1VYVA

Beta4 subunit of ca2+ channel
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
332
structure length
274
Chain Sequence
AIRQEREQQAAIQLERAKSKPVAFAVKTNVSYCGALDEDVPVPSSAVSFDAKDFLHIKEKYNNDWWIGRLVKEGCEIGFIPSPLRLENIRIQQEQKRKHIPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKSSLAEVQSEIERIFELARSLQLVVLDADTINHPAQLIKTSLAPIIVHVKVSSPKVLQRLIKSRGKSQSKHLNVQLVAADKLAQCPPEMFDVILDENQLEDACEHLGEYLEAYWRATH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of the Alpha(1)-Beta Subunit Interaction of Voltage-Gated Ca(2+) Channels
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
molecule keywords CALCIUM CHANNEL BETA-4SUBUNIT
total genus 78
structure length 274
sequence length 332
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
A PF12052 VGCC_beta4Aa_N Voltage gated calcium channel subunit beta domain 4Aa N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1vyvA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1vyvA02
2HLDD 4JBXA 4KBFA 2O9SA 4PSVA 2CHVA 3FKQA 5KSYA 1DO0A 3B2EA 5J4KA 5L3QA 2IYWA 5HTKA 2BVNA 3PIRA 5P21A 5EJEA 3BJIC 1Z63A 2NGRA 3RRMA 2D8HA 2HYIC 3KJGA 3KXKA 2AR7A 2VSFA 1T0HB 2J0UB 1M1YE 2QGZA 4Q9LA 5EE1A 5EZ6B 5KHOC 5F9FA 4L9SA 1T8TA 2ZRHA 1U2RA 4EUNA 1MR3F 1RPZA 4ARZA 4AI6A 3QKSB 1Z2AA 2DLPA 2XXAA 1M3BA 1XFAA 1RLQC 2JTEA 1EESA 3PUYA 1BK2A 2FPLA 1M7GA 3WBJA 5BYKA 1NVVQ 4JLMA 2CL0X 3EWSA 1Z6TA 3K9NA 1LB1B 4OQXA 2O8DB 4JVMA 1C9KA 4HLQB 2O8FA 1CJVC 3RNJA 3W6NA 3EIEA 3IUYA 2QT1A 4CC7A 2CK3A 2HXSA 1E9RA 1OKKD 2XJ4A 4J9GA 1QHNA 2AL7A 3A1UA 3NGPA 2ZI5A 2F2VA 1Z29A 2KYBA 4B35A 4RKFA 4B73A 3BOSA 4HLUA 4LYHA 5JHHB 3C8UA 2OXRA 5JRZA 4LJ8A 3EARA 2F3TA 1EXMA 1RYHA 2EFCB 4ESRA 2WIBA 1IJFA 1CKEA 1JQJC 4I1UA 4QG7A 4URYR 1GZSA 1HE8B 3QF4A 4J0QA 2MOXA 3AVVA 2ASEA 3B1XA 3BB1A 3V00A 3AVXA 3HPRA 4P31A 2DA9A 4X8MA 4IIOA 4PANA 5FOUA 2YWGA 1SHZA 4JL8A 3KZ1E 2FJUA 1E3MA 1RYFA 1IN5A 5IHPA 1D2NA 3X1ZA 3PJRA 5J4VA 2WBLC 3A4LA 4ZCLA 1RE0A 3THWA 5JMTA 3WHLA 1B0UA 4MGZR 4J9DA 4QM7A 3AUYA 3KTAB 2ZR9A 4JS0A 4A6PA 5KO2A 2BZYA 1KHTA 1X3SA 2FSGA 4NONA 4OKSA 2GTJA 1AWJA 4FXPA 4DWJA 1NNEA 1NBMA 2ZRAA 3KB2A 3O8DA 3DPUA 3KKOA 3K9HA 4JPBW 1US8A 1ZVQA 2CK3D 4Q01A 3CKLA 3W8NA 2VSOA 4CRWB 4HZUB 1KOFA 5GJVC 3SEMA 1QCFA 4K11A 1UJYA 1CLUA 3AM1A 4JLPA 5G53C 1Z6GA 4LJ7A 4PSKA 1JR3A 2BCGY 3SJZA 1ODFA 1U81A 2IUTA 2XSZD 4Q9HA 5E95A 4ESVA 1Z0IA 2SRCA 1NP6A 3JVUA 4JL6A 1IN4A 2VLIA 3MRSA 4MRVA 4QFMA 4CGZA 1TQ6A 1SSHA 5H1YA 4UNSA 2V6IA 4HCKA 2C98A 3FGNA 4GFDA 3IILA 2LJ0A 1U94A 2J05A 4HDCA 2DFNA 5FTKA 3SDZA 4OMOA 4LBWA 4A8JA 1M34E 4QHSA 4BFVA 4AKHA 1AKYA 3A98A 2PX0A 1RIFA 1F48A 2M51A 1DEKA 2FA9A 2F43B 3AVQA 3U44B 2BBWA 5G3YA 4V0NA 3RRZA 2J6OA 2VHTA 1IONA 3Q5DA 4D0LB 4BGDA 4OK6A 3VTKA 3UWOA 5IF9A 1R7RA 2LWIA 1E6HA 4XVQA 2EU8A 1SXJC 4UXIA 2IF0A 5C18A 3T1TA 1G17A 3SZRA 1YWPA 2BTTA 3QPWA 4JKYA 2QMOA 3HR7A 1IM2A 4RY2A 3D7MA 2FFBA 2PLRA 2RGAA 3F3YA 5EUQB 2NPIA 5AUNB 1IY2A 1MOZA 2HSPA 3SJAA 3RHFA 4EDHA 1G1MA 5J47A 1BMFA 2ZYWX 4LK2A 2Q3FA 2QAGC 2ONJA 2IK8A 4HSEA 3GJ8A 2AHOA 3ZDQA 3E5HA 2FEIA 3I3SR 4JKIA 4YDSA 5TARA 2ZVQX 3TUJC 4JVSB 1UBFA 4AKEA 1Y0MA 1T9HA 2QTFA 3QENA 3TUZC 1EG7A 4IHQA 2JCSA 4BFXA 221PA 2ZRFA 4D82A 3UA6A 2SHKA 5EXSA 4J9EA 2G88A 2Z6VA 2ZE6A 4URUR 1VCOA 4WIAA 1VG8A 3BFXA 1WDXA 2REBA 1E0SA 4URZR 1YZUA 3TLXA 4B2IA 4Z89A 4LI0A 4TMZA 1N6KA 1E6CA 3EG1A 2VQSA 3T1QA 1RZ3A 2G9NA 3HYTA 4C0LA 2QEQA 4JT2A 2AWOA 4ZKDA 1UUEA 1KI6B 4O2RA 2RMOA 3VRZA 2ZSAA 1UFFA 2O8BB 2V1QA 2JLWA 3ICEA 2ZI7A 2J0VA 1UJ2A 3ASZA 2GCOA 1W4RA 3LQRA 1DG3A 1V1CA 5DNYB 2C78A 1XB2A 2O5VA 4YXWA 2BMEA 1KSGA 2ESWA 1CR4A 2OM2A 4RZXA 1E79A 2IYQA 4WW0A 1G16A 1DAHA 1YR7A 1Q21A 1YR8A 2X3XD 1UKZA 2AZSA 4EFLA 3QNUA 3WRXC 1SKYB 1G7TA 1M74A 1NN5A 3N2EA 4HLUC 3DMDA 3K0SA 4PAOA 4JBYA 4AYWA 2PNIA 3QEOA 1RFLA 2JLRA 2OSBA 5EE3A 1JI0A 1N5ZA 3LWNA 1XPUA 2EFHB 3FKSD 5BWMA 1SXJB 1YQTA 1XXHA 4JZKA 2PCLA 5IHIA 2FZ4A 3AKEA 3B1VA 4B32A 3T5GA 4ZDKA 4F14A 3CW2A 5FW9A 1AZEA 1KAOA 2QM8A 3A37A 3LRPA 3Q7PA 2HF8A 1XU4A 4NYJQ 4D4KA 1X6VA 2W2VA 1H65A 3QOFA 2OLKA 2WOJA 3C41J 1YZKA 4TMVA 4LUCA 3H0KA 4RZ2A 4YMUA 4O3MA 1ZNZA 3HPQA 2GXQA 1W49A 3B5JA 2IS4A 3PVLA 3RS2A 2AN9A 5DI9A 3IQLA 4AFZC 4M1MA 2DFLA 3EPJA 2BKEA 1GM5A 5HR5A 1W70A 1KI3A 5AJZA 3SR0A 4RFVA 1A2BA 1XJQA 4TT3A 2KGTA 3TVTA 3OEEA 4JJBA 1YZGA 4XD7A 5KNBA 2OJ2A 2VH5R 2ZEJA 1AOJA 5K8LA 4GDFA 3PUVA 4RD1A 4BLQA 3DHWC 1N5IA 3CUEF 3NPFA 4BFTA 5IRCD 5KPDA 1A0NB 1PZNA 2G77B 5HZKA 2NZ8A 2D2FA 1AIPA 5FTLA 5F98A 2AFIE 2L0XA 2GJSA 1Z0KA 4E07A 1E9FA 3EG2A 4DKXA 3BK7A 3K09A 3EGUA 2GCPA 4MRPA 1UFQA 1GRIA 1V5WA 1SXJA 1IJEA 3ZH9B 1Y3AA 2J06A 4U02A 2KBFA 4I1VA 2V55B 3EPKA 3W6OA 1Q57A 4OK5A 1VYUA 4V0KA 3EX7C 2QP3A 2YWEA 3ZVLA 5A4JA 2ZS8A 1E98A 3C16C 1HUQA 4OHVA 1E2NA 2D7DA 4A8JC 4FINA 1T3SA 4V0ME 1QVAA 1WMSA 3BB4A 821PA 3BIFA 3K0FB 5JWRA 2GZHA 2IHYA 521PA 5CM9C 4A9AA 4MYUA 3WRYC 3NH6A 4IDNA 3LO5A 2C9OA 1WP9A 4NYMR 4B2PA 4JLKA 4A82A 4JLVA 1C1YA 3NVAA 3THYA 4FN5A 2BOVA 1KZ7B 1TG0A 3O8BA 2QMHA 2RQUA 3ULRB 4US0R 1RRCA 1G9XA 4U5XA 5B58C 5JSZA 4G5RA 2HBWA 1IY1A 5FPKA 2P2LA 2HT1A 2ZJZA 4EJSC 1GRRA 1OXUA 2PJZA 3OESA 5EE5B 4EQ6A 2J45A 1WYXA 1YCSB 1E2EA 2FX3A 2ABLA 4Z8YA 4XWKA 1JXOA 2IUSA 2OI3A 5CK5A 3PEYA 1N0UA 1FW6A 2F3RA 1N5JA 2V3CC 2GHIA 2LJ1A 4YQFA 2QE7A 4KJZA 2EGCA 1QHXA 2PT7A 2PZEA 4Q00A 3OEHD 1E9AA 4B3GA 2LQNA 4E22A 4DDTA 5BYJA 3CRMA 1U0JA 2BBOA 2NOAA 2CH4W 2REXB 2WHXA 3AVOA 5IDVA 5JI3E 1G4AE 3BFVA 1OXVA 4Q18A 2J6FA 4TLBA 2H17A 3T35A 4WXRA 1X8LA 2GNOA 5FBQB 4QBFA 2OCBA 3K0FA 1VYVA 2KNBB 2Q0HA 3IEUA 4KAXA 5K8UA 2ZJ2A 1ZW6A 2IWRA 4I4LA 3I32A 3I5RA 2ZPTX 4A0GA 4NP6A 5CJPA 4YMWA 3UANA 1OV3A 1NLPC 4RUGA 4Z88A 1KI9A 1QWFA 1SHKA 2Z4RA 3H4MA 1NG1A 4UNPA 3RWMB 2N46A 2ORWA 4I99A 4M8NE 3EAQA 3CPJB 2R6FA 1ABOA 5FFMA 2VP0A 1UPTA 4PR0A 3IQWA 1GUAA 2ZRJA 2B7CA 1MRNA 1P9WA 4AY2A 4CT4B 1EFUA 1ZSGA 1UF9A 3W3AA 2GZDA 1T3HA 3DOFA 1CR0A 3JZMA 2IBMA 2JLXA 2EFEB 4QGFA 2R65A 1CR1A 3EW9A 1TTTA 2FPEA 4PZLA 2ZR7A 2KBTA 2WAYA 4RTZA 1N6HA 4OJKA 4A4DA 4QBHA 1HYQA 3AF0A 4BEJA 1TF2A 4C9BA 1E96A 4KLZA 4A1FA 4KITB 3PUZA 1NKSA 3TK1A 1G2BA 1F2TB 3CIOA 3OFND 4DB2A 2ZSFA 3DM5A 1NLYA 1K8RA 2VKNA 4NH0A 4TMTA 2J0QA 4TTPA 2VP2A 3TNFA 3VR1A 2D2EA 3QXSA 3M0QA 4AG2C 1E2LA 1UGVA 1M8PA 1VMAA 4M0LA 1FMKA 3VX3A 4LC0A 5EP3A 1P61B 2CCJA 1R5OA 3E70C 3TGPA 1TMKA 4I1OA 1GDDA 2OV2A 3DMNA 1GKYA 3U3KA 4FWTA 1NEGA 4CEIA 2DMOA 4D8DA 1K1ZA 1G7RA 1QHGA 1Z5ZA 1W4CA 3QQ5A 3MG9A 2EYYA 3NG1A 4I1SA 4KVAA 3LH5A 1E9CA 4Z8AA 3SYLA 1TUIA 4BLOA 4PHTA 1XZQA 2F9LA 3PE0A 2NMVA 4JJDA 2B92A 1U06A 3KJIA 3WNDA 5B64A 2OUKA 2WSMA 4OI0A 3TW8B 4J9CA 2IYUA 2F43A 5FOWA 1NEBA 4DJTA 4MDFA 1IN8A 1QHIA 4MH0R 5AUPB 1LS1A 4PQRA 2KJQA 1T5LA 3NHBA 5FPTA 3KKQA 4ERNA 1X2QA 3OFNA 4MGIR 4MYTA 4MKHA 1LF5A 3PEUA 4F38A 3FKSA 2QRZA 3ONWA 2ATVA 2B8WA 1JB1A 1JO8A 1R0YA 2LCFA 1ZAKA 2ZETA 1BB9A 4FD2A 4ZDIA 4EPRA 3CWQA 2BKUA 4M1KA 2ZJAA 3SFVA 4R71A 4TZ0A 3FB4A 2GK7A 5JECA 3W5JA 1ZUKA 4LBVA 3VR6A 2ZREA 5FPYA 1W4AA 1L2TA 2XITA 4BZXA 3KJEA 2C99A 3MJRA 3PUWA 3UMRA 1ZLMA 1IXZA 2O8CA 1Z07A 1H8ED 4QJ3A 3G82C 3VX4A 3QVUA 3GEEA 4LZZA 5GJWB 1JALA 3TSZA 1GFIA 3BD9A 3ZZUA 4OI1A 4UNRA 1KO5A 1ZNXA 3ASYA 3E1SA 4POAA 2OT3B 3U3RA 1YNZA 2I1VB 2GDJA 1DAFA 2C2HA 2WVJA 3HU3A 3MMPA 5HZHA 1COWA 1UBCA 2H8HA 3K0AB 4L9WA 2EPDA 4ZDWA 3OEED 2KBEA 1G4UR 2Z83A 2YSQA 4HAUA 3I5XA 4LV8B 4XD7D 5LPNA 1WCV1 4A15A 2KRNA 1K9AA 1KSHA 4DLWA 1XMJA 4AKGA 3I92A 5GVRA 3F5FA 4DLVA 3GJ5A 4DSTA 1NI3A 4OMMA 1ZU4A 3A1SA 4FMCB 2YC4C 4QNMA 4BZPA 4KRTA 1KJWA 5IHNA 4US2R 1PLKA 5FUVA 4EIKA 5HCNA 5FL7D 2HEIA 1IN6A 3AGQA 3TW4A 2FH5B 4EIWA 3SJCA 3EPHA 2BMFA 2AXNA 2NO6A 2O8EB 1SXJD 4FSSA 2CUDA 1QHSA 5K8IA 4ZNXA 1B07A 4YLGA 2GQIA 2AFHE 1KTVA 4NPHA 1SVKA 4LYFA 3FDIA 1E4YA 3EC1A 4TYPA 4C4PA 4IDQA 2O31A 1M6NA 1NG2A 3MD0A 1FPMA 2A5GA 2OCPA 5JSZB 1D6JA 3WBKA 2GRJA 1VKJA 2CCGA 2J59A 4IFBA 3ZVMA 1GCQC 2C8VA 2V1XA 1G6HA 1XX6A 2XOKD 3GMTA 3OAAA 1VG9B 1FYNA 4IOJA 4NDZA 1E1QA 1S8FA 4DT1B 2KEAA 3KDSE 1W46A 5H70A 1AS0A 2CHQA 2ZS9A 3HJNA 1DAIA 2KRSA 3IBYA 4RKEA 5A0FA 3LD9A 4G5SA 2UZ3A 1DOAA 4WZAE 4M1OA 2QQEA 2CJWB 3IEVA 1UBEA 3LXXA 3RYTC 2LX7A 1BYIA 2C95A 3KKMA 5FL7A 1KIKA 1ZM4A 4PO1A 4DLUA 4D0NA 4LHVA 3ZVNA 5FOVA 1ZRHA 1MABA 1F2UB 3C14C 2QE7D 3PUXA 3HR8A 1PUJA 4OMQA 2PMKA 5DSZA 4B3CA 1P2TA 1S4QA 3QXHA 1DAMA 2FSIA 2BBSA 1JEDA 1JPJA 5FR1A 2JLQA 1G5PA 4JL5A 1ANKA 2EVRA 2ZRGA 1G3IA 3FPAA 4OQLA 3QBVA 3RRYA 4IEEA 4ZI2A 4JJZA 3CH4B 1QHHA 3F0TA 3QE0A 1II8B 3NEYA 2FPFA 1XTJA 2KRMA 1CJTC 2WKPA 2MCNA 3W8RA 4PC1A 2LZ6B 2EYQA 4YMSA 1FNMA 2FEMA 3DZDA 2IA5A 5CDFA 1UEJA 1N2CE 3CO5A 3NTUA 4A8JB 3R8FA 2AZVA 1KJZA 3NMZC 1CXZA 2AK3A 1NMYA 4B2LA 4DHEA 4LBYA 1N6PA 1X69A 1Z2CA 3KTAA 3IKJA 1NVUQ 4Q5IA 2RN8A 1MRSA 1FP7A 1Q0UA 1XDBA 5CIQA 4BECA 2VHQA 4CC4B 4C0HA 4IFEA 2LJ3A 3OIUA 2Q21A 3IO3A 1OXTA 1Q1BA 2ZI3A 1J70A 1ZP6A 2DE0X 4JT4A 1GITA 4OQMA 1K4US 1Z47A 4R2IA 2KROA 3X1XA 4A2PA 4JSTA 3PEWA 3EPLA 3SHWA 4ZDJA 3C4JA 5EP4A 4AFUC 1C4OA 2JLSA 4HLCA 1E0AA 1EX7A 1WXUA 2KSQA 2JJ8A 3T15A 3V4FA 1QHHB 1ZU5A 3EA5A 2GAOA 3IIKA 2IEYA 1HTWA 1GILA 3KKPA 3Q85A 4HAWA 2CUBA 3MWKA 4M53A 3B7GA 4RZUA 3IIMA 4TLAA 3SFZA 2PL3A 1W0KD 4ASUD 2PX3A 3FFAA 4M4ZA 2PZGA 4BLPA 3C7KA 4IDPA 1AN0A 1T8UA 3H0FA 2HDNB 2XXAB 2XB4A 1VIAA 2ZSBA 2EQIA 2JMCA 5TMPA 3MJHA 4GOKA 3EC2A 2Q3HA 3B85A 4ABYA 3BH6A 3Q72A 4Q21A 4CDGA 4QJ5A 2K9GA 1PKTA 3GP8A 2KWIA 4NL4H 3UKDA 5F2EA 3A1VA 5F3WB 2PCJA 3H84A 3SN6A 2NQ2C 2VHUA 1G8YA 3THYB 4IRUB 3T1OA 4M9SA 1H92A 2GJKA 2WPDD 5GADl 2BCJQ 1RUWA 3EG0A 4IKEA 1TU4A 5CLQA 4XJXA 1XWIA 1AWOA 1OV4A 3JVVA 4MITA 4Q48A 2XTMA 3K0EA 4MKGA 1F60A 2A78A 1WXBA 3NDPA 1S9HA 5FOTA 1CR2A 2EFDB 3LBNA 4RCYA 1W4BA 4A6XA 2L2PA 1J8MF 4JBWA 1M8MA 2FO0A 4TL9A 4CZ2A 1N5LA 1UDWA 4CT5A 2FGKA 1HJDA 2EWVA 3RS5A 1SRLA 1W7AA 1NLFA 4DXAA 1WRBA 1W0KA 2H92A 4ASUA 1FOEB 1MABB 2XTNA 2ZTSA 3FHTA 2FPMA 2R9VA 4XVRA 4ZCIA 1AZGB 2WWIA 5A5GA 3LFUA 5BXQC 4YONB 2C0TA 3NHAA 5CIWA 1W1FA 5FBLB 2FPDA 2QM7A 1S3SA 4L5BA 1J8YF 3OIWA 5BQ5A 1DAGA 3EZ7A 2GILA 1KZGB 4GMXA 4NHOA 4DDWA 1I1JA 2V8OA 5JS7A 3VU9B 1AEYA 4FI3C 1QG4A 5KU1A 1VTKA 3KKNA 4AURA 3DOEA 5J4YA 2L3SA 4R2HA 3PG5A 4XSGA 2J87A 4Q9JA 2D8JA 1XPOA 2WPDA 3IPYA 5IH2A 1UECA 4DC9A 3VMFA 2KB0A 4B34A 4LUDA 3FMFA 1DBSA 2FSHA 3ZD6A 2BIFA 3DDCA 2WZQA 3I8XA 3TVDA 1IN7A 4TMKA 4Q7JB 3TAHA 2X8AA 2CDNA 2JJ1A 4U7DA 4Q1EA 1WLPB 2BZ8A 2W10A 4EPVA 1G3QA 4FCVA 3TUIC 1IOZA 2BBTA 4R0KA 4B76A 1OB2A 1NVXQ 4P32A 2PEZA 3EIQA 2DR3A 5SZHB 5KDOA 3PENA 2EYUA 2W6JA 1J3TA 3EA0A 4AYXA 3ZD7A 3VFDA 4OI4A 1TQ4A 3SBEA 1N0VC 4H1VA 4WVFA 1EWRA 3U6KA 1AS3A 4RTTA 3BE4A 4GRAA 4OMPA 2GXSA 2QPOA 3ZVRA 1R6BX 2ZRLA 4PC3A 3L82B 1SZPA 4FCTA 1R4AA 4MGYR 3RS3A 4FCWA 3RC8A 5C4MA 2GJAA 4HXJA 3WNBA 1L4UA 1GWNA 4CEHA 4XVUA 1E69A 1QDEA 1KI2A 1HSQA 5LB4A 4X8OA 4XSHA 2C0OA 1E2JA 1P5ZB 4Q47A 1Q1EA 1KK1A 3IO5A 1IO6A 3FJ5A 4G0NA 4TL8A 4Q4AB 4F7WA 2YHSA 3ZJYA 2XOKA 3GJ3A 3OAAD 3CX7A 2NPFA 2FSFA 4D26A 4M4SA 4R9UC 3NWJA 5KDLA 4TLEA 2CLDX 1AZSC 4TTRA 1P2SA 1W6XA 1EGAA 2C9YA 2ZAOA 5TB5A 1XD2A 1E2MA 3UMFA 2CVFA 1J2JA 2JS2A 3A58B 1FX0A 1MKYA 2OLJA 4M9ZA 3SE0A 2O52A 2JIZA 1P7CA 4XOIA 1LS6A 1GSIA 3LX5A 1XD2B 3OHMA 1X27A 4PPNA 5AR1A 2ZAMA 1IQPA 5B57C 1ZUYA 1GRNA 2MMGA 2X2FA 3FVQA 4Q19A 5JLJA 4C7OB 2WSSD 3TAUA 2CLSA 2FDCA 3AB3A 4BASA 4DUGD 2IYZA 5AJYA 2F6RA 3CBQA 5J4LA 4L8GA 1SVWA 4A92A 2BM1A 2G1KA 2VVKA 3U7GA 2L3PA 2F1RA 3GJ0A 4QKQA 2LNHB 2YDLA 4X8HA 1BIFA 4GBMA 3KXIA 4PAMA 1JJVA 2JT4A 1Z6YA 3U7EB 5CB6A 4GLMA 2J3EA 4C0BA 1MV0B 4DEXA 1Z08A 2EFGA 2XAUA 2YC2C 3CZQA 5JWOA 3SNHA 2AD5A 3ZZTA 1DO2A 3NDBB 4LBZA 3REAB 1XEXA 2IWHA 4JVLA 4MKIA 1Y57A 1M2OB 1ELOA 3I72A 1KSJA 2A37A 2K7AA 1E94E 1HE1C 5FWCA 1JU5C 1G8FA 3SU8A 1WIEA 1T5IA 1WE2A 4Q9IA 1SVIA 1XTKA 4LSGA 4B44A 3G0HA 1UE9A 1W5TA 2CBZA 1AZTA 1I2DA 1N6NA 3GLFB 3X1YA 2XNDA 5FBVB 1UHFA 3IQXA 1I0CA 1SPKA 4A2WA 1ZUHA 1OFIA 3VS7A 1VCMA 3QKUA 5L3VA 3GLGA 3H2YA 4PPFA 3VS6A 1U0HC 4Z8XA 4NCIA 3VNVA 1NMXA 3PEVA 3AVTA 5D3MB 1LV7A 2YWFA 5J40A 4Z1MA 2OCAA 1S0UA 2QAGB 4BWYA 4OL0A 2IYXA 1E79D 2F1JA 2FPKA 3EZ6A 4RVCA 2D62A 3VR2A 1FTSA 3UA7A 1NJFA 3D6TB 5E3HA 1GCQA 4DIEA 1WBBA 5FUWA 1LF0A 1NSFA 2ZITA 2LKDA 2C96A 4LPSA 1HV8A 5L3RA 2XGJA 5KNCA 1G7CA 3I5YA 1ZCBA 1E0JA 4D4MA 3ZYCA 1UHCA 1SRMA 5K8TA 3C5HA 2VO1A 1KDTA 3K53A 1GNRA 3SS8A 2HJGA 2ZUDA 4CYMA 4F93B 4LC1A 2WJIA 2DY1A 3QUSA 2B8TA 2CSQA 3RVBA 1RJ9A 4HVUA 3QPVA 2YZ2A 4Q03A 4RSGA 1UM8A 2VYFA 2G83A 3AUXA 1TEVA 2D1XA 3SBDA 1DTSA 1KK3A 2QL6A 3U3JA 4A2QA 3D31A 1LCKA 2ZI4A 1OKKA 2RQTA 2IW3A 1FNNA 3GJ4A 1ZBJA 3K70D 2QSZA 3RNLA 1U9IA 3SJBA 3EZFA 1R10A 2KYMA 2Z0MA 1Z22A 1SXJE 1D9ZA 4RD0A 4AYTA 4M1YA 1KSWA 2ZU6A 4C2TA 1E2HA 2RPNA 4W5JA 3BRWD 1T0HA 2J0UA 3BB3A 1S3GA 4TT3D 4UQOA 3IPXA 1H8HA 4GI7A 4GZMA 3L0SA 1HD3A 1VCIA 4G01B 2JM8A 1AWWA 3GLHA 5HE9A 3WMEA 4B6FA 4B71A 3EIHA 2K2MA 4D8KA 2ECZA 3M0UA 2OILA 2Z5FA 3NC1C 4XWAA 3QSYA 4FIDA 1JNYA 2H7VA 4LUEA 3A8TA 1VECA 5L3SB 1M3AA 5JWHA 4ACAA 2W2XA 5FH9A 3MUFA 3GLIA 4JJKA 2SEMA 5DGXA 2J7KA 1NLOC 3VS0A 1UKEA 2ZUCA 4UXHA 2FFHA 2GWHA 4OHZA 2P67A 2CE7A 3I4LA 1N6IA 1R0XA 2QG6A 3D8BA 2EWWA 1GTVA 4K81B 4PX9A 3C5CA 1P72A 4OMLA 2CMKA 3UG7A 1XEFA 2YOFA 2GXAA 4LGMA 3VS2A 1KDOA 1OPKA 3I35A 2QBYB 1YZQA 1ZMXA 4BZQA 3FWYA 2PZFA 1GCPA 1NL3A 2I1QA 2RMKA 4G5QA 3NBXX 3WXMA 1YWOA 2GGRA 4CVNA 5HKKD 1JR3D 2YOHA 2NTYC 1OJLA 4IVPA 1GKUB 4G5OA 3B13B 4WZBE 2JLUA 3DKVA 4W5HA 3U23A 4P4TA 4OQNA 8OHMA 2A36A 3U61B 1KFZA 1CS4C 1QWEA 2RNAA 2EKHA 1NKTA 2PT5A 3TKLA 1TX4B 4TSFA 1KNXA 2BV3A 1H8KA 1GIAA 2BM0A 3UF4A 2WWFA 4JLDA 1EFRA 5LB2A 5UKDA 3TH5A 4MRNA 1TU3A 3CB4A 2YJTD 5JJKA 5IT5A 3GEIA 2YWHA 4US1R 3GFPA 4PC6A 2IL1A 1Q1ZA 1NJGA 2WJHA 3P20A 4TWZA 4C0AC 1JBKA 1E32A 1GBRA 1UTIA 3THWB 2RQWA 1F3OA 3NKVA 4HAXA 1UKYA 3BC1A 3B9PA 3FOZA 1AA9A 1M7HA 2NO7A 2IS1A 5C4GB 3SQXA 1OLOA 4V03A 1KO1A 1QVRA 2RGBA 4AKIA 3AP3A 1W0JD 1F2TA 4NBSA 4NYIR 1D8TA 4U00A 1BMFD 3M1IA 3Q7QA 3DM9B 1XP8A 4A0RA 3ZZ0A 4HB2A 2RQRA 2OAP1 3ND8A 1LFDB 2CEAA 2IEZA 4BE7B 2GVDC 3W5IA 2FWRA 3VU9A 1FZQA 1G6OA 1QZXA 1TPZA 3FHCB 3KFXA 1G18A 4UNQA 3RSLA 1AJEA 5JEEA 2GEVA 1VPLA 3NHNA 3VKHA 3SI7A 4BEBA 1KI8A 2GCNA 3VHLB 5FTNA 3K70C 2XNSA 2ZRBA 2AKLA 2ZRIA 1OFHA 1SKQA 2DWPA 4GPTA 4KYUA 5EXPA 1NMZA 2KT8A 2LQWA 1P73A 2ZJOA 2AWNA 5FR2A 5IK2A 1KO4A 3SOPA 3A4NA 3SHFA 1PV4A 1WA7A 1P4SA 2OFXA 1U8YA 5AUOB 2C77A 1SVOA 2FU5C 2Z43A 1KSFX 3ND9A 3O47A 4UXJA 4J9HA 1N25A 2JAQA 1GOTA 2HF9A 3RAPR 5JFGA 3GEHA 2ZANA 2J7IA 2GF0A 2CNWA 3QF4B 4BFUA 2AK2A 2ZU0C 2JIZD 3I9QA 1QRAA 1W5SA 3HU1A 1NN1A 3IHWA 4JLAA 3TQFA 2FF7A 1VYTA 2VEDA 1IBRA 4TQAA 4ARZB 1OB5A 5AJWA 1DVRA 3DEFA 4LJYA 1P2UA 3LX8A 1OH7A 3THXA 1GL6A 2R6AA 4YXWD 1W0JA 1HH4A 1IY0A 4OI2A 2D0NA 2GK6A 3ZLJA 3QWXX 2BMJA 3P4XA 1G5RA 3ICQB 2V7QA 2QGNA 3QVVA 4KFRA 4BLTA 3P4YA 2GJ8A 4XWOA 1QKWA 3D3QA 3PVSA 1WF3A 1GL7A 4Q1CA 1YVDA 3H86A 1YU9A 2D7CA 4KO8A 4NYMQ 4QNRA 1KK0A 3R8CA 4DSUA 2ZSEA 3P32A 1WI7A 1OXSC 4QHTA 2J9RA 4RD6A 4EJSB 3QG5A 2P6NA 2V54A 4H9GA 2ZRCA 2ZS7A 2ZJYA 3B1YA 2DBYA 3LLMA 2YOGA 4GNKA 2JXBA 2M0YA 3U3MA 1YJ5A 2ECKA 4Q4JA 2PTKA 4LCBA 1YRAA 1AQUA 1CJUC 4EJSA 1MV3A 3LW8A 4OQFA 4OHWA 3ETLA 2GKSA 1Z6XA 5HPYB 2C5LA 1M27C 1Z83A 1LY1A 1X8KA 2Q9CA 3WYFA 4GBQA 1FMLA 1KIMA 1OPLA 1DAEA 2O0KA 2Q9AA 2ZRPA 4B6EA 4TYYA 4DCVA 1W44A 4D2IA 2GA8A 2QAGA 2RF0A 5LD2B 3ZS9A 1ZM3A 5JJIA 1NYFA 2V7QD 2K6DA 2VBCA 4M21A 3VAAA 4PO9A 3LAWA 1Z3IX 1E1RD 4E6RA 1L4YA 1YZNA 3GD7A 1G19A 2GESA 4URXR 2VF7A 1II9A 4LX0A 2KE9A 1UJ0A 3KQHA 1S96A 4AK9A 2FFQA 3CF2A 1XTIA 2ZROA 3BXZA 1SVSA 1BU1A 4Y92A 1KI1A 4DCUA 2F9MA 3MWYW 1Z0AA 2LCSA 1N5KA 5L23A 1RJ9B 3T5DA 2F1HA 1Z0DA 1N6OA 1TQDA 2F7SA 5BW8A 3TRFA 4LV6A 5DI3B 1E9EA 1VCNA 2YINC 4LHYA 2DM1A 5DHFA 4AG1C 2ZE8A 1CEEA 4QM6A 2ZI6A 3NBZC 3UWKA 1GP2A 3GLHB 4XTCS 3QEJA 4DT1A 3U4QA 3U44A 1SVLA 1NBME 2HYDA 3MGCA 3PR1A 5G41A 1ZD9A 4Q4JB 2JS0A 1X6BA 1A2KC 3M4YA 2HCKA 2NG1A 2ZXUA 2A5DA 4P33A 1E2PA 2A30A 2ANCA 4B3BA 3M0SA 1OPXA 2C04A 2X19A 5SZKB 2G0TA 2GETA 5DYIA 1KMHA 1NRJB 2P0EA 1JQLB 5KSZA 2MMCA 1ZINA 4DCSA 3AKDA 3A1WA 1EWQA 2YYZA 1ZYUA 4CF7A 5EP2A 5DISB 4F92B 4JZ3A 2GTPA 2VA8A 4ORZA 2CSIA 1VDZA 2PBRA 4DSOA 4EPXA 1YKSA 4NU0A 4OK3A 4P0TA 4PO8A 2WV9A 2CL6X 3VS1A 3KX2A 3AKYA 3OE7A 1W48A 4WZ6A 2AD1A 3BH0A 4NCKA 1FMJA 1Z8FA 5FPSA 3LY5A 2CHGA 4J9IA 1XD9A 2EGEA 4DEYA 2JASA 1IHUA 1ZC4A 2JLZA 3U60B 3BS4A 3CRQA 3T12A 2IHBA 1Z0FA 1EFCA 4HVWA 1P60A 2ZYTX 2REOA 2AX4A 3M0EA 1OH5A 2VSXA 3THKA 2WIAA 3L8ZA 1KK2A 2UVQA 5KDDA 1SVMA 2VP6A 2WKRA 5E7IA 3NBFA 1KO7A 1B23P 1E2QA 3U4QB 2FG0A 2V4ZA 1JECA 2WWYA 2A3RA 1A4RA 4HAVA 4PC7A 3AP1A 3S1AA 5FOSA 4D6PA 5JZVA 1X1RA 1E7OA 4UKDA 4G5GA 3TE6A 1XMSA 4D4JA 1F5NA 1NVVR 2YKGA 3PQCA 4CEJA 3UK6A 1Q12A 121PA 3B9QA 2YT6A 1K0SA 1VG1A 4JLNA 2IYVA 2V9PA 5EC7A 2RGDA 4X1VA 3VKGA 2Y8EA 3ADDA 4HEJA 2OBNA 1V43A 1YZTA 2DFTA 1Z06A 3QKRB 2BMDA 4J9BA 2H57A 4HI0E 4K8OA 2XTZA 4OBEA 2I0NA 4D4LA 3M6AA 2G6BA 4BFSA 2QDLA 1OXXK 2IYTA 5FTJA 4F4JA 3R9XA 5AK0A 2VP5A 1ZUNB 2YUQA 1OEBA 2WKQA 3QIAA 1CRPA 2J5XA 4P4SA 1O87A 3K0AA 5I22A 1G291 1YHNA 2CLCX 5JEDA 4E09A 3KXLA 4Z51A 1JR3E 1WX6A 2AXPA 2WJJA 3CRW1 2ATXA 4CIDA 2Z4SA 4F4IA 2W00A 1TF7A 3P1JA 3TSWA 4X8LA 5IHKA 1T4GA 4ZI3A 3KJHA 4DVGA 2IF2A 3MLEA 4TZ6A 2ZR0A 1JXMA 4IVQA 4TTQA 1E4VA 1S9DA 5JS8A 5KOYA 4DRZA 1X2KA 2QPAA 2YUOA 1NYGA 4ZIRA 1L8QA 2GVZC 2E1RA 2FGJA 3K1JA 1W47A 2CL7X 3LDAA 2WJYA 4CC2A 2ZYUX 3OIVA 4BFZA 4DLXA 1RC8A 2YUNA 1XXHE 4FW9A 3L8YA 4Q02A 4GOXA 1P62B 1GRQA 4AG6A 4Q9KA 2IIMA 3NIBA 4BLRA 2QORA 4KVGA 5EUMA 2RB4A 3WY9A 1SGWA 2NO0A 5B2ZA 4N1AA 1R5BA 2K5UA 1X86B 4BFWA 5EXTA 4BFYA 2GJ9A 3QXJA 1NM7A 4KFSA 2YUPA 2KR3A 1B3QA 1OYYA 2OXCA 4PFSA 3GLGB 4C2UA 3RDPA 5L3SA 2NO9A 1BBZA 5EZ5A 5M04A 3H0HA 2QSYA 1X6GA 1E2DA 1CJKC 1NN3A 1BS1A 4CEHB 1LTQA 5FI1B 2QT0A 2QMUA 4II7A 2OE2A 4F91B 5AWFC 1TAGA 2O8EA 2B7BA 3U7FB 1DS6A 4RTXA 2X77A 4LDJA 1XTQA 3A36A 4JLBA 2FMXA 4HUTA 1DE0A 4F17A 4C30A 2K3BA 2QAJA 4YMVA 1WFWA 2ORVA 3CPEA 3K0CA 1MO6A 1FQJA 4HB3A 2P6RA 1KMQA 4KSBA 2ZYVX 3CX8A 1I07A 2ROLA 2DCUA 5E7JA 4QL3A 1YR9A 4PHGA 2NZJA 5KYKA 3TR5A 4BLSA 2N42A 3TR0A 4M9XA 4Q4LA 2D74A 2BJVA 4UNNA 3LV8A 3L43A 2XJ9A 1XEWX 4TQUS 3EG3A 1QG2A 2W0MA 4C0QC 4J9FA 3VS4A 3EXAA 4QT7A 2DB3A 4G3XA 2F2XA 3CR7A 4CC3A 3ZL7C 2W2TA 4JMPA 4IDOA 3K9GA 1Z6AA 4WOPA 3RC3A 5C2JB 2FN4A 2QUZA 3KQKA 2CT4A 2O88A 4ZO4A 1CJMA 2K79A 2X2EA 1FX0B 2KXCA 4BPBA 4LJ6A 4CEIB 3AKCA 3Q5EA 3QKTA 3CQTA 4TMWA 4S2EA 1E1RA 2HXYA 3LQQA 3KQNA 2ZRMA 4TN1A 3AF3A 4RTWA 4BQSA 1XTSA 4M1TA 1E2IA 2MSEB 4E5UA 4JZ4A 1CIPA 3C15C 4S35A 2P5SA 2XB2A 2H5EA 4Q7KA 2KE5A 3RBBB 2VWFA 4PPGA 1CKAA 3A1TA 4MUAA 2JW4A 1YP5A 2FZLA 3BFKA 4B3FX 2QMEA 4K46A 3KL4A 3CF6R 4DLSA 5J4HA 1KKMA 4HB0A 4EKDA 2VP4A 2ODEA 1E0KA 2D3WA 4P3YA 4LHWA 4V0LA 3THOA 3WMFA 2EYXA 2DPXA 4MKFA 1XZPA 3LVRE 1AGPA 5CYPA 4CEJB 2LMJA 1XEXB 3L0PA 4QRHA 4UJ5A 1XF9A 4QGHA 1E9BA 1R0ZA 721PA 1U0LA 2DJQA 1KY2A 4PAQA 1G3UA 3L2OB 2AK5A 4G1UC 3J81k 1QKXA 2EVWX 3I73A 4HLDA 4B47A 2RGEA 5GJBA 4AFQC 3AF4A 4OMNA 4WBSA 2FOLA 3REGA 3EWAA 1N0WA 4Q7MB 2ZJ8A 2R2AA 4M2LA 5EP1A 1XTRA 3T06B 4WAUA 5D3QA 1KMHB 4QGGA 2X1VA 2WICA 4IXNA 4TMXA 1E2GA 3M0PA 2JM9A 1K0XA 3WNCA 1ZM9A 4B3DA 5IXFA 4C7OA 1JR6A 5E4FA 3OE7D 3ZIAA 4IOKA 4LJ5A 1RRGA 2W6IA 4BUJA 3KUDA 3AVPA 3B1ZA 4GMDA 3RS4A 2E9SA 2W58A 3AH8A 2OESA 4PTLA 4TYWA 2RGNC 5GVSA 3C0CA 1JQQA 3I1FA 1R2QA 1NBMD 1A1VA 2BEJA 2EBPA 1AVZC 3CONA 2A28A 3Q3JB 2J1LA 2JEOA 3CX6A 1Q3TA 3RS0A 2FG5A 4M22A 4JLOA 2IS6A 5DE3A 1G5TA 3IHLA 4P4UA 4HB4A 1SHGA 1JAIA 3JZAA 4IOMA 4WXPA 4WA7A 2J6KA 1S2MA 1XMIA 1UADA 1U98A 2J7PD 1AM4D 3VR4A 1HT2E 5FPHA 1YN8A 1M7BA 2BC9A 3CWZA 3KQLA 3FMOB 2XSZA 5EQTA 3B1WA 2HUPA 2BZXA 1ZNYA 3DZ8A 2WWHA 4CW7A 3QXXA 1M3CA 3LLUA 5AUQA 3ADCA 2C0IA 2A5FA 2VL7A 4F4CA 1R0WA 4PZYA 1I4TD 2ORIA 5DLQC 4JJCA 1RVDA 4MQBA 2PZ1A 1NVWQ 3WYGA 3EHRA 4DCNA 2JA1A 3M0TA 4LJ9A 2GF9A 2GBLC 4N3NA 4C0JA 2V1RA 1GBQA 1NY6A 4L15A 3QKSA 5JBQA 1F6BA 1T91A 1J99A 2O0HA 5C1BA 1WA5A 1US8B 2W6ID 1S1NA 1E99A 1U5SA 2WOOA 1XPRA 3CNLA 2W0ZA 3DL0A 1PKSA 2NIPA 4Q4HB 5AJVB 1AKEA 2DHRA 1KY3A 5HCKA 1FUKA 2RCNA 4EPYA 3CZPA 2HCJB 5CLLA 5LBIA 4ZCMA 2OCYC 3OEHA 1CKBA 1SEMA 3U3OA 1OW3B 2WWXA 3EG5A 4KHZA 4DUGA 3H0IA 1TQ2A 2A7QA 2O8DA 1G8GA 1PRLC 2HEQA 1K76A 4PXAA 3W90A 2HT6A 3HYRA 4LHZA 3RWOA 2GTOA 2VIIA 2BJWA 3RSOA 1OFTA 3UXMA 3P27A 3REBB 2ZVPX 1GNQA 2IYSA 4NKRA 4PZZA 1PLJA 4F16A 2FRWA 4N0EA 4C3ZA 4MUBA 3TJZA 3VNUA 1LVGA 2E87A 4LOAA 4A0HA 4DDVA 4GP6A 1GKIA 4AFSC 2IXFA 2W0SA 4KXFB 3WMGA 1NY5A 1S1CA 4LE9A 2VHCA 1U9IC 3HP1A 5HE8A 4GZLA 1D2MA 1X1SA 1QLYA 1NIPA 6Q21A 1ZM7A 3B78A 1BH2A 4B43A 4TQ9A 4ZIRB 1KI6A 2R8RA 1OOTA 3CM0A 2PLFA 3RANA 1EK0A 4GL2A 3H1TA 4RTYA 2XNDD 3QKRA 5J5CA 3VR3A 1G7SA 3X1DA 1U90A 2ED1A 3L0OA 3AP2A 1TNDA 2OFOA 4OJQA 1OYWA 1RI9A 1D9XA 1KDPA 1X8JA 3QG1A 2ODWA 4V02A 4EQ6B 3LA6A 4RTUA 1K6MA 4MGKR 2JATA 1TUEA 2B86A 1OH8A 3MCAA 1I4DD 2WMNB 2ERYA 3QBTA 1T6NA 4JVNA 5TDHA 4PC2A 5DHAA 4L4UA 2GNCA 1WQ1R 4MYCA 2J0SA 2JGNA 3MAAC 4MDEA 3MSXA 3NEJA 5TVKA 4NYJR 2IUUA 3FE2A 2CH4A 4HZUA 3H41A 1FTNA 4DB4A 2EYZA 2G0NA 2DL7A 4KYIB 1FFHA 2ZE5A 1ZD8A 4GP7A 1W36D 1MT0A 2ROTA 2QENA 2F1IA 3GLIB 2R62A 4KCGA 2G3YA 1NLZA 3RABA 5DN6D 1HQCA 3VHXA 1KKLA 4C0KA 4DLTA 5BN3A 2GXUA 2CVHA 3LXRA 4JYBA 3R20A 1AGRA 1MO5A 1ARKA 3HU2A 4JLJA 4RD2A 3GLIE 2CE2X 5FTMA 2H18A 1MUZA 4IDHA 5JRJA 2Q6TA 2QBYA 2WWGA 4WCIA 4NCJA 4QOSA 1WDTA 5JCPA 4D81A 3R7WB 3W3ZB 1CP2A 2DYBA 1BOFA 2YNMA 5G3ZA 1T3LA 3GQBA 2DYKA 2RH5A 4AIIA 4DBLC 2H16A 2QY9A 2XX3A 4MRSA 2DVJA 3VR5A 3DVLA 4RZ3A 3WP1B 2LKCA 2WWWA 5KNDA 1UBGA 1KO8A 1NN0A 4NCNA 4TYNA 3A4MA 3G5UA 5BN4A 2DF6A 4A0FA 2L3QA 2P65A 1PVOA 3R9IA 1ZNWA 2ZRDA 3DKPA 5L3QB 3GJ7A 1XD8A 3W6PA 3X1WA 1OT3A 3SC3A 1TADA 4RCZA 2Q9BA 5TV2A 1HQYE 1G3MA 2I3BA 2YVUA 3WHKA 1NG9A 2OO7A 3CRRA 4B74A 2PEYA 3NXSA 3U2QA 5KTYA 3CLVA 3K9LA 1W2HA 2QP9X 4ILEA 4KLNA 2GBQA 4V0OA 4AG5A 1P3JA 1P6XA 2CREA 3QXCA 4Q66C 4NYIQ 5CITA 2OEPA 2ANBA 3NH9A 5DIFA 5DN6A 2BHRA 3CR8A 1W36C 5CYOA 4PHHA 2FE4A 1Q1QA 3N70A 3PVQA 3EZ2A 1GVNB 1KI7A 2MSDB 3O8CA 1P75A 2ZUBA 5F9HA 1E2FA 1YR6A 1GG2A 1Z9ZA 1CULC 3QJYA 1CF4A 5GJCA 2OBLA 2O8BA 4GT1A 3B6EA 1H3HA 2ZRNA 4LJ4A 5KPJA 1Q20A 4FMDB 1COWD 3UPUA 4AC9A 1SKYE 2V1UA 2JDIA 1QF9A 2IT1A 3QI2A 3GFTA 3K8YA 1G8HA 5JJLA 1EFRD 2Q3MA 4W7SA 3S1AB 5I11A 421PA 3AEZA 3E2IA 4IXMA 3REFA 1GL9B 3FMPB 1K5DA 4QHYA 3NBYC 5CB8A 1IXSB 1XNJA 1T0JB 3IIJA 2BEKA 3VS3A 3BWDD 3ZIAD 1SULA 3MWJA 4NZYA 3SQWA 5ECAA 3GPLA 3EHQA 1Q22A 1AWXA 2R6DA 4FMCF 3QF7A 4LPKA 2QRNA 1O3YA 1R8QA 1IXRC 1OF1A 4TL7A 5FUXA 3TSOA 3O5ZA 1CRQA 4M1WA 3M0RA 1XBTA 3R6NA 3ZQ6A 4DLRA 2H8KA 5CK4A 2ZSDA 4PQYA 1G20E 2LP5A 5E7MA 2EW1A 1PNJA 2MSCB 4LJAA 4ITRC 3THXB 3UATA 1ONBA 2RGCA 1MO4A 1WXQA 2WM9B 1GL5A 1ESMA 2CXXA 4Q1DA 1G64A 5H68A 2R44A 2PMDA 4IW3B 1RLPC 3EZ9A 2J7PA 3VRYA 4HYYA 3U6BA 1II8A 2OAWA 1E9DA 3CPHA 4LYJA 1GFCA 2A08A 2OFWA 4JSYA 1OHHA 2IYLD 4MRRA 2JDID 4B3XA 4ON9A 4URWR 1OE0A 1R8SA 1E1QD 2VTKA 5IK2D 1YE8A 4YMTA 2DRMA 4QC2A 2QQ0A 3U5ZB 2B21A 1XOVA 1RW4A 2J41A 2NUZA 1J90A 3MWLA 3T1VA 2BWJA 1MV5A 4R7ZA 2DL8A 4IOLA 2PJRA 1VIYA 2VF8A 5LD2C 2WMOB 3QPUA 2MIOA 5KSPA 5DO9A 2CNWD 1ZBDA 2GZAA 4DZZA 3TMKA 5H8WA 4NMMA 2FRYA 1KAGA 2JMAA 2DWOA 4KODA 2XZLA 4HZIA 4LN2A 3OF5A 2HJVA 4A63B 3LBHA 4UJ3A 4IJMA 4Z1MD 1G8PA 4BRWA 2JJ2D 1Y63A 2XZOA 1BO6A 4QBGB 2IX3A 1DAKA 1L7VC 2R6CA 2RQVA 2RHDA 5FL3A 3VKWA 1TEXA 1Z9QA 1JJ7A 1WXTA 1S1MA 3AVWA 1OFUX 2FNAA 1VG0B 5LDDC 3I61A 4ZKEA 4EFNA 1ZC3A 2DFKB 4Q1BA 2DBMA 2RAPA 4YC7A 2ODBA 3B60A 2DWQA 1ZUUA 4N0DA 5G40A 1N3BA 1UDXA 2QPTA 2IC5A 4V0MA 3ZGXA 1II0A 2ZJ5A 1M30A 5FI0B 2IXEA 4R98A 2P3SA 1A5TA 4IEIA 2TMKA 4ESHA 3B8HA 1U8ZA 4FWIB 4DLZA 2W83A 1UEIA 4PSAA 3KQUA 2GEUA 2XEXA 3Q8XB 5FWBA 1PRMC 4Q7LA 1A82A 2IYRA 1JEEA 3RS7A 2IYYA 4I81A 4LRWA 5TXGA 4Q1AA 3K70B 2DILA 1KGDA 5ANRB 1OIVA 1ETUA 1LNZA 3N5CA 4LY6A 3KUCA 2KT1A 4EPWA 4D80A 4Z54A 5EE0A 4PPQA 1K5GA 3PV0A 1XMVA 5DH9A 3U7HB 2B6HA 2ONKA 2P5TB 3GBQA 3EASA 4DLYA 3R9WA 1ZJ6A 4GOJA 2HDAA 1ZCAA 5HCIA 3IBGA 1H8HD 4Y0VA 5EE9A 2FV8A 4AD8A 2YV5A 2O0JA 3GJ6A 2AKKA 4KSCA 2GAAA 2N1BA 2OAQ1 2VRWA 3BH7A 3W9YA 3I62A 1IAQA 1GFDA 2OG2A 4IIMA 1HA3A 2GCOB 1DPFA 4QXAA 3T34A 3MFYA 2I4IA 4XH9B 3LVQE 2A9KA 4D0GA 4D25A 3ADKA 3UMSA 1SHFA 4KI0A 4W5WA 4MA4A 1E6GA 4HDOB 621PA 1BKDR 1W2GA 3GLHE 2ZE7A 5SZJA 1ZIPA 4B75A 4BRUA 4AWXA 4LHXA 2GEDA 4KV9A 3IDQA 3F8TA 3GLGE 5L8VA 4W9MC 3AGPA 4O25A 2BDTA 1RRFA 4HATA 4OYHA 4Q1FA 5IXBA 3P26A 2AKYA 2JLVA 3I8SA 3GJXC 3O8RA 3PFIA 2ZM5A 1ZM2A 1LW7A 1P9RA 1WB9A 1H8EA 3T61A 2E5KA 2QROA 2WJVA 5HKKA 1HURA 2EGAA 2QNRA 4IVRA 2RKOA 1Z28A 3CRVA 3NC0C 4QJ4A 2HV8A 1JPNA 1CSKA 4HUQB 4DDUA 2EQBA 2QTVB 2QU8A 2DBKA 2D06A 3BBPA 4TSFD 2A5JA 1F2UA 3N2IA 4TL6A 1PLLA 2AKAB 3Q9LA 1KJYA 3HWSA 1XCGB 4E03A 1XCPA 3ECCA 2R6GA 2OHFA 1W1WA 2X3WD 2RGNA 5CJ2A 4NE2A 1R5NA 3AF1A 3BGWA 3FFBA 4P4SB 1UG1A 1EFHA 3BERA 1AQYA 1N6RA 3TBKA 4HVVA 2OBMA 4KBGA 4O2LA 4FMBB 4Q4HA 4DIDA 2HCBA 1NSTA 1X43A 1MO3A 3AF2A 1DELA 3WYAA 2KXDA 3SYNA 4XIGS 1QBKC 3X2SA 5JHGB 1DG1G 1XXHB 1AD5A 2OZEA 2JLYA 2XMFA 3V4RA 1W36B 3KB1A 3ADBA 4Y0AA 1ESNA 4RD4A 5KUTA 1NF3A 4TLCA 5FOXA 1GNPA 1NIJA 5JCZA 2J46A 4HAZA 1JAHA 2UKDA 2NO1A 5GJVB 5ELXA 4XTRA 1TF5A 4HDQB 2ZIAA 4ZV4A 3PCRB 1HY3A 4FMDF 1P9NA 1HT1E 3PITA 1G3RA 1MH1A 3BAFA 4QGAA 3KFVA 2WTUA 1QHYA 3I5SA 2A5YB 4QBIA 1TL7C 3OZXA 3LBIA 3VQTA 2EYWA 1U3OA 1VHTA 1OSNA 2VHJA 2RGXA 2L0AA 3CNOA 1HEIA 2QI9C 4EFMA 1ZIOA 1I4LD 2JJ1D 1UDLA 5DI3A 4C0SA 2ENMA 1ABQA 1TUCA 4O0MA 3DO6A 1N6LA 3UIEA 2RGGA 1GAJA 2ZI9A 3LW7A 1G41A 4B48A 4LYAA 1A7JA 2QP4A 2QN6A 3QY0A 1PWTA 1KNQA 3GCGA 2DL3A 1BYUA 2D4HA 4DCTA 5JI2E 2W6JD 4MYHA 3R7WA 4RFSB 2FEOA 4HAYA 2F2WA 1U99A 1KDRA 1OIXA 1XEWY 2QZ4A 4RD3A 4H1UA 1OIWA 3RLFA 2IS2A 1YZLA 1AS2A 4KU4A 3FYHA 4EAQA 3TIFA 1D5CA 2H1LA 2NWMA 4KFUA 4LWZA 3TQCA 4DSNA 5TY0A 4LNPA 4A36A 3UG6A 5FBRB 5GJWC 3GLFA 2ODNA 1DARA 2O8CB 2QA5A 1AK2A 2O9VA 3BORA 3CNNA 1XCMA 1FL9A 5B30A 1OHHD 1G83A 1I2MA 1KI4A 1Q44A 5C46F 4JYCA 1CBUA 2VP9A 3FHOA 2KI5A 2ZJBA 4B33A 1P2VA 3AVUA 2DRKA 5KSOA 1E9SA 1UKVY 1XJCA 2ERXA 1XRJA 2O2OA 1SQ5A 1UAAA 3IGFA 2DL4A 3SEAA 4URVR 3LNCA 2DL5A 4OHXA 1U8AA 5DYGA 4YDHB 3AV0B 1JEGA 1FUUA 3K0CC 2GBLA 2HLDA 1T0JA 3OIYA 5CM8B 4ACBA 1ZD1A 1EFTA 3B82A 3ZQJA 2CDTA 1ZX6A 1Z0JA 2ZQ5A 3V9PA 1PUIA 4EPTA 1FP6A 4RFSA 4PHFA 3L0IB 2P4RA 1CU1A 3JV3A 1RKBA 2JJ2A 5D3MA 5EXXA 2XZPA 1PJRA 2P6UA 2WSSA 1G21E 1RRPA 3AQ4A 2CJWA 2QTHA 4PQFA 4TLDA 3FTQA 1WBDA 2EW3A 2DX1A 1XJ0A 1E2KA 2A2ZA 2FFAA 1TUDA 2DNUA 2V6JA 4LV5B 4TYQA 4ZPXA 1EFNA 1EX6A 3QWYA 2VPPA 1FQKA 3CF0A 3HDTA 4M9QA 3VS5A 5FBWB 5CDFE 3W34A 2C03A 3PXGA 2C9CA 5AJXA 1YRBA 4L16A 4KFTA 2RHMA 4RTVA 3RRNA 1DADA 2UZIR 1J7KA 4JIMA 3GFOA 3GLFE 1Q3HA 1OH6A 3AVYA 1ZUIA 2CT3A 1KYIA 3WP0A 2WJGA 2ED0A 4RJLA 5BN5A 2O8FB 1VA7A 1CTQA 2PH1A 5FUYA 3K09C 3CH5A 3FMIA 3SYKA 4NTZA 3ZS8A 1VHLA 4GSYA 4OHYA 1D2EA 2CCKA 2G1JA 4Q4AA 2IXGA 4NCHA 2ZRKA 2F55A 1PHTA 4HUQA 4M1SA 5SZIA 3A6PC 2WAXA 2G6FX
chains in the Genus database with same CATH superfamily
4GL4A 2DFDA 3AY0A 2O9SA 4UEJA 2C7GA 1BXZA 1O6BA 4EUEA 4UC4A 2CHVA 5JV5A 5GAOp 1NW9B 3B2EA 5KC9A 1WHKA 5HTKA 3CKYA 4OGGA 1YBAA 4QKUA 5TS2A 2E7ZA 3CVYA 2J3HA 4QPJC 1T15A 4LMPA 1JXQA 2VSFA 1HXDA 1T0HB 3WYNA 5ALJA 4DV2B 2PMWB 2Z3VA 4CCYA 1T8TA 2HFKA 1X8XA 4OY3A 5ADWA 1KP3A 4OLAA 2WM8A 4EUNA 1WZIA 3JPWA 4J90A 5CPFA 5FLXE 4MP8A 1UBMS 1QF6A 1R9GA 3MIZA 2XG8D 3QKSB 3ZCUA 4C4YA 2DLPA 1ZCZA 2XXAA 2WU4A 4RPIA 4MS3B 2JTEA 2FLWA 2HSGA 3WBJA 1S2GA 5DTEA 1NVVQ 2W2OA 2NTEA 2X4JA 2CL0X 4JLMA 3R7FA 4RTMA 3DKMA 4OQXA 2XKOC 2FUKA 3VYUB 4JVMA 2RDMA 2O8FA 2XGGA 1XTVA 2I33A 4Z0HO 4FTWA 4N3AA 1RRVA 1YZHA 3IUYA 1OQKA 5JD6A 1GO2A 1MAAA 1PEKE 5I47A 3A1UA 1FSFA 2BCEA 3NGPA 3JQ6A 3CYFA 4HUJA 2AHRA 2O2HA 3Q3EA 5DKFA 3VJMA 4AWAA 1I30A 3CMET 2KW5A 2YVAA 5LJ3d 3KC2A 3QA3E 4JC8A 4V0QA 4B73A 4HX9A 5BMVF 3VJRA 2WYUA 2DUNA 4GX0A 2QTBA 3EARA 2F3TA 3RIGA 3IKLA 1GTJ1 5AOAA 1BU5A 4E5SA 3AETB 2EFCB 4MCJA 4XCVA 4URYR 4I1UA 3RRFA 5JSFA 1NONA 1AC5A 1DIGA 3OZEA 4J0QA 2ASEA 2Q6VA 4M8LA 1V4NA 3R8XA 1CY6A 3V00A 4CMHA 3VV0A 4PNZA 4YIKA 1ZR2A 1HNNA 3FETA 3HUEA 4I2NA 4ZQBA 4XK8E 1JDPA 2V6BA 3LF2A 4RA6A 4X8MA 5BVHA 4D02A 2XF8A 4BI8B 4PANA 5FOUA 1ZD3A 4ENSA 4L5YA 2FJUA 1RYFA 2WM3A 1EU1A 1L8LA 3TFQA 1KHCA 1W4ZA 3OMXA 4X6LA 2VWGA 1FCJA 3A4LA 1RI4A 4ZOBA 1DXQA 1G5QA 1RE0A 1O96B 4C0DB 2G07A 5DNDA 4ZCLA 4BNMA 5K8CA 1B0UA 3HKEB 4MGZR 5E9AA 3THWA 2VNKA 4YB8A 1VZ2A 1DDOA 2QMZA 2FPXA 3N74A 2BZYA 1KHTA 5BUQA 3FPLA 3OU2A 5AJHA 4RG8A 2GTJA 3IC5A 4X66B 3IAEA 3DW1X 1WLSA 4KXLA 1AWJA 4L22A 4FXPA 4ABTA 3FVTA 3IEPA 1TPYA 2G63A 4J75A 4X20A 3GLFB 1NJIC 4QNNA 4D6XA 1NSYA 4EG0A 1PZEA 4Q01A 1L7NA 2C07A 4HRYA 4EG1A 1NUHA 2QYOA 1JSLA 4D74A 1MV8A 2VVTA 5GONA 5G53C 4MZPA 4U8GA 1MDFA 1BA2A 1JHQA 1JR3A 3M5DA 1WUJS 1U81A 2IUTA 4HPWA 2CJYA 3AIKA 1PQWA 1Z0IA 2NVBA 3LUHA 2P9QA 2GCGA 3AUKA 1UFRA 1FQWA 2RGWA 4O6JA 1IN4A 1C4WA 3GNGA 1KZ4A 2JCYA 2M6RA 5CO7A 1TQ6A 1VI5A 2WDPA 4GBED 2XCTB 1Q92A 1F06A 1FXWA 2GHTA 3OZFA 4HDCA 4OFXA 3ZNOA 3IILA 4BJ5A 1VQOA 2HZ7A 2IHJA 3GCWA 5FTKA 3AETA 3CUYA 2EZUA 4MW9A 3ROQA 2XUAA 1L3CA 1NW6A 3GWGA 1GTG1 4DLLA 2BBWA 4Y7DA 1XZEA 1MXFA 3PU6A 5FXMA 4KGDA 5HF8A 2IV2X 2J6OA 1XV5A 1ZNQO 2BUAA 2H7XA 2QYSA 2WJPA 3O3NB 2XHZA 3DE6X 3Q5DA 1TGVA 2HL5C 4X41A 4XD2A 1DO8A 2UVPB 1R4NB 1BCSB 1R6TA 3GR6A 4YTLA 2QD2A 2XA9A 2YJ6A 1JB9A 4JYMA 5KVQA 3UFXA 5C18A 4WNAA 1M6YA 2YHIA 1ISHA 2FPPA 5LC1A 2BTTA 4DA0A 5J58A 2COYA 1HMYA 1IM2A 1ZSVA 4PSDA 4YRLA 2PLRA 2HMAA 3HKEA 5AUNB 4ZYLA 1MOZA 4FEEA 1WHTB 4YV7A 1G9TA 2OK8A 3LGAA 5H82A 3ESXA 2AYYA 4LOLA 5J47A 2Q3FA 2QAGC 4JLUA 4OB1B 4CM8A 3E5HA 1MX9A 1KQ2A 4R0VA 2FEIA 4R05A 3RC1A 6ADHA 3N9IA 2I87A 3PX7A 4JNKA 3K5PA 3H19A 4J4HA 2ZGWA 2RB5A 2WTNA 5AJUA 4ZVKA 2QTFA 1T9HA 3QENA 4TLLB 3FTDA 1W87A 3W78A 5LLSA 3P2YA 4BFXA 4MMLA 3L7CA 3DEKA 2FWAA 1YQWA 3PSHA 2D2XA 4IHJA 2AYXA 4RW0A 4UHDA 4J9EA 2YJ3A 4C5EA 1P1RA 4JSRA 1EA5A 4G1BA 2PUAA 4QEKA 2QN7A 2HIHA 1MJFA 1VG8A 4BE2A 1WDXA 1C0EA 2CYBA 2REBA 4DLNA 2LBPA 3LQ1A 1R12A 5CEEA 2I3AA 4Z89A 3CISA 1E6CA 4DTCA 2FXVA 3T1QA 4DR7B 3FW1A 4F2GA 1KQOA 3JQGB 4JT2A 3FNHA 2KK4A 1KI6B 3PE3A 3TQOA 4XUEA 2ZSAA 1NZJA 1R88A 4QQGA 2CMHA 2X40A 2YYAA 3IV7A 2V1QA 2XDDA 1F0YA 3G02A 4JB2A 4YIHA 3ICEA 2J0VA 1UJ2A 4RE6A 5EG5A 2BGKA 1F1BB 2JGDA 1UFOA 4UUOA 3PC2A 2RD2A 1DG3A 1LBEA 5A62A 1BX3A 2O5VA 4O2AF 2CFSA 3DXFA 5IXYA 2M9MA 2ESWA 1CUAA 4BZZA 3L6OO 3OY2A 1KRXA 1DAHA 5EJ6A 3VU8A 2N0SA 1DXOA 3RFVA 1T5HX 3CPWS 1PK8A 3DMDA 3DWEX 2HAEA 4PAOA 4X00A 1GAEO 1PE0A 3HP4A 3QEOA 3FN4A 1HE4A 4JOSA 4AYWA 1L7OA 4BNNA 1RFLA 4Y2HA 2F8MA 5ITZB 1JI0A 1N5ZA 3LWNA 3MFQA 3ZK9A 1BMTA 1SG6A 1SXJB 3CEHA 2ZQZA 4J4BA 2X5JO 1NW7A 4WDRA 2P9BA 1C3JA 3GT7A 2ORED 3NONA 4ER3A 1T8RA 1YCHA 3IE1A 1DZIA 3FYUB 2BR4A 4JEMA 4Q9NA 4ZDKA 1TO2E 4I4TB 3R6WA 3SWNB 1AZEA 2PUWA 2QM8A 2CVZA 4MWEA 2FPIA 5EGNA 3Q7PA 3UCFA 4F3RA 3MN1A 4E5DA 3MEQA 5D01A 1QP0A 1GEEA 2LPMA 2WU0A 3EYAA 3UXYA 1R16A 1UBLS 2Z9DA 2R7AA 3B52X 1QAMA 3KSUA 3P0RA 4EKYA 2JAXA 3BMOB 1U4SA 1ZSZC 1ZNZA 3HPQA 2GXQA 2G5TA 2HMSA 1PU2A 3PVLA 3GW8A 4UHBA 4IG4A 3ZV5A 2W42A 1KOJA 2AN9A 5DI9A 3IQLA 2JFGA 4GE3A 1NXSA 4M1MA 2WYWA 3VBEA 1W19A 2D5CA 1A0OA 1O58A 2E4ZA 4BV2A 2HQRA 1A2BA 1SCQA 2NVOA 4N03A 2KGTA 4TT3A 4QOIA 3QPCA 1GU7A 4I50A 2R8YA 3AJ8A 3WB0A 4EKNB 2IKQA 3L1HA 3OLZA 1T9ZA 4YP7A 4EHFA 3E1GA 3RGWS 2JLAA 2ODQA 3OWXA 3FPFA 3V8BA 3BSWA 2OTCA 5JS2A 5B5SA 2R7NA 5KYUB 2NZ8A 3RC9A 1T1JA 2UV8A 3V8JA 1ZWKA 1AIPA 3KO8A 3QU5A 2WF8A 3CLUD 4HWRA 2IPNA 1FYXA 2DJIA 5FTLA 3QJ6A 1PT5A 2Q5IA 4DKXA 3BK7A 5B37A 1VBMA 3K09A 1I51A 1TM7E 2GCPA 1FTYA 4RZQA 1GRIA 4ZI7A 1V5WA 4IVNA 1CR6A 1G2OA 3VH3A 5AW8A 3DKIA 1DT3A 2OGWA 2FMFA 4ZQFA 4UPVA 5M3BA 2VEOA 4I1VA 5EEHA 3HCPA 5LP6B 1R8OB 5KTKA 2WG2A 2HA2A 4OK5A 3PKZA 2ECOA 3H16A 4FW1A 3AJDA 2ZS8A 3K6SA 2D7DA 3OOYA 3H2ZA 5ESWA 4DEVA 3P5BA 1L5MA 1WMSA 2WE8A 3HSSA 2WAAA 1VHWA 1FS6A 3GPDG 3ME5A 2GZHA 3N2GA 3RBAA 3CCLA 521PA 1D3BA 4PJJA 3KQVA 1ODJA 2UYCA 3WRYC 2QHXA 3BK1A 4ARCA 3SYRA 3LO5A 2G3RA 4NYMR 1T36B 4A82A 1I5OB 1T26A 1XZKA 4ZT3A 4CMEC 3L41A 3EZXA 2RHLA 2BOVA 3DLHA 3P0IA 4NU8X 4AO7A 2HA4A 2QLNA 4US0R 4DLKA 3ZH2A 1Z4IA 3R1IA 3M1AA 3D8RA 3BF7A 3KG2A 1ZA1B 1RRCA 1IVNA 4HDNB 1Y7HA 4UZEA 2P2LA 1SC6A 4QU5A 3FIJA 3PIDA 3ZXUB 4HJRA 4ZN6A 1PN3A 3RU7A 3OESA 4JOQA 1RQPA 3A4IA 1WYXA 1N9ZA 4BMVA 1YASA 1YCSB 3UH0A 2ABLA 1CE8A 4BX9A 2OI3A 3ZQUA 1N0UA 3WICA 3V8LA 3B3FA 2F3RA 2Y4XA 3GG9A 1X3LA 2EGCA 3O4JA 2PT7A 2Q5JA 4PVDA 1Y9JA 1KD1R 2D5AA 3EXIA 4NDNE 2LQNA 2R97A 2HU5A 1R6VA 3J7TA 4AXBA 2DFVA 4AMGA 1U63A 2GNPA 1ISFA 3GJZA 1MMNA 2EQKA 5CB4A 4WJKB 2I1LA 1YL7A 4D5GA 4BJHB 1ABBA 2PL1A 1ZIDA 4CTMA 1X8LA 4QLOA 2Z58A 4QBFA 4U9HS 3G8CA 3SSAA 3K0FA 4N47A 2O2YA 2Q0HA 3IEUA 3P96A 5K8UA 2XH8A 2IWRA 4G8BA 3I32A 3I5RA 4WKPA 4A0GA 2P2GA 3GGCA 5CA0A 3ZVKA 1VQKA 1T1IA 4YMWA 3PLRA 4QFBA 4JCCA 3UANA 1Q1NA 5JC8A 4ND8A 1SHKA 1P8AA 1K73R 5D6XA 2HSDA 5FYDA 4HMPA 4I99A 2O5RA 3ZDYB 3WAJA 3HBNA 1XVLA 3C3WA 3EF1A 3HGMA 5IN5A 2VXFA 3MTEA 2VP0A 3GFBA 3IQWA 4PJOC 3PDIB 2B7CA 3FYCA 2I7DA 4AY2A 3Q0EA 3C39A 3KOXA 1J2TA 4OB0B 4CLOA 3V32A 3WGZA 4B6MA 2F90A 3ELBA 3WJ1A 3WLTA 2C83A 1GA4A 1RYBA 2ZBQA 5CCEA 1M33A 5CFOA 2Q1UA 4ENTA 2DT8A 1PD1A 3VOAA 3DKKA 4QGFA 2BN4A 3K9BA 2HIAA 3G1UA 1RZUA 4JT9A 5FLXA 1N6HA 4OJKA 1LDEA 4QBHA 4Y2GA 3LWDA 3SHQA 4BEJA 1H9CA 2YTZA 4UAGA 5HXAA 4KITB 3U7RA 2Q2NA 4P82A 5M7EA 5FRNA 1SG0A 3MF4A 5AXCA 4DR4B 1WB4A 3ITKA 3X20B 2R8XA 4B45A 3OHPA 4DC1A 3O1JC 5H7XA 5FJJA 3FTCA 4JJ6A 4P34A 1VMEA 1AKQA 5FLYA 3VX4A 3WWDA 5DM7R 3S99A 4HZGA 3TNFA 1VQ4A 2D2EA 4MEJA 3KCQA 4ZOEA 1VMAA 2VHEA 1E2LA 1UGVA 1VQ5A 3KNZA 4GUAA 1K7SN 2CP6A 3NBAA 3UJDA 2O3RA 4DZTA 4BVBA 5B2EA 3BXGA 1R5OA 2QRHA 4F56A 3R75A 4I1OA 1FMFA 4MLPA 5GAN6 2H5JA 3DMNA 2Y0DA 1NBAA 4ZOCA 4BY9E 1NEGA 1K1ZA 1G7RA 1QHGA 3QQ5A 4M9UA 3VC2A 4J7FA 1BI1A 2P6MA 3NG1A 5L9AA 3LH5A 3KU4A 3S55A 1V25A 4S1WA 3PLAE 3Q88A 4Q12A 2EFYA 2G9VA 3DAOA 5HZMA 4U0JA 3A9SA 4CQJA 4J29A 3PE0A 2QXUA 4A4KA 5AW0A 1DOHA 4IGFA 2RI0A 4JJDA 3HYCA 3WNDA 5B64A 3QWHA 2ZT5A 2OUKA 4LJKA 4Y2VA 1UPUA 5HNKA 2PSFA 4BDYA 1C41A 5AW2A 4R3NA 1XMPA 1ZI8A 4L7QA 3TW8B 2V5VA 4PNHA 4J9CA 5FOWA 3A1DA 3AV3A 4DJTA 2FP4B 4TS1A 2HL6A 5EXEA 3W5DA 10MHA 1QHIA 4MH0R 4QO8A 2RK2A 4UBIA 1H1LB 4M78E 1T5LA 1Q86U 1UXOA 1ZK3A 4X1KA 3JD0A 2PFSA 1QYVA 5FPTA 3ZCTA 2VAWA 1X2QA 4MGIR 2IHKA 4L4YA 2XVXA 3PEUA 4F38A 1X7XB 2B37A 1D0VA 1ID1A 1JIJA 2YZKA 2OC4A 3R44A 3ENNA 2B8WA 2PQWA 3RJMA 4NX2A 1YB6A 2GAIA 1WUTA 3B5IA 4UVIA 4I50F 4WT7A 1BB9A 4ZYVA 1HETA 5FB3A 1EVKA 4U6QA 3CWQA 4M1KA 4KR9A 1EXWA 3I6QA 3W5JA 1ZUKA 3NUZA 2GN8A 2ZREA 5IKOA 4G09A 5KTSA 1RAGA 1L2TA 3NM5A 4UU1A 3T99A 2Q6KA 4M78G 1AF7A 2XDQA 5F5XA 4A5SA 3UMRA 5JRDS 5K3BA 5LM3A 1UAGA 1LPBB 5EJFA 1Z07A 1KE1A 2O8CA 2PVOB 4EMHA 1KD1C 1F14A 1IEXA 1TCVA 3G82C 3KQOA 4ND3A 5A7GA 3CCFA 4L59A 1BI0A 3DFUA 4RLHA 1Q0LA 3L4JA 4KHPB 2Y92A 3ASYA 3L8FA 1YNZA 2GDJA 2XBUA 2DRIA 3LCCA 3QIVA 1SOMA 3FSGA 2MYTA 1Q7YC 2PX5A 1DJPA 4WXYB 2H00A 3L8HA 1J2UA 1UBCA 2ZBPA 3B3AA 4P7KA 3V42A 4ZDWA 2Z98A 4KE8A 2V7PA 3V2UA 2P6OA 4XD7D 1WCV1 4FL6A 2J3LA 2Y3IA 4QX6A 3IX7A 3OQ5A 3STYA 3DDUA 5BY2A 2WF9A 2WC1A 1Y7XA 2OC9A 1EIWA 4DA9A 1E77A 2X0DA 4DLVA 1ISSA 3TW8A 1YD7A 4OMMA 1Y4SA 1I5RA 5HBRA 1VXRA 3A1SA 3TBHA 3BM5A 4BZPA 1K5HA 2I8AA 2HD0A 4US2R 4C4RA 3ML1A 1Z35A 2QVBA 3WGLA 3P9CA 5HCNA 1BDMA 2HEIA 4MUMA 4TV9A 5JCJA 2FH5B 1PNOA 1B6GA 2YH2A 3OCXA 4EA9A 4EIWA 3OW2A 1E3SA 2AXNA 3NT5A 4FDMA 1VGRA 1RWBA 3QE3A 1PTJC 4NZ9A 1RCTE 3ZKWB 4FZVA 5THKA 3TXAA 5BWOA 1QO9A 3LUAA 4ZNXA 1AURA 1B07A 1ULZA 4C87A 3VYSB 2GQIA 1N8SA 2AFHE 2JTFA 4M83A 1BGVA 1SVKA 1KARA 2K2WA 1GZ5A 4POOA 4LRXA 3FDIA 5AVTA 3H9CA 2Q3JA 3AFIA 5JFTA 1MGOA 2J9GA 3EVAA 4L95C 4BQRA 2A5GA 5JSZB 1QSGA 4IFBA 1GCQC 2CXNA 2XOKD 4BGIA 1XX6A 1SUAA 2J9YB 1C3LA 1OFUA 4IOJA 4OGLA 3KJZA 3ZU2A 1E1QA 3RCBA 3C6ZA 2BSXA 5H70A 1R8YA 3ZDBA 1AS0A 4F7UE 2Y1OA 4GZ3A 3UAZA 3KSBC 3PNMA 1M6EX 1SG5A 3M6VA 4RKEA 1VQ9Q 3SD4A 6REQA 1SR8A 5AOVA 4GS5A 3LD9A 1BCMA 4G5SA 2UZ3A 3HXLA 4RZIA 2R0QC 3TSCA 5FA8A 4PK4A 2BZ0A 1PYGA 3IEVA 3MERA 5FHRA 4Y9SA 2LX7A 5G02A 2PH7A 3AG5A 3DOJA 3DVAB 1KIKA 3KKMA 4BLVA 4Z9AA 3VVLA 4CG1A 2YDXA 4DLUA 4PYRA 5IT9A 1ODLA 3ZVNA 4ND5A 1MABA 1C9EA 2PZMA 2P3QA 3IQEA 2AC7A 3PUXA 3WKAA 1KG1A 1UPXA 2PMKA 1KRWA 1PT6A 1TS9A 1EINA 1P2TA 1S4QA 3EMKA 1XVTA 2FSIA 4C5GA 5FR1A 1OH5A 3PFNA 4Y2SA 2JLQA 4XJTA 1YV9A 3PT9A 1K27A 1G3IA 3S1LA 4ZI2A 2R8ZA 3CH4B 3JCMe 4Q3CA 3DLLA 1JDBC 1QGED 3F0TA 3G8BA 3IT0A 3KWMA 3VZBA 1NDUA 4GPBA 2KRMA 3PL1A 5BQ3A 2C0CA 2YFKA 4ZAXA 1KC8U 2GHRA 4UFNA 5K3AA 2O3SA 3RTDA 4AJEA 2TMGA 5I3ZA 1PNVA 2HM7A 4D9JA 1YHZA 2H06A 4JXKA 4OO3A 2DVMA 2FEMA 3T3IA 5HRAA 3DDWA 1QH9A 2IY9A 4PLWA 3NTUA 1R0SA 3OSVA 1L9KA 4P08A 1JA1A 3R8FA 3KWJA 4KPUB 1VJ5A 3KLNA 1KJZA 3KM0A 1CXZA 4DMUB 3D02A 3QITA 3RUEA 1Z2PX 2IIBA 1NVAA 1ZVMA 2J09A 2L5QA 3FRNA 5AHKA 1JZSA 3IKJA 3H8ZA 2EQUA 4Q5IA 1A5ZA 1ICEA 1MRSA 3DTYA 1HDCA 3LT4A 3T7AA 5CIQA 3OYIA 1JDBB 3CEYA 1DI0A 2E4AA 2FSUA 2VTEA 1VHJA 4KB5A 2ENUA 3U9SA 3LKDA 5E6RB 2K4MA 1OXTA 1Q91A 2O1EA 4PGAA 4XYGA 3DFKA 3EGOA 2ZI3A 4ZQGA 5AHRA 4ME7A 5ELMA 1J70A 1ZP6A 2DE0X 2G7MC 1GV1A 4QUGA 1K4US 1SCNE 2ID7A 2KROA 1V3TA 4IWYA 3JYQA 1A9XA 4IHAA 2BE7A 4ZICA 3SHWA 1TZCA 3FWPA 5CBPB 3PB3A 3SIPA 1XTZA 1IWOA 4LY9A 1PJBA 1E0AA 4LG1A 1WXUA 1J0DA 1RVV1 3AR4A 4FLMA 4Q0MA 2UYHA 1OBFO 2BIVA 3S68A 3TVDA 3OEYA 3C12A 2CUBA 3G5MA 3IIMA 4QUBA 3IJEB 4CMCA 3RTCA 4ASUD 2HO4A 2PX3A 3PJFA 3GRKA 1TZMA 1FFDA 1G5HA 1QE3A 3BSFA 1AN0A 4ISCA 3H0FA 4MCHA 4ZO7A 3HACA 1VIAA 2QB5A 3IVGA 1YR1A 4KQ9A 3MJHA 4OHMA 1VIVA 3EC2A 3HUTA 2NZYA 4LFBB 3C7TA 1R0CA 4DTIA 1BGXT 1TIPA 3R6LA 3FEOA 3NKLA 1HI9A 4HWOA 4MPJA 4OM7A 4QJ5A 2KWIA 1LSSA 2AUNA 5GANf 3DA8A 1TTQB 3A1VA 1DKMA 3GMSA 5DJ5A 3DZKA 1BX1A 3H84A 4QUKA 4YJ2F 2VHUA 4FFVA 1G8YA 2PKWA 3THYB 2GJKA 4GVLA 5GAMe 1JDZA 1XQYA 1D6SA 2AH5A 2D0OB 3EHDA 2ADOA 1RUWA 1TU4A 4BPRA 2HHJA 4M78C 1KJ9A 2AT1B 3EGXA 3IJPA 4N65A 3AF5A 4MKGA 4BMXA 1ZQ9A 4WL0A 2EFDB 1USIA 3FPCA 1W4BA 1QVFA 4RDHA 4RCYA 5ECYA 3UGQA 5KIAA 2QK0A 1QE5A 4X7MA 2FO0A 3PDWA 4XR9A 1F20A 1E2UA 2FLKA 2VJLA 1DJOA 1BOOA 2GYVA 2QX8A 4G41A 4IILA 4U63A 2OFFA 2OCGA 3R6TA 2BKDN 1SRLA 4K2HA 3T9DA 3EULA 1JN0A 1TM5E 4I14A 4X1KB 4R5MA 2H92A 4HWTA 4OP2A 2XTNA 2ZTSA 4MI6A 4RXUA 3WDKA 1E6MA 4CODB 5CCBA 5BXQC 1TUGB 1AZGB 2VYCA 3NWBA 4YONB 2IFTA 2C0TA 4C4AA 1X38A 5FBLB 2FPDA 4TSRA 5DYNA 3PD0A 1J8YF 5BQ5A 4FXOA 4ZC8A 4NHOA 4UM9B 5JY1A 2V8OA 2IY8A 2AOUB 1L4FA 3UV7A 3VU9B 4BU0A 5EJAA 2SBTA 4FI3C 2PK3A 5GAN5 2Z57A 2EEPA 3WWPA 4D8TA 4H3SA 2QTLA 5BV0A 3WS7A 4R2HA 3LUPA 4DWVA 3A5ZB 3VHRA 1ZSZB 4RX1A 4RY0A 2WPDA 5CQYA 1BX0A 4CQMA 3JQ8A 1D0SA 1Y8RA 1QK3A 1D2GA 2GTIA 1I1HA 2ONYA 3NGXA 4XR4A 1IB6A 4DC9A 3I1JA 4C4SA 3IQIX 3QTLA 4M98A 5JFOA 4LUDA 1JI3A 1JG7A 2FSHA 3I8XA 3F9CA 5KU7A 5D6NA 5K0ZA 3TAHA 3D1VA 3EK2A 3DE2X 4Q7JB 4U7DA 4Q1EA 1G1AA 2BZ8A 1N9KA 1KL7A 2Q99A 4FCVA 3RBXA 2EJWA 2OVBA 3VZPA 5NLLA 3GEPA 5TGDA 2Y1EA 1P0MA 4NPAA 1QIJA 2BM8A 3IXMA 5LQKA 3TM4A 5SZHB 3ZWKA 3ZWMA 1IPFA 3PENA 4UTXA 3VJLA 1UOOA 2BEUB 1WLYA 4ZVUA 4V1CI 5AK5A 4R8SA 3O3MB 1DQNA 3TI9A 4ZQCB 3A1FA 1TMOA 3VFDA 3NIGB 3SBEA 3IEMA 2ZPEB 1N0VC 6NULA 3UMJA 4HVCA 1XKQA 3O84A 5JOQA 4ILKA 4MUGA 1T24A 3AY6A 4UOZA 2YW2A 1GNSA 1QH1A 1R6BX 1V35A 3HV2A 3L82B 1SZPA 3QA9A 4FCTA 1IUPA 1T9GR 2W93A 4ZO6A 4AB1A 4YACA 1VZ3A 4E46A 2F5KA 1VQ7T 1LPPA 2H5IA 3O8QA 4CM3A 4CYMA 5C4IA 1VQLT 3RC8A 1EIZA 2OZLA 3DEHA 2YWJA 1PNRA 2WUGA 4CEHA 1E69A 2KPOA 1KI2A 4YAFA 1HSQA 4HDKB 1UMDB 2WUFA 1PS0A 4J16A 3SC6A 4B3IA 1EG2A 2VOEA 5BXYA 5EG2A 4XSHA 3IAAA 3ZDDA 4DARA 4HRVA 4PQEA 3NYIA 5LYYA 2FB9A 1DEHA 1JEOA 3IO5A 3HYNA 5KYWB 3GZJA 4FFMA 1XZMA 1NX9A 2YHSA 1MVNA 2XOKA 4I3GA 2NPFA 3WHPA 1CUDA 1K9MU 2FSFA 1IGUA 2NXCA 4I7EA 1Y37A 5KDLA 2IVZA 5B4TA 4D26A 2V8KA 2J9XB 3QLUC 2L19A 2CLDX 2CMGA 2WLSA 3H5LA 5KYWA 3COWA 1A50B 5E6SB 1P2SA 4YN3A 3HFOA 1HQDA 1EGAA 1GAQA 1Q0HA 2ZAOA 3AUFA 3TO5A 3W8EA 4F04A 2UUAB 2VPTA 3HB5X 1E2MA 4FFPA 1KFCB 3S44A 1E7WA 4G63A 5EJ9A 2Y68A 1JHAA 4M9ZA 2JARA 3B20A 2DUJA 4TMYA 1C80A 3PQ8A 5CKHA 2QD3A 1YU6A 5GANh 3MB8A 1EI9A 4G1FA 1KPGA 1UMCB 2GPTA 4NCXA 4CI0C 4IZ6A 4M9CA 4RA6B 3UAWA 9ATCA 4PPNA 1B43A 2YHIB 2ZAMA 3HDGA 1FDUA 1GRNA 1ZOOA 2MMGA 2X2FA 3F6PA 3OS1A 1YVUA 3FVQA 3ZWWA 2CWDA 4C7OB 1M2JA 1YJNA 2VYVA 5EHZA 3DOUA 1ZOPA 4IQ0A 2K5IA 3AB3A 1V47A 3MJCA 1B8NA 1C3OB 2F6RA 2IYZA 3CBQA 4MULA 2B5WA 2WUVA 3CTPA 4LSZA 1FVXA 3O4IA 4FSDA 2MTBA 4A0SA 3HH8A 3CEPB 3U7GA 3SP1A 5EQFA 3MMXA 2RAFA 3M34A 1M1KC 1U3UA 1KJ8A 1VP9A 1WWKA 2J3EA 3M49A 1GTL1 2EFGA 3CZQA 2BW0A 4QTUB 5JWOA 2JFXA 3ZFJA 1EVLA 1NDHA 4EMGA 1LCIA 1OVGA 4TXNA 5COQA 4KI7A 4MKIA 1DC6A 2PTHA 4OQYA 1GZVA 1U28A 4N5DA 1I94B 1AX9A 1M2KA 4Q5WA 1E94E 1HE1C 2WMDA 1MHNA 2MWPA 2DF8A 1MXHA 1W8DA 3IH5A 5LWHA 1W2BP 3BIOA 3L4EA 4OSOA 4NXMB 1XTKA 1UE9A 3KVYA 1W5TA 2CBZA 2VOJA 1I2DA 1N6NA 3Q3CA 3VPCA 3ZTWA 2GBGA 3S7ZA 1HE3A 2H0AA 1C1HA 3JQEA 2RHBA 3IQXA 4IDCA 3X1YA 4A2WA 2I7CA 1OFIA 2VCHA 3BMNA 2R00A 3CKMA 3QKUA 3T3EA 3IP9A 3H2YA 3C3AA 5IC5A 3U9LA 5A6VA 1KIAA 1U0HC 1PFQA 2GERA 3CH7A 4N0QA 4UOQA 2X9VA 4Z8XA 1H6BA 2C3MA 2Q6IA 1LV7A 4YNBA 4INJA 3ONEA 2OCAA 2E5FA 4XOUA 1S0UA 1TAHA 3M9XA 3CMAQ 1QWOA 1BE6A 2NZUG 2FPKA 2F1JA 2KHZA 4OMCA 1W52X 3AOGA 4K86A 3VR2A 5BWLA 2NLOA 1V6CA 5E3HA 1GCQA 4E88A 4ZFNA 1NSFA 2ZITA 2FZ5A 2LKDA 4JBGA 4LPSA 5DHQA 2ZUWA 4NJEB 5EIWA 5L3RA 1BDHA 5KNCA 1G7CA 4O4HB 1I7NA 1C3OA 2DX7A 3SFTA 1UHCA 1KMNA 5F4ZA 5FBHA 2AEMA 2VO1A 4AMZA 3SS8A 1PJAA 2CSQA 5KE3A 1YFZA 4AX4A 5IKEA 1UKAA 3AM4A 1QYXA 3PFBA 2I7VA <