4M7AF

Crystal structure of lsm2-8 complex bound to the 3' end sequence of u6 snrna
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
80
structure length
66
Chain Sequence
b'AILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMNARKLGLTVIRGTILVSLSSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
molecule tags Rna binding protein
source organism Saccharomyces cerevisiae
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
total genus 8
structure length 66
sequence length 80
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7aF00
3V7SA 4C8QD 1KQ1A 5GAOr 4M7DA 5GAOl 4F7UB 2DTOA 5CAIA 4HT8A 1Y96A 4C8QC 2DZCA 4M77E 5GAOn 1U1SA 3RERA 2DXUA 2E10A 3QHSA 4HA8A 4A53A 3SB2A 5LJ5d 5LJ3j 5GANf 4C8QA 5GAMj 4XU0A 3JCMg 4M7DC 3FJPA 1BIAA 4JRIA 5GAN8 1KQ2A 4EMKA 3QO3A 2RB6A 3RKWA 2DXTA 4F7UF 3JB9H 2DZ9A 5GAN5 3V8KA 2DVEA 4A54A 4F7UA 2DTHA 5DY9A 4Y91A 5GMKi 1H641 4PJOD 1I4K1 1D3BA 4EMKB 1B34B 1D3BB 5GAN6 5GMKj 3BDUA 4PNOA 3BW1A 3V8LA 5LJ3g 5LJ5e 4M75B 5GAMg 5GAOp 5GAOq 5LJ3h 3EFRA 4JLIA 4M7AD 2DJZA 4M78E 3RUXA 5GANe 4M77A 1I8FA 4M77D 2DKGA 4M75F 4N0AC 1YCYA 3EFSA 1WQ7A 2E65A 2EJ9A 3PGGA 3V7RA 4C92E 5I21A 5LJ5g 3JB9D 5GAMe 4PJOA 4PJOE 4QVDA 4M75A 4C92G 4M75E 4XTZA 2JN0A 2EJGA 4PJOF 3RESA 2Y90A 4M78G 3RIRA 4EMKC 4C8QB 2VXFA 2K57A 3JCMh 1I5LA 4JRKA 3JCMd 4RCBA 4PJOB 3INZA 2RD1A 4M7DF 5GAN3 4X9CA 4M7AC 3JCMV 4M75D 4M77C 5GANg 4XU2A 2RM4A 2EAYA 3JCMb 3JB9J 1MGQA 3SWNB 3JCMf 3M4GA 4M7DB 5GAMd 2E64A 5GAN2 3JB9F 1B34A 3HFOA 4MMLA 4C8QF 1M5Q1 4QVCA 4M7AE 5LJ3d 4J6WA 2EWNA 1BIBA 2FB7A 2HNIA 4RCCA 4XTWA 4XU3A 5GAN7 1M8VA 4M77B 3JCMQ 4C8QG 1HK9A 1X01A 4M7AB 4EMGA 4F7UE 3FIFA 2EJFA 2YLBA 4NOYA 5LJ3f 5GANj 3RKXA 4M7AG 5GMKh 1LOJA 2VC8A 4M7DE 4M77G 3GIBA 3JCMc 4WF2A 1HXDA 4J5YA 5GMKe 4C92F 5LJ5j 2VXEA 3JCMX 4M7DG 4N0AA 4XTXA 2QTXA 4M78C 3BY7A 4XTYA 4C92D 4EMHA 4XTUA 5GMKm 5LJ5f 4M75G 4C92A 3JCMJ 3JCMP 4M77F 5GAN4 1TH7A 2DEQA 4XTVA 4C8QE 1JBMA 5GANd 4M7AF 2YHTA 5GANh 3AHUA 4MMKA 4HT9A 2DTIA 3SWNA 5GAMh 3QSUA 4M7AA 3V7CA 4X9DA 1U1TA 4C92B 5LJ3e 4NL2A 3QUIA 4PJOC 5GAOm 2ZGWA 2E41A 4OP0A 5LJ5h 4M78B 3SWNC 2YLCA 3JB9G 2I2LA 4M75C 3L2ZA 4M78F 1N9RA 2RA2A 1JRIA 3V8JA 5GAMf 4C92C 5GMKl 4V2SA 4M78D 4DQ2A 3BFMA 1LJOA 4M78A 4JUVA 4M7DD 4XQ3A 3JCMe 1LNXA 3RKYA 4F7UG 3JB9I 1Y96B 3HSBA 3L1AA 2CGHA 4XU1A 1I81A 2E1HA 3FB9A 3HFNA 1WQWA 1WNLA 1WPYA 4J6XA 4J6YA 1N9SA 4PJOG 3VU3C 4NL3A 3JCMW 2FYKA
chains in the Genus database with same CATH superfamily
1EZZB 1XJWB 1QVFS 1IRXA 2IPOB 4C0DC 1VQOA 5KE3A 4N4GA 1YI2T 2JS2A 4D6WA 5C0MA 1E7OA 3EGXB 3EGDA 4EPCA 2P0QA 2OJ2A 3GOXA 4PJLA 2ABLA 4RMOA 1G8XA 1JEGA 4EMKA 3RKWA 1ABOA 3M55A 2EGAA 3OYEA 3CXCP 1KC8U 2DERA 3OYJA 2A0FB 5DY9A 1VQNA 5GMKj 4PNOA 1NLOC 2NUTB 2A7YA 2ZPHB 3NTIA 2GQIA 4C92E 3JB9D 3L2QA 2XKOC 2KSSA 3RIRA 1X2QA 3JCMh 1GFCA 2CT4A 3T9NA 4IUTA 3G71A 1VQMT 2VGNA 2CZ0B 1OQKA 2DVJA 2P4TA 4XU2A 4JJDA 2J06A 1OX9A 1IREB 2E64A 3JB9F 3HFOA 2ESWA 2FEIA 1WHMA 2EWNA 2PQWA 3VS6A 1PD0A 4E7ZA 3A8GB 1JU5C 3A8LB 3CCMA 3RR6A 4JZ3A 4C5HA 3JCMJ 4M75G 2DYBA 3JCMP 2ZAEA 2KDSA 3QSUA 3EH1A 4LXCA 1M1GA 2M02A 3CEYA 1Y0MA 8AT1B 1Q81R 3QUIA 1UECA 3C95A 4KGVB 5D6WA 5KE2A 4J7FA 3SFMA 2C06A 2J6KA 1I0CA 4VUBA 3VS2A 4C92C 4V2SA 4DQ2A 3H0FA 4M78A 1PRMC 1OZ3A 4OMNA 4J9BA 3MPUB 2K79A 1OPKA 1D0ZA 1I81A 4BACA 4Y92A 1BI1A 2EQJA 5FU6B 1MMAA 2RQRA 1N27A 3OS0A 5GAOr 2CP0A 4X34A 4ZN1A 1O9SA 5DLQE 3NMZC 2KRNA 3CCEA 1KQSP 2KGTA 4ELYC 2X4XA 3A8MB 4A4HA 3CMAT 1M2VB 2DL8A 2CP3A 1HD3A 4IURA 1VQPA 5FLXE 1G5VA 3L42A 1NBEB 1D3BA 2HSEB 2NWMA 1D1AA 5EG2A 3I35A 2V26A 2DMOA 3UPUA 2A3LA 1NPPA 3J7AF 1YCYA 4ANJA 1C1AA 1UJYA 3OYFA 3H41A 4CC7A 2XMFA 4JRPA 2E3IA 5CR2A 1O75A 4FCYA 2X3XD 2O9SA 2GTOA 5GANg 4J8OA 2PVGB 3L2RA 2LQWA 3JB9J 2DJQA 4E7IA 3KBGA 2QA4T 3PVQA 2QQRA 2HAXA 2JJ9A 2ZZDA 3OW2A 4C8QG 1X01A 4F7UE 1Q82C 2F5TX 1LOJA 4ZTJA 1FMKA 4WF2A 4BE2A 4C92F 4C5GA 1B7TA 1BKBA 1K8AR 1G83A 1RAEB 2G3RA 2L3QA 1WX6A 4RTXA 1VQ8Q 3V7CA 3G6ET 1KQSA 4RTZA 1K9AA 5GAOm 2K3XA 4ZGJB 2E6ZA 4MZTA 2I2LA 2J7IA 3OYLA 3CCRT 3KXTA 2DETA 2FRYA 2BZ8A 4FT2A 1VQ9A 3GNFB 3JB9I 4QT7A 2E1HA 4A63B 3OA6A 2X9HA 3S3MA 2NUPB 1KQ1A 2DRMA 1YIJA 3CC2T 1BK2A 4C8QC 1KK7A 1U1SA 1VQMA 3CQTA 4F16A 5KYWB 2O4XA 2RJEA 1K1ZA 2XK0A 3OW2S 1TOVA 3FJPA 3DLLA 2DXTA 3OYMA 3THKA 2YT6A 2X4YA 1N8RC 2AZSA 1RAAB 2O31A 4FSXA 1X6GA 3EGUA 2EQMA 5LJ5e 2DXBA 4R56A 2RPNA 3DB3A 3P8HA 2GQVA 3X25B 3EFSA 3V7RA 1W1FA 2VWFA 1OOTA 5CKBA 3CXCA 2JN0A 3MO8A 1YITA 5FROA 2JS0A 1IB8A 2D6FA 5KYXA 5DLOA 5CVIA 1JO8A 2GBQA 2EAYA 1HJDA 2KBTA 2KMTA 4KT0E 4QVCA 5GJWB 1BIBA 4P5NA 4XTWA 3EHQA 1M90U 3EHRA 1IGUA 2RO0A 3UDCA 2KYMA 3VV0A 2LNHB 3CMAQ 1D0YA 2VC8A 3CCET 1BI2A 1TUGB 2LQNA 4C92A 2LX9A 3TSWA 3QYGB 2IIMA 5GANh 1SF9A 1U3OA 3OBYA 2RI5A 2LCLA 4LUEA 1VQPT 1YJNT 3CCRA 3JB9G 1E6HA 3CBPA 4HKEA 1K0XA 1PNJA 2F5KA 1LNXA 2DA9A 4OB0B 1KSWA 1UGSB 2X4WA 1YJWT 4LDVA 1M1KC 4F17A 3VRYA 4RTUA 5GANf 5CKEA 1QP3A 1KJWA 1BIAA 1CKBA 2X4JA 4OVAA 4Q5WA 2MWOA 3ULRB 3PTAA 3BE3A 2FHDA 2DVEA 3X20B 2KQWA 2YUOA 2K7AA 4QQDA 2HL3A 3BDUA 2QEXA 3JAME 1TUCA 3RUXA 2KK4A 4CRIA 3CMEA 4PJOE 2LP5A 3WXMB 2DBKA 3CCMT 3M5AA 3RESA 2MPXC 4LNPA 4EIKA 2JT4A 1OU8A 4AMCA 3IQLA 5GAMd 5IT9E 4ZGDB 4YTLA 4EDUA 3CC7A 2LMJA 2JW4A 1YJ9A 3PMIA 1OU9A 1YHQT 2EJFA 1YCSB 2B86A 3R6OA 2YXYA 1QVFA 2KVQG 3SDZA 4DBHA 3L2UA 2VYTA 2DEQA 4BE0A 3TEEA 1K0SA 1NE8A 1UG1A 1Y57A 2VKNA 3CC7T 1YJNA 4HCKA 3SWNC 4J9CA 4C0GA 2KXDA 1QW1A 2F2XA 1X2KA 3C0CA 1KIKA 3H8ZA 3QZ9B 4XQ3A 2EKHA 2X3WD 1ARKA 2P0KA 3QZ5B 3G4SA 4D8DA 1JXMA 1VQOT 2RHIA 5J39A 4CC3A 1G3TA 5GAOl 1UGQB 1M3BA 1A0NB 1PKSA 4CI0C 3RBBB 5GAOn 2E10A 4E2FB 3H9NA 2D9TA 1SHGA 1PSEA 2DRKA 2QQ9A 1ZSGA 1W2BS 4ZNXA 3TVTA 7AT1B 1PWTA 3OS2A 1H8KA 2KI7A 1Y71A 4E7KA 4PFOA 2KROA 2QA4A 1PRLC 3S6WA 2LRQA 2Z0WA 3L2VA 1AWWA 2F2WA 4M78E 2MWPA 1K73U 1XOVA 1FMVA 5LJ5g 3GPLA 2SEMA 2FVUA 1ZBXA 3G6EQ 4JPBW 2R5MA 4J83A 1VQKA 2EYQA 1UGPB 2E6NA 4AFZC 1VQNQ 4II1A 4PLLA 4JRKA 2HCKA 3INZA 4FYVB 3SHWA 2GCXA 4F14A 2RM4A 3JCMb 1B34A 3L2WA 3G4SQ 1MV3A 2RH2A 5KCHA 4BE1A 1YJ9Q 3ZL7C 4KRTA 4Z8AA 2AK5A 2FO0A 2ATCB 4GLMA 2DL5A 2RQTA 1JXOA 2JUFA 3FLGA 1Q86U 1MNDA 2A08A 2K3YA 4OMMA 5J3BA 3VUBA 2P0PA 2C0OA 1XQHA 2YSQA 1QKXA 4FT4A 1JQQA 2DTIA 2WSEE 1M90C 1VQLT 1PM3A 4FIBA 3OSSC 2Y4YA 2NUZA 4C92B 3A5ZB 2D1XA 2QDYB 2HKQB 3M4YA 5KYYB 1VQ6A 3P8DA 3CCMQ 1AD5A 2DO3A 4RTWA 2XD0A 5M9OA 3CCUA 2W0ZA 2MCNA 1RUWA 2RJFA 1WXBA 1WQWA 1N9SA 2P4RA 2PNIA 3OBWA 2D0QB 3CD6A 1ZX6A 1IGQA 3JCMg 3MEAA 1WJSA 3CCSQ 2PVDB 4RG2A 3VS7A 2C0TA 4BDYA 2RMOA 4PL6A 1M3AA 1LCKA 1QWFA 9ATCB 1KFZA 3V8KA 1YI2A 3GBQA 2BZXA 2QAZA 1D3BB 4IUPA 2ZPGB 2DJZA 2DNUA 3ZFJA 3E2UA 2YRVA 2LVMA 2EJGA 4LUDA 3UF4A 3OYAA 2Y90A 4KBMB 3LWIA 1VQNT 4DBFA 2HDAA 1WHGA 2KAFA 1WXUA 1ZQ1A 1QP2A 3CC4A 4BI8B 1G2BA 1K4US 1RLQC 1S72A 4XAXB 3U23A 2QQBA 4M77B 2CP7A 4IUUA 5C6SA 4OMFB 1B07A 1HK9A 3ZEHA 3FIFA 4E7HA 1I5OB 1ZSZA 5KYUB 2LT4A 3MP1A 2L89A 1BB9A 5FWCA 4M77F 5GAN4 1M2VA 1JBMA 4RTVA 2KY9A 4M4ZA 2CSQA 3META 1VQ6Q 3EG9A 1C0MA 1YJWA 4CC4B 2ZGWA 1M30A 3EFOB 3NPFA 5FU6C 5ECAA 3OY9A 2BZYA 4BUGA 1S72T 3F70A 3OW2P 1PC0A 1BI3A 3VS5A 4L6V5 3LX7A 1VQ7A 5HKCA 3FJ5A 4N4IA 1Y96B 1FXXA 2FYKA 2AZVA 2GTJA 1XTDA 1NLPC 3NHNA 3NGPA 3M0UA 1TUDA 4X1VA 1VQ8A 2DFUA 1VOMA 3EAEA 1EIFA 1I1JA 2M1HA 2JTEA 4BDZA 2DZ9A 2K5IA 5GAN5 1D09B 2COZA 3C94A 3NFCA 4A54A 4A4FA 5IHIA 4N4HA 5I11A 1RADB 4KH0B 1OULA 2JVVA 3H6ZA 2QGFB 4LD6A 4B9XA 4DOVA 3EFOA 1VIEA 1M27C 1YHQA 3QJ6A 2EKOA 3CBMA 3PE0A 4M75E 4JS4A 4DA4A 1VQ5Q 5D6XA 3X28B 1TTHB 3KUFA 4PJOB 2O9VA 1AHJB 5KYUA 1BI0A 8ATCB 3TREA 3A1PA 2BIVA 2VV5A 2XDPA 4J6WA 1OPLA 3CCJT 1MMGA 2YUPA 2HQXA 2DEUA 2QEXT 3CC4Q 4LDXA 5GMKe 4M7DG 4WTOB 1FYNA 1KD1C 3HKSA 1TH7A 2EGCA 2GGRA 1MV0B 3X24B 4X9DA 2L2PA 4HCCA 3VS3A 4PFPA 3CMEQ 4M75C 1QVFP 1M8MA 1MNEA 4J9HA 4XK8E 1Y07A 5A0DA 1NG2A 1WHJA 4XU1A 2ROLA 3MP6A 1YJWQ 1M1KR 3QDRB 2GFAA 4JJNK 3JCMW 4MZPA 2CH4A 2O01E 2EBPA 4NS5A 5FU7B 3PMTA 2YDLA 4A53A 3J80E 1K9MU 3SB2A 4E7SA 2KT1A 2VASA 4R0KA 1N5ZA 1H3ZA 3I56A 2LJ3A 4M7DC 2LX7A 1UE9A 3OMCA 4DBQA 3QG1A 2RK1A 2LQKA 4FW2A 4OMQA 2FRWA 1UDLA 2JTMA 4PJJA 2OTLT 2E65A 1KC8C 3RNJA 4QVDA 2ZCFB 1RAFB 2A36A 1TWBA 4M78G 1U8RA 1I5LA 1MMNA 4DOWA 5IXBA 1NJIR 2RHYA 3OYNA 1JJ2A 2RN8A 5I2SA 2XIDA 2I0NA 2RQVA 4ESRA 1X75C 1CSKA 1ZHIA 3CPWP 3QDFA 3LLRA 3JV3A 5GAN7 4LE9A 1M8VA 2F69A 4JJBA 4EMGA 1RI9A 2RK2A 1HYOA 2CUDA 5GMKh 1YITT 4M7DE 1IHVA 3QWXX 1HXDA 3CMAA 2J6OA 2MF2A 3RDVA 1RLPC 4M7AF 2D8HA 5CO7A 3CCUT 3AT1B 3SWNA 1P92A 3CD6T 1D1BA 5IHKA 2JXBA 1U1TA 3MEVA 4HVUA 4J7IA 5CKDA 1YBYA 2V8IA 1ZUUA 3O5ZA 2PVOB 1B3QA 1NYGA 3L2ZA 2H3EB 2KXCA 2ROTA 2XU8A 1QCOA 4QQGA 4ZGEB 5HK0A 4FW1A 4PLIA 3RKYA 3CPWA 2WACA 3VU3C 2K3BA 1AWXA 2DYIA 1N8RU 4HCZA 1KHCA 2YWWA 3A8OB 2J05A 1YNZA 2IVWA 4R55A 3PIPA 4JRIA 4F7UF 5CIUA 2RNAA 1VYVA 5GAN6 3CCQQ 5GAOq 1Q7YR 5D7UA 4M77A 4M75F 3JSCA 2EJ9A 2LT1A 2EQIA 2HL5C 3DKMA 2MIOA 4ORZA 2FPEA 2XG8D 4FM4B 3ME9A 4EMKC 4C8QB 1VQ7Q 1R0CB 2L3RA 3M58A 2ZPBB 1UB4A 2EYZA 4PFZA 4J9EA 5AYFA 1TU0B 4RTTA 1KHIA 1YN8A 4C8QF 4RCCA 4KGZB 1FX7A 3R6NA 4B9WA 2YLBA 2EQKA 1Q86C 3M59A 3I56T 5LJ5j 1XNIA 2GF7A 2EYYA 4LDYA 4OB3B 2VVKA 4C8QE 2OTJA 1K9MR 1BCMA 1V29B 1M3CA 1WLPB 1X6BA 2PTKA 1FWZA 4PJOC 2E12A 2E41A 2QQAA 4QQ6A 4GLKA 2DX1A 3SEMA 4LN2A 2LQ8A 4LD9K 1F1BB 2CP2A 2NUPA 1JRIA 3M0PA 5GMKl 1AVZC 1SHFA 1QVGS 1GBQA 5CCAA 3L1AA 4FYXB 3FB9A 3VYGA 2KE9A 4PJOG 2MYSA 4JJCA 2OAWA 2JZ2A 3M0SA 5CAIA 3MEWA 3FEOA 1SPKA 2M51A 4AT1B 3OYYA 1ZSZB 3HL8A 3UA6A 3EGDB 4XU0A 1QVPA 4RTYA 4FYWB 3CCEQ 2EQUA 1WYXA 1QCNA 4AFUC 4B6MA 2DTHA 4Y91A 2AKLA 5GMKi 3CC7Q 2ED1A 3SD4A 3CD6Q 3V8LA 3BW1A 4M75B 2H3JA 1K9MC 2DKGA 2E5KA 4N0AC 1M2OA 3OYKA 2DD4A 3E9GA 2CYZB 1VUBA 2FZCB 2K57A 2DM1A 3CCJA 3JCMd 3EG1A 1GL5A 2LCCA 1QMCA 2BE9B 1PHTA 4M77C 4BI3A 2RJCA 1WHLA 5KCOA 1V1CA 5CK9A 4MMLA 1QKWA 4HVWA 1K76A 1YITQ 3VRZA 2NLUA 2YRCA 4PKCC 3QXEB 2C0IA 1ZA2B 2JM9A 2AT1B 1NJIC 4XTXA 1OX8A 3M0TA 2OTJQ 4K11A 2LDMA 2FZGB 2YHTA 3QPHA 3ASKA 4HT9A 1R0BG 2OAUA 2E3HA 1RAIB 1VQ5T 3MHXA 1VQLQ 2DL3A 5I22A 4M78B 1IO6A 1S1NA 2RQUA 1U5SA 3PT9A 2RF0A 4UC4A 3V8JA 4M78D 4C5IA 4Z88A 3GNGA 2HBPA 2RJDA 3CCLT 1K73R 2CZ1B 4J6YA 4NL3A 1GCQC 2VB6A 4M7DA 3HRSA 1Y96A 2KNBB 4LDWA 4HVVA 4M77E 2QA4Q 3QHSA 1X69A 4MZMA 1BYMA 1MMDA 1UTIA 4OMPA 4FL6A 2RB6A 1AEYA 2XDDA 5IHNA 1BU1A 2D0NA 4PJNA 3QWYA 3CCVT 1VQKQ 2WSCE 2FPFA 3M57A 2DL4A 4PJOD 1B34B 3HP9A 1JJ2S 2E70A 5GAOp 4RG8A 3EG3A 2WSFE 3GP8A 4OGEA 2ZPIB 2L3PA 5L8RE 3OYCA 2NUTA 4C5EA 3EG2A 5IH2A 1WA7A 4GBQA 2RD1A 3OB9A 2EYWA 3JCMV 2HMAA 2HSPA 3RMSA 1SKUB 2X51A 1Q82U 2FPDA 1TSFA 3GLXA 2EIFA 2QK0A 3CCVA 1GCQA 1M5Q1 1G3YA 4JRQA 1Z9QA 1AZEA 1NJIU 2OX7A 4M7AB 2YUQA 3RKXA 2KRMA 1KD1U 4FU6A 2M16A 3O8VA 4EMHA 3GF5A 1RACB 1IHWA 1VYUA 3EGXA 3VUZA 2QG9B 1Q95G 2RI2A 4JLGA 2DE0X 2HKNA 1WHHA 2XICA 1QVGP 4NL2A 2JM8A 3UT1A 2VUBA 4AG1C 1G3SA 4IUVA 1TG0A 4BY6B 3BFMA 4M7DD 1OZ2A 2EW3A 2OI3A 4ME7A 2M0YA 1VIFA 2LJ0A 1WNLA 1WXTA 2L0AA 1VQOQ 1K8AU 4A4GA 5KYNA 4F04B 2JOYA 3I9QA 1Z9ZA 4GY5A 2K5LA 5CKHA 3NTHA 4C8QA 2MAMA 2QASA 5HCKA 1Q81U 3P8BB 4J9GA 1OEBA 2LC4A 1Y7XA 1MHNA 4C0DB 5IXFA 4HXJA 3D7SB 1W4SA 1N8RR 3EH2A 3M54A 1SRLA 1W6XA 2EVRA 1VQ8T 2YUNA 2LTOA 2Y4XA 5GANe 4KUDK 3VS0A 3HRUA 3CXCS 1SG5A 2OTLA 4BB7A 1K8AC 2M9UA 4XTZA 5CQXA 1KD1R 3S3NA 1JJ2P 3M56A 1ABQA 1LVKA 2L3SA 4M7DF 1Q86R 2AIRB 3VS1A 2EGEA 3I55T 1Q81C 1GBRA 1ZSZC 2R58A 2MOXA 4M7AE 2FB7A 4ZTFA 1WFWA 5IN1A 3JCMQ 1AWOA 2A37A 4M77G 3NTKA 2EFIA 4XTYA 1H3HA 1UGVA 2KR3A 1KG1A 2X35A 3CPWS 1VA7A 3HPWA 3AHUA 5KH6A 1U06A 2PUKB 3I55A 2CKKA 2F2VA 2KYBA 5IAYA 2HD0A 1M9SA 1VQ6T 4A4KA 2DD5A 1SRMA 4M78F 1N9RA 2OTLQ 2FZKB 4F7UG 4MDWA 2CUBA 1TS9A 1WPYA 1VQ4A 4QKUA 3A8HB 4ELZC 1GRIA 3VKIA 1M1FA 4C8QD 4OB2B 3I5RA 2DTOA 3X26B 2DZCA 4J9IA 4J9FA 3MJXA 4KH1B 3QYHB 2DXUA 3RERA 3MKDA 3M0QA 2QEXQ 2E4HA 5LJ3j 5GAMj 1H92A 2YRDA 1YHQQ 3QBYA 4WCIA 5GAN8 3RMQA 2L8DA 3JB9H 2PU9B 1NEGA 2DK3A 1ZBJA 5CQYA 3PIOA 4KGXB 1NEBA 2K2MA 3EFRA 3HHTB 3CMET 1I8FA 3OYIA 1WI7A 4PJOA 3EG9B 5GAMe 3PNWC 4JZ4A 2FG0A 3OYGA 2O4XB 1T3LA 2LNVA 1PG5B 3TCJA 2HQHA 4C0FA 2CP5A 3OS5A 1SSHA 4DBRA 4IIOA 1VQLA 1RAHB 1NPRA 2CSIA 1WGSA 4KULA 3QJYA 2CZ7B 4XU3A 2KRSA 1X6OA 3QKJA 3LW5E 3OQ5A 4OGCA 3PFSA 3OSVA 5LJ3f 2CDTA 3GIBA 1TXQA 2OTJT 2QTXA 2BUDA 2BTTA 3PVLA 1AOJA 1WDXA 4PK4A 3FC3A 2DIGA 4XTVA 2CZ6B 3UWNA 4M7AA 1VQKT 1VQ9T 4IUQA 4BI4A 2D8JA 4D8KA 3UATA 4E47A 5LJ3e 5A0LA 5AT1B 4FYYB 4OP0A 2ED0A 4Y28E 2AKKA 2GNCA 1E6GA 4TVRA 3FRNA 1S72Q 1WHKA 5GAMf 2RI3A 1LJOA 3G7ZA 2CS7A 1GFDA 3M53A 2CGHA 3I55Q 3OYDA 4FSSA 4J6XA 3H0HA 3CC2Q 3JRZA 3URGA 2DIQA 2R57A 3C4SA 3BDLA 4JS5A 5KYXB 1YJ9T 5FWBA 1JB0E 1YFNA 3QIIA 1WJRA 4DEXA 3LYIA 4HCBA 2FL7A 3QO3A 2W10A 3CC4T 3LWHA 3CCVQ 1C6VX 1ZUYA 2V1RA 4F7UA 2O88A 2ECZA 1IZ6A 1UEBA 4EMKB 2RQWA 2G6FX 1HSQA 4KUIA 3OS1A 1PCXA 1M90R 4AFQC 2LJ1A 1OV3A 2QTVA 4M75A 5L23A 5A0GA 1KC8R 4PJOF 1T0JA 3LGLA 1OI1A 2MI6A 5FU7C 3CCLQ 3DLMA 2VXFA 3N5BB 1UJ0A 1MUZA 1NYFA 1W2BP 1SEMA 1ZUKA 1J3TA 2ZPFB 5LL6S 1EX4A 4M7DB 1MGQA 3SWNB 3G4ST 1W2BA 2EPDA 3DB4A 1QWEA 2HNIA 4IKFA 3WVDB 2PZ1A 2RHUA 4IIMA 4OF1A 3OYBA 2CP6A 1WJQA 2ENMA 3JCMc 4J5YA 2VXEA 4N0AA 2H8HA 5LJ5f 1RL2A 5GMKm 3S3OA 5A2QE 3J81E 5GANd 4A4EA 2L5QA 1VYTA 2RHXA 1VQ9Q 5HK3A 1W70A 3G6EA 3VS4A 1M1KU 1PKTA 2QDLA 3M0RA 2IG0A 2HEQA 2YLCA 1RABB 2DXCA 2QQSA 1T3SA 3G1JA 1V76A 3TU4K 2JMCA 1CKAA 5KYYA 3JCMe 1YIJT 3CC2A 3CCLA 1BBZA 1YWPA 1AT1B 3HSBA 1I07A 1AZGB 2O2OA 3G71Q 4E6RA 3V7SA 3C12A 2P84A 4F7UB 1VQ4Q 4HA8A 4L59A 1IXDA 5DM7R 3KFVA 2COYA 5GJVB 2LZ6B 2V1QA 4QVZA 3MP8A 1R8OB 1G3WA 2NYSA 1H641 1D1CA 1I4K1 5LJ3g 1M4ZA 5GAMg 1OYXA 5HY6A 2RHZA 2DBMA 1WQ7A 5I21A 4Z89A 4O6JA 1N6AA 4Z02A 1UUEA 2HZYA 1UGRB 4QW2A 1QLYA 3CPFA 4OMLA 4RCBA 2B8AA 3VJPA 3FDRA 2BKDN 1YIJQ 1K73C 4AG2C 4ATOA 3JCMf 2K9GA 3I5SA 1AWJA 1VQMQ 5D6YA 2LCSA 2QI2A 3OYHA 2MMPA 1WZOA 4C0ZA 3ER0A 1DJ7B 4NOYA 4O5VA 4AFSC 4M7AG 1SSFA 2QGGA 2EYXA 3Q1JA 2SRCA 4M78C 3BY7A 5FW9A 4C92D 4XTUA 2QXFA 1LPLA 1PSFA 5EC7A 1QVGA 5J26A 3E19A 1VQPQ 1X27A 1YJNQ 2JNGA 2AHJB 2DAQA 2DF6A 2PUOB 3CCQA 2XDBA 4OB1B 1BCOA 5LJ5h 2KT8A 2CT3A 1EFNA 2K5FA 3MEUA 3CBOA 2F1LA 2RA2A 2ZPEB 2R5AA 5FRMA 4RUGA 1QQJA 4L5GA 2KEAA 3G71T 3M9QA 4MDXA 4PJMA 2XHCA 4HT8A 1UHCA 3TSZA 3LGFA 3VYHB 1VQ5A 3CCST 1Q7YU 3CCJQ 5LJ5d 2A28A 2K6DA 3LH0A 2DILA 3HRTA 3WVEB 5KYWA 3I56Q 1X43A 2JMAA 5CKFA 3MCAB 2QYZA 3CCUQ 3EG0A 1ZA1B 2COWA 2E5QA 2DL7A 1ZLMA 4JDSA 5LJ3h 4JLIA 4M7AD 4E7JA 5FRNA 6AT1B 3CCRQ 3REBB 4BD3A 2XI9A 4M77D 1PD1A 3PGGA 2V8KA 3REAB 4C92G 2CH4W 1RI0A 4ZN3A 1FMWA 1GCPA 3ZBDA 1VQ7T 1Q7YC 2DPPB 5GAN3 3LH5A 4X9CA 4M7AC 4M75D 3CCSA 1UFFA 3M4GA 5GAN2 5I2MA 2JTFA 5LJ3d 1YI2Q 1KQ2A 1D0XA 4DEYA 1R77A 2GFUA 3UA7A 3E1SA 2DLPA 3E9FA 5GANj 1WIEA 2M0OA 3JCMX 2HQEA 1RAGB 4OMOA 4CC2A 1QCFA 3H0IA 1Q82R 4J9DA 2MK5A 3CCQT 4MMKA 4BY6C 5GAMh 4LDUA 2K4YA 1UHFA 2V8JA 1NM7A 2BE7D 1YP5A 2K2VA 3HTRA 1T0HA 2HBWA 2J6FA 1KQSS 1GXIE 3TQ7P 1ACMB 2VGMA 2CREA 4JUVA 4RKUE 3A98A 1NZ9A 1VQ4T 3HFNA 4E7LA 3OMGA 1YWOA
chains in the Genus database with same CATH topology
3VKIA 1M1FA 4C8QD 1G3TA 4OB2B 5GAOl 1QVFS 2DTOA 1UGQB 3X26B 4C0DC 2DZCA 1VQOA 4CI0C 5KE3A 4N4GA 5GAOn 1YI2T 1N8RU 3QYHB 2DXUA 2E10A 4D6WA 3RERA 4HCZA 1KHCA 3A8OB 5C0MA 5LJ3j 2IVWA 4R55A 2D9TA 5GAMj 4EPCA 3QBYA 3PIPA 2P0QA 3GOXA 4RMOA 1PSEA 5GAN8 4JRIA 4EMKA 3RMQA 3RKWA 2L8DA 4F7UF 2QQ9A 1W2BS 3JB9H 2PU9B 3M55A 3OYEA 5CIUA 1KC8U 3OS2A 2DK3A 3OYJA 1Y71A 5DY9A 5CQYA 4E7KA 1VQNA 2QA4A 3PIOA 5GAN6 5GMKj 4PNOA 5GAOq 3S6WA 2ZPHB 2A7YA 2LRQA 3NTIA 3L2VA 3EFRA 3HHTB 4M78E 3CMET 4M77A 1I8FA 2MWPA 1K73U 1XOVA 4M75F 3OYIA 3JSCA 4C92E 2EJ9A 3JB9D 5LJ5g 3GPLA 2FVUA 2LT1A 4PJOA 3DKMA 5GAMe 3L2QA 3PNWC 1ZBXA 3OYGA 2XKOC 2R5MA 2XG8D 2O4XB 2KSSA 4FM4B 4J83A 3ME9A 3RIRA 4C8QB 2EYQA 1UGPB 2E6NA 4EMKC 1VQKA 3JCMh 4II1A 2LNVA 4PLLA 4JRKA 3T9NA 2L3RA 3M58A 4IUTA 3INZA 3TCJA 4C0FA 2ZPBB 3G71A 1UB4A 1VQMT 2VGNA 2GCXA 2CZ0B 3OS5A 2P4TA 4XU2A 2RM4A 3JCMb 1VQLA 1IREB 5AYFA 1NPRA 2E64A 1KHIA 3JB9F 1B34A 3HFOA 3L2WA 2RH2A 1WGSA 4C8QF 5KCHA 4KULA 4BE1A 2EWNA 4RCCA 2PQWA 3QJYA 2CZ7B 4XU3A 1X6OA 3QKJA 1FX7A 3LW5E 3OQ5A 4OGCA 3PFSA 3OSVA 4B9WA 2YLBA 5LJ3f 2EQKA 3A8GB 1Q86C 3A8LB 2JUFA 3FLGA 3M59A 3I56T 1Q86U 3GIBA 5LJ5j 2K3YA 3CCMA 2OTJT 2QTXA 4C5HA 1XNIA 3JCMJ 5J3BA 2GF7A 2BUDA 4M75G 4LDYA 3VUBA 2P0PA 3JCMP 1XQHA 3FC3A 4OB3B 2DIGA 4XTVA 2CZ6B 4C8QE 2OTJA 3UWNA 4FT4A 2KDSA 2DTIA 3QSUA 1V29B 2WSEE 4M7AA 1VQKT 1VQ9T 1M90C 1M1GA 4IUQA 4BI4A 1FWZA 1VQLT 3CEYA 4FIBA 4C92B 3OSSC 2Y4YA 4E47A 5LJ3e 3QUIA 3A5ZB 5A0LA 2QDYB 2E12A 3C95A 3M4YA 2E41A 2QQAA 4OP0A 3P8DA 4GLKA 4QQ6A 4Y28E 4TVRA 5D6WA 2DO3A 4J7FA 5KE2A 3FRNA 3SFMA 2C06A 2LQ8A 4LD9K 2XD0A 1JRIA 4VUBA 5GAMf 4C92C 5M9OA 5GMKl 3CCUA 4DQ2A 4V2SA 2RI3A 1LJOA 3G7ZA 4M78A 1OZ3A 2CS7A 2RJFA 1QVGS 5CCAA 3L1AA 3M53A 2CGHA 1I81A 3FB9A 3OYDA 3VYGA 4BACA 1WQWA 4J6XA 4PJOG 1BI1A 2EQJA 1N9SA 5FU6B 1N27A 3OS0A 5GAOr 3JRZA 2JZ2A 5CAIA 3URGA 2DIQA 3MEWA 4X34A 2R57A 3C4SA 3FEOA 3OBWA 4ZN1A 3BDLA 4JS5A 2D0QB 1YJ9T 3CD6A 1O9SA 5DLQE 1JB0E 3QIIA 3OYYA 3HL8A 3CCEA 4XU0A 1WJRA 3JCMg 3MEAA 1WJSA 3LYIA 1QVPA 2PVDB 4HCBA 4ELYC 2FL7A 2X4XA 3A8MB 3QO3A 4RG2A 4A4HA 3CMAT 4BDYA 3CC4T 2EQUA 4PL6A 3LWHA 4IURA 1VQPA 3V8KA 4F7UA 5FLXE 1IZ6A 2DTHA 3L42A 4Y91A 5GMKi 1UEBA 1YI2A 1G5VA 1D3BA 4EMKB 1D3BB 4IUPA 3SD4A 3V8LA 3BW1A 4M75B 4KUIA 5EG2A 3OS1A 2ZPGB 2DJZA 2H3JA 3UPUA 2A3LA 1K9MC 1NPPA 2DKGA 3J7AF 3ZFJA 4N0AC 1YCYA 3OYFA 2YRVA 2DD4A 3E9GA 3OYKA 4M75A 2LVMA 5A0GA 2EJGA 4PJOF 3LWIA 3OYAA 2Y90A 4KBMB 1VQNT 3LGLA 1OI1A 2CYZB 2MI6A 1VUBA 5FU7C 2VXFA 2K57A 3DLMA 3N5BB 3CCJA 2KAFA 1ZQ1A 1O75A 1QP2A 5CR2A 3JCMd 2LCCA 4M77C 2ZPFB 4J8OA 2PVGB 5LL6S 5GANg 3L2RA 3CC4A 4M7DB 3JB9J 1MGQA 3SWNB 3G4ST 4BI3A 2RJCA 5KCOA 5CK9A 1W2BA 4E7IA 3DB4A 4MMLA 4BI8B 3KBGA 2QA4T 2HNIA 2QQRA 4XAXB 1S72A 2HAXA 4IKFA 2ZZDA 3OW2A 2QQBA 4M77B 4C8QG 4IUUA 5C6SA 4OMFB 3WVDB 5J39A 2NLUA 1HK9A 1X01A 3ZEHA 2RHUA 4PKCC 3QXEB 4OF1A 4F7UE 3OYBA 3FIFA 1Q82C 1WJQA 2F5TX 4E7HA 1LOJA 4ZTJA 1NJIC 3JCMc 4WF2A 4J5YA 4BE2A 4C92F 2LT4A 2VXEA 4C5GA 3MP1A 2L89A 4N0AA 4XTXA 5LJ5f 1RL2A 5GMKm 3S3OA 1BKBA 5A2QE 4M77F 5GAN4 3J81E 2G3RA 5GANd 1JBMA 2LDMA 2KY9A 4A4EA 2YHTA 2L5QA 2RHXA 3QPHA 3ASKA 5HK3A 3META 4HT9A 2OAUA 3V7CA 3G6ET 1KQSA 1YJWA 1VQ5T 3MHXA 3G6EA 1M1KU 5GAOm 2K3XA 2ZGWA 4ZGJB 2E6ZA 4M78B 2IG0A 2YLCA 4MZTA 5FU6C 2DXCA 2I2LA 4BUGA 3OY9A 2QQSA 1S72T 4UC4A 3F70A 3PT9A 3OYLA 3KXTA 3CCRT 3V8JA 3TU4K 1BI3A 4M78D 4C5IA 4L6V5 4FT2A 3LX7A 3GNGA 3JCMe 1VQ9A 2HBPA 3GNFB 5HKCA 3JB9I 4N4IA 1Y96B 1YIJT 2RJDA 1VQ7A 3CC2A 3CCLA 3HSBA 3CCLT 2E1HA 3OA6A 3S3MA 2CZ1B 4J6YA 4NL3A 1FXXA 2FYKA 3V7SA 1KQ1A 3C12A 1YIJA 3CC2T 4M7DA 1XTDA 4F7UB 3HRSA 1Y96A 4C8QC 4LDWA 4M77E 1U1SA 3QHSA 4MZMA 4HA8A 1VQMA 4L59A 1BYMA 1VQ8A 2O4XA 2RJEA 2XK0A 3OW2S 3FJPA 5DM7R 3DLLA 3EAEA 1EIFA 2M1HA 4FL6A 2RB6A 2DXTA 2XDDA 2DZ9A 4BDZA 2K5IA 5GAN5 3OYMA 3C94A 3MP8A 4QVZA 3NFCA 2X4YA 4A54A 3CCVT 1R8OB 4A4FA 1N8RC 1G3WA 4N4HA 2WSCE 1H641 3M57A 4FSXA 1I4K1 4PJOD 1B34B 2EQMA 3HP9A 3H6ZA 2JVVA 1JJ2S 5LJ5e 5LJ3g 2E70A 1M4ZA 2DXBA 4LD6A 5GAMg 1OYXA 4RG8A 5GAOp 4B9XA 5HY6A 4R56A 2WSFE 4DOVA 3GP8A 4OGEA 2ZPIB 2RHZA 1VIEA 3DB3A 1YHQA 3P8HA 2GQVA 3X25B 3EFSA 1WQ7A 3QJ6A 3V7RA 5I21A 2EKOA 3CBMA 4O6JA 5L8RE 3OYCA 5CKBA 1N6AA 4M75E 3CXCA 4C5EA 2JN0A 4Z02A 3MO8A 4JS4A 4DA4A 1YITA 5FROA 1UGRB 5D6XA 3X28B 4QW2A 3CPFA 4RCBA 3KUFA 2D6FA 4PJOB 2B8AA 2RD1A 3OB9A 3VJPA 3FDRA 5CVIA 5DLOA 3JCMV 2BKDN 1AHJB 3RMSA 1BI0A 1K73C 3TREA 2EAYA 1Q82U 4ATOA 2KMTA 3JCMf 3GLXA 2EIFA 3CCVA 2BIVA 2VV5A 4KT0E 2XDPA 5D6YA 1M5Q1 4QVCA 4J6WA 1G3YA 1BIBA 4P5NA 4XTWA 2QI2A 4JRQA 3CCJT 1M90U 3OYHA 1NJIU 2MMPA 4M7AB 2RO0A 3UDCA 2HQXA 4C0ZA 3ER0A 1DJ7B 4NOYA 4O5VA 3VV0A 3RKXA 4M7AG 2VC8A 1SSFA 3CCET 2QEXT 4LDXA 1KD1U 5GMKe 1BI2A 4M7DG 3Q1JA 4FU6A 4M78C 2M16A 3BY7A 3O8VA 4C92D 3HKSA 4XTUA 2QXFA 4C92A 4EMHA 3GF5A 1PSFA 2LX9A 1TH7A 3QYGB 5GANh 1QVGA 5J26A 3E19A 3VUZA 2JNGA 3OBYA 2RI2A 4JLGA 2AHJB 3X24B 2DAQA 2RI5A 4X9DA 2LCLA 2XICA 2PUOB 3CCQA 2XDBA 4NL2A 4OB1B 1VQPT 5LJ5h 4HCCA 1YJNT 3CCRA 3JB9G 3UT1A 2K5FA 2VUBA 4M75C 3CBPA 4HKEA 3MEUA 1G3SA 4IUVA 3CBOA 2RA2A 2ZPEB 4BY6B 2R5AA 4XK8E 3BFMA 4M7DD 1Y07A 5A0DA 5FRMA 1OZ2A 2F5KA 4ME7A 1LNXA 4L5GA 1VIFA 4XU1A 3MP6A 3G71T 4OB0B 1WNLA 3M9QA 4MDXA 3QDRB 2GFAA 4JJNK 3JCMW 1K8AU 1UGSB 4MZPA 2O01E 4A4GA 2XHCA 4HT8A 4NS5A 2X4WA 3LGFA 5FU7B 3VYHB 1YJWT 2JOYA 4LDVA 1VQ5A 3PMTA 3CCST 1Q7YU 4A53A 1M1KC 3J80E 4GY5A 2K5LA 3SB2A 5CKHA 5LJ5d 1K9MU 5GANf 3LH0A 3NTHA 5CKEA 4C8QA 1QP3A 2MAMA 3I56A 1KD1C 1H3ZA 4M7DC 1BIAA 3HRTA 1Q81U 3P8BB 3OMCA 3WVEB 2X4JA 3QG1A 4OVAA 4Q5WA 2LC4A 1Y7XA 1MHNA 2MWOA 4C0DB 3PTAA 2FHDA 2RK1A 2DVEA 2LQKA 1W4SA 3MCAB 5CKFA 3X20B 2KQWA 1VQ6A 4QQDA 3M54A 1VQ8T 3BDUA 2QEXA 2E5QA 3JAME 2LTOA 2Y4XA 5LJ3h 4JDSA 4JLIA 4M7AD 4E7JA 3RUXA 5FRNA 2JTMA 5GANe 4KUDK 2KK4A 2XI9A 4M77D 4BD3A 4CRIA 3CMEA 3HRUA 2E65A 3PGGA 1KC8C 2OTLT 4PJOE 3CXCS 2OTLA 2V8KA 3WXMB 4BB7A 4QVDA 4C92G 2ZCFB 1K8AC 2M9UA 4XTZA 3CCMT 5CQXA 3M5AA 3S3NA 1RI0A 3RESA 4M78G 4ZN3A 3M56A 3ZBDA 1U8RA 1I5LA 1VQ7T 4DOWA 1Q7YC 2DPPB 2RHYA 3OYNA 5GAN3 1JJ2A 5I2SA 4M7DF 2XIDA 4X9CA 4M7AC 4M75D 3CCSA 1X75C 1ZHIA 3I55T 4JRPA 3M4GA 3LLRA 1Q81C 5GAMd 5GAN2 4ZGDB 4YTLA 5I2MA 5IT9E 2JTFA 2R58A 4M7AE 5LJ3d 5GAN7 2FB7A 4EDUA 1KQ2A 1M8VA 3CC7A 4ZTFA 5IN1A 3JCMQ 2F69A 2GFUA 1YJ9A 4EMGA 2RK2A 3E1SA 3PMIA 1YHQT 3E9FA 2EJFA 5GANj 5GMKh 3R6OA 1YITT 4M7DE 4M77G 2M0OA 3NTKA 1HXDA 2EFIA 2HQEA 3JCMX 2KVQG 1QVFA 3SDZA 4XTYA 3CMAA 3L2UA 2VYTA 1KG1A 2MF2A 2X35A 3CPWS 3CCQT 2DEQA 3HPWA 4M7AF 4BE0A 5CO7A 3AHUA 3TEEA 4MMKA 3CCUT 4BY6C 3SWNA 5GAMh 1P92A 3CD6T 4LDUA 1NE8A 5KH6A 2PUKB 3I55A 2CKKA 2K4YA 1U1TA 3MEVA 5IAYA 1VQ4A 2HD0A 3CC7T 4J7IA 1M9SA 2V8JA 1YJNA 5CKDA 1YBYA 2V8IA 3SWNC 1VQ6T 4PJOC 2K2VA 4A4KA 2DD5A 2PVOB 4C0GA 1QW1A 3L2ZA 4M78F 1N9RA 2XU8A 4QQGA 4ZGEB 1KQSS 1GXIE 2VGMA 5HK0A 3H8ZA 3QZ9B 4JUVA 4RKUE 4PLIA 4XQ3A 3RKYA 4F7UG 1NZ9A 4MDWA 3CPWA 2P0KA 3QZ5B 3G4SA 1VQ4T 2WACA 3HFNA 4E7LA 3VU3C 1VQOT 1WPYA 2RHIA 3OMGA 3A8HB 4ELZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7S A;  4C8Q D;  1KQ1 A;  5GAO r;  4M7D A;  5GAO l;  4F7U B;  2DTO A;  5CAI A;  4HT8 A;  1Y96 A;  4C8Q C;  2DZC A;  4M77 E;  5GAO n;  1U1S A;  3RER A;  2DXU A;  2E10 A;  3QHS A;  4HA8 A;  4A53 A;  3SB2 A;  5LJ5 d;  5LJ3 j;  5GAN f;  4C8Q A;  5GAM j;  4XU0 A;  3JCM g;  4M7D C;  3FJP A;  1BIA A;  4JRI A;  5GAN 8;  1KQ2 A;  4EMK A;  3QO3 A;  2RB6 A;  3RKW A;  2DXT A;  4F7U F;  3JB9 H;  2DZ9 A;  5GAN 5;  3V8K A;  2DVE A;  4A54 A;  4F7U A;  2DTH A;  5DY9 A;  4Y91 A;  5GMK i;  1H64 1;  4PJO D;  1I4K 1;  1D3B A;  4EMK B;  1B34 B;  1D3B B;  5GAN 6;  5GMK j;  3BDU A;  4PNO A;  3BW1 A;  3V8L A;  5LJ3 g;  5LJ5 e;  4M75 B;  5GAM g;  5GAO p;  5GAO q;  5LJ3 h;  3EFR A;  4JLI A;  4M7A D;  2DJZ A;  4M78 E;  3RUX A;  5GAN e;  4M77 A;  1I8F A;  4M77 D;  2DKG A;  4M75 F;  4N0A C;  1YCY A;  3EFS A;  1WQ7 A;  2E65 A;  2EJ9 A;  3PGG A;  3V7R A;  4C92 E;  5I21 A;  5LJ5 g;  3JB9 D;  5GAM e;  4PJO A;  4PJO E;  4QVD A;  4M75 A;  4C92 G;  4M75 E;  4XTZ A;  2JN0 A;  2EJG A;  4PJO F;  3RES A;  2Y90 A;  4M78 G;  3RIR A;  4EMK C;  4C8Q B;  2VXF A;  2K57 A;  3JCM h;  1I5L A;  4JRK A;  3JCM d;  4RCB A;  4PJO B;  3INZ A;  2RD1 A;  4M7D F;  5GAN 3;  4X9C A;  4M7A C;  3JCM V;  4M75 D;  4M77 C;  5GAN g;  4XU2 A;  2RM4 A;  2EAY A;  3JCM b;  3JB9 J;  1MGQ A;  3SWN B;  3JCM f;  3M4G A;  4M7D B;  5GAM d;  2E64 A;  5GAN 2;  3JB9 F;  1B34 A;  3HFO A;  4MML A;  4C8Q F;  1M5Q 1;  4QVC A;  4M7A E;  5LJ3 d;  4J6W A;  2EWN A;  1BIB A;  2FB7 A;  2HNI A;  4RCC A;  4XTW A;  4XU3 A;  5GAN 7;  1M8V A;  4M77 B;  3JCM Q;  4C8Q G;  1HK9 A;  1X01 A;  4M7A B;  4EMG A;  4F7U E;  3FIF A;  2EJF A;  2YLB A;  4NOY A;  5LJ3 f;  5GAN j;  3RKX A;  4M7A G;  5GMK h;  1LOJ A;  2VC8 A;  4M7D E;  4M77 G;  3GIB A;  3JCM c;  4WF2 A;  1HXD A;  4J5Y A;  5GMK e;  4C92 F;  5LJ5 j;  2VXE A;  3JCM X;  4M7D G;  4N0A A;  4XTX A;  2QTX A;  4M78 C;  3BY7 A;  4XTY A;  4C92 D;  4EMH A;  4XTU A;  5GMK m;  5LJ5 f;  4M75 G;  4C92 A;  3JCM J;  3JCM P;  4M77 F;  5GAN 4;  1TH7 A;  2DEQ A;  4XTV A;  4C8Q E;  1JBM A;  5GAN d;  4M7A F;  2YHT A;  5GAN h;  3AHU A;  4MMK A;  4HT9 A;  2DTI A;  3SWN A;  5GAM h;  3QSU A;  4M7A A;  3V7C A;  4X9D A;  1U1T A;  4C92 B;  5LJ3 e;  4NL2 A;  3QUI A;  4PJO C;  5GAO m;  2ZGW A;  2E41 A;  4OP0 A;  5LJ5 h;  4M78 B;  3SWN C;  2YLC A;  3JB9 G;  2I2L A;  4M75 C;  3L2Z A;  4M78 F;  1N9R A;  2RA2 A;  1JRI A;  3V8J A;  5GAM f;  4C92 C;  5GMK l;  4V2S A;  4M78 D;  4DQ2 A;  3BFM A;  1LJO A;  4M78 A;  4JUV A;  4M7D D;  4XQ3 A;  3JCM e;  1LNX A;  3RKY A;  4F7U G;  3JB9 I;  1Y96 B;  3HSB A;  3L1A A;  2CGH A;  4XU1 A;  1I81 A;  2E1H A;  3FB9 A;  3HFN A;  1WQW A;  1WNL A;  1WPY A;  4J6X A;  4J6Y A;  1N9S A;  4PJO G;  3VU3 C;  4NL3 A;  3JCM W;  2FYK A; 
#chains in the Genus database with same CATH topology
 1EZZ B;  1XJW B;  1QVF S;  1IRX A;  2IPO B;  4C0D C;  1VQO A;  5KE3 A;  4N4G A;  1YI2 T;  2JS2 A;  4D6W A;  5C0M A;  1E7O A;  3EGX B;  3EGD A;  4EPC A;  2P0Q A;  2OJ2 A;  3GOX A;  4PJL A;  2ABL A;  4RMO A;  1G8X A;  1JEG A;  4EMK A;  3RKW A;  1ABO A;  3M55 A;  2EGA A;  3OYE A;  3CXC P;  1KC8 U;  2DER A;  3OYJ A;  2A0F B;  5DY9 A;  1VQN A;  5GMK j;  4PNO A;  1NLO C;  2NUT B;  2A7Y A;  2ZPH B;  3NTI A;  2GQI A;  4C92 E;  3JB9 D;  3L2Q A;  2XKO C;  2KSS A;  3RIR A;  1X2Q A;  3JCM h;  1GFC A;  2CT4 A;  3T9N A;  4IUT A;  3G71 A;  1VQM T;  2VGN A;  2CZ0 B;  1OQK A;  2DVJ A;  2P4T A;  4XU2 A;  4JJD A;  2J06 A;  1OX9 A;  1IRE B;  2E64 A;  3JB9 F;  3HFO A;  2ESW A;  2FEI A;  1WHM A;  2EWN A;  2PQW A;  3VS6 A;  1PD0 A;  4E7Z A;  3A8G B;  1JU5 C;  3A8L B;  3CCM A;  3RR6 A;  4JZ3 A;  4C5H A;  3JCM J;  4M75 G;  2DYB A;  3JCM P;  2ZAE A;  2KDS A;  3QSU A;  3EH1 A;  4LXC A;  1M1G A;  2M02 A;  3CEY A;  1Y0M A;  8AT1 B;  1Q81 R;  3QUI A;  1UEC A;  3C95 A;  4KGV B;  5D6W A;  5KE2 A;  4J7F A;  3SFM A;  2C06 A;  2J6K A;  1I0C A;  4VUB A;  3VS2 A;  4C92 C;  4V2S A;  4DQ2 A;  3H0F A;  4M78 A;  1PRM C;  1OZ3 A;  4OMN A;  4J9B A;  3MPU B;  2K79 A;  1OPK A;  1D0Z A;  1I81 A;  4BAC A;  4Y92 A;  1BI1 A;  2EQJ A;  5FU6 B;  1MMA A;  2RQR A;  1N27 A;  3OS0 A;  5GAO r;  2CP0 A;  4X34 A;  4ZN1 A;  1O9S A;  5DLQ E;  3NMZ C;  2KRN A;  3CCE A;  1KQS P;  2KGT A;  4ELY C;  2X4X A;  3A8M B;  4A4H A;  3CMA T;  1M2V B;  2DL8 A;  2CP3 A;  1HD3 A;  4IUR A;  1VQP A;  5FLX E;  1G5V A;  3L42 A;  1NBE B;  1D3B A;  2HSE B;  2NWM A;  1D1A A;  5EG2 A;  3I35 A;  2V26 A;  2DMO A;  3UPU A;  2A3L A;  1NPP A;  3J7A F;  1YCY A;  4ANJ A;  1C1A A;  1UJY A;  3OYF A;  3H41 A;  4CC7 A;  2XMF A;  4JRP A;  2E3I A;  5CR2 A;  1O75 A;  4FCY A;  2X3X D;  2O9S A;  2GTO A;  5GAN g;  4J8O A;  2PVG B;  3L2R A;  2LQW A;  3JB9 J;  2DJQ A;  4E7I A;  3KBG A;  2QA4 T;  3PVQ A;  2QQR A;  2HAX A;  2JJ9 A;  2ZZD A;  3OW2 A;  4C8Q G;  1X01 A;  4F7U E;  1Q82 C;  2F5T X;  1LOJ A;  4ZTJ A;  1FMK A;  4WF2 A;  4BE2 A;  4C92 F;  4C5G A;  1B7T A;  1BKB A;  1K8A R;  1G83 A;  1RAE B;  2G3R A;  2L3Q A;  1WX6 A;  4RTX A;  1VQ8 Q;  3V7C A;  3G6E T;  1KQS A;  4RTZ A;  1K9A A;  5GAO m;  2K3X A;  4ZGJ B;  2E6Z A;  4MZT A;  2I2L A;  2J7I A;  3OYL A;  3CCR T;  3KXT A;  2DET A;  2FRY A;  2BZ8 A;  4FT2 A;  1VQ9 A;  3GNF B;  3JB9 I;  4QT7 A;  2E1H A;  4A63 B;  3OA6 A;  2X9H A;  3S3M A;  2NUP B;  1KQ1 A;  2DRM A;  1YIJ A;  3CC2 T;  1BK2 A;  4C8Q C;  1KK7 A;  1U1S A;  1VQM A;  3CQT A;  4F16 A;  5KYW B;  2O4X A;  2RJE A;  1K1Z A;  2XK0 A;  3OW2 S;  1TOV A;  3FJP A;  3DLL A;  2DXT A;  3OYM A;  3THK A;  2YT6 A;  2X4Y A;  1N8R C;  2AZS A;  1RAA B;  2O31 A;  4FSX A;  1X6G A;  3EGU A;  2EQM A;  5LJ5 e;  2DXB A;  4R56 A;  2RPN A;  3DB3 A;  3P8H A;  2GQV A;  3X25 B;  3EFS A;  3V7R A;  1W1F A;  2VWF A;  1OOT A;  5CKB A;  3CXC A;  2JN0 A;  3MO8 A;  1YIT A;  5FRO A;  2JS0 A;  1IB8 A;  2D6F A;  5KYX A;  5DLO A;  5CVI A;  1JO8 A;  2GBQ A;  2EAY A;  1HJD A;  2KBT A;  2KMT A;  4KT0 E;  4QVC A;  5GJW B;  1BIB A;  4P5N A;  4XTW A;  3EHQ A;  1M90 U;  3EHR A;  1IGU A;  2RO0 A;  3UDC A;  2KYM A;  3VV0 A;  2LNH B;  3CMA Q;  1D0Y A;  2VC8 A;  3CCE T;  1BI2 A;  1TUG B;  2LQN A;  4C92 A;  2LX9 A;  3TSW A;  3QYG B;  2IIM A;  5GAN h;  1SF9 A;  1U3O A;  3OBY A;  2RI5 A;  2LCL A;  4LUE A;  1VQP T;  1YJN T;  3CCR A;  3JB9 G;  1E6H A;  3CBP A;  4HKE A;  1K0X A;  1PNJ A;  2F5K A;  1LNX A;  2DA9 A;  4OB0 B;  1KSW A;  1UGS B;  2X4W A;  1YJW T;  4LDV A;  1M1K C;  4F17 A;  3VRY A;  4RTU A;  5GAN f;  5CKE A;  1QP3 A;  1KJW A;  1BIA A;  1CKB A;  2X4J A;  4OVA A;  4Q5W A;  2MWO A;  3ULR B;  3PTA A;  3BE3 A;  2FHD A;  2DVE A;  3X20 B;  2KQW A;  2YUO A;  2K7A A;  4QQD A;  2HL3 A;  3BDU A;  2QEX A;  3JAM E;  1TUC A;  3RUX A;  2KK4 A;  4CRI A;  3CME A;  4PJO E;  2LP5 A;  3WXM B;  2DBK A;  3CCM T;  3M5A A;  3RES A;  2MPX C;  4LNP A;  4EIK A;  2JT4 A;  1OU8 A;  4AMC A;  3IQL A;  5GAM d;  5IT9 E;  4ZGD B;  4YTL A;  4EDU A;  3CC7 A;  2LMJ A;  2JW4 A;  1YJ9 A;  3PMI A;  1OU9 A;  1YHQ T;  2EJF A;  1YCS B;  2B86 A;  3R6O A;  2YXY A;  1QVF A;  2KVQ G;  3SDZ A;  4DBH A;  3L2U A;  2VYT A;  2DEQ A;  4BE0 A;  3TEE A;  1K0S A;  1NE8 A;  1UG1 A;  1Y57 A;  2VKN A;  3CC7 T;  1YJN A;  4HCK A;  3SWN C;  4J9C A;  4C0G A;  2KXD A;  1QW1 A;  2F2X A;  1X2K A;  3C0C A;  1KIK A;  3H8Z A;  3QZ9 B;  4XQ3 A;  2EKH A;  2X3W D;  1ARK A;  2P0K A;  3QZ5 B;  3G4S A;  4D8D A;  1JXM A;  1VQO T;  2RHI A;  5J39 A;  4CC3 A;  1G3T A;  5GAO l;  1UGQ B;  1M3B A;  1A0N B;  1PKS A;  4CI0 C;  3RBB B;  5GAO n;  2E10 A;  4E2F B;  3H9N A;  2D9T A;  1SHG A;  1PSE A;  2DRK A;  2QQ9 A;  1ZSG A;  1W2B S;  4ZNX A;  3TVT A;  7AT1 B;  1PWT A;  3OS2 A;  1H8K A;  2KI7 A;  1Y71 A;  4E7K A;  4PFO A;  2KRO A;  2QA4 A;  1PRL C;  3S6W A;  2LRQ A;  2Z0W A;  3L2V A;  1AWW A;  2F2W A;  4M78 E;  2MWP A;  1K73 U;  1XOV A;  1FMV A;  5LJ5 g;  3GPL A;  2SEM A;  2FVU A;  1ZBX A;  3G6E Q;  4JPB W;  2R5M A;  4J83 A;  1VQK A;  2EYQ A;  1UGP B;  2E6N A;  4AFZ C;  1VQN Q;  4II1 A;  4PLL A;  4JRK A;  2HCK A;  3INZ A;  4FYV B;  3SHW A;  2GCX A;  4F14 A;  2RM4 A;  3JCM b;  1B34 A;  3L2W A;  3G4S Q;  1MV3 A;  2RH2 A;  5KCH A;  4BE1 A;  1YJ9 Q;  3ZL7 C;  4KRT A;  4Z8A A;  2AK5 A;  2FO0 A;  2ATC B;  4GLM A;  2DL5 A;  2RQT A;  1JXO A;  2JUF A;  3FLG A;  1Q86 U;  1MND A;  2A08 A;  2K3Y A;  4OMM A;  5J3B A;  3VUB A;  2P0P A;  2C0O A;  1XQH A;  2YSQ A;  1QKX A;  4FT4 A;  1JQQ A;  2DTI A;  2WSE E;  1M90 C;  1VQL T;  1PM3 A;  4FIB A;  3OSS C;  2Y4Y A;  2NUZ A;  4C92 B;  3A5Z B;  2D1X A;  2QDY B;  2HKQ B;  3M4Y A;  5KYY B;  1VQ6 A;  3P8D A;  3CCM Q;  1AD5 A;  2DO3 A;  4RTW A;  2XD0 A;  5M9O A;  3CCU A;  2W0Z A;  2MCN A;  1RUW A;  2RJF A;  1WXB A;  1WQW A;  1N9S A;  2P4R A;  2PNI A;  3OBW A;  2D0Q B;  3CD6 A;  1ZX6 A;  1IGQ A;  3JCM g;  3MEA A;  1WJS A;  3CCS Q;  2PVD B;  4RG2 A;  3VS7 A;  2C0T A;  4BDY A;  2RMO A;  4PL6 A;  1M3A A;  1LCK A;  1QWF A;  9ATC B;  1KFZ A;  3V8K A;  1YI2 A;  3GBQ A;  2BZX A;  2QAZ A;  1D3B B;  4IUP A;  2ZPG B;  2DJZ A;  2DNU A;  3ZFJ A;  3E2U A;  2YRV A;  2LVM A;  2EJG A;  4LUD A;  3UF4 A;  3OYA A;  2Y90 A;  4KBM B;  3LWI A;  1VQN T;  4DBF A;  2HDA A;  1WHG A;  2KAF A;  1WXU A;  1ZQ1 A;  1QP2 A;  3CC4 A;  4BI8 B;  1G2B A;  1K4U S;  1RLQ C;  1S72 A;  4XAX B;  3U23 A;  2QQB A;  4M77 B;  2CP7 A;  4IUU A;  5C6S A;  4OMF B;  1B07 A;  1HK9 A;  3ZEH A;  3FIF A;  4E7H A;  1I5O B;  1ZSZ A;  5KYU B;  2LT4 A;  3MP1 A;  2L89 A;  1BB9 A;  5FWC A;  4M77 F;  5GAN 4;  1M2V A;  1JBM A;  4RTV A;  2KY9 A;  4M4Z A;  2CSQ A;  3MET A;  1VQ6 Q;  3EG9 A;  1C0M A;  1YJW A;  4CC4 B;  2ZGW A;  1M30 A;  3EFO B;  3NPF A;  5FU6 C;  5ECA A;  3OY9 A;  2BZY A;  4BUG A;  1S72 T;  3F70 A;  3OW2 P;  1PC0 A;  1BI3 A;  3VS5 A;  4L6V 5;  3LX7 A;  1VQ7 A;  5HKC A;  3FJ5 A;  4N4I A;  1Y96 B;  1FXX A;  2FYK A;  2AZV A;  2GTJ A;  1XTD A;  1NLP C;  3NHN A;  3NGP A;  3M0U A;  1TUD A;  4X1V A;  1VQ8 A;  2DFU A;  1VOM A;  3EAE A;  1EIF A;  1I1J A;  2M1H A;  2JTE A;  4BDZ A;  2DZ9 A;  2K5I A;  5GAN 5;  1D09 B;  2COZ A;  3C94 A;  3NFC A;  4A54 A;  4A4F A;  5IHI A;  4N4H A;  5I11 A;  1RAD B;  4KH0 B;  1OUL A;  2JVV A;  3H6Z A;  2QGF B;  4LD6 A;  4B9X A;  4DOV A;  3EFO A;  1VIE A;  1M27 C;  1YHQ A;  3QJ6 A;  2EKO A;  3CBM A;  3PE0 A;  4M75 E;  4JS4 A;  4DA4 A;  1VQ5 Q;  5D6X A;  3X28 B;  1TTH B;  3KUF A;  4PJO B;  2O9V A;  1AHJ B;  5KYU A;  1BI0 A;  8ATC B;  3TRE A;  3A1P A;  2BIV A;  2VV5 A;  2XDP A;  4J6W A;  1OPL A;  3CCJ T;  1MMG A;  2YUP A;  2HQX A;  2DEU A;  2QEX T;  3CC4 Q;  4LDX A;  5GMK e;  4M7D G;  4WTO B;  1FYN A;  1KD1 C;  3HKS A;  1TH7 A;  2EGC A;  2GGR A;  1MV0 B;  3X24 B;  4X9D A;  2L2P A;  4HCC A;  3VS3 A;  4PFP A;  3CME Q;  4M75 C;  1QVF P;  1M8M A;  1MNE A;  4J9H A;  4XK8 E;  1Y07 A;  5A0D A;  1NG2 A;  1WHJ A;  4XU1 A;  2ROL A;  3MP6 A;  1YJW Q;  1M1K R;  3QDR B;  2GFA A;  4JJN K;  3JCM W;  4MZP A;  2CH4 A;  2O01 E;  2EBP A;  4NS5 A;  5FU7 B;  3PMT A;  2YDL A;  4A53 A;  3J80 E;  1K9M U;  3SB2 A;  4E7S A;  2KT1 A;  2VAS A;  4R0K A;  1N5Z A;  1H3Z A;  3I56 A;  2LJ3 A;  4M7D C;  2LX7 A;  1UE9 A;  3OMC A;  4DBQ A;  3QG1 A;  2RK1 A;  2LQK A;  4FW2 A;  4OMQ A;  2FRW A;  1UDL A;  2JTM A;  4PJJ A;  2OTL T;  2E65 A;  1KC8 C;  3RNJ A;  4QVD A;  2ZCF B;  1RAF B;  2A36 A;  1TWB A;  4M78 G;  1U8R A;  1I5L A;  1MMN A;  4DOW A;  5IXB A;  1NJI R;  2RHY A;  3OYN A;  1JJ2 A;  2RN8 A;  5I2S A;  2XID A;  2I0N A;  2RQV A;  4ESR A;  1X75 C;  1CSK A;  1ZHI A;  3CPW P;  3QDF A;  3LLR A;  3JV3 A;  5GAN 7;  4LE9 A;  1M8V A;  2F69 A;  4JJB A;  4EMG A;  1RI9 A;  2RK2 A;  1HYO A;  2CUD A;  5GMK h;  1YIT T;  4M7D E;  1IHV A;  3QWX X;  1HXD A;  3CMA A;  2J6O A;  2MF2 A;  3RDV A;  1RLP C;  4M7A F;  2D8H A;  5CO7 A;  3CCU T;  3AT1 B;  3SWN A;  1P92 A;  3CD6 T;  1D1B A;  5IHK A;  2JXB A;  1U1T A;  3MEV A;  4HVU A;  4J7I A;  5CKD A;  1YBY A;  2V8I A;  1ZUU A;  3O5Z A;  2PVO B;  1B3Q A;  1NYG A;  3L2Z A;  2H3E B;  2KXC A;  2ROT A;  2XU8 A;  1QCO A;  4QQG A;  4ZGE B;  5HK0 A;  4FW1 A;  4PLI A;  3RKY A;  3CPW A;  2WAC A;  3VU3 C;  2K3B A;  1AWX A;  2DYI A;  1N8R U;  4HCZ A;  1KHC A;  2YWW A;  3A8O B;  2J05 A;  1YNZ A;  2IVW A;  4R55 A;  3PIP A;  4JRI A;  4F7U F;  5CIU A;  2RNA A;  1VYV A;  5GAN 6;  3CCQ Q;  5GAO q;  1Q7Y R;  5D7U A;  4M77 A;  4M75 F;  3JSC A;  2EJ9 A;  2LT1 A;  2EQI A;  2HL5 C;  3DKM A;  2MIO A;  4ORZ A;  2FPE A;  2XG8 D;  4FM4 B;  3ME9 A;  4EMK C;  4C8Q B;  1VQ7 Q;  1R0C B;  2L3R A;  3M58 A;  2ZPB B;  1UB4 A;  2EYZ A;  4PFZ A;  4J9E A;  5AYF A;  1TU0 B;  4RTT A;  1KHI A;  1YN8 A;  4C8Q F;  4RCC A;  4KGZ B;  1FX7 A;  3R6N A;  4B9W A;  2YLB A;  2EQK A;  1Q86 C;  3M59 A;  3I56 T;  5LJ5 j;  1XNI A;  2GF7 A;  2EYY A;  4LDY A;  4OB3 B;  2VVK A;  4C8Q E;  2OTJ A;  1K9M R;  1BCM A;  1V29 B;  1M3C A;  1WLP B;  1X6B A;  2PTK A;  1FWZ A;  4PJO C;  2E12 A;  2E41 A;  2QQA A;  4QQ6 A;  4GLK A;  2DX1 A;  3SEM A;  4LN2 A;  2LQ8 A;  4LD9 K;  1F1B B;  2CP2 A;  2NUP A;  1JRI A;  3M0P A;  5GMK l;  1AVZ C;  1SHF A;  1QVG S;  1GBQ A;  5CCA A;  3L1A A;  4FYX B;  3FB9 A;  3VYG A;  2KE9 A;  4PJO G;  2MYS A;  4JJC A;  2OAW A;  2JZ2 A;  3M0S A;  5CAI A;  3MEW A;  3FEO A;  1SPK A;  2M51 A;  4AT1 B;  3OYY A;  1ZSZ B;  3HL8 A;  3UA6 A;  3EGD B;  4XU0 A;  1QVP A;  4RTY A;  4FYW B;  3CCE Q;  2EQU A;  1WYX A;  1QCN A;  4AFU C;  4B6M A;  2DTH A;  4Y91 A;  2AKL A;  5GMK i;  3CC7 Q;  2ED1 A;  3SD4 A;  3CD6 Q;  3V8L A;  3BW1 A;  4M75 B;  2H3J A;  1K9M C;  2DKG A;  2E5K A;  4N0A C;  1M2O A;  3OYK A;  2DD4 A;  3E9G A;  2CYZ B;  1VUB A;  2FZC B;  2K57 A;  2DM1 A;  3CCJ A;  3JCM d;  3EG1 A;  1GL5 A;  2LCC A;  1QMC A;  2BE9 B;  1PHT A;  4M77 C;  4BI3 A;  2RJC A;  1WHL A;  5KCO A;  1V1C A;  5CK9 A;  4MML A;  1QKW A;  4HVW A;  1K76 A;  1YIT Q;  3VRZ A;  2NLU A;  2YRC A;  4PKC C;  3QXE B;  2C0I A;  1ZA2 B;  2JM9 A;  2AT1 B;  1NJI C;  4XTX A;  1OX8 A;  3M0T A;  2OTJ Q;  4K11 A;  2LDM A;  2FZG B;  2YHT A;  3QPH A;  3ASK A;  4HT9 A;  1R0B G;  2OAU A;  2E3H A;  1RAI B;  1VQ5 T;  3MHX A;  1VQL Q;  2DL3 A;  5I22 A;  4M78 B;  1IO6 A;  1S1N A;  2RQU A;  1U5S A;  3PT9 A;  2RF0 A;  4UC4 A;  3V8J A;  4M78 D;  4C5I A;  4Z88 A;  3GNG A;  2HBP A;  2RJD A;  3CCL T;  1K73 R;  2CZ1 B;  4J6Y A;  4NL3 A;  1GCQ C;  2VB6 A;  4M7D A;  3HRS A;  1Y96 A;  2KNB B;  4LDW A;  4HVV A;  4M77 E;  2QA4 Q;  3QHS A;  1X69 A;  4MZM A;  1BYM A;  1MMD A;  1UTI A;  4OMP A;  4FL6 A;  2RB6 A;  1AEY A;  2XDD A;  5IHN A;  1BU1 A;  2D0N A;  4PJN A;  3QWY A;  3CCV T;  1VQK Q;  2WSC E;  2FPF A;  3M57 A;  2DL4 A;  4PJO D;  1B34 B;  3HP9 A;  1JJ2 S;  2E70 A;  5GAO p;  4RG8 A;  3EG3 A;  2WSF E;  3GP8 A;  4OGE A;  2ZPI B;  2L3P A;  5L8R E;  3OYC A;  2NUT A;  4C5E A;  3EG2 A;  5IH2 A;  1WA7 A;  4GBQ A;  2RD1 A;  3OB9 A;  2EYW A;  3JCM V;  2HMA A;  2HSP A;  3RMS A;  1SKU B;  2X51 A;  1Q82 U;  2FPD A;  1TSF A;  3GLX A;  2EIF A;  2QK0 A;  3CCV A;  1GCQ A;  1M5Q 1;  1G3Y A;  4JRQ A;  1Z9Q A;  1AZE A;  1NJI U;  2OX7 A;  4M7A B;  2YUQ A;  3RKX A;  2KRM A;  1KD1 U;  4FU6 A;  2M16 A;  3O8V A;  4EMH A;  3GF5 A;  1RAC B;  1IHW A;  1VYU A;  3EGX A;  3VUZ A;  2QG9 B;  1Q95 G;  2RI2 A;  4JLG A;  2DE0 X;  2HKN A;  1WHH A;  2XIC A;  1QVG P;  4NL2 A;  2JM8 A;  3UT1 A;  2VUB A;  4AG1 C;  1G3S A;  4IUV A;  1TG0 A;  4BY6 B;  3BFM A;  4M7D D;  1OZ2 A;  2EW3 A;  2OI3 A;  4ME7 A;  2M0Y A;  1VIF A;  2LJ0 A;  1WNL A;  1WXT A;  2L0A A;  1VQO Q;  1K8A U;  4A4G A;  5KYN A;  4F04 B;  2JOY A;  3I9Q A;  1Z9Z A;  4GY5 A;  2K5L A;  5CKH A;  3NTH A;  4C8Q A;  2MAM A;  2QAS A;  5HCK A;  1Q81 U;  3P8B B;  4J9G A;  1OEB A;  2LC4 A;  1Y7X A;  1MHN A;  4C0D B;  5IXF A;  4HXJ A;  3D7S B;  1W4S A;  1N8R R;  3EH2 A;  3M54 A;  1SRL A;  1W6X A;  2EVR A;  1VQ8 T;  2YUN A;  2LTO A;  2Y4X A;  5GAN e;  4KUD K;  3VS0 A;  3HRU A;  3CXC S;  1SG5 A;  2OTL A;  4BB7 A;  1K8A C;  2M9U A;  4XTZ A;  5CQX A;  1KD1 R;  3S3N A;  1JJ2 P;  3M56 A;  1ABQ A;  1LVK A;  2L3S A;  4M7D F;  1Q86 R;  2AIR B;  3VS1 A;  2EGE A;  3I55 T;  1Q81 C;  1GBR A;  1ZSZ C;  2R58 A;  2MOX A;  4M7A E;  2FB7 A;  4ZTF A;  1WFW A;  5IN1 A;  3JCM Q;  1AWO A;  2A37 A;  4M77 G;  3NTK A;  2EFI A;  4XTY A;  1H3H A;  1UGV A;  2KR3 A;  1KG1 A;  2X35 A;  3CPW S;  1VA7 A;  3HPW A;  3AHU A;  5KH6 A;  1U06 A;  2PUK B;  3I55 A;  2CKK A;  2F2V A;  2KYB A;  5IAY A;  2HD0 A;  1M9S A;  1VQ6 T;  4A4K A;  2DD5 A;  1SRM A;  4M78 F;  1N9R A;  2OTL Q;  2FZK B;  4F7U G;  4MDW A;  2CUB A;  1TS9 A;  1WPY A;  1VQ4 A;  4QKU A;  3A8H B;  4ELZ C;  1GRI A;  3VKI A;  1M1F A;  4C8Q D;  4OB2 B;  3I5R A;  2DTO A;  3X26 B;  2DZC A;  4J9I A;  4J9F A;  3MJX A;  4KH1 B;  3QYH B;  2DXU A;  3RER A;  3MKD A;  3M0Q A;  2QEX Q;  2E4H A;  5LJ3 j;  5GAM j;  1H92 A;  2YRD A;  1YHQ Q;  3QBY A;  4WCI A;  5GAN 8;  3RMQ A;  2L8D A;  3JB9 H;  2PU9 B;  1NEG A;  2DK3 A;  1ZBJ A;  5CQY A;  3PIO A;  4KGX B;  1NEB A;  2K2M A;  3EFR A;  3HHT B;  3CME T;  1I8F A;  3OYI A;  1WI7 A;  4PJO A;  3EG9 B;  5GAM e;  3PNW C;  4JZ4 A;  2FG0 A;  3OYG A;  2O4X B;  1T3L A;  2LNV A;  1PG5 B;  3TCJ A;  2HQH A;  4C0F A;  2CP5 A;  3OS5 A;  1SSH A;  4DBR A;  4IIO A;  1VQL A;  1RAH B;  1NPR A;  2CSI A;  1WGS A;  4KUL A;  3QJY A;  2CZ7 B;  4XU3 A;  2KRS A;  1X6O A;  3QKJ A;  3LW5 E;  3OQ5 A;  4OGC A;  3PFS A;  3OSV A;  5LJ3 f;  2CDT A;  3GIB A;  1TXQ A;  2OTJ T;  2QTX A;  2BUD A;  2BTT A;  3PVL A;  1AOJ A;  1WDX A;  4PK4 A;  3FC3 A;  2DIG A;  4XTV A;  2CZ6 B;  3UWN A;  4M7A A;  1VQK T;  1VQ9 T;  4IUQ A;  4BI4 A;  2D8J A;  4D8K A;  3UAT A;  4E47 A;  5LJ3 e;  5A0L A;  5AT1 B;  4FYY B;  4OP0 A;  2ED0 A;  4Y28 E;  2AKK A;  2GNC A;  1E6G A;  4TVR A;  3FRN A;  1S72 Q;  1WHK A;  5GAM f;  2RI3 A;  1LJO A;  3G7Z A;  2CS7 A;  1GFD A;  3M53 A;  2CGH A;  3I55 Q;  3OYD A;  4FSS A;  4J6X A;  3H0H A;  3CC2 Q;  3JRZ A;  3URG A;  2DIQ A;  2R57 A;  3C4S A;  3BDL A;  4JS5 A;  5KYX B;  1YJ9 T;  5FWB A;  1JB0 E;  1YFN A;  3QII A;  1WJR A;  4DEX A;  3LYI A;  4HCB A;  2FL7 A;  3QO3 A;  2W10 A;  3CC4 T;  3LWH A;  3CCV Q;  1C6V X;  1ZUY A;  2V1R A;  4F7U A;  2O88 A;  2ECZ A;  1IZ6 A;  1UEB A;  4EMK B;  2RQW A;  2G6F X;  1HSQ A;  4KUI A;  3OS1 A;  1PCX A;  1M90 R;  4AFQ C;  2LJ1 A;  1OV3 A;  2QTV A;  4M75 A;  5L23 A;  5A0G A;  1KC8 R;  4PJO F;  1T0J A;  3LGL A;  1OI1 A;  2MI6 A;  5FU7 C;  3CCL Q;  3DLM A;  2VXF A;  3N5B B;  1UJ0 A;  1MUZ A;  1NYF A;  1W2B P;  1SEM A;  1ZUK A;  1J3T A;  2ZPF B;  5LL6 S;  1EX4 A;  4M7D B;  1MGQ A;  3SWN B;  3G4S T;  1W2B A;  2EPD A;  3DB4 A;  1QWE A;  2HNI A;  4IKF A;  3WVD B;  2PZ1 A;  2RHU A;  4IIM A;  4OF1 A;  3OYB A;  2CP6 A;  1WJQ A;  2ENM A;  3JCM c;  4J5Y A;  2VXE A;  4N0A A;  2H8H A;  5LJ5 f;  1RL2 A;  5GMK m;  3S3O A;  5A2Q E;  3J81 E;  5GAN d;  4A4E A;  2L5Q A;  1VYT A;  2RHX A;  1VQ9 Q;  5HK3 A;  1W70 A;  3G6E A;  3VS4 A;  1M1K U;  1PKT A;  2QDL A;  3M0R A;  2IG0 A;  2HEQ A;  2YLC A;  1RAB B;  2DXC A;  2QQS A;  1T3S A;  3G1J A;  1V76 A;  3TU4 K;  2JMC A;  1CKA A;  5KYY A;  3JCM e;  1YIJ T;  3CC2 A;  3CCL A;  1BBZ A;  1YWP A;  1AT1 B;  3HSB A;  1I07 A;  1AZG B;  2O2O A;  3G71 Q;  4E6R A;  3V7S A;  3C12 A;  2P84 A;  4F7U B;  1VQ4 Q;  4HA8 A;  4L59 A;  1IXD A;  5DM7 R;  3KFV A;  2COY A;  5GJV B;  2LZ6 B;  2V1Q A;  4QVZ A;  3MP8 A;  1R8O B;  1G3W A;  2NYS A;  1H64 1;  1D1C A;  1I4K 1;  5LJ3 g;  1M4Z A;  5GAM g;  1OYX A;  5HY6 A;  2RHZ A;  2DBM A;  1WQ7 A;  5I21 A;  4Z89 A;  4O6J A;  1N6A A;  4Z02 A;  1UUE A;  2HZY A;  1UGR B;  4QW2 A;  1QLY A;  3CPF A;  4OML A;  4RCB A;  2B8A A;  3VJP A;  3FDR A;  2BKD N;  1YIJ Q;  1K73 C;  4AG2 C;  4ATO A;  3JCM f;  2K9G A;  3I5S A;  1AWJ A;  1VQM Q;  5D6Y A;  2LCS A;  2QI2 A;  3OYH A;  2MMP A;  1WZO A;  4C0Z A;  3ER0 A;  1DJ7 B;  4NOY A;  4O5V A;  4AFS C;  4M7A G;  1SSF A;  2QGG A;  2EYX A;  3Q1J A;  2SRC A;  4M78 C;  3BY7 A;  5FW9 A;  4C92 D;  4XTU A;  2QXF A;  1LPL A;  1PSF A;  5EC7 A;  1QVG A;  5J26 A;  3E19 A;  1VQP Q;  1X27 A;  1YJN Q;  2JNG A;  2AHJ B;  2DAQ A;  2DF6 A;  2PUO B;  3CCQ A;  2XDB A;  4OB1 B;  1BCO A;  5LJ5 h;  2KT8 A;  2CT3 A;  1EFN A;  2K5F A;  3MEU A;  3CBO A;  2F1L A;  2RA2 A;  2ZPE B;  2R5A A;  5FRM A;  4RUG A;  1QQJ A;  4L5G A;  2KEA A;  3G71 T;  3M9Q A;  4MDX A;  4PJM A;  2XHC A;  4HT8 A;  1UHC A;  3TSZ A;  3LGF A;  3VYH B;  1VQ5 A;  3CCS T;  1Q7Y U;  3CCJ Q;  5LJ5 d;  2A28 A;  2K6D A;  3LH0 A;  2DIL A;  3HRT A;  3WVE B;  5KYW A;  3I56 Q;  1X43 A;  2JMA A;  5CKF A;  3MCA B;  2QYZ A;  3CCU Q;  3EG0 A;  1ZA1 B;  2COW A;  2E5Q A;  2DL7 A;  1ZLM A;  4JDS A;  5LJ3 h;  4JLI A;  4M7A D;  4E7J A;  5FRN A;  6AT1 B;  3CCR Q;  3REB B;  4BD3 A;  2XI9 A;  4M77 D;  1PD1 A;  3PGG A;  2V8K A;  3REA B;  4C92 G;  2CH4 W;  1RI0 A;  4ZN3 A;  1FMW A;  1GCP A;  3ZBD A;  1VQ7 T;  1Q7Y C;  2DPP B;  5GAN 3;  3LH5 A;  4X9C A;  4M7A C;  4M75 D;  3CCS A;  1UFF A;  3M4G A;  5GAN 2;  5I2M A;  2JTF A;  5LJ3 d;  1YI2 Q;  1KQ2 A;  1D0X A;  4DEY A;  1R77 A;  2GFU A;  3UA7 A;  3E1S A;  2DLP A;  3E9F A;  5GAN j;  1WIE A;  2M0O A;  3JCM X;  2HQE A;  1RAG B;  4OMO A;  4CC2 A;  1QCF A;  3H0I A;  1Q82 R;  4J9D A;  2MK5 A;  3CCQ T;  4MMK A;  4BY6 C;  5GAM h;  4LDU A;  2K4Y A;  1UHF A;  2V8J A;  1NM7 A;  2BE7 D;  1YP5 A;  2K2V A;  3HTR A;  1T0H A;  2HBW A;  2J6F A;  1KQS S;  1GXI E;  3TQ7 P;  1ACM B;  2VGM A;  2CRE A;  4JUV A;  4RKU E;  3A98 A;  1NZ9 A;  1VQ4 T;  3HFN A;  4E7L A;  3OMG A;  1YWO A; 
#chains in the Genus database with same CATH homology
 3VKI A;  1M1F A;  4C8Q D;  1G3T A;  4OB2 B;  5GAO l;  1QVF S;  2DTO A;  1UGQ B;  3X26 B;  4C0D C;  2DZC A;  1VQO A;  4CI0 C;  5KE3 A;  4N4G A;  5GAO n;  1YI2 T;  1N8R U;  3QYH B;  2DXU A;  2E10 A;  4D6W A;  3RER A;  4HCZ A;  1KHC A;  3A8O B;  5C0M A;  5LJ3 j;  2IVW A;  4R55 A;  2D9T A;  5GAM j;  4EPC A;  3QBY A;  3PIP A;  2P0Q A;  3GOX A;  4RMO A;  1PSE A;  5GAN 8;  4JRI A;  4EMK A;  3RMQ A;  3RKW A;  2L8D A;  4F7U F;  2QQ9 A;  1W2B S;  3JB9 H;  2PU9 B;  3M55 A;  3OYE A;  5CIU A;  1KC8 U;  3OS2 A;  2DK3 A;  3OYJ A;  1Y71 A;  5DY9 A;  5CQY A;  4E7K A;  1VQN A;  2QA4 A;  3PIO A;  5GAN 6;  5GMK j;  4PNO A;  5GAO q;  3S6W A;  2ZPH B;  2A7Y A;  2LRQ A;  3NTI A;  3L2V A;  3EFR A;  3HHT B;  4M78 E;  3CME T;  4M77 A;  1I8F A;  2MWP A;  1K73 U;  1XOV A;  4M75 F;  3OYI A;  3JSC A;  4C92 E;  2EJ9 A;  3JB9 D;  5LJ5 g;  3GPL A;  2FVU A;  2LT1 A;  4PJO A;  3DKM A;  5GAM e;  3L2Q A;  3PNW C;  1ZBX A;  3OYG A;  2XKO C;  2R5M A;  2XG8 D;  2O4X B;  2KSS A;  4FM4 B;  4J83 A;  3ME9 A;  3RIR A;  4C8Q B;  2EYQ A;  1UGP B;  2E6N A;  4EMK C;  1VQK A;  3JCM h;  4II1 A;  2LNV A;  4PLL A;  4JRK A;  3T9N A;  2L3R A;  3M58 A;  4IUT A;  3INZ A;  3TCJ A;  4C0F A;  2ZPB B;  3G71 A;  1UB4 A;  1VQM T;  2VGN A;  2GCX A;  2CZ0 B;  3OS5 A;  2P4T A;  4XU2 A;  2RM4 A;  3JCM b;  1VQL A;  1IRE B;  5AYF A;  1NPR A;  2E64 A;  1KHI A;  3JB9 F;  1B34 A;  3HFO A;  3L2W A;  2RH2 A;  1WGS A;  4C8Q F;  5KCH A;  4KUL A;  4BE1 A;  2EWN A;  4RCC A;  2PQW A;  3QJY A;  2CZ7 B;  4XU3 A;  1X6O A;  3QKJ A;  1FX7 A;  3LW5 E;  3OQ5 A;  4OGC A;  3PFS A;  3OSV A;  4B9W A;  2YLB A;  5LJ3 f;  2EQK A;  3A8G B;  1Q86 C;  3A8L B;  2JUF A;  3FLG A;  3M59 A;  3I56 T;  1Q86 U;  3GIB A;  5LJ5 j;  2K3Y A;  3CCM A;  2OTJ T;  2QTX A;  4C5H A;  1XNI A;  3JCM J;  5J3B A;  2GF7 A;  2BUD A;  4M75 G;  4LDY A;  3VUB A;  2P0P A;  3JCM P;  1XQH A;  3FC3 A;  4OB3 B;  2DIG A;  4XTV A;  2CZ6 B;  4C8Q E;  2OTJ A;  3UWN A;  4FT4 A;  2KDS A;  2DTI A;  3QSU A;  1V29 B;  2WSE E;  4M7A A;  1VQK T;  1VQ9 T;  1M90 C;  1M1G A;  4IUQ A;  4BI4 A;  1FWZ A;  1VQL T;  3CEY A;  4FIB A;  4C92 B;  3OSS C;  2Y4Y A;  4E47 A;  5LJ3 e;  3QUI A;  3A5Z B;  5A0L A;  2QDY B;  2E12 A;  3C95 A;  3M4Y A;  2E41 A;  2QQA A;  4OP0 A;  3P8D A;  4GLK A;  4QQ6 A;  4Y28 E;  4TVR A;  5D6W A;  2DO3 A;  4J7F A;  5KE2 A;  3FRN A;  3SFM A;  2C06 A;  2LQ8 A;  4LD9 K;  2XD0 A;  1JRI A;  4VUB A;  5GAM f;  4C92 C;  5M9O A;  5GMK l;  3CCU A;  4DQ2 A;  4V2S A;  2RI3 A;  1LJO A;  3G7Z A;  4M78 A;  1OZ3 A;  2CS7 A;  2RJF A;  1QVG S;  5CCA A;  3L1A A;  3M53 A;  2CGH A;  1I81 A;  3FB9 A;  3OYD A;  3VYG A;  4BAC A;  1WQW A;  4J6X A;  4PJO G;  1BI1 A;  2EQJ A;  1N9S A;  5FU6 B;  1N27 A;  3OS0 A;  5GAO r;  3JRZ A;  2JZ2 A;  5CAI A;  3URG A;  2DIQ A;  3MEW A;  4X34 A;  2R57 A;  3C4S A;  3FEO A;  3OBW A;  4ZN1 A;  3BDL A;  4JS5 A;  2D0Q B;  1YJ9 T;  3CD6 A;  1O9S A;  5DLQ E;  1JB0 E;  3QII A;  3OYY A;  3HL8 A;  3CCE A;  4XU0 A;  1WJR A;  3JCM g;  3MEA A;  1WJS A;  3LYI A;  1QVP A;  2PVD B;  4HCB A;  4ELY C;  2FL7 A;  2X4X A;  3A8M B;  3QO3 A;  4RG2 A;  4A4H A;  3CMA T;  4BDY A;  3CC4 T;  2EQU A;  4PL6 A;  3LWH A;  4IUR A;  1VQP A;  3V8K A;  4F7U A;  5FLX E;  1IZ6 A;  2DTH A;  3L42 A;  4Y91 A;  5GMK i;  1UEB A;  1YI2 A;  1G5V A;  1D3B A;  4EMK B;  1D3B B;  4IUP A;  3SD4 A;  3V8L A;  3BW1 A;  4M75 B;  4KUI A;  5EG2 A;  3OS1 A;  2ZPG B;  2DJZ A;  2H3J A;  3UPU A;  2A3L A;  1K9M C;  1NPP A;  2DKG A;  3J7A F;  3ZFJ A;  4N0A C;  1YCY A;  3OYF A;  2YRV A;  2DD4 A;  3E9G A;  3OYK A;  4M75 A;  2LVM A;  5A0G A;  2EJG A;  4PJO F;  3LWI A;  3OYA A;  2Y90 A;  4KBM B;  1VQN T;  3LGL A;  1OI1 A;  2CYZ B;  2MI6 A;  1VUB A;  5FU7 C;  2VXF A;  2K57 A;  3DLM A;  3N5B B;  3CCJ A;  2KAF A;  1ZQ1 A;  1O75 A;  1QP2 A;  5CR2 A;  3JCM d;  2LCC A;  4M77 C;  2ZPF B;  4J8O A;  2PVG B;  5LL6 S;  5GAN g;  3L2R A;  3CC4 A;  4M7D B;  3JB9 J;  1MGQ A;  3SWN B;  3G4S T;  4BI3 A;  2RJC A;  5KCO A;  5CK9 A;  1W2B A;  4E7I A;  3DB4 A;  4MML A;  4BI8 B;  3KBG A;  2QA4 T;  2HNI A;  2QQR A;  4XAX B;  1S72 A;  2HAX A;  4IKF A;  2ZZD A;  3OW2 A;  2QQB A;  4M77 B;  4C8Q G;  4IUU A;  5C6S A;  4OMF B;  3WVD B;  5J39 A;  2NLU A;  1HK9 A;  1X01 A;  3ZEH A;  2RHU A;  4PKC C;  3QXE B;  4OF1 A;  4F7U E;  3OYB A;  3FIF A;  1Q82 C;  1WJQ A;  2F5T X;  4E7H A;  1LOJ A;  4ZTJ A;  1NJI C;  3JCM c;  4WF2 A;  4J5Y A;  4BE2 A;  4C92 F;  2LT4 A;  2VXE A;  4C5G A;  3MP1 A;  2L89 A;  4N0A A;  4XTX A;  5LJ5 f;  1RL2 A;  5GMK m;  3S3O A;  1BKB A;  5A2Q E;  4M77 F;  5GAN 4;  3J81 E;  2G3R A;  5GAN d;  1JBM A;  2LDM A;  2KY9 A;  4A4E A;  2YHT A;  2L5Q A;  2RHX A;  3QPH A;  3ASK A;  5HK3 A;  3MET A;  4HT9 A;  2OAU A;  3V7C A;  3G6E T;  1KQS A;  1YJW A;  1VQ5 T;  3MHX A;  3G6E A;  1M1K U;  5GAO m;  2K3X A;  2ZGW A;  4ZGJ B;  2E6Z A;  4M78 B;  2IG0 A;  2YLC A;  4MZT A;  5FU6 C;  2DXC A;  2I2L A;  4BUG A;  3OY9 A;  2QQS A;  1S72 T;  4UC4 A;  3F70 A;  3PT9 A;  3OYL A;  3KXT A;  3CCR T;  3V8J A;  3TU4 K;  1BI3 A;  4M78 D;  4C5I A;  4L6V 5;  4FT2 A;  3LX7 A;  3GNG A;  3JCM e;  1VQ9 A;  2HBP A;  3GNF B;  5HKC A;  3JB9 I;  4N4I A;  1Y96 B;  1YIJ T;  2RJD A;  1VQ7 A;  3CC2 A;  3CCL A;  3HSB A;  3CCL T;  2E1H A;  3OA6 A;  3S3M A;  2CZ1 B;  4J6Y A;  4NL3 A;  1FXX A;  2FYK A;  3V7S A;  1KQ1 A;  3C12 A;  1YIJ A;  3CC2 T;  4M7D A;  1XTD A;  4F7U B;  3HRS A;  1Y96 A;  4C8Q C;  4LDW A;  4M77 E;  1U1S A;  3QHS A;  4MZM A;  4HA8 A;  1VQM A;  4L59 A;  1BYM A;  1VQ8 A;  2O4X A;  2RJE A;  2XK0 A;  3OW2 S;  3FJP A;  5DM7 R;  3DLL A;  3EAE A;  1EIF A;  2M1H A;  4FL6 A;  2RB6 A;  2DXT A;  2XDD A;  2DZ9 A;  4BDZ A;  2K5I A;  5GAN 5;  3OYM A;  3C94 A;  3MP8 A;  4QVZ A;  3NFC A;  2X4Y A;  4A54 A;  3CCV T;  1R8O B;  4A4F A;  1N8R C;  1G3W A;  4N4H A;  2WSC E;  1H64 1;  3M57 A;  4FSX A;  1I4K 1;  4PJO D;  1B34 B;  2EQM A;  3HP9 A;  3H6Z A;  2JVV A;  1JJ2 S;  5LJ5 e;  5LJ3 g;  2E70 A;  1M4Z A;  2DXB A;  4LD6 A;  5GAM g;  1OYX A;  4RG8 A;  5GAO p;  4B9X A;  5HY6 A;  4R56 A;  2WSF E;  4DOV A;  3GP8 A;  4OGE A;  2ZPI B;  2RHZ A;  1VIE A;  3DB3 A;  1YHQ A;  3P8H A;  2GQV A;  3X25 B;  3EFS A;  1WQ7 A;  3QJ6 A;  3V7R A;  5I21 A;  2EKO A;  3CBM A;  4O6J A;  5L8R E;  3OYC A;  5CKB A;  1N6A A;  4M75 E;  3CXC A;  4C5E A;  2JN0 A;  4Z02 A;  3MO8 A;  4JS4 A;  4DA4 A;  1YIT A;  5FRO A;  1UGR B;  5D6X A;  3X28 B;  4QW2 A;  3CPF A;  4RCB A;  3KUF A;  2D6F A;  4PJO B;  2B8A A;  2RD1 A;  3OB9 A;  3VJP A;  3FDR A;  5CVI A;  5DLO A;  3JCM V;  2BKD N;  1AHJ B;  3RMS A;  1BI0 A;  1K73 C;  3TRE A;  2EAY A;  1Q82 U;  4ATO A;  2KMT A;  3JCM f;  3GLX A;  2EIF A;  3CCV A;  2BIV A;  2VV5 A;  4KT0 E;  2XDP A;  5D6Y A;  1M5Q 1;  4QVC A;  4J6W A;  1G3Y A;  1BIB A;  4P5N A;  4XTW A;  2QI2 A;  4JRQ A;  3CCJ T;  1M90 U;  3OYH A;  1NJI U;  2MMP A;  4M7A B;  2RO0 A;  3UDC A;  2HQX A;  4C0Z A;  3ER0 A;  1DJ7 B;  4NOY A;  4O5V A;  3VV0 A;  3RKX A;  4M7A G;  2VC8 A;  1SSF A;  3CCE T;  2QEX T;  4LDX A;  1KD1 U;  5GMK e;  1BI2 A;  4M7D G;  3Q1J A;  4FU6 A;  4M78 C;  2M16 A;  3BY7 A;  3O8V A;  4C92 D;  3HKS A;  4XTU A;  2QXF A;  4C92 A;  4EMH A;  3GF5 A;  1PSF A;  2LX9 A;  1TH7 A;  3QYG B;  5GAN h;  1QVG A;  5J26 A;  3E19 A;  3VUZ A;  2JNG A;  3OBY A;  2RI2 A;  4JLG A;  2AHJ B;  3X24 B;  2DAQ A;  2RI5 A;  4X9D A;  2LCL A;  2XIC A;  2PUO B;  3CCQ A;  2XDB A;  4NL2 A;  4OB1 B;  1VQP T;  5LJ5 h;  4HCC A;  1YJN T;  3CCR A;  3JB9 G;  3UT1 A;  2K5F A;  2VUB A;  4M75 C;  3CBP A;  4HKE A;  3MEU A;  1G3S A;  4IUV A;  3CBO A;  2RA2 A;  2ZPE B;  4BY6 B;  2R5A A;  4XK8 E;  3BFM A;  4M7D D;  1Y07 A;  5A0D A;  5FRM A;  1OZ2 A;  2F5K A;  4ME7 A;  1LNX A;  4L5G A;  1VIF A;  4XU1 A;  3MP6 A;  3G71 T;  4OB0 B;  1WNL A;  3M9Q A;  4MDX A;  3QDR B;  2GFA A;  4JJN K;  3JCM W;  1K8A U;  1UGS B;  4MZP A;  2O01 E;  4A4G A;  2XHC A;  4HT8 A;  4NS5 A;  2X4W A;  3LGF A;  5FU7 B;  3VYH B;  1YJW T;  2JOY A;  4LDV A;  1VQ5 A;  3PMT A;  3CCS T;  1Q7Y U;  4A53 A;  1M1K C;  3J80 E;  4GY5 A;  2K5L A;  3SB2 A;  5CKH A;  5LJ5 d;  1K9M U;  5GAN f;  3LH0 A;  3NTH A;  5CKE A;  4C8Q A;  1QP3 A;  2MAM A;  3I56 A;  1KD1 C;  1H3Z A;  4M7D C;  1BIA A;  3HRT A;  1Q81 U;  3P8B B;  3OMC A;  3WVE B;  2X4J A;  3QG1 A;  4OVA A;  4Q5W A;  2LC4 A;  1Y7X A;  1MHN A;  2MWO A;  4C0D B;  3PTA A;  2FHD A;  2RK1 A;  2DVE A;  2LQK A;  1W4S A;  3MCA B;  5CKF A;  3X20 B;  2KQW A;  1VQ6 A;  4QQD A;  3M54 A;  1VQ8 T;  3BDU A;  2QEX A;  2E5Q A;  3JAM E;  2LTO A;  2Y4X A;  5LJ3 h;  4JDS A;  4JLI A;  4M7A D;  4E7J A;  3RUX A;  5FRN A;  2JTM A;  5GAN e;  4KUD K;  2KK4 A;  2XI9 A;  4M77 D;  4BD3 A;  4CRI A;  3CME A;  3HRU A;  2E65 A;  3PGG A;  1KC8 C;  2OTL T;  4PJO E;  3CXC S;  2OTL A;  2V8K A;  3WXM B;  4BB7 A;  4QVD A;  4C92 G;  2ZCF B;  1K8A C;  2M9U A;  4XTZ A;  3CCM T;  5CQX A;  3M5A A;  3S3N A;  1RI0 A;  3RES A;  4M78 G;  4ZN3 A;  3M56 A;  3ZBD A;  1U8R A;  1I5L A;  1VQ7 T;  4DOW A;  1Q7Y C;  2DPP B;  2RHY A;  3OYN A;  5GAN 3;  1JJ2 A;  5I2S A;  4M7D F;  2XID A;  4X9C A;  4M7A C;  4M75 D;  3CCS A;  1X75 C;  1ZHI A;  3I55 T;  4JRP A;  3M4G A;  3LLR A;  1Q81 C;  5GAM d;  5GAN 2;  4ZGD B;  4YTL A;  5I2M A;  5IT9 E;  2JTF A;  2R58 A;  4M7A E;  5LJ3 d;  5GAN 7;  2FB7 A;  4EDU A;  1KQ2 A;  1M8V A;  3CC7 A;  4ZTF A;  5IN1 A;  3JCM Q;  2F69 A;  2GFU A;  1YJ9 A;  4EMG A;  2RK2 A;  3E1S A;  3PMI A;  1YHQ T;  3E9F A;  2EJF A;  5GAN j;  5GMK h;  3R6O A;  1YIT T;  4M7D E;  4M77 G;  2M0O A;  3NTK A;  1HXD A;  2EFI A;  2HQE A;  3JCM X;  2KVQ G;  1QVF A;  3SDZ A;  4XTY A;  3CMA A;  3L2U A;  2VYT A;  1KG1 A;  2MF2 A;  2X35 A;  3CPW S;  3CCQ T;  2DEQ A;  3HPW A;  4M7A F;  4BE0 A;  5CO7 A;  3AHU A;  3TEE A;  4MMK A;  3CCU T;  4BY6 C;  3SWN A;  5GAM h;  1P92 A;  3CD6 T;  4LDU A;  1NE8 A;  5KH6 A;  2PUK B;  3I55 A;  2CKK A;  2K4Y A;  1U1T A;  3MEV A;  5IAY A;  1VQ4 A;  2HD0 A;  3CC7 T;  4J7I A;  1M9S A;  2V8J A;  1YJN A;  5CKD A;  1YBY A;  2V8I A;  3SWN C;  1VQ6 T;  4PJO C;  2K2V A;  4A4K A;  2DD5 A;  2PVO B;  4C0G A;  1QW1 A;  3L2Z A;  4M78 F;  1N9R A;  2XU8 A;  4QQG A;  4ZGE B;  1KQS S;  1GXI E;  2VGM A;  5HK0 A;  3H8Z A;  3QZ9 B;  4JUV A;  4RKU E;  4PLI A;  4XQ3 A;  3RKY A;  4F7U G;  1NZ9 A;  4MDW A;  3CPW A;  2P0K A;  3QZ5 B;  3G4S A;  1VQ4 T;  2WAC A;  3HFN A;  4E7L A;  3VU3 C;  1VQO T;  1WPY A;  2RHI A;  3OMG A;  3A8H B;  4ELZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...