1N8RR

Structure of large ribosomal subunit in complex with virginiamycin m
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2002-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1n8rR00
3CCVQ 1VQ9Q 1N8RR 3OW2P 1KC8R 3CCSQ 1YJNQ 1KD1R 3CCRQ 1W2BP 1YHQQ 1VQMQ 1M1KR 1VQ5Q 1K9MR 3CCEQ 3CMEQ 3G4SQ 1YI2Q 1KQSP 1YIJQ 1M90R 3CCUQ 1VQKQ 1VQ8Q 1Q7YR 1VQ6Q 2OTJQ 3CC2Q 1YITQ 1QVGP 1Q81R 3CD6Q 1VQNQ 1YJ9Q 3G6EQ 3CC7Q 3CCQQ 1Q86R 1K8AR 1JJ2P 1VQ7Q 3CC4Q 3CCLQ 1VQLQ 1VQPQ 3G71Q 3CCJQ 2QEXQ 1VQOQ 1NJIR 3CMAQ 2OTLQ 1S72Q 3CPWP 1Q82R 1K73R 3I55Q 1VQ4Q 3I56Q 1YJWQ 3CCMQ 1QVFP 3CXCP 2QA4Q
chains in the Genus database with same CATH superfamily
3ASKA 1FXXA 1Z9ZA 4RTWA 1BCMA 2XKOC 3UDCA 2V8IA 1WGSA 2X3XD 4LNPA 4N0AA 2O2OA 2D0NA 3PIOA 2LCSA 1NPPA 2P4TA 2QQBA 4J9CA 2L3QA 4L6V5 1NJIR 3EG3A 3A8OB 1WJRA 4FSXA 1WQ7A 5LJ3g 5DLOA 1PSFA 5GAMh 5IAYA 2AT1B 1V1CA 3CCRT 1SPKA 5CCAA 4ELYC 5L8RE 1PD0A 4EMHA 3S3MA 4RG8A 2HSEB 1WLPB 1AT1B 4PLLA 1VQ7T 4RCBA 1OQKA 2QTVA 2PNIA 3PMIA 2A28A 2GF7A 2AKKA 4QW2A 3JCMh 4Z89A 5CAIA 2A36A 4M7DC 4F7UA 2BKDN 1H641 2HDAA 5AYFA 4M78F 4A4KA 1VQLA 4J9BA 4M7AF 3HPWA 3CCQT 4ZN3A 2FHDA 2RH2A 1HJDA 1JO8A 1G3TA 2EGEA 1UJ0A 4DOVA 3MEWA 3CCMQ 4FCYA 3RKWA 4RMOA 4LD6A 4ZTFA 5GMKj 1RAIB 3GIBA 1QWFA 4FYWB 4PK4A 3EG9B 4QQGA 2JVVA 1ZSZB 3V7CA 2M02A 1VQPT 2RN8A 1ZSGA 3CCLQ 5GANe 2E10A 4BB7A 3FEOA 3N5BB 1UHCA 4QKUA 4AG1C 2OTJA 2CS7A 2K7AA 1M5Q1 1N9RA 3VRYA 1WA7A 4GLKA 3TSZA 5DY9A 2XMFA 2K79A 2KNBB 3I9QA 8ATCB 1ZBXA 5FU7C 1YITQ 2JTEA 4O6JA 3NHNA 3QZ9B 4ESRA 4B9WA 2RJEA 5EC7A 4M7AG 4OB2B 3X24B 3EG1A 1NYGA 1M30A 1YJWQ 1RLPC 3LX7A 3GBQA 2M16A 1YJNT 3EG9A 3OW2S 4M78E 3CCRQ 1WIEA 1VQKT 4M7AE 3THKA 4E7SA 2EKHA 4FYVB 2HZYA 3RMQA 4RG2A 1M90U 2LNVA 4PJNA 1VQ7Q 1GFCA 2O01E 2FG0A 3PVLA 3CMAQ 4QT7A 3I5RA 3EG0A 4FIBA 1YHQT 2DRKA 3A8GB 1NE8A 2KMTA 2VASA 1VUBA 1YJ9T 3EGDA 3DB3A 4E2FB 3G7ZA 4C8QA 1K9MC 3CD6Q 1D1BA 1X6GA 3GNGA 4JJBA 3JB9F 2QDYB 1YI2A 5C6SA 4BACA 4A63B 2IIMA 2DL4A 4XK8E 2WSEE 1M1KR 3JRZA 3MJXA 2LP5A 2JZ2A 2HQXA 2EQKA 9ATCB 1WXBA 2LTOA 4MZMA 1W2BA 1NPRA 1VQLQ 1VQPQ 1NEBA 3VUZA 2DXBA 5FWCA 1W4SA 2HEQA 1VQ9Q 2LVMA 2A37A 4N4IA 5DLQE 1W2BS 1H92A 4M75B 5GAMe 3EGXB 3LWIA 2HL3A 1ZSZC 3I56A 1Q81R 2ED0A 4C8QD 2J6KA 4EMKA 4B9XA 2O4XA 4QVZA 1T3SA 1WHLA 2W10A 2X51A 5KYNA 2DD4A 1ABOA 1B7TA 4RTTA 3CPWP 1K73C 1UGSB 2B8AA 2YXYA 2ABLA 3JCMe 1YJNQ 4DBQA 2DL8A 1SRLA 1VQKQ 2J6FA 1RABB 3CXCA 3CC2Q 4PKCC 3JSCA 3D7SB 1OU8A 3L2QA 2DEQA 2R5MA 3QG1A 3C12A 2Y4XA 3CXCS 4IKFA 4BE0A 5KCHA 3P8DA 1RL2A 4BI8B 4ORZA 1Q82U 2CT3A 2RD1A 3CMET 2MYSA 1YHQQ 4Y28E 2GTJA 2V26A 2PZ1A 2D6FA 2Z0WA 3WVDB 1S1NA 1YJ9Q 5LJ5h 4J9FA 3JCMb 1BK2A 1Q7YC 2QEXT 2CP2A 8AT1B 3OYFA 1BI3A 3HFNA 2EJGA 3QXEB 4CRIA 4E7IA 4GBQA 2WACA 4E7ZA 5LJ3e 5GAN5 3JB9H 1MUZA 3KXTA 1VQOA 5HK3A 2YRCA 1KQSA 3H0IA 1OX8A 2XI9A 2JTMA 4PJOB 2JMCA 2JS2A 3MEAA 3FLGA 4J9EA 3G6EA 2P84A 3M0RA 4IUPA 5HK0A 1KQSS 2YUPA 2DLPA 3AT1B 2JNGA 2HCKA 1QWEA 4CC7A 2E3HA 3P8BB 2KY9A 4KT0E 3KFVA 4JZ3A 1VYVA 1IZ6A 2VXEA 2PUKB 4M78A 2K3YA 3JB9J 1S72T 2GGRA 4HVVA 1OPKA 4M7AA 2DYIA 5I22A 2J05A 3QJ6A 4PJJA 1I5OB 2CZ1B 1ZBJA 3SWNB 1GFDA 4M75C 1RI9A 1V29B 4C0DB 1LJOA 2VYTA 1KD1C 1VIEA 4D8KA 3PNWC 1H3ZA 3I5SA 3EFOB 3TCJA 4JLGA 5AT1B 2XHCA 2QQ9A 1VQ5A 3RKXA 1D0ZA 4BI3A 3CCVT 1G3SA 2CDTA 5KYXA 4QQ6A 1ARKA 1IHVA 4E7JA 3FIFA 1C1AA 1KQSP 2BZXA 3NTIA 3VKIA 1Q86R 1JBMA 1G2BA 4HKEA 2H3EB 4ZN1A 1WI7A 2DETA 1I4K1 2K5IA 3TU4K 3GLXA 2DNUA 2GTOA 4R56A 4BE1A 1Y7XA 3EFOA 4C5IA 1M90R 1MMDA 1Q95G 2FPEA 1BIBA 2CP6A 2M51A 3E9GA 3MKDA 4AG2C 2XK0A 2ROLA 4ANJA 4PJMA 1I1JA 4JJNK 4LDUA 4X9CA 2C0OA 5LJ5j 2DPPB 1X6BA 5GMKl 3TSWA 2HMAA 1VQ8T 3A5ZB 2FL7A 1KC8C 1N8RU 5CK9A 1VQ4A 4M4ZA 2SRCA 4ZGJB 1M3BA 1Y71A 2E1HA 3OS5A 2EYXA 3VJPA 2D9TA 2MCNA 1EIFA 2FZGB 1S72Q 1AZEA 1YIJA 3CCUA 1M8MA 4D8DA 1T3LA 3S3OA 3QDFA 4M77D 4C0ZA 1NLOC 3PE0A 2AZVA 4JUVA 1WJSA 1VA7A 4MMKA 4M77C 2VKNA 1IO6A 4XTWA 3NGPA 5HCKA 3TVTA 3BDLA 2VXFA 1JEGA 3NFCA 4A54A 3CCVQ 4FU6A 2E3IA 1XOVA 1MHNA 3SWNC 4C0DC 4F16A 2ZPGB 4Y92A 2XDBA 1OULA 3UWNA 3ZFJA 1K9MU 2MIOA 1QCOA 2MOXA 4J9DA 4EPCA 2CSIA 3OYBA 2IVWA 3HL8A 1MMNA 2YWWA 4C92C 2JTFA 2V1QA 1K0XA 1FWZA 2R57A 2KR3A 1YN8A 4MZPA 1QMCA 5GAN6 1QLYA 1UTIA 2ED1A 3OYYA 4OGEA 3OYAA 2OAWA 1UECA 4P5NA 1B07A 4E7LA 1VQMA 1TTHB 1Q82R 2DXUA 1VQ6A 1I0CA 1JJ2A 1YP5A 4C8QE 1ABQA 1D3BB 2A0FB 5CQXA 2P0QA 4PFOA 5D6XA 3SB2A 3JCMV 3RNJA 1A0NB 1W6XA 3CC7T 2OAUA 4MDWA 3JAME 4HCZA 1JJ2S 2RQWA 1Z9QA 3TREA 5I11A 3CCLT 1K9AA 1K0SA 4HVWA 5C0MA 1HD3A 2RQUA 1WYXA 1IREB 2X9HA 1T0JA 2XIDA 1QVFP 1LCKA 2DE0X 3PTAA 1K73U 3CCSQ 3CC4A 2JN0A 2L3PA 3ME9A 2IG0A 1IRXA 3OYKA 3UATA 1YITT 4F7UB 2X4XA 4YTLA 3QWXX 2NYSA 3MP1A 3CCEA 3RMSA 1OOTA 1YJWT 1D3BA 1WX6A 4C5EA 1NJIC 1TOVA 3MO8A 1BIAA 3FJ5A 2E5KA 2FRWA 2EYZA 2CUBA 1Y96A 1D1AA 1MNDA 1UUEA 2DVJA 4AMCA 4XU3A 2COWA 4DEXA 3E19A 1JJ2P 1IHWA 5CKEA 1Q7YU 4M7DD 3CMAT 5D7UA 2CSQA 2XU8A 2RF0A 4TVRA 2DMOA 2RK1A 3PGGA 4A4EA 2LZ6B 2LQ8A 4OB3B 3OY9A 4HCCA 1D1CA 5D6YA 5GANj 4DBFA 4J6YA 4MMLA 1D0XA 1FYNA 3CCQA 2DVEA 5LJ5f 4Z88A 3G4SQ 2P4RA 2L3RA 4CC2A 1GBRA 3CD6T 1AWXA 3RR6A 4ZGEB 3JV3A 2L0AA 2BUDA 3OSSC 1NLPC 1M3CA 1TUGB 2D0QB 2W0ZA 4ME7A 5LL6S 3A8MB 1YCSB 2VGNA 3I55A 1PRMC 1AHJB 4RKUE 4FW1A 4X1VA 3O8VA 3CC7Q 1VQLT 2ZPEB 1PKTA 2HL5C 4RTYA 3L42A 1KSWA 2QI2A 1Y07A 1QP2A 5LJ3h 4WTOB 1VQ9T 2EYQA 1PC0A 4C5GA 2RI5A 4ZNXA 1FMVA 1NG2A 3OQ5A 3S6WA 1UDLA 2OX7A 1M8VA 1TS9A 3HHTB 3PIPA 3OYJA 3Q1JA 1WQWA 2EGCA 2K5FA 2K4YA 5CKHA 4X34A 3VS0A 3JCMJ 3EGDB 2LX7A 4M77F 5EG2A 4C8QB 1AVZC 2KYBA 3L2UA 1OV3A 2R58A 2X35A 1N8RR 2DTOA 4AFQC 2DRMA 2EFIA 2AKLA 4LN2A 3CC2T 3C4SA 1QP3A 1BKBA 1CKBA 2RJFA 3GPLA 3HKSA 2EW3A 1UGVA 2DM1A 3RBBB 5FW9A 1U06A 1MV3A 1X2KA 3OS1A 4OMQA 3X26B 5HKCA 1PM3A 4OB0B 3T9NA 3CPWA 2OTLA 3M0PA 3M9QA 4Z8AA 2EKOA 4XTVA 2CZ6B 3EHRA 4JRQA 2HKQB 1R0CB 5GAMj 1K8AR 2LCCA 1WPYA 5CQYA 2LJ3A 4F14A 3CPWS 4JJDA 2V8KA 1GBQA 4AFUC 1ZX6A 2KAFA 2RQTA 4EMKB 1V76A 2VUBA 3VS5A 2O4XB 5KYYA 4XU0A 2K2VA 2FPDA 1M2VA 2AIRB 4JLIA 4M77G 1MGQA 3GF5A 1K9MR 4PNOA 3G71A 2JW4A 1M1KC 3TQ7P 1UJYA 3OMGA 1IXDA 4M77E 3M53A 1TSFA 3OYEA 2BTTA 1YI2T 1GXIE 2L89A 4BD3A 2HQHA 1F1BB 1PHTA 3DLMA 2QA4A 4C92G 1PCXA 2ZZDA 2LQWA 3HRUA 4J9IA 2EWNA 1GCQA 3UA6A 3OA6A 1QCFA 4PLIA 2CKKA 4B6MA 1H3HA 2C0IA 1MMGA 3PT9A 4RUGA 5GANf 2JJ9A 4X9DA 3R6OA 4NL3A 2JOYA 2E12A 3WVEB 2HSPA 2OTJQ 5CKDA 2E41A 5LJ3j 1M2OA 2QDLA 1UHFA 3M58A 3FJPA 4KUIA 3I56T 3QBYA 3CMEA 2BZ8A 2DTHA 3V8JA 3META 3OS2A 1P92A 4JRPA 2DFUA 4M7DF 5GAOm 4FT4A 2DA9A 2X3WD 4EIKA 2O9VA 2DJQA 2CZ7B 2M0OA 1QQJA 4RTZA 4CC3A 3M54A 1WHKA 3G1JA 5KE3A 4M78B 4J83A 1X27A 3EH2A 4J7IA 2DBMA 4M7AB 3OMCA 3CCJA 2QK0A 2KK4A 2NUPA 2V8JA 4OGCA 2F2WA 4RTVA 3U23A 1Q7YR 2KBTA 3HFOA 2RQRA 2F2VA 2DF6A 4FYYB 2KT8A 3IQLA 5GAMd 3CQTA 2KDSA 3JCMP 1WHMA 2VVKA 4LE9A 1AZGB 2P0KA 3VU3C 4JS5A 2CUDA 2P0PA 1RLQC 3A8LB 1B34A 4FM4B 2PTKA 3QHSA 2AZSA 4OP0A 4ATOA 4FT2A 1YI2Q 2F2XA 3VS6A 3VUBA 5KYXB 4JDSA 4CI0C 3CBPA 1KG1A 3JCMd 2FB7A 4OMOA 1VQOT 4M7DG 5A0DA 4MDXA 3NTHA 4F04B 3G71Q 2DTIA 5KYWA 3VV0A 4OMNA 4M75D 5L23A 1M1FA 4J8OA 3QIIA 2Y4YA 3RKYA 1UGQB 4BUGA 4K11A 4M7DE 2KQWA 3FB9A 2MWPA 2FZCB 1X2QA 2RHXA 3G6ET 3RIRA 2X4JA 3VS1A 4BI4A 4QQDA 4L59A 2CP7A 1SSFA 5GAMf 2LJ0A 2GQVA 5GAN8 2YHTA 4BY6B 3HP9A 3E9FA 2SEMA 3I56Q 3V8LA 5GAN4 1B3QA 2QQRA 3UPUA 4R55A 4JS4A 1M4ZA 2EJ9A 3RESA 2DJZA 2KROA 4KBMB 1KFZA 1BBZA 1TWBA 1D09B 3JCMf 4RTUA 3EGUA 4JRKA 2YDLA 1Q86C 2DXTA 2ZPIB 3J80E 2AHJB 3F70A 3QWYA 1AWWA 2VV5A 4ZGDB 5FU6B 3MEUA 3OYCA 2M0YA 2KGTA 4M77A 3EAEA 2XDPA 5IHNA 2EQJA 1I8FA 1R77A 2GFUA 1K4US 1GCPA 4DBRA 1UE9A 1QW1A 4DBHA 1G3YA 5GAN3 2FZKB 2GCXA 4XAXB 2QYZA 4OMMA 4HCKA 1VQ8A 2JMAA 3OB9A 4M78C 1MNEA 2RQVA 2YSQA 5FROA 1VQNA 4M7AC 1X6OA 1SHGA 3M0UA 2QGGA 2HAXA 1OZ3A 3VS7A 2KXCA 2LC4A 2E6ZA 2RK2A 3PMTA 3LW5E 3EHQA 2O9SA 2O31A 1NEGA 2I2LA 5LJ3f 5IT9E 2KRNA 3OYDA 3VS3A 1VQOQ 2PVGB 4VUBA 3V7SA 4PJOC 1RAEB 2RNAA 2KYMA 5J3BA 2FRYA 1KIKA 4JPBW 4HVUA 3CCST 3R6NA 1GL5A 1X01A 2D1XA 2EQUA 2EYWA 1E6GA 4ELZC 5KCOA 5J39A 4QVCA 3G6EQ 4GY5A 2RMOA 2ZPHB 3QUIA 3L2RA 3ZL7C 1N5ZA 4IIMA 4HT8A 4OMLA 2FYKA 2M9UA 2MF2A 2G3RA 2NUTA 4LDWA 3UT1A 1BI2A 1G8XA 5ECAA 1YIJT 1I81A 2K2MA 2MMPA 3RUXA 3QSUA 2C06A 3J7AF 1QVFA 2QTXA 2OI3A 3A8HB 4FL6A 2DZ9A 4HA8A 1OYXA 1U3OA 4C92D 2WSFE 3OYGA 5CIUA 4BY6C 3LGLA 1PKSA 1HYOA 1QVFS 2EBPA 4Y91A 2HNIA 5IHIA 4NL2A 3MP8A 1JXMA 2K3XA 4L5GA 3G4ST 2DZCA 3GNFB 1VQ5Q 4IUUA 1WHHA 1OZ2A 2RHYA 5GMKh 3CCMA 2CGHA 1VYUA 2EQIA 4A4GA 2LQKA 3FC3A 1X43A 4A53A 2EVRA 1TUCA 3TEEA 3JCMX 4LDYA 2CYZB 1Q82C 1YNZA 3HTRA 1R8OB 4RCCA 5FU6C 3SHWA 2VB6A 1X69A 3CCLA 2KRMA 1KK7A 5IH2A 2DL3A 2O88A 2MPXC 1W70A 2F5TX 4ZTJA 2LT1A 4O5VA 5GMKi 3MHXA 4M7DA 2EGAA 3DKMA 5CR2A 2RPNA 2FEIA 4AT1B 1Y96B 3OYMA 2JM9A 3JCMg 5CKFA 1YITA 4BDYA 3H41A 1W1FA 5J26A 2ZAEA 2DL5A 4J6WA 3AHUA 3HRTA 4OF1A 1FMWA 5LJ5d 1VQ6T 2DYBA 2E64A 2ZCFB 4BDZA 4MZTA 4M75F 1YJWA 3CEYA 2DKGA 4XU2A 1VQNQ 1YCYA 2DD5A 2RO0A 3O5ZA 4XU1A 4D6WA 3CCRA 2GBQA 5FRNA 1RI0A 2F69A 3LLRA 1CKAA 1VQ4Q 4DOWA 1KQ2A 3NMZC 3MP6A 1G3WA 1PRLC 1QVPA 3J81E 1OI1A 1VQ7A 4NOYA 2XG8D 3V7RA 1RADB 3CMAA 1YIJQ 3CCUQ 4XTUA 3ER0A 1UGPB 2K5LA 3RERA 4KGVB 2B86A 3CC4T 1XJWB 1JB0E 5GAOn 1RUWA 1YFNA 1SKUB 2Y90A 2E5QA 1ZA1B 1KJWA 2JXBA 3CD6A 4FYXB 1YWOA 3LH0A 2CT4A 3SD4A 4LUEA 3CCET 2ESWA 2AK5A 4WCIA 4F17A 2EYYA 2QASA 2KT1A 2YUOA 3BE3A 1ZUKA 3M5AA 4M75G 2XD0A 2OJ2A 3OS0A 4IUVA 5CVIA 3M4YA 3EH1A 1EZZB 3V8KA 1BCOA 2MWOA 1VQPA 1VIFA 1WXUA 4M75E 2QQAA 5GAN2 1BB9A 1VQ9A 4DQ2A 1YWPA 2GFAA 4JZ4A 1KHCA 2BIVA 4PFZA 5FRMA 1AOJA 4N0AC 4QVDA 1QKWA 3X28B 3WXMB 4BE2A 3E1SA 3HSBA 1O9SA 1O75A 4PJOF 3QDRB 1DJ7B 5I2SA 1VQMQ 4E6RA 5KYUB 1UB4A 1HSQA 1VQ6Q 1KD1U 1K1ZA 2ZGWA 3OSVA 2QAZA 4EMGA 1YJNA 2BE9B 3I55T 1EX4A 2COZA 1SG5A 1VQKA 3VYHB 4KULA 3CC2A 2K57A 1C0MA 2YLBA 2DK3A 1IGUA 1XNIA 1N8RC 2A3LA 2JS0A 2OTJT 5KYYB 3CPFA 3OW2A 4M78G 1M2VB 4J9HA 5KH6A 3CC4Q 2CZ0B 1YHQA 2VWFA 5GMKe 1Q86U 2DERA 4J7FA 5KYUA 1ZSZA 1YJ9A 2F5KA 3VS4A 3VYGA 2LNHB 2PU9B 1QKXA 2HKNA 3CCEQ 4C92F 4C0FA 1QCNA 3L2WA 4PL6A 4PJOG 2XICA 1PWTA 3A1PA 2WSCE 3P8HA 5FLXE 4J9GA 1XTDA 2XDDA 2ENMA 2PVOB 1K8AC 2E4HA 2QGFB 4N4HA 1TXQA 2BE7D 2RA2A 2G6FX 1TUDA 4PJOE 2RJCA 3SFMA 2L8DA 2RHUA 3C0CA 5GANd 3UF4A 1M27C 1OU9A 3L1AA 5A0LA 5GAOr 1WHJA 1KC8U 1OX9A 4IURA 4OVAA 3CCQQ 4IUTA 2DIQA 2OTLT 3BW1A 4C0GA 4J5YA 1PD1A 3C94A 2CH4A 2K6DA 2YRVA 4KH0B 3UA7A 3OBYA 4LXCA 2CREA 3OW2P 1D0YA 1KHIA 2ZPFB 3URGA 1Y57A 1FMKA 5LJ5g 1JQQA 1U1TA 3G71T 4FSSA 1Q81C 1CSKA 5I2MA 1UEBA 1QVGA 2RJDA 3I55Q 1U5SA 2R5AA 4IIOA 1YBYA 2RI3A 1N6AA 1JU5C 4E47A 3GP8A 4PJLA 4C92E 2ZPBB 1VYTA 1T0HA 4NS5A 2KE9A 1QVGS 2L3SA 2X4YA 1LPLA 2HBPA 3EFSA 2LQNA 4JRIA 2CH4W 2EAYA 1MMAA 3M56A 2NUPB 1RAFB 2KRSA 1XQHA 1K73R 4C8QC 2QA4T 3BY7A 2LX9A 3JB9G 5KE2A 2ECZA 2KEAA 2PUOB 3PVQA 4OB1B 1K76A 2NLUA 1LNXA 3SEMA 2QEXA 2DILA 1PG5B 1FX7A 3FDRA 3REBB 3HRSA 1B34B 1IGQA 2RI2A 2QG9B 2MI6A 1WFWA 1BI1A 2RHZA 3VS2A 1UGRB 1M3AA 5GJVB 4M75A 2EIFA 2VC8A 3JCMW 3EGXA 1N9SA 3E2UA 2MK5A 4V2SA 4LDVA 3PFSA 2YRDA 3INZA 3RDVA 1E6HA 2JT4A 5KYWB 2LJ1A 1W2BP 3M57A 1LOJA 4AFSC 1QVGP 3DLLA 4HCBA 1SHFA 2LT4A 3EG2A 3BFMA 1M9SA 1WXTA 2OTLQ 3REAB 1ZQ1A 1HK9A 3MPUB 4EMKC 3QPHA 1GCQC 2DX1A 1EFNA 3QKJA 2LDMA 2KVQG 1LVKA 1OPLA 4DEYA 1S72A 5GAOl 3QO3A 2PVDB 3CCJT 1RAGB 2EQMA 2E70A 4E7KA 1ACMB 2L5QA 3CXCP 1NJIU 7AT1B 2H8HA 2V1RA 1J3TA 5A2QE 1JXOA 2F1LA 3CCVA 1RACB 4F7UF 1AWOA 4M77B 2FO0A 4J6XA 3H6ZA 2DEUA 1G83A 3I35A 4LDXA 2QA4Q 5FWBA 3LH5A 2A08A 3H0HA 4IUQA 1KD1R 5IXBA 3H0FA 3OYHA 1TU0B 2NWMA 3LYIA 4PJOA 2D8HA 4Q5WA 4XTYA 3ULRB 1WZOA 4DA4A 5LJ3d 1NZ9A 3JCMQ 3M0TA 2C0TA 1IB8A 4E7HA 1RAHB 1MV0B 1ZLMA 1WDXA 1OEBA 4C92B 1WJQA 2VGMA 1WHGA 2MAMA 5GMKm 4KUDK 1VQ5T 1I07A 2H3JA 3CMEQ 2NUZA 1U1SA 3X25B 4LUDA 1ZUUA 5GANg 3DB4A 3NPFA 3L2VA 1M90C 3X20B 4M78D 2YLCA 1SRMA 3GOXA 3SWNA 2QEXQ 4M7AD 2A7YA 2KI7A 3A98A 4KGZB 2JUFA 4F7UG 3MEVA 2PQWA 2KXDA 2ATCB 4R0KA 3SDZA 1UFFA 1GRIA 2K3BA 2I0NA 5HY6A 1AD5A 2J6OA 2QQSA 3LGFA 5DM7R 3QYHB 2NUTB 2RM4A 4F7UE 4PJOD 1R0BG 2M1HA 5GJWB 4OMPA 1SF9A 5IN1A 4C92A 1Y0MA 2FVUA 3CCSA 3CCJQ 2DBKA 1M1GA 2LCLA 4FW2A 4N4GA 3OYLA 2K9GA 2CP5A 5I21A 1N27A 1KC8R 1WNLA 4XTXA 2DXCA 3H8ZA 1VQNT 4WF2A 6AT1B 2GQIA 4A4FA 3M0SA 2KSSA 2LRQA 3OBWA 1PSEA 3QZ5B 4JJCA 2DL7A 4HT9A 1VQ4T 1ZA2B 4LD9K 2IPOB 3OYNA 2LMJA 4KGXB 3QJYA 1HXDA 4EDUA 4C8QF 5CKBA 3M4GA 2DO3A 3KUFA 1AWJA 3JCMc 2J7IA 3CCUT 1NBEB 5GANh 2EJFA 4A4HA 2DIGA 1H8KA 3JB9I 4HXJA 5GAN7 2L2PA 2DAQA 2YUQA 1K8AU 3G4SA 4Z02A 4XQ3A 5LJ5e 2D8JA 2YT6A 4GLMA 3ZEHA 5GAOq 5IHKA 4M7DB 4KH1B 4RTXA 1BI0A 3KBGA 3M0QA 1RAAB 2E65A 1E7OA 2HD0A 3M59A 1M1KU 4KRTA 2BZYA 1PNJA 1SSHA 1NM7A 4AFZC 2YUNA 3ZBDA 3M55A 2X4WA 2QXFA 5CO7A 1TH7A 1TG0A 1ZUYA 5GAMg 3JB9D 3CC7A 1AEYA 2GNCA 3H9NA 1U8RA 1C6VX 1UG1A 2HBWA 4C8QG 1SEMA 2ROTA 4PFPA 4UC4A 3OYIA 1BYMA 1BU1A 1JRIA 2RHIA 3FRNA 3C95A 1G5VA 4C5HA 2COYA 2CP0A 3L2ZA 2FPFA 3LWHA 5D6WA 1Q81U 1KQ1A 3CCMT 3MCAB 3CBOA 2E6NA 2HQEA 2RB6A 2CP3A 2JM8A 2EPDA 1VQMT 1ZHIA 3S3NA 1VQ8Q 5FU7B 3QYGB 3BDUA 5A0GA 3EFRA 1I5LA 4II1A 4CC4B 3CBMA 3VRZA 5GAOp 5M9OA 1X75C 1NYFA 4OMFB 4XTZA 1VOMA 3NTKA 5IXFA 2J06A
chains in the Genus database with same CATH topology
3CCVQ 1VQ9Q 1N8RR 3OW2P 1KC8R 3CCSQ 1YJNQ 1KD1R 3CCRQ 1W2BP 1YHQQ 1VQMQ 1M1KR 1VQ5Q 1K9MR 3CCEQ 3CMEQ 3G4SQ 1YI2Q 1KQSP 1YIJQ 1M90R 3CCUQ 1VQKQ 1VQ8Q 1Q7YR 1VQ6Q 2OTJQ 3CC2Q 1YITQ 1QVGP 1Q81R 3CD6Q 1VQNQ 1YJ9Q 3G6EQ 3CC7Q 3CCQQ 1Q86R 1K8AR 1JJ2P 1VQ7Q 3CC4Q 3CCLQ 1VQLQ 1VQPQ 3G71Q 3CCJQ 2QEXQ 1VQOQ 1NJIR 3CMAQ 2OTLQ 1S72Q 3CPWP 1Q82R 1K73R 3I55Q 1VQ4Q 3I56Q 1YJWQ 3CCMQ 1QVFP 3CXCP 2QA4Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCV Q;  1VQ9 Q;  1N8R R;  3OW2 P;  1KC8 R;  3CCS Q;  1YJN Q;  1KD1 R;  3CCR Q;  1W2B P;  1YHQ Q;  1VQM Q;  1M1K R;  1VQ5 Q;  1K9M R;  3CCE Q;  3CME Q;  3G4S Q;  1YI2 Q;  1KQS P;  1YIJ Q;  1M90 R;  3CCU Q;  1VQK Q;  1VQ8 Q;  1Q7Y R;  1VQ6 Q;  2OTJ Q;  3CC2 Q;  1YIT Q;  1QVG P;  1Q81 R;  3CD6 Q;  1VQN Q;  1YJ9 Q;  3G6E Q;  3CC7 Q;  3CCQ Q;  1Q86 R;  1K8A R;  1JJ2 P;  1VQ7 Q;  3CC4 Q;  3CCL Q;  1VQL Q;  1VQP Q;  3G71 Q;  3CCJ Q;  2QEX Q;  1VQO Q;  1NJI R;  3CMA Q;  2OTL Q;  1S72 Q;  3CPW P;  1Q82 R;  1K73 R;  3I55 Q;  1VQ4 Q;  3I56 Q;  1YJW Q;  3CCM Q;  1QVF P;  3CXC P;  2QA4 Q; 
#chains in the Genus database with same CATH topology
 3ASK A;  1FXX A;  1Z9Z A;  4RTW A;  1BCM A;  2XKO C;  3UDC A;  2V8I A;  1WGS A;  2X3X D;  4LNP A;  4N0A A;  2O2O A;  2D0N A;  3PIO A;  2LCS A;  1NPP A;  2P4T A;  2QQB A;  4J9C A;  2L3Q A;  4L6V 5;  1NJI R;  3EG3 A;  3A8O B;  1WJR A;  4FSX A;  1WQ7 A;  5LJ3 g;  5DLO A;  1PSF A;  5GAM h;  5IAY A;  2AT1 B;  1V1C A;  3CCR T;  1SPK A;  5CCA A;  4ELY C;  5L8R E;  1PD0 A;  4EMH A;  3S3M A;  4RG8 A;  2HSE B;  1WLP B;  1AT1 B;  4PLL A;  1VQ7 T;  4RCB A;  1OQK A;  2QTV A;  2PNI A;  3PMI A;  2A28 A;  2GF7 A;  2AKK A;  4QW2 A;  3JCM h;  4Z89 A;  5CAI A;  2A36 A;  4M7D C;  4F7U A;  2BKD N;  1H64 1;  2HDA A;  5AYF A;  4M78 F;  4A4K A;  1VQL A;  4J9B A;  4M7A F;  3HPW A;  3CCQ T;  4ZN3 A;  2FHD A;  2RH2 A;  1HJD A;  1JO8 A;  1G3T A;  2EGE A;  1UJ0 A;  4DOV A;  3MEW A;  3CCM Q;  4FCY A;  3RKW A;  4RMO A;  4LD6 A;  4ZTF A;  5GMK j;  1RAI B;  3GIB A;  1QWF A;  4FYW B;  4PK4 A;  3EG9 B;  4QQG A;  2JVV A;  1ZSZ B;  3V7C A;  2M02 A;  1VQP T;  2RN8 A;  1ZSG A;  3CCL Q;  5GAN e;  2E10 A;  4BB7 A;  3FEO A;  3N5B B;  1UHC A;  4QKU A;  4AG1 C;  2OTJ A;  2CS7 A;  2K7A A;  1M5Q 1;  1N9R A;  3VRY A;  1WA7 A;  4GLK A;  3TSZ A;  5DY9 A;  2XMF A;  2K79 A;  2KNB B;  3I9Q A;  8ATC B;  1ZBX A;  5FU7 C;  1YIT Q;  2JTE A;  4O6J A;  3NHN A;  3QZ9 B;  4ESR A;  4B9W A;  2RJE A;  5EC7 A;  4M7A G;  4OB2 B;  3X24 B;  3EG1 A;  1NYG A;  1M30 A;  1YJW Q;  1RLP C;  3LX7 A;  3GBQ A;  2M16 A;  1YJN T;  3EG9 A;  3OW2 S;  4M78 E;  3CCR Q;  1WIE A;  1VQK T;  4M7A E;  3THK A;  4E7S A;  2EKH A;  4FYV B;  2HZY A;  3RMQ A;  4RG2 A;  1M90 U;  2LNV A;  4PJN A;  1VQ7 Q;  1GFC A;  2O01 E;  2FG0 A;  3PVL A;  3CMA Q;  4QT7 A;  3I5R A;  3EG0 A;  4FIB A;  1YHQ T;  2DRK A;  3A8G B;  1NE8 A;  2KMT A;  2VAS A;  1VUB A;  1YJ9 T;  3EGD A;  3DB3 A;  4E2F B;  3G7Z A;  4C8Q A;  1K9M C;  3CD6 Q;  1D1B A;  1X6G A;  3GNG A;  4JJB A;  3JB9 F;  2QDY B;  1YI2 A;  5C6S A;  4BAC A;  4A63 B;  2IIM A;  2DL4 A;  4XK8 E;  2WSE E;  1M1K R;  3JRZ A;  3MJX A;  2LP5 A;  2JZ2 A;  2HQX A;  2EQK A;  9ATC B;  1WXB A;  2LTO A;  4MZM A;  1W2B A;  1NPR A;  1VQL Q;  1VQP Q;  1NEB A;  3VUZ A;  2DXB A;  5FWC A;  1W4S A;  2HEQ A;  1VQ9 Q;  2LVM A;  2A37 A;  4N4I A;  5DLQ E;  1W2B S;  1H92 A;  4M75 B;  5GAM e;  3EGX B;  3LWI A;  2HL3 A;  1ZSZ C;  3I56 A;  1Q81 R;  2ED0 A;  4C8Q D;  2J6K A;  4EMK A;  4B9X A;  2O4X A;  4QVZ A;  1T3S A;  1WHL A;  2W10 A;  2X51 A;  5KYN A;  2DD4 A;  1ABO A;  1B7T A;  4RTT A;  3CPW P;  1K73 C;  1UGS B;  2B8A A;  2YXY A;  2ABL A;  3JCM e;  1YJN Q;  4DBQ A;  2DL8 A;  1SRL A;  1VQK Q;  2J6F A;  1RAB B;  3CXC A;  3CC2 Q;  4PKC C;  3JSC A;  3D7S B;  1OU8 A;  3L2Q A;  2DEQ A;  2R5M A;  3QG1 A;  3C12 A;  2Y4X A;  3CXC S;  4IKF A;  4BE0 A;  5KCH A;  3P8D A;  1RL2 A;  4BI8 B;  4ORZ A;  1Q82 U;  2CT3 A;  2RD1 A;  3CME T;  2MYS A;  1YHQ Q;  4Y28 E;  2GTJ A;  2V26 A;  2PZ1 A;  2D6F A;  2Z0W A;  3WVD B;  1S1N A;  1YJ9 Q;  5LJ5 h;  4J9F A;  3JCM b;  1BK2 A;  1Q7Y C;  2QEX T;  2CP2 A;  8AT1 B;  3OYF A;  1BI3 A;  3HFN A;  2EJG A;  3QXE B;  4CRI A;  4E7I A;  4GBQ A;  2WAC A;  4E7Z A;  5LJ3 e;  5GAN 5;  3JB9 H;  1MUZ A;  3KXT A;  1VQO A;  5HK3 A;  2YRC A;  1KQS A;  3H0I A;  1OX8 A;  2XI9 A;  2JTM A;  4PJO B;  2JMC A;  2JS2 A;  3MEA A;  3FLG A;  4J9E A;  3G6E A;  2P84 A;  3M0R A;  4IUP A;  5HK0 A;  1KQS S;  2YUP A;  2DLP A;  3AT1 B;  2JNG A;  2HCK A;  1QWE A;  4CC7 A;  2E3H A;  3P8B B;  2KY9 A;  4KT0 E;  3KFV A;  4JZ3 A;  1VYV A;  1IZ6 A;  2VXE A;  2PUK B;  4M78 A;  2K3Y A;  3JB9 J;  1S72 T;  2GGR A;  4HVV A;  1OPK A;  4M7A A;  2DYI A;  5I22 A;  2J05 A;  3QJ6 A;  4PJJ A;  1I5O B;  2CZ1 B;  1ZBJ A;  3SWN B;  1GFD A;  4M75 C;  1RI9 A;  1V29 B;  4C0D B;  1LJO A;  2VYT A;  1KD1 C;  1VIE A;  4D8K A;  3PNW C;  1H3Z A;  3I5S A;  3EFO B;  3TCJ A;  4JLG A;  5AT1 B;  2XHC A;  2QQ9 A;  1VQ5 A;  3RKX A;  1D0Z A;  4BI3 A;  3CCV T;  1G3S A;  2CDT A;  5KYX A;  4QQ6 A;  1ARK A;  1IHV A;  4E7J A;  3FIF A;  1C1A A;  1KQS P;  2BZX A;  3NTI A;  3VKI A;  1Q86 R;  1JBM A;  1G2B A;  4HKE A;  2H3E B;  4ZN1 A;  1WI7 A;  2DET A;  1I4K 1;  2K5I A;  3TU4 K;  3GLX A;  2DNU A;  2GTO A;  4R56 A;  4BE1 A;  1Y7X A;  3EFO A;  4C5I A;  1M90 R;  1MMD A;  1Q95 G;  2FPE A;  1BIB A;  2CP6 A;  2M51 A;  3E9G A;  3MKD A;  4AG2 C;  2XK0 A;  2ROL A;  4ANJ A;  4PJM A;  1I1J A;  4JJN K;  4LDU A;  4X9C A;  2C0O A;  5LJ5 j;  2DPP B;  1X6B A;  5GMK l;  3TSW A;  2HMA A;  1VQ8 T;  3A5Z B;  2FL7 A;  1KC8 C;  1N8R U;  5CK9 A;  1VQ4 A;  4M4Z A;  2SRC A;  4ZGJ B;  1M3B A;  1Y71 A;  2E1H A;  3OS5 A;  2EYX A;  3VJP A;  2D9T A;  2MCN A;  1EIF A;  2FZG B;  1S72 Q;  1AZE A;  1YIJ A;  3CCU A;  1M8M A;  4D8D A;  1T3L A;  3S3O A;  3QDF A;  4M77 D;  4C0Z A;  1NLO C;  3PE0 A;  2AZV A;  4JUV A;  1WJS A;  1VA7 A;  4MMK A;  4M77 C;  2VKN A;  1IO6 A;  4XTW A;  3NGP A;  5HCK A;  3TVT A;  3BDL A;  2VXF A;  1JEG A;  3NFC A;  4A54 A;  3CCV Q;  4FU6 A;  2E3I A;  1XOV A;  1MHN A;  3SWN C;  4C0D C;  4F16 A;  2ZPG B;  4Y92 A;  2XDB A;  1OUL A;  3UWN A;  3ZFJ A;  1K9M U;  2MIO A;  1QCO A;  2MOX A;  4J9D A;  4EPC A;  2CSI A;  3OYB A;  2IVW A;  3HL8 A;  1MMN A;  2YWW A;  4C92 C;  2JTF A;  2V1Q A;  1K0X A;  1FWZ A;  2R57 A;  2KR3 A;  1YN8 A;  4MZP A;  1QMC A;  5GAN 6;  1QLY A;  1UTI A;  2ED1 A;  3OYY A;  4OGE A;  3OYA A;  2OAW A;  1UEC A;  4P5N A;  1B07 A;  4E7L A;  1VQM A;  1TTH B;  1Q82 R;  2DXU A;  1VQ6 A;  1I0C A;  1JJ2 A;  1YP5 A;  4C8Q E;  1ABQ A;  1D3B B;  2A0F B;  5CQX A;  2P0Q A;  4PFO A;  5D6X A;  3SB2 A;  3JCM V;  3RNJ A;  1A0N B;  1W6X A;  3CC7 T;  2OAU A;  4MDW A;  3JAM E;  4HCZ A;  1JJ2 S;  2RQW A;  1Z9Q A;  3TRE A;  5I11 A;  3CCL T;  1K9A A;  1K0S A;  4HVW A;  5C0M A;  1HD3 A;  2RQU A;  1WYX A;  1IRE B;  2X9H A;  1T0J A;  2XID A;  1QVF P;  1LCK A;  2DE0 X;  3PTA A;  1K73 U;  3CCS Q;  3CC4 A;  2JN0 A;  2L3P A;  3ME9 A;  2IG0 A;  1IRX A;  3OYK A;  3UAT A;  1YIT T;  4F7U B;  2X4X A;  4YTL A;  3QWX X;  2NYS A;  3MP1 A;  3CCE A;  3RMS A;  1OOT A;  1YJW T;  1D3B A;  1WX6 A;  4C5E A;  1NJI C;  1TOV A;  3MO8 A;  1BIA A;  3FJ5 A;  2E5K A;  2FRW A;  2EYZ A;  2CUB A;  1Y96 A;  1D1A A;  1MND A;  1UUE A;  2DVJ A;  4AMC A;  4XU3 A;  2COW A;  4DEX A;  3E19 A;  1JJ2 P;  1IHW A;  5CKE A;  1Q7Y U;  4M7D D;  3CMA T;  5D7U A;  2CSQ A;  2XU8 A;  2RF0 A;  4TVR A;  2DMO A;  2RK1 A;  3PGG A;  4A4E A;  2LZ6 B;  2LQ8 A;  4OB3 B;  3OY9 A;  4HCC A;  1D1C A;  5D6Y A;  5GAN j;  4DBF A;  4J6Y A;  4MML A;  1D0X A;  1FYN A;  3CCQ A;  2DVE A;  5LJ5 f;  4Z88 A;  3G4S Q;  2P4R A;  2L3R A;  4CC2 A;  1GBR A;  3CD6 T;  1AWX A;  3RR6 A;  4ZGE B;  3JV3 A;  2L0A A;  2BUD A;  3OSS C;  1NLP C;  1M3C A;  1TUG B;  2D0Q B;  2W0Z A;  4ME7 A;  5LL6 S;  3A8M B;  1YCS B;  2VGN A;  3I55 A;  1PRM C;  1AHJ B;  4RKU E;  4FW1 A;  4X1V A;  3O8V A;  3CC7 Q;  1VQL T;  2ZPE B;  1PKT A;  2HL5 C;  4RTY A;  3L42 A;  1KSW A;  2QI2 A;  1Y07 A;  1QP2 A;  5LJ3 h;  4WTO B;  1VQ9 T;  2EYQ A;  1PC0 A;  4C5G A;  2RI5 A;  4ZNX A;  1FMV A;  1NG2 A;  3OQ5 A;  3S6W A;  1UDL A;  2OX7 A;  1M8V A;  1TS9 A;  3HHT B;  3PIP A;  3OYJ A;  3Q1J A;  1WQW A;  2EGC A;  2K5F A;  2K4Y A;  5CKH A;  4X34 A;  3VS0 A;  3JCM J;  3EGD B;  2LX7 A;  4M77 F;  5EG2 A;  4C8Q B;  1AVZ C;  2KYB A;  3L2U A;  1OV3 A;  2R58 A;  2X35 A;  1N8R R;  2DTO A;  4AFQ C;  2DRM A;  2EFI A;  2AKL A;  4LN2 A;  3CC2 T;  3C4S A;  1QP3 A;  1BKB A;  1CKB A;  2RJF A;  3GPL A;  3HKS A;  2EW3 A;  1UGV A;  2DM1 A;  3RBB B;  5FW9 A;  1U06 A;  1MV3 A;  1X2K A;  3OS1 A;  4OMQ A;  3X26 B;  5HKC A;  1PM3 A;  4OB0 B;  3T9N A;  3CPW A;  2OTL A;  3M0P A;  3M9Q A;  4Z8A A;  2EKO A;  4XTV A;  2CZ6 B;  3EHR A;  4JRQ A;  2HKQ B;  1R0C B;  5GAM j;  1K8A R;  2LCC A;  1WPY A;  5CQY A;  2LJ3 A;  4F14 A;  3CPW S;  4JJD A;  2V8K A;  1GBQ A;  4AFU C;  1ZX6 A;  2KAF A;  2RQT A;  4EMK B;  1V76 A;  2VUB A;  3VS5 A;  2O4X B;  5KYY A;  4XU0 A;  2K2V A;  2FPD A;  1M2V A;  2AIR B;  4JLI A;  4M77 G;  1MGQ A;  3GF5 A;  1K9M R;  4PNO A;  3G71 A;  2JW4 A;  1M1K C;  3TQ7 P;  1UJY A;  3OMG A;  1IXD A;  4M77 E;  3M53 A;  1TSF A;  3OYE A;  2BTT A;  1YI2 T;  1GXI E;  2L89 A;  4BD3 A;  2HQH A;  1F1B B;  1PHT A;  3DLM A;  2QA4 A;  4C92 G;  1PCX A;  2ZZD A;  2LQW A;  3HRU A;  4J9I A;  2EWN A;  1GCQ A;  3UA6 A;  3OA6 A;  1QCF A;  4PLI A;  2CKK A;  4B6M A;  1H3H A;  2C0I A;  1MMG A;  3PT9 A;  4RUG A;  5GAN f;  2JJ9 A;  4X9D A;  3R6O A;  4NL3 A;  2JOY A;  2E12 A;  3WVE B;  2HSP A;  2OTJ Q;  5CKD A;  2E41 A;  5LJ3 j;  1M2O A;  2QDL A;  1UHF A;  3M58 A;  3FJP A;  4KUI A;  3I56 T;  3QBY A;  3CME A;  2BZ8 A;  2DTH A;  3V8J A;  3MET A;  3OS2 A;  1P92 A;  4JRP A;  2DFU A;  4M7D F;  5GAO m;  4FT4 A;  2DA9 A;  2X3W D;  4EIK A;  2O9V A;  2DJQ A;  2CZ7 B;  2M0O A;  1QQJ A;  4RTZ A;  4CC3 A;  3M54 A;  1WHK A;  3G1J A;  5KE3 A;  4M78 B;  4J83 A;  1X27 A;  3EH2 A;  4J7I A;  2DBM A;  4M7A B;  3OMC A;  3CCJ A;  2QK0 A;  2KK4 A;  2NUP A;  2V8J A;  4OGC A;  2F2W A;  4RTV A;  3U23 A;  1Q7Y R;  2KBT A;  3HFO A;  2RQR A;  2F2V A;  2DF6 A;  4FYY B;  2KT8 A;  3IQL A;  5GAM d;  3CQT A;  2KDS A;  3JCM P;  1WHM A;  2VVK A;  4LE9 A;  1AZG B;  2P0K A;  3VU3 C;  4JS5 A;  2CUD A;  2P0P A;  1RLQ C;  3A8L B;  1B34 A;  4FM4 B;  2PTK A;  3QHS A;  2AZS A;  4OP0 A;  4ATO A;  4FT2 A;  1YI2 Q;  2F2X A;  3VS6 A;  3VUB A;  5KYX B;  4JDS A;  4CI0 C;  3CBP A;  1KG1 A;  3JCM d;  2FB7 A;  4OMO A;  1VQO T;  4M7D G;  5A0D A;  4MDX A;  3NTH A;  4F04 B;  3G71 Q;  2DTI A;  5KYW A;  3VV0 A;  4OMN A;  4M75 D;  5L23 A;  1M1F A;  4J8O A;  3QII A;  2Y4Y A;  3RKY A;  1UGQ B;  4BUG A;  4K11 A;  4M7D E;  2KQW A;  3FB9 A;  2MWP A;  2FZC B;  1X2Q A;  2RHX A;  3G6E T;  3RIR A;  2X4J A;  3VS1 A;  4BI4 A;  4QQD A;  4L59 A;  2CP7 A;  1SSF A;  5GAM f;  2LJ0 A;  2GQV A;  5GAN 8;  2YHT A;  4BY6 B;  3HP9 A;  3E9F A;  2SEM A;  3I56 Q;  3V8L A;  5GAN 4;  1B3Q A;  2QQR A;  3UPU A;  4R55 A;  4JS4 A;  1M4Z A;  2EJ9 A;  3RES A;  2DJZ A;  2KRO A;  4KBM B;  1KFZ A;  1BBZ A;  1TWB A;  1D09 B;  3JCM f;  4RTU A;  3EGU A;  4JRK A;  2YDL A;  1Q86 C;  2DXT A;  2ZPI B;  3J80 E;  2AHJ B;  3F70 A;  3QWY A;  1AWW A;  2VV5 A;  4ZGD B;  5FU6 B;  3MEU A;  3OYC A;  2M0Y A;  2KGT A;  4M77 A;  3EAE A;  2XDP A;  5IHN A;  2EQJ A;  1I8F A;  1R77 A;  2GFU A;  1K4U S;  1GCP A;  4DBR A;  1UE9 A;  1QW1 A;  4DBH A;  1G3Y A;  5GAN 3;  2FZK B;  2GCX A;  4XAX B;  2QYZ A;  4OMM A;  4HCK A;  1VQ8 A;  2JMA A;  3OB9 A;  4M78 C;  1MNE A;  2RQV A;  2YSQ A;  5FRO A;  1VQN A;  4M7A C;  1X6O A;  1SHG A;  3M0U A;  2QGG A;  2HAX A;  1OZ3 A;  3VS7 A;  2KXC A;  2LC4 A;  2E6Z A;  2RK2 A;  3PMT A;  3LW5 E;  3EHQ A;  2O9S A;  2O31 A;  1NEG A;  2I2L A;  5LJ3 f;  5IT9 E;  2KRN A;  3OYD A;  3VS3 A;  1VQO Q;  2PVG B;  4VUB A;  3V7S A;  4PJO C;  1RAE B;  2RNA A;  2KYM A;  5J3B A;  2FRY A;  1KIK A;  4JPB W;  4HVU A;  3CCS T;  3R6N A;  1GL5 A;  1X01 A;  2D1X A;  2EQU A;  2EYW A;  1E6G A;  4ELZ C;  5KCO A;  5J39 A;  4QVC A;  3G6E Q;  4GY5 A;  2RMO A;  2ZPH B;  3QUI A;  3L2R A;  3ZL7 C;  1N5Z A;  4IIM A;  4HT8 A;  4OML A;  2FYK A;  2M9U A;  2MF2 A;  2G3R A;  2NUT A;  4LDW A;  3UT1 A;  1BI2 A;  1G8X A;  5ECA A;  1YIJ T;  1I81 A;  2K2M A;  2MMP A;  3RUX A;  3QSU A;  2C06 A;  3J7A F;  1QVF A;  2QTX A;  2OI3 A;  3A8H B;  4FL6 A;  2DZ9 A;  4HA8 A;  1OYX A;  1U3O A;  4C92 D;  2WSF E;  3OYG A;  5CIU A;  4BY6 C;  3LGL A;  1PKS A;  1HYO A;  1QVF S;  2EBP A;  4Y91 A;  2HNI A;  5IHI A;  4NL2 A;  3MP8 A;  1JXM A;  2K3X A;  4L5G A;  3G4S T;  2DZC A;  3GNF B;  1VQ5 Q;  4IUU A;  1WHH A;  1OZ2 A;  2RHY A;  5GMK h;  3CCM A;  2CGH A;  1VYU A;  2EQI A;  4A4G A;  2LQK A;  3FC3 A;  1X43 A;  4A53 A;  2EVR A;  1TUC A;  3TEE A;  3JCM X;  4LDY A;  2CYZ B;  1Q82 C;  1YNZ A;  3HTR A;  1R8O B;  4RCC A;  5FU6 C;  3SHW A;  2VB6 A;  1X69 A;  3CCL A;  2KRM A;  1KK7 A;  5IH2 A;  2DL3 A;  2O88 A;  2MPX C;  1W70 A;  2F5T X;  4ZTJ A;  2LT1 A;  4O5V A;  5GMK i;  3MHX A;  4M7D A;  2EGA A;  3DKM A;  5CR2 A;  2RPN A;  2FEI A;  4AT1 B;  1Y96 B;  3OYM A;  2JM9 A;  3JCM g;  5CKF A;  1YIT A;  4BDY A;  3H41 A;  1W1F A;  5J26 A;  2ZAE A;  2DL5 A;  4J6W A;  3AHU A;  3HRT A;  4OF1 A;  1FMW A;  5LJ5 d;  1VQ6 T;  2DYB A;  2E64 A;  2ZCF B;  4BDZ A;  4MZT A;  4M75 F;  1YJW A;  3CEY A;  2DKG A;  4XU2 A;  1VQN Q;  1YCY A;  2DD5 A;  2RO0 A;  3O5Z A;  4XU1 A;  4D6W A;  3CCR A;  2GBQ A;  5FRN A;  1RI0 A;  2F69 A;  3LLR A;  1CKA A;  1VQ4 Q;  4DOW A;  1KQ2 A;  3NMZ C;  3MP6 A;  1G3W A;  1PRL C;  1QVP A;  3J81 E;  1OI1 A;  1VQ7 A;  4NOY A;  2XG8 D;  3V7R A;  1RAD B;  3CMA A;  1YIJ Q;  3CCU Q;  4XTU A;  3ER0 A;  1UGP B;  2K5L A;  3RER A;  4KGV B;  2B86 A;  3CC4 T;  1XJW B;  1JB0 E;  5GAO n;  1RUW A;  1YFN A;  1SKU B;  2Y90 A;  2E5Q A;  1ZA1 B;  1KJW A;  2JXB A;  3CD6 A;  4FYX B;  1YWO A;  3LH0 A;  2CT4 A;  3SD4 A;  4LUE A;  3CCE T;  2ESW A;  2AK5 A;  4WCI A;  4F17 A;  2EYY A;  2QAS A;  2KT1 A;  2YUO A;  3BE3 A;  1ZUK A;  3M5A A;  4M75 G;  2XD0 A;  2OJ2 A;  3OS0 A;  4IUV A;  5CVI A;  3M4Y A;  3EH1 A;  1EZZ B;  3V8K A;  1BCO A;  2MWO A;  1VQP A;  1VIF A;  1WXU A;  4M75 E;  2QQA A;  5GAN 2;  1BB9 A;  1VQ9 A;  4DQ2 A;  1YWP A;  2GFA A;  4JZ4 A;  1KHC A;  2BIV A;  4PFZ A;  5FRM A;  1AOJ A;  4N0A C;  4QVD A;  1QKW A;  3X28 B;  3WXM B;  4BE2 A;  3E1S A;  3HSB A;  1O9S A;  1O75 A;  4PJO F;  3QDR B;  1DJ7 B;  5I2S A;  1VQM Q;  4E6R A;  5KYU B;  1UB4 A;  1HSQ A;  1VQ6 Q;  1KD1 U;  1K1Z A;  2ZGW A;  3OSV A;  2QAZ A;  4EMG A;  1YJN A;  2BE9 B;  3I55 T;  1EX4 A;  2COZ A;  1SG5 A;  1VQK A;  3VYH B;  4KUL A;  3CC2 A;  2K57 A;  1C0M A;  2YLB A;  2DK3 A;  1IGU A;  1XNI A;  1N8R C;  2A3L A;  2JS0 A;  2OTJ T;  5KYY B;  3CPF A;  3OW2 A;  4M78 G;  1M2V B;  4J9H A;  5KH6 A;  3CC4 Q;  2CZ0 B;  1YHQ A;  2VWF A;  5GMK e;  1Q86 U;  2DER A;  4J7F A;  5KYU A;  1ZSZ A;  1YJ9 A;  2F5K A;  3VS4 A;  3VYG A;  2LNH B;  2PU9 B;  1QKX A;  2HKN A;  3CCE Q;  4C92 F;  4C0F A;  1QCN A;  3L2W A;  4PL6 A;  4PJO G;  2XIC A;  1PWT A;  3A1P A;  2WSC E;  3P8H A;  5FLX E;  4J9G A;  1XTD A;  2XDD A;  2ENM A;  2PVO B;  1K8A C;  2E4H A;  2QGF B;  4N4H A;  1TXQ A;  2BE7 D;  2RA2 A;  2G6F X;  1TUD A;  4PJO E;  2RJC A;  3SFM A;  2L8D A;  2RHU A;  3C0C A;  5GAN d;  3UF4 A;  1M27 C;  1OU9 A;  3L1A A;  5A0L A;  5GAO r;  1WHJ A;  1KC8 U;  1OX9 A;  4IUR A;  4OVA A;  3CCQ Q;  4IUT A;  2DIQ A;  2OTL T;  3BW1 A;  4C0G A;  4J5Y A;  1PD1 A;  3C94 A;  2CH4 A;  2K6D A;  2YRV A;  4KH0 B;  3UA7 A;  3OBY A;  4LXC A;  2CRE A;  3OW2 P;  1D0Y A;  1KHI A;  2ZPF B;  3URG A;  1Y57 A;  1FMK A;  5LJ5 g;  1JQQ A;  1U1T A;  3G71 T;  4FSS A;  1Q81 C;  1CSK A;  5I2M A;  1UEB A;  1QVG A;  2RJD A;  3I55 Q;  1U5S A;  2R5A A;  4IIO A;  1YBY A;  2RI3 A;  1N6A A;  1JU5 C;  4E47 A;  3GP8 A;  4PJL A;  4C92 E;  2ZPB B;  1VYT A;  1T0H A;  4NS5 A;  2KE9 A;  1QVG S;  2L3S A;  2X4Y A;  1LPL A;  2HBP A;  3EFS A;  2LQN A;  4JRI A;  2CH4 W;  2EAY A;  1MMA A;  3M56 A;  2NUP B;  1RAF B;  2KRS A;  1XQH A;  1K73 R;  4C8Q C;  2QA4 T;  3BY7 A;  2LX9 A;  3JB9 G;  5KE2 A;  2ECZ A;  2KEA A;  2PUO B;  3PVQ A;  4OB1 B;  1K76 A;  2NLU A;  1LNX A;  3SEM A;  2QEX A;  2DIL A;  1PG5 B;  1FX7 A;  3FDR A;  3REB B;  3HRS A;  1B34 B;  1IGQ A;  2RI2 A;  2QG9 B;  2MI6 A;  1WFW A;  1BI1 A;  2RHZ A;  3VS2 A;  1UGR B;  1M3A A;  5GJV B;  4M75 A;  2EIF A;  2VC8 A;  3JCM W;  3EGX A;  1N9S A;  3E2U A;  2MK5 A;  4V2S A;  4LDV A;  3PFS A;  2YRD A;  3INZ A;  3RDV A;  1E6H A;  2JT4 A;  5KYW B;  2LJ1 A;  1W2B P;  3M57 A;  1LOJ A;  4AFS C;  1QVG P;  3DLL A;  4HCB A;  1SHF A;  2LT4 A;  3EG2 A;  3BFM A;  1M9S A;  1WXT A;  2OTL Q;  3REA B;  1ZQ1 A;  1HK9 A;  3MPU B;  4EMK C;  3QPH A;  1GCQ C;  2DX1 A;  1EFN A;  3QKJ A;  2LDM A;  2KVQ G;  1LVK A;  1OPL A;  4DEY A;  1S72 A;  5GAO l;  3QO3 A;  2PVD B;  3CCJ T;  1RAG B;  2EQM A;  2E70 A;  4E7K A;  1ACM B;  2L5Q A;  3CXC P;  1NJI U;  7AT1 B;  2H8H A;  2V1R A;  1J3T A;  5A2Q E;  1JXO A;  2F1L A;  3CCV A;  1RAC B;  4F7U F;  1AWO A;  4M77 B;  2FO0 A;  4J6X A;  3H6Z A;  2DEU A;  1G83 A;  3I35 A;  4LDX A;  2QA4 Q;  5FWB A;  3LH5 A;  2A08 A;  3H0H A;  4IUQ A;  1KD1 R;  5IXB A;  3H0F A;  3OYH A;  1TU0 B;  2NWM A;  3LYI A;  4PJO A;  2D8H A;  4Q5W A;  4XTY A;  3ULR B;  1WZO A;  4DA4 A;  5LJ3 d;  1NZ9 A;  3JCM Q;  3M0T A;  2C0T A;  1IB8 A;  4E7H A;  1RAH B;  1MV0 B;  1ZLM A;  1WDX A;  1OEB A;  4C92 B;  1WJQ A;  2VGM A;  1WHG A;  2MAM A;  5GMK m;  4KUD K;  1VQ5 T;  1I07 A;  2H3J A;  3CME Q;  2NUZ A;  1U1S A;  3X25 B;  4LUD A;  1ZUU A;  5GAN g;  3DB4 A;  3NPF A;  3L2V A;  1M90 C;  3X20 B;  4M78 D;  2YLC A;  1SRM A;  3GOX A;  3SWN A;  2QEX Q;  4M7A D;  2A7Y A;  2KI7 A;  3A98 A;  4KGZ B;  2JUF A;  4F7U G;  3MEV A;  2PQW A;  2KXD A;  2ATC B;  4R0K A;  3SDZ A;  1UFF A;  1GRI A;  2K3B A;  2I0N A;  5HY6 A;  1AD5 A;  2J6O A;  2QQS A;  3LGF A;  5DM7 R;  3QYH B;  2NUT B;  2RM4 A;  4F7U E;  4PJO D;  1R0B G;  2M1H A;  5GJW B;  4OMP A;  1SF9 A;  5IN1 A;  4C92 A;  1Y0M A;  2FVU A;  3CCS A;  3CCJ Q;  2DBK A;  1M1G A;  2LCL A;  4FW2 A;  4N4G A;  3OYL A;  2K9G A;  2CP5 A;  5I21 A;  1N27 A;  1KC8 R;  1WNL A;  4XTX A;  2DXC A;  3H8Z A;  1VQN T;  4WF2 A;  6AT1 B;  2GQI A;  4A4F A;  3M0S A;  2KSS A;  2LRQ A;  3OBW A;  1PSE A;  3QZ5 B;  4JJC A;  2DL7 A;  4HT9 A;  1VQ4 T;  1ZA2 B;  4LD9 K;  2IPO B;  3OYN A;  2LMJ A;  4KGX B;  3QJY A;  1HXD A;  4EDU A;  4C8Q F;  5CKB A;  3M4G A;  2DO3 A;  3KUF A;  1AWJ A;  3JCM c;  2J7I A;  3CCU T;  1NBE B;  5GAN h;  2EJF A;  4A4H A;  2DIG A;  1H8K A;  3JB9 I;  4HXJ A;  5GAN 7;  2L2P A;  2DAQ A;  2YUQ A;  1K8A U;  3G4S A;  4Z02 A;  4XQ3 A;  5LJ5 e;  2D8J A;  2YT6 A;  4GLM A;  3ZEH A;  5GAO q;  5IHK A;  4M7D B;  4KH1 B;  4RTX A;  1BI0 A;  3KBG A;  3M0Q A;  1RAA B;  2E65 A;  1E7O A;  2HD0 A;  3M59 A;  1M1K U;  4KRT A;  2BZY A;  1PNJ A;  1SSH A;  1NM7 A;  4AFZ C;  2YUN A;  3ZBD A;  3M55 A;  2X4W A;  2QXF A;  5CO7 A;  1TH7 A;  1TG0 A;  1ZUY A;  5GAM g;  3JB9 D;  3CC7 A;  1AEY A;  2GNC A;  3H9N A;  1U8R A;  1C6V X;  1UG1 A;  2HBW A;  4C8Q G;  1SEM A;  2ROT A;  4PFP A;  4UC4 A;  3OYI A;  1BYM A;  1BU1 A;  1JRI A;  2RHI A;  3FRN A;  3C95 A;  1G5V A;  4C5H A;  2COY A;  2CP0 A;  3L2Z A;  2FPF A;  3LWH A;  5D6W A;  1Q81 U;  1KQ1 A;  3CCM T;  3MCA B;  3CBO A;  2E6N A;  2HQE A;  2RB6 A;  2CP3 A;  2JM8 A;  2EPD A;  1VQM T;  1ZHI A;  3S3N A;  1VQ8 Q;  5FU7 B;  3QYG B;  3BDU A;  5A0G A;  3EFR A;  1I5L A;  4II1 A;  4CC4 B;  3CBM A;  3VRZ A;  5GAO p;  5M9O A;  1X75 C;  1NYF A;  4OMF B;  4XTZ A;  1VOM A;  3NTK A;  5IXF A;  2J06 A; 
#chains in the Genus database with same CATH homology
 3CCV Q;  1VQ9 Q;  1N8R R;  3OW2 P;  1KC8 R;  3CCS Q;  1YJN Q;  1KD1 R;  3CCR Q;  1W2B P;  1YHQ Q;  1VQM Q;  1M1K R;  1VQ5 Q;  1K9M R;  3CCE Q;  3CME Q;  3G4S Q;  1YI2 Q;  1KQS P;  1YIJ Q;  1M90 R;  3CCU Q;  1VQK Q;  1VQ8 Q;  1Q7Y R;  1VQ6 Q;  2OTJ Q;  3CC2 Q;  1YIT Q;  1QVG P;  1Q81 R;  3CD6 Q;  1VQN Q;  1YJ9 Q;  3G6E Q;  3CC7 Q;  3CCQ Q;  1Q86 R;  1K8A R;  1JJ2 P;  1VQ7 Q;  3CC4 Q;  3CCL Q;  1VQL Q;  1VQP Q;  3G71 Q;  3CCJ Q;  2QEX Q;  1VQO Q;  1NJI R;  3CMA Q;  2OTL Q;  1S72 Q;  3CPW P;  1Q82 R;  1K73 R;  3I55 Q;  1VQ4 Q;  3I56 Q;  1YJW Q;  3CCM Q;  1QVF P;  3CXC P;  2QA4 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...