5HKCA

Crystal structure of m. tuberculosis mazf-mt3 t52d-f62d mutant in complex with 8-mer rna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNDALAAMPGNVDLPATTTRLPRDSVVNVTAIVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of M. tuberculosis MazF-mt3 T52D-F62D mutant in complex with 8-mer RNA
rcsb
source organism Mycobacterium tuberculosis (strain cdc 1551 / oshkosh)
molecule tags Hydrolase/rna
molecule keywords Endoribonuclease MazF6
total genus 28
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5hkcA00
4ME7A 3JSCA 5HKCA 5CK9A 5CKBA 5HK0A 5CKEA 4MZMA 2C06A 2MF2A 2KMTA 5CR2A 5CCAA 4HKEA 1VUBA 3TCJA 3VUBA 1UB4A 5DLOA 5CO7A 4MZTA 4MZPA 5HK3A 4OF1A 5CKDA 3JRZA 3HPWA 4ELZC 4VUBA 1NE8A 5CKFA 3G7ZA 5CQYA 4MDXA 5CQXA 5CKHA 3NFCA 1M1FA 2VUBA 1X75C 4ELYC
chains in the Genus database with same CATH superfamily
2LJ3A 5CIUA 1IZ6A 2K9GA 2DD4A 1M1KU 4XU3A 2PTKA 1OQKA 3LWIA 1VQPQ 4M7DA 2AIRB 2EPDA 4BY6C 4LD9K 5D6YA 4AFUC 1BU1A 3LX7A 2LQKA 4XTWA 1PD0A 3VS0A 1G83A 3OYMA 5KYNA 4JRPA 3HKSA 4J9IA 3NTHA 2QA4A 2J6KA 4AFQC 5LJ5e 4J7IA 1VQKA 5GMKl 2MCNA 4RTTA 1LPLA 1PD1A 3CEYA 4GLKA 3I56A 1N5ZA 3MP1A 4OMOA 5IT9E 2XD0A 3REBB 1VQLT 3MO8A 4UC4A 3IQLA 1ZX6A 4KH1B 3M4GA 1AHJB 2GNCA 1PG5B 2CREA 1VQ7A 1NM7A 3M54A 3HSBA 1VQNQ 3CCUQ 4C0DC 2QQAA 2QA4T 2F1LA 4BE2A 4DA4A 4FCYA 4LD6A 3CCVT 4N0AC 1KFZA 2EGCA 4M7AE 3JB9J 1VQLQ 6AT1B 3M0SA 1UTIA 1OU8A 5FRMA 2KYBA 3CC7Q 4M75C 2OTLT 4J83A 3JCMV 2X4XA 4XTUA 5CQYA 1RUWA 2VUBA 4F04B 2HQEA 1Q81R 2XDBA 3UWNA 2A37A 1M1KR 2M0YA 2F2XA 2QEXT 1R8OB 3EGDA 3WXMB 1SSHA 2D0QB 2YRDA 3J80E 2DZ9A 1UE9A 3EH1A 4HXJA 5CKDA 5GAOq 1VQ4A 1WI7A 5CKFA 2M02A 4MMLA 1B3QA 1T3SA 2DL5A 1OPLA 4BI8B 1WJRA 4R0KA 2DK3A 3CCVQ 2KR3A 5KCOA 4Y28E 2RH2A 2X4YA 2M51A 3GOXA 1NZ9A 1UGPB 3L42A 5FU6C 3RBBB 2NYSA 4M7DE 4OP0A 1QVFP 1D0YA 1YI2Q 2HKNA 2X3WD 1QMCA 2XKOC 3HFOA 3S3NA 1YI2A 2KAFA 2ROTA 1YCYA 3ZEHA 5LJ5j 3V7SA 1K9MR 1QW1A 2F5KA 2ZPEB 1GRIA 1DJ7B 5KE2A 2DRKA 3EG3A 3VS6A 1K73U 2P84A 4RUGA 2JN0A 3FEOA 3JV3A 3M0PA 3OW2S 3J7AF 2HQHA 4OMPA 2X51A 1AT1B 1VUBA 1ZUKA 2O9SA 2CT3A 2KRNA 3MCAB 2KXCA 2DAQA 2FRWA 3CBPA 3CD6A 3OY9A 2RK2A 3H6ZA 2D9TA 2C0TA 1VQPT 1QVPA 2RI2A 3G4SQ 4C8QE 3QBYA 1YJ9Q 1B34B 2QI2A 4J6XA 1MHNA 4CC2A 3CCQA 3OA6A 1OV3A 1ZSZB 2EFIA 2CZ1B 3CCSQ 5GANe 1GXIE 2XI9A 2ABLA 2QQSA 2QG9B 1VQMQ 2LMJA 2MI6A 1NLPC 1TSFA 1RLQC 1OULA 5HY6A 5J3BA 1YIJT 3RESA 1ZHIA 4M77B 4KGXB 3JCMJ 1Y0MA 2DM1A 2P4RA 3G6ET 2O4XA 2EQIA 1M5Q1 5FU6B 1VOMA 2X4JA 4KT0E 1KIKA 3VS4A 1VQ5Q 1U1SA 2EJGA 2FZGB 1QP3A 1I1JA 2P4TA 2ENMA 3TREA 2M9UA 2LJ1A 3A98A 4XU1A 1YIJQ 1YJ9T 4PJOD 4RCBA 5KYWA 2OAWA 2LDMA 3CCJA 3LH5A 1ACMB 2ZCFB 4PFOA 2GFAA 2DMOA 3JRZA 4RTWA 5A0DA 2AZVA 2K2VA 3M58A 2XDDA 1VQ8Q 4DEYA 1HD3A 5FWCA 3I55Q 2ZAEA 3D7SB 5GAN6 3URGA 2O9VA 4RTXA 1GCPA 4Y91A 4AFSC 2EQJA 2LT4A 4J5YA 4LDWA 4M7AF 2DF6A 3CC7T 1G8XA 1BK2A 3DB3A 8AT1B 2YUQA 2M16A 2RPNA 2DX1A 2ROLA 4NOYA 2DYIA 4EMKC 2X4WA 1K1ZA 3OS0A 3SWNC 2BIVA 1YHQQ 3CMET 2DNUA 3TEEA 4HVUA 5CR2A 2JVVA 2V26A 2L8DA 5LJ5d 1AWJA 3JB9H 3QSUA 2A36A 4CC7A 2G6FX 2BTTA 2EYXA 2ED1A 1OI1A 1R0BG 3JAME 4FW1A 4NS5A 4C92G 2JTEA 3LW5E 4HCCA 2EYWA 2MAMA 3JCMQ 1SG5A 4F7UG 5HK0A 2KBTA 2FYKA 4E7HA 2MWPA 2J6OA 3EGUA 4JJBA 3SD4A 1GCQA 1PSFA 4PJJA 3BDUA 3JCMg 2KVQG 2CP2A 2BUDA 3CCMA 2QEXQ 1JQQA 4O5VA 2F2VA 3OSSC 4M75B 3LWHA 1AZEA 4E7JA 3M56A 3CC7A 2OTLQ 1HK9A 3CCJQ 1U1TA 1VQ4T 1VQ5T 4M77F 1OU9A 1UGRB 1WJQA 1WXBA 4FSXA 2BE7D 4C0ZA 3PT9A 4NL2A 4HT9A 1N9SA 4DOWA 2RQRA 2KSSA 4OVAA 1KC8C 3THKA 1X75C 2C0OA 3VU3C 2YSQA 3JB9F 3P8DA 1VQOQ 2E6ZA 1YJNQ 2XMFA 2YT6A 2HMAA 1OZ2A 2VB6A 1RI0A 2RF0A 3G1JA 2LNVA 2FZKB 1WQWA 2YUNA 4E7SA 2KQWA 2DXTA 3DLLA 2JM9A 1VQNT 4ELZC 4N4HA 5IHKA 3MKDA 3G7ZA 4PL6A 1R0CB 3RUXA 3HRSA 3OSVA 2L5QA 4KH0B 2K5LA 4Z89A 2GTOA 2DJZA 3CC2A 5GAOl 4PLIA 1VQ4Q 1D1BA 3OMCA 3BE3A 4M78B 1Z9QA 5LJ3g 3X20B 4PJNA 1VQLA 2ZPIB 2P0PA 1KQ2A 3EAEA 4BE1A 2SRCA 2MWOA 3JCMW 2DIQA 1D09B 3EFRA 2RQUA 3EFOB 4N4GA 1YJNA 1FWZA 3H9NA 3I55A 1UJ0A 2CZ0B 2OX7A 4IUTA 1D3BA 2EQMA 1PWTA 1CKAA 2MF2A 1TOVA 3I9QA 1FXXA 4JRKA 4B9WA 2GQVA 1TWBA 3JCMX 4M7DF 1BI1A 4OF1A 3G4ST 1EIFA 4WCIA 1X6OA 1NJIU 1WA7A 2LP5A 4FYYB 3TVTA 4J9DA 4C8QF 2QXFA 1B07A 1PKTA 3GLXA 5DY9A 3OYGA 4PLLA 1W2BA 3RERA 1PC0A 2K5IA 1RI9A 3VUZA 3VUBA 4E7LA 3SB2A 5CVIA 4BUGA 3JCMP 1M2VB 3M4YA 1SHFA 1I07A 1WHMA 3LH0A 3VS3A 1M2OA 3HRUA 3U23A 1BCOA 2HSPA 1IGUA 3DKMA 1M1KC 3UF4A 4PJLA 4J9EA 1SF9A 1NYGA 4CI0C 1RLPC 2NUZA 3QZ9B 3EHQA 3L1AA 5KH6A 4LN2A 1QCOA 2Y4YA 2B86A 1K8AC 1ZUUA 2LCCA 2DIGA 3PVLA 3WVEB 3CCQQ 2L2PA 3QDFA 3JCMh 1TUDA 5GANd 1Y96B 5KYUA 3ER0A 3CPWA 1ZBXA 1M1GA 3X26B 2OAUA 2OTJA 4MZMA 5J26A 3MEWA 2RJDA 4E2FB 4HVWA 2CUDA 1Q86R 3OYCA 2XK0A 3F70A 1HXDA 3A8HB 1G3SA 3TQ7P 5D7UA 3RNJA 1P92A 2VASA 4M77G 1LCKA 4DOVA 3JCMe 3QYHB 2FB7A 3CCLT 1MMAA 3S3MA 2HBWA 3CQTA 4M77A 1W4SA 3X25B 4B6MA 4R55A 2QQ9A 1TH7A 1FMWA 5GAMd 4V2SA 2NUTA 5KYWB 2D8JA 2LTOA 3V7CA 3JCMd 3VRZA 2YUOA 3RKWA 1V76A 1LNXA 2XIDA 5GAMe 3EGXB 1SSFA 5DM7R 5A2QE 1S1NA 2A08A 1ZQ1A 1ZSGA 4JDSA 1MNDA 2HKQB 2FPEA 4B9XA 3QHSA 4M78D 2XHCA 3VRYA 2DEUA 2DL3A 2NLUA 4M4ZA 1YIJA 5KYYB 2HD0A 2Z0WA 3M9QA 5D6WA 3LGLA 2V8KA 1M8MA 1IGQA 3CXCS 1QWEA 3PTAA 1JU5C 1LOJA 1K8AU 1VQMA 4OGEA 1D3BB 2KI7A 2W0ZA 2PUKB 3CCMQ 2YRVA 3BW1A 4LDUA 3I5RA 3PVQA 2RNAA 3MJXA 4JLIA 1JJ2S 2RN8A 4Q5WA 1BI3A 1VQPA 5GAN4 1RADB 4KGZB 3JB9I 3CCEQ 4JZ4A 2HDAA 2XDPA 2DKGA 2EW3A 1G3TA 3FDRA 2YUPA 4C0DB 1WHLA 1QKXA 1KHIA 1GFDA 2CP7A 2D8HA 2DTOA 4PFPA 2QK0A 2AT1B 4HA8A 4ZTFA 2CH4W 2VXFA 2O4XB 4DQ2A 3GPLA 1KD1C 3CCUA 1UHFA 3CMAA 3H41A 3M0RA 2RQWA 1KHCA 2FPFA 3MEAA 3UA7A 5KYUB 2DLPA 5GANf 3OQ5A 3V8KA 4FM4B 4PK4A 3JB9G 2J05A 1Q82U 1UEBA 3EG0A 5LJ5f 4VUBA 1BB9A 5AT1B 4M75F 3OMGA 4KBMB 5GMKe 3C4SA 2GFUA 4RG2A 3CCEA 2D1XA 3M5AA 2XG8D 1ZSZC 5HCKA 1MGQA 1QVGA 2VV5A 5C6SA 3VJPA 4OB3B 2RHYA 4BDYA 4JUVA 1MUZA 4AT1B 2RA2A 1X2QA 3SHWA 2JJ9A 2EQUA 2E41A 4PNOA 2O2OA 3CCUT 4MDXA 4MDWA 1Q7YC 4KULA 1W2BS 1D1CA 1SPKA 1N6AA 2VWFA 4BD3A 2BE9B 4JRIA 1EFNA 5CKEA 2OTLA 4YTLA 3KFVA 2I2LA 1PSEA 5HK3A 1W1FA 1C1AA 1E6HA 1FX7A 2LRQA 5FLXE 3OYKA 2H3JA 5CQXA 2CUBA 5IN1A 3QUIA 2EKOA 3VS1A 3CCVA 1RAEB 2YWWA 2PVGB 2E65A 2CS7A 2V8IA 5FROA 2DVJA 3RKXA 4C8QA 4RTYA 2ECZA 2DRMA 2EJ9A 1KQSP 2IG0A 1MV3A 1RACB 1VQMT 2WSEE 5KE3A 2CZ7B 1VQ8A 3Q1JA 4DBFA 1CKBA 1B34A 1W6XA 5LJ3f 1JRIA 4ZN1A 3HTRA 4RCCA 4LDXA 1SRLA 4J9GA 3MEUA 1KSWA 1WHKA 3PMTA 2PUOB 3QIIA 1Q82C 1VQ8T 2EQKA 4Z02A 3OYDA 4PJOF 1QVFS 2EYQA 1QWFA 4M78F 2KE9A 1H92A 3CCRT 1VYVA 1LJOA 3CCQT 1M30A 1JB0E 4K11A 1W2BP 1HJDA 5L8RE 4LE9A 2LX9A 1XOVA 4JJNK 3NHNA 1MV0B 1NYFA 1D1AA 2CGHA 2DL4A 1M8VA 4EDUA 5GAN3 3CD6T 4JJCA 1UDLA 4LDYA 4J7FA 2HL5C 4JPBW 1K73R 5GMKj 1Q7YU 2R57A 4HCKA 4FYVB 1T3LA 1VYTA 3OYNA 4M7DB 3OYFA 3P8BB 2Y4XA 3C12A 1K9AA 4PJOE 2RI5A 2HZYA 4WF2A 1YI2T 5L23A 2OTJT 3HFNA 1S72Q 1X43A 1G5VA 2RQTA 3G71Q 3CXCA 3VS7A 2K3XA 1G2BA 3GNFB 1BIBA 4JS4A 4QVCA 4ELYC 2GGRA 3CCRQ 1AEYA 1RAFB 4J6YA 3AT1B 4FT4A 4LXCA 2HAXA 2GTJA 3LLRA 4IUUA 1SRMA 2L3QA 1Q86C 2DERA 1WPYA 1Y57A 3HHTB 4M77D 2CP6A 1GL5A 1WHGA 2YDLA 1ABQA 3CC4Q 1N9RA 2EKHA 2V1RA 3N5BB 5KYYA 1IXDA 2VGMA 4IIOA 1H3HA 1BI0A 1GCQC 1X27A 2CDTA 4ZN3A 4QKUA 5LJ5h 4JLGA 1NPPA 2EGEA 3FRNA 1VQ9T 1VQ6T 1WJSA 2EGAA 1RL2A 3VS5A 3OS5A 1AWXA 2YRCA 5GAOp 4M77E 4IKFA 2EYYA 2V8JA 1C6VX 5ECAA 2O31A 3G71A 2BZYA 1EZZB 2QASA 4EMGA 3NFCA 4M7AB 4IIMA 4DBHA 2GQIA 3BFMA 3DLMA 2QA4Q 2JTMA 3EH2A 2ZGWA 4XAXB 2ZPGB 5I22A 3M0UA 1ABOA 1VQ7T 1M90U 3OYHA 3VV0A 2E6NA 3AHUA 3GIBA 3QG1A 4ZGEB 2KYMA 4C5EA 4L5GA 2QQRA 2K79A 4FIBA 3NTKA 3ME9A 1M1FA 2COYA 1WFWA 1N8RC 1WYXA 3GNGA 1I4K1 4DBRA 4Z8AA 2O88A 4RTVA 2AK5A 4J9BA 1VQKT 5IHIA 2ZPBB 3QJ6A 2LT1A 2VVKA 4L6V5 3CC2Q 3FJPA 5CO7A 1KQSS 1IRXA 4FYXB 2JS2A 2DO3A 1Q82R 2GBQA 2L0AA 4FSSA 1SKUB 2J06A 2OJ2A 2QDYB 3G71T 4OMMA 2ATCB 2HNIA 5GMKh 3E1SA 1X2KA 1M90R 2E10A 1BI2A 3CC4A 3QZ5B 3E9GA 4OB0B 2KXDA 4JZ3A 1KJWA 4OMNA 4N4IA 5GAOr 3CCLA 1IREB 1TG0A 1U3OA 2FZCB 2JTFA 1U5SA 2CYZB 3I56Q 4X34A 2E5QA 4M7DC 2NUPB 1YWOA 1VQOA 2JS0A 2XU8A 4XK8E 9ATCB 2CKKA 4OMFB 2COWA 2K3BA 2DA9A 2FVUA 2WSFE 5FRNA 2DBMA 1AWOA 5GJWB 3ZL7C 4EMHA 1M4ZA 1AD5A 2NWMA 3EG2A 4P5NA 3CCMT 2DXCA 2R58A 4ME7A 2L3RA 1VQKQ 1Q7YR 4BY6B 4QW2A 4AG1C 2K5FA 4F7UA 2LX7A 3L2QA 2K3YA 1IHVA 4ZGJB 1YITQ 1AZGB 5GAMf 3CBMA 4X1VA 5GMKi 1JO8A 2RM4A 3CPWS 3OBWA 1K73C 1YN8A 4M75A 2JNGA 2OTJQ 1ZA2B 2HEQA 2DFUA 4F7UB 4ORZA 1WDXA 1NG2A 3CMAQ 3ULRB 2JMCA 2DVEA 3PIOA 3TU4K 4QQGA 1I5LA 4FL6A 4RTUA 4TVRA 3PIPA 3TSZA 4D8DA 4C5HA 4M7AD 3OS1A 3OB9A 3TSWA 5CKHA 2FRYA 4BI4A 3QDRB 3H0HA 1E6GA 4ATOA 3G4SA 3META 1FYNA 1BYMA 3X24B 1K4US 4XU0A 1RAHB 2DZCA 1UFFA 4C92D 3CCLQ 2A7YA 1AVZC 1PNJA 3HPWA 4IUPA 2P0KA 1YJNT 3QPHA 1OX9A 1NLOC 5IAYA 2RB6A 2RI3A 2KK4A 4C8QC 2BZXA 2K2MA 1BIAA 3E2UA 3NMZC 2IVWA 4M7DG 4WTOB 4F16A 3VKIA 1WNLA 4IURA 4ANJA 2LQNA 1BCMA 4M75D 2E3HA 5KYXA 1ZSZA 4HVVA 2V1QA 1KD1U 2O01E 1ZA1B 2HQXA 2CSIA 4C0FA 1YITA 3P8HA 2KRMA 2VKNA 4PJOA 1I8FA 1VIEA 1SHGA 4ZTJA 2WSCE 3RDVA 3LYIA 3CXCP 1Q81U 2I0NA 2SEMA 3QO3A 3S3OA 1UHCA 4IUVA 3H0FA 4PKCC 1FMKA 5EG2A 1VIFA 4PJOG 2PQWA 1JBMA 3A5ZB 2E70A 5I21A 1PRLC 5D6XA 5I2MA 1XTDA 5LJ3d 3VYGA 4M78C 5IHNA 3CD6Q 2KRSA 4C92E 3CCET 5DLQE 1OEBA 3A8OB 1KD1R 1WLPB 4LDVA 4AFZC 4EIKA 2X35A 4FW2A 2ZPFB 4C92B 4JJDA 3JCMf 2DPPB 3EFSA 2A0FB 1QVFA 2DTIA 2QYZA 4GLMA 2J6FA 4L59A 3RMSA 5IXBA 1JEGA 4CRIA 5GJVB 1WXTA 4RKUE 2EJFA 4QVZA 4A4KA 2E3IA 1X6GA 4FU6A 1S72A 1QKWA 2RQVA 3CMEA 1CSKA 2YLBA 2MMPA 1Y7XA 2X3XD 4M7AG 1NEBA 3QJYA 1G3WA 2LVMA 1PCXA 4M7AA 2DXBA 2K6DA 3C95A 5GAN7 3FLGA 3UA6A 1WQ7A 1I5OB 1GBQA 1RAIB 2BKDN 1YFNA 3CPFA 1M3BA 1WHHA 1UB4A 4JRQA 3OW2P 5GAN8 1TXQA 4BDZA 5C0MA 5IXFA 4A4FA 2LQWA 4XTYA 2F69A 1W70A 3EGXA 5GAOm 2RO0A 4GY5A 1YHQT 5GAOn 1VQ6Q 2DE0X 1YWPA 1JJ2A 1XNIA 1YNZA 2WACA 3MHXA 2R5AA 2F5TX 3EGDB 1N27A 2EBPA 4GBQA 3TCJA 1JXMA 1F1BB 3CC2T 1UUEA 2PZ1A 3R6OA 1K0SA 4HT8A 3PFSA 5KYXB 1VYUA 1NBEB 3C94A 4C8QB 1K0XA 2JMAA 3M59A 2KGTA 2DXUA 1X01A 2BZ8A 3MEVA 4DBQA 1KQ1A 2CP5A 3UATA 4E7KA 3M57A 1TUCA 3M0QA 2HCKA 1VQNA 5CKBA 1IHWA 2RHIA 2DL7A 3PMIA 3I35A 3L2RA 3G6EA 4HKEA 5I2SA 5GAMh 2F2WA 1I0CA 1VA7A 4XQ3A 2DEQA 1YHQA 3LGFA 2QTVA 4Z88A 3GF5A 3M53A 3I56T 4F17A 1WZOA 2E1HA 3E9FA 3J81E 3L2WA 2ESWA 1D0XA 1K8AR 4OMQA 4HCBA 1VQ9Q 4DEXA 1PKSA 1AOJA 1FMVA 2FPDA 1N8RR 2DETA 1NE8A 5GANh 2ZPHB 1E7OA 4JS5A 4BB7A 4CC3A 2A3LA 4EPCA 3KXTA 1EX4A 5GANg 2KT1A 1KG1A 1NEGA 3V7RA 3EG9B 2FL7A 1M3AA 1M2VA 1ZLMA 2MOXA 2AKLA 1MMNA 3M55A 4EMKA 2HL3A 4M78E 4KUIA 3ZFJA 4N0AA 1ZBJA 1R77A 2M1HA 2VGNA 3GP8A 4C0GA 3A8MB 4LUDA 4A4HA 2OI3A 3VS2A 3UPUA 1A0NB 3WVDB 5CK9A 1HSQA 3A1PA 5GAN5 2A28A 3EHRA 4A4GA 4PJOC 5M9OA 2DL8A 2QAZA 3OYYA 4XU2A 3R6NA 1U8RA 2LNHB 4QQ6A 2CT4A 1GBRA 1WX6A 2VC8A 4ZGDB 1UG1A 2LCSA 2LJ0A 4X9DA 1UGQB 3INZA 2DD5A 2KT8A 3C0CA 3RMQA 1M90C 2EWNA 2QGFB 3OYAA 2DILA 3JCMc 2GF7A 1YCSB 2CP3A 2XICA 3O5ZA 5DLOA 1XQHA 4O6JA 1Q95G 1JXOA 2YHTA 2MIOA 4FYWB 3I55T 1SEMA 3OYIA 5FW9A 4J9CA 3FIFA 2LQ8A 2QTXA 3DB4A 3OYBA 1WGSA 4A54A 2HSEB 2RMOA 2E12A 4R56A 3FB9A 4RTZA 4C8QG 3ASKA 1ARKA 2KY9A 5LJ3h 4AG2C 3NGPA 4J9HA 1BBZA 5FWBA 2RHZA 1IO6A 3S6WA 4XTVA 2VXEA 1T0HA 2COZA 1YITT 1YJWT 1YP5A 4FT2A 3A8LB 4RG8A 3KBGA 4M77C 2FEIA 1O75A 1KC8R 2NUPA 1KQSA 1K76A 3ZBDA 2E5KA 1OYXA 1T0JA 4NL3A 2P0QA 1I81A 2K7AA 1U06A 1QLYA 2RHXA 1J3TA 2L89A 2C06A 2KMTA 4F7UF 3PGGA 4D8KA 5IH2A 1QCNA 3EG9A 4QT7A 1QQJA 3X28B 1UGSB 4A63B 5FU7B 1OOTA 2D0NA 4II1A 1AWWA 3RIRA 3GBQA 4C5GA 2KEAA 3M0TA 3PE0A 4XTXA 3UT1A 3L2ZA 3BY7A 3PNWC 1BKBA 2C0IA 1HYOA 5GAN2 3QKJA 3SEMA 4EMKB 1WXUA 2JM8A 1OZ3A 5AYFA 2Y90A 3EFOA 1PHTA 4OMLA 1VQ5A 1X6BA 4A53A 2ED0A 2EYZA 4J6WA 3RR6A 1LVKA 4AMCA 2X9HA 1M9SA 2GCXA 4X9CA 2J7IA 1G3YA 3V8JA 2JUFA 4E47A 3H8ZA 1RAAB 4OB1B 2CZ6B 3OS2A 1S72T 1PM3A 4C92A 3HRTA 1M27C 1MMDA 3NTIA 1RABB 4IUQA 4OB2B 4MZTA 1VQ6A 1TTHB 2JW4A 4LUEA 2RJEA 4HCZA 2PVOB 1Y71A 4J9FA 2JXBA 2W10A 3EG1A 4ESRA 2FG0A 3RKYA 2QQBA 4QVDA 4RMOA 1MMGA 1QCFA 3H0IA 2IIMA 2IPOB 2JZ2A 5GAMj 3UDCA 5I11A 1YJWQ 4PFZA 5GMKm 1VQ7Q 2MK5A 1K9MU 1IB8A 2AZSA 4MMKA 2YXYA 3OW2A 2KROA 2FO0A 2VYTA 4KGVB 4D6WA 2DJQA 1V1CA 1O9SA 2JT4A 2DTHA 3QYGB 8ATCB 1K9MC 3CMEQ 4M75G 4E7ZA 1KK7A 2JOYA 1JJ2P 4M7DD 1YBYA 3OYEA 3SDZA 3CPWP 4MZPA 3SWNB 1VQOT 5GANj 3QXEB 2KNBB 4F14A 3L2UA 2LC4A 3HP9A 1Z9ZA 5CAIA 2RD1A 2L3SA 5LJ3j 3CCJT 3CC4T 1V29B 1UGVA 1YJ9A 5A0LA 2FHDA 1Y96A 1TU0B 3V8LA 4C5IA 2B8AA 2KDSA 2RJFA 1TS9A 1H641 1MNEA 1OPKA 5A0GA 1Q81C 1OX8A 3CCSA 2AHJB 3OYJA 3JB9D 2G3RA 2HBPA 5HKCA 1NPRA 2EVRA 2CH4A 2CSQA 2RJCA 7AT1B 4BACA 3MPUB 3QWXX 2K57A 5CCAA 3CCRA 1UECA 3REAB 2RK1A 2CP0A 3HL8A 2AKKA 4LNPA 2D6FA 4PJOB 2NUTB 4OGCA 3G6EQ 5EC7A 5KCHA 3E19A 5FU7C 4BE0A 2DBKA 3A8GB 2H8HA 4M7AC 2EIFA 3KUFA 4KRTA 1TUGB 3NPFA 4PJMA 5LL6S 1X69A 4KUDK 4J8OA 2QDLA 1B7TA 4C92F 3MP6A 3FJ5A 1H8KA 4E7IA 2K4YA 3CCST 2R5MA 2MYSA 4C92C 2QGGA 3MP8A 1UJYA 1H3ZA 3JSCA 1YJWA 4CC4B 4BI3A 2E4HA 3T9NA 2YLCA 2LCLA 2MPXC 1M3CA 4M75E 1D0ZA 1WIEA 1WHJA 2H3EB 1PRMC 1GFCA 1VQ9A 3BDLA 3FC3A 1RAGB 1XJWB 2PVDB 3SWNA 4Y92A 2L3PA 2DYBA 1Y07A 4M78G 3QWYA 5GAMg 4M78A 1N8RU 3I5SA 1QVGS 3O8VA 1C0MA 2M0OA 4E6RA 5LJ3e 3OBYA 2PNIA 3L2VA 1Q86U 2ZZDA 3SFMA 1NJIC 2E64A 4QQDA 3OYLA 2RHUA 3VYHB 1ZUYA 2LZ6B 4C8QD 1QVGP 2QEXA 4ZNXA 4F7UE 1QP2A 4XTZA 3CBOA 5J39A 2EAYA 4A4EA 3CMAT 3JCMb 2PU9B 1KC8U 5LJ5g 1NJIR
chains in the Genus database with same CATH topology
1YJNA 1VQ9T 1FWZA 3E9FA 5CIUA 1IZ6A 3J81E 3I55A 1VQ6T 3L2WA 2CZ0B 1WJSA 4IUTA 1D3BA 1RL2A 2DD4A 2EQMA 4HCBA 1M1KU 4XU3A 3LWIA 3OS5A 2MF2A 4M7DA 5GAOp 4M77E 4IKFA 1FXXA 4JRKA 2V8JA 4BY6C 4LD9K 5D6YA 4B9WA 2GQVA 3JCMX 4M7DF 1BI1A 4OF1A 3G71A 3G4ST 1EIFA 1NE8A 3LX7A 2ZPHB 2LQKA 5GANh 4XTWA 4JS5A 4BB7A 4EMGA 1X6OA 2A3LA 3NFCA 4M7AB 4EPCA 3OYMA 1NJIU 4JRPA 3KXTA 5GANg 1KG1A 3BFMA 3DLMA 3HKSA 3V7RA 2FL7A 4C8QF 2JTMA 2QXFA 2ZGWA 4XAXB 2ZPGB 3NTHA 2QA4A 3GLXA 5DY9A 3M55A 3OYGA 4PLLA 1W2BA 3RERA 1VQ7T 5LJ5e 1M90U 4EMKA 3OYHA 3VV0A 2E6NA 3AHUA 3GIBA 4M78E 2K5IA 4J7IA 3QG1A 4ZGEB 1VQKA 3VUZA 3VUBA 5GMKl 4E7LA 3SB2A 4KUIA 5CVIA 4BUGA 3ZFJA 4N0AA 3JCMP 2M1HA 4L5GA 4C5EA 2VGNA 2QQRA 3M4YA 3GP8A 4C0GA 3A8MB 3CEYA 4GLKA 3LH0A 4FIBA 3I56A 3NTKA 3ME9A 1M1FA 4A4HA 1N8RC 3MP1A 3HRUA 5IT9E 3GNGA 2XD0A 1I4K1 3UPUA 3WVDB 5CK9A 1VQLT 3MO8A 3DKMA 5GAN5 4UC4A 3M4GA 1M1KC 4A4GA 1VQKT 1AHJB 4PJOC 5M9OA 2ZPBB 4CI0C 3QZ9B 3QJ6A 2LT1A 1VQ7A 3M54A 4L6V5 3HSBA 3OYYA 3FJPA 5CO7A 4XU2A 4C0DC 2QQAA 3L1AA 2QA4T 5KH6A 1U8RA 4BE2A 1KQSS 4DA4A 2Y4YA 4QQ6A 1K8AC 4LD6A 3CCVT 4N0AC 2DO3A 2VC8A 4M7AE 2LCCA 2DIGA 4ZGDB 3WVEB 3JB9J 3JCMh 4X9DA 2QDYB 3G71T 5GANd 1UGQB 1Y96B 5FRMA 3ER0A 2HNIA 5GMKh 3INZA 2DD5A 3CPWA 1ZBXA 3RMQA 3E1SA 1M1GA 2EWNA 2E10A 1BI2A 3X26B 2OAUA 4M75C 3OYAA 2OTLT 2OTJA 4MZMA 5J26A 3MEWA 2RJDA 3CC4A 3QZ5B 3E9GA 4OB0B 3JCMc 2GF7A 2XICA 5DLOA 1XQHA 4N4IA 4O6JA 5GAOr 2YHTA 4J83A 3CCLA 3I55T 3OYCA 1IREB 3JCMV 2XK0A 3F70A 2JTFA 3OYIA 1HXDA 2CYZB 2X4XA 4XTUA 5CQYA 3A8HB 1G3SA 2E5QA 3FIFA 4X34A 2LQ8A 2QTXA 2VUBA 3DB4A 3OYBA 4M7DC 2HQEA 1P92A 1WGSA 2XDBA 3UWNA 4A54A 4M77G 3JCMe 4DOVA 2E12A 4R56A 3QYHB 2FB7A 3FB9A 3CCLT 1VQOA 3S3MA 4C8QG 3ASKA 2KY9A 2XU8A 4M77A 1W4SA 4XK8E 3X25B 4R55A 2QQ9A 5LJ3h 2QEXT 1R8OB 1TH7A 2CKKA 4OMFB 3WXMB 5GAMd 4V2SA 2D0QB 3S6WA 2LTOA 2RHZA 4XTVA 2VXEA 2DZ9A 2FVUA 2WSFE 3V7CA 3JCMd 3J80E 5FRNA 5CKDA 5GAOq 1YITT 1VQ4A 1YJWT 5CKFA 4MMLA 4FT2A 3A8LB 4RG8A 3RKWA 3KBGA 4M77C 4BI8B 1LNXA 1WJRA 1M4ZA 2DK3A 2XIDA 4P5NA 4EMHA 5GAMe 5KCOA 1O75A 1SSFA 2DXCA 2R58A 5DM7R 3CCMT 4Y28E 2RH2A 5A2QE 2X4YA 1KQSA 4ME7A 2L3RA 1ZQ1A 3GOXA 1NZ9A 1UGPB 3L42A 3ZBDA 4BY6B 1OYXA 4JDSA 5FU6C 4QW2A 4NL3A 2P0QA 1I81A 2K5FA 4B9XA 4F7UA 4OP0A 4M7DE 3QHSA 4M78D 2XHCA 2RHXA 3L2QA 2L89A 2C06A 2KMTA 4F7UF 2K3YA 3PGGA 4ZGJB 2NLUA 2XKOC 3HFOA 5GAMf 3S3NA 1YI2A 3CBMA 1UGSB 3X28B 5FU7B 5GMKi 1YIJA 2RM4A 2KAFA 3CPWS 2HD0A 4II1A 1YCYA 3OBWA 3RIRA 1K73C 3ZEHA 5D6WA 3M9QA 4C5GA 3LGLA 5LJ5j 4M75A 3V7SA 2JNGA 2V8KA 1QW1A 4XTXA 2F5KA 3UT1A 2ZPEB 3L2ZA 3BY7A 3PNWC 1BKBA 1DJ7B 5KE2A 3CXCS 3PTAA 5GAN2 1K73U 1LOJA 3QKJA 4F7UB 1K8AU 2JN0A 1VQMA 4OGEA 1D3BB 3FEOA 3OW2S 4EMKB 2PUKB 3PIOA 2DVEA 3J7AF 1OZ3A 3TU4K 4QQGA 5AYFA 1VUBA 2Y90A 1I5LA 2YRVA 3MCAB 3BW1A 4LDUA 1VQ5A 4FL6A 4TVRA 3PIPA 4JLIA 4C5HA 1JJ2S 2DAQA 4Q5WA 1BI3A 3CBPA 1VQPA 4M7AD 4A53A 3OS1A 5GAN4 3OB9A 3CD6A 5CKHA 3OY9A 4J6WA 4BI4A 2RK2A 3H6ZA 2D9TA 3QDRB 3JB9I 1VQPT 1QVPA 2RI2A 4C8QE 2XDPA 2DKGA 3QBYA 1M9SA 1B34B 2GCXA 4X9CA 3G4SA 1G3TA 1G3YA 2QI2A 2JUFA 3FDRA 3META 3H8ZA 3V8JA 4C0DB 4E47A 1BYMA 4OB1B 2CZ6B 3OS2A 3X24B 1S72T 4J6XA 1MHNA 3CCQA 3OA6A 4XU0A 4C92A 3HRTA 3NTIA 1KHIA 2DZCA 2CZ1B 2EFIA 4C92D 4IUQA 2A7YA 4OB2B 4MZTA 2DTOA 1VQ6A 5GANe 1GXIE 3HPWA 2XI9A 4IUPA 2P0KA 1YJNT 4HA8A 2RJEA 3QPHA 4ZTFA 4HCZA 2VXFA 2O4XB 4DQ2A 2PVOB 1Y71A 2QQSA 3GPLA 2MI6A 1KD1C 3CCUA 3CMAA 5HY6A 1KHCA 5J3BA 1YIJT 3RESA 3MEAA 1ZHIA 3RKYA 2QQBA 4M77B 5IAYA 4QVDA 4RMOA 3JCMJ 5GANf 2RB6A 2RI3A 2KK4A 3OQ5A 4C8QC 3V8KA 3G6ET 4FM4B 2JZ2A 2O4XA 5GAMj 3JB9G 3UDCA 1M5Q1 1BIAA 5GMKm 5FU6B 1K9MU 2X4JA 2IVWA 4KT0E 1Q82U 1UEBA 4M7DG 5LJ5f 1U1SA 4VUBA 2EJGA 3VKIA 4MMKA 1WNLA 3OMGA 4IURA 4KBMB 4M75D 4M75F 5GMKe 1QP3A 3OW2A 2P4TA 2VYTA 3C4SA 3TREA 2GFUA 2M9UA 4RG2A 4D6WA 3CCEA 3M5AA 1KD1U 2XG8D 1O9SA 2O01E 4XU1A 1MGQA 2DTHA 1QVGA 3QYGB 1K9MC 2HQXA 4C0FA 1YITA 3P8HA 2VV5A 5C6SA 4M75G 3VJPA 1YJ9T 2JOYA 4RCBA 4OB3B 2RHYA 4PJOD 4BDYA 4PJOA 4JUVA 4M7DD 1YBYA 2LDMA 3CCJA 3OYEA 2RA2A 1I8FA 2ZCFB 1VIEA 3SDZA 2EQUA 2E41A 4MZPA 4PNOA 3SWNB 1VQOT 2GFAA 3JRZA 5GANj 3QXEB 5A0DA 4ZTJA 2WSCE 3CCUT 2K2VA 3LYIA 4MDXA 3M58A 4MDWA 1Q7YC 5LJ5g 2XDDA 4KULA 3L2UA 1W2BS 2LC4A 3HP9A 1M90C 1Q81U 5CAIA 3QO3A 2RD1A 3S3OA 4IUVA 4PKCC 5EG2A 1N6AA 4BD3A 1VIFA 4PJOG 2PQWA 1JBMA 4JRIA 5LJ3j 3CCJT 3A5ZB 3CC4T 2E70A 5CKEA 5I21A 5GAN6 2OTLA 4YTLA 1V29B 5D6XA 5I2MA 4Y91A 3URGA 2I2LA 2EQJA 1XTDA 1YJ9A 5A0LA 2FHDA 1PSEA 5HK3A 1Y96A 2LT4A 3V8LA 5LJ3d 4C5IA 2B8AA 4J5YA 4LDWA 3VYGA 1FX7A 4M78C 2KDSA 2RJFA 4M7AF 2LRQA 5FLXE 1H641 3OYKA 2H3JA 5CQXA 3CC7T 4C92E 5IN1A 3CCET 3DB3A 3QUIA 2EKOA 5A0GA 5DLQE 3A8OB 3CCVA 1Q81C 2M16A 4LDVA 2AHJB 4EMKC 4NOYA 3OYJA 3CCSA 2X4WA 2G3RA 3OS0A 3JB9D 2HBPA 5HKCA 3SWNC 2PVGB 2BIVA 1NPRA 2E65A 2CS7A 2V8IA 2X35A 5FROA 3RKXA 3CMET 4C8QA 2RJCA 4BACA 2ZPFB 2EJ9A 3TEEA 2IG0A 4C92B 2K57A 5CR2A 3JCMf 2JVVA 5CCAA 3CCRA 1VQMT 2DPPB 2WSEE 5KE3A 2L8DA 2CZ7B 3EFSA 1VQ8A 3Q1JA 5LJ5d 2DTIA 1QVFA 1B34A 5LJ3f 3JB9H 3QSUA 1JRIA 2RK1A 4ZN1A 3HL8A 4RCCA 4LDXA 2D6FA 4L59A 4PJOB 1OI1A 4OGCA 3JAME 3RMSA 4CRIA 4NS5A 3MEUA 4C92G 5KCHA 3E19A 5FU7C 4BE0A 4RKUE 2EJFA 3PMTA 2PUOB 3QIIA 3A8GB 4QVZA 2EQKA 4Z02A 3OYDA 3LW5E 1Q82C 1VQ8T 4A4KA 2MAMA 4PJOF 4HCCA 1QVFS 2EYQA 3JCMQ 4M78F 4M7AC 2EIFA 3KUFA 4F7UG 3CCRT 5HK0A 1LJOA 2FYKA 4FU6A 5LL6S 3CCQT 1JB0E 4J8OA 1S72A 4KUDK 4E7HA 2MWPA 5L8RE 4C92F 3MP6A 3CMEA 2YLBA 2LX9A 3SD4A 1PSFA 2MMPA 4E7IA 1XOVA 1Y7XA 4JJNK 2K4YA 4M7AG 3CCST 3BDUA 3JCMg 2KVQG 3QJYA 1G3WA 2BUDA 3CCMA 2CGHA 2R5MA 1M8VA 4EDUA 4O5VA 2LVMA 3OSSC 4M75B 5GAN3 3LWHA 4C92C 4E7JA 3M56A 3CC7A 3CD6T 2DXBA 4M7AA 1HK9A 3C95A 3MP8A 5GAN7 3FLGA 1H3ZA 1U1TA 3JSCA 1VQ4T 1YJWA 4BI3A 4LDYA 4J7FA 1VQ5T 1WQ7A 2YLCA 4M77F 1UGRB 3T9NA 2LCLA 1WJQA 5GMKj 1Q7YU 4FSXA 2R57A 2BKDN 3CPFA 4M75E 4C0ZA 3OYNA 4M7DB 1UB4A 4JRQA 3OYFA 3P8BB 3PT9A 2Y4XA 3C12A 5GAN8 4NL2A 4BDZA 4HT9A 5C0MA 1N9SA 4A4FA 4XTYA 2F69A 4DOWA 1VQ9A 3BDLA 2KSSA 3FC3A 2PVDB 5GAOm 4PJOE 4OVAA 2RI5A 1KC8C 2RO0A 4GY5A 1YHQT 1X75C 5GAOn 3SWNA 3VU3C 3JB9F 3P8DA 1JJ2A 1XNIA 2E6ZA 2WACA 4WF2A 1Y07A 3MHXA 1YI2T 1OZ2A 4M78G 2R5AA 5GAMg 2F5TX 1RI0A 1N27A 2LNVA 2OTJT 4M78A 3HFNA 1WQWA 1N8RU 3TCJA 2KQWA 2DXTA 3DLLA 1G5VA 1QVGS 3O8VA 2M0OA 3CC2T 4ELZC 3R6OA 4N4HA 3CXCA 1VQNT 4HT8A 4ATOA 3G7ZA 4PL6A 2K3XA 3PFSA 5LJ3e 3OBYA 3C94A 4C8QB 3RUXA 3GNFB 3HRSA 2L5QA 1BIBA 3OSVA 2ZZDA 3L2VA 2K5LA 3M59A 4JS4A 1Q86U 3SFMA 1NJIC 4QVCA 2E64A 2DXUA 4QQDA 4ELYC 1X01A 3MEVA 1KQ1A 3OYLA 2DJZA 4E7KA 3CC2A 3M57A 1VQNA 2RHUA 4J6YA 4PLIA 5GAOl 3VYHB 4FT4A 5CKBA 2RHIA 3OMCA 2HAXA 3LLRA 4IUUA 4C8QD 1Q86C 3PMIA 1WPYA 4M78B 3L2RA 3G6EA 3HHTB 4M77D 2QEXA 5LJ3g 4HKEA 1QP2A 4F7UE 5I2SA 5GAMh 3X20B 4XTZA 1VQLA 3CBOA 1N9RA 3N5BB 2EAYA 2ZPIB 2P0PA 5J39A 1KQ2A 2VGMA 4XQ3A 3EAEA 1BI0A 2DEQA 4A4EA 4ZN3A 4BE1A 2MWOA 3JCMW 1YHQA 2DIQA 3LGFA 5LJ5h 3CMAT 3GF5A 3M53A 3EFRA 3JCMb 2PU9B 3I56T 1KC8U 4JLGA 1NPPA 2E1HA 4N4GA 3FRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ME7 A;  3JSC A;  5HKC A;  5CK9 A;  5CKB A;  5HK0 A;  5CKE A;  4MZM A;  2C06 A;  2MF2 A;  2KMT A;  5CR2 A;  5CCA A;  4HKE A;  1VUB A;  3TCJ A;  3VUB A;  1UB4 A;  5DLO A;  5CO7 A;  4MZT A;  4MZP A;  5HK3 A;  4OF1 A;  5CKD A;  3JRZ A;  3HPW A;  4ELZ C;  4VUB A;  1NE8 A;  5CKF A;  3G7Z A;  5CQY A;  4MDX A;  5CQX A;  5CKH A;  3NFC A;  1M1F A;  2VUB A;  1X75 C;  4ELY C; 
#chains in the Genus database with same CATH topology
 2LJ3 A;  5CIU A;  1IZ6 A;  2K9G A;  2DD4 A;  1M1K U;  4XU3 A;  2PTK A;  1OQK A;  3LWI A;  1VQP Q;  4M7D A;  2AIR B;  2EPD A;  4BY6 C;  4LD9 K;  5D6Y A;  4AFU C;  1BU1 A;  3LX7 A;  2LQK A;  4XTW A;  1PD0 A;  3VS0 A;  1G83 A;  3OYM A;  5KYN A;  4JRP A;  3HKS A;  4J9I A;  3NTH A;  2QA4 A;  2J6K A;  4AFQ C;  5LJ5 e;  4J7I A;  1VQK A;  5GMK l;  2MCN A;  4RTT A;  1LPL A;  1PD1 A;  3CEY A;  4GLK A;  3I56 A;  1N5Z A;  3MP1 A;  4OMO A;  5IT9 E;  2XD0 A;  3REB B;  1VQL T;  3MO8 A;  4UC4 A;  3IQL A;  1ZX6 A;  4KH1 B;  3M4G A;  1AHJ B;  2GNC A;  1PG5 B;  2CRE A;  1VQ7 A;  1NM7 A;  3M54 A;  3HSB A;  1VQN Q;  3CCU Q;  4C0D C;  2QQA A;  2QA4 T;  2F1L A;  4BE2 A;  4DA4 A;  4FCY A;  4LD6 A;  3CCV T;  4N0A C;  1KFZ A;  2EGC A;  4M7A E;  3JB9 J;  1VQL Q;  6AT1 B;  3M0S A;  1UTI A;  1OU8 A;  5FRM A;  2KYB A;  3CC7 Q;  4M75 C;  2OTL T;  4J83 A;  3JCM V;  2X4X A;  4XTU A;  5CQY A;  1RUW A;  2VUB A;  4F04 B;  2HQE A;  1Q81 R;  2XDB A;  3UWN A;  2A37 A;  1M1K R;  2M0Y A;  2F2X A;  2QEX T;  1R8O B;  3EGD A;  3WXM B;  1SSH A;  2D0Q B;  2YRD A;  3J80 E;  2DZ9 A;  1UE9 A;  3EH1 A;  4HXJ A;  5CKD A;  5GAO q;  1VQ4 A;  1WI7 A;  5CKF A;  2M02 A;  4MML A;  1B3Q A;  1T3S A;  2DL5 A;  1OPL A;  4BI8 B;  1WJR A;  4R0K A;  2DK3 A;  3CCV Q;  2KR3 A;  5KCO A;  4Y28 E;  2RH2 A;  2X4Y A;  2M51 A;  3GOX A;  1NZ9 A;  1UGP B;  3L42 A;  5FU6 C;  3RBB B;  2NYS A;  4M7D E;  4OP0 A;  1QVF P;  1D0Y A;  1YI2 Q;  2HKN A;  2X3W D;  1QMC A;  2XKO C;  3HFO A;  3S3N A;  1YI2 A;  2KAF A;  2ROT A;  1YCY A;  3ZEH A;  5LJ5 j;  3V7S A;  1K9M R;  1QW1 A;  2F5K A;  2ZPE B;  1GRI A;  1DJ7 B;  5KE2 A;  2DRK A;  3EG3 A;  3VS6 A;  1K73 U;  2P84 A;  4RUG A;  2JN0 A;  3FEO A;  3JV3 A;  3M0P A;  3OW2 S;  3J7A F;  2HQH A;  4OMP A;  2X51 A;  1AT1 B;  1VUB A;  1ZUK A;  2O9S A;  2CT3 A;  2KRN A;  3MCA B;  2KXC A;  2DAQ A;  2FRW A;  3CBP A;  3CD6 A;  3OY9 A;  2RK2 A;  3H6Z A;  2D9T A;  2C0T A;  1VQP T;  1QVP A;  2RI2 A;  3G4S Q;  4C8Q E;  3QBY A;  1YJ9 Q;  1B34 B;  2QI2 A;  4J6X A;  1MHN A;  4CC2 A;  3CCQ A;  3OA6 A;  1OV3 A;  1ZSZ B;  2EFI A;  2CZ1 B;  3CCS Q;  5GAN e;  1GXI E;  2XI9 A;  2ABL A;  2QQS A;  2QG9 B;  1VQM Q;  2LMJ A;  2MI6 A;  1NLP C;  1TSF A;  1RLQ C;  1OUL A;  5HY6 A;  5J3B A;  1YIJ T;  3RES A;  1ZHI A;  4M77 B;  4KGX B;  3JCM J;  1Y0M A;  2DM1 A;  2P4R A;  3G6E T;  2O4X A;  2EQI A;  1M5Q 1;  5FU6 B;  1VOM A;  2X4J A;  4KT0 E;  1KIK A;  3VS4 A;  1VQ5 Q;  1U1S A;  2EJG A;  2FZG B;  1QP3 A;  1I1J A;  2P4T A;  2ENM A;  3TRE A;  2M9U A;  2LJ1 A;  3A98 A;  4XU1 A;  1YIJ Q;  1YJ9 T;  4PJO D;  4RCB A;  5KYW A;  2OAW A;  2LDM A;  3CCJ A;  3LH5 A;  1ACM B;  2ZCF B;  4PFO A;  2GFA A;  2DMO A;  3JRZ A;  4RTW A;  5A0D A;  2AZV A;  2K2V A;  3M58 A;  2XDD A;  1VQ8 Q;  4DEY A;  1HD3 A;  5FWC A;  3I55 Q;  2ZAE A;  3D7S B;  5GAN 6;  3URG A;  2O9V A;  4RTX A;  1GCP A;  4Y91 A;  4AFS C;  2EQJ A;  2LT4 A;  4J5Y A;  4LDW A;  4M7A F;  2DF6 A;  3CC7 T;  1G8X A;  1BK2 A;  3DB3 A;  8AT1 B;  2YUQ A;  2M16 A;  2RPN A;  2DX1 A;  2ROL A;  4NOY A;  2DYI A;  4EMK C;  2X4W A;  1K1Z A;  3OS0 A;  3SWN C;  2BIV A;  1YHQ Q;  3CME T;  2DNU A;  3TEE A;  4HVU A;  5CR2 A;  2JVV A;  2V26 A;  2L8D A;  5LJ5 d;  1AWJ A;  3JB9 H;  3QSU A;  2A36 A;  4CC7 A;  2G6F X;  2BTT A;  2EYX A;  2ED1 A;  1OI1 A;  1R0B G;  3JAM E;  4FW1 A;  4NS5 A;  4C92 G;  2JTE A;  3LW5 E;  4HCC A;  2EYW A;  2MAM A;  3JCM Q;  1SG5 A;  4F7U G;  5HK0 A;  2KBT A;  2FYK A;  4E7H A;  2MWP A;  2J6O A;  3EGU A;  4JJB A;  3SD4 A;  1GCQ A;  1PSF A;  4PJJ A;  3BDU A;  3JCM g;  2KVQ G;  2CP2 A;  2BUD A;  3CCM A;  2QEX Q;  1JQQ A;  4O5V A;  2F2V A;  3OSS C;  4M75 B;  3LWH A;  1AZE A;  4E7J A;  3M56 A;  3CC7 A;  2OTL Q;  1HK9 A;  3CCJ Q;  1U1T A;  1VQ4 T;  1VQ5 T;  4M77 F;  1OU9 A;  1UGR B;  1WJQ A;  1WXB A;  4FSX A;  2BE7 D;  4C0Z A;  3PT9 A;  4NL2 A;  4HT9 A;  1N9S A;  4DOW A;  2RQR A;  2KSS A;  4OVA A;  1KC8 C;  3THK A;  1X75 C;  2C0O A;  3VU3 C;  2YSQ A;  3JB9 F;  3P8D A;  1VQO Q;  2E6Z A;  1YJN Q;  2XMF A;  2YT6 A;  2HMA A;  1OZ2 A;  2VB6 A;  1RI0 A;  2RF0 A;  3G1J A;  2LNV A;  2FZK B;  1WQW A;  2YUN A;  4E7S A;  2KQW A;  2DXT A;  3DLL A;  2JM9 A;  1VQN T;  4ELZ C;  4N4H A;  5IHK A;  3MKD A;  3G7Z A;  4PL6 A;  1R0C B;  3RUX A;  3HRS A;  3OSV A;  2L5Q A;  4KH0 B;  2K5L A;  4Z89 A;  2GTO A;  2DJZ A;  3CC2 A;  5GAO l;  4PLI A;  1VQ4 Q;  1D1B A;  3OMC A;  3BE3 A;  4M78 B;  1Z9Q A;  5LJ3 g;  3X20 B;  4PJN A;  1VQL A;  2ZPI B;  2P0P A;  1KQ2 A;  3EAE A;  4BE1 A;  2SRC A;  2MWO A;  3JCM W;  2DIQ A;  1D09 B;  3EFR A;  2RQU A;  3EFO B;  4N4G A;  1YJN A;  1FWZ A;  3H9N A;  3I55 A;  1UJ0 A;  2CZ0 B;  2OX7 A;  4IUT A;  1D3B A;  2EQM A;  1PWT A;  1CKA A;  2MF2 A;  1TOV A;  3I9Q A;  1FXX A;  4JRK A;  4B9W A;  2GQV A;  1TWB A;  3JCM X;  4M7D F;  1BI1 A;  4OF1 A;  3G4S T;  1EIF A;  4WCI A;  1X6O A;  1NJI U;  1WA7 A;  2LP5 A;  4FYY B;  3TVT A;  4J9D A;  4C8Q F;  2QXF A;  1B07 A;  1PKT A;  3GLX A;  5DY9 A;  3OYG A;  4PLL A;  1W2B A;  3RER A;  1PC0 A;  2K5I A;  1RI9 A;  3VUZ A;  3VUB A;  4E7L A;  3SB2 A;  5CVI A;  4BUG A;  3JCM P;  1M2V B;  3M4Y A;  1SHF A;  1I07 A;  1WHM A;  3LH0 A;  3VS3 A;  1M2O A;  3HRU A;  3U23 A;  1BCO A;  2HSP A;  1IGU A;  3DKM A;  1M1K C;  3UF4 A;  4PJL A;  4J9E A;  1SF9 A;  1NYG A;  4CI0 C;  1RLP C;  2NUZ A;  3QZ9 B;  3EHQ A;  3L1A A;  5KH6 A;  4LN2 A;  1QCO A;  2Y4Y A;  2B86 A;  1K8A C;  1ZUU A;  2LCC A;  2DIG A;  3PVL A;  3WVE B;  3CCQ Q;  2L2P A;  3QDF A;  3JCM h;  1TUD A;  5GAN d;  1Y96 B;  5KYU A;  3ER0 A;  3CPW A;  1ZBX A;  1M1G A;  3X26 B;  2OAU A;  2OTJ A;  4MZM A;  5J26 A;  3MEW A;  2RJD A;  4E2F B;  4HVW A;  2CUD A;  1Q86 R;  3OYC A;  2XK0 A;  3F70 A;  1HXD A;  3A8H B;  1G3S A;  3TQ7 P;  5D7U A;  3RNJ A;  1P92 A;  2VAS A;  4M77 G;  1LCK A;  4DOV A;  3JCM e;  3QYH B;  2FB7 A;  3CCL T;  1MMA A;  3S3M A;  2HBW A;  3CQT A;  4M77 A;  1W4S A;  3X25 B;  4B6M A;  4R55 A;  2QQ9 A;  1TH7 A;  1FMW A;  5GAM d;  4V2S A;  2NUT A;  5KYW B;  2D8J A;  2LTO A;  3V7C A;  3JCM d;  3VRZ A;  2YUO A;  3RKW A;  1V76 A;  1LNX A;  2XID A;  5GAM e;  3EGX B;  1SSF A;  5DM7 R;  5A2Q E;  1S1N A;  2A08 A;  1ZQ1 A;  1ZSG A;  4JDS A;  1MND A;  2HKQ B;  2FPE A;  4B9X A;  3QHS A;  4M78 D;  2XHC A;  3VRY A;  2DEU A;  2DL3 A;  2NLU A;  4M4Z A;  1YIJ A;  5KYY B;  2HD0 A;  2Z0W A;  3M9Q A;  5D6W A;  3LGL A;  2V8K A;  1M8M A;  1IGQ A;  3CXC S;  1QWE A;  3PTA A;  1JU5 C;  1LOJ A;  1K8A U;  1VQM A;  4OGE A;  1D3B B;  2KI7 A;  2W0Z A;  2PUK B;  3CCM Q;  2YRV A;  3BW1 A;  4LDU A;  3I5R A;  3PVQ A;  2RNA A;  3MJX A;  4JLI A;  1JJ2 S;  2RN8 A;  4Q5W A;  1BI3 A;  1VQP A;  5GAN 4;  1RAD B;  4KGZ B;  3JB9 I;  3CCE Q;  4JZ4 A;  2HDA A;  2XDP A;  2DKG A;  2EW3 A;  1G3T A;  3FDR A;  2YUP A;  4C0D B;  1WHL A;  1QKX A;  1KHI A;  1GFD A;  2CP7 A;  2D8H A;  2DTO A;  4PFP A;  2QK0 A;  2AT1 B;  4HA8 A;  4ZTF A;  2CH4 W;  2VXF A;  2O4X B;  4DQ2 A;  3GPL A;  1KD1 C;  3CCU A;  1UHF A;  3CMA A;  3H41 A;  3M0R A;  2RQW A;  1KHC A;  2FPF A;  3MEA A;  3UA7 A;  5KYU B;  2DLP A;  5GAN f;  3OQ5 A;  3V8K A;  4FM4 B;  4PK4 A;  3JB9 G;  2J05 A;  1Q82 U;  1UEB A;  3EG0 A;  5LJ5 f;  4VUB A;  1BB9 A;  5AT1 B;  4M75 F;  3OMG A;  4KBM B;  5GMK e;  3C4S A;  2GFU A;  4RG2 A;  3CCE A;  2D1X A;  3M5A A;  2XG8 D;  1ZSZ C;  5HCK A;  1MGQ A;  1QVG A;  2VV5 A;  5C6S A;  3VJP A;  4OB3 B;  2RHY A;  4BDY A;  4JUV A;  1MUZ A;  4AT1 B;  2RA2 A;  1X2Q A;  3SHW A;  2JJ9 A;  2EQU A;  2E41 A;  4PNO A;  2O2O A;  3CCU T;  4MDX A;  4MDW A;  1Q7Y C;  4KUL A;  1W2B S;  1D1C A;  1SPK A;  1N6A A;  2VWF A;  4BD3 A;  2BE9 B;  4JRI A;  1EFN A;  5CKE A;  2OTL A;  4YTL A;  3KFV A;  2I2L A;  1PSE A;  5HK3 A;  1W1F A;  1C1A A;  1E6H A;  1FX7 A;  2LRQ A;  5FLX E;  3OYK A;  2H3J A;  5CQX A;  2CUB A;  5IN1 A;  3QUI A;  2EKO A;  3VS1 A;  3CCV A;  1RAE B;  2YWW A;  2PVG B;  2E65 A;  2CS7 A;  2V8I A;  5FRO A;  2DVJ A;  3RKX A;  4C8Q A;  4RTY A;  2ECZ A;  2DRM A;  2EJ9 A;  1KQS P;  2IG0 A;  1MV3 A;  1RAC B;  1VQM T;  2WSE E;  5KE3 A;  2CZ7 B;  1VQ8 A;  3Q1J A;  4DBF A;  1CKB A;  1B34 A;  1W6X A;  5LJ3 f;  1JRI A;  4ZN1 A;  3HTR A;  4RCC A;  4LDX A;  1SRL A;  4J9G A;  3MEU A;  1KSW A;  1WHK A;  3PMT A;  2PUO B;  3QII A;  1Q82 C;  1VQ8 T;  2EQK A;  4Z02 A;  3OYD A;  4PJO F;  1QVF S;  2EYQ A;  1QWF A;  4M78 F;  2KE9 A;  1H92 A;  3CCR T;  1VYV A;  1LJO A;  3CCQ T;  1M30 A;  1JB0 E;  4K11 A;  1W2B P;  1HJD A;  5L8R E;  4LE9 A;  2LX9 A;  1XOV A;  4JJN K;  3NHN A;  1MV0 B;  1NYF A;  1D1A A;  2CGH A;  2DL4 A;  1M8V A;  4EDU A;  5GAN 3;  3CD6 T;  4JJC A;  1UDL A;  4LDY A;  4J7F A;  2HL5 C;  4JPB W;  1K73 R;  5GMK j;  1Q7Y U;  2R57 A;  4HCK A;  4FYV B;  1T3L A;  1VYT A;  3OYN A;  4M7D B;  3OYF A;  3P8B B;  2Y4X A;  3C12 A;  1K9A A;  4PJO E;  2RI5 A;  2HZY A;  4WF2 A;  1YI2 T;  5L23 A;  2OTJ T;  3HFN A;  1S72 Q;  1X43 A;  1G5V A;  2RQT A;  3G71 Q;  3CXC A;  3VS7 A;  2K3X A;  1G2B A;  3GNF B;  1BIB A;  4JS4 A;  4QVC A;  4ELY C;  2GGR A;  3CCR Q;  1AEY A;  1RAF B;  4J6Y A;  3AT1 B;  4FT4 A;  4LXC A;  2HAX A;  2GTJ A;  3LLR A;  4IUU A;  1SRM A;  2L3Q A;  1Q86 C;  2DER A;  1WPY A;  1Y57 A;  3HHT B;  4M77 D;  2CP6 A;  1GL5 A;  1WHG A;  2YDL A;  1ABQ A;  3CC4 Q;  1N9R A;  2EKH A;  2V1R A;  3N5B B;  5KYY A;  1IXD A;  2VGM A;  4IIO A;  1H3H A;  1BI0 A;  1GCQ C;  1X27 A;  2CDT A;  4ZN3 A;  4QKU A;  5LJ5 h;  4JLG A;  1NPP A;  2EGE A;  3FRN A;  1VQ9 T;  1VQ6 T;  1WJS A;  2EGA A;  1RL2 A;  3VS5 A;  3OS5 A;  1AWX A;  2YRC A;  5GAO p;  4M77 E;  4IKF A;  2EYY A;  2V8J A;  1C6V X;  5ECA A;  2O31 A;  3G71 A;  2BZY A;  1EZZ B;  2QAS A;  4EMG A;  3NFC A;  4M7A B;  4IIM A;  4DBH A;  2GQI A;  3BFM A;  3DLM A;  2QA4 Q;  2JTM A;  3EH2 A;  2ZGW A;  4XAX B;  2ZPG B;  5I22 A;  3M0U A;  1ABO A;  1VQ7 T;  1M90 U;  3OYH A;  3VV0 A;  2E6N A;  3AHU A;  3GIB A;  3QG1 A;  4ZGE B;  2KYM A;  4C5E A;  4L5G A;  2QQR A;  2K79 A;  4FIB A;  3NTK A;  3ME9 A;  1M1F A;  2COY A;  1WFW A;  1N8R C;  1WYX A;  3GNG A;  1I4K 1;  4DBR A;  4Z8A A;  2O88 A;  4RTV A;  2AK5 A;  4J9B A;  1VQK T;  5IHI A;  2ZPB B;  3QJ6 A;  2LT1 A;  2VVK A;  4L6V 5;  3CC2 Q;  3FJP A;  5CO7 A;  1KQS S;  1IRX A;  4FYX B;  2JS2 A;  2DO3 A;  1Q82 R;  2GBQ A;  2L0A A;  4FSS A;  1SKU B;  2J06 A;  2OJ2 A;  2QDY B;  3G71 T;  4OMM A;  2ATC B;  2HNI A;  5GMK h;  3E1S A;  1X2K A;  1M90 R;  2E10 A;  1BI2 A;  3CC4 A;  3QZ5 B;  3E9G A;  4OB0 B;  2KXD A;  4JZ3 A;  1KJW A;  4OMN A;  4N4I A;  5GAO r;  3CCL A;  1IRE B;  1TG0 A;  1U3O A;  2FZC B;  2JTF A;  1U5S A;  2CYZ B;  3I56 Q;  4X34 A;  2E5Q A;  4M7D C;  2NUP B;  1YWO A;  1VQO A;  2JS0 A;  2XU8 A;  4XK8 E;  9ATC B;  2CKK A;  4OMF B;  2COW A;  2K3B A;  2DA9 A;  2FVU A;  2WSF E;  5FRN A;  2DBM A;  1AWO A;  5GJW B;  3ZL7 C;  4EMH A;  1M4Z A;  1AD5 A;  2NWM A;  3EG2 A;  4P5N A;  3CCM T;  2DXC A;  2R58 A;  4ME7 A;  2L3R A;  1VQK Q;  1Q7Y R;  4BY6 B;  4QW2 A;  4AG1 C;  2K5F A;  4F7U A;  2LX7 A;  3L2Q A;  2K3Y A;  1IHV A;  4ZGJ B;  1YIT Q;  1AZG B;  5GAM f;  3CBM A;  4X1V A;  5GMK i;  1JO8 A;  2RM4 A;  3CPW S;  3OBW A;  1K73 C;  1YN8 A;  4M75 A;  2JNG A;  2OTJ Q;  1ZA2 B;  2HEQ A;  2DFU A;  4F7U B;  4ORZ A;  1WDX A;  1NG2 A;  3CMA Q;  3ULR B;  2JMC A;  2DVE A;  3PIO A;  3TU4 K;  4QQG A;  1I5L A;  4FL6 A;  4RTU A;  4TVR A;  3PIP A;  3TSZ A;  4D8D A;  4C5H A;  4M7A D;  3OS1 A;  3OB9 A;  3TSW A;  5CKH A;  2FRY A;  4BI4 A;  3QDR B;  3H0H A;  1E6G A;  4ATO A;  3G4S A;  3MET A;  1FYN A;  1BYM A;  3X24 B;  1K4U S;  4XU0 A;  1RAH B;  2DZC A;  1UFF A;  4C92 D;  3CCL Q;  2A7Y A;  1AVZ C;  1PNJ A;  3HPW A;  4IUP A;  2P0K A;  1YJN T;  3QPH A;  1OX9 A;  1NLO C;  5IAY A;  2RB6 A;  2RI3 A;  2KK4 A;  4C8Q C;  2BZX A;  2K2M A;  1BIA A;  3E2U A;  3NMZ C;  2IVW A;  4M7D G;  4WTO B;  4F16 A;  3VKI A;  1WNL A;  4IUR A;  4ANJ A;  2LQN A;  1BCM A;  4M75 D;  2E3H A;  5KYX A;  1ZSZ A;  4HVV A;  2V1Q A;  1KD1 U;  2O01 E;  1ZA1 B;  2HQX A;  2CSI A;  4C0F A;  1YIT A;  3P8H A;  2KRM A;  2VKN A;  4PJO A;  1I8F A;  1VIE A;  1SHG A;  4ZTJ A;  2WSC E;  3RDV A;  3LYI A;  3CXC P;  1Q81 U;  2I0N A;  2SEM A;  3QO3 A;  3S3O A;  1UHC A;  4IUV A;  3H0F A;  4PKC C;  1FMK A;  5EG2 A;  1VIF A;  4PJO G;  2PQW A;  1JBM A;  3A5Z B;  2E70 A;  5I21 A;  1PRL C;  5D6X A;  5I2M A;  1XTD A;  5LJ3 d;  3VYG A;  4M78 C;  5IHN A;  3CD6 Q;  2KRS A;  4C92 E;  3CCE T;  5DLQ E;  1OEB A;  3A8O B;  1KD1 R;  1WLP B;  4LDV A;  4AFZ C;  4EIK A;  2X35 A;  4FW2 A;  2ZPF B;  4C92 B;  4JJD A;  3JCM f;  2DPP B;  3EFS A;  2A0F B;  1QVF A;  2DTI A;  2QYZ A;  4GLM A;  2J6F A;  4L59 A;  3RMS A;  5IXB A;  1JEG A;  4CRI A;  5GJV B;  1WXT A;  4RKU E;  2EJF A;  4QVZ A;  4A4K A;  2E3I A;  1X6G A;  4FU6 A;  1S72 A;  1QKW A;  2RQV A;  3CME A;  1CSK A;  2YLB A;  2MMP A;  1Y7X A;  2X3X D;  4M7A G;  1NEB A;  3QJY A;  1G3W A;  2LVM A;  1PCX A;  4M7A A;  2DXB A;  2K6D A;  3C95 A;  5GAN 7;  3FLG A;  3UA6 A;  1WQ7 A;  1I5O B;  1GBQ A;  1RAI B;  2BKD N;  1YFN A;  3CPF A;  1M3B A;  1WHH A;  1UB4 A;  4JRQ A;  3OW2 P;  5GAN 8;  1TXQ A;  4BDZ A;  5C0M A;  5IXF A;  4A4F A;  2LQW A;  4XTY A;  2F69 A;  1W70 A;  3EGX A;  5GAO m;  2RO0 A;  4GY5 A;  1YHQ T;  5GAO n;  1VQ6 Q;  2DE0 X;  1YWP A;  1JJ2 A;  1XNI A;  1YNZ A;  2WAC A;  3MHX A;  2R5A A;  2F5T X;  3EGD B;  1N27 A;  2EBP A;  4GBQ A;  3TCJ A;  1JXM A;  1F1B B;  3CC2 T;  1UUE A;  2PZ1 A;  3R6O A;  1K0S A;  4HT8 A;  3PFS A;  5KYX B;  1VYU A;  1NBE B;  3C94 A;  4C8Q B;  1K0X A;  2JMA A;  3M59 A;  2KGT A;  2DXU A;  1X01 A;  2BZ8 A;  3MEV A;  4DBQ A;  1KQ1 A;  2CP5 A;  3UAT A;  4E7K A;  3M57 A;  1TUC A;  3M0Q A;  2HCK A;  1VQN A;  5CKB A;  1IHW A;  2RHI A;  2DL7 A;  3PMI A;  3I35 A;  3L2R A;  3G6E A;  4HKE A;  5I2S A;  5GAM h;  2F2W A;  1I0C A;  1VA7 A;  4XQ3 A;  2DEQ A;  1YHQ A;  3LGF A;  2QTV A;  4Z88 A;  3GF5 A;  3M53 A;  3I56 T;  4F17 A;  1WZO A;  2E1H A;  3E9F A;  3J81 E;  3L2W A;  2ESW A;  1D0X A;  1K8A R;  4OMQ A;  4HCB A;  1VQ9 Q;  4DEX A;  1PKS A;  1AOJ A;  1FMV A;  2FPD A;  1N8R R;  2DET A;  1NE8 A;  5GAN h;  2ZPH B;  1E7O A;  4JS5 A;  4BB7 A;  4CC3 A;  2A3L A;  4EPC A;  3KXT A;  1EX4 A;  5GAN g;  2KT1 A;  1KG1 A;  1NEG A;  3V7R A;  3EG9 B;  2FL7 A;  1M3A A;  1M2V A;  1ZLM A;  2MOX A;  2AKL A;  1MMN A;  3M55 A;  4EMK A;  2HL3 A;  4M78 E;  4KUI A;  3ZFJ A;  4N0A A;  1ZBJ A;  1R77 A;  2M1H A;  2VGN A;  3GP8 A;  4C0G A;  3A8M B;  4LUD A;  4A4H A;  2OI3 A;  3VS2 A;  3UPU A;  1A0N B;  3WVD B;  5CK9 A;  1HSQ A;  3A1P A;  5GAN 5;  2A28 A;  3EHR A;  4A4G A;  4PJO C;  5M9O A;  2DL8 A;  2QAZ A;  3OYY A;  4XU2 A;  3R6N A;  1U8R A;  2LNH B;  4QQ6 A;  2CT4 A;  1GBR A;  1WX6 A;  2VC8 A;  4ZGD B;  1UG1 A;  2LCS A;  2LJ0 A;  4X9D A;  1UGQ B;  3INZ A;  2DD5 A;  2KT8 A;  3C0C A;  3RMQ A;  1M90 C;  2EWN A;  2QGF B;  3OYA A;  2DIL A;  3JCM c;  2GF7 A;  1YCS B;  2CP3 A;  2XIC A;  3O5Z A;  5DLO A;  1XQH A;  4O6J A;  1Q95 G;  1JXO A;  2YHT A;  2MIO A;  4FYW B;  3I55 T;  1SEM A;  3OYI A;  5FW9 A;  4J9C A;  3FIF A;  2LQ8 A;  2QTX A;  3DB4 A;  3OYB A;  1WGS A;  4A54 A;  2HSE B;  2RMO A;  2E12 A;  4R56 A;  3FB9 A;  4RTZ A;  4C8Q G;  3ASK A;  1ARK A;  2KY9 A;  5LJ3 h;  4AG2 C;  3NGP A;  4J9H A;  1BBZ A;  5FWB A;  2RHZ A;  1IO6 A;  3S6W A;  4XTV A;  2VXE A;  1T0H A;  2COZ A;  1YIT T;  1YJW T;  1YP5 A;  4FT2 A;  3A8L B;  4RG8 A;  3KBG A;  4M77 C;  2FEI A;  1O75 A;  1KC8 R;  2NUP A;  1KQS A;  1K76 A;  3ZBD A;  2E5K A;  1OYX A;  1T0J A;  4NL3 A;  2P0Q A;  1I81 A;  2K7A A;  1U06 A;  1QLY A;  2RHX A;  1J3T A;  2L89 A;  2C06 A;  2KMT A;  4F7U F;  3PGG A;  4D8K A;  5IH2 A;  1QCN A;  3EG9 A;  4QT7 A;  1QQJ A;  3X28 B;  1UGS B;  4A63 B;  5FU7 B;  1OOT A;  2D0N A;  4II1 A;  1AWW A;  3RIR A;  3GBQ A;  4C5G A;  2KEA A;  3M0T A;  3PE0 A;  4XTX A;  3UT1 A;  3L2Z A;  3BY7 A;  3PNW C;  1BKB A;  2C0I A;  1HYO A;  5GAN 2;  3QKJ A;  3SEM A;  4EMK B;  1WXU A;  2JM8 A;  1OZ3 A;  5AYF A;  2Y90 A;  3EFO A;  1PHT A;  4OML A;  1VQ5 A;  1X6B A;  4A53 A;  2ED0 A;  2EYZ A;  4J6W A;  3RR6 A;  1LVK A;  4AMC A;  2X9H A;  1M9S A;  2GCX A;  4X9C A;  2J7I A;  1G3Y A;  3V8J A;  2JUF A;  4E47 A;  3H8Z A;  1RAA B;  4OB1 B;  2CZ6 B;  3OS2 A;  1S72 T;  1PM3 A;  4C92 A;  3HRT A;  1M27 C;  1MMD A;  3NTI A;  1RAB B;  4IUQ A;  4OB2 B;  4MZT A;  1VQ6 A;  1TTH B;  2JW4 A;  4LUE A;  2RJE A;  4HCZ A;  2PVO B;  1Y71 A;  4J9F A;  2JXB A;  2W10 A;  3EG1 A;  4ESR A;  2FG0 A;  3RKY A;  2QQB A;  4QVD A;  4RMO A;  1MMG A;  1QCF A;  3H0I A;  2IIM A;  2IPO B;  2JZ2 A;  5GAM j;  3UDC A;  5I11 A;  1YJW Q;  4PFZ A;  5GMK m;  1VQ7 Q;  2MK5 A;  1K9M U;  1IB8 A;  2AZS A;  4MMK A;  2YXY A;  3OW2 A;  2KRO A;  2FO0 A;  2VYT A;  4KGV B;  4D6W A;  2DJQ A;  1V1C A;  1O9S A;  2JT4 A;  2DTH A;  3QYG B;  8ATC B;  1K9M C;  3CME Q;  4M75 G;  4E7Z A;  1KK7 A;  2JOY A;  1JJ2 P;  4M7D D;  1YBY A;  3OYE A;  3SDZ A;  3CPW P;  4MZP A;  3SWN B;  1VQO T;  5GAN j;  3QXE B;  2KNB B;  4F14 A;  3L2U A;  2LC4 A;  3HP9 A;  1Z9Z A;  5CAI A;  2RD1 A;  2L3S A;  5LJ3 j;  3CCJ T;  3CC4 T;  1V29 B;  1UGV A;  1YJ9 A;  5A0L A;  2FHD A;  1Y96 A;  1TU0 B;  3V8L A;  4C5I A;  2B8A A;  2KDS A;  2RJF A;  1TS9 A;  1H64 1;  1MNE A;  1OPK A;  5A0G A;  1Q81 C;  1OX8 A;  3CCS A;  2AHJ B;  3OYJ A;  3JB9 D;  2G3R A;  2HBP A;  5HKC A;  1NPR A;  2EVR A;  2CH4 A;  2CSQ A;  2RJC A;  7AT1 B;  4BAC A;  3MPU B;  3QWX X;  2K57 A;  5CCA A;  3CCR A;  1UEC A;  3REA B;  2RK1 A;  2CP0 A;  3HL8 A;  2AKK A;  4LNP A;  2D6F A;  4PJO B;  2NUT B;  4OGC A;  3G6E Q;  5EC7 A;  5KCH A;  3E19 A;  5FU7 C;  4BE0 A;  2DBK A;  3A8G B;  2H8H A;  4M7A C;  2EIF A;  3KUF A;  4KRT A;  1TUG B;  3NPF A;  4PJM A;  5LL6 S;  1X69 A;  4KUD K;  4J8O A;  2QDL A;  1B7T A;  4C92 F;  3MP6 A;  3FJ5 A;  1H8K A;  4E7I A;  2K4Y A;  3CCS T;  2R5M A;  2MYS A;  4C92 C;  2QGG A;  3MP8 A;  1UJY A;  1H3Z A;  3JSC A;  1YJW A;  4CC4 B;  4BI3 A;  2E4H A;  3T9N A;  2YLC A;  2LCL A;  2MPX C;  1M3C A;  4M75 E;  1D0Z A;  1WIE A;  1WHJ A;  2H3E B;  1PRM C;  1GFC A;  1VQ9 A;  3BDL A;  3FC3 A;  1RAG B;  1XJW B;  2PVD B;  3SWN A;  4Y92 A;  2L3P A;  2DYB A;  1Y07 A;  4M78 G;  3QWY A;  5GAM g;  4M78 A;  1N8R U;  3I5S A;  1QVG S;  3O8V A;  1C0M A;  2M0O A;  4E6R A;  5LJ3 e;  3OBY A;  2PNI A;  3L2V A;  1Q86 U;  2ZZD A;  3SFM A;  1NJI C;  2E64 A;  4QQD A;  3OYL A;  2RHU A;  3VYH B;  1ZUY A;  2LZ6 B;  4C8Q D;  1QVG P;  2QEX A;  4ZNX A;  4F7U E;  1QP2 A;  4XTZ A;  3CBO A;  5J39 A;  2EAY A;  4A4E A;  3CMA T;  3JCM b;  2PU9 B;  1KC8 U;  5LJ5 g;  1NJI R; 
#chains in the Genus database with same CATH homology
 1YJN A;  1VQ9 T;  1FWZ A;  3E9F A;  5CIU A;  1IZ6 A;  3J81 E;  3I55 A;  1VQ6 T;  3L2W A;  2CZ0 B;  1WJS A;  4IUT A;  1D3B A;  1RL2 A;  2DD4 A;  2EQM A;  4HCB A;  1M1K U;  4XU3 A;  3LWI A;  3OS5 A;  2MF2 A;  4M7D A;  5GAO p;  4M77 E;  4IKF A;  1FXX A;  4JRK A;  2V8J A;  4BY6 C;  4LD9 K;  5D6Y A;  4B9W A;  2GQV A;  3JCM X;  4M7D F;  1BI1 A;  4OF1 A;  3G71 A;  3G4S T;  1EIF A;  1NE8 A;  3LX7 A;  2ZPH B;  2LQK A;  5GAN h;  4XTW A;  4JS5 A;  4BB7 A;  4EMG A;  1X6O A;  2A3L A;  3NFC A;  4M7A B;  4EPC A;  3OYM A;  1NJI U;  4JRP A;  3KXT A;  5GAN g;  1KG1 A;  3BFM A;  3DLM A;  3HKS A;  3V7R A;  2FL7 A;  4C8Q F;  2JTM A;  2QXF A;  2ZGW A;  4XAX B;  2ZPG B;  3NTH A;  2QA4 A;  3GLX A;  5DY9 A;  3M55 A;  3OYG A;  4PLL A;  1W2B A;  3RER A;  1VQ7 T;  5LJ5 e;  1M90 U;  4EMK A;  3OYH A;  3VV0 A;  2E6N A;  3AHU A;  3GIB A;  4M78 E;  2K5I A;  4J7I A;  3QG1 A;  4ZGE B;  1VQK A;  3VUZ A;  3VUB A;  5GMK l;  4E7L A;  3SB2 A;  4KUI A;  5CVI A;  4BUG A;  3ZFJ A;  4N0A A;  3JCM P;  2M1H A;  4L5G A;  4C5E A;  2VGN A;  2QQR A;  3M4Y A;  3GP8 A;  4C0G A;  3A8M B;  3CEY A;  4GLK A;  3LH0 A;  4FIB A;  3I56 A;  3NTK A;  3ME9 A;  1M1F A;  4A4H A;  1N8R C;  3MP1 A;  3HRU A;  5IT9 E;  3GNG A;  2XD0 A;  1I4K 1;  3UPU A;  3WVD B;  5CK9 A;  1VQL T;  3MO8 A;  3DKM A;  5GAN 5;  4UC4 A;  3M4G A;  1M1K C;  4A4G A;  1VQK T;  1AHJ B;  4PJO C;  5M9O A;  2ZPB B;  4CI0 C;  3QZ9 B;  3QJ6 A;  2LT1 A;  1VQ7 A;  3M54 A;  4L6V 5;  3HSB A;  3OYY A;  3FJP A;  5CO7 A;  4XU2 A;  4C0D C;  2QQA A;  3L1A A;  2QA4 T;  5KH6 A;  1U8R A;  4BE2 A;  1KQS S;  4DA4 A;  2Y4Y A;  4QQ6 A;  1K8A C;  4LD6 A;  3CCV T;  4N0A C;  2DO3 A;  2VC8 A;  4M7A E;  2LCC A;  2DIG A;  4ZGD B;  3WVE B;  3JB9 J;  3JCM h;  4X9D A;  2QDY B;  3G71 T;  5GAN d;  1UGQ B;  1Y96 B;  5FRM A;  3ER0 A;  2HNI A;  5GMK h;  3INZ A;  2DD5 A;  3CPW A;  1ZBX A;  3RMQ A;  3E1S A;  1M1G A;  2EWN A;  2E10 A;  1BI2 A;  3X26 B;  2OAU A;  4M75 C;  3OYA A;  2OTL T;  2OTJ A;  4MZM A;  5J26 A;  3MEW A;  2RJD A;  3CC4 A;  3QZ5 B;  3E9G A;  4OB0 B;  3JCM c;  2GF7 A;  2XIC A;  5DLO A;  1XQH A;  4N4I A;  4O6J A;  5GAO r;  2YHT A;  4J83 A;  3CCL A;  3I55 T;  3OYC A;  1IRE B;  3JCM V;  2XK0 A;  3F70 A;  2JTF A;  3OYI A;  1HXD A;  2CYZ B;  2X4X A;  4XTU A;  5CQY A;  3A8H B;  1G3S A;  2E5Q A;  3FIF A;  4X34 A;  2LQ8 A;  2QTX A;  2VUB A;  3DB4 A;  3OYB A;  4M7D C;  2HQE A;  1P92 A;  1WGS A;  2XDB A;  3UWN A;  4A54 A;  4M77 G;  3JCM e;  4DOV A;  2E12 A;  4R56 A;  3QYH B;  2FB7 A;  3FB9 A;  3CCL T;  1VQO A;  3S3M A;  4C8Q G;  3ASK A;  2KY9 A;  2XU8 A;  4M77 A;  1W4S A;  4XK8 E;  3X25 B;  4R55 A;  2QQ9 A;  5LJ3 h;  2QEX T;  1R8O B;  1TH7 A;  2CKK A;  4OMF B;  3WXM B;  5GAM d;  4V2S A;  2D0Q B;  3S6W A;  2LTO A;  2RHZ A;  4XTV A;  2VXE A;  2DZ9 A;  2FVU A;  2WSF E;  3V7C A;  3JCM d;  3J80 E;  5FRN A;  5CKD A;  5GAO q;  1YIT T;  1VQ4 A;  1YJW T;  5CKF A;  4MML A;  4FT2 A;  3A8L B;  4RG8 A;  3RKW A;  3KBG A;  4M77 C;  4BI8 B;  1LNX A;  1WJR A;  1M4Z A;  2DK3 A;  2XID A;  4P5N A;  4EMH A;  5GAM e;  5KCO A;  1O75 A;  1SSF A;  2DXC A;  2R58 A;  5DM7 R;  3CCM T;  4Y28 E;  2RH2 A;  5A2Q E;  2X4Y A;  1KQS A;  4ME7 A;  2L3R A;  1ZQ1 A;  3GOX A;  1NZ9 A;  1UGP B;  3L42 A;  3ZBD A;  4BY6 B;  1OYX A;  4JDS A;  5FU6 C;  4QW2 A;  4NL3 A;  2P0Q A;  1I81 A;  2K5F A;  4B9X A;  4F7U A;  4OP0 A;  4M7D E;  3QHS A;  4M78 D;  2XHC A;  2RHX A;  3L2Q A;  2L89 A;  2C06 A;  2KMT A;  4F7U F;  2K3Y A;  3PGG A;  4ZGJ B;  2NLU A;  2XKO C;  3HFO A;  5GAM f;  3S3N A;  1YI2 A;  3CBM A;  1UGS B;  3X28 B;  5FU7 B;  5GMK i;  1YIJ A;  2RM4 A;  2KAF A;  3CPW S;  2HD0 A;  4II1 A;  1YCY A;  3OBW A;  3RIR A;  1K73 C;  3ZEH A;  5D6W A;  3M9Q A;  4C5G A;  3LGL A;  5LJ5 j;  4M75 A;  3V7S A;  2JNG A;  2V8K A;  1QW1 A;  4XTX A;  2F5K A;  3UT1 A;  2ZPE B;  3L2Z A;  3BY7 A;  3PNW C;  1BKB A;  1DJ7 B;  5KE2 A;  3CXC S;  3PTA A;  5GAN 2;  1K73 U;  1LOJ A;  3QKJ A;  4F7U B;  1K8A U;  2JN0 A;  1VQM A;  4OGE A;  1D3B B;  3FEO A;  3OW2 S;  4EMK B;  2PUK B;  3PIO A;  2DVE A;  3J7A F;  1OZ3 A;  3TU4 K;  4QQG A;  5AYF A;  1VUB A;  2Y90 A;  1I5L A;  2YRV A;  3MCA B;  3BW1 A;  4LDU A;  1VQ5 A;  4FL6 A;  4TVR A;  3PIP A;  4JLI A;  4C5H A;  1JJ2 S;  2DAQ A;  4Q5W A;  1BI3 A;  3CBP A;  1VQP A;  4M7A D;  4A53 A;  3OS1 A;  5GAN 4;  3OB9 A;  3CD6 A;  5CKH A;  3OY9 A;  4J6W A;  4BI4 A;  2RK2 A;  3H6Z A;  2D9T A;  3QDR B;  3JB9 I;  1VQP T;  1QVP A;  2RI2 A;  4C8Q E;  2XDP A;  2DKG A;  3QBY A;  1M9S A;  1B34 B;  2GCX A;  4X9C A;  3G4S A;  1G3T A;  1G3Y A;  2QI2 A;  2JUF A;  3FDR A;  3MET A;  3H8Z A;  3V8J A;  4C0D B;  4E47 A;  1BYM A;  4OB1 B;  2CZ6 B;  3OS2 A;  3X24 B;  1S72 T;  4J6X A;  1MHN A;  3CCQ A;  3OA6 A;  4XU0 A;  4C92 A;  3HRT A;  3NTI A;  1KHI A;  2DZC A;  2CZ1 B;  2EFI A;  4C92 D;  4IUQ A;  2A7Y A;  4OB2 B;  4MZT A;  2DTO A;  1VQ6 A;  5GAN e;  1GXI E;  3HPW A;  2XI9 A;  4IUP A;  2P0K A;  1YJN T;  4HA8 A;  2RJE A;  3QPH A;  4ZTF A;  4HCZ A;  2VXF A;  2O4X B;  4DQ2 A;  2PVO B;  1Y71 A;  2QQS A;  3GPL A;  2MI6 A;  1KD1 C;  3CCU A;  3CMA A;  5HY6 A;  1KHC A;  5J3B A;  1YIJ T;  3RES A;  3MEA A;  1ZHI A;  3RKY A;  2QQB A;  4M77 B;  5IAY A;  4QVD A;  4RMO A;  3JCM J;  5GAN f;  2RB6 A;  2RI3 A;  2KK4 A;  3OQ5 A;  4C8Q C;  3V8K A;  3G6E T;  4FM4 B;  2JZ2 A;  2O4X A;  5GAM j;  3JB9 G;  3UDC A;  1M5Q 1;  1BIA A;  5GMK m;  5FU6 B;  1K9M U;  2X4J A;  2IVW A;  4KT0 E;  1Q82 U;  1UEB A;  4M7D G;  5LJ5 f;  1U1S A;  4VUB A;  2EJG A;  3VKI A;  4MMK A;  1WNL A;  3OMG A;  4IUR A;  4KBM B;  4M75 D;  4M75 F;  5GMK e;  1QP3 A;  3OW2 A;  2P4T A;  2VYT A;  3C4S A;  3TRE A;  2GFU A;  2M9U A;  4RG2 A;  4D6W A;  3CCE A;  3M5A A;  1KD1 U;  2XG8 D;  1O9S A;  2O01 E;  4XU1 A;  1MGQ A;  2DTH A;  1QVG A;  3QYG B;  1K9M C;  2HQX A;  4C0F A;  1YIT A;  3P8H A;  2VV5 A;  5C6S A;  4M75 G;  3VJP A;  1YJ9 T;  2JOY A;  4RCB A;  4OB3 B;  2RHY A;  4PJO D;  4BDY A;  4PJO A;  4JUV A;  4M7D D;  1YBY A;  2LDM A;  3CCJ A;  3OYE A;  2RA2 A;  1I8F A;  2ZCF B;  1VIE A;  3SDZ A;  2EQU A;  2E41 A;  4MZP A;  4PNO A;  3SWN B;  1VQO T;  2GFA A;  3JRZ A;  5GAN j;  3QXE B;  5A0D A;  4ZTJ A;  2WSC E;  3CCU T;  2K2V A;  3LYI A;  4MDX A;  3M58 A;  4MDW A;  1Q7Y C;  5LJ5 g;  2XDD A;  4KUL A;  3L2U A;  1W2B S;  2LC4 A;  3HP9 A;  1M90 C;  1Q81 U;  5CAI A;  3QO3 A;  2RD1 A;  3S3O A;  4IUV A;  4PKC C;  5EG2 A;  1N6A A;  4BD3 A;  1VIF A;  4PJO G;  2PQW A;  1JBM A;  4JRI A;  5LJ3 j;  3CCJ T;  3A5Z B;  3CC4 T;  2E70 A;  5CKE A;  5I21 A;  5GAN 6;  2OTL A;  4YTL A;  1V29 B;  5D6X A;  5I2M A;  4Y91 A;  3URG A;  2I2L A;  2EQJ A;  1XTD A;  1YJ9 A;  5A0L A;  2FHD A;  1PSE A;  5HK3 A;  1Y96 A;  2LT4 A;  3V8L A;  5LJ3 d;  4C5I A;  2B8A A;  4J5Y A;  4LDW A;  3VYG A;  1FX7 A;  4M78 C;  2KDS A;  2RJF A;  4M7A F;  2LRQ A;  5FLX E;  1H64 1;  3OYK A;  2H3J A;  5CQX A;  3CC7 T;  4C92 E;  5IN1 A;  3CCE T;  3DB3 A;  3QUI A;  2EKO A;  5A0G A;  5DLQ E;  3A8O B;  3CCV A;  1Q81 C;  2M16 A;  4LDV A;  2AHJ B;  4EMK C;  4NOY A;  3OYJ A;  3CCS A;  2X4W A;  2G3R A;  3OS0 A;  3JB9 D;  2HBP A;  5HKC A;  3SWN C;  2PVG B;  2BIV A;  1NPR A;  2E65 A;  2CS7 A;  2V8I A;  2X35 A;  5FRO A;  3RKX A;  3CME T;  4C8Q A;  2RJC A;  4BAC A;  2ZPF B;  2EJ9 A;  3TEE A;  2IG0 A;  4C92 B;  2K57 A;  5CR2 A;  3JCM f;  2JVV A;  5CCA A;  3CCR A;  1VQM T;  2DPP B;  2WSE E;  5KE3 A;  2L8D A;  2CZ7 B;  3EFS A;  1VQ8 A;  3Q1J A;  5LJ5 d;  2DTI A;  1QVF A;  1B34 A;  5LJ3 f;  3JB9 H;  3QSU A;  1JRI A;  2RK1 A;  4ZN1 A;  3HL8 A;  4RCC A;  4LDX A;  2D6F A;  4L59 A;  4PJO B;  1OI1 A;  4OGC A;  3JAM E;  3RMS A;  4CRI A;  4NS5 A;  3MEU A;  4C92 G;  5KCH A;  3E19 A;  5FU7 C;  4BE0 A;  4RKU E;  2EJF A;  3PMT A;  2PUO B;  3QII A;  3A8G B;  4QVZ A;  2EQK A;  4Z02 A;  3OYD A;  3LW5 E;  1Q82 C;  1VQ8 T;  4A4K A;  2MAM A;  4PJO F;  4HCC A;  1QVF S;  2EYQ A;  3JCM Q;  4M78 F;  4M7A C;  2EIF A;  3KUF A;  4F7U G;  3CCR T;  5HK0 A;  1LJO A;  2FYK A;  4FU6 A;  5LL6 S;  3CCQ T;  1JB0 E;  4J8O A;  1S72 A;  4KUD K;  4E7H A;  2MWP A;  5L8R E;  4C92 F;  3MP6 A;  3CME A;  2YLB A;  2LX9 A;  3SD4 A;  1PSF A;  2MMP A;  4E7I A;  1XOV A;  1Y7X A;  4JJN K;  2K4Y A;  4M7A G;  3CCS T;  3BDU A;  3JCM g;  2KVQ G;  3QJY A;  1G3W A;  2BUD A;  3CCM A;  2CGH A;  2R5M A;  1M8V A;  4EDU A;  4O5V A;  2LVM A;  3OSS C;  4M75 B;  5GAN 3;  3LWH A;  4C92 C;  4E7J A;  3M56 A;  3CC7 A;  3CD6 T;  2DXB A;  4M7A A;  1HK9 A;  3C95 A;  3MP8 A;  5GAN 7;  3FLG A;  1H3Z A;  1U1T A;  3JSC A;  1VQ4 T;  1YJW A;  4BI3 A;  4LDY A;  4J7F A;  1VQ5 T;  1WQ7 A;  2YLC A;  4M77 F;  1UGR B;  3T9N A;  2LCL A;  1WJQ A;  5GMK j;  1Q7Y U;  4FSX A;  2R57 A;  2BKD N;  3CPF A;  4M75 E;  4C0Z A;  3OYN A;  4M7D B;  1UB4 A;  4JRQ A;  3OYF A;  3P8B B;  3PT9 A;  2Y4X A;  3C12 A;  5GAN 8;  4NL2 A;  4BDZ A;  4HT9 A;  5C0M A;  1N9S A;  4A4F A;  4XTY A;  2F69 A;  4DOW A;  1VQ9 A;  3BDL A;  2KSS A;  3FC3 A;  2PVD B;  5GAO m;  4PJO E;  4OVA A;  2RI5 A;  1KC8 C;  2RO0 A;  4GY5 A;  1YHQ T;  1X75 C;  5GAO n;  3SWN A;  3VU3 C;  3JB9 F;  3P8D A;  1JJ2 A;  1XNI A;  2E6Z A;  2WAC A;  4WF2 A;  1Y07 A;  3MHX A;  1YI2 T;  1OZ2 A;  4M78 G;  2R5A A;  5GAM g;  2F5T X;  1RI0 A;  1N27 A;  2LNV A;  2OTJ T;  4M78 A;  3HFN A;  1WQW A;  1N8R U;  3TCJ A;  2KQW A;  2DXT A;  3DLL A;  1G5V A;  1QVG S;  3O8V A;  2M0O A;  3CC2 T;  4ELZ C;  3R6O A;  4N4H A;  3CXC A;  1VQN T;  4HT8 A;  4ATO A;  3G7Z A;  4PL6 A;  2K3X A;  3PFS A;  5LJ3 e;  3OBY A;  3C94 A;  4C8Q B;  3RUX A;  3GNF B;  3HRS A;  2L5Q A;  1BIB A;  3OSV A;  2ZZD A;  3L2V A;  2K5L A;  3M59 A;  4JS4 A;  1Q86 U;  3SFM A;  1NJI C;  4QVC A;  2E64 A;  2DXU A;  4QQD A;  4ELY C;  1X01 A;  3MEV A;  1KQ1 A;  3OYL A;  2DJZ A;  4E7K A;  3CC2 A;  3M57 A;  1VQN A;  2RHU A;  4J6Y A;  4PLI A;  5GAO l;  3VYH B;  4FT4 A;  5CKB A;  2RHI A;  3OMC A;  2HAX A;  3LLR A;  4IUU A;  4C8Q D;  1Q86 C;  3PMI A;  1WPY A;  4M78 B;  3L2R A;  3G6E A;  3HHT B;  4M77 D;  2QEX A;  5LJ3 g;  4HKE A;  1QP2 A;  4F7U E;  5I2S A;  5GAM h;  3X20 B;  4XTZ A;  1VQL A;  3CBO A;  1N9R A;  3N5B B;  2EAY A;  2ZPI B;  2P0P A;  5J39 A;  1KQ2 A;  2VGM A;  4XQ3 A;  3EAE A;  1BI0 A;  2DEQ A;  4A4E A;  4ZN3 A;  4BE1 A;  2MWO A;  3JCM W;  1YHQ A;  2DIQ A;  3LGF A;  5LJ5 h;  3CMA T;  3GF5 A;  3M53 A;  3EFR A;  3JCM b;  2PU9 B;  3I56 T;  1KC8 U;  4JLG A;  1NPP A;  2E1H A;  4N4G A;  3FRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...