5KE3A

Crystal structure of setdb1 tudor domain in complex with fragment mrt0181a
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
210
structure length
207
Chain Sequence
ENLYFQGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKSLLSGNHIAYDYHPPADKLYVGSRVVAKYKQVWLYAGIVAETPNVKNKLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLLKSGQLIKTEWEGTWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/transcription inhibitor
molecule keywords Histone-lysine N-methyltransferase SETDB1
publication title Crystal structure of SETDB1 Tudor domain in complex with fragment MRT0181a
rcsb
source organism Homo sapiens
total genus 58
structure length 207
sequence length 210
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18358 Tudor_4 Histone methyltransferase Tudor domain
A PF18359 TUDOR_5 Histone methyltransferase Tudor domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ke3A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ke3A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ke3A03
5D6XA 4BE0A 2HQEA 3OYGA 5J26A 4N4GA 5FROA 2NLUA 2RJCA 5C0MA 3OYLA 5J39A 2E5QA 2M1HA 3E9FA 2FHDA 1KHCA 4E7HA 2K3YA 5C6SA 2BIVA 2LTOA 3META 4IUVA 4N4IA 3M9QA 3P8DA 4PLLA 2X4XA 3LH0A 1WJRA 1OZ3A 4UC4A 3L2VA 4E7IA 3L2QA 3LGFA 2MWPA 4BACA 2X4WA 5M9OA 3OYFA 4OVAA 2GF7A 2RI3A 3LGLA 3L2UA 3CEYA 2G3RA 2DIQA 2R57A 3PMIA 3BDLA 2F5KA 2GFUA 4A4FA 5KCHA 3OS0A 2BUDA 1OYXA 3OS2A 4C5EA 2RHIA 4C5IA 3OYJA 3S3MA 2L3RA 3KUFA 2M0OA 3MEAA 4II1A 3OYHA 4IUUA 3DB3A 3MP1A 3MP6A 5D6WA 3MO8A 1OZ2A 3H6ZA 5IN1A 4QQDA 3PMTA 2K3XA 3QBYA 1WGSA 4IURA 4PL6A 4C5GA 5KE2A 2XDPA 5FRNA 4LD6A 2EQUA 2EQJA 2EQKA 2LRQA 2JZ2A 2RHXA 3L42A 2R5MA 3FEOA 2L8DA 3MEVA 3OMGA 3OYDA 3L2RA 2LCCA 3OMCA 4EDUA 3FLGA 3OY9A 3EAEA 3UT1A 4HCZA 2RI2A 3S3NA 3QIIA 3OA6A 3SD4A 2EKOA 2GFAA 2RHYA 3QJ6A 3S6WA 3DLMA 2P0KA 3FC3A 4QQ6A 2X4YA 2LVMA 4QVZA 4CRIA 5KE3A 3GOXA 1WJSA 2XK0A 3OYBA 2O4XA 4ZTJA 3UWNA 2E6NA 5KCOA 4A4HA 3MEWA 4BDYA 1WJQA 1SSFA 2L89A 3DB4A 4FU6A 2MWOA 2YRVA 3QKJA 4Z02A 3PFSA 4E7JA 3MP8A 2O4XB 3FDRA 3NTKA 3LX7A 4B9WA 3LLRA 2JTFA 4FL6A 3OYKA 4BDZA 4IKFA 5CIUA 4BD3A 2LDMA 2R58A 3OQ5A 2RJDA 3S3OA 3MEUA 2HQXA 4X34A 3OYCA 2CKKA 3NTHA 2QQRA 3OYAA 4BE2A 2RO0A 3Q1JA 4A4GA 5FRMA 3C4SA 3PNWC 1XNIA 1N27A 2DAQA 3OYIA 2EQMA 3LYIA 4E7LA 2R5AA 3O8VA 4Q5WA 4E7KA 2RJFA 4GY5A 3L2WA 4IUPA 2WACA 3OYNA 4BE1A 3P8HA 2PQWA 5D6YA 5KH6A 4IUTA 3NTIA 2X35A 4IUQA 2RI5A 1OI1A 2B8AA 2M16A 3F70A 2IG0A 3ME9A 4PLIA 3OS1A 3OYMA 5IAYA 2RJEA 4B9XA 4N4HA 1MHNA 2EFIA 3OYEA 4ZTFA 1H3ZA 2DIGA 2RHZA 1G5VA 4A4EA 4RG2A 2QQSA 4NS5A 4C5HA 2VYTA 2D9TA 4QQGA 3E9GA 2BKDN 3ZEHA 2RHUA 4L59A 3H8ZA 1RI0A 3OB9A 3ASKA 4QW2A
chains in the Genus database with same CATH superfamily
4FT4A 3AT1B 4J9HA 2XICA 1YWOA 2BE9B 1M4ZA 3OYGA 3OW2A 3LWIA 1EZZB 3CMEA 2B86A 4XTVA 3AHUA 2X4WA 3HRSA 2KROA 1G3WA 3M5AA 1HD3A 4A4FA 4EMKA 1YJNT 1IGQA 3V7RA 1E6HA 1BYMA 1EX4A 2DILA 4CC7A 4EMGA 1RAGB 1WFWA 1ZA1B 4IUUA 1N8RU 2W10A 1KHIA 2HMAA 4M4ZA 2O9SA 5D6WA 2L3SA 4DBFA 3MO8A 3RERA 2FZCB 4LD6A 1ZHIA 4J9CA 1ZBJA 1JB0E 3JCMd 3M0UA 1AZGB 1RL2A 2MPXC 2RI2A 1ZUKA 2DYIA 2EKOA 2A28A 3FC3A 2X4YA 1W70A 5GAOp 1YHQA 1WJSA 2VGMA 4FSXA 3RUXA 1QMCA 1G3SA 7AT1B 4J9GA 4CI0C 3QZ5B 5GAN6 4E7JA 2O4XB 3NTKA 2QA4Q 3JCMf 1UECA 4DQ2A 2DLPA 2LT1A 3OYYA 3OYAA 2ENMA 1AWWA 2AIRB 2RA2A 4XU1A 3HHTB 4KUDK 3CCQA 4XU2A 3QG1A 4KBMB 2M16A 3ME9A 3OS1A 2EYQA 4E7SA 3RMQA 1U8RA 2C0IA 1VYVA 2OTJA 1R0CB 2EYZA 3GF5A 4GLMA 1WYXA 2A7YA 4OMFB 2YUQA 4NOYA 2GQIA 2L2PA 2M02A 4F14A 1TUGB 2YLCA 5J26A 1RLPC 3CCJQ 2QA4T 2KE9A 1X01A 2D0QB 2L3PA 1VA7A 2NYSA 3M57A 2YRCA 2CZ1B 2EGCA 3CCVQ 1Y07A 1D0XA 1QVGS 4OGEA 2MWPA 3X20B 3UDCA 4YTLA 2MAMA 1NPRA 3P8BB 2EVRA 2HKNA 1TXQA 4XTUA 1QCOA 2AT1B 3OSSC 1I0CA 2VB6A 1VQNT 1SHGA 2J05A 4Y91A 3PTAA 1Q81U 2IPOB 5FRNA 4PL6A 2KRMA 4D8KA 1JXOA 3CCJT 2ZAEA 3OBYA 4M75C 3M0RA 4V2SA 1UGPB 3BY7A 2KRSA 4EDUA 3HSBA 4JPBW 2F1LA 2GFAA 5GAMg 4QVZA 4M7DC 1UGRB 5KYWB 1OEBA 1PSFA 4R0KA 4BDYA 4C8QG 1K9MU 2AZVA 4LN2A 3TSWA 1ZA2B 1RAAB 4IKFA 8AT1B 5CIUA 4PNOA 4BD3A 3UF4A 4QT7A 4C8QD 4CC4B 4HVUA 2K2VA 1I81A 4A4GA 3RKXA 3REBB 3T9NA 1VQKQ 5KYWA 1R8OB 4Y28E 2RMOA 3SHWA 2YSQA 4FM4B 1QCFA 2F69A 1QKXA 5FWBA 4FSSA 1K8AC 4F04B 2AK5A 1GCQC 1AHJB 4AMCA 2OTLQ 4JZ3A 5CK9A 1V29B 2X9HA 2CP2A 4QW2A 1KQSS 1K73C 3EFSA 2NLUA 3C12A 3SFMA 3RIRA 5GMKl 4R55A 2DKGA 4JRPA 2E5QA 1VQKT 4J9BA 1RACB 5ECAA 2WSEE 1WHGA 3HL8A 3L2QA 4HT8A 3CCUA 1ARKA 3PMIA 1QVGA 1IZ6A 2BUDA 4AFQC 3CCMA 5I2MA 2OTLT 2M0OA 3QDFA 5IHIA 2DTOA 1PRLC 2MOXA 2GTOA 1X27A 2HNIA 2XDPA 2E12A 5GANg 2NUZA 1Q82U 1HK9A 4M7DB 4JZ4A 2DRMA 1BI3A 2RNAA 2CP0A 3CQTA 2KY9A 1U1TA 3CCRQ 4M75A 3NPFA 3FIFA 3G6EA 2LC4A 4TVRA 3GP8A 2DETA 1MGQA 2E6NA 2RQRA 2VXFA 4E7ZA 4CC2A 2GQVA 1SSFA 4M7DA 3QKJA 3A8OB 5KYUB 1VQ5A 2RQTA 1SF9A 2D8JA 1M3AA 2EQIA 1X2KA 4P5NA 4AFSC 1N27A 2DAQA 2MCNA 4F17A 4E7KA 4MDXA 3OYNA 3M56A 4IUQA 2JVVA 2RI5A 1EFNA 3RBBB 1VYTA 4M75F 5A2QE 3CCRT 3H9NA 4WTOB 2RN8A 4C5HA 4QQGA 2D6FA 2BKDN 1WA7A 2VWFA 4M7DF 2L3QA 1YNZA 3N5BB 2DRKA 1AWJA 4O6JA 2KEAA 2CSQA 5GAMj 5CKFA 4RTXA 4N4IA 3I5SA 3M9QA 1KQSA 2E3IA 3JRZA 2O9VA 3EGUA 4C0DB 3LGFA 1YI2A 3CCSA 5GAMd 2W0ZA 2JMAA 4PJMA 4FYYB 1NJIC 1H8KA 1VQMQ 2FVUA 3VS6A 2PVDB 3KUFA 3J81E 1K73U 5LJ3h 3VKIA 1VQPA 2X3XD 2ABLA 2LQWA 1C0MA 3I56Q 2JN0A 1D1AA 1I1JA 3OW2P 1PG5B 3INZA 2EQJA 3H0FA 5GAMf 3H0HA 3FEOA 1GCPA 1WHMA 1T0JA 1TWBA 4DOVA 1MUZA 4PJOB 3QJ6A 2J6FA 2EYYA 2KR3A 5GJWB 5J3BA 4A4HA 3M54A 2BTTA 2L89A 4MDWA 4A54A 2K79A 3GBQA 1JRIA 1QVPA 3FDRA 3RR6A 3LX7A 1VQMT 2QEXQ 1VQ8A 2J6OA 1OU9A 2F5TX 2RJDA 1HYOA 2GTJA 4PFZA 1IRXA 5L8RE 1M30A 1VQ7A 3E19A 4PJOA 3CCEA 2EQMA 5GAOn 4IUPA 4EIKA 5D6YA 1ZQ1A 4BI4A 2O2OA 4DBHA 3KFVA 2V8IA 5LJ5j 5CR2A 1KD1R 1CKBA 5GANj 3H8ZA 2RQUA 4AG1C 1WIEA 2DL4A 1W4SA 2LCSA 2RM4A 4X1VA 2QEXT 4DBRA 4M78B 4C0GA 1KJWA 5FROA 1S72A 3OYLA 6AT1B 3CC2Q 4RTWA 2YHTA 3JB9J 2FHDA 1M9SA 2CT4A 4OB2B 3LH0A 2GCXA 3G71A 2HAXA 2PVOB 4OB3B 3LGLA 1PC0A 4M78A 2R57A 5LJ5f 2QTXA 3OS2A 5GANf 3M0TA 1AEYA 2CZ0B 2J7IA 1N8RC 1BCMA 2E5KA 2YDLA 2O88A 2L0AA 2CDTA 2PU9B 2BZYA 1W2BS 5GMKh 2SRCA 3A8GB 2C0TA 3CC2T 4FYXB 1PKTA 5FU6C 4C92E 4E2FB 1D1CA 3DLMA 1VQ4A 1M2VB 3HPWA 1VQ6A 4PJOE 2M0YA 3M55A 3VS2A 3HFOA 3PGGA 1WXTA 1VQLQ 3TCJA 2QQBA 3EH1A 4ANJA 4F7UE 4XTZA 2C06A 3EG3A 5IXFA 5HK0A 2KGTA 1X2QA 2LMJA 4L6V5 3NTHA 4M77B 3JCMJ 2COWA 1OX8A 3C4SA 2CGHA 3LWHA 4N0AC 1G2BA 1WNLA 4C8QF 3O8VA 2CH4A 2FEIA 1LCKA 2QDLA 2Z0WA 2ROTA 1UDLA 2LZ6B 4AFUC 2DJZA 2OX7A 3EHQA 1GRIA 5EC7A 1FMWA 4M77A 2A0FB 2JT4A 4WCIA 4ATOA 1VQLT 1QKWA 1KSWA 1UEBA 1SPKA 4E7IA 1KIKA 4XTWA 2FZGB 1RAHB 2DZCA 3RDVA 3GNGA 3O5ZA 4EPCA 4M78E 1YIJA 1KHCA 4M7AE 4LD9K 2ATCB 2LT4A 1G83A 3EHRA 1ACMB 1OZ3A 2DX1A 4ZNXA 3OS5A 3UA6A 3L2UA 4OVAA 3M58A 1SHFA 4PJLA 9ATCB 2GBQA 2G3RA 2QDYB 2LQKA 5IHNA 5KCHA 1YITA 3NFCA 5DLQE 4C5EA 1X75C 1H92A 4EMKB 1MMAA 2FPDA 4KT0E 1BK2A 3MP6A 2V8KA 2P4TA 1Q81C 4OP0A 1Q86R 3C94A 3QBYA 1QQJA 5FW9A 1OULA 3L42A 3OYDA 4JRQA 2XDDA 2ZPFB 1QP2A 2CZ6B 2KSSA 2X3WD 1B3QA 1ZUUA 4JS4A 1QVGP 1W2BA 3GIBA 2MYSA 2SEMA 3CMEQ 1UHCA 1K9MC 2DFUA 2HCKA 2A3LA 2HBWA 2ZPBB 3ER0A 3PFSA 4J8OA 4A53A 1UGVA 1XTDA 2H3EB 3SWNB 4KH1B 2A37A 2FG0A 2XG8D 4X34A 1IGUA 5CKHA 3CXCS 4AFZC 1BI1A 2RO0A 3Q1JA 4ELZC 4OB0B 4QKUA 1XNIA 4C0ZA 4M77E 2CYZB 2HQHA 4QVDA 1T3LA 5GAN5 4GY5A 2QYZA 1VQ9A 4N0AA 3SWNA 4IUTA 2D1XA 2IG0A 4OMLA 1MNDA 1MMGA 3EG2A 4HKEA 2EFIA 4DEYA 3LH5A 2GGRA 1PSEA 1WLPB 3CMET 1UB4A 2C0OA 1YHQQ 4F16A 2PUOB 4RTYA 4XU0A 4LXCA 1K0SA 2DNUA 4LNPA 1PRMC 5C0MA 1B34A 4LUDA 4XQ3A 3E9FA 2K4YA 1VIEA 4AT1B 2K6DA 1YCYA 2X4XA 3CPFA 1WJRA 3EG0A 1E6GA 5HK3A 1YWPA 5HCKA 2J6KA 5M9OA 2QASA 3CCQQ 3VV0A 2FRWA 1OYXA 1WHKA 5FU7C 4CC3A 1M5Q1 1PHTA 2OAWA 2FB7A 3NMZC 4JLIA 2FYKA 1VQNA 1UGSB 1YCSB 4C92G 2OTJQ 1ZBXA 1KD1U 1YHQT 4PJOG 2G6FX 5FLXE 3PMTA 2EJ9A 1Q82C 1KQSP 3V8KA 4C92D 5KYXA 4F7UG 2H3JA 4ESRA 1TUDA 4MMLA 2PNIA 3OY9A 3EAEA 3JCMh 3QIIA 2XHCA 4HVVA 3ZBDA 3WVDB 1UE9A 3GOXA 2DXBA 2V26A 1KFZA 4ZGEB 1JEGA 5KCOA 3CCQT 1FMVA 1NBEB 3JB9G 3UA7A 1QWEA 3WVEB 2J06A 2R58A 2JMCA 2KT8A 2OTJT 2CKKA 1RUWA 1U06A 2KAFA 1M90R 3CCVT 3EFOA 3HP9A 3CPWS 2RF0A 1FWZA 3CXCA 4JJBA 2AHJB 2DVJA 5IT9E 4BE1A 4E47A 2EYWA 1Y96B 3I55A 2YUOA 4M78G 4MMKA 2E3HA 2MMPA 4PJNA 1GFCA 4M7AG 3MPUB 2QQSA 2LJ1A 1SEMA 4MZMA 4M7AD 1B07A 1I07A 1Y96A 1KC8R 1XQHA 1VUBA 3DKMA 1M8VA 4KGZB 1IREB 2VC8A 5C6SA 1SKUB 2LTOA 3OYJA 4JLGA 4J6WA 2AKLA 2EWNA 2PTKA 2RB6A 3FB9A 2DIQA 3QWYA 3HFNA 1ABQA 5CAIA 1CKAA 1FXXA 1I5OB 5GMKi 3JCMc 4II1A 2K3XA 1WHJA 2RHXA 2L8DA 2LCCA 4EMHA 2F2XA 3FLGA 3FRNA 2QXFA 1EIFA 3OA6A 4FYVB 4M77G 5A0LA 4M75B 3R6NA 2PZ1A 5GJVB 1MMNA 1GL5A 3CCUQ 3NHNA 3I35A 2X51A 3H0IA 2JTFA 4FL6A 3CCMQ 1V1CA 3S3OA 3CBOA 1PD0A 2LP5A 3MKDA 2DEQA 1I4K1 2JNGA 1Y7XA 2LQNA 2RJFA 5HKCA 1X6GA 4JRIA 3UPUA 2JS0A 2CP3A 1M90C 3JCMP 3CPWA 1G3YA 1MHNA 4RUGA 1QW1A 1N9RA 3VUZA 4Z8AA 3G6EQ 3V7SA 2D9TA 1YJWQ 1BIAA 3CCUT 4BE0A 1UG1A 2EGEA 2HQEA 3CCMT 3PVQA 1VQ5Q 4FW2A 2KMTA 1WHHA 1Q7YR 4C92C 1RLQC 2E70A 2FPFA 5D7UA 1S1NA 2BIVA 2CUDA 3I5RA 4Z88A 1GBRA 2DTHA 3ZL7C 2ECZA 1QP3A 4BACA 3BFMA 1NM7A 2KK4A 3VS4A 2MI6A 1GCQA 2K7AA 1JU5C 1YP5A 3PVLA 4FCYA 3RMSA 1H3HA 4XK8E 4K11A 3G6ET 3MEAA 1KQ1A 2P0PA 4IIOA 1YJWT 1T3SA 3HTRA 5I11A 4RTVA 4GBQA 2DL3A 2F2VA 2DMOA 3RKWA 3QSUA 2JZ2A 1M27C 3JCMb 1QVFS 2CS7A 2IVWA 1MV0B 3CC7A 2HEQA 5AT1B 2RPNA 2EPDA 5CKDA 2DXCA 5KE3A 1RAIB 3MCAB 5LJ3e 5DY9A 3EGXB 1YI2Q 2FZKB 3CCSQ 4M75E 2DK3A 4ME7A 1I8FA 4AG2C 4C8QC 4B9WA 3X26B 4BDZA 4J5YA 4M7AC 3G4SA 4M7DE 2L5QA 3KBGA 1NPPA 1VQPQ 4J7IA 1YJ9A 5I21A 1W2BP 3CD6A 4KULA 4J9EA 3EGXA 3L2WA 3RKYA 5CO7A 1ZLMA 4LDXA 4B9XA 2QQ9A 3TU4K 1XJWB 2O31A 1IHVA 3SB2A 2KYBA 3M0QA 1YI2T 3CCST 1HSQA 2X4JA 3ASKA 3I56T 5D6XA 1WDXA 3R6OA 2EJGA 4E6RA 1NG2A 1VQ8Q 1NYFA 2E4HA 1VQ7Q 3CMAA 1VQPT 2HSPA 1AT1B 2VGNA 1M90U 4RCBA 3VRYA 1UGQB 4OMOA 4ZN1A 2KNBB 3CCEQ 1Q95G 3REAB 2LNVA 4DOWA 2ZGWA 3OS0A 5GAMh 2GNCA 1AD5A 2RHIA 2L3RA 1TUCA 1SG5A 3PIPA 4BI3A 3A1PA 2DBKA 5IN1A 4QQDA 1PM3A 4OB1B 1M2OA 5KE2A 1AWOA 1JQQA 3FJ5A 1VOMA 3JAME 2A08A 1K0XA 3MEVA 2XI9A 1VQ8T 1KC8U 1S72Q 1VQ7T 1G8XA 3RESA 4C8QB 4C92F 1WI7A 3QYGB 2A36A 4BY6C 2QTVA 2LVMA 3E1SA 5A0GA 1UJ0A 3G71Q 1QVFA 2LQ8A 4F7UF 1WJQA 1BB9A 4Z02A 3VS7A 1X43A 3CC4A 2ZPGB 1XOVA 5GMKe 3SEMA 1VIFA 2VVKA 4C8QA 1ZUYA 5CCAA 2P4RA 3CCLA 2P84A 2MIOA 3I9QA 2DF6A 4OMNA 3UATA 5IXBA 3E2UA 3U23A 2YXYA 1U3OA 1S72T 2FL7A 4HVWA 2B8AA 1WPYA 3THKA 4PLIA 5CVIA 2NUPA 1X6BA 1PNJA 1M3BA 1VQOA 3G71T 4OMPA 4QVCA 2LJ3A 3TQ7P 2EIFA 1VQ6Q 5GAN2 1X6OA 1JJ2S 1ZSGA 3KXTA 1O75A 1A0NB 2DXTA 1RI0A 3JCMQ 3D7SB 2RK2A 1N5ZA 1KQ2A 1TS9A 2XMFA 2ZPEB 2LJ0A 5LJ5h 3CXCP 4ORZA 3BDUA 1M8MA 5GANh 4M7AF 2JOYA 2CREA 2QAZA 4J6YA 3SDZA 5KH6A 1O9SA 1UJYA 2DE0X 2DZ9A 3A8HB 2DERA 4HXJA 3A98A 1IB8A 2YUNA 2DYBA 1D09B 2JTEA 1YBYA 2EAYA 4C5IA 1Y0MA 1M3CA 4RG8A 4BB7A 4MZPA 1KD1C 3PIOA 2DJQA 1VQ6T 5GAOr 1C1AA 5DLOA 1WGSA 4RCCA 5KYYA 1W6XA 4PFOA 4KRTA 4KUIA 3IQLA 3VJPA 4M75G 3OMGA 2JTMA 3EH2A 3OMCA 1YJNA 1P92A 1Q7YU 4NL2A 4HCZA 5AYFA 1OU8A 1SSHA 3SD4A 1YIJQ 2RHYA 4L5GA 4M7DG 4D6WA 2KYMA 3GLXA 4LDWA 3A8MB 1V76A 1K76A 4RTUA 2Y4YA 4FU6A 3VYGA 5FU6B 3LLRA 2KT1A 1YITQ 4XTXA 3OYCA 4RTZA 4XTYA 4LDVA 4Q5WA 2RD1A 4C0FA 1R0BG 2WACA 1KG1A 2ZZDA 3NTIA 3F70A 2XIDA 1WXBA 1YIJT 2F2WA 2VKNA 4DA4A 3M4YA 3J80E 3VS5A 4IIMA 1G3TA 1AZEA 4R56A 2EW3A 1M1GA 1WQ7A 2JS2A 5GMKm 1YITT 4Y92A 4JDSA 2V1QA 3X28B 1JJ2A 5I2SA 8ATCB 2M1HA 1M1KR 1I5LA 2HBPA 1B34B 1X69A 4DBQA 3CPWP 2PVGB 2E64A 4HCKA 4PJJA 2QA4A 1NE8A 1VQ9Q 2Y4XA 5FWCA 4OMQA 3S3MA 2FO0A 1TSFA 2KDSA 3M0PA 3M0SA 3DB3A 3VS0A 1T0HA 1NZ9A 2YWWA 3H6ZA 3EGDB 4X9CA 4JJCA 4DEXA 2PUKB 1K1ZA 1FYNA 4B6MA 2QQAA 2ZCFB 5KYXB 2HKQB 1K8AR 2I2LA 3JB9I 3EGDA 2O4XA 2Y90A 5GAOm 1YN8A 2RQVA 1Z9ZA 3CBPA 3CCJA 5LJ3g 4JS5A 2VXEA 1VQ9T 3EG1A 2ED0A 1K73R 1UUEA 2QK0A 3V8LA 3CCVA 4PJOD 1LPLA 3FJPA 1BCOA 2VUBA 2JM9A 3L1AA 1VQNQ 5FRMA 2YLBA 3JCMe 1SRMA 2NUTB 3OYIA 1Q86C 3LYIA 1TG0A 4XU3A 3EFOB 2CSIA 1N6AA 1NLPC 2RQWA 2E41A 4PFPA 1SRLA 3OYMA 1LOJA 1H3ZA 3GNFB 2DIGA 3A8LB 3E9GA 3BE3A 2NUTA 4J9DA 4L59A 3JB9D 3JCMV 2EJFA 2AZSA 4FW1A 4N4GA 1IHWA 2WSCE 1TOVA 4E7HA 2K3YA 1OPKA 2I0NA 3META 4PLLA 4A4KA 1OV3A 3X25B 3GPLA 2RH2A 1BBZA 3OYFA 2GF7A 2LX7A 3CEYA 4M78D 1M1KC 3BDLA 2COZA 2K9GA 5HY6A 3I55Q 1JO8A 2M51A 4PKCC 1GBQA 2DXUA 1VQKA 2QGGA 1OZ2A 1IXDA 2CP5A 1QCNA 5FU7B 2EQUA 1HJDA 1PD1A 1N9SA 1MMDA 1OPLA 5DM7R 1Y57A 3UT1A 2OTLA 3S6WA 4QQ6A 2XK0A 4ZTJA 5CQYA 1M1FA 3MEWA 2MWOA 2YRVA 1D0ZA 1ZSZC 3I55T 2CUBA 3NGPA 1HXDA 4HCCA 2HQXA 4JRKA 2DEUA 3V7CA 3PNWC 4RKUE 4LDUA 2R5AA 2DD5A 1D3BB 5LL6S 1BI2A 1QVFP 1WQWA 1NJIR 1W1FA 2EYXA 2YUPA 3OBWA 3ZFJA 5IAYA 2RJEA 1U1SA 2DBMA 2DM1A 2K5FA 3PE0A 4M77D 2BE7D 4A4EA 2AKKA 2JJ9A 4KGVB 3ZEHA 2RHUA 4Z89A 3QDRB 3QPHA 3MHXA 1QWFA 4FIBA 4RMOA 1D3BA 3OB9A 5GAOq 1JBMA 4C0DC 1Q86U 2RJCA 2K5LA 2VASA 1K4US 5IH2A 2K5IA 3CCRA 2XDBA 2DO3A 5LJ5g 4O5VA 1QLYA 3QUIA 5CQXA 2OJ2A 4UC4A 3L2VA 5LJ3j 2KBTA 2KRNA 2P0QA 2D0NA 2RI3A 5GAN4 1JXMA 2CZ7B 2GFUA 4ZN3A 5LJ3d 1YJWA 1FMKA 2LNHB 3V8JA 3HKSA 2HSEB 5GAOl 4PJOC 4C5GA 2BZXA 4A63B 2EQKA 2LRQA 3C0CA 4OGCA 3CBMA 1KC8C 1AWXA 2E6ZA 2KI7A 2YT6A 2ZPHB 4X9DA 2EKHA 2WSFE 2E10A 5LJ3f 3VS3A 1ZSZB 2OAUA 1M1KU 4HCBA 3L2ZA 2DVEA 2P0KA 5I22A 1YFNA 3TSZA 1F1BB 3TVTA 3C95A 4CRIA 5KYUA 2JXBA 2NWMA 3JSCA 3OYBA 1LVKA 1KK7A 2CP7A 2K2MA 3X24B 4OMMA 2ROLA 1TU0B 2DPPB 3OYKA 4KH0B 2ESWA 1VQ5T 4JJNK 1ZSZA 2QQRA 4BE2A 3QZ9B 1U5SA 1Y71A 4E7LA 4NL3A 1UHFA 1LJOA 4VUBA 2ZPIB 2XKOC 3BW1A 4J7FA 3P8HA 2K3BA 1BIBA 2X35A 1E7OA 1VQMA 1UFFA 4N4HA 2CP6A 1K8AU 3CC7Q 4M78C 2XD0A 1N8RR 4ZTFA 2RHZA 4NS5A 3M53A 1D0YA 3I56A 5L23A 3H41A 2KVQG 2MK5A 3TEEA 1AOJA 1AVZC 3TREA 1PCXA 2JW4A 2V8JA 4IUVA 1GFDA 3P8DA 3G4SQ 2FRYA 2YRDA 1YJ9Q 3EG9B 2DL8A 2IIMA 2XU8A 3CD6Q 5IHKA 3JB9H 2E65A 4C92B 2DA9A 2F5KA 3M4GA 2QEXA 5GMKj 3CC7T 2DL7A 1WXUA 4F7UB 1RAEB 3VRZA 2RK1A 2DTIA 2H8HA 1JJ2P 3RNJA 2V1RA 3EG9A 2ED1A 4C92A 2HDAA 2R5MA 3L2RA 1OX9A 1UTIA 1MNEA 1PWTA 2FPEA 1Q7YC 1NEGA 2VV5A 1H641 1RADB 5GAMe 4F7UA 2CT3A 3VS1A 3G4ST 1ZX6A 2MF2A 4GLKA 3HRUA 3CMAQ 2DD4A 1YJ9T 3CD6T 2OI3A 4M77C 3DB4A 4D8DA 3ULRB 1OQKA 2HD0A 3CC2A 2LDMA 3MEUA 1BKBA 3LW5E 1RI9A 1D1BA 4KGXB 3G1JA 5LJ5d 3HRTA 3URGA 1NLOC 1TTHB 5GANd 3QJYA 4PJOF 3JCMg 3JV3A 1RABB 4M7AB 3CCET 3QHSA 4BI8B 2PQWA 1OI1A 3J7AF 2KQWA 4ZGDB 3CMAT 4XAXB 3VUBA 2EGAA 1ABOA 1MV3A 3M59A 2VYTA 2NUPB 1C6VX 1Q81R 3A5ZB 3VYHB 1NYGA 4M7AA 4LUEA 3OW2S 4LDYA 2E1HA 2HZYA 4J6XA 2DL5A 3JCMX 2BZ8A 5CKEA 3JB9F 3CC4Q 5J39A 3QWXX 1BU1A 4J9IA 1IO6A 4OF1A 2EBPA 3CCLQ 1VQLA 1WX6A 2JUFA 4EMKC 1K9MR 1RAFB 3G7ZA 1VQ4Q 4JUVA 1NJIU 3QYHB 4ZGJB 1DJ7B 3QO3A 4WF2A 1GXIE 4FYWB 3OYHA 2LCLA 5LJ5e 4M78F 3MJXA 3MP1A 5GANe 1VQOQ 2QG9B 1BI0A 1WZOA 1J3TA 4IURA 2LX9A 1WHLA 2K57A 5GAN7 3PT9A 1R77A 3CC4T 1VYUA 5KYYB 3VU3C 1M2VA 2O01E 4JJDA 4RTTA 2M9UA 3SWNC 2COYA 3CCLT 5GAN3 3DLLA 4J9FA 4HT9A 1B7TA 4ELYC 4J83A 1NEBA 3UWNA 1VQ4T 3MP8A 1LNXA 4BY6B 1CSKA 3OQ5A 5A0DA 4FT2A 1K9AA 1VQOT 4PK4A 2KXCA 3QXEB 2HL3A 4BUGA 2KXDA 4HA8A 5KYNA 1FX7A 4M75D 3OSVA 1PKSA 4MZTA 3JCMW 1TH7A 4C8QE 2JM8A 5GAN8 2HL5C 1OOTA 2D8HA 2QGFB 5EG2A 1YJNQ 4LE9A 5CKBA 4M7DD 3OYEA 2QI2A 1G5VA 4RG2A 3WXMB 1Z9QA 3EFRA 1Q82R 2CH4W 4M77F 3S3NA
chains in the Genus database with same CATH topology
4BE0A 1W4SA 2RM4A 4FT4A 2HQEA 2QEXT 2XICA 4M78B 4C0GA 3CCMT 4N4GA 5FROA 1S72A 2KMTA 3OYLA 2WSCE 4C92C 2YHTA 2E70A 1M4ZA 3JB9J 2FHDA 4E7HA 2K3YA 3OYGA 2BIVA 1M9SA 3META 4PLLA 3OW2A 4OB2B 3LH0A 2GCXA 4A4KA 3G71A 3LWIA 2DTHA 3CMEA 2HAXA 2PVOB 4XTVA 1QP3A 3X25B 4BACA 2X4WA 3GPLA 3AHUA 3HRSA 2RH2A 3BFMA 3OYFA 2GF7A 2KK4A 3LGLA 2MI6A 3CEYA 4OB3B 1G3WA 3M5AA 4M78D 4M78A 2R57A 4A4FA 3BDLA 4EMKA 5LJ5f 1YJNT 1M1KC 2QTXA 3OS2A 3V7RA 5GANf 1BYMA 3RMSA 5HY6A 2CZ0B 4XK8E 4PKCC 4EMGA 3G6ET 1N8RC 3MEAA 1KQ1A 2P0PA 4IUUA 1YJWT 1N8RU 1KHIA 2DXUA 5D6WA 1VQKA 3MO8A 1OZ2A 2PU9B 3RERA 4LD6A 2EQUA 5FU7B 1W2BS 3RKWA 1ZHIA 5GMKh 2JZ2A 3QSUA 1N9SA 3A8GB 5DM7R 1JB0E 3JCMb 3JCMd 3CC2T 1QVFS 2CS7A 2IVWA 1RL2A 3CC7A 3UT1A 2RI2A 2OTLA 5FU6C 4C92E 2EKOA 3S6WA 5CKDA 3DLMA 3FC3A 1VQ4A 3HPWA 4QQ6A 1VQ6A 2X4YA 2DXCA 5KE3A 3M55A 4PJOE 3HFOA 3PGGA 5GAOp 3MCAB 1YHQA 1WJSA 2VGMA 2XK0A 4FSXA 5LJ3e 3RUXA 4ZTJA 5DY9A 5CQYA 3TCJA 1M1FA 2QQBA 1G3SA 3MEWA 4F7UE 2MWOA 2YRVA 2DK3A 4M75E 4XTZA 3QZ5B 4CI0C 4ME7A 1I8FA 4C8QC 5GAN6 2C06A 4E7JA 2O4XB 3NTKA 4B9WA 3I55T 3X26B 4BDZA 4J5YA 3JCMf 4M7AC 5HK0A 1HXDA 4DQ2A 4HCCA 2HQXA 2LT1A 3OYYA 4JRKA 4L6V5 3NTHA 4M77B 3OYAA 3G4SA 3JCMJ 2L5QA 4M7DE 3KBGA 4PJOC 3V7CA 1NPPA 3C4SA 3PNWC 2CGHA 4J7IA 4RKUE 3LWHA 1YJ9A 5I21A 2RA2A 4LDUA 4XU1A 3CD6A 3HHTB 4KULA 2R5AA 4N0AC 1WNLA 4KUDK 4C8QF 2DD5A 3O8VA 1D3BB 3L2WA 3CCQA 3RKYA 5CO7A 5LL6S 4XU2A 1BI2A 3QG1A 4LDXA 4KBMB 1WQWA 2DJZA 2M16A 3ME9A 3OS1A 3OBWA 2EYQA 3ZFJA 2RJEA 1U1SA 2K5FA 3RMQA 5IAYA 4B9XA 2QQ9A 3TU4K 1U8RA 4M77D 4M77A 2OTJA 3SB2A 4A4EA 4ATOA 3GF5A 1VQLT 2A7YA 3ZEHA 2RHUA 4OMFB 3QDRB 3QPHA 1YI2T 4NOYA 3MHXA 4FIBA 3CCST 4RMOA 1D3BA 1UEBA 2X4JA 3OB9A 3ASKA 3I56T 5GAOq 5D6XA 4XTWA 4E7IA 3R6OA 1JBMA 2YLCA 5J26A 2QA4T 4C0DC 1X01A 2EJGA 2D0QB 1Q86U 2DZCA 2RJCA 2K5LA 3GNGA 4EPCA 4M78E 2K5IA 3M57A 3CCRA 2CZ1B 2XDBA 1YIJA 2DO3A 1KHCA 5LJ5g 1Y07A 3CMAA 4O5VA 1VQPT 4LD9K 2LT4A 3QUIA 4M7AE 2VGNA 5CQXA 1QVGS 1M90U 4RCBA 1OZ3A 1UGQB 4UC4A 4ZN1A 3L2VA 5LJ3j 4OGEA 2MWPA 2P0QA 3OS5A 3L2UA 4OVAA 3M58A 2RI3A 5GAN4 2G3RA 2CZ7B 2QDYB 3X20B 4DOWA 2LNVA 2LQKA 2ZGWA 3UDCA 3OS0A 2GFUA 5KCHA 5GAMh 1YITA 3NFCA 4YTLA 2MAMA 1NPRA 3P8BB 5DLQE 4C5EA 5LJ3d 1X75C 4ZN3A 2RHIA 1YJWA 4XTUA 2L3RA 3OSSC 4EMKB 4KT0E 3V8JA 3HKSA 3PIPA 3MP6A 2V8KA 4BI3A 2P4TA 1Q81C 4OP0A 5IN1A 1VQNT 4QQDA 3PTAA 4OB1B 3C94A 3QBYA 4Y91A 5KE2A 5GAOl 4PL6A 4C5GA 1Q81U 5FRNA 3CCJT 2EQKA 2LRQA 3JAME 4OGCA 3L42A 3OBYA 3CBMA 3MEVA 3OYDA 2XI9A 1KC8C 4M75C 4JRQA 1VQ8T 2E6ZA 4V2SA 2XDDA 2ZPHB 1UGPB 2ZPFB 3BY7A 4X9DA 1KC8U 1QP2A 2CZ6B 2KSSA 4EDUA 2WSFE 2E10A 1VQ7T 3HSBA 5LJ3f 3RESA 4C8QB 4C92F 4JS4A 1W2BA 2OAUA 3QYGB 1M1KU 4HCBA 2GFAA 3GIBA 4BY6C 3L2ZA 2DVEA 2P0KA 5GAMg 2LVMA 3E1SA 3C95A 4QVZA 4CRIA 5A0GA 4M7DC 3OYBA 3JSCA 1UGRB 1QVFA 1PSFA 2LQ8A 4F7UF 1WJQA 3X24B 4BDYA 1K9MC 4C8QG 4Z02A 1K9MU 2A3LA 2ZPBB 3ER0A 4A53A 3PFSA 4J8OA 1XTDA 3SWNB 2DPPB 3OYKA 3CC4A 2ZPGB 1XOVA 5GMKe 4IKFA 5CIUA 4PNOA 2XG8D 4BD3A 1VIFA 1VQ5T 4JJNK 4C8QA 4C8QD 4X34A 3CXCS 5CKHA 2QQRA 2K2VA 1I81A 4BE2A 1BI1A 2RO0A 3Q1JA 3QZ9B 4A4GA 4ELZC 5CCAA 4OB0B 3CCLA 1XNIA 1Y71A 3RKXA 4C0ZA 4M77E 2CYZB 3T9NA 1R8OB 4E7LA 4NL3A 4QVDA 5GAN5 4Y28E 1LJOA 4GY5A 4VUBA 2ZPIB 4FM4B 2XKOC 3BW1A 4J7FA 3P8HA 2F69A 1VQ9A 4N0AA 3SWNA 1S72T 1BIBA 2FL7A 2X35A 4IUTA 2B8AA 1WPYA 1VQMA 2IG0A 4PLIA 5CVIA 1K8AC 4N4HA 4HKEA 1AHJB 1K8AU 4M78C 2XD0A 2EFIA 4ZTFA 2RHZA 5CK9A 1VQOA 1PSEA 3G71T 1V29B 4NS5A 4QVCA 3M53A 3CMET 1UB4A 2EIFA 3I56A 5GAN2 1X6OA 1JJ2S 3KXTA 1O75A 2DXTA 2PUOB 1RI0A 4XU0A 2KVQG 4QW2A 3JCMQ 2RK2A 3TEEA 1KQSS 1K73C 1KQ2A 3EFSA 2NLUA 2ZPEB 3TREA 5C0MA 1B34A 3C12A 3RIRA 3SFMA 5GMKl 5LJ5h 2DKGA 3BDUA 4R55A 4JRPA 2E5QA 4XQ3A 5GANh 4M7AF 3E9FA 2JOYA 1VIEA 2K4YA 4J6YA 3SDZA 5KH6A 2V8JA 4IUVA 1O9SA 3P8DA 1YCYA 2X4XA 3CPFA 1WJRA 1VQKT 2DZ9A 3A8HB 5HK3A 2WSEE 3L2QA 3HL8A 2XU8A 5M9OA 2E65A 3CCUA 4HT8A 4C92B 3JB9H 3VV0A 3PMIA 1QVGA 2F5KA 3M4GA 2QEXA 1IZ6A 2BUDA 1OYXA 5GMKj 3CCMA 1YBYA 5FU7C 3CC7T 2EAYA 1M5Q1 4C5IA 2FB7A 4JLIA 5I2MA 2OTLT 4RG8A 4BB7A 2FYKA 4F7UB 4MZPA 1VQNA 2M0OA 1UGSB 4C92G 1KD1C 2RK1A 2DTIA 1ZBXA 3PIOA 1VQ6T 1KD1U 1YHQT 4PJOG 2DTOA 5GAOr 5FLXE 5DLOA 3PMTA 1WGSA 2EJ9A 4RCCA 2HNIA 2XDPA 2E12A 1Q82C 5GANg 3V8KA 4C92D 4C92A 1Q82U 4KUIA 1HK9A 3VJPA 4F7UG 4M75G 4M7DB 2R5MA 3OMGA 2H3JA 2JTMA 3L2RA 3OMCA 1BI3A 1YJNA 2VV5A 1P92A 4MMLA 1Q7YC 1Q7YU 3OY9A 2KY9A 4NL2A 3EAEA 1H641 1U1TA 4HCZA 5GAMe 5AYFA 3JCMh 3QIIA 4M75A 3SD4A 4F7UA 3G4ST 2RHYA 2XHCA 3FIFA 2LC4A 2MF2A 4GLKA 3HRUA 4L5GA 3G6EA 4D6WA 3ZBDA 3GLXA 4M7DG 2DD4A 1YJ9T 4TVRA 3WVDB 3GP8A 3GOXA 2DXBA 3CD6T 4LDWA 4ZGEB 3A8MB 1MGQA 2E6NA 2VXFA 4M77C 5KCOA 3CCQT 2GQVA 2Y4YA 1SSFA 3DB4A 4FU6A 4M7DA 3QKJA 3JB9G 3A8OB 3VYGA 1VQ5A 5FU6B 3LLRA 3WVEB 2HD0A 3CC2A 2LDMA 2R58A 4XTXA 3MEUA 2OTJT 3OYCA 2CKKA 2KAFA 1BKBA 4P5NA 3LW5E 4XTYA 3CCVT 1N27A 2DAQA 4LDVA 5LJ5d 3HRTA 3HP9A 3URGA 3CPWS 5GANd 3QJYA 4Q5WA 4PJOF 4E7KA 4MDXA 3JCMg 1FWZA 2RD1A 4M7AB 4C0FA 2WACA 3OYNA 2AHJB 3CXCA 5IT9E 3CCET 4BE1A 4E47A 1KG1A 2ZZDA 3QHSA 4BI8B 2PQWA 3M56A 1Y96B 3NTIA 4IUQA 1OI1A 2JVVA 2RI5A 3F70A 3I55A 2XIDA 4M75F 5A2QE 3CCRT 3J7AF 2KQWA 4M78G 1YIJT 4MMKA 4ZGDB 3CMAT 2MMPA 4XAXB 3VUBA 4DA4A 3M4YA 3J80E 4M7AG 1G3TA 2QQSA 3M59A 2VYTA 4C5HA 4QQGA 2D6FA 2BKDN 4MZMA 3A5ZB 4M7DF 4R56A 3VYHB 1M1GA 1WQ7A 4M7AA 4M7AD 3N5BB 3OW2S 4LDYA 2E1HA 5GMKm 1YITT 1Y96A 4J6XA 4O6JA 3JCMX 1XQHA 4JDSA 1VUBA 3DKMA 5CKEA 3X28B 3JB9F 1JJ2A 1M8VA 5GAMj 5I2SA 5J39A 5CKFA 2M1HA 1IREB 2VC8A 1I5LA 2HBPA 5C6SA 2LTOA 4N4IA 3OYJA 3M9QA 4JLGA 1KQSA 4J6WA 1B34B 2EWNA 3JRZA 4OF1A 1VQLA 4C0DB 2PVGB 3LGFA 2JUFA 4EMKC 1YI2A 2E64A 3CCSA 5GAMd 3G7ZA 2RB6A 3FB9A 2DIQA 4JUVA 3HFNA 1NJIC 2QA4A 1NE8A 1NJIU 2Y4XA 3QYHB 4ZGJB 5CAIA 1DJ7B 1FXXA 5GMKi 2FVUA 3QO3A 3S3MA 4WF2A 2PVDB 3JCMc 2KDSA 1GXIE 3KUFA 3J81E 1K73U 4II1A 5LJ3h 3VKIA 2LCLA 5LJ5e 4M78F 3OYHA 3DB3A 1VQPA 3MP1A 5GANe 1BI0A 1NZ9A 3H6ZA 2K3XA 2JN0A 4X9CA 4IURA 2PUKB 3INZA 2LX9A 2EQJA 2K57A 5GAN7 5GAMf 2RHXA 3PT9A 3FEOA 2L8DA 2QQAA 2LCCA 4EMHA 4DOVA 3CC4T 2ZCFB 3VU3C 2O01E 3FLGA 3FRNA 2QXFA 1EIFA 4PJOB 3OA6A 2M9UA 3QJ6A 3SWNC 3CCLT 5GAN3 2I2LA 3DLLA 4M77G 3JB9I 4HT9A 5A0LA 2O4XA 4M75B 2Y90A 4J83A 3UWNA 5J3BA 4ELYC 5GAOm 1VQ4T 4A4HA 3M54A 2L89A 4MDWA 4A54A 3CBPA 3CCJA 5LJ3g 4JS5A 2VXEA 1VQ9T 3MP8A 1JRIA 1LNXA 1QVPA 3FDRA 3LX7A 1VQMT 4BY6B 3V8LA 2JTFA 4FL6A 1VQ8A 2F5TX 3OQ5A 2RJDA 3CCVA 5L8RE 3S3OA 3CBOA 5A0DA 1VQ7A 4FT2A 4PJOA 3E19A 4PJOD 3FJPA 2VUBA 1VQOT 3L1AA 3QXEB 5FRMA 4BUGA 2DEQA 1I4K1 2JNGA 2YLBA 1Y7XA 3JCMe 4HA8A 3OYIA 2EQMA 1FX7A 3LYIA 4M75D 3CCEA 1Q86C 3OSVA 5GAOn 4MZTA 2RJFA 1TH7A 4C8QE 5HKCA 4IUPA 3JCMW 4XU3A 5GAN8 1N6AA 4JRIA 5D6YA 2E41A 3UPUA 1ZQ1A 4BI4A 1M90C 3JCMP 5EG2A 3OYMA 3CPWA 1G3YA 5CKBA 4M7DD 1LOJA 1MHNA 2V8IA 1QW1A 5LJ5j 2QI2A 3GNFB 5CR2A 3OYEA 2DIGA 1H3ZA 1N9RA 1G5VA 3VUZA 4RG2A 5GANj 3V7SA 3WXMB 2D9TA 3A8LB 3E9GA 3EFRA 4L59A 3H8ZA 3JB9D 1BIAA 3JCMV 3CCUT 4M77F 3S3NA 2EJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D6X A;  4BE0 A;  2HQE A;  3OYG A;  5J26 A;  4N4G A;  5FRO A;  2NLU A;  2RJC A;  5C0M A;  3OYL A;  5J39 A;  2E5Q A;  2M1H A;  3E9F A;  2FHD A;  1KHC A;  4E7H A;  2K3Y A;  5C6S A;  2BIV A;  2LTO A;  3MET A;  4IUV A;  4N4I A;  3M9Q A;  3P8D A;  4PLL A;  2X4X A;  3LH0 A;  1WJR A;  1OZ3 A;  4UC4 A;  3L2V A;  4E7I A;  3L2Q A;  3LGF A;  2MWP A;  4BAC A;  2X4W A;  5M9O A;  3OYF A;  4OVA A;  2GF7 A;  2RI3 A;  3LGL A;  3L2U A;  3CEY A;  2G3R A;  2DIQ A;  2R57 A;  3PMI A;  3BDL A;  2F5K A;  2GFU A;  4A4F A;  5KCH A;  3OS0 A;  2BUD A;  1OYX A;  3OS2 A;  4C5E A;  2RHI A;  4C5I A;  3OYJ A;  3S3M A;  2L3R A;  3KUF A;  2M0O A;  3MEA A;  4II1 A;  3OYH A;  4IUU A;  3DB3 A;  3MP1 A;  3MP6 A;  5D6W A;  3MO8 A;  1OZ2 A;  3H6Z A;  5IN1 A;  4QQD A;  3PMT A;  2K3X A;  3QBY A;  1WGS A;  4IUR A;  4PL6 A;  4C5G A;  5KE2 A;  2XDP A;  5FRN A;  4LD6 A;  2EQU A;  2EQJ A;  2EQK A;  2LRQ A;  2JZ2 A;  2RHX A;  3L42 A;  2R5M A;  3FEO A;  2L8D A;  3MEV A;  3OMG A;  3OYD A;  3L2R A;  2LCC A;  3OMC A;  4EDU A;  3FLG A;  3OY9 A;  3EAE A;  3UT1 A;  4HCZ A;  2RI2 A;  3S3N A;  3QII A;  3OA6 A;  3SD4 A;  2EKO A;  2GFA A;  2RHY A;  3QJ6 A;  3S6W A;  3DLM A;  2P0K A;  3FC3 A;  4QQ6 A;  2X4Y A;  2LVM A;  4QVZ A;  4CRI A;  5KE3 A;  3GOX A;  1WJS A;  2XK0 A;  3OYB A;  2O4X A;  4ZTJ A;  3UWN A;  2E6N A;  5KCO A;  4A4H A;  3MEW A;  4BDY A;  1WJQ A;  1SSF A;  2L89 A;  3DB4 A;  4FU6 A;  2MWO A;  2YRV A;  3QKJ A;  4Z02 A;  3PFS A;  4E7J A;  3MP8 A;  2O4X B;  3FDR A;  3NTK A;  3LX7 A;  4B9W A;  3LLR A;  2JTF A;  4FL6 A;  3OYK A;  4BDZ A;  4IKF A;  5CIU A;  4BD3 A;  2LDM A;  2R58 A;  3OQ5 A;  2RJD A;  3S3O A;  3MEU A;  2HQX A;  4X34 A;  3OYC A;  2CKK A;  3NTH A;  2QQR A;  3OYA A;  4BE2 A;  2RO0 A;  3Q1J A;  4A4G A;  5FRM A;  3C4S A;  3PNW C;  1XNI A;  1N27 A;  2DAQ A;  3OYI A;  2EQM A;  3LYI A;  4E7L A;  2R5A A;  3O8V A;  4Q5W A;  4E7K A;  2RJF A;  4GY5 A;  3L2W A;  4IUP A;  2WAC A;  3OYN A;  4BE1 A;  3P8H A;  2PQW A;  5D6Y A;  5KH6 A;  4IUT A;  3NTI A;  2X35 A;  4IUQ A;  2RI5 A;  1OI1 A;  2B8A A;  2M16 A;  3F70 A;  2IG0 A;  3ME9 A;  4PLI A;  3OS1 A;  3OYM A;  5IAY A;  2RJE A;  4B9X A;  4N4H A;  1MHN A;  2EFI A;  3OYE A;  4ZTF A;  1H3Z A;  2DIG A;  2RHZ A;  1G5V A;  4A4E A;  4RG2 A;  2QQS A;  4NS5 A;  4C5H A;  2VYT A;  2D9T A;  4QQG A;  3E9G A;  2BKD N;  3ZEH A;  2RHU A;  4L59 A;  3H8Z A;  1RI0 A;  3OB9 A;  3ASK A;  4QW2 A; 
#chains in the Genus database with same CATH topology
 4FT4 A;  3AT1 B;  4J9H A;  2XIC A;  1YWO A;  2BE9 B;  1M4Z A;  3OYG A;  3OW2 A;  3LWI A;  1EZZ B;  3CME A;  2B86 A;  4XTV A;  3AHU A;  2X4W A;  3HRS A;  2KRO A;  1G3W A;  3M5A A;  1HD3 A;  4A4F A;  4EMK A;  1YJN T;  1IGQ A;  3V7R A;  1E6H A;  1BYM A;  1EX4 A;  2DIL A;  4CC7 A;  4EMG A;  1RAG B;  1WFW A;  1ZA1 B;  4IUU A;  1N8R U;  2W10 A;  1KHI A;  2HMA A;  4M4Z A;  2O9S A;  5D6W A;  2L3S A;  4DBF A;  3MO8 A;  3RER A;  2FZC B;  4LD6 A;  1ZHI A;  4J9C A;  1ZBJ A;  1JB0 E;  3JCM d;  3M0U A;  1AZG B;  1RL2 A;  2MPX C;  2RI2 A;  1ZUK A;  2DYI A;  2EKO A;  2A28 A;  3FC3 A;  2X4Y A;  1W70 A;  5GAO p;  1YHQ A;  1WJS A;  2VGM A;  4FSX A;  3RUX A;  1QMC A;  1G3S A;  7AT1 B;  4J9G A;  4CI0 C;  3QZ5 B;  5GAN 6;  4E7J A;  2O4X B;  3NTK A;  2QA4 Q;  3JCM f;  1UEC A;  4DQ2 A;  2DLP A;  2LT1 A;  3OYY A;  3OYA A;  2ENM A;  1AWW A;  2AIR B;  2RA2 A;  4XU1 A;  3HHT B;  4KUD K;  3CCQ A;  4XU2 A;  3QG1 A;  4KBM B;  2M16 A;  3ME9 A;  3OS1 A;  2EYQ A;  4E7S A;  3RMQ A;  1U8R A;  2C0I A;  1VYV A;  2OTJ A;  1R0C B;  2EYZ A;  3GF5 A;  4GLM A;  1WYX A;  2A7Y A;  4OMF B;  2YUQ A;  4NOY A;  2GQI A;  2L2P A;  2M02 A;  4F14 A;  1TUG B;  2YLC A;  5J26 A;  1RLP C;  3CCJ Q;  2QA4 T;  2KE9 A;  1X01 A;  2D0Q B;  2L3P A;  1VA7 A;  2NYS A;  3M57 A;  2YRC A;  2CZ1 B;  2EGC A;  3CCV Q;  1Y07 A;  1D0X A;  1QVG S;  4OGE A;  2MWP A;  3X20 B;  3UDC A;  4YTL A;  2MAM A;  1NPR A;  3P8B B;  2EVR A;  2HKN A;  1TXQ A;  4XTU A;  1QCO A;  2AT1 B;  3OSS C;  1I0C A;  2VB6 A;  1VQN T;  1SHG A;  2J05 A;  4Y91 A;  3PTA A;  1Q81 U;  2IPO B;  5FRN A;  4PL6 A;  2KRM A;  4D8K A;  1JXO A;  3CCJ T;  2ZAE A;  3OBY A;  4M75 C;  3M0R A;  4V2S A;  1UGP B;  3BY7 A;  2KRS A;  4EDU A;  3HSB A;  4JPB W;  2F1L A;  2GFA A;  5GAM g;  4QVZ A;  4M7D C;  1UGR B;  5KYW B;  1OEB A;  1PSF A;  4R0K A;  4BDY A;  4C8Q G;  1K9M U;  2AZV A;  4LN2 A;  3TSW A;  1ZA2 B;  1RAA B;  4IKF A;  8AT1 B;  5CIU A;  4PNO A;  4BD3 A;  3UF4 A;  4QT7 A;  4C8Q D;  4CC4 B;  4HVU A;  2K2V A;  1I81 A;  4A4G A;  3RKX A;  3REB B;  3T9N A;  1VQK Q;  5KYW A;  1R8O B;  4Y28 E;  2RMO A;  3SHW A;  2YSQ A;  4FM4 B;  1QCF A;  2F69 A;  1QKX A;  5FWB A;  4FSS A;  1K8A C;  4F04 B;  2AK5 A;  1GCQ C;  1AHJ B;  4AMC A;  2OTL Q;  4JZ3 A;  5CK9 A;  1V29 B;  2X9H A;  2CP2 A;  4QW2 A;  1KQS S;  1K73 C;  3EFS A;  2NLU A;  3C12 A;  3SFM A;  3RIR A;  5GMK l;  4R55 A;  2DKG A;  4JRP A;  2E5Q A;  1VQK T;  4J9B A;  1RAC B;  5ECA A;  2WSE E;  1WHG A;  3HL8 A;  3L2Q A;  4HT8 A;  3CCU A;  1ARK A;  3PMI A;  1QVG A;  1IZ6 A;  2BUD A;  4AFQ C;  3CCM A;  5I2M A;  2OTL T;  2M0O A;  3QDF A;  5IHI A;  2DTO A;  1PRL C;  2MOX A;  2GTO A;  1X27 A;  2HNI A;  2XDP A;  2E12 A;  5GAN g;  2NUZ A;  1Q82 U;  1HK9 A;  4M7D B;  4JZ4 A;  2DRM A;  1BI3 A;  2RNA A;  2CP0 A;  3CQT A;  2KY9 A;  1U1T A;  3CCR Q;  4M75 A;  3NPF A;  3FIF A;  3G6E A;  2LC4 A;  4TVR A;  3GP8 A;  2DET A;  1MGQ A;  2E6N A;  2RQR A;  2VXF A;  4E7Z A;  4CC2 A;  2GQV A;  1SSF A;  4M7D A;  3QKJ A;  3A8O B;  5KYU B;  1VQ5 A;  2RQT A;  1SF9 A;  2D8J A;  1M3A A;  2EQI A;  1X2K A;  4P5N A;  4AFS C;  1N27 A;  2DAQ A;  2MCN A;  4F17 A;  4E7K A;  4MDX A;  3OYN A;  3M56 A;  4IUQ A;  2JVV A;  2RI5 A;  1EFN A;  3RBB B;  1VYT A;  4M75 F;  5A2Q E;  3CCR T;  3H9N A;  4WTO B;  2RN8 A;  4C5H A;  4QQG A;  2D6F A;  2BKD N;  1WA7 A;  2VWF A;  4M7D F;  2L3Q A;  1YNZ A;  3N5B B;  2DRK A;  1AWJ A;  4O6J A;  2KEA A;  2CSQ A;  5GAM j;  5CKF A;  4RTX A;  4N4I A;  3I5S A;  3M9Q A;  1KQS A;  2E3I A;  3JRZ A;  2O9V A;  3EGU A;  4C0D B;  3LGF A;  1YI2 A;  3CCS A;  5GAM d;  2W0Z A;  2JMA A;  4PJM A;  4FYY B;  1NJI C;  1H8K A;  1VQM Q;  2FVU A;  3VS6 A;  2PVD B;  3KUF A;  3J81 E;  1K73 U;  5LJ3 h;  3VKI A;  1VQP A;  2X3X D;  2ABL A;  2LQW A;  1C0M A;  3I56 Q;  2JN0 A;  1D1A A;  1I1J A;  3OW2 P;  1PG5 B;  3INZ A;  2EQJ A;  3H0F A;  5GAM f;  3H0H A;  3FEO A;  1GCP A;  1WHM A;  1T0J A;  1TWB A;  4DOV A;  1MUZ A;  4PJO B;  3QJ6 A;  2J6F A;  2EYY A;  2KR3 A;  5GJW B;  5J3B A;  4A4H A;  3M54 A;  2BTT A;  2L89 A;  4MDW A;  4A54 A;  2K79 A;  3GBQ A;  1JRI A;  1QVP A;  3FDR A;  3RR6 A;  3LX7 A;  1VQM T;  2QEX Q;  1VQ8 A;  2J6O A;  1OU9 A;  2F5T X;  2RJD A;  1HYO A;  2GTJ A;  4PFZ A;  1IRX A;  5L8R E;  1M30 A;  1VQ7 A;  3E19 A;  4PJO A;  3CCE A;  2EQM A;  5GAO n;  4IUP A;  4EIK A;  5D6Y A;  1ZQ1 A;  4BI4 A;  2O2O A;  4DBH A;  3KFV A;  2V8I A;  5LJ5 j;  5CR2 A;  1KD1 R;  1CKB A;  5GAN j;  3H8Z A;  2RQU A;  4AG1 C;  1WIE A;  2DL4 A;  1W4S A;  2LCS A;  2RM4 A;  4X1V A;  2QEX T;  4DBR A;  4M78 B;  4C0G A;  1KJW A;  5FRO A;  1S72 A;  3OYL A;  6AT1 B;  3CC2 Q;  4RTW A;  2YHT A;  3JB9 J;  2FHD A;  1M9S A;  2CT4 A;  4OB2 B;  3LH0 A;  2GCX A;  3G71 A;  2HAX A;  2PVO B;  4OB3 B;  3LGL A;  1PC0 A;  4M78 A;  2R57 A;  5LJ5 f;  2QTX A;  3OS2 A;  5GAN f;  3M0T A;  1AEY A;  2CZ0 B;  2J7I A;  1N8R C;  1BCM A;  2E5K A;  2YDL A;  2O88 A;  2L0A A;  2CDT A;  2PU9 B;  2BZY A;  1W2B S;  5GMK h;  2SRC A;  3A8G B;  2C0T A;  3CC2 T;  4FYX B;  1PKT A;  5FU6 C;  4C92 E;  4E2F B;  1D1C A;  3DLM A;  1VQ4 A;  1M2V B;  3HPW A;  1VQ6 A;  4PJO E;  2M0Y A;  3M55 A;  3VS2 A;  3HFO A;  3PGG A;  1WXT A;  1VQL Q;  3TCJ A;  2QQB A;  3EH1 A;  4ANJ A;  4F7U E;  4XTZ A;  2C06 A;  3EG3 A;  5IXF A;  5HK0 A;  2KGT A;  1X2Q A;  2LMJ A;  4L6V 5;  3NTH A;  4M77 B;  3JCM J;  2COW A;  1OX8 A;  3C4S A;  2CGH A;  3LWH A;  4N0A C;  1G2B A;  1WNL A;  4C8Q F;  3O8V A;  2CH4 A;  2FEI A;  1LCK A;  2QDL A;  2Z0W A;  2ROT A;  1UDL A;  2LZ6 B;  4AFU C;  2DJZ A;  2OX7 A;  3EHQ A;  1GRI A;  5EC7 A;  1FMW A;  4M77 A;  2A0F B;  2JT4 A;  4WCI A;  4ATO A;  1VQL T;  1QKW A;  1KSW A;  1UEB A;  1SPK A;  4E7I A;  1KIK A;  4XTW A;  2FZG B;  1RAH B;  2DZC A;  3RDV A;  3GNG A;  3O5Z A;  4EPC A;  4M78 E;  1YIJ A;  1KHC A;  4M7A E;  4LD9 K;  2ATC B;  2LT4 A;  1G83 A;  3EHR A;  1ACM B;  1OZ3 A;  2DX1 A;  4ZNX A;  3OS5 A;  3UA6 A;  3L2U A;  4OVA A;  3M58 A;  1SHF A;  4PJL A;  9ATC B;  2GBQ A;  2G3R A;  2QDY B;  2LQK A;  5IHN A;  5KCH A;  1YIT A;  3NFC A;  5DLQ E;  4C5E A;  1X75 C;  1H92 A;  4EMK B;  1MMA A;  2FPD A;  4KT0 E;  1BK2 A;  3MP6 A;  2V8K A;  2P4T A;  1Q81 C;  4OP0 A;  1Q86 R;  3C94 A;  3QBY A;  1QQJ A;  5FW9 A;  1OUL A;  3L42 A;  3OYD A;  4JRQ A;  2XDD A;  2ZPF B;  1QP2 A;  2CZ6 B;  2KSS A;  2X3W D;  1B3Q A;  1ZUU A;  4JS4 A;  1QVG P;  1W2B A;  3GIB A;  2MYS A;  2SEM A;  3CME Q;  1UHC A;  1K9M C;  2DFU A;  2HCK A;  2A3L A;  2HBW A;  2ZPB B;  3ER0 A;  3PFS A;  4J8O A;  4A53 A;  1UGV A;  1XTD A;  2H3E B;  3SWN B;  4KH1 B;  2A37 A;  2FG0 A;  2XG8 D;  4X34 A;  1IGU A;  5CKH A;  3CXC S;  4AFZ C;  1BI1 A;  2RO0 A;  3Q1J A;  4ELZ C;  4OB0 B;  4QKU A;  1XNI A;  4C0Z A;  4M77 E;  2CYZ B;  2HQH A;  4QVD A;  1T3L A;  5GAN 5;  4GY5 A;  2QYZ A;  1VQ9 A;  4N0A A;  3SWN A;  4IUT A;  2D1X A;  2IG0 A;  4OML A;  1MND A;  1MMG A;  3EG2 A;  4HKE A;  2EFI A;  4DEY A;  3LH5 A;  2GGR A;  1PSE A;  1WLP B;  3CME T;  1UB4 A;  2C0O A;  1YHQ Q;  4F16 A;  2PUO B;  4RTY A;  4XU0 A;  4LXC A;  1K0S A;  2DNU A;  4LNP A;  1PRM C;  5C0M A;  1B34 A;  4LUD A;  4XQ3 A;  3E9F A;  2K4Y A;  1VIE A;  4AT1 B;  2K6D A;  1YCY A;  2X4X A;  3CPF A;  1WJR A;  3EG0 A;  1E6G A;  5HK3 A;  1YWP A;  5HCK A;  2J6K A;  5M9O A;  2QAS A;  3CCQ Q;  3VV0 A;  2FRW A;  1OYX A;  1WHK A;  5FU7 C;  4CC3 A;  1M5Q 1;  1PHT A;  2OAW A;  2FB7 A;  3NMZ C;  4JLI A;  2FYK A;  1VQN A;  1UGS B;  1YCS B;  4C92 G;  2OTJ Q;  1ZBX A;  1KD1 U;  1YHQ T;  4PJO G;  2G6F X;  5FLX E;  3PMT A;  2EJ9 A;  1Q82 C;  1KQS P;  3V8K A;  4C92 D;  5KYX A;  4F7U G;  2H3J A;  4ESR A;  1TUD A;  4MML A;  2PNI A;  3OY9 A;  3EAE A;  3JCM h;  3QII A;  2XHC A;  4HVV A;  3ZBD A;  3WVD B;  1UE9 A;  3GOX A;  2DXB A;  2V26 A;  1KFZ A;  4ZGE B;  1JEG A;  5KCO A;  3CCQ T;  1FMV A;  1NBE B;  3JB9 G;  3UA7 A;  1QWE A;  3WVE B;  2J06 A;  2R58 A;  2JMC A;  2KT8 A;  2OTJ T;  2CKK A;  1RUW A;  1U06 A;  2KAF A;  1M90 R;  3CCV T;  3EFO A;  3HP9 A;  3CPW S;  2RF0 A;  1FWZ A;  3CXC A;  4JJB A;  2AHJ B;  2DVJ A;  5IT9 E;  4BE1 A;  4E47 A;  2EYW A;  1Y96 B;  3I55 A;  2YUO A;  4M78 G;  4MMK A;  2E3H A;  2MMP A;  4PJN A;  1GFC A;  4M7A G;  3MPU B;  2QQS A;  2LJ1 A;  1SEM A;  4MZM A;  4M7A D;  1B07 A;  1I07 A;  1Y96 A;  1KC8 R;  1XQH A;  1VUB A;  3DKM A;  1M8V A;  4KGZ B;  1IRE B;  2VC8 A;  5C6S A;  1SKU B;  2LTO A;  3OYJ A;  4JLG A;  4J6W A;  2AKL A;  2EWN A;  2PTK A;  2RB6 A;  3FB9 A;  2DIQ A;  3QWY A;  3HFN A;  1ABQ A;  5CAI A;  1CKA A;  1FXX A;  1I5O B;  5GMK i;  3JCM c;  4II1 A;  2K3X A;  1WHJ A;  2RHX A;  2L8D A;  2LCC A;  4EMH A;  2F2X A;  3FLG A;  3FRN A;  2QXF A;  1EIF A;  3OA6 A;  4FYV B;  4M77 G;  5A0L A;  4M75 B;  3R6N A;  2PZ1 A;  5GJV B;  1MMN A;  1GL5 A;  3CCU Q;  3NHN A;  3I35 A;  2X51 A;  3H0I A;  2JTF A;  4FL6 A;  3CCM Q;  1V1C A;  3S3O A;  3CBO A;  1PD0 A;  2LP5 A;  3MKD A;  2DEQ A;  1I4K 1;  2JNG A;  1Y7X A;  2LQN A;  2RJF A;  5HKC A;  1X6G A;  4JRI A;  3UPU A;  2JS0 A;  2CP3 A;  1M90 C;  3JCM P;  3CPW A;  1G3Y A;  1MHN A;  4RUG A;  1QW1 A;  1N9R A;  3VUZ A;  4Z8A A;  3G6E Q;  3V7S A;  2D9T A;  1YJW Q;  1BIA A;  3CCU T;  4BE0 A;  1UG1 A;  2EGE A;  2HQE A;  3CCM T;  3PVQ A;  1VQ5 Q;  4FW2 A;  2KMT A;  1WHH A;  1Q7Y R;  4C92 C;  1RLQ C;  2E70 A;  2FPF A;  5D7U A;  1S1N A;  2BIV A;  2CUD A;  3I5R A;  4Z88 A;  1GBR A;  2DTH A;  3ZL7 C;  2ECZ A;  1QP3 A;  4BAC A;  3BFM A;  1NM7 A;  2KK4 A;  3VS4 A;  2MI6 A;  1GCQ A;  2K7A A;  1JU5 C;  1YP5 A;  3PVL A;  4FCY A;  3RMS A;  1H3H A;  4XK8 E;  4K11 A;  3G6E T;  3MEA A;  1KQ1 A;  2P0P A;  4IIO A;  1YJW T;  1T3S A;  3HTR A;  5I11 A;  4RTV A;  4GBQ A;  2DL3 A;  2F2V A;  2DMO A;  3RKW A;  3QSU A;  2JZ2 A;  1M27 C;  3JCM b;  1QVF S;  2CS7 A;  2IVW A;  1MV0 B;  3CC7 A;  2HEQ A;  5AT1 B;  2RPN A;  2EPD A;  5CKD A;  2DXC A;  5KE3 A;  1RAI B;  3MCA B;  5LJ3 e;  5DY9 A;  3EGX B;  1YI2 Q;  2FZK B;  3CCS Q;  4M75 E;  2DK3 A;  4ME7 A;  1I8F A;  4AG2 C;  4C8Q C;  4B9W A;  3X26 B;  4BDZ A;  4J5Y A;  4M7A C;  3G4S A;  4M7D E;  2L5Q A;  3KBG A;  1NPP A;  1VQP Q;  4J7I A;  1YJ9 A;  5I21 A;  1W2B P;  3CD6 A;  4KUL A;  4J9E A;  3EGX A;  3L2W A;  3RKY A;  5CO7 A;  1ZLM A;  4LDX A;  4B9X A;  2QQ9 A;  3TU4 K;  1XJW B;  2O31 A;  1IHV A;  3SB2 A;  2KYB A;  3M0Q A;  1YI2 T;  3CCS T;  1HSQ A;  2X4J A;  3ASK A;  3I56 T;  5D6X A;  1WDX A;  3R6O A;  2EJG A;  4E6R A;  1NG2 A;  1VQ8 Q;  1NYF A;  2E4H A;  1VQ7 Q;  3CMA A;  1VQP T;  2HSP A;  1AT1 B;  2VGN A;  1M90 U;  4RCB A;  3VRY A;  1UGQ B;  4OMO A;  4ZN1 A;  2KNB B;  3CCE Q;  1Q95 G;  3REA B;  2LNV A;  4DOW A;  2ZGW A;  3OS0 A;  5GAM h;  2GNC A;  1AD5 A;  2RHI A;  2L3R A;  1TUC A;  1SG5 A;  3PIP A;  4BI3 A;  3A1P A;  2DBK A;  5IN1 A;  4QQD A;  1PM3 A;  4OB1 B;  1M2O A;  5KE2 A;  1AWO A;  1JQQ A;  3FJ5 A;  1VOM A;  3JAM E;  2A08 A;  1K0X A;  3MEV A;  2XI9 A;  1VQ8 T;  1KC8 U;  1S72 Q;  1VQ7 T;  1G8X A;  3RES A;  4C8Q B;  4C92 F;  1WI7 A;  3QYG B;  2A36 A;  4BY6 C;  2QTV A;  2LVM A;  3E1S A;  5A0G A;  1UJ0 A;  3G71 Q;  1QVF A;  2LQ8 A;  4F7U F;  1WJQ A;  1BB9 A;  4Z02 A;  3VS7 A;  1X43 A;  3CC4 A;  2ZPG B;  1XOV A;  5GMK e;  3SEM A;  1VIF A;  2VVK A;  4C8Q A;  1ZUY A;  5CCA A;  2P4R A;  3CCL A;  2P84 A;  2MIO A;  3I9Q A;  2DF6 A;  4OMN A;  3UAT A;  5IXB A;  3E2U A;  3U23 A;  2YXY A;  1U3O A;  1S72 T;  2FL7 A;  4HVW A;  2B8A A;  1WPY A;  3THK A;  4PLI A;  5CVI A;  2NUP A;  1X6B A;  1PNJ A;  1M3B A;  1VQO A;  3G71 T;  4OMP A;  4QVC A;  2LJ3 A;  3TQ7 P;  2EIF A;  1VQ6 Q;  5GAN 2;  1X6O A;  1JJ2 S;  1ZSG A;  3KXT A;  1O75 A;  1A0N B;  2DXT A;  1RI0 A;  3JCM Q;  3D7S B;  2RK2 A;  1N5Z A;  1KQ2 A;  1TS9 A;  2XMF A;  2ZPE B;  2LJ0 A;  5LJ5 h;  3CXC P;  4ORZ A;  3BDU A;  1M8M A;  5GAN h;  4M7A F;  2JOY A;  2CRE A;  2QAZ A;  4J6Y A;  3SDZ A;  5KH6 A;  1O9S A;  1UJY A;  2DE0 X;  2DZ9 A;  3A8H B;  2DER A;  4HXJ A;  3A98 A;  1IB8 A;  2YUN A;  2DYB A;  1D09 B;  2JTE A;  1YBY A;  2EAY A;  4C5I A;  1Y0M A;  1M3C A;  4RG8 A;  4BB7 A;  4MZP A;  1KD1 C;  3PIO A;  2DJQ A;  1VQ6 T;  5GAO r;  1C1A A;  5DLO A;  1WGS A;  4RCC A;  5KYY A;  1W6X A;  4PFO A;  4KRT A;  4KUI A;  3IQL A;  3VJP A;  4M75 G;  3OMG A;  2JTM A;  3EH2 A;  3OMC A;  1YJN A;  1P92 A;  1Q7Y U;  4NL2 A;  4HCZ A;  5AYF A;  1OU8 A;  1SSH A;  3SD4 A;  1YIJ Q;  2RHY A;  4L5G A;  4M7D G;  4D6W A;  2KYM A;  3GLX A;  4LDW A;  3A8M B;  1V76 A;  1K76 A;  4RTU A;  2Y4Y A;  4FU6 A;  3VYG A;  5FU6 B;  3LLR A;  2KT1 A;  1YIT Q;  4XTX A;  3OYC A;  4RTZ A;  4XTY A;  4LDV A;  4Q5W A;  2RD1 A;  4C0F A;  1R0B G;  2WAC A;  1KG1 A;  2ZZD A;  3NTI A;  3F70 A;  2XID A;  1WXB A;  1YIJ T;  2F2W A;  2VKN A;  4DA4 A;  3M4Y A;  3J80 E;  3VS5 A;  4IIM A;  1G3T A;  1AZE A;  4R56 A;  2EW3 A;  1M1G A;  1WQ7 A;  2JS2 A;  5GMK m;  1YIT T;  4Y92 A;  4JDS A;  2V1Q A;  3X28 B;  1JJ2 A;  5I2S A;  8ATC B;  2M1H A;  1M1K R;  1I5L A;  2HBP A;  1B34 B;  1X69 A;  4DBQ A;  3CPW P;  2PVG B;  2E64 A;  4HCK A;  4PJJ A;  2QA4 A;  1NE8 A;  1VQ9 Q;  2Y4X A;  5FWC A;  4OMQ A;  3S3M A;  2FO0 A;  1TSF A;  2KDS A;  3M0P A;  3M0S A;  3DB3 A;  3VS0 A;  1T0H A;  1NZ9 A;  2YWW A;  3H6Z A;  3EGD B;  4X9C A;  4JJC A;  4DEX A;  2PUK B;  1K1Z A;  1FYN A;  4B6M A;  2QQA A;  2ZCF B;  5KYX B;  2HKQ B;  1K8A R;  2I2L A;  3JB9 I;  3EGD A;  2O4X A;  2Y90 A;  5GAO m;  1YN8 A;  2RQV A;  1Z9Z A;  3CBP A;  3CCJ A;  5LJ3 g;  4JS5 A;  2VXE A;  1VQ9 T;  3EG1 A;  2ED0 A;  1K73 R;  1UUE A;  2QK0 A;  3V8L A;  3CCV A;  4PJO D;  1LPL A;  3FJP A;  1BCO A;  2VUB A;  2JM9 A;  3L1A A;  1VQN Q;  5FRM A;  2YLB A;  3JCM e;  1SRM A;  2NUT B;  3OYI A;  1Q86 C;  3LYI A;  1TG0 A;  4XU3 A;  3EFO B;  2CSI A;  1N6A A;  1NLP C;  2RQW A;  2E41 A;  4PFP A;  1SRL A;  3OYM A;  1LOJ A;  1H3Z A;  3GNF B;  2DIG A;  3A8L B;  3E9G A;  3BE3 A;  2NUT A;  4J9D A;  4L59 A;  3JB9 D;  3JCM V;  2EJF A;  2AZS A;  4FW1 A;  4N4G A;  1IHW A;  2WSC E;  1TOV A;  4E7H A;  2K3Y A;  1OPK A;  2I0N A;  3MET A;  4PLL A;  4A4K A;  1OV3 A;  3X25 B;  3GPL A;  2RH2 A;  1BBZ A;  3OYF A;  2GF7 A;  2LX7 A;  3CEY A;  4M78 D;  1M1K C;  3BDL A;  2COZ A;  2K9G A;  5HY6 A;  3I55 Q;  1JO8 A;  2M51 A;  4PKC C;  1GBQ A;  2DXU A;  1VQK A;  2QGG A;  1OZ2 A;  1IXD A;  2CP5 A;  1QCN A;  5FU7 B;  2EQU A;  1HJD A;  1PD1 A;  1N9S A;  1MMD A;  1OPL A;  5DM7 R;  1Y57 A;  3UT1 A;  2OTL A;  3S6W A;  4QQ6 A;  2XK0 A;  4ZTJ A;  5CQY A;  1M1F A;  3MEW A;  2MWO A;  2YRV A;  1D0Z A;  1ZSZ C;  3I55 T;  2CUB A;  3NGP A;  1HXD A;  4HCC A;  2HQX A;  4JRK A;  2DEU A;  3V7C A;  3PNW C;  4RKU E;  4LDU A;  2R5A A;  2DD5 A;  1D3B B;  5LL6 S;  1BI2 A;  1QVF P;  1WQW A;  1NJI R;  1W1F A;  2EYX A;  2YUP A;  3OBW A;  3ZFJ A;  5IAY A;  2RJE A;  1U1S A;  2DBM A;  2DM1 A;  2K5F A;  3PE0 A;  4M77 D;  2BE7 D;  4A4E A;  2AKK A;  2JJ9 A;  4KGV B;  3ZEH A;  2RHU A;  4Z89 A;  3QDR B;  3QPH A;  3MHX A;  1QWF A;  4FIB A;  4RMO A;  1D3B A;  3OB9 A;  5GAO q;  1JBM A;  4C0D C;  1Q86 U;  2RJC A;  2K5L A;  2VAS A;  1K4U S;  5IH2 A;  2K5I A;  3CCR A;  2XDB A;  2DO3 A;  5LJ5 g;  4O5V A;  1QLY A;  3QUI A;  5CQX A;  2OJ2 A;  4UC4 A;  3L2V A;  5LJ3 j;  2KBT A;  2KRN A;  2P0Q A;  2D0N A;  2RI3 A;  5GAN 4;  1JXM A;  2CZ7 B;  2GFU A;  4ZN3 A;  5LJ3 d;  1YJW A;  1FMK A;  2LNH B;  3V8J A;  3HKS A;  2HSE B;  5GAO l;  4PJO C;  4C5G A;  2BZX A;  4A63 B;  2EQK A;  2LRQ A;  3C0C A;  4OGC A;  3CBM A;  1KC8 C;  1AWX A;  2E6Z A;  2KI7 A;  2YT6 A;  2ZPH B;  4X9D A;  2EKH A;  2WSF E;  2E10 A;  5LJ3 f;  3VS3 A;  1ZSZ B;  2OAU A;  1M1K U;  4HCB A;  3L2Z A;  2DVE A;  2P0K A;  5I22 A;  1YFN A;  3TSZ A;  1F1B B;  3TVT A;  3C95 A;  4CRI A;  5KYU A;  2JXB A;  2NWM A;  3JSC A;  3OYB A;  1LVK A;  1KK7 A;  2CP7 A;  2K2M A;  3X24 B;  4OMM A;  2ROL A;  1TU0 B;  2DPP B;  3OYK A;  4KH0 B;  2ESW A;  1VQ5 T;  4JJN K;  1ZSZ A;  2QQR A;  4BE2 A;  3QZ9 B;  1U5S A;  1Y71 A;  4E7L A;  4NL3 A;  1UHF A;  1LJO A;  4VUB A;  2ZPI B;  2XKO C;  3BW1 A;  4J7F A;  3P8H A;  2K3B A;  1BIB A;  2X35 A;  1E7O A;  1VQM A;  1UFF A;  4N4H A;  2CP6 A;  1K8A U;  3CC7 Q;  4M78 C;  2XD0 A;  1N8R R;  4ZTF A;  2RHZ A;  4NS5 A;  3M53 A;  1D0Y A;  3I56 A;  5L23 A;  3H41 A;  2KVQ G;  2MK5 A;  3TEE A;  1AOJ A;  1AVZ C;  3TRE A;  1PCX A;  2JW4 A;  2V8J A;  4IUV A;  1GFD A;  3P8D A;  3G4S Q;  2FRY A;  2YRD A;  1YJ9 Q;  3EG9 B;  2DL8 A;  2IIM A;  2XU8 A;  3CD6 Q;  5IHK A;  3JB9 H;  2E65 A;  4C92 B;  2DA9 A;  2F5K A;  3M4G A;  2QEX A;  5GMK j;  3CC7 T;  2DL7 A;  1WXU A;  4F7U B;  1RAE B;  3VRZ A;  2RK1 A;  2DTI A;  2H8H A;  1JJ2 P;  3RNJ A;  2V1R A;  3EG9 A;  2ED1 A;  4C92 A;  2HDA A;  2R5M A;  3L2R A;  1OX9 A;  1UTI A;  1MNE A;  1PWT A;  2FPE A;  1Q7Y C;  1NEG A;  2VV5 A;  1H64 1;  1RAD B;  5GAM e;  4F7U A;  2CT3 A;  3VS1 A;  3G4S T;  1ZX6 A;  2MF2 A;  4GLK A;  3HRU A;  3CMA Q;  2DD4 A;  1YJ9 T;  3CD6 T;  2OI3 A;  4M77 C;  3DB4 A;  4D8D A;  3ULR B;  1OQK A;  2HD0 A;  3CC2 A;  2LDM A;  3MEU A;  1BKB A;  3LW5 E;  1RI9 A;  1D1B A;  4KGX B;  3G1J A;  5LJ5 d;  3HRT A;  3URG A;  1NLO C;  1TTH B;  5GAN d;  3QJY A;  4PJO F;  3JCM g;  3JV3 A;  1RAB B;  4M7A B;  3CCE T;  3QHS A;  4BI8 B;  2PQW A;  1OI1 A;  3J7A F;  2KQW A;  4ZGD B;  3CMA T;  4XAX B;  3VUB A;  2EGA A;  1ABO A;  1MV3 A;  3M59 A;  2VYT A;  2NUP B;  1C6V X;  1Q81 R;  3A5Z B;  3VYH B;  1NYG A;  4M7A A;  4LUE A;  3OW2 S;  4LDY A;  2E1H A;  2HZY A;  4J6X A;  2DL5 A;  3JCM X;  2BZ8 A;  5CKE A;  3JB9 F;  3CC4 Q;  5J39 A;  3QWX X;  1BU1 A;  4J9I A;  1IO6 A;  4OF1 A;  2EBP A;  3CCL Q;  1VQL A;  1WX6 A;  2JUF A;  4EMK C;  1K9M R;  1RAF B;  3G7Z A;  1VQ4 Q;  4JUV A;  1NJI U;  3QYH B;  4ZGJ B;  1DJ7 B;  3QO3 A;  4WF2 A;  1GXI E;  4FYW B;  3OYH A;  2LCL A;  5LJ5 e;  4M78 F;  3MJX A;  3MP1 A;  5GAN e;  1VQO Q;  2QG9 B;  1BI0 A;  1WZO A;  1J3T A;  4IUR A;  2LX9 A;  1WHL A;  2K57 A;  5GAN 7;  3PT9 A;  1R77 A;  3CC4 T;  1VYU A;  5KYY B;  3VU3 C;  1M2V A;  2O01 E;  4JJD A;  4RTT A;  2M9U A;  3SWN C;  2COY A;  3CCL T;  5GAN 3;  3DLL A;  4J9F A;  4HT9 A;  1B7T A;  4ELY C;  4J83 A;  1NEB A;  3UWN A;  1VQ4 T;  3MP8 A;  1LNX A;  4BY6 B;  1CSK A;  3OQ5 A;  5A0D A;  4FT2 A;  1K9A A;  1VQO T;  4PK4 A;  2KXC A;  3QXE B;  2HL3 A;  4BUG A;  2KXD A;  4HA8 A;  5KYN A;  1FX7 A;  4M75 D;  3OSV A;  1PKS A;  4MZT A;  3JCM W;  1TH7 A;  4C8Q E;  2JM8 A;  5GAN 8;  2HL5 C;  1OOT A;  2D8H A;  2QGF B;  5EG2 A;  1YJN Q;  4LE9 A;  5CKB A;  4M7D D;  3OYE A;  2QI2 A;  1G5V A;  4RG2 A;  3WXM B;  1Z9Q A;  3EFR A;  1Q82 R;  2CH4 W;  4M77 F;  3S3N A; 
#chains in the Genus database with same CATH homology
 4BE0 A;  1W4S A;  2RM4 A;  4FT4 A;  2HQE A;  2QEX T;  2XIC A;  4M78 B;  4C0G A;  3CCM T;  4N4G A;  5FRO A;  1S72 A;  2KMT A;  3OYL A;  2WSC E;  4C92 C;  2YHT A;  2E70 A;  1M4Z A;  3JB9 J;  2FHD A;  4E7H A;  2K3Y A;  3OYG A;  2BIV A;  1M9S A;  3MET A;  4PLL A;  3OW2 A;  4OB2 B;  3LH0 A;  2GCX A;  4A4K A;  3G71 A;  3LWI A;  2DTH A;  3CME A;  2HAX A;  2PVO B;  4XTV A;  1QP3 A;  3X25 B;  4BAC A;  2X4W A;  3GPL A;  3AHU A;  3HRS A;  2RH2 A;  3BFM A;  3OYF A;  2GF7 A;  2KK4 A;  3LGL A;  2MI6 A;  3CEY A;  4OB3 B;  1G3W A;  3M5A A;  4M78 D;  4M78 A;  2R57 A;  4A4F A;  3BDL A;  4EMK A;  5LJ5 f;  1YJN T;  1M1K C;  2QTX A;  3OS2 A;  3V7R A;  5GAN f;  1BYM A;  3RMS A;  5HY6 A;  2CZ0 B;  4XK8 E;  4PKC C;  4EMG A;  3G6E T;  1N8R C;  3MEA A;  1KQ1 A;  2P0P A;  4IUU A;  1YJW T;  1N8R U;  1KHI A;  2DXU A;  5D6W A;  1VQK A;  3MO8 A;  1OZ2 A;  2PU9 B;  3RER A;  4LD6 A;  2EQU A;  5FU7 B;  1W2B S;  3RKW A;  1ZHI A;  5GMK h;  2JZ2 A;  3QSU A;  1N9S A;  3A8G B;  5DM7 R;  1JB0 E;  3JCM b;  3JCM d;  3CC2 T;  1QVF S;  2CS7 A;  2IVW A;  1RL2 A;  3CC7 A;  3UT1 A;  2RI2 A;  2OTL A;  5FU6 C;  4C92 E;  2EKO A;  3S6W A;  5CKD A;  3DLM A;  3FC3 A;  1VQ4 A;  3HPW A;  4QQ6 A;  1VQ6 A;  2X4Y A;  2DXC A;  5KE3 A;  3M55 A;  4PJO E;  3HFO A;  3PGG A;  5GAO p;  3MCA B;  1YHQ A;  1WJS A;  2VGM A;  2XK0 A;  4FSX A;  5LJ3 e;  3RUX A;  4ZTJ A;  5DY9 A;  5CQY A;  3TCJ A;  1M1F A;  2QQB A;  1G3S A;  3MEW A;  4F7U E;  2MWO A;  2YRV A;  2DK3 A;  4M75 E;  4XTZ A;  3QZ5 B;  4CI0 C;  4ME7 A;  1I8F A;  4C8Q C;  5GAN 6;  2C06 A;  4E7J A;  2O4X B;  3NTK A;  4B9W A;  3I55 T;  3X26 B;  4BDZ A;  4J5Y A;  3JCM f;  4M7A C;  5HK0 A;  1HXD A;  4DQ2 A;  4HCC A;  2HQX A;  2LT1 A;  3OYY A;  4JRK A;  4L6V 5;  3NTH A;  4M77 B;  3OYA A;  3G4S A;  3JCM J;  2L5Q A;  4M7D E;  3KBG A;  4PJO C;  3V7C A;  1NPP A;  3C4S A;  3PNW C;  2CGH A;  4J7I A;  4RKU E;  3LWH A;  1YJ9 A;  5I21 A;  2RA2 A;  4LDU A;  4XU1 A;  3CD6 A;  3HHT B;  4KUL A;  2R5A A;  4N0A C;  1WNL A;  4KUD K;  4C8Q F;  2DD5 A;  3O8V A;  1D3B B;  3L2W A;  3CCQ A;  3RKY A;  5CO7 A;  5LL6 S;  4XU2 A;  1BI2 A;  3QG1 A;  4LDX A;  4KBM B;  1WQW A;  2DJZ A;  2M16 A;  3ME9 A;  3OS1 A;  3OBW A;  2EYQ A;  3ZFJ A;  2RJE A;  1U1S A;  2K5F A;  3RMQ A;  5IAY A;  4B9X A;  2QQ9 A;  3TU4 K;  1U8R A;  4M77 D;  4M77 A;  2OTJ A;  3SB2 A;  4A4E A;  4ATO A;  3GF5 A;  1VQL T;  2A7Y A;  3ZEH A;  2RHU A;  4OMF B;  3QDR B;  3QPH A;  1YI2 T;  4NOY A;  3MHX A;  4FIB A;  3CCS T;  4RMO A;  1D3B A;  1UEB A;  2X4J A;  3OB9 A;  3ASK A;  3I56 T;  5GAO q;  5D6X A;  4XTW A;  4E7I A;  3R6O A;  1JBM A;  2YLC A;  5J26 A;  2QA4 T;  4C0D C;  1X01 A;  2EJG A;  2D0Q B;  1Q86 U;  2DZC A;  2RJC A;  2K5L A;  3GNG A;  4EPC A;  4M78 E;  2K5I A;  3M57 A;  3CCR A;  2CZ1 B;  2XDB A;  1YIJ A;  2DO3 A;  1KHC A;  5LJ5 g;  1Y07 A;  3CMA A;  4O5V A;  1VQP T;  4LD9 K;  2LT4 A;  3QUI A;  4M7A E;  2VGN A;  5CQX A;  1QVG S;  1M90 U;  4RCB A;  1OZ3 A;  1UGQ B;  4UC4 A;  4ZN1 A;  3L2V A;  5LJ3 j;  4OGE A;  2MWP A;  2P0Q A;  3OS5 A;  3L2U A;  4OVA A;  3M58 A;  2RI3 A;  5GAN 4;  2G3R A;  2CZ7 B;  2QDY B;  3X20 B;  4DOW A;  2LNV A;  2LQK A;  2ZGW A;  3UDC A;  3OS0 A;  2GFU A;  5KCH A;  5GAM h;  1YIT A;  3NFC A;  4YTL A;  2MAM A;  1NPR A;  3P8B B;  5DLQ E;  4C5E A;  5LJ3 d;  1X75 C;  4ZN3 A;  2RHI A;  1YJW A;  4XTU A;  2L3R A;  3OSS C;  4EMK B;  4KT0 E;  3V8J A;  3HKS A;  3PIP A;  3MP6 A;  2V8K A;  4BI3 A;  2P4T A;  1Q81 C;  4OP0 A;  5IN1 A;  1VQN T;  4QQD A;  3PTA A;  4OB1 B;  3C94 A;  3QBY A;  4Y91 A;  5KE2 A;  5GAO l;  4PL6 A;  4C5G A;  1Q81 U;  5FRN A;  3CCJ T;  2EQK A;  2LRQ A;  3JAM E;  4OGC A;  3L42 A;  3OBY A;  3CBM A;  3MEV A;  3OYD A;  2XI9 A;  1KC8 C;  4M75 C;  4JRQ A;  1VQ8 T;  2E6Z A;  4V2S A;  2XDD A;  2ZPH B;  1UGP B;  2ZPF B;  3BY7 A;  4X9D A;  1KC8 U;  1QP2 A;  2CZ6 B;  2KSS A;  4EDU A;  2WSF E;  2E10 A;  1VQ7 T;  3HSB A;  5LJ3 f;  3RES A;  4C8Q B;  4C92 F;  4JS4 A;  1W2B A;  2OAU A;  3QYG B;  1M1K U;  4HCB A;  2GFA A;  3GIB A;  4BY6 C;  3L2Z A;  2DVE A;  2P0K A;  5GAM g;  2LVM A;  3E1S A;  3C95 A;  4QVZ A;  4CRI A;  5A0G A;  4M7D C;  3OYB A;  3JSC A;  1UGR B;  1QVF A;  1PSF A;  2LQ8 A;  4F7U F;  1WJQ A;  3X24 B;  4BDY A;  1K9M C;  4C8Q G;  4Z02 A;  1K9M U;  2A3L A;  2ZPB B;  3ER0 A;  4A53 A;  3PFS A;  4J8O A;  1XTD A;  3SWN B;  2DPP B;  3OYK A;  3CC4 A;  2ZPG B;  1XOV A;  5GMK e;  4IKF A;  5CIU A;  4PNO A;  2XG8 D;  4BD3 A;  1VIF A;  1VQ5 T;  4JJN K;  4C8Q A;  4C8Q D;  4X34 A;  3CXC S;  5CKH A;  2QQR A;  2K2V A;  1I81 A;  4BE2 A;  1BI1 A;  2RO0 A;  3Q1J A;  3QZ9 B;  4A4G A;  4ELZ C;  5CCA A;  4OB0 B;  3CCL A;  1XNI A;  1Y71 A;  3RKX A;  4C0Z A;  4M77 E;  2CYZ B;  3T9N A;  1R8O B;  4E7L A;  4NL3 A;  4QVD A;  5GAN 5;  4Y28 E;  1LJO A;  4GY5 A;  4VUB A;  2ZPI B;  4FM4 B;  2XKO C;  3BW1 A;  4J7F A;  3P8H A;  2F69 A;  1VQ9 A;  4N0A A;  3SWN A;  1S72 T;  1BIB A;  2FL7 A;  2X35 A;  4IUT A;  2B8A A;  1WPY A;  1VQM A;  2IG0 A;  4PLI A;  5CVI A;  1K8A C;  4N4H A;  4HKE A;  1AHJ B;  1K8A U;  4M78 C;  2XD0 A;  2EFI A;  4ZTF A;  2RHZ A;  5CK9 A;  1VQO A;  1PSE A;  3G71 T;  1V29 B;  4NS5 A;  4QVC A;  3M53 A;  3CME T;  1UB4 A;  2EIF A;  3I56 A;  5GAN 2;  1X6O A;  1JJ2 S;  3KXT A;  1O75 A;  2DXT A;  2PUO B;  1RI0 A;  4XU0 A;  2KVQ G;  4QW2 A;  3JCM Q;  2RK2 A;  3TEE A;  1KQS S;  1K73 C;  1KQ2 A;  3EFS A;  2NLU A;  2ZPE B;  3TRE A;  5C0M A;  1B34 A;  3C12 A;  3RIR A;  3SFM A;  5GMK l;  5LJ5 h;  2DKG A;  3BDU A;  4R55 A;  4JRP A;  2E5Q A;  4XQ3 A;  5GAN h;  4M7A F;  3E9F A;  2JOY A;  1VIE A;  2K4Y A;  4J6Y A;  3SDZ A;  5KH6 A;  2V8J A;  4IUV A;  1O9S A;  3P8D A;  1YCY A;  2X4X A;  3CPF A;  1WJR A;  1VQK T;  2DZ9 A;  3A8H B;  5HK3 A;  2WSE E;  3L2Q A;  3HL8 A;  2XU8 A;  5M9O A;  2E65 A;  3CCU A;  4HT8 A;  4C92 B;  3JB9 H;  3VV0 A;  3PMI A;  1QVG A;  2F5K A;  3M4G A;  2QEX A;  1IZ6 A;  2BUD A;  1OYX A;  5GMK j;  3CCM A;  1YBY A;  5FU7 C;  3CC7 T;  2EAY A;  1M5Q 1;  4C5I A;  2FB7 A;  4JLI A;  5I2M A;  2OTL T;  4RG8 A;  4BB7 A;  2FYK A;  4F7U B;  4MZP A;  1VQN A;  2M0O A;  1UGS B;  4C92 G;  1KD1 C;  2RK1 A;  2DTI A;  1ZBX A;  3PIO A;  1VQ6 T;  1KD1 U;  1YHQ T;  4PJO G;  2DTO A;  5GAO r;  5FLX E;  5DLO A;  3PMT A;  1WGS A;  2EJ9 A;  4RCC A;  2HNI A;  2XDP A;  2E12 A;  1Q82 C;  5GAN g;  3V8K A;  4C92 D;  4C92 A;  1Q82 U;  4KUI A;  1HK9 A;  3VJP A;  4F7U G;  4M75 G;  4M7D B;  2R5M A;  3OMG A;  2H3J A;  2JTM A;  3L2R A;  3OMC A;  1BI3 A;  1YJN A;  2VV5 A;  1P92 A;  4MML A;  1Q7Y C;  1Q7Y U;  3OY9 A;  2KY9 A;  4NL2 A;  3EAE A;  1H64 1;  1U1T A;  4HCZ A;  5GAM e;  5AYF A;  3JCM h;  3QII A;  4M75 A;  3SD4 A;  4F7U A;  3G4S T;  2RHY A;  2XHC A;  3FIF A;  2LC4 A;  2MF2 A;  4GLK A;  3HRU A;  4L5G A;  3G6E A;  4D6W A;  3ZBD A;  3GLX A;  4M7D G;  2DD4 A;  1YJ9 T;  4TVR A;  3WVD B;  3GP8 A;  3GOX A;  2DXB A;  3CD6 T;  4LDW A;  4ZGE B;  3A8M B;  1MGQ A;  2E6N A;  2VXF A;  4M77 C;  5KCO A;  3CCQ T;  2GQV A;  2Y4Y A;  1SSF A;  3DB4 A;  4FU6 A;  4M7D A;  3QKJ A;  3JB9 G;  3A8O B;  3VYG A;  1VQ5 A;  5FU6 B;  3LLR A;  3WVE B;  2HD0 A;  3CC2 A;  2LDM A;  2R58 A;  4XTX A;  3MEU A;  2OTJ T;  3OYC A;  2CKK A;  2KAF A;  1BKB A;  4P5N A;  3LW5 E;  4XTY A;  3CCV T;  1N27 A;  2DAQ A;  4LDV A;  5LJ5 d;  3HRT A;  3HP9 A;  3URG A;  3CPW S;  5GAN d;  3QJY A;  4Q5W A;  4PJO F;  4E7K A;  4MDX A;  3JCM g;  1FWZ A;  2RD1 A;  4M7A B;  4C0F A;  2WAC A;  3OYN A;  2AHJ B;  3CXC A;  5IT9 E;  3CCE T;  4BE1 A;  4E47 A;  1KG1 A;  2ZZD A;  3QHS A;  4BI8 B;  2PQW A;  3M56 A;  1Y96 B;  3NTI A;  4IUQ A;  1OI1 A;  2JVV A;  2RI5 A;  3F70 A;  3I55 A;  2XID A;  4M75 F;  5A2Q E;  3CCR T;  3J7A F;  2KQW A;  4M78 G;  1YIJ T;  4MMK A;  4ZGD B;  3CMA T;  2MMP A;  4XAX B;  3VUB A;  4DA4 A;  3M4Y A;  3J80 E;  4M7A G;  1G3T A;  2QQS A;  3M59 A;  2VYT A;  4C5H A;  4QQG A;  2D6F A;  2BKD N;  4MZM A;  3A5Z B;  4M7D F;  4R56 A;  3VYH B;  1M1G A;  1WQ7 A;  4M7A A;  4M7A D;  3N5B B;  3OW2 S;  4LDY A;  2E1H A;  5GMK m;  1YIT T;  1Y96 A;  4J6X A;  4O6J A;  3JCM X;  1XQH A;  4JDS A;  1VUB A;  3DKM A;  5CKE A;  3X28 B;  3JB9 F;  1JJ2 A;  1M8V A;  5GAM j;  5I2S A;  5J39 A;  5CKF A;  2M1H A;  1IRE B;  2VC8 A;  1I5L A;  2HBP A;  5C6S A;  2LTO A;  4N4I A;  3OYJ A;  3M9Q A;  4JLG A;  1KQS A;  4J6W A;  1B34 B;  2EWN A;  3JRZ A;  4OF1 A;  1VQL A;  4C0D B;  2PVG B;  3LGF A;  2JUF A;  4EMK C;  1YI2 A;  2E64 A;  3CCS A;  5GAM d;  3G7Z A;  2RB6 A;  3FB9 A;  2DIQ A;  4JUV A;  3HFN A;  1NJI C;  2QA4 A;  1NE8 A;  1NJI U;  2Y4X A;  3QYH B;  4ZGJ B;  5CAI A;  1DJ7 B;  1FXX A;  5GMK i;  2FVU A;  3QO3 A;  3S3M A;  4WF2 A;  2PVD B;  3JCM c;  2KDS A;  1GXI E;  3KUF A;  3J81 E;  1K73 U;  4II1 A;  5LJ3 h;  3VKI A;  2LCL A;  5LJ5 e;  4M78 F;  3OYH A;  3DB3 A;  1VQP A;  3MP1 A;  5GAN e;  1BI0 A;  1NZ9 A;  3H6Z A;  2K3X A;  2JN0 A;  4X9C A;  4IUR A;  2PUK B;  3INZ A;  2LX9 A;  2EQJ A;  2K57 A;  5GAN 7;  5GAM f;  2RHX A;  3PT9 A;  3FEO A;  2L8D A;  2QQA A;  2LCC A;  4EMH A;  4DOV A;  3CC4 T;  2ZCF B;  3VU3 C;  2O01 E;  3FLG A;  3FRN A;  2QXF A;  1EIF A;  4PJO B;  3OA6 A;  2M9U A;  3QJ6 A;  3SWN C;  3CCL T;  5GAN 3;  2I2L A;  3DLL A;  4M77 G;  3JB9 I;  4HT9 A;  5A0L A;  2O4X A;  4M75 B;  2Y90 A;  4J83 A;  3UWN A;  5J3B A;  4ELY C;  5GAO m;  1VQ4 T;  4A4H A;  3M54 A;  2L89 A;  4MDW A;  4A54 A;  3CBP A;  3CCJ A;  5LJ3 g;  4JS5 A;  2VXE A;  1VQ9 T;  3MP8 A;  1JRI A;  1LNX A;  1QVP A;  3FDR A;  3LX7 A;  1VQM T;  4BY6 B;  3V8L A;  2JTF A;  4FL6 A;  1VQ8 A;  2F5T X;  3OQ5 A;  2RJD A;  3CCV A;  5L8R E;  3S3O A;  3CBO A;  5A0D A;  1VQ7 A;  4FT2 A;  4PJO A;  3E19 A;  4PJO D;  3FJP A;  2VUB A;  1VQO T;  3L1A A;  3QXE B;  5FRM A;  4BUG A;  2DEQ A;  1I4K 1;  2JNG A;  2YLB A;  1Y7X A;  3JCM e;  4HA8 A;  3OYI A;  2EQM A;  1FX7 A;  3LYI A;  4M75 D;  3CCE A;  1Q86 C;  3OSV A;  5GAO n;  4MZT A;  2RJF A;  1TH7 A;  4C8Q E;  5HKC A;  4IUP A;  3JCM W;  4XU3 A;  5GAN 8;  1N6A A;  4JRI A;  5D6Y A;  2E41 A;  3UPU A;  1ZQ1 A;  4BI4 A;  1M90 C;  3JCM P;  5EG2 A;  3OYM A;  3CPW A;  1G3Y A;  5CKB A;  4M7D D;  1LOJ A;  1MHN A;  2V8I A;  1QW1 A;  5LJ5 j;  2QI2 A;  3GNF B;  5CR2 A;  3OYE A;  2DIG A;  1H3Z A;  1N9R A;  1G5V A;  3VUZ A;  4RG2 A;  5GAN j;  3V7S A;  3WXM B;  2D9T A;  3A8L B;  3E9G A;  3EFR A;  4L59 A;  3H8Z A;  3JB9 D;  1BIA A;  3JCM V;  3CCU T;  4M77 F;  3S3N A;  2EJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...