1VYVA

Beta4 subunit of ca2+ channel
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
332
structure length
274
Chain Sequence
AIRQEREQQAAIQLERAKSKPVAFAVKTNVSYCGALDEDVPVPSSAVSFDAKDFLHIKEKYNNDWWIGRLVKEGCEIGFIPSPLRLENIRIQQEQKRKHIPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKSSLAEVQSEIERIFELARSLQLVVLDADTINHPAQLIKTSLAPIIVHVKVSSPKVLQRLIKSRGKSQSKHLNVQLVAADKLAQCPPEMFDVILDENQLEDACEHLGEYLEAYWRATH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALCIUM CHANNEL BETA-4SUBUNIT
publication title Structural Basis of the Alpha(1)-Beta Subunit Interaction of Voltage-Gated Ca(2+) Channels
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 78
structure length 274
sequence length 332
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
A PF12052 VGCC_beta4Aa_N Voltage gated calcium channel subunit beta domain 4Aa N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1vyvA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1vyvA02
4IHQA 1AGRA 5IT5A 3TAHA 2QRNA 2D8HA 2VP6A 2O8CB 1R2QA 1QVAA 4EQ6B 1WA5A 3CPHA 4TLEA 4HAWA 2QI9C 1II8B 4RKEA 1NP6A 1ESMA 4NCNA 2GBLC 1MO4A 2R2AA 3B1VA 4FINA 5C46F 3HYTA 1ARKA 1GKYA 3WNDA 1Q44A 2CXXA 1EFTA 3LBIA 2BV3A 3ECCA 2RGNC 4BLOA 1TUDA 2UKDA 4RFSA 5FR2A 1M7GA 4URYR 5DI3A 1AM4D 1XP8A 2J6OA 2YSQA 2ZR0A 3CRQA 2BCGY 5DSZA 3LBHA 1UBFA 5EUQB 2N42A 2Q3FA 2YDLA 4EAQA 2BM1A 5A4JA 1UADA 1KDPA 3O8BA 2A78A 3K09A 5HKKD 4A0HA 1SULA 4UKDA 2VHCA 4EJSC 2IS4A 1NVWQ 4QGHA 4A4DA 3TGPA 3SBDA 5F9FA 3V4RA 2LWIA 1K5GA 4ACAA 4Z1MD 1SKYB 5EZ5A 1SKQA 4M9XA 4A8JC 4YDSA 4M0LA 2FZLA 1DE0A 4LUEA 4GL2A 2QENA 3IPXA 1W7AA 1KIMA 2JLQA 1LY1A 1AKEA 4C0HA 4B47A 1M1YE 4OI4A 4JKYA 1DARA 3FDIA 4L9WA 5KUTA 1E9EA 2JMAA 2L0XA 2X1VA 5CDFE 1RIFA 2J3EA 3THYB 3DOFA 4ZO4A 1Z6TA 3ZZTA 1KI7A 2QSZA 3B1XA 2QE7A 2VL7A 2C9YA 4JL8A 1E2FA 3TKLA 1J2JA 2J6KA 2R6DA 2ECZA 2ZYUX 3ASZA 1BU1A 2OLKA 1H8HD 3BJIC 5EP1A 1IBRA 1WCV1 4CEIB 3BAFA 3K0AB 4P33A 4NU0A 4KI0A 3UWOA 3THKA 3I5SA 5FBQB 3TQFA 2PEYA 4HCKA 3IO5A 4DDVA 4PO8A 3IHWA 3KKQA 2G1JA 5EP2A 2OESA 4W5WA 2ZJ5A 3HWSA 3NHAA 3NWJA 2XGJA 1W2GA 4NMMA 3A98A 2BKEA 4CT4B 4B3GA 4HUQA 3WNBA 1KO8A 1N0VC 1XPUA 5DE3A 4TN1A 4A82A 2A9KA 2QP9X 1N5ZA 1J3TA 1G3UA 2ZRLA 1X27A 2OG2A 3ZYCA 4Q4JA 2D1XA 3AVWA 3FMFA 1D2MA 4HUTA 2ZSBA 4OI1A 4KRTA 1ZM4A 1QG4A 2NWMA 1Z47A 1QCFA 3AH8A 4L16A 3TNFA 4G5OA 1G2BA 1X43A 1CR0A 1N6IA 2F3RA 2G3YA 4GMXA 4KBGA 3P4YA 2EBPA 3ZD6A 1FP7A 4AI6A 2BIFA 4KFSA 3U60B 4F91B 2LMJA 1Z08A 1W1FA 1IN4A 1G1MA 4FCWA 3WRXC 4EPRA 2HCJB 4Q01A 3T1OA 4Q4AA 5CIQA 1OPLA 1OIVA 3CRW1 1UJYA 3DZ8A 3NDPA 4G0NA 3MWLA 2GTJA 1NN3A 1NEGA 3SYNA 1CR4A 1A4RA 1KNQA 1GL9B 4AURA 4LUCA 2IYLD 2ZJAA 2WPDD 1T3LA 1YN8A 1FX0B 3RS0A 2LJ1A 3LV8A 2O8BA 2Z4RA 1G6HA 2NOAA 2CHVA 1A5TA 3GJ5A 4MGYR 3MWKA 2KWIA 3SJCA 1WLPB 3FKSA 4D0NA 4JL5A 1CSKA 2DMOA 1KTVA 2W0MA 3R20A 1P9WA 1ZUHA 3I5YA 4HLDA 1GDDA 1F5NA 2BEKA 2EYUA 2VP9A 2L3QA 4OI2A 5DH9A 2L3PA 3T5GA 2A5YB 3EG5A 2QG6A 3W6PA 2DRKA 2PJZA 4D4JA 1T0JA 1TX4B 5FBVB 2BBOA 2VIIA 4B48A 4I81A 2IL1A 1RYFA 2R62A 2YVUA 5JHHB 5GADl 4TMXA 5JWOA 2NPIA 4F93B 1IN5A 4M9ZA 1F6BA 1R5BA 3IILA 3EA0A 1E1QD 2W0ZA 1XD2A 3W3AA 3JZAA 2VKNA 4HB3A 4YONB 4XTCS 2B8TA 2CBZA 1EXMA 2GTOA 1XBTA 1GNQA 1Z2CA 1JBKA 3QKSA 4CEJB 4DB2A 3J81k 4L15A 1VYVA 1RKBA 1OKKA 3CF0A 2PCLA 1AQYA 4GT1A 2QGZA 3IIKA 5KSYA 1COWD 3UA6A 4RD1A 2CVHA 2FNAA 1DS6A 1XJQA 2PX3A 2BEJA 1U99A 1R5OA 3OEHA 1OYWA 2DL5A 3LQQA 5HPYB 2PEZA 3U2QA 5HCKA 2OBMA 1KSFX 4BZXA 4RZXA 1GFCA 1I2DA 2V4ZA 3CH5A 3W5IA 2ZEJA 4FMDF 3LW8A 3F3YA 3M4YA 2IXGA 2QTHA 1QHNA 4V0KA 1AZTA 1XXHA 3NTUA 4KAXA 5JI2E 2XNDD 3FOZA 2ANCA 1G7TA 1ODFA 1Z2AA 4XD7D 3H84A 1ZD1A 2A5GA 2PX0A 4B3BA 5KSOA 2ZI7A 1H3HA 1GL7A 4D4MA 1NM7A 2FPDA 1R0ZA 2Z5FA 3NC0C 4M1TA 3BB3A 1DPFA 1XX6A 2BCJQ 3A1WA 4J9CA 3A4NA 3BD9A 1E99A 1ABQA 2WVJA 2ZI5A 1UPTA 1QLYA 4HI0E 4WZ6A 4PO9A 3PEYA 4FMCF 1F2TA 5CYOA 1UEJA 3QENA 1KDRA 1U90A 1KFZA 1FPMA 4XWAA 5FTMA 3BGWA 3QSYA 1PKSA 5JBQA 2QT0A 2QAGA 3IQWA 3U6KA 1JR6A 4J9GA 2JJ1A 3QXSA 4PPQA 5B2ZA 4C0AC 3LNCA 2KR3A 1MABB 1HY3A 4Q48A 4BASA 1E9FA 1IM2A 2CL7X 4L8GA 1UGVA 1HT2E 2CH4A 2PLRA 4KCGA 2NO7A 2AZSA 4Q7MB 2NO1A 4IDPA 4KSCA 2V1QA 5F3WB 4JBXA 5JWRA 2DVJA 4IFBA 3ZVRA 2B7BA 4PSVA 1P61B 3BRWD 4GFDA 2KI5A 4MYTA 1CKBA 1R6BX 2ZYTX 5C1BA 5HR5A 4ESRA 1DEKA 1FMJA 1S1NA 4ASUA 1DG3A 4BUJA 5LD2B 2ZTSA 2OFXA 3L0SA 2GEVA 4XJXA 3JV3A 3MAAC 4IVRA 1ZBJA 1XTSA 2RGGA 2KT1A 4US1R 1I4DD 3PUVA 1GILA 2W2XA 2JS0A 5GJBA 1UG1A 2JGNA 2OAWA 1ZINA 5TXGA 3GLGE 1RJ9B 3AF2A 1UBEA 2FPKA 2GCNA 4B32A 2LNHB 3SN6A 2ZR9A 5C2JB 5KNDA 3AVUA 2CCJA 4GBQA 1XFAA 2MSCB 3V00A 4FWTA 1KHTA 4IDHA 1E1RD 1SXJB 1VCNA 1E2KA 2VQSA 5EP3A 3ZVMA 3PEUA 3AUXA 2OCBA 2LQWA 3CR8A 2VLIA 3SYKA 2LJ3A 5IXFA 1TQ6A 2DA9A 2Q3MA 2RQUA 4Q19A 3BXZA 4B76A 3D6TB 1BKDR 1KSJA 3KJEA 2OEPA 3IBGA 2ZE7A 3IBYA 3K53A 5SZJA 4EPTA 3U7HB 2OJ2A 2B8WA 2FJUA 4GRAA 2F1JA 1QHHB 1NEBA 2ORVA 2XSZD 2EFCB 1TMKA 3SBEA 1G7SA 4WXPA 2W58A 5H70A 1S9HA 2DRMA 3HU2A 2VO1A 5EQTA 3UG6A 1XOVA 3P4XA 1G8FA 5IHIA 2C03A 1NSTA 4NDZA 4OHZA 4HLUA 4ZDIA 1T8TA 3N2IA 2GEDA 1TG0A 4TZ6A 2FGJA 3B82A 3GEEA 3M0TA 1JQJC 1SHFA 3P1JA 4A0GA 4HAZA 2QL6A 1ZUKA 3CNOA 1E69A 3HYRA 2RKOA 2ZRMA 4G3XA 4CT5A 3L2OB 4R7ZA 5KU1A 3LFUA 2DWOA 4MKIA 1HT1E 2R9VA 4JLPA 4LJAA 1XMJA 3T12A 3WY9A 3GEIA 1E4YA 5SZIA 1WFWA 5KTYA 2EQIA 3IQXA 3KXLA 1MO6A 2X3WD 2OCPA 2CREA 1G5TA 1QF9A 4I4LA 2M0YA 2IYSA 4PPGA 3AVYA 4D8KA 2EW1A 3DKVA 4LJ9A 3KB2A 3PQCA 1FYNA 1GNRA 3ZZ0A 2WHXA 1BMFA 2QT1A 1Z0AA 5JSZB 2K3BA 2IF2A 1KMHA 4PZLA 1FW6A 4PSKA 3E1SA 5AR1A 2IYXA 3KJGA 3OIVA 5L3SB 1TNDA 3VX4A 4OMQA 1GAJA 2HCBA 2ZXUA 4KXFB 2ZE6A 4Q4HA 2EU8A 4I99A 2HXSA 4IOJA 4KBFA 4LHYA 5F9HA 4D81A 4GOXA 2JDID 3NGPA 2GAAA 2G6FX 3AVXA 2HLDD 1NYFA 2KYBA 2P0EA 1P7CA 4BEBA 1E9AA 5FTLA 2PNIA 3NXSA 2DFLA 2WWWA 1N2CE 4DHEA 1KZGB 1BOFA 1VECA 4PANA 4Q7JB 4KSBA 1E2GA 4TYPA 3KXKA 5L3RA 3HU3A 2IYTA 1XMSA 3V9PA 4HVUA 3B8HA 4KV9A 2GF0A 2IYYA 3OEEA 2OUKA 2VHUA 1N6LA 3ADDA 3TSZA 2GBLA 4UNQA 2KYMA 1SVMA 5JMTA 4LBWA 1UECA 4OK6A 3SQWA 2VTKA 1HH4A 4A2WA 3D8BA 2DYBA 2RGNA 3ZS9A 3IO3A 4DZZA 4ZCMA 1SKYE 1JNYA 1UAAA 2A3RA 4CEHA 421PA 2RCNA 2WIAA 2LCFA 4ZDKA 4PX9A 3BFKA 1P73A 3OE7D 4U5XA 4OHXA 2FFAA 3V4FA 2CLCX 4AKEA 1TF7A 1N6KA 5DYGA 2DE0X 2PMKA 3GFTA 1M6NA 1GIAA 4CC3A 4M1OA 1W0KA 4Q4LA 2IUTA 5CK4A 5JCPA 2HT1A 1Z5ZA 4EJSA 1J7KA 4L5BA 3EARA 3KZ1E 4LJ4A 4U00A 4UJ5A 4URWR 5J4KA 3ZDQA 3FTQA 5FW9A 2ZJ8A 4EIKA 3OF5A 1TU3A 4A8JA 1XZPA 1DO0A 5E95A 2FN4A 4MGIR 4Q7LA 3GLIB 3UKDA 1KO1A 4HLQB 2F3TA 2C98A 1CF4A 3VS3A 5J40A 4P4TA 3QEOA 1ZW6A 5FUYA 3HPRA 4AYXA 2GWHA 4OMPA 5A5GA 2I0NA 3M0EA 2KJQA 1O3YA 5GJWB 2QBYA 821PA 1SRMA 1FL9A 3LXRA 3WBJA 2X19A 3HP1A 3AF0A 2WSMA 2PZFA 2QE7D 2ASEA 3GPLA 3TJZA 2ZS8A 5GJVB 3ZQ6A 1ETUA 3AVTA 4X1VA 4ARZB 3OFNA 4KO8A 2W0SA 2A08A 1Z0DA 4N0DA 2O0HA 1KI6A 3I92A 2RGCA 2LX7A 3SFVA 2JM9A 1NVVQ 2GF9A 2ROTA 4B74A 2C96A 5AJVB 2Q6TA 3U4QA 1PZNA 2J45A 2NQ2C 4ESHA 1AK2A 4YLGA 2AKKA 1JEDA 4DLZA 3ZQJA 4X8MA 3T35A 1WB9A 2EQBA 5FR1A 4GSYA 2QEQA 1NLOC 2NO0A 2WWXA 1FP6A 1OOTA 4J9FA 1OV4A 2WV9A 2P3SA 4PC3A 3W9YA 1VCMA 1KI9A 3CKLA 4WXRA 4PC2A 3UATA 4YC7A 3CWZA 4S2EA 3I73A 1G3RA 3KTAA 5A0FA 4URVR 3CBQA 2JLVA 4HZUA 1JAIA 4GNKA 3GFOA 4RFSB 1G3MA 3PEVA 5KPJA 5TMPA 2YWGA 4MUBA 3X1ZA 2AK5A 4JT4A 5DI3B 521PA 4AFZC 1E79A 1V43A 4DCTA 2QMUA 5FFMA 1Q21A 4JPBW 3M0UA 3ZZUA 1D8TA 3IPYA 5J47A 3LWNA 1K8RA 2FO0A 5E7JA 2KRMA 4G01B 4NYJR 4D2IA 1P60A 2GZHA 1CJMA 2JIZA 2Z6VA 4DSOA 3NHNA 3QXHA 4F7WA 1ANKA 2VP5A 4NYMQ 5IDVA 3ASYA 5CLLA 1GRQA 1N3BA 4WBSA 3UWKA 2MSEB 3BH6A 4PFSA 4Q66C 2BWJA 1W36C 4CC4B 1TQDA 4BQSA 3SU8A 3FKSD 2RMKA 3H4MA 3T1TA 5FPHA 2F6RA 3EZFA 4CGZA 3VR2A 5FL3A 1YU9A 4MKHA 4Q03A 1I4TD 4D0GA 3IEUA 2ZE5A 4R2HA 4QBIA 4YMSA 4Z8XA 3VNUA 2ZI6A 1JEEA 3SEMA 4JZ3A 3ZGXA 3SC3A 2DBMA 4C3ZA 1Z3IX 2ZETA 2LKDA 1Q1EA 2XXAA 4GI7A 2XB2A 2PH1A 2L3SA 4QNMA 2E5KA 5CDFA 2J05A 2VHJA 4NONA 2DCUA 1OFHA 3BH7A 2ZREA 3ADCA 2IS2A 1NG2A 2CDTA 1E2LA 4G5GA 4RD4A 4V0LA 3VQTA 5L3QA 3EC2A 1A2BA 4OMOA 4YMWA 4BFZA 3GD7A 3VMFA 3UA7A 3LLUA 3EX7C 1ZNWA 2JJ2A 4S35A 2DLPA 2O5VA 2WBLC 1PRMC 2I3BA 4KJZA 4YQFA 1WIEA 1JALA 4B6EA 1W46A 4MGZR 3VS7A 4DEXA 2HBWA 3U5ZB 2IXEA 2V9PA 3WNCA 4HUQB 3K0EA 4DBLC 4DLYA 1Z0JA 4DIEA 4F4CA 4Q4JB 5HZKA 1BIFA 2X2EA 5KSZA 2XTMA 4RJLA 3VS1A 2P67A 1X6GA 3MLEA 3K9GA 1R0XA 5FOWA 5B30A 5LB4A 3PJRA 4PQYA 4AKIA 1KKMA 3DMNA 5KDOA 4EPVA 5CB6A 2O8EA 3ND9A 3PG5A 4D6PA 6Q21A 4ZDWA 4Q4AB 3U7FB 3TUIC 1X86B 3KUCA 1M7BA 2EFHB 1VG1A 3U3KA 4URXR 5KO2A 1DAKA 1NN0A 3FMPB 3IGFA 3VR1A 3LXXA 4PHTA 3LW7A 2AR7A 2CLDX 2X77A 4W7SA 1FUKA 3LRPA 3RVBA 2O8BB 2A5DA 2CVFA 3BFXA 3MUFA 3P26A 5G3YA 4CRWB 3MJHA 4DLRA 1S3SA 2BBTA 1Y57A 1E2HA 2DFTA 2A30A 2BKUA 2FSHA 3I8XA 2H7VA 2ZJZA 3LY5A 4IVQA 4RTVA 2N1BA 3Q7QA 2WJYA 3BS4A 4MRSA 3LLMA 2V1XA 2O31A 3WHLA 1ZIOA 5DNYB 3EG1A 4E09A 1QKWA 4Q1EA 5KNBA 1P9RA 3C16C 1QHGA 1E32A 2DL7A 2ZJBA 4GOKA 1GM5A 4HZIA 4POAA 1EFUA 4V0OA 4LDJA 2Q9BA 1T0JB 2YUOA 2CUBA 3B60A 4I1VA 2KXCA 5D3QA 4A2QA 1GG2A 1U8ZA 2CL0X 2ZRCA 4ZPXA 5EXPA 4ZI2A 3E2IA 1B3QA 3K0CC 3A1VA 3Q72A 1XD2B 2R44A 4Q5IA 3G0HA 3N70A 3HJNA 3QKRA 1E96A 2PJRA 2QTVB 3VX3A 3CQTA 2EVWX 5KPDA 1NBME 4D4LA 2QPTA 2ZR7A 3GLHE 3QKSB 2YWEA 1U8YA 1HD3A 3SI7A 4ASUD 2DILA 2WAYA 1XDBA 1W5SA 2FMXA 2VF7A 4MGKR 4P4UA 1AN0A 1XTKA 4QGGA 2C78A 1P2TA 2FF7A 2F9LA 4PQFA 4QKQA 1K1ZA 1EK0A 4HVVA 5CM8B 1NMZA 4M53A 5LBIA 3I8SA 2B86A 2NTYC 3OAAA 1HEIA 2AN9A 3CIOA 3LX8A 1IXSB 4JIMA 1KSWA 4BRWA 2ODNA 3DDCA 2GJ8A 2JLXA 1RZ3A 1XTJA 1GWNA 3PXGA 1WA7A 4NP6A 3RHFA 3GLFE 1I07A 3FJ5A 1WMSA 3VS5A 1D5CA 1KJYA 4OMNA 1ZM7A 2CL6X 2OSBA 3FVQA 1XXHB 1RC8A 3KFVA 3UMFA 3LAWA 2H8HA 1AEYA 4HB0A 4C0QC 3IEVA 2HUPA 4LC1A 4BZPA 4A92A 1W4BA 4NYJQ 2IHBA 4ZKEA 1U9IC 2QN6A 4QT7A 3AB3A 4BFSA 4ZDJA 3IIMA 4R71A 1Q20A 1F2TB 1ABOA 1FNNA 1N5KA 4LV8B 3AKEA 2ZRDA 1QHXA 2AKAB 1LFDB 2DBYA 4AFQC 2XAUA 2YINC 4OQMA 4O3MA 2CHQA 5FI0B 3CNLA 2QAGB 3TBKA 4IJMA 1DO2A 3ZJYA 1OIXA 4FIDA 1MRNA 1NIPA 4DSUA 4XWOA 4Q18A 4E03A 4Z8AA 2WJHA 2WWYA 4C0BA 2FEMA 1NG9A 1G18A 2F2XA 3CH4B 4FW9A 4ITRC 4MKGA 4TQ9A 5H1YA 5JRJA 3NH6A 2Z4SA 2P6RA 2AK2A 2DX1A 2FSIA 1GUAA 2ZPTX 4O0MA 4WW0A 5FI1B 1TADA 1W48A 1JI0A 1AWWA 2J6FA 1E6CA 3I9QA 2B6HA 2D2FA 2O9VA 4JLNA 4JYCA 3RABA 3OIWA 5C18A 2V7QD 2C5LA 2NGRA 1SHKA 1S4QA 2GNOA 2F1HA 2WKRA 2WTUA 5JEDA 3PEWA 1G4AE 4BLTA 4LYAA 4PC1A 3CPEA 1MT0A 4K11A 2BZYA 1M34E 1ZAKA 3SEAA 1KSGA 1FTNA 1OPKA 2GJKA 4DUGA 2IBMA 4OK3A 1IN7A 3L0IB 2AFHE 1QBKC 4TSFA 3C15C 4Q9LA 5G40A 4Q1FA 3T5DA 3U7EB 1WXQA 4B2PA 2CNWA 2KBTA 2D62A 4F4IA 3GCGA 1MO5A 5J5CA 2ZQ5A 4GBMA 3PVSA 4EIWA 4BFYA 1M30A 3B1WA 2OILA 1OHHA 4PO1A 2BMEA 3Q85A 1M2OB 4ZV4A 4DDUA 1DAIA 5KYKA 1UHFA 1JQLB 1EFHA 1DAMA 4AG6A 1YKSA 2PLFA 3QKUA 1XPRA 1ZNZA 3MWJA 3EG2A 3U3RA 3DZDA 5BN3A 2EGAA 3GLGA 1SZPA 2C9OA 5IH2A 4P32A 3C4JA 3BE4A 1WBBA 1E9RA 1M8MA 2KB0A 3B78A 2ZAOA 4LY6A 4MDEA 3OEED 1Z6AA 5FTKA 4C4PA 4DC9A 2J41A 4O2RA 1H92A 4KLNA 2ZU6A 3KL4A 3QWYA 1HQCA 1OYYA 2IT1A 5G41A 621PA 3PR1A 4H1VA 1KMQA 5LPNA 1AZSC 3NKVA 2CLSA 3QBTA 1ZUYA 3REAB 5FPTA 3LVQE 3GJ7A 2EGEA 4IXMA 3SDZA 1X8JA 3TUZC 3PVLA 1ZD8A 3U61B 1M8PA 4D26A 4WVFA 1ZU5A 2Q9CA 3QY0A 1WYXA 2P2LA 5IF9A 2HF8A 4IOLA 4XOIA 1IONA 4F17A 2D0NA 3O5ZA 2WWIA 1IJEA 2D7DA 2AD1A 1P2UA 4HLCA 4HEJA 3TW8B 2MSDB 2J1LA 2PL3A 2AK3A 3CNNA 2WM9B 2ROLA 1J99A 1Y3AA 2FWRA 3AKYA 4YXWA 4Z51A 4HVWA 3RS4A 2BJWA 4B3DA 2ENMA 3KXIA 5KOYA 2I1VB 1S3GA 1TEVA 4RD6A 2GBQA 4M4SA 4HB2A 4JSTA 3BBPA 3N5CA 1HSQA 3K1JA 1P72A 2QMOA 1L7VC 4WZBE 1SVIA 2F2VA 3KJHA 4J0QA 1Q22A 4BFWA 4GZLA 2F43A 1J8MF 4PHHA 3AF3A 4DXAA 4UNNA 2K2MA 3CW2A 1KMHB 1E0AA 1CULC 1PKTA 4C0SA 3QPVA 1IO6A 3ZVLA 1DAHA 4RTTA 1EX6A 4K46A 1X6BA 5FUWA 4UNSA 4Q4HB 2Z83A 4EFMA 5AUOB 2F2WA 3OFND 5JLJA 2IYWA 3LX5A 3WRYC 2ZJ2A 2H18A 1HV8A 1NVUQ 2NO9A 5SZHB 1Z9QA 1J8YF 3M6AA 4BFXA 3QG1A 4F38A 1HJDA 5AUNB 1WX6A 1SXJD 2QNRA 5FWCA 2EWWA 2ZM5A 3KQUA 1M74A 4Z8YA 1GNPA 2W83A 2D8JA 4LUDA 4LBVA 1AD5A 3CX8A 2ZI9A 1KZ7B 4DWJA 2QAJA 3GBQA 2HT6A 2AHOA 2AXNA 4KYUA 3EPJA 1KSHA 3N2EA 3H1TA 4JYBA 2BMFA 4TT3A 1CIPA 2ZVPX 2C99A 4DLUA 1FQJA 4RCZA 1AWJA 4V0ME 1CRPA 4E07A 1OH7A 1R8QA 2YC2C 1AKYA 1XEXA 1NN5A 2FEIA 1X8KA 2HSPA 4IDOA 1GCQC 1YRBA 4D80A 4CEHB 1KK0A 4PAOA 2A37A 121PA 3PVQA 2WWHA 3RWMB 1VIAA 1E79D 3TRFA 1A7JA 1OEBA 4II7A 1UE9A 1S96A 3TE6A 4CYMA 2ZRPA 3TSOA 4US2R 1E0JA 4LYFA 1Z28A 4M1WA 1KYIA 1M27C 4KLZA 3CF6R 5H68A 1G20E 2FFHA 2QUZA 4NCIA 4XSGA 1TQ2A 2JLUA 3SQXA 4EJSB 5TB5A 4TWZA 4LJYA 2JIZD 1Z06A 3IDQA 4Q9KA 2BHRA 4PZZA 2KBEA 1OH6A 1OB5A 2JEOA 5IXBA 1PLJA 1PNJA 1SGWA 3EIHA 1F2UA 3I5RA 1U98A 4AK9A 4A8JB 3VS0A 4KHZA 2GVDC 2ZSDA 1X1RA 5GVSA 2JMCA 1YE8A 4PC6A 3T34A 5L8VA 1PWTA 4QHTA 5HTKA 5J4LA 2GA8A 2ZUDA 1GFIA 5FOUA 3ETLA 1E0KA 2Q21A 4JJKA 3K9HA 2GZDA 1YZLA 5TV2A 3IIJA 2B21A 2HF9A 3TVDA 1Z8FA 2HCKA 4ZKDA 5G53C 3VR4A 2QBYB 5B64A 4LV6A 4TLBA 3RNLA 1NIJA 2E1RA 3B13B 1XF9A 1TQ4A 3H0FA 4X8OA 2GJSA 1JR3E 1HA3A 1X2KA 5FOVA 5ANRB 1CLUA 1NVVR 3TH5A 1BH2A 1GSIA 1G5PA 2OHFA 4J9BA 1IQPA 2OE2A 3DEFA 4OJQA 4YDHB 2ZSEA 4A6XA 1KI6B 1YCSB 2EPDA 2FU5C 1UDLA 3CR7A 3RANA 4DLXA 2WSSA 2R6GA 5KNCA 4C0LA 1LB1B 3U4QB 1ZIPA 3WXMA 2L0AA 1OFTA 1E2MA 3SJBA 4KFTA 2O8DB 3QF7A 2GESA 1W6XA 2C77A 2JJ2D 2ODWA 3O8CA 3A1UA 3BB1A 5EXTA 2G77B 2H57A 1SHZA 1CP2A 4EPXA 2Q9AA 1VG9B 1R5NA 5JRZA 1TPZA 2YHSA 3KJIA 1G8PA 1BYUA 3MJRA 4OL0A 3VAAA 1Q3HA 1NKTA 2FSFA 1GKUB 1YRAA 1T5IA 2JAQA 2QU8A 4Q9HA 3EIQA 1IN8A 1E2NA 3G5UA 4GP7A 1SRLA 1JECA 2DFNA 4G1UC 4HZUB 4Z89A 3UK6A 4BE7B 2XX3A 3R9XA 4A36A 2IEYA 1U3OA 3EAQA 3QIAA 2O8FA 3WP0A 1Z83A 3ZLJA 1C1YA 1DADA 2GETA 3RRYA 3SHFA 3QBVA 1VHLA 5FBWB 3CZQA 4PHFA 4IRUB 1H8EA 4BGDA 4OHYA 1NKSA 2DWPA 4BLRA 2XTZA 4Z1MA 2OXCA 1WDXA 5E7IA 1JQQA 4NYMR 2QZ4A 1NY5A 2GNCA 1Y63A 4NCHA 3THXA 3NDBB 4J9DA 2V3CC 2XITA 2YWFA 3FHOA 4LYJA 3FMIA 4R98A 1K6MA 4I1OA 4CC2A 1N6NA 4H1UA 5I22A 2YWHA 3LBNA 4RZ2A 1NSFA 1YR8A 2GCPA 1BBZA 3IQLA 5LDDC 1G17A 2H1LA 5J4YA 1ESNA 5TY0A 2IXFA 1FMLA 1M3AA 2XJ9A 5C4MA 1J70A 3VR3A 3SJAA 3VHLB 3W6NA 5FH9A 4LPSA 2HJGA 1KNXA 3WP1B 5EUMA 3I61A 1I1JA 3EXAA 2DL4A 1H8HA 3FFAA 4HDCA 3U44B 1E2JA 1ZRHA 1N5LA 1OF1A 1XTRA 4RD2A 5FTNA 4KFUA 1YZTA 2XXAB 1EX7A 2GCOA 5K8IA 1TAGA 4RY2A 2EYZA 4TL7A 4LHZA 2ZI3A 3FMOB 1QDEA 2QA5A 3K0CA 4LHXA 2D4HA 1AWOA 5UKDA 2EYQA 3AKCA 4MITA 4MUAA 1DAEA 4A63B 1CXZA 1S9DA 2JCSA 1KI1A 3ONWA 4M1YA 4PQRA 4TMZA 3NC1C 5DHAA 3NVAA 3RS2A 4XVUA 2I4IA 5L3QB 2JM8A 1YZQA 1W4RA 1CS4C 1DBSA 1JPNA 4LNPA 2A7QA 4ZCIA 3FPAA 3LD9A 4ZI3A 4X8HA 5CJPA 3KQNA 1KO4A 2IS6A 1WE2A 1FZQA 2LQNA 1GRRA 1PHTA 1JO8A 2P4RA 3SHWA 1KDTA 1OFIA 3DM5A 3E70C 1Q12A 1XD9A 1KOFA 2K79A 2GQIA 2ZAMA 3L0OA 3L43A 2BBWA 2JLSA 3VNVA 5JCZA 2GZAA 2R8RA 3PITA 2FG5A 4B34A 3VHXA 4JJBA 1KKLA 2H17A 3C8UA 3OAAD 4YMUA 1N5IA 5ECAA 4IDNA 4TTPA 4K8OA 3AVVA 1GITA 2F1RA 2YKGA 2WPDA 1BO6A 3QE0A 4FN5A 2O8EB 4ESVA 1G64A 2AD5A 1UEIA 5J4VA 1PV4A 4RD3A 4HAVA 3NPFA 2EW3A 2QTFA 5JWHA 2RH5A 4GDFA 2JXBA 3I3SR 4LE9A 3KQLA 1I0CA 1OIWA 1G9XA 3RWOA 2DJQA 1XMVA 1KJWA 2KE9A 1G5RA 3K8YA 2VSXA 3EIEA 2SHKA 3REBB 2H5EA 2ZSFA 2GVZC 4Q02A 1U9IA 4QHSA 2GEUA 1YHNA 3B9QA 4JLAA 4NYIR 2XOKA 1A0NB 3S1AB 2RGAA 4NTZA 4ZIRA 3H41A 3SJZA 3L8ZA 3RS5A 3MGCA 1H8KA 1VPLA 4JLOA 4JVNA 4B3FX 4OQFA 1K76A 1MABA 4GZMA 1VG0B 4QBGB 1ZC4A 4JJDA 2X8AA 4TMKA 1OSNA 5I11A 4F14A 2WJJA 3TK1A 3UANA 1GBQA 4NL4H 4W9MC 3VS4A 4FSSA 1E1QA 1IXZA 3AEZA 3OZXA 1UKYA 2PZGA 1R8SA 3QXXA 4TTQA 2G1KA 4OQXA 1XZQA 2BVNA 1DVRA 2HDNB 1AIPA 1LF5A 2K6DA 5EJEA 4E6RA 2FH5B 2RB4A 5E3HA 2AL7A 1TEXA 3QKRB 1SVSA 2FGKA 2ATXA 1ZC3A 2XNSA 3KB1A 4DSTA 3UPUA 2VH5R 2ED0A 2QM7A 2IA5A 3WMFA 5BYJA 3B1YA 4B35A 1HTWA 4A15A 1KAOA 1XCMA 3EPLA 3NBYC 2D06A 3C41J 4DUGD 1AOJA 3U7GA 1NLPC 4OMLA 3PE0A 3T15A 3H0KA 3KFXA 1JXOA 5EE3A 2C8VA 4EKDA 1NBMA 4C0JA 4MRVA 3W8RA 5FTJA 2IF0A 2KROA 3GLHA 4MKFA 4HYYA 2CNWD 3W90A 2EFDB 4A1FA 4DLVA 1B23P 2CJWA 2V6JA 4HXJA 1JAHA 4FWIB 1DAFA 5EC7A 1T6NA 3THWA 1M3BA 1US8A 2RGXA 1AVZC 1OFUX 1OHHD 2PTKA 1JXMA 3GFPA 2D3WA 4R2IA 3BFVA 4TL6A 2HEQA 4PZYA 3CPJB 3QQ5A 1GRNA 1WDTA 1G41A 4XIGS 4OJKA 4Q1CA 4RKFA 5FOSA 2REXB 2CE7A 4P4SA 1G16A 3UXMA 1K4US 3G82C 3PFIA 1E9BA 2IW3A 5GVRA 4D8DA 1HE8B 4MYUA 2ZIAA 1KGDA 4B71A 3F0TA 3GLFA 1MV3A 2WWGA 3MMPA 4U02A 1S8FA 1Z6YA 1OLOA 1UKEA 3NMZC 1NY6A 2QM8A 3ZD7A 4WZAE 2J06A 4BZQA 2ZRHA 3EC1A 2CSIA 5J4HA 3Q3JB 2CSQA 2QGNA 3SZRA 2W6JA 5JJKA 2HYIC 1YQTA 4OHVA 2KEAA 4F92B 1H65A 2YT6A 3K0SA 1DG1G 4NKRA 4YMVA 5HZHA 2AWOA 1E3MA 1WI7A 4TLAA 4O25A 2P6NA 5DHFA 4MRRA 5JFGA 3KX2A 3TQCA 2WWFA 4OBEA 4A0RA 2IUSA 1SVOA 2YC4C 1LS1A 5FOTA 2JLZA 1KJZA 2ATVA 4DT1A 4QC2A 2ODBA 1QHSA 8OHMA 2RHMA 4RUGA 1N5JA 2ZYWX 4E22A 2KGTA 4EFLA 2YUQA 3FHTA 3VS2A 4YXWD 4AG2C 2NUZA 2FRWA 1ZU4A 3EZ7A 1YZNA 4WIAA 5L3SA 1Z0FA 4Y0VA 2YYZA 2Q3HA 1YVDA 1PJRA 5M04A 2JW4A 3T1QA 1N6HA 2PT5A 3RAPR 1OKKD 1TTTA 3TAUA 4Q1BA 2ERXA 2CT3A 3PV0A 4BECA 2YOHA 2GHIA 1G8YA 4GOJA 4DEYA 2NG1A 2GXQA 4CVNA 2WOJA 1TF5A 2G6BA 3DHWC 5ELXA 3OEHD 4CW7A 4LJ8A 3MCAA 2J46A 5EP4A 1FNMA 3H86A 2P5SA 2UVQA 4EUNA 1UM8A 1E9SA 2G0TA 1JEGA 1U94A 2UZIR 2PCJA 4JVMA 2EYXA 3DPUA 4NH0A 1DOAA 3IUYA 2OT3B 3LA6A 2QORA 2VA8A 2D2EA 2ZU0C 3GLGB 1UKVY 4A9AA 2TMKA 2WZQA 1AJEA 3MSXA 3BORA 4G5RA 1PVOA 3W5JA 1UJ2A 1LCKA 1CTQA 2ZI4A 2FOLA 4JLBA 1E6GA 2AKLA 1Q3TA 1VHTA 3C5CA 4TT3D 221PA 2IUUA 2JASA 1Z22A 3MD0A 3KQHA 4CF7A 3CWQA 4M9QA 4TQAA 1GCQA 3GJ8A 2J7KA 2P65A 4NYIQ 5FBLB 3U3JA 2RQRA 4TL9A 2EWVA 4X8LA 3VKGA 1S1CA 4M9SA 2BM0A 1Q57A 2N46A 2ODEA 4JLMA 3FWYA 3M0QA 2CK3A 2J7PA 3A8TA 1Q1ZA 1RI9A 2BBSA 4MA4A 4QHYA 2JJ1D 4C9BA 1E2PA 1V5WA 2J0QA 3DO6A 5IHKA 2LJ0A 3E5HA 4UJ3A 2R6AA 5BXQC 4TZ0A 2O2OA 1YZKA 2HEIA 3EGUA 2WIBA 2XTNA 3VKWA 3A58B 2CUDA 2GKSA 1M3CA 2GXUA 1AGPA 4JZKA 1T0HA 3PUXA 2P6UA 4XWKA 1AWXA 3AP3A 1MV0B 1ZCBA 2A5FA 1ZP6A 1R7RA 1W36D 1PLLA 1YZUA 5JJLA 4RTXA 3IHLA 1E0SA 1EG7A 2HYDA 2M51A 4XVQA 4D82A 1D2EA 1VDZA 1OXSC 4B73A 1SXJE 3X2SA 2ZUCA 4A2PA 4YMTA 1YNZA 3K70D 2DPXA 3GJ6A 2WICA 4GMDA 2RQVA 4LBYA 1PLKA 4V03A 3FGNA 4C2UA 1YWPA 1XJ0A 3P27A 1GTVA 3TUJC 3SOPA 4QM7A 3REGA 2JTEA 1KY2A 4M2LA 3MRSA 3BB4A 4URZR 2PBRA 1RRFA 2HJVA 4JJCA 4XSHA 4AD8A 2K9GA 4RTZA 1A82A 3DL0A 1X1SA 2XZOA 3RBBB 4OQLA 5CB8A 3D3QA 4DJTA 3VU9A 2GK6A 2AWNA 2WSSD 2H8KA 3QPWA 1QWEA 3H0HA 2C9CA 4DRZA 4TYYA 1XPOA 3FYHA 2MMGA 2O9SA 4D4KA 2IYQA 1NNEA 1KDOA 2OCYC 4TMVA 3O47A 5AUQA 5F98A 4BFUA 1NVXQ 2ZE8A 3SR0A 1AS2A 1Z0KA 1ONBA 3B1ZA 2UZ3A 1SSHA 2DF6A 1NL3A 2OZEA 1IAQA 2VF8A 3ZL7C 4IOKA 4UXJA 3TR5A 3WYAA 2FFQA 4B6FA 2ERYA 4C7OA 4DLWA 1W4AA 2YOFA 1VYUA 3OE7A 2AKYA 4JBYA 2QPAA 1ZUUA 1L4YA 1P2SA 1QHIA 1XEXB 4J9HA 2GAOA 3QI2A 3RNJA 4K81B 4OK5A 1P5ZB 3I62A 5EXXA 2NZJA 3A6PC 1W0JA 1CRQA 5C4GB 3Q5EA 4JS0A 3K0FA 1ZM9A 4KU4A 1L4UA 4Q21A 3W6OA 4XVRA 5IRCD 2YOGA 3QF4A 3FE2A 4V0MA 2EYWA 3D31A 3CRMA 3AGPA 2KE5A 1UJ0A 4M1SA 1YJ5A 2IK8A 4OI0A 1H8ED 5DGXA 2J0UA 3CX6A 2ZRJA 2H92A 3EW9A 4RCYA 2ZRGA 3I5XA 3PIRA 1U2RA 1UF9A 3KKPA 1G3IA 3PUYA 3EPKA 2GXAA 3X1XA 4AYWA 2LCSA 2ED1A 2C95A 2EFEB 5DN6A 2KT8A 1Z07A 5E7MA 1F2UB 4OMMA 2Q0HA 1W36B 1KAGA 2OO7A 1NJFA 5LD2C 5BN4A 4BPBA 3VR5A 5EE5B 4U7DA 3PUWA 3Q8XB 3QJYA 4JVLA 3AP1A 3AF4A 3K70B 3JVUA 5EZ6B 4AWXA 3M0SA 2IS1A 4LCBA 2ZROA 2WMOB 1BMFD 4M22A 1F3OA 3HDTA 1UUEA 4PSAA 4LOAA 1ZNXA 3ULRB 1RLPC 1G7RA 1RRGA 1V1CA 3JVVA 1SXJC 2CE2X 1MR3F 3HPQA 4LYHA 3RS3A 1UBGA 4N0EA 3LO5A 4LZZA 3QNUA 2RNAA 2W6IA 1GKIA 2ZJYA 5KDDA 2QQEA 3CO5A 1TF2A 1DTSA 4QXAA 3AKDA 1XEFA 2O88A 4LPKA 1JR3A 3VS6A 2RGDA 3UIEA 5H8WA 4IIOA 4JLJA 5D3MA 4DCSA 1WQ1R 5FPYA 1VMAA 2V1UA 2HXYA 3I1FA 2AFIE 5JHGB 4NE2A 3A36A 4IEEA 4KFRA 5IK2A 2BMDA 1L8QA 4ZNXA 4DCUA 1N6RA 1R0WA 1LTQA 3GP8A 2QP4A 1T4GA 1Z9ZA 2ONKA 1XCPA 3B2EA 4NZYA 2KRSA 4F16A 2IHYA 2SEMA 3LH5A 1KI3A 3GEHA 3HR7A 2XZPA 1Z6GA 4OHWA 2DNUA 2E87A 1KO7A 2FX3A 4L9SA 1XJCA 4OYHA 1W2HA 4PPFA 3U6BA 3I35A 3Q9LA 2AXPA 2C0OA 2IYRA 5EE9A 2PMDA 4P3YA 3GLIE 2O8FB 2J7IA 4LWZA 4AYTA 3H2YA 2LZ6B 2QMHA 1R0YA 4PR0A 1GCPA 5DIFA 1XU4A 1XCGB 2OFWA 1QHYA 3W3ZB 2VP2A 4IXNA 1W0KD 2ABLA 2G83A 2QQ0A 1EESA 4O2LA 4ORZA 4AY2A 3THXB 4MYCA 4DVGA 3R7WA 3EG0A 1VA7A 3B9PA 3PUZA 4G5QA 1AZGB 4R0KA 2RGEA 3I32A 1N0WA 1RVDA 1AQUA 1NMXA 4US0R 1N6PA 2XOKD 3OESA 1Z29A 1MKYA 5TDHA 2XB4A 5K8LA 2VSOA 4WOPA 4OQNA 1CJTC 5CJ2A 5FUVA 2VVKA 4D0LB 1UDWA 2H16A 4L4UA 5CIWA 1GFDA 3IKJA 3L0PA 3X1DA 2GJAA 2FA9A 2I1QA 1KK2A 1P3JA 3QPUA 4MRNA 4NBSA 4DCNA 4P31A 2K5UA 4AC9A 5K8UA 2FPLA 2C0IA 4PAQA 3L82B 1JU5C 4GP6A 4UNPA 1WBDA 1GRIA 2HDAA 2A28A 1Y0MA 2V55B 3ZH9B 3AM1A 1XWIA 2GK7A 3C14C 1B07A 1E4VA 1K5DA 1UDXA 2GCOB 3T06B 1G19A 2FZ4A 1UFFA 1KI2A 2DY1A 3OIUA 3W34A 4ACBA 4DLTA 1OJLA 1ZNYA 1I4LD 2O8CA 4Q00A 5TARA 4LGMA 1EFRA 4J9IA 4EQ6A 3BH0A 3EZ2A 1II8A 4QL3A 1E94E 1ZUIA 4M8NE 4LSGA 1KY3A 1RLQC 3FKQA 1AZEA 1JJVA 5FL7A 5KHOC 3CRRA 4LRWA 4TMTA 1B0UA 3DVLA 2YZ2A 4QJ5A 2BOVA 3T61A 4TL8A 1D2NA 1OXUA 2EFGA 2RF0A 3RSOA 5GJCA 1SHGA 5FOXA 1KI4A 2CEAA 2JJ8A 1ZSGA 2FPFA 1NBMD 1SVWA 4D25A 3OIYA 4JJZA 4I1SA 3QVUA 3R9IA 1BK2A 1ZCAA 1OV3A 4RTUA 1XNJA 2OV2A 3RS7A 4QOSA 2VWFA 4NPHA 3KKOA 3B85A 4IEIA 4V02A 4EFNA 2VHQA 3DKPA 1HYQA 2RPNA 4HDQB 4CIDA 4UQOA 2NIPA 1YR7A 4FMDB 3W8NA 3T1VA 4NHOA 3SS8A 2L2PA 1VCIA 4EDHA 2V8OA 4CDGA 2PZEA 2EVRA 1CJUC 2REOA 2V6IA 3BERA 5AWFC 2YV5A 1CU1A 1XD8A 4Q9IA 5F2EA 2IC5A 5KSPA 1CJVC 1Q1QA 5LB2A 2YNMA 1XEWX 3WMEA 3ZIAA 1LVGA 2AX4A 3EA5A 4ZIRB 3THYA 1MRSA 3LQRA 3MG9A 2FG0A 2VPPA 2BDTA 3PENA 4FMCB 5GJWC 3ZS8A 3GMTA 3EG3A 2W6JD 4UNRA 4NCJA 5EE0A 1G83A 1D9XA 3LDAA 3AQ4A 4AKHA 5GJVC 4M1MA 2B92A 4MQBA 4MRPA 2GXSA 1CR2A 4J9EA 1C4OA 1VKJA 1N25A 4AFUC 4QG7A 1G3QA 4Y92A 1CEEA 3RSLA 2GTPA 5DISB 3CX7A 3K0AA 5P21A 4CEIA 4GLMA 5DYIA 5AJZA 3R8FA 1U0JA 4Q1DA 4LBZA 1PRLC 3UMSA 1E2DA 1F48A 3KDSE 4B2LA 1E6HA 1TU4A 3CF2A 2ORIA 2SRCA 3O8DA 4KYIB 4FCVA 1U8AA 3CB4A 5AK0A 4WA7A 4BLPA 5BW8A 1HUQA 5JI3E 3ADBA 4GPTA 3X1YA 5JECA 1UKZA 1M7HA 1XB2A 3QXCA 1AS3A 2RN8A 4PXAA 2G88A 4LN2A 2FPMA 2R65A 3QKTA 4ILEA 1XTQA 1G21E 1HURA 1GVNB 2IWRA 4H9GA 2EKHA 2MIOA 2LKCA 3GJ3A 3A1SA 3RC3A 2EGCA 1P6XA 1QG2A 1Z6XA 2E9SA 2VEDA 2VHTA 2WKPA 1RUWA 3F8TA 3RLFA 1NI3A 3EASA 3GLHB 3KTAB 4NCKA 5G3ZA 4CZ2A 4AKGA 2FDCA 2CJWB 2BZ8A 4DKXA 4JZ4A 2CCGA 2CCKA 4MYHA 5HKKA 3QUSA 1P75A 3THWB 3K09C 4ON9A 1US8B 4B3CA 1E7OA 4MH0R 4EPWA 2W10A 2ESWA 4LI0A 5E4FA 1FX0A 2F55A 1EFNA 1E98A 3DOEA 5CYPA 5CM9C 2GJ9A 2RQTA 3M0PA 4DSNA 1VYTA 3CUEF 1N6OA 4P4SB 4QGFA 3TW4A 4OKSA 2BZXA 1VTKA 2DYKA 2REBA 3VRYA 4KODA 4RFVA 3KKMA 2QDLA 5DLQC 3GLFB 4ABYA 1OH5A 3FHCB 4N3NA 4DIDA 2ZRIA 4V0NA 1GL5A 1ZD9A 5FPSA 1RPZA 2OM2A 2JT4A 2QPOA 2R6CA 4A0FA 1TUCA 3NBZC 4M21A 2JS2A 1IY2A 4QNRA 1A1VA 1BYIA 2JA1A 2FRYA 2X2FA 2J59A 4A6PA 2QY9A 2WMNB 2VRWA 1QWFA 4JBWA 2MMCA 1FUUA 2A36A 2VYFA 2F7SA 3VR6A 4BLSA 2AZVA 1F60A 1G8HA 4TMWA 2FEOA 3UF4A 1OXXK 3MWYW 1X2QA 2DBKA 2QRZA 4LJ7A 4Q7KA 2CK3D 2J7PD 4C2TA 1AA9A 2BJVA 4FCTA 2RHDA 4PAMA 2G9NA 2J5XA 3M1IA 4HB4A 2O0KA 4QBHA 1ZLMA 4ZCLA 1I2MA 1XTIA 3AVPA 4HATA 4Z54A 2ZS9A 4AIIA 4DT1B 2V7QA 1T3SA 1C9KA 3EZ6A 1NN1A 2OCAA 2DB3A 3U23A 2YJTD 1NLFA 3CZPA 2X3XD 3I4LA 4CEJA 3CRVA 1G7CA 1W4CA 1MOZA 1GOTA 4FMBB 1U0HC 1S0UA 4TLDA 1E2QA 4FXPA 1KIKA 4TLCA 4HSEA 4URUR 3U3OA 1WRBA 4N1AA 5JEEA 3REFA 1WXTA 2ZUBA 1ZVQA 3RRMA 1GL6A 1XXHE 2EYYA 2JATA 1ZUNB 2ZYVX 4Q47A 3WBKA 5IHPA 1E2IA 4KITB 1E9CA 4QM6A 4AG1C 1UFQA 2NO6A 1GP2A 3GJ4A 5CITA 2BC9A 1CJKC 3THOA 5L3VA 3ICQB 1SVLA 2DWQA 3FB4A 1IXRC 1RE0A 1R10A 2JLYA 4JLKA 4LHVA 1IOZA 1FMKA 1NF3A 3D7MA 1DAGA 2DHRA 3TIFA 3CONA 5FWBA 4B44A 3NEYA 1ZJ6A 3P20A 1L2TA 1MUZA 4TQUS 3BK7A 3AV0B 5B57C 3AVOA 3KQKA 1NMYA 5JJIA 1TL7C 1W49A 2IYVA 4IVPA 2ZJOA 3NBXX 4JMPA 1K0XA 3L8YA 3PCRB 1QVRA 1ZMXA 3C5HA 3RYTC 4RTYA 4FI3C 3VRZA 2CDNA 1SEMA 1OH8A 2DL3A 2GDJA 1NG1A 1G8GA 2KBFA 4JLVA 2LP5A 721PA 4RD0A 3UG7A 3QXJA 3R9WA 1G291 2J9RA 1LNZA 2CHGA 1CBUA 1E9DA 1KK1A 4Z88A 1W0JD 1NYGA 3TR0A 2MCNA 1R4AA 1XEWY 2ZRFA 3RC8A 1P62B 1WXBA 4C0KA 4PTLA 2D7CA 3AGQA 3KUDA 5B58C 2ORWA 3VKHA 1OT3A 4AG5A 4PC7A 2JLWA 1D6JA 1EFCA 1RRPA 1QKXA 1OE0A 2OAP1 1YZGA 1T0HB 3A37A 3EWAA 1RFLA 1VCOA 3P32A 1T91A 5DN6D 1Q0UA 1S2MA 2KSQA 3TMKA 5IHNA 3C7KA 3I72A 4LHWA 4QFMA 1YP5A 3M0RA 1W1WA 2ZANA 1LV7A 3NG1A 1T5LA 2ZVQX 3FFBA 3A4MA 1TUEA 1O87A 5JS8A 1COWA 2J0VA 3TLXA 4TYNA 2QMEA 3RRNA 3LVRE 1EWRA 2KXDA 4UXIA 3WYFA 3X1WA 4IFEA 1D9ZA 2ECKA 3GJ0A 4W5JA 1PUIA 1UHCA 1S1MA 2BMJA 2XEXA 1RJ9A 1NLZA 2Y8EA 3NH9A 2RMOA 4PPNA 4TSFD 1UBCA 1EGAA 3GJXC 3QWXX 4EPYA 1IJFA 1JPJA 3HR8A 2W2TA 5FPKA 3B5JA 1NLYA 1QRAA 3QVVA 4LC0A 3VTKA 4HAYA 4RTWA 1FOEB 1SXJA 4Y0AA 3SFZA 4Q9JA 2CH4W 3EHQA 3SE0A 1K0SA 2GGRA 4E5UA 2IEZA 3EWSA 2O8DA 2XNDA 5KDLA 2ZRNA 4XD7A 4WAUA 2VSFA 4HDOB 4BLQA 2W6ID 3ICEA 4M4ZA 4JSYA 3VU9B 2V1RA 1JJ7A 1X8LA 2FV8A 2Z0MA 4QJ3A 1KO5A 2OBNA 1G6OA 1JR3D 4TYWA 1OXVA 2F1IA 1QHHA 1Z0IA 2NPFA 2BTTA 1U5SA 3ZVNA 2A2ZA 2C0TA 4F4JA 3HU1A 1BS1A 4JT2A 2VBCA 4AFSC 4KVAA 4W5HA 5HE8A 3RRZA 2C04A 5IK2D 2ZITA 1II9A 3AP2A 3NHBA 4LJ5A 4C7OB 2WJIA 2XMFA 1RYHA 1YWOA 1E2EA 2DM1A 2QAGC 2ZSAA 2OLJA 4DLSA 2NMVA 4BEJA 4M1KA 3VFDA 3GQBA 3NBFA 4DB4A 1XRJA 1X69A 2QP3A 1KK3A 1VG8A 1ELOA 2CT4A 1G4UR 2QSYA 3A4LA 3K0FB 2KNBB 2CMKA 2RGBA 2FFBA 3BC1A 5K8TA 3O8RA 3QF4B 1IY0A 4WCIA 1PUJA 4PHGA 5BYKA 4IIMA 5EXSA 2W00A 4RSGA 2ONJA 1NJGA 1K9AA 2ANBA 2IX3A 2GRJA 2J0UB 4HAUA 2DR3A 1OB2A 1U06A 2WJVA 2W2VA 3K9NA 2IYUA 3QOFA 3K9LA 4QGAA 4BRUA 3QEJA 3WHKA 4BWYA 3AUYA 3SNHA 1ZM2A 4DDTA 1VIYA 1EWQA 1Z63A 5CLQA 1OW3B 5HE9A 4BFTA 5JZVA 1RRCA 4MDFA 4QJ4A 3BIFA 3K70C 2FPEA 3TSWA 1WP9A 4RZ3A 1ZYUA 4LV5B 3A1TA 5JSZA 5EE1A 3EPHA 2F9MA 2YUPA 2OAQ1 2WAXA 3QG5A 3U44A 2R6FA 2JLRA 4TYQA 2XJ4A 2A5JA 1YR9A 4RVCA 1SPKA 1IN6A 1ZBDA 2OXRA 5BN5A 5AJWA 2ZRBA 3DM9B 1NRJB 4QBFA 3C0CA 2FE4A 2DFKB 1OPXA 2MOXA 4BFVA 1E1RA 2FSGA 3R6NA 2IIMA 5L23A 1J90A 1LW7A 2O0JA 1ZX6A 3BWDD 3EZ9A 3NEJA 1CKAA 2J0SA 4ERNA 5SZKB 2IWHA 4B2IA 3B7GA 1SQ5A 2RQWA 1EFRD 1LS6A 1MV5A 5JS7A 4B3XA 4P0TA 1WXUA 2O52A 5AUPB 3AVQA 2B7CA 4QRHA 1X3SA 3F5FA 4UXHA 4XH9B 5D3MB 5FL7D 4LX0A 2XSZA 4DDWA 1A2KC 1KI8A 1T3HA 1P9NA 1OXTA 1HQYE 1U0LA 4JVSB 3DMDA 3TVTA 1JB1A 2P5TB 2PT7A 3MFYA 4CC7A 1DELA 1W5TA 4KVGA 1ZM3A 2OBLA 4B43A 1CKEA 2GILA 4HLUC 1BB9A 3H0IA 2WKQA 2Z43A 4R9UC 5FUXA 3CLVA 1W70A 1SVKA 1YR6A 2ZRAA 4G5SA 1RW4A 2PZ1A 3WYGA 4LK2A 5TVKA 2WJGA 1T9HA 1CR1A 4RZUA 3NIBA 2V54A 4HAXA 3KKNA 3R8CA 3ADKA 1FFHA 2RAPA 4IOMA 5DO9A 3CM0A 4XTRA 4JKIA 4IKEA 5DI9A 1HE1C 1MO3A 4FD2A 2IYZA 1GZSA 2HV8A 1GBRA 2OFOA 2WOOA 5AJXA 1IHUA 3S1AA 3GLIA 2OI3A 4IDQA 1FQKA 3R7WB 2VP0A 1P2VA 1WF3A 4JLDA 2VP4A 2DL8A 1U81A 3JZMA 3Q7PA 5HCNA 3B6EA 2ZRKA 4Q1AA 4C30A 1X6VA 1XMIA 2K7AA 3ZIAD 5BWMA 3Q5DA 1FTSA 1Q1BA 1W47A 3SYLA 4LJ6A 1P4SA 1QZXA 4IW3B 3ND8A 4B75A 1LF0A 3AF1A 3U3MA 2YUNA 3UMRA 2D74A 3WMGA 1N0UA 3BOSA 2NZ8A 1W44A 1TUIA 4I1UA 2KRNA 2C2HA 4DCVA 4ARZA 2G0NA 1AS0A 1MH1A 2F43B 3OHMA 5HCIA 4JL6A 5CK5A 2ZS7A 1UTIA 1II0A 1T8UA 2JDIA 2QROA 4B33A 5FBRB 1IY1A 2HLDA 2XZLA 4TTRA 3EHRA 2J87A 3RDPA 5BQ5A 5AJYA
chains in the Genus database with same CATH superfamily
3ENVA 1VLLA 4FN4A 4I55B 3R75A 4FDTA 1N5MA 3QWFA 1RCUA 5LJ3d 1ARKA 3IV6A 1TUDA 4PN3A 2J6OA 4U63A 3SVTA 4L75A 4ZYLA 3EGIA 4DWVA 1H22A 2A78A 4UKDA 3DTVD 1XA3A 1ZS9A 2R84A 2X9HA 3EEFA 2E3JA 5TJ9A 4I9FA 3S1LA 1DARA 5F1KA 2X1VA 5AKEA 5EPUA 4S0ZA 1KI7A 3Q12A 2E4WA 1QRRA 3R0IA 1UKAA 1IBRA 4N7JA 5LUBA 5KQRA 4OXRA 4KE9A 4V24A 4AZ0B 4ZD6A 5K9ZA 2XGJA 1JIJA 1Q95A 1KO8A 5GAMd 2VSNA 1X27A 4CIXA 4MW7A 1X1CA 3E3OA 3UQYS 5IP5A 3TNFA 1IL0A 5AKZA 3HA2A 3DLAA 3PSHA 5I4KA 4FCWA 1G1MA 1NJIR 3L1UA 1Z4NA 4KWTA 4XD2A 1NN3A 1GCOA 2VXCA 4J90A 4CMKA 3PL5A 1FX0B 2LJ1A 2WJAA 1ZSZA 4OBXA 3AOEA 3MWKA 3WKDA 1S7CA 2Q9UA 2ZZNA 2P2YA 3R44A 2BEKA 4XIIA 1T9CA 4DYHA 3GRKA 1E6EA 5LJIA 1WEKA 4D9FA 4FGKA 5FBVB 1PJLA 1O94A 1TDJA 1IVNA 4JUCA 4WZAB 3DCYA 4AW9A 3WGZA 5EAIA 4YRSA 1WJQA 1Z2CA 3F73A 2G08A 2XDAA 4RD1A 4N4AA 4YCCA 1CDDA 3ZWVA 1Z25A 2OBMA 1I2DA 2WQ6A 5CQYA 1C80A 3E4CA 1BWRA 2IXGA 4KAXA 3K8ZA 1N1EA 3OT1B 1E89A 4BE0A 2ZB7A 4M1TA 4J9CA 1AH2A 2LQKA 2VXEA 1DJQA 2GPNA 2PYDA 2CMGA 3WK7A 4XWAA 3N53A 4FW2A 5JBQA 3OCJA 4H6VA 1JBQA 2I78A 4DYDA 5LMUB 3CLUD 1UBMS 4KE7A 4RHXA 2EP8A 3JWPA 2ZLBA 5F3WB 3ZVRA 2DULA 1WDLA 4KE8A 5JANA 3I3OA 2WSBA 1DEKA 3C39A 5I9SA 4PAGA 3S29A 2QDYB 5SY9A 2QQFA 4WZZA 1NHWA 1HZZC 5DCUA 1ZCJA 2SCUA 1EWTA 2PD3A 3SZMA 4JWKA 2MSCB 2FRDA 2O59A 3OOHA 2VQSA 4DRXB 4NWIA 5DWDA 2IHNA 3IBYA 2B8WA 2H1FA 1CV2A 1CQJB 4C8QE 5EOVA 2EFCB 2BFFB 5REQB 2DRMA 4I3GA 3N8DA 1QK4A 3ES9A 4NDZA 2RB6A 1SO8A 2FGJA 5GOTA 4C3VA 2E1PA 3IKMB 3CNOA 5FV7A 4PNZA 1R74A 1FFBA 2FMFA 4LXCA 1N7JA 1KARA 5FORA 2CREA 4E0BA 4DMRA 1A8UA 2BSAA 3SIXA 3UJDA 5L3SB 4KQMA 2A33A 2ZXUA 5IZCC 2C57A 4K9NA 2WB2A 2CKKA 4LHYA 2FG6C 5HIJA 2GAAA 4BEBA 1TGVA 4YRGA 1X9HA 2X14A 4KSBA 1X80A 1NE7A 1D0ZA 5CGZA 1BS9A 1ISGA 1D3BB 2VWHA 2RCNA 3G2MA 4U5XA 3BXGA 3T9CA 5DYGA 4IWNA 3ECSA 1Z45A 4RH1A 5CK4A 5CMLA 4BNGA 3Q9SA 4L2IA 4R83A 1PFYA 2L42A 1PKXA 4E1AA 5KYUA 1U0FA 2P8JA 4GOLD 3HPWA 2ZPEB 4LXUA 2I62A 1PT7A 3VYSB 3PCXA 2ZIWB 5JPIA 2EBUA 4FXOA 3ZQ6A 1Y4ZA 2A08A 4NL2A 2Q0SA 2LRHA 1VQ5Q 4X8MA 1M2FA 2ZJFA 2WV9A 4D9MA 1Y6ZA 3CKLA 1NW6A 3CRZA 2PXAA 4S2EA 3KTAA 4MA0A 3QQPA 5AXAA 5KPJA 5IU6A 4DPLA 4MUBA 3X1ZA 4EA7A 3VO8A 3OOYA 4JJEA 4EOGA 2QT9A 4I50A 1DZ3A 3KSUA 2YBDA 3IURA 3UWKA 2ZT7A 1T13A 5TGDA 4X6YA 5FPHA 1AUQA 3RVMA 4Q03A 3K6SA 1NZ9A 4IEFB 4RF3A 2XXAA 4ER5A 2E5KA 2P0QA 4NONA 3R5XA 1K6IA 1YE3A 4RD4A 3T54A 3EC2A 2MCFA 3EX7C 1H6AA 1KMMA 2CVPA 1W46A 1XTDA 1I7PA 4KGDA 1G8AA 4H3KB 4ZWNA 2WMDA 4QODA 2R58A 3L7BA 2DY0A 1K7SN 3LUHA 5DV9A 3K9GA 1LDMA 3PJRA 1X74A 4A4FA 3DMNA 4EW2A 1CW2B 4D6PA 2KLHA 4NFSA 3PICA 1NOJA 1NN0A 1Y1PA 2DQSA 3TM5A 5AW8A 3LW7A 2C8LA 3GGJA 3UT0A 1ZSZB 4DLRA 3QLUC 4HFRA 3JY6A 4O4IA 4WSOA 3WYDA 3OZDA 3T0FA 4ZPXA 2KK4A 2FB9A 5FWYA 1SVUA 1NMQA 5KPDA 1ZX1A 3GLHE 1V41E 1DC3A 1HD3A 3MVEA 2OSVA 1A9SA 4GS5A 3WL3A 2Z57A 1T26A 4GIBA 2C4VA 2Q3CA 2W22A 5A4DA 1WMSA 1ZM7A 1UXHA 3PPIA 5GAN3 2XY4A 1H93A 1NFQA 3SXJA 1APBA 3PFBA 2XKBA 1XLTA 5BSKA 1UK6A 3GJSA 1SC3A 1YD7A 3ZJYA 4WY2A 3CH4B 3JZDA 4MKGA 3NH6A 1LC0A 3BAZA 4CMEC 1E6CA 2B6NA 2OBXA 1H6CA 9LDTA 5JEDA 3H9CA 4X0EA 2AMYA 3CPEA 4II1A 2BZYA 3RREA 2G72A 5DNWA 3U7EB 2ODPA 4PS0A 5T4EA 4RGQA 2KBTA 4RF2A 3GCGA 1J56A 3DWEX 1OHHA 3OPQA 2BFMA 2YXNA 3K05A 4CU2A 2EGGA 4GEGA 2ENWA 1ATIA 1ODLA 3DBRB 2ROQA 3S68A 4PVCA 1AZSC 2CLSA 3ZI0A 5ICMA 2EGEA 3IX7A 3TUZC 2H2IA 1WMDA 1ZU5A 1O95A 4JC4A 3TIIA 1U1FA 4KIUA 4C1NA 1RBMA 2WD8A 3HJFA 4PSDA 1L5FA 2X8LA 2QTRA 2MSDB 2XNJA 1PR1A 3CMCO 5AHOA 1RYDA 3PFFA 1S3GA 3LT5A 2GBQA 3DPIA 4DQ0A 1SVIA 1RZUA 3GP3A 4UVIA 4BFWA 2Z3VA 1E0AA 3QK7A 4I6EA 3W8FA 1X6BA 1M5RA 3ZJ4A 3N5BB 3DYIA 3DV0A 1AQJA 3N2GA 3S99A 4JNKA 4B46A 5FWCA 1NV9A 2ZM5A 2Q62A 3ZNPA 2PKQO 2EJWA 1X80B 4V2SA 4GXRA 4HF7A 5DULA 1X38A 2JCGA 1E77A 1D3AA 1OR8A 1QKKA 4J1SA 3P9XA 4ZAWA 2F3UA 3TSOA 1EVYA 4TWJA 4EENA 1ZQ1A 4RL4A 4W5RA 2BRUC 1KEUA 2EJUA 2PS0A 3LC0A 3OFSA 4Q9KA 3ZZNA 4L2IB 4GP9A 5KYUB 4IINA 4X7BA 1J2UA 1ZVVA 1VQMA 1E7WA 1BFUA 2CUKA 3TVDA 4JJIA 4EZBA 4QZVA 2E1RA 2GEJA 3ZBPA 2Z6AA 1JR3E 5FOVA 3R0VA 1CLUA 5ANRB 4ZJYA 4N3AA 5D01A 3CR7A 5LDHA 1JT9A 2AE1A 1E2MA 2KY9A 3QF7A 5BWLA 3D6AA 4FUQA 3DMTA 4CL0A 3K1TA 1Y1SA 3KJIA 4QOEA 3CCUQ 1RHJA 2B99A 1ODTC 3OYLA 5GV7A 5IM4A 1JECA 2BMWA 4V0SA 3HNRA 3B8EA 2JVJA 3ILSA 3O8NA 3PRKE 3I0ZA 4DR3B 1TKAA 3A4TA 1PS9A 3DR5A 3OCUA 1UP4A 2XITA 4I50B 1JS1X 4R98A 1U6JA 2G17A 5ES3A 3ETHA 3IQLA 1G63A 4HWKA 2QR3A 3K6SB 5E9AA 1TQ8A 1E2JA 2XXAB 2GCOA 3LL4A 4RY2A 2EYZA 2RAFA 4JI3B 5ER9A 1DPGA 4L59A 1Y6RA 4R8RA 4Z7QB 4WLNA 1NPRA 5LZ4A 5I5GA 5BRJA 1GRRA 3TUJC 4O4HF 5AT1A 2GZAA 3SEFA 4RMNA 1DKNA 3K20A 3HP7A 2RAUA 4JR0A 3G2JA 1RRVA 1RBZA 3HMQA 1G64A 3EB9A 2O14A 3FPBA 3J81E 2RGYA 2OGUA 3HA5A 2AC7A 2IX9A 3PGXA 3CTMA 1G5RA 2C8KA 2JJQA 5AXCA 2RGAA 1ZHFA 3H41A 4ZTUB 2COKA 4O4IB 2OTLA 4TMKA 3WGOA 1D0SA 3SP1A 5BQFA 4M7DA 3MJVA 1CZLA 4FSSA 3NTLA 4N03A 3ROZA 3IP9A 3R9KA 3ZWXA 5J5VA 4HDRA 5FWYB 1PR6A 2ISSD 3KB1A 2X6RA 3MTEA 5F64A 3A7EA 3H2IA 3AB7A 1AOJA 3RNOA 2R87A 4RBNA 4EKDA 5ALQA 4OHMA 3CH6A 3BZUA 1VBMA 2GRUA 3V34A 1P0MA 1M3BA 2P4TA 2VF2A 4M55A 5U4XA 3GFPA 2V45A 2ZQYA 3LTEA 3PFIA 3G82C 2P68A 3OUTA 3AK4A 5FAKA 3JD1A 4GQBA 1LUAA 3Q3JB 3M89A 2KEAA 3DOUA 4MNTA 3TQCA 1SVOA 4QC2A 1C3JA 1UWVA 5EFZA 5BMVA 5BO5A 2NSYA 1FS6A 5CCBA 3KSZO 3P71T 1NWHA 4RH0A 2ODTX 2K57A 1I6KA 2EG9A 1NBAA 1ZUNA 2V7BA 1IRIA 2CFSA 4CW7A 5HP4A 5HJ5A 4ZXFA 2PCJA 1DKUA 1SCUA 4DJFC 2QORA 2D2EA 2FK8A 1KDVA 2TMKA 3B3AA 1KZ1A 3DLTA 4RIGA 1A5ZA 221PA 2JASA 1V95A 3EYWA 3A32A 3O84A 1E58A 3OH8A 1HX7A 4E3ZA 2PQ0A 8MHTA 3G7UA 1SPBS 2CK3A 1K86A 5B4TA 1YFLA 5AI6A 1LX7A 1KXJA 2E1HA 1BU5A 3EVCA 4WCFA 2HPAA 4MVJD 1R7RA 2EW2A 2HYDA 2WPNA 3ZK7A 3WMXA 3X2SA 1KWGA 5BT9A 2WHRA 5CH8A 3CMMA 4LGVA 2VPYA 4JJCA 2ON6A 5IUNC 1IB8A 5LUAA 3DV0B 3D3QA 2AWNA 3N2GB 2ZXFA 1W6UA 3FYHA 2O9SA 2ACVA 2HU5A 3GNFB 1AS2A 4YRBA 1XP5A 4UM7A 1HKUA 4QTUB 1A88A 5HHTA 4C7OA 3E6AA 1W4AA 1U2ZA 1P2SA 3CC4T 2MPXC 4F04B 5AVRA 3E9GA 2BKXA 3DBLA 3FE2A 4V0MA 4WLUA 1B42A 1U0OC 2VV5A 4RKQA 3DBHA 3EW9A 4RCYA 2FE1A 3CJTA 3KKPA 5DLYA 4DR6B 1QGED 2ZAGA 3TTVA 5U9CA 5EINA 4U7DA 3OZCA 1BMFD 3AIKA 1F3OA 3P52A 2XUOA 1ZNXA 3ULRB 1RLPC 3DCNA 3JVVA 2O1WA 3LO5A 2JFPA 2FR8A 5DHUA 4DCSA 5AKXA 4N6NA 5JHGB 1B34A 2PUGA 4GHWA 2DNUA 1AN9A 5BNFA 3I35A 2D5IA 4RTNA 3M5PA 1MAVA 1XCGB 2ABLA 4FZVA 5FULA 3R7WA 1Z38A 1XTPA 1I5LA 1W19A 4AF6A 3ORSA 5TQ2A 4IH4A 4BATA 4YUVA 1QPBA 3PI7A 3D0QA 1QZTA 5A03A 1P3JA 1D2AA 3JAMA 1B6SA 1OD6A 4TKZA 1UC9A 1UDXA 2GCOB 5ICEA 1G19A 2FZ4A 4HV4A 3VJRA 2R1UA 1KS9A 1EFRA 4FR2A 4FJ2A 2H3HA 1ZUIA 3LLSA 4M8NE 1NURA 3GLUA 5KHOC 3DVLA 3T61A 5AOAA 2AQIA 4WOKA 1MAWA 1GVHA 5AT1B 2PKRA 5A6SB 4DANA 3JALA 1ZCAA 4UBMA 3RS7A 4KT0E 4HH0A 3LRXA 3V7NA 2WIFA 4UQOA 4MI1A 3URMA 1PR3A 4F11A 3DQZA 1HWYA 5KSPA 4CQLA 1CJVC 3HYSA 3L9XA 3I83A 2JHFA 1MRSA 3PENA 3ZS8A 4NCJA 4B82A 4HH1A 2B92A 2V58A 2IW1A 4EUKA 4M7DB 5EPOA 4QG7A 2B9EA 2C0PA 4HX5A 2P91A 2A14A 1EXWA 4FS3A 4YFYA 4WKPA 4CWAA 4RKUE 4G1CA 5BW8A 2E70A 1WCXA 1UKZA 5JYCA 4YYZA 3JCMQ 1YQXA 2GWRA 2EGCA 3GRCA 2E9SA 3NHRA 2PMFA 2CP3A 4ITUA 5DZSA 1BFDA 3M49A 1EFNA 3AI2A 3M0PA 4G26A 3CUEF 4QGFA 5D5HA 3MP8A 3G4SA 4EVRA 3U80A 2XW6A 2QRVA 4WHMA 1G8SA 2X2FA 2I91A 1FVFA 2JCVA 3QV1A 3MWYW 3D3WA 3E3NA 2MSWA 3QFSA 4KQ1A 1ZLMA 3N7UA 1ENYA 4RVNA 1E7MA 2ZS9A 2V7QA 7AT1A 1E2QA 4TLCA 1KIKA 2DHDA 1WRBA 2VOJA 3GARA 3FUXA 3WKCA 1ZUNB 1S7GA 2VLBA 1DCFA 4S3MA 5JNRA 1FMKA 4B5LA 4LJRA 3PRJA 1ACLA 2ADMA 1SCUB 3GFGA 4LDQA 3CXCS 4Y2RA 4IVPA 1OGIA 2BL4A 2E4VA 5T8KC 1ZD4A 4RIEA 1DCKA 4MVJE 1E9DA 4Z88A 4F86A 3TR0A 3M2TA 3NOXA 2F8TA 1YCFA 1R0BG 5ENDA 4BIMA 4WCFB 1Q0UA 2FZEA 1DJMA 4LQCA 1T5LA 1HDOA 3GLQA 1CZOA 3WYFA 1PUIA 1EGAA 1KAEA 1RYYA 1QOQB 3VTKA 5IVHA 2CH4W 2R7KA 4J03A 1HYEA 5C32A 1YI2A 3C4SA 1B73A 3HU1A 4D8TA 3RRZA 4C7OB 3T8YA 5EWJA 3VR4H 5IT0A 2NN3C 2QRKA 1V8BA 3BC1A 1R77A 5H3CA 4LKOA 3DBLB 3DFIA 2XHZA 5LXTF 3U62A 3S2ZA 5KNCH 4TLLB 1JHMA 4MDFA 3K70C 3HBLA 3KBOA 2OAQ1 4X6LA 4X94A 1OZHA 4Z86A 4ND6A 2CYCA 4QBFA 3GLSA 4F72A 3R6NA 1ZX6A 5BSWA 5KWIA 5SZKB 4B2IA 4BEVA 3SKVA 1WXUA 3OU7A 5CNKA 4LX0A 4RLSA 3C94A 2Q5CA 3CCST 1B34B 1DELA 4O4HA 4EBFA 2ZBFA 4OGCA 3BHIA 1W70A 3PX3A 4G5SA 3U4GA 3GT4A 3MWDA 4JYAB 3FH0A 5AVYA 4QYSA 2Q1XA 2RHZA 3R7WB 4JYPA 1KBZA 4LJ6A 3AWDA 5TQ2B 1G59A 1NJ6A 1AS0A 1TK3A 2DBVO 4Z7NB 3BBLA 4Q05A 5EQDA 1WD5A 2XZLA 1DFGA 1R9GA 1U3DA 3TAHA 2GBIA 3RHSA 3ZCXA 4G9EA 5JASA 3KQVA 2Z30A 1ESMA 4FINA 3B1VA 1Z2OX 4N3CA 4LOIA 2NZ2A 1FMFA 3CLSC 1XQVA 5LNK6 4J6XA 3ZV7A 4CUKA 3JALB 2BM1A 4PJNA 4FDMA 1KDPA 1DX9A 4YWJA 2NU7A 4MVJF 5THKA 5F9FA 4H60A 4RGBA 4B47A 4CQLB 1AV7A 2A0KA 1RIFA 3DOFA 4NXNB 1FUYB 2R6DA 2QYSA 1GL3A 3IKTA 1P74A 2EEPA 1RD4A 3N8KA 5LQCA 2QTCA 1ZJ4A 2CXRA 4NMMA 1O5OA 5EJ2A 1Y9JA 4HC4A 1FFXA 3GPDG 2Q49A 4V2IA 2EJVA 3OYCA 1Z56C 4O3FA 5CH3A 5CIUA 3KBGA 5TSDA 2A7XA 1GL9B 4YHHB 3MTJA 4LUCA 1TB4A 2IYLD 3OB9A 2JLAA 3K5HA 2NOAA 3DMGA 4MGYR 3GUZA 2QXTA 3R20A 1EWKA 4L07A 1B0PA 5JMOA 2QD5A 3U7JA 2QRVB 4MWOA 3NBAA 4PIVA 1BQEA 4MA5A 2DRKA 4J6YA 3VYVA 4RA6A 2YWXA 3AX6A 3H2GA 3CBPA 2E6UX 2XUGA 1BS2A 1R5BA 4XARA 4ZOBA 1P8JA 3A6JA 1ENPA 1TZMA 3C7CB 7AT1B 9GPBA 3HCOA 2XCIA 3OJFA 2MU1A 5F3DA 2NVOA 4M0FA 1DRKA 2ZEJA 2QJTA 2QTHA 1QE5A 2P30A 1XXHA 4M7PA 1ZD1A 2N75A 5KSOA 4NX2A 3PX7A 4KPYA 3LC1O 5IC4A 3TFQA 1AMOA 4GQAA 1QYDA 5IEBA 1HY3A 1XKXA 2MAMA 2NO7A 3CUWA 4B4VA 3KVYA 1ZVJA 2C8JA 4P7KA 1L5QA 1YK1A 5C1BA 1I7QB 5AW0A 2B4AA 1FMJA 1DXHA 1AU9A 2GEVA 2B82A 3JB9J 1MU0A 2GNAA 5JCOA 4DMHA 3GDWA 1N8NA 2CCJA 4PQEA 3NB0A 3DH0A 2OTJA 3DULA 3T3NA 4NHEA 1IWPB 2ZE7A 3AR8A 4Z1OA 1DDIA 1NEBA 1MAHA 4MIKA 3ZEAA 2AXQA 1M90U 4ILKA 1N5RA 5EWJB 4EW6A 3VPCA 1MO2A 4DAOA 2ZRMA 4QUHA 4R7ZA 4LF5B 4IUVA 4PR3A 4DCPA 4RK5A 3T12A 1E4YA 2ZPUA 1Y4SA 1Y89A 3FNEA 4AL4A 3GPCA 5IAYA 4QVZA 1VMKA 5LA6A 1KMHA 4PSKA 5CIYA 2Q6OA 1YQEA 5HKAA 4RJTA 4KBFA 3JB9H 5F9HA 1GNVA 1W2WB 2Z2KA 4GPIB 4DVJA 2G6FX 4EKNB 2WLTA 4E7LA 1OZ3A 1UPCA 2C7QA 4K6FA 4W6QA 2VHUA 1J97A 2COYA 2WWVD 3DAGA 1SKYE 4CEHA 4O4HB 4DR7B 3NJRA 1FU7A 1M6NA 3MMNA 4M1OA 4PU0A 3MWDB 2GF7A 4EJSA 1GNLA 1J7KA 3C95A 4Q3LA 4JYZA 2FF5A 1DO0A 3JAWA 1XQ1A 4L0QA 1EB9A 3VS3A 1QW1A 5ITZA 1P0CA 5ICCA 2PQMA 3TJZA 2PUBA 3FR7A 4GI1A 5IDXA 1ODJA 2JM9A 2GF9A 3V9AA 4QDTA 1LJOA 4C5HA 1KYQA 2PPVA 4X71A 1X70A 1OV4A 2O1XA 3F4BA 3CWZA 3I73A 4NE9A 3KV1A 4PLZA 3QELA 1RQXA 2D1QA 2D6FA 3IS3A 4GICA 1U4OA 4CKCA 4MB0A 3NHNA 4PFQA 2NU7B 2ZZKA 2ODQA 4N18A 4B6QA 2MSEB 2YNMC 1OWLA 2XGGA 3EGEA 6NULA 2MJLA 2Q3BA 4ZGGA 4MKHA 3SEMA 1XQXA 2XB2A 2QQ5A 3DOOA 5IYZF 4N5MA 2PM8A 1MNDA 4Z02A 3QXEB 3ZNNA 2DVMA 1ULHA 1V6CA 3E27A 3G0IA 3TGLA 1JDUA 3VSDA 1HT3A 4MUFA 3GHYA 3IV9A 1FFXB 1M1XB 4F6RA 3G0BA 1BIFA 4H7JA 3RVLA 4DRYA 1UZUA 1R0XA 3HWWA 4H31A 1ND5A 3M58A 4R1LA 6Q21A 5C0MA 5BV8A 1NBWB 5JD6A 1AX9A 1R16A 5G3YA 4ONEA 3MJHA 3FXAA 2NPOA 4JU9A 2OBBA 2ZJBA 4MS1A 1RXWA 3MOIA 2VNJA 4IMIB 4RA6B 1HYHA 1PR5A 3EXG2 1U8ZA 3RVQA 4KXYA 2KAFA 3NOQA 4QXMA 4F45A 3A14A 3RH0A 2WAYA 4QGGA 5ALEA 4M53A 3I8SA 1RR6A 1M5TA 4EO4A 2V5UA 1ZK1A 5AJTA 5DBGA 1RMTA 5JZSA 3U09A 1P2BA 4M7WA 4NIMA 3SWNA 4D4GA 4FZ3A 1XXHB 4INOA 3AB3A 3M34A 3D4IA 2Q6KA 1ABOA 1FNNA 1M1ZA 4IIXA 3UF0A 2CHQA 1L4MA 3HJCA 2JG3A 3C3WA 5B3JA 3OHPA 1CQPA 1O6FA 3A2MA 2ZKIA 4FW9A 2DX1A 5LXTA 2PUOB 1G6KA 1W48A 2RC6A 4U7TB 5K1ZA 1FDWA 1SHKA 1WABA 2HMTA 3H9QA 4Q9LA 2YMPA 1RYEA 3NEPX 5KOJA 3D3NA 4TMFA 1FP2A 2BKAA 2WYWA 5LZ5A 3CZ5A 2QTBA 2RI3A 4OGLA 3E3LA 2EGAA 4YV1A 3RFCA 1WBBA 1Q1GA 3QDRB 1T35A 4JDPA 1TZ2A 5G41A 2EKQA 1KMQA 4J1NA 2QD4A 5CKBA 4DMFA 5L45A 3PVLA 4WVFA 3B89A 1UUFA 4BMSA 4NBTA 3RLIA 2NXNA 2AD1A 2HRDA 3BGVA 5KTKA 3CNNA 4HRVA 5HZGA 2UZAA 4Z51A 1AHNA 4RD6A 3KXDA 1YMVA 4HB2A 4JSTA 3RV3A 5B4UA 5JO0A 4TTAA 3HV0A 5LA6B 1Q22A 2XUZA 3JWJA 3QPBA 1TTHA 4UNNA 1KMHB 3DAHA 1EX6A 3OFND 3KFLA 3TLAA 3MK31 2FVXA 2QEXT 3A6EA 4LI3X 4QDUA 4DC1A 4LUDA 2AHOA 4MAFA 1UZNA 3EPJA 3N2EA 4ZU1X 1Z4OA 1PNRA 1FLDA 2WDPA 2WFAA 3H9JA 4KULA 2NZYA 1WHLA 1ULBA 4CEHB 4YMGA 1SCAA 3G7ZA 1E79D 3SSOA 4TXLA 4KLZA 1RLMA 4EJSB 4N4HA 1IOVA 2LCQA 4QEKA 1SGWA 4AK9A 1Y5LA 2E4HA 3JAWB 5GVSA 4L6AA 2ZJ7A 2Q8QA 5HTKA 2GA8A 4JJKA 3T3DA 3K9HA 5ITZB 1GZ5A 1GZ3A 5K20A 2FSVC 5HBRA 3RANA 3S8EA 1JEOA 1U1SA 2QI2A 4AUEA 1XZMA 1HNWB 2A0FA 2H57A 1XL1A 1LPAB 3GLKA 1DNPA 4NEGA 4RXUA 4XUCA 5HK9A 2QU8A 3G5UA 1FNDA 1LNQA 3K2IA 4F97A 1YKGA 1C4WA 3JQCA 2QTWB 1YB5A 5D6YA 2V9CA 3N2YA 3ROPA 1P18A 1U7DA 3DLLA 3NI2A 5EMJA 3FBGA 4NCHA 4CKCB 2KS6A 3KZVA 1M0TA 4EW1A 4B2YA 3V8RA 4DTCA 4F3TA 4DDMA 1JG1A 1V45E 1WDMA 3FFAA 2DL4A 1H8HA 3CCLT 4M77E 3OECA 5IH3A 5C4IA 5ULLA 4LHSA 1NUUA 4LHXA 2D4HA 1R6XA 2P6PA 3RS2A 4TTTS 4ZCIA 2H8GA 4FFOA 5HVNA 1I01A 3C87A 2JI9A 1XD9A 2R0QC 3M33A 3OAAD 5AICA 4X7RA 1JRLA 5BSRA 4TTPA 3RERA 3LX6A 4WFKA 4EG1A 1M2EA 3I8OA 2RH5A 1SA0A 2WYVA 1K9SA 4EJMA 3M5DA 2F64A 5A0LA 3KJXA 4Q02A 1Z3CA 2UZ1A 3FCYA 3A3YA 3ZWPA 5B7NA 2II6A 4DKJA 1Q0LA 2AZXA 3NIFB 3UANA 4BMPB 3BJMA 4HPJB 4DFDA 4DG5A 1XZQA 1OZFA 1GR0A 4KQ2A 1QK3A 1ZC3A 4LRQA 3UPUA 3UAZA 5IJZA 4D8VA 2TRSB 3EPLA 1QU2A 3ZE8A 1IULA 2HF2A 1K6JA 1OBVA 1B7TA 4FE3A 2EFDB 4BC0A 4R0VA 1KS2A 2WE7A 5EC7A 1HFKA 4Z2YA 2RHHA 5L7WA 1GCIA 1QIMA 3SWNB 4LF6B 2AJTA 1TLFA 1G41A 4RXMA 4RKFA 2YXEA 2CE7A 4D3ZA 1FVHA 4U02A 3NMZC 3SX0A 2ZRHA 2QL9A 2HWYA 1YQTA 1EXNA 1J8VA 2E37A 1E3MA 3GEGA 2P6NA 4C8QD 3KOMA 1YJAA 1KETA 3WAGA 1KJZA 2ABWA 4WMLA 1QHSA 4CFYA 4H6PA 2WTMA 4BQNA 5LXTB 2YUQA 3FHTA 3H2HA 5L3SA 2YYZA 1P7ZA 3DUWA 3TCNA 1FRFS 3OIGA 3SJ7A 4J3FA 1TF5A 3SR4A 5KOJB 1Q82C 5LP1A 1KQNA 1QOPB 3CISA 1Q86C 4LOHA 1QGOA 3GFBA 2EYXA 4NH0A 5FPPA 3RMSA 3LT1A 1P33A 3WK9A 4UDOA 3SKXA 2FOLA 1BU8A 2YDYA 5FBKA 4X8LA 3VKGA 3A25A 5LJ5e 2IPXA 4M9SA 4C4TA 1IHDA 4FFMA 4JLMA 2W5UA 4BXOA 1QP4A 4OLBA 5TMBA 2XTNA 3QZUA 2PD4A 4JZKA 2EX4A 5JH7F 3ZHZA 3L0CA 2J6IA 3INNA 1YZUA 4O5AA 3FUVA 1ESZA 3K94A 4C7BA 3V4VB 1SHTX 1C3OA 1CUFA 1TTHB 1ML3A 1WOMA 3REGA 3OW2S 2AZ4A 2ZQZA 1HDGO 4WGGA 4WZBA 4D9GA 1ZZGA 3OZIA 2OCYC 4C0DB 4UATA 4BFUA 1QDLB 1ONBA 1SSHA 4PJLA 5FO0A 1SNYA 3WYAA 3TR5A 3BQNB 4JBYA 2IBTA 2ATEA 1ZG3A 2E55A 2WMYA 4AJLA 3D31A 1JB9A 4X7MA 2J0UA 4J4HA 4R81A 2GXAA 4FE7A 4DJAA 1KAGA 4BMNA 5EE5B 5FU6B 2FRXA 2WUEA 1OAOA 5EQJB 3M0SA 4D3FA 3VR3D 3ZDCA 1OMOA 4I36A 1YH3A 3EA4A 2Q0QA 1N0IA 5CURA 1RRGA 2BTOA 2D1SA 3KQSA 5IYZA 4QXAA 2G7ZA 1NR7A 4JLJA 1WR8A 4HXEB 4G56A 4C6RA 2A0FB 4KDRA 1OC2A 4LDZA 2W48A 4I2VA 3F7MA 1WBJB 3G2IA 1N6RA 2OBYA 5TT1A 1USWA 3DUFA 4MQLA 4FHEA 5LDGA 2LZ6B 2H0QA 2H31A 3WA7A 1W0KD 1EVQA 3X44A 4ZANA 1K9MU 1AKNA 3BF8A 1AQUA 1J0XO 2VSOA 1DDOA 1TZJA 4AVYA