5KE3A

Crystal structure of setdb1 tudor domain in complex with fragment mrt0181a
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
210
structure length
207
Chain Sequence
ENLYFQGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKSLLSGNHIAYDYHPPADKLYVGSRVVAKYKQVWLYAGIVAETPNVKNKLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLLKSGQLIKTEWEGTWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase SETDB1
publication title Crystal structure of SETDB1 Tudor domain in complex with fragment MRT0181a
rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 58
structure length 207
sequence length 210
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18358 Tudor_4 Histone methyltransferase Tudor domain
A PF18359 TUDOR_5 Histone methyltransferase Tudor domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ke3A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ke3A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5ke3A03
4C5EA 2G3RA 5FRMA 4N4HA 1RI0A 4QW2A 3PMIA 2EQKA 3QIIA 3CEYA 3MP6A 4L59A 3M9QA 4IUQA 1OI1A 2FHDA 2XDPA 3S3OA 3FEOA 2MWPA 4A4FA 3FC3A 4N4IA 1XNIA 3LX7A 3OYMA 2RHIA 3F70A 3OYAA 2X4XA 3OQ5A 2VYTA 4OVAA 4Z02A 4Q5WA 2EQUA 4FL6A 2K3YA 5D6XA 4EDUA 3QJ6A 2P0KA 2GFUA 2BUDA 2BKDN 2R5AA 4N4GA 4NS5A 4A4GA 1WJQA 3H8ZA 3MEAA 2IG0A 1WGSA 3FDRA 3OB9A 2K3XA 3S3MA 2X4YA 1H3ZA 2LCCA 4LD6A 4PL6A 4BD3A 2LRQA 2X35A 4C5GA 2YRVA 5KE2A 4II1A 1MHNA 4BDZA 3GOXA 3FLGA 5J26A 2D9TA 2R57A 3P8DA 3E9GA 2QQSA 4IUVA 4QQDA 5C6SA 2RHXA 5IAYA 4C5IA 3MO8A 2O4XB 4QQ6A 3SD4A 1OYXA 3S3NA 2RHUA 3PFSA 5CIUA 1OZ3A 4PLIA 2L3RA 3MEVA 3NTHA 5KH6A 2MWOA 2B8AA 3OYJA 4BACA 1WJSA 2CKKA 3LH0A 3ZEHA 2L8DA 2EQMA 2LVMA 2X4WA 3OS1A 5C0MA 4E7KA 3QBYA 3OS0A 4GY5A 3LLRA 3NTIA 3OYCA 3OYLA 4IUTA 2BIVA 2JTFA 2RJEA 4UC4A 4A4EA 2L89A 3DLMA 4QQGA 2HQXA 2RI3A 3EAEA 5IN1A 3O8VA 2M1HA 2RJCA 3C4SA 3DB4A 4B9WA 2DIQA 3ASKA 2PQWA 2XK0A 2EKOA 3UT1A 2WACA 2F5KA 3MP1A 4BE0A 3OYHA 2GF7A 3L2WA 4IUPA 3OYDA 1G5VA 2E5QA 3UWNA 5KCHA 4QVZA 3OMCA 3OYFA 3NTKA 4HCZA 2DIGA 2LDMA 5FROA 3OYEA 3S6WA 2EFIA 4BE2A 4BE1A 4E7IA 5J39A 3H6ZA 3ME9A 3OYGA 2R58A 3LYIA 2M0OA 1WJRA 2LTOA 3PMTA 5M9OA 4E7LA 2JZ2A 4B9XA 2RO0A 3BDLA 4CRIA 2RHZA 3MEUA 4X34A 3OA6A 4IKFA 3OY9A 4ZTJA 4PLLA 2R5MA 5KCOA 2O4XA 4RG2A 5FRNA 3OYIA 1KHCA 2RJFA 5D6WA 3P8HA 4IUUA 4A4HA 3OYBA 2EQJA 2RHYA 2RI5A 3LGLA 2M16A 3LGFA 3QKJA 4ZTFA 2QQRA 2NLUA 3PNWC 3MEWA 4E7JA 3L2UA 3OS2A 3META 3E9FA 3Q1JA 3L2VA 2DAQA 3OYNA 1OZ2A 3L42A 3OMGA 4IURA 5D6YA 3MP8A 4C5HA 4BDYA 2RI2A 3L2QA 4E7HA 1SSFA 3OYKA 2GFAA 4FU6A 3L2RA 1N27A 3DB3A 2E6NA 3KUFA 5KE3A 2RJDA 2HQEA
chains in the Genus database with same CATH superfamily
2RF0A 3GBQA 5AT1B 1OI1A 2FHDA 3E2UA 3FEOA 3UF4A 1BBZA 1VQNQ 3OYAA 1K9MR 1M3BA 5IT9E 1ABOA 5HKCA 2RQUA 2EJFA 2HBWA 1YI2T 3OB9A 1RAAB 2LCCA 1PNJA 2X35A 1S72T 3JCMP 3GNGA 4OMPA 5LL6S 5C6SA 2VWFA 3VS2A 1BYMA 2O4XB 1G3WA 1UTIA 5I21A 1OX9A 3A8LB 5L23A 2QASA 2D6FA 3J80E 3OBYA 3QWYA 1VQ8T 4J7IA 3LLRA 3I56A 2QDYB 2RJEA 3EAEA 1MNEA 2FRWA 4TVRA 1C0MA 1G83A 2ZPEB 4A63B 1VIFA 2KDSA 4OMFB 2EJGA 2YXYA 3WVDB 5A0GA 1E6GA 2ENMA 2HNIA 5J39A 3LYIA 5IHKA 3GPLA 2LZ6B 3LH5A 2IVWA 2DTOA 5GAMd 4J7FA 2EYYA 2OAUA 2FPFA 2NUTA 2D1XA 4M77A 5D6WA 3CCMQ 1VQ9A 2Z0WA 3DLLA 2DILA 3X25B 4ZN3A 3JB9J 2NLUA 2EWNA 2L5QA 2E41A 3R6NA 3VUBA 2AK5A 2QEXA 4KUIA 1VQ6A 3DKMA 1YHQT 3OMGA 3U23A 1YIJA 2RI2A 3NPFA 4AG1C 4J6XA 5GAOn 3EHQA 3OYKA 2D8HA 4C8QG 5FU7C 3L1AA 1D0XA 3JCMf 2KE9A 1U1SA 4JRQA 5FWCA 2COWA 4KULA 4DA4A 2K5LA 1QVFS 2CT3A 3ULRB 3CPFA 1K9AA 2EYWA 4OGEA 4JJNK 1AVZC 2EQUA 2FZKB 2EYXA 4LUEA 2GFUA 2QDLA 4X9DA 1PKTA 1VQLT 3HFOA 4NS5A 1QKXA 2IG0A 1WGSA 2ATCB 2YLCA 2DERA 3S3MA 3CC7A 4LD6A 4GLKA 5GAN3 4F7UE 1YITT 3FLGA 1PWTA 1WA7A 1UGRB 1WHLA 1B07A 3OBWA 2V26A 1EZZB 1WHKA 1U5SA 2COZA 3QG1A 4RCCA 3JCMX 1NPRA 4ZNXA 5KH6A 2ECZA 3M0UA 2B8AA 1O75A 2CP6A 1WJSA 1X43A 3LH0A 2ZPHB 5GAOl 1AZGB 2D0QB 3EFRA 2CP3A 4J9GA 1N5ZA 3OYCA 4VUBA 2C0OA 2V8KA 2YUQA 4F7UF 2ESWA 2F5KA 4DBHA 4LN2A 3RKYA 1X69A 3BY7A 3V8KA 1VQ7T 1BU1A 4JZ3A 2D0NA 1WXUA 1ZLMA 4J83A 4M75C 2YHTA 3QZ5B 5GJWB 4F14A 3G4ST 4HVWA 2KY9A 3OY9A 1M1GA 2O4XA 1UJ0A 1KHCA 1QW1A 2RJFA 4A4HA 4IUUA 3I55A 4ORZA 3CCET 2XG8D 4WF2A 4QVDA 2KR3A 3CCRA 3JCMV 2JUFA 3PE0A 4BY6B 4C5HA 1VQ4A 2SRCA 1SSFA 4C92A 3CCQA 1UJYA 2YSQA 3DB3A 2BE9B 3JB9D 1PCXA 3CPWS 1JQQA 2BE7D 2DFUA 4N4HA 2DTHA 4QW2A 3QIIA 5FU7B 4Z89A 2DXUA 1IXDA 1BI2A 1VYUA 2FVUA 1ZSZC 4A4FA 3G71T 1I0CA 4E6RA 1EX4A 1CKBA 2E5KA 3CCJT 2WSEE 1HXDA 1LJOA 4P5NA 2K3YA 5D7UA 2DX1A 1QVGS 4PFOA 4AT1B 1OU9A 4A4GA 2I0NA 2CSQA 3HSBA 4C5GA 4II1A 4M77G 1ZX6A 5GAN4 2DJZA 1I1JA 4C8QC 4IUVA 5I11A 2DYIA 2H8HA 2X3XD 1X2KA 4QQ6A 3M56A 1D3BB 2KYBA 1ARKA 3EG9B 2FZGB 1JU5C 4XU0A 4C0GA 4FT2A 2QA4Q 5LJ3h 7AT1B 2EGCA 5CQYA 3NTIA 3PVLA 2RB6A 1JO8A 1G3SA 3A8HB 5GANh 3UT1A 2RH2A 2GF7A 4IUPA 2OTLQ 2E5QA 3CCVT 3M55A 5CR2A 2EFIA 1TWBA 3H6ZA 4FT4A 2OAWA 1GBQA 3VS6A 2ROTA 2ROLA 2A36A 1D09B 4M75B 4EMHA 4HVVA 2GQIA 4C92F 2DJQA 4XU2A 1YI2A 3JAME 3H9NA 1P92A 1X6BA 4DEYA 2DZ9A 5GMKl 3R6OA 2DL3A 3OS2A 3WVEB 4Y92A 2HD0A 1BI3A 1YJ9Q 1YJWA 3X26B 3CEYA 3VYGA 4M75D 1VQ8A 1T3SA 1KQ2A 2X4XA 1OEBA 2JOYA 1ZSZB 3QJYA 3BW1A 3JV3A 1LOJA 4EDUA 5GMKi 5GMKe 3I56T 4EIKA 1Q82U 4K11A 2BKDN 2F2XA 3RR6A 1VQ5T 2HL3A 3GLXA 1GXIE 2EGEA 1I81A 4C5IA 4C8QB 3HPWA 4FIBA 2RHUA 4NL2A 3PFSA 1YJNQ 3MEVA 2AKKA 1K76A 1M1KU 2CH4A 3CC2Q 3VRYA 1Q82C 5GAMg 2HQXA 2F1LA 2M1HA 2O9VA 5LJ5h 3ASKA 1KQ1A 2QEXT 4M77C 4XU1A 2KBTA 3OYDA 3J81E 3CCLQ 1VQ6T 1YIJT 1CKAA 4C8QD 2D8JA 1G3TA 1Z9ZA 1VIEA 3PMTA 1D1AA 2MMPA 4B9XA 1KFZA 3BDLA 2CSIA 1UB4A 3EFOA 4ZTJA 1K0XA 5GAOq 2HBPA 1M1KC 2XKOC 4DBRA 1D3BA 1VQLA 4DOVA 1S1NA 1AHJB 3EG9A 2RHYA 1QLYA 1Z9QA 2DD5A 3M0QA 1YITA 4F04B 2ZPGB 2DAQA 3CC7T 3M0RA 1GFCA 3VS3A 4RMOA 2DBKA 5LJ3j 4RTUA 2MI6A 3P8BB 4RTWA 1VQ9Q 3CBMA 4XTXA 1WPYA 4C5EA 2K2MA 3OSSC 1RI0A 2HCKA 2I2LA 4IUQA 5GANj 1WQ7A 4FSSA 4OMNA 3FC3A 3PGGA 1WI7A 1QCFA 1I8FA 2M9UA 5D6XA 4LDVA 3EG3A 1YBYA 2HDAA 3INZA 2BZYA 3OSVA 2OX7A 2VV5A 1OPKA 1VQMA 1MMAA 3IQLA 3ZFJA 1TTHB 1J3TA 5A0DA 1VQPA 3EGUA 2DL4A 2LCLA 3G4SA 4FYWB 2YRCA 2CT4A 2QYZA 4JRKA 1I07A 1RAHB 4FW1A 3CCEA 2LX9A 3ZEHA 1IHWA 2XU8A 2DA9A 2EQMA 2QGFB 1M90R 4E7KA 3I55T 3LWIA 2MYSA 3CCRT 2ZAEA 3SEMA 1PD1A 1ZSZA 4KUDK 2WACA 3JCMJ 3MKDA 4A4KA 2HSEB 3AHUA 5KCHA 4NL3A 4M77B 2CREA 3CCUA 3CMEQ 4BE2A 3G71A 2B86A 2R58A 5GAMh 1G2BA 4FYVB 1K8AC 3FIFA 4RTXA 2NYSA 2J7IA 4IKFA 4M75E 2K5IA 4C92C 4PLLA 2R5MA 3JCMh 3I5RA 1BB9A 2DXCA 3NMZC 2DRMA 4BI8B 1ZHIA 1W6XA 4FM4B 3META 1M9SA 2DXTA 4N0AC 5D6YA 4HT8A 1RAIB 1BI1A 1JRIA 4WTOB 4M77D 3L2QA 2NUPA 3RNJA 3MHXA 3CCST 2LX7A 1KK7A 2RQVA 4L59A 2CDTA 4M7AA 2V1RA 4ANJA 4M7DG 2CP0A 3G7ZA 4X1VA 4R56A 1RLPC 2JJ9A 1T0JA 2QQ9A 1VQ4Q 3M57A 3CCQQ 4XTWA 4ELZC 5I2MA 3CCVA 1KJWA 5CCAA 1E7OA 2JMCA 2XHCA 3QXEB 1Q7YU 5AYFA 2EPDA 5GAN8 1EIFA 1I4K1 4OMLA 2KI7A 2E65A 2YUOA 2L3PA 1WZOA 1RADB 2W0ZA 5FWBA 4C8QE 3CMAT 4PJOG 5CIUA 2MWOA 2CZ1B 2O9SA 4J9IA 1SHFA 5HY6A 5FW9A 2KRSA 2DZCA 2DNUA 2BIVA 2K2VA 3DLMA 4QQGA 3DB4A 3EGXB 1Q7YC 1X75C 1FXXA 2KROA 3OYHA 1D1BA 4C8QF 1M5Q1 4HCKA 3OYFA 1OQKA 2AZSA 1WHGA 5ECAA 1YJWT 2IIMA 1Q86U 1MMNA 1V29B 1NLOC 5GAN6 3ZL7C 3G6EA 1YP5A 1KQSS 2CH4W 2LQKA 5IHIA 1FWZA 5FRNA 3P8HA 2KT1A 4C92B 4PK4A 2PVOB 1IREB 3RIRA 1VQ5A 2YT6A 4E7JA 2MPXC 2QTXA 1JJ2S 3OYNA 2DM1A 1OZ2A 2LJ3A 1NEGA 5FLXE 4DOWA 1ZUYA 1PC0A 2Y4XA 3TEEA 1YI2Q 1Q86C 2G3RA 2ZCFB 1SPKA 3PMIA 2KXDA 1S72Q 5CAIA 1H641 1KC8U 4KBMB 5GAN5 4RTTA 3LX7A 4NOYA 1JB0E 3F70A 3OW2S 2OTJT 1MMGA 4C92D 4BY6C 5GAMf 2M02A 4RKUE 5GAMj 1WJQA 5CKBA 1W2BP 4J9FA 1QMCA 3D7SB 2L3SA 3E9GA 4QQDA 2RHXA 1IHVA 2JS2A 1UGPB 1IB8A 3SD4A 2HKQB 2JVVA 3KBGA 3REBB 1WX6A 1KC8C 1KIKA 1RUWA 3OS5A 5CKHA 1PG5B 4M7DC 1KG1A 1TSFA 4V2SA 2GNCA 2L8DA 1Y0MA 3V7RA 3JCMc 2X4JA 2JTFA 2G6FX 1WQWA 3RBBB 1OX8A 1TU0B 3O8VA 3RERA 3C4SA 2E64A 4M7AG 2FO0A 5CKEA 1QCNA 2QI2A 3H41A 3GIBA 2LC4A 1MUZA 1G5VA 1OU8A 1YWOA 1GCQC 1Y7XA 4M77E 3M0PA 2GTOA 3S6WA 1C6VX 1WJRA 2QGGA 1KQSP 4CRIA 1YHQQ 1HJDA 1XTDA 2GCXA 2K6DA 4RG2A 1QVPA 1M3CA 1NPPA 3VS4A 2RNAA 1QCOA 4ZGEB 1X6OA 2M16A 4OGCA 1ZSGA 1VQMT 2JTEA 4M77F 1R77A 1PD0A 1VQOA 4CC4B 4BUGA 3L42A 1VQPT 4E7HA 2LQWA 4OMOA 3EGXA 1WLPB 1VQLQ 4QKUA 8ATCB 2PTKA 1XQHA 4KH0B 2VXFA 2WSFE 2XDPA 2KQWA 3ER0A 2RM4A 3OW2P 3TSWA 4N4IA 1AWJA 3OYMA 2AZVA 2CP2A 2LT4A 2KMTA 2A0FB 2HZYA 2P0KA 1MNDA 5CQXA 4JS4A 4FSXA 3EFSA 1M8MA 3A8GB 4AFZC 1QVFP 3CCUT 3C95A 3E19A 4DEXA 1ZA2B 2DMOA 4XU3A 1MGQA 1X27A 1OZ3A 5GJVB 4N0AA 2KEAA 4BACA 4JLGA 2MAMA 2M0YA 3CC4A 1K4US 4AFUC 4J6WA 1VQ7Q 2H3JA 2RQWA 5LJ3e 3OS1A 3J7AF 4C0ZA 4YTLA 3TVTA 4M7DB 2Y90A 1M8VA 4IUTA 4UC4A 4A4EA 1LVKA 5KYYB 4PJNA 1W2BA 3RKWA 5GANe 2AT1B 1HYOA 2XK0A 2EKOA 3CCSA 3L2WA 3QDFA 3EFOB 2QAZA 4HCZA 2ABLA 4JJBA 2LDMA 4F7UG 4E7IA 1QWFA 1KD1U 4XTZA 2RO0A 3MEUA 4PJOB 4ESRA 2HKNA 2HSPA 1FMVA 4M7DD 3M54A 4C92E 4QVCA 1W70A 2JS0A 2ZGWA 4B6MA 1TG0A 3JSCA 1RABB 4M7AC 2MCNA 3G71Q 4HT9A 2JT4A 2LP5A 3CCJQ 4ZGJB 4O5VA 1WXBA 2AKLA 4FU6A 3CMAA 1QWEA 2E4HA 2LJ1A 1KD1C 3O5ZA 4FW2A 4AG2C 4ZGDB 3QO3A 3FJ5A 4HXJA 4PJOD 2RK2A 1RAGB 1MV0B 3CXCS 1KSWA 2YUNA 2RHIA 4EMKB 2LJ0A 2GQVA 1PRLC 2F2VA 2NUZA 3CPWP 4BD3A 5KYUA 4JPBW 1K73U 5KE2A 3NHNA 4AFSC 4RUGA 2V1QA 2QQSA 1BK2A 1YN8A 3MO8A 3C94A 2DKGA 5DY9A 2RMOA 3OW2A 1HSQA 3HKSA 1Q82R 3G6ET 1BKBA 3I9QA 3CCVQ 1QVGP 1IZ6A 1VQKT 3QPHA 3VKIA 1LPLA 2A3LA 1R0BG 3V8LA 2FB7A 1B3QA 2RI3A 3CCLT 2RJCA 5LJ5e 2W10A 2A28A 2VGMA 1K73C 2KAFA 1H3HA 2V8JA 1QVFA 3M59A 3UA7A 2PUOB 4E2FB 1Y07A 2PZ1A 5DLQE 1M1KR 1Q81U 1UGSB 4EMGA 5I22A 1NLPC 3VV0A 3M0TA 2OTJA 4M78A 2FRYA 1N9SA 2KK4A 3OYIA 5KYNA 2NUPB 5A2QE 2EQJA 2MK5A 1GFDA 3CD6T 2O2OA 3UDCA 1C1AA 3L2UA 1BCMA 3HRUA 4M7DA 2E3HA 2X51A 4M7AB 4BDYA 5KYYA 3I56Q 1Q81C 4F16A 2RN8A 4JUVA 2VKNA 1B7TA 4R0KA 4RTYA 2DYBA 3M9QA 1VQ5Q 2H3EB 4JS5A 4BI4A 4M4ZA 1PM3A 2MWPA 3VYHB 1NE8A 1GCQA 2DK3A 4HKEA 4LE9A 2RK1A 3JCMW 1JXMA 4FL6A 1NBEB 4PJOA 2CZ7B 4OF1A 4KRTA 2R5AA 3REAB 4M7AD 3VS7A 5LJ3d 1ZUKA 1O9SA 1SRMA 4RCBA 2DL7A 2EVRA 1BIAA 5J26A 2D9TA 2DVJA 3P8DA 2Y4YA 2PU9B 2DEQA 2LCSA 3AT1B 2V8IA 5GANd 2QEXQ 3X24B 2LQ8A 1VQ6Q 4PLIA 4DQ2A 4HCBA 1YIJQ 1FMKA 4IIOA 1IGQA 1NYFA 1QKWA 1AZEA 4E7ZA 4M7DE 1AWOA 3QYGB 4CC3A 2FL7A 4LDWA 3ZBDA 3CPWA 2OI3A 4EMKA 2YDLA 1FMWA 2DIQA 2YWWA 2PQWA 1WNLA 4OMQA 4BE0A 1VQOT 1RAFB 1WHHA 2EKHA 1K8AR 4QT7A 3M4GA 4QVZA 2J06A 3H0HA 2MF2A 3EH2A 1F1BB 3TSZA 3CC7Q 5IXBA 1TUCA 1QVGA 4E7LA 4M7DF 1TXQA 1SF9A 2RHZA 4HVUA 3JRZA 2VB6A 4RTVA 4HCCA 3JCMe 1UUEA 3HRTA 3LGFA 4LDUA 1JBMA 2RQTA 3QYHB 3QDRB 1RAEB 3RDVA 4XTVA 1LNXA 2DL5A 2K4YA 4XTUA 5J3BA 5I2SA 3SDZA 3H0FA 2VXEA 2QA4A 4PJOF 1N8RU 4J9DA 2J6KA 1QQJA 2KT8A 3JCMQ 1A0NB 3MP6A 2K7AA 3JB9G 3QWXX 2E3IA 2K3BA 6AT1B 3CC4T 3SWNB 1OULA 3LWHA 2OTLA 1WDXA 2QK0A 4OB0B 4N4GA 4M78G 2A37A 2K3XA 2X4YA 1N9RA 1RL2A 2VASA 1DJ7B 3I55Q 3PIOA 4XAXB 1VA7A 2FEIA 2GTJA 2R57A 1VQNT 3CCRQ 1N8RC 2KVQG 5LJ5d 2ED0A 4J9BA 1OYXA 2JM8A 1JEGA 1ZA1B 3LW5E 2L3RA 2RA2A 1NJIU 5GMKj 1WIEA 4HA8A 4IIMA 2CKKA 5EC7A 1Q7YR 2PVGB 2RD1A 3OYLA 1YJ9A 3EGDB 1X6GA 1MV3A 5IN1A 4OB3B 3MP1A 2XMFA 4O6JA 3HL8A 2K57A 1SRLA 4KH1B 4KGXB 1OOTA 2EYQA 3NTKA 2K79A 2KSSA 5FROA 1WXTA 1G3YA 1NJIC 2P84A 4MDXA 1GL5A 1UG1A 1PRMC 1VOMA 3CCSQ 1UGQB 4DBQA 1WFWA 4ATOA 3EHRA 2QXFA 1W1FA 3M4YA 1AWWA 1G8XA 2K9GA 3Q1JA 1Q86R 1UDLA 1K9MU 1E6HA 2XDDA 1SHGA 4M7AE 1ACMB 1YJNA 4OB1B 2P0QA 5L8RE 1T3LA 3L2RA 2E6NA 3CCMT 3CC2A 1YFNA 4A53A 4KT0E 1VQKA 2ZPBB 1UFFA 3TCJA 1I5OB 5KYWB 2L3QA 2P0PA 3QSUA 2VGNA 5FU6B 4GLMA 5GAOm 4M75G 3CCLA 4OVAA 2QQAA 4Z8AA 3V7SA 4M7AF 3CMAQ 1IRXA 3MEAA 2M51A 3VS5A 2P4TA 1K9MC 3RMSA 1M2VB 4FYYB 2HMAA 1U8RA 1MHNA 2ZZDA 1KC8R 5DLOA 1D0ZA 3SFMA 1M30A 2GBQA 1D1CA 3VJPA 1CSKA 3CBPA 1IGUA 3TU4K 2XI9A 1SKUB 3S3NA 4J9EA 2KGTA 2DL8A 4AMCA 3NTHA 2KRNA 4Y91A 3A1PA 4F7UA 4OMMA 1R0CB 1D0YA 2LMJA 3GF5A 3CD6A 1YJWQ 1WYXA 1V76A 3OS0A 3RUXA 4XK8E 4M78C 1M4ZA 1M1FA 1VQ8Q 3SWNA 2XD0A 4C0FA 2CZ0B 3G1JA 5GAN2 3UPUA 1YCYA 1NM7A 2J6FA 3JCMd 4JRIA 4C0DB 3BE3A 2OJ2A 2RPNA 2KXCA 1SEMA 4D8KA 2MOXA 1WHJA 2AIRB 3A8OB 4X34A 3M0SA 3M53A 3MCAB 9ATCB 1T0HA 4J5YA 4J8OA 1X01A 2DTIA 2RI5A 1H92A 1UE9A 1EFNA 2FPEA 3PNWC 1FX7A 1N6AA 1UECA 2X9HA 2F5TX 1UEBA 5CVIA 5IXFA 2OTJQ 4LXCA 3EGDA 5HK0A 4L5GA 4PJOC 1OPLA 4PFPA 2GFAA 5HK3A 2HQEA 3M5AA 5LJ3g 1AEYA 5FRMA 1GCPA 2FPDA 1BCOA 3NFCA 5KYUB 3VU3C 2E6ZA 2YUPA 2LT1A 2HAXA 5GANg 4D8DA 2VYTA 1JJ2P 3EG0A 5EG2A 4Q5WA 3VRZA 2DPPB 2DF6A 3VS1A 2BUDA 2DLPA 5A0LA 3CMEA 4ELYC 2DD4A 3H8ZA 5IH2A 2K5FA 1W4SA 2VVKA 4CI0C 3PIPA 2F69A 4EMKC 2JW4A 3TREA 1U1TA 1YITQ 1ABQA 4WCIA 1R8OB 4EPCA 1VUBA 1NEBA 2DBMA 4MZTA 2E70A 2LVMA 3HTRA 4JLIA 2L89A 5KYWA 2EQIA 1Y71A 3T9NA 5GMKm 4M78B 2ED1A 3KXTA 1AWXA 2DEUA 2FG0A 2EAYA 4CC7A 1KHIA 2DE0X 4MMKA 2QA4T 1M2VA 1VQMQ 2JTMA 3QHSA 1AOJA 4LDXA 3OA6A 1VQPQ 4E47A 3G4SQ 2OTLT 2HEQA 1ZUUA 3LGLA 3PTAA 2QQRA 3MEWA 2C0TA 4M78D 1TS9A 2A08A 3CCEQ 1GRIA 1KD1R 1VQNA 1YNZA 3PT9A 2YLBA 2EW3A 2PUKB 3URGA 2L2PA 2CP5A 3C0CA 2DXBA 2ZPIB 4JJDA 2PVDB 2EQKA 4D6WA 2VC8A 4PJMA 3X28B 2DO3A 3S3OA 4MMLA 2EIFA 1BI0A 5LJ5g 3CCUQ 2JM9A 2FYKA 3OQ5A 1U3OA 3A5ZB 3QJ6A 1YJ9T 1XOVA 1M3AA 2XICA 2P4RA 3V8JA 4FCYA 4KGZB 1NZ9A 1KQSA 4BDZA 1HK9A 3JCMb 2EGAA 2C0IA 3HRSA 3UA6A 1NYGA 2JMAA 2JXBA 2E10A 4MZMA 3RESA 1JJ2A 2C06A 1B34B 3A98A 2O31A 2X4WA 1K73R 2WSCE 4OP0A 4L6V5 4B9WA 1QP2A 1PSFA 1UHCA 2EJ9A 1S72A 1YJNT 3CCMA 4Y28E 1ZBJA 2BZ8A 3OMCA 2DIGA 3FB9A 4GBQA 3CC2T 3OYGA 2CS7A 2M0OA 4LNPA 5GAOr 2LTOA 2PNIA 2XIDA 3H0IA 3JB9I 2EYZA 3EG1A 2X3WD 3QKJA 2NWMA 4BB7A 4JZ4A 1Q81R 4ME7A 1M27C 5CK9A 3L2VA 1I5LA 4IURA 3MP8A 3SB2A 1FYNA 4RG8A 4JJCA 5KE3A 2RJDA 3UATA 1H8KA 3BFMA 3HP9A 1RI9A 1U06A 4JDSA 1AT1B 2CUDA 4KGVB 1WHMA 5GMKh 1Q95G 4C92G 1TUGB 2COYA 4PJLA 5KYXB 3G6EQ 4OB2B 3RKXA 1VQ9T 1Y96B 2LNHB 1VQKQ 1TH7A 5DM7R 1YHQA 2YRVA 2CGHA 3GOXA 3JB9H 2VUBA 4PFZA 1X2QA 3GNFB 3CXCP 3N5BB 3SWNC 3L2ZA 4X9CA 1NG2A 5IAYA 2HQHA 2KYMA 4CC2A 1M2OA 4MZPA 3JCMg 2GGRA 1K1ZA 4XTYA 3QUIA 2CUBA 3NGPA 4LDYA 3HFNA 5CKFA 2O01E 1TUDA 4GY5A 1GBRA 1UGVA 1Y57A 2KNBB 2RQRA 3THKA 4MDWA 2DETA 4M78E 3CBOA 1UHFA 4E7SA 3CD6Q 3OYEA 2LQNA 2E1HA 4BE1A 5LJ3f 3JB9F 2FZCB 3ME9A 1RACB 3TQ7P 5HCKA 5GANf 1YWPA 3EH1A 1RLQC 3BDUA 4M78F 2HL5C 3M58A 4ZTFA 4AFQC 1B34A 2J05A 3CMET 1YCSB 3CQTA 2EBPA 1PSEA 2E12A 4M75A 3HHTB 5GAMe 1SSHA 1BIBA 3RMQA 1QP3A 2MIOA 2L0AA 1VQ7A 3KFVA 3QZ9B 2XDBA 4PJOE 2QQBA 4A54A 1JXOA 4LUDA 1AD5A 2ZPFB 1V1CA 4ZN1A 3A8MB 1XNIA 2DRKA 1IO6A 4Z02A 1K8AU 1PHTA 4PNOA 4PJJA 4BI3A 4Z88A 3E1SA 3FDRA 1N8RR 1H3ZA 1M90U 4PL6A 1ZBXA 4J9HA 2LRQA 4JRPA 2CZ6B 2JNGA 4F7UB 5CO7A 1K0SA 2IPOB 2JN0A 2QTVA 2F2WA 3MJXA 3FJPA 5FU6C 2NUTB 1VQ4T 4DBFA 3CCQT 3V7CA 2A7YA 1VQOQ 2AHJB 3OYJA 3VS0A 1OV3A 4XQ3A 3CCJA 1TOVA 4LD9K 5C0MA 3C12A 4R55A 3QBYA 1ZQ1A 4C8QA 4RTZA 8AT1B 2BTTA 1M90C 2O88A 3SHWA 2BZXA 1PKSA 3UWNA 3CXCA 1NJIR 1XJWB 2DVEA 5KYXA 2CYZB 3OYYA 4F17A 1Y96A 3GP8A 5M9OA 2JZ2A 2LNVA 5GAOp 2QG9B 4M75F 5LJ5f 5KCOA 3MPUB 1VYVA 5LJ5j 3X20B 3EG2A 5GAN7 3OYBA 2YRDA 4C0DC 1MMDA 5IHNA 4J9CA 2J6OA 5CKDA 3VUZA 1LCKA 2SEMA 4FYXB 3E9FA 3CC4Q 3FRNA 4J6YA 1SG5A 3I5SA 4PKCC 2CP7A 3PVQA 1HD3A 3WXMB 1N27A 1VYTA 1W2BS 3KUFA 2KRMA 3I35A
chains in the Genus database with same CATH topology
4XTXA 3M5AA 1WPYA 4C5EA 3OSSC 5LJ3g 5FRMA 1RI0A 3QO3A 4ZGDB 2I2LA 4IUQA 5GANj 1OI1A 2FHDA 3NFCA 4PJOD 1WQ7A 2RK2A 3FEOA 3CXCS 3VU3C 2E6ZA 3FC3A 2LT1A 3PGGA 2RHIA 4EMKB 2HAXA 3OYAA 5GANg 2GQVA 2VYTA 5EG2A 1I8FA 5IT9E 4Q5WA 2M9UA 5D6XA 2DPPB 4LDVA 5HKCA 1YBYA 3INZA 2BUDA 3OSVA 2VV5A 5A0LA 3CMEA 2EJFA 2DD4A 4ELYC 1VQMA 3H8ZA 1YI2T 3ZFJA 2K5FA 3OB9A 1W4SA 2LCCA 4BD3A 1K73U 2X35A 4CI0C 5KE2A 1S72T 3PIPA 5A0DA 2F69A 3JCMP 1VQPA 3GNGA 2LCLA 2QQSA 5LL6S 4EMKC 5C6SA 3TREA 3G4SA 1U1TA 3MO8A 3C94A 2O4XB 1BYMA 2DKGA 5DY9A 4JRKA 1R8OB 1G3WA 3OW2A 4EPCA 5I21A 3HKSA 3G6ET 1BKBA 1VUBA 3A8LB 2LX9A 3ZEHA 3CCEA 2XU8A 4MZTA 1IZ6A 1VQKT 2D6FA 2E70A 2EQMA 3QPHA 2LVMA 3J80E 3OBYA 3VKIA 4E7KA 1VQ8T 4JLIA 3I55T 4J7IA 2A3LA 3LWIA 3LLRA 3V8LA 2QDYB 3I56A 2FB7A 2RJEA 2L89A 2RI3A 3EAEA 3CCRT 1Y71A 3T9NA 3CCLT 2RJCA 5LJ5e 4TVRA 5GMKm 2ZPEB 4KUDK 4M78B 1VIFA 2WACA 3KXTA 2KDSA 2VGMA 3JCMJ 1K73C 4OMFB 2KAFA 4A4KA 2EJGA 2V8JA 3WVDB 1QVFA 5A0GA 3AHUA 5KCHA 3M59A 4NL3A 2EAYA 2PUOB 1KHIA 4M77B 3CCUA 4MMKA 1Y07A 5DLQE 2QA4T 4BE2A 1Q81U 2HNIA 1UGSB 4EMGA 5J39A 3G71A 3VV0A 2JTMA 2R58A 3LYIA 5GAMh 3GPLA 3QHSA 4LDXA 2OTJA 2IVWA 1K8AC 4M78A 3FIFA 2DTOA 3OA6A 4IKFA 4M75E 5GAMd 2K5IA 4C92C 4J7FA 1N9SA 2OAUA 2R5MA 2KK4A 4PLLA 3OYIA 4E47A 4M77A 5D6WA 3JCMh 5A2QE 2OTLT 1VQ9A 2DXCA 3DLLA 2EQJA 3LGLA 4BI8B 3X25B 4ZN3A 1ZHIA 3PTAA 3JB9J 3CD6T 2QQRA 2NLUA 2EWNA 3MEWA 2L5QA 3UDCA 2E41A 3L2UA 4FM4B 4M78D 3META 3VUBA 3HRUA 4M7DA 1M9SA 2QEXA 1VQNA 3PT9A 4KUIA 4M7AB 2DXTA 4N0AC 2YLBA 3DKMA 5D6YA 3OMGA 1YHQT 4HT8A 1BI1A 2PUKB 1JRIA 3URGA 1YIJA 4BDYA 4M77D 2RI2A 3L2QA 4J6XA 5GAOn 3OYKA 3MHXA 3CCST 1Q81C 2DXBA 4C8QG 5FU7C 3L1AA 3JCMf 2ZPIB 4JUVA 2PVDB 1U1SA 2EQKA 4D6WA 2VC8A 4JRQA 4L59A 3M9QA 3X28B 2DO3A 4KULA 3S3OA 4DA4A 4JS5A 4BI4A 4MMLA 2K5LA 3VYHB 2MWPA 1QVFS 2EIFA 4M7AA 1BI0A 3CPFA 1NE8A 4HKEA 2DK3A 5LJ5g 4M7DG 3OQ5A 2FYKA 3G7ZA 2RK1A 4R56A 4OGEA 4JJNK 3JCMW 2EQUA 4FL6A 2QQ9A 3A5ZB 3M57A 3QJ6A 1YJ9T 1XOVA 4PJOA 2CZ7B 2GFUA 4XTWA 4OF1A 4ELZC 4X9DA 1VQLT 5I2MA 3HFOA 2R5AA 2XICA 4NS5A 3CCVA 3V8JA 5CCAA 2IG0A 1WGSA 2YLCA 3S3MA 2XHCA 3QXEB 3CC7A 1Q7YU 4M7AD 4LD6A 5AYFA 4GLKA 5GAN3 5GAN8 5LJ3d 1NZ9A 1O9SA 1EIFA 4F7UE 1YITT 1KQSA 1I4K1 4RCBA 4BDZA 3FLGA 1BIAA 1HK9A 2D9TA 2E65A 3P8DA 5J26A 2Y4YA 3JCMb 1UGRB 2DEQA 2PU9B 3OBWA 4C8QE 2V8IA 5GANd 3HRSA 3QG1A 3X24B 4RCCA 2LQ8A 3JCMX 3CMAT 1NPRA 4PJOG 5CIUA 4PLIA 5KH6A 4DQ2A 4HCBA 2MWOA 2B8AA 2CZ1B 1O75A 2E10A 4MZMA 3RESA 1WJSA 3LH0A 1JJ2A 2C06A 2ZPHB 1B34B 5GAOl 5HY6A 2X4WA 2D0QB 3EFRA 4M7DE 2DZCA 3OYCA 3QYGB 4VUBA 2BIVA 2K2VA 2FL7A 4LDWA 2WSCE 2V8KA 3DLMA 4OP0A 4QQGA 4L6V5 3ZBDA 4F7UF 3CPWA 4B9WA 4EMKA 3DB4A 1Q7YC 2DIQA 1X75C 2PQWA 1QP2A 1WNLA 1FXXA 1PSFA 2F5KA 4BE0A 3RKYA 3OYHA 1VQOT 2EJ9A 1S72A 1YJNT 3CCMA 4Y28E 4C8QF 1M5Q1 3M4GA 4QVZA 3OMCA 3BY7A 3V8KA 3OYFA 2DIGA 1VQ7T 3FB9A 1YJWT 2MF2A 4J83A 3CC2T 3OYGA 2CS7A 2M0OA 2YHTA 3QZ5B 4M75C 5GAOr 1V29B 2LTOA 1Q86U 2XIDA 4E7LA 1QVGA 5GAN6 3G4ST 4M7DF 2RHZA 3G6EA 2KY9A 3JRZA 3OY9A 1KQSS 2LQKA 1M1GA 1FWZA 2O4XA 3JB9I 4HCCA 5FRNA 3JCMe 1KHCA 1QW1A 2RJFA 4A4HA 3P8HA 4IUUA 3HRTA 3I55A 4C92B 3CCET 2XG8D 2PVOB 3LGFA 4LDUA 1IREB 3QKJA 4WF2A 3RIRA 4QVDA 4BB7A 1JBMA 3CCRA 1VQ5A 4E7JA 3QYHB 2QTXA 4ME7A 5CK9A 3JCMV 3QDRB 3L2VA 2JUFA 1JJ2S 1I5LA 3OYNA 4XTVA 1LNXA 1OZ2A 4IURA 4BY6B 3MP8A 4C5HA 1VQ4A 2K4YA 4XTUA 5J3BA 3SB2A 5I2SA 3SDZA 1SSFA 4C92A 3CCQA 5FLXE 4RG8A 4DOWA 2VXEA 3DB3A 2QA4A 3JB9D 4PJOF 3CPWS 2Y4XA 2RJDA 3TEEA 5KE3A 1Q86C 1N8RU 2G3RA 2ZCFB 4N4HA 2DTHA 3PMIA 3QIIA 4QW2A 5FU7B 3MP6A 2DXUA 3JCMQ 1BI2A 3JB9G 5CAIA 1H641 3BFMA 3HP9A 1KC8U 2FVUA 4KBMB 5GAN5 4A4FA 3G71T 3CC4T 3LX7A 3SWNB 4NOYA 1JB0E 3F70A 3LWHA 3OW2S 3CCJT 2OTJT 4C92D 2WSEE 1HXDA 2OTLA 1LJOA 4BY6C 4P5NA 2K3YA 4JDSA 5GAMf 4RKUE 5GMKh 1QVGS 4C92G 5GAMj 4OB0B 4N4GA 4M78G 4A4GA 4OB2B 1WJQA 3RKXA 1VQ9T 5CKBA 2K3XA 1Y96B 2X4YA 3HSBA 1TH7A 1N9RA 5DM7R 1RL2A 4C5GA 2YRVA 1DJ7B 1YHQA 2CGHA 4II1A 4M77G 4XAXB 5GAN4 3PIOA 2DJZA 3GOXA 3JB9H 4C8QC 2VUBA 3GNFB 2R57A 3E9GA 3N5BB 4IUVA 4QQDA 3L2ZA 4X9CA 2RHXA 3SWNC 1VQNT 5IAYA 1UGPB 1N8RC 2KVQG 5LJ5d 4QQ6A 4MZPA 3M56A 3SD4A 1D3BB 3JCMg 1OYXA 2JVVA 3KBGA 4XTYA 3QUIA 3LW5E 1KC8C 2L3RA 2RA2A 1NJIU 5GMKj 3OS5A 4HA8A 4XU0A 4FT2A 4LDYA 2CKKA 5CKHA 4C0GA 4M7DC 4V2SA 1KG1A 3HFNA 2L8DA 5CKFA 5LJ3h 2O01E 5CQYA 2PVGB 2RD1A 2X4JA 3JCMc 4GY5A 3V7RA 3NTIA 3OYLA 1YJ9A 2JTFA 1WQWA 5IN1A 3RERA 3O8VA 4MDWA 3C4SA 2RB6A 2E64A 1G3SA 3A8HB 4OB3B 5GANh 4M7AG 3UT1A 2RH2A 4M78E 3CBOA 5CKEA 3MP1A 2QI2A 1VQ6A 2GF7A 3P8BB 2LC4A 3HL8A 4IUPA 2K57A 4O6JA 3GIBA 1G5VA 2E5QA 3CCVT 3M55A 1Y7XA 2EYQA 3NTKA 4M77E 2KSSA 5CR2A 5FROA 3OYEA 3S6WA 2EFIA 2E1HA 4BE1A 5LJ3f 3JB9F 3H6ZA 3ME9A 4FT4A 1G3YA 1WJRA 4CRIA 1NJIC 4MDXA 4M75B 1XTDA 2GCXA 5GANf 4EMHA 4RG2A 1QVPA 1UGQB 1NPPA 4C92F 4XU2A 1YI2A 3BDUA 4M78F 3JAME 4ZGEB 1P92A 1X6OA 4ATOA 2M16A 3M58A 4OGCA 2DZ9A 2QXFA 4ZTFA 1B34A 3CMET 3M4YA 1VQMT 5GMKl 3R6OA 3OS2A 3WVEB 4M77F 3Q1JA 1PSEA 2E12A 4M75A 1K9MU 1VQOA 2XDDA 4M7AE 4BUGA 3L42A 1YJNA 2HD0A 3HHTB 1BI3A 5GAMe 4OB1B 1BIBA 2P0QA 5L8RE 1VQPT 3RMQA 4E7HA 1QP3A 1VQ7A 3QZ9B 2XDBA 3L2RA 1YJWA 2E6NA 3X26B 3CCMT 1XQHA 3CC2A 4PJOE 2QQBA 4A54A 4A53A 2VXFA 4KT0E 1VQKA 3CEYA 3VYGA 2ZPBB 3TCJA 2WSFE 2XDPA 2KQWA 3ER0A 4M75D 2RM4A 2ZPFB 1VQ8A 4ZN1A 2P0PA 3A8MB 2VGNA 4N4IA 1XNIA 1KQ2A 3OYMA 3QSUA 5FU6B 5GAOm 2X4XA 4M75G 2JOYA 2LT4A 3CCLA 3QJYA 4OVAA 4Z02A 1K8AU 3BW1A 2QQAA 2KMTA 3V7SA 1LOJA 4EDUA 5GMKi 2P0KA 5GMKe 3I56T 4PNOA 4M7AF 4BI3A 5CQXA 4JS4A 1Q82U 2BKDN 4FSXA 3E1SA 3MEAA 2P4TA 3FDRA 3RMSA 1K9MC 1H3ZA 1M90U 4PL6A 1ZBXA 2LRQA 4JRPA 3EFSA 1VQ5T 2CZ6B 2JNGA 1U8RA 4F7UB 5CO7A 1MHNA 2ZZDA 3GLXA 1GXIE 5DLOA 2JN0A 3A8GB 3SFMA 3FJPA 3CCUT 3C95A 3E19A 5FU6C 1I81A 3VJPA 3CBPA 4C5IA 4C8QB 4XU3A 3HPWA 1MGQA 1VQ4T 3TU4K 2XI9A 4FIBA 3CCQT 3V7CA 3S3NA 2A7YA 2RHUA 3PFSA 4NL2A 1OZ3A 2AHJB 3MEVA 3NTHA 4N0AA 3OYJA 4BACA 4JLGA 4Y91A 2MAMA 3CC4A 4F7UA 3GF5A 4J6WA 4XQ3A 3CCJA 2H3JA 3OS1A 5LJ3e 1M1KU 4LD9K 3CD6A 3J7AF 4C0ZA 3C12A 4YTLA 5C0MA 4R55A 4M7DB 2Y90A 3QBYA 3OS0A 3RUXA 1M8VA 4IUTA 4UC4A 4XK8E 1ZQ1A 4M78C 1M4ZA 4A4EA 4C8QA 1M1FA 2HQXA 5GAMg 1Q82C 1W2BA 3SWNA 3RKWA 2XD0A 2M1HA 4C0FA 5GANe 5LJ5h 3ASKA 1M90C 2CZ0B 1KQ1A 2EKOA 2XK0A 5GAN2 2QEXT 3CCSA 3UPUA 4M77C 4XU1A 1YCYA 3L2WA 3OYDA 3JCMd 3J81E 1VQ6T 4JRIA 3UWNA 4C0DB 3CXCA 1YIJT 2DVEA 2CYZB 4HCZA 3OYYA 2LDMA 4F7UG 1Y96A 4C8QD 4E7IA 1G3TA 3GP8A 1KD1U 1VIEA 3PMTA 2MMPA 5M9OA 2JZ2A 4XTZA 2LNVA 2RO0A 3BDLA 4B9XA 3A8OB 5GAOp 3MEUA 4M75F 4X34A 4PJOB 5LJ5f 1UB4A 3M53A 4ZTJA 5KCOA 5GAOq 2HBPA 1M1KC 2XKOC 5LJ5j 3X20B 4M7DD 1D3BA 3MCAB 4DOVA 1VQLA 3M54A 1AHJB 5GAN7 3OYBA 4J5YA 4C92E 4J8OA 4C0DC 1X01A 2RHYA 2DTIA 2RI5A 4QVCA 2ZGWA 3JSCA 5CKDA 1FX7A 1N6AA 2DD5A 3PNWC 3VUZA 1YITA 4M7AC 2F5TX 4HT9A 1UEBA 3E9FA 2ZPGB 5CVIA 2DAQA 3FRNA 3CC7T 4J6YA 4ZGJB 5HK0A 4L5GA 4O5VA 4PKCC 4RMOA 4PJOC 5LJ3j 2GFAA 4FU6A 5HK3A 3CMAA 3WXMB 2MI6A 1N27A 1W2BS 3KUFA 1KD1C 2HQEA 3CBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C5E A;  2G3R A;  5FRM A;  4N4H A;  1RI0 A;  4QW2 A;  3PMI A;  2EQK A;  3QII A;  3CEY A;  3MP6 A;  4L59 A;  3M9Q A;  4IUQ A;  1OI1 A;  2FHD A;  2XDP A;  3S3O A;  3FEO A;  2MWP A;  4A4F A;  3FC3 A;  4N4I A;  1XNI A;  3LX7 A;  3OYM A;  2RHI A;  3F70 A;  3OYA A;  2X4X A;  3OQ5 A;  2VYT A;  4OVA A;  4Z02 A;  4Q5W A;  2EQU A;  4FL6 A;  2K3Y A;  5D6X A;  4EDU A;  3QJ6 A;  2P0K A;  2GFU A;  2BUD A;  2BKD N;  2R5A A;  4N4G A;  4NS5 A;  4A4G A;  1WJQ A;  3H8Z A;  3MEA A;  2IG0 A;  1WGS A;  3FDR A;  3OB9 A;  2K3X A;  3S3M A;  2X4Y A;  1H3Z A;  2LCC A;  4LD6 A;  4PL6 A;  4BD3 A;  2LRQ A;  2X35 A;  4C5G A;  2YRV A;  5KE2 A;  4II1 A;  1MHN A;  4BDZ A;  3GOX A;  3FLG A;  5J26 A;  2D9T A;  2R57 A;  3P8D A;  3E9G A;  2QQS A;  4IUV A;  4QQD A;  5C6S A;  2RHX A;  5IAY A;  4C5I A;  3MO8 A;  2O4X B;  4QQ6 A;  3SD4 A;  1OYX A;  3S3N A;  2RHU A;  3PFS A;  5CIU A;  1OZ3 A;  4PLI A;  2L3R A;  3MEV A;  3NTH A;  5KH6 A;  2MWO A;  2B8A A;  3OYJ A;  4BAC A;  1WJS A;  2CKK A;  3LH0 A;  3ZEH A;  2L8D A;  2EQM A;  2LVM A;  2X4W A;  3OS1 A;  5C0M A;  4E7K A;  3QBY A;  3OS0 A;  4GY5 A;  3LLR A;  3NTI A;  3OYC A;  3OYL A;  4IUT A;  2BIV A;  2JTF A;  2RJE A;  4UC4 A;  4A4E A;  2L89 A;  3DLM A;  4QQG A;  2HQX A;  2RI3 A;  3EAE A;  5IN1 A;  3O8V A;  2M1H A;  2RJC A;  3C4S A;  3DB4 A;  4B9W A;  2DIQ A;  3ASK A;  2PQW A;  2XK0 A;  2EKO A;  3UT1 A;  2WAC A;  2F5K A;  3MP1 A;  4BE0 A;  3OYH A;  2GF7 A;  3L2W A;  4IUP A;  3OYD A;  1G5V A;  2E5Q A;  3UWN A;  5KCH A;  4QVZ A;  3OMC A;  3OYF A;  3NTK A;  4HCZ A;  2DIG A;  2LDM A;  5FRO A;  3OYE A;  3S6W A;  2EFI A;  4BE2 A;  4BE1 A;  4E7I A;  5J39 A;  3H6Z A;  3ME9 A;  3OYG A;  2R58 A;  3LYI A;  2M0O A;  1WJR A;  2LTO A;  3PMT A;  5M9O A;  4E7L A;  2JZ2 A;  4B9X A;  2RO0 A;  3BDL A;  4CRI A;  2RHZ A;  3MEU A;  4X34 A;  3OA6 A;  4IKF A;  3OY9 A;  4ZTJ A;  4PLL A;  2R5M A;  5KCO A;  2O4X A;  4RG2 A;  5FRN A;  3OYI A;  1KHC A;  2RJF A;  5D6W A;  3P8H A;  4IUU A;  4A4H A;  3OYB A;  2EQJ A;  2RHY A;  2RI5 A;  3LGL A;  2M16 A;  3LGF A;  3QKJ A;  4ZTF A;  2QQR A;  2NLU A;  3PNW C;  3MEW A;  4E7J A;  3L2U A;  3OS2 A;  3MET A;  3E9F A;  3Q1J A;  3L2V A;  2DAQ A;  3OYN A;  1OZ2 A;  3L42 A;  3OMG A;  4IUR A;  5D6Y A;  3MP8 A;  4C5H A;  4BDY A;  2RI2 A;  3L2Q A;  4E7H A;  1SSF A;  3OYK A;  2GFA A;  4FU6 A;  3L2R A;  1N27 A;  3DB3 A;  2E6N A;  3KUF A;  5KE3 A;  2RJD A;  2HQE A; 
#chains in the Genus database with same CATH topology
 2RF0 A;  3GBQ A;  5AT1 B;  1OI1 A;  2FHD A;  3E2U A;  3FEO A;  3UF4 A;  1BBZ A;  1VQN Q;  3OYA A;  1K9M R;  1M3B A;  5IT9 E;  1ABO A;  5HKC A;  2RQU A;  2EJF A;  2HBW A;  1YI2 T;  3OB9 A;  1RAA B;  2LCC A;  1PNJ A;  2X35 A;  1S72 T;  3JCM P;  3GNG A;  4OMP A;  5LL6 S;  5C6S A;  2VWF A;  3VS2 A;  1BYM A;  2O4X B;  1G3W A;  1UTI A;  5I21 A;  1OX9 A;  3A8L B;  5L23 A;  2QAS A;  2D6F A;  3J80 E;  3OBY A;  3QWY A;  1VQ8 T;  4J7I A;  3LLR A;  3I56 A;  2QDY B;  2RJE A;  3EAE A;  1MNE A;  2FRW A;  4TVR A;  1C0M A;  1G83 A;  2ZPE B;  4A63 B;  1VIF A;  2KDS A;  4OMF B;  2EJG A;  2YXY A;  3WVD B;  5A0G A;  1E6G A;  2ENM A;  2HNI A;  5J39 A;  3LYI A;  5IHK A;  3GPL A;  2LZ6 B;  3LH5 A;  2IVW A;  2DTO A;  5GAM d;  4J7F A;  2EYY A;  2OAU A;  2FPF A;  2NUT A;  2D1X A;  4M77 A;  5D6W A;  3CCM Q;  1VQ9 A;  2Z0W A;  3DLL A;  2DIL A;  3X25 B;  4ZN3 A;  3JB9 J;  2NLU A;  2EWN A;  2L5Q A;  2E41 A;  3R6N A;  3VUB A;  2AK5 A;  2QEX A;  4KUI A;  1VQ6 A;  3DKM A;  1YHQ T;  3OMG A;  3U23 A;  1YIJ A;  2RI2 A;  3NPF A;  4AG1 C;  4J6X A;  5GAO n;  3EHQ A;  3OYK A;  2D8H A;  4C8Q G;  5FU7 C;  3L1A A;  1D0X A;  3JCM f;  2KE9 A;  1U1S A;  4JRQ A;  5FWC A;  2COW A;  4KUL A;  4DA4 A;  2K5L A;  1QVF S;  2CT3 A;  3ULR B;  3CPF A;  1K9A A;  2EYW A;  4OGE A;  4JJN K;  1AVZ C;  2EQU A;  2FZK B;  2EYX A;  4LUE A;  2GFU A;  2QDL A;  4X9D A;  1PKT A;  1VQL T;  3HFO A;  4NS5 A;  1QKX A;  2IG0 A;  1WGS A;  2ATC B;  2YLC A;  2DER A;  3S3M A;  3CC7 A;  4LD6 A;  4GLK A;  5GAN 3;  4F7U E;  1YIT T;  3FLG A;  1PWT A;  1WA7 A;  1UGR B;  1WHL A;  1B07 A;  3OBW A;  2V26 A;  1EZZ B;  1WHK A;  1U5S A;  2COZ A;  3QG1 A;  4RCC A;  3JCM X;  1NPR A;  4ZNX A;  5KH6 A;  2ECZ A;  3M0U A;  2B8A A;  1O75 A;  2CP6 A;  1WJS A;  1X43 A;  3LH0 A;  2ZPH B;  5GAO l;  1AZG B;  2D0Q B;  3EFR A;  2CP3 A;  4J9G A;  1N5Z A;  3OYC A;  4VUB A;  2C0O A;  2V8K A;  2YUQ A;  4F7U F;  2ESW A;  2F5K A;  4DBH A;  4LN2 A;  3RKY A;  1X69 A;  3BY7 A;  3V8K A;  1VQ7 T;  1BU1 A;  4JZ3 A;  2D0N A;  1WXU A;  1ZLM A;  4J83 A;  4M75 C;  2YHT A;  3QZ5 B;  5GJW B;  4F14 A;  3G4S T;  4HVW A;  2KY9 A;  3OY9 A;  1M1G A;  2O4X A;  1UJ0 A;  1KHC A;  1QW1 A;  2RJF A;  4A4H A;  4IUU A;  3I55 A;  4ORZ A;  3CCE T;  2XG8 D;  4WF2 A;  4QVD A;  2KR3 A;  3CCR A;  3JCM V;  2JUF A;  3PE0 A;  4BY6 B;  4C5H A;  1VQ4 A;  2SRC A;  1SSF A;  4C92 A;  3CCQ A;  1UJY A;  2YSQ A;  3DB3 A;  2BE9 B;  3JB9 D;  1PCX A;  3CPW S;  1JQQ A;  2BE7 D;  2DFU A;  4N4H A;  2DTH A;  4QW2 A;  3QII A;  5FU7 B;  4Z89 A;  2DXU A;  1IXD A;  1BI2 A;  1VYU A;  2FVU A;  1ZSZ C;  4A4F A;  3G71 T;  1I0C A;  4E6R A;  1EX4 A;  1CKB A;  2E5K A;  3CCJ T;  2WSE E;  1HXD A;  1LJO A;  4P5N A;  2K3Y A;  5D7U A;  2DX1 A;  1QVG S;  4PFO A;  4AT1 B;  1OU9 A;  4A4G A;  2I0N A;  2CSQ A;  3HSB A;  4C5G A;  4II1 A;  4M77 G;  1ZX6 A;  5GAN 4;  2DJZ A;  1I1J A;  4C8Q C;  4IUV A;  5I11 A;  2DYI A;  2H8H A;  2X3X D;  1X2K A;  4QQ6 A;  3M56 A;  1D3B B;  2KYB A;  1ARK A;  3EG9 B;  2FZG B;  1JU5 C;  4XU0 A;  4C0G A;  4FT2 A;  2QA4 Q;  5LJ3 h;  7AT1 B;  2EGC A;  5CQY A;  3NTI A;  3PVL A;  2RB6 A;  1JO8 A;  1G3S A;  3A8H B;  5GAN h;  3UT1 A;  2RH2 A;  2GF7 A;  4IUP A;  2OTL Q;  2E5Q A;  3CCV T;  3M55 A;  5CR2 A;  2EFI A;  1TWB A;  3H6Z A;  4FT4 A;  2OAW A;  1GBQ A;  3VS6 A;  2ROT A;  2ROL A;  2A36 A;  1D09 B;  4M75 B;  4EMH A;  4HVV A;  2GQI A;  4C92 F;  2DJQ A;  4XU2 A;  1YI2 A;  3JAM E;  3H9N A;  1P92 A;  1X6B A;  4DEY A;  2DZ9 A;  5GMK l;  3R6O A;  2DL3 A;  3OS2 A;  3WVE B;  4Y92 A;  2HD0 A;  1BI3 A;  1YJ9 Q;  1YJW A;  3X26 B;  3CEY A;  3VYG A;  4M75 D;  1VQ8 A;  1T3S A;  1KQ2 A;  2X4X A;  1OEB A;  2JOY A;  1ZSZ B;  3QJY A;  3BW1 A;  3JV3 A;  1LOJ A;  4EDU A;  5GMK i;  5GMK e;  3I56 T;  4EIK A;  1Q82 U;  4K11 A;  2BKD N;  2F2X A;  3RR6 A;  1VQ5 T;  2HL3 A;  3GLX A;  1GXI E;  2EGE A;  1I81 A;  4C5I A;  4C8Q B;  3HPW A;  4FIB A;  2RHU A;  4NL2 A;  3PFS A;  1YJN Q;  3MEV A;  2AKK A;  1K76 A;  1M1K U;  2CH4 A;  3CC2 Q;  3VRY A;  1Q82 C;  5GAM g;  2HQX A;  2F1L A;  2M1H A;  2O9V A;  5LJ5 h;  3ASK A;  1KQ1 A;  2QEX T;  4M77 C;  4XU1 A;  2KBT A;  3OYD A;  3J81 E;  3CCL Q;  1VQ6 T;  1YIJ T;  1CKA A;  4C8Q D;  2D8J A;  1G3T A;  1Z9Z A;  1VIE A;  3PMT A;  1D1A A;  2MMP A;  4B9X A;  1KFZ A;  3BDL A;  2CSI A;  1UB4 A;  3EFO A;  4ZTJ A;  1K0X A;  5GAO q;  2HBP A;  1M1K C;  2XKO C;  4DBR A;  1D3B A;  1VQL A;  4DOV A;  1S1N A;  1AHJ B;  3EG9 A;  2RHY A;  1QLY A;  1Z9Q A;  2DD5 A;  3M0Q A;  1YIT A;  4F04 B;  2ZPG B;  2DAQ A;  3CC7 T;  3M0R A;  1GFC A;  3VS3 A;  4RMO A;  2DBK A;  5LJ3 j;  4RTU A;  2MI6 A;  3P8B B;  4RTW A;  1VQ9 Q;  3CBM A;  4XTX A;  1WPY A;  4C5E A;  2K2M A;  3OSS C;  1RI0 A;  2HCK A;  2I2L A;  4IUQ A;  5GAN j;  1WQ7 A;  4FSS A;  4OMN A;  3FC3 A;  3PGG A;  1WI7 A;  1QCF A;  1I8F A;  2M9U A;  5D6X A;  4LDV A;  3EG3 A;  1YBY A;  2HDA A;  3INZ A;  2BZY A;  3OSV A;  2OX7 A;  2VV5 A;  1OPK A;  1VQM A;  1MMA A;  3IQL A;  3ZFJ A;  1TTH B;  1J3T A;  5A0D A;  1VQP A;  3EGU A;  2DL4 A;  2LCL A;  3G4S A;  4FYW B;  2YRC A;  2CT4 A;  2QYZ A;  4JRK A;  1I07 A;  1RAH B;  4FW1 A;  3CCE A;  2LX9 A;  3ZEH A;  1IHW A;  2XU8 A;  2DA9 A;  2EQM A;  2QGF B;  1M90 R;  4E7K A;  3I55 T;  3LWI A;  2MYS A;  3CCR T;  2ZAE A;  3SEM A;  1PD1 A;  1ZSZ A;  4KUD K;  2WAC A;  3JCM J;  3MKD A;  4A4K A;  2HSE B;  3AHU A;  5KCH A;  4NL3 A;  4M77 B;  2CRE A;  3CCU A;  3CME Q;  4BE2 A;  3G71 A;  2B86 A;  2R58 A;  5GAM h;  1G2B A;  4FYV B;  1K8A C;  3FIF A;  4RTX A;  2NYS A;  2J7I A;  4IKF A;  4M75 E;  2K5I A;  4C92 C;  4PLL A;  2R5M A;  3JCM h;  3I5R A;  1BB9 A;  2DXC A;  3NMZ C;  2DRM A;  4BI8 B;  1ZHI A;  1W6X A;  4FM4 B;  3MET A;  1M9S A;  2DXT A;  4N0A C;  5D6Y A;  4HT8 A;  1RAI B;  1BI1 A;  1JRI A;  4WTO B;  4M77 D;  3L2Q A;  2NUP A;  3RNJ A;  3MHX A;  3CCS T;  2LX7 A;  1KK7 A;  2RQV A;  4L59 A;  2CDT A;  4M7A A;  2V1R A;  4ANJ A;  4M7D G;  2CP0 A;  3G7Z A;  4X1V A;  4R56 A;  1RLP C;  2JJ9 A;  1T0J A;  2QQ9 A;  1VQ4 Q;  3M57 A;  3CCQ Q;  4XTW A;  4ELZ C;  5I2M A;  3CCV A;  1KJW A;  5CCA A;  1E7O A;  2JMC A;  2XHC A;  3QXE B;  1Q7Y U;  5AYF A;  2EPD A;  5GAN 8;  1EIF A;  1I4K 1;  4OML A;  2KI7 A;  2E65 A;  2YUO A;  2L3P A;  1WZO A;  1RAD B;  2W0Z A;  5FWB A;  4C8Q E;  3CMA T;  4PJO G;  5CIU A;  2MWO A;  2CZ1 B;  2O9S A;  4J9I A;  1SHF A;  5HY6 A;  5FW9 A;  2KRS A;  2DZC A;  2DNU A;  2BIV A;  2K2V A;  3DLM A;  4QQG A;  3DB4 A;  3EGX B;  1Q7Y C;  1X75 C;  1FXX A;  2KRO A;  3OYH A;  1D1B A;  4C8Q F;  1M5Q 1;  4HCK A;  3OYF A;  1OQK A;  2AZS A;  1WHG A;  5ECA A;  1YJW T;  2IIM A;  1Q86 U;  1MMN A;  1V29 B;  1NLO C;  5GAN 6;  3ZL7 C;  3G6E A;  1YP5 A;  1KQS S;  2CH4 W;  2LQK A;  5IHI A;  1FWZ A;  5FRN A;  3P8H A;  2KT1 A;  4C92 B;  4PK4 A;  2PVO B;  1IRE B;  3RIR A;  1VQ5 A;  2YT6 A;  4E7J A;  2MPX C;  2QTX A;  1JJ2 S;  3OYN A;  2DM1 A;  1OZ2 A;  2LJ3 A;  1NEG A;  5FLX E;  4DOW A;  1ZUY A;  1PC0 A;  2Y4X A;  3TEE A;  1YI2 Q;  1Q86 C;  2G3R A;  2ZCF B;  1SPK A;  3PMI A;  2KXD A;  1S72 Q;  5CAI A;  1H64 1;  1KC8 U;  4KBM B;  5GAN 5;  4RTT A;  3LX7 A;  4NOY A;  1JB0 E;  3F70 A;  3OW2 S;  2OTJ T;  1MMG A;  4C92 D;  4BY6 C;  5GAM f;  2M02 A;  4RKU E;  5GAM j;  1WJQ A;  5CKB A;  1W2B P;  4J9F A;  1QMC A;  3D7S B;  2L3S A;  3E9G A;  4QQD A;  2RHX A;  1IHV A;  2JS2 A;  1UGP B;  1IB8 A;  3SD4 A;  2HKQ B;  2JVV A;  3KBG A;  3REB B;  1WX6 A;  1KC8 C;  1KIK A;  1RUW A;  3OS5 A;  5CKH A;  1PG5 B;  4M7D C;  1KG1 A;  1TSF A;  4V2S A;  2GNC A;  2L8D A;  1Y0M A;  3V7R A;  3JCM c;  2X4J A;  2JTF A;  2G6F X;  1WQW A;  3RBB B;  1OX8 A;  1TU0 B;  3O8V A;  3RER A;  3C4S A;  2E64 A;  4M7A G;  2FO0 A;  5CKE A;  1QCN A;  2QI2 A;  3H41 A;  3GIB A;  2LC4 A;  1MUZ A;  1G5V A;  1OU8 A;  1YWO A;  1GCQ C;  1Y7X A;  4M77 E;  3M0P A;  2GTO A;  3S6W A;  1C6V X;  1WJR A;  2QGG A;  1KQS P;  4CRI A;  1YHQ Q;  1HJD A;  1XTD A;  2GCX A;  2K6D A;  4RG2 A;  1QVP A;  1M3C A;  1NPP A;  3VS4 A;  2RNA A;  1QCO A;  4ZGE B;  1X6O A;  2M16 A;  4OGC A;  1ZSG A;  1VQM T;  2JTE A;  4M77 F;  1R77 A;  1PD0 A;  1VQO A;  4CC4 B;  4BUG A;  3L42 A;  1VQP T;  4E7H A;  2LQW A;  4OMO A;  3EGX A;  1WLP B;  1VQL Q;  4QKU A;  8ATC B;  2PTK A;  1XQH A;  4KH0 B;  2VXF A;  2WSF E;  2XDP A;  2KQW A;  3ER0 A;  2RM4 A;  3OW2 P;  3TSW A;  4N4I A;  1AWJ A;  3OYM A;  2AZV A;  2CP2 A;  2LT4 A;  2KMT A;  2A0F B;  2HZY A;  2P0K A;  1MND A;  5CQX A;  4JS4 A;  4FSX A;  3EFS A;  1M8M A;  3A8G B;  4AFZ C;  1QVF P;  3CCU T;  3C95 A;  3E19 A;  4DEX A;  1ZA2 B;  2DMO A;  4XU3 A;  1MGQ A;  1X27 A;  1OZ3 A;  5GJV B;  4N0A A;  2KEA A;  4BAC A;  4JLG A;  2MAM A;  2M0Y A;  3CC4 A;  1K4U S;  4AFU C;  4J6W A;  1VQ7 Q;  2H3J A;  2RQW A;  5LJ3 e;  3OS1 A;  3J7A F;  4C0Z A;  4YTL A;  3TVT A;  4M7D B;  2Y90 A;  1M8V A;  4IUT A;  4UC4 A;  4A4E A;  1LVK A;  5KYY B;  4PJN A;  1W2B A;  3RKW A;  5GAN e;  2AT1 B;  1HYO A;  2XK0 A;  2EKO A;  3CCS A;  3L2W A;  3QDF A;  3EFO B;  2QAZ A;  4HCZ A;  2ABL A;  4JJB A;  2LDM A;  4F7U G;  4E7I A;  1QWF A;  1KD1 U;  4XTZ A;  2RO0 A;  3MEU A;  4PJO B;  4ESR A;  2HKN A;  2HSP A;  1FMV A;  4M7D D;  3M54 A;  4C92 E;  4QVC A;  1W70 A;  2JS0 A;  2ZGW A;  4B6M A;  1TG0 A;  3JSC A;  1RAB B;  4M7A C;  2MCN A;  3G71 Q;  4HT9 A;  2JT4 A;  2LP5 A;  3CCJ Q;  4ZGJ B;  4O5V A;  1WXB A;  2AKL A;  4FU6 A;  3CMA A;  1QWE A;  2E4H A;  2LJ1 A;  1KD1 C;  3O5Z A;  4FW2 A;  4AG2 C;  4ZGD B;  3QO3 A;  3FJ5 A;  4HXJ A;  4PJO D;  2RK2 A;  1RAG B;  1MV0 B;  3CXC S;  1KSW A;  2YUN A;  2RHI A;  4EMK B;  2LJ0 A;  2GQV A;  1PRL C;  2F2V A;  2NUZ A;  3CPW P;  4BD3 A;  5KYU A;  4JPB W;  1K73 U;  5KE2 A;  3NHN A;  4AFS C;  4RUG A;  2V1Q A;  2QQS A;  1BK2 A;  1YN8 A;  3MO8 A;  3C94 A;  2DKG A;  5DY9 A;  2RMO A;  3OW2 A;  1HSQ A;  3HKS A;  1Q82 R;  3G6E T;  1BKB A;  3I9Q A;  3CCV Q;  1QVG P;  1IZ6 A;  1VQK T;  3QPH A;  3VKI A;  1LPL A;  2A3L A;  1R0B G;  3V8L A;  2FB7 A;  1B3Q A;  2RI3 A;  3CCL T;  2RJC A;  5LJ5 e;  2W10 A;  2A28 A;  2VGM A;  1K73 C;  2KAF A;  1H3H A;  2V8J A;  1QVF A;  3M59 A;  3UA7 A;  2PUO B;  4E2F B;  1Y07 A;  2PZ1 A;  5DLQ E;  1M1K R;  1Q81 U;  1UGS B;  4EMG A;  5I22 A;  1NLP C;  3VV0 A;  3M0T A;  2OTJ A;  4M78 A;  2FRY A;  1N9S A;  2KK4 A;  3OYI A;  5KYN A;  2NUP B;  5A2Q E;  2EQJ A;  2MK5 A;  1GFD A;  3CD6 T;  2O2O A;  3UDC A;  1C1A A;  3L2U A;  1BCM A;  3HRU A;  4M7D A;  2E3H A;  2X51 A;  4M7A B;  4BDY A;  5KYY A;  3I56 Q;  1Q81 C;  4F16 A;  2RN8 A;  4JUV A;  2VKN A;  1B7T A;  4R0K A;  4RTY A;  2DYB A;  3M9Q A;  1VQ5 Q;  2H3E B;  4JS5 A;  4BI4 A;  4M4Z A;  1PM3 A;  2MWP A;  3VYH B;  1NE8 A;  1GCQ A;  2DK3 A;  4HKE A;  4LE9 A;  2RK1 A;  3JCM W;  1JXM A;  4FL6 A;  1NBE B;  4PJO A;  2CZ7 B;  4OF1 A;  4KRT A;  2R5A A;  3REA B;  4M7A D;  3VS7 A;  5LJ3 d;  1ZUK A;  1O9S A;  1SRM A;  4RCB A;  2DL7 A;  2EVR A;  1BIA A;  5J26 A;  2D9T A;  2DVJ A;  3P8D A;  2Y4Y A;  2PU9 B;  2DEQ A;  2LCS A;  3AT1 B;  2V8I A;  5GAN d;  2QEX Q;  3X24 B;  2LQ8 A;  1VQ6 Q;  4PLI A;  4DQ2 A;  4HCB A;  1YIJ Q;  1FMK A;  4IIO A;  1IGQ A;  1NYF A;  1QKW A;  1AZE A;  4E7Z A;  4M7D E;  1AWO A;  3QYG B;  4CC3 A;  2FL7 A;  4LDW A;  3ZBD A;  3CPW A;  2OI3 A;  4EMK A;  2YDL A;  1FMW A;  2DIQ A;  2YWW A;  2PQW A;  1WNL A;  4OMQ A;  4BE0 A;  1VQO T;  1RAF B;  1WHH A;  2EKH A;  1K8A R;  4QT7 A;  3M4G A;  4QVZ A;  2J06 A;  3H0H A;  2MF2 A;  3EH2 A;  1F1B B;  3TSZ A;  3CC7 Q;  5IXB A;  1TUC A;  1QVG A;  4E7L A;  4M7D F;  1TXQ A;  1SF9 A;  2RHZ A;  4HVU A;  3JRZ A;  2VB6 A;  4RTV A;  4HCC A;  3JCM e;  1UUE A;  3HRT A;  3LGF A;  4LDU A;  1JBM A;  2RQT A;  3QYH B;  3QDR B;  1RAE B;  3RDV A;  4XTV A;  1LNX A;  2DL5 A;  2K4Y A;  4XTU A;  5J3B A;  5I2S A;  3SDZ A;  3H0F A;  2VXE A;  2QA4 A;  4PJO F;  1N8R U;  4J9D A;  2J6K A;  1QQJ A;  2KT8 A;  3JCM Q;  1A0N B;  3MP6 A;  2K7A A;  3JB9 G;  3QWX X;  2E3I A;  2K3B A;  6AT1 B;  3CC4 T;  3SWN B;  1OUL A;  3LWH A;  2OTL A;  1WDX A;  2QK0 A;  4OB0 B;  4N4G A;  4M78 G;  2A37 A;  2K3X A;  2X4Y A;  1N9R A;  1RL2 A;  2VAS A;  1DJ7 B;  3I55 Q;  3PIO A;  4XAX B;  1VA7 A;  2FEI A;  2GTJ A;  2R57 A;  1VQN T;  3CCR Q;  1N8R C;  2KVQ G;  5LJ5 d;  2ED0 A;  4J9B A;  1OYX A;  2JM8 A;  1JEG A;  1ZA1 B;  3LW5 E;  2L3R A;  2RA2 A;  1NJI U;  5GMK j;  1WIE A;  4HA8 A;  4IIM A;  2CKK A;  5EC7 A;  1Q7Y R;  2PVG B;  2RD1 A;  3OYL A;  1YJ9 A;  3EGD B;  1X6G A;  1MV3 A;  5IN1 A;  4OB3 B;  3MP1 A;  2XMF A;  4O6J A;  3HL8 A;  2K57 A;  1SRL A;  4KH1 B;  4KGX B;  1OOT A;  2EYQ A;  3NTK A;  2K79 A;  2KSS A;  5FRO A;  1WXT A;  1G3Y A;  1NJI C;  2P84 A;  4MDX A;  1GL5 A;  1UG1 A;  1PRM C;  1VOM A;  3CCS Q;  1UGQ B;  4DBQ A;  1WFW A;  4ATO A;  3EHR A;  2QXF A;  1W1F A;  3M4Y A;  1AWW A;  1G8X A;  2K9G A;  3Q1J A;  1Q86 R;  1UDL A;  1K9M U;  1E6H A;  2XDD A;  1SHG A;  4M7A E;  1ACM B;  1YJN A;  4OB1 B;  2P0Q A;  5L8R E;  1T3L A;  3L2R A;  2E6N A;  3CCM T;  3CC2 A;  1YFN A;  4A53 A;  4KT0 E;  1VQK A;  2ZPB B;  1UFF A;  3TCJ A;  1I5O B;  5KYW B;  2L3Q A;  2P0P A;  3QSU A;  2VGN A;  5FU6 B;  4GLM A;  5GAO m;  4M75 G;  3CCL A;  4OVA A;  2QQA A;  4Z8A A;  3V7S A;  4M7A F;  3CMA Q;  1IRX A;  3MEA A;  2M51 A;  3VS5 A;  2P4T A;  1K9M C;  3RMS A;  1M2V B;  4FYY B;  2HMA A;  1U8R A;  1MHN A;  2ZZD A;  1KC8 R;  5DLO A;  1D0Z A;  3SFM A;  1M30 A;  2GBQ A;  1D1C A;  3VJP A;  1CSK A;  3CBP A;  1IGU A;  3TU4 K;  2XI9 A;  1SKU B;  3S3N A;  4J9E A;  2KGT A;  2DL8 A;  4AMC A;  3NTH A;  2KRN A;  4Y91 A;  3A1P A;  4F7U A;  4OMM A;  1R0C B;  1D0Y A;  2LMJ A;  3GF5 A;  3CD6 A;  1YJW Q;  1WYX A;  1V76 A;  3OS0 A;  3RUX A;  4XK8 E;  4M78 C;  1M4Z A;  1M1F A;  1VQ8 Q;  3SWN A;  2XD0 A;  4C0F A;  2CZ0 B;  3G1J A;  5GAN 2;  3UPU A;  1YCY A;  1NM7 A;  2J6F A;  3JCM d;  4JRI A;  4C0D B;  3BE3 A;  2OJ2 A;  2RPN A;  2KXC A;  1SEM A;  4D8K A;  2MOX A;  1WHJ A;  2AIR B;  3A8O B;  4X34 A;  3M0S A;  3M53 A;  3MCA B;  9ATC B;  1T0H A;  4J5Y A;  4J8O A;  1X01 A;  2DTI A;  2RI5 A;  1H92 A;  1UE9 A;  1EFN A;  2FPE A;  3PNW C;  1FX7 A;  1N6A A;  1UEC A;  2X9H A;  2F5T X;  1UEB A;  5CVI A;  5IXF A;  2OTJ Q;  4LXC A;  3EGD A;  5HK0 A;  4L5G A;  4PJO C;  1OPL A;  4PFP A;  2GFA A;  5HK3 A;  2HQE A;  3M5A A;  5LJ3 g;  1AEY A;  5FRM A;  1GCP A;  2FPD A;  1BCO A;  3NFC A;  5KYU B;  3VU3 C;  2E6Z A;  2YUP A;  2LT1 A;  2HAX A;  5GAN g;  4D8D A;  2VYT A;  1JJ2 P;  3EG0 A;  5EG2 A;  4Q5W A;  3VRZ A;  2DPP B;  2DF6 A;  3VS1 A;  2BUD A;  2DLP A;  5A0L A;  3CME A;  4ELY C;  2DD4 A;  3H8Z A;  5IH2 A;  2K5F A;  1W4S A;  2VVK A;  4CI0 C;  3PIP A;  2F69 A;  4EMK C;  2JW4 A;  3TRE A;  1U1T A;  1YIT Q;  1ABQ A;  4WCI A;  1R8O B;  4EPC A;  1VUB A;  1NEB A;  2DBM A;  4MZT A;  2E70 A;  2LVM A;  3HTR A;  4JLI A;  2L89 A;  5KYW A;  2EQI A;  1Y71 A;  3T9N A;  5GMK m;  4M78 B;  2ED1 A;  3KXT A;  1AWX A;  2DEU A;  2FG0 A;  2EAY A;  4CC7 A;  1KHI A;  2DE0 X;  4MMK A;  2QA4 T;  1M2V A;  1VQM Q;  2JTM A;  3QHS A;  1AOJ A;  4LDX A;  3OA6 A;  1VQP Q;  4E47 A;  3G4S Q;  2OTL T;  2HEQ A;  1ZUU A;  3LGL A;  3PTA A;  2QQR A;  3MEW A;  2C0T A;  4M78 D;  1TS9 A;  2A08 A;  3CCE Q;  1GRI A;  1KD1 R;  1VQN A;  1YNZ A;  3PT9 A;  2YLB A;  2EW3 A;  2PUK B;  3URG A;  2L2P A;  2CP5 A;  3C0C A;  2DXB A;  2ZPI B;  4JJD A;  2PVD B;  2EQK A;  4D6W A;  2VC8 A;  4PJM A;  3X28 B;  2DO3 A;  3S3O A;  4MML A;  2EIF A;  1BI0 A;  5LJ5 g;  3CCU Q;  2JM9 A;  2FYK A;  3OQ5 A;  1U3O A;  3A5Z B;  3QJ6 A;  1YJ9 T;  1XOV A;  1M3A A;  2XIC A;  2P4R A;  3V8J A;  4FCY A;  4KGZ B;  1NZ9 A;  1KQS A;  4BDZ A;  1HK9 A;  3JCM b;  2EGA A;  2C0I A;  3HRS A;  3UA6 A;  1NYG A;  2JMA A;  2JXB A;  2E10 A;  4MZM A;  3RES A;  1JJ2 A;  2C06 A;  1B34 B;  3A98 A;  2O31 A;  2X4W A;  1K73 R;  2WSC E;  4OP0 A;  4L6V 5;  4B9W A;  1QP2 A;  1PSF A;  1UHC A;  2EJ9 A;  1S72 A;  1YJN T;  3CCM A;  4Y28 E;  1ZBJ A;  2BZ8 A;  3OMC A;  2DIG A;  3FB9 A;  4GBQ A;  3CC2 T;  3OYG A;  2CS7 A;  2M0O A;  4LNP A;  5GAO r;  2LTO A;  2PNI A;  2XID A;  3H0I A;  3JB9 I;  2EYZ A;  3EG1 A;  2X3W D;  3QKJ A;  2NWM A;  4BB7 A;  4JZ4 A;  1Q81 R;  4ME7 A;  1M27 C;  5CK9 A;  3L2V A;  1I5L A;  4IUR A;  3MP8 A;  3SB2 A;  1FYN A;  4RG8 A;  4JJC A;  5KE3 A;  2RJD A;  3UAT A;  1H8K A;  3BFM A;  3HP9 A;  1RI9 A;  1U06 A;  4JDS A;  1AT1 B;  2CUD A;  4KGV B;  1WHM A;  5GMK h;  1Q95 G;  4C92 G;  1TUG B;  2COY A;  4PJL A;  5KYX B;  3G6E Q;  4OB2 B;  3RKX A;  1VQ9 T;  1Y96 B;  2LNH B;  1VQK Q;  1TH7 A;  5DM7 R;  1YHQ A;  2YRV A;  2CGH A;  3GOX A;  3JB9 H;  2VUB A;  4PFZ A;  1X2Q A;  3GNF B;  3CXC P;  3N5B B;  3SWN C;  3L2Z A;  4X9C A;  1NG2 A;  5IAY A;  2HQH A;  2KYM A;  4CC2 A;  1M2O A;  4MZP A;  3JCM g;  2GGR A;  1K1Z A;  4XTY A;  3QUI A;  2CUB A;  3NGP A;  4LDY A;  3HFN A;  5CKF A;  2O01 E;  1TUD A;  4GY5 A;  1GBR A;  1UGV A;  1Y57 A;  2KNB B;  2RQR A;  3THK A;  4MDW A;  2DET A;  4M78 E;  3CBO A;  1UHF A;  4E7S A;  3CD6 Q;  3OYE A;  2LQN A;  2E1H A;  4BE1 A;  5LJ3 f;  3JB9 F;  2FZC B;  3ME9 A;  1RAC B;  3TQ7 P;  5HCK A;  5GAN f;  1YWP A;  3EH1 A;  1RLQ C;  3BDU A;  4M78 F;  2HL5 C;  3M58 A;  4ZTF A;  4AFQ C;  1B34 A;  2J05 A;  3CME T;  1YCS B;  3CQT A;  2EBP A;  1PSE A;  2E12 A;  4M75 A;  3HHT B;  5GAM e;  1SSH A;  1BIB A;  3RMQ A;  1QP3 A;  2MIO A;  2L0A A;  1VQ7 A;  3KFV A;  3QZ9 B;  2XDB A;  4PJO E;  2QQB A;  4A54 A;  1JXO A;  4LUD A;  1AD5 A;  2ZPF B;  1V1C A;  4ZN1 A;  3A8M B;  1XNI A;  2DRK A;  1IO6 A;  4Z02 A;  1K8A U;  1PHT A;  4PNO A;  4PJJ A;  4BI3 A;  4Z88 A;  3E1S A;  3FDR A;  1N8R R;  1H3Z A;  1M90 U;  4PL6 A;  1ZBX A;  4J9H A;  2LRQ A;  4JRP A;  2CZ6 B;  2JNG A;  4F7U B;  5CO7 A;  1K0S A;  2IPO B;  2JN0 A;  2QTV A;  2F2W A;  3MJX A;  3FJP A;  5FU6 C;  2NUT B;  1VQ4 T;  4DBF A;  3CCQ T;  3V7C A;  2A7Y A;  1VQO Q;  2AHJ B;  3OYJ A;  3VS0 A;  1OV3 A;  4XQ3 A;  3CCJ A;  1TOV A;  4LD9 K;  5C0M A;  3C12 A;  4R55 A;  3QBY A;  1ZQ1 A;  4C8Q A;  4RTZ A;  8AT1 B;  2BTT A;  1M90 C;  2O88 A;  3SHW A;  2BZX A;  1PKS A;  3UWN A;  3CXC A;  1NJI R;  1XJW B;  2DVE A;  5KYX A;  2CYZ B;  3OYY A;  4F17 A;  1Y96 A;  3GP8 A;  5M9O A;  2JZ2 A;  2LNV A;  5GAO p;  2QG9 B;  4M75 F;  5LJ5 f;  5KCO A;  3MPU B;  1VYV A;  5LJ5 j;  3X20 B;  3EG2 A;  5GAN 7;  3OYB A;  2YRD A;  4C0D C;  1MMD A;  5IHN A;  4J9C A;  2J6O A;  5CKD A;  3VUZ A;  1LCK A;  2SEM A;  4FYX B;  3E9F A;  3CC4 Q;  3FRN A;  4J6Y A;  1SG5 A;  3I5S A;  4PKC C;  2CP7 A;  3PVQ A;  1HD3 A;  3WXM B;  1N27 A;  1VYT A;  1W2B S;  3KUF A;  2KRM A;  3I35 A; 
#chains in the Genus database with same CATH homology
 4XTX A;  3M5A A;  1WPY A;  4C5E A;  3OSS C;  5LJ3 g;  5FRM A;  1RI0 A;  3QO3 A;  4ZGD B;  2I2L A;  4IUQ A;  5GAN j;  1OI1 A;  2FHD A;  3NFC A;  4PJO D;  1WQ7 A;  2RK2 A;  3FEO A;  3CXC S;  3VU3 C;  2E6Z A;  3FC3 A;  2LT1 A;  3PGG A;  2RHI A;  4EMK B;  2HAX A;  3OYA A;  5GAN g;  2GQV A;  2VYT A;  5EG2 A;  1I8F A;  5IT9 E;  4Q5W A;  2M9U A;  5D6X A;  2DPP B;  4LDV A;  5HKC A;  1YBY A;  3INZ A;  2BUD A;  3OSV A;  2VV5 A;  5A0L A;  3CME A;  2EJF A;  2DD4 A;  4ELY C;  1VQM A;  3H8Z A;  1YI2 T;  3ZFJ A;  2K5F A;  3OB9 A;  1W4S A;  2LCC A;  4BD3 A;  1K73 U;  2X35 A;  4CI0 C;  5KE2 A;  1S72 T;  3PIP A;  5A0D A;  2F69 A;  3JCM P;  1VQP A;  3GNG A;  2LCL A;  2QQS A;  5LL6 S;  4EMK C;  5C6S A;  3TRE A;  3G4S A;  1U1T A;  3MO8 A;  3C94 A;  2O4X B;  1BYM A;  2DKG A;  5DY9 A;  4JRK A;  1R8O B;  1G3W A;  3OW2 A;  4EPC A;  5I21 A;  3HKS A;  3G6E T;  1BKB A;  1VUB A;  3A8L B;  2LX9 A;  3ZEH A;  3CCE A;  2XU8 A;  4MZT A;  1IZ6 A;  1VQK T;  2D6F A;  2E70 A;  2EQM A;  3QPH A;  2LVM A;  3J80 E;  3OBY A;  3VKI A;  4E7K A;  1VQ8 T;  4JLI A;  3I55 T;  4J7I A;  2A3L A;  3LWI A;  3LLR A;  3V8L A;  2QDY B;  3I56 A;  2FB7 A;  2RJE A;  2L89 A;  2RI3 A;  3EAE A;  3CCR T;  1Y71 A;  3T9N A;  3CCL T;  2RJC A;  5LJ5 e;  4TVR A;  5GMK m;  2ZPE B;  4KUD K;  4M78 B;  1VIF A;  2WAC A;  3KXT A;  2KDS A;  2VGM A;  3JCM J;  1K73 C;  4OMF B;  2KAF A;  4A4K A;  2EJG A;  2V8J A;  3WVD B;  1QVF A;  5A0G A;  3AHU A;  5KCH A;  3M59 A;  4NL3 A;  2EAY A;  2PUO B;  1KHI A;  4M77 B;  3CCU A;  4MMK A;  1Y07 A;  5DLQ E;  2QA4 T;  4BE2 A;  1Q81 U;  2HNI A;  1UGS B;  4EMG A;  5J39 A;  3G71 A;  3VV0 A;  2JTM A;  2R58 A;  3LYI A;  5GAM h;  3GPL A;  3QHS A;  4LDX A;  2OTJ A;  2IVW A;  1K8A C;  4M78 A;  3FIF A;  2DTO A;  3OA6 A;  4IKF A;  4M75 E;  5GAM d;  2K5I A;  4C92 C;  4J7F A;  1N9S A;  2OAU A;  2R5M A;  2KK4 A;  4PLL A;  3OYI A;  4E47 A;  4M77 A;  5D6W A;  3JCM h;  5A2Q E;  2OTL T;  1VQ9 A;  2DXC A;  3DLL A;  2EQJ A;  3LGL A;  4BI8 B;  3X25 B;  4ZN3 A;  1ZHI A;  3PTA A;  3JB9 J;  3CD6 T;  2QQR A;  2NLU A;  2EWN A;  3MEW A;  2L5Q A;  3UDC A;  2E41 A;  3L2U A;  4FM4 B;  4M78 D;  3MET A;  3VUB A;  3HRU A;  4M7D A;  1M9S A;  2QEX A;  1VQN A;  3PT9 A;  4KUI A;  4M7A B;  2DXT A;  4N0A C;  2YLB A;  3DKM A;  5D6Y A;  3OMG A;  1YHQ T;  4HT8 A;  1BI1 A;  2PUK B;  1JRI A;  3URG A;  1YIJ A;  4BDY A;  4M77 D;  2RI2 A;  3L2Q A;  4J6X A;  5GAO n;  3OYK A;  3MHX A;  3CCS T;  1Q81 C;  2DXB A;  4C8Q G;  5FU7 C;  3L1A A;  3JCM f;  2ZPI B;  4JUV A;  2PVD B;  1U1S A;  2EQK A;  4D6W A;  2VC8 A;  4JRQ A;  4L59 A;  3M9Q A;  3X28 B;  2DO3 A;  4KUL A;  3S3O A;  4DA4 A;  4JS5 A;  4BI4 A;  4MML A;  2K5L A;  3VYH B;  2MWP A;  1QVF S;  2EIF A;  4M7A A;  1BI0 A;  3CPF A;  1NE8 A;  4HKE A;  2DK3 A;  5LJ5 g;  4M7D G;  3OQ5 A;  2FYK A;  3G7Z A;  2RK1 A;  4R56 A;  4OGE A;  4JJN K;  3JCM W;  2EQU A;  4FL6 A;  2QQ9 A;  3A5Z B;  3M57 A;  3QJ6 A;  1YJ9 T;  1XOV A;  4PJO A;  2CZ7 B;  2GFU A;  4XTW A;  4OF1 A;  4ELZ C;  4X9D A;  1VQL T;  5I2M A;  3HFO A;  2R5A A;  2XIC A;  4NS5 A;  3CCV A;  3V8J A;  5CCA A;  2IG0 A;  1WGS A;  2YLC A;  3S3M A;  2XHC A;  3QXE B;  3CC7 A;  1Q7Y U;  4M7A D;  4LD6 A;  5AYF A;  4GLK A;  5GAN 3;  5GAN 8;  5LJ3 d;  1NZ9 A;  1O9S A;  1EIF A;  4F7U E;  1YIT T;  1KQS A;  1I4K 1;  4RCB A;  4BDZ A;  3FLG A;  1BIA A;  1HK9 A;  2D9T A;  2E65 A;  3P8D A;  5J26 A;  2Y4Y A;  3JCM b;  1UGR B;  2DEQ A;  2PU9 B;  3OBW A;  4C8Q E;  2V8I A;  5GAN d;  3HRS A;  3QG1 A;  3X24 B;  4RCC A;  2LQ8 A;  3JCM X;  3CMA T;  1NPR A;  4PJO G;  5CIU A;  4PLI A;  5KH6 A;  4DQ2 A;  4HCB A;  2MWO A;  2B8A A;  2CZ1 B;  1O75 A;  2E10 A;  4MZM A;  3RES A;  1WJS A;  3LH0 A;  1JJ2 A;  2C06 A;  2ZPH B;  1B34 B;  5GAO l;  5HY6 A;  2X4W A;  2D0Q B;  3EFR A;  4M7D E;  2DZC A;  3OYC A;  3QYG B;  4VUB A;  2BIV A;  2K2V A;  2FL7 A;  4LDW A;  2WSC E;  2V8K A;  3DLM A;  4OP0 A;  4QQG A;  4L6V 5;  3ZBD A;  4F7U F;  3CPW A;  4B9W A;  4EMK A;  3DB4 A;  1Q7Y C;  2DIQ A;  1X75 C;  2PQW A;  1QP2 A;  1WNL A;  1FXX A;  1PSF A;  2F5K A;  4BE0 A;  3RKY A;  3OYH A;  1VQO T;  2EJ9 A;  1S72 A;  1YJN T;  3CCM A;  4Y28 E;  4C8Q F;  1M5Q 1;  3M4G A;  4QVZ A;  3OMC A;  3BY7 A;  3V8K A;  3OYF A;  2DIG A;  1VQ7 T;  3FB9 A;  1YJW T;  2MF2 A;  4J83 A;  3CC2 T;  3OYG A;  2CS7 A;  2M0O A;  2YHT A;  3QZ5 B;  4M75 C;  5GAO r;  1V29 B;  2LTO A;  1Q86 U;  2XID A;  4E7L A;  1QVG A;  5GAN 6;  3G4S T;  4M7D F;  2RHZ A;  3G6E A;  2KY9 A;  3JRZ A;  3OY9 A;  1KQS S;  2LQK A;  1M1G A;  1FWZ A;  2O4X A;  3JB9 I;  4HCC A;  5FRN A;  3JCM e;  1KHC A;  1QW1 A;  2RJF A;  4A4H A;  3P8H A;  4IUU A;  3HRT A;  3I55 A;  4C92 B;  3CCE T;  2XG8 D;  2PVO B;  3LGF A;  4LDU A;  1IRE B;  3QKJ A;  4WF2 A;  3RIR A;  4QVD A;  4BB7 A;  1JBM A;  3CCR A;  1VQ5 A;  4E7J A;  3QYH B;  2QTX A;  4ME7 A;  5CK9 A;  3JCM V;  3QDR B;  3L2V A;  2JUF A;  1JJ2 S;  1I5L A;  3OYN A;  4XTV A;  1LNX A;  1OZ2 A;  4IUR A;  4BY6 B;  3MP8 A;  4C5H A;  1VQ4 A;  2K4Y A;  4XTU A;  5J3B A;  3SB2 A;  5I2S A;  3SDZ A;  1SSF A;  4C92 A;  3CCQ A;  5FLX E;  4RG8 A;  4DOW A;  2VXE A;  3DB3 A;  2QA4 A;  3JB9 D;  4PJO F;  3CPW S;  2Y4X A;  2RJD A;  3TEE A;  5KE3 A;  1Q86 C;  1N8R U;  2G3R A;  2ZCF B;  4N4H A;  2DTH A;  3PMI A;  3QII A;  4QW2 A;  5FU7 B;  3MP6 A;  2DXU A;  3JCM Q;  1BI2 A;  3JB9 G;  5CAI A;  1H64 1;  3BFM A;  3HP9 A;  1KC8 U;  2FVU A;  4KBM B;  5GAN 5;  4A4F A;  3G71 T;  3CC4 T;  3LX7 A;  3SWN B;  4NOY A;  1JB0 E;  3F70 A;  3LWH A;  3OW2 S;  3CCJ T;  2OTJ T;  4C92 D;  2WSE E;  1HXD A;  2OTL A;  1LJO A;  4BY6 C;  4P5N A;  2K3Y A;  4JDS A;  5GAM f;  4RKU E;  5GMK h;  1QVG S;  4C92 G;  5GAM j;  4OB0 B;  4N4G A;  4M78 G;  4A4G A;  4OB2 B;  1WJQ A;  3RKX A;  1VQ9 T;  5CKB A;  2K3X A;  1Y96 B;  2X4Y A;  3HSB A;  1TH7 A;  1N9R A;  5DM7 R;  1RL2 A;  4C5G A;  2YRV A;  1DJ7 B;  1YHQ A;  2CGH A;  4II1 A;  4M77 G;  4XAX B;  5GAN 4;  3PIO A;  2DJZ A;  3GOX A;  3JB9 H;  4C8Q C;  2VUB A;  3GNF B;  2R57 A;  3E9G A;  3N5B B;  4IUV A;  4QQD A;  3L2Z A;  4X9C A;  2RHX A;  3SWN C;  1VQN T;  5IAY A;  1UGP B;  1N8R C;  2KVQ G;  5LJ5 d;  4QQ6 A;  4MZP A;  3M56 A;  3SD4 A;  1D3B B;  3JCM g;  1OYX A;  2JVV A;  3KBG A;  4XTY A;  3QUI A;  3LW5 E;  1KC8 C;  2L3R A;  2RA2 A;  1NJI U;  5GMK j;  3OS5 A;  4HA8 A;  4XU0 A;  4FT2 A;  4LDY A;  2CKK A;  5CKH A;  4C0G A;  4M7D C;  4V2S A;  1KG1 A;  3HFN A;  2L8D A;  5CKF A;  5LJ3 h;  2O01 E;  5CQY A;  2PVG B;  2RD1 A;  2X4J A;  3JCM c;  4GY5 A;  3V7R A;  3NTI A;  3OYL A;  1YJ9 A;  2JTF A;  1WQW A;  5IN1 A;  3RER A;  3O8V A;  4MDW A;  3C4S A;  2RB6 A;  2E64 A;  1G3S A;  3A8H B;  4OB3 B;  5GAN h;  4M7A G;  3UT1 A;  2RH2 A;  4M78 E;  3CBO A;  5CKE A;  3MP1 A;  2QI2 A;  1VQ6 A;  2GF7 A;  3P8B B;  2LC4 A;  3HL8 A;  4IUP A;  2K57 A;  4O6J A;  3GIB A;  1G5V A;  2E5Q A;  3CCV T;  3M55 A;  1Y7X A;  2EYQ A;  3NTK A;  4M77 E;  2KSS A;  5CR2 A;  5FRO A;  3OYE A;  3S6W A;  2EFI A;  2E1H A;  4BE1 A;  5LJ3 f;  3JB9 F;  3H6Z A;  3ME9 A;  4FT4 A;  1G3Y A;  1WJR A;  4CRI A;  1NJI C;  4MDX A;  4M75 B;  1XTD A;  2GCX A;  5GAN f;  4EMH A;  4RG2 A;  1QVP A;  1UGQ B;  1NPP A;  4C92 F;  4XU2 A;  1YI2 A;  3BDU A;  4M78 F;  3JAM E;  4ZGE B;  1P92 A;  1X6O A;  4ATO A;  2M16 A;  3M58 A;  4OGC A;  2DZ9 A;  2QXF A;  4ZTF A;  1B34 A;  3CME T;  3M4Y A;  1VQM T;  5GMK l;  3R6O A;  3OS2 A;  3WVE B;  4M77 F;  3Q1J A;  1PSE A;  2E12 A;  4M75 A;  1K9M U;  1VQO A;  2XDD A;  4M7A E;  4BUG A;  3L42 A;  1YJN A;  2HD0 A;  3HHT B;  1BI3 A;  5GAM e;  4OB1 B;  1BIB A;  2P0Q A;  5L8R E;  1VQP T;  3RMQ A;  4E7H A;  1QP3 A;  1VQ7 A;  3QZ9 B;  2XDB A;  3L2R A;  1YJW A;  2E6N A;  3X26 B;  3CCM T;  1XQH A;  3CC2 A;  4PJO E;  2QQB A;  4A54 A;  4A53 A;  2VXF A;  4KT0 E;  1VQK A;  3CEY A;  3VYG A;  2ZPB B;  3TCJ A;  2WSF E;  2XDP A;  2KQW A;  3ER0 A;  4M75 D;  2RM4 A;  2ZPF B;  1VQ8 A;  4ZN1 A;  2P0P A;  3A8M B;  2VGN A;  4N4I A;  1XNI A;  1KQ2 A;  3OYM A;  3QSU A;  5FU6 B;  5GAO m;  2X4X A;  4M75 G;  2JOY A;  2LT4 A;  3CCL A;  3QJY A;  4OVA A;  4Z02 A;  1K8A U;  3BW1 A;  2QQA A;  2KMT A;  3V7S A;  1LOJ A;  4EDU A;  5GMK i;  2P0K A;  5GMK e;  3I56 T;  4PNO A;  4M7A F;  4BI3 A;  5CQX A;  4JS4 A;  1Q82 U;  2BKD N;  4FSX A;  3E1S A;  3MEA A;  2P4T A;  3FDR A;  3RMS A;  1K9M C;  1H3Z A;  1M90 U;  4PL6 A;  1ZBX A;  2LRQ A;  4JRP A;  3EFS A;  1VQ5 T;  2CZ6 B;  2JNG A;  1U8R A;  4F7U B;  5CO7 A;  1MHN A;  2ZZD A;  3GLX A;  1GXI E;  5DLO A;  2JN0 A;  3A8G B;  3SFM A;  3FJP A;  3CCU T;  3C95 A;  3E19 A;  5FU6 C;  1I81 A;  3VJP A;  3CBP A;  4C5I A;  4C8Q B;  4XU3 A;  3HPW A;  1MGQ A;  1VQ4 T;  3TU4 K;  2XI9 A;  4FIB A;  3CCQ T;  3V7C A;  3S3N A;  2A7Y A;  2RHU A;  3PFS A;  4NL2 A;  1OZ3 A;  2AHJ B;  3MEV A;  3NTH A;  4N0A A;  3OYJ A;  4BAC A;  4JLG A;  4Y91 A;  2MAM A;  3CC4 A;  4F7U A;  3GF5 A;  4J6W A;  4XQ3 A;  3CCJ A;  2H3J A;  3OS1 A;  5LJ3 e;  1M1K U;  4LD9 K;  3CD6 A;  3J7A F;  4C0Z A;  3C12 A;  4YTL A;  5C0M A;  4R55 A;  4M7D B;  2Y90 A;  3QBY A;  3OS0 A;  3RUX A;  1M8V A;  4IUT A;  4UC4 A;  4XK8 E;  1ZQ1 A;  4M78 C;  1M4Z A;  4A4E A;  4C8Q A;  1M1F A;  2HQX A;  5GAM g;  1Q82 C;  1W2B A;  3SWN A;  3RKW A;  2XD0 A;  2M1H A;  4C0F A;  5GAN e;  5LJ5 h;  3ASK A;  1M90 C;  2CZ0 B;  1KQ1 A;  2EKO A;  2XK0 A;  5GAN 2;  2QEX T;  3CCS A;  3UPU A;  4M77 C;  4XU1 A;  1YCY A;  3L2W A;  3OYD A;  3JCM d;  3J81 E;  1VQ6 T;  4JRI A;  3UWN A;  4C0D B;  3CXC A;  1YIJ T;  2DVE A;  2CYZ B;  4HCZ A;  3OYY A;  2LDM A;  4F7U G;  1Y96 A;  4C8Q D;  4E7I A;  1G3T A;  3GP8 A;  1KD1 U;  1VIE A;  3PMT A;  2MMP A;  5M9O A;  2JZ2 A;  4XTZ A;  2LNV A;  2RO0 A;  3BDL A;  4B9X A;  3A8O B;  5GAO p;  3MEU A;  4M75 F;  4X34 A;  4PJO B;  5LJ5 f;  1UB4 A;  3M53 A;  4ZTJ A;  5KCO A;  5GAO q;  2HBP A;  1M1K C;  2XKO C;  5LJ5 j;  3X20 B;  4M7D D;  1D3B A;  3MCA B;  4DOV A;  1VQL A;  3M54 A;  1AHJ B;  5GAN 7;  3OYB A;  4J5Y A;  4C92 E;  4J8O A;  4C0D C;  1X01 A;  2RHY A;  2DTI A;  2RI5 A;  4QVC A;  2ZGW A;  3JSC A;  5CKD A;  1FX7 A;  1N6A A;  2DD5 A;  3PNW C;  3VUZ A;  1YIT A;  4M7A C;  2F5T X;  4HT9 A;  1UEB A;  3E9F A;  2ZPG B;  5CVI A;  2DAQ A;  3FRN A;  3CC7 T;  4J6Y A;  4ZGJ B;  5HK0 A;  4L5G A;  4O5V A;  4PKC C;  4RMO A;  4PJO C;  5LJ3 j;  2GFA A;  4FU6 A;  5HK3 A;  3CMA A;  3WXM B;  2MI6 A;  1N27 A;  1W2B S;  3KUF A;  1KD1 C;  2HQE A;  3CBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...