2LNVA

Solution structure of gspc-hr of typeii secretion system
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
104
structure length
104
Chain Sequence
GSHMLEMAGALDASQMSNLPPSTLNLSLTGVMAGDDDSRSIAIISKDNEQFSRGVNEEVPGYNAKIVSIRPDRVVLQYQGRYEVLGLYSQEDSGSDGVPGAQVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords General secretion pathway protein C
publication title Solution Structure of Homology Region (HR) Domain of Type II Secretion System.
pubmed doi rcsb
source organism Dickeya dadantii
total genus 13
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.830 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2lnvA01
2Y4YA 2IVWA 2LC4A 2Y4XA 3OSSC 2LNVA
chains in the Genus database with same CATH superfamily
4AMCA 5GANd 1M90U 1U06A 4HCBA 4KULA 2DA9A 1OZ3A 3QWXX 3E19A 4RTWA 4M78C 5D7UA 1JBMA 3M0UA 1C6VX 3ZEHA 2KNBB 1OOTA 2CUDA 1M2VA 1U1SA 5GAN2 3GOXA 1M3AA 1NLPC 4NOYA 1OPKA 1V1CA 3OYLA 3QJYA 1CSKA 2E64A 2ROTA 2RPNA 3C0CA 2D0QB 3M56A 2AIRB 4X1VA 2HEQA 2DBKA 2CGHA 1UGVA 3EFOB 5CVIA 1N8RC 2MYSA 5FU6C 1VOMA 3CXCS 1WHJA 2CZ1B 1YJ9Q 3V7SA 1QMCA 3QZ9B 3SHWA 1QQJA 1BCMA 4KGVB 3TSZA 1YJ9T 3RMSA 4PJOE 4LUDA 2KGTA 3JB9G 4PJOF 1UFFA 4MMLA 3H6ZA 1YJ9A 3GBQA 3IQLA 1ZBJA 4HT9A 2Y90A 4DEXA 4OMOA 1QVGS 4F7UE 2YUQA 1AWXA 4BI3A 4BUGA 4F7UF 5HK0A 2DVJA 1ZUKA 1Q7YU 2ZPFB 4FYYB 2HD0A 2COYA 1X27A 2EFIA 5DLOA 4JS5A 1AWOA 2JVVA 4IKFA 1RUWA 3CBOA 5LL6S 4JZ3A 3CD6Q 2DRKA 1ARKA 1WQ7A 3J7AF 2EYYA 3TCJA 2DERA 3CD6T 1X6BA 1RAFB 1ABQA 3ZL7C 3SWNA 1I5LA 3J81E 2O4XA 3LW5E 3ULRB 1W6XA 5GANj 1RI9A 3JB9D 3CD6A 1NPRA 1MUZA 4PK4A 2QDLA 2A36A 1Y96B 2A28A 3KBGA 2LJ0A 4LDYA 2LT1A 1Z9QA 5GAMh 4Z02A 4DOVA 1PNJA 2G6FX 1TU0B 1W70A 1M1GA 5FWCA 1SKUB 3X26B 3VS3A 1OV3A 4C0FA 4X9CA 1CKAA 2CZ6B 1Q86U 1M3BA 2FVUA 4E7ZA 2RQWA 4J9EA 1QLYA 4KUIA 1BI0A 2HMAA 2E3IA 2R5AA 3TVTA 4M7AD 2EKOA 4E7LA 5I2SA 3FC3A 4M7DC 3QHSA 4FSSA 4C8QC 3JB9J 1SHGA 3MEVA 2AT1B 2RHIA 3UT1A 2XI9A 2BE7D 3MJXA 1BBZA 5GAOq 2CKKA 4LUEA 3JB9I 4P5NA 5GMKl 2D0NA 1D09B 3JAME 1KD1C 3JB9F 4PFOA 4B6MA 4IUQA 1AVZC 2RHXA 3LGFA 4A4EA 1D3BB 2FB7A 1HK9A 2CT3A 3WVEB 1M2OA 2FL7A 4HVWA 1FWZA 3R6OA 1TH7A 2MWOA 3H0IA 5AYFA 2L3RA 4BACA 4M78A 1LNXA 4M77G 1OEBA 2DVEA 2KXCA 1B3QA 3HP9A 4XU3A 4JJBA 1VQMQ 2GFAA 2DXTA 1VQMT 3VS0A 3EAEA 4M7AE 2PNIA 3LYIA 4RUGA 4M7AF 3OMGA 1D0XA 3M0SA 1VQMA 4LXCA 3VYHB 3CCRQ 4R0KA 1VQ4Q 4PJJA 5GAN4 1YN8A 5FLXE 3CCRT 1VQ4T 3PE0A 1TUCA 1Q81R 1YHQQ 2EQIA 1I5OB 5I11A 3JCMV 1YHQT 2VASA 2DM1A 2PQWA 4EMHA 2EBPA 2JS0A 4FSXA 1SSHA 1WQWA 4M4ZA 2GQVA 3D7SB 1YHQA 3LH0A 1SRMA 4HCZA 5GAOn 5IHKA 3QBYA 2P0PA 2Y4XA 5CKDA 9ATCB 3X25B 4J83A 4M77D 1UECA 1K9MU 2PTKA 3OS5A 2YRCA 1FYNA 1SEMA 2O9VA 2XKOC 3EG0A 2ZGWA 3OYIA 1K73R 1MNEA 3RUXA 1QW1A 3JV3A 1ZBXA 2LCLA 1OZ2A 1RLQC 5KYWA 3MO8A 1BB9A 5GAMg 4JRIA 4Z88A 4Y92A 5CIUA 5GANe 1YITQ 2CH4A 4FM4B 1RACB 5GMKm 2EJGA 1SRLA 3TREA 1YITT 2QASA 2ATCB 1H3HA 2OTJQ 3SWNB 3L2UA 5J39A 3LX7A 2O4XB 1YWOA 5FW9A 3EG3A 1NJIR 2OTJT 1MMGA 2PUKB 4E47A 1YITA 4J9IA 4RTZA 4PLIA 4LD6A 2OTJA 1B34A 4RTTA 1WXTA 3M53A 4DEYA 2DTIA 3SDZA 5A0GA 3HFOA 1QCOA 2DXUA 4M77E 1M5Q1 4M77F 4L5GA 3VS6A 2BKDN 2YWWA 1Q82R 3RESA 1QCFA 2EWNA 5LJ5j 4J6YA 5GMKe 2K6DA 5FROA 3GP8A 5LJ3g 5J26A 2RJDA 4KUDK 2LCCA 4QQ6A 2MI6A 2VYTA 4M7DA 4C8QA 1G3SA 5HK3A 3CCSQ 4CC7A 5IH2A 1QVFS 3CCST 2NLUA 2GNCA 2E5KA 3PNWC 2RF0A 1IGQA 2GCXA 2PVDB 1Q7YC 1D1CA 3CCSA 1RI0A 4UC4A 3EFSA 2MPXC 4ORZA 2QYZA 3WVDB 4II1A 3E9FA 2COZA 4DBHA 3EFRA 2VGMA 4FYWB 3UA7A 2AZVA 1WI7A 4JZ4A 1OPLA 4AFSC 2YHTA 3F70A 1LOJA 1UUEA 4XAXB 4M78B 2M51A 2EJFA 3CCMQ 5I2MA 4QW2A 4HKEA 4PLLA 5L8RE 3CCMT 4BI8B 3CCJQ 2L3QA 4ZN1A 1Q81U 2LMJA 3M54A 3CCJT 2X3XD 5I21A 3CCMA 3C4SA 1RAEB 1UE9A 2OTLQ 4HA8A 3CCJA 4B9XA 2RK1A 3QWYA 4BE1A 2OTLT 2DFUA 3VUBA 5GJVB 1GFCA 4BI4A 2KI7A 3FJ5A 1UEBA 4NL3A 2E6NA 2DL7A 5FU6B 2OTLA 5IN1A 1BIBA 1TOVA 2LRQA 2K5FA 3CXCA 1WJQA 1K73U 2DF6A 1NE8A 1VYVA 2R58A 3OW2A 3NTIA 1JRIA 4FYXB 3EGUA 3NHNA 4R56A 2CP6A 2OAUA 3E1SA 1VQ8A 1MV3A 2MWPA 2H8HA 3M0PA 1QVGA 1BI2A 2KMTA 2FG0A 5CCAA 1IHWA 3G6EQ 3CPWS 5KYWB 2NUTA 5A0LA 3G6ET 5CR2A 2CH4W 2HQXA 4RG2A 3OMCA 2DIQA 2WACA 3G6EA 1PWTA 4FL6A 2RK2A 2EYWA 4MDXA 1Z9ZA 4RG8A 2CZ0B 2X35A 4LDWA 3WXMB 4D8KA 3RBBB 1K76A 4A4HA 1B34B 1Q82U 2RM4A 2ZPEB 1Y07A 4RTYA 3TQ7P 2QK0A 3OBYA 2L3PA 2OI3A 3BE3A 3I9QA 4J9FA 1VQ7Q 2VB6A 1M1KC 1VQ7T 3VRYA 1JU5C 1RADB 2BZ8A 1R0BG 2D9TA 1VQ7A 4A63B 1R0CB 3NPFA 4KT0E 4E7KA 2ZPGB 1KHCA 5KYUB 4JRQA 4RCCA 2EPDA 4E7HA 1FXXA 1H641 3A8MB 2E12A 2ENMA 4PJOG 4BE0A 2P0QA 5IXFA 5GAN5 5FRNA 4MZTA 4DOWA 1HSQA 1C0MA 5D6WA 2KSSA 2A0FB 3QSUA 1SPKA 4N4GA 4F7UG 1JQQA 1K1ZA 1LJOA 1YIJQ 1QKXA 2CSQA 3BDLA 3L2ZA 1YIJT 2RI5A 3PMIA 4ATOA 1ZQ1A 2EQJA 1UGQB 2DL3A 3BDUA 4PJLA 4OP0A 3NFCA 5HKCA 1KHIA 1YIJA 4QKUA 3JCMW 1QP3A 2V26A 2QTVA 3JCMd 2AHJB 1VQKQ 1GBRA 2XDPA 2GBQA 1X69A 4PFPA 1VQKT 4PJOD 5FU7B 4OB3B 4E7JA 3MP6A 1BIAA 1WXBA 1D3BA 2V8IA 1K0XA 4EDUA 2KROA 1PD0A 4ZTJA 1N9SA 1VQKA 3QG1A 3SFMA 2FPFA 4FYVB 2GTJA 2ED0A 2RMOA 2YLCA 1G3TA 1N6AA 4JJNK 1YFNA 4XTYA 1KQ2A 2W10A 2MF2A 3OS1A 3UWNA 2LZ6B 3M9QA 2FHDA 2DAQA 3REBB 2F2WA 4A4FA 1AOJA 2ZAEA 5GANg 4OMPA 1BCOA 2L3SA 3CBPA 2HNIA 2NUTB 1KQSP 2QAZA 2RH2A 4J6XA 3OW2S 1N5ZA 3RIRA 4QVDA 2MOXA 2P4RA 3FIFA 2QGFB 4OGCA 2F2XA 2OX7A 1G8XA 4IUPA 4OB0B 5CKEA 3PIPA 4JS4A 2KAFA 2RQTA 1KFZA 3FDRA 3JCMf 5KH6A 2VXEA 4N0AC 3FEOA 4XTVA 2KRNA 2D6FA 4A54A 4GY5A 4L59A 4C92E 2V8JA 4L6V5 1TSFA 2LC4A 4C92F 1PCXA 2VXFA 3EH2A 2H3EB 2HBWA 4XU1A 4JRPA 2C0TA 4FT2A 1D1AA 3JCMP 3QYHB 4M7AG 4PJOC 1H92A 1K8AR 2HDAA 1ZHIA 2QA4Q 1WHMA 5LJ5h 3EHRA 2QA4T 4A4GA 4LDUA 2LJ1A 4OMQA 2QA4A 2VWFA 2ECZA 3CXCP 1M9SA 1VIEA 1G5VA 2EQUA 4XU0A 2RO0A 1NLOC 1IREB 2JUFA 5IHIA 2L8DA 3R6NA 1OU9A 2V1QA 2EJ9A 1XJWB 1QVFA 4M77B 4HCKA 4NL2A 2JT4A 2BE9B 5GMKi 1JXOA 1ZA1B 3LGLA 1AHJB 2GFUA 2DO3A 5DY9A 1QVGP 3EGDA 3P8DA 1GL5A 1EIFA 4Q5WA 1VYTA 2J6KA 1X43A 2K79A 2K2MA 2LT4A 1RLPC 4FW1A 3G7ZA 1ZX6A 3RR6A 5GMKj 4HXJA 1RL2A 4HVUA 4XTWA 4HCCA 1EX4A 2E65A 3OYKA 1W2BS 1LVKA 4MZMA 4M75E 5KYXA 1IRXA 2LX9A 1JO8A 1VQ9Q 2LNHB 1KC8R 3CCQT 1VQ9T 2COWA 3JCMJ 2DILA 4E6RA 2HAXA 4QQDA 5LJ3h 3M4YA 1VQ9A 3J80E 2RQUA 3MP8A 1TUDA 4Y91A 2MAMA 1Y7XA 3DLMA 2KYMA 4AFUC 2ESWA 2L89A 1VQPQ 1VQPT 2DL8A 1ACMB 4MZPA 2MCNA 3PFSA 2FZGB 1M8MA 4FW2A 1VQPA 2K2VA 1ZLMA 4XQ3A 4CC2A 1VYUA 2DXCA 1N8RR 2DYIA 5FU7C 2A37A 4DQ2A 4JJCA 4V2SA 2F69A 1SHFA 2M1HA 2DL5A 2RJEA 1X2KA 2GGRA 3GIBA 3RKWA 2VUBA 3CCRA 4VUBA 1VQ4A 5HY6A 2ROLA 3EG2A 3H8ZA 4ZGEB 3CPWA 2J6OA 2VGNA 1HXDA 2R5MA 4C0DC 3CC2Q 1J3TA 2AKLA 4OMFB 3E2UA 3L2VA 3CC2T 3QDFA 1M30A 2DTHA 1TWBA 2DPPB 4M7AC 2EAYA 4PL6A 3ZBDA 3FRNA 5LJ5g 3CC2A 4N0AA 2QQ9A 1NEGA 1D0YA 5GAMd 3LWIA 3JCMe 4XTZA 3I35A 4O5VA 5IHNA 1T3SA 2KEAA 4F16A 1K8AU 4LD9K 1OU8A 2JOYA 3RDVA 1NG2A 4ESRA 3X20B 2MK5A 2BUDA 4OMMA 2V1RA 3VV0A 1MV0B 5M9OA 1LPLA 3OYHA 1D0ZA 3QJ6A 2E5QA 1M90C 3OYJA 4PJOA 3G71Q 2XU8A 1JJ2S 1X75C 3G71T 3VS7A 3G4SQ 3OYDA 3VYGA 1VQNQ 3SD4A 1SSFA 3G4ST 4J7FA 4LE9A 1VA7A 4DBFA 1VQNT 2IG0A 1ABOA 4DBQA 3OSSC 2J7IA 4F7UA 1X6OA 4LNPA 2H3JA 3G4SA 3OA6A 2DZ9A 1AD5A 3OQ5A 1VQNA 3HRSA 1PD1A 3L2WA 1VQOQ 3OSVA 5FWBA 3CPFA 1WLPB 5GJWB 2JM8A 1VQOT 2M16A 2DETA 1MNDA 2M0OA 4KH1B 4E7SA 3CMAQ 3O5ZA 4PKCC 3MEWA 1M8VA 4ANJA 3CMAT 1I1JA 2RA2A 1VQOA 3P8HA 2BZXA 1E6GA 1JB0E 3OB9A 5ECAA 3HFNA 3CMAA 3EGDB 3GNGA 2RJCA 1XNIA 1T0HA 2DL4A 5KYUA 4BDZA 2J05A 3HHTB 1UB4A 2O01E 1OULA 5GAMf 3JSCA 1MHNA 1IHVA 2CP2A 2D1XA 1KD1R 5KYXB 1NZ9A 2KVQG 2XDBA 5J3BA 5CKFA 4ELYC 1M27C 4M77C 2MMPA 2RB6A 2XDDA 2RD1A 2BTTA 2QQRA 2YUOA 3VU3C 3MKDA 1RABB 1JEGA 4XU2A 1UJYA 3OYCA 2QXFA 2MIOA 5EC7A 1QWEA 3GF5A 2DRMA 2X4JA 3PMTA 3DB3A 2A7YA 4E7IA 1Y0MA 1N8RU 1N9RA 2ZPIB 3EH1A 3M4GA 4Y28E 1XQHA 4O6JA 3EG9B 4IUUA 1NYGA 2LVMA 2KY9A 1MMNA 2X51A 2Z0WA 3QZ5B 5LJ3f 5IXBA 5D6XA 2J6FA 1UHFA 1GCQC 3QDRB 5CO7A 1W1FA 3FB9A 1Q86C 4C5GA 4KGZB 1P92A 2ZCFB 1B7TA 1FMWA 1IZ6A 1U3OA 1XOVA 1WJRA 2RHYA 4MDWA 3SB2A 1QVFP 3RNJA 3C95A 2DTOA 1NYFA 2GTOA 4A53A 4BY6B 2VKNA 5AT1B 3OYGA 1OQKA 2GF7A 2RHUA 2HL5C 2KE9A 5DM7R 4M7AA 2WSEE 2K5LA 1PSFA 2CP0A 5CAIA 1BU1A 7AT1B 1H8KA 4QVZA 3VRZA 2DNUA 2EYZA 5HCKA 1BI3A 4C0ZA 1WDXA 2V8KA 1NJIU 1M90R 2HKNA 5GAOl 1NBEB 4PJOB 3GNFB 1PM3A 4KBMB 2RNAA 1R77A 2CREA 5KCHA 5KYYB 3CC7Q 2EVRA 3BW1A 3CC7T 2EW3A 2FEIA 3M59A 5GANh 2LQKA 3HRTA 2JNGA 4F7UB 2O88A 2XG8D 4ZNXA 2HKQB 3CC7A 4HT8A 2XICA 1TG0A 3L42A 3C12A 2LX7A 2KDSA 1QKWA 1V76A 2DEUA 1S72Q 2DD4A 1PKTA 2CUBA 1S72T 5L23A 1VUBA 4LN2A 1KD1U 3JB9H 2YUPA 2JM9A 2CP5A 3PGGA 2YSQA 3QYGB 2KT1A 1S72A 1VQ6Q 1A0NB 1WX6A 4MMKA 3V8KA 3OYMA 1VQ6T 3OYAA 4J9BA 3ME9A 2E10A 1YWPA 3M58A 3JCMb 1K9MC 5GMKh 2NUZA 1QCNA 2EGAA 1VQ6A 3CPWP 1Q7YR 5GAMe 1W2BA 3A5ZB 4M77A 1WXUA 4AFZC 1ZUUA 2R57A 1NEBA 2CZ7B 2WSCE 1G83A 3PIOA 4IUTA 1X01A 4IIOA 4OB2B 2PUOB 2X3WD 3VJPA 2YDLA 4C92G 4FT4A 2QTXA 1TUGB 3HKSA 2FPEA 1GFDA 4AG2C 2KT8A 2E6ZA 4J9HA 3OYBA 1PG5B 3M55A 4RCBA 3X24B 1VQLQ 1I0CA 2LQWA 2L2PA 4M78E 3NMZC 5KCOA 3GLXA 4FU6A 1VQLT 2A08A 4M78F 3E9GA 3JCMX 3HRUA 3L1AA 3CC4Q 2CYZB 5LJ3e 4RKUE 3CCUQ 3M0RA 3REAB 1VQLA 3CC4T 1AWWA 1QWFA 1VQ5Q 3CCUT 1T3LA 1VQ5T 2M9UA 3V7CA 3NTHA 3CC4A 4LDVA 3CCUA 2X4XA 2L5QA 1ZSZC 8ATCB 1VQ5A 4KH0B 2KK4A 2JMCA 4C0DB 2LTOA 4M7DG 3S6WA 2AKKA 4C92D 2QG9B 4CI0C 4N4IA 3P8BB 3M0QA 2LQ8A 4M7AB 4OB1B 4OMNA 2VC8A 1KK7A 1T0JA 2YRVA 2E70A 4FCYA 1YJNQ 4M75G 1YJNT 2DE0X 5I22A 5CQYA 4CC3A 2D8JA 2YUNA 4BD3A 2F2VA 1ZA2B 5KYNA 1YJNA 4BY6C 2LJ3A 2DYBA 4WF2A 8AT1B 3DLLA 1I4K1 1G3WA 3GPLA 1WHLA 1U8RA 1JJ2A 3VS4A 1I07A 1Q81C 2DKGA 1OI1A 4M7DD 4C8QD 4BE2A 3QO3A 1W4SA 2QQBA 1RAIB 2CP3A 2C06A 2DX1A 1UG1A 1WNLA 2DJQA 2DZCA 2EYXA 4QT7A 1TXQA 4CRIA 3A8GB 4RTVA 2RQVA 2LQNA 1M1KR 5KE2A 4AT1B 1M3CA 2F5TX 1C1AA 4M75D 2B8AA 2P4TA 1K73C 4OGEA 4J9GA 3QXEB 3OBWA 4RMOA 1WYXA 1U5SA 4AG1C 2RHZA 4KRTA 2SEMA 1K9MR 1RAGB 1UGRB 4J9CA 5GANf 1M4ZA 3BY7A 4D8DA 4IUVA 2B86A 2JN0A 1PC0A 2FRWA 4A4KA 4X34A 1WIEA 4C92C 1KIKA 2DJZA 3MPUB 3OW2P 1RAAB 2KRSA 4EMKC 3JCMc 2C0IA 4OMLA 4M7DE 2P84A 2XMFA 4C8QE 2NYSA 2NUPA 4M7DF 4JLIA 4C8QF 1NJIC 2CS7A 4IIMA 3OYFA 3SEMA 3G1JA 2LCSA 1G3YA 4TVRA 4EMGA 2F1LA 3LLRA 1NPPA 3L2RA 2P0KA 3M5AA 4GBQA 1X6GA 4BB7A 2OAWA 5C0MA 4ZGDB 5CKBA 3CCQQ 3V8LA 4BDYA 4EIKA 4M75F 4F04B 1Q82C 3EHQA 1PKSA 3KFVA 2GQIA 3NGPA 4WTOB 2I2LA 5A2QE 2HQEA 3KUFA 4K11A 3QKJA 3CCQA 3QUIA 3URGA 2KXDA 1OYXA 1WFWA 2FO0A 2EYQA 4PNOA 1M1FA 5IAYA 4PJNA 2HZYA 3TEEA 1PSEA 2X9HA 2C0OA 5FRMA 1ZUYA 3RKXA 1B07A 2E4HA 1F1BB 1ZSZA 1NM7A 2KRMA 5KE3A 3S3MA 3EG9A 2CT4A 2QI2A 1QVPA 4M75C 3EGXA 2A3LA 2ZPHB 1EZZB 4N4HA 3S3NA 1YJWQ 4GLKA 1O9SA 2ED1A 5CK9A 3CCEQ 4DA4A 1YJWT 3OYYA 3H0FA 1TS9A 3H41A 3CCET 2DLPA 4CC4B 1M2VB 2HSPA 1MMDA 5A0DA 1KQ1A 1YJWA 3OYNA 1RAHB 3V8JA 3CCEA 2WSFE 2PVGB 2EQMA 2KYBA 4WCIA 1W2BP 2X4YA 3OS0A 5LJ5d 2EKHA 3PT9A 1YP5A 1HYOA 1HD3A 3BFMA 4JLGA 1IXDA 2DXBA 3RKYA 3DB4A 1BKBA 4YTLA 1M1KU 4LDXA 3PVQA 2PU9B 4EPCA 1FMKA 1R8OB 2G3RA 4IURA 3UDCA 3M57A 4E2FB 4ZGJB 3RMQA 2RQRA 4JRKA 2K3BA 3DKMA 2FZCB 1LCKA 4GLMA 3CCLQ 1Y57A 2X4WA 3THKA 3VUZA 4Z89A 1PRLC 3CCLT 5KYYA 2O9SA 1AZEA 4RTUA 3O8VA 2JJ9A 1BK2A 3G71A 3CCLA 2M02A 2XIDA 2EGCA 4JPBW 3FLGA 2L0AA 3OY9A 4C92A 2RI3A 4EMKA 3LWHA 1WGSA 5LJ3d 3CMEQ 2DK3A 4QQGA 3FJPA 3INZA 2ZZDA 3A8LB 3M0TA 2VV5A 2NUPB 3CMET 1MMAA 2Y4YA 1IO6A 4PJMA 1CKBA 1WHKA 3EG1A 2I0NA 3CMEA 5LJ5f 1K0SA 1KC8U 2K4YA 2M0YA 2K3XA 2JS2A 3QPHA 4KGXB 3I56Q 3JRZA 4JJDA 3S3OA 2PVOB 3I56T 2O31A 2EQKA 1PHTA 3I5RA 4C5IA 1SG5A 2JZ2A 2AZSA 4JUVA 1WA7A 3T9NA 1GRIA 1K9AA 3I56A 2CP7A 2J06A 1EFNA 2HBPA 1PRMC 3QIIA 3VS1A 1JJ2P 2E1HA 2ZPBB 5GAN8 5GAMj 1FX7A 3MHXA 5EG2A 1Y71A 4J9DA 2K57A 1GXIE 3HSBA 4NS5A 1KQSA 1BI1A 3AHUA 2FYKA 2IVWA 2BZYA 3VKIA 1ZSZB 3TSWA 5CKHA 1YCSB 2E41A 4J5YA 1Q95G 4ZN3A 6AT1B 3N5BB 5D6YA 1ZSGA 4M75A 3X28B 1OX8A 4DBRA 2OJ2A 3PTAA 3EGXB 2BIVA 3KXTA 1YI2Q 3C94A 4PFZA 3JCMQ 1YI2T 1TTHB 2JTFA 4Z8AA 3HL8A 1AZGB 3UF4A 2F5KA 1WHGA 2HL3A 2HSEB 1YI2A 1X2QA 2AK5A 3A98A 1UJ0A 4F17A 5LJ3j 1BYMA 2CDTA 1KJWA 4FIBA 3A1PA 4AFQC 2D8HA 3TU4K 1H3ZA 2E3HA 1N27A 2JXBA 1JXMA 2LNVA 2RN8A 1K4US 2HCKA 1VIFA 2NWMA 3MCAB 3CEYA 1GCPA 2YLBA 2DEQA 1E6HA 3MP1A 2RI2A 2ABLA 3A8HB 1KG1A 1VQ8Q 1IB8A 2XK0A 1GBQA 1YBYA 2YXYA 5IT9E 1XTDA 1VQ8T 4RTXA 1YNZA 3JCMh 2XHCA 1OX9A 3PVLA 4J8OA 4M78G 1FMVA 3EFOA 1KSWA 2QEXQ 5GAOp 3Q1JA 3MEAA 2W0ZA 2QEXT 2O2OA 3ER0A 4OVAA 2RJFA 3ASKA 1I8FA 5GAN6 3CQTA 3I55Q 3AT1B 2QEXA 2VVKA 3I55T 1E7OA 2JTEA 2YRDA 3V7RA 1DJ7B 4C92B 3I55A 3OYEA 2FRYA 4C5HA 4EMKB 2IIMA 3VS2A 1D1BA 3OS2A 4XTXA 5CQXA 2XD0A 3UA6A 4JDSA 2CSIA 2EGEA 1O75A 3META 2QQSA 1WZOA 4J7IA 2LP5A 5LJ5e 4ZTFA 2K7AA 4M78D 2K9GA 3U23A 2JW4A 4HVVA 3ZFJA 2PZ1A 2QDYB 3SWNC 2JMAA 1K8AC 4ME7A 2FZKB 4D6WA 5GAN7 3UPUA 5GAN3 3VS5A 1WHHA 1WJSA 5C6SA 4M7DB 1Y96A 4C8QB 4X9DA 1MGQA 3A8OB 1AEYA 1I81A 1S1NA 3MEUA 2KBTA 1AWJA 4QVCA 1HJDA 3HTRA 2DMOA 2KQWA 4F14A 3UATA 2DBMA 2SRCA 4J6WA 1UTIA 2HQHA 5DLQE 1IGUA 2JTMA 2K5IA 4C5EA 4R55A 1UDLA 2DIGA 1U1TA 4M75B 1UHCA 1UGSB 5GAOm 4XK8E 1SF9A 1YCYA 3CBMA 2YT6A 3H9NA 1UGPB 2K3YA 1WPYA 2FPDA 1KQSS 2KR3A 5GAOr 1Q86R 1GCQA 2QGGA 4ELZC 4B9WA 2LDMA 4XTUA 3RERA 4C0GA 2DD5A 1G2BA 4OF1A 3I5SA 3CCVQ 1V29B 1QP2A 2IPOB 3L2QA 2EIFA 2QQAA 3CCVT 1KC8C 3LH5A 3HPWA 1AT1B 3H0HA 4C8QG 3JCMg 3NTKA 3CCVA
chains in the Genus database with same CATH topology
3L2WA 3OSVA 4M75F 5CCAA 3CPFA 1Q82C 5GANd 3CPWS 1M90U 4HCBA 1VQOT 4KULA 2M16A 4M7DF 1OZ3A 5A0LA 2M0OA 2I2LA 5A2QE 5CR2A 3G6ET 3E19A 2HQEA 3KUFA 4M78C 3QKJA 3CCQA 4PKCC 3MEWA 1M8VA 1JBMA 2HQXA 4RG2A 3QUIA 3ZEHA 2RA2A 1VQOA 3CMAT 3P8HA 3OMCA 2DIQA 2WACA 3G6EA 4FL6A 2RK2A 3URGA 1JB0E 1OYXA 1U1SA 3OB9A 5GAN2 3GOXA 2EYQA 3HFNA 4PNOA 3CMAA 1M1FA 4NOYA 3GNGA 4MDXA 2RJCA 1XNIA 5IAYA 4RG8A 3OYLA 3QJYA 3TEEA 1PSEA 2CZ0B 2X35A 4LDWA 4BDZA 3WXMB 2E64A 5FRMA 3RKXA 2D0QB 3M56A 4A4HA 3HHTB 1UB4A 2O01E 2CGHA 1B34B 1Q82U 5CVIA 5KE3A 3S3MA 5GAMf 3JSCA 1MHNA 1N8RC 2QI2A 1QVPA 1NZ9A 2KVQG 2RM4A 2ZPEB 4M75C 2XDBA 1Y07A 5FU6C 5J3BA 3CXCS 2CZ1B 5CKFA 3OBYA 4ELYC 4M77C 2A3LA 2ZPHB 4N4HA 3V7SA 2MMPA 2RB6A 3QZ9B 3S3NA 2XDDA 2RD1A 4GLKA 1YJ9T 3RMSA 4PJOE 2QQRA 3VU3C 1O9SA 5CK9A 3JB9G 4PJOF 4DA4A 1YJWT 1M1KC 1VQ7T 4MMLA 3OYYA 4XU2A 3OYCA 2QXFA 3CCET 3H6ZA 1YJ9A 5A0DA 1KQ1A 3GF5A 1YJWA 2D9TA 2X4JA 1VQ7A 3OYNA 3PMTA 3V8JA 3CCEA 4HT9A 2WSFE 2Y90A 3DB3A 2PVGB 2A7YA 4KT0E 2ZPGB 1KHCA 2EQMA 4JRQA 4RCCA 4E7KA 4E7IA 1QVGS 1N8RU 4F7UE 4E7HA 1N9RA 2ZPIB 4BI3A 4BUGA 2X4YA 1FXXA 3M4GA 4F7UF 5HK0A 1H641 3A8MB 4Y28E 5LJ5d 1XQHA 3OS0A 3PT9A 2E12A 4O6JA 4PJOG 4IUUA 1Q7YU 2ZPFB 2HD0A 4BE0A 2LVMA 2KY9A 2P0QA 2EFIA 5GAN5 3BFMA 4JLGA 5FRNA 5DLOA 2DXBA 4JS5A 2JVVA 3RKYA 3DB4A 1BKBA 4MZTA 4YTLA 4DOWA 1M1KU 4LDXA 4IKFA 3QZ5B 5D6WA 2PU9B 5LJ3f 4EPCA 3CBOA 2KSSA 5LL6S 5D6XA 1R8OB 2G3RA 3QSUA 1WQ7A 4IURA 3UDCA 3J7AF 4N4GA 3TCJA 4F7UG 3CD6T 1LJOA 3QDRB 3JCMg 3M57A 5CO7A 3SWNA 1I5LA 3J81E 3FB9A 2O4XA 3LW5E 4ZGJB 1Q86C 4C5GA 1P92A 3RMQA 3BDLA 3L2ZA 5GANj 1YIJT 3JB9D 3CD6A 2ZCFB 1NPRA 1IZ6A 4JRKA 2RI5A 3PMIA 4ATOA 1XOVA 1WJRA 1ZQ1A 2EQJA 1UGQB 2RHYA 3DKMA 3BDUA 1Y96B 4MDWA 3NFCA 4OP0A 3KBGA 1KHIA 3SB2A 5HKCA 3C95A 2DTOA 2X4WA 1YIJA 3VUZA 4A53A 4BY6B 3CCLT 4LDYA 2LT1A 5GAMh 4Z02A 4DOVA 3OYGA 3JCMW 1QP3A 3O8VA 3JCMd 2AHJB 2GF7A 1M1GA 2RHUA 5DM7R 4M7AA 3G71A 3CCLA 2XDPA 3X26B 2XIDA 2WSEE 2K5LA 4C0FA 1VQKT 4X9CA 4PJOD 1PSFA 5CAIA 5FU7B 4OB3B 4E7JA 3MP6A 1BIAA 1D3BA 2CZ6B 2V8IA 3FLGA 4QVZA 4EDUA 2FVUA 1Q86U 4ZTJA 1N9SA 3OY9A 1VQKA 4KUIA 3QG1A 1BI0A 1BI3A 2RI3A 2R5AA 3SFMA 4C0ZA 4C92A 2V8KA 4EMKA 3LWHA 1NJIU 1WGSA 5LJ3d 4M7AD 2DK3A 4QQGA 2EKOA 3FJPA 4E7LA 3INZA 2ZZDA 3A8LB 5I2SA 2VV5A 2YLCA 1G3TA 3FC3A 3CMET 4M7DC 3QHSA 4C8QC 1N6AA 2Y4YA 3JB9J 5GAOl 4JJNK 4PJOB 3GNFB 3MEVA 4KBMB 2RHIA 3UT1A 2XI9A 4XTYA 5KCHA 3CMEA 5LJ5f 1KQ2A 5GAOq 2CKKA 1KC8U 2K4YA 3JB9I 3BW1A 4P5NA 5GMKl 2MF2A 3OS1A 3CC7T 3JAME 1KD1C 3JB9F 2K3XA 3M59A 3UWNA 5GANh 4IUQA 2RHXA 3M9QA 2FHDA 2LQKA 3HRTA 3LGFA 2DAQA 2JNGA 3QPHA 4F7UB 3JRZA 2XG8D 3CC7A 3S3OA 4HT8A 4A4FA 4A4EA 1D3BB 2PVOB 3I56T 2FB7A 5GANg 1HK9A 2EQKA 2XICA 3WVEB 4C5IA 2JZ2A 2FL7A 1FWZA 3L42A 3C12A 4JUVA 3T9NA 3CBPA 1TH7A 3R6OA 2MWOA 2KDSA 3I56A 2HNIA 5AYFA 2RH2A 2HBPA 2L3RA 4J6XA 3OW2S 3QIIA 4BACA 3RIRA 2DD4A 4M78A 1LNXA 2E1HA 4M77G 2ZPBB 5GAN8 4QVDA 5GAMj 1S72T 2DVEA 1FX7A 3HP9A 3FIFA 3MHXA 4XU3A 5EG2A 1VUBA 1Y71A 4OGCA 2GFAA 2K57A 2DXTA 1KD1U 3HSBA 3JB9H 1GXIE 4NS5A 1VQMT 4IUPA 4OB0B 5CKEA 1S72A 3PGGA 3QYGB 3EAEA 1KQSA 3PIPA 4M7AE 4JS4A 3LYIA 2KAFA 1BI1A 3AHUA 4M7AF 2FYKA 2IVWA 4MMKA 3V8KA 3FDRA 3JCMf 5KH6A 2VXEA 3OYMA 3OYAA 1VQ6T 3OMGA 4N0AC 3VKIA 3ME9A 1VQMA 3FEOA 3VYHB 2E10A 3M58A 3JCMb 1K9MC 4XTVA 5GMKh 5GAN4 5CKHA 2E41A 4J5YA 5FLXE 2D6FA 3CCRT 1VQ6A 1VQ4T 4ZN3A 4A54A 4GY5A 4L59A 4C92E 2V8JA 4L6V5 2LC4A 3N5BB 5D6YA 4C92F 2VXFA 4M75A 5GAMe 3X28B 3PTAA 3JCMV 1YHQT 1W2BA 2PQWA 3A5ZB 4M77A 4XU1A 4EMHA 2BIVA 4JRPA 4FT2A 3KXTA 3JCMP 3C94A 3QYHB 4M7AG 4FSXA 3JCMQ 1WQWA 2GQVA 4PJOC 2R57A 1YHQA 3LH0A 1YI2T 2JTFA 2CZ7B 2WSCE 4HCZA 5GAOn 1ZHIA 3PIOA 3HL8A 4IUTA 3QBYA 1X01A 4OB2B 2P0PA 2PUOB 5LJ5h 2Y4XA 2F5KA 5CKDA 2QA4T 1YI2A 3VJPA 4A4GA 3X25B 4C92G 4J83A 4M77D 4FT4A 2QTXA 1K9MU 3OS5A 5LJ3j 1BYMA 4LDUA 3HKSA 4FIBA 2QA4A 2XKOC 2ZGWA 3OYIA 2E6ZA 1M9SA 1VIEA 3RUXA 1G5VA 2EQUA 1QW1A 4XU0A 3OYBA 3TU4K 1H3ZA 1N27A 2RO0A 2JUFA 1IREB 1ZBXA 3M55A 2LCLA 1OZ2A 2L8DA 4RCBA 3X24B 3MO8A 2LNVA 2EJ9A 4JRIA 5GAMg 1QVFA 4M77B 1VIFA 4M78E 5KCOA 4NL2A 3GLXA 4FU6A 1VQLT 3MCAB 3CEYA 4M78F 5CIUA 2YLBA 3E9GA 5GANe 3JCMX 3HRUA 3L1AA 5GMKi 2CYZB 2DEQA 5LJ3e 4RKUE 4FM4B 5GMKm 3LGLA 2EJGA 1AHJB 3MP1A 3TREA 3CC4T 1YITT 1VQLA 2GFUA 2RI2A 3SWNB 3A8HB 3L2UA 5J39A 2DO3A 5DY9A 3LX7A 2O4XB 3CCUT 1KG1A 2XK0A 3P8DA 1YBYA 1EIFA 4Q5WA 5IT9E 1VQ5T 2OTJT 2M9UA 1XTDA 2LT4A 2PUKB 3NTHA 3V7CA 4E47A 1YITA 1VQ8T 4LDVA 3CC4A 3G7ZA 3JCMh 2XHCA 5GMKj 4XTWA 1RL2A 3CCUA 2X4XA 4HCCA 2E65A 2L5QA 4PLIA 4LD6A 2OTJA 4J8OA 1VQ5A 3OYKA 1B34A 2KK4A 4M78G 2LTOA 4C0DB 4M7DG 1W2BS 3M53A 3S6WA 5GAOp 3Q1JA 4MZMA 2DTIA 4C92D 4M75E 3MEAA 4CI0C 2LX9A 4N4IA 3SDZA 5A0GA 3HFOA 2DXUA 3P8BB 2QEXT 3CCQT 3ER0A 4OVAA 2LQ8A 4M77E 2RJFA 1M5Q1 3ASKA 4M7AB 1I8FA 4M77F 5GAN6 4L5GA 4OB1B 1VQ9T 2VC8A 3JCMJ 2HAXA 4QQDA 2QEXA 2BKDN 5LJ3h 3I55T 3M4YA 2YRVA 3RESA 1VQ9A 2EWNA 5LJ5j 4J6YA 5GMKe 3V7RA 3MP8A 3J80E 2E70A 5FROA 3GP8A 4Y91A 1DJ7B 5LJ3g 2MAMA 3NTKA 4C92B 5J26A 3I55A 3OYEA 1Y7XA 4C5HA 4EMKB 2RJDA 3DLMA 4KUDK 4M75G 1YJNT 2LCCA 4QQ6A 2L89A 2MI6A 2VYTA 5CQYA 3OS2A 4XTXA 4M7DA 4C8QA 1G3SA 1VQPT 4BD3A 5CQXA 5HK3A 1YJNA 4MZPA 4BY6C 2XD0A 3PFSA 4WF2A 3DLLA 4JDSA 1QVFS 1I4K1 3CCST 2NLUA 1G3WA 1O75A 3META 1VQPA 3GPLA 2QQSA 2K2VA 4J7IA 1VQNA 5LJ5e 1U8RA 3PNWC 4ZTFA 1JJ2A 2GCXA 2PVDB 4XQ3A 1Q7YC 2DKGA 1Q81C 3CCSA 1RI0A 1OI1A 4UC4A 3EFSA 4M78D 4M7DD 2DXCA 4C8QD 5FU7C 4BE2A 4DQ2A 3WVDB 4II1A 4V2SA 3QO3A 3E9FA 3ZFJA 2QDYB 2F69A 1W4SA 2M1HA 2QQBA 2C06A 2RJEA 3EFRA 2VGMA 3GIBA 3SWNC 1WNLA 2VUBA 3RKWA 2DZCA 1K8AC 4ME7A 2YHTA 4CRIA 3CCRA 4VUBA 3A8GB 4D6WA 1VQ4A 5GAN7 3UPUA 5HY6A 3F70A 5GAN3 1LOJA 1WJSA 4XAXB 5C6SA 5KE2A 4M78B 3H8ZA 4M7DB 2EJFA 1Y96A 5I2MA 4C8QB 4X9DA 1MGQA 4ZGEB 3CPWA 2VGNA 1HXDA 2R5MA 4QW2A 4C0DC 4HKEA 4PLLA 5L8RE 3CCMT 4BI8B 4OMFB 3A8OB 4ZN1A 1I81A 2F5TX 4M75D 3L2VA 1Q81U 3M54A 3CC2T 2B8AA 2P4TA 1K73C 3MEUA 3CCJT 4OGEA 3OBWA 2DTHA 3QXEB 4QVCA 5I21A 4RMOA 2KQWA 2RHZA 3CCMA 2DPPB 4M7AC 2EAYA 3C4SA 4PL6A 3ZBDA 3FRNA 1UGRB 5GANf 5LJ5g 3CC2A 1M4ZA 4N0AA 2QQ9A 3BY7A 4HA8A 3CCJA 4B9XA 4J6WA 2RK1A 5GAMd 3LWIA 3JCMe 4IUVA 4XTZA 4O5VA 2JN0A 5DLQE 4BE1A 1K8AU 2OTLT 4LD9K 2JTMA 3VUBA 2K5IA 4C5EA 4R55A 4BI4A 4NL3A 2JOYA 1UEBA 2DIGA 2E6NA 4A4KA 3X20B 4X34A 1U1TA 4C92C 2BUDA 2DJZA 4M75B 1UGSB 5FU6B 2OTLA 4EMKC 5IN1A 4XK8E 3JCMc 5GAOm 3VV0A 5M9OA 1YCYA 3CBMA 1BIBA 1UGPB 4M7DE 4C8QE 3OYHA 2LRQA 3QJ6A 2K5FA 2K3YA 2E5QA 4JLIA 4C8QF 1WPYA 3CXCA 1M90C 1NJIC 3OYJA 1KQSS 4PJOA 1WJQA 2CS7A 1K73U 5GAOr 3OYFA 1NE8A 2XU8A 1G3YA 4TVRA 4EMGA 1JJ2S 3OW2A 2R58A 1X75C 4ELZC 4B9WA 3G71T 2LDMA 4XTUA 3V8LA 3NTIA 1JRIA 4C0GA 3RERA 3OYDA 3LLRA 2DD5A 3VYGA 1NPPA 4OF1A 3SD4A 1SSFA 1V29B 3L2RA 1QP2A 3G4ST 3L2QA 4J7FA 2P0KA 2EIFA 3M5AA 4R56A 2IG0A 1VQNT 2QQAA 4BB7A 3CCVT 1KC8C 3OSSC 2OAUA 3HPWA 4F7UA 3E1SA 1X6OA 5C0MA 2H3JA 3G4SA 4ZGDB 1VQ8A 2MWPA 4C8QG 3OA6A 5CKBA 2DZ9A 1QVGA 3OQ5A 1BI2A 3HRSA 2KMTA 3CCVA 4BDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y4Y A;  2IVW A;  2LC4 A;  2Y4X A;  3OSS C;  2LNV A; 
#chains in the Genus database with same CATH topology
 4AMC A;  5GAN d;  1M90 U;  1U06 A;  4HCB A;  4KUL A;  2DA9 A;  1OZ3 A;  3QWX X;  3E19 A;  4RTW A;  4M78 C;  5D7U A;  1JBM A;  3M0U A;  1C6V X;  3ZEH A;  2KNB B;  1OOT A;  2CUD A;  1M2V A;  1U1S A;  5GAN 2;  3GOX A;  1M3A A;  1NLP C;  4NOY A;  1OPK A;  1V1C A;  3OYL A;  3QJY A;  1CSK A;  2E64 A;  2ROT A;  2RPN A;  3C0C A;  2D0Q B;  3M56 A;  2AIR B;  4X1V A;  2HEQ A;  2DBK A;  2CGH A;  1UGV A;  3EFO B;  5CVI A;  1N8R C;  2MYS A;  5FU6 C;  1VOM A;  3CXC S;  1WHJ A;  2CZ1 B;  1YJ9 Q;  3V7S A;  1QMC A;  3QZ9 B;  3SHW A;  1QQJ A;  1BCM A;  4KGV B;  3TSZ A;  1YJ9 T;  3RMS A;  4PJO E;  4LUD A;  2KGT A;  3JB9 G;  4PJO F;  1UFF A;  4MML A;  3H6Z A;  1YJ9 A;  3GBQ A;  3IQL A;  1ZBJ A;  4HT9 A;  2Y90 A;  4DEX A;  4OMO A;  1QVG S;  4F7U E;  2YUQ A;  1AWX A;  4BI3 A;  4BUG A;  4F7U F;  5HK0 A;  2DVJ A;  1ZUK A;  1Q7Y U;  2ZPF B;  4FYY B;  2HD0 A;  2COY A;  1X27 A;  2EFI A;  5DLO A;  4JS5 A;  1AWO A;  2JVV A;  4IKF A;  1RUW A;  3CBO A;  5LL6 S;  4JZ3 A;  3CD6 Q;  2DRK A;  1ARK A;  1WQ7 A;  3J7A F;  2EYY A;  3TCJ A;  2DER A;  3CD6 T;  1X6B A;  1RAF B;  1ABQ A;  3ZL7 C;  3SWN A;  1I5L A;  3J81 E;  2O4X A;  3LW5 E;  3ULR B;  1W6X A;  5GAN j;  1RI9 A;  3JB9 D;  3CD6 A;  1NPR A;  1MUZ A;  4PK4 A;  2QDL A;  2A36 A;  1Y96 B;  2A28 A;  3KBG A;  2LJ0 A;  4LDY A;  2LT1 A;  1Z9Q A;  5GAM h;  4Z02 A;  4DOV A;  1PNJ A;  2G6F X;  1TU0 B;  1W70 A;  1M1G A;  5FWC A;  1SKU B;  3X26 B;  3VS3 A;  1OV3 A;  4C0F A;  4X9C A;  1CKA A;  2CZ6 B;  1Q86 U;  1M3B A;  2FVU A;  4E7Z A;  2RQW A;  4J9E A;  1QLY A;  4KUI A;  1BI0 A;  2HMA A;  2E3I A;  2R5A A;  3TVT A;  4M7A D;  2EKO A;  4E7L A;  5I2S A;  3FC3 A;  4M7D C;  3QHS A;  4FSS A;  4C8Q C;  3JB9 J;  1SHG A;  3MEV A;  2AT1 B;  2RHI A;  3UT1 A;  2XI9 A;  2BE7 D;  3MJX A;  1BBZ A;  5GAO q;  2CKK A;  4LUE A;  3JB9 I;  4P5N A;  5GMK l;  2D0N A;  1D09 B;  3JAM E;  1KD1 C;  3JB9 F;  4PFO A;  4B6M A;  4IUQ A;  1AVZ C;  2RHX A;  3LGF A;  4A4E A;  1D3B B;  2FB7 A;  1HK9 A;  2CT3 A;  3WVE B;  1M2O A;  2FL7 A;  4HVW A;  1FWZ A;  3R6O A;  1TH7 A;  2MWO A;  3H0I A;  5AYF A;  2L3R A;  4BAC A;  4M78 A;  1LNX A;  4M77 G;  1OEB A;  2DVE A;  2KXC A;  1B3Q A;  3HP9 A;  4XU3 A;  4JJB A;  1VQM Q;  2GFA A;  2DXT A;  1VQM T;  3VS0 A;  3EAE A;  4M7A E;  2PNI A;  3LYI A;  4RUG A;  4M7A F;  3OMG A;  1D0X A;  3M0S A;  1VQM A;  4LXC A;  3VYH B;  3CCR Q;  4R0K A;  1VQ4 Q;  4PJJ A;  5GAN 4;  1YN8 A;  5FLX E;  3CCR T;  1VQ4 T;  3PE0 A;  1TUC A;  1Q81 R;  1YHQ Q;  2EQI A;  1I5O B;  5I11 A;  3JCM V;  1YHQ T;  2VAS A;  2DM1 A;  2PQW A;  4EMH A;  2EBP A;  2JS0 A;  4FSX A;  1SSH A;  1WQW A;  4M4Z A;  2GQV A;  3D7S B;  1YHQ A;  3LH0 A;  1SRM A;  4HCZ A;  5GAO n;  5IHK A;  3QBY A;  2P0P A;  2Y4X A;  5CKD A;  9ATC B;  3X25 B;  4J83 A;  4M77 D;  1UEC A;  1K9M U;  2PTK A;  3OS5 A;  2YRC A;  1FYN A;  1SEM A;  2O9V A;  2XKO C;  3EG0 A;  2ZGW A;  3OYI A;  1K73 R;  1MNE A;  3RUX A;  1QW1 A;  3JV3 A;  1ZBX A;  2LCL A;  1OZ2 A;  1RLQ C;  5KYW A;  3MO8 A;  1BB9 A;  5GAM g;  4JRI A;  4Z88 A;  4Y92 A;  5CIU A;  5GAN e;  1YIT Q;  2CH4 A;  4FM4 B;  1RAC B;  5GMK m;  2EJG A;  1SRL A;  3TRE A;  1YIT T;  2QAS A;  2ATC B;  1H3H A;  2OTJ Q;  3SWN B;  3L2U A;  5J39 A;  3LX7 A;  2O4X B;  1YWO A;  5FW9 A;  3EG3 A;  1NJI R;  2OTJ T;  1MMG A;  2PUK B;  4E47 A;  1YIT A;  4J9I A;  4RTZ A;  4PLI A;  4LD6 A;  2OTJ A;  1B34 A;  4RTT A;  1WXT A;  3M53 A;  4DEY A;  2DTI A;  3SDZ A;  5A0G A;  3HFO A;  1QCO A;  2DXU A;  4M77 E;  1M5Q 1;  4M77 F;  4L5G A;  3VS6 A;  2BKD N;  2YWW A;  1Q82 R;  3RES A;  1QCF A;  2EWN A;  5LJ5 j;  4J6Y A;  5GMK e;  2K6D A;  5FRO A;  3GP8 A;  5LJ3 g;  5J26 A;  2RJD A;  4KUD K;  2LCC A;  4QQ6 A;  2MI6 A;  2VYT A;  4M7D A;  4C8Q A;  1G3S A;  5HK3 A;  3CCS Q;  4CC7 A;  5IH2 A;  1QVF S;  3CCS T;  2NLU A;  2GNC A;  2E5K A;  3PNW C;  2RF0 A;  1IGQ A;  2GCX A;  2PVD B;  1Q7Y C;  1D1C A;  3CCS A;  1RI0 A;  4UC4 A;  3EFS A;  2MPX C;  4ORZ A;  2QYZ A;  3WVD B;  4II1 A;  3E9F A;  2COZ A;  4DBH A;  3EFR A;  2VGM A;  4FYW B;  3UA7 A;  2AZV A;  1WI7 A;  4JZ4 A;  1OPL A;  4AFS C;  2YHT A;  3F70 A;  1LOJ A;  1UUE A;  4XAX B;  4M78 B;  2M51 A;  2EJF A;  3CCM Q;  5I2M A;  4QW2 A;  4HKE A;  4PLL A;  5L8R E;  3CCM T;  4BI8 B;  3CCJ Q;  2L3Q A;  4ZN1 A;  1Q81 U;  2LMJ A;  3M54 A;  3CCJ T;  2X3X D;  5I21 A;  3CCM A;  3C4S A;  1RAE B;  1UE9 A;  2OTL Q;  4HA8 A;  3CCJ A;  4B9X A;  2RK1 A;  3QWY A;  4BE1 A;  2OTL T;  2DFU A;  3VUB A;  5GJV B;  1GFC A;  4BI4 A;  2KI7 A;  3FJ5 A;  1UEB A;  4NL3 A;  2E6N A;  2DL7 A;  5FU6 B;  2OTL A;  5IN1 A;  1BIB A;  1TOV A;  2LRQ A;  2K5F A;  3CXC A;  1WJQ A;  1K73 U;  2DF6 A;  1NE8 A;  1VYV A;  2R58 A;  3OW2 A;  3NTI A;  1JRI A;  4FYX B;  3EGU A;  3NHN A;  4R56 A;  2CP6 A;  2OAU A;  3E1S A;  1VQ8 A;  1MV3 A;  2MWP A;  2H8H A;  3M0P A;  1QVG A;  1BI2 A;  2KMT A;  2FG0 A;  5CCA A;  1IHW A;  3G6E Q;  3CPW S;  5KYW B;  2NUT A;  5A0L A;  3G6E T;  5CR2 A;  2CH4 W;  2HQX A;  4RG2 A;  3OMC A;  2DIQ A;  2WAC A;  3G6E A;  1PWT A;  4FL6 A;  2RK2 A;  2EYW A;  4MDX A;  1Z9Z A;  4RG8 A;  2CZ0 B;  2X35 A;  4LDW A;  3WXM B;  4D8K A;  3RBB B;  1K76 A;  4A4H A;  1B34 B;  1Q82 U;  2RM4 A;  2ZPE B;  1Y07 A;  4RTY A;  3TQ7 P;  2QK0 A;  3OBY A;  2L3P A;  2OI3 A;  3BE3 A;  3I9Q A;  4J9F A;  1VQ7 Q;  2VB6 A;  1M1K C;  1VQ7 T;  3VRY A;  1JU5 C;  1RAD B;  2BZ8 A;  1R0B G;  2D9T A;  1VQ7 A;  4A63 B;  1R0C B;  3NPF A;  4KT0 E;  4E7K A;  2ZPG B;  1KHC A;  5KYU B;  4JRQ A;  4RCC A;  2EPD A;  4E7H A;  1FXX A;  1H64 1;  3A8M B;  2E12 A;  2ENM A;  4PJO G;  4BE0 A;  2P0Q A;  5IXF A;  5GAN 5;  5FRN A;  4MZT A;  4DOW A;  1HSQ A;  1C0M A;  5D6W A;  2KSS A;  2A0F B;  3QSU A;  1SPK A;  4N4G A;  4F7U G;  1JQQ A;  1K1Z A;  1LJO A;  1YIJ Q;  1QKX A;  2CSQ A;  3BDL A;  3L2Z A;  1YIJ T;  2RI5 A;  3PMI A;  4ATO A;  1ZQ1 A;  2EQJ A;  1UGQ B;  2DL3 A;  3BDU A;  4PJL A;  4OP0 A;  3NFC A;  5HKC A;  1KHI A;  1YIJ A;  4QKU A;  3JCM W;  1QP3 A;  2V26 A;  2QTV A;  3JCM d;  2AHJ B;  1VQK Q;  1GBR A;  2XDP A;  2GBQ A;  1X69 A;  4PFP A;  1VQK T;  4PJO D;  5FU7 B;  4OB3 B;  4E7J A;  3MP6 A;  1BIA A;  1WXB A;  1D3B A;  2V8I A;  1K0X A;  4EDU A;  2KRO A;  1PD0 A;  4ZTJ A;  1N9S A;  1VQK A;  3QG1 A;  3SFM A;  2FPF A;  4FYV B;  2GTJ A;  2ED0 A;  2RMO A;  2YLC A;  1G3T A;  1N6A A;  4JJN K;  1YFN A;  4XTY A;  1KQ2 A;  2W10 A;  2MF2 A;  3OS1 A;  3UWN A;  2LZ6 B;  3M9Q A;  2FHD A;  2DAQ A;  3REB B;  2F2W A;  4A4F A;  1AOJ A;  2ZAE A;  5GAN g;  4OMP A;  1BCO A;  2L3S A;  3CBP A;  2HNI A;  2NUT B;  1KQS P;  2QAZ A;  2RH2 A;  4J6X A;  3OW2 S;  1N5Z A;  3RIR A;  4QVD A;  2MOX A;  2P4R A;  3FIF A;  2QGF B;  4OGC A;  2F2X A;  2OX7 A;  1G8X A;  4IUP A;  4OB0 B;  5CKE A;  3PIP A;  4JS4 A;  2KAF A;  2RQT A;  1KFZ A;  3FDR A;  3JCM f;  5KH6 A;  2VXE A;  4N0A C;  3FEO A;  4XTV A;  2KRN A;  2D6F A;  4A54 A;  4GY5 A;  4L59 A;  4C92 E;  2V8J A;  4L6V 5;  1TSF A;  2LC4 A;  4C92 F;  1PCX A;  2VXF A;  3EH2 A;  2H3E B;  2HBW A;  4XU1 A;  4JRP A;  2C0T A;  4FT2 A;  1D1A A;  3JCM P;  3QYH B;  4M7A G;  4PJO C;  1H92 A;  1K8A R;  2HDA A;  1ZHI A;  2QA4 Q;  1WHM A;  5LJ5 h;  3EHR A;  2QA4 T;  4A4G A;  4LDU A;  2LJ1 A;  4OMQ A;  2QA4 A;  2VWF A;  2ECZ A;  3CXC P;  1M9S A;  1VIE A;  1G5V A;  2EQU A;  4XU0 A;  2RO0 A;  1NLO C;  1IRE B;  2JUF A;  5IHI A;  2L8D A;  3R6N A;  1OU9 A;  2V1Q A;  2EJ9 A;  1XJW B;  1QVF A;  4M77 B;  4HCK A;  4NL2 A;  2JT4 A;  2BE9 B;  5GMK i;  1JXO A;  1ZA1 B;  3LGL A;  1AHJ B;  2GFU A;  2DO3 A;  5DY9 A;  1QVG P;  3EGD A;  3P8D A;  1GL5 A;  1EIF A;  4Q5W A;  1VYT A;  2J6K A;  1X43 A;  2K79 A;  2K2M A;  2LT4 A;  1RLP C;  4FW1 A;  3G7Z A;  1ZX6 A;  3RR6 A;  5GMK j;  4HXJ A;  1RL2 A;  4HVU A;  4XTW A;  4HCC A;  1EX4 A;  2E65 A;  3OYK A;  1W2B S;  1LVK A;  4MZM A;  4M75 E;  5KYX A;  1IRX A;  2LX9 A;  1JO8 A;  1VQ9 Q;  2LNH B;  1KC8 R;  3CCQ T;  1VQ9 T;  2COW A;  3JCM J;  2DIL A;  4E6R A;  2HAX A;  4QQD A;  5LJ3 h;  3M4Y A;  1VQ9 A;  3J80 E;  2RQU A;  3MP8 A;  1TUD A;  4Y91 A;  2MAM A;  1Y7X A;  3DLM A;  2KYM A;  4AFU C;  2ESW A;  2L89 A;  1VQP Q;  1VQP T;  2DL8 A;  1ACM B;  4MZP A;  2MCN A;  3PFS A;  2FZG B;  1M8M A;  4FW2 A;  1VQP A;  2K2V A;  1ZLM A;  4XQ3 A;  4CC2 A;  1VYU A;  2DXC A;  1N8R R;  2DYI A;  5FU7 C;  2A37 A;  4DQ2 A;  4JJC A;  4V2S A;  2F69 A;  1SHF A;  2M1H A;  2DL5 A;  2RJE A;  1X2K A;  2GGR A;  3GIB A;  3RKW A;  2VUB A;  3CCR A;  4VUB A;  1VQ4 A;  5HY6 A;  2ROL A;  3EG2 A;  3H8Z A;  4ZGE B;  3CPW A;  2J6O A;  2VGN A;  1HXD A;  2R5M A;  4C0D C;  3CC2 Q;  1J3T A;  2AKL A;  4OMF B;  3E2U A;  3L2V A;  3CC2 T;  3QDF A;  1M30 A;  2DTH A;  1TWB A;  2DPP B;  4M7A C;  2EAY A;  4PL6 A;  3ZBD A;  3FRN A;  5LJ5 g;  3CC2 A;  4N0A A;  2QQ9 A;  1NEG A;  1D0Y A;  5GAM d;  3LWI A;  3JCM e;  4XTZ A;  3I35 A;  4O5V A;  5IHN A;  1T3S A;  2KEA A;  4F16 A;  1K8A U;  4LD9 K;  1OU8 A;  2JOY A;  3RDV A;  1NG2 A;  4ESR A;  3X20 B;  2MK5 A;  2BUD A;  4OMM A;  2V1R A;  3VV0 A;  1MV0 B;  5M9O A;  1LPL A;  3OYH A;  1D0Z A;  3QJ6 A;  2E5Q A;  1M90 C;  3OYJ A;  4PJO A;  3G71 Q;  2XU8 A;  1JJ2 S;  1X75 C;  3G71 T;  3VS7 A;  3G4S Q;  3OYD A;  3VYG A;  1VQN Q;  3SD4 A;  1SSF A;  3G4S T;  4J7F A;  4LE9 A;  1VA7 A;  4DBF A;  1VQN T;  2IG0 A;  1ABO A;  4DBQ A;  3OSS C;  2J7I A;  4F7U A;  1X6O A;  4LNP A;  2H3J A;  3G4S A;  3OA6 A;  2DZ9 A;  1AD5 A;  3OQ5 A;  1VQN A;  3HRS A;  1PD1 A;  3L2W A;  1VQO Q;  3OSV A;  5FWB A;  3CPF A;  1WLP B;  5GJW B;  2JM8 A;  1VQO T;  2M16 A;  2DET A;  1MND A;  2M0O A;  4KH1 B;  4E7S A;  3CMA Q;  3O5Z A;  4PKC C;  3MEW A;  1M8V A;  4ANJ A;  3CMA T;  1I1J A;  2RA2 A;  1VQO A;  3P8H A;  2BZX A;  1E6G A;  1JB0 E;  3OB9 A;  5ECA A;  3HFN A;  3CMA A;  3EGD B;  3GNG A;  2RJC A;  1XNI A;  1T0H A;  2DL4 A;  5KYU A;  4BDZ A;  2J05 A;  3HHT B;  1UB4 A;  2O01 E;  1OUL A;  5GAM f;  3JSC A;  1MHN A;  1IHV A;  2CP2 A;  2D1X A;  1KD1 R;  5KYX B;  1NZ9 A;  2KVQ G;  2XDB A;  5J3B A;  5CKF A;  4ELY C;  1M27 C;  4M77 C;  2MMP A;  2RB6 A;  2XDD A;  2RD1 A;  2BTT A;  2QQR A;  2YUO A;  3VU3 C;  3MKD A;  1RAB B;  1JEG A;  4XU2 A;  1UJY A;  3OYC A;  2QXF A;  2MIO A;  5EC7 A;  1QWE A;  3GF5 A;  2DRM A;  2X4J A;  3PMT A;  3DB3 A;  2A7Y A;  4E7I A;  1Y0M A;  1N8R U;  1N9R A;  2ZPI B;  3EH1 A;  3M4G A;  4Y28 E;  1XQH A;  4O6J A;  3EG9 B;  4IUU A;  1NYG A;  2LVM A;  2KY9 A;  1MMN A;  2X51 A;  2Z0W A;  3QZ5 B;  5LJ3 f;  5IXB A;  5D6X A;  2J6F A;  1UHF A;  1GCQ C;  3QDR B;  5CO7 A;  1W1F A;  3FB9 A;  1Q86 C;  4C5G A;  4KGZ B;  1P92 A;  2ZCF B;  1B7T A;  1FMW A;  1IZ6 A;  1U3O A;  1XOV A;  1WJR A;  2RHY A;  4MDW A;  3SB2 A;  1QVF P;  3RNJ A;  3C95 A;  2DTO A;  1NYF A;  2GTO A;  4A53 A;  4BY6 B;  2VKN A;  5AT1 B;  3OYG A;  1OQK A;  2GF7 A;  2RHU A;  2HL5 C;  2KE9 A;  5DM7 R;  4M7A A;  2WSE E;  2K5L A;  1PSF A;  2CP0 A;  5CAI A;  1BU1 A;  7AT1 B;  1H8K A;  4QVZ A;  3VRZ A;  2DNU A;  2EYZ A;  5HCK A;  1BI3 A;  4C0Z A;  1WDX A;  2V8K A;  1NJI U;  1M90 R;  2HKN A;  5GAO l;  1NBE B;  4PJO B;  3GNF B;  1PM3 A;  4KBM B;  2RNA A;  1R77 A;  2CRE A;  5KCH A;  5KYY B;  3CC7 Q;  2EVR A;  3BW1 A;  3CC7 T;  2EW3 A;  2FEI A;  3M59 A;  5GAN h;  2LQK A;  3HRT A;  2JNG A;  4F7U B;  2O88 A;  2XG8 D;  4ZNX A;  2HKQ B;  3CC7 A;  4HT8 A;  2XIC A;  1TG0 A;  3L42 A;  3C12 A;  2LX7 A;  2KDS A;  1QKW A;  1V76 A;  2DEU A;  1S72 Q;  2DD4 A;  1PKT A;  2CUB A;  1S72 T;  5L23 A;  1VUB A;  4LN2 A;  1KD1 U;  3JB9 H;  2YUP A;  2JM9 A;  2CP5 A;  3PGG A;  2YSQ A;  3QYG B;  2KT1 A;  1S72 A;  1VQ6 Q;  1A0N B;  1WX6 A;  4MMK A;  3V8K A;  3OYM A;  1VQ6 T;  3OYA A;  4J9B A;  3ME9 A;  2E10 A;  1YWP A;  3M58 A;  3JCM b;  1K9M C;  5GMK h;  2NUZ A;  1QCN A;  2EGA A;  1VQ6 A;  3CPW P;  1Q7Y R;  5GAM e;  1W2B A;  3A5Z B;  4M77 A;  1WXU A;  4AFZ C;  1ZUU A;  2R57 A;  1NEB A;  2CZ7 B;  2WSC E;  1G83 A;  3PIO A;  4IUT A;  1X01 A;  4IIO A;  4OB2 B;  2PUO B;  2X3W D;  3VJP A;  2YDL A;  4C92 G;  4FT4 A;  2QTX A;  1TUG B;  3HKS A;  2FPE A;  1GFD A;  4AG2 C;  2KT8 A;  2E6Z A;  4J9H A;  3OYB A;  1PG5 B;  3M55 A;  4RCB A;  3X24 B;  1VQL Q;  1I0C A;  2LQW A;  2L2P A;  4M78 E;  3NMZ C;  5KCO A;  3GLX A;  4FU6 A;  1VQL T;  2A08 A;  4M78 F;  3E9G A;  3JCM X;  3HRU A;  3L1A A;  3CC4 Q;  2CYZ B;  5LJ3 e;  4RKU E;  3CCU Q;  3M0R A;  3REA B;  1VQL A;  3CC4 T;  1AWW A;  1QWF A;  1VQ5 Q;  3CCU T;  1T3L A;  1VQ5 T;  2M9U A;  3V7C A;  3NTH A;  3CC4 A;  4LDV A;  3CCU A;  2X4X A;  2L5Q A;  1ZSZ C;  8ATC B;  1VQ5 A;  4KH0 B;  2KK4 A;  2JMC A;  4C0D B;  2LTO A;  4M7D G;  3S6W A;  2AKK A;  4C92 D;  2QG9 B;  4CI0 C;  4N4I A;  3P8B B;  3M0Q A;  2LQ8 A;  4M7A B;  4OB1 B;  4OMN A;  2VC8 A;  1KK7 A;  1T0J A;  2YRV A;  2E70 A;  4FCY A;  1YJN Q;  4M75 G;  1YJN T;  2DE0 X;  5I22 A;  5CQY A;  4CC3 A;  2D8J A;  2YUN A;  4BD3 A;  2F2V A;  1ZA2 B;  5KYN A;  1YJN A;  4BY6 C;  2LJ3 A;  2DYB A;  4WF2 A;  8AT1 B;  3DLL A;  1I4K 1;  1G3W A;  3GPL A;  1WHL A;  1U8R A;  1JJ2 A;  3VS4 A;  1I07 A;  1Q81 C;  2DKG A;  1OI1 A;  4M7D D;  4C8Q D;  4BE2 A;  3QO3 A;  1W4S A;  2QQB A;  1RAI B;  2CP3 A;  2C06 A;  2DX1 A;  1UG1 A;  1WNL A;  2DJQ A;  2DZC A;  2EYX A;  4QT7 A;  1TXQ A;  4CRI A;  3A8G B;  4RTV A;  2RQV A;  2LQN A;  1M1K R;  5KE2 A;  4AT1 B;  1M3C A;  2F5T X;  1C1A A;  4M75 D;  2B8A A;  2P4T A;  1K73 C;  4OGE A;  4J9G A;  3QXE B;  3OBW A;  4RMO A;  1WYX A;  1U5S A;  4AG1 C;  2RHZ A;  4KRT A;  2SEM A;  1K9M R;  1RAG B;  1UGR B;  4J9C A;  5GAN f;  1M4Z A;  3BY7 A;  4D8D A;  4IUV A;  2B86 A;  2JN0 A;  1PC0 A;  2FRW A;  4A4K A;  4X34 A;  1WIE A;  4C92 C;  1KIK A;  2DJZ A;  3MPU B;  3OW2 P;  1RAA B;  2KRS A;  4EMK C;  3JCM c;  2C0I A;  4OML A;  4M7D E;  2P84 A;  2XMF A;  4C8Q E;  2NYS A;  2NUP A;  4M7D F;  4JLI A;  4C8Q F;  1NJI C;  2CS7 A;  4IIM A;  3OYF A;  3SEM A;  3G1J A;  2LCS A;  1G3Y A;  4TVR A;  4EMG A;  2F1L A;  3LLR A;  1NPP A;  3L2R A;  2P0K A;  3M5A A;  4GBQ A;  1X6G A;  4BB7 A;  2OAW A;  5C0M A;  4ZGD B;  5CKB A;  3CCQ Q;  3V8L A;  4BDY A;  4EIK A;  4M75 F;  4F04 B;  1Q82 C;  3EHQ A;  1PKS A;  3KFV A;  2GQI A;  3NGP A;  4WTO B;  2I2L A;  5A2Q E;  2HQE A;  3KUF A;  4K11 A;  3QKJ A;  3CCQ A;  3QUI A;  3URG A;  2KXD A;  1OYX A;  1WFW A;  2FO0 A;  2EYQ A;  4PNO A;  1M1F A;  5IAY A;  4PJN A;  2HZY A;  3TEE A;  1PSE A;  2X9H A;  2C0O A;  5FRM A;  1ZUY A;  3RKX A;  1B07 A;  2E4H A;  1F1B B;  1ZSZ A;  1NM7 A;  2KRM A;  5KE3 A;  3S3M A;  3EG9 A;  2CT4 A;  2QI2 A;  1QVP A;  4M75 C;  3EGX A;  2A3L A;  2ZPH B;  1EZZ B;  4N4H A;  3S3N A;  1YJW Q;  4GLK A;  1O9S A;  2ED1 A;  5CK9 A;  3CCE Q;  4DA4 A;  1YJW T;  3OYY A;  3H0F A;  1TS9 A;  3H41 A;  3CCE T;  2DLP A;  4CC4 B;  1M2V B;  2HSP A;  1MMD A;  5A0D A;  1KQ1 A;  1YJW A;  3OYN A;  1RAH B;  3V8J A;  3CCE A;  2WSF E;  2PVG B;  2EQM A;  2KYB A;  4WCI A;  1W2B P;  2X4Y A;  3OS0 A;  5LJ5 d;  2EKH A;  3PT9 A;  1YP5 A;  1HYO A;  1HD3 A;  3BFM A;  4JLG A;  1IXD A;  2DXB A;  3RKY A;  3DB4 A;  1BKB A;  4YTL A;  1M1K U;  4LDX A;  3PVQ A;  2PU9 B;  4EPC A;  1FMK A;  1R8O B;  2G3R A;  4IUR A;  3UDC A;  3M57 A;  4E2F B;  4ZGJ B;  3RMQ A;  2RQR A;  4JRK A;  2K3B A;  3DKM A;  2FZC B;  1LCK A;  4GLM A;  3CCL Q;  1Y57 A;  2X4W A;  3THK A;  3VUZ A;  4Z89 A;  1PRL C;  3CCL T;  5KYY A;  2O9S A;  1AZE A;  4RTU A;  3O8V A;  2JJ9 A;  1BK2 A;  3G71 A;  3CCL A;  2M02 A;  2XID A;  2EGC A;  4JPB W;  3FLG A;  2L0A A;  3OY9 A;  4C92 A;  2RI3 A;  4EMK A;  3LWH A;  1WGS A;  5LJ3 d;  3CME Q;  2DK3 A;  4QQG A;  3FJP A;  3INZ A;  2ZZD A;  3A8L B;  3M0T A;  2VV5 A;  2NUP B;  3CME T;  1MMA A;  2Y4Y A;  1IO6 A;  4PJM A;  1CKB A;  1WHK A;  3EG1 A;  2I0N A;  3CME A;  5LJ5 f;  1K0S A;  1KC8 U;  2K4Y A;  2M0Y A;  2K3X A;  2JS2 A;  3QPH A;  4KGX B;  3I56 Q;  3JRZ A;  4JJD A;  3S3O A;  2PVO B;  3I56 T;  2O31 A;  2EQK A;  1PHT A;  3I5R A;  4C5I A;  1SG5 A;  2JZ2 A;  2AZS A;  4JUV A;  1WA7 A;  3T9N A;  1GRI A;  1K9A A;  3I56 A;  2CP7 A;  2J06 A;  1EFN A;  2HBP A;  1PRM C;  3QII A;  3VS1 A;  1JJ2 P;  2E1H A;  2ZPB B;  5GAN 8;  5GAM j;  1FX7 A;  3MHX A;  5EG2 A;  1Y71 A;  4J9D A;  2K57 A;  1GXI E;  3HSB A;  4NS5 A;  1KQS A;  1BI1 A;  3AHU A;  2FYK A;  2IVW A;  2BZY A;  3VKI A;  1ZSZ B;  3TSW A;  5CKH A;  1YCS B;  2E41 A;  4J5Y A;  1Q95 G;  4ZN3 A;  6AT1 B;  3N5B B;  5D6Y A;  1ZSG A;  4M75 A;  3X28 B;  1OX8 A;  4DBR A;  2OJ2 A;  3PTA A;  3EGX B;  2BIV A;  3KXT A;  1YI2 Q;  3C94 A;  4PFZ A;  3JCM Q;  1YI2 T;  1TTH B;  2JTF A;  4Z8A A;  3HL8 A;  1AZG B;  3UF4 A;  2F5K A;  1WHG A;  2HL3 A;  2HSE B;  1YI2 A;  1X2Q A;  2AK5 A;  3A98 A;  1UJ0 A;  4F17 A;  5LJ3 j;  1BYM A;  2CDT A;  1KJW A;  4FIB A;  3A1P A;  4AFQ C;  2D8H A;  3TU4 K;  1H3Z A;  2E3H A;  1N27 A;  2JXB A;  1JXM A;  2LNV A;  2RN8 A;  1K4U S;  2HCK A;  1VIF A;  2NWM A;  3MCA B;  3CEY A;  1GCP A;  2YLB A;  2DEQ A;  1E6H A;  3MP1 A;  2RI2 A;  2ABL A;  3A8H B;  1KG1 A;  1VQ8 Q;  1IB8 A;  2XK0 A;  1GBQ A;  1YBY A;  2YXY A;  5IT9 E;  1XTD A;  1VQ8 T;  4RTX A;  1YNZ A;  3JCM h;  2XHC A;  1OX9 A;  3PVL A;  4J8O A;  4M78 G;  1FMV A;  3EFO A;  1KSW A;  2QEX Q;  5GAO p;  3Q1J A;  3MEA A;  2W0Z A;  2QEX T;  2O2O A;  3ER0 A;  4OVA A;  2RJF A;  3ASK A;  1I8F A;  5GAN 6;  3CQT A;  3I55 Q;  3AT1 B;  2QEX A;  2VVK A;  3I55 T;  1E7O A;  2JTE A;  2YRD A;  3V7R A;  1DJ7 B;  4C92 B;  3I55 A;  3OYE A;  2FRY A;  4C5H A;  4EMK B;  2IIM A;  3VS2 A;  1D1B A;  3OS2 A;  4XTX A;  5CQX A;  2XD0 A;  3UA6 A;  4JDS A;  2CSI A;  2EGE A;  1O75 A;  3MET A;  2QQS A;  1WZO A;  4J7I A;  2LP5 A;  5LJ5 e;  4ZTF A;  2K7A A;  4M78 D;  2K9G A;  3U23 A;  2JW4 A;  4HVV A;  3ZFJ A;  2PZ1 A;  2QDY B;  3SWN C;  2JMA A;  1K8A C;  4ME7 A;  2FZK B;  4D6W A;  5GAN 7;  3UPU A;  5GAN 3;  3VS5 A;  1WHH A;  1WJS A;  5C6S A;  4M7D B;  1Y96 A;  4C8Q B;  4X9D A;  1MGQ A;  3A8O B;  1AEY A;  1I81 A;  1S1N A;  3MEU A;  2KBT A;  1AWJ A;  4QVC A;  1HJD A;  3HTR A;  2DMO A;  2KQW A;  4F14 A;  3UAT A;  2DBM A;  2SRC A;  4J6W A;  1UTI A;  2HQH A;  5DLQ E;  1IGU A;  2JTM A;  2K5I A;  4C5E A;  4R55 A;  1UDL A;  2DIG A;  1U1T A;  4M75 B;  1UHC A;  1UGS B;  5GAO m;  4XK8 E;  1SF9 A;  1YCY A;  3CBM A;  2YT6 A;  3H9N A;  1UGP B;  2K3Y A;  1WPY A;  2FPD A;  1KQS S;  2KR3 A;  5GAO r;  1Q86 R;  1GCQ A;  2QGG A;  4ELZ C;  4B9W A;  2LDM A;  4XTU A;  3RER A;  4C0G A;  2DD5 A;  1G2B A;  4OF1 A;  3I5S A;  3CCV Q;  1V29 B;  1QP2 A;  2IPO B;  3L2Q A;  2EIF A;  2QQA A;  3CCV T;  1KC8 C;  3LH5 A;  3HPW A;  1AT1 B;  3H0H A;  4C8Q G;  3JCM g;  3NTK A;  3CCV A; 
#chains in the Genus database with same CATH homology
 3L2W A;  3OSV A;  4M75 F;  5CCA A;  3CPF A;  1Q82 C;  5GAN d;  3CPW S;  1M90 U;  4HCB A;  1VQO T;  4KUL A;  2M16 A;  4M7D F;  1OZ3 A;  5A0L A;  2M0O A;  2I2L A;  5A2Q E;  5CR2 A;  3G6E T;  3E19 A;  2HQE A;  3KUF A;  4M78 C;  3QKJ A;  3CCQ A;  4PKC C;  3MEW A;  1M8V A;  1JBM A;  2HQX A;  4RG2 A;  3QUI A;  3ZEH A;  2RA2 A;  1VQO A;  3CMA T;  3P8H A;  3OMC A;  2DIQ A;  2WAC A;  3G6E A;  4FL6 A;  2RK2 A;  3URG A;  1JB0 E;  1OYX A;  1U1S A;  3OB9 A;  5GAN 2;  3GOX A;  2EYQ A;  3HFN A;  4PNO A;  3CMA A;  1M1F A;  4NOY A;  3GNG A;  4MDX A;  2RJC A;  1XNI A;  5IAY A;  4RG8 A;  3OYL A;  3QJY A;  3TEE A;  1PSE A;  2CZ0 B;  2X35 A;  4LDW A;  4BDZ A;  3WXM B;  2E64 A;  5FRM A;  3RKX A;  2D0Q B;  3M56 A;  4A4H A;  3HHT B;  1UB4 A;  2O01 E;  2CGH A;  1B34 B;  1Q82 U;  5CVI A;  5KE3 A;  3S3M A;  5GAM f;  3JSC A;  1MHN A;  1N8R C;  2QI2 A;  1QVP A;  1NZ9 A;  2KVQ G;  2RM4 A;  2ZPE B;  4M75 C;  2XDB A;  1Y07 A;  5FU6 C;  5J3B A;  3CXC S;  2CZ1 B;  5CKF A;  3OBY A;  4ELY C;  4M77 C;  2A3L A;  2ZPH B;  4N4H A;  3V7S A;  2MMP A;  2RB6 A;  3QZ9 B;  3S3N A;  2XDD A;  2RD1 A;  4GLK A;  1YJ9 T;  3RMS A;  4PJO E;  2QQR A;  3VU3 C;  1O9S A;  5CK9 A;  3JB9 G;  4PJO F;  4DA4 A;  1YJW T;  1M1K C;  1VQ7 T;  4MML A;  3OYY A;  4XU2 A;  3OYC A;  2QXF A;  3CCE T;  3H6Z A;  1YJ9 A;  5A0D A;  1KQ1 A;  3GF5 A;  1YJW A;  2D9T A;  2X4J A;  1VQ7 A;  3OYN A;  3PMT A;  3V8J A;  3CCE A;  4HT9 A;  2WSF E;  2Y90 A;  3DB3 A;  2PVG B;  2A7Y A;  4KT0 E;  2ZPG B;  1KHC A;  2EQM A;  4JRQ A;  4RCC A;  4E7K A;  4E7I A;  1QVG S;  1N8R U;  4F7U E;  4E7H A;  1N9R A;  2ZPI B;  4BI3 A;  4BUG A;  2X4Y A;  1FXX A;  3M4G A;  4F7U F;  5HK0 A;  1H64 1;  3A8M B;  4Y28 E;  5LJ5 d;  1XQH A;  3OS0 A;  3PT9 A;  2E12 A;  4O6J A;  4PJO G;  4IUU A;  1Q7Y U;  2ZPF B;  2HD0 A;  4BE0 A;  2LVM A;  2KY9 A;  2P0Q A;  2EFI A;  5GAN 5;  3BFM A;  4JLG A;  5FRN A;  5DLO A;  2DXB A;  4JS5 A;  2JVV A;  3RKY A;  3DB4 A;  1BKB A;  4MZT A;  4YTL A;  4DOW A;  1M1K U;  4LDX A;  4IKF A;  3QZ5 B;  5D6W A;  2PU9 B;  5LJ3 f;  4EPC A;  3CBO A;  2KSS A;  5LL6 S;  5D6X A;  1R8O B;  2G3R A;  3QSU A;  1WQ7 A;  4IUR A;  3UDC A;  3J7A F;  4N4G A;  3TCJ A;  4F7U G;  3CD6 T;  1LJO A;  3QDR B;  3JCM g;  3M57 A;  5CO7 A;  3SWN A;  1I5L A;  3J81 E;  3FB9 A;  2O4X A;  3LW5 E;  4ZGJ B;  1Q86 C;  4C5G A;  1P92 A;  3RMQ A;  3BDL A;  3L2Z A;  5GAN j;  1YIJ T;  3JB9 D;  3CD6 A;  2ZCF B;  1NPR A;  1IZ6 A;  4JRK A;  2RI5 A;  3PMI A;  4ATO A;  1XOV A;  1WJR A;  1ZQ1 A;  2EQJ A;  1UGQ B;  2RHY A;  3DKM A;  3BDU A;  1Y96 B;  4MDW A;  3NFC A;  4OP0 A;  3KBG A;  1KHI A;  3SB2 A;  5HKC A;  3C95 A;  2DTO A;  2X4W A;  1YIJ A;  3VUZ A;  4A53 A;  4BY6 B;  3CCL T;  4LDY A;  2LT1 A;  5GAM h;  4Z02 A;  4DOV A;  3OYG A;  3JCM W;  1QP3 A;  3O8V A;  3JCM d;  2AHJ B;  2GF7 A;  1M1G A;  2RHU A;  5DM7 R;  4M7A A;  3G71 A;  3CCL A;  2XDP A;  3X26 B;  2XID A;  2WSE E;  2K5L A;  4C0F A;  1VQK T;  4X9C A;  4PJO D;  1PSF A;  5CAI A;  5FU7 B;  4OB3 B;  4E7J A;  3MP6 A;  1BIA A;  1D3B A;  2CZ6 B;  2V8I A;  3FLG A;  4QVZ A;  4EDU A;  2FVU A;  1Q86 U;  4ZTJ A;  1N9S A;  3OY9 A;  1VQK A;  4KUI A;  3QG1 A;  1BI0 A;  1BI3 A;  2RI3 A;  2R5A A;  3SFM A;  4C0Z A;  4C92 A;  2V8K A;  4EMK A;  3LWH A;  1NJI U;  1WGS A;  5LJ3 d;  4M7A D;  2DK3 A;  4QQG A;  2EKO A;  3FJP A;  4E7L A;  3INZ A;  2ZZD A;  3A8L B;  5I2S A;  2VV5 A;  2YLC A;  1G3T A;  3FC3 A;  3CME T;  4M7D C;  3QHS A;  4C8Q C;  1N6A A;  2Y4Y A;  3JB9 J;  5GAO l;  4JJN K;  4PJO B;  3GNF B;  3MEV A;  4KBM B;  2RHI A;  3UT1 A;  2XI9 A;  4XTY A;  5KCH A;  3CME A;  5LJ5 f;  1KQ2 A;  5GAO q;  2CKK A;  1KC8 U;  2K4Y A;  3JB9 I;  3BW1 A;  4P5N A;  5GMK l;  2MF2 A;  3OS1 A;  3CC7 T;  3JAM E;  1KD1 C;  3JB9 F;  2K3X A;  3M59 A;  3UWN A;  5GAN h;  4IUQ A;  2RHX A;  3M9Q A;  2FHD A;  2LQK A;  3HRT A;  3LGF A;  2DAQ A;  2JNG A;  3QPH A;  4F7U B;  3JRZ A;  2XG8 D;  3CC7 A;  3S3O A;  4HT8 A;  4A4F A;  4A4E A;  1D3B B;  2PVO B;  3I56 T;  2FB7 A;  5GAN g;  1HK9 A;  2EQK A;  2XIC A;  3WVE B;  4C5I A;  2JZ2 A;  2FL7 A;  1FWZ A;  3L42 A;  3C12 A;  4JUV A;  3T9N A;  3CBP A;  1TH7 A;  3R6O A;  2MWO A;  2KDS A;  3I56 A;  2HNI A;  5AYF A;  2RH2 A;  2HBP A;  2L3R A;  4J6X A;  3OW2 S;  3QII A;  4BAC A;  3RIR A;  2DD4 A;  4M78 A;  1LNX A;  2E1H A;  4M77 G;  2ZPB B;  5GAN 8;  4QVD A;  5GAM j;  1S72 T;  2DVE A;  1FX7 A;  3HP9 A;  3FIF A;  3MHX A;  4XU3 A;  5EG2 A;  1VUB A;  1Y71 A;  4OGC A;  2GFA A;  2K57 A;  2DXT A;  1KD1 U;  3HSB A;  3JB9 H;  1GXI E;  4NS5 A;  1VQM T;  4IUP A;  4OB0 B;  5CKE A;  1S72 A;  3PGG A;  3QYG B;  3EAE A;  1KQS A;  3PIP A;  4M7A E;  4JS4 A;  3LYI A;  2KAF A;  1BI1 A;  3AHU A;  4M7A F;  2FYK A;  2IVW A;  4MMK A;  3V8K A;  3FDR A;  3JCM f;  5KH6 A;  2VXE A;  3OYM A;  3OYA A;  1VQ6 T;  3OMG A;  4N0A C;  3VKI A;  3ME9 A;  1VQM A;  3FEO A;  3VYH B;  2E10 A;  3M58 A;  3JCM b;  1K9M C;  4XTV A;  5GMK h;  5GAN 4;  5CKH A;  2E41 A;  4J5Y A;  5FLX E;  2D6F A;  3CCR T;  1VQ6 A;  1VQ4 T;  4ZN3 A;  4A54 A;  4GY5 A;  4L59 A;  4C92 E;  2V8J A;  4L6V 5;  2LC4 A;  3N5B B;  5D6Y A;  4C92 F;  2VXF A;  4M75 A;  5GAM e;  3X28 B;  3PTA A;  3JCM V;  1YHQ T;  1W2B A;  2PQW A;  3A5Z B;  4M77 A;  4XU1 A;  4EMH A;  2BIV A;  4JRP A;  4FT2 A;  3KXT A;  3JCM P;  3C94 A;  3QYH B;  4M7A G;  4FSX A;  3JCM Q;  1WQW A;  2GQV A;  4PJO C;  2R57 A;  1YHQ A;  3LH0 A;  1YI2 T;  2JTF A;  2CZ7 B;  2WSC E;  4HCZ A;  5GAO n;  1ZHI A;  3PIO A;  3HL8 A;  4IUT A;  3QBY A;  1X01 A;  4OB2 B;  2P0P A;  2PUO B;  5LJ5 h;  2Y4X A;  2F5K A;  5CKD A;  2QA4 T;  1YI2 A;  3VJP A;  4A4G A;  3X25 B;  4C92 G;  4J83 A;  4M77 D;  4FT4 A;  2QTX A;  1K9M U;  3OS5 A;  5LJ3 j;  1BYM A;  4LDU A;  3HKS A;  4FIB A;  2QA4 A;  2XKO C;  2ZGW A;  3OYI A;  2E6Z A;  1M9S A;  1VIE A;  3RUX A;  1G5V A;  2EQU A;  1QW1 A;  4XU0 A;  3OYB A;  3TU4 K;  1H3Z A;  1N27 A;  2RO0 A;  2JUF A;  1IRE B;  1ZBX A;  3M55 A;  2LCL A;  1OZ2 A;  2L8D A;  4RCB A;  3X24 B;  3MO8 A;  2LNV A;  2EJ9 A;  4JRI A;  5GAM g;  1QVF A;  4M77 B;  1VIF A;  4M78 E;  5KCO A;  4NL2 A;  3GLX A;  4FU6 A;  1VQL T;  3MCA B;  3CEY A;  4M78 F;  5CIU A;  2YLB A;  3E9G A;  5GAN e;  3JCM X;  3HRU A;  3L1A A;  5GMK i;  2CYZ B;  2DEQ A;  5LJ3 e;  4RKU E;  4FM4 B;  5GMK m;  3LGL A;  2EJG A;  1AHJ B;  3MP1 A;  3TRE A;  3CC4 T;  1YIT T;  1VQL A;  2GFU A;  2RI2 A;  3SWN B;  3A8H B;  3L2U A;  5J39 A;  2DO3 A;  5DY9 A;  3LX7 A;  2O4X B;  3CCU T;  1KG1 A;  2XK0 A;  3P8D A;  1YBY A;  1EIF A;  4Q5W A;  5IT9 E;  1VQ5 T;  2OTJ T;  2M9U A;  1XTD A;  2LT4 A;  2PUK B;  3NTH A;  3V7C A;  4E47 A;  1YIT A;  1VQ8 T;  4LDV A;  3CC4 A;  3G7Z A;  3JCM h;  2XHC A;  5GMK j;  4XTW A;  1RL2 A;  3CCU A;  2X4X A;  4HCC A;  2E65 A;  2L5Q A;  4PLI A;  4LD6 A;  2OTJ A;  4J8O A;  1VQ5 A;  3OYK A;  1B34 A;  2KK4 A;  4M78 G;  2LTO A;  4C0D B;  4M7D G;  1W2B S;  3M53 A;  3S6W A;  5GAO p;  3Q1J A;  4MZM A;  2DTI A;  4C92 D;  4M75 E;  3MEA A;  4CI0 C;  2LX9 A;  4N4I A;  3SDZ A;  5A0G A;  3HFO A;  2DXU A;  3P8B B;  2QEX T;  3CCQ T;  3ER0 A;  4OVA A;  2LQ8 A;  4M77 E;  2RJF A;  1M5Q 1;  3ASK A;  4M7A B;  1I8F A;  4M77 F;  5GAN 6;  4L5G A;  4OB1 B;  1VQ9 T;  2VC8 A;  3JCM J;  2HAX A;  4QQD A;  2QEX A;  2BKD N;  5LJ3 h;  3I55 T;  3M4Y A;  2YRV A;  3RES A;  1VQ9 A;  2EWN A;  5LJ5 j;  4J6Y A;  5GMK e;  3V7R A;  3MP8 A;  3J80 E;  2E70 A;  5FRO A;  3GP8 A;  4Y91 A;  1DJ7 B;  5LJ3 g;  2MAM A;  3NTK A;  4C92 B;  5J26 A;  3I55 A;  3OYE A;  1Y7X A;  4C5H A;  4EMK B;  2RJD A;  3DLM A;  4KUD K;  4M75 G;  1YJN T;  2LCC A;  4QQ6 A;  2L89 A;  2MI6 A;  2VYT A;  5CQY A;  3OS2 A;  4XTX A;  4M7D A;  4C8Q A;  1G3S A;  1VQP T;  4BD3 A;  5CQX A;  5HK3 A;  1YJN A;  4MZP A;  4BY6 C;  2XD0 A;  3PFS A;  4WF2 A;  3DLL A;  4JDS A;  1QVF S;  1I4K 1;  3CCS T;  2NLU A;  1G3W A;  1O75 A;  3MET A;  1VQP A;  3GPL A;  2QQS A;  2K2V A;  4J7I A;  1VQN A;  5LJ5 e;  1U8R A;  3PNW C;  4ZTF A;  1JJ2 A;  2GCX A;  2PVD B;  4XQ3 A;  1Q7Y C;  2DKG A;  1Q81 C;  3CCS A;  1RI0 A;  1OI1 A;  4UC4 A;  3EFS A;  4M78 D;  4M7D D;  2DXC A;  4C8Q D;  5FU7 C;  4BE2 A;  4DQ2 A;  3WVD B;  4II1 A;  4V2S A;  3QO3 A;  3E9F A;  3ZFJ A;  2QDY B;  2F69 A;  1W4S A;  2M1H A;  2QQB A;  2C06 A;  2RJE A;  3EFR A;  2VGM A;  3GIB A;  3SWN C;  1WNL A;  2VUB A;  3RKW A;  2DZC A;  1K8A C;  4ME7 A;  2YHT A;  4CRI A;  3CCR A;  4VUB A;  3A8G B;  4D6W A;  1VQ4 A;  5GAN 7;  3UPU A;  5HY6 A;  3F70 A;  5GAN 3;  1LOJ A;  1WJS A;  4XAX B;  5C6S A;  5KE2 A;  4M78 B;  3H8Z A;  4M7D B;  2EJF A;  1Y96 A;  5I2M A;  4C8Q B;  4X9D A;  1MGQ A;  4ZGE B;  3CPW A;  2VGN A;  1HXD A;  2R5M A;  4QW2 A;  4C0D C;  4HKE A;  4PLL A;  5L8R E;  3CCM T;  4BI8 B;  4OMF B;  3A8O B;  4ZN1 A;  1I81 A;  2F5T X;  4M75 D;  3L2V A;  1Q81 U;  3M54 A;  3CC2 T;  2B8A A;  2P4T A;  1K73 C;  3MEU A;  3CCJ T;  4OGE A;  3OBW A;  2DTH A;  3QXE B;  4QVC A;  5I21 A;  4RMO A;  2KQW A;  2RHZ A;  3CCM A;  2DPP B;  4M7A C;  2EAY A;  3C4S A;  4PL6 A;  3ZBD A;  3FRN A;  1UGR B;  5GAN f;  5LJ5 g;  3CC2 A;  1M4Z A;  4N0A A;  2QQ9 A;  3BY7 A;  4HA8 A;  3CCJ A;  4B9X A;  4J6W A;  2RK1 A;  5GAM d;  3LWI A;  3JCM e;  4IUV A;  4XTZ A;  4O5V A;  2JN0 A;  5DLQ E;  4BE1 A;  1K8A U;  2OTL T;  4LD9 K;  2JTM A;  3VUB A;  2K5I A;  4C5E A;  4R55 A;  4BI4 A;  4NL3 A;  2JOY A;  1UEB A;  2DIG A;  2E6N A;  4A4K A;  3X20 B;  4X34 A;  1U1T A;  4C92 C;  2BUD A;  2DJZ A;  4M75 B;  1UGS B;  5FU6 B;  2OTL A;  4EMK C;  5IN1 A;  4XK8 E;  3JCM c;  5GAO m;  3VV0 A;  5M9O A;  1YCY A;  3CBM A;  1BIB A;  1UGP B;  4M7D E;  4C8Q E;  3OYH A;  2LRQ A;  3QJ6 A;  2K5F A;  2K3Y A;  2E5Q A;  4JLI A;  4C8Q F;  1WPY A;  3CXC A;  1M90 C;  1NJI C;  3OYJ A;  1KQS S;  4PJO A;  1WJQ A;  2CS7 A;  1K73 U;  5GAO r;  3OYF A;  1NE8 A;  2XU8 A;  1G3Y A;  4TVR A;  4EMG A;  1JJ2 S;  3OW2 A;  2R58 A;  1X75 C;  4ELZ C;  4B9W A;  3G71 T;  2LDM A;  4XTU A;  3V8L A;  3NTI A;  1JRI A;  4C0G A;  3RER A;  3OYD A;  3LLR A;  2DD5 A;  3VYG A;  1NPP A;  4OF1 A;  3SD4 A;  1SSF A;  1V29 B;  3L2R A;  1QP2 A;  3G4S T;  3L2Q A;  4J7F A;  2P0K A;  2EIF A;  3M5A A;  4R56 A;  2IG0 A;  1VQN T;  2QQA A;  4BB7 A;  3CCV T;  1KC8 C;  3OSS C;  2OAU A;  3HPW A;  4F7U A;  3E1S A;  1X6O A;  5C0M A;  2H3J A;  3G4S A;  4ZGD B;  1VQ8 A;  2MWP A;  4C8Q G;  3OA6 A;  5CKB A;  2DZ9 A;  1QVG A;  3OQ5 A;  1BI2 A;  3HRS A;  2KMT A;  3CCV A;  4BDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...