4M77E

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
80
structure length
70
Chain Sequence
ILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLKVMQHHGRMLLSGNNIAILVPGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 10
structure length 70
sequence length 80
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77E00
1M5Q1 4C8QC 4M7DG 1LJOA 3L2ZA 5LJ5j 4M75D 2EJ9A 2RM4A 4M7AF 2HNIA 1Y96A 4M77A 2DTIA 1HK9A 3BDUA 4J5YA 2E41A 2EWNA 4F7UA 4M7AC 2VXFA 4EMKA 4M78E 4XU0A 5LJ3e 4M75B 1BIAA 4JLIA 5GANf 5GAN4 4RCCA 4X9DA 5GAN2 2FYKA 4C92G 4V2SA 1BIBA 4C8QE 4DQ2A 1YCYA 3JCMW 5GAOm 3QHSA 2DVEA 3M4GA 3SWNB 3SWNA 4PJOB 3JCMJ 5GAOl 4J6WA 5I21A 3RUXA 4M7AE 1U1SA 3V7RA 2YLBA 1H641 4M75F 2E10A 5GAMe 5DY9A 3HSBA 3PGGA 2DXUA 4M77D 4Y91A 5GMKi 4M7DA 1TH7A 4M75C 4HT8A 4XU3A 1LNXA 1I5LA 4QVDA 4PJOF 3EFSA 1Y96B 4M77B 1WQWA 3SWNC 4N0AA 4EMHA 4XTWA 4XTVA 5GMKm 5GAN5 4PJOC 4XTUA 4M78G 3QO3A 4XTYA 4F7UB 3JB9G 4JRKA 4EMKB 4C92A 1WQ7A 1U1TA 2VXEA 4PJOD 5GAMf 5CAIA 4C8QG 1I4K1 4M75E 3JCMX 5GAMd 3FIFA 3BY7A 3V8KA 4A53A 1WPYA 4JRIA 4M77F 3RKYA 3JCMe 3JCMb 4M7DD 5LJ5e 5GAN8 4M7AG 4PJOE 4OP0A 4HT9A 4XU1A 4F7UF 4M77C 5GANh 3GIBA 4JUVA 3SB2A 3RERA 4RCBA 1N9RA 5GANg 4M7DB 3RESA 2DZ9A 4EMKC 3V7CA 2QTXA 4WF2A 1JRIA 3V8LA 1HXDA 2DEQA 4C92D 5GANj 4M78A 5GAOq 4MMKA 3JCMf 3JCMd 4M77E 2DTOA 5LJ5f 2EJFA 5LJ5d 5GAOn 5GMKl 3RKXA 2RB6A 5LJ3h 2I2LA 4C8QA 4C92B 2EJGA 1KQ2A 3INZA 2DXTA 4F7UE 4M75G 4M7DF 1D3BB 5LJ3g 1MGQA 1D3BA 3FB9A 3JCMc 4XQ3A 5GAN7 3AHUA 4EMGA 5GAN6 5GAOr 3BW1A 4M7DC 5GMKh 4M78F 4HA8A 4M7AA 1M8VA 5LJ3j 4PJOG 4J6XA 3EFRA 3JB9I 3JB9H 1WNLA 4XTXA 2Y90A 2E65A 3QUIA 4N0AC 4XU2A 4C92F 4J6YA 5GAMh 3FJPA 4MMLA 3JCMV 3QSUA 5GMKj 4M78D 1B34A 2K57A 4C92C 2YLCA 5GAMg 2YHTA 4M7DE 4X9CA 4C8QD 2E64A 5GAOp 5GAMj 4M78B 3V8JA 4M77G 5GAN3 1X01A 1JBMA 1I81A 2FB7A 4M75A 4A54A 5GANd 4F7UG 3JB9J 4C8QB 4M7AD 2JN0A 1I8FA 2DKGA 4PNOA 3VU3C 4C92E 5GMKe 3JCMQ 3V7SA 2DJZA 3HFOA 2DZCA 3L1AA 4PJOA 3JCMP 4M7AB 2ZGWA 3RKWA 4NL3A 3JCMh 2E1HA 4NL2A 3JB9F 2CGHA 2RA2A 1LOJA 3RIRA 3BFMA 5GANe 5LJ5h 1KQ1A 4XTZA 1N9SA 3JCMg 4M78C 2DTHA 2VC8A 5LJ3f 4C8QF 5LJ3d 5LJ5g 3HFNA 4NOYA 2EAYA 2RD1A 1B34B 4QVCA 3JB9D
chains in the Genus database with same CATH superfamily
1R0CB 1Q7YC 1M9SA 2K5LA 1K1ZA 2DJQA 1SPKA 1VQ9Q 1N5ZA 2EWNA 4M7AC 1VQOQ 4BDYA 3A8GB 4QT7A 4NS5A 4E7IA 3S3OA 1XOVA 1T0HA 2FYKA 4E47A 1PD0A 4LUEA 2DVEA 2GQIA 2JZ2A 2QA4A 1F1BB 1SEMA 4J9HA 2CS7A 1BYMA 2K9GA 3PGGA 3PMIA 4M7DA 2L3PA 3CC7Q 3OMGA 3OS1A 4QQDA 3CCRT 1UEBA 3M9QA 2KBTA 3PE0A 1PRMC 4M78G 4OB1B 2YRCA 1IHWA 1W4SA 2NUZA 2NYSA 1WPYA 2BZYA 3C0CA 2K7AA 2PNIA 4F7UF 3RERA 2KQWA 1MNEA 1MNDA 4HCCA 1AT1B 3SFMA 1N8RR 1TWBA 3PNWC 4JLGA 3RKXA 2KAFA 4WCIA 4DA4A 2DXTA 4F7UE 1NG2A 2F69A 3AHUA 4KULA 3RMSA 3H0HA 1BI0A 2JT4A 5FWBA 1YWPA 1WNLA 3OA6A 2KR3A 1QVGS 3MP6A 3J81E 1G3TA 2C0OA 1OOTA 1PKSA 1KQSS 1RUWA 2ZZDA 5GJWB 1N27A 2JVVA 4C0FA 1M30A 1GBQA 1VQ6T 1K8AR 1Q82C 1AVZC 1WX6A 5FWCA 3C4SA 5CCAA 1LOJA 3NTHA 2HZYA 1RL2A 3M57A 4FU6A 4BE1A 5LJ3f 3CCJT 1B3QA 1YNZA 1ZQ1A 5FU7C 2E6ZA 2CSIA 5I2MA 1TTHB 3SD4A 1VQ8Q 1D1CA 2JJ9A 3THKA 1IXDA 3VYGA 1YJNT 4TVRA 5GAOm 3MCAB 5KYYA 4KH0B 3OW2S 2XKOC 3H0FA 1UFFA 4OMFB 3QZ9B 1RAGB 4ZN3A 1VIFA 3DB3A 4LUDA 1PKTA 1LNXA 1KK7A 1M8MA 3TCJA 4LDVA 2JW4A 3LYIA 2FRYA 1IB8A 4F7UB 2BE7D 1UTIA 2RHIA 2C0TA 1I4K1 7AT1B 4L5GA 3M5AA 3EGDB 3M53A 5CKHA 3LH5A 1JU5C 3ZL7C 2RJDA 3G6ET 2JM8A 2K79A 1Y71A 4OMNA 1PM3A 4ELYC 1IHVA 5A0GA 2QTXA 3NGPA 5D6WA 3CPWS 1E6GA 2KK4A 2EYXA 2CP7A 1OU9A 2C0IA 2DO3A 2EJGA 4E6RA 1RAHB 3A5ZB 5GAN7 1KHCA 2AZSA 2ZPBB 2IVWA 4C0DC 1M8VA 3LWIA 4PL6A 4C92C 1KC8U 2L8DA 4QQGA 4DBFA 1OEBA 2CP0A 4BDZA 4BUGA 1S72Q 2DJZA 1K9MR 1N9SA 2PUKB 3WXMB 1LJOA 1B34B 3CCVA 4MZPA 4Z89A 2L3SA 4C8QC 4HCKA 4Q5WA 2QQ9A 2RM4A 4K11A 3TSWA 2CREA 4YTLA 4E7SA 1XNIA 4BD3A 1RAAB 5GAN2 4OB2B 4PK4A 4DBQA 3JV3A 3OYBA 3HKSA 4IURA 4J6WA 1FXXA 1VYVA 3RUXA 1R77A 3G4ST 3CCMT 4M77D 1VQPA 3CBMA 4CRIA 2XU8A 4PJOF 2FRWA 2LCLA 1YJWQ 2GCXA 2RNAA 3CMEA 2DM1A 3M0TA 3UA6A 1K0XA 1ZSZC 1QVPA 2QAZA 3NTIA 1MMDA 1IGUA 1VYUA 1GFDA 5CQYA 4PJOE 2M51A 1SKUB 2VB6A 2FEIA 1NPRA 4EMKC 1EFNA 3V7CA 2X3XD 3V8LA 1VQ7A 2DEQA 2V8IA 3X26B 1EZZB 2ROTA 4JJNK 2EJFA 4J7IA 4M75G 1D3BB 1G3SA 4FT4A 4FYVB 4EMGA 1OI1A 2MIOA 3G1JA 5GMKh 4M78F 2LJ0A 3M0UA 1ABOA 4J6XA 2R58A 1JJ2P 4XU2A 3PTAA 1IO6A 3Q1JA 3FJPA 3JCMV 2K57A 3OYIA 4KRTA 1QVGA 4LE9A 4UC4A 1KFZA 2R5MA 2B86A 5FROA 3VUBA 2FB7A 3CMAA 1YFNA 1KD1U 1V76A 3GBQA 3L1AA 3RIRA 4ZTJA 2NLUA 3VS3A 5CKBA 3CCUA 1I1JA 5LJ3d 5KH6A 4OF1A 2WSEE 3GOXA 4M7DG 1Q81U 4M77A 1K0SA 3QXEB 2KVQG 1AEYA 1VQ9T 5LJ3e 1YHQQ 1VQOT 1YI2Q 1KG1A 4PFZA 2ABLA 1SSFA 1VQ5Q 3I35A 1D1BA 4JRPA 1QW1A 3JCMJ 4PJOB 3QBYA 5FRNA 2NWMA 1PSFA 1M1KU 3LLRA 2DE0X 1VQ4A 3RR6A 1RLPC 1NLOC 3CC7T 4BB7A 1AD5A 1J3TA 1YJ9Q 5ECAA 4XTVA 3CD6Q 3DKMA 2OTJQ 3ULRB 1X6GA 3CC4A 3QDFA 2Y4YA 3I5SA 3V8KA 3CQTA 3G71A 4J9EA 3FJ5A 1U06A 4DOVA 1WHLA 3JSCA 2VGMA 3CCLA 4RCBA 1N9RA 5KYXB 3FC3A 3RESA 2V1RA 1JRIA 4BY6C 3EG3A 1V29B 3MO8A 1YITQ 3C12A 2J05A 5GMKl 3A1PA 3EG0A 1ZBXA 2CP5A 3E1SA 2EQIA 4XQ3A 1OPKA 1X43A 2L89A 1KJWA 5LJ3j 4QKUA 4Y28E 2DL7A 1GCQC 3R6OA 2QQRA 2DIQA 3I56Q 2RQTA 3LWHA 4KUIA 3OYKA 2COZA 2HDAA 2D0NA 3CXCP 1TSFA 1H3HA 1K8AC 3OS5A 4CC7A 5AT1B 3PMTA 3JB9J 2L2PA 2V1QA 2EYYA 3V7SA 2OTLA 3OYNA 1HSQA 4C5GA 1JJ2A 3CCQA 3BFMA 4M78C 2NUPA 3I5RA 1RAEB 3A98A 2EBPA 1VQ8A 1NJIR 4M7AF 4AFSC 1VQMA 5CK9A 4JRQA 2PTKA 3MEUA 2LZ6B 1YCYA 1IZ6A 1E7OA 4C5HA 2KDSA 2QGFB 4RUGA 2OX7A 4LXCA 4M7AE 1WJRA 1X69A 5GAMe 1YIJA 2BKDN 2YT6A 3D7SB 1JXOA 1Y96B 5IT9E 1Q7YU 2E70A 1I07A 3U23A 2X51A 2XK0A 2DIGA 4C5IA 4CC3A 4N4HA 4A53A 1SRLA 4OMQA 4CI0C 3P8HA 4X34A 1UGRB 3HPWA 3OYGA 2YUNA 2KYMA 3CCMQ 2X9HA 1UGQB 3M0QA 2ED0A 1HD3A 2E5QA 4KGXB 1PG5B 2Y4XA 2OAUA 1RAFB 3I55A 5LJ3g 3A8OB 4RTYA 3KUFA 1TG0A 5D6XA 5HY6A 1JO8A 2RJEA 2O9SA 2M0YA 2CP6A 1PCXA 5FRMA 4R55A 3CCSA 3EG9B 2CH4W 4JJBA 5GAMj 3M0RA 2X4JA 2D8JA 3WVEB 1SF9A 4OMOA 2XD0A 1VQNA 2JN0A 2CSQA 2FZKB 3CCEQ 4PJJA 1S72T 2LTOA 2XDDA 4A4GA 4M7AB 2J6FA 1G83A 2CGHA 3E9FA 2RHZA 3NHNA 3LW5E 4A4HA 2X35A 2PUOB 2LJ3A 2KRSA 3CXCA 5EG2A 2RD1A 2DRMA 3L42A 3OMCA 2A37A 2QQAA 1PRLC 1VQLA 1BKBA 3REBB 4OB0B 3OYLA 2YUOA 2D9TA 2O31A 2EQMA 1FYNA 1R0BG 3OYAA 1Q82U 1NE8A 1QVFP 2RI3A 4Y91A 2DLPA 4OVAA 2JTFA 1UGVA 2KROA 2JNGA 2AT1B 1YJWT 4PLIA 3GP8A 3M58A 1R8OB 2E3IA 1QMCA 1BK2A 4N4IA 3EAEA 1VQKQ 2O9VA 1JEGA 1MMNA 2CZ6B 5FLXE 4LDWA 2GGRA 1ACMB 3GIBA 4HCBA 4PKCC 5KYNA 2A0FB 2QEXQ 1QCNA 2F2VA 3CCRA 1MV3A 2ED1A 4ZGDB 2O2OA 2PVGB 4ESRA 3M0PA 1BI2A 1UB4A 2DD5A 2RN8A 2YRVA 4F14A 1A0NB 3HRSA 1M2VB 1I0CA 2GTJA 4IUVA 4KGZB 5D6YA 4JPBW 2LNHB 2Y90A 4BI3A 4C92F 4J6YA 4OGCA 2DVJA 4R0KA 5GAMg 3OYEA 1PHTA 2H3EB 4RKUE 1M3AA 2KSSA 4M77G 1RI0A 5FU7B 1W6XA 3PIPA 3UATA 4C92E 5GMKe 1ABQA 2GBQA 4KUDK 3SHWA 3JB9F 2FO0A 3NPFA 4C8QF 4FCYA 2FZGB 5CVIA 5FW9A 2A7YA 2OI3A 4E2FB 2O88A 4PLLA 4F7UA 1YHQT 1QWEA 2LX7A 2VV5A 4KT0E 4O6JA 1YI2T 3ZBDA 2VASA 1VQ6A 4C8QE 2D6FA 2P4TA 4E7LA 3LGFA 3SWNA 1VQ5T 3WVDB 4F04B 3CCJA 3SEMA 4FT2A 1VA7A 1M90U 1SSHA 3MHXA 4M75C 2JS0A 1W2BS 2YXYA 1YJ9T 1K4US 5GMKm 2XDPA 4N0AA 3MEAA 5GAN5 3CD6T 2ZPHB 3M55A 2BUDA 2MF2A 1OULA 2BZ8A 2OTJT 4FW1A 1YJNA 2LVMA 3CBOA 2MYSA 2CT4A 1WI7A 4GY5A 1QVFA 2MAMA 4XU1A 1K73C 3SB2A 3OY9A 1AHJB 3J7AF 4C0DB 3IQLA 4WF2A 1OZ3A 2ZPEB 4OMMA 4MZMA 5CQXA 5EC7A 1ARKA 1YITT 3N5BB 2EIFA 2FPEA 4C92B 3CC2Q 1GL5A 4IUPA 2LP5A 2F5TX 2XIDA 5CKEA 2HQHA 4M7DC 3QIIA 3OYFA 4RTWA 1JXMA 4DEXA 1E6HA 4XTXA 3G6EA 4C5EA 2LRQA 3I56T 4JS5A 1B34A 1K76A 3TREA 3GPLA 1N6AA 4J9IA 1QVGP 4AMCA 4B9XA 1Q86R 2LT1A 2D1XA 5GANd 4C8QB 5A2QE 3VRZA 1KQSP 4BI8B 4RMOA 1NJIC 5GANe 4OMLA 3M4YA 3HFNA 1NEBA 2EGCA 1X75C 3RBBB 4CC4B 4PJNA 1G3YA 1S1NA 3OYCA 2E41A 3CPFA 4BE2A 1BIAA 2M16A 3H0IA 2DL4A 4LD6A 1YP5A 3HRUA 1ZSZB 4X1VA 2K5FA 1M3BA 3S3MA 1M90C 3QKJA 4LD9K 1OU8A 2SRCA 3OW2P 1AZGB 1MMGA 3SWNC 1I5OB 3HP9A 4XAXB 4A63B 1UE9A 4EMKB 1Z9ZA 2EYZA 3EGUA 5GAMf 2EQJA 5CAIA 1AWOA 1NBEB 2COWA 5IHKA 1G2BA 3JCMe 2X4XA 3L2VA 2GFAA 2K2MA 4ATOA 3G4SA 2FPDA 1X2KA 1QLYA 1WXTA 2CH4A 4C0ZA 5KYUB 1HYOA 5GANj 5HK3A 4J8OA 3OYMA 1AWJA 5KYWB 2HKNA 4EDUA 3CPWP 5C6SA 2JMAA 4A4KA 4DBRA 3X20B 2QQBA 3JCMc 5J26A 1M27C 3OQ5A 3OYDA 2F2XA 4BI4A 1WHGA 1FMKA 2O4XA 1RACB 1TOVA 1RI9A 2QDLA 1JBMA 3VYHB 3TQ7P 2DYBA 3JCMQ 3CCET 4PJOA 1TU0B 2AKKA 3HHTB 2QA4Q 2PVOB 3MJXA 3LH0A 2JS2A 2KGTA 1X27A 2KXCA 4DOWA 4J83A 2FHDA 5A0DA 3L2UA 1K8AU 2EFIA 2VXFA 4M78E 3JAME 1UJ0A 1KQSA 4X9DA 4FL6A 3MKDA 2RHYA 3JCMW 2OJ2A 2RHUA 3BE3A 3VS4A 2L3RA 5KYXA 2DAQA 5HCKA 1PD1A 4HXJA 1RADB 3MEWA 1TS9A 4FM4B 1H92A 2W10A 4XTWA 1UG1A 1VQ9A 2YSQA 5I22A 1PWTA 1W2BA 1VQOA 3OBWA 3G7ZA 4JS4A 4FSXA 1AZEA 4FYWB 4BY6B 3RNJA 2P0KA 3JCMX 1VQKT 1K9AA 3QWXX 3BY7A 2RF0A 3NMZC 5LJ5e 2K5IA 1WXUA 4R56A 3UT1A 4J9BA 3O5ZA 2FZCB 5GANg 3OW2A 2HBWA 5A0LA 3CC7A 2MWPA 2QEXT 3EFOB 3PIOA 1RAIB 3GNGA 4MMKA 2KNBB 1ZHIA 4D8DA 1D1AA 1RABB 1Y57A 5GAN6 4RTTA 2WSCE 1PSEA 3VRYA 3LGLA 3LX7A 4J9GA 4GLKA 5HK0A 2X4YA 1N8RC 2BZXA 2M0OA 3FEOA 2JUFA 4X9CA 3GF5A 5DLQE 1KSWA 2GF7A 4M78B 3V8JA 2WACA 1X01A 3CPWA 4FIBA 2E4HA 4F7UG 1WHJA 4KH1B 5KE2A 4M7AD 2HMAA 1M1GA 2D0QB 2DZCA 2NUTB 1H8KA 4QVZA 2PZ1A 4AFZC 1M4ZA 3X25B 3JCMg 1JQQA 2DTHA 2VC8A 5LJ5j 1UDLA 1Y96A 3NFCA 2RPNA 2AHJB 5GAN4 2DFUA 1UGSB 4DQ2A 3QWYA 3VUZA 1V1CA 5GAOl 4ELZC 1TUDA 1WZOA 2YDLA 3GLXA 5KCOA 2KRNA 2E10A 5D7UA 4D8KA 1XTDA 2QDYB 3O8VA 3VS1A 2DILA 3S3NA 3TU4K 4AFQC 4RG2A 4XTUA 2LQWA 2VXEA 5FU6B 2LT4A 5GAMd 5IH2A 2LQ8A 4HVUA 4Z8AA 3EH2A 4IIMA 4M77C 3H9NA 3URGA 2V26A 4J9FA 2QXFA 3EG9A 1MMAA 2H3JA 1EX4A 1Z9QA 4D6WA 2MOXA 2HL3A 2BIVA 4EPCA 1B7TA 3CC2T 2L3QA 3KFVA 2KT1A 2C06A 2QQSA 1DJ7B 4M7AA 4Z02A 2RQVA 2JM9A 1G3WA 2OAWA 1Q86C 1YIJT 1QKWA 1KHIA 2L0AA 2L5QA 4AG1C 3CCVQ 4A4FA 1MUZA 5FU6C 4QQ6A 2LDMA 1D09B 3C95A 2LCCA 4IUQA 3C94A 3I9QA 1I8FA 3UWNA 2ROLA 4MZTA 1WHHA 4ZTFA 3M56A 1Y7XA 2MWOA 4FYYB 2CP3A 2CUDA 5LJ5g 3EGXB 2XDBA 2CYZB 2IPOB 1CKBA 3L2ZA 2EJ9A 3CMEQ 4B9WA 1K9MC 3QDRB 2DPPB 3SDZA 4JLIA 5GANf 3OSSC 1S72A 3M4GA 1SHFA 4KBMB 2YRDA 4M75F 1B07A 2DXUA 5GMKi 1D0XA 2HBPA 2V8JA 3M59A 1OQKA 1VQ7Q 4QVDA 3FDRA 2QYZA 1XQHA 2DXBA 1WQ7A 5C0MA 3OYJA 2CT3A 4M75E 2A08A 1GRIA 5J39A 3M54A 1WXBA 4LNPA 3JCMb 3EG1A 1SRMA 1BU1A 4JUVA 2LNVA 2DX1A 2VUBA 2A3LA 9ATCB 4C92D 1ZA2B 3R6NA 3ZEHA 1YJWA 2KXDA 5GAOq 3DB4A 2YUPA 3JCMf 4F17A 1YN8A 3CMAQ 5LJ3h 4JZ4A 2I2LA 5HKCA 2K2VA 4LN2A 4ANJA 4M7DF 2FPFA 2JXBA 1KC8R 3OB9A 2E6NA 2K3BA 3VV0A 3E9GA 3ER0A 4PJOG 2AIRB 1VIEA 3JB9H 2QASA 4MMLA 3QSUA 1K73U 3OS2A 2CKKA 5I2SA 4M7DE 3X28B 4C8QD 3HRTA 3MP1A 2F5KA 5IN1A 2ZAEA 4IUTA 2ESWA 2J06A 2AK5A 2KI7A 4RTXA 2ZGWA 3RKWA 4GBQA 4NL2A 2QA4T 1ZLMA 3VS5A 4XTZA 2VGNA 2E3HA 2HKQB 1VQ4Q 2YWWA 3PT9A 4EIKA 3RDVA 5IXFA 1W1FA 5DLOA 1M3CA 2DERA 4XU0A 4M75B 3NTKA 2DD4A 1NEGA 4RCCA 3CC4Q 3OYYA 2E12A 1LPLA 2VWFA 3G71Q 3VS7A 5I21A 1OPLA 2YLBA 1NJIU 5DY9A 5I11A 3CCLQ 2COYA 1GBRA 4XU3A 1CSKA 1I5LA 3A8HB 3QO3A 3AT1B 1YHQA 4C92A 5LL6S 2E5KA 1YI2A 2RMOA 2W0ZA 2LQNA 2QTVA 2V8KA 4OB3B 4HVVA 1VQ5A 1OYXA 3EGDA 4JRIA 1AWWA 1OV3A 4OP0A 1VUBA 2DL5A 2J6KA 4OGEA 1WYXA 3MPUB 4M7DB 4II1A 4RTUA 1YJ9A 2DK3A 2DF6A 3CD6A 4ORZA 1NLPC 5LJ5f 2OTJA 4C8QA 2EVRA 3INZA 1WFWA 1VYTA 1W70A 2OTLQ 4JJCA 1WHMA 2RI5A 4BACA 1NZ9A 1KD1R 3CCQQ 3EFRA 2ECZA 2E65A 4RTVA 4RTZA 1X6OA 5GAMh 4WTOB 4JZ3A 2JTEA 5GMKj 4E7KA 3A8MB 5CO7A 2KYBA 3BDLA 1VQMQ 1YITA 1MV0B 1WA7A 1RLQC 4J7FA 2ZPGB 1Q81R 1NYFA 3VU3C 4PNOA 2GNCA 3UPUA 1X6BA 4FYXB 1ZSZA 3QJ6A 2BE9B 1C0MA 2X4WA 2MK5A 4JJDA 1YIJQ 3I56A 1UUEA 5KCHA 4E7JA 4IKFA 1OX9A 1M1KR 2LX9A 2DTIA 1CKAA 2EKOA 2A36A 1FMVA 2PVDB 4EMKA 2HQXA 3E19A 2ZPFB 3SWNB 8AT1B 2DL3A 1PC0A 1GFCA 3OBYA 2KY9A 2ZPIB 1U1SA 2ENMA 4QW2A 4LDXA 3PFSA 2J7IA 4KGVB 3M0SA 5KYUA 1LCKA 2QG9B 5KYWA 1X2QA 2CP2A 4PJOD 1U5SA 4HCZA 1ZUKA 2M02A 3I55Q 1T3LA 4AT1B 1W2BP 5KYYB 4PFOA 3OS0A 2PU9B 3X24B 2RO0A 5L23A 4M7AG 4N4GA 2EPDA 3L2WA 4ZNXA 3CCSQ 2Z0WA 2K6DA 1SG5A 1HXDA 2WSFE 3GNFB 1OZ2A 3VKIA 3JCMd 2DETA 1QKXA 2CZ7B 1VQNQ 1KQ2A 1JJ2S 3PVQA 5CKDA 1WDXA 2O01E 2ATCB 1MGQA 1D3BA 5GAOr 3QZ5B 3E2UA 4IUUA 3KBGA 4BE0A 2DNUA 2AKLA 2XI9A 4RG8A 1Y07A 1ZBJA 5GAN8 4N0AC 1IREB 2MPXC 3FRNA 3CCMA 5DM7R 4M78D 1D0ZA 3CCVT 2YLCA 2YHTA 1HJDA 2B8AA 2E64A 1VQLQ 3A8LB 1G5VA 2HQEA 1OX8A 2KE9A 2EW3A 2DKGA 2KT8A 1Y0MA 1FMWA 2VYTA 4J9DA 1BCMA 2KEAA 1O75A 2VKNA 4VUBA 1QCOA 4HKEA 2XG8D 1U8RA 4NOYA 1VQPT 2DBKA 3META 1N8RU 1EIFA 5IAYA 3L2RA 1HK9A 3CMET 4ZGJB 3QPHA 2LCSA 1Q7YR 1BIBA 1MHNA 2DMOA 4L59A 3CCEA 3QHSA 2P4RA 2GFUA 4O5VA 2DBMA 3QJYA 2RHXA 2P84A 1WGSA 2RQUA 1SHGA 4IIOA 4FSSA 2RJFA 2HSEB 1VQ7T 3EFOA 4PJLA 3CCRQ 1GCQA 2RQRA 2CZ1B 1ZUUA 2RI2A 3ASKA 1U1TA 2RJCA 1QP2A 1WHKA 5CR2A 1BB9A 1FX7A 4M77F 3S6WA 4HT9A 1NPPA 2DA9A 3TVTA 5IHIA 1ZSGA 2DZ9A 1WIEA 1ZX6A 1KC8C 1YWOA 2VVKA 2LMJA 2KRMA 1G8XA 4J9CA 4M4ZA 2K3YA 4M78A 5CIUA 4M77E 5LJ5d 2M9UA 3DLLA 3CMAT 4B6MA 4ZN1A 1BBZA 1VQKA 2RQWA 3P8DA 2EQUA 2NUTA 2QI2A 3CXCS 4HA8A 2JTMA 3JB9I 3CCUT 3JRZA 2QGGA 1M2OA 2IIMA 1BI3A 2O4XB 2QEXA 2DRKA 4LDYA 1NYGA 3EH1A 3RMQA 4P5NA 5IHNA 4MDWA 2JOYA 2RK1A 4MDXA 1UHCA 2MI6A 2M1HA 1VQ6Q 2GQVA 2E1HA 2RA2A 2QK0A 4XK8E 3KXTA 2D8HA 4CC2A 1AWXA 3CCJQ 2F1LA 1VQ4T 1P92A 2I0NA 4E7HA 2EAYA 4QVCA 1M5Q1 1Q82R 1Q86U 2EQKA 3HTRA 2HNIA 2HCKA 4Y92A 3BDUA 3P8BB 1QCFA 3QYHB 3T9NA 8ATCB 2LC4A 3EHQA 3EHRA 3J80E 3CC4T 4C92G 1YJNQ 1D0YA 3OYHA 1GXIE 3G71T 2FG0A 2CDTA 3V7RA 3OSVA 2AZVA 3CCLT 1XJWB 2RK2A 1TH7A 3UDCA 3ZFJA 4HT8A 4ZGEB 5KE3A 4L6V5 2DYIA 4M77B 2BTTA 1QP3A 1WQWA 1K73R 4PJOC 3JB9G 4XTYA 2R57A 2PQWA 1K9MU 1C6VX 2HD0A 4C8QG 3MEVA 1WJQA 3VS0A 3RKYA 3H41A 1TUGB 1QQJA 3G6EQ 5GANh 5AYFA 1AOJA 3DLMA 2GTOA 3QYGB 1GCPA 1ZA1B 1WLPB 1KD1C 3TSZA 6AT1B 2DL8A 2DXCA 1M1FA 2DTOA 5GAOn 1YCSB 2JMCA 2P0QA 3VS6A 2X3WD 2HSPA 1YBYA 2OTLT 2EGEA 3CCQT 4OMPA 3HL8A 2EKHA 2G3RA 2XHCA 3H8ZA 3EGXA 1Q81C 2J6OA 1T3SA 4ME7A 2P0PA 1VQ8T 2HL5C 1VQMT 4AFUC 3ME9A 1BI1A 4A54A 3CC2A 1WJSA 1KIKA 2R5AA 3HFOA 5J3BA 4C0GA 3JCMP 1M1KC 2CZ0B 3JCMh 1H3ZA 1TUCA 1KQ1A 4GLMA 2MCNA 2CUBA 2FVUA 4M75D 2YUQA 4DEYA 5GJVB 3H6ZA 4J5YA 1M90R 3UA7A 4FW2A 2F2WA 1ZUYA 5M9OA 4PFPA 4V2SA 2SEMA 1QVFS 3VS2A 4Z88A 3TEEA 1C1AA 3QG1A 3G4SQ 1IRXA 4DBHA 1H641 3HSBA 3MP8A 2NUPB 4HVWA 1VQPQ 2EYWA 3EFSA 3F70A 4EMHA 1Q95G 1PNJA 4E7ZA 2DEUA 1NM7A 4JRKA 1UGPB 2G6FX 3REAB 2HAXA 2EYQA 1U3OA 2RH2A 3I55T 3FIFA 2LJ1A 1UJYA 4M7DD 4LDUA 1UECA 1FWZA 2KMTA 3CCST 5CKFA 4A4EA 1VOMA 4JDSA 4AG2C 1T0JA 2K3XA 3PVLA 1IGQA 2RB6A 3CBPA 1VQNT 3FB9A 1M2VA 3BW1A 2IG0A 3L2QA 2K4YA 2MMPA 1LVKA 3QUIA 3FLGA 2EGAA 1TXQA 2FL7A 1QWFA 1VQLT 5IXBA 5GAOp 3VJPA 2ZCFB 5GAN3 1BCOA 2HEQA 1I81A 4M75A 2XICA 2LQKA 1O9SA 3CEYA 4F16A 2A28A 4NL3A 2XMFA 1JB0E 2H8HA 5LJ5h 4PJMA 3CCUQ 5L8RE 1UHFA 3EG2A 3JB9D 3UF4A
chains in the Genus database with same CATH topology
4J83A 2FHDA 1Q7YC 1M9SA 2K5LA 2LX9A 5A0DA 1VQ8A 4M7AF 2DTIA 3L2UA 1VQMA 2EKOA 5CK9A 2EWNA 4JRQA 1K8AU 4M7AC 2EFIA 2PVDB 2VXFA 4M78E 3A8GB 4EMKA 3JAME 3MEUA 4NS5A 4BDYA 4E7IA 3S3OA 1XOVA 1KQSA 2HQXA 4X9DA 2FYKA 4FL6A 4E47A 3E19A 2ZPFB 2RHYA 1YCYA 3JCMW 1IZ6A 2DVEA 3SWNB 4C5HA 2KDSA 2JZ2A 2QA4A 3OBYA 2KY9A 2RHUA 2ZPIB 4M7AE 1U1SA 1WJRA 1BYMA 2CS7A 5GAMe 2L3RA 3PGGA 1YIJA 3PMIA 4QW2A 4M7DA 4LDXA 2DAQA 3PFSA 2BKDN 3OMGA 3MEWA 3OS1A 1Y96B 4FM4B 4QQDA 3CCRT 1UEBA 3M9QA 4XTWA 5IT9E 1Q7YU 2E70A 1VQ9A 4OB1B 4M78G 1W2BA 1VQOA 3OBWA 3G7ZA 2XK0A 2DIGA 4C5IA 4FSXA 4HCZA 4JS4A 4PJOD 4BY6B 1W4SA 3JCMX 2P0KA 1VQKT 4N4HA 3BY7A 4A53A 1WPYA 4CI0C 3P8HA 3OS0A 4X34A 1UGRB 2PU9B 3HPWA 2K5IA 2RO0A 3X24B 5LJ5e 3OYGA 4M7AG 4F7UF 4N4GA 4R56A 3UT1A 3L2WA 3RERA 2KQWA 5GANg 3OW2A 1UGQB 5A0LA 3CC7A 2MWPA 1HXDA 2E5QA 2QEXT 4HCCA 2WSFE 3GNFB 3PIOA 3SFMA 3GNGA 1OZ2A 4MMKA 3VKIA 3JCMd 3PNWC 4JLGA 3RKXA 2CZ7B 1ZHIA 2KAFA 2Y4XA 1KQ2A 1JJ2S 2OAUA 4DA4A 2DXTA 4F7UE 5CKDA 2O01E 3I55A 5LJ3g 1MGQA 1D3BA 2F69A 1YJNT 3A8OB 3AHUA 5GAN6 5GAOr 3KUFA 4KULA 3QZ5B 2WSCE 3RMSA 1PSEA 4IUUA 3LGLA 3KBGA 5D6XA 5HY6A 1BI0A 2RJEA 4BE0A 3LX7A 2XI9A 5HK0A 4GLKA 4RG8A 1Y07A 1WNLA 3OA6A 2X4YA 5GAN8 4N0AC 1IREB 5FRMA 1N8RC 1QVGS 3FRNA 4R55A 3CCSA 3CCMA 5DM7R 4M78D 3MP6A 2M0OA 3CCVT 3J81E 1G3TA 2YLCA 2YHTA 2B8AA 3FEOA 2JUFA 4X9CA 2E64A 3GF5A 3A8LB 1KQSS 5DLQE 2GF7A 4M78B 5GAMj 2HQEA 2ZZDA 3V8JA 1G5VA 2X4JA 2WACA 1X01A 3WVEB 3CPWA 1N27A 2JVVA 4FIBA 4C0FA 1VQNA 2XD0A 4F7UG 5KE2A 4M7AD 1Q86C 2JN0A 2DKGA 1VQ6T 1S72T 1M1GA 2LTOA 2D0QB 2VYTA 2XDDA 1Q82C 2DZCA 4A4GA 3C4SA 4M7AB 4QVZA 5CCAA 1O75A 2CGHA 1LOJA 2RHZA 3E9FA 1M4ZA 3NTHA 4HKEA 4VUBA 1RL2A 3X25B 3JCMg 3LW5E 3M57A 2DTHA 2VC8A 4FU6A 2X35A 2PUOB 5LJ3f 2XG8D 4A4HA 5EG2A 1ZQ1A 5FU7C 2E6ZA 4NOYA 3CXCA 2RD1A 1U8RA 1VQPT 5I2MA 3META 1N8RU 1EIFA 3L42A 2QQAA 3OMCA 5LJ5j 3SD4A 1VQLA 1Y96A 5IAYA 3L2RA 1BKBA 1HK9A 3CMET 4ZGJB 3NFCA 3QPHA 4OB0B 2AHJB 5GAN4 3OYLA 3VYGA 1BIBA 1MHNA 1UGSB 4L59A 2D9TA 4TVRA 4DQ2A 3CCEA 5GAOm 3MCAB 3QHSA 2GFUA 4O5VA 3VUZA 5GAOl 4ELZC 2EQMA 3QJYA 2XKOC 3OYAA 3OW2S 2RHXA 1Q82U 3GLXA 5KCOA 1NE8A 4OMFB 3QZ9B 2E10A 1WGSA 2RI3A 4Y91A 1XTDA 2QDYB 1VIFA 3O8VA 3DB3A 4ZN3A 3S3NA 3TU4K 4OVAA 2JTFA 1LNXA 2JNGA 1VQ7T 2RJFA 3TCJA 1YJWT 4PLIA 3GP8A 3M58A 4LDVA 4RG2A 3LYIA 1R8OB 4XTUA 2CZ1B 4F7UB 2RI2A 3ASKA 2RHIA 1U1TA 2RJCA 3CCJT 2VXEA 1QP2A 3EAEA 2LT4A 1I4K1 4N4IA 4L5GA 5FU6B 5GAMd 5CR2A 3M5AA 1FX7A 2LQ8A 4M77F 3S6WA 2CZ6B 3M53A 5CKHA 5FLXE 4LDWA 4HT9A 2RJDA 1NPPA 4M77C 3G6ET 3GIBA 1Y71A 4ELYC 4HCBA 3URGA 4PKCC 5A0GA 2QXFA 2DZ9A 2QTXA 5D6WA 1KC8C 3CPWS 2H3JA 2KK4A 3CCRA 4M78A 2K3YA 4ZGDB 4D6WA 5CIUA 4M77E 2PVGB 2DO3A 5LJ5d 2M9UA 3DLLA 3CMAT 1BI2A 2BIVA 2EJGA 4EPCA 4ZN1A 3CC2T 1UB4A 2DD5A 1VQKA 2YRVA 3A5ZB 3HRSA 5GAN7 1KHCA 3P8DA 2C06A 2EQUA 2QQSA 1DJ7B 2ZPBB 2IVWA 2QI2A 3CXCS 4C0DC 4HA8A 4M7AA 1M8VA 4IUVA 4Z02A 2JTMA 5D6YA 1G3WA 3JB9I 2Y90A 3CCUT 3JRZA 4BI3A 4J6YA 4C92F 4OGCA 3LWIA 1KHIA 4PL6A 1YIJT 1BI3A 2L5QA 2O4XB 4C92C 4A4FA 5GAMg 3OYEA 2QEXA 4RKUE 4LDYA 5FU6C 3RMQA 4QQ6A 2KSSA 4P5NA 1KC8U 4M77G 2L8DA 1RI0A 2LDMA 2JOYA 4MDWA 2RK1A 4QQGA 3C95A 5FU7B 4BE1A 2LCCA 4IUQA 3C94A 3PIPA 4BDZA 1I8FA 3UWNA 4BUGA 4MDXA 4MZTA 2MI6A 2M1HA 4C92E 5GMKe 2DJZA 4ZTFA 3M56A 4KUDK 2GQVA 1Y7XA 3JB9F 2E1HA 2MWOA 2RA2A 4XK8E 3KXTA 1N9SA 2PUKB 4C8QF 5LJ5g 3WXMB 1VQ4T 1P92A 4E7HA 2EAYA 1B34B 1LJOA 4QVCA 4MZPA 3CCVA 1M5Q1 2CYZB 4C8QC 1Q86U 2XDBA 4Q5WA 2EQKA 3L2ZA 2QQ9A 5CVIA 2EJ9A 2RM4A 2A7YA 2HNIA 3BDUA 3P8BB 4B9WA 4YTLA 1K9MC 3QDRB 4PLLA 2DPPB 4F7UA 1XNIA 3QYHB 3T9NA 4BD3A 3SDZA 2LC4A 1YHQT 4JLIA 5GANf 2VV5A 4KT0E 4O6JA 1YI2T 3J80E 5GAN2 3ZBDA 3CC4T 4OB2B 4C92G 1VQ6A 3OSSC 4C8QE 2P4TA 1S72A 2D6FA 4E7LA 3M4GA 3LGFA 3SWNA 1VQ5T 3OYHA 3WVDB 3OYBA 1GXIE 3HKSA 4IURA 4J6WA 3G71T 1FXXA 3RUXA 4KBMB 3V7RA 3OSVA 3G4ST 4M75F 3CCJA 4FT2A 2DXUA 4M77D 5GMKi 3CCLT 3CCMT 2RK2A 1VQPA 1TH7A 1M90U 2HBPA 2V8JA 3CBMA 3M59A 3MHXA 4M75C 3UDCA 3ZFJA 4CRIA 2XU8A 4ZGEB 4HT8A 4QVDA 4L6V5 2LCLA 4PJOF 5KE3A 1W2BS 3FDRA 1YJ9T 4M77B 2GCXA 1QP3A 1WQWA 2XDPA 4N0AA 5GMKm 3MEAA 5GAN5 3CMEA 3CD6T 4PJOC 1XQHA 2ZPHB 3M55A 2BUDA 3JB9G 4XTYA 2DXBA 2MF2A 2R57A 2PQWA 2OTJT 1WQ7A 5C0MA 1K9MU 3OYJA 2HD0A 1QVPA 4C8QG 1YJNA 4M75E 2LVMA 3MEVA 3NTIA 5J39A 3M54A 1WJQA 3CBOA 3RKYA 4GY5A 3JCMb 5CQYA 1QVFA 4PJOE 2MAMA 4XU1A 1K73C 5GANh 4JUVA 3SB2A 2LNVA 3OY9A 1AHJB 3J7AF 5AYFA 1NPRA 2VUBA 4EMKC 4C0DB 3V7CA 1K73U 2A3LA 4WF2A 1OZ3A 3DLMA 3QYGB 3V8LA 1VQ7A 2ZPEB 2DEQA 2V8IA 4MZMA 5CQXA 4C92D 3X26B 3ZEHA 1YJWA 5GAOq 3DB4A 1YITT 1KD1C 3JCMf 3N5BB 2DXCA 1M1FA 2DTOA 4JJNK 2EJFA 5GAOn 4J7IA 2EIFA 5LJ3h 2I2LA 4C92B 5HKCA 2K2VA 4M7DF 4M75G 1D3BB 2P0QA 1G3SA 4FT4A 4IUPA 2XIDA 2F5TX 3OB9A 5CKEA 1YBYA 2E6NA 4EMGA 1OI1A 2OTLT 3QIIA 5GMKh 4M7DC 4M78F 3VV0A 3E9GA 3ER0A 3OYFA 4PJOG 4J6XA 3CCQT 2R58A 1VIEA 3JB9H 4XTXA 3G6EA 3HL8A 4XU2A 4C5EA 3PTAA 3Q1JA 3FJPA 4MMLA 3JCMV 3QSUA 1Q81C 2G3RA 2LRQA 2XHCA 3H8ZA 1B34A 3OS2A 2CKKA 3I56T 2K57A 5I2SA 4JS5A 3OYIA 4ME7A 3TREA 4M7DE 3X28B 3GPLA 1N6AA 1QVGA 2P0PA 4C8QD 1VQ8T 3HRTA 3MP1A 1VQMT 4UC4A 2F5KA 2R5MA 5FROA 4B9XA 3VUBA 2LT1A 3ME9A 5IN1A 2FB7A 1BI1A 4A54A 5GANd 3CMAA 4C8QB 1KD1U 3CC2A 1WJSA 4IUTA 5A2QE 4BI8B 2R5AA 3HFOA 5J3BA 3L1AA 4C0GA 3JCMP 1M1KC 2ZGWA 3RKWA 4RMOA 2CZ0B 3JCMh 1NJIC 4NL2A 2QA4T 1H3ZA 3RIRA 5GANe 2NLUA 4ZTJA 5CKBA 1KQ1A 4XTZA 2VGNA 3CCUA 3M4YA 5LJ3d 3PT9A 3HFNA 4OF1A 5KH6A 2WSEE 3GOXA 2FVUA 1X75C 4M7DG 4M75D 1Q81U 1G3YA 4M77A 3QXEB 5DLOA 2KVQG 3H6ZA 3OYCA 4J5YA 2E41A 1VQ9T 3CPFA 4BE2A 5LJ3e 4XU0A 5M9OA 4M75B 1BIAA 2DD4A 3NTKA 1VQOT 4RCCA 2M16A 1KG1A 4V2SA 3OYYA 1QVFS 2E12A 1SSFA 4JRPA 4LD6A 1QW1A 3JCMJ 3HRUA 4PJOB 3TEEA 3QBYA 5FRNA 1PSFA 2K5FA 5I21A 3QG1A 3S3MA 1M1KU 2YLBA 3LLRA 1H641 1NJIU 5DY9A 1M90C 3MP8A 1VQ4A 3HSBA 3QKJA 4LD9K 4XU3A 3CC7T 1I5LA 4BB7A 3EFSA 3F70A 4EMHA 3SWNC 4XTVA 3DKMA 3HP9A 4XAXB 5KCHA 3A8HB 3QO3A 4JRKA 1YHQA 4EMKB 1UGPB 4C92A 5LL6S 2HAXA 2EYQA 1YI2A 3CC4A 5GAMf 2EQJA 2RH2A 5CAIA 3I55T 2Y4YA 2V8KA 4OB3B 3FIFA 3V8KA 1VQ5A 1OYXA 4JRIA 3JCMe 4M7DD 2X4XA 3G71A 3L2VA 2GFAA 4LDUA 4ATOA 4OP0A 1VUBA 4DOVA 3G4SA 3JSCA 1FWZA 2VGMA 4OGEA 3CCLA 2KMTA 1N9RA 4RCBA 3CCST 3FC3A 3RESA 4M7DB 5CKFA 4A4EA 4C0ZA 1JRIA 4II1A 4BY6C 5GANj 1YJ9A 1V29B 5HK3A 4JDSA 2DK3A 3MO8A 3CD6A 4J8OA 3OYMA 3C12A 5LJ5f 2K3XA 2OTJA 5GMKl 2RB6A 3CBPA 4C8QA 1ZBXA 4EDUA 3E1SA 1VQNT 3INZA 5C6SA 4A4KA 3X20B 2QQBA 3FB9A 3JCMc 4XQ3A 5J26A 2RI5A 3BW1A 2IG0A 2L89A 3OQ5A 4BACA 3OYDA 1NZ9A 5LJ3j 3L2QA 2K4YA 3EFRA 4Y28E 2MMPA 4BI4A 2E65A 3QUIA 3FLGA 3R6OA 2QQRA 1X6OA 2DIQA 5GAMh 5GMKj 3LWHA 2FL7A 4KUIA 2O4XA 3OYKA 4E7KA 3A8MB 1K8AC 5CO7A 3BDLA 3OS5A 1VQLT 5GAOp 1YITA 3VJPA 2ZCFB 5GAN3 1JBMA 4J7FA 3PMTA 1I81A 4M75A 2ZPGB 3VYHB 3JB9J 2XICA 2LQKA 3VU3C 4PNOA 1O9SA 3CEYA 3JCMQ 3CCET 3V7SA 3UPUA 2OTLA 3OYNA 4C5GA 4PJOA 3HHTB 4NL3A 1JJ2A 3QJ6A 1JB0E 3CCQA 5LJ5h 2X4WA 2PVOB 3BFMA 3LH0A 4M78C 5L8RE 3I56A 4DOWA 4E7JA 4IKFA 3JB9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M5Q 1;  4C8Q C;  4M7D G;  1LJO A;  3L2Z A;  5LJ5 j;  4M75 D;  2EJ9 A;  2RM4 A;  4M7A F;  2HNI A;  1Y96 A;  4M77 A;  2DTI A;  1HK9 A;  3BDU A;  4J5Y A;  2E41 A;  2EWN A;  4F7U A;  4M7A C;  2VXF A;  4EMK A;  4M78 E;  4XU0 A;  5LJ3 e;  4M75 B;  1BIA A;  4JLI A;  5GAN f;  5GAN 4;  4RCC A;  4X9D A;  5GAN 2;  2FYK A;  4C92 G;  4V2S A;  1BIB A;  4C8Q E;  4DQ2 A;  1YCY A;  3JCM W;  5GAO m;  3QHS A;  2DVE A;  3M4G A;  3SWN B;  3SWN A;  4PJO B;  3JCM J;  5GAO l;  4J6W A;  5I21 A;  3RUX A;  4M7A E;  1U1S A;  3V7R A;  2YLB A;  1H64 1;  4M75 F;  2E10 A;  5GAM e;  5DY9 A;  3HSB A;  3PGG A;  2DXU A;  4M77 D;  4Y91 A;  5GMK i;  4M7D A;  1TH7 A;  4M75 C;  4HT8 A;  4XU3 A;  1LNX A;  1I5L A;  4QVD A;  4PJO F;  3EFS A;  1Y96 B;  4M77 B;  1WQW A;  3SWN C;  4N0A A;  4EMH A;  4XTW A;  4XTV A;  5GMK m;  5GAN 5;  4PJO C;  4XTU A;  4M78 G;  3QO3 A;  4XTY A;  4F7U B;  3JB9 G;  4JRK A;  4EMK B;  4C92 A;  1WQ7 A;  1U1T A;  2VXE A;  4PJO D;  5GAM f;  5CAI A;  4C8Q G;  1I4K 1;  4M75 E;  3JCM X;  5GAM d;  3FIF A;  3BY7 A;  3V8K A;  4A53 A;  1WPY A;  4JRI A;  4M77 F;  3RKY A;  3JCM e;  3JCM b;  4M7D D;  5LJ5 e;  5GAN 8;  4M7A G;  4PJO E;  4OP0 A;  4HT9 A;  4XU1 A;  4F7U F;  4M77 C;  5GAN h;  3GIB A;  4JUV A;  3SB2 A;  3RER A;  4RCB A;  1N9R A;  5GAN g;  4M7D B;  3RES A;  2DZ9 A;  4EMK C;  3V7C A;  2QTX A;  4WF2 A;  1JRI A;  3V8L A;  1HXD A;  2DEQ A;  4C92 D;  5GAN j;  4M78 A;  5GAO q;  4MMK A;  3JCM f;  3JCM d;  4M77 E;  2DTO A;  5LJ5 f;  2EJF A;  5LJ5 d;  5GAO n;  5GMK l;  3RKX A;  2RB6 A;  5LJ3 h;  2I2L A;  4C8Q A;  4C92 B;  2EJG A;  1KQ2 A;  3INZ A;  2DXT A;  4F7U E;  4M75 G;  4M7D F;  1D3B B;  5LJ3 g;  1MGQ A;  1D3B A;  3FB9 A;  3JCM c;  4XQ3 A;  5GAN 7;  3AHU A;  4EMG A;  5GAN 6;  5GAO r;  3BW1 A;  4M7D C;  5GMK h;  4M78 F;  4HA8 A;  4M7A A;  1M8V A;  5LJ3 j;  4PJO G;  4J6X A;  3EFR A;  3JB9 I;  3JB9 H;  1WNL A;  4XTX A;  2Y90 A;  2E65 A;  3QUI A;  4N0A C;  4XU2 A;  4C92 F;  4J6Y A;  5GAM h;  3FJP A;  4MML A;  3JCM V;  3QSU A;  5GMK j;  4M78 D;  1B34 A;  2K57 A;  4C92 C;  2YLC A;  5GAM g;  2YHT A;  4M7D E;  4X9C A;  4C8Q D;  2E64 A;  5GAO p;  5GAM j;  4M78 B;  3V8J A;  4M77 G;  5GAN 3;  1X01 A;  1JBM A;  1I81 A;  2FB7 A;  4M75 A;  4A54 A;  5GAN d;  4F7U G;  3JB9 J;  4C8Q B;  4M7A D;  2JN0 A;  1I8F A;  2DKG A;  4PNO A;  3VU3 C;  4C92 E;  5GMK e;  3JCM Q;  3V7S A;  2DJZ A;  3HFO A;  2DZC A;  3L1A A;  4PJO A;  3JCM P;  4M7A B;  2ZGW A;  3RKW A;  4NL3 A;  3JCM h;  2E1H A;  4NL2 A;  3JB9 F;  2CGH A;  2RA2 A;  1LOJ A;  3RIR A;  3BFM A;  5GAN e;  5LJ5 h;  1KQ1 A;  4XTZ A;  1N9S A;  3JCM g;  4M78 C;  2DTH A;  2VC8 A;  5LJ3 f;  4C8Q F;  5LJ3 d;  5LJ5 g;  3HFN A;  4NOY A;  2EAY A;  2RD1 A;  1B34 B;  4QVC A;  3JB9 D; 
#chains in the Genus database with same CATH topology
 1R0C B;  1Q7Y C;  1M9S A;  2K5L A;  1K1Z A;  2DJQ A;  1SPK A;  1VQ9 Q;  1N5Z A;  2EWN A;  4M7A C;  1VQO Q;  4BDY A;  3A8G B;  4QT7 A;  4NS5 A;  4E7I A;  3S3O A;  1XOV A;  1T0H A;  2FYK A;  4E47 A;  1PD0 A;  4LUE A;  2DVE A;  2GQI A;  2JZ2 A;  2QA4 A;  1F1B B;  1SEM A;  4J9H A;  2CS7 A;  1BYM A;  2K9G A;  3PGG A;  3PMI A;  4M7D A;  2L3P A;  3CC7 Q;  3OMG A;  3OS1 A;  4QQD A;  3CCR T;  1UEB A;  3M9Q A;  2KBT A;  3PE0 A;  1PRM C;  4M78 G;  4OB1 B;  2YRC A;  1IHW A;  1W4S A;  2NUZ A;  2NYS A;  1WPY A;  2BZY A;  3C0C A;  2K7A A;  2PNI A;  4F7U F;  3RER A;  2KQW A;  1MNE A;  1MND A;  4HCC A;  1AT1 B;  3SFM A;  1N8R R;  1TWB A;  3PNW C;  4JLG A;  3RKX A;  2KAF A;  4WCI A;  4DA4 A;  2DXT A;  4F7U E;  1NG2 A;  2F69 A;  3AHU A;  4KUL A;  3RMS A;  3H0H A;  1BI0 A;  2JT4 A;  5FWB A;  1YWP A;  1WNL A;  3OA6 A;  2KR3 A;  1QVG S;  3MP6 A;  3J81 E;  1G3T A;  2C0O A;  1OOT A;  1PKS A;  1KQS S;  1RUW A;  2ZZD A;  5GJW B;  1N27 A;  2JVV A;  4C0F A;  1M30 A;  1GBQ A;  1VQ6 T;  1K8A R;  1Q82 C;  1AVZ C;  1WX6 A;  5FWC A;  3C4S A;  5CCA A;  1LOJ A;  3NTH A;  2HZY A;  1RL2 A;  3M57 A;  4FU6 A;  4BE1 A;  5LJ3 f;  3CCJ T;  1B3Q A;  1YNZ A;  1ZQ1 A;  5FU7 C;  2E6Z A;  2CSI A;  5I2M A;  1TTH B;  3SD4 A;  1VQ8 Q;  1D1C A;  2JJ9 A;  3THK A;  1IXD A;  3VYG A;  1YJN T;  4TVR A;  5GAO m;  3MCA B;  5KYY A;  4KH0 B;  3OW2 S;  2XKO C;  3H0F A;  1UFF A;  4OMF B;  3QZ9 B;  1RAG B;  4ZN3 A;  1VIF A;  3DB3 A;  4LUD A;  1PKT A;  1LNX A;  1KK7 A;  1M8M A;  3TCJ A;  4LDV A;  2JW4 A;  3LYI A;  2FRY A;  1IB8 A;  4F7U B;  2BE7 D;  1UTI A;  2RHI A;  2C0T A;  1I4K 1;  7AT1 B;  4L5G A;  3M5A A;  3EGD B;  3M53 A;  5CKH A;  3LH5 A;  1JU5 C;  3ZL7 C;  2RJD A;  3G6E T;  2JM8 A;  2K79 A;  1Y71 A;  4OMN A;  1PM3 A;  4ELY C;  1IHV A;  5A0G A;  2QTX A;  3NGP A;  5D6W A;  3CPW S;  1E6G A;  2KK4 A;  2EYX A;  2CP7 A;  1OU9 A;  2C0I A;  2DO3 A;  2EJG A;  4E6R A;  1RAH B;  3A5Z B;  5GAN 7;  1KHC A;  2AZS A;  2ZPB B;  2IVW A;  4C0D C;  1M8V A;  3LWI A;  4PL6 A;  4C92 C;  1KC8 U;  2L8D A;  4QQG A;  4DBF A;  1OEB A;  2CP0 A;  4BDZ A;  4BUG A;  1S72 Q;  2DJZ A;  1K9M R;  1N9S A;  2PUK B;  3WXM B;  1LJO A;  1B34 B;  3CCV A;  4MZP A;  4Z89 A;  2L3S A;  4C8Q C;  4HCK A;  4Q5W A;  2QQ9 A;  2RM4 A;  4K11 A;  3TSW A;  2CRE A;  4YTL A;  4E7S A;  1XNI A;  4BD3 A;  1RAA B;  5GAN 2;  4OB2 B;  4PK4 A;  4DBQ A;  3JV3 A;  3OYB A;  3HKS A;  4IUR A;  4J6W A;  1FXX A;  1VYV A;  3RUX A;  1R77 A;  3G4S T;  3CCM T;  4M77 D;  1VQP A;  3CBM A;  4CRI A;  2XU8 A;  4PJO F;  2FRW A;  2LCL A;  1YJW Q;  2GCX A;  2RNA A;  3CME A;  2DM1 A;  3M0T A;  3UA6 A;  1K0X A;  1ZSZ C;  1QVP A;  2QAZ A;  3NTI A;  1MMD A;  1IGU A;  1VYU A;  1GFD A;  5CQY A;  4PJO E;  2M51 A;  1SKU B;  2VB6 A;  2FEI A;  1NPR A;  4EMK C;  1EFN A;  3V7C A;  2X3X D;  3V8L A;  1VQ7 A;  2DEQ A;  2V8I A;  3X26 B;  1EZZ B;  2ROT A;  4JJN K;  2EJF A;  4J7I A;  4M75 G;  1D3B B;  1G3S A;  4FT4 A;  4FYV B;  4EMG A;  1OI1 A;  2MIO A;  3G1J A;  5GMK h;  4M78 F;  2LJ0 A;  3M0U A;  1ABO A;  4J6X A;  2R58 A;  1JJ2 P;  4XU2 A;  3PTA A;  1IO6 A;  3Q1J A;  3FJP A;  3JCM V;  2K57 A;  3OYI A;  4KRT A;  1QVG A;  4LE9 A;  4UC4 A;  1KFZ A;  2R5M A;  2B86 A;  5FRO A;  3VUB A;  2FB7 A;  3CMA A;  1YFN A;  1KD1 U;  1V76 A;  3GBQ A;  3L1A A;  3RIR A;  4ZTJ A;  2NLU A;  3VS3 A;  5CKB A;  3CCU A;  1I1J A;  5LJ3 d;  5KH6 A;  4OF1 A;  2WSE E;  3GOX A;  4M7D G;  1Q81 U;  4M77 A;  1K0S A;  3QXE B;  2KVQ G;  1AEY A;  1VQ9 T;  5LJ3 e;  1YHQ Q;  1VQO T;  1YI2 Q;  1KG1 A;  4PFZ A;  2ABL A;  1SSF A;  1VQ5 Q;  3I35 A;  1D1B A;  4JRP A;  1QW1 A;  3JCM J;  4PJO B;  3QBY A;  5FRN A;  2NWM A;  1PSF A;  1M1K U;  3LLR A;  2DE0 X;  1VQ4 A;  3RR6 A;  1RLP C;  1NLO C;  3CC7 T;  4BB7 A;  1AD5 A;  1J3T A;  1YJ9 Q;  5ECA A;  4XTV A;  3CD6 Q;  3DKM A;  2OTJ Q;  3ULR B;  1X6G A;  3CC4 A;  3QDF A;  2Y4Y A;  3I5S A;  3V8K A;  3CQT A;  3G71 A;  4J9E A;  3FJ5 A;  1U06 A;  4DOV A;  1WHL A;  3JSC A;  2VGM A;  3CCL A;  4RCB A;  1N9R A;  5KYX B;  3FC3 A;  3RES A;  2V1R A;  1JRI A;  4BY6 C;  3EG3 A;  1V29 B;  3MO8 A;  1YIT Q;  3C12 A;  2J05 A;  5GMK l;  3A1P A;  3EG0 A;  1ZBX A;  2CP5 A;  3E1S A;  2EQI A;  4XQ3 A;  1OPK A;  1X43 A;  2L89 A;  1KJW A;  5LJ3 j;  4QKU A;  4Y28 E;  2DL7 A;  1GCQ C;  3R6O A;  2QQR A;  2DIQ A;  3I56 Q;  2RQT A;  3LWH A;  4KUI A;  3OYK A;  2COZ A;  2HDA A;  2D0N A;  3CXC P;  1TSF A;  1H3H A;  1K8A C;  3OS5 A;  4CC7 A;  5AT1 B;  3PMT A;  3JB9 J;  2L2P A;  2V1Q A;  2EYY A;  3V7S A;  2OTL A;  3OYN A;  1HSQ A;  4C5G A;  1JJ2 A;  3CCQ A;  3BFM A;  4M78 C;  2NUP A;  3I5R A;  1RAE B;  3A98 A;  2EBP A;  1VQ8 A;  1NJI R;  4M7A F;  4AFS C;  1VQM A;  5CK9 A;  4JRQ A;  2PTK A;  3MEU A;  2LZ6 B;  1YCY A;  1IZ6 A;  1E7O A;  4C5H A;  2KDS A;  2QGF B;  4RUG A;  2OX7 A;  4LXC A;  4M7A E;  1WJR A;  1X69 A;  5GAM e;  1YIJ A;  2BKD N;  2YT6 A;  3D7S B;  1JXO A;  1Y96 B;  5IT9 E;  1Q7Y U;  2E70 A;  1I07 A;  3U23 A;  2X51 A;  2XK0 A;  2DIG A;  4C5I A;  4CC3 A;  4N4H A;  4A53 A;  1SRL A;  4OMQ A;  4CI0 C;  3P8H A;  4X34 A;  1UGR B;  3HPW A;  3OYG A;  2YUN A;  2KYM A;  3CCM Q;  2X9H A;  1UGQ B;  3M0Q A;  2ED0 A;  1HD3 A;  2E5Q A;  4KGX B;  1PG5 B;  2Y4X A;  2OAU A;  1RAF B;  3I55 A;  5LJ3 g;  3A8O B;  4RTY A;  3KUF A;  1TG0 A;  5D6X A;  5HY6 A;  1JO8 A;  2RJE A;  2O9S A;  2M0Y A;  2CP6 A;  1PCX A;  5FRM A;  4R55 A;  3CCS A;  3EG9 B;  2CH4 W;  4JJB A;  5GAM j;  3M0R A;  2X4J A;  2D8J A;  3WVE B;  1SF9 A;  4OMO A;  2XD0 A;  1VQN A;  2JN0 A;  2CSQ A;  2FZK B;  3CCE Q;  4PJJ A;  1S72 T;  2LTO A;  2XDD A;  4A4G A;  4M7A B;  2J6F A;  1G83 A;  2CGH A;  3E9F A;  2RHZ A;  3NHN A;  3LW5 E;  4A4H A;  2X35 A;  2PUO B;  2LJ3 A;  2KRS A;  3CXC A;  5EG2 A;  2RD1 A;  2DRM A;  3L42 A;  3OMC A;  2A37 A;  2QQA A;  1PRL C;  1VQL A;  1BKB A;  3REB B;  4OB0 B;  3OYL A;  2YUO A;  2D9T A;  2O31 A;  2EQM A;  1FYN A;  1R0B G;  3OYA A;  1Q82 U;  1NE8 A;  1QVF P;  2RI3 A;  4Y91 A;  2DLP A;  4OVA A;  2JTF A;  1UGV A;  2KRO A;  2JNG A;  2AT1 B;  1YJW T;  4PLI A;  3GP8 A;  3M58 A;  1R8O B;  2E3I A;  1QMC A;  1BK2 A;  4N4I A;  3EAE A;  1VQK Q;  2O9V A;  1JEG A;  1MMN A;  2CZ6 B;  5FLX E;  4LDW A;  2GGR A;  1ACM B;  3GIB A;  4HCB A;  4PKC C;  5KYN A;  2A0F B;  2QEX Q;  1QCN A;  2F2V A;  3CCR A;  1MV3 A;  2ED1 A;  4ZGD B;  2O2O A;  2PVG B;  4ESR A;  3M0P A;  1BI2 A;  1UB4 A;  2DD5 A;  2RN8 A;  2YRV A;  4F14 A;  1A0N B;  3HRS A;  1M2V B;  1I0C A;  2GTJ A;  4IUV A;  4KGZ B;  5D6Y A;  4JPB W;  2LNH B;  2Y90 A;  4BI3 A;  4C92 F;  4J6Y A;  4OGC A;  2DVJ A;  4R0K A;  5GAM g;  3OYE A;  1PHT A;  2H3E B;  4RKU E;  1M3A A;  2KSS A;  4M77 G;  1RI0 A;  5FU7 B;  1W6X A;  3PIP A;  3UAT A;  4C92 E;  5GMK e;  1ABQ A;  2GBQ A;  4KUD K;  3SHW A;  3JB9 F;  2FO0 A;  3NPF A;  4C8Q F;  4FCY A;  2FZG B;  5CVI A;  5FW9 A;  2A7Y A;  2OI3 A;  4E2F B;  2O88 A;  4PLL A;  4F7U A;  1YHQ T;  1QWE A;  2LX7 A;  2VV5 A;  4KT0 E;  4O6J A;  1YI2 T;  3ZBD A;  2VAS A;  1VQ6 A;  4C8Q E;  2D6F A;  2P4T A;  4E7L A;  3LGF A;  3SWN A;  1VQ5 T;  3WVD B;  4F04 B;  3CCJ A;  3SEM A;  4FT2 A;  1VA7 A;  1M90 U;  1SSH A;  3MHX A;  4M75 C;  2JS0 A;  1W2B S;  2YXY A;  1YJ9 T;  1K4U S;  5GMK m;  2XDP A;  4N0A A;  3MEA A;  5GAN 5;  3CD6 T;  2ZPH B;  3M55 A;  2BUD A;  2MF2 A;  1OUL A;  2BZ8 A;  2OTJ T;  4FW1 A;  1YJN A;  2LVM A;  3CBO A;  2MYS A;  2CT4 A;  1WI7 A;  4GY5 A;  1QVF A;  2MAM A;  4XU1 A;  1K73 C;  3SB2 A;  3OY9 A;  1AHJ B;  3J7A F;  4C0D B;  3IQL A;  4WF2 A;  1OZ3 A;  2ZPE B;  4OMM A;  4MZM A;  5CQX A;  5EC7 A;  1ARK A;  1YIT T;  3N5B B;  2EIF A;  2FPE A;  4C92 B;  3CC2 Q;  1GL5 A;  4IUP A;  2LP5 A;  2F5T X;  2XID A;  5CKE A;  2HQH A;  4M7D C;  3QII A;  3OYF A;  4RTW A;  1JXM A;  4DEX A;  1E6H A;  4XTX A;  3G6E A;  4C5E A;  2LRQ A;  3I56 T;  4JS5 A;  1B34 A;  1K76 A;  3TRE A;  3GPL A;  1N6A A;  4J9I A;  1QVG P;  4AMC A;  4B9X A;  1Q86 R;  2LT1 A;  2D1X A;  5GAN d;  4C8Q B;  5A2Q E;  3VRZ A;  1KQS P;  4BI8 B;  4RMO A;  1NJI C;  5GAN e;  4OML A;  3M4Y A;  3HFN A;  1NEB A;  2EGC A;  1X75 C;  3RBB B;  4CC4 B;  4PJN A;  1G3Y A;  1S1N A;  3OYC A;  2E41 A;  3CPF A;  4BE2 A;  1BIA A;  2M16 A;  3H0I A;  2DL4 A;  4LD6 A;  1YP5 A;  3HRU A;  1ZSZ B;  4X1V A;  2K5F A;  1M3B A;  3S3M A;  1M90 C;  3QKJ A;  4LD9 K;  1OU8 A;  2SRC A;  3OW2 P;  1AZG B;  1MMG A;  3SWN C;  1I5O B;  3HP9 A;  4XAX B;  4A63 B;  1UE9 A;  4EMK B;  1Z9Z A;  2EYZ A;  3EGU A;  5GAM f;  2EQJ A;  5CAI A;  1AWO A;  1NBE B;  2COW A;  5IHK A;  1G2B A;  3JCM e;  2X4X A;  3L2V A;  2GFA A;  2K2M A;  4ATO A;  3G4S A;  2FPD A;  1X2K A;  1QLY A;  1WXT A;  2CH4 A;  4C0Z A;  5KYU B;  1HYO A;  5GAN j;  5HK3 A;  4J8O A;  3OYM A;  1AWJ A;  5KYW B;  2HKN A;  4EDU A;  3CPW P;  5C6S A;  2JMA A;  4A4K A;  4DBR A;  3X20 B;  2QQB A;  3JCM c;  5J26 A;  1M27 C;  3OQ5 A;  3OYD A;  2F2X A;  4BI4 A;  1WHG A;  1FMK A;  2O4X A;  1RAC B;  1TOV A;  1RI9 A;  2QDL A;  1JBM A;  3VYH B;  3TQ7 P;  2DYB A;  3JCM Q;  3CCE T;  4PJO A;  1TU0 B;  2AKK A;  3HHT B;  2QA4 Q;  2PVO B;  3MJX A;  3LH0 A;  2JS2 A;  2KGT A;  1X27 A;  2KXC A;  4DOW A;  4J83 A;  2FHD A;  5A0D A;  3L2U A;  1K8A U;  2EFI A;  2VXF A;  4M78 E;  3JAM E;  1UJ0 A;  1KQS A;  4X9D A;  4FL6 A;  3MKD A;  2RHY A;  3JCM W;  2OJ2 A;  2RHU A;  3BE3 A;  3VS4 A;  2L3R A;  5KYX A;  2DAQ A;  5HCK A;  1PD1 A;  4HXJ A;  1RAD B;  3MEW A;  1TS9 A;  4FM4 B;  1H92 A;  2W10 A;  4XTW A;  1UG1 A;  1VQ9 A;  2YSQ A;  5I22 A;  1PWT A;  1W2B A;  1VQO A;  3OBW A;  3G7Z A;  4JS4 A;  4FSX A;  1AZE A;  4FYW B;  4BY6 B;  3RNJ A;  2P0K A;  3JCM X;  1VQK T;  1K9A A;  3QWX X;  3BY7 A;  2RF0 A;  3NMZ C;  5LJ5 e;  2K5I A;  1WXU A;  4R56 A;  3UT1 A;  4J9B A;  3O5Z A;  2FZC B;  5GAN g;  3OW2 A;  2HBW A;  5A0L A;  3CC7 A;  2MWP A;  2QEX T;  3EFO B;  3PIO A;  1RAI B;  3GNG A;  4MMK A;  2KNB B;  1ZHI A;  4D8D A;  1D1A A;  1RAB B;  1Y57 A;  5GAN 6;  4RTT A;  2WSC E;  1PSE A;  3VRY A;  3LGL A;  3LX7 A;  4J9G A;  4GLK A;  5HK0 A;  2X4Y A;  1N8R C;  2BZX A;  2M0O A;  3FEO A;  2JUF A;  4X9C A;  3GF5 A;  5DLQ E;  1KSW A;  2GF7 A;  4M78 B;  3V8J A;  2WAC A;  1X01 A;  3CPW A;  4FIB A;  2E4H A;  4F7U G;  1WHJ A;  4KH1 B;  5KE2 A;  4M7A D;  2HMA A;  1M1G A;  2D0Q B;  2DZC A;  2NUT B;  1H8K A;  4QVZ A;  2PZ1 A;  4AFZ C;  1M4Z A;  3X25 B;  3JCM g;  1JQQ A;  2DTH A;  2VC8 A;  5LJ5 j;  1UDL A;  1Y96 A;  3NFC A;  2RPN A;  2AHJ B;  5GAN 4;  2DFU A;  1UGS B;  4DQ2 A;  3QWY A;  3VUZ A;  1V1C A;  5GAO l;  4ELZ C;  1TUD A;  1WZO A;  2YDL A;  3GLX A;  5KCO A;  2KRN A;  2E10 A;  5D7U A;  4D8K A;  1XTD A;  2QDY B;  3O8V A;  3VS1 A;  2DIL A;  3S3N A;  3TU4 K;  4AFQ C;  4RG2 A;  4XTU A;  2LQW A;  2VXE A;  5FU6 B;  2LT4 A;  5GAM d;  5IH2 A;  2LQ8 A;  4HVU A;  4Z8A A;  3EH2 A;  4IIM A;  4M77 C;  3H9N A;  3URG A;  2V26 A;  4J9F A;  2QXF A;  3EG9 A;  1MMA A;  2H3J A;  1EX4 A;  1Z9Q A;  4D6W A;  2MOX A;  2HL3 A;  2BIV A;  4EPC A;  1B7T A;  3CC2 T;  2L3Q A;  3KFV A;  2KT1 A;  2C06 A;  2QQS A;  1DJ7 B;  4M7A A;  4Z02 A;  2RQV A;  2JM9 A;  1G3W A;  2OAW A;  1Q86 C;  1YIJ T;  1QKW A;  1KHI A;  2L0A A;  2L5Q A;  4AG1 C;  3CCV Q;  4A4F A;  1MUZ A;  5FU6 C;  4QQ6 A;  2LDM A;  1D09 B;  3C95 A;  2LCC A;  4IUQ A;  3C94 A;  3I9Q A;  1I8F A;  3UWN A;  2ROL A;  4MZT A;  1WHH A;  4ZTF A;  3M56 A;  1Y7X A;  2MWO A;  4FYY B;  2CP3 A;  2CUD A;  5LJ5 g;  3EGX B;  2XDB A;  2CYZ B;  2IPO B;  1CKB A;  3L2Z A;  2EJ9 A;  3CME Q;  4B9W A;  1K9M C;  3QDR B;  2DPP B;  3SDZ A;  4JLI A;  5GAN f;  3OSS C;  1S72 A;  3M4G A;  1SHF A;  4KBM B;  2YRD A;  4M75 F;  1B07 A;  2DXU A;  5GMK i;  1D0X A;  2HBP A;  2V8J A;  3M59 A;  1OQK A;  1VQ7 Q;  4QVD A;  3FDR A;  2QYZ A;  1XQH A;  2DXB A;  1WQ7 A;  5C0M A;  3OYJ A;  2CT3 A;  4M75 E;  2A08 A;  1GRI A;  5J39 A;  3M54 A;  1WXB A;  4LNP A;  3JCM b;  3EG1 A;  1SRM A;  1BU1 A;  4JUV A;  2LNV A;  2DX1 A;  2VUB A;  2A3L A;  9ATC B;  4C92 D;  1ZA2 B;  3R6N A;  3ZEH A;  1YJW A;  2KXD A;  5GAO q;  3DB4 A;  2YUP A;  3JCM f;  4F17 A;  1YN8 A;  3CMA Q;  5LJ3 h;  4JZ4 A;  2I2L A;  5HKC A;  2K2V A;  4LN2 A;  4ANJ A;  4M7D F;  2FPF A;  2JXB A;  1KC8 R;  3OB9 A;  2E6N A;  2K3B A;  3VV0 A;  3E9G A;  3ER0 A;  4PJO G;  2AIR B;  1VIE A;  3JB9 H;  2QAS A;  4MML A;  3QSU A;  1K73 U;  3OS2 A;  2CKK A;  5I2S A;  4M7D E;  3X28 B;  4C8Q D;  3HRT A;  3MP1 A;  2F5K A;  5IN1 A;  2ZAE A;  4IUT A;  2ESW A;  2J06 A;  2AK5 A;  2KI7 A;  4RTX A;  2ZGW A;  3RKW A;  4GBQ A;  4NL2 A;  2QA4 T;  1ZLM A;  3VS5 A;  4XTZ A;  2VGN A;  2E3H A;  2HKQ B;  1VQ4 Q;  2YWW A;  3PT9 A;  4EIK A;  3RDV A;  5IXF A;  1W1F A;  5DLO A;  1M3C A;  2DER A;  4XU0 A;  4M75 B;  3NTK A;  2DD4 A;  1NEG A;  4RCC A;  3CC4 Q;  3OYY A;  2E12 A;  1LPL A;  2VWF A;  3G71 Q;  3VS7 A;  5I21 A;  1OPL A;  2YLB A;  1NJI U;  5DY9 A;  5I11 A;  3CCL Q;  2COY A;  1GBR A;  4XU3 A;  1CSK A;  1I5L A;  3A8H B;  3QO3 A;  3AT1 B;  1YHQ A;  4C92 A;  5LL6 S;  2E5K A;  1YI2 A;  2RMO A;  2W0Z A;  2LQN A;  2QTV A;  2V8K A;  4OB3 B;  4HVV A;  1VQ5 A;  1OYX A;  3EGD A;  4JRI A;  1AWW A;  1OV3 A;  4OP0 A;  1VUB A;  2DL5 A;  2J6K A;  4OGE A;  1WYX A;  3MPU B;  4M7D B;  4II1 A;  4RTU A;  1YJ9 A;  2DK3 A;  2DF6 A;  3CD6 A;  4ORZ A;  1NLP C;  5LJ5 f;  2OTJ A;  4C8Q A;  2EVR A;  3INZ A;  1WFW A;  1VYT A;  1W70 A;  2OTL Q;  4JJC A;  1WHM A;  2RI5 A;  4BAC A;  1NZ9 A;  1KD1 R;  3CCQ Q;  3EFR A;  2ECZ A;  2E65 A;  4RTV A;  4RTZ A;  1X6O A;  5GAM h;  4WTO B;  4JZ3 A;  2JTE A;  5GMK j;  4E7K A;  3A8M B;  5CO7 A;  2KYB A;  3BDL A;  1VQM Q;  1YIT A;  1MV0 B;  1WA7 A;  1RLQ C;  4J7F A;  2ZPG B;  1Q81 R;  1NYF A;  3VU3 C;  4PNO A;  2GNC A;  3UPU A;  1X6B A;  4FYX B;  1ZSZ A;  3QJ6 A;  2BE9 B;  1C0M A;  2X4W A;  2MK5 A;  4JJD A;  1YIJ Q;  3I56 A;  1UUE A;  5KCH A;  4E7J A;  4IKF A;  1OX9 A;  1M1K R;  2LX9 A;  2DTI A;  1CKA A;  2EKO A;  2A36 A;  1FMV A;  2PVD B;  4EMK A;  2HQX A;  3E19 A;  2ZPF B;  3SWN B;  8AT1 B;  2DL3 A;  1PC0 A;  1GFC A;  3OBY A;  2KY9 A;  2ZPI B;  1U1S A;  2ENM A;  4QW2 A;  4LDX A;  3PFS A;  2J7I A;  4KGV B;  3M0S A;  5KYU A;  1LCK A;  2QG9 B;  5KYW A;  1X2Q A;  2CP2 A;  4PJO D;  1U5S A;  4HCZ A;  1ZUK A;  2M02 A;  3I55 Q;  1T3L A;  4AT1 B;  1W2B P;  5KYY B;  4PFO A;  3OS0 A;  2PU9 B;  3X24 B;  2RO0 A;  5L23 A;  4M7A G;  4N4G A;  2EPD A;  3L2W A;  4ZNX A;  3CCS Q;  2Z0W A;  2K6D A;  1SG5 A;  1HXD A;  2WSF E;  3GNF B;  1OZ2 A;  3VKI A;  3JCM d;  2DET A;  1QKX A;  2CZ7 B;  1VQN Q;  1KQ2 A;  1JJ2 S;  3PVQ A;  5CKD A;  1WDX A;  2O01 E;  2ATC B;  1MGQ A;  1D3B A;  5GAO r;  3QZ5 B;  3E2U A;  4IUU A;  3KBG A;  4BE0 A;  2DNU A;  2AKL A;  2XI9 A;  4RG8 A;  1Y07 A;  1ZBJ A;  5GAN 8;  4N0A C;  1IRE B;  2MPX C;  3FRN A;  3CCM A;  5DM7 R;  4M78 D;  1D0Z A;  3CCV T;  2YLC A;  2YHT A;  1HJD A;  2B8A A;  2E64 A;  1VQL Q;  3A8L B;  1G5V A;  2HQE A;  1OX8 A;  2KE9 A;  2EW3 A;  2DKG A;  2KT8 A;  1Y0M A;  1FMW A;  2VYT A;  4J9D A;  1BCM A;  2KEA A;  1O75 A;  2VKN A;  4VUB A;  1QCO A;  4HKE A;  2XG8 D;  1U8R A;  4NOY A;  1VQP T;  2DBK A;  3MET A;  1N8R U;  1EIF A;  5IAY A;  3L2R A;  1HK9 A;  3CME T;  4ZGJ B;  3QPH A;  2LCS A;  1Q7Y R;  1BIB A;  1MHN A;  2DMO A;  4L59 A;  3CCE A;  3QHS A;  2P4R A;  2GFU A;  4O5V A;  2DBM A;  3QJY A;  2RHX A;  2P84 A;  1WGS A;  2RQU A;  1SHG A;  4IIO A;  4FSS A;  2RJF A;  2HSE B;  1VQ7 T;  3EFO A;  4PJL A;  3CCR Q;  1GCQ A;  2RQR A;  2CZ1 B;  1ZUU A;  2RI2 A;  3ASK A;  1U1T A;  2RJC A;  1QP2 A;  1WHK A;  5CR2 A;  1BB9 A;  1FX7 A;  4M77 F;  3S6W A;  4HT9 A;  1NPP A;  2DA9 A;  3TVT A;  5IHI A;  1ZSG A;  2DZ9 A;  1WIE A;  1ZX6 A;  1KC8 C;  1YWO A;  2VVK A;  2LMJ A;  2KRM A;  1G8X A;  4J9C A;  4M4Z A;  2K3Y A;  4M78 A;  5CIU A;  4M77 E;  5LJ5 d;  2M9U A;  3DLL A;  3CMA T;  4B6M A;  4ZN1 A;  1BBZ A;  1VQK A;  2RQW A;  3P8D A;  2EQU A;  2NUT A;  2QI2 A;  3CXC S;  4HA8 A;  2JTM A;  3JB9 I;  3CCU T;  3JRZ A;  2QGG A;  1M2O A;  2IIM A;  1BI3 A;  2O4X B;  2QEX A;  2DRK A;  4LDY A;  1NYG A;  3EH1 A;  3RMQ A;  4P5N A;  5IHN A;  4MDW A;  2JOY A;  2RK1 A;  4MDX A;  1UHC A;  2MI6 A;  2M1H A;  1VQ6 Q;  2GQV A;  2E1H A;  2RA2 A;  2QK0 A;  4XK8 E;  3KXT A;  2D8H A;  4CC2 A;  1AWX A;  3CCJ Q;  2F1L A;  1VQ4 T;  1P92 A;  2I0N A;  4E7H A;  2EAY A;  4QVC A;  1M5Q 1;  1Q82 R;  1Q86 U;  2EQK A;  3HTR A;  2HNI A;  2HCK A;  4Y92 A;  3BDU A;  3P8B B;  1QCF A;  3QYH B;  3T9N A;  8ATC B;  2LC4 A;  3EHQ A;  3EHR A;  3J80 E;  3CC4 T;  4C92 G;  1YJN Q;  1D0Y A;  3OYH A;  1GXI E;  3G71 T;  2FG0 A;  2CDT A;  3V7R A;  3OSV A;  2AZV A;  3CCL T;  1XJW B;  2RK2 A;  1TH7 A;  3UDC A;  3ZFJ A;  4HT8 A;  4ZGE B;  5KE3 A;  4L6V 5;  2DYI A;  4M77 B;  2BTT A;  1QP3 A;  1WQW A;  1K73 R;  4PJO C;  3JB9 G;  4XTY A;  2R57 A;  2PQW A;  1K9M U;  1C6V X;  2HD0 A;  4C8Q G;  3MEV A;  1WJQ A;  3VS0 A;  3RKY A;  3H41 A;  1TUG B;  1QQJ A;  3G6E Q;  5GAN h;  5AYF A;  1AOJ A;  3DLM A;  2GTO A;  3QYG B;  1GCP A;  1ZA1 B;  1WLP B;  1KD1 C;  3TSZ A;  6AT1 B;  2DL8 A;  2DXC A;  1M1F A;  2DTO A;  5GAO n;  1YCS B;  2JMC A;  2P0Q A;  3VS6 A;  2X3W D;  2HSP A;  1YBY A;  2OTL T;  2EGE A;  3CCQ T;  4OMP A;  3HL8 A;  2EKH A;  2G3R A;  2XHC A;  3H8Z A;  3EGX A;  1Q81 C;  2J6O A;  1T3S A;  4ME7 A;  2P0P A;  1VQ8 T;  2HL5 C;  1VQM T;  4AFU C;  3ME9 A;  1BI1 A;  4A54 A;  3CC2 A;  1WJS A;  1KIK A;  2R5A A;  3HFO A;  5J3B A;  4C0G A;  3JCM P;  1M1K C;  2CZ0 B;  3JCM h;  1H3Z A;  1TUC A;  1KQ1 A;  4GLM A;  2MCN A;  2CUB A;  2FVU A;  4M75 D;  2YUQ A;  4DEY A;  5GJV B;  3H6Z A;  4J5Y A;  1M90 R;  3UA7 A;  4FW2 A;  2F2W A;  1ZUY A;  5M9O A;  4PFP A;  4V2S A;  2SEM A;  1QVF S;  3VS2 A;  4Z88 A;  3TEE A;  1C1A A;  3QG1 A;  3G4S Q;  1IRX A;  4DBH A;  1H64 1;  3HSB A;  3MP8 A;  2NUP B;  4HVW A;  1VQP Q;  2EYW A;  3EFS A;  3F70 A;  4EMH A;  1Q95 G;  1PNJ A;  4E7Z A;  2DEU A;  1NM7 A;  4JRK A;  1UGP B;  2G6F X;  3REA B;  2HAX A;  2EYQ A;  1U3O A;  2RH2 A;  3I55 T;  3FIF A;  2LJ1 A;  1UJY A;  4M7D D;  4LDU A;  1UEC A;  1FWZ A;  2KMT A;  3CCS T;  5CKF A;  4A4E A;  1VOM A;  4JDS A;  4AG2 C;  1T0J A;  2K3X A;  3PVL A;  1IGQ A;  2RB6 A;  3CBP A;  1VQN T;  3FB9 A;  1M2V A;  3BW1 A;  2IG0 A;  3L2Q A;  2K4Y A;  2MMP A;  1LVK A;  3QUI A;  3FLG A;  2EGA A;  1TXQ A;  2FL7 A;  1QWF A;  1VQL T;  5IXB A;  5GAO p;  3VJP A;  2ZCF B;  5GAN 3;  1BCO A;  2HEQ A;  1I81 A;  4M75 A;  2XIC A;  2LQK A;  1O9S A;  3CEY A;  4F16 A;  2A28 A;  4NL3 A;  2XMF A;  1JB0 E;  2H8H A;  5LJ5 h;  4PJM A;  3CCU Q;  5L8R E;  1UHF A;  3EG2 A;  3JB9 D;  3UF4 A; 
#chains in the Genus database with same CATH homology
 4J83 A;  2FHD A;  1Q7Y C;  1M9S A;  2K5L A;  2LX9 A;  5A0D A;  1VQ8 A;  4M7A F;  2DTI A;  3L2U A;  1VQM A;  2EKO A;  5CK9 A;  2EWN A;  4JRQ A;  1K8A U;  4M7A C;  2EFI A;  2PVD B;  2VXF A;  4M78 E;  3A8G B;  4EMK A;  3JAM E;  3MEU A;  4NS5 A;  4BDY A;  4E7I A;  3S3O A;  1XOV A;  1KQS A;  2HQX A;  4X9D A;  2FYK A;  4FL6 A;  4E47 A;  3E19 A;  2ZPF B;  2RHY A;  1YCY A;  3JCM W;  1IZ6 A;  2DVE A;  3SWN B;  4C5H A;  2KDS A;  2JZ2 A;  2QA4 A;  3OBY A;  2KY9 A;  2RHU A;  2ZPI B;  4M7A E;  1U1S A;  1WJR A;  1BYM A;  2CS7 A;  5GAM e;  2L3R A;  3PGG A;  1YIJ A;  3PMI A;  4QW2 A;  4M7D A;  4LDX A;  2DAQ A;  3PFS A;  2BKD N;  3OMG A;  3MEW A;  3OS1 A;  1Y96 B;  4FM4 B;  4QQD A;  3CCR T;  1UEB A;  3M9Q A;  4XTW A;  5IT9 E;  1Q7Y U;  2E70 A;  1VQ9 A;  4OB1 B;  4M78 G;  1W2B A;  1VQO A;  3OBW A;  3G7Z A;  2XK0 A;  2DIG A;  4C5I A;  4FSX A;  4HCZ A;  4JS4 A;  4PJO D;  4BY6 B;  1W4S A;  3JCM X;  2P0K A;  1VQK T;  4N4H A;  3BY7 A;  4A53 A;  1WPY A;  4CI0 C;  3P8H A;  3OS0 A;  4X34 A;  1UGR B;  2PU9 B;  3HPW A;  2K5I A;  2RO0 A;  3X24 B;  5LJ5 e;  3OYG A;  4M7A G;  4F7U F;  4N4G A;  4R56 A;  3UT1 A;  3L2W A;  3RER A;  2KQW A;  5GAN g;  3OW2 A;  1UGQ B;  5A0L A;  3CC7 A;  2MWP A;  1HXD A;  2E5Q A;  2QEX T;  4HCC A;  2WSF E;  3GNF B;  3PIO A;  3SFM A;  3GNG A;  1OZ2 A;  4MMK A;  3VKI A;  3JCM d;  3PNW C;  4JLG A;  3RKX A;  2CZ7 B;  1ZHI A;  2KAF A;  2Y4X A;  1KQ2 A;  1JJ2 S;  2OAU A;  4DA4 A;  2DXT A;  4F7U E;  5CKD A;  2O01 E;  3I55 A;  5LJ3 g;  1MGQ A;  1D3B A;  2F69 A;  1YJN T;  3A8O B;  3AHU A;  5GAN 6;  5GAO r;  3KUF A;  4KUL A;  3QZ5 B;  2WSC E;  3RMS A;  1PSE A;  4IUU A;  3LGL A;  3KBG A;  5D6X A;  5HY6 A;  1BI0 A;  2RJE A;  4BE0 A;  3LX7 A;  2XI9 A;  5HK0 A;  4GLK A;  4RG8 A;  1Y07 A;  1WNL A;  3OA6 A;  2X4Y A;  5GAN 8;  4N0A C;  1IRE B;  5FRM A;  1N8R C;  1QVG S;  3FRN A;  4R55 A;  3CCS A;  3CCM A;  5DM7 R;  4M78 D;  3MP6 A;  2M0O A;  3CCV T;  3J81 E;  1G3T A;  2YLC A;  2YHT A;  2B8A A;  3FEO A;  2JUF A;  4X9C A;  2E64 A;  3GF5 A;  3A8L B;  1KQS S;  5DLQ E;  2GF7 A;  4M78 B;  5GAM j;  2HQE A;  2ZZD A;  3V8J A;  1G5V A;  2X4J A;  2WAC A;  1X01 A;  3WVE B;  3CPW A;  1N27 A;  2JVV A;  4FIB A;  4C0F A;  1VQN A;  2XD0 A;  4F7U G;  5KE2 A;  4M7A D;  1Q86 C;  2JN0 A;  2DKG A;  1VQ6 T;  1S72 T;  1M1G A;  2LTO A;  2D0Q B;  2VYT A;  2XDD A;  1Q82 C;  2DZC A;  4A4G A;  3C4S A;  4M7A B;  4QVZ A;  5CCA A;  1O75 A;  2CGH A;  1LOJ A;  2RHZ A;  3E9F A;  1M4Z A;  3NTH A;  4HKE A;  4VUB A;  1RL2 A;  3X25 B;  3JCM g;  3LW5 E;  3M57 A;  2DTH A;  2VC8 A;  4FU6 A;  2X35 A;  2PUO B;  5LJ3 f;  2XG8 D;  4A4H A;  5EG2 A;  1ZQ1 A;  5FU7 C;  2E6Z A;  4NOY A;  3CXC A;  2RD1 A;  1U8R A;  1VQP T;  5I2M A;  3MET A;  1N8R U;  1EIF A;  3L42 A;  2QQA A;  3OMC A;  5LJ5 j;  3SD4 A;  1VQL A;  1Y96 A;  5IAY A;  3L2R A;  1BKB A;  1HK9 A;  3CME T;  4ZGJ B;  3NFC A;  3QPH A;  4OB0 B;  2AHJ B;  5GAN 4;  3OYL A;  3VYG A;  1BIB A;  1MHN A;  1UGS B;  4L59 A;  2D9T A;  4TVR A;  4DQ2 A;  3CCE A;  5GAO m;  3MCA B;  3QHS A;  2GFU A;  4O5V A;  3VUZ A;  5GAO l;  4ELZ C;  2EQM A;  3QJY A;  2XKO C;  3OYA A;  3OW2 S;  2RHX A;  1Q82 U;  3GLX A;  5KCO A;  1NE8 A;  4OMF B;  3QZ9 B;  2E10 A;  1WGS A;  2RI3 A;  4Y91 A;  1XTD A;  2QDY B;  1VIF A;  3O8V A;  3DB3 A;  4ZN3 A;  3S3N A;  3TU4 K;  4OVA A;  2JTF A;  1LNX A;  2JNG A;  1VQ7 T;  2RJF A;  3TCJ A;  1YJW T;  4PLI A;  3GP8 A;  3M58 A;  4LDV A;  4RG2 A;  3LYI A;  1R8O B;  4XTU A;  2CZ1 B;  4F7U B;  2RI2 A;  3ASK A;  2RHI A;  1U1T A;  2RJC A;  3CCJ T;  2VXE A;  1QP2 A;  3EAE A;  2LT4 A;  1I4K 1;  4N4I A;  4L5G A;  5FU6 B;  5GAM d;  5CR2 A;  3M5A A;  1FX7 A;  2LQ8 A;  4M77 F;  3S6W A;  2CZ6 B;  3M53 A;  5CKH A;  5FLX E;  4LDW A;  4HT9 A;  2RJD A;  1NPP A;  4M77 C;  3G6E T;  3GIB A;  1Y71 A;  4ELY C;  4HCB A;  3URG A;  4PKC C;  5A0G A;  2QXF A;  2DZ9 A;  2QTX A;  5D6W A;  1KC8 C;  3CPW S;  2H3J A;  2KK4 A;  3CCR A;  4M78 A;  2K3Y A;  4ZGD B;  4D6W A;  5CIU A;  4M77 E;  2PVG B;  2DO3 A;  5LJ5 d;  2M9U A;  3DLL A;  3CMA T;  1BI2 A;  2BIV A;  2EJG A;  4EPC A;  4ZN1 A;  3CC2 T;  1UB4 A;  2DD5 A;  1VQK A;  2YRV A;  3A5Z B;  3HRS A;  5GAN 7;  1KHC A;  3P8D A;  2C06 A;  2EQU A;  2QQS A;  1DJ7 B;  2ZPB B;  2IVW A;  2QI2 A;  3CXC S;  4C0D C;  4HA8 A;  4M7A A;  1M8V A;  4IUV A;  4Z02 A;  2JTM A;  5D6Y A;  1G3W A;  3JB9 I;  2Y90 A;  3CCU T;  3JRZ A;  4BI3 A;  4J6Y A;  4C92 F;  4OGC A;  3LWI A;  1KHI A;  4PL6 A;  1YIJ T;  1BI3 A;  2L5Q A;  2O4X B;  4C92 C;  4A4F A;  5GAM g;  3OYE A;  2QEX A;  4RKU E;  4LDY A;  5FU6 C;  3RMQ A;  4QQ6 A;  2KSS A;  4P5N A;  1KC8 U;  4M77 G;  2L8D A;  1RI0 A;  2LDM A;  2JOY A;  4MDW A;  2RK1 A;  4QQG A;  3C95 A;  5FU7 B;  4BE1 A;  2LCC A;  4IUQ A;  3C94 A;  3PIP A;  4BDZ A;  1I8F A;  3UWN A;  4BUG A;  4MDX A;  4MZT A;  2MI6 A;  2M1H A;  4C92 E;  5GMK e;  2DJZ A;  4ZTF A;  3M56 A;  4KUD K;  2GQV A;  1Y7X A;  3JB9 F;  2E1H A;  2MWO A;  2RA2 A;  4XK8 E;  3KXT A;  1N9S A;  2PUK B;  4C8Q F;  5LJ5 g;  3WXM B;  1VQ4 T;  1P92 A;  4E7H A;  2EAY A;  1B34 B;  1LJO A;  4QVC A;  4MZP A;  3CCV A;  1M5Q 1;  2CYZ B;  4C8Q C;  1Q86 U;  2XDB A;  4Q5W A;  2EQK A;  3L2Z A;  2QQ9 A;  5CVI A;  2EJ9 A;  2RM4 A;  2A7Y A;  2HNI A;  3BDU A;  3P8B B;  4B9W A;  4YTL A;  1K9M C;  3QDR B;  4PLL A;  2DPP B;  4F7U A;  1XNI A;  3QYH B;  3T9N A;  4BD3 A;  3SDZ A;  2LC4 A;  1YHQ T;  4JLI A;  5GAN f;  2VV5 A;  4KT0 E;  4O6J A;  1YI2 T;  3J80 E;  5GAN 2;  3ZBD A;  3CC4 T;  4OB2 B;  4C92 G;  1VQ6 A;  3OSS C;  4C8Q E;  2P4T A;  1S72 A;  2D6F A;  4E7L A;  3M4G A;  3LGF A;  3SWN A;  1VQ5 T;  3OYH A;  3WVD B;  3OYB A;  1GXI E;  3HKS A;  4IUR A;  4J6W A;  3G71 T;  1FXX A;  3RUX A;  4KBM B;  3V7R A;  3OSV A;  3G4S T;  4M75 F;  3CCJ A;  4FT2 A;  2DXU A;  4M77 D;  5GMK i;  3CCL T;  3CCM T;  2RK2 A;  1VQP A;  1TH7 A;  1M90 U;  2HBP A;  2V8J A;  3CBM A;  3M59 A;  3MHX A;  4M75 C;  3UDC A;  3ZFJ A;  4CRI A;  2XU8 A;  4ZGE B;  4HT8 A;  4QVD A;  4L6V 5;  2LCL A;  4PJO F;  5KE3 A;  1W2B S;  3FDR A;  1YJ9 T;  4M77 B;  2GCX A;  1QP3 A;  1WQW A;  2XDP A;  4N0A A;  5GMK m;  3MEA A;  5GAN 5;  3CME A;  3CD6 T;  4PJO C;  1XQH A;  2ZPH B;  3M55 A;  2BUD A;  3JB9 G;  4XTY A;  2DXB A;  2MF2 A;  2R57 A;  2PQW A;  2OTJ T;  1WQ7 A;  5C0M A;  1K9M U;  3OYJ A;  2HD0 A;  1QVP A;  4C8Q G;  1YJN A;  4M75 E;  2LVM A;  3MEV A;  3NTI A;  5J39 A;  3M54 A;  1WJQ A;  3CBO A;  3RKY A;  4GY5 A;  3JCM b;  5CQY A;  1QVF A;  4PJO E;  2MAM A;  4XU1 A;  1K73 C;  5GAN h;  4JUV A;  3SB2 A;  2LNV A;  3OY9 A;  1AHJ B;  3J7A F;  5AYF A;  1NPR A;  2VUB A;  4EMK C;  4C0D B;  3V7C A;  1K73 U;  2A3L A;  4WF2 A;  1OZ3 A;  3DLM A;  3QYG B;  3V8L A;  1VQ7 A;  2ZPE B;  2DEQ A;  2V8I A;  4MZM A;  5CQX A;  4C92 D;  3X26 B;  3ZEH A;  1YJW A;  5GAO q;  3DB4 A;  1YIT T;  1KD1 C;  3JCM f;  3N5B B;  2DXC A;  1M1F A;  2DTO A;  4JJN K;  2EJF A;  5GAO n;  4J7I A;  2EIF A;  5LJ3 h;  2I2L A;  4C92 B;  5HKC A;  2K2V A;  4M7D F;  4M75 G;  1D3B B;  2P0Q A;  1G3S A;  4FT4 A;  4IUP A;  2XID A;  2F5T X;  3OB9 A;  5CKE A;  1YBY A;  2E6N A;  4EMG A;  1OI1 A;  2OTL T;  3QII A;  5GMK h;  4M7D C;  4M78 F;  3VV0 A;  3E9G A;  3ER0 A;  3OYF A;  4PJO G;  4J6X A;  3CCQ T;  2R58 A;  1VIE A;  3JB9 H;  4XTX A;  3G6E A;  3HL8 A;  4XU2 A;  4C5E A;  3PTA A;  3Q1J A;  3FJP A;  4MML A;  3JCM V;  3QSU A;  1Q81 C;  2G3R A;  2LRQ A;  2XHC A;  3H8Z A;  1B34 A;  3OS2 A;  2CKK A;  3I56 T;  2K57 A;  5I2S A;  4JS5 A;  3OYI A;  4ME7 A;  3TRE A;  4M7D E;  3X28 B;  3GPL A;  1N6A A;  1QVG A;  2P0P A;  4C8Q D;  1VQ8 T;  3HRT A;  3MP1 A;  1VQM T;  4UC4 A;  2F5K A;  2R5M A;  5FRO A;  4B9X A;  3VUB A;  2LT1 A;  3ME9 A;  5IN1 A;  2FB7 A;  1BI1 A;  4A54 A;  5GAN d;  3CMA A;  4C8Q B;  1KD1 U;  3CC2 A;  1WJS A;  4IUT A;  5A2Q E;  4BI8 B;  2R5A A;  3HFO A;  5J3B A;  3L1A A;  4C0G A;  3JCM P;  1M1K C;  2ZGW A;  3RKW A;  4RMO A;  2CZ0 B;  3JCM h;  1NJI C;  4NL2 A;  2QA4 T;  1H3Z A;  3RIR A;  5GAN e;  2NLU A;  4ZTJ A;  5CKB A;  1KQ1 A;  4XTZ A;  2VGN A;  3CCU A;  3M4Y A;  5LJ3 d;  3PT9 A;  3HFN A;  4OF1 A;  5KH6 A;  2WSE E;  3GOX A;  2FVU A;  1X75 C;  4M7D G;  4M75 D;  1Q81 U;  1G3Y A;  4M77 A;  3QXE B;  5DLO A;  2KVQ G;  3H6Z A;  3OYC A;  4J5Y A;  2E41 A;  1VQ9 T;  3CPF A;  4BE2 A;  5LJ3 e;  4XU0 A;  5M9O A;  4M75 B;  1BIA A;  2DD4 A;  3NTK A;  1VQO T;  4RCC A;  2M16 A;  1KG1 A;  4V2S A;  3OYY A;  1QVF S;  2E12 A;  1SSF A;  4JRP A;  4LD6 A;  1QW1 A;  3JCM J;  3HRU A;  4PJO B;  3TEE A;  3QBY A;  5FRN A;  1PSF A;  2K5F A;  5I21 A;  3QG1 A;  3S3M A;  1M1K U;  2YLB A;  3LLR A;  1H64 1;  1NJI U;  5DY9 A;  1M90 C;  3MP8 A;  1VQ4 A;  3HSB A;  3QKJ A;  4LD9 K;  4XU3 A;  3CC7 T;  1I5L A;  4BB7 A;  3EFS A;  3F70 A;  4EMH A;  3SWN C;  4XTV A;  3DKM A;  3HP9 A;  4XAX B;  5KCH A;  3A8H B;  3QO3 A;  4JRK A;  1YHQ A;  4EMK B;  1UGP B;  4C92 A;  5LL6 S;  2HAX A;  2EYQ A;  1YI2 A;  3CC4 A;  5GAM f;  2EQJ A;  2RH2 A;  5CAI A;  3I55 T;  2Y4Y A;  2V8K A;  4OB3 B;  3FIF A;  3V8K A;  1VQ5 A;  1OYX A;  4JRI A;  3JCM e;  4M7D D;  2X4X A;  3G71 A;  3L2V A;  2GFA A;  4LDU A;  4ATO A;  4OP0 A;  1VUB A;  4DOV A;  3G4S A;  3JSC A;  1FWZ A;  2VGM A;  4OGE A;  3CCL A;  2KMT A;  1N9R A;  4RCB A;  3CCS T;  3FC3 A;  3RES A;  4M7D B;  5CKF A;  4A4E A;  4C0Z A;  1JRI A;  4II1 A;  4BY6 C;  5GAN j;  1YJ9 A;  1V29 B;  5HK3 A;  4JDS A;  2DK3 A;  3MO8 A;  3CD6 A;  4J8O A;  3OYM A;  3C12 A;  5LJ5 f;  2K3X A;  2OTJ A;  5GMK l;  2RB6 A;  3CBP A;  4C8Q A;  1ZBX A;  4EDU A;  3E1S A;  1VQN T;  3INZ A;  5C6S A;  4A4K A;  3X20 B;  2QQB A;  3FB9 A;  3JCM c;  4XQ3 A;  5J26 A;  2RI5 A;  3BW1 A;  2IG0 A;  2L89 A;  3OQ5 A;  4BAC A;  3OYD A;  1NZ9 A;  5LJ3 j;  3L2Q A;  2K4Y A;  3EFR A;  4Y28 E;  2MMP A;  4BI4 A;  2E65 A;  3QUI A;  3FLG A;  3R6O A;  2QQR A;  1X6O A;  2DIQ A;  5GAM h;  5GMK j;  3LWH A;  2FL7 A;  4KUI A;  2O4X A;  3OYK A;  4E7K A;  3A8M B;  1K8A C;  5CO7 A;  3BDL A;  3OS5 A;  1VQL T;  5GAO p;  1YIT A;  3VJP A;  2ZCF B;  5GAN 3;  1JBM A;  4J7F A;  3PMT A;  1I81 A;  4M75 A;  2ZPG B;  3VYH B;  3JB9 J;  2XIC A;  2LQK A;  3VU3 C;  4PNO A;  1O9S A;  3CEY A;  3JCM Q;  3CCE T;  3V7S A;  3UPU A;  2OTL A;  3OYN A;  4C5G A;  4PJO A;  3HHT B;  4NL3 A;  1JJ2 A;  3QJ6 A;  1JB0 E;  3CCQ A;  5LJ5 h;  2X4W A;  2PVO B;  3BFM A;  3LH0 A;  4M78 C;  5L8R E;  3I56 A;  4DOW A;  4E7J A;  4IKF A;  3JB9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...