1RUWA

Crystal structure of the sh3 domain from s. cerevisiae myo3
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
b'KDPKFEAAYDFPGSGSSSELPLKKGDIVFISRDEPSGWSLAKLLDGSKEGWVPTAYMTPYKDTRNTVPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin-3 isoform
molecule tags Contractile protein
source organism Saccharomyces cerevisiae
publication title Crystal structure of the SH3 domain from S. cerevisiae Myo3
rcsb
total genus 11
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2003-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ruwA01
2KRNA 4HVWA 1MV3A 4M4ZA 2QDLA 5HCKA 5IXFA 3VS7A 2KYBA 2DBMA 3M0PA 2EVRA 2KYMA 2OAWA 2KR3A 2DILA 2E5KA 2HDAA 2DVJA 1VYUA 1E6GA 1RI9A 2H8HA 2DRMA 4EIKA 1ZX6A 3EHQA 4RTUA 4F16A 4CC7A 2CSIA 4LN2A 1K0SA 1HSQA 2LP5A 4GBQA 5I11A 1ZUYA 3NMZC 4R0KA 2EGAA 2ABLA 1UJ0A 1U5SA 2JTEA 1NM7A 2LJ0A 3SEMA 2CUDA 4IIMA 1GCQA 3VS1A 3ZL7C 1T3LA 3I5RA 5FWCA 2BTTA 2ROTA 3I9QA 1YNZA 2DL3A 1WDXA 4X1VA 4IIOA 2ESWA 1OPLA 2A36A 4RTXA 2LCSA 2RMOA 1YN8A 4AG1C 1T3SA 2J7IA 3PVQA 3H0FA 4RTYA 4A63B 2CUBA 1CSKA 2V1RA 2OJ2A 2JM8A 4J9FA 3VS4A 3PVLA 4J9HA 1W70A 2AKLA 2C0TA 2IIMA 2J6OA 1N5ZA 1UJYA 2CREA 3M0SA 2K9GA 1FMKA 4F17A 2W0ZA 2CH4W 1JXOA 2DJQA 2J05A 4OMNA 2LNHB 2C0OA 2JM9A 1TG0A 1PRMC 2DYBA 3EHRA 3EGUA 1OPKA 2JMCA 1NLPC 1M3BA 2M51A 4ESRA 2D1XA 4AG2C 2M0YA 2RQVA 1AOJA 2B86A 2J06A 4HVVA 1KJWA 2PZ1A 2EYWA 2HEQA 4JZ4A 2DL5A 2MOXA 1UG1A 1GBRA 1UTIA 3FJ5A 1E7OA 2HSPA 1K0XA 2RN8A 1Y57A 2J6KA 4J9DA 1RLQC 3EG3A 5IXBA 2GNCA 5L23A 1YWPA 3REBB 1YWOA 4OMPA 5IHIA 2ROLA 1AWWA 3H41A 1U3OA 1GFCA 4RTVA 3NHNA 2O31A 2DE0X 2MIOA 2EYXA 4OMOA 2FPDA 2DF6A 1NEBA 1AZEA 2DLPA 3M0QA 4OMQA 1AEYA 1AWXA 3TVTA 1GRIA 2I0NA 3O5ZA 2DL7A 1RLPC 2YUPA 2ENMA 1OOTA 2KBTA 2W10A 1PNJA 2DNUA 1MUZA 1NG2A 2D0NA 1I0CA 1K76A 3UATA 3I35A 1HD3A 4JJDA 1ZBJA 2DRKA 1IO6A 1OV3A 3M0RA 3R6NA 1PHTA 4J9EA 3C0CA 3CQTA 1H8KA 2RQUA 2RNAA 1M3CA 2RQTA 4JZ3A 2L3QA 2RQRA 4OMLA 1I1JA 1QKXA 1X2QA 4K11A 2A28A 4RUGA 5IHKA 1G2BA 5IH2A 2F2XA 2FG0A 2CT4A 1NLOC 2KROA 2CT3A 2FO0A 1UUEA 1PWTA 1H92A 2GBQA 2O2OA 1WFWA 2EPDA 2JW4A 1SSHA 1SPKA 2DM1A 3VRYA 5FWBA 2MCNA 4JJCA 1W1FA 3VS3A 1OEBA 4LUEA 4LUDA 1CKBA 1QLYA 1G83A 2PTKA 1ABOA 1UHCA 2HBWA 3RNJA 4DEYA 2BZ8A 2RF0A 2P4RA 3EG0A 2EKHA 2O88A 1H3HA 2K79A 1WX6A 1SHGA 1GL5A 2KXCA 1JXMA 5FW9A 2LQWA 1S1NA 2DMOA 2OI3A 4AFQC 4HXJA 1KSWA 1A0NB 2FPEA 1UGVA 2CH4A 1ARKA 4RTZA 4D8KA 2JS0A 3UF4A 2D8HA 3JV3A 4AFSC 3VRZA 1GCQC 2SRCA 4CC4B 5IHNA 1NEGA 2KT8A 2GTOA 2YSQA 2JMAA 1Y0MA 2NWMA 3NGPA 1HJDA 1AZGB 2AZSA 1EFNA 1M27C 2KGTA 3VS6A 1KIKA 1VA7A 2LQNA 1U06A 1JO8A 1WLPB 2KE9A 2JT4A 1PKTA 1PRLC 1UDLA 1MV0B 1WA7A 2KRMA 1UE9A 1JU5C 2HCKA 4J9CA 5ECAA 4E6RA 1K9AA 2O9SA 2X3XD 1B07A 1BBZA 1QWFA 3TSWA 2KXDA 5EC7A 1K4US 2KRSA 4CC2A 2FRWA 4RTWA 4LE9A 2GTJA 2ED1A 3SHWA 4D8DA 1LCKA 1TUCA 4RTTA 1SEMA 2K3BA 3EG2A 2K2MA 2YDLA 3THKA 1AWOA 1VYTA 4DEXA 4ZNXA 1I07A 2L2PA 4ORZA 2FRYA 2SEMA 4FSSA 1ABQA 4GLMA 2RPNA 2A37A 2LJ1A 2XMFA 2JXBA 1ZSGA 1TUDA 4WCIA 1WXTA 3QWXX 2O9VA 1X43A 2YUQA 1E6HA 1AD5A 1BK2A 2KT1A 3VS2A 4CC3A 1T0HA 2EGEA 1AVZC 1QWEA 1XOVA 2F2VA 1NYFA 2D8JA 1X6BA 2KNBB 1QCFA 2V1QA 3VS0A 1UFFA 2F2WA 4JJBA 3UA6A 2CSQA 2VKNA 1GFDA 2BZXA 1SHFA 2EW3A 3GBQA 3NPFA 1W6XA 2JS2A 1X6GA 2LX7A 4J9BA 2L0AA 2YT6A 1WYXA 5I22A 2EBPA 1JQQA 1RUWA 2BZYA 2DL4A 1BU1A 2KEAA 1WXUA 2VVKA 3A98A 4LNPA 3EG1A 1WXBA 4KRTA 2AKKA 1VYVA 2A08A 2ED0A 1PKSA 1KFZA 5GJVB 3M0TA 1J3TA 1Z9ZA 3REAB 4HVUA 1WI7A 2GQIA 4HCKA 3H0HA 2EGCA 2YUOA 2EYYA 2YUNA 1ZLMA 2G6FX 1X69A 2AZVA 1X2KA 2FPFA 1T0JA 1YCSB 1ZUUA 3KFVA 1UHFA 4Y92A 1M30A 4Z8AA 3TSZA 1CKAA 1M8MA 2L3PA 1WIEA 4AFUC 1SRMA 1FYNA 4JPBW 1SRLA 4OMMA 2EQIA 3RBBB 4Z89A 1K1ZA 3PE0A 2FEIA 1ZUKA 2X3WD 2CDTA 3ULRB 3U23A 1V1CA 4QT7A 3I5SA 3IQLA 2RQWA 2DBKA 3M0UA 2ECZA 2DX1A 3LH5A 2GGRA 4Z88A 3QWYA 2VWFA 2DA9A 4F14A 1QKWA 2LMJA 2DL8A 1GBQA 1Z9QA 3UA7A 1UECA 2C0IA 1YP5A 1GCPA 5GJWB 4J9IA 2K6DA 2L3SA 3H0IA 4J9GA 1NYGA 4AFZC 2NUZA 1B3QA 2EYZA 1BB9A 2LJ3A 2PNIA 2LZ6B 2K7AA 2J6FA 1X27A 3VS5A 1JEGA 1M3AA 1AWJA 2AK5A
chains in the Genus database with same CATH superfamily
4M4ZA 5LJ3e 5HCKA 2V8JA 5IXFA 3VS7A 4RG2A 2KYMA 4J6WA 3PTAA 2E5KA 3RKWA 3OYMA 1VYUA 2H8HA 3TREA 4BDYA 5CVIA 2COZA 2DRMA 2K57A 5AYFA 5GAOn 3OBYA 4RTUA 4F16A 1Q81U 1M1FA 4JUVA 4LN2A 2LP5A 3L2ZA 5LJ3j 1H641 5GAOq 5I11A 4FYXB 1ZUYA 4HT8A 2EGAA 1UJ0A 1U5SA 1XJWB 1NM7A 1QVGP 2CUDA 1NE8A 2Y4XA 4OB2B 1GCQA 3VJPA 1QCNA 4EMKB 3INZA 3TCJA 3MEWA 1MMGA 4MMLA 4F7UA 1S72A 1Q7YC 5GMKl 3I9QA 2LQ8A 4FL6A 1KC8C 1WDXA 4BE1A 1PG5B 4M75F 3OW2A 2XK0A 5LJ5g 4E7KA 1YN8A 4XQ3A 4AG1C 1T3SA 3A8OB 1VQ4Q 4LD9K 4A63B 2CUBA 2DKGA 1D3BB 2KY9A 1BCMA 1YJWT 4J7IA 1M2OA 3PGGA 3PVLA 3CCEA 2QQ9A 4C8QA 4DBQA 4KGXB 4LDVA 6AT1B 2RK2A 4MMKA 5A2QE 3M0SA 4V2SA 4C0ZA 4M7DB 1TWBA 2DJQA 4PJOD 1YIJA 4Z02A 1WZOA 2XKOC 2EKOA 4IUPA 4KH1B 3EHRA 5KYWA 3X24B 1N9SA 4NOYA 4ESRA 4M78A 4M7AG 1QP2A 3NFCA 3HRTA 4PJJA 1Q7YU 3KBGA 5LJ5e 2J06A 3G1JA 2HL3A 2CYZB 3FLGA 1UG1A 1GBRA 3HTRA 1KG1A 2DEQA 1RAAB 2K3YA 3FJ5A 3HL8A 3DB4A 3N5BB 4XTVA 3OYHA 2E41A 1Y96A 4J9DA 5FROA 1RLQC 3CCJQ 3REBB 1YWOA 4OMPA 5IHIA 2ROLA 3H41A 3HHTB 1Q86U 2EYXA 1ZA2B 8ATCB 2LTOA 3VU3C 1AZEA 3M0QA 1RAIB 1YJ9T 3CCSA 4O6JA 1VQ6T 2LVMA 1G3SA 2I0NA 3G6EQ 4HKEA 2ENMA 1OOTA 2COYA 4B9XA 3TEEA 3CCST 1ZBJA 1OV3A 1YI2T 4CI0C 4C0FA 2QEXQ 3CQTA 2RNAA 2QDYB 4JZ3A 1IGUA 2RQRA 3LGLA 1VQ7Q 1I1JA 1F1BB 1WHKA 2VGMA 2NUPA 5IH2A 2F2XA 1RL2A 3JCMW 1OZ3A 1G3TA 2KROA 2L3RA 4NL2A 3OBWA 1H92A 4C0GA 1QVFA 1SPKA 2DFUA 2DM1A 2EFIA 5FWBA 4N4GA 5GAOp 2RO0A 2H3EB 5D7UA 4O5VA 1G83A 2JOYA 1ABOA 1YI2Q 4DEYA 1BI1A 4X9DA 2LC4A 2JVVA 4M77E 3PFSA 2YRVA 3MO8A 1LJOA 1QVGA 1WHJA 4RCCA 4D8KA 2M9UA 5GAMf 3EGXA 4M7AB 4C5GA 1QP3A 2PVOB 3L2VA 5IHNA 2M02A 1QCOA 2GTOA 1TTHB 2JMAA 2QQSA 2L5QA 1TOVA 1AZGB 3EGXB 3VS6A 1Y7XA 1QVFS 2EAYA 1X6OA 2XDBA 2HCKA 4OB1B 5ECAA 4PNOA 3HPWA 5GAMh 3OMGA 4JJNK 2VV5A 3CCVA 3DLLA 1B07A 1QMCA 1BBZA 1WHGA 2KXDA 5EC7A 4JS5A 5IN1A 3QKJA 1RI0A 3M58A 3I56T 3HRUA 3LWHA 2BE7D 4ZN3A 1G5VA 1KQ2A 1OX8A 2MMPA 3G7ZA 1TUCA 2BUDA 4XU1A 2COWA 1VQ5T 1R0CB 2VUBA 3M54A 4DEXA 3PIOA 1VQOT 4M75G 4GLMA 4BI8B 3RIRA 1K73R 2CP6A 4ME7A 1WQ7A 1AD5A 1YJ9Q 3CC4Q 3VS2A 1S72Q 3C95A 3RMQA 1XOVA 1RAFB 1NYFA 2KNBB 1QCFA 4OB3B 2FHDA 3OB9A 4ZGJB 2V1QA 3MJXA 3UA6A 2CSQA 3WXMB 4WF2A 3C4SA 5GANj 1W6XA 3SWNA 3CCEQ 3CCUQ 4J9BA 4LDUA 3TU4K 1I81A 5CKBA 2JZ2A 3JCMc 1IGQA 3CC4T 2X9HA 3A98A 3I55T 3JB9G 2RHIA 4KRTA 4C8QE 4F7UB 5GAOl 5GJVB 2AIRB 2GQVA 3FC3A 2CKKA 1J3TA 4KGVB 1DJ7B 3REAB 3A8LB 2WSCE 4GLKA 3JRZA 5FLXE 4OB0B 1ZLMA 2AZVA 2RK1A 2QA4A 4M7AD 3A8GB 1X2KA 5LJ3h 1O75A 4C92F 1WJSA 3JB9F 1T0JA 4M7DA 4KBMB 5KYYA 2E6ZA 3KFVA 3G71Q 4Y92A 3JCMe 3GF5A 3SFMA 3TSZA 1M1KR 1U8RA 2X4WA 8AT1B 2QA4T 3SWNC 3OSSC 1SRMA 3A8MB 2EQKA 3JCMX 3Q1JA 1PD1A 3JCMd 4M75C 3CCSQ 3D7SB 1D1AA 1Q82U 1VQLQ 1WHLA 2CDTA 2CZ0B 4M78D 4HCCA 4QW2A 1V1CA 2F5TX 4QT7A 3I5SA 2KK4A 3IQLA 3DLMA 2MPXC 5DM7R 1VQ9A 1IZ6A 4LDWA 2M16A 1KD1U 4L6V5 1MNDA 2VWFA 4XTYA 4EMKA 3UA7A 2DL8A 1GBQA 2QEXA 4C92B 3CC2A 4OGCA 4C8QD 2PU9B 4E7HA 2K6DA 3S6WA 3PMIA 5CQXA 2NUZA 2QTXA 3GP8A 2KAFA 4RMOA 2EYZA 1U1SA 2K7AA 1JEGA 1M3AA 2KRNA 3CCMQ 2QDLA 3OSVA 2EQUA 4M75A 2KYBA 3PIPA 4QKUA 3SD4A 2OAWA 5I2SA 2KR3A 3P8DA 5DLOA 2HDAA 1M1KC 2P0QA 3QO3A 1OI1A 1VQKA 2VYTA 4J7FA 2LRQA 4CC7A 3M57A 2MWPA 4GBQA 1FX7A 1RABB 3CXCS 4R0KA 4FM4B 1KC8R 1TXQA 2QTVA 4BUGA 3VUBA 3J7AF 1ACMB 1T3LA 4XU3A 3JCMQ 1X75C 3ASKA 2FZGB 5LJ3d 2BTTA 4LDXA 1VUBA 1KQ1A 1OPLA 4M75D 1VQ4A 4RTXA 2LCSA 3UWNA 1M4ZA 2X4XA 2J7IA 3PVQA 5GAN4 3FJPA 1CSKA 2JUFA 3RERA 1U1TA 2D9TA 1TUGB 4FW1A 4J9FA 1Q86R 2HL5C 4J9HA 2NUTB 4HCBA 3E2UA 2AKLA 3SB2A 2PVDB 3OMCA 1JBMA 3BW1A 3CCVQ 2DPPB 2L8DA 4FIBA 5KYNA 1KQSA 3CMAA 2CREA 4PJOB 1YIJQ 4HT9A 1FMKA 2CH4W 4PJOF 1NJIC 1VQ6A 2J05A 4OMNA 3MP1A 2DYBA 1UGPB 1N9RA 1OPKA 4XU2A 4C92G 1S72T 2M51A 2X4JA 5HK3A 4UC4A 3F70A 2RQVA 1YCYA 3JCMV 5D6XA 1AOJA 3G4SQ 1C0MA 2EYWA 4JZ4A 2DL5A 3M4YA 4E2FB 3OYCA 3OW2S 3LGFA 1YIJT 2J6KA 1TS9A 3S3NA 2E3HA 3RKXA 1WHMA 3FEOA 3CCUT 3VYGA 4FYYB 3WVEB 5KYXB 2Z0WA 3MCAB 4PJOE 3AT1B 3NHNA 2O31A 4FSXA 3QBYA 4IUQA 4QQ6A 2FPDA 4XTXA 1VQMQ 3G6EA 2DLPA 3JAME 1AWXA 1KQSS 4KUDK 4X34A 2IVWA 4J83A 5A0LA 4RKUE 3OYBA 2RJFA 1RLPC 2KBTA 2W10A 1M5Q1 3MP8A 5KH6A 3NTHA 1MUZA 1NG2A 1I0CA 1WQWA 4XAXB 2DRKA 3HKSA 1IO6A 4QQGA 3R6NA 3CC7T 1PHTA 4J9EA 3WVDB 4PLIA 1H8KA 2RQUA 2FVUA 1M3CA 2RQTA 2JJ9A 1M8VA 4OMLA 1QKXA 3H6ZA 4MZMA 5IHKA 1QVPA 1G2BA 3E9FA 2FG0A 1NLOC 5EG2A 1VQPA 1UUEA 2FZCB 1PWTA 1UGRB 2EPDA 3H9NA 1K9MU 1SSHA 2A7YA 2L89A 3PNWC 2MCNA 4JJCA 3CPWS 1OU9A 5HK0A 1VQ8A 3RKYA 2AHJB 4PJLA 1MMNA 2HSEB 2DEUA 2HQXA 2LCLA 2P4RA 2RA2A 3CBOA 2EKHA 2O88A 1SHGA 2O4XA 2O01E 1JXMA 3CD6Q 2LQWA 1S1NA 2OI3A 1BIAA 4OMFB 2WSEE 1A0NB 2FPEA 1UGVA 3JCMb 4RTZA 2ZPGB 2R5AA 2K5LA 3UF4A 4M78E 1GCQC 4AT1B 4CC4B 1H3ZA 5LL6S 2PUKB 2KT8A 3QJYA 2NLUA 3OW2P 2CS7A 2RJDA 2AZSA 1EFNA 1YJNA 1UGQB 3EFRA 4P5NA 1IB8A 3EH1A 5GAN6 1WLPB 1PRLC 5KE2A 4KUIA 4PJOA 4N4HA 2XG8D 2ZCFB 4J9CA 3DKMA 1ZSZB 1JJ2P 2DTIA 1M2VA 2O9SA 5LJ5h 1QWFA 3TSWA 3CCLA 2MI6A 3EFOA 5CKHA 4CC2A 3M4GA 2GTJA 2ED1A 1VQPT 3SHWA 5KCOA 5FU6B 3I56Q 5GAOr 4IKFA 2YLBA 2K2MA 2VXEA 2YDLA 2EYQA 1AWOA 4ZNXA 3META 1I07A 4ORZA 2SEMA 1ABQA 4OF1A 2RPNA 2A37A 4ZN1A 2OAUA 1ZSGA 1TUDA 4PJOC 3QWXX 2O9VA 3H8ZA 2DXUA 4MZTA 4L5GA 2KT1A 1D3BA 4N0AA 1AVZC 2ZPHB 4BACA 1QWEA 2LNVA 2ATCB 1OYXA 2D8JA 1IREB 2K3XA 1B34A 2GFAA 2XDDA 1QW1A 4M75E 5KYWB 2F2WA 2ZPIB 4JJBA 1QQJA 3CXCP 3CCQQ 3RDVA 3QZ9B 4DA4A 3QDFA 2CP3A 2EW3A 4C0DB 5GAN7 5CK9A 4BDZA 1X6GA 2R57A 4KH0B 1BI2A 2L0AA 2YT6A 3BE3A 5I22A 1AT1B 3GNGA 3QYHB 1RACB 2DL4A 3FDRA 2QQAA 3EG1A 2AKKA 5GAOm 1R0BG 1TH7A 2GCXA 1PKSA 1VQ6Q 1W2BA 2QYZA 4ANJA 1YBYA 2OTJA 2ZAEA 1Z9ZA 3X26B 1VQ9T 1D1BA 1JRIA 1VIFA 3OS1A 2YUOA 4A4EA 2EYYA 2YUNA 4N0AC 3RMSA 2G6FX 2OTJT 1X69A 3OYEA 3OYFA 1RAHB 2CP0A 4M7AF 3G71A 2V26A 4C92D 4CRIA 2FPFA 1JB0E 1YHQQ 1K8AC 2G3RA 2V8IA 1ZUUA 3UT1A 2GF7A 3QUIA 2IPOB 3P8HA 1M8MA 2EQMA 1WIEA 2ZPFB 3JSCA 3CCJA 1FYNA 4JPBW 2RI3A 4OMMA 1N8RC 1K1ZA 4KULA 5IT9E 1Y71A 1VQLT 4E7JA 3E1SA 1PSEA 3CCJT 3QIIA 2KMTA 2RB6A 2RM4A 3OA6A 1ZSZA 3L42A 4E7SA 2RQWA 1TSFA 3BFMA 2RD1A 3EFOB 3CPFA 4PLLA 2M1HA 2DX1A 1QKWA 1G8XA 1PM3A 4ZGDB 5GJWB 4C8QF 2K4YA 3H0IA 4J9GA 1NYGA 1M9SA 4X9CA 1VQKT 4AFZC 3CCMA 3X20B 3OYJA 1C6VX 2LJ3A 1VQPQ 1X27A 5FU6C 3VS5A 5GANh 3SWNB 2K2VA 2X51A 4OVAA 2DBMA 3M0PA 2JTMA 2EVRA 1G3WA 4JDSA 2DVJA 1E6GA 1RI9A 2XHCA 4EMHA 4EIKA 3EHQA 2OTLT 3OYNA 2KDSA 4J8OA 3OYLA 4JS4A 1HSQA 3CMAT 3BY7A 4PJNA 1C1AA 3NMZC 1NJIR 4DBHA 1P92A 1WPYA 1PD0A 1YJWQ 3R6OA 3X28B 4ELZC 2QG9B 3VS1A 3PMTA 2XI9A 2XIDA 1LOJA 2R5MA 5CIUA 4A4FA 2ROTA 1IHVA 1YNZA 2IG0A 4X1VA 4IIOA 2ESWA 2QQRA 2DK3A 1BI3A 3VV0A 4M77C 3RUXA 2HKQB 1KC8U 1RAGB 4PL6A 1R77A 4RTYA 5GANe 4Y91A 1TU0B 2V1RA 2OJ2A 1QVFP 3LX7A 2P0KA 3VS4A 4PK4A 1W70A 1FXXA 3QYGB 5IAYA 2DXBA 3CCRQ 1UJYA 3OYGA 2MWOA 4J6XA 2K9GA 3CCLQ 2W0ZA 1Q81C 1JXOA 3M5AA 2DD4A 1D0ZA 2JM9A 1N8RU 2DZ9A 3CC2Q 2B8AA 2Y4YA 1PRMC 2LX9A 3MKDA 4QVDA 4J5YA 3EGUA 2JMCA 1NLPC 1M3BA 2DJZA 5GANg 3G4ST 2D1XA 1V29B 4AG2C 2E12A 2B86A 5I21A 4E7LA 4HVVA 4KT0E 1RADB 4TVRA 1UTIA 2YLCA 4M77A 1VQ5Q 1K0XA 2M0OA 4M7DC 1I4K1 5L23A 3X25B 4QQDA 4B9WA 1Q86C 4PJMA 1YJ9A 1W2BP 1AWWA 3GPLA 3EG9A 1GFCA 4RTVA 2DE0X 4OMOA 1ZA1B 1NEBA 1WHHA 3HRSA 2A3LA 4JRKA 1EX4A 4L59A 3TVTA 3HSBA 2DAQA 4DOWA 2EIFA 5A0GA 4EPCA 2DL7A 4M75B 3FB9A 3NTKA 1MGQA 1PNJA 2DNUA 2D0NA 1K76A 3UATA 3I35A 1HD3A 2HMAA 3MEVA 2QAZA 2BIVA 3M0RA 3L2RA 3JB9I 1VQNA 2OTJQ 5LJ3f 3OYIA 1IRXA 4JRIA 2L3QA 2E10A 4EMKC 1YITA 3P8BB 2A28A 2FO0A 1D0YA 1GXIE 2O2OA 1WFWA 2QXFA 3S3OA 3VRYA 2CZ1B 3VS3A 2C06A 4LUEA 2OTLQ 1ZQ1A 2PTKA 3M9QA 2F5KA 3RNJA 4BB7A 1IHWA 2BZ8A 3LH0A 2E4HA 3EG0A 3G4SA 1GL5A 1VQ7T 2KXCA 4DBRA 3OS5A 4F04B 5GMKe 5FW9A 3EGDA 2DMOA 1K73U 3QJ6A 2RI2A 2VASA 1NPRA 2K5FA 2CH4A 2JTFA 3L2WA 2ZGWA 1VQ8T 2JS0A 2D8HA 4FCYA 4AFSC 3L2QA 4GY5A 3ER0A 4DQ2A 2SRCA 1KHCA 4PFPA 1NEGA 4BE0A 3MEUA 1MNEA 3LW5E 4R56A 1YJNQ 2QI2A 2NWMA 1HJDA 2LCCA 2KGTA 3MPUB 1KIKA 1VA7A 2LQNA 4M78C 1KHIA 3CPWA 1JO8A 2JT4A 1UDLA 1MV0B 1WA7A 2KRMA 1UE9A 1UB4A 1SF9A 1YI2A 1JU5C 2DIQA 3V7SA 3JCMh 1K9AA 2FB7A 1I8FA 1MMAA 1N6AA 4Y28E 4II1A 2LDMA 4F7UE 1YITT 3CEYA 3GLXA 4OP0A 2XD0A 2FRWA 4RTWA 1BIBA 4LE9A 1I5OB 5GAN8 2I2LA 4RTTA 1SEMA 2K3BA 2WACA 4Q5WA 3EG2A 4M7AE 2ZPBB 1MHNA 2L2PA 3EAEA 4J6YA 4FSSA 1OQKA 2DXCA 1XNIA 5FU7B 2LJ1A 2JXBA 4ELYC 1X43A 4PFOA 1E6HA 2YUQA 1JJ2A 1BK2A 1VQOA 4MDWA 1O9SA 2F2VA 3TQ7P 4B6MA 2HQHA 4RCBA 3CCQA 4M7AC 3VS0A 1UFFA 1FMWA 4M7DF 2QEXT 3S3MA 2BZXA 1SHFA 1MMDA 3CBPA 1WGSA 2JN0A 3GBQA 3NPFA 2JS2A 2RH2A 1WYXA 5C0MA 4BI4A 1JQQA 2WSFE 1BU1A 2KEAA 4LNPA 2VVKA 3G71T 1WXBA 1KD1C 1VYVA 5CKDA 2ED0A 3EG9B 3HP9A 1Q7YR 1ZSZC 1VQ9Q 2VGNA 4A4GA 7AT1B 2O4XB 3M0TA 3LLRA 4M7DG 3CCVT 4WTOB 1K9MR 2ZZDA 4FYVB 4QVCA 4XK8E 1WI7A 2GQIA 2P84A 4HCKA 3H0HA 1OX9A 2EGCA 4XTUA 4LXCA 1I5LA 1JJ2S 2PQWA 2E64A 2H3JA 2LT1A 5LJ5j 1QVGS 1N27A 1VQ5A 1UHFA 3O8VA 3PT9A 5GAMe 1M30A 4Z8AA 4A4KA 3OY9A 2L3PA 1BI0A 1HYOA 5GAN3 4M77F 5GAN5 2PUOB 4RG8A 4Z89A 5LJ5f 4BY6C 3PE0A 2FEIA 3GIBA 1ZUKA 3NTIA 2MF2A 3M59A 3ULRB 2D0QB 2DO3A 3U23A 1KQSP 2DTHA 2RI5A 3AHUA 3JCMJ 5CR2A 1Q82C 3CCMT 5GMKh 3HFOA 3CD6T 3M0UA 2CZ7B 2GGRA 3QDRB 3KUFA 4FU6A 2E1HA 4IUTA 2NUPB 2LMJA 1UECA 1OULA 2QK0A 1V76A 4FT2A 2VXFA 3C12A 2RJCA 1W4SA 3T9NA 1B3QA 3CC7Q 3OYDA 4M78G 2OTLA 2X35A 2PNIA 3KXTA 2LZ6B 4M7AA 3UDCA 5J3BA 1AWJA 2AK5A 2KVQG 4HVWA 1MV3A 3RR6A 1Q81R 2NYSA 5CKFA 5CCAA 1X01A 1VQ8Q 2DILA 1OZ2A 2A0FB 1AHJB 1ZBXA 1ZHIA 4EDUA 1YHQA 1ZX6A 1LNXA 1UEBA 2CSIA 5DLQE 3JCMP 1K0SA 4KGZB 3VYHB 2EWNA 4DOVA 2ABLA 1FMVA 3HFNA 2JTEA 2LJ0A 4FYWB 4NL3A 4JLGA 3SEMA 1BKBA 4IIMA 1K9MC 4BD3A 4E7ZA 2HAXA 3V7RA 3ZL7C 3M55A 4R55A 3EFSA 3I5RA 5FWCA 1LVKA 1NZ9A 4MZPA 5I2MA 2DL3A 5GMKm 4DBFA 2QGGA 4C8QG 2A36A 1PC0A 2P4TA 2RMOA 1VIEA 4IUUA 2BKDN 3H0FA 4EMGA 4A4HA 2XDPA 5CQYA 5CAIA 1VQ4T 1W2BS 2JM8A 4LD6A 5FRMA 4M78B 3CMEA 2E6NA 5DY9A 3CCRT 2IIMA 2C0TA 1BYMA 2XICA 4ATOA 3QG1A 2J6OA 1B34B 1N5ZA 2OX7A 2EJFA 2P0PA 2CP7A 3ZFJA 2K5IA 4F17A 3CMET 5KCHA 1D1CA 2RJEA 2LNHB 2YRDA 2C0OA 2VC8A 2EQJA 1TG0A 1WJRA 2YXYA 3OS2A 4JRQA 2GFUA 1Y96B 4C8QB 3OQ5A 5J26A 3ZEHA 1VQMT 3J81E 2M0YA 4BY6B 2QA4Q 1KJWA 2PZ1A 2HEQA 2MOXA 1K8AU 1N8RR 2HNIA 1E7OA 4ZTFA 2JNGA 2HSPA 2RN8A 1Y57A 3EG3A 5IXBA 2GNCA 2XU8A 5D6WA 1YWPA 1EIFA 3E19A 5GANf 4XTWA 3URGA 3CCET 4FW2A 4C92A 2HZYA 1BCOA 1U3OA 2KQWA 3QXEB 2MYSA 2MIOA 5LJ3g 3I55Q 3FIFA 1D09B 2DF6A 3A8HB 4OMQA 1AEYA 4BE2A 4A53A 3QSUA 1GRIA 3O5ZA 2AT1B 2YUPA 4C92E 1XTDA 4IURA 1LPLA 3G6ET 2DIGA 4JJDA 2RHZA 1K8AR 2E70A 3QZ5B 3C0CA 1UGSB 4D6WA 2CP2A 4VUBA 1X2QA 2V8KA 3CCRA 4K11A 4RUGA 1VQ7A 2CT4A 2EJ9A 2CT3A 2DERA 2GBQA 4M77G 4C92C 2JW4A 1W1FA 5CKEA 3LWIA 1OEBA 3VKIA 4LUDA 3C94A 1CKBA 1QLYA 5D6YA 1VQNT 4PFZA 2DYIA 1UHCA 2HBWA 4AMCA 2RF0A 1Q82R 1VQKQ 5FU7C 2R58A 1VQMA 1H3HA 1M2VB 2K79A 1WX6A 4HA8A 2HD0A 2DTOA 5AT1B 3OYAA 3V7CA 3OS0A 4AFQC 2FZKB 4HXJA 1KSWA 3BDLA 2DZCA 4XU0A 5A0DA 2FYKA 4MDXA 1NPPA 5GANd 3I56A 1ARKA 2E5QA 1KD1R 2DETA 3JCMf 3JV3A 1B7TA 1M90R 3VRZA 3CCUA 3MP6A 3SDZA 1YJNT 3UPUA 1HXDA 2YSQA 1NJIU 2E3IA 3EGDB 3OYYA 2LT4A 1Y0MA 3NGPA 1M27C 5GMKi 1D0XA 2X4YA 1U06A 2KE9A 1PKTA 1SKUB 4YTLA 3GOXA 2ZPEB 3CC7A 4E6RA 4M77B 1SSFA 3FRNA 1YITQ 5FRNA 3QHSA 2X3XD 1WNLA 2E65A 5KYYB 4OGEA 3CPWP 1K4US 2KRSA 1XQHA 2LQKA 2DD5A 2DVEA 2RHYA 2YRCA 1G3YA 4N4IA 4D8DA 1LCKA 4C5EA 2Y90A 3THKA 4FT4A 4C8QC 1VYTA 3CCQT 3M56A 2FRYA 2CGHA 2MAMA 3L1AA 5L8RE 5GMKj 1VQOQ 2XMFA 3JB9H 4WCIA 5GAN2 4BI3A 1WXTA 3EH2A 2VB6A 4HCZA 2HBPA 4CC3A 3JB9J 1T0HA 2EGEA 1Y07A 9ATCB 3CC4A 5GAMj 1X6BA 3J80E 5KYUB 4C5HA 2QGFB 1KK7A 1Q95G 3CBMA 2KI7A 2NUTA 3CMEQ 2QASA 1HK9A 2VKNA 4JRPA 4M7DD 1GFDA 5M9OA 5KE3A 2RHXA 3GNFB 2CZ6B 3RESA 2LX7A 1OU8A 1M1GA 2EBPA 1RUWA 2BZYA 3ME9A 3M53A 4LDYA 1VOMA 3V8LA 1WXUA 5J39A 3VUZA 4F7UF 2FL7A 2BE9B 2RHUA 2A08A 2D6FA 5KYXA 1KFZA 2YWWA 4C5IA 4XTZA 1M90U 4PJOG 3MEAA 4HVUA 5GAMg 1M1KU 3CCLT 5CO7A 3ZBDA 4A54A 5GAMd 5KYUA 2YHTA 3A1PA 3CC2T 3BDUA 1RAEB 2QQBA 4ZGEB 3JB9D 4PKCC 4IUVA 1YCSB 2F1LA 4M7DE 5HY6A 1CKAA 1EZZB 3E9GA 2EJGA 3OYKA 3CD6A 4AFUC 1IXDA 3L2UA 4M77D 1SRLA 2EQIA 3RBBB 1SG5A 3A5ZB 2F69A 4JLIA 5LJ5d 2X3WD 3I55A 4E47A 3V8KA 4ZTJA 3V8JA 4M78F 1PCXA 4QVZA 2KSSA 1PSFA 1VQLA 1YFNA 3LYIA 2HKNA 2DBKA 1YHQT 5C6SA 2DXTA 3CXCA 1NBEB 1FWZA 3MHXA 2ECZA 1WJQA 3LH5A 4F7UG 1M90C 1R8OB 1YJWA 4Z88A 3QWYA 2DA9A 4F14A 5HKCA 1Z9QA 2C0IA 3DB3A 1YP5A 1VQNQ 1GCPA 2MK5A 4J9IA 3JCMg 4C0DC 2HQEA 2L3SA 3QPHA 3CMAQ 1BB9A 4NS5A 2J6FA 2PVGB 4E7IA 1K73C 2CP5A
chains in the Genus database with same CATH topology
2KRNA 4HVWA 1MV3A 4M4ZA 2QDLA 5HCKA 5IXFA 3VS7A 2KYBA 2DBMA 3M0PA 2EVRA 2KYMA 2OAWA 2KR3A 2DILA 2E5KA 2HDAA 2DVJA 1VYUA 1E6GA 1RI9A 2H8HA 2DRMA 4EIKA 1ZX6A 3EHQA 4RTUA 4F16A 4CC7A 2CSIA 4LN2A 1K0SA 1HSQA 2LP5A 4GBQA 5I11A 1ZUYA 3NMZC 4R0KA 2EGAA 2ABLA 1UJ0A 1U5SA 2JTEA 1NM7A 2LJ0A 3SEMA 2CUDA 4IIMA 1GCQA 3VS1A 3ZL7C 1T3LA 3I5RA 5FWCA 2BTTA 2ROTA 3I9QA 1YNZA 2DL3A 1WDXA 4X1VA 4IIOA 2ESWA 1OPLA 2A36A 4RTXA 2LCSA 2RMOA 1YN8A 4AG1C 1T3SA 2J7IA 3PVQA 3H0FA 4RTYA 4A63B 2CUBA 1CSKA 2V1RA 2OJ2A 2JM8A 4J9FA 3VS4A 3PVLA 4J9HA 1W70A 2AKLA 2C0TA 2IIMA 2J6OA 1N5ZA 1UJYA 2CREA 3M0SA 2K9GA 1FMKA 4F17A 2W0ZA 2CH4W 1JXOA 2DJQA 2J05A 4OMNA 2LNHB 2C0OA 2JM9A 1TG0A 1PRMC 2DYBA 3EHRA 3EGUA 1OPKA 2JMCA 1NLPC 1M3BA 2M51A 4ESRA 2D1XA 4AG2C 2M0YA 2RQVA 1AOJA 2B86A 2J06A 4HVVA 1KJWA 2PZ1A 2EYWA 2HEQA 4JZ4A 2DL5A 2MOXA 1UG1A 1GBRA 1UTIA 3FJ5A 1E7OA 2HSPA 1K0XA 2RN8A 1Y57A 2J6KA 4J9DA 1RLQC 3EG3A 5IXBA 2GNCA 5L23A 1YWPA 3REBB 1YWOA 4OMPA 5IHIA 2ROLA 1AWWA 3H41A 1U3OA 1GFCA 4RTVA 3NHNA 2O31A 2DE0X 2MIOA 2EYXA 4OMOA 2FPDA 2DF6A 1NEBA 1AZEA 2DLPA 3M0QA 4OMQA 1AEYA 1AWXA 3TVTA 1GRIA 2I0NA 3O5ZA 2DL7A 1RLPC 2YUPA 2ENMA 1OOTA 2KBTA 2W10A 1PNJA 2DNUA 1MUZA 1NG2A 2D0NA 1I0CA 1K76A 3UATA 3I35A 1HD3A 4JJDA 1ZBJA 2DRKA 1IO6A 1OV3A 3M0RA 3R6NA 1PHTA 4J9EA 3C0CA 3CQTA 1H8KA 2RQUA 2RNAA 1M3CA 2RQTA 4JZ3A 2L3QA 2RQRA 4OMLA 1I1JA 1QKXA 1X2QA 4K11A 2A28A 4RUGA 5IHKA 1G2BA 5IH2A 2F2XA 2FG0A 2CT4A 1NLOC 2KROA 2CT3A 2FO0A 1UUEA 1PWTA 1H92A 2GBQA 2O2OA 1WFWA 2EPDA 2JW4A 1SSHA 1SPKA 2DM1A 3VRYA 5FWBA 2MCNA 4JJCA 1W1FA 3VS3A 1OEBA 4LUEA 4LUDA 1CKBA 1QLYA 1G83A 2PTKA 1ABOA 1UHCA 2HBWA 3RNJA 4DEYA 2BZ8A 2RF0A 2P4RA 3EG0A 2EKHA 2O88A 1H3HA 2K79A 1WX6A 1SHGA 1GL5A 2KXCA 1JXMA 5FW9A 2LQWA 1S1NA 2DMOA 2OI3A 4AFQC 4HXJA 1KSWA 1A0NB 2FPEA 1UGVA 2CH4A 1ARKA 4RTZA 4D8KA 2JS0A 3UF4A 2D8HA 3JV3A 4AFSC 3VRZA 1GCQC 2SRCA 4CC4B 5IHNA 1NEGA 2KT8A 2GTOA 2YSQA 2JMAA 1Y0MA 2NWMA 3NGPA 1HJDA 1AZGB 2AZSA 1EFNA 1M27C 2KGTA 3VS6A 1KIKA 1VA7A 2LQNA 1U06A 1JO8A 1WLPB 2KE9A 2JT4A 1PKTA 1PRLC 1UDLA 1MV0B 1WA7A 2KRMA 1UE9A 1JU5C 2HCKA 4J9CA 5ECAA 4E6RA 1K9AA 2O9SA 2X3XD 1B07A 1BBZA 1QWFA 3TSWA 2KXDA 5EC7A 1K4US 2KRSA 4CC2A 2FRWA 4RTWA 4LE9A 2GTJA 2ED1A 3SHWA 4D8DA 1LCKA 1TUCA 4RTTA 1SEMA 2K3BA 3EG2A 2K2MA 2YDLA 3THKA 1AWOA 1VYTA 4DEXA 4ZNXA 1I07A 2L2PA 4ORZA 2FRYA 2SEMA 4FSSA 1ABQA 4GLMA 2RPNA 2A37A 2LJ1A 2XMFA 2JXBA 1ZSGA 1TUDA 4WCIA 1WXTA 3QWXX 2O9VA 1X43A 2YUQA 1E6HA 1AD5A 1BK2A 2KT1A 3VS2A 4CC3A 1T0HA 2EGEA 1AVZC 1QWEA 1XOVA 2F2VA 1NYFA 2D8JA 1X6BA 2KNBB 1QCFA 2V1QA 3VS0A 1UFFA 2F2WA 4JJBA 3UA6A 2CSQA 2VKNA 1GFDA 2BZXA 1SHFA 2EW3A 3GBQA 3NPFA 1W6XA 2JS2A 1X6GA 2LX7A 4J9BA 2L0AA 2YT6A 1WYXA 5I22A 2EBPA 1JQQA 1RUWA 2BZYA 2DL4A 1BU1A 2KEAA 1WXUA 2VVKA 3A98A 4LNPA 3EG1A 1WXBA 4KRTA 2AKKA 1VYVA 2A08A 2ED0A 1PKSA 1KFZA 5GJVB 3M0TA 1J3TA 1Z9ZA 3REAB 4HVUA 1WI7A 2GQIA 4HCKA 3H0HA 2EGCA 2YUOA 2EYYA 2YUNA 1ZLMA 2G6FX 1X69A 2AZVA 1X2KA 2FPFA 1T0JA 1YCSB 1ZUUA 3KFVA 1UHFA 4Y92A 1M30A 4Z8AA 3TSZA 1CKAA 1M8MA 2L3PA 1WIEA 4AFUC 1SRMA 1FYNA 4JPBW 1SRLA 4OMMA 2EQIA 3RBBB 4Z89A 1K1ZA 3PE0A 2FEIA 1ZUKA 2X3WD 2CDTA 3ULRB 3U23A 1V1CA 4QT7A 3I5SA 3IQLA 2RQWA 2DBKA 3M0UA 2ECZA 2DX1A 3LH5A 2GGRA 4Z88A 3QWYA 2VWFA 2DA9A 4F14A 1QKWA 2LMJA 2DL8A 1GBQA 1Z9QA 3UA7A 1UECA 2C0IA 1YP5A 1GCPA 5GJWB 4J9IA 2K6DA 2L3SA 3H0IA 4J9GA 1NYGA 4AFZC 2NUZA 1B3QA 2EYZA 1BB9A 2LJ3A 2PNIA 2LZ6B 2K7AA 2J6FA 1X27A 3VS5A 1JEGA 1M3AA 1AWJA 2AK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRN A;  4HVW A;  1MV3 A;  4M4Z A;  2QDL A;  5HCK A;  5IXF A;  3VS7 A;  2KYB A;  2DBM A;  3M0P A;  2EVR A;  2KYM A;  2OAW A;  2KR3 A;  2DIL A;  2E5K A;  2HDA A;  2DVJ A;  1VYU A;  1E6G A;  1RI9 A;  2H8H A;  2DRM A;  4EIK A;  1ZX6 A;  3EHQ A;  4RTU A;  4F16 A;  4CC7 A;  2CSI A;  4LN2 A;  1K0S A;  1HSQ A;  2LP5 A;  4GBQ A;  5I11 A;  1ZUY A;  3NMZ C;  4R0K A;  2EGA A;  2ABL A;  1UJ0 A;  1U5S A;  2JTE A;  1NM7 A;  2LJ0 A;  3SEM A;  2CUD A;  4IIM A;  1GCQ A;  3VS1 A;  3ZL7 C;  1T3L A;  3I5R A;  5FWC A;  2BTT A;  2ROT A;  3I9Q A;  1YNZ A;  2DL3 A;  1WDX A;  4X1V A;  4IIO A;  2ESW A;  1OPL A;  2A36 A;  4RTX A;  2LCS A;  2RMO A;  1YN8 A;  4AG1 C;  1T3S A;  2J7I A;  3PVQ A;  3H0F A;  4RTY A;  4A63 B;  2CUB A;  1CSK A;  2V1R A;  2OJ2 A;  2JM8 A;  4J9F A;  3VS4 A;  3PVL A;  4J9H A;  1W70 A;  2AKL A;  2C0T A;  2IIM A;  2J6O A;  1N5Z A;  1UJY A;  2CRE A;  3M0S A;  2K9G A;  1FMK A;  4F17 A;  2W0Z A;  2CH4 W;  1JXO A;  2DJQ A;  2J05 A;  4OMN A;  2LNH B;  2C0O A;  2JM9 A;  1TG0 A;  1PRM C;  2DYB A;  3EHR A;  3EGU A;  1OPK A;  2JMC A;  1NLP C;  1M3B A;  2M51 A;  4ESR A;  2D1X A;  4AG2 C;  2M0Y A;  2RQV A;  1AOJ A;  2B86 A;  2J06 A;  4HVV A;  1KJW A;  2PZ1 A;  2EYW A;  2HEQ A;  4JZ4 A;  2DL5 A;  2MOX A;  1UG1 A;  1GBR A;  1UTI A;  3FJ5 A;  1E7O A;  2HSP A;  1K0X A;  2RN8 A;  1Y57 A;  2J6K A;  4J9D A;  1RLQ C;  3EG3 A;  5IXB A;  2GNC A;  5L23 A;  1YWP A;  3REB B;  1YWO A;  4OMP A;  5IHI A;  2ROL A;  1AWW A;  3H41 A;  1U3O A;  1GFC A;  4RTV A;  3NHN A;  2O31 A;  2DE0 X;  2MIO A;  2EYX A;  4OMO A;  2FPD A;  2DF6 A;  1NEB A;  1AZE A;  2DLP A;  3M0Q A;  4OMQ A;  1AEY A;  1AWX A;  3TVT A;  1GRI A;  2I0N A;  3O5Z A;  2DL7 A;  1RLP C;  2YUP A;  2ENM A;  1OOT A;  2KBT A;  2W10 A;  1PNJ A;  2DNU A;  1MUZ A;  1NG2 A;  2D0N A;  1I0C A;  1K76 A;  3UAT A;  3I35 A;  1HD3 A;  4JJD A;  1ZBJ A;  2DRK A;  1IO6 A;  1OV3 A;  3M0R A;  3R6N A;  1PHT A;  4J9E A;  3C0C A;  3CQT A;  1H8K A;  2RQU A;  2RNA A;  1M3C A;  2RQT A;  4JZ3 A;  2L3Q A;  2RQR A;  4OML A;  1I1J A;  1QKX A;  1X2Q A;  4K11 A;  2A28 A;  4RUG A;  5IHK A;  1G2B A;  5IH2 A;  2F2X A;  2FG0 A;  2CT4 A;  1NLO C;  2KRO A;  2CT3 A;  2FO0 A;  1UUE A;  1PWT A;  1H92 A;  2GBQ A;  2O2O A;  1WFW A;  2EPD A;  2JW4 A;  1SSH A;  1SPK A;  2DM1 A;  3VRY A;  5FWB A;  2MCN A;  4JJC A;  1W1F A;  3VS3 A;  1OEB A;  4LUE A;  4LUD A;  1CKB A;  1QLY A;  1G83 A;  2PTK A;  1ABO A;  1UHC A;  2HBW A;  3RNJ A;  4DEY A;  2BZ8 A;  2RF0 A;  2P4R A;  3EG0 A;  2EKH A;  2O88 A;  1H3H A;  2K79 A;  1WX6 A;  1SHG A;  1GL5 A;  2KXC A;  1JXM A;  5FW9 A;  2LQW A;  1S1N A;  2DMO A;  2OI3 A;  4AFQ C;  4HXJ A;  1KSW A;  1A0N B;  2FPE A;  1UGV A;  2CH4 A;  1ARK A;  4RTZ A;  4D8K A;  2JS0 A;  3UF4 A;  2D8H A;  3JV3 A;  4AFS C;  3VRZ A;  1GCQ C;  2SRC A;  4CC4 B;  5IHN A;  1NEG A;  2KT8 A;  2GTO A;  2YSQ A;  2JMA A;  1Y0M A;  2NWM A;  3NGP A;  1HJD A;  1AZG B;  2AZS A;  1EFN A;  1M27 C;  2KGT A;  3VS6 A;  1KIK A;  1VA7 A;  2LQN A;  1U06 A;  1JO8 A;  1WLP B;  2KE9 A;  2JT4 A;  1PKT A;  1PRL C;  1UDL A;  1MV0 B;  1WA7 A;  2KRM A;  1UE9 A;  1JU5 C;  2HCK A;  4J9C A;  5ECA A;  4E6R A;  1K9A A;  2O9S A;  2X3X D;  1B07 A;  1BBZ A;  1QWF A;  3TSW A;  2KXD A;  5EC7 A;  1K4U S;  2KRS A;  4CC2 A;  2FRW A;  4RTW A;  4LE9 A;  2GTJ A;  2ED1 A;  3SHW A;  4D8D A;  1LCK A;  1TUC A;  4RTT A;  1SEM A;  2K3B A;  3EG2 A;  2K2M A;  2YDL A;  3THK A;  1AWO A;  1VYT A;  4DEX A;  4ZNX A;  1I07 A;  2L2P A;  4ORZ A;  2FRY A;  2SEM A;  4FSS A;  1ABQ A;  4GLM A;  2RPN A;  2A37 A;  2LJ1 A;  2XMF A;  2JXB A;  1ZSG A;  1TUD A;  4WCI A;  1WXT A;  3QWX X;  2O9V A;  1X43 A;  2YUQ A;  1E6H A;  1AD5 A;  1BK2 A;  2KT1 A;  3VS2 A;  4CC3 A;  1T0H A;  2EGE A;  1AVZ C;  1QWE A;  1XOV A;  2F2V A;  1NYF A;  2D8J A;  1X6B A;  2KNB B;  1QCF A;  2V1Q A;  3VS0 A;  1UFF A;  2F2W A;  4JJB A;  3UA6 A;  2CSQ A;  2VKN A;  1GFD A;  2BZX A;  1SHF A;  2EW3 A;  3GBQ A;  3NPF A;  1W6X A;  2JS2 A;  1X6G A;  2LX7 A;  4J9B A;  2L0A A;  2YT6 A;  1WYX A;  5I22 A;  2EBP A;  1JQQ A;  1RUW A;  2BZY A;  2DL4 A;  1BU1 A;  2KEA A;  1WXU A;  2VVK A;  3A98 A;  4LNP A;  3EG1 A;  1WXB A;  4KRT A;  2AKK A;  1VYV A;  2A08 A;  2ED0 A;  1PKS A;  1KFZ A;  5GJV B;  3M0T A;  1J3T A;  1Z9Z A;  3REA B;  4HVU A;  1WI7 A;  2GQI A;  4HCK A;  3H0H A;  2EGC A;  2YUO A;  2EYY A;  2YUN A;  1ZLM A;  2G6F X;  1X69 A;  2AZV A;  1X2K A;  2FPF A;  1T0J A;  1YCS B;  1ZUU A;  3KFV A;  1UHF A;  4Y92 A;  1M30 A;  4Z8A A;  3TSZ A;  1CKA A;  1M8M A;  2L3P A;  1WIE A;  4AFU C;  1SRM A;  1FYN A;  4JPB W;  1SRL A;  4OMM A;  2EQI A;  3RBB B;  4Z89 A;  1K1Z A;  3PE0 A;  2FEI A;  1ZUK A;  2X3W D;  2CDT A;  3ULR B;  3U23 A;  1V1C A;  4QT7 A;  3I5S A;  3IQL A;  2RQW A;  2DBK A;  3M0U A;  2ECZ A;  2DX1 A;  3LH5 A;  2GGR A;  4Z88 A;  3QWY A;  2VWF A;  2DA9 A;  4F14 A;  1QKW A;  2LMJ A;  2DL8 A;  1GBQ A;  1Z9Q A;  3UA7 A;  1UEC A;  2C0I A;  1YP5 A;  1GCP A;  5GJW B;  4J9I A;  2K6D A;  2L3S A;  3H0I A;  4J9G A;  1NYG A;  4AFZ C;  2NUZ A;  1B3Q A;  2EYZ A;  1BB9 A;  2LJ3 A;  2PNI A;  2LZ6 B;  2K7A A;  2J6F A;  1X27 A;  3VS5 A;  1JEG A;  1M3A A;  1AWJ A;  2AK5 A; 
#chains in the Genus database with same CATH topology
 4M4Z A;  5LJ3 e;  5HCK A;  2V8J A;  5IXF A;  3VS7 A;  4RG2 A;  2KYM A;  4J6W A;  3PTA A;  2E5K A;  3RKW A;  3OYM A;  1VYU A;  2H8H A;  3TRE A;  4BDY A;  5CVI A;  2COZ A;  2DRM A;  2K57 A;  5AYF A;  5GAO n;  3OBY A;  4RTU A;  4F16 A;  1Q81 U;  1M1F A;  4JUV A;  4LN2 A;  2LP5 A;  3L2Z A;  5LJ3 j;  1H64 1;  5GAO q;  5I11 A;  4FYX B;  1ZUY A;  4HT8 A;  2EGA A;  1UJ0 A;  1U5S A;  1XJW B;  1NM7 A;  1QVG P;  2CUD A;  1NE8 A;  2Y4X A;  4OB2 B;  1GCQ A;  3VJP A;  1QCN A;  4EMK B;  3INZ A;  3TCJ A;  3MEW A;  1MMG A;  4MML A;  4F7U A;  1S72 A;  1Q7Y C;  5GMK l;  3I9Q A;  2LQ8 A;  4FL6 A;  1KC8 C;  1WDX A;  4BE1 A;  1PG5 B;  4M75 F;  3OW2 A;  2XK0 A;  5LJ5 g;  4E7K A;  1YN8 A;  4XQ3 A;  4AG1 C;  1T3S A;  3A8O B;  1VQ4 Q;  4LD9 K;  4A63 B;  2CUB A;  2DKG A;  1D3B B;  2KY9 A;  1BCM A;  1YJW T;  4J7I A;  1M2O A;  3PGG A;  3PVL A;  3CCE A;  2QQ9 A;  4C8Q A;  4DBQ A;  4KGX B;  4LDV A;  6AT1 B;  2RK2 A;  4MMK A;  5A2Q E;  3M0S A;  4V2S A;  4C0Z A;  4M7D B;  1TWB A;  2DJQ A;  4PJO D;  1YIJ A;  4Z02 A;  1WZO A;  2XKO C;  2EKO A;  4IUP A;  4KH1 B;  3EHR A;  5KYW A;  3X24 B;  1N9S A;  4NOY A;  4ESR A;  4M78 A;  4M7A G;  1QP2 A;  3NFC A;  3HRT A;  4PJJ A;  1Q7Y U;  3KBG A;  5LJ5 e;  2J06 A;  3G1J A;  2HL3 A;  2CYZ B;  3FLG A;  1UG1 A;  1GBR A;  3HTR A;  1KG1 A;  2DEQ A;  1RAA B;  2K3Y A;  3FJ5 A;  3HL8 A;  3DB4 A;  3N5B B;  4XTV A;  3OYH A;  2E41 A;  1Y96 A;  4J9D A;  5FRO A;  1RLQ C;  3CCJ Q;  3REB B;  1YWO A;  4OMP A;  5IHI A;  2ROL A;  3H41 A;  3HHT B;  1Q86 U;  2EYX A;  1ZA2 B;  8ATC B;  2LTO A;  3VU3 C;  1AZE A;  3M0Q A;  1RAI B;  1YJ9 T;  3CCS A;  4O6J A;  1VQ6 T;  2LVM A;  1G3S A;  2I0N A;  3G6E Q;  4HKE A;  2ENM A;  1OOT A;  2COY A;  4B9X A;  3TEE A;  3CCS T;  1ZBJ A;  1OV3 A;  1YI2 T;  4CI0 C;  4C0F A;  2QEX Q;  3CQT A;  2RNA A;  2QDY B;  4JZ3 A;  1IGU A;  2RQR A;  3LGL A;  1VQ7 Q;  1I1J A;  1F1B B;  1WHK A;  2VGM A;  2NUP A;  5IH2 A;  2F2X A;  1RL2 A;  3JCM W;  1OZ3 A;  1G3T A;  2KRO A;  2L3R A;  4NL2 A;  3OBW A;  1H92 A;  4C0G A;  1QVF A;  1SPK A;  2DFU A;  2DM1 A;  2EFI A;  5FWB A;  4N4G A;  5GAO p;  2RO0 A;  2H3E B;  5D7U A;  4O5V A;  1G83 A;  2JOY A;  1ABO A;  1YI2 Q;  4DEY A;  1BI1 A;  4X9D A;  2LC4 A;  2JVV A;  4M77 E;  3PFS A;  2YRV A;  3MO8 A;  1LJO A;  1QVG A;  1WHJ A;  4RCC A;  4D8K A;  2M9U A;  5GAM f;  3EGX A;  4M7A B;  4C5G A;  1QP3 A;  2PVO B;  3L2V A;  5IHN A;  2M02 A;  1QCO A;  2GTO A;  1TTH B;  2JMA A;  2QQS A;  2L5Q A;  1TOV A;  1AZG B;  3EGX B;  3VS6 A;  1Y7X A;  1QVF S;  2EAY A;  1X6O A;  2XDB A;  2HCK A;  4OB1 B;  5ECA A;  4PNO A;  3HPW A;  5GAM h;  3OMG A;  4JJN K;  2VV5 A;  3CCV A;  3DLL A;  1B07 A;  1QMC A;  1BBZ A;  1WHG A;  2KXD A;  5EC7 A;  4JS5 A;  5IN1 A;  3QKJ A;  1RI0 A;  3M58 A;  3I56 T;  3HRU A;  3LWH A;  2BE7 D;  4ZN3 A;  1G5V A;  1KQ2 A;  1OX8 A;  2MMP A;  3G7Z A;  1TUC A;  2BUD A;  4XU1 A;  2COW A;  1VQ5 T;  1R0C B;  2VUB A;  3M54 A;  4DEX A;  3PIO A;  1VQO T;  4M75 G;  4GLM A;  4BI8 B;  3RIR A;  1K73 R;  2CP6 A;  4ME7 A;  1WQ7 A;  1AD5 A;  1YJ9 Q;  3CC4 Q;  3VS2 A;  1S72 Q;  3C95 A;  3RMQ A;  1XOV A;  1RAF B;  1NYF A;  2KNB B;  1QCF A;  4OB3 B;  2FHD A;  3OB9 A;  4ZGJ B;  2V1Q A;  3MJX A;  3UA6 A;  2CSQ A;  3WXM B;  4WF2 A;  3C4S A;  5GAN j;  1W6X A;  3SWN A;  3CCE Q;  3CCU Q;  4J9B A;  4LDU A;  3TU4 K;  1I81 A;  5CKB A;  2JZ2 A;  3JCM c;  1IGQ A;  3CC4 T;  2X9H A;  3A98 A;  3I55 T;  3JB9 G;  2RHI A;  4KRT A;  4C8Q E;  4F7U B;  5GAO l;  5GJV B;  2AIR B;  2GQV A;  3FC3 A;  2CKK A;  1J3T A;  4KGV B;  1DJ7 B;  3REA B;  3A8L B;  2WSC E;  4GLK A;  3JRZ A;  5FLX E;  4OB0 B;  1ZLM A;  2AZV A;  2RK1 A;  2QA4 A;  4M7A D;  3A8G B;  1X2K A;  5LJ3 h;  1O75 A;  4C92 F;  1WJS A;  3JB9 F;  1T0J A;  4M7D A;  4KBM B;  5KYY A;  2E6Z A;  3KFV A;  3G71 Q;  4Y92 A;  3JCM e;  3GF5 A;  3SFM A;  3TSZ A;  1M1K R;  1U8R A;  2X4W A;  8AT1 B;  2QA4 T;  3SWN C;  3OSS C;  1SRM A;  3A8M B;  2EQK A;  3JCM X;  3Q1J A;  1PD1 A;  3JCM d;  4M75 C;  3CCS Q;  3D7S B;  1D1A A;  1Q82 U;  1VQL Q;  1WHL A;  2CDT A;  2CZ0 B;  4M78 D;  4HCC A;  4QW2 A;  1V1C A;  2F5T X;  4QT7 A;  3I5S A;  2KK4 A;  3IQL A;  3DLM A;  2MPX C;  5DM7 R;  1VQ9 A;  1IZ6 A;  4LDW A;  2M16 A;  1KD1 U;  4L6V 5;  1MND A;  2VWF A;  4XTY A;  4EMK A;  3UA7 A;  2DL8 A;  1GBQ A;  2QEX A;  4C92 B;  3CC2 A;  4OGC A;  4C8Q D;  2PU9 B;  4E7H A;  2K6D A;  3S6W A;  3PMI A;  5CQX A;  2NUZ A;  2QTX A;  3GP8 A;  2KAF A;  4RMO A;  2EYZ A;  1U1S A;  2K7A A;  1JEG A;  1M3A A;  2KRN A;  3CCM Q;  2QDL A;  3OSV A;  2EQU A;  4M75 A;  2KYB A;  3PIP A;  4QKU A;  3SD4 A;  2OAW A;  5I2S A;  2KR3 A;  3P8D A;  5DLO A;  2HDA A;  1M1K C;  2P0Q A;  3QO3 A;  1OI1 A;  1VQK A;  2VYT A;  4J7F A;  2LRQ A;  4CC7 A;  3M57 A;  2MWP A;  4GBQ A;  1FX7 A;  1RAB B;  3CXC S;  4R0K A;  4FM4 B;  1KC8 R;  1TXQ A;  2QTV A;  4BUG A;  3VUB A;  3J7A F;  1ACM B;  1T3L A;  4XU3 A;  3JCM Q;  1X75 C;  3ASK A;  2FZG B;  5LJ3 d;  2BTT A;  4LDX A;  1VUB A;  1KQ1 A;  1OPL A;  4M75 D;  1VQ4 A;  4RTX A;  2LCS A;  3UWN A;  1M4Z A;  2X4X A;  2J7I A;  3PVQ A;  5GAN 4;  3FJP A;  1CSK A;  2JUF A;  3RER A;  1U1T A;  2D9T A;  1TUG B;  4FW1 A;  4J9F A;  1Q86 R;  2HL5 C;  4J9H A;  2NUT B;  4HCB A;  3E2U A;  2AKL A;  3SB2 A;  2PVD B;  3OMC A;  1JBM A;  3BW1 A;  3CCV Q;  2DPP B;  2L8D A;  4FIB A;  5KYN A;  1KQS A;  3CMA A;  2CRE A;  4PJO B;  1YIJ Q;  4HT9 A;  1FMK A;  2CH4 W;  4PJO F;  1NJI C;  1VQ6 A;  2J05 A;  4OMN A;  3MP1 A;  2DYB A;  1UGP B;  1N9R A;  1OPK A;  4XU2 A;  4C92 G;  1S72 T;  2M51 A;  2X4J A;  5HK3 A;  4UC4 A;  3F70 A;  2RQV A;  1YCY A;  3JCM V;  5D6X A;  1AOJ A;  3G4S Q;  1C0M A;  2EYW A;  4JZ4 A;  2DL5 A;  3M4Y A;  4E2F B;  3OYC A;  3OW2 S;  3LGF A;  1YIJ T;  2J6K A;  1TS9 A;  3S3N A;  2E3H A;  3RKX A;  1WHM A;  3FEO A;  3CCU T;  3VYG A;  4FYY B;  3WVE B;  5KYX B;  2Z0W A;  3MCA B;  4PJO E;  3AT1 B;  3NHN A;  2O31 A;  4FSX A;  3QBY A;  4IUQ A;  4QQ6 A;  2FPD A;  4XTX A;  1VQM Q;  3G6E A;  2DLP A;  3JAM E;  1AWX A;  1KQS S;  4KUD K;  4X34 A;  2IVW A;  4J83 A;  5A0L A;  4RKU E;  3OYB A;  2RJF A;  1RLP C;  2KBT A;  2W10 A;  1M5Q 1;  3MP8 A;  5KH6 A;  3NTH A;  1MUZ A;  1NG2 A;  1I0C A;  1WQW A;  4XAX B;  2DRK A;  3HKS A;  1IO6 A;  4QQG A;  3R6N A;  3CC7 T;  1PHT A;  4J9E A;  3WVD B;  4PLI A;  1H8K A;  2RQU A;  2FVU A;  1M3C A;  2RQT A;  2JJ9 A;  1M8V A;  4OML A;  1QKX A;  3H6Z A;  4MZM A;  5IHK A;  1QVP A;  1G2B A;  3E9F A;  2FG0 A;  1NLO C;  5EG2 A;  1VQP A;  1UUE A;  2FZC B;  1PWT A;  1UGR B;  2EPD A;  3H9N A;  1K9M U;  1SSH A;  2A7Y A;  2L89 A;  3PNW C;  2MCN A;  4JJC A;  3CPW S;  1OU9 A;  5HK0 A;  1VQ8 A;  3RKY A;  2AHJ B;  4PJL A;  1MMN A;  2HSE B;  2DEU A;  2HQX A;  2LCL A;  2P4R A;  2RA2 A;  3CBO A;  2EKH A;  2O88 A;  1SHG A;  2O4X A;  2O01 E;  1JXM A;  3CD6 Q;  2LQW A;  1S1N A;  2OI3 A;  1BIA A;  4OMF B;  2WSE E;  1A0N B;  2FPE A;  1UGV A;  3JCM b;  4RTZ A;  2ZPG B;  2R5A A;  2K5L A;  3UF4 A;  4M78 E;  1GCQ C;  4AT1 B;  4CC4 B;  1H3Z A;  5LL6 S;  2PUK B;  2KT8 A;  3QJY A;  2NLU A;  3OW2 P;  2CS7 A;  2RJD A;  2AZS A;  1EFN A;  1YJN A;  1UGQ B;  3EFR A;  4P5N A;  1IB8 A;  3EH1 A;  5GAN 6;  1WLP B;  1PRL C;  5KE2 A;  4KUI A;  4PJO A;  4N4H A;  2XG8 D;  2ZCF B;  4J9C A;  3DKM A;  1ZSZ B;  1JJ2 P;  2DTI A;  1M2V A;  2O9S A;  5LJ5 h;  1QWF A;  3TSW A;  3CCL A;  2MI6 A;  3EFO A;  5CKH A;  4CC2 A;  3M4G A;  2GTJ A;  2ED1 A;  1VQP T;  3SHW A;  5KCO A;  5FU6 B;  3I56 Q;  5GAO r;  4IKF A;  2YLB A;  2K2M A;  2VXE A;  2YDL A;  2EYQ A;  1AWO A;  4ZNX A;  3MET A;  1I07 A;  4ORZ A;  2SEM A;  1ABQ A;  4OF1 A;  2RPN A;  2A37 A;  4ZN1 A;  2OAU A;  1ZSG A;  1TUD A;  4PJO C;  3QWX X;  2O9V A;  3H8Z A;  2DXU A;  4MZT A;  4L5G A;  2KT1 A;  1D3B A;  4N0A A;  1AVZ C;  2ZPH B;  4BAC A;  1QWE A;  2LNV A;  2ATC B;  1OYX A;  2D8J A;  1IRE B;  2K3X A;  1B34 A;  2GFA A;  2XDD A;  1QW1 A;  4M75 E;  5KYW B;  2F2W A;  2ZPI B;  4JJB A;  1QQJ A;  3CXC P;  3CCQ Q;  3RDV A;  3QZ9 B;  4DA4 A;  3QDF A;  2CP3 A;  2EW3 A;  4C0D B;  5GAN 7;  5CK9 A;  4BDZ A;  1X6G A;  2R57 A;  4KH0 B;  1BI2 A;  2L0A A;  2YT6 A;  3BE3 A;  5I22 A;  1AT1 B;  3GNG A;  3QYH B;  1RAC B;  2DL4 A;  3FDR A;  2QQA A;  3EG1 A;  2AKK A;  5GAO m;  1R0B G;  1TH7 A;  2GCX A;  1PKS A;  1VQ6 Q;  1W2B A;  2QYZ A;  4ANJ A;  1YBY A;  2OTJ A;  2ZAE A;  1Z9Z A;  3X26 B;  1VQ9 T;  1D1B A;  1JRI A;  1VIF A;  3OS1 A;  2YUO A;  4A4E A;  2EYY A;  2YUN A;  4N0A C;  3RMS A;  2G6F X;  2OTJ T;  1X69 A;  3OYE A;  3OYF A;  1RAH B;  2CP0 A;  4M7A F;  3G71 A;  2V26 A;  4C92 D;  4CRI A;  2FPF A;  1JB0 E;  1YHQ Q;  1K8A C;  2G3R A;  2V8I A;  1ZUU A;  3UT1 A;  2GF7 A;  3QUI A;  2IPO B;  3P8H A;  1M8M A;  2EQM A;  1WIE A;  2ZPF B;  3JSC A;  3CCJ A;  1FYN A;  4JPB W;  2RI3 A;  4OMM A;  1N8R C;  1K1Z A;  4KUL A;  5IT9 E;  1Y71 A;  1VQL T;  4E7J A;  3E1S A;  1PSE A;  3CCJ T;  3QII A;  2KMT A;  2RB6 A;  2RM4 A;  3OA6 A;  1ZSZ A;  3L42 A;  4E7S A;  2RQW A;  1TSF A;  3BFM A;  2RD1 A;  3EFO B;  3CPF A;  4PLL A;  2M1H A;  2DX1 A;  1QKW A;  1G8X A;  1PM3 A;  4ZGD B;  5GJW B;  4C8Q F;  2K4Y A;  3H0I A;  4J9G A;  1NYG A;  1M9S A;  4X9C A;  1VQK T;  4AFZ C;  3CCM A;  3X20 B;  3OYJ A;  1C6V X;  2LJ3 A;  1VQP Q;  1X27 A;  5FU6 C;  3VS5 A;  5GAN h;  3SWN B;  2K2V A;  2X51 A;  4OVA A;  2DBM A;  3M0P A;  2JTM A;  2EVR A;  1G3W A;  4JDS A;  2DVJ A;  1E6G A;  1RI9 A;  2XHC A;  4EMH A;  4EIK A;  3EHQ A;  2OTL T;  3OYN A;  2KDS A;  4J8O A;  3OYL A;  4JS4 A;  1HSQ A;  3CMA T;  3BY7 A;  4PJN A;  1C1A A;  3NMZ C;  1NJI R;  4DBH A;  1P92 A;  1WPY A;  1PD0 A;  1YJW Q;  3R6O A;  3X28 B;  4ELZ C;  2QG9 B;  3VS1 A;  3PMT A;  2XI9 A;  2XID A;  1LOJ A;  2R5M A;  5CIU A;  4A4F A;  2ROT A;  1IHV A;  1YNZ A;  2IG0 A;  4X1V A;  4IIO A;  2ESW A;  2QQR A;  2DK3 A;  1BI3 A;  3VV0 A;  4M77 C;  3RUX A;  2HKQ B;  1KC8 U;  1RAG B;  4PL6 A;  1R77 A;  4RTY A;  5GAN e;  4Y91 A;  1TU0 B;  2V1R A;  2OJ2 A;  1QVF P;  3LX7 A;  2P0K A;  3VS4 A;  4PK4 A;  1W70 A;  1FXX A;  3QYG B;  5IAY A;  2DXB A;  3CCR Q;  1UJY A;  3OYG A;  2MWO A;  4J6X A;  2K9G A;  3CCL Q;  2W0Z A;  1Q81 C;  1JXO A;  3M5A A;  2DD4 A;  1D0Z A;  2JM9 A;  1N8R U;  2DZ9 A;  3CC2 Q;  2B8A A;  2Y4Y A;  1PRM C;  2LX9 A;  3MKD A;  4QVD A;  4J5Y A;  3EGU A;  2JMC A;  1NLP C;  1M3B A;  2DJZ A;  5GAN g;  3G4S T;  2D1X A;  1V29 B;  4AG2 C;  2E12 A;  2B86 A;  5I21 A;  4E7L A;  4HVV A;  4KT0 E;  1RAD B;  4TVR A;  1UTI A;  2YLC A;  4M77 A;  1VQ5 Q;  1K0X A;  2M0O A;  4M7D C;  1I4K 1;  5L23 A;  3X25 B;  4QQD A;  4B9W A;  1Q86 C;  4PJM A;  1YJ9 A;  1W2B P;  1AWW A;  3GPL A;  3EG9 A;  1GFC A;  4RTV A;  2DE0 X;  4OMO A;  1ZA1 B;  1NEB A;  1WHH A;  3HRS A;  2A3L A;  4JRK A;  1EX4 A;  4L59 A;  3TVT A;  3HSB A;  2DAQ A;  4DOW A;  2EIF A;  5A0G A;  4EPC A;  2DL7 A;  4M75 B;  3FB9 A;  3NTK A;  1MGQ A;  1PNJ A;  2DNU A;  2D0N A;  1K76 A;  3UAT A;  3I35 A;  1HD3 A;  2HMA A;  3MEV A;  2QAZ A;  2BIV A;  3M0R A;  3L2R A;  3JB9 I;  1VQN A;  2OTJ Q;  5LJ3 f;  3OYI A;  1IRX A;  4JRI A;  2L3Q A;  2E10 A;  4EMK C;  1YIT A;  3P8B B;  2A28 A;  2FO0 A;  1D0Y A;  1GXI E;  2O2O A;  1WFW A;  2QXF A;  3S3O A;  3VRY A;  2CZ1 B;  3VS3 A;  2C06 A;  4LUE A;  2OTL Q;  1ZQ1 A;  2PTK A;  3M9Q A;  2F5K A;  3RNJ A;  4BB7 A;  1IHW A;  2BZ8 A;  3LH0 A;  2E4H A;  3EG0 A;  3G4S A;  1GL5 A;  1VQ7 T;  2KXC A;  4DBR A;  3OS5 A;  4F04 B;  5GMK e;  5FW9 A;  3EGD A;  2DMO A;  1K73 U;  3QJ6 A;  2RI2 A;  2VAS A;  1NPR A;  2K5F A;  2CH4 A;  2JTF A;  3L2W A;  2ZGW A;  1VQ8 T;  2JS0 A;  2D8H A;  4FCY A;  4AFS C;  3L2Q A;  4GY5 A;  3ER0 A;  4DQ2 A;  2SRC A;  1KHC A;  4PFP A;  1NEG A;  4BE0 A;  3MEU A;  1MNE A;  3LW5 E;  4R56 A;  1YJN Q;  2QI2 A;  2NWM A;  1HJD A;  2LCC A;  2KGT A;  3MPU B;  1KIK A;  1VA7 A;  2LQN A;  4M78 C;  1KHI A;  3CPW A;  1JO8 A;  2JT4 A;  1UDL A;  1MV0 B;  1WA7 A;  2KRM A;  1UE9 A;  1UB4 A;  1SF9 A;  1YI2 A;  1JU5 C;  2DIQ A;  3V7S A;  3JCM h;  1K9A A;  2FB7 A;  1I8F A;  1MMA A;  1N6A A;  4Y28 E;  4II1 A;  2LDM A;  4F7U E;  1YIT T;  3CEY A;  3GLX A;  4OP0 A;  2XD0 A;  2FRW A;  4RTW A;  1BIB A;  4LE9 A;  1I5O B;  5GAN 8;  2I2L A;  4RTT A;  1SEM A;  2K3B A;  2WAC A;  4Q5W A;  3EG2 A;  4M7A E;  2ZPB B;  1MHN A;  2L2P A;  3EAE A;  4J6Y A;  4FSS A;  1OQK A;  2DXC A;  1XNI A;  5FU7 B;  2LJ1 A;  2JXB A;  4ELY C;  1X43 A;  4PFO A;  1E6H A;  2YUQ A;  1JJ2 A;  1BK2 A;  1VQO A;  4MDW A;  1O9S A;  2F2V A;  3TQ7 P;  4B6M A;  2HQH A;  4RCB A;  3CCQ A;  4M7A C;  3VS0 A;  1UFF A;  1FMW A;  4M7D F;  2QEX T;  3S3M A;  2BZX A;  1SHF A;  1MMD A;  3CBP A;  1WGS A;  2JN0 A;  3GBQ A;  3NPF A;  2JS2 A;  2RH2 A;  1WYX A;  5C0M A;  4BI4 A;  1JQQ A;  2WSF E;  1BU1 A;  2KEA A;  4LNP A;  2VVK A;  3G71 T;  1WXB A;  1KD1 C;  1VYV A;  5CKD A;  2ED0 A;  3EG9 B;  3HP9 A;  1Q7Y R;  1ZSZ C;  1VQ9 Q;  2VGN A;  4A4G A;  7AT1 B;  2O4X B;  3M0T A;  3LLR A;  4M7D G;  3CCV T;  4WTO B;  1K9M R;  2ZZD A;  4FYV B;  4QVC A;  4XK8 E;  1WI7 A;  2GQI A;  2P84 A;  4HCK A;  3H0H A;  1OX9 A;  2EGC A;  4XTU A;  4LXC A;  1I5L A;  1JJ2 S;  2PQW A;  2E64 A;  2H3J A;  2LT1 A;  5LJ5 j;  1QVG S;  1N27 A;  1VQ5 A;  1UHF A;  3O8V A;  3PT9 A;  5GAM e;  1M30 A;  4Z8A A;  4A4K A;  3OY9 A;  2L3P A;  1BI0 A;  1HYO A;  5GAN 3;  4M77 F;  5GAN 5;  2PUO B;  4RG8 A;  4Z89 A;  5LJ5 f;  4BY6 C;  3PE0 A;  2FEI A;  3GIB A;  1ZUK A;  3NTI A;  2MF2 A;  3M59 A;  3ULR B;  2D0Q B;  2DO3 A;  3U23 A;  1KQS P;  2DTH A;  2RI5 A;  3AHU A;  3JCM J;  5CR2 A;  1Q82 C;  3CCM T;  5GMK h;  3HFO A;  3CD6 T;  3M0U A;  2CZ7 B;  2GGR A;  3QDR B;  3KUF A;  4FU6 A;  2E1H A;  4IUT A;  2NUP B;  2LMJ A;  1UEC A;  1OUL A;  2QK0 A;  1V76 A;  4FT2 A;  2VXF A;  3C12 A;  2RJC A;  1W4S A;  3T9N A;  1B3Q A;  3CC7 Q;  3OYD A;  4M78 G;  2OTL A;  2X35 A;  2PNI A;  3KXT A;  2LZ6 B;  4M7A A;  3UDC A;  5J3B A;  1AWJ A;  2AK5 A;  2KVQ G;  4HVW A;  1MV3 A;  3RR6 A;  1Q81 R;  2NYS A;  5CKF A;  5CCA A;  1X01 A;  1VQ8 Q;  2DIL A;  1OZ2 A;  2A0F B;  1AHJ B;  1ZBX A;  1ZHI A;  4EDU A;  1YHQ A;  1ZX6 A;  1LNX A;  1UEB A;  2CSI A;  5DLQ E;  3JCM P;  1K0S A;  4KGZ B;  3VYH B;  2EWN A;  4DOV A;  2ABL A;  1FMV A;  3HFN A;  2JTE A;  2LJ0 A;  4FYW B;  4NL3 A;  4JLG A;  3SEM A;  1BKB A;  4IIM A;  1K9M C;  4BD3 A;  4E7Z A;  2HAX A;  3V7R A;  3ZL7 C;  3M55 A;  4R55 A;  3EFS A;  3I5R A;  5FWC A;  1LVK A;  1NZ9 A;  4MZP A;  5I2M A;  2DL3 A;  5GMK m;  4DBF A;  2QGG A;  4C8Q G;  2A36 A;  1PC0 A;  2P4T A;  2RMO A;  1VIE A;  4IUU A;  2BKD N;  3H0F A;  4EMG A;  4A4H A;  2XDP A;  5CQY A;  5CAI A;  1VQ4 T;  1W2B S;  2JM8 A;  4LD6 A;  5FRM A;  4M78 B;  3CME A;  2E6N A;  5DY9 A;  3CCR T;  2IIM A;  2C0T A;  1BYM A;  2XIC A;  4ATO A;  3QG1 A;  2J6O A;  1B34 B;  1N5Z A;  2OX7 A;  2EJF A;  2P0P A;  2CP7 A;  3ZFJ A;  2K5I A;  4F17 A;  3CME T;  5KCH A;  1D1C A;  2RJE A;  2LNH B;  2YRD A;  2C0O A;  2VC8 A;  2EQJ A;  1TG0 A;  1WJR A;  2YXY A;  3OS2 A;  4JRQ A;  2GFU A;  1Y96 B;  4C8Q B;  3OQ5 A;  5J26 A;  3ZEH A;  1VQM T;  3J81 E;  2M0Y A;  4BY6 B;  2QA4 Q;  1KJW A;  2PZ1 A;  2HEQ A;  2MOX A;  1K8A U;  1N8R R;  2HNI A;  1E7O A;  4ZTF A;  2JNG A;  2HSP A;  2RN8 A;  1Y57 A;  3EG3 A;  5IXB A;  2GNC A;  2XU8 A;  5D6W A;  1YWP A;  1EIF A;  3E19 A;  5GAN f;  4XTW A;  3URG A;  3CCE T;  4FW2 A;  4C92 A;  2HZY A;  1BCO A;  1U3O A;  2KQW A;  3QXE B;  2MYS A;  2MIO A;  5LJ3 g;  3I55 Q;  3FIF A;  1D09 B;  2DF6 A;  3A8H B;  4OMQ A;  1AEY A;  4BE2 A;  4A53 A;  3QSU A;  1GRI A;  3O5Z A;  2AT1 B;  2YUP A;  4C92 E;  1XTD A;  4IUR A;  1LPL A;  3G6E T;  2DIG A;  4JJD A;  2RHZ A;  1K8A R;  2E70 A;  3QZ5 B;  3C0C A;  1UGS B;  4D6W A;  2CP2 A;  4VUB A;  1X2Q A;  2V8K A;  3CCR A;  4K11 A;  4RUG A;  1VQ7 A;  2CT4 A;  2EJ9 A;  2CT3 A;  2DER A;  2GBQ A;  4M77 G;  4C92 C;  2JW4 A;  1W1F A;  5CKE A;  3LWI A;  1OEB A;  3VKI A;  4LUD A;  3C94 A;  1CKB A;  1QLY A;  5D6Y A;  1VQN T;  4PFZ A;  2DYI A;  1UHC A;  2HBW A;  4AMC A;  2RF0 A;  1Q82 R;  1VQK Q;  5FU7 C;  2R58 A;  1VQM A;  1H3H A;  1M2V B;  2K79 A;  1WX6 A;  4HA8 A;  2HD0 A;  2DTO A;  5AT1 B;  3OYA A;  3V7C A;  3OS0 A;  4AFQ C;  2FZK B;  4HXJ A;  1KSW A;  3BDL A;  2DZC A;  4XU0 A;  5A0D A;  2FYK A;  4MDX A;  1NPP A;  5GAN d;  3I56 A;  1ARK A;  2E5Q A;  1KD1 R;  2DET A;  3JCM f;  3JV3 A;  1B7T A;  1M90 R;  3VRZ A;  3CCU A;  3MP6 A;  3SDZ A;  1YJN T;  3UPU A;  1HXD A;  2YSQ A;  1NJI U;  2E3I A;  3EGD B;  3OYY A;  2LT4 A;  1Y0M A;  3NGP A;  1M27 C;  5GMK i;  1D0X A;  2X4Y A;  1U06 A;  2KE9 A;  1PKT A;  1SKU B;  4YTL A;  3GOX A;  2ZPE B;  3CC7 A;  4E6R A;  4M77 B;  1SSF A;  3FRN A;  1YIT Q;  5FRN A;  3QHS A;  2X3X D;  1WNL A;  2E65 A;  5KYY B;  4OGE A;  3CPW P;  1K4U S;  2KRS A;  1XQH A;  2LQK A;  2DD5 A;  2DVE A;  2RHY A;  2YRC A;  1G3Y A;  4N4I A;  4D8D A;  1LCK A;  4C5E A;  2Y90 A;  3THK A;  4FT4 A;  4C8Q C;  1VYT A;  3CCQ T;  3M56 A;  2FRY A;  2CGH A;  2MAM A;  3L1A A;  5L8R E;  5GMK j;  1VQO Q;  2XMF A;  3JB9 H;  4WCI A;  5GAN 2;  4BI3 A;  1WXT A;  3EH2 A;  2VB6 A;  4HCZ A;  2HBP A;  4CC3 A;  3JB9 J;  1T0H A;  2EGE A;  1Y07 A;  9ATC B;  3CC4 A;  5GAM j;  1X6B A;  3J80 E;  5KYU B;  4C5H A;  2QGF B;  1KK7 A;  1Q95 G;  3CBM A;  2KI7 A;  2NUT A;  3CME Q;  2QAS A;  1HK9 A;  2VKN A;  4JRP A;  4M7D D;  1GFD A;  5M9O A;  5KE3 A;  2RHX A;  3GNF B;  2CZ6 B;  3RES A;  2LX7 A;  1OU8 A;  1M1G A;  2EBP A;  1RUW A;  2BZY A;  3ME9 A;  3M53 A;  4LDY A;  1VOM A;  3V8L A;  1WXU A;  5J39 A;  3VUZ A;  4F7U F;  2FL7 A;  2BE9 B;  2RHU A;  2A08 A;  2D6F A;  5KYX A;  1KFZ A;  2YWW A;  4C5I A;  4XTZ A;  1M90 U;  4PJO G;  3MEA A;  4HVU A;  5GAM g;  1M1K U;  3CCL T;  5CO7 A;  3ZBD A;  4A54 A;  5GAM d;  5KYU A;  2YHT A;  3A1P A;  3CC2 T;  3BDU A;  1RAE B;  2QQB A;  4ZGE B;  3JB9 D;  4PKC C;  4IUV A;  1YCS B;  2F1L A;  4M7D E;  5HY6 A;  1CKA A;  1EZZ B;  3E9G A;  2EJG A;  3OYK A;  3CD6 A;  4AFU C;  1IXD A;  3L2U A;  4M77 D;  1SRL A;  2EQI A;  3RBB B;  1SG5 A;  3A5Z B;  2F69 A;  4JLI A;  5LJ5 d;  2X3W D;  3I55 A;  4E47 A;  3V8K A;  4ZTJ A;  3V8J A;  4M78 F;  1PCX A;  4QVZ A;  2KSS A;  1PSF A;  1VQL A;  1YFN A;  3LYI A;  2HKN A;  2DBK A;  1YHQ T;  5C6S A;  2DXT A;  3CXC A;  1NBE B;  1FWZ A;  3MHX A;  2ECZ A;  1WJQ A;  3LH5 A;  4F7U G;  1M90 C;  1R8O B;  1YJW A;  4Z88 A;  3QWY A;  2DA9 A;  4F14 A;  5HKC A;  1Z9Q A;  2C0I A;  3DB3 A;  1YP5 A;  1VQN Q;  1GCP A;  2MK5 A;  4J9I A;  3JCM g;  4C0D C;  2HQE A;  2L3S A;  3QPH A;  3CMA Q;  1BB9 A;  4NS5 A;  2J6F A;  2PVG B;  4E7I A;  1K73 C;  2CP5 A; 
#chains in the Genus database with same CATH homology
 2KRN A;  4HVW A;  1MV3 A;  4M4Z A;  2QDL A;  5HCK A;  5IXF A;  3VS7 A;  2KYB A;  2DBM A;  3M0P A;  2EVR A;  2KYM A;  2OAW A;  2KR3 A;  2DIL A;  2E5K A;  2HDA A;  2DVJ A;  1VYU A;  1E6G A;  1RI9 A;  2H8H A;  2DRM A;  4EIK A;  1ZX6 A;  3EHQ A;  4RTU A;  4F16 A;  4CC7 A;  2CSI A;  4LN2 A;  1K0S A;  1HSQ A;  2LP5 A;  4GBQ A;  5I11 A;  1ZUY A;  3NMZ C;  4R0K A;  2EGA A;  2ABL A;  1UJ0 A;  1U5S A;  2JTE A;  1NM7 A;  2LJ0 A;  3SEM A;  2CUD A;  4IIM A;  1GCQ A;  3VS1 A;  3ZL7 C;  1T3L A;  3I5R A;  5FWC A;  2BTT A;  2ROT A;  3I9Q A;  1YNZ A;  2DL3 A;  1WDX A;  4X1V A;  4IIO A;  2ESW A;  1OPL A;  2A36 A;  4RTX A;  2LCS A;  2RMO A;  1YN8 A;  4AG1 C;  1T3S A;  2J7I A;  3PVQ A;  3H0F A;  4RTY A;  4A63 B;  2CUB A;  1CSK A;  2V1R A;  2OJ2 A;  2JM8 A;  4J9F A;  3VS4 A;  3PVL A;  4J9H A;  1W70 A;  2AKL A;  2C0T A;  2IIM A;  2J6O A;  1N5Z A;  1UJY A;  2CRE A;  3M0S A;  2K9G A;  1FMK A;  4F17 A;  2W0Z A;  2CH4 W;  1JXO A;  2DJQ A;  2J05 A;  4OMN A;  2LNH B;  2C0O A;  2JM9 A;  1TG0 A;  1PRM C;  2DYB A;  3EHR A;  3EGU A;  1OPK A;  2JMC A;  1NLP C;  1M3B A;  2M51 A;  4ESR A;  2D1X A;  4AG2 C;  2M0Y A;  2RQV A;  1AOJ A;  2B86 A;  2J06 A;  4HVV A;  1KJW A;  2PZ1 A;  2EYW A;  2HEQ A;  4JZ4 A;  2DL5 A;  2MOX A;  1UG1 A;  1GBR A;  1UTI A;  3FJ5 A;  1E7O A;  2HSP A;  1K0X A;  2RN8 A;  1Y57 A;  2J6K A;  4J9D A;  1RLQ C;  3EG3 A;  5IXB A;  2GNC A;  5L23 A;  1YWP A;  3REB B;  1YWO A;  4OMP A;  5IHI A;  2ROL A;  1AWW A;  3H41 A;  1U3O A;  1GFC A;  4RTV A;  3NHN A;  2O31 A;  2DE0 X;  2MIO A;  2EYX A;  4OMO A;  2FPD A;  2DF6 A;  1NEB A;  1AZE A;  2DLP A;  3M0Q A;  4OMQ A;  1AEY A;  1AWX A;  3TVT A;  1GRI A;  2I0N A;  3O5Z A;  2DL7 A;  1RLP C;  2YUP A;  2ENM A;  1OOT A;  2KBT A;  2W10 A;  1PNJ A;  2DNU A;  1MUZ A;  1NG2 A;  2D0N A;  1I0C A;  1K76 A;  3UAT A;  3I35 A;  1HD3 A;  4JJD A;  1ZBJ A;  2DRK A;  1IO6 A;  1OV3 A;  3M0R A;  3R6N A;  1PHT A;  4J9E A;  3C0C A;  3CQT A;  1H8K A;  2RQU A;  2RNA A;  1M3C A;  2RQT A;  4JZ3 A;  2L3Q A;  2RQR A;  4OML A;  1I1J A;  1QKX A;  1X2Q A;  4K11 A;  2A28 A;  4RUG A;  5IHK A;  1G2B A;  5IH2 A;  2F2X A;  2FG0 A;  2CT4 A;  1NLO C;  2KRO A;  2CT3 A;  2FO0 A;  1UUE A;  1PWT A;  1H92 A;  2GBQ A;  2O2O A;  1WFW A;  2EPD A;  2JW4 A;  1SSH A;  1SPK A;  2DM1 A;  3VRY A;  5FWB A;  2MCN A;  4JJC A;  1W1F A;  3VS3 A;  1OEB A;  4LUE A;  4LUD A;  1CKB A;  1QLY A;  1G83 A;  2PTK A;  1ABO A;  1UHC A;  2HBW A;  3RNJ A;  4DEY A;  2BZ8 A;  2RF0 A;  2P4R A;  3EG0 A;  2EKH A;  2O88 A;  1H3H A;  2K79 A;  1WX6 A;  1SHG A;  1GL5 A;  2KXC A;  1JXM A;  5FW9 A;  2LQW A;  1S1N A;  2DMO A;  2OI3 A;  4AFQ C;  4HXJ A;  1KSW A;  1A0N B;  2FPE A;  1UGV A;  2CH4 A;  1ARK A;  4RTZ A;  4D8K A;  2JS0 A;  3UF4 A;  2D8H A;  3JV3 A;  4AFS C;  3VRZ A;  1GCQ C;  2SRC A;  4CC4 B;  5IHN A;  1NEG A;  2KT8 A;  2GTO A;  2YSQ A;  2JMA A;  1Y0M A;  2NWM A;  3NGP A;  1HJD A;  1AZG B;  2AZS A;  1EFN A;  1M27 C;  2KGT A;  3VS6 A;  1KIK A;  1VA7 A;  2LQN A;  1U06 A;  1JO8 A;  1WLP B;  2KE9 A;  2JT4 A;  1PKT A;  1PRL C;  1UDL A;  1MV0 B;  1WA7 A;  2KRM A;  1UE9 A;  1JU5 C;  2HCK A;  4J9C A;  5ECA A;  4E6R A;  1K9A A;  2O9S A;  2X3X D;  1B07 A;  1BBZ A;  1QWF A;  3TSW A;  2KXD A;  5EC7 A;  1K4U S;  2KRS A;  4CC2 A;  2FRW A;  4RTW A;  4LE9 A;  2GTJ A;  2ED1 A;  3SHW A;  4D8D A;  1LCK A;  1TUC A;  4RTT A;  1SEM A;  2K3B A;  3EG2 A;  2K2M A;  2YDL A;  3THK A;  1AWO A;  1VYT A;  4DEX A;  4ZNX A;  1I07 A;  2L2P A;  4ORZ A;  2FRY A;  2SEM A;  4FSS A;  1ABQ A;  4GLM A;  2RPN A;  2A37 A;  2LJ1 A;  2XMF A;  2JXB A;  1ZSG A;  1TUD A;  4WCI A;  1WXT A;  3QWX X;  2O9V A;  1X43 A;  2YUQ A;  1E6H A;  1AD5 A;  1BK2 A;  2KT1 A;  3VS2 A;  4CC3 A;  1T0H A;  2EGE A;  1AVZ C;  1QWE A;  1XOV A;  2F2V A;  1NYF A;  2D8J A;  1X6B A;  2KNB B;  1QCF A;  2V1Q A;  3VS0 A;  1UFF A;  2F2W A;  4JJB A;  3UA6 A;  2CSQ A;  2VKN A;  1GFD A;  2BZX A;  1SHF A;  2EW3 A;  3GBQ A;  3NPF A;  1W6X A;  2JS2 A;  1X6G A;  2LX7 A;  4J9B A;  2L0A A;  2YT6 A;  1WYX A;  5I22 A;  2EBP A;  1JQQ A;  1RUW A;  2BZY A;  2DL4 A;  1BU1 A;  2KEA A;  1WXU A;  2VVK A;  3A98 A;  4LNP A;  3EG1 A;  1WXB A;  4KRT A;  2AKK A;  1VYV A;  2A08 A;  2ED0 A;  1PKS A;  1KFZ A;  5GJV B;  3M0T A;  1J3T A;  1Z9Z A;  3REA B;  4HVU A;  1WI7 A;  2GQI A;  4HCK A;  3H0H A;  2EGC A;  2YUO A;  2EYY A;  2YUN A;  1ZLM A;  2G6F X;  1X69 A;  2AZV A;  1X2K A;  2FPF A;  1T0J A;  1YCS B;  1ZUU A;  3KFV A;  1UHF A;  4Y92 A;  1M30 A;  4Z8A A;  3TSZ A;  1CKA A;  1M8M A;  2L3P A;  1WIE A;  4AFU C;  1SRM A;  1FYN A;  4JPB W;  1SRL A;  4OMM A;  2EQI A;  3RBB B;  4Z89 A;  1K1Z A;  3PE0 A;  2FEI A;  1ZUK A;  2X3W D;  2CDT A;  3ULR B;  3U23 A;  1V1C A;  4QT7 A;  3I5S A;  3IQL A;  2RQW A;  2DBK A;  3M0U A;  2ECZ A;  2DX1 A;  3LH5 A;  2GGR A;  4Z88 A;  3QWY A;  2VWF A;  2DA9 A;  4F14 A;  1QKW A;  2LMJ A;  2DL8 A;  1GBQ A;  1Z9Q A;  3UA7 A;  1UEC A;  2C0I A;  1YP5 A;  1GCP A;  5GJW B;  4J9I A;  2K6D A;  2L3S A;  3H0I A;  4J9G A;  1NYG A;  4AFZ C;  2NUZ A;  1B3Q A;  2EYZ A;  1BB9 A;  2LJ3 A;  2PNI A;  2LZ6 B;  2K7A A;  2J6F A;  1X27 A;  3VS5 A;  1JEG A;  1M3A A;  1AWJ A;  2AK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...