1RUWA

Crystal structure of the sh3 domain from s. cerevisiae myo3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
KDPKFEAAYDFPGSGSSSELPLKKGDIVFISRDEPSGWSLAKLLDGSKEGWVPTAYMTPYKDTRNTVPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the SH3 domain from S. cerevisiae Myo3
rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
molecule keywords Myosin-3 isoform
total genus 11
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2003-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ruwA01
1HSQA 2D0NA 1IO6A 3PVLA 1WDXA 2ABLA 2DM1A 2KXCA 2ROLA 2RQRA 1M3AA 1GFCA 2YUOA 1K9AA 1QLYA 2C0IA 2CT4A 1BU1A 1VYUA 2BZYA 4RTXA 1M3CA 1ABOA 1WYXA 1H3HA 2CREA 1PHTA 1NYGA 3THKA 2P4RA 3VS0A 4DEYA 1OEBA 2I0NA 4GBQA 3UF4A 1SEMA 1FMKA 1WX6A 4AFUC 4CC2A 1W6XA 1CSKA 3KFVA 1UHCA 2ED1A 3M0TA 2ED0A 1ZBJA 1TG0A 2L0AA 1AEYA 2LJ0A 2EW3A 3ULRB 5FWBA 3REAB 2J7IA 3M0RA 1M8MA 3VS2A 4D8DA 3M0UA 1OV3A 1X69A 2FEIA 4J9GA 3VRYA 5I11A 1NEGA 4OMOA 2JXBA 2RN8A 1KFZA 1QKWA 4WCIA 4CC7A 3U23A 2J6OA 2FRYA 4D8KA 1E6HA 2O31A 2K3BA 2CSIA 3SHWA 1UJ0A 4Z89A 2LX7A 1T0HA 2O9SA 1HD3A 1U3OA 2M0YA 2F2VA 1W1FA 1Y57A 2DX1A 2OJ2A 2SEMA 2BZ8A 2K7AA 1TUDA 2DL8A 2MIOA 2O9VA 4HVWA 2DYBA 1UE9A 2RQWA 2EVRA 4J9CA 1AZGB 3R6NA 1I0CA 3ZL7C 2DL7A 1JU5C 1Z9QA 2X3WD 1MV3A 4LN2A 1SHGA 1YP5A 2C0TA 2DBKA 4F14A 3NPFA 3VS3A 3NGPA 1SHFA 1UJYA 2KT8A 2SRCA 2F2XA 2KXDA 2YT6A 2NWMA 1E7OA 1UDLA 2JW4A 4OMLA 4OMPA 3H41A 2EYZA 2J6KA 3I9QA 2RMOA 1RLQC 1V1CA 4RTWA 1NEBA 2NUZA 3UA7A 3VS7A 1SPKA 1A0NB 1U5SA 1SRLA 2FRWA 2KRSA 1K0XA 1G83A 4OMMA 2DL3A 1GCQA 1WXUA 2LJ1A 2RQVA 3QWXX 2M51A 1XOVA 3TSZA 4M4ZA 2V1QA 4CC4B 1ZX6A 2KEAA 2KBTA 3UA6A 1ARKA 2KRMA 2AKKA 1PKSA 1GCPA 1K1ZA 2VKNA 2KT1A 3JV3A 1ZUUA 2JS0A 2LMJA 4LE9A 4J9EA 1PWTA 1WXTA 2D8JA 2GBQA 4RTUA 1U06A 2DL4A 2OI3A 2EBPA 1X2KA 3RNJA 1JXOA 2OAWA 2W10A 1ZUKA 2RNAA 1ZUYA 2DBMA 5IHKA 1SSHA 1CKBA 1UG1A 1ZSGA 2H8HA 4FSSA 1JO8A 4OMQA 1ABQA 2AZVA 1NLOC 2JMCA 3IQLA 5IHNA 1X6GA 2FPFA 2QDLA 2AKLA 4RTYA 1BB9A 4R0KA 4X1VA 3TVTA 2DNUA 2J6FA 4ORZA 2KE9A 2YDLA 1M30A 1BK2A 3EG2A 1NG2A 2RQTA 2HDAA 2BTTA 2K79A 1Z9ZA 2EPDA 1RUWA 5EC7A 1I07A 1W70A 3M0QA 1JXMA 3I5RA 3REBB 1H92A 4J9HA 2EYXA 1PNJA 1VA7A 2ENMA 4KRTA 1YNZA 3A98A 3VRZA 4HVVA 2L2PA 4JJBA 2GTJA 1EFNA 2EKHA 1OPKA 3I35A 4Z8AA 1JEGA 3VS4A 3VS1A 1K4US 2C0OA 2EGEA 1N5ZA 4OMNA 1S1NA 1QKXA 2CUDA 1X2QA 2HSPA 2GGRA 2RF0A 5FW9A 2LQNA 2K6DA 2IIMA 3TSWA 4HVUA 2J06A 1MUZA 4HXJA 3M0PA 1MV0B 1WA7A 2DRKA 2L3QA 2A36A 2L3SA 1J3TA 2AZSA 1T0JA 1PRLC 1WI7A 2O2OA 1UFFA 2KRNA 5L23A 2K9GA 2YUPA 2CT3A 1X6BA 3RBBB 3PE0A 2DJQA 3NMZC 2JS2A 4E6RA 3FJ5A 1X43A 1PRMC 3EG0A 4EIKA 4QT7A 2E5KA 2KNBB 1YCSB 2B86A 2VVKA 4LUEA 5IXFA 5I22A 2JM8A 1JQQA 2FPEA 5GJWB 1UTIA 2HCKA 3M0SA 2A28A 2MOXA 2LP5A 4LNPA 2ECZA 1GCQC 5GJVB 2ESWA 2YUQA 2A08A 4AFSC 4J9IA 3EG3A 3SEMA 2CSQA 1WIEA 1AWWA 4Y92A 1WXBA 1QWFA 5IXBA 1BBZA 1M27C 2LNHB 4AG1C 1NLPC 1OPLA 1RLPC 2EYYA 2FPDA 1KJWA 4HCKA 1GBRA 2K2MA 1LCKA 2CH4A 4JJDA 1UGVA 3H0HA 1T3SA 4CC3A 1G2BA 3PVQA 2F2WA 2KR3A 3QWYA 5IH2A 2HBWA 2CDTA 4JJCA 1YWOA 3EHQA 2LCSA 3UATA 1X27A 2PZ1A 1OOTA 4ZNXA 2JM9A 4JZ3A 1TUCA 3EGUA 3EG1A 4JPBW 1H8KA 2RQUA 2LQWA 2ROTA 3I5SA 1UHFA 2DE0X 4J9FA 1AWXA 2CH4W 1KSWA 4RTVA 1FYNA 2A37A 2DRMA 2FO0A 2L3PA 1AD5A 2DILA 1KIKA 1GFDA 3H0FA 2W0ZA 1VYVA 1SRMA 2LJ3A 4A63B 2JMAA 2CUBA 1B3QA 2D8HA 2YSQA 1AVZC 1ZLMA 2HEQA 4RTZA 1YN8A 2KGTA 4GLMA 4AFZC 2DMOA 2EQIA 2JTEA 4LUDA 1GL5A 4J9BA 1K76A 1HJDA 2DL5A 1VYTA 1WFWA 2EGCA 1UECA 5FWCA 1AOJA 2XMFA 4AFQC 4F16A 2EGAA 2O88A 4DEXA 2GTOA 5HCKA 4JZ4A 3VS6A 5ECAA 1QWEA 2D1XA 2DLPA 4RTTA 1NYFA 1Y0MA 2KYBA 4K11A 3LH5A 3CQTA 1AZEA 1RI9A 2VWFA 4IIOA 5IHIA 3C0CA 1E6GA 2PTKA 2DVJA 2EYWA 2FG0A 2X3XD 2PNIA 2AK5A 2DF6A 3H0IA 2JT4A 2MCNA 2YUNA 1AWJA 1QCFA 2GQIA 4ESRA 1GRIA 1PKTA 2BZXA 1I1JA 1WLPB 2KROA 4F17A 3VS5A 1B07A 2V1RA 2KYMA 1CKAA 1K0SA 1AWOA 4RUGA 4AG2C 2J05A 4J9DA 1UUEA 1NM7A 3NHNA 2DA9A 3EHRA 1T3LA 1M3BA 4IIMA 1GBQA 1YWPA 2RPNA 3GBQA 2LZ6B 3O5ZA 4Z88A 2G6FX 2GNCA
chains in the Genus database with same CATH superfamily
1YJ9A 1HSQA 3PVLA 3DKMA 2ABLA 2RJDA 5FU7B 2YUOA 5KYXB 1K9AA 2LVMA 2CT4A 1VQ8Q 2KQWA 1BU1A 3KBGA 3A1PA 4N4HA 2DZCA 1VYUA 2K3XA 2Y90A 2CKKA 4RTXA 3QG1A 1PM3A 4BI8B 4DEYA 3WVDB 2COZA 4M77G 1CSKA 4M78C 2VASA 3KFVA 4XTXA 1VQ7T 3M4YA 5GAMj 1TUGB 2PUOB 4NL3A 1TG0A 1BIBA 2HSEB 4M7AG 1VQ9T 2RO0A 5FWBA 3DB3A 3AHUA 5GAMe 3CC4A 2QQBA 3EH2A 2LX9A 2HNIA 3GPLA 1Q7YR 1OV3A 2FEIA 2E1HA 2AIRB 3U23A 2E3IA 4D8KA 1E6HA 1WJRA 4PJJA 3CCRQ 1VQLT 1OU8A 1T0HA 3PMTA 3QUIA 2RJEA 1U3OA 4WF2A 1EZZB 2SEMA 3JCMb 2K7AA 2DEUA 5KYNA 4EPCA 1QCOA 2EFIA 1K73C 3L2QA 1UE9A 3LW5E 1AZGB 1M1KU 2X3WD 1MV3A 2DPPB 2DVEA 1SHGA 1YP5A 4EDUA 4F14A 4BI4A 3CXCS 3NGPA 2KT8A 5CKDA 1R0CB 2FHDA 5LJ3h 4A4KA 1QP2A 1E7OA 3EG9B 1Q81C 3QSUA 2EYZA 2JTFA 4RTWA 1ZSZA 2NUZA 1M9SA 4LD9K 5LJ3j 3VS7A 3G6ET 2DD5A 3H8ZA 1G5VA 1PSFA 2KRSA 2DTHA 1G83A 4MZPA 4OMMA 2DL3A 3TREA 3CCST 2LQKA 1WXUA 2LJ1A 1OX9A 3G1JA 1B34A 2M51A 1XOVA 3TSZA 3OY9A 3QJ6A 4M4ZA 4M7DB 1D1AA 1D1BA 2KBTA 4F04B 1PKSA 3A8GB 3FB9A 2VKNA 2KT1A 1ZUUA 1VQ9Q 4C92A 2CP6A 1WXTA 4FW1A 4E7KA 2RK1A 1FX7A 3JCMJ 2MK5A 4C8QD 4XU2A 2OI3A 2NUPB 3LYIA 1M2OA 2EBPA 5LJ5d 2EYQA 1TS9A 4BE0A 4M78F 2RNAA 1QVFP 4L5GA 2CZ0B 3V8KA 1ZUYA 1SSHA 3QO3A 1UGRB 1UG1A 1ZSGA 2EJ9A 2H8HA 4KBMB 2JJ9A 1PSEA 5CAIA 3QIIA 1ABQA 3IQLA 1X6GA 4FSXA 4DBRA 5DM7R 3FLGA 1D09B 4R0KA 4X1VA 4ORZA 1NE8A 1M30A 3M54A 1S72Q 1Y96B 5LL6S 3ZFJA 3EG2A 4M75A 1D3BB 1VQKT 2A7YA 1IGQA 4QQDA 1I07A 1W70A 3M0QA 1JXMA 4GLKA 5FU6C 1VQ5Q 2ENMA 2DJZA 3CMEA 5CO7A 2V8JA 3CCEQ 2EKHA 4MDWA 3WVEB 1OPKA 5D6YA 4X34A 2BE9B 3I35A 4M7AD 2OTJQ 2A0FB 4OMNA 1S1NA 4E2FB 4M7AB 6AT1B 4ME7A 5GMKj 4LDWA 2HZYA 1WNLA 2IIMA 2ZPEB 2KI7A 1MUZA 1MV0B 1WA7A 8ATCB 3O8VA 2O4XB 2L3QA 2BIVA 2VV5A 4M7DF 3VJPA 5AYFA 3HKSA 4C5IA 2AZSA 2XICA 1V29B 1G8XA 3LGLA 2O2OA 3LWHA 1UFFA 1Y96A 4MDXA 1AHJB 1ACMB 1YFNA 2L5QA 1X6BA 5CVIA 3RBBB 4PJOG 1NJIR 4F7UF 3CCQQ 2DXTA 2EQKA 3NMZC 3PT9A 4E47A 3M58A 1G3WA 3L1AA 3EG0A 2KK4A 4QT7A 1K73U 4M7DD 1YCSB 2MI6A 2B86A 4HKEA 5IXFA 2D6FA 1RL2A 3G71A 3EGXA 3VUBA 2RD1A 1JQQA 2WSEE 3CMAT 2YRDA 2HCKA 3M0SA 2MOXA 2ECZA 5GAN5 2YUQA 5L8RE 2L89A 2CSQA 1IREB 5DY9A 1QWFA 3HRTA 2RI5A 4C92B 2BKDN 1BBZA 1M27C 4CRIA 1Q82R 5GAOn 3JCMd 1NBEB 3M4GA 1NPPA 1D0ZA 3GNGA 2LT4A 4M75G 4RCBA 3C94A 4JDSA 3EFRA 1LNXA 4JLIA 5LJ5g 1VQLQ 1LCKA 5AT1B 2QA4T 1XQHA 2K2VA 2BUDA 1YCYA 1Q81R 1Q86C 4PFOA 4CC3A 4C0DB 2F2WA 2KR3A 3MCAB 5IH2A 2CDTA 2PVOB 2XHCA 1YWOA 2LCSA 3URGA 4J5YA 3JSCA 3JAME 1M1GA 2JM9A 3JCMe 4JZ3A 1TUCA 3EGUA 3EG1A 2YRVA 3CXCA 2JN0A 2FZKB 2RQUA 4FT4A 2LQWA 4LXCA 1UHFA 1N8RC 4D6WA 1OULA 4B9XA 2EQUA 2CH4W 1KSWA 4ZN1A 5LJ3g 3BE3A 1WQ7A 2DRMA 2FO0A 1KIKA 3CBMA 1KC8R 3HSBA 2COWA 3SWNB 4A63B 3A5ZB 4PJOE 2ZPBB 2YSQA 4RTZA 1YN8A 5CK9A 5HKCA 1N9RA 4R56A 4OB1B 2DMOA 4LUDA 1GL5A 1K76A 2FYKA 3MEAA 4IUUA 2DL5A 1Y07A 2KAFA 1WFWA 1UECA 1AOJA 4XQ3A 2O88A 1Y7XA 2GTOA 4ZN3A 2K5IA 5HCKA 3G6EQ 3CCUQ 4Y28E 5ECAA 1QWEA 2DLPA 4F7UA 3VYGA 2F1LA 1VOMA 2DERA 3CQTA 2RA2A 2VWFA 4PJLA 5IHIA 2RHZA 3I56A 5DLQE 4BUGA 1M5Q1 2X3XD 4QVCA 2OTJA 1LOJA 2O01E 2AK5A 3CC7Q 3TQ7P 3OYBA 2JT4A 1WZOA 3QHSA 2YUNA 2GQIA 4ESRA 2BZXA 3JB9I 4XTYA 1VQ6Q 3RKXA 2KROA 2YLCA 3QKJA 2MMPA 4OB2B 4FU6A 4F17A 4KH0B 2H3JA 3VS5A 1B07A 1C1AA 3E9FA 1QP3A 5D6XA 1CKAA 1K0SA 3CC2A 4RUGA 2J05A 1VQ8T 1H3ZA 1KHCA 3OYEA 1TH7A 1YWPA 1NJIC 4VUBA 3O5ZA 4LDXA 4OGCA 3CCVQ 1W2BS 2ZPGB 2ROLA 2RQRA 1M3AA 5CKEA 1GFCA 4C92D 2JUFA 2E3HA 2C0IA 4UC4A 1LVKA 1PG5B 3NTKA 1K8AC 5LJ3d 2DKGA 4M77C 4OGEA 1KQSP 4PLLA 1VQMA 3H9NA 2QASA 2RK2A 3THKA 2P4RA 1IXDA 4BY6C 4M7AC 2HBPA 1OEBA 4GBQA 3UF4A 1WX6A 1QVGP 1D0XA 1UHCA 1MMAA 3L2WA 1Q86U 1ZBJA 2L0AA 4JLGA 2EW3A 3OS5A 1VQLA 2X9HA 2OTLQ 5GAOq 3M0RA 1M8MA 2XI9A 3X28B 2C06A 2HQHA 4J7FA 1KQSS 1ZHIA 4ELYC 5GAN8 1X69A 3VRYA 1NZ9A 4OMOA 5I11A 5KYYA 4QW2A 4Z02A 1QKWA 4DBHA 5KCHA 4PJOD 2Y4YA 1VQ6T 3MPUB 2J6OA 2O31A 3CCRT 2CSIA 1UJ0A 3SWNA 1JRIA 2LX7A 2E64A 3QZ5B 1C6VX 2DIQA 1YHQT 2M0YA 2F2VA 4R55A 1W1FA 2DX1A 3JB9J 2BZ8A 1TUDA 2QI2A 3X26B 3MJXA 2LRQA 2DL8A 2MIOA 4FW2A 4J9CA 4N4IA 1PD0A 2V8KA 3OW2S 4FCYA 4LN2A 2C0TA 2DETA 3CCVT 3FDRA 3VS3A 1UJYA 4Q5WA 2CS7A 1MMDA 2F2XA 1UDLA 5GMKm 3HRSA 5D7UA 4OMPA 3OYLA 2J6KA 4IUTA 2WSFE 2RMOA 1V1CA 3UA7A 4M78D 3BY7A 1A0NB 4CI0C 2FRWA 1S72A 2RI3A 1K0XA 4BE2A 3OW2P 2MPXC 3META 2RQVA 4O5VA 4KUDK 4C8QE 3UA6A 1ARKA 1YIJQ 2KRMA 2AKKA 2HKQB 3A8OB 3TU4K 4EMKA 3M53A 2LMJA 4M77E 2GBQA 4RTUA 1U06A 4QKUA 4PJNA 1JXOA 3MEVA 4ZGJB 2DBMA 3PIPA 1RAGB 3ME9A 4OMQA 2FVUA 2EAYA 5HY6A 2FPFA 2QK0A 3SB2A 4ELZC 1N8RR 5KYWA 2WACA 2O4XA 3TVTA 3CC4T 3NFCA 3CCLQ 1VQOQ 2D9TA 1D1CA 5GANg 1RAEB 2F5KA 2ZPIB 3GOXA 2EPDA 3REBB 4J6XA 1FMWA 1KQ1A 3CD6T 4QVZA 1HXDA 5GAMg 4KRTA 4JJBA 3S3MA 1M1KR 5KYXA 1O9SA 3CPWS 4Z8AA 1JEGA 4XTUA 3BDUA 1K4US 1KK7A 2EGEA 4MZMA 2EKOA 2MWPA 5FW9A 2LQNA 1KC8C 3CC7T 3G4SA 4M75B 1VQ5A 4HXJA 3M0PA 2X35A 4XK8E 1C0MA 1J3TA 3OYMA 1RAFB 4C8QB 4C92E 2ZZDA 9ATCB 1WHLA 4QQ6A 1F1BB 2CP2A 1PD1A 5GAN7 2K9GA 2RHUA 2YUPA 3L42A 1YITQ 1YBYA 3JCMc 3PE0A 1VQOA 3E2UA 2JS2A 4E6RA 2DD4A 2Y4XA 3C95A 2E5KA 2KNBB 2VVKA 4LUEA 1WHGA 4BI3A 4M77A 1OX8A 4C8QA 1EIFA 3WXMB 3JCMh 4PNOA 5GJWB 1YJWA 2F5TX 2A28A 2DZ9A 2LP5A 3SDZA 5GJVB 2ESWA 4BE1A 4A4EA 3CCLT 1QVPA 1M90R 3CCQA 4XTWA 3GP8A 1VQNT 4M7DA 1AWWA 4Y92A 5IXBA 4E7HA 4M77D 1KD1R 1RLPC 4KT0E 3JRZA 4M77B 3RR6A 3CCUA 3CCMT 4XU1A 2OTLT 1U1SA 2K2MA 2K5FA 2LQ8A 4JJDA 4NOYA 1IHWA 3CBOA 1T3SA 2M02A 3QWYA 4N0AC 1V76A 1I4K1 2M0OA 3I55T 3RIRA 3VUZA 2ZGWA 1BIAA 3EH1A 4FYVB 5KH6A 2M9UA 4ZNXA 1VQKA 1FWZA 3G71Q 1RACB 1X6OA 2DE0X 4JS4A 2X4YA 2E4HA 5GMKh 2RHYA 3E1SA 1FYNA 2A37A 3OMGA 1VQ9A 5KCOA 2L3PA 1X01A 2DILA 3OQ5A 4HT8A 3JCMQ 2W0ZA 1G3YA 1VYVA 2QAZA 3L2VA 2QQAA 2VXFA 2G3RA 1QCNA 2LJ3A 2EJGA 2BE7D 2JMAA 2D8HA 1AVZC 1ZLMA 2KMTA 4IURA 4AFZC 4RG2A 4HA8A 1M8VA 3OYDA 2JTEA 5I2SA 5GANd 3EG9A 2YWWA 4F16A 2EGAA 2YHTA 3M57A 3CPWA 1YIJT 3H6ZA 2DXCA 2XK0A 3VS6A 1UGPB 1NYFA 4K11A 3HL8A 4N0AA 3OB9A 3MP6A 1AZEA 3QJYA 1RAIB 1E6GA 5KYWB 2FG0A 2DTOA 1VQNQ 3VV0A 5I2MA 5A0GA 1N8RU 2DF6A 3H0IA 5GAMf 2MF2A 2MCNA 1AWJA 1GRIA 1R0BG 1I1JA 3S6WA 3DLMA 2V1RA 1IGUA 2AT1B 2KY9A 1WPYA 2QDYB 2WSCE 3M55A 4M75F 3HHTB 4HT9A 4J9DA 1KQ2A 3CXCP 2E6ZA 5GAOr 1M1FA 4KH1B 2LTOA 5LJ5h 4IIMA 2L8DA 5CR2A 2K57A 3RUXA 4C8QC 4Z88A 5FU7C 3C4SA 2D0NA 3GLXA 1WDXA 3NTHA 2KXCA 2P0PA 1QMCA 4DA4A 2E41A 3LH0A 3P8BB 3EFSA 2JTMA 3VKIA 2VC8A 1PC0A 2KDSA 1QLYA 3A8HB 2QQSA 4ZTFA 1I5LA 1MHNA 2QTVA 3HPWA 1M3CA 4F7UG 1WYXA 5GMKe 4PJOF 2VXEA 1EX4A 4PJOA 1H3HA 2CREA 1I81A 1PHTA 1NYGA 3PFSA 1WHKA 2QEXQ 1K8AR 2I0NA 1W6XA 2QGGA 5IT9E 2ED1A 3M0TA 1K8AU 4M7DG 1AEYA 3SFMA 3CD6Q 2RHIA 3ULRB 3OW2A 4OMFB 1ZA1B 4O6JA 1M2VB 5CIUA 2L3RA 2ZPHB 1O75A 4PJMA 3G7ZA 2JXBA 4F7UE 1KFZA 2XKOC 3M5AA 2X4WA 1SF9A 2K3BA 3RESA 4Z89A 3OYKA 3DB4A 2O9SA 1HD3A 1KD1U 1YHQQ 3CEYA 1Q95G 5KYYB 2DIGA 3JCMg 2I2LA 3CCEA 4J6WA 2LDMA 1WHHA 2RQWA 3ZL7C 2EVRA 3R6NA 2EIFA 2DL7A 1JU5C 3I56Q 5FRNA 2DBKA 4NL2A 3LX7A 3MO8A 3M56A 1M1KC 1RABB 1Q7YC 1JJ2P 2KXDA 2YT6A 3KUFA 5LJ5e 4OMLA 3H41A 1UB4A 2ZCFB 3R6OA 1SPKA 1U5SA 3OYFA 5LJ5j 4M78G 1GCQA 4XU3A 3JCMV 1KC8U 4TVRA 5KE3A 1YI2T 2FZGB 4KGZB 2V1QA 4CC4B 4JS5A 1ZX6A 4LDYA 3G71T 1G3SA 1GCPA 1LJOA 1K1ZA 4XTVA 3GIBA 1U8RA 3G6EA 4PLIA 2LC4A 2JS0A 4J83A 4J9EA 1PWTA 1YJNT 3CCSA 2DL4A 2RJFA 5CQXA 1ZBXA 3UWNA 3RNJA 3RKYA 2W10A 4C0DC 2EJFA 3BFMA 2OAUA 4PL6A 5A0LA 4PK4A 3PMIA 5IHKA 2P0QA 1RI0A 4OF1A 5M9OA 2HAXA 2XG8D 2XIDA 1B7TA 1BYMA 2QA4A 1NLOC 2JMCA 3EFOA 1IHVA 5FRMA 1OZ3A 2QDLA 3J7AF 2DXBA 1BI1A 1BB9A 2J6FA 2KE9A 3QXEB 4HCCA 4KUIA 1RAHB 1NG2A 2RQTA 2RI2A 2BTTA 4B6MA 5A2QE 3FRNA 5C0MA 3V7SA 5J26A 5EG2A 4DBFA 4ZGEB 4KGXB 1H92A 4M78B 4J9HA 2EYXA 3LGFA 5C6SA 2V8IA 4AT1B 1SSFA 1YNZA 2VB6A 4HVVA 2L2PA 3CCJA 5J39A 3CMAQ 5GANh 2NUTA 2H3EB 1YHQA 2VYTA 1YITA 1TWBA 3VS1A 3VS4A 1KHIA 2QGFB 3GF5A 1MNEA 1N5ZA 2CUDA 1X2QA 2HSPA 2LT1A 5GMKi 2GGRA 1WHMA 4HCZA 4C0GA 5GAN2 2QTXA 3TSWA 2IG0A 2CGHA 1TSFA 4HVUA 2J06A 2ZAEA 4M78A 3INZA 2EWNA 4M7AF 3V7RA 3HFOA 2P4TA 1BCMA 2L3SA 5LJ5f 3P8DA 4PFPA 1T0JA 1MGQA 3EGXB 4M77F 1VQ4T 1VUBA 2KRNA 4LD6A 1S72T 3SWNC 5L23A 2DEQA 2CZ6B 1SG5A 2ATCB 3CBPA 2E70A 5KYUA 4ZGDB 1BKBA 1VQNA 5GMKl 2MWOA 1PRMC 2P0KA 3CMEQ 5I22A 4RMOA 3TEEA 2JM8A 3CC2T 2GFAA 1JJ2A 1W2BA 4J6YA 3CCUT 1UTIA 1Q7YU 1N27A 3JB9H 2NYSA 1GCQC 1R77A 2A08A 4AFSC 1WJSA 2HKNA 4EMKC 4C92C 3G4SQ 1WIEA 5CCAA 1WXBA 2Z0WA 1YJ9T 4M7AA 1IRXA 2X51A 1RADB 1M90C 1XTDA 4JRKA 3HP9A 4M7DC 2CZ7B 1SKUB 2FPDA 2P84A 4HCKA 3OBWA 2CH4A 3NTIA 4MMLA 1UGVA 2XU8A 2E65A 4A53A 2HBWA 5I21A 3EHQA 1KG1A 1VQMT 2R57A 1IB8A 1ZA2B 2PU9B 2GQVA 1D3BA 5GANe 2OX7A 1H8KA 2ROTA 4MZTA 2K3YA 5HK3A 2VGNA 2DXUA 4J9FA 1AWXA 4FYXB 4J7IA 3X20B 4RTVA 1OQKA 1AD5A 3V8LA 3OMCA 2XDPA 4EMGA 3JB9D 3H0FA 3CCJQ 3RKWA 1VQ4Q 1QVGA 2K5LA 2DTIA 3QYHB 1B3QA 2GF7A 5IAYA 3RMQA 5GAN3 2KGTA 4GLMA 4M78E 4RKUE 2E12A 4RCCA 1OZ2A 2DFUA 4J9BA 3OYJA 4QQGA 4C8QF 1HJDA 1VYTA 4BDZA 2EGCA 5FWCA 4QVDA 2E6NA 3OYIA 2QYZA 4JZ4A 2D1XA 3OYYA 1OI1A 3FJPA 4RTTA 5HK0A 2EQJA 3LH5A 2D0QB 3OYAA 1VQ8A 3JCMf 3QZ9B 1NJIU 5GANf 2PTKA 3OS0A 2EYWA 4OB3B 3L2UA 3QDFA 3ASKA 1K73R 2HQXA 3L2RA 5KYUB 3RERA 4FT2A 4OP0A 1B34B 1BI2A 4A4HA 1PKTA 1WLPB 1YI2Q 3EGDA 1I5OB 2KVQG 3ZEHA 5LJ3f 3MKDA 3UT1A 1AWOA 4AG2C 3OYHA 1NM7A 2DA9A 3MP1A 3OSVA 1VIEA 3OYGA 2PVGB 2YLBA 2NUPA 3OA6A 3MP8A 3X25B 1VQPA 2LZ6B 2G6FX 3JB9F 2GNCA 1IO6A 4C5HA 4XTZA 2QEXT 4JRQA 3DLLA 2DM1A 4JRIA 1QVGS 4M7AE 2YRCA 3V7CA 4BACA 2IVWA 4X9CA 3P8HA 1YJWQ 4JRPA 4OVAA 1IZ6A 2BZYA 3JCMX 1RAAB 1W2BP 2XD0A 5D6WA 1ABOA 3A8MB 3EGDB 4FL6A 3FIFA 1R8OB 3VS0A 3L2ZA 3QYGB 4AFUC 1SEMA 1FMKA 1UGSB 4CC2A 2R5MA 1WGSA 4BY6B 3E9GA 2ED0A 3RDVA 2PUKB 3LLRA 3JCMW 4FIBA 2F69A 1OYXA 2LJ0A 4RG8A 4P5NA 3LWIA 4LDUA 3OS1A 2QXFA 3REAB 4C92F 2CP7A 2J7IA 8AT1B 3PGGA 3VS2A 4D8DA 3M0UA 4J9GA 4FM4B 1NEGA 5A0DA 2RN8A 1VQ7A 2JVVA 2RHXA 3CPFA 4PKCC 4WCIA 3PTAA 4CC7A 3FC3A 4E7SA 2FRYA 3UDCA 3SHWA 3CMET 4EMHA 3A8LB 1YIJA 2CP3A 4M75E 1WHJA 4A54A 2K4YA 1Y57A 2OJ2A 4GY5A 2O9VA 4HVWA 1Q82U 2DYBA 2XDDA 1I0CA 5GAN4 1Z9QA 2HQEA 3I56T 1VIFA 3NPFA 1SHFA 2SRCA 2CZ1B 2NWMA 3Q1JA 2JW4A 2HMAA 1WJQA 1Q81U 3I9QA 1MNDA 1KD1C 2CP0A 1RLQC 1NEBA 1SRLA 1TU0B 1JB0E 3CC4Q 3CCVA 4DBQA 4DQ2A 1M4ZA 2RH2A 2CYZB 1K9MC 3QWXX 1VQPQ 3M59A 4II1A 4E7IA 5GAN6 2JZ2A 1TXQA 2GCXA 2KEAA 4XAXB 4M75C 1MMGA 3OYCA 1FMVA 4BB7A 4ZTJA 1UEBA 3JV3A 3CMAA 3S3OA 1YJNQ 4LE9A 5CKBA 2E5QA 2EQMA 3QDRB 2D8JA 2MAMA 3D7SB 1ZSZC 1X2KA 2OAWA 4FYYB 3TCJA 1ZUKA 2LNVA 4IUQA 4E7JA 3C12A 4DOWA 1M90U 4L59A 5GANj 4V2SA 4IKFA 4A4FA 3QBYA 1CKBA 2DO3A 4KGVB 5J3BA 4FSSA 4AMCA 5CKFA 1JO8A 2KSSA 1TTHB 2OTLA 2AZVA 4F7UB 5IHNA 2YXYA 1AT1B 3F70A 5KE2A 4B9WA 3CD6A 2AKLA 3OYNA 3HRUA 4RTYA 3KXTA 2M1HA 3CCJT 2DNUA 2YDLA 1BK2A 2XDBA 4IUPA 1QW1A 1YITT 2HDAA 2K79A 1Z9ZA 4FYWB 3EAEA 1RUWA 3ER0A 4PJOB 5EC7A 1GXIE 3I5RA 1VQ6A 1G3TA 3OSSC 1W4SA 1PNJA 1VA7A 3A98A 3VRZA 2GTJA 1EFNA 4E7ZA 2X4XA 4PJOC 4IUVA 1OU9A 1QVFA 2QG9B 2C0OA 2NLUA 3OBYA 1VQ4A 1QKXA 3RMSA 3GNFB 2RF0A 1JJ2S 3E19A 2K6DA 4OB0B 3N5BB 2JOYA 3HFNA 1ZSZB 4C92G 1U1TA 2HL3A 5CKHA 3SD4A 2DRKA 4XU0A 4ATOA 2GFUA 3CC2Q 2A36A 2R5AA 3CCMQ 4HCBA 1P92A 2X4JA 1PRLC 1UGQB 1WI7A 5IN1A 3AT1B 5GAOl 1YJWT 2V26A 2DAQA 2CT3A 1N9SA 3G4ST 3CC7A 4BDYA 2FL7A 2DJQA 1YJ9Q 3CCQT 2NUTB 1Q86R 3FJ5A 3QPHA 5GAOp 1X43A 4N4GA 4EIKA 2QQRA 1JBMA 4L6V5 1BI3A 2FPEA 3V8JA 4C5EA 3ZBDA 2R58A 5CQYA 3CCMA 1YJNA 2LCLA 4LNPA 2B8AA 4JJNK 4E7LA 1HK9A 4KULA 4J9IA 1VQOT 1XNIA 3JB9G 3EG3A 4Y91A 1BI0A 3SEMA 1QVFS 1Q82C 3MEUA 2LNHB 4AG1C 1BCOA 3EFOB 4EMKB 2M16A 3VU3C 4C5GA 1NLPC 1OPLA 1QQJA 3JCMP 2E10A 1NPRA 2MYSA 2EYYA 1KJWA 1XJWB 3BDLA 1GBRA 2VGMA 1PCXA 1X75C 2QA4Q 3H0HA 1G2BA 1LPLA 3PVQA 1DJ7B 1MMNA 2QQ9A 5FLXE 4JUVA 7AT1B 5GAMd 4X9DA 3CCSQ 4JJCA 1VQMQ 2IPOB 3UATA 1N6AA 1X27A 2PZ1A 3HTRA 1Y71A 3MHXA 1OOTA 5GAOm 3CPWP 3T9NA 5FROA 3PIOA 4JPBW 3I5SA 4ANJA 3FEOA 2AHJB 3J80E 1TOVA 4M7DE 4PFZA 2PVDB 1GFDA 2RM4A 3I55A 4NS5A 4C8QG 3UPUA 1D0YA 1SRMA 2HD0A 5DLOA 2LCCA 1K9MR 2CUBA 2HEQA 1VQKQ 1FXXA 2ZPFB 2FZCB 3OS2A 1K9MU 2EQIA 4A4GA 4M75D 5GAMh 3CCRA 2DK3A 1VQ5T 3S3NA 3J81E 1VQ7Q 2XMFA 4AFQC 4YTLA 1KQSA 3MEWA 4C0FA 4DEXA 4WTOB 1I8FA 2VUBA 1WQWA 2A3LA 1Y0MA 2KYBA 3X24B 3CCET 1RI9A 4LDVA 4IIOA 3C0CA 3BW1A 2DVJA 2PNIA 2COYA 1VQPT 1HYOA 1QCFA 5FU6B 4DOVA 2FB7A 2PQWA 4C0ZA 2QEXA 2JNGA 2HL5C 2KYMA 2DYIA 1H641 1UUEA 4J8OA 3NHNA 3VYHB 3M9QA 3EHRA 3PNWC 2CP5A 2OTJT 5LJ3e 3I55Q 2RJCA 1T3LA 1M3BA 4BD3A 3CCLA 1M2VA 1GBQA 2RB6A 2RPNA 3GBQA 1ZQ1A 4MMKA 1YI2A
chains in the Genus database with same CATH topology
1HSQA 2D0NA 1IO6A 3PVLA 1WDXA 2ABLA 2DM1A 2KXCA 2ROLA 2RQRA 1M3AA 1GFCA 2YUOA 1K9AA 1QLYA 2C0IA 2CT4A 1BU1A 1VYUA 2BZYA 4RTXA 1M3CA 1ABOA 1WYXA 1H3HA 2CREA 1PHTA 1NYGA 3THKA 2P4RA 3VS0A 4DEYA 1OEBA 2I0NA 4GBQA 3UF4A 1SEMA 1FMKA 1WX6A 4AFUC 4CC2A 1W6XA 1CSKA 3KFVA 1UHCA 2ED1A 3M0TA 2ED0A 1ZBJA 1TG0A 2L0AA 1AEYA 2LJ0A 2EW3A 3ULRB 5FWBA 3REAB 2J7IA 3M0RA 1M8MA 3VS2A 4D8DA 3M0UA 1OV3A 1X69A 2FEIA 4J9GA 3VRYA 5I11A 1NEGA 4OMOA 2JXBA 2RN8A 1KFZA 1QKWA 4WCIA 4CC7A 3U23A 2J6OA 2FRYA 4D8KA 1E6HA 2O31A 2K3BA 2CSIA 3SHWA 1UJ0A 4Z89A 2LX7A 1T0HA 2O9SA 1HD3A 1U3OA 2M0YA 2F2VA 1W1FA 1Y57A 2DX1A 2OJ2A 2SEMA 2BZ8A 2K7AA 1TUDA 2DL8A 2MIOA 2O9VA 4HVWA 2DYBA 1UE9A 2RQWA 2EVRA 4J9CA 1AZGB 3R6NA 1I0CA 3ZL7C 2DL7A 1JU5C 1Z9QA 2X3WD 1MV3A 4LN2A 1SHGA 1YP5A 2C0TA 2DBKA 4F14A 3NPFA 3VS3A 3NGPA 1SHFA 1UJYA 2KT8A 2SRCA 2F2XA 2KXDA 2YT6A 2NWMA 1E7OA 1UDLA 2JW4A 4OMLA 4OMPA 3H41A 2EYZA 2J6KA 3I9QA 2RMOA 1RLQC 1V1CA 4RTWA 1NEBA 2NUZA 3UA7A 3VS7A 1SPKA 1A0NB 1U5SA 1SRLA 2FRWA 2KRSA 1K0XA 1G83A 4OMMA 2DL3A 1GCQA 1WXUA 2LJ1A 2RQVA 3QWXX 2M51A 1XOVA 3TSZA 4M4ZA 2V1QA 4CC4B 1ZX6A 2KEAA 2KBTA 3UA6A 1ARKA 2KRMA 2AKKA 1PKSA 1GCPA 1K1ZA 2VKNA 2KT1A 3JV3A 1ZUUA 2JS0A 2LMJA 4LE9A 4J9EA 1PWTA 1WXTA 2D8JA 2GBQA 4RTUA 1U06A 2DL4A 2OI3A 2EBPA 1X2KA 3RNJA 1JXOA 2OAWA 2W10A 1ZUKA 2RNAA 1ZUYA 2DBMA 5IHKA 1SSHA 1CKBA 1UG1A 1ZSGA 2H8HA 4FSSA 1JO8A 4OMQA 1ABQA 2AZVA 1NLOC 2JMCA 3IQLA 5IHNA 1X6GA 2FPFA 2QDLA 2AKLA 4RTYA 1BB9A 4R0KA 4X1VA 3TVTA 2DNUA 2J6FA 4ORZA 2KE9A 2YDLA 1M30A 1BK2A 3EG2A 1NG2A 2RQTA 2HDAA 2BTTA 2K79A 1Z9ZA 2EPDA 1RUWA 5EC7A 1I07A 1W70A 3M0QA 1JXMA 3I5RA 3REBB 1H92A 4J9HA 2EYXA 1PNJA 1VA7A 2ENMA 4KRTA 1YNZA 3A98A 3VRZA 4HVVA 2L2PA 4JJBA 2GTJA 1EFNA 2EKHA 1OPKA 3I35A 4Z8AA 1JEGA 3VS4A 3VS1A 1K4US 2C0OA 2EGEA 1N5ZA 4OMNA 1S1NA 1QKXA 2CUDA 1X2QA 2HSPA 2GGRA 2RF0A 5FW9A 2LQNA 2K6DA 2IIMA 3TSWA 4HVUA 2J06A 1MUZA 4HXJA 3M0PA 1MV0B 1WA7A 2DRKA 2L3QA 2A36A 2L3SA 1J3TA 2AZSA 1T0JA 1PRLC 1WI7A 2O2OA 1UFFA 2KRNA 5L23A 2K9GA 2YUPA 2CT3A 1X6BA 3RBBB 3PE0A 2DJQA 3NMZC 2JS2A 4E6RA 3FJ5A 1X43A 1PRMC 3EG0A 4EIKA 4QT7A 2E5KA 2KNBB 1YCSB 2B86A 2VVKA 4LUEA 5IXFA 5I22A 2JM8A 1JQQA 2FPEA 5GJWB 1UTIA 2HCKA 3M0SA 2A28A 2MOXA 2LP5A 4LNPA 2ECZA 1GCQC 5GJVB 2ESWA 2YUQA 2A08A 4AFSC 4J9IA 3EG3A 3SEMA 2CSQA 1WIEA 1AWWA 4Y92A 1WXBA 1QWFA 5IXBA 1BBZA 1M27C 2LNHB 4AG1C 1NLPC 1OPLA 1RLPC 2EYYA 2FPDA 1KJWA 4HCKA 1GBRA 2K2MA 1LCKA 2CH4A 4JJDA 1UGVA 3H0HA 1T3SA 4CC3A 1G2BA 3PVQA 2F2WA 2KR3A 3QWYA 5IH2A 2HBWA 2CDTA 4JJCA 1YWOA 3EHQA 2LCSA 3UATA 1X27A 2PZ1A 1OOTA 4ZNXA 2JM9A 4JZ3A 1TUCA 3EGUA 3EG1A 4JPBW 1H8KA 2RQUA 2LQWA 2ROTA 3I5SA 1UHFA 2DE0X 4J9FA 1AWXA 2CH4W 1KSWA 4RTVA 1FYNA 2A37A 2DRMA 2FO0A 2L3PA 1AD5A 2DILA 1KIKA 1GFDA 3H0FA 2W0ZA 1VYVA 1SRMA 2LJ3A 4A63B 2JMAA 2CUBA 1B3QA 2D8HA 2YSQA 1AVZC 1ZLMA 2HEQA 4RTZA 1YN8A 2KGTA 4GLMA 4AFZC 2DMOA 2EQIA 2JTEA 4LUDA 1GL5A 4J9BA 1K76A 1HJDA 2DL5A 1VYTA 1WFWA 2EGCA 1UECA 5FWCA 1AOJA 2XMFA 4AFQC 4F16A 2EGAA 2O88A 4DEXA 2GTOA 5HCKA 4JZ4A 3VS6A 5ECAA 1QWEA 2D1XA 2DLPA 4RTTA 1NYFA 1Y0MA 2KYBA 4K11A 3LH5A 3CQTA 1AZEA 1RI9A 2VWFA 4IIOA 5IHIA 3C0CA 1E6GA 2PTKA 2DVJA 2EYWA 2FG0A 2X3XD 2PNIA 2AK5A 2DF6A 3H0IA 2JT4A 2MCNA 2YUNA 1AWJA 1QCFA 2GQIA 4ESRA 1GRIA 1PKTA 2BZXA 1I1JA 1WLPB 2KROA 4F17A 3VS5A 1B07A 2V1RA 2KYMA 1CKAA 1K0SA 1AWOA 4RUGA 4AG2C 2J05A 4J9DA 1UUEA 1NM7A 3NHNA 2DA9A 3EHRA 1T3LA 1M3BA 4IIMA 1GBQA 1YWPA 2RPNA 3GBQA 2LZ6B 3O5ZA 4Z88A 2G6FX 2GNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HSQ A;  2D0N A;  1IO6 A;  3PVL A;  1WDX A;  2ABL A;  2DM1 A;  2KXC A;  2ROL A;  2RQR A;  1M3A A;  1GFC A;  2YUO A;  1K9A A;  1QLY A;  2C0I A;  2CT4 A;  1BU1 A;  1VYU A;  2BZY A;  4RTX A;  1M3C A;  1ABO A;  1WYX A;  1H3H A;  2CRE A;  1PHT A;  1NYG A;  3THK A;  2P4R A;  3VS0 A;  4DEY A;  1OEB A;  2I0N A;  4GBQ A;  3UF4 A;  1SEM A;  1FMK A;  1WX6 A;  4AFU C;  4CC2 A;  1W6X A;  1CSK A;  3KFV A;  1UHC A;  2ED1 A;  3M0T A;  2ED0 A;  1ZBJ A;  1TG0 A;  2L0A A;  1AEY A;  2LJ0 A;  2EW3 A;  3ULR B;  5FWB A;  3REA B;  2J7I A;  3M0R A;  1M8M A;  3VS2 A;  4D8D A;  3M0U A;  1OV3 A;  1X69 A;  2FEI A;  4J9G A;  3VRY A;  5I11 A;  1NEG A;  4OMO A;  2JXB A;  2RN8 A;  1KFZ A;  1QKW A;  4WCI A;  4CC7 A;  3U23 A;  2J6O A;  2FRY A;  4D8K A;  1E6H A;  2O31 A;  2K3B A;  2CSI A;  3SHW A;  1UJ0 A;  4Z89 A;  2LX7 A;  1T0H A;  2O9S A;  1HD3 A;  1U3O A;  2M0Y A;  2F2V A;  1W1F A;  1Y57 A;  2DX1 A;  2OJ2 A;  2SEM A;  2BZ8 A;  2K7A A;  1TUD A;  2DL8 A;  2MIO A;  2O9V A;  4HVW A;  2DYB A;  1UE9 A;  2RQW A;  2EVR A;  4J9C A;  1AZG B;  3R6N A;  1I0C A;  3ZL7 C;  2DL7 A;  1JU5 C;  1Z9Q A;  2X3W D;  1MV3 A;  4LN2 A;  1SHG A;  1YP5 A;  2C0T A;  2DBK A;  4F14 A;  3NPF A;  3VS3 A;  3NGP A;  1SHF A;  1UJY A;  2KT8 A;  2SRC A;  2F2X A;  2KXD A;  2YT6 A;  2NWM A;  1E7O A;  1UDL A;  2JW4 A;  4OML A;  4OMP A;  3H41 A;  2EYZ A;  2J6K A;  3I9Q A;  2RMO A;  1RLQ C;  1V1C A;  4RTW A;  1NEB A;  2NUZ A;  3UA7 A;  3VS7 A;  1SPK A;  1A0N B;  1U5S A;  1SRL A;  2FRW A;  2KRS A;  1K0X A;  1G83 A;  4OMM A;  2DL3 A;  1GCQ A;  1WXU A;  2LJ1 A;  2RQV A;  3QWX X;  2M51 A;  1XOV A;  3TSZ A;  4M4Z A;  2V1Q A;  4CC4 B;  1ZX6 A;  2KEA A;  2KBT A;  3UA6 A;  1ARK A;  2KRM A;  2AKK A;  1PKS A;  1GCP A;  1K1Z A;  2VKN A;  2KT1 A;  3JV3 A;  1ZUU A;  2JS0 A;  2LMJ A;  4LE9 A;  4J9E A;  1PWT A;  1WXT A;  2D8J A;  2GBQ A;  4RTU A;  1U06 A;  2DL4 A;  2OI3 A;  2EBP A;  1X2K A;  3RNJ A;  1JXO A;  2OAW A;  2W10 A;  1ZUK A;  2RNA A;  1ZUY A;  2DBM A;  5IHK A;  1SSH A;  1CKB A;  1UG1 A;  1ZSG A;  2H8H A;  4FSS A;  1JO8 A;  4OMQ A;  1ABQ A;  2AZV A;  1NLO C;  2JMC A;  3IQL A;  5IHN A;  1X6G A;  2FPF A;  2QDL A;  2AKL A;  4RTY A;  1BB9 A;  4R0K A;  4X1V A;  3TVT A;  2DNU A;  2J6F A;  4ORZ A;  2KE9 A;  2YDL A;  1M30 A;  1BK2 A;  3EG2 A;  1NG2 A;  2RQT A;  2HDA A;  2BTT A;  2K79 A;  1Z9Z A;  2EPD A;  1RUW A;  5EC7 A;  1I07 A;  1W70 A;  3M0Q A;  1JXM A;  3I5R A;  3REB B;  1H92 A;  4J9H A;  2EYX A;  1PNJ A;  1VA7 A;  2ENM A;  4KRT A;  1YNZ A;  3A98 A;  3VRZ A;  4HVV A;  2L2P A;  4JJB A;  2GTJ A;  1EFN A;  2EKH A;  1OPK A;  3I35 A;  4Z8A A;  1JEG A;  3VS4 A;  3VS1 A;  1K4U S;  2C0O A;  2EGE A;  1N5Z A;  4OMN A;  1S1N A;  1QKX A;  2CUD A;  1X2Q A;  2HSP A;  2GGR A;  2RF0 A;  5FW9 A;  2LQN A;  2K6D A;  2IIM A;  3TSW A;  4HVU A;  2J06 A;  1MUZ A;  4HXJ A;  3M0P A;  1MV0 B;  1WA7 A;  2DRK A;  2L3Q A;  2A36 A;  2L3S A;  1J3T A;  2AZS A;  1T0J A;  1PRL C;  1WI7 A;  2O2O A;  1UFF A;  2KRN A;  5L23 A;  2K9G A;  2YUP A;  2CT3 A;  1X6B A;  3RBB B;  3PE0 A;  2DJQ A;  3NMZ C;  2JS2 A;  4E6R A;  3FJ5 A;  1X43 A;  1PRM C;  3EG0 A;  4EIK A;  4QT7 A;  2E5K A;  2KNB B;  1YCS B;  2B86 A;  2VVK A;  4LUE A;  5IXF A;  5I22 A;  2JM8 A;  1JQQ A;  2FPE A;  5GJW B;  1UTI A;  2HCK A;  3M0S A;  2A28 A;  2MOX A;  2LP5 A;  4LNP A;  2ECZ A;  1GCQ C;  5GJV B;  2ESW A;  2YUQ A;  2A08 A;  4AFS C;  4J9I A;  3EG3 A;  3SEM A;  2CSQ A;  1WIE A;  1AWW A;  4Y92 A;  1WXB A;  1QWF A;  5IXB A;  1BBZ A;  1M27 C;  2LNH B;  4AG1 C;  1NLP C;  1OPL A;  1RLP C;  2EYY A;  2FPD A;  1KJW A;  4HCK A;  1GBR A;  2K2M A;  1LCK A;  2CH4 A;  4JJD A;  1UGV A;  3H0H A;  1T3S A;  4CC3 A;  1G2B A;  3PVQ A;  2F2W A;  2KR3 A;  3QWY A;  5IH2 A;  2HBW A;  2CDT A;  4JJC A;  1YWO A;  3EHQ A;  2LCS A;  3UAT A;  1X27 A;  2PZ1 A;  1OOT A;  4ZNX A;  2JM9 A;  4JZ3 A;  1TUC A;  3EGU A;  3EG1 A;  4JPB W;  1H8K A;  2RQU A;  2LQW A;  2ROT A;  3I5S A;  1UHF A;  2DE0 X;  4J9F A;  1AWX A;  2CH4 W;  1KSW A;  4RTV A;  1FYN A;  2A37 A;  2DRM A;  2FO0 A;  2L3P A;  1AD5 A;  2DIL A;  1KIK A;  1GFD A;  3H0F A;  2W0Z A;  1VYV A;  1SRM A;  2LJ3 A;  4A63 B;  2JMA A;  2CUB A;  1B3Q A;  2D8H A;  2YSQ A;  1AVZ C;  1ZLM A;  2HEQ A;  4RTZ A;  1YN8 A;  2KGT A;  4GLM A;  4AFZ C;  2DMO A;  2EQI A;  2JTE A;  4LUD A;  1GL5 A;  4J9B A;  1K76 A;  1HJD A;  2DL5 A;  1VYT A;  1WFW A;  2EGC A;  1UEC A;  5FWC A;  1AOJ A;  2XMF A;  4AFQ C;  4F16 A;  2EGA A;  2O88 A;  4DEX A;  2GTO A;  5HCK A;  4JZ4 A;  3VS6 A;  5ECA A;  1QWE A;  2D1X A;  2DLP A;  4RTT A;  1NYF A;  1Y0M A;  2KYB A;  4K11 A;  3LH5 A;  3CQT A;  1AZE A;  1RI9 A;  2VWF A;  4IIO A;  5IHI A;  3C0C A;  1E6G A;  2PTK A;  2DVJ A;  2EYW A;  2FG0 A;  2X3X D;  2PNI A;  2AK5 A;  2DF6 A;  3H0I A;  2JT4 A;  2MCN A;  2YUN A;  1AWJ A;  1QCF A;  2GQI A;  4ESR A;  1GRI A;  1PKT A;  2BZX A;  1I1J A;  1WLP B;  2KRO A;  4F17 A;  3VS5 A;  1B07 A;  2V1R A;  2KYM A;  1CKA A;  1K0S A;  1AWO A;  4RUG A;  4AG2 C;  2J05 A;  4J9D A;  1UUE A;  1NM7 A;  3NHN A;  2DA9 A;  3EHR A;  1T3L A;  1M3B A;  4IIM A;  1GBQ A;  1YWP A;  2RPN A;  3GBQ A;  2LZ6 B;  3O5Z A;  4Z88 A;  2G6F X;  2GNC A; 
#chains in the Genus database with same CATH topology
 1YJ9 A;  1HSQ A;  3PVL A;  3DKM A;  2ABL A;  2RJD A;  5FU7 B;  2YUO A;  5KYX B;  1K9A A;  2LVM A;  2CT4 A;  1VQ8 Q;  2KQW A;  1BU1 A;  3KBG A;  3A1P A;  4N4H A;  2DZC A;  1VYU A;  2K3X A;  2Y90 A;  2CKK A;  4RTX A;  3QG1 A;  1PM3 A;  4BI8 B;  4DEY A;  3WVD B;  2COZ A;  4M77 G;  1CSK A;  4M78 C;  2VAS A;  3KFV A;  4XTX A;  1VQ7 T;  3M4Y A;  5GAM j;  1TUG B;  2PUO B;  4NL3 A;  1TG0 A;  1BIB A;  2HSE B;  4M7A G;  1VQ9 T;  2RO0 A;  5FWB A;  3DB3 A;  3AHU A;  5GAM e;  3CC4 A;  2QQB A;  3EH2 A;  2LX9 A;  2HNI A;  3GPL A;  1Q7Y R;  1OV3 A;  2FEI A;  2E1H A;  2AIR B;  3U23 A;  2E3I A;  4D8K A;  1E6H A;  1WJR A;  4PJJ A;  3CCR Q;  1VQL T;  1OU8 A;  1T0H A;  3PMT A;  3QUI A;  2RJE A;  1U3O A;  4WF2 A;  1EZZ B;  2SEM A;  3JCM b;  2K7A A;  2DEU A;  5KYN A;  4EPC A;  1QCO A;  2EFI A;  1K73 C;  3L2Q A;  1UE9 A;  3LW5 E;  1AZG B;  1M1K U;  2X3W D;  1MV3 A;  2DPP B;  2DVE A;  1SHG A;  1YP5 A;  4EDU A;  4F14 A;  4BI4 A;  3CXC S;  3NGP A;  2KT8 A;  5CKD A;  1R0C B;  2FHD A;  5LJ3 h;  4A4K A;  1QP2 A;  1E7O A;  3EG9 B;  1Q81 C;  3QSU A;  2EYZ A;  2JTF A;  4RTW A;  1ZSZ A;  2NUZ A;  1M9S A;  4LD9 K;  5LJ3 j;  3VS7 A;  3G6E T;  2DD5 A;  3H8Z A;  1G5V A;  1PSF A;  2KRS A;  2DTH A;  1G83 A;  4MZP A;  4OMM A;  2DL3 A;  3TRE A;  3CCS T;  2LQK A;  1WXU A;  2LJ1 A;  1OX9 A;  3G1J A;  1B34 A;  2M51 A;  1XOV A;  3TSZ A;  3OY9 A;  3QJ6 A;  4M4Z A;  4M7D B;  1D1A A;  1D1B A;  2KBT A;  4F04 B;  1PKS A;  3A8G B;  3FB9 A;  2VKN A;  2KT1 A;  1ZUU A;  1VQ9 Q;  4C92 A;  2CP6 A;  1WXT A;  4FW1 A;  4E7K A;  2RK1 A;  1FX7 A;  3JCM J;  2MK5 A;  4C8Q D;  4XU2 A;  2OI3 A;  2NUP B;  3LYI A;  1M2O A;  2EBP A;  5LJ5 d;  2EYQ A;  1TS9 A;  4BE0 A;  4M78 F;  2RNA A;  1QVF P;  4L5G A;  2CZ0 B;  3V8K A;  1ZUY A;  1SSH A;  3QO3 A;  1UGR B;  1UG1 A;  1ZSG A;  2EJ9 A;  2H8H A;  4KBM B;  2JJ9 A;  1PSE A;  5CAI A;  3QII A;  1ABQ A;  3IQL A;  1X6G A;  4FSX A;  4DBR A;  5DM7 R;  3FLG A;  1D09 B;  4R0K A;  4X1V A;  4ORZ A;  1NE8 A;  1M30 A;  3M54 A;  1S72 Q;  1Y96 B;  5LL6 S;  3ZFJ A;  3EG2 A;  4M75 A;  1D3B B;  1VQK T;  2A7Y A;  1IGQ A;  4QQD A;  1I07 A;  1W70 A;  3M0Q A;  1JXM A;  4GLK A;  5FU6 C;  1VQ5 Q;  2ENM A;  2DJZ A;  3CME A;  5CO7 A;  2V8J A;  3CCE Q;  2EKH A;  4MDW A;  3WVE B;  1OPK A;  5D6Y A;  4X34 A;  2BE9 B;  3I35 A;  4M7A D;  2OTJ Q;  2A0F B;  4OMN A;  1S1N A;  4E2F B;  4M7A B;  6AT1 B;  4ME7 A;  5GMK j;  4LDW A;  2HZY A;  1WNL A;  2IIM A;  2ZPE B;  2KI7 A;  1MUZ A;  1MV0 B;  1WA7 A;  8ATC B;  3O8V A;  2O4X B;  2L3Q A;  2BIV A;  2VV5 A;  4M7D F;  3VJP A;  5AYF A;  3HKS A;  4C5I A;  2AZS A;  2XIC A;  1V29 B;  1G8X A;  3LGL A;  2O2O A;  3LWH A;  1UFF A;  1Y96 A;  4MDX A;  1AHJ B;  1ACM B;  1YFN A;  2L5Q A;  1X6B A;  5CVI A;  3RBB B;  4PJO G;  1NJI R;  4F7U F;  3CCQ Q;  2DXT A;  2EQK A;  3NMZ C;  3PT9 A;  4E47 A;  3M58 A;  1G3W A;  3L1A A;  3EG0 A;  2KK4 A;  4QT7 A;  1K73 U;  4M7D D;  1YCS B;  2MI6 A;  2B86 A;  4HKE A;  5IXF A;  2D6F A;  1RL2 A;  3G71 A;  3EGX A;  3VUB A;  2RD1 A;  1JQQ A;  2WSE E;  3CMA T;  2YRD A;  2HCK A;  3M0S A;  2MOX A;  2ECZ A;  5GAN 5;  2YUQ A;  5L8R E;  2L89 A;  2CSQ A;  1IRE B;  5DY9 A;  1QWF A;  3HRT A;  2RI5 A;  4C92 B;  2BKD N;  1BBZ A;  1M27 C;  4CRI A;  1Q82 R;  5GAO n;  3JCM d;  1NBE B;  3M4G A;  1NPP A;  1D0Z A;  3GNG A;  2LT4 A;  4M75 G;  4RCB A;  3C94 A;  4JDS A;  3EFR A;  1LNX A;  4JLI A;  5LJ5 g;  1VQL Q;  1LCK A;  5AT1 B;  2QA4 T;  1XQH A;  2K2V A;  2BUD A;  1YCY A;  1Q81 R;  1Q86 C;  4PFO A;  4CC3 A;  4C0D B;  2F2W A;  2KR3 A;  3MCA B;  5IH2 A;  2CDT A;  2PVO B;  2XHC A;  1YWO A;  2LCS A;  3URG A;  4J5Y A;  3JSC A;  3JAM E;  1M1G A;  2JM9 A;  3JCM e;  4JZ3 A;  1TUC A;  3EGU A;  3EG1 A;  2YRV A;  3CXC A;  2JN0 A;  2FZK B;  2RQU A;  4FT4 A;  2LQW A;  4LXC A;  1UHF A;  1N8R C;  4D6W A;  1OUL A;  4B9X A;  2EQU A;  2CH4 W;  1KSW A;  4ZN1 A;  5LJ3 g;  3BE3 A;  1WQ7 A;  2DRM A;  2FO0 A;  1KIK A;  3CBM A;  1KC8 R;  3HSB A;  2COW A;  3SWN B;  4A63 B;  3A5Z B;  4PJO E;  2ZPB B;  2YSQ A;  4RTZ A;  1YN8 A;  5CK9 A;  5HKC A;  1N9R A;  4R56 A;  4OB1 B;  2DMO A;  4LUD A;  1GL5 A;  1K76 A;  2FYK A;  3MEA A;  4IUU A;  2DL5 A;  1Y07 A;  2KAF A;  1WFW A;  1UEC A;  1AOJ A;  4XQ3 A;  2O88 A;  1Y7X A;  2GTO A;  4ZN3 A;  2K5I A;  5HCK A;  3G6E Q;  3CCU Q;  4Y28 E;  5ECA A;  1QWE A;  2DLP A;  4F7U A;  3VYG A;  2F1L A;  1VOM A;  2DER A;  3CQT A;  2RA2 A;  2VWF A;  4PJL A;  5IHI A;  2RHZ A;  3I56 A;  5DLQ E;  4BUG A;  1M5Q 1;  2X3X D;  4QVC A;  2OTJ A;  1LOJ A;  2O01 E;  2AK5 A;  3CC7 Q;  3TQ7 P;  3OYB A;  2JT4 A;  1WZO A;  3QHS A;  2YUN A;  2GQI A;  4ESR A;  2BZX A;  3JB9 I;  4XTY A;  1VQ6 Q;  3RKX A;  2KRO A;  2YLC A;  3QKJ A;  2MMP A;  4OB2 B;  4FU6 A;  4F17 A;  4KH0 B;  2H3J A;  3VS5 A;  1B07 A;  1C1A A;  3E9F A;  1QP3 A;  5D6X A;  1CKA A;  1K0S A;  3CC2 A;  4RUG A;  2J05 A;  1VQ8 T;  1H3Z A;  1KHC A;  3OYE A;  1TH7 A;  1YWP A;  1NJI C;  4VUB A;  3O5Z A;  4LDX A;  4OGC A;  3CCV Q;  1W2B S;  2ZPG B;  2ROL A;  2RQR A;  1M3A A;  5CKE A;  1GFC A;  4C92 D;  2JUF A;  2E3H A;  2C0I A;  4UC4 A;  1LVK A;  1PG5 B;  3NTK A;  1K8A C;  5LJ3 d;  2DKG A;  4M77 C;  4OGE A;  1KQS P;  4PLL A;  1VQM A;  3H9N A;  2QAS A;  2RK2 A;  3THK A;  2P4R A;  1IXD A;  4BY6 C;  4M7A C;  2HBP A;  1OEB A;  4GBQ A;  3UF4 A;  1WX6 A;  1QVG P;  1D0X A;  1UHC A;  1MMA A;  3L2W A;  1Q86 U;  1ZBJ A;  2L0A A;  4JLG A;  2EW3 A;  3OS5 A;  1VQL A;  2X9H A;  2OTL Q;  5GAO q;  3M0R A;  1M8M A;  2XI9 A;  3X28 B;  2C06 A;  2HQH A;  4J7F A;  1KQS S;  1ZHI A;  4ELY C;  5GAN 8;  1X69 A;  3VRY A;  1NZ9 A;  4OMO A;  5I11 A;  5KYY A;  4QW2 A;  4Z02 A;  1QKW A;  4DBH A;  5KCH A;  4PJO D;  2Y4Y A;  1VQ6 T;  3MPU B;  2J6O A;  2O31 A;  3CCR T;  2CSI A;  1UJ0 A;  3SWN A;  1JRI A;  2LX7 A;  2E64 A;  3QZ5 B;  1C6V X;  2DIQ A;  1YHQ T;  2M0Y A;  2F2V A;  4R55 A;  1W1F A;  2DX1 A;  3JB9 J;  2BZ8 A;  1TUD A;  2QI2 A;  3X26 B;  3MJX A;  2LRQ A;  2DL8 A;  2MIO A;  4FW2 A;  4J9C A;  4N4I A;  1PD0 A;  2V8K A;  3OW2 S;  4FCY A;  4LN2 A;  2C0T A;  2DET A;  3CCV T;  3FDR A;  3VS3 A;  1UJY A;  4Q5W A;  2CS7 A;  1MMD A;  2F2X A;  1UDL A;  5GMK m;  3HRS A;  5D7U A;  4OMP A;  3OYL A;  2J6K A;  4IUT A;  2WSF E;  2RMO A;  1V1C A;  3UA7 A;  4M78 D;  3BY7 A;  1A0N B;  4CI0 C;  2FRW A;  1S72 A;  2RI3 A;  1K0X A;  4BE2 A;  3OW2 P;  2MPX C;  3MET A;  2RQV A;  4O5V A;  4KUD K;  4C8Q E;  3UA6 A;  1ARK A;  1YIJ Q;  2KRM A;  2AKK A;  2HKQ B;  3A8O B;  3TU4 K;  4EMK A;  3M53 A;  2LMJ A;  4M77 E;  2GBQ A;  4RTU A;  1U06 A;  4QKU A;  4PJN A;  1JXO A;  3MEV A;  4ZGJ B;  2DBM A;  3PIP A;  1RAG B;  3ME9 A;  4OMQ A;  2FVU A;  2EAY A;  5HY6 A;  2FPF A;  2QK0 A;  3SB2 A;  4ELZ C;  1N8R R;  5KYW A;  2WAC A;  2O4X A;  3TVT A;  3CC4 T;  3NFC A;  3CCL Q;  1VQO Q;  2D9T A;  1D1C A;  5GAN g;  1RAE B;  2F5K A;  2ZPI B;  3GOX A;  2EPD A;  3REB B;  4J6X A;  1FMW A;  1KQ1 A;  3CD6 T;  4QVZ A;  1HXD A;  5GAM g;  4KRT A;  4JJB A;  3S3M A;  1M1K R;  5KYX A;  1O9S A;  3CPW S;  4Z8A A;  1JEG A;  4XTU A;  3BDU A;  1K4U S;  1KK7 A;  2EGE A;  4MZM A;  2EKO A;  2MWP A;  5FW9 A;  2LQN A;  1KC8 C;  3CC7 T;  3G4S A;  4M75 B;  1VQ5 A;  4HXJ A;  3M0P A;  2X35 A;  4XK8 E;  1C0M A;  1J3T A;  3OYM A;  1RAF B;  4C8Q B;  4C92 E;  2ZZD A;  9ATC B;  1WHL A;  4QQ6 A;  1F1B B;  2CP2 A;  1PD1 A;  5GAN 7;  2K9G A;  2RHU A;  2YUP A;  3L42 A;  1YIT Q;  1YBY A;  3JCM c;  3PE0 A;  1VQO A;  3E2U A;  2JS2 A;  4E6R A;  2DD4 A;  2Y4X A;  3C95 A;  2E5K A;  2KNB B;  2VVK A;  4LUE A;  1WHG A;  4BI3 A;  4M77 A;  1OX8 A;  4C8Q A;  1EIF A;  3WXM B;  3JCM h;  4PNO A;  5GJW B;  1YJW A;  2F5T X;  2A28 A;  2DZ9 A;  2LP5 A;  3SDZ A;  5GJV B;  2ESW A;  4BE1 A;  4A4E A;  3CCL T;  1QVP A;  1M90 R;  3CCQ A;  4XTW A;  3GP8 A;  1VQN T;  4M7D A;  1AWW A;  4Y92 A;  5IXB A;  4E7H A;  4M77 D;  1KD1 R;  1RLP C;  4KT0 E;  3JRZ A;  4M77 B;  3RR6 A;  3CCU A;  3CCM T;  4XU1 A;  2OTL T;  1U1S A;  2K2M A;  2K5F A;  2LQ8 A;  4JJD A;  4NOY A;  1IHW A;  3CBO A;  1T3S A;  2M02 A;  3QWY A;  4N0A C;  1V76 A;  1I4K 1;  2M0O A;  3I55 T;  3RIR A;  3VUZ A;  2ZGW A;  1BIA A;  3EH1 A;  4FYV B;  5KH6 A;  2M9U A;  4ZNX A;  1VQK A;  1FWZ A;  3G71 Q;  1RAC B;  1X6O A;  2DE0 X;  4JS4 A;  2X4Y A;  2E4H A;  5GMK h;  2RHY A;  3E1S A;  1FYN A;  2A37 A;  3OMG A;  1VQ9 A;  5KCO A;  2L3P A;  1X01 A;  2DIL A;  3OQ5 A;  4HT8 A;  3JCM Q;  2W0Z A;  1G3Y A;  1VYV A;  2QAZ A;  3L2V A;  2QQA A;  2VXF A;  2G3R A;  1QCN A;  2LJ3 A;  2EJG A;  2BE7 D;  2JMA A;  2D8H A;  1AVZ C;  1ZLM A;  2KMT A;  4IUR A;  4AFZ C;  4RG2 A;  4HA8 A;  1M8V A;  3OYD A;  2JTE A;  5I2S A;  5GAN d;  3EG9 A;  2YWW A;  4F16 A;  2EGA A;  2YHT A;  3M57 A;  3CPW A;  1YIJ T;  3H6Z A;  2DXC A;  2XK0 A;  3VS6 A;  1UGP B;  1NYF A;  4K11 A;  3HL8 A;  4N0A A;  3OB9 A;  3MP6 A;  1AZE A;  3QJY A;  1RAI B;  1E6G A;  5KYW B;  2FG0 A;  2DTO A;  1VQN Q;  3VV0 A;  5I2M A;  5A0G A;  1N8R U;  2DF6 A;  3H0I A;  5GAM f;  2MF2 A;  2MCN A;  1AWJ A;  1GRI A;  1R0B G;  1I1J A;  3S6W A;  3DLM A;  2V1R A;  1IGU A;  2AT1 B;  2KY9 A;  1WPY A;  2QDY B;  2WSC E;  3M55 A;  4M75 F;  3HHT B;  4HT9 A;  4J9D A;  1KQ2 A;  3CXC P;  2E6Z A;  5GAO r;  1M1F A;  4KH1 B;  2LTO A;  5LJ5 h;  4IIM A;  2L8D A;  5CR2 A;  2K57 A;  3RUX A;  4C8Q C;  4Z88 A;  5FU7 C;  3C4S A;  2D0N A;  3GLX A;  1WDX A;  3NTH A;  2KXC A;  2P0P A;  1QMC A;  4DA4 A;  2E41 A;  3LH0 A;  3P8B B;  3EFS A;  2JTM A;  3VKI A;  2VC8 A;  1PC0 A;  2KDS A;  1QLY A;  3A8H B;  2QQS A;  4ZTF A;  1I5L A;  1MHN A;  2QTV A;  3HPW A;  1M3C A;  4F7U G;  1WYX A;  5GMK e;  4PJO F;  2VXE A;  1EX4 A;  4PJO A;  1H3H A;  2CRE A;  1I81 A;  1PHT A;  1NYG A;  3PFS A;  1WHK A;  2QEX Q;  1K8A R;  2I0N A;  1W6X A;  2QGG A;  5IT9 E;  2ED1 A;  3M0T A;  1K8A U;  4M7D G;  1AEY A;  3SFM A;  3CD6 Q;  2RHI A;  3ULR B;  3OW2 A;  4OMF B;  1ZA1 B;  4O6J A;  1M2V B;  5CIU A;  2L3R A;  2ZPH B;  1O75 A;  4PJM A;  3G7Z A;  2JXB A;  4F7U E;  1KFZ A;  2XKO C;  3M5A A;  2X4W A;  1SF9 A;  2K3B A;  3RES A;  4Z89 A;  3OYK A;  3DB4 A;  2O9S A;  1HD3 A;  1KD1 U;  1YHQ Q;  3CEY A;  1Q95 G;  5KYY B;  2DIG A;  3JCM g;  2I2L A;  3CCE A;  4J6W A;  2LDM A;  1WHH A;  2RQW A;  3ZL7 C;  2EVR A;  3R6N A;  2EIF A;  2DL7 A;  1JU5 C;  3I56 Q;  5FRN A;  2DBK A;  4NL2 A;  3LX7 A;  3MO8 A;  3M56 A;  1M1K C;  1RAB B;  1Q7Y C;  1JJ2 P;  2KXD A;  2YT6 A;  3KUF A;  5LJ5 e;  4OML A;  3H41 A;  1UB4 A;  2ZCF B;  3R6O A;  1SPK A;  1U5S A;  3OYF A;  5LJ5 j;  4M78 G;  1GCQ A;  4XU3 A;  3JCM V;  1KC8 U;  4TVR A;  5KE3 A;  1YI2 T;  2FZG B;  4KGZ B;  2V1Q A;  4CC4 B;  4JS5 A;  1ZX6 A;  4LDY A;  3G71 T;  1G3S A;  1GCP A;  1LJO A;  1K1Z A;  4XTV A;  3GIB A;  1U8R A;  3G6E A;  4PLI A;  2LC4 A;  2JS0 A;  4J83 A;  4J9E A;  1PWT A;  1YJN T;  3CCS A;  2DL4 A;  2RJF A;  5CQX A;  1ZBX A;  3UWN A;  3RNJ A;  3RKY A;  2W10 A;  4C0D C;  2EJF A;  3BFM A;  2OAU A;  4PL6 A;  5A0L A;  4PK4 A;  3PMI A;  5IHK A;  2P0Q A;  1RI0 A;  4OF1 A;  5M9O A;  2HAX A;  2XG8 D;  2XID A;  1B7T A;  1BYM A;  2QA4 A;  1NLO C;  2JMC A;  3EFO A;  1IHV A;  5FRM A;  1OZ3 A;  2QDL A;  3J7A F;  2DXB A;  1BI1 A;  1BB9 A;  2J6F A;  2KE9 A;  3QXE B;  4HCC A;  4KUI A;  1RAH B;  1NG2 A;  2RQT A;  2RI2 A;  2BTT A;  4B6M A;  5A2Q E;  3FRN A;  5C0M A;  3V7S A;  5J26 A;  5EG2 A;  4DBF A;  4ZGE B;  4KGX B;  1H92 A;  4M78 B;  4J9H A;  2EYX A;  3LGF A;  5C6S A;  2V8I A;  4AT1 B;  1SSF A;  1YNZ A;  2VB6 A;  4HVV A;  2L2P A;  3CCJ A;  5J39 A;  3CMA Q;  5GAN h;  2NUT A;  2H3E B;  1YHQ A;  2VYT A;  1YIT A;  1TWB A;  3VS1 A;  3VS4 A;  1KHI A;  2QGF B;  3GF5 A;  1MNE A;  1N5Z A;  2CUD A;  1X2Q A;  2HSP A;  2LT1 A;  5GMK i;  2GGR A;  1WHM A;  4HCZ A;  4C0G A;  5GAN 2;  2QTX A;  3TSW A;  2IG0 A;  2CGH A;  1TSF A;  4HVU A;  2J06 A;  2ZAE A;  4M78 A;  3INZ A;  2EWN A;  4M7A F;  3V7R A;  3HFO A;  2P4T A;  1BCM A;  2L3S A;  5LJ5 f;  3P8D A;  4PFP A;  1T0J A;  1MGQ A;  3EGX B;  4M77 F;  1VQ4 T;  1VUB A;  2KRN A;  4LD6 A;  1S72 T;  3SWN C;  5L23 A;  2DEQ A;  2CZ6 B;  1SG5 A;  2ATC B;  3CBP A;  2E70 A;  5KYU A;  4ZGD B;  1BKB A;  1VQN A;  5GMK l;  2MWO A;  1PRM C;  2P0K A;  3CME Q;  5I22 A;  4RMO A;  3TEE A;  2JM8 A;  3CC2 T;  2GFA A;  1JJ2 A;  1W2B A;  4J6Y A;  3CCU T;  1UTI A;  1Q7Y U;  1N27 A;  3JB9 H;  2NYS A;  1GCQ C;  1R77 A;  2A08 A;  4AFS C;  1WJS A;  2HKN A;  4EMK C;  4C92 C;  3G4S Q;  1WIE A;  5CCA A;  1WXB A;  2Z0W A;  1YJ9 T;  4M7A A;  1IRX A;  2X51 A;  1RAD B;  1M90 C;  1XTD A;  4JRK A;  3HP9 A;  4M7D C;  2CZ7 B;  1SKU B;  2FPD A;  2P84 A;  4HCK A;  3OBW A;  2CH4 A;  3NTI A;  4MML A;  1UGV A;  2XU8 A;  2E65 A;  4A53 A;  2HBW A;  5I21 A;  3EHQ A;  1KG1 A;  1VQM T;  2R57 A;  1IB8 A;  1ZA2 B;  2PU9 B;  2GQV A;  1D3B A;  5GAN e;  2OX7 A;  1H8K A;  2ROT A;  4MZT A;  2K3Y A;  5HK3 A;  2VGN A;  2DXU A;  4J9F A;  1AWX A;  4FYX B;  4J7I A;  3X20 B;  4RTV A;  1OQK A;  1AD5 A;  3V8L A;  3OMC A;  2XDP A;  4EMG A;  3JB9 D;  3H0F A;  3CCJ Q;  3RKW A;  1VQ4 Q;  1QVG A;  2K5L A;  2DTI A;  3QYH B;  1B3Q A;  2GF7 A;  5IAY A;  3RMQ A;  5GAN 3;  2KGT A;  4GLM A;  4M78 E;  4RKU E;  2E12 A;  4RCC A;  1OZ2 A;  2DFU A;  4J9B A;  3OYJ A;  4QQG A;  4C8Q F;  1HJD A;  1VYT A;  4BDZ A;  2EGC A;  5FWC A;  4QVD A;  2E6N A;  3OYI A;  2QYZ A;  4JZ4 A;  2D1X A;  3OYY A;  1OI1 A;  3FJP A;  4RTT A;  5HK0 A;  2EQJ A;  3LH5 A;  2D0Q B;  3OYA A;  1VQ8 A;  3JCM f;  3QZ9 B;  1NJI U;  5GAN f;  2PTK A;  3OS0 A;  2EYW A;  4OB3 B;  3L2U A;  3QDF A;  3ASK A;  1K73 R;  2HQX A;  3L2R A;  5KYU B;  3RER A;  4FT2 A;  4OP0 A;  1B34 B;  1BI2 A;  4A4H A;  1PKT A;  1WLP B;  1YI2 Q;  3EGD A;  1I5O B;  2KVQ G;  3ZEH A;  5LJ3 f;  3MKD A;  3UT1 A;  1AWO A;  4AG2 C;  3OYH A;  1NM7 A;  2DA9 A;  3MP1 A;  3OSV A;  1VIE A;  3OYG A;  2PVG B;  2YLB A;  2NUP A;  3OA6 A;  3MP8 A;  3X25 B;  1VQP A;  2LZ6 B;  2G6F X;  3JB9 F;  2GNC A;  1IO6 A;  4C5H A;  4XTZ A;  2QEX T;  4JRQ A;  3DLL A;  2DM1 A;  4JRI A;  1QVG S;  4M7A E;  2YRC A;  3V7C A;  4BAC A;  2IVW A;  4X9C A;  3P8H A;  1YJW Q;  4JRP A;  4OVA A;  1IZ6 A;  2BZY A;  3JCM X;  1RAA B;  1W2B P;  2XD0 A;  5D6W A;  1ABO A;  3A8M B;  3EGD B;  4FL6 A;  3FIF A;  1R8O B;  3VS0 A;  3L2Z A;  3QYG B;  4AFU C;  1SEM A;  1FMK A;  1UGS B;  4CC2 A;  2R5M A;  1WGS A;  4BY6 B;  3E9G A;  2ED0 A;  3RDV A;  2PUK B;  3LLR A;  3JCM W;  4FIB A;  2F69 A;  1OYX A;  2LJ0 A;  4RG8 A;  4P5N A;  3LWI A;  4LDU A;  3OS1 A;  2QXF A;  3REA B;  4C92 F;  2CP7 A;  2J7I A;  8AT1 B;  3PGG A;  3VS2 A;  4D8D A;  3M0U A;  4J9G A;  4FM4 B;  1NEG A;  5A0D A;  2RN8 A;  1VQ7 A;  2JVV A;  2RHX A;  3CPF A;  4PKC C;  4WCI A;  3PTA A;  4CC7 A;  3FC3 A;  4E7S A;  2FRY A;  3UDC A;  3SHW A;  3CME T;  4EMH A;  3A8L B;  1YIJ A;  2CP3 A;  4M75 E;  1WHJ A;  4A54 A;  2K4Y A;  1Y57 A;  2OJ2 A;  4GY5 A;  2O9V A;  4HVW A;  1Q82 U;  2DYB A;  2XDD A;  1I0C A;  5GAN 4;  1Z9Q A;  2HQE A;  3I56 T;  1VIF A;  3NPF A;  1SHF A;  2SRC A;  2CZ1 B;  2NWM A;  3Q1J A;  2JW4 A;  2HMA A;  1WJQ A;  1Q81 U;  3I9Q A;  1MND A;  1KD1 C;  2CP0 A;  1RLQ C;  1NEB A;  1SRL A;  1TU0 B;  1JB0 E;  3CC4 Q;  3CCV A;  4DBQ A;  4DQ2 A;  1M4Z A;  2RH2 A;  2CYZ B;  1K9M C;  3QWX X;  1VQP Q;  3M59 A;  4II1 A;  4E7I A;  5GAN 6;  2JZ2 A;  1TXQ A;  2GCX A;  2KEA A;  4XAX B;  4M75 C;  1MMG A;  3OYC A;  1FMV A;  4BB7 A;  4ZTJ A;  1UEB A;  3JV3 A;  3CMA A;  3S3O A;  1YJN Q;  4LE9 A;  5CKB A;  2E5Q A;  2EQM A;  3QDR B;  2D8J A;  2MAM A;  3D7S B;  1ZSZ C;  1X2K A;  2OAW A;  4FYY B;  3TCJ A;  1ZUK A;  2LNV A;  4IUQ A;  4E7J A;  3C12 A;  4DOW A;  1M90 U;  4L59 A;  5GAN j;  4V2S A;  4IKF A;  4A4F A;  3QBY A;  1CKB A;  2DO3 A;  4KGV B;  5J3B A;  4FSS A;  4AMC A;  5CKF A;  1JO8 A;  2KSS A;  1TTH B;  2OTL A;  2AZV A;  4F7U B;  5IHN A;  2YXY A;  1AT1 B;  3F70 A;  5KE2 A;  4B9W A;  3CD6 A;  2AKL A;  3OYN A;  3HRU A;  4RTY A;  3KXT A;  2M1H A;  3CCJ T;  2DNU A;  2YDL A;  1BK2 A;  2XDB A;  4IUP A;  1QW1 A;  1YIT T;  2HDA A;  2K79 A;  1Z9Z A;  4FYW B;  3EAE A;  1RUW A;  3ER0 A;  4PJO B;  5EC7 A;  1GXI E;  3I5R A;  1VQ6 A;  1G3T A;  3OSS C;  1W4S A;  1PNJ A;  1VA7 A;  3A98 A;  3VRZ A;  2GTJ A;  1EFN A;  4E7Z A;  2X4X A;  4PJO C;  4IUV A;  1OU9 A;  1QVF A;  2QG9 B;  2C0O A;  2NLU A;  3OBY A;  1VQ4 A;  1QKX A;  3RMS A;  3GNF B;  2RF0 A;  1JJ2 S;  3E19 A;  2K6D A;  4OB0 B;  3N5B B;  2JOY A;  3HFN A;  1ZSZ B;  4C92 G;  1U1T A;  2HL3 A;  5CKH A;  3SD4 A;  2DRK A;  4XU0 A;  4ATO A;  2GFU A;  3CC2 Q;  2A36 A;  2R5A A;  3CCM Q;  4HCB A;  1P92 A;  2X4J A;  1PRL C;  1UGQ B;  1WI7 A;  5IN1 A;  3AT1 B;  5GAO l;  1YJW T;  2V26 A;  2DAQ A;  2CT3 A;  1N9S A;  3G4S T;  3CC7 A;  4BDY A;  2FL7 A;  2DJQ A;  1YJ9 Q;  3CCQ T;  2NUT B;  1Q86 R;  3FJ5 A;  3QPH A;  5GAO p;  1X43 A;  4N4G A;  4EIK A;  2QQR A;  1JBM A;  4L6V 5;  1BI3 A;  2FPE A;  3V8J A;  4C5E A;  3ZBD A;  2R58 A;  5CQY A;  3CCM A;  1YJN A;  2LCL A;  4LNP A;  2B8A A;  4JJN K;  4E7L A;  1HK9 A;  4KUL A;  4J9I A;  1VQO T;  1XNI A;  3JB9 G;  3EG3 A;  4Y91 A;  1BI0 A;  3SEM A;  1QVF S;  1Q82 C;  3MEU A;  2LNH B;  4AG1 C;  1BCO A;  3EFO B;  4EMK B;  2M16 A;  3VU3 C;  4C5G A;  1NLP C;  1OPL A;  1QQJ A;  3JCM P;  2E10 A;  1NPR A;  2MYS A;  2EYY A;  1KJW A;  1XJW B;  3BDL A;  1GBR A;  2VGM A;  1PCX A;  1X75 C;  2QA4 Q;  3H0H A;  1G2B A;  1LPL A;  3PVQ A;  1DJ7 B;  1MMN A;  2QQ9 A;  5FLX E;  4JUV A;  7AT1 B;  5GAM d;  4X9D A;  3CCS Q;  4JJC A;  1VQM Q;  2IPO B;  3UAT A;  1N6A A;  1X27 A;  2PZ1 A;  3HTR A;  1Y71 A;  3MHX A;  1OOT A;  5GAO m;  3CPW P;  3T9N A;  5FRO A;  3PIO A;  4JPB W;  3I5S A;  4ANJ A;  3FEO A;  2AHJ B;  3J80 E;  1TOV A;  4M7D E;  4PFZ A;  2PVD B;  1GFD A;  2RM4 A;  3I55 A;  4NS5 A;  4C8Q G;  3UPU A;  1D0Y A;  1SRM A;  2HD0 A;  5DLO A;  2LCC A;  1K9M R;  2CUB A;  2HEQ A;  1VQK Q;  1FXX A;  2ZPF B;  2FZC B;  3OS2 A;  1K9M U;  2EQI A;  4A4G A;  4M75 D;  5GAM h;  3CCR A;  2DK3 A;  1VQ5 T;  3S3N A;  3J81 E;  1VQ7 Q;  2XMF A;  4AFQ C;  4YTL A;  1KQS A;  3MEW A;  4C0F A;  4DEX A;  4WTO B;  1I8F A;  2VUB A;  1WQW A;  2A3L A;  1Y0M A;  2KYB A;  3X24 B;  3CCE T;  1RI9 A;  4LDV A;  4IIO A;  3C0C A;  3BW1 A;  2DVJ A;  2PNI A;  2COY A;  1VQP T;  1HYO A;  1QCF A;  5FU6 B;  4DOV A;  2FB7 A;  2PQW A;  4C0Z A;  2QEX A;  2JNG A;  2HL5 C;  2KYM A;  2DYI A;  1H64 1;  1UUE A;  4J8O A;  3NHN A;  3VYH B;  3M9Q A;  3EHR A;  3PNW C;  2CP5 A;  2OTJ T;  5LJ3 e;  3I55 Q;  2RJC A;  1T3L A;  1M3B A;  4BD3 A;  3CCL A;  1M2V A;  1GBQ A;  2RB6 A;  2RPN A;  3GBQ A;  1ZQ1 A;  4MMK A;  1YI2 A; 
#chains in the Genus database with same CATH homology
 1HSQ A;  2D0N A;  1IO6 A;  3PVL A;  1WDX A;  2ABL A;  2DM1 A;  2KXC A;  2ROL A;  2RQR A;  1M3A A;  1GFC A;  2YUO A;  1K9A A;  1QLY A;  2C0I A;  2CT4 A;  1BU1 A;  1VYU A;  2BZY A;  4RTX A;  1M3C A;  1ABO A;  1WYX A;  1H3H A;  2CRE A;  1PHT A;  1NYG A;  3THK A;  2P4R A;  3VS0 A;  4DEY A;  1OEB A;  2I0N A;  4GBQ A;  3UF4 A;  1SEM A;  1FMK A;  1WX6 A;  4AFU C;  4CC2 A;  1W6X A;  1CSK A;  3KFV A;  1UHC A;  2ED1 A;  3M0T A;  2ED0 A;  1ZBJ A;  1TG0 A;  2L0A A;  1AEY A;  2LJ0 A;  2EW3 A;  3ULR B;  5FWB A;  3REA B;  2J7I A;  3M0R A;  1M8M A;  3VS2 A;  4D8D A;  3M0U A;  1OV3 A;  1X69 A;  2FEI A;  4J9G A;  3VRY A;  5I11 A;  1NEG A;  4OMO A;  2JXB A;  2RN8 A;  1KFZ A;  1QKW A;  4WCI A;  4CC7 A;  3U23 A;  2J6O A;  2FRY A;  4D8K A;  1E6H A;  2O31 A;  2K3B A;  2CSI A;  3SHW A;  1UJ0 A;  4Z89 A;  2LX7 A;  1T0H A;  2O9S A;  1HD3 A;  1U3O A;  2M0Y A;  2F2V A;  1W1F A;  1Y57 A;  2DX1 A;  2OJ2 A;  2SEM A;  2BZ8 A;  2K7A A;  1TUD A;  2DL8 A;  2MIO A;  2O9V A;  4HVW A;  2DYB A;  1UE9 A;  2RQW A;  2EVR A;  4J9C A;  1AZG B;  3R6N A;  1I0C A;  3ZL7 C;  2DL7 A;  1JU5 C;  1Z9Q A;  2X3W D;  1MV3 A;  4LN2 A;  1SHG A;  1YP5 A;  2C0T A;  2DBK A;  4F14 A;  3NPF A;  3VS3 A;  3NGP A;  1SHF A;  1UJY A;  2KT8 A;  2SRC A;  2F2X A;  2KXD A;  2YT6 A;  2NWM A;  1E7O A;  1UDL A;  2JW4 A;  4OML A;  4OMP A;  3H41 A;  2EYZ A;  2J6K A;  3I9Q A;  2RMO A;  1RLQ C;  1V1C A;  4RTW A;  1NEB A;  2NUZ A;  3UA7 A;  3VS7 A;  1SPK A;  1A0N B;  1U5S A;  1SRL A;  2FRW A;  2KRS A;  1K0X A;  1G83 A;  4OMM A;  2DL3 A;  1GCQ A;  1WXU A;  2LJ1 A;  2RQV A;  3QWX X;  2M51 A;  1XOV A;  3TSZ A;  4M4Z A;  2V1Q A;  4CC4 B;  1ZX6 A;  2KEA A;  2KBT A;  3UA6 A;  1ARK A;  2KRM A;  2AKK A;  1PKS A;  1GCP A;  1K1Z A;  2VKN A;  2KT1 A;  3JV3 A;  1ZUU A;  2JS0 A;  2LMJ A;  4LE9 A;  4J9E A;  1PWT A;  1WXT A;  2D8J A;  2GBQ A;  4RTU A;  1U06 A;  2DL4 A;  2OI3 A;  2EBP A;  1X2K A;  3RNJ A;  1JXO A;  2OAW A;  2W10 A;  1ZUK A;  2RNA A;  1ZUY A;  2DBM A;  5IHK A;  1SSH A;  1CKB A;  1UG1 A;  1ZSG A;  2H8H A;  4FSS A;  1JO8 A;  4OMQ A;  1ABQ A;  2AZV A;  1NLO C;  2JMC A;  3IQL A;  5IHN A;  1X6G A;  2FPF A;  2QDL A;  2AKL A;  4RTY A;  1BB9 A;  4R0K A;  4X1V A;  3TVT A;  2DNU A;  2J6F A;  4ORZ A;  2KE9 A;  2YDL A;  1M30 A;  1BK2 A;  3EG2 A;  1NG2 A;  2RQT A;  2HDA A;  2BTT A;  2K79 A;  1Z9Z A;  2EPD A;  1RUW A;  5EC7 A;  1I07 A;  1W70 A;  3M0Q A;  1JXM A;  3I5R A;  3REB B;  1H92 A;  4J9H A;  2EYX A;  1PNJ A;  1VA7 A;  2ENM A;  4KRT A;  1YNZ A;  3A98 A;  3VRZ A;  4HVV A;  2L2P A;  4JJB A;  2GTJ A;  1EFN A;  2EKH A;  1OPK A;  3I35 A;  4Z8A A;  1JEG A;  3VS4 A;  3VS1 A;  1K4U S;  2C0O A;  2EGE A;  1N5Z A;  4OMN A;  1S1N A;  1QKX A;  2CUD A;  1X2Q A;  2HSP A;  2GGR A;  2RF0 A;  5FW9 A;  2LQN A;  2K6D A;  2IIM A;  3TSW A;  4HVU A;  2J06 A;  1MUZ A;  4HXJ A;  3M0P A;  1MV0 B;  1WA7 A;  2DRK A;  2L3Q A;  2A36 A;  2L3S A;  1J3T A;  2AZS A;  1T0J A;  1PRL C;  1WI7 A;  2O2O A;  1UFF A;  2KRN A;  5L23 A;  2K9G A;  2YUP A;  2CT3 A;  1X6B A;  3RBB B;  3PE0 A;  2DJQ A;  3NMZ C;  2JS2 A;  4E6R A;  3FJ5 A;  1X43 A;  1PRM C;  3EG0 A;  4EIK A;  4QT7 A;  2E5K A;  2KNB B;  1YCS B;  2B86 A;  2VVK A;  4LUE A;  5IXF A;  5I22 A;  2JM8 A;  1JQQ A;  2FPE A;  5GJW B;  1UTI A;  2HCK A;  3M0S A;  2A28 A;  2MOX A;  2LP5 A;  4LNP A;  2ECZ A;  1GCQ C;  5GJV B;  2ESW A;  2YUQ A;  2A08 A;  4AFS C;  4J9I A;  3EG3 A;  3SEM A;  2CSQ A;  1WIE A;  1AWW A;  4Y92 A;  1WXB A;  1QWF A;  5IXB A;  1BBZ A;  1M27 C;  2LNH B;  4AG1 C;  1NLP C;  1OPL A;  1RLP C;  2EYY A;  2FPD A;  1KJW A;  4HCK A;  1GBR A;  2K2M A;  1LCK A;  2CH4 A;  4JJD A;  1UGV A;  3H0H A;  1T3S A;  4CC3 A;  1G2B A;  3PVQ A;  2F2W A;  2KR3 A;  3QWY A;  5IH2 A;  2HBW A;  2CDT A;  4JJC A;  1YWO A;  3EHQ A;  2LCS A;  3UAT A;  1X27 A;  2PZ1 A;  1OOT A;  4ZNX A;  2JM9 A;  4JZ3 A;  1TUC A;  3EGU A;  3EG1 A;  4JPB W;  1H8K A;  2RQU A;  2LQW A;  2ROT A;  3I5S A;  1UHF A;  2DE0 X;  4J9F A;  1AWX A;  2CH4 W;  1KSW A;  4RTV A;  1FYN A;  2A37 A;  2DRM A;  2FO0 A;  2L3P A;  1AD5 A;  2DIL A;  1KIK A;  1GFD A;  3H0F A;  2W0Z A;  1VYV A;  1SRM A;  2LJ3 A;  4A63 B;  2JMA A;  2CUB A;  1B3Q A;  2D8H A;  2YSQ A;  1AVZ C;  1ZLM A;  2HEQ A;  4RTZ A;  1YN8 A;  2KGT A;  4GLM A;  4AFZ C;  2DMO A;  2EQI A;  2JTE A;  4LUD A;  1GL5 A;  4J9B A;  1K76 A;  1HJD A;  2DL5 A;  1VYT A;  1WFW A;  2EGC A;  1UEC A;  5FWC A;  1AOJ A;  2XMF A;  4AFQ C;  4F16 A;  2EGA A;  2O88 A;  4DEX A;  2GTO A;  5HCK A;  4JZ4 A;  3VS6 A;  5ECA A;  1QWE A;  2D1X A;  2DLP A;  4RTT A;  1NYF A;  1Y0M A;  2KYB A;  4K11 A;  3LH5 A;  3CQT A;  1AZE A;  1RI9 A;  2VWF A;  4IIO A;  5IHI A;  3C0C A;  1E6G A;  2PTK A;  2DVJ A;  2EYW A;  2FG0 A;  2X3X D;  2PNI A;  2AK5 A;  2DF6 A;  3H0I A;  2JT4 A;  2MCN A;  2YUN A;  1AWJ A;  1QCF A;  2GQI A;  4ESR A;  1GRI A;  1PKT A;  2BZX A;  1I1J A;  1WLP B;  2KRO A;  4F17 A;  3VS5 A;  1B07 A;  2V1R A;  2KYM A;  1CKA A;  1K0S A;  1AWO A;  4RUG A;  4AG2 C;  2J05 A;  4J9D A;  1UUE A;  1NM7 A;  3NHN A;  2DA9 A;  3EHR A;  1T3L A;  1M3B A;  4IIM A;  1GBQ A;  1YWP A;  2RPN A;  3GBQ A;  2LZ6 B;  3O5Z A;  4Z88 A;  2G6F X;  2GNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...