1W4SA

Crystal structure of the proximal bah domain of polybromo
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
146
structure length
146
Chain Sequence
MYHVGDYVYVEPAEANLQPHIVCIERLWEDSAGEKWLYGCWFYRPNETFHLATRKFLEKEVFKSDYYNKVPVSKILGKCVVMFVKEYFKLCPENFRDEDVYVCESRYSAKTKSFKKIKLWTMPVSSVRFVPRDVPLPVVRVASVFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Proximal Bah Domain of the Polybromo Protein
pubmed doi rcsb
source organism Gallus gallus
molecule tags Nuclear protein
molecule keywords POLYBROMO 1 PROTEIN
total genus 30
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1w4sA00
4DA4A 3PT9A 4KULA 4JJNK 4DOVA 1ZHIA 4FT2A 4KUIA 4KUDK 1M4ZA 4FSXA 2FL7A 4DOWA 1W4SA 4FT4A 2FVUA 3TU4K 4LD9K 4BB7A 3PTAA 1ZBXA
chains in the Genus database with same CATH superfamily
5LJ5e 1UGVA 1AWWA 4Z89A 3OYJA 2DMOA 4HT9A 2DERA 2MWOA 4HCBA 4RG8A 5IT9E 2QEXA 4LN2A 4FL6A 4F16A 4XU2A 1NEBA 1QVPA 4JJDA 5HK0A 1PCXA 3LH5A 1Z9ZA 1RI0A 5GAMg 4B6MA 5GANj 2EYZA 1CKAA 4KGZB 4C5HA 4FT2A 2R5AA 1VQPT 4KUDK 5GAOn 4M75C 1I5OB 1MMNA 1VQ9T 1IB8A 5GANd 3ZEHA 2L89A 3QYHB 2VC8A 1ZSZC 5IXFA 3HRSA 1Q81U 1PRMC 2ZPBB 2KRMA 1UFFA 2DL3A 4NL2A 3BY7A 1YIJA 3OYLA 4CC2A 2J05A 2X3XD 4JUVA 2J6FA 1XOVA 5I2MA 4PJOE 2IVWA 5GMKi 1VQ7Q 1Y96A 1M9SA 1FWZA 1PD1A 3CXCA 2DTHA 5D6WA 1UG1A 3KBGA 4HVVA 3OB9A 1RACB 1AOJA 3EGDA 1SPKA 2FZGB 3F70A 1N8RR 4NOYA 2RH2A 4XU3A 3LLRA 2SRCA 4LDYA 2GTJA 1JQQA 5GMKm 3G71T 4RTUA 5GAOl 2QXFA 3OY9A 5KYWA 2EIFA 2LZ6B 1QW1A 3ER0A 4HXJA 1OOTA 2YT6A 4AG2C 2GQVA 2MAMA 2RHXA 1M2VA 5CKFA 1RL2A 3EG2A 2E3IA 3M0PA 3JB9J 2MF2A 1ZLMA 3G4SA 4M7DE 1GCQA 4OMPA 4DBQA 4JRPA 4PKCC 1VQLT 2KI7A 1I5LA 2JN0A 4EMGA 1GFDA 3OMGA 4A63B 1E6HA 2BUDA 1FMVA 1ZBXA 2XI9A 2QASA 2K5FA 4KBMB 1TWBA 4FW1A 1I4K1 4AG1C 1UJ0A 1BKBA 3VU3C 1VOMA 1VQ6Q 4N0AA 1U1SA 1WGSA 3OYDA 4LUEA 1QMCA 2MMPA 2BE7D 1GL5A 3A8LB 4CI0C 3CBMA 3L2VA 5FLXE 2CZ1B 2J7IA 4BY6B 4LD9K 2DJZA 2F69A 3RMSA 3CC7A 1QVFP 2OI3A 4CRIA 3A8HB 1ACMB 1UDLA 1YITT 2C0TA 2E1HA 3X20B 1M90U 1P92A 4ZTFA 2QQBA 2JTFA 3QJYA 4KH1B 5GAN3 2ZZDA 1YIJQ 3OA6A 1K1ZA 1YIJT 5LJ3f 4J9CA 3JCMQ 4IIOA 5GAN5 1KQ2A 1NLOC 2AZVA 2JJ9A 3J81E 3CD6Q 4JDSA 3CCLA 3CCSA 3OYHA 3HRUA 2JXBA 1OX9A 3O5ZA 2VVKA 5A0DA 4XTVA 5FRNA 4DBHA 2B86A 4M7DF 3LW5E 3GNFB 2W0ZA 2MYSA 2EKHA 2LQWA 3J80E 2R5MA 3M5AA 1OPLA 1UGQB 4HVWA 5LJ3j 2C0OA 2JS0A 1GBRA 3CCJA 2ENMA 4OB0B 3UA6A 4QQGA 5GANe 3QO3A 5KE2A 2OTJT 3HFOA 4FSSA 4GBQA 3FJ5A 2J06A 1N8RC 2L3QA 2V8IA 5LJ5d 2KROA 3CMAT 4MZTA 3E2UA 1XNIA 3I5RA 3SWNC 4PLIA 1D0ZA 2FPEA 2GNCA 4PLLA 1Y57A 1C6VX 1M30A 4C0FA 2FPDA 2VWFA 3PMTA 2L2PA 4XU1A 4XTXA 4E7IA 2O88A 1VQ5Q 1M1FA 1M4ZA 1I07A 3JCMh 2ESWA 4JPBW 3CMEA 2XMFA 4MZMA 3MJXA 3VKIA 4V2SA 1D1CA 4C0DC 1X01A 3G71A 2LT1A 3S3NA 2OTLT 1AEYA 3OYGA 3I56A 3CCVQ 2RF0A 3E1SA 5I21A 1B34A 3CC7Q 1YBYA 1ZA2B 4PJNA 3EHQA 4J6WA 5GAOp 1VQ7T 1OZ2A 4EMKA 3WVEB 3META 3CMEQ 1TUGB 2EKOA 4PK4A 5CKBA 3TQ7P 3HSBA 1TXQA 2K57A 1NYGA 3EFOB 3OYKA 5IHNA 2PQWA 4KUIA 3BDLA 3REBB 3CCQT 3V8LA 2BZYA 3TREA 5FRMA 3SB2A 2EQKA 4ZGJB 4R55A 4M7AB 3CC4A 1WYXA 1Q86U 1RAGB 4GLMA 2DTOA 3PIOA 2E3HA 2NWMA 3AHUA 2QG9B 3OW2S 2WACA 4L6V5 5KYUA 5J39A 4IUVA 2PVOB 4OGCA 4A53A 4XU0A 1Q7YU 3EAEA 4FYWB 2EGAA 1T3LA 1TOVA 4E7SA 3G71Q 4BDZA 3VRZA 4AFUC 2CUBA 4OVAA 2ED1A 2PVDB 1PWTA 2H3EB 3OYFA 3RBBB 5HK3A 5HY6A 1IGQA 1LPLA 2V8KA 2HBPA 4KULA 4PJOA 3CC4T 2NYSA 3HP9A 2MPXC 4OMLA 1YWPA 5LJ3e 5HCKA 1VQOA 1OV3A 2L3PA 4RTYA 2LX7A 2EAYA 4MDXA 3RKWA 2V8JA 3RERA 3OW2A 1SG5A 2COZA 2LRQA 3HKSA 2DJQA 3DLLA 1VQ7A 2RNAA 2DL8A 1ARKA 1X43A 1WDXA 1T0JA 3MEUA 1WZOA 2YUQA 3HRTA 1RAHB 3M59A 2ROLA 2CUDA 2RJFA 4QVZA 3UPUA 3R6OA 1YJNA 2AHJB 2LJ1A 3C95A 4PJOC 3JCMc 1Y7XA 1B34B 2BIVA 2NUTB 2C06A 4PL6A 4XK8E 5KYWB 5GAN8 4BE2A 1NJIR 1QVFS 3O8VA 1WJQA 1M1KC 2KRSA 2QA4A 2D8HA 5IHKA 2DD5A 4BI4A 3INZA 3OSSC 4F04B 3QDFA 2P0KA 5FW9A 3OYMA 2LCLA 2DL5A 1WFWA 2CT4A 2HBWA 2SEMA 3HL8A 3KFVA 4C8QA 3QWYA 3CC2T 4EIKA 2XDBA 1CKBA 2CT3A 1HJDA 2FO0A 1M27C 2KK4A 3WVDB 5CAIA 3I56T 2LX9A 2RQWA 2P84A 2JUFA 2YXYA 1QCFA 3URGA 4QT7A 2K7AA 3JB9F 3A1PA 1VQKT 3C4SA 1SHGA 3N5BB 3BDUA 3VS7A 4M75G 1SEMA 4FIBA 1X75C 1IHWA 1JU5C 2DF6A 3I55Q 3CBPA 3H0IA 1JXOA 1OX8A 3CXCS 3VYGA 1VQ6T 2CSIA 2DEQA 2DTIA 1ZHIA 1Y71A 4NS5A 1YJ9T 4EMHA 1UHCA 2PTKA 2Y4XA 4YTLA 3EG9B 2KEAA 3NHNA 3LGFA 3UWNA 3X25B 4E47A 2FYKA 4ESRA 3CC4Q 3GP8A 3OS0A 4OB2B 3VS1A 1SF9A 4M7DC 3BFMA 2QA4Q 2O31A 1G3TA 1VQMT 1D3BA 3OW2P 2VKNA 1YITA 1S1NA 4J83A 1MNDA 4J9IA 4FW2A 3V7SA 1YP5A 2YLBA 4RTWA 1Y0MA 2EYQA 3A5ZB 4M77E 3X28B 4F7UF 1U8RA 4LDVA 4BY6C 1K76A 3JCMV 4C0ZA 1YI2Q 3M9QA 1YWOA 5AT1B 4D8DA 3JB9H 5GANg 1WPYA 2EPDA 4LNPA 3S3MA 4UC4A 1YJWQ 2XDDA 1K0XA 2DE0X 1PSFA 2ZAEA 2OAWA 4PJLA 2I0NA 4IUQA 1YHQQ 2E5KA 1ZSGA 3H9NA 4XTYA 1PHTA 3VRYA 4N4IA 3CC7T 3A98A 1VQKA 5GAN7 4XQ3A 2DBKA 2A28A 1YN8A 4FSXA 2CP2A 2YLCA 1RADB 1H92A 2BZXA 3BW1A 1Q81C 4Z02A 1FXXA 1NLPC 4M78A 1JBMA 5L8RE 2YUNA 2ZGWA 4F7UG 4PJOD 5GMKh 1YJWA 1W2BP 3G7ZA 3EG1A 4C8QG 4JS4A 1UJYA 2CP6A 4JLGA 3JCMJ 3V7RA 1YCSB 2WSFE 1I8FA 4KT0E 3M4GA 5J3BA 4QKUA 4R56A 5GAOr 2LNHB 1WHGA 4EMKC 2RPNA 2CZ0B 3LWIA 4C0GA 1S72Q 3FJPA 2K3YA 3EGDB 1O75A 4LDUA 1KD1C 2X4XA 2DL4A 1IXDA 4M75E 1Q81R 1TG0A 1KIKA 3QZ9B 2WSCE 3VUZA 1JEGA 5M9OA 3V8KA 2D0NA 2M1HA 2E4HA 4A4GA 1G3SA 2HSEB 5LL6S 1D1AA 4DBFA 4J5YA 3H8ZA 2COYA 3PVQA 1KD1R 2CGHA 1VQNA 2L3RA 2QK0A 4OMQA 2VV5A 2AZSA 4WTOB 3ULRB 2QGGA 2YRCA 4RUGA 1KSWA 5AYFA 2GF7A 1SRMA 5GAOq 3RKYA 2PNIA 1M8VA 1RAEB 3OS5A 1RABB 3PGGA 1T0HA 3GPLA 1HXDA 2JS2A 1KQSP 2EYWA 2DEUA 3TU4K 1LOJA 2YUOA 2DVEA 2QI2A 3CCMA 2V26A 1E7OA 4JZ3A 3D7SB 3IQLA 3QSUA 1OU9A 2WSEE 4JZ4A 1SRLA 2X9HA 3VS6A 2QGFB 3CCLQ 1MMAA 1QWFA 4LXCA 2DK3A 3RKXA 3CCUT 3MEWA 1Q82R 2DFUA 2PVGB 3DLMA 1OZ3A 5KYUB 3M53A 2G6FX 2LJ3A 3M54A 1NZ9A 1UGRB 2YDLA 1ZBJA 1TUDA 1SSHA 2L3SA 1QLYA 2K4YA 4M77D 3SWNB 3VV0A 1ABQA 3CCEA 2KXCA 2FG0A 5LJ3g 3QJ6A 4HT8A 1R77A 3OQ5A 2PUKB 3MHXA 1M8MA 2YHTA 2HEQA 1H3HA 1B3QA 2V1QA 4M78B 4IUPA 4PNOA 3MEVA 4ORZA 1VQLQ 1PRLC 2HKNA 4M7AD 1RLQC 1VQ9Q 2RJEA 3DB3A 2X4JA 3LWHA 2BZ8A 1J3TA 2P0QA 4HA8A 3JCMX 1VQMA 1M2OA 3P8DA 4A4EA 1K8AC 3P8BB 2COWA 3KUFA 1ZQ1A 5LJ5g 1K0SA 5CKHA 2G3RA 3GIBA 4GY5A 4QQDA 4FM4B 4HCCA 1QCOA 1MV0B 2CZ6B 3CCVT 4B9WA 2HKQB 2JM8A 4PJMA 1NYFA 1U1TA 4DOWA 5KYYB 2JMAA 2D1XA 2KDSA 4XAXB 3QHSA 1DJ7B 2DAQA 3CCEQ 1BU1A 2D9TA 4TVRA 1K73C 2XICA 2P4RA 4MDWA 2RQVA 1K9MR 1XQHA 2MOXA 3GNGA 1ZUUA 2HCKA 1TSFA 2IPOB 2EQUA 2DVJA 1X6OA 3VS0A 3QKJA 2FPFA 3CCRT 2A08A 1HD3A 1GRIA 2FRYA 4BE1A 5GMKe 1QP2A 2E6NA 5CQXA 2GBQA 1FMWA 3JB9G 4C92G 2OAUA 2LQNA 3JRZA 3CC2A 2RI2A 3OYAA 3DKMA 2FL7A 3JCMg 1IZ6A 4LD6A 2E10A 5IXBA 2MWPA 2XK0A 1N8RU 1R0CB 2K5LA 1WX6A 3L2WA 4BD3A 1EFNA 2QAZA 1W6XA 4C8QE 2QDLA 4O6JA 1E6GA 1WXUA 1TU0B 4P5NA 3M57A 5FWCA 1G3YA 2CP7A 1VQ4T 3NTKA 3CBOA 1PM3A 5GAN6 1RLPC 1X27A 1B07A 1K9AA 4M7DD 1LCKA 3I35A 1VQ5T 1BB9A 1JRIA 2YSQA 1YJ9A 8AT1B 4QQ6A 5IH2A 2JNGA 2AKLA 1N9SA 5GAMf 1G2BA 4II1A 1KD1U 2QTXA 3OMCA 1T3SA 1KC8U 3OYEA 4C0DB 3CMET 1M1KR 2OJ2A 4RCBA 2EGCA 3CCQQ 3EG3A 1W4SA 1EIFA 2DIQA 4PJJA 4M77A 4J9DA 1QVGS 1Q95G 2EGEA 3L2QA 2DL7A 2ZPFB 2OTJA 5CVIA 4ZN3A 3OYNA 3X24B 2VASA 5GMKl 2JM9A 2DYBA 2ECZA 1OPKA 1OQKA 2DETA 3SHWA 1WLPB 1U5SA 2GFUA 4EDUA 4JJBA 1D09B 4J7FA 3PNWC 3EGUA 1KQSS 2RMOA 4FYXB 4J9BA 3TVTA 3L2UA 4DA4A 1AD5A 1TUCA 2P0PA 5I11A 3G6EA 1W1FA 1IO6A 2K6DA 3VJPA 2JTEA 2XKOC 2VGMA 2KR3A 3C0CA 1RAIB 3JB9D 1VQKQ 4KH0B 5CQYA 1AWJA 2OTJQ 3MKDA 4HKEA 5GANf 1NBEB 2QQ9A 2HQHA 2KT1A 3VUBA 3L2RA 5A0GA 2CKKA 1WJSA 5C6SA 2CH4A 1BCMA 2I2LA 5FU6B 4CC3A 2OX7A 4AFSC 2JW4A 1X6GA 2MI6A 1VQPQ 1KK7A 1RAAB 1Y96B 1M2VB 1WQWA 1CSKA 1YHQT 1BK2A 3G6EQ 1MNEA 1C0MA 2YUPA 4MMKA 4F7UA 2PZ1A 2DD4A 3JCMW 5GMKj 3JB9I 2KT8A 4ZGEB 1PC0A 2D8JA 4M78G 1X2KA 2RJDA 3QIIA 5GAMd 2GFAA 2DKGA 3ASKA 2RO0A 3G4SQ 4VUBA 1FYNA 2XIDA 3ZFJA 1BYMA 2E64A 5C0MA 2F2VA 1VA7A 1VQPA 1N27A 2DA9A 1BCOA 3JCMf 4ME7A 1M3AA 3TCJA 2R58A 2YRVA 3RDVA 4PFPA 1AHJB 4F7UB 3EHRA 4LUDA 2DO3A 3QDRB 4RTVA 3H6ZA 3CD6T 4M75F 4J9FA 1O9SA 1BIAA 5GJWB 2LQKA 2F2WA 1UGPB 2HD0A 1AVZC 4N0AC 1WXBA 2DRMA 7AT1B 4FYYB 1YITQ 4N4HA 2DBMA 3AT1B 4N4GA 4X1VA 1H3ZA 4Q5WA 4M77G 4M78D 1K73U 2PUOB 1ZSZA 2EJFA 2DXTA 2EWNA 2LTOA 1MMGA 1QKXA 2O4XB 2DPPB 4A4HA 2ZPHB 5IAYA 5GAMe 1M3CA 1IGUA 4JJCA 4KGVB 1OI1A 1KQ1A 3EG0A 3CPWS 1QP3A 1TTHB 2OTLA 2RHIA 1GCQC 1MHNA 1GCPA 4JS5A 4MMLA 3RESA 1V29B 2RI3A 3OS2A 1UE9A 3CPFA 3NTHA 2DRKA 2QEXT 4PJOF 2NLUA 1MGQA 2K9GA 4AT1B 5DLOA 1BI0A 3EGXA 2KVQG 3M0TA 3OYCA 5FU6C 2LCSA 2VB6A 3RNJA 3CMAA 2K2MA 4J7IA 3ME9A 4FT4A 1X2QA 2KXDA 1NPPA 3UA7A 2RHUA 4F7UE 1G5VA 2RHYA 2CH4W 2HQEA 5GAN4 1VIFA 5A2QE 2O9SA 4ELZC 1M1GA 1QWEA 2FRWA 2PU9B 2A3LA 4RMOA 2E65A 1VYVA 2V1RA 3M58A 3U23A 3CCVA 1KG1A 3SDZA 2LCCA 2X4WA 4BDYA 1H641 1YNZA 1Q82U 1K9MU 3PT9A 4E7KA 1IRXA 4ANJA 2EQMA 1SHFA 5ECAA 3CEYA 2XU8A 2F5TX 1KHCA 1NJIC 2LC4A 4PJOB 3GF5A 2ZPGB 5KCHA 1K4US 1M3BA 2QYZA 4M7DG 3CPWP 1IHVA 3UDCA 1PKSA 1VQ8A 5A0LA 3C12A 1JJ2S 4M77C 2X51A 1W2BA 1YHQA 2LP5A 3VYHB 4JJNK 1X69A 2GQIA 2R57A 4A54A 1LVKA 1WHLA 5J26A 3OBYA 2LJ0A 1W70A 2P4TA 3ZL7C 1Q86C 1MV3A 1AZGB 2M0YA 2RQRA 3E9FA 4RTXA 4E2FB 5CKDA 2QEXQ 4ZTJA 1GXIE 3PTAA 4L59A 1GFCA 1I81A 2ROTA 3JSCA 2RK2A 5KYXA 2MIOA 4CC7A 4C92D 1N6AA 1Q7YC 3E9GA 3LYIA 4DBRA 2JOYA 4XTZA 3THKA 2HSPA 4CC4B 3JAME 2M0OA 4RTTA 3JCMb 2HNIA 3SEMA 2GGRA 1JO8A 4QVCA 1OU8A 3S3OA 4C92B 2ABLA 4OMMA 4C92E 2XG8D 4ATOA 1AWOA 1U3OA 1NG2A 3FDRA 2RM4A 3OYYA 1QKWA 4C92C 1WHKA 1VQ8Q 1HK9A 2KAFA 2DM1A 2GTOA 2CP3A 2LVMA 3HFNA 4IURA 4M75B 4Z88A 2QA4T 3M0UA 3QBYA 3FRNA 2EVRA 4IKFA 4OGEA 5FROA 5KE3A 3CCSQ 3SD4A 2KMTA 2M51A 4RG2A 1V76A 2NUTA 9ATCB 1OEBA 1JJ2A 3KXTA 2X35A 4DEYA 4M4ZA 1Y07A 1XJWB 4M75D 1WQ7A 4OMOA 1KC8R 3CCMT 4E6RA 1A0NB 3MEAA 4D8KA 4M7DA 2DZCA 2DXBA 2ZPEB 2JZ2A 2IG0A 2DLPA 1JXMA 4LE9A 4J6XA 3UF4A 3PMIA 3PIPA 3UT1A 3I56Q 4M78F 2D0QB 2A37A 2MCNA 4Z8AA 1WJRA 3EH2A 4Y91A 2DNUA 4A4KA 5EC7A 2W10A 5EG2A 2A7YA 3FB9A 5HKCA 2HL5C 4LDWA 3TSZA 1PNJA 2NUPB 1NM7A 2RD1A 2CREA 1X6BA 3H0HA 1RI9A 2HQXA 3JCMd 5GANh 4M75A 4R0KA 1D1BA 1MMDA 1ZA1B 2X3WD 4E7HA 1K8AU 5GAMj 1K73R 1PD0A 2E70A 2M02A 1JJ2P 4M77F 2KNBB 2QQRA 4KGXB 5CCAA 3BE3A 1WA7A 4RKUE 4ZNXA 2CZ7B 1WHMA 2ZPIB 4WCIA 5LJ3h 1AT1B 3M56A 1D3BB 1SSFA 3NGPA 2JT4A 4C5IA 1WXTA 2KQWA 5DLQE 4M7AC 3QPHA 1UTIA 2E5QA 1VQNQ 4AMCA 1QVFA 3FC3A 1I1JA 4QVDA 5DM7R 2RA2A 4PFOA 4B9XA 1V1CA 1Q86R 2HMAA 3MO8A 1ZUKA 2M16A 3H41A 1F1BB 1TS9A 2LNVA 3M55A 2LQ8A 1D0XA 2JVVA 3M0RA 2DXUA 1UEBA 4IIMA 3FEOA 3HPWA 3FIFA 5LJ5h 2DILA 4EPCA 2EJGA 1PKTA 2KY9A 2DXCA 1Q82C 1B7TA 2H8HA 4Y92A 4IUTA 3L42A 2F2XA 2Y90A 2CS7A 3EFSA 5FU7B 1SKUB 2IIMA 2FEIA 3GLXA 4F14A 4M7AG 3H0FA 4M78E 4AFQC 3ZBDA 2EW3A 2FZCB 1BI3A 5CK9A 1QCNA 2LMJA 3HHTB 1YCYA 3EFRA 1YJNQ 2XD0A 5KH6A 4BE0A 3R6NA 1JB0E 5D6YA 2F1LA 3CQTA 4PJOG 1M90C 2VYTA 1VQOQ 3Q1JA 4C5EA 4X34A 3NTIA 1NPRA 2RB6A 1YFNA 1LJOA 3I55A 2CDTA 3CCQA 1RAFB 4FYVB 1U06A 3NMZC 2BTTA 2CP5A 1G83A 2C0IA 2EQIA 3CD6A 3FLGA 2ED0A 2EQJA 1QQJA 4OF1A 4JRKA 3L2ZA 3A8GB 3QUIA 1BI1A 2L8DA 2OTLQ 2RN8A 3OYBA 3LH0A 2MK5A 4RTZA 3LX7A 5GAMh 3L1AA 2FZKB 2LT4A 5KCOA 3JCMP 4X9CA 3X26B 1KQSA 1H8KA 3VS3A 3CCRQ 5I2SA 3QZ5B 4DEXA 1D0YA 2Z0WA 3S6WA 4QW2A 2QTVA 1VYUA 1BBZA 2EBPA 2EYYA 1EX4A 1PG5B 2XDPA 4C8QF 1ZUYA 2GCXA 3EGXB 4HCZA 1YI2A 4JRQA 2K5IA 3RMQA 3J7AF 3VS4A 2JMCA 2K3BA 2VGNA 4ZN1A 2BE9B 1M5Q1 4L5GA 3REAB 1NE8A 2BKDN 2KRNA 1AWXA 3TEEA 5CO7A 5I22A 4BI3A 3OS1A 1KHIA 1KJWA 1ZSZB 4BUGA 4E7LA 3QG1A 4BACA 3GBQA 4J9GA 2O9VA 3CCJQ 1G8XA 2J6OA 4C8QB 4J9EA 1G3WA 3SWNA 2CSQA 3PFSA 1YJNT 5KYYA 3G6ET 5GJVB 4M78C 1VQLA 3I9QA 1Z9QA 4J9HA 1S72T 1VQ9A 3NPFA 1VIEA 1R0BG 1QVGP 1UB4A 2M9UA 2FHDA 1ZX6A 3M0QA 2KGTA 1VQOT 3VS2A 4GLKA 8ATCB 1WHJA 2X4YA 5CIUA 4C8QD 3GOXA 2FB7A 1QVGA 2RK1A 3SFMA 1UECA 4X9DA 2EYXA 3A8OB 3CCRA 4M77B 1N9RA 5DY9A 1EZZB 2RI5A 3QWXX 4LDXA 1WIEA 1BI2A 1ABOA 2EJ9A 2K2VA 3EH1A 2L5QA 3CXCP 5D7UA 3V8JA 1S72A 2J6KA 2NUZA 1OYXA 3EFOA 5IN1A 1VQMQ 3CCLT 6AT1B 4M7AE 2AT1B 3E19A 4ELYC 1VQNT 5LJ5f 1OULA 2D6FA 4M7AA 1W2BS 2KBTA 4O5VA 1M90R 2O2OA 4C8QC 2E6ZA 2H3JA 1RUWA 2F5KA 5GAN2 3CCUQ 4ZGDB 2HL3A 4RCCA 4BI8B 1LNXA 3OSVA 1VQ4A 4K11A 2CYZB 2JTMA 2EFIA 1M1KU 1GBQA 2YWWA 5KYXB 2E41A 2YRDA 3M4YA 2KE9A 1WNLA 3CMAQ 4FCYA 3T9NA 3NFCA 3CC2Q 4EMKB 2RQUA 2QQSA 5CR2A 1HYOA 4HCKA 3QYGB 4OMNA 3CCET 1VQ5A 4OB3B 2HDAA 4M7AF 1PSEA 2ZCFB 2ATCB 2RJCA 2LDMA 3CCST 1IREB 4J6YA 4OB1B 3DB4A 2HAXA 2DZ9A 2QQAA 1VQ4Q 1VQ6A 5LJ3d 4XTUA 1VQ8T 4Y28E 2DX1A 5FU7C 2L0AA 4E7ZA 4OP0A 2NUPA 5CKEA 4IUUA 3RIRA 5KYNA 1YJ9Q 4XTWA 3OBWA 4PFZA 1UGSB 4A4FA 2VUBA 4WF2A 2A0FB 2K3XA 3CPWA 3HTRA 5IHIA 4E7JA 3I55T 1NJIU 2Y4YA 3CCMQ 1K8AR 3JV3A 3P8HA 1YJWT 4KRTA 5GAOm 3RUXA 3CCUA 3QXEB 4M7DB 3VS5A 2AK5A 3G1JA 2DIGA 2E12A 3PE0A 3RR6A 1AZEA 2VXEA 3TSWA 2KYBA 5D6XA 3JCMe 2B8AA 4DQ2A 3EG9A 4C92F 1TH7A 2AIRB 3OYIA 4JRIA 3I5SA 4J8OA 4OMFB 3MP8A 2RHZA 2AKKA 1NEGA 2HZYA 3A8MB 1FMKA 1UUEA 2O01E 5L23A 3LGLA 1HSQA 2K79A 3MCAB 1Q7YR 4D6WA 2VXFA 3MP1A 1KFZA 1K9MC 2KSSA 1KC8C 4MZPA 4AFZC 4HVUA 1YI2T 2O4XA 4C92A 1N5ZA 2KYMA 2DYIA 2A36A 1VUBA 1C1AA 2FVUA 1BIBA 1VYTA 1WI7A 3M0SA 1FX7A 2CP0A 3MP6A 1I0CA 4C5GA 4JLIA 3PVLA 1XTDA 4DOVA 2QDYB 3WXMB 1MUZA 2XHCA 5FWBA 2RQTA 4F17A 1WHHA 5LJ5j 1UHFA 4NL3A 3UATA 3V7CA 3MPUB 4FU6A 3C94A 3CCJT 4BB7A 1R8OB 3G4ST
chains in the Genus database with same CATH topology
5CCAA 3L2QA 2KK4A 3WVDB 5LJ5e 5CAIA 4RKUE 3I56T 2LX9A 2CZ7B 2ZPFB 2OTJA 3OYJA 5CVIA 2JUFA 4ZN3A 3OYNA 2ZPIB 3X24B 4HT9A 5LJ3h 5GMKl 3URGA 4E47A 3M56A 3JB9F 1D3BB 2MWOA 4HCBA 4RG8A 5IT9E 1SSFA 2GFUA 4EDUA 2QEXA 3C4SA 1VQKT 4FL6A 3N5BB 4C5IA 4J7FA 2KQWA 3BDUA 3PNWC 5DLQE 4XU2A 4M7AC 4M75G 1KQSS 1QVPA 3QPHA 4FIBA 5HK0A 1X75C 2E5QA 1RI0A 3L2UA 4DA4A 5GAMg 3FC3A 3CBPA 1QVFA 5GANj 4QVDA 5DM7R 2P0PA 3CXCS 2RA2A 3VYGA 3G6EA 1VQ6T 2DEQA 4C5HA 4B9XA 2DTIA 1ZHIA 4FT2A 3VJPA 1Y71A 4NS5A 2R5AA 1VQPT 2XKOC 2VGMA 5GAOn 4EMHA 1YJ9T 4KUDK 4M75C 3MO8A 2M16A 1VQ9T 3JB9D 2Y4XA 5GANd 3ZEHA 2LNVA 5CQYA 2L89A 3QYHB 2VC8A 2LQ8A 3LGFA 3M55A 2FYKA 2JVVA 4HKEA 3X25B 2DXUA 1UEBA 3HRSA 3GP8A 1Q81U 5GANf 2ZPBB 3OS0A 3FEOA 2QQ9A 4OB2B 3HPWA 3FIFA 3VUBA 5A0GA 2CKKA 2EJGA 4EPCA 5LJ5h 3L2RA 4M7DC 1WJSA 2KY9A 5C6SA 3BFMA 2DXCA 1G3TA 4NL2A 1VQMT 1D3BA 3BY7A 2I2LA 5FU6B 1Q82C 1YIJA 3OYLA 1YITA 2MI6A 4IUTA 3L42A 2Y90A 4JUVA 1XOVA 4J83A 1Y96B 5I2MA 4PJOE 1WQWA 1YHQT 2CS7A 3V7SA 3EFSA 2IVWA 2YLBA 2EYQA 3A5ZB 5FU7B 5GMKi 1Y96A 4M77E 1M9SA 1FWZA 4MMKA 4F7UA 3CXCA 2DTHA 2DD4A 5D6WA 3JCMW 3X28B 3GLXA 4F7UF 5GMKj 3JB9I 1U8RA 4M7AG 4M78E 4ZGEB 4LDVA 3ZBDA 4BY6C 4M78G 1BI3A 2RJDA 5CK9A 3QIIA 5GAMd 2GFAA 3KBGA 3HHTB 1YCYA 2DKGA 3EFRA 3ASKA 3JCMV 3OB9A 2XD0A 5KH6A 2RO0A 4C0ZA 4BE0A 3M9QA 3F70A 4NOYA 4VUBA 2RH2A 4XU3A 1JB0E 2XIDA 5D6YA 4PJOG 3ZFJA 3LLRA 1M90C 1BYMA 2E64A 2VYTA 3JB9H 4LDYA 5C0MA 5GMKm 5GANg 3G71T 5GAOl 1WPYA 3Q1JA 3S3MA 4UC4A 2QXFA 4C5EA 4X34A 3NTIA 2XDDA 3OY9A 2EIFA 3ER0A 1QW1A 1N27A 1VQPA 1PSFA 3JCMf 4ME7A 1NPRA 2RB6A 3TCJA 1LJOA 3I55A 2R58A 2YRVA 3CCQA 1AHJB 4F7UB 2GQVA 4IUQA 2DO3A 3CD6A 3QDRB 2MAMA 3H6ZA 2RHXA 4XTYA 3FLGA 5CKFA 3CD6T 4N4IA 4M75F 3CC7T 2EQJA 1VQKA 1RL2A 5GAN7 4XQ3A 4OF1A 4FSXA 3JB9J 2MF2A 2YLCA 3UWNA 1O9SA 4JRKA 1BIAA 3BW1A 3G4SA 4M7DE 1Q81C 3L2ZA 4JRPA 4PKCC 4Z02A 1VQLT 1FXXA 1I5LA 2JN0A 3A8GB 3QUIA 1JBMA 1BI1A 2LQKA 4M78A 1UGPB 2HD0A 5L8RE 3OMGA 2L8DA 2ZGWA 4EMGA 4N0AC 2BUDA 4F7UG 3OYBA 1ZBXA 4PJOD 2XI9A 5GMKh 1YJWA 3LH0A 5GAMh 3LX7A 4N4HA 3G7ZA 3L1AA 2K5FA 4C8QG 4JS4A 4N4GA 4KBMB 2LT4A 1H3ZA 4Q5WA 1I4K1 5KCOA 3JCMP 4X9CA 3X26B 1BKBA 1KQSA 4JLGA 4M77G 3VU3C 4M78D 5I2SA 2PUOB 3QZ5B 4N0AA 3JCMJ 3V7RA 1U1SA 1WGSA 1K73U 2EJFA 2DXTA 2WSFE 1I8FA 3OYDA 2MMPA 4KT0E 3M4GA 3S6WA 3A8LB 5J3BA 2EWNA 2LTOA 3CBMA 4QW2A 4CI0C 4R56A 3L2VA 5GAOr 5FLXE 2O4XB 2DPPB 4A4HA 2CZ1B 4EMKC 4BY6B 2ZPHB 2CZ0B 5IAYA 2DJZA 2F69A 5GAMe 4C0GA 3RMSA 3LWIA 3CC7A 4LD9K 3FJPA 2K3YA 1O75A 2XDPA 4CRIA 1OI1A 4C8QF 2GCXA 4LDUA 3A8HB 4HCZA 1YI2A 1YITT 1KQ1A 4JRQA 2K5IA 2X4XA 1QP3A 3RMQA 3CPWS 1KD1C 3J7AF 4M75E 2E1HA 3X20B 1M90U 2VGNA 2RHIA 2OTLA 3QZ9B 4ZN1A 2WSCE 3VUZA 1MHNA 1P92A 5M9OA 2QQBA 2JTFA 3QJYA 4ZTFA 3V8KA 4L5GA 1M5Q1 2M1HA 4MMLA 4YTLA 5GAN3 2ZZDA 1NE8A 4JS5A 3RESA 4A4GA 2BKDN 1G3SA 1V29B 2RI3A 3OS2A 3OA6A 3TEEA 5CO7A 5LL6S 4BI3A 3OS1A 1KHIA 4J5YA 3CPFA 3H8ZA 3NTHA 4BUGA 4E7LA 1YIJT 5LJ3f 3QG1A 4BACA 2QEXT 2CGHA 4PJOF 3JCMQ 5GAN5 2L3RA 2NLUA 1KQ2A 1VQNA 1MGQA 4C8QB 3J81E 1G3WA 2VV5A 3SWNA 5DLOA 1BI0A 3PFSA 4JDSA 1YJNT 3G6ET 3CCLA 3CCSA 2KVQG 4M78C 3OYCA 1VQLA 5FU6C 5AYFA 2GF7A 3OYHA 1S72T 1VQ9A 5GAOq 3RKYA 3HRUA 1VIEA 3CMAA 1M8VA 3OS5A 4J7IA 5A0DA 4XTVA 1UB4A 3ME9A 5FRNA 2M9UA 2FHDA 3PGGA 4FT4A 1VQOT 3GPLA 1HXDA 4GLKA 3LW5E 4M7DF 2X4YA 3TU4K 5CIUA 1LOJA 3GNFB 4C8QD 2DVEA 3GOXA 2FB7A 1NPPA 2QI2A 3CCMA 2RK1A 2RHUA 3J80E 1QVGA 2R5MA 3M5AA 1UGQB 4F7UE 5LJ3j 1G5VA 2RHYA 3SFMA 4X9DA 2HQEA 3QSUA 2WSEE 3A8OB 3CCRA 5GAN4 1VIFA 4M77B 5A2QE 3CCJA 1N9RA 5DY9A 4ELZC 2RI5A 4OB0B 4LDXA 1M1GA 4QQGA 5GANe 2PU9B 3QO3A 3RKXA 5KE2A 2DK3A 3CCUT 2A3LA 1BI2A 4RMOA 2E65A 3M58A 3MEWA 2OTJT 2EJ9A 2K2VA 3HFOA 2L5QA 3CCVA 1KG1A 3SDZA 3V8JA 1N8RC 2V8IA 2PVGB 5LJ5d 3DLMA 2LCCA 1S72A 3CMAT 1OZ3A 4MZTA 1XNIA 3M53A 2X4WA 3M54A 1H641 4PLIA 1NZ9A 3SWNC 4BDYA 4PLLA 1OYXA 1Q82U 1K9MU 1UGRB 3PT9A 5IN1A 4E7KA 4C0FA 2EQMA 3SWNB 2K4YA 3PMTA 4M77D 3VV0A 3CCLT 4M7AE 3E19A 1VQNT 4ELYC 3CCEA 4XU1A 3CEYA 4XTXA 4E7IA 2XU8A 5LJ5f 5LJ3g 1M1FA 1M4ZA 2F5TX 1KHCA 3QJ6A 4HT8A 2D6FA 1NJIC 3OQ5A 3JCMh 4M7AA 3CMEA 2LC4A 4MZMA 1W2BS 4PJOB 3GF5A 2ZPGB 3VKIA 5KCHA 4V2SA 4O5VA 4C0DC 4C8QC 1X01A 2E6ZA 2PUKB 2H3JA 3G71A 2F5KA 3UDCA 5GAN2 4ZGDB 3MHXA 4M7DG 2YHTA 4RCCA 1VQ8A 5A0LA 4BI8B 1LNXA 2LT1A 3C12A 3OSVA 4M77C 1VQ4A 1JJ2S 3S3NA 2CYZB 4M78B 2OTLT 1W2BA 1YHQA 2JTMA 2EFIA 4IUPA 1M1KU 3OYGA 4PNOA 3I56A 3MEVA 2E41A 3E1SA 3VYHB 3M4YA 5I21A 4JJNK 4M7AD 1B34A 2RJEA 3DB3A 1WNLA 2X4JA 3LWHA 1YBYA 2P0QA 3T9NA 4HA8A 3NFCA 3JCMX 4EMKB 1VQMA 2R57A 3P8DA 2QQSA 4A54A 5CR2A 4J6WA 4A4EA 1K8AC 5J26A 3OBYA 3QYGB 5GAOp 3P8BB 1VQ7T 1OZ2A 2P4TA 4EMKA 1VQ5A 3CCET 4OB3B 3WVEB 1Q86C 3KUFA 4ZTJA 3META 1PSEA 1ZQ1A 3E9FA 5CKDA 5LJ5g 4M7AF 2EKOA 5CKBA 2ZCFB 3PTAA 4L59A 5CKHA 2G3RA 2RJCA 1I81A 3GIBA 2LDMA 3CCST 1IREB 3JSCA 4GY5A 4QQDA 2RK2A 4FM4B 3HSBA 4J6YA 4OB1B 4HCCA 2K57A 3DB4A 3OYKA 2HAXA 2DZ9A 2CZ6B 2QQAA 3CCVT 4C92D 1VQ6A 2PQWA 4B9WA 1N6AA 4KUIA 5LJ3d 1Q7YC 1GXIE 3E9GA 4XTUA 1VQ8T 4Y28E 3LYIA 5FU7C 1U1TA 3BDLA 3CCQT 4DOWA 3V8LA 4OP0A 3TREA 2JOYA 4XTZA 3SB2A 2EQKA 2KDSA 5CKEA 4ZGJB 4M7AB 4R55A 4XAXB 3CC4A 4IUUA 3QHSA 3RIRA 1Q86U 2DTOA 3JAME 2M0OA 3PIOA 4XTWA 2HNIA 3JCMb 1DJ7B 3OBWA 2DAQA 3AHUA 1UGSB 4A4FA 4QVCA 3S3OA 2VUBA 4WF2A 3OW2S 4C92B 2WACA 2K3XA 4L6V5 2D9TA 3CPWA 4E7JA 4C92E 3I55T 4TVRA 5J39A 2XICA 2XG8D 2Y4YA 1K73C 1NJIU 4MDWA 4IUVA 4ATOA 2PVOB 1XQHA 4OGCA 4A53A 3P8HA 4XU0A 3EAEA 1YJWT 3FDRA 1Q7YU 2RM4A 3OYYA 5GAOm 4BDZA 3RUXA 3GNGA 3CCUA 3QXEB 4C92C 4M7DB 2DIGA 2E12A 1HK9A 2EQUA 2KAFA 2LVMA 3HFNA 4IURA 4M75B 1X6OA 2VXEA 4OVAA 2QA4T 3QKJA 2PVDB 3FRNA 3QBYA 3CCRT 5FRMA 4IKFA 1QVGS 3OYFA 5D6XA 4OGEA 5FROA 1QP2A 5GMKe 4BE1A 2E6NA 5CQXA 3JCMe 2B8AA 5KE3A 3SD4A 5HK3A 4DQ2A 3JB9G 4C92G 2OAUA 2KMTA 2V8KA 4RG2A 2HBPA 1TH7A 4KULA 5HY6A 4C92F 4PJOA 3CC4T 3HP9A 3OYIA 3JRZA 3CC2A 2RI2A 4JRIA 1JJ2A 3OYAA 3DKMA 3KXTA 2FL7A 3JCMg 2X35A 1IZ6A 4LD6A 2E10A 4J8OA 2MWPA 2XK0A 5LJ3e 1Y07A 1VQOA 4OMFB 4M75D 3MP8A 2RHZA 1WQ7A 3A8MB 2EAYA 2O01E 1N8RU 3LGLA 3CCMT 2K5LA 3L2WA 4BD3A 3MCAB 4MDXA 4C8QE 4O6JA 2VXFA 3MEAA 3MP1A 3RKWA 2V8JA 4D6WA 4M7DA 3RERA 3OW2A 2DZCA 2DXBA 1K9MC 2ZPEB 2JZ2A 2IG0A 2LRQA 3HKSA 2KSSA 3DLLA 4P5NA 1KC8C 1VQ7A 4J6XA 3M57A 1G3YA 3PMIA 3PIPA 3UT1A 4MZPA 1VQ4T 3NTKA 3MEUA 4M78F 2D0QB 2O4XA 4C92A 3CBOA 1YI2T 3HRTA 5GAN6 3M59A 1WJRA 1VUBA 4Y91A 2RJFA 4QVZA 2FVUA 4A4KA 3UPUA 3R6OA 1YJNA 4M7DD 1VQ5T 2AHJB 1JRIA 1BIBA 3C95A 1YJ9A 5EG2A 4PJOC 2A7YA 1Y7XA 1FX7A 3FB9A 3JCMc 5HKCA 1B34B 2BIVA 4QQ6A 2JNGA 3MP6A 4LDWA 4PL6A 4XK8E 5GAN8 4BE2A 2C06A 1QVFS 3O8VA 1WJQA 1M1KC 4C5GA 1N9SA 4JLIA 5GAMf 2QA4A 2RD1A 4II1A 1XTDA 4DOVA 2QDYB 3WXMB 1KD1U 2XHCA 2QTXA 2DD5A 3OMCA 4BI4A 3INZA 1KC8U 3OSSC 3OYEA 4C0DB 3CMET 2P0KA 2HQXA 3JCMd 5GANh 4M75A 3OYMA 4RCBA 2LCLA 1W4SA 4E7HA 3HL8A 1K8AU 5LJ5j 5GAMj 4NL3A 1EIFA 4C8QA 2E70A 2DIQA 3V7CA 3CC2T 4M77F 4FU6A 3C94A 3CCJT 4BB7A 2XDBA 4M77A 1R8OB 2QQRA 3G4ST
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DA4 A;  3PT9 A;  4KUL A;  4JJN K;  4DOV A;  1ZHI A;  4FT2 A;  4KUI A;  4KUD K;  1M4Z A;  4FSX A;  2FL7 A;  4DOW A;  1W4S A;  4FT4 A;  2FVU A;  3TU4 K;  4LD9 K;  4BB7 A;  3PTA A;  1ZBX A; 
#chains in the Genus database with same CATH topology
 5LJ5 e;  1UGV A;  1AWW A;  4Z89 A;  3OYJ A;  2DMO A;  4HT9 A;  2DER A;  2MWO A;  4HCB A;  4RG8 A;  5IT9 E;  2QEX A;  4LN2 A;  4FL6 A;  4F16 A;  4XU2 A;  1NEB A;  1QVP A;  4JJD A;  5HK0 A;  1PCX A;  3LH5 A;  1Z9Z A;  1RI0 A;  5GAM g;  4B6M A;  5GAN j;  2EYZ A;  1CKA A;  4KGZ B;  4C5H A;  4FT2 A;  2R5A A;  1VQP T;  4KUD K;  5GAO n;  4M75 C;  1I5O B;  1MMN A;  1VQ9 T;  1IB8 A;  5GAN d;  3ZEH A;  2L89 A;  3QYH B;  2VC8 A;  1ZSZ C;  5IXF A;  3HRS A;  1Q81 U;  1PRM C;  2ZPB B;  2KRM A;  1UFF A;  2DL3 A;  4NL2 A;  3BY7 A;  1YIJ A;  3OYL A;  4CC2 A;  2J05 A;  2X3X D;  4JUV A;  2J6F A;  1XOV A;  5I2M A;  4PJO E;  2IVW A;  5GMK i;  1VQ7 Q;  1Y96 A;  1M9S A;  1FWZ A;  1PD1 A;  3CXC A;  2DTH A;  5D6W A;  1UG1 A;  3KBG A;  4HVV A;  3OB9 A;  1RAC B;  1AOJ A;  3EGD A;  1SPK A;  2FZG B;  3F70 A;  1N8R R;  4NOY A;  2RH2 A;  4XU3 A;  3LLR A;  2SRC A;  4LDY A;  2GTJ A;  1JQQ A;  5GMK m;  3G71 T;  4RTU A;  5GAO l;  2QXF A;  3OY9 A;  5KYW A;  2EIF A;  2LZ6 B;  1QW1 A;  3ER0 A;  4HXJ A;  1OOT A;  2YT6 A;  4AG2 C;  2GQV A;  2MAM A;  2RHX A;  1M2V A;  5CKF A;  1RL2 A;  3EG2 A;  2E3I A;  3M0P A;  3JB9 J;  2MF2 A;  1ZLM A;  3G4S A;  4M7D E;  1GCQ A;  4OMP A;  4DBQ A;  4JRP A;  4PKC C;  1VQL T;  2KI7 A;  1I5L A;  2JN0 A;  4EMG A;  1GFD A;  3OMG A;  4A63 B;  1E6H A;  2BUD A;  1FMV A;  1ZBX A;  2XI9 A;  2QAS A;  2K5F A;  4KBM B;  1TWB A;  4FW1 A;  1I4K 1;  4AG1 C;  1UJ0 A;  1BKB A;  3VU3 C;  1VOM A;  1VQ6 Q;  4N0A A;  1U1S A;  1WGS A;  3OYD A;  4LUE A;  1QMC A;  2MMP A;  2BE7 D;  1GL5 A;  3A8L B;  4CI0 C;  3CBM A;  3L2V A;  5FLX E;  2CZ1 B;  2J7I A;  4BY6 B;  4LD9 K;  2DJZ A;  2F69 A;  3RMS A;  3CC7 A;  1QVF P;  2OI3 A;  4CRI A;  3A8H B;  1ACM B;  1UDL A;  1YIT T;  2C0T A;  2E1H A;  3X20 B;  1M90 U;  1P92 A;  4ZTF A;  2QQB A;  2JTF A;  3QJY A;  4KH1 B;  5GAN 3;  2ZZD A;  1YIJ Q;  3OA6 A;  1K1Z A;  1YIJ T;  5LJ3 f;  4J9C A;  3JCM Q;  4IIO A;  5GAN 5;  1KQ2 A;  1NLO C;  2AZV A;  2JJ9 A;  3J81 E;  3CD6 Q;  4JDS A;  3CCL A;  3CCS A;  3OYH A;  3HRU A;  2JXB A;  1OX9 A;  3O5Z A;  2VVK A;  5A0D A;  4XTV A;  5FRN A;  4DBH A;  2B86 A;  4M7D F;  3LW5 E;  3GNF B;  2W0Z A;  2MYS A;  2EKH A;  2LQW A;  3J80 E;  2R5M A;  3M5A A;  1OPL A;  1UGQ B;  4HVW A;  5LJ3 j;  2C0O A;  2JS0 A;  1GBR A;  3CCJ A;  2ENM A;  4OB0 B;  3UA6 A;  4QQG A;  5GAN e;  3QO3 A;  5KE2 A;  2OTJ T;  3HFO A;  4FSS A;  4GBQ A;  3FJ5 A;  2J06 A;  1N8R C;  2L3Q A;  2V8I A;  5LJ5 d;  2KRO A;  3CMA T;  4MZT A;  3E2U A;  1XNI A;  3I5R A;  3SWN C;  4PLI A;  1D0Z A;  2FPE A;  2GNC A;  4PLL A;  1Y57 A;  1C6V X;  1M30 A;  4C0F A;  2FPD A;  2VWF A;  3PMT A;  2L2P A;  4XU1 A;  4XTX A;  4E7I A;  2O88 A;  1VQ5 Q;  1M1F A;  1M4Z A;  1I07 A;  3JCM h;  2ESW A;  4JPB W;  3CME A;  2XMF A;  4MZM A;  3MJX A;  3VKI A;  4V2S A;  1D1C A;  4C0D C;  1X01 A;  3G71 A;  2LT1 A;  3S3N A;  2OTL T;  1AEY A;  3OYG A;  3I56 A;  3CCV Q;  2RF0 A;  3E1S A;  5I21 A;  1B34 A;  3CC7 Q;  1YBY A;  1ZA2 B;  4PJN A;  3EHQ A;  4J6W A;  5GAO p;  1VQ7 T;  1OZ2 A;  4EMK A;  3WVE B;  3MET A;  3CME Q;  1TUG B;  2EKO A;  4PK4 A;  5CKB A;  3TQ7 P;  3HSB A;  1TXQ A;  2K57 A;  1NYG A;  3EFO B;  3OYK A;  5IHN A;  2PQW A;  4KUI A;  3BDL A;  3REB B;  3CCQ T;  3V8L A;  2BZY A;  3TRE A;  5FRM A;  3SB2 A;  2EQK A;  4ZGJ B;  4R55 A;  4M7A B;  3CC4 A;  1WYX A;  1Q86 U;  1RAG B;  4GLM A;  2DTO A;  3PIO A;  2E3H A;  2NWM A;  3AHU A;  2QG9 B;  3OW2 S;  2WAC A;  4L6V 5;  5KYU A;  5J39 A;  4IUV A;  2PVO B;  4OGC A;  4A53 A;  4XU0 A;  1Q7Y U;  3EAE A;  4FYW B;  2EGA A;  1T3L A;  1TOV A;  4E7S A;  3G71 Q;  4BDZ A;  3VRZ A;  4AFU C;  2CUB A;  4OVA A;  2ED1 A;  2PVD B;  1PWT A;  2H3E B;  3OYF A;  3RBB B;  5HK3 A;  5HY6 A;  1IGQ A;  1LPL A;  2V8K A;  2HBP A;  4KUL A;  4PJO A;  3CC4 T;  2NYS A;  3HP9 A;  2MPX C;  4OML A;  1YWP A;  5LJ3 e;  5HCK A;  1VQO A;  1OV3 A;  2L3P A;  4RTY A;  2LX7 A;  2EAY A;  4MDX A;  3RKW A;  2V8J A;  3RER A;  3OW2 A;  1SG5 A;  2COZ A;  2LRQ A;  3HKS A;  2DJQ A;  3DLL A;  1VQ7 A;  2RNA A;  2DL8 A;  1ARK A;  1X43 A;  1WDX A;  1T0J A;  3MEU A;  1WZO A;  2YUQ A;  3HRT A;  1RAH B;  3M59 A;  2ROL A;  2CUD A;  2RJF A;  4QVZ A;  3UPU A;  3R6O A;  1YJN A;  2AHJ B;  2LJ1 A;  3C95 A;  4PJO C;  3JCM c;  1Y7X A;  1B34 B;  2BIV A;  2NUT B;  2C06 A;  4PL6 A;  4XK8 E;  5KYW B;  5GAN 8;  4BE2 A;  1NJI R;  1QVF S;  3O8V A;  1WJQ A;  1M1K C;  2KRS A;  2QA4 A;  2D8H A;  5IHK A;  2DD5 A;  4BI4 A;  3INZ A;  3OSS C;  4F04 B;  3QDF A;  2P0K A;  5FW9 A;  3OYM A;  2LCL A;  2DL5 A;  1WFW A;  2CT4 A;  2HBW A;  2SEM A;  3HL8 A;  3KFV A;  4C8Q A;  3QWY A;  3CC2 T;  4EIK A;  2XDB A;  1CKB A;  2CT3 A;  1HJD A;  2FO0 A;  1M27 C;  2KK4 A;  3WVD B;  5CAI A;  3I56 T;  2LX9 A;  2RQW A;  2P84 A;  2JUF A;  2YXY A;  1QCF A;  3URG A;  4QT7 A;  2K7A A;  3JB9 F;  3A1P A;  1VQK T;  3C4S A;  1SHG A;  3N5B B;  3BDU A;  3VS7 A;  4M75 G;  1SEM A;  4FIB A;  1X75 C;  1IHW A;  1JU5 C;  2DF6 A;  3I55 Q;  3CBP A;  3H0I A;  1JXO A;  1OX8 A;  3CXC S;  3VYG A;  1VQ6 T;  2CSI A;  2DEQ A;  2DTI A;  1ZHI A;  1Y71 A;  4NS5 A;  1YJ9 T;  4EMH A;  1UHC A;  2PTK A;  2Y4X A;  4YTL A;  3EG9 B;  2KEA A;  3NHN A;  3LGF A;  3UWN A;  3X25 B;  4E47 A;  2FYK A;  4ESR A;  3CC4 Q;  3GP8 A;  3OS0 A;  4OB2 B;  3VS1 A;  1SF9 A;  4M7D C;  3BFM A;  2QA4 Q;  2O31 A;  1G3T A;  1VQM T;  1D3B A;  3OW2 P;  2VKN A;  1YIT A;  1S1N A;  4J83 A;  1MND A;  4J9I A;  4FW2 A;  3V7S A;  1YP5 A;  2YLB A;  4RTW A;  1Y0M A;  2EYQ A;  3A5Z B;  4M77 E;  3X28 B;  4F7U F;  1U8R A;  4LDV A;  4BY6 C;  1K76 A;  3JCM V;  4C0Z A;  1YI2 Q;  3M9Q A;  1YWO A;  5AT1 B;  4D8D A;  3JB9 H;  5GAN g;  1WPY A;  2EPD A;  4LNP A;  3S3M A;  4UC4 A;  1YJW Q;  2XDD A;  1K0X A;  2DE0 X;  1PSF A;  2ZAE A;  2OAW A;  4PJL A;  2I0N A;  4IUQ A;  1YHQ Q;  2E5K A;  1ZSG A;  3H9N A;  4XTY A;  1PHT A;  3VRY A;  4N4I A;  3CC7 T;  3A98 A;  1VQK A;  5GAN 7;  4XQ3 A;  2DBK A;  2A28 A;  1YN8 A;  4FSX A;  2CP2 A;  2YLC A;  1RAD B;  1H92 A;  2BZX A;  3BW1 A;  1Q81 C;  4Z02 A;  1FXX A;  1NLP C;  4M78 A;  1JBM A;  5L8R E;  2YUN A;  2ZGW A;  4F7U G;  4PJO D;  5GMK h;  1YJW A;  1W2B P;  3G7Z A;  3EG1 A;  4C8Q G;  4JS4 A;  1UJY A;  2CP6 A;  4JLG A;  3JCM J;  3V7R A;  1YCS B;  2WSF E;  1I8F A;  4KT0 E;  3M4G A;  5J3B A;  4QKU A;  4R56 A;  5GAO r;  2LNH B;  1WHG A;  4EMK C;  2RPN A;  2CZ0 B;  3LWI A;  4C0G A;  1S72 Q;  3FJP A;  2K3Y A;  3EGD B;  1O75 A;  4LDU A;  1KD1 C;  2X4X A;  2DL4 A;  1IXD A;  4M75 E;  1Q81 R;  1TG0 A;  1KIK A;  3QZ9 B;  2WSC E;  3VUZ A;  1JEG A;  5M9O A;  3V8K A;  2D0N A;  2M1H A;  2E4H A;  4A4G A;  1G3S A;  2HSE B;  5LL6 S;  1D1A A;  4DBF A;  4J5Y A;  3H8Z A;  2COY A;  3PVQ A;  1KD1 R;  2CGH A;  1VQN A;  2L3R A;  2QK0 A;  4OMQ A;  2VV5 A;  2AZS A;  4WTO B;  3ULR B;  2QGG A;  2YRC A;  4RUG A;  1KSW A;  5AYF A;  2GF7 A;  1SRM A;  5GAO q;  3RKY A;  2PNI A;  1M8V A;  1RAE B;  3OS5 A;  1RAB B;  3PGG A;  1T0H A;  3GPL A;  1HXD A;  2JS2 A;  1KQS P;  2EYW A;  2DEU A;  3TU4 K;  1LOJ A;  2YUO A;  2DVE A;  2QI2 A;  3CCM A;  2V26 A;  1E7O A;  4JZ3 A;  3D7S B;  3IQL A;  3QSU A;  1OU9 A;  2WSE E;  4JZ4 A;  1SRL A;  2X9H A;  3VS6 A;  2QGF B;  3CCL Q;  1MMA A;  1QWF A;  4LXC A;  2DK3 A;  3RKX A;  3CCU T;  3MEW A;  1Q82 R;  2DFU A;  2PVG B;  3DLM A;  1OZ3 A;  5KYU B;  3M53 A;  2G6F X;  2LJ3 A;  3M54 A;  1NZ9 A;  1UGR B;  2YDL A;  1ZBJ A;  1TUD A;  1SSH A;  2L3S A;  1QLY A;  2K4Y A;  4M77 D;  3SWN B;  3VV0 A;  1ABQ A;  3CCE A;  2KXC A;  2FG0 A;  5LJ3 g;  3QJ6 A;  4HT8 A;  1R77 A;  3OQ5 A;  2PUK B;  3MHX A;  1M8M A;  2YHT A;  2HEQ A;  1H3H A;  1B3Q A;  2V1Q A;  4M78 B;  4IUP A;  4PNO A;  3MEV A;  4ORZ A;  1VQL Q;  1PRL C;  2HKN A;  4M7A D;  1RLQ C;  1VQ9 Q;  2RJE A;  3DB3 A;  2X4J A;  3LWH A;  2BZ8 A;  1J3T A;  2P0Q A;  4HA8 A;  3JCM X;  1VQM A;  1M2O A;  3P8D A;  4A4E A;  1K8A C;  3P8B B;  2COW A;  3KUF A;  1ZQ1 A;  5LJ5 g;  1K0S A;  5CKH A;  2G3R A;  3GIB A;  4GY5 A;  4QQD A;  4FM4 B;  4HCC A;  1QCO A;  1MV0 B;  2CZ6 B;  3CCV T;  4B9W A;  2HKQ B;  2JM8 A;  4PJM A;  1NYF A;  1U1T A;  4DOW A;  5KYY B;  2JMA A;  2D1X A;  2KDS A;  4XAX B;  3QHS A;  1DJ7 B;  2DAQ A;  3CCE Q;  1BU1 A;  2D9T A;  4TVR A;  1K73 C;  2XIC A;  2P4R A;  4MDW A;  2RQV A;  1K9M R;  1XQH A;  2MOX A;  3GNG A;  1ZUU A;  2HCK A;  1TSF A;  2IPO B;  2EQU A;  2DVJ A;  1X6O A;  3VS0 A;  3QKJ A;  2FPF A;  3CCR T;  2A08 A;  1HD3 A;  1GRI A;  2FRY A;  4BE1 A;  5GMK e;  1QP2 A;  2E6N A;  5CQX A;  2GBQ A;  1FMW A;  3JB9 G;  4C92 G;  2OAU A;  2LQN A;  3JRZ A;  3CC2 A;  2RI2 A;  3OYA A;  3DKM A;  2FL7 A;  3JCM g;  1IZ6 A;  4LD6 A;  2E10 A;  5IXB A;  2MWP A;  2XK0 A;  1N8R U;  1R0C B;  2K5L A;  1WX6 A;  3L2W A;  4BD3 A;  1EFN A;  2QAZ A;  1W6X A;  4C8Q E;  2QDL A;  4O6J A;  1E6G A;  1WXU A;  1TU0 B;  4P5N A;  3M57 A;  5FWC A;  1G3Y A;  2CP7 A;  1VQ4 T;  3NTK A;  3CBO A;  1PM3 A;  5GAN 6;  1RLP C;  1X27 A;  1B07 A;  1K9A A;  4M7D D;  1LCK A;  3I35 A;  1VQ5 T;  1BB9 A;  1JRI A;  2YSQ A;  1YJ9 A;  8AT1 B;  4QQ6 A;  5IH2 A;  2JNG A;  2AKL A;  1N9S A;  5GAM f;  1G2B A;  4II1 A;  1KD1 U;  2QTX A;  3OMC A;  1T3S A;  1KC8 U;  3OYE A;  4C0D B;  3CME T;  1M1K R;  2OJ2 A;  4RCB A;  2EGC A;  3CCQ Q;  3EG3 A;  1W4S A;  1EIF A;  2DIQ A;  4PJJ A;  4M77 A;  4J9D A;  1QVG S;  1Q95 G;  2EGE A;  3L2Q A;  2DL7 A;  2ZPF B;  2OTJ A;  5CVI A;  4ZN3 A;  3OYN A;  3X24 B;  2VAS A;  5GMK l;  2JM9 A;  2DYB A;  2ECZ A;  1OPK A;  1OQK A;  2DET A;  3SHW A;  1WLP B;  1U5S A;  2GFU A;  4EDU A;  4JJB A;  1D09 B;  4J7F A;  3PNW C;  3EGU A;  1KQS S;  2RMO A;  4FYX B;  4J9B A;  3TVT A;  3L2U A;  4DA4 A;  1AD5 A;  1TUC A;  2P0P A;  5I11 A;  3G6E A;  1W1F A;  1IO6 A;  2K6D A;  3VJP A;  2JTE A;  2XKO C;  2VGM A;  2KR3 A;  3C0C A;  1RAI B;  3JB9 D;  1VQK Q;  4KH0 B;  5CQY A;  1AWJ A;  2OTJ Q;  3MKD A;  4HKE A;  5GAN f;  1NBE B;  2QQ9 A;  2HQH A;  2KT1 A;  3VUB A;  3L2R A;  5A0G A;  2CKK A;  1WJS A;  5C6S A;  2CH4 A;  1BCM A;  2I2L A;  5FU6 B;  4CC3 A;  2OX7 A;  4AFS C;  2JW4 A;  1X6G A;  2MI6 A;  1VQP Q;  1KK7 A;  1RAA B;  1Y96 B;  1M2V B;  1WQW A;  1CSK A;  1YHQ T;  1BK2 A;  3G6E Q;  1MNE A;  1C0M A;  2YUP A;  4MMK A;  4F7U A;  2PZ1 A;  2DD4 A;  3JCM W;  5GMK j;  3JB9 I;  2KT8 A;  4ZGE B;  1PC0 A;  2D8J A;  4M78 G;  1X2K A;  2RJD A;  3QII A;  5GAM d;  2GFA A;  2DKG A;  3ASK A;  2RO0 A;  3G4S Q;  4VUB A;  1FYN A;  2XID A;  3ZFJ A;  1BYM A;  2E64 A;  5C0M A;  2F2V A;  1VA7 A;  1VQP A;  1N27 A;  2DA9 A;  1BCO A;  3JCM f;  4ME7 A;  1M3A A;  3TCJ A;  2R58 A;  2YRV A;  3RDV A;  4PFP A;  1AHJ B;  4F7U B;  3EHR A;  4LUD A;  2DO3 A;  3QDR B;  4RTV A;  3H6Z A;  3CD6 T;  4M75 F;  4J9F A;  1O9S A;  1BIA A;  5GJW B;  2LQK A;  2F2W A;  1UGP B;  2HD0 A;  1AVZ C;  4N0A C;  1WXB A;  2DRM A;  7AT1 B;  4FYY B;  1YIT Q;  4N4H A;  2DBM A;  3AT1 B;  4N4G A;  4X1V A;  1H3Z A;  4Q5W A;  4M77 G;  4M78 D;  1K73 U;  2PUO B;  1ZSZ A;  2EJF A;  2DXT A;  2EWN A;  2LTO A;  1MMG A;  1QKX A;  2O4X B;  2DPP B;  4A4H A;  2ZPH B;  5IAY A;  5GAM e;  1M3C A;  1IGU A;  4JJC A;  4KGV B;  1OI1 A;  1KQ1 A;  3EG0 A;  3CPW S;  1QP3 A;  1TTH B;  2OTL A;  2RHI A;  1GCQ C;  1MHN A;  1GCP A;  4JS5 A;  4MML A;  3RES A;  1V29 B;  2RI3 A;  3OS2 A;  1UE9 A;  3CPF A;  3NTH A;  2DRK A;  2QEX T;  4PJO F;  2NLU A;  1MGQ A;  2K9G A;  4AT1 B;  5DLO A;  1BI0 A;  3EGX A;  2KVQ G;  3M0T A;  3OYC A;  5FU6 C;  2LCS A;  2VB6 A;  3RNJ A;  3CMA A;  2K2M A;  4J7I A;  3ME9 A;  4FT4 A;  1X2Q A;  2KXD A;  1NPP A;  3UA7 A;  2RHU A;  4F7U E;  1G5V A;  2RHY A;  2CH4 W;  2HQE A;  5GAN 4;  1VIF A;  5A2Q E;  2O9S A;  4ELZ C;  1M1G A;  1QWE A;  2FRW A;  2PU9 B;  2A3L A;  4RMO A;  2E65 A;  1VYV A;  2V1R A;  3M58 A;  3U23 A;  3CCV A;  1KG1 A;  3SDZ A;  2LCC A;  2X4W A;  4BDY A;  1H64 1;  1YNZ A;  1Q82 U;  1K9M U;  3PT9 A;  4E7K A;  1IRX A;  4ANJ A;  2EQM A;  1SHF A;  5ECA A;  3CEY A;  2XU8 A;  2F5T X;  1KHC A;  1NJI C;  2LC4 A;  4PJO B;  3GF5 A;  2ZPG B;  5KCH A;  1K4U S;  1M3B A;  2QYZ A;  4M7D G;  3CPW P;  1IHV A;  3UDC A;  1PKS A;  1VQ8 A;  5A0L A;  3C12 A;  1JJ2 S;  4M77 C;  2X51 A;  1W2B A;  1YHQ A;  2LP5 A;  3VYH B;  4JJN K;  1X69 A;  2GQI A;  2R57 A;  4A54 A;  1LVK A;  1WHL A;  5J26 A;  3OBY A;  2LJ0 A;  1W70 A;  2P4T A;  3ZL7 C;  1Q86 C;  1MV3 A;  1AZG B;  2M0Y A;  2RQR A;  3E9F A;  4RTX A;  4E2F B;  5CKD A;  2QEX Q;  4ZTJ A;  1GXI E;  3PTA A;  4L59 A;  1GFC A;  1I81 A;  2ROT A;  3JSC A;  2RK2 A;  5KYX A;  2MIO A;  4CC7 A;  4C92 D;  1N6A A;  1Q7Y C;  3E9G A;  3LYI A;  4DBR A;  2JOY A;  4XTZ A;  3THK A;  2HSP A;  4CC4 B;  3JAM E;  2M0O A;  4RTT A;  3JCM b;  2HNI A;  3SEM A;  2GGR A;  1JO8 A;  4QVC A;  1OU8 A;  3S3O A;  4C92 B;  2ABL A;  4OMM A;  4C92 E;  2XG8 D;  4ATO A;  1AWO A;  1U3O A;  1NG2 A;  3FDR A;  2RM4 A;  3OYY A;  1QKW A;  4C92 C;  1WHK A;  1VQ8 Q;  1HK9 A;  2KAF A;  2DM1 A;  2GTO A;  2CP3 A;  2LVM A;  3HFN A;  4IUR A;  4M75 B;  4Z88 A;  2QA4 T;  3M0U A;  3QBY A;  3FRN A;  2EVR A;  4IKF A;  4OGE A;  5FRO A;  5KE3 A;  3CCS Q;  3SD4 A;  2KMT A;  2M51 A;  4RG2 A;  1V76 A;  2NUT A;  9ATC B;  1OEB A;  1JJ2 A;  3KXT A;  2X35 A;  4DEY A;  4M4Z A;  1Y07 A;  1XJW B;  4M75 D;  1WQ7 A;  4OMO A;  1KC8 R;  3CCM T;  4E6R A;  1A0N B;  3MEA A;  4D8K A;  4M7D A;  2DZC A;  2DXB A;  2ZPE B;  2JZ2 A;  2IG0 A;  2DLP A;  1JXM A;  4LE9 A;  4J6X A;  3UF4 A;  3PMI A;  3PIP A;  3UT1 A;  3I56 Q;  4M78 F;  2D0Q B;  2A37 A;  2MCN A;  4Z8A A;  1WJR A;  3EH2 A;  4Y91 A;  2DNU A;  4A4K A;  5EC7 A;  2W10 A;  5EG2 A;  2A7Y A;  3FB9 A;  5HKC A;  2HL5 C;  4LDW A;  3TSZ A;  1PNJ A;  2NUP B;  1NM7 A;  2RD1 A;  2CRE A;  1X6B A;  3H0H A;  1RI9 A;  2HQX A;  3JCM d;  5GAN h;  4M75 A;  4R0K A;  1D1B A;  1MMD A;  1ZA1 B;  2X3W D;  4E7H A;  1K8A U;  5GAM j;  1K73 R;  1PD0 A;  2E70 A;  2M02 A;  1JJ2 P;  4M77 F;  2KNB B;  2QQR A;  4KGX B;  5CCA A;  3BE3 A;  1WA7 A;  4RKU E;  4ZNX A;  2CZ7 B;  1WHM A;  2ZPI B;  4WCI A;  5LJ3 h;  1AT1 B;  3M56 A;  1D3B B;  1SSF A;  3NGP A;  2JT4 A;  4C5I A;  1WXT A;  2KQW A;  5DLQ E;  4M7A C;  3QPH A;  1UTI A;  2E5Q A;  1VQN Q;  4AMC A;  1QVF A;  3FC3 A;  1I1J A;  4QVD A;  5DM7 R;  2RA2 A;  4PFO A;  4B9X A;  1V1C A;  1Q86 R;  2HMA A;  3MO8 A;  1ZUK A;  2M16 A;  3H41 A;  1F1B B;  1TS9 A;  2LNV A;  3M55 A;  2LQ8 A;  1D0X A;  2JVV A;  3M0R A;  2DXU A;  1UEB A;  4IIM A;  3FEO A;  3HPW A;  3FIF A;  5LJ5 h;  2DIL A;  4EPC A;  2EJG A;  1PKT A;  2KY9 A;  2DXC A;  1Q82 C;  1B7T A;  2H8H A;  4Y92 A;  4IUT A;  3L42 A;  2F2X A;  2Y90 A;  2CS7 A;  3EFS A;  5FU7 B;  1SKU B;  2IIM A;  2FEI A;  3GLX A;  4F14 A;  4M7A G;  3H0F A;  4M78 E;  4AFQ C;  3ZBD A;  2EW3 A;  2FZC B;  1BI3 A;  5CK9 A;  1QCN A;  2LMJ A;  3HHT B;  1YCY A;  3EFR A;  1YJN Q;  2XD0 A;  5KH6 A;  4BE0 A;  3R6N A;  1JB0 E;  5D6Y A;  2F1L A;  3CQT A;  4PJO G;  1M90 C;  2VYT A;  1VQO Q;  3Q1J A;  4C5E A;  4X34 A;  3NTI A;  1NPR A;  2RB6 A;  1YFN A;  1LJO A;  3I55 A;  2CDT A;  3CCQ A;  1RAF B;  4FYV B;  1U06 A;  3NMZ C;  2BTT A;  2CP5 A;  1G83 A;  2C0I A;  2EQI A;  3CD6 A;  3FLG A;  2ED0 A;  2EQJ A;  1QQJ A;  4OF1 A;  4JRK A;  3L2Z A;  3A8G B;  3QUI A;  1BI1 A;  2L8D A;  2OTL Q;  2RN8 A;  3OYB A;  3LH0 A;  2MK5 A;  4RTZ A;  3LX7 A;  5GAM h;  3L1A A;  2FZK B;  2LT4 A;  5KCO A;  3JCM P;  4X9C A;  3X26 B;  1KQS A;  1H8K A;  3VS3 A;  3CCR Q;  5I2S A;  3QZ5 B;  4DEX A;  1D0Y A;  2Z0W A;  3S6W A;  4QW2 A;  2QTV A;  1VYU A;  1BBZ A;  2EBP A;  2EYY A;  1EX4 A;  1PG5 B;  2XDP A;  4C8Q F;  1ZUY A;  2GCX A;  3EGX B;  4HCZ A;  1YI2 A;  4JRQ A;  2K5I A;  3RMQ A;  3J7A F;  3VS4 A;  2JMC A;  2K3B A;  2VGN A;  4ZN1 A;  2BE9 B;  1M5Q 1;  4L5G A;  3REA B;  1NE8 A;  2BKD N;  2KRN A;  1AWX A;  3TEE A;  5CO7 A;  5I22 A;  4BI3 A;  3OS1 A;  1KHI A;  1KJW A;  1ZSZ B;  4BUG A;  4E7L A;  3QG1 A;  4BAC A;  3GBQ A;  4J9G A;  2O9V A;  3CCJ Q;  1G8X A;  2J6O A;  4C8Q B;  4J9E A;  1G3W A;  3SWN A;  2CSQ A;  3PFS A;  1YJN T;  5KYY A;  3G6E T;  5GJV B;  4M78 C;  1VQL A;  3I9Q A;  1Z9Q A;  4J9H A;  1S72 T;  1VQ9 A;  3NPF A;  1VIE A;  1R0B G;  1QVG P;  1UB4 A;  2M9U A;  2FHD A;  1ZX6 A;  3M0Q A;  2KGT A;  1VQO T;  3VS2 A;  4GLK A;  8ATC B;  1WHJ A;  2X4Y A;  5CIU A;  4C8Q D;  3GOX A;  2FB7 A;  1QVG A;  2RK1 A;  3SFM A;  1UEC A;  4X9D A;  2EYX A;  3A8O B;  3CCR A;  4M77 B;  1N9R A;  5DY9 A;  1EZZ B;  2RI5 A;  3QWX X;  4LDX A;  1WIE A;  1BI2 A;  1ABO A;  2EJ9 A;  2K2V A;  3EH1 A;  2L5Q A;  3CXC P;  5D7U A;  3V8J A;  1S72 A;  2J6K A;  2NUZ A;  1OYX A;  3EFO A;  5IN1 A;  1VQM Q;  3CCL T;  6AT1 B;  4M7A E;  2AT1 B;  3E19 A;  4ELY C;  1VQN T;  5LJ5 f;  1OUL A;  2D6F A;  4M7A A;  1W2B S;  2KBT A;  4O5V A;  1M90 R;  2O2O A;  4C8Q C;  2E6Z A;  2H3J A;  1RUW A;  2F5K A;  5GAN 2;  3CCU Q;  4ZGD B;  2HL3 A;  4RCC A;  4BI8 B;  1LNX A;  3OSV A;  1VQ4 A;  4K11 A;  2CYZ B;  2JTM A;  2EFI A;  1M1K U;  1GBQ A;  2YWW A;  5KYX B;  2E41 A;  2YRD A;  3M4Y A;  2KE9 A;  1WNL A;  3CMA Q;  4FCY A;  3T9N A;  3NFC A;  3CC2 Q;  4EMK B;  2RQU A;  2QQS A;  5CR2 A;  1HYO A;  4HCK A;  3QYG B;  4OMN A;  3CCE T;  1VQ5 A;  4OB3 B;  2HDA A;  4M7A F;  1PSE A;  2ZCF B;  2ATC B;  2RJC A;  2LDM A;  3CCS T;  1IRE B;  4J6Y A;  4OB1 B;  3DB4 A;  2HAX A;  2DZ9 A;  2QQA A;  1VQ4 Q;  1VQ6 A;  5LJ3 d;  4XTU A;  1VQ8 T;  4Y28 E;  2DX1 A;  5FU7 C;  2L0A A;  4E7Z A;  4OP0 A;  2NUP A;  5CKE A;  4IUU A;  3RIR A;  5KYN A;  1YJ9 Q;  4XTW A;  3OBW A;  4PFZ A;  1UGS B;  4A4F A;  2VUB A;  4WF2 A;  2A0F B;  2K3X A;  3CPW A;  3HTR A;  5IHI A;  4E7J A;  3I55 T;  1NJI U;  2Y4Y A;  3CCM Q;  1K8A R;  3JV3 A;  3P8H A;  1YJW T;  4KRT A;  5GAO m;  3RUX A;  3CCU A;  3QXE B;  4M7D B;  3VS5 A;  2AK5 A;  3G1J A;  2DIG A;  2E12 A;  3PE0 A;  3RR6 A;  1AZE A;  2VXE A;  3TSW A;  2KYB A;  5D6X A;  3JCM e;  2B8A A;  4DQ2 A;  3EG9 A;  4C92 F;  1TH7 A;  2AIR B;  3OYI A;  4JRI A;  3I5S A;  4J8O A;  4OMF B;  3MP8 A;  2RHZ A;  2AKK A;  1NEG A;  2HZY A;  3A8M B;  1FMK A;  1UUE A;  2O01 E;  5L23 A;  3LGL A;  1HSQ A;  2K79 A;  3MCA B;  1Q7Y R;  4D6W A;  2VXF A;  3MP1 A;  1KFZ A;  1K9M C;  2KSS A;  1KC8 C;  4MZP A;  4AFZ C;  4HVU A;  1YI2 T;  2O4X A;  4C92 A;  1N5Z A;  2KYM A;  2DYI A;  2A36 A;  1VUB A;  1C1A A;  2FVU A;  1BIB A;  1VYT A;  1WI7 A;  3M0S A;  1FX7 A;  2CP0 A;  3MP6 A;  1I0C A;  4C5G A;  4JLI A;  3PVL A;  1XTD A;  4DOV A;  2QDY B;  3WXM B;  1MUZ A;  2XHC A;  5FWB A;  2RQT A;  4F17 A;  1WHH A;  5LJ5 j;  1UHF A;  4NL3 A;  3UAT A;  3V7C A;  3MPU B;  4FU6 A;  3C94 A;  3CCJ T;  4BB7 A;  1R8O B;  3G4S T; 
#chains in the Genus database with same CATH homology
 5CCA A;  3L2Q A;  2KK4 A;  3WVD B;  5LJ5 e;  5CAI A;  4RKU E;  3I56 T;  2LX9 A;  2CZ7 B;  2ZPF B;  2OTJ A;  3OYJ A;  5CVI A;  2JUF A;  4ZN3 A;  3OYN A;  2ZPI B;  3X24 B;  4HT9 A;  5LJ3 h;  5GMK l;  3URG A;  4E47 A;  3M56 A;  3JB9 F;  1D3B B;  2MWO A;  4HCB A;  4RG8 A;  5IT9 E;  1SSF A;  2GFU A;  4EDU A;  2QEX A;  3C4S A;  1VQK T;  4FL6 A;  3N5B B;  4C5I A;  4J7F A;  2KQW A;  3BDU A;  3PNW C;  5DLQ E;  4XU2 A;  4M7A C;  4M75 G;  1KQS S;  1QVP A;  3QPH A;  4FIB A;  5HK0 A;  1X75 C;  2E5Q A;  1RI0 A;  3L2U A;  4DA4 A;  5GAM g;  3FC3 A;  3CBP A;  1QVF A;  5GAN j;  4QVD A;  5DM7 R;  2P0P A;  3CXC S;  2RA2 A;  3VYG A;  3G6E A;  1VQ6 T;  2DEQ A;  4C5H A;  4B9X A;  2DTI A;  1ZHI A;  4FT2 A;  3VJP A;  1Y71 A;  4NS5 A;  2R5A A;  1VQP T;  2XKO C;  2VGM A;  5GAO n;  4EMH A;  1YJ9 T;  4KUD K;  4M75 C;  3MO8 A;  2M16 A;  1VQ9 T;  3JB9 D;  2Y4X A;  5GAN d;  3ZEH A;  2LNV A;  5CQY A;  2L89 A;  3QYH B;  2VC8 A;  2LQ8 A;  3LGF A;  3M55 A;  2FYK A;  2JVV A;  4HKE A;  3X25 B;  2DXU A;  1UEB A;  3HRS A;  3GP8 A;  1Q81 U;  5GAN f;  2ZPB B;  3OS0 A;  3FEO A;  2QQ9 A;  4OB2 B;  3HPW A;  3FIF A;  3VUB A;  5A0G A;  2CKK A;  2EJG A;  4EPC A;  5LJ5 h;  3L2R A;  4M7D C;  1WJS A;  2KY9 A;  5C6S A;  3BFM A;  2DXC A;  1G3T A;  4NL2 A;  1VQM T;  1D3B A;  3BY7 A;  2I2L A;  5FU6 B;  1Q82 C;  1YIJ A;  3OYL A;  1YIT A;  2MI6 A;  4IUT A;  3L42 A;  2Y90 A;  4JUV A;  1XOV A;  4J83 A;  1Y96 B;  5I2M A;  4PJO E;  1WQW A;  1YHQ T;  2CS7 A;  3V7S A;  3EFS A;  2IVW A;  2YLB A;  2EYQ A;  3A5Z B;  5FU7 B;  5GMK i;  1Y96 A;  4M77 E;  1M9S A;  1FWZ A;  4MMK A;  4F7U A;  3CXC A;  2DTH A;  2DD4 A;  5D6W A;  3JCM W;  3X28 B;  3GLX A;  4F7U F;  5GMK j;  3JB9 I;  1U8R A;  4M7A G;  4M78 E;  4ZGE B;  4LDV A;  3ZBD A;  4BY6 C;  4M78 G;  1BI3 A;  2RJD A;  5CK9 A;  3QII A;  5GAM d;  2GFA A;  3KBG A;  3HHT B;  1YCY A;  2DKG A;  3EFR A;  3ASK A;  3JCM V;  3OB9 A;  2XD0 A;  5KH6 A;  2RO0 A;  4C0Z A;  4BE0 A;  3M9Q A;  3F70 A;  4NOY A;  4VUB A;  2RH2 A;  4XU3 A;  1JB0 E;  2XID A;  5D6Y A;  4PJO G;  3ZFJ A;  3LLR A;  1M90 C;  1BYM A;  2E64 A;  2VYT A;  3JB9 H;  4LDY A;  5C0M A;  5GMK m;  5GAN g;  3G71 T;  5GAO l;  1WPY A;  3Q1J A;  3S3M A;  4UC4 A;  2QXF A;  4C5E A;  4X34 A;  3NTI A;  2XDD A;  3OY9 A;  2EIF A;  3ER0 A;  1QW1 A;  1N27 A;  1VQP A;  1PSF A;  3JCM f;  4ME7 A;  1NPR A;  2RB6 A;  3TCJ A;  1LJO A;  3I55 A;  2R58 A;  2YRV A;  3CCQ A;  1AHJ B;  4F7U B;  2GQV A;  4IUQ A;  2DO3 A;  3CD6 A;  3QDR B;  2MAM A;  3H6Z A;  2RHX A;  4XTY A;  3FLG A;  5CKF A;  3CD6 T;  4N4I A;  4M75 F;  3CC7 T;  2EQJ A;  1VQK A;  1RL2 A;  5GAN 7;  4XQ3 A;  4OF1 A;  4FSX A;  3JB9 J;  2MF2 A;  2YLC A;  3UWN A;  1O9S A;  4JRK A;  1BIA A;  3BW1 A;  3G4S A;  4M7D E;  1Q81 C;  3L2Z A;  4JRP A;  4PKC C;  4Z02 A;  1VQL T;  1FXX A;  1I5L A;  2JN0 A;  3A8G B;  3QUI A;  1JBM A;  1BI1 A;  2LQK A;  4M78 A;  1UGP B;  2HD0 A;  5L8R E;  3OMG A;  2L8D A;  2ZGW A;  4EMG A;  4N0A C;  2BUD A;  4F7U G;  3OYB A;  1ZBX A;  4PJO D;  2XI9 A;  5GMK h;  1YJW A;  3LH0 A;  5GAM h;  3LX7 A;  4N4H A;  3G7Z A;  3L1A A;  2K5F A;  4C8Q G;  4JS4 A;  4N4G A;  4KBM B;  2LT4 A;  1H3Z A;  4Q5W A;  1I4K 1;  5KCO A;  3JCM P;  4X9C A;  3X26 B;  1BKB A;  1KQS A;  4JLG A;  4M77 G;  3VU3 C;  4M78 D;  5I2S A;  2PUO B;  3QZ5 B;  4N0A A;  3JCM J;  3V7R A;  1U1S A;  1WGS A;  1K73 U;  2EJF A;  2DXT A;  2WSF E;  1I8F A;  3OYD A;  2MMP A;  4KT0 E;  3M4G A;  3S6W A;  3A8L B;  5J3B A;  2EWN A;  2LTO A;  3CBM A;  4QW2 A;  4CI0 C;  4R56 A;  3L2V A;  5GAO r;  5FLX E;  2O4X B;  2DPP B;  4A4H A;  2CZ1 B;  4EMK C;  4BY6 B;  2ZPH B;  2CZ0 B;  5IAY A;  2DJZ A;  2F69 A;  5GAM e;  4C0G A;  3RMS A;  3LWI A;  3CC7 A;  4LD9 K;  3FJP A;  2K3Y A;  1O75 A;  2XDP A;  4CRI A;  1OI1 A;  4C8Q F;  2GCX A;  4LDU A;  3A8H B;  4HCZ A;  1YI2 A;  1YIT T;  1KQ1 A;  4JRQ A;  2K5I A;  2X4X A;  1QP3 A;  3RMQ A;  3CPW S;  1KD1 C;  3J7A F;  4M75 E;  2E1H A;  3X20 B;  1M90 U;  2VGN A;  2RHI A;  2OTL A;  3QZ9 B;  4ZN1 A;  2WSC E;  3VUZ A;  1MHN A;  1P92 A;  5M9O A;  2QQB A;  2JTF A;  3QJY A;  4ZTF A;  3V8K A;  4L5G A;  1M5Q 1;  2M1H A;  4MML A;  4YTL A;  5GAN 3;  2ZZD A;  1NE8 A;  4JS5 A;  3RES A;  4A4G A;  2BKD N;  1G3S A;  1V29 B;  2RI3 A;  3OS2 A;  3OA6 A;  3TEE A;  5CO7 A;  5LL6 S;  4BI3 A;  3OS1 A;  1KHI A;  4J5Y A;  3CPF A;  3H8Z A;  3NTH A;  4BUG A;  4E7L A;  1YIJ T;  5LJ3 f;  3QG1 A;  4BAC A;  2QEX T;  2CGH A;  4PJO F;  3JCM Q;  5GAN 5;  2L3R A;  2NLU A;  1KQ2 A;  1VQN A;  1MGQ A;  4C8Q B;  3J81 E;  1G3W A;  2VV5 A;  3SWN A;  5DLO A;  1BI0 A;  3PFS A;  4JDS A;  1YJN T;  3G6E T;  3CCL A;  3CCS A;  2KVQ G;  4M78 C;  3OYC A;  1VQL A;  5FU6 C;  5AYF A;  2GF7 A;  3OYH A;  1S72 T;  1VQ9 A;  5GAO q;  3RKY A;  3HRU A;  1VIE A;  3CMA A;  1M8V A;  3OS5 A;  4J7I A;  5A0D A;  4XTV A;  1UB4 A;  3ME9 A;  5FRN A;  2M9U A;  2FHD A;  3PGG A;  4FT4 A;  1VQO T;  3GPL A;  1HXD A;  4GLK A;  3LW5 E;  4M7D F;  2X4Y A;  3TU4 K;  5CIU A;  1LOJ A;  3GNF B;  4C8Q D;  2DVE A;  3GOX A;  2FB7 A;  1NPP A;  2QI2 A;  3CCM A;  2RK1 A;  2RHU A;  3J80 E;  1QVG A;  2R5M A;  3M5A A;  1UGQ B;  4F7U E;  5LJ3 j;  1G5V A;  2RHY A;  3SFM A;  4X9D A;  2HQE A;  3QSU A;  2WSE E;  3A8O B;  3CCR A;  5GAN 4;  1VIF A;  4M77 B;  5A2Q E;  3CCJ A;  1N9R A;  5DY9 A;  4ELZ C;  2RI5 A;  4OB0 B;  4LDX A;  1M1G A;  4QQG A;  5GAN e;  2PU9 B;  3QO3 A;  3RKX A;  5KE2 A;  2DK3 A;  3CCU T;  2A3L A;  1BI2 A;  4RMO A;  2E65 A;  3M58 A;  3MEW A;  2OTJ T;  2EJ9 A;  2K2V A;  3HFO A;  2L5Q A;  3CCV A;  1KG1 A;  3SDZ A;  3V8J A;  1N8R C;  2V8I A;  2PVG B;  5LJ5 d;  3DLM A;  2LCC A;  1S72 A;  3CMA T;  1OZ3 A;  4MZT A;  1XNI A;  3M53 A;  2X4W A;  3M54 A;  1H64 1;  4PLI A;  1NZ9 A;  3SWN C;  4BDY A;  4PLL A;  1OYX A;  1Q82 U;  1K9M U;  1UGR B;  3PT9 A;  5IN1 A;  4E7K A;  4C0F A;  2EQM A;  3SWN B;  2K4Y A;  3PMT A;  4M77 D;  3VV0 A;  3CCL T;  4M7A E;  3E19 A;  1VQN T;  4ELY C;  3CCE A;  4XU1 A;  3CEY A;  4XTX A;  4E7I A;  2XU8 A;  5LJ5 f;  5LJ3 g;  1M1F A;  1M4Z A;  2F5T X;  1KHC A;  3QJ6 A;  4HT8 A;  2D6F A;  1NJI C;  3OQ5 A;  3JCM h;  4M7A A;  3CME A;  2LC4 A;  4MZM A;  1W2B S;  4PJO B;  3GF5 A;  2ZPG B;  3VKI A;  5KCH A;  4V2S A;  4O5V A;  4C0D C;  4C8Q C;  1X01 A;  2E6Z A;  2PUK B;  2H3J A;  3G71 A;  2F5K A;  3UDC A;  5GAN 2;  4ZGD B;  3MHX A;  4M7D G;  2YHT A;  4RCC A;  1VQ8 A;  5A0L A;  4BI8 B;  1LNX A;  2LT1 A;  3C12 A;  3OSV A;  4M77 C;  1VQ4 A;  1JJ2 S;  3S3N A;  2CYZ B;  4M78 B;  2OTL T;  1W2B A;  1YHQ A;  2JTM A;  2EFI A;  4IUP A;  1M1K U;  3OYG A;  4PNO A;  3I56 A;  3MEV A;  2E41 A;  3E1S A;  3VYH B;  3M4Y A;  5I21 A;  4JJN K;  4M7A D;  1B34 A;  2RJE A;  3DB3 A;  1WNL A;  2X4J A;  3LWH A;  1YBY A;  2P0Q A;  3T9N A;  4HA8 A;  3NFC A;  3JCM X;  4EMK B;  1VQM A;  2R57 A;  3P8D A;  2QQS A;  4A54 A;  5CR2 A;  4J6W A;  4A4E A;  1K8A C;  5J26 A;  3OBY A;  3QYG B;  5GAO p;  3P8B B;  1VQ7 T;  1OZ2 A;  2P4T A;  4EMK A;  1VQ5 A;  3CCE T;  4OB3 B;  3WVE B;  1Q86 C;  3KUF A;  4ZTJ A;  3MET A;  1PSE A;  1ZQ1 A;  3E9F A;  5CKD A;  5LJ5 g;  4M7A F;  2EKO A;  5CKB A;  2ZCF B;  3PTA A;  4L59 A;  5CKH A;  2G3R A;  2RJC A;  1I81 A;  3GIB A;  2LDM A;  3CCS T;  1IRE B;  3JSC A;  4GY5 A;  4QQD A;  2RK2 A;  4FM4 B;  3HSB A;  4J6Y A;  4OB1 B;  4HCC A;  2K57 A;  3DB4 A;  3OYK A;  2HAX A;  2DZ9 A;  2CZ6 B;  2QQA A;  3CCV T;  4C92 D;  1VQ6 A;  2PQW A;  4B9W A;  1N6A A;  4KUI A;  5LJ3 d;  1Q7Y C;  1GXI E;  3E9G A;  4XTU A;  1VQ8 T;  4Y28 E;  3LYI A;  5FU7 C;  1U1T A;  3BDL A;  3CCQ T;  4DOW A;  3V8L A;  4OP0 A;  3TRE A;  2JOY A;  4XTZ A;  3SB2 A;  2EQK A;  2KDS A;  5CKE A;  4ZGJ B;  4M7A B;  4R55 A;  4XAX B;  3CC4 A;  4IUU A;  3QHS A;  3RIR A;  1Q86 U;  2DTO A;  3JAM E;  2M0O A;  3PIO A;  4XTW A;  2HNI A;  3JCM b;  1DJ7 B;  3OBW A;  2DAQ A;  3AHU A;  1UGS B;  4A4F A;  4QVC A;  3S3O A;  2VUB A;  4WF2 A;  3OW2 S;  4C92 B;  2WAC A;  2K3X A;  4L6V 5;  2D9T A;  3CPW A;  4E7J A;  4C92 E;  3I55 T;  4TVR A;  5J39 A;  2XIC A;  2XG8 D;  2Y4Y A;  1K73 C;  1NJI U;  4MDW A;  4IUV A;  4ATO A;  2PVO B;  1XQH A;  4OGC A;  4A53 A;  3P8H A;  4XU0 A;  3EAE A;  1YJW T;  3FDR A;  1Q7Y U;  2RM4 A;  3OYY A;  5GAO m;  4BDZ A;  3RUX A;  3GNG A;  3CCU A;  3QXE B;  4C92 C;  4M7D B;  2DIG A;  2E12 A;  1HK9 A;  2EQU A;  2KAF A;  2LVM A;  3HFN A;  4IUR A;  4M75 B;  1X6O A;  2VXE A;  4OVA A;  2QA4 T;  3QKJ A;  2PVD B;  3FRN A;  3QBY A;  3CCR T;  5FRM A;  4IKF A;  1QVG S;  3OYF A;  5D6X A;  4OGE A;  5FRO A;  1QP2 A;  5GMK e;  4BE1 A;  2E6N A;  5CQX A;  3JCM e;  2B8A A;  5KE3 A;  3SD4 A;  5HK3 A;  4DQ2 A;  3JB9 G;  4C92 G;  2OAU A;  2KMT A;  2V8K A;  4RG2 A;  2HBP A;  1TH7 A;  4KUL A;  5HY6 A;  4C92 F;  4PJO A;  3CC4 T;  3HP9 A;  3OYI A;  3JRZ A;  3CC2 A;  2RI2 A;  4JRI A;  1JJ2 A;  3OYA A;  3DKM A;  3KXT A;  2FL7 A;  3JCM g;  2X35 A;  1IZ6 A;  4LD6 A;  2E10 A;  4J8O A;  2MWP A;  2XK0 A;  5LJ3 e;  1Y07 A;  1VQO A;  4OMF B;  4M75 D;  3MP8 A;  2RHZ A;  1WQ7 A;  3A8M B;  2EAY A;  2O01 E;  1N8R U;  3LGL A;  3CCM T;  2K5L A;  3L2W A;  4BD3 A;  3MCA B;  4MDX A;  4C8Q E;  4O6J A;  2VXF A;  3MEA A;  3MP1 A;  3RKW A;  2V8J A;  4D6W A;  4M7D A;  3RER A;  3OW2 A;  2DZC A;  2DXB A;  1K9M C;  2ZPE B;  2JZ2 A;  2IG0 A;  2LRQ A;  3HKS A;  2KSS A;  3DLL A;  4P5N A;  1KC8 C;  1VQ7 A;  4J6X A;  3M57 A;  1G3Y A;  3PMI A;  3PIP A;  3UT1 A;  4MZP A;  1VQ4 T;  3NTK A;  3MEU A;  4M78 F;  2D0Q B;  2O4X A;  4C92 A;  3CBO A;  1YI2 T;  3HRT A;  5GAN 6;  3M59 A;  1WJR A;  1VUB A;  4Y91 A;  2RJF A;  4QVZ A;  2FVU A;  4A4K A;  3UPU A;  3R6O A;  1YJN A;  4M7D D;  1VQ5 T;  2AHJ B;  1JRI A;  1BIB A;  3C95 A;  1YJ9 A;  5EG2 A;  4PJO C;  2A7Y A;  1Y7X A;  1FX7 A;  3FB9 A;  3JCM c;  5HKC A;  1B34 B;  2BIV A;  4QQ6 A;  2JNG A;  3MP6 A;  4LDW A;  4PL6 A;  4XK8 E;  5GAN 8;  4BE2 A;  2C06 A;  1QVF S;  3O8V A;  1WJQ A;  1M1K C;  4C5G A;  1N9S A;  4JLI A;  5GAM f;  2QA4 A;  2RD1 A;  4II1 A;  1XTD A;  4DOV A;  2QDY B;  3WXM B;  1KD1 U;  2XHC A;  2QTX A;  2DD5 A;  3OMC A;  4BI4 A;  3INZ A;  1KC8 U;  3OSS C;  3OYE A;  4C0D B;  3CME T;  2P0K A;  2HQX A;  3JCM d;  5GAN h;  4M75 A;  3OYM A;  4RCB A;  2LCL A;  1W4S A;  4E7H A;  3HL8 A;  1K8A U;  5LJ5 j;  5GAM j;  4NL3 A;  1EIF A;  4C8Q A;  2E70 A;  2DIQ A;  3V7C A;  3CC2 T;  4M77 F;  4FU6 A;  3C94 A;  3CCJ T;  4BB7 A;  2XDB A;  4M77 A;  1R8O B;  2QQR A;  3G4S T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...