1RUWA

Crystal structure of the sh3 domain from s. cerevisiae myo3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
KDPKFEAAYDFPGSGSSSELPLKKGDIVFISRDEPSGWSLAKLLDGSKEGWVPTAYMTPYKDTRNTVPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin-3 isoform
publication title Crystal structure of the SH3 domain from S. cerevisiae Myo3
rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
total genus 11
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2003-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ruwA01
2YSQA 2L0AA 1SEMA 2V1RA 2W0ZA 2X3WD 1KJWA 4Z89A 1T3LA 1JQQA 2L2PA 2HBWA 1AWWA 1YNZA 2GGRA 4LE9A 4RTTA 4HCKA 1J3TA 4GLMA 2C0IA 1Y57A 1UHFA 3IQLA 2DRKA 2MOXA 5GJVB 2ROTA 2KT8A 4X1VA 3NGPA 1BBZA 3A98A 1YCSB 1UHCA 2JS0A 2H8HA 4QT7A 1KIKA 2DRMA 1ZUKA 1Y0MA 3RNJA 1SPKA 1JEGA 3NPFA 1MV0B 3RBBB 2I0NA 2NWMA 4CC3A 1NEGA 1M30A 4ORZA 3VRZA 3TSZA 1X6GA 2F2VA 5I22A 2CSQA 2EGEA 4HVVA 4JJBA 5HCKA 3EG2A 2ED1A 1NLOC 4CC4B 4Y92A 2KYBA 2K2MA 2RQUA 3VS6A 2LMJA 1UGVA 2KRSA 4RTZA 2KBTA 1ABQA 4IIMA 3CQTA 1ABOA 1UG1A 2AKKA 2RN8A 2A36A 2DX1A 2F2WA 2DF6A 2FPDA 2JW4A 1FMKA 4AG1C 3UATA 2DL5A 2KRNA 2GQIA 3LH5A 2LQWA 4D8DA 2RNAA 1M8MA 1WFWA 2M51A 1IO6A 3EG3A 5FWCA 2JMCA 3PVLA 2G6FX 1TUCA 4RTYA 1QKWA 2O88A 2VWFA 2DLPA 4OMNA 4F14A 2D1XA 1B07A 1U5SA 1GBQA 3VS7A 1A0NB 2KXDA 2SRCA 1RLPC 2O9VA 3UA6A 1B3QA 3M0PA 2KNBB 1WDXA 1U3OA 3QWYA 1UJ0A 1AWOA 1V1CA 4J9HA 2J6OA 2YDLA 1XOVA 2EGCA 2JS2A 2HSPA 2HDAA 1M3AA 3R6NA 3VRYA 1E6HA 4JPBW 4D8KA 5ECAA 3VS1A 1X2KA 3THKA 5IHNA 1HJDA 2D0NA 2JM8A 1SHGA 3U23A 1NYFA 2L3SA 3EG1A 1X27A 2ENMA 3M0TA 1GL5A 3H0HA 2RF0A 2RQRA 3I5RA 2GNCA 1ZX6A 2F2XA 1RLQC 4AG2C 3ULRB 1UJYA 5IH2A 1ARKA 2DL8A 1OV3A 1X2QA 1M27C 4GBQA 3TVTA 2GTOA 1PKTA 2KYMA 2KROA 2E5KA 2EVRA 1X6BA 1JXOA 2LNHB 3M0SA 2FEIA 5IHIA 4LNPA 3VS5A 2ESWA 2BZXA 2A37A 2M0YA 2OAWA 1I1JA 2RMOA 4LUDA 2DA9A 1KSWA 1UFFA 2CREA 2EW3A 1MV3A 2YUQA 2PZ1A 4AFSC 2BZ8A 3QWXX 1ZLMA 1ZBJA 2J05A 2A28A 1GBRA 1AD5A 1T0JA 2LP5A 1VYVA 2LQNA 2PTKA 1X43A 3SEMA 2DJQA 2MIOA 1K0SA 1WIEA 4J9DA 4AFUC 2KR3A 1W1FA 2EBPA 4J9BA 3I9QA 2DL4A 2KXCA 1SSHA 1GRIA 3EHQA 4OMQA 4RTUA 1NM7A 1M3BA 1WLPB 2A08A 2P4RA 2C0TA 4OMOA 2EPDA 1KFZA 2DNUA 4WCIA 2K79A 4DEYA 2LCSA 1QKXA 1GCQA 1PNJA 1TUDA 1H3HA 2OJ2A 1E7OA 2D8HA 1K1ZA 2FPEA 1K0XA 4A63B 2CT3A 2HCKA 2EKHA 5IXFA 4KRTA 2CUBA 2RQTA 2O31A 2DL3A 4HVUA 1PRMC 4OMLA 1GFDA 1UE9A 4RTXA 4J9CA 2K9GA 2FRYA 3REBB 2XMFA 1YN8A 2FRWA 1QWEA 2CDTA 1JO8A 4CC2A 4J9GA 4J9IA 2AZSA 2B86A 2JXBA 2FPFA 2LZ6B 1H92A 2VVKA 2KRMA 2J6KA 2JT4A 1SRMA 1SRLA 1OPLA 2YUOA 1NEBA 2JMAA 3REAB 2DL7A 1M3CA 2V1QA 1MUZA 2FO0A 2O9SA 2L3PA 5IHKA 1N5ZA 1U06A 3M0QA 2ROLA 1ZUYA 1BB9A 4Z88A 1AWXA 1AZGB 3I35A 2YUPA 2GBQA 2DE0X 4M4ZA 2KGTA 1T3SA 2JTEA 1BK2A 2VKNA 2DYBA 3SHWA 2BTTA 4ESRA 2EGAA 3JV3A 2LJ1A 1BU1A 2SEMA 3VS0A 2D8JA 3PE0A 4HVWA 5EC7A 3O5ZA 1NG2A 3H41A 1CKBA 1X69A 3PVQA 4F16A 1ZUUA 1QWFA 1K76A 2QDLA 4FSSA 2K7AA 4RTWA 2ABLA 1HD3A 1PKSA 5GJWB 1Z9ZA 2EYWA 1AEYA 2RQWA 1PWTA 1WI7A 2L3QA 3M0RA 4IIOA 4RTVA 4OMMA 2EYYA 2HEQA 2ED0A 1VYUA 3KFVA 2CUDA 2EYXA 2CT4A 1AWJA 1HSQA 5FWBA 3VS2A 1ZSGA 2LJ3A 2LX7A 2AK5A 4JJCA 2DBKA 2X3XD 1NYGA 5IXBA 3C0CA 2GTJA 2J7IA 1AOJA 2OI3A 4Z8AA 2AKLA 1CSKA 1RUWA 4JZ3A 4LN2A 2C0OA 4EIKA 1TG0A 4RUGA 1GFCA 2ECZA 1WA7A 3NMZC 2CSIA 4K11A 1PHTA 2O2OA 2FG0A 1UUEA 1FYNA 1VA7A 2J06A 1JXMA 3H0IA 3VS4A 1G83A 1I07A 2EYZA 3FJ5A 3EHRA 1S1NA 4E6RA 1K9AA 2RQVA 4JZ4A 4J9EA 1CKAA 2CH4W 3GBQA 1Z9QA 1H8KA 1WX6A 2DM1A 5I11A 5L23A 1SHFA 1WXTA 1AVZC 1W6XA 1OPKA 1YWOA 2RPNA 4J9FA 4AFZC 4DEXA 1WYXA 1I0CA 4CC7A 1YP5A 4ZNXA 4F17A 3NHNA 1WXBA 1QCFA 4AFQC 2YUNA 1RI9A 2AZVA 2DILA 2KEAA 2K3BA 1G2BA 3I5SA 1VYTA 2DBMA 2LJ0A 3M0UA 2CH4A 5FW9A 4OMPA 2K6DA 4LUEA 1QLYA 3TSWA 1OEBA 4HXJA 1WXUA 1W70A 1K4US 1GCQC 2KT1A 2J6FA 1LCKA 2W10A 1JU5C 1GCPA 1E6GA 1EFNA 2IIMA 1AZEA 2BZYA 2MCNA 3EGUA 1UTIA 3EG0A 2YT6A 4R0KA 1YWPA 2DMOA 3UF4A 3VS3A 2EQIA 3H0FA 2KE9A 1OOTA 2DVJA 2PNIA 2JM9A 2NUZA 3UA7A 1PRLC 1UDLA 1T0HA 1NLPC 3ZL7C 4JJDA 1UECA
chains in the Genus database with same CATH superfamily
5GANf 3OY9A 4FYXB 4C92C 4HCCA 5GANh 4IUTA 4M75B 1S72T 4Z89A 2M16A 1VQ6T 1JQQA 1VQ4Q 2HBWA 2GGRA 2QA4A 5GAN4 1J3TA 2GFAA 1UHFA 3IQLA 4M78B 5HK3A 2L89A 3JCMJ 2CKKA 3OB9A 4M77D 1YCSB 3P8BB 1VQOQ 2H8HA 1LVKA 1SPKA 2Y4XA 3H9NA 3NPFA 4MZMA 1WJRA 3X20B 1M30A 1IHWA 3TQ7P 2RK1A 4FYYB 5HCKA 3DKMA 3LH0A 4DBFA 5D6YA 3JCMd 3EH1A 2ED1A 4CC4B 1Q7YC 2RJCA 4GY5A 1MGQA 2EQKA 4V2SA 4F7UB 2LMJA 1BIAA 1C6VX 1ABQA 4JS5A 1VQ4A 1KQSA 1MMGA 2AKKA 2RN8A 3OS0A 2RHUA 1VQPA 1KC8R 4C92F 4XU2A 3MP6A 1WJQA 2OTJT 3G1JA 5GAN3 3UATA 3J81E 1M90R 2GQIA 4M77G 1WFWA 1M2VA 5GAN2 3A5ZB 1BI0A 2E64A 3HL8A 3OS1A 5GMKh 1BKBA 2HNIA 5FWCA 2QQBA 2F5KA 2V8JA 5D6WA 2O88A 4FT2A 3OSSC 2DLPA 2DXBA 4BUGA 3GNFB 1TU0B 3VS7A 1A0NB 1WQWA 4ZGDB 3CD6T 1B3QA 3M0PA 3QWYA 1V1CA 4J9HA 2J6OA 2L5QA 1XOVA 2FHDA 3VUBA 3RKYA 2HDAA 4KT0E 1M3AA 4C92E 1EIFA 2CP6A 3R6NA 1E6HA 4ZN3A 4D8KA 5ECAA 1V76A 1X2KA 2LCLA 5IHNA 1HJDA 2JM8A 1D1BA 3U23A 2B8AA 3ZBDA 3CXCS 3M0TA 2RF0A 3I5RA 5KYUA 1ZX6A 2RK2A 1I81A 4ZTFA 3JB9J 5KYNA 5GAN5 1S72Q 1PM3A 2Y90A 2DTOA 3QBYA 2HQHA 3CXCA 2C06A 2DL8A 2HKQB 4GBQA 3TVTA 3QPHA 2GTOA 4FYWB 2KYMA 5KCOA 4MMKA 2KROA 1R8OB 2E41A 4IUUA 3PNWC 2JUFA 4R56A 1JXOA 4RG2A 2BZXA 3VUZA 2DA9A 1Q86U 1KSWA 1UFFA 2CREA 2YUQA 3OYAA 4A4HA 1D09B 4NOYA 2R57A 1JRIA 4PK4A 1T0JA 1VYVA 4EMKB 1QQJA 3SEMA 2DJQA 1K0SA 4J9DA 4AFUC 3S3NA 3VYGA 4J7FA 2KXCA 3A8OB 4RTUA 1YITT 4XQ3A 1KD1U 2HL5C 1JB0E 1D3BB 1UGQB 3RKWA 1VQ6A 1WLPB 4A4FA 1R0BG 2A08A 3HFOA 2EPDA 4ME7A 4WF2A 5CR2A 3JAME 2DNUA 1IGUA 3CBMA 3CCET 1WGSA 2PVGB 2WSFE 4JRPA 2OTJQ 2IVWA 1WHJA 5J39A 1E7OA 5CKEA 1K1ZA 4N4GA 5LJ3e 1K0XA 4A63B 4KRTA 2RQTA 3QDFA 2A7YA 2CZ6B 4J7IA 5I21A 2DL3A 4HVUA 5M9OA 1PRMC 4Y91A 4C0ZA 3F70A 3QKJA 3PTAA 4J9CA 3GIBA 3L2ZA 1JO8A 2DKGA 2CZ0B 3EH2A 2MWOA 4RCBA 2JXBA 4C92A 1H92A 3CD6Q 2KQWA 1RAFB 1VQ9Q 3WVEB 3OYMA 5KH6A 1NBEB 5IHKA 3M0QA 1I8FA 2BE9B 1ZUYA 3SWNB 8ATCB 1AZGB 2QGFB 2OTJA 3CCLT 2DVEA 3A8MB 4OVAA 2DE0X 2KGTA 4FM4B 2JTEA 2L8DA 2RJDA 4LDXA 3SHWA 1UGRB 2LDMA 1RI0A 2LJ1A 4GLKA 1BU1A 2RH2A 3SB2A 2KAFA 2EFIA 4PJOC 5EC7A 4PLLA 1NG2A 4C0DB 4J5YA 1BI2A 2E6NA 3X28B 1FX7A 3DB3A 4PJJA 5A0GA 3M53A 2QDLA 4O5VA 3VKIA 5CKHA 1HD3A 5GJWB 2EYWA 5KE3A 3ER0A 2XD0A 3E9FA 1WI7A 4UC4A 4IIOA 4RTVA 1RAIB 2HEQA 1FXXA 2ED0A 3OYJA 3CC2T 1I5LA 2QXFA 4JLIA 5FWBA 1Y96A 3EFOB 2EYQA 3PIPA 1DJ7B 2KSSA 2DBKA 4P5NA 3KUFA 2YRVA 3URGA 5IXBA 1H3ZA 2GTJA 4IUVA 2J7IA 5GAN8 2AKLA 1RACB 4EIKA 3DLLA 2ECZA 1IHVA 2BUDA 3CCEQ 5GMKl 4M75F 2WSCE 2VASA 2O2OA 4A53A 2ZPBB 3GNGA 1W2BP 4LDYA 4MMLA 1VA7A 1WZOA 2RHIA 3H0IA 3RR6A 3VS4A 3QO3A 2RO0A 4M78F 3EHRA 2PU9B 2EQMA 4IURA 1K9AA 1MNDA 4JZ4A 1CKAA 2CH4W 3META 1H8KA 3JCMe 2DM1A 3JCMX 3JCMQ 1R77A 5L23A 2EQUA 1G3WA 4Q5WA 2ZPEB 2DJZA 1QVFP 1WXTA 2CP5A 8AT1B 1AVZC 4J9FA 4OF1A 5CQYA 2YXYA 2YWWA 1O9SA 1AHJB 4PKCC 1ZHIA 1YITA 2X4WA 2FYKA 4A4EA 3HSBA 3E2UA 1RI9A 3CCRQ 2DXTA 1TH7A 2M0OA 3I5SA 7AT1B 1K73C 4J6WA 2ZPHB 2DBMA 3OS2A 3M0UA 2P0KA 2QA4T 4PFZA 4F7UF 3CPWP 1B34A 4M75E 1OZ3A 3CCLQ 1OULA 1K4US 1OX9A 1GCQC 1VIFA 2W10A 4X34A 4E7ZA 2EJGA 4QQDA 1I4K1 2MAMA 1AZEA 1N8RR 4OB1B 3OYHA 4FCYA 1YWPA 2K3XA 1D1CA 3VU3C 3VS3A 3X26B 4BD3A 2EQIA 2VXEA 4ZN1A 1TWBA 2KE9A 5GAMd 1YFNA 2JM9A 2NUZA 2JJ9A 3OS5A 2LVMA 1UDLA 1ZSZB 2CP3A 3CCJT 3VYHB 3ZL7C 4E7IA 2LX9A 2COYA 3FDRA 2DK3A 4RCCA 5DLQE 3CCQQ 2L2PA 1YNZA 3KBGA 1VOMA 4F7UE 1VQPT 4C8QA 1UEBA 4PLIA 1VQKA 2XI9A 3CCLA 3CC2Q 2DYIA 5KYXB 5GAMf 4BACA 3QUIA 3QXEB 1Q81R 3NGPA 3A98A 1EX4A 2JS0A 4LDVA 4QT7A 2HAXA 1KIKA 2LTOA 2KI7A 3RNJA 1IGQA 1NPPA 3HRSA 3RBBB 3UPUA 4ORZA 3OMCA 3WVDB 4DOWA 3UWNA 1VQ5T 1X6GA 1PD0A 5I22A 1BCOA 4JJBA 5FU6C 3EG2A 5GANj 4M7AC 4C0FA 5AT1B 1NLOC 4Y92A 4L5GA 4RKUE 5LL6S 1TUGB 4XTVA 3VS6A 2BE7D 4BDYA 2AT1B 2KRSA 3H6ZA 2KBTA 2EJ9A 3CQTA 2LNVA 1M8VA 1XTDA 4DQ2A 3P8HA 3FLGA 2FPDA 5DM7R 2JW4A 4Y28E 2QK0A 1FMKA 4LD6A 1NJIU 4L6V5 4PJOD 3LH5A 2KRNA 1M8MA 5FU7B 3OYGA 1IO6A 3MKDA 2YHTA 3TREA 4M75A 1QVPA 2NUPA 2AHJB 2G6FX 2X4XA 5LJ3h 4RTYA 5LJ3g 1M1KC 3JB9D 2HL3A 3CPFA 2QA4Q 4J8OA 3GP8A 4M78A 1SG5A 1U5SA 1GBQA 2KXDA 1RLPC 4XU1A 2O9VA 3UA6A 2E3HA 3OQ5A 5GANd 4M7AF 3HRTA 1UJ0A 5CKDA 4X9CA 3OSVA 3LLRA 2EGCA 3L2RA 3RESA 3OYDA 2D6FA 3VS1A 3FB9A 1QMCA 3DLMA 1SHGA 4PJOG 1NYFA 2L3SA 3EG1A 3E9GA 3SFMA 4F7UA 4B9XA 2RQRA 3OYKA 2XDPA 1RLQC 4HA8A 2D9TA 1ARKA 5IT9E 1OV3A 4FT4A 4QW2A 1VQPQ 3JB9G 2E5KA 2EVRA 1YCYA 5CQXA 2HMAA 2E12A 4QQ6A 2FEIA 3HHTB 3OYCA 4M7AE 2CZ1B 4LNPA 2OAWA 2A37A 2RMOA 1QCOA 2EWNA 4XTZA 2EW3A 2FZGB 1KK7A 2CP7A 5IN1A 1MHNA 2LQNA 1VQ5Q 1X43A 2MIOA 1K9MC 5CK9A 5LJ5h 5LJ5g 4CRIA 3V8KA 2KR3A 2DIQA 3CCJA 1UB4A 3AHUA 2DL4A 3CCUA 4MDXA 1QVGS 4E47A 1IREB 5GAOq 1UGSB 4XTWA 2RM4A 2K79A 4EDUA 1QVGA 1GCQA 4BI3A 4HCBA 2PQWA 2K5FA 3CEYA 4ZTJA 4JLGA 1Q86C 3S6WA 1BYMA 2CT3A 2HCKA 1N9RA 2GF7A 2O31A 3J80E 1WNLA 1ACMB 4OMLA 1Q82C 2YRDA 4M7DD 4O6JA 1VQ5A 2FRYA 3ZFJA 2XMFA 2Z0WA 2JZ2A 3JCMg 2B86A 1KD1C 2VVKA 3EFSA 2KRMA 3MPUB 3JCMP 4BI8B 1SRLA 4M77B 2YUOA 1NEBA 1NJIR 6AT1B 2DEQA 2FO0A 2L3PA 3SD4A 2ROLA 4EMKA 4J83A 4Z88A 3I35A 4XTUA 2V8KA 2KDSA 3EG9B 1XQHA 4C0GA 1BK2A 2VKNA 2DYBA 4RG8A 2E4HA 3LX7A 4ESRA 3JV3A 1D3BA 1OX8A 1SSFA 2CS7A 2FB7A 2FVUA 1VQ6Q 3CPWS 4M7AA 2VYTA 4M7DG 1VQMT 1X69A 1XJWB 2EJFA 1M5Q1 2H3EB 1K76A 2QEXA 3MEWA 4FSSA 2IPOB 1Q7YU 2K7AA 1VQ8A 3MEAA 3V7SA 1WHMA 2ABLA 1PKSA 1BI1A 1KHCA 1PWTA 2D0QB 5GAMe 4OMMA 3CC7T 2QQAA 2EYXA 2COWA 3EGXA 5EG2A 4M7DB 2LT4A 3OYEA 2AK5A 3ME9A 4YTLA 2K5IA 1NYGA 3EGDB 3GLXA 4DBRA 2EQJA 1GXIE 3S3MA 2JN0A 3C0CA 5I2SA 5A0DA 1IXDA 4E7KA 3QIIA 4DOVA 3L42A 1CSKA 2CP0A 1RUWA 3V8LA 4J6XA 4A4GA 1LJOA 1M9SA 3RUXA 3QG1A 1WA7A 2CSIA 4C8QC 1SKUB 1YI2A 2JNGA 2FG0A 5D7UA 4RMOA 5KYWA 3JSCA 1I07A 3CCMA 5KYUB 2EYZA 1M4ZA 2LQKA 4J9EA 4PNOA 4NL2A 3C12A 3CC4T 3FEOA 2XDDA 2X9HA 2VGMA 2MYSA 4C92D 3CBOA 1W6XA 1YWOA 3L2QA 1WYXA 3BW1A 4CC7A 1N8RU 2CZ7B 3X25B 3OYLA 1YHQA 3RKXA 4FSXA 2HQEA 3NHNA 4AFQC 2YUNA 2XICA 2RI5A 2ZGWA 2AZVA 2DILA 1TOVA 2K3BA 4VUBA 1VYTA 2Y4YA 2CH4A 5FW9A 3I55T 4LUEA 3TSWA 1VQKT 3EFOA 3PIOA 5CKFA 2KT1A 2J6FA 1WHHA 3QZ9B 3JCMc 2MMPA 1WHLA 1GCPA 4BB7A 5FLXE 5GAN6 4C8QF 2M1HA 2BZYA 3RERA 2QDYB 2QQRA 5GAN7 2I2LA 2DTIA 2DMOA 2YT6A 2HBPA 4M75C 1Q81U 3H0FA 2K4YA 4DBHA 4N0AC 2DVJA 3PMTA 5GANe 2PNIA 4C92G 3M5AA 4M78C 2QQSA 3MEUA 3EAEA 2P0QA 4BY6B 4FYVB 1N9SA 2P84A 2YSQA 1VQLA 1KG1A 1HXDA 2R5AA 5GMKi 1PG5B 1T3LA 2F1LA 1RAEB 2DFUA 4PFOA 2CP2A 4HCKA 3CC7Q 3NTKA 4GLMA 2C0IA 1RAHB 3LW5E 1Y57A 3OA6A 4BDZA 2DRKA 3C4SA 2ROTA 4X1VA 2XKOC 2RD1A 1YJWT 3X24B 1PD1A 4C8QE 4NL3A 2DRMA 1ZUKA 1Y0MA 1YITQ 1KQSP 1JEGA 2BKDN 1MV0B 3OW2P 2NWMA 4FU6A 1JBMA 1Q7YR 3VRZA 2YRCA 3JCMb 1VQMA 2CSQA 2EGEA 4HVVA 4BE2A 2H3JA 5KYYB 1UGPB 2KYBA 3G6EA 2RQUA 2QQ9A 3DB4A 1I5OB 5HY6A 1X01A 1YIJT 3I56T 2ATCB 3OMGA 4QVDA 5GAMj 3GOXA 1UG1A 3CC7A 2A36A 2RJEA 2F2WA 3CC4Q 5GMKe 1W4SA 3CCST 4Z02A 4AG1C 2O4XB 3OBWA 3HRUA 1KC8C 2NUTB 3CMET 2RNAA 2QI2A 4HKEA 5J26A 1FMVA 2LC4A 4EMGA 5CVIA 1M90C 3QJYA 1TUCA 1YJNT 1QKWA 1QP2A 2E1HA 2DERA 1BIBA 1WHGA 1B07A 1Y96B 1VQKQ 2SRCA 2CYZB 1FWZA 3JB9I 4HT9A 3M58A 3OYBA 4QVZA 2KNBB 1WDXA 1U3OA 3FIFA 3NTHA 3CXCP 1AWOA 4M78E 1WPYA 1M1FA 2QG9B 3CC4A 1P92A 3BDUA 2VUBA 3A8GB 4JPBW 2VGNA 3M57A 1PCXA 3THKA 2ZCFB 2D0NA 4XTYA 1X27A 3CCVT 2A0FB 2DETA 3H0HA 4L59A 2GNCA 3CCUT 2F2XA 2X4JA 1FMWA 4AG2C 3G71T 1UJYA 3V7CA 5IH2A 3LYIA 4B6MA 4F04B 3I55A 2RB6A 4M77F 1Y07A 2FL7A 4EMKC 1X6BA 5I2MA 3M0SA 3VS5A 1X6OA 2M0YA 2E10A 4BI4A 4OB3B 4E7LA 4FW1A 2QYZA 2AIRB 1MV3A 4OB2B 1MMAA 1XNIA 1TXQA 3MP1A 2BZ8A 4II1A 3QWXX 4JRIA 4MZTA 1ZBJA 1RAGB 2A28A 1AD5A 3VV0A 3ASKA 2L3RA 2RHYA 5L8RE 3E19A 1WIEA 4LXCA 1K8AU 1IB8A 2K57A 3GF5A 3I9QA 3VJPA 1GRIA 4OMQA 3ZEHA 1NM7A 3I56Q 1NPRA 3G4ST 5LJ3d 5CKBA 4OMOA 2C0TA 1F1BB 5D6XA 1K73U 4A4KA 4WCIA 4M77E 4DEYA 2LCSA 1TUDA 3CCSQ 1H3HA 2D8HA 1YJWA 3L2WA 3HPWA 4M7DF 5LJ3f 3A8HB 1GFDA 4N0AA 2XU8A 4KUDK 2DO3A 3C95A 2FZCB 4BE1A 3REBB 2FRWA 2HQXA 3FC3A 1Y71A 3QHSA 1QWEA 3SWNC 4J9GA 5IAYA 2AZSA 2QEXT 2LZ6B 1OQKA 2ZPGB 1YIJA 4LDWA 3I56A 1VQ8T 1WQ7A 3JCMW 1OPLA 2JMAA 1RABB 4FIBA 1M3CA 5GAOn 2RHXA 2O9SA 4IUPA 1N5ZA 1U06A 2PUOB 3TU4K 1KQ2A 4C0DC 5GMKj 3CCSA 1D0ZA 2GBQA 1VQ7T 4M4ZA 1T3SA 3QYGB 4TVRA 3CMEA 4M75G 1OZ2A 3BE3A 2ZAEA 3CCJQ 3CCVQ 1N6AA 2SEMA 3CCUQ 4DA4A 3JB9H 3VS0A 5DLOA 2D8JA 3PE0A 1ZQ1A 4IKFA 4CI0C 1YJNA 2DD5A 3H41A 5FRMA 5LJ5d 2F69A 1QWFA 3A1PA 1YI2T 2HZYA 3M55A 2HKNA 1Z9ZA 2LRQA 2QGGA 5GANg 3CCMT 4PJOB 2NUPB 4AMCA 1EZZB 2RQWA 4KGXB 2P0PA 1N27A 1M2OA 2L3QA 3RDVA 1BCMA 3M56A 2KY9A 1PC0A 4MZPA 2CT4A 5LJ5f 3NFCA 2GFUA 1G8XA 2LJ3A 4F7UG 1YHQT 1OU8A 5CIUA 3CCVA 2E65A 2KMTA 4M77A 3V7RA 2M02A 3G4SQ 3G71A 1AOJA 4Z8AA 2MF2A 3UDCA 2YLBA 4PFPA 5CO7A 4LN2A 1M1KU 1TG0A 4ZGEB 3NMZC 3EG9A 1PHTA 1MMNA 4PJMA 1UUEA 3M4GA 2XDBA 1FYNA 1KQSS 3PMIA 1JXMA 4ELZC 3OW2S 3MJXA 1S1NA 5CCAA 3HTRA 1K8AR 3H8ZA 3GBQA 4KGZB 1WX6A 3OW2A 5I11A 2OTLT 4JUVA 1M1GA 4AFZC 2WSEE 1VQNT 1VQOA 3JCMf 2GQVA 1W2BS 2QAZA 3HFNA 3JCMh 1K73R 1YP5A 2QEXQ 4ZNXA 4F17A 1QCFA 1VQ8Q 1W2BA 3INZA 3G4SA 1VQLT 2MWPA 4JJNK 2LJ0A 2QTVA 1QVFS 1D1AA 4E7JA 4OMPA 2K6DA 3MCAB 1QLYA 2RI3A 4M7DA 3Q1JA 2XK0A 1QVFA 1VQ7Q 4JS4A 3EGDA 1NZ9A 1ZSZC 4C5EA 2IIMA 4R55A 1VQ9T 4M7AD 3OYYA 3EGUA 1UTIA 3EG0A 4R0KA 2V8IA 1WJSA 1QW1A 4JRQA 2RA2A 1TTHB 1C1AA 1N8RC 1K9MU 3EFRA 3HKSA 4AT1B 3UA7A 5DY9A 5J3BA 3CPWA 1T0HA 1YI2Q 1M2VB 2O01E 3G6ET 1UECA 1SF9A 4LDUA 2L0AA 3JRZA 3L2UA 1SEMA 2V1RA 2W0ZA 2X3WD 2LT1A 1PSEA 1VIEA 1KJWA 3CCMQ 1G3TA 2F5TX 2KVQG 1AWWA 4LE9A 4RTTA 1Y7XA 2ZZDA 3CMAT 2VXFA 4XTXA 1MNEA 1ZBXA 2MOXA 2JTMA 5GJVB 2KT8A 1VQ7A 5HKCA 2QASA 5CAIA 1BBZA 2M9UA 1TSFA 1UHCA 5FRNA 4FL6A 2XG8D 1YHQQ 2DZ9A 4OB0B 4N4HA 1LOJA 2DIGA 4M7AG 2I0NA 4CC3A 1NEGA 1Q81C 2A3LA 1Q82U 1U1SA 3TSZA 2LCCA 4ANJA 2F2VA 2OX7A 3SWNA 3LGLA 3LGFA 1YBYA 2K2MA 4PJNA 3C94A 2X51A 5GAOm 3BY7A 1S72A 1X75C 5FU7C 1UGVA 4RTZA 2PVDB 4IIMA 3S3OA 4C5HA 1ABOA 5FU6B 4M7AB 2DX1A 1JJ2P 3AT1B 2DF6A 1QCNA 4NS5A 2OTLQ 3PGGA 1BI3A 2CGHA 1VQNQ 5A0LA 3UT1A 2DL5A 2COZA 2LQWA 4D8DA 4D6WA 5FROA 2M51A 1M1KR 3EG3A 2MK5A 2IG0A 1RAAB 1VQLQ 2JMCA 3MHXA 3PVLA 3HP9A 2VWFA 3QDRB 1VUBA 4OMNA 4F14A 2D1XA 3EGXB 4KULA 2XHCA 3CCRT 2YDLA 2JS2A 3LWIA 2HSPA 1RL2A 2E70A 4OP0A 2EAYA 2E3IA 3VRYA 2OTLA 3M59A 1VQMQ 5A2QE 1VQNA 2PVOB 2K2VA 4ELYC 5KYYA 5GMKm 4IUQA 5GAOl 2G3RA 5KYWB 1IRXA 4QKUA 1IZ6A 2ENMA 3G6EQ 1GL5A 1OI1A 1YJ9T 3J7AF 2ZPIB 3ULRB 2VB6A 2X4YA 1X2QA 1M27C 4JDSA 4QVCA 1PKTA 5C0MA 3CMAQ 2O4XA 2LNHB 1U1TA 3P8DA 2HSEB 2NUTA 1V29B 3NTIA 5IHIA 3CD6A 1LPLA 2ESWA 1G5VA 4C92B 1I1JA 4LUDA 3TEEA 1D0YA 3MO8A 2RHZA 1VQ9A 3CCQT 1K9MR 2PZ1A 5LJ5e 1NE8A 4AFSC 1QP3A 4WTOB 1QVGP 4KGVB 1ZLMA 4PL6A 4PJLA 2J05A 3JCMV 1GBRA 2DTHA 2LP5A 2PTKA 4OMFB 5AYFA 4BE0A 1W1FA 4OGEA 5GAOr 2EBPA 2MPXC 4J9BA 4EMHA 1R0CB 1SSHA 3EHQA 2FZKB 2DXUA 1M3BA 2NLUA 2VV5A 1C0MA 4LD9K 4OGCA 2P4RA 1KFZA 3BDLA 2OAUA 1Q86R 3OYFA 3CMAA 3MEVA 1QKXA 4PJOF 1PNJA 2OJ2A 2RJFA 1Q82R 1ZSZA 2FPEA 3G7ZA 3R6OA 4X9DA 3E1SA 2EKHA 5IXFA 2CUBA 9ATCB 1AT1B 1PSFA 4M77C 3JB9F 4XU3A 1UE9A 4RTXA 1LNXA 1KD1R 2K9GA 1YN8A 2GCXA 3PFSA 2JTFA 1K8AC 3I55Q 2CDTA 4CC2A 5KYXA 4KBMB 2LQ8A 4J9IA 2KK4A 2FPFA 1KHIA 4DBQA 2J6KA 2JT4A 1SRMA 3M54A 3REAB 2DL7A 2V1QA 1MUZA 3WXMB 2V26A 3CCEA 4XAXB 1BB9A 4PJOE 1AWXA 1NJIC 2YUPA 2DXCA 1H641 5LJ3j 2R5MA 3OBYA 1HK9A 1KQ1A 2BTTA 2EGAA 1YJ9Q 4C8QD 4KH0B 2E6ZA 4HVWA 4ZGJB 3OYNA 2E5QA 3O5ZA 3O8VA 4FW2A 2WACA 1CKBA 3PVQA 4F16A 3FJPA 1ZUUA 4C5IA 4MDWA 3T9NA 2P4TA 4M7DC 4RTWA 1TS9A 3QYHB 2MI6A 1YJWQ 4B9WA 2QTXA 1B7TA 2DD4A 4J6YA 4XU0A 3CCRA 1AEYA 2XIDA 5KCHA 3M0RA 1O75A 1VQ4T 3GPLA 2EYYA 4HT8A 5C6SA 4A54A 1VYUA 3KFVA 2CUDA 1B34B 3LWHA 1AWJA 1HSQA 1MMDA 2VC8A 3VS2A 1ZSGA 2LX7A 5GAMh 3M9QA 1VQOT 4KH1B 5GAMg 4E7HA 4JJCA 1KC8U 2X3XD 2DEUA 3QSUA 4N4IA 1G3YA 4XK8E 1YJ9A 1D0XA 4E2FB 1YIJQ 4KUIA 2OI3A 4C8QG 4C5GA 5GAOp 1HYOA 1M90U 4JZ3A 2C0OA 3N5BB 2K5LA 4RUGA 1RADB 1GFCA 3D7SB 2X35A 4K11A 3SDZA 4ATOA 1G3SA 4M75D 3FRNA 1Q95G 2JOYA 4JRKA 2J06A 3CMEQ 1G83A 3MP8A 3FJ5A 3M4YA 3CCQA 5KE2A 1OU9A 4E6RA 5LJ5j 2RQVA 4M78D 1Z9QA 2ZPFB 3CBPA 1SHFA 1YJNQ 3L2VA 4C8QB 3CC2A 1OPKA 2RPNA 4DEXA 3L1AA 3RMQA 1I0CA 2EKOA 2DPPB 2JVVA 2NYSA 2DAQA 3QJ6A 2R58A 4HCZA 2DZCA 3V8JA 1WXBA 3RIRA 4E7SA 2PUKB 3BFMA 2EIFA 4PJOA 5HK0A 2KEAA 1G2BA 1JJ2S 4EPCA 2RI2A 1ZA1B 1JJ2A 1OEBA 4HXJA 1WXUA 1W70A 1U8RA 3QZ5B 1LCKA 1JU5C 2K3YA 1E6GA 1EFNA 1OYXA 4BY6C 3PT9A 3TCJA 4M7DE 2MCNA 3OYIA 3UF4A 3A8LB 3G71Q 4M78G 2BIVA 2HD0A 3RMSA 1OOTA 3KXTA 1PRLC 2YLCA 1WHKA 4QQGA 1NLPC 1ZA2B 4JJDA
chains in the Genus database with same CATH topology
2YSQA 2L0AA 1SEMA 2V1RA 2W0ZA 2X3WD 1KJWA 4Z89A 1T3LA 1JQQA 2L2PA 2HBWA 1AWWA 1YNZA 2GGRA 4LE9A 4RTTA 4HCKA 1J3TA 4GLMA 2C0IA 1Y57A 1UHFA 3IQLA 2DRKA 2MOXA 5GJVB 2ROTA 2KT8A 4X1VA 3NGPA 1BBZA 3A98A 1YCSB 1UHCA 2JS0A 2H8HA 4QT7A 1KIKA 2DRMA 1ZUKA 1Y0MA 3RNJA 1SPKA 1JEGA 3NPFA 1MV0B 3RBBB 2I0NA 2NWMA 4CC3A 1NEGA 1M30A 4ORZA 3VRZA 3TSZA 1X6GA 2F2VA 5I22A 2CSQA 2EGEA 4HVVA 4JJBA 5HCKA 3EG2A 2ED1A 1NLOC 4CC4B 4Y92A 2KYBA 2K2MA 2RQUA 3VS6A 2LMJA 1UGVA 2KRSA 4RTZA 2KBTA 1ABQA 4IIMA 3CQTA 1ABOA 1UG1A 2AKKA 2RN8A 2A36A 2DX1A 2F2WA 2DF6A 2FPDA 2JW4A 1FMKA 4AG1C 3UATA 2DL5A 2KRNA 2GQIA 3LH5A 2LQWA 4D8DA 2RNAA 1M8MA 1WFWA 2M51A 1IO6A 3EG3A 5FWCA 2JMCA 3PVLA 2G6FX 1TUCA 4RTYA 1QKWA 2O88A 2VWFA 2DLPA 4OMNA 4F14A 2D1XA 1B07A 1U5SA 1GBQA 3VS7A 1A0NB 2KXDA 2SRCA 1RLPC 2O9VA 3UA6A 1B3QA 3M0PA 2KNBB 1WDXA 1U3OA 3QWYA 1UJ0A 1AWOA 1V1CA 4J9HA 2J6OA 2YDLA 1XOVA 2EGCA 2JS2A 2HSPA 2HDAA 1M3AA 3R6NA 3VRYA 1E6HA 4JPBW 4D8KA 5ECAA 3VS1A 1X2KA 3THKA 5IHNA 1HJDA 2D0NA 2JM8A 1SHGA 3U23A 1NYFA 2L3SA 3EG1A 1X27A 2ENMA 3M0TA 1GL5A 3H0HA 2RF0A 2RQRA 3I5RA 2GNCA 1ZX6A 2F2XA 1RLQC 4AG2C 3ULRB 1UJYA 5IH2A 1ARKA 2DL8A 1OV3A 1X2QA 1M27C 4GBQA 3TVTA 2GTOA 1PKTA 2KYMA 2KROA 2E5KA 2EVRA 1X6BA 1JXOA 2LNHB 3M0SA 2FEIA 5IHIA 4LNPA 3VS5A 2ESWA 2BZXA 2A37A 2M0YA 2OAWA 1I1JA 2RMOA 4LUDA 2DA9A 1KSWA 1UFFA 2CREA 2EW3A 1MV3A 2YUQA 2PZ1A 4AFSC 2BZ8A 3QWXX 1ZLMA 1ZBJA 2J05A 2A28A 1GBRA 1AD5A 1T0JA 2LP5A 1VYVA 2LQNA 2PTKA 1X43A 3SEMA 2DJQA 2MIOA 1K0SA 1WIEA 4J9DA 4AFUC 2KR3A 1W1FA 2EBPA 4J9BA 3I9QA 2DL4A 2KXCA 1SSHA 1GRIA 3EHQA 4OMQA 4RTUA 1NM7A 1M3BA 1WLPB 2A08A 2P4RA 2C0TA 4OMOA 2EPDA 1KFZA 2DNUA 4WCIA 2K79A 4DEYA 2LCSA 1QKXA 1GCQA 1PNJA 1TUDA 1H3HA 2OJ2A 1E7OA 2D8HA 1K1ZA 2FPEA 1K0XA 4A63B 2CT3A 2HCKA 2EKHA 5IXFA 4KRTA 2CUBA 2RQTA 2O31A 2DL3A 4HVUA 1PRMC 4OMLA 1GFDA 1UE9A 4RTXA 4J9CA 2K9GA 2FRYA 3REBB 2XMFA 1YN8A 2FRWA 1QWEA 2CDTA 1JO8A 4CC2A 4J9GA 4J9IA 2AZSA 2B86A 2JXBA 2FPFA 2LZ6B 1H92A 2VVKA 2KRMA 2J6KA 2JT4A 1SRMA 1SRLA 1OPLA 2YUOA 1NEBA 2JMAA 3REAB 2DL7A 1M3CA 2V1QA 1MUZA 2FO0A 2O9SA 2L3PA 5IHKA 1N5ZA 1U06A 3M0QA 2ROLA 1ZUYA 1BB9A 4Z88A 1AWXA 1AZGB 3I35A 2YUPA 2GBQA 2DE0X 4M4ZA 2KGTA 1T3SA 2JTEA 1BK2A 2VKNA 2DYBA 3SHWA 2BTTA 4ESRA 2EGAA 3JV3A 2LJ1A 1BU1A 2SEMA 3VS0A 2D8JA 3PE0A 4HVWA 5EC7A 3O5ZA 1NG2A 3H41A 1CKBA 1X69A 3PVQA 4F16A 1ZUUA 1QWFA 1K76A 2QDLA 4FSSA 2K7AA 4RTWA 2ABLA 1HD3A 1PKSA 5GJWB 1Z9ZA 2EYWA 1AEYA 2RQWA 1PWTA 1WI7A 2L3QA 3M0RA 4IIOA 4RTVA 4OMMA 2EYYA 2HEQA 2ED0A 1VYUA 3KFVA 2CUDA 2EYXA 2CT4A 1AWJA 1HSQA 5FWBA 3VS2A 1ZSGA 2LJ3A 2LX7A 2AK5A 4JJCA 2DBKA 2X3XD 1NYGA 5IXBA 3C0CA 2GTJA 2J7IA 1AOJA 2OI3A 4Z8AA 2AKLA 1CSKA 1RUWA 4JZ3A 4LN2A 2C0OA 4EIKA 1TG0A 4RUGA 1GFCA 2ECZA 1WA7A 3NMZC 2CSIA 4K11A 1PHTA 2O2OA 2FG0A 1UUEA 1FYNA 1VA7A 2J06A 1JXMA 3H0IA 3VS4A 1G83A 1I07A 2EYZA 3FJ5A 3EHRA 1S1NA 4E6RA 1K9AA 2RQVA 4JZ4A 4J9EA 1CKAA 2CH4W 3GBQA 1Z9QA 1H8KA 1WX6A 2DM1A 5I11A 5L23A 1SHFA 1WXTA 1AVZC 1W6XA 1OPKA 1YWOA 2RPNA 4J9FA 4AFZC 4DEXA 1WYXA 1I0CA 4CC7A 1YP5A 4ZNXA 4F17A 3NHNA 1WXBA 1QCFA 4AFQC 2YUNA 1RI9A 2AZVA 2DILA 2KEAA 2K3BA 1G2BA 3I5SA 1VYTA 2DBMA 2LJ0A 3M0UA 2CH4A 5FW9A 4OMPA 2K6DA 4LUEA 1QLYA 3TSWA 1OEBA 4HXJA 1WXUA 1W70A 1K4US 1GCQC 2KT1A 2J6FA 1LCKA 2W10A 1JU5C 1GCPA 1E6GA 1EFNA 2IIMA 1AZEA 2BZYA 2MCNA 3EGUA 1UTIA 3EG0A 2YT6A 4R0KA 1YWPA 2DMOA 3UF4A 3VS3A 2EQIA 3H0FA 2KE9A 1OOTA 2DVJA 2PNIA 2JM9A 2NUZA 3UA7A 1PRLC 1UDLA 1T0HA 1NLPC 3ZL7C 4JJDA 1UECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YSQ A;  2L0A A;  1SEM A;  2V1R A;  2W0Z A;  2X3W D;  1KJW A;  4Z89 A;  1T3L A;  1JQQ A;  2L2P A;  2HBW A;  1AWW A;  1YNZ A;  2GGR A;  4LE9 A;  4RTT A;  4HCK A;  1J3T A;  4GLM A;  2C0I A;  1Y57 A;  1UHF A;  3IQL A;  2DRK A;  2MOX A;  5GJV B;  2ROT A;  2KT8 A;  4X1V A;  3NGP A;  1BBZ A;  3A98 A;  1YCS B;  1UHC A;  2JS0 A;  2H8H A;  4QT7 A;  1KIK A;  2DRM A;  1ZUK A;  1Y0M A;  3RNJ A;  1SPK A;  1JEG A;  3NPF A;  1MV0 B;  3RBB B;  2I0N A;  2NWM A;  4CC3 A;  1NEG A;  1M30 A;  4ORZ A;  3VRZ A;  3TSZ A;  1X6G A;  2F2V A;  5I22 A;  2CSQ A;  2EGE A;  4HVV A;  4JJB A;  5HCK A;  3EG2 A;  2ED1 A;  1NLO C;  4CC4 B;  4Y92 A;  2KYB A;  2K2M A;  2RQU A;  3VS6 A;  2LMJ A;  1UGV A;  2KRS A;  4RTZ A;  2KBT A;  1ABQ A;  4IIM A;  3CQT A;  1ABO A;  1UG1 A;  2AKK A;  2RN8 A;  2A36 A;  2DX1 A;  2F2W A;  2DF6 A;  2FPD A;  2JW4 A;  1FMK A;  4AG1 C;  3UAT A;  2DL5 A;  2KRN A;  2GQI A;  3LH5 A;  2LQW A;  4D8D A;  2RNA A;  1M8M A;  1WFW A;  2M51 A;  1IO6 A;  3EG3 A;  5FWC A;  2JMC A;  3PVL A;  2G6F X;  1TUC A;  4RTY A;  1QKW A;  2O88 A;  2VWF A;  2DLP A;  4OMN A;  4F14 A;  2D1X A;  1B07 A;  1U5S A;  1GBQ A;  3VS7 A;  1A0N B;  2KXD A;  2SRC A;  1RLP C;  2O9V A;  3UA6 A;  1B3Q A;  3M0P A;  2KNB B;  1WDX A;  1U3O A;  3QWY A;  1UJ0 A;  1AWO A;  1V1C A;  4J9H A;  2J6O A;  2YDL A;  1XOV A;  2EGC A;  2JS2 A;  2HSP A;  2HDA A;  1M3A A;  3R6N A;  3VRY A;  1E6H A;  4JPB W;  4D8K A;  5ECA A;  3VS1 A;  1X2K A;  3THK A;  5IHN A;  1HJD A;  2D0N A;  2JM8 A;  1SHG A;  3U23 A;  1NYF A;  2L3S A;  3EG1 A;  1X27 A;  2ENM A;  3M0T A;  1GL5 A;  3H0H A;  2RF0 A;  2RQR A;  3I5R A;  2GNC A;  1ZX6 A;  2F2X A;  1RLQ C;  4AG2 C;  3ULR B;  1UJY A;  5IH2 A;  1ARK A;  2DL8 A;  1OV3 A;  1X2Q A;  1M27 C;  4GBQ A;  3TVT A;  2GTO A;  1PKT A;  2KYM A;  2KRO A;  2E5K A;  2EVR A;  1X6B A;  1JXO A;  2LNH B;  3M0S A;  2FEI A;  5IHI A;  4LNP A;  3VS5 A;  2ESW A;  2BZX A;  2A37 A;  2M0Y A;  2OAW A;  1I1J A;  2RMO A;  4LUD A;  2DA9 A;  1KSW A;  1UFF A;  2CRE A;  2EW3 A;  1MV3 A;  2YUQ A;  2PZ1 A;  4AFS C;  2BZ8 A;  3QWX X;  1ZLM A;  1ZBJ A;  2J05 A;  2A28 A;  1GBR A;  1AD5 A;  1T0J A;  2LP5 A;  1VYV A;  2LQN A;  2PTK A;  1X43 A;  3SEM A;  2DJQ A;  2MIO A;  1K0S A;  1WIE A;  4J9D A;  4AFU C;  2KR3 A;  1W1F A;  2EBP A;  4J9B A;  3I9Q A;  2DL4 A;  2KXC A;  1SSH A;  1GRI A;  3EHQ A;  4OMQ A;  4RTU A;  1NM7 A;  1M3B A;  1WLP B;  2A08 A;  2P4R A;  2C0T A;  4OMO A;  2EPD A;  1KFZ A;  2DNU A;  4WCI A;  2K79 A;  4DEY A;  2LCS A;  1QKX A;  1GCQ A;  1PNJ A;  1TUD A;  1H3H A;  2OJ2 A;  1E7O A;  2D8H A;  1K1Z A;  2FPE A;  1K0X A;  4A63 B;  2CT3 A;  2HCK A;  2EKH A;  5IXF A;  4KRT A;  2CUB A;  2RQT A;  2O31 A;  2DL3 A;  4HVU A;  1PRM C;  4OML A;  1GFD A;  1UE9 A;  4RTX A;  4J9C A;  2K9G A;  2FRY A;  3REB B;  2XMF A;  1YN8 A;  2FRW A;  1QWE A;  2CDT A;  1JO8 A;  4CC2 A;  4J9G A;  4J9I A;  2AZS A;  2B86 A;  2JXB A;  2FPF A;  2LZ6 B;  1H92 A;  2VVK A;  2KRM A;  2J6K A;  2JT4 A;  1SRM A;  1SRL A;  1OPL A;  2YUO A;  1NEB A;  2JMA A;  3REA B;  2DL7 A;  1M3C A;  2V1Q A;  1MUZ A;  2FO0 A;  2O9S A;  2L3P A;  5IHK A;  1N5Z A;  1U06 A;  3M0Q A;  2ROL A;  1ZUY A;  1BB9 A;  4Z88 A;  1AWX A;  1AZG B;  3I35 A;  2YUP A;  2GBQ A;  2DE0 X;  4M4Z A;  2KGT A;  1T3S A;  2JTE A;  1BK2 A;  2VKN A;  2DYB A;  3SHW A;  2BTT A;  4ESR A;  2EGA A;  3JV3 A;  2LJ1 A;  1BU1 A;  2SEM A;  3VS0 A;  2D8J A;  3PE0 A;  4HVW A;  5EC7 A;  3O5Z A;  1NG2 A;  3H41 A;  1CKB A;  1X69 A;  3PVQ A;  4F16 A;  1ZUU A;  1QWF A;  1K76 A;  2QDL A;  4FSS A;  2K7A A;  4RTW A;  2ABL A;  1HD3 A;  1PKS A;  5GJW B;  1Z9Z A;  2EYW A;  1AEY A;  2RQW A;  1PWT A;  1WI7 A;  2L3Q A;  3M0R A;  4IIO A;  4RTV A;  4OMM A;  2EYY A;  2HEQ A;  2ED0 A;  1VYU A;  3KFV A;  2CUD A;  2EYX A;  2CT4 A;  1AWJ A;  1HSQ A;  5FWB A;  3VS2 A;  1ZSG A;  2LJ3 A;  2LX7 A;  2AK5 A;  4JJC A;  2DBK A;  2X3X D;  1NYG A;  5IXB A;  3C0C A;  2GTJ A;  2J7I A;  1AOJ A;  2OI3 A;  4Z8A A;  2AKL A;  1CSK A;  1RUW A;  4JZ3 A;  4LN2 A;  2C0O A;  4EIK A;  1TG0 A;  4RUG A;  1GFC A;  2ECZ A;  1WA7 A;  3NMZ C;  2CSI A;  4K11 A;  1PHT A;  2O2O A;  2FG0 A;  1UUE A;  1FYN A;  1VA7 A;  2J06 A;  1JXM A;  3H0I A;  3VS4 A;  1G83 A;  1I07 A;  2EYZ A;  3FJ5 A;  3EHR A;  1S1N A;  4E6R A;  1K9A A;  2RQV A;  4JZ4 A;  4J9E A;  1CKA A;  2CH4 W;  3GBQ A;  1Z9Q A;  1H8K A;  1WX6 A;  2DM1 A;  5I11 A;  5L23 A;  1SHF A;  1WXT A;  1AVZ C;  1W6X A;  1OPK A;  1YWO A;  2RPN A;  4J9F A;  4AFZ C;  4DEX A;  1WYX A;  1I0C A;  4CC7 A;  1YP5 A;  4ZNX A;  4F17 A;  3NHN A;  1WXB A;  1QCF A;  4AFQ C;  2YUN A;  1RI9 A;  2AZV A;  2DIL A;  2KEA A;  2K3B A;  1G2B A;  3I5S A;  1VYT A;  2DBM A;  2LJ0 A;  3M0U A;  2CH4 A;  5FW9 A;  4OMP A;  2K6D A;  4LUE A;  1QLY A;  3TSW A;  1OEB A;  4HXJ A;  1WXU A;  1W70 A;  1K4U S;  1GCQ C;  2KT1 A;  2J6F A;  1LCK A;  2W10 A;  1JU5 C;  1GCP A;  1E6G A;  1EFN A;  2IIM A;  1AZE A;  2BZY A;  2MCN A;  3EGU A;  1UTI A;  3EG0 A;  2YT6 A;  4R0K A;  1YWP A;  2DMO A;  3UF4 A;  3VS3 A;  2EQI A;  3H0F A;  2KE9 A;  1OOT A;  2DVJ A;  2PNI A;  2JM9 A;  2NUZ A;  3UA7 A;  1PRL C;  1UDL A;  1T0H A;  1NLP C;  3ZL7 C;  4JJD A;  1UEC A; 
#chains in the Genus database with same CATH topology
 5GAN f;  3OY9 A;  4FYX B;  4C92 C;  4HCC A;  5GAN h;  4IUT A;  4M75 B;  1S72 T;  4Z89 A;  2M16 A;  1VQ6 T;  1JQQ A;  1VQ4 Q;  2HBW A;  2GGR A;  2QA4 A;  5GAN 4;  1J3T A;  2GFA A;  1UHF A;  3IQL A;  4M78 B;  5HK3 A;  2L89 A;  3JCM J;  2CKK A;  3OB9 A;  4M77 D;  1YCS B;  3P8B B;  1VQO Q;  2H8H A;  1LVK A;  1SPK A;  2Y4X A;  3H9N A;  3NPF A;  4MZM A;  1WJR A;  3X20 B;  1M30 A;  1IHW A;  3TQ7 P;  2RK1 A;  4FYY B;  5HCK A;  3DKM A;  3LH0 A;  4DBF A;  5D6Y A;  3JCM d;  3EH1 A;  2ED1 A;  4CC4 B;  1Q7Y C;  2RJC A;  4GY5 A;  1MGQ A;  2EQK A;  4V2S A;  4F7U B;  2LMJ A;  1BIA A;  1C6V X;  1ABQ A;  4JS5 A;  1VQ4 A;  1KQS A;  1MMG A;  2AKK A;  2RN8 A;  3OS0 A;  2RHU A;  1VQP A;  1KC8 R;  4C92 F;  4XU2 A;  3MP6 A;  1WJQ A;  2OTJ T;  3G1J A;  5GAN 3;  3UAT A;  3J81 E;  1M90 R;  2GQI A;  4M77 G;  1WFW A;  1M2V A;  5GAN 2;  3A5Z B;  1BI0 A;  2E64 A;  3HL8 A;  3OS1 A;  5GMK h;  1BKB A;  2HNI A;  5FWC A;  2QQB A;  2F5K A;  2V8J A;  5D6W A;  2O88 A;  4FT2 A;  3OSS C;  2DLP A;  2DXB A;  4BUG A;  3GNF B;  1TU0 B;  3VS7 A;  1A0N B;  1WQW A;  4ZGD B;  3CD6 T;  1B3Q A;  3M0P A;  3QWY A;  1V1C A;  4J9H A;  2J6O A;  2L5Q A;  1XOV A;  2FHD A;  3VUB A;  3RKY A;  2HDA A;  4KT0 E;  1M3A A;  4C92 E;  1EIF A;  2CP6 A;  3R6N A;  1E6H A;  4ZN3 A;  4D8K A;  5ECA A;  1V76 A;  1X2K A;  2LCL A;  5IHN A;  1HJD A;  2JM8 A;  1D1B A;  3U23 A;  2B8A A;  3ZBD A;  3CXC S;  3M0T A;  2RF0 A;  3I5R A;  5KYU A;  1ZX6 A;  2RK2 A;  1I81 A;  4ZTF A;  3JB9 J;  5KYN A;  5GAN 5;  1S72 Q;  1PM3 A;  2Y90 A;  2DTO A;  3QBY A;  2HQH A;  3CXC A;  2C06 A;  2DL8 A;  2HKQ B;  4GBQ A;  3TVT A;  3QPH A;  2GTO A;  4FYW B;  2KYM A;  5KCO A;  4MMK A;  2KRO A;  1R8O B;  2E41 A;  4IUU A;  3PNW C;  2JUF A;  4R56 A;  1JXO A;  4RG2 A;  2BZX A;  3VUZ A;  2DA9 A;  1Q86 U;  1KSW A;  1UFF A;  2CRE A;  2YUQ A;  3OYA A;  4A4H A;  1D09 B;  4NOY A;  2R57 A;  1JRI A;  4PK4 A;  1T0J A;  1VYV A;  4EMK B;  1QQJ A;  3SEM A;  2DJQ A;  1K0S A;  4J9D A;  4AFU C;  3S3N A;  3VYG A;  4J7F A;  2KXC A;  3A8O B;  4RTU A;  1YIT T;  4XQ3 A;  1KD1 U;  2HL5 C;  1JB0 E;  1D3B B;  1UGQ B;  3RKW A;  1VQ6 A;  1WLP B;  4A4F A;  1R0B G;  2A08 A;  3HFO A;  2EPD A;  4ME7 A;  4WF2 A;  5CR2 A;  3JAM E;  2DNU A;  1IGU A;  3CBM A;  3CCE T;  1WGS A;  2PVG B;  2WSF E;  4JRP A;  2OTJ Q;  2IVW A;  1WHJ A;  5J39 A;  1E7O A;  5CKE A;  1K1Z A;  4N4G A;  5LJ3 e;  1K0X A;  4A63 B;  4KRT A;  2RQT A;  3QDF A;  2A7Y A;  2CZ6 B;  4J7I A;  5I21 A;  2DL3 A;  4HVU A;  5M9O A;  1PRM C;  4Y91 A;  4C0Z A;  3F70 A;  3QKJ A;  3PTA A;  4J9C A;  3GIB A;  3L2Z A;  1JO8 A;  2DKG A;  2CZ0 B;  3EH2 A;  2MWO A;  4RCB A;  2JXB A;  4C92 A;  1H92 A;  3CD6 Q;  2KQW A;  1RAF B;  1VQ9 Q;  3WVE B;  3OYM A;  5KH6 A;  1NBE B;  5IHK A;  3M0Q A;  1I8F A;  2BE9 B;  1ZUY A;  3SWN B;  8ATC B;  1AZG B;  2QGF B;  2OTJ A;  3CCL T;  2DVE A;  3A8M B;  4OVA A;  2DE0 X;  2KGT A;  4FM4 B;  2JTE A;  2L8D A;  2RJD A;  4LDX A;  3SHW A;  1UGR B;  2LDM A;  1RI0 A;  2LJ1 A;  4GLK A;  1BU1 A;  2RH2 A;  3SB2 A;  2KAF A;  2EFI A;  4PJO C;  5EC7 A;  4PLL A;  1NG2 A;  4C0D B;  4J5Y A;  1BI2 A;  2E6N A;  3X28 B;  1FX7 A;  3DB3 A;  4PJJ A;  5A0G A;  3M53 A;  2QDL A;  4O5V A;  3VKI A;  5CKH A;  1HD3 A;  5GJW B;  2EYW A;  5KE3 A;  3ER0 A;  2XD0 A;  3E9F A;  1WI7 A;  4UC4 A;  4IIO A;  4RTV A;  1RAI B;  2HEQ A;  1FXX A;  2ED0 A;  3OYJ A;  3CC2 T;  1I5L A;  2QXF A;  4JLI A;  5FWB A;  1Y96 A;  3EFO B;  2EYQ A;  3PIP A;  1DJ7 B;  2KSS A;  2DBK A;  4P5N A;  3KUF A;  2YRV A;  3URG A;  5IXB A;  1H3Z A;  2GTJ A;  4IUV A;  2J7I A;  5GAN 8;  2AKL A;  1RAC B;  4EIK A;  3DLL A;  2ECZ A;  1IHV A;  2BUD A;  3CCE Q;  5GMK l;  4M75 F;  2WSC E;  2VAS A;  2O2O A;  4A53 A;  2ZPB B;  3GNG A;  1W2B P;  4LDY A;  4MML A;  1VA7 A;  1WZO A;  2RHI A;  3H0I A;  3RR6 A;  3VS4 A;  3QO3 A;  2RO0 A;  4M78 F;  3EHR A;  2PU9 B;  2EQM A;  4IUR A;  1K9A A;  1MND A;  4JZ4 A;  1CKA A;  2CH4 W;  3MET A;  1H8K A;  3JCM e;  2DM1 A;  3JCM X;  3JCM Q;  1R77 A;  5L23 A;  2EQU A;  1G3W A;  4Q5W A;  2ZPE B;  2DJZ A;  1QVF P;  1WXT A;  2CP5 A;  8AT1 B;  1AVZ C;  4J9F A;  4OF1 A;  5CQY A;  2YXY A;  2YWW A;  1O9S A;  1AHJ B;  4PKC C;  1ZHI A;  1YIT A;  2X4W A;  2FYK A;  4A4E A;  3HSB A;  3E2U A;  1RI9 A;  3CCR Q;  2DXT A;  1TH7 A;  2M0O A;  3I5S A;  7AT1 B;  1K73 C;  4J6W A;  2ZPH B;  2DBM A;  3OS2 A;  3M0U A;  2P0K A;  2QA4 T;  4PFZ A;  4F7U F;  3CPW P;  1B34 A;  4M75 E;  1OZ3 A;  3CCL Q;  1OUL A;  1K4U S;  1OX9 A;  1GCQ C;  1VIF A;  2W10 A;  4X34 A;  4E7Z A;  2EJG A;  4QQD A;  1I4K 1;  2MAM A;  1AZE A;  1N8R R;  4OB1 B;  3OYH A;  4FCY A;  1YWP A;  2K3X A;  1D1C A;  3VU3 C;  3VS3 A;  3X26 B;  4BD3 A;  2EQI A;  2VXE A;  4ZN1 A;  1TWB A;  2KE9 A;  5GAM d;  1YFN A;  2JM9 A;  2NUZ A;  2JJ9 A;  3OS5 A;  2LVM A;  1UDL A;  1ZSZ B;  2CP3 A;  3CCJ T;  3VYH B;  3ZL7 C;  4E7I A;  2LX9 A;  2COY A;  3FDR A;  2DK3 A;  4RCC A;  5DLQ E;  3CCQ Q;  2L2P A;  1YNZ A;  3KBG A;  1VOM A;  4F7U E;  1VQP T;  4C8Q A;  1UEB A;  4PLI A;  1VQK A;  2XI9 A;  3CCL A;  3CC2 Q;  2DYI A;  5KYX B;  5GAM f;  4BAC A;  3QUI A;  3QXE B;  1Q81 R;  3NGP A;  3A98 A;  1EX4 A;  2JS0 A;  4LDV A;  4QT7 A;  2HAX A;  1KIK A;  2LTO A;  2KI7 A;  3RNJ A;  1IGQ A;  1NPP A;  3HRS A;  3RBB B;  3UPU A;  4ORZ A;  3OMC A;  3WVD B;  4DOW A;  3UWN A;  1VQ5 T;  1X6G A;  1PD0 A;  5I22 A;  1BCO A;  4JJB A;  5FU6 C;  3EG2 A;  5GAN j;  4M7A C;  4C0F A;  5AT1 B;  1NLO C;  4Y92 A;  4L5G A;  4RKU E;  5LL6 S;  1TUG B;  4XTV A;  3VS6 A;  2BE7 D;  4BDY A;  2AT1 B;  2KRS A;  3H6Z A;  2KBT A;  2EJ9 A;  3CQT A;  2LNV A;  1M8V A;  1XTD A;  4DQ2 A;  3P8H A;  3FLG A;  2FPD A;  5DM7 R;  2JW4 A;  4Y28 E;  2QK0 A;  1FMK A;  4LD6 A;  1NJI U;  4L6V 5;  4PJO D;  3LH5 A;  2KRN A;  1M8M A;  5FU7 B;  3OYG A;  1IO6 A;  3MKD A;  2YHT A;  3TRE A;  4M75 A;  1QVP A;  2NUP A;  2AHJ B;  2G6F X;  2X4X A;  5LJ3 h;  4RTY A;  5LJ3 g;  1M1K C;  3JB9 D;  2HL3 A;  3CPF A;  2QA4 Q;  4J8O A;  3GP8 A;  4M78 A;  1SG5 A;  1U5S A;  1GBQ A;  2KXD A;  1RLP C;  4XU1 A;  2O9V A;  3UA6 A;  2E3H A;  3OQ5 A;  5GAN d;  4M7A F;  3HRT A;  1UJ0 A;  5CKD A;  4X9C A;  3OSV A;  3LLR A;  2EGC A;  3L2R A;  3RES A;  3OYD A;  2D6F A;  3VS1 A;  3FB9 A;  1QMC A;  3DLM A;  1SHG A;  4PJO G;  1NYF A;  2L3S A;  3EG1 A;  3E9G A;  3SFM A;  4F7U A;  4B9X A;  2RQR A;  3OYK A;  2XDP A;  1RLQ C;  4HA8 A;  2D9T A;  1ARK A;  5IT9 E;  1OV3 A;  4FT4 A;  4QW2 A;  1VQP Q;  3JB9 G;  2E5K A;  2EVR A;  1YCY A;  5CQX A;  2HMA A;  2E12 A;  4QQ6 A;  2FEI A;  3HHT B;  3OYC A;  4M7A E;  2CZ1 B;  4LNP A;  2OAW A;  2A37 A;  2RMO A;  1QCO A;  2EWN A;  4XTZ A;  2EW3 A;  2FZG B;  1KK7 A;  2CP7 A;  5IN1 A;  1MHN A;  2LQN A;  1VQ5 Q;  1X43 A;  2MIO A;  1K9M C;  5CK9 A;  5LJ5 h;  5LJ5 g;  4CRI A;  3V8K A;  2KR3 A;  2DIQ A;  3CCJ A;  1UB4 A;  3AHU A;  2DL4 A;  3CCU A;  4MDX A;  1QVG S;  4E47 A;  1IRE B;  5GAO q;  1UGS B;  4XTW A;  2RM4 A;  2K79 A;  4EDU A;  1QVG A;  1GCQ A;  4BI3 A;  4HCB A;  2PQW A;  2K5F A;  3CEY A;  4ZTJ A;  4JLG A;  1Q86 C;  3S6W A;  1BYM A;  2CT3 A;  2HCK A;  1N9R A;  2GF7 A;  2O31 A;  3J80 E;  1WNL A;  1ACM B;  4OML A;  1Q82 C;  2YRD A;  4M7D D;  4O6J A;  1VQ5 A;  2FRY A;  3ZFJ A;  2XMF A;  2Z0W A;  2JZ2 A;  3JCM g;  2B86 A;  1KD1 C;  2VVK A;  3EFS A;  2KRM A;  3MPU B;  3JCM P;  4BI8 B;  1SRL A;  4M77 B;  2YUO A;  1NEB A;  1NJI R;  6AT1 B;  2DEQ A;  2FO0 A;  2L3P A;  3SD4 A;  2ROL A;  4EMK A;  4J83 A;  4Z88 A;  3I35 A;  4XTU A;  2V8K A;  2KDS A;  3EG9 B;  1XQH A;  4C0G A;  1BK2 A;  2VKN A;  2DYB A;  4RG8 A;  2E4H A;  3LX7 A;  4ESR A;  3JV3 A;  1D3B A;  1OX8 A;  1SSF A;  2CS7 A;  2FB7 A;  2FVU A;  1VQ6 Q;  3CPW S;  4M7A A;  2VYT A;  4M7D G;  1VQM T;  1X69 A;  1XJW B;  2EJF A;  1M5Q 1;  2H3E B;  1K76 A;  2QEX A;  3MEW A;  4FSS A;  2IPO B;  1Q7Y U;  2K7A A;  1VQ8 A;  3MEA A;  3V7S A;  1WHM A;  2ABL A;  1PKS A;  1BI1 A;  1KHC A;  1PWT A;  2D0Q B;  5GAM e;  4OMM A;  3CC7 T;  2QQA A;  2EYX A;  2COW A;  3EGX A;  5EG2 A;  4M7D B;  2LT4 A;  3OYE A;  2AK5 A;  3ME9 A;  4YTL A;  2K5I A;  1NYG A;  3EGD B;  3GLX A;  4DBR A;  2EQJ A;  1GXI E;  3S3M A;  2JN0 A;  3C0C A;  5I2S A;  5A0D A;  1IXD A;  4E7K A;  3QII A;  4DOV A;  3L42 A;  1CSK A;  2CP0 A;  1RUW A;  3V8L A;  4J6X A;  4A4G A;  1LJO A;  1M9S A;  3RUX A;  3QG1 A;  1WA7 A;  2CSI A;  4C8Q C;  1SKU B;  1YI2 A;  2JNG A;  2FG0 A;  5D7U A;  4RMO A;  5KYW A;  3JSC A;  1I07 A;  3CCM A;  5KYU B;  2EYZ A;  1M4Z A;  2LQK A;  4J9E A;  4PNO A;  4NL2 A;  3C12 A;  3CC4 T;  3FEO A;  2XDD A;  2X9H A;  2VGM A;  2MYS A;  4C92 D;  3CBO A;  1W6X A;  1YWO A;  3L2Q A;  1WYX A;  3BW1 A;  4CC7 A;  1N8R U;  2CZ7 B;  3X25 B;  3OYL A;  1YHQ A;  3RKX A;  4FSX A;  2HQE A;  3NHN A;  4AFQ C;  2YUN A;  2XIC A;  2RI5 A;  2ZGW A;  2AZV A;  2DIL A;  1TOV A;  2K3B A;  4VUB A;  1VYT A;  2Y4Y A;  2CH4 A;  5FW9 A;  3I55 T;  4LUE A;  3TSW A;  1VQK T;  3EFO A;  3PIO A;  5CKF A;  2KT1 A;  2J6F A;  1WHH A;  3QZ9 B;  3JCM c;  2MMP A;  1WHL A;  1GCP A;  4BB7 A;  5FLX E;  5GAN 6;  4C8Q F;  2M1H A;  2BZY A;  3RER A;  2QDY B;  2QQR A;  5GAN 7;  2I2L A;  2DTI A;  2DMO A;  2YT6 A;  2HBP A;  4M75 C;  1Q81 U;  3H0F A;  2K4Y A;  4DBH A;  4N0A C;  2DVJ A;  3PMT A;  5GAN e;  2PNI A;  4C92 G;  3M5A A;  4M78 C;  2QQS A;  3MEU A;  3EAE A;  2P0Q A;  4BY6 B;  4FYV B;  1N9S A;  2P84 A;  2YSQ A;  1VQL A;  1KG1 A;  1HXD A;  2R5A A;  5GMK i;  1PG5 B;  1T3L A;  2F1L A;  1RAE B;  2DFU A;  4PFO A;  2CP2 A;  4HCK A;  3CC7 Q;  3NTK A;  4GLM A;  2C0I A;  1RAH B;  3LW5 E;  1Y57 A;  3OA6 A;  4BDZ A;  2DRK A;  3C4S A;  2ROT A;  4X1V A;  2XKO C;  2RD1 A;  1YJW T;  3X24 B;  1PD1 A;  4C8Q E;  4NL3 A;  2DRM A;  1ZUK A;  1Y0M A;  1YIT Q;  1KQS P;  1JEG A;  2BKD N;  1MV0 B;  3OW2 P;  2NWM A;  4FU6 A;  1JBM A;  1Q7Y R;  3VRZ A;  2YRC A;  3JCM b;  1VQM A;  2CSQ A;  2EGE A;  4HVV A;  4BE2 A;  2H3J A;  5KYY B;  1UGP B;  2KYB A;  3G6E A;  2RQU A;  2QQ9 A;  3DB4 A;  1I5O B;  5HY6 A;  1X01 A;  1YIJ T;  3I56 T;  2ATC B;  3OMG A;  4QVD A;  5GAM j;  3GOX A;  1UG1 A;  3CC7 A;  2A36 A;  2RJE A;  2F2W A;  3CC4 Q;  5GMK e;  1W4S A;  3CCS T;  4Z02 A;  4AG1 C;  2O4X B;  3OBW A;  3HRU A;  1KC8 C;  2NUT B;  3CME T;  2RNA A;  2QI2 A;  4HKE A;  5J26 A;  1FMV A;  2LC4 A;  4EMG A;  5CVI A;  1M90 C;  3QJY A;  1TUC A;  1YJN T;  1QKW A;  1QP2 A;  2E1H A;  2DER A;  1BIB A;  1WHG A;  1B07 A;  1Y96 B;  1VQK Q;  2SRC A;  2CYZ B;  1FWZ A;  3JB9 I;  4HT9 A;  3M58 A;  3OYB A;  4QVZ A;  2KNB B;  1WDX A;  1U3O A;  3FIF A;  3NTH A;  3CXC P;  1AWO A;  4M78 E;  1WPY A;  1M1F A;  2QG9 B;  3CC4 A;  1P92 A;  3BDU A;  2VUB A;  3A8G B;  4JPB W;  2VGN A;  3M57 A;  1PCX A;  3THK A;  2ZCF B;  2D0N A;  4XTY A;  1X27 A;  3CCV T;  2A0F B;  2DET A;  3H0H A;  4L59 A;  2GNC A;  3CCU T;  2F2X A;  2X4J A;  1FMW A;  4AG2 C;  3G71 T;  1UJY A;  3V7C A;  5IH2 A;  3LYI A;  4B6M A;  4F04 B;  3I55 A;  2RB6 A;  4M77 F;  1Y07 A;  2FL7 A;  4EMK C;  1X6B A;  5I2M A;  3M0S A;  3VS5 A;  1X6O A;  2M0Y A;  2E10 A;  4BI4 A;  4OB3 B;  4E7L A;  4FW1 A;  2QYZ A;  2AIR B;  1MV3 A;  4OB2 B;  1MMA A;  1XNI A;  1TXQ A;  3MP1 A;  2BZ8 A;  4II1 A;  3QWX X;  4JRI A;  4MZT A;  1ZBJ A;  1RAG B;  2A28 A;  1AD5 A;  3VV0 A;  3ASK A;  2L3R A;  2RHY A;  5L8R E;  3E19 A;  1WIE A;  4LXC A;  1K8A U;  1IB8 A;  2K57 A;  3GF5 A;  3I9Q A;  3VJP A;  1GRI A;  4OMQ A;  3ZEH A;  1NM7 A;  3I56 Q;  1NPR A;  3G4S T;  5LJ3 d;  5CKB A;  4OMO A;  2C0T A;  1F1B B;  5D6X A;  1K73 U;  4A4K A;  4WCI A;  4M77 E;  4DEY A;  2LCS A;  1TUD A;  3CCS Q;  1H3H A;  2D8H A;  1YJW A;  3L2W A;  3HPW A;  4M7D F;  5LJ3 f;  3A8H B;  1GFD A;  4N0A A;  2XU8 A;  4KUD K;  2DO3 A;  3C95 A;  2FZC B;  4BE1 A;  3REB B;  2FRW A;  2HQX A;  3FC3 A;  1Y71 A;  3QHS A;  1QWE A;  3SWN C;  4J9G A;  5IAY A;  2AZS A;  2QEX T;  2LZ6 B;  1OQK A;  2ZPG B;  1YIJ A;  4LDW A;  3I56 A;  1VQ8 T;  1WQ7 A;  3JCM W;  1OPL A;  2JMA A;  1RAB B;  4FIB A;  1M3C A;  5GAO n;  2RHX A;  2O9S A;  4IUP A;  1N5Z A;  1U06 A;  2PUO B;  3TU4 K;  1KQ2 A;  4C0D C;  5GMK j;  3CCS A;  1D0Z A;  2GBQ A;  1VQ7 T;  4M4Z A;  1T3S A;  3QYG B;  4TVR A;  3CME A;  4M75 G;  1OZ2 A;  3BE3 A;  2ZAE A;  3CCJ Q;  3CCV Q;  1N6A A;  2SEM A;  3CCU Q;  4DA4 A;  3JB9 H;  3VS0 A;  5DLO A;  2D8J A;  3PE0 A;  1ZQ1 A;  4IKF A;  4CI0 C;  1YJN A;  2DD5 A;  3H41 A;  5FRM A;  5LJ5 d;  2F69 A;  1QWF A;  3A1P A;  1YI2 T;  2HZY A;  3M55 A;  2HKN A;  1Z9Z A;  2LRQ A;  2QGG A;  5GAN g;  3CCM T;  4PJO B;  2NUP B;  4AMC A;  1EZZ B;  2RQW A;  4KGX B;  2P0P A;  1N27 A;  1M2O A;  2L3Q A;  3RDV A;  1BCM A;  3M56 A;  2KY9 A;  1PC0 A;  4MZP A;  2CT4 A;  5LJ5 f;  3NFC A;  2GFU A;  1G8X A;  2LJ3 A;  4F7U G;  1YHQ T;  1OU8 A;  5CIU A;  3CCV A;  2E65 A;  2KMT A;  4M77 A;  3V7R A;  2M02 A;  3G4S Q;  3G71 A;  1AOJ A;  4Z8A A;  2MF2 A;  3UDC A;  2YLB A;  4PFP A;  5CO7 A;  4LN2 A;  1M1K U;  1TG0 A;  4ZGE B;  3NMZ C;  3EG9 A;  1PHT A;  1MMN A;  4PJM A;  1UUE A;  3M4G A;  2XDB A;  1FYN A;  1KQS S;  3PMI A;  1JXM A;  4ELZ C;  3OW2 S;  3MJX A;  1S1N A;  5CCA A;  3HTR A;  1K8A R;  3H8Z A;  3GBQ A;  4KGZ B;  1WX6 A;  3OW2 A;  5I11 A;  2OTL T;  4JUV A;  1M1G A;  4AFZ C;  2WSE E;  1VQN T;  1VQO A;  3JCM f;  2GQV A;  1W2B S;  2QAZ A;  3HFN A;  3JCM h;  1K73 R;  1YP5 A;  2QEX Q;  4ZNX A;  4F17 A;  1QCF A;  1VQ8 Q;  1W2B A;  3INZ A;  3G4S A;  1VQL T;  2MWP A;  4JJN K;  2LJ0 A;  2QTV A;  1QVF S;  1D1A A;  4E7J A;  4OMP A;  2K6D A;  3MCA B;  1QLY A;  2RI3 A;  4M7D A;  3Q1J A;  2XK0 A;  1QVF A;  1VQ7 Q;  4JS4 A;  3EGD A;  1NZ9 A;  1ZSZ C;  4C5E A;  2IIM A;  4R55 A;  1VQ9 T;  4M7A D;  3OYY A;  3EGU A;  1UTI A;  3EG0 A;  4R0K A;  2V8I A;  1WJS A;  1QW1 A;  4JRQ A;  2RA2 A;  1TTH B;  1C1A A;  1N8R C;  1K9M U;  3EFR A;  3HKS A;  4AT1 B;  3UA7 A;  5DY9 A;  5J3B A;  3CPW A;  1T0H A;  1YI2 Q;  1M2V B;  2O01 E;  3G6E T;  1UEC A;  1SF9 A;  4LDU A;  2L0A A;  3JRZ A;  3L2U A;  1SEM A;  2V1R A;  2W0Z A;  2X3W D;  2LT1 A;  1PSE A;  1VIE A;  1KJW A;  3CCM Q;  1G3T A;  2F5T X;  2KVQ G;  1AWW A;  4LE9 A;  4RTT A;  1Y7X A;  2ZZD A;  3CMA T;  2VXF A;  4XTX A;  1MNE A;  1ZBX A;  2MOX A;  2JTM A;  5GJV B;  2KT8 A;  1VQ7 A;  5HKC A;  2QAS A;  5CAI A;  1BBZ A;  2M9U A;  1TSF A;  1UHC A;  5FRN A;  4FL6 A;  2XG8 D;  1YHQ Q;  2DZ9 A;  4OB0 B;  4N4H A;  1LOJ A;  2DIG A;  4M7A G;  2I0N A;  4CC3 A;  1NEG A;  1Q81 C;  2A3L A;  1Q82 U;  1U1S A;  3TSZ A;  2LCC A;  4ANJ A;  2F2V A;  2OX7 A;  3SWN A;  3LGL A;  3LGF A;  1YBY A;  2K2M A;  4PJN A;  3C94 A;  2X51 A;  5GAO m;  3BY7 A;  1S72 A;  1X75 C;  5FU7 C;  1UGV A;  4RTZ A;  2PVD B;  4IIM A;  3S3O A;  4C5H A;  1ABO A;  5FU6 B;  4M7A B;  2DX1 A;  1JJ2 P;  3AT1 B;  2DF6 A;  1QCN A;  4NS5 A;  2OTL Q;  3PGG A;  1BI3 A;  2CGH A;  1VQN Q;  5A0L A;  3UT1 A;  2DL5 A;  2COZ A;  2LQW A;  4D8D A;  4D6W A;  5FRO A;  2M51 A;  1M1K R;  3EG3 A;  2MK5 A;  2IG0 A;  1RAA B;  1VQL Q;  2JMC A;  3MHX A;  3PVL A;  3HP9 A;  2VWF A;  3QDR B;  1VUB A;  4OMN A;  4F14 A;  2D1X A;  3EGX B;  4KUL A;  2XHC A;  3CCR T;  2YDL A;  2JS2 A;  3LWI A;  2HSP A;  1RL2 A;  2E70 A;  4OP0 A;  2EAY A;  2E3I A;  3VRY A;  2OTL A;  3M59 A;  1VQM Q;  5A2Q E;  1VQN A;  2PVO B;  2K2V A;  4ELY C;  5KYY A;  5GMK m;  4IUQ A;  5GAO l;  2G3R A;  5KYW B;  1IRX A;  4QKU A;  1IZ6 A;  2ENM A;  3G6E Q;  1GL5 A;  1OI1 A;  1YJ9 T;  3J7A F;  2ZPI B;  3ULR B;  2VB6 A;  2X4Y A;  1X2Q A;  1M27 C;  4JDS A;  4QVC A;  1PKT A;  5C0M A;  3CMA Q;  2O4X A;  2LNH B;  1U1T A;  3P8D A;  2HSE B;  2NUT A;  1V29 B;  3NTI A;  5IHI A;  3CD6 A;  1LPL A;  2ESW A;  1G5V A;  4C92 B;  1I1J A;  4LUD A;  3TEE A;  1D0Y A;  3MO8 A;  2RHZ A;  1VQ9 A;  3CCQ T;  1K9M R;  2PZ1 A;  5LJ5 e;  1NE8 A;  4AFS C;  1QP3 A;  4WTO B;  1QVG P;  4KGV B;  1ZLM A;  4PL6 A;  4PJL A;  2J05 A;  3JCM V;  1GBR A;  2DTH A;  2LP5 A;  2PTK A;  4OMF B;  5AYF A;  4BE0 A;  1W1F A;  4OGE A;  5GAO r;  2EBP A;  2MPX C;  4J9B A;  4EMH A;  1R0C B;  1SSH A;  3EHQ A;  2FZK B;  2DXU A;  1M3B A;  2NLU A;  2VV5 A;  1C0M A;  4LD9 K;  4OGC A;  2P4R A;  1KFZ A;  3BDL A;  2OAU A;  1Q86 R;  3OYF A;  3CMA A;  3MEV A;  1QKX A;  4PJO F;  1PNJ A;  2OJ2 A;  2RJF A;  1Q82 R;  1ZSZ A;  2FPE A;  3G7Z A;  3R6O A;  4X9D A;  3E1S A;  2EKH A;  5IXF A;  2CUB A;  9ATC B;  1AT1 B;  1PSF A;  4M77 C;  3JB9 F;  4XU3 A;  1UE9 A;  4RTX A;  1LNX A;  1KD1 R;  2K9G A;  1YN8 A;  2GCX A;  3PFS A;  2JTF A;  1K8A C;  3I55 Q;  2CDT A;  4CC2 A;  5KYX A;  4KBM B;  2LQ8 A;  4J9I A;  2KK4 A;  2FPF A;  1KHI A;  4DBQ A;  2J6K A;  2JT4 A;  1SRM A;  3M54 A;  3REA B;  2DL7 A;  2V1Q A;  1MUZ A;  3WXM B;  2V26 A;  3CCE A;  4XAX B;  1BB9 A;  4PJO E;  1AWX A;  1NJI C;  2YUP A;  2DXC A;  1H64 1;  5LJ3 j;  2R5M A;  3OBY A;  1HK9 A;  1KQ1 A;  2BTT A;  2EGA A;  1YJ9 Q;  4C8Q D;  4KH0 B;  2E6Z A;  4HVW A;  4ZGJ B;  3OYN A;  2E5Q A;  3O5Z A;  3O8V A;  4FW2 A;  2WAC A;  1CKB A;  3PVQ A;  4F16 A;  3FJP A;  1ZUU A;  4C5I A;  4MDW A;  3T9N A;  2P4T A;  4M7D C;  4RTW A;  1TS9 A;  3QYH B;  2MI6 A;  1YJW Q;  4B9W A;  2QTX A;  1B7T A;  2DD4 A;  4J6Y A;  4XU0 A;  3CCR A;  1AEY A;  2XID A;  5KCH A;  3M0R A;  1O75 A;  1VQ4 T;  3GPL A;  2EYY A;  4HT8 A;  5C6S A;  4A54 A;  1VYU A;  3KFV A;  2CUD A;  1B34 B;  3LWH A;  1AWJ A;  1HSQ A;  1MMD A;  2VC8 A;  3VS2 A;  1ZSG A;  2LX7 A;  5GAM h;  3M9Q A;  1VQO T;  4KH1 B;  5GAM g;  4E7H A;  4JJC A;  1KC8 U;  2X3X D;  2DEU A;  3QSU A;  4N4I A;  1G3Y A;  4XK8 E;  1YJ9 A;  1D0X A;  4E2F B;  1YIJ Q;  4KUI A;  2OI3 A;  4C8Q G;  4C5G A;  5GAO p;  1HYO A;  1M90 U;  4JZ3 A;  2C0O A;  3N5B B;  2K5L A;  4RUG A;  1RAD B;  1GFC A;  3D7S B;  2X35 A;  4K11 A;  3SDZ A;  4ATO A;  1G3S A;  4M75 D;  3FRN A;  1Q95 G;  2JOY A;  4JRK A;  2J06 A;  3CME Q;  1G83 A;  3MP8 A;  3FJ5 A;  3M4Y A;  3CCQ A;  5KE2 A;  1OU9 A;  4E6R A;  5LJ5 j;  2RQV A;  4M78 D;  1Z9Q A;  2ZPF B;  3CBP A;  1SHF A;  1YJN Q;  3L2V A;  4C8Q B;  3CC2 A;  1OPK A;  2RPN A;  4DEX A;  3L1A A;  3RMQ A;  1I0C A;  2EKO A;  2DPP B;  2JVV A;  2NYS A;  2DAQ A;  3QJ6 A;  2R58 A;  4HCZ A;  2DZC A;  3V8J A;  1WXB A;  3RIR A;  4E7S A;  2PUK B;  3BFM A;  2EIF A;  4PJO A;  5HK0 A;  2KEA A;  1G2B A;  1JJ2 S;  4EPC A;  2RI2 A;  1ZA1 B;  1JJ2 A;  1OEB A;  4HXJ A;  1WXU A;  1W70 A;  1U8R A;  3QZ5 B;  1LCK A;  1JU5 C;  2K3Y A;  1E6G A;  1EFN A;  1OYX A;  4BY6 C;  3PT9 A;  3TCJ A;  4M7D E;  2MCN A;  3OYI A;  3UF4 A;  3A8L B;  3G71 Q;  4M78 G;  2BIV A;  2HD0 A;  3RMS A;  1OOT A;  3KXT A;  1PRL C;  2YLC A;  1WHK A;  4QQG A;  1NLP C;  1ZA2 B;  4JJD A; 
#chains in the Genus database with same CATH homology
 2YSQ A;  2L0A A;  1SEM A;  2V1R A;  2W0Z A;  2X3W D;  1KJW A;  4Z89 A;  1T3L A;  1JQQ A;  2L2P A;  2HBW A;  1AWW A;  1YNZ A;  2GGR A;  4LE9 A;  4RTT A;  4HCK A;  1J3T A;  4GLM A;  2C0I A;  1Y57 A;  1UHF A;  3IQL A;  2DRK A;  2MOX A;  5GJV B;  2ROT A;  2KT8 A;  4X1V A;  3NGP A;  1BBZ A;  3A98 A;  1YCS B;  1UHC A;  2JS0 A;  2H8H A;  4QT7 A;  1KIK A;  2DRM A;  1ZUK A;  1Y0M A;  3RNJ A;  1SPK A;  1JEG A;  3NPF A;  1MV0 B;  3RBB B;  2I0N A;  2NWM A;  4CC3 A;  1NEG A;  1M30 A;  4ORZ A;  3VRZ A;  3TSZ A;  1X6G A;  2F2V A;  5I22 A;  2CSQ A;  2EGE A;  4HVV A;  4JJB A;  5HCK A;  3EG2 A;  2ED1 A;  1NLO C;  4CC4 B;  4Y92 A;  2KYB A;  2K2M A;  2RQU A;  3VS6 A;  2LMJ A;  1UGV A;  2KRS A;  4RTZ A;  2KBT A;  1ABQ A;  4IIM A;  3CQT A;  1ABO A;  1UG1 A;  2AKK A;  2RN8 A;  2A36 A;  2DX1 A;  2F2W A;  2DF6 A;  2FPD A;  2JW4 A;  1FMK A;  4AG1 C;  3UAT A;  2DL5 A;  2KRN A;  2GQI A;  3LH5 A;  2LQW A;  4D8D A;  2RNA A;  1M8M A;  1WFW A;  2M51 A;  1IO6 A;  3EG3 A;  5FWC A;  2JMC A;  3PVL A;  2G6F X;  1TUC A;  4RTY A;  1QKW A;  2O88 A;  2VWF A;  2DLP A;  4OMN A;  4F14 A;  2D1X A;  1B07 A;  1U5S A;  1GBQ A;  3VS7 A;  1A0N B;  2KXD A;  2SRC A;  1RLP C;  2O9V A;  3UA6 A;  1B3Q A;  3M0P A;  2KNB B;  1WDX A;  1U3O A;  3QWY A;  1UJ0 A;  1AWO A;  1V1C A;  4J9H A;  2J6O A;  2YDL A;  1XOV A;  2EGC A;  2JS2 A;  2HSP A;  2HDA A;  1M3A A;  3R6N A;  3VRY A;  1E6H A;  4JPB W;  4D8K A;  5ECA A;  3VS1 A;  1X2K A;  3THK A;  5IHN A;  1HJD A;  2D0N A;  2JM8 A;  1SHG A;  3U23 A;  1NYF A;  2L3S A;  3EG1 A;  1X27 A;  2ENM A;  3M0T A;  1GL5 A;  3H0H A;  2RF0 A;  2RQR A;  3I5R A;  2GNC A;  1ZX6 A;  2F2X A;  1RLQ C;  4AG2 C;  3ULR B;  1UJY A;  5IH2 A;  1ARK A;  2DL8 A;  1OV3 A;  1X2Q A;  1M27 C;  4GBQ A;  3TVT A;  2GTO A;  1PKT A;  2KYM A;  2KRO A;  2E5K A;  2EVR A;  1X6B A;  1JXO A;  2LNH B;  3M0S A;  2FEI A;  5IHI A;  4LNP A;  3VS5 A;  2ESW A;  2BZX A;  2A37 A;  2M0Y A;  2OAW A;  1I1J A;  2RMO A;  4LUD A;  2DA9 A;  1KSW A;  1UFF A;  2CRE A;  2EW3 A;  1MV3 A;  2YUQ A;  2PZ1 A;  4AFS C;  2BZ8 A;  3QWX X;  1ZLM A;  1ZBJ A;  2J05 A;  2A28 A;  1GBR A;  1AD5 A;  1T0J A;  2LP5 A;  1VYV A;  2LQN A;  2PTK A;  1X43 A;  3SEM A;  2DJQ A;  2MIO A;  1K0S A;  1WIE A;  4J9D A;  4AFU C;  2KR3 A;  1W1F A;  2EBP A;  4J9B A;  3I9Q A;  2DL4 A;  2KXC A;  1SSH A;  1GRI A;  3EHQ A;  4OMQ A;  4RTU A;  1NM7 A;  1M3B A;  1WLP B;  2A08 A;  2P4R A;  2C0T A;  4OMO A;  2EPD A;  1KFZ A;  2DNU A;  4WCI A;  2K79 A;  4DEY A;  2LCS A;  1QKX A;  1GCQ A;  1PNJ A;  1TUD A;  1H3H A;  2OJ2 A;  1E7O A;  2D8H A;  1K1Z A;  2FPE A;  1K0X A;  4A63 B;  2CT3 A;  2HCK A;  2EKH A;  5IXF A;  4KRT A;  2CUB A;  2RQT A;  2O31 A;  2DL3 A;  4HVU A;  1PRM C;  4OML A;  1GFD A;  1UE9 A;  4RTX A;  4J9C A;  2K9G A;  2FRY A;  3REB B;  2XMF A;  1YN8 A;  2FRW A;  1QWE A;  2CDT A;  1JO8 A;  4CC2 A;  4J9G A;  4J9I A;  2AZS A;  2B86 A;  2JXB A;  2FPF A;  2LZ6 B;  1H92 A;  2VVK A;  2KRM A;  2J6K A;  2JT4 A;  1SRM A;  1SRL A;  1OPL A;  2YUO A;  1NEB A;  2JMA A;  3REA B;  2DL7 A;  1M3C A;  2V1Q A;  1MUZ A;  2FO0 A;  2O9S A;  2L3P A;  5IHK A;  1N5Z A;  1U06 A;  3M0Q A;  2ROL A;  1ZUY A;  1BB9 A;  4Z88 A;  1AWX A;  1AZG B;  3I35 A;  2YUP A;  2GBQ A;  2DE0 X;  4M4Z A;  2KGT A;  1T3S A;  2JTE A;  1BK2 A;  2VKN A;  2DYB A;  3SHW A;  2BTT A;  4ESR A;  2EGA A;  3JV3 A;  2LJ1 A;  1BU1 A;  2SEM A;  3VS0 A;  2D8J A;  3PE0 A;  4HVW A;  5EC7 A;  3O5Z A;  1NG2 A;  3H41 A;  1CKB A;  1X69 A;  3PVQ A;  4F16 A;  1ZUU A;  1QWF A;  1K76 A;  2QDL A;  4FSS A;  2K7A A;  4RTW A;  2ABL A;  1HD3 A;  1PKS A;  5GJW B;  1Z9Z A;  2EYW A;  1AEY A;  2RQW A;  1PWT A;  1WI7 A;  2L3Q A;  3M0R A;  4IIO A;  4RTV A;  4OMM A;  2EYY A;  2HEQ A;  2ED0 A;  1VYU A;  3KFV A;  2CUD A;  2EYX A;  2CT4 A;  1AWJ A;  1HSQ A;  5FWB A;  3VS2 A;  1ZSG A;  2LJ3 A;  2LX7 A;  2AK5 A;  4JJC A;  2DBK A;  2X3X D;  1NYG A;  5IXB A;  3C0C A;  2GTJ A;  2J7I A;  1AOJ A;  2OI3 A;  4Z8A A;  2AKL A;  1CSK A;  1RUW A;  4JZ3 A;  4LN2 A;  2C0O A;  4EIK A;  1TG0 A;  4RUG A;  1GFC A;  2ECZ A;  1WA7 A;  3NMZ C;  2CSI A;  4K11 A;  1PHT A;  2O2O A;  2FG0 A;  1UUE A;  1FYN A;  1VA7 A;  2J06 A;  1JXM A;  3H0I A;  3VS4 A;  1G83 A;  1I07 A;  2EYZ A;  3FJ5 A;  3EHR A;  1S1N A;  4E6R A;  1K9A A;  2RQV A;  4JZ4 A;  4J9E A;  1CKA A;  2CH4 W;  3GBQ A;  1Z9Q A;  1H8K A;  1WX6 A;  2DM1 A;  5I11 A;  5L23 A;  1SHF A;  1WXT A;  1AVZ C;  1W6X A;  1OPK A;  1YWO A;  2RPN A;  4J9F A;  4AFZ C;  4DEX A;  1WYX A;  1I0C A;  4CC7 A;  1YP5 A;  4ZNX A;  4F17 A;  3NHN A;  1WXB A;  1QCF A;  4AFQ C;  2YUN A;  1RI9 A;  2AZV A;  2DIL A;  2KEA A;  2K3B A;  1G2B A;  3I5S A;  1VYT A;  2DBM A;  2LJ0 A;  3M0U A;  2CH4 A;  5FW9 A;  4OMP A;  2K6D A;  4LUE A;  1QLY A;  3TSW A;  1OEB A;  4HXJ A;  1WXU A;  1W70 A;  1K4U S;  1GCQ C;  2KT1 A;  2J6F A;  1LCK A;  2W10 A;  1JU5 C;  1GCP A;  1E6G A;  1EFN A;  2IIM A;  1AZE A;  2BZY A;  2MCN A;  3EGU A;  1UTI A;  3EG0 A;  2YT6 A;  4R0K A;  1YWP A;  2DMO A;  3UF4 A;  3VS3 A;  2EQI A;  3H0F A;  2KE9 A;  1OOT A;  2DVJ A;  2PNI A;  2JM9 A;  2NUZ A;  3UA7 A;  1PRL C;  1UDL A;  1T0H A;  1NLP C;  3ZL7 C;  4JJD A;  1UEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...