1RUWA

Crystal structure of the sh3 domain from s. cerevisiae myo3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
KDPKFEAAYDFPGSGSSSELPLKKGDIVFISRDEPSGWSLAKLLDGSKEGWVPTAYMTPYKDTRNTVPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Myosin-3 isoform
publication title Crystal structure of the SH3 domain from S. cerevisiae Myo3
rcsb
source organism Saccharomyces cerevisiae
total genus 11
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2003-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ruwA01
1AZEA 3EG0A 4RTZA 1WXUA 2D8HA 1NLOC 2M51A 1ZLMA 2CT3A 2DBMA 2CH4W 1WXBA 1BU1A 2L3PA 2HSPA 4JJCA 3ULRB 3VS0A 1LCKA 1H8KA 2PZ1A 2FEIA 1WI7A 2JMAA 2KXDA 4HVVA 2GQIA 2ROLA 3IQLA 1PRMC 4HVWA 3H41A 2K9GA 2KRMA 4OMNA 1IO6A 2DF6A 2LJ3A 4E6RA 5IH2A 1UGVA 2C0TA 1SRLA 1Y0MA 2RF0A 3C0CA 2RPNA 1TUCA 3O5ZA 1NYGA 2HCKA 1HJDA 1HD3A 2P4RA 1GBRA 1PHTA 2E5KA 2EBPA 1MUZA 3H0HA 3SEMA 1WA7A 1WLPB 1VYTA 2HDAA 3PE0A 2J7IA 3U23A 2KGTA 3M0UA 2F2WA 2XMFA 1RLQC 1VA7A 2NWMA 1S1NA 2KROA 2RMOA 1AVZC 1YWOA 1UHCA 1AD5A 2D8JA 2EYZA 1T3SA 2OJ2A 1M3AA 4J9GA 2ABLA 4R0KA 1JXMA 1ARKA 1W70A 1WDXA 2RN8A 2EGAA 2AZSA 1T0JA 4A63B 2CH4A 2ESWA 4J9CA 1X6BA 5ECAA 3REAB 2K7AA 2L3QA 4F17A 2EVRA 2RQWA 4D8DA 2JTEA 3TSZA 1Z9ZA 1E7OA 1H92A 2AZVA 1ZUUA 1X2KA 4AFZC 1WX6A 1KFZA 2DILA 3THKA 2ED0A 1I0CA 1GCQC 4RTUA 2KNBB 2DMOA 1RLPC 1ABOA 4F16A 1NM7A 1RI9A 2JXBA 3NHNA 2KT8A 4GBQA 4OMLA 1GFDA 1QLYA 2JS0A 3QWXX 2DE0X 1TUDA 1G83A 1I07A 1OPKA 4CC4B 2GNCA 2DL8A 2OI3A 5HCKA 1PRLC 2K3BA 1SRMA 4IIOA 2VKNA 2YUPA 5I11A 2JW4A 1WIEA 1QWEA 1XOVA 2DLPA 4LN2A 4CC2A 2DA9A 2H8HA 1EFNA 1MV3A 2KEAA 2F2VA 2O9VA 2YDLA 2AKLA 3SHWA 4D8KA 2ROTA 2GTJA 1Y57A 4RTWA 1W6XA 1GCQA 1YP5A 4ORZA 2FPFA 4AFSC 1K0XA 1UE9A 1ABQA 4Z88A 2MOXA 4CC7A 1U5SA 1NG2A 1UHFA 1UG1A 4J9HA 4HVUA 2FPEA 2QDLA 4LE9A 1M3BA 2D0NA 3UF4A 1QCFA 4OMMA 4RTTA 5GJWB 1YN8A 1B3QA 1BBZA 1UUEA 1X69A 3VS3A 5IXFA 4K11A 1W1FA 2LP5A 2NUZA 3EG3A 3M0RA 1WYXA 2IIMA 2DL5A 2KR3A 2DL7A 4ESRA 1X27A 3GBQA 2CUBA 2GTOA 2W10A 3JV3A 2J6OA 2CDTA 4J9DA 2KT1A 4J9IA 2KYBA 3UATA 1ZBJA 1X43A 2LCSA 3VS6A 2FPDA 1AOJA 2RQVA 3M0SA 4Z8AA 1QWFA 3M0TA 2YT6A 1WXTA 4IIMA 1T3LA 2X3WD 2CSIA 1RUWA 1UJ0A 2D1XA 2EYYA 5L23A 2DNUA 4J9BA 1G2BA 1ZUKA 2JM8A 2EYWA 2AK5A 1QKWA 1PNJA 3EG1A 2KXCA 1K9AA 2A36A 2O2OA 1OPLA 1SPKA 2K79A 2LJ0A 2ENMA 1CSKA 2MIOA 2DVJA 1KSWA 1ZSGA 2EQIA 4FSSA 4J9FA 4M4ZA 4WCIA 1NEBA 5IHIA 4AFUC 4RTVA 1BB9A 2JM9A 3PVQA 1JXOA 3UA7A 2B86A 2DM1A 2K2MA 3RNJA 2YSQA 4ZNXA 4JJDA 3UA6A 1U3OA 2EKHA 4EIKA 1SEMA 1GBQA 2LNHB 1H3HA 1K76A 1UDLA 4OMPA 1AEYA 3R6NA 1PKTA 3FJ5A 2C0IA 3I9QA 2DL3A 2CSQA 2C0OA 1QKXA 1VYUA 1K4US 4F14A 3PVLA 2RQTA 2FRWA 1M8MA 3VS2A 4X1VA 2EGCA 1MV0B 1JQQA 1PKSA 2G6FX 2RQUA 1YNZA 1M30A 1HSQA 1M27C 2LJ1A 1FYNA 1YCSB 4DEYA 2A28A 2K6DA 1JEGA 4HCKA 2CUDA 2EGEA 1SHFA 1OV3A 3TSWA 2YUOA 3EHQA 2FO0A 3EGUA 3NPFA 2J6FA 2BTTA 2VVKA 4LNPA 1K1ZA 1N5ZA 1NEGA 1UECA 4QT7A 4AG2C 2V1QA 3QWYA 5IHNA 2I0NA 3VRYA 4Z89A 3LH5A 2LX7A 1KJWA 1UTIA 4LUDA 2DL4A 1J3TA 2O9SA 2PNIA 1AWWA 4GLMA 4RUGA 3ZL7C 1TG0A 1U06A 2EYXA 5FWCA 4JPBW 2A37A 2DX1A 2LQNA 2L3SA 1GFCA 2DJQA 4JZ3A 2OAWA 1VYVA 2LQWA 3REBB 2ED1A 2MCNA 4DEXA 4RTXA 2LMJA 4Y92A 1CKAA 2RNAA 3CQTA 2DRMA 4OMOA 3I35A 3NGPA 4KRTA 2JS2A 1X6GA 1OOTA 1E6GA 2GBQA 1E6HA 2KE9A 4JJBA 4J9EA 3VS5A 5IHKA 4CC3A 1K0SA 1AWJA 3NMZC 3I5SA 1PWTA 2EPDA 2J06A 5EC7A 2KRNA 4LUEA 2HEQA 1BK2A 2A08A 1GL5A 2X3XD 4AG1C 1OEBA 2J05A 2EW3A 3VRZA 2KYMA 2L2PA 2SEMA 4OMQA 2ECZA 2M0YA 5IXBA 4HXJA 2CT4A 1NYFA 1V1CA 3VS4A 2L0AA 1ZUYA 1T0HA 1YWPA 1AZGB 1M3CA 1FMKA 1GCPA 2HBWA 2O88A 1A0NB 2VWFA 1SSHA 2BZ8A 2RQRA 2FG0A 1Z9QA 3M0QA 1AWOA 2PTKA 5FW9A 5GJVB 3EG2A 2CREA 1UJYA 1WFWA 2KRSA 2LZ6B 1ZX6A 3EHRA 5I22A 3M0PA 2KBTA 3KFVA 3RBBB 2AKKA 1SHGA 2DBKA 2FRYA 3I5RA 2DRKA 2GGRA 1JO8A 4JZ4A 1X2QA 2SRCA 3H0FA 2BZXA 2JT4A 2O31A 3VS7A 1I1JA 2J6KA 4AFQC 2V1RA 3A98A 1UFFA 2BZYA 2F2XA 5FWBA 1KIKA 2JMCA 3TVTA 2YUNA 1AWXA 1NLPC 3VS1A 3H0IA 2YUQA 1CKBA 1JU5C 2W0ZA 4RTYA 1GRIA 2DYBA 1B07A
chains in the Genus database with same CATH superfamily
3BE3A 4RTZA 1LJOA 4JDSA 3J81E 2D8HA 2M51A 1NPRA 4XU2A 3JCMX 2L3PA 2MWOA 4JJCA 1WI7A 2KXDA 3QXEB 1G5VA 2LVMA 4C8QC 2CP6A 2E1HA 2NLUA 2DVEA 3IQLA 4QQDA 2K9GA 5GAOq 5GAN7 5IH2A 2DTIA 1B34A 1Y0MA 2RF0A 2RPNA 4PJOA 1Q86U 4IUQA 1HJDA 2MWPA 2P4RA 2E5KA 2H3JA 1MUZA 3H0HA 3SEMA 4ZN3A 3BW1A 3OYJA 2YWWA 1VQPT 3MEUA 2XMFA 1X6OA 5LJ5e 2YLCA 4FT4A 1RLQC 3X25B 1AVZC 3EFOB 3I56Q 1AD5A 4M7DB 1OYXA 1G8XA 1M3AA 3M4YA 4BDYA 2E65A 2ZPIB 1VQMQ 3HFNA 1Q81U 2CP0A 2RJCA 4Y28E 3OYEA 1IGQA 5KYUA 4A63B 2CH4A 3CCQT 4NL3A 1X6BA 5ECAA 3CBMA 3REAB 2K7AA 3M57A 4N0AA 4MZMA 2RQWA 4D8DA 2E4HA 3JB9I 1YJNT 2HSEB 3M5AA 1QVGP 3PMTA 3BFMA 4M77G 3L1AA 1WX6A 2DILA 3L42A 3THKA 3OBYA 1M90U 2KNBB 3HPWA 3JCMb 2ZCFB 1U8RA 1RLPC 1Q82U 3TCJA 2ZPBB 1KC8R 5GMKm 2JXBA 3NHNA 4OMLA 1YITQ 1QLYA 1M2VB 1TUDA 5C6SA 4LDXA 1OPKA 1YCYA 3CXCS 4C0DC 1NJIC 1YHQT 2DZ9A 5HCKA 3L2QA 2E64A 1VQ8Q 1AHJB 2RJFA 5FLXE 1KD1C 2YUPA 2JW4A 3M55A 3CC4Q 1QWEA 4X9CA 4M7AF 3CCMT 3JCMc 1ACMB 1MGQA 2KEAA 2MAMA 1Y7XA 4D8KA 5HK0A 2R57A 1Y57A 1B34B 5LJ5d 1GCQA 4AFSC 1LNXA 4PJOB 1UE9A 1ABQA 1MNEA 2MOXA 1VQ9A 4BY6B 4PFPA 2XD0A 1UG1A 4J9HA 3VYHB 4E7IA 2FPEA 1Y96A 1WHHA 4C92G 3JCMP 3OBWA 3OS2A 4XTVA 3X24B 2L89A 3M0RA 2KR3A 4ESRA 3CD6A 1O75A 1M9SA 3HRTA 2RB6A 1VQOT 5KYUB 2W10A 4J9DA 4DOVA 2KT1A 4KGVB 1VQNA 4CRIA 3G4SQ 1WHLA 2DIQA 4IUUA 4BDZA 1Q86C 4M7DD 3CXCA 1JBMA 1Q7YR 2M16A 2RQVA 2QG9B 2LQKA 3UPUA 3OYMA 3RESA 3FB9A 3M0TA 1UGPB 4IIMA 1T3LA 2CSIA 4M78A 1WNLA 1G2BA 1ZUKA 3AT1B 5GANe 2JM8A 4A4FA 2EYWA 2O01E 5CO7A 3WVDB 4MDXA 3CMET 1Q81C 3QSUA 2DETA 2HZYA 4BUGA 1D09B 2L3RA 1WHGA 2QA4T 3CCVT 4E7KA 2BE7D 2QQ9A 2EQIA 4FSSA 3G1JA 2QTXA 3JB9G 1MHNA 1QVPA 3OQ5A 4M4ZA 4A54A 3X26B 1NEBA 2PUOB 3JCMf 1N8RU 5HY6A 1YIJT 1M90C 2HKNA 2RK2A 3EG9A 2P84A 3CCJQ 2YSQA 1Q82C 3E19A 4A4GA 2EKHA 2KAFA 1GBQA 1K76A 1I8FA 2H3EB 1AEYA 2EJFA 5GMKl 3MEVA 3LX7A 1QQJA 1QKXA 1OZ3A 2RHZA 2CYZB 3OYGA 1K4US 2NYSA 1IREB 1XJWB 2RQTA 3MPUB 2OTLQ 4PJOD 4IKFA 3VS2A 3PTAA 1PKSA 3L2ZA 3FRNA 4PJOE 4F7UB 4BE0A 1JJ2P 5A0LA 4FIBA 2LJ1A 1FYNA 3DB3A 3CCUA 1YJ9T 1M5Q1 4O6JA 3G71Q 3CC4A 1VQ7Q 2EGEA 3TSWA 3EHQA 2FO0A 3EGUA 4LDVA 3JCMh 3QUIA 3QWYA 2CZ1B 5FROA 4M7AG 4C8QB 4Z89A 3LH5A 5GANd 1FXXA 1UTIA 4LUDA 3OA6A 1M4ZA 2ZAEA 3FEOA 4GLMA 2QXFA 2O4XA 2KY9A 1TG0A 3TREA 4PFZA 4M78B 2DX1A 1GFCA 2OAWA 3REBB 2ED1A 2KI7A 4DEXA 3QPHA 2LMJA 4DBFA 3NGPA 3CCET 3HHTB 1RL2A 3CBOA 2HL5C 3CPFA 4J9EA 1K0SA 3I5SA 1PWTA 2QYZA 5EC7A 4R56A 4M7AA 1UEBA 1GL5A 2CZ6B 2D0QB 2EAYA 3OMCA 1OEBA 2XI9A 5I2SA 2J05A 3VRZA 2KYMA 1MNDA 3G7ZA 4HXJA 4L5GA 3VS4A 3GIBA 3GPLA 3EG9B 2E41A 2MK5A 2XIDA 1AT1B 5FU7C 3ZFJA 2YHTA 3PGGA 1FMKA 1GCPA 1VIFA 2HBWA 2X4WA 2O88A 2FYKA 4OB3B 1SSHA 4A4HA 5J39A 2RQRA 1O9SA 4HT8A 4MZPA 3E2UA 1K9MR 5FW9A 5GJVB 2XKOC 3EHRA 3RBBB 3O8VA 4Y91A 1WJQA 3I5RA 4J83A 4UC4A 4JZ4A 4BI4A 4EMHA 1X2QA 2SRCA 2BZXA 5KYWA 3CCLA 4C0DB 3CC2A 1UGRB 4JRKA 1XTDA 2J6KA 1YBYA 2V1RA 3A1PA 2K4YA 2IVWA 3FDRA 2JMCA 3I55A 3CC7A 3CCJA 5CQXA 2ZPGB 4MDWA 1TXQA 3EH2A 1VQPQ 2JUFA 2O4XB 1JU5C 2VXEA 4MZTA 2QQAA 2DYBA 4JRPA 5CKFA 1PG5B 1B07A 5GANf 3QJ6A 3MEAA 5GAMf 1NLOC 4MMKA 2DBMA 1WXBA 2B8AA 2HSPA 3V8KA 4C8QD 1H8KA 2FEIA 2JMAA 1YI2Q 4HVVA 4BI3A 2GQIA 3EH1A 4NS5A 2VC8A 4LDYA 5IAYA 3CCQQ 2DEQA 2KRMA 4OMNA 4C5IA 1GXIE 2C0TA 2HKQB 3RKWA 4ATOA 1TUCA 3OW2S 2V8JA 4M78E 9ATCB 1PHTA 3RDVA 1WA7A 4RCCA 4IURA 1VYTA 4LDWA 2HDAA 3PE0A 1YJWT 2E70A 1M1KR 3M0UA 2GFUA 2DK3A 1Y07A 4M77F 1VA7A 5CIUA 2QEXQ 3LH0A 2FB7A 4E2FB 2D8JA 1T3SA 3OS1A 5GAMh 3KBGA 2Y4XA 4LD6A 4C0FA 1ARKA 3CMAT 1WDXA 2EGAA 1VQLT 5LJ3j 1T0JA 2MYSA 2KDSA 1VOMA 2E6NA 4QVCA 3N5BB 1VIEA 3CCMQ 4X34A 4XU0A 4NL2A 2JTEA 3TSZA 3S3MA 2CP2A 1TH7A 4M77C 2EFIA 2XHCA 5M9OA 4A4EA 2AZVA 1X2KA 5GAN5 4AFZC 4AT1B 1KFZA 2HL3A 2ED0A 2LT4A 1GCQC 3RKYA 2DMOA 1RAHB 5GAOr 4FYXB 2X51A 2WSCE 1GFDA 2CP3A 2XDBA 4ELZC 3OW2A 2A0FB 4CC4B 1X75C 2FVUA 4HA8A 3EGDA 3CCSA 4C92F 4IIOA 1S72A 2P0QA 3QYGB 2VKNA 5I11A 3GNFB 4J7IA 1XOVA 2DLPA 4LN2A 2OTJT 2DTHA 3KXTA 2O9VA 3ME9A 2RM4A 1K0XA 4ORZA 3CXCP 4CC7A 4L59A 2HQXA 1NG2A 1UHFA 5LJ3g 2K3XA 2VASA 2EKOA 4LE9A 2D0NA 3JRZA 1KQSS 2QK0A 1QCFA 4C92C 3V7RA 5GJWB 1YN8A 4XTWA 1BBZA 1UUEA 4M78C 1X69A 3VS3A 4K11A 3JCMe 1PSEA 2NUZA 1OX8A 2IIMA 4M7AE 4PJLA 3CMEQ 3GBQA 2X4YA 3META 1YI2A 2J6OA 4C5EA 2CDTA 4BB7A 2JN0A 3FLGA 1RAEB 4J9IA 2KYBA 3CCVQ 1KHIA 2LCSA 3G6EQ 4DA4A 1AOJA 3MP8A 3JB9F 1QWFA 1YIJQ 2YT6A 1VQ5A 3EAEA 4RMOA 4ZN1A 1RUWA 2EYYA 1K73R 4JLGA 1D0XA 1JRIA 2D9TA 3OY9A 4HCZA 2NUTA 1QKWA 3EG1A 2EWNA 5GAN6 1HXDA 2CGHA 1K9AA 2KXCA 4LXCA 2O2OA 5FU7B 5AYFA 3EGDB 4WF2A 1NPPA 2A3LA 4OB1B 5GAN8 5GAN3 1K8AR 2DVJA 1KQSA 4Q5WA 2P0KA 5DM7R 1ZSGA 4M75G 1QCOA 2R5AA 3OYLA 5IHIA 4AFUC 1VQ4A 4IUPA 3M53A 3VUZA 1BB9A 2JM9A 3CBPA 4XTUA 4E47A 5EG2A 3PMIA 2DM1A 4KUDK 3RNJA 4JJDA 1NZ9A 1U3OA 3JCMd 2DERA 3RMSA 2RK1A 1SEMA 2DTOA 1H3HA 3GLXA 2GF7A 2VGNA 4M77A 1PKTA 3FJ5A 4EMKC 3X28B 3RMQA 1VQ6Q 4CI0C 3OYHA 3F70A 3OB9A 1VYUA 2AHJB 4XTXA 3PVLA 1U1TA 4OVAA 1M8MA 1SF9A 4KT0E 4X1VA 2RO0A 4FYWB 4J5YA 1JQQA 3OYDA 3VKIA 1FMWA 5KE2A 2LC4A 3A8OB 3JB9H 2K6DA 3CCEQ 1G3SA 1JEGA 2COYA 2DJZA 2EQKA 2RHXA 2YUOA 3NPFA 3SDZA 4JJNK 3M58A 2VVKA 1K1ZA 1OI1A 4FCYA 1NEGA 1UECA 4AG2C 3QG1A 4M7AC 3J80E 2ZPHB 3OSSC 2EJGA 3S3OA 3DB4A 2O9SA 2PNIA 1PD0A 4X9DA 5FWCA 2A37A 3OYKA 2L3SA 4JZ3A 4E7LA 4GLKA 2LQWA 1M1FA 1VQ9T 3JAME 4PJMA 2NUTB 3LGFA 3LYIA 2RNAA 2DRMA 4B9XA 1X6GA 4L6V5 1E6GA 4C92A 1E6HA 2KE9A 2QQRA 5IHKA 4CC3A 2WACA 1AWJA 2EPDA 4O5VA 1WHJA 2KRNA 3OS5A 4XK8E 1M1GA 3V8LA 1PSFA 1D0ZA 3CD6T 3UWNA 3I56A 4BI8B 5GAMe 3S3NA 2QASA 1V1CA 3KUFA 1VQMA 1VQNT 5J26A 2HNIA 3A5ZB 1BI1A 1M3CA 2EQJA 2RHIA 2IPOB 4M77B 2VXFA 1Z9QA 2M0OA 3M0QA 3FC3A 4E7JA 1QVFS 3EG2A 2CREA 1UJYA 2DKGA 1ZX6A 3H8ZA 3M0PA 4HT9A 5KYNA 2YRCA 2AKKA 2DD4A 5LJ5j 1QP3A 2FRYA 1Y96B 2FL7A 5KYXA 4OMFB 1YITA 4AFQC 1WHMA 3PIPA 3CCRQ 1QCNA 5FWBA 1IHWA 2JVVA 2COZA 3TVTA 1VQ8A 4PLLA 1KC8U 4KGXB 1BIBA 1YJWQ 1ZSZA 1NLPC 3VS1A 3H0IA 1HK9A 2FZCB 4DQ2A 2OX7A 3INZA 2K3YA 1BI3A 1WXUA 1VQ6A 1D1CA 1OQKA 2CH4W 3A8HB 1BU1A 1TS9A 2LTOA 3LLRA 3VS0A 3M9QA 4BACA 3AHUA 1OZ2A 4ZGEB 3L2RA 4FL6A 3CMAQ 4OGCA 2LX9A 4PK4A 5GAMd 4EMKA 4M7DF 4C92B 2V26A 1PRMC 4HVWA 3H41A 1VQKQ 1H3ZA 1W2BS 1IO6A 2DF6A 2RI5A 4E6RA 1UGVA 2BUDA 4N4IA 3C0CA 3LWIA 1NYGA 4C0ZA 2HAXA 1HD3A 1QVFA 1GBRA 2EBPA 2Z0WA 2YLBA 3CC4T 3CCUT 4XQ3A 2J7IA 4FYVB 1RAFB 2JJ9A 3OYAA 1RAGB 2RI3A 3U23A 2XICA 5FRMA 4BD3A 5LJ5g 2DXUA 2BIVA 2KROA 2RMOA 4ZTFA 1WJRA 2PU9B 1UHCA 2KQWA 3G4SA 5CKHA 2EYZA 5FRNA 2OJ2A 3VU3C 4J9GA 2ABLA 4N4HA 3QIIA 4EDUA 1R0BG 3OW2P 5A2QE 2EYQA 5J3BA 1W70A 2DXTA 1SG5A 2JTFA 5A0GA 2AZSA 3RR6A 2ZGWA 3MCAB 2ESWA 1NJIR 2HBPA 1Q7YU 2L3QA 5KCOA 1IZ6A 4FSXA 3R6OA 2E10A 1KD1R 5KYXB 4M77D 2X9HA 1LOJA 3QO3A 2PVOB 1E7OA 4KBMB 4M77E 3GOXA 4ZGJB 3C94A 4RTUA 4KUIA 4QVZA 2DEUA 4C5GA 2EJ9A 1W2BA 2KVQG 2F69A 1ZSZB 1RI9A 2QQSA 3P8HA 2E5QA 2JS0A 1G83A 1I07A 6AT1B 4DBHA 3VUBA 3ASKA 2ZPFB 5CK9A 1RACB 2K3BA 3P8BB 5KH6A 3OYFA 1MMAA 1WIEA 2EQUA 2K5FA 3MP1A 3P8DA 4CC2A 2DPPB 4EMKB 2DA9A 3ER0A 5D6WA 2H8HA 1V76A 1MV3A 2YDLA 3JCMJ 2EIFA 5GANj 2GTJA 4RTWA 1W6XA 2FPFA 2CZ0B 1TU0B 3CCRA 4Z88A 4EPCA 2XDDA 1KC8C 2HQHA 2OTLA 1X01A 2E12A 4HVUA 3CEYA 1M3BA 4A4KA 3CCLT 3CC2T 4C92D 3UF4A 3H6ZA 1LVKA 1Y71A 4RTTA 3G71A 2MMPA 1VQ7A 4M78D 1P92A 3OYCA 4C92E 1B3QA 2CP5A 4M7AB 4PJJA 3I55T 5AT1B 4ELYC 3CC7T 2LP5A 3CCJT 1WQWA 1YJNQ 1WYXA 2DL5A 1RABB 4RCBA 2DL7A 1G3TA 1X27A 1YFNA 2HQEA 2V8KA 1Q81R 1VQKA 1KQSP 1V29B 2RJDA 4D6WA 4KH0B 5CCAA 2ZZDA 1ZBJA 1X43A 8ATCB 3VS6A 5GMKh 1RAAB 4M7DG 2CP7A 3M0SA 1BCOA 1QP2A 2DZCA 4M75F 3OYBA 2VV5A 1WXTA 3RUXA 3L2UA 1YHQQ 1UJ0A 4J9BA 4N4GA 1M90R 5CKBA 2XK0A 3QHSA 3NTHA 3TEEA 2E6ZA 3A8MB 5GANg 1Q82R 3MKDA 5KYWB 4B9WA 3NFCA 3Q1JA 4PNOA 3LGLA 2A36A 2MF2A 1OPLA 3HRUA 1SPKA 2K79A 1ZA2B 2LJ0A 2LQ8A 5LJ3f 2ENMA 1CSKA 2MIOA 1Q7YC 3X20B 3DLMA 1KSWA 3JB9D 2R58A 4M75C 3QJYA 4M7DA 3QBYA 2BKDN 4J9FA 5GAN2 3LW5E 1BIAA 5GAOn 5GMKi 3JCMV 4F7UF 4J8OA 3C12A 3PVQA 3UA7A 2JOYA 2B86A 2K2MA 1MMNA 2E3IA 1I5OB 2LRQA 3UA6A 4II1A 1D1BA 4EIKA 1R0CB 4GY5A 2LNHB 2A7YA 1UDLA 1VQOQ 1K9MU 3R6NA 3OSVA 2C0IA 3I9QA 4C8QF 4DBQA 2DL3A 1WJSA 3S6WA 2CSQA 4JS5A 1VQ9Q 4J6WA 2EGCA 1MV0B 2RQUA 2WSFE 4MMLA 4PLIA 2LNVA 4PJOG 5LJ3h 1M27C 4P5NA 3JCMW 1OX9A 2YXYA 3H9NA 4HCKA 1QW1A 2CUDA 2ZPEB 1M2VA 5CVIA 1SHFA 1VQPA 3MO8A 3CCST 2M9UA 1S72T 4M7AD 2YRDA 2GCXA 1ZBXA 1IHVA 3CD6Q 1N27A 1MMDA 2DD5A 3VRYA 1KHCA 4Z02A 2QGFB 1KJWA 1D0YA 2DL4A 1J3TA 1VQNQ 4OP0A 2PVDB 4RKUE 4LDUA 3ZL7C 1U06A 4OGEA 2EYXA 4ZGDB 4JPBW 2QA4Q 3CCQA 2FHDA 3BDLA 1VYVA 4PKCC 1D3BA 3V7CA 2MCNA 4RTXA 4AMCA 2E3HA 2X4XA 1Q95G 1OU8A 5LL6S 1YJNA 4BE2A 3I35A 4KRTA 1BCMA 2JS2A 1OOTA 2GBQA 3T9NA 4JJBA 3FJPA 2CKKA 4ZTJA 3PT9A 2J06A 2K57A 2LCLA 5FU6C 2DXBA 2QEXA 1UB4A 2HEQA 2RI2A 1BK2A 2A08A 3E9FA 4AG1C 4J7FA 2SEMA 1M1KU 4OMQA 1YI2T 3FIFA 2M0YA 5IXBA 2CT4A 1NYFA 2L0AA 3GF5A 1LPLA 4HCCA 2DIGA 5KE3A 3EFSA 2PQWA 1N8RR 1AZGB 2KMTA 3TQ7P 1YHQA 2LCCA 5CQYA 2F1LA 4E7ZA 4EMGA 2VWFA 1YJ9Q 2BZ8A 2FG0A 3C4SA 2YRVA 3HP9A 1ZSZC 3CCMA 1VQ5T 3OMGA 3QYHB 5D6XA 3RERA 2DO3A 1PCXA 1WFWA 2L8DA 5GAOp 1W4SA 3ZBDA 3KFVA 1SSFA 1F1BB 2QEXT 5HK3A 1SHGA 2DBKA 3BDUA 3CPWS 2DFUA 2GGRA 3H0FA 2O31A 7AT1B 1I5LA 1I1JA 3QZ9B 1WGSA 4QQGA 1RADB 2DYIA 3QDRB 3A98A 2VB6A 4XAXB 3VV0A 2RA2A 4BE1A 2BZYA 1QVFP 2QTVA 2YUNA 4M75A 1AWXA 1DJ7B 4NOYA 5GAN4 3CCUQ 3MHXA 1N9RA 1K9MC 1R77A 1VQ4T 5DLQE 1CKBA 4F7UG 2W0ZA 1IGUA 1GRIA 1VQOA 1ZHIA 4R55A 3EG0A 1AZEA 1SKUB 2QI2A 2ATCB 1D3BB 1TSFA 1OULA 1ZLMA 2CT3A 4XTZA 4FM4B 2IG0A 3ULRB 1LCKA 4FU6A 2PZ1A 4F04B 2ROLA 4QW2A 4C8QG 2VGMA 1G3YA 1C0MA 2R5MA 2LJ3A 5IN1A 1PM3A 1SRLA 4M78G 3UDCA 2K2VA 3O5ZA 2HCKA 3SWNC 1OU9A 1WLPB 2RHYA 2P4TA 2JTMA 4F7UA 5I21A 2KGTA 2F2WA 3CMEA 3CPWA 2DAQA 4ME7A 2NWMA 1S1NA 3JCMQ 1W2BP 4YTLA 2MPXC 1YWOA 2QA4A 2RD1A 3CCVA 4WTOB 1QVGS 5C0MA 3J7AF 5GMKe 3RKXA 3NTKA 4R0KA 4C8QA 1JXMA 4M7DE 3HFOA 3G6EA 3M59A 4C0GA 2KK4A 2XDPA 4IUTA 1M8VA 2RN8A 1M2OA 1U1SA 5IT9E 1H641 1YIJA 3EGXA 4J9CA 3V8JA 3SB2A 4E7HA 1TOVA 2MI6A 4J6XA 2PVGB 5D7UA 4F17A 2EVRA 4V2SA 1M1KC 2VUBA 4OF1A 1Z9ZA 5L8RE 1H92A 1ZUUA 2PUKB 1TWBA 4VUBA 3C95A 1D1AA 1K73U 4DOWA 1I0CA 1FX7A 3A8LB 4M75B 2RJEA 3D7SB 1ABOA 1EIFA 4F16A 3I56T 1NM7A 1ZA1B 2F5TX 3NTIA 3G6ET 3CCLQ 2KT8A 2C06A 4GBQA 3CC2Q 5D6YA 2Y90A 3QWXX 2DE0X 1VQMT 1YJ9A 3DLLA 2GNCA 2DL8A 1K8AU 3I55Q 2OI3A 1PRLC 4RG2A 3CC7Q 1SRMA 1EZZB 1UGSB 2VYTA 2XG8D 2AIRB 1G3WA 1VUBA 2XU8A 3SFMA 1KQ2A 2CZ7B 5LJ5f 1BKBA 3HTRA 1EFNA 2F2VA 2AKLA 1WPYA 2LDMA 3SHWA 1QVGA 2ROTA 2K5LA 1YP5A 4OB0B 3MP6A 1BYMA 1U5SA 2AT1B 5LJ3e 4C5HA 2QDLA 2I2LA 1WZOA 1NE8A 5CKDA 1VQLQ 4KGZB 1YITT 4OMMA 3CCEA 3URGA 5GAOm 3A8GB 2V8IA 1VQ8T 3JCMg 5IXFA 2BE9B 1IB8A 1W1FA 3EG3A 2CUBA 5CKEA 4FW2A 2GTOA 1KG1A 3JV3A 3MEWA 5LJ5h 3EGXB 5CAIA 2X35A 2M02A 1VQ6T 3VYGA 3UATA 1MMGA 2QQBA 2RH2A 3ZEHA 3UT1A 2FPDA 4M7DC 3V7SA 3QKJA 4KH1B 3GP8A 4Z8AA 2GQVA 4FYYB 5CR2A 3MJXA 3OYYA 1IRXA 4PFOA 3JB9J 4TVRA 1KQ1A 2X3WD 3OYIA 5FU6B 4KULA 2D1XA 5L23A 2DNUA 3L2VA 3SWNA 1XNIA 2OTJQ 4LD9K 2AK5A 1PNJA 1ZQ1A 3PNWC 4A53A 3M4GA 3G4ST 4M75D 2QAZA 4M75E 4PJOF 5LJ3d 4WCIA 3L2WA 5A0DA 4FW1A 4RTVA 3CCSQ 3HRSA 1K73C 4ANJA 1S72Q 1JXOA 3DKMA 1JJ2S 1C6VX 1TUGB 3OS0A 1BI2A 4ZNXA 2FZGB 2QDYB 4OMPA 2D6FA 2WSEE 2Y4YA 4B6MA 4RG8A 5GMKj 1N8RC 4JLIA 2P0PA 5GAMj 2C0OA 1K8AC 4F14A 4E7SA 2FRWA 2X4JA 3PFSA 5KYYA 1UGQB 1HYOA 4PJOC 2G6FX 1YNZA 1M30A 2HD0A 2JNGA 1HSQA 1Q86R 5KCHA 1PD1A 4BY6C 1YCSB 4DEYA 4XU3A 2A28A 4DBRA 4F7UE 1YJWA 4QKUA 1TTHB 1OV3A 3PIOA 2RHUA 5DY9A 4J6YA 3OYNA 2J6FA 2BTTA 4LNPA 1NBEB 1N5ZA 4QT7A 3QZ5B 2V1QA 5IHNA 2I0NA 3WVEB 2NUPA 1N6AA 2LX7A 5HKCA 3HKSA 1FMVA 4C8QE 3CMAA 1AWWA 4RUGA 1VQLA 4PL6A 2M1HA 1RI0A 2LQNA 3CCRT 2DJQA 3SWNB 1QMCA 2OTLT 5GAOl 4N0AC 4Y92A 8AT1B 1CKAA 3CQTA 4OMOA 1VQ5Q 1JJ2A 3M56A 4FT2A 2EQMA 3G71T 2F5KA 1VQ7T 3BY7A 4XTYA 3HSBA 3VS5A 3NMZC 4LUEA 4XU1A 3RIRA 3TU4K 5GANh 2X3XD 1XQHA 5GAMg 1I81A 2EW3A 1JB0E 3HL8A 2L2PA 2OAUA 2JZ2A 2ECZA 3E1SA 4QVDA 3GNGA 4HCBA 1B7TA 1ZUYA 1VQKT 3VJPA 1T0HA 1YWPA 1BI0A 1I4K1 3QDFA 1WHKA 2LT1A 1A0NB 2HMAA 3EFOA 5I2MA 1VQ4Q 1WQ7A 3EFRA 2L5QA 2OTJA 4HKEA 1AWOA 4PJNA 3M54A 2PTKA 4JUVA 1IXDA 1C1AA 1EX4A 2FZKB 2LZ6B 2KRSA 5I22A 5KYYB 1NJIU 2KBTA 4IUVA 1KD1U 1FWZA 2DRKA 3E9GA 1JO8A 4JRIA 3LWHA 2GFAA 2G3RA 2JT4A 3VS7A 2DXCA 4QQ6A 2CS7A 2K5IA 5DLOA 1UFFA 2F2XA 2COWA 1KIKA 1R8OB 4JRQA 4JS4A 1N9SA 2NUPB 4M78F 2QGGA 3SD4A 2KSSA 3JSCA 3WXMB 2YUQA 3CPWP 1RAIB 4OB2B 4RTYA 1KK7A 1PC0A
chains in the Genus database with same CATH topology
1AZEA 3EG0A 4RTZA 1WXUA 2D8HA 1NLOC 2M51A 1ZLMA 2CT3A 2DBMA 2CH4W 1WXBA 1BU1A 2L3PA 2HSPA 4JJCA 3ULRB 3VS0A 1LCKA 1H8KA 2PZ1A 2FEIA 1WI7A 2JMAA 2KXDA 4HVVA 2GQIA 2ROLA 3IQLA 1PRMC 4HVWA 3H41A 2K9GA 2KRMA 4OMNA 1IO6A 2DF6A 2LJ3A 4E6RA 5IH2A 1UGVA 2C0TA 1SRLA 1Y0MA 2RF0A 3C0CA 2RPNA 1TUCA 3O5ZA 1NYGA 2HCKA 1HJDA 1HD3A 2P4RA 1GBRA 1PHTA 2E5KA 2EBPA 1MUZA 3H0HA 3SEMA 1WA7A 1WLPB 1VYTA 2HDAA 3PE0A 2J7IA 3U23A 2KGTA 3M0UA 2F2WA 2XMFA 1RLQC 1VA7A 2NWMA 1S1NA 2KROA 2RMOA 1AVZC 1YWOA 1UHCA 1AD5A 2D8JA 2EYZA 1T3SA 2OJ2A 1M3AA 4J9GA 2ABLA 4R0KA 1JXMA 1ARKA 1W70A 1WDXA 2RN8A 2EGAA 2AZSA 1T0JA 4A63B 2CH4A 2ESWA 4J9CA 1X6BA 5ECAA 3REAB 2K7AA 2L3QA 4F17A 2EVRA 2RQWA 4D8DA 2JTEA 3TSZA 1Z9ZA 1E7OA 1H92A 2AZVA 1ZUUA 1X2KA 4AFZC 1WX6A 1KFZA 2DILA 3THKA 2ED0A 1I0CA 1GCQC 4RTUA 2KNBB 2DMOA 1RLPC 1ABOA 4F16A 1NM7A 1RI9A 2JXBA 3NHNA 2KT8A 4GBQA 4OMLA 1GFDA 1QLYA 2JS0A 3QWXX 2DE0X 1TUDA 1G83A 1I07A 1OPKA 4CC4B 2GNCA 2DL8A 2OI3A 5HCKA 1PRLC 2K3BA 1SRMA 4IIOA 2VKNA 2YUPA 5I11A 2JW4A 1WIEA 1QWEA 1XOVA 2DLPA 4LN2A 4CC2A 2DA9A 2H8HA 1EFNA 1MV3A 2KEAA 2F2VA 2O9VA 2YDLA 2AKLA 3SHWA 4D8KA 2ROTA 2GTJA 1Y57A 4RTWA 1W6XA 1GCQA 1YP5A 4ORZA 2FPFA 4AFSC 1K0XA 1UE9A 1ABQA 4Z88A 2MOXA 4CC7A 1U5SA 1NG2A 1UHFA 1UG1A 4J9HA 4HVUA 2FPEA 2QDLA 4LE9A 1M3BA 2D0NA 3UF4A 1QCFA 4OMMA 4RTTA 5GJWB 1YN8A 1B3QA 1BBZA 1UUEA 1X69A 3VS3A 5IXFA 4K11A 1W1FA 2LP5A 2NUZA 3EG3A 3M0RA 1WYXA 2IIMA 2DL5A 2KR3A 2DL7A 4ESRA 1X27A 3GBQA 2CUBA 2GTOA 2W10A 3JV3A 2J6OA 2CDTA 4J9DA 2KT1A 4J9IA 2KYBA 3UATA 1ZBJA 1X43A 2LCSA 3VS6A 2FPDA 1AOJA 2RQVA 3M0SA 4Z8AA 1QWFA 3M0TA 2YT6A 1WXTA 4IIMA 1T3LA 2X3WD 2CSIA 1RUWA 1UJ0A 2D1XA 2EYYA 5L23A 2DNUA 4J9BA 1G2BA 1ZUKA 2JM8A 2EYWA 2AK5A 1QKWA 1PNJA 3EG1A 2KXCA 1K9AA 2A36A 2O2OA 1OPLA 1SPKA 2K79A 2LJ0A 2ENMA 1CSKA 2MIOA 2DVJA 1KSWA 1ZSGA 2EQIA 4FSSA 4J9FA 4M4ZA 4WCIA 1NEBA 5IHIA 4AFUC 4RTVA 1BB9A 2JM9A 3PVQA 1JXOA 3UA7A 2B86A 2DM1A 2K2MA 3RNJA 2YSQA 4ZNXA 4JJDA 3UA6A 1U3OA 2EKHA 4EIKA 1SEMA 1GBQA 2LNHB 1H3HA 1K76A 1UDLA 4OMPA 1AEYA 3R6NA 1PKTA 3FJ5A 2C0IA 3I9QA 2DL3A 2CSQA 2C0OA 1QKXA 1VYUA 1K4US 4F14A 3PVLA 2RQTA 2FRWA 1M8MA 3VS2A 4X1VA 2EGCA 1MV0B 1JQQA 1PKSA 2G6FX 2RQUA 1YNZA 1M30A 1HSQA 1M27C 2LJ1A 1FYNA 1YCSB 4DEYA 2A28A 2K6DA 1JEGA 4HCKA 2CUDA 2EGEA 1SHFA 1OV3A 3TSWA 2YUOA 3EHQA 2FO0A 3EGUA 3NPFA 2J6FA 2BTTA 2VVKA 4LNPA 1K1ZA 1N5ZA 1NEGA 1UECA 4QT7A 4AG2C 2V1QA 3QWYA 5IHNA 2I0NA 3VRYA 4Z89A 3LH5A 2LX7A 1KJWA 1UTIA 4LUDA 2DL4A 1J3TA 2O9SA 2PNIA 1AWWA 4GLMA 4RUGA 3ZL7C 1TG0A 1U06A 2EYXA 5FWCA 4JPBW 2A37A 2DX1A 2LQNA 2L3SA 1GFCA 2DJQA 4JZ3A 2OAWA 1VYVA 2LQWA 3REBB 2ED1A 2MCNA 4DEXA 4RTXA 2LMJA 4Y92A 1CKAA 2RNAA 3CQTA 2DRMA 4OMOA 3I35A 3NGPA 4KRTA 2JS2A 1X6GA 1OOTA 1E6GA 2GBQA 1E6HA 2KE9A 4JJBA 4J9EA 3VS5A 5IHKA 4CC3A 1K0SA 1AWJA 3NMZC 3I5SA 1PWTA 2EPDA 2J06A 5EC7A 2KRNA 4LUEA 2HEQA 1BK2A 2A08A 1GL5A 2X3XD 4AG1C 1OEBA 2J05A 2EW3A 3VRZA 2KYMA 2L2PA 2SEMA 4OMQA 2ECZA 2M0YA 5IXBA 4HXJA 2CT4A 1NYFA 1V1CA 3VS4A 2L0AA 1ZUYA 1T0HA 1YWPA 1AZGB 1M3CA 1FMKA 1GCPA 2HBWA 2O88A 1A0NB 2VWFA 1SSHA 2BZ8A 2RQRA 2FG0A 1Z9QA 3M0QA 1AWOA 2PTKA 5FW9A 5GJVB 3EG2A 2CREA 1UJYA 1WFWA 2KRSA 2LZ6B 1ZX6A 3EHRA 5I22A 3M0PA 2KBTA 3KFVA 3RBBB 2AKKA 1SHGA 2DBKA 2FRYA 3I5RA 2DRKA 2GGRA 1JO8A 4JZ4A 1X2QA 2SRCA 3H0FA 2BZXA 2JT4A 2O31A 3VS7A 1I1JA 2J6KA 4AFQC 2V1RA 3A98A 1UFFA 2BZYA 2F2XA 5FWBA 1KIKA 2JMCA 3TVTA 2YUNA 1AWXA 1NLPC 3VS1A 3H0IA 2YUQA 1CKBA 1JU5C 2W0ZA 4RTYA 1GRIA 2DYBA 1B07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AZE A;  3EG0 A;  4RTZ A;  1WXU A;  2D8H A;  1NLO C;  2M51 A;  1ZLM A;  2CT3 A;  2DBM A;  2CH4 W;  1WXB A;  1BU1 A;  2L3P A;  2HSP A;  4JJC A;  3ULR B;  3VS0 A;  1LCK A;  1H8K A;  2PZ1 A;  2FEI A;  1WI7 A;  2JMA A;  2KXD A;  4HVV A;  2GQI A;  2ROL A;  3IQL A;  1PRM C;  4HVW A;  3H41 A;  2K9G A;  2KRM A;  4OMN A;  1IO6 A;  2DF6 A;  2LJ3 A;  4E6R A;  5IH2 A;  1UGV A;  2C0T A;  1SRL A;  1Y0M A;  2RF0 A;  3C0C A;  2RPN A;  1TUC A;  3O5Z A;  1NYG A;  2HCK A;  1HJD A;  1HD3 A;  2P4R A;  1GBR A;  1PHT A;  2E5K A;  2EBP A;  1MUZ A;  3H0H A;  3SEM A;  1WA7 A;  1WLP B;  1VYT A;  2HDA A;  3PE0 A;  2J7I A;  3U23 A;  2KGT A;  3M0U A;  2F2W A;  2XMF A;  1RLQ C;  1VA7 A;  2NWM A;  1S1N A;  2KRO A;  2RMO A;  1AVZ C;  1YWO A;  1UHC A;  1AD5 A;  2D8J A;  2EYZ A;  1T3S A;  2OJ2 A;  1M3A A;  4J9G A;  2ABL A;  4R0K A;  1JXM A;  1ARK A;  1W70 A;  1WDX A;  2RN8 A;  2EGA A;  2AZS A;  1T0J A;  4A63 B;  2CH4 A;  2ESW A;  4J9C A;  1X6B A;  5ECA A;  3REA B;  2K7A A;  2L3Q A;  4F17 A;  2EVR A;  2RQW A;  4D8D A;  2JTE A;  3TSZ A;  1Z9Z A;  1E7O A;  1H92 A;  2AZV A;  1ZUU A;  1X2K A;  4AFZ C;  1WX6 A;  1KFZ A;  2DIL A;  3THK A;  2ED0 A;  1I0C A;  1GCQ C;  4RTU A;  2KNB B;  2DMO A;  1RLP C;  1ABO A;  4F16 A;  1NM7 A;  1RI9 A;  2JXB A;  3NHN A;  2KT8 A;  4GBQ A;  4OML A;  1GFD A;  1QLY A;  2JS0 A;  3QWX X;  2DE0 X;  1TUD A;  1G83 A;  1I07 A;  1OPK A;  4CC4 B;  2GNC A;  2DL8 A;  2OI3 A;  5HCK A;  1PRL C;  2K3B A;  1SRM A;  4IIO A;  2VKN A;  2YUP A;  5I11 A;  2JW4 A;  1WIE A;  1QWE A;  1XOV A;  2DLP A;  4LN2 A;  4CC2 A;  2DA9 A;  2H8H A;  1EFN A;  1MV3 A;  2KEA A;  2F2V A;  2O9V A;  2YDL A;  2AKL A;  3SHW A;  4D8K A;  2ROT A;  2GTJ A;  1Y57 A;  4RTW A;  1W6X A;  1GCQ A;  1YP5 A;  4ORZ A;  2FPF A;  4AFS C;  1K0X A;  1UE9 A;  1ABQ A;  4Z88 A;  2MOX A;  4CC7 A;  1U5S A;  1NG2 A;  1UHF A;  1UG1 A;  4J9H A;  4HVU A;  2FPE A;  2QDL A;  4LE9 A;  1M3B A;  2D0N A;  3UF4 A;  1QCF A;  4OMM A;  4RTT A;  5GJW B;  1YN8 A;  1B3Q A;  1BBZ A;  1UUE A;  1X69 A;  3VS3 A;  5IXF A;  4K11 A;  1W1F A;  2LP5 A;  2NUZ A;  3EG3 A;  3M0R A;  1WYX A;  2IIM A;  2DL5 A;  2KR3 A;  2DL7 A;  4ESR A;  1X27 A;  3GBQ A;  2CUB A;  2GTO A;  2W10 A;  3JV3 A;  2J6O A;  2CDT A;  4J9D A;  2KT1 A;  4J9I A;  2KYB A;  3UAT A;  1ZBJ A;  1X43 A;  2LCS A;  3VS6 A;  2FPD A;  1AOJ A;  2RQV A;  3M0S A;  4Z8A A;  1QWF A;  3M0T A;  2YT6 A;  1WXT A;  4IIM A;  1T3L A;  2X3W D;  2CSI A;  1RUW A;  1UJ0 A;  2D1X A;  2EYY A;  5L23 A;  2DNU A;  4J9B A;  1G2B A;  1ZUK A;  2JM8 A;  2EYW A;  2AK5 A;  1QKW A;  1PNJ A;  3EG1 A;  2KXC A;  1K9A A;  2A36 A;  2O2O A;  1OPL A;  1SPK A;  2K79 A;  2LJ0 A;  2ENM A;  1CSK A;  2MIO A;  2DVJ A;  1KSW A;  1ZSG A;  2EQI A;  4FSS A;  4J9F A;  4M4Z A;  4WCI A;  1NEB A;  5IHI A;  4AFU C;  4RTV A;  1BB9 A;  2JM9 A;  3PVQ A;  1JXO A;  3UA7 A;  2B86 A;  2DM1 A;  2K2M A;  3RNJ A;  2YSQ A;  4ZNX A;  4JJD A;  3UA6 A;  1U3O A;  2EKH A;  4EIK A;  1SEM A;  1GBQ A;  2LNH B;  1H3H A;  1K76 A;  1UDL A;  4OMP A;  1AEY A;  3R6N A;  1PKT A;  3FJ5 A;  2C0I A;  3I9Q A;  2DL3 A;  2CSQ A;  2C0O A;  1QKX A;  1VYU A;  1K4U S;  4F14 A;  3PVL A;  2RQT A;  2FRW A;  1M8M A;  3VS2 A;  4X1V A;  2EGC A;  1MV0 B;  1JQQ A;  1PKS A;  2G6F X;  2RQU A;  1YNZ A;  1M30 A;  1HSQ A;  1M27 C;  2LJ1 A;  1FYN A;  1YCS B;  4DEY A;  2A28 A;  2K6D A;  1JEG A;  4HCK A;  2CUD A;  2EGE A;  1SHF A;  1OV3 A;  3TSW A;  2YUO A;  3EHQ A;  2FO0 A;  3EGU A;  3NPF A;  2J6F A;  2BTT A;  2VVK A;  4LNP A;  1K1Z A;  1N5Z A;  1NEG A;  1UEC A;  4QT7 A;  4AG2 C;  2V1Q A;  3QWY A;  5IHN A;  2I0N A;  3VRY A;  4Z89 A;  3LH5 A;  2LX7 A;  1KJW A;  1UTI A;  4LUD A;  2DL4 A;  1J3T A;  2O9S A;  2PNI A;  1AWW A;  4GLM A;  4RUG A;  3ZL7 C;  1TG0 A;  1U06 A;  2EYX A;  5FWC A;  4JPB W;  2A37 A;  2DX1 A;  2LQN A;  2L3S A;  1GFC A;  2DJQ A;  4JZ3 A;  2OAW A;  1VYV A;  2LQW A;  3REB B;  2ED1 A;  2MCN A;  4DEX A;  4RTX A;  2LMJ A;  4Y92 A;  1CKA A;  2RNA A;  3CQT A;  2DRM A;  4OMO A;  3I35 A;  3NGP A;  4KRT A;  2JS2 A;  1X6G A;  1OOT A;  1E6G A;  2GBQ A;  1E6H A;  2KE9 A;  4JJB A;  4J9E A;  3VS5 A;  5IHK A;  4CC3 A;  1K0S A;  1AWJ A;  3NMZ C;  3I5S A;  1PWT A;  2EPD A;  2J06 A;  5EC7 A;  2KRN A;  4LUE A;  2HEQ A;  1BK2 A;  2A08 A;  1GL5 A;  2X3X D;  4AG1 C;  1OEB A;  2J05 A;  2EW3 A;  3VRZ A;  2KYM A;  2L2P A;  2SEM A;  4OMQ A;  2ECZ A;  2M0Y A;  5IXB A;  4HXJ A;  2CT4 A;  1NYF A;  1V1C A;  3VS4 A;  2L0A A;  1ZUY A;  1T0H A;  1YWP A;  1AZG B;  1M3C A;  1FMK A;  1GCP A;  2HBW A;  2O88 A;  1A0N B;  2VWF A;  1SSH A;  2BZ8 A;  2RQR A;  2FG0 A;  1Z9Q A;  3M0Q A;  1AWO A;  2PTK A;  5FW9 A;  5GJV B;  3EG2 A;  2CRE A;  1UJY A;  1WFW A;  2KRS A;  2LZ6 B;  1ZX6 A;  3EHR A;  5I22 A;  3M0P A;  2KBT A;  3KFV A;  3RBB B;  2AKK A;  1SHG A;  2DBK A;  2FRY A;  3I5R A;  2DRK A;  2GGR A;  1JO8 A;  4JZ4 A;  1X2Q A;  2SRC A;  3H0F A;  2BZX A;  2JT4 A;  2O31 A;  3VS7 A;  1I1J A;  2J6K A;  4AFQ C;  2V1R A;  3A98 A;  1UFF A;  2BZY A;  2F2X A;  5FWB A;  1KIK A;  2JMC A;  3TVT A;  2YUN A;  1AWX A;  1NLP C;  3VS1 A;  3H0I A;  2YUQ A;  1CKB A;  1JU5 C;  2W0Z A;  4RTY A;  1GRI A;  2DYB A;  1B07 A; 
#chains in the Genus database with same CATH topology
 3BE3 A;  4RTZ A;  1LJO A;  4JDS A;  3J81 E;  2D8H A;  2M51 A;  1NPR A;  4XU2 A;  3JCM X;  2L3P A;  2MWO A;  4JJC A;  1WI7 A;  2KXD A;  3QXE B;  1G5V A;  2LVM A;  4C8Q C;  2CP6 A;  2E1H A;  2NLU A;  2DVE A;  3IQL A;  4QQD A;  2K9G A;  5GAO q;  5GAN 7;  5IH2 A;  2DTI A;  1B34 A;  1Y0M A;  2RF0 A;  2RPN A;  4PJO A;  1Q86 U;  4IUQ A;  1HJD A;  2MWP A;  2P4R A;  2E5K A;  2H3J A;  1MUZ A;  3H0H A;  3SEM A;  4ZN3 A;  3BW1 A;  3OYJ A;  2YWW A;  1VQP T;  3MEU A;  2XMF A;  1X6O A;  5LJ5 e;  2YLC A;  4FT4 A;  1RLQ C;  3X25 B;  1AVZ C;  3EFO B;  3I56 Q;  1AD5 A;  4M7D B;  1OYX A;  1G8X A;  1M3A A;  3M4Y A;  4BDY A;  2E65 A;  2ZPI B;  1VQM Q;  3HFN A;  1Q81 U;  2CP0 A;  2RJC A;  4Y28 E;  3OYE A;  1IGQ A;  5KYU A;  4A63 B;  2CH4 A;  3CCQ T;  4NL3 A;  1X6B A;  5ECA A;  3CBM A;  3REA B;  2K7A A;  3M57 A;  4N0A A;  4MZM A;  2RQW A;  4D8D A;  2E4H A;  3JB9 I;  1YJN T;  2HSE B;  3M5A A;  1QVG P;  3PMT A;  3BFM A;  4M77 G;  3L1A A;  1WX6 A;  2DIL A;  3L42 A;  3THK A;  3OBY A;  1M90 U;  2KNB B;  3HPW A;  3JCM b;  2ZCF B;  1U8R A;  1RLP C;  1Q82 U;  3TCJ A;  2ZPB B;  1KC8 R;  5GMK m;  2JXB A;  3NHN A;  4OML A;  1YIT Q;  1QLY A;  1M2V B;  1TUD A;  5C6S A;  4LDX A;  1OPK A;  1YCY A;  3CXC S;  4C0D C;  1NJI C;  1YHQ T;  2DZ9 A;  5HCK A;  3L2Q A;  2E64 A;  1VQ8 Q;  1AHJ B;  2RJF A;  5FLX E;  1KD1 C;  2YUP A;  2JW4 A;  3M55 A;  3CC4 Q;  1QWE A;  4X9C A;  4M7A F;  3CCM T;  3JCM c;  1ACM B;  1MGQ A;  2KEA A;  2MAM A;  1Y7X A;  4D8K A;  5HK0 A;  2R57 A;  1Y57 A;  1B34 B;  5LJ5 d;  1GCQ A;  4AFS C;  1LNX A;  4PJO B;  1UE9 A;  1ABQ A;  1MNE A;  2MOX A;  1VQ9 A;  4BY6 B;  4PFP A;  2XD0 A;  1UG1 A;  4J9H A;  3VYH B;  4E7I A;  2FPE A;  1Y96 A;  1WHH A;  4C92 G;  3JCM P;  3OBW A;  3OS2 A;  4XTV A;  3X24 B;  2L89 A;  3M0R A;  2KR3 A;  4ESR A;  3CD6 A;  1O75 A;  1M9S A;  3HRT A;  2RB6 A;  1VQO T;  5KYU B;  2W10 A;  4J9D A;  4DOV A;  2KT1 A;  4KGV B;  1VQN A;  4CRI A;  3G4S Q;  1WHL A;  2DIQ A;  4IUU A;  4BDZ A;  1Q86 C;  4M7D D;  3CXC A;  1JBM A;  1Q7Y R;  2M16 A;  2RQV A;  2QG9 B;  2LQK A;  3UPU A;  3OYM A;  3RES A;  3FB9 A;  3M0T A;  1UGP B;  4IIM A;  1T3L A;  2CSI A;  4M78 A;  1WNL A;  1G2B A;  1ZUK A;  3AT1 B;  5GAN e;  2JM8 A;  4A4F A;  2EYW A;  2O01 E;  5CO7 A;  3WVD B;  4MDX A;  3CME T;  1Q81 C;  3QSU A;  2DET A;  2HZY A;  4BUG A;  1D09 B;  2L3R A;  1WHG A;  2QA4 T;  3CCV T;  4E7K A;  2BE7 D;  2QQ9 A;  2EQI A;  4FSS A;  3G1J A;  2QTX A;  3JB9 G;  1MHN A;  1QVP A;  3OQ5 A;  4M4Z A;  4A54 A;  3X26 B;  1NEB A;  2PUO B;  3JCM f;  1N8R U;  5HY6 A;  1YIJ T;  1M90 C;  2HKN A;  2RK2 A;  3EG9 A;  2P84 A;  3CCJ Q;  2YSQ A;  1Q82 C;  3E19 A;  4A4G A;  2EKH A;  2KAF A;  1GBQ A;  1K76 A;  1I8F A;  2H3E B;  1AEY A;  2EJF A;  5GMK l;  3MEV A;  3LX7 A;  1QQJ A;  1QKX A;  1OZ3 A;  2RHZ A;  2CYZ B;  3OYG A;  1K4U S;  2NYS A;  1IRE B;  1XJW B;  2RQT A;  3MPU B;  2OTL Q;  4PJO D;  4IKF A;  3VS2 A;  3PTA A;  1PKS A;  3L2Z A;  3FRN A;  4PJO E;  4F7U B;  4BE0 A;  1JJ2 P;  5A0L A;  4FIB A;  2LJ1 A;  1FYN A;  3DB3 A;  3CCU A;  1YJ9 T;  1M5Q 1;  4O6J A;  3G71 Q;  3CC4 A;  1VQ7 Q;  2EGE A;  3TSW A;  3EHQ A;  2FO0 A;  3EGU A;  4LDV A;  3JCM h;  3QUI A;  3QWY A;  2CZ1 B;  5FRO A;  4M7A G;  4C8Q B;  4Z89 A;  3LH5 A;  5GAN d;  1FXX A;  1UTI A;  4LUD A;  3OA6 A;  1M4Z A;  2ZAE A;  3FEO A;  4GLM A;  2QXF A;  2O4X A;  2KY9 A;  1TG0 A;  3TRE A;  4PFZ A;  4M78 B;  2DX1 A;  1GFC A;  2OAW A;  3REB B;  2ED1 A;  2KI7 A;  4DEX A;  3QPH A;  2LMJ A;  4DBF A;  3NGP A;  3CCE T;  3HHT B;  1RL2 A;  3CBO A;  2HL5 C;  3CPF A;  4J9E A;  1K0S A;  3I5S A;  1PWT A;  2QYZ A;  5EC7 A;  4R56 A;  4M7A A;  1UEB A;  1GL5 A;  2CZ6 B;  2D0Q B;  2EAY A;  3OMC A;  1OEB A;  2XI9 A;  5I2S A;  2J05 A;  3VRZ A;  2KYM A;  1MND A;  3G7Z A;  4HXJ A;  4L5G A;  3VS4 A;  3GIB A;  3GPL A;  3EG9 B;  2E41 A;  2MK5 A;  2XID A;  1AT1 B;  5FU7 C;  3ZFJ A;  2YHT A;  3PGG A;  1FMK A;  1GCP A;  1VIF A;  2HBW A;  2X4W A;  2O88 A;  2FYK A;  4OB3 B;  1SSH A;  4A4H A;  5J39 A;  2RQR A;  1O9S A;  4HT8 A;  4MZP A;  3E2U A;  1K9M R;  5FW9 A;  5GJV B;  2XKO C;  3EHR A;  3RBB B;  3O8V A;  4Y91 A;  1WJQ A;  3I5R A;  4J83 A;  4UC4 A;  4JZ4 A;  4BI4 A;  4EMH A;  1X2Q A;  2SRC A;  2BZX A;  5KYW A;  3CCL A;  4C0D B;  3CC2 A;  1UGR B;  4JRK A;  1XTD A;  2J6K A;  1YBY A;  2V1R A;  3A1P A;  2K4Y A;  2IVW A;  3FDR A;  2JMC A;  3I55 A;  3CC7 A;  3CCJ A;  5CQX A;  2ZPG B;  4MDW A;  1TXQ A;  3EH2 A;  1VQP Q;  2JUF A;  2O4X B;  1JU5 C;  2VXE A;  4MZT A;  2QQA A;  2DYB A;  4JRP A;  5CKF A;  1PG5 B;  1B07 A;  5GAN f;  3QJ6 A;  3MEA A;  5GAM f;  1NLO C;  4MMK A;  2DBM A;  1WXB A;  2B8A A;  2HSP A;  3V8K A;  4C8Q D;  1H8K A;  2FEI A;  2JMA A;  1YI2 Q;  4HVV A;  4BI3 A;  2GQI A;  3EH1 A;  4NS5 A;  2VC8 A;  4LDY A;  5IAY A;  3CCQ Q;  2DEQ A;  2KRM A;  4OMN A;  4C5I A;  1GXI E;  2C0T A;  2HKQ B;  3RKW A;  4ATO A;  1TUC A;  3OW2 S;  2V8J A;  4M78 E;  9ATC B;  1PHT A;  3RDV A;  1WA7 A;  4RCC A;  4IUR A;  1VYT A;  4LDW A;  2HDA A;  3PE0 A;  1YJW T;  2E70 A;  1M1K R;  3M0U A;  2GFU A;  2DK3 A;  1Y07 A;  4M77 F;  1VA7 A;  5CIU A;  2QEX Q;  3LH0 A;  2FB7 A;  4E2F B;  2D8J A;  1T3S A;  3OS1 A;  5GAM h;  3KBG A;  2Y4X A;  4LD6 A;  4C0F A;  1ARK A;  3CMA T;  1WDX A;  2EGA A;  1VQL T;  5LJ3 j;  1T0J A;  2MYS A;  2KDS A;  1VOM A;  2E6N A;  4QVC A;  3N5B B;  1VIE A;  3CCM Q;  4X34 A;  4XU0 A;  4NL2 A;  2JTE A;  3TSZ A;  3S3M A;  2CP2 A;  1TH7 A;  4M77 C;  2EFI A;  2XHC A;  5M9O A;  4A4E A;  2AZV A;  1X2K A;  5GAN 5;  4AFZ C;  4AT1 B;  1KFZ A;  2HL3 A;  2ED0 A;  2LT4 A;  1GCQ C;  3RKY A;  2DMO A;  1RAH B;  5GAO r;  4FYX B;  2X51 A;  2WSC E;  1GFD A;  2CP3 A;  2XDB A;  4ELZ C;  3OW2 A;  2A0F B;  4CC4 B;  1X75 C;  2FVU A;  4HA8 A;  3EGD A;  3CCS A;  4C92 F;  4IIO A;  1S72 A;  2P0Q A;  3QYG B;  2VKN A;  5I11 A;  3GNF B;  4J7I A;  1XOV A;  2DLP A;  4LN2 A;  2OTJ T;  2DTH A;  3KXT A;  2O9V A;  3ME9 A;  2RM4 A;  1K0X A;  4ORZ A;  3CXC P;  4CC7 A;  4L59 A;  2HQX A;  1NG2 A;  1UHF A;  5LJ3 g;  2K3X A;  2VAS A;  2EKO A;  4LE9 A;  2D0N A;  3JRZ A;  1KQS S;  2QK0 A;  1QCF A;  4C92 C;  3V7R A;  5GJW B;  1YN8 A;  4XTW A;  1BBZ A;  1UUE A;  4M78 C;  1X69 A;  3VS3 A;  4K11 A;  3JCM e;  1PSE A;  2NUZ A;  1OX8 A;  2IIM A;  4M7A E;  4PJL A;  3CME Q;  3GBQ A;  2X4Y A;  3MET A;  1YI2 A;  2J6O A;  4C5E A;  2CDT A;  4BB7 A;  2JN0 A;  3FLG A;  1RAE B;  4J9I A;  2KYB A;  3CCV Q;  1KHI A;  2LCS A;  3G6E Q;  4DA4 A;  1AOJ A;  3MP8 A;  3JB9 F;  1QWF A;  1YIJ Q;  2YT6 A;  1VQ5 A;  3EAE A;  4RMO A;  4ZN1 A;  1RUW A;  2EYY A;  1K73 R;  4JLG A;  1D0X A;  1JRI A;  2D9T A;  3OY9 A;  4HCZ A;  2NUT A;  1QKW A;  3EG1 A;  2EWN A;  5GAN 6;  1HXD A;  2CGH A;  1K9A A;  2KXC A;  4LXC A;  2O2O A;  5FU7 B;  5AYF A;  3EGD B;  4WF2 A;  1NPP A;  2A3L A;  4OB1 B;  5GAN 8;  5GAN 3;  1K8A R;  2DVJ A;  1KQS A;  4Q5W A;  2P0K A;  5DM7 R;  1ZSG A;  4M75 G;  1QCO A;  2R5A A;  3OYL A;  5IHI A;  4AFU C;  1VQ4 A;  4IUP A;  3M53 A;  3VUZ A;  1BB9 A;  2JM9 A;  3CBP A;  4XTU A;  4E47 A;  5EG2 A;  3PMI A;  2DM1 A;  4KUD K;  3RNJ A;  4JJD A;  1NZ9 A;  1U3O A;  3JCM d;  2DER A;  3RMS A;  2RK1 A;  1SEM A;  2DTO A;  1H3H A;  3GLX A;  2GF7 A;  2VGN A;  4M77 A;  1PKT A;  3FJ5 A;  4EMK C;  3X28 B;  3RMQ A;  1VQ6 Q;  4CI0 C;  3OYH A;  3F70 A;  3OB9 A;  1VYU A;  2AHJ B;  4XTX A;  3PVL A;  1U1T A;  4OVA A;  1M8M A;  1SF9 A;  4KT0 E;  4X1V A;  2RO0 A;  4FYW B;  4J5Y A;  1JQQ A;  3OYD A;  3VKI A;  1FMW A;  5KE2 A;  2LC4 A;  3A8O B;  3JB9 H;  2K6D A;  3CCE Q;  1G3S A;  1JEG A;  2COY A;  2DJZ A;  2EQK A;  2RHX A;  2YUO A;  3NPF A;  3SDZ A;  4JJN K;  3M58 A;  2VVK A;  1K1Z A;  1OI1 A;  4FCY A;  1NEG A;  1UEC A;  4AG2 C;  3QG1 A;  4M7A C;  3J80 E;  2ZPH B;  3OSS C;  2EJG A;  3S3O A;  3DB4 A;  2O9S A;  2PNI A;  1PD0 A;  4X9D A;  5FWC A;  2A37 A;  3OYK A;  2L3S A;  4JZ3 A;  4E7L A;  4GLK A;  2LQW A;  1M1F A;  1VQ9 T;  3JAM E;  4PJM A;  2NUT B;  3LGF A;  3LYI A;  2RNA A;  2DRM A;  4B9X A;  1X6G A;  4L6V 5;  1E6G A;  4C92 A;  1E6H A;  2KE9 A;  2QQR A;  5IHK A;  4CC3 A;  2WAC A;  1AWJ A;  2EPD A;  4O5V A;  1WHJ A;  2KRN A;  3OS5 A;  4XK8 E;  1M1G A;  3V8L A;  1PSF A;  1D0Z A;  3CD6 T;  3UWN A;  3I56 A;  4BI8 B;  5GAM e;  3S3N A;  2QAS A;  1V1C A;  3KUF A;  1VQM A;  1VQN T;  5J26 A;  2HNI A;  3A5Z B;  1BI1 A;  1M3C A;  2EQJ A;  2RHI A;  2IPO B;  4M77 B;  2VXF A;  1Z9Q A;  2M0O A;  3M0Q A;  3FC3 A;  4E7J A;  1QVF S;  3EG2 A;  2CRE A;  1UJY A;  2DKG A;  1ZX6 A;  3H8Z A;  3M0P A;  4HT9 A;  5KYN A;  2YRC A;  2AKK A;  2DD4 A;  5LJ5 j;  1QP3 A;  2FRY A;  1Y96 B;  2FL7 A;  5KYX A;  4OMF B;  1YIT A;  4AFQ C;  1WHM A;  3PIP A;  3CCR Q;  1QCN A;  5FWB A;  1IHW A;  2JVV A;  2COZ A;  3TVT A;  1VQ8 A;  4PLL A;  1KC8 U;  4KGX B;  1BIB A;  1YJW Q;  1ZSZ A;  1NLP C;  3VS1 A;  3H0I A;  1HK9 A;  2FZC B;  4DQ2 A;  2OX7 A;  3INZ A;  2K3Y A;  1BI3 A;  1WXU A;  1VQ6 A;  1D1C A;  1OQK A;  2CH4 W;  3A8H B;  1BU1 A;  1TS9 A;  2LTO A;  3LLR A;  3VS0 A;  3M9Q A;  4BAC A;  3AHU A;  1OZ2 A;  4ZGE B;  3L2R A;  4FL6 A;  3CMA Q;  4OGC A;  2LX9 A;  4PK4 A;  5GAM d;  4EMK A;  4M7D F;  4C92 B;  2V26 A;  1PRM C;  4HVW A;  3H41 A;  1VQK Q;  1H3Z A;  1W2B S;  1IO6 A;  2DF6 A;  2RI5 A;  4E6R A;  1UGV A;  2BUD A;  4N4I A;  3C0C A;  3LWI A;  1NYG A;  4C0Z A;  2HAX A;  1HD3 A;  1QVF A;  1GBR A;  2EBP A;  2Z0W A;  2YLB A;  3CC4 T;  3CCU T;  4XQ3 A;  2J7I A;  4FYV B;  1RAF B;  2JJ9 A;  3OYA A;  1RAG B;  2RI3 A;  3U23 A;  2XIC A;  5FRM A;  4BD3 A;  5LJ5 g;  2DXU A;  2BIV A;  2KRO A;  2RMO A;  4ZTF A;  1WJR A;  2PU9 B;  1UHC A;  2KQW A;  3G4S A;  5CKH A;  2EYZ A;  5FRN A;  2OJ2 A;  3VU3 C;  4J9G A;  2ABL A;  4N4H A;  3QII A;  4EDU A;  1R0B G;  3OW2 P;  5A2Q E;  2EYQ A;  5J3B A;  1W70 A;  2DXT A;  1SG5 A;  2JTF A;  5A0G A;  2AZS A;  3RR6 A;  2ZGW A;  3MCA B;  2ESW A;  1NJI R;  2HBP A;  1Q7Y U;  2L3Q A;  5KCO A;  1IZ6 A;  4FSX A;  3R6O A;  2E10 A;  1KD1 R;  5KYX B;  4M77 D;  2X9H A;  1LOJ A;  3QO3 A;  2PVO B;  1E7O A;  4KBM B;  4M77 E;  3GOX A;  4ZGJ B;  3C94 A;  4RTU A;  4KUI A;  4QVZ A;  2DEU A;  4C5G A;  2EJ9 A;  1W2B A;  2KVQ G;  2F69 A;  1ZSZ B;  1RI9 A;  2QQS A;  3P8H A;  2E5Q A;  2JS0 A;  1G83 A;  1I07 A;  6AT1 B;  4DBH A;  3VUB A;  3ASK A;  2ZPF B;  5CK9 A;  1RAC B;  2K3B A;  3P8B B;  5KH6 A;  3OYF A;  1MMA A;  1WIE A;  2EQU A;  2K5F A;  3MP1 A;  3P8D A;  4CC2 A;  2DPP B;  4EMK B;  2DA9 A;  3ER0 A;  5D6W A;  2H8H A;  1V76 A;  1MV3 A;  2YDL A;  3JCM J;  2EIF A;  5GAN j;  2GTJ A;  4RTW A;  1W6X A;  2FPF A;  2CZ0 B;  1TU0 B;  3CCR A;  4Z88 A;  4EPC A;  2XDD A;  1KC8 C;  2HQH A;  2OTL A;  1X01 A;  2E12 A;  4HVU A;  3CEY A;  1M3B A;  4A4K A;  3CCL T;  3CC2 T;  4C92 D;  3UF4 A;  3H6Z A;  1LVK A;  1Y71 A;  4RTT A;  3G71 A;  2MMP A;  1VQ7 A;  4M78 D;  1P92 A;  3OYC A;  4C92 E;  1B3Q A;  2CP5 A;  4M7A B;  4PJJ A;  3I55 T;  5AT1 B;  4ELY C;  3CC7 T;  2LP5 A;  3CCJ T;  1WQW A;  1YJN Q;  1WYX A;  2DL5 A;  1RAB B;  4RCB A;  2DL7 A;  1G3T A;  1X27 A;  1YFN A;  2HQE A;  2V8K A;  1Q81 R;  1VQK A;  1KQS P;  1V29 B;  2RJD A;  4D6W A;  4KH0 B;  5CCA A;  2ZZD A;  1ZBJ A;  1X43 A;  8ATC B;  3VS6 A;  5GMK h;  1RAA B;  4M7D G;  2CP7 A;  3M0S A;  1BCO A;  1QP2 A;  2DZC A;  4M75 F;  3OYB A;  2VV5 A;  1WXT A;  3RUX A;  3L2U A;  1YHQ Q;  1UJ0 A;  4J9B A;  4N4G A;  1M90 R;  5CKB A;  2XK0 A;  3QHS A;  3NTH A;  3TEE A;  2E6Z A;  3A8M B;  5GAN g;  1Q82 R;  3MKD A;  5KYW B;  4B9W A;  3NFC A;  3Q1J A;  4PNO A;  3LGL A;  2A36 A;  2MF2 A;  1OPL A;  3HRU A;  1SPK A;  2K79 A;  1ZA2 B;  2LJ0 A;  2LQ8 A;  5LJ3 f;  2ENM A;  1CSK A;  2MIO A;  1Q7Y C;  3X20 B;  3DLM A;  1KSW A;  3JB9 D;  2R58 A;  4M75 C;  3QJY A;  4M7D A;  3QBY A;  2BKD N;  4J9F A;  5GAN 2;  3LW5 E;  1BIA A;  5GAO n;  5GMK i;  3JCM V;  4F7U F;  4J8O A;  3C12 A;  3PVQ A;  3UA7 A;  2JOY A;  2B86 A;  2K2M A;  1MMN A;  2E3I A;  1I5O B;  2LRQ A;  3UA6 A;  4II1 A;  1D1B A;  4EIK A;  1R0C B;  4GY5 A;  2LNH B;  2A7Y A;  1UDL A;  1VQO Q;  1K9M U;  3R6N A;  3OSV A;  2C0I A;  3I9Q A;  4C8Q F;  4DBQ A;  2DL3 A;  1WJS A;  3S6W A;  2CSQ A;  4JS5 A;  1VQ9 Q;  4J6W A;  2EGC A;  1MV0 B;  2RQU A;  2WSF E;  4MML A;  4PLI A;  2LNV A;  4PJO G;  5LJ3 h;  1M27 C;  4P5N A;  3JCM W;  1OX9 A;  2YXY A;  3H9N A;  4HCK A;  1QW1 A;  2CUD A;  2ZPE B;  1M2V A;  5CVI A;  1SHF A;  1VQP A;  3MO8 A;  3CCS T;  2M9U A;  1S72 T;  4M7A D;  2YRD A;  2GCX A;  1ZBX A;  1IHV A;  3CD6 Q;  1N27 A;  1MMD A;  2DD5 A;  3VRY A;  1KHC A;  4Z02 A;  2QGF B;  1KJW A;  1D0Y A;  2DL4 A;  1J3T A;  1VQN Q;  4OP0 A;  2PVD B;  4RKU E;  4LDU A;  3ZL7 C;  1U06 A;  4OGE A;  2EYX A;  4ZGD B;  4JPB W;  2QA4 Q;  3CCQ A;  2FHD A;  3BDL A;  1VYV A;  4PKC C;  1D3B A;  3V7C A;  2MCN A;  4RTX A;  4AMC A;  2E3H A;  2X4X A;  1Q95 G;  1OU8 A;  5LL6 S;  1YJN A;  4BE2 A;  3I35 A;  4KRT A;  1BCM A;  2JS2 A;  1OOT A;  2GBQ A;  3T9N A;  4JJB A;  3FJP A;  2CKK A;  4ZTJ A;  3PT9 A;  2J06 A;  2K57 A;  2LCL A;  5FU6 C;  2DXB A;  2QEX A;  1UB4 A;  2HEQ A;  2RI2 A;  1BK2 A;  2A08 A;  3E9F A;  4AG1 C;  4J7F A;  2SEM A;  1M1K U;  4OMQ A;  1YI2 T;  3FIF A;  2M0Y A;  5IXB A;  2CT4 A;  1NYF A;  2L0A A;  3GF5 A;  1LPL A;  4HCC A;  2DIG A;  5KE3 A;  3EFS A;  2PQW A;  1N8R R;  1AZG B;  2KMT A;  3TQ7 P;  1YHQ A;  2LCC A;  5CQY A;  2F1L A;  4E7Z A;  4EMG A;  2VWF A;  1YJ9 Q;  2BZ8 A;  2FG0 A;  3C4S A;  2YRV A;  3HP9 A;  1ZSZ C;  3CCM A;  1VQ5 T;  3OMG A;  3QYH B;  5D6X A;  3RER A;  2DO3 A;  1PCX A;  1WFW A;  2L8D A;  5GAO p;  1W4S A;  3ZBD A;  3KFV A;  1SSF A;  1F1B B;  2QEX T;  5HK3 A;  1SHG A;  2DBK A;  3BDU A;  3CPW S;  2DFU A;  2GGR A;  3H0F A;  2O31 A;  7AT1 B;  1I5L A;  1I1J A;  3QZ9 B;  1WGS A;  4QQG A;  1RAD B;  2DYI A;  3QDR B;  3A98 A;  2VB6 A;  4XAX B;  3VV0 A;  2RA2 A;  4BE1 A;  2BZY A;  1QVF P;  2QTV A;  2YUN A;  4M75 A;  1AWX A;  1DJ7 B;  4NOY A;  5GAN 4;  3CCU Q;  3MHX A;  1N9R A;  1K9M C;  1R77 A;  1VQ4 T;  5DLQ E;  1CKB A;  4F7U G;  2W0Z A;  1IGU A;  1GRI A;  1VQO A;  1ZHI A;  4R55 A;  3EG0 A;  1AZE A;  1SKU B;  2QI2 A;  2ATC B;  1D3B B;  1TSF A;  1OUL A;  1ZLM A;  2CT3 A;  4XTZ A;  4FM4 B;  2IG0 A;  3ULR B;  1LCK A;  4FU6 A;  2PZ1 A;  4F04 B;  2ROL A;  4QW2 A;  4C8Q G;  2VGM A;  1G3Y A;  1C0M A;  2R5M A;  2LJ3 A;  5IN1 A;  1PM3 A;  1SRL A;  4M78 G;  3UDC A;  2K2V A;  3O5Z A;  2HCK A;  3SWN C;  1OU9 A;  1WLP B;  2RHY A;  2P4T A;  2JTM A;  4F7U A;  5I21 A;  2KGT A;  2F2W A;  3CME A;  3CPW A;  2DAQ A;  4ME7 A;  2NWM A;  1S1N A;  3JCM Q;  1W2B P;  4YTL A;  2MPX C;  1YWO A;  2QA4 A;  2RD1 A;  3CCV A;  4WTO B;  1QVG S;  5C0M A;  3J7A F;  5GMK e;  3RKX A;  3NTK A;  4R0K A;  4C8Q A;  1JXM A;  4M7D E;  3HFO A;  3G6E A;  3M59 A;  4C0G A;  2KK4 A;  2XDP A;  4IUT A;  1M8V A;  2RN8 A;  1M2O A;  1U1S A;  5IT9 E;  1H64 1;  1YIJ A;  3EGX A;  4J9C A;  3V8J A;  3SB2 A;  4E7H A;  1TOV A;  2MI6 A;  4J6X A;  2PVG B;  5D7U A;  4F17 A;  2EVR A;  4V2S A;  1M1K C;  2VUB A;  4OF1 A;  1Z9Z A;  5L8R E;  1H92 A;  1ZUU A;  2PUK B;  1TWB A;  4VUB A;  3C95 A;  1D1A A;  1K73 U;  4DOW A;  1I0C A;  1FX7 A;  3A8L B;  4M75 B;  2RJE A;  3D7S B;  1ABO A;  1EIF A;  4F16 A;  3I56 T;  1NM7 A;  1ZA1 B;  2F5T X;  3NTI A;  3G6E T;  3CCL Q;  2KT8 A;  2C06 A;  4GBQ A;  3CC2 Q;  5D6Y A;  2Y90 A;  3QWX X;  2DE0 X;  1VQM T;  1YJ9 A;  3DLL A;  2GNC A;  2DL8 A;  1K8A U;  3I55 Q;  2OI3 A;  1PRL C;  4RG2 A;  3CC7 Q;  1SRM A;  1EZZ B;  1UGS B;  2VYT A;  2XG8 D;  2AIR B;  1G3W A;  1VUB A;  2XU8 A;  3SFM A;  1KQ2 A;  2CZ7 B;  5LJ5 f;  1BKB A;  3HTR A;  1EFN A;  2F2V A;  2AKL A;  1WPY A;  2LDM A;  3SHW A;  1QVG A;  2ROT A;  2K5L A;  1YP5 A;  4OB0 B;  3MP6 A;  1BYM A;  1U5S A;  2AT1 B;  5LJ3 e;  4C5H A;  2QDL A;  2I2L A;  1WZO A;  1NE8 A;  5CKD A;  1VQL Q;  4KGZ B;  1YIT T;  4OMM A;  3CCE A;  3URG A;  5GAO m;  3A8G B;  2V8I A;  1VQ8 T;  3JCM g;  5IXF A;  2BE9 B;  1IB8 A;  1W1F A;  3EG3 A;  2CUB A;  5CKE A;  4FW2 A;  2GTO A;  1KG1 A;  3JV3 A;  3MEW A;  5LJ5 h;  3EGX B;  5CAI A;  2X35 A;  2M02 A;  1VQ6 T;  3VYG A;  3UAT A;  1MMG A;  2QQB A;  2RH2 A;  3ZEH A;  3UT1 A;  2FPD A;  4M7D C;  3V7S A;  3QKJ A;  4KH1 B;  3GP8 A;  4Z8A A;  2GQV A;  4FYY B;  5CR2 A;  3MJX A;  3OYY A;  1IRX A;  4PFO A;  3JB9 J;  4TVR A;  1KQ1 A;  2X3W D;  3OYI A;  5FU6 B;  4KUL A;  2D1X A;  5L23 A;  2DNU A;  3L2V A;  3SWN A;  1XNI A;  2OTJ Q;  4LD9 K;  2AK5 A;  1PNJ A;  1ZQ1 A;  3PNW C;  4A53 A;  3M4G A;  3G4S T;  4M75 D;  2QAZ A;  4M75 E;  4PJO F;  5LJ3 d;  4WCI A;  3L2W A;  5A0D A;  4FW1 A;  4RTV A;  3CCS Q;  3HRS A;  1K73 C;  4ANJ A;  1S72 Q;  1JXO A;  3DKM A;  1JJ2 S;  1C6V X;  1TUG B;  3OS0 A;  1BI2 A;  4ZNX A;  2FZG B;  2QDY B;  4OMP A;  2D6F A;  2WSE E;  2Y4Y A;  4B6M A;  4RG8 A;  5GMK j;  1N8R C;  4JLI A;  2P0P A;  5GAM j;  2C0O A;  1K8A C;  4F14 A;  4E7S A;  2FRW A;  2X4J A;  3PFS A;  5KYY A;  1UGQ B;  1HYO A;  4PJO C;  2G6F X;  1YNZ A;  1M30 A;  2HD0 A;  2JNG A;  1HSQ A;  1Q86 R;  5KCH A;  1PD1 A;  4BY6 C;  1YCS B;  4DEY A;  4XU3 A;  2A28 A;  4DBR A;  4F7U E;  1YJW A;  4QKU A;  1TTH B;  1OV3 A;  3PIO A;  2RHU A;  5DY9 A;  4J6Y A;  3OYN A;  2J6F A;  2BTT A;  4LNP A;  1NBE B;  1N5Z A;  4QT7 A;  3QZ5 B;  2V1Q A;  5IHN A;  2I0N A;  3WVE B;  2NUP A;  1N6A A;  2LX7 A;  5HKC A;  3HKS A;  1FMV A;  4C8Q E;  3CMA A;  1AWW A;  4RUG A;  1VQL A;  4PL6 A;  2M1H A;  1RI0 A;  2LQN A;  3CCR T;  2DJQ A;  3SWN B;  1QMC A;  2OTL T;  5GAO l;  4N0A C;  4Y92 A;  8AT1 B;  1CKA A;  3CQT A;  4OMO A;  1VQ5 Q;  1JJ2 A;  3M56 A;  4FT2 A;  2EQM A;  3G71 T;  2F5K A;  1VQ7 T;  3BY7 A;  4XTY A;  3HSB A;  3VS5 A;  3NMZ C;  4LUE A;  4XU1 A;  3RIR A;  3TU4 K;  5GAN h;  2X3X D;  1XQH A;  5GAM g;  1I81 A;  2EW3 A;  1JB0 E;  3HL8 A;  2L2P A;  2OAU A;  2JZ2 A;  2ECZ A;  3E1S A;  4QVD A;  3GNG A;  4HCB A;  1B7T A;  1ZUY A;  1VQK T;  3VJP A;  1T0H A;  1YWP A;  1BI0 A;  1I4K 1;  3QDF A;  1WHK A;  2LT1 A;  1A0N B;  2HMA A;  3EFO A;  5I2M A;  1VQ4 Q;  1WQ7 A;  3EFR A;  2L5Q A;  2OTJ A;  4HKE A;  1AWO A;  4PJN A;  3M54 A;  2PTK A;  4JUV A;  1IXD A;  1C1A A;  1EX4 A;  2FZK B;  2LZ6 B;  2KRS A;  5I22 A;  5KYY B;  1NJI U;  2KBT A;  4IUV A;  1KD1 U;  1FWZ A;  2DRK A;  3E9G A;  1JO8 A;  4JRI A;  3LWH A;  2GFA A;  2G3R A;  2JT4 A;  3VS7 A;  2DXC A;  4QQ6 A;  2CS7 A;  2K5I A;  5DLO A;  1UFF A;  2F2X A;  2COW A;  1KIK A;  1R8O B;  4JRQ A;  4JS4 A;  1N9S A;  2NUP B;  4M78 F;  2QGG A;  3SD4 A;  2KSS A;  3JSC A;  3WXM B;  2YUQ A;  3CPW P;  1RAI B;  4OB2 B;  4RTY A;  1KK7 A;  1PC0 A; 
#chains in the Genus database with same CATH homology
 1AZE A;  3EG0 A;  4RTZ A;  1WXU A;  2D8H A;  1NLO C;  2M51 A;  1ZLM A;  2CT3 A;  2DBM A;  2CH4 W;  1WXB A;  1BU1 A;  2L3P A;  2HSP A;  4JJC A;  3ULR B;  3VS0 A;  1LCK A;  1H8K A;  2PZ1 A;  2FEI A;  1WI7 A;  2JMA A;  2KXD A;  4HVV A;  2GQI A;  2ROL A;  3IQL A;  1PRM C;  4HVW A;  3H41 A;  2K9G A;  2KRM A;  4OMN A;  1IO6 A;  2DF6 A;  2LJ3 A;  4E6R A;  5IH2 A;  1UGV A;  2C0T A;  1SRL A;  1Y0M A;  2RF0 A;  3C0C A;  2RPN A;  1TUC A;  3O5Z A;  1NYG A;  2HCK A;  1HJD A;  1HD3 A;  2P4R A;  1GBR A;  1PHT A;  2E5K A;  2EBP A;  1MUZ A;  3H0H A;  3SEM A;  1WA7 A;  1WLP B;  1VYT A;  2HDA A;  3PE0 A;  2J7I A;  3U23 A;  2KGT A;  3M0U A;  2F2W A;  2XMF A;  1RLQ C;  1VA7 A;  2NWM A;  1S1N A;  2KRO A;  2RMO A;  1AVZ C;  1YWO A;  1UHC A;  1AD5 A;  2D8J A;  2EYZ A;  1T3S A;  2OJ2 A;  1M3A A;  4J9G A;  2ABL A;  4R0K A;  1JXM A;  1ARK A;  1W70 A;  1WDX A;  2RN8 A;  2EGA A;  2AZS A;  1T0J A;  4A63 B;  2CH4 A;  2ESW A;  4J9C A;  1X6B A;  5ECA A;  3REA B;  2K7A A;  2L3Q A;  4F17 A;  2EVR A;  2RQW A;  4D8D A;  2JTE A;  3TSZ A;  1Z9Z A;  1E7O A;  1H92 A;  2AZV A;  1ZUU A;  1X2K A;  4AFZ C;  1WX6 A;  1KFZ A;  2DIL A;  3THK A;  2ED0 A;  1I0C A;  1GCQ C;  4RTU A;  2KNB B;  2DMO A;  1RLP C;  1ABO A;  4F16 A;  1NM7 A;  1RI9 A;  2JXB A;  3NHN A;  2KT8 A;  4GBQ A;  4OML A;  1GFD A;  1QLY A;  2JS0 A;  3QWX X;  2DE0 X;  1TUD A;  1G83 A;  1I07 A;  1OPK A;  4CC4 B;  2GNC A;  2DL8 A;  2OI3 A;  5HCK A;  1PRL C;  2K3B A;  1SRM A;  4IIO A;  2VKN A;  2YUP A;  5I11 A;  2JW4 A;  1WIE A;  1QWE A;  1XOV A;  2DLP A;  4LN2 A;  4CC2 A;  2DA9 A;  2H8H A;  1EFN A;  1MV3 A;  2KEA A;  2F2V A;  2O9V A;  2YDL A;  2AKL A;  3SHW A;  4D8K A;  2ROT A;  2GTJ A;  1Y57 A;  4RTW A;  1W6X A;  1GCQ A;  1YP5 A;  4ORZ A;  2FPF A;  4AFS C;  1K0X A;  1UE9 A;  1ABQ A;  4Z88 A;  2MOX A;  4CC7 A;  1U5S A;  1NG2 A;  1UHF A;  1UG1 A;  4J9H A;  4HVU A;  2FPE A;  2QDL A;  4LE9 A;  1M3B A;  2D0N A;  3UF4 A;  1QCF A;  4OMM A;  4RTT A;  5GJW B;  1YN8 A;  1B3Q A;  1BBZ A;  1UUE A;  1X69 A;  3VS3 A;  5IXF A;  4K11 A;  1W1F A;  2LP5 A;  2NUZ A;  3EG3 A;  3M0R A;  1WYX A;  2IIM A;  2DL5 A;  2KR3 A;  2DL7 A;  4ESR A;  1X27 A;  3GBQ A;  2CUB A;  2GTO A;  2W10 A;  3JV3 A;  2J6O A;  2CDT A;  4J9D A;  2KT1 A;  4J9I A;  2KYB A;  3UAT A;  1ZBJ A;  1X43 A;  2LCS A;  3VS6 A;  2FPD A;  1AOJ A;  2RQV A;  3M0S A;  4Z8A A;  1QWF A;  3M0T A;  2YT6 A;  1WXT A;  4IIM A;  1T3L A;  2X3W D;  2CSI A;  1RUW A;  1UJ0 A;  2D1X A;  2EYY A;  5L23 A;  2DNU A;  4J9B A;  1G2B A;  1ZUK A;  2JM8 A;  2EYW A;  2AK5 A;  1QKW A;  1PNJ A;  3EG1 A;  2KXC A;  1K9A A;  2A36 A;  2O2O A;  1OPL A;  1SPK A;  2K79 A;  2LJ0 A;  2ENM A;  1CSK A;  2MIO A;  2DVJ A;  1KSW A;  1ZSG A;  2EQI A;  4FSS A;  4J9F A;  4M4Z A;  4WCI A;  1NEB A;  5IHI A;  4AFU C;  4RTV A;  1BB9 A;  2JM9 A;  3PVQ A;  1JXO A;  3UA7 A;  2B86 A;  2DM1 A;  2K2M A;  3RNJ A;  2YSQ A;  4ZNX A;  4JJD A;  3UA6 A;  1U3O A;  2EKH A;  4EIK A;  1SEM A;  1GBQ A;  2LNH B;  1H3H A;  1K76 A;  1UDL A;  4OMP A;  1AEY A;  3R6N A;  1PKT A;  3FJ5 A;  2C0I A;  3I9Q A;  2DL3 A;  2CSQ A;  2C0O A;  1QKX A;  1VYU A;  1K4U S;  4F14 A;  3PVL A;  2RQT A;  2FRW A;  1M8M A;  3VS2 A;  4X1V A;  2EGC A;  1MV0 B;  1JQQ A;  1PKS A;  2G6F X;  2RQU A;  1YNZ A;  1M30 A;  1HSQ A;  1M27 C;  2LJ1 A;  1FYN A;  1YCS B;  4DEY A;  2A28 A;  2K6D A;  1JEG A;  4HCK A;  2CUD A;  2EGE A;  1SHF A;  1OV3 A;  3TSW A;  2YUO A;  3EHQ A;  2FO0 A;  3EGU A;  3NPF A;  2J6F A;  2BTT A;  2VVK A;  4LNP A;  1K1Z A;  1N5Z A;  1NEG A;  1UEC A;  4QT7 A;  4AG2 C;  2V1Q A;  3QWY A;  5IHN A;  2I0N A;  3VRY A;  4Z89 A;  3LH5 A;  2LX7 A;  1KJW A;  1UTI A;  4LUD A;  2DL4 A;  1J3T A;  2O9S A;  2PNI A;  1AWW A;  4GLM A;  4RUG A;  3ZL7 C;  1TG0 A;  1U06 A;  2EYX A;  5FWC A;  4JPB W;  2A37 A;  2DX1 A;  2LQN A;  2L3S A;  1GFC A;  2DJQ A;  4JZ3 A;  2OAW A;  1VYV A;  2LQW A;  3REB B;  2ED1 A;  2MCN A;  4DEX A;  4RTX A;  2LMJ A;  4Y92 A;  1CKA A;  2RNA A;  3CQT A;  2DRM A;  4OMO A;  3I35 A;  3NGP A;  4KRT A;  2JS2 A;  1X6G A;  1OOT A;  1E6G A;  2GBQ A;  1E6H A;  2KE9 A;  4JJB A;  4J9E A;  3VS5 A;  5IHK A;  4CC3 A;  1K0S A;  1AWJ A;  3NMZ C;  3I5S A;  1PWT A;  2EPD A;  2J06 A;  5EC7 A;  2KRN A;  4LUE A;  2HEQ A;  1BK2 A;  2A08 A;  1GL5 A;  2X3X D;  4AG1 C;  1OEB A;  2J05 A;  2EW3 A;  3VRZ A;  2KYM A;  2L2P A;  2SEM A;  4OMQ A;  2ECZ A;  2M0Y A;  5IXB A;  4HXJ A;  2CT4 A;  1NYF A;  1V1C A;  3VS4 A;  2L0A A;  1ZUY A;  1T0H A;  1YWP A;  1AZG B;  1M3C A;  1FMK A;  1GCP A;  2HBW A;  2O88 A;  1A0N B;  2VWF A;  1SSH A;  2BZ8 A;  2RQR A;  2FG0 A;  1Z9Q A;  3M0Q A;  1AWO A;  2PTK A;  5FW9 A;  5GJV B;  3EG2 A;  2CRE A;  1UJY A;  1WFW A;  2KRS A;  2LZ6 B;  1ZX6 A;  3EHR A;  5I22 A;  3M0P A;  2KBT A;  3KFV A;  3RBB B;  2AKK A;  1SHG A;  2DBK A;  2FRY A;  3I5R A;  2DRK A;  2GGR A;  1JO8 A;  4JZ4 A;  1X2Q A;  2SRC A;  3H0F A;  2BZX A;  2JT4 A;  2O31 A;  3VS7 A;  1I1J A;  2J6K A;  4AFQ C;  2V1R A;  3A98 A;  1UFF A;  2BZY A;  2F2X A;  5FWB A;  1KIK A;  2JMC A;  3TVT A;  2YUN A;  1AWX A;  1NLP C;  3VS1 A;  3H0I A;  2YUQ A;  1CKB A;  1JU5 C;  2W0Z A;  4RTY A;  1GRI A;  2DYB A;  1B07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...