4M7AF

Crystal structure of lsm2-8 complex bound to the 3' end sequence of u6 snrna
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
80
structure length
66
Chain Sequence
AILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMNARKLGLTVIRGTILVSLSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 8
structure length 66
sequence length 80
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7aF00
3QO3A 4PJOB 4EMKA 4M7AE 2ZGWA 4OP0A 5GAN7 3INZA 4X9CA 5LJ5d 4RCBA 4PJOD 1KQ2A 1HK9A 2DTIA 2EJGA 3JCMe 3JCMJ 4XTUA 4C8QC 5GMKi 5LJ5j 3BFMA 4F7UG 4M75F 5GAMd 4NOYA 3JB9J 1BIBA 4C8QG 4M77B 5GAN4 1MGQA 2RA2A 5GAMj 4J6XA 4M7DF 4A53A 4C92G 2FB7A 1D3BB 4M77A 4XU3A 5GAMe 5LJ5g 3HFNA 4WF2A 4XU0A 2HNIA 4XTZA 1LNXA 1WPYA 5LJ5f 4M78E 3JB9G 5DY9A 5GAMg 4XU2A 2YHTA 2DZ9A 4M75B 5GAMf 4JLIA 5GAOq 4X9DA 4PJOF 3JB9H 4M75A 4A54A 2FYKA 5LJ5h 5GAN2 1N9SA 1WQWA 2DEQA 4J6YA 4J6WA 2EAYA 4QVCA 2K57A 3V7SA 1I4K1 5GAMh 1I81A 4JRIA 4M77G 4M7AB 2VXEA 2RD1A 2DTHA 2E65A 4RCCA 4JUVA 4M7AD 4Y91A 4PJOA 5GMKj 4M75C 3JCMV 3QUIA 3SWNB 4XTYA 2DZCA 1WNLA 3EFSA 2E64A 3EFRA 4J5YA 4M75G 1X01A 4XQ3A 3SWNA 5LJ5e 3QSUA 4C92C 4M7DC 2DVEA 2VC8A 3RIRA 4M7DG 3V7CA 2RB6A 2Y90A 1Y96B 4F7UE 4EMKC 1LJOA 4C8QE 1D3BA 3V8KA 2E41A 1I5LA 1Y96A 4HT9A 2E1HA 4PJOC 1JRIA 4DQ2A 2VXFA 4M78D 4C92E 3RKWA 4M7AF 2DXUA 3L2ZA 4PJOG 1U1SA 3VU3C 5GAOn 2EJ9A 2JN0A 5LJ3d 3FJPA 5GAOm 3JCMP 3JB9D 3QHSA 5LJ3j 4M77C 1M8VA 2YLBA 5LJ3e 4N0AA 5GAN8 3BY7A 3JCMW 5GAOp 3FB9A 3HFOA 4MMLA 3V7RA 5GAN3 3RUXA 5LJ3g 3RKXA 1B34B 4M7AA 5LJ3f 4M78F 3V8LA 4M77E 4NL2A 1B34A 5GMKe 4MMKA 5GAN6 3JB9F 5GMKm 1WQ7A 5LJ3h 4XU1A 4XTXA 2DXTA 4M75E 1N9RA 1U1TA 3BDUA 3L1AA 4M78B 3JCMb 3PGGA 3JB9I 3JCMQ 2YLCA 4M7AC 4M78A 4C8QD 4M7DE 4M7AG 3BW1A 4M7DD 3RKYA 5GAOl 4PNOA 4XTWA 2DJZA 4C92D 5GMKh 5GAN5 2QTXA 3HSBA 3SWNC 3JCMd 3M4GA 2DKGA 2DTOA 3AHUA 4PJOE 1M5Q1 5GANd 2EJFA 2RM4A 1JBMA 4M78C 5GANj 4F7UF 5GANe 4C8QF 4M78G 3SB2A 3JCMg 1HXDA 2I2LA 3JCMf 4HA8A 4C92F 4M77D 5GANg 3RESA 2CGHA 2EWNA 5GMKl 5GANf 1YCYA 3FIFA 4N0AC 1BIAA 4F7UB 5CAIA 5GAOr 3JCMh 4C8QB 3GIBA 3V8JA 4QVDA 1I8FA 4JRKA 4F7UA 4M75D 1LOJA 3JCMX 4M7DB 4C8QA 1H641 4C92B 1TH7A 5GANh 2E10A 3RERA 4EMGA 4HT8A 4M7DA 1KQ1A 4XTVA 4EMHA 4C92A 5I21A 4V2SA 3JCMc 4EMKB 4NL3A 4M77F
chains in the Genus database with same CATH superfamily
2DRMA 4J9BA 4OP0A 2O9SA 3I55T 3C4SA 1E6HA 5GAMd 2D6FA 1KG1A 5IHIA 2NUZA 2OTJA 2RQRA 4LD6A 1VQKQ 1UEBA 3SDZA 1EFNA 2QQBA 2EFIA 2RK1A 2XK0A 4IKFA 1NE8A 1EZZB 4JLGA 2C06A 4K11A 2RQWA 6AT1B 2E65A 3CCVT 4JS4A 4ATOA 1Y71A 4IUTA 4PJOA 2RQVA 1D1AA 4E2FB 3SWNB 3EFRA 1HYOA 1UGVA 2EQMA 5KYWA 1MV0B 1SPKA 4KGXB 2OX7A 2E1HA 1PRLC 4PFPA 2JJ9A 1VQ5T 3JB9D 3G71T 5LJ3j 2C0TA 2L8DA 2CREA 2MAMA 3RKXA 3IQLA 1B34B 3KBGA 2DBMA 2F1LA 1ZSZB 3OSSC 4KRTA 5KYXA 5GMKm 4L5GA 2IG0A 4XU1A 4C5HA 5KH6A 3EG1A 2EYQA 1WHKA 5I11A 2F2VA 5GMKh 3M0UA 9ATCB 3G4SQ 2DKGA 2M0OA 1HJDA 2XHCA 2E6ZA 2RO0A 4PJMA 1SHGA 4AFUC 2EQIA 1OPKA 3LWIA 2IVWA 1SSFA 3JCMh 3V8JA 1I8FA 5M9OA 2ROLA 2FVUA 2PNIA 1T0HA 1QKXA 4EMKA 1QMCA 4OMFB 4PJOD 3THKA 1V1CA 3BFMA 4M75F 2AIRB 2JNGA 2RHXA 4PFOA 2K6DA 4FYYB 3REBB 1NEGA 1BB9A 2BE7D 2BZXA 1ABOA 3I5RA 2BZ8A 2XDDA 3CMAQ 1IZ6A 5FROA 1K8AU 2KAFA 4OMLA 1UGQB 2RJFA 5GAMh 4JRIA 3NTHA 2VXEA 2JM9A 2HL3A 3QBYA 2Y4YA 2KQWA 3GF5A 5LJ5e 4M7DC 5CVIA 5CCAA 1S72Q 1CSKA 1BCOA 2ED0A 2K3XA 4C8QE 2QA4Q 1Y96A 2KR3A 4KGVB 3FC3A 1G8XA 2HQXA 3MP8A 5LJ3d 4PJNA 4KBMB 1YHQT 2ZPEB 1IB8A 3M56A 3QHSA 2XI9A 3X26B 4ZN1A 3I56T 2QK0A 3RNJA 5CKEA 1IXDA 5C6SA 3LLRA 3C94A 4YTLA 1FMKA 2CYZB 4FT2A 3CD6Q 1MUZA 1UG1A 3JB9I 5KYUB 3JSCA 2O4XB 1N8RC 1XQHA 2QTXA 5CQYA 4R0KA 3LH5A 2YUNA 5FRNA 8AT1B 1Q95G 1MNDA 3J81E 2VWFA 1VQOA 4MZTA 4LN2A 3URGA 4PKCC 1TUCA 2P4TA 3VYGA 2QQAA 4BI8B 2DD5A 4QW2A 3CQTA 1YJ9A 4QVDA 2K3YA 4BD3A 4F7UA 3PT9A 5CO7A 1ARKA 2VASA 2KI7A 2YT6A 2KT1A 1VQKT 4M77F 3QO3A 2HQHA 1AOJA 4AG2C 1GRIA 3O8VA 5IXFA 5KYNA 3E2UA 4GBQA 5LJ5j 1JJ2P 2D9TA 3TSZA 3OBWA 2K5LA 3KXTA 1YITA 3M0PA 1KQSP 3EHRA 1G3TA 3X24B 2FYKA 1WXTA 2KK4A 3LW5E 2JTEA 1N9SA 1NPRA 4J6YA 1D0XA 2HEQA 2R58A 4QQ6A 4X1VA 3E19A 3HKSA 3QWXX 4BE2A 1KC8R 3VRYA 2XDPA 2PVGB 1J3TA 2MWOA 2VV5A 4FYWB 4KT0E 2DAQA 4AT1B 2O88A 1WHMA 1Q7YC 4GY5A 3I56A 4AFQC 4PJOG 1NLPC 1YCSB 2FZCB 1BI3A 2ZCFB 2J6KA 5GAN8 3TCJA 1RADB 2W0ZA 5D6WA 1VQ6A 2K5IA 3VS3A 1VQMT 3QKJA 2NLUA 5FU6C 1GFCA 2DYIA 4RMOA 4LUEA 5J3BA 3CC4A 5LJ3h 4MDXA 4UC4A 3META 3R6NA 3CEYA 1D0YA 3OS0A 3JV3A 1GFDA 4XTWA 3CCRQ 3M4GA 1UJYA 2LP5A 2QGFB 1WYXA 2LCCA 2P4RA 1M3AA 3QZ5B 1PM3A 4HA8A 4O5VA 1O9SA 2CGHA 3NHNA 3QYHB 2AHJB 2PTKA 4C8QB 1VQ7A 2COYA 2DL7A 3CCET 2CZ6B 2LQWA 4J9GA 4X9CA 5LJ5d 3CMEA 4M4ZA 5GMKi 5CKHA 2RF0A 4NOYA 4CC3A 3M55A 5I2SA 2MWPA 1AEYA 3SHWA 2X4XA 1TOVA 1AT1B 2BIVA 2RJEA 5GAN2 2OTLQ 4J6WA 3CBPA 1S72T 1ZSGA 3NGPA 3CCUA 2RQTA 2QA4T 1QVPA 2QG9B 2RD1A 4OMOA 5J26A 3VS4A 1ZUUA 4OMNA 2QQ9A 1U8RA 2DETA 2HBPA 1WNLA 3SWNA 4MZMA 4AFSC 3V8KA 3S3MA 1T0JA 2O9VA 1G3WA 2VXFA 2CSQA 1U1SA 2BUDA 3CD6T 2M02A 1VQMA 4A4GA 2XICA 1UDLA 5KYYB 1QWFA 2GF7A 4PJJA 3PMTA 1UE9A 4FW2A 1B34A 3CC7Q 4CC4B 3CXCP 2RK2A 1AD5A 2R57A 1ZSZA 2CT3A 3EG9B 4M75E 4ZN3A 1VQ4A 2DL5A 2QYZA 2C0OA 1OI1A 1Y07A 2JS0A 3CBMA 1M90C 2RHZA 4CI0C 2LNHB 2P0KA 3VJPA 3LGLA 4FL6A 5GANj 2K79A 2XDBA 2JS2A 3JCMg 4OMMA 4JJNK 4C92F 1I0CA 4JJCA 4HCBA 4BE1A 2O2OA 3QDRB 1WA7A 3CCEA 1W2BP 4J83A 1BIAA 3OW2P 1N27A 1UFFA 4RTUA 5D7UA 4LDUA 2EGAA 4NS5A 2YSQA 5C0MA 4ZGJB 1MMGA 4Z89A 3J80E 2MIOA 3M0RA 4F7UG 2QAZA 1VIEA 2MOXA 2EGEA 2O31A 1VQLA 1M30A 2BZYA 2HNIA 4DOVA 3MHXA 3OY9A 2D8HA 5DY9A 5GAMg 1Y57A 1I5OB 5LJ5h 1M2VB 2MMPA 1YI2Q 3TVTA 1OX9A 4OB2B 4E7HA 1KHCA 2DZCA 4FW1A 4BACA 5DLOA 4M7DG 3OYNA 2D8JA 4O6JA 1Z9ZA 3CC2Q 3EGUA 1FMWA 4R56A 1N8RR 2QDYB 1Q86C 3PFSA 3T9NA 3FJPA 2L0AA 1M8VA 2EQUA 3UATA 1N8RU 5EC7A 2A3LA 3C95A 3S6WA 1PHTA 4M77E 2E3HA 1VQPQ 3VUZA 2E12A 1PG5B 4DBRA 1BI1A 1N9RA 4FIBA 3VS7A 2EQJA 4LNPA 1QVFP 3QJYA 1JO8A 3DLMA 2O4XA 3VV0A 1SRMA 3H0IA 5GANd 1BI0A 2A36A 1WJQA 3M59A 2XD0A 2JVVA 4DA4A 1RAFB 3VKIA 1VYTA 1BU1A 2DNUA 5GMKl 1RLPC 1YCYA 1YWOA 1AWWA 3CCQQ 1KIKA 3CCJQ 2QEXT 2ATCB 2L3RA 3FJ5A 1PC0A 3RERA 1BI2A 1KQ1A 3R6OA 1V29B 2OAWA 4PFZA 5GAN7 3DB3A 2KY9A 3FLGA 4RCBA 2E70A 4L6V5 2K2VA 4C8QC 2OTLT 4MDWA 1M8MA 2R5AA 4E7KA 1NJIC 2FB7A 1D3BB 2KNBB 4XU3A 1PKTA 1KJWA 4M75B 3MPUB 2D0NA 2MPXC 3OMCA 2V1RA 1Q7YU 5AYFA 2COWA 2X3WD 3M57A 4KUDK 4M7AB 2X4WA 3CCMA 2AZSA 4F04B 3OB9A 5I22A 3OSVA 3HRSA 2VVKA 2H8HA 2RI3A 2EKOA 3LGFA 3QXEB 4QVZA 4EMKC 4RTZA 2FPFA 3MJXA 4HT9A 1FMVA 2RNAA 3CC7T 1M1GA 3OYJA 4JJBA 1ZUYA 3FEOA 4IUVA 3MO8A 2NUTB 1QWEA 4RG8A 3KFVA 2VKNA 5LJ3g 1YFNA 3MEVA 4J9DA 3V8LA 1TUDA 1W4SA 2DEUA 1B7TA 5D6YA 3CCSA 2LX7A 2WSEE 2LMJA 1VOMA 2DJZA 1DJ7B 2D1XA 1JB0E 3NPFA 1IREB 1JU5C 2B8AA 2JM8A 5DLQE 1X69A 1TU0B 2QEXA 1RI0A 1W6XA 1ACMB 4BE0A 1YJWT 4C8QA 5GANh 3M0SA 1WZOA 3C12A 1H3HA 3PNWC 4D8DA 1FXXA 3M54A 3L2QA 2X4JA 1KQ2A 1M3CA 1YJNA 3MEWA 1PNJA 3VYHB 1YI2T 4M77B 1JJ2S 1X27A 1TUGB 3EG0A 2HQEA 4RTXA 2A7YA 5I2MA 1HD3A 3CPFA 4OVAA 2PVDB 3CPWP 1NYFA 4KUIA 2QQRA 1YWPA 1WQWA 3I55A 5HKCA 3WVDB 2DX1A 1JJ2A 3PVLA 1CKAA 3V7CA 2KSSA 1LJOA 3HRTA 3QG1A 5A0GA 1M90R 3G7ZA 1Y0MA 1KQSA 4MZPA 4C92E 4M7AF 1X2KA 2L3PA 1VQPT 3MCAB 2QDLA 1VYUA 2CZ7B 2H3JA 5GAOn 5GAOm 3CCVA 2CKKA 4HCCA 3QZ9B 2NUPB 1FX7A 2FG0A 4N0AA 4Q5WA 3HFOA 4JZ3A 5KYYA 3OYIA 2E5KA 4M78F 2AK5A 4MMKA 1WDXA 2KDSA 1WHJA 5GAN6 1VQ5A 3G71A 3ME9A 4C8QD 1W70A 4DBHA 2K3BA 3G6EQ 4TVRA 4RUGA 3CCQT 1H8KA 1VQNT 2VB6A 3CCJT 2Y4XA 2VUBA 1YJWA 2CP3A 3UWNA 2HKNA 2YDLA 4F17A 3OYLA 1YIJQ 5CAIA 3VRZA 2LVMA 3C0CA 2PVOB 1H641 3D7SB 1QQJA 2OAUA 4KH1B 5CK9A 3TREA 4A4FA 3CCLQ 2PUKB 4J9CA 2ESWA 5AT1B 3H6ZA 1RAAB 3AT1B 1AHJB 4GLKA 3I35A 2DTIA 4C5IA 4AG1C 3L2UA 5GAN4 1NZ9A 3M0QA 4A53A 5LJ5g 4HXJA 1YN8A 2I0NA 4ZGDB 1XOVA 1WPYA 4FU6A 1Q86R 1M1KC 3JB9G 4KULA 4X9DA 2GQVA 1WJSA 1BBZA 3U23A 1BKBA 1Q86U 1M2VA 2EAYA 5HK3A 2G6FX 2DTHA 2NYSA 1UB4A 4M75C 2RMOA 3EFSA 2P84A 2D0QB 4J5YA 1Z9QA 3NFCA 3UF4A 2DVEA 2VC8A 4IURA 4EPCA 2CP5A 1JRIA 4DQ2A 1ZX6A 2F2WA 3VU3C 2EJ9A 4A4EA 4E7IA 3L42A 2LCSA 2VGMA 2M16A 2EKHA 3V7RA 3OYGA 5DM7R 2LRQA 1WLPB 3HTRA 3UA7A 3VS1A 4FT4A 3WVEB 4ELYC 1ZA2B 1YHQA 3BDUA 1ZA1B 1KC8U 3JCMQ 2ZZDA 4II1A 1VQNA 2LQ8A 4RKUE 3RKYA 5FRMA 4FYVB 3HSBA 3SWNC 5IHKA 1LPLA 4LDVA 2IPOB 4KH0B 3RR6A 2DERA 1JBMA 1A0NB 1NJIR 3G1JA 5FLXE 3SB2A 3VS5A 1D1BA 2I2LA 1VQ8Q 3G4ST 3A8LB 4ZTFA 3N5BB 4OB1B 4JZ4A 1NJIU 2DILA 4RTVA 1MV3A 5LL6S 1ZHIA 4CRIA 1K0XA 1G3SA 4C92B 4EMGA 3OYBA 2R5MA 4N4GA 2KT8A 3OYKA 1ZSZC 2EGCA 4PJOB 3UT1A 2JTMA 2L3QA 3NTKA 4DEYA 1IGQA 2OTJQ 4C8QG 1RABB 4XTZA 1W2BA 4J9IA 2ECZA 2CP2A 4JS5A 4F16A 1VQKA 2YXYA 4FM4B 3ZL7C 4M75A 4A54A 4FSXA 4J8OA 2PU9B 1H3ZA 2LX9A 3PVQA 2HKQB 4ME7A 1FYNA 2AKLA 4ORZA 1T3SA 3CMAT 2RJDA 3GP8A 5L23A 1LVKA 1I1JA 2AZVA 4JPBW 1X01A 3QSUA 4EDUA 1Q81R 2ZPGB 2DRKA 3RDVA 1EIFA 3RKWA 2DXUA 2CP6A 3GNGA 5ECAA 3PTAA 2CP0A 4BY6B 4F14A 5IAYA 5HY6A 4JDSA 2NUTA 2GFAA 2KXCA 2C0IA 4IUPA 3JRZA 3G6ET 5FU7B 5GMKe 4OGCA 2PZ1A 3LWHA 3JB9F 4B6MA 4XTXA 1WXUA 3HP9A 5HCKA 1BCMA 2E5QA 3M4YA 4N4HA 1K9MR 3BW1A 1OU8A 3OS2A 4PL6A 4C5GA 2CT4A 2V8KA 4E7ZA 1YIJT 2L2PA 3OYMA 2CUDA 3G4SA 4DOWA 2RH2A 3QWYA 3CCLT 3JCMf 4C0DB 5GANg 1QVGS 4HCKA 3L2RA 2MI6A 5GAOr 2KRNA 2BE9B 4M75D 1LCKA 1ZBJA 2DBKA 2LDMA 4M7AE 2E3IA 3H9NA 7AT1B 2AT1B 3QYGB 2X9HA 1BIBA 1QVGA 1KHIA 3EHQA 4M77A 5GAMe 4JJDA 3HFNA 1CKBA 1OULA 4M78E 1UGSB 1MMDA 5GAMf 2DXCA 3LYIA 4PJOF 2CUBA 3JB9H 1MHNA 1X75C 3NTIA 4PLIA 3CMAA 1UGRB 2V8IA 1I81A 2GTJA 3FRNA 1G83A 3H0HA 4LDWA 3ULRB 4RCCA 2SRCA 2DL4A 5GMKj 2PUOB 3X28B 5IXBA 2CH4W 2RB6A 1AZGB 1S72A 4IUQA 3HL8A 2QA4A 4IIMA 1HSQA 2XMFA 5FWCA 3VS6A 4QKUA 3EGDB 1GCQA 1QCNA 4QT7A 2YLBA 5CR2A 5GAOp 2NUPA 1OV3A 3H8ZA 2DJQA 2JT4A 2CH4A 1GXIE 4C0ZA 2DL3A 2BKDN 2IIMA 4AFZC 2F2XA 1N6AA 5L8RE 2JW4A 2K5FA 1UGPB 3CD6A 3HHTB 3M5AA 1VQ8T 3LX7A 1SF9A 5GAN5 3NMZC 1PD1A 1WXBA 1X2QA 3EH1A 4PLLA 4B9XA 2OJ2A 1RAGB 3EFOB 1VQOQ 4LUDA 3BDLA 3EG3A 1M1KR 1E7OA 3CCRT 2HAXA 2YWWA 4M77D 5KCOA 2X51A 1YJ9Q 4JRPA 4FSSA 3KUFA 2FZKB 3GIBA 1WI7A 1NG2A 5A2QE 1M1KU 2OTJT 4M7DB 2YUQA 1SRLA 3JCMc 5KYUA 2HCKA 2PQWA 1OPLA 1WFWA 3EG2A 4Y28E 3OS1A 1YITQ 4XAXB 1ZQ1A 2GFUA 3REAB 4BI4A 1VA7A 1G5VA 4WTOB 3TQ7P 3L2VA 3MEUA 1OEBA 1KD1C 1K4US 1AWOA 1F1BB 1T3LA 1NM7A 3A8MB 4ANJA 2FL7A 4JUVA 2FPDA 4E47A 2XU8A 4LDYA 2GBQA 2KEAA 2E64A 4M75G 1AVZC 2XKOC 3RIRA 3RMSA 3JAME 2CDTA 3QIIA 3QDFA 3OYCA 4CC2A 1AWXA 2M1HA 1U06A 2MCNA 1VIFA 5LJ3e 1VQ6Q 3E9FA 1R0CB 2FPEA 3ER0A 3BY7A 1NLOC 2JUFA 2Z0WA 5LJ3f 1ZUKA 2RHIA 4WCIA 3ZFJA 4L59A 3CC4Q 4A4HA 3ASKA 1QCOA 1TTHB 1SEMA 4M78B 3PIOA 3CBOA 4BDZA 2EVRA 3DKMA 2A28A 3M53A 5GAOl 2X35A 1C1AA 2H3EB 1JQQA 3CCRA 1X6OA 2RHUA 3VS0A 2EJFA 1BK2A 4OB0B 1PCXA 2EW3A 3LH0A 4F7UF 1SG5A 2X3XD 4Z88A 4RTWA 1GBQA 1UECA 2EPDA 2B86A 4N0AC 1VQ7Q 2QI2A 4JRKA 1UJ0A 1Q81C 1K9AA 2LQNA 4XTVA 1S1NA 4C92A 1M4ZA 4NL3A 3JCMV 3CMEQ 4C0DC 2L5QA 4C5EA 2HD0A 2EYZA 1HK9A 4XTUA 1SKUB 2BTTA 3MP6A 3L2WA 1IO6A 4J6XA 4M7DF 2RHYA 1LNXA 4ZGEB 1VQ9Q 2CP7A 1RAHB 2RI5A 5FU6B 2E4HA 3CCUQ 2QASA 4DBFA 1RAEB 2EIFA 3V7SA 1I4K1 2XIDA 4M77G 2OTLA 1K9MC 2DM1A 1VUBA 4PJLA 4JRQA 4OB3B 4BB7A 3Q1JA 3P8HA 1Q82C 1K0SA 1UHFA 1UTIA 5CKDA 1I07A 1KSWA 2E41A 1N5ZA 2KRMA 1GL5A 3UDCA 2M0YA 2L3SA 1VQMQ 2OI3A 3JCMP 1KQSS 4RTYA 3OYHA 4GLMA 1TSFA 2DL8A 1D09B 3OYAA 3PIPA 1SHFA 3A8OB 1OQKA 2KROA 3CC2T 4MMLA 2V1QA 3BE3A 2E6NA 1OU9A 2J05A 2VYTA 1B3QA 1VQ4Q 3CC7A 1G2BA 1RI9A 2DA9A 1VQOT 1WIEA 4HCZA 4C92D 1R77A 1YJ9T 1PWTA 2V26A 3AHUA 2DTOA 1M90U 4B9WA 4PJOE 3I9QA 3OYEA 2A37A 1HXDA 4DBQA 1QP2A 3M0TA 1KFZA 3CCEQ 1SSHA 4OMQA 3RESA 1K8AR 1M27C 4P5NA 3FIFA 1MNEA 4PK4A 3A98A 2LNVA 3EG9A 2CZ0B 4KGZB 1YITT 1YP5A 2QQSA 2XG8D 2JOYA 5KE2A 1PKSA 1VYVA 4VUBA 1YBYA 2V8JA 1VQLQ 5CQXA 4LE9A 1C6VX 2RA2A 4CC7A 4BI3A 4WF2A 5LJ5f 3E1SA 4XU2A 3O5ZA 5GAOq 4X34A 2J7IA 3ZEHA 2DEQA 2GGRA 2K57A 2JTFA 3J7AF 1YI2A 2RI2A 2KGTA 2GNCA 4OGEA 2DLPA 2FHDA 3QUIA 4XTYA 1VQ6T 1E6GA 4BDYA 2GQIA 1M3BA 2YRVA 3CC4T 3CC2A 3EGDA 2ZPFB 1GBRA 3VUBA 5CKFA 3EGXB 2EBPA 1VQPA 1WHGA 2K4YA 1UUEA 2MF2A 4M7AC 2YLCA 4XK8E 4Z8AA 4IIOA 1OZ2A 2ABLA 3EH2A 3I5SA 1VQ7T 3A5ZB 2EYWA 2J06A 2RQUA 4M78C 3EFOA 3GBQA 4E7LA 3VS2A 1ABQA 3CMET 3CXCS 3A1PA 4N4IA 1U3OA 2LJ1A 1G3YA 5IT9E 1KD1R 3H0FA 2W10A 3CCQA 3CCJA 2E10A 4M7DA 2A0FB 2FZGB 4ZTJA 1PSEA 2K7AA 1VQ9T 1KD1U 2EYXA 4LD9K 3JCMJ 1OZ3A 3CCUT 1XJWB 4J7IA 3JB9J 2MYSA 1WGSA 3CXCA 2EQKA 3GOXA 1K73C 3TSWA 4C92G 4E6RA 1TXQA 2JZ2A 1W2BS 3OW2S 2FRWA 4FYXB 4D6WA 4QVCA 3CCMQ 3E9GA 3OQ5A 2RJCA 4DEXA 1AWJA 4HKEA 2KMTA 1WHLA 2DE0X 4ELZC 4Y92A 2K9GA 5KYWB 1AZEA 1QW1A 2JMCA 2F5TX 2FRYA 2SEMA 2YUPA 4F7UE 2EYYA 1D3BA 1V76A 3OW2A 1X43A 4A4KA 1WHHA 1OYXA 2GCXA 2HMAA 2QTVA 4C0GA 1KK7A 1NEBA 1VQ4T 3HRUA 4LXCA 4M77C 2KBTA 3EAEA 1RLQC 2DXBA 2O01E 3FB9A 3RUXA 5J39A 4M7AA 1PRMC 2WSCE 2ZAEA 2HBWA 2CSIA 5KYXB 3CCSQ 5KE3A 3UA6A 1P92A 3GNFB 1M2OA 4RG2A 3P8BB 1JXMA 2DXTA 1U1TA 3OMGA 2JMAA 5IH2A 3PGGA 2HL5C 4M78A 4M7DE 5A0DA 4M7DD 4PNOA 2DO3A 1Q81U 2YRDA 3X20B 3RMQA 1M5Q1 1PSFA 2RM4A 4Z02A 1R8OB 2QEXQ 4HVUA 5GANe 4C0FA 4R55A 3S3NA 1GCQC 3A8HB 5GANf 1K1ZA 3GLXA 2F69A 2A08A 1VQLT 1VQ9A 1PD0A 2ZPIB 4ZNXA 4HT8A 4A63B 4EMHA 5I21A 1M9SA 2MK5A 1QCFA 3OBYA 4EMKB 2DFUA 2YUOA 2LT4A 1QVFS 3P8DA 2ZGWA 1YJNQ 4FCYA 3INZA 1TG0A 1Q82R 3JCMe 1K9MU 2KRSA 1RUWA 1TWBA 4E7SA 5FWBA 1H92A 1C0MA 1ZBXA 4XU0A 1Q82U 1RAIB 2COZA 4EIKA 5CIUA 1IRXA 2KYBA 3I55Q 1U5SA 3MP1A 3S3OA 1QVFA 5HK0A 1IHVA 2HDAA 4OMPA 3M58A 4J9EA 2G3RA 1XTDA 4M7AD 3QPHA 2KXDA 3OYDA 2Y90A 1Y96B 1XNIA 3PE0A 1MMNA 1JEGA 1K8AC 3H41A 4M78D 3CCVQ 1NBEB 5KCHA 2F5KA 4QQDA 3L2ZA 1WX6A 2JN0A 4IUUA 1X6BA 2RPNA 1YNZA 1D1CA 2LZ6B 1JXOA 3A8GB 2GTOA 3WXMB 1W1FA 1RL2A 3SEMA 3TU4K 1VQ5Q 1OX8A 3G71Q 1QLYA 2LTOA 2J6FA 2JXBA 4BUGA 2RN8A 2DIQA 3GPLA 4ESRA 3G6EA 4RTTA 3OYYA 2L89A 2DK3A 5IHNA 4J9FA 1YJWQ 4C8QF 1TS9A 2EWNA 3DB4A 1NYGA 5FW9A 4F7UB 1BYMA 1NPPA 3MKDA 1YIJA 3UPUA 2ED1A 2WSFE 2M51A 1TH7A 3TEEA 4LDXA 2CS7A 1B07A 5GJVB 2QXFA 5EG2A 3CCLA 3MEAA 2LC4A 2EJGA 1FWZA 3SFMA 1O75A 2DF6A 3CCMT 2ROTA 1IGUA 1MGQA 5GAMj 2LCLA 3SD4A 2FEIA 1WJRA 2P0PA 3M9QA 3X25B 2YHTA 2DZ9A 2VGNA 4JLIA 5CKBA 5IN1A 2WACA 2J6OA 3PMIA 2NWMA 2LJ3A 3F70A 5GJWB 2DD4A 5A0LA 8ATCB 4QQGA 4Y91A 1X6GA 1QP3A 2CZ1B 4XQ3A 4C92C 4J7FA 3DLLA 1I5LA 1IHWA 4PJOC 2FO0A 1M1FA 3CCST 2KYMA 2HZYA 2ZPBB 2ENMA 2ZPHB 3CPWS 2DPPB 1OOTA 2LJ0A 2KVQG 3JCMW 3ZBDA 5GAN3 2DMOA 2LT1A 1RACB 4NL2A 4HVWA 1QVGP 3QJ6A 1KC8C 3EGXA 4HVVA 2HSEB 2LQKA 1YHQQ 2DYBA 3OYFA 1GCPA 4J9HA 1D0ZA 1WQ7A 3OS5A 2AKKA 1QKWA 1VQNQ 3I56Q 3L1AA 3JCMb 2M9UA 3CPWA 3HPWA 4M7AG 1ZLMA 2YRCA 4AMCA 3OA6A 2QGGA 3JCMd 1MMAA 2K2MA 2DIGA 4E7JA 1K73R 3FDRA 1EX4A 4M78G 1R0BG 2KE9A 4OF1A 1Q7YR 3RBBB 1YJNT 1VQ8A 2DVJA 1K73U 4BY6C 2P0QA 1UHCA 3JCMX 1LOJA 5D6XA 2X4YA 2HSPA 4D8KA 4V2SA 1K76A 5FU7C 1Y7XA
chains in the Genus database with same CATH topology
4ZGJB 4VUBA 4PJOB 3UT1A 3J80E 2JTMA 4OP0A 1YBYA 3I55T 2V8JA 3C4SA 3NTKA 4F7UG 5CQXA 5GAMd 1VIEA 2D6FA 1KG1A 4C8QG 2RA2A 1VQLA 2OTJA 4BI3A 4LD6A 4WF2A 5LJ5f 2HNIA 4XTZA 4DOVA 3MHXA 3OY9A 1W2BA 5DY9A 1UEBA 3E1SA 3SDZA 5GAMg 4XU2A 4JS5A 2QQBA 2RK1A 2EFIA 2XK0A 4X34A 5GAOq 1VQKA 4FM4B 4IKFA 1NE8A 4M75A 4FSXA 4J8OA 4A54A 4JLGA 2PU9B 5LJ5h 2C06A 3ZEHA 1H3ZA 2LX9A 2DEQA 2MMPA 2K57A 4ME7A 2JTFA 3J7AF 1YI2A 2RI2A 2E65A 3CCVT 4OB2B 4E7HA 4JS4A 4ATOA 1Y71A 4IUTA 2RJDA 3CMAT 4OGEA 3GP8A 4PJOA 1KHCA 2FHDA 3QUIA 3SWNB 4XTYA 2DZCA 4BACA 3EFRA 1X01A 3QSUA 4EDUA 1VQ6T 5DLOA 4M7DG 3OYNA 2EQMA 2ZPGB 4BDYA 1EIFA 4O6JA 2E1HA 4R56A 2YRVA 2QDYB 1Q86C 3RKWA 2DXUA 3PFSA 3T9NA 3CC4T 3CC2A 3FJPA 3GNGA 1VQ5T 3PTAA 3JB9D 3G71T 5LJ3j 4BY6B 5IAYA 1M8VA 2EQUA 5HY6A 4JDSA 2L8DA 1N8RU 2ZPFB 2GFAA 2MAMA 2A3LA 3C95A 3RKXA 3S6WA 1B34B 3VUBA 4IUPA 3KBGA 3JRZA 4M77E 5CKFA 5FU7B 3G6ET 5GMKe 4OGCA 3VUZA 3LWHA 2E12A 3OSSC 3JB9F 5GMKm 1VQPA 4L5GA 1BI1A 2IG0A 4XU1A 4XTXA 4C5HA 1N9RA 5KH6A 4FIBA 3HP9A 2EYQA 2K4YA 2E5QA 2MF2A 4M7AC 2YLCA 3M4YA 4N4HA 4XK8E 2EQJA 3BW1A 3OS2A 3QJYA 5GMKh 4PL6A 3DLMA 4C5GA 2V8KA 1OZ2A 2O4XA 3VV0A 1YIJT 2DKGA 1VQ7T 3A5ZB 2M0OA 5GANd 3OYMA 1BI0A 2XHCA 3G4SA 2E6ZA 4DOWA 1WJQA 3M59A 4M78C 2RO0A 2RH2A 2XD0A 4E7LA 3CCLT 2JVVA 3JCMf 4DA4A 3VKIA 3CMET 4C0DB 5GANg 5GMKl 1QVGS 1YCYA 3LWIA 3CXCS 4N4IA 3L2RA 2IVWA 2MI6A 1SSFA 1G3YA 5GAOr 3JCMh 5IT9E 3V8JA 1I8FA 2QEXT 4M75D 5M9OA 2L3RA 3CCQA 3CCJA 2E10A 3RERA 1BI2A 1KQ1A 2FVUA 4M7DA 3R6OA 4ZTJA 2LDMA 1PSEA 1V29B 1VQ9T 4EMKA 1KD1U 4M7AE 5GAN7 4LD9K 3DB3A 2KY9A 4OMFB 3FLGA 4RCBA 2E70A 4PJOD 3JCMJ 4L6V5 1OZ3A 2K2VA 3QYGB 4C8QC 3BFMA 3CCUT 4M75F 2JNGA 2OTLT 2RHXA 4J7IA 1BIBA 3JB9J 4MDWA 1WGSA 1KHIA 1QVGA 2R5AA 4E7KA 3CXCA 2EQKA 3GOXA 1K73C 4C92G 2FB7A 1D3BB 4M77A 4XU3A 5GAMe 1NJIC 3HFNA 4M78E 1UGSB 4M75B 5GAMf 2XDDA 2DXCA 2JZ2A 3LYIA 4PJOF 3JB9H 1W2BS 3OMCA 1MHNA 3OW2S 1X75C 3NTIA 1IZ6A 4PLIA 1Q7YU 3CMAA 5FROA 5AYFA 1K8AU 3M57A 1UGRB 2KAFA 4KUDK 4D6WA 2V8IA 4QVCA 1UGQB 2RJFA 3E9GA 3OQ5A 2RJCA 1I81A 5GAMh 4JRIA 3FRNA 3NTHA 2VXEA 2X4WA 3QBYA 4LDWA 4M7AB 2Y4YA 3CCMA 4RCCA 3OB9A 3OSVA 3HRSA 4HKEA 2KQWA 2PUOB 5GMKj 3GF5A 2KMTA 3X28B 5LJ5e 4M7DC 2RI3A 4ELZC 5CVIA 2EKOA 1QW1A 5CCAA 2F5TX 3LGFA 2RB6A 2K3XA 1M1KC 4F7UE 3QXEB 4QVZA 4EMKC 4C8QE 1D3BA 1S72A 1Y96A 3OW2A 4IUQA 4HT9A 4A4KA 3HL8A 1OYXA 2QA4A 3CC7T 2GCXA 3FC3A 2HQXA 3MP8A 1M1GA 4C0GA 5LJ3d 1VQ4T 3OYJA 4KBMB 1YHQT 2ZPEB 3HRUA 3M56A 3QHSA 2XI9A 3FEOA 4IUVA 4M77C 3MO8A 3X26B 3EAEA 2YLBA 4ZN1A 5CR2A 2DXBA 3I56T 2O01E 4RG8A 5GAOp 3FB9A 3H8ZA 5CKEA 3RUXA 5J39A 5LJ3g 4M7AA 2WSCE 3MEVA 1GXIE 3V8LA 5C6SA 3LLRA 4C0ZA 1W4SA 3C94A 4YTLA 2CYZB 5KE3A 2BKDN 5D6YA 4FT2A 1N6AA 1P92A 3GNFB 5L8RE 3CCSA 2K5FA 4RG2A 3P8BB 2DXTA 1UGPB 2WSEE 1U1TA 3OMGA 3CD6A 3HHTB 3PGGA 3JB9I 4M78A 4M7DE 5A0DA 3M5AA 4M7DD 1VQ8T 3JSCA 3LX7A 4PNOA 2DJZA 5GAN5 1DJ7B 2DO3A 1XQHA 2O4XB 2QTXA 1N8RC 5CQYA 1Q81U 4PLLA 4B9XA 3X20B 3RMQA 1M5Q1 5FRNA 1PSFA 1JB0E 2RM4A 4Z02A 1IREB 1R8OB 5GANe 2B8AA 3BDLA 5DLQE 3J81E 1VQOA 4C0FA 4MZTA 4R55A 3CCRT 2QEXA 3S3NA 2HAXA 1RI0A 3URGA 4M77D 4PKCC 3A8HB 5GANf 5KCOA 2P4TA 3VYGA 2QQAA 4BI8B 2DD5A 3GLXA 4JRPA 3KUFA 4QW2A 4BE0A 1YJWT 1YJ9A 2F69A 3GIBA 5A2QE 1VQLT 4QVDA 2K3YA 4BD3A 4F7UA 1M1KU 1VQ9A 4M7DB 2OTJT 4C8QA 2ZPIB 5GANh 3PT9A 5CO7A 4HT8A 4EMHA 5I21A 1M9SA 3C12A 3JCMc 3OBYA 4EMKB 1VQKT 4M77F 2LT4A 2PQWA 3P8DA 3PNWC 1FXXA 3QO3A 1QVFS 2ZGWA 3M54A 3INZA 3L2QA 2X4JA 1KQ2A 3JCMe 1K9MU 3O8VA 3MEWA 5LJ5j 1YJNA 4Y28E 2D9TA 3OS1A 3VYHB 1YI2T 4M77B 1JJ2S 4XAXB 1ZQ1A 2HQEA 2GFUA 1ZBXA 3OBWA 2A7YA 2K5LA 4XU0A 3KXTA 1YITA 1Q82U 4BI4A 5I2MA 1G5VA 3CPFA 5CIUA 1G3TA 2PVDB 4OVAA 3X24B 3L2VA 2FYKA 3MEUA 4KUIA 2KK4A 3LW5E 2QQRA 3MP1A 3S3OA 1N9SA 1NPRA 1WQWA 4J6YA 2R58A 5HK0A 3I55A 1KD1C 1QVFA 5HKCA 4QQ6A 3A8MB 3E19A 3M58A 2FL7A 3HKSA 2G3RA 4BE2A 3WVDB 4JUVA 1XTDA 4M7AD 4E47A 2XU8A 1JJ2A 2XDPA 2PVGB 3QPHA 2MWOA 4LDYA 2VV5A 4M75G 2E64A 4KT0E 2XKOC 2DAQA 3RIRA 3OYDA 3V7CA 2Y90A 2KSSA 3RMSA 1Y96B 3JAME 1LJOA 1XNIA 3HRTA 3QIIA 3QG1A 5A0GA 1Q7YC 3G7ZA 1K8AC 1KQSA 4M78D 4GY5A 4MZPA 4C92E 5KCHA 2F5KA 3OYCA 4QQDA 3L2ZA 4PJOG 3I56A 1VQPT 4M7AF 3MCAB 2CZ7B 2H3JA 2JN0A 2M1HA 5GAOn 5GAOm 3CCVA 2CKKA 4IUUA 1BI3A 4HCCA 3QZ9B 1VIFA 2ZCFB 5LJ3e 1FX7A 3E9FA 4N0AA 3A8GB 3BY7A 3ER0A 4Q5WA 3TCJA 5GAN8 2JUFA 3HFOA 5D6WA 3WXMB 1VQ6A 3OYIA 2K5IA 5LJ3f 4M78F 2RHIA 1VQMT 3ZFJA 4L59A 3QKJA 1RL2A 2NLUA 4MMKA 5FU6C 2KDSA 4A4HA 3ASKA 4RMOA 3TU4K 5GAN6 5J3BA 3CC4A 5LJ3h 4MDXA 4UC4A 2LTOA 3META 4M78B 1VQ5A 3PIOA 3CEYA 3OS0A 3G71A 3CBOA 4BUGA 4BDZA 3ME9A 4C8QD 3DKMA 3M53A 5GAOl 2X35A 4XTWA 2DIQA 3GPLA 4TVRA 3M4GA 3G6EA 3CCRA 3OYYA 3CCQT 1VQNT 3CCJT 1X6OA 2L89A 2DK3A 2RHUA 2EJFA 2Y4XA 4OB0B 3LH0A 4F7UF 2LCCA 2VUBA 4C8QF 1YJWA 3QZ5B 4O5VA 4HA8A 3UWNA 1O9SA 2CGHA 2EWNA 3DB4A 3OYLA 3QYHB 4N0AC 4F7UB 5CAIA 2AHJB 4C8QB 1BYMA 1NPPA 2LVMA 2QI2A 4JRKA 2WSFE 3UPUA 2PVOB 1YIJA 1VQ7A 1H641 1Q81C 1TH7A 2OAUA 3TEEA 5CK9A 3TREA 4LDXA 4XTVA 2CS7A 4C92A 4A4FA 2PUKB 3CCET 1M4ZA 2CZ6B 3JCMV 4NL3A 4C0DC 2L5QA 2QXFA 3H6ZA 5EG2A 3CCLA 4C5EA 4X9CA 5LJ5d 2HD0A 3MEAA 3CMEA 1AHJB 2LC4A 4GLKA 1HK9A 1FWZA 2DTIA 2EJGA 4XTUA 5GMKi 5CKHA 3SFMA 4C5IA 3L2UA 4NOYA 1O75A 3MP6A 5GAN4 3L2WA 1NZ9A 3CCMT 1MGQA 5GAMj 3M55A 4J6XA 4M7DF 4A53A 5C0MA 5I2SA 5LJ5g 2LCLA 2MWPA 2RHYA 3SD4A 1XOVA 4ZGDB 1WJRA 1LNXA 1WPYA 2P0PA 2X4XA 3M9QA 4FU6A 4KULA 3X25B 4ZGEB 3JB9G 2BIVA 2YHTA 2DZ9A 2VGNA 4JLIA 4X9DA 2GQVA 2RI5A 5CKBA 5FU6B 5IN1A 2WACA 3OYKA 2RJEA 1WJSA 5GAN2 3PMIA 1BKBA 3F70A 4J6WA 3CBPA 1S72T 1Q86U 2EAYA 2EIFA 3V7SA 1I4K1 2DD4A 2XIDA 5HK3A 3CCUA 4M77G 1QVPA 5A0LA 2QA4T 1K9MC 2OTLA 2RD1A 2DTHA 5J26A 4QQGA 1UB4A 1VUBA 2QQ9A 4Y91A 4JRQA 1QP3A 4OB3B 4M75C 1U8RA 2CZ1B 3Q1JA 4BB7A 2HBPA 4XQ3A 1WNLA 3EFSA 2D0QB 4J5YA 3P8HA 3SWNA 1Q82C 3NFCA 4C92C 2DVEA 2VC8A 4J7FA 5CKDA 4IURA 4MZMA 4EPCA 3V8KA 3DLLA 2E41A 1I5LA 3S3MA 4PJOC 1JRIA 4DQ2A 3UDCA 1G3WA 2VXFA 1M1FA 1U1SA 3CCST 3VU3C 2EJ9A 2BUDA 2ZPBB 4A4EA 4E7IA 2ZPHB 3JCMP 3CPWS 1KQSS 2DPPB 3CD6T 3L42A 1VQMA 3OYHA 4A4GA 3OYAA 3PIPA 2VGMA 2XICA 2M16A 3A8OB 2KVQG 3JCMW 3CC2T 4MMLA 3V7RA 3ZBDA 5GAN3 3OYGA 2GF7A 5DM7R 3PMTA 2LRQA 2LT1A 2E6NA 4NL2A 1B34A 2VYTA 2RK2A 3QJ6A 1KC8C 2R57A 2LQKA 3CC7A 3OYFA 1WQ7A 4FT4A 3WVEB 3OS5A 4ELYC 1VQOT 4M75E 4ZN3A 1VQ4A 1YHQA 3BDUA 3L1AA 3JCMb 1KC8U 4HCZA 3JCMQ 1OI1A 2M9UA 2ZZDA 4II1A 1Y07A 1VQNA 3CPWA 2LQ8A 3CBMA 3HPWA 4M7AG 4RKUE 1M90C 2RHZA 3RKYA 5FRMA 3OA6A 4C92D 3HSBA 3SWNC 4CI0C 1YJ9T 2P0KA 4LDVA 3JCMd 3AHUA 2DTOA 1M90U 4B9WA 4PJOE 3VJPA 3LGLA 4FL6A 2DIGA 1JBMA 4E7JA 5GANj 3FDRA 3OYEA 2XDBA 5FLXE 4M78G 3SB2A 3JCMg 1HXDA 2I2LA 4OF1A 4JJNK 1QP2A 4C92F 4HCBA 3RESA 3G4ST 3A8LB 4BE1A 1YJNT 4ZTFA 3N5BB 3QDRB 4OB1B 4P5NA 1VQ8A 3CCEA 1K73U 3FIFA 4J83A 1BIAA 4BY6C 2P0QA 1NJIU 1N27A 5LL6S 2LNVA 1ZHIA 2CZ0B 4CRIA 3JCMX 1LOJA 1G3SA 4C92B 5D6XA 1YITT 2QQSA 2X4YA 4EMGA 2XG8D 4V2SA 2JOYA 4LDUA 5KE2A 3OYBA 2R5MA 5FU7C 4N4GA 4NS5A 1Y7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QO3 A;  4PJO B;  4EMK A;  4M7A E;  2ZGW A;  4OP0 A;  5GAN 7;  3INZ A;  4X9C A;  5LJ5 d;  4RCB A;  4PJO D;  1KQ2 A;  1HK9 A;  2DTI A;  2EJG A;  3JCM e;  3JCM J;  4XTU A;  4C8Q C;  5GMK i;  5LJ5 j;  3BFM A;  4F7U G;  4M75 F;  5GAM d;  4NOY A;  3JB9 J;  1BIB A;  4C8Q G;  4M77 B;  5GAN 4;  1MGQ A;  2RA2 A;  5GAM j;  4J6X A;  4M7D F;  4A53 A;  4C92 G;  2FB7 A;  1D3B B;  4M77 A;  4XU3 A;  5GAM e;  5LJ5 g;  3HFN A;  4WF2 A;  4XU0 A;  2HNI A;  4XTZ A;  1LNX A;  1WPY A;  5LJ5 f;  4M78 E;  3JB9 G;  5DY9 A;  5GAM g;  4XU2 A;  2YHT A;  2DZ9 A;  4M75 B;  5GAM f;  4JLI A;  5GAO q;  4X9D A;  4PJO F;  3JB9 H;  4M75 A;  4A54 A;  2FYK A;  5LJ5 h;  5GAN 2;  1N9S A;  1WQW A;  2DEQ A;  4J6Y A;  4J6W A;  2EAY A;  4QVC A;  2K57 A;  3V7S A;  1I4K 1;  5GAM h;  1I81 A;  4JRI A;  4M77 G;  4M7A B;  2VXE A;  2RD1 A;  2DTH A;  2E65 A;  4RCC A;  4JUV A;  4M7A D;  4Y91 A;  4PJO A;  5GMK j;  4M75 C;  3JCM V;  3QUI A;  3SWN B;  4XTY A;  2DZC A;  1WNL A;  3EFS A;  2E64 A;  3EFR A;  4J5Y A;  4M75 G;  1X01 A;  4XQ3 A;  3SWN A;  5LJ5 e;  3QSU A;  4C92 C;  4M7D C;  2DVE A;  2VC8 A;  3RIR A;  4M7D G;  3V7C A;  2RB6 A;  2Y90 A;  1Y96 B;  4F7U E;  4EMK C;  1LJO A;  4C8Q E;  1D3B A;  3V8K A;  2E41 A;  1I5L A;  1Y96 A;  4HT9 A;  2E1H A;  4PJO C;  1JRI A;  4DQ2 A;  2VXF A;  4M78 D;  4C92 E;  3RKW A;  4M7A F;  2DXU A;  3L2Z A;  4PJO G;  1U1S A;  3VU3 C;  5GAO n;  2EJ9 A;  2JN0 A;  5LJ3 d;  3FJP A;  5GAO m;  3JCM P;  3JB9 D;  3QHS A;  5LJ3 j;  4M77 C;  1M8V A;  2YLB A;  5LJ3 e;  4N0A A;  5GAN 8;  3BY7 A;  3JCM W;  5GAO p;  3FB9 A;  3HFO A;  4MML A;  3V7R A;  5GAN 3;  3RUX A;  5LJ3 g;  3RKX A;  1B34 B;  4M7A A;  5LJ3 f;  4M78 F;  3V8L A;  4M77 E;  4NL2 A;  1B34 A;  5GMK e;  4MMK A;  5GAN 6;  3JB9 F;  5GMK m;  1WQ7 A;  5LJ3 h;  4XU1 A;  4XTX A;  2DXT A;  4M75 E;  1N9R A;  1U1T A;  3BDU A;  3L1A A;  4M78 B;  3JCM b;  3PGG A;  3JB9 I;  3JCM Q;  2YLC A;  4M7A C;  4M78 A;  4C8Q D;  4M7D E;  4M7A G;  3BW1 A;  4M7D D;  3RKY A;  5GAO l;  4PNO A;  4XTW A;  2DJZ A;  4C92 D;  5GMK h;  5GAN 5;  2QTX A;  3HSB A;  3SWN C;  3JCM d;  3M4G A;  2DKG A;  2DTO A;  3AHU A;  4PJO E;  1M5Q 1;  5GAN d;  2EJF A;  2RM4 A;  1JBM A;  4M78 C;  5GAN j;  4F7U F;  5GAN e;  4C8Q F;  4M78 G;  3SB2 A;  3JCM g;  1HXD A;  2I2L A;  3JCM f;  4HA8 A;  4C92 F;  4M77 D;  5GAN g;  3RES A;  2CGH A;  2EWN A;  5GMK l;  5GAN f;  1YCY A;  3FIF A;  4N0A C;  1BIA A;  4F7U B;  5CAI A;  5GAO r;  3JCM h;  4C8Q B;  3GIB A;  3V8J A;  4QVD A;  1I8F A;  4JRK A;  4F7U A;  4M75 D;  1LOJ A;  3JCM X;  4M7D B;  4C8Q A;  1H64 1;  4C92 B;  1TH7 A;  5GAN h;  2E10 A;  3RER A;  4EMG A;  4HT8 A;  4M7D A;  1KQ1 A;  4XTV A;  4EMH A;  4C92 A;  5I21 A;  4V2S A;  3JCM c;  4EMK B;  4NL3 A;  4M77 F; 
#chains in the Genus database with same CATH topology
 2DRM A;  4J9B A;  4OP0 A;  2O9S A;  3I55 T;  3C4S A;  1E6H A;  5GAM d;  2D6F A;  1KG1 A;  5IHI A;  2NUZ A;  2OTJ A;  2RQR A;  4LD6 A;  1VQK Q;  1UEB A;  3SDZ A;  1EFN A;  2QQB A;  2EFI A;  2RK1 A;  2XK0 A;  4IKF A;  1NE8 A;  1EZZ B;  4JLG A;  2C06 A;  4K11 A;  2RQW A;  6AT1 B;  2E65 A;  3CCV T;  4JS4 A;  4ATO A;  1Y71 A;  4IUT A;  4PJO A;  2RQV A;  1D1A A;  4E2F B;  3SWN B;  3EFR A;  1HYO A;  1UGV A;  2EQM A;  5KYW A;  1MV0 B;  1SPK A;  4KGX B;  2OX7 A;  2E1H A;  1PRL C;  4PFP A;  2JJ9 A;  1VQ5 T;  3JB9 D;  3G71 T;  5LJ3 j;  2C0T A;  2L8D A;  2CRE A;  2MAM A;  3RKX A;  3IQL A;  1B34 B;  3KBG A;  2DBM A;  2F1L A;  1ZSZ B;  3OSS C;  4KRT A;  5KYX A;  5GMK m;  4L5G A;  2IG0 A;  4XU1 A;  4C5H A;  5KH6 A;  3EG1 A;  2EYQ A;  1WHK A;  5I11 A;  2F2V A;  5GMK h;  3M0U A;  9ATC B;  3G4S Q;  2DKG A;  2M0O A;  1HJD A;  2XHC A;  2E6Z A;  2RO0 A;  4PJM A;  1SHG A;  4AFU C;  2EQI A;  1OPK A;  3LWI A;  2IVW A;  1SSF A;  3JCM h;  3V8J A;  1I8F A;  5M9O A;  2ROL A;  2FVU A;  2PNI A;  1T0H A;  1QKX A;  4EMK A;  1QMC A;  4OMF B;  4PJO D;  3THK A;  1V1C A;  3BFM A;  4M75 F;  2AIR B;  2JNG A;  2RHX A;  4PFO A;  2K6D A;  4FYY B;  3REB B;  1NEG A;  1BB9 A;  2BE7 D;  2BZX A;  1ABO A;  3I5R A;  2BZ8 A;  2XDD A;  3CMA Q;  1IZ6 A;  5FRO A;  1K8A U;  2KAF A;  4OML A;  1UGQ B;  2RJF A;  5GAM h;  4JRI A;  3NTH A;  2VXE A;  2JM9 A;  2HL3 A;  3QBY A;  2Y4Y A;  2KQW A;  3GF5 A;  5LJ5 e;  4M7D C;  5CVI A;  5CCA A;  1S72 Q;  1CSK A;  1BCO A;  2ED0 A;  2K3X A;  4C8Q E;  2QA4 Q;  1Y96 A;  2KR3 A;  4KGV B;  3FC3 A;  1G8X A;  2HQX A;  3MP8 A;  5LJ3 d;  4PJN A;  4KBM B;  1YHQ T;  2ZPE B;  1IB8 A;  3M56 A;  3QHS A;  2XI9 A;  3X26 B;  4ZN1 A;  3I56 T;  2QK0 A;  3RNJ A;  5CKE A;  1IXD A;  5C6S A;  3LLR A;  3C94 A;  4YTL A;  1FMK A;  2CYZ B;  4FT2 A;  3CD6 Q;  1MUZ A;  1UG1 A;  3JB9 I;  5KYU B;  3JSC A;  2O4X B;  1N8R C;  1XQH A;  2QTX A;  5CQY A;  4R0K A;  3LH5 A;  2YUN A;  5FRN A;  8AT1 B;  1Q95 G;  1MND A;  3J81 E;  2VWF A;  1VQO A;  4MZT A;  4LN2 A;  3URG A;  4PKC C;  1TUC A;  2P4T A;  3VYG A;  2QQA A;  4BI8 B;  2DD5 A;  4QW2 A;  3CQT A;  1YJ9 A;  4QVD A;  2K3Y A;  4BD3 A;  4F7U A;  3PT9 A;  5CO7 A;  1ARK A;  2VAS A;  2KI7 A;  2YT6 A;  2KT1 A;  1VQK T;  4M77 F;  3QO3 A;  2HQH A;  1AOJ A;  4AG2 C;  1GRI A;  3O8V A;  5IXF A;  5KYN A;  3E2U A;  4GBQ A;  5LJ5 j;  1JJ2 P;  2D9T A;  3TSZ A;  3OBW A;  2K5L A;  3KXT A;  1YIT A;  3M0P A;  1KQS P;  3EHR A;  1G3T A;  3X24 B;  2FYK A;  1WXT A;  2KK4 A;  3LW5 E;  2JTE A;  1N9S A;  1NPR A;  4J6Y A;  1D0X A;  2HEQ A;  2R58 A;  4QQ6 A;  4X1V A;  3E19 A;  3HKS A;  3QWX X;  4BE2 A;  1KC8 R;  3VRY A;  2XDP A;  2PVG B;  1J3T A;  2MWO A;  2VV5 A;  4FYW B;  4KT0 E;  2DAQ A;  4AT1 B;  2O88 A;  1WHM A;  1Q7Y C;  4GY5 A;  3I56 A;  4AFQ C;  4PJO G;  1NLP C;  1YCS B;  2FZC B;  1BI3 A;  2ZCF B;  2J6K A;  5GAN 8;  3TCJ A;  1RAD B;  2W0Z A;  5D6W A;  1VQ6 A;  2K5I A;  3VS3 A;  1VQM T;  3QKJ A;  2NLU A;  5FU6 C;  1GFC A;  2DYI A;  4RMO A;  4LUE A;  5J3B A;  3CC4 A;  5LJ3 h;  4MDX A;  4UC4 A;  3MET A;  3R6N A;  3CEY A;  1D0Y A;  3OS0 A;  3JV3 A;  1GFD A;  4XTW A;  3CCR Q;  3M4G A;  1UJY A;  2LP5 A;  2QGF B;  1WYX A;  2LCC A;  2P4R A;  1M3A A;  3QZ5 B;  1PM3 A;  4HA8 A;  4O5V A;  1O9S A;  2CGH A;  3NHN A;  3QYH B;  2AHJ B;  2PTK A;  4C8Q B;  1VQ7 A;  2COY A;  2DL7 A;  3CCE T;  2CZ6 B;  2LQW A;  4J9G A;  4X9C A;  5LJ5 d;  3CME A;  4M4Z A;  5GMK i;  5CKH A;  2RF0 A;  4NOY A;  4CC3 A;  3M55 A;  5I2S A;  2MWP A;  1AEY A;  3SHW A;  2X4X A;  1TOV A;  1AT1 B;  2BIV A;  2RJE A;  5GAN 2;  2OTL Q;  4J6W A;  3CBP A;  1S72 T;  1ZSG A;  3NGP A;  3CCU A;  2RQT A;  2QA4 T;  1QVP A;  2QG9 B;  2RD1 A;  4OMO A;  5J26 A;  3VS4 A;  1ZUU A;  4OMN A;  2QQ9 A;  1U8R A;  2DET A;  2HBP A;  1WNL A;  3SWN A;  4MZM A;  4AFS C;  3V8K A;  3S3M A;  1T0J A;  2O9V A;  1G3W A;  2VXF A;  2CSQ A;  1U1S A;  2BUD A;  3CD6 T;  2M02 A;  1VQM A;  4A4G A;  2XIC A;  1UDL A;  5KYY B;  1QWF A;  2GF7 A;  4PJJ A;  3PMT A;  1UE9 A;  4FW2 A;  1B34 A;  3CC7 Q;  4CC4 B;  3CXC P;  2RK2 A;  1AD5 A;  2R57 A;  1ZSZ A;  2CT3 A;  3EG9 B;  4M75 E;  4ZN3 A;  1VQ4 A;  2DL5 A;  2QYZ A;  2C0O A;  1OI1 A;  1Y07 A;  2JS0 A;  3CBM A;  1M90 C;  2RHZ A;  4CI0 C;  2LNH B;  2P0K A;  3VJP A;  3LGL A;  4FL6 A;  5GAN j;  2K79 A;  2XDB A;  2JS2 A;  3JCM g;  4OMM A;  4JJN K;  4C92 F;  1I0C A;  4JJC A;  4HCB A;  4BE1 A;  2O2O A;  3QDR B;  1WA7 A;  3CCE A;  1W2B P;  4J83 A;  1BIA A;  3OW2 P;  1N27 A;  1UFF A;  4RTU A;  5D7U A;  4LDU A;  2EGA A;  4NS5 A;  2YSQ A;  5C0M A;  4ZGJ B;  1MMG A;  4Z89 A;  3J80 E;  2MIO A;  3M0R A;  4F7U G;  2QAZ A;  1VIE A;  2MOX A;  2EGE A;  2O31 A;  1VQL A;  1M30 A;  2BZY A;  2HNI A;  4DOV A;  3MHX A;  3OY9 A;  2D8H A;  5DY9 A;  5GAM g;  1Y57 A;  1I5O B;  5LJ5 h;  1M2V B;  2MMP A;  1YI2 Q;  3TVT A;  1OX9 A;  4OB2 B;  4E7H A;  1KHC A;  2DZC A;  4FW1 A;  4BAC A;  5DLO A;  4M7D G;  3OYN A;  2D8J A;  4O6J A;  1Z9Z A;  3CC2 Q;  3EGU A;  1FMW A;  4R56 A;  1N8R R;  2QDY B;  1Q86 C;  3PFS A;  3T9N A;  3FJP A;  2L0A A;  1M8V A;  2EQU A;  3UAT A;  1N8R U;  5EC7 A;  2A3L A;  3C95 A;  3S6W A;  1PHT A;  4M77 E;  2E3H A;  1VQP Q;  3VUZ A;  2E12 A;  1PG5 B;  4DBR A;  1BI1 A;  1N9R A;  4FIB A;  3VS7 A;  2EQJ A;  4LNP A;  1QVF P;  3QJY A;  1JO8 A;  3DLM A;  2O4X A;  3VV0 A;  1SRM A;  3H0I A;  5GAN d;  1BI0 A;  2A36 A;  1WJQ A;  3M59 A;  2XD0 A;  2JVV A;  4DA4 A;  1RAF B;  3VKI A;  1VYT A;  1BU1 A;  2DNU A;  5GMK l;  1RLP C;  1YCY A;  1YWO A;  1AWW A;  3CCQ Q;  1KIK A;  3CCJ Q;  2QEX T;  2ATC B;  2L3R A;  3FJ5 A;  1PC0 A;  3RER A;  1BI2 A;  1KQ1 A;  3R6O A;  1V29 B;  2OAW A;  4PFZ A;  5GAN 7;  3DB3 A;  2KY9 A;  3FLG A;  4RCB A;  2E70 A;  4L6V 5;  2K2V A;  4C8Q C;  2OTL T;  4MDW A;  1M8M A;  2R5A A;  4E7K A;  1NJI C;  2FB7 A;  1D3B B;  2KNB B;  4XU3 A;  1PKT A;  1KJW A;  4M75 B;  3MPU B;  2D0N A;  2MPX C;  3OMC A;  2V1R A;  1Q7Y U;  5AYF A;  2COW A;  2X3W D;  3M57 A;  4KUD K;  4M7A B;  2X4W A;  3CCM A;  2AZS A;  4F04 B;  3OB9 A;  5I22 A;  3OSV A;  3HRS A;  2VVK A;  2H8H A;  2RI3 A;  2EKO A;  3LGF A;  3QXE B;  4QVZ A;  4EMK C;  4RTZ A;  2FPF A;  3MJX A;  4HT9 A;  1FMV A;  2RNA A;  3CC7 T;  1M1G A;  3OYJ A;  4JJB A;  1ZUY A;  3FEO A;  4IUV A;  3MO8 A;  2NUT B;  1QWE A;  4RG8 A;  3KFV A;  2VKN A;  5LJ3 g;  1YFN A;  3MEV A;  4J9D A;  3V8L A;  1TUD A;  1W4S A;  2DEU A;  1B7T A;  5D6Y A;  3CCS A;  2LX7 A;  2WSE E;  2LMJ A;  1VOM A;  2DJZ A;  1DJ7 B;  2D1X A;  1JB0 E;  3NPF A;  1IRE B;  1JU5 C;  2B8A A;  2JM8 A;  5DLQ E;  1X69 A;  1TU0 B;  2QEX A;  1RI0 A;  1W6X A;  1ACM B;  4BE0 A;  1YJW T;  4C8Q A;  5GAN h;  3M0S A;  1WZO A;  3C12 A;  1H3H A;  3PNW C;  4D8D A;  1FXX A;  3M54 A;  3L2Q A;  2X4J A;  1KQ2 A;  1M3C A;  1YJN A;  3MEW A;  1PNJ A;  3VYH B;  1YI2 T;  4M77 B;  1JJ2 S;  1X27 A;  1TUG B;  3EG0 A;  2HQE A;  4RTX A;  2A7Y A;  5I2M A;  1HD3 A;  3CPF A;  4OVA A;  2PVD B;  3CPW P;  1NYF A;  4KUI A;  2QQR A;  1YWP A;  1WQW A;  3I55 A;  5HKC A;  3WVD B;  2DX1 A;  1JJ2 A;  3PVL A;  1CKA A;  3V7C A;  2KSS A;  1LJO A;  3HRT A;  3QG1 A;  5A0G A;  1M90 R;  3G7Z A;  1Y0M A;  1KQS A;  4MZP A;  4C92 E;  4M7A F;  1X2K A;  2L3P A;  1VQP T;  3MCA B;  2QDL A;  1VYU A;  2CZ7 B;  2H3J A;  5GAO n;  5GAO m;  3CCV A;  2CKK A;  4HCC A;  3QZ9 B;  2NUP B;  1FX7 A;  2FG0 A;  4N0A A;  4Q5W A;  3HFO A;  4JZ3 A;  5KYY A;  3OYI A;  2E5K A;  4M78 F;  2AK5 A;  4MMK A;  1WDX A;  2KDS A;  1WHJ A;  5GAN 6;  1VQ5 A;  3G71 A;  3ME9 A;  4C8Q D;  1W70 A;  4DBH A;  2K3B A;  3G6E Q;  4TVR A;  4RUG A;  3CCQ T;  1H8K A;  1VQN T;  2VB6 A;  3CCJ T;  2Y4X A;  2VUB A;  1YJW A;  2CP3 A;  3UWN A;  2HKN A;  2YDL A;  4F17 A;  3OYL A;  1YIJ Q;  5CAI A;  3VRZ A;  2LVM A;  3C0C A;  2PVO B;  1H64 1;  3D7S B;  1QQJ A;  2OAU A;  4KH1 B;  5CK9 A;  3TRE A;  4A4F A;  3CCL Q;  2PUK B;  4J9C A;  2ESW A;  5AT1 B;  3H6Z A;  1RAA B;  3AT1 B;  1AHJ B;  4GLK A;  3I35 A;  2DTI A;  4C5I A;  4AG1 C;  3L2U A;  5GAN 4;  1NZ9 A;  3M0Q A;  4A53 A;  5LJ5 g;  4HXJ A;  1YN8 A;  2I0N A;  4ZGD B;  1XOV A;  1WPY A;  4FU6 A;  1Q86 R;  1M1K C;  3JB9 G;  4KUL A;  4X9D A;  2GQV A;  1WJS A;  1BBZ A;  3U23 A;  1BKB A;  1Q86 U;  1M2V A;  2EAY A;  5HK3 A;  2G6F X;  2DTH A;  2NYS A;  1UB4 A;  4M75 C;  2RMO A;  3EFS A;  2P84 A;  2D0Q B;  4J5Y A;  1Z9Q A;  3NFC A;  3UF4 A;  2DVE A;  2VC8 A;  4IUR A;  4EPC A;  2CP5 A;  1JRI A;  4DQ2 A;  1ZX6 A;  2F2W A;  3VU3 C;  2EJ9 A;  4A4E A;  4E7I A;  3L42 A;  2LCS A;  2VGM A;  2M16 A;  2EKH A;  3V7R A;  3OYG A;  5DM7 R;  2LRQ A;  1WLP B;  3HTR A;  3UA7 A;  3VS1 A;  4FT4 A;  3WVE B;  4ELY C;  1ZA2 B;  1YHQ A;  3BDU A;  1ZA1 B;  1KC8 U;  3JCM Q;  2ZZD A;  4II1 A;  1VQN A;  2LQ8 A;  4RKU E;  3RKY A;  5FRM A;  4FYV B;  3HSB A;  3SWN C;  5IHK A;  1LPL A;  4LDV A;  2IPO B;  4KH0 B;  3RR6 A;  2DER A;  1JBM A;  1A0N B;  1NJI R;  3G1J A;  5FLX E;  3SB2 A;  3VS5 A;  1D1B A;  2I2L A;  1VQ8 Q;  3G4S T;  3A8L B;  4ZTF A;  3N5B B;  4OB1 B;  4JZ4 A;  1NJI U;  2DIL A;  4RTV A;  1MV3 A;  5LL6 S;  1ZHI A;  4CRI A;  1K0X A;  1G3S A;  4C92 B;  4EMG A;  3OYB A;  2R5M A;  4N4G A;  2KT8 A;  3OYK A;  1ZSZ C;  2EGC A;  4PJO B;  3UT1 A;  2JTM A;  2L3Q A;  3NTK A;  4DEY A;  1IGQ A;  2OTJ Q;  4C8Q G;  1RAB B;  4XTZ A;  1W2B A;  4J9I A;  2ECZ A;  2CP2 A;  4JS5 A;  4F16 A;  1VQK A;  2YXY A;  4FM4 B;  3ZL7 C;  4M75 A;  4A54 A;  4FSX A;  4J8O A;  2PU9 B;  1H3Z A;  2LX9 A;  3PVQ A;  2HKQ B;  4ME7 A;  1FYN A;  2AKL A;  4ORZ A;  1T3S A;  3CMA T;  2RJD A;  3GP8 A;  5L23 A;  1LVK A;  1I1J A;  2AZV A;  4JPB W;  1X01 A;  3QSU A;  4EDU A;  1Q81 R;  2ZPG B;  2DRK A;  3RDV A;  1EIF A;  3RKW A;  2DXU A;  2CP6 A;  3GNG A;  5ECA A;  3PTA A;  2CP0 A;  4BY6 B;  4F14 A;  5IAY A;  5HY6 A;  4JDS A;  2NUT A;  2GFA A;  2KXC A;  2C0I A;  4IUP A;  3JRZ A;  3G6E T;  5FU7 B;  5GMK e;  4OGC A;  2PZ1 A;  3LWH A;  3JB9 F;  4B6M A;  4XTX A;  1WXU A;  3HP9 A;  5HCK A;  1BCM A;  2E5Q A;  3M4Y A;  4N4H A;  1K9M R;  3BW1 A;  1OU8 A;  3OS2 A;  4PL6 A;  4C5G A;  2CT4 A;  2V8K A;  4E7Z A;  1YIJ T;  2L2P A;  3OYM A;  2CUD A;  3G4S A;  4DOW A;  2RH2 A;  3QWY A;  3CCL T;  3JCM f;  4C0D B;  5GAN g;  1QVG S;  4HCK A;  3L2R A;  2MI6 A;  5GAO r;  2KRN A;  2BE9 B;  4M75 D;  1LCK A;  1ZBJ A;  2DBK A;  2LDM A;  4M7A E;  2E3I A;  3H9N A;  7AT1 B;  2AT1 B;  3QYG B;  2X9H A;  1BIB A;  1QVG A;  1KHI A;  3EHQ A;  4M77 A;  5GAM e;  4JJD A;  3HFN A;  1CKB A;  1OUL A;  4M78 E;  1UGS B;  1MMD A;  5GAM f;  2DXC A;  3LYI A;  4PJO F;  2CUB A;  3JB9 H;  1MHN A;  1X75 C;  3NTI A;  4PLI A;  3CMA A;  1UGR B;  2V8I A;  1I81 A;  2GTJ A;  3FRN A;  1G83 A;  3H0H A;  4LDW A;  3ULR B;  4RCC A;  2SRC A;  2DL4 A;  5GMK j;  2PUO B;  3X28 B;  5IXB A;  2CH4 W;  2RB6 A;  1AZG B;  1S72 A;  4IUQ A;  3HL8 A;  2QA4 A;  4IIM A;  1HSQ A;  2XMF A;  5FWC A;  3VS6 A;  4QKU A;  3EGD B;  1GCQ A;  1QCN A;  4QT7 A;  2YLB A;  5CR2 A;  5GAO p;  2NUP A;  1OV3 A;  3H8Z A;  2DJQ A;  2JT4 A;  2CH4 A;  1GXI E;  4C0Z A;  2DL3 A;  2BKD N;  2IIM A;  4AFZ C;  2F2X A;  1N6A A;  5L8R E;  2JW4 A;  2K5F A;  1UGP B;  3CD6 A;  3HHT B;  3M5A A;  1VQ8 T;  3LX7 A;  1SF9 A;  5GAN 5;  3NMZ C;  1PD1 A;  1WXB A;  1X2Q A;  3EH1 A;  4PLL A;  4B9X A;  2OJ2 A;  1RAG B;  3EFO B;  1VQO Q;  4LUD A;  3BDL A;  3EG3 A;  1M1K R;  1E7O A;  3CCR T;  2HAX A;  2YWW A;  4M77 D;  5KCO A;  2X51 A;  1YJ9 Q;  4JRP A;  4FSS A;  3KUF A;  2FZK B;  3GIB A;  1WI7 A;  1NG2 A;  5A2Q E;  1M1K U;  2OTJ T;  4M7D B;  2YUQ A;  1SRL A;  3JCM c;  5KYU A;  2HCK A;  2PQW A;  1OPL A;  1WFW A;  3EG2 A;  4Y28 E;  3OS1 A;  1YIT Q;  4XAX B;  1ZQ1 A;  2GFU A;  3REA B;  4BI4 A;  1VA7 A;  1G5V A;  4WTO B;  3TQ7 P;  3L2V A;  3MEU A;  1OEB A;  1KD1 C;  1K4U S;  1AWO A;  1F1B B;  1T3L A;  1NM7 A;  3A8M B;  4ANJ A;  2FL7 A;  4JUV A;  2FPD A;  4E47 A;  2XU8 A;  4LDY A;  2GBQ A;  2KEA A;  2E64 A;  4M75 G;  1AVZ C;  2XKO C;  3RIR A;  3RMS A;  3JAM E;  2CDT A;  3QII A;  3QDF A;  3OYC A;  4CC2 A;  1AWX A;  2M1H A;  1U06 A;  2MCN A;  1VIF A;  5LJ3 e;  1VQ6 Q;  3E9F A;  1R0C B;  2FPE A;  3ER0 A;  3BY7 A;  1NLO C;  2JUF A;  2Z0W A;  5LJ3 f;  1ZUK A;  2RHI A;  4WCI A;  3ZFJ A;  4L59 A;  3CC4 Q;  4A4H A;  3ASK A;  1QCO A;  1TTH B;  1SEM A;  4M78 B;  3PIO A;  3CBO A;  4BDZ A;  2EVR A;  3DKM A;  2A28 A;  3M53 A;  5GAO l;  2X35 A;  1C1A A;  2H3E B;  1JQQ A;  3CCR A;  1X6O A;  2RHU A;  3VS0 A;  2EJF A;  1BK2 A;  4OB0 B;  1PCX A;  2EW3 A;  3LH0 A;  4F7U F;  1SG5 A;  2X3X D;  4Z88 A;  4RTW A;  1GBQ A;  1UEC A;  2EPD A;  2B86 A;  4N0A C;  1VQ7 Q;  2QI2 A;  4JRK A;  1UJ0 A;  1Q81 C;  1K9A A;  2LQN A;  4XTV A;  1S1N A;  4C92 A;  1M4Z A;  4NL3 A;  3JCM V;  3CME Q;  4C0D C;  2L5Q A;  4C5E A;  2HD0 A;  2EYZ A;  1HK9 A;  4XTU A;  1SKU B;  2BTT A;  3MP6 A;  3L2W A;  1IO6 A;  4J6X A;  4M7D F;  2RHY A;  1LNX A;  4ZGE B;  1VQ9 Q;  2CP7 A;  1RAH B;  2RI5 A;  5FU6 B;  2E4H A;  3CCU Q;  2QAS A;  4DBF A;  1RAE B;  2EIF A;  3V7S A;  1I4K 1;  2XID A;  4M77 G;  2OTL A;  1K9M C;  2DM1 A;  1VUB A;  4PJL A;  4JRQ A;  4OB3 B;  4BB7 A;  3Q1J A;  3P8H A;  1Q82 C;  1K0S A;  1UHF A;  1UTI A;  5CKD A;  1I07 A;  1KSW A;  2E41 A;  1N5Z A;  2KRM A;  1GL5 A;  3UDC A;  2M0Y A;  2L3S A;  1VQM Q;  2OI3 A;  3JCM P;  1KQS S;  4RTY A;  3OYH A;  4GLM A;  1TSF A;  2DL8 A;  1D09 B;  3OYA A;  3PIP A;  1SHF A;  3A8O B;  1OQK A;  2KRO A;  3CC2 T;  4MML A;  2V1Q A;  3BE3 A;  2E6N A;  1OU9 A;  2J05 A;  2VYT A;  1B3Q A;  1VQ4 Q;  3CC7 A;  1G2B A;  1RI9 A;  2DA9 A;  1VQO T;  1WIE A;  4HCZ A;  4C92 D;  1R77 A;  1YJ9 T;  1PWT A;  2V26 A;  3AHU A;  2DTO A;  1M90 U;  4B9W A;  4PJO E;  3I9Q A;  3OYE A;  2A37 A;  1HXD A;  4DBQ A;  1QP2 A;  3M0T A;  1KFZ A;  3CCE Q;  1SSH A;  4OMQ A;  3RES A;  1K8A R;  1M27 C;  4P5N A;  3FIF A;  1MNE A;  4PK4 A;  3A98 A;  2LNV A;  3EG9 A;  2CZ0 B;  4KGZ B;  1YIT T;  1YP5 A;  2QQS A;  2XG8 D;  2JOY A;  5KE2 A;  1PKS A;  1VYV A;  4VUB A;  1YBY A;  2V8J A;  1VQL Q;  5CQX A;  4LE9 A;  1C6V X;  2RA2 A;  4CC7 A;  4BI3 A;  4WF2 A;  5LJ5 f;  3E1S A;  4XU2 A;  3O5Z A;  5GAO q;  4X34 A;  2J7I A;  3ZEH A;  2DEQ A;  2GGR A;  2K57 A;  2JTF A;  3J7A F;  1YI2 A;  2RI2 A;  2KGT A;  2GNC A;  4OGE A;  2DLP A;  2FHD A;  3QUI A;  4XTY A;  1VQ6 T;  1E6G A;  4BDY A;  2GQI A;  1M3B A;  2YRV A;  3CC4 T;  3CC2 A;  3EGD A;  2ZPF B;  1GBR A;  3VUB A;  5CKF A;  3EGX B;  2EBP A;  1VQP A;  1WHG A;  2K4Y A;  1UUE A;  2MF2 A;  4M7A C;  2YLC A;  4XK8 E;  4Z8A A;  4IIO A;  1OZ2 A;  2ABL A;  3EH2 A;  3I5S A;  1VQ7 T;  3A5Z B;  2EYW A;  2J06 A;  2RQU A;  4M78 C;  3EFO A;  3GBQ A;  4E7L A;  3VS2 A;  1ABQ A;  3CME T;  3CXC S;  3A1P A;  4N4I A;  1U3O A;  2LJ1 A;  1G3Y A;  5IT9 E;  1KD1 R;  3H0F A;  2W10 A;  3CCQ A;  3CCJ A;  2E10 A;  4M7D A;  2A0F B;  2FZG B;  4ZTJ A;  1PSE A;  2K7A A;  1VQ9 T;  1KD1 U;  2EYX A;  4LD9 K;  3JCM J;  1OZ3 A;  3CCU T;  1XJW B;  4J7I A;  3JB9 J;  2MYS A;  1WGS A;  3CXC A;  2EQK A;  3GOX A;  1K73 C;  3TSW A;  4C92 G;  4E6R A;  1TXQ A;  2JZ2 A;  1W2B S;  3OW2 S;  2FRW A;  4FYX B;  4D6W A;  4QVC A;  3CCM Q;  3E9G A;  3OQ5 A;  2RJC A;  4DEX A;  1AWJ A;  4HKE A;  2KMT A;  1WHL A;  2DE0 X;  4ELZ C;  4Y92 A;  2K9G A;  5KYW B;  1AZE A;  1QW1 A;  2JMC A;  2F5T X;  2FRY A;  2SEM A;  2YUP A;  4F7U E;  2EYY A;  1D3B A;  1V76 A;  3OW2 A;  1X43 A;  4A4K A;  1WHH A;  1OYX A;  2GCX A;  2HMA A;  2QTV A;  4C0G A;  1KK7 A;  1NEB A;  1VQ4 T;  3HRU A;  4LXC A;  4M77 C;  2KBT A;  3EAE A;  1RLQ C;  2DXB A;  2O01 E;  3FB9 A;  3RUX A;  5J39 A;  4M7A A;  1PRM C;  2WSC E;  2ZAE A;  2HBW A;  2CSI A;  5KYX B;  3CCS Q;  5KE3 A;  3UA6 A;  1P92 A;  3GNF B;  1M2O A;  4RG2 A;  3P8B B;  1JXM A;  2DXT A;  1U1T A;  3OMG A;  2JMA A;  5IH2 A;  3PGG A;  2HL5 C;  4M78 A;  4M7D E;  5A0D A;  4M7D D;  4PNO A;  2DO3 A;  1Q81 U;  2YRD A;  3X20 B;  3RMQ A;  1M5Q 1;  1PSF A;  2RM4 A;  4Z02 A;  1R8O B;  2QEX Q;  4HVU A;  5GAN e;  4C0F A;  4R55 A;  3S3N A;  1GCQ C;  3A8H B;  5GAN f;  1K1Z A;  3GLX A;  2F69 A;  2A08 A;  1VQL T;  1VQ9 A;  1PD0 A;  2ZPI B;  4ZNX A;  4HT8 A;  4A63 B;  4EMH A;  5I21 A;  1M9S A;  2MK5 A;  1QCF A;  3OBY A;  4EMK B;  2DFU A;  2YUO A;  2LT4 A;  1QVF S;  3P8D A;  2ZGW A;  1YJN Q;  4FCY A;  3INZ A;  1TG0 A;  1Q82 R;  3JCM e;  1K9M U;  2KRS A;  1RUW A;  1TWB A;  4E7S A;  5FWB A;  1H92 A;  1C0M A;  1ZBX A;  4XU0 A;  1Q82 U;  1RAI B;  2COZ A;  4EIK A;  5CIU A;  1IRX A;  2KYB A;  3I55 Q;  1U5S A;  3MP1 A;  3S3O A;  1QVF A;  5HK0 A;  1IHV A;  2HDA A;  4OMP A;  3M58 A;  4J9E A;  2G3R A;  1XTD A;  4M7A D;  3QPH A;  2KXD A;  3OYD A;  2Y90 A;  1Y96 B;  1XNI A;  3PE0 A;  1MMN A;  1JEG A;  1K8A C;  3H41 A;  4M78 D;  3CCV Q;  1NBE B;  5KCH A;  2F5K A;  4QQD A;  3L2Z A;  1WX6 A;  2JN0 A;  4IUU A;  1X6B A;  2RPN A;  1YNZ A;  1D1C A;  2LZ6 B;  1JXO A;  3A8G B;  2GTO A;  3WXM B;  1W1F A;  1RL2 A;  3SEM A;  3TU4 K;  1VQ5 Q;  1OX8 A;  3G71 Q;  1QLY A;  2LTO A;  2J6F A;  2JXB A;  4BUG A;  2RN8 A;  2DIQ A;  3GPL A;  4ESR A;  3G6E A;  4RTT A;  3OYY A;  2L89 A;  2DK3 A;  5IHN A;  4J9F A;  1YJW Q;  4C8Q F;  1TS9 A;  2EWN A;  3DB4 A;  1NYG A;  5FW9 A;  4F7U B;  1BYM A;  1NPP A;  3MKD A;  1YIJ A;  3UPU A;  2ED1 A;  2WSF E;  2M51 A;  1TH7 A;  3TEE A;  4LDX A;  2CS7 A;  1B07 A;  5GJV B;  2QXF A;  5EG2 A;  3CCL A;  3MEA A;  2LC4 A;  2EJG A;  1FWZ A;  3SFM A;  1O75 A;  2DF6 A;  3CCM T;  2ROT A;  1IGU A;  1MGQ A;  5GAM j;  2LCL A;  3SD4 A;  2FEI A;  1WJR A;  2P0P A;  3M9Q A;  3X25 B;  2YHT A;  2DZ9 A;  2VGN A;  4JLI A;  5CKB A;  5IN1 A;  2WAC A;  2J6O A;  3PMI A;  2NWM A;  2LJ3 A;  3F70 A;  5GJW B;  2DD4 A;  5A0L A;  8ATC B;  4QQG A;  4Y91 A;  1X6G A;  1QP3 A;  2CZ1 B;  4XQ3 A;  4C92 C;  4J7F A;  3DLL A;  1I5L A;  1IHW A;  4PJO C;  2FO0 A;  1M1F A;  3CCS T;  2KYM A;  2HZY A;  2ZPB B;  2ENM A;  2ZPH B;  3CPW S;  2DPP B;  1OOT A;  2LJ0 A;  2KVQ G;  3JCM W;  3ZBD A;  5GAN 3;  2DMO A;  2LT1 A;  1RAC B;  4NL2 A;  4HVW A;  1QVG P;  3QJ6 A;  1KC8 C;  3EGX A;  4HVV A;  2HSE B;  2LQK A;  1YHQ Q;  2DYB A;  3OYF A;  1GCP A;  4J9H A;  1D0Z A;  1WQ7 A;  3OS5 A;  2AKK A;  1QKW A;  1VQN Q;  3I56 Q;  3L1A A;  3JCM b;  2M9U A;  3CPW A;  3HPW A;  4M7A G;  1ZLM A;  2YRC A;  4AMC A;  3OA6 A;  2QGG A;  3JCM d;  1MMA A;  2K2M A;  2DIG A;  4E7J A;  1K73 R;  3FDR A;  1EX4 A;  4M78 G;  1R0B G;  2KE9 A;  4OF1 A;  1Q7Y R;  3RBB B;  1YJN T;  1VQ8 A;  2DVJ A;  1K73 U;  4BY6 C;  2P0Q A;  1UHC A;  3JCM X;  1LOJ A;  5D6X A;  2X4Y A;  2HSP A;  4D8K A;  4V2S A;  1K76 A;  5FU7 C;  1Y7X A; 
#chains in the Genus database with same CATH homology
 4ZGJ B;  4VUB A;  4PJO B;  3UT1 A;  3J80 E;  2JTM A;  4OP0 A;  1YBY A;  3I55 T;  2V8J A;  3C4S A;  3NTK A;  4F7U G;  5CQX A;  5GAM d;  1VIE A;  2D6F A;  1KG1 A;  4C8Q G;  2RA2 A;  1VQL A;  2OTJ A;  4BI3 A;  4LD6 A;  4WF2 A;  5LJ5 f;  2HNI A;  4XTZ A;  4DOV A;  3MHX A;  3OY9 A;  1W2B A;  5DY9 A;  1UEB A;  3E1S A;  3SDZ A;  5GAM g;  4XU2 A;  4JS5 A;  2QQB A;  2RK1 A;  2EFI A;  2XK0 A;  4X34 A;  5GAO q;  1VQK A;  4FM4 B;  4IKF A;  1NE8 A;  4M75 A;  4FSX A;  4J8O A;  4A54 A;  4JLG A;  2PU9 B;  5LJ5 h;  2C06 A;  3ZEH A;  1H3Z A;  2LX9 A;  2DEQ A;  2MMP A;  2K57 A;  4ME7 A;  2JTF A;  3J7A F;  1YI2 A;  2RI2 A;  2E65 A;  3CCV T;  4OB2 B;  4E7H A;  4JS4 A;  4ATO A;  1Y71 A;  4IUT A;  2RJD A;  3CMA T;  4OGE A;  3GP8 A;  4PJO A;  1KHC A;  2FHD A;  3QUI A;  3SWN B;  4XTY A;  2DZC A;  4BAC A;  3EFR A;  1X01 A;  3QSU A;  4EDU A;  1VQ6 T;  5DLO A;  4M7D G;  3OYN A;  2EQM A;  2ZPG B;  4BDY A;  1EIF A;  4O6J A;  2E1H A;  4R56 A;  2YRV A;  2QDY B;  1Q86 C;  3RKW A;  2DXU A;  3PFS A;  3T9N A;  3CC4 T;  3CC2 A;  3FJP A;  3GNG A;  1VQ5 T;  3PTA A;  3JB9 D;  3G71 T;  5LJ3 j;  4BY6 B;  5IAY A;  1M8V A;  2EQU A;  5HY6 A;  4JDS A;  2L8D A;  1N8R U;  2ZPF B;  2GFA A;  2MAM A;  2A3L A;  3C95 A;  3RKX A;  3S6W A;  1B34 B;  3VUB A;  4IUP A;  3KBG A;  3JRZ A;  4M77 E;  5CKF A;  5FU7 B;  3G6E T;  5GMK e;  4OGC A;  3VUZ A;  3LWH A;  2E12 A;  3OSS C;  3JB9 F;  5GMK m;  1VQP A;  4L5G A;  1BI1 A;  2IG0 A;  4XU1 A;  4XTX A;  4C5H A;  1N9R A;  5KH6 A;  4FIB A;  3HP9 A;  2EYQ A;  2K4Y A;  2E5Q A;  2MF2 A;  4M7A C;  2YLC A;  3M4Y A;  4N4H A;  4XK8 E;  2EQJ A;  3BW1 A;  3OS2 A;  3QJY A;  5GMK h;  4PL6 A;  3DLM A;  4C5G A;  2V8K A;  1OZ2 A;  2O4X A;  3VV0 A;  1YIJ T;  2DKG A;  1VQ7 T;  3A5Z B;  2M0O A;  5GAN d;  3OYM A;  1BI0 A;  2XHC A;  3G4S A;  2E6Z A;  4DOW A;  1WJQ A;  3M59 A;  4M78 C;  2RO0 A;  2RH2 A;  2XD0 A;  4E7L A;  3CCL T;  2JVV A;  3JCM f;  4DA4 A;  3VKI A;  3CME T;  4C0D B;  5GAN g;  5GMK l;  1QVG S;  1YCY A;  3LWI A;  3CXC S;  4N4I A;  3L2R A;  2IVW A;  2MI6 A;  1SSF A;  1G3Y A;  5GAO r;  3JCM h;  5IT9 E;  3V8J A;  1I8F A;  2QEX T;  4M75 D;  5M9O A;  2L3R A;  3CCQ A;  3CCJ A;  2E10 A;  3RER A;  1BI2 A;  1KQ1 A;  2FVU A;  4M7D A;  3R6O A;  4ZTJ A;  2LDM A;  1PSE A;  1V29 B;  1VQ9 T;  4EMK A;  1KD1 U;  4M7A E;  5GAN 7;  4LD9 K;  3DB3 A;  2KY9 A;  4OMF B;  3FLG A;  4RCB A;  2E70 A;  4PJO D;  3JCM J;  4L6V 5;  1OZ3 A;  2K2V A;  3QYG B;  4C8Q C;  3BFM A;  3CCU T;  4M75 F;  2JNG A;  2OTL T;  2RHX A;  4J7I A;  1BIB A;  3JB9 J;  4MDW A;  1WGS A;  1KHI A;  1QVG A;  2R5A A;  4E7K A;  3CXC A;  2EQK A;  3GOX A;  1K73 C;  4C92 G;  2FB7 A;  1D3B B;  4M77 A;  4XU3 A;  5GAM e;  1NJI C;  3HFN A;  4M78 E;  1UGS B;  4M75 B;  5GAM f;  2XDD A;  2DXC A;  2JZ2 A;  3LYI A;  4PJO F;  3JB9 H;  1W2B S;  3OMC A;  1MHN A;  3OW2 S;  1X75 C;  3NTI A;  1IZ6 A;  4PLI A;  1Q7Y U;  3CMA A;  5FRO A;  5AYF A;  1K8A U;  3M57 A;  1UGR B;  2KAF A;  4KUD K;  4D6W A;  2V8I A;  4QVC A;  1UGQ B;  2RJF A;  3E9G A;  3OQ5 A;  2RJC A;  1I81 A;  5GAM h;  4JRI A;  3FRN A;  3NTH A;  2VXE A;  2X4W A;  3QBY A;  4LDW A;  4M7A B;  2Y4Y A;  3CCM A;  4RCC A;  3OB9 A;  3OSV A;  3HRS A;  4HKE A;  2KQW A;  2PUO B;  5GMK j;  3GF5 A;  2KMT A;  3X28 B;  5LJ5 e;  4M7D C;  2RI3 A;  4ELZ C;  5CVI A;  2EKO A;  1QW1 A;  5CCA A;  2F5T X;  3LGF A;  2RB6 A;  2K3X A;  1M1K C;  4F7U E;  3QXE B;  4QVZ A;  4EMK C;  4C8Q E;  1D3B A;  1S72 A;  1Y96 A;  3OW2 A;  4IUQ A;  4HT9 A;  4A4K A;  3HL8 A;  1OYX A;  2QA4 A;  3CC7 T;  2GCX A;  3FC3 A;  2HQX A;  3MP8 A;  1M1G A;  4C0G A;  5LJ3 d;  1VQ4 T;  3OYJ A;  4KBM B;  1YHQ T;  2ZPE B;  3HRU A;  3M56 A;  3QHS A;  2XI9 A;  3FEO A;  4IUV A;  4M77 C;  3MO8 A;  3X26 B;  3EAE A;  2YLB A;  4ZN1 A;  5CR2 A;  2DXB A;  3I56 T;  2O01 E;  4RG8 A;  5GAO p;  3FB9 A;  3H8Z A;  5CKE A;  3RUX A;  5J39 A;  5LJ3 g;  4M7A A;  2WSC E;  3MEV A;  1GXI E;  3V8L A;  5C6S A;  3LLR A;  4C0Z A;  1W4S A;  3C94 A;  4YTL A;  2CYZ B;  5KE3 A;  2BKD N;  5D6Y A;  4FT2 A;  1N6A A;  1P92 A;  3GNF B;  5L8R E;  3CCS A;  2K5F A;  4RG2 A;  3P8B B;  2DXT A;  1UGP B;  2WSE E;  1U1T A;  3OMG A;  3CD6 A;  3HHT B;  3PGG A;  3JB9 I;  4M78 A;  4M7D E;  5A0D A;  3M5A A;  4M7D D;  1VQ8 T;  3JSC A;  3LX7 A;  4PNO A;  2DJZ A;  5GAN 5;  1DJ7 B;  2DO3 A;  1XQH A;  2O4X B;  2QTX A;  1N8R C;  5CQY A;  1Q81 U;  4PLL A;  4B9X A;  3X20 B;  3RMQ A;  1M5Q 1;  5FRN A;  1PSF A;  1JB0 E;  2RM4 A;  4Z02 A;  1IRE B;  1R8O B;  5GAN e;  2B8A A;  3BDL A;  5DLQ E;  3J81 E;  1VQO A;  4C0F A;  4MZT A;  4R55 A;  3CCR T;  2QEX A;  3S3N A;  2HAX A;  1RI0 A;  3URG A;  4M77 D;  4PKC C;  3A8H B;  5GAN f;  5KCO A;  2P4T A;  3VYG A;  2QQA A;  4BI8 B;  2DD5 A;  3GLX A;  4JRP A;  3KUF A;  4QW2 A;  4BE0 A;  1YJW T;  1YJ9 A;  2F69 A;  3GIB A;  5A2Q E;  1VQL T;  4QVD A;  2K3Y A;  4BD3 A;  4F7U A;  1M1K U;  1VQ9 A;  4M7D B;  2OTJ T;  4C8Q A;  2ZPI B;  5GAN h;  3PT9 A;  5CO7 A;  4HT8 A;  4EMH A;  5I21 A;  1M9S A;  3C12 A;  3JCM c;  3OBY A;  4EMK B;  1VQK T;  4M77 F;  2LT4 A;  2PQW A;  3P8D A;  3PNW C;  1FXX A;  3QO3 A;  1QVF S;  2ZGW A;  3M54 A;  3INZ A;  3L2Q A;  2X4J A;  1KQ2 A;  3JCM e;  1K9M U;  3O8V A;  3MEW A;  5LJ5 j;  1YJN A;  4Y28 E;  2D9T A;  3OS1 A;  3VYH B;  1YI2 T;  4M77 B;  1JJ2 S;  4XAX B;  1ZQ1 A;  2HQE A;  2GFU A;  1ZBX A;  3OBW A;  2A7Y A;  2K5L A;  4XU0 A;  3KXT A;  1YIT A;  1Q82 U;  4BI4 A;  5I2M A;  1G5V A;  3CPF A;  5CIU A;  1G3T A;  2PVD B;  4OVA A;  3X24 B;  3L2V A;  2FYK A;  3MEU A;  4KUI A;  2KK4 A;  3LW5 E;  2QQR A;  3MP1 A;  3S3O A;  1N9S A;  1NPR A;  1WQW A;  4J6Y A;  2R58 A;  5HK0 A;  3I55 A;  1KD1 C;  1QVF A;  5HKC A;  4QQ6 A;  3A8M B;  3E19 A;  3M58 A;  2FL7 A;  3HKS A;  2G3R A;  4BE2 A;  3WVD B;  4JUV A;  1XTD A;  4M7A D;  4E47 A;  2XU8 A;  1JJ2 A;  2XDP A;  2PVG B;  3QPH A;  2MWO A;  4LDY A;  2VV5 A;  4M75 G;  2E64 A;  4KT0 E;  2XKO C;  2DAQ A;  3RIR A;  3OYD A;  3V7C A;  2Y90 A;  2KSS A;  3RMS A;  1Y96 B;  3JAM E;  1LJO A;  1XNI A;  3HRT A;  3QII A;  3QG1 A;  5A0G A;  1Q7Y C;  3G7Z A;  1K8A C;  1KQS A;  4M78 D;  4GY5 A;  4MZP A;  4C92 E;  5KCH A;  2F5K A;  3OYC A;  4QQD A;  3L2Z A;  4PJO G;  3I56 A;  1VQP T;  4M7A F;  3MCA B;  2CZ7 B;  2H3J A;  2JN0 A;  2M1H A;  5GAO n;  5GAO m;  3CCV A;  2CKK A;  4IUU A;  1BI3 A;  4HCC A;  3QZ9 B;  1VIF A;  2ZCF B;  5LJ3 e;  1FX7 A;  3E9F A;  4N0A A;  3A8G B;  3BY7 A;  3ER0 A;  4Q5W A;  3TCJ A;  5GAN 8;  2JUF A;  3HFO A;  5D6W A;  3WXM B;  1VQ6 A;  3OYI A;  2K5I A;  5LJ3 f;  4M78 F;  2RHI A;  1VQM T;  3ZFJ A;  4L59 A;  3QKJ A;  1RL2 A;  2NLU A;  4MMK A;  5FU6 C;  2KDS A;  4A4H A;  3ASK A;  4RMO A;  3TU4 K;  5GAN 6;  5J3B A;  3CC4 A;  5LJ3 h;  4MDX A;  4UC4 A;  2LTO A;  3MET A;  4M78 B;  1VQ5 A;  3PIO A;  3CEY A;  3OS0 A;  3G71 A;  3CBO A;  4BUG A;  4BDZ A;  3ME9 A;  4C8Q D;  3DKM A;  3M53 A;  5GAO l;  2X35 A;  4XTW A;  2DIQ A;  3GPL A;  4TVR A;  3M4G A;  3G6E A;  3CCR A;  3OYY A;  3CCQ T;  1VQN T;  3CCJ T;  1X6O A;  2L89 A;  2DK3 A;  2RHU A;  2EJF A;  2Y4X A;  4OB0 B;  3LH0 A;  4F7U F;  2LCC A;  2VUB A;  4C8Q F;  1YJW A;  3QZ5 B;  4O5V A;  4HA8 A;  3UWN A;  1O9S A;  2CGH A;  2EWN A;  3DB4 A;  3OYL A;  3QYH B;  4N0A C;  4F7U B;  5CAI A;  2AHJ B;  4C8Q B;  1BYM A;  1NPP A;  2LVM A;  2QI2 A;  4JRK A;  2WSF E;  3UPU A;  2PVO B;  1YIJ A;  1VQ7 A;  1H64 1;  1Q81 C;  1TH7 A;  2OAU A;  3TEE A;  5CK9 A;  3TRE A;  4LDX A;  4XTV A;  2CS7 A;  4C92 A;  4A4F A;  2PUK B;  3CCE T;  1M4Z A;  2CZ6 B;  3JCM V;  4NL3 A;  4C0D C;  2L5Q A;  2QXF A;  3H6Z A;  5EG2 A;  3CCL A;  4C5E A;  4X9C A;  5LJ5 d;  2HD0 A;  3MEA A;  3CME A;  1AHJ B;  2LC4 A;  4GLK A;  1HK9 A;  1FWZ A;  2DTI A;  2EJG A;  4XTU A;  5GMK i;  5CKH A;  3SFM A;  4C5I A;  3L2U A;  4NOY A;  1O75 A;  3MP6 A;  5GAN 4;  3L2W A;  1NZ9 A;  3CCM T;  1MGQ A;  5GAM j;  3M55 A;  4J6X A;  4M7D F;  4A53 A;  5C0M A;  5I2S A;  5LJ5 g;  2LCL A;  2MWP A;  2RHY A;  3SD4 A;  1XOV A;  4ZGD B;  1WJR A;  1LNX A;  1WPY A;  2P0P A;  2X4X A;  3M9Q A;  4FU6 A;  4KUL A;  3X25 B;  4ZGE B;  3JB9 G;  2BIV A;  2YHT A;  2DZ9 A;  2VGN A;  4JLI A;  4X9D A;  2GQV A;  2RI5 A;  5CKB A;  5FU6 B;  5IN1 A;  2WAC A;  3OYK A;  2RJE A;  1WJS A;  5GAN 2;  3PMI A;  1BKB A;  3F70 A;  4J6W A;  3CBP A;  1S72 T;  1Q86 U;  2EAY A;  2EIF A;  3V7S A;  1I4K 1;  2DD4 A;  2XID A;  5HK3 A;  3CCU A;  4M77 G;  1QVP A;  5A0L A;  2QA4 T;  1K9M C;  2OTL A;  2RD1 A;  2DTH A;  5J26 A;  4QQG A;  1UB4 A;  1VUB A;  2QQ9 A;  4Y91 A;  4JRQ A;  1QP3 A;  4OB3 B;  4M75 C;  1U8R A;  2CZ1 B;  3Q1J A;  4BB7 A;  2HBP A;  4XQ3 A;  1WNL A;  3EFS A;  2D0Q B;  4J5Y A;  3P8H A;  3SWN A;  1Q82 C;  3NFC A;  4C92 C;  2DVE A;  2VC8 A;  4J7F A;  5CKD A;  4IUR A;  4MZM A;  4EPC A;  3V8K A;  3DLL A;  2E41 A;  1I5L A;  3S3M A;  4PJO C;  1JRI A;  4DQ2 A;  3UDC A;  1G3W A;  2VXF A;  1M1F A;  1U1S A;  3CCS T;  3VU3 C;  2EJ9 A;  2BUD A;  2ZPB B;  4A4E A;  4E7I A;  2ZPH B;  3JCM P;  3CPW S;  1KQS S;  2DPP B;  3CD6 T;  3L42 A;  1VQM A;  3OYH A;  4A4G A;  3OYA A;  3PIP A;  2VGM A;  2XIC A;  2M16 A;  3A8O B;  2KVQ G;  3JCM W;  3CC2 T;  4MML A;  3V7R A;  3ZBD A;  5GAN 3;  3OYG A;  2GF7 A;  5DM7 R;  3PMT A;  2LRQ A;  2LT1 A;  2E6N A;  4NL2 A;  1B34 A;  2VYT A;  2RK2 A;  3QJ6 A;  1KC8 C;  2R57 A;  2LQK A;  3CC7 A;  3OYF A;  1WQ7 A;  4FT4 A;  3WVE B;  3OS5 A;  4ELY C;  1VQO T;  4M75 E;  4ZN3 A;  1VQ4 A;  1YHQ A;  3BDU A;  3L1A A;  3JCM b;  1KC8 U;  4HCZ A;  3JCM Q;  1OI1 A;  2M9U A;  2ZZD A;  4II1 A;  1Y07 A;  1VQN A;  3CPW A;  2LQ8 A;  3CBM A;  3HPW A;  4M7A G;  4RKU E;  1M90 C;  2RHZ A;  3RKY A;  5FRM A;  3OA6 A;  4C92 D;  3HSB A;  3SWN C;  4CI0 C;  1YJ9 T;  2P0K A;  4LDV A;  3JCM d;  3AHU A;  2DTO A;  1M90 U;  4B9W A;  4PJO E;  3VJP A;  3LGL A;  4FL6 A;  2DIG A;  1JBM A;  4E7J A;  5GAN j;  3FDR A;  3OYE A;  2XDB A;  5FLX E;  4M78 G;  3SB2 A;  3JCM g;  1HXD A;  2I2L A;  4OF1 A;  4JJN K;  1QP2 A;  4C92 F;  4HCB A;  3RES A;  3G4S T;  3A8L B;  4BE1 A;  1YJN T;  4ZTF A;  3N5B B;  3QDR B;  4OB1 B;  4P5N A;  1VQ8 A;  3CCE A;  1K73 U;  3FIF A;  4J83 A;  1BIA A;  4BY6 C;  2P0Q A;  1NJI U;  1N27 A;  5LL6 S;  2LNV A;  1ZHI A;  2CZ0 B;  4CRI A;  3JCM X;  1LOJ A;  1G3S A;  4C92 B;  5D6X A;  1YIT T;  2QQS A;  2X4Y A;  4EMG A;  2XG8 D;  4V2S A;  2JOY A;  4LDU A;  5KE2 A;  3OYB A;  2R5M A;  5FU7 C;  4N4G A;  4NS5 A;  1Y7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...