4M7AF

Crystal structure of lsm2-8 complex bound to the 3' end sequence of u6 snrna
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
80
structure length
66
Chain Sequence
AILDLAKYKDSKIRVKLMGGKLVIGVLKGYDQLMNLVLDDTVEYMNARKLGLTVIRGTILVSLSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 8
structure length 66
sequence length 80
chains with identical sequence M
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m7aF00
5LJ3g 4M7DE 1X01A 3JCMV 5GAN7 4M7DG 3FIFA 3V7CA 5GAMf 5GAOq 4M78F 2EJ9A 2DEQA 4JUVA 5GANf 2HNIA 5GAN5 3SWNC 4M7AD 1I8FA 4M78A 4C92F 4PJOC 2E1HA 4X9DA 1JRIA 4Y91A 4C8QD 4F7UA 5LJ3h 2RA2A 3JB9D 4C92A 3RERA 2EWNA 2DZCA 3L2ZA 1Y96B 3BW1A 4M7AF 3JCMW 3QHSA 1H641 2QTXA 4J5YA 4OP0A 5LJ5f 2VXFA 1LNXA 3BDUA 1BIBA 1HK9A 5GANj 4C8QF 4M7DC 5GAN6 4M75B 4M77A 4XU1A 5GAN2 2RM4A 3JCMP 3JB9F 4XTYA 1I81A 3HFNA 3JCMh 4N0AC 3JB9I 3SWNA 4JRIA 4M7DD 2EJFA 2FYKA 5GANe 4PJOA 5GANg 1D3BA 5DY9A 2RB6A 4M75E 1KQ2A 4EMKC 4M7AC 4M75G 3QO3A 3EFRA 1YCYA 3JCMJ 3BFMA 3VU3C 4C8QC 5LJ5j 3V7SA 4M7DF 4XTXA 5GAMh 5CAIA 3V8LA 4QVDA 3JCMe 4XTVA 5GAOr 3JCMQ 3FB9A 4V2SA 3JCMg 5LJ5e 4F7UB 3JCMX 5GANh 2ZGWA 5LJ5g 3JCMb 4N0AA 4QVCA 2DTHA 3GIBA 4J6WA 5GAMj 4NL3A 2E65A 4EMGA 3JB9H 1M5Q1 4PNOA 4F7UE 4M7AA 3INZA 4EMKA 4F7UG 1KQ1A 5GAN3 4C92G 5GAMe 4J6YA 4M77B 3QUIA 5GAMg 2EJGA 3JCMc 2CGHA 2EAYA 4A53A 3M4GA 4HA8A 3SWNB 4C8QA 5GMKl 4RCCA 4X9CA 2E41A 4M75D 2DTOA 4XTZA 4PJOB 1HXDA 1WNLA 1D3BB 1U1TA 3V8KA 5LJ3d 3EFSA 4XU3A 5GAOn 4M77E 3HSBA 5GANd 4M77G 3BY7A 3FJPA 1B34A 4NL2A 3L1AA 4XTWA 2VXEA 4HT8A 2E10A 1U1SA 4M78B 2K57A 4PJOG 1BIAA 1WQWA 4M75F 1TH7A 4M7DA 1JBMA 2Y90A 2RD1A 4C92B 5GMKj 3RUXA 3RKWA 1LJOA 4HT9A 1WQ7A 4A54A 3JCMd 2YHTA 4M78E 2DTIA 4M78G 5GMKm 5GAN8 1I4K1 4MMLA 2DJZA 3SB2A 2YLCA 3RKXA 5I21A 2DXUA 5GMKi 4JRKA 5GAOp 4C92E 1LOJA 2DKGA 4M7AB 4EMKB 2DXTA 4NOYA 3HFOA 4M75C 3V8JA 4M77C 5LJ5h 4XQ3A 5LJ3f 3PGGA 2JN0A 2VC8A 4C8QB 4DQ2A 5GAOl 2DZ9A 4XU0A 1MGQA 4F7UF 4M77D 5GAMd 3RIRA 1M8VA 2FB7A 4XU2A 3V7RA 3RKYA 4M7AE 1I5LA 4M7AG 5GMKh 4PJOD 1WPYA 1B34B 3RESA 4C8QE 4EMHA 4PJOE 1Y96A 2I2LA 4MMKA 4C8QG 3JB9G 3QSUA 4JLIA 5GAN4 4M78C 3JCMf 3AHUA 1N9SA 4J6XA 4M77F 4M7DB 4XTUA 5LJ3j 3JB9J 4M78D 1N9RA 2E64A 4M75A 4C92C 5GAOm 4PJOF 2DVEA 4RCBA 5LJ5d 4C92D 5GMKe 5LJ3e 4WF2A 2YLBA
chains in the Genus database with same CATH superfamily
3OS5A 8ATCB 1OYXA 3CC4A 5GAOq 1S1NA 1UGVA 1NE8A 4M7AD 4FW2A 1WHLA 2DL8A 2PZ1A 1QVGA 3VUZA 3OYIA 4DA4A 4ZTFA 4C8QD 1MMNA 3RNJA 2VB6A 2GF7A 3OQ5A 3X28B 2RHUA 1YIJQ 3MEWA 1K76A 5GANj 4RUGA 4JRIA 4J9DA 5GANe 1NJIC 2ZCFB 2YUQA 1KQ2A 2EFIA 5CKHA 5GAMh 1WJQA 4E7JA 2VWFA 2AK5A 2LJ3A 3JCMb 4HCCA 1G8XA 2LQWA 3FRNA 2E65A 3QWYA 3DB4A 1M5Q1 2X4WA 3D7SB 5D6YA 1KQ1A 4EMKA 1K73R 1W4SA 4KGXB 2CSQA 5A0GA 3GF5A 1GXIE 2LNVA 4X9CA 2E41A 4M75D 2KROA 2K5IA 3BE3A 3ME9A 4BB7A 4AFQC 2P4RA 2SEMA 2KGTA 2DPPB 3SHWA 3OW2S 3THKA 4J9EA 4CC2A 1OOTA 1N8RU 1M3BA 5GMKi 2QEXA 4JRKA 4N4IA 3MCAB 3KXTA 2AHJB 2PVDB 3KFVA 1K9MC 4BY6B 1M2VB 1NPPA 2XG8D 4XQ3A 4E7LA 1IGQA 1MMDA 2HSPA 5J3BA 1YHQT 1MGQA 4KH1B 1IGUA 5GMKh 1Q7YU 1WJSA 3RDVA 5KE3A 1OPLA 1W1FA 3JB9J 1RL2A 3LYIA 2FZGB 2HQXA 2XK0A 3M0QA 1EZZB 2ABLA 2RO0A 3LX7A 2L8DA 1ZQ1A 2NWMA 2O01E 1VQ7T 1I8FA 1M4ZA 4JJDA 4HCKA 4OMNA 1KQSP 2KNBB 4PJOC 2CT3A 1YWOA 4Z02A 4C0DB 2K3XA 1Y96B 3WVEB 4VUBA 1VA7A 1B7TA 5DLQE 2A0FB 1PRMC 3CD6T 5GAN6 4BACA 3P8HA 5CKFA 3CCRQ 1X27A 2EGAA 4JRPA 2L89A 3CMAQ 2DERA 3UA6A 1X75C 2MWPA 4K11A 4A4FA 1PD0A 2PNIA 4BDYA 1QP3A 2BUDA 2EBPA 4DOWA 4FYVB 2O9SA 2QDYB 4JS5A 2E3HA 5LJ5g 3CC7T 3M53A 3I55Q 2LCSA 3OYLA 1NBEB 3QZ9B 2ESWA 4A4GA 3SWNB 3VYHB 4AG1C 3EGDA 3MEUA 4HVVA 1UGQB 1VQMQ 3SEMA 4LDYA 2DF6A 2KMTA 1PNJA 1RI0A 3CCLT 4C92B 3ZEHA 2F1LA 2DJZA 2RNAA 3SB2A 2DETA 3E1SA 3PIOA 3DLMA 3NGPA 3QDFA 3KBGA 5KH6A 4M7AE 3SD4A 3CCVQ 1RADB 1FXXA 2LRQA 4IUTA 4C8QE 4WTOB 4MMKA 1K73C 2D0NA 1OPKA 5FWCA 2RQRA 4FT4A 2LJ0A 4LDVA 4DEYA 2V8KA 2DVEA 1X2KA 5LJ3g 2YSQA 4J9CA 4X34A 3FC3A 2O88A 2J06A 3FIFA 1UGSB 5GAMf 1V76A 4JJNK 1SRLA 2MCNA 2RI5A 1AT1B 3HRTA 2KVQG 1VQKT 1KIKA 2V1QA 1M2OA 2XD0A 2P0QA 4E7ZA 1V29B 1JJ2P 3EGXA 2EVRA 1HK9A 2OJ2A 4J9IA 4XU1A 5CR2A 2MPXC 3HFNA 1N27A 4RTXA 1ABOA 2HSEB 2RQTA 4KH0B 4JPBW 5KYNA 2JZ2A 4M75E 3MO8A 2RHYA 2XDBA 2YDLA 1ACMB 3JCMJ 5LJ5j 2X4YA 3JCMQ 2R57A 1K1ZA 5LJ5e 5GANh 4A4HA 1ZSGA 2GTJA 1P92A 5HKCA 4F7UE 2M9UA 3S3NA 5GAMg 2CT4A 2FZCB 3C94A 3CCQA 2DTOA 3OYBA 1OZ3A 3I5RA 2A3LA 2CUBA 4NL2A 2LQKA 2C0TA 2CSIA 5A2QE 3VS5A 2DL5A 4M78B 2K57A 5HY6A 3I56T 3PIPA 2ZZDA 3L2WA 3R6NA 3X24B 1FX7A 3M58A 3TCJA 3CPWP 2R5MA 4C5GA 3V8JA 2VUBA 1KQSA 4BUGA 1M30A 5A0DA 3G6ET 1ZUKA 4J9GA 2VYTA 4BI3A 1V1CA 2OTLQ 3CCJQ 3GNFB 4QKUA 1WDXA 2A7YA 1WZOA 1KC8U 1VQ4Q 4PK4A 2X4JA 5LJ3j 3CC2A 1YJ9T 1DJ7B 1XNIA 4BI8B 5LJ3e 2CP0A 2M02A 3OYKA 1VQ5A 2NLUA 1ZUYA 5L23A 3NPFA 5FWBA 3PMIA 4OB2B 4C92F 1JRIA 4AG2C 1OULA 1UUEA 2RI3A 2QTXA 1Q86U 2RN8A 1GBRA 5IN1A 3JRZA 2LCLA 4M7DD 3HHTB 4Y92A 4R56A 3H0FA 1OI1A 9ATCB 4EMKC 3PFSA 4FCYA 1VQNA 2ECZA 4JRQA 1WXUA 3BFMA 4Q5WA 1H3ZA 1X43A 2JS0A 2AZSA 4NL3A 5GAMj 4B6MA 1E6GA 2RPNA 5GAMe 3KUFA 3JCMc 1T0HA 2NYSA 4PJOB 2FPDA 5KE2A 2CP2A 2DBMA 2IPOB 4D6WA 1VQPT 3CCMT 2RJCA 2VXEA 2YT6A 2ZPBB 3C12A 1HYOA 1QVGP 1D0YA 3RR6A 3FDRA 3QG1A 4OB3B 2O2OA 2XDPA 4E6RA 2FPEA 1RAEB 2DXUA 2BTTA 4HCZA 2QQSA 2QXFA 4DQ2A 5A0LA 2LZ6B 3VS1A 3SFMA 2FEIA 3A1PA 1Y0MA 4M7AG 5HCKA 1TUDA 4C8QG 1X6OA 1VQ6T 2FPFA 1YFNA 2PUKB 1FWZA 1ZSZA 1G83A 3GLXA 4IURA 2KE9A 5GMKe 3CCET 3PT9A 2NUPA 1X01A 3GPLA 5CKEA 2CH4W 5HK3A 4M78F 5I2MA 5GANf 1UJYA 1WGSA 2GNCA 3QYHB 3LH5A 1MV3A 3L2UA 2W10A 2HMAA 1K9MU 2VXFA 1BIBA 1YHQQ 4FYYB 3O5ZA 3CMEA 1NYGA 3L42A 3JB9I 2HDAA 3JCMh 2HBPA 2CZ0B 2QTVA 3OSSC 1QLYA 2HQHA 1KQSS 4ZGDB 1KG1A 4M75G 3DKMA 2XHCA 3OS1A 3CC4T 2SRCA 3V7SA 2ZAEA 3VS7A 4ZN1A 2DTHA 4D8KA 3GIBA 2YWWA 2K5LA 3VRZA 5KYYA 4F7UG 2JUFA 1VQ7Q 2DE0X 4M77B 2XIDA 1MUZA 2EAYA 5LJ5h 3CEYA 1WNLA 4L59A 4N4GA 4JZ3A 3EFSA 4MZTA 2EGCA 5CKDA 1KJWA 2DK3A 4AT1B 1D0XA 2DVJA 2JVVA 5AT1B 4LXCA 3CD6Q 1JBMA 4QVZA 2RK2A 2F2WA 2PUOB 2DYBA 5IHIA 4RTUA 3G4SA 5GAN8 4DEXA 5KYXA 2KXDA 1UB4A 2DKGA 1VQLT 3LGFA 1CSKA 3UPUA 5FRMA 2DBKA 2WACA 3CC7Q 5CO7A 1MMAA 2KRNA 2O4XB 4OB0B 1AVZC 1GCQC 4J7IA 5CCAA 4HCBA 1CKAA 4OVAA 2EQIA 4R0KA 4PJOF 3I5SA 2DXCA 2RI2A 3VKIA 1TU0B 5FU6C 4M7DE 1Y57A 2QEXT 2VV5A 4PJNA 3CCLQ 4X9DA 4J9HA 5CKBA 2HL5C 5LJ3h 1WA7A 1AWWA 3M0PA 1ZLMA 2E12A 4FW1A 2LX7A 3QHSA 2X51A 2KXCA 2XU8A 3BDUA 2F5TX 3HRSA 5GAN2 3JB9F 2YUPA 4AFUC 2ROTA 3QWXX 2JOYA 3MP6A 2M0OA 3MPUB 3EG3A 1WHHA 2VKNA 2M0YA 3H41A 1K73U 4Y28E 4LN2A 4BE0A 4XTXA 5CAIA 5KCOA 2F69A 2GFUA 1JJ2S 1D09B 2RH2A 5FU7C 5J39A 4RTVA 3LH0A 4IIOA 1M90R 2D1XA 5KCHA 3CBPA 1VQ9T 2JJ9A 2M1HA 4M7AA 8AT1B 3U23A 5KYUB 1EX4A 4C92G 1M1KR 1VQKQ 1C0MA 2ZPEB 4QQGA 1VQ5Q 4C8QA 3M4GA 2K3BA 1KK7A 1FMVA 4IUPA 4F04B 4PJLA 3UA7A 1Z9ZA 2G6FX 3NTIA 2ATCB 4HXJA 1X69A 1WHKA 4XK8E 3RUXA 3RKWA 1PHTA 1X6BA 2KYBA 3J7AF 1BKBA 1MHNA 2FHDA 1K8AR 1VQLA 2E3IA 4EMKB 3PE0A 1YN8A 2KYMA 3HFOA 7AT1B 3PGGA 2DZ9A 4FSSA 3ZBDA 4Z88A 2I0NA 2COYA 2RQVA 1WHGA 2PU9B 4GLKA 3QYGB 5D6WA 3JCMf 4J6XA 4M77F 1JXMA 2E64A 4M75A 4FM4B 3CPWS 1R8OB 2LQ8A 2WSCE 1SF9A 2BZYA 2XKOC 3OYJA 1Q82R 3I56Q 1W2BS 1W6XA 2QI2A 2QYZA 4JJBA 1RACB 4F7UA 1YITA 2DNUA 2EWNA 2EYYA 1R77A 1JU5C 3JCMW 5LJ5f 2ED1A 2K2MA 4N4HA 4M7DC 1O9SA 2KQWA 4L5GA 1QVFA 1NG2A 3EAEA 3G6EQ 2DRMA 3QJYA 2KT1A 3E9FA 2XDDA 2JTFA 1XQHA 2R58A 1AWJA 3QO3A 1VQ8A 3EFRA 3OMGA 5IT9E 1IREB 1YJ9Q 2DX1A 4A4KA 4V2SA 3JCMg 2RJFA 5GJWB 1TWBA 2KBTA 5GJVB 1VQ9A 2JTEA 3UT1A 2JMAA 2QQ9A 3INZA 2JM8A 4O5VA 2OAUA 3CCUT 2JTMA 2AIRB 4MZMA 4HA8A 2EW3A 2QGGA 3CXCP 5KYWA 3VS4A 3VS3A 5GANd 3OB9A 3BY7A 1SKUB 4ZGEB 2HCKA 2FZKB 1UFFA 3E9GA 3HP9A 3M56A 1N8RR 2Y4XA 2LJ1A 4O6JA 1M8MA 2CZ7B 3CCST 1NLOC 2CYZB 1WLPB 5I21A 4JJCA 5GAOp 1ZSZC 2O9VA 3JAME 1ZUUA 2ZPGB 3QXEB 1UG1A 5LJ3f 3JSCA 2FB7A 3EGDB 3CCQT 1M90C 1VQOA 1QVGS 4RMOA 1TG0A 4E47A 1M1KC 2V1RA 3M54A 1JQQA 3H9NA 1AZGB 2F2XA 4C92D 4E7SA 1VQPQ 3S3MA 3CCMQ 3TSZA 4M7DG 4TVRA 3N5BB 3O8VA 3REBB 1UJ0A 4JUVA 1Q81R 4LE9A 4C92A 1WFWA 1SG5A 5LL6S 2H3JA 1K8AC 3LGLA 1AD5A 4BE1A 1QWFA 3CQTA 1QKXA 4GY5A 1M27C 3M0TA 1Y71A 3CC2T 2ZPFB 2DL4A 2BZ8A 3NHNA 1YI2A 1D3BA 2CREA 2DXBA 1GCQA 1VQ6Q 4PKCC 5L8RE 3VU3C 3MEAA 3M0RA 4ZNXA 1VQ5T 2FRYA 1OU8A 3JCMe 1UTIA 4NS5A 3CCEQ 4CC7A 2PVGB 4MZPA 1KD1R 2BE9B 2Y4YA 3OMCA 1U3OA 4OF1A 4RTWA 5FU6B 1Q82C 3CCUA 3EGXB 3EFOA 3VV0A 4J6YA 4DBFA 2EJGA 1K0SA 1D0ZA 1MMGA 2GBQA 2J6KA 1YJWA 4FL6A 1B34A 1TXQA 3L1AA 4KRTA 3M0SA 1VQNT 2PQWA 4FYWB 3CCSA 1XOVA 1QCFA 1T0JA 2CP7A 2YHTA 2P0KA 2PTKA 4CRIA 3OYNA 3CC4Q 4GLMA 2P4TA 1UEBA 1QVPA 3GP8A 2JN0A 4XU0A 2X4XA 3NTHA 5FU7B 3RESA 4PJMA 1SHGA 3LW5E 1MNDA 1NEBA 2EYXA 3G71A 2QDLA 3G7ZA 2MAMA 2OTJT 4M78D 2YRDA 3AT1B 2VGMA 1IHVA 4EPCA 3L2VA 4KUDK 3JCMV 1N8RC 2YRVA 4J8OA 4M78A 4HVUA 2QK0A 2J6OA 4OMLA 1RI9A 2WSEE 2HKNA 2EQUA 2OAWA 2RHIA 1Q7YC 1VQLQ 1I07A 4IUVA 1LNXA 5DM7R 2AZVA 3CXCA 3VRYA 5FROA 1AEYA 1PG5B 2FVUA 4M7AC 1FYNA 2E70A 2AKKA 4C8QC 2H8HA 3EHQA 1G3TA 1YWPA 1CKBA 4LDUA 3OYGA 2K79A 2QEXQ 3MP8A 1M3CA 5GAN3 1YNZA 1YIJA 1Q81C 1Y7XA 3H0HA 1ZBXA 2EGEA 2JM9A 4Z89A 2XMFA 3CMET 2L2PA 4WCIA 4OB1B 3J81E 4DBRA 3S3OA 2CP3A 3FJPA 1N6AA 4XTWA 1QMCA 1U1SA 1TUGB 4M7DA 2V26A 4HT9A 1SEMA 3M4YA 1S72T 2DEUA 3RKXA 3PNWC 4C92E 2O31A 2J6FA 3ZL7C 4M75C 4EDUA 3T9NA 3VYGA 3OY9A 2J05A 1KD1C 1M1FA 2DRKA 4PJOD 4QW2A 2E4HA 1VQ9Q 4J9BA 2OTJA 1TUCA 5GAN4 2L5QA 3M59A 3URGA 4BE2A 1M3AA 4XTUA 1NJIU 2CP5A 3WVDB 2CZ1B 1R0BG 1FMWA 1C1AA 3M0UA 1YJNT 4OMMA 3G4ST 1KHIA 1OX8A 2MK5A 4RG2A 2X3WD 2EJ9A 4BI4A 3FLGA 4CC4B 1OZ2A 2D0QB 2KAFA 3OYCA 3PVQA 3JB9D 3RERA 2DZCA 3L2ZA 3NMZC 1ZSZB 4IIMA 1IB8A 4F16A 2K2VA 4DBQA 1JB0E 4FIBA 2NUPB 2RB6A 3EG9A 1J3TA 4P5NA 2BKDN 1RAFB 4XTVA 2JNGA 1UGPB 4J6WA 4JLGA 3FJ5A 4KBMB 3HTRA 4UC4A 2NUTA 5IH2A 2LNHB 4LUDA 1OU9A 4C0GA 3OYFA 1WJRA 3CMAA 1BBZA 2E6NA 4RTZA 2E10A 1BCOA 1KHCA 3CBOA 1BU1A 2HL3A 4HVWA 2GFAA 1S72A 1JO8A 1WYXA 4E7HA 4C0ZA 2HQEA 2LP5A 2EIFA 4M78E 3QPHA 1H92A 3I55A 5KYYB 3CXCS 1NPRA 1U8RA 4BD3A 1QVFP 3QBYA 4M77D 5GAMd 2KT8A 1QCOA 1VYVA 3TREA 1VQMA 2GCXA 5CK9A 3EG1A 3CCUQ 4L6V5 4C92C 1YJNA 1T3LA 4WF2A 1I1JA 3OYDA 5KYXB 1NZ9A 2E5KA 3V7CA 2X3XD 2COZA 3A8HB 1XJWB 3M55A 1B3QA 2E1HA 3OYYA 3CCSQ 1VYTA 4QQ6A 3UWNA 2RA2A 3EH1A 4FSXA 3CCVA 2ZPHB 3LWHA 2FL7A 2FRWA 3CCQQ 3G1JA 5HK0A 4C5IA 1YCSB 2GQIA 1YCYA 1BB9A 5GAOr 4E7IA 2IIMA 1VIFA 4KT0E 4N0AA 3OA6A 1YITT 4EIKA 2C06A 4E2FB 3JB9H 1D1AA 2KR3A 4J7FA 1HD3A 1AWXA 4A53A 2L3QA 1HJDA 2QQAA 1K8AU 1PM3A 2H3EB 3V8KA 5CVIA 1TS9A 1K4US 4C5EA 1VQ8T 3EGUA 3X25B 3CC2Q 2HZYA 3QIIA 1Q95G 2CDTA 2DA9A 1I4K1 4MMLA 2MF2A 1LOJA 3E19A 2DAQA 4M7AB 2AT1B 2EYQA 1SSFA 1BCMA 4B9WA 5C6SA 3H0IA 4C8QB 2LT4A 2MMPA 1M8VA 4XU2A 3RKYA 4ZGJB 2DM1A 2DMOA 1BI0A 1Q82U 2QGFB 4OMQA 3TU4K 3IQLA 4M78C 3AHUA 3ASKA 4ATOA 1B07A 3DB3A 1BK2A 3DLLA 5KYUA 1C6VX 2EYWA 2DLPA 1GCPA 1BI2A 5GAN7 4FU6A 1SPKA 1AZEA 1VQNQ 1E6HA 1WI7A 5GAN5 1PC0A 3UF4A 1LCKA 2QA4T 2A36A 2IG0A 1VQOT 1Y07A 2OTLA 3CCJA 4KUIA 4JS4A 5M9OA 1ZA1B 1VQ4A 4M75B 3META 3QZ5B 4XTYA 1WHMA 2EJFA 2EQKA 2HD0A 3RBBB 4ZTJA 1X2QA 2A37A 2ZPIB 1VIEA 4ZN3A 5FRNA 2OTJQ 2OX7A 2QQRA 5IHNA 3VS0A 3OYHA 3V8LA 2VVKA 2E6ZA 2HBWA 3FB9A 2A08A 2KRSA 4F7UB 4OGEA 3H6ZA 2LDMA 4PFZA 4QVCA 3J80E 1WHJA 4JDSA 2LT1A 1OV3A 3QUIA 3PTAA 3UDCA 1M2VA 2HEQA 1N5ZA 4XTZA 1HXDA 1YI2T 2LQNA 2ED0A 4IKFA 4M77E 1QQJA 1K9AA 3QKJA 1O75A 4DBHA 2DL3A 2A28A 2K9GA 2KK4A 2Y90A 2QAZA 3VUBA 1WIEA 4X1VA 2DTIA 2XICA 4M78G 3NFCA 4MDXA 3MEVA 2MI6A 1FMKA 2DXTA 2DIQA 4LD6A 2LTOA 1G3SA 3A5ZB 3RIRA 5KYWB 2P0PA 1G3YA 1I5LA 4YTLA 1K0XA 1WPYA 1YJWT 4KGVB 3JV3A 4ELYC 1Y96A 4IUUA 1Q81U 2L3SA 2DILA 3LLRA 5J26A 2QASA 3CMEQ 3A98A 2RQWA 4PLIA 3OS0A 2YLBA 2V8IA 3M9QA 1QWEA 1HSQA 2W0ZA 2MIOA 1Q7YR 5IHKA 4RKUE 2G3RA 4A4EA 2QA4A 5EC7A 1UGRB 4OGCA 4J9FA 4LNPA 1S72Q 2GQVA 1GFCA 1NLPC 2K6DA 1VYUA 3BW1A 1IZ6A 4M7AF 3OYAA 2D6FA 3GOXA 1H641 5FW9A 2EQJA 3G71T 2VGNA 2RF0A 4C8QF 4PFPA 1AWOA 1QKWA 3SWNA 4C0FA 1KD1U 4LDXA 5DY9A 3SDZA 2IVWA 3L2QA 3HPWA 3TSWA 2DO3A 2ZGWA 1YJNQ 2JT4A 2ENMA 2CP6A 3G4SQ 4BDZA 3P8DA 1RLQC 3REAB 5IXBA 2AKLA 1BI1A 2P84A 1YHQA 1PKTA 2DD4A 1ZHIA 1D3BB 4OMFB 1NM7A 4R55A 2JS2A 1PRLC 4HT8A 2K7AA 2EYZA 4PJOG 1WQWA 4M75F 2RD1A 3OSVA 1U5SA 1WQ7A 2RJDA 2L3RA 1QCNA 5D6XA 2YLCA 1Z9QA 2JXBA 3EFOB 1UE9A 1GBQA 1VQ7A 1YIJT 4M77C 2VC8A 4F7UF 3V7RA 3MKDA 3EG2A 3TVTA 1B34B 2KRMA 4EMHA 1JEGA 3JB9G 2COWA 3QSUA 3CD6A 1XTDA 3I9QA 3GNGA 2KSSA 4B9XA 2KDSA 4D8DA 1AHJB 4QT7A 3H8ZA 2L0AA 1QVFS 1PSEA 4HKEA 1UHCA 2D8HA 1U06A 2M16A 5I2SA 4A63B 4J83A 3CC7A 1SRMA 2EKOA 3RMSA 4XAXB 2DL7A 3QDRB 2YRCA 4J5YA 2DFUA 3TQ7P 3MJXA 3ER0A 1PD1A 4LUEA 3GBQA 4N0AC 3C4SA 1IRXA 4C5HA 3EH2A 4AFSC 2LMJA 3P8BB 1RAGB 2K3YA 3CCLA 2RMOA 4M4ZA 4CI0C 2DIGA 3RMQA 2PVOB 3JCMX 5I22A 3EHRA 1QP2A 2DYIA 1ARKA 4MDWA 1KSWA 1WX6A 1I5OB 1IO6A 3OW2P 1YBYA 4ELZC 2FG0A 2XI9A 2RJEA 3UATA 1RAIB 2R5AA 1NEGA 4RCCA 1SHFA 1U1TA 2HAXA 1BI3A 4M77G 1W2BP 2MOXA 3PMTA 1BIAA 2QQBA 4AFZC 1IHWA 4RG8A 1GL5A 3JCMd 1MV0B 1RUWA 3OS2A 2CKKA 1VQKA 3CPFA 1W70A 1IXDA 2CH4A 2F5KA 4PFOA 1YITQ 3CCRT 3MHXA 3ZFJA 5IXFA 3CMAT 2KI7A 2I2LA 4QQDA 1JXOA 4LD9K 3L2RA 2CS7A 3MP1A 1AOJA 4M7DB 1A0NB 1N9RA 2C0OA 1RLPC 1M1GA 3VS2A 4RCBA 5LJ5d 3PVLA 4F17A 2MWOA 2E5QA 1VQ8Q 3I55T 2X9HA 2GTOA 2DEQA 2HNIA 1KC8R 5FLXE 4Y91A 1BYMA 1VUBA 1X6GA 2YXYA 3HL8A 3A8GB 3OBYA 1VQMT 1D1CA 3C95A 1RAAB 4OP0A 5DLOA 3A8MB 2RM4A 3JCMP 1I81A 4OMPA 3TEEA 1G5VA 4PJOA 2F2VA 4E7KA 1WXTA 3ULRB 1E7OA 1TTHB 1OX9A 2LC4A 4BY6C 2YUNA 3I56A 2D9TA 1ABQA 2NUZA 2K4YA 4QVDA 1Q86R 4ORZA 3VS6A 2YUOA 5ECAA 4PLLA 1PWTA 4KULA 3CCVT 4EMGA 4PNOA 5C0MA 1KFZA 3F70A 3S6WA 2LCCA 2JW4A 2QA4Q 2CGHA 5GMKl 1TSFA 3I35A 3G6EA 2V8JA 4RTYA 3EG9B 1RAHB 5LJ3d 4XU3A 1VQOQ 5GAOn 3HSBA 4ME7A 1JJ2A 2QG9B 3OBWA 1TH7A 1YJ9A 1ZBJA 5I11A 5GMKj 1LJOA 4C0DC 1PCXA 4A54A 5GMKm 2BZXA 4LDWA 3EG0A 4GBQA 4DOVA 3R6OA 4NOYA 2LX9A 1SSHA 2RHXA 4RTTA 4CC3A 2X35A 4JZ4A 5GAOl 2NUTB 2M51A 5CQYA 3CCRA 4FT2A 4IUQA 1NJIR 1NYFA 3WXMB 1PSFA 4JLIA 4ANJA 2CUDA 5EG2A 1N9SA 4OMOA 4Z8AA 2FO0A 4ESRA 1YI2Q 6AT1B 2MYSA 2VASA 2BE7D 5GAOm 2ROLA 1MNEA 3CBMA 2RK1A 4FYXB 2KY9A 3X26B 1QW1A 1R0CB 3SWNC 3HKSA 3Q1JA 1UHFA 2L3PA 3C0CA 3HRUA 2B8AA 3OW2A 1T3SA 1WXBA 4PJJA 2CZ6B 1GRIA 1UECA 1VOMA 2J7IA 2OI3A 3A8OB 3CPWA 2D8JA 3E2UA 3M5AA 4M77A 1PKSA 2FYKA 2EKHA 5GANg 1VQPA 2JMCA 1YJWQ 3CCMA 3X20B 1EIFA 1W2BA 5CQXA 2GGRA 4M7DF 5AYFA 1M9SA 1K9MR 2KEAA 2RQUA 5IAYA 3OYMA 1TOVA 4II1A 3M57A 2BIVA 4F14A 1GFDA 2C0IA 2OTLT 3CCJT 1KC8C 1G3WA 1OEBA 1VQ4T 1D1BA 1M90U 1H3HA 1M1KU 4KGZB 1YP5A 2O4XA 1ZX6A 1I0CA 1VQ6A 4PL6A 3G71Q 1LVKA 1ZA2B 2RHZA 1H8KA 2K5FA 3NTKA 3OYEA 3CCEA 2WSFE 5CIUA 1G2BA 1OQKA 3BDLA 2DD5A 1F1BB 1Q86C 2EPDA 1EFNA 3A8LB 2B86A 3VJPA 2LVMA 2EQMA 2Z0WA 4PJOE 2HKQB 3QJ6A 3FEOA 1UDLA 1RABB 3LWIA 4AMCA 2DJQA 1LPLA 5D7UA
chains in the Genus database with same CATH topology
2V8IA 3PT9A 3M9QA 3OS5A 1X01A 3JCMV 1OYXA 3CC4A 3GPLA 5CKEA 1N8RC 5HK3A 2YRVA 4RKUE 5GAOq 4M78F 2G3RA 4A4EA 2QA4A 4J8OA 1NE8A 5I2MA 5GANf 1WGSA 4M7AD 1UGRB 4OGCA 4M78A 1QVGA 3VUZA 3OYIA 4DA4A 4ZTFA 4C8QD 2WSEE 3QYHB 2GQVA 2EQUA 2GF7A 2RHIA 3L2UA 3BW1A 1IZ6A 4M7AF 3OYAA 1Q7YC 3OQ5A 2D6FA 3GOXA 1H641 3X28B 2RHUA 2EQJA 1K9MU 2VXFA 4IUVA 1LNXA 2VGNA 3MEWA 1BIBA 3G71T 5GANj 4C8QF 3CMEA 5DM7R 3L42A 3JB9I 3CXCA 3JCMh 3SWNA 4JRIA 5FROA 4C0FA 5GANe 2HBPA 1NJIC 1KD1U 4LDXA 2CZ0B 5DY9A 2FVUA 3OSSC 2ZCFB 3SDZA 1KQSS 4ZGDB 1KQ2A 4M7AC 1KG1A 4M75G 3DKMA 2XHCA 3OS1A 2E70A 3CC4T 2IVWA 3L2QA 2EFIA 5CKHA 4C8QC 3V7SA 3HPWA 5GAMh 2DO3A 1G3TA 1WJQA 4E7JA 4LDUA 2ZGWA 3JCMb 3OYGA 4ZN1A 4HCCA 4BDZA 2DTHA 3FRNA 3P8DA 3GIBA 2K5LA 2E65A 3DB4A 1M5Q1 3MP8A 2X4WA 5GAN3 5D6YA 4EMKA 1KQ1A 1BI1A 2JUFA 1Y7XA 4F7UG 1YIJA 1Q81C 1W4SA 2XIDA 1ZBXA 4M77B 1YHQA 5A0GA 3GF5A 2DD4A 2EAYA 1GXIE 2LNVA 3CEYA 5LJ5h 3CMET 4X9CA 2E41A 4M75D 4OB1B 1ZHIA 1WNLA 2K5IA 1D3BB 3J81E 4L59A 4N4GA 4OMFB 4R55A 3S3OA 3EFSA 3ME9A 4MZTA 5CKDA 4BB7A 2DK3A 3FJPA 1N6AA 4HT8A 4XTWA 2JVVA 1U1SA 4PJOG 1WQWA 4M75F 2DPPB 4M7DA 1JBMA 4QVZA 3OW2S 2RD1A 2RK2A 3OSVA 2PUOB 4HT9A 1WQ7A 2RJDA 2L3RA 3G4SA 3M4YA 5GAN8 1S72T 1N8RU 5D6XA 2YLCA 3PNWC 3RKXA 5GMKi 2QEXA 4JRKA 4N4IA 3MCAB 4C92E 3KXTA 1UB4A 2AHJB 2DKGA 2PVDB 4M75C 1VQ7A 1VQLT 1K9MC 1YIJT 4BY6B 1NPPA 2XG8D 3LGFA 4M77C 4XQ3A 3T9NA 2VC8A 3VYGA 4EDUA 3OY9A 5J3BA 3UPUA 1MGQA 4F7UF 2WACA 1YHQT 5FRMA 5CO7A 3V7RA 1KD1C 1M1FA 5GMKh 4PJOD 1Q7YU 2O4XB 4OB0B 4QW2A 1B34B 1WJSA 4J7IA 5CCAA 4EMHA 4HCBA 2OTJA 3JB9G 3QSUA 5GAN4 4OVAA 5KE3A 2L5QA 3M59A 3CD6A 1XTDA 3URGA 4BE2A 4XTUA 3GNGA 3JB9J 1NJIU 2KSSA 4PJOF 1RL2A 4B9XA 2DXCA 2RI2A 3WVDB 2KDSA 3VKIA 2CZ1B 1AHJB 3LYIA 1YJNT 3H8ZA 1QVFS 5FU6C 1KHIA 3G4ST 4M7DE 4RG2A 2HQXA 2XK0A 1PSEA 2QEXT 4HKEA 2VV5A 2RO0A 2EJ9A 3LX7A 4BI4A 2L8DA 3FLGA 1ZQ1A 2O01E 1VQ7T 1I8FA 1M4ZA 1OZ2A 2D0QB 2KAFA 2M16A 5I2SA 4PJOC 4J83A 4X9DA 3CC7A 3OYCA 5CKBA 2EKOA 5LJ3h 3JB9D 3RMSA 4Z02A 3RERA 4C0DB 2K3XA 4XAXB 2DZCA 3L2ZA 1Y96B 2E12A 3WVEB 3QDRB 4VUBA 3QHSA 4J5YA 5DLQE 2XU8A 3BDUA 3ER0A 3CD6T 2F5TX 3HRSA 5GAN6 5GAN2 3JB9F 4BACA 4N0AC 3P8HA 2JOYA 3C4SA 2M0OA 2K2VA 3MP6A 5CKFA 1JB0E 4FIBA 4C5HA 2RB6A 4JRPA 2L89A 4P5NA 1X75C 2MWPA 2BKDN 4A4FA 1K73U 4Y28E 3P8BB 3OS0A 2K3YA 3CCLA 4BE0A 4BDYA 4XTXA 4CI0C 1QP3A 2BUDA 4DOWA 2F69A 5CAIA 4XTVA 5KCOA 2DIGA 3RMQA 2QDYB 2GFUA 2PVOB 3JCMX 2JNGA 4JS5A 1JJ2S 1QP2A 2RH2A 5FU7C 5J39A 3M53A 5LJ5g 3CC7T 3LH0A 4MDWA 1UGPB 4J6WA 5KCHA 3CBPA 1YBYA 4JLGA 3OYLA 1VQ9T 4M7AA 2M1HA 4KBMB 4ELZC 3QZ9B 4C92G 2XI9A 4UC4A 2ZPEB 4QQGA 2RJEA 4A4GA 4C8QA 3M4GA 2R5AA 3SWNB 3VYHB 4RCCA 5GMKe 1U1TA 3MEUA 4IUPA 2HAXA 1UGQB 4C0GA 3OYFA 1WJRA 3CMAA 1BI3A 4M77G 3NTIA 4LDYA 3PMTA 2E6NA 2KMTA 2E10A 1RI0A 1BIAA 3CCLT 2QQBA 1KHCA 3CBOA 1VQMA 4C92B 4RG8A 4XK8E 3RUXA 3RKWA 2GFAA 1S72A 4E7HA 4C0ZA 2HQEA 3JCMd 2EIFA 4M78E 3ZEHA 3J7AF 1BKBA 1MHNA 2DJZA 3SB2A 2FHDA 3QPHA 1VQLA 3OS2A 3I55A 2CKKA 3E1SA 3CXCS 3PIOA 1NPRA 4EMKB 1U8RA 3DLMA 3HFOA 1VQKA 3CPFA 3PGGA 4BD3A 2DZ9A 3KBGA 3QBYA 4M77D 3ZBDA 5GAMd 5KH6A 2F5KA 4M7AE 3SD4A 1FXXA 3CCRT 3MHXA 2LRQA 3TREA 3ZFJA 2GCXA 2PU9B 4GLKA 4IUTA 4C8QE 3QYGB 2I2LA 4MMKA 4QQDA 5D6WA 3CMAT 4LD9K 1K73C 3L2RA 2CS7A 3JCMf 4J6XA 3MP1A 4M77F 4FT4A 4M7DB 4LDVA 1N9RA 2E64A 4FM4B 4L6V5 4M75A 4C92C 3CPWS 2V8KA 1YJNA 2DVEA 1M1GA 4RCBA 1R8OB 5LJ5d 2LQ8A 4WF2A 2WSCE 5LJ3g 2MWOA 4X34A 3OYDA 3FC3A 2XKOC 1NZ9A 2E5QA 3FIFA 1UGSB 3V7CA 5GAMf 3I55T 4JJNK 3OYJA 2DEQA 2RI5A 3A8HB 3HRTA 2HNIA 1W2BS 3M55A 3CCET 2KVQG 1VQKT 2QI2A 2E1HA 3OYYA 5FLXE 4QQ6A 4Y91A 3UWNA 4F7UA 2RA2A 4FSXA 1YITA 3CCVA 1BYMA 2ZPHB 2XD0A 2EWNA 3LWHA 1VUBA 3HL8A 2P0QA 3A8GB 1V29B 3OBYA 1VQMT 3C95A 3JCMW 4OP0A 5LJ5f 2FL7A 4N4HA 4M7DC 1HK9A 1O9SA 4XU1A 3A8MB 5DLOA 5CR2A 2RM4A 3JCMP 2KQWA 4L5GA 1I81A 3HFNA 1QVFA 3EAEA 3TEEA 1G5VA 3QJYA 1N27A 3E9FA 4PJOA 2XDDA 5HK0A 2JTFA 1XQHA 4C5IA 4E7KA 2JZ2A 4M75E 3MO8A 2RHYA 2XDBA 2R58A 3QO3A 1VQ8A 2LC4A 1YCYA 3EFRA 4BY6C 3OMGA 3JCMJ 5LJ5j 3I56A 2D9TA 2X4YA 5IT9E 1IREB 5GAOr 2K4YA 4QVDA 3JCMQ 4A4KA 2R57A 3JCMg 4E7IA 1VIFA 5LJ5e 4KT0E 5GANh 4PLLA 4A4HA 4V2SA 2RJFA 4N0AA 3OA6A 1P92A 1YITT 4KULA 1VQ9A 3CCVT 2C06A 4EMGA 3UT1A 5HKCA 3JB9H 4PNOA 2QQ9A 4F7UE 5C0MA 2M9UA 3F70A 3INZA 4J7FA 4O5VA 3S6WA 3S3NA 2OAUA 5GAMg 3CCUT 2JTMA 2LCCA 2CGHA 4MZMA 4A53A 4HA8A 3C94A 5GMKl 3CCQA 2QQAA 3G6EA 2DTOA 2V8JA 3OYBA 1OZ3A 1K8AU 2A3LA 3V8KA 5LJ3d 4XU3A 5GAOn 3HSBA 5CVIA 5GANd 3OB9A 3BY7A 4ME7A 2LQKA 4NL2A 4ZGEB 5A2QE 4C5EA 3E9GA 1JJ2A 1VQ8T 3HP9A 4M78B 2K57A 3M56A 2Y4XA 3OBWA 5HY6A 1TH7A 3I56T 4O6JA 1YJ9A 3X25B 3PIPA 2ZZDA 2CZ7B 5GMKj 3L2WA 1LJOA 3CCST 3QIIA 4C0DC 5CK9A 3X24B 4A54A 2CYZB 5GMKm 1FX7A 1I4K1 4MMLA 5I21A 4LDWA 5GAOp 2MF2A 1LOJA 3M58A 3E19A 2DAQA 4M7AB 3R6OA 3TCJA 4DOVA 2R5MA 4NOYA 4C5GA 2EYQA 3V8JA 2LX9A 2VUBA 1SSFA 3JAME 2RHXA 4B9WA 2ZPGB 3QXEB 5LJ3f 2X35A 4C8QB 5C6SA 4BUGA 5GAOl 1KQSA 2LT4A 2MMPA 1M8VA 3JSCA 2FB7A 4XU2A 5CQYA 5A0DA 3CCQT 3CCRA 4FT2A 3RKYA 4ZGJB 3G6ET 1M90C 1VQOA 4IUQA 4BI3A 1QVGS 2VYTA 4RMOA 3WXMB 1BI0A 1Q82U 4E47A 3TU4K 3GNFB 1PSFA 1M1KC 4JLIA 2A7YA 4M78C 3AHUA 3ASKA 1N9SA 5EG2A 1KC8U 4ATOA 3DB3A 3M54A 2X4JA 5LJ3j 3DLLA 3CC2A 1YJ9T 1DJ7B 1XNIA 4BI8B 1BI2A 4C92D 5LJ3e 5GAOm 3S3MA 5GAN7 3CBMA 4M7DG 2RK1A 4FU6A 4TVRA 3OYKA 3N5BB 3O8VA 2KY9A 3X26B 1VQ5A 4JUVA 1QW1A 2NLUA 5GAN5 3SWNC 3HKSA 3Q1JA 4C92F 3PMIA 4OB2B 2QA4T 1JRIA 4C92A 1K8AC 5LL6S 2H3JA 2IG0A 3HRUA 3LGLA 2B8AA 3OW2A 1VQOT 1Y07A 4BE1A 2OTLA 2CZ6B 2RI3A 3A8OB 4KUIA 3CCJA 2QTXA 3CPWA 4JS4A 5M9OA 1Q86U 1VQ4A 3L2VA 4GY5A 3M5AA 4M75B 3JRZA 3META 4M77A 5IN1A 2LCLA 1Y71A 3QZ5B 4XTYA 4M7DD 3HHTB 4R56A 3CC2T 2EJFA 2EQKA 2FYKA 2HD0A 2ZPFB 1YI2A 4ZTJA 5GANg 1D3BA 1VQPA 1OI1A 3CCMA 3X20B 1EIFA 2ZPIB 2DXBA 5CQXA 4EMKC 3PFSA 1VIEA 1W2BA 4PKCC 4ZN3A 1VQNA 5L8RE 4JRQA 5FRNA 3BFMA 2QQRA 3MEAA 4Q5WA 5AYFA 3VU3C 4M7DF 1H3ZA 3OYHA 1M9SA 1VQ5T 3V8LA 3JCMe 2E6ZA 3FB9A 4NS5A 4F7UB 5IAYA 4OGEA 3H6ZA 2LDMA 3OYMA 4QVCA 2PVGB 4MZPA 3J80E 4NL3A 5GAMj 2Y4YA 4II1A 3OMCA 3M57A 2BIVA 4JDSA 4OF1A 5FU6B 2LT1A 3CCUA 1Q82C 2OTLT 3CCJT 5GAMe 3VV0A 4J6YA 1KC8C 1G3WA 3KUFA 3QUIA 3UDCA 3PTAA 2EJGA 3JCMc 1VQ4T 1M90U 4XTZA 4PJOB 1HXDA 5KE2A 1YJWA 1YI2T 1M1KU 4IKFA 4D6WA 4M77E 1VQPT 2O4XA 4FL6A 1B34A 4PL6A 3QKJA 1O75A 2RJCA 3L1AA 2VXEA 3CCMT 1VQ6A 2ZPBB 2RHZA 1VQNT 2PQWA 2KK4A 3C12A 3CCSA 2K5FA 1XOVA 3NTKA 2Y90A 3OYEA 4EPCA 3FDRA 3QG1A 3CCEA 3VUBA 4OB3B 2WSFE 2YHTA 2XDPA 5CIUA 2P0KA 2DTIA 2XICA 4M78G 4CRIA 3OYNA 3NFCA 4MDXA 2DXUA 3MEVA 2MI6A 3BDLA 2P4TA 2DXTA 4HCZA 2DD5A 2DIQA 2QQSA 4LD6A 2QXFA 1Q86C 1UEBA 1QVPA 2LTOA 2JN0A 1G3SA 4DQ2A 5A0LA 3GP8A 4XU0A 3A5ZB 3A8LB 3SFMA 3RIRA 2X4XA 3VJPA 3NTHA 2LVMA 2EQMA 1G3YA 2P0PA 1I5LA 4M7AG 4YTLA 5FU7B 1WPYA 1YJWT 3RESA 4ELYC 4PJOE 1Y96A 4C8QG 1X6OA 3LW5E 3QJ6A 4IUUA 1VQ6T 1Q81U 3G71A 3FEOA 3G7ZA 2MAMA 2PUKB 2OTJT 1FWZA 3LLRA 5J26A 3LWIA 4M78D 2VGMA 3GLXA 4IURA 4E7LA 4PLIA 2YLBA 4KUDK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJ3 g;  4M7D E;  1X01 A;  3JCM V;  5GAN 7;  4M7D G;  3FIF A;  3V7C A;  5GAM f;  5GAO q;  4M78 F;  2EJ9 A;  2DEQ A;  4JUV A;  5GAN f;  2HNI A;  5GAN 5;  3SWN C;  4M7A D;  1I8F A;  4M78 A;  4C92 F;  4PJO C;  2E1H A;  4X9D A;  1JRI A;  4Y91 A;  4C8Q D;  4F7U A;  5LJ3 h;  2RA2 A;  3JB9 D;  4C92 A;  3RER A;  2EWN A;  2DZC A;  3L2Z A;  1Y96 B;  3BW1 A;  4M7A F;  3JCM W;  3QHS A;  1H64 1;  2QTX A;  4J5Y A;  4OP0 A;  5LJ5 f;  2VXF A;  1LNX A;  3BDU A;  1BIB A;  1HK9 A;  5GAN j;  4C8Q F;  4M7D C;  5GAN 6;  4M75 B;  4M77 A;  4XU1 A;  5GAN 2;  2RM4 A;  3JCM P;  3JB9 F;  4XTY A;  1I81 A;  3HFN A;  3JCM h;  4N0A C;  3JB9 I;  3SWN A;  4JRI A;  4M7D D;  2EJF A;  2FYK A;  5GAN e;  4PJO A;  5GAN g;  1D3B A;  5DY9 A;  2RB6 A;  4M75 E;  1KQ2 A;  4EMK C;  4M7A C;  4M75 G;  3QO3 A;  3EFR A;  1YCY A;  3JCM J;  3BFM A;  3VU3 C;  4C8Q C;  5LJ5 j;  3V7S A;  4M7D F;  4XTX A;  5GAM h;  5CAI A;  3V8L A;  4QVD A;  3JCM e;  4XTV A;  5GAO r;  3JCM Q;  3FB9 A;  4V2S A;  3JCM g;  5LJ5 e;  4F7U B;  3JCM X;  5GAN h;  2ZGW A;  5LJ5 g;  3JCM b;  4N0A A;  4QVC A;  2DTH A;  3GIB A;  4J6W A;  5GAM j;  4NL3 A;  2E65 A;  4EMG A;  3JB9 H;  1M5Q 1;  4PNO A;  4F7U E;  4M7A A;  3INZ A;  4EMK A;  4F7U G;  1KQ1 A;  5GAN 3;  4C92 G;  5GAM e;  4J6Y A;  4M77 B;  3QUI A;  5GAM g;  2EJG A;  3JCM c;  2CGH A;  2EAY A;  4A53 A;  3M4G A;  4HA8 A;  3SWN B;  4C8Q A;  5GMK l;  4RCC A;  4X9C A;  2E41 A;  4M75 D;  2DTO A;  4XTZ A;  4PJO B;  1HXD A;  1WNL A;  1D3B B;  1U1T A;  3V8K A;  5LJ3 d;  3EFS A;  4XU3 A;  5GAO n;  4M77 E;  3HSB A;  5GAN d;  4M77 G;  3BY7 A;  3FJP A;  1B34 A;  4NL2 A;  3L1A A;  4XTW A;  2VXE A;  4HT8 A;  2E10 A;  1U1S A;  4M78 B;  2K57 A;  4PJO G;  1BIA A;  1WQW A;  4M75 F;  1TH7 A;  4M7D A;  1JBM A;  2Y90 A;  2RD1 A;  4C92 B;  5GMK j;  3RUX A;  3RKW A;  1LJO A;  4HT9 A;  1WQ7 A;  4A54 A;  3JCM d;  2YHT A;  4M78 E;  2DTI A;  4M78 G;  5GMK m;  5GAN 8;  1I4K 1;  4MML A;  2DJZ A;  3SB2 A;  2YLC A;  3RKX A;  5I21 A;  2DXU A;  5GMK i;  4JRK A;  5GAO p;  4C92 E;  1LOJ A;  2DKG A;  4M7A B;  4EMK B;  2DXT A;  4NOY A;  3HFO A;  4M75 C;  3V8J A;  4M77 C;  5LJ5 h;  4XQ3 A;  5LJ3 f;  3PGG A;  2JN0 A;  2VC8 A;  4C8Q B;  4DQ2 A;  5GAO l;  2DZ9 A;  4XU0 A;  1MGQ A;  4F7U F;  4M77 D;  5GAM d;  3RIR A;  1M8V A;  2FB7 A;  4XU2 A;  3V7R A;  3RKY A;  4M7A E;  1I5L A;  4M7A G;  5GMK h;  4PJO D;  1WPY A;  1B34 B;  3RES A;  4C8Q E;  4EMH A;  4PJO E;  1Y96 A;  2I2L A;  4MMK A;  4C8Q G;  3JB9 G;  3QSU A;  4JLI A;  5GAN 4;  4M78 C;  3JCM f;  3AHU A;  1N9S A;  4J6X A;  4M77 F;  4M7D B;  4XTU A;  5LJ3 j;  3JB9 J;  4M78 D;  1N9R A;  2E64 A;  4M75 A;  4C92 C;  5GAO m;  4PJO F;  2DVE A;  4RCB A;  5LJ5 d;  4C92 D;  5GMK e;  5LJ3 e;  4WF2 A;  2YLB A; 
#chains in the Genus database with same CATH topology
 3OS5 A;  8ATC B;  1OYX A;  3CC4 A;  5GAO q;  1S1N A;  1UGV A;  1NE8 A;  4M7A D;  4FW2 A;  1WHL A;  2DL8 A;  2PZ1 A;  1QVG A;  3VUZ A;  3OYI A;  4DA4 A;  4ZTF A;  4C8Q D;  1MMN A;  3RNJ A;  2VB6 A;  2GF7 A;  3OQ5 A;  3X28 B;  2RHU A;  1YIJ Q;  3MEW A;  1K76 A;  5GAN j;  4RUG A;  4JRI A;  4J9D A;  5GAN e;  1NJI C;  2ZCF B;  2YUQ A;  1KQ2 A;  2EFI A;  5CKH A;  5GAM h;  1WJQ A;  4E7J A;  2VWF A;  2AK5 A;  2LJ3 A;  3JCM b;  4HCC A;  1G8X A;  2LQW A;  3FRN A;  2E65 A;  3QWY A;  3DB4 A;  1M5Q 1;  2X4W A;  3D7S B;  5D6Y A;  1KQ1 A;  4EMK A;  1K73 R;  1W4S A;  4KGX B;  2CSQ A;  5A0G A;  3GF5 A;  1GXI E;  2LNV A;  4X9C A;  2E41 A;  4M75 D;  2KRO A;  2K5I A;  3BE3 A;  3ME9 A;  4BB7 A;  4AFQ C;  2P4R A;  2SEM A;  2KGT A;  2DPP B;  3SHW A;  3OW2 S;  3THK A;  4J9E A;  4CC2 A;  1OOT A;  1N8R U;  1M3B A;  5GMK i;  2QEX A;  4JRK A;  4N4I A;  3MCA B;  3KXT A;  2AHJ B;  2PVD B;  3KFV A;  1K9M C;  4BY6 B;  1M2V B;  1NPP A;  2XG8 D;  4XQ3 A;  4E7L A;  1IGQ A;  1MMD A;  2HSP A;  5J3B A;  1YHQ T;  1MGQ A;  4KH1 B;  1IGU A;  5GMK h;  1Q7Y U;  1WJS A;  3RDV A;  5KE3 A;  1OPL A;  1W1F A;  3JB9 J;  1RL2 A;  3LYI A;  2FZG B;  2HQX A;  2XK0 A;  3M0Q A;  1EZZ B;  2ABL A;  2RO0 A;  3LX7 A;  2L8D A;  1ZQ1 A;  2NWM A;  2O01 E;  1VQ7 T;  1I8F A;  1M4Z A;  4JJD A;  4HCK A;  4OMN A;  1KQS P;  2KNB B;  4PJO C;  2CT3 A;  1YWO A;  4Z02 A;  4C0D B;  2K3X A;  1Y96 B;  3WVE B;  4VUB A;  1VA7 A;  1B7T A;  5DLQ E;  2A0F B;  1PRM C;  3CD6 T;  5GAN 6;  4BAC A;  3P8H A;  5CKF A;  3CCR Q;  1X27 A;  2EGA A;  4JRP A;  2L89 A;  3CMA Q;  2DER A;  3UA6 A;  1X75 C;  2MWP A;  4K11 A;  4A4F A;  1PD0 A;  2PNI A;  4BDY A;  1QP3 A;  2BUD A;  2EBP A;  4DOW A;  4FYV B;  2O9S A;  2QDY B;  4JS5 A;  2E3H A;  5LJ5 g;  3CC7 T;  3M53 A;  3I55 Q;  2LCS A;  3OYL A;  1NBE B;  3QZ9 B;  2ESW A;  4A4G A;  3SWN B;  3VYH B;  4AG1 C;  3EGD A;  3MEU A;  4HVV A;  1UGQ B;  1VQM Q;  3SEM A;  4LDY A;  2DF6 A;  2KMT A;  1PNJ A;  1RI0 A;  3CCL T;  4C92 B;  3ZEH A;  2F1L A;  2DJZ A;  2RNA A;  3SB2 A;  2DET A;  3E1S A;  3PIO A;  3DLM A;  3NGP A;  3QDF A;  3KBG A;  5KH6 A;  4M7A E;  3SD4 A;  3CCV Q;  1RAD B;  1FXX A;  2LRQ A;  4IUT A;  4C8Q E;  4WTO B;  4MMK A;  1K73 C;  2D0N A;  1OPK A;  5FWC A;  2RQR A;  4FT4 A;  2LJ0 A;  4LDV A;  4DEY A;  2V8K A;  2DVE A;  1X2K A;  5LJ3 g;  2YSQ A;  4J9C A;  4X34 A;  3FC3 A;  2O88 A;  2J06 A;  3FIF A;  1UGS B;  5GAM f;  1V76 A;  4JJN K;  1SRL A;  2MCN A;  2RI5 A;  1AT1 B;  3HRT A;  2KVQ G;  1VQK T;  1KIK A;  2V1Q A;  1M2O A;  2XD0 A;  2P0Q A;  4E7Z A;  1V29 B;  1JJ2 P;  3EGX A;  2EVR A;  1HK9 A;  2OJ2 A;  4J9I A;  4XU1 A;  5CR2 A;  2MPX C;  3HFN A;  1N27 A;  4RTX A;  1ABO A;  2HSE B;  2RQT A;  4KH0 B;  4JPB W;  5KYN A;  2JZ2 A;  4M75 E;  3MO8 A;  2RHY A;  2XDB A;  2YDL A;  1ACM B;  3JCM J;  5LJ5 j;  2X4Y A;  3JCM Q;  2R57 A;  1K1Z A;  5LJ5 e;  5GAN h;  4A4H A;  1ZSG A;  2GTJ A;  1P92 A;  5HKC A;  4F7U E;  2M9U A;  3S3N A;  5GAM g;  2CT4 A;  2FZC B;  3C94 A;  3CCQ A;  2DTO A;  3OYB A;  1OZ3 A;  3I5R A;  2A3L A;  2CUB A;  4NL2 A;  2LQK A;  2C0T A;  2CSI A;  5A2Q E;  3VS5 A;  2DL5 A;  4M78 B;  2K57 A;  5HY6 A;  3I56 T;  3PIP A;  2ZZD A;  3L2W A;  3R6N A;  3X24 B;  1FX7 A;  3M58 A;  3TCJ A;  3CPW P;  2R5M A;  4C5G A;  3V8J A;  2VUB A;  1KQS A;  4BUG A;  1M30 A;  5A0D A;  3G6E T;  1ZUK A;  4J9G A;  2VYT A;  4BI3 A;  1V1C A;  2OTL Q;  3CCJ Q;  3GNF B;  4QKU A;  1WDX A;  2A7Y A;  1WZO A;  1KC8 U;  1VQ4 Q;  4PK4 A;  2X4J A;  5LJ3 j;  3CC2 A;  1YJ9 T;  1DJ7 B;  1XNI A;  4BI8 B;  5LJ3 e;  2CP0 A;  2M02 A;  3OYK A;  1VQ5 A;  2NLU A;  1ZUY A;  5L23 A;  3NPF A;  5FWB A;  3PMI A;  4OB2 B;  4C92 F;  1JRI A;  4AG2 C;  1OUL A;  1UUE A;  2RI3 A;  2QTX A;  1Q86 U;  2RN8 A;  1GBR A;  5IN1 A;  3JRZ A;  2LCL A;  4M7D D;  3HHT B;  4Y92 A;  4R56 A;  3H0F A;  1OI1 A;  9ATC B;  4EMK C;  3PFS A;  4FCY A;  1VQN A;  2ECZ A;  4JRQ A;  1WXU A;  3BFM A;  4Q5W A;  1H3Z A;  1X43 A;  2JS0 A;  2AZS A;  4NL3 A;  5GAM j;  4B6M A;  1E6G A;  2RPN A;  5GAM e;  3KUF A;  3JCM c;  1T0H A;  2NYS A;  4PJO B;  2FPD A;  5KE2 A;  2CP2 A;  2DBM A;  2IPO B;  4D6W A;  1VQP T;  3CCM T;  2RJC A;  2VXE A;  2YT6 A;  2ZPB B;  3C12 A;  1HYO A;  1QVG P;  1D0Y A;  3RR6 A;  3FDR A;  3QG1 A;  4OB3 B;  2O2O A;  2XDP A;  4E6R A;  2FPE A;  1RAE B;  2DXU A;  2BTT A;  4HCZ A;  2QQS A;  2QXF A;  4DQ2 A;  5A0L A;  2LZ6 B;  3VS1 A;  3SFM A;  2FEI A;  3A1P A;  1Y0M A;  4M7A G;  5HCK A;  1TUD A;  4C8Q G;  1X6O A;  1VQ6 T;  2FPF A;  1YFN A;  2PUK B;  1FWZ A;  1ZSZ A;  1G83 A;  3GLX A;  4IUR A;  2KE9 A;  5GMK e;  3CCE T;  3PT9 A;  2NUP A;  1X01 A;  3GPL A;  5CKE A;  2CH4 W;  5HK3 A;  4M78 F;  5I2M A;  5GAN f;  1UJY A;  1WGS A;  2GNC A;  3QYH B;  3LH5 A;  1MV3 A;  3L2U A;  2W10 A;  2HMA A;  1K9M U;  2VXF A;  1BIB A;  1YHQ Q;  4FYY B;  3O5Z A;  3CME A;  1NYG A;  3L42 A;  3JB9 I;  2HDA A;  3JCM h;  2HBP A;  2CZ0 B;  2QTV A;  3OSS C;  1QLY A;  2HQH A;  1KQS S;  4ZGD B;  1KG1 A;  4M75 G;  3DKM A;  2XHC A;  3OS1 A;  3CC4 T;  2SRC A;  3V7S A;  2ZAE A;  3VS7 A;  4ZN1 A;  2DTH A;  4D8K A;  3GIB A;  2YWW A;  2K5L A;  3VRZ A;  5KYY A;  4F7U G;  2JUF A;  1VQ7 Q;  2DE0 X;  4M77 B;  2XID A;  1MUZ A;  2EAY A;  5LJ5 h;  3CEY A;  1WNL A;  4L59 A;  4N4G A;  4JZ3 A;  3EFS A;  4MZT A;  2EGC A;  5CKD A;  1KJW A;  2DK3 A;  4AT1 B;  1D0X A;  2DVJ A;  2JVV A;  5AT1 B;  4LXC A;  3CD6 Q;  1JBM A;  4QVZ A;  2RK2 A;  2F2W A;  2PUO B;  2DYB A;  5IHI A;  4RTU A;  3G4S A;  5GAN 8;  4DEX A;  5KYX A;  2KXD A;  1UB4 A;  2DKG A;  1VQL T;  3LGF A;  1CSK A;  3UPU A;  5FRM A;  2DBK A;  2WAC A;  3CC7 Q;  5CO7 A;  1MMA A;  2KRN A;  2O4X B;  4OB0 B;  1AVZ C;  1GCQ C;  4J7I A;  5CCA A;  4HCB A;  1CKA A;  4OVA A;  2EQI A;  4R0K A;  4PJO F;  3I5S A;  2DXC A;  2RI2 A;  3VKI A;  1TU0 B;  5FU6 C;  4M7D E;  1Y57 A;  2QEX T;  2VV5 A;  4PJN A;  3CCL Q;  4X9D A;  4J9H A;  5CKB A;  2HL5 C;  5LJ3 h;  1WA7 A;  1AWW A;  3M0P A;  1ZLM A;  2E12 A;  4FW1 A;  2LX7 A;  3QHS A;  2X51 A;  2KXC A;  2XU8 A;  3BDU A;  2F5T X;  3HRS A;  5GAN 2;  3JB9 F;  2YUP A;  4AFU C;  2ROT A;  3QWX X;  2JOY A;  3MP6 A;  2M0O A;  3MPU B;  3EG3 A;  1WHH A;  2VKN A;  2M0Y A;  3H41 A;  1K73 U;  4Y28 E;  4LN2 A;  4BE0 A;  4XTX A;  5CAI A;  5KCO A;  2F69 A;  2GFU A;  1JJ2 S;  1D09 B;  2RH2 A;  5FU7 C;  5J39 A;  4RTV A;  3LH0 A;  4IIO A;  1M90 R;  2D1X A;  5KCH A;  3CBP A;  1VQ9 T;  2JJ9 A;  2M1H A;  4M7A A;  8AT1 B;  3U23 A;  5KYU B;  1EX4 A;  4C92 G;  1M1K R;  1VQK Q;  1C0M A;  2ZPE B;  4QQG A;  1VQ5 Q;  4C8Q A;  3M4G A;  2K3B A;  1KK7 A;  1FMV A;  4IUP A;  4F04 B;  4PJL A;  3UA7 A;  1Z9Z A;  2G6F X;  3NTI A;  2ATC B;  4HXJ A;  1X69 A;  1WHK A;  4XK8 E;  3RUX A;  3RKW A;  1PHT A;  1X6B A;  2KYB A;  3J7A F;  1BKB A;  1MHN A;  2FHD A;  1K8A R;  1VQL A;  2E3I A;  4EMK B;  3PE0 A;  1YN8 A;  2KYM A;  3HFO A;  7AT1 B;  3PGG A;  2DZ9 A;  4FSS A;  3ZBD A;  4Z88 A;  2I0N A;  2COY A;  2RQV A;  1WHG A;  2PU9 B;  4GLK A;  3QYG B;  5D6W A;  3JCM f;  4J6X A;  4M77 F;  1JXM A;  2E64 A;  4M75 A;  4FM4 B;  3CPW S;  1R8O B;  2LQ8 A;  2WSC E;  1SF9 A;  2BZY A;  2XKO C;  3OYJ A;  1Q82 R;  3I56 Q;  1W2B S;  1W6X A;  2QI2 A;  2QYZ A;  4JJB A;  1RAC B;  4F7U A;  1YIT A;  2DNU A;  2EWN A;  2EYY A;  1R77 A;  1JU5 C;  3JCM W;  5LJ5 f;  2ED1 A;  2K2M A;  4N4H A;  4M7D C;  1O9S A;  2KQW A;  4L5G A;  1QVF A;  1NG2 A;  3EAE A;  3G6E Q;  2DRM A;  3QJY A;  2KT1 A;  3E9F A;  2XDD A;  2JTF A;  1XQH A;  2R58 A;  1AWJ A;  3QO3 A;  1VQ8 A;  3EFR A;  3OMG A;  5IT9 E;  1IRE B;  1YJ9 Q;  2DX1 A;  4A4K A;  4V2S A;  3JCM g;  2RJF A;  5GJW B;  1TWB A;  2KBT A;  5GJV B;  1VQ9 A;  2JTE A;  3UT1 A;  2JMA A;  2QQ9 A;  3INZ A;  2JM8 A;  4O5V A;  2OAU A;  3CCU T;  2JTM A;  2AIR B;  4MZM A;  4HA8 A;  2EW3 A;  2QGG A;  3CXC P;  5KYW A;  3VS4 A;  3VS3 A;  5GAN d;  3OB9 A;  3BY7 A;  1SKU B;  4ZGE B;  2HCK A;  2FZK B;  1UFF A;  3E9G A;  3HP9 A;  3M56 A;  1N8R R;  2Y4X A;  2LJ1 A;  4O6J A;  1M8M A;  2CZ7 B;  3CCS T;  1NLO C;  2CYZ B;  1WLP B;  5I21 A;  4JJC A;  5GAO p;  1ZSZ C;  2O9V A;  3JAM E;  1ZUU A;  2ZPG B;  3QXE B;  1UG1 A;  5LJ3 f;  3JSC A;  2FB7 A;  3EGD B;  3CCQ T;  1M90 C;  1VQO A;  1QVG S;  4RMO A;  1TG0 A;  4E47 A;  1M1K C;  2V1R A;  3M54 A;  1JQQ A;  3H9N A;  1AZG B;  2F2X A;  4C92 D;  4E7S A;  1VQP Q;  3S3M A;  3CCM Q;  3TSZ A;  4M7D G;  4TVR A;  3N5B B;  3O8V A;  3REB B;  1UJ0 A;  4JUV A;  1Q81 R;  4LE9 A;  4C92 A;  1WFW A;  1SG5 A;  5LL6 S;  2H3J A;  1K8A C;  3LGL A;  1AD5 A;  4BE1 A;  1QWF A;  3CQT A;  1QKX A;  4GY5 A;  1M27 C;  3M0T A;  1Y71 A;  3CC2 T;  2ZPF B;  2DL4 A;  2BZ8 A;  3NHN A;  1YI2 A;  1D3B A;  2CRE A;  2DXB A;  1GCQ A;  1VQ6 Q;  4PKC C;  5L8R E;  3VU3 C;  3MEA A;  3M0R A;  4ZNX A;  1VQ5 T;  2FRY A;  1OU8 A;  3JCM e;  1UTI A;  4NS5 A;  3CCE Q;  4CC7 A;  2PVG B;  4MZP A;  1KD1 R;  2BE9 B;  2Y4Y A;  3OMC A;  1U3O A;  4OF1 A;  4RTW A;  5FU6 B;  1Q82 C;  3CCU A;  3EGX B;  3EFO A;  3VV0 A;  4J6Y A;  4DBF A;  2EJG A;  1K0S A;  1D0Z A;  1MMG A;  2GBQ A;  2J6K A;  1YJW A;  4FL6 A;  1B34 A;  1TXQ A;  3L1A A;  4KRT A;  3M0S A;  1VQN T;  2PQW A;  4FYW B;  3CCS A;  1XOV A;  1QCF A;  1T0J A;  2CP7 A;  2YHT A;  2P0K A;  2PTK A;  4CRI A;  3OYN A;  3CC4 Q;  4GLM A;  2P4T A;  1UEB A;  1QVP A;  3GP8 A;  2JN0 A;  4XU0 A;  2X4X A;  3NTH A;  5FU7 B;  3RES A;  4PJM A;  1SHG A;  3LW5 E;  1MND A;  1NEB A;  2EYX A;  3G71 A;  2QDL A;  3G7Z A;  2MAM A;  2OTJ T;  4M78 D;  2YRD A;  3AT1 B;  2VGM A;  1IHV A;  4EPC A;  3L2V A;  4KUD K;  3JCM V;  1N8R C;  2YRV A;  4J8O A;  4M78 A;  4HVU A;  2QK0 A;  2J6O A;  4OML A;  1RI9 A;  2WSE E;  2HKN A;  2EQU A;  2OAW A;  2RHI A;  1Q7Y C;  1VQL Q;  1I07 A;  4IUV A;  1LNX A;  5DM7 R;  2AZV A;  3CXC A;  3VRY A;  5FRO A;  1AEY A;  1PG5 B;  2FVU A;  4M7A C;  1FYN A;  2E70 A;  2AKK A;  4C8Q C;  2H8H A;  3EHQ A;  1G3T A;  1YWP A;  1CKB A;  4LDU A;  3OYG A;  2K79 A;  2QEX Q;  3MP8 A;  1M3C A;  5GAN 3;  1YNZ A;  1YIJ A;  1Q81 C;  1Y7X A;  3H0H A;  1ZBX A;  2EGE A;  2JM9 A;  4Z89 A;  2XMF A;  3CME T;  2L2P A;  4WCI A;  4OB1 B;  3J81 E;  4DBR A;  3S3O A;  2CP3 A;  3FJP A;  1N6A A;  4XTW A;  1QMC A;  1U1S A;  1TUG B;  4M7D A;  2V26 A;  4HT9 A;  1SEM A;  3M4Y A;  1S72 T;  2DEU A;  3RKX A;  3PNW C;  4C92 E;  2O31 A;  2J6F A;  3ZL7 C;  4M75 C;  4EDU A;  3T9N A;  3VYG A;  3OY9 A;  2J05 A;  1KD1 C;  1M1F A;  2DRK A;  4PJO D;  4QW2 A;  2E4H A;  1VQ9 Q;  4J9B A;  2OTJ A;  1TUC A;  5GAN 4;  2L5Q A;  3M59 A;  3URG A;  4BE2 A;  1M3A A;  4XTU A;  1NJI U;  2CP5 A;  3WVD B;  2CZ1 B;  1R0B G;  1FMW A;  1C1A A;  3M0U A;  1YJN T;  4OMM A;  3G4S T;  1KHI A;  1OX8 A;  2MK5 A;  4RG2 A;  2X3W D;  2EJ9 A;  4BI4 A;  3FLG A;  4CC4 B;  1OZ2 A;  2D0Q B;  2KAF A;  3OYC A;  3PVQ A;  3JB9 D;  3RER A;  2DZC A;  3L2Z A;  3NMZ C;  1ZSZ B;  4IIM A;  1IB8 A;  4F16 A;  2K2V A;  4DBQ A;  1JB0 E;  4FIB A;  2NUP B;  2RB6 A;  3EG9 A;  1J3T A;  4P5N A;  2BKD N;  1RAF B;  4XTV A;  2JNG A;  1UGP B;  4J6W A;  4JLG A;  3FJ5 A;  4KBM B;  3HTR A;  4UC4 A;  2NUT A;  5IH2 A;  2LNH B;  4LUD A;  1OU9 A;  4C0G A;  3OYF A;  1WJR A;  3CMA A;  1BBZ A;  2E6N A;  4RTZ A;  2E10 A;  1BCO A;  1KHC A;  3CBO A;  1BU1 A;  2HL3 A;  4HVW A;  2GFA A;  1S72 A;  1JO8 A;  1WYX A;  4E7H A;  4C0Z A;  2HQE A;  2LP5 A;  2EIF A;  4M78 E;  3QPH A;  1H92 A;  3I55 A;  5KYY B;  3CXC S;  1NPR A;  1U8R A;  4BD3 A;  1QVF P;  3QBY A;  4M77 D;  5GAM d;  2KT8 A;  1QCO A;  1VYV A;  3TRE A;  1VQM A;  2GCX A;  5CK9 A;  3EG1 A;  3CCU Q;  4L6V 5;  4C92 C;  1YJN A;  1T3L A;  4WF2 A;  1I1J A;  3OYD A;  5KYX B;  1NZ9 A;  2E5K A;  3V7C A;  2X3X D;  2COZ A;  3A8H B;  1XJW B;  3M55 A;  1B3Q A;  2E1H A;  3OYY A;  3CCS Q;  1VYT A;  4QQ6 A;  3UWN A;  2RA2 A;  3EH1 A;  4FSX A;  3CCV A;  2ZPH B;  3LWH A;  2FL7 A;  2FRW A;  3CCQ Q;  3G1J A;  5HK0 A;  4C5I A;  1YCS B;  2GQI A;  1YCY A;  1BB9 A;  5GAO r;  4E7I A;  2IIM A;  1VIF A;  4KT0 E;  4N0A A;  3OA6 A;  1YIT T;  4EIK A;  2C06 A;  4E2F B;  3JB9 H;  1D1A A;  2KR3 A;  4J7F A;  1HD3 A;  1AWX A;  4A53 A;  2L3Q A;  1HJD A;  2QQA A;  1K8A U;  1PM3 A;  2H3E B;  3V8K A;  5CVI A;  1TS9 A;  1K4U S;  4C5E A;  1VQ8 T;  3EGU A;  3X25 B;  3CC2 Q;  2HZY A;  3QII A;  1Q95 G;  2CDT A;  2DA9 A;  1I4K 1;  4MML A;  2MF2 A;  1LOJ A;  3E19 A;  2DAQ A;  4M7A B;  2AT1 B;  2EYQ A;  1SSF A;  1BCM A;  4B9W A;  5C6S A;  3H0I A;  4C8Q B;  2LT4 A;  2MMP A;  1M8V A;  4XU2 A;  3RKY A;  4ZGJ B;  2DM1 A;  2DMO A;  1BI0 A;  1Q82 U;  2QGF B;  4OMQ A;  3TU4 K;  3IQL A;  4M78 C;  3AHU A;  3ASK A;  4ATO A;  1B07 A;  3DB3 A;  1BK2 A;  3DLL A;  5KYU A;  1C6V X;  2EYW A;  2DLP A;  1GCP A;  1BI2 A;  5GAN 7;  4FU6 A;  1SPK A;  1AZE A;  1VQN Q;  1E6H A;  1WI7 A;  5GAN 5;  1PC0 A;  3UF4 A;  1LCK A;  2QA4 T;  2A36 A;  2IG0 A;  1VQO T;  1Y07 A;  2OTL A;  3CCJ A;  4KUI A;  4JS4 A;  5M9O A;  1ZA1 B;  1VQ4 A;  4M75 B;  3MET A;  3QZ5 B;  4XTY A;  1WHM A;  2EJF A;  2EQK A;  2HD0 A;  3RBB B;  4ZTJ A;  1X2Q A;  2A37 A;  2ZPI B;  1VIE A;  4ZN3 A;  5FRN A;  2OTJ Q;  2OX7 A;  2QQR A;  5IHN A;  3VS0 A;  3OYH A;  3V8L A;  2VVK A;  2E6Z A;  2HBW A;  3FB9 A;  2A08 A;  2KRS A;  4F7U B;  4OGE A;  3H6Z A;  2LDM A;  4PFZ A;  4QVC A;  3J80 E;  1WHJ A;  4JDS A;  2LT1 A;  1OV3 A;  3QUI A;  3PTA A;  3UDC A;  1M2V A;  2HEQ A;  1N5Z A;  4XTZ A;  1HXD A;  1YI2 T;  2LQN A;  2ED0 A;  4IKF A;  4M77 E;  1QQJ A;  1K9A A;  3QKJ A;  1O75 A;  4DBH A;  2DL3 A;  2A28 A;  2K9G A;  2KK4 A;  2Y90 A;  2QAZ A;  3VUB A;  1WIE A;  4X1V A;  2DTI A;  2XIC A;  4M78 G;  3NFC A;  4MDX A;  3MEV A;  2MI6 A;  1FMK A;  2DXT A;  2DIQ A;  4LD6 A;  2LTO A;  1G3S A;  3A5Z B;  3RIR A;  5KYW B;  2P0P A;  1G3Y A;  1I5L A;  4YTL A;  1K0X A;  1WPY A;  1YJW T;  4KGV B;  3JV3 A;  4ELY C;  1Y96 A;  4IUU A;  1Q81 U;  2L3S A;  2DIL A;  3LLR A;  5J26 A;  2QAS A;  3CME Q;  3A98 A;  2RQW A;  4PLI A;  3OS0 A;  2YLB A;  2V8I A;  3M9Q A;  1QWE A;  1HSQ A;  2W0Z A;  2MIO A;  1Q7Y R;  5IHK A;  4RKU E;  2G3R A;  4A4E A;  2QA4 A;  5EC7 A;  1UGR B;  4OGC A;  4J9F A;  4LNP A;  1S72 Q;  2GQV A;  1GFC A;  1NLP C;  2K6D A;  1VYU A;  3BW1 A;  1IZ6 A;  4M7A F;  3OYA A;  2D6F A;  3GOX A;  1H64 1;  5FW9 A;  2EQJ A;  3G71 T;  2VGN A;  2RF0 A;  4C8Q F;  4PFP A;  1AWO A;  1QKW A;  3SWN A;  4C0F A;  1KD1 U;  4LDX A;  5DY9 A;  3SDZ A;  2IVW A;  3L2Q A;  3HPW A;  3TSW A;  2DO3 A;  2ZGW A;  1YJN Q;  2JT4 A;  2ENM A;  2CP6 A;  3G4S Q;  4BDZ A;  3P8D A;  1RLQ C;  3REA B;  5IXB A;  2AKL A;  1BI1 A;  2P84 A;  1YHQ A;  1PKT A;  2DD4 A;  1ZHI A;  1D3B B;  4OMF B;  1NM7 A;  4R55 A;  2JS2 A;  1PRL C;  4HT8 A;  2K7A A;  2EYZ A;  4PJO G;  1WQW A;  4M75 F;  2RD1 A;  3OSV A;  1U5S A;  1WQ7 A;  2RJD A;  2L3R A;  1QCN A;  5D6X A;  2YLC A;  1Z9Q A;  2JXB A;  3EFO B;  1UE9 A;  1GBQ A;  1VQ7 A;  1YIJ T;  4M77 C;  2VC8 A;  4F7U F;  3V7R A;  3MKD A;  3EG2 A;  3TVT A;  1B34 B;  2KRM A;  4EMH A;  1JEG A;  3JB9 G;  2COW A;  3QSU A;  3CD6 A;  1XTD A;  3I9Q A;  3GNG A;  2KSS A;  4B9X A;  2KDS A;  4D8D A;  1AHJ B;  4QT7 A;  3H8Z A;  2L0A A;  1QVF S;  1PSE A;  4HKE A;  1UHC A;  2D8H A;  1U06 A;  2M16 A;  5I2S A;  4A63 B;  4J83 A;  3CC7 A;  1SRM A;  2EKO A;  3RMS A;  4XAX B;  2DL7 A;  3QDR B;  2YRC A;  4J5Y A;  2DFU A;  3TQ7 P;  3MJX A;  3ER0 A;  1PD1 A;  4LUE A;  3GBQ A;  4N0A C;  3C4S A;  1IRX A;  4C5H A;  3EH2 A;  4AFS C;  2LMJ A;  3P8B B;  1RAG B;  2K3Y A;  3CCL A;  2RMO A;  4M4Z A;  4CI0 C;  2DIG A;  3RMQ A;  2PVO B;  3JCM X;  5I22 A;  3EHR A;  1QP2 A;  2DYI A;  1ARK A;  4MDW A;  1KSW A;  1WX6 A;  1I5O B;  1IO6 A;  3OW2 P;  1YBY A;  4ELZ C;  2FG0 A;  2XI9 A;  2RJE A;  3UAT A;  1RAI B;  2R5A A;  1NEG A;  4RCC A;  1SHF A;  1U1T A;  2HAX A;  1BI3 A;  4M77 G;  1W2B P;  2MOX A;  3PMT A;  1BIA A;  2QQB A;  4AFZ C;  1IHW A;  4RG8 A;  1GL5 A;  3JCM d;  1MV0 B;  1RUW A;  3OS2 A;  2CKK A;  1VQK A;  3CPF A;  1W70 A;  1IXD A;  2CH4 A;  2F5K A;  4PFO A;  1YIT Q;  3CCR T;  3MHX A;  3ZFJ A;  5IXF A;  3CMA T;  2KI7 A;  2I2L A;  4QQD A;  1JXO A;  4LD9 K;  3L2R A;  2CS7 A;  3MP1 A;  1AOJ A;  4M7D B;  1A0N B;  1N9R A;  2C0O A;  1RLP C;  1M1G A;  3VS2 A;  4RCB A;  5LJ5 d;  3PVL A;  4F17 A;  2MWO A;  2E5Q A;  1VQ8 Q;  3I55 T;  2X9H A;  2GTO A;  2DEQ A;  2HNI A;  1KC8 R;  5FLX E;  4Y91 A;  1BYM A;  1VUB A;  1X6G A;  2YXY A;  3HL8 A;  3A8G B;  3OBY A;  1VQM T;  1D1C A;  3C95 A;  1RAA B;  4OP0 A;  5DLO A;  3A8M B;  2RM4 A;  3JCM P;  1I81 A;  4OMP A;  3TEE A;  1G5V A;  4PJO A;  2F2V A;  4E7K A;  1WXT A;  3ULR B;  1E7O A;  1TTH B;  1OX9 A;  2LC4 A;  4BY6 C;  2YUN A;  3I56 A;  2D9T A;  1ABQ A;  2NUZ A;  2K4Y A;  4QVD A;  1Q86 R;  4ORZ A;  3VS6 A;  2YUO A;  5ECA A;  4PLL A;  1PWT A;  4KUL A;  3CCV T;  4EMG A;  4PNO A;  5C0M A;  1KFZ A;  3F70 A;  3S6W A;  2LCC A;  2JW4 A;  2QA4 Q;  2CGH A;  5GMK l;  1TSF A;  3I35 A;  3G6E A;  2V8J A;  4RTY A;  3EG9 B;  1RAH B;  5LJ3 d;  4XU3 A;  1VQO Q;  5GAO n;  3HSB A;  4ME7 A;  1JJ2 A;  2QG9 B;  3OBW A;  1TH7 A;  1YJ9 A;  1ZBJ A;  5I11 A;  5GMK j;  1LJO A;  4C0D C;  1PCX A;  4A54 A;  5GMK m;  2BZX A;  4LDW A;  3EG0 A;  4GBQ A;  4DOV A;  3R6O A;  4NOY A;  2LX9 A;  1SSH A;  2RHX A;  4RTT A;  4CC3 A;  2X35 A;  4JZ4 A;  5GAO l;  2NUT B;  2M51 A;  5CQY A;  3CCR A;  4FT2 A;  4IUQ A;  1NJI R;  1NYF A;  3WXM B;  1PSF A;  4JLI A;  4ANJ A;  2CUD A;  5EG2 A;  1N9S A;  4OMO A;  4Z8A A;  2FO0 A;  4ESR A;  1YI2 Q;  6AT1 B;  2MYS A;  2VAS A;  2BE7 D;  5GAO m;  2ROL A;  1MNE A;  3CBM A;  2RK1 A;  4FYX B;  2KY9 A;  3X26 B;  1QW1 A;  1R0C B;  3SWN C;  3HKS A;  3Q1J A;  1UHF A;  2L3P A;  3C0C A;  3HRU A;  2B8A A;  3OW2 A;  1T3S A;  1WXB A;  4PJJ A;  2CZ6 B;  1GRI A;  1UEC A;  1VOM A;  2J7I A;  2OI3 A;  3A8O B;  3CPW A;  2D8J A;  3E2U A;  3M5A A;  4M77 A;  1PKS A;  2FYK A;  2EKH A;  5GAN g;  1VQP A;  2JMC A;  1YJW Q;  3CCM A;  3X20 B;  1EIF A;  1W2B A;  5CQX A;  2GGR A;  4M7D F;  5AYF A;  1M9S A;  1K9M R;  2KEA A;  2RQU A;  5IAY A;  3OYM A;  1TOV A;  4II1 A;  3M57 A;  2BIV A;  4F14 A;  1GFD A;  2C0I A;  2OTL T;  3CCJ T;  1KC8 C;  1G3W A;  1OEB A;  1VQ4 T;  1D1B A;  1M90 U;  1H3H A;  1M1K U;  4KGZ B;  1YP5 A;  2O4X A;  1ZX6 A;  1I0C A;  1VQ6 A;  4PL6 A;  3G71 Q;  1LVK A;  1ZA2 B;  2RHZ A;  1H8K A;  2K5F A;  3NTK A;  3OYE A;  3CCE A;  2WSF E;  5CIU A;  1G2B A;  1OQK A;  3BDL A;  2DD5 A;  1F1B B;  1Q86 C;  2EPD A;  1EFN A;  3A8L B;  2B86 A;  3VJP A;  2LVM A;  2EQM A;  2Z0W A;  4PJO E;  2HKQ B;  3QJ6 A;  3FEO A;  1UDL A;  1RAB B;  3LWI A;  4AMC A;  2DJQ A;  1LPL A;  5D7U A; 
#chains in the Genus database with same CATH homology
 2V8I A;  3PT9 A;  3M9Q A;  3OS5 A;  1X01 A;  3JCM V;  1OYX A;  3CC4 A;  3GPL A;  5CKE A;  1N8R C;  5HK3 A;  2YRV A;  4RKU E;  5GAO q;  4M78 F;  2G3R A;  4A4E A;  2QA4 A;  4J8O A;  1NE8 A;  5I2M A;  5GAN f;  1WGS A;  4M7A D;  1UGR B;  4OGC A;  4M78 A;  1QVG A;  3VUZ A;  3OYI A;  4DA4 A;  4ZTF A;  4C8Q D;  2WSE E;  3QYH B;  2GQV A;  2EQU A;  2GF7 A;  2RHI A;  3L2U A;  3BW1 A;  1IZ6 A;  4M7A F;  3OYA A;  1Q7Y C;  3OQ5 A;  2D6F A;  3GOX A;  1H64 1;  3X28 B;  2RHU A;  2EQJ A;  1K9M U;  2VXF A;  4IUV A;  1LNX A;  2VGN A;  3MEW A;  1BIB A;  3G71 T;  5GAN j;  4C8Q F;  3CME A;  5DM7 R;  3L42 A;  3JB9 I;  3CXC A;  3JCM h;  3SWN A;  4JRI A;  5FRO A;  4C0F A;  5GAN e;  2HBP A;  1NJI C;  1KD1 U;  4LDX A;  2CZ0 B;  5DY9 A;  2FVU A;  3OSS C;  2ZCF B;  3SDZ A;  1KQS S;  4ZGD B;  1KQ2 A;  4M7A C;  1KG1 A;  4M75 G;  3DKM A;  2XHC A;  3OS1 A;  2E70 A;  3CC4 T;  2IVW A;  3L2Q A;  2EFI A;  5CKH A;  4C8Q C;  3V7S A;  3HPW A;  5GAM h;  2DO3 A;  1G3T A;  1WJQ A;  4E7J A;  4LDU A;  2ZGW A;  3JCM b;  3OYG A;  4ZN1 A;  4HCC A;  4BDZ A;  2DTH A;  3FRN A;  3P8D A;  3GIB A;  2K5L A;  2E65 A;  3DB4 A;  1M5Q 1;  3MP8 A;  2X4W A;  5GAN 3;  5D6Y A;  4EMK A;  1KQ1 A;  1BI1 A;  2JUF A;  1Y7X A;  4F7U G;  1YIJ A;  1Q81 C;  1W4S A;  2XID A;  1ZBX A;  4M77 B;  1YHQ A;  5A0G A;  3GF5 A;  2DD4 A;  2EAY A;  1GXI E;  2LNV A;  3CEY A;  5LJ5 h;  3CME T;  4X9C A;  2E41 A;  4M75 D;  4OB1 B;  1ZHI A;  1WNL A;  2K5I A;  1D3B B;  3J81 E;  4L59 A;  4N4G A;  4OMF B;  4R55 A;  3S3O A;  3EFS A;  3ME9 A;  4MZT A;  5CKD A;  4BB7 A;  2DK3 A;  3FJP A;  1N6A A;  4HT8 A;  4XTW A;  2JVV A;  1U1S A;  4PJO G;  1WQW A;  4M75 F;  2DPP B;  4M7D A;  1JBM A;  4QVZ A;  3OW2 S;  2RD1 A;  2RK2 A;  3OSV A;  2PUO B;  4HT9 A;  1WQ7 A;  2RJD A;  2L3R A;  3G4S A;  3M4Y A;  5GAN 8;  1S72 T;  1N8R U;  5D6X A;  2YLC A;  3PNW C;  3RKX A;  5GMK i;  2QEX A;  4JRK A;  4N4I A;  3MCA B;  4C92 E;  3KXT A;  1UB4 A;  2AHJ B;  2DKG A;  2PVD B;  4M75 C;  1VQ7 A;  1VQL T;  1K9M C;  1YIJ T;  4BY6 B;  1NPP A;  2XG8 D;  3LGF A;  4M77 C;  4XQ3 A;  3T9N A;  2VC8 A;  3VYG A;  4EDU A;  3OY9 A;  5J3B A;  3UPU A;  1MGQ A;  4F7U F;  2WAC A;  1YHQ T;  5FRM A;  5CO7 A;  3V7R A;  1KD1 C;  1M1F A;  5GMK h;  4PJO D;  1Q7Y U;  2O4X B;  4OB0 B;  4QW2 A;  1B34 B;  1WJS A;  4J7I A;  5CCA A;  4EMH A;  4HCB A;  2OTJ A;  3JB9 G;  3QSU A;  5GAN 4;  4OVA A;  5KE3 A;  2L5Q A;  3M59 A;  3CD6 A;  1XTD A;  3URG A;  4BE2 A;  4XTU A;  3GNG A;  3JB9 J;  1NJI U;  2KSS A;  4PJO F;  1RL2 A;  4B9X A;  2DXC A;  2RI2 A;  3WVD B;  2KDS A;  3VKI A;  2CZ1 B;  1AHJ B;  3LYI A;  1YJN T;  3H8Z A;  1QVF S;  5FU6 C;  1KHI A;  3G4S T;  4M7D E;  4RG2 A;  2HQX A;  2XK0 A;  1PSE A;  2QEX T;  4HKE A;  2VV5 A;  2RO0 A;  2EJ9 A;  3LX7 A;  4BI4 A;  2L8D A;  3FLG A;  1ZQ1 A;  2O01 E;  1VQ7 T;  1I8F A;  1M4Z A;  1OZ2 A;  2D0Q B;  2KAF A;  2M16 A;  5I2S A;  4PJO C;  4J83 A;  4X9D A;  3CC7 A;  3OYC A;  5CKB A;  2EKO A;  5LJ3 h;  3JB9 D;  3RMS A;  4Z02 A;  3RER A;  4C0D B;  2K3X A;  4XAX B;  2DZC A;  3L2Z A;  1Y96 B;  2E12 A;  3WVE B;  3QDR B;  4VUB A;  3QHS A;  4J5Y A;  5DLQ E;  2XU8 A;  3BDU A;  3ER0 A;  3CD6 T;  2F5T X;  3HRS A;  5GAN 6;  5GAN 2;  3JB9 F;  4BAC A;  4N0A C;  3P8H A;  2JOY A;  3C4S A;  2M0O A;  2K2V A;  3MP6 A;  5CKF A;  1JB0 E;  4FIB A;  4C5H A;  2RB6 A;  4JRP A;  2L89 A;  4P5N A;  1X75 C;  2MWP A;  2BKD N;  4A4F A;  1K73 U;  4Y28 E;  3P8B B;  3OS0 A;  2K3Y A;  3CCL A;  4BE0 A;  4BDY A;  4XTX A;  4CI0 C;  1QP3 A;  2BUD A;  4DOW A;  2F69 A;  5CAI A;  4XTV A;  5KCO A;  2DIG A;  3RMQ A;  2QDY B;  2GFU A;  2PVO B;  3JCM X;  2JNG A;  4JS5 A;  1JJ2 S;  1QP2 A;  2RH2 A;  5FU7 C;  5J39 A;  3M53 A;  5LJ5 g;  3CC7 T;  3LH0 A;  4MDW A;  1UGP B;  4J6W A;  5KCH A;  3CBP A;  1YBY A;  4JLG A;  3OYL A;  1VQ9 T;  4M7A A;  2M1H A;  4KBM B;  4ELZ C;  3QZ9 B;  4C92 G;  2XI9 A;  4UC4 A;  2ZPE B;  4QQG A;  2RJE A;  4A4G A;  4C8Q A;  3M4G A;  2R5A A;  3SWN B;  3VYH B;  4RCC A;  5GMK e;  1U1T A;  3MEU A;  4IUP A;  2HAX A;  1UGQ B;  4C0G A;  3OYF A;  1WJR A;  3CMA A;  1BI3 A;  4M77 G;  3NTI A;  4LDY A;  3PMT A;  2E6N A;  2KMT A;  2E10 A;  1RI0 A;  1BIA A;  3CCL T;  2QQB A;  1KHC A;  3CBO A;  1VQM A;  4C92 B;  4RG8 A;  4XK8 E;  3RUX A;  3RKW A;  2GFA A;  1S72 A;  4E7H A;  4C0Z A;  2HQE A;  3JCM d;  2EIF A;  4M78 E;  3ZEH A;  3J7A F;  1BKB A;  1MHN A;  2DJZ A;  3SB2 A;  2FHD A;  3QPH A;  1VQL A;  3OS2 A;  3I55 A;  2CKK A;  3E1S A;  3CXC S;  3PIO A;  1NPR A;  4EMK B;  1U8R A;  3DLM A;  3HFO A;  1VQK A;  3CPF A;  3PGG A;  4BD3 A;  2DZ9 A;  3KBG A;  3QBY A;  4M77 D;  3ZBD A;  5GAM d;  5KH6 A;  2F5K A;  4M7A E;  3SD4 A;  1FXX A;  3CCR T;  3MHX A;  2LRQ A;  3TRE A;  3ZFJ A;  2GCX A;  2PU9 B;  4GLK A;  4IUT A;  4C8Q E;  3QYG B;  2I2L A;  4MMK A;  4QQD A;  5D6W A;  3CMA T;  4LD9 K;  1K73 C;  3L2R A;  2CS7 A;  3JCM f;  4J6X A;  3MP1 A;  4M77 F;  4FT4 A;  4M7D B;  4LDV A;  1N9R A;  2E64 A;  4FM4 B;  4L6V 5;  4M75 A;  4C92 C;  3CPW S;  2V8K A;  1YJN A;  2DVE A;  1M1G A;  4RCB A;  1R8O B;  5LJ5 d;  2LQ8 A;  4WF2 A;  2WSC E;  5LJ3 g;  2MWO A;  4X34 A;  3OYD A;  3FC3 A;  2XKO C;  1NZ9 A;  2E5Q A;  3FIF A;  1UGS B;  3V7C A;  5GAM f;  3I55 T;  4JJN K;  3OYJ A;  2DEQ A;  2RI5 A;  3A8H B;  3HRT A;  2HNI A;  1W2B S;  3M55 A;  3CCE T;  2KVQ G;  1VQK T;  2QI2 A;  2E1H A;  3OYY A;  5FLX E;  4QQ6 A;  4Y91 A;  3UWN A;  4F7U A;  2RA2 A;  4FSX A;  1YIT A;  3CCV A;  1BYM A;  2ZPH B;  2XD0 A;  2EWN A;  3LWH A;  1VUB A;  3HL8 A;  2P0Q A;  3A8G B;  1V29 B;  3OBY A;  1VQM T;  3C95 A;  3JCM W;  4OP0 A;  5LJ5 f;  2FL7 A;  4N4H A;  4M7D C;  1HK9 A;  1O9S A;  4XU1 A;  3A8M B;  5DLO A;  5CR2 A;  2RM4 A;  3JCM P;  2KQW A;  4L5G A;  1I81 A;  3HFN A;  1QVF A;  3EAE A;  3TEE A;  1G5V A;  3QJY A;  1N27 A;  3E9F A;  4PJO A;  2XDD A;  5HK0 A;  2JTF A;  1XQH A;  4C5I A;  4E7K A;  2JZ2 A;  4M75 E;  3MO8 A;  2RHY A;  2XDB A;  2R58 A;  3QO3 A;  1VQ8 A;  2LC4 A;  1YCY A;  3EFR A;  4BY6 C;  3OMG A;  3JCM J;  5LJ5 j;  3I56 A;  2D9T A;  2X4Y A;  5IT9 E;  1IRE B;  5GAO r;  2K4Y A;  4QVD A;  3JCM Q;  4A4K A;  2R57 A;  3JCM g;  4E7I A;  1VIF A;  5LJ5 e;  4KT0 E;  5GAN h;  4PLL A;  4A4H A;  4V2S A;  2RJF A;  4N0A A;  3OA6 A;  1P92 A;  1YIT T;  4KUL A;  1VQ9 A;  3CCV T;  2C06 A;  4EMG A;  3UT1 A;  5HKC A;  3JB9 H;  4PNO A;  2QQ9 A;  4F7U E;  5C0M A;  2M9U A;  3F70 A;  3INZ A;  4J7F A;  4O5V A;  3S6W A;  3S3N A;  2OAU A;  5GAM g;  3CCU T;  2JTM A;  2LCC A;  2CGH A;  4MZM A;  4A53 A;  4HA8 A;  3C94 A;  5GMK l;  3CCQ A;  2QQA A;  3G6E A;  2DTO A;  2V8J A;  3OYB A;  1OZ3 A;  1K8A U;  2A3L A;  3V8K A;  5LJ3 d;  4XU3 A;  5GAO n;  3HSB A;  5CVI A;  5GAN d;  3OB9 A;  3BY7 A;  4ME7 A;  2LQK A;  4NL2 A;  4ZGE B;  5A2Q E;  4C5E A;  3E9G A;  1JJ2 A;  1VQ8 T;  3HP9 A;  4M78 B;  2K57 A;  3M56 A;  2Y4X A;  3OBW A;  5HY6 A;  1TH7 A;  3I56 T;  4O6J A;  1YJ9 A;  3X25 B;  3PIP A;  2ZZD A;  2CZ7 B;  5GMK j;  3L2W A;  1LJO A;  3CCS T;  3QII A;  4C0D C;  5CK9 A;  3X24 B;  4A54 A;  2CYZ B;  5GMK m;  1FX7 A;  1I4K 1;  4MML A;  5I21 A;  4LDW A;  5GAO p;  2MF2 A;  1LOJ A;  3M58 A;  3E19 A;  2DAQ A;  4M7A B;  3R6O A;  3TCJ A;  4DOV A;  2R5M A;  4NOY A;  4C5G A;  2EYQ A;  3V8J A;  2LX9 A;  2VUB A;  1SSF A;  3JAM E;  2RHX A;  4B9W A;  2ZPG B;  3QXE B;  5LJ3 f;  2X35 A;  4C8Q B;  5C6S A;  4BUG A;  5GAO l;  1KQS A;  2LT4 A;  2MMP A;  1M8V A;  3JSC A;  2FB7 A;  4XU2 A;  5CQY A;  5A0D A;  3CCQ T;  3CCR A;  4FT2 A;  3RKY A;  4ZGJ B;  3G6E T;  1M90 C;  1VQO A;  4IUQ A;  4BI3 A;  1QVG S;  2VYT A;  4RMO A;  3WXM B;  1BI0 A;  1Q82 U;  4E47 A;  3TU4 K;  3GNF B;  1PSF A;  1M1K C;  4JLI A;  2A7Y A;  4M78 C;  3AHU A;  3ASK A;  1N9S A;  5EG2 A;  1KC8 U;  4ATO A;  3DB3 A;  3M54 A;  2X4J A;  5LJ3 j;  3DLL A;  3CC2 A;  1YJ9 T;  1DJ7 B;  1XNI A;  4BI8 B;  1BI2 A;  4C92 D;  5LJ3 e;  5GAO m;  3S3M A;  5GAN 7;  3CBM A;  4M7D G;  2RK1 A;  4FU6 A;  4TVR A;  3OYK A;  3N5B B;  3O8V A;  2KY9 A;  3X26 B;  1VQ5 A;  4JUV A;  1QW1 A;  2NLU A;  5GAN 5;  3SWN C;  3HKS A;  3Q1J A;  4C92 F;  3PMI A;  4OB2 B;  2QA4 T;  1JRI A;  4C92 A;  1K8A C;  5LL6 S;  2H3J A;  2IG0 A;  3HRU A;  3LGL A;  2B8A A;  3OW2 A;  1VQO T;  1Y07 A;  4BE1 A;  2OTL A;  2CZ6 B;  2RI3 A;  3A8O B;  4KUI A;  3CCJ A;  2QTX A;  3CPW A;  4JS4 A;  5M9O A;  1Q86 U;  1VQ4 A;  3L2V A;  4GY5 A;  3M5A A;  4M75 B;  3JRZ A;  3MET A;  4M77 A;  5IN1 A;  2LCL A;  1Y71 A;  3QZ5 B;  4XTY A;  4M7D D;  3HHT B;  4R56 A;  3CC2 T;  2EJF A;  2EQK A;  2FYK A;  2HD0 A;  2ZPF B;  1YI2 A;  4ZTJ A;  5GAN g;  1D3B A;  1VQP A;  1OI1 A;  3CCM A;  3X20 B;  1EIF A;  2ZPI B;  2DXB A;  5CQX A;  4EMK C;  3PFS A;  1VIE A;  1W2B A;  4PKC C;  4ZN3 A;  1VQN A;  5L8R E;  4JRQ A;  5FRN A;  3BFM A;  2QQR A;  3MEA A;  4Q5W A;  5AYF A;  3VU3 C;  4M7D F;  1H3Z A;  3OYH A;  1M9S A;  1VQ5 T;  3V8L A;  3JCM e;  2E6Z A;  3FB9 A;  4NS5 A;  4F7U B;  5IAY A;  4OGE A;  3H6Z A;  2LDM A;  3OYM A;  4QVC A;  2PVG B;  4MZP A;  3J80 E;  4NL3 A;  5GAM j;  2Y4Y A;  4II1 A;  3OMC A;  3M57 A;  2BIV A;  4JDS A;  4OF1 A;  5FU6 B;  2LT1 A;  3CCU A;  1Q82 C;  2OTL T;  3CCJ T;  5GAM e;  3VV0 A;  4J6Y A;  1KC8 C;  1G3W A;  3KUF A;  3QUI A;  3UDC A;  3PTA A;  2EJG A;  3JCM c;  1VQ4 T;  1M90 U;  4XTZ A;  4PJO B;  1HXD A;  5KE2 A;  1YJW A;  1YI2 T;  1M1K U;  4IKF A;  4D6W A;  4M77 E;  1VQP T;  2O4X A;  4FL6 A;  1B34 A;  4PL6 A;  3QKJ A;  1O75 A;  2RJC A;  3L1A A;  2VXE A;  3CCM T;  1VQ6 A;  2ZPB B;  2RHZ A;  1VQN T;  2PQW A;  2KK4 A;  3C12 A;  3CCS A;  2K5F A;  1XOV A;  3NTK A;  2Y90 A;  3OYE A;  4EPC A;  3FDR A;  3QG1 A;  3CCE A;  3VUB A;  4OB3 B;  2WSF E;  2YHT A;  2XDP A;  5CIU A;  2P0K A;  2DTI A;  2XIC A;  4M78 G;  4CRI A;  3OYN A;  3NFC A;  4MDX A;  2DXU A;  3MEV A;  2MI6 A;  3BDL A;  2P4T A;  2DXT A;  4HCZ A;  2DD5 A;  2DIQ A;  2QQS A;  4LD6 A;  2QXF A;  1Q86 C;  1UEB A;  1QVP A;  2LTO A;  2JN0 A;  1G3S A;  4DQ2 A;  5A0L A;  3GP8 A;  4XU0 A;  3A5Z B;  3A8L B;  3SFM A;  3RIR A;  2X4X A;  3VJP A;  3NTH A;  2LVM A;  2EQM A;  1G3Y A;  2P0P A;  1I5L A;  4M7A G;  4YTL A;  5FU7 B;  1WPY A;  1YJW T;  3RES A;  4ELY C;  4PJO E;  1Y96 A;  4C8Q G;  1X6O A;  3LW5 E;  3QJ6 A;  4IUU A;  1VQ6 T;  1Q81 U;  3G71 A;  3FEO A;  3G7Z A;  2MAM A;  2PUK B;  2OTJ T;  1FWZ A;  3LLR A;  5J26 A;  3LWI A;  4M78 D;  2VGM A;  3GLX A;  4IUR A;  4E7L A;  4PLI A;  2YLB A;  4KUD K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...