4ME7A

Crystal structure of bacillus subtilis toxin mazf in complex with cognate antitoxin maze
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
105
Chain Sequence
MIVKRGDVYFADLVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQIRTIDKQRLTDKITHLDDEMMDKVDEALQISLALID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA interferase EndoA
publication title Structural Basis of mRNA Recognition and Cleavage by Toxin MazF and Its Regulation by Antitoxin MazE in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase/hydrolase inhibitor
total genus 23
structure length 105
sequence length 115
chains with identical sequence B, C, D
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4me7A00
5CKEA 4MDXA 5CCAA 3HPWA 5CKBA 3NFCA 5CQXA 5CR2A 5DLOA 4MZMA 5HKCA 2MF2A 1VUBA 4HKEA 5CKHA 4VUBA 5CKDA 4ELYC 2KMTA 5CKFA 4OF1A 3G7ZA 5HK0A 5HK3A 4ELZC 4ME7A 1UB4A 2VUBA 5CK9A 3JRZA 1NE8A 1X75C 5CO7A 3VUBA 4MZTA 1M1FA 4MZPA 2C06A 3TCJA 3JSCA 5CQYA
chains in the Genus database with same CATH superfamily
2XG8D 1YWPA 2LNHB 1K9AA 2M0OA 3L2VA 1NEGA 1Q81R 3PT9A 4M77G 2RJCA 2YRCA 3CCQQ 3CBMA 4M77A 3C12A 3CCEQ 2RHUA 2V26A 3CMAQ 4M7AG 1X43A 5FW9A 1KC8R 1LPLA 2GTJA 3G4ST 5KYYB 2DMOA 4C5IA 3G6EQ 3G71T 5KE2A 4PK4A 2DIGA 2LJ3A 3BY7A 1CSKA 5GAMf 5LJ3e 4AG1C 2DD5A 1NJIR 3E9FA 3CMEA 2GQIA 4FW2A 4ZTFA 3O8VA 4TVRA 4RCBA 3OYAA 2WSCE 3CC2Q 4DOWA 2COWA 3JB9I 3RESA 2RHIA 1JJ2A 3PTAA 2COYA 3RMQA 3CCVA 1YJWT 1QQJA 2E3IA 3OYYA 3QXEB 1YHQA 3JRZA 4OMNA 1UE9A 4MMLA 4BI8B 2YLBA 1AWWA 4V2SA 1VQOQ 1HD3A 2CGHA 1VQ8Q 3M4GA 1K73C 1K9MR 4ANJA 3OSSC 4XTVA 1X6GA 4B6MA 1IGQA 4FCYA 1M2VB 3CCUQ 1BI1A 1JB0E 2OAWA 3EFOB 1WXUA 4IUTA 2MMPA 1B34B 2LX7A 1K1ZA 1S72T 2DZCA 2FZGB 4M77E 3OYMA 2EYYA 1BYMA 4M7AE 2DYBA 2DXTA 4M75G 1VQ5Q 2LZ6B 4II1A 4M75A 4JLIA 5DM7R 4JLGA 2LQ8A 1U1SA 1JBMA 2X35A 2YUQA 2QEXQ 2RJEA 1C0MA 4C0FA 4CRIA 2KSSA 1UHCA 2GQVA 2JTEA 3SEMA 4C92C 2L8DA 4EMKA 2ESWA 4KBMB 5KYWB 2K3YA 3SDZA 4OMOA 3QPHA 2JVVA 1T3SA 3JCMc 3OYIA 3GNFB 1MMNA 3M55A 1M3CA 2IVWA 5L8RE 3CCMT 2CREA 2JM9A 4A4FA 1G3WA 3EG2A 4RTZA 2D8JA 3WVDB 3OYCA 1Y71A 4Y28E 3CCVT 4X34A 2VC8A 4J9EA 2O9VA 1UG1A 3NTIA 3PE0A 1VQPA 2JTMA 4IIMA 3Q1JA 2CDTA 1MV3A 1NE8A 1WHKA 4E7HA 1IHWA 2NWMA 4J7IA 2PTKA 2PUKB 3CCQT 1RAGB 5GAN6 4M7AC 3LWIA 4M75E 4JZ3A 1W4SA 4KGZB 3UT1A 2F1LA 3H8ZA 4BUGA 1ZA1B 4EMGA 3FEOA 1ACMB 2DPPB 4RTXA 2KRNA 5I21A 2QK0A 4LXCA 3RKXA 1VQ4Q 5IH2A 3JCMQ 3J80E 2FHDA 3M59A 3M0PA 1QWEA 4C5HA 2QG9B 3I5RA 1I0CA 4C92B 2XD0A 5DLQE 2C0TA 2L3RA 2DYIA 3VJPA 2MPXC 1HSQA 4ELYC 3M0QA 3JCMW 4DOVA 1Y96B 1WLPB 2M51A 2E10A 1PKSA 1YNZA 3SHWA 1VQOT 2LCSA 2WSEE 4GY5A 2RD1A 2CP3A 3LGLA 4JJNK 1ZLMA 3CPWA 5LJ5f 3H0IA 5GAN8 1YJNQ 3CCUT 2M16A 3GF5A 4C92F 1K73R 2DZ9A 3QO3A 4MMKA 1CKAA 2NUPA 2RHXA 4OMPA 5GAN3 4D8KA 1QVFA 3PGGA 1X75C 4LDUA 5GAMd 3CC4A 3X26B 1VQPT 4M75C 4HCCA 4XTYA 2EFIA 4M7AB 2M02A 4HVUA 4YTLA 2QEXT 2OI3A 4J9BA 2D6FA 2KRSA 3EG0A 1K8AU 4AMCA 2BE7D 2FPFA 5C6SA 4LDXA 1UGQB 3TU4K 1SG5A 3S3NA 4OMFB 1LOJA 3HFOA 2EQUA 2RJFA 4F7UA 3C94A 1QVGA 2E65A 4IIOA 4M7AF 1MMGA 5GJVB 2O9SA 4ZN1A 5HY6A 1UDLA 3ZBDA 3M0UA 4J6WA 2OJ2A 4C8QA 3M5AA 4ZGDB 1UGPB 2A7YA 4NS5A 1ZA2B 3NPFA 2KROA 3M0SA 4PKCC 2ZCFB 4PJLA 1UJ0A 5D6YA 1Q7YC 2DILA 2K5FA 1QMCA 1RUWA 1S1NA 2MCNA 5CIUA 3A8LB 2LJ1A 2DETA 3ZEHA 3CCJQ 3CCSQ 4J8OA 2J6OA 5CO7A 4OMQA 1U3OA 1E7OA 3JAME 4C92D 2EGCA 1IRXA 1X2QA 3QUIA 3EFSA 5CCAA 5GAOq 3VS2A 2CP7A 2Y4XA 1Z9ZA 2QA4Q 2VXEA 3CC4T 1VQ7A 3QDFA 3ASKA 1SRLA 2KRMA 1SPKA 1AD5A 1VQ4T 1TUCA 3P8BB 5LJ3f 3DB3A 2HQHA 4OB0B 4CC2A 1SHGA 3RDVA 2EW3A 4BE1A 2C0OA 4XK8E 5IHIA 4BB7A 3NFCA 4ORZA 4C8QE 2DNUA 5GAOl 3EG3A 4A53A 2AK5A 4R0KA 4RMOA 2K6DA 4FIBA 5J39A 5C0MA 2DL3A 2RMOA 2JUFA 2G6FX 4M7AD 3HFNA 1YJNT 2RQRA 3RIRA 3PIOA 5IT9E 4FT2A 3LH0A 5FU7C 5CKDA 1KK7A 2PU9B 1TWBA 4QQGA 3X20B 4ELZC 4RG2A 2DIQA 3E19A 4AFZC 3M53A 2RQUA 1I81A 4LDWA 2JZ2A 1OULA 3A8HB 3EGXB 4J9DA 2JOYA 2RHZA 5DY9A 2K4YA 3SB2A 1P92A 3MP6A 1D09B 2GBQA 1QCNA 5DLOA 3I56Q 2CUDA 1X27A 1I5LA 4VUBA 1B7TA 4J6XA 3DKMA 3I55A 1TOVA 3QHSA 2DTHA 4E7SA 2VASA 8ATCB 2EGEA 1VQ7T 3NGPA 5A0GA 1OZ2A 2FZCB 1K8AC 2O88A 2X3WD 1YCSB 4CC7A 1KFZA 1NEBA 4M78C 2DD4A 2HD0A 3CC7Q 5GANj 1GBRA 1QCOA 2X4YA 1WA7A 4LNPA 2SRCA 5CKFA 2CZ1B 2E3HA 2ZPIB 3R6OA 1M90C 1PSEA 1VQLQ 3V7RA 4ZGEB 1YI2A 1RI0A 3H6ZA 1VIEA 3LGFA 4M75D 1H92A 1OOTA 1Q95G 2CYZB 3L2UA 2E5KA 4RTVA 1NG2A 2P4TA 1N6AA 2PNIA 2YUNA 2KR3A 1GCQA 4OP0A 4Z8AA 2KYMA 1VUBA 3OY9A 2DE0X 3HHTB 4QT7A 3CCJT 2EYXA 1VQMA 5FRNA 5FU7B 1RADB 1D0YA 3LH5A 5CK9A 1WJQA 2R58A 4BI3A 5FLXE 3TCJA 4JJBA 1XTDA 1WNLA 2QA4T 2HBWA 4PJOG 5L23A 2EQKA 2CZ7B 4PJOA 1OZ3A 2M1HA 2XMFA 5KE3A 1Y07A 1YFNA 1ZSGA 3G7ZA 2QAZA 2DJZA 1AZEA 2GFUA 5GMKi 1M30A 1EFNA 2K7AA 4F04B 1WJRA 4BD3A 1AWXA 3MO8A 4RG8A 1NBEB 2YLCA 3PIPA 3I55T 2A28A 1YJWA 4HCZA 2K79A 3CPWS 3OW2A 1OX8A 3GP8A 4M78B 2VVKA 5FWBA 1HJDA 4OB3B 1X6BA 3FIFA 1KQSP 1WXBA 1WPYA 2HL3A 3JCMX 1NYGA 1YWOA 1BBZA 4A4HA 1M3AA 1X69A 2EPDA 3I5SA 1QVFS 4DQ2A 4PJMA 1D3BB 1GFCA 4BE0A 4J9IA 3PVQA 2MOXA 3D7SB 1W2BP 4C5GA 1M27C 4GBQA 4XTXA 4M78F 3TSZA 2FVUA 2DXUA 2R5AA 2MK5A 5KYXB 4PJOE 5I22A 3UA7A 1YIJQ 4F17A 2WSFE 2H3JA 3I56T 1R0CB 5GAMg 3INZA 1WGSA 1IGUA 2FYKA 2EJGA 3CCRA 2ZPEB 2PQWA 4DBQA 5HKCA 5AYFA 1V76A 2GF7A 2RK1A 1W6XA 3LX7A 2XI9A 3OYEA 3HRUA 2AKKA 1BU1A 3VUBA 3CCLA 1MUZA 4BACA 3CD6A 2V8JA 4O6JA 1K8AR 1UJYA 3H9NA 5CKBA 3CCMA 4LDVA 1NYFA 2YHTA 2FRYA 1IZ6A 1G83A 1VQ9Q 1VQLT 1RAHB 3VV0A 1RABB 4M7DG 4M7DA 1JO8A 4EPCA 1M90R 4LD6A 4XU2A 1BI3A 4LD9K 5GANd 1Q86U 5FROA 2HMAA 5GAMj 5GAOm 2E1HA 3V7SA 4E7KA 2MWOA 2QGGA 3NTHA 2H8HA 2J7IA 5A0LA 3CCQA 3CCEA 3CMAA 1M8VA 1IO6A 1C6VX 4LUEA 3G6EA 2F5KA 4L6V5 4RKUE 1XQHA 3CQTA 4M78D 4FU6A 1KQ2A 4RCCA 1GXIE 4HXJA 3MEUA 2RF0A 2C0IA 2DFUA 1D1BA 2L3PA 3IQLA 4KT0E 3V8LA 5KH6A 2KK4A 3OYHA 3CC2A 1I07A 1M9SA 1M4ZA 5GMKj 3RNJA 3MHXA 3CCRT 1G3YA 1TTHB 2AHJB 2K5LA 3EG9A 3OYDA 1FWZA 2EYQA 2O4XA 5GANe 3FJPA 3P8HA 4IUQA 1RI9A 3MEAA 1VQOA 4HCBA 1PKTA 4LE9A 4M7DE 3CCLT 1GL5A 2DTIA 1VQ8A 1I4K1 1W1FA 3FB9A 3CD6T 2DKGA 1SRMA 4KRTA 1M2OA 4EDUA 2Z0WA 3CCUA 1RL2A 3OSVA 4UC4A 2KYBA 1VOMA 2QDLA 5A2QE 3VS5A 4N4GA 4JRPA 2FEIA 3M54A 4BY6C 2LVMA 2OTLQ 1VQ6Q 5I2MA 2KMTA 1LJOA 3CPFA 2VKNA 4J5YA 1AOJA 3C95A 1FMVA 1VQ5A 4Q5WA 4DEYA 1U8RA 3SD4A 1N9SA 1NM7A 2XKOC 2OTJQ 2QEXA 2LCCA 4M77C 1ZUKA 1LNXA 3CCET 3CMAT 2LTOA 3JCMJ 1OV3A 3QYHB 4Z89A 3G6ET 1YJ9Q 2KI7A 3JCMd 1NPPA 4E47A 1X2KA 1O75A 5HK3A 1UGSB 1PD1A 4HVWA 3SFMA 2ED0A 3REBB 3LLRA 1MNEA 2E41A 2DJQA 1WDXA 5IXFA 4N4HA 4J9HA 3CC2T 7AT1B 1VQ9T 5CR2A 3EGUA 4M7DC 1QP3A 4D6WA 4RTUA 3R6NA 1KHCA 5GAMh 3M4YA 1JXMA 4A54A 3V7CA 3PVLA 2DBKA 1ZSZA 4FW1A 2RQTA 1VQ8T 2RI2A 2QQAA 2JM8A 4A4KA 1UFFA 2P84A 2HSPA 1RAFB 1WI7A 5GAN2 2DL8A 2RI3A 1M3BA 3QZ9B 1KSWA 1Q86C 2KAFA 1JXOA 2XIDA 4BY6B 1PD0A 4FYVB 3F70A 1YJ9A 3N5BB 2RQWA 2E5QA 1IB8A 2DVEA 2W10A 1U06A 4FM4B 3M56A 2QXFA 2GNCA 2P4RA 1VQ4A 5GMKl 1VQ5T 4M77B 1LVKA 3EFRA 1QVPA 3MEVA 4FYXB 2RO0A 4HA8A 2ZPGB 3MP8A 2LP5A 4X9DA 3SWNA 4WCIA 1OU8A 4OB1B 4EMKC 2KNBB 2MI6A 4F7UG 3QJYA 3HKSA 2DAQA 3BW1A 3RUXA 3OYJA 4M77F 1AZGB 1R8OB 4MZMA 2MF2A 4NL3A 2QQSA 1V1CA 1YJNA 3GNGA 2GFAA 1UEBA 4FSXA 4C8QG 1Q82U 2PVGB 3WXMB 2ZPHB 4N0AA 1BCOA 2E6NA 5GAMe 1WHHA 5D6XA 2DEUA 2DBMA 4C0DC 2DRKA 3URGA 2OTLT 4C5EA 2W0ZA 1HXDA 2DEQA 5KYUA 1SKUB 4HT8A 4KULA 2ROLA 5AT1B 2BZYA 2OTJT 3EHRA 1OU9A 1WQWA 5GAN4 1TU0B 2KXDA 3CBPA 3AHUA 1YJ9T 2DK3A 3A1PA 1GFDA 4M75B 4C0ZA 3OYKA 1NLPC 5GMKe 1O9SA 2P0QA 2B86A 4KH0B 2D8HA 4JDSA 1ZX6A 1JJ2S 1G2BA 3CXCA 1N5ZA 2YUPA 2DLPA 1GBQA 4J7FA 3FJ5A 4F7UE 1W70A 4AFQC 5CKEA 1I8FA 4EMKB 2KXCA 2JS0A 2HAXA 1M1GA 3PMIA 1E6GA 3I35A 2JT4A 4M75F 2D0QB 4QVZA 1WX6A 1B07A 4LN2A 4ME7A 5KYYA 2K57A 1JU5C 3OBWA 2QDYB 1B3QA 1VYVA 4M77D 3ZL7C 2FPDA 3X28B 3CCJA 3CCSA 4B9XA 5CVIA 1WFWA 5GANg 4C0DB 2VV5A 4JUVA 4JJCA 1JQQA 1Q86R 1H3ZA 1YP5A 2WACA 2QA4A 3T9NA 1UB4A 2D9TA 2OAUA 3NMZC 2DA9A 5HCKA 1UGRB 4AG2C 2V1QA 2YWWA 4CC4B 1TS9A 2F2WA 3NTKA 3OB9A 3L2WA 3X25B 1KD1U 2BUDA 2ZPBB 1YITQ 1E6HA 2DF6A 2PUOB 3EAEA 1MHNA 1BI2A 3RKYA 1G3TA 1M2VA 2HZYA 1OPLA 3BE3A 3EFOA 4PFOA 2CSQA 1B34A 2J05A 2XHCA 2LJ0A 1RACB 2DXBA 2RA2A 2ZAEA 2RH2A 3UATA 1KJWA 3HRSA 5LL6S 2YXYA 5LJ5d 5M9OA 4A4EA 2L89A 4GLKA 4GLMA 2AZVA 4JRQA 1PNJA 1N9RA 4QKUA 1T0JA 3I9QA 4C8QC 3VS6A 2D1XA 1QKWA 3OMGA 1PG5B 2VUBA 3VRZA 2BZ8A 2MIOA 3HSBA 4FT4A 3G4SQ 4NL2A 4MZTA 2EQIA 3MP1A 1JEGA 1AT1B 1KIKA 2EWNA 2QI2A 3HPWA 1VQKQ 1Q82C 4K11A 5KYWA 1ZUYA 2COZA 1OYXA 4RTTA 1QW1A 2NUPB 4AT1B 1NPRA 2L3QA 2CSIA 3OS0A 3CCST 1YITA 3I56A 1BCMA 2L0AA 2BE9B 1K4US 1M1FA 3JB9J 1GRIA 1OPKA 2AT1B 1X6OA 1C1AA 2XK0A 2Y4YA 2JS2A 2E4HA 4KUIA 1U5SA 3CC7A 2KY9A 2DXCA 5IHKA 3JCMg 2CUBA 2C06A 1KQ1A 1ZBXA 5GMKm 1VQLA 1S72Q 3RERA 4F7UB 1GCPA 3PNWC 3A8OB 4RUGA 2H3EB 2LNVA 5FRMA 3OYLA 2K3BA 1VQKA 4KGXB 3QIIA 2HQXA 4R56A 1FMWA 4C8QB 4DBRA 4BDYA 2J06A 1JRIA 4QVDA 2KT1A 2EYWA 3VU3C 3OYNA 3CBOA 3L2QA 2I2LA 3OS1A 2XDBA 1SSHA 2EQMA 4F7UF 5EC7A 5EG2A 4E7IA 1OEBA 4A63B 3REAB 4C92G 4L59A 2XICA 4C92A 6AT1B 5IXBA 2YRDA 2LX9A 4DBHA 1YN8A 4PL6A 1WHMA 1TG0A 1H641 4OB2B 3QWXX 1T3LA 1Y96A 1BIBA 4C8QF 5LJ3d 2D0NA 1JJ2P 4OMLA 3JB9G 3MEWA 3CMEQ 1XNIA 1MV0B 4ZNXA 3A5ZB 2DM1A 3VUZA 1YITT 1D1AA 2MAMA 4XTUA 3UA6A 4OVAA 3CCVQ 3OS2A 1YHQQ 5D7UA 1ZQ1A 1QVGS 3AT1B 1KD1C 3HTRA 1ABOA 3EG1A 3QKJA 1X01A 3G1JA 5GANh 3O5ZA 2JXBA 4XTWA 4MZPA 3QWYA 1U1TA 2MYSA 3CC7T 1I5OB 1OI1A 2A08A 5I11A 2R57A 3ULRB 1KQSA 1WYXA 2ENMA 4M7AA 2ROTA 5J26A 2CP0A 3BFMA 2DERA 4QVCA 2ZPFB 2R5MA 5GAOn 3DB4A 3EH1A 1WQ7A 4QQDA 2JW4A 1VQKT 1W2BA 1EIFA 1GCQC 3VS1A 4PFZA 5KCHA 1KHIA 2CS7A 4C92E 1ARKA 3E9GA 2JTFA 2SEMA 2LT1A 1YIJA 1Q82R 1NZ9A 4XTZA 4X9CA 1AHJB 1IREB 2RM4A 4FYYB 4OMMA 2NYSA 2GGRA 2O01E 4HVVA 2HCKA 4JRIA 1Y57A 3BDUA 4DA4A 4PNOA 2HNIA 1A0NB 2ZZDA 3QSUA 2DTOA 4NOYA 1AWJA 1SHFA 2EJ9A 4PJOC 1AWOA 2K2VA 1FXXA 4F16A 3CXCS 3X24B 4PLIA 1R77A 2F5TX 1UHFA 4C8QD 1T0HA 1WXTA 2V1RA 2L5QA 2FB7A 1VA7A 4EMHA 4JPBW 2QTVA 2RK2A 3UF4A 2JJ9A 1VQ9A 1LCKA 1OQKA 3C4SA 1QCFA 2J6FA 1K76A 1BB9A 4FL6A 3RKWA 3TREA 2KEAA 1HYOA 4XQ3A 3THKA 4DBFA 1VQPQ 1Z9QA 3HL8A 3DLMA 2GCXA 2HQEA 3S3MA 4FSSA 4EIKA 1WHLA 2NUTA 3CEYA 3L2ZA 3V8KA 2PZ1A 3QBYA 2CH4W 1NLOC 1PCXA 1QKXA 4ESRA 2FZKB 1UUEA 1MMDA 3JCMh 2VB6A 1YCYA 2RN8A 2F69A 4FYWB 2V8KA 2L3SA 2PVDB 2IIMA 2NUZA 2EAYA 4J6YA 2M9UA 2LQNA 2XU8A 3CMET 1RLPC 1RAEB 4BI4A 1D0XA 4IKFA 2P0KA 3GBQA 1M1KU 1Q7YU 1YIJT 1YBYA 3VS0A 4XAXB 3GLXA 2X4WA 2J6KA 4E7LA 4PJOB 1FYNA 3KFVA 5GJWB 2LDMA 2BTTA 1YHQT 4J83A 2M0YA 3CPWP 3M58A 3OYGA 2CH4A 1WHJA 1N8RU 4X1VA 3TQ7P 2MWPA 4JS4A 1ZHIA 2RNAA 4BDZA 1CKBA 4D8DA 1KD1R 4E2FB 3ZFJA 3TSWA 3WVEB 3VS3A 1F1BB 4RTWA 3LWHA 1QVFP 3L1AA 4A4GA 3L42A 3EGXA 3KBGA 3OS5A 3UDCA 4PJOF 2CZ6B 3BDLA 5LJ5g 1H3HA 2CP2A 3JCMP 2A3LA 2X3XD 2CT4A 4OF1A 2VYTA 3CC4Q 2ED1A 2CT3A 2OTLA 1VQ6A 4E6RA 5KYNA 4Y92A 2KGTA 4Y91A 2DO3A 3JB9H 3OMCA 1G3SA 2LCLA 2QQBA 1XOVA 2OTJA 2K5IA 1EZZB 1PC0A 2A36A 3J7AF 3TVTA 3QJ6A 3GPLA 4P5NA 3HP9A 4N4IA 1QVGP 3JV3A 2LQWA 3M0TA 2E70A 3JCMe 4RTYA 2Y90A 4J9GA 4ZGJB 1SF9A 1PWTA 4OGEA 1K0XA 2JMAA 1UTIA 5GMKh 1WHGA 2ABLA 4PJNA 5LJ5j 2X51A 3RMSA 1D1CA 1VYUA 2ATCB 2CZ0B 2JN0A 1FX7A 3OW2S 3UPUA 4JZ4A 1Q81U 2VXFA 1G5VA 2HEQA 1I1JA 5GAN7 2FL7A 3JB9F 3QG1A 1KC8U 2FO0A 4HCKA 4KGVB 2BIVA 1R0BG 1TUDA 2XDDA 3VS7A 2QQRA 1SEMA 3OBYA 3FLGA 1NJIU 4M7DB 2RI5A 3H41A 2EKOA 4PJOD 2F2VA 4AFSC 4HT9A 4J9FA 3CXCP 4J9CA 1VQ7Q 2KQWA 1M90U 1AVZC 3EGDA 2RJDA 2CP5A 3QDRB 1VQ6T 2QASA 4M78G 5FWCA 4M78A 1MGQA 3GIBA 1K0SA 4M7DF 4XU3A 3EH2A 3LW5E 2EGAA 2JMCA 2KT8A 4IUPA 3OYBA 1K9MU 2IPOB 3RBBB 5LJ3g 4B9WA 1G8XA 2HBPA 1VIFA 1SSFA 1TSFA 3M0RA 1M1KC 1D3BA 3VYHB 5IAYA 5CQXA 2A0FB 1VYTA 2HL5C 4CC3A 1KQSS 2FPEA 2RHYA 3M9QA 3QZ5B 4KH1B 4C0GA 1N8RC 4IUUA 3EG9B 5KYXA 2LQKA 1PM3A 4PFPA 4MDXA 5GAOr 2O4XB 2KVQG 1W2BS 1BIAA 1VQNQ 2ECZA 2NUTB 3MKDA 2RQVA 9ATCB 3JB9D 4DEXA 2I0NA 1H8KA 1ZSZC 1KG1A 1DJ7B 2DL7A 2OX7A 3A8GB 1PSFA 3E2UA 5LJ3j 5IN1A 1TH7A 3EHQA 4M78E 3I55Q 2A37A 4QQ6A 1WIEA 2F2XA 3E1SA 2DX1A 3META 2BKDN 2LC4A 2YRVA 2LRQA 1PHTA 5LJ5h 2EKHA 2GTOA 5J3BA 2BZXA 1XJWB 3JSCA 5CQYA 3MJXA 1RAAB 2KBTA 2YT6A 4MDWA 2EVRA 4JS5A 3LYIA 4M7DD 2HSEB 3S3OA 3SWNC 4ZTJA 1VQNA 5HK0A 1YI2Q 3NHNA 1BKBA 2ZGWA 1Y0MA 1OX9A 5CAIA 1TUGB 2FG0A 2EIFA 2X4JA 1RLQC 1WZOA 2EYZA 1Q81C 5GANf 3OQ5A 3A98A 4ZN3A 1VQMQ 2YDLA 2K9GA 2K2MA 1M5Q1 3M57A 3KXTA 1KC8C 2YSQA 2AIRB 2PVOB 3JCMV 3S6WA 3PMTA 4Z02A 1IXDA 2FRWA 3L2RA 4N0AC 1ZSZB 1PRMC 3H0HA 2AKLA 3GOXA 3G71Q 1NJIC 4Z88A 4M4ZA 3VRYA 1ZUUA 3FRNA 4IURA 2B8AA 4AFUC 4O5VA 4XU0A 5FU6C 2X9HA 5A0DA 2QGFB 4E7ZA 2CKKA 2XDPA 3OW2P 2EQJA 2O31A 3FDRA 5IHNA 1EX4A 2HDAA 1RAIB 1YJWQ 1K73U 3C0CA 2HKNA 3MPUB 2RB6A 1TXQA 3OYFA 1K9MC 2LMJA 5LJ5e 1M1KR 1Q7YR 4IUVA 2X4XA 2QTXA 3A8MB 3U23A 5CKHA 1AEYA 5D6WA 3SWNB 1BI0A 3MCAB 2RPNA 2P0PA 3ER0A 3FC3A 2CP6A 2IG0A 1N8RR 3HRTA 1MMAA 1VQNT 1N27A 3G4SA 3G71A 1D0ZA 1HK9A 2EJFA 2K3XA 4XU1A 1J3TA 1PRLC 3QYGB 1V29B 2V8IA 5LJ3h 2O2OA 3PFSA 4HKEA 2LT4A 4CI0C 2EBPA 3KUFA 5ECAA 2KE9A 4OGCA 2DL5A 2QQ9A 2G3RA 3UWNA 3OA6A 3V8JA 2VGNA 1MNDA 3CCRQ 4LUDA 2E6ZA 5KCOA 5GAN5 2QYZA 1QP2A 1UECA 3EGDB 3JCMb 4JJDA 3H0FA 1ZBJA 2AZSA 1WJSA 2NLUA 4WTOB 5KYUB 4E7JA 2VGMA 3JCMf 2DVJA 3CCLQ 5FU6B 4JRKA 2HKQB 3DLLA 3CD6Q 5GAOp 2VWFA 2DRMA 4PLLA 1QLYA 3VKIA 4F14A 2L2PA 3CCMQ 2E64A 4WF2A 1M8MA 5I2SA 1BK2A 3TEEA 4QW2A 3J81E 4L5GA 3VYGA 1YI2T 1S72A 4KUDK 1IHVA 2YUOA 1QWFA 4ATOA 4PJJA 3P8DA 1ABQA 2E12A 8AT1B 4BE2A 2JNGA 3VS4A 3RR6A 1FMKA 1Y7XA 4R55A 1UGVA 1VQMT 2DL4A 3ME9A 4LDYA 2KDSA
chains in the Genus database with same CATH topology
2XG8D 2E6NA 5GAMe 4E7LA 5D6XA 2M0OA 3L2VA 4PJOB 4C0DC 3PT9A 2LDMA 4M78C 3URGA 4M77G 2DD4A 2RJCA 1YHQT 2HD0A 4J83A 4C5EA 5GANj 3CBMA 4M77A 3C12A 3M58A 2X4YA 3OYGA 1HXDA 2DEQA 2RHUA 4M7AG 1N8RU 4HT8A 2MWPA 4KULA 4JS4A 5CKFA 1ZHIA 3G4ST 4C5IA 2CZ1B 3G71T 5KE2A 2OTJT 2DIGA 2ZPIB 3R6OA 4BDZA 1PSEA 1M90C 3V7RA 3ZFJA 4ZGEB 3BY7A 1WQWA 1RI0A 5GAN4 3WVEB 3H6ZA 1VIEA 1YI2A 5GAMf 5LJ3e 3LGFA 3CBPA 4M75D 3LWHA 3AHUA 3L1AA 4A4GA 2CYZB 2DD5A 3L2UA 3L42A 3E9FA 3CMEA 3KBGA 1YJ9T 2P4TA 3OS5A 3UDCA 1N6AA 4PJOF 2DK3A 2CZ6B 3BDLA 3O8VA 4OP0A 4TVRA 5LJ5g 4RCBA 3OYAA 2WSCE 4M75B 3OY9A 1VUBA 4DOWA 3JB9I 3HHTB 3RESA 4C0ZA 2RHIA 3CCJT 3PTAA 3OYKA 3JCMP 1VQMA 1JJ2A 5FRNA 2A3LA 5FU7B 4OF1A 2VYTA 3RMQA 5GMKe 3CCVA 1O9SA 2P0QA 1YJWT 4JDSA 5CK9A 2OTLA 3OYYA 3QXEB 1WJQA 3JRZA 2R58A 1YHQA 4MMLA 3CXCA 4BI8B 4BI3A 1JJ2S 2YLBA 5FLXE 4J7FA 4F7UE 3TCJA 1XTDA 1WNLA 4V2SA 5CKEA 4Y91A 1I8FA 2DO3A 3OMCA 3JB9H 2QA4T 1G3SA 2CGHA 2LCLA 4EMKB 2OTLT 4PJOG 2QQBA 1XOVA 2EQKA 2CZ7B 3M4GA 2K5IA 2HAXA 4PJOA 2OTJA 1OZ3A 1M1GA 1K73C 3J7AF 2M1HA 3PMIA 3QJ6A 3OSSC 4XTVA 4P5NA 3GPLA 3HP9A 4M75F 2D0QB 4QVZA 5KE3A 1BI1A 4N4IA 1JB0E 1Y07A 3G7ZA 4IUTA 2E70A 2MMPA 2DJZA 4ME7A 1B34B 2GFUA 2K57A 3OBWA 3JCMe 5GMKi 2Y90A 4ZGJB 1WJRA 4BD3A 2QDYB 1S72T 3MO8A 4RG8A 4M77D 2YLCA 3PIPA 3X28B 4OGEA 2DZCA 3CCJA 3CCSA 4M77E 3OYMA 3I55T 5GMKh 1BYMA 4M7AE 4B9XA 1YJWA 4HCZA 5CVIA 5LJ5j 3CPWS 5GANg 2DXTA 3RMSA 3OW2A 4M75G 4C0DB 2VV5A 2CZ0B 4JUVA 4M78B 4II1A 4M75A 4JLIA 3GP8A 2JN0A 4OB3B 5DM7R 1K8AC 4JLGA 2LQ8A 3FIFA 1U1SA 1JBMA 1H3ZA 1WPYA 2WACA 2QA4A 3T9NA 1FX7A 3JCMX 3OW2S 3UPUA 1Q81U 2X35A 1UB4A 2D9TA 2OAUA 2VXFA 3ME9A 1G5VA 5GAN7 2FL7A 1UGRB 2RJEA 4A4HA 3JB9F 3QG1A 4C0FA 4CRIA 2KSSA 2GQVA 1KC8U 1QVFS 3NTKA 4DQ2A 3OB9A 3L2WA 1D3BB 4BE0A 4C92C 2L8DA 2BIVA 4EMKA 3X25B 4KBMB 1KD1U 2K3YA 2BUDA 2ZPBB 3SDZA 2XDDA 3QPHA 2QQRA 2JVVA 4C5GA 2PUOB 3JCMc 1VQ6A 3OBYA 4XTXA 3EAEA 4M78F 3OYIA 1MHNA 3GNFB 1BI2A 2DXUA 2FVUA 3RKYA 1G3TA 3FLGA 3M55A 1NJIU 4M7DB 2IVWA 2RI5A 5L8RE 3CCMT 2R5AA 1B34A 2EKOA 2XHCA 2RA2A 4A4FA 2DXBA 4PJOD 1G3WA 2RH2A 4PJOE 3HRSA 5LL6S 5LJ5d 4HT9A 2WSFE 5M9OA 2H3JA 3I56T 5GAMg 3INZA 3WVDB 1WGSA 4A4EA 3OYCA 1Y71A 4Y28E 3CCVT 2L89A 4GLKA 2FYKA 2KQWA 4JRQA 2EJGA 1M90U 3CCRA 2RJDA 4X34A 2ZPEB 2PQWA 1N9RA 3QDRB 1VQ6T 2VC8A 5HKCA 4M78G 4C8QC 5AYFA 4M78A 1MGQA 3NTIA 1VQPA 3GIBA 2GF7A 2JTMA 2RK1A 4M7DF 4XU3A 3LW5E 3OMGA 3Q1JA 2VUBA 3LX7A 2XI9A 3HSBA 3OYEA 4FT4A 3HRUA 4IUPA 1NE8A 4NL2A 3OYBA 1K9MU 4E7HA 3VUBA 4MZTA 3CCLA 4J7IA 4BACA 3MP1A 5LJ3g 3CD6A 4B9WA 2PUKB 2V8JA 4O6JA 3CCQT 2HBPA 1VIFA 1SSFA 5GAN6 4M7AC 2EWNA 3LWIA 2QI2A 3HPWA 4M75E 1D3BA 5CKBA 3VYHB 4LDVA 1W4SA 5IAYA 3CCMA 2YHTA 1Q82C 3UT1A 5CQXA 3H8ZA 4BUGA 1M1KC 1OYXA 4EMGA 1IZ6A 3FEOA 1QW1A 1NPRA 1VQLT 3VV0A 1KQSS 3OS0A 3CCST 1YITA 4M7DG 3I56A 2DPPB 4M7DA 2RHYA 3M9QA 3QZ5B 4C0GA 5I21A 1N8RC 4EPCA 4IUUA 3RKXA 4LD6A 1M1FA 4XU2A 3JB9J 1BI3A 2LQKA 4LD9K 3JCMQ 1X6OA 2FHDA 3M59A 5GANd 3J80E 5FROA 5GAOr 2XK0A 1Q86U 2Y4YA 5GAMj 4C5HA 2O4XB 2KVQG 1W2BS 1BIAA 5GAOm 2E1HA 3V7SA 4C92B 4E7KA 2XD0A 2MWOA 5DLQE 2L3RA 3NTHA 3JB9D 4KUIA 3VJPA 5A0LA 4ELYC 3CC7A 3CCQA 3JCMW 4DOVA 3CCEA 1Y96B 1KG1A 2KY9A 1DJ7B 3CMAA 2DXCA 1M8VA 2E10A 3JCMg 1VQOT 3A8GB 2WSEE 4GY5A 1PSFA 3G6EA 2RD1A 2C06A 3LGLA 2F5KA 4L6V5 1KQ1A 1XQHA 4RKUE 5LJ3j 4JJNK 1ZBXA 5GMKm 4ZTFA 1VQLA 3CPWA 3RERA 5IN1A 5LJ5f 4F7UB 4M78D 4FU6A 3PNWC 1TH7A 1KQ2A 3A8OB 4RCCA 4M78E 5GAN8 1GXIE 3CCUT 3MEUA 2LNVA 5FRMA 3OYLA 2M16A 1VQKA 3GF5A 4C92F 4KT0E 2DZ9A 3QIIA 3QO3A 2HQXA 4MMKA 4QQ6A 3V8LA 4R56A 3E1SA 2RHXA 5KH6A 2KK4A 2BKDN 3META 2LC4A 5GAN3 3OYHA 2YRVA 4C8QB 4BDYA 1M9SA 5GMKj 1M4ZA 2LRQA 3CC2A 5LJ5h 1QVFA 3PGGA 1JRIA 4QVDA 3MHXA 5J3BA 3CCRT 1G3YA 1X75C 4LDUA 3VU3C 5GAMd 3CBOA 3OYNA 3CC4A 2AHJB 2K5LA 3JSCA 5CQYA 3L2QA 3OYDA 3X26B 2I2LA 1VQPT 1FWZA 3OS1A 2XDBA 4M75C 4HCCA 2EQMA 2EYQA 4MDWA 4F7UF 4XTYA 2O4XA 5EG2A 4E7IA 5GANe 4JS5A 2EFIA 3LYIA 4M7DD 3FJPA 3P8HA 4IUQA 3MEAA 4M7AB 4C92G 3S3OA 1VQOA 4L59A 2XICA 4HCBA 3SWNC 4ZTJA 4C92A 3CCLT 2DTIA 4YTLA 1VQ8A 4M7DE 2X4WA 2QEXT 2LX9A 1VQNA 1I4K1 3FB9A 2D6FA 3CD6T 4PL6A 5HK0A 2DKGA 1K8AU 1H641 4OB2B 1Y96A 1BKBA 1BIBA 2ZGWA 4C8QF 5LJ3d 5CAIA 4EDUA 3CCUA 3JB9G 5C6SA 3MEWA 4LDXA 1UGQB 1XNIA 1RL2A 2EIFA 2X4JA 3TU4K 3OSVA 3A5ZB 3S3NA 3VUZA 4OMFB 4UC4A 1LOJA 3HFOA 2EQUA 2RJFA 5A2QE 1Q81C 1YITT 5GANf 3OQ5A 4F7UA 4ZN3A 4N4GA 3C94A 4JRPA 1M5Q1 2MAMA 3M57A 3M54A 4XTUA 4BY6C 1QVGA 2E65A 4OVAA 3KXTA 1KC8C 4M7AF 2LVMA 4ZN1A 5HY6A 3OS2A 4M7DC 5I2MA 2KMTA 3ZBDA 2PVOB 1LJOA 1ZQ1A 3CPFA 4J5YA 4J6WA 3S6WA 3JCMV 3PMTA 4Z02A 1QVGS 1KD1C 3C95A 1VQ5A 4C8QA 3L2RA 4Q5WA 3M5AA 3QKJA 4N0AC 1X01A 4ZGDB 5GANh 1U8RA 1UGPB 1N9SA 2A7YA 3SD4A 4NS5A 3GOXA 2XKOC 4XTWA 4MZPA 1NJIC 1U1TA 4PKCC 2QEXA 2LCCA 2ZCFB 4M77C 1LNXA 3CC7T 1OI1A 3FRNA 3CCET 4IURA 5D6YA 2B8AA 2R57A 3CMAT 2LTOA 1Q7YC 1KQSA 3JCMJ 2K5FA 4O5VA 4XU0A 5J26A 4M7AA 3QYHB 5FU6C 3G6ET 5CIUA 3BFMA 5A0DA 3JCMd 3A8LB 1NPPA 4E47A 2CKKA 4QVCA 1O75A 2XDPA 2ZPFB 5HK3A 1UGSB 2R5MA 3SFMA 3ZEHA 5GAOn 2EQJA 3DB4A 3LLRA 3FDRA 2E41A 4J8OA 1WQ7A 4QQDA 5CO7A 1VQKT 1K73U 1W2BA 3JAME 1EIFA 4C92D 3QUIA 2RB6A 3EFSA 1KHIA 5CCAA 5KCHA 4N4HA 2CS7A 5GAOq 4C92E 3CC2T 3E9GA 2JTFA 3OYFA 1K9MC 2Y4XA 2LT1A 5LJ5e 1VQ9T 1YIJA 5CR2A 1NZ9A 2X4XA 2QTXA 4IUVA 2VXEA 1AHJB 1IREB 1QP3A 2RM4A 3A8MB 4X9CA 3CC4T 1VQ7A 4D6WA 5CKHA 2O01E 3ASKA 1KHCA 4JRIA 5GAMh 5D6WA 3BDUA 3M4YA 3SWNB 4DA4A 1BI0A 3MCAB 1VQ4T 4A54A 3V7CA 2P0PA 2HNIA 4PNOA 3P8BB 2ZZDA 3DB3A 3ER0A 5LJ3f 3QSUA 3FC3A 2DTOA 4NOYA 4OB0B 2EJ9A 2IG0A 1VQ8T 2RI2A 3HRTA 4PJOC 1VQNT 2QQAA 1N27A 2K2VA 4BE1A 1FXXA 4A4KA 3G4SA 3CXCS 3X24B 3G71A 4XK8E 4PLIA 4BB7A 1HK9A 5GAN2 3NFCA 2EJFA 2RI3A 2F5TX 3QZ9B 2K3XA 4XU1A 4C8QD 3QYGB 1V29B 2V8IA 5LJ3h 4C8QE 2L5QA 3PFSA 4HKEA 2FB7A 5GAOl 2KAFA 1Q86C 2XIDA 4BY6B 4A53A 2LT4A 4CI0C 4RMOA 3KUFA 4EMHA 4OGCA 3F70A 2QQ9A 2G3RA 4FIBA 1YJ9A 5J39A 2RK2A 5C0MA 3UWNA 3N5BB 1VQ9A 3OA6A 2E5QA 2DVEA 2JUFA 3V8JA 2VGNA 3C4SA 4M7AD 3HFNA 2E6ZA 4FM4B 5KCOA 1YJNT 3M56A 4FL6A 5GAN5 2QXFA 3RKWA 1QP2A 1VQ4A 3RIRA 3PIOA 5GMKl 3JCMb 3TREA 5IT9E 1VQ5T 4XQ3A 3EFRA 4M77B 4FT2A 1WJSA 2NLUA 3HL8A 1QVPA 2GCXA 2HQEA 3DLMA 3LH0A 3MEVA 2RO0A 5FU7C 3S3MA 4HA8A 1S72A 2ZPGB 5CKDA 4E7JA 2VGMA 3CEYA 3L2ZA 3V8KA 2PU9B 3MP8A 3JCMf 3QBYA 4X9DA 4QQGA 3X20B 5FU6B 4ELZC 4RG2A 2DIQA 3E19A 3SWNA 4JRKA 3DLLA 3M53A 5GAOp 4PLLA 1I81A 4OB1B 3VKIA 4MDXA 4LDWA 4EMKC 2JZ2A 4XTZA 2E64A 2MI6A 3A8HB 2JOYA 4WF2A 2RHZA 5DY9A 4F7UG 2K4YA 3QJYA 3HKSA 2DAQA 3SB2A 3JCMh 1YCYA 5I2SA 3BW1A 1P92A 3RUXA 3OYJA 3TEEA 3MP6A 2F69A 4M77F 4QW2A 1R8OB 2V8KA 4L5GA 4MZMA 3VYGA 5DLOA 2MF2A 3J81E 4NL3A 1YI2T 4KUDK 4ATOA 2PVDB 1I5LA 4VUBA 2QQSA 4J6XA 2EAYA 3DKMA 1YJNA 3I55A 3P8DA 4J6YA 2M9UA 2XU8A 3GNGA 2GFAA 1UEBA 3CMET 2E12A 3QHSA 4FSXA 4C8QG 4BE2A 2DTHA 4BI4A 4IKFA 2JNGA 2P0KA 1M1KU 1Q7YU 1YIJT 1Q82U 1Y7XA 4R55A 2PVGB 3WXMB 2ZPHB 1VQ7T 5A0GA 1VQMT 1OZ2A 1YBYA 4LDYA 4N0AA 4XAXB 3GLXA 2KDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CKE A;  4MDX A;  5CCA A;  3HPW A;  5CKB A;  3NFC A;  5CQX A;  5CR2 A;  5DLO A;  4MZM A;  5HKC A;  2MF2 A;  1VUB A;  4HKE A;  5CKH A;  4VUB A;  5CKD A;  4ELY C;  2KMT A;  5CKF A;  4OF1 A;  3G7Z A;  5HK0 A;  5HK3 A;  4ELZ C;  4ME7 A;  1UB4 A;  2VUB A;  5CK9 A;  3JRZ A;  1NE8 A;  1X75 C;  5CO7 A;  3VUB A;  4MZT A;  1M1F A;  4MZP A;  2C06 A;  3TCJ A;  3JSC A;  5CQY A; 
#chains in the Genus database with same CATH topology
 2XG8 D;  1YWP A;  2LNH B;  1K9A A;  2M0O A;  3L2V A;  1NEG A;  1Q81 R;  3PT9 A;  4M77 G;  2RJC A;  2YRC A;  3CCQ Q;  3CBM A;  4M77 A;  3C12 A;  3CCE Q;  2RHU A;  2V26 A;  3CMA Q;  4M7A G;  1X43 A;  5FW9 A;  1KC8 R;  1LPL A;  2GTJ A;  3G4S T;  5KYY B;  2DMO A;  4C5I A;  3G6E Q;  3G71 T;  5KE2 A;  4PK4 A;  2DIG A;  2LJ3 A;  3BY7 A;  1CSK A;  5GAM f;  5LJ3 e;  4AG1 C;  2DD5 A;  1NJI R;  3E9F A;  3CME A;  2GQI A;  4FW2 A;  4ZTF A;  3O8V A;  4TVR A;  4RCB A;  3OYA A;  2WSC E;  3CC2 Q;  4DOW A;  2COW A;  3JB9 I;  3RES A;  2RHI A;  1JJ2 A;  3PTA A;  2COY A;  3RMQ A;  3CCV A;  1YJW T;  1QQJ A;  2E3I A;  3OYY A;  3QXE B;  1YHQ A;  3JRZ A;  4OMN A;  1UE9 A;  4MML A;  4BI8 B;  2YLB A;  1AWW A;  4V2S A;  1VQO Q;  1HD3 A;  2CGH A;  1VQ8 Q;  3M4G A;  1K73 C;  1K9M R;  4ANJ A;  3OSS C;  4XTV A;  1X6G A;  4B6M A;  1IGQ A;  4FCY A;  1M2V B;  3CCU Q;  1BI1 A;  1JB0 E;  2OAW A;  3EFO B;  1WXU A;  4IUT A;  2MMP A;  1B34 B;  2LX7 A;  1K1Z A;  1S72 T;  2DZC A;  2FZG B;  4M77 E;  3OYM A;  2EYY A;  1BYM A;  4M7A E;  2DYB A;  2DXT A;  4M75 G;  1VQ5 Q;  2LZ6 B;  4II1 A;  4M75 A;  4JLI A;  5DM7 R;  4JLG A;  2LQ8 A;  1U1S A;  1JBM A;  2X35 A;  2YUQ A;  2QEX Q;  2RJE A;  1C0M A;  4C0F A;  4CRI A;  2KSS A;  1UHC A;  2GQV A;  2JTE A;  3SEM A;  4C92 C;  2L8D A;  4EMK A;  2ESW A;  4KBM B;  5KYW B;  2K3Y A;  3SDZ A;  4OMO A;  3QPH A;  2JVV A;  1T3S A;  3JCM c;  3OYI A;  3GNF B;  1MMN A;  3M55 A;  1M3C A;  2IVW A;  5L8R E;  3CCM T;  2CRE A;  2JM9 A;  4A4F A;  1G3W A;  3EG2 A;  4RTZ A;  2D8J A;  3WVD B;  3OYC A;  1Y71 A;  4Y28 E;  3CCV T;  4X34 A;  2VC8 A;  4J9E A;  2O9V A;  1UG1 A;  3NTI A;  3PE0 A;  1VQP A;  2JTM A;  4IIM A;  3Q1J A;  2CDT A;  1MV3 A;  1NE8 A;  1WHK A;  4E7H A;  1IHW A;  2NWM A;  4J7I A;  2PTK A;  2PUK B;  3CCQ T;  1RAG B;  5GAN 6;  4M7A C;  3LWI A;  4M75 E;  4JZ3 A;  1W4S A;  4KGZ B;  3UT1 A;  2F1L A;  3H8Z A;  4BUG A;  1ZA1 B;  4EMG A;  3FEO A;  1ACM B;  2DPP B;  4RTX A;  2KRN A;  5I21 A;  2QK0 A;  4LXC A;  3RKX A;  1VQ4 Q;  5IH2 A;  3JCM Q;  3J80 E;  2FHD A;  3M59 A;  3M0P A;  1QWE A;  4C5H A;  2QG9 B;  3I5R A;  1I0C A;  4C92 B;  2XD0 A;  5DLQ E;  2C0T A;  2L3R A;  2DYI A;  3VJP A;  2MPX C;  1HSQ A;  4ELY C;  3M0Q A;  3JCM W;  4DOV A;  1Y96 B;  1WLP B;  2M51 A;  2E10 A;  1PKS A;  1YNZ A;  3SHW A;  1VQO T;  2LCS A;  2WSE E;  4GY5 A;  2RD1 A;  2CP3 A;  3LGL A;  4JJN K;  1ZLM A;  3CPW A;  5LJ5 f;  3H0I A;  5GAN 8;  1YJN Q;  3CCU T;  2M16 A;  3GF5 A;  4C92 F;  1K73 R;  2DZ9 A;  3QO3 A;  4MMK A;  1CKA A;  2NUP A;  2RHX A;  4OMP A;  5GAN 3;  4D8K A;  1QVF A;  3PGG A;  1X75 C;  4LDU A;  5GAM d;  3CC4 A;  3X26 B;  1VQP T;  4M75 C;  4HCC A;  4XTY A;  2EFI A;  4M7A B;  2M02 A;  4HVU A;  4YTL A;  2QEX T;  2OI3 A;  4J9B A;  2D6F A;  2KRS A;  3EG0 A;  1K8A U;  4AMC A;  2BE7 D;  2FPF A;  5C6S A;  4LDX A;  1UGQ B;  3TU4 K;  1SG5 A;  3S3N A;  4OMF B;  1LOJ A;  3HFO A;  2EQU A;  2RJF A;  4F7U A;  3C94 A;  1QVG A;  2E65 A;  4IIO A;  4M7A F;  1MMG A;  5GJV B;  2O9S A;  4ZN1 A;  5HY6 A;  1UDL A;  3ZBD A;  3M0U A;  4J6W A;  2OJ2 A;  4C8Q A;  3M5A A;  4ZGD B;  1UGP B;  2A7Y A;  4NS5 A;  1ZA2 B;  3NPF A;  2KRO A;  3M0S A;  4PKC C;  2ZCF B;  4PJL A;  1UJ0 A;  5D6Y A;  1Q7Y C;  2DIL A;  2K5F A;  1QMC A;  1RUW A;  1S1N A;  2MCN A;  5CIU A;  3A8L B;  2LJ1 A;  2DET A;  3ZEH A;  3CCJ Q;  3CCS Q;  4J8O A;  2J6O A;  5CO7 A;  4OMQ A;  1U3O A;  1E7O A;  3JAM E;  4C92 D;  2EGC A;  1IRX A;  1X2Q A;  3QUI A;  3EFS A;  5CCA A;  5GAO q;  3VS2 A;  2CP7 A;  2Y4X A;  1Z9Z A;  2QA4 Q;  2VXE A;  3CC4 T;  1VQ7 A;  3QDF A;  3ASK A;  1SRL A;  2KRM A;  1SPK A;  1AD5 A;  1VQ4 T;  1TUC A;  3P8B B;  5LJ3 f;  3DB3 A;  2HQH A;  4OB0 B;  4CC2 A;  1SHG A;  3RDV A;  2EW3 A;  4BE1 A;  2C0O A;  4XK8 E;  5IHI A;  4BB7 A;  3NFC A;  4ORZ A;  4C8Q E;  2DNU A;  5GAO l;  3EG3 A;  4A53 A;  2AK5 A;  4R0K A;  4RMO A;  2K6D A;  4FIB A;  5J39 A;  5C0M A;  2DL3 A;  2RMO A;  2JUF A;  2G6F X;  4M7A D;  3HFN A;  1YJN T;  2RQR A;  3RIR A;  3PIO A;  5IT9 E;  4FT2 A;  3LH0 A;  5FU7 C;  5CKD A;  1KK7 A;  2PU9 B;  1TWB A;  4QQG A;  3X20 B;  4ELZ C;  4RG2 A;  2DIQ A;  3E19 A;  4AFZ C;  3M53 A;  2RQU A;  1I81 A;  4LDW A;  2JZ2 A;  1OUL A;  3A8H B;  3EGX B;  4J9D A;  2JOY A;  2RHZ A;  5DY9 A;  2K4Y A;  3SB2 A;  1P92 A;  3MP6 A;  1D09 B;  2GBQ A;  1QCN A;  5DLO A;  3I56 Q;  2CUD A;  1X27 A;  1I5L A;  4VUB A;  1B7T A;  4J6X A;  3DKM A;  3I55 A;  1TOV A;  3QHS A;  2DTH A;  4E7S A;  2VAS A;  8ATC B;  2EGE A;  1VQ7 T;  3NGP A;  5A0G A;  1OZ2 A;  2FZC B;  1K8A C;  2O88 A;  2X3W D;  1YCS B;  4CC7 A;  1KFZ A;  1NEB A;  4M78 C;  2DD4 A;  2HD0 A;  3CC7 Q;  5GAN j;  1GBR A;  1QCO A;  2X4Y A;  1WA7 A;  4LNP A;  2SRC A;  5CKF A;  2CZ1 B;  2E3H A;  2ZPI B;  3R6O A;  1M90 C;  1PSE A;  1VQL Q;  3V7R A;  4ZGE B;  1YI2 A;  1RI0 A;  3H6Z A;  1VIE A;  3LGF A;  4M75 D;  1H92 A;  1OOT A;  1Q95 G;  2CYZ B;  3L2U A;  2E5K A;  4RTV A;  1NG2 A;  2P4T A;  1N6A A;  2PNI A;  2YUN A;  2KR3 A;  1GCQ A;  4OP0 A;  4Z8A A;  2KYM A;  1VUB A;  3OY9 A;  2DE0 X;  3HHT B;  4QT7 A;  3CCJ T;  2EYX A;  1VQM A;  5FRN A;  5FU7 B;  1RAD B;  1D0Y A;  3LH5 A;  5CK9 A;  1WJQ A;  2R58 A;  4BI3 A;  5FLX E;  3TCJ A;  4JJB A;  1XTD A;  1WNL A;  2QA4 T;  2HBW A;  4PJO G;  5L23 A;  2EQK A;  2CZ7 B;  4PJO A;  1OZ3 A;  2M1H A;  2XMF A;  5KE3 A;  1Y07 A;  1YFN A;  1ZSG A;  3G7Z A;  2QAZ A;  2DJZ A;  1AZE A;  2GFU A;  5GMK i;  1M30 A;  1EFN A;  2K7A A;  4F04 B;  1WJR A;  4BD3 A;  1AWX A;  3MO8 A;  4RG8 A;  1NBE B;  2YLC A;  3PIP A;  3I55 T;  2A28 A;  1YJW A;  4HCZ A;  2K79 A;  3CPW S;  3OW2 A;  1OX8 A;  3GP8 A;  4M78 B;  2VVK A;  5FWB A;  1HJD A;  4OB3 B;  1X6B A;  3FIF A;  1KQS P;  1WXB A;  1WPY A;  2HL3 A;  3JCM X;  1NYG A;  1YWO A;  1BBZ A;  4A4H A;  1M3A A;  1X69 A;  2EPD A;  3I5S A;  1QVF S;  4DQ2 A;  4PJM A;  1D3B B;  1GFC A;  4BE0 A;  4J9I A;  3PVQ A;  2MOX A;  3D7S B;  1W2B P;  4C5G A;  1M27 C;  4GBQ A;  4XTX A;  4M78 F;  3TSZ A;  2FVU A;  2DXU A;  2R5A A;  2MK5 A;  5KYX B;  4PJO E;  5I22 A;  3UA7 A;  1YIJ Q;  4F17 A;  2WSF E;  2H3J A;  3I56 T;  1R0C B;  5GAM g;  3INZ A;  1WGS A;  1IGU A;  2FYK A;  2EJG A;  3CCR A;  2ZPE B;  2PQW A;  4DBQ A;  5HKC A;  5AYF A;  1V76 A;  2GF7 A;  2RK1 A;  1W6X A;  3LX7 A;  2XI9 A;  3OYE A;  3HRU A;  2AKK A;  1BU1 A;  3VUB A;  3CCL A;  1MUZ A;  4BAC A;  3CD6 A;  2V8J A;  4O6J A;  1K8A R;  1UJY A;  3H9N A;  5CKB A;  3CCM A;  4LDV A;  1NYF A;  2YHT A;  2FRY A;  1IZ6 A;  1G83 A;  1VQ9 Q;  1VQL T;  1RAH B;  3VV0 A;  1RAB B;  4M7D G;  4M7D A;  1JO8 A;  4EPC A;  1M90 R;  4LD6 A;  4XU2 A;  1BI3 A;  4LD9 K;  5GAN d;  1Q86 U;  5FRO A;  2HMA A;  5GAM j;  5GAO m;  2E1H A;  3V7S A;  4E7K A;  2MWO A;  2QGG A;  3NTH A;  2H8H A;  2J7I A;  5A0L A;  3CCQ A;  3CCE A;  3CMA A;  1M8V A;  1IO6 A;  1C6V X;  4LUE A;  3G6E A;  2F5K A;  4L6V 5;  4RKU E;  1XQH A;  3CQT A;  4M78 D;  4FU6 A;  1KQ2 A;  4RCC A;  1GXI E;  4HXJ A;  3MEU A;  2RF0 A;  2C0I A;  2DFU A;  1D1B A;  2L3P A;  3IQL A;  4KT0 E;  3V8L A;  5KH6 A;  2KK4 A;  3OYH A;  3CC2 A;  1I07 A;  1M9S A;  1M4Z A;  5GMK j;  3RNJ A;  3MHX A;  3CCR T;  1G3Y A;  1TTH B;  2AHJ B;  2K5L A;  3EG9 A;  3OYD A;  1FWZ A;  2EYQ A;  2O4X A;  5GAN e;  3FJP A;  3P8H A;  4IUQ A;  1RI9 A;  3MEA A;  1VQO A;  4HCB A;  1PKT A;  4LE9 A;  4M7D E;  3CCL T;  1GL5 A;  2DTI A;  1VQ8 A;  1I4K 1;  1W1F A;  3FB9 A;  3CD6 T;  2DKG A;  1SRM A;  4KRT A;  1M2O A;  4EDU A;  2Z0W A;  3CCU A;  1RL2 A;  3OSV A;  4UC4 A;  2KYB A;  1VOM A;  2QDL A;  5A2Q E;  3VS5 A;  4N4G A;  4JRP A;  2FEI A;  3M54 A;  4BY6 C;  2LVM A;  2OTL Q;  1VQ6 Q;  5I2M A;  2KMT A;  1LJO A;  3CPF A;  2VKN A;  4J5Y A;  1AOJ A;  3C95 A;  1FMV A;  1VQ5 A;  4Q5W A;  4DEY A;  1U8R A;  3SD4 A;  1N9S A;  1NM7 A;  2XKO C;  2OTJ Q;  2QEX A;  2LCC A;  4M77 C;  1ZUK A;  1LNX A;  3CCE T;  3CMA T;  2LTO A;  3JCM J;  1OV3 A;  3QYH B;  4Z89 A;  3G6E T;  1YJ9 Q;  2KI7 A;  3JCM d;  1NPP A;  4E47 A;  1X2K A;  1O75 A;  5HK3 A;  1UGS B;  1PD1 A;  4HVW A;  3SFM A;  2ED0 A;  3REB B;  3LLR A;  1MNE A;  2E41 A;  2DJQ A;  1WDX A;  5IXF A;  4N4H A;  4J9H A;  3CC2 T;  7AT1 B;  1VQ9 T;  5CR2 A;  3EGU A;  4M7D C;  1QP3 A;  4D6W A;  4RTU A;  3R6N A;  1KHC A;  5GAM h;  3M4Y A;  1JXM A;  4A54 A;  3V7C A;  3PVL A;  2DBK A;  1ZSZ A;  4FW1 A;  2RQT A;  1VQ8 T;  2RI2 A;  2QQA A;  2JM8 A;  4A4K A;  1UFF A;  2P84 A;  2HSP A;  1RAF B;  1WI7 A;  5GAN 2;  2DL8 A;  2RI3 A;  1M3B A;  3QZ9 B;  1KSW A;  1Q86 C;  2KAF A;  1JXO A;  2XID A;  4BY6 B;  1PD0 A;  4FYV B;  3F70 A;  1YJ9 A;  3N5B B;  2RQW A;  2E5Q A;  1IB8 A;  2DVE A;  2W10 A;  1U06 A;  4FM4 B;  3M56 A;  2QXF A;  2GNC A;  2P4R A;  1VQ4 A;  5GMK l;  1VQ5 T;  4M77 B;  1LVK A;  3EFR A;  1QVP A;  3MEV A;  4FYX B;  2RO0 A;  4HA8 A;  2ZPG B;  3MP8 A;  2LP5 A;  4X9D A;  3SWN A;  4WCI A;  1OU8 A;  4OB1 B;  4EMK C;  2KNB B;  2MI6 A;  4F7U G;  3QJY A;  3HKS A;  2DAQ A;  3BW1 A;  3RUX A;  3OYJ A;  4M77 F;  1AZG B;  1R8O B;  4MZM A;  2MF2 A;  4NL3 A;  2QQS A;  1V1C A;  1YJN A;  3GNG A;  2GFA A;  1UEB A;  4FSX A;  4C8Q G;  1Q82 U;  2PVG B;  3WXM B;  2ZPH B;  4N0A A;  1BCO A;  2E6N A;  5GAM e;  1WHH A;  5D6X A;  2DEU A;  2DBM A;  4C0D C;  2DRK A;  3URG A;  2OTL T;  4C5E A;  2W0Z A;  1HXD A;  2DEQ A;  5KYU A;  1SKU B;  4HT8 A;  4KUL A;  2ROL A;  5AT1 B;  2BZY A;  2OTJ T;  3EHR A;  1OU9 A;  1WQW A;  5GAN 4;  1TU0 B;  2KXD A;  3CBP A;  3AHU A;  1YJ9 T;  2DK3 A;  3A1P A;  1GFD A;  4M75 B;  4C0Z A;  3OYK A;  1NLP C;  5GMK e;  1O9S A;  2P0Q A;  2B86 A;  4KH0 B;  2D8H A;  4JDS A;  1ZX6 A;  1JJ2 S;  1G2B A;  3CXC A;  1N5Z A;  2YUP A;  2DLP A;  1GBQ A;  4J7F A;  3FJ5 A;  4F7U E;  1W70 A;  4AFQ C;  5CKE A;  1I8F A;  4EMK B;  2KXC A;  2JS0 A;  2HAX A;  1M1G A;  3PMI A;  1E6G A;  3I35 A;  2JT4 A;  4M75 F;  2D0Q B;  4QVZ A;  1WX6 A;  1B07 A;  4LN2 A;  4ME7 A;  5KYY A;  2K57 A;  1JU5 C;  3OBW A;  2QDY B;  1B3Q A;  1VYV A;  4M77 D;  3ZL7 C;  2FPD A;  3X28 B;  3CCJ A;  3CCS A;  4B9X A;  5CVI A;  1WFW A;  5GAN g;  4C0D B;  2VV5 A;  4JUV A;  4JJC A;  1JQQ A;  1Q86 R;  1H3Z A;  1YP5 A;  2WAC A;  2QA4 A;  3T9N A;  1UB4 A;  2D9T A;  2OAU A;  3NMZ C;  2DA9 A;  5HCK A;  1UGR B;  4AG2 C;  2V1Q A;  2YWW A;  4CC4 B;  1TS9 A;  2F2W A;  3NTK A;  3OB9 A;  3L2W A;  3X25 B;  1KD1 U;  2BUD A;  2ZPB B;  1YIT Q;  1E6H A;  2DF6 A;  2PUO B;  3EAE A;  1MHN A;  1BI2 A;  3RKY A;  1G3T A;  1M2V A;  2HZY A;  1OPL A;  3BE3 A;  3EFO A;  4PFO A;  2CSQ A;  1B34 A;  2J05 A;  2XHC A;  2LJ0 A;  1RAC B;  2DXB A;  2RA2 A;  2ZAE A;  2RH2 A;  3UAT A;  1KJW A;  3HRS A;  5LL6 S;  2YXY A;  5LJ5 d;  5M9O A;  4A4E A;  2L89 A;  4GLK A;  4GLM A;  2AZV A;  4JRQ A;  1PNJ A;  1N9R A;  4QKU A;  1T0J A;  3I9Q A;  4C8Q C;  3VS6 A;  2D1X A;  1QKW A;  3OMG A;  1PG5 B;  2VUB A;  3VRZ A;  2BZ8 A;  2MIO A;  3HSB A;  4FT4 A;  3G4S Q;  4NL2 A;  4MZT A;  2EQI A;  3MP1 A;  1JEG A;  1AT1 B;  1KIK A;  2EWN A;  2QI2 A;  3HPW A;  1VQK Q;  1Q82 C;  4K11 A;  5KYW A;  1ZUY A;  2COZ A;  1OYX A;  4RTT A;  1QW1 A;  2NUP B;  4AT1 B;  1NPR A;  2L3Q A;  2CSI A;  3OS0 A;  3CCS T;  1YIT A;  3I56 A;  1BCM A;  2L0A A;  2BE9 B;  1K4U S;  1M1F A;  3JB9 J;  1GRI A;  1OPK A;  2AT1 B;  1X6O A;  1C1A A;  2XK0 A;  2Y4Y A;  2JS2 A;  2E4H A;  4KUI A;  1U5S A;  3CC7 A;  2KY9 A;  2DXC A;  5IHK A;  3JCM g;  2CUB A;  2C06 A;  1KQ1 A;  1ZBX A;  5GMK m;  1VQL A;  1S72 Q;  3RER A;  4F7U B;  1GCP A;  3PNW C;  3A8O B;  4RUG A;  2H3E B;  2LNV A;  5FRM A;  3OYL A;  2K3B A;  1VQK A;  4KGX B;  3QII A;  2HQX A;  4R56 A;  1FMW A;  4C8Q B;  4DBR A;  4BDY A;  2J06 A;  1JRI A;  4QVD A;  2KT1 A;  2EYW A;  3VU3 C;  3OYN A;  3CBO A;  3L2Q A;  2I2L A;  3OS1 A;  2XDB A;  1SSH A;  2EQM A;  4F7U F;  5EC7 A;  5EG2 A;  4E7I A;  1OEB A;  4A63 B;  3REA B;  4C92 G;  4L59 A;  2XIC A;  4C92 A;  6AT1 B;  5IXB A;  2YRD A;  2LX9 A;  4DBH A;  1YN8 A;  4PL6 A;  1WHM A;  1TG0 A;  1H64 1;  4OB2 B;  3QWX X;  1T3L A;  1Y96 A;  1BIB A;  4C8Q F;  5LJ3 d;  2D0N A;  1JJ2 P;  4OML A;  3JB9 G;  3MEW A;  3CME Q;  1XNI A;  1MV0 B;  4ZNX A;  3A5Z B;  2DM1 A;  3VUZ A;  1YIT T;  1D1A A;  2MAM A;  4XTU A;  3UA6 A;  4OVA A;  3CCV Q;  3OS2 A;  1YHQ Q;  5D7U A;  1ZQ1 A;  1QVG S;  3AT1 B;  1KD1 C;  3HTR A;  1ABO A;  3EG1 A;  3QKJ A;  1X01 A;  3G1J A;  5GAN h;  3O5Z A;  2JXB A;  4XTW A;  4MZP A;  3QWY A;  1U1T A;  2MYS A;  3CC7 T;  1I5O B;  1OI1 A;  2A08 A;  5I11 A;  2R57 A;  3ULR B;  1KQS A;  1WYX A;  2ENM A;  4M7A A;  2ROT A;  5J26 A;  2CP0 A;  3BFM A;  2DER A;  4QVC A;  2ZPF B;  2R5M A;  5GAO n;  3DB4 A;  3EH1 A;  1WQ7 A;  4QQD A;  2JW4 A;  1VQK T;  1W2B A;  1EIF A;  1GCQ C;  3VS1 A;  4PFZ A;  5KCH A;  1KHI A;  2CS7 A;  4C92 E;  1ARK A;  3E9G A;  2JTF A;  2SEM A;  2LT1 A;  1YIJ A;  1Q82 R;  1NZ9 A;  4XTZ A;  4X9C A;  1AHJ B;  1IRE B;  2RM4 A;  4FYY B;  4OMM A;  2NYS A;  2GGR A;  2O01 E;  4HVV A;  2HCK A;  4JRI A;  1Y57 A;  3BDU A;  4DA4 A;  4PNO A;  2HNI A;  1A0N B;  2ZZD A;  3QSU A;  2DTO A;  4NOY A;  1AWJ A;  1SHF A;  2EJ9 A;  4PJO C;  1AWO A;  2K2V A;  1FXX A;  4F16 A;  3CXC S;  3X24 B;  4PLI A;  1R77 A;  2F5T X;  1UHF A;  4C8Q D;  1T0H A;  1WXT A;  2V1R A;  2L5Q A;  2FB7 A;  1VA7 A;  4EMH A;  4JPB W;  2QTV A;  2RK2 A;  3UF4 A;  2JJ9 A;  1VQ9 A;  1LCK A;  1OQK A;  3C4S A;  1QCF A;  2J6F A;  1K76 A;  1BB9 A;  4FL6 A;  3RKW A;  3TRE A;  2KEA A;  1HYO A;  4XQ3 A;  3THK A;  4DBF A;  1VQP Q;  1Z9Q A;  3HL8 A;  3DLM A;  2GCX A;  2HQE A;  3S3M A;  4FSS A;  4EIK A;  1WHL A;  2NUT A;  3CEY A;  3L2Z A;  3V8K A;  2PZ1 A;  3QBY A;  2CH4 W;  1NLO C;  1PCX A;  1QKX A;  4ESR A;  2FZK B;  1UUE A;  1MMD A;  3JCM h;  2VB6 A;  1YCY A;  2RN8 A;  2F69 A;  4FYW B;  2V8K A;  2L3S A;  2PVD B;  2IIM A;  2NUZ A;  2EAY A;  4J6Y A;  2M9U A;  2LQN A;  2XU8 A;  3CME T;  1RLP C;  1RAE B;  4BI4 A;  1D0X A;  4IKF A;  2P0K A;  3GBQ A;  1M1K U;  1Q7Y U;  1YIJ T;  1YBY A;  3VS0 A;  4XAX B;  3GLX A;  2X4W A;  2J6K A;  4E7L A;  4PJO B;  1FYN A;  3KFV A;  5GJW B;  2LDM A;  2BTT A;  1YHQ T;  4J83 A;  2M0Y A;  3CPW P;  3M58 A;  3OYG A;  2CH4 A;  1WHJ A;  1N8R U;  4X1V A;  3TQ7 P;  2MWP A;  4JS4 A;  1ZHI A;  2RNA A;  4BDZ A;  1CKB A;  4D8D A;  1KD1 R;  4E2F B;  3ZFJ A;  3TSW A;  3WVE B;  3VS3 A;  1F1B B;  4RTW A;  3LWH A;  1QVF P;  3L1A A;  4A4G A;  3L42 A;  3EGX A;  3KBG A;  3OS5 A;  3UDC A;  4PJO F;  2CZ6 B;  3BDL A;  5LJ5 g;  1H3H A;  2CP2 A;  3JCM P;  2A3L A;  2X3X D;  2CT4 A;  4OF1 A;  2VYT A;  3CC4 Q;  2ED1 A;  2CT3 A;  2OTL A;  1VQ6 A;  4E6R A;  5KYN A;  4Y92 A;  2KGT A;  4Y91 A;  2DO3 A;  3JB9 H;  3OMC A;  1G3S A;  2LCL A;  2QQB A;  1XOV A;  2OTJ A;  2K5I A;  1EZZ B;  1PC0 A;  2A36 A;  3J7A F;  3TVT A;  3QJ6 A;  3GPL A;  4P5N A;  3HP9 A;  4N4I A;  1QVG P;  3JV3 A;  2LQW A;  3M0T A;  2E70 A;  3JCM e;  4RTY A;  2Y90 A;  4J9G A;  4ZGJ B;  1SF9 A;  1PWT A;  4OGE A;  1K0X A;  2JMA A;  1UTI A;  5GMK h;  1WHG A;  2ABL A;  4PJN A;  5LJ5 j;  2X51 A;  3RMS A;  1D1C A;  1VYU A;  2ATC B;  2CZ0 B;  2JN0 A;  1FX7 A;  3OW2 S;  3UPU A;  4JZ4 A;  1Q81 U;  2VXF A;  1G5V A;  2HEQ A;  1I1J A;  5GAN 7;  2FL7 A;  3JB9 F;  3QG1 A;  1KC8 U;  2FO0 A;  4HCK A;  4KGV B;  2BIV A;  1R0B G;  1TUD A;  2XDD A;  3VS7 A;  2QQR A;  1SEM A;  3OBY A;  3FLG A;  1NJI U;  4M7D B;  2RI5 A;  3H41 A;  2EKO A;  4PJO D;  2F2V A;  4AFS C;  4HT9 A;  4J9F A;  3CXC P;  4J9C A;  1VQ7 Q;  2KQW A;  1M90 U;  1AVZ C;  3EGD A;  2RJD A;  2CP5 A;  3QDR B;  1VQ6 T;  2QAS A;  4M78 G;  5FWC A;  4M78 A;  1MGQ A;  3GIB A;  1K0S A;  4M7D F;  4XU3 A;  3EH2 A;  3LW5 E;  2EGA A;  2JMC A;  2KT8 A;  4IUP A;  3OYB A;  1K9M U;  2IPO B;  3RBB B;  5LJ3 g;  4B9W A;  1G8X A;  2HBP A;  1VIF A;  1SSF A;  1TSF A;  3M0R A;  1M1K C;  1D3B A;  3VYH B;  5IAY A;  5CQX A;  2A0F B;  1VYT A;  2HL5 C;  4CC3 A;  1KQS S;  2FPE A;  2RHY A;  3M9Q A;  3QZ5 B;  4KH1 B;  4C0G A;  1N8R C;  4IUU A;  3EG9 B;  5KYX A;  2LQK A;  1PM3 A;  4PFP A;  4MDX A;  5GAO r;  2O4X B;  2KVQ G;  1W2B S;  1BIA A;  1VQN Q;  2ECZ A;  2NUT B;  3MKD A;  2RQV A;  9ATC B;  3JB9 D;  4DEX A;  2I0N A;  1H8K A;  1ZSZ C;  1KG1 A;  1DJ7 B;  2DL7 A;  2OX7 A;  3A8G B;  1PSF A;  3E2U A;  5LJ3 j;  5IN1 A;  1TH7 A;  3EHQ A;  4M78 E;  3I55 Q;  2A37 A;  4QQ6 A;  1WIE A;  2F2X A;  3E1S A;  2DX1 A;  3MET A;  2BKD N;  2LC4 A;  2YRV A;  2LRQ A;  1PHT A;  5LJ5 h;  2EKH A;  2GTO A;  5J3B A;  2BZX A;  1XJW B;  3JSC A;  5CQY A;  3MJX A;  1RAA B;  2KBT A;  2YT6 A;  4MDW A;  2EVR A;  4JS5 A;  3LYI A;  4M7D D;  2HSE B;  3S3O A;  3SWN C;  4ZTJ A;  1VQN A;  5HK0 A;  1YI2 Q;  3NHN A;  1BKB A;  2ZGW A;  1Y0M A;  1OX9 A;  5CAI A;  1TUG B;  2FG0 A;  2EIF A;  2X4J A;  1RLQ C;  1WZO A;  2EYZ A;  1Q81 C;  5GAN f;  3OQ5 A;  3A98 A;  4ZN3 A;  1VQM Q;  2YDL A;  2K9G A;  2K2M A;  1M5Q 1;  3M57 A;  3KXT A;  1KC8 C;  2YSQ A;  2AIR B;  2PVO B;  3JCM V;  3S6W A;  3PMT A;  4Z02 A;  1IXD A;  2FRW A;  3L2R A;  4N0A C;  1ZSZ B;  1PRM C;  3H0H A;  2AKL A;  3GOX A;  3G71 Q;  1NJI C;  4Z88 A;  4M4Z A;  3VRY A;  1ZUU A;  3FRN A;  4IUR A;  2B8A A;  4AFU C;  4O5V A;  4XU0 A;  5FU6 C;  2X9H A;  5A0D A;  2QGF B;  4E7Z A;  2CKK A;  2XDP A;  3OW2 P;  2EQJ A;  2O31 A;  3FDR A;  5IHN A;  1EX4 A;  2HDA A;  1RAI B;  1YJW Q;  1K73 U;  3C0C A;  2HKN A;  3MPU B;  2RB6 A;  1TXQ A;  3OYF A;  1K9M C;  2LMJ A;  5LJ5 e;  1M1K R;  1Q7Y R;  4IUV A;  2X4X A;  2QTX A;  3A8M B;  3U23 A;  5CKH A;  1AEY A;  5D6W A;  3SWN B;  1BI0 A;  3MCA B;  2RPN A;  2P0P A;  3ER0 A;  3FC3 A;  2CP6 A;  2IG0 A;  1N8R R;  3HRT A;  1MMA A;  1VQN T;  1N27 A;  3G4S A;  3G71 A;  1D0Z A;  1HK9 A;  2EJF A;  2K3X A;  4XU1 A;  1J3T A;  1PRL C;  3QYG B;  1V29 B;  2V8I A;  5LJ3 h;  2O2O A;  3PFS A;  4HKE A;  2LT4 A;  4CI0 C;  2EBP A;  3KUF A;  5ECA A;  2KE9 A;  4OGC A;  2DL5 A;  2QQ9 A;  2G3R A;  3UWN A;  3OA6 A;  3V8J A;  2VGN A;  1MND A;  3CCR Q;  4LUD A;  2E6Z A;  5KCO A;  5GAN 5;  2QYZ A;  1QP2 A;  1UEC A;  3EGD B;  3JCM b;  4JJD A;  3H0F A;  1ZBJ A;  2AZS A;  1WJS A;  2NLU A;  4WTO B;  5KYU B;  4E7J A;  2VGM A;  3JCM f;  2DVJ A;  3CCL Q;  5FU6 B;  4JRK A;  2HKQ B;  3DLL A;  3CD6 Q;  5GAO p;  2VWF A;  2DRM A;  4PLL A;  1QLY A;  3VKI A;  4F14 A;  2L2P A;  3CCM Q;  2E64 A;  4WF2 A;  1M8M A;  5I2S A;  1BK2 A;  3TEE A;  4QW2 A;  3J81 E;  4L5G A;  3VYG A;  1YI2 T;  1S72 A;  4KUD K;  1IHV A;  2YUO A;  1QWF A;  4ATO A;  4PJJ A;  3P8D A;  1ABQ A;  2E12 A;  8AT1 B;  4BE2 A;  2JNG A;  3VS4 A;  3RR6 A;  1FMK A;  1Y7X A;  4R55 A;  1UGV A;  1VQM T;  2DL4 A;  3ME9 A;  4LDY A;  2KDS A; 
#chains in the Genus database with same CATH homology
 2XG8 D;  2E6N A;  5GAM e;  4E7L A;  5D6X A;  2M0O A;  3L2V A;  4PJO B;  4C0D C;  3PT9 A;  2LDM A;  4M78 C;  3URG A;  4M77 G;  2DD4 A;  2RJC A;  1YHQ T;  2HD0 A;  4J83 A;  4C5E A;  5GAN j;  3CBM A;  4M77 A;  3C12 A;  3M58 A;  2X4Y A;  3OYG A;  1HXD A;  2DEQ A;  2RHU A;  4M7A G;  1N8R U;  4HT8 A;  2MWP A;  4KUL A;  4JS4 A;  5CKF A;  1ZHI A;  3G4S T;  4C5I A;  2CZ1 B;  3G71 T;  5KE2 A;  2OTJ T;  2DIG A;  2ZPI B;  3R6O A;  4BDZ A;  1PSE A;  1M90 C;  3V7R A;  3ZFJ A;  4ZGE B;  3BY7 A;  1WQW A;  1RI0 A;  5GAN 4;  3WVE B;  3H6Z A;  1VIE A;  1YI2 A;  5GAM f;  5LJ3 e;  3LGF A;  3CBP A;  4M75 D;  3LWH A;  3AHU A;  3L1A A;  4A4G A;  2CYZ B;  2DD5 A;  3L2U A;  3L42 A;  3E9F A;  3CME A;  3KBG A;  1YJ9 T;  2P4T A;  3OS5 A;  3UDC A;  1N6A A;  4PJO F;  2DK3 A;  2CZ6 B;  3BDL A;  3O8V A;  4OP0 A;  4TVR A;  5LJ5 g;  4RCB A;  3OYA A;  2WSC E;  4M75 B;  3OY9 A;  1VUB A;  4DOW A;  3JB9 I;  3HHT B;  3RES A;  4C0Z A;  2RHI A;  3CCJ T;  3PTA A;  3OYK A;  3JCM P;  1VQM A;  1JJ2 A;  5FRN A;  2A3L A;  5FU7 B;  4OF1 A;  2VYT A;  3RMQ A;  5GMK e;  3CCV A;  1O9S A;  2P0Q A;  1YJW T;  4JDS A;  5CK9 A;  2OTL A;  3OYY A;  3QXE B;  1WJQ A;  3JRZ A;  2R58 A;  1YHQ A;  4MML A;  3CXC A;  4BI8 B;  4BI3 A;  1JJ2 S;  2YLB A;  5FLX E;  4J7F A;  4F7U E;  3TCJ A;  1XTD A;  1WNL A;  4V2S A;  5CKE A;  4Y91 A;  1I8F A;  2DO3 A;  3OMC A;  3JB9 H;  2QA4 T;  1G3S A;  2CGH A;  2LCL A;  4EMK B;  2OTL T;  4PJO G;  2QQB A;  1XOV A;  2EQK A;  2CZ7 B;  3M4G A;  2K5I A;  2HAX A;  4PJO A;  2OTJ A;  1OZ3 A;  1M1G A;  1K73 C;  3J7A F;  2M1H A;  3PMI A;  3QJ6 A;  3OSS C;  4XTV A;  4P5N A;  3GPL A;  3HP9 A;  4M75 F;  2D0Q B;  4QVZ A;  5KE3 A;  1BI1 A;  4N4I A;  1JB0 E;  1Y07 A;  3G7Z A;  4IUT A;  2E70 A;  2MMP A;  2DJZ A;  4ME7 A;  1B34 B;  2GFU A;  2K57 A;  3OBW A;  3JCM e;  5GMK i;  2Y90 A;  4ZGJ B;  1WJR A;  4BD3 A;  2QDY B;  1S72 T;  3MO8 A;  4RG8 A;  4M77 D;  2YLC A;  3PIP A;  3X28 B;  4OGE A;  2DZC A;  3CCJ A;  3CCS A;  4M77 E;  3OYM A;  3I55 T;  5GMK h;  1BYM A;  4M7A E;  4B9X A;  1YJW A;  4HCZ A;  5CVI A;  5LJ5 j;  3CPW S;  5GAN g;  2DXT A;  3RMS A;  3OW2 A;  4M75 G;  4C0D B;  2VV5 A;  2CZ0 B;  4JUV A;  4M78 B;  4II1 A;  4M75 A;  4JLI A;  3GP8 A;  2JN0 A;  4OB3 B;  5DM7 R;  1K8A C;  4JLG A;  2LQ8 A;  3FIF A;  1U1S A;  1JBM A;  1H3Z A;  1WPY A;  2WAC A;  2QA4 A;  3T9N A;  1FX7 A;  3JCM X;  3OW2 S;  3UPU A;  1Q81 U;  2X35 A;  1UB4 A;  2D9T A;  2OAU A;  2VXF A;  3ME9 A;  1G5V A;  5GAN 7;  2FL7 A;  1UGR B;  2RJE A;  4A4H A;  3JB9 F;  3QG1 A;  4C0F A;  4CRI A;  2KSS A;  2GQV A;  1KC8 U;  1QVF S;  3NTK A;  4DQ2 A;  3OB9 A;  3L2W A;  1D3B B;  4BE0 A;  4C92 C;  2L8D A;  2BIV A;  4EMK A;  3X25 B;  4KBM B;  1KD1 U;  2K3Y A;  2BUD A;  2ZPB B;  3SDZ A;  2XDD A;  3QPH A;  2QQR A;  2JVV A;  4C5G A;  2PUO B;  3JCM c;  1VQ6 A;  3OBY A;  4XTX A;  3EAE A;  4M78 F;  3OYI A;  1MHN A;  3GNF B;  1BI2 A;  2DXU A;  2FVU A;  3RKY A;  1G3T A;  3FLG A;  3M55 A;  1NJI U;  4M7D B;  2IVW A;  2RI5 A;  5L8R E;  3CCM T;  2R5A A;  1B34 A;  2EKO A;  2XHC A;  2RA2 A;  4A4F A;  2DXB A;  4PJO D;  1G3W A;  2RH2 A;  4PJO E;  3HRS A;  5LL6 S;  5LJ5 d;  4HT9 A;  2WSF E;  5M9O A;  2H3J A;  3I56 T;  5GAM g;  3INZ A;  3WVD B;  1WGS A;  4A4E A;  3OYC A;  1Y71 A;  4Y28 E;  3CCV T;  2L89 A;  4GLK A;  2FYK A;  2KQW A;  4JRQ A;  2EJG A;  1M90 U;  3CCR A;  2RJD A;  4X34 A;  2ZPE B;  2PQW A;  1N9R A;  3QDR B;  1VQ6 T;  2VC8 A;  5HKC A;  4M78 G;  4C8Q C;  5AYF A;  4M78 A;  1MGQ A;  3NTI A;  1VQP A;  3GIB A;  2GF7 A;  2JTM A;  2RK1 A;  4M7D F;  4XU3 A;  3LW5 E;  3OMG A;  3Q1J A;  2VUB A;  3LX7 A;  2XI9 A;  3HSB A;  3OYE A;  4FT4 A;  3HRU A;  4IUP A;  1NE8 A;  4NL2 A;  3OYB A;  1K9M U;  4E7H A;  3VUB A;  4MZT A;  3CCL A;  4J7I A;  4BAC A;  3MP1 A;  5LJ3 g;  3CD6 A;  4B9W A;  2PUK B;  2V8J A;  4O6J A;  3CCQ T;  2HBP A;  1VIF A;  1SSF A;  5GAN 6;  4M7A C;  2EWN A;  3LWI A;  2QI2 A;  3HPW A;  4M75 E;  1D3B A;  5CKB A;  3VYH B;  4LDV A;  1W4S A;  5IAY A;  3CCM A;  2YHT A;  1Q82 C;  3UT1 A;  5CQX A;  3H8Z A;  4BUG A;  1M1K C;  1OYX A;  4EMG A;  1IZ6 A;  3FEO A;  1QW1 A;  1NPR A;  1VQL T;  3VV0 A;  1KQS S;  3OS0 A;  3CCS T;  1YIT A;  4M7D G;  3I56 A;  2DPP B;  4M7D A;  2RHY A;  3M9Q A;  3QZ5 B;  4C0G A;  5I21 A;  1N8R C;  4EPC A;  4IUU A;  3RKX A;  4LD6 A;  1M1F A;  4XU2 A;  3JB9 J;  1BI3 A;  2LQK A;  4LD9 K;  3JCM Q;  1X6O A;  2FHD A;  3M59 A;  5GAN d;  3J80 E;  5FRO A;  5GAO r;  2XK0 A;  1Q86 U;  2Y4Y A;  5GAM j;  4C5H A;  2O4X B;  2KVQ G;  1W2B S;  1BIA A;  5GAO m;  2E1H A;  3V7S A;  4C92 B;  4E7K A;  2XD0 A;  2MWO A;  5DLQ E;  2L3R A;  3NTH A;  3JB9 D;  4KUI A;  3VJP A;  5A0L A;  4ELY C;  3CC7 A;  3CCQ A;  3JCM W;  4DOV A;  3CCE A;  1Y96 B;  1KG1 A;  2KY9 A;  1DJ7 B;  3CMA A;  2DXC A;  1M8V A;  2E10 A;  3JCM g;  1VQO T;  3A8G B;  2WSE E;  4GY5 A;  1PSF A;  3G6E A;  2RD1 A;  2C06 A;  3LGL A;  2F5K A;  4L6V 5;  1KQ1 A;  1XQH A;  4RKU E;  5LJ3 j;  4JJN K;  1ZBX A;  5GMK m;  4ZTF A;  1VQL A;  3CPW A;  3RER A;  5IN1 A;  5LJ5 f;  4F7U B;  4M78 D;  4FU6 A;  3PNW C;  1TH7 A;  1KQ2 A;  3A8O B;  4RCC A;  4M78 E;  5GAN 8;  1GXI E;  3CCU T;  3MEU A;  2LNV A;  5FRM A;  3OYL A;  2M16 A;  1VQK A;  3GF5 A;  4C92 F;  4KT0 E;  2DZ9 A;  3QII A;  3QO3 A;  2HQX A;  4MMK A;  4QQ6 A;  3V8L A;  4R56 A;  3E1S A;  2RHX A;  5KH6 A;  2KK4 A;  2BKD N;  3MET A;  2LC4 A;  5GAN 3;  3OYH A;  2YRV A;  4C8Q B;  4BDY A;  1M9S A;  5GMK j;  1M4Z A;  2LRQ A;  3CC2 A;  5LJ5 h;  1QVF A;  3PGG A;  1JRI A;  4QVD A;  3MHX A;  5J3B A;  3CCR T;  1G3Y A;  1X75 C;  4LDU A;  3VU3 C;  5GAM d;  3CBO A;  3OYN A;  3CC4 A;  2AHJ B;  2K5L A;  3JSC A;  5CQY A;  3L2Q A;  3OYD A;  3X26 B;  2I2L A;  1VQP T;  1FWZ A;  3OS1 A;  2XDB A;  4M75 C;  4HCC A;  2EQM A;  2EYQ A;  4MDW A;  4F7U F;  4XTY A;  2O4X A;  5EG2 A;  4E7I A;  5GAN e;  4JS5 A;  2EFI A;  3LYI A;  4M7D D;  3FJP A;  3P8H A;  4IUQ A;  3MEA A;  4M7A B;  4C92 G;  3S3O A;  1VQO A;  4L59 A;  2XIC A;  4HCB A;  3SWN C;  4ZTJ A;  4C92 A;  3CCL T;  2DTI A;  4YTL A;  1VQ8 A;  4M7D E;  2X4W A;  2QEX T;  2LX9 A;  1VQN A;  1I4K 1;  3FB9 A;  2D6F A;  3CD6 T;  4PL6 A;  5HK0 A;  2DKG A;  1K8A U;  1H64 1;  4OB2 B;  1Y96 A;  1BKB A;  1BIB A;  2ZGW A;  4C8Q F;  5LJ3 d;  5CAI A;  4EDU A;  3CCU A;  3JB9 G;  5C6S A;  3MEW A;  4LDX A;  1UGQ B;  1XNI A;  1RL2 A;  2EIF A;  2X4J A;  3TU4 K;  3OSV A;  3A5Z B;  3S3N A;  3VUZ A;  4OMF B;  4UC4 A;  1LOJ A;  3HFO A;  2EQU A;  2RJF A;  5A2Q E;  1Q81 C;  1YIT T;  5GAN f;  3OQ5 A;  4F7U A;  4ZN3 A;  4N4G A;  3C94 A;  4JRP A;  1M5Q 1;  2MAM A;  3M57 A;  3M54 A;  4XTU A;  4BY6 C;  1QVG A;  2E65 A;  4OVA A;  3KXT A;  1KC8 C;  4M7A F;  2LVM A;  4ZN1 A;  5HY6 A;  3OS2 A;  4M7D C;  5I2M A;  2KMT A;  3ZBD A;  2PVO B;  1LJO A;  1ZQ1 A;  3CPF A;  4J5Y A;  4J6W A;  3S6W A;  3JCM V;  3PMT A;  4Z02 A;  1QVG S;  1KD1 C;  3C95 A;  1VQ5 A;  4C8Q A;  3L2R A;  4Q5W A;  3M5A A;  3QKJ A;  4N0A C;  1X01 A;  4ZGD B;  5GAN h;  1U8R A;  1UGP B;  1N9S A;  2A7Y A;  3SD4 A;  4NS5 A;  3GOX A;  2XKO C;  4XTW A;  4MZP A;  1NJI C;  1U1T A;  4PKC C;  2QEX A;  2LCC A;  2ZCF B;  4M77 C;  1LNX A;  3CC7 T;  1OI1 A;  3FRN A;  3CCE T;  4IUR A;  5D6Y A;  2B8A A;  2R57 A;  3CMA T;  2LTO A;  1Q7Y C;  1KQS A;  3JCM J;  2K5F A;  4O5V A;  4XU0 A;  5J26 A;  4M7A A;  3QYH B;  5FU6 C;  3G6E T;  5CIU A;  3BFM A;  5A0D A;  3JCM d;  3A8L B;  1NPP A;  4E47 A;  2CKK A;  4QVC A;  1O75 A;  2XDP A;  2ZPF B;  5HK3 A;  1UGS B;  2R5M A;  3SFM A;  3ZEH A;  5GAO n;  2EQJ A;  3DB4 A;  3LLR A;  3FDR A;  2E41 A;  4J8O A;  1WQ7 A;  4QQD A;  5CO7 A;  1VQK T;  1K73 U;  1W2B A;  3JAM E;  1EIF A;  4C92 D;  3QUI A;  2RB6 A;  3EFS A;  1KHI A;  5CCA A;  5KCH A;  4N4H A;  2CS7 A;  5GAO q;  4C92 E;  3CC2 T;  3E9G A;  2JTF A;  3OYF A;  1K9M C;  2Y4X A;  2LT1 A;  5LJ5 e;  1VQ9 T;  1YIJ A;  5CR2 A;  1NZ9 A;  2X4X A;  2QTX A;  4IUV A;  2VXE A;  1AHJ B;  1IRE B;  1QP3 A;  2RM4 A;  3A8M B;  4X9C A;  3CC4 T;  1VQ7 A;  4D6W A;  5CKH A;  2O01 E;  3ASK A;  1KHC A;  4JRI A;  5GAM h;  5D6W A;  3BDU A;  3M4Y A;  3SWN B;  4DA4 A;  1BI0 A;  3MCA B;  1VQ4 T;  4A54 A;  3V7C A;  2P0P A;  2HNI A;  4PNO A;  3P8B B;  2ZZD A;  3DB3 A;  3ER0 A;  5LJ3 f;  3QSU A;  3FC3 A;  2DTO A;  4NOY A;  4OB0 B;  2EJ9 A;  2IG0 A;  1VQ8 T;  2RI2 A;  3HRT A;  4PJO C;  1VQN T;  2QQA A;  1N27 A;  2K2V A;  4BE1 A;  1FXX A;  4A4K A;  3G4S A;  3CXC S;  3X24 B;  3G71 A;  4XK8 E;  4PLI A;  4BB7 A;  1HK9 A;  5GAN 2;  3NFC A;  2EJF A;  2RI3 A;  2F5T X;  3QZ9 B;  2K3X A;  4XU1 A;  4C8Q D;  3QYG B;  1V29 B;  2V8I A;  5LJ3 h;  4C8Q E;  2L5Q A;  3PFS A;  4HKE A;  2FB7 A;  5GAO l;  2KAF A;  1Q86 C;  2XID A;  4BY6 B;  4A53 A;  2LT4 A;  4CI0 C;  4RMO A;  3KUF A;  4EMH A;  4OGC A;  3F70 A;  2QQ9 A;  2G3R A;  4FIB A;  1YJ9 A;  5J39 A;  2RK2 A;  5C0M A;  3UWN A;  3N5B B;  1VQ9 A;  3OA6 A;  2E5Q A;  2DVE A;  2JUF A;  3V8J A;  2VGN A;  3C4S A;  4M7A D;  3HFN A;  2E6Z A;  4FM4 B;  5KCO A;  1YJN T;  3M56 A;  4FL6 A;  5GAN 5;  2QXF A;  3RKW A;  1QP2 A;  1VQ4 A;  3RIR A;  3PIO A;  5GMK l;  3JCM b;  3TRE A;  5IT9 E;  1VQ5 T;  4XQ3 A;  3EFR A;  4M77 B;  4FT2 A;  1WJS A;  2NLU A;  3HL8 A;  1QVP A;  2GCX A;  2HQE A;  3DLM A;  3LH0 A;  3MEV A;  2RO0 A;  5FU7 C;  3S3M A;  4HA8 A;  1S72 A;  2ZPG B;  5CKD A;  4E7J A;  2VGM A;  3CEY A;  3L2Z A;  3V8K A;  2PU9 B;  3MP8 A;  3JCM f;  3QBY A;  4X9D A;  4QQG A;  3X20 B;  5FU6 B;  4ELZ C;  4RG2 A;  2DIQ A;  3E19 A;  3SWN A;  4JRK A;  3DLL A;  3M53 A;  5GAO p;  4PLL A;  1I81 A;  4OB1 B;  3VKI A;  4MDX A;  4LDW A;  4EMK C;  2JZ2 A;  4XTZ A;  2E64 A;  2MI6 A;  3A8H B;  2JOY A;  4WF2 A;  2RHZ A;  5DY9 A;  4F7U G;  2K4Y A;  3QJY A;  3HKS A;  2DAQ A;  3SB2 A;  3JCM h;  1YCY A;  5I2S A;  3BW1 A;  1P92 A;  3RUX A;  3OYJ A;  3TEE A;  3MP6 A;  2F69 A;  4M77 F;  4QW2 A;  1R8O B;  2V8K A;  4L5G A;  4MZM A;  3VYG A;  5DLO A;  2MF2 A;  3J81 E;  4NL3 A;  1YI2 T;  4KUD K;  4ATO A;  2PVD B;  1I5L A;  4VUB A;  2QQS A;  4J6X A;  2EAY A;  3DKM A;  1YJN A;  3I55 A;  3P8D A;  4J6Y A;  2M9U A;  2XU8 A;  3GNG A;  2GFA A;  1UEB A;  3CME T;  2E12 A;  3QHS A;  4FSX A;  4C8Q G;  4BE2 A;  2DTH A;  4BI4 A;  4IKF A;  2JNG A;  2P0K A;  1M1K U;  1Q7Y U;  1YIJ T;  1Q82 U;  1Y7X A;  4R55 A;  2PVG B;  3WXM B;  2ZPH B;  1VQ7 T;  5A0G A;  1VQM T;  1OZ2 A;  1YBY A;  4LDY A;  4N0A A;  4XAX B;  3GLX A;  2KDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...