1W4SA

Crystal structure of the proximal bah domain of polybromo
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
146
structure length
146
Chain Sequence
b'MYHVGDYVYVEPAEANLQPHIVCIERLWEDSAGEKWLYGCWFYRPNETFHLATRKFLEKEVFKSDYYNKVPVSKILGKCVVMFVKEYFKLCPENFRDEDVYVCESRYSAKTKSFKKIKLWTMPVSSVRFVPRDVPLPVVRVASVFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POLYBROMO 1 PROTEIN
publication title Crystal Structure of the Proximal Bah Domain of the Polybromo Protein
pubmed doi rcsb
source organism Gallus gallus
molecule tags Nuclear protein
total genus 30
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1w4sA00
4DA4A 2FVUA 4JJNK 4DOWA 2FL7A 4DOVA 4KULA 4LD9K 4KUIA 1W4SA 4FT4A 1ZHIA 4FSXA 1M4ZA 1ZBXA 3PTAA 4FT2A 3PT9A 3TU4K 4BB7A 4KUDK
chains in the Genus database with same CATH superfamily
3EGDA 4DA4A 4XAXB 1PNJA 3JCMc 4DBRA 4QQGA 1K73U 3L2VA 2HAXA 1D0ZA 1RAAB 3EG3A 3RIRA 4HA8A 2NYSA 4M7AA 1YI2T 1JB0E 1SF9A 2VKNA 3OYKA 1Q81C 2JXBA 3SFMA 2BZXA 3P8HA 1VQ7A 1NJIR 3HRUA 1X2KA 1AWOA 4XTVA 4EPCA 1YBYA 4QVDA 1W2BA 3EH1A 3HSBA 5KE2A 4Z88A 1WHLA 3CCUA 5CVIA 2FRYA 4RG2A 2DVEA 4IUTA 5LJ3g 3I55T 1YJNT 1DJ7B 3CD6A 3M0SA 2L3QA 2X4JA 1V76A 1Q7YU 3SDZA 4J9DA 4WF2A 1YIJQ 5KYXB 4LDUA 4F7UE 1M5Q1 5KCOA 2WSFE 4DBFA 1Y96A 2DBMA 4KULA 4A4HA 3OYAA 4M7DG 3M0TA 4OB1B 3A8LB 1G3SA 1TOVA 4N4IA 1AEYA 1D1AA 1HYOA 3OSVA 4ZN3A 2HEQA 3E9FA 2FG0A 2W10A 4C8QF 4E6RA 4XU3A 5LJ5d 2XU8A 4IKFA 2CT4A 3VS1A 4C92F 4Z89A 3JSCA 4M77A 2KRNA 2ZPBB 2VC8A 2L2PA 2A3LA 2QGFB 4PJOF 4PL6A 4EIKA 4UC4A 2PU9B 4N0AA 1IREB 1OULA 3OYCA 2V1RA 2KGTA 2QXFA 3FEOA 4J6WA 3ASKA 1NYGA 1S1NA 1MV0B 5GANf 1NLPC 2RI3A 1YJWA 5GAOp 2A36A 1JU5C 4NL2A 2J7IA 4IUQA 2KBTA 3ME9A 2LZ6B 3JRZA 2COZA 4F14A 4ZN1A 3G71Q 1EX4A 2KEAA 5LJ3d 1RAIB 1JJ2S 2DILA 1OV3A 2ZPGB 1M1FA 2D0NA 3PMTA 4M78F 1YITQ 1QKWA 1KC8U 4HCZA 1ZQ1A 1GL5A 2QEXQ 1ZUUA 3CCMQ 2M02A 4PFOA 4OMPA 3CCSA 1M8VA 3QXEB 4L6V5 4QT7A 3CC4A 2SRCA 1MHNA 5A2QE 2HMAA 3M56A 3EFOA 4M7AG 4PK4A 2W0ZA 4JRKA 1B34B 3JB9H 4K11A 5CKHA 4AFZC 3LWIA 1MGQA 1AVZC 2ZPEB 4QVCA 1PSEA 3DKMA 2DK3A 1NG2A 3JCMW 3G6EA 1CKAA 2CZ0B 3CCUT 3LGLA 2KR3A 1RLPC 2A0FB 3CXCS 4ME7A 1RI9A 4A4GA 1GBQA 1TTHB 3JCMJ 2FPDA 1Q82C 1VQKQ 2XD0A 2G6FX 2MCNA 1B07A 1W1FA 2EAYA 3CCVA 1M4ZA 3UT1A 5GMKi 2CDTA 2RMOA 4RCBA 3CCRQ 1UEBA 5KYUA 2ROTA 1GCQC 3A8HB 3V8LA 1BIAA 1BKBA 2A28A 1BB9A 1YHQA 3M4GA 2KSSA 4C8QA 4ZGJB 4BI3A 2DJZA 5GAN7 1QVGA 2J05A 1ZBXA 4Z8AA 1YN8A 4C92A 5FWBA 1OPLA 2CH4W 1M30A 1U3OA 1IO6A 2HL3A 2L8DA 2M16A 1FXXA 4HCBA 3RDVA 1KQSP 2JTEA 4MMLA 3E9GA 2RK1A 4E2FB 2KMTA 2RN8A 4M77G 4M75D 1U1SA 1TXQA 1PHTA 4AG1C 1SSFA 5HKCA 1VQ6Q 1BI0A 4F7UA 2XMFA 2RO0A 5FU7C 5CKEA 3GPLA 1Q86C 1QCNA 2I2LA 2VYTA 1B7TA 3RR6A 5FLXE 2FL7A 2AKLA 2EGEA 1WHGA 4M75B 4A4FA 1YJWT 1UECA 5GMKj 3X26B 1WXUA 3E1SA 1M90U 5GANj 1VQ9Q 1G3WA 1NJIC 3X25B 3BW1A 4ZNXA 5A0DA 1JQQA 3C12A 3QJYA 2IVWA 3CMAA 3ZEHA 3PGGA 2MI6A 1JXOA 3EHQA 4J6YA 1OOTA 4Y91A 1N6AA 1VIFA 1CSKA 3CCEA 4J5YA 1ZUYA 2AT1B 5IHNA 1YNZA 3TSWA 1SG5A 2X51A 3QWXX 3CCST 2COYA 3VYGA 4BY6B 3CC4T 1QCFA 1D0XA 1KD1R 1AWXA 1QQJA 3GP8A 5CCAA 3I56A 1HXDA 3GF5A 3PVQA 3EFSA 4LNPA 3OS2A 2E3IA 1K9AA 5GAN6 4JLGA 3L2ZA 4RMOA 3CC2Q 2ZPIB 4OB3B 1JJ2A 2DZCA 2LQ8A 2YUQA 2JUFA 5KYXA 2JMCA 4OMFB 1PM3A 2KNBB 1MMAA 2D6FA 2NWMA 3CCVT 2HZYA 5GJVB 3S3NA 2CS7A 2VV5A 2X4WA 2FO0A 4XK8E 3L2WA 1GBRA 4ORZA 4M75E 3MEUA 3NTHA 5FWCA 6AT1B 4FSXA 2HSPA 2M0YA 2DXTA 3THKA 1QP2A 2EYQA 1WLPB 1M2OA 3E19A 1VUBA 5M9OA 1BBZA 3PMIA 1TU0B 1RL2A 4NS5A 4FCYA 2DLPA 1S72Q 4MDXA 1YHQT 3V7SA 2F2VA 4XTWA 4B9WA 2VGNA 1WYXA 2PTKA 2PVOB 1WXBA 1VQOQ 3CXCA 2CUDA 1H92A 3EHRA 3RESA 3NTIA 4CI0C 2YUPA 1RACB 1SRLA 2OTJQ 3P8BB 2K3YA 1SPKA 2K7AA 5LJ5h 3M4YA 3CMEQ 3RERA 1LVKA 5I2MA 5GMKe 2HNIA 3C95A 5D6XA 3ZBDA 1PG5B 2BUDA 1K8AR 2KRSA 2KRMA 5GANe 2XDDA 3NGPA 2R5AA 1QLYA 4A4KA 3CC7T 4RTVA 3OYNA 4ANJA 3FB9A 2LT4A 2FZKB 2NUTA 2QQAA 4XTYA 3MP1A 1BI3A 1QMCA 3QUIA 1IZ6A 4DQ2A 2EGCA 2O9SA 1M27C 5CR2A 3DB4A 2GFAA 2ZCFB 5CKFA 2RQVA 2EKOA 2JOYA 5D6WA 1ACMB 1WGSA 1WPYA 4C5HA 2QG9B 4OMMA 3CMAT 4FT2A 2O9VA 1WHMA 2DVJA 1Q81U 2E5QA 5GAOm 5DY9A 1OU9A 2PNIA 3M55A 3QYHB 4BD3A 2RA2A 3CCET 5GMKm 2GBQA 3JCMQ 4DOVA 1Z9ZA 2JT4A 4JS4A 2JW4A 1KQSS 1B34A 1U06A 3CBPA 3MEWA 1OX8A 1PD0A 1RAFB 2EIFA 1KSWA 1TUDA 4EMGA 1FMKA 2VVKA 1G3YA 2GF7A 2QGGA 1BU1A 3M5AA 3I56T 1NLOC 4XQ3A 4J9EA 2E10A 3QWYA 2DL7A 1LJOA 2Y4YA 1VQNQ 3CCLQ 2ED0A 2ROLA 3PIPA 4RTYA 2O31A 4PJOD 5D7UA 5GAOq 4EMKB 4C8QB 1Q82R 1UUEA 4TVRA 2QI2A 4QW2A 1NZ9A 3O5ZA 3X24B 3JCMP 1YIJA 2RQRA 2BE9B 4WCIA 1WA7A 3I5SA 2HL5C 4CC3A 1NPRA 2HDAA 4PJOB 2BIVA 2K2MA 5GANg 4J8OA 4AFUC 3VS6A 2KYBA 1FMVA 2CP6A 2DL5A 1NBEB 2DXCA 1VQ5Q 5EC7A 5KE3A 3JB9J 1T3LA 2DMOA 2XDPA 4DEXA 1V1CA 2RJDA 4J9GA 1ZSZB 3ZFJA 1VQ8T 3NMZC 4BDZA 2HQHA 2JNGA 3OYJA 4QKUA 1N5ZA 4BDYA 1C1AA 3VS5A 4BE0A 3S3MA 3OS1A 2P0PA 3LH5A 2L5QA 2HQEA 2RH2A 4C0ZA 3QIIA 4ATOA 4QVZA 2K4YA 2HQXA 4M78B 1Q86R 4M75A 2QQ9A 2EQKA 1W6XA 3V8KA 4WTOB 1N9RA 4JS5A 4JZ3A 1UHFA 4C8QE 3FIFA 4PLIA 2ATCB 2RPNA 2C0IA 1I8FA 2DE0X 3CCJQ 1YJNQ 1I1JA 3GBQA 1YCYA 1KD1C 4C92E 4D6WA 1HSQA 4OB0B 4OGCA 1C6VX 5ECAA 1RUWA 1FMWA 1G83A 1KHIA 4M7DC 3JCMd 1G5VA 3G71A 2OI3A 2E6ZA 4PJOE 2D8JA 2DETA 2H8HA 5GAN3 4YTLA 2LNHB 1K4US 1M3AA 3MP8A 1OQKA 4LD6A 1Z9QA 2DBKA 1VQPT 3CCMA 2EFIA 2E3HA 2MMPA 2E6NA 2VXEA 3MHXA 4OVAA 4OMOA 4KGVB 1JO8A 1YWOA 1Q82U 5GANd 1WXTA 3UWNA 2XKOC 3QJ6A 1R0CB 1PKSA 4KGZB 4FYVB 1D0YA 4JJBA 1GCPA 1TS9A 2QA4A 4BI8B 2F5TX 2MAMA 2YLCA 2C0TA 4PJLA 1OYXA 1SHFA 1K0XA 1F1BB 1ZBJA 1M2VB 2VB6A 3SD4A 1A0NB 2LX7A 4M78E 3OSSC 1IGQA 3REBB 3LLRA 3UPUA 1YIJT 3QDRB 2NUPB 4IUPA 1N8RR 3EG9B 1KQSA 4RTTA 3OYFA 3TQ7P 1YJ9T 3CCRA 1U1TA 1XOVA 2EYZA 2P0KA 4BE1A 3DLMA 2QK0A 2KI7A 3WVDB 9ATCB 1K8AC 1VQLT 1T0HA 1PC0A 2JVVA 2NUZA 1GCQA 1MV3A 2PQWA 3RBBB 2J6KA 1Y71A 2RI2A 2K5FA 4PNOA 4DBQA 2DIQA 1M1KC 2RJEA 2NUTB 4E7KA 2CKKA 4M7AC 1Q86U 2HBPA 2JN0A 2KY9A 2DEUA 3HP9A 3CPWS 2BZYA 4BUGA 3N5BB 1X43A 3EAEA 3QG1A 1C0MA 3ULRB 5GAMf 2EVRA 3I5RA 2AHJB 4FYXB 1W70A 1XJWB 2JZ2A 1VQ6A 1B3QA 1NJIU 3FDRA 1WQWA 1VQ4A 2RQTA 2KVQG 1KJWA 3QO3A 2J06A 1GRIA 2DD5A 4X9DA 4HT9A 1M3BA 1K73C 2X3WD 1AHJB 2LCSA 4A53A 2FHDA 1OEBA 3EGXB 5LJ5f 2JMAA 1VQ7T 1T0JA 4V2SA 4NOYA 4JDSA 2R57A 3G71T 3V7RA 1Y0MA 4FIBA 1I07A 4M7DD 2MOXA 3J81E 1XNIA 2XDBA 1K0SA 4F04B 2QTVA 1O9SA 3MCAB 3CD6T 2ZZDA 5GAOr 2GFUA 3LWHA 1CKBA 2B8AA 4LUDA 3OS5A 2DJQA 1NPPA 2P4RA 4L59A 2HCKA 3PT9A 1Q7YC 2FRWA 1X6OA 2DM1A 2EQUA 3FJPA 5KYWB 2K9GA 4M7DB 2DO3A 1UGRB 2LCLA 4XTZA 4C0GA 2VWFA 4M77C 5GAOl 1X75C 2YRDA 2CP7A 4OP0A 2RJFA 2X3XD 1LOJA 5CIUA 1TG0A 1UE9A 4L5GA 4EMKA 4J9IA 2QA4T 4HT8A 3L2RA 3WVEB 2LJ0A 3CC2A 1PWTA 4PJJA 4N0AC 3LGFA 1UB4A 2RNAA 3RUXA 2HD0A 4P5NA 5FU6C 2X35A 2E1HA 3L1AA 2F5KA 2FZGB 2DL8A 4PJOA 3EFRA 5FW9A 2WSCE 4PJMA 1TUGB 2AIRB 1Y07A 4FT4A 3JB9G 3OW2P 1I4K1 2EBPA 2E41A 1BCMA 4O5VA 3OA6A 3MEAA 1S72A 2DTHA 1ZSZA 1KQ1A 3CBMA 1WHJA 2L89A 5EG2A 2DTOA 4BE2A 2FZCB 2I0NA 5IHIA 3SWNC 2MWOA 1KQ2A 2HKQB 2DKGA 4AFSC 1JXMA 3TVTA 2YRVA 1YP5A 2OTJA 1SSHA 3HFNA 3A8OB 3FC3A 3ER0A 2GCXA 1M3CA 1IHVA 2D9TA 4FW2A 1I5OB 3CMEA 3OS0A 2CZ6B 4PKCC 4M78A 2HKNA 2ENMA 4LDXA 3FRNA 3OYLA 2V26A 3BE3A 4FSSA 3PFSA 4HCKA 2RJCA 2FB7A 1VQ4T 5GAMj 3CCQQ 2IIMA 1D1CA 5GJWB 4KT0E 3V8JA 3A8GB 4JUVA 2RQUA 2DRKA 4RCCA 5GAN5 3J7AF 2KXDA 3HHTB 1N9SA 4PLLA 2LJ1A 4E7SA 3F70A 1VQMQ 2ZAEA 4ZTJA 2DA9A 4LDYA 2K6DA 4Q5WA 2VASA 3G6ET 5LJ5j 3I35A 1UFFA 1BI1A 3VS2A 1R77A 1I81A 2YT6A 3JCMh 1AD5A 3X20B 3OYBA 2FVUA 1M1GA 2OJ2A 3S6WA 4KRTA 2XICA 5CKBA 2V8IA 1YHQQ 3A1PA 3META 2D1XA 1N8RC 4HVUA 1ZA1B 2A08A 2J6OA 2LTOA 1FYNA 5CAIA 4M7DF 5GMKh 1YFNA 1MNDA 1PRLC 1IXDA 4FYYB 4OMLA 1NEBA 1JRIA 1M2VA 5GANh 4JJDA 4C5GA 2KDSA 1X69A 2KYMA 3MPUB 3UDCA 3REAB 3CC2T 1VQNA 4X1VA 2QASA 1IRXA 4C8QG 1X01A 1QW1A 4J83A 2EJFA 2CSQA 2EPDA 2NUPA 3EG9A 1QVPA 2QYZA 4ELYC 3HRTA 4KGXB 4C92G 2OX7A 2OTLA 2AZSA 2V8KA 1N27A 2G3RA 4GBQA 4KH1B 2CH4A 3CC7Q 2GQIA 1QVGP 1Q95G 2LC4A 1ZX6A 4LD9K 4O6JA 1VA7A 1ZUKA 2K57A 1S72T 3RMSA 2ESWA 2DXUA 2XI9A 2YDLA 1VQ5A 3FLGA 1ABOA 4JJCA 4F7UG 2JTFA 2Y90A 2A7YA 3VRZA 2M9UA 3L42A 1QVFP 2F2WA 3CMAQ 1M1KR 4CRIA 2LX9A 3M58A 3PVLA 5GAMe 3LX7A 1OZ3A 1TSFA 3H8ZA 5J26A 2YUOA 3CCEQ 2K79A 3H6ZA 3CMET 2XK0A 4GY5A 5FU7B 1K76A 1TUCA 3M9QA 4M78G 1MNEA 1KD1U 4RUGA 3G4SQ 2KT8A 4C5IA 3VS4A 4AFQC 5LJ3h 3GLXA 3I56Q 3VRYA 2LNVA 2GTJA 3EGXA 4M7AF 5LJ5e 1UJ0A 1K73R 1K9MC 3BFMA 1D09B 2CREA 5J3BA 3QZ5B 5GAN2 4A54A 3M57A 2R58A 3OW2S 3CCJA 4FU6A 2JM9A 2EYXA 4Z02A 4AT1B 2WSEE 3CPWP 4D8KA 2E5KA 4LUEA 2ZPFB 3RKYA 2CP2A 2ZGWA 1EZZB 5D6YA 2B86A 3MKDA 1TWBA 3G1JA 1PRMC 3SHWA 2RM4A 3TSZA 2KXCA 4IUUA 5KYWA 3LH0A 3OBYA 4M7DA 3H9NA 1G2BA 4M4ZA 3L2UA 3D7SB 1Q7YR 1O75A 1GFCA 2PUOB 3FJ5A 1IGUA 4IURA 2CP5A 4JJNK 1PD1A 4J7IA 1E6HA 1UGVA 2D0QB 1W4SA 5A0GA 1V29B 3R6NA 3JB9I 4A63B 3MP6A 1VQ8Q 3O8VA 2F1LA 3BY7A 4X9CA 1WHKA 4IIOA 3QSUA 1VQNT 4LE9A 2YHTA 2LRQA 2KROA 2CZ1B 2XHCA 3UA6A 5GAMg 1K8AU 3OYMA 3HTRA 5CKDA 2OTLT 5I22A 2JTMA 4XTUA 3JB9F 4M77F 2FPFA 2DX1A 4OMQA 3M54A 3PTAA 3DLLA 1MMNA 2RF0A 1QCOA 4LDVA 1M1KU 4LN2A 3J80E 1YI2Q 3TCJA 4EDUA 1WQ7A 4PJNA 1HK9A 5LJ5g 2RHXA 2YWWA 1VQ5T 2P4TA 4VUBA 1FX7A 5KH6A 4J9CA 1I5LA 1WX6A 2EWNA 4N4HA 2O2OA 5IHKA 1E7OA 2SEMA 1JBMA 2VGMA 1D3BB 1PSFA 2JM8A 5KCHA 5I11A 1X6BA 3IQLA 5GAOn 3I55Q 2LQKA 1KHCA 3JAME 2YUNA 2DL3A 2VUBA 2K5IA 1VQPQ 4AG2C 2P84A 1YCSB 1BK2A 8AT1B 1IB8A 3OQ5A 1RAHB 2CT3A 2OAUA 4IIMA 2GGRA 1YITA 2XIDA 3VKIA 5IAYA 1R8OB 2QEXA 1KC8R 5HK0A 2AKKA 2YSQA 4CC7A 2KQWA 1QVGS 3OBWA 2CUBA 3CCJT 4JZ4A 3NHNA 2M0OA 2H3JA 4C0DC 2DPPB 1AWWA 3RKWA 3RMQA 2MYSA 4FM4B 3VS0A 4ZGDB 3ZL7C 1NEGA 2DERA 2LDMA 2LCCA 2M1HA 2LP5A 4QQ6A 1YJ9Q 3OYYA 3PNWC 4RTUA 5GAMd 2C06A 1QVFS 1UHCA 3X28B 2YXYA 4PFZA 2QDYB 1VQKA 2X4XA 1BYMA 2PVDB 3CQTA 1VQLQ 2GQVA 3VS3A 3NFCA 1WZOA 2JJ9A 1VYVA 2BKDN 4LXCA 3OW2A 2C0OA 2H3EB 2V1QA 1HD3A 3JCMV 4C0FA 4E7HA 5C0MA 2DEQA 2IPOB 1Y57A 3JCMf 2L3PA 2KT1A 1X27A 3HKSA 4M75C 3EG0A 2ZPHB 5IXBA 5CO7A 2E4HA 2E70A 5HK3A 1OI1A 1WJSA 4XU0A 4Y28E 2RHZA 4A4EA 5C6SA 2ECZA 2EQJA 1T3SA 4F16A 4R56A 1MMDA 2O88A 4F7UF 1VYTA 1UG1A 4CC4B 4PFPA 2F69A 3C94A 4NL3A 3M0PA 4E47A 3JV3A 2QDLA 2D8HA 2X9HA 3EGUA 1VQ7Q 2DD4A 5IN1A 4KUDK 2CZ7B 4M75G 4BY6C 4E7ZA 1Y7XA 3QDFA 4F17A 3VS7A 3P8DA 1UGPB 1QWEA 3EG1A 3CCUQ 1NYFA 3JCMX 3CD6Q 1VQ9A 3SWNA 1M90R 3GIBA 2CGHA 2DNUA 3INZA 2AZVA 3OYGA 5FRNA 5AYFA 4E7IA 4XTXA 4FW1A 4JRQA 5KYYB 1VOMA 1YITT 4HXJA 2J6FA 5FRMA 3CCQA 2RHUA 1K9MR 2QEXT 2K2VA 3GNGA 4Y92A 3CCMT 4R55A 2EQMA 5LL6S 1SRMA 2QA4Q 1W2BP 3OYEA 2YLBA 3JCMb 3U23A 3VV0A 4ELZC 2A37A 4GLKA 3TREA 3MO8A 1VQMA 1EIFA 2K3XA 1G3TA 2RHIA 1N8RU 3UA7A 1ABQA 5GMKl 4J9HA 1YWPA 4RG8A 2K5LA 3RKXA 1XTDA 2DZ9A 2IG0A 5IT9E 4J6XA 2EKHA 3SB2A 2WACA 4GLMA 5LJ3f 2LQNA 3EH2A 4MZPA 3H41A 1KG1A 5KYNA 1VQKT 1H3ZA 2O4XB 2GTOA 4DOWA 5CQYA 2OAWA 2DAQA 4EMHA 3G7ZA 5GAN8 4C0DB 2EJ9A 3CCRT 1AOJA 2ABLA 1ZHIA 3OB9A 2DF6A 2MF2A 3LYIA 2KAFA 2PUKB 1P92A 2VXFA 1WNLA 2HSEB 1YJWQ 3M59A 1BCOA 2QAZA 1IHWA 2CYZB 1NE8A 4MDWA 4HCCA 3HL8A 1VQOA 1QVFA 5FROA 3EG2A 3TEEA 5IXFA 5L8RE 3M0QA 3M53A 1LNXA 2Y4XA 4MMKA 4JLIA 2EYWA 2EGAA 4M7AD 1VQ4Q 3CC7A 3NPFA 4M7DE 3A8MB 4RTWA 3CCSQ 3EGDB 3H0IA 3CC4Q 2MPXC 1VQ6T 2P0QA 3AT1B 1M9SA 1RAGB 2CP0A 1D3BA 4M7AB 7AT1B 3BDLA 5J39A 1SHGA 4E7JA 2MK5A 3DB3A 1KC8C 1JEGA 3G6EQ 1H8KA 2L3SA 1K1ZA 2EW3A 3VYHB 1PCXA 4B6MA 1LPLA 4JRIA 3OMGA 1G8XA 1VQ9T 2DYBA 5HY6A 1AT1B 3CPWA 1K9MU 2DXBA 2BTTA 1UTIA 5HCKA 2L3RA 3CCVQ 4ZGEB 2LT1A 5GAN4 2LQWA 3HRSA 3BDUA 4EMKC 4C8QC 1Q81R 3G4SA 2X4YA 3GOXA 2LVMA 4DEYA 4JRPA 1HJDA 3UF4A 3OYDA 4MZMA 3CCQT 3MEVA 3HFOA 4C92C 2O01E 4CC2A 3RNJA 4R0KA 1LCKA 1AZEA 1Y96B 4OMNA 1QKXA 3OMCA 1UGSB 2COWA 2ED1A 1OU8A 5A0LA 4PJOC 1OX9A 2EQIA 1PKTA 3H0FA 2HBWA 4KH0B 3I9QA 1UDLA 2KK4A 1VQMT 5DLOA 2PVGB 4M77D 3JB9D 2QTXA 1AWJA 1U5SA 4IUVA 1TH7A 1MUZA 3Q1JA 3CBOA 3CCLA 1ZSZC 3A5ZB 1KIKA 3V7CA 4J7FA 2DL4A 1GFDA 1BI2A 2RB6A 3PE0A 2E65A 5GAMh 2XG8D 1WJRA 2K3BA 4M7AE 3TU4K 4M77B 4N4GA 3OY9A 4OGEA 3L2QA 5LJ3j 4II1A 4PJOG 5AT1B 1X6GA 1UJYA 1VYUA 4KUIA 3JCMe 2MIOA 4FYWB 4QQDA 4DBHA 1VQ8A 3UATA 4M78C 3HPWA 3KFVA 2V8JA 1MMGA 5FU6B 1OZ2A 4HVVA 3M0UA 3VUBA 1VQOT 1VIEA 2EJGA 1WDXA 1W2BS 2DYIA 1KK7A 8ATCB 4E7LA 2OTJT 1WFWA 4LDWA 2DTIA 1E6GA 1H3HA 4RTXA 1M90C 1H641 2LJ3A 2L0AA 4ESRA 1GXIE 2BZ8A 1RAEB 4J9BA 2M51A 4RTZA 1XQHA 2PZ1A 1YI2A 1UGQB 4M75F 4MZTA 1D1BA 3SWNB 4BB7A 2DFUA 1EFNA 2GNCA 2RD1A 5DLQE 3SEMA 2CP3A 2YRCA 3AHUA 3KXTA 5CQXA 2RQWA 3EFOB 2FEIA 1RLQC 3A98A 4BI4A 1QWFA 2DIGA 4J9FA 3WXMB 1SEMA 3E2UA 2CSIA 3VUZA 3I55A 4M77E 1YJNA 4XU2A 2QQSA 1ZSGA 5I21A 1R0BG 4HVWA 4HKEA 5KYYA 3QPHA 1SKUB 2F2XA 3KUFA 1VQPA 3R6OA 3NTKA 4ZTFA 3QHSA 2JS2A 1WIEA 3G4ST 1WHHA 1KFZA 1WJQA 1BIBA 4C8QD 3MJXA 1ZLMA 3T9NA 3VU3C 5IH2A 2RHYA 4RKUE 1WI7A 4C92D 5KYUB 3QKJA 2FPEA 2RI5A 4KBMB 3JCMg 4D8DA 5CK9A 1OPKA 2NLUA 3QZ9B 2Z0WA 1JJ2P 4FL6A 3QYGB 3PIOA 2KE9A 4AMCA 3C4SA 5LJ3e 2OTLQ 4B9XA 5I2SA 3QBYA 4C92B 2O4XA 3CCLT 4OF1A 1YJ9A 2QQBA 1RABB 1QP3A 4BACA 2R5MA 4XU1A 3OYIA 2E64A 2MWPA 4OB2B 1ARKA 3H0HA 1X2QA 1VQLA 2EYYA 2LMJA 2QQRA 3S3OA 1FWZA 3M0RA 2FYKA 3C0CA 2DRMA 1I0CA 2RK2A 4F7UB 3LW5E 3CXCP 4C5EA 1NM7A 2E12A 2JS0A 1U8RA 1AZGB 5L23A 4JPBW 1J3TA 4M78D 5DM7R 3OYHA 2BE7D 3CPFA 3CEYA 3URGA 1RADB 1M8MA 4X34A 1RI0A 1ZA2B 3GNFB 2AK5A 3VJPA 3KBGA
chains in the Genus database with same CATH topology
2CZ7B 2CZ6B 4M78A 4PKCC 1BI3A 4DA4A 3QUIA 1IZ6A 4M75G 4DQ2A 4LDXA 4XAXB 4BY6C 1Y7XA 3FRNA 3OYLA 5CR2A 3DB4A 3JCMc 2GFAA 4QQGA 3P8DA 1K73U 1UGPB 2ZCFB 5CKFA 2EKOA 3L2VA 2HAXA 2JOYA 3PFSA 2RJCA 2FB7A 5D6WA 1VQ4T 3RIRA 4HA8A 1WGSA 5GAMj 4M7AA 1WPYA 1JB0E 3JCMX 1YI2T 4C5HA 3CMAT 4FT2A 4KT0E 3V8JA 3OYKA 1Q81C 1Q81U 3A8GB 1VQ9A 2E5QA 3SWNA 5GAOm 4JUVA 5DY9A 3SFMA 1VQMA 1VQ7A 3P8HA 3GIBA 2CGHA 3M55A 3HRUA 4RCCA 5GAN5 3INZA 3QYHB 4XTVA 2RA2A 4BD3A 3OYGA 4EPCA 3CCET 3J7AF 5FRNA 1YBYA 5AYFA 4E7IA 4XTXA 4JRQA 5GMKm 4QVDA 1W2BA 3HSBA 5KE2A 3JCMQ 4DOVA 3HHTB 1N9SA 4PLLA 3F70A 4JS4A 4ZTJA 1KQSS 1B34A 5CVIA 3CCUA 1YITT 3CBPA 3MEWA 4LDYA 4RG2A 2DVEA 4IUTA 5LJ3g 2EIFA 3I55T 1YJNT 5FRMA 3CCQA 2RHUA 4Q5WA 1DJ7B 3G6ET 3CD6A 5LJ5j 4EMGA 2QEXT 2K2VA 3GNGA 3CCMT 2X4JA 1BI1A 1G3YA 2GF7A 4R55A 2EQMA 5LL6S 3M5AA 3I56T 1Q7YU 3SDZA 1I81A 3JCMh 4WF2A 4XQ3A 3X20B 2E10A 3OYEA 2YLBA 3OYBA 2QA4T 4LDUA 4F7UE 1M5Q1 5KCOA 2WSFE 3JCMb 2FVUA 3VV0A 1LJOA 4ELZC 1M1GA 2D6FA 3S6WA 4GLKA 2Y4YA 2XICA 1Y96A 3MO8A 1EIFA 2V8IA 4KULA 2K3XA 3META 5CKBA 3TREA 3PIPA 4A4HA 1G3TA 3OYAA 2RHIA 1N8RC 1N8RU 4PJOD 2LTOA 5GAOq 4EMKB 4C8QB 5CAIA 4M7DF 5GMKl 4TVRA 2QI2A 4QW2A 4RG8A 5GMKh 4M7DG 2K5LA 4OB1B 3RKXA 3A8LB 1XTDA 2DZ9A 2IG0A 1G3SA 1NZ9A 4J6XA 5IT9E 3SB2A 2WACA 4N4IA 3X24B 5LJ3f 3JCMP 1YIJA 3OSVA 4MZPA 4ZN3A 1JRIA 1KG1A 5GANh 1VQKT 1H3ZA 2O4XB 3E9FA 4C5GA 2KDSA 3UDCA 4DOWA 4C8QF 3CC2T 1VQNA 5CQYA 4C8QG 1NPRA 1X01A 1QW1A 2DAQA 4J83A 3G7ZA 4XU3A 2EJFA 4EMHA 5LJ5d 5GAN8 4C0DB 2BIVA 4PJOB 5GANg 2XU8A 2EJ9A 4J8OA 3CCRT 4IKFA 1QVPA 1ZHIA 3OB9A 4KUDK 4ELYC 4C92F 3HRTA 4C92G 2MF2A 2DXCA 3LYIA 2KAFA 2PUKB 3JSCA 1P92A 4M77A 2OTLA 2VXFA 2ZPBB 2VC8A 5KE3A 1WNLA 3JB9J 2V8KA 2XDPA 1N27A 3M59A 2A3LA 4PJOF 2RJDA 2G3RA 4PL6A 2CYZB 3ZFJA 1NE8A 2LC4A 4MDWA 1VQ8T 4UC4A 2PU9B 4N0AA 4BDZA 4HCCA 2JNGA 3HL8A 1VQOA 4LD9K 1IREB 1QVFA 4O6JA 3OYCA 5FROA 3OYJA 2K57A 1S72T 3RMSA 3TEEA 5L8RE 2QXFA 3FEOA 4BDYA 2DXUA 4J6WA 2XI9A 3M53A 1LNXA 3ASKA 3FLGA 2Y4XA 1VQ5A 4F7UG 5GANf 4MMKA 2RI3A 4JLIA 4BE0A 2JTFA 2Y90A 3S3MA 1YJWA 3OS1A 4M7AD 2P0PA 2A7YA 5GAOp 2L5QA 2HQEA 2M9UA 2RH2A 4NL2A 3L42A 3CC7A 4C0ZA 4M7DE 3QIIA 4ATOA 4CRIA 2LX9A 4IUQA 4QVZA 3M58A 2K4YA 3A8MB 2HQXA 4M78B 4M75A 2QQ9A 2EQKA 3LX7A 3ME9A 1OZ3A 3JRZA 3V8KA 5GAMe 3H8ZA 4ZN1A 1VQ6T 5J26A 2P0QA 1M9SA 1N9RA 4JS5A 3H6ZA 5LJ3d 3CMET 2XK0A 1JJ2S 4C8QE 1D3BA 3FIFA 4PLIA 4GY5A 5FU7B 4M7AB 2ZPGB 1M1FA 3BDLA 1I8FA 3PMTA 5J39A 4M78F 3M9QA 4E7JA 4M78G 3DB3A 1KC8C 1KC8U 4HCZA 1KD1C 1YCYA 1KD1U 1ZQ1A 4C92E 4D6WA 4C5IA 4OB0B 4OGCA 3CCSA 3VYHB 1M8VA 3QXEB 5LJ3h 3GLXA 4L6V5 3CC4A 2LNVA 1MHNA 1KHIA 4M7DC 5A2QE 3M56A 3JCMd 4JRIA 3G71A 3OMGA 4M7AF 5LJ5e 1G5VA 2E6ZA 4M7AG 4PJOE 1VQ9T 5GAN3 1K9MC 5HY6A 3CPWA 1K9MU 4JRKA 2DXBA 4YTLA 1B34B 3JB9H 3BFMA 5J3BA 2L3RA 5CKHA 3LWIA 3QZ5B 4ZGEB 2LT1A 4A54A 5GAN2 3M57A 1MGQA 5GAN4 2ZPEB 2R58A 3HRSA 1PSEA 3BDUA 3DKMA 3MP8A 4LD6A 4QVCA 3CCJA 2DK3A 3OW2S 4EMKC 4C8QC 4FU6A 3G4SA 3JCMW 2X4YA 3G6EA 3GOXA 1VQPT 2LVMA 4Z02A 3CCMA 2CZ0B 3CCUT 2WSEE 2EFIA 4JRPA 3LGLA 3OYDA 4MZMA 3CCQT 3MEVA 2MMPA 3CXCS 2E6NA 3HFOA 2VXEA 3MHXA 4ME7A 4C92C 2O01E 4OVAA 2ZPFB 3RKYA 4A4GA 2ZGWA 3JCMJ 1Q82C 1Q82U 5GANd 3UWNA 1Y96B 2XKOC 2XD0A 3QJ6A 3OMCA 5D6YA 1UGSB 2EAYA 3CCVA 5A0LA 1M4ZA 3UT1A 2RM4A 5GMKi 4PJOC 4IUUA 4RCBA 3LH0A 3OBYA 4M7DA 2QA4A 4BI8B 1UEBA 2F5TX 2KK4A 3L2UA 2MAMA 1VQMT 3A8HB 3V8LA 5DLOA 2YLCA 2PVGB 1O75A 4M77D 1OYXA 3JB9D 2PUOB 2QTXA 4JJNK 4IURA 4IUVA 1TH7A 1BIAA 1BKBA 3SD4A 4J7IA 4M78E 3OSSC 3Q1JA 3CBOA 1YHQA 3CCLA 2D0QB 1W4SA 3M4GA 2KSSA 3A5ZB 1V29B 4C8QA 5A0GA 3LLRA 4ZGJB 3UPUA 3V7CA 4J7FA 3JB9I 3QDRB 4BI3A 1YIJT 2DJZA 5GAN7 1BI2A 3MP6A 4IUPA 1QVGA 1KQSA 3OYFA 2RB6A 3O8VA 1ZBXA 3BY7A 4X9CA 1YJ9T 2E65A 4C92A 5GAMh 3CCRA 2XG8D 1WJRA 1U1TA 1XOVA 4M7AE 3QSUA 1VQNT 3TU4K 4M77B 2L8DA 4N4GA 2YHTA 2LRQA 2M16A 3OY9A 4OGEA 3L2QA 2P0KA 5LJ3j 4II1A 2CZ1B 4BE1A 2XHCA 3DLMA 1FXXA 4PJOG 4HCBA 5GAMg 3WVDB 1K8AC 1K8AU 3OYMA 1VQLT 5CKDA 2OTLT 4MMLA 4KUIA 3JCMe 3E9GA 2JTMA 2JVVA 4XTUA 2RK1A 3JB9F 2KMTA 4M77F 4QQDA 2PQWA 4M77G 4M75D 4M78C 1VQ8A 1U1SA 3HPWA 1Y71A 3M54A 2RI2A 2K5FA 2V8JA 3PTAA 3DLLA 5FU6B 1SSFA 4PNOA 5HKCA 1BI0A 1OZ2A 4F7UA 2DIQA 4LDVA 3VUBA 1M1KC 1M1KU 1VQOT 2RO0A 2RJEA 1VIEA 2EJGA 3J80E 4E7KA 2CKKA 5FU7C 5CKEA 3GPLA 4M7AC 3TCJA 4EDUA 1Q86C 1Q86U 2I2LA 2HBPA 1W2BS 2JN0A 2KY9A 1WQ7A 3HP9A 1HK9A 2VYTA 5LJ5g 2RHXA 4E7LA 1VQ5T 5FLXE 2FL7A 2OTJT 3CPWS 2P4TA 4BUGA 3N5BB 4VUBA 1FX7A 3EAEA 4M75B 3QG1A 4LDWA 4A4FA 5KH6A 1YJWT 5GAMf 5GMKj 1I5LA 3X26B 2DTIA 2AHJB 2EWNA 4N4HA 3E1SA 2JZ2A 1M90C 1H641 1M90U 1VQ6A 1JBMA 2VGMA 1D3BB 5GANj 1G3WA 1NJIU 1PSFA 3FDRA 1WQWA 3X25B 3BW1A 5KCHA 1VQ4A 1NJIC 2KVQG 5A0DA 1XQHA 1YI2A 5GAOn 3C12A 1UGQB 3QJYA 4M75F 4MZTA 3SWNB 3QO3A 2IVWA 2LQKA 4BB7A 3CMAA 2RD1A 1KHCA 3ZEHA 3PGGA 3JAME 2DD5A 5DLQE 4X9DA 4HT9A 1K73C 2MI6A 1AHJB 2VUBA 4J6YA 2K5IA 4Y91A 3AHUA 3KXTA 1N6AA 2FHDA 4A53A 1VIFA 3CCEA 5CQXA 4J5YA 5LJ5f 1VQ7T 4V2SA 4BI4A 3OQ5A 2DIGA 3WXMB 2OAUA 4NOYA 3CCST 1GXIE 1YITA 2XIDA 3VYGA 4BY6B 3VKIA 3CC4T 3VUZA 4JDSA 3I55A 4M77E 1YJNA 2R57A 4XU2A 3G71T 3V7RA 2QQSA 5IAYA 1R8OB 4FIBA 2QEXA 5I21A 5HK0A 4M7DD 3J81E 4HKEA 1XNIA 3GP8A 2XDBA 5CCAA 3I56A 1HXDA 3GF5A 1O9SA 3MCAB 3QPHA 1VQPA 3KUFA 3CD6T 2KQWA 3R6OA 3OBWA 1QVGS 3EFSA 2ZZDA 3OS2A 5GAOr 3NTKA 2GFUA 3CCJT 3QHSA 4ZTFA 3LWHA 2B8AA 3G4ST 1BYMA 5GAN6 1WJQA 3OS5A 1BIBA 2M0OA 4JLGA 4C8QD 2H3JA 3L2ZA 4RMOA 4C0DC 1NPPA 2ZPIB 4OB3B 2DPPB 4L59A 3T9NA 1JJ2A 3PT9A 3RKWA 3RMQA 2DZCA 1Q7YC 2LQ8A 4FM4B 2JUFA 3VU3C 1X6OA 2EQUA 4ZGDB 3FJPA 4M7DB 2RHYA 2DO3A 4OMFB 1UGRB 2LDMA 2LCLA 4RKUE 2LCCA 2M1HA 4C92D 4QQ6A 3QKJA 4XTZA 4C0GA 3OYYA 2RI5A 3PNWC 1X75C 4M77C 4KBMB 4OP0A 3JCMg 5GAMd 2RJFA 5GAOl 3CCVT 2C06A 3S3NA 3X28B 2CS7A 2VV5A 2X4WA 5CK9A 1LOJA 1QVFS 2NLUA 4XK8E 3QZ9B 5CIUA 3L2WA 2QDYB 4L5GA 4EMKA 1VQKA 2X4XA 3MEUA 3NTHA 4M75E 2PVDB 4FL6A 3QYGB 4FSXA 3L2RA 3PIOA 2DXTA 4HT8A 1QP2A 3WVEB 3CC2A 2EYQA 3E19A 2GQVA 1VUBA 3C4SA 4N0AC 5M9OA 3NFCA 5LJ3e 3LGFA 3PMIA 4B9XA 1RL2A 2BKDN 5I2SA 1UB4A 4NS5A 3QBYA 4C92B 4MDXA 1YHQT 2O4XA 3RUXA 3CCLT 4OF1A 2HD0A 3OW2A 4P5NA 5FU6C 2QQBA 1YJ9A 3V7SA 2X35A 2E1HA 3L1AA 2F5KA 4XTWA 3JCMV 4PJOA 3EFRA 4B9WA 1QP3A 2VGNA 4BACA 2PVOB 4C0FA 2R5MA 4E7HA 4XU1A 2WSCE 3OYIA 5C0MA 3CXCA 2E64A 2MWPA 4OB2B 2DEQA 1Y07A 4FT4A 3RESA 3JCMf 3NTIA 4CI0C 3JB9G 1VQLA 2QQRA 3S3OA 1FWZA 1I4K1 2E41A 3HKSA 4M75C 4O5VA 3OA6A 3MEAA 2ZPHB 2FYKA 3P8BB 2K3YA 1S72A 2DTHA 5LJ5h 5CO7A 1KQ1A 2RK2A 2E70A 3CBMA 4F7UB 3LW5E 5HK3A 3M4YA 2L89A 4C5EA 1OI1A 1WJSA 4XU0A 4Y28E 5EG2A 3RERA 2E12A 2RHZA 2DTOA 4A4EA 5C6SA 5I2MA 4BE2A 1U8RA 5GMKe 2HNIA 2EQJA 3C95A 5D6XA 4M78D 2BUDA 3ZBDA 5DM7R 4R56A 3SWNC 2MWOA 3OYHA 1KQ2A 3CPFA 3CEYA 2DKGA 3URGA 5GANe 2XDDA 2YRVA 4F7UF 2OTJA 2R5AA 2F69A 3HFNA 3C94A 3A8OB 4A4KA 3CC7T 3FC3A 3OYNA 3ER0A 2LT4A 3FB9A 2GCXA 2QQAA 4NL3A 2D9TA 4E47A 4X34A 4XTYA 1RI0A 3MP1A 3GNFB 3VJPA 3OS0A 3CMEA 2DD4A 5IN1A 3KBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DA4 A;  2FVU A;  4JJN K;  4DOW A;  2FL7 A;  4DOV A;  4KUL A;  4LD9 K;  4KUI A;  1W4S A;  4FT4 A;  1ZHI A;  4FSX A;  1M4Z A;  1ZBX A;  3PTA A;  4FT2 A;  3PT9 A;  3TU4 K;  4BB7 A;  4KUD K; 
#chains in the Genus database with same CATH topology
 3EGD A;  4DA4 A;  4XAX B;  1PNJ A;  3JCM c;  4DBR A;  4QQG A;  1K73 U;  3L2V A;  2HAX A;  1D0Z A;  1RAA B;  3EG3 A;  3RIR A;  4HA8 A;  2NYS A;  4M7A A;  1YI2 T;  1JB0 E;  1SF9 A;  2VKN A;  3OYK A;  1Q81 C;  2JXB A;  3SFM A;  2BZX A;  3P8H A;  1VQ7 A;  1NJI R;  3HRU A;  1X2K A;  1AWO A;  4XTV A;  4EPC A;  1YBY A;  4QVD A;  1W2B A;  3EH1 A;  3HSB A;  5KE2 A;  4Z88 A;  1WHL A;  3CCU A;  5CVI A;  2FRY A;  4RG2 A;  2DVE A;  4IUT A;  5LJ3 g;  3I55 T;  1YJN T;  1DJ7 B;  3CD6 A;  3M0S A;  2L3Q A;  2X4J A;  1V76 A;  1Q7Y U;  3SDZ A;  4J9D A;  4WF2 A;  1YIJ Q;  5KYX B;  4LDU A;  4F7U E;  1M5Q 1;  5KCO A;  2WSF E;  4DBF A;  1Y96 A;  2DBM A;  4KUL A;  4A4H A;  3OYA A;  4M7D G;  3M0T A;  4OB1 B;  3A8L B;  1G3S A;  1TOV A;  4N4I A;  1AEY A;  1D1A A;  1HYO A;  3OSV A;  4ZN3 A;  2HEQ A;  3E9F A;  2FG0 A;  2W10 A;  4C8Q F;  4E6R A;  4XU3 A;  5LJ5 d;  2XU8 A;  4IKF A;  2CT4 A;  3VS1 A;  4C92 F;  4Z89 A;  3JSC A;  4M77 A;  2KRN A;  2ZPB B;  2VC8 A;  2L2P A;  2A3L A;  2QGF B;  4PJO F;  4PL6 A;  4EIK A;  4UC4 A;  2PU9 B;  4N0A A;  1IRE B;  1OUL A;  3OYC A;  2V1R A;  2KGT A;  2QXF A;  3FEO A;  4J6W A;  3ASK A;  1NYG A;  1S1N A;  1MV0 B;  5GAN f;  1NLP C;  2RI3 A;  1YJW A;  5GAO p;  2A36 A;  1JU5 C;  4NL2 A;  2J7I A;  4IUQ A;  2KBT A;  3ME9 A;  2LZ6 B;  3JRZ A;  2COZ A;  4F14 A;  4ZN1 A;  3G71 Q;  1EX4 A;  2KEA A;  5LJ3 d;  1RAI B;  1JJ2 S;  2DIL A;  1OV3 A;  2ZPG B;  1M1F A;  2D0N A;  3PMT A;  4M78 F;  1YIT Q;  1QKW A;  1KC8 U;  4HCZ A;  1ZQ1 A;  1GL5 A;  2QEX Q;  1ZUU A;  3CCM Q;  2M02 A;  4PFO A;  4OMP A;  3CCS A;  1M8V A;  3QXE B;  4L6V 5;  4QT7 A;  3CC4 A;  2SRC A;  1MHN A;  5A2Q E;  2HMA A;  3M56 A;  3EFO A;  4M7A G;  4PK4 A;  2W0Z A;  4JRK A;  1B34 B;  3JB9 H;  4K11 A;  5CKH A;  4AFZ C;  3LWI A;  1MGQ A;  1AVZ C;  2ZPE B;  4QVC A;  1PSE A;  3DKM A;  2DK3 A;  1NG2 A;  3JCM W;  3G6E A;  1CKA A;  2CZ0 B;  3CCU T;  3LGL A;  2KR3 A;  1RLP C;  2A0F B;  3CXC S;  4ME7 A;  1RI9 A;  4A4G A;  1GBQ A;  1TTH B;  3JCM J;  2FPD A;  1Q82 C;  1VQK Q;  2XD0 A;  2G6F X;  2MCN A;  1B07 A;  1W1F A;  2EAY A;  3CCV A;  1M4Z A;  3UT1 A;  5GMK i;  2CDT A;  2RMO A;  4RCB A;  3CCR Q;  1UEB A;  5KYU A;  2ROT A;  1GCQ C;  3A8H B;  3V8L A;  1BIA A;  1BKB A;  2A28 A;  1BB9 A;  1YHQ A;  3M4G A;  2KSS A;  4C8Q A;  4ZGJ B;  4BI3 A;  2DJZ A;  5GAN 7;  1QVG A;  2J05 A;  1ZBX A;  4Z8A A;  1YN8 A;  4C92 A;  5FWB A;  1OPL A;  2CH4 W;  1M30 A;  1U3O A;  1IO6 A;  2HL3 A;  2L8D A;  2M16 A;  1FXX A;  4HCB A;  3RDV A;  1KQS P;  2JTE A;  4MML A;  3E9G A;  2RK1 A;  4E2F B;  2KMT A;  2RN8 A;  4M77 G;  4M75 D;  1U1S A;  1TXQ A;  1PHT A;  4AG1 C;  1SSF A;  5HKC A;  1VQ6 Q;  1BI0 A;  4F7U A;  2XMF A;  2RO0 A;  5FU7 C;  5CKE A;  3GPL A;  1Q86 C;  1QCN A;  2I2L A;  2VYT A;  1B7T A;  3RR6 A;  5FLX E;  2FL7 A;  2AKL A;  2EGE A;  1WHG A;  4M75 B;  4A4F A;  1YJW T;  1UEC A;  5GMK j;  3X26 B;  1WXU A;  3E1S A;  1M90 U;  5GAN j;  1VQ9 Q;  1G3W A;  1NJI C;  3X25 B;  3BW1 A;  4ZNX A;  5A0D A;  1JQQ A;  3C12 A;  3QJY A;  2IVW A;  3CMA A;  3ZEH A;  3PGG A;  2MI6 A;  1JXO A;  3EHQ A;  4J6Y A;  1OOT A;  4Y91 A;  1N6A A;  1VIF A;  1CSK A;  3CCE A;  4J5Y A;  1ZUY A;  2AT1 B;  5IHN A;  1YNZ A;  3TSW A;  1SG5 A;  2X51 A;  3QWX X;  3CCS T;  2COY A;  3VYG A;  4BY6 B;  3CC4 T;  1QCF A;  1D0X A;  1KD1 R;  1AWX A;  1QQJ A;  3GP8 A;  5CCA A;  3I56 A;  1HXD A;  3GF5 A;  3PVQ A;  3EFS A;  4LNP A;  3OS2 A;  2E3I A;  1K9A A;  5GAN 6;  4JLG A;  3L2Z A;  4RMO A;  3CC2 Q;  2ZPI B;  4OB3 B;  1JJ2 A;  2DZC A;  2LQ8 A;  2YUQ A;  2JUF A;  5KYX A;  2JMC A;  4OMF B;  1PM3 A;  2KNB B;  1MMA A;  2D6F A;  2NWM A;  3CCV T;  2HZY A;  5GJV B;  3S3N A;  2CS7 A;  2VV5 A;  2X4W A;  2FO0 A;  4XK8 E;  3L2W A;  1GBR A;  4ORZ A;  4M75 E;  3MEU A;  3NTH A;  5FWC A;  6AT1 B;  4FSX A;  2HSP A;  2M0Y A;  2DXT A;  3THK A;  1QP2 A;  2EYQ A;  1WLP B;  1M2O A;  3E19 A;  1VUB A;  5M9O A;  1BBZ A;  3PMI A;  1TU0 B;  1RL2 A;  4NS5 A;  4FCY A;  2DLP A;  1S72 Q;  4MDX A;  1YHQ T;  3V7S A;  2F2V A;  4XTW A;  4B9W A;  2VGN A;  1WYX A;  2PTK A;  2PVO B;  1WXB A;  1VQO Q;  3CXC A;  2CUD A;  1H92 A;  3EHR A;  3RES A;  3NTI A;  4CI0 C;  2YUP A;  1RAC B;  1SRL A;  2OTJ Q;  3P8B B;  2K3Y A;  1SPK A;  2K7A A;  5LJ5 h;  3M4Y A;  3CME Q;  3RER A;  1LVK A;  5I2M A;  5GMK e;  2HNI A;  3C95 A;  5D6X A;  3ZBD A;  1PG5 B;  2BUD A;  1K8A R;  2KRS A;  2KRM A;  5GAN e;  2XDD A;  3NGP A;  2R5A A;  1QLY A;  4A4K A;  3CC7 T;  4RTV A;  3OYN A;  4ANJ A;  3FB9 A;  2LT4 A;  2FZK B;  2NUT A;  2QQA A;  4XTY A;  3MP1 A;  1BI3 A;  1QMC A;  3QUI A;  1IZ6 A;  4DQ2 A;  2EGC A;  2O9S A;  1M27 C;  5CR2 A;  3DB4 A;  2GFA A;  2ZCF B;  5CKF A;  2RQV A;  2EKO A;  2JOY A;  5D6W A;  1ACM B;  1WGS A;  1WPY A;  4C5H A;  2QG9 B;  4OMM A;  3CMA T;  4FT2 A;  2O9V A;  1WHM A;  2DVJ A;  1Q81 U;  2E5Q A;  5GAO m;  5DY9 A;  1OU9 A;  2PNI A;  3M55 A;  3QYH B;  4BD3 A;  2RA2 A;  3CCE T;  5GMK m;  2GBQ A;  3JCM Q;  4DOV A;  1Z9Z A;  2JT4 A;  4JS4 A;  2JW4 A;  1KQS S;  1B34 A;  1U06 A;  3CBP A;  3MEW A;  1OX8 A;  1PD0 A;  1RAF B;  2EIF A;  1KSW A;  1TUD A;  4EMG A;  1FMK A;  2VVK A;  1G3Y A;  2GF7 A;  2QGG A;  1BU1 A;  3M5A A;  3I56 T;  1NLO C;  4XQ3 A;  4J9E A;  2E10 A;  3QWY A;  2DL7 A;  1LJO A;  2Y4Y A;  1VQN Q;  3CCL Q;  2ED0 A;  2ROL A;  3PIP A;  4RTY A;  2O31 A;  4PJO D;  5D7U A;  5GAO q;  4EMK B;  4C8Q B;  1Q82 R;  1UUE A;  4TVR A;  2QI2 A;  4QW2 A;  1NZ9 A;  3O5Z A;  3X24 B;  3JCM P;  1YIJ A;  2RQR A;  2BE9 B;  4WCI A;  1WA7 A;  3I5S A;  2HL5 C;  4CC3 A;  1NPR A;  2HDA A;  4PJO B;  2BIV A;  2K2M A;  5GAN g;  4J8O A;  4AFU C;  3VS6 A;  2KYB A;  1FMV A;  2CP6 A;  2DL5 A;  1NBE B;  2DXC A;  1VQ5 Q;  5EC7 A;  5KE3 A;  3JB9 J;  1T3L A;  2DMO A;  2XDP A;  4DEX A;  1V1C A;  2RJD A;  4J9G A;  1ZSZ B;  3ZFJ A;  1VQ8 T;  3NMZ C;  4BDZ A;  2HQH A;  2JNG A;  3OYJ A;  4QKU A;  1N5Z A;  4BDY A;  1C1A A;  3VS5 A;  4BE0 A;  3S3M A;  3OS1 A;  2P0P A;  3LH5 A;  2L5Q A;  2HQE A;  2RH2 A;  4C0Z A;  3QII A;  4ATO A;  4QVZ A;  2K4Y A;  2HQX A;  4M78 B;  1Q86 R;  4M75 A;  2QQ9 A;  2EQK A;  1W6X A;  3V8K A;  4WTO B;  1N9R A;  4JS5 A;  4JZ3 A;  1UHF A;  4C8Q E;  3FIF A;  4PLI A;  2ATC B;  2RPN A;  2C0I A;  1I8F A;  2DE0 X;  3CCJ Q;  1YJN Q;  1I1J A;  3GBQ A;  1YCY A;  1KD1 C;  4C92 E;  4D6W A;  1HSQ A;  4OB0 B;  4OGC A;  1C6V X;  5ECA A;  1RUW A;  1FMW A;  1G83 A;  1KHI A;  4M7D C;  3JCM d;  1G5V A;  3G71 A;  2OI3 A;  2E6Z A;  4PJO E;  2D8J A;  2DET A;  2H8H A;  5GAN 3;  4YTL A;  2LNH B;  1K4U S;  1M3A A;  3MP8 A;  1OQK A;  4LD6 A;  1Z9Q A;  2DBK A;  1VQP T;  3CCM A;  2EFI A;  2E3H A;  2MMP A;  2E6N A;  2VXE A;  3MHX A;  4OVA A;  4OMO A;  4KGV B;  1JO8 A;  1YWO A;  1Q82 U;  5GAN d;  1WXT A;  3UWN A;  2XKO C;  3QJ6 A;  1R0C B;  1PKS A;  4KGZ B;  4FYV B;  1D0Y A;  4JJB A;  1GCP A;  1TS9 A;  2QA4 A;  4BI8 B;  2F5T X;  2MAM A;  2YLC A;  2C0T A;  4PJL A;  1OYX A;  1SHF A;  1K0X A;  1F1B B;  1ZBJ A;  1M2V B;  2VB6 A;  3SD4 A;  1A0N B;  2LX7 A;  4M78 E;  3OSS C;  1IGQ A;  3REB B;  3LLR A;  3UPU A;  1YIJ T;  3QDR B;  2NUP B;  4IUP A;  1N8R R;  3EG9 B;  1KQS A;  4RTT A;  3OYF A;  3TQ7 P;  1YJ9 T;  3CCR A;  1U1T A;  1XOV A;  2EYZ A;  2P0K A;  4BE1 A;  3DLM A;  2QK0 A;  2KI7 A;  3WVD B;  9ATC B;  1K8A C;  1VQL T;  1T0H A;  1PC0 A;  2JVV A;  2NUZ A;  1GCQ A;  1MV3 A;  2PQW A;  3RBB B;  2J6K A;  1Y71 A;  2RI2 A;  2K5F A;  4PNO A;  4DBQ A;  2DIQ A;  1M1K C;  2RJE A;  2NUT B;  4E7K A;  2CKK A;  4M7A C;  1Q86 U;  2HBP A;  2JN0 A;  2KY9 A;  2DEU A;  3HP9 A;  3CPW S;  2BZY A;  4BUG A;  3N5B B;  1X43 A;  3EAE A;  3QG1 A;  1C0M A;  3ULR B;  5GAM f;  2EVR A;  3I5R A;  2AHJ B;  4FYX B;  1W70 A;  1XJW B;  2JZ2 A;  1VQ6 A;  1B3Q A;  1NJI U;  3FDR A;  1WQW A;  1VQ4 A;  2RQT A;  2KVQ G;  1KJW A;  3QO3 A;  2J06 A;  1GRI A;  2DD5 A;  4X9D A;  4HT9 A;  1M3B A;  1K73 C;  2X3W D;  1AHJ B;  2LCS A;  4A53 A;  2FHD A;  1OEB A;  3EGX B;  5LJ5 f;  2JMA A;  1VQ7 T;  1T0J A;  4V2S A;  4NOY A;  4JDS A;  2R57 A;  3G71 T;  3V7R A;  1Y0M A;  4FIB A;  1I07 A;  4M7D D;  2MOX A;  3J81 E;  1XNI A;  2XDB A;  1K0S A;  4F04 B;  2QTV A;  1O9S A;  3MCA B;  3CD6 T;  2ZZD A;  5GAO r;  2GFU A;  3LWH A;  1CKB A;  2B8A A;  4LUD A;  3OS5 A;  2DJQ A;  1NPP A;  2P4R A;  4L59 A;  2HCK A;  3PT9 A;  1Q7Y C;  2FRW A;  1X6O A;  2DM1 A;  2EQU A;  3FJP A;  5KYW B;  2K9G A;  4M7D B;  2DO3 A;  1UGR B;  2LCL A;  4XTZ A;  4C0G A;  2VWF A;  4M77 C;  5GAO l;  1X75 C;  2YRD A;  2CP7 A;  4OP0 A;  2RJF A;  2X3X D;  1LOJ A;  5CIU A;  1TG0 A;  1UE9 A;  4L5G A;  4EMK A;  4J9I A;  2QA4 T;  4HT8 A;  3L2R A;  3WVE B;  2LJ0 A;  3CC2 A;  1PWT A;  4PJJ A;  4N0A C;  3LGF A;  1UB4 A;  2RNA A;  3RUX A;  2HD0 A;  4P5N A;  5FU6 C;  2X35 A;  2E1H A;  3L1A A;  2F5K A;  2FZG B;  2DL8 A;  4PJO A;  3EFR A;  5FW9 A;  2WSC E;  4PJM A;  1TUG B;  2AIR B;  1Y07 A;  4FT4 A;  3JB9 G;  3OW2 P;  1I4K 1;  2EBP A;  2E41 A;  1BCM A;  4O5V A;  3OA6 A;  3MEA A;  1S72 A;  2DTH A;  1ZSZ A;  1KQ1 A;  3CBM A;  1WHJ A;  2L89 A;  5EG2 A;  2DTO A;  4BE2 A;  2FZC B;  2I0N A;  5IHI A;  3SWN C;  2MWO A;  1KQ2 A;  2HKQ B;  2DKG A;  4AFS C;  1JXM A;  3TVT A;  2YRV A;  1YP5 A;  2OTJ A;  1SSH A;  3HFN A;  3A8O B;  3FC3 A;  3ER0 A;  2GCX A;  1M3C A;  1IHV A;  2D9T A;  4FW2 A;  1I5O B;  3CME A;  3OS0 A;  2CZ6 B;  4PKC C;  4M78 A;  2HKN A;  2ENM A;  4LDX A;  3FRN A;  3OYL A;  2V26 A;  3BE3 A;  4FSS A;  3PFS A;  4HCK A;  2RJC A;  2FB7 A;  1VQ4 T;  5GAM j;  3CCQ Q;  2IIM A;  1D1C A;  5GJW B;  4KT0 E;  3V8J A;  3A8G B;  4JUV A;  2RQU A;  2DRK A;  4RCC A;  5GAN 5;  3J7A F;  2KXD A;  3HHT B;  1N9S A;  4PLL A;  2LJ1 A;  4E7S A;  3F70 A;  1VQM Q;  2ZAE A;  4ZTJ A;  2DA9 A;  4LDY A;  2K6D A;  4Q5W A;  2VAS A;  3G6E T;  5LJ5 j;  3I35 A;  1UFF A;  1BI1 A;  3VS2 A;  1R77 A;  1I81 A;  2YT6 A;  3JCM h;  1AD5 A;  3X20 B;  3OYB A;  2FVU A;  1M1G A;  2OJ2 A;  3S6W A;  4KRT A;  2XIC A;  5CKB A;  2V8I A;  1YHQ Q;  3A1P A;  3MET A;  2D1X A;  1N8R C;  4HVU A;  1ZA1 B;  2A08 A;  2J6O A;  2LTO A;  1FYN A;  5CAI A;  4M7D F;  5GMK h;  1YFN A;  1MND A;  1PRL C;  1IXD A;  4FYY B;  4OML A;  1NEB A;  1JRI A;  1M2V A;  5GAN h;  4JJD A;  4C5G A;  2KDS A;  1X69 A;  2KYM A;  3MPU B;  3UDC A;  3REA B;  3CC2 T;  1VQN A;  4X1V A;  2QAS A;  1IRX A;  4C8Q G;  1X01 A;  1QW1 A;  4J83 A;  2EJF A;  2CSQ A;  2EPD A;  2NUP A;  3EG9 A;  1QVP A;  2QYZ A;  4ELY C;  3HRT A;  4KGX B;  4C92 G;  2OX7 A;  2OTL A;  2AZS A;  2V8K A;  1N27 A;  2G3R A;  4GBQ A;  4KH1 B;  2CH4 A;  3CC7 Q;  2GQI A;  1QVG P;  1Q95 G;  2LC4 A;  1ZX6 A;  4LD9 K;  4O6J A;  1VA7 A;  1ZUK A;  2K57 A;  1S72 T;  3RMS A;  2ESW A;  2DXU A;  2XI9 A;  2YDL A;  1VQ5 A;  3FLG A;  1ABO A;  4JJC A;  4F7U G;  2JTF A;  2Y90 A;  2A7Y A;  3VRZ A;  2M9U A;  3L42 A;  1QVF P;  2F2W A;  3CMA Q;  1M1K R;  4CRI A;  2LX9 A;  3M58 A;  3PVL A;  5GAM e;  3LX7 A;  1OZ3 A;  1TSF A;  3H8Z A;  5J26 A;  2YUO A;  3CCE Q;  2K79 A;  3H6Z A;  3CME T;  2XK0 A;  4GY5 A;  5FU7 B;  1K76 A;  1TUC A;  3M9Q A;  4M78 G;  1MNE A;  1KD1 U;  4RUG A;  3G4S Q;  2KT8 A;  4C5I A;  3VS4 A;  4AFQ C;  5LJ3 h;  3GLX A;  3I56 Q;  3VRY A;  2LNV A;  2GTJ A;  3EGX A;  4M7A F;  5LJ5 e;  1UJ0 A;  1K73 R;  1K9M C;  3BFM A;  1D09 B;  2CRE A;  5J3B A;  3QZ5 B;  5GAN 2;  4A54 A;  3M57 A;  2R58 A;  3OW2 S;  3CCJ A;  4FU6 A;  2JM9 A;  2EYX A;  4Z02 A;  4AT1 B;  2WSE E;  3CPW P;  4D8K A;  2E5K A;  4LUE A;  2ZPF B;  3RKY A;  2CP2 A;  2ZGW A;  1EZZ B;  5D6Y A;  2B86 A;  3MKD A;  1TWB A;  3G1J A;  1PRM C;  3SHW A;  2RM4 A;  3TSZ A;  2KXC A;  4IUU A;  5KYW A;  3LH0 A;  3OBY A;  4M7D A;  3H9N A;  1G2B A;  4M4Z A;  3L2U A;  3D7S B;  1Q7Y R;  1O75 A;  1GFC A;  2PUO B;  3FJ5 A;  1IGU A;  4IUR A;  2CP5 A;  4JJN K;  1PD1 A;  4J7I A;  1E6H A;  1UGV A;  2D0Q B;  1W4S A;  5A0G A;  1V29 B;  3R6N A;  3JB9 I;  4A63 B;  3MP6 A;  1VQ8 Q;  3O8V A;  2F1L A;  3BY7 A;  4X9C A;  1WHK A;  4IIO A;  3QSU A;  1VQN T;  4LE9 A;  2YHT A;  2LRQ A;  2KRO A;  2CZ1 B;  2XHC A;  3UA6 A;  5GAM g;  1K8A U;  3OYM A;  3HTR A;  5CKD A;  2OTL T;  5I22 A;  2JTM A;  4XTU A;  3JB9 F;  4M77 F;  2FPF A;  2DX1 A;  4OMQ A;  3M54 A;  3PTA A;  3DLL A;  1MMN A;  2RF0 A;  1QCO A;  4LDV A;  1M1K U;  4LN2 A;  3J80 E;  1YI2 Q;  3TCJ A;  4EDU A;  1WQ7 A;  4PJN A;  1HK9 A;  5LJ5 g;  2RHX A;  2YWW A;  1VQ5 T;  2P4T A;  4VUB A;  1FX7 A;  5KH6 A;  4J9C A;  1I5L A;  1WX6 A;  2EWN A;  4N4H A;  2O2O A;  5IHK A;  1E7O A;  2SEM A;  1JBM A;  2VGM A;  1D3B B;  1PSF A;  2JM8 A;  5KCH A;  5I11 A;  1X6B A;  3IQL A;  5GAO n;  3I55 Q;  2LQK A;  1KHC A;  3JAM E;  2YUN A;  2DL3 A;  2VUB A;  2K5I A;  1VQP Q;  4AG2 C;  2P84 A;  1YCS B;  1BK2 A;  8AT1 B;  1IB8 A;  3OQ5 A;  1RAH B;  2CT3 A;  2OAU A;  4IIM A;  2GGR A;  1YIT A;  2XID A;  3VKI A;  5IAY A;  1R8O B;  2QEX A;  1KC8 R;  5HK0 A;  2AKK A;  2YSQ A;  4CC7 A;  2KQW A;  1QVG S;  3OBW A;  2CUB A;  3CCJ T;  4JZ4 A;  3NHN A;  2M0O A;  2H3J A;  4C0D C;  2DPP B;  1AWW A;  3RKW A;  3RMQ A;  2MYS A;  4FM4 B;  3VS0 A;  4ZGD B;  3ZL7 C;  1NEG A;  2DER A;  2LDM A;  2LCC A;  2M1H A;  2LP5 A;  4QQ6 A;  1YJ9 Q;  3OYY A;  3PNW C;  4RTU A;  5GAM d;  2C06 A;  1QVF S;  1UHC A;  3X28 B;  2YXY A;  4PFZ A;  2QDY B;  1VQK A;  2X4X A;  1BYM A;  2PVD B;  3CQT A;  1VQL Q;  2GQV A;  3VS3 A;  3NFC A;  1WZO A;  2JJ9 A;  1VYV A;  2BKD N;  4LXC A;  3OW2 A;  2C0O A;  2H3E B;  2V1Q A;  1HD3 A;  3JCM V;  4C0F A;  4E7H A;  5C0M A;  2DEQ A;  2IPO B;  1Y57 A;  3JCM f;  2L3P A;  2KT1 A;  1X27 A;  3HKS A;  4M75 C;  3EG0 A;  2ZPH B;  5IXB A;  5CO7 A;  2E4H A;  2E70 A;  5HK3 A;  1OI1 A;  1WJS A;  4XU0 A;  4Y28 E;  2RHZ A;  4A4E A;  5C6S A;  2ECZ A;  2EQJ A;  1T3S A;  4F16 A;  4R56 A;  1MMD A;  2O88 A;  4F7U F;  1VYT A;  1UG1 A;  4CC4 B;  4PFP A;  2F69 A;  3C94 A;  4NL3 A;  3M0P A;  4E47 A;  3JV3 A;  2QDL A;  2D8H A;  2X9H A;  3EGU A;  1VQ7 Q;  2DD4 A;  5IN1 A;  4KUD K;  2CZ7 B;  4M75 G;  4BY6 C;  4E7Z A;  1Y7X A;  3QDF A;  4F17 A;  3VS7 A;  3P8D A;  1UGP B;  1QWE A;  3EG1 A;  3CCU Q;  1NYF A;  3JCM X;  3CD6 Q;  1VQ9 A;  3SWN A;  1M90 R;  3GIB A;  2CGH A;  2DNU A;  3INZ A;  2AZV A;  3OYG A;  5FRN A;  5AYF A;  4E7I A;  4XTX A;  4FW1 A;  4JRQ A;  5KYY B;  1VOM A;  1YIT T;  4HXJ A;  2J6F A;  5FRM A;  3CCQ A;  2RHU A;  1K9M R;  2QEX T;  2K2V A;  3GNG A;  4Y92 A;  3CCM T;  4R55 A;  2EQM A;  5LL6 S;  1SRM A;  2QA4 Q;  1W2B P;  3OYE A;  2YLB A;  3JCM b;  3U23 A;  3VV0 A;  4ELZ C;  2A37 A;  4GLK A;  3TRE A;  3MO8 A;  1VQM A;  1EIF A;  2K3X A;  1G3T A;  2RHI A;  1N8R U;  3UA7 A;  1ABQ A;  5GMK l;  4J9H A;  1YWP A;  4RG8 A;  2K5L A;  3RKX A;  1XTD A;  2DZ9 A;  2IG0 A;  5IT9 E;  4J6X A;  2EKH A;  3SB2 A;  2WAC A;  4GLM A;  5LJ3 f;  2LQN A;  3EH2 A;  4MZP A;  3H41 A;  1KG1 A;  5KYN A;  1VQK T;  1H3Z A;  2O4X B;  2GTO A;  4DOW A;  5CQY A;  2OAW A;  2DAQ A;  4EMH A;  3G7Z A;  5GAN 8;  4C0D B;  2EJ9 A;  3CCR T;  1AOJ A;  2ABL A;  1ZHI A;  3OB9 A;  2DF6 A;  2MF2 A;  3LYI A;  2KAF A;  2PUK B;  1P92 A;  2VXF A;  1WNL A;  2HSE B;  1YJW Q;  3M59 A;  1BCO A;  2QAZ A;  1IHW A;  2CYZ B;  1NE8 A;  4MDW A;  4HCC A;  3HL8 A;  1VQO A;  1QVF A;  5FRO A;  3EG2 A;  3TEE A;  5IXF A;  5L8R E;  3M0Q A;  3M53 A;  1LNX A;  2Y4X A;  4MMK A;  4JLI A;  2EYW A;  2EGA A;  4M7A D;  1VQ4 Q;  3CC7 A;  3NPF A;  4M7D E;  3A8M B;  4RTW A;  3CCS Q;  3EGD B;  3H0I A;  3CC4 Q;  2MPX C;  1VQ6 T;  2P0Q A;  3AT1 B;  1M9S A;  1RAG B;  2CP0 A;  1D3B A;  4M7A B;  7AT1 B;  3BDL A;  5J39 A;  1SHG A;  4E7J A;  2MK5 A;  3DB3 A;  1KC8 C;  1JEG A;  3G6E Q;  1H8K A;  2L3S A;  1K1Z A;  2EW3 A;  3VYH B;  1PCX A;  4B6M A;  1LPL A;  4JRI A;  3OMG A;  1G8X A;  1VQ9 T;  2DYB A;  5HY6 A;  1AT1 B;  3CPW A;  1K9M U;  2DXB A;  2BTT A;  1UTI A;  5HCK A;  2L3R A;  3CCV Q;  4ZGE B;  2LT1 A;  5GAN 4;  2LQW A;  3HRS A;  3BDU A;  4EMK C;  4C8Q C;  1Q81 R;  3G4S A;  2X4Y A;  3GOX A;  2LVM A;  4DEY A;  4JRP A;  1HJD A;  3UF4 A;  3OYD A;  4MZM A;  3CCQ T;  3MEV A;  3HFO A;  4C92 C;  2O01 E;  4CC2 A;  3RNJ A;  4R0K A;  1LCK A;  1AZE A;  1Y96 B;  4OMN A;  1QKX A;  3OMC A;  1UGS B;  2COW A;  2ED1 A;  1OU8 A;  5A0L A;  4PJO C;  1OX9 A;  2EQI A;  1PKT A;  3H0F A;  2HBW A;  4KH0 B;  3I9Q A;  1UDL A;  2KK4 A;  1VQM T;  5DLO A;  2PVG B;  4M77 D;  3JB9 D;  2QTX A;  1AWJ A;  1U5S A;  4IUV A;  1TH7 A;  1MUZ A;  3Q1J A;  3CBO A;  3CCL A;  1ZSZ C;  3A5Z B;  1KIK A;  3V7C A;  4J7F A;  2DL4 A;  1GFD A;  1BI2 A;  2RB6 A;  3PE0 A;  2E65 A;  5GAM h;  2XG8 D;  1WJR A;  2K3B A;  4M7A E;  3TU4 K;  4M77 B;  4N4G A;  3OY9 A;  4OGE A;  3L2Q A;  5LJ3 j;  4II1 A;  4PJO G;  5AT1 B;  1X6G A;  1UJY A;  1VYU A;  4KUI A;  3JCM e;  2MIO A;  4FYW B;  4QQD A;  4DBH A;  1VQ8 A;  3UAT A;  4M78 C;  3HPW A;  3KFV A;  2V8J A;  1MMG A;  5FU6 B;  1OZ2 A;  4HVV A;  3M0U A;  3VUB A;  1VQO T;  1VIE A;  2EJG A;  1WDX A;  1W2B S;  2DYI A;  1KK7 A;  8ATC B;  4E7L A;  2OTJ T;  1WFW A;  4LDW A;  2DTI A;  1E6G A;  1H3H A;  4RTX A;  1M90 C;  1H64 1;  2LJ3 A;  2L0A A;  4ESR A;  1GXI E;  2BZ8 A;  1RAE B;  4J9B A;  2M51 A;  4RTZ A;  1XQH A;  2PZ1 A;  1YI2 A;  1UGQ B;  4M75 F;  4MZT A;  1D1B A;  3SWN B;  4BB7 A;  2DFU A;  1EFN A;  2GNC A;  2RD1 A;  5DLQ E;  3SEM A;  2CP3 A;  2YRC A;  3AHU A;  3KXT A;  5CQX A;  2RQW A;  3EFO B;  2FEI A;  1RLQ C;  3A98 A;  4BI4 A;  1QWF A;  2DIG A;  4J9F A;  3WXM B;  1SEM A;  3E2U A;  2CSI A;  3VUZ A;  3I55 A;  4M77 E;  1YJN A;  4XU2 A;  2QQS A;  1ZSG A;  5I21 A;  1R0B G;  4HVW A;  4HKE A;  5KYY A;  3QPH A;  1SKU B;  2F2X A;  3KUF A;  1VQP A;  3R6O A;  3NTK A;  4ZTF A;  3QHS A;  2JS2 A;  1WIE A;  3G4S T;  1WHH A;  1KFZ A;  1WJQ A;  1BIB A;  4C8Q D;  3MJX A;  1ZLM A;  3T9N A;  3VU3 C;  5IH2 A;  2RHY A;  4RKU E;  1WI7 A;  4C92 D;  5KYU B;  3QKJ A;  2FPE A;  2RI5 A;  4KBM B;  3JCM g;  4D8D A;  5CK9 A;  1OPK A;  2NLU A;  3QZ9 B;  2Z0W A;  1JJ2 P;  4FL6 A;  3QYG B;  3PIO A;  2KE9 A;  4AMC A;  3C4S A;  5LJ3 e;  2OTL Q;  4B9X A;  5I2S A;  3QBY A;  4C92 B;  2O4X A;  3CCL T;  4OF1 A;  1YJ9 A;  2QQB A;  1RAB B;  1QP3 A;  4BAC A;  2R5M A;  4XU1 A;  3OYI A;  2E64 A;  2MWP A;  4OB2 B;  1ARK A;  3H0H A;  1X2Q A;  1VQL A;  2EYY A;  2LMJ A;  2QQR A;  3S3O A;  1FWZ A;  3M0R A;  2FYK A;  3C0C A;  2DRM A;  1I0C A;  2RK2 A;  4F7U B;  3LW5 E;  3CXC P;  4C5E A;  1NM7 A;  2E12 A;  2JS0 A;  1U8R A;  1AZG B;  5L23 A;  4JPB W;  1J3T A;  4M78 D;  5DM7 R;  3OYH A;  2BE7 D;  3CPF A;  3CEY A;  3URG A;  1RAD B;  1M8M A;  4X34 A;  1RI0 A;  1ZA2 B;  3GNF B;  2AK5 A;  3VJP A;  3KBG A; 
#chains in the Genus database with same CATH homology
 2CZ7 B;  2CZ6 B;  4M78 A;  4PKC C;  1BI3 A;  4DA4 A;  3QUI A;  1IZ6 A;  4M75 G;  4DQ2 A;  4LDX A;  4XAX B;  4BY6 C;  1Y7X A;  3FRN A;  3OYL A;  5CR2 A;  3DB4 A;  3JCM c;  2GFA A;  4QQG A;  3P8D A;  1K73 U;  1UGP B;  2ZCF B;  5CKF A;  2EKO A;  3L2V A;  2HAX A;  2JOY A;  3PFS A;  2RJC A;  2FB7 A;  5D6W A;  1VQ4 T;  3RIR A;  4HA8 A;  1WGS A;  5GAM j;  4M7A A;  1WPY A;  1JB0 E;  3JCM X;  1YI2 T;  4C5H A;  3CMA T;  4FT2 A;  4KT0 E;  3V8J A;  3OYK A;  1Q81 C;  1Q81 U;  3A8G B;  1VQ9 A;  2E5Q A;  3SWN A;  5GAO m;  4JUV A;  5DY9 A;  3SFM A;  1VQM A;  1VQ7 A;  3P8H A;  3GIB A;  2CGH A;  3M55 A;  3HRU A;  4RCC A;  5GAN 5;  3INZ A;  3QYH B;  4XTV A;  2RA2 A;  4BD3 A;  3OYG A;  4EPC A;  3CCE T;  3J7A F;  5FRN A;  1YBY A;  5AYF A;  4E7I A;  4XTX A;  4JRQ A;  5GMK m;  4QVD A;  1W2B A;  3HSB A;  5KE2 A;  3JCM Q;  4DOV A;  3HHT B;  1N9S A;  4PLL A;  3F70 A;  4JS4 A;  4ZTJ A;  1KQS S;  1B34 A;  5CVI A;  3CCU A;  1YIT T;  3CBP A;  3MEW A;  4LDY A;  4RG2 A;  2DVE A;  4IUT A;  5LJ3 g;  2EIF A;  3I55 T;  1YJN T;  5FRM A;  3CCQ A;  2RHU A;  4Q5W A;  1DJ7 B;  3G6E T;  3CD6 A;  5LJ5 j;  4EMG A;  2QEX T;  2K2V A;  3GNG A;  3CCM T;  2X4J A;  1BI1 A;  1G3Y A;  2GF7 A;  4R55 A;  2EQM A;  5LL6 S;  3M5A A;  3I56 T;  1Q7Y U;  3SDZ A;  1I81 A;  3JCM h;  4WF2 A;  4XQ3 A;  3X20 B;  2E10 A;  3OYE A;  2YLB A;  3OYB A;  2QA4 T;  4LDU A;  4F7U E;  1M5Q 1;  5KCO A;  2WSF E;  3JCM b;  2FVU A;  3VV0 A;  1LJO A;  4ELZ C;  1M1G A;  2D6F A;  3S6W A;  4GLK A;  2Y4Y A;  2XIC A;  1Y96 A;  3MO8 A;  1EIF A;  2V8I A;  4KUL A;  2K3X A;  3MET A;  5CKB A;  3TRE A;  3PIP A;  4A4H A;  1G3T A;  3OYA A;  2RHI A;  1N8R C;  1N8R U;  4PJO D;  2LTO A;  5GAO q;  4EMK B;  4C8Q B;  5CAI A;  4M7D F;  5GMK l;  4TVR A;  2QI2 A;  4QW2 A;  4RG8 A;  5GMK h;  4M7D G;  2K5L A;  4OB1 B;  3RKX A;  3A8L B;  1XTD A;  2DZ9 A;  2IG0 A;  1G3S A;  1NZ9 A;  4J6X A;  5IT9 E;  3SB2 A;  2WAC A;  4N4I A;  3X24 B;  5LJ3 f;  3JCM P;  1YIJ A;  3OSV A;  4MZP A;  4ZN3 A;  1JRI A;  1KG1 A;  5GAN h;  1VQK T;  1H3Z A;  2O4X B;  3E9F A;  4C5G A;  2KDS A;  3UDC A;  4DOW A;  4C8Q F;  3CC2 T;  1VQN A;  5CQY A;  4C8Q G;  1NPR A;  1X01 A;  1QW1 A;  2DAQ A;  4J83 A;  3G7Z A;  4XU3 A;  2EJF A;  4EMH A;  5LJ5 d;  5GAN 8;  4C0D B;  2BIV A;  4PJO B;  5GAN g;  2XU8 A;  2EJ9 A;  4J8O A;  3CCR T;  4IKF A;  1QVP A;  1ZHI A;  3OB9 A;  4KUD K;  4ELY C;  4C92 F;  3HRT A;  4C92 G;  2MF2 A;  2DXC A;  3LYI A;  2KAF A;  2PUK B;  3JSC A;  1P92 A;  4M77 A;  2OTL A;  2VXF A;  2ZPB B;  2VC8 A;  5KE3 A;  1WNL A;  3JB9 J;  2V8K A;  2XDP A;  1N27 A;  3M59 A;  2A3L A;  4PJO F;  2RJD A;  2G3R A;  4PL6 A;  2CYZ B;  3ZFJ A;  1NE8 A;  2LC4 A;  4MDW A;  1VQ8 T;  4UC4 A;  2PU9 B;  4N0A A;  4BDZ A;  4HCC A;  2JNG A;  3HL8 A;  1VQO A;  4LD9 K;  1IRE B;  1QVF A;  4O6J A;  3OYC A;  5FRO A;  3OYJ A;  2K57 A;  1S72 T;  3RMS A;  3TEE A;  5L8R E;  2QXF A;  3FEO A;  4BDY A;  2DXU A;  4J6W A;  2XI9 A;  3M53 A;  1LNX A;  3ASK A;  3FLG A;  2Y4X A;  1VQ5 A;  4F7U G;  5GAN f;  4MMK A;  2RI3 A;  4JLI A;  4BE0 A;  2JTF A;  2Y90 A;  3S3M A;  1YJW A;  3OS1 A;  4M7A D;  2P0P A;  2A7Y A;  5GAO p;  2L5Q A;  2HQE A;  2M9U A;  2RH2 A;  4NL2 A;  3L42 A;  3CC7 A;  4C0Z A;  4M7D E;  3QII A;  4ATO A;  4CRI A;  2LX9 A;  4IUQ A;  4QVZ A;  3M58 A;  2K4Y A;  3A8M B;  2HQX A;  4M78 B;  4M75 A;  2QQ9 A;  2EQK A;  3LX7 A;  3ME9 A;  1OZ3 A;  3JRZ A;  3V8K A;  5GAM e;  3H8Z A;  4ZN1 A;  1VQ6 T;  5J26 A;  2P0Q A;  1M9S A;  1N9R A;  4JS5 A;  3H6Z A;  5LJ3 d;  3CME T;  2XK0 A;  1JJ2 S;  4C8Q E;  1D3B A;  3FIF A;  4PLI A;  4GY5 A;  5FU7 B;  4M7A B;  2ZPG B;  1M1F A;  3BDL A;  1I8F A;  3PMT A;  5J39 A;  4M78 F;  3M9Q A;  4E7J A;  4M78 G;  3DB3 A;  1KC8 C;  1KC8 U;  4HCZ A;  1KD1 C;  1YCY A;  1KD1 U;  1ZQ1 A;  4C92 E;  4D6W A;  4C5I A;  4OB0 B;  4OGC A;  3CCS A;  3VYH B;  1M8V A;  3QXE B;  5LJ3 h;  3GLX A;  4L6V 5;  3CC4 A;  2LNV A;  1MHN A;  1KHI A;  4M7D C;  5A2Q E;  3M56 A;  3JCM d;  4JRI A;  3G71 A;  3OMG A;  4M7A F;  5LJ5 e;  1G5V A;  2E6Z A;  4M7A G;  4PJO E;  1VQ9 T;  5GAN 3;  1K9M C;  5HY6 A;  3CPW A;  1K9M U;  4JRK A;  2DXB A;  4YTL A;  1B34 B;  3JB9 H;  3BFM A;  5J3B A;  2L3R A;  5CKH A;  3LWI A;  3QZ5 B;  4ZGE B;  2LT1 A;  4A54 A;  5GAN 2;  3M57 A;  1MGQ A;  5GAN 4;  2ZPE B;  2R58 A;  3HRS A;  1PSE A;  3BDU A;  3DKM A;  3MP8 A;  4LD6 A;  4QVC A;  3CCJ A;  2DK3 A;  3OW2 S;  4EMK C;  4C8Q C;  4FU6 A;  3G4S A;  3JCM W;  2X4Y A;  3G6E A;  3GOX A;  1VQP T;  2LVM A;  4Z02 A;  3CCM A;  2CZ0 B;  3CCU T;  2WSE E;  2EFI A;  4JRP A;  3LGL A;  3OYD A;  4MZM A;  3CCQ T;  3MEV A;  2MMP A;  3CXC S;  2E6N A;  3HFO A;  2VXE A;  3MHX A;  4ME7 A;  4C92 C;  2O01 E;  4OVA A;  2ZPF B;  3RKY A;  4A4G A;  2ZGW A;  3JCM J;  1Q82 C;  1Q82 U;  5GAN d;  3UWN A;  1Y96 B;  2XKO C;  2XD0 A;  3QJ6 A;  3OMC A;  5D6Y A;  1UGS B;  2EAY A;  3CCV A;  5A0L A;  1M4Z A;  3UT1 A;  2RM4 A;  5GMK i;  4PJO C;  4IUU A;  4RCB A;  3LH0 A;  3OBY A;  4M7D A;  2QA4 A;  4BI8 B;  1UEB A;  2F5T X;  2KK4 A;  3L2U A;  2MAM A;  1VQM T;  3A8H B;  3V8L A;  5DLO A;  2YLC A;  2PVG B;  1O75 A;  4M77 D;  1OYX A;  3JB9 D;  2PUO B;  2QTX A;  4JJN K;  4IUR A;  4IUV A;  1TH7 A;  1BIA A;  1BKB A;  3SD4 A;  4J7I A;  4M78 E;  3OSS C;  3Q1J A;  3CBO A;  1YHQ A;  3CCL A;  2D0Q B;  1W4S A;  3M4G A;  2KSS A;  3A5Z B;  1V29 B;  4C8Q A;  5A0G A;  3LLR A;  4ZGJ B;  3UPU A;  3V7C A;  4J7F A;  3JB9 I;  3QDR B;  4BI3 A;  1YIJ T;  2DJZ A;  5GAN 7;  1BI2 A;  3MP6 A;  4IUP A;  1QVG A;  1KQS A;  3OYF A;  2RB6 A;  3O8V A;  1ZBX A;  3BY7 A;  4X9C A;  1YJ9 T;  2E65 A;  4C92 A;  5GAM h;  3CCR A;  2XG8 D;  1WJR A;  1U1T A;  1XOV A;  4M7A E;  3QSU A;  1VQN T;  3TU4 K;  4M77 B;  2L8D A;  4N4G A;  2YHT A;  2LRQ A;  2M16 A;  3OY9 A;  4OGE A;  3L2Q A;  2P0K A;  5LJ3 j;  4II1 A;  2CZ1 B;  4BE1 A;  2XHC A;  3DLM A;  1FXX A;  4PJO G;  4HCB A;  5GAM g;  3WVD B;  1K8A C;  1K8A U;  3OYM A;  1VQL T;  5CKD A;  2OTL T;  4MML A;  4KUI A;  3JCM e;  3E9G A;  2JTM A;  2JVV A;  4XTU A;  2RK1 A;  3JB9 F;  2KMT A;  4M77 F;  4QQD A;  2PQW A;  4M77 G;  4M75 D;  4M78 C;  1VQ8 A;  1U1S A;  3HPW A;  1Y71 A;  3M54 A;  2RI2 A;  2K5F A;  2V8J A;  3PTA A;  3DLL A;  5FU6 B;  1SSF A;  4PNO A;  5HKC A;  1BI0 A;  1OZ2 A;  4F7U A;  2DIQ A;  4LDV A;  3VUB A;  1M1K C;  1M1K U;  1VQO T;  2RO0 A;  2RJE A;  1VIE A;  2EJG A;  3J80 E;  4E7K A;  2CKK A;  5FU7 C;  5CKE A;  3GPL A;  4M7A C;  3TCJ A;  4EDU A;  1Q86 C;  1Q86 U;  2I2L A;  2HBP A;  1W2B S;  2JN0 A;  2KY9 A;  1WQ7 A;  3HP9 A;  1HK9 A;  2VYT A;  5LJ5 g;  2RHX A;  4E7L A;  1VQ5 T;  5FLX E;  2FL7 A;  2OTJ T;  3CPW S;  2P4T A;  4BUG A;  3N5B B;  4VUB A;  1FX7 A;  3EAE A;  4M75 B;  3QG1 A;  4LDW A;  4A4F A;  5KH6 A;  1YJW T;  5GAM f;  5GMK j;  1I5L A;  3X26 B;  2DTI A;  2AHJ B;  2EWN A;  4N4H A;  3E1S A;  2JZ2 A;  1M90 C;  1H64 1;  1M90 U;  1VQ6 A;  1JBM A;  2VGM A;  1D3B B;  5GAN j;  1G3W A;  1NJI U;  1PSF A;  3FDR A;  1WQW A;  3X25 B;  3BW1 A;  5KCH A;  1VQ4 A;  1NJI C;  2KVQ G;  5A0D A;  1XQH A;  1YI2 A;  5GAO n;  3C12 A;  1UGQ B;  3QJY A;  4M75 F;  4MZT A;  3SWN B;  3QO3 A;  2IVW A;  2LQK A;  4BB7 A;  3CMA A;  2RD1 A;  1KHC A;  3ZEH A;  3PGG A;  3JAM E;  2DD5 A;  5DLQ E;  4X9D A;  4HT9 A;  1K73 C;  2MI6 A;  1AHJ B;  2VUB A;  4J6Y A;  2K5I A;  4Y91 A;  3AHU A;  3KXT A;  1N6A A;  2FHD A;  4A53 A;  1VIF A;  3CCE A;  5CQX A;  4J5Y A;  5LJ5 f;  1VQ7 T;  4V2S A;  4BI4 A;  3OQ5 A;  2DIG A;  3WXM B;  2OAU A;  4NOY A;  3CCS T;  1GXI E;  1YIT A;  2XID A;  3VYG A;  4BY6 B;  3VKI A;  3CC4 T;  3VUZ A;  4JDS A;  3I55 A;  4M77 E;  1YJN A;  2R57 A;  4XU2 A;  3G71 T;  3V7R A;  2QQS A;  5IAY A;  1R8O B;  4FIB A;  2QEX A;  5I21 A;  5HK0 A;  4M7D D;  3J81 E;  4HKE A;  1XNI A;  3GP8 A;  2XDB A;  5CCA A;  3I56 A;  1HXD A;  3GF5 A;  1O9S A;  3MCA B;  3QPH A;  1VQP A;  3KUF A;  3CD6 T;  2KQW A;  3R6O A;  3OBW A;  1QVG S;  3EFS A;  2ZZD A;  3OS2 A;  5GAO r;  3NTK A;  2GFU A;  3CCJ T;  3QHS A;  4ZTF A;  3LWH A;  2B8A A;  3G4S T;  1BYM A;  5GAN 6;  1WJQ A;  3OS5 A;  1BIB A;  2M0O A;  4JLG A;  4C8Q D;  2H3J A;  3L2Z A;  4RMO A;  4C0D C;  1NPP A;  2ZPI B;  4OB3 B;  2DPP B;  4L59 A;  3T9N A;  1JJ2 A;  3PT9 A;  3RKW A;  3RMQ A;  2DZC A;  1Q7Y C;  2LQ8 A;  4FM4 B;  2JUF A;  3VU3 C;  1X6O A;  2EQU A;  4ZGD B;  3FJP A;  4M7D B;  2RHY A;  2DO3 A;  4OMF B;  1UGR B;  2LDM A;  2LCL A;  4RKU E;  2LCC A;  2M1H A;  4C92 D;  4QQ6 A;  3QKJ A;  4XTZ A;  4C0G A;  3OYY A;  2RI5 A;  3PNW C;  1X75 C;  4M77 C;  4KBM B;  4OP0 A;  3JCM g;  5GAM d;  2RJF A;  5GAO l;  3CCV T;  2C06 A;  3S3N A;  3X28 B;  2CS7 A;  2VV5 A;  2X4W A;  5CK9 A;  1LOJ A;  1QVF S;  2NLU A;  4XK8 E;  3QZ9 B;  5CIU A;  3L2W A;  2QDY B;  4L5G A;  4EMK A;  1VQK A;  2X4X A;  3MEU A;  3NTH A;  4M75 E;  2PVD B;  4FL6 A;  3QYG B;  4FSX A;  3L2R A;  3PIO A;  2DXT A;  4HT8 A;  1QP2 A;  3WVE B;  3CC2 A;  2EYQ A;  3E19 A;  2GQV A;  1VUB A;  3C4S A;  4N0A C;  5M9O A;  3NFC A;  5LJ3 e;  3LGF A;  3PMI A;  4B9X A;  1RL2 A;  2BKD N;  5I2S A;  1UB4 A;  4NS5 A;  3QBY A;  4C92 B;  4MDX A;  1YHQ T;  2O4X A;  3RUX A;  3CCL T;  4OF1 A;  2HD0 A;  3OW2 A;  4P5N A;  5FU6 C;  2QQB A;  1YJ9 A;  3V7S A;  2X35 A;  2E1H A;  3L1A A;  2F5K A;  4XTW A;  3JCM V;  4PJO A;  3EFR A;  4B9W A;  1QP3 A;  2VGN A;  4BAC A;  2PVO B;  4C0F A;  2R5M A;  4E7H A;  4XU1 A;  2WSC E;  3OYI A;  5C0M A;  3CXC A;  2E64 A;  2MWP A;  4OB2 B;  2DEQ A;  1Y07 A;  4FT4 A;  3RES A;  3JCM f;  3NTI A;  4CI0 C;  3JB9 G;  1VQL A;  2QQR A;  3S3O A;  1FWZ A;  1I4K 1;  2E41 A;  3HKS A;  4M75 C;  4O5V A;  3OA6 A;  3MEA A;  2ZPH B;  2FYK A;  3P8B B;  2K3Y A;  1S72 A;  2DTH A;  5LJ5 h;  5CO7 A;  1KQ1 A;  2RK2 A;  2E70 A;  3CBM A;  4F7U B;  3LW5 E;  5HK3 A;  3M4Y A;  2L89 A;  4C5E A;  1OI1 A;  1WJS A;  4XU0 A;  4Y28 E;  5EG2 A;  3RER A;  2E12 A;  2RHZ A;  2DTO A;  4A4E A;  5C6S A;  5I2M A;  4BE2 A;  1U8R A;  5GMK e;  2HNI A;  2EQJ A;  3C95 A;  5D6X A;  4M78 D;  2BUD A;  3ZBD A;  5DM7 R;  4R56 A;  3SWN C;  2MWO A;  3OYH A;  1KQ2 A;  3CPF A;  3CEY A;  2DKG A;  3URG A;  5GAN e;  2XDD A;  2YRV A;  4F7U F;  2OTJ A;  2R5A A;  2F69 A;  3HFN A;  3C94 A;  3A8O B;  4A4K A;  3CC7 T;  3FC3 A;  3OYN A;  3ER0 A;  2LT4 A;  3FB9 A;  2GCX A;  2QQA A;  4NL3 A;  2D9T A;  4E47 A;  4X34 A;  4XTY A;  1RI0 A;  3MP1 A;  3GNF B;  3VJP A;  3OS0 A;  3CME A;  2DD4 A;  5IN1 A;  3KBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...