5HKCA

Crystal structure of m. tuberculosis mazf-mt3 t52d-f62d mutant in complex with 8-mer rna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
b'MVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNDALAAMPGNVDLPATTTRLPRDSVVNVTAIVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease MazF6
publication title Crystal structure of M. tuberculosis MazF-mt3 T52D-F62D mutant in complex with 8-mer RNA
rcsb
source organism Mycobacterium tuberculosis (strain cdc 1551 / oshkosh)
molecule tags Hydrolase/rna
total genus 28
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5hkcA00
3G7ZA 5CKEA 2VUBA 5CCAA 1VUBA 5CO7A 2C06A 3TCJA 4MZMA 3NFCA 5CKHA 5HKCA 5HK3A 3JRZA 1M1FA 4VUBA 5CKBA 5CKFA 5CQXA 4OF1A 3HPWA 2KMTA 5CQYA 1X75C 5CK9A 5CKDA 4MZPA 3VUBA 4MDXA 4HKEA 4ELZC 5CR2A 1NE8A 2MF2A 3JSCA 4MZTA 5DLOA 4ME7A 1UB4A 5HK0A 4ELYC
chains in the Genus database with same CATH superfamily
1WQWA 1N8RC 3HFOA 1Y07A 2ABLA 3V7CA 1M1FA 2B86A 3CXCS 4HVUA 3I35A 2K4YA 2LRQA 1X2KA 1YWPA 2RJCA 5GAN3 4A54A 1S72T 2LNHB 2DLPA 3JSCA 2DXTA 1ZUUA 3QKJA 1KK7A 2LJ1A 1JEGA 3I5SA 3RESA 4ANJA 1RUWA 1WGSA 2QDYB 1YITT 2E3IA 5A0GA 3WVEB 5ECAA 3RBBB 1HD3A 4DOWA 1QVFS 2F5TX 2MAMA 5IH2A 1EIFA 4M77C 5CIUA 5GAMj 3L1AA 2DIGA 2B8AA 2RD1A 1KQSS 1OOTA 4FSXA 3AHUA 2DJQA 3CCMT 3CCSA 2EW3A 2PUKB 1U3OA 1RABB 2JS0A 2CZ6B 3HRSA 2EGAA 3M0SA 4FYVB 4C92G 2EBPA 1W6XA 2KBTA 1YJWT 1VQMQ 1BYMA 2OI3A 2HMAA 4LN2A 4BD3A 4M78A 4OMLA 5CAIA 2MPXC 5KYUB 5LJ5j 5KH6A 3CEYA 2L3RA 2KYMA 1RADB 3HP9A 1LCKA 3OA6A 2RO0A 4O6JA 1VQLT 3S3MA 1G3YA 2DL4A 2L3SA 3LW5E 3OMGA 4GLMA 3SD4A 3CXCP 2CUBA 5FU6B 3S3OA 3PIOA 1V1CA 1VQ7T 4FW2A 4KGZB 2YRVA 4M75A 2XU8A 4ME7A 5IN1A 2OTJQ 4Z8AA 2C0OA 1VQ9Q 3I56T 3OYYA 4CRIA 1Q7YR 3A98A 1YI2T 2RQTA 1KD1C 2COWA 4M7DG 1PD0A 1YJ9Q 2V1RA 2RB6A 3VRZA 2OTLQ 2DPPB 4XTXA 5IAYA 2PU9B 2LZ6B 1OZ2A 2DRKA 2HBWA 5L8RE 5DLQE 2HNIA 2HQEA 1M4ZA 3OYFA 1KQSP 4A4KA 3CC2T 1WZOA 1UJ0A 4F7UA 1M1KC 1ZBJA 4BUGA 5CQYA 3LYIA 1KG1A 1EX4A 2COYA 1KQ2A 4ELZC 2EAYA 3PT9A 1VQPT 3EG9B 3I55A 3OYBA 4OMOA 4BDZA 2EIFA 2VGNA 2O9VA 2V26A 2BE9B 5CKEA 3G4SQ 3QJYA 2AIRB 2Z0WA 2QQAA 3OW2P 3H9NA 2F2XA 3PMIA 3H0FA 2AZVA 2DZ9A 3KFVA 5LJ3h 2PZ1A 2EQMA 4C5HA 1UUEA 3CCVQ 4D8DA 5GAN6 3DKMA 5CR2A 4C0ZA 1JRIA 4R0KA 1QCNA 1CSKA 2JJ9A 3QXEB 3V8LA 2E6ZA 5IHKA 2SEMA 2HL3A 2PUOB 5HKCA 5KCHA 4JZ4A 2D9TA 2JVVA 2YRCA 4HVWA 2QXFA 1YHQA 2J6OA 2M0OA 1MGQA 4PJOF 1JO8A 4M77D 1HXDA 1OU8A 2MI6A 2GFUA 3EG3A 4XTYA 3G71Q 1VQNQ 2GTOA 5FW9A 3EGXA 3TCJA 2FPFA 3HRUA 2QA4Q 1R8OB 2CYZB 3M0UA 1M2OA 2DE0X 3EGDA 2LT4A 3AT1B 3CQTA 1OI1A 5CQXA 3OYMA 1OX9A 3SHWA 2DBKA 2XI9A 5LL6S 1IRXA 1D0YA 3FLGA 2CZ1B 3JB9G 1WHKA 1WHJA 4C92A 2KYBA 4HCKA 2LCCA 1QMCA 2A28A 1RAGB 2ROLA 3GP8A 1ZSZC 4TVRA 9ATCB 2CP3A 3PGGA 2VVKA 1QLYA 3QZ5B 4KGXB 4BY6B 4OB3B 2EJGA 4PJLA 4CC3A 2KXCA 2FG0A 1QCOA 1R77A 1VQMT 4ELYC 4DEXA 3GF5A 1UGSB 1Q7YU 2LC4A 5CO7A 2O2OA 2YRDA 3JCMW 3CCQA 3OSSC 3EG0A 1E6HA 2LMJA 5GANe 3M58A 4EMKC 4ZN3A 4M7DA 4D6WA 1VYTA 3DB3A 2MIOA 3QBYA 2OTJT 4XTZA 2LCSA 3REBB 1X2QA 3VYHB 1VQ9T 2D6FA 3H0IA 3KBGA 4A4EA 2P0PA 4J7FA 4AFQC 1YJ9T 2OTLT 2FB7A 1M2VB 3X26B 3CPWS 2YWWA 1WJRA 5GAN7 4BE1A 2LJ0A 2CP7A 3FRNA 5KYXB 3V8KA 3RNJA 2KY9A 4X9CA 3BDLA 2E10A 1NPRA 4FW1A 4J8OA 4OMPA 3OYDA 4Y91A 3QWYA 1MV3A 1X27A 1K9MR 1WJQA 1GBRA 1D3BB 2DIQA 2H3EB 3IQLA 3SEMA 1M1GA 2L2PA 3L42A 3JCMV 4PJOE 4HCZA 4Z89A 2K7AA 1X6BA 1X6GA 5DY9A 2F2WA 4QVZA 3G4ST 2HD0A 2E70A 4XU2A 3UWNA 4FL6A 4L59A 2JZ2A 3P8BB 2K3YA 4BI4A 3CCVT 4RG8A 3BW1A 2QAZA 3M0PA 2HL5C 2J7IA 3E9FA 3EAEA 2CS7A 2JTEA 4LE9A 3JCMc 5GMKh 2CH4A 1S72A 1AT1B 1KHCA 2AKLA 1IGUA 3DB4A 5FU7B 3UPUA 4PLIA 2DX1A 2JMAA 3VUBA 2ED1A 2X51A 4IIMA 5GAOl 4JRIA 1YITA 5LJ3j 4BI8B 2DEQA 1JXMA 5I11A 1PKTA 1IHWA 4ZGEB 4HCCA 5GAMd 2OAWA 3OYKA 2X4XA 3G71T 2L3PA 1VQNT 3M9QA 2AKKA 4PJOB 1ABOA 4X34A 4IURA 5LJ5h 2QA4T 1TU0B 1SHFA 2LQNA 1NJIR 2KNBB 8AT1B 3H8ZA 4J83A 3X25B 3CCMA 2KROA 1G8XA 1GCQA 4AG2C 1V76A 4F04B 1O9SA 5CCAA 3NTKA 4ZTFA 1KFZA 5L23A 4DBRA 4LD9K 2BZ8A 1YJWA 4C8QF 4N0AA 5LJ5d 1U8RA 4RTZA 5J39A 2KGTA 3OBYA 2LCLA 3C94A 3JCMX 1NEBA 1FWZA 2JTMA 2ZGWA 1YJNQ 2EYQA 4Y28E 3GNGA 1U1TA 4JRQA 4XTVA 2A08A 4EMHA 3X28B 4JLIA 1SG5A 2LQKA 4WCIA 1UHCA 2Y4XA 3GLXA 1VQ7A 1RAAB 2J6KA 5J26A 3EG9A 2LX7A 2XIDA 1Z9ZA 2LX9A 2PNIA 3I56A 1RI0A 2VV5A 1TUCA 1P92A 1YI2A 3E1SA 2FZCB 4M77B 2HQXA 4DQ2A 2NUPB 2PQWA 1K4US 3A8HB 3JCMJ 5A0DA 2JMCA 4NOYA 3WXMB 2RMOA 1FYNA 3CCEQ 4HVVA 2RHYA 1PWTA 1TSFA 4XTUA 2M02A 3S3NA 4EMGA 4QW2A 3MEWA 1WI7A 4M7AF 3OSVA 1K9MU 1XQHA 3JAME 3G6EA 1QVFA 3EG2A 1KJWA 1LVKA 3G1JA 4F16A 3ZL7C 3CC2A 2K5IA 1X6OA 3QYGB 4IUVA 2K3XA 2VB6A 4XAXB 3VS6A 1QVGA 3FJ5A 4BB7A 2H8HA 1M3CA 3UF4A 4PNOA 3RKWA 2DK3A 2QYZA 3CBPA 3LH0A 2HCKA 2RQUA 1D1AA 1VQ5Q 1UB4A 1BCMA 2A3LA 3VS4A 2QGFB 1K1ZA 2DXUA 3H0HA 3MEVA 2EKOA 4KUDK 2WSEE 1VQOA 1CKBA 2KDSA 1JU5C 1JB0E 4OMFB 3NGPA 1AWOA 2L3QA 2EQJA 3A8OB 1MMNA 1UG1A 3FB9A 4GBQA 1KC8R 2R57A 4OB2B 1D0ZA 1AZGB 1PC0A 1ZHIA 2RQWA 4RCBA 1E6GA 3HRTA 1QVPA 2RHXA 2DJZA 1AVZC 3OYHA 2JOYA 1PM3A 3L2ZA 3VS1A 2DL5A 1YP5A 2NUTB 3MJXA 2MCNA 3BY7A 1PNJA 5KYNA 2W0ZA 1ZQ1A 2CKKA 3MKDA 4OMNA 4PK4A 4JLGA 2XG8D 2RK1A 1NJIU 1ZUKA 1MMGA 2YLCA 2ZPFB 3NMZC 1PHTA 1BU1A 2QI2A 4J9CA 5KYWB 1UGQB 1FMKA 4AFUC 2M0YA 1YCYA 5CKHA 2YT6A 1WIEA 2CSIA 2VGMA 2DA9A 1XOVA 1WJSA 3ZBDA 1TH7A 3MEAA 4AG1C 3CCLQ 2X35A 2CP6A 3L2RA 4JRPA 1A0NB 2PTKA 5GMKj 3PNWC 3FIFA 4JJDA 3FEOA 4FYWB 4HA8A 2KSSA 3VU3C 3JCMQ 1QVGS 5GAN2 5IT9E 1NZ9A 2ENMA 4RTYA 5A0LA 1NYFA 1W4SA 3FDRA 4M77G 2HKNA 3O8VA 3TVTA 4JJNK 3PE0A 1OEBA 5GAMf 4Q5WA 1RAFB 1W1FA 4RTVA 3LWIA 1VQMA 2FL7A 2X9HA 4C92C 1AEYA 2EYZA 4LD6A 4E7JA 4M7AE 3PFSA 4KBMB 2QASA 4FYYB 5FLXE 1YJNT 2PVDB 1X43A 3QWXX 3UATA 1XNIA 2M51A 5KE2A 2RPNA 3EFSA 1D3BA 3FJPA 1RAHB 4GY5A 3O5ZA 3LWHA 4C0DB 4RTWA 5LJ5f 2LTOA 1OX8A 1PD1A 2OTJA 2BZXA 1VQ9A 4Y92A 2K2VA 3REAB 3OYIA 1Q81R 1SRMA 1YJ9A 4RCCA 1QWEA 2OTLA 3C0CA 4BE2A 4M7DC 1ZLMA 2LT1A 3CCET 1QVFP 3UA6A 5GAMg 1M30A 3OS2A 1VQKQ 1K8AR 2VWFA 1ZX6A 3CBOA 2RA2A 1K9AA 4AMCA 5GAMe 1M90C 5GAOq 1QVGP 2HKQB 4PJOD 3BFMA 4B6MA 5KYYB 1K0XA 2QDLA 3GIBA 2FEIA 4M78F 2Y90A 4ZTJA 2RI3A 2NUZA 1KC8U 5GAOn 8ATCB 1IHVA 1UTIA 3OYNA 5FRNA 1N8RR 4EMKB 5LJ5g 3OB9A 2HBPA 3A1PA 3G7ZA 5GAN4 3QDRB 5C0MA 3G4SA 1VQ5T 4M75F 1T0JA 1WYXA 2EYWA 1B07A 1I8FA 3BE3A 2KR3A 4QQ6A 2XICA 4RMOA 2DVEA 4ESRA 3CCVA 1WX6A 2DYBA 3I55Q 1WHLA 2EJ9A 4IUUA 1OQKA 2XD0A 3OYGA 4JZ3A 3VS7A 1C1AA 4XQ3A 3UT1A 2L0AA 4HXJA 1UGPB 2E65A 3ZFJA 3VS3A 2XDPA 3JCMh 2R58A 3OMCA 5LJ3d 3RR6A 3M55A 3UA7A 1GBQA 1NE8A 4BE0A 4F7UF 1UGVA 4C8QC 3MP8A 2O31A 5GANj 1HYOA 1SHGA 2G3RA 3R6OA 1BIBA 3G71A 1VQNA 1W2BA 5GAOm 2DM1A 3CPWA 1KIKA 2CZ7B 3A8MB 2QA4A 4IIOA 2R5AA 2RM4A 3JCMd 3HPWA 2IVWA 1FX7A 1ZBXA 4RTUA 1TOVA 3CMAQ 3HFNA 2DXCA 1Y71A 1S1NA 4IUTA 4M77A 5KCOA 2VKNA 3SWNA 3CCLT 2NUPA 3PIPA 1LJOA 2KRMA 3VS2A 1M3AA 4OMQA 2F5KA 1O75A 4FT4A 5FROA 2VYTA 2RN8A 2DBMA 2MOXA 3SFMA 1Q86C 3NHNA 1JQQA 3M54A 1BI0A 1HK9A 3QSUA 3ULRB 2QEXQ 5D6YA 3NPFA 4M7AC 1KD1R 2FYKA 2K3BA 1ZSGA 1M5Q1 1F1BB 5GAOp 3CCST 3OS0A 2I0NA 3TSWA 1Q81U 2V1QA 2JS2A 4C5GA 3ASKA 2O4XB 4M78E 1I81A 4PJMA 5CVIA 3R6NA 3OS5A 2ZPEB 3VV0A 1T0HA 1NJIC 2JN0A 2K5FA 4QKUA 1K8AU 1K73R 2P4TA 3CBMA 1V29B 2KI7A 1G83A 3GNFB 4ZGJB 4RTXA 3ME9A 1VYVA 4O5VA 4C92F 1QCFA 2RQRA 3VUZA 4EDUA 1SPKA 4CC7A 3VYGA 4QT7A 3M53A 1W2BS 1YCSB 2O9SA 1N8RU 2NUTA 1SEMA 3RKYA 1VQKT 2EGEA 2RI2A 3LX7A 4PFZA 2KE9A 3EH2A 4LDYA 4MDWA 1X75C 3RKXA 2V8KA 4ZN1A 4MMKA 5KYWA 2E41A 4KH0B 1SKUB 4OB1B 4N4IA 2DL7A 2BIVA 3JCMb 4F7UE 2RK2A 2E5KA 1NYGA 3C95A 4M7DF 1UGRB 1BB9A 1G5VA 1YIJQ 2KK4A 1MNDA 4OB0B 5GMKl 1WFWA 2CP2A 1OPKA 1N9RA 2DL3A 3NTIA 1GFDA 1VQ4Q 2MF2A 3JB9H 3M56A 1G2BA 4J6WA 1M8MA 2H3JA 4NL3A 2CP5A 3VJPA 1VQ8Q 3I55T 2V8JA 4PJJA 4DA4A 2FZGB 2CZ0B 2CDTA 2AK5A 2KEAA 3OYAA 4JS4A 3QPHA 3P8DA 4E7SA 2MMPA 4CI0C 1MUZA 4MDXA 1X69A 2E64A 4R55A 4QQDA 1I07A 3JV3A 1YWOA 1IB8A 1VYUA 2YUPA 2ZCFB 2E12A 2G6FX 5KYUA 3GPLA 1EFNA 3CC4Q 1W2BP 3CPWP 3C4SA 2AZSA 1Z9QA 3N5BB 3H6ZA 3V7SA 4AFSC 1R0CB 2P0QA 1WLPB 5LJ3f 4MMLA 1JJ2A 3J7AF 1KC8C 3CMAT 4A4HA 5HK0A 4NL2A 3HHTB 1KD1U 2C0TA 4HT9A 4M7AD 2EVRA 2KT8A 3QIIA 2K57A 1PRLC 2HAXA 2D0NA 2GGRA 2DAQA 2P84A 4JS5A 2JT4A 1RLPC 4PFOA 4L5GA 4C92E 1YJNA 1BI3A 5KYYA 2VUBA 4II1A 1K73U 1VQLA 2QEXT 3A8LB 4PKCC 1AWXA 2C0IA 1FMVA 4OF1A 5I22A 1JXOA 1BBZA 4M78C 2ATCB 1WXBA 1N9SA 4EMKA 2PVOB 2O01E 3JB9F 1SRLA 2AHJB 2ROTA 4IKFA 2OX7A 5AYFA 5LJ3g 1RL2A 3CCJQ 3MO8A 1H92A 4KGVB 2J6FA 3RIRA 3CCUQ 5I2SA 1TUDA 3OY9A 4JUVA 3CCEA 1G3WA 3E2UA 2OAUA 5LJ3e 1UECA 4CC4B 1UE9A 3CMEQ 4M75C 4M7DE 1WDXA 2COZA 3E9GA 1Q82R 2IPOB 2M16A 2DTIA 2GF7A 2VC8A 2KVQG 3JCMg 2GBQA 3QDFA 2MWPA 3TEEA 1BIAA 2RJDA 1K0SA 2IIMA 6AT1B 4C92B 2YUQA 3NFCA 1N5ZA 3QO3A 4V2SA 4PLLA 1X01A 1GFCA 1JJ2S 3OS1A 1HJDA 3CC7Q 2KMTA 2E6NA 1VQPA 1U5SA 4LDVA 3CD6Q 1WNLA 2HDAA 2DFUA 3VS5A 4N4HA 1U06A 1LOJA 3INZA 4X1VA 3EFOB 4R56A 2DZCA 1VQ5A 3E19A 3URGA 2FHDA 2QQ9A 1OU9A 3M0QA 3VS0A 3LLRA 3PVLA 2X4YA 5GMKi 1Q7YC 3L2WA 1VQ6Q 1WXTA 1Q81C 5GANh 1M3BA 1LPLA 1QP3A 2NWMA 1YIJT 1UFFA 3M4YA 4D8KA 3DLMA 3SDZA 2DNUA 2WSFE 4PJOG 4FSSA 5HCKA 2W10A 2K79A 2QQSA 4M7DB 1BK2A 4E7ZA 2XK0A 3M0RA 1TUGB 1VQ4T 1VQOQ 1PSFA 1VQ8T 1SSFA 2GNCA 1VIEA 5A2QE 4J7IA 1I5OB 4LDWA 2HSPA 3CCRQ 1KSWA 1D0XA 4AT1B 4FIBA 1UDLA 5GANd 2DERA 3QYHB 1D1CA 4ATOA 4PFPA 3M0TA 2E5QA 4ZNXA 4NS5A 4E47A 1ZUYA 3M57A 4C8QE 2E1HA 1GXIE 1PRMC 2RI5A 2XDBA 2X4WA 2DF6A 3QG1A 4XU0A 2L8DA 3OQ5A 4FYXB 2QQBA 3CC4T 2D1XA 2HEQA 3WVDB 5GAN8 1IO6A 4M4ZA 2RJFA 2O4XA 3CCLA 4A63B 1JJ2P 5IXFA 5IXBA 3L2UA 3S6WA 4DOVA 2VXEA 2XDDA 2KRNA 1GRIA 3NTHA 1NM7A 1B3QA 4FCYA 1RAIB 2HZYA 2DTHA 3BDUA 1I5LA 4JRKA 2QQRA 4X9DA 1TXQA 5CKFA 3SWNC 1G3TA 1AZEA 2CH4W 2QGGA 1M2VA 5CKDA 2CP0A 1R0BG 2MK5A 1MMDA 1NG2A 4M78D 1RLQC 4JJCA 2BKDN 4PJNA 2A37A 3QHSA 1PG5B 5KYXA 1W70A 2BZYA 3CCSQ 1H641 1NBEB 1E7OA 4MZMA 1H3ZA 4C8QB 1Y0MA 2J05A 4KH1B 3M59A 2IG0A 3M5AA 2DRMA 3L2QA 5CK9A 1WA7A 4M75D 4J5YA 4WTOB 4QVDA 4KRTA 5IHIA 1Q82U 3MHXA 2ED0A 1WHGA 3X24B 1TG0A 4E6RA 2QG9B 1SSHA 3CPFA 3OW2S 3OYJA 2EGCA 1FMWA 1I1JA 4J9FA 2EPDA 3CCJT 4FM4B 4K11A 3CCUT 2M1HA 1IGQA 5GAN5 7AT1B 2NLUA 3RMQA 4MZPA 4EPCA 1D09B 1ZSZB 4Z88A 3CMET 1Y96B 2ZPBB 2EQKA 1VQKA 2FO0A 2XHCA 3MP6A 2RQVA 2FPDA 2GQVA 2LNVA 4QQGA 2DTOA 3H41A 5GMKe 3JRZA 3EHQA 4M7AB 3OBWA 2F69A 4DEYA 3SB2A 3CC7T 3G6ET 3T9NA 2M9UA 3CD6T 2F2VA 2ECZA 1K73C 4PJOA 1OYXA 3EH1A 2A7YA 2MWOA 3A5ZB 5LJ5e 1AWJA 1VQ6T 4HKEA 2JUFA 5GJWB 3QZ9B 5GMKm 4BDYA 1T3LA 3L2VA 4OP0A 2ZPHB 4J6XA 1MV0B 1YFNA 4RTTA 4PL6A 1VIFA 2FZKB 3KXTA 1VQOT 2JXBA 1AWWA 3MCAB 2LQ8A 1VA7A 2ZPIB 1AOJA 3MP1A 4LUEA 1D1BA 3CCRT 1K9MC 2OJ2A 2WSCE 2DKGA 3OYCA 1J3TA 4BACA 2RH2A 2FRYA 1M27C 2CGHA 4C0GA 1N6AA 1YN8A 1KQ1A 2HQHA 3HKSA 5IHNA 3V7RA 5FWCA 1YHQQ 4A4FA 5HY6A 2QTXA 3MPUB 1K76A 4C8QG 2LQWA 1U1SA 3CMAA 4OGCA 5GANf 5DLOA 4LUDA 2EWNA 4P5NA 3JCMP 3HL8A 4C92D 5FU6C 2RNAA 4C0DC 2EYYA 3FC3A 2GCXA 4VUBA 1B34B 3P8HA 2YDLA 1M8VA 3VKIA 1C0MA 2CT4A 1AD5A 3M4GA 4RKUE 2RJEA 2GFAA 1GCQC 4MZTA 3QUIA 2RHZA 1QP2A 2QEXA 2L5QA 3EHRA 2LVMA 2KAFA 3RUXA 1WQ7A 1WHHA 4N0AC 3KUFA 1RACB 3GBQA 5CKBA 2QTVA 4IUQA 2AT1B 5I21A 1NLPC 4DBQA 4M7AG 4J6YA 3EFOA 1N27A 4M7DD 4QVCA 1YBYA 2E3HA 1M90R 2LDMA 5GANg 2A36A 2VXFA 2X4JA 2DETA 1NLOC 2DEUA 1M1KR 2DO3A 4M77F 2K5LA 3CCQQ 2X3WD 4XU1A 1UEBA 2ZAEA 4CC2A 1GL5A 2BE7D 3JB9J 2RHIA 1MMAA 1VOMA 1SF9A 4M75E 1TTHB 1Y7XA 2JM9A 2EYXA 2BUDA 3RMSA 4HCBA 4KUIA 1HSQA 2JNGA 2DXBA 4C5EA 1G3SA 5KE3A 2X3XD 1JBMA 2P0KA 2YXYA 4BI3A 1OZ3A 1MHNA 2D8HA 3TREA 3X20B 5D7UA 2JTFA 4E2FB 1PKSA 2ZZDA 4M78B 1KHIA 4L6V5 1OULA 5HK3A 1UHFA 3D7SB 2DVJA 2RHUA 2DL8A 1T3SA 3RERA 2J06A 1YIJA 2LJ3A 4OGEA 3ER0A 3EFRA 4KULA 1QWFA 2DD5A 3C12A 5I2MA 2K2MA 2YLBA 1PCXA 2ZPGB 2D8JA 4A53A 1VQ4A 4E7IA 2QK0A 4M75B 1Q82C 4GLKA 1FXXA 1VQ8A 2EQUA 4C8QD 4J9BA 4N4GA 1PSEA 1IXDA 1C6VX 5EC7A 2CUDA 3EG1A 3HTRA 4FT2A 2CREA 2O88A 3HSBA 2PVGB 1NEGA 2CSQA 4J9DA 4J9EA 5GAOr 2YUOA 3CC4A 4C8QA 2SRCA 4E7LA 4BY6C 5GAMh 1EZZB 2F1LA 1Q86R 2YUNA 1MNEA 3PMTA 1S72Q 4KT0E 3JB9D 3VRYA 4Z02A 1QQJA 2VASA 4F7UB 2EKHA 4LNPA 1I4K1 2Y4YA 4XTWA 1ACMB 4FU6A 1YHQT 1RI9A 3F70A 2CT3A 1YITQ 1BI2A 4XU3A 1AHJB 2V8IA 2XMFA 2XKOC 4J9IA 4RUGA 4ORZA 5M9OA 3V8JA 1ABQA 3LGFA 3TU4K 4EIKA 2MYSA 2RF0A 4ZGDB 3I5RA 3PVQA 2ESWA 1RAEB 4M77E 1ZSZA 1Y96A 3QJ6A 1XJWB 3JCMf 3CCMQ 2YHTA 2GTJA 2A0FB 3ZEHA 1BCOA 1M90U 1TWBA 1M9SA 1OPLA 1H8KA 1QKXA 1ZA2B 3UDCA 4F14A 2EJFA 4M7AA 1M1KU 1XTDA 5DM7R 1YJWQ 1I0CA 4F17A 5GJVB 4AFZC 5D6WA 4XK8E 2FRWA 2P4RA 1QKWA 1DJ7B 4E7KA 1QW1A 1UJYA 1VQLQ 3A8GB 4A4GA 3CCJA 2EQIA 1VUBA 4JPBW 3CCUA 1BI1A 1IREB 3EGXB 2DD4A 1VQ7Q 3OYLA 4YTLA 2JW4A 4M78G 1B7TA 4DBHA 2FPEA 2JM8A 4DBFA 4C0FA 1Q95G 3CCQT 3CMEA 3EGDB 2K6DA 3CXCA 2L89A 3I56Q 2D0QB 3EGUA 5J3BA 1OV3A 1YI2Q 2WACA 3LGLA 3SWNB 4LXCA 3THKA 4JDSA 2GQIA 2C06A 1TS9A 2KXDA 4M75G 5D6XA 4E7HA 3JCMe 5FRMA 2E4HA 3DLLA 1ARKA 5EG2A 3CC7A 2DMOA 3G6EQ 2KT1A 3TSZA 2DILA 2I2LA 4LDXA 2YSQA 3CD6A 3I9QA 3GOXA 3Q1JA 3CC2Q 1Y57A 4LDUA 5FU7C 1YNZA 3OYEA 3RDVA 1KQSA 1WPYA 4UC4A 3J81E 2BTTA 1VQPQ 1VQ6A 2LP5A 4IUPA 3TQ7P 2NYSA 1BKBA 3MEUA 1LNXA 1GCPA 4F7UG 4B9XA 4HT8A 1ZA1B 4PJOC 3META 5C6SA 4J9HA 3U23A 2HSEB 4OVAA 1H3HA 2EFIA 2K9GA 1K8AC 1NPPA 2R5MA 1B34A 1Q86U 2FVUA 3JB9I 4JJBA 2DYIA 3OW2A 1IZ6A 4C5IA 5AT1B 1WXUA 2KRSA 4J9GA 3CCRA 4WF2A 2KQWA 5FWBA 3J80E 1WHMA 3LH5A 4OMMA 4RG2A 4B9WA 1CKAA 3PTAA
chains in the Genus database with same CATH topology
1O9SA 1WQWA 5CCAA 2P4TA 3CBMA 3NTKA 4ZTFA 1N8RC 3HFOA 1V29B 1Y07A 3V7CA 3GNFB 1M1FA 1K73C 4PJOA 1OYXA 3CXCS 4LD9K 2A7YA 4ZGJB 2MWOA 3A5ZB 2K4YA 1YJWA 3ME9A 2LRQA 5LJ5e 4O5VA 4C92F 2RJCA 4N0AA 4C8QF 5LJ5d 4A54A 5GAN3 3VUZA 4EDUA 1U8RA 5J39A 1S72T 3VYGA 1VQ6T 3OBYA 2LCLA 3C94A 4HKEA 3JCMX 1FWZA 2JTMA 3JSCA 3M53A 2DXTA 2JUFA 3QKJA 1W2BS 2ZGWA 3QZ9B 5GMKm 4BDYA 2EYQA 3RESA 3L2VA 1N8RU 4Y28E 3GNGA 1U1TA 4JRQA 1WGSA 2ZPHB 4OP0A 4XTVA 2QDYB 4J6XA 3RKYA 1VQKT 1YITT 2RI2A 3LX7A 4EMHA 3X28B 4JLIA 2LQKA 5A0GA 3WVEB 4PL6A 2Y4XA 1VIFA 3GLXA 4DOWA 3KXTA 1VQOT 1VQ7A 2F5TX 2MAMA 1QVFS 4LDYA 4MDWA 1EIFA 1X75C 4M77C 5J26A 3RKXA 3CMAT 5CIUA 3MCAB 5GAMj 2XIDA 2LQ8A 3L1AA 2LX9A 2DIGA 3I56A 2ZPIB 2B8AA 3MP1A 1RI0A 2V8KA 4ZN1A 2VV5A 4MMKA 3CCRT 1K9MC 2E41A 1P92A 2WSCE 4OB1B 2RD1A 1YI2A 2DKGA 3E1SA 4N4IA 3OYCA 4M77B 2HQXA 1KQSS 4DQ2A 4FSXA 4BACA 3AHUA 2RH2A 3CCMT 2PQWA 3CCSA 2BIVA 3A8HB 3JCMJ 5A0DA 3JCMb 2PUKB 4F7UE 2RK2A 2CGHA 4C0GA 3WXMB 4NOYA 4M7DF 1N6AA 3C95A 1KQ1A 1UGRB 1G5VA 2KK4A 3HKSA 2RHYA 5GAN4 3V7RA 4OB0B 2CZ6B 3HRSA 4A4FA 5HY6A 4XTUA 5GMKl 3S3NA 1N9RA 3NTIA 4QW2A 2QTXA 4C92G 4EMGA 4C8QG 3MEWA 1U1SA 4M7AF 3OSVA 1YJWT 1K9MU 1BYMA 3CMAA 1XQHA 4OGCA 3JAME 3G6EA 5GANf 2MF2A 4BD3A 1QVFA 3JB9H 3M56A 5DLOA 2EWNA 4J6WA 4P5NA 4M78A 5CAIA 2H3JA 4NL3A 3VJPA 5LJ5j 3JCMP 3I55T 2V8JA 3CEYA 3HL8A 4C92D 2L3RA 5KH6A 4DA4A 3HP9A 3CC2A 2K5IA 1X6OA 3QYGB 2CZ0B 4IUVA 5FU6C 3OA6A 2K3XA 2RO0A 4C0DC 4O6JA 4XAXB 3FC3A 2GCXA 4BB7A 4VUBA 3OYAA 1QVGA 1VQLT 4JS4A 1G3YA 3S3MA 3QPHA 3LW5E 3P8DA 1B34B 3P8HA 3OMGA 2MMPA 3SD4A 4PNOA 3RKWA 5FU6B 2DK3A 4CI0C 3S3OA 1M8VA 3VKIA 3PIOA 1VQ7T 4MDXA 3CBPA 3LH0A 3M4GA 2E64A 2YRVA 4R55A 4RKUE 4M75A 4QQDA 2RJEA 2GFAA 4MZTA 2ZCFB 2XU8A 2E12A 2RHZA 3QUIA 1QP2A 4ME7A 5IN1A 3GPLA 1UB4A 2QEXA 2A3LA 2L5QA 3I56T 3OYYA 4CRIA 2DXUA 2LVMA 3MEVA 1YI2T 3C4SA 2EKOA 2KAFA 2WSEE 4KUDK 3RUXA 1WQ7A 1VQOA 1KD1C 3N5BB 4N0AC 4M7DG 3H6ZA 2KDSA 3KUFA 2RB6A 5CKBA 1JB0E 4OMFB 3V7SA 2EQJA 4IUQA 3A8OB 2DPPB 5I21A 4XTXA 3FB9A 2PU9B 5IAYA 2R57A 2P0QA 4OB2B 4M7AG 4J6YA 1OZ2A 4M7DD 1N27A 5LJ3f 4MMLA 1JJ2A 3J7AF 4QVCA 1KC8C 1YBYA 1ZHIA 4RCBA 5L8RE 5DLQE 2HNIA 3HRTA 1QVPA 2HQEA 1M4ZA 2LDMA 2RHXA 2DJZA 2VXFA 3HHTB 4NL2A 5HK0A 5GANg 2X4JA 3OYFA 3OYHA 1KD1U 2JOYA 4HT9A 3L2ZA 4M7AD 3QIIA 2K57A 2DO3A 4M77F 2K5LA 4A4KA 3CC2T 4XU1A 3BY7A 1UEBA 2HAXA 4F7UA 1M1KC 1ZQ1A 3JB9J 2RHIA 4BUGA 2CKKA 2DAQA 4JS5A 5CQYA 3LYIA 4JLGA 4M75E 1KG1A 1Y7XA 2XG8D 1KQ2A 4ELZC 2BUDA 2EAYA 2RK1A 3PT9A 1VQPT 3RMSA 1NJIU 3I55A 2YLCA 3OYBA 4HCBA 2ZPFB 4L5GA 4C92E 4BDZA 4KUIA 2EIFA 2QI2A 2VGNA 1YJNA 2JNGA 1BI3A 5CKEA 1UGQB 2DXBA 2VUBA 4II1A 1K73U 1VQLA 2QEXT 4C5EA 3QJYA 3A8LB 1G3SA 5KE3A 1YCYA 5CKHA 2QQAA 2VGMA 1JBMA 2P0KA 1XOVA 3PMIA 4PKCC 4BI3A 1OZ3A 1MHNA 2DZ9A 1WJSA 5LJ3h 3ZBDA 1TH7A 3MEAA 3TREA 4OF1A 2EQMA 4C5HA 3CD6A 2X35A 3X20B 5GAN6 3L2RA 4M78C 3DKMA 2JTFA 5CR2A 4JRPA 4C0ZA 1N9SA 4EMKA 1JRIA 2PVOB 5GMKj 3PNWC 2O01E 3FIFA 3JB9F 2AHJB 3QXEB 3FEOA 4HA8A 4IKFA 5AYFA 2KSSA 3VU3C 3JCMQ 5LJ3g 1QVGS 1RL2A 3V8LA 3MO8A 2ZZDA 5GAN2 4M78B 5IT9E 1KHIA 1NZ9A 2E6ZA 5A0LA 4L6V5 3RIRA 1W4SA 2PUOB 5HKCA 3FDRA 5I2SA 5KCHA 5HK3A 2D9TA 2JVVA 4M77G 3OY9A 2RHUA 4JUVA 3O8VA 1G3WA 3CCEA 4JJNK 2OAUA 5LJ3e 1YIJA 3RERA 5GAMf 4Q5WA 4OGEA 2QXFA 3ER0A 3EFRA 4M75C 3LWIA 1YHQA 4M7DE 4KULA 2DD5A 2M0OA 3C12A 5I2MA 4A4HA 2YLBA 2ZPGB 1MGQA 4PJOF 4M77D 3E9GA 2FL7A 1HXDA 1VQMA 4A53A 2MI6A 4C92C 4E7IA 1VQ4A 2M16A 2DTIA 2GF7A 2VC8A 2GFUA 2KVQG 4XTYA 4M75B 4LD6A 3JCMg 1Q82C 2OTJT 4E7JA 4M7AE 2MWPA 4GLKA 1FXXA 1VQ8A 3TEEA 2EQUA 1BIAA 2RJDA 3PFSA 4KBMB 4C8QD 3TCJA 4C92B 3HRUA 3NFCA 5FLXE 1YJNT 4N4GA 1PSEA 3QO3A 1R8OB 2CYZB 2PVDB 4V2SA 4PLLA 1X01A 1XNIA 2LT4A 4FT2A 1JJ2S 5KE2A 1OI1A 5CQXA 3OS1A 3EFSA 1D3BA 2KMTA 2E6NA 3FJPA 3OYMA 1VQPA 4LDVA 4GY5A 2XI9A 3LWHA 5LL6S 4C0DB 3HSBA 1WNLA 5LJ5f 4N4HA 2PVGB 2LTOA 3FLGA 1LOJA 3INZA 2CZ1B 2OTJA 4R56A 3JB9G 2DZCA 1VQ5A 3E19A 3URGA 1VQ9A 5GAOr 4C92A 3CC4A 4C8QA 2FHDA 2LCCA 4E7LA 2QQ9A 4BY6C 5GAMh 2K2VA 3GP8A 3LLRA 3OYIA 2X4YA 5GMKi 1Q7YC 3PMTA 4KT0E 4TVRA 3L2WA 3JB9D 3PGGA 4Z02A 1YJ9A 4RCCA 1Q81C 4BE2A 2OTLA 5GANh 3QZ5B 4BY6B 2LT1A 4F7UB 4M7DC 4OB3B 2EJGA 3CCET 1QP3A 1I4K1 1YIJT 2Y4YA 3M4YA 5GAMg 4XTWA 3DLMA 3SDZA 2WSFE 4FU6A 4PJOG 1YHQT 3OS2A 3F70A 1BI2A 4XU3A 1AHJB 2QQSA 2V8IA 4M7DB 2XKOC 1VQMT 2XK0A 4ELYC 1VQ4T 3GF5A 1UGSB 3CBOA 1Q7YU 2RA2A 2LC4A 5GAMe 5CO7A 1M90C 5GAOq 5M9OA 4PJOD 3BFMA 1PSFA 3V8JA 3GIBA 3LGFA 1VQ8T 1SSFA 3TU4K 3CCQA 3JCMW 4M78F 1VIEA 5A2QE 4J7IA 3OSSC 4LDWA 2Y90A 4ZGDB 5GANe 3M58A 5GANd 4FIBA 4EMKC 4ZTJA 4M77E 4ZN3A 2RI3A 3QYHB 1Y96A 4ATOA 1KC8U 5GAOn 3QJ6A 3JCMf 2YHTA 4M7DA 4D6WA 3ZEHA 2E5QA 4NS5A 3OYNA 3DB3A 4E47A 5FRNA 3M57A 4C8QE 1M90U 2E1HA 4EMKB 1GXIE 5LJ5g 3OB9A 1M9SA 2RI5A 2HBPA 2XDBA 3G7ZA 2X4WA 3QBYA 3QDRB 3QG1A 2L8DA 4XU0A 4XTZA 3UDCA 3OQ5A 2EJFA 4M75F 5C0MA 3G4SA 1VQ5T 4M7AA 1M1KU 1XTDA 5DM7R 3VYHB 2QQBA 1I8FA 3CC4T 1VQ9T 3WVDB 5GAN8 2D6FA 4QQ6A 2XICA 2RJFA 4RMOA 2O4XA 3KBGA 5D6WA 4A4EA 4XK8E 2P0PA 4J7FA 2DVEA 3CCLA 3CCVA 1DJ7B 1YJ9T 2EJ9A 2OTLT 2FB7A 4IUUA 4E7KA 3X26B 1QW1A 3CPWS 1WJRA 3OYGA 5GAN7 2XD0A 4BE1A 3L2UA 3S6WA 4DOVA 3A8GB 2VXEA 4XQ3A 3UT1A 4A4GA 3FRNA 3NTHA 2XDDA 3V8KA 3CCJA 1VUBA 2KY9A 4X9CA 3BDLA 2E10A 1UGPB 2E65A 3CCUA 1BI1A 1IREB 2DTHA 3BDUA 1NPRA 1I5LA 2DD4A 4J8OA 4JRKA 3ZFJA 3OYLA 1Q82U 2QQRA 4YTLA 3OYDA 2XDPA 4M78G 4X9DA 4Y91A 3JCMh 2R58A 5CKFA 4C0FA 3OMCA 3SWNC 1G3TA 5LJ3d 3CMEA 3CCQT 3CXCA 5CKDA 1WJQA 2L89A 1D3BB 2D0QB 3M55A 5J3BA 2DIQA 1NE8A 4BE0A 4F7UF 4M78D 2WACA 3LGLA 4C8QC 2BKDN 3MP8A 3QHSA 3SWNB 5GANj 1M1GA 2G3RA 3L42A 3R6OA 1BIBA 4JDSA 3JCMV 4PJOE 3G71A 1VQNA 1W2BA 5GAOm 2C06A 1H641 4HCZA 3CPWA 4MZMA 2CZ7B 3A8MB 1H3ZA 4C8QB 4M75G 2QA4A 5D6XA 3CD6T 5DY9A 3JCMe 2R5AA 3M59A 2RM4A 4QVZA 2IG0A 3G4ST 4E7HA 5FRMA 3M5AA 3JCMd 3HPWA 3DLLA 2HD0A 1FX7A 1ZBXA 2IVWA 5EG2A 5CK9A 3L2QA 3CC7A 2E70A 3HFNA 4XU2A 3UWNA 2DXCA 4FL6A 4M75D 2I2LA 4LDXA 1Y71A 4J5YA 4IUTA 2JZ2A 3P8BB 2K3YA 4L59A 4M77A 3SWNA 4BI4A 4QVDA 5KCOA 3GOXA 3MHXA 3CCLT 3Q1JA 3X24B 3CCVT 4RG8A 3BW1A 3PIPA 1LJOA 4LDUA 2F5KA 3CPFA 5FU7C 3OYEA 3OW2S 1O75A 3E9FA 3OYJA 4FT4A 3EAEA 2CS7A 1KQSA 1WPYA 5FROA 5GMKh 2VYTA 3JCMc 3CCJT 4UC4A 3J81E 1S72A 1VQ6A 4FM4B 1KHCA 3SFMA 3CCUT 1Q86C 3DB4A 5FU7B 2M1HA 4IUPA 3UPUA 5GAN5 4PLIA 3M54A 2NLUA 3RMQA 4MZPA 3VUBA 1BKBA 4EPCA 3MEUA 1BI0A 5GAOl 1HK9A 3QSUA 4JRIA 1Y96B 3CMET 2ZPBB 2EQKA 1LNXA 4F7UG 4B9XA 1VQKA 2XHCA 5D6YA 4HT8A 1YITA 3MP6A 5LJ3j 4M7AC 4PJOC 4BI8B 3META 2DEQA 5C6SA 2FYKA 2GQVA 4OVAA 2LNVA 4QQGA 2DTOA 4ZGEB 2EFIA 1K8AC 4HCCA 1NPPA 2R5MA 1M5Q1 1B34A 5GAMd 5GMKe 3JRZA 5GAOp 3OS0A 3CCST 1Q86U 1Q81U 3OYKA 2FVUA 2X4XA 4M7AB 3JB9I 3M9QA 3G71T 1VQNT 4PJOB 4X34A 3OW2A 1IZ6A 3OBWA 4IURA 2F69A 5LJ5h 4C5IA 2QA4T 3CCRA 4WF2A 2KQWA 3SB2A 4C5GA 3ASKA 3J80E 2O4XB 4M78E 1I81A 3H8ZA 5CVIA 4J83A 3X25B 3OS5A 3CC7T 2ZPEB 3CCMA 3VV0A 1NJIC 4RG2A 2JN0A 4B9WA 2K5FA 3G6ET 3PTAA 3T9NA 1K8AU 2M9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G7Z A;  5CKE A;  2VUB A;  5CCA A;  1VUB A;  5CO7 A;  2C06 A;  3TCJ A;  4MZM A;  3NFC A;  5CKH A;  5HKC A;  5HK3 A;  3JRZ A;  1M1F A;  4VUB A;  5CKB A;  5CKF A;  5CQX A;  4OF1 A;  3HPW A;  2KMT A;  5CQY A;  1X75 C;  5CK9 A;  5CKD A;  4MZP A;  3VUB A;  4MDX A;  4HKE A;  4ELZ C;  5CR2 A;  1NE8 A;  2MF2 A;  3JSC A;  4MZT A;  5DLO A;  4ME7 A;  1UB4 A;  5HK0 A;  4ELY C; 
#chains in the Genus database with same CATH topology
 1WQW A;  1N8R C;  3HFO A;  1Y07 A;  2ABL A;  3V7C A;  1M1F A;  2B86 A;  3CXC S;  4HVU A;  3I35 A;  2K4Y A;  2LRQ A;  1X2K A;  1YWP A;  2RJC A;  5GAN 3;  4A54 A;  1S72 T;  2LNH B;  2DLP A;  3JSC A;  2DXT A;  1ZUU A;  3QKJ A;  1KK7 A;  2LJ1 A;  1JEG A;  3I5S A;  3RES A;  4ANJ A;  1RUW A;  1WGS A;  2QDY B;  1YIT T;  2E3I A;  5A0G A;  3WVE B;  5ECA A;  3RBB B;  1HD3 A;  4DOW A;  1QVF S;  2F5T X;  2MAM A;  5IH2 A;  1EIF A;  4M77 C;  5CIU A;  5GAM j;  3L1A A;  2DIG A;  2B8A A;  2RD1 A;  1KQS S;  1OOT A;  4FSX A;  3AHU A;  2DJQ A;  3CCM T;  3CCS A;  2EW3 A;  2PUK B;  1U3O A;  1RAB B;  2JS0 A;  2CZ6 B;  3HRS A;  2EGA A;  3M0S A;  4FYV B;  4C92 G;  2EBP A;  1W6X A;  2KBT A;  1YJW T;  1VQM Q;  1BYM A;  2OI3 A;  2HMA A;  4LN2 A;  4BD3 A;  4M78 A;  4OML A;  5CAI A;  2MPX C;  5KYU B;  5LJ5 j;  5KH6 A;  3CEY A;  2L3R A;  2KYM A;  1RAD B;  3HP9 A;  1LCK A;  3OA6 A;  2RO0 A;  4O6J A;  1VQL T;  3S3M A;  1G3Y A;  2DL4 A;  2L3S A;  3LW5 E;  3OMG A;  4GLM A;  3SD4 A;  3CXC P;  2CUB A;  5FU6 B;  3S3O A;  3PIO A;  1V1C A;  1VQ7 T;  4FW2 A;  4KGZ B;  2YRV A;  4M75 A;  2XU8 A;  4ME7 A;  5IN1 A;  2OTJ Q;  4Z8A A;  2C0O A;  1VQ9 Q;  3I56 T;  3OYY A;  4CRI A;  1Q7Y R;  3A98 A;  1YI2 T;  2RQT A;  1KD1 C;  2COW A;  4M7D G;  1PD0 A;  1YJ9 Q;  2V1R A;  2RB6 A;  3VRZ A;  2OTL Q;  2DPP B;  4XTX A;  5IAY A;  2PU9 B;  2LZ6 B;  1OZ2 A;  2DRK A;  2HBW A;  5L8R E;  5DLQ E;  2HNI A;  2HQE A;  1M4Z A;  3OYF A;  1KQS P;  4A4K A;  3CC2 T;  1WZO A;  1UJ0 A;  4F7U A;  1M1K C;  1ZBJ A;  4BUG A;  5CQY A;  3LYI A;  1KG1 A;  1EX4 A;  2COY A;  1KQ2 A;  4ELZ C;  2EAY A;  3PT9 A;  1VQP T;  3EG9 B;  3I55 A;  3OYB A;  4OMO A;  4BDZ A;  2EIF A;  2VGN A;  2O9V A;  2V26 A;  2BE9 B;  5CKE A;  3G4S Q;  3QJY A;  2AIR B;  2Z0W A;  2QQA A;  3OW2 P;  3H9N A;  2F2X A;  3PMI A;  3H0F A;  2AZV A;  2DZ9 A;  3KFV A;  5LJ3 h;  2PZ1 A;  2EQM A;  4C5H A;  1UUE A;  3CCV Q;  4D8D A;  5GAN 6;  3DKM A;  5CR2 A;  4C0Z A;  1JRI A;  4R0K A;  1QCN A;  1CSK A;  2JJ9 A;  3QXE B;  3V8L A;  2E6Z A;  5IHK A;  2SEM A;  2HL3 A;  2PUO B;  5HKC A;  5KCH A;  4JZ4 A;  2D9T A;  2JVV A;  2YRC A;  4HVW A;  2QXF A;  1YHQ A;  2J6O A;  2M0O A;  1MGQ A;  4PJO F;  1JO8 A;  4M77 D;  1HXD A;  1OU8 A;  2MI6 A;  2GFU A;  3EG3 A;  4XTY A;  3G71 Q;  1VQN Q;  2GTO A;  5FW9 A;  3EGX A;  3TCJ A;  2FPF A;  3HRU A;  2QA4 Q;  1R8O B;  2CYZ B;  3M0U A;  1M2O A;  2DE0 X;  3EGD A;  2LT4 A;  3AT1 B;  3CQT A;  1OI1 A;  5CQX A;  3OYM A;  1OX9 A;  3SHW A;  2DBK A;  2XI9 A;  5LL6 S;  1IRX A;  1D0Y A;  3FLG A;  2CZ1 B;  3JB9 G;  1WHK A;  1WHJ A;  4C92 A;  2KYB A;  4HCK A;  2LCC A;  1QMC A;  2A28 A;  1RAG B;  2ROL A;  3GP8 A;  1ZSZ C;  4TVR A;  9ATC B;  2CP3 A;  3PGG A;  2VVK A;  1QLY A;  3QZ5 B;  4KGX B;  4BY6 B;  4OB3 B;  2EJG A;  4PJL A;  4CC3 A;  2KXC A;  2FG0 A;  1QCO A;  1R77 A;  1VQM T;  4ELY C;  4DEX A;  3GF5 A;  1UGS B;  1Q7Y U;  2LC4 A;  5CO7 A;  2O2O A;  2YRD A;  3JCM W;  3CCQ A;  3OSS C;  3EG0 A;  1E6H A;  2LMJ A;  5GAN e;  3M58 A;  4EMK C;  4ZN3 A;  4M7D A;  4D6W A;  1VYT A;  3DB3 A;  2MIO A;  3QBY A;  2OTJ T;  4XTZ A;  2LCS A;  3REB B;  1X2Q A;  3VYH B;  1VQ9 T;  2D6F A;  3H0I A;  3KBG A;  4A4E A;  2P0P A;  4J7F A;  4AFQ C;  1YJ9 T;  2OTL T;  2FB7 A;  1M2V B;  3X26 B;  3CPW S;  2YWW A;  1WJR A;  5GAN 7;  4BE1 A;  2LJ0 A;  2CP7 A;  3FRN A;  5KYX B;  3V8K A;  3RNJ A;  2KY9 A;  4X9C A;  3BDL A;  2E10 A;  1NPR A;  4FW1 A;  4J8O A;  4OMP A;  3OYD A;  4Y91 A;  3QWY A;  1MV3 A;  1X27 A;  1K9M R;  1WJQ A;  1GBR A;  1D3B B;  2DIQ A;  2H3E B;  3IQL A;  3SEM A;  1M1G A;  2L2P A;  3L42 A;  3JCM V;  4PJO E;  4HCZ A;  4Z89 A;  2K7A A;  1X6B A;  1X6G A;  5DY9 A;  2F2W A;  4QVZ A;  3G4S T;  2HD0 A;  2E70 A;  4XU2 A;  3UWN A;  4FL6 A;  4L59 A;  2JZ2 A;  3P8B B;  2K3Y A;  4BI4 A;  3CCV T;  4RG8 A;  3BW1 A;  2QAZ A;  3M0P A;  2HL5 C;  2J7I A;  3E9F A;  3EAE A;  2CS7 A;  2JTE A;  4LE9 A;  3JCM c;  5GMK h;  2CH4 A;  1S72 A;  1AT1 B;  1KHC A;  2AKL A;  1IGU A;  3DB4 A;  5FU7 B;  3UPU A;  4PLI A;  2DX1 A;  2JMA A;  3VUB A;  2ED1 A;  2X51 A;  4IIM A;  5GAO l;  4JRI A;  1YIT A;  5LJ3 j;  4BI8 B;  2DEQ A;  1JXM A;  5I11 A;  1PKT A;  1IHW A;  4ZGE B;  4HCC A;  5GAM d;  2OAW A;  3OYK A;  2X4X A;  3G71 T;  2L3P A;  1VQN T;  3M9Q A;  2AKK A;  4PJO B;  1ABO A;  4X34 A;  4IUR A;  5LJ5 h;  2QA4 T;  1TU0 B;  1SHF A;  2LQN A;  1NJI R;  2KNB B;  8AT1 B;  3H8Z A;  4J83 A;  3X25 B;  3CCM A;  2KRO A;  1G8X A;  1GCQ A;  4AG2 C;  1V76 A;  4F04 B;  1O9S A;  5CCA A;  3NTK A;  4ZTF A;  1KFZ A;  5L23 A;  4DBR A;  4LD9 K;  2BZ8 A;  1YJW A;  4C8Q F;  4N0A A;  5LJ5 d;  1U8R A;  4RTZ A;  5J39 A;  2KGT A;  3OBY A;  2LCL A;  3C94 A;  3JCM X;  1NEB A;  1FWZ A;  2JTM A;  2ZGW A;  1YJN Q;  2EYQ A;  4Y28 E;  3GNG A;  1U1T A;  4JRQ A;  4XTV A;  2A08 A;  4EMH A;  3X28 B;  4JLI A;  1SG5 A;  2LQK A;  4WCI A;  1UHC A;  2Y4X A;  3GLX A;  1VQ7 A;  1RAA B;  2J6K A;  5J26 A;  3EG9 A;  2LX7 A;  2XID A;  1Z9Z A;  2LX9 A;  2PNI A;  3I56 A;  1RI0 A;  2VV5 A;  1TUC A;  1P92 A;  1YI2 A;  3E1S A;  2FZC B;  4M77 B;  2HQX A;  4DQ2 A;  2NUP B;  2PQW A;  1K4U S;  3A8H B;  3JCM J;  5A0D A;  2JMC A;  4NOY A;  3WXM B;  2RMO A;  1FYN A;  3CCE Q;  4HVV A;  2RHY A;  1PWT A;  1TSF A;  4XTU A;  2M02 A;  3S3N A;  4EMG A;  4QW2 A;  3MEW A;  1WI7 A;  4M7A F;  3OSV A;  1K9M U;  1XQH A;  3JAM E;  3G6E A;  1QVF A;  3EG2 A;  1KJW A;  1LVK A;  3G1J A;  4F16 A;  3ZL7 C;  3CC2 A;  2K5I A;  1X6O A;  3QYG B;  4IUV A;  2K3X A;  2VB6 A;  4XAX B;  3VS6 A;  1QVG A;  3FJ5 A;  4BB7 A;  2H8H A;  1M3C A;  3UF4 A;  4PNO A;  3RKW A;  2DK3 A;  2QYZ A;  3CBP A;  3LH0 A;  2HCK A;  2RQU A;  1D1A A;  1VQ5 Q;  1UB4 A;  1BCM A;  2A3L A;  3VS4 A;  2QGF B;  1K1Z A;  2DXU A;  3H0H A;  3MEV A;  2EKO A;  4KUD K;  2WSE E;  1VQO A;  1CKB A;  2KDS A;  1JU5 C;  1JB0 E;  4OMF B;  3NGP A;  1AWO A;  2L3Q A;  2EQJ A;  3A8O B;  1MMN A;  1UG1 A;  3FB9 A;  4GBQ A;  1KC8 R;  2R57 A;  4OB2 B;  1D0Z A;  1AZG B;  1PC0 A;  1ZHI A;  2RQW A;  4RCB A;  1E6G A;  3HRT A;  1QVP A;  2RHX A;  2DJZ A;  1AVZ C;  3OYH A;  2JOY A;  1PM3 A;  3L2Z A;  3VS1 A;  2DL5 A;  1YP5 A;  2NUT B;  3MJX A;  2MCN A;  3BY7 A;  1PNJ A;  5KYN A;  2W0Z A;  1ZQ1 A;  2CKK A;  3MKD A;  4OMN A;  4PK4 A;  4JLG A;  2XG8 D;  2RK1 A;  1NJI U;  1ZUK A;  1MMG A;  2YLC A;  2ZPF B;  3NMZ C;  1PHT A;  1BU1 A;  2QI2 A;  4J9C A;  5KYW B;  1UGQ B;  1FMK A;  4AFU C;  2M0Y A;  1YCY A;  5CKH A;  2YT6 A;  1WIE A;  2CSI A;  2VGM A;  2DA9 A;  1XOV A;  1WJS A;  3ZBD A;  1TH7 A;  3MEA A;  4AG1 C;  3CCL Q;  2X35 A;  2CP6 A;  3L2R A;  4JRP A;  1A0N B;  2PTK A;  5GMK j;  3PNW C;  3FIF A;  4JJD A;  3FEO A;  4FYW B;  4HA8 A;  2KSS A;  3VU3 C;  3JCM Q;  1QVG S;  5GAN 2;  5IT9 E;  1NZ9 A;  2ENM A;  4RTY A;  5A0L A;  1NYF A;  1W4S A;  3FDR A;  4M77 G;  2HKN A;  3O8V A;  3TVT A;  4JJN K;  3PE0 A;  1OEB A;  5GAM f;  4Q5W A;  1RAF B;  1W1F A;  4RTV A;  3LWI A;  1VQM A;  2FL7 A;  2X9H A;  4C92 C;  1AEY A;  2EYZ A;  4LD6 A;  4E7J A;  4M7A E;  3PFS A;  4KBM B;  2QAS A;  4FYY B;  5FLX E;  1YJN T;  2PVD B;  1X43 A;  3QWX X;  3UAT A;  1XNI A;  2M51 A;  5KE2 A;  2RPN A;  3EFS A;  1D3B A;  3FJP A;  1RAH B;  4GY5 A;  3O5Z A;  3LWH A;  4C0D B;  4RTW A;  5LJ5 f;  2LTO A;  1OX8 A;  1PD1 A;  2OTJ A;  2BZX A;  1VQ9 A;  4Y92 A;  2K2V A;  3REA B;  3OYI A;  1Q81 R;  1SRM A;  1YJ9 A;  4RCC A;  1QWE A;  2OTL A;  3C0C A;  4BE2 A;  4M7D C;  1ZLM A;  2LT1 A;  3CCE T;  1QVF P;  3UA6 A;  5GAM g;  1M30 A;  3OS2 A;  1VQK Q;  1K8A R;  2VWF A;  1ZX6 A;  3CBO A;  2RA2 A;  1K9A A;  4AMC A;  5GAM e;  1M90 C;  5GAO q;  1QVG P;  2HKQ B;  4PJO D;  3BFM A;  4B6M A;  5KYY B;  1K0X A;  2QDL A;  3GIB A;  2FEI A;  4M78 F;  2Y90 A;  4ZTJ A;  2RI3 A;  2NUZ A;  1KC8 U;  5GAO n;  8ATC B;  1IHV A;  1UTI A;  3OYN A;  5FRN A;  1N8R R;  4EMK B;  5LJ5 g;  3OB9 A;  2HBP A;  3A1P A;  3G7Z A;  5GAN 4;  3QDR B;  5C0M A;  3G4S A;  1VQ5 T;  4M75 F;  1T0J A;  1WYX A;  2EYW A;  1B07 A;  1I8F A;  3BE3 A;  2KR3 A;  4QQ6 A;  2XIC A;  4RMO A;  2DVE A;  4ESR A;  3CCV A;  1WX6 A;  2DYB A;  3I55 Q;  1WHL A;  2EJ9 A;  4IUU A;  1OQK A;  2XD0 A;  3OYG A;  4JZ3 A;  3VS7 A;  1C1A A;  4XQ3 A;  3UT1 A;  2L0A A;  4HXJ A;  1UGP B;  2E65 A;  3ZFJ A;  3VS3 A;  2XDP A;  3JCM h;  2R58 A;  3OMC A;  5LJ3 d;  3RR6 A;  3M55 A;  3UA7 A;  1GBQ A;  1NE8 A;  4BE0 A;  4F7U F;  1UGV A;  4C8Q C;  3MP8 A;  2O31 A;  5GAN j;  1HYO A;  1SHG A;  2G3R A;  3R6O A;  1BIB A;  3G71 A;  1VQN A;  1W2B A;  5GAO m;  2DM1 A;  3CPW A;  1KIK A;  2CZ7 B;  3A8M B;  2QA4 A;  4IIO A;  2R5A A;  2RM4 A;  3JCM d;  3HPW A;  2IVW A;  1FX7 A;  1ZBX A;  4RTU A;  1TOV A;  3CMA Q;  3HFN A;  2DXC A;  1Y71 A;  1S1N A;  4IUT A;  4M77 A;  5KCO A;  2VKN A;  3SWN A;  3CCL T;  2NUP A;  3PIP A;  1LJO A;  2KRM A;  3VS2 A;  1M3A A;  4OMQ A;  2F5K A;  1O75 A;  4FT4 A;  5FRO A;  2VYT A;  2RN8 A;  2DBM A;  2MOX A;  3SFM A;  1Q86 C;  3NHN A;  1JQQ A;  3M54 A;  1BI0 A;  1HK9 A;  3QSU A;  3ULR B;  2QEX Q;  5D6Y A;  3NPF A;  4M7A C;  1KD1 R;  2FYK A;  2K3B A;  1ZSG A;  1M5Q 1;  1F1B B;  5GAO p;  3CCS T;  3OS0 A;  2I0N A;  3TSW A;  1Q81 U;  2V1Q A;  2JS2 A;  4C5G A;  3ASK A;  2O4X B;  4M78 E;  1I81 A;  4PJM A;  5CVI A;  3R6N A;  3OS5 A;  2ZPE B;  3VV0 A;  1T0H A;  1NJI C;  2JN0 A;  2K5F A;  4QKU A;  1K8A U;  1K73 R;  2P4T A;  3CBM A;  1V29 B;  2KI7 A;  1G83 A;  3GNF B;  4ZGJ B;  4RTX A;  3ME9 A;  1VYV A;  4O5V A;  4C92 F;  1QCF A;  2RQR A;  3VUZ A;  4EDU A;  1SPK A;  4CC7 A;  3VYG A;  4QT7 A;  3M53 A;  1W2B S;  1YCS B;  2O9S A;  1N8R U;  2NUT A;  1SEM A;  3RKY A;  1VQK T;  2EGE A;  2RI2 A;  3LX7 A;  4PFZ A;  2KE9 A;  3EH2 A;  4LDY A;  4MDW A;  1X75 C;  3RKX A;  2V8K A;  4ZN1 A;  4MMK A;  5KYW A;  2E41 A;  4KH0 B;  1SKU B;  4OB1 B;  4N4I A;  2DL7 A;  2BIV A;  3JCM b;  4F7U E;  2RK2 A;  2E5K A;  1NYG A;  3C95 A;  4M7D F;  1UGR B;  1BB9 A;  1G5V A;  1YIJ Q;  2KK4 A;  1MND A;  4OB0 B;  5GMK l;  1WFW A;  2CP2 A;  1OPK A;  1N9R A;  2DL3 A;  3NTI A;  1GFD A;  1VQ4 Q;  2MF2 A;  3JB9 H;  3M56 A;  1G2B A;  4J6W A;  1M8M A;  2H3J A;  4NL3 A;  2CP5 A;  3VJP A;  1VQ8 Q;  3I55 T;  2V8J A;  4PJJ A;  4DA4 A;  2FZG B;  2CZ0 B;  2CDT A;  2AK5 A;  2KEA A;  3OYA A;  4JS4 A;  3QPH A;  3P8D A;  4E7S A;  2MMP A;  4CI0 C;  1MUZ A;  4MDX A;  1X69 A;  2E64 A;  4R55 A;  4QQD A;  1I07 A;  3JV3 A;  1YWO A;  1IB8 A;  1VYU A;  2YUP A;  2ZCF B;  2E12 A;  2G6F X;  5KYU A;  3GPL A;  1EFN A;  3CC4 Q;  1W2B P;  3CPW P;  3C4S A;  2AZS A;  1Z9Q A;  3N5B B;  3H6Z A;  3V7S A;  4AFS C;  1R0C B;  2P0Q A;  1WLP B;  5LJ3 f;  4MML A;  1JJ2 A;  3J7A F;  1KC8 C;  3CMA T;  4A4H A;  5HK0 A;  4NL2 A;  3HHT B;  1KD1 U;  2C0T A;  4HT9 A;  4M7A D;  2EVR A;  2KT8 A;  3QII A;  2K57 A;  1PRL C;  2HAX A;  2D0N A;  2GGR A;  2DAQ A;  2P84 A;  4JS5 A;  2JT4 A;  1RLP C;  4PFO A;  4L5G A;  4C92 E;  1YJN A;  1BI3 A;  5KYY A;  2VUB A;  4II1 A;  1K73 U;  1VQL A;  2QEX T;  3A8L B;  4PKC C;  1AWX A;  2C0I A;  1FMV A;  4OF1 A;  5I22 A;  1JXO A;  1BBZ A;  4M78 C;  2ATC B;  1WXB A;  1N9S A;  4EMK A;  2PVO B;  2O01 E;  3JB9 F;  1SRL A;  2AHJ B;  2ROT A;  4IKF A;  2OX7 A;  5AYF A;  5LJ3 g;  1RL2 A;  3CCJ Q;  3MO8 A;  1H92 A;  4KGV B;  2J6F A;  3RIR A;  3CCU Q;  5I2S A;  1TUD A;  3OY9 A;  4JUV A;  3CCE A;  1G3W A;  3E2U A;  2OAU A;  5LJ3 e;  1UEC A;  4CC4 B;  1UE9 A;  3CME Q;  4M75 C;  4M7D E;  1WDX A;  2COZ A;  3E9G A;  1Q82 R;  2IPO B;  2M16 A;  2DTI A;  2GF7 A;  2VC8 A;  2KVQ G;  3JCM g;  2GBQ A;  3QDF A;  2MWP A;  3TEE A;  1BIA A;  2RJD A;  1K0S A;  2IIM A;  6AT1 B;  4C92 B;  2YUQ A;  3NFC A;  1N5Z A;  3QO3 A;  4V2S A;  4PLL A;  1X01 A;  1GFC A;  1JJ2 S;  3OS1 A;  1HJD A;  3CC7 Q;  2KMT A;  2E6N A;  1VQP A;  1U5S A;  4LDV A;  3CD6 Q;  1WNL A;  2HDA A;  2DFU A;  3VS5 A;  4N4H A;  1U06 A;  1LOJ A;  3INZ A;  4X1V A;  3EFO B;  4R56 A;  2DZC A;  1VQ5 A;  3E19 A;  3URG A;  2FHD A;  2QQ9 A;  1OU9 A;  3M0Q A;  3VS0 A;  3LLR A;  3PVL A;  2X4Y A;  5GMK i;  1Q7Y C;  3L2W A;  1VQ6 Q;  1WXT A;  1Q81 C;  5GAN h;  1M3B A;  1LPL A;  1QP3 A;  2NWM A;  1YIJ T;  1UFF A;  3M4Y A;  4D8K A;  3DLM A;  3SDZ A;  2DNU A;  2WSF E;  4PJO G;  4FSS A;  5HCK A;  2W10 A;  2K79 A;  2QQS A;  4M7D B;  1BK2 A;  4E7Z A;  2XK0 A;  3M0R A;  1TUG B;  1VQ4 T;  1VQO Q;  1PSF A;  1VQ8 T;  1SSF A;  2GNC A;  1VIE A;  5A2Q E;  4J7I A;  1I5O B;  4LDW A;  2HSP A;  3CCR Q;  1KSW A;  1D0X A;  4AT1 B;  4FIB A;  1UDL A;  5GAN d;  2DER A;  3QYH B;  1D1C A;  4ATO A;  4PFP A;  3M0T A;  2E5Q A;  4ZNX A;  4NS5 A;  4E47 A;  1ZUY A;  3M57 A;  4C8Q E;  2E1H A;  1GXI E;  1PRM C;  2RI5 A;  2XDB A;  2X4W A;  2DF6 A;  3QG1 A;  4XU0 A;  2L8D A;  3OQ5 A;  4FYX B;  2QQB A;  3CC4 T;  2D1X A;  2HEQ A;  3WVD B;  5GAN 8;  1IO6 A;  4M4Z A;  2RJF A;  2O4X A;  3CCL A;  4A63 B;  1JJ2 P;  5IXF A;  5IXB A;  3L2U A;  3S6W A;  4DOV A;  2VXE A;  2XDD A;  2KRN A;  1GRI A;  3NTH A;  1NM7 A;  1B3Q A;  4FCY A;  1RAI B;  2HZY A;  2DTH A;  3BDU A;  1I5L A;  4JRK A;  2QQR A;  4X9D A;  1TXQ A;  5CKF A;  3SWN C;  1G3T A;  1AZE A;  2CH4 W;  2QGG A;  1M2V A;  5CKD A;  2CP0 A;  1R0B G;  2MK5 A;  1MMD A;  1NG2 A;  4M78 D;  1RLQ C;  4JJC A;  2BKD N;  4PJN A;  2A37 A;  3QHS A;  1PG5 B;  5KYX A;  1W70 A;  2BZY A;  3CCS Q;  1H64 1;  1NBE B;  1E7O A;  4MZM A;  1H3Z A;  4C8Q B;  1Y0M A;  2J05 A;  4KH1 B;  3M59 A;  2IG0 A;  3M5A A;  2DRM A;  3L2Q A;  5CK9 A;  1WA7 A;  4M75 D;  4J5Y A;  4WTO B;  4QVD A;  4KRT A;  5IHI A;  1Q82 U;  3MHX A;  2ED0 A;  1WHG A;  3X24 B;  1TG0 A;  4E6R A;  2QG9 B;  1SSH A;  3CPF A;  3OW2 S;  3OYJ A;  2EGC A;  1FMW A;  1I1J A;  4J9F A;  2EPD A;  3CCJ T;  4FM4 B;  4K11 A;  3CCU T;  2M1H A;  1IGQ A;  5GAN 5;  7AT1 B;  2NLU A;  3RMQ A;  4MZP A;  4EPC A;  1D09 B;  1ZSZ B;  4Z88 A;  3CME T;  1Y96 B;  2ZPB B;  2EQK A;  1VQK A;  2FO0 A;  2XHC A;  3MP6 A;  2RQV A;  2FPD A;  2GQV A;  2LNV A;  4QQG A;  2DTO A;  3H41 A;  5GMK e;  3JRZ A;  3EHQ A;  4M7A B;  3OBW A;  2F69 A;  4DEY A;  3SB2 A;  3CC7 T;  3G6E T;  3T9N A;  2M9U A;  3CD6 T;  2F2V A;  2ECZ A;  1K73 C;  4PJO A;  1OYX A;  3EH1 A;  2A7Y A;  2MWO A;  3A5Z B;  5LJ5 e;  1AWJ A;  1VQ6 T;  4HKE A;  2JUF A;  5GJW B;  3QZ9 B;  5GMK m;  4BDY A;  1T3L A;  3L2V A;  4OP0 A;  2ZPH B;  4J6X A;  1MV0 B;  1YFN A;  4RTT A;  4PL6 A;  1VIF A;  2FZK B;  3KXT A;  1VQO T;  2JXB A;  1AWW A;  3MCA B;  2LQ8 A;  1VA7 A;  2ZPI B;  1AOJ A;  3MP1 A;  4LUE A;  1D1B A;  3CCR T;  1K9M C;  2OJ2 A;  2WSC E;  2DKG A;  3OYC A;  1J3T A;  4BAC A;  2RH2 A;  2FRY A;  1M27 C;  2CGH A;  4C0G A;  1N6A A;  1YN8 A;  1KQ1 A;  2HQH A;  3HKS A;  5IHN A;  3V7R A;  5FWC A;  1YHQ Q;  4A4F A;  5HY6 A;  2QTX A;  3MPU B;  1K76 A;  4C8Q G;  2LQW A;  1U1S A;  3CMA A;  4OGC A;  5GAN f;  5DLO A;  4LUD A;  2EWN A;  4P5N A;  3JCM P;  3HL8 A;  4C92 D;  5FU6 C;  2RNA A;  4C0D C;  2EYY A;  3FC3 A;  2GCX A;  4VUB A;  1B34 B;  3P8H A;  2YDL A;  1M8V A;  3VKI A;  1C0M A;  2CT4 A;  1AD5 A;  3M4G A;  4RKU E;  2RJE A;  2GFA A;  1GCQ C;  4MZT A;  3QUI A;  2RHZ A;  1QP2 A;  2QEX A;  2L5Q A;  3EHR A;  2LVM A;  2KAF A;  3RUX A;  1WQ7 A;  1WHH A;  4N0A C;  3KUF A;  1RAC B;  3GBQ A;  5CKB A;  2QTV A;  4IUQ A;  2AT1 B;  5I21 A;  1NLP C;  4DBQ A;  4M7A G;  4J6Y A;  3EFO A;  1N27 A;  4M7D D;  4QVC A;  1YBY A;  2E3H A;  1M90 R;  2LDM A;  5GAN g;  2A36 A;  2VXF A;  2X4J A;  2DET A;  1NLO C;  2DEU A;  1M1K R;  2DO3 A;  4M77 F;  2K5L A;  3CCQ Q;  2X3W D;  4XU1 A;  1UEB A;  2ZAE A;  4CC2 A;  1GL5 A;  2BE7 D;  3JB9 J;  2RHI A;  1MMA A;  1VOM A;  1SF9 A;  4M75 E;  1TTH B;  1Y7X A;  2JM9 A;  2EYX A;  2BUD A;  3RMS A;  4HCB A;  4KUI A;  1HSQ A;  2JNG A;  2DXB A;  4C5E A;  1G3S A;  5KE3 A;  2X3X D;  1JBM A;  2P0K A;  2YXY A;  4BI3 A;  1OZ3 A;  1MHN A;  2D8H A;  3TRE A;  3X20 B;  5D7U A;  2JTF A;  4E2F B;  1PKS A;  2ZZD A;  4M78 B;  1KHI A;  4L6V 5;  1OUL A;  5HK3 A;  1UHF A;  3D7S B;  2DVJ A;  2RHU A;  2DL8 A;  1T3S A;  3RER A;  2J06 A;  1YIJ A;  2LJ3 A;  4OGE A;  3ER0 A;  3EFR A;  4KUL A;  1QWF A;  2DD5 A;  3C12 A;  5I2M A;  2K2M A;  2YLB A;  1PCX A;  2ZPG B;  2D8J A;  4A53 A;  1VQ4 A;  4E7I A;  2QK0 A;  4M75 B;  1Q82 C;  4GLK A;  1FXX A;  1VQ8 A;  2EQU A;  4C8Q D;  4J9B A;  4N4G A;  1PSE A;  1IXD A;  1C6V X;  5EC7 A;  2CUD A;  3EG1 A;  3HTR A;  4FT2 A;  2CRE A;  2O88 A;  3HSB A;  2PVG B;  1NEG A;  2CSQ A;  4J9D A;  4J9E A;  5GAO r;  2YUO A;  3CC4 A;  4C8Q A;  2SRC A;  4E7L A;  4BY6 C;  5GAM h;  1EZZ B;  2F1L A;  1Q86 R;  2YUN A;  1MNE A;  3PMT A;  1S72 Q;  4KT0 E;  3JB9 D;  3VRY A;  4Z02 A;  1QQJ A;  2VAS A;  4F7U B;  2EKH A;  4LNP A;  1I4K 1;  2Y4Y A;  4XTW A;  1ACM B;  4FU6 A;  1YHQ T;  1RI9 A;  3F70 A;  2CT3 A;  1YIT Q;  1BI2 A;  4XU3 A;  1AHJ B;  2V8I A;  2XMF A;  2XKO C;  4J9I A;  4RUG A;  4ORZ A;  5M9O A;  3V8J A;  1ABQ A;  3LGF A;  3TU4 K;  4EIK A;  2MYS A;  2RF0 A;  4ZGD B;  3I5R A;  3PVQ A;  2ESW A;  1RAE B;  4M77 E;  1ZSZ A;  1Y96 A;  3QJ6 A;  1XJW B;  3JCM f;  3CCM Q;  2YHT A;  2GTJ A;  2A0F B;  3ZEH A;  1BCO A;  1M90 U;  1TWB A;  1M9S A;  1OPL A;  1H8K A;  1QKX A;  1ZA2 B;  3UDC A;  4F14 A;  2EJF A;  4M7A A;  1M1K U;  1XTD A;  5DM7 R;  1YJW Q;  1I0C A;  4F17 A;  5GJV B;  4AFZ C;  5D6W A;  4XK8 E;  2FRW A;  2P4R A;  1QKW A;  1DJ7 B;  4E7K A;  1QW1 A;  1UJY A;  1VQL Q;  3A8G B;  4A4G A;  3CCJ A;  2EQI A;  1VUB A;  4JPB W;  3CCU A;  1BI1 A;  1IRE B;  3EGX B;  2DD4 A;  1VQ7 Q;  3OYL A;  4YTL A;  2JW4 A;  4M78 G;  1B7T A;  4DBH A;  2FPE A;  2JM8 A;  4DBF A;  4C0F A;  1Q95 G;  3CCQ T;  3CME A;  3EGD B;  2K6D A;  3CXC A;  2L89 A;  3I56 Q;  2D0Q B;  3EGU A;  5J3B A;  1OV3 A;  1YI2 Q;  2WAC A;  3LGL A;  3SWN B;  4LXC A;  3THK A;  4JDS A;  2GQI A;  2C06 A;  1TS9 A;  2KXD A;  4M75 G;  5D6X A;  4E7H A;  3JCM e;  5FRM A;  2E4H A;  3DLL A;  1ARK A;  5EG2 A;  3CC7 A;  2DMO A;  3G6E Q;  2KT1 A;  3TSZ A;  2DIL A;  2I2L A;  4LDX A;  2YSQ A;  3CD6 A;  3I9Q A;  3GOX A;  3Q1J A;  3CC2 Q;  1Y57 A;  4LDU A;  5FU7 C;  1YNZ A;  3OYE A;  3RDV A;  1KQS A;  1WPY A;  4UC4 A;  3J81 E;  2BTT A;  1VQP Q;  1VQ6 A;  2LP5 A;  4IUP A;  3TQ7 P;  2NYS A;  1BKB A;  3MEU A;  1LNX A;  1GCP A;  4F7U G;  4B9X A;  4HT8 A;  1ZA1 B;  4PJO C;  3MET A;  5C6S A;  4J9H A;  3U23 A;  2HSE B;  4OVA A;  1H3H A;  2EFI A;  2K9G A;  1K8A C;  1NPP A;  2R5M A;  1B34 A;  1Q86 U;  2FVU A;  3JB9 I;  4JJB A;  2DYI A;  3OW2 A;  1IZ6 A;  4C5I A;  5AT1 B;  1WXU A;  2KRS A;  4J9G A;  3CCR A;  4WF2 A;  2KQW A;  5FWB A;  3J80 E;  1WHM A;  3LH5 A;  4OMM A;  4RG2 A;  4B9W A;  1CKA A;  3PTA A; 
#chains in the Genus database with same CATH homology
 1O9S A;  1WQW A;  5CCA A;  2P4T A;  3CBM A;  3NTK A;  4ZTF A;  1N8R C;  3HFO A;  1V29 B;  1Y07 A;  3V7C A;  3GNF B;  1M1F A;  1K73 C;  4PJO A;  1OYX A;  3CXC S;  4LD9 K;  2A7Y A;  4ZGJ B;  2MWO A;  3A5Z B;  2K4Y A;  1YJW A;  3ME9 A;  2LRQ A;  5LJ5 e;  4O5V A;  4C92 F;  2RJC A;  4N0A A;  4C8Q F;  5LJ5 d;  4A54 A;  5GAN 3;  3VUZ A;  4EDU A;  1U8R A;  5J39 A;  1S72 T;  3VYG A;  1VQ6 T;  3OBY A;  2LCL A;  3C94 A;  4HKE A;  3JCM X;  1FWZ A;  2JTM A;  3JSC A;  3M53 A;  2DXT A;  2JUF A;  3QKJ A;  1W2B S;  2ZGW A;  3QZ9 B;  5GMK m;  4BDY A;  2EYQ A;  3RES A;  3L2V A;  1N8R U;  4Y28 E;  3GNG A;  1U1T A;  4JRQ A;  1WGS A;  2ZPH B;  4OP0 A;  4XTV A;  2QDY B;  4J6X A;  3RKY A;  1VQK T;  1YIT T;  2RI2 A;  3LX7 A;  4EMH A;  3X28 B;  4JLI A;  2LQK A;  5A0G A;  3WVE B;  4PL6 A;  2Y4X A;  1VIF A;  3GLX A;  4DOW A;  3KXT A;  1VQO T;  1VQ7 A;  2F5T X;  2MAM A;  1QVF S;  4LDY A;  4MDW A;  1EIF A;  1X75 C;  4M77 C;  5J26 A;  3RKX A;  3CMA T;  5CIU A;  3MCA B;  5GAM j;  2XID A;  2LQ8 A;  3L1A A;  2LX9 A;  2DIG A;  3I56 A;  2ZPI B;  2B8A A;  3MP1 A;  1RI0 A;  2V8K A;  4ZN1 A;  2VV5 A;  4MMK A;  3CCR T;  1K9M C;  2E41 A;  1P92 A;  2WSC E;  4OB1 B;  2RD1 A;  1YI2 A;  2DKG A;  3E1S A;  4N4I A;  3OYC A;  4M77 B;  2HQX A;  1KQS S;  4DQ2 A;  4FSX A;  4BAC A;  3AHU A;  2RH2 A;  3CCM T;  2PQW A;  3CCS A;  2BIV A;  3A8H B;  3JCM J;  5A0D A;  3JCM b;  2PUK B;  4F7U E;  2RK2 A;  2CGH A;  4C0G A;  3WXM B;  4NOY A;  4M7D F;  1N6A A;  3C95 A;  1KQ1 A;  1UGR B;  1G5V A;  2KK4 A;  3HKS A;  2RHY A;  5GAN 4;  3V7R A;  4OB0 B;  2CZ6 B;  3HRS A;  4A4F A;  5HY6 A;  4XTU A;  5GMK l;  3S3N A;  1N9R A;  3NTI A;  4QW2 A;  2QTX A;  4C92 G;  4EMG A;  4C8Q G;  3MEW A;  1U1S A;  4M7A F;  3OSV A;  1YJW T;  1K9M U;  1BYM A;  3CMA A;  1XQH A;  4OGC A;  3JAM E;  3G6E A;  5GAN f;  2MF2 A;  4BD3 A;  1QVF A;  3JB9 H;  3M56 A;  5DLO A;  2EWN A;  4J6W A;  4P5N A;  4M78 A;  5CAI A;  2H3J A;  4NL3 A;  3VJP A;  5LJ5 j;  3JCM P;  3I55 T;  2V8J A;  3CEY A;  3HL8 A;  4C92 D;  2L3R A;  5KH6 A;  4DA4 A;  3HP9 A;  3CC2 A;  2K5I A;  1X6O A;  3QYG B;  2CZ0 B;  4IUV A;  5FU6 C;  3OA6 A;  2K3X A;  2RO0 A;  4C0D C;  4O6J A;  4XAX B;  3FC3 A;  2GCX A;  4BB7 A;  4VUB A;  3OYA A;  1QVG A;  1VQL T;  4JS4 A;  1G3Y A;  3S3M A;  3QPH A;  3LW5 E;  3P8D A;  1B34 B;  3P8H A;  3OMG A;  2MMP A;  3SD4 A;  4PNO A;  3RKW A;  5FU6 B;  2DK3 A;  4CI0 C;  3S3O A;  1M8V A;  3VKI A;  3PIO A;  1VQ7 T;  4MDX A;  3CBP A;  3LH0 A;  3M4G A;  2E64 A;  2YRV A;  4R55 A;  4RKU E;  4M75 A;  4QQD A;  2RJE A;  2GFA A;  4MZT A;  2ZCF B;  2XU8 A;  2E12 A;  2RHZ A;  3QUI A;  1QP2 A;  4ME7 A;  5IN1 A;  3GPL A;  1UB4 A;  2QEX A;  2A3L A;  2L5Q A;  3I56 T;  3OYY A;  4CRI A;  2DXU A;  2LVM A;  3MEV A;  1YI2 T;  3C4S A;  2EKO A;  2KAF A;  2WSE E;  4KUD K;  3RUX A;  1WQ7 A;  1VQO A;  1KD1 C;  3N5B B;  4N0A C;  4M7D G;  3H6Z A;  2KDS A;  3KUF A;  2RB6 A;  5CKB A;  1JB0 E;  4OMF B;  3V7S A;  2EQJ A;  4IUQ A;  3A8O B;  2DPP B;  5I21 A;  4XTX A;  3FB9 A;  2PU9 B;  5IAY A;  2R57 A;  2P0Q A;  4OB2 B;  4M7A G;  4J6Y A;  1OZ2 A;  4M7D D;  1N27 A;  5LJ3 f;  4MML A;  1JJ2 A;  3J7A F;  4QVC A;  1KC8 C;  1YBY A;  1ZHI A;  4RCB A;  5L8R E;  5DLQ E;  2HNI A;  3HRT A;  1QVP A;  2HQE A;  1M4Z A;  2LDM A;  2RHX A;  2DJZ A;  2VXF A;  3HHT B;  4NL2 A;  5HK0 A;  5GAN g;  2X4J A;  3OYF A;  3OYH A;  1KD1 U;  2JOY A;  4HT9 A;  3L2Z A;  4M7A D;  3QII A;  2K57 A;  2DO3 A;  4M77 F;  2K5L A;  4A4K A;  3CC2 T;  4XU1 A;  3BY7 A;  1UEB A;  2HAX A;  4F7U A;  1M1K C;  1ZQ1 A;  3JB9 J;  2RHI A;  4BUG A;  2CKK A;  2DAQ A;  4JS5 A;  5CQY A;  3LYI A;  4JLG A;  4M75 E;  1KG1 A;  1Y7X A;  2XG8 D;  1KQ2 A;  4ELZ C;  2BUD A;  2EAY A;  2RK1 A;  3PT9 A;  1VQP T;  3RMS A;  1NJI U;  3I55 A;  2YLC A;  3OYB A;  4HCB A;  2ZPF B;  4L5G A;  4C92 E;  4BDZ A;  4KUI A;  2EIF A;  2QI2 A;  2VGN A;  1YJN A;  2JNG A;  1BI3 A;  5CKE A;  1UGQ B;  2DXB A;  2VUB A;  4II1 A;  1K73 U;  1VQL A;  2QEX T;  4C5E A;  3QJY A;  3A8L B;  1G3S A;  5KE3 A;  1YCY A;  5CKH A;  2QQA A;  2VGM A;  1JBM A;  2P0K A;  1XOV A;  3PMI A;  4PKC C;  4BI3 A;  1OZ3 A;  1MHN A;  2DZ9 A;  1WJS A;  5LJ3 h;  3ZBD A;  1TH7 A;  3MEA A;  3TRE A;  4OF1 A;  2EQM A;  4C5H A;  3CD6 A;  2X35 A;  3X20 B;  5GAN 6;  3L2R A;  4M78 C;  3DKM A;  2JTF A;  5CR2 A;  4JRP A;  4C0Z A;  1N9S A;  4EMK A;  1JRI A;  2PVO B;  5GMK j;  3PNW C;  2O01 E;  3FIF A;  3JB9 F;  2AHJ B;  3QXE B;  3FEO A;  4HA8 A;  4IKF A;  5AYF A;  2KSS A;  3VU3 C;  3JCM Q;  5LJ3 g;  1QVG S;  1RL2 A;  3V8L A;  3MO8 A;  2ZZD A;  5GAN 2;  4M78 B;  5IT9 E;  1KHI A;  1NZ9 A;  2E6Z A;  5A0L A;  4L6V 5;  3RIR A;  1W4S A;  2PUO B;  5HKC A;  3FDR A;  5I2S A;  5KCH A;  5HK3 A;  2D9T A;  2JVV A;  4M77 G;  3OY9 A;  2RHU A;  4JUV A;  3O8V A;  1G3W A;  3CCE A;  4JJN K;  2OAU A;  5LJ3 e;  1YIJ A;  3RER A;  5GAM f;  4Q5W A;  4OGE A;  2QXF A;  3ER0 A;  3EFR A;  4M75 C;  3LWI A;  1YHQ A;  4M7D E;  4KUL A;  2DD5 A;  2M0O A;  3C12 A;  5I2M A;  4A4H A;  2YLB A;  2ZPG B;  1MGQ A;  4PJO F;  4M77 D;  3E9G A;  2FL7 A;  1HXD A;  1VQM A;  4A53 A;  2MI6 A;  4C92 C;  4E7I A;  1VQ4 A;  2M16 A;  2DTI A;  2GF7 A;  2VC8 A;  2GFU A;  2KVQ G;  4XTY A;  4M75 B;  4LD6 A;  3JCM g;  1Q82 C;  2OTJ T;  4E7J A;  4M7A E;  2MWP A;  4GLK A;  1FXX A;  1VQ8 A;  3TEE A;  2EQU A;  1BIA A;  2RJD A;  3PFS A;  4KBM B;  4C8Q D;  3TCJ A;  4C92 B;  3HRU A;  3NFC A;  5FLX E;  1YJN T;  4N4G A;  1PSE A;  3QO3 A;  1R8O B;  2CYZ B;  2PVD B;  4V2S A;  4PLL A;  1X01 A;  1XNI A;  2LT4 A;  4FT2 A;  1JJ2 S;  5KE2 A;  1OI1 A;  5CQX A;  3OS1 A;  3EFS A;  1D3B A;  2KMT A;  2E6N A;  3FJP A;  3OYM A;  1VQP A;  4LDV A;  4GY5 A;  2XI9 A;  3LWH A;  5LL6 S;  4C0D B;  3HSB A;  1WNL A;  5LJ5 f;  4N4H A;  2PVG B;  2LTO A;  3FLG A;  1LOJ A;  3INZ A;  2CZ1 B;  2OTJ A;  4R56 A;  3JB9 G;  2DZC A;  1VQ5 A;  3E19 A;  3URG A;  1VQ9 A;  5GAO r;  4C92 A;  3CC4 A;  4C8Q A;  2FHD A;  2LCC A;  4E7L A;  2QQ9 A;  4BY6 C;  5GAM h;  2K2V A;  3GP8 A;  3LLR A;  3OYI A;  2X4Y A;  5GMK i;  1Q7Y C;  3PMT A;  4KT0 E;  4TVR A;  3L2W A;  3JB9 D;  3PGG A;  4Z02 A;  1YJ9 A;  4RCC A;  1Q81 C;  4BE2 A;  2OTL A;  5GAN h;  3QZ5 B;  4BY6 B;  2LT1 A;  4F7U B;  4M7D C;  4OB3 B;  2EJG A;  3CCE T;  1QP3 A;  1I4K 1;  1YIJ T;  2Y4Y A;  3M4Y A;  5GAM g;  4XTW A;  3DLM A;  3SDZ A;  2WSF E;  4FU6 A;  4PJO G;  1YHQ T;  3OS2 A;  3F70 A;  1BI2 A;  4XU3 A;  1AHJ B;  2QQS A;  2V8I A;  4M7D B;  2XKO C;  1VQM T;  2XK0 A;  4ELY C;  1VQ4 T;  3GF5 A;  1UGS B;  3CBO A;  1Q7Y U;  2RA2 A;  2LC4 A;  5GAM e;  5CO7 A;  1M90 C;  5GAO q;  5M9O A;  4PJO D;  3BFM A;  1PSF A;  3V8J A;  3GIB A;  3LGF A;  1VQ8 T;  1SSF A;  3TU4 K;  3CCQ A;  3JCM W;  4M78 F;  1VIE A;  5A2Q E;  4J7I A;  3OSS C;  4LDW A;  2Y90 A;  4ZGD B;  5GAN e;  3M58 A;  5GAN d;  4FIB A;  4EMK C;  4ZTJ A;  4M77 E;  4ZN3 A;  2RI3 A;  3QYH B;  1Y96 A;  4ATO A;  1KC8 U;  5GAO n;  3QJ6 A;  3JCM f;  2YHT A;  4M7D A;  4D6W A;  3ZEH A;  2E5Q A;  4NS5 A;  3OYN A;  3DB3 A;  4E47 A;  5FRN A;  3M57 A;  4C8Q E;  1M90 U;  2E1H A;  4EMK B;  1GXI E;  5LJ5 g;  3OB9 A;  1M9S A;  2RI5 A;  2HBP A;  2XDB A;  3G7Z A;  2X4W A;  3QBY A;  3QDR B;  3QG1 A;  2L8D A;  4XU0 A;  4XTZ A;  3UDC A;  3OQ5 A;  2EJF A;  4M75 F;  5C0M A;  3G4S A;  1VQ5 T;  4M7A A;  1M1K U;  1XTD A;  5DM7 R;  3VYH B;  2QQB A;  1I8F A;  3CC4 T;  1VQ9 T;  3WVD B;  5GAN 8;  2D6F A;  4QQ6 A;  2XIC A;  2RJF A;  4RMO A;  2O4X A;  3KBG A;  5D6W A;  4A4E A;  4XK8 E;  2P0P A;  4J7F A;  2DVE A;  3CCL A;  3CCV A;  1DJ7 B;  1YJ9 T;  2EJ9 A;  2OTL T;  2FB7 A;  4IUU A;  4E7K A;  3X26 B;  1QW1 A;  3CPW S;  1WJR A;  3OYG A;  5GAN 7;  2XD0 A;  4BE1 A;  3L2U A;  3S6W A;  4DOV A;  3A8G B;  2VXE A;  4XQ3 A;  3UT1 A;  4A4G A;  3FRN A;  3NTH A;  2XDD A;  3V8K A;  3CCJ A;  1VUB A;  2KY9 A;  4X9C A;  3BDL A;  2E10 A;  1UGP B;  2E65 A;  3CCU A;  1BI1 A;  1IRE B;  2DTH A;  3BDU A;  1NPR A;  1I5L A;  2DD4 A;  4J8O A;  4JRK A;  3ZFJ A;  3OYL A;  1Q82 U;  2QQR A;  4YTL A;  3OYD A;  2XDP A;  4M78 G;  4X9D A;  4Y91 A;  3JCM h;  2R58 A;  5CKF A;  4C0F A;  3OMC A;  3SWN C;  1G3T A;  5LJ3 d;  3CME A;  3CCQ T;  3CXC A;  5CKD A;  1WJQ A;  2L89 A;  1D3B B;  2D0Q B;  3M55 A;  5J3B A;  2DIQ A;  1NE8 A;  4BE0 A;  4F7U F;  4M78 D;  2WAC A;  3LGL A;  4C8Q C;  2BKD N;  3MP8 A;  3QHS A;  3SWN B;  5GAN j;  1M1G A;  2G3R A;  3L42 A;  3R6O A;  1BIB A;  4JDS A;  3JCM V;  4PJO E;  3G71 A;  1VQN A;  1W2B A;  5GAO m;  2C06 A;  1H64 1;  4HCZ A;  3CPW A;  4MZM A;  2CZ7 B;  3A8M B;  1H3Z A;  4C8Q B;  4M75 G;  2QA4 A;  5D6X A;  3CD6 T;  5DY9 A;  3JCM e;  2R5A A;  3M59 A;  2RM4 A;  4QVZ A;  2IG0 A;  3G4S T;  4E7H A;  5FRM A;  3M5A A;  3JCM d;  3HPW A;  3DLL A;  2HD0 A;  1FX7 A;  1ZBX A;  2IVW A;  5EG2 A;  5CK9 A;  3L2Q A;  3CC7 A;  2E70 A;  3HFN A;  4XU2 A;  3UWN A;  2DXC A;  4FL6 A;  4M75 D;  2I2L A;  4LDX A;  1Y71 A;  4J5Y A;  4IUT A;  2JZ2 A;  3P8B B;  2K3Y A;  4L59 A;  4M77 A;  3SWN A;  4BI4 A;  4QVD A;  5KCO A;  3GOX A;  3MHX A;  3CCL T;  3Q1J A;  3X24 B;  3CCV T;  4RG8 A;  3BW1 A;  3PIP A;  1LJO A;  4LDU A;  2F5K A;  3CPF A;  5FU7 C;  3OYE A;  3OW2 S;  1O75 A;  3E9F A;  3OYJ A;  4FT4 A;  3EAE A;  2CS7 A;  1KQS A;  1WPY A;  5FRO A;  5GMK h;  2VYT A;  3JCM c;  3CCJ T;  4UC4 A;  3J81 E;  1S72 A;  1VQ6 A;  4FM4 B;  1KHC A;  3SFM A;  3CCU T;  1Q86 C;  3DB4 A;  5FU7 B;  2M1H A;  4IUP A;  3UPU A;  5GAN 5;  4PLI A;  3M54 A;  2NLU A;  3RMQ A;  4MZP A;  3VUB A;  1BKB A;  4EPC A;  3MEU A;  1BI0 A;  5GAO l;  1HK9 A;  3QSU A;  4JRI A;  1Y96 B;  3CME T;  2ZPB B;  2EQK A;  1LNX A;  4F7U G;  4B9X A;  1VQK A;  2XHC A;  5D6Y A;  4HT8 A;  1YIT A;  3MP6 A;  5LJ3 j;  4M7A C;  4PJO C;  4BI8 B;  3MET A;  2DEQ A;  5C6S A;  2FYK A;  2GQV A;  4OVA A;  2LNV A;  4QQG A;  2DTO A;  4ZGE B;  2EFI A;  1K8A C;  4HCC A;  1NPP A;  2R5M A;  1M5Q 1;  1B34 A;  5GAM d;  5GMK e;  3JRZ A;  5GAO p;  3OS0 A;  3CCS T;  1Q86 U;  1Q81 U;  3OYK A;  2FVU A;  2X4X A;  4M7A B;  3JB9 I;  3M9Q A;  3G71 T;  1VQN T;  4PJO B;  4X34 A;  3OW2 A;  1IZ6 A;  3OBW A;  4IUR A;  2F69 A;  5LJ5 h;  4C5I A;  2QA4 T;  3CCR A;  4WF2 A;  2KQW A;  3SB2 A;  4C5G A;  3ASK A;  3J80 E;  2O4X B;  4M78 E;  1I81 A;  3H8Z A;  5CVI A;  4J83 A;  3X25 B;  3OS5 A;  3CC7 T;  2ZPE B;  3CCM A;  3VV0 A;  1NJI C;  4RG2 A;  2JN0 A;  4B9W A;  2K5F A;  3G6E T;  3PTA A;  3T9N A;  1K8A U;  2M9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...