4M77E

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
80
structure length
70
Chain Sequence
ILPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEWLKVMQHHGRMLLSGNNIAILVPGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
total genus 10
structure length 70
sequence length 80
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77E00
4M7AG 2DTIA 1MGQA 4C92E 4XTZA 3JCMh 3V8LA 4XTUA 5LJ5g 4J6XA 4N0AA 3EFSA 3FJPA 4X9DA 4QVDA 4PJOB 4F7UG 4M7AF 4M77A 3HFNA 2E1HA 5GAMh 5GANg 4M75B 3SWNA 1U1SA 4DQ2A 3JB9F 4M7AB 4M78A 4C8QB 2E65A 3JCMd 3L2ZA 2EAYA 5GAMf 5GMKj 4X9CA 5LJ3g 5GAOm 3RESA 5GAN8 3JB9I 4NL3A 1M8VA 4F7UB 3FIFA 4M75A 1KQ1A 5CAIA 1WQWA 1Y96B 1N9SA 3INZA 1WPYA 1Y96A 1LOJA 4M77G 4WF2A 4XTWA 4MMLA 4M78E 4C92F 4Y91A 3GIBA 2E10A 3SB2A 4XU0A 4EMGA 2DEQA 3RKYA 3JCMP 4C8QG 3HSBA 4EMHA 4PJOE 1M5Q1 3QHSA 4M78F 3JCMQ 2DTOA 5LJ3j 2DVEA 5GANe 4J5YA 2YLCA 2EWNA 2DZCA 4C8QE 5GAMd 1H641 3JCMf 4JRIA 4M7DG 3BDUA 4M77B 3JCMJ 3JB9G 5GAMg 3JB9H 5LJ3f 3RKXA 5GAN4 4C92A 4PJOA 1I81A 1I8FA 4M75D 4XTXA 2VXEA 3BW1A 4JLIA 2HNIA 3AHUA 4M7AD 3JCMW 3EFRA 4M78B 4JUVA 1HK9A 2EJFA 2RD1A 2JN0A 5DY9A 3V8JA 4HT9A 5I21A 5LJ5f 1LNXA 3QSUA 4M7DB 2RM4A 2YLBA 5GAN2 4M7DA 2K57A 4HA8A 5GAOn 1WNLA 4PNOA 3V7SA 3L1AA 3V8KA 4F7UF 5GAN3 4PJOC 4C92C 2ZGWA 1D3BB 3BY7A 3QO3A 5LJ3d 4F7UE 5GMKm 5LJ5h 2DTHA 1JRIA 4M75C 1U1TA 3JCMg 4C8QF 4PJOD 4M78G 2DXTA 3QUIA 2RA2A 1N9RA 4J6WA 3SWNB 4C92D 4M75F 5GAMe 5GAMj 4M7AC 5GMKi 2FYKA 4JRKA 4NOYA 2QTXA 5GAOp 4PJOF 4EMKB 4XU1A 3RUXA 4EMKA 5LJ5e 3M4GA 4V2SA 1B34B 4XTYA 3RERA 1BIAA 2VC8A 5GANf 2DZ9A 5LJ5d 1JBMA 4XU3A 4HT8A 3PGGA 4A54A 4C8QA 4M7AA 1KQ2A 4RCBA 5GAN6 4M7DF 2CGHA 2FB7A 4XQ3A 5GAN7 5GMKe 4MMKA 4N0AC 3JCMe 3FB9A 5GMKl 4M7DD 5GAN5 5GAOq 2VXFA 4NL2A 4M7AE 4J6YA 4M77C 1LJOA 3JCMV 2EJ9A 4M7DC 4M75E 1D3BA 4C8QC 5GANj 1B34A 4M77D 3V7RA 3JB9J 4XU2A 4M7DE 4C92B 5GANh 3V7CA 2DKGA 1I5LA 4F7UA 2RB6A 1I4K1 4C8QD 2I2LA 1BIBA 4M77F 2DXUA 2Y90A 5LJ5j 4RCCA 1HXDA 4OP0A 3RKWA 3VU3C 2DJZA 4QVCA 1TH7A 4A53A 3JCMb 3JCMX 4EMKC 3BFMA 5LJ3h 2E41A 3JCMc 1WQ7A 1X01A 3JB9D 4PJOG 4M78D 3RIRA 4C92G 5GAOl 5GAOr 4XTVA 5GANd 2EJGA 2YHTA 5LJ3e 3SWNC 1YCYA 4M75G 4M77E 2E64A 3HFOA 4M78C 5GMKh
chains in the Genus database with same CATH superfamily
4DEXA 4XTUA 4OMMA 3PIOA 1BK2A 1M90R 1VQ5A 2F1LA 3CC4A 1Y07A 4AFSC 4OB0B 3OW2P 3JB9F 5IT9E 2LJ1A 3HRUA 5FROA 3M0UA 1OPKA 1YP5A 3MEUA 2D0QB 1VQMA 4QVDA 1WPYA 4WF2A 1I07A 1WJQA 2A7YA 2ZZDA 1VQ8Q 3JSCA 2JMCA 2K79A 2PNIA 5IN1A 4ZTFA 1U06A 2E12A 4OMQA 3HPWA 2VV5A 2QI2A 1C0MA 2GQIA 2O9SA 5LJ5f 3QYHB 3HL8A 4K11A 2KVQG 1QCOA 2K57A 2QG9B 3EH2A 1VQ4A 1M3CA 3I5RA 5LJ5h 4C8QF 3GBQA 4PJOD 1UGQB 4JRKA 2V26A 2KT8A 3RUXA 4C0ZA 1R8OB 4IUUA 2FVUA 1KIKA 2KR3A 1N6AA 3L2RA 2O4XA 2QTVA 5I11A 4HXJA 5HCKA 2CT4A 4N0AC 4MZMA 1NPRA 1JXOA 2F2VA 1G2BA 1QVFA 1N8RC 2EJ9A 2EQIA 2JTMA 2KRSA 1KD1C 3E9FA 4PLLA 2M9UA 4BUGA 2Y90A 4QKUA 4RCCA 1YHQT 4C5GA 2DJZA 5A0LA 2ZPHB 2DX1A 3GLXA 1YI2A 4FT4A 1Q7YR 1K9AA 3OSSC 2DL4A 1UGSB 2NWMA 1RABB 1PM3A 1ACMB 2KBTA 1TS9A 1YJWQ 1IZ6A 4J6XA 2E5KA 3EGDB 3A8GB 5KE3A 4AFQC 2JTEA 4PJOB 1IREB 1ZX6A 5FWCA 3CCLQ 1RAEB 3MEVA 2VB6A 3UT1A 3REBB 2C0IA 4X9CA 3SD4A 2M16A 2XU8A 2CSQA 2CZ1B 1OX9A 1Q7YU 3FIFA 2PTKA 3I56Q 1OV3A 5DLQE 1N5ZA 4E7SA 2FZKB 3QHSA 1VQLT 3JCMQ 2C0OA 2J6FA 3PFSA 4OMNA 3OSVA 4RKUE 3JB9G 1OQKA 1JXMA 2JXBA 1I81A 3M0SA 4M75D 1YITA 1AZEA 1KK7A 1UTIA 1WHGA 2OJ2A 5GAOn 1Y0MA 3QJ6A 4MZTA 4KGZB 4FYVB 2O88A 3I56A 1E6HA 1G3SA 4J6WA 1N9RA 1P92A 3EG0A 4ELZC 3CXCA 1Q82U 5J3BA 1BIAA 4LNPA 2VC8A 2RNAA 2PU9B 3VS0A 2O4XB 3CMAQ 1Q81C 1U3OA 2L0AA 2X4JA 2EW3A 3L2WA 4OGEA 5GMKl 1W2BA 5FU6C 3LH0A 2BE7D 3KBGA 3RBBB 1M90U 3PE0A 4IIMA 3HP9A 2EYYA 2MYSA 3KUFA 4XU2A 2EYXA 4E7KA 1UJYA 1NEGA 4DBRA 1MNEA 2DMOA 3QG1A 3FEOA 1QWEA 2VGMA 3NGPA 4EDUA 4Z89A 4EMKC 4N4HA 3CC2A 3PNWC 2DIGA 5I22A 3NMZC 2BIVA 1D0ZA 1QP2A 1ABOA 2X3XD 2YUQA 2ZCFB 3DB4A 2EKOA 3EGXA 4PFZA 1N27A 5LJ5g 2J05A 3UA7A 1AWWA 1YJNQ 3OYYA 4R56A 4II1A 3AT1B 1UGPB 4AT1B 1ZBXA 3LWHA 4KT0E 1D1CA 4FYYB 3M58A 3L2ZA 3NTKA 2QASA 4C5HA 4JJDA 4BI4A 4OB3B 1W2BS 3INZA 1JEGA 2RHIA 1KHCA 1YFNA 2Y4YA 1H3ZA 1UEBA 1D0YA 1R77A 4AG1C 2RH2A 4LDXA 4KGXB 2EKHA 1VQOT 5IXBA 4M7DG 4AFZC 1OU9A 3JCMJ 1BI1A 3X24B 2RQTA 1YJWA 1F1BB 3TCJA 1YJNT 2CZ7B 2M51A 1QKXA 1AZGB 3V7SA 2XG8D 3L1AA 4PJOC 2LRQA 2K5LA 5GANf 1QVFS 3VYHB 5M9OA 4HVUA 3CCEA 5GAMj 4LDVA 2AIRB 2FYKA 1PSEA 3QBYA 4NOYA 3CCST 1VQPT 2GFAA 4V2SA 5FU7C 1KJWA 1QW1A 3CD6Q 1SPKA 3OYHA 1M8MA 3C4SA 1I1JA 3WVDB 3EAEA 4C0DB 3C95A 3A1PA 4X34A 5J26A 2HL5C 4JZ4A 1MNDA 2QEXA 1AHJB 2R5MA 1M9SA 1NG2A 1D3BA 2CP7A 3CC2T 1R0CB 1SG5A 3G71Q 4M7DE 4C92B 1FXXA 3V7CA 4ZGDB 1AWOA 1YJWT 2DXBA 3QJYA 3A98A 2EYQA 1ZSZC 4C5EA 3M0PA 1BCMA 2HD0A 4RTWA 3EG9A 1SEMA 2EJGA 4M75G 4M77E 3CC4T 2HSPA 1M27C 1MGQA 2RK1A 1YHQQ 3G6EA 3CCUT 2XIDA 3HRTA 1TOVA 3CXCP 4R55A 5GAMh 2VWFA 4C8QB 3JCMd 2EGCA 4FSXA 5GAMf 5FU6B 6AT1B 2VVKA 1OZ2A 1VQ4T 1X6OA 1Y96A 2P4RA 1VQ8T 3VS3A 4J9EA 2E10A 3HSBA 2QAZA 2DEQA 3I9QA 1M5Q1 2A36A 4M78F 1LCKA 2J6KA 5CKHA 4JJCA 2DILA 3JCMf 3BDUA 3JB9H 3CQTA 3X25B 4PJOA 3G4SQ 1TG0A 4XTXA 3OYIA 1AT1B 4JLIA 2AKLA 1PCXA 3VS2A 1HK9A 1ZHIA 1QCNA 3V8JA 4D8DA 3OYBA 1LNXA 1MHNA 2RM4A 2XI9A 1GXIE 1WGSA 4ZN1A 5LJ3d 1JRIA 1ZUKA 4J9DA 4M78G 3MPUB 2KRMA 4RG8A 2GCXA 2WACA 4LE9A 2L8DA 4XTYA 1UJ0A 1H92A 2HCKA 1QLYA 3ZEHA 2QEXT 2QQAA 2MAMA 1KQ2A 2FB7A 2X35A 2XKOC 5GMKe 1VQPA 3FB9A 3E19A 3G6EQ 4ZN3A 1Y71A 5GAN5 2CH4A 5GAOq 1OEBA 3OY9A 4FCYA 2AT1B 4ELYC 1AWXA 1I5LA 2RK2A 4JPBW 2FO0A 2RMOA 2MWPA 1UB4A 3RKWA 2ED0A 2QA4A 4ZNXA 5CIUA 4LXCA 5GAOl 1NEBA 3CBOA 4KULA 5HK3A 1YCYA 1M1GA 1JU5C 2RI2A 3EFOB 3NTIA 4IUVA 3UA6A 2YRVA 2A28A 3GP8A 3ME9A 3MKDA 4PL6A 1R0BG 2CSIA 5GANg 3H0FA 2QK0A 1PKTA 3SWNA 2RI5A 2EFIA 2KI7A 4N4IA 1Q86C 1M8VA 2RQWA 3ZL7C 4M75A 5CAIA 4M77G 3U23A 1AOJA 4ZTJA 1GL5A 4Y91A 2BZYA 2F2XA 3LW5E 1RUWA 3CCMA 3CD6T 2KEAA 1VQKT 3A8LB 4OB2B 2M1HA 2JT4A 2HNIA 3DKMA 3EG1A 3A8OB 2H3EB 1XJWB 3QSUA 4M7DB 3I55T 1X6GA 4DOWA 1NJIR 5GAN3 5FLXE 4JZ3A 2RHZA 4QT7A 1G3WA 2OAUA 3FC3A 3QUIA 4M7AC 3GF5A 2DL5A 2FZGB 1K9MU 2K4YA 5KYYB 2COZA 3OYFA 1K1ZA 4MDXA 2HMAA 4XU3A 3OYGA 3QYGB 2F5KA 2QDLA 2EPDA 2IG0A 5CO7A 4HCCA 3TREA 1H3HA 3DLMA 3PTAA 2KDSA 4NL2A 2PVGB 1BI3A 1D1AA 2CP6A 1YWPA 1WFWA 3CCLT 1I4K1 4M77F 1Y7XA 1Q86U 1WJRA 1B3QA 3VYGA 1XTDA 3CCVQ 4GLKA 5KYXB 1SRMA 5L23A 2YHTA 4PFOA 2EGEA 1UG1A 4B9WA 3TSWA 2VKNA 1VQ9T 3FJPA 4DBHA 4E6RA 4RMOA 1GFCA 1HD3A 5KYWA 4E7HA 2B86A 3N5BB 4X1VA 2JS0A 2E65A 4JJNK 2LC4A 3D7SB 1XOVA 5GMKj 2XICA 1VQMQ 5KYUB 3CXCS 4FU6A 4EMGA 4M78E 1VQ8A 3RKYA 3JCMP 4EMHA 5EG2A 2CH4W 5GANe 2KXCA 1AD5A 4A4FA 2DK3A 2DZCA 1K9MR 3CCET 3TEEA 3SFMA 1WI7A 4E2FB 1PKSA 4D6WA 1S72A 1Q81R 1VQ9A 1VOMA 1K73C 1VQNQ 2JN0A 5DY9A 4JS5A 1YJ9A 2NUTA 4HA8A 3CMET 2DYBA 2YSQA 3QO3A 4F7UE 3JCMg 3C0CA 3SWNB 4PJMA 1E6GA 1WIEA 1M2VA 2RHUA 1ZUUA 4CRIA 2DYIA 1T0JA 2MPXC 1B34B 2OI3A 2PZ1A 5CKFA 3PT9A 2SRCA 1QP3A 8AT1B 4M7DF 2CGHA 1AEYA 3CCVA 5A0GA 2RF0A 3UF4A 4MDWA 1KC8R 4BI3A 1GBRA 2LVMA 4RTTA 1YNZA 4M77D 1ZSGA 4P5NA 2W10A 1J3TA 3MO8A 3LYIA 3OQ5A 3OS5A 3CCQA 4XK8E 3R6NA 3FLGA 5HK0A 4J8OA 3JB9D 2EVRA 2MCNA 3P8HA 3CC7Q 3BDLA 3VS4A 3RDVA 5FRNA 2KSSA 1AWJA 1RL2A 1YIJT 1YN8A 4L59A 4HKEA 2BUDA 2KY9A 1VQOQ 3L2UA 1NZ9A 1PHTA 1NM7A 2OAWA 3I5SA 2LT4A 2O2OA 1WQWA 1BI0A 1WDXA 2COWA 2H8HA 2AZSA 1KQSP 1RADB 4YTLA 5CKBA 3CC7A 1RLQC 4Y92A 4EIKA 2RO0A 3JAME 4M77B 1NBEB 4J7IA 3CCJT 3S3OA 1JJ2A 3EFRA 3H0IA 4HT9A 2MIOA 2DLPA 2LQ8A 1VIEA 2JVVA 1U1TA 1TTHB 2RQVA 3OB9A 1JJ2S 4PKCC 1FYNA 1IGUA 2DO3A 2QTXA 3G4ST 3CCQT 2ABLA 2LTOA 1JJ2P 1QWFA 5I2MA 4DBQA 4RTUA 4A54A 4C0GA 1M1FA 2QGFB 1K8AC 4MMKA 4D8KA 5HY6A 1T0HA 2DETA 1C6VX 2KMTA 2DVJA 2NUPB 3I35A 1KD1R 2ESWA 2DIQA 1M1KC 2OTJT 5AYFA 1BIBA 3CCRQ 2GGRA 3E1SA 4A53A 2M0OA 2ZPGB 3OYLA 4QW2A 3SHWA 2AHJB 3S6WA 2GQVA 3EG9B 1DJ7B 2RJDA 3CC4Q 2G6FX 3P8BB 3HFOA 2FPEA 3NPFA 2YUNA 4C92E 1KC8C 2A37A 4VUBA 4BDZA 2JM8A 1IHWA 1OU8A 2JTFA 4RTXA 1Q86R 2CDTA 2L3PA 2E1HA 1SHFA 1PNJA 2I0NA 3L42A 2HQXA 3VS1A 2K6DA 2JOYA 4IUPA 3VUBA 3RESA 1SF9A 1VQ6T 1GCPA 3CCMQ 4J9IA 3X20B 1YITQ 3I56T 4M4ZA 3CBMA 3LX7A 3MP8A 3OBYA 2E3HA 1YJ9Q 3EGXB 4FYXB 4QQ6A 3EG3A 4C8QE 3R6OA 2GTOA 1X6BA 4LD6A 1Z9QA 1TWBA 2K2MA 5C0MA 1FWZA 3OS2A 2EJFA 4FT2A 3VJPA 4JRPA 1K0XA 2RJCA 5I21A 3F70A 5GAN2 1TU0B 2F5TX 4BE1A 2LNVA 3UDCA 1WNLA 2J06A 1PG5B 1OOTA 4M75C 4A4GA 4GLMA 3VV0A 5A2QE 3OS0A 1ZLMA 1WHMA 2FHDA 1GBQA 2BTTA 2P4TA 1VQ7A 4EMKB 2YUPA 5LJ5e 4Z02A 2GTJA 1X69A 5HKCA 2MI6A 5GJWB 2X51A 1BYMA 5GAN7 3WVEB 4LUEA 1QKWA 3RMSA 1UDLA 1YIJQ 2CZ6B 1NYFA 3NHNA 4M7DC 1JO8A 1Q82R 2VYTA 3GPLA 3G7ZA 2DKGA 4F7UA 5KCOA 2CP5A 3M57A 3BFMA 5LJ3h 1T3SA 2R57A 1YI2T 4C92G 1K8AR 3CCVT 2LT1A 1MV0B 3M5AA 1KQSS 2EIFA 1OPLA 1NLOC 2DD4A 1YBYA 5CK9A 1MMAA 2CS7A 5FU7B 3OW2S 5CQXA 4X9DA 3OA6A 4JJBA 4M75B 1S72T 3KXTA 1OX8A 2F69A 1K0SA 1VYUA 3CEYA 3CCMT 2AKKA 4NL3A 3GOXA 3J7AF 1WJSA 3M4YA 1SSFA 4IUTA 1RAHB 4PJOE 4C8QG 1UFFA 3S3MA 1MMDA 3THKA 2BE9B 4N4GA 2KT1A 3M56A 5GAMg 2FZCB 4Q5WA 4M7AD 3VRZA 2EGAA 3J80E 2V1RA 2ZPFB 2DRMA 2R5AA 4PJNA 3JRZA 4M7DA 4IUQA 2LX7A 2CP0A 2P84A 1M1KR 2EQKA 3V8KA 3VS6A 4C92C 2D1XA 2DNUA 3BY7A 5GMKm 2XMFA 3URGA 3WXMB 3FDRA 2K9GA 1UHCA 2HBPA 4EMKA 2YRCA 2PUOB 2ENMA 2KQWA 1EX4A 1SKUB 3CMAA 1GCQA 1D0XA 3CCJA 1QVGP 2A0FB 2PUKB 1VQ5T 2DEUA 3OYAA 1X2QA 1G8XA 2ROLA 1XQHA 1I0CA 4LDWA 4M7AE 4O5VA 4OGCA 2WSCE 2ZPBB 4OMOA 1HXDA 2K2VA 2W0ZA 4BY6C 1YI2Q 4QVCA 1JB0E 1RAAB 3QWXX 2E41A 3RIRA 4DOVA 2FPDA 4F14A 2LJ3A 1BB9A 4Z8AA 3J81E 3M59A 3LWIA 1RI9A 4KUDK 1RLPC 2XDDA 3CPFA 3EFSA 2E6NA 4F7UG 1V29B 4IKFA 1Q81U 3H9NA 1WHJA 3PMIA 1TUGB 2EAYA 1EFNA 3GNFB 4A4KA 4ZGJB 5GAN8 4FL6A 3Q1JA 2OTLT 1WHKA 3SB2A 4BI8B 4JS4A 5LJ3j 2QQRA 3UWNA 1TSFA 3M55A 2QGGA 4CI0C 2NLUA 2GF7A 5J39A 2CZ0B 1CKBA 2NUTB 1SHGA 1S72Q 3RKXA 2AK5A 2DL7A 2G3RA 1W4SA 1SRLA 2VXEA 4IIOA 1VQ6A 2HQEA 2D8JA 2DERA 2YLBA 3ASKA 4BY6B 5IXFA 1UGVA 1IGQA 3VKIA 2PVOB 1B07A 2QQ9A 2DTHA 1KD1U 2C0TA 2RI3A 2V8IA 4RTYA 4ANJA 5KCHA 2DXTA 4C92D 5GAMe 1C1AA 1MMGA 1VIFA 1PSFA 4B9XA 1QVGA 2LX9A 1ARKA 3TQ7P 4CC2A 2OX7A 2X4YA 3DB3A 4JDSA 2CKKA 2X4WA 2LQNA 4J6YA 2CP2A 4PJJA 1RAIB 5CKEA 4OB1B 3PVLA 1VQLA 3G71A 1ZA2B 3DLLA 2O31A 2LQWA 2OTLA 2YXYA 4C8QD 3PIPA 1K4US 1OZ3A 3FJ5A 1JQQA 1PD0A 3JCMX 2QQBA 1WQ7A 2KYMA 2JM9A 3HRSA 5LJ3e 3ULRB 3LLRA 4M7AG 4WCIA 4B6MA 4OMLA 4N0AA 1K9MC 1YIJA 3CCEQ 3M0QA 4QVZA 1VQ7T 4CC3A 2NUPA 4QQDA 1IO6A 2D6FA 1FMVA 1NPPA 2WSEE 5D6WA 1VQMT 1LOJA 4LUDA 4MMLA 1ZSZB 1BI2A 2EYZA 3RNJA 1FMKA 4AG2C 4J5YA 2VUBA 2MOXA 3LH5A 2GFUA 2L3SA 3X26B 2HL3A 2L2PA 2HEQA 1UE9A 1HSQA 2K3YA 4GBQA 4RG2A 2RD1A 4GY5A 4LDUA 2DJQA 2CT3A 2LMJA 2ZGWA 1O75A 2C06A 2A08A 4J9GA 2HQHA 1EIFA 1WA7A 4PJLA 1W2BP 4KH1B 4KRTA 2RQUA 2EQMA 5IH2A 2DZ9A 2M02A 3CCUA 1VYVA 5GAN6 2E4HA 2V8JA 1KFZA 2JW4A 1M3AA 3ER0A 1W6XA 1NJIC 4M77C 4QQGA 1ZUYA 2D9TA 5LL6S 2FRWA 5GANj 2R58A 4AFUC 2XDBA 1XNIA 5GANh 3M53A 4A4EA 2MK5A 1G5VA 2IPOB 1VA7A 1WX6A 4BB7A 5LJ5j 1K73U 3VU3C 1G3TA 1TH7A 2E6ZA 1RAGB 1V76A 2HKQB 8ATCB 4E7IA 3SWNC 1VQKQ 1GRIA 2DTIA 3OYDA 2QA4T 2BZXA 2YDLA 2QXFA 5KYYA 4DA4A 3CCSA 2XK0A 2FEIA 4DQ2A 3CMEA 2QDYB 4L6V5 4IURA 2JNGA 1SSHA 2PQWA 5LJ3g 2K3XA 4WTOB 1BCOA 2HDAA 3M9QA 4BD3A 1VQ6Q 4F7UB 1N9SA 1YCSB 4XU0A 2DBMA 2RPNA 4F04B 4KH0B 4TVRA 3OYNA 4E7ZA 1KHIA 1RI0A 2JS2A 4BE0A 2HSEB 5GAMd 4BE2A 3BW1A 3RMQA 1U5SA 2A3LA 2QYZA 3TSZA 2LCLA 3G1JA 1ZA1B 3QXEB 2FPFA 1NYGA 5CKDA 3OYJA 1TXQA 1Q82C 5ECAA 1MV3A 3GNGA 2L3QA 1K8AU 4M75F 2BKDN 2B8AA 5CQYA 5GMKi 4ESRA 4BDYA 5GAOp 1YHQA 2LDMA 3S3NA 3RR6A 3EG2A 5DLOA 3OYCA 1JBMA 2AZVA 1X2KA 4F16A 4MZPA 2MF2A 1QQJA 2JMAA 1OULA 1NE8A 2QQSA 4XQ3A 2YUOA 2EQJA 1VQKA 4E7JA 2H3JA 2XHCA 2EBPA 3CPWP 1H8KA 3V7RA 1IB8A 1TUCA 2KGTA 2I2LA 1Z9ZA 3A5ZB 1W70A 4OP0A 2V1QA 2O01E 2VASA 4JRQA 1VQ7Q 2QA4Q 1X01A 2LCCA 4PJOG 4ATOA 4OF1A 5GANd 1RACB 2D8HA 3LGLA 5FWBA 4C5IA 3CPWA 2K3BA 2DE0X 1YJ9T 4ME7A 3H0HA 3MCAB 1GFDA 4M7AF 1O9SA 1U1SA 3CBPA 2L5QA 4M78A 2LCSA 1E7OA 1PWTA 3O8VA 2ZAEA 3OMGA 1KQ1A 2E70A 4C92F 1IXDA 4Z88A 2X9HA 1WHLA 1YITT 5KE2A 2MWOA 2EWNA 3OYMA 1H641 3L2QA 2KYBA 1A0NB 4OMFB 5GAN4 2X4XA 3CCQQ 3H41A 3CCSQ 2ED1A 1FX7A 3JV3A 1G83A 3G4SA 3PMTA 3CPWS 4F7UF 2NUZA 1WXTA 1T3LA 1RAFB 1IRXA 2Y4XA 4ZGEB 3OYEA 2ATCB 2Z0WA 4PJOF 2HBWA 4XU1A 1VQOA 3X28B 2HKNA 2K5IA 2EYWA 1D1BA 1YJNA 4AMCA 1B7TA 1ZBJA 2RHXA 2DM1A 2RJEA 4F17A 1LJOA 1KQSA 4C8QC 3OW2A 4PLIA 1B34A 3JB9J 2DFUA 2RB6A 3KFVA 3OS1A 3CCUQ 2DXUA 3M54A 1OYXA 2LNHB 1U8RA 2LQKA 1HYOA 9ATCB 3VS7A 3M0TA 4NS5A 3META 2P0KA 4J9CA 5IHIA 2YRDA 1CKAA 3NFCA 2FG0A 3HKSA 1CSKA 2K7AA 5GMKh 2HAXA 3TU4K 3P8DA 2CP3A 1VUBA 4RUGA 1M90C 3HFNA 2DPPB 1UUEA 3G6ET 2DXCA 4HVWA 3EGDA 4RTZA 5D6YA 5GAOm 3JB9I 3CD6A 2D0NA 4J9BA 1Q95G 4OMPA 3C12A 4RTVA 2DVEA 1VYTA 2YLCA 3NTHA 2YWWA 3ZFJA 1QMCA 2ECZA 5LJ3f 2XDPA 3MJXA 3BE3A 2FL7A 3I55Q 4FM4B 2L3RA 1QVPA 4KGVB 2O9VA 4JUVA 4XAXB 2WSFE 5L8RE 2CREA 2RHYA 1NJIU 4PNOA 1M30A 1D3BB 4HCKA 1LPLA 2DAQA 1M1KU 3CC7T 3A8HB 3OYKA 2RN8A 1ZSZA 3UPUA 3MEAA 3MP1A 4FYWB 3RERA 3EFOA 1PD1A 1MMNA 4M7AA 2JUFA 4RCBA 3QKJA 4M7DD 1FMWA 1VQLQ 4HVVA 4FW2A 4O6JA 3JCMV 4KBMB 1KSWA 2RQRA 2LZ6B 3ZBDA 1PRMC 1K76A 3M0RA 3JCMb 2KAFA 1IHVA 5KYWB 3CCRT 1NLPC 2CUDA 1GCQC 4CC4B 1WZOA 1VQ9Q 1UHFA 2JJ9A 4Y28E 4FIBA 3JCMh 4ORZA 4KUIA 3E9GA 5KH6A 3CC2Q 1Q7YC 5GJVB 5KYNA 3G71T 3CCJQ 1N8RU 4M77A 1QVGS 2GBQA 1EZZB 1UGRB 4HCZA 2BZ8A 2MMPA 1X75C 1W1FA 3QPHA 1ABQA 4A4HA 4PFPA 2J7IA 2DBKA 4XTWA 1YWOA 1VQPQ 4J7FA 1VQ4Q 2X3WD 3HHTB 5C6SA 4JRIA 2ZPEB 3MP6A 3VUZA 4CC7A 1I8FA 2K5FA 4J83A 3T9NA 3CMEQ 3AHUA 2LJ0A 1Y57A 3JCMW 3MEWA 4M78B 1M3BA 2GNCA 4JLGA 2PVDB 2NYSA 4E47A 4UC4A 5KYXA 1M4ZA 2VGNA 2HZYA 3H8ZA 2EQUA 1PRLC 4PK4A 2ROTA 3I55A 4J9FA 4HCBA 4R0KA 3H6ZA 4E7LA 3MHXA 5EC7A 3JCMe 3EH1A 4LN2A 4LD9K 3QWYA 1OI1A 1TUDA 1G3YA 3CCLA 2XD0A 3SEMA 2ZPIB 3QDFA 3L2VA 2KE9A 3OBWA 5CCAA 3QDRB 2P0QA 2COYA 2IVWA 4FSSA 3CCRA 5FRMA 1M2OA 4M78D 5GAOr 2M0YA 4XTVA 3A8MB 1X43A 2KROA 2E64A 4DEYA 4J9HA 1UECA 4M78C 4LDYA 5A0DA 3LGFA 4XTZA 3EGUA 4EPCA 3V8LA 1HJDA 5I2SA 1WXUA 1K73R 1MUZA 2V8KA 3HTRA 1VQNT 3PVQA 2J6OA 4M7AB 3E2UA 3SDZA 1BKBA 1N8RR 1QVFP 2OTJQ 4DBFA 3C94A 1Y96B 5D6XA 1M2VB 1WYXA 5IAYA 2OTLQ 3CMAT 3GIBA 4L5GA 2E3IA 5FW9A 1I5OB 2DTOA 1LVKA 1X27A 4A63B 1WXBA 5DM7R 3QZ5B 4C92A 5KYUA 4C0DC 5CVIA 2JZ2A 2DF6A 1BU1A 2OTJA 3QZ9B 2CUBA 2KXDA 2DL3A 3EHRA 2DRKA 2DD5A 5AT1B 2RA2A 2SEMA 3UATA 2DA9A 2KK4A 1WLPB 2IIMA 3M4GA 1QCFA 2YT6A 5LJ5d 1D09B 4HT8A 3PGGA 2KRNA 1KG1A 3QIIA 4C8QA 3REAB 3EHQA 4C0FA 2F2WA 1KC8U 1V1CA 3OMCA 1S1NA 2VXFA 1AVZC 2E5QA 3FRNA 1VQ5Q 4M75E 5CR2A 2KNBB 2P0PA 1WHHA 5IHNA 3VRYA 5D7UA 3O5ZA 2QEXQ 3VS5A 7AT1B 1BBZA 1ZQ1A 3JCMc 4FW1A 3TVTA 2CYZB 1VQNA 4OVAA 4BACA 2LP5A 1PC0A 2L89A 2FRYA 2RJFA 3IQLA 2DL8A 5IHKA
chains in the Genus database with same CATH topology
3M5AA 2RI2A 3NTIA 4C5IA 3CPWA 1KQSS 2EIFA 4IUVA 4XTUA 2DD4A 2YRVA 1YBYA 5CK9A 3PIOA 5FU7B 2CS7A 4ME7A 3GP8A 1YJ9T 3ME9A 4PL6A 5CQXA 4X9DA 3OW2S 1VQ5A 3OA6A 3MCAB 3CC4A 4M7AF 1O9SA 5GANg 1Y07A 4M75B 3SWNA 1S72T 4OB0B 1U1SA 3KXTA 3JB9F 3CBPA 2L5QA 5IT9E 4M78A 3HRUA 5FROA 2F69A 2RI5A 2EFIA 3O8VA 3CEYA 3CCMT 4N4IA 1Q86C 4NL3A 3GOXA 1M8VA 3OMGA 3MEUA 3J7AF 4M75A 1WJSA 1KQ1A 2D0QB 4QVDA 2E70A 5CAIA 1VQMA 1WPYA 1SSFA 3M4YA 4IUTA 4M77G 4WF2A 4C92F 4ZTJA 4Y91A 1WJQA 2A7YA 4PJOE 4C8QG 3S3MA 2ZZDA 3JSCA 1YITT 5KE2A 2MWOA 3LW5E 5IN1A 3CCMA 4ZTFA 2EWNA 3CD6T 4N4GA 3OYMA 1H641 3L2QA 2E12A 3M56A 5GAMg 4OMFB 4Q5WA 5GAN4 3A8LB 4OB2B 1VQKT 2M1HA 2HNIA 3HPWA 4M7AD 2X4XA 3DKMA 2VV5A 2QI2A 3A8OB 3J80E 2ZPFB 5LJ5f 3QSUA 1FX7A 2R5AA 3HL8A 3QYHB 3JRZA 2KVQG 4M7DA 4IUQA 2K57A 3PMTA 4DOWA 3I55T 3G4SA 1VQ4A 3CPWS 2EQKA 3V8KA 4F7UF 5GAN3 4C92C 5FLXE 5GMKm 3BY7A 2RHZA 5LJ5h 2Y4XA 4C8QF 1G3WA 2OAUA 3URGA 4PJOD 3FC3A 3QUIA 3WXMB 4ZGEB 1UGQB 4M7AC 3GF5A 3FDRA 3OYEA 4JRKA 1K9MU 4M7AE 4PJOF 2K4YA 4XU1A 2HBPA 3RUXA 4EMKA 1VQOA 2PUOB 1R8OB 4IUUA 3X28B 4C0ZA 3OYFA 2KQWA 2FVUA 2K5IA 1N6AA 3CMAA 4MDXA 3L2RA 2O4XA 4XU3A 3OYGA 3CCJA 1YJNA 3QYGB 2F5KA 2PUKB 1VQ5T 2IG0A 5CO7A 3OYAA 4HCCA 3TREA 3DLMA 4N0AC 3PTAA 2RHXA 4MZMA 1NPRA 1XQHA 2KDSA 2RJEA 4LDWA 4NL2A 2PVGB 1LJOA 1N8RC 1KQSA 4O5VA 1BI3A 2EJ9A 1QVFA 2JTMA 4OGCA 4C8QC 3OW2A 4PLIA 1B34A 3JB9J 2WSCE 1KD1C 3CCLT 2ZPBB 3E9FA 2RB6A 1I4K1 4PLLA 2M9UA 4BUGA 3OS1A 4M77F 2DXUA 3M54A 2Y90A 1Y7XA 4RCCA 1HXDA 1OYXA 1YHQT 1Q86U 2K2VA 1WJRA 3VYGA 1U8RA 4BY6C 1XTDA 2LQKA 2DJZA 4C5GA 5A0LA 1JB0E 4QVCA 4M7DB 2ZPHB 3META 4GLKA 4NS5A 2P0KA 3GLXA 2E41A 1YI2A 4FT4A 3RIRA 4DOVA 2YHTA 3NFCA 3OSSC 3J81E 3HKSA 1UGSB 5GMKh 4B9WA 3M59A 2HAXA 3LWIA 4KUDK 1IZ6A 1VQ9T 3TU4K 3P8DA 2XDDA 1VUBA 4J6XA 3CPFA 3A8GB 3EFSA 3FJPA 2E6NA 5KE3A 4PJOB 4F7UG 1M90C 4RMOA 1V29B 3HFNA 4IKFA 1IREB 2DPPB 3G6ET 4E7HA 1Q81U 3PMIA 3N5BB 2DXCA 3MEVA 2E65A 4JJNK 3UT1A 2LC4A 2EAYA 1XOVA 5D6YA 2XICA 4X9CA 3GNFB 3SD4A 4A4KA 2M16A 2XU8A 4ZGJB 5GMKj 5GAN8 5GAOm 3JB9I 3CD6A 2CZ1B 1Q7YU 3FIFA 4FL6A 3CXCS 3Q1JA 4FU6A 4EMGA 3C12A 4M78E 2OTLT 1VQ8A 5DLQE 3SB2A 4BI8B 3RKYA 3JCMP 4EMHA 3QHSA 5EG2A 1VQLT 3JCMQ 4JS4A 5LJ3j 2DVEA 5GANe 4A4FA 3PFSA 2QQRA 2YLCA 2DK3A 3NTHA 3OSVA 2DZCA 3M55A 3UWNA 3CCET 3ZFJA 3TEEA 4CI0C 2NLUA 2GF7A 3SFMA 4RKUE 5J39A 2CZ0B 3JB9G 5LJ3f 3RKXA 2XDPA 1I81A 2FL7A 4FM4B 2G3RA 2L3RA 1W4SA 4M75D 2VXEA 1QVPA 4D6WA 1YITA 1S72A 1VQ9A 1VQ6A 4JUVA 2HQEA 4XAXB 1K73C 2WSFE 5L8RE 2JN0A 5DY9A 4JS5A 1YJ9A 2RHYA 1NJIU 2YLBA 3ASKA 4HA8A 5GAOn 4BY6B 3QJ6A 4MZTA 4PNOA 3CMET 3VKIA 2PVOB 1D3BB 3QO3A 3I56A 4F7UE 2QQ9A 2DTHA 3JCMg 2DAQA 2RI3A 2V8IA 1KD1U 1G3SA 1M1KU 5KCHA 3CC7T 2DXTA 4C92D 4J6WA 1N9RA 3SWNB 5GAMe 3A8HB 1P92A 4ELZC 1VIFA 2RHUA 3OYKA 3CXCA 3UPUA 4CRIA 1PSFA 1Q82U 3MEAA 3MP1A 1B34B 3RERA 5J3BA 1BIAA 5CKFA 2VC8A 4B9XA 2LX9A 2PU9B 3PT9A 1QVGA 4ATOA 2O4XB 1Q81C 1QP3A 2JUFA 4M7AA 4RCBA 4M7DF 2CGHA 2X4JA 5A0GA 3QKJA 3CCVA 3L2WA 4OGEA 2X4YA 5GMKl 1W2BA 4M7DD 3DB3A 3LH0A 4JDSA 4MDWA 5FU6C 2CKKA 2X4WA 3KBGA 4BI3A 4O6JA 4J6YA 1M90U 4OB1B 5CKEA 3JCMV 2LVMA 1VQLA 3HP9A 4KBMB 3G71A 3KUFA 4M77D 3DLLA 4XU2A 4P5NA 4E7KA 2OTLA 4C8QD 3PIPA 3ZBDA 3MO8A 3LYIA 3OQ5A 1OZ3A 3FEOA 3OS5A 2VGMA 3QG1A 3CCQA 4XK8E 3JCMb 2KAFA 4EDUA 3JCMX 4EMKC 3FLGA 2QQBA 4N4HA 5HK0A 1WQ7A 3CC2A 3PNWC 4J8OA 3CCRT 3JB9D 2DIGA 3HRSA 3P8HA 5LJ3e 2BIVA 3BDLA 3LLRA 1QP2A 4Y28E 4M7AG 2ZCFB 3DB4A 4FIBA 2EKOA 4KUIA 3JCMh 5FRNA 3E9GA 5KH6A 1N27A 2KSSA 5LJ5g 4N0AA 1K9MC 1Q7YC 1YIJA 1RL2A 1YIJT 3G71T 4L59A 4HKEA 1N8RU 4QVZA 4M77A 1VQ7T 3OYYA 4R56A 4II1A 1QVGS 1UGPB 2BUDA 2KY9A 1UGRB 1ZBXA 3LWHA 4KT0E 4HCZA 4QQDA 2MMPA 3L2UA 3M58A 3L2ZA 1X75C 3NTKA 3QPHA 1NZ9A 4C5HA 4A4HA 2D6FA 4BI4A 4OB3B 1NPPA 2WSEE 1W2BS 2LT4A 1WQWA 3INZA 5D6WA 1BI0A 1VQMT 2RHIA 1LOJA 4XTWA 4MMLA 1KHCA 1BI2A 4J7FA 2Y4YA 1H3ZA 1UEBA 4YTLA 3HHTB 5CKBA 2RH2A 4J5YA 4LDXA 2VUBA 5C6SA 3CC7A 1VQOT 2GFUA 4JRIA 2RO0A 4M7DG 2ZPEB 3MP6A 3JAME 4M77B 3JCMJ 3VUZA 1BI1A 3X26B 3X24B 1YJWA 1I8FA 4J7IA 2K5FA 4J83A 3T9NA 3TCJA 2CZ7B 3CCJT 1YJNT 3AHUA 2K3YA 3JCMW 4RG2A 3EFRA 3MEWA 4M78B 3S3OA 1JJ2A 2RD1A 4GY5A 4HT9A 4JLGA 4LDUA 2PVDB 4E47A 4UC4A 3V7SA 2LQ8A 2XG8D 1VIEA 3L1AA 4PJOC 1M4ZA 2LRQA 2K5LA 2JVVA 2VGNA 2ZGWA 5GANf 1O75A 3VYHB 1QVFS 5M9OA 1U1TA 3H8ZA 2EQUA 3CCEA 2C06A 5GAMj 3OB9A 4LDVA 1EIFA 1JJ2S 4PKCC 2FYKA 1PSEA 3QBYA 4NOYA 3CCST 2DO3A 2QTXA 1VQPT 3I55A 3G4ST 3CCQT 2GFAA 4HCBA 2LTOA 4V2SA 5FU7C 1QW1A 2EQMA 2DZ9A 5I2MA 3CCUA 3H6ZA 4A54A 3OYHA 4E7LA 3MHXA 3C4SA 4C0GA 5GAN6 3WVDB 1M1FA 1K8AC 3EAEA 2V8JA 4MMKA 4C0DB 3C95A 5HY6A 3JCMe 4X34A 5J26A 3ER0A 2QEXA 2KMTA 4M77C 1AHJB 1NJIC 4QQGA 2R5MA 4LD9K 2D9TA 5LL6S 1M9SA 1D3BA 1OI1A 3CC2T 5GANj 2DIQA 2R58A 4M7DE 2XDBA 4C92B 1XNIA 5GANh 1FXXA 3M53A 3V7CA 1G3YA 4A4EA 1M1KC 3CCLA 2XD0A 4ZGDB 2OTJT 1G5VA 5AYFA 1BIBA 4BB7A 1YJWT 5LJ5j 2DXBA 2ZPIB 3QJYA 3L2VA 3OBWA 1K73U 5CCAA 3VU3C 2EYQA 1G3TA 1TH7A 3E1SA 3QDRB 2P0QA 4A53A 4C5EA 2E6ZA 2M0OA 2IVWA 2ZPGB 3OYLA 2HD0A 3CCRA 4QW2A 4E7IA 5FRMA 4M78D 2AHJB 3S6WA 5GAOr 4XTVA 2GQVA 2EJGA 3SWNC 3A8MB 1DJ7B 2RJDA 2E64A 4M75G 4M77E 3CC4T 3P8BB 3HFOA 4M78C 5A0DA 4LDYA 2DTIA 1MGQA 2RK1A 3LGFA 4XTZA 4C92E 3OYDA 4EPCA 3G6EA 3CCUT 3V8LA 2QA4T 1KC8C 2XIDA 4VUBA 4BDZA 5I2SA 2JTFA 2QXFA 3HRTA 2V8KA 4DA4A 4R55A 1VQNT 3CCSA 2E1HA 5GAMh 2XK0A 4DQ2A 3CMEA 2QDYB 4M7AB 4L6V5 3L42A 3SDZA 1BKBA 2HQXA 4IURA 4C8QB 2JNGA 3JCMd 4FSXA 2JOYA 2PQWA 4IUPA 5FU6B 5GAMf 5LJ3g 2K3XA 3VUBA 3RESA 1OZ2A 3M9QA 4BD3A 1VQ6T 4F7UB 1VQ4T 3C94A 1Y96B 1N9SA 1X6OA 1Y96A 3X20B 5D6XA 5IAYA 3I56T 3CMAT 1VQ8T 3GIBA 2E10A 3CBMA 4L5GA 4XU0A 2DEQA 3HSBA 3LX7A 1M5Q1 4M78F 4TVRA 3OYNA 2DTOA 3MP8A 3OBYA 1KHIA 1RI0A 4QQ6A 4BE0A 4C8QE 5GAMd 5CKHA 3R6OA 3JCMf 4BE2A 5DM7R 3BDUA 3JB9H 3X25B 4PJOA 3QZ5B 4C92A 4LD6A 4XTXA 4C0DC 5C0MA 5CVIA 2JZ2A 3BW1A 4JLIA 3OYIA 1FWZA 3OS2A 1HK9A 2EJFA 3RMQA 1ZHIA 2A3LA 4FT2A 3VJPA 3V8JA 4JRPA 2OTJA 2LCLA 2RJCA 3QZ9B 5I21A 1LNXA 1MHNA 3OYBA 2RM4A 3F70A 5GAN2 2XI9A 2F5TX 4BE1A 1GXIE 3QXEB 2LNVA 3UDCA 1WNLA 1WGSA 5CKDA 3OYJA 4ZN1A 5LJ3d 1JRIA 4M75C 4A4GA 3VV0A 2DD5A 5A2QE 3OS0A 1Q82C 4M78G 2RA2A 3GNGA 1K8AU 4M75F 2BKDN 2B8AA 5CQYA 5GMKi 2FHDA 4BDYA 4RG8A 5GAOp 2P4TA 1VQ7A 2GCXA 2KK4A 4EMKB 1YHQA 2WACA 5LJ5e 2LDMA 3M4GA 3S3NA 4Z02A 2L8DA 4XTYA 5HKCA 5DLOA 3OYCA 2MI6A 5LJ5d 1JBMA 4HT8A 3ZEHA 3PGGA 4MZPA 2QQAA 2QEXT 2MF2A 2MAMA 3QIIA 4C8QA 1KG1A 1KQ2A 4C0FA 1BYMA 2FB7A 2X35A 2XKOC 2QQSA 4XQ3A 1NE8A 5GAN7 1KC8U 5GMKe 3OMCA 3WVEB 1VQPA 3FB9A 3E19A 4ZN3A 1Y71A 5GAN5 5GAOq 2VXFA 3RMSA 2EQJA 1VQKA 4E7JA 2H3JA 2E5QA 3FRNA 2CZ6B 4M7DC 4M75E 5CR2A 3OY9A 2XHCA 2VYTA 2P0PA 3V7RA 4ELYC 3GPLA 3G7ZA 2DKGA 1I5LA 2RK2A 4F7UA 2I2LA 5KCOA 2MWPA 3A5ZB 1UB4A 4OP0A 3RKWA 3M57A 2QA4A 2O01E 1ZQ1A 4JRQA 3BFMA 5CIUA 5LJ3h 3JCMc 2R57A 1YI2T 1X01A 2LCCA 4PJOG 2CYZB 4C92G 3CBOA 4OVAA 5GAOl 4BACA 1VQNA 4KULA 4OF1A 5GANd 5HK3A 2L89A 2RJFA 1YCYA 3CCVT 2LT1A 3LGLA 1M1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7A G;  2DTI A;  1MGQ A;  4C92 E;  4XTZ A;  3JCM h;  3V8L A;  4XTU A;  5LJ5 g;  4J6X A;  4N0A A;  3EFS A;  3FJP A;  4X9D A;  4QVD A;  4PJO B;  4F7U G;  4M7A F;  4M77 A;  3HFN A;  2E1H A;  5GAM h;  5GAN g;  4M75 B;  3SWN A;  1U1S A;  4DQ2 A;  3JB9 F;  4M7A B;  4M78 A;  4C8Q B;  2E65 A;  3JCM d;  3L2Z A;  2EAY A;  5GAM f;  5GMK j;  4X9C A;  5LJ3 g;  5GAO m;  3RES A;  5GAN 8;  3JB9 I;  4NL3 A;  1M8V A;  4F7U B;  3FIF A;  4M75 A;  1KQ1 A;  5CAI A;  1WQW A;  1Y96 B;  1N9S A;  3INZ A;  1WPY A;  1Y96 A;  1LOJ A;  4M77 G;  4WF2 A;  4XTW A;  4MML A;  4M78 E;  4C92 F;  4Y91 A;  3GIB A;  2E10 A;  3SB2 A;  4XU0 A;  4EMG A;  2DEQ A;  3RKY A;  3JCM P;  4C8Q G;  3HSB A;  4EMH A;  4PJO E;  1M5Q 1;  3QHS A;  4M78 F;  3JCM Q;  2DTO A;  5LJ3 j;  2DVE A;  5GAN e;  4J5Y A;  2YLC A;  2EWN A;  2DZC A;  4C8Q E;  5GAM d;  1H64 1;  3JCM f;  4JRI A;  4M7D G;  3BDU A;  4M77 B;  3JCM J;  3JB9 G;  5GAM g;  3JB9 H;  5LJ3 f;  3RKX A;  5GAN 4;  4C92 A;  4PJO A;  1I81 A;  1I8F A;  4M75 D;  4XTX A;  2VXE A;  3BW1 A;  4JLI A;  2HNI A;  3AHU A;  4M7A D;  3JCM W;  3EFR A;  4M78 B;  4JUV A;  1HK9 A;  2EJF A;  2RD1 A;  2JN0 A;  5DY9 A;  3V8J A;  4HT9 A;  5I21 A;  5LJ5 f;  1LNX A;  3QSU A;  4M7D B;  2RM4 A;  2YLB A;  5GAN 2;  4M7D A;  2K57 A;  4HA8 A;  5GAO n;  1WNL A;  4PNO A;  3V7S A;  3L1A A;  3V8K A;  4F7U F;  5GAN 3;  4PJO C;  4C92 C;  2ZGW A;  1D3B B;  3BY7 A;  3QO3 A;  5LJ3 d;  4F7U E;  5GMK m;  5LJ5 h;  2DTH A;  1JRI A;  4M75 C;  1U1T A;  3JCM g;  4C8Q F;  4PJO D;  4M78 G;  2DXT A;  3QUI A;  2RA2 A;  1N9R A;  4J6W A;  3SWN B;  4C92 D;  4M75 F;  5GAM e;  5GAM j;  4M7A C;  5GMK i;  2FYK A;  4JRK A;  4NOY A;  2QTX A;  5GAO p;  4PJO F;  4EMK B;  4XU1 A;  3RUX A;  4EMK A;  5LJ5 e;  3M4G A;  4V2S A;  1B34 B;  4XTY A;  3RER A;  1BIA A;  2VC8 A;  5GAN f;  2DZ9 A;  5LJ5 d;  1JBM A;  4XU3 A;  4HT8 A;  3PGG A;  4A54 A;  4C8Q A;  4M7A A;  1KQ2 A;  4RCB A;  5GAN 6;  4M7D F;  2CGH A;  2FB7 A;  4XQ3 A;  5GAN 7;  5GMK e;  4MMK A;  4N0A C;  3JCM e;  3FB9 A;  5GMK l;  4M7D D;  5GAN 5;  5GAO q;  2VXF A;  4NL2 A;  4M7A E;  4J6Y A;  4M77 C;  1LJO A;  3JCM V;  2EJ9 A;  4M7D C;  4M75 E;  1D3B A;  4C8Q C;  5GAN j;  1B34 A;  4M77 D;  3V7R A;  3JB9 J;  4XU2 A;  4M7D E;  4C92 B;  5GAN h;  3V7C A;  2DKG A;  1I5L A;  4F7U A;  2RB6 A;  1I4K 1;  4C8Q D;  2I2L A;  1BIB A;  4M77 F;  2DXU A;  2Y90 A;  5LJ5 j;  4RCC A;  1HXD A;  4OP0 A;  3RKW A;  3VU3 C;  2DJZ A;  4QVC A;  1TH7 A;  4A53 A;  3JCM b;  3JCM X;  4EMK C;  3BFM A;  5LJ3 h;  2E41 A;  3JCM c;  1WQ7 A;  1X01 A;  3JB9 D;  4PJO G;  4M78 D;  3RIR A;  4C92 G;  5GAO l;  5GAO r;  4XTV A;  5GAN d;  2EJG A;  2YHT A;  5LJ3 e;  3SWN C;  1YCY A;  4M75 G;  4M77 E;  2E64 A;  3HFO A;  4M78 C;  5GMK h; 
#chains in the Genus database with same CATH topology
 4DEX A;  4XTU A;  4OMM A;  3PIO A;  1BK2 A;  1M90 R;  1VQ5 A;  2F1L A;  3CC4 A;  1Y07 A;  4AFS C;  4OB0 B;  3OW2 P;  3JB9 F;  5IT9 E;  2LJ1 A;  3HRU A;  5FRO A;  3M0U A;  1OPK A;  1YP5 A;  3MEU A;  2D0Q B;  1VQM A;  4QVD A;  1WPY A;  4WF2 A;  1I07 A;  1WJQ A;  2A7Y A;  2ZZD A;  1VQ8 Q;  3JSC A;  2JMC A;  2K79 A;  2PNI A;  5IN1 A;  4ZTF A;  1U06 A;  2E12 A;  4OMQ A;  3HPW A;  2VV5 A;  2QI2 A;  1C0M A;  2GQI A;  2O9S A;  5LJ5 f;  3QYH B;  3HL8 A;  4K11 A;  2KVQ G;  1QCO A;  2K57 A;  2QG9 B;  3EH2 A;  1VQ4 A;  1M3C A;  3I5R A;  5LJ5 h;  4C8Q F;  3GBQ A;  4PJO D;  1UGQ B;  4JRK A;  2V26 A;  2KT8 A;  3RUX A;  4C0Z A;  1R8O B;  4IUU A;  2FVU A;  1KIK A;  2KR3 A;  1N6A A;  3L2R A;  2O4X A;  2QTV A;  5I11 A;  4HXJ A;  5HCK A;  2CT4 A;  4N0A C;  4MZM A;  1NPR A;  1JXO A;  2F2V A;  1G2B A;  1QVF A;  1N8R C;  2EJ9 A;  2EQI A;  2JTM A;  2KRS A;  1KD1 C;  3E9F A;  4PLL A;  2M9U A;  4BUG A;  2Y90 A;  4QKU A;  4RCC A;  1YHQ T;  4C5G A;  2DJZ A;  5A0L A;  2ZPH B;  2DX1 A;  3GLX A;  1YI2 A;  4FT4 A;  1Q7Y R;  1K9A A;  3OSS C;  2DL4 A;  1UGS B;  2NWM A;  1RAB B;  1PM3 A;  1ACM B;  2KBT A;  1TS9 A;  1YJW Q;  1IZ6 A;  4J6X A;  2E5K A;  3EGD B;  3A8G B;  5KE3 A;  4AFQ C;  2JTE A;  4PJO B;  1IRE B;  1ZX6 A;  5FWC A;  3CCL Q;  1RAE B;  3MEV A;  2VB6 A;  3UT1 A;  3REB B;  2C0I A;  4X9C A;  3SD4 A;  2M16 A;  2XU8 A;  2CSQ A;  2CZ1 B;  1OX9 A;  1Q7Y U;  3FIF A;  2PTK A;  3I56 Q;  1OV3 A;  5DLQ E;  1N5Z A;  4E7S A;  2FZK B;  3QHS A;  1VQL T;  3JCM Q;  2C0O A;  2J6F A;  3PFS A;  4OMN A;  3OSV A;  4RKU E;  3JB9 G;  1OQK A;  1JXM A;  2JXB A;  1I81 A;  3M0S A;  4M75 D;  1YIT A;  1AZE A;  1KK7 A;  1UTI A;  1WHG A;  2OJ2 A;  5GAO n;  1Y0M A;  3QJ6 A;  4MZT A;  4KGZ B;  4FYV B;  2O88 A;  3I56 A;  1E6H A;  1G3S A;  4J6W A;  1N9R A;  1P92 A;  3EG0 A;  4ELZ C;  3CXC A;  1Q82 U;  5J3B A;  1BIA A;  4LNP A;  2VC8 A;  2RNA A;  2PU9 B;  3VS0 A;  2O4X B;  3CMA Q;  1Q81 C;  1U3O A;  2L0A A;  2X4J A;  2EW3 A;  3L2W A;  4OGE A;  5GMK l;  1W2B A;  5FU6 C;  3LH0 A;  2BE7 D;  3KBG A;  3RBB B;  1M90 U;  3PE0 A;  4IIM A;  3HP9 A;  2EYY A;  2MYS A;  3KUF A;  4XU2 A;  2EYX A;  4E7K A;  1UJY A;  1NEG A;  4DBR A;  1MNE A;  2DMO A;  3QG1 A;  3FEO A;  1QWE A;  2VGM A;  3NGP A;  4EDU A;  4Z89 A;  4EMK C;  4N4H A;  3CC2 A;  3PNW C;  2DIG A;  5I22 A;  3NMZ C;  2BIV A;  1D0Z A;  1QP2 A;  1ABO A;  2X3X D;  2YUQ A;  2ZCF B;  3DB4 A;  2EKO A;  3EGX A;  4PFZ A;  1N27 A;  5LJ5 g;  2J05 A;  3UA7 A;  1AWW A;  1YJN Q;  3OYY A;  4R56 A;  4II1 A;  3AT1 B;  1UGP B;  4AT1 B;  1ZBX A;  3LWH A;  4KT0 E;  1D1C A;  4FYY B;  3M58 A;  3L2Z A;  3NTK A;  2QAS A;  4C5H A;  4JJD A;  4BI4 A;  4OB3 B;  1W2B S;  3INZ A;  1JEG A;  2RHI A;  1KHC A;  1YFN A;  2Y4Y A;  1H3Z A;  1UEB A;  1D0Y A;  1R77 A;  4AG1 C;  2RH2 A;  4LDX A;  4KGX B;  2EKH A;  1VQO T;  5IXB A;  4M7D G;  4AFZ C;  1OU9 A;  3JCM J;  1BI1 A;  3X24 B;  2RQT A;  1YJW A;  1F1B B;  3TCJ A;  1YJN T;  2CZ7 B;  2M51 A;  1QKX A;  1AZG B;  3V7S A;  2XG8 D;  3L1A A;  4PJO C;  2LRQ A;  2K5L A;  5GAN f;  1QVF S;  3VYH B;  5M9O A;  4HVU A;  3CCE A;  5GAM j;  4LDV A;  2AIR B;  2FYK A;  1PSE A;  3QBY A;  4NOY A;  3CCS T;  1VQP T;  2GFA A;  4V2S A;  5FU7 C;  1KJW A;  1QW1 A;  3CD6 Q;  1SPK A;  3OYH A;  1M8M A;  3C4S A;  1I1J A;  3WVD B;  3EAE A;  4C0D B;  3C95 A;  3A1P A;  4X34 A;  5J26 A;  2HL5 C;  4JZ4 A;  1MND A;  2QEX A;  1AHJ B;  2R5M A;  1M9S A;  1NG2 A;  1D3B A;  2CP7 A;  3CC2 T;  1R0C B;  1SG5 A;  3G71 Q;  4M7D E;  4C92 B;  1FXX A;  3V7C A;  4ZGD B;  1AWO A;  1YJW T;  2DXB A;  3QJY A;  3A98 A;  2EYQ A;  1ZSZ C;  4C5E A;  3M0P A;  1BCM A;  2HD0 A;  4RTW A;  3EG9 A;  1SEM A;  2EJG A;  4M75 G;  4M77 E;  3CC4 T;  2HSP A;  1M27 C;  1MGQ A;  2RK1 A;  1YHQ Q;  3G6E A;  3CCU T;  2XID A;  3HRT A;  1TOV A;  3CXC P;  4R55 A;  5GAM h;  2VWF A;  4C8Q B;  3JCM d;  2EGC A;  4FSX A;  5GAM f;  5FU6 B;  6AT1 B;  2VVK A;  1OZ2 A;  1VQ4 T;  1X6O A;  1Y96 A;  2P4R A;  1VQ8 T;  3VS3 A;  4J9E A;  2E10 A;  3HSB A;  2QAZ A;  2DEQ A;  3I9Q A;  1M5Q 1;  2A36 A;  4M78 F;  1LCK A;  2J6K A;  5CKH A;  4JJC A;  2DIL A;  3JCM f;  3BDU A;  3JB9 H;  3CQT A;  3X25 B;  4PJO A;  3G4S Q;  1TG0 A;  4XTX A;  3OYI A;  1AT1 B;  4JLI A;  2AKL A;  1PCX A;  3VS2 A;  1HK9 A;  1ZHI A;  1QCN A;  3V8J A;  4D8D A;  3OYB A;  1LNX A;  1MHN A;  2RM4 A;  2XI9 A;  1GXI E;  1WGS A;  4ZN1 A;  5LJ3 d;  1JRI A;  1ZUK A;  4J9D A;  4M78 G;  3MPU B;  2KRM A;  4RG8 A;  2GCX A;  2WAC A;  4LE9 A;  2L8D A;  4XTY A;  1UJ0 A;  1H92 A;  2HCK A;  1QLY A;  3ZEH A;  2QEX T;  2QQA A;  2MAM A;  1KQ2 A;  2FB7 A;  2X35 A;  2XKO C;  5GMK e;  1VQP A;  3FB9 A;  3E19 A;  3G6E Q;  4ZN3 A;  1Y71 A;  5GAN 5;  2CH4 A;  5GAO q;  1OEB A;  3OY9 A;  4FCY A;  2AT1 B;  4ELY C;  1AWX A;  1I5L A;  2RK2 A;  4JPB W;  2FO0 A;  2RMO A;  2MWP A;  1UB4 A;  3RKW A;  2ED0 A;  2QA4 A;  4ZNX A;  5CIU A;  4LXC A;  5GAO l;  1NEB A;  3CBO A;  4KUL A;  5HK3 A;  1YCY A;  1M1G A;  1JU5 C;  2RI2 A;  3EFO B;  3NTI A;  4IUV A;  3UA6 A;  2YRV A;  2A28 A;  3GP8 A;  3ME9 A;  3MKD A;  4PL6 A;  1R0B G;  2CSI A;  5GAN g;  3H0F A;  2QK0 A;  1PKT A;  3SWN A;  2RI5 A;  2EFI A;  2KI7 A;  4N4I A;  1Q86 C;  1M8V A;  2RQW A;  3ZL7 C;  4M75 A;  5CAI A;  4M77 G;  3U23 A;  1AOJ A;  4ZTJ A;  1GL5 A;  4Y91 A;  2BZY A;  2F2X A;  3LW5 E;  1RUW A;  3CCM A;  3CD6 T;  2KEA A;  1VQK T;  3A8L B;  4OB2 B;  2M1H A;  2JT4 A;  2HNI A;  3DKM A;  3EG1 A;  3A8O B;  2H3E B;  1XJW B;  3QSU A;  4M7D B;  3I55 T;  1X6G A;  4DOW A;  1NJI R;  5GAN 3;  5FLX E;  4JZ3 A;  2RHZ A;  4QT7 A;  1G3W A;  2OAU A;  3FC3 A;  3QUI A;  4M7A C;  3GF5 A;  2DL5 A;  2FZG B;  1K9M U;  2K4Y A;  5KYY B;  2COZ A;  3OYF A;  1K1Z A;  4MDX A;  2HMA A;  4XU3 A;  3OYG A;  3QYG B;  2F5K A;  2QDL A;  2EPD A;  2IG0 A;  5CO7 A;  4HCC A;  3TRE A;  1H3H A;  3DLM A;  3PTA A;  2KDS A;  4NL2 A;  2PVG B;  1BI3 A;  1D1A A;  2CP6 A;  1YWP A;  1WFW A;  3CCL T;  1I4K 1;  4M77 F;  1Y7X A;  1Q86 U;  1WJR A;  1B3Q A;  3VYG A;  1XTD A;  3CCV Q;  4GLK A;  5KYX B;  1SRM A;  5L23 A;  2YHT A;  4PFO A;  2EGE A;  1UG1 A;  4B9W A;  3TSW A;  2VKN A;  1VQ9 T;  3FJP A;  4DBH A;  4E6R A;  4RMO A;  1GFC A;  1HD3 A;  5KYW A;  4E7H A;  2B86 A;  3N5B B;  4X1V A;  2JS0 A;  2E65 A;  4JJN K;  2LC4 A;  3D7S B;  1XOV A;  5GMK j;  2XIC A;  1VQM Q;  5KYU B;  3CXC S;  4FU6 A;  4EMG A;  4M78 E;  1VQ8 A;  3RKY A;  3JCM P;  4EMH A;  5EG2 A;  2CH4 W;  5GAN e;  2KXC A;  1AD5 A;  4A4F A;  2DK3 A;  2DZC A;  1K9M R;  3CCE T;  3TEE A;  3SFM A;  1WI7 A;  4E2F B;  1PKS A;  4D6W A;  1S72 A;  1Q81 R;  1VQ9 A;  1VOM A;  1K73 C;  1VQN Q;  2JN0 A;  5DY9 A;  4JS5 A;  1YJ9 A;  2NUT A;  4HA8 A;  3CME T;  2DYB A;  2YSQ A;  3QO3 A;  4F7U E;  3JCM g;  3C0C A;  3SWN B;  4PJM A;  1E6G A;  1WIE A;  1M2V A;  2RHU A;  1ZUU A;  4CRI A;  2DYI A;  1T0J A;  2MPX C;  1B34 B;  2OI3 A;  2PZ1 A;  5CKF A;  3PT9 A;  2SRC A;  1QP3 A;  8AT1 B;  4M7D F;  2CGH A;  1AEY A;  3CCV A;  5A0G A;  2RF0 A;  3UF4 A;  4MDW A;  1KC8 R;  4BI3 A;  1GBR A;  2LVM A;  4RTT A;  1YNZ A;  4M77 D;  1ZSG A;  4P5N A;  2W10 A;  1J3T A;  3MO8 A;  3LYI A;  3OQ5 A;  3OS5 A;  3CCQ A;  4XK8 E;  3R6N A;  3FLG A;  5HK0 A;  4J8O A;  3JB9 D;  2EVR A;  2MCN A;  3P8H A;  3CC7 Q;  3BDL A;  3VS4 A;  3RDV A;  5FRN A;  2KSS A;  1AWJ A;  1RL2 A;  1YIJ T;  1YN8 A;  4L59 A;  4HKE A;  2BUD A;  2KY9 A;  1VQO Q;  3L2U A;  1NZ9 A;  1PHT A;  1NM7 A;  2OAW A;  3I5S A;  2LT4 A;  2O2O A;  1WQW A;  1BI0 A;  1WDX A;  2COW A;  2H8H A;  2AZS A;  1KQS P;  1RAD B;  4YTL A;  5CKB A;  3CC7 A;  1RLQ C;  4Y92 A;  4EIK A;  2RO0 A;  3JAM E;  4M77 B;  1NBE B;  4J7I A;  3CCJ T;  3S3O A;  1JJ2 A;  3EFR A;  3H0I A;  4HT9 A;  2MIO A;  2DLP A;  2LQ8 A;  1VIE A;  2JVV A;  1U1T A;  1TTH B;  2RQV A;  3OB9 A;  1JJ2 S;  4PKC C;  1FYN A;  1IGU A;  2DO3 A;  2QTX A;  3G4S T;  3CCQ T;  2ABL A;  2LTO A;  1JJ2 P;  1QWF A;  5I2M A;  4DBQ A;  4RTU A;  4A54 A;  4C0G A;  1M1F A;  2QGF B;  1K8A C;  4MMK A;  4D8K A;  5HY6 A;  1T0H A;  2DET A;  1C6V X;  2KMT A;  2DVJ A;  2NUP B;  3I35 A;  1KD1 R;  2ESW A;  2DIQ A;  1M1K C;  2OTJ T;  5AYF A;  1BIB A;  3CCR Q;  2GGR A;  3E1S A;  4A53 A;  2M0O A;  2ZPG B;  3OYL A;  4QW2 A;  3SHW A;  2AHJ B;  3S6W A;  2GQV A;  3EG9 B;  1DJ7 B;  2RJD A;  3CC4 Q;  2G6F X;  3P8B B;  3HFO A;  2FPE A;  3NPF A;  2YUN A;  4C92 E;  1KC8 C;  2A37 A;  4VUB A;  4BDZ A;  2JM8 A;  1IHW A;  1OU8 A;  2JTF A;  4RTX A;  1Q86 R;  2CDT A;  2L3P A;  2E1H A;  1SHF A;  1PNJ A;  2I0N A;  3L42 A;  2HQX A;  3VS1 A;  2K6D A;  2JOY A;  4IUP A;  3VUB A;  3RES A;  1SF9 A;  1VQ6 T;  1GCP A;  3CCM Q;  4J9I A;  3X20 B;  1YIT Q;  3I56 T;  4M4Z A;  3CBM A;  3LX7 A;  3MP8 A;  3OBY A;  2E3H A;  1YJ9 Q;  3EGX B;  4FYX B;  4QQ6 A;  3EG3 A;  4C8Q E;  3R6O A;  2GTO A;  1X6B A;  4LD6 A;  1Z9Q A;  1TWB A;  2K2M A;  5C0M A;  1FWZ A;  3OS2 A;  2EJF A;  4FT2 A;  3VJP A;  4JRP A;  1K0X A;  2RJC A;  5I21 A;  3F70 A;  5GAN 2;  1TU0 B;  2F5T X;  4BE1 A;  2LNV A;  3UDC A;  1WNL A;  2J06 A;  1PG5 B;  1OOT A;  4M75 C;  4A4G A;  4GLM A;  3VV0 A;  5A2Q E;  3OS0 A;  1ZLM A;  1WHM A;  2FHD A;  1GBQ A;  2BTT A;  2P4T A;  1VQ7 A;  4EMK B;  2YUP A;  5LJ5 e;  4Z02 A;  2GTJ A;  1X69 A;  5HKC A;  2MI6 A;  5GJW B;  2X51 A;  1BYM A;  5GAN 7;  3WVE B;  4LUE A;  1QKW A;  3RMS A;  1UDL A;  1YIJ Q;  2CZ6 B;  1NYF A;  3NHN A;  4M7D C;  1JO8 A;  1Q82 R;  2VYT A;  3GPL A;  3G7Z A;  2DKG A;  4F7U A;  5KCO A;  2CP5 A;  3M57 A;  3BFM A;  5LJ3 h;  1T3S A;  2R57 A;  1YI2 T;  4C92 G;  1K8A R;  3CCV T;  2LT1 A;  1MV0 B;  3M5A A;  1KQS S;  2EIF A;  1OPL A;  1NLO C;  2DD4 A;  1YBY A;  5CK9 A;  1MMA A;  2CS7 A;  5FU7 B;  3OW2 S;  5CQX A;  4X9D A;  3OA6 A;  4JJB A;  4M75 B;  1S72 T;  3KXT A;  1OX8 A;  2F69 A;  1K0S A;  1VYU A;  3CEY A;  3CCM T;  2AKK A;  4NL3 A;  3GOX A;  3J7A F;  1WJS A;  3M4Y A;  1SSF A;  4IUT A;  1RAH B;  4PJO E;  4C8Q G;  1UFF A;  3S3M A;  1MMD A;  3THK A;  2BE9 B;  4N4G A;  2KT1 A;  3M56 A;  5GAM g;  2FZC B;  4Q5W A;  4M7A D;  3VRZ A;  2EGA A;  3J80 E;  2V1R A;  2ZPF B;  2DRM A;  2R5A A;  4PJN A;  3JRZ A;  4M7D A;  4IUQ A;  2LX7 A;  2CP0 A;  2P84 A;  1M1K R;  2EQK A;  3V8K A;  3VS6 A;  4C92 C;  2D1X A;  2DNU A;  3BY7 A;  5GMK m;  2XMF A;  3URG A;  3WXM B;  3FDR A;  2K9G A;  1UHC A;  2HBP A;  4EMK A;  2YRC A;  2PUO B;  2ENM A;  2KQW A;  1EX4 A;  1SKU B;  3CMA A;  1GCQ A;  1D0X A;  3CCJ A;  1QVG P;  2A0F B;  2PUK B;  1VQ5 T;  2DEU A;  3OYA A;  1X2Q A;  1G8X A;  2ROL A;  1XQH A;  1I0C A;  4LDW A;  4M7A E;  4O5V A;  4OGC A;  2WSC E;  2ZPB B;  4OMO A;  1HXD A;  2K2V A;  2W0Z A;  4BY6 C;  1YI2 Q;  4QVC A;  1JB0 E;  1RAA B;  3QWX X;  2E41 A;  3RIR A;  4DOV A;  2FPD A;  4F14 A;  2LJ3 A;  1BB9 A;  4Z8A A;  3J81 E;  3M59 A;  3LWI A;  1RI9 A;  4KUD K;  1RLP C;  2XDD A;  3CPF A;  3EFS A;  2E6N A;  4F7U G;  1V29 B;  4IKF A;  1Q81 U;  3H9N A;  1WHJ A;  3PMI A;  1TUG B;  2EAY A;  1EFN A;  3GNF B;  4A4K A;  4ZGJ B;  5GAN 8;  4FL6 A;  3Q1J A;  2OTL T;  1WHK A;  3SB2 A;  4BI8 B;  4JS4 A;  5LJ3 j;  2QQR A;  3UWN A;  1TSF A;  3M55 A;  2QGG A;  4CI0 C;  2NLU A;  2GF7 A;  5J39 A;  2CZ0 B;  1CKB A;  2NUT B;  1SHG A;  1S72 Q;  3RKX A;  2AK5 A;  2DL7 A;  2G3R A;  1W4S A;  1SRL A;  2VXE A;  4IIO A;  1VQ6 A;  2HQE A;  2D8J A;  2DER A;  2YLB A;  3ASK A;  4BY6 B;  5IXF A;  1UGV A;  1IGQ A;  3VKI A;  2PVO B;  1B07 A;  2QQ9 A;  2DTH A;  1KD1 U;  2C0T A;  2RI3 A;  2V8I A;  4RTY A;  4ANJ A;  5KCH A;  2DXT A;  4C92 D;  5GAM e;  1C1A A;  1MMG A;  1VIF A;  1PSF A;  4B9X A;  1QVG A;  2LX9 A;  1ARK A;  3TQ7 P;  4CC2 A;  2OX7 A;  2X4Y A;  3DB3 A;  4JDS A;  2CKK A;  2X4W A;  2LQN A;  4J6Y A;  2CP2 A;  4PJJ A;  1RAI B;  5CKE A;  4OB1 B;  3PVL A;  1VQL A;  3G71 A;  1ZA2 B;  3DLL A;  2O31 A;  2LQW A;  2OTL A;  2YXY A;  4C8Q D;  3PIP A;  1K4U S;  1OZ3 A;  3FJ5 A;  1JQQ A;  1PD0 A;  3JCM X;  2QQB A;  1WQ7 A;  2KYM A;  2JM9 A;  3HRS A;  5LJ3 e;  3ULR B;  3LLR A;  4M7A G;  4WCI A;  4B6M A;  4OML A;  4N0A A;  1K9M C;  1YIJ A;  3CCE Q;  3M0Q A;  4QVZ A;  1VQ7 T;  4CC3 A;  2NUP A;  4QQD A;  1IO6 A;  2D6F A;  1FMV A;  1NPP A;  2WSE E;  5D6W A;  1VQM T;  1LOJ A;  4LUD A;  4MML A;  1ZSZ B;  1BI2 A;  2EYZ A;  3RNJ A;  1FMK A;  4AG2 C;  4J5Y A;  2VUB A;  2MOX A;  3LH5 A;  2GFU A;  2L3S A;  3X26 B;  2HL3 A;  2L2P A;  2HEQ A;  1UE9 A;  1HSQ A;  2K3Y A;  4GBQ A;  4RG2 A;  2RD1 A;  4GY5 A;  4LDU A;  2DJQ A;  2CT3 A;  2LMJ A;  2ZGW A;  1O75 A;  2C06 A;  2A08 A;  4J9G A;  2HQH A;  1EIF A;  1WA7 A;  4PJL A;  1W2B P;  4KH1 B;  4KRT A;  2RQU A;  2EQM A;  5IH2 A;  2DZ9 A;  2M02 A;  3CCU A;  1VYV A;  5GAN 6;  2E4H A;  2V8J A;  1KFZ A;  2JW4 A;  1M3A A;  3ER0 A;  1W6X A;  1NJI C;  4M77 C;  4QQG A;  1ZUY A;  2D9T A;  5LL6 S;  2FRW A;  5GAN j;  2R58 A;  4AFU C;  2XDB A;  1XNI A;  5GAN h;  3M53 A;  4A4E A;  2MK5 A;  1G5V A;  2IPO B;  1VA7 A;  1WX6 A;  4BB7 A;  5LJ5 j;  1K73 U;  3VU3 C;  1G3T A;  1TH7 A;  2E6Z A;  1RAG B;  1V76 A;  2HKQ B;  8ATC B;  4E7I A;  3SWN C;  1VQK Q;  1GRI A;  2DTI A;  3OYD A;  2QA4 T;  2BZX A;  2YDL A;  2QXF A;  5KYY A;  4DA4 A;  3CCS A;  2XK0 A;  2FEI A;  4DQ2 A;  3CME A;  2QDY B;  4L6V 5;  4IUR A;  2JNG A;  1SSH A;  2PQW A;  5LJ3 g;  2K3X A;  4WTO B;  1BCO A;  2HDA A;  3M9Q A;  4BD3 A;  1VQ6 Q;  4F7U B;  1N9S A;  1YCS B;  4XU0 A;  2DBM A;  2RPN A;  4F04 B;  4KH0 B;  4TVR A;  3OYN A;  4E7Z A;  1KHI A;  1RI0 A;  2JS2 A;  4BE0 A;  2HSE B;  5GAM d;  4BE2 A;  3BW1 A;  3RMQ A;  1U5S A;  2A3L A;  2QYZ A;  3TSZ A;  2LCL A;  3G1J A;  1ZA1 B;  3QXE B;  2FPF A;  1NYG A;  5CKD A;  3OYJ A;  1TXQ A;  1Q82 C;  5ECA A;  1MV3 A;  3GNG A;  2L3Q A;  1K8A U;  4M75 F;  2BKD N;  2B8A A;  5CQY A;  5GMK i;  4ESR A;  4BDY A;  5GAO p;  1YHQ A;  2LDM A;  3S3N A;  3RR6 A;  3EG2 A;  5DLO A;  3OYC A;  1JBM A;  2AZV A;  1X2K A;  4F16 A;  4MZP A;  2MF2 A;  1QQJ A;  2JMA A;  1OUL A;  1NE8 A;  2QQS A;  4XQ3 A;  2YUO A;  2EQJ A;  1VQK A;  4E7J A;  2H3J A;  2XHC A;  2EBP A;  3CPW P;  1H8K A;  3V7R A;  1IB8 A;  1TUC A;  2KGT A;  2I2L A;  1Z9Z A;  3A5Z B;  1W70 A;  4OP0 A;  2V1Q A;  2O01 E;  2VAS A;  4JRQ A;  1VQ7 Q;  2QA4 Q;  1X01 A;  2LCC A;  4PJO G;  4ATO A;  4OF1 A;  5GAN d;  1RAC B;  2D8H A;  3LGL A;  5FWB A;  4C5I A;  3CPW A;  2K3B A;  2DE0 X;  1YJ9 T;  4ME7 A;  3H0H A;  3MCA B;  1GFD A;  4M7A F;  1O9S A;  1U1S A;  3CBP A;  2L5Q A;  4M78 A;  2LCS A;  1E7O A;  1PWT A;  3O8V A;  2ZAE A;  3OMG A;  1KQ1 A;  2E70 A;  4C92 F;  1IXD A;  4Z88 A;  2X9H A;  1WHL A;  1YIT T;  5KE2 A;  2MWO A;  2EWN A;  3OYM A;  1H64 1;  3L2Q A;  2KYB A;  1A0N B;  4OMF B;  5GAN 4;  2X4X A;  3CCQ Q;  3H41 A;  3CCS Q;  2ED1 A;  1FX7 A;  3JV3 A;  1G83 A;  3G4S A;  3PMT A;  3CPW S;  4F7U F;  2NUZ A;  1WXT A;  1T3L A;  1RAF B;  1IRX A;  2Y4X A;  4ZGE B;  3OYE A;  2ATC B;  2Z0W A;  4PJO F;  2HBW A;  4XU1 A;  1VQO A;  3X28 B;  2HKN A;  2K5I A;  2EYW A;  1D1B A;  1YJN A;  4AMC A;  1B7T A;  1ZBJ A;  2RHX A;  2DM1 A;  2RJE A;  4F17 A;  1LJO A;  1KQS A;  4C8Q C;  3OW2 A;  4PLI A;  1B34 A;  3JB9 J;  2DFU A;  2RB6 A;  3KFV A;  3OS1 A;  3CCU Q;  2DXU A;  3M54 A;  1OYX A;  2LNH B;  1U8R A;  2LQK A;  1HYO A;  9ATC B;  3VS7 A;  3M0T A;  4NS5 A;  3MET A;  2P0K A;  4J9C A;  5IHI A;  2YRD A;  1CKA A;  3NFC A;  2FG0 A;  3HKS A;  1CSK A;  2K7A A;  5GMK h;  2HAX A;  3TU4 K;  3P8D A;  2CP3 A;  1VUB A;  4RUG A;  1M90 C;  3HFN A;  2DPP B;  1UUE A;  3G6E T;  2DXC A;  4HVW A;  3EGD A;  4RTZ A;  5D6Y A;  5GAO m;  3JB9 I;  3CD6 A;  2D0N A;  4J9B A;  1Q95 G;  4OMP A;  3C12 A;  4RTV A;  2DVE A;  1VYT A;  2YLC A;  3NTH A;  2YWW A;  3ZFJ A;  1QMC A;  2ECZ A;  5LJ3 f;  2XDP A;  3MJX A;  3BE3 A;  2FL7 A;  3I55 Q;  4FM4 B;  2L3R A;  1QVP A;  4KGV B;  2O9V A;  4JUV A;  4XAX B;  2WSF E;  5L8R E;  2CRE A;  2RHY A;  1NJI U;  4PNO A;  1M30 A;  1D3B B;  4HCK A;  1LPL A;  2DAQ A;  1M1K U;  3CC7 T;  3A8H B;  3OYK A;  2RN8 A;  1ZSZ A;  3UPU A;  3MEA A;  3MP1 A;  4FYW B;  3RER A;  3EFO A;  1PD1 A;  1MMN A;  4M7A A;  2JUF A;  4RCB A;  3QKJ A;  4M7D D;  1FMW A;  1VQL Q;  4HVV A;  4FW2 A;  4O6J A;  3JCM V;  4KBM B;  1KSW A;  2RQR A;  2LZ6 B;  3ZBD A;  1PRM C;  1K76 A;  3M0R A;  3JCM b;  2KAF A;  1IHV A;  5KYW B;  3CCR T;  1NLP C;  2CUD A;  1GCQ C;  4CC4 B;  1WZO A;  1VQ9 Q;  1UHF A;  2JJ9 A;  4Y28 E;  4FIB A;  3JCM h;  4ORZ A;  4KUI A;  3E9G A;  5KH6 A;  3CC2 Q;  1Q7Y C;  5GJV B;  5KYN A;  3G71 T;  3CCJ Q;  1N8R U;  4M77 A;  1QVG S;  2GBQ A;  1EZZ B;  1UGR B;  4HCZ A;  2BZ8 A;  2MMP A;  1X75 C;  1W1F A;  3QPH A;  1ABQ A;  4A4H A;  4PFP A;  2J7I A;  2DBK A;  4XTW A;  1YWO A;  1VQP Q;  4J7F A;  1VQ4 Q;  2X3W D;  3HHT B;  5C6S A;  4JRI A;  2ZPE B;  3MP6 A;  3VUZ A;  4CC7 A;  1I8F A;  2K5F A;  4J83 A;  3T9N A;  3CME Q;  3AHU A;  2LJ0 A;  1Y57 A;  3JCM W;  3MEW A;  4M78 B;  1M3B A;  2GNC A;  4JLG A;  2PVD B;  2NYS A;  4E47 A;  4UC4 A;  5KYX A;  1M4Z A;  2VGN A;  2HZY A;  3H8Z A;  2EQU A;  1PRL C;  4PK4 A;  2ROT A;  3I55 A;  4J9F A;  4HCB A;  4R0K A;  3H6Z A;  4E7L A;  3MHX A;  5EC7 A;  3JCM e;  3EH1 A;  4LN2 A;  4LD9 K;  3QWY A;  1OI1 A;  1TUD A;  1G3Y A;  3CCL A;  2XD0 A;  3SEM A;  2ZPI B;  3QDF A;  3L2V A;  2KE9 A;  3OBW A;  5CCA A;  3QDR B;  2P0Q A;  2COY A;  2IVW A;  4FSS A;  3CCR A;  5FRM A;  1M2O A;  4M78 D;  5GAO r;  2M0Y A;  4XTV A;  3A8M B;  1X43 A;  2KRO A;  2E64 A;  4DEY A;  4J9H A;  1UEC A;  4M78 C;  4LDY A;  5A0D A;  3LGF A;  4XTZ A;  3EGU A;  4EPC A;  3V8L A;  1HJD A;  5I2S A;  1WXU A;  1K73 R;  1MUZ A;  2V8K A;  3HTR A;  1VQN T;  3PVQ A;  2J6O A;  4M7A B;  3E2U A;  3SDZ A;  1BKB A;  1N8R R;  1QVF P;  2OTJ Q;  4DBF A;  3C94 A;  1Y96 B;  5D6X A;  1M2V B;  1WYX A;  5IAY A;  2OTL Q;  3CMA T;  3GIB A;  4L5G A;  2E3I A;  5FW9 A;  1I5O B;  2DTO A;  1LVK A;  1X27 A;  4A63 B;  1WXB A;  5DM7 R;  3QZ5 B;  4C92 A;  5KYU A;  4C0D C;  5CVI A;  2JZ2 A;  2DF6 A;  1BU1 A;  2OTJ A;  3QZ9 B;  2CUB A;  2KXD A;  2DL3 A;  3EHR A;  2DRK A;  2DD5 A;  5AT1 B;  2RA2 A;  2SEM A;  3UAT A;  2DA9 A;  2KK4 A;  1WLP B;  2IIM A;  3M4G A;  1QCF A;  2YT6 A;  5LJ5 d;  1D09 B;  4HT8 A;  3PGG A;  2KRN A;  1KG1 A;  3QII A;  4C8Q A;  3REA B;  3EHQ A;  4C0F A;  2F2W A;  1KC8 U;  1V1C A;  3OMC A;  1S1N A;  2VXF A;  1AVZ C;  2E5Q A;  3FRN A;  1VQ5 Q;  4M75 E;  5CR2 A;  2KNB B;  2P0P A;  1WHH A;  5IHN A;  3VRY A;  5D7U A;  3O5Z A;  2QEX Q;  3VS5 A;  7AT1 B;  1BBZ A;  1ZQ1 A;  3JCM c;  4FW1 A;  3TVT A;  2CYZ B;  1VQN A;  4OVA A;  4BAC A;  2LP5 A;  1PC0 A;  2L89 A;  2FRY A;  2RJF A;  3IQL A;  2DL8 A;  5IHK A; 
#chains in the Genus database with same CATH homology
 3M5A A;  2RI2 A;  3NTI A;  4C5I A;  3CPW A;  1KQS S;  2EIF A;  4IUV A;  4XTU A;  2DD4 A;  2YRV A;  1YBY A;  5CK9 A;  3PIO A;  5FU7 B;  2CS7 A;  4ME7 A;  3GP8 A;  1YJ9 T;  3ME9 A;  4PL6 A;  5CQX A;  4X9D A;  3OW2 S;  1VQ5 A;  3OA6 A;  3MCA B;  3CC4 A;  4M7A F;  1O9S A;  5GAN g;  1Y07 A;  4M75 B;  3SWN A;  1S72 T;  4OB0 B;  1U1S A;  3KXT A;  3JB9 F;  3CBP A;  2L5Q A;  5IT9 E;  4M78 A;  3HRU A;  5FRO A;  2F69 A;  2RI5 A;  2EFI A;  3O8V A;  3CEY A;  3CCM T;  4N4I A;  1Q86 C;  4NL3 A;  3GOX A;  1M8V A;  3OMG A;  3MEU A;  3J7A F;  4M75 A;  1WJS A;  1KQ1 A;  2D0Q B;  4QVD A;  2E70 A;  5CAI A;  1VQM A;  1WPY A;  1SSF A;  3M4Y A;  4IUT A;  4M77 G;  4WF2 A;  4C92 F;  4ZTJ A;  4Y91 A;  1WJQ A;  2A7Y A;  4PJO E;  4C8Q G;  3S3M A;  2ZZD A;  3JSC A;  1YIT T;  5KE2 A;  2MWO A;  3LW5 E;  5IN1 A;  3CCM A;  4ZTF A;  2EWN A;  3CD6 T;  4N4G A;  3OYM A;  1H64 1;  3L2Q A;  2E12 A;  3M56 A;  5GAM g;  4OMF B;  4Q5W A;  5GAN 4;  3A8L B;  4OB2 B;  1VQK T;  2M1H A;  2HNI A;  3HPW A;  4M7A D;  2X4X A;  3DKM A;  2VV5 A;  2QI2 A;  3A8O B;  3J80 E;  2ZPF B;  5LJ5 f;  3QSU A;  1FX7 A;  2R5A A;  3HL8 A;  3QYH B;  3JRZ A;  2KVQ G;  4M7D A;  4IUQ A;  2K57 A;  3PMT A;  4DOW A;  3I55 T;  3G4S A;  1VQ4 A;  3CPW S;  2EQK A;  3V8K A;  4F7U F;  5GAN 3;  4C92 C;  5FLX E;  5GMK m;  3BY7 A;  2RHZ A;  5LJ5 h;  2Y4X A;  4C8Q F;  1G3W A;  2OAU A;  3URG A;  4PJO D;  3FC3 A;  3QUI A;  3WXM B;  4ZGE B;  1UGQ B;  4M7A C;  3GF5 A;  3FDR A;  3OYE A;  4JRK A;  1K9M U;  4M7A E;  4PJO F;  2K4Y A;  4XU1 A;  2HBP A;  3RUX A;  4EMK A;  1VQO A;  2PUO B;  1R8O B;  4IUU A;  3X28 B;  4C0Z A;  3OYF A;  2KQW A;  2FVU A;  2K5I A;  1N6A A;  3CMA A;  4MDX A;  3L2R A;  2O4X A;  4XU3 A;  3OYG A;  3CCJ A;  1YJN A;  3QYG B;  2F5K A;  2PUK B;  1VQ5 T;  2IG0 A;  5CO7 A;  3OYA A;  4HCC A;  3TRE A;  3DLM A;  4N0A C;  3PTA A;  2RHX A;  4MZM A;  1NPR A;  1XQH A;  2KDS A;  2RJE A;  4LDW A;  4NL2 A;  2PVG B;  1LJO A;  1N8R C;  1KQS A;  4O5V A;  1BI3 A;  2EJ9 A;  1QVF A;  2JTM A;  4OGC A;  4C8Q C;  3OW2 A;  4PLI A;  1B34 A;  3JB9 J;  2WSC E;  1KD1 C;  3CCL T;  2ZPB B;  3E9F A;  2RB6 A;  1I4K 1;  4PLL A;  2M9U A;  4BUG A;  3OS1 A;  4M77 F;  2DXU A;  3M54 A;  2Y90 A;  1Y7X A;  4RCC A;  1HXD A;  1OYX A;  1YHQ T;  1Q86 U;  2K2V A;  1WJR A;  3VYG A;  1U8R A;  4BY6 C;  1XTD A;  2LQK A;  2DJZ A;  4C5G A;  5A0L A;  1JB0 E;  4QVC A;  4M7D B;  2ZPH B;  3MET A;  4GLK A;  4NS5 A;  2P0K A;  3GLX A;  2E41 A;  1YI2 A;  4FT4 A;  3RIR A;  4DOV A;  2YHT A;  3NFC A;  3OSS C;  3J81 E;  3HKS A;  1UGS B;  5GMK h;  4B9W A;  3M59 A;  2HAX A;  3LWI A;  4KUD K;  1IZ6 A;  1VQ9 T;  3TU4 K;  3P8D A;  2XDD A;  1VUB A;  4J6X A;  3CPF A;  3A8G B;  3EFS A;  3FJP A;  2E6N A;  5KE3 A;  4PJO B;  4F7U G;  1M90 C;  4RMO A;  1V29 B;  3HFN A;  4IKF A;  1IRE B;  2DPP B;  3G6E T;  4E7H A;  1Q81 U;  3PMI A;  3N5B B;  2DXC A;  3MEV A;  2E65 A;  4JJN K;  3UT1 A;  2LC4 A;  2EAY A;  1XOV A;  5D6Y A;  2XIC A;  4X9C A;  3GNF B;  3SD4 A;  4A4K A;  2M16 A;  2XU8 A;  4ZGJ B;  5GMK j;  5GAN 8;  5GAO m;  3JB9 I;  3CD6 A;  2CZ1 B;  1Q7Y U;  3FIF A;  4FL6 A;  3CXC S;  3Q1J A;  4FU6 A;  4EMG A;  3C12 A;  4M78 E;  2OTL T;  1VQ8 A;  5DLQ E;  3SB2 A;  4BI8 B;  3RKY A;  3JCM P;  4EMH A;  3QHS A;  5EG2 A;  1VQL T;  3JCM Q;  4JS4 A;  5LJ3 j;  2DVE A;  5GAN e;  4A4F A;  3PFS A;  2QQR A;  2YLC A;  2DK3 A;  3NTH A;  3OSV A;  2DZC A;  3M55 A;  3UWN A;  3CCE T;  3ZFJ A;  3TEE A;  4CI0 C;  2NLU A;  2GF7 A;  3SFM A;  4RKU E;  5J39 A;  2CZ0 B;  3JB9 G;  5LJ3 f;  3RKX A;  2XDP A;  1I81 A;  2FL7 A;  4FM4 B;  2G3R A;  2L3R A;  1W4S A;  4M75 D;  2VXE A;  1QVP A;  4D6W A;  1YIT A;  1S72 A;  1VQ9 A;  1VQ6 A;  4JUV A;  2HQE A;  4XAX B;  1K73 C;  2WSF E;  5L8R E;  2JN0 A;  5DY9 A;  4JS5 A;  1YJ9 A;  2RHY A;  1NJI U;  2YLB A;  3ASK A;  4HA8 A;  5GAO n;  4BY6 B;  3QJ6 A;  4MZT A;  4PNO A;  3CME T;  3VKI A;  2PVO B;  1D3B B;  3QO3 A;  3I56 A;  4F7U E;  2QQ9 A;  2DTH A;  3JCM g;  2DAQ A;  2RI3 A;  2V8I A;  1KD1 U;  1G3S A;  1M1K U;  5KCH A;  3CC7 T;  2DXT A;  4C92 D;  4J6W A;  1N9R A;  3SWN B;  5GAM e;  3A8H B;  1P92 A;  4ELZ C;  1VIF A;  2RHU A;  3OYK A;  3CXC A;  3UPU A;  4CRI A;  1PSF A;  1Q82 U;  3MEA A;  3MP1 A;  1B34 B;  3RER A;  5J3B A;  1BIA A;  5CKF A;  2VC8 A;  4B9X A;  2LX9 A;  2PU9 B;  3PT9 A;  1QVG A;  4ATO A;  2O4X B;  1Q81 C;  1QP3 A;  2JUF A;  4M7A A;  4RCB A;  4M7D F;  2CGH A;  2X4J A;  5A0G A;  3QKJ A;  3CCV A;  3L2W A;  4OGE A;  2X4Y A;  5GMK l;  1W2B A;  4M7D D;  3DB3 A;  3LH0 A;  4JDS A;  4MDW A;  5FU6 C;  2CKK A;  2X4W A;  3KBG A;  4BI3 A;  4O6J A;  4J6Y A;  1M90 U;  4OB1 B;  5CKE A;  3JCM V;  2LVM A;  1VQL A;  3HP9 A;  4KBM B;  3G71 A;  3KUF A;  4M77 D;  3DLL A;  4XU2 A;  4P5N A;  4E7K A;  2OTL A;  4C8Q D;  3PIP A;  3ZBD A;  3MO8 A;  3LYI A;  3OQ5 A;  1OZ3 A;  3FEO A;  3OS5 A;  2VGM A;  3QG1 A;  3CCQ A;  4XK8 E;  3JCM b;  2KAF A;  4EDU A;  3JCM X;  4EMK C;  3FLG A;  2QQB A;  4N4H A;  5HK0 A;  1WQ7 A;  3CC2 A;  3PNW C;  4J8O A;  3CCR T;  3JB9 D;  2DIG A;  3HRS A;  3P8H A;  5LJ3 e;  2BIV A;  3BDL A;  3LLR A;  1QP2 A;  4Y28 E;  4M7A G;  2ZCF B;  3DB4 A;  4FIB A;  2EKO A;  4KUI A;  3JCM h;  5FRN A;  3E9G A;  5KH6 A;  1N27 A;  2KSS A;  5LJ5 g;  4N0A A;  1K9M C;  1Q7Y C;  1YIJ A;  1RL2 A;  1YIJ T;  3G71 T;  4L59 A;  4HKE A;  1N8R U;  4QVZ A;  4M77 A;  1VQ7 T;  3OYY A;  4R56 A;  4II1 A;  1QVG S;  1UGP B;  2BUD A;  2KY9 A;  1UGR B;  1ZBX A;  3LWH A;  4KT0 E;  4HCZ A;  4QQD A;  2MMP A;  3L2U A;  3M58 A;  3L2Z A;  1X75 C;  3NTK A;  3QPH A;  1NZ9 A;  4C5H A;  4A4H A;  2D6F A;  4BI4 A;  4OB3 B;  1NPP A;  2WSE E;  1W2B S;  2LT4 A;  1WQW A;  3INZ A;  5D6W A;  1BI0 A;  1VQM T;  2RHI A;  1LOJ A;  4XTW A;  4MML A;  1KHC A;  1BI2 A;  4J7F A;  2Y4Y A;  1H3Z A;  1UEB A;  4YTL A;  3HHT B;  5CKB A;  2RH2 A;  4J5Y A;  4LDX A;  2VUB A;  5C6S A;  3CC7 A;  1VQO T;  2GFU A;  4JRI A;  2RO0 A;  4M7D G;  2ZPE B;  3MP6 A;  3JAM E;  4M77 B;  3JCM J;  3VUZ A;  1BI1 A;  3X26 B;  3X24 B;  1YJW A;  1I8F A;  4J7I A;  2K5F A;  4J83 A;  3T9N A;  3TCJ A;  2CZ7 B;  3CCJ T;  1YJN T;  3AHU A;  2K3Y A;  3JCM W;  4RG2 A;  3EFR A;  3MEW A;  4M78 B;  3S3O A;  1JJ2 A;  2RD1 A;  4GY5 A;  4HT9 A;  4JLG A;  4LDU A;  2PVD B;  4E47 A;  4UC4 A;  3V7S A;  2LQ8 A;  2XG8 D;  1VIE A;  3L1A A;  4PJO C;  1M4Z A;  2LRQ A;  2K5L A;  2JVV A;  2VGN A;  2ZGW A;  5GAN f;  1O75 A;  3VYH B;  1QVF S;  5M9O A;  1U1T A;  3H8Z A;  2EQU A;  3CCE A;  2C06 A;  5GAM j;  3OB9 A;  4LDV A;  1EIF A;  1JJ2 S;  4PKC C;  2FYK A;  1PSE A;  3QBY A;  4NOY A;  3CCS T;  2DO3 A;  2QTX A;  1VQP T;  3I55 A;  3G4S T;  3CCQ T;  2GFA A;  4HCB A;  2LTO A;  4V2S A;  5FU7 C;  1QW1 A;  2EQM A;  2DZ9 A;  5I2M A;  3CCU A;  3H6Z A;  4A54 A;  3OYH A;  4E7L A;  3MHX A;  3C4S A;  4C0G A;  5GAN 6;  3WVD B;  1M1F A;  1K8A C;  3EAE A;  2V8J A;  4MMK A;  4C0D B;  3C95 A;  5HY6 A;  3JCM e;  4X34 A;  5J26 A;  3ER0 A;  2QEX A;  2KMT A;  4M77 C;  1AHJ B;  1NJI C;  4QQG A;  2R5M A;  4LD9 K;  2D9T A;  5LL6 S;  1M9S A;  1D3B A;  1OI1 A;  3CC2 T;  5GAN j;  2DIQ A;  2R58 A;  4M7D E;  2XDB A;  4C92 B;  1XNI A;  5GAN h;  1FXX A;  3M53 A;  3V7C A;  1G3Y A;  4A4E A;  1M1K C;  3CCL A;  2XD0 A;  4ZGD B;  2OTJ T;  1G5V A;  5AYF A;  1BIB A;  4BB7 A;  1YJW T;  5LJ5 j;  2DXB A;  2ZPI B;  3QJY A;  3L2V A;  3OBW A;  1K73 U;  5CCA A;  3VU3 C;  2EYQ A;  1G3T A;  1TH7 A;  3E1S A;  3QDR B;  2P0Q A;  4A53 A;  4C5E A;  2E6Z A;  2M0O A;  2IVW A;  2ZPG B;  3OYL A;  2HD0 A;  3CCR A;  4QW2 A;  4E7I A;  5FRM A;  4M78 D;  2AHJ B;  3S6W A;  5GAO r;  4XTV A;  2GQV A;  2EJG A;  3SWN C;  3A8M B;  1DJ7 B;  2RJD A;  2E64 A;  4M75 G;  4M77 E;  3CC4 T;  3P8B B;  3HFO A;  4M78 C;  5A0D A;  4LDY A;  2DTI A;  1MGQ A;  2RK1 A;  3LGF A;  4XTZ A;  4C92 E;  3OYD A;  4EPC A;  3G6E A;  3CCU T;  3V8L A;  2QA4 T;  1KC8 C;  2XID A;  4VUB A;  4BDZ A;  5I2S A;  2JTF A;  2QXF A;  3HRT A;  2V8K A;  4DA4 A;  4R55 A;  1VQN T;  3CCS A;  2E1H A;  5GAM h;  2XK0 A;  4DQ2 A;  3CME A;  2QDY B;  4M7A B;  4L6V 5;  3L42 A;  3SDZ A;  1BKB A;  2HQX A;  4IUR A;  4C8Q B;  2JNG A;  3JCM d;  4FSX A;  2JOY A;  2PQW A;  4IUP A;  5FU6 B;  5GAM f;  5LJ3 g;  2K3X A;  3VUB A;  3RES A;  1OZ2 A;  3M9Q A;  4BD3 A;  1VQ6 T;  4F7U B;  1VQ4 T;  3C94 A;  1Y96 B;  1N9S A;  1X6O A;  1Y96 A;  3X20 B;  5D6X A;  5IAY A;  3I56 T;  3CMA T;  1VQ8 T;  3GIB A;  2E10 A;  3CBM A;  4L5G A;  4XU0 A;  2DEQ A;  3HSB A;  3LX7 A;  1M5Q 1;  4M78 F;  4TVR A;  3OYN A;  2DTO A;  3MP8 A;  3OBY A;  1KHI A;  1RI0 A;  4QQ6 A;  4BE0 A;  4C8Q E;  5GAM d;  5CKH A;  3R6O A;  3JCM f;  4BE2 A;  5DM7 R;  3BDU A;  3JB9 H;  3X25 B;  4PJO A;  3QZ5 B;  4C92 A;  4LD6 A;  4XTX A;  4C0D C;  5C0M A;  5CVI A;  2JZ2 A;  3BW1 A;  4JLI A;  3OYI A;  1FWZ A;  3OS2 A;  1HK9 A;  2EJF A;  3RMQ A;  1ZHI A;  2A3L A;  4FT2 A;  3VJP A;  3V8J A;  4JRP A;  2OTJ A;  2LCL A;  2RJC A;  3QZ9 B;  5I21 A;  1LNX A;  1MHN A;  3OYB A;  2RM4 A;  3F70 A;  5GAN 2;  2XI9 A;  2F5T X;  4BE1 A;  1GXI E;  3QXE B;  2LNV A;  3UDC A;  1WNL A;  1WGS A;  5CKD A;  3OYJ A;  4ZN1 A;  5LJ3 d;  1JRI A;  4M75 C;  4A4G A;  3VV0 A;  2DD5 A;  5A2Q E;  3OS0 A;  1Q82 C;  4M78 G;  2RA2 A;  3GNG A;  1K8A U;  4M75 F;  2BKD N;  2B8A A;  5CQY A;  5GMK i;  2FHD A;  4BDY A;  4RG8 A;  5GAO p;  2P4T A;  1VQ7 A;  2GCX A;  2KK4 A;  4EMK B;  1YHQ A;  2WAC A;  5LJ5 e;  2LDM A;  3M4G A;  3S3N A;  4Z02 A;  2L8D A;  4XTY A;  5HKC A;  5DLO A;  3OYC A;  2MI6 A;  5LJ5 d;  1JBM A;  4HT8 A;  3ZEH A;  3PGG A;  4MZP A;  2QQA A;  2QEX T;  2MF2 A;  2MAM A;  3QII A;  4C8Q A;  1KG1 A;  1KQ2 A;  4C0F A;  1BYM A;  2FB7 A;  2X35 A;  2XKO C;  2QQS A;  4XQ3 A;  1NE8 A;  5GAN 7;  1KC8 U;  5GMK e;  3OMC A;  3WVE B;  1VQP A;  3FB9 A;  3E19 A;  4ZN3 A;  1Y71 A;  5GAN 5;  5GAO q;  2VXF A;  3RMS A;  2EQJ A;  1VQK A;  4E7J A;  2H3J A;  2E5Q A;  3FRN A;  2CZ6 B;  4M7D C;  4M75 E;  5CR2 A;  3OY9 A;  2XHC A;  2VYT A;  2P0P A;  3V7R A;  4ELY C;  3GPL A;  3G7Z A;  2DKG A;  1I5L A;  2RK2 A;  4F7U A;  2I2L A;  5KCO A;  2MWP A;  3A5Z B;  1UB4 A;  4OP0 A;  3RKW A;  3M57 A;  2QA4 A;  2O01 E;  1ZQ1 A;  4JRQ A;  3BFM A;  5CIU A;  5LJ3 h;  3JCM c;  2R57 A;  1YI2 T;  1X01 A;  2LCC A;  4PJO G;  2CYZ B;  4C92 G;  3CBO A;  4OVA A;  5GAO l;  4BAC A;  1VQN A;  4KUL A;  4OF1 A;  5GAN d;  5HK3 A;  2L89 A;  2RJF A;  1YCY A;  3CCV T;  2LT1 A;  3LGL A;  1M1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...