1N8RR

Structure of large ribosomal subunit in complex with virginiamycin m
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 23S ribosomal RNA
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2002-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1n8rR00
1Q7YR 1VQLQ 1YITQ 1KC8R 3I55Q 1K8AR 1VQ4Q 1Q82R 3CMAQ 3CC4Q 1W2BP 1VQ6Q 3CCRQ 3CMEQ 1VQOQ 1YIJQ 1NJIR 1K73R 1K9MR 1M90R 1VQNQ 3CCEQ 1KQSP 1VQ9Q 1YJ9Q 3CCMQ 1Q86R 1JJ2P 3G6EQ 3CPWP 3CCUQ 3CCJQ 3CCVQ 1YJNQ 1N8RR 3CC2Q 1VQ7Q 3CD6Q 3G4SQ 1QVGP 1KD1R 3CC7Q 1YI2Q 3OW2P 1S72Q 1VQPQ 2QEXQ 3CCLQ 1VQKQ 2QA4Q 2OTJQ 1Q81R 1VQ5Q 2OTLQ 3CCQQ 3I56Q 1VQMQ 1M1KR 1YJWQ 3G71Q 1QVFP 3CXCP 3CCSQ 1YHQQ 1VQ8Q
chains in the Genus database with same CATH superfamily
4M77D 2DVJA 2YLCA 3EGXB 3BDUA 1GCQA 2PUOB 1UE9A 3L2ZA 4BY6C 5FU6C 1NJIC 1S72A 4Q5WA 3M0SA 3O5ZA 4M7AA 5CKDA 3O8VA 4J5YA 2GQVA 3G7ZA 3L2RA 2ESWA 1QCOA 5LJ5f 1KHCA 3HRTA 2LJ1A 1QMCA 5LJ3d 3CMEQ 1SHGA 4GY5A 3VS2A 3PMIA 2KXCA 2RB6A 1WFWA 5C6SA 1LCKA 1KD1R 1BCMA 2X35A 3EG2A 4RTXA 1SHFA 1YP5A 2AKLA 4BY6B 1W1FA 3JCMh 3QKJA 2DTOA 4LUDA 2QGFB 2BE7D 2YRVA 4LDYA 1BIBA 4PJOA 1G5VA 1B3QA 1M2VB 1RI0A 1Q82U 3HTRA 3UT1A 3MCAB 3V8LA 1OYXA 1BI3A 2DILA 1JU5C 1X43A 3QZ9B 1QKXA 3OB9A 3X28B 1VUBA 3TU4K 4FU6A 5GAN8 3CCEQ 4E7KA 1FYNA 4RUGA 1M1KC 3CBMA 3OMCA 3J80E 3CPWP 5GMKj 2O01E 1WZOA 4K11A 2DRMA 2F5KA 1AZGB 1K73U 3M0TA 4A4GA 4Y92A 1QWEA 3L2VA 2M9UA 1R0CB 4F7UG 1FMVA 4B9WA 5GJVB 2A0FB 4PJMA 4LDXA 3PIOA 2LQKA 3CCJA 1K1ZA 3VKIA 1JJ2P 1KC8U 1LJOA 3VS7A 5CCAA 3SFMA 4CC3A 4P5NA 4A4EA 2DYBA 1Q86C 1X2KA 2MAMA 3G71Q 4OB1B 2SRCA 1QQJA 2LQ8A 4HKEA 1IHVA 2DZCA 3I56A 4QQGA 3JB9I 4L59A 1ZQ1A 1E6GA 1BU1A 3JB9D 2KYBA 3EGXA 3CXCA 1JRIA 2RI5A 1VQNA 2BTTA 1OI1A 3CC7Q 1X6GA 4Z8AA 5IHIA 2V1QA 1MV3A 3MEUA 3OS1A 1YHQQ 1VQLQ 4JJBA 2M51A 2MOXA 3A8LB 2DJQA 1K9MR 1VQNQ 4FL6A 3J81E 3MHXA 5KYWB 2RHYA 1K8AU 2RQWA 1UECA 3RBBB 1WXBA 4HCKA 1XJWB 5A2QE 2K3XA 3QSUA 5I2MA 3QPHA 4C92B 2VASA 3ASKA 2D0QB 1XQHA 2NYSA 1M4ZA 2DL7A 3CC7T 1M90U 3E1SA 2XU8A 2QG9B 2C0IA 3M5AA 8AT1B 1FMWA 2VXEA 3X25B 1W70A 1I4K1 2JJ9A 3QBYA 1W4SA 2LCLA 1CKBA 1B07A 2EYYA 4BUGA 2ZPFB 3V8KA 3M54A 3PVLA 4PNOA 5DY9A 1VQ5Q 4RTZA 2LX9A 4M75C 3CMEA 2NLUA 2RQTA 2E3IA 1BYMA 4XAXB 4II1A 4J9FA 4PK4A 3EG9A 2HBPA 2I2LA 4AG1C 2LT1A 3Q1JA 5LJ3j 2VYTA 4EMKC 3A1PA 1UG1A 2PVOB 2Z0WA 2R5MA 3OYAA 1Q82R 4M78F 1WXUA 2Y90A 4ANJA 1Q7YR 3TVTA 3CCVT 4LUEA 1ZUUA 1PRLC 3FB9A 3QG1A 4J9GA 7AT1B 4ZGEB 3MJXA 5LJ3f 1MHNA 1A0NB 2CUDA 5CQXA 1M5Q1 1VYVA 1PCXA 4C5HA 2JM9A 1K4US 1X6OA 5GMKi 1VQKQ 2OTJQ 5GAMj 5GANj 3M58A 1K8AC 1QVFP 3GIBA 2GFAA 5GAOq 3I55T 1SRLA 3V7CA 1CKAA 1UB4A 1HD3A 2MMPA 2VVKA 1V76A 4NOYA 4QW2A 2GBQA 1I5OB 1VQ9Q 3LGLA 2L5QA 2DIGA 4XU0A 2CZ6B 3HKSA 1VIFA 1NPPA 4M78E 2J6KA 2L3PA 3R6NA 1AT1B 2HL3A 3MP1A 4V2SA 2C0TA 4BDYA 3V7RA 5CR2A 2DKGA 2ATCB 4IKFA 1VQ6Q 4E47A 2PQWA 1NYFA 2EIFA 2L8DA 2YSQA 2QA4A 1VQOA 5FWBA 2JS2A 2W10A 3NTKA 3OYHA 4LN2A 1T3LA 3T9NA 3CCUT 4XU3A 1RABB 2KRNA 4PFPA 2ZPEB 4C92C 5LJ5j 3GPLA 2XD0A 2FPFA 2ABLA 3A8GB 3CCMQ 1BIAA 2JS0A 3MEWA 2M0OA 3LYIA 1WDXA 3QWXX 2DX1A 2NUTA 1Q7YU 3ZL7C 1WIEA 2EKHA 2KDSA 1M2VA 2RJEA 2RK1A 3JB9J 3EFRA 4JRQA 2BKDN 1VQ6T 1TSFA 3HRSA 3P8BB 3FIFA 2RI2A 2LP5A 3VS1A 3RR6A 4C0GA 2CDTA 5DLOA 3CCUQ 1AWJA 3RESA 3EG3A 2DBKA 1TU0B 2EPDA 4NS5A 1OZ3A 5CAIA 2RJFA 5EC7A 3M0RA 3CCEA 4OB0B 2X4XA 3VS6A 1VQ9T 2F5TX 3GLXA 1WHMA 2WSFE 2LJ0A 3QYGB 1IZ6A 1PNJA 2P0KA 4QQ6A 4NL2A 2X4YA 1PM3A 4F14A 4F7UA 2LT4A 1T3SA 2H3EB 4WF2A 2CP7A 5AT1B 2K57A 4L5GA 2PU9B 2COZA 1SG5A 1YJWQ 5GAOr 4BE0A 2DXTA 2QQRA 3PIPA 2AZSA 3AT1B 2YXYA 3FC3A 3DLLA 2AKKA 2XDDA 1V29B 3VS5A 2O4XB 1QVFA 4F16A 2XK0A 4J9HA 2PVGB 2QDYB 3REBB 3GP8A 1M27C 2KYMA 2QK0A 3I55A 1QLYA 3VS4A 1AWWA 4RTWA 3PNWC 2EJGA 2HSEB 2E5QA 1WYXA 3CCRQ 3J7AF 2EVRA 4FSSA 1RLPC 1YCYA 4QQDA 3VS3A 2NWMA 3QO3A 3MP8A 1ACMB 5GMKh 1ZSZC 1SSHA 1WHGA 1YI2T 4XTZA 1MV0B 3CD6T 4J9BA 2E4HA 2DO3A 1WHLA 1D0ZA 1U1TA 1GFCA 3DB4A 4ELYC 1JB0E 2CP3A 2HQEA 5KH6A 2HKNA 2RO0A 2X3XD 2QDLA 4M77G 4YTLA 4R56A 1UGPB 3WVEB 2NUTB 2ZPIB 4D8KA 2QEXT 5GANh 3S3MA 1QVFS 5CKBA 4EIKA 3OA6A 1TXQA 1OU8A 2X4JA 2O9SA 2PTKA 5FROA 5GAN2 4PJOB 1RAIB 1PRMC 3EG0A 4MZMA 3CXCS 2HNIA 1TTHB 4QKUA 3QJYA 2WACA 2IVWA 1UFFA 4PL6A 2XI9A 2K3YA 1Q82C 1VQ8A 2RQRA 4LXCA 2EYZA 3OW2P 4IURA 2HL5C 1MNEA 4OMNA 4EMKB 3CC2A 2KNBB 3JB9H 3JRZA 4FYWB 1C6VX 3FEOA 2EQIA 4J6XA 1ARKA 1YIJQ 3MP6A 2MWOA 3H41A 2K2MA 1D1CA 4C92E 1KQSA 1AZEA 3CMAA 1YCSB 4M7DF 1WGSA 5A0LA 3FLGA 4M77B 4DQ2A 3CCET 1HSQA 2R5AA 3CCST 3VUBA 3CBPA 4JUVA 4JJDA 3JCMJ 3CD6A 2V1RA 2K3BA 3FRNA 2MPXC 2A7YA 2FVUA 1Y96B 1NPRA 1E7OA 3CCVA 1EFNA 2E1HA 4FYVB 1YI2Q 2DM1A 4RMOA 3OYMA 2X51A 3S3NA 3E9FA 5FU7C 1Q95G 4C92A 2HDAA 3RMQA 4BACA 1VQ4Q 1N8RC 3QWYA 4HA8A 1LOJA 1JXOA 4PFOA 2V8JA 4FW2A 4E7LA 2EJ9A 1IGUA 1YJWA 2M16A 4GLMA 2JVVA 2MF2A 3QYHB 1D1AA 3OS5A 3NHNA 1ZHIA 4PJOF 2L3RA 3EG9B 3EH2A 4AG2C 2HQXA 2JXBA 1OEBA 3PVQA 2AZVA 1OULA 1UDLA 4M75D 2VGMA 3CCMT 3VJPA 4OMLA 2CZ7B 4RCBA 1VQLA 3C12A 2D8HA 2MCNA 1N9SA 2K9GA 4J7IA 2LCSA 8ATCB 4XU2A 1Q86U 2G6FX 1GL5A 1QVGS 1B34A 2X3WD 1MMAA 5DLQE 1K73C 2EQUA 2BIVA 1PD1A 1RACB 4OMOA 2FZGB 2CKKA 3UWNA 1Z9QA 1H8KA 2V26A 3EAEA 2HZYA 3VV0A 5KE3A 2D8JA 4CC2A 4BE1A 1PSEA 2ZPHB 3H0HA 2LTOA 3HP9A 1WJQA 3OSSC 4MDWA 3KXTA 3HPWA 3PTAA 4ATOA 3GOXA 2CYZB 2F2XA 1LVKA 1IRXA 1QCFA 2C0OA 1UUEA 3KFVA 4E6RA 2RMOA 5GAOm 2DEQA 2E10A 2H3JA 4HVUA 2EQJA 2DXBA 2KR3A 4PKCC 4BDZA 3CCQQ 2BZXA 2RHZA 1AWOA 1RL2A 1X2QA 4ZGJB 2CUBA 1K0XA 3NTIA 3HHTB 2KMTA 3CCJT 2EKOA 4M7DC 1M1FA 1K8AR 2RF0A 1YBYA 5DM7R 1NM7A 3JAME 1M1KU 1IO6A 5GAOp 1TG0A 1M1GA 3I5RA 4RTVA 2O31A 3I9QA 3M0UA 1TWBA 4FM4B 4M78A 4LDUA 3QJ6A 4C0ZA 4CRIA 5GAMg 2J06A 4BI4A 1UGQB 3CC2Q 2GCXA 2OTLA 1VQPQ 2ZGWA 3C4SA 3MO8A 4FYYB 4MMKA 5L8RE 1VQLT 4Z02A 1N8RU 1C0MA 1WI7A 2H8HA 3ZEHA 1PD0A 2DTHA 2RHIA 4TVRA 4M75A 3ER0A 2CZ0B 4KRTA 2SEMA 4E7SA 3G71T 3G1JA 2K7AA 1Q86R 4F7UF 4PJOG 3SWNC 4AMCA 1OU9A 2M0YA 3CCRA 4JJCA 2O88A 4HVWA 5I11A 2FRYA 3CPFA 4PJLA 1HJDA 2EGEA 3META 1PKSA 2JT4A 1XOVA 4N0AC 2L0AA 2E64A 1FXXA 3BW1A 2CP0A 4OF1A 4X9CA 3CCQT 1NLPC 1YJNA 4RCCA 1EIFA 2A08A 3TREA 4A4HA 4QVDA 2CP6A 5IXFA 1BBZA 2XKOC 3G4SA 1AD5A 1M3BA 3CXCP 3JCMb 3CCSQ 1FMKA 4M77A 4ZTFA 1MMNA 2GFUA 3HFNA 1MMDA 2FHDA 2DETA 2CSQA 4HCZA 1VYUA 4B6MA 1N6AA 4N4GA 2YT6A 2QQSA 1X01A 1WJSA 2EYQA 2CP5A 2DZ9A 4QVZA 3PGGA 1D0YA 1G3TA 4M7AD 2HAXA 1OPKA 2QTXA 2JW4A 1NG2A 2KBTA 2DBMA 3CC4T 2R58A 3BFMA 3RDVA 3VRYA 3OYFA 4ESRA 1VQ8T 4M78G 4M78D 3SEMA 1WLPB 3EFOB 3EGDB 3BE3A 4OB3B 4J6WA 4R0KA 5D6XA 4XQ3A 1OX8A 3P8DA 1QCNA 1G8XA 3CCUA 3I5SA 2CH4W 2AT1B 3DLMA 2QI2A 4OMQA 3QUIA 1I07A 3PFSA 2E12A 1BKBA 2EGAA 3OYYA 4J8OA 4KBMB 2FYKA 2PNIA 1VQ4T 5ECAA 4N0AA 5A0DA 5KYWA 1WHKA 1U06A 5KYNA 2MWPA 1PKTA 2DLPA 3GF5A 2LVMA 1KQ2A 1RAHB 4GLKA 2NUZA 4RKUE 1VQ4A 3CQTA 5I21A 3CMET 2QQ9A 2QA4Q 1G2BA 2FB7A 1RAGB 2EYWA 5GJWB 4LD6A 1ZA2B 2BUDA 1Y96A 1KC8C 1YHQA 3EHRA 3CBOA 3M56A 4C0DC 1JBMA 4O6JA 3MPUB 3CEYA 3UF4A 2JZ2A 2MK5A 3EFOA 3EGDA 4PLIA 3CC4A 1JQQA 3VYGA 1QKWA 2V8KA 5KYUB 2CGHA 3GBQA 1DJ7B 2QYZA 2GTJA 2L3SA 2COYA 3LH5A 3M9QA 2QTVA 9ATCB 4XTUA 5D6WA 3OW2A 1S72T 3HSBA 1X69A 2E70A 1R77A 2WSCE 4M7DD 1Z9ZA 1M8VA 4PJOE 1YFNA 4EMKA 3G4ST 2A3LA 2QEXQ 3OYKA 2LCCA 1VQKT 2OTJT 1O9SA 2F2VA 4HCBA 2DERA 3FDRA 2HCKA 4KUDK 3SB2A 3JCMX 3M4YA 3SWNA 5HK3A 1VQ5A 1QVGA 4OMMA 3NPFA 3PE0A 3UATA 2K6DA 4FT2A 4PFZA 3EGUA 4JS4A 4J6YA 2YWWA 2JOYA 1H641 2J05A 3CCJQ 3FJ5A 1ZUYA 2A28A 2HQHA 4LDVA 2E6ZA 2LNHB 4CC7A 2KVQG 3A8HB 4HVVA 2JNGA 2ZAEA 3OBYA 4XTWA 3G71A 2K4YA 4MMLA 2DFUA 4M7DB 4E2FB 1NLOC 4M77E 5HKCA 1Y71A 2HMAA 1YNZA 3OYBA 4DBHA 2LMJA 4A63B 2ZPBB 4LNPA 2FPEA 2LJ3A 1K9MU 2GF7A 3EFSA 3IQLA 3CC7A 1WQ7A 4DBRA 1NE8A 5HK0A 2OJ2A 2EYXA 3DKMA 2V8IA 3CMAQ 2L89A 1I1JA 2M1HA 3CPWA 2KRSA 2QXFA 3ULRB 2DYIA 5FRNA 3CD6Q 4DBQA 5GAMf 3HL8A 1S72Q 2A37A 4M78B 3UDCA 2RPNA 3TSZA 2GNCA 1VQMA 2FRWA 2NUPB 2KY9A 3L2QA 1NJIR 1ZX6A 2DEUA 4KUIA 4C8QB 5M9OA 1QVGP 3JB9G 2LC4A 4N4IA 3OYGA 2XIDA 1VQMQ 1M1KR 1IHWA 2LRQA 4RG2A 4EPCA 3V8JA 3H6ZA 1GFDA 3E19A 1K9AA 5GAN6 1MNDA 3REAB 2DTIA 3C94A 2YUOA 4E7JA 1K73R 5EG2A 1H92A 3KBGA 5LJ3g 2PZ1A 1M9SA 4F17A 2RN8A 1YJ9T 1WXTA 2K5FA 4PJOC 3G6EQ 1KD1U 1N8RR 4PJOD 1QP3A 4Y91A 1QVPA 4XTVA 1UEBA 2IG0A 1UJ0A 3OMGA 3I56Q 1VQ8Q 3THKA 2D9TA 2F69A 2RK2A 1VQ6A 3P8HA 4OP0A 1Y0MA 2LNVA 1NYGA 3OBWA 4IIMA 1ZSGA 1RI9A 2XMFA 1NEBA 2OX7A 2DXUA 4RTTA 3JCMP 4FW1A 1YIJA 3H0IA 2OAUA 1KQ1A 2P4TA 2VGNA 4OVAA 4IUPA 1KC8R 1KG1A 4PJNA 4HT9A 4KH0B 1IGQA 1W2BA 1ZA1B 1M30A 3CCMA 4M75G 2EGCA 3I56T 2QEXA 1BI1A 2PVDB 1Q7YC 2RM4A 3VUZA 2LZ6B 3AHUA 1BI2A 2DNUA 3RKWA 4LDWA 2ROTA 4RTYA 4M7AG 4C8QF 4HCCA 5IT9E 3EHQA 1YIJT 5CKHA 2J6OA 4M7DE 4BB7A 5KCHA 1M90C 4HT8A 4X1VA 1ABQA 4RG8A 1PWTA 2R57A 4PJJA 2WSEE 4XU1A 1HYOA 3CCQA 4M78C 3M53A 5FU7B 4DEXA 3QDFA 5CK9A 1PC0A 2XDBA 2DJZA 2CREA 2KAFA 3MEVA 5A0GA 1EZZB 2F1LA 2DL5A 5GANe 1VQ7A 2QQBA 3UA7A 1I5LA 1VQPA 1WA7A 1NZ9A 4KGVB 2GGRA 2J6FA 4AFZC 2C06A 1GBRA 2QGGA 1W6XA 2YDLA 2OAWA 2FG0A 3JCMW 1VQ7T 5CIUA 4IIOA 2KROA 4JLIA 1WQWA 2DL4A 4KGXB 1YJWT 2KSSA 1WJRA 1X6BA 2DK3A 4C8QD 5IHKA 1KIKA 2L2PA 1CSKA 3RKXA 3MEAA 3CC4Q 3A8OB 2Y4XA 2FZCB 3HFOA 4DOVA 4A4FA 4OMPA 1S1NA 4M7AC 4M77F 2DD5A 2YUPA 2VV5A 3H0FA 1VA7A 2RJCA 4XK8E 2CZ1B 3JCMc 4A54A 1WHHA 5GAOn 4JZ4A 4C92G 1ZBJA 2YRCA 4IUUA 3JCMV 1I81A 2HD0A 1TUCA 2DA9A 3LW5E 5GANg 4MZPA 2FZKB 4D8DA 3EH1A 3MKDA 1TOVA 1NEGA 2E65A 4MZTA 2D6FA 1KHIA 1VOMA 2K79A 4ZN3A 5FWCA 4FIBA 1RLQC 1XTDA 3SD4A 1U8RA 1LNXA 2CH4A 4ZGDB 5GAOl 1T0HA 2ROLA 2J7IA 2FPDA 4GBQA 1NBEB 3OSVA 3NFCA 1XNIA 2DL8A 4M75F 1K76A 1FX7A 5KYXA 2FEIA 1YWPA 1H3ZA 3H8ZA 1OZ2A 1VQOQ 1G83A 5FLXE 1UGRB 4M7AF 1KK7A 2DD4A 5KE2A 1YHQT 2CT3A 2RH2A 2OI3A 3DB3A 4CC4B 4Z88A 1VQNT 4MDXA 1ZSZA 2JN0A 4JRIA 5GAMd 3OYIA 4FCYA 1UGSB 4WCIA 4OB2B 3FJPA 1F1BB 4ELZC 3TEEA 3X20B 2ZZDA 1RUWA 4FYXB 3OS2A 2RNAA 2D0NA 3M0PA 1EX4A 1B34B 4EDUA 2HKQB 4B9XA 5J39A 3CCLQ 1M3CA 1N5ZA 2VC8A 4C8QA 3D7SB 2QAZA 4KH1B 2KT8A 4EMHA 3JV3A 2JTFA 2L3QA 4C92F 1AOJA 1RADB 4X9DA 3PT9A 3BDLA 1OQKA 1OV3A 2RJDA 5LJ5h 4BI3A 3X26B 3CCLA 2AK5A 1BB9A 3HRUA 2LQNA 5I22A 5GAN3 3QHSA 1GBQA 2ED0A 5KCOA 3VYHB 1V1CA 2ED1A 3JSCA 2FO0A 1SSFA 2AIRB 2JUFA 4M7AE 1I8FA 2ZPGB 3CPWS 3TSWA 5LJ5d 2YUNA 5I2SA 4J9IA 1D3BA 2LDMA 3RUXA 4M77C 5FRMA 5C0MA 1G3YA 4C92D 2KEAA 2KI7A 2P0PA 2O4XA 5KYXB 2KGTA 3JCMf 2MI6A 3UA6A 2RHUA 2HEQA 4JS5A 3M4GA 3SDZA 5J3BA 3VS0A 3A98A 1JXMA 1IXDA 3E9GA 1AWXA 1G3WA 3R6OA 1YJ9A 1NJIU 1VQ5T 1B7TA 3C0CA 4DEYA 1YITQ 3WVDB 5HY6A 3CCRT 4AFSC 4F7UB 4N4HA 3SWNB 1R8OB 1AHJB 1U5SA 4C0DB 4IUTA 3CCVQ 3G6ET 1PG5B 1YITA 5GAN4 1P92A 2KE9A 1J3TA 1BCOA 5CO7A 4AT1B 4JLGA 1FWZA 4DBFA 1OX9A 2RHXA 1HXDA 1R0BG 4C8QC 2DRKA 1ZUKA 4O5VA 1M3AA 2JMAA 3LLRA 2LX7A 4JPBW 4XTYA 3V7SA 2F2WA 2M02A 2OTLT 1Q81R 5LL6S 4ZTJA 2FL7A 1UHCA 2E3HA 2IIMA 4FT4A 1SF9A 3LX7A 1SRMA 3I55Q 5GANd 2MYSA 4QT7A 3SHWA 4F04B 4C5IA 5LJ3h 3JCMg 4IUVA 3OYJA 3KUFA 3CMAT 3RIRA 2RI3A 2VWFA 3RERA 4CI0C 1G3SA 4J9CA 1KQSP 3QXEB 2P0QA 2KT1A 2A36A 4C5GA 3JB9F 2EQMA 3H9NA 1D0XA 3RNJA 1JJ2A 1D3BB 2RQVA 1W2BS 2ZCFB 3A5ZB 1K0SA 3NGPA 4F7UE 1PHTA 5CKFA 4BD3A 1QP2A 4AFQC 1JEGA 3QIIA 3ZFJA 1Y7XA 3NTHA 1WNLA 4WTOB 5FU6B 4DOWA 2XHCA 5KYYB 3VU3C 1VQPT 2E5KA 1U3OA 2P84A 1UTIA 5LJ3e 3OW2S 3QDRB 1KSWA 4OMFB 1T0JA 4QVCA 2VXFA 3TQ7P 3ZBDA 1TH7A 2XDPA 1C1AA 2CT4A 5GMKm 2E6NA 4KULA 2VKNA 3L42A 2YHTA 1YI2A 1YN8A 4J9DA 6AT1B 2KRMA 1D1BA 4ZN1A 2EQKA 2BZ8A 1MUZA 1VQOT 2B8AA 5GAN7 1K9MC 3OY9A 4ME7A 4E7IA 1WX6A 2EJFA 5GAN5 1GCPA 3LWIA 4M4ZA 2JTEA 2RQUA 3QZ5B 2YUQA 1TUGB 5LJ5e 2KQWA 2VB6A 1MMGA 1ZSZB 3BY7A 4X34A 2OTLQ 2GQIA 4KGZB 1RAAB 1IB8A 5FW9A 1BI0A 2X9HA 1Y57A 1AEYA 3OYDA 1KJWA 1HK9A 5GMKe 2LQWA 2VUBA 1M90R 2EW3A 4BE2A 2DAQA 2DVEA 1ZLMA 3OYNA 5IH2A 1VYTA 1Y07A 4Y28E 1U1SA 4UC4A 2XG8D 3LGFA 4J7FA 2RD1A 2EBPA 1W2BP 1VQKA 1KQSS 2OTJA 2ECZA 2MIOA 3TCJA 1ABOA 2RA2A 1JO8A 5GAMh 4XTXA 2CSIA 4BI8B 5CQYA 4OGCA 4M7DG 3U23A 3M55A 5GANf 4IUQA 3L1AA 4M75E 1RAFB 2QQAA 3JCMe 1D09B 3N5BB 3X24B 3F70A 4OGEA 2E41A 1N9RA 4JRPA 1QWFA 1SKUB 1GCQC 2K5LA 3LH0A 4AFUC 3CCSA 3I35A 5HCKA 4C5EA 2DPPB 5IN1A 2HBWA 4JJNK 1H3HA 1M8MA 3M59A 1LPLA 1VQ7Q 3RMSA 4L6V5 2G3RA 3G6EA 2X4WA 1X75C 4JRKA 3M57A 5IHNA 5KYUA 3WXMB 3PMTA 3INZA 1SEMA 2BZYA 3CC2T 3M0QA 3OS0A 1X27A 5AYFA 1GXIE 4DA4A 4KT0E 4J83A 1TUDA 1GRIA 1VIEA 4RTUA 2KK4A 4J9EA 2NUPA 2K5IA 3C95A 1AVZC 2PUKB 2QA4T 4LD9K 1PSFA 3L2UA 1ZBXA 2JTMA 1YWOA 2IPOB 3ME9A 2QASA 1I0CA 1VQMT 1YITT 2JMCA 3NMZC 1YJNT 1RAEB 1UHFA 2D1XA 1Q81U 2XICA 2KXDA 1BK2A 1KD1C 4LE9A 2O9VA 2P4RA 4Z89A 3RKYA 2DXCA 1YJ9Q 5D6YA 1WPYA 4D6WA 4JZ3A 4M75B 1O75A 4E7ZA 2I0NA 3OYLA 5CKEA 4ORZA 3S3OA 1SPKA 2B86A 1TS9A 5J26A 5LJ5g 2EFIA 1MGQA 2EWNA 4VUBA 2GTOA 2W0ZA 4PLLA 2YLBA 5IXBA 3S6WA 2COWA 5GMKl 1Q81C 4M7DA 4E7HA 1QW1A 3EG1A 2O2OA 3G4SQ 4JDSA 3A8MB 5D7UA 5L23A 2YRDA 4FSXA 2Y4YA 2AHJB 4NL3A 4A53A 3JCMQ 1WHJA 3OQ5A 2JM8A 3VRZA 3L2WA 1M2OA 2DF6A 1UGVA 4ZNXA 3UPUA 2DL3A 1JJ2S 4HXJA 3LWHA 5CVIA 1UJYA 2CP2A 5IAYA 4R55A 2DIQA 3OYCA 2EAYA 3URGA 5KYYA 2K2VA 1N27A 1E6HA 1OOTA 2DE0X 1OPLA 5GAMe 2HSPA 2BE9B 3CCLT 1KFZA 4C8QG 3GNFB 3JCMd 4EMGA 2CS7A 1IREB 2DMOA 3OYEA 4A4KA 1YJNQ 4C0FA 3GNGA 4C8QE 2ENMA 1VQ9A 3E2UA 4M7AB
chains in the Genus database with same CATH topology
1Q7YR 1VQLQ 1YITQ 1KC8R 3I55Q 1K8AR 1VQ4Q 1Q82R 3CMAQ 3CC4Q 1W2BP 1VQ6Q 3CCRQ 3CMEQ 1VQOQ 1YIJQ 1NJIR 1K73R 1K9MR 1M90R 1VQNQ 3CCEQ 1KQSP 1VQ9Q 1YJ9Q 3CCMQ 1Q86R 1JJ2P 3G6EQ 3CPWP 3CCUQ 3CCJQ 3CCVQ 1YJNQ 1N8RR 3CC2Q 1VQ7Q 3CD6Q 3G4SQ 1QVGP 1KD1R 3CC7Q 1YI2Q 3OW2P 1S72Q 1VQPQ 2QEXQ 3CCLQ 1VQKQ 2QA4Q 2OTJQ 1Q81R 1VQ5Q 2OTLQ 3CCQQ 3I56Q 1VQMQ 1M1KR 1YJWQ 3G71Q 1QVFP 3CXCP 3CCSQ 1YHQQ 1VQ8Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q7Y R;  1VQL Q;  1YIT Q;  1KC8 R;  3I55 Q;  1K8A R;  1VQ4 Q;  1Q82 R;  3CMA Q;  3CC4 Q;  1W2B P;  1VQ6 Q;  3CCR Q;  3CME Q;  1VQO Q;  1YIJ Q;  1NJI R;  1K73 R;  1K9M R;  1M90 R;  1VQN Q;  3CCE Q;  1KQS P;  1VQ9 Q;  1YJ9 Q;  3CCM Q;  1Q86 R;  1JJ2 P;  3G6E Q;  3CPW P;  3CCU Q;  3CCJ Q;  3CCV Q;  1YJN Q;  1N8R R;  3CC2 Q;  1VQ7 Q;  3CD6 Q;  3G4S Q;  1QVG P;  1KD1 R;  3CC7 Q;  1YI2 Q;  3OW2 P;  1S72 Q;  1VQP Q;  2QEX Q;  3CCL Q;  1VQK Q;  2QA4 Q;  2OTJ Q;  1Q81 R;  1VQ5 Q;  2OTL Q;  3CCQ Q;  3I56 Q;  1VQM Q;  1M1K R;  1YJW Q;  3G71 Q;  1QVF P;  3CXC P;  3CCS Q;  1YHQ Q;  1VQ8 Q; 
#chains in the Genus database with same CATH topology
 4M77 D;  2DVJ A;  2YLC A;  3EGX B;  3BDU A;  1GCQ A;  2PUO B;  1UE9 A;  3L2Z A;  4BY6 C;  5FU6 C;  1NJI C;  1S72 A;  4Q5W A;  3M0S A;  3O5Z A;  4M7A A;  5CKD A;  3O8V A;  4J5Y A;  2GQV A;  3G7Z A;  3L2R A;  2ESW A;  1QCO A;  5LJ5 f;  1KHC A;  3HRT A;  2LJ1 A;  1QMC A;  5LJ3 d;  3CME Q;  1SHG A;  4GY5 A;  3VS2 A;  3PMI A;  2KXC A;  2RB6 A;  1WFW A;  5C6S A;  1LCK A;  1KD1 R;  1BCM A;  2X35 A;  3EG2 A;  4RTX A;  1SHF A;  1YP5 A;  2AKL A;  4BY6 B;  1W1F A;  3JCM h;  3QKJ A;  2DTO A;  4LUD A;  2QGF B;  2BE7 D;  2YRV A;  4LDY A;  1BIB A;  4PJO A;  1G5V A;  1B3Q A;  1M2V B;  1RI0 A;  1Q82 U;  3HTR A;  3UT1 A;  3MCA B;  3V8L A;  1OYX A;  1BI3 A;  2DIL A;  1JU5 C;  1X43 A;  3QZ9 B;  1QKX A;  3OB9 A;  3X28 B;  1VUB A;  3TU4 K;  4FU6 A;  5GAN 8;  3CCE Q;  4E7K A;  1FYN A;  4RUG A;  1M1K C;  3CBM A;  3OMC A;  3J80 E;  3CPW P;  5GMK j;  2O01 E;  1WZO A;  4K11 A;  2DRM A;  2F5K A;  1AZG B;  1K73 U;  3M0T A;  4A4G A;  4Y92 A;  1QWE A;  3L2V A;  2M9U A;  1R0C B;  4F7U G;  1FMV A;  4B9W A;  5GJV B;  2A0F B;  4PJM A;  4LDX A;  3PIO A;  2LQK A;  3CCJ A;  1K1Z A;  3VKI A;  1JJ2 P;  1KC8 U;  1LJO A;  3VS7 A;  5CCA A;  3SFM A;  4CC3 A;  4P5N A;  4A4E A;  2DYB A;  1Q86 C;  1X2K A;  2MAM A;  3G71 Q;  4OB1 B;  2SRC A;  1QQJ A;  2LQ8 A;  4HKE A;  1IHV A;  2DZC A;  3I56 A;  4QQG A;  3JB9 I;  4L59 A;  1ZQ1 A;  1E6G A;  1BU1 A;  3JB9 D;  2KYB A;  3EGX A;  3CXC A;  1JRI A;  2RI5 A;  1VQN A;  2BTT A;  1OI1 A;  3CC7 Q;  1X6G A;  4Z8A A;  5IHI A;  2V1Q A;  1MV3 A;  3MEU A;  3OS1 A;  1YHQ Q;  1VQL Q;  4JJB A;  2M51 A;  2MOX A;  3A8L B;  2DJQ A;  1K9M R;  1VQN Q;  4FL6 A;  3J81 E;  3MHX A;  5KYW B;  2RHY A;  1K8A U;  2RQW A;  1UEC A;  3RBB B;  1WXB A;  4HCK A;  1XJW B;  5A2Q E;  2K3X A;  3QSU A;  5I2M A;  3QPH A;  4C92 B;  2VAS A;  3ASK A;  2D0Q B;  1XQH A;  2NYS A;  1M4Z A;  2DL7 A;  3CC7 T;  1M90 U;  3E1S A;  2XU8 A;  2QG9 B;  2C0I A;  3M5A A;  8AT1 B;  1FMW A;  2VXE A;  3X25 B;  1W70 A;  1I4K 1;  2JJ9 A;  3QBY A;  1W4S A;  2LCL A;  1CKB A;  1B07 A;  2EYY A;  4BUG A;  2ZPF B;  3V8K A;  3M54 A;  3PVL A;  4PNO A;  5DY9 A;  1VQ5 Q;  4RTZ A;  2LX9 A;  4M75 C;  3CME A;  2NLU A;  2RQT A;  2E3I A;  1BYM A;  4XAX B;  4II1 A;  4J9F A;  4PK4 A;  3EG9 A;  2HBP A;  2I2L A;  4AG1 C;  2LT1 A;  3Q1J A;  5LJ3 j;  2VYT A;  4EMK C;  3A1P A;  1UG1 A;  2PVO B;  2Z0W A;  2R5M A;  3OYA A;  1Q82 R;  4M78 F;  1WXU A;  2Y90 A;  4ANJ A;  1Q7Y R;  3TVT A;  3CCV T;  4LUE A;  1ZUU A;  1PRL C;  3FB9 A;  3QG1 A;  4J9G A;  7AT1 B;  4ZGE B;  3MJX A;  5LJ3 f;  1MHN A;  1A0N B;  2CUD A;  5CQX A;  1M5Q 1;  1VYV A;  1PCX A;  4C5H A;  2JM9 A;  1K4U S;  1X6O A;  5GMK i;  1VQK Q;  2OTJ Q;  5GAM j;  5GAN j;  3M58 A;  1K8A C;  1QVF P;  3GIB A;  2GFA A;  5GAO q;  3I55 T;  1SRL A;  3V7C A;  1CKA A;  1UB4 A;  1HD3 A;  2MMP A;  2VVK A;  1V76 A;  4NOY A;  4QW2 A;  2GBQ A;  1I5O B;  1VQ9 Q;  3LGL A;  2L5Q A;  2DIG A;  4XU0 A;  2CZ6 B;  3HKS A;  1VIF A;  1NPP A;  4M78 E;  2J6K A;  2L3P A;  3R6N A;  1AT1 B;  2HL3 A;  3MP1 A;  4V2S A;  2C0T A;  4BDY A;  3V7R A;  5CR2 A;  2DKG A;  2ATC B;  4IKF A;  1VQ6 Q;  4E47 A;  2PQW A;  1NYF A;  2EIF A;  2L8D A;  2YSQ A;  2QA4 A;  1VQO A;  5FWB A;  2JS2 A;  2W10 A;  3NTK A;  3OYH A;  4LN2 A;  1T3L A;  3T9N A;  3CCU T;  4XU3 A;  1RAB B;  2KRN A;  4PFP A;  2ZPE B;  4C92 C;  5LJ5 j;  3GPL A;  2XD0 A;  2FPF A;  2ABL A;  3A8G B;  3CCM Q;  1BIA A;  2JS0 A;  3MEW A;  2M0O A;  3LYI A;  1WDX A;  3QWX X;  2DX1 A;  2NUT A;  1Q7Y U;  3ZL7 C;  1WIE A;  2EKH A;  2KDS A;  1M2V A;  2RJE A;  2RK1 A;  3JB9 J;  3EFR A;  4JRQ A;  2BKD N;  1VQ6 T;  1TSF A;  3HRS A;  3P8B B;  3FIF A;  2RI2 A;  2LP5 A;  3VS1 A;  3RR6 A;  4C0G A;  2CDT A;  5DLO A;  3CCU Q;  1AWJ A;  3RES A;  3EG3 A;  2DBK A;  1TU0 B;  2EPD A;  4NS5 A;  1OZ3 A;  5CAI A;  2RJF A;  5EC7 A;  3M0R A;  3CCE A;  4OB0 B;  2X4X A;  3VS6 A;  1VQ9 T;  2F5T X;  3GLX A;  1WHM A;  2WSF E;  2LJ0 A;  3QYG B;  1IZ6 A;  1PNJ A;  2P0K A;  4QQ6 A;  4NL2 A;  2X4Y A;  1PM3 A;  4F14 A;  4F7U A;  2LT4 A;  1T3S A;  2H3E B;  4WF2 A;  2CP7 A;  5AT1 B;  2K57 A;  4L5G A;  2PU9 B;  2COZ A;  1SG5 A;  1YJW Q;  5GAO r;  4BE0 A;  2DXT A;  2QQR A;  3PIP A;  2AZS A;  3AT1 B;  2YXY A;  3FC3 A;  3DLL A;  2AKK A;  2XDD A;  1V29 B;  3VS5 A;  2O4X B;  1QVF A;  4F16 A;  2XK0 A;  4J9H A;  2PVG B;  2QDY B;  3REB B;  3GP8 A;  1M27 C;  2KYM A;  2QK0 A;  3I55 A;  1QLY A;  3VS4 A;  1AWW A;  4RTW A;  3PNW C;  2EJG A;  2HSE B;  2E5Q A;  1WYX A;  3CCR Q;  3J7A F;  2EVR A;  4FSS A;  1RLP C;  1YCY A;  4QQD A;  3VS3 A;  2NWM A;  3QO3 A;  3MP8 A;  1ACM B;  5GMK h;  1ZSZ C;  1SSH A;  1WHG A;  1YI2 T;  4XTZ A;  1MV0 B;  3CD6 T;  4J9B A;  2E4H A;  2DO3 A;  1WHL A;  1D0Z A;  1U1T A;  1GFC A;  3DB4 A;  4ELY C;  1JB0 E;  2CP3 A;  2HQE A;  5KH6 A;  2HKN A;  2RO0 A;  2X3X D;  2QDL A;  4M77 G;  4YTL A;  4R56 A;  1UGP B;  3WVE B;  2NUT B;  2ZPI B;  4D8K A;  2QEX T;  5GAN h;  3S3M A;  1QVF S;  5CKB A;  4EIK A;  3OA6 A;  1TXQ A;  1OU8 A;  2X4J A;  2O9S A;  2PTK A;  5FRO A;  5GAN 2;  4PJO B;  1RAI B;  1PRM C;  3EG0 A;  4MZM A;  3CXC S;  2HNI A;  1TTH B;  4QKU A;  3QJY A;  2WAC A;  2IVW A;  1UFF A;  4PL6 A;  2XI9 A;  2K3Y A;  1Q82 C;  1VQ8 A;  2RQR A;  4LXC A;  2EYZ A;  3OW2 P;  4IUR A;  2HL5 C;  1MNE A;  4OMN A;  4EMK B;  3CC2 A;  2KNB B;  3JB9 H;  3JRZ A;  4FYW B;  1C6V X;  3FEO A;  2EQI A;  4J6X A;  1ARK A;  1YIJ Q;  3MP6 A;  2MWO A;  3H41 A;  2K2M A;  1D1C A;  4C92 E;  1KQS A;  1AZE A;  3CMA A;  1YCS B;  4M7D F;  1WGS A;  5A0L A;  3FLG A;  4M77 B;  4DQ2 A;  3CCE T;  1HSQ A;  2R5A A;  3CCS T;  3VUB A;  3CBP A;  4JUV A;  4JJD A;  3JCM J;  3CD6 A;  2V1R A;  2K3B A;  3FRN A;  2MPX C;  2A7Y A;  2FVU A;  1Y96 B;  1NPR A;  1E7O A;  3CCV A;  1EFN A;  2E1H A;  4FYV B;  1YI2 Q;  2DM1 A;  4RMO A;  3OYM A;  2X51 A;  3S3N A;  3E9F A;  5FU7 C;  1Q95 G;  4C92 A;  2HDA A;  3RMQ A;  4BAC A;  1VQ4 Q;  1N8R C;  3QWY A;  4HA8 A;  1LOJ A;  1JXO A;  4PFO A;  2V8J A;  4FW2 A;  4E7L A;  2EJ9 A;  1IGU A;  1YJW A;  2M16 A;  4GLM A;  2JVV A;  2MF2 A;  3QYH B;  1D1A A;  3OS5 A;  3NHN A;  1ZHI A;  4PJO F;  2L3R A;  3EG9 B;  3EH2 A;  4AG2 C;  2HQX A;  2JXB A;  1OEB A;  3PVQ A;  2AZV A;  1OUL A;  1UDL A;  4M75 D;  2VGM A;  3CCM T;  3VJP A;  4OML A;  2CZ7 B;  4RCB A;  1VQL A;  3C12 A;  2D8H A;  2MCN A;  1N9S A;  2K9G A;  4J7I A;  2LCS A;  8ATC B;  4XU2 A;  1Q86 U;  2G6F X;  1GL5 A;  1QVG S;  1B34 A;  2X3W D;  1MMA A;  5DLQ E;  1K73 C;  2EQU A;  2BIV A;  1PD1 A;  1RAC B;  4OMO A;  2FZG B;  2CKK A;  3UWN A;  1Z9Q A;  1H8K A;  2V26 A;  3EAE A;  2HZY A;  3VV0 A;  5KE3 A;  2D8J A;  4CC2 A;  4BE1 A;  1PSE A;  2ZPH B;  3H0H A;  2LTO A;  3HP9 A;  1WJQ A;  3OSS C;  4MDW A;  3KXT A;  3HPW A;  3PTA A;  4ATO A;  3GOX A;  2CYZ B;  2F2X A;  1LVK A;  1IRX A;  1QCF A;  2C0O A;  1UUE A;  3KFV A;  4E6R A;  2RMO A;  5GAO m;  2DEQ A;  2E10 A;  2H3J A;  4HVU A;  2EQJ A;  2DXB A;  2KR3 A;  4PKC C;  4BDZ A;  3CCQ Q;  2BZX A;  2RHZ A;  1AWO A;  1RL2 A;  1X2Q A;  4ZGJ B;  2CUB A;  1K0X A;  3NTI A;  3HHT B;  2KMT A;  3CCJ T;  2EKO A;  4M7D C;  1M1F A;  1K8A R;  2RF0 A;  1YBY A;  5DM7 R;  1NM7 A;  3JAM E;  1M1K U;  1IO6 A;  5GAO p;  1TG0 A;  1M1G A;  3I5R A;  4RTV A;  2O31 A;  3I9Q A;  3M0U A;  1TWB A;  4FM4 B;  4M78 A;  4LDU A;  3QJ6 A;  4C0Z A;  4CRI A;  5GAM g;  2J06 A;  4BI4 A;  1UGQ B;  3CC2 Q;  2GCX A;  2OTL A;  1VQP Q;  2ZGW A;  3C4S A;  3MO8 A;  4FYY B;  4MMK A;  5L8R E;  1VQL T;  4Z02 A;  1N8R U;  1C0M A;  1WI7 A;  2H8H A;  3ZEH A;  1PD0 A;  2DTH A;  2RHI A;  4TVR A;  4M75 A;  3ER0 A;  2CZ0 B;  4KRT A;  2SEM A;  4E7S A;  3G71 T;  3G1J A;  2K7A A;  1Q86 R;  4F7U F;  4PJO G;  3SWN C;  4AMC A;  1OU9 A;  2M0Y A;  3CCR A;  4JJC A;  2O88 A;  4HVW A;  5I11 A;  2FRY A;  3CPF A;  4PJL A;  1HJD A;  2EGE A;  3MET A;  1PKS A;  2JT4 A;  1XOV A;  4N0A C;  2L0A A;  2E64 A;  1FXX A;  3BW1 A;  2CP0 A;  4OF1 A;  4X9C A;  3CCQ T;  1NLP C;  1YJN A;  4RCC A;  1EIF A;  2A08 A;  3TRE A;  4A4H A;  4QVD A;  2CP6 A;  5IXF A;  1BBZ A;  2XKO C;  3G4S A;  1AD5 A;  1M3B A;  3CXC P;  3JCM b;  3CCS Q;  1FMK A;  4M77 A;  4ZTF A;  1MMN A;  2GFU A;  3HFN A;  1MMD A;  2FHD A;  2DET A;  2CSQ A;  4HCZ A;  1VYU A;  4B6M A;  1N6A A;  4N4G A;  2YT6 A;  2QQS A;  1X01 A;  1WJS A;  2EYQ A;  2CP5 A;  2DZ9 A;  4QVZ A;  3PGG A;  1D0Y A;  1G3T A;  4M7A D;  2HAX A;  1OPK A;  2QTX A;  2JW4 A;  1NG2 A;  2KBT A;  2DBM A;  3CC4 T;  2R58 A;  3BFM A;  3RDV A;  3VRY A;  3OYF A;  4ESR A;  1VQ8 T;  4M78 G;  4M78 D;  3SEM A;  1WLP B;  3EFO B;  3EGD B;  3BE3 A;  4OB3 B;  4J6W A;  4R0K A;  5D6X A;  4XQ3 A;  1OX8 A;  3P8D A;  1QCN A;  1G8X A;  3CCU A;  3I5S A;  2CH4 W;  2AT1 B;  3DLM A;  2QI2 A;  4OMQ A;  3QUI A;  1I07 A;  3PFS A;  2E12 A;  1BKB A;  2EGA A;  3OYY A;  4J8O A;  4KBM B;  2FYK A;  2PNI A;  1VQ4 T;  5ECA A;  4N0A A;  5A0D A;  5KYW A;  1WHK A;  1U06 A;  5KYN A;  2MWP A;  1PKT A;  2DLP A;  3GF5 A;  2LVM A;  1KQ2 A;  1RAH B;  4GLK A;  2NUZ A;  4RKU E;  1VQ4 A;  3CQT A;  5I21 A;  3CME T;  2QQ9 A;  2QA4 Q;  1G2B A;  2FB7 A;  1RAG B;  2EYW A;  5GJW B;  4LD6 A;  1ZA2 B;  2BUD A;  1Y96 A;  1KC8 C;  1YHQ A;  3EHR A;  3CBO A;  3M56 A;  4C0D C;  1JBM A;  4O6J A;  3MPU B;  3CEY A;  3UF4 A;  2JZ2 A;  2MK5 A;  3EFO A;  3EGD A;  4PLI A;  3CC4 A;  1JQQ A;  3VYG A;  1QKW A;  2V8K A;  5KYU B;  2CGH A;  3GBQ A;  1DJ7 B;  2QYZ A;  2GTJ A;  2L3S A;  2COY A;  3LH5 A;  3M9Q A;  2QTV A;  9ATC B;  4XTU A;  5D6W A;  3OW2 A;  1S72 T;  3HSB A;  1X69 A;  2E70 A;  1R77 A;  2WSC E;  4M7D D;  1Z9Z A;  1M8V A;  4PJO E;  1YFN A;  4EMK A;  3G4S T;  2A3L A;  2QEX Q;  3OYK A;  2LCC A;  1VQK T;  2OTJ T;  1O9S A;  2F2V A;  4HCB A;  2DER A;  3FDR A;  2HCK A;  4KUD K;  3SB2 A;  3JCM X;  3M4Y A;  3SWN A;  5HK3 A;  1VQ5 A;  1QVG A;  4OMM A;  3NPF A;  3PE0 A;  3UAT A;  2K6D A;  4FT2 A;  4PFZ A;  3EGU A;  4JS4 A;  4J6Y A;  2YWW A;  2JOY A;  1H64 1;  2J05 A;  3CCJ Q;  3FJ5 A;  1ZUY A;  2A28 A;  2HQH A;  4LDV A;  2E6Z A;  2LNH B;  4CC7 A;  2KVQ G;  3A8H B;  4HVV A;  2JNG A;  2ZAE A;  3OBY A;  4XTW A;  3G71 A;  2K4Y A;  4MML A;  2DFU A;  4M7D B;  4E2F B;  1NLO C;  4M77 E;  5HKC A;  1Y71 A;  2HMA A;  1YNZ A;  3OYB A;  4DBH A;  2LMJ A;  4A63 B;  2ZPB B;  4LNP A;  2FPE A;  2LJ3 A;  1K9M U;  2GF7 A;  3EFS A;  3IQL A;  3CC7 A;  1WQ7 A;  4DBR A;  1NE8 A;  5HK0 A;  2OJ2 A;  2EYX A;  3DKM A;  2V8I A;  3CMA Q;  2L89 A;  1I1J A;  2M1H A;  3CPW A;  2KRS A;  2QXF A;  3ULR B;  2DYI A;  5FRN A;  3CD6 Q;  4DBQ A;  5GAM f;  3HL8 A;  1S72 Q;  2A37 A;  4M78 B;  3UDC A;  2RPN A;  3TSZ A;  2GNC A;  1VQM A;  2FRW A;  2NUP B;  2KY9 A;  3L2Q A;  1NJI R;  1ZX6 A;  2DEU A;  4KUI A;  4C8Q B;  5M9O A;  1QVG P;  3JB9 G;  2LC4 A;  4N4I A;  3OYG A;  2XID A;  1VQM Q;  1M1K R;  1IHW A;  2LRQ A;  4RG2 A;  4EPC A;  3V8J A;  3H6Z A;  1GFD A;  3E19 A;  1K9A A;  5GAN 6;  1MND A;  3REA B;  2DTI A;  3C94 A;  2YUO A;  4E7J A;  1K73 R;  5EG2 A;  1H92 A;  3KBG A;  5LJ3 g;  2PZ1 A;  1M9S A;  4F17 A;  2RN8 A;  1YJ9 T;  1WXT A;  2K5F A;  4PJO C;  3G6E Q;  1KD1 U;  1N8R R;  4PJO D;  1QP3 A;  4Y91 A;  1QVP A;  4XTV A;  1UEB A;  2IG0 A;  1UJ0 A;  3OMG A;  3I56 Q;  1VQ8 Q;  3THK A;  2D9T A;  2F69 A;  2RK2 A;  1VQ6 A;  3P8H A;  4OP0 A;  1Y0M A;  2LNV A;  1NYG A;  3OBW A;  4IIM A;  1ZSG A;  1RI9 A;  2XMF A;  1NEB A;  2OX7 A;  2DXU A;  4RTT A;  3JCM P;  4FW1 A;  1YIJ A;  3H0I A;  2OAU A;  1KQ1 A;  2P4T A;  2VGN A;  4OVA A;  4IUP A;  1KC8 R;  1KG1 A;  4PJN A;  4HT9 A;  4KH0 B;  1IGQ A;  1W2B A;  1ZA1 B;  1M30 A;  3CCM A;  4M75 G;  2EGC A;  3I56 T;  2QEX A;  1BI1 A;  2PVD B;  1Q7Y C;  2RM4 A;  3VUZ A;  2LZ6 B;  3AHU A;  1BI2 A;  2DNU A;  3RKW A;  4LDW A;  2ROT A;  4RTY A;  4M7A G;  4C8Q F;  4HCC A;  5IT9 E;  3EHQ A;  1YIJ T;  5CKH A;  2J6O A;  4M7D E;  4BB7 A;  5KCH A;  1M90 C;  4HT8 A;  4X1V A;  1ABQ A;  4RG8 A;  1PWT A;  2R57 A;  4PJJ A;  2WSE E;  4XU1 A;  1HYO A;  3CCQ A;  4M78 C;  3M53 A;  5FU7 B;  4DEX A;  3QDF A;  5CK9 A;  1PC0 A;  2XDB A;  2DJZ A;  2CRE A;  2KAF A;  3MEV A;  5A0G A;  1EZZ B;  2F1L A;  2DL5 A;  5GAN e;  1VQ7 A;  2QQB A;  3UA7 A;  1I5L A;  1VQP A;  1WA7 A;  1NZ9 A;  4KGV B;  2GGR A;  2J6F A;  4AFZ C;  2C06 A;  1GBR A;  2QGG A;  1W6X A;  2YDL A;  2OAW A;  2FG0 A;  3JCM W;  1VQ7 T;  5CIU A;  4IIO A;  2KRO A;  4JLI A;  1WQW A;  2DL4 A;  4KGX B;  1YJW T;  2KSS A;  1WJR A;  1X6B A;  2DK3 A;  4C8Q D;  5IHK A;  1KIK A;  2L2P A;  1CSK A;  3RKX A;  3MEA A;  3CC4 Q;  3A8O B;  2Y4X A;  2FZC B;  3HFO A;  4DOV A;  4A4F A;  4OMP A;  1S1N A;  4M7A C;  4M77 F;  2DD5 A;  2YUP A;  2VV5 A;  3H0F A;  1VA7 A;  2RJC A;  4XK8 E;  2CZ1 B;  3JCM c;  4A54 A;  1WHH A;  5GAO n;  4JZ4 A;  4C92 G;  1ZBJ A;  2YRC A;  4IUU A;  3JCM V;  1I81 A;  2HD0 A;  1TUC A;  2DA9 A;  3LW5 E;  5GAN g;  4MZP A;  2FZK B;  4D8D A;  3EH1 A;  3MKD A;  1TOV A;  1NEG A;  2E65 A;  4MZT A;  2D6F A;  1KHI A;  1VOM A;  2K79 A;  4ZN3 A;  5FWC A;  4FIB A;  1RLQ C;  1XTD A;  3SD4 A;  1U8R A;  1LNX A;  2CH4 A;  4ZGD B;  5GAO l;  1T0H A;  2ROL A;  2J7I A;  2FPD A;  4GBQ A;  1NBE B;  3OSV A;  3NFC A;  1XNI A;  2DL8 A;  4M75 F;  1K76 A;  1FX7 A;  5KYX A;  2FEI A;  1YWP A;  1H3Z A;  3H8Z A;  1OZ2 A;  1VQO Q;  1G83 A;  5FLX E;  1UGR B;  4M7A F;  1KK7 A;  2DD4 A;  5KE2 A;  1YHQ T;  2CT3 A;  2RH2 A;  2OI3 A;  3DB3 A;  4CC4 B;  4Z88 A;  1VQN T;  4MDX A;  1ZSZ A;  2JN0 A;  4JRI A;  5GAM d;  3OYI A;  4FCY A;  1UGS B;  4WCI A;  4OB2 B;  3FJP A;  1F1B B;  4ELZ C;  3TEE A;  3X20 B;  2ZZD A;  1RUW A;  4FYX B;  3OS2 A;  2RNA A;  2D0N A;  3M0P A;  1EX4 A;  1B34 B;  4EDU A;  2HKQ B;  4B9X A;  5J39 A;  3CCL Q;  1M3C A;  1N5Z A;  2VC8 A;  4C8Q A;  3D7S B;  2QAZ A;  4KH1 B;  2KT8 A;  4EMH A;  3JV3 A;  2JTF A;  2L3Q A;  4C92 F;  1AOJ A;  1RAD B;  4X9D A;  3PT9 A;  3BDL A;  1OQK A;  1OV3 A;  2RJD A;  5LJ5 h;  4BI3 A;  3X26 B;  3CCL A;  2AK5 A;  1BB9 A;  3HRU A;  2LQN A;  5I22 A;  5GAN 3;  3QHS A;  1GBQ A;  2ED0 A;  5KCO A;  3VYH B;  1V1C A;  2ED1 A;  3JSC A;  2FO0 A;  1SSF A;  2AIR B;  2JUF A;  4M7A E;  1I8F A;  2ZPG B;  3CPW S;  3TSW A;  5LJ5 d;  2YUN A;  5I2S A;  4J9I A;  1D3B A;  2LDM A;  3RUX A;  4M77 C;  5FRM A;  5C0M A;  1G3Y A;  4C92 D;  2KEA A;  2KI7 A;  2P0P A;  2O4X A;  5KYX B;  2KGT A;  3JCM f;  2MI6 A;  3UA6 A;  2RHU A;  2HEQ A;  4JS5 A;  3M4G A;  3SDZ A;  5J3B A;  3VS0 A;  3A98 A;  1JXM A;  1IXD A;  3E9G A;  1AWX A;  1G3W A;  3R6O A;  1YJ9 A;  1NJI U;  1VQ5 T;  1B7T A;  3C0C A;  4DEY A;  1YIT Q;  3WVD B;  5HY6 A;  3CCR T;  4AFS C;  4F7U B;  4N4H A;  3SWN B;  1R8O B;  1AHJ B;  1U5S A;  4C0D B;  4IUT A;  3CCV Q;  3G6E T;  1PG5 B;  1YIT A;  5GAN 4;  1P92 A;  2KE9 A;  1J3T A;  1BCO A;  5CO7 A;  4AT1 B;  4JLG A;  1FWZ A;  4DBF A;  1OX9 A;  2RHX A;  1HXD A;  1R0B G;  4C8Q C;  2DRK A;  1ZUK A;  4O5V A;  1M3A A;  2JMA A;  3LLR A;  2LX7 A;  4JPB W;  4XTY A;  3V7S A;  2F2W A;  2M02 A;  2OTL T;  1Q81 R;  5LL6 S;  4ZTJ A;  2FL7 A;  1UHC A;  2E3H A;  2IIM A;  4FT4 A;  1SF9 A;  3LX7 A;  1SRM A;  3I55 Q;  5GAN d;  2MYS A;  4QT7 A;  3SHW A;  4F04 B;  4C5I A;  5LJ3 h;  3JCM g;  4IUV A;  3OYJ A;  3KUF A;  3CMA T;  3RIR A;  2RI3 A;  2VWF A;  3RER A;  4CI0 C;  1G3S A;  4J9C A;  1KQS P;  3QXE B;  2P0Q A;  2KT1 A;  2A36 A;  4C5G A;  3JB9 F;  2EQM A;  3H9N A;  1D0X A;  3RNJ A;  1JJ2 A;  1D3B B;  2RQV A;  1W2B S;  2ZCF B;  3A5Z B;  1K0S A;  3NGP A;  4F7U E;  1PHT A;  5CKF A;  4BD3 A;  1QP2 A;  4AFQ C;  1JEG A;  3QII A;  3ZFJ A;  1Y7X A;  3NTH A;  1WNL A;  4WTO B;  5FU6 B;  4DOW A;  2XHC A;  5KYY B;  3VU3 C;  1VQP T;  2E5K A;  1U3O A;  2P84 A;  1UTI A;  5LJ3 e;  3OW2 S;  3QDR B;  1KSW A;  4OMF B;  1T0J A;  4QVC A;  2VXF A;  3TQ7 P;  3ZBD A;  1TH7 A;  2XDP A;  1C1A A;  2CT4 A;  5GMK m;  2E6N A;  4KUL A;  2VKN A;  3L42 A;  2YHT A;  1YI2 A;  1YN8 A;  4J9D A;  6AT1 B;  2KRM A;  1D1B A;  4ZN1 A;  2EQK A;  2BZ8 A;  1MUZ A;  1VQO T;  2B8A A;  5GAN 7;  1K9M C;  3OY9 A;  4ME7 A;  4E7I A;  1WX6 A;  2EJF A;  5GAN 5;  1GCP A;  3LWI A;  4M4Z A;  2JTE A;  2RQU A;  3QZ5 B;  2YUQ A;  1TUG B;  5LJ5 e;  2KQW A;  2VB6 A;  1MMG A;  1ZSZ B;  3BY7 A;  4X34 A;  2OTL Q;  2GQI A;  4KGZ B;  1RAA B;  1IB8 A;  5FW9 A;  1BI0 A;  2X9H A;  1Y57 A;  1AEY A;  3OYD A;  1KJW A;  1HK9 A;  5GMK e;  2LQW A;  2VUB A;  1M90 R;  2EW3 A;  4BE2 A;  2DAQ A;  2DVE A;  1ZLM A;  3OYN A;  5IH2 A;  1VYT A;  1Y07 A;  4Y28 E;  1U1S A;  4UC4 A;  2XG8 D;  3LGF A;  4J7F A;  2RD1 A;  2EBP A;  1W2B P;  1VQK A;  1KQS S;  2OTJ A;  2ECZ A;  2MIO A;  3TCJ A;  1ABO A;  2RA2 A;  1JO8 A;  5GAM h;  4XTX A;  2CSI A;  4BI8 B;  5CQY A;  4OGC A;  4M7D G;  3U23 A;  3M55 A;  5GAN f;  4IUQ A;  3L1A A;  4M75 E;  1RAF B;  2QQA A;  3JCM e;  1D09 B;  3N5B B;  3X24 B;  3F70 A;  4OGE A;  2E41 A;  1N9R A;  4JRP A;  1QWF A;  1SKU B;  1GCQ C;  2K5L A;  3LH0 A;  4AFU C;  3CCS A;  3I35 A;  5HCK A;  4C5E A;  2DPP B;  5IN1 A;  2HBW A;  4JJN K;  1H3H A;  1M8M A;  3M59 A;  1LPL A;  1VQ7 Q;  3RMS A;  4L6V 5;  2G3R A;  3G6E A;  2X4W A;  1X75 C;  4JRK A;  3M57 A;  5IHN A;  5KYU A;  3WXM B;  3PMT A;  3INZ A;  1SEM A;  2BZY A;  3CC2 T;  3M0Q A;  3OS0 A;  1X27 A;  5AYF A;  1GXI E;  4DA4 A;  4KT0 E;  4J83 A;  1TUD A;  1GRI A;  1VIE A;  4RTU A;  2KK4 A;  4J9E A;  2NUP A;  2K5I A;  3C95 A;  1AVZ C;  2PUK B;  2QA4 T;  4LD9 K;  1PSF A;  3L2U A;  1ZBX A;  2JTM A;  1YWO A;  2IPO B;  3ME9 A;  2QAS A;  1I0C A;  1VQM T;  1YIT T;  2JMC A;  3NMZ C;  1YJN T;  1RAE B;  1UHF A;  2D1X A;  1Q81 U;  2XIC A;  2KXD A;  1BK2 A;  1KD1 C;  4LE9 A;  2O9V A;  2P4R A;  4Z89 A;  3RKY A;  2DXC A;  1YJ9 Q;  5D6Y A;  1WPY A;  4D6W A;  4JZ3 A;  4M75 B;  1O75 A;  4E7Z A;  2I0N A;  3OYL A;  5CKE A;  4ORZ A;  3S3O A;  1SPK A;  2B86 A;  1TS9 A;  5J26 A;  5LJ5 g;  2EFI A;  1MGQ A;  2EWN A;  4VUB A;  2GTO A;  2W0Z A;  4PLL A;  2YLB A;  5IXB A;  3S6W A;  2COW A;  5GMK l;  1Q81 C;  4M7D A;  4E7H A;  1QW1 A;  3EG1 A;  2O2O A;  3G4S Q;  4JDS A;  3A8M B;  5D7U A;  5L23 A;  2YRD A;  4FSX A;  2Y4Y A;  2AHJ B;  4NL3 A;  4A53 A;  3JCM Q;  1WHJ A;  3OQ5 A;  2JM8 A;  3VRZ A;  3L2W A;  1M2O A;  2DF6 A;  1UGV A;  4ZNX A;  3UPU A;  2DL3 A;  1JJ2 S;  4HXJ A;  3LWH A;  5CVI A;  1UJY A;  2CP2 A;  5IAY A;  4R55 A;  2DIQ A;  3OYC A;  2EAY A;  3URG A;  5KYY A;  2K2V A;  1N27 A;  1E6H A;  1OOT A;  2DE0 X;  1OPL A;  5GAM e;  2HSP A;  2BE9 B;  3CCL T;  1KFZ A;  4C8Q G;  3GNF B;  3JCM d;  4EMG A;  2CS7 A;  1IRE B;  2DMO A;  3OYE A;  4A4K A;  1YJN Q;  4C0F A;  3GNG A;  4C8Q E;  2ENM A;  1VQ9 A;  3E2U A;  4M7A B; 
#chains in the Genus database with same CATH homology
 1Q7Y R;  1VQL Q;  1YIT Q;  1KC8 R;  3I55 Q;  1K8A R;  1VQ4 Q;  1Q82 R;  3CMA Q;  3CC4 Q;  1W2B P;  1VQ6 Q;  3CCR Q;  3CME Q;  1VQO Q;  1YIJ Q;  1NJI R;  1K73 R;  1K9M R;  1M90 R;  1VQN Q;  3CCE Q;  1KQS P;  1VQ9 Q;  1YJ9 Q;  3CCM Q;  1Q86 R;  1JJ2 P;  3G6E Q;  3CPW P;  3CCU Q;  3CCJ Q;  3CCV Q;  1YJN Q;  1N8R R;  3CC2 Q;  1VQ7 Q;  3CD6 Q;  3G4S Q;  1QVG P;  1KD1 R;  3CC7 Q;  1YI2 Q;  3OW2 P;  1S72 Q;  1VQP Q;  2QEX Q;  3CCL Q;  1VQK Q;  2QA4 Q;  2OTJ Q;  1Q81 R;  1VQ5 Q;  2OTL Q;  3CCQ Q;  3I56 Q;  1VQM Q;  1M1K R;  1YJW Q;  3G71 Q;  1QVF P;  3CXC P;  3CCS Q;  1YHQ Q;  1VQ8 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...