1W4SA

Crystal structure of the proximal bah domain of polybromo
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
146
structure length
146
Chain Sequence
MYHVGDYVYVEPAEANLQPHIVCIERLWEDSAGEKWLYGCWFYRPNETFHLATRKFLEKEVFKSDYYNKVPVSKILGKCVVMFVKEYFKLCPENFRDEDVYVCESRYSAKTKSFKKIKLWTMPVSSVRFVPRDVPLPVVRVASVFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Nuclear protein
molecule keywords POLYBROMO 1 PROTEIN
publication title Crystal Structure of the Proximal Bah Domain of the Polybromo Protein
pubmed doi rcsb
source organism Gallus gallus
total genus 30
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1w4sA00
1ZHIA 1W4SA 4DA4A 4KUDK 1M4ZA 4BB7A 4JJNK 2FL7A 4FT4A 3PT9A 4KUIA 2FVUA 3PTAA 1ZBXA 4FSXA 4DOWA 4DOVA 4LD9K 3TU4K 4FT2A 4KULA
chains in the Genus database with same CATH superfamily
1VQ4T 5LJ5h 3QDFA 1U8RA 3VS6A 1WA7A 1RACB 3BDLA 1X6BA 4C8QG 4EDUA 3JB9H 1KD1U 2LCCA 2X4WA 2JS2A 1YCSB 4C8QD 3META 2OTLT 3FJ5A 3J81E 3GIBA 2ROTA 1GXIE 1Q7YU 5FU7B 5C0MA 3A8MB 4MZPA 3L2QA 2YRVA 4KH1B 4LNPA 2EYZA 2GFUA 1EX4A 2AKKA 3NTKA 3JB9I 5KYUA 4JJCA 1W2BS 1WHGA 3PIPA 4X1VA 1XOVA 2IPOB 1JJ2P 4C5IA 1UB4A 1OYXA 4FSSA 5I11A 3GF5A 4N4HA 2DERA 4M78A 2DM1A 3NPFA 2F69A 1WLPB 2QYZA 3OYAA 1M5Q1 3R6OA 3BY7A 5LJ3f 3CCQA 1YJNA 1YI2T 2W0ZA 1WNLA 3VKIA 4R56A 2OJ2A 5D6WA 4XTUA 1W2BA 2BE7D 3FEOA 1PM3A 2NUTA 4M7DB 2LT1A 4A4EA 1JJ2S 2HQEA 3ASKA 4PFPA 4A4GA 1Z9ZA 5AT1B 2E10A 1ZLMA 3EGXB 2YSQA 3X26B 3V8JA 5GAOm 3I5SA 3DLLA 1YIJQ 5FU7C 2M51A 5DLOA 2EQUA 4C92E 2YRCA 2DRMA 1PSFA 4M75E 1QVGS 5KCHA 2RO0A 2LC4A 2QQAA 1N8RC 2DBMA 4KGXB 1JJ2A 4O6JA 2LT4A 4M78F 2AZVA 3JB9F 1PRLC 5DLQE 2D0QB 3INZA 2XI9A 3A1PA 4HVVA 3CCLT 3Q1JA 2VUBA 4DBQA 1UG1A 5FWBA 3OMGA 4J6YA 5FROA 3EGDA 1QCOA 2ZPEB 1OU9A 1QVGA 5M9OA 1SF9A 5FW9A 4Q5WA 1J3TA 2QASA 4B6MA 2JUFA 3OYHA 1QQJA 4M7DC 2QDYB 2L3PA 1TSFA 2F5KA 1N9SA 1YP5A 2HMAA 5GAN4 5LJ3g 2HDAA 1VA7A 2KSSA 4FW2A 3CEYA 1ARKA 2CKKA 3URGA 1AT1B 1RAHB 2K4YA 2RQTA 1ZUUA 3EH1A 1WHJA 4AFQC 5GAMd 2L3QA 1H8KA 1VQOQ 4F14A 3OSSC 2BZXA 4M77G 1UE9A 5FRMA 3FC3A 4C92A 3EFOB 3RR6A 5IT9E 1W4SA 5LJ3j 1YITQ 2V1RA 4DA4A 5KYXA 4F7UE 2EYXA 2QGGA 2ED1A 1M90C 2K5FA 3LLRA 3A98A 2QA4T 4LDUA 1NJIR 1WJRA 1UTIA 2E41A 2GQVA 3CCEQ 3H9NA 4AFSC 2VC8A 3UF4A 4E7JA 3CC2T 4M78D 1VQPT 1M1KR 3CBOA 3JB9D 2LJ0A 1LCKA 1RI0A 3JCMQ 1XNIA 1K9MC 5GMKm 2EJGA 3S3MA 5GAN2 3VRZA 2EFIA 3RUXA 2RJFA 1WHKA 2VGNA 2RK1A 1D3BA 4BUGA 3X20B 2DZ9A 2EQKA 5CR2A 4DBRA 3VYHB 1FXXA 4CI0C 4L6V5 2IVWA 5GAN8 4BY6B 2CH4W 2DAQA 3ME9A 3JCMP 4JJNK 1VQ6T 1G3TA 6AT1B 2DVJA 1JB0E 4PJNA 4LDWA 3UPUA 2MPXC 5GAN7 1M90U 4OB2B 3NTHA 1VQOA 2X4JA 4XQ3A 1Z9QA 2P4RA 4K11A 1YHQA 3M57A 4J6WA 1GCQA 1X27A 1YITA 5D6YA 5A0GA 4DOWA 1SPKA 1K9MU 2VB6A 3UATA 4PJOE 2FZCB 1VQNQ 2RQVA 3RKWA 1ZX6A 1HSQA 3ZFJA 1QW1A 2P0QA 1KC8R 1BCMA 1E7OA 2BUDA 2RHXA 5CK9A 4XK8E 2MOXA 4DBFA 1BIAA 1O75A 4NL3A 3WVEB 3OW2P 5FLXE 4BY6C 4F16A 4F04B 1BKBA 2DILA 2ZPHB 3CPWS 3TVTA 4JRQA 2VXEA 3P8HA 3VS0A 4IUUA 1AHJB 2GF7A 1Y0MA 3JB9J 3PMTA 1R0CB 3M4GA 4Z89A 1MMGA 1M2VB 4JPBW 2DIGA 2E6NA 2JMAA 2KT8A 1PRMC 3G4SQ 4JLGA 3OW2S 2JW4A 2K3YA 1NJIC 2K3BA 3CCRT 2DLPA 1VQ5A 2COZA 2DETA 2R58A 4DEXA 1YFNA 4ZGDB 1MV3A 4ATOA 1XJWB 3CPWA 1Y96B 3L2UA 1D0YA 3TQ7P 1YJWQ 2DL3A 3OBYA 3V7RA 1MMNA 1WXUA 3JAME 1O9SA 2Z0WA 3VS1A 2QEXA 2MK5A 3C4SA 4M75B 1R77A 1VQKT 3M5AA 4XU1A 3A8LB 5CKHA 2KT1A 1C0MA 1X2QA 3CMAQ 1SEMA 3G1JA 4PJMA 3OW2A 1IXDA 1AVZC 1NYGA 2DFUA 3GNFB 3JSCA 5GMKi 5GMKj 2RI5A 3BE3A 1B3QA 5CKDA 1NM7A 3MPUB 3I55T 1BU1A 2DXTA 4PFOA 2DL8A 5CKFA 4C5HA 2O2OA 2PZ1A 3M55A 3C12A 2RPNA 4AFZC 2OAUA 5IXBA 3JCMe 4VUBA 4RG2A 3SWNA 2RJDA 3OYDA 2ZGWA 5IAYA 3CMEQ 4CRIA 4C8QE 1KD1R 4E7LA 4LE9A 1VQ7T 1IREB 2DXBA 2A08A 1X69A 3L2WA 1UGQB 3EG2A 4F17A 1IHWA 1CKAA 1W70A 4II1A 2WSFE 1Q7YR 4M7AA 2RA2A 4E2FB 2YXYA 3X24B 2MMPA 3M9QA 4XU3A 2PVOB 4C92C 1FWZA 3SEMA 4M75C 1M3BA 3V8LA 4E7IA 2DK3A 4BE2A 1GFDA 4BDYA 1JU5C 3VS4A 4F7UB 1KC8C 1K0SA 4BI3A 1YJWA 2GQIA 1NE8A 4A54A 3VV0A 1KQ1A 2L3RA 2CT4A 1WJQA 4LXCA 4BE1A 5D7UA 2HQXA 2QGFB 3VS7A 2PUOB 1IHVA 2H8HA 1FYNA 1Q81U 1RAAB 1HXDA 4LDYA 1M8MA 1T0JA 1IB8A 1JQQA 4FYWB 3VS2A 4ZTJA 2DL4A 4C0DB 3CCJT 4M7AF 1W1FA 1NEBA 4C8QA 3E1SA 4J7FA 2QQBA 1QVFP 1D1BA 2JM9A 2O9SA 1FMVA 4KGZB 3REAB 1PC0A 4AFUC 3CC4T 2RB6A 4J9BA 3CMEA 1WYXA 1RABB 3G6EQ 4DEYA 3PE0A 2RQUA 4E7SA 2E70A 1WXTA 3A8GB 4ZTFA 1AOJA 1AWXA 1H92A 2Y4XA 5GANf 3MP1A 1T3LA 3EG9B 3QG1A 3KBGA 2CT3A 3VUZA 3QKJA 2PVDB 1T0HA 1YN8A 4ELZC 2O01E 1FX7A 2ZAEA 3UA6A 3MEVA 3PT9A 1B34B 1TTHB 2ZPGB 1C6VX 2QI2A 3EGXA 4HT9A 1WXBA 4PJOB 2GBQA 2DXUA 2MF2A 3MEAA 1YWPA 2KAFA 1KD1C 3UA7A 2CZ1B 3CCST 4IIOA 1QLYA 4AG1C 3CQTA 2HBPA 2PVGB 3I9QA 3FLGA 2VXFA 2CUDA 1M4ZA 3QYGB 2DVEA 2CREA 3H41A 1K76A 4TVRA 3RESA 3T9NA 1QKXA 4IIMA 1SSHA 4FYVB 4M7AD 3EFSA 5I2SA 2M9UA 3JCMh 3KFVA 4EMKC 1UEBA 1ZSZA 2CS7A 3CCQQ 1YJNQ 5HK0A 4BD3A 1V1CA 2DPPB 3TCJA 1D0XA 1VIFA 4M78E 2QA4A 4LN2A 5EC7A 1ZBXA 2XMFA 3LH0A 4RCCA 1S1NA 2OTJT 2OI3A 5GAMf 5GANg 1VQLA 5L8RE 1CKBA 1UDLA 1WQWA 1KSWA 4PJOC 1NZ9A 1OULA 2ECZA 4OB1B 4D6WA 1W2BP 2J6OA 2E65A 4EMHA 2DMOA 2EKHA 2VASA 5GANj 3OS1A 3OS5A 2RHZA 1TWBA 4OMQA 1KQ2A 4NOYA 4WF2A 2RD1A 2RN8A 4M77A 4RTXA 2WSEE 2CZ0B 2XKOC 1AWWA 1W6XA 1FMKA 2P4TA 1ZBJA 2K9GA 3GPLA 4HKEA 5KYWB 2FVUA 1M90R 3SWNC 5GMKe 1MNEA 1XTDA 3JCMX 2QTVA 3HP9A 3CXCA 3EG1A 1G5VA 2P0PA 3F70A 1PNJA 4XTZA 4M7DG 3NTIA 3OYNA 3OYCA 1KG1A 1K8AC 2JT4A 2EWNA 1YJ9Q 1Y57A 1K9MR 3C94A 2R5AA 1WZOA 1KQSS 1QVGP 5LJ5f 1ZUKA 1WI7A 2JJ9A 5GAMg 5A2QE 2E5KA 2SEMA 3CD6T 4M77F 2CUBA 3G71A 1M3CA 2YUPA 1BIBA 1VYUA 4OMOA 3CCVT 2GGRA 3OYMA 3CMAT 1WPYA 3SFMA 2V8KA 3JCMW 2HKNA 1SRLA 2E1HA 3P8DA 3E19A 2QQRA 2KYMA 3HKSA 1SHGA 1KQSA 3NMZC 3FRNA 5HKCA 5GAMj 4MZMA 4QVZA 1N5ZA 1WX6A 1JO8A 3OB9A 2KI7A 1BK2A 2RNAA 4PL6A 3ZL7C 2LQNA 1NLOC 2MI6A 3J7AF 2QXFA 2C0IA 2LNHB 2YHTA 4C8QC 4HXJA 1BI2A 2D9TA 3HFNA 1YWOA 3CCRA 2IG0A 2J06A 1YNZA 7AT1B 1NLPC 1K8AU 1E6HA 2HKQB 2PTKA 2YT6A 2LTOA 1OQKA 2IIMA 2LDMA 1JXOA 1HYOA 2CP3A 4GLKA 1PD1A 2E5QA 3LH5A 3VJPA 3KUFA 2EKOA 3EHRA 5CQYA 2ABLA 1N27A 2FYKA 3QYHB 1YJ9A 1G3WA 5LJ5g 1Q86R 2KEAA 2PUKB 1VYVA 2HCKA 2CP5A 2XHCA 3CCMT 3PGGA 4X9DA 2WSCE 1YHQQ 1UFFA 4M77D 3M4YA 3VUBA 1R0BG 4LD6A 2DJZA 1ABQA 1Q95G 2COYA 3NFCA 2DRKA 3H8ZA 4CC2A 2JNGA 4J9FA 1K9AA 5LJ5j 2BTTA 1VQ7A 1RAFB 1LVKA 2KR3A 1X75C 5IHNA 3CC7T 2L5QA 5C6SA 1BI1A 1QCFA 3JCMd 2EGCA 1BB9A 1N9RA 3HTRA 2R5MA 2DTIA 2LZ6B 1IRXA 4FW1A 1CSKA 3OYLA 1I5LA 3H0IA 4XTXA 2RJEA 4QKUA 2B86A 5KYUB 3G6ET 3EFRA 3V8KA 1QCNA 1OZ2A 1PCXA 1K4US 3S3NA 2DTHA 2LX9A 3BFMA 1VQ8Q 4QQDA 1GFCA 4J9EA 3LWHA 4RTTA 3AHUA 2NLUA 1S72T 4RTYA 4M78B 1AZGB 8ATCB 4MDXA 2YLBA 1U06A 1VQ5Q 3EAEA 4YTLA 2H3JA 3LGFA 5IN1A 4JZ3A 2D1XA 2NYSA 4E6RA 2ZPIB 1Q81R 2HBWA 1QWFA 4BACA 3QJYA 1OOTA 2DD4A 3QHSA 2NUTB 3V7CA 2QEXQ 2CSIA 2J7IA 2ESWA 1JXMA 1JBMA 3D7SB 2X3XD 3EG3A 4XTYA 1FMWA 1TS9A 1QVPA 3I56Q 4JDSA 2E4HA 1X6OA 2R57A 2EGEA 2DZCA 2D0NA 3CC4A 3CPWP 3CCUA 1IGUA 4OP0A 4B9XA 5KYYA 1G2BA 1PG5B 3QIIA 1VQMT 3CBPA 3MP6A 1QP3A 4C0FA 5KH6A 2FHDA 3CCQT 5J3BA 2EAYA 3S6WA 2RI3A 2DEQA 9ATCB 4IKFA 1G8XA 1Q86C 2JTEA 4M78C 3OS0A 2FZKB 2HEQA 4RTVA 2FB7A 3HSBA 3EGDB 1QP2A 2PQWA 2ENMA 2OTLQ 3QZ5B 1OZ3A 1G3SA 1RLQC 1K0XA 1VQ8A 1TU0B 3QO3A 3SHWA 4PK4A 2DBKA 1D1AA 2JVVA 2NUPB 1VQ9T 3FJPA 2LCLA 2CZ7B 4F7UF 4M75G 1YBYA 4M7AE 1MUZA 1Y07A 1ZSGA 2KDSA 4OB0B 3OYKA 3M0RA 3HPWA 2DJQA 3OMCA 1TOVA 2EYYA 3H0FA 2XK0A 3OYBA 4C92B 4J9GA 2D8JA 1I1JA 4ANJA 1F1BB 2I0NA 3QUIA 2YWWA 1MMAA 5KYXB 1R8OB 4FYYB 4QVCA 4LDXA 4LD9K 3I56A 3OYJA 1TH7A 1B34A 2G6FX 2DEUA 1Q86U 2RM4A 2DE0X 2O4XA 2YUNA 4XU2A 2OTJA 4Z02A 5GAOl 2JXBA 4J9CA 4HCZA 1Q81C 4KH0B 1NPRA 3FDRA 2RQRA 2CP2A 1VQ4A 2EGAA 4N4GA 1ZHIA 2J05A 3FB9A 3WVDB 1D3BB 4R0KA 5IHIA 2KRSA 4RTWA 4X34A 1ZUYA 2OTLA 4AG2C 3MJXA 2FRWA 4OGCA 4F7UG 1GBQA 3CCLQ 2CDTA 1YIJT 1NPPA 2DKGA 1UECA 8AT1B 2KRNA 3GLXA 5GAN5 1Y7XA 3BDUA 2Y90A 1V76A 3P8BB 1VUBA 4PJOF 4E7ZA 2FL7A 4OF1A 4OMNA 4Z88A 1I07A 4WCIA 1IO6A 3THKA 1M2OA 1GRIA 1K73U 1OPLA 4PJJA 5LJ3e 3IQLA 2E3IA 4FCYA 4BI8B 2DF6A 2KK4A 1T3SA 2VYTA 1YI2A 1UGPB 4J5YA 1AZEA 5CKEA 1OX9A 1D0ZA 3JRZA 1BI3A 2CH4A 4HVUA 4BB7A 3DKMA 5CO7A 3QXEB 3CD6A 2D8HA 2E6ZA 1YCYA 2RHIA 3CCVA 4L59A 5IH2A 2DD5A 3X25B 2QA4Q 4O5VA 2QQ9A 4BI4A 2FO0A 5HCKA 2RK2A 2LJ3A 1VQOT 3DB3A 1RAIB 2C0OA 1PWTA 3OYGA 2QTXA 4OGEA 4EMKB 3FIFA 3TSWA 2D6FA 1H3ZA 3NGPA 1VQLQ 4J7IA 3JCMV 4PKCC 1VQPQ 1PSEA 1YITT 1X01A 3LWIA 2LRQA 3CCLA 2BKDN 1GBRA 4PJOG 3VRYA 5IXFA 1GCQC 1K8AR 3O5ZA 2HAXA 5GAOn 4M7DA 3KXTA 1KIKA 2KE9A 3EHQA 3CCET 3J80E 4OMMA 5DM7R 3QDRB 4MMKA 3I35A 3RMSA 1VQ6Q 3A8OB 1GL5A 2RI2A 4ZGEB 2BZYA 3RIRA 4QVDA 2JM8A 3E9FA 3SDZA 2JN0A 2LX7A 1SRMA 2FZGB 2MAMA 4L5GA 3TEEA 1M8VA 1BI0A 1Q82C 1KFZA 1K1ZA 4M77E 4IUQA 2EIFA 2L3SA 2FRYA 2VKNA 3OQ5A 2V8IA 2XDBA 3HHTB 4JRPA 1RLPC 1UJYA 4Y91A 3SWNB 1AWOA 2K2VA 1U1TA 2KY9A 1I8FA 4M7DF 3R6NA 2O31A 1BBZA 5LL6S 3ULRB 4C0ZA 3JV3A 3CC7A 5CIUA 3CXCP 1AWJA 3OSVA 2G3RA 3G71Q 2RQWA 4JZ4A 4M7AB 3CC2A 4XTVA 4P5NA 1VQPA 1G83A 2MYSA 2LJ1A 1UJ0A 1VYTA 3M0QA 1LOJA 4RKUE 4E7HA 2FPEA 2H3EB 2JTFA 1I4K1 2AT1B 1VQNT 1MHNA 2FPFA 1QMCA 4IUVA 3EFOA 5LJ3h 1M3AA 4PLLA 2AHJB 3CXCS 1Q82U 2O88A 4PNOA 4OMFB 1S72A 2E64A 3OS2A 4FT2A 3DLMA 2K57A 1KJWA 4JUVA 4D8KA 1I81A 1XQHA 3JCMf 3LX7A 3CCRQ 5FU6C 3H6ZA 1VQ6A 2VVKA 3QPHA 1ACMB 1U1SA 3E9GA 4HCCA 1KQSP 2XU8A 3L2VA 1BCOA 2DA9A 2KYBA 4RTZA 4ZNXA 2GFAA 4C8QB 1I0CA 1HJDA 4DBHA 1TG0A 1VQKQ 2EQIA 2L8DA 1OX8A 1OU8A 4CC7A 2GCXA 3G4ST 4M7AC 2FG0A 3VS3A 4AMCA 4FT4A 2CYZB 2HL3A 4GLMA 4M7DD 4OMLA 5J39A 4C5EA 1YJWT 3UT1A 2M02A 3H0HA 3I55Q 2GNCA 4EMGA 2DXCA 1VOMA 1VQMA 3M0TA 2LQWA 5GJWB 4HVWA 4EIKA 2WACA 1ZA2B 1UGRB 2AK5A 1VQ7Q 4HCBA 5GANd 4A53A 2DL7A 1SSFA 3GP8A 4NL2A 4JRKA 2C0TA 1JRIA 3RBBB 4IUPA 4PLIA 5CQXA 3HL8A 2P84A 5GAN3 2KNBB 1AD5A 4B9WA 4E47A 3GBQA 2KGTA 2DL5A 4FYXB 3JCMg 1DJ7B 2KMTA 1VQ9A 3CMET 3VU3C 2ROLA 4CC4B 2W10A 4BE0A 3OYIA 4M4ZA 1WHHA 4C0GA 2JMCA 2K5LA 4BDZA 1RAGB 4OB3B 2K2MA 4RCBA 2M16A 2I2LA 3L2RA 3QZ9B 2XG8D 1ZSZB 4IURA 1VQKA 4RTUA 4KT0E 3REBB 3PVQA 5KE2A 5KCOA 2K6DA 2VGMA 3RDVA 3TREA 2JZ2A 5A0LA 3RNJA 2P0KA 5CVIA 4FM4B 5GJVB 3HRUA 4MMLA 4UC4A 4ZN3A 3OA6A 4J9DA 1V29B 3GNGA 3QBYA 3CCJQ 1M2VA 2X4XA 1X6GA 1RL2A 3E2UA 5A0DA 1WHMA 2NUPA 3I55A 2CP6A 2F1LA 3RMQA 2MWPA 2OX7A 1UHCA 3CC4Q 1OEBA 2K3XA 3CCUQ 4A63B 3QJ6A 4ZGJB 1IZ6A 1Y96A 2AZSA 2L2PA 2YRDA 4HT8A 3L2ZA 4KGVB 1PD0A 1X2KA 4ZN1A 2XICA 4M75A 1M9SA 1N8RU 3OBWA 2EQJA 3VYGA 2E12A 1WIEA 4KUDK 3EH2A 1U5SA 4M77B 2KVQG 1KK7A 5GMKh 1YIJA 1ZSZC 5GAOp 2LQKA 2BIVA 4M78G 3JB9G 1TUGB 2CP7A 3S3OA 2ZPFB 1WHLA 3UDCA 1VQLT 4LDVA 1K73R 3G7ZA 2A36A 2JS0A 3L1AA 2MCNA 4J8OA 2RHUA 2LQ8A 1EIFA 4QW2A 3CCSQ 2OAWA 1OI1A 3PVLA 2NUZA 1WQ7A 2CGHA 3PFSA 1M1GA 1KHIA 1E6GA 1WJSA 3QWYA 5KE3A 5FRNA 3V7SA 4J6XA 2LVMA 3PMIA 4C92F 1ABOA 4JJBA 5LJ3d 1ZQ1A 2EBPA 4M75F 4QT7A 4Y92A 2QK0A 2X35A 2J6KA 3CCJA 4NS5A 3U23A 2A3LA 5LJ5d 4J83A 3M54A 1UHFA 2KXCA 2E3HA 4A4KA 2GTJA 2MIOA 1LPLA 2YUOA 1B07A 2Y4YA 1MNDA 4M77C 4F7UA 2EJFA 2FEIA 3JCMc 2BZ8A 1C1AA 1D09B 2RMOA 2OTJQ 1M1FA 5GANe 3M56A 2QG9B 4J9IA 4EPCA 1PKSA 1YJNT 2DX1A 1SHFA 1VQ4Q 2SRCA 2EQMA 4IUTA 1KHCA 4N0AA 3MHXA 5FWCA 3A8HB 4XU0A 1ZA1B 2ED0A 3DB4A 3CCEA 2M1HA 2A28A 3G71T 2FPDA 4ESRA 2F2XA 4HCKA 3SB2A 3PTAA 1RAEB 2BE9B 1H3HA 4LUDA 2XDDA 3QWXX 1TUDA 2ATCB 3MKDA 5HK3A 4DOVA 2HL5C 2EJ9A 4C92G 3CCSA 3OYEA 5IHKA 3M58A 4KBMB 2EPDA 1GCPA 2L0AA 5GAN6 2K79A 4EMKA 2KROA 1H641 4C92D 4HA8A 2HZYA 2B8AA 2COWA 4ME7A 4M75D 4JJDA 5KYNA 2XIDA 1RADB 3EG9A 2ZCFB 5CCAA 3RERA 4XAXB 3LGLA 3LYIA 2O9VA 2AIRB 3A5ZB 4LUEA 3N5BB 5DY9A 1YI2Q 5D6XA 4RUGA 5ECAA 3O8VA 1BYMA 3QSUA 2RH2A 1M1KC 2AKLA 2X4YA 1K73C 3L42A 4A4FA 2LNVA 2QDLA 4RMOA 1HK9A 5GAMe 4QQGA 5I2MA 2HQHA 3CD6Q 3CPFA 3VS5A 4PJOA 3WXMB 3PNWC 2EW3A 4KUIA 4KRTA 2HNIA 2MWOA 1M30A 2X51A 4J9HA 5I21A 3CCVQ 2VV5A 2EVRA 5GAOr 4GY5A 4OMPA 1YJ9T 4GBQA 1UGSB 3UWNA 2LP5A 1G3YA 2L89A 1D1CA 2CP0A 5I22A 1MV0B 3M53A 1VQNA 2A7YA 2QAZA 1Q82R 1WDXA 3RKXA 4CC3A 1EZZB 3C95A 2YUQA 4JLIA 2LMJA 3NHNA 2M0OA 1EFNA 3M59A 1P92A 2F2WA 3MCAB 1NG2A 4Z8AA 3C0CA 1OV3A 3JCMb 1NJIU 4FU6A 2VWFA 2ZZDA 5L23A 2V26A 1NBEB 1OPKA 3LW5E 2X9HA 3EG0A 2DYIA 4PJLA 5GAOq 1X43A 1A0NB 1NEGA 2QQSA 1M1KU 1WFWA 4M7DE 1PHTA 4MZTA 2KRMA 4JRIA 3TU4K 5HY6A 3G4SA 4KULA 2JOYA 1MMDA 2DO3A 2A37A 5LJ5e 5GANh 1JEGA 5KYYB 2DYBA 3CCMQ 1PKTA 2NWMA 5AYFA 3GOXA 2K5IA 3HFOA 4OVAA 1MGQA 3MO8A 1QWEA 2GTOA 2ZPBB 3PIOA 4ORZA 3CMAA 1N6AA 2RJCA 5KYWA 4RG8A 4DQ2A 4FL6A 3CC7Q 2YDLA 5EG2A 2K7AA 2KBTA 2HSPA 4D8DA 2KQWA 3CC2Q 1Y71A 2CSQA 1YHQT 1SG5A 3BW1A 5GMKl 2V8JA 2J6FA 3AT1B 1RI9A 3CBMA 1U3OA 2RHYA 1I5OB 4ELYC 3CCUT 1UUEA 2A0FB 1LJOA 3MP8A 2XDPA 2HD0A 3M0UA 3HRSA 2HSEB 2V1QA 4PFZA 3SD4A 4PJOD 2YLCA 3I5RA 1S72Q 2LCSA 1KC8U 2KXDA 1M27C 4C5GA 1QVFS 2RF0A 2F2VA 2PNIA 5CAIA 1QKWA 4XTWA 5GAMh 4AT1B 1TUCA 2EYQA 4QQ6A 4C8QF 1VQ8T 3OYFA 4N0AC 2O4XB 1HD3A 1VIEA 2C06A 4X9CA 1AEYA 3X28B 3CCMA 5FU6B 5CKBA 4E7KA 4C0DC 2X3WD 4FIBA 1QVFA 3TSZA 1VQ5T 2XD0A 4JS4A 3MEWA 4WTOB 4A4HA 3ER0A 4Y28E 4M7AG 2EYWA 1WGSA 3OYYA 1TXQA 1Q7YC 3EGUA 2QEXT 4FSXA 1N8RR 1RUWA 1LNXA 1VQMQ 3ZBDA 3OY9A 2CZ6B 3JCMJ 3MEUA 2M0YA 1UGVA 4V2SA 1NYFA 5J26A 3RKYA 3I56T 2JTMA 3M0SA 4JS5A 1B7TA 4R55A 2F5TX 3G6EA 2DIQA 1SKUB 2DTOA 3ZEHA 1IGQA 2PU9B 3HRTA 2DNUA 4N4IA 4MDWA 3M0PA 1VQ9Q
chains in the Genus database with same CATH topology
1VQ4T 2PQWA 5A0DA 5LJ5h 1Q81U 3I55A 1U8RA 1HXDA 1OZ3A 1G3SA 3QZ5B 4LDYA 3RMQA 1VQ8A 3BDLA 2MWPA 4C8QG 4EDUA 4ZTJA 3JB9H 1KD1U 3QO3A 2LCCA 2X4WA 4C0DB 3CCJT 4M7AF 4C8QA 3E1SA 2K3XA 4J7FA 2JVVA 3QJ6A 1VQ9T 3FJPA 4C8QD 4ZGJB 1IZ6A 3META 1Y96A 2QQBA 2LCLA 2OTLT 2CZ7B 4HT8A 4F7UF 3J81E 3GIBA 3L2ZA 1GXIE 4M75G 1Q7YU 5FU7B 1YBYA 4M7AE 1Y07A 2KDSA 5C0MA 3A8MB 4MZPA 2XICA 4OB0B 4M75A 1M9SA 4ZN1A 3OYKA 3HPWA 3L2QA 3CC4T 1N8RU 2RB6A 3OMCA 2YRVA 3CMEA 3OBWA 2EQJA 2GFUA 3VYGA 2E12A 2XK0A 4KUDK 3OYBA 3NTKA 4M77B 3JB9I 4C92B 2E70A 2KVQG 1W2BS 3QUIA 3A8GB 3PIPA 4ZTFA 1XOVA 5GMKh 1YIJA 1R8OB 2Y4XA 4QVCA 3MP1A 4C5IA 5GANf 5GAOp 4LDXA 2LQKA 2BIVA 1UB4A 3QG1A 4M78G 1OYXA 3JB9G 3KBGA 4LD9K 3S3OA 3GF5A 3I56A 2ZPFB 4N4HA 3VUZA 3QKJA 4M78A 3UDCA 3OYJA 1TH7A 2F69A 2PVDB 1VQLT 1B34A 3OYAA 1M5Q1 3R6OA 4LDVA 3BY7A 5LJ3f 4ELZC 1Q86U 3CCQA 2RM4A 3G7ZA 2O01E 1YJNA 2O4XA 3L1AA 1FX7A 1YI2T 4J8OA 3MEVA 2RHUA 4XU2A 2LQ8A 1EIFA 3PT9A 4QW2A 1B34B 1WNLA 4Z02A 5GAOl 3VKIA 4R56A 5D6WA 2ZPGB 4XTUA 1W2BA 1OI1A 3FEOA 4HCZA 2QI2A 4M7DB 2LT1A 4A4EA 4HT9A 1JJ2S 1WQ7A 2CGHA 1Q81C 2HQEA 3ASKA 3PFSA 4PJOB 1M1GA 1KHIA 1NPRA 1WJSA 2DXUA 3FDRA 4A4GA 5KE3A 2MF2A 3MEAA 5FRNA 2KAFA 3V7SA 2OTJA 2E10A 4J6XA 1VQ4A 1KD1C 2LVMA 3PMIA 2CZ1B 4C92F 4N4GA 5LJ3d 3CCST 1ZQ1A 4M75F 1ZHIA 3X26B 2HBPA 2PVGB 3FB9A 2X35A 3V8JA 3WVDB 5GAOm 1D3BB 3CCJA 3DLLA 3FLGA 2VXFA 5FU7C 1M4ZA 4NS5A 3QYGB 2EQUA 5DLOA 2DVEA 2A3LA 4C92E 5LJ5d 4TVRA 4J83A 4X34A 1PSFA 3RESA 3T9NA 3M54A 4M75E 2OTLA 1QVGS 5KCHA 4M7AD 2RO0A 2LC4A 2QQAA 3EFSA 4OGCA 4F7UG 4A4KA 5I2SA 2M9UA 1N8RC 3JCMh 2Y4YA 4M77C 4EMKC 1UEBA 1JJ2A 4F7UA 1YIJT 2EJFA 2CS7A 4O6JA 2LT4A 1NPPA 3JCMc 2DKGA 4M78F 5HK0A 3JB9F 4BD3A 5DLQE 2D0QB 3INZA 2DPPB 3GLXA 2XI9A 1M1FA 5GAN5 1Y7XA 3TCJA 5GANe 3BDUA 2Y90A 3CCLT 3Q1JA 3M56A 2VUBA 3P8BB 1VIFA 1VUBA 4PJOF 4EPCA 4M78E 2FL7A 4OF1A 2QA4A 3OMGA 1YJNT 4J6YA 5FROA 1ZBXA 1K73U 3LH0A 4RCCA 2ZPEB 2OTJT 5GAMf 5LJ3e 2EQMA 1QVGA 4IUTA 5GANg 1KHCA 5M9OA 4N0AA 1VQLA 3MHXA 4Q5WA 5L8RE 3A8HB 2JUFA 4XU0A 3OYHA 4BI8B 2KK4A 2VYTA 1YI2A 4M7DC 3DB4A 1UGPB 2QDYB 1WQWA 4J5YA 2F5KA 1N9SA 5CKEA 3CCEA 5GAN4 4PJOC 2M1HA 5LJ3g 3G71T 1NZ9A 2KSSA 3JRZA 4OB1B 1BI3A 4D6WA 4BB7A 3CEYA 3DKMA 2CKKA 3SB2A 3URGA 2K4YA 5CO7A 3QXEB 3PTAA 2E65A 4EMHA 5GAMd 2XDDA 3CD6A 5GANj 3OS1A 5HK3A 4DOVA 3OS5A 2E6ZA 2EJ9A 2RHZA 3OSSC 4M77G 4C92G 3CCSA 1YCYA 3OYEA 2RHIA 3CCVA 3M58A 1KQ2A 4NOYA 4WF2A 4KBMB 4L59A 2RD1A 5FRMA 4M77A 5GAN6 4C92A 4EMKA 2WSEE 3FC3A 1H641 2DD5A 3X25B 5IT9E 2CZ0B 4C92D 2XKOC 1W4SA 4HA8A 4O5VA 5LJ3j 2B8AA 2QQ9A 4BI4A 4ME7A 4M75D 2RK2A 1VQOT 4DA4A 2XIDA 3DB3A 4F7UE 2P4TA 3OYGA 2QTXA 4OGEA 4EMKB 2ZCFB 3GPLA 3FIFA 4HKEA 1M90C 2FVUA 5CCAA 2D6FA 2K5FA 3SWNC 3RERA 4XAXB 5GMKe 1H3ZA 4J7IA 3JCMV 4PKCC 1PSEA 3LLRA 3LGLA 3LYIA 2QA4T 3A5ZB 4LDUA 3N5BB 5DY9A 1XTDA 3JCMX 1WJRA 1YITT 2E41A 1X01A 2GQVA 3HP9A 5D6XA 4JRQA 3CXCA 3LWIA 3O8VA 1BYMA 3QSUA 2LRQA 2P0PA 1G5VA 3F70A 2VC8A 4E7JA 2RH2A 3CC2T 1M1KC 3CCLA 4XTZA 4M7DG 4M78D 3NTIA 2BKDN 2X4YA 3CBOA 3OYNA 3JB9D 3OYCA 3L42A 1VQPT 4PJOG 4A4FA 2LNVA 1K73C 1KG1A 1K8AC 4RMOA 1HK9A 1RI0A 5GAMe 2EWNA 4QQGA 1XNIA 5I2MA 3JCMQ 5GMKm 5GAOn 3KXTA 2EJGA 3S3MA 4DQ2A 1K9MC 3CPFA 2HAXA 3C94A 5GAN2 4PJOA 2R5AA 3PNWC 3WXMB 3CCET 4M7DA 3J80E 4KUIA 1KQSS 2HNIA 2MWOA 5I21A 5LJ5f 2EFIA 2VV5A 3RUXA 5GAOr 5DM7R 3QDRB 4GY5A 2RJFA 2VGNA 4MMKA 3RMSA 2RK1A 5GAMg 5A2QE 1YJ9T 3A8OB 1UGSB 1D3BA 3UWNA 2RI2A 4BUGA 4ZGEB 3X20B 1G3YA 2DZ9A 2EQKA 2L89A 3RIRA 5CR2A 4QVDA 4M77F 3VYHB 3G71A 1FXXA 3E9FA 4CI0C 3SDZA 4L6V5 2IVWA 5GAN8 2JN0A 1BIBA 4BY6B 2MAMA 3M53A 3CCVT 1VQNA 1VQ6A 3OYMA 3CMAT 2DAQA 4L5GA 3TEEA 1M8VA 1WPYA 2A7YA 1BI0A 2V8KA 3ME9A 3SFMA 3JCMW 1Q82C 3JCMP 4JJNK 1VQ6T 3RKXA 1G3TA 4M77E 3C95A 2E1HA 3P8DA 4IUQA 3E19A 2EIFA 4JLIA 2M0OA 3OQ5A 2QQRA 3HKSA 1KQSA 1JB0E 2V8IA 3FRNA 5HKCA 5GAMj 4MZMA 3M59A 4QVZA 2XDBA 3OB9A 1P92A 4LDWA 3HHTB 4JRPA 3UPUA 3MCAB 5GAN7 1M90U 4OB2B 4PL6A 3NTHA 1VQOA 2MI6A 3J7AF 2X4JA 4XQ3A 2QXFA 4Y91A 3SWNB 3JCMb 4FU6A 1NJIU 2ZZDA 2YHTA 2K2VA 4C8QC 1QVFA 3LW5E 1U1TA 2KY9A 1I8FA 4M7DF 5GAOq 1YHQA 3M57A 1BI2A 2D9TA 3HFNA 4J6WA 5LL6S 3CCRA 2QQSA 1M1KU 4C0ZA 2IG0A 1YITA 3CC7A 5D6YA 5CIUA 5A0GA 1K8AU 4DOWA 3OSVA 2G3RA 1K9MU 4M7DE 4M7AB 2LTOA 4MZTA 4PJOE 3CC2A 4JRIA 4XTVA 4P5NA 5HY6A 3G4SA 3TU4K 1VQPA 3RKWA 2LDMA 4KULA 2JOYA 2DO3A 3ZFJA 5LJ5e 1LOJA 1QW1A 2P0QA 4RKUE 5GANh 4GLKA 4E7HA 2JTFA 2E5QA 2BUDA 2RHXA 5CK9A 1I4K1 4XK8E 1VQNT 5AYFA 3GOXA 3VJPA 3KUFA 1BIAA 2EKOA 1O75A 1MHNA 2K5IA 5CQYA 2FYKA 1N27A 3HFOA 3WVEB 4NL3A 5FLXE 3QYHB 4BY6C 4OVAA 1YJ9A 1G3WA 1MGQA 4IUVA 5LJ5g 5LJ3h 3MO8A 4PLLA 2PUKB 1BKBA 2AHJB 3CXCS 1Q82U 2ZPHB 3CPWS 4PNOA 2ZPBB 4OMFB 3PIOA 1S72A 2E64A 2XHCA 3OS2A 2VXEA 3PGGA 4FT2A 3CMAA 3CCMT 3DLMA 2K57A 1N6AA 2RJCA 2WSCE 3P8HA 4JUVA 4X9DA 1I81A 1XQHA 4IUUA 4RG8A 4M77D 1AHJB 3LX7A 2GF7A 3M4YA 3H6ZA 3PMTA 4FL6A 5FU6C 3JCMf 3VUBA 3JB9J 4LD6A 3M4GA 2DJZA 3QPHA 3E9GA 1U1SA 2DIGA 5EG2A 4HCCA 2E6NA 3NFCA 2XU8A 3H8ZA 2JNGA 2KQWA 3L2VA 1Y71A 5LJ5j 1YHQT 5GMKl 3BW1A 4JLGA 3OW2S 2K3YA 1NJIC 3CCRT 1VQ7A 2V8JA 1VQ5A 3CBMA 1X75C 2GFAA 2R58A 4C8QB 3CC7T 3CD6T 4ZGDB 2L5QA 4ATOA 2L8DA 2RHYA 5C6SA 3CPWA 1Y96B 1BI1A 4ELYC 3JCMd 3CCUT 3L2UA 1LJOA 2GCXA 3G4ST 3MP8A 2XDPA 2HD0A 3OBYA 3HRSA 1N9RA 3V7RA 4M7AC 3JAME 1O9SA 2R5MA 2QEXA 3C4SA 2DTIA 4FT4A 2CYZB 4M75B 4M7DD 3CCMA 1VQKT 3SD4A 3M5AA 4XU1A 4PJOD 2YLCA 3A8LB 3OYLA 5CKHA 1I5LA 4XTXA 2RJEA 5J39A 1KC8U 4C5EA 1YJWT 3UT1A 3G6ET 3EFRA 4C5GA 3V8KA 1QVFS 1OZ2A 3OW2A 3S3NA 4EMGA 2DTHA 2LX9A 2DXCA 3BFMA 4QQDA 1VQMA 3LWHA 3GNFB 3JSCA 5GMKi 5GMKj 3AHUA 2RI5A 5CAIA 2WACA 2NLUA 1S72T 4XTWA 5CKDA 5GAMh 4M78B 1UGRB 3I55T 4MDXA 2EYQA 2YLBA 4QQ6A 2DXTA 5CKFA 3EAEA 4YTLA 4C5HA 4C8QF 5GANd 2H3JA 3OYFA 1VQ8T 4HCBA 4N0AC 3LGFA 5IN1A 4A53A 2O4XB 3M55A 1VIEA 2C06A 3C12A 4X9CA 2OAUA 3X28B 2ZPIB 3JCMe 1SSFA 4VUBA 4RG2A 3SWNA 2RJDA 3OYDA 5FU6B 3GP8A 2ZGWA 4NL2A 5CKBA 4C0DC 5IAYA 4BACA 4E7KA 3QJYA 4JRKA 4FIBA 4C8QE 2DD4A 1JRIA 4CRIA 3QHSA 4E7LA 4IUPA 4PLIA 5CQXA 3V7CA 1VQ5T 1VQ7T 2XD0A 3HL8A 4JS4A 5GAN3 1IREB 2DXBA 3MEWA 4B9WA 4A4HA 4E47A 3ER0A 1UGQB 3L2WA 4Y28E 4M7AG 3JCMg 1DJ7B 1JBMA 2KMTA 1VQ9A 1WGSA 3OYYA 3CMET 1Q7YC 4II1A 3VU3C 2WSFE 4XTYA 4M7AA 1QVPA 4JDSA 2RA2A 1X6OA 2R57A 4BE0A 3X24B 2QEXT 2MMPA 4FSXA 1LNXA 3M9QA 3ZBDA 3OYIA 4C0GA 4XU3A 2PVOB 2CZ6B 2DZCA 2K5LA 4C92C 3OY9A 3JCMJ 1FWZA 3CC4A 3MEUA 4BDZA 3CCUA 4M75C 4OP0A 4OB3B 3V8LA 4B9XA 4V2SA 4RCBA 4E7IA 5J26A 3RKYA 3I56T 2M16A 2DK3A 2I2LA 3L2RA 2JTMA 3QZ9B 4BE2A 4BDYA 2XG8D 3QIIA 4JS5A 4F7UB 1VQMT 3CBPA 3MP6A 1KC8C 1QP3A 4IURA 4C0FA 5KH6A 2FHDA 4R55A 1VQKA 4KT0E 5KE2A 3CCQT 2F5TX 5KCOA 5J3BA 2EAYA 4BI3A 5A0LA 2VGMA 3S6WA 3TREA 2JZ2A 1YJWA 3G6EA 1NE8A 2DIQA 2RI3A 2DEQA 4A54A 4IKFA 2DTOA 3VV0A 2P0KA 1KQ1A 5CVIA 3ZEHA 4FM4B 1Q86C 2L3RA 2PU9B 4M78C 3HRTA 3OS0A 3HRUA 4MMLA 4UC4A 1WJQA 4ZN3A 3OA6A 1V29B 4BE1A 3GNGA 4N4IA 2FB7A 3QBYA 2HQXA 3HSBA 1QP2A 2PUOB 4MDWA 2X4XA 1RL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZHI A;  1W4S A;  4DA4 A;  4KUD K;  1M4Z A;  4BB7 A;  4JJN K;  2FL7 A;  4FT4 A;  3PT9 A;  4KUI A;  2FVU A;  3PTA A;  1ZBX A;  4FSX A;  4DOW A;  4DOV A;  4LD9 K;  3TU4 K;  4FT2 A;  4KUL A; 
#chains in the Genus database with same CATH topology
 1VQ4 T;  5LJ5 h;  3QDF A;  1U8R A;  3VS6 A;  1WA7 A;  1RAC B;  3BDL A;  1X6B A;  4C8Q G;  4EDU A;  3JB9 H;  1KD1 U;  2LCC A;  2X4W A;  2JS2 A;  1YCS B;  4C8Q D;  3MET A;  2OTL T;  3FJ5 A;  3J81 E;  3GIB A;  2ROT A;  1GXI E;  1Q7Y U;  5FU7 B;  5C0M A;  3A8M B;  4MZP A;  3L2Q A;  2YRV A;  4KH1 B;  4LNP A;  2EYZ A;  2GFU A;  1EX4 A;  2AKK A;  3NTK A;  3JB9 I;  5KYU A;  4JJC A;  1W2B S;  1WHG A;  3PIP A;  4X1V A;  1XOV A;  2IPO B;  1JJ2 P;  4C5I A;  1UB4 A;  1OYX A;  4FSS A;  5I11 A;  3GF5 A;  4N4H A;  2DER A;  4M78 A;  2DM1 A;  3NPF A;  2F69 A;  1WLP B;  2QYZ A;  3OYA A;  1M5Q 1;  3R6O A;  3BY7 A;  5LJ3 f;  3CCQ A;  1YJN A;  1YI2 T;  2W0Z A;  1WNL A;  3VKI A;  4R56 A;  2OJ2 A;  5D6W A;  4XTU A;  1W2B A;  2BE7 D;  3FEO A;  1PM3 A;  2NUT A;  4M7D B;  2LT1 A;  4A4E A;  1JJ2 S;  2HQE A;  3ASK A;  4PFP A;  4A4G A;  1Z9Z A;  5AT1 B;  2E10 A;  1ZLM A;  3EGX B;  2YSQ A;  3X26 B;  3V8J A;  5GAO m;  3I5S A;  3DLL A;  1YIJ Q;  5FU7 C;  2M51 A;  5DLO A;  2EQU A;  4C92 E;  2YRC A;  2DRM A;  1PSF A;  4M75 E;  1QVG S;  5KCH A;  2RO0 A;  2LC4 A;  2QQA A;  1N8R C;  2DBM A;  4KGX B;  1JJ2 A;  4O6J A;  2LT4 A;  4M78 F;  2AZV A;  3JB9 F;  1PRL C;  5DLQ E;  2D0Q B;  3INZ A;  2XI9 A;  3A1P A;  4HVV A;  3CCL T;  3Q1J A;  2VUB A;  4DBQ A;  1UG1 A;  5FWB A;  3OMG A;  4J6Y A;  5FRO A;  3EGD A;  1QCO A;  2ZPE B;  1OU9 A;  1QVG A;  5M9O A;  1SF9 A;  5FW9 A;  4Q5W A;  1J3T A;  2QAS A;  4B6M A;  2JUF A;  3OYH A;  1QQJ A;  4M7D C;  2QDY B;  2L3P A;  1TSF A;  2F5K A;  1N9S A;  1YP5 A;  2HMA A;  5GAN 4;  5LJ3 g;  2HDA A;  1VA7 A;  2KSS A;  4FW2 A;  3CEY A;  1ARK A;  2CKK A;  3URG A;  1AT1 B;  1RAH B;  2K4Y A;  2RQT A;  1ZUU A;  3EH1 A;  1WHJ A;  4AFQ C;  5GAM d;  2L3Q A;  1H8K A;  1VQO Q;  4F14 A;  3OSS C;  2BZX A;  4M77 G;  1UE9 A;  5FRM A;  3FC3 A;  4C92 A;  3EFO B;  3RR6 A;  5IT9 E;  1W4S A;  5LJ3 j;  1YIT Q;  2V1R A;  4DA4 A;  5KYX A;  4F7U E;  2EYX A;  2QGG A;  2ED1 A;  1M90 C;  2K5F A;  3LLR A;  3A98 A;  2QA4 T;  4LDU A;  1NJI R;  1WJR A;  1UTI A;  2E41 A;  2GQV A;  3CCE Q;  3H9N A;  4AFS C;  2VC8 A;  3UF4 A;  4E7J A;  3CC2 T;  4M78 D;  1VQP T;  1M1K R;  3CBO A;  3JB9 D;  2LJ0 A;  1LCK A;  1RI0 A;  3JCM Q;  1XNI A;  1K9M C;  5GMK m;  2EJG A;  3S3M A;  5GAN 2;  3VRZ A;  2EFI A;  3RUX A;  2RJF A;  1WHK A;  2VGN A;  2RK1 A;  1D3B A;  4BUG A;  3X20 B;  2DZ9 A;  2EQK A;  5CR2 A;  4DBR A;  3VYH B;  1FXX A;  4CI0 C;  4L6V 5;  2IVW A;  5GAN 8;  4BY6 B;  2CH4 W;  2DAQ A;  3ME9 A;  3JCM P;  4JJN K;  1VQ6 T;  1G3T A;  6AT1 B;  2DVJ A;  1JB0 E;  4PJN A;  4LDW A;  3UPU A;  2MPX C;  5GAN 7;  1M90 U;  4OB2 B;  3NTH A;  1VQO A;  2X4J A;  4XQ3 A;  1Z9Q A;  2P4R A;  4K11 A;  1YHQ A;  3M57 A;  4J6W A;  1GCQ A;  1X27 A;  1YIT A;  5D6Y A;  5A0G A;  4DOW A;  1SPK A;  1K9M U;  2VB6 A;  3UAT A;  4PJO E;  2FZC B;  1VQN Q;  2RQV A;  3RKW A;  1ZX6 A;  1HSQ A;  3ZFJ A;  1QW1 A;  2P0Q A;  1KC8 R;  1BCM A;  1E7O A;  2BUD A;  2RHX A;  5CK9 A;  4XK8 E;  2MOX A;  4DBF A;  1BIA A;  1O75 A;  4NL3 A;  3WVE B;  3OW2 P;  5FLX E;  4BY6 C;  4F16 A;  4F04 B;  1BKB A;  2DIL A;  2ZPH B;  3CPW S;  3TVT A;  4JRQ A;  2VXE A;  3P8H A;  3VS0 A;  4IUU A;  1AHJ B;  2GF7 A;  1Y0M A;  3JB9 J;  3PMT A;  1R0C B;  3M4G A;  4Z89 A;  1MMG A;  1M2V B;  4JPB W;  2DIG A;  2E6N A;  2JMA A;  2KT8 A;  1PRM C;  3G4S Q;  4JLG A;  3OW2 S;  2JW4 A;  2K3Y A;  1NJI C;  2K3B A;  3CCR T;  2DLP A;  1VQ5 A;  2COZ A;  2DET A;  2R58 A;  4DEX A;  1YFN A;  4ZGD B;  1MV3 A;  4ATO A;  1XJW B;  3CPW A;  1Y96 B;  3L2U A;  1D0Y A;  3TQ7 P;  1YJW Q;  2DL3 A;  3OBY A;  3V7R A;  1MMN A;  1WXU A;  3JAM E;  1O9S A;  2Z0W A;  3VS1 A;  2QEX A;  2MK5 A;  3C4S A;  4M75 B;  1R77 A;  1VQK T;  3M5A A;  4XU1 A;  3A8L B;  5CKH A;  2KT1 A;  1C0M A;  1X2Q A;  3CMA Q;  1SEM A;  3G1J A;  4PJM A;  3OW2 A;  1IXD A;  1AVZ C;  1NYG A;  2DFU A;  3GNF B;  3JSC A;  5GMK i;  5GMK j;  2RI5 A;  3BE3 A;  1B3Q A;  5CKD A;  1NM7 A;  3MPU B;  3I55 T;  1BU1 A;  2DXT A;  4PFO A;  2DL8 A;  5CKF A;  4C5H A;  2O2O A;  2PZ1 A;  3M55 A;  3C12 A;  2RPN A;  4AFZ C;  2OAU A;  5IXB A;  3JCM e;  4VUB A;  4RG2 A;  3SWN A;  2RJD A;  3OYD A;  2ZGW A;  5IAY A;  3CME Q;  4CRI A;  4C8Q E;  1KD1 R;  4E7L A;  4LE9 A;  1VQ7 T;  1IRE B;  2DXB A;  2A08 A;  1X69 A;  3L2W A;  1UGQ B;  3EG2 A;  4F17 A;  1IHW A;  1CKA A;  1W70 A;  4II1 A;  2WSF E;  1Q7Y R;  4M7A A;  2RA2 A;  4E2F B;  2YXY A;  3X24 B;  2MMP A;  3M9Q A;  4XU3 A;  2PVO B;  4C92 C;  1FWZ A;  3SEM A;  4M75 C;  1M3B A;  3V8L A;  4E7I A;  2DK3 A;  4BE2 A;  1GFD A;  4BDY A;  1JU5 C;  3VS4 A;  4F7U B;  1KC8 C;  1K0S A;  4BI3 A;  1YJW A;  2GQI A;  1NE8 A;  4A54 A;  3VV0 A;  1KQ1 A;  2L3R A;  2CT4 A;  1WJQ A;  4LXC A;  4BE1 A;  5D7U A;  2HQX A;  2QGF B;  3VS7 A;  2PUO B;  1IHV A;  2H8H A;  1FYN A;  1Q81 U;  1RAA B;  1HXD A;  4LDY A;  1M8M A;  1T0J A;  1IB8 A;  1JQQ A;  4FYW B;  3VS2 A;  4ZTJ A;  2DL4 A;  4C0D B;  3CCJ T;  4M7A F;  1W1F A;  1NEB A;  4C8Q A;  3E1S A;  4J7F A;  2QQB A;  1QVF P;  1D1B A;  2JM9 A;  2O9S A;  1FMV A;  4KGZ B;  3REA B;  1PC0 A;  4AFU C;  3CC4 T;  2RB6 A;  4J9B A;  3CME A;  1WYX A;  1RAB B;  3G6E Q;  4DEY A;  3PE0 A;  2RQU A;  4E7S A;  2E70 A;  1WXT A;  3A8G B;  4ZTF A;  1AOJ A;  1AWX A;  1H92 A;  2Y4X A;  5GAN f;  3MP1 A;  1T3L A;  3EG9 B;  3QG1 A;  3KBG A;  2CT3 A;  3VUZ A;  3QKJ A;  2PVD B;  1T0H A;  1YN8 A;  4ELZ C;  2O01 E;  1FX7 A;  2ZAE A;  3UA6 A;  3MEV A;  3PT9 A;  1B34 B;  1TTH B;  2ZPG B;  1C6V X;  2QI2 A;  3EGX A;  4HT9 A;  1WXB A;  4PJO B;  2GBQ A;  2DXU A;  2MF2 A;  3MEA A;  1YWP A;  2KAF A;  1KD1 C;  3UA7 A;  2CZ1 B;  3CCS T;  4IIO A;  1QLY A;  4AG1 C;  3CQT A;  2HBP A;  2PVG B;  3I9Q A;  3FLG A;  2VXF A;  2CUD A;  1M4Z A;  3QYG B;  2DVE A;  2CRE A;  3H41 A;  1K76 A;  4TVR A;  3RES A;  3T9N A;  1QKX A;  4IIM A;  1SSH A;  4FYV B;  4M7A D;  3EFS A;  5I2S A;  2M9U A;  3JCM h;  3KFV A;  4EMK C;  1UEB A;  1ZSZ A;  2CS7 A;  3CCQ Q;  1YJN Q;  5HK0 A;  4BD3 A;  1V1C A;  2DPP B;  3TCJ A;  1D0X A;  1VIF A;  4M78 E;  2QA4 A;  4LN2 A;  5EC7 A;  1ZBX A;  2XMF A;  3LH0 A;  4RCC A;  1S1N A;  2OTJ T;  2OI3 A;  5GAM f;  5GAN g;  1VQL A;  5L8R E;  1CKB A;  1UDL A;  1WQW A;  1KSW A;  4PJO C;  1NZ9 A;  1OUL A;  2ECZ A;  4OB1 B;  4D6W A;  1W2B P;  2J6O A;  2E65 A;  4EMH A;  2DMO A;  2EKH A;  2VAS A;  5GAN j;  3OS1 A;  3OS5 A;  2RHZ A;  1TWB A;  4OMQ A;  1KQ2 A;  4NOY A;  4WF2 A;  2RD1 A;  2RN8 A;  4M77 A;  4RTX A;  2WSE E;  2CZ0 B;  2XKO C;  1AWW A;  1W6X A;  1FMK A;  2P4T A;  1ZBJ A;  2K9G A;  3GPL A;  4HKE A;  5KYW B;  2FVU A;  1M90 R;  3SWN C;  5GMK e;  1MNE A;  1XTD A;  3JCM X;  2QTV A;  3HP9 A;  3CXC A;  3EG1 A;  1G5V A;  2P0P A;  3F70 A;  1PNJ A;  4XTZ A;  4M7D G;  3NTI A;  3OYN A;  3OYC A;  1KG1 A;  1K8A C;  2JT4 A;  2EWN A;  1YJ9 Q;  1Y57 A;  1K9M R;  3C94 A;  2R5A A;  1WZO A;  1KQS S;  1QVG P;  5LJ5 f;  1ZUK A;  1WI7 A;  2JJ9 A;  5GAM g;  5A2Q E;  2E5K A;  2SEM A;  3CD6 T;  4M77 F;  2CUB A;  3G71 A;  1M3C A;  2YUP A;  1BIB A;  1VYU A;  4OMO A;  3CCV T;  2GGR A;  3OYM A;  3CMA T;  1WPY A;  3SFM A;  2V8K A;  3JCM W;  2HKN A;  1SRL A;  2E1H A;  3P8D A;  3E19 A;  2QQR A;  2KYM A;  3HKS A;  1SHG A;  1KQS A;  3NMZ C;  3FRN A;  5HKC A;  5GAM j;  4MZM A;  4QVZ A;  1N5Z A;  1WX6 A;  1JO8 A;  3OB9 A;  2KI7 A;  1BK2 A;  2RNA A;  4PL6 A;  3ZL7 C;  2LQN A;  1NLO C;  2MI6 A;  3J7A F;  2QXF A;  2C0I A;  2LNH B;  2YHT A;  4C8Q C;  4HXJ A;  1BI2 A;  2D9T A;  3HFN A;  1YWO A;  3CCR A;  2IG0 A;  2J06 A;  1YNZ A;  7AT1 B;  1NLP C;  1K8A U;  1E6H A;  2HKQ B;  2PTK A;  2YT6 A;  2LTO A;  1OQK A;  2IIM A;  2LDM A;  1JXO A;  1HYO A;  2CP3 A;  4GLK A;  1PD1 A;  2E5Q A;  3LH5 A;  3VJP A;  3KUF A;  2EKO A;  3EHR A;  5CQY A;  2ABL A;  1N27 A;  2FYK A;  3QYH B;  1YJ9 A;  1G3W A;  5LJ5 g;  1Q86 R;  2KEA A;  2PUK B;  1VYV A;  2HCK A;  2CP5 A;  2XHC A;  3CCM T;  3PGG A;  4X9D A;  2WSC E;  1YHQ Q;  1UFF A;  4M77 D;  3M4Y A;  3VUB A;  1R0B G;  4LD6 A;  2DJZ A;  1ABQ A;  1Q95 G;  2COY A;  3NFC A;  2DRK A;  3H8Z A;  4CC2 A;  2JNG A;  4J9F A;  1K9A A;  5LJ5 j;  2BTT A;  1VQ7 A;  1RAF B;  1LVK A;  2KR3 A;  1X75 C;  5IHN A;  3CC7 T;  2L5Q A;  5C6S A;  1BI1 A;  1QCF A;  3JCM d;  2EGC A;  1BB9 A;  1N9R A;  3HTR A;  2R5M A;  2DTI A;  2LZ6 B;  1IRX A;  4FW1 A;  1CSK A;  3OYL A;  1I5L A;  3H0I A;  4XTX A;  2RJE A;  4QKU A;  2B86 A;  5KYU B;  3G6E T;  3EFR A;  3V8K A;  1QCN A;  1OZ2 A;  1PCX A;  1K4U S;  3S3N A;  2DTH A;  2LX9 A;  3BFM A;  1VQ8 Q;  4QQD A;  1GFC A;  4J9E A;  3LWH A;  4RTT A;  3AHU A;  2NLU A;  1S72 T;  4RTY A;  4M78 B;  1AZG B;  8ATC B;  4MDX A;  2YLB A;  1U06 A;  1VQ5 Q;  3EAE A;  4YTL A;  2H3J A;  3LGF A;  5IN1 A;  4JZ3 A;  2D1X A;  2NYS A;  4E6R A;  2ZPI B;  1Q81 R;  2HBW A;  1QWF A;  4BAC A;  3QJY A;  1OOT A;  2DD4 A;  3QHS A;  2NUT B;  3V7C A;  2QEX Q;  2CSI A;  2J7I A;  2ESW A;  1JXM A;  1JBM A;  3D7S B;  2X3X D;  3EG3 A;  4XTY A;  1FMW A;  1TS9 A;  1QVP A;  3I56 Q;  4JDS A;  2E4H A;  1X6O A;  2R57 A;  2EGE A;  2DZC A;  2D0N A;  3CC4 A;  3CPW P;  3CCU A;  1IGU A;  4OP0 A;  4B9X A;  5KYY A;  1G2B A;  1PG5 B;  3QII A;  1VQM T;  3CBP A;  3MP6 A;  1QP3 A;  4C0F A;  5KH6 A;  2FHD A;  3CCQ T;  5J3B A;  2EAY A;  3S6W A;  2RI3 A;  2DEQ A;  9ATC B;  4IKF A;  1G8X A;  1Q86 C;  2JTE A;  4M78 C;  3OS0 A;  2FZK B;  2HEQ A;  4RTV A;  2FB7 A;  3HSB A;  3EGD B;  1QP2 A;  2PQW A;  2ENM A;  2OTL Q;  3QZ5 B;  1OZ3 A;  1G3S A;  1RLQ C;  1K0X A;  1VQ8 A;  1TU0 B;  3QO3 A;  3SHW A;  4PK4 A;  2DBK A;  1D1A A;  2JVV A;  2NUP B;  1VQ9 T;  3FJP A;  2LCL A;  2CZ7 B;  4F7U F;  4M75 G;  1YBY A;  4M7A E;  1MUZ A;  1Y07 A;  1ZSG A;  2KDS A;  4OB0 B;  3OYK A;  3M0R A;  3HPW A;  2DJQ A;  3OMC A;  1TOV A;  2EYY A;  3H0F A;  2XK0 A;  3OYB A;  4C92 B;  4J9G A;  2D8J A;  1I1J A;  4ANJ A;  1F1B B;  2I0N A;  3QUI A;  2YWW A;  1MMA A;  5KYX B;  1R8O B;  4FYY B;  4QVC A;  4LDX A;  4LD9 K;  3I56 A;  3OYJ A;  1TH7 A;  1B34 A;  2G6F X;  2DEU A;  1Q86 U;  2RM4 A;  2DE0 X;  2O4X A;  2YUN A;  4XU2 A;  2OTJ A;  4Z02 A;  5GAO l;  2JXB A;  4J9C A;  4HCZ A;  1Q81 C;  4KH0 B;  1NPR A;  3FDR A;  2RQR A;  2CP2 A;  1VQ4 A;  2EGA A;  4N4G A;  1ZHI A;  2J05 A;  3FB9 A;  3WVD B;  1D3B B;  4R0K A;  5IHI A;  2KRS A;  4RTW A;  4X34 A;  1ZUY A;  2OTL A;  4AG2 C;  3MJX A;  2FRW A;  4OGC A;  4F7U G;  1GBQ A;  3CCL Q;  2CDT A;  1YIJ T;  1NPP A;  2DKG A;  1UEC A;  8AT1 B;  2KRN A;  3GLX A;  5GAN 5;  1Y7X A;  3BDU A;  2Y90 A;  1V76 A;  3P8B B;  1VUB A;  4PJO F;  4E7Z A;  2FL7 A;  4OF1 A;  4OMN A;  4Z88 A;  1I07 A;  4WCI A;  1IO6 A;  3THK A;  1M2O A;  1GRI A;  1K73 U;  1OPL A;  4PJJ A;  5LJ3 e;  3IQL A;  2E3I A;  4FCY A;  4BI8 B;  2DF6 A;  2KK4 A;  1T3S A;  2VYT A;  1YI2 A;  1UGP B;  4J5Y A;  1AZE A;  5CKE A;  1OX9 A;  1D0Z A;  3JRZ A;  1BI3 A;  2CH4 A;  4HVU A;  4BB7 A;  3DKM A;  5CO7 A;  3QXE B;  3CD6 A;  2D8H A;  2E6Z A;  1YCY A;  2RHI A;  3CCV A;  4L59 A;  5IH2 A;  2DD5 A;  3X25 B;  2QA4 Q;  4O5V A;  2QQ9 A;  4BI4 A;  2FO0 A;  5HCK A;  2RK2 A;  2LJ3 A;  1VQO T;  3DB3 A;  1RAI B;  2C0O A;  1PWT A;  3OYG A;  2QTX A;  4OGE A;  4EMK B;  3FIF A;  3TSW A;  2D6F A;  1H3Z A;  3NGP A;  1VQL Q;  4J7I A;  3JCM V;  4PKC C;  1VQP Q;  1PSE A;  1YIT T;  1X01 A;  3LWI A;  2LRQ A;  3CCL A;  2BKD N;  1GBR A;  4PJO G;  3VRY A;  5IXF A;  1GCQ C;  1K8A R;  3O5Z A;  2HAX A;  5GAO n;  4M7D A;  3KXT A;  1KIK A;  2KE9 A;  3EHQ A;  3CCE T;  3J80 E;  4OMM A;  5DM7 R;  3QDR B;  4MMK A;  3I35 A;  3RMS A;  1VQ6 Q;  3A8O B;  1GL5 A;  2RI2 A;  4ZGE B;  2BZY A;  3RIR A;  4QVD A;  2JM8 A;  3E9F A;  3SDZ A;  2JN0 A;  2LX7 A;  1SRM A;  2FZG B;  2MAM A;  4L5G A;  3TEE A;  1M8V A;  1BI0 A;  1Q82 C;  1KFZ A;  1K1Z A;  4M77 E;  4IUQ A;  2EIF A;  2L3S A;  2FRY A;  2VKN A;  3OQ5 A;  2V8I A;  2XDB A;  3HHT B;  4JRP A;  1RLP C;  1UJY A;  4Y91 A;  3SWN B;  1AWO A;  2K2V A;  1U1T A;  2KY9 A;  1I8F A;  4M7D F;  3R6N A;  2O31 A;  1BBZ A;  5LL6 S;  3ULR B;  4C0Z A;  3JV3 A;  3CC7 A;  5CIU A;  3CXC P;  1AWJ A;  3OSV A;  2G3R A;  3G71 Q;  2RQW A;  4JZ4 A;  4M7A B;  3CC2 A;  4XTV A;  4P5N A;  1VQP A;  1G83 A;  2MYS A;  2LJ1 A;  1UJ0 A;  1VYT A;  3M0Q A;  1LOJ A;  4RKU E;  4E7H A;  2FPE A;  2H3E B;  2JTF A;  1I4K 1;  2AT1 B;  1VQN T;  1MHN A;  2FPF A;  1QMC A;  4IUV A;  3EFO A;  5LJ3 h;  1M3A A;  4PLL A;  2AHJ B;  3CXC S;  1Q82 U;  2O88 A;  4PNO A;  4OMF B;  1S72 A;  2E64 A;  3OS2 A;  4FT2 A;  3DLM A;  2K57 A;  1KJW A;  4JUV A;  4D8K A;  1I81 A;  1XQH A;  3JCM f;  3LX7 A;  3CCR Q;  5FU6 C;  3H6Z A;  1VQ6 A;  2VVK A;  3QPH A;  1ACM B;  1U1S A;  3E9G A;  4HCC A;  1KQS P;  2XU8 A;  3L2V A;  1BCO A;  2DA9 A;  2KYB A;  4RTZ A;  4ZNX A;  2GFA A;  4C8Q B;  1I0C A;  1HJD A;  4DBH A;  1TG0 A;  1VQK Q;  2EQI A;  2L8D A;  1OX8 A;  1OU8 A;  4CC7 A;  2GCX A;  3G4S T;  4M7A C;  2FG0 A;  3VS3 A;  4AMC A;  4FT4 A;  2CYZ B;  2HL3 A;  4GLM A;  4M7D D;  4OML A;  5J39 A;  4C5E A;  1YJW T;  3UT1 A;  2M02 A;  3H0H A;  3I55 Q;  2GNC A;  4EMG A;  2DXC A;  1VOM A;  1VQM A;  3M0T A;  2LQW A;  5GJW B;  4HVW A;  4EIK A;  2WAC A;  1ZA2 B;  1UGR B;  2AK5 A;  1VQ7 Q;  4HCB A;  5GAN d;  4A53 A;  2DL7 A;  1SSF A;  3GP8 A;  4NL2 A;  4JRK A;  2C0T A;  1JRI A;  3RBB B;  4IUP A;  4PLI A;  5CQX A;  3HL8 A;  2P84 A;  5GAN 3;  2KNB B;  1AD5 A;  4B9W A;  4E47 A;  3GBQ A;  2KGT A;  2DL5 A;  4FYX B;  3JCM g;  1DJ7 B;  2KMT A;  1VQ9 A;  3CME T;  3VU3 C;  2ROL A;  4CC4 B;  2W10 A;  4BE0 A;  3OYI A;  4M4Z A;  1WHH A;  4C0G A;  2JMC A;  2K5L A;  4BDZ A;  1RAG B;  4OB3 B;  2K2M A;  4RCB A;  2M16 A;  2I2L A;  3L2R A;  3QZ9 B;  2XG8 D;  1ZSZ B;  4IUR A;  1VQK A;  4RTU A;  4KT0 E;  3REB B;  3PVQ A;  5KE2 A;  5KCO A;  2K6D A;  2VGM A;  3RDV A;  3TRE A;  2JZ2 A;  5A0L A;  3RNJ A;  2P0K A;  5CVI A;  4FM4 B;  5GJV B;  3HRU A;  4MML A;  4UC4 A;  4ZN3 A;  3OA6 A;  4J9D A;  1V29 B;  3GNG A;  3QBY A;  3CCJ Q;  1M2V A;  2X4X A;  1X6G A;  1RL2 A;  3E2U A;  5A0D A;  1WHM A;  2NUP A;  3I55 A;  2CP6 A;  2F1L A;  3RMQ A;  2MWP A;  2OX7 A;  1UHC A;  3CC4 Q;  1OEB A;  2K3X A;  3CCU Q;  4A63 B;  3QJ6 A;  4ZGJ B;  1IZ6 A;  1Y96 A;  2AZS A;  2L2P A;  2YRD A;  4HT8 A;  3L2Z A;  4KGV B;  1PD0 A;  1X2K A;  4ZN1 A;  2XIC A;  4M75 A;  1M9S A;  1N8R U;  3OBW A;  2EQJ A;  3VYG A;  2E12 A;  1WIE A;  4KUD K;  3EH2 A;  1U5S A;  4M77 B;  2KVQ G;  1KK7 A;  5GMK h;  1YIJ A;  1ZSZ C;  5GAO p;  2LQK A;  2BIV A;  4M78 G;  3JB9 G;  1TUG B;  2CP7 A;  3S3O A;  2ZPF B;  1WHL A;  3UDC A;  1VQL T;  4LDV A;  1K73 R;  3G7Z A;  2A36 A;  2JS0 A;  3L1A A;  2MCN A;  4J8O A;  2RHU A;  2LQ8 A;  1EIF A;  4QW2 A;  3CCS Q;  2OAW A;  1OI1 A;  3PVL A;  2NUZ A;  1WQ7 A;  2CGH A;  3PFS A;  1M1G A;  1KHI A;  1E6G A;  1WJS A;  3QWY A;  5KE3 A;  5FRN A;  3V7S A;  4J6X A;  2LVM A;  3PMI A;  4C92 F;  1ABO A;  4JJB A;  5LJ3 d;  1ZQ1 A;  2EBP A;  4M75 F;  4QT7 A;  4Y92 A;  2QK0 A;  2X35 A;  2J6K A;  3CCJ A;  4NS5 A;  3U23 A;  2A3L A;  5LJ5 d;  4J83 A;  3M54 A;  1UHF A;  2KXC A;  2E3H A;  4A4K A;  2GTJ A;  2MIO A;  1LPL A;  2YUO A;  1B07 A;  2Y4Y A;  1MND A;  4M77 C;  4F7U A;  2EJF A;  2FEI A;  3JCM c;  2BZ8 A;  1C1A A;  1D09 B;  2RMO A;  2OTJ Q;  1M1F A;  5GAN e;  3M56 A;  2QG9 B;  4J9I A;  4EPC A;  1PKS A;  1YJN T;  2DX1 A;  1SHF A;  1VQ4 Q;  2SRC A;  2EQM A;  4IUT A;  1KHC A;  4N0A A;  3MHX A;  5FWC A;  3A8H B;  4XU0 A;  1ZA1 B;  2ED0 A;  3DB4 A;  3CCE A;  2M1H A;  2A28 A;  3G71 T;  2FPD A;  4ESR A;  2F2X A;  4HCK A;  3SB2 A;  3PTA A;  1RAE B;  2BE9 B;  1H3H A;  4LUD A;  2XDD A;  3QWX X;  1TUD A;  2ATC B;  3MKD A;  5HK3 A;  4DOV A;  2HL5 C;  2EJ9 A;  4C92 G;  3CCS A;  3OYE A;  5IHK A;  3M58 A;  4KBM B;  2EPD A;  1GCP A;  2L0A A;  5GAN 6;  2K79 A;  4EMK A;  2KRO A;  1H64 1;  4C92 D;  4HA8 A;  2HZY A;  2B8A A;  2COW A;  4ME7 A;  4M75 D;  4JJD A;  5KYN A;  2XID A;  1RAD B;  3EG9 A;  2ZCF B;  5CCA A;  3RER A;  4XAX B;  3LGL A;  3LYI A;  2O9V A;  2AIR B;  3A5Z B;  4LUE A;  3N5B B;  5DY9 A;  1YI2 Q;  5D6X A;  4RUG A;  5ECA A;  3O8V A;  1BYM A;  3QSU A;  2RH2 A;  1M1K C;  2AKL A;  2X4Y A;  1K73 C;  3L42 A;  4A4F A;  2LNV A;  2QDL A;  4RMO A;  1HK9 A;  5GAM e;  4QQG A;  5I2M A;  2HQH A;  3CD6 Q;  3CPF A;  3VS5 A;  4PJO A;  3WXM B;  3PNW C;  2EW3 A;  4KUI A;  4KRT A;  2HNI A;  2MWO A;  1M30 A;  2X51 A;  4J9H A;  5I21 A;  3CCV Q;  2VV5 A;  2EVR A;  5GAO r;  4GY5 A;  4OMP A;  1YJ9 T;  4GBQ A;  1UGS B;  3UWN A;  2LP5 A;  1G3Y A;  2L89 A;  1D1C A;  2CP0 A;  5I22 A;  1MV0 B;  3M53 A;  1VQN A;  2A7Y A;  2QAZ A;  1Q82 R;  1WDX A;  3RKX A;  4CC3 A;  1EZZ B;  3C95 A;  2YUQ A;  4JLI A;  2LMJ A;  3NHN A;  2M0O A;  1EFN A;  3M59 A;  1P92 A;  2F2W A;  3MCA B;  1NG2 A;  4Z8A A;  3C0C A;  1OV3 A;  3JCM b;  1NJI U;  4FU6 A;  2VWF A;  2ZZD A;  5L23 A;  2V26 A;  1NBE B;  1OPK A;  3LW5 E;  2X9H A;  3EG0 A;  2DYI A;  4PJL A;  5GAO q;  1X43 A;  1A0N B;  1NEG A;  2QQS A;  1M1K U;  1WFW A;  4M7D E;  1PHT A;  4MZT A;  2KRM A;  4JRI A;  3TU4 K;  5HY6 A;  3G4S A;  4KUL A;  2JOY A;  1MMD A;  2DO3 A;  2A37 A;  5LJ5 e;  5GAN h;  1JEG A;  5KYY B;  2DYB A;  3CCM Q;  1PKT A;  2NWM A;  5AYF A;  3GOX A;  2K5I A;  3HFO A;  4OVA A;  1MGQ A;  3MO8 A;  1QWE A;  2GTO A;  2ZPB B;  3PIO A;  4ORZ A;  3CMA A;  1N6A A;  2RJC A;  5KYW A;  4RG8 A;  4DQ2 A;  4FL6 A;  3CC7 Q;  2YDL A;  5EG2 A;  2K7A A;  2KBT A;  2HSP A;  4D8D A;  2KQW A;  3CC2 Q;  1Y71 A;  2CSQ A;  1YHQ T;  1SG5 A;  3BW1 A;  5GMK l;  2V8J A;  2J6F A;  3AT1 B;  1RI9 A;  3CBM A;  1U3O A;  2RHY A;  1I5O B;  4ELY C;  3CCU T;  1UUE A;  2A0F B;  1LJO A;  3MP8 A;  2XDP A;  2HD0 A;  3M0U A;  3HRS A;  2HSE B;  2V1Q A;  4PFZ A;  3SD4 A;  4PJO D;  2YLC A;  3I5R A;  1S72 Q;  2LCS A;  1KC8 U;  2KXD A;  1M27 C;  4C5G A;  1QVF S;  2RF0 A;  2F2V A;  2PNI A;  5CAI A;  1QKW A;  4XTW A;  5GAM h;  4AT1 B;  1TUC A;  2EYQ A;  4QQ6 A;  4C8Q F;  1VQ8 T;  3OYF A;  4N0A C;  2O4X B;  1HD3 A;  1VIE A;  2C06 A;  4X9C A;  1AEY A;  3X28 B;  3CCM A;  5FU6 B;  5CKB A;  4E7K A;  4C0D C;  2X3W D;  4FIB A;  1QVF A;  3TSZ A;  1VQ5 T;  2XD0 A;  4JS4 A;  3MEW A;  4WTO B;  4A4H A;  3ER0 A;  4Y28 E;  4M7A G;  2EYW A;  1WGS A;  3OYY A;  1TXQ A;  1Q7Y C;  3EGU A;  2QEX T;  4FSX A;  1N8R R;  1RUW A;  1LNX A;  1VQM Q;  3ZBD A;  3OY9 A;  2CZ6 B;  3JCM J;  3MEU A;  2M0Y A;  1UGV A;  4V2S A;  1NYF A;  5J26 A;  3RKY A;  3I56 T;  2JTM A;  3M0S A;  4JS5 A;  1B7T A;  4R55 A;  2F5T X;  3G6E A;  2DIQ A;  1SKU B;  2DTO A;  3ZEH A;  1IGQ A;  2PU9 B;  3HRT A;  2DNU A;  4N4I A;  4MDW A;  3M0P A;  1VQ9 Q; 
#chains in the Genus database with same CATH homology
 1VQ4 T;  2PQW A;  5A0D A;  5LJ5 h;  1Q81 U;  3I55 A;  1U8R A;  1HXD A;  1OZ3 A;  1G3S A;  3QZ5 B;  4LDY A;  3RMQ A;  1VQ8 A;  3BDL A;  2MWP A;  4C8Q G;  4EDU A;  4ZTJ A;  3JB9 H;  1KD1 U;  3QO3 A;  2LCC A;  2X4W A;  4C0D B;  3CCJ T;  4M7A F;  4C8Q A;  3E1S A;  2K3X A;  4J7F A;  2JVV A;  3QJ6 A;  1VQ9 T;  3FJP A;  4C8Q D;  4ZGJ B;  1IZ6 A;  3MET A;  1Y96 A;  2QQB A;  2LCL A;  2OTL T;  2CZ7 B;  4HT8 A;  4F7U F;  3J81 E;  3GIB A;  3L2Z A;  1GXI E;  4M75 G;  1Q7Y U;  5FU7 B;  1YBY A;  4M7A E;  1Y07 A;  2KDS A;  5C0M A;  3A8M B;  4MZP A;  2XIC A;  4OB0 B;  4M75 A;  1M9S A;  4ZN1 A;  3OYK A;  3HPW A;  3L2Q A;  3CC4 T;  1N8R U;  2RB6 A;  3OMC A;  2YRV A;  3CME A;  3OBW A;  2EQJ A;  2GFU A;  3VYG A;  2E12 A;  2XK0 A;  4KUD K;  3OYB A;  3NTK A;  4M77 B;  3JB9 I;  4C92 B;  2E70 A;  2KVQ G;  1W2B S;  3QUI A;  3A8G B;  3PIP A;  4ZTF A;  1XOV A;  5GMK h;  1YIJ A;  1R8O B;  2Y4X A;  4QVC A;  3MP1 A;  4C5I A;  5GAN f;  5GAO p;  4LDX A;  2LQK A;  2BIV A;  1UB4 A;  3QG1 A;  4M78 G;  1OYX A;  3JB9 G;  3KBG A;  4LD9 K;  3S3O A;  3GF5 A;  3I56 A;  2ZPF B;  4N4H A;  3VUZ A;  3QKJ A;  4M78 A;  3UDC A;  3OYJ A;  1TH7 A;  2F69 A;  2PVD B;  1VQL T;  1B34 A;  3OYA A;  1M5Q 1;  3R6O A;  4LDV A;  3BY7 A;  5LJ3 f;  4ELZ C;  1Q86 U;  3CCQ A;  2RM4 A;  3G7Z A;  2O01 E;  1YJN A;  2O4X A;  3L1A A;  1FX7 A;  1YI2 T;  4J8O A;  3MEV A;  2RHU A;  4XU2 A;  2LQ8 A;  1EIF A;  3PT9 A;  4QW2 A;  1B34 B;  1WNL A;  4Z02 A;  5GAO l;  3VKI A;  4R56 A;  5D6W A;  2ZPG B;  4XTU A;  1W2B A;  1OI1 A;  3FEO A;  4HCZ A;  2QI2 A;  4M7D B;  2LT1 A;  4A4E A;  4HT9 A;  1JJ2 S;  1WQ7 A;  2CGH A;  1Q81 C;  2HQE A;  3ASK A;  3PFS A;  4PJO B;  1M1G A;  1KHI A;  1NPR A;  1WJS A;  2DXU A;  3FDR A;  4A4G A;  5KE3 A;  2MF2 A;  3MEA A;  5FRN A;  2KAF A;  3V7S A;  2OTJ A;  2E10 A;  4J6X A;  1VQ4 A;  1KD1 C;  2LVM A;  3PMI A;  2CZ1 B;  4C92 F;  4N4G A;  5LJ3 d;  3CCS T;  1ZQ1 A;  4M75 F;  1ZHI A;  3X26 B;  2HBP A;  2PVG B;  3FB9 A;  2X35 A;  3V8J A;  3WVD B;  5GAO m;  1D3B B;  3CCJ A;  3DLL A;  3FLG A;  2VXF A;  5FU7 C;  1M4Z A;  4NS5 A;  3QYG B;  2EQU A;  5DLO A;  2DVE A;  2A3L A;  4C92 E;  5LJ5 d;  4TVR A;  4J83 A;  4X34 A;  1PSF A;  3RES A;  3T9N A;  3M54 A;  4M75 E;  2OTL A;  1QVG S;  5KCH A;  4M7A D;  2RO0 A;  2LC4 A;  2QQA A;  3EFS A;  4OGC A;  4F7U G;  4A4K A;  5I2S A;  2M9U A;  1N8R C;  3JCM h;  2Y4Y A;  4M77 C;  4EMK C;  1UEB A;  1JJ2 A;  4F7U A;  1YIJ T;  2EJF A;  2CS7 A;  4O6J A;  2LT4 A;  1NPP A;  3JCM c;  2DKG A;  4M78 F;  5HK0 A;  3JB9 F;  4BD3 A;  5DLQ E;  2D0Q B;  3INZ A;  2DPP B;  3GLX A;  2XI9 A;  1M1F A;  5GAN 5;  1Y7X A;  3TCJ A;  5GAN e;  3BDU A;  2Y90 A;  3CCL T;  3Q1J A;  3M56 A;  2VUB A;  3P8B B;  1VIF A;  1VUB A;  4PJO F;  4EPC A;  4M78 E;  2FL7 A;  4OF1 A;  2QA4 A;  3OMG A;  1YJN T;  4J6Y A;  5FRO A;  1ZBX A;  1K73 U;  3LH0 A;  4RCC A;  2ZPE B;  2OTJ T;  5GAM f;  5LJ3 e;  2EQM A;  1QVG A;  4IUT A;  5GAN g;  1KHC A;  5M9O A;  4N0A A;  1VQL A;  3MHX A;  4Q5W A;  5L8R E;  3A8H B;  2JUF A;  4XU0 A;  3OYH A;  4BI8 B;  2KK4 A;  2VYT A;  1YI2 A;  4M7D C;  3DB4 A;  1UGP B;  2QDY B;  1WQW A;  4J5Y A;  2F5K A;  1N9S A;  5CKE A;  3CCE A;  5GAN 4;  4PJO C;  2M1H A;  5LJ3 g;  3G71 T;  1NZ9 A;  2KSS A;  3JRZ A;  4OB1 B;  1BI3 A;  4D6W A;  4BB7 A;  3CEY A;  3DKM A;  2CKK A;  3SB2 A;  3URG A;  2K4Y A;  5CO7 A;  3QXE B;  3PTA A;  2E65 A;  4EMH A;  5GAM d;  2XDD A;  3CD6 A;  5GAN j;  3OS1 A;  5HK3 A;  4DOV A;  3OS5 A;  2E6Z A;  2EJ9 A;  2RHZ A;  3OSS C;  4M77 G;  4C92 G;  3CCS A;  1YCY A;  3OYE A;  2RHI A;  3CCV A;  3M58 A;  1KQ2 A;  4NOY A;  4WF2 A;  4KBM B;  4L59 A;  2RD1 A;  5FRM A;  4M77 A;  5GAN 6;  4C92 A;  4EMK A;  2WSE E;  3FC3 A;  1H64 1;  2DD5 A;  3X25 B;  5IT9 E;  2CZ0 B;  4C92 D;  2XKO C;  1W4S A;  4HA8 A;  4O5V A;  5LJ3 j;  2B8A A;  2QQ9 A;  4BI4 A;  4ME7 A;  4M75 D;  2RK2 A;  1VQO T;  4DA4 A;  2XID A;  3DB3 A;  4F7U E;  2P4T A;  3OYG A;  2QTX A;  4OGE A;  4EMK B;  2ZCF B;  3GPL A;  3FIF A;  4HKE A;  1M90 C;  2FVU A;  5CCA A;  2D6F A;  2K5F A;  3SWN C;  3RER A;  4XAX B;  5GMK e;  1H3Z A;  4J7I A;  3JCM V;  4PKC C;  1PSE A;  3LLR A;  3LGL A;  3LYI A;  2QA4 T;  3A5Z B;  4LDU A;  3N5B B;  5DY9 A;  1XTD A;  3JCM X;  1WJR A;  1YIT T;  2E41 A;  1X01 A;  2GQV A;  3HP9 A;  5D6X A;  4JRQ A;  3CXC A;  3LWI A;  3O8V A;  1BYM A;  3QSU A;  2LRQ A;  2P0P A;  1G5V A;  3F70 A;  2VC8 A;  4E7J A;  2RH2 A;  3CC2 T;  1M1K C;  3CCL A;  4XTZ A;  4M7D G;  4M78 D;  3NTI A;  2BKD N;  2X4Y A;  3CBO A;  3OYN A;  3JB9 D;  3OYC A;  3L42 A;  1VQP T;  4PJO G;  4A4F A;  2LNV A;  1K73 C;  1KG1 A;  1K8A C;  4RMO A;  1HK9 A;  1RI0 A;  5GAM e;  2EWN A;  4QQG A;  1XNI A;  5I2M A;  3JCM Q;  5GMK m;  5GAO n;  3KXT A;  2EJG A;  3S3M A;  4DQ2 A;  1K9M C;  3CPF A;  2HAX A;  3C94 A;  5GAN 2;  4PJO A;  2R5A A;  3PNW C;  3WXM B;  3CCE T;  4M7D A;  3J80 E;  4KUI A;  1KQS S;  2HNI A;  2MWO A;  5I21 A;  5LJ5 f;  2EFI A;  2VV5 A;  3RUX A;  5GAO r;  5DM7 R;  3QDR B;  4GY5 A;  2RJF A;  2VGN A;  4MMK A;  3RMS A;  2RK1 A;  5GAM g;  5A2Q E;  1YJ9 T;  3A8O B;  1UGS B;  1D3B A;  3UWN A;  2RI2 A;  4BUG A;  4ZGE B;  3X20 B;  1G3Y A;  2DZ9 A;  2EQK A;  2L89 A;  3RIR A;  5CR2 A;  4QVD A;  4M77 F;  3VYH B;  3G71 A;  1FXX A;  3E9F A;  4CI0 C;  3SDZ A;  4L6V 5;  2IVW A;  5GAN 8;  2JN0 A;  1BIB A;  4BY6 B;  2MAM A;  3M53 A;  3CCV T;  1VQN A;  1VQ6 A;  3OYM A;  3CMA T;  2DAQ A;  4L5G A;  3TEE A;  1M8V A;  1WPY A;  2A7Y A;  1BI0 A;  2V8K A;  3ME9 A;  3SFM A;  3JCM W;  1Q82 C;  3JCM P;  4JJN K;  1VQ6 T;  3RKX A;  1G3T A;  4M77 E;  3C95 A;  2E1H A;  3P8D A;  4IUQ A;  3E19 A;  2EIF A;  4JLI A;  2M0O A;  3OQ5 A;  2QQR A;  3HKS A;  1KQS A;  1JB0 E;  2V8I A;  3FRN A;  5HKC A;  5GAM j;  4MZM A;  3M59 A;  4QVZ A;  2XDB A;  3OB9 A;  1P92 A;  4LDW A;  3HHT B;  4JRP A;  3UPU A;  3MCA B;  5GAN 7;  1M90 U;  4OB2 B;  4PL6 A;  3NTH A;  1VQO A;  2MI6 A;  3J7A F;  2X4J A;  4XQ3 A;  2QXF A;  4Y91 A;  3SWN B;  3JCM b;  4FU6 A;  1NJI U;  2ZZD A;  2YHT A;  2K2V A;  4C8Q C;  1QVF A;  3LW5 E;  1U1T A;  2KY9 A;  1I8F A;  4M7D F;  5GAO q;  1YHQ A;  3M57 A;  1BI2 A;  2D9T A;  3HFN A;  4J6W A;  5LL6 S;  3CCR A;  2QQS A;  1M1K U;  4C0Z A;  2IG0 A;  1YIT A;  3CC7 A;  5D6Y A;  5CIU A;  5A0G A;  1K8A U;  4DOW A;  3OSV A;  2G3R A;  1K9M U;  4M7D E;  4M7A B;  2LTO A;  4MZT A;  4PJO E;  3CC2 A;  4JRI A;  4XTV A;  4P5N A;  5HY6 A;  3G4S A;  3TU4 K;  1VQP A;  3RKW A;  2LDM A;  4KUL A;  2JOY A;  2DO3 A;  3ZFJ A;  5LJ5 e;  1LOJ A;  1QW1 A;  2P0Q A;  4RKU E;  5GAN h;  4GLK A;  4E7H A;  2JTF A;  2E5Q A;  2BUD A;  2RHX A;  5CK9 A;  1I4K 1;  4XK8 E;  1VQN T;  5AYF A;  3GOX A;  3VJP A;  3KUF A;  1BIA A;  2EKO A;  1O75 A;  1MHN A;  2K5I A;  5CQY A;  2FYK A;  1N27 A;  3HFO A;  3WVE B;  4NL3 A;  5FLX E;  3QYH B;  4BY6 C;  4OVA A;  1YJ9 A;  1G3W A;  1MGQ A;  4IUV A;  5LJ5 g;  5LJ3 h;  3MO8 A;  4PLL A;  2PUK B;  1BKB A;  2AHJ B;  3CXC S;  1Q82 U;  2ZPH B;  3CPW S;  4PNO A;  2ZPB B;  4OMF B;  3PIO A;  1S72 A;  2E64 A;  2XHC A;  3OS2 A;  2VXE A;  3PGG A;  4FT2 A;  3CMA A;  3CCM T;  3DLM A;  2K57 A;  1N6A A;  2RJC A;  2WSC E;  3P8H A;  4JUV A;  4X9D A;  1I81 A;  1XQH A;  4IUU A;  4RG8 A;  4M77 D;  1AHJ B;  3LX7 A;  2GF7 A;  3M4Y A;  3H6Z A;  3PMT A;  4FL6 A;  5FU6 C;  3JCM f;  3VUB A;  3JB9 J;  4LD6 A;  3M4G A;  2DJZ A;  3QPH A;  3E9G A;  1U1S A;  2DIG A;  5EG2 A;  4HCC A;  2E6N A;  3NFC A;  2XU8 A;  3H8Z A;  2JNG A;  2KQW A;  3L2V A;  1Y71 A;  5LJ5 j;  1YHQ T;  5GMK l;  3BW1 A;  4JLG A;  3OW2 S;  2K3Y A;  1NJI C;  3CCR T;  1VQ7 A;  2V8J A;  1VQ5 A;  3CBM A;  1X75 C;  2GFA A;  2R58 A;  4C8Q B;  3CC7 T;  3CD6 T;  4ZGD B;  2L5Q A;  4ATO A;  2L8D A;  2RHY A;  5C6S A;  3CPW A;  1Y96 B;  1BI1 A;  4ELY C;  3JCM d;  3CCU T;  3L2U A;  1LJO A;  2GCX A;  3G4S T;  3MP8 A;  2XDP A;  2HD0 A;  3OBY A;  3HRS A;  1N9R A;  3V7R A;  4M7A C;  3JAM E;  1O9S A;  2R5M A;  2QEX A;  3C4S A;  2DTI A;  4FT4 A;  2CYZ B;  4M75 B;  4M7D D;  3CCM A;  1VQK T;  3SD4 A;  3M5A A;  4XU1 A;  4PJO D;  2YLC A;  3A8L B;  3OYL A;  5CKH A;  1I5L A;  4XTX A;  2RJE A;  5J39 A;  1KC8 U;  4C5E A;  1YJW T;  3UT1 A;  3G6E T;  3EFR A;  4C5G A;  3V8K A;  1QVF S;  1OZ2 A;  3OW2 A;  3S3N A;  4EMG A;  2DTH A;  2LX9 A;  2DXC A;  3BFM A;  4QQD A;  1VQM A;  3LWH A;  3GNF B;  3JSC A;  5GMK i;  5GMK j;  3AHU A;  2RI5 A;  5CAI A;  2WAC A;  2NLU A;  1S72 T;  4XTW A;  5CKD A;  5GAM h;  4M78 B;  1UGR B;  3I55 T;  4MDX A;  2EYQ A;  2YLB A;  4QQ6 A;  2DXT A;  5CKF A;  3EAE A;  4YTL A;  4C5H A;  4C8Q F;  5GAN d;  2H3J A;  3OYF A;  1VQ8 T;  4HCB A;  4N0A C;  3LGF A;  5IN1 A;  4A53 A;  2O4X B;  3M55 A;  1VIE A;  2C06 A;  3C12 A;  4X9C A;  2OAU A;  3X28 B;  2ZPI B;  3JCM e;  1SSF A;  4VUB A;  4RG2 A;  3SWN A;  2RJD A;  3OYD A;  5FU6 B;  3GP8 A;  2ZGW A;  4NL2 A;  5CKB A;  4C0D C;  5IAY A;  4BAC A;  4E7K A;  3QJY A;  4JRK A;  4FIB A;  4C8Q E;  2DD4 A;  1JRI A;  4CRI A;  3QHS A;  4E7L A;  4IUP A;  4PLI A;  5CQX A;  3V7C A;  1VQ5 T;  1VQ7 T;  2XD0 A;  3HL8 A;  4JS4 A;  5GAN 3;  1IRE B;  2DXB A;  3MEW A;  4B9W A;  4A4H A;  4E47 A;  3ER0 A;  1UGQ B;  3L2W A;  4Y28 E;  4M7A G;  3JCM g;  1DJ7 B;  1JBM A;  2KMT A;  1VQ9 A;  1WGS A;  3OYY A;  3CME T;  1Q7Y C;  4II1 A;  3VU3 C;  2WSF E;  4XTY A;  4M7A A;  1QVP A;  4JDS A;  2RA2 A;  1X6O A;  2R57 A;  4BE0 A;  3X24 B;  2QEX T;  2MMP A;  4FSX A;  1LNX A;  3M9Q A;  3ZBD A;  3OYI A;  4C0G A;  4XU3 A;  2PVO B;  2CZ6 B;  2DZC A;  2K5L A;  4C92 C;  3OY9 A;  3JCM J;  1FWZ A;  3CC4 A;  3MEU A;  4BDZ A;  3CCU A;  4M75 C;  4OP0 A;  4OB3 B;  3V8L A;  4B9X A;  4V2S A;  4RCB A;  4E7I A;  5J26 A;  3RKY A;  3I56 T;  2M16 A;  2DK3 A;  2I2L A;  3L2R A;  2JTM A;  3QZ9 B;  4BE2 A;  4BDY A;  2XG8 D;  3QII A;  4JS5 A;  4F7U B;  1VQM T;  3CBP A;  3MP6 A;  1KC8 C;  1QP3 A;  4IUR A;  4C0F A;  5KH6 A;  2FHD A;  4R55 A;  1VQK A;  4KT0 E;  5KE2 A;  3CCQ T;  2F5T X;  5KCO A;  5J3B A;  2EAY A;  4BI3 A;  5A0L A;  2VGM A;  3S6W A;  3TRE A;  2JZ2 A;  1YJW A;  3G6E A;  1NE8 A;  2DIQ A;  2RI3 A;  2DEQ A;  4A54 A;  4IKF A;  2DTO A;  3VV0 A;  2P0K A;  1KQ1 A;  5CVI A;  3ZEH A;  4FM4 B;  1Q86 C;  2L3R A;  2PU9 B;  4M78 C;  3HRT A;  3OS0 A;  3HRU A;  4MML A;  4UC4 A;  1WJQ A;  4ZN3 A;  3OA6 A;  1V29 B;  4BE1 A;  3GNG A;  4N4I A;  2FB7 A;  3QBY A;  2HQX A;  3HSB A;  1QP2 A;  2PUO B;  4MDW A;  2X4X A;  1RL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...