1VYVA

Beta4 subunit of ca2+ channel
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
332
structure length
274
Chain Sequence
AIRQEREQQAAIQLERAKSKPVAFAVKTNVSYCGALDEDVPVPSSAVSFDAKDFLHIKEKYNNDWWIGRLVKEGCEIGFIPSPLRLENIRIQQEQKRKHIPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKSSLAEVQSEIERIFELARSLQLVVLDADTINHPAQLIKTSLAPIIVHVKVSSPKVLQRLIKSRGKSQSKHLNVQLVAADKLAQCPPEMFDVILDENQLEDACEHLGEYLEAYWRATH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords CALCIUM CHANNEL BETA-4SUBUNIT
publication title Structural Basis of the Alpha(1)-Beta Subunit Interaction of Voltage-Gated Ca(2+) Channels
pubmed doi rcsb
source organism Rattus norvegicus
total genus 78
structure length 274
sequence length 332
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
A PF12052 VGCC_beta4Aa_N Voltage gated calcium channel subunit beta domain 4Aa N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1vyvA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1vyvA02
1KI3A 5E7JA 5C1BA 3PQCA 1YWPA 1ZX6A 5JEDA 1LNZA 2W6IA 5H1YA 2QN6A 1RVDA 2NQ2C 3F5FA 1SQ5A 3A1UA 1Z5ZA 2JLQA 3CNOA 1DAMA 1WBDA 2OEPA 4ZCMA 2QBYA 1UJ0A 1T6NA 4NU0A 1ZUKA 1FX0B 5K8IA 4YDHB 4DB2A 2IBMA 3VRZA 1EGAA 2VH5R 1WF3A 2ZR7A 1WXQA 3K9NA 1TNDA 2IUTA 4RD3A 3TLXA 1N5JA 3ADKA 4DCTA 4EJSB 1J2JA 2IYXA 2VSXA 4PHHA 1GSIA 2ZYUX 4J0QA 2ZRPA 3OFNA 4TMWA 2B21A 2H8KA 4B75A 4IOJA 1GFIA 2NGRA 2QSYA 2JJ2D 1WIEA 4FSSA 2ZU0C 2XSZD 1K0XA 2B6HA 4Q4HA 2GGRA 3SZRA 3PEUA 3TSWA 2NWMA 2GCPA 3KKOA 1PJRA 5FOXA 1AGRA 4LY6A 1W4CA 2QORA 2SRCA 2KXCA 2D1XA 1R5OA 5HE8A 2VSOA 2O8EB 3VKGA 1HT1E 2RGBA 3B9PA 3TAUA 4GOJA 2QROA 4TLAA 2R6FA 1AEYA 4II7A 1HY3A 3AKDA 3EG2A 1EXMA 1DS6A 1X8LA 4I1VA 4QGGA 4RCZA 3VR4A 1NLOC 3SU8A 1P9NA 4PQFA 1QKWA 1U3OA 2LCSA 2ZJ5A 2PLFA 3I1FA 3OAAA 2P65A 2O8BB 2W2XA 3FFAA 3P4YA 4Z8YA 2P6NA 4AKEA 1CJKC 4TMKA 4OK3A 2AK2A 3X1YA 4C0AC 4OHWA 3CW2A 3PR1A 1Z83A 3REBB 5D3QA 4G5SA 3TW8B 3GLGA 1JJVA 3BE4A 4L4UA 4OHXA 3PJRA 1QVRA 3DM9B 1KDRA 4JSTA 2FSGA 4DLUA 1S3GA 1QKXA 4AFSC 1EX6A 4WCIA 2Z4RA 2ED0A 4OK6A 3MWYW 5L3SA 3TUZC 2ZRIA 2FSHA 1LFDB 1GBRA 1OE0A 4DUGD 2FFQA 3K0FA 5JJLA 4RKFA 2BVNA 1E1QD 2JLYA 2D4HA 3FMPB 3BAFA 2BBSA 4HCKA 4R98A 3SDZA 1E2HA 3O47A 5JS8A 2JLXA 5CM8B 4MKIA 1I2DA 4KLNA 3QWYA 1VTKA 1RUWA 1VCIA 2ZQ5A 3U2QA 621PA 1Q20A 2CE2X 3S1AA 2DBKA 3ASYA 1A2KC 3PEYA 4Z8XA 1PLJA 1PV4A 1X6GA 2JW4A 2OLKA 3VRYA 2WKQA 1YN8A 4LHYA 4BEJA 4CRWB 4YDSA 2FNAA 4IXMA 3LLMA 1G20E 4US0R 3CR7A 4AD8A 1Y57A 3HDTA 1F3OA 1KDOA 4HAYA 5FTLA 4XWAA 2QGNA 1Q1ZA 2J06A 4UNPA 2AZSA 4OMPA 4I1SA 1OHHD 2R6CA 2BBOA 2K3BA 2ZRMA 3RS7A 5BWMA 2CVFA 1E96A 1WA5A 2IYQA 1BO6A 3WXMA 4BRUA 1ZMXA 3I5YA 2L2PA 3PEWA 1G291 2BEJA 3PFIA 2L3SA 1RPZA 2OBLA 1GRQA 1KSHA 1OIWA 2A5JA 4AC9A 4RTWA 4OQLA 4V02A 1KSJA 4RSGA 4OHZA 2OXCA 3ZVMA 4I4LA 1MH1A 1JJ7A 3MRSA 4Q00A 1LF5A 3U6KA 3SQWA 2EFDB 2I0NA 2FO0A 1VG1A 2CT3A 3OEEA 3VAAA 1LVGA 2ZR9A 2JIZD 5CJ2A 3RNJA 3AVPA 4DIDA 1VYUA 3VS3A 2YWGA 1ZIPA 2ZJOA 4HVUA 5DSZA 2UZ3A 3AVQA 1NY6A 5FTKA 4AFQC 2R6DA 1A0NB 5AJYA 2F55A 1AZEA 1L7VC 4IOKA 3I4LA 2CMKA 5TARA 1P73A 4ZCLA 1GRRA 5ECAA 1AWWA 2ZJBA 2WBLC 1H8ED 2HEIA 4MH0R 2RMOA 2PX3A 4MRPA 4QC2A 2WVJA 1YE8A 2EFCB 3M1IA 4BZXA 2LNHB 3M0TA 2J59A 3IEVA 4C0KA 2O31A 5HTKA 4Q9KA 2J46A 1KY2A 1RLPC 3DOEA 2AKAB 1GBQA 3QIAA 4HLUC 3KB1A 4CC3A 1AK2A 5JWRA 4G0NA 1W49A 4IDQA 4LV5B 1CP2A 3U4QB 2EYZA 3TVTA 4I99A 4DSNA 1W1WA 1UM8A 3CRQA 3N2IA 2WOOA 3L0OA 3QEOA 1Z6XA 1Z3IX 1CR2A 1GWNA 3VKWA 3REAB 3TNFA 4QJ5A 1XD2A 2JLZA 5E95A 5KNBA 2RKOA 5FPKA 2IHYA 1RIFA 3NH6A 4LI0A 1E94E 3BS4A 2IYWA 3ASZA 1D6JA 1OFTA 2CHGA 2QP9X 3VS5A 3EZ2A 2MMCA 4PAMA 2O2OA 5KDLA 2KBFA 5EE3A 2ZUDA 1SVOA 2L0XA 3SI7A 4G5GA 1NG2A 1JXMA 2BEKA 2F6RA 2HUPA 3LLUA 4KHZA 1R7RA 2IYZA 5KTYA 2O8EA 2QPOA 3U7HB 4MRVA 3UG6A 5KDOA 1JPNA 3EA0A 2KEAA 1BYUA 3BORA 2CCJA 1Z22A 1E2JA 4URXR 3WP0A 1A2BA 1G5TA 1TF5A 2I3BA 2BCGY 3QKUA 2FPFA 4V0OA 3AP3A 2O8BA 2ANBA 4P4SA 1IY2A 1UKYA 2I1VB 2K79A 4QBIA 4GLMA 3ZVRA 1M27C 3I35A 2QZ4A 4Q9LA 1DVRA 2IXFA 4Z8AA 4C0LA 2QA5A 3GJ4A 2EGCA 4FN5A 3ZS8A 2XEXA 4MQBA 1E2DA 1M7GA 3LBHA 2KE9A 4IW3B 1JBKA 3W9YA 1C9KA 4BFZA 2J0UB 4US2R 4LPKA 2GTPA 2REXB 2QT1A 4RTZA 1AN0A 1NEBA 4IVRA 1E98A 3KQUA 2J0VA 4BFYA 1Z2AA 1L4UA 2KRSA 2KSQA 2ZAOA 3PUYA 4RZXA 4V0ME 4A9AA 3THXA 1X1RA 4GT1A 2HXSA 2H1LA 2C9YA 3T06B 3WHKA 1Z6YA 5CM9C 5F3WB 3X1DA 2WZQA 4F4JA 1YRAA 4EPXA 2Q6TA 3LQRA 2QMHA 2IUSA 4KBFA 1YZNA 3ZQ6A 4CIDA 1LW7A 2H7VA 4JVSB 2QAJA 4D2IA 6Q21A 3QE0A 1UE9A 3BB4A 1GG2A 4IOMA 4QGAA 4EAQA 1M7HA 3AP1A 2RHDA 2PNIA 4ZDKA 3AUXA 1BMFA 1DELA 4C9BA 1UG1A 1XJ0A 3LRPA 4CC7A 1RJ9B 1GL9B 4V0KA 1W5TA 4W5WA 4A6PA 2A5FA 5GJBA 3I5SA 2HYIC 2VBCA 5DI3B 3D6TB 4GI7A 1W36B 1G8PA 2IA5A 3CF6R 1G8HA 4QBGB 2OFXA 3BOSA 4UJ5A 5L3VA 3SFZA 1F60A 2GTOA 3A98A 4A8JB 2PEYA 2BTTA 2BWJA 1DE0A 3IIMA 4KCGA 3GJ0A 4PAOA 3L8YA 4LNPA 1G3QA 2QQEA 3D31A 2WWFA 2WIAA 2GAAA 1MABA 1UBGA 1B23P 4AWXA 3O8BA 4DJTA 2D7CA 4K11A 2DILA 4LPSA 1M1YE 1OSNA 1FZQA 1P2VA 2GXUA 2QMOA 1NY5A 2RF0A 2CDNA 2CJWA 1SHGA 3LQQA 5GJWC 4HB3A 2DCUA 2OXRA 2C78A 2WSMA 2CNWA 3U7EB 3ZJYA 5A4JA 1P62B 3AF0A 1QHXA 2WPDA 4FMDB 3CQTA 1ANKA 3TMKA 1XMIA 2D74A 1UBEA 2L0AA 1FFHA 1QWEA 1S4QA 4LHVA 1W2GA 2FRYA 1GRIA 4KJZA 1WLPB 4AKIA 2J45A 4J9EA 4IDPA 4HLQB 1YWOA 3U7GA 4D8KA 5SZKB 4J9BA 4JYBA 5HCIA 2YUPA 5KU1A 1Z0AA 3IO3A 1SHFA 3A1SA 4BZPA 2YSQA 4GNKA 2J0QA 5JECA 3SE0A 2QP4A 2HSPA 4RTYA 4AIIA 3FGNA 2LJ0A 4JJBA 1Q1EA 3UA6A 3GLFA 3I5RA 2RQRA 3EX7C 4UXHA 1RYHA 2V6IA 4RZ2A 4GP7A 1GL5A 2AN9A 3OZXA 3U4QA 3KUDA 4LHXA 4LX0A 4OQXA 4QRHA 1N5IA 4IEEA 4BFVA 2KNBB 2JJ1D 1F6BA 2ZI6A 2EVRA 4NCHA 1JQQA 2ZI7A 4GBQA 2KRNA 2GVDC 1OB2A 5G41A 4X8LA 3RLFA 4DKXA 1E4VA 2V6JA 1GNQA 2IUUA 3A4MA 2ZRCA 1IXZA 3MCAA 4LJ8A 2WKPA 1G3UA 4EFMA 1S1NA 3THOA 1IN7A 2WJIA 3NBXX 2FPLA 3BERA 1F2UA 4KO8A 4HUQB 3W3ZB 4FIDA 3QG5A 1XXHB 5FTNA 3KKMA 4FMBB 4AYTA 4AKHA 5L3QB 3NMZC 1U99A 4B6FA 2CUDA 2VP4A 4EQ6B 3T5DA 1DPFA 3BFXA 3GJ8A 5EXPA 1NKSA 2BJWA 3NTUA 4B73A 4OBEA 3SN6A 1X8JA 3EIHA 2ZJAA 3EIEA 3NBYC 2J05A 1FPMA 5IH2A 1QHHB 5IXFA 1FMJA 5FFMA 3CIOA 4NL4H 4RVCA 2N46A 1DAKA 2WKRA 1LY1A 2A36A 1SHZA 5EZ6B 1SHKA 2IYTA 2W00A 4TTRA 1E9DA 2JM9A 3VR5A 2V4ZA 1EFRD 2RN8A 1Z08A 4TTQA 4TMZA 3SR0A 4Q1CA 1U8YA 4D81A 1KKLA 1U0JA 2ZRHA 2ERXA 2NPIA 2V9PA 1KI4A 3I62A 3N5CA 4CGZA 1Z8FA 3SEMA 4ZIRB 2DL7A 2FFAA 3MMPA 4TN1A 1US8B 2AX4A 3Q5DA 5FPTA 2O8CB 1QG4A 1NSTA 2Q21A 1NL3A 4DVGA 5I11A 1W0JD 4GSYA 5GJCA 1HH4A 2IWRA 2B8WA 4M1SA 2IHBA 3W5IA 5KPJA 5SZJA 3AVYA 4LHZA 1BU1A 5UKDA 1KNQA 4DLSA 2KRMA 1ZW6A 4B2PA 4CDGA 2PL3A 2R6GA 3TJZA 4LUCA 3REGA 3AVOA 3SEAA 2F2XA 3Q9LA 2FPDA 1HQCA 3FKSA 4UNQA 3M6AA 2K6DA 1OXUA 2XNSA 3KJGA 4FI3C 4XIGS 5EZ5A 4PO9A 5DI3A 4JLOA 1OIXA 3C41J 4L9WA 2OSBA 4KBGA 1FP6A 1R6BX 1UDLA 4YMVA 3THWA 1XF9A 1GIAA 1SKQA 3KXKA 2LX7A 3OHMA 5GADl 1Z47A 2OFOA 4JYCA 3BB1A 2AFIE 2EFEB 3NVAA 3BXZA 4Q4JA 2QG6A 3NC0C 1EFCA 1P61B 1WDTA 3CO5A 4MGYR 1T3LA 3QUSA 4NKRA 3NIBA 4DIEA 2RQWA 3TIFA 1R0YA 2Z4SA 3AGPA 1YQTA 3C5HA 2QMEA 3IPXA 4KLZA 2VHQA 1G3IA 1WXUA 3K0SA 2GXAA 2FZ4A 4HUTA 5KYKA 4H9GA 2G9NA 2EU8A 3I72A 5KDDA 2ORWA 1XMJA 3I61A 1ZNWA 2AKKA 1TMKA 4O2LA 1QDEA 4R2HA 4IDOA 2QI9C 2DWPA 2QBYB 2IX3A 2ZI4A 1ZIOA 2C9OA 4W5JA 1UHFA 1NVVQ 2F7SA 2RQVA 3X1ZA 1KI1A 2LWIA 1ZM2A 2BZXA 3UANA 4KFSA 5K8TA 3KJEA 1W1FA 1OXSC 3MJHA 1R10A 5EUQB 4M1OA 5FW9A 1ZVQA 1KAOA 1W5SA 4ARZA 4AFUC 5FL3A 3VX3A 4B43A 5KHOC 1XTKA 4QNRA 3KFVA 4KAXA 4Q4HB 1XEFA 2C5LA 2YUQA 5D3MA 2GJ8A 2XZLA 2FE4A 1AJEA 1RRFA 2QGZA 1DBSA 1YR8A 1OH6A 4B3DA 5FPSA 2ZJZA 3WBKA 4OKSA 1TU4A 1P9RA 4Q1EA 5EP1A 1QLYA 2MCNA 5JS7A 4Z88A 1HEIA 3KKQA 5KNDA 1CS4C 2P5TB 2XX3A 1N0UA 2V7QA 3AP2A 3KZ1E 3QJYA 4QG7A 4G5OA 5FBLB 1XX6A 3OESA 4JJKA 4LBVA 4MKHA 2GWHA 1CSKA 1DOAA 3GLHB 1NLPC 4HUQA 2GBQA 1XXHA 2Y8EA 3ZIAD 1FL9A 1E2MA 5L3QA 3GLGB 4L15A 3C15C 2WAXA 3EZFA 4QKQA 1CR1A 4ON9A 4DLTA 2J6OA 2ESWA 2VHJA 1X3SA 1W7AA 1ZINA 3VQTA 5AUOB 1AWXA 5CLQA 2UVQA 3T61A 3TQCA 2QRZA 2CSQA 4G3XA 4POAA 2VL7A 2QU8A 4FXPA 4B2IA 4TLBA 2AR7A 1KK1A 1NMZA 1NMXA 4GPTA 1BB9A 3K0FB 4GZLA 4HAXA 2W6JD 3H2YA 3BFVA 4OI2A 4HVWA 2CK3A 1SKYB 3MWLA 3QPVA 2X3WD 5FPYA 4DBLC 2ZS8A 3AV0B 2VO1A 1UKVY 3KQKA 2ZYVX 4DXAA 2A5YB 3ADDA 4H1VA 2FPMA 3RWOA 3AGQA 2GF9A 2CDTA 3H4MA 4Q02A 1TAGA 3UPUA 2YC4C 3DO6A 3RANA 4QM6A 1YRBA 2YHSA 2AWNA 2IC5A 3RHFA 5IK2D 4C2UA 5CB6A 2IF2A 4G5QA 2NO9A 1AM4D 4ZIRA 4CW7A 1RRCA 3MWJA 1J8MF 1US8A 1Y63A 4B34A 2O8CA 4QHSA 3RRYA 1G8FA 1VDZA 5EUMA 3QF4A 1LS1A 1QRAA 1S96A 1SXJB 4LDJA 3T1TA 2LJ3A 1T0HA 1HQYE 1XB2A 3QKSA 2DFNA 1Q3HA 2ZE8A 1E1RD 4TWZA 821PA 5I22A 1AZTA 1Z29A 2DFLA 2R2AA 4LYAA 1KGDA 5J47A 2P3SA 1K5GA 2XITA 4UXJA 2KGTA 4LV8B 3KTAA 1AIPA 1G8GA 2M51A 3B1ZA 3P32A 4OMNA 4CVNA 3RSLA 1ZUIA 3D3QA 1FP7A 1TQDA 4A1FA 5FI1B 2D62A 3VS0A 1P60A 3BD9A 3T1OA 1U5SA 2BKUA 2ERYA 1KO8A 2YZ2A 2K5UA 4Z1MD 4EIWA 1W4BA 1W44A 1W2HA 4WVFA 1K9AA 4OJQA 3H84A 4UXIA 3SOPA 1CIPA 1SVWA 2ZROA 2J7PD 5FL7D 4BEBA 4P32A 5JZVA 1K76A 2O9VA 4OMMA 2GTJA 3IILA 4RUGA 3H1TA 1ZUYA 3H0HA 3GCGA 1WXBA 1AD5A 2BM1A 2J41A 3B7GA 5FOTA 2KT1A 1VHTA 2RAPA 3RS3A 4LHWA 1G64A 3B60A 3A58B 3CRVA 5CIQA 4B3FX 4DRZA 1CLUA 1UKEA 4URWR 3CPHA 1NLFA 1P75A 1XTSA 3P20A 4DLVA 1KI9A 5SZHB 3RBBB 1W0KA 4PPFA 5SZIA 2P0EA 4PHGA 4B3XA 1GNPA 3FFBA 1W6XA 2DR3A 3FMFA 2IYRA 3MGCA 4IDNA 4O0MA 3V4FA 5DH9A 4PO1A 4CYMA 1WCV1 2W83A 1UKZA 1U06A 3WYAA 3EZ6A 3TBKA 2ZRDA 2VHCA 2ZU6A 4K46A 4URZR 2HLDD 1W70A 2RGNA 1X69A 2VHUA 4RJLA 1KNXA 3AVVA 1AWOA 4TZ0A 4O3MA 2C95A 4H1UA 3TKLA 4CEJA 5K8LA 2ZS9A 4NZYA 2IS4A 4MKGA 5C4GB 2JM8A 4MRRA 1EFUA 1TTTA 4HLCA 3KXLA 1XD2B 5EE0A 1JEEA 1Q12A 4HDOB 3UIEA 4M1TA 2VTKA 1ABQA 1OFIA 2ZE5A 5BYJA 1Z9ZA 1FOEB 4JS0A 1Z28A 4EPTA 4A0HA 3IQWA 3RABA 1CF4A 2HCKA 4M9XA 1IJEA 2W0MA 2XTZA 3BFKA 2EFGA 4D8DA 3FYHA 4YMTA 4BLRA 5TVKA 4ZKEA 2GILA 3K0EA 4HAUA 1T3HA 2BCJQ 3IHLA 1SRLA 4YLGA 3RRMA 5AUNB 3SHWA 5KOYA 5HZKA 1I0CA 1GL6A 1E79A 3CWZA 2YWEA 3SYLA 3ZS9A 2N42A 1WP9A 4E07A 4YMUA 4OI1A 5JCPA 4CEHA 2KXDA 4BLQA 4Q1DA 1G4UR 1UPTA 3L8ZA 3B1WA 4P4SB 1RRGA 1PWTA 1UJYA 2E1RA 2DBMA 1G7RA 3GLHA 3U3MA 1S2MA 1WYXA 1HA3A 2C98A 1A7JA 1P2UA 3NWJA 1E3MA 3QKRA 3R9WA 2HYDA 1JAHA 3A36A 2VRWA 4TYQA 1WQ1R 2Z43A 4FD2A 3EC1A 4A92A 3CZQA 2GCOB 1XTIA 1ZM4A 1TF2A 1YR9A 2X77A 2P6RA 4MYCA 4AK9A 4ZDIA 1N2CE 1JEGA 1Q0UA 4HB4A 3UWOA 4QL3A 2KJQA 3EGUA 3C14C 4DSTA 2QPTA 5G3YA 2FEMA 4HYYA 4JBWA 3NHAA 5FOSA 3U3JA 3THXB 4JPBW 1QHNA 2JCSA 1JU5C 2BZ8A 4LUEA 5JLJA 3ETLA 1LV7A 1NBMA 2IYUA 3VX4A 1H8HA 1U9IA 5C2JB 1AGPA 2YOHA 1W36D 3P26A 1SPKA 3NHNA 1KFZA 1F2TA 1OYWA 2D06A 2G88A 4PANA 4X8MA 1HV8A 1E2IA 3AF1A 4AFZC 4FCWA 3WMEA 3NBFA 2F1HA 1HURA 2ZM5A 5IXBA 4LJ4A 3VHLB 3W34A 3VMFA 2DLPA 3I8SA 3UF4A 3M0SA 1VG0B 4ZI3A 3ZVNA 3EAQA 2WWWA 3OEHA 1AA9A 2XNDA 3DHWC 4TLDA 1BYIA 4CEIB 1GOTA 1CJVC 4PSAA 1SXJA 4NYJQ 2GJSA 2YJTD 4D0NA 2PJZA 4TT3A 5CLLA 2CXXA 1XBTA 5FOVA 1NN5A 3EG0A 2VEDA 3QBVA 1GKUB 2EQIA 4D4MA 1MABB 1CKEA 4A82A 4B32A 1WDXA 4PC6A 5JFGA 1COWD 2V1UA 1SVKA 4PZLA 3LBNA 2RGGA 2IL1A 1TQ6A 4JL8A 1E2EA 5JWHA 2DPXA 4EFNA 2ZRGA 3VS7A 5FUVA 4EDHA 2IYSA 4Q9HA 2CJWB 4BUJA 5KSOA 1AWJA 2IEZA 1P9WA 2QM7A 2YNMA 5EE9A 1KY3A 1L8QA 1QZXA 2ZUBA 3IIKA 4F4CA 1ZD8A 4IVQA 2OAQ1 3MAAC 4MA4A 1T0JA 2YINC 2R65A 1KIMA 3EWSA 1QBKC 2IK8A 3EXAA 4KVAA 4DLWA 3VU9B 2HV8A 3V9PA 4C3ZA 3K09A 2X2FA 3THYA 2BKEA 2VVKA 4JLMA 3CPEA 5ANRB 5LPNA 3U3OA 2E87A 1TQ2A 3MG9A 2J87A 1GAJA 1CXZA 2L3QA 2A7QA 3LDAA 4X8HA 3C16C 5BXQC 2FDCA 2WSSD 4JLJA 1T8TA 5DI9A 2VP9A 4YMSA 5E4FA 4CF7A 2GAOA 5AJXA 1NG9A 1ZLMA 3EPLA 1XMVA 2RCNA 5CDFE 2R6AA 3GLFB 3B6EA 3Q5EA 5J4YA 3ZZ0A 1GCQA 4B47A 2MSEB 2QTHA 1XCGB 4L5BA 1HE1C 3OIVA 2CLSA 5IHNA 2OO7A 2QE7D 4BE7B 2R62A 4RY2A 2PZGA 1JR3A 4LYJA 2AD5A 2OG2A 1DO0A 4X8OA 4F7WA 1NYGA 5DHFA 2WAYA 5H70A 3ZLJA 1N0WA 2QAGA 2FFHA 2WJJA 4O2RA 4TSFA 1ZM7A 2WMOB 5TV2A 3LX8A 4KU4A 1OF1A 3B8HA 4BLOA 4C0JA 3A4LA 4DSOA 5JI2E 3RC8A 1NJGA 1ZYUA 2ZYWX 3PUZA 1RE0A 1X2KA 2ABLA 4CC4B 1FUUA 1DEKA 5LB4A 3TUIC 4C0SA 1F2UB 5K8UA 3WNBA 1E2NA 1YZKA 1YJ5A 1B3QA 3GLIB 4RTVA 2CCGA 3D7MA 3AKEA 2DRKA 3EPHA 3U60B 3IDQA 3SS8A 1Z0FA 2VIIA 3CPJB 1QHSA 3NC1C 4LUDA 4HAWA 4IIMA 2FPKA 2HBWA 2LQNA 2WOJA 1UADA 3GFOA 2EKHA 2IYVA 3LNCA 1P4SA 4PR0A 2GJKA 4JJCA 3WRXC 1AQYA 4D4KA 5DN6A 4PAQA 2W0SA 4FMCB 4QJ3A 5HR5A 2WJGA 3K0CA 2N1BA 4TL7A 3IO5A 1W36C 121PA 2GESA 1IONA 1NLZA 2MOXA 4G5RA 4XH9B 4OHYA 5CYOA 1MO3A 4A8JC 2OILA 1I4DD 1TPZA 5JMTA 2FOLA 1XFAA 1EESA 5C46F 1M3BA 5LD2B 1IAQA 2GCOA 4JVLA 2EYYA 1IXRC 4YXWA 421PA 1G19A 3I32A 5L23A 5GJVB 2QRNA 4Z54A 2F1IA 2R44A 1TU3A 2VHTA 4FCVA 1JAIA 4P4UA 3SYNA 1XWIA 3EG3A 2PT7A 5AJWA 4J9FA 3ADCA 2NTYC 2FZLA 4C7OA 2XJ4A 3VS6A 2Q9AA 3B5JA 1GZSA 3A37A 2QTFA 4MYTA 3J81k 2BDTA 3CX8A 2D8HA 3QI2A 1T4GA 3EHQA 3K70B 1R0ZA 1LCKA 4EPRA 2IS6A 1T91A 4XVUA 3CLVA 2MMGA 4Q7JB 3GLGE 3WHLA 4Q4AB 1Y0MA 1W4RA 4PC7A 4UQOA 2OAWA 4D4LA 1DAEA 1XZPA 2BIFA 4JJZA 2CH4A 1Q1QA 4Q01A 2CEAA 3TH5A 3DZ8A 5A0FA 1JR6A 2OM2A 2G77B 4S35A 1XRJA 3AM1A 1G5PA 4CEIA 1KDPA 1VCNA 2HDNB 2CVHA 4AG5A 1N6PA 4QGHA 4L9SA 1G3MA 4KI0A 1X27A 2JLWA 3V4RA 4EPYA 4GMDA 3WNDA 1Z6AA 3CBQA 3THWB 3T5GA 4AYWA 2GVZC 1NBME 4JL6A 1GUAA 2WWGA 2BMJA 2W6ID 2B7BA 4WZBE 4BASA 1KSWA 3VS1A 1YZQA 2DYBA 1U98A 3LW8A 4Q4JB 1S1MA 3VR3A 5HKKA 3HP1A 2Q3HA 2K7AA 2H17A 4OQMA 5CYPA 2GRJA 3VTKA 4EPVA 2Q9CA 1IN5A 1E0AA 3KFXA 2BMEA 521PA 3LA6A 3WNCA 5L3RA 3CX6A 3ECCA 4IFBA 1MO6A 4FMDF 4N0DA 1J99A 2FG5A 2HT6A 2KBEA 3BC1A 3FJ5A 2X3XD 4URYR 5TDHA 1M6NA 3OFND 4DCSA 2EW3A 1D9ZA 1G6HA 3VU9A 4D80A 1G7TA 2RB4A 4M1WA 5LDDC 2YV5A 1OXVA 2D0NA 1R8QA 4PQYA 1YR7A 4AYXA 5J4KA 2XJ9A 3IIJA 2K9GA 1G16A 2RH5A 1N6HA 1ZCBA 3R8CA 5J5CA 4C2TA 4ASUA 2XOKA 5EXTA 1PRMC 2OAP1 5CITA 2GZHA 2J0SA 1EFNA 5HCKA 4BFXA 2KROA 2YT6A 1K5DA 2JAQA 4M1KA 2IYYA 5E7MA 4ARZB 4Q47A 1H92A 1KOFA 2A30A 3Q72A 4B71A 2IS1A 3H0FA 1L4YA 3QENA 4F4IA 3OAAD 1A4RA 4PO8A 1U0LA 4B48A 5D3MB 2A78A 4JZKA 4V0NA 3PV0A 4NDZA 3U44A 2ORIA 2ATVA 2XZPA 4PC3A 1N5KA 2YVUA 2ZJ8A 3ZD7A 1X6BA 5FBWB 3VS2A 2QEQA 3F0TA 4W7SA 3R9XA 1ESNA 1EFHA 1H3HA 1FQJA 1ZAKA 4Q7LA 3UKDA 4OMOA 2WIBA 1PKTA 1E2LA 4NTZA 3KB2A 1KO1A 2O0JA 4Q03A 1BK2A 2RGCA 4LBYA 3NGPA 2FGJA 2QSZA 3CX7A 5B2ZA 3CNNA 2HCBA 3B13B 4TQ9A 3GLIA 3DM5A 4RD4A 2HJVA 2JDIA 2ROTA 3AQ4A 4LYHA 5FWBA 2C77A 2OT3B 3SQXA 4US1R 3QG1A 4P31A 1BBZA 3RYTC 2YUOA 4WBSA 2VF7A 4A15A 1ELOA 2F3TA 2A28A 2ZEJA 3Q7QA 3L0IB 3W3AA 4ZKDA 1AS0A 1TX4B 4LK2A 5DLQC 2WWHA 3EG5A 1FNMA 4B35A 2FF7A 2DX1A 2PEZA 3N2EA 1OIVA 3VNVA 2ZANA 2OCPA 1II8A 3HPRA 1G8YA 1SGWA 4NCIA 3QXHA 3VR2A 4KFTA 4OYHA 4F14A 1A82A 4LGMA 2B86A 1E69A 2PTKA 1QHGA 3AKCA 3P4XA 5JHGB 3FMIA 1XJQA 2EYXA 2JMAA 1K0SA 4E22A 4KXFB 4JLDA 1E32A 1I4LD 1KO4A 1M3AA 5JRJA 3QOFA 1Z9QA 3FDIA 2MSCB 2JJ2A 2BJVA 1KMQA 1NVXQ 1U90A 2XSZA 4QHYA 1R5NA 4TMXA 3R20A 5JJKA 4Y92A 2FFBA 2AXNA 2PX0A 5FOUA 3QF4B 2ODWA 3BH7A 2OCYC 5IRCD 4HLUA 1KJYA 1D2MA 1OH7A 1TADA 3AVUA 2JS0A 1KI6B 1Q44A 1T0HB 1N3BA 4QGFA 4F93B 3OEED 1AZSC 3QKSB 1DG1G 2V1XA 1QHYA 5C18A 3UMSA 2FH5B 1SVMA 1NSFA 2R9VA 4YQFA 2Z0MA 4Q4AA 3W90A 2C04A 2ZRNA 1IY1A 2I1QA 4J9DA 5FPHA 1NI3A 3CNLA 2RGNC 2FA9A 2RGDA 4QBFA 1N6OA 1E2GA 3GP8A 3IUYA 1H65A 3KTAB 1D5CA 1NIPA 1RW4A 2KB0A 2OESA 1KTVA 2SHKA 4WZ6A 3T34A 4D0LB 2H57A 2OHFA 3T35A 4W5HA 1S1CA 2ATXA 3SJZA 2DYKA 1ZBJA 3SFVA 4ORZA 2ZS7A 2GNOA 2G6FX 1IOZA 1ZNXA 3RS5A 1NN3A 4Q1BA 4MGKR 1OW3B 3HR7A 4LJYA 5TXGA 1E9SA 1EWQA 4AKGA 1IM2A 1DADA 4DUGA 2QM8A 3PEVA 4B6EA 4LC1A 3ULRB 1IN8A 4DT1B 1E1QA 1Z0DA 3RRNA 2DFTA 2ZE7A 3CF2A 5H8WA 2GEDA 3D8BA 2BC9A 2O5VA 2C03A 2G0TA 1EWRA 2J3EA 2OBNA 2PLRA 4Q19A 1OV4A 3Q8XB 3TE6A 5F9HA 4R7ZA 1MV3A 3AF3A 1U0HC 2QMUA 2FSIA 1FTSA 2F2VA 4OJKA 3RSOA 3RS0A 3JVUA 3UXMA 1GNRA 2GEVA 2Q0HA 3FHOA 2EPDA 1GKIA 2VP5A 3C8UA 2O8FA 2FGKA 3P27A 4TYWA 1MO4A 2J1LA 4ZNXA 1UFQA 3QPUA 2AFHE 3AUYA 3MWKA 1HSQA 2CL0X 1GFCA 3SJBA 2JXBA 1CR4A 3NKVA 2FEIA 1R2QA 2C0TA 1OHHA 1Z6TA 1P6XA 3TQFA 3W8NA 2GDJA 1ZP6A 3GPLA 5KO2A 4OMQA 2QP3A 2ZRFA 1NJFA 4C0BA 1A1VA 4CEJB 1R0XA 3CWQA 3PVLA 5FI0B 5AJZA 1ZUHA 1WX6A 3EASA 1N25A 4JLNA 2RMKA 4JVMA 2NO1A 3ICEA 3R9IA 1AVZC 4GOKA 5HPYB 1SEMA 2WHXA 2F43A 4BLTA 4NE2A 5JI3E 3WMGA 1SULA 2EW1A 4TTPA 4KFRA 1U9IC 4LJ6A 3CZPA 2JASA 1ZRHA 3QPWA 4G01B 1E9AA 2ZYTX 3DKPA 4D0GA 5KUTA 3UA7A 1UEIA 4JZ4A 1HD3A 1KDTA 4PQRA 5CK4A 5DIFA 5IHPA 1L2TA 2JIZA 2ODNA 2X1VA 1V5WA 4WAUA 2PBRA 3T1QA 4BRWA 2Q3MA 4ILEA 3ZGXA 1OEBA 3GBQA 2X8AA 4UNRA 4XD7D 4CEHB 3G5UA 2ZJYA 1ZCAA 1G21E 2QY9A 5BN3A 1NKTA 4EFLA 3NBZC 1Z0IA 2CCKA 3FHCB 3OIUA 4HZUA 4JIMA 1GM5A 1R5BA 2PZ1A 1SXJC 1VECA 3C5CA 2YDLA 2VPPA 3NH9A 5FUXA 4M2LA 4B3GA 3U23A 4DCNA 3SYKA 2BBWA 1YZUA 3QKRB 3GLFE 3HR8A 2EFHB 1OB5A 2V55B 5B30A 2RNAA 1NYFA 1H8EA 2DL3A 1KKMA 1Z0KA 2O0KA 2J6KA 4KITB 2WSSA 3UMFA 1PLLA 4XSHA 2ZAMA 4IHQA 4B76A 1R4AA 2VLIA 2VSFA 4ACAA 4B33A 2ZJ2A 3HJNA 1KYIA 1Z07A 5DISB 3QSYA 2ZRAA 5LB2A 721PA 2FMXA 3WYGA 1X43A 1G83A 4R71A 3GJXC 2CHQA 2NZ8A 1CJMA 2DE0X 1FUKA 3B9QA 4ZO4A 3IKJA 3M0PA 1WFWA 2DMOA 3RVBA 4LZZA 4LYFA 2CBZA 4N0EA 1F2TB 1RZ3A 4I81A 1Q1BA 3GLIE 1JNYA 4GDFA 3FVQA 2REBA 4JT4A 4RTTA 3K09C 3CH4B 2GNCA 3PUVA 1YZTA 4QNMA 2A5GA 4WXRA 2ZRBA 1H8KA 2HEQA 1XEWY 4FWIB 4M21A 4Q48A 4OQFA 3IBGA 2ROLA 1OXXK 4RCYA 2CL6X 4HATA 3B1VA 2VP0A 1N0VC 1TUIA 2GBLA 1U94A 4DZZA 3WMFA 1KI6A 1GTVA 4F91B 5DGXA 3Q3JB 5BN5A 2PCLA 2ZREA 5E7IA 4LJ7A 5M04A 4ZDJA 2CNWD 1GCQC 3QF7A 2WPDD 1GCPA 3AVXA 4BGDA 4F17A 2HCJB 2G3YA 1KZ7B 3B1YA 1BIFA 2GZDA 2NIPA 2QNRA 3K1JA 1OKKD 4Z51A 1E99A 4GBMA 2C99A 4LJAA 4E03A 1UBFA 3H86A 3Q7PA 3L82B 5FTJA 1VG8A 1R0WA 3B82A 3CONA 1VYVA 2HXYA 3K9HA 4MGIR 5TB5A 1T5LA 4GL2A 2GQIA 4OMLA 2XAUA 1G1MA 3LBIA 2CREA 2P4RA 4HDCA 4RFVA 4TLEA 4XVRA 1QVAA 5JBQA 5J4HA 1CKBA 3E70C 1NMYA 1T0JB 221PA 3K0AA 2H18A 4EKDA 1ARKA 5AWFC 2GJAA 2A37A 3I9QA 4DT1A 3A6PC 2W2VA 3RDPA 4DLYA 3BRWD 4HZIA 1KI7A 4MRSA 3THYB 2OBMA 1S9DA 1ONBA 2NO0A 1G41A 3BIFA 4Y0AA 4DDTA 4XSGA 2BBTA 4BWYA 1TEXA 1SVSA 2M0YA 2AL7A 2ZRKA 3K9GA 2IEYA 1A5TA 3QVVA 2XGJA 1WE2A 2AK3A 1P72A 3GEIA 3TSOA 3GJ5A 2WM9B 2D8JA 2D2FA 3HWSA 1FTNA 1QG2A 3E2IA 4NP6A 4JLBA 5JRZA 5TMPA 2A5DA 1K6MA 4JT2A 2A9KA 2ZSEA 4KV9A 4LV6A 1M8MA 4GFDA 5F98A 1BOFA 4FCTA 3RAPR 1R8SA 1RLQC 1JPJA 1HJDA 2C0OA 2GZAA 1E0JA 3NDBB 5BQ5A 3QKTA 3TAHA 2OZEA 3L2OB 2QAGB 4URVR 2EYQA 2EQBA 2DB3A 2SEMA 2JMCA 3VFDA 2D7DA 5DNYB 3KXIA 4AG1C 4PZZA 4RD1A 3KJHA 1X86B 3HU2A 1XEXB 4PPNA 2LCFA 3UWKA 1VCOA 3CRRA 4QBHA 3T1VA 5P21A 1HUQA 1ABOA 1NVUQ 1UF9A 1W47A 1X1SA 3O8CA 4M9QA 4HDQB 2EGAA 3QXXA 3GJ6A 1T8UA 2ASEA 2OLJA 1KI8A 3KQNA 3CR8A 3PE0A 2W10A 1GFDA 3R7WB 3CB4A 1HTWA 4F92B 3X1WA 1S3SA 3TK1A 3FWYA 3UG7A 3FTQA 4A63B 2V1RA 2BZYA 4JBXA 4FINA 4KODA 4DLRA 3ZZUA 2JLRA 3LVQE 3QVUA 5JHHB 3KKNA 1MO5A 3LD9A 4LJ9A 3C0CA 4Q7MB 4EIKA 5BYKA 1TUDA 1JB1A 5G53C 4HAZA 4M4ZA 2B92A 4MDFA 3GD7A 4ESHA 4D6PA 2LZ6B 2PMKA 4OI4A 3K70D 1XP8A 3T15A 1M7BA 2TMKA 4OHVA 2O8DA 3AKYA 4V0MA 4WZAE 2LKCA 4A0FA 1MUZA 2JEOA 2QL6A 1XTQA 3L43A 4EUNA 3HU1A 1AKYA 2KYMA 1LF0A 2H92A 5JEEA 3W6NA 2YKGA 3ND9A 1YR6A 4PSVA 1UTIA 2EWWA 4C7OB 3CRW1 2Z83A 5HZHA 1UEJA 5CB8A 3WY9A 1KAGA 2JJ1A 2P5SA 1VHLA 3GEEA 4NCKA 5IHKA 4D26A 2V1QA 3FKSD 1G5RA 3M0RA 2EVWX 3SBEA 4OQNA 1SVIA 2RHMA 3IBYA 3PITA 4P4TA 2AWOA 2BMDA 4MUAA 3THKA 1XXHE 3DEFA 3N70A 4P33A 3OF5A 1ZD1A 4ZPXA 1IN4A 3I5XA 1TUCA 5ELXA 3GQBA 1IO6A 3WBJA 2WMNB 5CJPA 2WWIA 2BV3A 1Q57A 1OH8A 4TYPA 1ZNZA 4WOPA 3IQXA 1ZUUA 1MRNA 3KJIA 2ZSAA 4JLPA 4DDWA 1CBUA 2J5XA 4NCJA 5J4VA 4C30A 2DNUA 4LRWA 2ZVQX 4WA7A 2WTUA 2VF8A 5AR1A 3U3RA 3GFPA 5AUPB 2IYLD 3I8XA 1N6IA 4LJ5A 3TRFA 1KI2A 5EP4A 4NMMA 4RD2A 4C0QC 4DDVA 1K8RA 5EE1A 3EZ7A 1IXSB 1UBCA 3BJIC 4IOLA 1OV3A 1XTRA 2AHOA 2LMJA 3I73A 1VYTA 1NN1A 4MKFA 2AKLA 4HB0A 3LV8A 1MOZA 4HEJA 4NCNA 1JI0A 3F8TA 3LVRE 4HXJA 1OJLA 2ZSDA 1EFRA 1OPXA 2H5EA 1XPUA 2LP5A 3CUEF 5FBQB 3DMNA 1XMSA 1ZNYA 2GETA 5KPDA 4IJMA 1PHTA 1RYFA 2V8OA 4XJXA 1TQ4A 1JQJC 4P3YA 3NEJA 4PTLA 5HE9A 4A4DA 3TR5A 1PLKA 1UAAA 2UZIR 2CLDX 5CK5A 3REFA 2W58A 5TY0A 3HYTA 4L16A 5F2EA 1SZPA 1WBBA 3ONWA 3A4NA 3O8DA 1W0JA 2OCAA 4K8OA 3QWXX 5G40A 4MITA 4IIOA 2BHRA 2HT1A 4NONA 3B2EA 3T12A 1NIJA 4PHFA 4MYHA 1VMAA 2FPEA 2FRWA 5EXXA 4G1UC 2KR3A 1FQKA 4NYIR 2VP2A 8OHMA 5JSZA 2OCBA 2IIMA 2V7QD 4U00A 2OI3A 3M0UA 1IJFA 5IT5A 4TYYA 4QXAA 1ZJ6A 3HYRA 2IWHA 3OE7D 1G17A 1PZNA 3H0KA 1N6LA 2DBYA 5AJVB 1YP5A 5LD2C 1OYYA 2NPFA 4JLVA 1AZGB 1DARA 4BLSA 2JTEA 2NO6A 2YYZA 2ZR0A 3U44B 4PPGA 3FHTA 2QPAA 1XTJA 1HT2E 2ZI3A 4PPQA 5GJVC 2O9SA 2PH1A 2P2LA 4TL8A 2GXSA 2AZVA 4NPHA 3A1TA 4PFSA 2UKDA 3MSXA 1IY0A 1DAHA 2ONKA 4UNSA 3SHFA 5FBVB 1J70A 2EBPA 4PHTA 1XEXA 4AY2A 1X8KA 4MYUA 5KSPA 5L8VA 4PXAA 1CKAA 1NF3A 1HE8B 4GMXA 4BQSA 4JBYA 2LKDA 3GMTA 1N5ZA 3JZAA 2XB4A 3A1VA 3VKHA 3K70C 2CK3D 2NOAA 4JLAA 1FX0A 2ORVA 2ZXUA 3AVTA 1N6NA 4DB4A 3DMDA 5GVRA 4WIAA 4A0RA 4JVNA 1ZC4A 3R7WA 4D82A 4EJSA 5FOWA 3LX5A 2B7CA 2ZRJA 4JKIA 1I1JA 2JA1A 2ENMA 2A2ZA 4M1MA 1KK2A 1UJ2A 1XD8A 2VWFA 2W0ZA 2YWFA 4FMCF 3ZL7C 1V1CA 3EWAA 4WXPA 4CT4B 1II8B 1P7CA 1Z0JA 3U6BA 4JJDA 4IDHA 1D8TA 2J7IA 3O8RA 4RZUA 2AD1A 4DEXA 1W46A 3U5ZB 1E9FA 4KRTA 2PCJA 3FOZA 3AB3A 3FKQA 1OXTA 1Z63A 1CTQA 3ZDQA 1PUIA 2Q3FA 1X6VA 3C7KA 4V0LA 3EARA 1XOVA 2ECKA 2AK5A 4FWTA 2GF0A 1AS3A 1NNEA 3MLEA 1O87A 1MT0A 1MV5A 2HF8A 2X19A 2RQUA 2CUBA 1GKYA 4YC7A 3TVDA 3VR1A 3DZDA 1AS2A 4DHEA 1E9EA 2JGNA 4J9CA 1ETUA 1VIYA 2JLSA 3EIQA 1ZU5A 2REOA 1E2QA 3JZMA 4A2PA 5IF9A 2XB2A 4HSEA 2WJHA 3B85A 4XTRA 2FEOA 3GLHE 4ACBA 2GEUA 3QBTA 1AOJA 4RD0A 1E4YA 2IW3A 4XD7A 2CE7A 1GP2A 1FMLA 3L0SA 3OIWA 3QNUA 5E3HA 5IHIA 1YKSA 2VP6A 5FTMA 2FG0A 1RRPA 4HLDA 2WICA 1G7SA 4B3BA 1W48A 3ZIAA 4QJ4A 1WA7A 1UHCA 2ZE6A 3AH8A 1Y3AA 3GFTA 2EWVA 1E6HA 1BH2A 1D2NA 1E2PA 1M30A 4LOAA 1M34E 4Q9JA 5FUWA 5AK0A 1FNNA 3RRZA 1N5LA 2HF9A 4C4PA 3BWDD 3LXXA 5JWOA 5KSYA 2F9MA 5FUYA 2ZTSA 1E0SA 1S9HA 4B74A 1SKYE 1G6OA 1E6CA 4TL6A 3EPJA 4UKDA 1S0UA 2YUNA 3E5HA 4Q5IA 4J9HA 4RKEA 3UK6A 1W0KD 4RZ3A 1XPRA 3QQ5A 4DC9A 1GL7A 2W6JA 1Z6GA 2GK6A 4AG6A 2LQWA 4IKEA 3L0PA 3OIYA 1G3RA 2O52A 3B1XA 5BW8A 2IT1A 1J7KA 1KSGA 2OE2A 1MRSA 4R2IA 2DJQA 3NPFA 2PT5A 3PG5A 2C96A 3EC2A 3F3YA 3ZVLA 4ERNA 3R6NA 3IQLA 1NLYA 5GVSA 1JO8A 5KNCA 5F9FA 1I07A 4NYMR 5FBRB 3AF2A 2MIOA 5IK2A 5AUQA 1SXJE 2O8FB 3EZ9A 3QY0A 4F16A 4LCBA 1ZU4A 3QXJA 2QDLA 4NHOA 4LSGA 2WWYA 2G0NA 1XCPA 4Q66C 1D2EA 4QOSA 2H8HA 1GDDA 5FWCA 2ZIAA 4M9SA 3FMOB 2PZEA 2IXEA 1TL7C 1DAGA 1OFUX 4U5XA 4E5UA 5B57C 1CRQA 3EA5A 3RNLA 1UFFA 4DEYA 3EPKA 1RKBA 3MJRA 1E1RA 4DDUA 1YZGA 3PVSA 2RQTA 3FE2A 4NYIQ 4BFTA 2ECZA 1PVOA 2GCNA 2JLUA 5HCNA 1JXOA 1T5IA 1I4TD 1ZC3A 1E79D 1XNJA 1ZM3A 1OKKA 1VCMA 1U8AA 3SNHA 1VG9B 4DLXA 3KQLA 2F43B 1M3CA 4PZYA 4R9UC 3JV3A 4QT7A 3TUJC 1ZBDA 2RGAA 1MR3F 4HAVA 1QHIA 2AKYA 1QF9A 3AF4A 3DDCA 3DL0A 3BK7A 2C8VA 2IXGA 1C4OA 2KI5A 2PMDA 4JKYA 4TQUS 2J9RA 1MV0B 1NM7A 4PC2A 4NBSA 4XWKA 2XTMA 4ESRA 3KX2A 1X2QA 3LFUA 3P1JA 4P0TA 4Z1MA 3X2SA 4A2WA 1NVVR 1PKSA 4IEIA 3UMRA 3BGWA 1KO5A 2DFKB 3EW9A 2J7PA 3K9LA 3DPUA 3HU3A 1IQPA 5FL7A 4HZUB 1VPLA 1ODFA 2Q9BA 2YOFA 5DYGA 5KSZA 2GBLC 2G83A 4PSKA 3FB4A 2GJ9A 3C4JA 4MGZR 3PVQA 4N1AA 4D25A 3AVWA 1RC8A 4L8GA 4LE9A 1LB1B 1NBMD 5C4MA 1G18A 1H8HD 2DM1A 3LW7A 4XVQA 3G0HA 3SJCA 4IXNA 1EK0A 3RC3A 4EPWA 1JR3E 2P67A 3CKLA 3BB3A 3WP1B 5GJWB 3X1XA 2DF6A 2XZOA 1TEVA 2GXQA 3TR0A 2O88A 2DY1A 2GA8A 2NO7A 5FH9A 4V03A 2I4IA 2ODBA 2G6BA 2HLDA 1EG7A 3IGFA 2RGXA 3GJ3A 1KJZA 3OEHD 2BMFA 2CLCX 3PUXA 2XNDD 2DWOA 1V43A 1UUEA 1Q3TA 4QFMA 3NXSA 1SXJD 5CIWA 4Q1FA 3CM0A 2WWXA 2FX3A 4TT3D 2HJGA 3JVVA 1FMKA 1S8FA 1YHNA 2WV9A 4I1UA 1XEWX 3Q85A 2XXAB 5EC7A 2Z6VA 4XOIA 2JJ8A 5DHAA 3KL4A 3NEYA 1GILA 5DO9A 1CEEA 1PRLC 1DAIA 1E2KA 3U61B 3ZD6A 3PUWA 1E2FA 4MRNA 1RI9A 1YVDA 4B2LA 4UNNA 2DVJA 1TG0A 1KZGB 1P5ZB 4RD6A 3SJAA 1QWFA 1RFLA 2DWQA 4Q9IA 3EG1A 1P2TA 2EYWA 1NN0A 2C0IA 2ZSBA 2DHRA 2ZPTX 2E9SA 1GITA 3M0EA 1NVWQ 2J0UA 4KYUA 4N3NA 4XTCS 4GP6A 4KVGA 4OI0A 1F48A 2JT4A 2XTNA 1DTSA 4AG2C 2QENA 4W9MC 1YU9A 1J8YF 2DL4A 2X2EA 3V00A 4MUBA 1CRPA 3ZYCA 3W8RA 4X1VA 2NZJA 1JALA 1E9CA 4AI6A 3PCRB 2RGEA 4TYNA 3RWMB 4ZV4A 4TZ6A 4DCUA 1PNJA 2B8TA 2OJ2A 2ZI5A 4F38A 1OH5A 3SBDA 2KBTA 4UJ3A 3MFYA 1M2OB 3A1WA 3WRYC 5JJIA 1DAFA 4CT5A 3U3KA 3QXCA 4RFSB 1B07A 3A8TA 1E7OA 1ZM9A 4LC0A 4TLCA 1G2BA 3ZQJA 3K0AB 1AKEA 4QM7A 2GKSA 4Q7KA 2GHIA 4URUR 4BPBA 3IPYA 1Z06A 2JS2A 2PZFA 1RJ9A 2DL5A 1CJUC 3TSZA 2VQSA 1GRNA 3HPQA 2ZRLA 1JR3D 2R8RA 1M74A 4NYMQ 1K1ZA 4TL9A 4DWJA 1TF7A 3LAWA 4Y0VA 4A8JA 1FYNA 1JECA 1EFTA 1IBRA 3R8FA 4TSFD 2YWHA 3CRMA 1O3YA 3KUCA 4KFUA 1U8ZA 3VR6A 2VKNA 1BS1A 4YMWA 4ZDWA 5J40A 1SSHA 2VA8A 3KDSE 3I92A 4BFWA 1LTQA 5J4LA 4C0HA 1ESMA 1XD9A 4HB2A 4Z89A 4GRAA 2C9CA 4Q21A 3NHBA 2CL7X 4IRUB 3E1SA 3B78A 3LXRA 3M0QA 1T9HA 4QHTA 1C1YA 1KMHB 3MD0A 3VHXA 4LN2A 1Q21A 5B64A 1J3TA 1XZQA 3TGPA 4IVPA 3DKVA 2Z5FA 1SRMA 3BH6A 4A36A 1CULC 2D3WA 1COWA 4GZMA 1G4AE 2CSIA 5DN6D 3U7FB 2IF0A 2ZUCA 1XU4A 3W5JA 1T3SA 1B0UA 5JCZA 4ESVA 2PJRA 1OT3A 1II9A 4R0KA 2DA9A 4S2EA 2L3PA 3UATA 4KSBA 2F2WA 4E09A 1Z2CA 2ZITA 4U02A 3GJ7A 3ND8A 4D4JA 4LBWA 4DSUA 3AEZA 4ITRC 3NDPA 4XWOA 2FSFA 2E5KA 2A3RA 1XJCA 4M1YA 1OLOA 1NRJB 1KO7A 1SVLA 1EX7A 4TQAA 4YXWD 4WW0A 2DRMA 3CH5A 1E0KA 1KK3A 3DVLA 5H68A 1CJTC 4Q1AA 1UDWA 3K53A 2NUZA 1IN6A 3W6OA 3QEJA 1NEGA 4JLKA 1JEDA 4U7DA 2D2EA 1U81A 3FPAA 3KKPA 3M4YA 2O0HA 2K2MA 2ED1A 4GOXA 4J9GA 2KT8A 4KSCA 5EQTA 5FR1A 1II0A 4RTXA 1AQUA 2CT4A 1G9XA 1PUJA 1OOTA 2NMVA 2FU5C 2ZETA 2GK7A 2LJ1A 2O8DB 4M53A 3TW4A 4BFSA 3IEUA 3BH0A 4TMVA 3RS2A 1BMFD 3OE7A 2KYBA 1J90A 2NG1A 2OUKA 2ZI9A 4JSYA 2QE7A 1FW6A 3LY5A 2ODEA 5EP3A 2QQ0A 4A0GA 3O5ZA 1K4US 1XDBA 1KK0A 2YOGA 2OV2A 2F9LA 2F1JA 1HYQA 1WRBA 1CR0A 1ZD9A 3ICQB 1N6KA 4EQ6A 2RPNA 4Q18A 2V3CC 5BN4A 4A2QA 2J7KA 2H16A 2EGEA 3RS4A 4JMPA 2YC2C 2XXAA 4ZCIA 5L3SB 1QHHA 3PXGA 5EXSA 1ZUNB 4BFUA 2G1KA 3NG1A 1DO2A 1M8PA 1N6RA 2OFWA 5DE3A 3WYFA 4LBZA 4ABYA 2C2HA 2IS2A 2ZSFA 3CF0A 2ONJA 4ZI2A 5HKKD 4JL5A 1D9XA 1BKDR 1P3JA 1G7CA 1NG1A 3BBPA 3SC3A 1KJWA 1E6GA 1E9BA 1OPKA 2A08A 2DL8A 1GVNB 2FN4A 1F5NA 4PC1A 4OK5A 4HI0E 3S1AB 4KYIB 2AXPA 5EP2A 1KIKA 1IHUA 2EYUA 1OPLA 5A5GA 3PIRA 4CC2A 3W6PA 3EHRA 1XPOA 1YNZA 1VKJA 5IDVA 2CH4W 4E6RA 3ZZTA 4Q4LA 2F1RA 2ANCA 3K8YA 3LWNA 4B3CA 4DCVA 3G82C 3LO5A 1XCMA 2QAGC 3DOFA 2P6UA 3LH5A 5DYIA 3VNUA 1NP6A 3ZH9B 4BZQA 2KWIA 4BLPA 2BOVA 1WXTA 5EJEA 1UECA 5LBIA 2J6FA 1P2SA 2QTVB 2XOKD 4NYJR 1OFHA 4RFSA 5FR2A 4ASUD 2QT0A 3I3SR 4K81B 2G1JA 2WJVA 2FV8A 1VA7A 2ZVPX 3GEHA 1YCSB 4YONB 4TMTA 3ADBA 4MDEA 1ZSGA 1KHTA 1W4AA 2W2TA 3IHWA 4I1OA 4PX9A 4BECA 2BM0A 2FWRA 1E9RA 2F3RA 2CHVA 1DG3A 2WJYA 3H0IA 3MUFA 4IFEA 1KSFX 3VS4A 4M8NE 4O25A 2XMFA 4EJSC 3H41A 1WMSA 4M22A 4M9ZA 4AURA 4M0LA 5CDFA 2MSDB 1MKYA 1LS6A 4B44A 3K0CC 4LWZA 4M4SA 4HVVA 1UDXA 5EE5B 2HDAA 5JSZB 2JLVA 5G3ZA 1I2MA 3PENA 1CU1A 1UGVA 1YZLA 1QCFA 1WB9A 4OL0A 4DLZA 4J9IA 3KQHA 2KE5A 4A6XA 1U2RA 2V54A 1JQLB 4NH0A 2VYFA 4CZ2A 1TUEA 1Q22A 2JDID 1KMHA 1WI7A 4JZ3A 4RTUA 2FJUA 3QXSA 2JATA 2QUZA 1VIAA 4FW9A 5B58C
chains in the Genus database with same CATH superfamily
3ZY6A 2RK6A 1LNZA 1YI0A 4M86A 1P33A 3HHPA 4MVJA 4PX2A 5FADA 1I30A 4XB1A 2IUTA 3TLXA 1W59A 4EJSB 4YUWA 2TSYB 3SX4A 4EQZA 3VV2A 3BIOA 5A6SA 5HG0A 1G63A 3KZXA 2Q5JA 2ZWMA 3J7TA 3M5CA 5EJGA 1L7PA 1AGRA 5AOCA 3D5QA 3S2GA 5EZSA 4YMLA 1X3LA 4GOJA 3EZYA 1X8LA 4RCZA 1QKWA 3S7TA 3QLUC 3MJVA 2P65A 3ANTA 1F0NA 4J0JA 1HDXA 2AK2A 4N76A 1L8OA 5B5SA 4ETIA 2ZCJA 1N6AA 4DNQA 1S3GA 3NTIA 3S7ZA 2B98A 3BCSA 2QVBA 1GBRA 4MQFB 2FFQA 5LZ9A 5DULA 1GPAA 5EMNA 2NU9A 3CVXA 1RQNA 2R57A 5J3BA 2OLKA 4C06A 1QK3A 1QFXA 4RMOA 4LHYA 5ESRA 3LLMA 1G20E 1GQOA 1U0GA 2NQ8A 3W77A 2AZSA 2K3BA 1DIOB 4PX3A 3RS7A 1CZUA 3PGGA 1O9GA 2L3SA 1GCIA 3HY6A 2H65A 3OTQA 3SQWA 3LHIA 2OA0A 1K73C 1VLMA 5IM4A 3G0DA 4NOKA 2GBCA 4AO8A 5JXHA 4NE9A 4IWXA 1VQ6T 1P4HA 2LVMA 3PIOA 1Y4SA 2WVHA 3H8JA 2O31A 1RLPC 1X7XA 3FVVA 2R84A 3MCTA 2GCEA 2Y1FA 4LV5B 4JY7A 4NF2A 5T57A 4DSNA 4I8DA 4FGUA 3N8KA 2OBFA 3L0OA 4DQ0A 2RI5A 2PRZA 4R1PA 4J07A 1M9SA 2AF3C 2RKOA 4E4YA 3AJAA 1TD1A 4H16A 3SI7A 5ED4A 1UKCA 2IYZA 2QPOA 2G09A 1Q81U 3I64A 4CG3A 3L79A 2JFPA 2DPHA 3SXJA 4P4SA 2I1VB 4EY6A 3ZVRA 4P5EA 1ABEA 2LIPA 1MEOA 2QA5A 3GJ4A 4FN5A 4CR8A 4IW3B 3IOEA 3RVKA 3FF4A 4QG3A 1SU6A 2P4SA 2C9YA 3WE7A 3AWIA 3GGSA 4IIJF 3OQ1A 4IOMA 1GG2A 3AP1A 1OV6A 4PK4A 1JTEA 5HUQA 1UG1A 2I8LA 1XTPA 4GQAA 1GKKA 4FE7A 3K6SB 4GI7A 1OILA 4QBGB 2I2BA 2AFHA 1DE0A 5GMKi 1G3QA 1B8UA 3FPSA 1E1LA 4K11A 2VDPB 4V0QA 4L0CA 2WPDA 3HKSA 1BCSB 3DLHA 2QRVA 4NVRA 4J9EA 4YDRA 3IUQA 4UM9B 2FW6A 2SKEA 3DBLB 1MNEA 5T6BA 4XTZA 3CNBA 4RTYA 3FPJA 1BMTA 2M6RA 2OGWA 2RQRA 3CMEA 2XMZA 4KIJA 1NUPA 2CXNA 5DEOA 4LF4B 3IELA 2BRUA 1SZJG 3TBFA 4EFMA 5A3QA 1RAIB 3IAHA 3TO5A 1DX9A 1YR1A 1W1UA 3MA0A 1JFVA 4PLGA 1FPMA 3OYMA 1SUWA 3ES9A 1RAHA 1H22A 4G0WA 1FQWA 3VR5A 2V4ZA 4JU9A 1M2KA 3DR5A 4D81A 5C9ZA 1O95D 1R64A 1L5MA 1PT7A 1HFKA 3ZWKA 4X84A 1EHYA 2XHZA 4PR3A 1I10A 2FMHA 1T8RA 1HH4A 1IZ8A 4M1SA 4UVEA 4JYAB 2KRMA 2LVBA 5EIHA 2YY6A 3INZA 4I8IA 4RMIA 4LD6A 4A73A 1XF9A 4CMEC 1Y6FA 5L8RE 4R83A 4U9IS 3GZTB 4IO0A 4ARBA 3DBRB 2GPYA 3K2IA 1T13A 4MGYR 3OYGA 1UXHA 2P9ZA 4RPJA 2QMEA 4KLZA 2R7KA 5KYKA 3V1KA 2XUQA 3K0KA 3H17A 3H8VA 3QVGA 3RQIA 3L49A 3M6MD 2HF7A 3X1ZA 3K5HA 4JJFA 4M7DE 1W1FA 2GLTA 3LUAA 5KHOC 5A0VA 4D02A 2CVPA 3PPYA 2DTDA 4C01A 1LDMA 3V4LA 3DDSA 1GZ6A 5EIXA 2PTGA 5JNRA 1UOEA 2PU7A 5AJUA 5IANA 2VPXA 3GCXA 2O23A 5L3QA 3CC4A 2VDOB 3ICWA 1IB8A 4HQ0A 3E1KA 1ML4A 4M9CA 4JXZA 1SD1A 4BI3A 4BMXA 1KK1A 1TJ5A 4YQZA 4MV6A 4FB4A 1EFPB 2O0LA 4C2UA 1G0NA 2XB9A 5CB6A 5HF9A 2IF2A 2ZPIB 1J0EA 4L0DA 4A6EA 1C0LA 4AWAA 1AM4D 4ZIRA 5HQ3A 1QYIA 5KOJB 1GPLA 4FUQA 4TWAA 2B4AA 4XD2A 1CE8B 5JXIA 3KT0A 4J2HA 4OP3A 1T1EA 2M51A 3NDRA 2QD2A 3BD9A 5JNVA 3VZPA 4TZKA 1EGMB 3IILA 3H1TA 3S8EA 3LQYA 4ZO8A 1JQAA 4DRZA 4RU1A 5EG2A 2HRDA 1RQPA 1W6XA 3FMFA 3LZDA 2O07A 4OAPA 3RUHA 3TBKA 2RGNA 1NAIA 1DRJA 1UZAA 2IS4A 2BTEA 1EFUA 4JWTA 5FO1A 2EZ8A 1I5OA 2OXEA 3Q3EA 4A0HA 1R4NB 1RXYA 4M75E 1DP4A 3U19A 4M78C 2DEUA 3UJCA 4H7HA 3I0NA 4Q1DA 2X2OA 1KDYA 3H3JA 4MZXA 2VSYA 2R1TB 4O4HB 1G7RA 3CCUT 3NETA 1SHUX 1XNIA 2X77A 2Q3EA 3AFMA 2Q1UA 4XUCA 5A4FS 3D6NB 4QYTA 1VKZA 5JLJA 4YCSA 1U9IA 2Z8YA 2YOHA 1F2TA 2QMYA 2QD5A 3AEYA 4BO6A 4L95C 4I7EA 3GDFA 3QKIA 4BFLA 1SEPA 4TXJA 3ZI4A 2UYOA 2CZ7B 3QBVA 2X22A 1GKUB 3B5EA 1XZGA 2X41A 1WDXA 4M7DF 2K7ZA 1QFJA 2ON6A 3IRVA 3M49A 5H3CA 3EDQA 1D2GA 1WHJA 1T0JA 1OWMA 5DYTA 1QBKC 4X64B 2HV8A 1MIOB 1RAFB 2OTLT 3CPEA 3AY6A 1SC4A 5IAOA 3EIOA 1RLIA 1EFVB 1NX6A 1PEKE 1M66A 4B7AA 3LKZA 2OO7A 2QE7D 1TU0A 3GPCA 3I2KA 1DO0A 4F7WA 2YYAA 4KPGA 4LYYA 1XDGA 3B8HA 1CUSA 3GCWA 5HA5A 1VQ5Q 1OU8A 1B3QA 1UPUA 3DZGA 1L3IA 2JCGA 4CM6A 1BSVA 4PR0A 3ZTYA 4FMCB 2E18A 5HR5A 4RTLA 2Q8QA 3HBMA 3HQ4O 3ZHTA 1KJIA 1XFAA 4YRPA 5CDTA 4YXWA 3QDFA 4WASA 4F2DA 1GLGA 3ADCA 4B4WA 5EZQA 1T34A 4DMRA 1PNOA 1LRLA 5JPDA 4KV7A 1TKCA 1LCKA 4EPRA 3OP1A 4AN0A 3WHLA 1HQKA 2J3IA 2Q4DA 2CH4A 1GFSA 2MT9A 1XUOA 5A0FA 2Y0PA 5KU7A 1SIOA 3CW9A 1PX0A 3IPAA 2EX1A 2IFTA 1XJWB 3INTA 3RARA 2VI5A 1KHCA 3HP1A 1E0AA 5L3RA 1X75C 4IFBA 4N0DA 5JNSA 4M75F 4IKOA 3VU8A 1A50B 4M9UA 1LEHA 4AKTA 4G0PA 1NXSA 2X3FA 2ZIXA 1BDHA 1D3BA 3ZI7A 5J4KA 4ASUA 3O26A 1IQRA 1ZGGA 4H3HB 1RDFA 2R8BA 1R0CA 2NV6A 4ZOLA 3USCS 5B36A 3N07A 1HR0B 2XQGA 2LGJA 3HB0A 5F76A 5E9WA 4D79A 1KAMA 3C48A 4OMOA 2Q5FA 1AGNA 3L9WA 1CDZA 4UAUA 4NBUA 3GLKA 4PLLA 1N7JA 3RB8A 4UM7A 4N3CA 3IJPA 2VF7A 3O91A 1FNMA 4PFJA 4RNDB 1XKQA 2PEZA 1I7QB 3BMNB 2VH1A 3H4TA 1DIRA 4F14A 5KCHA 4F7DA 4CQMA 3UCEA 2HA5A 2PZKA 2ZUUA 1NVXQ 1FNCA 2KQUA 1CJBA 1VCHA 1Y37A 4PWZA 2G80A 1U3TA 1CRLA 2MYSA 4QGFA 1DG1G 2V1XA 1U2PA 1YE3A 1QQ6A 3P9SA 3CC8A 3PMTA 1OX4A 1EVJA 4TKMA 2D59A 2QZZA 3CPWP 3HR7A 2DFTA 5IM5A 3E9GA 4MZPA 2P91A 2FSIA 4EBFA 4IQFA 2D0PB 4UVDA 2GEVA 1OZGA 1QVFA 2ID9A 1EWTA 2QVYX 2FEIA 1OOEA 3FF1A 2GDJA 5IC4A 1SVUA 1Z2PX 2P3OA 4JLNA 3GDGA 1YTLA 2FJ0A 3NVMB 1WKCA 3UKJA 1EGVB 5KUTA 3UA7A 4V24A 3DDWA 2R1VA 3B6ZA 2X1VA 4RBNA 2PBRA 3ZDZB 4UOEA 4WFIA 1G21E 2J48A 2C82A 1EX1A 3STUA 3TU4K 2BBWA 4UHDA 3Q8LA 2RNAA 3KVRA 3FMVA 4B33A 5LB2A 3ZJUA 4GI5A 3HVIA 3OJWA 5HVNA 3BGDA 1FUKA 4FLMA 3OLVA 2XMRA 2PSSA 4IX1A 4QTYA 1Q1BA 3FH0A 1JNYA 4KDEA 4OM7A 1AU9A 1AGXA 4WXRA 4NU6A 1RFGE 1X7ZB 5AESA 3AM5A 2BDUA 3B53X 4O4LB 4E1VA 3QMMA 4R3UC 5DB4A 5LA6F 1OKKD 2ORED 3ZHOA 4X60A 3CJQA 4YAWA 1XFDA 4XVRA 3WFIA 3GH1A 1G98A 2ZDQA 3E70C 4IF6A 5DW3A 2IZZA 3ACDA 4M46A 1H0HA 2NO0A 2IJGX 4ENVA 4Y0AA 2GGSA 1ZN2A 5FNVA 4G4SO 4XCXA 2D2FA 3BKXA 1QG2A 3M2TA 2FPIA 4RPGA 4DA9A 1BOFA 5EVCA 2J9FA 2GZAA 4L8FA 2I6XA 2HMUA 3WBBA 5LZ2A 1XEXB 2PUVA 2LNVA 4KWTA 2QM0A 1DC8A 2WYVA 5D00A 4EF4A 2YZMA 3IIIA 2VEOA 2BKDN 1FSZA 3HN2A 3LVQE 2WJ4A 4QWMA 4ID9A 1Q84A 4AMVA 1JB1A 1UOPA 3SQDA 3TMYA 2YIVX 1XP8A 1T9BA 3O3NB 1RXEA 5AW5A 2JEOA 1XTQA 1E5VA 1KAGA 2V1QA 3H2IA 9LDTA 3NYRA 1IZ9A 2Q2OA 2WMNB 5EY5B 4Z2YA 5JCOA 1TAHA 5AXBA 3TXXA 3FNBA 1PBNA 3OCUA 1G3TA 3ME9A 4KQMA 5IBQA 4F2HA 3TRFA 3OQMA 4F4DA 4DDVA 3MLAA 4G5YA 4MSUA 3RSQA 5G4KA 4A16A 2HNAA 2Q62A 2EKBA 1K8QA 3LVRE 3NCTA 4TMYA 2HR1A 5E1BA 1BDBA 3D3WB 4ZVKA 1UAAA 2DTOA 1X39A 1PLKA 1F6DA 3REFA 4AF7A 1LWOA 2JVKA 4ID3A 4JHLA 4EHJA 4ZJUA 1A1SA 3Q5GA 2PRYA 4H59A 2IIMA 3MEVA 2OI3A 1JEOA 2HU5A 3H0KA 1QLJA 1NDQA 4EF5A 2NO6A 1HT2E 4TL8A 5D7UA 1DAHA 1HLDA 1Z4JA 5J39A 2ZXUA 3KD2A 3EVBA 5GVRA 5LJ5g 5CT4A 4UMFA 2IV2X 3WGKA 3ID6C 4ND4A 5EZYA 1ECJA 1XVVA 1IZZA 2PCJA 1XK6A 3KVNA 4BJHB 1ND6A 3EARA 5LU9A 2GF0A 1MT0A 4UUOA 3VDMA 3TCJA 3B9RA 2QAZA 4MHTA 1C7JA 3B85A 3IQHX 4CKXA 1SC1A 2RAFA 4DA8A 5AFSA 3ZV5A 2CGEA 4MVJM 2EBWA 2HU8A 5FUWA 1M30A 3HABA 1DC6A 1IH8A 2VCEA 1KE2A 1JYSA 1S9HA 3Q6MA 4OP1A 1S0UA 4RZ3A 5ALQA 3SC2B 3CVWA 2JC3A 5BW8A 3K16A 1NX9A 3ICOA 3EC2A 1A9QA 1U9CA 2FUG1 3ZY2A 1H2HA 3WLRA 5JTUA 2QDLA 2WC1A 1VL2A 3HKBA 1FMVA 1OFUX 1GTZA 1WUYA 3HHEA 4DEYA 2WFZA 1PR0A 4F8YA 4DDUA 1QYDA 5HCNA 1T5IA 1VCMA 3I8OA 3COWA 4R9UC 3TUJC 2KI5A 4JKYA 1TTHB 1A8SA 2DERA 4ISCA 3WLQA 4BB6A 2PR2A 3BGWA 2EFYA 2PL5A 2DFKB 2GYUA 3DPUA 4ARAA 5BN3B 1U1CA 2F1LA 2YOFA 2VT2A 3U9LA 3OLWA 5AYVA 1NBMD 5EKTA 4EKIA 2FB9A 2XDDA 1QGOA 1IG0A 2JH3A 3WJ1A 5H3LA 4JI1B 3GJ3A 3KEQA 1IHXA 2E64A 3G5AA 4UOZA 3CM0A 5GONA 1YVUA 3MYYA 1XAHA 1LNXA 3ZJ5A 1IJKA 1FDSA 4MEAA 2XXAB 2Z6VA 4M6WB 1PTJA 1PRLC 2D8AA 2KPOA 5FA5A 4RD6A 2SECE 1AQ6A 1EK6A 3IMGA 1VFPA 2AG0A 5JAPA 2X2EA 3F97A 1J24A 1DUVG 2NZJA 3VPAA 4TYNA 3D02A 1C8VB 3QXCA 1ZS9A 3ACCA 4N48A 1AKEA 3KP1A 1V3QE 3CCRA 2FPWA 3EW7A 2JBHA 4X91A 3NJ4A 1IZYA 5TQVA 3R6DA 3MTDA 1KMCA 4H0FA 4OYYA 1IBRA 2I2AA 3CRMA 3O2JA 4FZRA 4EL0A 3S1SA 1RI0A 3OH8A 2Q4EA 4CN8A 4YAOA 1U5BB 3SHQA 1JE0A 1HDYA 1BFUA 1QFMA 1WX1A 4NV1A 3DULA 1TVKA 2CFCA 4BV2A 3WYDA 4I1IA 1QLHA 4DC0A 2P40A 1C9JA 4DSUA 3VJKA 3AEZA 1ZOPA 4B7XA 3DVLA 1UDWA 4IMPA 4UUPA 2G5TA 2O0HA 4KSCA 4YHHB 5GAN6 4NOYA 1XXLA 3KHTA 4JC5A 5K3FB 4Q3LA 2JCVA 1Y96B 3JCMX 2X35A 4F3NA 4MS4B 4UASA 1U3WA 3Q7RA 2AXQA 1Q74A 1ZD9A 1LJOA 4LOLA 2XRYA 3BXGA 4JMPA 3E4CA 3LHSA 2OOSA 1ZA1B 1DO2A 1M8PA 1V26A 3VR3D 1BKDR 1KQ1A 4HVTA 3FFTA 4BNHA 2HD4A 4YXFA 1FZTA 1XPOA 1I4OA 3PHBE 4M7DG 1XCMA 3DOFA 5AXCA 3T38A 1NP6A 2YV4A 4NX2A 4IILA 2XUPA 1MVLA 2PZLA 2O6HA 2IEBA 4K81B 5JY1A 5FT9A 3MWFA 3GI1A 5U9CA 1R0BA 2WJYA 3H0IA 2QZJA 2VNAA 2FF5A 3PF9A 3KKLA 5CDFA 4TLLB 4XWYA 1NYQA 4LWZA 1DQNA 1UEBA 5BP7A 4J9IA 4QFCA 4CZ2A 1L5NA 5LZ7A 4GYJA 1X7WB 1LA2A 1DGQA 4EGCB 2YXEA 5B58C 3JD4A 2WM8A 1AMNA 3DB1A 1F20A 1YWPA 4NIMA 1D07A 4WNAB 3A1UA 1GUZA 5IBCA 3ZVKA 2VUSA 3EF0A 1ZUKA 4R1OA 3D0KA 2VH5R 1PJZA 3N0TA 5HIMA 1N5JA 3X1KA 1J2JA 1B2LA 2ZYUX 3BQ9A 1FFBA 1R66A 3GMSA 1ZKDA 1NE8A 5EQDA 4MWBA 4LQ4A 1K73U 3JQ8A 2Y6VA 1NLOC 1P9NA 3JSXA 1YNSA 3KQWA 4Z8YA 3P2OA 4C0AC 3GV0A 4D43A 2B2NA 4KIGA 5C5CA 2FSGA 4AFSC 1C7ZA 1ZHFA 4OK6A 3CFYA 3TUZC 1QJCA 1LFDB 4E2FB 1DXHA 5THXA 4IJQA 3W2GA 1PV4A 1X6GA 3E82A 3RYCA 1CUJA 4F3YA 4UBKA 3NBAA 3OG9A 4YAUA 1Q1ZA 3FROA 2DH6A 5CH5A 4JYZA 2CXPA 3I42A 3NONA 4JBLA 5LKRA 5AK3A 1J1UA 3COZA 4M75G 3O3CA 3ZVMA 3MRSA 3TPZA 3B6IA 1S01A 1ZIPA 1OZ0A 1BIAA 1A0NB 1RQ2A 2Z6QA 1JN0A 3M9WA 4J1NA 4M0MA 1P73A 5DWVA 1GRRA 1AWWA 3PIIA 4AF6A 2CYCA 4RLFA 5EWJA 3PHGA 4BZXA 3M0TA 4KN8A 3ANYB 1PFUA 3JQEA 1KY2A 1J0BA 3I9V6 4JJEA 4BB9A 3EBOA 1BI0A 3IQFA 2EYZA 3IT2A 5A5VA 4ML3A 2QAIA 4N7BA 3CRQA 1R15A 1Z3IX 2BR3A 3WKEA 1QE0A 1XD2A 3R09A 3HL8A 1F8YA 4BX2A 5GAOl 1H6DA 4G63A 1MMDA 1D6JA 1LRKA 3H16A 3GW8A 3RTBA 5AVWA 4HGRA 3A4TA 3U7HB 1N9ZA 4EUFA 1FS6A 3C24A 3QKUA 2FPFA 4R55A 1EP1B 3ON5A 4R0NA 3OPYA 1DVRA 4OXRA 4ZTJA 2Q3CA 2XEXA 2PAAA 1FYWA 1BD3A 2EEPA 1OXKB 3KQUA 3LUBA 2V7TA 4MI3A 3IS3A 1JEQA 2WZQA 4F4JA 1YRAA 4BE4A 2N1MA 5JDIC 3K71B 3I2GA 2CZQA 3WLPA 3AUXA 1DELA 4C9BA 3O82A 1DQSA 1ECFA 5H16A 3ZNNA 1W36B 3HSSA 2YJ5A 5GAOq 3C45A 4LNPA 2H3HA 1E3WA 4EY7A 2PKQO 4KTVE 3SBXA 3HY3A 1XV5A 4FMDB 5EWMB 4AKIA 2SCUB 4L6CA 1O4VA 4IDPA 2AOTB 5JO9A 4ZFNA 2H2IA 5CR2A 2WJPA 4MCAA 3V8JA 2PU9B 2LJ0A 3I5RA 4RZ2A 4YJ2F 4GP7A 3I56Q 4F7UB 5KCOA 5E6RB 4BQQA 5M5BA 2EVRA 4EZEA 5DHTA 4GBQA 4RHYA 2P3LA 4LJ8A 1QTNA 3NBXX 2XYGA 2FPLA 1OZAA 1QOPB 3WXBA 1XMOB 2X3UA 5A2QE 1Y3FE 3L8HA 5AW7A 4B73A 5HJ5A 4L3VA 4KK4A 1WBJB 4NZNA 1NV8A 2XMBA 3FD8A 4MVCA 2IITA 4B9EA 4F6RB 2ZIGA 5A7GA 5DU2A 3BDVA 4Q1CA 1H1LA 3CPSA 1KKLA 4RTMA 2L18A 1U0JA 1AXEA 4JBHA 2F4NA 2ERXA 3OHPA 1JHUA 3SSNA 4TXHA 1QG4A 1NL3A 4M37A 2WSFE 4DVGA 4TX1A 1D2HA 5GJCA 4XAXB 1B34A 3I4FA 2C00A 4RTSA 1T9AA 1XHLA 3FCXA 4N47A 1FYVA 4D42A 4BD3A 3Q9LA 1AKVA 3LCCA 2OD2A 5KOHB 1RR6A 4LE2A 1J2EA 4M77C 4Q4JA 1NP7A 1WY5A 2CV1A 1TTPB 1AHPA 2Z9BA 1AUOA 3F4KA 3PX3A 4OQQA 1WXUA 1UPCA 3I72A 4TVBA 1XMJA 2PN1A 2QI9C 3CUKA 3ZLTA 1ZIOA 5I7UA 5EJ2A 1ZMBA 1W85A 3K5PA 3B12A 1KI1A 2NU7A 1C5KA 4L8YA 2MDTA 1HL7A 1Z2OX 3N6RA 4Q4HB 3ZGZA 5D3MA 3PK0A 5TMBA 3GAMA 3AXTA 4OKSA 5AOVA 1QH0A 3AIMA 4B9WA 1P9RA 5JS7A 1E20A 5FUQA 2UYYA 2CYBA 5HTOA 3E8XA 1M1UA 4QUAA 4ZQFA 3KSDO 1USGA 5J43A 3KPUA 3NBKA 1AQNA 3AESA 1CK4A 2A9OA 2PVSA 3WSTA 4ALKA 1SXQA 4MICA 1M34B 2FAXA 3GN2A 3PQ6A 3T4XA 3UHOA 4JJGA 5FPYA 5ALRA 2EKOA 1F38A 3ADDA 1A3CA 1NU8A 1Y4AE 4HDSB 4X44A 2OD9A 2O2JA 2OXTA 2QEXQ 3DTYA 3GFRA 1EP3B 2L42A 2YCLA 3WGTA 1S96A 1YQXA 1XB2A 1TA4A 2ZE8A 3CU5A 3O8OB 3JALB 2R2AA 2XITA 5FLEX 1T2AA 3I55T 4UU1A 4K03A 5F3DA 3V8LA 2VP3A 4YEDA 4DV3B 3UWPA 1RJWA 3I9NA 4FYVA 2J7PD 4OMMA 1Q17A 4ONEA 5DOVA 1RXWA 5ITZA 3H0HA 2AJTA 2FWPA 5JTTA 4KPUB 3MTJA 3GX1A 1DBVO 5B3AA 4Q37A 5EIFA 4M0FA 2E6NA 3MGCA 1VKOA 1OJ7A 1L5QA 2Y3IA 2VHUA 4G81A 4RL4A 3TKLA 2ZBUA 4MKGA 5C4GB 2JM8A 2QRGA 1TKRA 4N8DA 2AUNA 4DMGA 3UIEA 3D3EA 1K8AC 2XNCA 5DWDA 3FYHA 3N1UA 2EFGA 1KOLA 2GILA 5B1DA 1T3HA 3RVNA 2H1RA 3VO2A 4LDXA 5K3DA 3ROPA 1EXVA 3K6JA 4W6QA 1NV9A 2QVGA 5BV7A 1UJYA 3Q41A 1NPRA 3AG5A 3QKRA 3AHGA 2P6RA 4KXLA 1LSSA 4FNOA 4MYCA 4PS1A 3HGQA 3W4KA 3RBVA 2KJQA 2V6GA 1W93A 4JBWA 2QD3A 3DBHA 3U3JA 1DBIA 1G66A 1HDCA 1QGED 5JBIA 3PDHA 2BZ8A 1NF8A 3VI4B 3IOBA 3H5IA 3IR5A 3NHNA 2OKCA 5ALJA 3RSSA 4B4VA 3KM0A 3LYIA 4OP0A 4AZSA 2R4TA 3DHWC 4JWKA 3K2EA 2GJSA 2I6SA 2LCLA 2O3TA 3HA2A 3UPTA 1PSWA 2IPOA 2Y05A 4R2MA 2FVXA 2WJ3A 3T1HB 1MABB 1XVAA 2I7TA 5K0JA 2EC5A 2BN4A 3VS7A 1JGTA 1OROA 1VP9A 5CAEB 1L8QA 1QZXA 3WLTA 3QOWA 2EL9A 1IN1A 3Q3IA 3CD6Q 2R65A 1S8OA 1JDBB 2C9ZA 1NVEA 3G02A 1GXIE 3I56A 2X2FA 3PHLA 1U4OA 2Z5LA 2I66A 4FZ5A 4JLMA 3PUIA 2D0OB 1X1EA 5AJTA 4NXMB 1T8TA 1QIJA 5GAOp 2GAOA 3EPLA 3BIXA 2DY0A 4LZNA 4L5BA 4FQ5A 1HZZC 5AKGA 3LWHA 3FGZA 3FGOA 2AQ8A 3R9XB 2JGDB 3MCAB 4YB8A 5LP1A 2X5KO 5E4JA 4GVXA 3PUZA 4QBTA 5DNEA 1DEKA 1UGQB 2B5OA 2PXHA 1REQA 4W5OA 2OV6A 4EA7A 4BS9A 4JJNK 3QVKA 2HBWA 1LOJA 1UADA 4EPCA 2W0SA 5H4GA 3IO5A 1G2OA 5IJWA 2W9XA 1BX0A 2OILA 4DILA 3U4AA 2RM4A 4OKIA 5JSKA 3VVMA 8ABPA 3CLKA 3KC2A 4P4UA 5B1IA 3SYNA 5IC5A 4UPVA 4G8DA 4QUJA 2XRZA 3CX8A 3QI2A 3ETDA 4GH5A 1DTEA 2ETVA 2VTBA 3D6MA 3O8QB 4DMMA 1IHVA 2CEAA 3QBEA 4CEIA 1VCNA 2I7XA 4AG5A 3II6X 1G2PA 1MJHA 4ZCQA 2JLWA 3LX6A 1UMBB 1Z6AA 3BIJA 2QOEA 4JL6A 2WWGA 2DPGA 4ZOCA 2VR1A 3A1DA 4JUVA 4AY3A 5CB4F 2B30A 4MW7A 1ID8A 4UDXX 3W8FA 2ECQA 2WYIA 3N28A 2FQQA 3R7AA 3FM9A 4CIWA 4FN4A 4G6ZA 2FMTA 4HWRA 4HVLA 3IR7A 5HCKA 2FPRA 1K5DA 4XWTA 5K6RA 4Q47A 4DBLE 3H0FA 1TYCA 2FFJA 1KEEA 3UF0A 3GEGA 4GLFA 5FIUA 1NOJA 2ATVA 1N5KA 2ZJ8A 3PICA 2GBPA 2QG9B 1NW4A 3NJRA 2JI6A 1VKHA 5BQFA 1E2LA 1YIAA 1AG9A 3ABRB 2JDIA 3VGPA 3AQ4A 2O50A 2HREA 3SZ3A 3N74A 2QN1A 3VNVA 2V96A 2ZANA 1ACJA 1SGWA 2VQDA 1YF3A 3A6EA 2ZIVB 1UK7A 3ILVA 1WV0A 4PYOA 3UUGA 3C6YA 1I4LD 3V80A 4AUMA 1KMQA 3PFBA 1V8PA 2J5BA 3A9VA 4R69A 3TQTA 2PX0A 5FOUA 1C30A 2Y71A 1FXWA 2OZLB 2YZKA 4WUTA 1TADA 1WVIA 3BFPA 3VJRA 2R9VA 1RHRA 5FPHA 4UVGA 3SKVA 1KY5A 2HSGA 1S1CA 2ATXA 3A1CA 1JA0A 3THRA 3FTPA 3F90A 4B6EA 3BGIA 4BXOA 5CDYA 2PLRA 4HPXB 3Q8XB 1KS9A 4L5JA 5L7TA 5BMVF 1NAHA 1WO8A 1GKIA 3ZCUA 4DLPA 1PJ2A 2GKOA 1C1XA 1HSQA 4XU2A 1WMDA 1X7GA 1OHHA 3QU7A 3GPLA 3BILA 1R0XA 4BX8A 5I8ZA 5FI0B 3MHTA 3C3BA 2I62A 2HQ1A 5H0IA 3IKTA 1Z3CA 1AHHA 5KTKA 1AKRA 3ZEIA 5DIFA 5IHPA 3UK0A 3TXYA 1FFGA 4IUBS 1MJ5A 3WKCA 5GM1A 5KIAA 5KVSA 1J2TA 4CI0B 1LDGA 5A4KA 5C3MA 2UUAB 4FGKA 4BO3A 2ZIZA 2IDZA 2BEUA 1WZCA 2Q4OA 2HQEA 4YV1A 1JW9B 2YQ5A 3INGA 2FMXA 3WYGA 3OE1A 2HHJA 3EEBA 1VIMA 4BIIA 2XWPA 3I1YA 1SQ6A 3BMOA 5IT4A 3FVQA 3RUEA 4ROTA 2GNCA 3PUVA 1YZTA 3OYJA 2HA7A 1OXXK 1OBFO 1GXSA 3SKXA 3JB9D 3AB7A 5TS2A 2FKNA 1MEJA 1RZUA 1T2VA 4F17A 2P9TA 4A91A 1Q5PA 3RC2A 5TF0A 5LJ5h 2Z95A 3P9YA 4O2BA 4CQLA 1RBZA 1GR1A 3TD9A 1QFYA 3LBIA 4RFVA 5AIAA 1PNVA 1IB6A 1QQBA 4DT1A 3A6PC 4A27A 4PLPA 3THYB 4A8PA 1A4XA 3OW2S 2Q7DA 4XFKA 2IEYA 3UOAB 1WE2A 4PZPA 5BV8A 3TSOA 4JITA 1DIHA 1D4FA 1C29B 2OCXA 4JI0B 1Q83A 3UFXB