8JA 2KVQG 2PVOB 5FROA 5GAMd 3L2UA 2K2VA 1G3TA 3JCMg 3H6ZA 2VUBA 2RA2A 4BI8B 5LJ3e 4M7AF 1VQLT 3S3OA 5A0DA 2JUFA 2KY9A 4RKUE 3M54A 2PU9B 4N4GA 3QJ6A 4FT4A 4LDYA 4RG2A 3TREA 5A0GA 3QXEB 2RJEA 4Y91A 3CD6A 1NJIU 3UWNA 2DIGA 1UGPB 2V8IA 2DZ9A 4MMKA 5GAOm 3ZBDA 4DA4A 1TH7A 3CMAT 1W2BS 1XNIA 2LT1A 3LX7A 2L8DA 5J39A 3SWNB 3VYHB 4LDVA 3JB9G 3META 1LOJA 3CCST 1Q82C 1O75A 2QQAA 5GAMf 1Q7YC 3G4ST 5GANj 2QXFA 1N8RC 3JB9F 5FRMA 5C0MA 5DY9A 1M1FA 3MCAB 1VQ6T 1JJ2A 1KD1C 3DKMA 1PSFA 3I56T 1BI3A 1K9MU 3DLLA 2KDSA 3WXMB 3WVEB 3CXCA 1H641 4E7HA 2E41A 2ZZDA 2JZ2A 3V7RA 5J3BA 3VUBA 1N6AA 3HL8A 2GFAA 3EFSA 4A53A 3V8KA 3BDUA 4ZN3A 5GAOp 4IUUA 4R55A 2IVWA 5GAMh 2CYZB 3X25B 4HCCA 3C4SA 3VYGA 2YLCA 3CC7A 3E1SA 3A8HB 1Q81C 3HHTB 4FM4B 4HKEA 5M9OA 3SD4A 5GANg 2K5LA 2CZ6B 3OYEA 2FL7A 3JB9J 1G5VA 4M7AC 2QQSA 1JJ2S 1Q86C 5CR2A 3SFMA 3OB9A 3S6WA 2BUDA 2LVMA 4BE1A 1X75C 4OB0B 4J83A 3CXCS 3SDZA 2KQWA 1D3BA 3CCUA 4J6XA 4NOYA 3Q1JA 1KQ1A 1WPYA 4GLKA 2RM4A 2WSFE 2JVVA 3LGFA 3TCJA 1QVFA 4OMFB 1QVPA 3FRNA 5GAN8 4C8QB 1YITT 3JB9I 3GOXA 1Q82U 3JAME 2CS7A 4C92E 5GAOr 2MAMA 2WSCE 1DJ7B 3CCJA 1Q7YU 1N8RU 3CC2T 2B8AA 2DD4A 5GAMj 5CQXA 3TU4K 2ZPHB 1N9RA 4OB3B 5LJ5e 3JCMh 2DK3A 2DVEA 1S72T 1FX7A 2RK2A 1YJ9T 1IREB 2EJFA 3HFNA 3G71A 1VQNT 4C5HA 4F7UG 2OAUA 4DQ2A 1I8FA 3MP6A 3OBWA 4M78B 2QQRA 1UGSB 3FB9A 3T9NA 2VGNA 3ZEHA 4M7DB 4FU6A 3L2QA 5GANd 5CQYA 3OW2A 4NL2A 1M8VA 4XAXB 3GP8A 1VQLA 4KUIA 1VQKT 2D6FA 1XTDA 4XK8E 3OA6A 1QVFS 3OYKA 2RHUA 4ME7A 3CBMA 5D6YA 3OYCA 3A8OB 2MF2A 3OSSC 4J8OA 1Q81U 3PMIA 3E19A 1OI1A 1BI0A 3UT1A 4EMGA 4KUDK 2EQJA 4ZTJA 5LJ5d 2G3RA 4Z02A 3M4GA 2ZCFB 2RB6A 5GAMg 5FU7B 2DZCA 2HQXA 1VQMT 1Q86U 2DKGA 3CCVT 3CMAA 4RG8A 1NJIC 3JCMX 2WACA 2K5IA 2K57A 4QW2A 4II1A 2EAYA 1VIFA 2EQKA 1UB4A 3CCSA 1Y7XA 1Y07A 2DD5A 2DTHA 2ZPGB 3RMQA 1BIAA 3VJPA 4C0FA 4C8QD 4ZN1A 3BFMA 4IUQA 3RUXA 4E7IA 4JS5A 3CCMT 5GANf 2MWOA 4C92D 3CCLT 4M75G 2LQKA 4EMKB 1YIJA 1YHQA 1VQ6A 1YJWT 2PVGB 1JBMA 2LC4A 2VV5A 4O5VA 1JRIA 3ASKA 4M75F 4OGEA 3I56A 4PJOB 2M0OA 4M78D 1MGQA 4C8QF 3A8LB 4M77G 5GMKh 4M7DD 1G3SA 2H3JA 5LJ3g 2DO3A 3SWNC 3OS0A 1K9MC 3FEOA 5LJ5f 2M1HA 4J7IA 4FIBA 3CMET 4JRKA 4F7UA 5KE3A 3KBGA 2CZ0B 1I4K1 5GANh 1WQ7A 5GAN2 3OS5A 3MEAA 1WQWA 4XU1A 3CCRT 4XTWA 4BY6B 4M78F 5LL6S 3S3NA 4M7DF 2GCXA 2VGMA 3J80E 3RIRA 1YBYA 2LRQA 2RJDA 2XDPA 4C5EA 5GMKm 1VQ4T 1HK9A 5GAN7 2XKOC 1VQ5T 4D6WA 4N4HA 3PNWC 4ZGJB 3C95A 2KMTA 3KUFA 3CPWA 1K73C 1HXDA 3GLXA 4KT0E 2P0PA 4BI3A 4IUTA 4DOVA 5GAOq 5GAN3 2DTOA 2XI9A 2CZ7B 4OB2B 2X4JA 3QJYA 1X6OA 2O01E 4GY5A 2VXFA 5GMKj 3O8VA 2F69A 2PQWA 4IKFA 2HAXA 4HCZA 4A54A 5LJ3d 4M75A 4QVCA 3CCEA 4EPCA 2VC8A 2RO0A 3I55A 2DXBA 5L8RE 1QVGA 4PJOD 3JCMQ 1LJOA 3F70A 1S72A 1VQNA 1YJ9A 3OYDA 1U1TA 1WNLA 5GAOl 4M77A 3CPWS 3G7ZA 4RMOA 1I5LA 3J7AF 5CVIA 5J26A 4XTVA 2ZGWA 2R57A 1OZ3A 4M75C 3VUZA 3VV0A 2C06A 2KSSA 2LTOA 4PJOF 4JRQA 1GXIE 3NFCA 3M57A 3LLRA 4QVZA 3NTHA 3PIOA 3LW5E 5LJ5j 1Y96A 2MMPA 4M7AA 2XG8D 2XK0A 2MWPA 1K8AC 3L1AA 2A3LA 2FHDA 1BKBA 3C12A 4M77C 3JCMV 4BE2A 1YI2T 2XDDA 3X24B 1QVGS 3GNGA 5I2MA 3OYFA 5KCOA 5LJ3f 2GFUA 3RESA 4JRIA 4XTZA 1VQMA 4M7DC 4JUVA 2OTLT 1UGRB 2QI2A 4C5IA 4MDXA 4BB7A 5DM7R 4C0DB 1K73U 4F7UE 3QIIA 3MEUA 4A4GA 2F5TX 3P8DA 3OYNA 4B9WA 2Y4YA 1BI1A 1NPRA 2M16A 3ZFJA 1N9SA 2D9TA 2LCCA 3V7CA 3CCMA 4XTYA 3G6ET 4ZTFA 3CCLA 4C0ZA 2YHTA 5EG2A 2RI5A 5LJ5g 4QQ6A 2Y4XA 2JTMA 3QZ9B 3OS2A 3FDRA 2ZPIB 4B9XA 1FXXA 3OYMA 4HT9A 4XU0A 3M56A 5LJ3h 2RJCA 4CRIA 4JJNK 2CZ1B 3BDLA 4MZMA 4OF1A 3FLGA 5FU7C 4C5GA 3OYBA 1NZ9A 1OZ2A 4ELYC 1ZBXA 1I81A 2A7YA 3CBOA 4C92B 1VQ7T 3HPWA 3CMEA 3V8JA 1YCYA 3CEYA 1BI2A 2Y90A 2DXTA 3L2ZA 2PUOB 1WGSA 3MEVA 3MEWA 4XQ3A 3V7SA 5C6SA 2VXEA 3M9QA 4PJOC 1B34A 2E12A 2DXUA 3E9GA 2JTFA 3HRUA 3HP9A 2E5QA 4PLLA 3X28B 5GMKi 4KBMB 3VU3C 3CCRA 4L59A 2RJFA 1QP3A 3CBPA 4CI0C 2RD1A 2JNGA 3OW2S 3OS1A 1U8RA 2BKDN 2DJZA 1IZ6A 2QDYB 1VQ8T 4M75E 4RCCA 1K8AU 1XQHA 1VQ4A 1ZHIA 4ZGDB 3M4YA 1Y71A 3S3MA 4IUPA 1VQ5A 2R58A 4FT2A 1UGQB 3NTIA 4L6V5 4BUGA 4R56A 3KXTA 2HD0A 4C0GA 2QQ9A 2X4XA 3L2RA 2CGHA 2EQMA 4M77E 4RCBA 3QG1A 5HKCA 3QUIA 4VUBA 3J81E 4PL6A 3PT9A 5LJ3j 1U1SA 5KCHA 2FYKA 2ZPEB 4EDUA 5I2SA 3AHUA 3A5ZB 4X9CA 3V8LA 4M7AE 3QPHA 3L42A 3JCMc 5FU6B 3UDCA 3OBYA 1KC8U 3MO8A 5HY6A 2XIDA 3JCMW 3HRSA 2XDBA 5KE2A 3G4SA 3X20B 2DAQA 3RKYA 3QDRB 3SWNA 3WVDB 5GAN6 3CPFA 1VQPT 3RKWA 3FJPA 2P4TA 4C8QG 4XU3A 2NLUA 3CC4T 3QO3A 2X4WA 4XU2A 3RMSA 2R5MA 4JS4A 4HA8A 2DEQA 4PNOA 4C92G 2BIVA 1VQOT 1KQSA 4L5GA 1G3WA 4P5NA 3M58A 2JN0A 4NS5A 5IN1A 4C92F 1D3BB 3LGLA 5CIUA 2K4YA 2RHIA 4M78G 3L2VA 1M1KU 3OSVA 4KULA 3RKXA 2E6NA 4JDSA 4M7DG 1YI2A 5IAYA 1R8OB 3CCUT 1P92A 5A2QE 3QYGB 1BYMA 4YTLA 1VQ9T 2OTLA 2YLBA 3M53A 2R5AA 4V2SA 1QP2A 5CKHA 1M5Q1 2X4YA 1KG1A 1V29B 3H8ZA 2KK4A 4LDUA 2HBPA 3GF5A 5LJ5h 1MHNA 1KQSS 1JB0E 3JCMJ 3CCJT 5HK0A 3PTAA 4Y28E 2LX9A 2M9UA 4J6YA 4BACA 1YJNT 5CCAA 3HFOA 2RHYA 3OYAA 1YITA 2E65A 3P8HA 5GMKl 4NL3A 2E6ZA 3PGGA 3M55A 4MDWA 1VQ7A 4FL6A 4C0DC 3JSCA 2QEXT 1VQ9A 2LQ8A 4C8QA 3OYGA 3OYIA 1LNXA 1BIBA 2KAFA 3MP1A 3MP8A 3TEEA 3OYHA 3UPUA 4QQDA 3LWHA 4Q5WA 4C92A 4PJOG 3HRTA 5DLQE 3LYIA 2EJ9A 2K5FA 4O6JA 5IT9E 1O9SA 1W4SA 3OYLA 3JCMe 3X26B 1VQ8A 2E70A 2ZPBB 3HSBA 3E9FA 3JB9D 4C8QC 2LCLA 1NE8A 3C94A 4M78A 2QA4T 4E7KA 1VQKA 4BDYA 4QQGA 4M7DA 1H3ZA 3QKJA 4LDWA 4C92C 4EMHA 1M90C 2RH2A 2PUKB 5D6WA 3OYJA 2EQUA 2L5QA 2V8KA 4J6WA 1WJRA 4X9DA 3GPLA 4MZPA 3DB4A 4OGCA 5FLXE 2XICA 4M78C 5GAOn 3CCVA 1YIJT 1RL2A 4JLGA 1YHQT 1SSFA 2XD0A 1ZQ1A 3A8MB 3HKSA 2AHJB 3PMTA 1N27A 2DPPB 1XOVA 2O4XB 2QTXA 4BDZA 4E7JA 3JCMd 4A4KA 2E10A 4F7UB 5CKBA 2ZPFB 1KC8C 1VQPA 5DLOA 1AHJB 3CC4A 1EIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HK0 A;  4MZM A;  4OF1 A;  5HK3 A;  4ELY C;  4VUB A;  5CCA A;  5CO7 A;  3HPW A;  4HKE A;  5CQX A;  4MZP A;  5HKC A;  5CKD A;  1VUB A;  5CKF A;  1UB4 A;  3JSC A;  3TCJ A;  2VUB A;  5CR2 A;  4MDX A;  4MZT A;  1M1F A;  1X75 C;  5CQY A;  5CKH A;  3G7Z A;  4ELZ C;  5CKB A;  2C06 A;  2KMT A;  4ME7 A;  5CKE A;  3JRZ A;  5CK9 A;  5DLO A;  3VUB A;  3NFC A;  2MF2 A;  1NE8 A; 
#chains in the Genus database with same CATH topology
 4IUV A;  2ECZ A;  2XHC A;  3DLM A;  2D8J A;  2EWN A;  1ABO A;  2YRV A;  5FU6 C;  2EYQ A;  2HNI A;  1M9S A;  5CKF A;  1AWJ A;  2J05 A;  3EGD B;  2K3Y A;  3EAE A;  4JRP A;  4AMC A;  2O2O A;  2KI7 A;  3QHS A;  4MZT A;  4OMM A;  4OMQ A;  5KYY B;  4N4I A;  3JCM f;  1NM7 A;  3CD6 T;  2P0K A;  1OU9 A;  5AYF A;  3CCL Q;  4M75 B;  2FRW A;  2E64 A;  4XTU A;  4J9C A;  2HQE A;  1VA7 A;  1PSE A;  2MYS A;  1WXU A;  1XJW B;  3I55 T;  3EGU A;  5KH6 A;  2YRD A;  4BY6 C;  4X34 A;  3FC3 A;  1UGV A;  2NUP B;  3BW1 A;  2EKO A;  3GIB A;  3CCR Q;  2QEX A;  1RAF B;  6AT1 B;  2EGA A;  3QWX X;  2COY A;  4TVR A;  1AVZ C;  3URG A;  4OVA A;  4FSX A;  4B6M A;  4E47 A;  1UUE A;  2RHZ A;  3GNF B;  2KBT A;  3OYY A;  3VRY A;  3R6O A;  4LDX A;  2FRY A;  2L3R A;  1M2V B;  2JMA A;  1GFC A;  1TUC A;  2VYT A;  1KQ2 A;  3JRZ A;  2FG0 A;  2RQV A;  2HDA A;  3M0U A;  5D6X A;  1GBQ A;  1WXB A;  2CKK A;  4M77 F;  4M7A G;  3TSW A;  2KVQ G;  5FRO A;  1RAB B;  1G3T A;  3JCM g;  2RA2 A;  4M7A F;  2YXY A;  1GL5 A;  5A0D A;  2OTL Q;  2RQW A;  3M54 A;  1ZSG A;  1KD1 R;  3NGP A;  4RTX A;  5A0G A;  3CD6 A;  2DET A;  1AEY A;  5GAO m;  3ZBD A;  2KR3 A;  4DEY A;  1W2B S;  1XNI A;  2DA9 A;  1YIT Q;  1EZZ B;  1Q7Y C;  1D0Y A;  1VQ6 T;  1JJ2 A;  4PFO A;  2K9G A;  1BI3 A;  4WCI A;  1K9M U;  2EKH A;  3WXM B;  3WVE B;  2CSI A;  1ZUU A;  3VUB A;  1N6A A;  4A53 A;  3EFS A;  4IUU A;  4HCC A;  2CP0 A;  3VYG A;  1S1N A;  1IO6 A;  3A8H B;  3HHT B;  4FM4 B;  3JB9 J;  1G5V A;  4FSS A;  2JT4 A;  2JS0 A;  4J83 A;  4J9F A;  2DM1 A;  1VQP Q;  2LJ1 A;  4CC4 B;  1QVP A;  2CP3 A;  3GOX A;  4AFU C;  5GAO r;  2MAM A;  2SRC A;  1DJ7 B;  3CCJ A;  1VQO Q;  1ZLM A;  3TU4 K;  1N9R A;  1IRE B;  4C5H A;  1HJD A;  1UGS B;  1WDX A;  4FU6 A;  4CC2 A;  4NL2 A;  1UHF A;  3GP8 A;  1VQK T;  4XK8 E;  3OA6 A;  1GFD A;  3A8O B;  2NWM A;  3PMI A;  1PRM C;  4KUD K;  1Q86 U;  1NJI C;  4RG8 A;  3QDF A;  3JCM X;  5EC7 A;  2L3P A;  4QW2 A;  1T3S A;  1UB4 A;  3OW2 S;  2RF0 A;  4C8Q D;  4C0F A;  1V1C A;  3RMQ A;  4IUQ A;  4E7I A;  3CCL T;  2LQK A;  4EMK B;  1VQ6 A;  2PVG B;  2KXD A;  4OGE A;  4M7D D;  1G3S A;  2H3J A;  2QA4 Q;  4DBQ A;  1D1B A;  2DF6 A;  2CZ0 B;  2K6D A;  1E6H A;  1G83 A;  5GAN 2;  3OS5 A;  1WQW A;  4XU1 A;  3CCR T;  4M78 F;  2OAW A;  1IRX A;  2X3X D;  2VGM A;  1YBY A;  3M0P A;  1Q7Y R;  1VQ4 T;  1HK9 A;  2ROT A;  1SSH A;  2JW4 A;  3CPW A;  2KNB B;  2P0P A;  4IUT A;  2M0Y A;  4OB2 B;  5KYY A;  2VB6 A;  2O01 E;  3CCQ Q;  2F69 A;  2OTJ Q;  2NYS A;  4AFZ C;  4FCY A;  4M75 A;  4PJO D;  1LJO A;  3F70 A;  1GBR A;  5GAO l;  3CXC P;  3CQT A;  2ZGW A;  3VUZ A;  4M75 C;  2LTO A;  2NUP A;  2JTE A;  3NFC A;  1C6V X;  3LW5 E;  2XK0 A;  1M30 A;  3L1A A;  3VS2 A;  1BKB A;  2EYW A;  1QVG S;  5I2M A;  5KCO A;  4M7D C;  2OTL T;  4QT7 A;  1I1J A;  3QII A;  3P8D A;  1U3O A;  1WI7 A;  1BI1 A;  2ZAE A;  3V7C A;  4ZTF A;  5IXF A;  3CCL A;  4FYV B;  5EG2 A;  2FEI A;  1ZUY A;  3M0S A;  3OS2 A;  2RJC A;  4C5G A;  2HKN A;  1M2V A;  4ELY C;  2O9S A;  1PM3 A;  4C92 B;  1BI2 A;  2PUO B;  1WGS A;  4XQ3 A;  2E12 A;  2DXU A;  3E9G A;  3HP9 A;  3VU3 C;  3CCR A;  4L59 A;  3NMZ C;  1BU1 A;  3CBP A;  3OS1 A;  4FW2 A;  1PG5 B;  4M75 E;  4RCC A;  4F04 B;  1VQ4 A;  4L6V 5;  3PVQ A;  2HD0 A;  4ZNX A;  4R0K A;  2QQ9 A;  2EQM A;  4PL6 A;  1YWP A;  2A08 A;  2IPO B;  3V8L A;  1KFZ A;  3L42 A;  1UG1 A;  5FU6 B;  3ULR B;  3HRS A;  2CH4 W;  1AD5 A;  5KE2 A;  2YT6 A;  1X43 A;  3WVD B;  5GAN 6;  1VQP T;  3BE3 A;  2QEX Q;  1VQL Q;  1YWO A;  3FJP A;  4C8Q G;  4XU3 A;  2NLU A;  1FMK A;  1EFN A;  2X4W A;  3RMS A;  1RAC B;  2DEQ A;  4D8K A;  2A0F B;  1SKU B;  5AT1 B;  1VQO T;  4CC7 A;  2COZ A;  4AFS C;  2K4Y A;  3L2V A;  1C0M A;  1M1K U;  2KXC A;  4KUL A;  4M7D G;  1JEG A;  4JJD A;  2M02 A;  4YTL A;  2OTL A;  1QP2 A;  4LXC A;  1NEB A;  1V29 B;  1YHQ Q;  2HBP A;  4QKU A;  2NUT B;  3R6N A;  2FZG B;  1T0J A;  3HFO A;  3OYA A;  1YIT A;  2E4H A;  4PJM A;  1ZBJ A;  4MDW A;  4JJC A;  1R0C B;  3UPU A;  4PJO G;  1ACM B;  2EJ9 A;  3EHQ A;  4O6J A;  3U23 A;  3OYL A;  2J7I A;  1AWW A;  3HSB A;  3JB9 D;  3VS0 A;  2C0T A;  2QA4 T;  1NLO C;  2IIM A;  4EMH A;  2RH2 A;  5D6W A;  4J9I A;  2EQU A;  4AT1 B;  4ESR A;  4X9D A;  2CT3 A;  3VS7 A;  3I55 Q;  1YIJ T;  1D1A A;  3HKS A;  4BDZ A;  1XOV A;  3JCM d;  5FW9 A;  4RTY A;  4OMP A;  1G2B A;  1KC8 C;  1SF9 A;  1VQP A;  1SEM A;  1AHJ B;  2DRM A;  3AHU A;  3ER0 A;  2IG0 A;  2GQV A;  3ZL7 C;  3CCQ T;  3JB9 H;  2X35 A;  2OTJ T;  1FWZ A;  2AIR B;  2GBQ A;  3FIF A;  4EMK A;  3BY7 A;  1VQO A;  1KHI A;  1PKT A;  1UEB A;  2AKL A;  4LD9 K;  1I0C A;  3QSU A;  1VQM Q;  3VS6 A;  3TSZ A;  1X6B A;  2EVR A;  4JZ4 A;  4N0A A;  2MI6 A;  3MHX A;  4EMK C;  1G3Y A;  3JCM b;  3CCM Q;  5GAN e;  2D0Q B;  3A8G B;  2LDM A;  3ME9 A;  5CK9 A;  1ZSZ C;  3M5A A;  1Y57 A;  2F5K A;  2RHX A;  1QCO A;  4KGX B;  4N0A C;  2YRC A;  5HK3 A;  4A4H A;  4J5Y A;  1YN8 A;  3M59 A;  5FRN A;  1OUL A;  4HVU A;  3H0H A;  2VVK A;  2M51 A;  2HKQ B;  1CKB A;  3EFR A;  1WHK A;  4F7U F;  2JOY A;  2LNV A;  5HCK A;  2C0O A;  1H3H A;  1UJ0 A;  1RLQ C;  4A4E A;  4ZGE B;  1KQS P;  5KYX B;  2MIO A;  1OPK A;  4FW1 A;  2LT4 A;  2QA4 A;  2P0Q A;  1M4Z A;  4KRT A;  1NBE B;  1TWB A;  1VIE A;  2DXC A;  5IHK A;  4IUR A;  2DL4 A;  1M3A A;  5CAI A;  4OP0 A;  4M77 D;  1TG0 A;  1I07 A;  2G6F X;  3QBY A;  5KYW A;  5GAN 5;  1VQ6 Q;  2EJG A;  2PNI A;  1GCP A;  1K0S A;  4OMO A;  2L89 A;  2QGG A;  4M7A D;  1QW1 A;  4UC4 A;  2HSE B;  3PIP A;  3CCQ A;  2OTJ A;  2RI2 A;  3JCM P;  1YI2 Q;  3AT1 B;  3H6Z A;  5LJ3 e;  1TUG B;  1VQL T;  2KY9 A;  4N4G A;  1RAD B;  3VS5 A;  2H8H A;  4RG2 A;  3TRE A;  1ZA1 B;  3QXE B;  2RJE A;  4Y91 A;  3UWN A;  4J9D A;  2V8I A;  2I0N A;  3H0I A;  2LT1 A;  3LX7 A;  5J39 A;  1IGQ A;  3VYH B;  3JB9 G;  1RI9 A;  5D7U A;  4PJJ A;  2QXF A;  1B3Q A;  1VQ9 Q;  3JB9 F;  5C0M A;  3MCA B;  3EG2 A;  1KD1 C;  1MNE A;  3DKM A;  2VWF A;  3CXC A;  2JZ2 A;  3V7R A;  1VQ8 Q;  1WHG A;  2A37 A;  1VQK Q;  2IVW A;  3X25 B;  8AT1 B;  2YLC A;  1K0X A;  5M9O A;  5GAN g;  2DBM A;  4RUG A;  2CZ6 B;  3SHW A;  2FL7 A;  4M7A C;  2QQS A;  5KYU B;  1JJ2 S;  1Y0M A;  1Q86 C;  1JQQ A;  1BCM A;  1WHH A;  2LVM A;  4BE1 A;  4OB0 B;  3SDZ A;  2HZY A;  4NOY A;  2JVV A;  5I22 A;  1QVF A;  4OMF B;  1QWF A;  4C8Q B;  1ZX6 A;  1Q82 U;  1D0X A;  4C92 E;  2V1R A;  2WSC E;  1N5Z A;  1PHT A;  1ABQ A;  2GTO A;  3H0F A;  4OB3 B;  5LJ5 e;  5FWB A;  2RK2 A;  2FPF A;  3HFN A;  2NUT A;  2DRK A;  1I8F A;  3ZEH A;  4M7D B;  3T9N A;  2DFU A;  2CP6 A;  1VQL A;  2LMJ A;  2D6F A;  2RN8 A;  3CBM A;  2D1X A;  5D6Y A;  1VQ4 Q;  4J8O A;  1Q81 U;  5GJW B;  3E19 A;  2AT1 B;  1U5S A;  4EMG A;  2P4R A;  4Z02 A;  2L0A A;  1VQM T;  2KGT A;  2DKG A;  2FPE A;  1ZUK A;  2HL3 A;  2DBK A;  1VIF A;  2EAY A;  2EQK A;  1RAI B;  1Y07 A;  1Y7X A;  3VJP A;  4ZN1 A;  3BFM A;  3EG1 A;  3CCM T;  1YHQ A;  1YJW T;  4DBR A;  1T0H A;  1JBM A;  2LC4 A;  3ASK A;  2JXB A;  4PJO B;  4M78 D;  1NYG A;  3A8L B;  4M77 G;  5GMK h;  5LJ3 g;  2DO3 A;  3SWN C;  5LJ5 f;  2M1H A;  2KT8 A;  4FIB A;  2F1L A;  1I4K 1;  4M4Z A;  5LL6 S;  3S3N A;  5GMK m;  2JJ9 A;  5GAN 7;  1VQ5 T;  1AZG B;  2KMT A;  5FWC A;  4JZ3 A;  4DOV A;  2DTO A;  4Y92 A;  2XI9 A;  1X69 A;  4GY5 A;  2VXF A;  5GMK j;  1YCS B;  1E7O A;  1AT1 B;  1VOM A;  2HAX A;  4HCZ A;  2F2V A;  4QVC A;  4EPC A;  2QAS A;  3I55 A;  2DXB A;  5L8R E;  1CSK A;  5ECA A;  2MPX C;  3OYD A;  1WNL A;  1Q86 R;  3CPW S;  4RMO A;  5J26 A;  2ED0 A;  2C06 A;  3I35 A;  4IIM A;  2KSS A;  1GXI E;  3M57 A;  2KRS A;  3LLR A;  4E2F B;  3PIO A;  1KIK A;  2A3L A;  2FHD A;  4BE2 A;  1QMC A;  1YI2 T;  2DL8 A;  2XDD A;  3OYF A;  1VQM A;  2AKK A;  4JUV A;  5KYX A;  2CP5 A;  1K73 U;  1TXQ A;  2F5T X;  4DBF A;  2Y4Y A;  3ZFJ A;  3A1P A;  3CCM A;  3G6E T;  2YHT A;  1D0Z A;  2RI5 A;  5LJ5 g;  2JTM A;  2QTV A;  1M8M A;  4HT9 A;  3GBQ A;  3M56 A;  4CRI A;  3EG9 B;  4OF1 A;  3FLG A;  3TQ7 P;  1OZ2 A;  1I81 A;  3C0C A;  3CC7 Q;  2A7Y A;  3HPW A;  3V8J A;  1VQ9 T;  3CEY A;  2Y90 A;  3V7S A;  3MEW A;  2VXE A;  2E5Q A;  5GMK i;  4ORZ A;  1QP3 A;  2RD1 A;  2DJZ A;  1VQ8 T;  2W0Z A;  4ZGD B;  1KSW A;  3EGX A;  3S3M A;  4FYY B;  1VQ5 A;  1UGQ B;  4R56 A;  2FZK B;  1K9A A;  4RCB A;  3PT9 A;  5KCH A;  4K11 A;  4EDU A;  2JM8 A;  3MO8 A;  5HY6 A;  2XID A;  3X20 B;  3RKY A;  3QDR B;  3CPF A;  1AWO A;  2P4T A;  2PZ1 A;  3QO3 A;  2R5M A;  3I9Q A;  2D8H A;  1KQS A;  1ZSZ B;  3M58 A;  5IN1 A;  3LGL A;  1YP5 A;  4M78 G;  2DMO A;  1UFF A;  1YI2 A;  2K2M A;  2RMO A;  4J9B A;  1WIE A;  1WX6 A;  3CCU T;  2YLB A;  1IHW A;  2R5A A;  4V2S A;  1YIJ Q;  3H8Z A;  2EBP A;  2V26 A;  5KYU A;  4KH1 B;  4Y28 E;  4J6Y A;  4DBH A;  3EG3 A;  1YJN T;  4LNP A;  5GMK l;  4FYX B;  4FL6 A;  4C0D C;  1VQ9 A;  1D09 B;  4C8Q A;  3I5R A;  4KGZ B;  1J3T A;  2KAF A;  1BIB A;  2DX1 A;  3MP8 A;  4QQD A;  2J6K A;  3LWH A;  4Q5W A;  2ESW A;  5DLQ E;  2K5F A;  5IH2 A;  1W4S A;  1VQ8 A;  2E70 A;  1VQK A;  4C8Q C;  3C94 A;  4E7K A;  1H3Z A;  4QQG A;  2KYB A;  4M7D A;  1BB9 A;  1MMD A;  2L5Q A;  1PKS A;  5KYW B;  5FLX E;  2XIC A;  4PJL A;  1RL2 A;  4JLG A;  2XD0 A;  1ZQ1 A;  3A8M B;  1S72 Q;  4E7J A;  1VQN Q;  1N27 A;  1YJ9 Q;  2QTX A;  1PNJ A;  4RTZ A;  1M1K R;  1WZO A;  1NLP C;  2AZV A;  3L2W A;  5GJV B;  3HTR A;  1NYF A;  2YUO A;  1VUB A;  1R0B G;  4PJO A;  5I11 A;  1AZE A;  1GRI A;  3OQ5 A;  2WSE E;  3QYH B;  1KK7 A;  1OOT A;  2OI3 A;  4PJO C;  1M90 U;  3QZ5 B;  4C8Q E;  1RI0 A;  1NPP A;  4GBQ A;  2RQT A;  1LCK A;  2E1H A;  2I2L A;  3CCE T;  4M77 B;  3CME Q;  1WJS A;  1YJN A;  4AG1 C;  2VAS A;  1WJQ A;  4M7D E;  1RAE B;  4M7A B;  2EIF A;  2LQW A;  2MCN A;  1RLP C;  2J06 A;  4J7F A;  2QYZ A;  5CKE A;  1RAG B;  3N5B B;  4MML A;  2QG9 B;  3FJ5 A;  3CC7 T;  9ATC B;  4BE0 A;  2X9H A;  2K3X A;  2RI3 A;  1WYX A;  2ED1 A;  1Q95 G;  4J9H A;  1MMA A;  3LWI A;  2EFI A;  3E2U A;  4ATO A;  1OEB A;  4LD6 A;  3OMG A;  4WF2 A;  5GAM e;  3SB2 A;  4A4F A;  1IHV A;  4PJO E;  1X01 A;  1T3L A;  4Z8A A;  1WFW A;  2RK1 A;  4QVD A;  1B34 B;  2O4X A;  2QQB A;  5CO7 A;  1H8K A;  1OYX A;  4JPB W;  4HCB A;  4BD3 A;  3G71 T;  2JM9 A;  2V8J A;  3L2U A;  2K2V A;  3EG9 A;  2VUB A;  4BI8 B;  4GLM A;  1PD1 A;  3S3O A;  2GGR A;  4RKU E;  3QJ6 A;  2L3S A;  3A98 A;  3VRZ A;  4LDY A;  3UA6 A;  1NJI U;  4D8D A;  2BE9 B;  2DE0 X;  1WHM A;  3CMA T;  2EGE A;  2J6F A;  3SWN B;  1WLP B;  4LDV A;  3MET A;  1Q82 C;  1O75 A;  2QQA A;  1JXM A;  2L3Q A;  5GAM f;  3G4S T;  5GAN j;  1K76 A;  5DY9 A;  1QKX A;  1MMN A;  1HD3 A;  2KDS A;  2O88 A;  1H64 1;  4E7H A;  2E41 A;  1MMG A;  2ZZD A;  4RTU A;  5J3B A;  1UJY A;  2RQR A;  2HSP A;  4E7S A;  3V8K A;  3BDU A;  2CYZ B;  3C4S A;  3CC7 A;  3E1S A;  1Q81 C;  3SD4 A;  2K5L A;  3OYE A;  4Z89 A;  2RPN A;  1ZSZ A;  2K7A A;  5CR2 A;  4J9G A;  3SFM A;  3OB9 A;  3S6W A;  2LP5 A;  3MJX A;  3CXC S;  1EX4 A;  1WXT A;  2KQW A;  4J6X A;  1WPY A;  4GLK A;  2WSF E;  3NHN A;  3RR6 A;  3CC4 Q;  1YJW Q;  5GAN 8;  4KH0 B;  2AK5 A;  3JAM E;  2HCK A;  4IIO A;  1N8R U;  4PFP A;  2O9V A;  2DD4 A;  3JV3 A;  1QCN A;  1SG5 A;  3JCM h;  2DVE A;  1S72 T;  1VQN T;  1YJ9 T;  3G71 A;  4F7U G;  1BBZ A;  3EH2 A;  4M78 B;  3OBW A;  2BTT A;  3UA7 A;  3L2Q A;  1IXD A;  2DIL A;  1QVF S;  2RHU A;  3REA B;  1U06 A;  2KYM A;  1A0N B;  1VQ5 Q;  1GCQ C;  3UT1 A;  1BI0 A;  2EQJ A;  4ZTJ A;  5LJ5 d;  2ZCF B;  2RB6 A;  5GAM g;  2OJ2 A;  2E3I A;  2QK0 A;  2K79 A;  2HQX A;  1YNZ A;  4J9E A;  3CCV T;  3CMA A;  4AG2 C;  2K5I A;  2K57 A;  4II1 A;  1Z9Z A;  2DTH A;  2ZPG B;  1BIA A;  3VS1 A;  3RUX A;  1TOV A;  5GAN f;  3IQL A;  4C92 D;  1YIJ A;  4JJB A;  2VKN A;  1JRI A;  2W10 A;  1V76 A;  1PC0 A;  1K9M C;  1OU8 A;  3FEO A;  3CME T;  5IXB A;  5KE3 A;  1W2B P;  1WQ7 A;  1YFN A;  1W70 A;  4XTW A;  4PFZ A;  3THK A;  3EGX B;  2GCX A;  3J80 E;  1Q82 R;  2KRN A;  3M0Q A;  2LRQ A;  2RJD A;  2XDP A;  3H9N A;  2CP7 A;  4C5E A;  1JO8 A;  2Z0W A;  2XKO C;  1QWE A;  4N4H A;  3KFV A;  1K73 C;  1HXD A;  2EQI A;  2LX7 A;  4BI3 A;  3G6E Q;  5GAN 3;  2X4J A;  3QJY A;  3O8V A;  2PQW A;  4IKF A;  4A54 A;  2VC8 A;  1Q81 R;  3UF4 A;  2EGC A;  3JCM Q;  1S72 A;  1W6X A;  1VQN A;  1YJ9 A;  4OMN A;  1U1T A;  2HBW A;  4M77 A;  3EHR A;  3VV0 A;  1OZ3 A;  1VYV A;  1K1Z A;  5LJ5 j;  1M2O A;  4Z88 A;  2MMP A;  3O5Z A;  4M7A A;  4M77 C;  3JCM V;  2YDL A;  3X24 B;  1IGU A;  3GNG A;  5LJ3 f;  2GFU A;  4JRI A;  4C5I A;  5DM7 R;  4C0D B;  2O31 A;  4A4G A;  4B9W A;  1NEG A;  1NPR A;  2M16 A;  1N9S A;  1F1B B;  4QQ6 A;  2Y4X A;  4XU0 A;  5FU7 C;  2EYX A;  2DYI A;  1UDL A;  1PRL C;  2BE7 D;  4KGV B;  3CBO A;  3CME A;  1YCY A;  5HKC A;  3L2Z A;  2DXT A;  2A36 A;  5C6S A;  3M9Q A;  1B34 A;  2KEA A;  2JTF A;  3OW2 P;  2CUD A;  7AT1 B;  1U8R A;  2JNG A;  2COW A;  3CCU Q;  1HYO A;  1K8A U;  1B7T A;  1ZHI A;  1Y71 A;  2R58 A;  3NTI A;  4BUG A;  1PCX A;  1OV3 A;  2X4X A;  3M0R A;  3L2R A;  4M77 E;  3QG1 A;  2L2P A;  4VUB A;  1QLY A;  1K9M R;  1U1S A;  1OX8 A;  1WHJ A;  2EYY A;  3A5Z B;  4X9C A;  1YJN Q;  4M7A E;  3QPH A;  3JCM c;  3UDC A;  1KC8 U;  2XDB A;  3JCM W;  4F16 A;  2KT1 A;  3SWN A;  2C0I A;  2FPD A;  3RKW A;  3CC4 T;  2RNA A;  3VS3 A;  4HA8 A;  4C92 G;  1WA7 A;  1K73 R;  4L5G A;  2RQU A;  2JN0 A;  4C92 F;  4PK4 A;  1D3B B;  2BZ8 A;  5CIU A;  2FO0 A;  4JDS A;  1R8O B;  3CCS Q;  3QYG B;  2E5K A;  2B86 A;  3M53 A;  2X4Y A;  2KK4 A;  4LDU A;  1FMV A;  1MHN A;  1KQS S;  1JB0 E;  3I56 Q;  2PTK A;  3CCJ T;  3QWY A;  1TU0 B;  2LX9 A;  1VYT A;  2M9U A;  2ATC B;  3EG0 A;  5CCA A;  2RHY A;  2E65 A;  3P8H A;  2KE9 A;  1QVG P;  2E6Z A;  4RTW A;  4HXJ A;  3JSC A;  3OYI A;  1LNX A;  2DVJ A;  1JXO A;  3TEE A;  3OYH A;  4ANJ A;  2LCL A;  1NE8 A;  4M78 A;  3QKJ A;  4LDW A;  1M90 C;  2PUK B;  2CDT A;  2V8K A;  5L23 A;  3DB4 A;  2LJ3 A;  4LUD A;  3CC2 Q;  2EPD A;  3CCE Q;  4M78 C;  1FMW A;  1SSF A;  3PMT A;  2O4X B;  2KRO A;  3EFO B;  4A4K A;  4F7U B;  5CKB A;  2ZPF B;  5DLO A;  4E7Z A;  3CC4 A;  1YJW A;  2CT4 A;  2DEU A;  2DL5 A;  1TSF A;  3PVL A;  2GF7 A;  1IB8 A;  4PJN A;  2PVD B;  3PE0 A;  1SHF A;  4PKC C;  4E7L A;  3PFS A;  3MKD A;  5GMK e;  3P8B B;  5I21 A;  3UAT A;  1RAH B;  4RTT A;  1I5O B;  1M1K C;  3NTK A;  2NUZ A;  3LH0 A;  3OY9 A;  3RER A;  2XU8 A;  5GAN 4;  3DB3 A;  1M1G A;  4DOW A;  4F17 A;  1KHC A;  2QDL A;  2FVU A;  1KD1 U;  4OB1 B;  3INZ A;  4M78 E;  4XTX A;  1C1A A;  1M27 C;  3G71 Q;  1Y96 B;  1SPK A;  4BI4 A;  4ELZ C;  1X2Q A;  2CRE A;  2P84 A;  4JLI A;  4PLI A;  2FZC B;  1X27 A;  3RBB B;  1WHL A;  3CMA Q;  4M75 D;  3LH5 A;  5CKD A;  2FB7 A;  1B07 A;  3RNJ A;  4HT8 A;  2LQN A;  3G4S Q;  3VKI A;  2ROL A;  3OMC A;  3SEM A;  3G6E A;  2DER A;  2DTI A;  1W2B A;  2DIQ A;  5A0L A;  2HEQ A;  1M90 R;  2PVO B;  5GAM d;  1RUW A;  2V1Q A;  2CSQ A;  2JUF A;  1HSQ A;  2PU9 B;  4FT4 A;  3EGD A;  1W1F A;  2DYB A;  2DIG A;  1UGP B;  2DZ9 A;  4MMK A;  4DA4 A;  1TH7 A;  2DL7 A;  2L8D A;  4X1V A;  1M3C A;  2GTJ A;  1LOJ A;  3CCS T;  2DJQ A;  4F14 A;  1VQ7 Q;  1N8R C;  2HQH A;  5FRM A;  1M1F A;  2XMF A;  4LE9 A;  1D1C A;  1PSF A;  3VS4 A;  3I56 T;  3RDV A;  3DLL A;  2QAZ A;  2H3E B;  3HL8 A;  2GFA A;  5GAO p;  4ZN3 A;  4R55 A;  1Z9Q A;  5GAM h;  2F2X A;  2LNH B;  4HKE A;  1MND A;  3CCV Q;  1TS9 A;  2BUD A;  1X75 C;  4A63 B;  1D3B A;  3CCU A;  2GQI A;  3Q1J A;  1KQ1 A;  1QVF P;  2RM4 A;  1LVK A;  2YUP A;  3LGF A;  3TCJ A;  2BZX A;  3FRN A;  1YIT T;  3JB9 I;  1UEC A;  2CS7 A;  1Q7Y U;  3CC2 T;  2B8A A;  5GAM j;  5CQX A;  2ZPH B;  1JU5 C;  1NJI R;  2DK3 A;  3G1J A;  1FX7 A;  2EJF A;  1TTH B;  2OAU A;  4DQ2 A;  3MP6 A;  2QQR A;  3FB9 A;  2VGN A;  5IHN A;  1M8V A;  5GAN d;  5CQY A;  3OW2 A;  4XAX B;  4KUI A;  1XTD A;  3NPF A;  3OYK A;  4ME7 A;  2MOX A;  3OYC A;  2MF2 A;  3OSS C;  1OI1 A;  2G3R A;  3M4G A;  2X3W D;  5FU7 B;  2DZC A;  2WAC A;  3CCS A;  2DD5 A;  1FYN A;  4JS5 A;  1UTI A;  2MWO A;  4M75 G;  2VV5 A;  4O5V A;  3I56 A;  4M75 F;  2M0O A;  1MGQ A;  4C8Q F;  3M0T A;  2JS2 A;  3OS0 A;  3MPU B;  3EFO A;  4J7I A;  4JRK A;  4F7U A;  1BK2 A;  3KBG A;  4HCK A;  5GAN h;  4CC3 A;  3MEA A;  3REB B;  4BY6 B;  4M7D F;  3RIR A;  4WTO B;  1H92 A;  2F2W A;  1N8R R;  1R77 A;  4D6W A;  3PNW C;  4ZGJ B;  4RTV A;  3C95 A;  1ARK A;  1TUD A;  3KUF A;  1G8X A;  2EW3 A;  3GLX A;  4KT0 E;  5KYN A;  5GAO q;  2CZ7 B;  1UHC A;  1RAA B;  1X6O A;  1SRL A;  2QGF B;  2J6O A;  1QCF A;  5LJ3 d;  3CC2 A;  3CCE A;  4AFQ C;  2RO0 A;  1QVG A;  1JJ2 P;  2LZ6 B;  2AZS A;  1I5L A;  3G7Z A;  3J7A F;  4OML A;  5CVI A;  4XTV A;  2R57 A;  4JRQ A;  4PJO F;  3CD6 Q;  3I5S A;  8ATC B;  4QVZ A;  3NTH A;  1Y96 A;  2ABL A;  2XG8 D;  2MWP A;  1K8A C;  3C12 A;  2D0N A;  1OQK A;  4FYW B;  2SEM A;  2BZY A;  3EH1 A;  3RES A;  4XTZ A;  2ENM A;  1UGR B;  2QI2 A;  2A28 A;  4MDX A;  4BB7 A;  4F7U E;  2YUN A;  3MEU A;  3OYN A;  1X2K A;  1OX9 A;  2D9T A;  2LCC A;  4EIK A;  4XTY A;  2DL3 A;  4C0Z A;  5IHI A;  3QZ9 B;  2LJ0 A;  3FDR A;  2ZPI B;  1AWX A;  1FXX A;  4B9X A;  3OYM A;  4JJN K;  2MK5 A;  5LJ3 h;  4E6R A;  2CZ1 B;  3BDL A;  1M3B A;  4MZM A;  3OYB A;  1NZ9 A;  1ZBX A;  1VQ7 T;  3MEV A;  3HRU A;  4PLL A;  3X28 B;  4KBM B;  2HL5 C;  1GCQ A;  2RJF A;  4CI0 C;  2BKD N;  1IZ6 A;  2QDY B;  1XQH A;  3M4Y A;  4IUP A;  4FT2 A;  3KXT A;  4C0G A;  2GNC A;  2CGH A;  3QUI A;  1SRM A;  3J81 E;  3CCJ Q;  4LN2 A;  5LJ3 j;  2FYK A;  2ZPE B;  2LCS A;  2HMA A;  5I2S A;  3OBY A;  3G4S A;  2DAQ A;  2X51 A;  4XU2 A;  4JS4 A;  3TVT A;  2YWW A;  2K3B A;  4PNO A;  1CKA A;  2BIV A;  2CP2 A;  1G3W A;  4HVW A;  4P5N A;  4NS5 A;  2YUQ A;  3H41 A;  1NG2 A;  2RHI A;  3OSV A;  3RKX A;  2E6N A;  1K4U S;  1E6G A;  5IAY A;  1P92 A;  5A2Q E;  1BYM A;  1AOJ A;  2OX7 A;  5CKH A;  1M5Q 1;  1KG1 A;  1X6G A;  2CUB A;  3CPW P;  4HVV A;  3GF5 A;  5LJ5 h;  3JCM J;  2JMC A;  5HK0 A;  3PTA A;  4BAC A;  1K8A R;  4NL3 A;  1PWT A;  1LPL A;  3M55 A;  3PGG A;  1VQ7 A;  2CH4 A;  2QEX T;  2E3H A;  2LQ8 A;  3OYG A;  1ZA2 B;  2KRM A;  3MP1 A;  4LUE A;  1QQJ A;  4C92 A;  1MUZ A;  3D7S B;  3HRT A;  1QKW A;  3LYI A;  4DEX A;  5IT9 E;  1O9S A;  3JCM e;  3X26 B;  2ZPB B;  1UE9 A;  3E9F A;  1KC8 R;  4BDY A;  4C92 C;  1BCO A;  1SHG A;  1VYU A;  3OYJ A;  4J6W A;  1WJR A;  3GPL A;  4MZP A;  4OGC A;  5GAO n;  2EYZ A;  3CCV A;  1MV0 B;  1YHQ T;  2AHJ B;  2DPP B;  1PD0 A;  2E10 A;  2YSQ A;  2DLP A;  2DNU A;  1OPL A;  1MV3 A;  1KJW A;  1EIF A; 
#chains in the Genus database with same CATH homology
 3ER0 A;  2IG0 A;  1YJW A;  4IUV A;  2GQV A;  3CCQ T;  3JB9 H;  2X35 A;  2OTJ T;  2XHC A;  1FWZ A;  2GF7 A;  3DLM A;  3FIF A;  2EWN A;  3BY7 A;  4EMK A;  1VQO A;  2PVD B;  1KHI A;  3L2W A;  1UEB A;  2YRV A;  4LD9 K;  5FU6 C;  1VUB A;  2EYQ A;  3QSU A;  2HNI A;  1M9S A;  5CKF A;  4PJO A;  4PKC C;  4E7L A;  3PFS A;  2K3Y A;  3EAE A;  5GMK e;  3P8B B;  5I21 A;  4JRP A;  4MZT A;  2MI6 A;  3MHX A;  3QHS A;  4N0A A;  3OQ5 A;  2WSE E;  3QYH B;  4EMK C;  4N4I A;  3JCM f;  1M1K C;  1G3Y A;  3NTK A;  3CC2 A;  3CD6 T;  3JCM b;  5GAN e;  2D0Q B;  2P0K A;  5AYF A;  3A8G B;  2LDM A;  3LH0 A;  3ME9 A;  3OY9 A;  5CK9 A;  3QZ5 B;  4C8Q E;  1M90 U;  1RI0 A;  3M5A A;  2XU8 A;  4M75 B;  5GAN 4;  3RER A;  3DB3 A;  2F5K A;  2RHX A;  2E64 A;  1NPP A;  1M1G A;  4XTU A;  4N0A C;  2HQE A;  5HK3 A;  4DOW A;  4A4H A;  2E1H A;  1PSE A;  4J5Y A;  2I2L A;  3M59 A;  3CCE T;  5FRN A;  3I55 T;  1KHC A;  4M77 B;  5KH6 A;  2FVU A;  1KD1 U;  4OB1 B;  1WJS A;  3INZ A;  1YJN A;  4BY6 C;  4X34 A;  4M78 E;  3FC3 A;  1WJQ A;  4M7D E;  3BW1 A;  4XTX A;  2EKO A;  3GIB A;  1Y96 B;  4M7A B;  2EIF A;  3EFR A;  2QEX A;  4F7U F;  2JOY A;  2LNV A;  4BI4 A;  4ELZ C;  4J7F A;  5CKE A;  3N5B B;  4MML A;  4A4E A;  4TVR A;  4ZGE B;  3URG A;  4OVA A;  3CC7 T;  4JLI A;  4PLI A;  2LT4 A;  2QA4 A;  4BE0 A;  4FSX A;  2P0Q A;  1M4Z A;  2K3X A;  2RI3 A;  4E47 A;  2RHZ A;  3GNF B;  4M75 D;  5CKD A;  1VIE A;  3LWI A;  2EFI A;  3OYY A;  2DXC A;  2FB7 A;  4LD6 A;  3OMG A;  4ATO A;  4WF2 A;  4IUR A;  4HT8 A;  3R6O A;  4LDX A;  5GAM e;  3SB2 A;  4OP0 A;  5CAI A;  2L3R A;  4M77 D;  3VKI A;  3QBY A;  4A4F A;  2VYT A;  5GAN 5;  4PJO E;  1KQ2 A;  1X01 A;  2EJG A;  3JRZ A;  2RK1 A;  4QVD A;  2L89 A;  3OMC A;  1B34 B;  2O4X A;  3G6E A;  4M7A D;  1QW1 A;  2QQB A;  4UC4 A;  3PIP A;  5D6X A;  2CKK A;  4M77 F;  3CCQ A;  2DTI A;  5CO7 A;  2OTJ A;  1OYX A;  4HCB A;  4BD3 A;  2RI2 A;  2DIQ A;  5A0L A;  3G71 T;  1W2B A;  3JCM P;  4M7A G;  2V8J A;  2KVQ G;  2PVO B;  5FRO A;  5GAM d;  3L2U A;  2K2V A;  1G3T A;  3JCM g;  3H6Z A;  2VUB A;  2RA2 A;  4BI8 B;  5LJ3 e;  4M7A F;  1VQL T;  3S3O A;  5A0D A;  2JUF A;  2KY9 A;  4RKU E;  3M54 A;  2PU9 B;  4N4G A;  3QJ6 A;  4FT4 A;  4LDY A;  4RG2 A;  3TRE A;  5A0G A;  3QXE B;  2RJE A;  4Y91 A;  3CD6 A;  1NJI U;  3UWN A;  2DIG A;  1UGP B;  2V8I A;  2DZ9 A;  4MMK A;  5GAO m;  3ZBD A;  4DA4 A;  1TH7 A;  3CMA T;  1W2B S;  1XNI A;  2LT1 A;  3LX7 A;  2L8D A;  5J39 A;  3SWN B;  3VYH B;  4LDV A;  3JB9 G;  3MET A;  1LOJ A;  3CCS T;  1Q82 C;  1O75 A;  2QQA A;  5GAM f;  1Q7Y C;  3G4S T;  5GAN j;  2QXF A;  1N8R C;  3JB9 F;  5FRM A;  5C0M A;  5DY9 A;  1M1F A;  3MCA B;  1VQ6 T;  1JJ2 A;  1KD1 C;  3DKM A;  1PSF A;  3I56 T;  1BI3 A;  1K9M U;  3DLL A;  2KDS A;  3WXM B;  3WVE B;  3CXC A;  1H64 1;  4E7H A;  2E41 A;  2ZZD A;  2JZ2 A;  3V7R A;  5J3B A;  3VUB A;  1N6A A;  3HL8 A;  2GFA A;  3EFS A;  4A53 A;  3V8K A;  3BDU A;  4ZN3 A;  5GAO p;  4IUU A;  4R55 A;  2IVW A;  5GAM h;  2CYZ B;  3X25 B;  4HCC A;  3C4S A;  3VYG A;  2YLC A;  3CC7 A;  3E1S A;  3A8H B;  1Q81 C;  3HHT B;  4FM4 B;  4HKE A;  5M9O A;  3SD4 A;  5GAN g;  2K5L A;  2CZ6 B;  3OYE A;  2FL7 A;  3JB9 J;  1G5V A;  4M7A C;  2QQS A;  1JJ2 S;  1Q86 C;  5CR2 A;  3SFM A;  3OB9 A;  3S6W A;  2BUD A;  2LVM A;  4BE1 A;  1X75 C;  4OB0 B;  4J83 A;  3CXC S;  3SDZ A;  2KQW A;  1D3B A;  3CCU A;  4J6X A;  4NOY A;  3Q1J A;  1KQ1 A;  1WPY A;  4GLK A;  2RM4 A;  2WSF E;  2JVV A;  3LGF A;  3TCJ A;  1QVF A;  4OMF B;  1QVP A;  3FRN A;  5GAN 8;  4C8Q B;  1YIT T;  3JB9 I;  3GOX A;  1Q82 U;  3JAM E;  2CS7 A;  4C92 E;  5GAO r;  2MAM A;  2WSC E;  1DJ7 B;  3CCJ A;  1Q7Y U;  1N8R U;  3CC2 T;  2B8A A;  2DD4 A;  5GAM j;  5CQX A;  3TU4 K;  2ZPH B;  1N9R A;  4OB3 B;  5LJ5 e;  3JCM h;  2DK3 A;  2DVE A;  1S72 T;  1FX7 A;  2RK2 A;  1YJ9 T;  1IRE B;  2EJF A;  3HFN A;  3G71 A;  1VQN T;  4C5H A;  4F7U G;  2OAU A;  4DQ2 A;  1I8F A;  3MP6 A;  3OBW A;  4M78 B;  2QQR A;  1UGS B;  3FB9 A;  3T9N A;  2VGN A;  3ZEH A;  4M7D B;  4FU6 A;  3L2Q A;  5GAN d;  5CQY A;  3OW2 A;  4NL2 A;  1M8V A;  4XAX B;  3GP8 A;  1VQL A;  4KUI A;  1VQK T;  2D6F A;  1XTD A;  4XK8 E;  3OA6 A;  1QVF S;  3OYK A;  2RHU A;  4ME7 A;  3CBM A;  5D6Y A;  3OYC A;  3A8O B;  2MF2 A;  3OSS C;  4J8O A;  1Q81 U;  3PMI A;  3E19 A;  1OI1 A;  1BI0 A;  3UT1 A;  4EMG A;  4KUD K;  2EQJ A;  4ZTJ A;  5LJ5 d;  2G3R A;  4Z02 A;  3M4G A;  2ZCF B;  2RB6 A;  5GAM g;  5FU7 B;  2DZC A;  2HQX A;  1VQM T;  1Q86 U;  2DKG A;  3CCV T;  3CMA A;  4RG8 A;  1NJI C;  3JCM X;  2WAC A;  2K5I A;  2K57 A;  4QW2 A;  4II1 A;  2EAY A;  1VIF A;  2EQK A;  1UB4 A;  3CCS A;  1Y7X A;  1Y07 A;  2DD5 A;  2DTH A;  2ZPG B;  3RMQ A;  1BIA A;  3VJP A;  4C0F A;  4C8Q D;  4ZN1 A;  3BFM A;  4IUQ A;  3RUX A;  4E7I A;  4JS5 A;  3CCM T;  5GAN f;  2MWO A;  4C92 D;  3CCL T;  4M75 G;  2LQK A;  4EMK B;  1YIJ A;  1YHQ A;  1VQ6 A;  1YJW T;  2PVG B;  1JBM A;  2LC4 A;  2VV5 A;  4O5V A;  1JRI A;  3ASK A;  4M75 F;  4OGE A;  3I56 A;  4PJO B;  2M0O A;  4M78 D;  1MGQ A;  4C8Q F;  3A8L B;  4M77 G;  5GMK h;  4M7D D;  1G3S A;  2H3J A;  5LJ3 g;  2DO3 A;  3SWN C;  3OS0 A;  1K9M C;  3FEO A;  5LJ5 f;  2M1H A;  4J7I A;  4FIB A;  3CME T;  4JRK A;  4F7U A;  5KE3 A;  3KBG A;  2CZ0 B;  1I4K 1;  5GAN h;  1WQ7 A;  5GAN 2;  3OS5 A;  3MEA A;  1WQW A;  4XU1 A;  3CCR T;  4XTW A;  4BY6 B;  4M78 F;  5LL6 S;  3S3N A;  4M7D F;  2GCX A;  2VGM A;  3J80 E;  3RIR A;  1YBY A;  2LRQ A;  2RJD A;  2XDP A;  4C5E A;  5GMK m;  1VQ4 T;  1HK9 A;  5GAN 7;  2XKO C;  1VQ5 T;  4D6W A;  4N4H A;  3PNW C;  4ZGJ B;  3C95 A;  2KMT A;  3KUF A;  3CPW A;  1K73 C;  1HXD A;  3GLX A;  4KT0 E;  2P0P A;  4BI3 A;  4IUT A;  4DOV A;  5GAO q;  5GAN 3;  2DTO A;  2XI9 A;  2CZ7 B;  4OB2 B;  2X4J A;  3QJY A;  1X6O A;  2O01 E;  4GY5 A;  2VXF A;  5GMK j;  3O8V A;  2F69 A;  2PQW A;  4IKF A;  2HAX A;  4HCZ A;  4A54 A;  5LJ3 d;  4M75 A;  4QVC A;  3CCE A;  4EPC A;  2VC8 A;  2RO0 A;  3I55 A;  2DXB A;  5L8R E;  1QVG A;  4PJO D;  3JCM Q;  1LJO A;  3F70 A;  1S72 A;  1VQN A;  1YJ9 A;  3OYD A;  1U1T A;  1WNL A;  5GAO l;  4M77 A;  3CPW S;  3G7Z A;  4RMO A;  1I5L A;  3J7A F;  5CVI A;  5J26 A;  4XTV A;  2ZGW A;  2R57 A;  1OZ3 A;  4M75 C;  3VUZ A;  3VV0 A;  2C06 A;  2KSS A;  2LTO A;  4PJO F;  4JRQ A;  1GXI E;  3NFC A;  3M57 A;  3LLR A;  4QVZ A;  3NTH A;  3PIO A;  3LW5 E;  5LJ5 j;  1Y96 A;  2MMP A;  4M7A A;  2XG8 D;  2XK0 A;  2MWP A;  1K8A C;  3L1A A;  2A3L A;  2FHD A;  1BKB A;  3C12 A;  4M77 C;  3JCM V;  4BE2 A;  1YI2 T;  2XDD A;  3X24 B;  1QVG S;  3GNG A;  5I2M A;  3OYF A;  5KCO A;  5LJ3 f;  2GFU A;  3RES A;  4JRI A;  4XTZ A;  1VQM A;  4M7D C;  4JUV A;  2OTL T;  1UGR B;  2QI2 A;  4C5I A;  4MDX A;  4BB7 A;  5DM7 R;  4C0D B;  1K73 U;  4F7U E;  3QII A;  3MEU A;  4A4G A;  2F5T X;  3P8D A;  3OYN A;  4B9W A;  2Y4Y A;  1BI1 A;  1NPR A;  2M16 A;  3ZFJ A;  1N9S A;  2D9T A;  2LCC A;  3V7C A;  3CCM A;  4XTY A;  3G6E T;  4ZTF A;  3CCL A;  4C0Z A;  2YHT A;  5EG2 A;  2RI5 A;  5LJ5 g;  4QQ6 A;  2Y4X A;  2JTM A;  3QZ9 B;  3OS2 A;  3FDR A;  2ZPI B;  4B9X A;  1FXX A;  3OYM A;  4HT9 A;  4XU0 A;  3M56 A;  5LJ3 h;  2RJC A;  4CRI A;  4JJN K;  2CZ1 B;  3BDL A;  4MZM A;  4OF1 A;  3FLG A;  5FU7 C;  4C5G A;  3OYB A;  1NZ9 A;  1OZ2 A;  4ELY C;  1ZBX A;  1I81 A;  2A7Y A;  3CBO A;  4C92 B;  1VQ7 T;  3HPW A;  3CME A;  3V8J A;  1YCY A;  3CEY A;  1BI2 A;  2Y90 A;  2DXT A;  3L2Z A;  2PUO B;  1WGS A;  3MEV A;  3MEW A;  4XQ3 A;  3V7S A;  5C6S A;  2VXE A;  3M9Q A;  4PJO C;  1B34 A;  2E12 A;  2DXU A;  3E9G A;  2JTF A;  3HRU A;  3HP9 A;  2E5Q A;  4PLL A;  3X28 B;  5GMK i;  4KBM B;  3VU3 C;  3CCR A;  4L59 A;  2RJF A;  1QP3 A;  3CBP A;  4CI0 C;  2RD1 A;  2JNG A;  3OW2 S;  3OS1 A;  1U8R A;  2BKD N;  2DJZ A;  1IZ6 A;  2QDY B;  1VQ8 T;  4M75 E;  4RCC A;  1K8A U;  1XQH A;  1VQ4 A;  1ZHI A;  4ZGD B;  3M4Y A;  1Y71 A;  3S3M A;  4IUP A;  1VQ5 A;  2R58 A;  4FT2 A;  1UGQ B;  3NTI A;  4L6V 5;  4BUG A;  4R56 A;  3KXT A;  2HD0 A;  4C0G A;  2QQ9 A;  2X4X A;  3L2R A;  2CGH A;  2EQM A;  4M77 E;  4RCB A;  3QG1 A;  5HKC A;  3QUI A;  4VUB A;  3J81 E;  4PL6 A;  3PT9 A;  5LJ3 j;  1U1S A;  5KCH A;  2FYK A;  2ZPE B;  4EDU A;  5I2S A;  3AHU A;  3A5Z B;  4X9C A;  3V8L A;  4M7A E;  3QPH A;  3L42 A;  3JCM c;  5FU6 B;  3UDC A;  3OBY A;  1KC8 U;  3MO8 A;  5HY6 A;  2XID A;  3JCM W;  3HRS A;  2XDB A;  5KE2 A;  3G4S A;  3X20 B;  2DAQ A;  3RKY A;  3QDR B;  3SWN A;  3WVD B;  5GAN 6;  3CPF A;  1VQP T;  3RKW A;  3FJP A;  2P4T A;  4C8Q G;  4XU3 A;  2NLU A;  3CC4 T;  3QO3 A;  2X4W A;  4XU2 A;  3RMS A;  2R5M A;  4JS4 A;  4HA8 A;  2DEQ A;  4PNO A;  4C92 G;  2BIV A;  1VQO T;  1KQS A;  4L5G A;  1G3W A;  4P5N A;  3M58 A;  2JN0 A;  4NS5 A;  5IN1 A;  4C92 F;  1D3B B;  3LGL A;  5CIU A;  2K4Y A;  2RHI A;  4M78 G;  3L2V A;  1M1K U;  3OSV A;  4KUL A;  3RKX A;  2E6N A;  4JDS A;  4M7D G;  1YI2 A;  5IAY A;  1R8O B;  3CCU T;  1P92 A;  5A2Q E;  3QYG B;  1BYM A;  4YTL A;  1VQ9 T;  2OTL A;  2YLB A;  3M53 A;  2R5A A;  4V2S A;  1QP2 A;  5CKH A;  1M5Q 1;  2X4Y A;  1KG1 A;  1V29 B;  3H8Z A;  2KK4 A;  4LDU A;  2HBP A;  3GF5 A;  5LJ5 h;  1MHN A;  1KQS S;  1JB0 E;  3JCM J;  3CCJ T;  5HK0 A;  3PTA A;  4Y28 E;  2LX9 A;  2M9U A;  4J6Y A;  4BAC A;  1YJN T;  5CCA A;  3HFO A;  2RHY A;  3OYA A;  1YIT A;  2E65 A;  3P8H A;  5GMK l;  4NL3 A;  2E6Z A;  3PGG A;  3M55 A;  4MDW A;  1VQ7 A;  4FL6 A;  4C0D C;  3JSC A;  2QEX T;  1VQ9 A;  2LQ8 A;  4C8Q A;  3OYG A;  3OYI A;  1LNX A;  1BIB A;  2KAF A;  3MP1 A;  3MP8 A;  3TEE A;  3OYH A;  3UPU A;  4QQD A;  3LWH A;  4Q5W A;  4C92 A;  4PJO G;  3HRT A;  5DLQ E;  3LYI A;  2EJ9 A;  2K5F A;  4O6J A;  5IT9 E;  1O9S A;  1W4S A;  3OYL A;  3JCM e;  3X26 B;  1VQ8 A;  2E70 A;  2ZPB B;  3HSB A;  3E9F A;  3JB9 D;  4C8Q C;  2LCL A;  1NE8 A;  3C94 A;  4M78 A;  2QA4 T;  4E7K A;  1VQK A;  4BDY A;  4QQG A;  4M7D A;  1H3Z A;  3QKJ A;  4LDW A;  4C92 C;  4EMH A;  1M90 C;  2RH2 A;  2PUK B;  5D6W A;  3OYJ A;  2EQU A;  2L5Q A;  2V8K A;  4J6W A;  1WJR A;  4X9D A;  3GPL A;  4MZP A;  3DB4 A;  4OGC A;  5FLX E;  2XIC A;  4M78 C;  5GAO n;  3CCV A;  1YIJ T;  1RL2 A;  4JLG A;  1YHQ T;  1SSF A;  2XD0 A;  1ZQ1 A;  3A8M B;  3HKS A;  2AHJ B;  3PMT A;  1N27 A;  2DPP B;  1XOV A;  2O4X B;  2QTX A;  4BDZ A;  4E7J A;  3JCM d;  4A4K A;  2E10 A;  4F7U B;  5CKB A;  2ZPF B;  1KC8 C;  1VQP A;  5DLO A;  1AHJ B;  3CC4 A;  1EIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...