4M77E

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
80
structure length
70
Chain Sequence
b'ILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLKVMQHHGRMLLSGNNIAILVPGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 10
structure length 70
sequence length 80
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77E00
3V7SA 4F7UE 4M75F 2E1HA 4C92C 1TH7A 4HT9A 4M7DE 4J6XA 1BIAA 2QTXA 5GANg 3JB9D 4M77B 2FB7A 4Y91A 4C8QD 5LJ5h 4XU0A 3JCMX 4XTWA 2DTIA 4QVCA 1U1TA 5GMKe 1B34B 4M77A 4M75G 5LJ3d 5GAN4 4M7DF 4C92B 3JCMQ 3HSBA 5LJ3g 2DTHA 2EWNA 3BFMA 4XTYA 3RKYA 3JCMd 1N9RA 3JCMg 1B34A 2DZ9A 5GANd 3JCMW 4PJOA 1M8VA 4C92A 4M75D 3GIBA 4NL3A 4F7UG 3BW1A 4M7DG 1U1SA 5GAMg 3INZA 2YLBA 3RKWA 4JUVA 5GMKm 3L1AA 3QSUA 5GMKj 3JCMc 2DJZA 2VXEA 2FYKA 4HT8A 3JB9G 3QUIA 4OP0A 4M7DD 3SWNA 5GAOq 4M7AA 2DTOA 5LJ5e 5GMKl 4PJOC 5GMKi 2RM4A 3FJPA 3V7CA 5DY9A 5LJ3h 3BDUA 3V8LA 5LJ5f 1WQ7A 1JBMA 4NL2A 3JCMh 5GAN6 1N9SA 4JLIA 3V7RA 4M77E 1LJOA 5GAN2 4XTZA 4RCCA 2VC8A 4WF2A 4PJOB 3EFRA 4XTVA 3V8KA 5GAMh 2HNIA 2RA2A 4M78C 3SWNC 3V8JA 4M7AC 4PJOE 4QVDA 4C92E 5LJ5j 2VXFA 3QHSA 1HXDA 4M77F 1WQWA 2RD1A 4JRIA 4NOYA 4XQ3A 4XTUA 5GANe 1KQ2A 2DEQA 2I2LA 2EJGA 4C8QC 5GANf 2E41A 2E10A 4PJOF 4M78B 3SWNB 4M7AB 2EAYA 2RB6A 4C92F 2YLCA 1WNLA 5I21A 5LJ3e 3RESA 4J6YA 4M7AE 2DXUA 4M77G 2JN0A 4XU2A 4M78A 5CAIA 1KQ1A 3JCMe 5GAN3 5GAN5 5GAOm 3JB9H 3FB9A 3AHUA 1I81A 1M5Q1 2YHTA 4M75C 1MGQA 5GANj 3JCMV 2DVEA 4M77D 4C92G 5GAMe 4M78F 4MMKA 4C8QA 4EMGA 3RKXA 5GAOl 4M7AF 2E64A 4XTXA 1BIBA 5LJ5d 3JCMb 3JCMP 5GAMf 5GAOp 4J5YA 3JB9I 4PJOD 4A54A 1I8FA 4C92D 5LJ3j 4M75B 4A53A 4M7DC 1X01A 4EMKC 2CGHA 4J6WA 3JCMJ 4M75A 3HFOA 3HFNA 1H641 5GAMj 4F7UB 2EJ9A 4M78D 4M7DB 4M7AD 2DZCA 1HK9A 4X9DA 4EMKB 4M78E 1WPYA 3L2ZA 4HA8A 4PNOA 1YCYA 4XU1A 3EFSA 4DQ2A 3FIFA 1Y96B 4F7UA 1LOJA 3RERA 3BY7A 4M7DA 4RCBA 2DKGA 1D3BB 4N0AA 5LJ3f 4C8QB 4EMKA 4PJOG 4MMLA 3JCMf 4C8QE 4F7UF 1Y96A 1I4K1 4XU3A 1D3BA 1LNXA 5GAN7 2EJFA 5GMKh 3RIRA 1I5LA 5LJ5g 3PGGA 5GAOr 2K57A 3JB9F 3QO3A 4JRKA 3SB2A 4C8QF 5GAMd 2Y90A 4N0AC 4M78G 4M75E 1JRIA 2DXTA 3VU3C 5GAOn 4M7AG 2E65A 5GANh 5GAN8 4M77C 3RUXA 4X9CA 2ZGWA 4EMHA 4V2SA 3JB9J 3M4GA 4C8QG
chains in the Genus database with same CATH superfamily
2CDTA 4HT9A 4UC4A 2D6FA 5GANg 4BD3A 4JDSA 2PTKA 1M1KR 4RTVA 1X75C 4JJBA 4A4KA 3I56T 3S3MA 4A4FA 2NYSA 2NUTA 1M90R 4F7UG 2QEXT 1VQ9A 5GMKm 4AG1C 4GBQA 3CPFA 1YFNA 1VYVA 5LJ5e 1VQKQ 1GRIA 2RJDA 2DK3A 4C5GA 2CSQA 2K5LA 3JSCA 2QQRA 2Y4XA 4E7SA 2X3XD 2OTLQ 3OA6A 4JS4A 4FYXB 2PUOB 4FW2A 4R55A 2RD1A 4XQ3A 3R6NA 8ATCB 2AZVA 1VQ6T 2AKLA 2CZ1B 2YLCA 4QKUA 3I9QA 5IXFA 1KK7A 4ATOA 5GAOm 3CCUT 2L5QA 4M75C 3VYHB 2LJ0A 3CCJT 4XAXB 3CCMT 4L6V5 2BE7D 3RR6A 1DJ7B 1E6GA 1RI0A 1T0HA 4M7DC 1OOTA 3QG1A 3SD4A 2C06A 1T3LA 1RUWA 4BE0A 3VS2A 1PRLC 1ZSZB 2E5KA 3VUZA 2LT1A 1TSFA 1UFFA 4PNOA 5FU6C 2EYWA 1IXDA 4OMPA 3OYKA 2DEUA 1UGRB 2OX7A 1BKBA 2EJFA 1BI0A 1TUCA 3RIRA 3JB9F 1M1FA 2MI6A 3CMAA 4ZTJA 4FU6A 2ZGWA 5IHIA 4IIMA 3CBOA 4Q5WA 3NTIA 5A0DA 1VQ7Q 5CCAA 1VQPA 1Q7YU 2FB7A 3GP8A 3EG9B 1NEGA 1W4SA 4HCBA 5CR2A 3N5BB 2EGAA 4HVVA 2OAWA 3CCRA 3HPWA 2M02A 1QLYA 4Y28E 3OYAA 2DRMA 1YN8A 1W2BS 4PJOC 3NPFA 3LGLA 2XI9A 5KYUB 1YJWA 2K4YA 3QWXX 2DXBA 1CKAA 2DIQA 1YWOA 4QVDA 3OBWA 1KSWA 5LJ5j 3I56Q 1VUBA 2RQWA 4NOYA 5L8RE 4DEYA 1VQ4A 2BTTA 1OULA 3SWNB 2EQMA 4M7AB 4BDYA 1OZ2A 2DVEA 4C0DC 4OMQA 4M7AF 1WHLA 2E4HA 4J5YA 2YUQA 3OSSC 4E7LA 3EG2A 3NHNA 1SSHA 2M0OA 4CC2A 1YJ9T 3CCLQ 3JCMJ 1VQ6Q 5CKBA 1WX6A 1ZQ1A 1UB4A 2BZ8A 2X4WA 5D6WA 2KSSA 3RERA 2XU8A 2FRYA 2FPEA 3CCJQ 3DKMA 3CCMQ 2QDLA 1I4K1 3A1PA 1KD1U 5IH2A 3P8DA 3LYIA 1N6AA 5GAN7 4IUVA 1M3AA 3A8OB 2GFUA 4CI0C 3EG1A 4HXJA 3LX7A 1PKSA 4BY6B 3MP1A 4C92C 1Y7XA 1HJDA 4ESRA 3JB9D 1Q86R 2HD0A 1UJ0A 3MO8A 4M77A 4E7JA 1M30A 3HSBA 2EWNA 1CSKA 4J9HA 2LQNA 1X6GA 4OMNA 3CEYA 4B9XA 3PMIA 5HK3A 4KGXB 1QVFA 1VOMA 2F2VA 2XICA 3EGXA 1KG1A 1VQLT 1AHJB 2EPDA 2V8JA 1PG5B 3PT9A 2KRNA 1MMNA 2I2LA 1J3TA 5GANf 1VQ8T 5HCKA 3CC2A 4M78B 2CP6A 2EAYA 3LH0A 2GTOA 1YI2T 4XU2A 3JCMe 2PU9B 2KBTA 4C0FA 3BE3A 4M78F 3VS4A 2DD4A 2K3YA 2VYTA 1JJ2S 5CVIA 1ZUYA 2GFAA 2PVOB 1AVZC 2NUPA 4EMKC 1AWJA 2O9SA 2I0NA 3VS7A 3UPUA 5FU7B 3QXEB 2H3JA 3C94A 2BZYA 1RADB 4HCCA 4M7AD 1KQSA 4HA8A 2XHCA 1KQ2A 3PIOA 3BY7A 5LJ3f 1D3BB 4J9DA 3CCSA 1VQNQ 4BACA 3NMZC 4N4GA 1S72A 3G6ET 5GAOr 3CD6T 1YJ9Q 1KHCA 5GAOn 2DXTA 5KYYB 4RTWA 3G71A 1WIEA 4J9EA 3VS1A 2RPNA 4M75F 2RF0A 1WHKA 2E1HA 3GNFB 3KBGA 2EBPA 1T0JA 4AMCA 3H0HA 4QVCA 1U1TA 3QYGB 1BI3A 4M7DF 5AT1B 3OYCA 4HCZA 3REAB 7AT1B 3QJYA 2KRSA 2QYZA 2RJCA 1M8MA 2MK5A 3OMCA 3TU4K 3CPWS 2QDYB 4N4HA 3QUIA 5D7UA 3PMTA 2DTOA 3UF4A 1PKTA 3FEOA 1N9SA 1RAAB 1TG0A 4M77E 4XTZA 2J7IA 1Q81C 3UATA 5GAMh 5GJVB 1NPPA 1RLPC 2RHIA 5GANe 2DFUA 4JRPA 2KROA 2YRVA 3DB4A 3M55A 2COZA 1XTDA 2KE9A 2RJFA 1KQ1A 1X2QA 1G3SA 5IHNA 2CKKA 1QVPA 1VQLQ 2L8DA 4MMKA 4C8QA 4KUDK 1BIBA 3VYGA 1X43A 3VV0A 3MP6A 1ZSZC 2HQXA 3GBQA 1IZ6A 4RUGA 3CQTA 1D1CA 2VVKA 2KY9A 3HFNA 1VQ8Q 1H92A 1GCQC 2LJ1A 4M78D 4NS5A 5DLOA 1I1JA 4X9DA 1RL2A 1YI2Q 2LX9A 3H0IA 2DM1A 3HHTB 4OMFB 4E47A 2A3LA 4VUBA 1VQMA 2QASA 3WVDB 3G4SA 1QWEA 1K76A 2LQKA 3GPLA 2K57A 1RABB 4B6MA 2A36A 1M3CA 4F17A 2RI2A 2F5TX 3UDCA 3JB9J 3NTKA 3ZL7C 3I55A 2NLUA 2E3IA 2FPDA 2RK2A 4LUDA 2ZPGB 4ZGEB 4XU0A 1ZA2B 3ZEHA 3M0SA 1K8AU 4M75G 3M59A 3JCMQ 1VQPT 2NUTB 3X26B 1GBRA 2LTOA 3G6EQ 4M75D 2A0FB 3CCET 4M7DG 2ABLA 3RKWA 2YLBA 4PLIA 2DJZA 4KBMB 1UEBA 2DL4A 3CCRT 4M7DD 1SPKA 1S1NA 4RG2A 3ER0A 2P4TA 2RM4A 3V7CA 1IREB 1D09B 3V8LA 5KYWA 1Q82U 4J7FA 4RCCA 3SWNC 1RAEB 4M7AC 3QDFA 2BE9B 2KR3A 1OX9A 4Z02A 5DLQE 2JTEA 2JTFA 2QG9B 2Z0WA 2FRWA 3L2WA 3BDLA 2FO0A 2VGMA 1WNLA 2FZGB 4C92F 2H8HA 2RMOA 4X1VA 2DXUA 2J05A 1VQ4T 1TXQA 3I5SA 3VUBA 3QDRB 5GANj 2CZ6B 5FLXE 1WXBA 2YUNA 4ZGDB 4AG2C 1Q86U 5IHKA 1XQHA 4PL6A 1SRLA 4DOWA 1XNIA 3OMGA 2LVMA 4OB1B 2ECZA 2BIVA 3F70A 2LCSA 4IIOA 2GGRA 2W0ZA 1WPYA 2DRKA 4BI4A 3S3NA 4PJOG 3VRYA 4C8QE 1Y96A 2L2PA 1YNZA 4XU3A 2P4RA 5KCOA 2R5MA 4J7IA 1T3SA 2QAZA 2C0IA 4BY6C 2KT8A 2XK0A 2D8HA 4BE1A 1AD5A 4JZ4A 2D0NA 1Y07A 1X6BA 1K0XA 1M2OA 2LT4A 5FWCA 5GMKe 1WJSA 3ZFJA 3X20B 1MMGA 2MCNA 4E6RA 3CCVT 2ZZDA 2DZ9A 4PJOA 4FT2A 3VS6A 4BI8B 4OVAA 2FPFA 1V29B 4ZN1A 3L2VA 3TREA 2DPPB 3BDUA 3A8HB 2CYZB 5CKFA 4TVRA 4BUGA 4LDVA 3H41A 5GAN2 1K73U 4XTVA 5IT9E 2CT4A 2FZKB 4M78C 4AFZC 2HBPA 2RJEA 2JS0A 2COWA 2RQTA 1WQWA 3CCEQ 3MEWA 2ENMA 3L2RA 3UA6A 4EIKA 1K4US 3JV3A 2D0QB 3REBB 1WHHA 1M9SA 5CQXA 3LWIA 3FB9A 1JB0E 4DBRA 2OJ2A 3RBBB 4C92G 1GXIE 4XTXA 4HCKA 5CO7A 4ZN3A 5FU7C 4C92D 2GF7A 2O88A 1JEGA 3FLGA 2RHUA 1UGPB 2A37A 3EFOA 1BB9A 3MJXA 1Y71A 2KVQG 2EQKA 3E9GA 3OW2P 1D1BA 4F7UA 4KUIA 1AWXA 1IRXA 2V26A 4QT7A 2RO0A 1NZ9A 1NLOC 2KXCA 1SHGA 2XDPA 3HL8A 2BKDN 2V1QA 4JRKA 1GFCA 1RAGB 4II1A 5LL6S 3OW2A 4AFQC 2PNIA 2KAFA 3CMET 2EGCA 2RNAA 4V2SA 3EG3A 3M9QA 4ELZC 3MEAA 3ASKA 3WVEB 3CXCS 4JJNK 4M77B 5CKHA 4XTWA 5CKDA 1QCOA 2FEIA 1AWWA 2PUKB 3OBYA 1V1CA 3C95A 2E70A 4MZPA 2YSQA 2V1RA 3BW1A 5GAMg 2H3EB 2FG0A 3QSUA 5GMKj 1VQ5Q 2PVDB 2DAQA 2JXBA 3EGXB 2HQEA 2YUPA 4D6WA 4J9IA 3P8HA 4OMMA 3VKIA 1LJOA 4ANJA 4N4IA 1U8RA 1UGQB 2RA2A 3CCVQ 1QVGS 4PJOE 2LC4A 1QKXA 1AT1B 1UHCA 1K0SA 2HKQB 3OY9A 3PVLA 2ATCB 2J6KA 3PVQA 1YWPA 2MIOA 5CAIA 3QYHB 1K9AA 1Q81R 2ED0A 2KI7A 4XK8E 4RKUE 4D8KA 1IHVA 3X28B 3OSVA 1EX4A 1YHQT 5LJ5d 2M51A 2NUPB 4DEXA 3JB9I 3PTAA 4A54A 4A53A 5KYNA 2WSFE 3SFMA 1PNJA 4CC3A 2QEXQ 1VQKA 1WHGA 2VWFA 1PHTA 4KRTA 2OTLA 4XU1A 4DOVA 3JCMf 4OB2B 1X6OA 4RTXA 2KEAA 5AYFA 1VQMT 2YDLA 1I5LA 1R8OB 3G4ST 5KYXB 2O4XB 3OYBA 3R6OA 2O2OA 1VYTA 2HKNA 2E65A 1IO6A 2M1HA 1YJNT 2HSEB 2LZ6B 2CP2A 4LNPA 2PZ1A 2EQJA 2ZPIB 4F7UE 2ZPHB 1UECA 4MDWA 2X3WD 3CCUQ 1FX7A 4OMLA 2FZCB 1M2VA 1N5ZA 1VQOT 2V8IA 3I55T 3DLLA 1ZUKA 4C0GA 2DNUA 2X35A 3RKYA 3CPWA 5GJWB 5IN1A 3GNGA 2D8JA 5KE3A 2CZ7B 1VA7A 3C4SA 3CMEQ 2EKHA 3QIIA 3JB9G 2QQSA 2DLPA 3NGPA 5GMKl 3M57A 4CC7A 2AT1B 3CC7T 1QVFP 3OB9A 2RI3A 3A8MB 2DA9A 3ME9A 3ULRB 2EFIA 2O01E 4XTUA 2QGFB 1G3WA 1NJIU 2YRDA 4KULA 2VV5A 2DXCA 1VQ7A 4J9CA 4LE9A 4JPBW 1EZZB 1ZSZA 2HQHA 2EQIA 2JUFA 2ROLA 3A5ZB 2R5AA 1I81A 3A8GB 5GAOl 1D0XA 3RKXA 3HTRA 1MMDA 4Y92A 2C0TA 2K2VA 2DERA 5HK0A 2JT4A 1UHFA 2KK4A 4E7IA 2K2MA 4PFPA 3META 3EFSA 3FIFA 1LOJA 2F2WA 1KC8U 2JMAA 2EYZA 2X4JA 4J83A 2OTJA 1KQSP 1UGSB 2MF2A 1YHQQ 1WXTA 2QQ9A 5I2MA 3EHQA 1YIJT 1M3BA 2B8AA 4AFUC 2MMPA 1M1KU 4N0AC 4M7AG 1GFDA 4O6JA 5GANh 2D1XA 1RI9A 3HP9A 3GF5A 4EMHA 1HD3A 1M90U 2GBQA 2CZ0B 4RMOA 3U23A 4L5GA 1FMWA 1QCFA 4ELYC 4QW2A 4CC4B 3CCLA 2DTHA 5KYUA 1VQMQ 1YITT 2L0AA 1OX8A 1U1SA 1G8XA 2KGTA 1YJNQ 3J80E 2VXEA 2LRQA 3CCJA 2DL7A 3CCMA 4KT0E 3SWNA 4M7AA 5IXBA 5KYWB 3UWNA 5LJ3h 3OYHA 1WQ7A 1VQOQ 4AFSC 1SHFA 2KMTA 2LCCA 3QWYA 2IIMA 3S3OA 4QQDA 2HNIA 3V8JA 4HKEA 2MOXA 2MYSA 1FWZA 5CIUA 2IPOB 2E10A 2EYXA 4FT4A 3PIPA 2IVWA 4JLGA 3LGFA 1YBYA 1VQ9T 3OYYA 1PCXA 3CC7Q 2CP3A 2F2XA 2DX1A 1UDLA 5GAMf 1QP3A 3HRTA 4LD6A 5M9OA 2WSCE 5FWBA 3L2ZA 1Y96B 3CC4A 4PJLA 4B9WA 2GCXA 1ZLMA 6AT1B 4M78G 2A28A 4M77C 3M4GA 4ORZA 1TUGB 2FL7A 1ZBJA 4C0ZA 1XJWB 2QTXA 1G3TA 1PD1A 3ZBDA 1BI1A 3E19A 2ROTA 1MHNA 1TWBA 2CREA 4QVZA 1YIJQ 1K8AC 4XTYA 3M0UA 3KUFA 1M8VA 1WHJA 3GIBA 2J6FA 2SRCA 3CMAT 1BU1A 1VQNA 2RN8A 4RTTA 4BE2A 3M0RA 2XIDA 4LDXA 1KFZA 4IUTA 4WF2A 1YJ9A 3V8KA 1Q82C 4DA4A 1C0MA 1QWFA 1B07A 1YITQ 2VXFA 3CD6Q 2MPXC 3A8LB 1NE8A 3LH5A 2X51A 2DD5A 3EH2A 3RESA 4M7AE 4Z8AA 2NWMA 2DETA 1KQSS 2ZCFB 4JZ3A 1M5Q1 1YP5A 3THKA 5GAMe 2FVUA 2RHXA 1BK2A 1TTHB 1AZGB 2K3XA 2LQ8A 5GAOp 2QTVA 5I2SA 4LUEA 3MKDA 3EFOB 3G1JA 3UT1A 3M0TA 2CGHA 1MV3A 1YJWT 4M75A 2FHDA 2YRCA 4A63B 2DE0X 4E7KA 1H641 4F7UB 2RH2A 1TOVA 2YWWA 5GANd 1B7TA 1N8RC 4M7DA 1VQ9Q 4RCBA 4E2FB 2YT6A 4F7UF 5ECAA 1BBZA 1ABOA 1G3YA 2V8KA 4FSSA 3CCQA 5GAN8 2M0YA 4JS5A 5HKCA 4WCIA 2RK1A 2GTJA 4LDYA 1LCKA 1TS9A 3VS0A 5FRNA 1W6XA 3FRNA 5LJ5h 1H3ZA 2LCLA 5FROA 5LJ3d 4PJNA 2K6DA 1IGQA 4HVWA 1VQ8A 1QQJA 4FYYB 3H6ZA 2CH4A 4A4EA 3L1AA 2X9HA 1R77A 1ZHIA 1TU0B 1K9MC 1OEBA 1ZUUA 1QW1A 3NFCA 1QVGA 2RHZA 1U5SA 3HRSA 2AKKA 4FYWB 2F1LA 1A0NB 2KXDA 1K73C 4BB7A 2DL3A 4MZMA 2L89A 3TVTA 1G5VA 2GNCA 4FL6A 1HXDA 1NBEB 3CBPA 4LD9K 3I35A 2LNVA 2EJGA 4C8QC 1M27C 2ESWA 1W2BA 2M16A 3CMAQ 1JU5C 1LPLA 3URGA 5A0GA 2HZYA 5GAN3 2K5IA 3I5RA 4MDXA 1JQQA 1MGQA 2PQWA 3G6EA 4FCYA 3JRZA 3PE0A 1VQPQ 2B86A 2L3RA 4PFZA 5A2QE 2YUOA 3VS3A 2P84A 4EPCA 2L3QA 3OYEA 4ME7A 1I5OB 5GAMj 2C0OA 4M4ZA 1HK9A 3CCRQ 2G6FX 2DYIA 2KNBB 3CC2T 1FMKA 2LNHB 4LDWA 4MMLA 1GBQA 1LNXA 3EGUA 1PRMC 2ZAEA 2OTJT 2SEMA 3PGGA 1YJWQ 4M75E 2P0KA 1I0CA 1D0ZA 2E5QA 2A08A 3L2UA 1M2VB 4M7DE 1VQ4Q 1X27A 4QQ6A 3TSZA 2HSPA 1VYUA 4PK4A 2HMAA 4Y91A 1I07A 3LWHA 5IAYA 3Q1JA 3OS1A 4KH0B 2QA4A 4HVUA 5LJ3g 1Z9ZA 5A0LA 3H0FA 1B34A 1U06A 4F16A 4C92A 4WTOB 3H8ZA 3CCST 3D7SB 3CCLT 4NL3A 1BYMA 3LLRA 1IGUA 1S72T 1MV0B 1G2BA 5HY6A 4J8OA 5GAOq 2QK0A 1OPKA 3G71T 1NEBA 3MEUA 1JBMA 1QCNA 1NLPC 4NL2A 1CKBA 1Q7YC 1UJYA 1UG1A 2W10A 3FDRA 5CKEA 2AHJB 4FSXA 4Z88A 3EH1A 2DVJA 1RACB 3QHSA 2WACA 4M77F 1W1FA 1ZSGA 2DEQA 2XDDA 2JJ9A 2CUDA 4X34A 2HBWA 4YTLA 2DF6A 2CP5A 3PFSA 3EGDA 3JB9H 1UE9A 2E6NA 3JCMV 1AOJA 2EQUA 1XOVA 1NYFA 1JJ2P 3M4YA 3VRZA 2O31A 4RTUA 1PM3A 2XG8D 2EYYA 4PFOA 1WFWA 2QQAA 3HFOA 2GQVA 5KH6A 4FIBA 4DBHA 5C6SA 2DKGA 4N0AA 4EMKA 3OYIA 1JJ2A 1RAIB 2LMJA 4D8DA 3A98A 2MWOA 2LX7A 4J9BA 3QZ5B 4GY5A 3CC4T 3CCEA 2OAUA 4PKCC 1WJRA 1PWTA 1UTIA 3TQ7P 2CSIA 1VIEA 1U3OA 2EGEA 2AIRB 2AZSA 4ZGJB 1NG2A 5J3BA 5FRMA 1FYNA 3CC2Q 3E1SA 2DTIA 3GOXA 4KGVB 4A4GA 1KD1C 2OTJQ 4FM4B 1N9RA 1UGVA 1AZEA 3P8BB 3J81E 3JCMc 2DJQA 3CPWP 2FYKA 1EFNA 3CBMA 3OYLA 2XDBA 4RG8A 1K8AR 2HL3A 3FC3A 3AT1B 3PNWC 3QZ9B 1BCOA 3JCMh 5GAN6 5KE2A 4JRQA 1VQNT 5J39A 2ZPEB 3M0QA 5EC7A 4IUPA 1JO8A 4C92E 3CCSQ 2XD0A 1UUEA 9ATCB 2E41A 2G3RA 1S72Q 1JXMA 1NJIC 2RB6A 3DB3A 3X25B 1MUZA 2QQBA 4M77G 2JN0A 4KGZB 3G71Q 1Q82R 2E3HA 1TUDA 3AHUA 2JW4A 3E2UA 3MEVA 4MZTA 4M77D 4OGEA 4QQGA 2F5KA 8AT1B 3JCMb 3QPHA 3IQLA 2KT1A 1VQ5A 3RMQA 1GCPA 4J6WA 4RTZA 2NUZA 1VIFA 4L59A 2EJ9A 1QMCA 2QGGA 3OW2S 2DZCA 1H3HA 3OYMA 1YCYA 2CP0A 4C8QB 3CCVA 4OMOA 1Z9QA 1KC8C 1C6VX 1OZ3A 1GCQA 2DO3A 4GLKA 1C1AA 5LJ5g 3OYJA 1OYXA 4C8QF 1GL5A 3M53A 1M1KC 1N8RR 5C0MA 3JAME 2CT3A 1PD0A 4KH1B 4X9CA 4ZNXA 1SSFA 1M90C 3CCQT 3V7SA 1SF9A 2JVVA 1P92A 3NTHA 1RAFB 2MAMA 4LN2A 2J06A 4E7ZA 2X4XA 2K79A 3I56A 5GAN4 3CC4Q 1PSFA 3EG9A 4R0KA 2QEXA 3BFMA 3S6WA 3E9FA 3KFVA 4K11A 4CRIA 4JUVA 1D0YA 2KDSA 2DL8A 4HT8A 3M56A 3MP8A 5GMKi 2RQUA 3SEMA 2EIFA 2F69A 3HRUA 3V7RA 1OPLA 1ZX6A 1KJWA 4AT1B 4IKFA 1BCMA 1VQ6A 1ARKA 4JJDA 3OQ5A 2K3BA 1FMVA 5CQYA 3G4SQ 4JRIA 4F04B 1K9MR 3O8VA 2VB6A 1X2KA 1MMAA 3O5ZA 3CCUA 2K7AA 1KIKA 3UA7A 2L3SA 3EG0A 5I21A 3M0PA 5GAN5 1K73R 4EMGA 1WA7A 1SG5A 4O5VA 3I55Q 4C5HA 2VGNA 3EHRA 2PVGB 3C0CA 1OV3A 2DL5A 3RMSA 1I8FA 2CUBA 3CMEA 3T9NA 4M75B 4IURA 1B3QA 4EDUA 1NYGA 5KYXA 2O4XA 1MNDA 4M7DB 1E7OA 2EVRA 2L3PA 1FXXA 1AWOA 2E6ZA 3QJ6A 1RAHB 2CH4W 1AEYA 2QI2A 4FYVB 1IHWA 2CP7A 5FU6B 1ZA1B 4BI3A 1NPRA 4RTYA 3VU3C 3OYDA 2JM9A 2P0QA 3L42A 5KCHA 1O9SA 2K5FA 4C8QG 4J9FA 4IUQA 1WHMA 2JS2A 2VKNA 1TH7A 4J6XA 3SDZA 2M9UA 3OYFA 4C8QD 2COYA 3JCMX 2YXYA 4OB3B 3OYGA 1IB8A 1OI1A 2HDAA 1K1ZA 2R58A 3JCMd 4PLLA 3JCMW 1SEMA 1Y57A 3GLXA 2QA4T 1WI7A 1NM7A 4GLMA 1ABQA 1RLQC 2LP5A 4OP0A 3CCQQ 2R57A 1YHQA 5DY9A 1QVFS 2X4YA 1N27A 1HYOA 3QKJA 4JLIA 4A4HA 2D9TA 3M58A 4E7HA 1Q81U 2ZPBB 4PJOB 2DBMA 1LVKA 3EFRA 3LW5E 3RNJA 1G83A 5DM7R 2XMFA 2HAXA 3EAEA 2A7YA 2Y4YA 3MPUB 3QBYA 3KXTA 3FJ5A 2ED1A 4PJOF 1QP2A 4LXCA 2QXFA 5LJ3e 4J6YA 3OS0A 1Q7YR 1WJQA 4BDZA 1WXUA 1YCSB 4M78A 3WXMB 1WLPB 2YHTA 4R56A 2KYBA 4F14A 3RDVA 1ZBXA 2KRMA 2MWPA 2P0PA 2E64A 1MNEA 3VS5A 4P5NA 1YJNA 1H8KA 1X01A 4C0DB 3G7ZA 2RHYA 2GQIA 1HSQA 5D6XA 4DBFA 1Q95G 4OGCA 1M1GA 1PC0A 1OQKA 2CS7A 2DMOA 1VQOA 5CK9A 3TSWA 4ZTFA 2RQVA 1R0BG 2JOYA 1D3BA 2JM8A 3VJPA 5GMKh 1E6HA 4LDUA 1R0CB 1QKWA 3H9NA 1Q86C 4OB0B 2DILA 1JRIA 2E12A 2WSEE 3DLMA 4C5IA 2JTMA 2BUDA 3SB2A 5KYYA 3CC7A 1WYXA 2LDMA 2ZPFB 1BIAA 3CXCP 1VQKT 2JNGA 2LJ3A 3M5AA 3J7AF 2OTLT 1B34B 5D6YA 4C92B 5L23A 2DYBA 2EKOA 3JCMg 1WZOA 1V76A 3INZA 2EYQA 1D1AA 1OU8A 1F1BB 4OF1A 3CXCA 2O9VA 2J6OA 2RI5A 2BZXA 2VASA 1VQLA 3OYNA 2KQWA 3FJPA 1KD1R 2OI3A 5LJ5f 1KHIA 1Y0MA 1SKUB 3MCAB 3OS2A 2VC8A 3SHWA 1QVGP 2AK5A 2DBKA 2QA4Q 1YI2A 3HKSA 3EGDB 5I11A 1N8RU 1O75A 1SRMA 4DBQA 1JXOA 2LQWA 1YIJA 1W2BP 2EW3A 3OS5A 2DIGA 4FW1A 2K9GA 4JJCA 3C12A 1OU9A 2HL5C 4PJJA 3JCMP 3M54A 4PJOD 4J9GA 4PJMA 5LJ3j 5J26A 1NJIR 3L2QA 4C5EA 1WGSA 3X24B 1WDXA 1VQ5T 5FW9A 5I22A 4EMKB 4M78E 2RQRA 2HCKA 4DQ2A 5EG2A 3MHXA 1VQ7T 2VUBA 2KYMA 1YITA 1BI2A 3CD6A 1W70A 2JMCA 4IUUA 2JZ2A 1EIFA 2XKOC 2HEQA 3QO3A 4Z89A 1ACMB 2Y90A 5GAMd 3TEEA 1X69A 3RUXA 1M4ZA 1K9MU 2IG0A 3TCJA 1PSEA 1KC8R
chains in the Genus database with same CATH topology
5J3BA 2CZ0B 5FRMA 3NTKA 4RMOA 4HT9A 4UC4A 3I55A 2D6FA 2NLUA 5GANg 2RK2A 3E1SA 4L5GA 4ZGEB 2ZPGB 4XU0A 4BD3A 4JDSA 4QW2A 4ELYC 2DTIA 3ZEHA 1K8AU 4M75G 3M59A 3CCLA 3JCMQ 1VQPT 3GOXA 2DTHA 3X26B 4A4GA 1KD1C 2LTOA 4FM4B 1N9RA 1YITT 1X75C 4A4KA 3I56T 4M75D 3P8BB 4A4FA 3S3MA 4F7UG 3CCET 2QEXT 4M7DG 1U1SA 3RKWA 2YLBA 4PLIA 1VQ9A 5GMKm 3J81E 3JCMc 2DJZA 2VXEA 3J80E 2LRQA 3CCJA 2FYKA 3CPFA 4KBMB 1UEBA 3CCRT 4KT0E 3CCMA 4M7DD 3CBMA 3SWNA 4M7AA 3OYLA 5LJ5e 4RG2A 2XDBA 3ER0A 4RG8A 2P4TA 2RM4A 3V7CA 3UWNA 1IREB 5LJ3h 3OYHA 2RJDA 3FC3A 2DK3A 3PNWC 2K5LA 1WQ7A 3QZ9B 3V8LA 4C5GA 3JCMh 3JSCA 2QQRA 2Y4XA 5GAN6 5KE2A 4JRQA 1VQNT 2KMTA 2LCCA 5J39A 1Q82U 4J7FA 4RCCA 3OA6A 2ZPEB 3S3OA 4QQDA 2HNIA 4IUPA 3SWNC 4JS4A 3V8JA 4M7AC 2PUOB 4C92E 4HKEA 2XD0A 4Z02A 5DLQE 4R55A 2RD1A 4XQ3A 1FWZA 2JTFA 5CIUA 1VQ6T 3L2WA 2E41A 2G3RA 2CZ1B 2E10A 3BDLA 1NJIC 2RB6A 3DB3A 2VGMA 1WNLA 2YLCA 2IVWA 4FT4A 3X25B 4C92F 2QQBA 4JLGA 3PIPA 3LGFA 2DXUA 4M77G 2JN0A 1YBYA 1VQ4T 4ATOA 5GAOm 3CCUT 2L5QA 1VQ9T 3VUBA 3OYYA 3QDRB 3AHUA 4M75C 3VYHB 3MEVA 3CCJT 5GANj 2CZ6B 4M77D 4MZTA 4XAXB 4OGEA 4L6V5 3CCMT 4QQGA 5FLXE 2F5KA 4ZGDB 3JCMb 1Q86U 1DJ7B 3QPHA 5GAMf 1RI0A 4M7DC 1XQHA 3QG1A 1VQ5A 1QP3A 3HRTA 3SD4A 2C06A 3RMQA 4PL6A 4J6WA 4LD6A 4DOWA 1XNIA 3OMGA 1VIFA 2LVMA 4BE0A 5M9OA 4L59A 4OB1B 2EJ9A 2BIVA 3F70A 2WSCE 3OW2S 2DZCA 3VUZA 2LT1A 1WPYA 3L2ZA 4PNOA 3OYMA 1YCYA 5FU6C 1Y96B 3CC4A 4BI4A 3S3NA 4C8QB 3CCVA 4PJOG 1KC8C 4C8QE 1Y96A 3OYKA 4B9WA 4XU3A 1OZ3A 1UGRB 2DO3A 4GLKA 1BKBA 5KCOA 2EJFA 1BI0A 3RIRA 2R5MA 5LJ5g 3JB9F 1M1FA 2GCXA 2MI6A 4J7IA 3OYJA 3CMAA 1OYXA 4C8QF 4ZTJA 3M53A 4BY6C 4M78G 2XK0A 4FU6A 1M1KC 5C0MA 3JAME 4BE1A 4M77C 4X9CA 2ZGWA 1SSFA 3M4GA 2FL7A 1M90C 3CCQT 1Y07A 3V7SA 4C0ZA 2JVVA 3CBOA 4Q5WA 1P92A 3NTIA 3NTHA 2QTXA 5A0DA 5CCAA 3JB9J 2LT4A 2MAMA 1VQPA 1Q7YU 2FB7A 3GP8A 1G3TA 3ZBDA 1BI1A 3E19A 5GMKe 2X4XA 1WJSA 3ZFJA 1W4SA 5GAN4 1MHNA 3I56A 1PSFA 4QVZA 4HCBA 3X20B 2QEXA 5CR2A 1K8AC 3BFMA 4XTYA 3CCVT 2ZZDA 2DZ9A 3KUFA 3S6WA 4PJOA 1M8VA 3N5BB 3GIBA 4FT2A 3CCRA 3E9FA 3HPWA 4E7LA 4BI8B 4CRIA 4OVAA 4JUVA 2KDSA 1V29B 3CMAT 4Y28E 3OYAA 4HT8A 4ZN1A 3M56A 3MP8A 3L2VA 1W2BS 1VQNA 4PJOC 5GMKi 3TREA 2DPPB 2EIFA 3BDUA 4BE2A 3A8HB 3LGLA 2XIDA 2CYZB 2F69A 5CKFA 4LDXA 2XI9A 3HRUA 4TVRA 3V7RA 4BUGA 4LDVA 4IUTA 5GAN2 1K73U 4WF2A 1YJ9A 1YJWA 4IKFA 2K4YA 4XTVA 3V8KA 5IT9E 1Q82C 1VQ6A 4M78C 4DA4A 2HBPA 2DXBA 2DIQA 2RJEA 3OQ5A 3OBWA 4QVDA 5LJ5j 2VXFA 1VUBA 3A8LB 5CQYA 1NE8A 1WQWA 4JRIA 4NOYA 5L8RE 3MEWA 3O8VA 3L2RA 1VQ4A 2DD5A 3SWNB 3CCUA 2EQMA 4M7AB 2D0QB 5I21A 3RESA 4M7AE 4BDYA 1M9SA 5CQXA 5GAN5 1OZ2A 3LWIA 3FB9A 1JB0E 1KQSS 2ZCFB 1M5Q1 2DVEA 4C92G 4C0DC 5GAMe 4EMGA 2FVUA 4M7AF 2RHXA 1GXIE 4O5VA 4C5HA 4XTXA 2K3XA 2VGNA 5CO7A 2LQ8A 4ZN3A 2PVGB 4J5YA 3OSSC 5FU7C 3RMSA 1I8FA 4C92D 2GF7A 5I2SA 3T9NA 4M75B 3CMEA 4IURA 1M90U 3UT1A 2M0OA 2CGHA 4EDUA 1YJ9T 1YJWT 3JCMJ 3FLGA 2RHUA 4M75A 2FHDA 5CKBA 1UGPB 1ZQ1A 1UB4A 2O4XA 4E7KA 1H641 1Y71A 2KVQG 4F7UB 2RH2A 2EQKA 4M7DB 3E9GA 2X4WA 5D6WA 1FXXA 2KSSA 5GANd 2E6ZA 3QJ6A 4F7UA 4KUIA 2XU8A 1N8RC 3RERA 4M7DA 2QI2A 4RCBA 2RO0A 1NZ9A 3DKMA 4F7UF 1I4K1 1KD1U 2XDPA 3P8DA 5FU6B 3LYIA 1N6AA 5GAN7 3HL8A 4BI3A 1NPRA 2BKDN 4JRKA 4IUVA 3A8OB 2GFUA 4II1A 3VU3C 1G3YA 4CI0C 3OYDA 5LL6S 2P0QA 2V8KA 3OW2A 3L42A 3CCQA 5KCHA 2KAFA 5GAN8 3CMET 4JS5A 3LX7A 1VQ7T 4V2SA 1O9SA 3M9QA 5HKCA 2RK1A 2K5FA 4ELZC 4C8QG 4IUQA 3MEAA 4LDYA 3ASKA 4BY6B 3MP1A 4C92C 3WVEB 1TH7A 1Y7XA 3CXCS 4J6XA 5FRNA 3SDZA 2M9UA 3JB9D 3OYFA 4M77B 4JJNK 4C8QD 3FRNA 5CKHA 5LJ5h 1H3ZA 3JCMX 2HD0A 4XTWA 5CKDA 4OB3B 3OYGA 3MO8A 2LCLA 4M77A 5FROA 5LJ3d 4E7JA 3HSBA 2PUKB 3OBYA 1OI1A 2EWNA 2R58A 3JCMd 3C95A 1VQ8A 4PLLA 3JCMW 2E70A 3GLXA 3H6ZA 2QA4T 4MZPA 3BW1A 3CEYA 5GAMg 4A4EA 4B9XA 3L1AA 3QSUA 3PMIA 5GMKj 5HK3A 2PVDB 1QVFA 2DAQA 4OP0A 1ZHIA 2HQEA 2R57A 1K9MC 1YHQA 4D6WA 1QW1A 5DY9A 1QVFS 2XICA 2X4YA 1N27A 3P8HA 3QKJA 3NFCA 1QVGA 2RHZA 4JLIA 1KG1A 3HRSA 3VKIA 2D9TA 3M58A 4A4HA 1LJOA 2ZPBB 4E7HA 1Q81U 1VQLT 4N4IA 4PJOB 1AHJB 3EFRA 1K73C 3LW5E 2V8JA 4BB7A 1UGQB 2RA2A 1U8RA 1QVGS 4PJOE 4MZMA 2L89A 5DM7R 1G5VA 3PT9A 4FL6A 1HXDA 2LC4A 2HAXA 3CBPA 4LD9K 2OTLT 2LNVA 2I2LA 2EJGA 3EAEA 2A7YA 2Y4YA 3QBYA 4C8QC 5GANf 1VQ8T 3KXTA 3OY9A 1W2BA 4PJOF 4M78B 2M16A 3CC2A 1QP2A 2EAYA 3LH0A 2QXFA 5LJ3e 4J6YA 3OS0A 1YI2T 3URGA 1WJQA 4BDZA 5A0GA 4XU2A 4M78A 3WXMB 3QYHB 2PU9B 5CAIA 3JCMe 5GAN3 2K5IA 4MDXA 4C0FA 2YHTA 1MGQA 4XK8E 4R56A 2PQWA 4RKUE 3G6EA 4M78F 1ZBXA 2MWPA 2P0PA 2DD4A 3X28B 2E64A 2K3YA 3OSVA 3JRZA 2VYTA 1YHQT 1JJ2S 5LJ5d 5CVIA 3JB9I 3PTAA 4A54A 2L3RA 2GFAA 4P5NA 4A53A 2PVOB 1YJNA 2WSFE 3SFMA 1X01A 4C0DB 4EMKC 5A2QE 3G7ZA 2RHYA 3UPUA 5D6XA 4EPCA 3OYEA 4ME7A 5FU7B 3QXEB 2H3JA 3C94A 4OGCA 5GAMj 1VQKA 4HCCA 1M1GA 4M7AD 2CS7A 1VQOA 1HK9A 1KQSA 5CK9A 4HA8A 2XHCA 2OTLA 4XU1A 4DOVA 3PIOA 4ZTFA 1KQ2A 3BY7A 5LJ3f 1D3BB 3CC2T 4LDWA 4MMLA 3JCMf 3CCSA 2JOYA 1D3BA 4BACA 1LNXA 4N4GA 4OB2B 3VJPA 1X6OA 5AYFA 5GMKh 1VQMT 1I5LA 2OTJT 1S72A 3PGGA 3G6ET 4LDUA 5GAOr 3CD6T 1R8OB 1Q86C 3G4ST 2O4XB 4OB0B 1KHCA 5GAOn 3OYBA 4M75E 1JRIA 2DXTA 2P0KA 2E12A 2WSEE 3DLMA 3R6OA 2E65A 3G71A 4C5IA 2JTMA 2E5QA 2M1HA 1YJNT 2BUDA 3SB2A 3CC7A 4F7UE 3L2UA 2EQJA 2ZPIB 4M75F 2E1HA 2LDMA 2ZPFB 4M7DE 2ZPHB 1BIAA 4QQ6A 3GNFB 4MDWA 3KBGA 1VQKT 1FX7A 2JNGA 4Y91A 3M5AA 1VQOT 3LWHA 3J7AF 2V8IA 4QVCA 1U1TA 5IAYA 3I55T 3Q1JA 1B34B 3OS1A 3QYGB 3DLLA 1BI3A 5D6YA 2QA4A 4C92B 3OYCA 4M7DF 4HCZA 5LJ3g 4C0GA 2X35A 3RKYA 5A0LA 2EKOA 3JCMg 1B34A 3CPWA 5IN1A 4C92A 3H8ZA 3CCST 3CCLT 4NL3A 3GNGA 1BYMA 3QJYA 5KE3A 3LLRA 2RJCA 2CZ7B 3C4SA 3INZA 2EYQA 3OMCA 3TU4K 3QIIA 3CPWS 1S72T 4OF1A 3CXCA 5HY6A 2QDYB 4N4HA 3QUIA 3JB9G 2QQSA 2RI5A 4J8OA 5GAOq 3PMTA 2DTOA 1VQLA 5GMKl 3OYNA 2KQWA 3FJPA 3G71T 3FEOA 3M57A 5LJ5f 3MEUA 1KHIA 1JBMA 4NL2A 3OB9A 3CC7T 1N9SA 2RI3A 4M77E 3MCAB 1Q7YC 4XTZA 3OS2A 2VC8A 3A8MB 1Q81C 5GAMh 3FDRA 3ME9A 5CKEA 2AHJB 4FSXA 2EFIA 5GAOp 2O01E 3QHSA 2WACA 1NPPA 2RHIA 4M77F 4XTUA 5GANe 4JRPA 1G3WA 2DEQA 2XDDA 1YI2A 2YRVA 3HKSA 1NJIU 4KULA 4X34A 2VV5A 2DXCA 1VQ7A 4YTLA 1N8RU 3DB4A 3M55A 1O75A 1XTDA 3PFSA 2RJFA 1KQ1A 2JUFA 3JB9H 3A5ZB 2R5AA 1I81A 1YIJA 2E6NA 1G3SA 3OS5A 2DIGA 3JCMV 2CKKA 1QVPA 3A8GB 2EQUA 2L8DA 3C12A 4MMKA 3RKXA 4C8QA 5GAOl 4KUDK 1XOVA 1BIBA 3VYGA 3VV0A 3JCMP 3M54A 4PJOD 3M4YA 3MP6A 2HQXA 5LJ3j 5J26A 1IZ6A 2XG8D 3L2QA 2K2VA 4C5EA 5HK0A 2KY9A 1WGSA 2QQAA 3HFOA 2GQVA 2KK4A 3HFNA 5KH6A 3X24B 1VQ5T 4M78D 4NS5A 4E7IA 5DLOA 4FIBA 4X9DA 3META 1RL2A 4EMKB 5C6SA 2LX9A 4M78E 4DQ2A 3EFSA 3FIFA 1LOJA 3HHTB 3MHXA 4OMFB 5EG2A 2DKGA 1KC8U 2VUBA 4N0AA 4EMKA 4E47A 2A3LA 2X4JA 4J83A 3OYIA 1BI2A 1YITA 4VUBA 1VQMA 1JJ2A 2MWOA 2OTJA 1UGSB 3CD6A 3WVDB 3G4SA 2MF2A 4IUUA 3QZ5B 4GY5A 3CC4T 2JZ2A 3CCEA 1EIFA 2LQKA 2QQ9A 2OAUA 4PKCC 5I2MA 1YIJT 1WJRA 2XKOC 3GPLA 2K57A 2B8AA 3QO3A 2MMPA 1M1KU 5GAMd 2Y90A 4N0AC 3TEEA 4M7AG 4O6JA 1VIEA 5GANh 3RUXA 2RI2A 1M4ZA 2F5TX 3GF5A 3HP9A 2IG0A 3TCJA 3UDCA 4EMHA 1K9MU 1PSEA 4ZGJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7S A;  4F7U E;  4M75 F;  2E1H A;  4C92 C;  1TH7 A;  4HT9 A;  4M7D E;  4J6X A;  1BIA A;  2QTX A;  5GAN g;  3JB9 D;  4M77 B;  2FB7 A;  4Y91 A;  4C8Q D;  5LJ5 h;  4XU0 A;  3JCM X;  4XTW A;  2DTI A;  4QVC A;  1U1T A;  5GMK e;  1B34 B;  4M77 A;  4M75 G;  5LJ3 d;  5GAN 4;  4M7D F;  4C92 B;  3JCM Q;  3HSB A;  5LJ3 g;  2DTH A;  2EWN A;  3BFM A;  4XTY A;  3RKY A;  3JCM d;  1N9R A;  3JCM g;  1B34 A;  2DZ9 A;  5GAN d;  3JCM W;  4PJO A;  1M8V A;  4C92 A;  4M75 D;  3GIB A;  4NL3 A;  4F7U G;  3BW1 A;  4M7D G;  1U1S A;  5GAM g;  3INZ A;  2YLB A;  3RKW A;  4JUV A;  5GMK m;  3L1A A;  3QSU A;  5GMK j;  3JCM c;  2DJZ A;  2VXE A;  2FYK A;  4HT8 A;  3JB9 G;  3QUI A;  4OP0 A;  4M7D D;  3SWN A;  5GAO q;  4M7A A;  2DTO A;  5LJ5 e;  5GMK l;  4PJO C;  5GMK i;  2RM4 A;  3FJP A;  3V7C A;  5DY9 A;  5LJ3 h;  3BDU A;  3V8L A;  5LJ5 f;  1WQ7 A;  1JBM A;  4NL2 A;  3JCM h;  5GAN 6;  1N9S A;  4JLI A;  3V7R A;  4M77 E;  1LJO A;  5GAN 2;  4XTZ A;  4RCC A;  2VC8 A;  4WF2 A;  4PJO B;  3EFR A;  4XTV A;  3V8K A;  5GAM h;  2HNI A;  2RA2 A;  4M78 C;  3SWN C;  3V8J A;  4M7A C;  4PJO E;  4QVD A;  4C92 E;  5LJ5 j;  2VXF A;  3QHS A;  1HXD A;  4M77 F;  1WQW A;  2RD1 A;  4JRI A;  4NOY A;  4XQ3 A;  4XTU A;  5GAN e;  1KQ2 A;  2DEQ A;  2I2L A;  2EJG A;  4C8Q C;  5GAN f;  2E41 A;  2E10 A;  4PJO F;  4M78 B;  3SWN B;  4M7A B;  2EAY A;  2RB6 A;  4C92 F;  2YLC A;  1WNL A;  5I21 A;  5LJ3 e;  3RES A;  4J6Y A;  4M7A E;  2DXU A;  4M77 G;  2JN0 A;  4XU2 A;  4M78 A;  5CAI A;  1KQ1 A;  3JCM e;  5GAN 3;  5GAN 5;  5GAO m;  3JB9 H;  3FB9 A;  3AHU A;  1I81 A;  1M5Q 1;  2YHT A;  4M75 C;  1MGQ A;  5GAN j;  3JCM V;  2DVE A;  4M77 D;  4C92 G;  5GAM e;  4M78 F;  4MMK A;  4C8Q A;  4EMG A;  3RKX A;  5GAO l;  4M7A F;  2E64 A;  4XTX A;  1BIB A;  5LJ5 d;  3JCM b;  3JCM P;  5GAM f;  5GAO p;  4J5Y A;  3JB9 I;  4PJO D;  4A54 A;  1I8F A;  4C92 D;  5LJ3 j;  4M75 B;  4A53 A;  4M7D C;  1X01 A;  4EMK C;  2CGH A;  4J6W A;  3JCM J;  4M75 A;  3HFO A;  3HFN A;  1H64 1;  5GAM j;  4F7U B;  2EJ9 A;  4M78 D;  4M7D B;  4M7A D;  2DZC A;  1HK9 A;  4X9D A;  4EMK B;  4M78 E;  1WPY A;  3L2Z A;  4HA8 A;  4PNO A;  1YCY A;  4XU1 A;  3EFS A;  4DQ2 A;  3FIF A;  1Y96 B;  4F7U A;  1LOJ A;  3RER A;  3BY7 A;  4M7D A;  4RCB A;  2DKG A;  1D3B B;  4N0A A;  5LJ3 f;  4C8Q B;  4EMK A;  4PJO G;  4MML A;  3JCM f;  4C8Q E;  4F7U F;  1Y96 A;  1I4K 1;  4XU3 A;  1D3B A;  1LNX A;  5GAN 7;  2EJF A;  5GMK h;  3RIR A;  1I5L A;  5LJ5 g;  3PGG A;  5GAO r;  2K57 A;  3JB9 F;  3QO3 A;  4JRK A;  3SB2 A;  4C8Q F;  5GAM d;  2Y90 A;  4N0A C;  4M78 G;  4M75 E;  1JRI A;  2DXT A;  3VU3 C;  5GAO n;  4M7A G;  2E65 A;  5GAN h;  5GAN 8;  4M77 C;  3RUX A;  4X9C A;  2ZGW A;  4EMH A;  4V2S A;  3JB9 J;  3M4G A;  4C8Q G; 
#chains in the Genus database with same CATH topology
 2CDT A;  4HT9 A;  4UC4 A;  2D6F A;  5GAN g;  4BD3 A;  4JDS A;  2PTK A;  1M1K R;  4RTV A;  1X75 C;  4JJB A;  4A4K A;  3I56 T;  3S3M A;  4A4F A;  2NYS A;  2NUT A;  1M90 R;  4F7U G;  2QEX T;  1VQ9 A;  5GMK m;  4AG1 C;  4GBQ A;  3CPF A;  1YFN A;  1VYV A;  5LJ5 e;  1VQK Q;  1GRI A;  2RJD A;  2DK3 A;  4C5G A;  2CSQ A;  2K5L A;  3JSC A;  2QQR A;  2Y4X A;  4E7S A;  2X3X D;  2OTL Q;  3OA6 A;  4JS4 A;  4FYX B;  2PUO B;  4FW2 A;  4R55 A;  2RD1 A;  4XQ3 A;  3R6N A;  8ATC B;  2AZV A;  1VQ6 T;  2AKL A;  2CZ1 B;  2YLC A;  4QKU A;  3I9Q A;  5IXF A;  1KK7 A;  4ATO A;  5GAO m;  3CCU T;  2L5Q A;  4M75 C;  3VYH B;  2LJ0 A;  3CCJ T;  4XAX B;  3CCM T;  4L6V 5;  2BE7 D;  3RR6 A;  1DJ7 B;  1E6G A;  1RI0 A;  1T0H A;  4M7D C;  1OOT A;  3QG1 A;  3SD4 A;  2C06 A;  1T3L A;  1RUW A;  4BE0 A;  3VS2 A;  1PRL C;  1ZSZ B;  2E5K A;  3VUZ A;  2LT1 A;  1TSF A;  1UFF A;  4PNO A;  5FU6 C;  2EYW A;  1IXD A;  4OMP A;  3OYK A;  2DEU A;  1UGR B;  2OX7 A;  1BKB A;  2EJF A;  1BI0 A;  1TUC A;  3RIR A;  3JB9 F;  1M1F A;  2MI6 A;  3CMA A;  4ZTJ A;  4FU6 A;  2ZGW A;  5IHI A;  4IIM A;  3CBO A;  4Q5W A;  3NTI A;  5A0D A;  1VQ7 Q;  5CCA A;  1VQP A;  1Q7Y U;  2FB7 A;  3GP8 A;  3EG9 B;  1NEG A;  1W4S A;  4HCB A;  5CR2 A;  3N5B B;  2EGA A;  4HVV A;  2OAW A;  3CCR A;  3HPW A;  2M02 A;  1QLY A;  4Y28 E;  3OYA A;  2DRM A;  1YN8 A;  1W2B S;  4PJO C;  3NPF A;  3LGL A;  2XI9 A;  5KYU B;  1YJW A;  2K4Y A;  3QWX X;  2DXB A;  1CKA A;  2DIQ A;  1YWO A;  4QVD A;  3OBW A;  1KSW A;  5LJ5 j;  3I56 Q;  1VUB A;  2RQW A;  4NOY A;  5L8R E;  4DEY A;  1VQ4 A;  2BTT A;  1OUL A;  3SWN B;  2EQM A;  4M7A B;  4BDY A;  1OZ2 A;  2DVE A;  4C0D C;  4OMQ A;  4M7A F;  1WHL A;  2E4H A;  4J5Y A;  2YUQ A;  3OSS C;  4E7L A;  3EG2 A;  3NHN A;  1SSH A;  2M0O A;  4CC2 A;  1YJ9 T;  3CCL Q;  3JCM J;  1VQ6 Q;  5CKB A;  1WX6 A;  1ZQ1 A;  1UB4 A;  2BZ8 A;  2X4W A;  5D6W A;  2KSS A;  3RER A;  2XU8 A;  2FRY A;  2FPE A;  3CCJ Q;  3DKM A;  3CCM Q;  2QDL A;  1I4K 1;  3A1P A;  1KD1 U;  5IH2 A;  3P8D A;  3LYI A;  1N6A A;  5GAN 7;  4IUV A;  1M3A A;  3A8O B;  2GFU A;  4CI0 C;  3EG1 A;  4HXJ A;  3LX7 A;  1PKS A;  4BY6 B;  3MP1 A;  4C92 C;  1Y7X A;  1HJD A;  4ESR A;  3JB9 D;  1Q86 R;  2HD0 A;  1UJ0 A;  3MO8 A;  4M77 A;  4E7J A;  1M30 A;  3HSB A;  2EWN A;  1CSK A;  4J9H A;  2LQN A;  1X6G A;  4OMN A;  3CEY A;  4B9X A;  3PMI A;  5HK3 A;  4KGX B;  1QVF A;  1VOM A;  2F2V A;  2XIC A;  3EGX A;  1KG1 A;  1VQL T;  1AHJ B;  2EPD A;  2V8J A;  1PG5 B;  3PT9 A;  2KRN A;  1MMN A;  2I2L A;  1J3T A;  5GAN f;  1VQ8 T;  5HCK A;  3CC2 A;  4M78 B;  2CP6 A;  2EAY A;  3LH0 A;  2GTO A;  1YI2 T;  4XU2 A;  3JCM e;  2PU9 B;  2KBT A;  4C0F A;  3BE3 A;  4M78 F;  3VS4 A;  2DD4 A;  2K3Y A;  2VYT A;  1JJ2 S;  5CVI A;  1ZUY A;  2GFA A;  2PVO B;  1AVZ C;  2NUP A;  4EMK C;  1AWJ A;  2O9S A;  2I0N A;  3VS7 A;  3UPU A;  5FU7 B;  3QXE B;  2H3J A;  3C94 A;  2BZY A;  1RAD B;  4HCC A;  4M7A D;  1KQS A;  4HA8 A;  2XHC A;  1KQ2 A;  3PIO A;  3BY7 A;  5LJ3 f;  1D3B B;  4J9D A;  3CCS A;  1VQN Q;  4BAC A;  3NMZ C;  4N4G A;  1S72 A;  3G6E T;  5GAO r;  3CD6 T;  1YJ9 Q;  1KHC A;  5GAO n;  2DXT A;  5KYY B;  4RTW A;  3G71 A;  1WIE A;  4J9E A;  3VS1 A;  2RPN A;  4M75 F;  2RF0 A;  1WHK A;  2E1H A;  3GNF B;  3KBG A;  2EBP A;  1T0J A;  4AMC A;  3H0H A;  4QVC A;  1U1T A;  3QYG B;  1BI3 A;  4M7D F;  5AT1 B;  3OYC A;  4HCZ A;  3REA B;  7AT1 B;  3QJY A;  2KRS A;  2QYZ A;  2RJC A;  1M8M A;  2MK5 A;  3OMC A;  3TU4 K;  3CPW S;  2QDY B;  4N4H A;  3QUI A;  5D7U A;  3PMT A;  2DTO A;  3UF4 A;  1PKT A;  3FEO A;  1N9S A;  1RAA B;  1TG0 A;  4M77 E;  4XTZ A;  2J7I A;  1Q81 C;  3UAT A;  5GAM h;  5GJV B;  1NPP A;  1RLP C;  2RHI A;  5GAN e;  2DFU A;  4JRP A;  2KRO A;  2YRV A;  3DB4 A;  3M55 A;  2COZ A;  1XTD A;  2KE9 A;  2RJF A;  1KQ1 A;  1X2Q A;  1G3S A;  5IHN A;  2CKK A;  1QVP A;  1VQL Q;  2L8D A;  4MMK A;  4C8Q A;  4KUD K;  1BIB A;  3VYG A;  1X43 A;  3VV0 A;  3MP6 A;  1ZSZ C;  2HQX A;  3GBQ A;  1IZ6 A;  4RUG A;  3CQT A;  1D1C A;  2VVK A;  2KY9 A;  3HFN A;  1VQ8 Q;  1H92 A;  1GCQ C;  2LJ1 A;  4M78 D;  4NS5 A;  5DLO A;  1I1J A;  4X9D A;  1RL2 A;  1YI2 Q;  2LX9 A;  3H0I A;  2DM1 A;  3HHT B;  4OMF B;  4E47 A;  2A3L A;  4VUB A;  1VQM A;  2QAS A;  3WVD B;  3G4S A;  1QWE A;  1K76 A;  2LQK A;  3GPL A;  2K57 A;  1RAB B;  4B6M A;  2A36 A;  1M3C A;  4F17 A;  2RI2 A;  2F5T X;  3UDC A;  3JB9 J;  3NTK A;  3ZL7 C;  3I55 A;  2NLU A;  2E3I A;  2FPD A;  2RK2 A;  4LUD A;  2ZPG B;  4ZGE B;  4XU0 A;  1ZA2 B;  3ZEH A;  3M0S A;  1K8A U;  4M75 G;  3M59 A;  3JCM Q;  1VQP T;  2NUT B;  3X26 B;  1GBR A;  2LTO A;  3G6E Q;  4M75 D;  2A0F B;  3CCE T;  4M7D G;  2ABL A;  3RKW A;  2YLB A;  4PLI A;  2DJZ A;  4KBM B;  1UEB A;  2DL4 A;  3CCR T;  4M7D D;  1SPK A;  1S1N A;  4RG2 A;  3ER0 A;  2P4T A;  2RM4 A;  3V7C A;  1IRE B;  1D09 B;  3V8L A;  5KYW A;  1Q82 U;  4J7F A;  4RCC A;  3SWN C;  1RAE B;  4M7A C;  3QDF A;  2BE9 B;  2KR3 A;  1OX9 A;  4Z02 A;  5DLQ E;  2JTE A;  2JTF A;  2QG9 B;  2Z0W A;  2FRW A;  3L2W A;  3BDL A;  2FO0 A;  2VGM A;  1WNL A;  2FZG B;  4C92 F;  2H8H A;  2RMO A;  4X1V A;  2DXU A;  2J05 A;  1VQ4 T;  1TXQ A;  3I5S A;  3VUB A;  3QDR B;  5GAN j;  2CZ6 B;  5FLX E;  1WXB A;  2YUN A;  4ZGD B;  4AG2 C;  1Q86 U;  5IHK A;  1XQH A;  4PL6 A;  1SRL A;  4DOW A;  1XNI A;  3OMG A;  2LVM A;  4OB1 B;  2ECZ A;  2BIV A;  3F70 A;  2LCS A;  4IIO A;  2GGR A;  2W0Z A;  1WPY A;  2DRK A;  4BI4 A;  3S3N A;  4PJO G;  3VRY A;  4C8Q E;  1Y96 A;  2L2P A;  1YNZ A;  4XU3 A;  2P4R A;  5KCO A;  2R5M A;  4J7I A;  1T3S A;  2QAZ A;  2C0I A;  4BY6 C;  2KT8 A;  2XK0 A;  2D8H A;  4BE1 A;  1AD5 A;  4JZ4 A;  2D0N A;  1Y07 A;  1X6B A;  1K0X A;  1M2O A;  2LT4 A;  5FWC A;  5GMK e;  1WJS A;  3ZFJ A;  3X20 B;  1MMG A;  2MCN A;  4E6R A;  3CCV T;  2ZZD A;  2DZ9 A;  4PJO A;  4FT2 A;  3VS6 A;  4BI8 B;  4OVA A;  2FPF A;  1V29 B;  4ZN1 A;  3L2V A;  3TRE A;  2DPP B;  3BDU A;  3A8H B;  2CYZ B;  5CKF A;  4TVR A;  4BUG A;  4LDV A;  3H41 A;  5GAN 2;  1K73 U;  4XTV A;  5IT9 E;  2CT4 A;  2FZK B;  4M78 C;  4AFZ C;  2HBP A;  2RJE A;  2JS0 A;  2COW A;  2RQT A;  1WQW A;  3CCE Q;  3MEW A;  2ENM A;  3L2R A;  3UA6 A;  4EIK A;  1K4U S;  3JV3 A;  2D0Q B;  3REB B;  1WHH A;  1M9S A;  5CQX A;  3LWI A;  3FB9 A;  1JB0 E;  4DBR A;  2OJ2 A;  3RBB B;  4C92 G;  1GXI E;  4XTX A;  4HCK A;  5CO7 A;  4ZN3 A;  5FU7 C;  4C92 D;  2GF7 A;  2O88 A;  1JEG A;  3FLG A;  2RHU A;  1UGP B;  2A37 A;  3EFO A;  1BB9 A;  3MJX A;  1Y71 A;  2KVQ G;  2EQK A;  3E9G A;  3OW2 P;  1D1B A;  4F7U A;  4KUI A;  1AWX A;  1IRX A;  2V26 A;  4QT7 A;  2RO0 A;  1NZ9 A;  1NLO C;  2KXC A;  1SHG A;  2XDP A;  3HL8 A;  2BKD N;  2V1Q A;  4JRK A;  1GFC A;  1RAG B;  4II1 A;  5LL6 S;  3OW2 A;  4AFQ C;  2PNI A;  2KAF A;  3CME T;  2EGC A;  2RNA A;  4V2S A;  3EG3 A;  3M9Q A;  4ELZ C;  3MEA A;  3ASK A;  3WVE B;  3CXC S;  4JJN K;  4M77 B;  5CKH A;  4XTW A;  5CKD A;  1QCO A;  2FEI A;  1AWW A;  2PUK B;  3OBY A;  1V1C A;  3C95 A;  2E70 A;  4MZP A;  2YSQ A;  2V1R A;  3BW1 A;  5GAM g;  2H3E B;  2FG0 A;  3QSU A;  5GMK j;  1VQ5 Q;  2PVD B;  2DAQ A;  2JXB A;  3EGX B;  2HQE A;  2YUP A;  4D6W A;  4J9I A;  3P8H A;  4OMM A;  3VKI A;  1LJO A;  4ANJ A;  4N4I A;  1U8R A;  1UGQ B;  2RA2 A;  3CCV Q;  1QVG S;  4PJO E;  2LC4 A;  1QKX A;  1AT1 B;  1UHC A;  1K0S A;  2HKQ B;  3OY9 A;  3PVL A;  2ATC B;  2J6K A;  3PVQ A;  1YWP A;  2MIO A;  5CAI A;  3QYH B;  1K9A A;  1Q81 R;  2ED0 A;  2KI7 A;  4XK8 E;  4RKU E;  4D8K A;  1IHV A;  3X28 B;  3OSV A;  1EX4 A;  1YHQ T;  5LJ5 d;  2M51 A;  2NUP B;  4DEX A;  3JB9 I;  3PTA A;  4A54 A;  4A53 A;  5KYN A;  2WSF E;  3SFM A;  1PNJ A;  4CC3 A;  2QEX Q;  1VQK A;  1WHG A;  2VWF A;  1PHT A;  4KRT A;  2OTL A;  4XU1 A;  4DOV A;  3JCM f;  4OB2 B;  1X6O A;  4RTX A;  2KEA A;  5AYF A;  1VQM T;  2YDL A;  1I5L A;  1R8O B;  3G4S T;  5KYX B;  2O4X B;  3OYB A;  3R6O A;  2O2O A;  1VYT A;  2HKN A;  2E65 A;  1IO6 A;  2M1H A;  1YJN T;  2HSE B;  2LZ6 B;  2CP2 A;  4LNP A;  2PZ1 A;  2EQJ A;  2ZPI B;  4F7U E;  2ZPH B;  1UEC A;  4MDW A;  2X3W D;  3CCU Q;  1FX7 A;  4OML A;  2FZC B;  1M2V A;  1N5Z A;  1VQO T;  2V8I A;  3I55 T;  3DLL A;  1ZUK A;  4C0G A;  2DNU A;  2X35 A;  3RKY A;  3CPW A;  5GJW B;  5IN1 A;  3GNG A;  2D8J A;  5KE3 A;  2CZ7 B;  1VA7 A;  3C4S A;  3CME Q;  2EKH A;  3QII A;  3JB9 G;  2QQS A;  2DLP A;  3NGP A;  5GMK l;  3M57 A;  4CC7 A;  2AT1 B;  3CC7 T;  1QVF P;  3OB9 A;  2RI3 A;  3A8M B;  2DA9 A;  3ME9 A;  3ULR B;  2EFI A;  2O01 E;  4XTU A;  2QGF B;  1G3W A;  1NJI U;  2YRD A;  4KUL A;  2VV5 A;  2DXC A;  1VQ7 A;  4J9C A;  4LE9 A;  4JPB W;  1EZZ B;  1ZSZ A;  2HQH A;  2EQI A;  2JUF A;  2ROL A;  3A5Z B;  2R5A A;  1I81 A;  3A8G B;  5GAO l;  1D0X A;  3RKX A;  3HTR A;  1MMD A;  4Y92 A;  2C0T A;  2K2V A;  2DER A;  5HK0 A;  2JT4 A;  1UHF A;  2KK4 A;  4E7I A;  2K2M A;  4PFP A;  3MET A;  3EFS A;  3FIF A;  1LOJ A;  2F2W A;  1KC8 U;  2JMA A;  2EYZ A;  2X4J A;  4J83 A;  2OTJ A;  1KQS P;  1UGS B;  2MF2 A;  1YHQ Q;  1WXT A;  2QQ9 A;  5I2M A;  3EHQ A;  1YIJ T;  1M3B A;  2B8A A;  4AFU C;  2MMP A;  1M1K U;  4N0A C;  4M7A G;  1GFD A;  4O6J A;  5GAN h;  2D1X A;  1RI9 A;  3HP9 A;  3GF5 A;  4EMH A;  1HD3 A;  1M90 U;  2GBQ A;  2CZ0 B;  4RMO A;  3U23 A;  4L5G A;  1FMW A;  1QCF A;  4ELY C;  4QW2 A;  4CC4 B;  3CCL A;  2DTH A;  5KYU A;  1VQM Q;  1YIT T;  2L0A A;  1OX8 A;  1U1S A;  1G8X A;  2KGT A;  1YJN Q;  3J80 E;  2VXE A;  2LRQ A;  3CCJ A;  2DL7 A;  3CCM A;  4KT0 E;  3SWN A;  4M7A A;  5IXB A;  5KYW B;  3UWN A;  5LJ3 h;  3OYH A;  1WQ7 A;  1VQO Q;  4AFS C;  1SHF A;  2KMT A;  2LCC A;  3QWY A;  2IIM A;  3S3O A;  4QQD A;  2HNI A;  3V8J A;  4HKE A;  2MOX A;  2MYS A;  1FWZ A;  5CIU A;  2IPO B;  2E10 A;  2EYX A;  4FT4 A;  3PIP A;  2IVW A;  4JLG A;  3LGF A;  1YBY A;  1VQ9 T;  3OYY A;  1PCX A;  3CC7 Q;  2CP3 A;  2F2X A;  2DX1 A;  1UDL A;  5GAM f;  1QP3 A;  3HRT A;  4LD6 A;  5M9O A;  2WSC E;  5FWB A;  3L2Z A;  1Y96 B;  3CC4 A;  4PJL A;  4B9W A;  2GCX A;  1ZLM A;  6AT1 B;  4M78 G;  2A28 A;  4M77 C;  3M4G A;  4ORZ A;  1TUG B;  2FL7 A;  1ZBJ A;  4C0Z A;  1XJW B;  2QTX A;  1G3T A;  1PD1 A;  3ZBD A;  1BI1 A;  3E19 A;  2ROT A;  1MHN A;  1TWB A;  2CRE A;  4QVZ A;  1YIJ Q;  1K8A C;  4XTY A;  3M0U A;  3KUF A;  1M8V A;  1WHJ A;  3GIB A;  2J6F A;  2SRC A;  3CMA T;  1BU1 A;  1VQN A;  2RN8 A;  4RTT A;  4BE2 A;  3M0R A;  2XID A;  4LDX A;  1KFZ A;  4IUT A;  4WF2 A;  1YJ9 A;  3V8K A;  1Q82 C;  4DA4 A;  1C0M A;  1QWF A;  1B07 A;  1YIT Q;  2VXF A;  3CD6 Q;  2MPX C;  3A8L B;  1NE8 A;  3LH5 A;  2X51 A;  2DD5 A;  3EH2 A;  3RES A;  4M7A E;  4Z8A A;  2NWM A;  2DET A;  1KQS S;  2ZCF B;  4JZ3 A;  1M5Q 1;  1YP5 A;  3THK A;  5GAM e;  2FVU A;  2RHX A;  1BK2 A;  1TTH B;  1AZG B;  2K3X A;  2LQ8 A;  5GAO p;  2QTV A;  5I2S A;  4LUE A;  3MKD A;  3EFO B;  3G1J A;  3UT1 A;  3M0T A;  2CGH A;  1MV3 A;  1YJW T;  4M75 A;  2FHD A;  2YRC A;  4A63 B;  2DE0 X;  4E7K A;  1H64 1;  4F7U B;  2RH2 A;  1TOV A;  2YWW A;  5GAN d;  1B7T A;  1N8R C;  4M7D A;  1VQ9 Q;  4RCB A;  4E2F B;  2YT6 A;  4F7U F;  5ECA A;  1BBZ A;  1ABO A;  1G3Y A;  2V8K A;  4FSS A;  3CCQ A;  5GAN 8;  2M0Y A;  4JS5 A;  5HKC A;  4WCI A;  2RK1 A;  2GTJ A;  4LDY A;  1LCK A;  1TS9 A;  3VS0 A;  5FRN A;  1W6X A;  3FRN A;  5LJ5 h;  1H3Z A;  2LCL A;  5FRO A;  5LJ3 d;  4PJN A;  2K6D A;  1IGQ A;  4HVW A;  1VQ8 A;  1QQJ A;  4FYY B;  3H6Z A;  2CH4 A;  4A4E A;  3L1A A;  2X9H A;  1R77 A;  1ZHI A;  1TU0 B;  1K9M C;  1OEB A;  1ZUU A;  1QW1 A;  3NFC A;  1QVG A;  2RHZ A;  1U5S A;  3HRS A;  2AKK A;  4FYW B;  2F1L A;  1A0N B;  2KXD A;  1K73 C;  4BB7 A;  2DL3 A;  4MZM A;  2L89 A;  3TVT A;  1G5V A;  2GNC A;  4FL6 A;  1HXD A;  1NBE B;  3CBP A;  4LD9 K;  3I35 A;  2LNV A;  2EJG A;  4C8Q C;  1M27 C;  2ESW A;  1W2B A;  2M16 A;  3CMA Q;  1JU5 C;  1LPL A;  3URG A;  5A0G A;  2HZY A;  5GAN 3;  2K5I A;  3I5R A;  4MDX A;  1JQQ A;  1MGQ A;  2PQW A;  3G6E A;  4FCY A;  3JRZ A;  3PE0 A;  1VQP Q;  2B86 A;  2L3R A;  4PFZ A;  5A2Q E;  2YUO A;  3VS3 A;  2P84 A;  4EPC A;  2L3Q A;  3OYE A;  4ME7 A;  1I5O B;  5GAM j;  2C0O A;  4M4Z A;  1HK9 A;  3CCR Q;  2G6F X;  2DYI A;  2KNB B;  3CC2 T;  1FMK A;  2LNH B;  4LDW A;  4MML A;  1GBQ A;  1LNX A;  3EGU A;  1PRM C;  2ZAE A;  2OTJ T;  2SEM A;  3PGG A;  1YJW Q;  4M75 E;  2P0K A;  1I0C A;  1D0Z A;  2E5Q A;  2A08 A;  3L2U A;  1M2V B;  4M7D E;  1VQ4 Q;  1X27 A;  4QQ6 A;  3TSZ A;  2HSP A;  1VYU A;  4PK4 A;  2HMA A;  4Y91 A;  1I07 A;  3LWH A;  5IAY A;  3Q1J A;  3OS1 A;  4KH0 B;  2QA4 A;  4HVU A;  5LJ3 g;  1Z9Z A;  5A0L A;  3H0F A;  1B34 A;  1U06 A;  4F16 A;  4C92 A;  4WTO B;  3H8Z A;  3CCS T;  3D7S B;  3CCL T;  4NL3 A;  1BYM A;  3LLR A;  1IGU A;  1S72 T;  1MV0 B;  1G2B A;  5HY6 A;  4J8O A;  5GAO q;  2QK0 A;  1OPK A;  3G71 T;  1NEB A;  3MEU A;  1JBM A;  1QCN A;  1NLP C;  4NL2 A;  1CKB A;  1Q7Y C;  1UJY A;  1UG1 A;  2W10 A;  3FDR A;  5CKE A;  2AHJ B;  4FSX A;  4Z88 A;  3EH1 A;  2DVJ A;  1RAC B;  3QHS A;  2WAC A;  4M77 F;  1W1F A;  1ZSG A;  2DEQ A;  2XDD A;  2JJ9 A;  2CUD A;  4X34 A;  2HBW A;  4YTL A;  2DF6 A;  2CP5 A;  3PFS A;  3EGD A;  3JB9 H;  1UE9 A;  2E6N A;  3JCM V;  1AOJ A;  2EQU A;  1XOV A;  1NYF A;  1JJ2 P;  3M4Y A;  3VRZ A;  2O31 A;  4RTU A;  1PM3 A;  2XG8 D;  2EYY A;  4PFO A;  1WFW A;  2QQA A;  3HFO A;  2GQV A;  5KH6 A;  4FIB A;  4DBH A;  5C6S A;  2DKG A;  4N0A A;  4EMK A;  3OYI A;  1JJ2 A;  1RAI B;  2LMJ A;  4D8D A;  3A98 A;  2MWO A;  2LX7 A;  4J9B A;  3QZ5 B;  4GY5 A;  3CC4 T;  3CCE A;  2OAU A;  4PKC C;  1WJR A;  1PWT A;  1UTI A;  3TQ7 P;  2CSI A;  1VIE A;  1U3O A;  2EGE A;  2AIR B;  2AZS A;  4ZGJ B;  1NG2 A;  5J3B A;  5FRM A;  1FYN A;  3CC2 Q;  3E1S A;  2DTI A;  3GOX A;  4KGV B;  4A4G A;  1KD1 C;  2OTJ Q;  4FM4 B;  1N9R A;  1UGV A;  1AZE A;  3P8B B;  3J81 E;  3JCM c;  2DJQ A;  3CPW P;  2FYK A;  1EFN A;  3CBM A;  3OYL A;  2XDB A;  4RG8 A;  1K8A R;  2HL3 A;  3FC3 A;  3AT1 B;  3PNW C;  3QZ9 B;  1BCO A;  3JCM h;  5GAN 6;  5KE2 A;  4JRQ A;  1VQN T;  5J39 A;  2ZPE B;  3M0Q A;  5EC7 A;  4IUP A;  1JO8 A;  4C92 E;  3CCS Q;  2XD0 A;  1UUE A;  9ATC B;  2E41 A;  2G3R A;  1S72 Q;  1JXM A;  1NJI C;  2RB6 A;  3DB3 A;  3X25 B;  1MUZ A;  2QQB A;  4M77 G;  2JN0 A;  4KGZ B;  3G71 Q;  1Q82 R;  2E3H A;  1TUD A;  3AHU A;  2JW4 A;  3E2U A;  3MEV A;  4MZT A;  4M77 D;  4OGE A;  4QQG A;  2F5K A;  8AT1 B;  3JCM b;  3QPH A;  3IQL A;  2KT1 A;  1VQ5 A;  3RMQ A;  1GCP A;  4J6W A;  4RTZ A;  2NUZ A;  1VIF A;  4L59 A;  2EJ9 A;  1QMC A;  2QGG A;  3OW2 S;  2DZC A;  1H3H A;  3OYM A;  1YCY A;  2CP0 A;  4C8Q B;  3CCV A;  4OMO A;  1Z9Q A;  1KC8 C;  1C6V X;  1OZ3 A;  1GCQ A;  2DO3 A;  4GLK A;  1C1A A;  5LJ5 g;  3OYJ A;  1OYX A;  4C8Q F;  1GL5 A;  3M53 A;  1M1K C;  1N8R R;  5C0M A;  3JAM E;  2CT3 A;  1PD0 A;  4KH1 B;  4X9C A;  4ZNX A;  1SSF A;  1M90 C;  3CCQ T;  3V7S A;  1SF9 A;  2JVV A;  1P92 A;  3NTH A;  1RAF B;  2MAM A;  4LN2 A;  2J06 A;  4E7Z A;  2X4X A;  2K79 A;  3I56 A;  5GAN 4;  3CC4 Q;  1PSF A;  3EG9 A;  4R0K A;  2QEX A;  3BFM A;  3S6W A;  3E9F A;  3KFV A;  4K11 A;  4CRI A;  4JUV A;  1D0Y A;  2KDS A;  2DL8 A;  4HT8 A;  3M56 A;  3MP8 A;  5GMK i;  2RQU A;  3SEM A;  2EIF A;  2F69 A;  3HRU A;  3V7R A;  1OPL A;  1ZX6 A;  1KJW A;  4AT1 B;  4IKF A;  1BCM A;  1VQ6 A;  1ARK A;  4JJD A;  3OQ5 A;  2K3B A;  1FMV A;  5CQY A;  3G4S Q;  4JRI A;  4F04 B;  1K9M R;  3O8V A;  2VB6 A;  1X2K A;  1MMA A;  3O5Z A;  3CCU A;  2K7A A;  1KIK A;  3UA7 A;  2L3S A;  3EG0 A;  5I21 A;  3M0P A;  5GAN 5;  1K73 R;  4EMG A;  1WA7 A;  1SG5 A;  4O5V A;  3I55 Q;  4C5H A;  2VGN A;  3EHR A;  2PVG B;  3C0C A;  1OV3 A;  2DL5 A;  3RMS A;  1I8F A;  2CUB A;  3CME A;  3T9N A;  4M75 B;  4IUR A;  1B3Q A;  4EDU A;  1NYG A;  5KYX A;  2O4X A;  1MND A;  4M7D B;  1E7O A;  2EVR A;  2L3P A;  1FXX A;  1AWO A;  2E6Z A;  3QJ6 A;  1RAH B;  2CH4 W;  1AEY A;  2QI2 A;  4FYV B;  1IHW A;  2CP7 A;  5FU6 B;  1ZA1 B;  4BI3 A;  1NPR A;  4RTY A;  3VU3 C;  3OYD A;  2JM9 A;  2P0Q A;  3L42 A;  5KCH A;  1O9S A;  2K5F A;  4C8Q G;  4J9F A;  4IUQ A;  1WHM A;  2JS2 A;  2VKN A;  1TH7 A;  4J6X A;  3SDZ A;  2M9U A;  3OYF A;  4C8Q D;  2COY A;  3JCM X;  2YXY A;  4OB3 B;  3OYG A;  1IB8 A;  1OI1 A;  2HDA A;  1K1Z A;  2R58 A;  3JCM d;  4PLL A;  3JCM W;  1SEM A;  1Y57 A;  3GLX A;  2QA4 T;  1WI7 A;  1NM7 A;  4GLM A;  1ABQ A;  1RLQ C;  2LP5 A;  4OP0 A;  3CCQ Q;  2R57 A;  1YHQ A;  5DY9 A;  1QVF S;  2X4Y A;  1N27 A;  1HYO A;  3QKJ A;  4JLI A;  4A4H A;  2D9T A;  3M58 A;  4E7H A;  1Q81 U;  2ZPB B;  4PJO B;  2DBM A;  1LVK A;  3EFR A;  3LW5 E;  3RNJ A;  1G83 A;  5DM7 R;  2XMF A;  2HAX A;  3EAE A;  2A7Y A;  2Y4Y A;  3MPU B;  3QBY A;  3KXT A;  3FJ5 A;  2ED1 A;  4PJO F;  1QP2 A;  4LXC A;  2QXF A;  5LJ3 e;  4J6Y A;  3OS0 A;  1Q7Y R;  1WJQ A;  4BDZ A;  1WXU A;  1YCS B;  4M78 A;  3WXM B;  1WLP B;  2YHT A;  4R56 A;  2KYB A;  4F14 A;  3RDV A;  1ZBX A;  2KRM A;  2MWP A;  2P0P A;  2E64 A;  1MNE A;  3VS5 A;  4P5N A;  1YJN A;  1H8K A;  1X01 A;  4C0D B;  3G7Z A;  2RHY A;  2GQI A;  1HSQ A;  5D6X A;  4DBF A;  1Q95 G;  4OGC A;  1M1G A;  1PC0 A;  1OQK A;  2CS7 A;  2DMO A;  1VQO A;  5CK9 A;  3TSW A;  4ZTF A;  2RQV A;  1R0B G;  2JOY A;  1D3B A;  2JM8 A;  3VJP A;  5GMK h;  1E6H A;  4LDU A;  1R0C B;  1QKW A;  3H9N A;  1Q86 C;  4OB0 B;  2DIL A;  1JRI A;  2E12 A;  2WSE E;  3DLM A;  4C5I A;  2JTM A;  2BUD A;  3SB2 A;  5KYY A;  3CC7 A;  1WYX A;  2LDM A;  2ZPF B;  1BIA A;  3CXC P;  1VQK T;  2JNG A;  2LJ3 A;  3M5A A;  3J7A F;  2OTL T;  1B34 B;  5D6Y A;  4C92 B;  5L23 A;  2DYB A;  2EKO A;  3JCM g;  1WZO A;  1V76 A;  3INZ A;  2EYQ A;  1D1A A;  1OU8 A;  1F1B B;  4OF1 A;  3CXC A;  2O9V A;  2J6O A;  2RI5 A;  2BZX A;  2VAS A;  1VQL A;  3OYN A;  2KQW A;  3FJP A;  1KD1 R;  2OI3 A;  5LJ5 f;  1KHI A;  1Y0M A;  1SKU B;  3MCA B;  3OS2 A;  2VC8 A;  3SHW A;  1QVG P;  2AK5 A;  2DBK A;  2QA4 Q;  1YI2 A;  3HKS A;  3EGD B;  5I11 A;  1N8R U;  1O75 A;  1SRM A;  4DBQ A;  1JXO A;  2LQW A;  1YIJ A;  1W2B P;  2EW3 A;  3OS5 A;  2DIG A;  4FW1 A;  2K9G A;  4JJC A;  3C12 A;  1OU9 A;  2HL5 C;  4PJJ A;  3JCM P;  3M54 A;  4PJO D;  4J9G A;  4PJM A;  5LJ3 j;  5J26 A;  1NJI R;  3L2Q A;  4C5E A;  1WGS A;  3X24 B;  1WDX A;  1VQ5 T;  5FW9 A;  5I22 A;  4EMK B;  4M78 E;  2RQR A;  2HCK A;  4DQ2 A;  5EG2 A;  3MHX A;  1VQ7 T;  2VUB A;  2KYM A;  1YIT A;  1BI2 A;  3CD6 A;  1W70 A;  2JMC A;  4IUU A;  2JZ2 A;  1EIF A;  2XKO C;  2HEQ A;  3QO3 A;  4Z89 A;  1ACM B;  2Y90 A;  5GAM d;  3TEE A;  1X69 A;  3RUX A;  1M4Z A;  1K9M U;  2IG0 A;  3TCJ A;  1PSE A;  1KC8 R; 
#chains in the Genus database with same CATH homology
 5J3B A;  2CZ0 B;  5FRM A;  3NTK A;  4RMO A;  4HT9 A;  4UC4 A;  3I55 A;  2D6F A;  2NLU A;  5GAN g;  2RK2 A;  3E1S A;  4L5G A;  4ZGE B;  2ZPG B;  4XU0 A;  4BD3 A;  4JDS A;  4QW2 A;  4ELY C;  2DTI A;  3ZEH A;  1K8A U;  4M75 G;  3M59 A;  3CCL A;  3JCM Q;  1VQP T;  3GOX A;  2DTH A;  3X26 B;  4A4G A;  1KD1 C;  2LTO A;  4FM4 B;  1N9R A;  1YIT T;  1X75 C;  4A4K A;  3I56 T;  4M75 D;  3P8B B;  4A4F A;  3S3M A;  4F7U G;  3CCE T;  2QEX T;  4M7D G;  1U1S A;  3RKW A;  2YLB A;  4PLI A;  1VQ9 A;  5GMK m;  3J81 E;  3JCM c;  2DJZ A;  2VXE A;  3J80 E;  2LRQ A;  3CCJ A;  2FYK A;  3CPF A;  4KBM B;  1UEB A;  3CCR T;  4KT0 E;  3CCM A;  4M7D D;  3CBM A;  3SWN A;  4M7A A;  3OYL A;  5LJ5 e;  4RG2 A;  2XDB A;  3ER0 A;  4RG8 A;  2P4T A;  2RM4 A;  3V7C A;  3UWN A;  1IRE B;  5LJ3 h;  3OYH A;  2RJD A;  3FC3 A;  2DK3 A;  3PNW C;  2K5L A;  1WQ7 A;  3QZ9 B;  3V8L A;  4C5G A;  3JCM h;  3JSC A;  2QQR A;  2Y4X A;  5GAN 6;  5KE2 A;  4JRQ A;  1VQN T;  2KMT A;  2LCC A;  5J39 A;  1Q82 U;  4J7F A;  4RCC A;  3OA6 A;  2ZPE B;  3S3O A;  4QQD A;  2HNI A;  4IUP A;  3SWN C;  4JS4 A;  3V8J A;  4M7A C;  2PUO B;  4C92 E;  4HKE A;  2XD0 A;  4Z02 A;  5DLQ E;  4R55 A;  2RD1 A;  4XQ3 A;  1FWZ A;  2JTF A;  5CIU A;  1VQ6 T;  3L2W A;  2E41 A;  2G3R A;  2CZ1 B;  2E10 A;  3BDL A;  1NJI C;  2RB6 A;  3DB3 A;  2VGM A;  1WNL A;  2YLC A;  2IVW A;  4FT4 A;  3X25 B;  4C92 F;  2QQB A;  4JLG A;  3PIP A;  3LGF A;  2DXU A;  4M77 G;  2JN0 A;  1YBY A;  1VQ4 T;  4ATO A;  5GAO m;  3CCU T;  2L5Q A;  1VQ9 T;  3VUB A;  3OYY A;  3QDR B;  3AHU A;  4M75 C;  3VYH B;  3MEV A;  3CCJ T;  5GAN j;  2CZ6 B;  4M77 D;  4MZT A;  4XAX B;  4OGE A;  4L6V 5;  3CCM T;  4QQG A;  5FLX E;  2F5K A;  4ZGD B;  3JCM b;  1Q86 U;  1DJ7 B;  3QPH A;  5GAM f;  1RI0 A;  4M7D C;  1XQH A;  3QG1 A;  1VQ5 A;  1QP3 A;  3HRT A;  3SD4 A;  2C06 A;  3RMQ A;  4PL6 A;  4J6W A;  4LD6 A;  4DOW A;  1XNI A;  3OMG A;  1VIF A;  2LVM A;  4BE0 A;  5M9O A;  4L59 A;  4OB1 B;  2EJ9 A;  2BIV A;  3F70 A;  2WSC E;  3OW2 S;  2DZC A;  3VUZ A;  2LT1 A;  1WPY A;  3L2Z A;  4PNO A;  3OYM A;  1YCY A;  5FU6 C;  1Y96 B;  3CC4 A;  4BI4 A;  3S3N A;  4C8Q B;  3CCV A;  4PJO G;  1KC8 C;  4C8Q E;  1Y96 A;  3OYK A;  4B9W A;  4XU3 A;  1OZ3 A;  1UGR B;  2DO3 A;  4GLK A;  1BKB A;  5KCO A;  2EJF A;  1BI0 A;  3RIR A;  2R5M A;  5LJ5 g;  3JB9 F;  1M1F A;  2GCX A;  2MI6 A;  4J7I A;  3OYJ A;  3CMA A;  1OYX A;  4C8Q F;  4ZTJ A;  3M53 A;  4BY6 C;  4M78 G;  2XK0 A;  4FU6 A;  1M1K C;  5C0M A;  3JAM E;  4BE1 A;  4M77 C;  4X9C A;  2ZGW A;  1SSF A;  3M4G A;  2FL7 A;  1M90 C;  3CCQ T;  1Y07 A;  3V7S A;  4C0Z A;  2JVV A;  3CBO A;  4Q5W A;  1P92 A;  3NTI A;  3NTH A;  2QTX A;  5A0D A;  5CCA A;  3JB9 J;  2LT4 A;  2MAM A;  1VQP A;  1Q7Y U;  2FB7 A;  3GP8 A;  1G3T A;  3ZBD A;  1BI1 A;  3E19 A;  5GMK e;  2X4X A;  1WJS A;  3ZFJ A;  1W4S A;  5GAN 4;  1MHN A;  3I56 A;  1PSF A;  4QVZ A;  4HCB A;  3X20 B;  2QEX A;  5CR2 A;  1K8A C;  3BFM A;  4XTY A;  3CCV T;  2ZZD A;  2DZ9 A;  3KUF A;  3S6W A;  4PJO A;  1M8V A;  3N5B B;  3GIB A;  4FT2 A;  3CCR A;  3E9F A;  3HPW A;  4E7L A;  4BI8 B;  4CRI A;  4OVA A;  4JUV A;  2KDS A;  1V29 B;  3CMA T;  4Y28 E;  3OYA A;  4HT8 A;  4ZN1 A;  3M56 A;  3MP8 A;  3L2V A;  1W2B S;  1VQN A;  4PJO C;  5GMK i;  3TRE A;  2DPP B;  2EIF A;  3BDU A;  4BE2 A;  3A8H B;  3LGL A;  2XID A;  2CYZ B;  2F69 A;  5CKF A;  4LDX A;  2XI9 A;  3HRU A;  4TVR A;  3V7R A;  4BUG A;  4LDV A;  4IUT A;  5GAN 2;  1K73 U;  4WF2 A;  1YJ9 A;  1YJW A;  4IKF A;  2K4Y A;  4XTV A;  3V8K A;  5IT9 E;  1Q82 C;  1VQ6 A;  4M78 C;  4DA4 A;  2HBP A;  2DXB A;  2DIQ A;  2RJE A;  3OQ5 A;  3OBW A;  4QVD A;  5LJ5 j;  2VXF A;  1VUB A;  3A8L B;  5CQY A;  1NE8 A;  1WQW A;  4JRI A;  4NOY A;  5L8R E;  3MEW A;  3O8V A;  3L2R A;  1VQ4 A;  2DD5 A;  3SWN B;  3CCU A;  2EQM A;  4M7A B;  2D0Q B;  5I21 A;  3RES A;  4M7A E;  4BDY A;  1M9S A;  5CQX A;  5GAN 5;  1OZ2 A;  3LWI A;  3FB9 A;  1JB0 E;  1KQS S;  2ZCF B;  1M5Q 1;  2DVE A;  4C92 G;  4C0D C;  5GAM e;  4EMG A;  2FVU A;  4M7A F;  2RHX A;  1GXI E;  4O5V A;  4C5H A;  4XTX A;  2K3X A;  2VGN A;  5CO7 A;  2LQ8 A;  4ZN3 A;  2PVG B;  4J5Y A;  3OSS C;  5FU7 C;  3RMS A;  1I8F A;  4C92 D;  2GF7 A;  5I2S A;  3T9N A;  4M75 B;  3CME A;  4IUR A;  1M90 U;  3UT1 A;  2M0O A;  2CGH A;  4EDU A;  1YJ9 T;  1YJW T;  3JCM J;  3FLG A;  2RHU A;  4M75 A;  2FHD A;  5CKB A;  1UGP B;  1ZQ1 A;  1UB4 A;  2O4X A;  4E7K A;  1H64 1;  1Y71 A;  2KVQ G;  4F7U B;  2RH2 A;  2EQK A;  4M7D B;  3E9G A;  2X4W A;  5D6W A;  1FXX A;  2KSS A;  5GAN d;  2E6Z A;  3QJ6 A;  4F7U A;  4KUI A;  2XU8 A;  1N8R C;  3RER A;  4M7D A;  2QI2 A;  4RCB A;  2RO0 A;  1NZ9 A;  3DKM A;  4F7U F;  1I4K 1;  1KD1 U;  2XDP A;  3P8D A;  5FU6 B;  3LYI A;  1N6A A;  5GAN 7;  3HL8 A;  4BI3 A;  1NPR A;  2BKD N;  4JRK A;  4IUV A;  3A8O B;  2GFU A;  4II1 A;  3VU3 C;  1G3Y A;  4CI0 C;  3OYD A;  5LL6 S;  2P0Q A;  2V8K A;  3OW2 A;  3L42 A;  3CCQ A;  5KCH A;  2KAF A;  5GAN 8;  3CME T;  4JS5 A;  3LX7 A;  1VQ7 T;  4V2S A;  1O9S A;  3M9Q A;  5HKC A;  2RK1 A;  2K5F A;  4ELZ C;  4C8Q G;  4IUQ A;  3MEA A;  4LDY A;  3ASK A;  4BY6 B;  3MP1 A;  4C92 C;  3WVE B;  1TH7 A;  1Y7X A;  3CXC S;  4J6X A;  5FRN A;  3SDZ A;  2M9U A;  3JB9 D;  3OYF A;  4M77 B;  4JJN K;  4C8Q D;  3FRN A;  5CKH A;  5LJ5 h;  1H3Z A;  3JCM X;  2HD0 A;  4XTW A;  5CKD A;  4OB3 B;  3OYG A;  3MO8 A;  2LCL A;  4M77 A;  5FRO A;  5LJ3 d;  4E7J A;  3HSB A;  2PUK B;  3OBY A;  1OI1 A;  2EWN A;  2R58 A;  3JCM d;  3C95 A;  1VQ8 A;  4PLL A;  3JCM W;  2E70 A;  3GLX A;  3H6Z A;  2QA4 T;  4MZP A;  3BW1 A;  3CEY A;  5GAM g;  4A4E A;  4B9X A;  3L1A A;  3QSU A;  3PMI A;  5GMK j;  5HK3 A;  2PVD B;  1QVF A;  2DAQ A;  4OP0 A;  1ZHI A;  2HQE A;  2R57 A;  1K9M C;  1YHQ A;  4D6W A;  1QW1 A;  5DY9 A;  1QVF S;  2XIC A;  2X4Y A;  1N27 A;  3P8H A;  3QKJ A;  3NFC A;  1QVG A;  2RHZ A;  4JLI A;  1KG1 A;  3HRS A;  3VKI A;  2D9T A;  3M58 A;  4A4H A;  1LJO A;  2ZPB B;  4E7H A;  1Q81 U;  1VQL T;  4N4I A;  4PJO B;  1AHJ B;  3EFR A;  1K73 C;  3LW5 E;  2V8J A;  4BB7 A;  1UGQ B;  2RA2 A;  1U8R A;  1QVG S;  4PJO E;  4MZM A;  2L89 A;  5DM7 R;  1G5V A;  3PT9 A;  4FL6 A;  1HXD A;  2LC4 A;  2HAX A;  3CBP A;  4LD9 K;  2OTL T;  2LNV A;  2I2L A;  2EJG A;  3EAE A;  2A7Y A;  2Y4Y A;  3QBY A;  4C8Q C;  5GAN f;  1VQ8 T;  3KXT A;  3OY9 A;  1W2B A;  4PJO F;  4M78 B;  2M16 A;  3CC2 A;  1QP2 A;  2EAY A;  3LH0 A;  2QXF A;  5LJ3 e;  4J6Y A;  3OS0 A;  1YI2 T;  3URG A;  1WJQ A;  4BDZ A;  5A0G A;  4XU2 A;  4M78 A;  3WXM B;  3QYH B;  2PU9 B;  5CAI A;  3JCM e;  5GAN 3;  2K5I A;  4MDX A;  4C0F A;  2YHT A;  1MGQ A;  4XK8 E;  4R56 A;  2PQW A;  4RKU E;  3G6E A;  4M78 F;  1ZBX A;  2MWP A;  2P0P A;  2DD4 A;  3X28 B;  2E64 A;  2K3Y A;  3OSV A;  3JRZ A;  2VYT A;  1YHQ T;  1JJ2 S;  5LJ5 d;  5CVI A;  3JB9 I;  3PTA A;  4A54 A;  2L3R A;  2GFA A;  4P5N A;  4A53 A;  2PVO B;  1YJN A;  2WSF E;  3SFM A;  1X01 A;  4C0D B;  4EMK C;  5A2Q E;  3G7Z A;  2RHY A;  3UPU A;  5D6X A;  4EPC A;  3OYE A;  4ME7 A;  5FU7 B;  3QXE B;  2H3J A;  3C94 A;  4OGC A;  5GAM j;  1VQK A;  4HCC A;  1M1G A;  4M7A D;  2CS7 A;  1VQO A;  1HK9 A;  1KQS A;  5CK9 A;  4HA8 A;  2XHC A;  2OTL A;  4XU1 A;  4DOV A;  3PIO A;  4ZTF A;  1KQ2 A;  3BY7 A;  5LJ3 f;  1D3B B;  3CC2 T;  4LDW A;  4MML A;  3JCM f;  3CCS A;  2JOY A;  1D3B A;  4BAC A;  1LNX A;  4N4G A;  4OB2 B;  3VJP A;  1X6O A;  5AYF A;  5GMK h;  1VQM T;  1I5L A;  2OTJ T;  1S72 A;  3PGG A;  3G6E T;  4LDU A;  5GAO r;  3CD6 T;  1R8O B;  1Q86 C;  3G4S T;  2O4X B;  4OB0 B;  1KHC A;  5GAO n;  3OYB A;  4M75 E;  1JRI A;  2DXT A;  2P0K A;  2E12 A;  2WSE E;  3DLM A;  3R6O A;  2E65 A;  3G71 A;  4C5I A;  2JTM A;  2E5Q A;  2M1H A;  1YJN T;  2BUD A;  3SB2 A;  3CC7 A;  4F7U E;  3L2U A;  2EQJ A;  2ZPI B;  4M75 F;  2E1H A;  2LDM A;  2ZPF B;  4M7D E;  2ZPH B;  1BIA A;  4QQ6 A;  3GNF B;  4MDW A;  3KBG A;  1VQK T;  1FX7 A;  2JNG A;  4Y91 A;  3M5A A;  1VQO T;  3LWH A;  3J7A F;  2V8I A;  4QVC A;  1U1T A;  5IAY A;  3I55 T;  3Q1J A;  1B34 B;  3OS1 A;  3QYG B;  3DLL A;  1BI3 A;  5D6Y A;  2QA4 A;  4C92 B;  3OYC A;  4M7D F;  4HCZ A;  5LJ3 g;  4C0G A;  2X35 A;  3RKY A;  5A0L A;  2EKO A;  3JCM g;  1B34 A;  3CPW A;  5IN1 A;  4C92 A;  3H8Z A;  3CCS T;  3CCL T;  4NL3 A;  3GNG A;  1BYM A;  3QJY A;  5KE3 A;  3LLR A;  2RJC A;  2CZ7 B;  3C4S A;  3INZ A;  2EYQ A;  3OMC A;  3TU4 K;  3QII A;  3CPW S;  1S72 T;  4OF1 A;  3CXC A;  5HY6 A;  2QDY B;  4N4H A;  3QUI A;  3JB9 G;  2QQS A;  2RI5 A;  4J8O A;  5GAO q;  3PMT A;  2DTO A;  1VQL A;  5GMK l;  3OYN A;  2KQW A;  3FJP A;  3G71 T;  3FEO A;  3M57 A;  5LJ5 f;  3MEU A;  1KHI A;  1JBM A;  4NL2 A;  3OB9 A;  3CC7 T;  1N9S A;  2RI3 A;  4M77 E;  3MCA B;  1Q7Y C;  4XTZ A;  3OS2 A;  2VC8 A;  3A8M B;  1Q81 C;  5GAM h;  3FDR A;  3ME9 A;  5CKE A;  2AHJ B;  4FSX A;  2EFI A;  5GAO p;  2O01 E;  3QHS A;  2WAC A;  1NPP A;  2RHI A;  4M77 F;  4XTU A;  5GAN e;  4JRP A;  1G3W A;  2DEQ A;  2XDD A;  1YI2 A;  2YRV A;  3HKS A;  1NJI U;  4KUL A;  4X34 A;  2VV5 A;  2DXC A;  1VQ7 A;  4YTL A;  1N8R U;  3DB4 A;  3M55 A;  1O75 A;  1XTD A;  3PFS A;  2RJF A;  1KQ1 A;  2JUF A;  3JB9 H;  3A5Z B;  2R5A A;  1I81 A;  1YIJ A;  2E6N A;  1G3S A;  3OS5 A;  2DIG A;  3JCM V;  2CKK A;  1QVP A;  3A8G B;  2EQU A;  2L8D A;  3C12 A;  4MMK A;  3RKX A;  4C8Q A;  5GAO l;  4KUD K;  1XOV A;  1BIB A;  3VYG A;  3VV0 A;  3JCM P;  3M54 A;  4PJO D;  3M4Y A;  3MP6 A;  2HQX A;  5LJ3 j;  5J26 A;  1IZ6 A;  2XG8 D;  3L2Q A;  2K2V A;  4C5E A;  5HK0 A;  2KY9 A;  1WGS A;  2QQA A;  3HFO A;  2GQV A;  2KK4 A;  3HFN A;  5KH6 A;  3X24 B;  1VQ5 T;  4M78 D;  4NS5 A;  4E7I A;  5DLO A;  4FIB A;  4X9D A;  3MET A;  1RL2 A;  4EMK B;  5C6S A;  2LX9 A;  4M78 E;  4DQ2 A;  3EFS A;  3FIF A;  1LOJ A;  3HHT B;  3MHX A;  4OMF B;  5EG2 A;  2DKG A;  1KC8 U;  2VUB A;  4N0A A;  4EMK A;  4E47 A;  2A3L A;  2X4J A;  4J83 A;  3OYI A;  1BI2 A;  1YIT A;  4VUB A;  1VQM A;  1JJ2 A;  2MWO A;  2OTJ A;  1UGS B;  3CD6 A;  3WVD B;  3G4S A;  2MF2 A;  4IUU A;  3QZ5 B;  4GY5 A;  3CC4 T;  2JZ2 A;  3CCE A;  1EIF A;  2LQK A;  2QQ9 A;  2OAU A;  4PKC C;  5I2M A;  1YIJ T;  1WJR A;  2XKO C;  3GPL A;  2K57 A;  2B8A A;  3QO3 A;  2MMP A;  1M1K U;  5GAM d;  2Y90 A;  4N0A C;  3TEE A;  4M7A G;  4O6J A;  1VIE A;  5GAN h;  3RUX A;  2RI2 A;  1M4Z A;  2F5T X;  3GF5 A;  3HP9 A;  2IG0 A;  3TCJ A;  3UDC A;  4EMH A;  1K9M U;  1PSE A;  4ZGJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...