1W4SA

Crystal structure of the proximal bah domain of polybromo
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
146
structure length
146
Chain Sequence
MYHVGDYVYVEPAEANLQPHIVCIERLWEDSAGEKWLYGCWFYRPNETFHLATRKFLEKEVFKSDYYNKVPVSKILGKCVVMFVKEYFKLCPENFRDEDVYVCESRYSAKTKSFKKIKLWTMPVSSVRFVPRDVPLPVVRVASVFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POLYBROMO 1 PROTEIN
publication title Crystal Structure of the Proximal Bah Domain of the Polybromo Protein
pubmed doi rcsb
source organism Gallus gallus
molecule tags Nuclear protein
total genus 30
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1w4sA00
3TU4K 3PT9A 4FT4A 4DOVA 1ZHIA 2FL7A 4LD9K 1ZBXA 4KULA 4BB7A 3PTAA 4JJNK 4FSXA 4KUDK 2FVUA 4DOWA 1M4ZA 4FT2A 1W4SA 4KUIA 4DA4A
chains in the Genus database with same CATH superfamily
1BI2A 1RAAB 3OYLA 2NLUA 1QVFP 4AMCA 3EG9B 1IREB 2DTIA 1H92A 1W6XA 2DBKA 2GCXA 4M7AG 1B7TA 4C8QA 3LLRA 1V29B 1QKXA 1T0JA 4NL3A 2YUQA 1WHHA 4JJCA 1BKBA 2K3BA 2KXCA 1LVKA 3OSVA 2JOYA 3CQTA 5GAN5 3LW5E 2CZ7B 1UJ0A 5HKCA 1K4US 3G71T 1OEBA 4PJOE 1OULA 2J05A 2XD0A 3GNFB 4UC4A 4BI4A 2O01E 3OS0A 2GF7A 1ZUKA 4LDVA 2J7IA 4AFZC 4F7UF 2DTHA 1VQOQ 1KK7A 2MAMA 2LNHB 2O9SA 2CUBA 3L2UA 3HSBA 4C8QB 1M2VA 2IIMA 2DLPA 3JCMc 1UDLA 3VUZA 3OYIA 2RPNA 2ZPIB 5DM7R 4OMFB 8ATCB 1QP2A 3I5RA 5I2MA 4M75D 2A3LA 3TQ7P 1G3SA 1OZ3A 3QJYA 2L3SA 5FU6C 5L8RE 3OBYA 1PKTA 3G4SQ 4KGVB 5KCOA 2Y4YA 2DVEA 3J80E 4HT8A 2AHJB 5GAOp 3CPFA 1K9MR 4O6JA 4TVRA 1AWXA 1H8KA 2QGGA 3ZL7C 4ESRA 4LDXA 4F16A 3WVDB 2I0NA 1QCFA 1VQ6A 3KBGA 4QW2A 4MDXA 1YJWQ 2CREA 2A36A 2ZGWA 4J9HA 4PJOC 4J9EA 2FZKB 3NTKA 2KRMA 1M2VB 4N0AC 3EG0A 5GANd 2DIQA 2F2VA 3OA6A 1YFNA 4B6MA 3I5SA 4AG2C 1YJNA 5AYFA 2CP3A 2X3WD 2DL3A 4PJJA 4KT0E 1UUEA 2XIDA 2A37A 1OPKA 2BKDN 3DLLA 4LNPA 2EQMA 1YWOA 4JLGA 5IN1A 4DBQA 1X6BA 1X6GA 2FVUA 1VOMA 3SDZA 3OYEA 1IHWA 9ATCB 4OP0A 1I8FA 2FEIA 4Y92A 2MK5A 4NOYA 2RK2A 1UEBA 1TTHB 5FLXE 2DKGA 4JJDA 3D7SB 4XAXB 1FX7A 2CZ6B 2FZGB 2X35A 2DF6A 1I1JA 1W4SA 2EGAA 2KXDA 3P8BB 3UA7A 3GBQA 1WA7A 2DM1A 3OS1A 1D1AA 3I55Q 2CZ1B 1PG5B 3M4YA 5CKHA 3M56A 4VUBA 3OYFA 3CD6T 1FMVA 2YXYA 3FEOA 5DLQE 1VQNQ 4CC3A 2IVWA 2KR3A 2K5IA 1WPYA 2X4WA 1M30A 3QJ6A 1VQ9Q 1U1SA 1KC8R 1TXQA 2VWFA 2A0FB 1RADB 4CC2A 2SRCA 1YNZA 4GY5A 2LJ0A 1FMWA 2DPPB 2RF0A 3LGFA 2LTOA 3G71A 2RI3A 4Q5WA 4A4HA 2JW4A 2XK0A 4NL2A 2LCSA 2BE9B 2RJFA 4E7SA 1JXMA 2FHDA 4E7ZA 1Z9QA 2ATCB 4Y28E 1WDXA 2EVRA 2L3QA 3ZEHA 3L1AA 4M7DE 4OMOA 5CCAA 3CD6Q 2H8HA 3A5ZB 3C12A 4EMKC 3C94A 1QMCA 1ZQ1A 1QP3A 4QKUA 4KH1B 1OOTA 2EJFA 2HL5C 3BDUA 3OS5A 3PNWC 2E6ZA 3ME9A 4M4ZA 1UHCA 3JCMX 3OBWA 4OGEA 4PJNA 1C0MA 3RESA 4YTLA 2VVKA 2R57A 2QA4Q 2B86A 1AD5A 2J06A 4DOWA 1M8MA 4EDUA 3FDRA 1D1BA 1SRMA 1M1KC 2MOXA 4C92F 4V2SA 2V1QA 1NLPC 2HBWA 3DKMA 4XTWA 1RLQC 1R0BG 3CEYA 3S6WA 4D6WA 1Q82R 1AWWA 3QBYA 4OF1A 1VQMT 4PJOD 2CZ0B 2DAQA 4M7DC 1K0SA 2E3HA 1KFZA 3PVQA 3AHUA 2YLBA 4C5HA 3RDVA 1MUZA 3VJPA 4F7UG 3OYCA 3MCAB 5GAN6 1RL2A 3P8HA 3BFMA 1D0ZA 1KQSA 2RQVA 4HA8A 4C0ZA 2FZCB 3HL8A 4PLIA 2DX1A 1VQKT 3GF5A 4XK8E 3S3NA 2EGEA 4M75F 2D9TA 4F17A 2F5KA 4J9IA 2QQRA 2BZYA 4RG8A 4M77G 4R56A 2GFAA 1KHCA 3FJ5A 1LJOA 2KE9A 3I9QA 1Q7YR 2FPEA 1PNJA 3G6ET 2KT8A 2HBPA 1Y0MA 1OYXA 2C06A 2JVVA 2V8IA 2KRNA 1K73C 4FT2A 2DXBA 3RUXA 4JZ4A 3OW2A 3UPUA 1JJ2A 1ZBXA 3L2ZA 2D8HA 4AFSC 2JM8A 1UTIA 3A8HB 3V8KA 3GLXA 2CH4A 1VQ4Q 1BBZA 3CCLT 3OYNA 1YBYA 4M78F 4FYYB 3X26B 4J9CA 2HKNA 4WF2A 2M0OA 3EGUA 3VV0A 4C92A 1M1KU 3O5ZA 4FW1A 1QWEA 3E1SA 2EAYA 3G6EQ 1HJDA 4BE0A 3META 2J6OA 1RUWA 4C5GA 4OB0B 1TSFA 2QTVA 4EMGA 3OMGA 3ZBDA 1F1BB 1JEGA 2HAXA 1QVGA 4IUTA 2CP7A 1N6AA 1B34B 2A28A 2YSQA 4M77D 2OTJT 1K8AC 1TS9A 1TOVA 3CC2Q 2JN0A 1BI1A 2R5AA 4M7AE 4II1A 1B3QA 1X27A 4C92B 2RHXA 2QQ9A 4M75A 4RTUA 2FRWA 3LYIA 1WQ7A 2QYZA 3CBOA 4JZ3A 5FWCA 2X4JA 4E47A 3IQLA 4XTYA 2DERA 4QVCA 3CCUQ 3CPWS 1VQ5T 1O75A 3L2RA 1VQMA 5FU7C 1RAEB 1W2BA 4JJBA 1ZX6A 2AT1B 1WJRA 2D1XA 3HRTA 2L8DA 5KYNA 2C0OA 4ZGJB 5GAN2 4DBRA 1K73U 4M75C 2HCKA 3SEMA 2DL4A 2KNBB 1TUCA 2XU8A 1I07A 1M5Q1 1LNXA 5FU7B 1NM7A 5GMKi 1KIKA 5GAN7 2DL5A 4WCIA 2KY9A 1JU5C 1W1FA 3TSWA 2RD1A 4M75B 1VQKA 4ORZA 3C95A 3JV3A 2KMTA 4J7IA 1VQ8A 4M78A 4J9GA 1VIFA 1E7OA 1VA7A 2DXUA 2P84A 1CKAA 1VQ5Q 3PIPA 4M7AC 2QDYB 5LJ5f 2VXEA 4HCBA 5HK3A 3CCJQ 3C4SA 1C6VX 1QVFS 2K5LA 5GAOq 1V1CA 3JCMW 3QO3A 1JB0E 2DNUA 2EFIA 3CXCA 5KH6A 4LUEA 3JB9J 5LJ5g 1YIJT 5LJ5e 4J8OA 2GQIA 2LZ6B 3H8ZA 3JCMP 1HXDA 3OYBA 3REBB 1Q81C 4L6V5 5EG2A 5GMKj 2YRDA 3VS7A 3URGA 2LVMA 1VQ7Q 3CCLA 1UGPB 4M78B 4A4GA 5CQXA 2MI6A 4BACA 1K8AU 1BCOA 4PJOF 4RKUE 2KK4A 4A63B 2DRMA 4J9FA 3X28B 2CP6A 2BIVA 3CCQQ 1KQSP 2A7YA 5CKEA 5IAYA 1GRIA 5ECAA 4C0DC 4PNOA 3MKDA 1JBMA 1M27C 2MCNA 1KSWA 2DEQA 1I0CA 2MIOA 1AT1B 3MPUB 4FSSA 4C0GA 1I81A 4JRKA 4C0DB 2O9VA 1BU1A 1VQOT 1QVPA 3SB2A 5GAN4 3VYGA 1WLPB 4OGCA 2OTJA 4KGZB 3JCMf 3VRYA 3VS5A 4KGXB 1NG2A 2LQWA 4L5GA 4HCZA 2CH4W 1QCNA 1PSFA 2WSCE 1AHJB 2C0IA 3OW2P 2RI2A 2DO3A 1OPLA 1YP5A 1JJ2P 4IUPA 2L3RA 2M9UA 1RAGB 1M3BA 3AT1B 3JCMg 1YI2A 3JCMe 1AOJA 3G4ST 1IGQA 4BDZA 2PU9B 2OTLQ 1R0CB 2NUTA 5LJ5j 2D0QB 3FB9A 4JUVA 2JMCA 3CC7T 2DJZA 3I56Q 1X75C 2MPXC 4A4FA 4EIKA 1AZEA 3VYHB 1YJWT 1XJWB 2X4XA 2LP5A 1YJ9A 1JQQA 1PHTA 2HMAA 5CKBA 1EZZB 5GJVB 3HFOA 3MJXA 1D0YA 3VS0A 1Q81U 1XTDA 2KYMA 3JB9H 2L89A 3UATA 2CGHA 5GAMd 2MWOA 1ARKA 4RUGA 1NYFA 4PJOA 3NHNA 1SPKA 1QVGP 4N4IA 4N0AA 4C5EA 3L2QA 1DJ7B 1OZ2A 2F5TX 4GBQA 2DIGA 2W10A 3M57A 3BDLA 2NUTB 1QW1A 3QYHB 2DTOA 3CC7Q 5FRMA 2E3IA 5M9OA 1VQPQ 2DZ9A 5FU6B 2ABLA 2CSQA 3R6NA 3J81E 1NEBA 4M7AD 2WSFE 3SHWA 4LD6A 1YIJA 1R8OB 2RK1A 5EC7A 1H641 2XMFA 2PQWA 2HSPA 3CCVT 3H0FA 1U8RA 2PUOB 2OAUA 1W2BP 5IHNA 1X43A 2QI2A 1QCOA 3GNGA 4JRIA 4PJOB 5FWBA 3I55T 1SF9A 4NS5A 3M0SA 2COZA 1VYVA 1IHVA 1G8XA 3VS2A 5GANf 1KD1C 1VQNT 1S72Q 1VYUA 3HPWA 3M5AA 1NJIR 1VQ9T 3HRUA 1XNIA 4PFPA 1S1NA 4QVZA 4E7LA 1ZA1B 2HEQA 3CC4Q 3QIIA 3JCMb 5GANg 4M7DF 1Y07A 3NTHA 4FSXA 5GANe 4C8QG 5KCHA 1WHJA 2AKKA 3RBBB 3EAEA 3CCVQ 2RHUA 1N27A 3BY7A 3WXMB 3TSZA 2IG0A 1ZBJA 2CT3A 1KHIA 1ZLMA 2EYWA 2GFUA 1VQOA 1VQLT 2ROLA 3X24B 2EYQA 3CXCP 4M77E 3FIFA 1D0XA 1AEYA 1PD0A 1HK9A 5CR2A 1XQHA 1QLYA 3MP6A 2RA2A 3CMAT 1C1AA 1X69A 2DRKA 4A53A 1KC8C 2FG0A 1O9SA 3JB9F 2EKOA 5GAOm 3G4SA 4EMKA 1Q86C 2M16A 4CRIA 2QEXQ 3VS1A 5D6YA 1UGVA 5KYXA 1N8RC 2QA4T 3CCSQ 3L2WA 1M2OA 1SRLA 2E65A 1VQLQ 1JO8A 1ZUYA 1YJWA 3EFSA 1IZ6A 3TREA 5D7UA 3GP8A 1YITQ 3M53A 2JXBA 2BZ8A 4J5YA 3CMAQ 2EQIA 2LNVA 2C0TA 1G3YA 2QG9B 4M77C 2O88A 3EHRA 5CKFA 2K5FA 1QKWA 3M9QA 4C8QD 1ZSGA 4OVAA 4EMKB 2PUKB 1KD1U 4A54A 2K2MA 1NPRA 5GANj 4JRPA 4QT7A 2DETA 5KYXB 4Z02A 2RQTA 1GFDA 3A98A 4M7DA 1B07A 3H6ZA 4HT9A 2A08A 2X4YA 1UGRB 4ZGEB 2LQ8A 5AT1B 3CCVA 1TG0A 4LUDA 2PVGB 2DXTA 1UG1A 4LE9A 4R55A 3RKWA 3FJPA 4HVUA 1Q82C 4ELZC 5KE2A 1ZSZC 2XI9A 3NTIA 1ACMB 2F1LA 2X51A 2VKNA 2EQJA 3I55A 2CSIA 1M1KR 3M55A 1Z9ZA 1K76A 2DD4A 1LOJA 5GMKm 3GPLA 3ASKA 3OYAA 4RCBA 1M90C 1VQNA 6AT1B 2O4XA 2QDLA 2OI3A 1KC8U 1VQ9A 2COWA 4M7DB 5I21A 2OJ2A 3FRNA 1PM3A 1Q86U 3EG1A 1FMKA 3JRZA 1VQ4T 2V8KA 2GGRA 3M4GA 4DA4A 5LJ3d 4E7JA 1Y71A 4RTTA 1N8RU 5KYUB 4XQ3A 4GLKA 2L3PA 4A4EA 2VGMA 3CMEQ 2MMPA 2XDDA 4Z8AA 5FRNA 1K9AA 5FW9A 2EQKA 5GJWB 2F2WA 4R0KA 2I2LA 3CD6A 1M8VA 2EJGA 2JT4A 4BE1A 2O4XB 3JAME 3OB9A 1NBEB 4M7AF 3CBMA 3QWXX 5GAN8 1WGSA 3P8DA 3O8VA 3OQ5A 4IIMA 3TEEA 1HD3A 4C5IA 1M1GA 2FRYA 1OV3A 2VUBA 2JMAA 5D6WA 1K73R 2PVOB 1B34A 3CCMQ 1CKBA 2RHIA 2QQBA 1SSFA 2QA4A 3CC2T 2QAZA 2HZYA 1MNEA 2D0NA 2DXCA 3A8MB 3EG3A 3TVTA 2AZVA 1Q82U 1YHQT 3CCUT 2HQEA 3CCEQ 1MMNA 3MP8A 1WHGA 3SFMA 1IGUA 2EBPA 4E2FB 3CCRT 2KDSA 4MMKA 2CP5A 3VUBA 2G6FX 4OB2B 4BD3A 1M90U 4E6RA 4MZPA 5I2SA 1R77A 2DBMA 4FM4B 1X2KA 5GAN3 4RTWA 4QVDA 2RO0A 4PK4A 1UE9A 4BE2A 1D09B 2LCLA 3JSCA 2HL3A 1MHNA 2E6NA 2KAFA 4ZN1A 2RB6A 3KFVA 1GCQC 3EH2A 2JTFA 1UECA 3MEWA 3OYMA 3G1JA 2EPDA 1I4K1 2P0PA 2E12A 1Q95G 5CO7A 1X2QA 3M58A 1YHQQ 1FWZA 1K8AR 2ED0A 4JJNK 1WHLA 2YDLA 3R6OA 1RI9A 3CCJT 3CCRQ 4IKFA 4BY6C 3RMQA 4E7IA 5GAMh 1U06A 5HCKA 4JPBW 2NUZA 2LQKA 1WI7A 3INZA 4M7AA 3E2UA 2HKQB 2ZPBB 4BY6B 2CP2A 2GBQA 2GTJA 3A8OB 2RM4A 3QKJA 4LDUA 1VQ7T 1VQ4A 2KQWA 2K9GA 3M0UA 4AFUC 1PWTA 2HDAA 3X25B 3V7SA 3HFNA 4X9CA 4QQ6A 5J39A 5HK0A 2M1HA 2HD0A 2BTTA 3CCQT 5J26A 2ROTA 4JDSA 1PRLC 2RJDA 1D1CA 3G6EA 3OYGA 4XTVA 4M7AB 2H3JA 1H3HA 5GAOn 1AWOA 2DA9A 3L2VA 3OW2S 1X6OA 4X1VA 2QQAA 3MO8A 3LH0A 1VUBA 1JJ2S 4C92G 1N9SA 3FC3A 5D6XA 4XU1A 3SWNA 2E10A 4Z89A 4P5NA 2V26A 2KVQG 3DB4A 5A0LA 5IT9E 2YT6A 1RACB 2IPOB 3CC2A 2FL7A 3VS6A 4ME7A 3QZ9B 1D3BA 2VXFA 2K6DA 3M59A 5CQYA 3LGLA 3QHSA 4N4GA 2FB7A 3EG2A 4GLMA 4K11A 3SWNC 4FYXB 3CCUA 1OX8A 2OTLT 2NYSA 1TWBA 4PFOA 1LCKA 3NFCA 1TH7A 4ZNXA 4C8QE 3I56T 3CBPA 1VQ6Q 4M75G 1UGQB 2KBTA 1MV3A 3RKYA 3OYJA 1QVGS 2VGNA 3EFRA 2DD5A 3REAB 3SWNB 3F70A 4KRTA 1YN8A 3PIOA 4XTXA 1EX4A 1LPLA 3V8LA 1YJNQ 4AG1C 1JRIA 2L0AA 3SD4A 1ZA2B 2ZPEB 4A4KA 1D3BB 1GBQA 1WJSA 2DMOA 1GXIE 4ELYC 2V8JA 4LD9K 1WXTA 5IH2A 2G3RA 1MMGA 4KULA 3ULRB 1GCPA 2KROA 2M0YA 2R5MA 4E7KA 1VQ5A 2E1HA 2DFUA 3UT1A 1W2BS 2NWMA 2O31A 1VYTA 4C92D 1BYMA 2PTKA 3CCJA 2XHCA 2YLCA 1RI0A 1VQPT 1WXBA 1Y57A 4QQGA 3TU4K 4HCCA 2NUPA 1M3CA 4M78G 2CS7A 2QGFB 3UF4A 3HRSA 2JTEA 1IB8A 1OU8A 4C8QC 5IXBA 2PNIA 3NMZC 3EGDA 2QASA 2AZSA 4MZMA 3J7AF 1HSQA 2CUDA 1U3OA 2ENMA 1M1FA 2K4YA 1VQ7A 1EIFA 3N5BB 1YCYA 3PMIA 2VYTA 1V76A 1CSKA 4HKEA 2K79A 4IUUA 1WJQA 2M02A 1YWPA 3RKXA 4EPCA 3HKSA 1S72T 2F69A 4ZGDB 1UHFA 5C0MA 1K9MC 3CCQA 3M0TA 5GAMf 3MEVA 5LL6S 5A0GA 2XDBA 4M77F 3CC4T 2BZXA 2NUPB 3CXCS 4J6XA 3VS3A 1AWJA 1N9RA 3G71Q 4OMLA 2JS0A 1UFFA 3EGDB 5GAMg 3PVLA 5GAMe 3V7RA 2RJEA 5KYYA 3QPHA 2HQHA 5FROA 4LXCA 2WSEE 5J3BA 1WQWA 2EYZA 2KYBA 1UB4A 4KUIA 4OB1B 4XTZA 4ANJA 4J83A 4CC7A 4O5VA 1PC0A 4FT4A 1BK2A 3MHXA 5LJ3h 1NJIC 4AFQC 2KRSA 1FXXA 1OX9A 3EGXA 4M78D 3QG1A 2J6KA 4XU0A 2CYZB 4JS5A 2D6FA 4F7UE 1ABOA 2Y90A 2EGCA 2QEXT 1KD1R 2OTLA 3OY9A 2X3XD 5KYWA 1TUDA 4DQ2A 1Y96A 2ZPGB 4F04B 4ATOA 1WIEA 3H0IA 1OI1A 5DY9A 3I56A 1SKUB 5KYYB 3CCST 4ZTFA 2JNGA 1MMAA 5GAOr 4RTYA 2P4TA 2B8AA 2RMOA 5IXFA 4D8KA 4DBFA 2HQXA 2RHYA 1YITT 3S3MA 4FYVB 3JCMQ 2ZCFB 2KT1A 4F7UA 5A2QE 3MEAA 3MP1A 5HY6A 3KXTA 4E7HA 3EGXB 3H41A 4J9DA 2LT4A 1GFCA 1U5SA 2PVDB 1UJYA 4RMOA 2LX9A 2KSSA 4PLLA 3M54A 3VKIA 1IRXA 1K9MU 1MGQA 4FCYA 5KYWB 1Y96B 3CC7A 4J7FA 2JUFA 4M77A 4PKCC 4L59A 1IO6A 4Z88A 1VQPA 2DL7A 1WX6A 3PFSA 4X9DA 3M0QA 5GAMj 4PJOG 5GMKh 3H0HA 1BB9A 1AVZC 1Q86R 1NZ9A 1W70A 2P0KA 4D8DA 3QWYA 3E19A 2RN8A 3JB9I 5DLOA 3A1PA 2LC4A 3M0RA 4F7UB 4KUDK 4PL6A 2X9HA 1N8RR 1NPPA 3X20B 5KE3A 2OX7A 3QXEB 1JXOA 2LJ3A 2LCCA 1RLPC 2E5QA 1G83A 4WTOB 2VB6A 1NLOC 2MF2A 3BW1A 2ESWA 4QQDA 4EMHA 2FPDA 1NJIU 2MYSA 1G3WA 1ZSZA 1S72A 4KBMB 2AK5A 4M77B 4JS4A 4J6WA 2QQSA 3QYGB 3BE3A 4IURA 1UGSB 3CC4A 2RQWA 2YUOA 2LQNA 4HCKA 3WVEB 4DOVA 2LDMA 2J6FA 2WACA 1PSEA 4BDYA 3THKA 3V7CA 1OU9A 1I5OB 5KYUA 4CC4B 1GBRA 2DL8A 3CMET 1GL5A 2QK0A 3A8GB 4OMQA 2BE7D 1T3LA 4FIBA 4X34A 2AIRB 2VC8A 3A8LB 1MMDA 8AT1B 3LWIA 2JS2A 1ZHIA 2RH2A 3CPWA 4XTUA 4RG2A 1ZSZB 4AT1B 2CP0A 3OYHA 5LJ5h 3OS2A 3FLGA 3GOXA 3Q1JA 2VV5A 1M3AA 2YWWA 4RCCA 2ECZA 2DJQA 4BI3A 7AT1B 1WHMA 2K2VA 4RTXA 2EWNA 4FU6A 2QEXA 1M90R 1BIBA 3C0CA 2D8JA 3NPFA 2R58A 2FPFA 2ZZDA 3CCMT 2HNIA 1PCXA 1T3SA 4OB3B 2DZCA 4XU3A 1BI3A 4HVWA 4IUQA 3CCSA 4FW2A 3I35A 2DYIA 4FYWB 1VQLA 1PRMC 1Y7XA 2HSEB 1WHKA 2EKHA 1RAIB 2P4RA 4PJLA 3PMTA 1VQ8T 3EFOA 1YITA 1Q7YC 1E6HA 2Y4XA 3QDFA 3HHTB 4XU2A 3CMAA 5LJ3f 1VQMQ 2RHZA 3CCET 1TU0B 3OSSC 4J6YA 5I22A 3ER0A 2F2XA 2DK3A 3E9GA 1QWFA 1QVFA 1WXUA 5IHIA 2MWPA 2SEMA 4HVVA 1PD1A 5LJ3g 4Y91A 5I11A 2EW3A 5LJ3e 4C92E 2EYYA 4MMLA 2KGTA 4PJMA 2GQVA 2RQRA 2E5KA 2E64A 3RERA 1VIEA 1BI0A 3H9NA 3UWNA 3QUIA 1K0XA 4BUGA 1VQKQ 3RIRA 5IHKA 2GTOA 1SHFA 1VQ8Q 2DYBA 3EFOB 4OMPA 4OMMA 1IXDA 4N4HA 2ZPFB 3LWHA 1BCMA 1XOVA 3JCMh 5GAOl 2KEAA 4B9XA 4M7DG 2XG8D 1GCQA 4OMNA 3U23A 2RI5A 1AZGB 2XDPA 1H3ZA 1K1ZA 4FL6A 2GNCA 1SHGA 4LDYA 2RQUA 1E6GA 2M51A 1TUGB 1SG5A 3HTRA 3RNJA 2ZAEA 2YHTA 2EJ9A 1KQ2A 2YRCA 4M75E 1HYOA 3OYDA 1P92A 2E41A 4B9WA 4RTVA 1PKSA 4C92C 3CCLQ 2LMJA 4C0FA 1WZOA 1WYXA 1X01A 4ZN3A 2O2OA 3EHQA 1SSHA 1I5LA 2P0QA 2LX7A 1WNLA 4DEYA 5GMKe 2LJ1A 3JB9G 3OYKA 3CMEA 1FYNA 5CK9A 4DEXA 1BIAA 2JTMA 1M4ZA 3GIBA 1SEMA 3G7ZA 1Q7YU 1KG1A 2EIFA 2QTXA 2ED1A 4MZTA 1OQKA 4JLIA 1YI2T 2YUNA 2EQUA 2VASA 3E9FA 3OYYA 3LH5A 4BI8B 5LJ3j 4M78E 1ABQA 1KQSS 3T9NA 2PZ1A 2OAWA 4IIOA 3QDRB 1N5ZA 2BUDA 5CAIA 2KI7A 3VS4A 3HP9A 4LDWA 1J3TA 2JJ9A 2V1RA 2RJCA 1YJ9T 1NEGA 5C6SA 5LJ5d 2OTJQ 3CCMA 2K3YA 2XICA 3M0PA 4M7DD 2Z0WA 1G2BA 2DVJA 1A0NB 4C8QF 5GMKl 3RR6A 4JRQA 3JCMJ 1KQ1A 2LRQA 4LN2A 1NYGA 1YI2Q 2K7AA 2ZPHB 2E4HA 2L2PA 2JZ2A 2FYKA 3L42A 3VRZA 1RABB 3DB3A 2QXFA 5GANh 3CCEA 3PE0A 4MDWA 5A0DA 2L5QA 4BB7A 3PGGA 1G3TA 3PTAA 2DEUA 1QQJA 4IUVA 1VQ6T 4RTZA 1YCSB 1U1TA 5CKDA 3S3OA 1T0HA 1YJ9Q 5L23A 1MNDA 4M78C 4ZTJA 4CI0C 3LX7A 3QSUA 3JB9D 3CPWP 3KUFA 3PT9A 2DE0X 2YUPA 3UDCA 1EFNA 2E70A 1Q81R 1YJNT 3ZFJA 3MEUA 1KJWA 2K3XA 2COYA 4HXJA 2K57A 3EG9A 3OMCA 2EYXA 3NGPA 4DBHA 4F14A 1RAFB 2CDTA 1YHQA 2YRVA 2JM9A 2CT4A 2LT1A 3EH1A 1WFWA 3DLMA 1NE8A 3CCRA 4KH0B 3VU3C 3V8JA 3JCMV 3RMSA 2AKLA 2CKKA 2FO0A 1RAHB 2RNAA 1ZUUA 1YIJQ 2DILA 3UA6A 3QZ5B 3JCMd 1MV0B 2W0ZA 1G5VA 5CVIA 1M9SA 4PFZA 3TCJA 2XKOC 5CIUA 2H3EB 4J9BA
chains in the Genus database with same CATH topology
4M75A 3ASKA 1BI2A 4DQ2A 3LYIA 1Y96A 1WQ7A 2ZPGB 3OYAA 4RCBA 3OYLA 4ATOA 3CBOA 1OI1A 2NLUA 1M90C 1VQNA 2X4JA 4E47A 4XTYA 2O4XA 1IREB 5DY9A 3I56A 2DTIA 4QVCA 3CCST 4ZTFA 2JNGA 3CPWS 1KC8U 1VQ9A 5GAOr 2GCXA 1VQ5T 2P4TA 4M7AG 2B8AA 4M7DB 4C8QA 5I21A 1O75A 3L2RA 3LLRA 1VQMA 1V29B 5FU7C 3FRNA 1W2BA 2HQXA 2RHYA 1YITT 3S3MA 1Q86U 5GMKm 1WJRA 3JRZA 1VQ4T 3HRTA 3JCMQ 4NL3A 2V8KA 2ZCFB 2L8DA 4DA4A 3M4GA 4F7UA 4ZGJB 5GAN2 5A2QE 1BKBA 3MEAA 4M75C 3MP1A 5LJ3d 4E7JA 1K73U 5HY6A 1Y71A 3KXTA 1N8RU 2XU8A 4E7HA 4XQ3A 1M5Q1 4GLKA 3OY9A 3OSVA 2JOYA 2LT4A 4A4EA 2VGMA 1LNXA 2MMPA 5FU7B 5GAN5 5GMKi 3LW5E 2XDDA 2PVDB 4RMOA 5GAN7 2CZ7B 5HKCA 3G71T 2KY9A 4PJOE 5FRNA 2EQKA 2LX9A 2XD0A 2KSSA 4PLLA 3M54A 3GNFB 3VKIA 4UC4A 4BI4A 1K9MU 2O01E 2RD1A 2I2LA 1MGQA 3OS0A 2GF7A 4M75B 1VQKA 1Y96B 4LDVA 3CD6A 1M8VA 3C95A 2EJGA 2KMTA 3CC7A 4J7IA 1VQ8A 4J7FA 2JUFA 4M77A 4M78A 4L59A 2DTHA 4PKCC 4F7UF 2O4XB 4BE1A 3JAME 1VQPA 3OB9A 2MAMA 3PFSA 1VIFA 4X9DA 5GAMj 2DXUA 4PJOG 4M7AF 3CBMA 5GMKh 3PIPA 4M7AC 5GAN8 2QDYB 1WGSA 2VXEA 3P8DA 4C8QB 5LJ5f 3L2UA 4HCBA 5HK3A 3O8VA 3HSBA 3JCMc 3OQ5A 3VUZA 3TEEA 3C4SA 1NZ9A 4C5IA 3OYIA 1M1GA 2P0KA 2ZPIB 4OMFB 5DM7R 1QVFS 2K5LA 5GAOq 3E19A 1QP2A 3JCMW 3JB9I 5I2MA 5DLOA 2VUBA 2LC4A 4M75D 5D6WA 3QO3A 2A3LA 2PVOB 4F7UB 1B34A 1JB0E 1G3SA 2EFIA 1OZ3A 4PL6A 5KH6A 3CXCA 3JB9J 4KUDK 3QJYA 5LJ5g 5FU6C 5L8RE 1YIJT 5LJ5e 4J8OA 1NPPA 2RHIA 3OBYA 3X20B 5KE3A 3H8ZA 2QQBA 3QXEB 3JCMP 1SSFA 1HXDA 2LCCA 2QA4A 3CC2T 3OYBA 2E5QA 5KCOA 2Y4YA 2DVEA 3J80E 4HT8A 2AHJB 2MF2A 1Q81C 5GAOp 3CPFA 3BW1A 4L6V5 5EG2A 2DXCA 3A8MB 5GMKj 4QQDA 4EMHA 3URGA 4O6JA 4TVRA 1NJIU 1G3WA 2LVMA 4LDXA 1S72A 4KBMB 3WVDB 3CCLA 1UGPB 4M77B 4M78B 4J6WA 4A4GA 3CCUT 4JS4A 2QQSA 5CQXA 2MI6A 3KBGA 4QW2A 4BACA 4MDXA 1K8AU 2HQEA 3QYGB 4PJOF 4RKUE 3MP8A 2KK4A 2ZGWA 4PJOC 3SFMA 4IURA 1UGSB 3NTKA 3CC4A 3CCRT 3X28B 5GANd 2KDSA 4N0AC 2DIQA 4MMKA 2BIVA 3VUBA 4OB2B 3OA6A 4BD3A 2A7YA 3WVEB 5CKEA 4DOVA 5IAYA 2LDMA 1YJNA 1VQ6A 2WACA 1PSEA 5AYFA 4BDYA 1M90U 4MZPA 4KT0E 3V7CA 5I2SA 4C0DC 4PNOA 4FM4B 1JBMA 5GAN3 2XIDA 4QVDA 2RO0A 2BKDN 3CMET 3DLLA 4BE2A 2EQMA 2LCLA 3A8GB 3JSCA 4JLGA 1MHNA 5IN1A 2E6NA 2FVUA 2DEQA 4FIBA 3SDZA 3OYEA 2KAFA 4ZN1A 2RB6A 4X34A 4OP0A 1I8FA 2VC8A 3A8LB 4C0GA 2JTFA 1I81A 3MEWA 4JRKA 4C0DB 4NOYA 2RK2A 3LWIA 1ZHIA 3OYMA 2RH2A 3CPWA 1I4K1 2P0PA 4RG2A 4XTUA 2E12A 1YHQT 1UEBA 5FLXE 1VQOT 1QVPA 5CO7A 3OYHA 3M58A 3SB2A 3FLGA 5LJ5h 1FWZA 5GAN4 3VYGA 3OS2A 2DKGA 4JJNK 3GOXA 3Q1JA 2VV5A 4OGCA 3R6OA 2OTJA 4XAXB 3JCMf 1FX7A 4RCCA 3CCJT 2CZ6B 4IKFA 4L5GA 4HCZA 2X35A 4BY6C 1PSFA 4BI3A 2WSCE 1AHJB 3RMQA 4E7IA 2K2VA 2EWNA 1W4SA 4FU6A 2RI2A 5GAMh 2DO3A 2QEXA 1BIBA 4IUPA 3P8BB 2L3RA 2R58A 2M9UA 2ZZDA 3CCMT 2HNIA 2LQKA 3INZA 4OB3B 3JCMg 2DZCA 4M7AA 4XU3A 3OS1A 1YI2A 1BI3A 3JCMe 4IUQA 3G4ST 2CZ1B 3CCSA 4BDZA 2ZPBB 2PU9B 4BY6B 3M4YA 5CKHA 1VQLA 5LJ5j 2D0QB 3A8OB 3M56A 4VUBA 3FB9A 1Y7XA 3OYFA 1KG1A 2RM4A 4JUVA 3CD6T 3FEOA 5DLQE 3PMTA 3CC7T 2IVWA 1VQ8T 3QKJA 1YITA 2K5IA 4LDUA 1Q7YC 1WPYA 2DJZA 2X4WA 2Y4XA 1X75C 4A4FA 1VQ4A 2KQWA 3QJ6A 1VQ7T 3HHTB 3X25B 1U1SA 3VYHB 4XU2A 1YJWT 3CMAA 5LJ3f 3V7SA 2RHZA 2X4XA 3CCET 3HFNA 3OSSC 4J6YA 3ER0A 4GY5A 1YJ9A 4X9CA 4QQ6A 5J39A 5HK0A 2DK3A 2M1HA 2DPPB 3E9GA 2HD0A 1QVFA 5CKBA 3LGFA 2MWPA 3HFOA 2LTOA 3CCQT 1Q81U 5J26A 1XTDA 3G71A 3JB9H 2L89A 2RI3A 4Q5WA 4A4HA 2CGHA 2XK0A 4NL2A 4JDSA 5LJ3g 4Y91A 2RJFA 5GAMd 2MWOA 2RJDA 5LJ3e 4C92E 2FHDA 3G6EA 3OYGA 4PJOA 4MMLA 4XTVA 4M7AB 2GQVA 2H3JA 4N4IA 4N0AA 4Y28E 4C5EA 3L2QA 5GAOn 1DJ7B 1OZ2A 2E64A 3RERA 2F5TX 1VIEA 2DIGA 3L2VA 3OW2S 3M57A 1BI0A 1X6OA 3BDLA 3QUIA 3UWNA 3ZEHA 1QW1A 2QQAA 3L1AA 3LH0A 1VUBA 3MO8A 3QYHB 3RIRA 4BUGA 1N9SA 2DTOA 4C92G 5CCAA 1JJ2S 4M7DE 3A5ZB 3C12A 3FC3A 4EMKC 5FRMA 3C94A 5D6XA 5M9OA 1ZQ1A 1QP3A 4N4HA 2DZ9A 2ZPFB 5FU6B 4XU1A 3LWHA 2EJFA 3J81E 1LOJA 3SWNA 2E10A 1XOVA 4P5NA 3BDUA 3OS5A 3PNWC 3JCMh 2KVQG 4M7AD 2E6ZA 2WSFE 3DB4A 5GAOl 4LD6A 1YIJA 1R8OB 4B9XA 5A0LA 4M7DG 2RK1A 1H641 2XG8D 2PQWA 3ME9A 5IT9E 3JCMX 3CCVT 2RI5A 2XDPA 3OBWA 3CC2A 1H3ZA 2FL7A 4FL6A 1U8RA 2PUOB 4LDYA 2OAUA 4OGEA 4ME7A 3QZ9B 1D3BA 2YHTA 2QI2A 2EJ9A 3RESA 2VXFA 3M59A 4YTLA 3GNGA 2R57A 5CQYA 4JRIA 3LGLA 1KQ2A 4M75E 4PJOB 3QHSA 4N4GA 2FB7A 3I55T 3SWNC 3CCUA 4NS5A 3OYDA 4DOWA 1P92A 2OTLT 4EDUA 3FDRA 1M1KC 2E41A 4B9WA 1KD1C 4C92F 5GANf 1VQNT 4V2SA 4C8QE 3NFCA 1TH7A 4C92C 3I56T 3HPWA 3CBPA 3DKMA 3M5AA 1UGQB 4M75G 4XTWA 4C0FA 3HRUA 3OYJA 3RKYA 1VQ9T 3CEYA 1X01A 1XNIA 3S6WA 4ZN3A 2VGNA 4QVZA 3EFRA 3QBYA 4D6WA 4E7LA 2DD5A 1QVGS 1I5LA 2P0QA 4OF1A 3SWNB 3F70A 1VQMT 4PJOD 3QIIA 2CZ0B 2DAQA 3JCMb 1WNLA 5GMKe 5GANg 3PIOA 3JB9G 4M7DF 4XTXA 1Y07A 3NTHA 4FSXA 5GANe 3OYKA 4C8QG 5CK9A 5KCHA 3CMEA 4M7DC 1BIAA 2JTMA 1M4ZA 3EAEA 3V8LA 3GIBA 2RHUA 3G7ZA 1N27A 3AHUA 2YLBA 3BY7A 3WXMB 1JRIA 3SD4A 2EIFA 2QTXA 4C5HA 1Q7YU 2ZPEB 4MZTA 2IG0A 4JLIA 4A4KA 1YI2T 2EQUA 3VJPA 1D3BB 4F7UG 1WJSA 1KHIA 1GXIE 3E9FA 3OYYA 3OYCA 4ELYC 2V8JA 3MCAB 4LD9K 5GAN6 1RL2A 2G3RA 3P8HA 4KULA 4BI8B 2GFUA 3BFMA 1KQSA 1VQOA 1VQLT 5LJ3j 3X24B 2EYQA 2R5MA 4HA8A 4M78E 4M77E 4E7KA 4C0ZA 3HL8A 1KQSS 3T9NA 3FIFA 2E1HA 4PLIA 1VQ5A 3UT1A 1W2BS 3QDRB 1VQKT 4C92D 1BYMA 2BUDA 3GF5A 3CCJA 1HK9A 5CAIA 2XHCA 2YLCA 4XK8E 5CR2A 3S3NA 1RI0A 1VQPT 3HP9A 1XQHA 4LDWA 4M75F 2D9TA 3MP6A 2RA2A 3CMAT 2F5KA 2RJCA 1YJ9T 2QQRA 4QQGA 3TU4K 4HCCA 4RG8A 5C6SA 4M77G 4M78G 2CS7A 4A53A 5LJ5d 1KC8C 4R56A 3CCMA 3HRSA 1O9SA 2GFAA 2K3YA 1KHCA 2XICA 3JB9F 4M7DD 2EKOA 4C8QF 5GAOm 5GMKl 4C8QC 3G4SA 4EMKA 1Q86C 2M16A 4CRIA 4JRQA 3JCMJ 1LJOA 1KQ1A 2LRQA 3G6ET 2HBPA 1OYXA 5D6YA 2C06A 2JVVA 2V8IA 4MZMA 1K73C 4FT2A 3J7AF 2ZPHB 1M1FA 2K4YA 1N8RC 2QA4T 1VQ7A 2DXBA 3RUXA 1EIFA 2JZ2A 3L2WA 2FYKA 3N5BB 3L42A 1YCYA 3PMIA 3OW2A 2E65A 2VYTA 3DB3A 2QXFA 1YJWA 3UPUA 3EFSA 5GANh 1IZ6A 3TREA 3CCEA 1JJ2A 1Q82U 1ZBXA 4HKEA 3GP8A 3L2ZA 4MDWA 2L5QA 4IUUA 3M53A 1G3TA 3PGGA 4BB7A 5A0DA 3PTAA 1WJQA 3A8HB 3RKXA 3V8KA 3GLXA 4EPCA 3HKSA 1S72T 2F69A 4ZGDB 5C0MA 3CCLT 4IUVA 1K9MC 1VQ6T 3CCQA 5CKDA 1U1TA 4J5YA 3S3OA 2LNVA 5GAMf 3MEVA 1YBYA 3OYNA 5LL6S 1G3YA 5A0GA 2XDBA 4M77F 4M78F 3CC4T 3CXCS 4M78C 4M77C 4ZTJA 4CI0C 3LX7A 5CKFA 3X26B 3QSUA 2K5FA 3JB9D 4J6XA 3M9QA 4C8QD 4WF2A 3KUFA 3PT9A 1N9RA 2M0OA 3VV0A 3UDCA 4C92A 2E70A 1M1KU 1YJNT 4OVAA 1KD1U 3ZFJA 2PUKB 4EMKB 4A54A 3MEUA 5GAMg 3E1SA 1NPRA 2EAYA 2K3XA 5GAMe 5GANj 4JRPA 2K57A 4BE0A 3META 3OMCA 3V7RA 2RJEA 3QPHA 4Z02A 5FROA 4C5GA 4OB0B 2WSEE 4M7DA 1YHQA 2YRVA 5J3BA 3OMGA 4EMGA 1WQWA 3ZBDA 1UB4A 3H6ZA 2LT1A 4KUIA 4OB1B 4XTZA 4HT9A 4J83A 3DLMA 4O5VA 2X4YA 1UGRB 1NE8A 3CCRA 2HAXA 4ZGEB 4FT4A 3VU3C 3V8JA 3JCMV 2LQ8A 3RMSA 1QVGA 3CCVA 4IUTA 3MHXA 1N6AA 2CKKA 5LJ3h 1NJIC 2PVGB 2DXTA 1FXXA 1B34B 4R55A 3RKWA 3FJPA 3QG1A 4M77D 4M78D 4XU0A 4ELZC 1Q82C 5KE2A 2CYZB 2XI9A 4JS5A 2OTJT 1K8AC 3NTIA 3QZ5B 3JCMd 2D6FA 4F7UE 2Y90A 2EQJA 2JN0A 3I55A 1BI1A 2R5AA 3M55A 4M7AE 1G5VA 5CVIA 4II1A 2QEXT 1M9SA 4C92B 3TCJA 2RHXA 2XKOC 5CIUA 2OTLA 2DD4A 2QQ9A 3GPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TU4 K;  3PT9 A;  4FT4 A;  4DOV A;  1ZHI A;  2FL7 A;  4LD9 K;  1ZBX A;  4KUL A;  4BB7 A;  3PTA A;  4JJN K;  4FSX A;  4KUD K;  2FVU A;  4DOW A;  1M4Z A;  4FT2 A;  1W4S A;  4KUI A;  4DA4 A; 
#chains in the Genus database with same CATH topology
 1BI2 A;  1RAA B;  3OYL A;  2NLU A;  1QVF P;  4AMC A;  3EG9 B;  1IRE B;  2DTI A;  1H92 A;  1W6X A;  2DBK A;  2GCX A;  4M7A G;  1B7T A;  4C8Q A;  3LLR A;  1V29 B;  1QKX A;  1T0J A;  4NL3 A;  2YUQ A;  1WHH A;  4JJC A;  1BKB A;  2K3B A;  2KXC A;  1LVK A;  3OSV A;  2JOY A;  3CQT A;  5GAN 5;  3LW5 E;  2CZ7 B;  1UJ0 A;  5HKC A;  1K4U S;  3G71 T;  1OEB A;  4PJO E;  1OUL A;  2J05 A;  2XD0 A;  3GNF B;  4UC4 A;  4BI4 A;  2O01 E;  3OS0 A;  2GF7 A;  1ZUK A;  4LDV A;  2J7I A;  4AFZ C;  4F7U F;  2DTH A;  1VQO Q;  1KK7 A;  2MAM A;  2LNH B;  2O9S A;  2CUB A;  3L2U A;  3HSB A;  4C8Q B;  1M2V A;  2IIM A;  2DLP A;  3JCM c;  1UDL A;  3VUZ A;  3OYI A;  2RPN A;  2ZPI B;  5DM7 R;  4OMF B;  8ATC B;  1QP2 A;  3I5R A;  5I2M A;  4M75 D;  2A3L A;  3TQ7 P;  1G3S A;  1OZ3 A;  3QJY A;  2L3S A;  5FU6 C;  5L8R E;  3OBY A;  1PKT A;  3G4S Q;  4KGV B;  5KCO A;  2Y4Y A;  2DVE A;  3J80 E;  4HT8 A;  2AHJ B;  5GAO p;  3CPF A;  1K9M R;  4O6J A;  4TVR A;  1AWX A;  1H8K A;  2QGG A;  3ZL7 C;  4ESR A;  4LDX A;  4F16 A;  3WVD B;  2I0N A;  1QCF A;  1VQ6 A;  3KBG A;  4QW2 A;  4MDX A;  1YJW Q;  2CRE A;  2A36 A;  2ZGW A;  4J9H A;  4PJO C;  4J9E A;  2FZK B;  3NTK A;  2KRM A;  1M2V B;  4N0A C;  3EG0 A;  5GAN d;  2DIQ A;  2F2V A;  3OA6 A;  1YFN A;  4B6M A;  3I5S A;  4AG2 C;  1YJN A;  5AYF A;  2CP3 A;  2X3W D;  2DL3 A;  4PJJ A;  4KT0 E;  1UUE A;  2XID A;  2A37 A;  1OPK A;  2BKD N;  3DLL A;  4LNP A;  2EQM A;  1YWO A;  4JLG A;  5IN1 A;  4DBQ A;  1X6B A;  1X6G A;  2FVU A;  1VOM A;  3SDZ A;  3OYE A;  1IHW A;  9ATC B;  4OP0 A;  1I8F A;  2FEI A;  4Y92 A;  2MK5 A;  4NOY A;  2RK2 A;  1UEB A;  1TTH B;  5FLX E;  2DKG A;  4JJD A;  3D7S B;  4XAX B;  1FX7 A;  2CZ6 B;  2FZG B;  2X35 A;  2DF6 A;  1I1J A;  1W4S A;  2EGA A;  2KXD A;  3P8B B;  3UA7 A;  3GBQ A;  1WA7 A;  2DM1 A;  3OS1 A;  1D1A A;  3I55 Q;  2CZ1 B;  1PG5 B;  3M4Y A;  5CKH A;  3M56 A;  4VUB A;  3OYF A;  3CD6 T;  1FMV A;  2YXY A;  3FEO A;  5DLQ E;  1VQN Q;  4CC3 A;  2IVW A;  2KR3 A;  2K5I A;  1WPY A;  2X4W A;  1M30 A;  3QJ6 A;  1VQ9 Q;  1U1S A;  1KC8 R;  1TXQ A;  2VWF A;  2A0F B;  1RAD B;  4CC2 A;  2SRC A;  1YNZ A;  4GY5 A;  2LJ0 A;  1FMW A;  2DPP B;  2RF0 A;  3LGF A;  2LTO A;  3G71 A;  2RI3 A;  4Q5W A;  4A4H A;  2JW4 A;  2XK0 A;  4NL2 A;  2LCS A;  2BE9 B;  2RJF A;  4E7S A;  1JXM A;  2FHD A;  4E7Z A;  1Z9Q A;  2ATC B;  4Y28 E;  1WDX A;  2EVR A;  2L3Q A;  3ZEH A;  3L1A A;  4M7D E;  4OMO A;  5CCA A;  3CD6 Q;  2H8H A;  3A5Z B;  3C12 A;  4EMK C;  3C94 A;  1QMC A;  1ZQ1 A;  1QP3 A;  4QKU A;  4KH1 B;  1OOT A;  2EJF A;  2HL5 C;  3BDU A;  3OS5 A;  3PNW C;  2E6Z A;  3ME9 A;  4M4Z A;  1UHC A;  3JCM X;  3OBW A;  4OGE A;  4PJN A;  1C0M A;  3RES A;  4YTL A;  2VVK A;  2R57 A;  2QA4 Q;  2B86 A;  1AD5 A;  2J06 A;  4DOW A;  1M8M A;  4EDU A;  3FDR A;  1D1B A;  1SRM A;  1M1K C;  2MOX A;  4C92 F;  4V2S A;  2V1Q A;  1NLP C;  2HBW A;  3DKM A;  4XTW A;  1RLQ C;  1R0B G;  3CEY A;  3S6W A;  4D6W A;  1Q82 R;  1AWW A;  3QBY A;  4OF1 A;  1VQM T;  4PJO D;  2CZ0 B;  2DAQ A;  4M7D C;  1K0S A;  2E3H A;  1KFZ A;  3PVQ A;  3AHU A;  2YLB A;  4C5H A;  3RDV A;  1MUZ A;  3VJP A;  4F7U G;  3OYC A;  3MCA B;  5GAN 6;  1RL2 A;  3P8H A;  3BFM A;  1D0Z A;  1KQS A;  2RQV A;  4HA8 A;  4C0Z A;  2FZC B;  3HL8 A;  4PLI A;  2DX1 A;  1VQK T;  3GF5 A;  4XK8 E;  3S3N A;  2EGE A;  4M75 F;  2D9T A;  4F17 A;  2F5K A;  4J9I A;  2QQR A;  2BZY A;  4RG8 A;  4M77 G;  4R56 A;  2GFA A;  1KHC A;  3FJ5 A;  1LJO A;  2KE9 A;  3I9Q A;  1Q7Y R;  2FPE A;  1PNJ A;  3G6E T;  2KT8 A;  2HBP A;  1Y0M A;  1OYX A;  2C06 A;  2JVV A;  2V8I A;  2KRN A;  1K73 C;  4FT2 A;  2DXB A;  3RUX A;  4JZ4 A;  3OW2 A;  3UPU A;  1JJ2 A;  1ZBX A;  3L2Z A;  2D8H A;  4AFS C;  2JM8 A;  1UTI A;  3A8H B;  3V8K A;  3GLX A;  2CH4 A;  1VQ4 Q;  1BBZ A;  3CCL T;  3OYN A;  1YBY A;  4M78 F;  4FYY B;  3X26 B;  4J9C A;  2HKN A;  4WF2 A;  2M0O A;  3EGU A;  3VV0 A;  4C92 A;  1M1K U;  3O5Z A;  4FW1 A;  1QWE A;  3E1S A;  2EAY A;  3G6E Q;  1HJD A;  4BE0 A;  3MET A;  2J6O A;  1RUW A;  4C5G A;  4OB0 B;  1TSF A;  2QTV A;  4EMG A;  3OMG A;  3ZBD A;  1F1B B;  1JEG A;  2HAX A;  1QVG A;  4IUT A;  2CP7 A;  1N6A A;  1B34 B;  2A28 A;  2YSQ A;  4M77 D;  2OTJ T;  1K8A C;  1TS9 A;  1TOV A;  3CC2 Q;  2JN0 A;  1BI1 A;  2R5A A;  4M7A E;  4II1 A;  1B3Q A;  1X27 A;  4C92 B;  2RHX A;  2QQ9 A;  4M75 A;  4RTU A;  2FRW A;  3LYI A;  1WQ7 A;  2QYZ A;  3CBO A;  4JZ3 A;  5FWC A;  2X4J A;  4E47 A;  3IQL A;  4XTY A;  2DER A;  4QVC A;  3CCU Q;  3CPW S;  1VQ5 T;  1O75 A;  3L2R A;  1VQM A;  5FU7 C;  1RAE B;  1W2B A;  4JJB A;  1ZX6 A;  2AT1 B;  1WJR A;  2D1X A;  3HRT A;  2L8D A;  5KYN A;  2C0O A;  4ZGJ B;  5GAN 2;  4DBR A;  1K73 U;  4M75 C;  2HCK A;  3SEM A;  2DL4 A;  2KNB B;  1TUC A;  2XU8 A;  1I07 A;  1M5Q 1;  1LNX A;  5FU7 B;  1NM7 A;  5GMK i;  1KIK A;  5GAN 7;  2DL5 A;  4WCI A;  2KY9 A;  1JU5 C;  1W1F A;  3TSW A;  2RD1 A;  4M75 B;  1VQK A;  4ORZ A;  3C95 A;  3JV3 A;  2KMT A;  4J7I A;  1VQ8 A;  4M78 A;  4J9G A;  1VIF A;  1E7O A;  1VA7 A;  2DXU A;  2P84 A;  1CKA A;  1VQ5 Q;  3PIP A;  4M7A C;  2QDY B;  5LJ5 f;  2VXE A;  4HCB A;  5HK3 A;  3CCJ Q;  3C4S A;  1C6V X;  1QVF S;  2K5L A;  5GAO q;  1V1C A;  3JCM W;  3QO3 A;  1JB0 E;  2DNU A;  2EFI A;  3CXC A;  5KH6 A;  4LUE A;  3JB9 J;  5LJ5 g;  1YIJ T;  5LJ5 e;  4J8O A;  2GQI A;  2LZ6 B;  3H8Z A;  3JCM P;  1HXD A;  3OYB A;  3REB B;  1Q81 C;  4L6V 5;  5EG2 A;  5GMK j;  2YRD A;  3VS7 A;  3URG A;  2LVM A;  1VQ7 Q;  3CCL A;  1UGP B;  4M78 B;  4A4G A;  5CQX A;  2MI6 A;  4BAC A;  1K8A U;  1BCO A;  4PJO F;  4RKU E;  2KK4 A;  4A63 B;  2DRM A;  4J9F A;  3X28 B;  2CP6 A;  2BIV A;  3CCQ Q;  1KQS P;  2A7Y A;  5CKE A;  5IAY A;  1GRI A;  5ECA A;  4C0D C;  4PNO A;  3MKD A;  1JBM A;  1M27 C;  2MCN A;  1KSW A;  2DEQ A;  1I0C A;  2MIO A;  1AT1 B;  3MPU B;  4FSS A;  4C0G A;  1I81 A;  4JRK A;  4C0D B;  2O9V A;  1BU1 A;  1VQO T;  1QVP A;  3SB2 A;  5GAN 4;  3VYG A;  1WLP B;  4OGC A;  2OTJ A;  4KGZ B;  3JCM f;  3VRY A;  3VS5 A;  4KGX B;  1NG2 A;  2LQW A;  4L5G A;  4HCZ A;  2CH4 W;  1QCN A;  1PSF A;  2WSC E;  1AHJ B;  2C0I A;  3OW2 P;  2RI2 A;  2DO3 A;  1OPL A;  1YP5 A;  1JJ2 P;  4IUP A;  2L3R A;  2M9U A;  1RAG B;  1M3B A;  3AT1 B;  3JCM g;  1YI2 A;  3JCM e;  1AOJ A;  3G4S T;  1IGQ A;  4BDZ A;  2PU9 B;  2OTL Q;  1R0C B;  2NUT A;  5LJ5 j;  2D0Q B;  3FB9 A;  4JUV A;  2JMC A;  3CC7 T;  2DJZ A;  3I56 Q;  1X75 C;  2MPX C;  4A4F A;  4EIK A;  1AZE A;  3VYH B;  1YJW T;  1XJW B;  2X4X A;  2LP5 A;  1YJ9 A;  1JQQ A;  1PHT A;  2HMA A;  5CKB A;  1EZZ B;  5GJV B;  3HFO A;  3MJX A;  1D0Y A;  3VS0 A;  1Q81 U;  1XTD A;  2KYM A;  3JB9 H;  2L89 A;  3UAT A;  2CGH A;  5GAM d;  2MWO A;  1ARK A;  4RUG A;  1NYF A;  4PJO A;  3NHN A;  1SPK A;  1QVG P;  4N4I A;  4N0A A;  4C5E A;  3L2Q A;  1DJ7 B;  1OZ2 A;  2F5T X;  4GBQ A;  2DIG A;  2W10 A;  3M57 A;  3BDL A;  2NUT B;  1QW1 A;  3QYH B;  2DTO A;  3CC7 Q;  5FRM A;  2E3I A;  5M9O A;  1VQP Q;  2DZ9 A;  5FU6 B;  2ABL A;  2CSQ A;  3R6N A;  3J81 E;  1NEB A;  4M7A D;  2WSF E;  3SHW A;  4LD6 A;  1YIJ A;  1R8O B;  2RK1 A;  5EC7 A;  1H64 1;  2XMF A;  2PQW A;  2HSP A;  3CCV T;  3H0F A;  1U8R A;  2PUO B;  2OAU A;  1W2B P;  5IHN A;  1X43 A;  2QI2 A;  1QCO A;  3GNG A;  4JRI A;  4PJO B;  5FWB A;  3I55 T;  1SF9 A;  4NS5 A;  3M0S A;  2COZ A;  1VYV A;  1IHV A;  1G8X A;  3VS2 A;  5GAN f;  1KD1 C;  1VQN T;  1S72 Q;  1VYU A;  3HPW A;  3M5A A;  1NJI R;  1VQ9 T;  3HRU A;  1XNI A;  4PFP A;  1S1N A;  4QVZ A;  4E7L A;  1ZA1 B;  2HEQ A;  3CC4 Q;  3QII A;  3JCM b;  5GAN g;  4M7D F;  1Y07 A;  3NTH A;  4FSX A;  5GAN e;  4C8Q G;  5KCH A;  1WHJ A;  2AKK A;  3RBB B;  3EAE A;  3CCV Q;  2RHU A;  1N27 A;  3BY7 A;  3WXM B;  3TSZ A;  2IG0 A;  1ZBJ A;  2CT3 A;  1KHI A;  1ZLM A;  2EYW A;  2GFU A;  1VQO A;  1VQL T;  2ROL A;  3X24 B;  2EYQ A;  3CXC P;  4M77 E;  3FIF A;  1D0X A;  1AEY A;  1PD0 A;  1HK9 A;  5CR2 A;  1XQH A;  1QLY A;  3MP6 A;  2RA2 A;  3CMA T;  1C1A A;  1X69 A;  2DRK A;  4A53 A;  1KC8 C;  2FG0 A;  1O9S A;  3JB9 F;  2EKO A;  5GAO m;  3G4S A;  4EMK A;  1Q86 C;  2M16 A;  4CRI A;  2QEX Q;  3VS1 A;  5D6Y A;  1UGV A;  5KYX A;  1N8R C;  2QA4 T;  3CCS Q;  3L2W A;  1M2O A;  1SRL A;  2E65 A;  1VQL Q;  1JO8 A;  1ZUY A;  1YJW A;  3EFS A;  1IZ6 A;  3TRE A;  5D7U A;  3GP8 A;  1YIT Q;  3M53 A;  2JXB A;  2BZ8 A;  4J5Y A;  3CMA Q;  2EQI A;  2LNV A;  2C0T A;  1G3Y A;  2QG9 B;  4M77 C;  2O88 A;  3EHR A;  5CKF A;  2K5F A;  1QKW A;  3M9Q A;  4C8Q D;  1ZSG A;  4OVA A;  4EMK B;  2PUK B;  1KD1 U;  4A54 A;  2K2M A;  1NPR A;  5GAN j;  4JRP A;  4QT7 A;  2DET A;  5KYX B;  4Z02 A;  2RQT A;  1GFD A;  3A98 A;  4M7D A;  1B07 A;  3H6Z A;  4HT9 A;  2A08 A;  2X4Y A;  1UGR B;  4ZGE B;  2LQ8 A;  5AT1 B;  3CCV A;  1TG0 A;  4LUD A;  2PVG B;  2DXT A;  1UG1 A;  4LE9 A;  4R55 A;  3RKW A;  3FJP A;  4HVU A;  1Q82 C;  4ELZ C;  5KE2 A;  1ZSZ C;  2XI9 A;  3NTI A;  1ACM B;  2F1L A;  2X51 A;  2VKN A;  2EQJ A;  3I55 A;  2CSI A;  1M1K R;  3M55 A;  1Z9Z A;  1K76 A;  2DD4 A;  1LOJ A;  5GMK m;  3GPL A;  3ASK A;  3OYA A;  4RCB A;  1M90 C;  1VQN A;  6AT1 B;  2O4X A;  2QDL A;  2OI3 A;  1KC8 U;  1VQ9 A;  2COW A;  4M7D B;  5I21 A;  2OJ2 A;  3FRN A;  1PM3 A;  1Q86 U;  3EG1 A;  1FMK A;  3JRZ A;  1VQ4 T;  2V8K A;  2GGR A;  3M4G A;  4DA4 A;  5LJ3 d;  4E7J A;  1Y71 A;  4RTT A;  1N8R U;  5KYU B;  4XQ3 A;  4GLK A;  2L3P A;  4A4E A;  2VGM A;  3CME Q;  2MMP A;  2XDD A;  4Z8A A;  5FRN A;  1K9A A;  5FW9 A;  2EQK A;  5GJW B;  2F2W A;  4R0K A;  2I2L A;  3CD6 A;  1M8V A;  2EJG A;  2JT4 A;  4BE1 A;  2O4X B;  3JAM E;  3OB9 A;  1NBE B;  4M7A F;  3CBM A;  3QWX X;  5GAN 8;  1WGS A;  3P8D A;  3O8V A;  3OQ5 A;  4IIM A;  3TEE A;  1HD3 A;  4C5I A;  1M1G A;  2FRY A;  1OV3 A;  2VUB A;  2JMA A;  5D6W A;  1K73 R;  2PVO B;  1B34 A;  3CCM Q;  1CKB A;  2RHI A;  2QQB A;  1SSF A;  2QA4 A;  3CC2 T;  2QAZ A;  2HZY A;  1MNE A;  2D0N A;  2DXC A;  3A8M B;  3EG3 A;  3TVT A;  2AZV A;  1Q82 U;  1YHQ T;  3CCU T;  2HQE A;  3CCE Q;  1MMN A;  3MP8 A;  1WHG A;  3SFM A;  1IGU A;  2EBP A;  4E2F B;  3CCR T;  2KDS A;  4MMK A;  2CP5 A;  3VUB A;  2G6F X;  4OB2 B;  4BD3 A;  1M90 U;  4E6R A;  4MZP A;  5I2S A;  1R77 A;  2DBM A;  4FM4 B;  1X2K A;  5GAN 3;  4RTW A;  4QVD A;  2RO0 A;  4PK4 A;  1UE9 A;  4BE2 A;  1D09 B;  2LCL A;  3JSC A;  2HL3 A;  1MHN A;  2E6N A;  2KAF A;  4ZN1 A;  2RB6 A;  3KFV A;  1GCQ C;  3EH2 A;  2JTF A;  1UEC A;  3MEW A;  3OYM A;  3G1J A;  2EPD A;  1I4K 1;  2P0P A;  2E12 A;  1Q95 G;  5CO7 A;  1X2Q A;  3M58 A;  1YHQ Q;  1FWZ A;  1K8A R;  2ED0 A;  4JJN K;  1WHL A;  2YDL A;  3R6O A;  1RI9 A;  3CCJ T;  3CCR Q;  4IKF A;  4BY6 C;  3RMQ A;  4E7I A;  5GAM h;  1U06 A;  5HCK A;  4JPB W;  2NUZ A;  2LQK A;  1WI7 A;  3INZ A;  4M7A A;  3E2U A;  2HKQ B;  2ZPB B;  4BY6 B;  2CP2 A;  2GBQ A;  2GTJ A;  3A8O B;  2RM4 A;  3QKJ A;  4LDU A;  1VQ7 T;  1VQ4 A;  2KQW A;  2K9G A;  3M0U A;  4AFU C;  1PWT A;  2HDA A;  3X25 B;  3V7S A;  3HFN A;  4X9C A;  4QQ6 A;  5J39 A;  5HK0 A;  2M1H A;  2HD0 A;  2BTT A;  3CCQ T;  5J26 A;  2ROT A;  4JDS A;  1PRL C;  2RJD A;  1D1C A;  3G6E A;  3OYG A;  4XTV A;  4M7A B;  2H3J A;  1H3H A;  5GAO n;  1AWO A;  2DA9 A;  3L2V A;  3OW2 S;  1X6O A;  4X1V A;  2QQA A;  3MO8 A;  3LH0 A;  1VUB A;  1JJ2 S;  4C92 G;  1N9S A;  3FC3 A;  5D6X A;  4XU1 A;  3SWN A;  2E10 A;  4Z89 A;  4P5N A;  2V26 A;  2KVQ G;  3DB4 A;  5A0L A;  5IT9 E;  2YT6 A;  1RAC B;  2IPO B;  3CC2 A;  2FL7 A;  3VS6 A;  4ME7 A;  3QZ9 B;  1D3B A;  2VXF A;  2K6D A;  3M59 A;  5CQY A;  3LGL A;  3QHS A;  4N4G A;  2FB7 A;  3EG2 A;  4GLM A;  4K11 A;  3SWN C;  4FYX B;  3CCU A;  1OX8 A;  2OTL T;  2NYS A;  1TWB A;  4PFO A;  1LCK A;  3NFC A;  1TH7 A;  4ZNX A;  4C8Q E;  3I56 T;  3CBP A;  1VQ6 Q;  4M75 G;  1UGQ B;  2KBT A;  1MV3 A;  3RKY A;  3OYJ A;  1QVG S;  2VGN A;  3EFR A;  2DD5 A;  3REA B;  3SWN B;  3F70 A;  4KRT A;  1YN8 A;  3PIO A;  4XTX A;  1EX4 A;  1LPL A;  3V8L A;  1YJN Q;  4AG1 C;  1JRI A;  2L0A A;  3SD4 A;  1ZA2 B;  2ZPE B;  4A4K A;  1D3B B;  1GBQ A;  1WJS A;  2DMO A;  1GXI E;  4ELY C;  2V8J A;  4LD9 K;  1WXT A;  5IH2 A;  2G3R A;  1MMG A;  4KUL A;  3ULR B;  1GCP A;  2KRO A;  2M0Y A;  2R5M A;  4E7K A;  1VQ5 A;  2E1H A;  2DFU A;  3UT1 A;  1W2B S;  2NWM A;  2O31 A;  1VYT A;  4C92 D;  1BYM A;  2PTK A;  3CCJ A;  2XHC A;  2YLC A;  1RI0 A;  1VQP T;  1WXB A;  1Y57 A;  4QQG A;  3TU4 K;  4HCC A;  2NUP A;  1M3C A;  4M78 G;  2CS7 A;  2QGF B;  3UF4 A;  3HRS A;  2JTE A;  1IB8 A;  1OU8 A;  4C8Q C;  5IXB A;  2PNI A;  3NMZ C;  3EGD A;  2QAS A;  2AZS A;  4MZM A;  3J7A F;  1HSQ A;  2CUD A;  1U3O A;  2ENM A;  1M1F A;  2K4Y A;  1VQ7 A;  1EIF A;  3N5B B;  1YCY A;  3PMI A;  2VYT A;  1V76 A;  1CSK A;  4HKE A;  2K79 A;  4IUU A;  1WJQ A;  2M02 A;  1YWP A;  3RKX A;  4EPC A;  3HKS A;  1S72 T;  2F69 A;  4ZGD B;  1UHF A;  5C0M A;  1K9M C;  3CCQ A;  3M0T A;  5GAM f;  3MEV A;  5LL6 S;  5A0G A;  2XDB A;  4M77 F;  3CC4 T;  2BZX A;  2NUP B;  3CXC S;  4J6X A;  3VS3 A;  1AWJ A;  1N9R A;  3G71 Q;  4OML A;  2JS0 A;  1UFF A;  3EGD B;  5GAM g;  3PVL A;  5GAM e;  3V7R A;  2RJE A;  5KYY A;  3QPH A;  2HQH A;  5FRO A;  4LXC A;  2WSE E;  5J3B A;  1WQW A;  2EYZ A;  2KYB A;  1UB4 A;  4KUI A;  4OB1 B;  4XTZ A;  4ANJ A;  4J83 A;  4CC7 A;  4O5V A;  1PC0 A;  4FT4 A;  1BK2 A;  3MHX A;  5LJ3 h;  1NJI C;  4AFQ C;  2KRS A;  1FXX A;  1OX9 A;  3EGX A;  4M78 D;  3QG1 A;  2J6K A;  4XU0 A;  2CYZ B;  4JS5 A;  2D6F A;  4F7U E;  1ABO A;  2Y90 A;  2EGC A;  2QEX T;  1KD1 R;  2OTL A;  3OY9 A;  2X3X D;  5KYW A;  1TUD A;  4DQ2 A;  1Y96 A;  2ZPG B;  4F04 B;  4ATO A;  1WIE A;  3H0I A;  1OI1 A;  5DY9 A;  3I56 A;  1SKU B;  5KYY B;  3CCS T;  4ZTF A;  2JNG A;  1MMA A;  5GAO r;  4RTY A;  2P4T A;  2B8A A;  2RMO A;  5IXF A;  4D8K A;  4DBF A;  2HQX A;  2RHY A;  1YIT T;  3S3M A;  4FYV B;  3JCM Q;  2ZCF B;  2KT1 A;  4F7U A;  5A2Q E;  3MEA A;  3MP1 A;  5HY6 A;  3KXT A;  4E7H A;  3EGX B;  3H41 A;  4J9D A;  2LT4 A;  1GFC A;  1U5S A;  2PVD B;  1UJY A;  4RMO A;  2LX9 A;  2KSS A;  4PLL A;  3M54 A;  3VKI A;  1IRX A;  1K9M U;  1MGQ A;  4FCY A;  5KYW B;  1Y96 B;  3CC7 A;  4J7F A;  2JUF A;  4M77 A;  4PKC C;  4L59 A;  1IO6 A;  4Z88 A;  1VQP A;  2DL7 A;  1WX6 A;  3PFS A;  4X9D A;  3M0Q A;  5GAM j;  4PJO G;  5GMK h;  3H0H A;  1BB9 A;  1AVZ C;  1Q86 R;  1NZ9 A;  1W70 A;  2P0K A;  4D8D A;  3QWY A;  3E19 A;  2RN8 A;  3JB9 I;  5DLO A;  3A1P A;  2LC4 A;  3M0R A;  4F7U B;  4KUD K;  4PL6 A;  2X9H A;  1N8R R;  1NPP A;  3X20 B;  5KE3 A;  2OX7 A;  3QXE B;  1JXO A;  2LJ3 A;  2LCC A;  1RLP C;  2E5Q A;  1G83 A;  4WTO B;  2VB6 A;  1NLO C;  2MF2 A;  3BW1 A;  2ESW A;  4QQD A;  4EMH A;  2FPD A;  1NJI U;  2MYS A;  1G3W A;  1ZSZ A;  1S72 A;  4KBM B;  2AK5 A;  4M77 B;  4JS4 A;  4J6W A;  2QQS A;  3QYG B;  3BE3 A;  4IUR A;  1UGS B;  3CC4 A;  2RQW A;  2YUO A;  2LQN A;  4HCK A;  3WVE B;  4DOV A;  2LDM A;  2J6F A;  2WAC A;  1PSE A;  4BDY A;  3THK A;  3V7C A;  1OU9 A;  1I5O B;  5KYU A;  4CC4 B;  1GBR A;  2DL8 A;  3CME T;  1GL5 A;  2QK0 A;  3A8G B;  4OMQ A;  2BE7 D;  1T3L A;  4FIB A;  4X34 A;  2AIR B;  2VC8 A;  3A8L B;  1MMD A;  8AT1 B;  3LWI A;  2JS2 A;  1ZHI A;  2RH2 A;  3CPW A;  4XTU A;  4RG2 A;  1ZSZ B;  4AT1 B;  2CP0 A;  3OYH A;  5LJ5 h;  3OS2 A;  3FLG A;  3GOX A;  3Q1J A;  2VV5 A;  1M3A A;  2YWW A;  4RCC A;  2ECZ A;  2DJQ A;  4BI3 A;  7AT1 B;  1WHM A;  2K2V A;  4RTX A;  2EWN A;  4FU6 A;  2QEX A;  1M90 R;  1BIB A;  3C0C A;  2D8J A;  3NPF A;  2R58 A;  2FPF A;  2ZZD A;  3CCM T;  2HNI A;  1PCX A;  1T3S A;  4OB3 B;  2DZC A;  4XU3 A;  1BI3 A;  4HVW A;  4IUQ A;  3CCS A;  4FW2 A;  3I35 A;  2DYI A;  4FYW B;  1VQL A;  1PRM C;  1Y7X A;  2HSE B;  1WHK A;  2EKH A;  1RAI B;  2P4R A;  4PJL A;  3PMT A;  1VQ8 T;  3EFO A;  1YIT A;  1Q7Y C;  1E6H A;  2Y4X A;  3QDF A;  3HHT B;  4XU2 A;  3CMA A;  5LJ3 f;  1VQM Q;  2RHZ A;  3CCE T;  1TU0 B;  3OSS C;  4J6Y A;  5I22 A;  3ER0 A;  2F2X A;  2DK3 A;  3E9G A;  1QWF A;  1QVF A;  1WXU A;  5IHI A;  2MWP A;  2SEM A;  4HVV A;  1PD1 A;  5LJ3 g;  4Y91 A;  5I11 A;  2EW3 A;  5LJ3 e;  4C92 E;  2EYY A;  4MML A;  2KGT A;  4PJM A;  2GQV A;  2RQR A;  2E5K A;  2E64 A;  3RER A;  1VIE A;  1BI0 A;  3H9N A;  3UWN A;  3QUI A;  1K0X A;  4BUG A;  1VQK Q;  3RIR A;  5IHK A;  2GTO A;  1SHF A;  1VQ8 Q;  2DYB A;  3EFO B;  4OMP A;  4OMM A;  1IXD A;  4N4H A;  2ZPF B;  3LWH A;  1BCM A;  1XOV A;  3JCM h;  5GAO l;  2KEA A;  4B9X A;  4M7D G;  2XG8 D;  1GCQ A;  4OMN A;  3U23 A;  2RI5 A;  1AZG B;  2XDP A;  1H3Z A;  1K1Z A;  4FL6 A;  2GNC A;  1SHG A;  4LDY A;  2RQU A;  1E6G A;  2M51 A;  1TUG B;  1SG5 A;  3HTR A;  3RNJ A;  2ZAE A;  2YHT A;  2EJ9 A;  1KQ2 A;  2YRC A;  4M75 E;  1HYO A;  3OYD A;  1P92 A;  2E41 A;  4B9W A;  4RTV A;  1PKS A;  4C92 C;  3CCL Q;  2LMJ A;  4C0F A;  1WZO A;  1WYX A;  1X01 A;  4ZN3 A;  2O2O A;  3EHQ A;  1SSH A;  1I5L A;  2P0Q A;  2LX7 A;  1WNL A;  4DEY A;  5GMK e;  2LJ1 A;  3JB9 G;  3OYK A;  3CME A;  1FYN A;  5CK9 A;  4DEX A;  1BIA A;  2JTM A;  1M4Z A;  3GIB A;  1SEM A;  3G7Z A;  1Q7Y U;  1KG1 A;  2EIF A;  2QTX A;  2ED1 A;  4MZT A;  1OQK A;  4JLI A;  1YI2 T;  2YUN A;  2EQU A;  2VAS A;  3E9F A;  3OYY A;  3LH5 A;  4BI8 B;  5LJ3 j;  4M78 E;  1ABQ A;  1KQS S;  3T9N A;  2PZ1 A;  2OAW A;  4IIO A;  3QDR B;  1N5Z A;  2BUD A;  5CAI A;  2KI7 A;  3VS4 A;  3HP9 A;  4LDW A;  1J3T A;  2JJ9 A;  2V1R A;  2RJC A;  1YJ9 T;  1NEG A;  5C6S A;  5LJ5 d;  2OTJ Q;  3CCM A;  2K3Y A;  2XIC A;  3M0P A;  4M7D D;  2Z0W A;  1G2B A;  2DVJ A;  1A0N B;  4C8Q F;  5GMK l;  3RR6 A;  4JRQ A;  3JCM J;  1KQ1 A;  2LRQ A;  4LN2 A;  1NYG A;  1YI2 Q;  2K7A A;  2ZPH B;  2E4H A;  2L2P A;  2JZ2 A;  2FYK A;  3L42 A;  3VRZ A;  1RAB B;  3DB3 A;  2QXF A;  5GAN h;  3CCE A;  3PE0 A;  4MDW A;  5A0D A;  2L5Q A;  4BB7 A;  3PGG A;  1G3T A;  3PTA A;  2DEU A;  1QQJ A;  4IUV A;  1VQ6 T;  4RTZ A;  1YCS B;  1U1T A;  5CKD A;  3S3O A;  1T0H A;  1YJ9 Q;  5L23 A;  1MND A;  4M78 C;  4ZTJ A;  4CI0 C;  3LX7 A;  3QSU A;  3JB9 D;  3CPW P;  3KUF A;  3PT9 A;  2DE0 X;  2YUP A;  3UDC A;  1EFN A;  2E70 A;  1Q81 R;  1YJN T;  3ZFJ A;  3MEU A;  1KJW A;  2K3X A;  2COY A;  4HXJ A;  2K57 A;  3EG9 A;  3OMC A;  2EYX A;  3NGP A;  4DBH A;  4F14 A;  1RAF B;  2CDT A;  1YHQ A;  2YRV A;  2JM9 A;  2CT4 A;  2LT1 A;  3EH1 A;  1WFW A;  3DLM A;  1NE8 A;  3CCR A;  4KH0 B;  3VU3 C;  3V8J A;  3JCM V;  3RMS A;  2AKL A;  2CKK A;  2FO0 A;  1RAH B;  2RNA A;  1ZUU A;  1YIJ Q;  2DIL A;  3UA6 A;  3QZ5 B;  3JCM d;  1MV0 B;  2W0Z A;  1G5V A;  5CVI A;  1M9S A;  4PFZ A;  3TCJ A;  2XKO C;  5CIU A;  2H3E B;  4J9B A; 
#chains in the Genus database with same CATH homology
 4M75 A;  3ASK A;  1BI2 A;  4DQ2 A;  3LYI A;  1Y96 A;  1WQ7 A;  2ZPG B;  3OYA A;  4RCB A;  3OYL A;  4ATO A;  3CBO A;  1OI1 A;  2NLU A;  1M90 C;  1VQN A;  2X4J A;  4E47 A;  4XTY A;  2O4X A;  1IRE B;  5DY9 A;  3I56 A;  2DTI A;  4QVC A;  3CCS T;  4ZTF A;  2JNG A;  3CPW S;  1KC8 U;  1VQ9 A;  5GAO r;  2GCX A;  1VQ5 T;  2P4T A;  4M7A G;  2B8A A;  4M7D B;  4C8Q A;  5I21 A;  1O75 A;  3L2R A;  3LLR A;  1VQM A;  1V29 B;  5FU7 C;  3FRN A;  1W2B A;  2HQX A;  2RHY A;  1YIT T;  3S3M A;  1Q86 U;  5GMK m;  1WJR A;  3JRZ A;  1VQ4 T;  3HRT A;  3JCM Q;  4NL3 A;  2V8K A;  2ZCF B;  2L8D A;  4DA4 A;  3M4G A;  4F7U A;  4ZGJ B;  5GAN 2;  5A2Q E;  1BKB A;  3MEA A;  4M75 C;  3MP1 A;  5LJ3 d;  4E7J A;  1K73 U;  5HY6 A;  1Y71 A;  3KXT A;  1N8R U;  2XU8 A;  4E7H A;  4XQ3 A;  1M5Q 1;  4GLK A;  3OY9 A;  3OSV A;  2JOY A;  2LT4 A;  4A4E A;  2VGM A;  1LNX A;  2MMP A;  5FU7 B;  5GAN 5;  5GMK i;  3LW5 E;  2XDD A;  2PVD B;  4RMO A;  5GAN 7;  2CZ7 B;  5HKC A;  3G71 T;  2KY9 A;  4PJO E;  5FRN A;  2EQK A;  2LX9 A;  2XD0 A;  2KSS A;  4PLL A;  3M54 A;  3GNF B;  3VKI A;  4UC4 A;  4BI4 A;  1K9M U;  2O01 E;  2RD1 A;  2I2L A;  1MGQ A;  3OS0 A;  2GF7 A;  4M75 B;  1VQK A;  1Y96 B;  4LDV A;  3CD6 A;  1M8V A;  3C95 A;  2EJG A;  2KMT A;  3CC7 A;  4J7I A;  1VQ8 A;  4J7F A;  2JUF A;  4M77 A;  4M78 A;  4L59 A;  2DTH A;  4PKC C;  4F7U F;  2O4X B;  4BE1 A;  3JAM E;  1VQP A;  3OB9 A;  2MAM A;  3PFS A;  1VIF A;  4X9D A;  5GAM j;  2DXU A;  4PJO G;  4M7A F;  3CBM A;  5GMK h;  3PIP A;  4M7A C;  5GAN 8;  2QDY B;  1WGS A;  2VXE A;  3P8D A;  4C8Q B;  5LJ5 f;  3L2U A;  4HCB A;  5HK3 A;  3O8V A;  3HSB A;  3JCM c;  3OQ5 A;  3VUZ A;  3TEE A;  3C4S A;  1NZ9 A;  4C5I A;  3OYI A;  1M1G A;  2P0K A;  2ZPI B;  4OMF B;  5DM7 R;  1QVF S;  2K5L A;  5GAO q;  3E19 A;  1QP2 A;  3JCM W;  3JB9 I;  5I2M A;  5DLO A;  2VUB A;  2LC4 A;  4M75 D;  5D6W A;  3QO3 A;  2A3L A;  2PVO B;  4F7U B;  1B34 A;  1JB0 E;  1G3S A;  2EFI A;  1OZ3 A;  4PL6 A;  5KH6 A;  3CXC A;  3JB9 J;  4KUD K;  3QJY A;  5LJ5 g;  5FU6 C;  5L8R E;  1YIJ T;  5LJ5 e;  4J8O A;  1NPP A;  2RHI A;  3OBY A;  3X20 B;  5KE3 A;  3H8Z A;  2QQB A;  3QXE B;  3JCM P;  1SSF A;  1HXD A;  2LCC A;  2QA4 A;  3CC2 T;  3OYB A;  2E5Q A;  5KCO A;  2Y4Y A;  2DVE A;  3J80 E;  4HT8 A;  2AHJ B;  2MF2 A;  1Q81 C;  5GAO p;  3CPF A;  3BW1 A;  4L6V 5;  5EG2 A;  2DXC A;  3A8M B;  5GMK j;  4QQD A;  4EMH A;  3URG A;  4O6J A;  4TVR A;  1NJI U;  1G3W A;  2LVM A;  4LDX A;  1S72 A;  4KBM B;  3WVD B;  3CCL A;  1UGP B;  4M77 B;  4M78 B;  4J6W A;  4A4G A;  3CCU T;  4JS4 A;  2QQS A;  5CQX A;  2MI6 A;  3KBG A;  4QW2 A;  4BAC A;  4MDX A;  1K8A U;  2HQE A;  3QYG B;  4PJO F;  4RKU E;  3MP8 A;  2KK4 A;  2ZGW A;  4PJO C;  3SFM A;  4IUR A;  1UGS B;  3NTK A;  3CC4 A;  3CCR T;  3X28 B;  5GAN d;  2KDS A;  4N0A C;  2DIQ A;  4MMK A;  2BIV A;  3VUB A;  4OB2 B;  3OA6 A;  4BD3 A;  2A7Y A;  3WVE B;  5CKE A;  4DOV A;  5IAY A;  2LDM A;  1YJN A;  1VQ6 A;  2WAC A;  1PSE A;  5AYF A;  4BDY A;  1M90 U;  4MZP A;  4KT0 E;  3V7C A;  5I2S A;  4C0D C;  4PNO A;  4FM4 B;  1JBM A;  5GAN 3;  2XID A;  4QVD A;  2RO0 A;  2BKD N;  3CME T;  3DLL A;  4BE2 A;  2EQM A;  2LCL A;  3A8G B;  3JSC A;  4JLG A;  1MHN A;  5IN1 A;  2E6N A;  2FVU A;  2DEQ A;  4FIB A;  3SDZ A;  3OYE A;  2KAF A;  4ZN1 A;  2RB6 A;  4X34 A;  4OP0 A;  1I8F A;  2VC8 A;  3A8L B;  4C0G A;  2JTF A;  1I81 A;  3MEW A;  4JRK A;  4C0D B;  4NOY A;  2RK2 A;  3LWI A;  1ZHI A;  3OYM A;  2RH2 A;  3CPW A;  1I4K 1;  2P0P A;  4RG2 A;  4XTU A;  2E12 A;  1YHQ T;  1UEB A;  5FLX E;  1VQO T;  1QVP A;  5CO7 A;  3OYH A;  3M58 A;  3SB2 A;  3FLG A;  5LJ5 h;  1FWZ A;  5GAN 4;  3VYG A;  3OS2 A;  2DKG A;  4JJN K;  3GOX A;  3Q1J A;  2VV5 A;  4OGC A;  3R6O A;  2OTJ A;  4XAX B;  3JCM f;  1FX7 A;  4RCC A;  3CCJ T;  2CZ6 B;  4IKF A;  4L5G A;  4HCZ A;  2X35 A;  4BY6 C;  1PSF A;  4BI3 A;  2WSC E;  1AHJ B;  3RMQ A;  4E7I A;  2K2V A;  2EWN A;  1W4S A;  4FU6 A;  2RI2 A;  5GAM h;  2DO3 A;  2QEX A;  1BIB A;  4IUP A;  3P8B B;  2L3R A;  2R58 A;  2M9U A;  2ZZD A;  3CCM T;  2HNI A;  2LQK A;  3INZ A;  4OB3 B;  3JCM g;  2DZC A;  4M7A A;  4XU3 A;  3OS1 A;  1YI2 A;  1BI3 A;  3JCM e;  4IUQ A;  3G4S T;  2CZ1 B;  3CCS A;  4BDZ A;  2ZPB B;  2PU9 B;  4BY6 B;  3M4Y A;  5CKH A;  1VQL A;  5LJ5 j;  2D0Q B;  3A8O B;  3M56 A;  4VUB A;  3FB9 A;  1Y7X A;  3OYF A;  1KG1 A;  2RM4 A;  4JUV A;  3CD6 T;  3FEO A;  5DLQ E;  3PMT A;  3CC7 T;  2IVW A;  1VQ8 T;  3QKJ A;  1YIT A;  2K5I A;  4LDU A;  1Q7Y C;  1WPY A;  2DJZ A;  2X4W A;  2Y4X A;  1X75 C;  4A4F A;  1VQ4 A;  2KQW A;  3QJ6 A;  1VQ7 T;  3HHT B;  3X25 B;  1U1S A;  3VYH B;  4XU2 A;  1YJW T;  3CMA A;  5LJ3 f;  3V7S A;  2RHZ A;  2X4X A;  3CCE T;  3HFN A;  3OSS C;  4J6Y A;  3ER0 A;  4GY5 A;  1YJ9 A;  4X9C A;  4QQ6 A;  5J39 A;  5HK0 A;  2DK3 A;  2M1H A;  2DPP B;  3E9G A;  2HD0 A;  1QVF A;  5CKB A;  3LGF A;  2MWP A;  3HFO A;  2LTO A;  3CCQ T;  1Q81 U;  5J26 A;  1XTD A;  3G71 A;  3JB9 H;  2L89 A;  2RI3 A;  4Q5W A;  4A4H A;  2CGH A;  2XK0 A;  4NL2 A;  4JDS A;  5LJ3 g;  4Y91 A;  2RJF A;  5GAM d;  2MWO A;  2RJD A;  5LJ3 e;  4C92 E;  2FHD A;  3G6E A;  3OYG A;  4PJO A;  4MML A;  4XTV A;  4M7A B;  2GQV A;  2H3J A;  4N4I A;  4N0A A;  4Y28 E;  4C5E A;  3L2Q A;  5GAO n;  1DJ7 B;  1OZ2 A;  2E64 A;  3RER A;  2F5T X;  1VIE A;  2DIG A;  3L2V A;  3OW2 S;  3M57 A;  1BI0 A;  1X6O A;  3BDL A;  3QUI A;  3UWN A;  3ZEH A;  1QW1 A;  2QQA A;  3L1A A;  3LH0 A;  1VUB A;  3MO8 A;  3QYH B;  3RIR A;  4BUG A;  1N9S A;  2DTO A;  4C92 G;  5CCA A;  1JJ2 S;  4M7D E;  3A5Z B;  3C12 A;  3FC3 A;  4EMK C;  5FRM A;  3C94 A;  5D6X A;  5M9O A;  1ZQ1 A;  1QP3 A;  4N4H A;  2DZ9 A;  2ZPF B;  5FU6 B;  4XU1 A;  3LWH A;  2EJF A;  3J81 E;  1LOJ A;  3SWN A;  2E10 A;  1XOV A;  4P5N A;  3BDU A;  3OS5 A;  3PNW C;  3JCM h;  2KVQ G;  4M7A D;  2E6Z A;  2WSF E;  3DB4 A;  5GAO l;  4LD6 A;  1YIJ A;  1R8O B;  4B9X A;  5A0L A;  4M7D G;  2RK1 A;  1H64 1;  2XG8 D;  2PQW A;  3ME9 A;  5IT9 E;  3JCM X;  3CCV T;  2RI5 A;  2XDP A;  3OBW A;  3CC2 A;  1H3Z A;  2FL7 A;  4FL6 A;  1U8R A;  2PUO B;  4LDY A;  2OAU A;  4OGE A;  4ME7 A;  3QZ9 B;  1D3B A;  2YHT A;  2QI2 A;  2EJ9 A;  3RES A;  2VXF A;  3M59 A;  4YTL A;  3GNG A;  2R57 A;  5CQY A;  4JRI A;  3LGL A;  1KQ2 A;  4M75 E;  4PJO B;  3QHS A;  4N4G A;  2FB7 A;  3I55 T;  3SWN C;  3CCU A;  4NS5 A;  3OYD A;  4DOW A;  1P92 A;  2OTL T;  4EDU A;  3FDR A;  1M1K C;  2E41 A;  4B9W A;  1KD1 C;  4C92 F;  5GAN f;  1VQN T;  4V2S A;  4C8Q E;  3NFC A;  1TH7 A;  4C92 C;  3I56 T;  3HPW A;  3CBP A;  3DKM A;  3M5A A;  1UGQ B;  4M75 G;  4XTW A;  4C0F A;  3HRU A;  3OYJ A;  3RKY A;  1VQ9 T;  3CEY A;  1X01 A;  1XNI A;  3S6W A;  4ZN3 A;  2VGN A;  4QVZ A;  3EFR A;  3QBY A;  4D6W A;  4E7L A;  2DD5 A;  1QVG S;  1I5L A;  2P0Q A;  4OF1 A;  3SWN B;  3F70 A;  1VQM T;  4PJO D;  3QII A;  2CZ0 B;  2DAQ A;  3JCM b;  1WNL A;  5GMK e;  5GAN g;  3PIO A;  3JB9 G;  4M7D F;  4XTX A;  1Y07 A;  3NTH A;  4FSX A;  5GAN e;  3OYK A;  4C8Q G;  5CK9 A;  5KCH A;  3CME A;  4M7D C;  1BIA A;  2JTM A;  1M4Z A;  3EAE A;  3V8L A;  3GIB A;  2RHU A;  3G7Z A;  1N27 A;  3AHU A;  2YLB A;  3BY7 A;  3WXM B;  1JRI A;  3SD4 A;  2EIF A;  2QTX A;  4C5H A;  1Q7Y U;  2ZPE B;  4MZT A;  2IG0 A;  4JLI A;  4A4K A;  1YI2 T;  2EQU A;  3VJP A;  1D3B B;  4F7U G;  1WJS A;  1KHI A;  1GXI E;  3E9F A;  3OYY A;  3OYC A;  4ELY C;  2V8J A;  3MCA B;  4LD9 K;  5GAN 6;  1RL2 A;  2G3R A;  3P8H A;  4KUL A;  4BI8 B;  2GFU A;  3BFM A;  1KQS A;  1VQO A;  1VQL T;  5LJ3 j;  3X24 B;  2EYQ A;  2R5M A;  4HA8 A;  4M78 E;  4M77 E;  4E7K A;  4C0Z A;  3HL8 A;  1KQS S;  3T9N A;  3FIF A;  2E1H A;  4PLI A;  1VQ5 A;  3UT1 A;  1W2B S;  3QDR B;  1VQK T;  4C92 D;  1BYM A;  2BUD A;  3GF5 A;  3CCJ A;  1HK9 A;  5CAI A;  2XHC A;  2YLC A;  4XK8 E;  5CR2 A;  3S3N A;  1RI0 A;  1VQP T;  3HP9 A;  1XQH A;  4LDW A;  4M75 F;  2D9T A;  3MP6 A;  2RA2 A;  3CMA T;  2F5K A;  2RJC A;  1YJ9 T;  2QQR A;  4QQG A;  3TU4 K;  4HCC A;  4RG8 A;  5C6S A;  4M77 G;  4M78 G;  2CS7 A;  4A53 A;  5LJ5 d;  1KC8 C;  4R56 A;  3CCM A;  3HRS A;  1O9S A;  2GFA A;  2K3Y A;  1KHC A;  2XIC A;  3JB9 F;  4M7D D;  2EKO A;  4C8Q F;  5GAO m;  5GMK l;  4C8Q C;  3G4S A;  4EMK A;  1Q86 C;  2M16 A;  4CRI A;  4JRQ A;  3JCM J;  1LJO A;  1KQ1 A;  2LRQ A;  3G6E T;  2HBP A;  1OYX A;  5D6Y A;  2C06 A;  2JVV A;  2V8I A;  4MZM A;  1K73 C;  4FT2 A;  3J7A F;  2ZPH B;  1M1F A;  2K4Y A;  1N8R C;  2QA4 T;  1VQ7 A;  2DXB A;  3RUX A;  1EIF A;  2JZ2 A;  3L2W A;  2FYK A;  3N5B B;  3L42 A;  1YCY A;  3PMI A;  3OW2 A;  2E65 A;  2VYT A;  3DB3 A;  2QXF A;  1YJW A;  3UPU A;  3EFS A;  5GAN h;  1IZ6 A;  3TRE A;  3CCE A;  1JJ2 A;  1Q82 U;  1ZBX A;  4HKE A;  3GP8 A;  3L2Z A;  4MDW A;  2L5Q A;  4IUU A;  3M53 A;  1G3T A;  3PGG A;  4BB7 A;  5A0D A;  3PTA A;  1WJQ A;  3A8H B;  3RKX A;  3V8K A;  3GLX A;  4EPC A;  3HKS A;  1S72 T;  2F69 A;  4ZGD B;  5C0M A;  3CCL T;  4IUV A;  1K9M C;  1VQ6 T;  3CCQ A;  5CKD A;  1U1T A;  4J5Y A;  3S3O A;  2LNV A;  5GAM f;  3MEV A;  1YBY A;  3OYN A;  5LL6 S;  1G3Y A;  5A0G A;  2XDB A;  4M77 F;  4M78 F;  3CC4 T;  3CXC S;  4M78 C;  4M77 C;  4ZTJ A;  4CI0 C;  3LX7 A;  5CKF A;  3X26 B;  3QSU A;  2K5F A;  3JB9 D;  4J6X A;  3M9Q A;  4C8Q D;  4WF2 A;  3KUF A;  3PT9 A;  1N9R A;  2M0O A;  3VV0 A;  3UDC A;  4C92 A;  2E70 A;  1M1K U;  1YJN T;  4OVA A;  1KD1 U;  3ZFJ A;  2PUK B;  4EMK B;  4A54 A;  3MEU A;  5GAM g;  3E1S A;  1NPR A;  2EAY A;  2K3X A;  5GAM e;  5GAN j;  4JRP A;  2K57 A;  4BE0 A;  3MET A;  3OMC A;  3V7R A;  2RJE A;  3QPH A;  4Z02 A;  5FRO A;  4C5G A;  4OB0 B;  2WSE E;  4M7D A;  1YHQ A;  2YRV A;  5J3B A;  3OMG A;  4EMG A;  1WQW A;  3ZBD A;  1UB4 A;  3H6Z A;  2LT1 A;  4KUI A;  4OB1 B;  4XTZ A;  4HT9 A;  4J83 A;  3DLM A;  4O5V A;  2X4Y A;  1UGR B;  1NE8 A;  3CCR A;  2HAX A;  4ZGE B;  4FT4 A;  3VU3 C;  3V8J A;  3JCM V;  2LQ8 A;  3RMS A;  1QVG A;  3CCV A;  4IUT A;  3MHX A;  1N6A A;  2CKK A;  5LJ3 h;  1NJI C;  2PVG B;  2DXT A;  1FXX A;  1B34 B;  4R55 A;  3RKW A;  3FJP A;  3QG1 A;  4M77 D;  4M78 D;  4XU0 A;  4ELZ C;  1Q82 C;  5KE2 A;  2CYZ B;  2XI9 A;  4JS5 A;  2OTJ T;  1K8A C;  3NTI A;  3QZ5 B;  3JCM d;  2D6F A;  4F7U E;  2Y90 A;  2EQJ A;  2JN0 A;  3I55 A;  1BI1 A;  2R5A A;  3M55 A;  4M7A E;  1G5V A;  5CVI A;  4II1 A;  2QEX T;  1M9S A;  4C92 B;  3TCJ A;  2RHX A;  2XKO C;  5CIU A;  2OTL A;  2DD4 A;  2QQ9 A;  3GPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...