5HKCA

Crystal structure of m. tuberculosis mazf-mt3 t52d-f62d mutant in complex with 8-mer rna
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
114
Chain Sequence
MVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNDALAAMPGNVDLPATTTRLPRDSVVNVTAIVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Endoribonuclease MazF6
publication title Crystal structure of M. tuberculosis MazF-mt3 T52D-F62D mutant in complex with 8-mer RNA
rcsb
source organism Mycobacterium tuberculosis (strain cdc 1551 / oshkosh)
total genus 28
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5hkcA00
4MZTA 4ELZC 3HPWA 2KMTA 5HKCA 5CCAA 5CK9A 2VUBA 5CR2A 1NE8A 5CQYA 3JRZA 4MDXA 4HKEA 2C06A 2MF2A 3NFCA 5CO7A 3TCJA 4ME7A 5HK3A 5CKHA 1UB4A 1M1FA 4MZMA 1VUBA 5CQXA 5CKEA 3JSCA 4MZPA 1X75C 4ELYC 3G7ZA 5CKDA 4VUBA 3VUBA 4OF1A 5CKBA 5DLOA 5CKFA 5HK0A
chains in the Genus database with same CATH superfamily
2BE9B 3NGPA 4N4HA 3QJYA 1UGSB 2DL5A 3AHUA 5GAOm 2K5IA 4ORZA 2QQBA 2QASA 2RK1A 3H8ZA 3SHWA 1Y7XA 1M2VB 2E6NA 1LCKA 1WHMA 1KD1R 1XTDA 4A4EA 3HKSA 4M7DF 3R6NA 3FJ5A 3CMAT 5HK0A 1Q95G 2K3XA 4LD9K 4ESRA 1M1GA 4OGEA 5GAOr 3RESA 3G6ET 1UDLA 1OPKA 1BI2A 9ATCB 2RHZA 1CKBA 2QQRA 3RNJA 2QXFA 4CC3A 1MMDA 4M77A 3OYMA 5DLOA 2KSSA 4J7FA 3I5SA 4C92B 4KGZB 3OB9A 2FRYA 5IXBA 4M78F 3JCMQ 1AVZC 2CZ0B 2AZSA 1AWXA 3M0UA 1WDXA 1AOJA 2QEXQ 3META 2RF0A 5CAIA 1F1BB 2QQSA 4A4HA 1HJDA 1QW1A 2MI6A 3MKDA 3JSCA 5L23A 3OW2A 1YI2A 1JO8A 2PUKB 4ZN1A 4HCZA 2V8JA 3TCJA 2E3IA 4OMPA 4QQ6A 2OTLA 5FW9A 2F5KA 1TWBA 1H641 2XDDA 3MO8A 2E4HA 4PJOG 4E7LA 3UATA 4J8OA 5KYUB 1PSFA 2JMAA 1RAGB 1WHJA 1I1JA 2HNIA 4Y92A 2MAMA 3OYLA 1VQ4T 1IB8A 1R0CB 1X6GA 4C5IA 2LT1A 3JCMV 1CKAA 3PNWC 1ZA1B 3EGXA 1MMGA 4M75D 1E6GA 1N8RR 3GF5A 2LNHB 3JCMP 2KXCA 1IHVA 1NZ9A 2A37A 3NTKA 3CPWA 1M1KU 2DTOA 1JU5C 2F5TX 1W6XA 2JTMA 1Q86C 3REAB 4BDYA 1X43A 1I5OB 1OEBA 1U1SA 1FX7A 3WXMB 4BB7A 3JCMe 2P0PA 1YJ9T 2KE9A 2GQVA 1WXBA 4E7SA 3CC2A 1KD1U 3QBYA 1BYMA 1Q7YU 3D7SB 2L5QA 3F70A 4FT2A 4IUPA 1MMNA 2YXYA 1IXDA 1VQ5T 2XHCA 2EJFA 1UGQB 3OW2S 4JJBA 1G2BA 2DD5A 2ZZDA 5J39A 1PRMC 3P8BB 4B6MA 4JZ4A 2DYIA 2FZCB 4J9EA 3I56T 2GCXA 3LGFA 3M0PA 1WQWA 2DBMA 2NLUA 4LUDA 1O75A 4LNPA 5CVIA 1B7TA 2E5KA 2KDSA 3TEEA 3A8HB 3OYBA 4FW2A 1X2QA 1Z9QA 2DF6A 1YIJA 5EC7A 1Z9ZA 2R5AA 2LX9A 1ZBJA 4AFSC 3E2UA 3GLXA 1UTIA 4BY6B 4JS4A 1Y07A 2KR3A 1T0JA 3UDCA 2L3QA 4FIBA 5A0GA 3LWHA 4RUGA 2EYZA 2DLPA 2HKQB 1PSEA 3L42A 1YHQA 1YP5A 1KQSP 2FZGB 4M78G 5GAOq 1VQOQ 4E7JA 2EQKA 2DX1A 2KGTA 2RI3A 1VQ8A 2O9VA 2RI5A 2JNGA 1WPYA 3PTAA 3CEYA 2G6FX 3OBWA 3J80E 1U5SA 5GJVB 4GLMA 2EFIA 4F04B 5DLQE 4Q5WA 2GF7A 3CCUQ 1FXXA 1D1CA 1PHTA 2E3HA 1VQLQ 4OMLA 4J9IA 3MP1A 1G3SA 4M75E 4XTUA 2VYTA 4OF1A 4EDUA 3L2WA 4IUQA 4F17A 2P0QA 4JLGA 1YI2T 1M2VA 1QWEA 4C0ZA 5C0MA 2LDMA 1RI9A 4LN2A 3CCQT 4QT7A 2CUBA 1VQPT 1M90R 1KQ1A 1XQHA 2ABLA 3SWNC 2CT4A 1K0XA 3P8DA 4WCIA 5AT1B 2ZPHB 3G7ZA 4J5YA 3RKYA 1K0SA 3RDVA 3KUFA 4XQ3A 1C1AA 2EKHA 4MZTA 5D6YA 1Q82C 2DRKA 1YJNQ 5GAMj 1B07A 2CSQA 4JRQA 3G4SQ 5LJ5d 3PIOA 1R8OB 2GTJA 1QKWA 2LQNA 3OYGA 4C92A 2JM9A 2DJQA 8ATCB 4RTYA 3OYAA 4JRPA 4NL2A 1ZUKA 2RM4A 3L2VA 1PNJA 3L1AA 2K2VA 1ZX6A 5GANd 2DXBA 3I9QA 2KROA 1NJIU 4X34A 2M9UA 4J83A 1QVGP 3SFMA 3VV0A 1PC0A 3ER0A 3U23A 1QP3A 1OI1A 1TS9A 1HD3A 5D6XA 4Y91A 1TH7A 1WXUA 4V2SA 1QP2A 2DEUA 2BE7D 2DJZA 5L8RE 1MUZA 3PIPA 4M77B 4RCCA 1KC8R 1ZSZA 4XTZA 2PZ1A 1SF9A 3CD6A 2YHTA 4KUIA 1VQNQ 2PVDB 3V8JA 2QGGA 3JV3A 2DZCA 2GBQA 2QTXA 2HSEB 3PT9A 3JCMf 2DM1A 1S72T 3C12A 2JXBA 3CBPA 1Y96A 4CC4B 3LLRA 2DIGA 2J6OA 1AT1B 5GAN4 3FRNA 2CGHA 1M30A 2HMAA 4NOYA 2YUOA 3M0QA 3HHTB 1PRLC 4HVWA 1FMWA 2AK5A 2KT8A 2RI2A 1M90U 1BK2A 1KK7A 1M5Q1 2RJEA 3EH2A 2KRMA 3L2QA 1PD1A 4LDUA 4OB1B 4IUTA 3TSWA 2YWWA 3EG2A 1UECA 3HSBA 1OV3A 5IH2A 1WI7A 2MYSA 2Z0WA 3OYFA 4J9GA 4M77D 1K8AR 3V7SA 4JZ3A 1VQ7T 3CCVQ 3QWYA 2ESWA 3H0IA 4ZGDB 7AT1B 1M3CA 2K2MA 1YITQ 3DB4A 4F7UA 2OAUA 4N0AA 4N4GA 4DEYA 4EMKC 2P4RA 3EAEA 2L0AA 3CC4Q 2JM8A 4C0GA 3LH5A 3OYJA 2E12A 5FRMA 1BB9A 2DTIA 2DILA 1SHFA 2BKDN 4J9DA 3CCMT 3CCRT 2AT1B 2JN0A 4JJDA 2EJGA 3G71A 3TVTA 2W0ZA 1JEGA 1RLPC 1GCQA 2QI2A 1K73R 2D6FA 1PKTA 4RTTA 3S3OA 1W2BP 1JQQA 5GAMe 2C0OA 4C5EA 3EG0A 1ZSGA 4M75C 3CC4A 1AD5A 3CCLA 2DXUA 3UA6A 2DL7A 4XK8E 1O9SA 2RQVA 4MDWA 4KGVB 2RJCA 3HRUA 3A98A 3VS6A 2CDTA 3PFSA 4P5NA 2KEAA 1LOJA 3JCMd 1NG2A 4BD3A 1VQ6A 1ZA2B 2LTOA 4AFUC 2DEQA 1EFNA 1WNLA 2K3BA 4PJOB 2CP5A 1QVFP 1VQ5Q 3OYNA 3PVQA 2RD1A 4E2FB 1YWOA 3QZ9B 4YTLA 5FWBA 1WGSA 2XKOC 2A08A 2F69A 2G3RA 2MF2A 4PLIA 3QWXX 2QG9B 4PNOA 2KRNA 3KXTA 2VV5A 3H9NA 3UA7A 3A1PA 1OZ2A 4D8DA 1X6BA 2L3SA 5I21A 5CKFA 4LDWA 1D0YA 1OZ3A 5FRNA 4M7AG 1AWJA 1WFWA 5CCAA 5GAN2 1K8AU 2FRWA 3LH0A 1M1KR 4LDXA 4DQ2A 4ME7A 3DLMA 3EGUA 1IGQA 4DBRA 3JB9D 1V29B 4QVCA 2CP2A 2CREA 1ZUUA 2EGEA 1UEBA 5GMKi 3EGDA 4KGXB 3CC7A 1JRIA 4FW1A 1Q7YR 4KH0B 2IIMA 2HL5C 4E6RA 5GMKl 1KFZA 2VXEA 1S1NA 4HCBA 5CR2A 2SEMA 3LYIA 4M75F 5J26A 2HKNA 1K9AA 3OYIA 1UE9A 2P4TA 1VUBA 5GAN3 4A4FA 2X4XA 2E70A 4C8QA 1VA7A 4FYYB 2EYXA 1WHHA 1GFCA 1VQ9T 1K73U 5GMKj 4M7AE 4OB0B 2KT1A 3OS0A 4FM4B 2WACA 4J9BA 4AG1C 2C06A 4M7DB 2CSIA 2EBPA 3CCST 2YUPA 4E47A 5GAMh 4IIMA 1BIBA 2K5FA 1NLOC 2KQWA 1NEGA 5KYXB 1Q81R 1RL2A 2MMPA 2FPFA 3QHSA 3CCQQ 1VQPQ 3M4YA 1OOTA 2J7IA 2YSQA 1G83A 2OJ2A 3VS3A 3BY7A 1VQMT 1UHFA 2RHYA 3QDRB 5CQXA 1ZLMA 4WTOB 2AKLA 1JBMA 1OPLA 2QEXA 1KJWA 2A28A 1QVPA 3QDFA 3HL8A 4ELYC 1ZSZB 2JOYA 2JJ9A 2E65A 2ZPFB 3VS2A 3X24B 1UJYA 1NM7A 2EGAA 4OB3B 3JCMW 1ZUYA 3SWNA 3VU3C 1D09B 2FZKB 2DKGA 2YT6A 3WVEB 2DVEA 1AZGB 1VYUA 3SEMA 2K9GA 2K79A 1J3TA 5CKEA 1G8XA 1T3LA 1V1CA 3SB2A 3M55A 1K1ZA 1YJWT 1X75C 1GBRA 1ZHIA 2Y4YA 5LJ3j 3JB9J 1Y96B 2XG8D 2EQIA 2X51A 1BBZA 1BKBA 4C92D 1M4ZA 1VIEA 2DL8A 2MCNA 5HKCA 4M7DD 1TUGB 3OW2P 2E41A 2X4WA 1YBYA 2YLCA 3QKJA 2QA4Q 2KBTA 1Y57A 3A5ZB 1K76A 2YDLA 2RHIA 1VQ6T 1U1TA 1LNXA 2KAFA 4J9HA 2DFUA 4KULA 2AZVA 2K7AA 5CKDA 1K9MU 2J05A 3BFMA 2RA2A 3M4GA 5GAMf 4E7ZA 3ASKA 5GAN7 3CMET 1SPKA 3CCJT 4JS5A 2H3JA 5FU7B 2QTVA 2VUBA 3EFOA 2FYKA 2XICA 1RAFB 1U06A 4C0DC 1UHCA 2VB6A 4X9DA 1E6HA 2ECZA 3NTHA 3UF4A 2YRVA 3QIIA 3CCEQ 2X3WD 2FB7A 3O8VA 1IO6A 4J7IA 2LT4A 4PJLA 2F2VA 1RACB 4PFPA 1D3BB 2K5LA 1GCPA 6AT1B 4LE9A 1UGRB 1JJ2P 1HXDA 4JJCA 4XTWA 4PJNA 4F7UB 1KQSA 1GXIE 2DRMA 4JPBW 5D7UA 2DTHA 2GNCA 3P8HA 3QPHA 1RI0A 1TUCA 1FMKA 1NJIR 2LMJA 1Q81U 1RAIB 4M75G 5C6SA 3CC7T 2DZ9A 3CXCP 2D0QB 2LJ0A 5IHNA 2RN8A 2LRQA 1M8VA 4PJOA 2VWFA 4ZGJB 3RIRA 4UC4A 5GAN6 4A4KA 3CPWS 2QYZA 3PMIA 2HSPA 2LX7A 1OX9A 2HDAA 4EMGA 2RO0A 1R77A 5IXFA 2ZPIB 2FL7A 2VC8A 4RTVA 3VJPA 2DIQA 1WJRA 2FPDA 5IN1A 3RBBB 1KIKA 3HFOA 3JAME 2A3LA 4JRIA 4TVRA 1WIEA 1VQ7Q 2V8IA 3IQLA 4M77C 3RMSA 2D8HA 2QDYB 2GFUA 3RKWA 3EHQA 5GMKe 1QMCA 3X28B 4HCKA 4AT1B 1B34A 2K57A 1SHGA 2L8DA 4NS5A 1TG0A 3I55Q 1KC8C 4FYWB 5GAMg 4PJMA 4OMFB 2EW3A 1C0MA 1H92A 1Q86R 3VRYA 3H0FA 3PMTA 4XU3A 2P84A 1MV3A 1VQOA 3RERA 3MEVA 5A0DA 5CQYA 4C92E 1TXQA 2V1QA 4MDXA 5KCHA 3ZFJA 3CCMQ 3CCRQ 3OSSC 4BE0A 1EX4A 2X4YA 5FLXE 1AEYA 2MK5A 4DBFA 4RCBA 1B3QA 2PQWA 1HYOA 2H3EB 2CT3A 2H8HA 4LDVA 1KQSS 2OTLT 2VKNA 4N4IA 3CCUA 2OTJQ 2C0IA 4M7AC 3I55A 2D0NA 1VQLA 5GAN5 4R56A 3OMCA 1T3SA 2NUZA 2JT4A 4BUGA 1M2OA 2LP5A 1JXMA 4RG2A 4XTYA 5DY9A 5GJWB 4K11A 4EPCA 5GAMd 4IURA 4A54A 2LQWA 2I0NA 4XTVA 4Y28E 2YLBA 3L2ZA 2A36A 2VXFA 4RTUA 1ABOA 5FU6B 3M5AA 3VS4A 1KQ2A 2B8AA 5CIUA 3OYHA 2LQ8A 2FEIA 1X6OA 3NTIA 2KNBB 4Z8AA 3X26B 2BIVA 5A2QE 4E7KA 1VQKQ 1W70A 4M7DA 2OTJA 1RUWA 5LJ3e 1VYVA 2ED0A 1H3HA 3EGDB 5LJ5j 2COWA 2MIOA 4JJNK 1YCSB 2AIRB 2XDPA 1YJNA 1BCOA 2OX7A 5KYXA 3G4SA 3VKIA 2ED1A 1TOVA 3UPUA 4QW2A 4PLLA 4AFZC 4MZPA 1I07A 1JXOA 3CC2T 2PNIA 5GMKm 1M3BA 1WHLA 1MNEA 3E1SA 2WSEE 1VQKA 4OMOA 3JB9H 5GANj 1BI3A 2O9SA 4M78A 4C8QB 2RQTA 3EH1A 3URGA 5HK3A 4CRIA 2E64A 2FO0A 1D1AA 3H6ZA 1W4SA 3PGGA 5HCKA 1XNIA 3OY9A 4FYXB 2EIFA 2LJ1A 3OS2A 1YFNA 4L5GA 3EG3A 4Z02A 1M3AA 1GL5A 3OS5A 5FROA 3MPUB 3L2RA 5GMKh 4EIKA 2D8JA 1BI0A 2EQUA 2KYBA 4M7AF 3CMAQ 4J9CA 1Q86U 1VQNA 1YIJT 1I8FA 3G6EQ 1N6AA 5IAYA 2YUNA 3HFNA 1KHCA 4FSXA 4BI8B 1ABQA 1AHJB 5CO7A 1WYXA 2O4XA 4F7UE 5KH6A 4KRTA 1NPRA 1VQ9Q 3SWNB 4DA4A 1FYNA 1YHQT 2K6DA 1FMVA 1WA7A 2X35A 3M54A 4D8KA 3G6EA 4PK4A 2L89A 4DBQA 4C8QD 2DXCA 4FU6A 1VQ8T 2RHUA 4QQGA 4E7IA 2A0FB 2L2PA 2DAQA 1UGVA 4FYVB 2YRDA 3OA6A 4RTXA 2MOXA 1D3BA 2DXTA 2XD0A 4ZTJA 1GFDA 3EHRA 1D0ZA 2DERA 1NYGA 1MHNA 1PKSA 2E5QA 1BI1A 5I2MA 1VQMQ 4EMHA 2M16A 1QCNA 4OB2B 5LJ3h 1VQOT 4RTWA 1UB4A 2OAWA 1M1FA 3GPLA 4O6JA 1M1KC 3O5ZA 3EFOB 3QYGB 3Q1JA 3CCVA 2KVQG 2JS2A 3CCUT 4BI3A 1VQ4Q 3RKXA 1VQLT 1YITA 3A8LB 2M02A 4RG8A 1KD1C 3HRSA 1YCYA 1OULA 2JS0A 1WQ7A 4DOVA 2MPXC 1Q7YC 5I11A 1QVFA 3OYDA 2COYA 4ATOA 1YJWQ 2QAZA 4LD6A 4MZMA 1EIFA 4BACA 2PVOB 1WJSA 2K3YA 3S6WA 2EQJA 3S3MA 1WLPB 3OYKA 4C92C 3LW5E 1YJ9Q 4RTZA 2PU9B 5CK9A 2KK4A 3NFCA 3INZA 4JDSA 3CPFA 5LJ5e 2DL4A 4M77G 1RAAB 5I22A 3GIBA 5EG2A 4MMKA 4ELZC 1X01A 5A0LA 2RNAA 4LXCA 2F2WA 2FPEA 3MHXA 2CH4W 4ZTFA 1G3WA 5GANe 4HA8A 1N9SA 4DEXA 3I56Q 4JLIA 1Q82U 1ZSZC 5LJ3f 3CD6T 1KHIA 1VQ5A 1B34B 5KCOA 4M4ZA 3ULRB 1YN8A 5DM7R 2O31A 1G3TA 2F2XA 2HBWA 2MWPA 4X1VA 1AWWA 2DO3A 1WHGA 1IGUA 1M8MA 1OU9A 2RHXA 2EYQA 2RPNA 4BDZA 4M77E 4J9FA 1ARKA 3BE3A 5FWCA 2DPPB 4IIOA 1QVFS 1XOVA 3CBOA 3I56A 1UG1A 3HTRA 2DNUA 3MEUA 3T9NA 2HEQA 3VUBA 2JMCA 1M9SA 5KYWB 1VQNT 1SKUB 2HBPA 1K9MR 1N8RC 4XU2A 3EG9A 2EAYA 3JCMJ 4GBQA 4EMKB 4L59A 1D1BA 3MP6A 2AHJB 3MEAA 1IHWA 4PJOD 2ZGWA 4LUEA 5J3BA 3JCMb 4C92F 1W1FA 1UFFA 2BZXA 1T0HA 1ZQ1A 5FU7C 4HCCA 2EQMA 3OYEA 1SEMA 4QQDA 1LJOA 3HP9A 4F16A 4CC2A 4HVVA 4J6XA 3CQTA 2IG0A 3VS0A 2O88A 2DVJA 3S3NA 5LL6S 4M75B 5AYFA 3EG1A 1YI2Q 5KYYA 1WX6A 3EFSA 3KBGA 4LDYA 1OQKA 1UUEA 3SDZA 4R55A 2KMTA 4N0AC 1QLYA 3M0SA 1RADB 2OTLQ 2LNVA 2J06A 1BU1A 5LJ3g 4WF2A 1AWOA 5LJ5h 4M78B 2JZ2A 2LCSA 4PFOA 2FVUA 1TTHB 1H3ZA 3LX7A 2P0KA 2RH2A 2M51A 3JB9G 1MV0B 3ZBDA 2CP6A 4AFQC 4BY6C 3CCVT 2DETA 3RMQA 4CC7A 1NJIC 3QZ5B 3G71T 2R5MA 1YITT 3QO3A 5IHKA 3L2UA 3CCQA 1G5VA 1VQPA 1QWFA 3REBB 4JUVA 1GCQC 2DK3A 4M7AA 3E19A 5GANh 2HD0A 3N5BB 4GY5A 4QVZA 1X2KA 3CC4T 3CCLT 2M1HA 3NHNA 1K4US 3TU4K 1FWZA 1AZEA 5LJ3d 2EVRA 1PM3A 3M57A 2EPDA 4JRKA 5ECAA 2ROLA 2YUQA 2L3RA 3CC2Q 2CYZB 1VOMA 4OMNA 1BCMA 3I5RA 1Y71A 3KFVA 2NWMA 2DBKA 3BW1A 2O4XB 1JJ2A 4KH1B 3H41A 3OYCA 3GP8A 3NMZC 2YRCA 2MWOA 4RMOA 2PVGB 4X9CA 4XTXA 2DD4A 1M27C 5GAN8 3MP8A 1HSQA 2BZ8A 2V1RA 4M78D 2QA4A 2XI9A 3CXCA 5KYNA 3J81E 1MNDA 4PJOE 1M90C 1S72Q 4IUVA 4XAXB 3FIFA 1TU0B 2RJFA 4F7UF 1XJWB 3V8KA 3OBYA 4DBHA 3LWIA 5LJ5f 3M53A 2AKKA 2VGNA 2A7YA 3GNFB 4IKFA 4QKUA 3CPWP 1UJ0A 4HXJA 3GBQA 2O2OA 2JTEA 4KBMB 2EKOA 2QDLA 5FU6C 4B9WA 1YIJQ 1C6VX 3X25B 3VYHB 3V7CA 2PTKA 3OS1A 3CCEA 2EGCA 2LZ6B 5D6WA 1S72A 2HQXA 2NUPA 1RAEB 5GANf 2ZCFB 2M0OA 1E7OA 1NE8A 3SD4A 2ATCB 4C92G 2LVMA 2LQKA 2NUTA 2X4JA 1NBEB 1YHQQ 4M7DG 3M0RA 4MMLA 4BE2A 1ACMB 4Z89A 1UGPB 2GQIA 2WSCE 2Y4XA 3J7AF 2OI3A 2HCKA 2DA9A 4ZNXA 4ZN3A 2CZ6B 1VQ8Q 4VUBA 4BI4A 3R6OA 1CSKA 2IVWA 2J6FA 1IRXA 1X69A 4C8QC 2HQHA 1JJ2S 4J6WA 2EJ9A 3X20B 1KG1A 2JTFA 2EWNA 3FB9A 2ENMA 1A0NB 2RJDA 2CUDA 3V8LA 1MMAA 3AT1B 3CBMA 3THKA 2E6ZA 4IUUA 4OMMA 3CXCS 2PUOB 2EYWA 3GNGA 1QKXA 2I2LA 2J6KA 1G3YA 4C5GA 3G1JA 2XIDA 1LPLA 4FCYA 3M59A 2CS7A 2DYBA 4F14A 1VQ7A 4XU1A 1X27A 1MGQA 4M7DE 2KYMA 1N8RU 5GAOl 5KYWA 3UT1A 5LJ5g 1V76A 4EMKA 2QEXT 3RR6A 4C5HA 2DL3A 3HPWA 1QCOA 2RQRA 2M0YA 2KRSA 1SSHA 2D1XA 1QVGA 4II1A 1BIAA 2LJ3A 3CCMA 3JCMh 4C0DB 3V7RA 4D6WA 3CCRA 2RQWA 4AMCA 4M78E 5GANg 2X9HA 3GOXA 3A8MB 4KUDK 2ZPGB 2VVKA 5KE3A 2RB6A 3ZEHA 1JB0E 4A63B 3QSUA 2X3XD 1SG5A 3NPFA 4HT9A 4M75A 4HKEA 2KY9A 2JUFA 1IREB 4O5VA 3VS5A 1GRIA 2XK0A 2LC4A 4L6V5 3FLGA 3EG9B 3VS1A 2LCCA 1K8AC 1YNZA 2QK0A 5I2SA 1RAHB 4Z88A 5IT9E 2XMFA 3EFRA 2O01E 1GBQA 2F1LA 4C8QF 3OYYA 2ZPEB 3C0CA 3QXEB 4M77F 4DOWA 3A8OB 4J6YA 4B9XA 1KSWA 1I4K1 4RKUE 4OVAA 3CD6Q 2DMOA 5M9OA 2BZYA 3TSZA 4F7UG 4PKCC 2HZYA 1I81A 2EYYA 2QA4T 2JW4A 3VUZA 4OGCA 1NLPC 8AT1B 2V8KA 2ZAEA 3DLLA 1I5LA 1PG5B 2GGRA 3M9QA 4QVDA 5KYYB 3JCMX 2BTTA 3I35A 1OYXA 4FL6A 1R0BG 2Y90A 1N5ZA 1TSFA 5KYUA 4PFZA 1K73C 2E1HA 4PL6A 3H0HA 1QCFA 1QVGS 1U3OA 3C95A 3A8GB 3DKMA 4FSSA 2BUDA 3CCET 4A53A 3MJXA 3ZL7C 1ZBXA 1VYTA 1QQJA 2V26A 2B86A 2XU8A 4PJOC 4CI0C 2CZ7B 4HVUA 2FHDA 3VYGA 1Q82R 3CMAA 3QG1A 1NEBA 3HRTA 4M7AB 4C0FA 1RLQC 2D9TA 2HL3A 3VRZA 3CCSQ 1WZOA 3QYHB 3E9FA 3JRZA 4BE1A 3VS7A 4FT4A 3BDLA 1RABB 5CKHA 2XDBA 2VASA 2GTOA 1N9RA 2RMOA 2HQEA 1PWTA 1VQ9A 3EGXB 2W10A 1SRMA 3RUXA 3JCMc 1W2BA 5IHIA 1P92A 3CCSA 2ROTA 4OMQA 4A4GA 1DJ7B 3E9GA 3BDUA 2ZPBB 4E7HA 5GAOp 3FEOA 3G71Q 1HK9A 2GFAA 2WSFE 3FJPA 5HY6A 3I55T 1WHKA 2R57A 2SRCA 1LVKA 3C94A 1VIFA 2C0TA 2QQAA 1VQMA 2RK2A 1K9MC 3LGLA 3UWNA 3JB9F 2CP3A 3CCLQ 2R58A 1NYFA 3JCMg 2FG0A 1IZ6A 2CZ1B 3JB9I 4NL3A 2NYSA 4M7AD 4R0KA 5CKBA 2CKKA 1Y0MA 1PD0A 2RQUA 1VQ6Q 4M7DC 2OTJT 3MEWA 1VQ4A 4PJOF 1KC8U 2L3PA 5GAOn 2IPOB 1U8RA 4OP0A 2COZA 2NUPB 4C8QG 4ANJA 1WJQA 2K4YA 1YJNT 1YJWA 2DE0X 2QGFB 4ZGEB 3G4ST 2CH4A 3C4SA 3CMEQ 3CCJQ 2NUTB 2JVVA 3M0TA 3OSVA 2KXDA 1YWPA 1SSFA 4PJJA 1Q81C 3OMGA 1VQKT 2E10A 1YJ9A 3M58A 1PCXA 1W2BS 4M78C 3WVDB 3FC3A 3QUIA 2KI7A 3DB3A 2CP0A 3M56A 2VGMA 5KE2A 3OQ5A 1D0XA 3CMEA 3CCJA 3TREA 3FDRA 1SRLA 2HAXA 2QQ9A 1N27A 2CP7A 4GLKA 2LCLA 3MCAB 4AG2C 1WXTA 3TQ7P 3ME9A 4C8QE 3PE0A 4HT8A 1EZZB 1OX8A 1NPPA 1OU8A 3CC7Q 1I0CA 1TUDA 3PVLA 4XU0A 1H8KA 3QJ6A 4KT0E
chains in the Genus database with same CATH topology
3GP8A 4BUGA 2MWOA 4RMOA 4N4HA 4RG2A 4XTYA 3QJYA 1UGSB 5DY9A 4EPCA 4IURA 2PVGB 4X9CA 4A54A 4M77D 4XTXA 5GAMd 3AHUA 5GAOm 2DD4A 5GAN8 3MP8A 3V7SA 2K5IA 4XTVA 4Y28E 2YLBA 2QQBA 3L2ZA 1VQ7T 2VXFA 4M78D 2RK1A 2XI9A 3H8ZA 3CXCA 2QA4A 5FU6B 3J81E 1Y7XA 2E6NA 4ZGDB 3M5AA 1KQ2A 4PJOE 2B8AA 5CIUA 3OYHA 2LQ8A 3NTIA 1X6OA 1M90C 1XTDA 3DB4A 4IUVA 2BIVA 3X26B 4A4EA 5A2QE 4E7KA 4XAXB 3FIFA 3HKSA 4F7UA 4M7DA 2RJFA 4M7DF 4F7UF 2OAUA 4N0AA 3V8KA 3OBYA 3CMAT 5HK0A 3LWIA 2K3XA 4N4GA 4EMKC 5LJ5f 3M53A 4LD9K 3EAEA 5LJ3e 2VGNA 1M1GA 2A7YA 3GNFB 4OGEA 5LJ5j 5GAOr 3RESA 4JJNK 3G6ET 4IKFA 2XDPA 1YJNA 4C0GA 1BI2A 3OYJA 2E12A 4KBMB 2EKOA 5FU6C 4B9WA 5FRMA 2DTIA 3G4SA 2BKDN 2RHZA 3VKIA 3VYHB 3X25B 2QQRA 3CCMT 3V7CA 3CCRT 3UPUA 2QXFA 4QW2A 2JN0A 4PLLA 4MZPA 2EJGA 3CC2T 3OS1A 3CCEA 5GMKm 5D6WA 3G71A 4M77A 3OYMA 1S72A 3E1SA 5DLOA 2HQXA 2KSSA 5GANf 2WSEE 4J7FA 1VQKA 4C92B 3JB9H 2ZCFB 2M0OA 3OB9A 5GANj 1BI3A 2QI2A 1NE8A 4M78A 2D6FA 3SD4A 4M78F 3JCMQ 4C92G 2LVMA 4C8QB 3S3OA 3URGA 2LQKA 2CZ0B 5HK3A 2X4JA 5GAMe 4M7DG 4C5EA 4MMLA 4CRIA 4BE2A 4M75C 2E64A 3META 3CC4A 3CCLA 5CAIA 1UGPB 2DXUA 2QQSA 2WSCE 4A4HA 3H6ZA 1W4SA 1QW1A 4XK8E 2MI6A 2Y4XA 3PGGA 1O9SA 3J7AF 3JSCA 4MDWA 4ZN3A 2CZ6B 1XNIA 3OY9A 4VUBA 2EIFA 4BI4A 3OS2A 2RJCA 3HRUA 3OW2A 3R6OA 1YI2A 2IVWA 4L5GA 4Z02A 4C8QC 3PFSA 2PUKB 4P5NA 4ZN1A 1JJ2S 1LOJA 4HCZA 3JCMd 4J6WA 2EJ9A 3X20B 3OS5A 2V8JA 1KG1A 2JTFA 4BD3A 5FROA 3TCJA 1VQ6A 2EWNA 2LTOA 3FB9A 2DEQA 3L2RA 1WNLA 4QQ6A 5GMKh 2OTLA 2RJDA 4PJOB 1BI0A 2EQUA 2F5KA 3V8LA 3OYNA 4M7AF 2RD1A 1H641 2XDDA 3MO8A 4PJOG 1Q86U 4E7LA 3QZ9B 3CBMA 4YTLA 1VQNA 2E6ZA 1YIJT 1I8FA 4IUUA 3CXCS 4J8OA 2PUOB 1WGSA 1N6AA 3GNGA 5IAYA 1PSFA 2I2LA 2XKOC 1G3YA 3HFNA 4C5GA 1KHCA 4FSXA 2XIDA 1N8RC 4BI8B 2HNIA 2CS7A 2F69A 1AHJB 2G3RA 3M59A 1VQ7A 2MAMA 2MF2A 4PLIA 4XU1A 5CO7A 3OYLA 1VQ4T 4PNOA 1MGQA 2O4XA 4C5IA 2LT1A 4F7UE 3KXTA 2VV5A 3JCMV 4M7DE 3PNWC 1N8RU 5GAOl 5KH6A 3UT1A 1NPRA 4M75D 3SWNB 4DA4A 5LJ5g 3GF5A 4EMKA 3JCMP 1YHQT 1OZ2A 1NZ9A 2QEXT 3NTKA 5I21A 5CKFA 2X35A 4LDWA 3CPWA 4C5HA 1OZ3A 1M1KU 2DTOA 5FRNA 3M54A 4M7AG 3HPWA 2F5TX 3G6EA 2JTMA 5CCAA 5GAN2 1Q86C 2L89A 3LH0A 4C8QD 2DXCA 4FU6A 4BDYA 1K8AU 1VQ8T 2RHUA 4LDXA 4DQ2A 1U1SA 4QQGA 4E7IA 4ME7A 1QVGA 1FX7A 2DAQA 3DLMA 3WXMB 4II1A 4BB7A 2P0PA 3JCMe 1YJ9T 1BIAA 3CCMA 3JCMh 4C0DB 3V7RA 4D6WA 3CCRA 3OA6A 3JB9D 1V29B 2GQVA 4QVCA 2OTJA 1D3BA 3CC2A 2DXTA 1KD1U 3QBYA 2XD0A 1BYMA 1Q7YU 1UEBA 4M78E 5GMKi 5GANg 3CC7A 4ZTJA 1JRIA 2L5QA 3GOXA 3A8MB 3F70A 4KUDK 2ZPGB 4FT2A 4IUPA 5KE3A 1MHNA 2RB6A 2E5QA 1BI1A 1VQ5T 5I2MA 3ZEHA 1JB0E 2XHCA 3QSUA 5GMKl 4EMHA 2EJFA 2M16A 2VXEA 4HCBA 5CR2A 1UGQB 4HT9A 4M75A 3LYIA 4HKEA 4OB2B 5LJ3h 4M75F 5J26A 3OW2S 1VQOT 2KY9A 2JUFA 1IREB 2DD5A 4O5VA 2ZZDA 2XK0A 1UB4A 3OYIA 1M1FA 2LC4A 4L6V5 4O6JA 3FLGA 3GPLA 1M1KC 2P4TA 1VUBA 2LCCA 5J39A 4A4FA 5GAN3 1K8AC 3P8BB 5I2SA 3QYGB 2X4XA 3Q1JA 3CCVA 2KVQG 2E70A 5IT9E 3EFRA 2O01E 4C8QA 3I56T 2GCXA 3CCUT 4C8QF 3LGFA 3OYYA 4BI3A 2ZPEB 3QXEB 3RKXA 1VQLT 1YITA 4M77F 3A8LB 1WQWA 4DOWA 1VQ9T 4RG8A 1K73U 2NLUA 3HRSA 4OB0B 1YCYA 5GMKj 3A8OB 1WQ7A 4DOVA 1Q7YC 4M7AE 1O75A 4J6YA 3OS0A 4B9XA 4FM4B 2WACA 5CVIA 1QVFA 3OYDA 2C06A 2KDSA 4ATOA 1I4K1 4RKUE 4M7DB 4OVAA 5M9OA 3CCST 4LD6A 4MZMA 3TEEA 3A8HB 4F7UG 3OYBA 1EIFA 4E47A 4BACA 4PKCC 5GAMh 2PVOB 1I81A 1YIJA 1WJSA 1BIBA 2QA4T 2K3YA 2R5AA 2LX9A 3S6WA 2EQJA 2K5FA 2KQWA 3S3MA 3VUZA 4OGCA 3GLXA 3OYKA 1RL2A 2MMPA 4C92C 3LW5E 4BY6B 2V8KA 3QHSA 4JS4A 1Y07A 3DLLA 2PU9B 3M4YA 3UDCA 5CK9A 1I5LA 2KK4A 4QVDA 3M9QA 3JCMX 3NFCA 1OYXA 4FIBA 3INZA 4FL6A 2Y90A 4JDSA 3BY7A 5A0GA 3CPFA 1VQMT 5LJ5e 3LWHA 4M77G 1K73C 2E1HA 4PL6A 1PSEA 2RHYA 3QDRB 5CQXA 3L42A 1YHQA 1QVGS 1JBMA 2QEXA 3GIBA 1QVPA 3C95A 4M78G 3HL8A 4ELYC 5EG2A 2JOYA 5GAOq 2E65A 3A8GB 3DKMA 2ZPFB 2BUDA 4E7JA 3CCET 2EQKA 3X24B 4A53A 4MMKA 2RI3A 4ELZC 2RI5A 1VQ8A 2JNGA 1WPYA 1X01A 3PTAA 3CEYA 3OBWA 4OB3B 5A0LA 1ZBXA 3J80E 3JCMW 3SWNA 3VU3C 2DKGA 3WVEB 2EFIA 2XU8A 3MHXA 3OYFA 1G3WA 2DVEA 5GANe 4ZTFA 4PJOC 5DLQE 2CZ7B 4CI0C 4HA8A 1N9SA 4Q5WA 2GF7A 2FHDA 3VYGA 1FXXA 4JLIA 5CKEA 1Q82U 3MP1A 3SB2A 5LJ3f 1G3SA 3M55A 1YJWT 1X75C 3CD6T 1KHIA 4M75E 4XTUA 1VQ5A 3CMAA 1B34B 1ZHIA 2Y4YA 5KCOA 5LJ3j 2VYTA 1Y96B 3QG1A 4OF1A 4EDUA 3JB9J 3HRTA 2XG8D 4M7AB 4C0FA 5DM7R 3L2WA 2D9TA 1G3TA 4IUQA 2P0QA 4JLGA 1BKBA 4C92D 1M4ZA 1VIEA 2MWPA 1YI2T 5HKCA 3QYHB 4M7DD 2DO3A 3E9FA 3JRZA 4BE1A 2E41A 2X4WA 1YBYA 4FT4A 4C0ZA 3BDLA 2YLCA 2RHXA 2LDMA 3QKJA 5C0MA 2EYQA 5CKHA 3A5ZB 3CCQT 2XDBA 1VQPT 2RHIA 1KQ1A 1XQHA 4BDZA 1VQ6T 4M77E 3SWNC 1QVFS 2DPPB 3P8DA 1U1TA 1LNXA 1XOVA 1N9RA 2KAFA 3CBOA 4KULA 3I56A 2ZPHB 2HQEA 3MEUA 3G7ZA 5CKDA 3T9NA 1K9MU 4J5YA 3BFMA 1VQ9A 3RKYA 3VUBA 1M9SA 1VQNT 2HBPA 2RA2A 3M4GA 3KUFA 4XQ3A 3RUXA 3JCMc 4MZTA 5D6YA 5GAMf 4XU2A 1W2BA 5GAN7 3ASKA 3CMET 1Q82C 1P92A 3CCJT 4JS5A 2EAYA 2H3JA 5FU7B 5GAMj 3JCMJ 2VUBA 4EMKB 2FYKA 4JRQA 2XICA 4L59A 3MP6A 2AHJB 3CCSA 5LJ5d 3PIOA 4C0DC 4A4GA 1R8OB 1DJ7B 4X9DA 3E9GA 3MEAA 3BDUA 2ZPBB 4PJOD 2ZGWA 3NTHA 2YRVA 3QIIA 4E7HA 5GAOp 3FEOA 5J3BA 3OYGA 3JCMb 2FB7A 4C92A 3O8VA 4C92F 4J7IA 2LT4A 1HK9A 2GFAA 2WSFE 3FJPA 1ZQ1A 5FU7C 5HY6A 1D3BB 2EQMA 3OYEA 4HCCA 3I55T 4QQDA 2K5LA 3OYAA 1LJOA 2R57A 3HP9A 3C94A 1UGRB 4NL2A 4JRPA 1VIFA 1HXDA 2RM4A 3L2VA 2QQAA 2K2VA 2RK2A 3L1AA 3LGLA 4XTWA 3UWNA 5GANd 1VQMA 1K9MC 3JB9F 2DXBA 4F7UB 4J6XA 1KQSA 1GXIE 2IG0A 2DTHA 3P8HA 1NJIU 3QPHA 4X34A 3S3NA 1RI0A 2R58A 2M9UA 5LL6S 4J83A 3SFMA 4M75B 3VV0A 5AYFA 3ER0A 3JCMg 4NL3A 1IZ6A 1QP3A 2CZ1B 3JB9I 1OI1A 1Q81U 5D6XA 4M75G 5C6SA 3EFSA 4M7AD 3CC7T 3KBGA 2DZ9A 2D0QB 4LDYA 5CKBA 2CKKA 1TH7A 4Y91A 3SDZA 1QP2A 4V2SA 4R55A 2OTJT 2KMTA 4M7DC 2LRQA 1M8VA 3MEWA 4PJOA 4N0AC 1VQ4A 4PJOF 4ZGJB 2DJZA 5L8RE 3RIRA 5GAOn 1KC8U 3PIPA 2LNVA 4UC4A 1U8RA 5GAN6 4OP0A 4M77B 4RCCA 4A4KA 3CPWS 4C8QG 3PMIA 4XTZA 5LJ3g 4WF2A 4EMGA 1WJQA 2K4YA 1YJNT 2RO0A 2YHTA 4KUIA 5LJ5h 1YJWA 2PVDB 3CD6A 4M78B 2JZ2A 2ZPIB 2FL7A 2FVUA 3V8JA 4ZGEB 3LX7A 2P0KA 2VC8A 3G4ST 3C4SA 1H3ZA 2RH2A 2DIQA 3VJPA 3JB9G 1WJRA 3ZBDA 5IN1A 3CCVT 2DZCA 4BY6C 2JVVA 3RMQA 3HFOA 2QTXA 1NJIC 3PT9A 3JAME 2A3LA 4JRIA 3QZ5B 4TVRA 3JCMf 3OSVA 3G71T 2V8IA 2R5MA 1S72T 1YITT 1SSFA 4M77C 3C12A 3RMSA 1Q81C 3OMGA 3QO3A 3L2UA 3CCQA 1VQKT 1VQPA 1G5VA 2E10A 1YJ9A 3M58A 2QDYB 2GFUA 3RKWA 1W2BS 5GMKe 3X28B 4JUVA 1B34A 2K57A 3CBPA 4M78C 3WVDB 2DK3A 1Y96A 3FC3A 1KD1C 4M7AA 3E19A 3QUIA 2L8DA 4NS5A 2HD0A 3DB3A 5GANh 3N5BB 4GY5A 4QVZA 1KC8C 3M56A 3CC4T 2VGMA 5GAMg 5KE2A 3CCLT 3LLRA 2DIGA 2M1HA 3OQ5A 4OMFB 5GAN4 3TU4K 3FRNA 1FWZA 2CGHA 3CMEA 3CCJA 3TREA 5LJ3d 3FDRA 4NOYA 3M57A 3PMTA 2HAXA 4JRKA 2QQ9A 4XU3A 1N27A 3HHTB 4GLKA 2LCLA 3RERA 1VQOA 3MCAB 3MEVA 5A0DA 5CQYA 4C92E 4MDXA 5KCHA 3ZFJA 2L3RA 2RI2A 3OSSC 5FLXE 2X4YA 4BE0A 1M90U 2CYZB 3ME9A 4C8QE 4RCBA 2PQWA 4HT8A 1NPPA 1M5Q1 1Y71A 2RJEA 3L2QA 4LDVA 1KQSS 2OTLT 3BW1A 4N4IA 4LDUA 3CCUA 4OB1B 4IUTA 3I55A 4M7AC 2O4XB 1JJ2A 1VQLA 4XU0A 5GAN5 3HSBA 4R56A 3QJ6A 4KT0E 3OMCA 3OYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MZT A;  4ELZ C;  3HPW A;  2KMT A;  5HKC A;  5CCA A;  5CK9 A;  2VUB A;  5CR2 A;  1NE8 A;  5CQY A;  3JRZ A;  4MDX A;  4HKE A;  2C06 A;  2MF2 A;  3NFC A;  5CO7 A;  3TCJ A;  4ME7 A;  5HK3 A;  5CKH A;  1UB4 A;  1M1F A;  4MZM A;  1VUB A;  5CQX A;  5CKE A;  3JSC A;  4MZP A;  1X75 C;  4ELY C;  3G7Z A;  5CKD A;  4VUB A;  3VUB A;  4OF1 A;  5CKB A;  5DLO A;  5CKF A;  5HK0 A; 
#chains in the Genus database with same CATH topology
 2BE9 B;  3NGP A;  4N4H A;  3QJY A;  1UGS B;  2DL5 A;  3AHU A;  5GAO m;  2K5I A;  4ORZ A;  2QQB A;  2QAS A;  2RK1 A;  3H8Z A;  3SHW A;  1Y7X A;  1M2V B;  2E6N A;  1LCK A;  1WHM A;  1KD1 R;  1XTD A;  4A4E A;  3HKS A;  4M7D F;  3R6N A;  3FJ5 A;  3CMA T;  5HK0 A;  1Q95 G;  2K3X A;  4LD9 K;  4ESR A;  1M1G A;  4OGE A;  5GAO r;  3RES A;  3G6E T;  1UDL A;  1OPK A;  1BI2 A;  9ATC B;  2RHZ A;  1CKB A;  2QQR A;  3RNJ A;  2QXF A;  4CC3 A;  1MMD A;  4M77 A;  3OYM A;  5DLO A;  2KSS A;  4J7F A;  3I5S A;  4C92 B;  4KGZ B;  3OB9 A;  2FRY A;  5IXB A;  4M78 F;  3JCM Q;  1AVZ C;  2CZ0 B;  2AZS A;  1AWX A;  3M0U A;  1WDX A;  1AOJ A;  2QEX Q;  3MET A;  2RF0 A;  5CAI A;  1F1B B;  2QQS A;  4A4H A;  1HJD A;  1QW1 A;  2MI6 A;  3MKD A;  3JSC A;  5L23 A;  3OW2 A;  1YI2 A;  1JO8 A;  2PUK B;  4ZN1 A;  4HCZ A;  2V8J A;  3TCJ A;  2E3I A;  4OMP A;  4QQ6 A;  2OTL A;  5FW9 A;  2F5K A;  1TWB A;  1H64 1;  2XDD A;  3MO8 A;  2E4H A;  4PJO G;  4E7L A;  3UAT A;  4J8O A;  5KYU B;  1PSF A;  2JMA A;  1RAG B;  1WHJ A;  1I1J A;  2HNI A;  4Y92 A;  2MAM A;  3OYL A;  1VQ4 T;  1IB8 A;  1R0C B;  1X6G A;  4C5I A;  2LT1 A;  3JCM V;  1CKA A;  3PNW C;  1ZA1 B;  3EGX A;  1MMG A;  4M75 D;  1E6G A;  1N8R R;  3GF5 A;  2LNH B;  3JCM P;  2KXC A;  1IHV A;  1NZ9 A;  2A37 A;  3NTK A;  3CPW A;  1M1K U;  2DTO A;  1JU5 C;  2F5T X;  1W6X A;  2JTM A;  1Q86 C;  3REA B;  4BDY A;  1X43 A;  1I5O B;  1OEB A;  1U1S A;  1FX7 A;  3WXM B;  4BB7 A;  3JCM e;  2P0P A;  1YJ9 T;  2KE9 A;  2GQV A;  1WXB A;  4E7S A;  3CC2 A;  1KD1 U;  3QBY A;  1BYM A;  1Q7Y U;  3D7S B;  2L5Q A;  3F70 A;  4FT2 A;  4IUP A;  1MMN A;  2YXY A;  1IXD A;  1VQ5 T;  2XHC A;  2EJF A;  1UGQ B;  3OW2 S;  4JJB A;  1G2B A;  2DD5 A;  2ZZD A;  5J39 A;  1PRM C;  3P8B B;  4B6M A;  4JZ4 A;  2DYI A;  2FZC B;  4J9E A;  3I56 T;  2GCX A;  3LGF A;  3M0P A;  1WQW A;  2DBM A;  2NLU A;  4LUD A;  1O75 A;  4LNP A;  5CVI A;  1B7T A;  2E5K A;  2KDS A;  3TEE A;  3A8H B;  3OYB A;  4FW2 A;  1X2Q A;  1Z9Q A;  2DF6 A;  1YIJ A;  5EC7 A;  1Z9Z A;  2R5A A;  2LX9 A;  1ZBJ A;  4AFS C;  3E2U A;  3GLX A;  1UTI A;  4BY6 B;  4JS4 A;  1Y07 A;  2KR3 A;  1T0J A;  3UDC A;  2L3Q A;  4FIB A;  5A0G A;  3LWH A;  4RUG A;  2EYZ A;  2DLP A;  2HKQ B;  1PSE A;  3L42 A;  1YHQ A;  1YP5 A;  1KQS P;  2FZG B;  4M78 G;  5GAO q;  1VQO Q;  4E7J A;  2EQK A;  2DX1 A;  2KGT A;  2RI3 A;  1VQ8 A;  2O9V A;  2RI5 A;  2JNG A;  1WPY A;  3PTA A;  3CEY A;  2G6F X;  3OBW A;  3J80 E;  1U5S A;  5GJV B;  4GLM A;  2EFI A;  4F04 B;  5DLQ E;  4Q5W A;  2GF7 A;  3CCU Q;  1FXX A;  1D1C A;  1PHT A;  2E3H A;  1VQL Q;  4OML A;  4J9I A;  3MP1 A;  1G3S A;  4M75 E;  4XTU A;  2VYT A;  4OF1 A;  4EDU A;  3L2W A;  4IUQ A;  4F17 A;  2P0Q A;  4JLG A;  1YI2 T;  1M2V A;  1QWE A;  4C0Z A;  5C0M A;  2LDM A;  1RI9 A;  4LN2 A;  3CCQ T;  4QT7 A;  2CUB A;  1VQP T;  1M90 R;  1KQ1 A;  1XQH A;  2ABL A;  3SWN C;  2CT4 A;  1K0X A;  3P8D A;  4WCI A;  5AT1 B;  2ZPH B;  3G7Z A;  4J5Y A;  3RKY A;  1K0S A;  3RDV A;  3KUF A;  4XQ3 A;  1C1A A;  2EKH A;  4MZT A;  5D6Y A;  1Q82 C;  2DRK A;  1YJN Q;  5GAM j;  1B07 A;  2CSQ A;  4JRQ A;  3G4S Q;  5LJ5 d;  3PIO A;  1R8O B;  2GTJ A;  1QKW A;  2LQN A;  3OYG A;  4C92 A;  2JM9 A;  2DJQ A;  8ATC B;  4RTY A;  3OYA A;  4JRP A;  4NL2 A;  1ZUK A;  2RM4 A;  3L2V A;  1PNJ A;  3L1A A;  2K2V A;  1ZX6 A;  5GAN d;  2DXB A;  3I9Q A;  2KRO A;  1NJI U;  4X34 A;  2M9U A;  4J83 A;  1QVG P;  3SFM A;  3VV0 A;  1PC0 A;  3ER0 A;  3U23 A;  1QP3 A;  1OI1 A;  1TS9 A;  1HD3 A;  5D6X A;  4Y91 A;  1TH7 A;  1WXU A;  4V2S A;  1QP2 A;  2DEU A;  2BE7 D;  2DJZ A;  5L8R E;  1MUZ A;  3PIP A;  4M77 B;  4RCC A;  1KC8 R;  1ZSZ A;  4XTZ A;  2PZ1 A;  1SF9 A;  3CD6 A;  2YHT A;  4KUI A;  1VQN Q;  2PVD B;  3V8J A;  2QGG A;  3JV3 A;  2DZC A;  2GBQ A;  2QTX A;  2HSE B;  3PT9 A;  3JCM f;  2DM1 A;  1S72 T;  3C12 A;  2JXB A;  3CBP A;  1Y96 A;  4CC4 B;  3LLR A;  2DIG A;  2J6O A;  1AT1 B;  5GAN 4;  3FRN A;  2CGH A;  1M30 A;  2HMA A;  4NOY A;  2YUO A;  3M0Q A;  3HHT B;  1PRL C;  4HVW A;  1FMW A;  2AK5 A;  2KT8 A;  2RI2 A;  1M90 U;  1BK2 A;  1KK7 A;  1M5Q 1;  2RJE A;  3EH2 A;  2KRM A;  3L2Q A;  1PD1 A;  4LDU A;  4OB1 B;  4IUT A;  3TSW A;  2YWW A;  3EG2 A;  1UEC A;  3HSB A;  1OV3 A;  5IH2 A;  1WI7 A;  2MYS A;  2Z0W A;  3OYF A;  4J9G A;  4M77 D;  1K8A R;  3V7S A;  4JZ3 A;  1VQ7 T;  3CCV Q;  3QWY A;  2ESW A;  3H0I A;  4ZGD B;  7AT1 B;  1M3C A;  2K2M A;  1YIT Q;  3DB4 A;  4F7U A;  2OAU A;  4N0A A;  4N4G A;  4DEY A;  4EMK C;  2P4R A;  3EAE A;  2L0A A;  3CC4 Q;  2JM8 A;  4C0G A;  3LH5 A;  3OYJ A;  2E12 A;  5FRM A;  1BB9 A;  2DTI A;  2DIL A;  1SHF A;  2BKD N;  4J9D A;  3CCM T;  3CCR T;  2AT1 B;  2JN0 A;  4JJD A;  2EJG A;  3G71 A;  3TVT A;  2W0Z A;  1JEG A;  1RLP C;  1GCQ A;  2QI2 A;  1K73 R;  2D6F A;  1PKT A;  4RTT A;  3S3O A;  1W2B P;  1JQQ A;  5GAM e;  2C0O A;  4C5E A;  3EG0 A;  1ZSG A;  4M75 C;  3CC4 A;  1AD5 A;  3CCL A;  2DXU A;  3UA6 A;  2DL7 A;  4XK8 E;  1O9S A;  2RQV A;  4MDW A;  4KGV B;  2RJC A;  3HRU A;  3A98 A;  3VS6 A;  2CDT A;  3PFS A;  4P5N A;  2KEA A;  1LOJ A;  3JCM d;  1NG2 A;  4BD3 A;  1VQ6 A;  1ZA2 B;  2LTO A;  4AFU C;  2DEQ A;  1EFN A;  1WNL A;  2K3B A;  4PJO B;  2CP5 A;  1QVF P;  1VQ5 Q;  3OYN A;  3PVQ A;  2RD1 A;  4E2F B;  1YWO A;  3QZ9 B;  4YTL A;  5FWB A;  1WGS A;  2XKO C;  2A08 A;  2F69 A;  2G3R A;  2MF2 A;  4PLI A;  3QWX X;  2QG9 B;  4PNO A;  2KRN A;  3KXT A;  2VV5 A;  3H9N A;  3UA7 A;  3A1P A;  1OZ2 A;  4D8D A;  1X6B A;  2L3S A;  5I21 A;  5CKF A;  4LDW A;  1D0Y A;  1OZ3 A;  5FRN A;  4M7A G;  1AWJ A;  1WFW A;  5CCA A;  5GAN 2;  1K8A U;  2FRW A;  3LH0 A;  1M1K R;  4LDX A;  4DQ2 A;  4ME7 A;  3DLM A;  3EGU A;  1IGQ A;  4DBR A;  3JB9 D;  1V29 B;  4QVC A;  2CP2 A;  2CRE A;  1ZUU A;  2EGE A;  1UEB A;  5GMK i;  3EGD A;  4KGX B;  3CC7 A;  1JRI A;  4FW1 A;  1Q7Y R;  4KH0 B;  2IIM A;  2HL5 C;  4E6R A;  5GMK l;  1KFZ A;  2VXE A;  1S1N A;  4HCB A;  5CR2 A;  2SEM A;  3LYI A;  4M75 F;  5J26 A;  2HKN A;  1K9A A;  3OYI A;  1UE9 A;  2P4T A;  1VUB A;  5GAN 3;  4A4F A;  2X4X A;  2E70 A;  4C8Q A;  1VA7 A;  4FYY B;  2EYX A;  1WHH A;  1GFC A;  1VQ9 T;  1K73 U;  5GMK j;  4M7A E;  4OB0 B;  2KT1 A;  3OS0 A;  4FM4 B;  2WAC A;  4J9B A;  4AG1 C;  2C06 A;  4M7D B;  2CSI A;  2EBP A;  3CCS T;  2YUP A;  4E47 A;  5GAM h;  4IIM A;  1BIB A;  2K5F A;  1NLO C;  2KQW A;  1NEG A;  5KYX B;  1Q81 R;  1RL2 A;  2MMP A;  2FPF A;  3QHS A;  3CCQ Q;  1VQP Q;  3M4Y A;  1OOT A;  2J7I A;  2YSQ A;  1G83 A;  2OJ2 A;  3VS3 A;  3BY7 A;  1VQM T;  1UHF A;  2RHY A;  3QDR B;  5CQX A;  1ZLM A;  4WTO B;  2AKL A;  1JBM A;  1OPL A;  2QEX A;  1KJW A;  2A28 A;  1QVP A;  3QDF A;  3HL8 A;  4ELY C;  1ZSZ B;  2JOY A;  2JJ9 A;  2E65 A;  2ZPF B;  3VS2 A;  3X24 B;  1UJY A;  1NM7 A;  2EGA A;  4OB3 B;  3JCM W;  1ZUY A;  3SWN A;  3VU3 C;  1D09 B;  2FZK B;  2DKG A;  2YT6 A;  3WVE B;  2DVE A;  1AZG B;  1VYU A;  3SEM A;  2K9G A;  2K79 A;  1J3T A;  5CKE A;  1G8X A;  1T3L A;  1V1C A;  3SB2 A;  3M55 A;  1K1Z A;  1YJW T;  1X75 C;  1GBR A;  1ZHI A;  2Y4Y A;  5LJ3 j;  3JB9 J;  1Y96 B;  2XG8 D;  2EQI A;  2X51 A;  1BBZ A;  1BKB A;  4C92 D;  1M4Z A;  1VIE A;  2DL8 A;  2MCN A;  5HKC A;  4M7D D;  1TUG B;  3OW2 P;  2E41 A;  2X4W A;  1YBY A;  2YLC A;  3QKJ A;  2QA4 Q;  2KBT A;  1Y57 A;  3A5Z B;  1K76 A;  2YDL A;  2RHI A;  1VQ6 T;  1U1T A;  1LNX A;  2KAF A;  4J9H A;  2DFU A;  4KUL A;  2AZV A;  2K7A A;  5CKD A;  1K9M U;  2J05 A;  3BFM A;  2RA2 A;  3M4G A;  5GAM f;  4E7Z A;  3ASK A;  5GAN 7;  3CME T;  1SPK A;  3CCJ T;  4JS5 A;  2H3J A;  5FU7 B;  2QTV A;  2VUB A;  3EFO A;  2FYK A;  2XIC A;  1RAF B;  1U06 A;  4C0D C;  1UHC A;  2VB6 A;  4X9D A;  1E6H A;  2ECZ A;  3NTH A;  3UF4 A;  2YRV A;  3QII A;  3CCE Q;  2X3W D;  2FB7 A;  3O8V A;  1IO6 A;  4J7I A;  2LT4 A;  4PJL A;  2F2V A;  1RAC B;  4PFP A;  1D3B B;  2K5L A;  1GCP A;  6AT1 B;  4LE9 A;  1UGR B;  1JJ2 P;  1HXD A;  4JJC A;  4XTW A;  4PJN A;  4F7U B;  1KQS A;  1GXI E;  2DRM A;  4JPB W;  5D7U A;  2DTH A;  2GNC A;  3P8H A;  3QPH A;  1RI0 A;  1TUC A;  1FMK A;  1NJI R;  2LMJ A;  1Q81 U;  1RAI B;  4M75 G;  5C6S A;  3CC7 T;  2DZ9 A;  3CXC P;  2D0Q B;  2LJ0 A;  5IHN A;  2RN8 A;  2LRQ A;  1M8V A;  4PJO A;  2VWF A;  4ZGJ B;  3RIR A;  4UC4 A;  5GAN 6;  4A4K A;  3CPW S;  2QYZ A;  3PMI A;  2HSP A;  2LX7 A;  1OX9 A;  2HDA A;  4EMG A;  2RO0 A;  1R77 A;  5IXF A;  2ZPI B;  2FL7 A;  2VC8 A;  4RTV A;  3VJP A;  2DIQ A;  1WJR A;  2FPD A;  5IN1 A;  3RBB B;  1KIK A;  3HFO A;  3JAM E;  2A3L A;  4JRI A;  4TVR A;  1WIE A;  1VQ7 Q;  2V8I A;  3IQL A;  4M77 C;  3RMS A;  2D8H A;  2QDY B;  2GFU A;  3RKW A;  3EHQ A;  5GMK e;  1QMC A;  3X28 B;  4HCK A;  4AT1 B;  1B34 A;  2K57 A;  1SHG A;  2L8D A;  4NS5 A;  1TG0 A;  3I55 Q;  1KC8 C;  4FYW B;  5GAM g;  4PJM A;  4OMF B;  2EW3 A;  1C0M A;  1H92 A;  1Q86 R;  3VRY A;  3H0F A;  3PMT A;  4XU3 A;  2P84 A;  1MV3 A;  1VQO A;  3RER A;  3MEV A;  5A0D A;  5CQY A;  4C92 E;  1TXQ A;  2V1Q A;  4MDX A;  5KCH A;  3ZFJ A;  3CCM Q;  3CCR Q;  3OSS C;  4BE0 A;  1EX4 A;  2X4Y A;  5FLX E;  1AEY A;  2MK5 A;  4DBF A;  4RCB A;  1B3Q A;  2PQW A;  1HYO A;  2H3E B;  2CT3 A;  2H8H A;  4LDV A;  1KQS S;  2OTL T;  2VKN A;  4N4I A;  3CCU A;  2OTJ Q;  2C0I A;  4M7A C;  3I55 A;  2D0N A;  1VQL A;  5GAN 5;  4R56 A;  3OMC A;  1T3S A;  2NUZ A;  2JT4 A;  4BUG A;  1M2O A;  2LP5 A;  1JXM A;  4RG2 A;  4XTY A;  5DY9 A;  5GJW B;  4K11 A;  4EPC A;  5GAM d;  4IUR A;  4A54 A;  2LQW A;  2I0N A;  4XTV A;  4Y28 E;  2YLB A;  3L2Z A;  2A36 A;  2VXF A;  4RTU A;  1ABO A;  5FU6 B;  3M5A A;  3VS4 A;  1KQ2 A;  2B8A A;  5CIU A;  3OYH A;  2LQ8 A;  2FEI A;  1X6O A;  3NTI A;  2KNB B;  4Z8A A;  3X26 B;  2BIV A;  5A2Q E;  4E7K A;  1VQK Q;  1W70 A;  4M7D A;  2OTJ A;  1RUW A;  5LJ3 e;  1VYV A;  2ED0 A;  1H3H A;  3EGD B;  5LJ5 j;  2COW A;  2MIO A;  4JJN K;  1YCS B;  2AIR B;  2XDP A;  1YJN A;  1BCO A;  2OX7 A;  5KYX A;  3G4S A;  3VKI A;  2ED1 A;  1TOV A;  3UPU A;  4QW2 A;  4PLL A;  4AFZ C;  4MZP A;  1I07 A;  1JXO A;  3CC2 T;  2PNI A;  5GMK m;  1M3B A;  1WHL A;  1MNE A;  3E1S A;  2WSE E;  1VQK A;  4OMO A;  3JB9 H;  5GAN j;  1BI3 A;  2O9S A;  4M78 A;  4C8Q B;  2RQT A;  3EH1 A;  3URG A;  5HK3 A;  4CRI A;  2E64 A;  2FO0 A;  1D1A A;  3H6Z A;  1W4S A;  3PGG A;  5HCK A;  1XNI A;  3OY9 A;  4FYX B;  2EIF A;  2LJ1 A;  3OS2 A;  1YFN A;  4L5G A;  3EG3 A;  4Z02 A;  1M3A A;  1GL5 A;  3OS5 A;  5FRO A;  3MPU B;  3L2R A;  5GMK h;  4EIK A;  2D8J A;  1BI0 A;  2EQU A;  2KYB A;  4M7A F;  3CMA Q;  4J9C A;  1Q86 U;  1VQN A;  1YIJ T;  1I8F A;  3G6E Q;  1N6A A;  5IAY A;  2YUN A;  3HFN A;  1KHC A;  4FSX A;  4BI8 B;  1ABQ A;  1AHJ B;  5CO7 A;  1WYX A;  2O4X A;  4F7U E;  5KH6 A;  4KRT A;  1NPR A;  1VQ9 Q;  3SWN B;  4DA4 A;  1FYN A;  1YHQ T;  2K6D A;  1FMV A;  1WA7 A;  2X35 A;  3M54 A;  4D8K A;  3G6E A;  4PK4 A;  2L89 A;  4DBQ A;  4C8Q D;  2DXC A;  4FU6 A;  1VQ8 T;  2RHU A;  4QQG A;  4E7I A;  2A0F B;  2L2P A;  2DAQ A;  1UGV A;  4FYV B;  2YRD A;  3OA6 A;  4RTX A;  2MOX A;  1D3B A;  2DXT A;  2XD0 A;  4ZTJ A;  1GFD A;  3EHR A;  1D0Z A;  2DER A;  1NYG A;  1MHN A;  1PKS A;  2E5Q A;  1BI1 A;  5I2M A;  1VQM Q;  4EMH A;  2M16 A;  1QCN A;  4OB2 B;  5LJ3 h;  1VQO T;  4RTW A;  1UB4 A;  2OAW A;  1M1F A;  3GPL A;  4O6J A;  1M1K C;  3O5Z A;  3EFO B;  3QYG B;  3Q1J A;  3CCV A;  2KVQ G;  2JS2 A;  3CCU T;  4BI3 A;  1VQ4 Q;  3RKX A;  1VQL T;  1YIT A;  3A8L B;  2M02 A;  4RG8 A;  1KD1 C;  3HRS A;  1YCY A;  1OUL A;  2JS0 A;  1WQ7 A;  4DOV A;  2MPX C;  1Q7Y C;  5I11 A;  1QVF A;  3OYD A;  2COY A;  4ATO A;  1YJW Q;  2QAZ A;  4LD6 A;  4MZM A;  1EIF A;  4BAC A;  2PVO B;  1WJS A;  2K3Y A;  3S6W A;  2EQJ A;  3S3M A;  1WLP B;  3OYK A;  4C92 C;  3LW5 E;  1YJ9 Q;  4RTZ A;  2PU9 B;  5CK9 A;  2KK4 A;  3NFC A;  3INZ A;  4JDS A;  3CPF A;  5LJ5 e;  2DL4 A;  4M77 G;  1RAA B;  5I22 A;  3GIB A;  5EG2 A;  4MMK A;  4ELZ C;  1X01 A;  5A0L A;  2RNA A;  4LXC A;  2F2W A;  2FPE A;  3MHX A;  2CH4 W;  4ZTF A;  1G3W A;  5GAN e;  4HA8 A;  1N9S A;  4DEX A;  3I56 Q;  4JLI A;  1Q82 U;  1ZSZ C;  5LJ3 f;  3CD6 T;  1KHI A;  1VQ5 A;  1B34 B;  5KCO A;  4M4Z A;  3ULR B;  1YN8 A;  5DM7 R;  2O31 A;  1G3T A;  2F2X A;  2HBW A;  2MWP A;  4X1V A;  1AWW A;  2DO3 A;  1WHG A;  1IGU A;  1M8M A;  1OU9 A;  2RHX A;  2EYQ A;  2RPN A;  4BDZ A;  4M77 E;  4J9F A;  1ARK A;  3BE3 A;  5FWC A;  2DPP B;  4IIO A;  1QVF S;  1XOV A;  3CBO A;  3I56 A;  1UG1 A;  3HTR A;  2DNU A;  3MEU A;  3T9N A;  2HEQ A;  3VUB A;  2JMC A;  1M9S A;  5KYW B;  1VQN T;  1SKU B;  2HBP A;  1K9M R;  1N8R C;  4XU2 A;  3EG9 A;  2EAY A;  3JCM J;  4GBQ A;  4EMK B;  4L59 A;  1D1B A;  3MP6 A;  2AHJ B;  3MEA A;  1IHW A;  4PJO D;  2ZGW A;  4LUE A;  5J3B A;  3JCM b;  4C92 F;  1W1F A;  1UFF A;  2BZX A;  1T0H A;  1ZQ1 A;  5FU7 C;  4HCC A;  2EQM A;  3OYE A;  1SEM A;  4QQD A;  1LJO A;  3HP9 A;  4F16 A;  4CC2 A;  4HVV A;  4J6X A;  3CQT A;  2IG0 A;  3VS0 A;  2O88 A;  2DVJ A;  3S3N A;  5LL6 S;  4M75 B;  5AYF A;  3EG1 A;  1YI2 Q;  5KYY A;  1WX6 A;  3EFS A;  3KBG A;  4LDY A;  1OQK A;  1UUE A;  3SDZ A;  4R55 A;  2KMT A;  4N0A C;  1QLY A;  3M0S A;  1RAD B;  2OTL Q;  2LNV A;  2J06 A;  1BU1 A;  5LJ3 g;  4WF2 A;  1AWO A;  5LJ5 h;  4M78 B;  2JZ2 A;  2LCS A;  4PFO A;  2FVU A;  1TTH B;  1H3Z A;  3LX7 A;  2P0K A;  2RH2 A;  2M51 A;  3JB9 G;  1MV0 B;  3ZBD A;  2CP6 A;  4AFQ C;  4BY6 C;  3CCV T;  2DET A;  3RMQ A;  4CC7 A;  1NJI C;  3QZ5 B;  3G71 T;  2R5M A;  1YIT T;  3QO3 A;  5IHK A;  3L2U A;  3CCQ A;  1G5V A;  1VQP A;  1QWF A;  3REB B;  4JUV A;  1GCQ C;  2DK3 A;  4M7A A;  3E19 A;  5GAN h;  2HD0 A;  3N5B B;  4GY5 A;  4QVZ A;  1X2K A;  3CC4 T;  3CCL T;  2M1H A;  3NHN A;  1K4U S;  3TU4 K;  1FWZ A;  1AZE A;  5LJ3 d;  2EVR A;  1PM3 A;  3M57 A;  2EPD A;  4JRK A;  5ECA A;  2ROL A;  2YUQ A;  2L3R A;  3CC2 Q;  2CYZ B;  1VOM A;  4OMN A;  1BCM A;  3I5R A;  1Y71 A;  3KFV A;  2NWM A;  2DBK A;  3BW1 A;  2O4X B;  1JJ2 A;  4KH1 B;  3H41 A;  3OYC A;  3GP8 A;  3NMZ C;  2YRC A;  2MWO A;  4RMO A;  2PVG B;  4X9C A;  4XTX A;  2DD4 A;  1M27 C;  5GAN 8;  3MP8 A;  1HSQ A;  2BZ8 A;  2V1R A;  4M78 D;  2QA4 A;  2XI9 A;  3CXC A;  5KYN A;  3J81 E;  1MND A;  4PJO E;  1M90 C;  1S72 Q;  4IUV A;  4XAX B;  3FIF A;  1TU0 B;  2RJF A;  4F7U F;  1XJW B;  3V8K A;  3OBY A;  4DBH A;  3LWI A;  5LJ5 f;  3M53 A;  2AKK A;  2VGN A;  2A7Y A;  3GNF B;  4IKF A;  4QKU A;  3CPW P;  1UJ0 A;  4HXJ A;  3GBQ A;  2O2O A;  2JTE A;  4KBM B;  2EKO A;  2QDL A;  5FU6 C;  4B9W A;  1YIJ Q;  1C6V X;  3X25 B;  3VYH B;  3V7C A;  2PTK A;  3OS1 A;  3CCE A;  2EGC A;  2LZ6 B;  5D6W A;  1S72 A;  2HQX A;  2NUP A;  1RAE B;  5GAN f;  2ZCF B;  2M0O A;  1E7O A;  1NE8 A;  3SD4 A;  2ATC B;  4C92 G;  2LVM A;  2LQK A;  2NUT A;  2X4J A;  1NBE B;  1YHQ Q;  4M7D G;  3M0R A;  4MML A;  4BE2 A;  1ACM B;  4Z89 A;  1UGP B;  2GQI A;  2WSC E;  2Y4X A;  3J7A F;  2OI3 A;  2HCK A;  2DA9 A;  4ZNX A;  4ZN3 A;  2CZ6 B;  1VQ8 Q;  4VUB A;  4BI4 A;  3R6O A;  1CSK A;  2IVW A;  2J6F A;  1IRX A;  1X69 A;  4C8Q C;  2HQH A;  1JJ2 S;  4J6W A;  2EJ9 A;  3X20 B;  1KG1 A;  2JTF A;  2EWN A;  3FB9 A;  2ENM A;  1A0N B;  2RJD A;  2CUD A;  3V8L A;  1MMA A;  3AT1 B;  3CBM A;  3THK A;  2E6Z A;  4IUU A;  4OMM A;  3CXC S;  2PUO B;  2EYW A;  3GNG A;  1QKX A;  2I2L A;  2J6K A;  1G3Y A;  4C5G A;  3G1J A;  2XID A;  1LPL A;  4FCY A;  3M59 A;  2CS7 A;  2DYB A;  4F14 A;  1VQ7 A;  4XU1 A;  1X27 A;  1MGQ A;  4M7D E;  2KYM A;  1N8R U;  5GAO l;  5KYW A;  3UT1 A;  5LJ5 g;  1V76 A;  4EMK A;  2QEX T;  3RR6 A;  4C5H A;  2DL3 A;  3HPW A;  1QCO A;  2RQR A;  2M0Y A;  2KRS A;  1SSH A;  2D1X A;  1QVG A;  4II1 A;  1BIA A;  2LJ3 A;  3CCM A;  3JCM h;  4C0D B;  3V7R A;  4D6W A;  3CCR A;  2RQW A;  4AMC A;  4M78 E;  5GAN g;  2X9H A;  3GOX A;  3A8M B;  4KUD K;  2ZPG B;  2VVK A;  5KE3 A;  2RB6 A;  3ZEH A;  1JB0 E;  4A63 B;  3QSU A;  2X3X D;  1SG5 A;  3NPF A;  4HT9 A;  4M75 A;  4HKE A;  2KY9 A;  2JUF A;  1IRE B;  4O5V A;  3VS5 A;  1GRI A;  2XK0 A;  2LC4 A;  4L6V 5;  3FLG A;  3EG9 B;  3VS1 A;  2LCC A;  1K8A C;  1YNZ A;  2QK0 A;  5I2S A;  1RAH B;  4Z88 A;  5IT9 E;  2XMF A;  3EFR A;  2O01 E;  1GBQ A;  2F1L A;  4C8Q F;  3OYY A;  2ZPE B;  3C0C A;  3QXE B;  4M77 F;  4DOW A;  3A8O B;  4J6Y A;  4B9X A;  1KSW A;  1I4K 1;  4RKU E;  4OVA A;  3CD6 Q;  2DMO A;  5M9O A;  2BZY A;  3TSZ A;  4F7U G;  4PKC C;  2HZY A;  1I81 A;  2EYY A;  2QA4 T;  2JW4 A;  3VUZ A;  4OGC A;  1NLP C;  8AT1 B;  2V8K A;  2ZAE A;  3DLL A;  1I5L A;  1PG5 B;  2GGR A;  3M9Q A;  4QVD A;  5KYY B;  3JCM X;  2BTT A;  3I35 A;  1OYX A;  4FL6 A;  1R0B G;  2Y90 A;  1N5Z A;  1TSF A;  5KYU A;  4PFZ A;  1K73 C;  2E1H A;  4PL6 A;  3H0H A;  1QCF A;  1QVG S;  1U3O A;  3C95 A;  3A8G B;  3DKM A;  4FSS A;  2BUD A;  3CCE T;  4A53 A;  3MJX A;  3ZL7 C;  1ZBX A;  1VYT A;  1QQJ A;  2V26 A;  2B86 A;  2XU8 A;  4PJO C;  4CI0 C;  2CZ7 B;  4HVU A;  2FHD A;  3VYG A;  1Q82 R;  3CMA A;  3QG1 A;  1NEB A;  3HRT A;  4M7A B;  4C0F A;  1RLQ C;  2D9T A;  2HL3 A;  3VRZ A;  3CCS Q;  1WZO A;  3QYH B;  3E9F A;  3JRZ A;  4BE1 A;  3VS7 A;  4FT4 A;  3BDL A;  1RAB B;  5CKH A;  2XDB A;  2VAS A;  2GTO A;  1N9R A;  2RMO A;  2HQE A;  1PWT A;  1VQ9 A;  3EGX B;  2W10 A;  1SRM A;  3RUX A;  3JCM c;  1W2B A;  5IHI A;  1P92 A;  3CCS A;  2ROT A;  4OMQ A;  4A4G A;  1DJ7 B;  3E9G A;  3BDU A;  2ZPB B;  4E7H A;  5GAO p;  3FEO A;  3G71 Q;  1HK9 A;  2GFA A;  2WSF E;  3FJP A;  5HY6 A;  3I55 T;  1WHK A;  2R57 A;  2SRC A;  1LVK A;  3C94 A;  1VIF A;  2C0T A;  2QQA A;  1VQM A;  2RK2 A;  1K9M C;  3LGL A;  3UWN A;  3JB9 F;  2CP3 A;  3CCL Q;  2R58 A;  1NYF A;  3JCM g;  2FG0 A;  1IZ6 A;  2CZ1 B;  3JB9 I;  4NL3 A;  2NYS A;  4M7A D;  4R0K A;  5CKB A;  2CKK A;  1Y0M A;  1PD0 A;  2RQU A;  1VQ6 Q;  4M7D C;  2OTJ T;  3MEW A;  1VQ4 A;  4PJO F;  1KC8 U;  2L3P A;  5GAO n;  2IPO B;  1U8R A;  4OP0 A;  2COZ A;  2NUP B;  4C8Q G;  4ANJ A;  1WJQ A;  2K4Y A;  1YJN T;  1YJW A;  2DE0 X;  2QGF B;  4ZGE B;  3G4S T;  2CH4 A;  3C4S A;  3CME Q;  3CCJ Q;  2NUT B;  2JVV A;  3M0T A;  3OSV A;  2KXD A;  1YWP A;  1SSF A;  4PJJ A;  1Q81 C;  3OMG A;  1VQK T;  2E10 A;  1YJ9 A;  3M58 A;  1PCX A;  1W2B S;  4M78 C;  3WVD B;  3FC3 A;  3QUI A;  2KI7 A;  3DB3 A;  2CP0 A;  3M56 A;  2VGM A;  5KE2 A;  3OQ5 A;  1D0X A;  3CME A;  3CCJ A;  3TRE A;  3FDR A;  1SRL A;  2HAX A;  2QQ9 A;  1N27 A;  2CP7 A;  4GLK A;  2LCL A;  3MCA B;  4AG2 C;  1WXT A;  3TQ7 P;  3ME9 A;  4C8Q E;  3PE0 A;  4HT8 A;  1EZZ B;  1OX8 A;  1NPP A;  1OU8 A;  3CC7 Q;  1I0C A;  1TUD A;  3PVL A;  4XU0 A;  1H8K A;  3QJ6 A;  4KT0 E; 
#chains in the Genus database with same CATH homology
 3GP8 A;  4BUG A;  2MWO A;  4RMO A;  4N4H A;  4RG2 A;  4XTY A;  3QJY A;  1UGS B;  5DY9 A;  4EPC A;  4IUR A;  2PVG B;  4X9C A;  4A54 A;  4M77 D;  4XTX A;  5GAM d;  3AHU A;  5GAO m;  2DD4 A;  5GAN 8;  3MP8 A;  3V7S A;  2K5I A;  4XTV A;  4Y28 E;  2YLB A;  2QQB A;  3L2Z A;  1VQ7 T;  2VXF A;  4M78 D;  2RK1 A;  2XI9 A;  3H8Z A;  3CXC A;  2QA4 A;  5FU6 B;  3J81 E;  1Y7X A;  2E6N A;  4ZGD B;  3M5A A;  1KQ2 A;  4PJO E;  2B8A A;  5CIU A;  3OYH A;  2LQ8 A;  3NTI A;  1X6O A;  1M90 C;  1XTD A;  3DB4 A;  4IUV A;  2BIV A;  3X26 B;  4A4E A;  5A2Q E;  4E7K A;  4XAX B;  3FIF A;  3HKS A;  4F7U A;  4M7D A;  2RJF A;  4M7D F;  4F7U F;  2OAU A;  4N0A A;  3V8K A;  3OBY A;  3CMA T;  5HK0 A;  3LWI A;  2K3X A;  4N4G A;  4EMK C;  5LJ5 f;  3M53 A;  4LD9 K;  3EAE A;  5LJ3 e;  2VGN A;  1M1G A;  2A7Y A;  3GNF B;  4OGE A;  5LJ5 j;  5GAO r;  3RES A;  4JJN K;  3G6E T;  4IKF A;  2XDP A;  1YJN A;  4C0G A;  1BI2 A;  3OYJ A;  2E12 A;  4KBM B;  2EKO A;  5FU6 C;  4B9W A;  5FRM A;  2DTI A;  3G4S A;  2BKD N;  2RHZ A;  3VKI A;  3VYH B;  3X25 B;  2QQR A;  3CCM T;  3V7C A;  3CCR T;  3UPU A;  2QXF A;  4QW2 A;  2JN0 A;  4PLL A;  4MZP A;  2EJG A;  3CC2 T;  3OS1 A;  3CCE A;  5GMK m;  5D6W A;  3G71 A;  4M77 A;  3OYM A;  1S72 A;  3E1S A;  5DLO A;  2HQX A;  2KSS A;  5GAN f;  2WSE E;  4J7F A;  1VQK A;  4C92 B;  3JB9 H;  2ZCF B;  2M0O A;  3OB9 A;  5GAN j;  1BI3 A;  2QI2 A;  1NE8 A;  4M78 A;  2D6F A;  3SD4 A;  4M78 F;  3JCM Q;  4C92 G;  2LVM A;  4C8Q B;  3S3O A;  3URG A;  2LQK A;  2CZ0 B;  5HK3 A;  2X4J A;  5GAM e;  4M7D G;  4C5E A;  4MML A;  4CRI A;  4BE2 A;  4M75 C;  2E64 A;  3MET A;  3CC4 A;  3CCL A;  5CAI A;  1UGP B;  2DXU A;  2QQS A;  2WSC E;  4A4H A;  3H6Z A;  1W4S A;  1QW1 A;  4XK8 E;  2MI6 A;  2Y4X A;  3PGG A;  1O9S A;  3J7A F;  3JSC A;  4MDW A;  4ZN3 A;  2CZ6 B;  1XNI A;  3OY9 A;  4VUB A;  2EIF A;  4BI4 A;  3OS2 A;  2RJC A;  3HRU A;  3OW2 A;  3R6O A;  1YI2 A;  2IVW A;  4L5G A;  4Z02 A;  4C8Q C;  3PFS A;  2PUK B;  4P5N A;  4ZN1 A;  1JJ2 S;  1LOJ A;  4HCZ A;  3JCM d;  4J6W A;  2EJ9 A;  3X20 B;  3OS5 A;  2V8J A;  1KG1 A;  2JTF A;  4BD3 A;  5FRO A;  3TCJ A;  1VQ6 A;  2EWN A;  2LTO A;  3FB9 A;  2DEQ A;  3L2R A;  1WNL A;  4QQ6 A;  5GMK h;  2OTL A;  2RJD A;  4PJO B;  1BI0 A;  2EQU A;  2F5K A;  3V8L A;  3OYN A;  4M7A F;  2RD1 A;  1H64 1;  2XDD A;  3MO8 A;  4PJO G;  1Q86 U;  4E7L A;  3QZ9 B;  3CBM A;  4YTL A;  1VQN A;  2E6Z A;  1YIJ T;  1I8F A;  4IUU A;  3CXC S;  4J8O A;  2PUO B;  1WGS A;  1N6A A;  3GNG A;  5IAY A;  1PSF A;  2I2L A;  2XKO C;  1G3Y A;  3HFN A;  4C5G A;  1KHC A;  4FSX A;  2XID A;  1N8R C;  4BI8 B;  2HNI A;  2CS7 A;  2F69 A;  1AHJ B;  2G3R A;  3M59 A;  1VQ7 A;  2MAM A;  2MF2 A;  4PLI A;  4XU1 A;  5CO7 A;  3OYL A;  1VQ4 T;  4PNO A;  1MGQ A;  2O4X A;  4C5I A;  2LT1 A;  4F7U E;  3KXT A;  2VV5 A;  3JCM V;  4M7D E;  3PNW C;  1N8R U;  5GAO l;  5KH6 A;  3UT1 A;  1NPR A;  4M75 D;  3SWN B;  4DA4 A;  5LJ5 g;  3GF5 A;  4EMK A;  3JCM P;  1YHQ T;  1OZ2 A;  1NZ9 A;  2QEX T;  3NTK A;  5I21 A;  5CKF A;  2X35 A;  4LDW A;  3CPW A;  4C5H A;  1OZ3 A;  1M1K U;  2DTO A;  5FRN A;  3M54 A;  4M7A G;  3HPW A;  2F5T X;  3G6E A;  2JTM A;  5CCA A;  5GAN 2;  1Q86 C;  2L89 A;  3LH0 A;  4C8Q D;  2DXC A;  4FU6 A;  4BDY A;  1K8A U;  1VQ8 T;  2RHU A;  4LDX A;  4DQ2 A;  1U1S A;  4QQG A;  4E7I A;  4ME7 A;  1QVG A;  1FX7 A;  2DAQ A;  3DLM A;  3WXM B;  4II1 A;  4BB7 A;  2P0P A;  3JCM e;  1YJ9 T;  1BIA A;  3CCM A;  3JCM h;  4C0D B;  3V7R A;  4D6W A;  3CCR A;  3OA6 A;  3JB9 D;  1V29 B;  2GQV A;  4QVC A;  2OTJ A;  1D3B A;  3CC2 A;  2DXT A;  1KD1 U;  3QBY A;  2XD0 A;  1BYM A;  1Q7Y U;  1UEB A;  4M78 E;  5GMK i;  5GAN g;  3CC7 A;  4ZTJ A;  1JRI A;  2L5Q A;  3GOX A;  3A8M B;  3F70 A;  4KUD K;  2ZPG B;  4FT2 A;  4IUP A;  5KE3 A;  1MHN A;  2RB6 A;  2E5Q A;  1BI1 A;  1VQ5 T;  5I2M A;  3ZEH A;  1JB0 E;  2XHC A;  3QSU A;  5GMK l;  4EMH A;  2EJF A;  2M16 A;  2VXE A;  4HCB A;  5CR2 A;  1UGQ B;  4HT9 A;  4M75 A;  3LYI A;  4HKE A;  4OB2 B;  5LJ3 h;  4M75 F;  5J26 A;  3OW2 S;  1VQO T;  2KY9 A;  2JUF A;  1IRE B;  2DD5 A;  4O5V A;  2ZZD A;  2XK0 A;  1UB4 A;  3OYI A;  1M1F A;  2LC4 A;  4L6V 5;  4O6J A;  3FLG A;  3GPL A;  1M1K C;  2P4T A;  1VUB A;  2LCC A;  5J39 A;  4A4F A;  5GAN 3;  1K8A C;  3P8B B;  5I2S A;  3QYG B;  2X4X A;  3Q1J A;  3CCV A;  2KVQ G;  2E70 A;  5IT9 E;  3EFR A;  2O01 E;  4C8Q A;  3I56 T;  2GCX A;  3CCU T;  4C8Q F;  3LGF A;  3OYY A;  4BI3 A;  2ZPE B;  3QXE B;  3RKX A;  1VQL T;  1YIT A;  4M77 F;  3A8L B;  1WQW A;  4DOW A;  1VQ9 T;  4RG8 A;  1K73 U;  2NLU A;  3HRS A;  4OB0 B;  1YCY A;  5GMK j;  3A8O B;  1WQ7 A;  4DOV A;  1Q7Y C;  4M7A E;  1O75 A;  4J6Y A;  3OS0 A;  4B9X A;  4FM4 B;  2WAC A;  5CVI A;  1QVF A;  3OYD A;  2C06 A;  2KDS A;  4ATO A;  1I4K 1;  4RKU E;  4M7D B;  4OVA A;  5M9O A;  3CCS T;  4LD6 A;  4MZM A;  3TEE A;  3A8H B;  4F7U G;  3OYB A;  1EIF A;  4E47 A;  4BAC A;  4PKC C;  5GAM h;  2PVO B;  1I81 A;  1YIJ A;  1WJS A;  1BIB A;  2QA4 T;  2K3Y A;  2R5A A;  2LX9 A;  3S6W A;  2EQJ A;  2K5F A;  2KQW A;  3S3M A;  3VUZ A;  4OGC A;  3GLX A;  3OYK A;  1RL2 A;  2MMP A;  4C92 C;  3LW5 E;  4BY6 B;  2V8K A;  3QHS A;  4JS4 A;  1Y07 A;  3DLL A;  2PU9 B;  3M4Y A;  3UDC A;  5CK9 A;  1I5L A;  2KK4 A;  4QVD A;  3M9Q A;  3JCM X;  3NFC A;  1OYX A;  4FIB A;  3INZ A;  4FL6 A;  2Y90 A;  4JDS A;  3BY7 A;  5A0G A;  3CPF A;  1VQM T;  5LJ5 e;  3LWH A;  4M77 G;  1K73 C;  2E1H A;  4PL6 A;  1PSE A;  2RHY A;  3QDR B;  5CQX A;  3L42 A;  1YHQ A;  1QVG S;  1JBM A;  2QEX A;  3GIB A;  1QVP A;  3C95 A;  4M78 G;  3HL8 A;  4ELY C;  5EG2 A;  2JOY A;  5GAO q;  2E65 A;  3A8G B;  3DKM A;  2ZPF B;  2BUD A;  4E7J A;  3CCE T;  2EQK A;  3X24 B;  4A53 A;  4MMK A;  2RI3 A;  4ELZ C;  2RI5 A;  1VQ8 A;  2JNG A;  1WPY A;  1X01 A;  3PTA A;  3CEY A;  3OBW A;  4OB3 B;  5A0L A;  1ZBX A;  3J80 E;  3JCM W;  3SWN A;  3VU3 C;  2DKG A;  3WVE B;  2EFI A;  2XU8 A;  3MHX A;  3OYF A;  1G3W A;  2DVE A;  5GAN e;  4ZTF A;  4PJO C;  5DLQ E;  2CZ7 B;  4CI0 C;  4HA8 A;  1N9S A;  4Q5W A;  2GF7 A;  2FHD A;  3VYG A;  1FXX A;  4JLI A;  5CKE A;  1Q82 U;  3MP1 A;  3SB2 A;  5LJ3 f;  1G3S A;  3M55 A;  1YJW T;  1X75 C;  3CD6 T;  1KHI A;  4M75 E;  4XTU A;  1VQ5 A;  3CMA A;  1B34 B;  1ZHI A;  2Y4Y A;  5KCO A;  5LJ3 j;  2VYT A;  1Y96 B;  3QG1 A;  4OF1 A;  4EDU A;  3JB9 J;  3HRT A;  2XG8 D;  4M7A B;  4C0F A;  5DM7 R;  3L2W A;  2D9T A;  1G3T A;  4IUQ A;  2P0Q A;  4JLG A;  1BKB A;  4C92 D;  1M4Z A;  1VIE A;  2MWP A;  1YI2 T;  5HKC A;  3QYH B;  4M7D D;  2DO3 A;  3E9F A;  3JRZ A;  4BE1 A;  2E41 A;  2X4W A;  1YBY A;  4FT4 A;  4C0Z A;  3BDL A;  2YLC A;  2RHX A;  2LDM A;  3QKJ A;  5C0M A;  2EYQ A;  5CKH A;  3A5Z B;  3CCQ T;  2XDB A;  1VQP T;  2RHI A;  1KQ1 A;  1XQH A;  4BDZ A;  1VQ6 T;  4M77 E;  3SWN C;  1QVF S;  2DPP B;  3P8D A;  1U1T A;  1LNX A;  1XOV A;  1N9R A;  2KAF A;  3CBO A;  4KUL A;  3I56 A;  2ZPH B;  2HQE A;  3MEU A;  3G7Z A;  5CKD A;  3T9N A;  1K9M U;  4J5Y A;  3BFM A;  1VQ9 A;  3RKY A;  3VUB A;  1M9S A;  1VQN T;  2HBP A;  2RA2 A;  3M4G A;  3KUF A;  4XQ3 A;  3RUX A;  3JCM c;  4MZT A;  5D6Y A;  5GAM f;  4XU2 A;  1W2B A;  5GAN 7;  3ASK A;  3CME T;  1Q82 C;  1P92 A;  3CCJ T;  4JS5 A;  2EAY A;  2H3J A;  5FU7 B;  5GAM j;  3JCM J;  2VUB A;  4EMK B;  2FYK A;  4JRQ A;  2XIC A;  4L59 A;  3MP6 A;  2AHJ B;  3CCS A;  5LJ5 d;  3PIO A;  4C0D C;  4A4G A;  1R8O B;  1DJ7 B;  4X9D A;  3E9G A;  3MEA A;  3BDU A;  2ZPB B;  4PJO D;  2ZGW A;  3NTH A;  2YRV A;  3QII A;  4E7H A;  5GAO p;  3FEO A;  5J3B A;  3OYG A;  3JCM b;  2FB7 A;  4C92 A;  3O8V A;  4C92 F;  4J7I A;  2LT4 A;  1HK9 A;  2GFA A;  2WSF E;  3FJP A;  1ZQ1 A;  5FU7 C;  5HY6 A;  1D3B B;  2EQM A;  3OYE A;  4HCC A;  3I55 T;  4QQD A;  2K5L A;  3OYA A;  1LJO A;  2R57 A;  3HP9 A;  3C94 A;  1UGR B;  4NL2 A;  4JRP A;  1VIF A;  1HXD A;  2RM4 A;  3L2V A;  2QQA A;  2K2V A;  2RK2 A;  3L1A A;  3LGL A;  4XTW A;  3UWN A;  5GAN d;  1VQM A;  1K9M C;  3JB9 F;  2DXB A;  4F7U B;  4J6X A;  1KQS A;  1GXI E;  2IG0 A;  2DTH A;  3P8H A;  1NJI U;  3QPH A;  4X34 A;  3S3N A;  1RI0 A;  2R58 A;  2M9U A;  5LL6 S;  4J83 A;  3SFM A;  4M75 B;  3VV0 A;  5AYF A;  3ER0 A;  3JCM g;  4NL3 A;  1IZ6 A;  1QP3 A;  2CZ1 B;  3JB9 I;  1OI1 A;  1Q81 U;  5D6X A;  4M75 G;  5C6S A;  3EFS A;  4M7A D;  3CC7 T;  3KBG A;  2DZ9 A;  2D0Q B;  4LDY A;  5CKB A;  2CKK A;  1TH7 A;  4Y91 A;  3SDZ A;  1QP2 A;  4V2S A;  4R55 A;  2OTJ T;  2KMT A;  4M7D C;  2LRQ A;  1M8V A;  3MEW A;  4PJO A;  4N0A C;  1VQ4 A;  4PJO F;  4ZGJ B;  2DJZ A;  5L8R E;  3RIR A;  5GAO n;  1KC8 U;  3PIP A;  2LNV A;  4UC4 A;  1U8R A;  5GAN 6;  4OP0 A;  4M77 B;  4RCC A;  4A4K A;  3CPW S;  4C8Q G;  3PMI A;  4XTZ A;  5LJ3 g;  4WF2 A;  4EMG A;  1WJQ A;  2K4Y A;  1YJN T;  2RO0 A;  2YHT A;  4KUI A;  5LJ5 h;  1YJW A;  2PVD B;  3CD6 A;  4M78 B;  2JZ2 A;  2ZPI B;  2FL7 A;  2FVU A;  3V8J A;  4ZGE B;  3LX7 A;  2P0K A;  2VC8 A;  3G4S T;  3C4S A;  1H3Z A;  2RH2 A;  2DIQ A;  3VJP A;  3JB9 G;  1WJR A;  3ZBD A;  5IN1 A;  3CCV T;  2DZC A;  4BY6 C;  2JVV A;  3RMQ A;  3HFO A;  2QTX A;  1NJI C;  3PT9 A;  3JAM E;  2A3L A;  4JRI A;  3QZ5 B;  4TVR A;  3JCM f;  3OSV A;  3G71 T;  2V8I A;  2R5M A;  1S72 T;  1YIT T;  1SSF A;  4M77 C;  3C12 A;  3RMS A;  1Q81 C;  3OMG A;  3QO3 A;  3L2U A;  3CCQ A;  1VQK T;  1VQP A;  1G5V A;  2E10 A;  1YJ9 A;  3M58 A;  2QDY B;  2GFU A;  3RKW A;  1W2B S;  5GMK e;  3X28 B;  4JUV A;  1B34 A;  2K57 A;  3CBP A;  4M78 C;  3WVD B;  2DK3 A;  1Y96 A;  3FC3 A;  1KD1 C;  4M7A A;  3E19 A;  3QUI A;  2L8D A;  4NS5 A;  2HD0 A;  3DB3 A;  5GAN h;  3N5B B;  4GY5 A;  4QVZ A;  1KC8 C;  3M56 A;  3CC4 T;  2VGM A;  5GAM g;  5KE2 A;  3CCL T;  3LLR A;  2DIG A;  2M1H A;  3OQ5 A;  4OMF B;  5GAN 4;  3TU4 K;  3FRN A;  1FWZ A;  2CGH A;  3CME A;  3CCJ A;  3TRE A;  5LJ3 d;  3FDR A;  4NOY A;  3M57 A;  3PMT A;  2HAX A;  4JRK A;  2QQ9 A;  4XU3 A;  1N27 A;  3HHT B;  4GLK A;  2LCL A;  3RER A;  1VQO A;  3MCA B;  3MEV A;  5A0D A;  5CQY A;  4C92 E;  4MDX A;  5KCH A;  3ZFJ A;  2L3R A;  2RI2 A;  3OSS C;  5FLX E;  2X4Y A;  4BE0 A;  1M90 U;  2CYZ B;  3ME9 A;  4C8Q E;  4RCB A;  2PQW A;  4HT8 A;  1NPP A;  1M5Q 1;  1Y71 A;  2RJE A;  3L2Q A;  4LDV A;  1KQS S;  2OTL T;  3BW1 A;  4N4I A;  4LDU A;  3CCU A;  4OB1 B;  4IUT A;  3I55 A;  4M7A C;  2O4X B;  1JJ2 A;  1VQL A;  4XU0 A;  5GAN 5;  3HSB A;  4R56 A;  3QJ6 A;  4KT0 E;  3OMC A;  3OYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...