2LNVA

Solution structure of gspc-hr of typeii secretion system
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
104
structure length
104
Chain Sequence
b'GSHMLEMAGALDASQMSNLPPSTLNLSLTGVMAGDDDSRSIAIISKDNEQFSRGVNEEVPGYNAKIVSIRPDRVVLQYQGRYEVLGLYSQEDSGSDGVPGAQVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General secretion pathway protein C
publication title Solution Structure of Homology Region (HR) Domain of Type II Secretion System.
pubmed doi rcsb
source organism Dickeya dadantii
molecule tags Transport protein
total genus 13
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.830 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lnvA01
3OSSC 2Y4YA 2Y4XA 2LNVA 2IVWA 2LC4A
chains in the Genus database with same CATH superfamily
4JPBW 2EYYA 1GBRA 5IAYA 3VRYA 3MO8A 2EYQA 4M77D 2I2LA 3RIRA 2DL4A 3CPWP 2GCXA 4KGXB 1M3BA 1HK9A 5KE2A 3CXCA 4J9IA 1ZSZA 3NTHA 3OYJA 1V29B 5KCOA 3TREA 2K3BA 1UGVA 5FU6C 3OYHA 2DRKA 1RI0A 2EQMA 1FMKA 1G3WA 3EG3A 1SHGA 3QZ9B 1VOMA 2EGCA 5GANf 2C0TA 1OOTA 1ZSZB 1PRLC 2RF0A 1AWOA 1LCKA 4C92A 1YJ9Q 1FMWA 4L6V5 3V8JA 2DTHA 2RHZA 1E6HA 1NZ9A 4EMHA 3CCMQ 2HDAA 2MWPA 2YRDA 2KQWA 1VQOQ 2QQSA 3I56T 2B8AA 3P8BB 4PFPA 1K73R 3P8DA 4FYYB 1YIJQ 5J3BA 2OX7A 1PCXA 1I4K1 5AYFA 1M9SA 3M9QA 1AZGB 4M77A 2E4HA 2RHXA 2V26A 2FEIA 1TG0A 5IHKA 5LJ5j 4GY5A 5EG2A 3MHXA 2YUQA 1FMVA 1N8RU 2VV5A 1Q82C 4J9DA 2KYBA 5KYUA 1OULA 2H3JA 2DD5A 2ED1A 3D7SB 3NMZC 4LD6A 1S1NA 2LDMA 2XKOC 4C92C 2CKKA 4F7UG 3CQTA 3QYGB 3CCJA 1VQLQ 4AFUC 2IVWA 2SRCA 4PNOA 4VUBA 2X35A 1PNJA 3MEVA 4IKFA 3M58A 2L0AA 1TS9A 2HKQB 2C0OA 1WJQA 2HAXA 4FCYA 4C8QB 2FG0A 4FIBA 1M3CA 4ATOA 2I0NA 2P0PA 2FB7A 4ZGEB 2Y90A 4BY6B 1UGPB 4RTUA 1QVFP 2JOYA 5GAOl 2M16A 3VRZA 1OU8A 1PG5B 1KHIA 2EW3A 2BUDA 3JCMJ 4M7DG 5GANe 4NOYA 1VQ6Q 5HCKA 3HTRA 4ORZA 4MZPA 2EYXA 4LUDA 3E2UA 5LJ3d 3ASKA 3CCET 2IPOB 2ECZA 3OYDA 2EKHA 1YI2T 3M56A 2GTJA 1Z9QA 1VQ7T 1JRIA 1IREB 1EFNA 1M1KU 1YNZA 2DKGA 2YRCA 2AZVA 2LNHB 4HKEA 5IN1A 4M78F 1U8RA 1XJWB 2CSIA 3CEYA 4EMKB 4PJOG 3DB4A 2EIFA 3I9QA 3AHUA 2LJ3A 1M30A 3OW2P 1VQPQ 2JM9A 4DBHA 1YITT 2RMOA 4BE1A 4KGZB 5FU7B 4LN2A 1XTDA 1Q82R 5CK9A 3A8GB 3BDLA 5LJ5g 5I2SA 4C92E 3BY7A 1W4SA 1JU5C 2YSQA 2JMCA 2J6OA 3LX7A 1IGUA 1QP3A 2FPFA 2HMAA 4R0KA 1M1KC 4WCIA 4HCCA 4GBQA 4PK4A 1G5VA 4CC7A 2BIVA 1BB9A 2HEQA 2X4XA 4NL3A 1MMNA 3E1SA 3JCMV 1U06A 1VQKA 4JRQA 1Q86U 1OPKA 3OS5A 3C94A 1UJ0A 2O01E 2CUBA 2EJ9A 4LDVA 4UC4A 3CC2T 1OPLA 3LWIA 4M4ZA 2CP5A 2M51A 2DM1A 1UHCA 2E3IA 2ZAEA 1IHWA 1K9MU 5IXFA 2RA2A 4JLIA 2DEQA 2CZ6B 1OX9A 4EMGA 1Q7YC 1QVPA 5HK3A 2CH4W 3GPLA 4M77F 2HSPA 1N6AA 2XDPA 4FU6A 2LMJA 5KH6A 3L2RA 1UGSB 4CC3A 1ZQ1A 2DNUA 2L3SA 4MDWA 4PJLA 4IUVA 4QVZA 1Q86C 4IUQA 1VQ8A 1G3TA 2EJGA 2O2OA 2EFIA 4A4FA 3INZA 2F2XA 1D1AA 3JRZA 3CCSQ 2DX1A 1E7OA 2K5IA 2M02A 4M7DD 1VQNT 2F69A 4ELZC 2K2MA 4IIMA 1R0BG 2X9HA 5GAN8 5AT1B 4CC2A 3EGXA 1RAIB 4IIOA 7AT1B 3QUIA 2RI2A 3LLRA 2BZYA 4LD9K 1NPPA 1YHQQ 1D0XA 3PGGA 3CCRA 1XOVA 1M1KR 4GLMA 2DL3A 4IUUA 1Y71A 3OMCA 3QWXX 4C0DC 1QVGS 4PJOD 2QEXT 4F7UB 2COWA 3M4YA 3VS0A 3PIOA 3CD6A 2DD4A 3ER0A 1MHNA 3CCVQ 2K2VA 4KGVB 1OZ3A 1RAHB 4TVRA 2QASA 1UUEA 2SEMA 5I22A 1BIAA 1GCPA 1D0YA 3I55T 2EQUA 2PNIA 1IGQA 4JJBA 3OA6A 2FRYA 1W70A 2YHTA 3WXMB 3HRUA 2ROTA 3QZ5B 2Y4XA 4M7DA 4HA8A 4JZ4A 3I55Q 3SD4A 3CMEA 3ULRB 3RKXA 1N9RA 1Q7YR 2MAMA 3QDFA 3JCMb 1JXMA 2DJZA 3QJYA 3G71T 4B9WA 1D09B 2A7YA 2LJ1A 4OP0A 1MMGA 4M7AG 4LE9A 5ECAA 1W2BP 1WIEA 2QGFB 1YBYA 1YCYA 3G71Q 3QBYA 1FWZA 1Q86R 1S72Q 1ZHIA 2JN0A 2NUZA 2CZ7B 4LDUA 4C5EA 1UGRB 1CKAA 2RHUA 4PJOA 2O4XB 3SB2A 1KQSP 1A0NB 2G6FX 1X2QA 3DLLA 1UDLA 4E7KA 2K57A 3RDVA 4KH1B 4HCKA 2E64A 4PFOA 1R8OB 4JZ3A 5CVIA 4OGCA 4E2FB 5CKDA 4M75B 4PJOB 2DXUA 2E12A 5IT9E 1QKXA 3V8LA 2VASA 2XICA 4PLLA 5GAN3 3OYMA 3J81E 1BI1A 4C5GA 3CC4Q 5M9OA 1I07A 2RH2A 4BUGA 4MZMA 3SWNA 2KBTA 1YCSB 4O5VA 1VYUA 2WSCE 1VIFA 2JT4A 1SRLA 3G1JA 2IG0A 1I81A 4FL6A 3JB9I 1VQ4Q 1PKSA 2CP7A 3S6WA 4OMFB 3M0TA 3RUXA 5KYYB 3FB9A 2PQWA 5L8RE 2KVQG 3G4SQ 1YJWT 2CP3A 3M0UA 3CCLQ 1G3SA 1Q81C 4EIKA 3CMAT 3TEEA 4HVWA 3LYIA 4N0AA 3CCQA 1YJWQ 3OS1A 3EG9B 1BBZA 5GAOq 4J9GA 4E7ZA 3A1PA 1WYXA 4D8KA 1AD5A 2P84A 2YLBA 4A4HA 2F5KA 3CMAQ 2RO0A 2OTJA 1U3OA 5FWBA 4PL6A 4PFZA 1AOJA 4XU1A 2DYIA 1MV3A 5LJ5h 1Y57A 2R58A 1KHCA 4C8QG 2BZXA 5A0GA 1M5Q1 4IUTA 1TWBA 2LRQA 2AKKA 1YWOA 2RJDA 4F7UF 2DL8A 2XG8D 2XMFA 3C4SA 1WXBA 3RERA 3RMSA 2NUPB 2FPDA 2JTFA 3PTAA 1BIBA 1Q95G 5IXBA 2KXDA 4E7IA 2EJFA 2RJCA 2L8DA 2P4TA 3EG1A 1NPRA 1VQ5A 1ZX6A 1QVGA 2J6KA 1D3BB 4M7AD 2KNBB 4J83A 4YTLA 1LJOA 3FIFA 2E65A 2P0KA 3JAME 3QO3A 4C0FA 2F1LA 1QQJA 2D8HA 2DAQA 1SG5A 2QGGA 3CC7A 3L42A 5CQYA 5FRNA 1GFCA 5L23A 1UEBA 2MCNA 1FX7A 1G83A 3TCJA 1BK2A 4ME7A 2KI7A 3O5ZA 1KD1U 3G6EQ 1VQ9Q 4X1VA 2QI2A 1GBQA 2QQ9A 4X34A 2JXBA 5DLQE 2ZCFB 2QK0A 1KC8U 2HQEA 3IQLA 4J6WA 3V7CA 1I8FA 3E9FA 3GNGA 4HT9A 5LJ5f 1ZUYA 3SEMA 2OTLT 3CCUA 4PJOF 1W6XA 2QA4A 3AT1B 4M7AA 3NTKA 1TSFA 1RAAB 2F2WA 2OTLQ 3RKWA 1V1CA 4DEYA 2D0NA 3H8ZA 2DA9A 2GGRA 5FW9A 1BI0A 1RACB 1SEMA 1X2KA 2WACA 1K76A 2A28A 5GAMd 4PJJA 1G3YA 3EFOB 4M7AB 2EYZA 1VIEA 4FW1A 1YJNA 4XAXB 2ZGWA 2M9UA 5FU6B 2MI6A 5D6XA 1VQMA 4XU3A 2LQKA 1KC8C 2DIGA 2CH4A 1I5LA 1PKTA 2ZPEB 2VKNA 2CP0A 4EDUA 5I21A 1YJ9T 4FW2A 3UATA 3CCMT 3META 1JJ2S 3HL8A 4M78C 2EGEA 4C8QD 1VQOT 1ZA2B 1UG1A 2W10A 3LWHA 1YIJT 2OAWA 4BI3A 5CAIA 3J7AF 2M1HA 1GCQA 4Y28E 2LP5A 3Q1JA 1C1AA 4XK8E 4DQ2A 1WQWA 3JCMW 1FYNA 3EFSA 2LVMA 1K0XA 1ZSZC 4F04B 2KE9A 4MZTA 2ZPGB 2NYSA 4FSSA 4OB3B 4BD3A 4JRIA 3I56A 2VUBA 1AT1B 1X69A 3I35A 1VQLT 4LUEA 5LJ5e 2E6ZA 3FLGA 4XTXA 1KQ1A 3FC3A 4C8QA 4J9BA 2PVGB 4ZNXA 2OJ2A 2RI3A 4RTXA 2E5QA 1MNEA 3VS1A 3CCJQ 1WQ7A 5KYNA 3HRSA 5GAN2 4DEXA 4AFQC 1ZBXA 1KC8R 1JEGA 4M77C 3H0HA 1N8RC 1VQ6T 4J9EA 3CXCP 4XQ3A 4DBRA 3RKYA 2YXYA 3TVTA 4M78E 2AHJB 3HFNA 5FWCA 4J6YA 3L2QA 2BZ8A 2C06A 4Z88A 2K6DA 4HCBA 2FYKA 2PZ1A 2VVKA 4QT7A 2BTTA 3VYGA 1TOVA 2PTKA 1PM3A 3NPFA 5GANj 1LVKA 3JB9J 4EMKA 4E6RA 2J6FA 2RI5A 2L89A 8ATCB 4MDXA 2A0FB 4RTTA 2E1HA 1WDXA 1VQPT 3BW1A 1SHFA 3OSVA 5LJ3h 2EPDA 2EQIA 4M7AF 4M75G 1M2VB 4J5YA 3M54A 3CCEA 1BCMA 1NJIU 3OB9A 3H41A 1OV3A 3VUZA 1TU0B 1YI2A 1VQ7A 3WVDB 1BCOA 4Y92A 1GXIE 2KMTA 1RAEB 2AIRB 2LCSA 5I2MA 3ZL7C 1JB0E 2DERA 2X4YA 1X01A 2KRNA 3HHTB 3TSWA 4PJNA 3A8OB 2M0OA 2JTEA 1U5SA 2VGNA 3VS6A 4EMKC 2DL7A 5GAMj 1YITA 2GF7A 1NBEB 5CCAA 1RADB 4KUIA 3RNJA 3S3MA 5I11A 2A37A 5GMKm 3JCMX 1OI1A 4XTVA 4M77E 2LX9A 2COYA 2V8KA 2VB6A 1Z9ZA 1JJ2A 3MEUA 3JCMd 1VQKQ 2DXBA 3EHRA 3L2ZA 4EPCA 4RTWA 2FZKB 2OAUA 1N8RR 3OYLA 3RESA 5FRMA 2FHDA 2QQRA 2A3LA 4B9XA 1WHLA 4XTUA 3OYCA 3J80E 2F5TX 4FM4B 1H8KA 5DM7R 2FVUA 4II1A 4XU2A 1AWWA 3FJ5A 2DBKA 3MP1A 1F1BB 3JSCA 2ABLA 1WHKA 2QQAA 1ARKA 2CGHA 5LJ3f 1NEBA 3CC2A 5HY6A 3UWNA 5GMKh 2DMOA 4JDSA 2O88A 1RAFB 5GAOn 3A5ZB 3M59A 3OYYA 5A0LA 3CCST 4DOWA 4Z89A 2GTOA 2J05A 3PT9A 4A53A 2X4JA 2NWMA 5DLOA 3HP9A 4HXJA 3PMIA 2L2PA 4O6JA 1PD0A 3CPFA 4C8QF 2RN8A 1K9MC 1VYTA 2RQRA 2KAFA 3QYHB 2RJEA 5D7UA 2NUTA 1YHQT 2CYZB 2LTOA 2DILA 4F7UA 2DO3A 1IB8A 3DKMA 1C6VX 4OB2B 3CPWS 4C0DB 2B86A 2FZGB 2NUTB 3I5RA 3CCVT 3DB3A 1VQNA 4DOVA 1B7TA 2L3QA 2LCCA 4M75D 1K9AA 3REBB 3CCRQ 3LGLA 4F17A 1YFNA 5GAMg 2HL3A 1NJIR 1Y7XA 2QTXA 1QWEA 4XTWA 3CD6Q 4RG2A 2QAZA 2XHCA 4V2SA 2R5AA 1RLQC 1ACMB 4AG1C 3M53A 3VS5A 2KT8A 1YWPA 2RQTA 3GF5A 2QEXA 2XD0A 1PSFA 1QLYA 2Y4YA 3HRTA 2JMAA 2AK5A 4PKCC 4FYXB 3SHWA 2MPXC 4ZN3A 4JJDA 3CMEQ 1S72T 1QW1A 3I55A 2O4XA 3QDRB 4KULA 5LJ3e 4ZGDB 1BI2A 2VWFA 3RR6A 2ESWA 5GJVB 2DK3A 3SFMA 3MP8A 4MMKA 2EWNA 2GNCA 2D8JA 2Z0WA 1EIFA 4DBFA 2YWWA 4M75A 3G71A 2NLUA 4KT0E 1M2OA 1K9MR 1YP5A 4J6XA 3HFOA 2QDYB 3A8MB 2E10A 4M7DC 1Y96B 3CC4T 1NYGA 2E5KA 2HBWA 4HT8A 3TU4K 2YT6A 4A4KA 4JJNK 2EVRA 2YRVA 1T3LA 3ZBDA 2L3RA 1DJ7B 3MJXA 3EGDB 2OI3A 2QXFA 3FDRA 2K3XA 3GBQA 2ED0A 5KYYA 1H3ZA 1VQ4T 4J7FA 5KYXB 2JS2A 2ZPIB 1WZOA 2H8HA 1UJYA 1RLPC 1LNXA 2DLPA 3G4ST 1QVFS 2HQHA 2EQJA 1NYFA 3CCLT 4PJOC 3FJPA 2LNVA 3C0CA 3EG9A 4J9CA 4C92G 1KQ2A 4C5IA 2XDBA 1RUWA 3C12A 3OBYA 1WJRA 1SKUB 2DTOA 3OSSC 2RK1A 4QKUA 1QWFA 5IHNA 3S3NA 1NEGA 5GMKe 3CBMA 2PUKB 2KY9A 1BYMA 1I0CA 1WXTA 2CS7A 2JVVA 4A63B 2HBPA 1K8AU 3H9NA 1YJWA 3KXTA 3SWNC 2NUPA 3OW2S 2RHYA 3CMAA 2DZ9A 4QVDA 1OU9A 1ABQA 4E47A 3X20B 4LNPA 1D3BA 3JV3A 1NG2A 2YUPA 3CPWA 2K79A 3NTIA 2CSQA 3M0QA 4M7DE 3THKA 1NLPC 4N4HA 4N0AC 1M27C 2O9VA 2KRSA 4QQ6A 1K73U 1K8AC 1I1JA 1VQ5Q 3OY9A 1ZSGA 3EG0A 3OYEA 1EZZB 4HVVA 4OMNA 4NS5A 1R0CB 4KH0B 1X6GA 3G6ET 5D6YA 1VQ9T 4PJOE 1U1TA 5GANd 3VS4A 3PE0A 3CC7Q 3OBWA 1H92A 4R56A 1CKBA 2YLCA 3PFSA 4Q5WA 2E70A 2CT4A 3JCMg 2RK2A 1AZEA 5C0MA 1N27A 4RUGA 3OYGA 3CBPA 4XTZA 1SRMA 3A98A 5FROA 3EH1A 2CZ0B 3QKJA 4WF2A 1WJSA 2VGMA 4M75F 2DXTA 4RKUE 4BI8B 2JZ2A 3EFOA 5CO7A 2GQIA 3CCUQ 1HD3A 3RBBB 2QA4Q 2DEUA 1KG1A 4HVUA 1BU1A 4C92D 3ZFJA 1N9SA 2EYWA 3E9GA 1KD1C 2KGTA 2X51A 4OF1A 5HK0A 1N5ZA 5CKFA 1M3AA 5EC7A 1OZ2A 2MMPA 1YJNQ 2JUFA 4P5NA 4ZTJA 3M57A 4Z8AA 4LDYA 1HJDA 2LJ0A 2RB6A 5J39A 1VQMQ 1WXUA 2G3RA 4M78B 3JB9F 3QSUA 2FRWA 5KCHA 5GAOm 4JS5A 1QVFA 5CQXA 4J7IA 1K8AR 2HKNA 3LW5E 1T0HA 5KYWA 1PHTA 4M7AC 3H0FA 1M1FA 1M90U 2J06A 1QVGP 3VS7A 3VJPA 2GFAA 1JBMA 1YJ9A 2BE9B 5KE3A 5KYWB 4IURA 2EBPA 1PC0A 1YN8A 1Q82U 3CCMA 1X43A 3G7ZA 2E3HA 4XTYA 3EGUA 1WLPB 1VQOA 3WVEB 3N5BB 4BE2A 2V1QA 4OB0B 4PLIA 3EFRA 1YIJA 2LX7A 2W0ZA 4RCCA 2KYMA 3LH5A 4J9FA 1KJWA 4ELYC 4NL2A 3OW2A 1W2BS 2RNAA 3BE3A 4C92B 3M0PA 2K4YA 1HSQA 1UE9A 3E19A 5GAOp 2K7AA 2LCLA 5GMKi 1M90C 3I56Q 3PIPA 3OYBA 3P8HA 2DE0X 1B34A 1HYOA 1GRIA 3ZEHA 3CCJT 2WSEE 1KQSS 1ZBJA 1RABB 3M0RA 3GOXA 3UPUA 1PWTA 3EAEA 2E41A 1UFFA 1GCQC 4BE0A 5CKHA 5GAMf 1KD1R 1HXDA 3L1AA 1OQKA 2MIOA 1QP2A 3UF4A 4M77B 1B34B 2LT1A 4JJCA 1SSHA 1VQLA 4L5GA 2CP2A 4RCBA 1WI7A 3L2WA 2V8IA 4XU0A 1WGSA 2QYZA 2GFUA 1TTHB 5CIUA 1IHVA 3VYHB 3KUFA 1XQHA 6AT1B 4FYVB 2KROA 3LGFA 2JJ9A 4A4EA 1D1CA 2XU8A 5KYUB 4OMMA 3EG2A 3OYKA 2XK0A 1UGQB 2XDDA 3RMQA 3MEAA 4M7AE 2VC8A 4AFZC 4B6MA 2L3PA 2DTIA 4KRTA 1D0ZA 4J9HA 2DFUA 4C8QC 3V8KA 2D9TA 1D1BA 3FEOA 4WTOB 1VQ6A 1M2VA 4A4GA 2HL5C 4BY6C 4QQDA 2R5MA 1JXOA 3QXEB 1BKBA 5GAN6 3GIBA 4KUDK 1PRMC 2CUDA 2H3EB 3X25B 5CKBA 3KFVA 1I5OB 1T3SA 2X4WA 3OMGA 2EAYA 3HPWA 2AKLA 1FXXA 4E7SA 5IHIA 2LZ6B 3CCEQ 3QHSA 1P92A 1R77A 1GL5A 1H3HA 3L2UA 3KBGA 2X3XD 1VQPA 2C0IA 3UT1A 1M90R 1YI2Q 3R6OA 2LQNA 3HKSA 1VQ7Q 1MNDA 3UA6A 2F2VA 3S3OA 2YUOA 2PVDB 2KSSA 5C6SA 4IUPA 2PVOB 2M0YA 1OX8A 1C0MA 1ZUKA 1X27A 3QPHA 2DXCA 3VV0A 3CBOA 1B3QA 5FU7C 1YITQ 1VQKT 4LXCA 3JB9G 2COZA 5GAMe 1H641 1WFWA 3TSZA 2LQWA 2K5LA 1NJIC 1Q7YU 2P0QA 1IRXA 3V7RA 2WSFE 3UA7A 4ESRA 1PD1A 2MOXA 3M4GA 3X24B 2RQWA 1ZA1B 2AT1B 4FYWB 2ZPFB 2KXCA 3NHNA 2IIMA 3JB9H 4DA4A 9ATCB 3JCMh 3PMTA 1E6GA 4C92F 1WHGA 2HCKA 4C8QE 3REAB 2J7IA 1UB4A 2XIDA 2KK4A 3BFMA 5IH2A 4ZTFA 2L5QA 3X28B 3X26B 3NGPA 1K4US 3MKDA 4OMOA 3A8LB 1ZUUA 3CC2Q 4CC4B 1VQ8T 5GANg 1W2BA 4C0GA 2PU9B 4E7JA 2QQBA 1XNIA 3OS2A 1VUBA 4ZN1A 2DL5A 4RMOA 1VQ8Q 3MPUB 4N4IA 4BB7A 3GLXA 4AFSC 1KQSA 3NFCA 5A2QE 1MMDA 1NLOC 4OMQA 3CCSA 4CRIA 1K0SA 2A36A 1AWJA 1NM7A 1KSWA 4DBQA 2P4RA 2AZSA 2FO0A 3CCRT 2KEAA 4BACA 2KT1A 2D1XA 3T9NA 1IXDA 2O9SA 2ROLA 3CD6T 2DRMA 3VS3A 2CZ1B 3OYFA 3ME9A 1YHQA 1ZLMA 1M8VA 1IZ6A 1M4ZA 1VQNQ 1IO6A 3C95A 2JNGA 1TUGB 3QG1A 2DVEA 2A08A 3I5SA 4C0ZA 3JCMf 4R55A 4JRKA 2DZCA 3VUBA 3EGXB 3CCVA 2EGAA 2X3WD 1QKWA 5GMKl 1JJ2P 3PVLA 1JQQA 4J8OA 3CMET 1J3TA 1O75A 4OMPA 4JLGA 2DJQA 4BDYA 1AHJB 2HQXA 2QEXQ 1X6BA 2K9GA 2LC4A 3LH0A 2D0QB 2ZPHB 2MF2A 1M1GA 4OB1B 3JB9D 1TUCA 2DYBA 3GNFB 4KBMB 1NE8A 1BI3A 2JM8A 2RQVA 3M0SA 4RTYA 3VKIA 2E6NA 3BDUA 1CSKA 5LJ3j 4Y91A 4QQGA 1G8XA 2RD1A 3DLMA 4JUVA 5LL6S 1Y96A 2O31A 4OVAA 1WHHA 3QJ6A 2CREA 1KIKA 1WNLA 4M78G 1S72A 1GFDA 2FZCB 4M7DB 1T0JA 1LOJA 3EGDA 2DIQA 1RAGB 2CDTA 3OYIA 3F70A 3MP6A 5KYXA 4BDZA 2MYSA 4RTZA 1QMCA 1AWXA 2JS0A 2RHIA 4OMLA 1TH7A 3GP8A 2VXFA 4FT4A 1TXQA 5GJWB 1OEBA 3JCMc 1SSFA 3HSBA 3URGA 1MMAA 3OS0A 1Q81U 3JCMQ 1QCNA 3U23A 2DETA 5GAN7 3CC4A 1VYVA 3CXCS 4M75C 2ENMA 5CKEA 4OGEA 1RL2A 2VYTA 4E7HA 4D6WA 3H0IA 1MUZA 2QDLA 2HD0A 1VQ4A 4X9DA 2DVJA 2RM4A 4LDXA 3JCMe 2V8JA 3CCQT 4K11A 1JO8A 3OQ5A 3PVQA 4JRPA 2RPNA 4F7UE 3VU3C 3G4SA 4QW2A 2LQ8A 5GAN4 2LT4A 3CCLA 2OTJT 3SWNB 4FT2A 3UDCA 1MV0B 4A54A 1WX6A 3CCQQ 3H6ZA 3TQ7P 2BKDN 4BI4A 8AT1B 5GMKj 1RI9A 4FSXA 4M77G 2QTVA 1QCFA 3OYAA 2OTJQ 2FL7A 1AEYA 1WPYA 2ATCB 2MWOA 1M8MA 2EKOA 1Y07A 5LJ5d 5GAN5 1K1ZA 4JS4A 4X9CA 4Z02A 1SPKA 2HZYA 3PNWC 4GLKA 5CR2A 5LJ3g 1UTIA 1WA7A 1O9SA 5A0DA 2EQKA 4AT1B 1G2BA 2DPPB 3MCAB 4CI0C 1VQ5T 2GQVA 3QWYA 1KK7A 2K5FA 5DY9A 2KDSA 4D8DA 4N4GA 4L59A 3VS2A 1U1SA 3V7SA 1WHMA 3L2VA 5J26A 1KFZA 1AVZC 1Y0MA 3CC7T 1X75C 3M55A 4AG2C 1LPLA 3M5AA 2JW4A 4F16A 2MK5A 5D6WA 3SDZA 4M78D 4M75E 3JCMP 2DBMA 1V76A 4C5HA 3EH2A 1EX4A 3FRNA 1WHJA 1QCOA 2KR3A 4ZGJB 4LDWA 4HCZA 4E7LA 5GANh 3EHQA 2CP6A 5GAOr 1UECA 1W1FA 4M7DF 3G6EA 1VQ9A 3CCUT 4F14A 2BE7D 1K73C 4RTVA 3OYNA 2DF6A 1MGQA 2QA4T 4PJMA 1UHFA 2D6FA 2GBQA 1ABOA 1Q81R 2FPEA 3O8VA 2QG9B 5HKCA 2ZPBB 1OYXA 1PSEA 1VA7A 2HSEB 4ANJA 4AMCA 2XI9A 1B07A 3A8HB 2JTMA 1YJNT 2CT3A 2OTLA 2R57A 1X6OA 2RQUA 2K3YA 4M78A 3MEWA 2KRMA 1TUDA 4RG8A 2VXEA 4QVCA 1VQMT 2PUOB 1SF9A 5FLXE 3R6NA 2ZZDA 4MMLA 2YDLA 5GAMh 2RJFA 2V1RA 2YUNA 3QIIA 2HNIA
chains in the Genus database with same CATH topology
4KUDK 4OB2B 3CPWS 4C0DB 3CMAT 3TEEA 3X25B 5IAYA 3MO8A 5CKBA 2EYQA 4M77D 2I2LA 3LYIA 3CCVT 3RIRA 2X4WA 4N0AA 2GCXA 3CCQA 3DB3A 1HK9A 3OMGA 3OS1A 5KE2A 3CXCA 2EAYA 1VQNA 4DOVA 3HPWA 5GAOq 2LCCA 4M75D 3OYJA 3NTHA 1V29B 3LGLA 2YLBA 4A4HA 5KCOA 2F5KA 3TREA 2RO0A 1FXXA 5GAMg 2OTJA 5FU6C 3OYHA 4PL6A 1RI0A 2EQMA 3QHSA 1P92A 1Y7XA 1G3WA 2QTXA 4XU1A 3L2UA 3KBGA 4XTWA 1VQPA 4RG2A 3UT1A 3QZ9B 3R6OA 5LJ5h 5GANf 2XHCA 2R58A 3HKSA 1KHCA 4C8QG 4V2SA 5A0GA 2R5AA 1M5Q1 4IUTA 2LRQA 3M53A 3S3OA 4C92A 2PVDB 3GF5A 4L6V5 3V8JA 2DTHA 2KSSA 2RHZA 2RJDA 1NZ9A 4F7UF 5C6SA 2QEXA 2XD0A 2XG8D 1PSFA 2Y4YA 3HRTA 3C4SA 4EMHA 4IUPA 3RERA 3RMSA 2JTFA 3PTAA 2PVOB 2MWPA 1BIBA 4PKCC 2KQWA 2QQSA 3QPHA 2DXCA 4ZN3A 3VV0A 3CBOA 5FU7C 1VQKT 3I56T 2B8AA 3JB9G 3P8BB 4E7IA 5GAMe 1S72T 2EJFA 2RJCA 2L8DA 2P4TA 1QW1A 1H641 3P8DA 3I55A 2O4XA 5J3BA 3QDRB 2K5LA 4KULA 1NJIC 1NPRA 1VQ5A 5LJ3e 1Q7YU 4ZGDB 1QVGA 2P0QA 1BI2A 3V7RA 1I4K1 2DK3A 2WSFE 1D3BB 3SFMA 4M7AD 5AYFA 3MP8A 1M9SA 3M4GA 3M9QA 4J83A 4MMKA 2EWNA 4M77A 4YTLA 3X24B 2RHXA 1LJOA 1EIFA 3FIFA 2E65A 2P0KA 2ZPFB 5LJ5j 3JAME 3QO3A 4GY5A 4M75A 5EG2A 4C0FA 3MHXA 4DA4A 3JB9H 2DAQA 3G71A 3CC7A 2NLUA 2VV5A 1N8RU 3L42A 4KT0E 5CQYA 5FRNA 1Q82C 3JCMh 3PMTA 4C92F 1UEBA 2H3JA 2DD5A 4C8QE 4LD6A 2LDMA 2XKOC 1FX7A 1UB4A 4C92C 2XIDA 2CKKA 2KK4A 3BFMA 4J6XA 3TCJA 2L5QA 3HFOA 4ZTFA 2QDYB 4F7UG 3A8MB 2E10A 4ME7A 3X28B 4M7DC 3X26B 1Y96B 3CC4T 3QYGB 4HT8A 3TU4K 1KD1U 3CCJA 3A8LB 4A4KA 4JJNK 2YRVA 1VQ8T 5GANg 3ZBDA 2L3RA 1DJ7B 2QI2A 2QQ9A 2IVWA 4C0GA 1W2BA 2PU9B 4PNOA 4E7JA 4VUBA 4X34A 2QQBA 2X35A 2ZCFB 2QXFA 5DLQE 3FDRA 3MEVA 2HQEA 1KC8U 2K3XA 4IKFA 1XNIA 3M58A 4PJOB 3OS2A 1VUBA 4ZN1A 1H3ZA 1VQ4T 4J7FA 3V7CA 4J6WA 1I8FA 2ZPIB 4RMOA 1WJQA 3E9FA 2HAXA 3GNGA 4HT9A 5LJ5f 4C8QB 4N4IA 2OTLT 3CCUA 4FIBA 4BB7A 3GLXA 4PJOF 1LNXA 1KQSA 4ATOA 3NFCA 5A2QE 3G4ST 1QVFS 2QA4A 2EQJA 2P0PA 4ZGEB 2FB7A 2Y90A 4BY6B 3CCLT 4M7AA 4PJOC 1UGPB 3NTKA 3CCSA 4CRIA 3FJPA 2JOYA 5GAOl 2LNVA 3RKWA 2M16A 3H8ZA 4C92G 1KHIA 1KQ2A 2BUDA 4C5IA 3JCMJ 1BI0A 4M7DG 5GANe 2WACA 4NOYA 3CCRT 5GAMd 1G3YA 4BACA 2XDBA 4M7AB 3C12A 3OBYA 1WJRA 1VIEA 4MZPA 3T9NA 2DTOA 1YJNA 4XAXB 3OSSC 2RK1A 3CCET 5LJ3d 3ASKA 2ZGWA 3OYDA 2M9UA 5FU6B 5GMKe 3S3NA 2MI6A 3CBMA 2PUKB 5D6XA 2KY9A 1BYMA 3CD6T 1VQMA 4XU3A 2LQKA 1YI2T 1KC8C 3M56A 2CZ1B 2DIGA 3ME9A 3OYFA 2CS7A 1YHQA 1JRIA 2JVVA 1VQ7T 1IZ6A 1IREB 1I5LA 1M4ZA 2HBPA 1M1KU 3C95A 1K8AU 1YJWA 2DKGA 2ZPEB 2JNGA 3QG1A 3KXTA 3SWNC 4EDUA 5I21A 2DVEA 1YJ9T 4HKEA 5IN1A 4C0ZA 4M78F 3JCMf 2RHYA 3CMAA 3OW2S 4EMKB 3CEYA 4R55A 1U8RA 4JRKA 3CCMT 4PJOG 2DZCA 2DZ9A 3META 3VUBA 3DB4A 2EIFA 3AHUA 3CCVA 1JJ2S 3HL8A 4M78C 4C8QD 4QVDA 1VQOT 5GMKl 1YITT 3CMET 4J8OA 1O75A 4E47A 4BE1A 5FU7B 4JLGA 3X20B 3LWHA 1XTDA 1YIJT 4BDYA 5CK9A 1AHJB 1D3BA 2HQXA 4BI3A 3A8GB 3BDLA 5LJ5g 5I2SA 4C92E 5CAIA 3CPWA 3J7AF 2M1HA 3BY7A 1W4SA 3NTIA 2LC4A 4M7DE 3LH0A 2D0QB 4Y28E 2ZPHB 3Q1JA 2MF2A 1M1GA 4N4HA 4OB1B 4XK8E 4N0AC 4DQ2A 3JB9D 1WQWA 3JCMW 3LX7A 1QP3A 3GNFB 4KBMB 3EFSA 2LVMA 1NE8A 1BI3A 4QQ6A 1M1KC 1K73U 1K8AC 4HCCA 1G5VA 3VKIA 2E6NA 3BDUA 2ZPGB 4MZTA 5LJ3j 4Y91A 2BIVA 4QQGA 3OY9A 2RD1A 3DLMA 3OYEA 2X4XA 4JUVA 4NL3A 4OB3B 5LL6S 1Y96A 3E1SA 3JCMV 4OVAA 4BD3A 4JRIA 3QJ6A 1VQKA 3I56A 4JRQA 2VUBA 1Q86U 4NS5A 1WNLA 4M78G 1S72A 3OS5A 3C94A 4M7DB 2O01E 1LOJA 2EJ9A 3G6ET 5D6YA 1VQLT 4LDVA 1VQ9T 2DIQA 4UC4A 5LJ5e 1U1TA 5GANd 3CC2T 4PJOE 2E6ZA 3OBWA 3OYIA 3FLGA 4XTXA 4R56A 1KQ1A 3F70A 2YLCA 3MP6A 3LWIA 3FC3A 4BDZA 3PFSA 4Q5WA 1K9MU 4C8QA 2PVGB 2E70A 2RHIA 2RI3A 1TH7A 2RA2A 3GP8A 4JLIA 2E5QA 3JCMg 2RK2A 2DEQA 5C0MA 1N27A 2CZ6B 2VXFA 3OYGA 1WQ7A 3CBPA 4FT4A 4EMGA 1Q7YC 4XTZA 1QVPA 3HRSA 5HK3A 5GAN2 3JCMc 3GPLA 1K73C 4M77F 1SSFA 5FROA 1N6AA 3HSBA 2XDPA 3URGA 3OS0A 5GAN6 4FU6A 1Q81U 2CZ0B 3JCMQ 1ZBXA 5KH6A 4M77C 3QKJA 4WF2A 5GAN7 1WJSA 2VGMA 1UGSB 4M75F 3L2RA 1ZQ1A 3CC4A 2DXTA 4RKUE 4BI8B 2JZ2A 4MDWA 3CXCS 4IUVA 4QVZA 5CO7A 4M75C 5CKEA 4IUQA 1Q86C 1N8RC 1VQ6T 1VQ8A 4OGEA 1G3TA 2EJGA 2EFIA 4A4FA 4XQ3A 3INZA 1RL2A 3RKYA 2VYTA 3JRZA 4D6WA 4E7HA 4M78E 1KG1A 2AHJB 2HD0A 3HFNA 1VQ4A 4X9DA 4J6YA 3L2QA 4C92D 2RM4A 4LDXA 3ZFJA 3JCMe 2K5IA 2C06A 1N9SA 3E9GA 2V8JA 3CCQT 1KD1C 2FYKA 4HCBA 4M7DD 3OQ5A 4JRPA 1VQNT 2F69A 4F7UE 3VU3C 3VYGA 3G4SA 4ELZC 4OF1A 5HK0A 4QW2A 5CKFA 5GANj 2LQ8A 1OZ2A 3JB9J 4EMKA 5GAN8 2MMPA 2RI5A 2LT4A 5GAN4 3CCLA 2L89A 2OTJT 3SWNB 4FT2A 3UDCA 4MDXA 4A54A 2JUFA 4P5NA 4ZTJA 3H6ZA 3M57A 2BKDN 4BI4A 3QUIA 4LDYA 5GMKj 2E1HA 4FSXA 2RI2A 2RB6A 1VQPT 3BW1A 3LLRA 3OSVA 5J39A 4M77G 4LD9K 2G3RA 3JB9F 4M78B 5LJ3h 3OYAA 3QSUA 1NPPA 3PGGA 3CCRA 5KCHA 5GAOm 2FL7A 4JS5A 1WPYA 1XOVA 2MWOA 5CQXA 4J7IA 1QVFA 4M7AF 4M75G 4IUUA 2EKOA 1Y71A 1Y07A 4J5YA 3OMCA 5LJ5d 3M54A 4C0DC 3CCEA 3LW5E 1QVGS 3OB9A 1NJIU 5GAN5 4PJOD 2QEXT 4M7AC 4F7UB 1M1FA 3M4YA 4JS4A 3PIOA 4X9CA 3VUZA 1M90U 4Z02A 2DD4A 3ER0A 1MHNA 1YI2A 3CD6A 3PNWC 2K2VA 4GLKA 1OZ3A 2GFAA 3VJPA 3WVDB 5CR2A 5LJ3g 1VQ7A 4TVRA 1JBMA 1BIAA 1O9SA 5A0DA 2EQKA 1YJ9A 3I55T 1GXIE 2EQUA 2KMTA 5I2MA 1JB0E 5KE3A 2X4YA 4IURA 1X01A 2DPPB 3HHTB 3MCAB 4CI0C 1Q82U 2GQVA 1VQ5T 3CCMA 3A8OB 3OA6A 3G7ZA 2K5FA 2M0OA 2VGNA 5DY9A 4XTYA 2YHTA 4EMKC 3WXMB 1VQOA 2KDSA 3HRUA 3QZ5B 3WVEB 5GAMj 2Y4XA 3N5BB 4BE2A 4HA8A 1YITA 4M7DA 3SD4A 4OB0B 2GF7A 4PLIA 3CMEA 4N4GA 5CCAA 4L59A 3EFRA 1U1SA 4KUIA 3S3MA 3RKXA 3V7SA 1N9RA 1YIJA 2MAMA 3JCMb 3L2VA 2DJZA 4RCCA 3QJYA 5J26A 3G71T 4B9WA 3CC7T 1X75C 2A7YA 3M55A 4ELYC 4NL2A 5GMKm 1OI1A 3JCMX 3OW2A 4XTVA 1W2BS 4OP0A 4M77E 2LX9A 3M5AA 4C92B 2V8KA 2K4YA 1JJ2A 4M7AG 3E19A 3SDZA 5D6WA 5GAOp 2LCLA 3MEUA 4M78D 5GMKi 1YBYA 1YCYA 4M75E 3JCMP 1M90C 3JCMd 2DXBA 3PIPA 3L2ZA 3QBYA 1FWZA 3P8HA 4EPCA 2OAUA 3OYBA 1B34A 3OYLA 3RESA 5FRMA 1ZHIA 2FHDA 3ZEHA 3CCJT 2JN0A 2WSEE 2QQRA 2A3LA 2CZ7B 4LDUA 4B9XA 1UGRB 4C5EA 4C5HA 1KQSS 4XTUA 3OYCA 3J80E 2RHUA 2F5TX 3FRNA 4PJOA 2O4XB 4FM4B 3SB2A 5DM7R 2FVUA 3GOXA 4II1A 4XU2A 4ZGJB 3UPUA 4LDWA 4HCZA 4E7LA 3DLLA 3EAEA 2E41A 4E7KA 5GANh 3MP1A 4BE0A 5CKHA 5GAMf 2K57A 1HXDA 3JSCA 3L1AA 1QP2A 5GAOr 4M77B 2E64A 1B34B 2LT1A 2QQAA 4M7DF 1R8OB 3G6EA 1VQLA 2CGHA 4L5GA 5LJ3f 4RCBA 3CCUT 1VQ9A 3CC2A 3L2WA 2V8IA 4XU0A 5HY6A 5CVIA 4OGCA 3UWNA 5GMKh 1WGSA 4JDSA 5CKDA 4M75B 5GAOn 2GFUA 3A5ZB 5CIUA 3M59A 3VYHB 3OYNA 3KUFA 1MGQA 2QA4T 2DXUA 1XQHA 3OYYA 2E12A 3LGFA 5IT9E 2D6FA 5A0LA 3V8LA 3CCST 4A4EA 4DOWA 2XU8A 2XICA 4PLLA 5GAN3 3OYMA 3J81E 3PT9A 1BI1A 4C5GA 4A53A 3O8VA 3OYKA 2X4JA 5M9OA 2XK0A 5HKCA 5DLOA 2RH2A 2ZPBB 1PSEA 1OYXA 4MZMA 4BUGA 3SWNA 1UGQB 3HP9A 3RMQA 3MEAA 2XDDA 4M7AE 2XI9A 3A8HB 2JTMA 4O5VA 2VC8A 3PMIA 4O6JA 3GIBA 1YJNT 2WSCE 3CPFA 4C8QF 1VIFA 2OTLA 1K9MC 2IG0A 2R57A 1I81A 1X6OA 2DTIA 4FL6A 3JB9I 2K3YA 2KAFA 3MEWA 4M78A 4RG8A 3QYHB 4C8QC 2VXEA 2RJEA 4OMFB 3S6WA 3RUXA 4QVCA 2PUOB 1VQMT 3V8KA 2D9TA 3FB9A 2PQWA 3FEOA 5L8RE 5FLXE 1YHQT 1VQ6A 2CYZB 2ZZDA 2LTOA 4A4GA 2KVQG 4MMLA 4BY6C 1YJWT 4QQDA 4F7UA 2R5MA 2RJFA 2DO3A 3QXEB 3DKMA 5GAMh 1M8VA 1BKBA 1G3SA 3QIIA 2HNIA 1Q81C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OSS C;  2Y4Y A;  2Y4X A;  2LNV A;  2IVW A;  2LC4 A; 
#chains in the Genus database with same CATH topology
 4JPB W;  2EYY A;  1GBR A;  5IAY A;  3VRY A;  3MO8 A;  2EYQ A;  4M77 D;  2I2L A;  3RIR A;  2DL4 A;  3CPW P;  2GCX A;  4KGX B;  1M3B A;  1HK9 A;  5KE2 A;  3CXC A;  4J9I A;  1ZSZ A;  3NTH A;  3OYJ A;  1V29 B;  5KCO A;  3TRE A;  2K3B A;  1UGV A;  5FU6 C;  3OYH A;  2DRK A;  1RI0 A;  2EQM A;  1FMK A;  1G3W A;  3EG3 A;  1SHG A;  3QZ9 B;  1VOM A;  2EGC A;  5GAN f;  2C0T A;  1OOT A;  1ZSZ B;  1PRL C;  2RF0 A;  1AWO A;  1LCK A;  4C92 A;  1YJ9 Q;  1FMW A;  4L6V 5;  3V8J A;  2DTH A;  2RHZ A;  1E6H A;  1NZ9 A;  4EMH A;  3CCM Q;  2HDA A;  2MWP A;  2YRD A;  2KQW A;  1VQO Q;  2QQS A;  3I56 T;  2B8A A;  3P8B B;  4PFP A;  1K73 R;  3P8D A;  4FYY B;  1YIJ Q;  5J3B A;  2OX7 A;  1PCX A;  1I4K 1;  5AYF A;  1M9S A;  3M9Q A;  1AZG B;  4M77 A;  2E4H A;  2RHX A;  2V26 A;  2FEI A;  1TG0 A;  5IHK A;  5LJ5 j;  4GY5 A;  5EG2 A;  3MHX A;  2YUQ A;  1FMV A;  1N8R U;  2VV5 A;  1Q82 C;  4J9D A;  2KYB A;  5KYU A;  1OUL A;  2H3J A;  2DD5 A;  2ED1 A;  3D7S B;  3NMZ C;  4LD6 A;  1S1N A;  2LDM A;  2XKO C;  4C92 C;  2CKK A;  4F7U G;  3CQT A;  3QYG B;  3CCJ A;  1VQL Q;  4AFU C;  2IVW A;  2SRC A;  4PNO A;  4VUB A;  2X35 A;  1PNJ A;  3MEV A;  4IKF A;  3M58 A;  2L0A A;  1TS9 A;  2HKQ B;  2C0O A;  1WJQ A;  2HAX A;  4FCY A;  4C8Q B;  2FG0 A;  4FIB A;  1M3C A;  4ATO A;  2I0N A;  2P0P A;  2FB7 A;  4ZGE B;  2Y90 A;  4BY6 B;  1UGP B;  4RTU A;  1QVF P;  2JOY A;  5GAO l;  2M16 A;  3VRZ A;  1OU8 A;  1PG5 B;  1KHI A;  2EW3 A;  2BUD A;  3JCM J;  4M7D G;  5GAN e;  4NOY A;  1VQ6 Q;  5HCK A;  3HTR A;  4ORZ A;  4MZP A;  2EYX A;  4LUD A;  3E2U A;  5LJ3 d;  3ASK A;  3CCE T;  2IPO B;  2ECZ A;  3OYD A;  2EKH A;  1YI2 T;  3M56 A;  2GTJ A;  1Z9Q A;  1VQ7 T;  1JRI A;  1IRE B;  1EFN A;  1M1K U;  1YNZ A;  2DKG A;  2YRC A;  2AZV A;  2LNH B;  4HKE A;  5IN1 A;  4M78 F;  1U8R A;  1XJW B;  2CSI A;  3CEY A;  4EMK B;  4PJO G;  3DB4 A;  2EIF A;  3I9Q A;  3AHU A;  2LJ3 A;  1M30 A;  3OW2 P;  1VQP Q;  2JM9 A;  4DBH A;  1YIT T;  2RMO A;  4BE1 A;  4KGZ B;  5FU7 B;  4LN2 A;  1XTD A;  1Q82 R;  5CK9 A;  3A8G B;  3BDL A;  5LJ5 g;  5I2S A;  4C92 E;  3BY7 A;  1W4S A;  1JU5 C;  2YSQ A;  2JMC A;  2J6O A;  3LX7 A;  1IGU A;  1QP3 A;  2FPF A;  2HMA A;  4R0K A;  1M1K C;  4WCI A;  4HCC A;  4GBQ A;  4PK4 A;  1G5V A;  4CC7 A;  2BIV A;  1BB9 A;  2HEQ A;  2X4X A;  4NL3 A;  1MMN A;  3E1S A;  3JCM V;  1U06 A;  1VQK A;  4JRQ A;  1Q86 U;  1OPK A;  3OS5 A;  3C94 A;  1UJ0 A;  2O01 E;  2CUB A;  2EJ9 A;  4LDV A;  4UC4 A;  3CC2 T;  1OPL A;  3LWI A;  4M4Z A;  2CP5 A;  2M51 A;  2DM1 A;  1UHC A;  2E3I A;  2ZAE A;  1IHW A;  1K9M U;  5IXF A;  2RA2 A;  4JLI A;  2DEQ A;  2CZ6 B;  1OX9 A;  4EMG A;  1Q7Y C;  1QVP A;  5HK3 A;  2CH4 W;  3GPL A;  4M77 F;  2HSP A;  1N6A A;  2XDP A;  4FU6 A;  2LMJ A;  5KH6 A;  3L2R A;  1UGS B;  4CC3 A;  1ZQ1 A;  2DNU A;  2L3S A;  4MDW A;  4PJL A;  4IUV A;  4QVZ A;  1Q86 C;  4IUQ A;  1VQ8 A;  1G3T A;  2EJG A;  2O2O A;  2EFI A;  4A4F A;  3INZ A;  2F2X A;  1D1A A;  3JRZ A;  3CCS Q;  2DX1 A;  1E7O A;  2K5I A;  2M02 A;  4M7D D;  1VQN T;  2F69 A;  4ELZ C;  2K2M A;  4IIM A;  1R0B G;  2X9H A;  5GAN 8;  5AT1 B;  4CC2 A;  3EGX A;  1RAI B;  4IIO A;  7AT1 B;  3QUI A;  2RI2 A;  3LLR A;  2BZY A;  4LD9 K;  1NPP A;  1YHQ Q;  1D0X A;  3PGG A;  3CCR A;  1XOV A;  1M1K R;  4GLM A;  2DL3 A;  4IUU A;  1Y71 A;  3OMC A;  3QWX X;  4C0D C;  1QVG S;  4PJO D;  2QEX T;  4F7U B;  2COW A;  3M4Y A;  3VS0 A;  3PIO A;  3CD6 A;  2DD4 A;  3ER0 A;  1MHN A;  3CCV Q;  2K2V A;  4KGV B;  1OZ3 A;  1RAH B;  4TVR A;  2QAS A;  1UUE A;  2SEM A;  5I22 A;  1BIA A;  1GCP A;  1D0Y A;  3I55 T;  2EQU A;  2PNI A;  1IGQ A;  4JJB A;  3OA6 A;  2FRY A;  1W70 A;  2YHT A;  3WXM B;  3HRU A;  2ROT A;  3QZ5 B;  2Y4X A;  4M7D A;  4HA8 A;  4JZ4 A;  3I55 Q;  3SD4 A;  3CME A;  3ULR B;  3RKX A;  1N9R A;  1Q7Y R;  2MAM A;  3QDF A;  3JCM b;  1JXM A;  2DJZ A;  3QJY A;  3G71 T;  4B9W A;  1D09 B;  2A7Y A;  2LJ1 A;  4OP0 A;  1MMG A;  4M7A G;  4LE9 A;  5ECA A;  1W2B P;  1WIE A;  2QGF B;  1YBY A;  1YCY A;  3G71 Q;  3QBY A;  1FWZ A;  1Q86 R;  1S72 Q;  1ZHI A;  2JN0 A;  2NUZ A;  2CZ7 B;  4LDU A;  4C5E A;  1UGR B;  1CKA A;  2RHU A;  4PJO A;  2O4X B;  3SB2 A;  1KQS P;  1A0N B;  2G6F X;  1X2Q A;  3DLL A;  1UDL A;  4E7K A;  2K57 A;  3RDV A;  4KH1 B;  4HCK A;  2E64 A;  4PFO A;  1R8O B;  4JZ3 A;  5CVI A;  4OGC A;  4E2F B;  5CKD A;  4M75 B;  4PJO B;  2DXU A;  2E12 A;  5IT9 E;  1QKX A;  3V8L A;  2VAS A;  2XIC A;  4PLL A;  5GAN 3;  3OYM A;  3J81 E;  1BI1 A;  4C5G A;  3CC4 Q;  5M9O A;  1I07 A;  2RH2 A;  4BUG A;  4MZM A;  3SWN A;  2KBT A;  1YCS B;  4O5V A;  1VYU A;  2WSC E;  1VIF A;  2JT4 A;  1SRL A;  3G1J A;  2IG0 A;  1I81 A;  4FL6 A;  3JB9 I;  1VQ4 Q;  1PKS A;  2CP7 A;  3S6W A;  4OMF B;  3M0T A;  3RUX A;  5KYY B;  3FB9 A;  2PQW A;  5L8R E;  2KVQ G;  3G4S Q;  1YJW T;  2CP3 A;  3M0U A;  3CCL Q;  1G3S A;  1Q81 C;  4EIK A;  3CMA T;  3TEE A;  4HVW A;  3LYI A;  4N0A A;  3CCQ A;  1YJW Q;  3OS1 A;  3EG9 B;  1BBZ A;  5GAO q;  4J9G A;  4E7Z A;  3A1P A;  1WYX A;  4D8K A;  1AD5 A;  2P84 A;  2YLB A;  4A4H A;  2F5K A;  3CMA Q;  2RO0 A;  2OTJ A;  1U3O A;  5FWB A;  4PL6 A;  4PFZ A;  1AOJ A;  4XU1 A;  2DYI A;  1MV3 A;  5LJ5 h;  1Y57 A;  2R58 A;  1KHC A;  4C8Q G;  2BZX A;  5A0G A;  1M5Q 1;  4IUT A;  1TWB A;  2LRQ A;  2AKK A;  1YWO A;  2RJD A;  4F7U F;  2DL8 A;  2XG8 D;  2XMF A;  3C4S A;  1WXB A;  3RER A;  3RMS A;  2NUP B;  2FPD A;  2JTF A;  3PTA A;  1BIB A;  1Q95 G;  5IXB A;  2KXD A;  4E7I A;  2EJF A;  2RJC A;  2L8D A;  2P4T A;  3EG1 A;  1NPR A;  1VQ5 A;  1ZX6 A;  1QVG A;  2J6K A;  1D3B B;  4M7A D;  2KNB B;  4J83 A;  4YTL A;  1LJO A;  3FIF A;  2E65 A;  2P0K A;  3JAM E;  3QO3 A;  4C0F A;  2F1L A;  1QQJ A;  2D8H A;  2DAQ A;  1SG5 A;  2QGG A;  3CC7 A;  3L42 A;  5CQY A;  5FRN A;  1GFC A;  5L23 A;  1UEB A;  2MCN A;  1FX7 A;  1G83 A;  3TCJ A;  1BK2 A;  4ME7 A;  2KI7 A;  3O5Z A;  1KD1 U;  3G6E Q;  1VQ9 Q;  4X1V A;  2QI2 A;  1GBQ A;  2QQ9 A;  4X34 A;  2JXB A;  5DLQ E;  2ZCF B;  2QK0 A;  1KC8 U;  2HQE A;  3IQL A;  4J6W A;  3V7C A;  1I8F A;  3E9F A;  3GNG A;  4HT9 A;  5LJ5 f;  1ZUY A;  3SEM A;  2OTL T;  3CCU A;  4PJO F;  1W6X A;  2QA4 A;  3AT1 B;  4M7A A;  3NTK A;  1TSF A;  1RAA B;  2F2W A;  2OTL Q;  3RKW A;  1V1C A;  4DEY A;  2D0N A;  3H8Z A;  2DA9 A;  2GGR A;  5FW9 A;  1BI0 A;  1RAC B;  1SEM A;  1X2K A;  2WAC A;  1K76 A;  2A28 A;  5GAM d;  4PJJ A;  1G3Y A;  3EFO B;  4M7A B;  2EYZ A;  1VIE A;  4FW1 A;  1YJN A;  4XAX B;  2ZGW A;  2M9U A;  5FU6 B;  2MI6 A;  5D6X A;  1VQM A;  4XU3 A;  2LQK A;  1KC8 C;  2DIG A;  2CH4 A;  1I5L A;  1PKT A;  2ZPE B;  2VKN A;  2CP0 A;  4EDU A;  5I21 A;  1YJ9 T;  4FW2 A;  3UAT A;  3CCM T;  3MET A;  1JJ2 S;  3HL8 A;  4M78 C;  2EGE A;  4C8Q D;  1VQO T;  1ZA2 B;  1UG1 A;  2W10 A;  3LWH A;  1YIJ T;  2OAW A;  4BI3 A;  5CAI A;  3J7A F;  2M1H A;  1GCQ A;  4Y28 E;  2LP5 A;  3Q1J A;  1C1A A;  4XK8 E;  4DQ2 A;  1WQW A;  3JCM W;  1FYN A;  3EFS A;  2LVM A;  1K0X A;  1ZSZ C;  4F04 B;  2KE9 A;  4MZT A;  2ZPG B;  2NYS A;  4FSS A;  4OB3 B;  4BD3 A;  4JRI A;  3I56 A;  2VUB A;  1AT1 B;  1X69 A;  3I35 A;  1VQL T;  4LUE A;  5LJ5 e;  2E6Z A;  3FLG A;  4XTX A;  1KQ1 A;  3FC3 A;  4C8Q A;  4J9B A;  2PVG B;  4ZNX A;  2OJ2 A;  2RI3 A;  4RTX A;  2E5Q A;  1MNE A;  3VS1 A;  3CCJ Q;  1WQ7 A;  5KYN A;  3HRS A;  5GAN 2;  4DEX A;  4AFQ C;  1ZBX A;  1KC8 R;  1JEG A;  4M77 C;  3H0H A;  1N8R C;  1VQ6 T;  4J9E A;  3CXC P;  4XQ3 A;  4DBR A;  3RKY A;  2YXY A;  3TVT A;  4M78 E;  2AHJ B;  3HFN A;  5FWC A;  4J6Y A;  3L2Q A;  2BZ8 A;  2C06 A;  4Z88 A;  2K6D A;  4HCB A;  2FYK A;  2PZ1 A;  2VVK A;  4QT7 A;  2BTT A;  3VYG A;  1TOV A;  2PTK A;  1PM3 A;  3NPF A;  5GAN j;  1LVK A;  3JB9 J;  4EMK A;  4E6R A;  2J6F A;  2RI5 A;  2L89 A;  8ATC B;  4MDX A;  2A0F B;  4RTT A;  2E1H A;  1WDX A;  1VQP T;  3BW1 A;  1SHF A;  3OSV A;  5LJ3 h;  2EPD A;  2EQI A;  4M7A F;  4M75 G;  1M2V B;  4J5Y A;  3M54 A;  3CCE A;  1BCM A;  1NJI U;  3OB9 A;  3H41 A;  1OV3 A;  3VUZ A;  1TU0 B;  1YI2 A;  1VQ7 A;  3WVD B;  1BCO A;  4Y92 A;  1GXI E;  2KMT A;  1RAE B;  2AIR B;  2LCS A;  5I2M A;  3ZL7 C;  1JB0 E;  2DER A;  2X4Y A;  1X01 A;  2KRN A;  3HHT B;  3TSW A;  4PJN A;  3A8O B;  2M0O A;  2JTE A;  1U5S A;  2VGN A;  3VS6 A;  4EMK C;  2DL7 A;  5GAM j;  1YIT A;  2GF7 A;  1NBE B;  5CCA A;  1RAD B;  4KUI A;  3RNJ A;  3S3M A;  5I11 A;  2A37 A;  5GMK m;  3JCM X;  1OI1 A;  4XTV A;  4M77 E;  2LX9 A;  2COY A;  2V8K A;  2VB6 A;  1Z9Z A;  1JJ2 A;  3MEU A;  3JCM d;  1VQK Q;  2DXB A;  3EHR A;  3L2Z A;  4EPC A;  4RTW A;  2FZK B;  2OAU A;  1N8R R;  3OYL A;  3RES A;  5FRM A;  2FHD A;  2QQR A;  2A3L A;  4B9X A;  1WHL A;  4XTU A;  3OYC A;  3J80 E;  2F5T X;  4FM4 B;  1H8K A;  5DM7 R;  2FVU A;  4II1 A;  4XU2 A;  1AWW A;  3FJ5 A;  2DBK A;  3MP1 A;  1F1B B;  3JSC A;  2ABL A;  1WHK A;  2QQA A;  1ARK A;  2CGH A;  5LJ3 f;  1NEB A;  3CC2 A;  5HY6 A;  3UWN A;  5GMK h;  2DMO A;  4JDS A;  2O88 A;  1RAF B;  5GAO n;  3A5Z B;  3M59 A;  3OYY A;  5A0L A;  3CCS T;  4DOW A;  4Z89 A;  2GTO A;  2J05 A;  3PT9 A;  4A53 A;  2X4J A;  2NWM A;  5DLO A;  3HP9 A;  4HXJ A;  3PMI A;  2L2P A;  4O6J A;  1PD0 A;  3CPF A;  4C8Q F;  2RN8 A;  1K9M C;  1VYT A;  2RQR A;  2KAF A;  3QYH B;  2RJE A;  5D7U A;  2NUT A;  1YHQ T;  2CYZ B;  2LTO A;  2DIL A;  4F7U A;  2DO3 A;  1IB8 A;  3DKM A;  1C6V X;  4OB2 B;  3CPW S;  4C0D B;  2B86 A;  2FZG B;  2NUT B;  3I5R A;  3CCV T;  3DB3 A;  1VQN A;  4DOV A;  1B7T A;  2L3Q A;  2LCC A;  4M75 D;  1K9A A;  3REB B;  3CCR Q;  3LGL A;  4F17 A;  1YFN A;  5GAM g;  2HL3 A;  1NJI R;  1Y7X A;  2QTX A;  1QWE A;  4XTW A;  3CD6 Q;  4RG2 A;  2QAZ A;  2XHC A;  4V2S A;  2R5A A;  1RLQ C;  1ACM B;  4AG1 C;  3M53 A;  3VS5 A;  2KT8 A;  1YWP A;  2RQT A;  3GF5 A;  2QEX A;  2XD0 A;  1PSF A;  1QLY A;  2Y4Y A;  3HRT A;  2JMA A;  2AK5 A;  4PKC C;  4FYX B;  3SHW A;  2MPX C;  4ZN3 A;  4JJD A;  3CME Q;  1S72 T;  1QW1 A;  3I55 A;  2O4X A;  3QDR B;  4KUL A;  5LJ3 e;  4ZGD B;  1BI2 A;  2VWF A;  3RR6 A;  2ESW A;  5GJV B;  2DK3 A;  3SFM A;  3MP8 A;  4MMK A;  2EWN A;  2GNC A;  2D8J A;  2Z0W A;  1EIF A;  4DBF A;  2YWW A;  4M75 A;  3G71 A;  2NLU A;  4KT0 E;  1M2O A;  1K9M R;  1YP5 A;  4J6X A;  3HFO A;  2QDY B;  3A8M B;  2E10 A;  4M7D C;  1Y96 B;  3CC4 T;  1NYG A;  2E5K A;  2HBW A;  4HT8 A;  3TU4 K;  2YT6 A;  4A4K A;  4JJN K;  2EVR A;  2YRV A;  1T3L A;  3ZBD A;  2L3R A;  1DJ7 B;  3MJX A;  3EGD B;  2OI3 A;  2QXF A;  3FDR A;  2K3X A;  3GBQ A;  2ED0 A;  5KYY A;  1H3Z A;  1VQ4 T;  4J7F A;  5KYX B;  2JS2 A;  2ZPI B;  1WZO A;  2H8H A;  1UJY A;  1RLP C;  1LNX A;  2DLP A;  3G4S T;  1QVF S;  2HQH A;  2EQJ A;  1NYF A;  3CCL T;  4PJO C;  3FJP A;  2LNV A;  3C0C A;  3EG9 A;  4J9C A;  4C92 G;  1KQ2 A;  4C5I A;  2XDB A;  1RUW A;  3C12 A;  3OBY A;  1WJR A;  1SKU B;  2DTO A;  3OSS C;  2RK1 A;  4QKU A;  1QWF A;  5IHN A;  3S3N A;  1NEG A;  5GMK e;  3CBM A;  2PUK B;  2KY9 A;  1BYM A;  1I0C A;  1WXT A;  2CS7 A;  2JVV A;  4A63 B;  2HBP A;  1K8A U;  3H9N A;  1YJW A;  3KXT A;  3SWN C;  2NUP A;  3OW2 S;  2RHY A;  3CMA A;  2DZ9 A;  4QVD A;  1OU9 A;  1ABQ A;  4E47 A;  3X20 B;  4LNP A;  1D3B A;  3JV3 A;  1NG2 A;  2YUP A;  3CPW A;  2K79 A;  3NTI A;  2CSQ A;  3M0Q A;  4M7D E;  3THK A;  1NLP C;  4N4H A;  4N0A C;  1M27 C;  2O9V A;  2KRS A;  4QQ6 A;  1K73 U;  1K8A C;  1I1J A;  1VQ5 Q;  3OY9 A;  1ZSG A;  3EG0 A;  3OYE A;  1EZZ B;  4HVV A;  4OMN A;  4NS5 A;  1R0C B;  4KH0 B;  1X6G A;  3G6E T;  5D6Y A;  1VQ9 T;  4PJO E;  1U1T A;  5GAN d;  3VS4 A;  3PE0 A;  3CC7 Q;  3OBW A;  1H92 A;  4R56 A;  1CKB A;  2YLC A;  3PFS A;  4Q5W A;  2E70 A;  2CT4 A;  3JCM g;  2RK2 A;  1AZE A;  5C0M A;  1N27 A;  4RUG A;  3OYG A;  3CBP A;  4XTZ A;  1SRM A;  3A98 A;  5FRO A;  3EH1 A;  2CZ0 B;  3QKJ A;  4WF2 A;  1WJS A;  2VGM A;  4M75 F;  2DXT A;  4RKU E;  4BI8 B;  2JZ2 A;  3EFO A;  5CO7 A;  2GQI A;  3CCU Q;  1HD3 A;  3RBB B;  2QA4 Q;  2DEU A;  1KG1 A;  4HVU A;  1BU1 A;  4C92 D;  3ZFJ A;  1N9S A;  2EYW A;  3E9G A;  1KD1 C;  2KGT A;  2X51 A;  4OF1 A;  5HK0 A;  1N5Z A;  5CKF A;  1M3A A;  5EC7 A;  1OZ2 A;  2MMP A;  1YJN Q;  2JUF A;  4P5N A;  4ZTJ A;  3M57 A;  4Z8A A;  4LDY A;  1HJD A;  2LJ0 A;  2RB6 A;  5J39 A;  1VQM Q;  1WXU A;  2G3R A;  4M78 B;  3JB9 F;  3QSU A;  2FRW A;  5KCH A;  5GAO m;  4JS5 A;  1QVF A;  5CQX A;  4J7I A;  1K8A R;  2HKN A;  3LW5 E;  1T0H A;  5KYW A;  1PHT A;  4M7A C;  3H0F A;  1M1F A;  1M90 U;  2J06 A;  1QVG P;  3VS7 A;  3VJP A;  2GFA A;  1JBM A;  1YJ9 A;  2BE9 B;  5KE3 A;  5KYW B;  4IUR A;  2EBP A;  1PC0 A;  1YN8 A;  1Q82 U;  3CCM A;  1X43 A;  3G7Z A;  2E3H A;  4XTY A;  3EGU A;  1WLP B;  1VQO A;  3WVE B;  3N5B B;  4BE2 A;  2V1Q A;  4OB0 B;  4PLI A;  3EFR A;  1YIJ A;  2LX7 A;  2W0Z A;  4RCC A;  2KYM A;  3LH5 A;  4J9F A;  1KJW A;  4ELY C;  4NL2 A;  3OW2 A;  1W2B S;  2RNA A;  3BE3 A;  4C92 B;  3M0P A;  2K4Y A;  1HSQ A;  1UE9 A;  3E19 A;  5GAO p;  2K7A A;  2LCL A;  5GMK i;  1M90 C;  3I56 Q;  3PIP A;  3OYB A;  3P8H A;  2DE0 X;  1B34 A;  1HYO A;  1GRI A;  3ZEH A;  3CCJ T;  2WSE E;  1KQS S;  1ZBJ A;  1RAB B;  3M0R A;  3GOX A;  3UPU A;  1PWT A;  3EAE A;  2E41 A;  1UFF A;  1GCQ C;  4BE0 A;  5CKH A;  5GAM f;  1KD1 R;  1HXD A;  3L1A A;  1OQK A;  2MIO A;  1QP2 A;  3UF4 A;  4M77 B;  1B34 B;  2LT1 A;  4JJC A;  1SSH A;  1VQL A;  4L5G A;  2CP2 A;  4RCB A;  1WI7 A;  3L2W A;  2V8I A;  4XU0 A;  1WGS A;  2QYZ A;  2GFU A;  1TTH B;  5CIU A;  1IHV A;  3VYH B;  3KUF A;  1XQH A;  6AT1 B;  4FYV B;  2KRO A;  3LGF A;  2JJ9 A;  4A4E A;  1D1C A;  2XU8 A;  5KYU B;  4OMM A;  3EG2 A;  3OYK A;  2XK0 A;  1UGQ B;  2XDD A;  3RMQ A;  3MEA A;  4M7A E;  2VC8 A;  4AFZ C;  4B6M A;  2L3P A;  2DTI A;  4KRT A;  1D0Z A;  4J9H A;  2DFU A;  4C8Q C;  3V8K A;  2D9T A;  1D1B A;  3FEO A;  4WTO B;  1VQ6 A;  1M2V A;  4A4G A;  2HL5 C;  4BY6 C;  4QQD A;  2R5M A;  1JXO A;  3QXE B;  1BKB A;  5GAN 6;  3GIB A;  4KUD K;  1PRM C;  2CUD A;  2H3E B;  3X25 B;  5CKB A;  3KFV A;  1I5O B;  1T3S A;  2X4W A;  3OMG A;  2EAY A;  3HPW A;  2AKL A;  1FXX A;  4E7S A;  5IHI A;  2LZ6 B;  3CCE Q;  3QHS A;  1P92 A;  1R77 A;  1GL5 A;  1H3H A;  3L2U A;  3KBG A;  2X3X D;  1VQP A;  2C0I A;  3UT1 A;  1M90 R;  1YI2 Q;  3R6O A;  2LQN A;  3HKS A;  1VQ7 Q;  1MND A;  3UA6 A;  2F2V A;  3S3O A;  2YUO A;  2PVD B;  2KSS A;  5C6S A;  4IUP A;  2PVO B;  2M0Y A;  1OX8 A;  1C0M A;  1ZUK A;  1X27 A;  3QPH A;  2DXC A;  3VV0 A;  3CBO A;  1B3Q A;  5FU7 C;  1YIT Q;  1VQK T;  4LXC A;  3JB9 G;  2COZ A;  5GAM e;  1H64 1;  1WFW A;  3TSZ A;  2LQW A;  2K5L A;  1NJI C;  1Q7Y U;  2P0Q A;  1IRX A;  3V7R A;  2WSF E;  3UA7 A;  4ESR A;  1PD1 A;  2MOX A;  3M4G A;  3X24 B;  2RQW A;  1ZA1 B;  2AT1 B;  4FYW B;  2ZPF B;  2KXC A;  3NHN A;  2IIM A;  3JB9 H;  4DA4 A;  9ATC B;  3JCM h;  3PMT A;  1E6G A;  4C92 F;  1WHG A;  2HCK A;  4C8Q E;  3REA B;  2J7I A;  1UB4 A;  2XID A;  2KK4 A;  3BFM A;  5IH2 A;  4ZTF A;  2L5Q A;  3X28 B;  3X26 B;  3NGP A;  1K4U S;  3MKD A;  4OMO A;  3A8L B;  1ZUU A;  3CC2 Q;  4CC4 B;  1VQ8 T;  5GAN g;  1W2B A;  4C0G A;  2PU9 B;  4E7J A;  2QQB A;  1XNI A;  3OS2 A;  1VUB A;  4ZN1 A;  2DL5 A;  4RMO A;  1VQ8 Q;  3MPU B;  4N4I A;  4BB7 A;  3GLX A;  4AFS C;  1KQS A;  3NFC A;  5A2Q E;  1MMD A;  1NLO C;  4OMQ A;  3CCS A;  4CRI A;  1K0S A;  2A36 A;  1AWJ A;  1NM7 A;  1KSW A;  4DBQ A;  2P4R A;  2AZS A;  2FO0 A;  3CCR T;  2KEA A;  4BAC A;  2KT1 A;  2D1X A;  3T9N A;  1IXD A;  2O9S A;  2ROL A;  3CD6 T;  2DRM A;  3VS3 A;  2CZ1 B;  3OYF A;  3ME9 A;  1YHQ A;  1ZLM A;  1M8V A;  1IZ6 A;  1M4Z A;  1VQN Q;  1IO6 A;  3C95 A;  2JNG A;  1TUG B;  3QG1 A;  2DVE A;  2A08 A;  3I5S A;  4C0Z A;  3JCM f;  4R55 A;  4JRK A;  2DZC A;  3VUB A;  3EGX B;  3CCV A;  2EGA A;  2X3W D;  1QKW A;  5GMK l;  1JJ2 P;  3PVL A;  1JQQ A;  4J8O A;  3CME T;  1J3T A;  1O75 A;  4OMP A;  4JLG A;  2DJQ A;  4BDY A;  1AHJ B;  2HQX A;  2QEX Q;  1X6B A;  2K9G A;  2LC4 A;  3LH0 A;  2D0Q B;  2ZPH B;  2MF2 A;  1M1G A;  4OB1 B;  3JB9 D;  1TUC A;  2DYB A;  3GNF B;  4KBM B;  1NE8 A;  1BI3 A;  2JM8 A;  2RQV A;  3M0S A;  4RTY A;  3VKI A;  2E6N A;  3BDU A;  1CSK A;  5LJ3 j;  4Y91 A;  4QQG A;  1G8X A;  2RD1 A;  3DLM A;  4JUV A;  5LL6 S;  1Y96 A;  2O31 A;  4OVA A;  1WHH A;  3QJ6 A;  2CRE A;  1KIK A;  1WNL A;  4M78 G;  1S72 A;  1GFD A;  2FZC B;  4M7D B;  1T0J A;  1LOJ A;  3EGD A;  2DIQ A;  1RAG B;  2CDT A;  3OYI A;  3F70 A;  3MP6 A;  5KYX A;  4BDZ A;  2MYS A;  4RTZ A;  1QMC A;  1AWX A;  2JS0 A;  2RHI A;  4OML A;  1TH7 A;  3GP8 A;  2VXF A;  4FT4 A;  1TXQ A;  5GJW B;  1OEB A;  3JCM c;  1SSF A;  3HSB A;  3URG A;  1MMA A;  3OS0 A;  1Q81 U;  3JCM Q;  1QCN A;  3U23 A;  2DET A;  5GAN 7;  3CC4 A;  1VYV A;  3CXC S;  4M75 C;  2ENM A;  5CKE A;  4OGE A;  1RL2 A;  2VYT A;  4E7H A;  4D6W A;  3H0I A;  1MUZ A;  2QDL A;  2HD0 A;  1VQ4 A;  4X9D A;  2DVJ A;  2RM4 A;  4LDX A;  3JCM e;  2V8J A;  3CCQ T;  4K11 A;  1JO8 A;  3OQ5 A;  3PVQ A;  4JRP A;  2RPN A;  4F7U E;  3VU3 C;  3G4S A;  4QW2 A;  2LQ8 A;  5GAN 4;  2LT4 A;  3CCL A;  2OTJ T;  3SWN B;  4FT2 A;  3UDC A;  1MV0 B;  4A54 A;  1WX6 A;  3CCQ Q;  3H6Z A;  3TQ7 P;  2BKD N;  4BI4 A;  8AT1 B;  5GMK j;  1RI9 A;  4FSX A;  4M77 G;  2QTV A;  1QCF A;  3OYA A;  2OTJ Q;  2FL7 A;  1AEY A;  1WPY A;  2ATC B;  2MWO A;  1M8M A;  2EKO A;  1Y07 A;  5LJ5 d;  5GAN 5;  1K1Z A;  4JS4 A;  4X9C A;  4Z02 A;  1SPK A;  2HZY A;  3PNW C;  4GLK A;  5CR2 A;  5LJ3 g;  1UTI A;  1WA7 A;  1O9S A;  5A0D A;  2EQK A;  4AT1 B;  1G2B A;  2DPP B;  3MCA B;  4CI0 C;  1VQ5 T;  2GQV A;  3QWY A;  1KK7 A;  2K5F A;  5DY9 A;  2KDS A;  4D8D A;  4N4G A;  4L59 A;  3VS2 A;  1U1S A;  3V7S A;  1WHM A;  3L2V A;  5J26 A;  1KFZ A;  1AVZ C;  1Y0M A;  3CC7 T;  1X75 C;  3M55 A;  4AG2 C;  1LPL A;  3M5A A;  2JW4 A;  4F16 A;  2MK5 A;  5D6W A;  3SDZ A;  4M78 D;  4M75 E;  3JCM P;  2DBM A;  1V76 A;  4C5H A;  3EH2 A;  1EX4 A;  3FRN A;  1WHJ A;  1QCO A;  2KR3 A;  4ZGJ B;  4LDW A;  4HCZ A;  4E7L A;  5GAN h;  3EHQ A;  2CP6 A;  5GAO r;  1UEC A;  1W1F A;  4M7D F;  3G6E A;  1VQ9 A;  3CCU T;  4F14 A;  2BE7 D;  1K73 C;  4RTV A;  3OYN A;  2DF6 A;  1MGQ A;  2QA4 T;  4PJM A;  1UHF A;  2D6F A;  2GBQ A;  1ABO A;  1Q81 R;  2FPE A;  3O8V A;  2QG9 B;  5HKC A;  2ZPB B;  1OYX A;  1PSE A;  1VA7 A;  2HSE B;  4ANJ A;  4AMC A;  2XI9 A;  1B07 A;  3A8H B;  2JTM A;  1YJN T;  2CT3 A;  2OTL A;  2R57 A;  1X6O A;  2RQU A;  2K3Y A;  4M78 A;  3MEW A;  2KRM A;  1TUD A;  4RG8 A;  2VXE A;  4QVC A;  1VQM T;  2PUO B;  1SF9 A;  5FLX E;  3R6N A;  2ZZD A;  4MML A;  2YDL A;  5GAM h;  2RJF A;  2V1R A;  2YUN A;  3QII A;  2HNI A; 
#chains in the Genus database with same CATH homology
 4KUD K;  4OB2 B;  3CPW S;  4C0D B;  3CMA T;  3TEE A;  3X25 B;  5IAY A;  3MO8 A;  5CKB A;  2EYQ A;  4M77 D;  2I2L A;  3LYI A;  3CCV T;  3RIR A;  2X4W A;  4N0A A;  2GCX A;  3CCQ A;  3DB3 A;  1HK9 A;  3OMG A;  3OS1 A;  5KE2 A;  3CXC A;  2EAY A;  1VQN A;  4DOV A;  3HPW A;  5GAO q;  2LCC A;  4M75 D;  3OYJ A;  3NTH A;  1V29 B;  3LGL A;  2YLB A;  4A4H A;  5KCO A;  2F5K A;  3TRE A;  2RO0 A;  1FXX A;  5GAM g;  2OTJ A;  5FU6 C;  3OYH A;  4PL6 A;  1RI0 A;  2EQM A;  3QHS A;  1P92 A;  1Y7X A;  1G3W A;  2QTX A;  4XU1 A;  3L2U A;  3KBG A;  4XTW A;  1VQP A;  4RG2 A;  3UT1 A;  3QZ9 B;  3R6O A;  5LJ5 h;  5GAN f;  2XHC A;  2R58 A;  3HKS A;  1KHC A;  4C8Q G;  4V2S A;  5A0G A;  2R5A A;  1M5Q 1;  4IUT A;  2LRQ A;  3M53 A;  3S3O A;  4C92 A;  2PVD B;  3GF5 A;  4L6V 5;  3V8J A;  2DTH A;  2KSS A;  2RHZ A;  2RJD A;  1NZ9 A;  4F7U F;  5C6S A;  2QEX A;  2XD0 A;  2XG8 D;  1PSF A;  2Y4Y A;  3HRT A;  3C4S A;  4EMH A;  4IUP A;  3RER A;  3RMS A;  2JTF A;  3PTA A;  2PVO B;  2MWP A;  1BIB A;  4PKC C;  2KQW A;  2QQS A;  3QPH A;  2DXC A;  4ZN3 A;  3VV0 A;  3CBO A;  5FU7 C;  1VQK T;  3I56 T;  2B8A A;  3JB9 G;  3P8B B;  4E7I A;  5GAM e;  1S72 T;  2EJF A;  2RJC A;  2L8D A;  2P4T A;  1QW1 A;  1H64 1;  3P8D A;  3I55 A;  2O4X A;  5J3B A;  3QDR B;  2K5L A;  4KUL A;  1NJI C;  1NPR A;  1VQ5 A;  5LJ3 e;  1Q7Y U;  4ZGD B;  1QVG A;  2P0Q A;  1BI2 A;  3V7R A;  1I4K 1;  2DK3 A;  2WSF E;  1D3B B;  3SFM A;  4M7A D;  5AYF A;  3MP8 A;  1M9S A;  3M4G A;  3M9Q A;  4J83 A;  4MMK A;  2EWN A;  4M77 A;  4YTL A;  3X24 B;  2RHX A;  1LJO A;  1EIF A;  3FIF A;  2E65 A;  2P0K A;  2ZPF B;  5LJ5 j;  3JAM E;  3QO3 A;  4GY5 A;  4M75 A;  5EG2 A;  4C0F A;  3MHX A;  4DA4 A;  3JB9 H;  2DAQ A;  3G71 A;  3CC7 A;  2NLU A;  2VV5 A;  1N8R U;  3L42 A;  4KT0 E;  5CQY A;  5FRN A;  1Q82 C;  3JCM h;  3PMT A;  4C92 F;  1UEB A;  2H3J A;  2DD5 A;  4C8Q E;  4LD6 A;  2LDM A;  2XKO C;  1FX7 A;  1UB4 A;  4C92 C;  2XID A;  2CKK A;  2KK4 A;  3BFM A;  4J6X A;  3TCJ A;  2L5Q A;  3HFO A;  4ZTF A;  2QDY B;  4F7U G;  3A8M B;  2E10 A;  4ME7 A;  3X28 B;  4M7D C;  3X26 B;  1Y96 B;  3CC4 T;  3QYG B;  4HT8 A;  3TU4 K;  1KD1 U;  3CCJ A;  3A8L B;  4A4K A;  4JJN K;  2YRV A;  1VQ8 T;  5GAN g;  3ZBD A;  2L3R A;  1DJ7 B;  2QI2 A;  2QQ9 A;  2IVW A;  4C0G A;  1W2B A;  2PU9 B;  4PNO A;  4E7J A;  4VUB A;  4X34 A;  2QQB A;  2X35 A;  2ZCF B;  2QXF A;  5DLQ E;  3FDR A;  3MEV A;  2HQE A;  1KC8 U;  2K3X A;  4IKF A;  1XNI A;  3M58 A;  4PJO B;  3OS2 A;  1VUB A;  4ZN1 A;  1H3Z A;  1VQ4 T;  4J7F A;  3V7C A;  4J6W A;  1I8F A;  2ZPI B;  4RMO A;  1WJQ A;  3E9F A;  2HAX A;  3GNG A;  4HT9 A;  5LJ5 f;  4C8Q B;  4N4I A;  2OTL T;  3CCU A;  4FIB A;  4BB7 A;  3GLX A;  4PJO F;  1LNX A;  1KQS A;  4ATO A;  3NFC A;  5A2Q E;  3G4S T;  1QVF S;  2QA4 A;  2EQJ A;  2P0P A;  4ZGE B;  2FB7 A;  2Y90 A;  4BY6 B;  3CCL T;  4M7A A;  4PJO C;  1UGP B;  3NTK A;  3CCS A;  4CRI A;  3FJP A;  2JOY A;  5GAO l;  2LNV A;  3RKW A;  2M16 A;  3H8Z A;  4C92 G;  1KHI A;  1KQ2 A;  2BUD A;  4C5I A;  3JCM J;  1BI0 A;  4M7D G;  5GAN e;  2WAC A;  4NOY A;  3CCR T;  5GAM d;  1G3Y A;  4BAC A;  2XDB A;  4M7A B;  3C12 A;  3OBY A;  1WJR A;  1VIE A;  4MZP A;  3T9N A;  2DTO A;  1YJN A;  4XAX B;  3OSS C;  2RK1 A;  3CCE T;  5LJ3 d;  3ASK A;  2ZGW A;  3OYD A;  2M9U A;  5FU6 B;  5GMK e;  3S3N A;  2MI6 A;  3CBM A;  2PUK B;  5D6X A;  2KY9 A;  1BYM A;  3CD6 T;  1VQM A;  4XU3 A;  2LQK A;  1YI2 T;  1KC8 C;  3M56 A;  2CZ1 B;  2DIG A;  3ME9 A;  3OYF A;  2CS7 A;  1YHQ A;  1JRI A;  2JVV A;  1VQ7 T;  1IZ6 A;  1IRE B;  1I5L A;  1M4Z A;  2HBP A;  1M1K U;  3C95 A;  1K8A U;  1YJW A;  2DKG A;  2ZPE B;  2JNG A;  3QG1 A;  3KXT A;  3SWN C;  4EDU A;  5I21 A;  2DVE A;  1YJ9 T;  4HKE A;  5IN1 A;  4C0Z A;  4M78 F;  3JCM f;  2RHY A;  3CMA A;  3OW2 S;  4EMK B;  3CEY A;  4R55 A;  1U8R A;  4JRK A;  3CCM T;  4PJO G;  2DZC A;  2DZ9 A;  3MET A;  3VUB A;  3DB4 A;  2EIF A;  3AHU A;  3CCV A;  1JJ2 S;  3HL8 A;  4M78 C;  4C8Q D;  4QVD A;  1VQO T;  5GMK l;  1YIT T;  3CME T;  4J8O A;  1O75 A;  4E47 A;  4BE1 A;  5FU7 B;  4JLG A;  3X20 B;  3LWH A;  1XTD A;  1YIJ T;  4BDY A;  5CK9 A;  1AHJ B;  1D3B A;  2HQX A;  4BI3 A;  3A8G B;  3BDL A;  5LJ5 g;  5I2S A;  4C92 E;  5CAI A;  3CPW A;  3J7A F;  2M1H A;  3BY7 A;  1W4S A;  3NTI A;  2LC4 A;  4M7D E;  3LH0 A;  2D0Q B;  4Y28 E;  2ZPH B;  3Q1J A;  2MF2 A;  1M1G A;  4N4H A;  4OB1 B;  4XK8 E;  4N0A C;  4DQ2 A;  3JB9 D;  1WQW A;  3JCM W;  3LX7 A;  1QP3 A;  3GNF B;  4KBM B;  3EFS A;  2LVM A;  1NE8 A;  1BI3 A;  4QQ6 A;  1M1K C;  1K73 U;  1K8A C;  4HCC A;  1G5V A;  3VKI A;  2E6N A;  3BDU A;  2ZPG B;  4MZT A;  5LJ3 j;  4Y91 A;  2BIV A;  4QQG A;  3OY9 A;  2RD1 A;  3DLM A;  3OYE A;  2X4X A;  4JUV A;  4NL3 A;  4OB3 B;  5LL6 S;  1Y96 A;  3E1S A;  3JCM V;  4OVA A;  4BD3 A;  4JRI A;  3QJ6 A;  1VQK A;  3I56 A;  4JRQ A;  2VUB A;  1Q86 U;  4NS5 A;  1WNL A;  4M78 G;  1S72 A;  3OS5 A;  3C94 A;  4M7D B;  2O01 E;  1LOJ A;  2EJ9 A;  3G6E T;  5D6Y A;  1VQL T;  4LDV A;  1VQ9 T;  2DIQ A;  4UC4 A;  5LJ5 e;  1U1T A;  5GAN d;  3CC2 T;  4PJO E;  2E6Z A;  3OBW A;  3OYI A;  3FLG A;  4XTX A;  4R56 A;  1KQ1 A;  3F70 A;  2YLC A;  3MP6 A;  3LWI A;  3FC3 A;  4BDZ A;  3PFS A;  4Q5W A;  1K9M U;  4C8Q A;  2PVG B;  2E70 A;  2RHI A;  2RI3 A;  1TH7 A;  2RA2 A;  3GP8 A;  4JLI A;  2E5Q A;  3JCM g;  2RK2 A;  2DEQ A;  5C0M A;  1N27 A;  2CZ6 B;  2VXF A;  3OYG A;  1WQ7 A;  3CBP A;  4FT4 A;  4EMG A;  1Q7Y C;  4XTZ A;  1QVP A;  3HRS A;  5HK3 A;  5GAN 2;  3JCM c;  3GPL A;  1K73 C;  4M77 F;  1SSF A;  5FRO A;  1N6A A;  3HSB A;  2XDP A;  3URG A;  3OS0 A;  5GAN 6;  4FU6 A;  1Q81 U;  2CZ0 B;  3JCM Q;  1ZBX A;  5KH6 A;  4M77 C;  3QKJ A;  4WF2 A;  5GAN 7;  1WJS A;  2VGM A;  1UGS B;  4M75 F;  3L2R A;  1ZQ1 A;  3CC4 A;  2DXT A;  4RKU E;  4BI8 B;  2JZ2 A;  4MDW A;  3CXC S;  4IUV A;  4QVZ A;  5CO7 A;  4M75 C;  5CKE A;  4IUQ A;  1Q86 C;  1N8R C;  1VQ6 T;  1VQ8 A;  4OGE A;  1G3T A;  2EJG A;  2EFI A;  4A4F A;  4XQ3 A;  3INZ A;  1RL2 A;  3RKY A;  2VYT A;  3JRZ A;  4D6W A;  4E7H A;  4M78 E;  1KG1 A;  2AHJ B;  2HD0 A;  3HFN A;  1VQ4 A;  4X9D A;  4J6Y A;  3L2Q A;  4C92 D;  2RM4 A;  4LDX A;  3ZFJ A;  3JCM e;  2K5I A;  2C06 A;  1N9S A;  3E9G A;  2V8J A;  3CCQ T;  1KD1 C;  2FYK A;  4HCB A;  4M7D D;  3OQ5 A;  4JRP A;  1VQN T;  2F69 A;  4F7U E;  3VU3 C;  3VYG A;  3G4S A;  4ELZ C;  4OF1 A;  5HK0 A;  4QW2 A;  5CKF A;  5GAN j;  2LQ8 A;  1OZ2 A;  3JB9 J;  4EMK A;  5GAN 8;  2MMP A;  2RI5 A;  2LT4 A;  5GAN 4;  3CCL A;  2L89 A;  2OTJ T;  3SWN B;  4FT2 A;  3UDC A;  4MDX A;  4A54 A;  2JUF A;  4P5N A;  4ZTJ A;  3H6Z A;  3M57 A;  2BKD N;  4BI4 A;  3QUI A;  4LDY A;  5GMK j;  2E1H A;  4FSX A;  2RI2 A;  2RB6 A;  1VQP T;  3BW1 A;  3LLR A;  3OSV A;  5J39 A;  4M77 G;  4LD9 K;  2G3R A;  3JB9 F;  4M78 B;  5LJ3 h;  3OYA A;  3QSU A;  1NPP A;  3PGG A;  3CCR A;  5KCH A;  5GAO m;  2FL7 A;  4JS5 A;  1WPY A;  1XOV A;  2MWO A;  5CQX A;  4J7I A;  1QVF A;  4M7A F;  4M75 G;  4IUU A;  2EKO A;  1Y71 A;  1Y07 A;  4J5Y A;  3OMC A;  5LJ5 d;  3M54 A;  4C0D C;  3CCE A;  3LW5 E;  1QVG S;  3OB9 A;  1NJI U;  5GAN 5;  4PJO D;  2QEX T;  4M7A C;  4F7U B;  1M1F A;  3M4Y A;  4JS4 A;  3PIO A;  4X9C A;  3VUZ A;  1M90 U;  4Z02 A;  2DD4 A;  3ER0 A;  1MHN A;  1YI2 A;  3CD6 A;  3PNW C;  2K2V A;  4GLK A;  1OZ3 A;  2GFA A;  3VJP A;  3WVD B;  5CR2 A;  5LJ3 g;  1VQ7 A;  4TVR A;  1JBM A;  1BIA A;  1O9S A;  5A0D A;  2EQK A;  1YJ9 A;  3I55 T;  1GXI E;  2EQU A;  2KMT A;  5I2M A;  1JB0 E;  5KE3 A;  2X4Y A;  4IUR A;  1X01 A;  2DPP B;  3HHT B;  3MCA B;  4CI0 C;  1Q82 U;  2GQV A;  1VQ5 T;  3CCM A;  3A8O B;  3OA6 A;  3G7Z A;  2K5F A;  2M0O A;  2VGN A;  5DY9 A;  4XTY A;  2YHT A;  4EMK C;  3WXM B;  1VQO A;  2KDS A;  3HRU A;  3QZ5 B;  3WVE B;  5GAM j;  2Y4X A;  3N5B B;  4BE2 A;  4HA8 A;  1YIT A;  4M7D A;  3SD4 A;  4OB0 B;  2GF7 A;  4PLI A;  3CME A;  4N4G A;  5CCA A;  4L59 A;  3EFR A;  1U1S A;  4KUI A;  3S3M A;  3RKX A;  3V7S A;  1N9R A;  1YIJ A;  2MAM A;  3JCM b;  3L2V A;  2DJZ A;  4RCC A;  3QJY A;  5J26 A;  3G71 T;  4B9W A;  3CC7 T;  1X75 C;  2A7Y A;  3M55 A;  4ELY C;  4NL2 A;  5GMK m;  1OI1 A;  3JCM X;  3OW2 A;  4XTV A;  1W2B S;  4OP0 A;  4M77 E;  2LX9 A;  3M5A A;  4C92 B;  2V8K A;  2K4Y A;  1JJ2 A;  4M7A G;  3E19 A;  3SDZ A;  5D6W A;  5GAO p;  2LCL A;  3MEU A;  4M78 D;  5GMK i;  1YBY A;  1YCY A;  4M75 E;  3JCM P;  1M90 C;  3JCM d;  2DXB A;  3PIP A;  3L2Z A;  3QBY A;  1FWZ A;  3P8H A;  4EPC A;  2OAU A;  3OYB A;  1B34 A;  3OYL A;  3RES A;  5FRM A;  1ZHI A;  2FHD A;  3ZEH A;  3CCJ T;  2JN0 A;  2WSE E;  2QQR A;  2A3L A;  2CZ7 B;  4LDU A;  4B9X A;  1UGR B;  4C5E A;  4C5H A;  1KQS S;  4XTU A;  3OYC A;  3J80 E;  2RHU A;  2F5T X;  3FRN A;  4PJO A;  2O4X B;  4FM4 B;  3SB2 A;  5DM7 R;  2FVU A;  3GOX A;  4II1 A;  4XU2 A;  4ZGJ B;  3UPU A;  4LDW A;  4HCZ A;  4E7L A;  3DLL A;  3EAE A;  2E41 A;  4E7K A;  5GAN h;  3MP1 A;  4BE0 A;  5CKH A;  5GAM f;  2K57 A;  1HXD A;  3JSC A;  3L1A A;  1QP2 A;  5GAO r;  4M77 B;  2E64 A;  1B34 B;  2LT1 A;  2QQA A;  4M7D F;  1R8O B;  3G6E A;  1VQL A;  2CGH A;  4L5G A;  5LJ3 f;  4RCB A;  3CCU T;  1VQ9 A;  3CC2 A;  3L2W A;  2V8I A;  4XU0 A;  5HY6 A;  5CVI A;  4OGC A;  3UWN A;  5GMK h;  1WGS A;  4JDS A;  5CKD A;  4M75 B;  5GAO n;  2GFU A;  3A5Z B;  5CIU A;  3M59 A;  3VYH B;  3OYN A;  3KUF A;  1MGQ A;  2QA4 T;  2DXU A;  1XQH A;  3OYY A;  2E12 A;  3LGF A;  5IT9 E;  2D6F A;  5A0L A;  3V8L A;  3CCS T;  4A4E A;  4DOW A;  2XU8 A;  2XIC A;  4PLL A;  5GAN 3;  3OYM A;  3J81 E;  3PT9 A;  1BI1 A;  4C5G A;  4A53 A;  3O8V A;  3OYK A;  2X4J A;  5M9O A;  2XK0 A;  5HKC A;  5DLO A;  2RH2 A;  2ZPB B;  1PSE A;  1OYX A;  4MZM A;  4BUG A;  3SWN A;  1UGQ B;  3HP9 A;  3RMQ A;  3MEA A;  2XDD A;  4M7A E;  2XI9 A;  3A8H B;  2JTM A;  4O5V A;  2VC8 A;  3PMI A;  4O6J A;  3GIB A;  1YJN T;  2WSC E;  3CPF A;  4C8Q F;  1VIF A;  2OTL A;  1K9M C;  2IG0 A;  2R57 A;  1I81 A;  1X6O A;  2DTI A;  4FL6 A;  3JB9 I;  2K3Y A;  2KAF A;  3MEW A;  4M78 A;  4RG8 A;  3QYH B;  4C8Q C;  2VXE A;  2RJE A;  4OMF B;  3S6W A;  3RUX A;  4QVC A;  2PUO B;  1VQM T;  3V8K A;  2D9T A;  3FB9 A;  2PQW A;  3FEO A;  5L8R E;  5FLX E;  1YHQ T;  1VQ6 A;  2CYZ B;  2ZZD A;  2LTO A;  4A4G A;  2KVQ G;  4MML A;  4BY6 C;  1YJW T;  4QQD A;  4F7U A;  2R5M A;  2RJF A;  2DO3 A;  3QXE B;  3DKM A;  5GAM h;  1M8V A;  1BKB A;  1G3S A;  3QII A;  2HNI A;  1Q81 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...