1VYVA

Beta4 subunit of ca2+ channel
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
332
structure length
274
Chain Sequence
AIRQEREQQAAIQLERAKSKPVAFAVKTNVSYCGALDEDVPVPSSAVSFDAKDFLHIKEKYNNDWWIGRLVKEGCEIGFIPSPLRLENIRIQQEQKRKHIPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKSSLAEVQSEIERIFELARSLQLVVLDADTINHPAQLIKTSLAPIIVHVKVSSPKVLQRLIKSRGKSQSKHLNVQLVAADKLAQCPPEMFDVILDENQLEDACEHLGEYLEAYWRATH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALCIUM CHANNEL BETA-4SUBUNIT
publication title Structural Basis of the Alpha(1)-Beta Subunit Interaction of Voltage-Gated Ca(2+) Channels
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 78
structure length 274
sequence length 332
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
A PF12052 VGCC_beta4Aa_N Voltage gated calcium channel subunit beta domain 4Aa N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1vyvA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1vyvA02
1QVAA 1GNRA 3GLIA 2O31A 1WDTA 3TUIC 3M0RA 4BZPA 2RCNA 1UKEA 2ZS7A 2JA1A 4YMUA 3UK6A 1BMFD 2KT8A 1NVVQ 4AURA 2QP9X 3MCAA 2QA5A 1E2EA 4A9AA 4BPBA 1TG0A 3E5HA 4MYHA 5C2JB 4TTQA 2CH4W 2J7IA 4R0KA 2B8TA 4KI0A 1U90A 1NG2A 2LP5A 3AF3A 1RYFA 1JEDA 2W58A 1ZP6A 3KZ1E 4DLXA 3U7HB 4B3GA 3ZZUA 1X8KA 4B2LA 1COWD 1FNNA 5CB8A 2IHBA 3TUZC 4LX0A 2RQWA 1SVKA 1N6NA 2KI5A 1E6GA 2OI3A 3N5CA 3SJZA 5FI0B 3SU8A 1I0CA 4ZIRA 1UAAA 2JDID 1SXJC 1OPLA 4D81A 2OHFA 4ACBA 3L8ZA 4UNRA 1E69A 2RPNA 1LV7A 2WAYA 3EC1A 1QG2A 3LY5A 4M22A 2J0UB 1UKZA 5AJXA 5DI3B 3W90A 1MO6A 3SBDA 4DCSA 3KKNA 5EP2A 4KFUA 2DA9A 3EGUA 2ZRCA 1A7JA 1FMJA 2EBPA 4V0ME 4D4JA 2W6ID 1W4AA 2FFBA 3OAAD 2O9VA 4Q00A 4RZUA 3O47A 2ANBA 5DIFA 1KJZA 3O8BA 4PPFA 3I3SR 2OM2A 2Q9BA 5F9HA 3FJ5A 1DAKA 1IXRC 1ZVQA 5EZ5A 5KO2A 2V3CC 2H57A 4NYIQ 1JR3A 1UJ2A 2V8OA 3IPYA 2IIMA 4WZBE 4QM7A 1KHTA 1Y63A 3ZVMA 4GPTA 1US8B 1J99A 2R44A 4DLTA 4AG1C 3VHLB 3LD9A 1ZUYA 4ILEA 2P67A 1XD2B 5HKKD 3FDIA 4BFWA 3B9PA 2FJUA 3V4FA 2FMXA 1QG4A 1G3IA 3LFUA 2QGNA 3OIYA 1JU5C 4XTCS 3EZ6A 2ZI3A 1ZUIA 2VKNA 4LWZA 4WIAA 2BBWA 5AUPB 1W0KA 2JLYA 3F0TA 1E0AA 2F43B 4BRWA 3CUEF 1VMAA 3ETLA 2CUBA 3O8DA 1HA3A 2VYFA 4Z8XA 2R6DA 4EDHA 2QAJA 2XAUA 1QRAA 3DZDA 2A08A 1YP5A 3PV0A 5HZHA 5L3VA 2BM0A 3CH5A 4ZO4A 1BBZA 1DO2A 2AWOA 4ZI3A 4F4IA 4LUDA 4CEJA 2AX4A 4X8MA 4Q66C 2O0HA 2FPLA 1CULC 5IK2A 5HPYB 3CM0A 4EUNA 2J6FA 1E4VA 1U81A 1EFRD 4JLDA 4TL9A 2R9VA 1P7CA 1D9ZA 1Z3IX 2QT1A 1M2OB 3K0AB 5EZ6B 3DDCA 2DNUA 2ZRAA 1NI3A 2OZEA 1Y57A 3TK1A 3CX8A 2LJ1A 4F16A 2C99A 2SHKA 4Q4AB 1X86B 2HSPA 1TAGA 3GLGB 1IN8A 1KK0A 3B60A 1KZGB 5C4GB 4A0GA 4Z1MA 1QLYA 1WXBA 3GD7A 3VTKA 1ZC4A 3SJAA 4NYMR 2P3SA 4L16A 1IM2A 2FG5A 3OFND 4D0GA 2JCSA 3IQWA 5EXTA 2EPDA 2GXUA 4KYUA 5LB2A 4ESHA 2OXCA 1KY3A 2GEDA 1S9DA 1CRQA 3HU3A 1YZLA 3CW2A 1QHGA 3CONA 3O5ZA 4J9EA 5FOSA 3ZVLA 4QG7A 2BBOA 2MMCA 2GJSA 1IXZA 1NN0A 5LDDC 2JS0A 3QPVA 1TF7A 4CRWB 2JAQA 3THXA 1A82A 2BBTA 2HXSA 3VS1A 1YRBA 2BVNA 1T5LA 4RTVA 4PQFA 3HWSA 3EW9A 4QGGA 3AF2A 2GDJA 4NYMQ 4URVR 2O8DA 1XXHE 4J9BA 5A5GA 1G7SA 3NBFA 2AZVA 1K5GA 3EARA 1GWNA 2NO0A 3GEHA 3A4NA 3NH6A 4WA7A 3FMFA 1H8HD 1U2RA 4P4UA 3PFIA 3FHCB 4OL0A 1L4UA 3AB3A 2DL8A 1T91A 1GTVA 1SZPA 4AFQC 1NLZA 2QENA 1DARA 2F1IA 2D2FA 4QHTA 4ZDKA 1PLJA 3WHLA 5EJEA 3A6PC 1PVOA 4X8HA 5CDFE 3H86A 3ZD6A 2YJTD 2ZJYA 4FINA 2XSZA 5B64A 3AVUA 4PZLA 5EE3A 2CHQA 4IOJA 1II0A 2EW1A 2QSZA 4Y0AA 2V1UA 2DX1A 2XITA 4JLBA 3GLIB 1SVOA 1KI8A 4O2LA 3B1ZA 4WAUA 4A2WA 3KQUA 1S2MA 3M6AA 3IQLA 2IC5A 4R9UC 3VR3A 1YWPA 3NG1A 4BRUA 2J05A 4QHSA 3VRYA 2QQEA 1BU1A 2NPIA 3G82C 1UFQA 3MLEA 1XD8A 3CPHA 4BGDA 5EXPA 1P73A 1Z08A 1OKKD 3WRXC 4C3ZA 1SGWA 1EX6A 3WP1B 2GETA 5GVRA 1L7VC 5FR2A 3QVUA 4A1FA 2IEZA 2DF6A 2WOJA 3BBPA 1KO5A 1ZD9A 4XTRA 3ONWA 1E9AA 1ZM2A 2CHGA 5B58C 2DYKA 2F1JA 2RKOA 1KK1A 4F93B 1XU4A 1YKSA 5GJWC 4LBWA 5FPYA 4DLSA 2DB3A 5CITA 2NPFA 1E0KA 4F14A 4G3XA 4TZ0A 3ZIAD 4QL3A 1Q3HA 3WBKA 4ZIRB 2W2TA 3QBTA 1E9RA 4B6FA 2ODBA 1AS0A 3CR7A 2K5UA 4LV5B 2CL6X 3KKOA 2AFIE 2ZJ5A 5HTKA 1NG9A 4UXHA 2QBYA 2G1KA 3IUYA 2NTYC 4DSTA 4XJXA 2ED0A 2YYZA 4TYPA 4B33A 3EG0A 1E0SA 1XEXA 2WWXA 4A8JC 1BIFA 4R2HA 3RAPR 3M0QA 4JSYA 2QDLA 2YZ2A 4M1YA 4QOSA 2QTHA 2NZ8A 2C04A 1W4BA 2G0NA 5KDLA 1FUKA 3AF4A 4DLVA 4I1SA 3OZXA 5FOXA 3RS3A 4MKFA 3I72A 1FP6A 3EA5A 1ESNA 4IDPA 2D4HA 3EHQA 2ZUCA 4BLRA 5KSZA 4WVFA 3CF2A 2JW4A 1UBCA 1QCFA 1M7HA 1IN4A 3AQ4A 3THOA 2C78A 3AEZA 2J41A 4KBFA 3CPEA 1W1FA 2ECZA 1DBSA 2ZAOA 5H1YA 4QXAA 4RTZA 2A5DA 3EPHA 4LJAA 1W36D 4JJKA 1Q44A 1H3HA 1SVMA 4NDZA 1XWIA 5DNYB 4TT3D 1W5TA 1B23P 1R0YA 3U4QA 4IRUB 5IT5A 2UVQA 1HUQA 4PANA 3OEHD 5JZVA 2HDAA 2F2VA 4QJ3A 1OXUA 4RD4A 1JQLB 4JMPA 3BH7A 3LW7A 1KGDA 5JEEA 4EPRA 1AKEA 2FSHA 1TQ6A 4CEJB 2BWJA 4EFMA 2F55A 1GFIA 3U2QA 3CX6A 5EQTA 5BW8A 1SXJE 1T5IA 2VO1A 4GZLA 2O0JA 4KFSA 4MYTA 4AWXA 3AGPA 2QP4A 2QORA 2R2AA 2ZSFA 4QJ5A 3Q85A 2CDTA 2C98A 2WV9A 3C15C 4B48A 1WBDA 2OFOA 2P2LA 1PKTA 4IEIA 2CNWA 3IGFA 3GLFA 4JLJA 4OI4A 5LB4A 2IYUA 2WBLC 5H70A 2QAGA 4FWIB 4DUGA 3ASYA 2FEMA 4JLAA 2O9SA 1T4GA 2WKPA 3U3MA 2RGNA 4M1KA 4E6RA 2QSYA 2FNAA 3IBGA 2ROLA 2HUPA 1CU1A 3ZS9A 1HE8B 4BE7B 1ZNYA 4GOJA 2ZAMA 3P20A 4A6PA 2QN6A 3CZQA 1KAOA 1LY1A 4CC4B 1R8QA 1AVZC 2YVUA 2IS6A 4ZCLA 3RRNA 1KSJA 3TSWA 3SN6A 1U94A 4Q03A 1Q21A 1R2QA 2A37A 3QG5A 4HAUA 1N6PA 1NY6A 1EWRA 2J7PA 4GL2A 5JJIA 4D8DA 3KB2A 1Z6YA 4HLQB 3KX2A 3EG5A 2CSIA 1YN8A 2W6JA 2ZSAA 1XMVA 2A3RA 3THXB 2O8BA 3C5HA 1OT3A 2H8KA 3E1SA 3B1VA 2ASEA 2P0EA 4J9GA 4Q1EA 4TLAA 4DVGA 4HYYA 2O8DB 1U0JA 3GLHE 3A37A 4RVCA 4PPQA 3SHFA 2K79A 5IHIA 2BMEA 2B7CA 1JR3D 2B6HA 3UKDA 1VDZA 1G9XA 2BJVA 1CR4A 1VG8A 3NXSA 4M8NE 2AKYA 4F91B 1M8PA 1N6OA 2IYTA 5FFMA 4C0QC 1ZM7A 2F1RA 3W6PA 5EXSA 2KE5A 1IN5A 2Z6VA 5AUQA 3R9XA 3M0PA 1X1RA 2J3EA 3ND8A 4Q7LA 1P2TA 1W0KD 1OIWA 1OXTA 5EP4A 2OE2A 5KSYA 4A82A 4BECA 2WMOB 1CR1A 2GNCA 2JEOA 5JECA 1G8GA 4OMNA 4JYBA 1KNXA 3HPQA 4NE2A 2X3XD 2ANCA 2V6JA 2JM9A 1KTVA 2QM8A 1DAIA 1TQDA 1CKAA 2KGTA 2CEAA 2RGEA 3B82A 3PQCA 1RJ9B 2NIPA 3DZ8A 4ZPXA 1YVDA 2XEXA 3U3JA 3KDSE 1GVNB 4RUGA 1SRMA 2CHVA 3K9LA 5IK2D 1OIVA 1TQ4A 5SZKB 3GBQA 5FL3A 3WBJA 4W5WA 1S9HA 1XEWX 5FPHA 2VQSA 1AA9A 3AUXA 3LX8A 3EG3A 3D6TB 2B21A 2AKAB 1S1NA 2BEJA 3QF4A 2DFLA 2HJGA 5IXBA 3UWOA 1IJEA 2J59A 2D62A 2D8JA 4NMMA 4QBIA 1UEJA 2EU8A 4Z1MD 1CKBA 3ZL7C 3ASZA 3M0SA 3BFKA 3G0HA 2H5EA 4GBMA 2QBYB 1GRQA 4GMXA 2MSEB 2LMJA 4MITA 1E1QA 4LPKA 2DYBA 1X43A 2RMOA 1P3JA 1R4AA 1AQYA 2D2EA 4OI1A 2ZJ8A 3ADCA 1XEXB 2Q3MA 3CRRA 1PRMC 1QWFA 3KUDA 4IW3B 1JPNA 1N6KA 4EPXA 4QGFA 3D31A 1JQJC 2RAPA 3I35A 2PEZA 1P75A 1K8RA 1Z0FA 3QXSA 1DPFA 1KSHA 1KI2A 3X1DA 3VS7A 3IPXA 1KKMA 2M0YA 1FW6A 4BFYA 1ZUNB 3I5SA 1CF4A 2RQTA 2OAP1 1GKYA 4DKXA 1N6HA 4RD6A 1OB2A 4TTRA 1JXMA 4LHYA 1GFDA 3UMFA 1TF5A 2NO7A 4I1UA 3SHWA 1W6XA 2JLUA 1FFHA 3EPLA 1ZBJA 5FUYA 4MUBA 3P1JA 3U4QB 2J45A 2N42A 1J3TA 4JLKA 1A2KC 5TDHA 1IY2A 2ZI6A 3M4YA 4LJ7A 4JT2A 1OH5A 5GJBA 1JALA 2XSZD 1T8TA 2OUKA 1JNYA 2EYQA 5CJ2A 2J0QA 4C2TA 1XB2A 1Q0UA 2W0ZA 5ECAA 5EUMA 4G1UC 2KE9A 4L15A 2DJQA 4QT7A 3KKQA 4NKRA 4LGMA 4XWOA 3VS6A 1E32A 4URXR 2W00A 1S8FA 4R98A 1UEIA 5CK4A 2GJ9A 3NMZC 2GBLA 2DRKA 4MGIR 3GLFB 1BH2A 2BZXA 4OMLA 4OMQA 1QKXA 3EPJA 2W10A 1EFTA 1GZSA 2QAGB 3R20A 1EXMA 3C41J 4O2RA 3IIJA 4QNMA 4V0MA 4JJZA 1M3AA 3AVXA 3K0CC 3RS7A 5JI3E 1E1RA 1VYVA 4P3YA 3KJIA 3WXMA 3TE6A 4D25A 4L5BA 2GCNA 1XZQA 1VHLA 4TMWA 1VG0B 4RKFA 2REXB 5TV2A 4MYUA 4GP7A 2P4RA 1LF5A 2WWWA 1DAHA 2ZRNA 3LXXA 4GP6A 4YMVA 1FP7A 4QBGB 2WICA 2WAXA 1XEWY 1NLOC 3BB4A 2REOA 5FUWA 2Y8EA 4C2UA 1OPXA 4JVLA 2K9GA 2C03A 2ZUDA 3M0UA 4DCVA 1CIPA 4A2QA 2YOGA 5JFGA 2FF7A 2LCFA 4ZKDA 5E4FA 8OHMA 1AOJA 1FQJA 2O8BB 4RD3A 3WMGA 3NC1C 2DE0X 1P4SA 2HF8A 4KAXA 1G20E 3NDBB 2KJQA 1OYYA 1SHZA 1MKYA 1U8AA 3FMPB 2VEDA 3H84A 3QNUA 3T1VA 3U61B 2FRYA 1CEEA 5K8LA 4P4TA 1O3YA 3QUSA 1SHGA 2KYBA 2RHDA 2OCAA 2GK6A 4JZ4A 1DAMA 1N5KA 3W6NA 4EIWA 4Z8YA 1WXQA 4GBQA 1SKYB 3FOZA 1T0HA 3B9QA 4GLMA 4QBHA 4Z51A 2H18A 1QBKC 4NPHA 4KODA 4D4MA 4B34A 1X6VA 2CSQA 1Z5ZA 3CNLA 1NL3A 1OW3B 4M1SA 5SZIA 1PJRA 1KJWA 4IXMA 5FBWB 3B5JA 1D9XA 5TY0A 3FKSD 2YKGA 4AKHA 2BMJA 1P9WA 3PCRB 4Z8AA 1U06A 5P21A 4HDQB 3SOPA 1OFTA 1GCQA 4MGYR 2L0AA 1HV8A 2VF8A 3MG9A 1XNJA 3AVPA 4UJ3A 4MRVA 3QF7A 1UE9A 1IXSB 2AK3A 4Q9LA 1Z06A 3AP1A 4J9HA 1F6BA 2OCYC 4G0NA 3IIKA 4RCYA 5DE3A 4PHGA 1TPZA 3GJ8A 5FTJA 4AI6A 1MT0A 3UWKA 2AZSA 2QE7A 1NN5A 3HR7A 4Q4JA 1D8TA 3REAB 5FW9A 3QOFA 3QF4B 1DG3A 1M74A 2O8CA 2CNWD 2OXRA 2K7AA 2PLRA 1YZUA 4J9FA 1KO7A 4RZXA 2GTJA 3A1UA 3KJGA 2ZR9A 1W36C 4DUGD 5KDOA 1TU3A 2F9LA 3NBZC 4DSUA 3ZD7A 4Q7JB 4LJ9A 1HY3A 2GAAA 5DISB 4TYYA 2ZRDA 4YMWA 4XH9B 4A15A 2PX0A 3RC8A 4DSOA 1P61B 2HBWA 2GVZC 1WFWA 2F6RA 1YZKA 2IYLD 5AJWA 1CJKC 2MMGA 5IHKA 1KMHA 3ZDQA 3SC3A 1G19A 3PEUA 5FTKA 1J7KA 2JLSA 1OLOA 2WWGA 1AGRA 3CLVA 3TBKA 121PA 4RD0A 2WZQA 3CB4A 3Q3JB 4JIMA 1W47A 1A2BA 2CUDA 3X1ZA 4DLRA 1FTSA 3GEEA 1HE1C 2DFNA 1NVVR 3BGWA 4PC7A 2NQ2C 3X1WA 4LJ4A 4HB2A 2WOOA 4B2IA 1E2FA 3AP3A 2J7PD 3ADBA 2VHCA 1HD3A 3VNVA 4GT1A 4M2LA 4B6EA 1FMKA 1GKUB 2V6IA 2W6JD 2F3RA 4XOIA 1N5JA 3SEMA 2ZE8A 2GF9A 2HDNB 1CP2A 2V1QA 3C14C 5GADl 2ZS9A 3HJNA 4NZYA 4PHHA 4B35A 1ZJ6A 3AKDA 3KQNA 1X6GA 4U02A 2REBA 2DBMA 3VU9A 5AJVB 1D5CA 4LDJA 4KJZA 2C0IA 1E96A 4CGZA 1FYNA 4KU4A 4DB4A 3RS2A 2Z4RA 3ZQJA 2AD5A 2ZRBA 1IQPA 1G8HA 1Z0IA 3R9IA 5J4KA 1U9IC 2KBFA 3DOFA 2QGZA 3OEEA 1GRNA 3MUFA 4ESVA 4HSEA 3KKMA 3UPUA 2KRMA 2JIZA 3SQXA 3IKJA 1UF9A 2IYRA 1IN6A 1W2HA 2CVHA 3DM9B 1G21E 3W3AA 4BLSA 1TU4A 2LQWA 4RTYA 2QRNA 2X2FA 4OMMA 4BLTA 1Q1QA 1KDTA 2I3BA 1UFFA 4JKIA 5AWFC 3T15A 2EFEB 3ZQ6A 3RS4A 1TEVA 1G291 1E6HA 2HLDA 1OH6A 4RFVA 3QPUA 3K9GA 3SI7A 2FZLA 2Q0HA 1TQ2A 4NYIR 3PIRA 1P6XA 2N1BA 4IVPA 4BASA 1AZTA 1SVSA 4IFEA 1JJ7A 2WWYA 4JZKA 1GRIA 3EG2A 1G18A 4K11A 2NO1A 1RLPC 4PO1A 4W5HA 5KSPA 2ZITA 4JYCA 3BD9A 4HAXA 5BYJA 3LRPA 5C18A 1FNMA 5KNBA 1NRJB 2CH4A 1TUEA 3A36A 1IY1A 2GK7A 3NVAA 1L8QA 1I4LD 3NBYC 4HAWA 2A5FA 1Z8FA 1KI4A 3L0SA 2BHRA 4HUTA 2FA9A 2YV5A 1E4YA 4OK3A 3EWAA 4Q9KA 4Y0VA 3U6KA 5DO9A 1NMYA 4ITRC 4JS0A 5F3WB 5BXQC 2KROA 3U60B 1E98A 3OE7A 3GFTA 1FTNA 2G9NA 1GL9B 2KYMA 4KHZA 4M1TA 4ZKEA 4JBWA 1K6MA 2RN8A 5M04A 2VRWA 4EFNA 1R10A 1KI1A 2KSQA 2J46A 4DLWA 5FBVB 4JL8A 2V1XA 3HPRA 2OJ2A 4DCUA 1UDXA 4AG2C 2ZRLA 1G83A 1WQ1R 1NLYA 1PRLC 3SDZA 2C0OA 1Z28A 2IXGA 1X69A 2JM8A 4Z54A 4YLGA 2XGJA 1T0HB 4TL7A 4B75A 1R5OA 4JJCA 4OJQA 3R7WA 2R6CA 2GKSA 4R7ZA 1NMZA 2VSFA 3K70B 1S3GA 2EYYA 3UXMA 1Z29A 2YUOA 1ZC3A 2GESA 4L8GA 4MRNA 3ZJYA 4YMTA 2VHTA 1N5ZA 3WY9A 5JJKA 2EYWA 5ELXA 1WP9A 1I2DA 2L0XA 1HQYE 2QMHA 3AKCA 1JR6A 4D0NA 3B1YA 1OFHA 1G1MA 2QMOA 3QWXX 4B47A 2V1RA 1JB1A 1T6NA 4GNKA 2FSFA 2ZRHA 4FSSA 2NOAA 1I2MA 1Z07A 5CIQA 3AP2A 4WW0A 5E7JA 4AG5A 4MRRA 2NUZA 3TVDA 5IH2A 1KKLA 1AN0A 1R7RA 3X1YA 3PE0A 5FTNA 1I4DD 2AN9A 3B85A 3BC1A 3OF5A 4JVMA 4M4ZA 3D3QA 2IX3A 1JEGA 1MO3A 1N0UA 1JAHA 1N6IA 3CWZA 4JLMA 4MUAA 1ZU5A 2VBCA 5A4JA 4J9DA 2FPKA 2R65A 4US2R 4BFVA 4HLUC 4Q4JB 4URWR 3LXRA 2G6FX 1K4US 2QU8A 3MJHA 4Q1DA 3A58B 4DLUA 2RQVA 2P65A 4PPGA 2XMFA 4KSBA 2ZJBA 3GJ4A 5FTMA 2O8CB 1LVGA 2FPFA 2GZDA 1VIAA 3W8RA 5ANRB 1OFUX 4LJYA 2Z0MA 2XZPA 2DL5A 3CNOA 3CKLA 3KTAA 2QMUA 3MJRA 1GNPA 4KFTA 2A2ZA 2F1HA 3M0EA 2XB2A 4OI0A 4DB2A 2WWHA 1Q57A 2CL7X 1E1RD 1RE0A 4EJSC 1KOFA 2C96A 1XXHB 4Q4HA 1YZQA 2WIBA 2WSSA 3QPWA 5IHNA 1Z6TA 2WJIA 3TVTA 2VL7A 4WCIA 2WJJA 4LY6A 3RC3A 3F3YA 3UIEA 1U5SA 1XCPA 2ZJZA 5KYKA 2AFHE 1KMHB 3BRWD 2DILA 1BYUA 1H8KA 2BMFA 3DKVA 2EQIA 2IL1A 2C0TA 3K9NA 3OIUA 2O2OA 3CIOA 4LBZA 3GLGE 1NNEA 4P0TA 4ABYA 4WZ6A 4GRAA 5JEDA 5FWCA 4IDHA 3QWYA 2PZGA 4LYAA 2D1XA 3CF6R 3K09A 1XEFA 1ZSGA 1F60A 2ZU6A 4XVUA 1SRLA 1II8B 2YWEA 3GJXC 5D3QA 3IEVA 2RQRA 1N6LA 2X2EA 2F9MA 2HT6A 3FKQA 2RGBA 4LBVA 1BS1A 2HCBA 1AWJA 4PSVA 5J4YA 1ZAKA 3CR8A 1XTQA 3NC0C 1SULA 1JPJA 4E22A 2LQNA 2RQUA 2ZETA 2IS4A 1AS2A 4LCBA 3H0KA 1RW4A 1SKQA 4MQBA 1R0ZA 3RYTC 5EUQB 1YRAA 2JLVA 4ZCMA 2WMNB 3VU9B 2GBQA 1WRBA 4HCKA 4C0LA 1W1WA 2Q3FA 1U0LA 1TUCA 3QXHA 2PBRA 4FIDA 5BN3A 3PVQA 1VECA 1TUDA 2CDNA 3REFA 1A4RA 1KI7A 2FFQA 2CXXA 3BE4A 1K1ZA 2JMCA 2JASA 2IWRA 1NJGA 2C77A 2W83A 3LWNA 3RS0A 4DHEA 1RJ9A 2Q21A 4AYWA 4M9SA 2R8RA 1J90A 3SNHA 1NYFA 1T3SA 4LOAA 3ZYCA 1VYUA 4CC3A 2YOHA 1W70A 3GJ0A 5TB5A 4D6PA 1YZNA 1Z83A 4EFLA 2IBMA 4PFSA 3B1WA 4OQNA 221PA 1UBEA 1LFDB 5K8TA 3CRW1 4UXJA 3V4RA 3CF0A 2ENMA 3EC2A 2IS1A 1RRPA 5G3YA 4Q9JA 1I07A 3QQ5A 4JVNA 4CF7A 3PUXA 2ZYTX 1GILA 4D8KA 5CM9C 3VR4A 1Q20A 2GZAA 3GMTA 3I92A 4DLZA 3GLIE 1RI9A 4JL5A 1CJMA 2GILA 3T1OA 4DEYA 1KYIA 2FZ4A 5UKDA 4PQYA 2QE7D 2IHYA 1ABQA 1HEIA 4C0HA 4LN2A 5L23A 2GNOA 4DRZA 2PJZA 3GP8A 2ORIA 2Q9CA 4RTXA 4KITB 2JJ2D 4AK9A 1F2UA 1K9AA 1BK2A 1E2LA 3K0EA 5CK5A 2DWPA 3WP0A 5TVKA 2CJWA 5IF9A 3C5CA 1GG2A 1JI0A 3MD0A 2CT3A 3AH8A 1G5TA 1RRCA 3TR0A 1NN1A 1VIYA 1CJUC 2CLDX 2HT1A 4X8LA 3NH9A 3MGCA 5CB6A 4ORZA 3PUZA 5CLQA 4ASUA 4TQUS 4LI0A 2KT1A 2M51A 2NGRA 2KNBB 4HB3A 3A4LA 1E9FA 3ND9A 3QVVA 2YC2C 4TL8A 4QM6A 1N0WA 3PEYA 1P72A 3A1VA 1XZPA 4URZR 1OHHA 3NTUA 4QGAA 4TYNA 4FCTA 5C46F 2GTPA 3FGNA 1KJYA 1KSWA 2DR3A 1S0UA 4FMCF 3LQQA 4TYQA 1OH8A 3U3KA 2VP5A 3H0HA 2KXDA 4IIOA 2VP2A 2WWIA 1HYQA 3FWYA 2ZXUA 2V54A 1S1CA 1SXJB 2DWQA 3OIVA 1OYWA 4B3BA 4D0LB 4OQXA 2E1RA 3R7WB 4F4CA 3GJ5A 1TTTA 1SSHA 2D74A 2J0VA 3BFVA 1KIKA 3R9WA 2ESWA 1NSTA 2VWFA 2BZYA 1ZNXA 4OMOA 2RGNC 4DDVA 2LJ3A 1OSNA 2A36A 3A1WA 3B13B 4A8JA 1VG1A 1JR3E 2YWHA 4HDOB 4PAMA 1KZ7B 2G6BA 2GEUA 1R6BX 2KR3A 1ZM9A 1OOTA 1DVRA 4RZ3A 3FB4A 5LPNA 3BH6A 3LVQE 4GFDA 3OEED 4DXAA 2QY9A 1Z6XA 2JIZD 1DS6A 2RGAA 4LC1A 4D4KA 3K8YA 3NKVA 1OV3A 1RKBA 1X27A 1Z2AA 3QXXA 3ADKA 1GL6A 1QWEA 5JBQA 2ZI4A 3IDQA 3G5UA 1N0VC 1XCGB 2HLDD 1W44A 5HZKA 2ZJ2A 1DO0A 2A30A 1ZCAA 2ATVA 5GJVC 4ARZB 2QTFA 2J6KA 1ESMA 4BLQA 4DSNA 3W9YA 1DG1G 1ELOA 4E07A 5KPDA 2JLWA 3KTAB 4BUJA 1V1CA 4UKDA 4DWJA 2EFDB 4GI7A 1QZXA 4G5GA 2UKDA 1SPKA 2WVJA 1UDWA 2W2XA 2AXNA 2LCSA 4Q4HB 4N0EA 4J9IA 2JT4A 3AF0A 4TMTA 1NEGA 3HU2A 5BN5A 2FGKA 1GAJA 5F2EA 5IHPA 3U44A 2RF0A 4LHXA 3W5JA 3HR8A 4JSTA 3SJCA 4YDHB 3U3RA 4AIIA 4OI2A 3QEOA 4DCNA 3VRZA 3RDPA 1Z47A 2RGDA 2LNHB 3IQXA 4Q1FA 5J4HA 3LQRA 4YDSA 4NTZA 5HE9A 2IYQA 2BKEA 1Z9ZA 1E9CA 2PEYA 4TTPA 2IYSA 1GP2A 4BLOA 1YWOA 4YQFA 3DO6A 2GCOA 1D2EA 2QT0A 1GFCA 3EZ9A 3GFPA 3OE7D 4GOKA 4O0MA 2DY1A 1Z0AA 2J9RA 2IT1A 3UG6A 1CBUA 4IVQA 4LYJA 3BH0A 1XF9A 2DWOA 1KSGA 5DHFA 1M7BA 3N70A 3JV3A 1NIPA 3FE2A 2QI9C 4OQFA 3L0OA 1TL7C 1ZNWA 2A5JA 2QG6A 3LW8A 3QE0A 3RHFA 2OG2A 4BLPA 5JS8A 3U23A 1IJFA 4OMPA 2FSIA 4PO9A 3TAHA 1NVXQ 2SRCA 5DGXA 1GL7A 3TW8B 1NVWQ 3DOEA 4L9SA 1EG7A 2BOVA 2JJ8A 2RNAA 4BZXA 4B43A 4EJSB 4D82A 1PKSA 2DCUA 5CYPA 5LD2C 4Q9HA 3CH4B 1NMXA 3ZZ0A 1G17A 2GJ8A 2ZRGA 4Q4LA 3R6NA 4Q48A 4RZ2A 1GIAA 3BFXA 1SHKA 4U7DA 1KIMA 4PC3A 2ZANA 4TMVA 1DE0A 1E2PA 4HLCA 4C0KA 1G3QA 4LJ6A 2ONKA 1COWA 4H9GA 3VR1A 2AXPA 2C9YA 3JZAA 4KLNA 4IIMA 4R2IA 4W5JA 1GOTA 2ZQ5A 3BB3A 1OPKA 421PA 4HI0E 3LDAA 3VS5A 3DMDA 1W46A 1G6HA 3F8TA 2G3YA 4F38A 3I5YA 1IOZA 3T35A 4OKSA 3QKUA 4EKDA 4ZI2A 1G2BA 1NBME 2HV8A 3BK7A 3PEWA 2B8WA 4C4PA 2FH5B 2CE7A 3QENA 4IDQA 4CEHB 4LBYA 3AF1A 4LV6A 3MWLA 4B3DA 5JRJA 1UKYA 3FYHA 3PITA 2LKDA 5EXXA 1RLQC 3TR5A 3ZVRA 3UF4A 1F2UB 4A2PA 2JJ1A 2ZE6A 4DJTA 2J06A 2FDCA 1HT1E 1DAFA 1WLPB 1RRFA 2CJWB 1E79A 4RTWA 4TSFA 2OBLA 1N3BA 2PX3A 3DEFA 1CJTC 3H2YA 3H4MA 3RWOA 3T12A 1R5BA 2A28A 2QP3A 5FOTA 1RYHA 3TGPA 1SHFA 2ZJAA 1YCSB 521PA 4PHTA 5G41A 4AY2A 1ZUKA 2ZRFA 3AKEA 4KBGA 1QHIA 1R8SA 3W8NA 1JJVA 1F2TA 4QGHA 1FX0A 1UBFA 4K8OA 5BQ5A 1KMQA 1UBGA 3EAQA 4TLCA 1JXOA 3VS4A 2NO6A 2O8EA 2C95A 3TKLA 3WYAA 3TW4A 4DLYA 5GJWB 4IDOA 5KHOC 1U8YA 2GJKA 1E94E 4NHOA 5L3SA 1KSFX 1TNDA 4NH0A 1UADA 2D7CA 5FOUA 2VLIA 4EQ6B 2FGJA 3V00A 4HZIA 2EGEA 3HP1A 2VHQA 3W5IA 4FI3C 2HYIC 1N2CE 1GITA 2ZE5A 1DTSA 3AUYA 4OYHA 2MCNA 1QHSA 4V0OA 5SZJA 1IONA 1DADA 1NY5A 4A8JB 4S35A 1HJDA 1X6BA 4RD1A 2H7VA 1BOFA 1Z22A 5FBQB 3REGA 2FFAA 1E99A 2ZVPX 1ZUUA 3RANA 4JL6A 2C9CA 4IJMA 2L3SA 2GXQA 1LS1A 2OFXA 4AFSC 1M3CA 1HQCA 1BO6A 4LNPA 1EESA 1VCMA 3WMFA 2CLSA 2HXYA 1SVWA 3EZ2A 4N1AA 4Q18A 4JVSB 2DL4A 1L2TA 4AKGA 1C4OA 1E2QA 3EA0A 2R6AA 5C4MA 4B3XA 1SVLA 4US1R 2ERXA 1ZIOA 3N2EA 4JT4A 1KI9A 4MRSA 1NSFA 4CC7A 2YSQA 3BXZA 3KFXA 1NLPC 3IHWA 3I8SA 4NONA 3VS0A 2HCJB 3FMIA 1P5ZB 2JMAA 1D6JA 4KVGA 2CMKA 3LNCA 2A9KA 1ANKA 1X3SA 5A0FA 2ABLA 1UHCA 4ON9A 1AM4D 4BWYA 3U44B 1A0NB 2MSDB 1BKDR 1OJLA 3I1FA 1X8LA 1TX4B 3EPKA 3AVOA 1G3UA 1Q1ZA 4JBXA 3N2IA 1UHFA 1G8FA 2XX3A 2G0TA 3AVWA 4OHYA 2EVRA 4R71A 1ZLMA 2BTTA 3H0FA 1FPMA 3CQTA 3QKTA 5FBRB 5JCPA 2RH5A 2GWHA 4HUQB 5J47A 4CIDA 1JO8A 1U99A 2H8HA 5EP1A 4PPNA 4ASUD 2BJWA 2IWHA 2GCOB 1H8HA 4E09A 4PC1A 3NHBA 4C0SA 4FW9A 4D4LA 1VTKA 3RBBB 1W5SA 2A5GA 3W34A 1U98A 2IYXA 1TUIA 2ZPTX 3WYFA 1KNQA 1B0UA 3LBNA 1OHHD 1J8MF 2H1LA 4BEJA 4URUR 4IEEA 5AK0A 4W9MC 1C9KA 3O8CA 4YXWA 2B7BA 2EYXA 2OFWA 2GF0A 3AVVA 1UECA 3CZPA 4A0HA 2IYYA 2ZRKA 4FMCB 2TMKA 3VX3A 4DZZA 3A1SA 3CRVA 2UZIR 2PCJA 4ZDWA 2PLFA 4CYMA 1Q1EA 4J9CA 4NYJR 3B6EA 4Z88A 3A4MA 3I5RA 3SZRA 3U7EB 4AD8A 1RUWA 1SKYE 2D3WA 2FX3A 1IAQA 3L0PA 2J0SA 5F98A 3KJHA 4B73A 4U00A 1XJ0A 5EE9A 3WNDA 2CCKA 4BFSA 1EGAA 1AIPA 2JLRA 1GBQA 2FE4A 1T9HA 1MRNA 2IUUA 4MGZR 2IYVA 4B74A 4WBSA 1ZUHA 2J5XA 1MABA 4FCWA 3UG7A 2AHOA 3K9HA 1RRGA 4OK6A 2BMDA 3SE0A 5JRZA 1GL5A 5I11A 2OESA 1XXHA 4QRHA 3O8RA 2KXCA 2RMKA 2YUNA 4RSGA 4AKIA 4NYJQ 1W4RA 3KJEA 1M30A 1GKIA 3BIFA 1R0XA 1ZCBA 3SR0A 1YHNA 1OV4A 4A0FA 4NCJA 1NYGA 1KDRA 4TLEA 5IRCD 1KFZA 1HTWA 4C0AC 3D7MA 5CDFA 1II8A 1E9DA 1E2HA 2C5LA 3AV0B 4Y92A 1H65A 4F17A 3CBQA 3RLFA 2ORWA 1H8EA 2AD1A 2C9OA 2DL3A 4HDCA 1GBRA 5TARA 5JS7A 1G7CA 2PH1A 3AVQA 4JLVA 1F2TB 1Z63A 1FX0B 1VCNA 3CX7A 3KXIA 4MKGA 4YONB 3EZ7A 4I1VA 3LH5A 3VKWA 2AR7A 1RPZA 1KI6A 1FZQA 2YC4C 2EGCA 4JLNA 4TMXA 2O8EB 4TLBA 2BIFA 5FL7A 4RKEA 1E2IA 3W3ZB 1K76A 3L2OB 5L3SB 4FD2A 2ONJA 1G7RA 2BDTA 5EE1A 1A5TA 5JWOA 4ZV4A 1OE0A 4F7WA 1X1SA 1ODFA 1PLKA 3X2SA 3ZS8A 3QEJA 2OBMA 3HYTA 3PUWA 2IA5A 2IUSA 4JBYA 1NP6A 1MOZA 2OO7A 4BZQA 2XTMA 4US0R 5H68A 2FG0A 1SQ5A 1B3QA 4PSKA 4EPWA 2IW3A 3T61A 3QY0A 2J87A 5KNDA 3PUVA 1IHUA 2QMEA 4RY2A 2QPTA 2P6NA 1OFIA 2AK5A 2BM1A 4AG6A 3RRMA 3K53A 3TIFA 5E95A 2LKCA 5CYOA 4MGKR 1DAEA 4BFTA 2WM9B 4RFSA 3THWA 4K81B 3Q7QA 4HZUA 1FL9A 1P62B 1XFAA 3FMOB 1CLUA 2BEKA 3FFBA 3SYKA 1W0JA 1IN7A 1EFUA 2DRMA 4B71A 2KRNA 2VSOA 2PMKA 1NLFA 1GUAA 2Z43A 3QJYA 4IDNA 1VKJA 2YWGA 4PX9A 5AJZA 3QKRA 1AKYA 3RNLA 3U6BA 1W4CA 1QVRA 3KQHA 1AZSC 2JTEA 3KXLA 1PLLA 3SFZA 1U9IA 1Z9QA 2PMDA 1M8MA 2D7DA 1IO6A 3IEUA 3P32A 2FU5C 5J4LA 4G01B 4W7SA 2JLXA 4M9QA 4Q02A 1G64A 4JKYA 4DBLC 1GNQA 1WX6A 2IEYA 5FOWA 1G8PA 3DPUA 1E1QD 2DL7A 4S2EA 1ZIPA 2IK8A 4LHWA 1B07A 1W7AA 3PVLA 2I1QA 4HAZA 4P33A 2PJRA 4V0LA 4XD7A 2JJ1D 2E87A 1G3MA 4KVAA 4WXPA 5JJLA 1RFLA 3OIWA 2ZU0C 1E3MA 4JZ3A 3KFVA 1LB1B 4DC9A 1G16A 1E79D 4Q19A 2EYUA 2FPMA 4TSFD 4HAYA 4UXIA 3TSOA 4Q1CA 3WHKA 2RGCA 4XVQA 3Q5EA 1YJ5A 2O0KA 1E7OA 3AM1A 2ROTA 1OIXA 4IXNA 3WNBA 2W0SA 1SXJA 2DLPA 2ZRMA 1VCOA 1ZD1A 4K46A 2XNSA 4LC0A 4M53A 2F3TA 4FCVA 4NCIA 4M1MA 2NMVA 3C7KA 2WIAA 4PC6A 1UKVY 1KI3A 1QHYA 1XBTA 5B2ZA 5AR1A 1YR9A 1IBRA 1E6CA 1HH4A 4BQSA 4A4DA 4H1UA 1YU9A 1MO4A 3NBXX 4AKEA 2G83A 5J5CA 4KCGA 3BB1A 4LUEA 2QTVB 2OLKA 3RWMB 4Q7MB 2VIIA 3ZH9B 4NL4H 4I99A 4OK5A 2GCPA 4C7OA 2F2XA 4HVWA 3E2IA 3WMEA 3RSLA 1XTJA 4CW7A 2J7KA 1CXZA 1XJQA 1WXTA 2OILA 3RVBA 5C1BA 5KOYA 3KQKA 5E7IA 1MV0B 2PZ1A 4HLDA 4LZZA 5DN6A 1AD5A 2ZS8A 1JECA 1G5RA 1ZX6A 2SEMA 2XOKA 2R62A 1WA5A 2G88A 4IHQA 3GQBA 2VP9A 2ZR0A 3EXAA 3QKSA 3VX4A 3EZFA 3A8TA 4J0QA 2CCGA 3VR6A 5AUOB 2QROA 4ARZA 1WF3A 2HEQA 3FHOA 3GJ7A 4TLDA 3SEAA 3GPLA 2YOFA 2G77B 5BN4A 4RJLA 4V0KA 4TQ9A 1NVUQ 2ERYA 4A63B 1XTRA 2CK3A 3K09C 1UJ0A 5FH9A 5JLJA 1MABB 5BWMA 3U7GA 4E5UA 2QPAA 1TEXA 4U5XA 1PUJA 4OJKA 2V7QA 2PZFA 4Q1AA 4GSYA 1T3LA 2XXAA 1UM8A 3GLHA 4O3MA 4LJ5A 3U3OA 2NZJA 4AFZC 1WXUA 1ZINA 2FWRA 2WHXA 2Z5FA 2FN4A 4DDWA 1Q3TA 1E9SA 1Z0DA 3I32A 4H1VA 3RS5A 1O87A 4QHYA 2KBTA 2W0MA 2QRZA 2EYZA 1ONBA 3SJBA 4C9BA 2O8FA 2ZRPA 3VKGA 5H8WA 4LUCA 1YZGA 3EWSA 5CLLA 3MAAC 1EX7A 2XB4A 3ZZTA 1V5WA 1RZ3A 1RIFA 1WDXA 1XMIA 3C8UA 1WMSA 5L8VA 2OV2A 2DFTA 3K0FA 2XJ9A 4IVRA 2WPDA 1P2SA 4KYIB 4NBSA 5AUNB 3ULRB 621PA 2LZ6B 2XTZA 1OB5A 2L3QA 4HLUA 2WKQA 2JLQA 2K6DA 2OCPA 3BJIC 4PTLA 2GQIA 2E9SA 5JI2E 2BC9A 3VR2A 1KI6B 1UG1A 4AYTA 4BFZA 1TMKA 3B2EA 1W36B 2HYDA 3CO5A 5D3MA 3FTQA 3NHAA 3THYA 3H1TA 2Q9AA 4HEJA 1VA7A 5L3QB 1G4UR 1OF1A 3IILA 4MKIA 2ODWA 3K70D 3X1XA 5FTLA 1M1YE 2I4IA 4EJSA 1XP8A 2CBZA 1YR8A 3DKPA 3MMPA 3TLXA 4TZ6A 1YE8A 1T3HA 3VNUA 2VHUA 2KWIA 2H92A 2YDLA 5EC7A 2WJHA 1M6NA 4G5QA 1PUIA 3WYGA 2WJVA 2AK2A 2ZEJA 3KB1A 4YXWD 1YR7A 1C1YA 2GA8A 1T0JA 2K3BA 1N6RA 4XIGS 3TQCA 5CJPA 4F4JA 3R8CA 1CS4C 1NF3A 1P2VA 4N0DA 5F9FA 4IKEA 1S1MA 4C0JA 4CC2A 4MH0R 4PHFA 3NIBA 1NBMA 2D8HA 4DT1A 3PG5A 2PNIA 4PAQA 3W6OA 1P9RA 3AGQA 5DYGA 2H16A 4BFXA 4CEIA 1TADA 4QBFA 1N5IA 3Q8XB 2CREA 4FWTA 4EIKA 4RFSB 3Q7PA 3THWB 4HZUB 4NCKA 4XVRA 2VTKA 1DELA 1MH1A 4MRPA 1EWQA 4CEHA 4G5SA 1OXXK 3UATA 4FXPA 3TQFA 1KDOA 3FPAA 4Q5IA 4C0BA 4X8OA 4CVNA 2PTKA 5IXFA 2FOLA 3QXCA 4DCTA 3UA7A 3QKRB 4KO8A 4UJ5A 3FHTA 3FVQA 4UQOA 5L3RA 2DHRA 2F2WA 3OESA 3ICQB 4V0NA 4HVUA 1CRPA 1Z6AA 2X1VA 1K0XA 3D8BA 3T06B 1S3SA 1CR0A 5KDDA 2CE2X 2P5TB 2X8AA 3OHMA 4LHVA 4UNPA 1II9A 5E7MA 2JLZA 4MKHA 4EPYA 2EFHB 2EWWA 1PV4A 2F7SA 2C2HA 2WKRA 821PA 4MA4A 2FFHA 1NKSA 3EIHA 1ZRHA 3GCGA 4KXFB 3TRFA 3WRYC 2A7QA 3B7GA 2YINC 2GHIA 5HR5A 2I0NA 2NWMA 1JBKA 4Q1BA 3BORA 1XCMA 1J8YF 1FOEB 1NM7A 2WJYA 2HJVA 2VPPA 4OHWA 1G7TA 1Y0MA 1XPOA 3PJRA 2GZHA 2IYZA 4TWZA 2Z4SA 2DFKB 2ZRIA 3QI2A 4I81A 4Q21A 1H8ED 5JMTA 4EQ6A 3L82B 1NJFA 2WSMA 1ARKA 4G5RA 1LCKA 2Z83A 2QAGC 5G53C 2FPDA 3EIQA 3AVYA 2DM1A 3AVTA 4PZYA 1KK2A 1NN3A 1OH7A 1E0JA 3P4YA 4JJBA 4DDTA 4M21A 2IS2A 1EFNA 1AZEA 2KEAA 1AQUA 1DOAA 4RCZA 2QL6A 5FUVA 1E2DA 3VQTA 4PZZA 4JJDA 5FL7D 4ZDIA 2PT7A 4KSCA 4A92A 2Q3HA 1UDLA 3L8YA 3LLUA 3EG1A 3FKSA 4OHZA 1AJEA 1R5NA 4C7OB 3QBVA 4DIDA 1J2JA 1QHNA 5KUTA 5FR1A 1TF2A 4D80A 1E2MA 2CVFA 1U8ZA 3S1AA 2ZROA 3EX7C 3VFDA 4POAA 5HCKA 5K8IA 2HF9A 4LRWA 3TNFA 1OXVA 2XNDA 2HCKA 1ZMXA 3RABA 3VMFA 2G1JA 5KSOA 5FUXA 1T8UA 1P2UA 1AWWA 4PXAA 1KAGA 1WCV1 4LYFA 2RGGA 3QKSB 4FMDF 5CM8B 2NG1A 3NDPA 3J81k 4Z89A 4FN5A 4JLOA 3L43A 4URYR 1MV5A 4O25A 2NO9A 1E2NA 1ABOA 3SQWA 2ZI5A 1BB9A 1VG9B 3R8FA 4XSGA 2P6RA 1MUZA 2QNRA 1UTIA 3B78A 4ZDJA 5GJCA 3ECCA 2D06A 5EP3A 4PC2A 1K5DA 3T5GA 3IO5A 5FPTA 2XXAB 1W0JD 3GLHB 4CT5A 2ZI9A 4Q01A 4P32A 1PNJA 3T5DA 2JS2A 1ZNZA 3JVVA 3HDTA 3BOSA 3B1XA 3V9PA 1AWOA 5DYIA 2EVWX 4G5OA 2OAQ1 1Z2CA 3C4JA 2O8FB 3L0IB 5JSZA 1ZW6A 1D2MA 4HUQA 2EW3A 1XPUA 1N25A 1AZGB 4PR0A 5EE5B 1VCIA 1QF9A 2P6UA 1EFCA 4B2PA 3EIEA 1WE2A 3K0FB 3C16C 4XD7D 2EFGA 3MWJA 2ORVA 4B32A 5J4VA 5JCZA 2J1LA 3Q72A 2XJ4A 4TQAA 3TMKA 1RC8A 3WNCA 5HE8A 2MIOA 2OT3B 2YT6A 1KY2A 1XJCA 2OCBA 4QFMA 5BYKA 4EPVA 2GRJA 1E9BA 1VHTA 3M1IA 1SXJD 2AWNA 5D3MB 5TMPA 5TXGA 1CR2A 3QSYA 3GFOA 3THYB 1QHXA 1DEKA 5K8UA 1WIEA 2VA8A 3IBYA 1UJYA 2V4ZA 1WBBA 3IIMA 3PR1A 2IF0A 4QKQA 4M9XA 1SEMA 1BMFA 2BV3A 3QIAA 1XD9A 4HB0A 1RVDA 1A1VA 1W2GA 3VHXA 4RTUA 1E2GA 2DPXA 3SBEA 2BCGY 1G8YA 4XSHA 1T0JB 3QXJA 1GDDA 4A0RA 4D26A 1Q1BA 2QUZA 2ECKA 1NKTA 5I22A 1CSKA 3LVRE 4Q7KA 2EFCB 4RTTA 5KPJA 2ZM5A 4DT1B 5B30A 3K1JA 4OHVA 4CEIB 3TAUA 4XWKA 5DN6D 1WI7A 2LJ0A 3MSXA 5GVSA 2B92A 5G40A 2XOKD 2XZLA 1AGPA 3MWKA 2RHMA 2JDIA 2YUPA 3LAWA 2ZJOA 4HAVA 4GZMA 1G6OA 1KO4A 3BS4A 5FWBA 1MR3F 2CLCX 4QJ4A 3KKPA 2DVJA 2BZ8A 3RNJA 1ZM4A 2ED1A 4NP6A 4ERNA 4F92B 3H41A 4A36A 2OAWA 2ODNA 2BCJQ 2CK3D 3NEJA 4L4UA 4M0LA 2ZTSA 4LJ8A 1L4YA 1XMSA 2VF7A 2W6IA 5EE0A 3OAAA 2CL0X 4LYHA 1D2NA 4ESRA 3VAAA 2V7QD 3VKHA 1JQQA 2OLJA 2CT4A 2WSSD 4YMSA 1H92A 3AKYA 2GXAA 2GJAA 3QG1A 4XWAA 3LX5A 1V43A 2QPOA 2YHSA 5SZHB 4M1WA 4PSAA 2P5SA 2ODEA 1WYXA 3FFAA 1FQKA 1BYIA 2V9PA 4ACAA 4X1VA 3MRSA 5JHGB 1MRSA 3K0SA 3NGPA 3EHRA 3HYRA 3NEYA 5FPSA 5HKKA 1U0HC 1ZU4A 2ZSEA 2V55B 1QKWA 3CRQA 2FEIA 2O52A 2XZOA 4OQLA 2B86A 1CTQA 2QZ4A 1DAGA 4UNNA 1G4AE 4EAQA 2YWFA 2GBLC 4TMZA 2DBKA 1EFHA 2IXEA 3PVSA 2QEQA 1QHHA 2R6FA 1E9EA 2PT5A 2WPDD 3HU1A 5HCNA 4HVVA 4DDUA 2BBSA 2EQBA 4UNQA 4NU0A 3I8XA 1M34E 1YQTA 2FV8A 2DBYA 3PENA 3VR5A 2CCJA 5KNCA 3GJ3A 4P4SA 4B44A 3KL4A 3DVLA 3PUYA 1WA7A 2GEVA 3BAFA 2RGXA 2K2MA 1FUUA 1KDPA 3TSZA 1XX6A 3ICEA 3CWQA 1EFRA 1NEBA 4TMKA 2L3PA 1SVIA 1ZYUA 3MWYW 4E03A 2VSXA 2DMOA 1XRJA 2ZYWX 4GDFA 4TYWA 4ZNXA 2QQ0A 3S1AB 2A5YB 5FBLB 3C0CA 2IYWA 2X3WD 4LK2A 2GTOA 5B57C 1MO5A 1XDBA 2OEPA 4CT4B 4M1OA 4AC9A 1KO1A 1X2QA 4HATA 2W2VA 4CZ2A 1XOVA 4LHZA 3ZGXA 1X2KA 4WZAE 4HB4A 3I73A 4JPBW 5IDVA 2AKKA 3UA6A 2JXBA 1NBMD 1XTKA 2ZVQX 1I1JA 4LE9A 3CPJB 3OFNA 5KTYA 2FEOA 1P9NA 1Q12A 1AK2A 3PEVA 1HURA 1F3OA 2GXSA 1CJVC 3ZLJA 1XTIA 2WTUA 3GJ6A 1NG1A 2ZIAA 3DHWC 3LV8A 3SS8A 3B8HA 2R6GA 3Q9LA 2KRSA 2YUQA 4IOMA 3U7FB 3DL0A 5AJYA 6Q21A 3Q5DA 4TN1A 2ZSDA 3TUJC 2J0UA 3K70C 4KFRA 3E70C 4PO8A 5DI3A 3GLFE 1OXSC 5DSZA 2GGRA 4V02A 3I62A 3KUCA 3EASA 2IXFA 2PL3A 4B3FX 2AKLA 1LF0A 2FO0A 2ZI7A 4M9ZA 2X77A 3LBIA 3ADDA 3I5XA 1PHTA 3LBHA 3TJZA 3F5FA 4D2IA 3NWJA 5JSZB 4C30A 1G5PA 1PZNA 2PZEA 1GCQC 1F5NA 4NCHA 2LX7A 3ZVNA 2BKUA 4MDEA 1QDEA 3JVUA 2ATXA 2ZE7A 2EKHA 3THKA 4WOPA 3K0CA 4UNSA 3RRZA 1KK3A 4OBEA 3UANA 4PQRA 2JGNA 1US8A 2O5VA 3T34A 3I4LA 4BFUA 5DH9A 4CDGA 4GMDA 1XD2A 1ZM3A 5GJVB 3IHLA 4RD2A 1Z6GA 4DEXA 3T1TA 4IFBA 2E5KA 1E2KA 5DHAA 2X19A 2ZR7A 1VYTA 2J6OA 3BWDD 1LS6A 2F43A 3REBB 4Q9IA 2QM7A 2MSCB 3NPFA 2FSGA 4B3CA 3CNNA 2ZYUX 3CRMA 4I1OA 1N5LA 3IO3A 4AFUC 4V03A 1ETUA 1J70A 3UMSA 3MFYA 4IOLA 5E3HA 2OSBA 4EPTA 3RSOA 2ZUBA 1LW7A 3H0IA 2ZRJA 4LV8B 2EGAA 4WXRA 4OHXA 5KU1A 1OKKA 2EWVA 2PCLA 3T1QA 1CKEA 3BERA 1GCPA 3SFVA 4LPSA 1UPTA 4P31A 4MYCA 5DLQC 4YC7A 3PXGA 3P26A 1U3OA 4OQMA 1LTQA 1P60A 1HSQA 2RB4A 2HEIA 1VPLA 3GEIA 4FMBB 1Z0KA 3DMNA 3K0AA 1FMLA 3DM5A 1F48A 1Y3AA 1Z0JA 1ZD8A 4ZCIA 4GOXA 4Q4AA 3P4XA 2XNDD 2YNMA 3U5ZB 1ZBDA 3ZIAA 3KXKA 1M27C 1S96A 2ZYVX 2VP4A 3GLGA 1OEBA 1UGVA 5FPKA 4MDFA 2GVDC 3JZMA 4II7A 3I61A 1EK0A 1LNZA 2VP0A 2I1VB 4NCNA 1XTSA 2ZSBA 4IOKA 3NHNA 3M0TA 3I9QA 1M7GA 4FMDB 1X8JA 1GM5A 3RRYA 3KQLA 4QC2A 3SYNA 1W49A 1UUEA 1MV3A 2JJ2A 2KBEA 5JWHA 5FI1B 1AWXA 4KV9A 1W48A 4L9WA 3LLMA 4LSGA 1E2JA 1K0SA 4N3NA 3A98A 3VS3A 1YNZA 1NIJA 4I4LA 4DIEA 4KLZA 2VP6A 1WB9A 2FRWA 5LD2B 4TL6A 721PA 1YR6A 4JLPA 2VVKA 1KO8A 3VS2A 1S4QA 1XMJA 2L2PA 2H17A 4A6XA 5FOVA 2IF2A 2KB0A 3LO5A 3LA6A 5LBIA 1M3BA 2UZ3A 2AL7A 3A1TA 4M4SA 1XPRA 4QNRA 4HXJA 1AS3A 5J40A 5JHHB 3P27A 3UMRA 2VH5R 1Q22A 2OBNA 2IUTA 2WWFA 4B76A 2C8VA 2O88A 2LWIA 2MOXA 2VHJA 2ZREA 1I4TD 3TH5A 4TT3A 1G41A 1R0WA 5G3ZA 1HT2E 1GSIA 1YZTA 5L3QA 2N46A 5DI9A 5HCIA 5CIWA 1JEEA 1QHHB 2A78A 4KRTA 3OEHA 2D0NA 1G3RA 2JATA 3SYLA 5JWRA 2WJGA 1JAIA 1GRRA 1AEYA 1IY0A 2Q6TA 4AYXA 4P4SB 4Q47A 1PWTA 2GAOA 4PAOA 4BEBA 2XTNA 2FPEA
chains in the Genus database with same CATH superfamily
4X0EA 2H1CA 4AURA 1KZ6A 4RELA 3RU2A 2B8TA 1KFEB 3U0VA 2O3QA 5IHXA 4Y18A 3PC8A 5BSUA 1XNQB 3ZEAA 4PAGA 1B76A 4D97A 1I0CA 1WMBA 4G63A 5H5JA 3G68A 4G1FA 2OHFA 4PV7A 2HQRA 3VTFA 5DI3B 1MO6A 3GUUA 4CI0C 2V45A 2OFFA 4FYVA 2Q4BA 5F9HA 2ZCFB 5BWBA 2JLAA 2VYQA 4FFOA 3I58A 9LDBA 5HJ7A 1UT6A 3CT6A 5IXJA 3F0TA 5HF6A 1JSCA 2WU3A 2QJFA 1HA3A 4O8ZA 2DIQA 5BUQA 1ZIDA 1H2BA 2X86A 5BRJA 1DO2A 3CJTA 1AVTA 4ZI3A 2B0JA 2AOVA 3F6EX 1F0YA 1EFRD 3CXCP 3GJTA 3BF8A 2QT1A 3AT1B 1HTBA 4F16A 1T5TA 2C99A 5BR7A 5E2AA 1QPBA 4A2CA 5KJEA 4X64B 2VTBB 4Z1MA 1VPVA 3ECSA 2VVTA 3IQWA 1L7XA 2LNDA 4E5VA 1V9LA 2GF2A 2QLBA 5BSRA 2V6MA 3PKJA 3THXA 3WISA 4MW7A 3TL2A 5A5GA 3KBBA 3A4NA 1NT4A 1H8HD 2QENA 4QHTA 3UJ6A 1PVOA 1EJ6A 2B1RA 2FUG1 5CDFE 4GHWA 5F3DA 1HE2A 1ZW1A 1ZVJA 1P4AA 4DJJA 4IY1A 4B6OA 2AH5A 3CUWA 4WK4B 2QQEA 3GEDA 2POQX 2QA4A 3MOGA 4C3ZA 3KAKA 3WA6A 4IIHA 2CHGA 2W42A 2YNMD 4G3XA 1XKXA 3THRA 2BHTA 5THKA 3CR7A 2CL6X 3BMOB 4M83A 3QE3A 2NTYC 2FR8A 1D4ZA 4OYYA 4EG1A 2P2DA 4UEQA 3WK5A 5GAN3 4S1OA 4ARIA 3RHZA 4O4LB 1DKRA 2ZUCA 2DD5A 4HT3B 4KBFA 2ZAOA 1ESDA 5KS2A 1OTYA 2BI7A 1N4DA 1H3HA 2G72A 3ETNA 1W5TA 1X9GA 4HNAA 2DVEA 1DRVA 3DMGA 1KGDA 4BX0A 4RK5A 3U2QA 5EQTA 4DM7A 4KIGA 3AGPA 5JO9A 4MB0A 2R2AA 1JAYA 4B48A 3DAGA 5KNCH 4IEIA 4GS5A 1JR4A 4M1KA 4BYMA 2ROLA 1BW9B 4A0SA 4HKTA 2I2AA 1EAYA 1ZRNA 3WGMA 1ZA1A 1U94A 3NC4A 4DG5A 2Q1WA 4V1CI 3VGJA 2B94A 3VO1A 3K9CA 5EKXA 2I80A 1IY8A 4CCSA 3UKDA 1G9XA 2DUUA 3I6YA 5EWMA 4KOAA 4XDYA 5AM4A 5H81A 2J9FA 2JZ2A 4UUAA 4YDRA 4A82A 2JEOA 2ANCA 2JM9A 2KGTA 4L5JA 1V3UA 2Q3BA 4H4CA 4YP5A 2HIGA 5U4QA 2B21A 5CKHA 4BJ5A 3NGXA 4HTAA 4J16A 5IT4A 1CVIA 1DJPA 1KFKB 3Q2IA 3HA5A 1X43A 1P3JA 3LRTA 2AOTB 3C4VA 3K30A 3UBMA 2FZCB 3ZQ4A 4KE8A 2M6LA 2V97A 3NHRA 1B8OA 1QS0B 1KY5A 4H59A 3PRKE 2XTAA 3MJDA 4YDQA 1RP7A 2H7CA 2R5MA 3W8FA 1X7YB 1J49A 2GAFA 1FYWA 5FUYA 4KREA 3PNVA 2VDOB 4K03A 5IAJA 1GLNA 4L73A 5LJ5j 1UZUA 3KT8A 1YK1A 4M98A 2DJQA 1YC5A 1R27A 3TFQA 4UVEA 1FF9A 2JGLA 3TZLA 3NBUA 3V4ZA 1M3AA 2G5TA 1PR1A 3B6IA 3RS7A 2R6JA 2ZSJA 4JJ6A 4MNTA 1JA1A 1XZQA 4Y6GB 3RD5A 4GP7A 1PR0A 3CLHA 2P4RA 3HKSA 4K6FA 3ZI4A 3SOZA 1OU8A 4Z02A 2IE0A 2JHAA 4EGCB 5JFGA 3ML1A 3RIMA 1V4BA 4ZKDA 3FZQA 2O8BB 3WMGA 4EF5A 3A0RB 3PHCA 5ALFA 4UMFA 2KYBA 5DBGA 3G5AA 1N4AA 4NFYA 5FD8A 1Z5ZA 3EBLA 4E1AA 1VE1A 2IRWA 5CKEA 5I9BA 2LCCA 2Q2VA 3EXHA 2C61A 2RH8A 3JR3A 4G0NA 1YOBA 4AI6A 3UWKA 5DHTA 4O4JA 4RL6A 5CMLA 4X60A 4J9FA 2GTJA 2XMRA 2GD0A 1X01A 3T4EA 5EKTA 4RSRA 5KQSA 4WF2A 3HDVA 2XUPA 4FJ2A 2QV7A 3WQBA 2HU8A 1IZ0A 1G9TA 4F9FA 3GOQA 1MFPA 1K4KA 3Q9SA 2ZE8A 5A0VA 3BL6A 1GZ5A 3WYCA 5I3ZA 4PLCA 1T15A 3LKZA 3G85A 2JIZA 3R0QA 3DM9B 1EJ0A 1GTG1 3C1UA 1WZCA 3RS4A 2NVBA 1OH6A 4D1YA 3K9GA 3SI7A 1KVQA 3L79A 1B6TA 3I12A 1AZTA 3IR5A 2RHHA 4UOZA 2X9HA 4J8PA 2PVPA 5K0GA 1TYDE 3UVEA 1FYVA 3IERA 3L0SA 4HUTA 3Q1KA 3K1ZA 3FMVA 4Y0VA 2QW8A 2KROA 5TEVA 1E98A 2VCEA 5TIIA 4M77B 1TH7A 1G83A 1NLYA 2C0OA 1Z28A 1Z4OA 4XX0A 1I14A 1YB2A 2BMVA 4MX8A 3GLTA 1ZZGA 4KXXA 2VSFA 1W96A 1V96A 1N5ZA 1YI8A 1HQYE 3O95A 4K1XA 4B7AA 2DO3A 2V1RA 5FWDA 4GNKA 2ZRHA 1KFBB 5JAMA 1AN0A 3OQJA 3B85A 3WMRA 5LJ3g 1MO3A 4A23A 3JQ8A 3Q87B 1T5HX 3TOVA 4D8WA 5ANRB 3CNOA 3WHPA 5FUQA 3V8EA 5A6VA 3ND6A 2WJJA 2QUAA 3INRA 2DILA 3R7BA 3I55A 5LQCA 5LXTB 5D5QA 1GXSA 3AJ8A 2IX9A 2PT9A 4R1LA 3H0KA 2ZW9A 2VA9A 4M77D 3LLVA 3B3JA 2GBQA 1QDLB 3KSZO 1HDIA 3OYEA 1I3NA 5E1MA 1J42A 4LOIA 1MOSA 5ICFA 2XMCA 4M7DG 2C77A 2WRZA 2CHFA 1XZFA 4D6PA 4X24A 4PL6A 3CPWP 3SS9X 1NUPA 5IVKA 1BZYA 2ZYTX 1PJ3A 3MP6A 4C3VA 2RAVA 3U1TA 2ORIA 3CCSQ 4HXFB 5B2FA 4AK9A 2NNLD 2R1ZA 1M34A 3Q1LA 4J91A 2CT3A 2HT1A 3GLXA 4W63A 3K1YA 1BJRE 4K6GA 2O2CA 4RWEA 4JP3A 3JVEA 3V8JA 3QVVA 3EDRA 4UHHA 2ECFA 4M89A 3G2OA 3OIVA 2IPLA 1JIXA 3HR4A 5IASA 2J0VA 4QRDA 3B3GA 3EXFA 4DDVA 4MV4A 4PAMA 3MXTA 2FVUA 3JSAA 3BKXA 5AM3A 3BWMA 2SKDA 3K8YA 3TLJA 1OV3A 4FLMA 1RWBA 4E7SA 1AF4A 1KP3A 2NU7A 2HLDD 3NYRA 3BWYA 1PTKA 1R3DA 1CLEA 3Q7TA 4DWJA 3UOAB 1A9QA 1EEXB 1LQUA 2I7XA 4X34A 2P84A 3RARA 2JT4A 2LZ0A 3I4FA 5IHPA 3U44A 4PAWA 5DBOA 1D1CA 3I05A 4WKGA 4R1QA 1XZKA 1ZIYA 1GNLA 2IYOA 1R16A 3ZOZA 2YJ4A 4RHUA 3UG6A 4LYJA 2PUBA 1D07A 4TKUB 3CISA 2YXBA 3QE0A 1NVWQ 4MV3A 1CY4A 3CH4B 5ENZA 4MUNA 1AHHA 4U7DA 2ZQZA 1V3QE 1GOTA 3E48A 1OPKA 2G70A 1U1CA 2D4AA 1ILWA 1NBME 3PEWA 2J48A 1P0PA 5I9MA 1HYHA 5L6LB 3TR5A 4BHTA 3ZVRA 2VR1A 4YCAA 3K7EA 2KYRA 4QJIA 4D6WA 3OC0A 3CNBA 4CUJA 5AW7A 4PHTA 2ZJ6A 4MQ6A 3W8NA 2AJDA 4TLMB 2YYAA 1W2BA 5GAN8 3WYAA 3C12A 4NHOA 2A9JA 3SXPA 4HZIA 2EGEA 2ZCUA 3WWZA 2G9UA 2I3AA 1U28A 1E6WA 3LUKA 4EMKA 1CNMA 2L3SA 2FAXA 1MEOA 1TZBA 3QZ5B 1EESA 4Y2HA 4HS9A 5M34A 2PUHA 2R7NA 5GOTA 1C4OA 5AIAA 3G6EQ 1R9GA 3DOHA 2FW6A 1GLGA 1IEVA 2YWDA 1A8UA 1S02A 3QTLA 3G6KA 3FCOA 4IHJA 2G1AA 1X39A 2HWYA 1ANKA 4GY5A 4ON9A 1K68A 2GBPA 3L1IA 1Q1ZA 1ZHOA 3U56A 3CQTA 1JO8A 3A3YA 5LM3A 5ALOA 1VLQA 1W5SA 4URUR 3M4XA 1H23A 3AY6A 4ANFA 1WXEA 2YHIA 1CK4A 1DQRA 3PDUA 3KELA 4TKLA 5CAEB 4ZDWA 1AKWA 4BX3A 3A4MA 2NM0A 1LX7A 1U8XX 2FE4A 3G23A 4KPYA 1IQUA 2VPIA 1UM9A 3AONB 5CEEA 1PZXA 2DFUA 2Q5IA 2KXCA 1SBYA 5KI6A 3G5TA 5IRCD 1KDRA 1Y1PA 1USUA 1AGYA 1NBHA 5DSXA 2EZTA 1DT5A 5LJ3e 1FZQA 2WNSA 3V4OA 5JWOA 4AQ7A 3C3BA 3KLPX 4QPJC 5FU7C 4DMMA 3C7DB 2RKWA 2J87A 4KO1S 4RY2A 2QPTA 1OFIA 4BZZA 3ZWVA 1QB8A 3QFTA 4MGKR 4QVZA 2BGKA 4RVUA 1NJ8A 1UFKA 3B38A 1L7EA 2L82A 1JVSA 1GUAA 5LYJA 4IFIA 5TNXA 3W5DA 3UJAA 1XRPA 4F3KA 4INJA 1SC4A 1QIKA 4HWOA 3OZBA 3HVRA 3FZEA 1SXJA 1ZD1A 1FFYA 3UYKA 3A1DA 1K73C 1XQXA 1M54A 4PFQA 4NU5A 1BN6A 2ZZDA 4U3JB 1DL5A 3EG9B 4QTXA 3WMEA 1KD1C 1UZLA 4M77E 2NYAA 3CCUA 1JECA 1TLTA 3QMWA 3LH0A 1A2QA 3EXAA 4G1MB 3L41A 2CCGA 3U7JA 1NR7A 3CCVQ 3LYUA 2QPAA 4ZAGA 2V7QA 2PMWB 3LBAA 4O3MA 3TREA 3UKOA 3T5TA 3QIVA 3URKA 2PYDA 2EYZA 3MERA 2ABWA 3VKGA 3E3OA 3AIKA 3UV6A 2OV2A 3HUDA 5DASA 2OTLQ 4LDUA 4J3NA 3MQ4A 5EINA 3KZXA 4EATA 1W36B 3HXLA 1FNCA 3N2GB 1RACA 3CF4A 2VWGA 1PHRA 4OLJA 3VNUA 2VHUA 5EC7A 3ZTWA 5KTKA 4R56A 4HRYA 1C1YA 1J2TA 5TT0A 1HFEL 2UVPB 2D54A 5E6UA 4XI9A 1WUKS 4BFXA 4BO6A 1TADA 4RTQA 1ZL0A 4LJRA 1JHRA 4R05A 1QF6A 1U3WA 5BRAA 4OU5A 5IS2A 3KV1A 5I51A 3HA2A 3UA7A 5JTTA 2DHRA 2B9VA 3OESA 3KT3A 1AKRA 4UNPA 2RG7A 3B2QA 2C2HA 2PZKA 4MA4A 2OP1A 3GCGA 1SCJA 4KDFA 5GTDA 4FONA 5KCMA 2RE8A 3DZBA 2Q62A 4EQ6A 4DLNA 2XHEA 4PZYA 3ZWCA 3A6KA 3P4YA 4M21A 2Q7DA 1NATA 3CCMT 2QRJA 1JVNA 1AJEA 4D80A 4C06A 2WHEA 3H5AA 3RABA 1NURA 1JHYA 4PXAA 3QKSB 1E77A 3ND7A 3EULA 4URYR 4IHKA 3A8GB 5LBTA 2QNRA 1WGSA 3IO5A 1W0JD 3CCRQ 2IV2X 4X1OA 1IB6A 1ZJYA 2V5UA 5DYIA 1OWPA 4G5OA 4YAJA 3PXUA 1EVZA 4HUQA 4MKZA 1P8AA 1U8CB 2ZYDA 2IEIA 1XZIA 2EIXA 3WQSB 1ORWA 4YRGA 4BC1A 4TQAA 2DPYA 3CC2A 1GAXA 3N2LA 3BA1A 1T9ZA 2B8AA 4E15A 1UJYA 1H9BA 3LMKA 1FP4A 4FGLA 3EFSA 4OH1A 2DXCA 1G8YA 1S3FA 1ZJWA 1T0JB 3QXJA 3B52X 3QE2A 3RCBA 4N0QA 5F5LA 3LVRE 4TVOA 3OJEA 5KWSA 3CMMA 3QXGA 3S0JA 5HQ3B 1QK5A 4FI3F 1E2BA 1Y7LA 3FSRA 2YUPA 5K6RA 1P81A 3KKPA 1SIOA 3MT9A 4L4UA 2VBFA 4LJ8A 1ZH6A 5EE0A 1IVSA 1TM5E 1X6OA 1TK9A 1IHXA 4TUYF 1FRVA 3LX5A 1FB5A 1YD7A 2C9DA 4D46A 4ZAXA 3FFAA 5HVNA 5JHGB 1MRSA 4RA9B 1ZU4A 5IJ0A 5GV7A 4OQLA 2D3TA 4XUEA 5CJJA 1K2WA 3HEBA 4A0QA 3KL4A 1WA7A 1TJYA 3ICEA 3OECA 4PFJA 2CLKB 1E89A 3N6XA 1BMTA 4TYWA 4ZNXA 5CAIA 4KYTA 4RIEA 4HATA 3ONDA 1WY5A 5IDVA 3PLAE 1Z7YA 4AJEA 3IVAA 1Z4IA 3Q7EA 1Q12A 6YASA 2A9OA 1Q1AA 4CNQA 2ILTA 4PO8A 4YRIA 2ES4A 4YS6A 4M9ZA 4D74A 3FUTA 4CM4B 1G5VA 1PHTA 3LBHA 1U0OC 1YVUA 3D2LA 1TUGA 2Q4RA 1ZY2A 5JS1A 2EKHA 3UANA 4BO1A 2NO5A 3G2KA 4BCDA 4N8DA 2Y3IA 8GPBA 5H0IA 3SWWA 2E5KA 3RAJA 2TECE 4H7KA 3QLVC 5CNMA 2XD0A 2MSCB 3CNNA 2YWWA 1QVVA 4CR8A 4QO7A 4B6QA 3FDRA 3LT5A 5FXMA 5LUAA 4MWDA 2OPHA 4EVIA 2K4YA 3LF1A 3RMSA 3WIBA 1IBLB 4Z1OA 3I61A 1SOWA 1XELA 5IJZA 2I1VB 3SZUA 1ZISA 3U9TA 3TB6A 3AERB 5FI1B 4E14A 3SXJA 3IP6A 4DIEA 1WB9A 1CERA 1ZK2A 2OKCA 4TL6A 2CY0A 1S4QA 2HMVA 3ZHTA 3GAMA 3LWHA 3PDIB 1WM1A 3C3CA 4PR3A 3I9V6 2QWXA 2N46A 5DI9A 4OGLA 2VNJA 2LBPA 3NKFA 5JWRA 1SC3A 3PE4A 1JL3A 4F60A 5EHGA 1GT91 4C7VA 3LYAA 3TUIC 4EEXA 1XHFA 2RCNA 4YMUA 2P9FA 4EHFA 4J0EA 3MCAA 2WTBA 4KI0A 4MV8A 2LP5A 3KALA 4DQUA 1BJKA 3UMYA 1R6VA 4P3KA 1ACMB 4MB2A 1ODSA 4TLLB 3OS5A 1XDGA 1BIAA 5EP2A 2BSXA 1BQEA 5M3BA 4V0ME 2UZ0A 2FFBA 2Y0DA 1IBCA 2V3CC 1O08A 2FYKA 3SGLA 4YQEA 2DEUA 3VHLB 3UC9A 4V2UA 4OPMA 1XQ6A 2QGNA 1Z73A 1W0KA 1HLGA 5A03A 3UYLA 1DTWB 4XRGA 1EFPB 3GMSA 5HK0A 3LFHA 2P90A 2O0HA 3ZI7A 5CVIA 2AJ8A 5M29A 2O5EA 1FYFA 4C92E 1P7CA 1JMYA 3DDCA 5DYWA 3UA4A 3WLHA 5KYNA 5EJ2A 3GLGB 3GT7A 3VTKA 3IALA 1ZC4A 1FRFS 4L16A 1ZGBA 2HJWA 3M9QA 2EPDA 1EDBA 4PBRA 1CYDA 4KYUA 2OXCA 5A3RA 1WDKA 3KHTA 3D0OA 3HRUA 2GZ2A 3RFVA 3P2JA 2WHPA 2P2NA 5IDXA 2QGFB 3MT8A 3FHCB 5DZSA 1NPRA 1DX4A 3AMVA 2BM9A 4B84A 1QP3A 4Q16A 3H86A 3MRXA 3R7DA 3RAEC 3QH4A 1IQ0A 5G0TA 3I83A 1GGEA 4A2WA 3IQLA 5HNKA 4DCJA 1B74A 5EXPA 4O5AA 3WP1B 4U2BA 2ZRQA 3ONEA 4LMAA 3TX6A 3VRHA 1KK1A 5CA0A 1YKSA 3TM4A 5CITA 1MC8A 1AS0A 1W5FA 3EIUA 3AOEA 2P5YA 2XYQA 2JJMA 4QOSA 2DECA 2LQKA 1SC6A 4GP9A 3GLRA 5KSZA 4DQKA 2XMQA 4ENSA 4LZPA 3PVCA 1QAMA 1QGDA 3RG2A 5EZYA 1S01A 5DNYB 1BVRA 3G17A 2G71A 4S3MA 3DZHA 3W5AA 4CEJB 1ECLA 3NNDA 1O96A 1ZQ9A 1EMDA 1GFIA 3JW8A 4KFSA 4ETNA 1TZ2A 4DLBA 4HVTA 3DOIA 1A04A 2BMAA 3TKAA 2O9SA 1JDBB 4Y2SA 1C0PA 4ZOAA 1CUZA 1VQLA 3NM6B 3MP1A 2OVBA 2IS6A 3AINA 3IIEA 3O03A 4ZYUA 4WE3A 3ZY6A 5DW0A 3SN6A 1J5EB 4HAUA 3KHSA 2CSIA 1UDCA 1ARZA 4MCIA 4PX3A 2RI2A 1D0IA 1VGQA 3OPYI 2PSHA 3P2EA 2FWNA 3WAJA 5LLTA 2BM8A 2GB4A 2ADMA 4MIKA 2AKYA 3CBGA 4IO0A 1MOPA 3K20A 3M0PA 4LD9K 4E94A 2OE2A 4F04A 1EG2A 4K9DA 5JECA 4MPTA 4JYBA 4NE2A 2V6JA 4LNHA 2C58A 4B43A 3LQYA 1JKIA 4B3IA 2PKQO 3WNZA 4LS3A 1M0SA 2A88A 2J3KA 2G5GX 3ZDZB 4NZMA 1H0RA 3ADCA 1TLLA 4KRFA 4Q39A 3QFFA 1N6KA 4EPXA 4QGFA 1JQJC 3GYGA 3LSYA 2GRUA 2KS6A 2XWJI 4IRMA 3EHEA 3VS7A 3L46A 2X0RA 2XWSA 2A59A 1Y6RA 4K0RA 3KBOA 4TTRA 4JI5B 1YFJA 1TF5A 3EPLA 1YDWA 2WJWA 2D0DA 4MUBA 4W9NC 2CC2A 2ZUWA 3HCOA 2PIAA 5IN4A 4KAJA 3RIGA 1W30A 3B70A 2NPOA 4O4JF 2K2QB 4QT7A 1TYBE 4LGMA 2WT4A 4R98A 1S2LA 2GBLA 2GK3A 4QUKA 3GLFB 2BZXA 4IG4A 3H11A 4HR7A 1QGUA 3U09A 2QN2A 4EI2A 5JAPA 3HU5A 4H31A 3DULA 3R0ZA 2K9GA 3WXBA 1I9CA 4A2QA 2C4HA 2XGOA 2QYZA 2ACEA 3H84A 2RHDA 2POCA 4GBQA 5TMEA 1DMRA 4ZT5A 3ESYA 4NPHA 2DLNA 3MELA 4NIMA 2CFOA 3LS2A 5LZ4A 3GL9A 5FV7A 1Z74A 1G2QA 1WEKA 2WNIA 1YJNQ 4F21A 2VF8A 3OYCA 4MRVA 3RVNA 4ZYYA 5FTJA 4LRXA 4LE1A 3UJPA 2EJBA 1YZUA 3BTVA 2CJPA 3NBZC 2Z1MA 4DSOA 3FCYA 1EJBA 4ZWNA 3ZDQA 3A26A 3IDAA 2M16A 2VUBA 4WZZA 3IYLW 5B7PA 2F3RA 1RABB 3CUKA 4CTNA 1ZJ6A 1X6GA 3IQIX 3D02A 4LDZA 1DC4A 3CUVA 1N7HA 3CEJA 4ZZ0A 3C3PA 3CNHA 2PBZA 3ZQJA 5B3LA 2YWCA 4DQ0A 2QGZA 3OEEA 3L0DA 3EUEA 4X1IA 3B20A 3IKJA 1W2HA 3W3AA 4KX3A 4M7DB 5HZMA 2WINI 5BV0A 2J6BA 4A4FA 3NALA 2JI6A 2NO1A 3P9ZA 1S4MA 1Z18A 4Q6BA 1FNMA 5KNBA 1P2FA 2AG5A 4OFZA 1M6WA 4EITA 4L4SA 1GZVA 4LMRA 3H13A 4QYIB 2EKLA 3H7IA 4MQ4A 2V1XA 1OA0A 1F6DA 3PX2A 2DUWA 3B7PA 1WQ1R 3C87A 5JCJA 4TL7A 1PZGA 4M9CA 3GOXA 5AI4A 4MRNA 2YUOA 5ELXA 4ZEWA 4FFNA 4E6PA 1TTHA 4PYKA 1G1MA 1E20A 4FSSA 1YQXA 3TRDA 1U6JA 3AP2A 3CUTA 1FFXB 1Y1LA 3BC1A 4M7DD 1N0UA 1N3IA 5A4JA 2V8KA 4BFVA 3DKRA 3MJRA 3ZW8A 4KFTA 1PEAA 5KX5B 3JAKB 1JSRA 3U81A 1RE0A 3OO0A 3RC3A 2OAGA 2B0CA 3UIEA 5AI0A 2J3QA 3G2QA 4C21A 3PE3A 3GLGE 3MTEA 1VQ4A 1VIEA 2E18A 3HUTA 1ZSGA 3G2JA 3N8DA 1HR0B 2AYYA 1BS1A 4JJGA 1ZAKA 3CV3A 2ZP1A 3HN7A 2LQNA 4WUVA 3N7TA 2P7HA 4ZCMA 4HCKA 5KYYA 1OGJA 2BUBA 4AUKA 2W83A 2PX4A 4C0DC 4M9SA 4M55A 1VLHA 3A6DA 3NJRA 4NCXA 3WZ2A 1IY9A 1UBEA 1WHJA 5K0TA 3EC2A 1I07A 2ATEA 1G9SA 1GILA 3O8NA 1UGPB 2GILA 4AZSA 1BDJA 4RA6A 4LN2A 2GNOA 3WGJA 4KITB 3TKYA 1C81A 1V6AA 3GRRA 3C6QA 3P52A 2LT1A 1VQ7T 3NX4A 5CLGA 1CRWG 1I1QB 5C46F 2DR3A 3AL0C 1J6UA 2H4YA 1QE0A 3D7RA 4B3BA 4D0LB 1IK4A 1RE1A 2X1MA 4OQXA 4S1NA 2I4TA 1ZNXA 1QH1A 4KLAA 4PLPA 1ZKMA 1OOTA 4NMHA 1EFAA 3E82A 4DXAA 3H6GA 2RGAA 4H7IA 5TGZA 2GI4A 4JT8A 5A71A 1C3OB 2Y76A 3IBCA 4KMOA 5HZKA 4FHCA 2QTFA 3FUCA 1DG1G 2VOJA 3I56Q 3A3KA 4FT4A 3KTAB 2Z6UA 4RTKA 4UKDA 4R1SA 4G5GA 3HB0A 3ONFA 3CSSA 4ZHQA 1ZOPA 1C3XA 3GA0A 2BLLA 3QEOA 3RDPA 2RGDA 1XDDA 3IEKA 2V7GA 3Q12A 1Q86U 3RTDA 4ZXFA 3X20B 1BN7A 2HMYB 3TL3A 1I5EA 4LY3A 1TL7C 5JS8A 2OG2A 3TGWA 1U7WA 2FSIA 4UNIA 2SRCA 1EPUA 1NMXA 1QO9A 3FDZA 4RLQA 2VJMA 1AHJB 4GDMA 2CN1A 4C0GA 4LJ6A 3EVGA 4XQCA 4IHJF 4CU5A 3NBQA 1I4K1 2PPLA 2B8WA 2QY6A 4LBYA 2PA3A 1PG5B 3AF1A 3PE6A 5IH3A 2JB9A 1NDHA 1F4VA 1V11B 4NXMB 4FKMA 4OX9Y 2EAUA 3F96A 3MCZA 1KRXA 1WUJS 5FOTA 5HEKA 2X4LA 2ZJ7A 4MINA 3VU8A 1DJLA 1JJAA 2AUTA 3KU4A 1MAHA 2QVCA 1SCNE 3VS4A 2QVBA 1DEXA 1JJBA 3CKMA 2WIKA 2R48A 3FAKA 4IF6A 4RVNA 2HN9A 2CHUA 3PQ5A 3KYCA 4FI3C 3ZV3A 3KR2A 1DTSA 2ZIWB 2BEVA 1HJDA 2C3MA 3Q9UA 1TC1A 4CM3A 1Q92A 3T7EA 2I3DA 2DBZA 1UFOA 3O6VA 4NZNA 1BO6A 4LNPA 3PRYA 2HCFA 2WSLA 5LJ5d 2CLSA 1H66A 5F1YA 4YUYA 4GZ3A 2I7DA 4HQLA 5IKMA 2JAHA 3ASKA 3W3AH 2YSQA 4A4EA 3STVA 3GUYA 3CURA 4YX9A 4J7IA 2A9KA 4X3PA 1BKDR 3I1FA 2GEFA 1TX4B 5G0SA 3OCVA 3QKTA 4CIDA 1NYRA 1CUIA 5KNBH 4EI8A 3GEGA 4JXJA 4OD0A 4D4LA 1D2CA 1U98A 3JZFA 4JOSA 4II2A 4W9MC 3EQZA 1EZZA 1GPLA 2GF0A 1CY1A 4DG9A 1FMWA 1Z34A 3WGTA 1U2GA 4FMCB 4OG2A 1YE3A 3GP3A 2PKCA 4E3ZA 4PGFA 1WETA 3IT2A 4Y6RA 4AZTA 2J0SA 2JLRA 3NDIA 1E8MA 4B74A 1ZUHA 1WTAA 2AF3C 1E0DA 4UHJA 3DZKA 3LC2O 1I2AA 1YI0A 5KAPA 4P3NA 4AKIA 4NYJQ 1ZCBA 4I1IA 5A2QE 3KR0A 3OQOA 2P2CA 2GN2A 3NYIA 5I7EA 1SFRA 1D6NA 1RZVA 3VJPA 2AD1A 2C9OA 3ZKWA 1H5NA 4TKMA 1F2TB 4UTOA 4Q15A 4EJ0A 1KI6A 3PC8C 5GINE 2JIRA 3Q7IA 1K76A 1K73R 3RK0A 1YOVA 5DB4A 3QEJA 3WA7A 4DKJA 4N6OA 1WCXA 3IVGA 1HORA 4B0PA 4KR0A 1VQMA 4EA7A 1KD1R 4EPWA 1C50A 3PUVA 4DAEA 3S40A 4AG6A 3TPZA 1PV2A 5BRNA 2WP8J 4EGJA 4RFSA 5DLDA 1XZGA 1FL9A 2BEKA 2Z3ZA 2D0PB 3MRTA 4IIVA 2H11A 4ND6A 4YJ3B 4B46A 2UUOA 1Z9QA 4M7DE 4K7JA 4ZQCB 4QODA 4LIPD 2IEYA 3RC7A 3OW2A 4CMBA 1B07A 2I1QA 1P6UA 1ULUA 2BFDA 3U49A 3KZKA 2VDNB 3M4GA 2XCRB 5ITWA 2RB5A 2O4XA 2NWQA 1EUYA 1JDVA 2W0SA 1VCOA 2E65A 4M53A 2HZYA 3UK1A 4UMVA 1KI3A 1I0LA 4H16A 2CV1A 1FRQA 2GKOA 2A57A 4PNHA 5J5CA 4MP8A 3SS7X 4NL4H 4I99A 4MQ5A 3EFOA 4M54A 4LDQA 1XJQA 2OILA 3IB6A 2PZ1A 1PSZA 1GN9A 4MZXA 3EGXB 4G8JA 3PIIA 5C5EA 4RJLA 4F4DA 1I32A 3OOYA 4KN5A 1XZHA 3A70A 5GAOq 2HEGA 2C4MA 1T3LA 1M90U 2RHUA 4LRSB 3U3OA 1U5BA 4B6RA 1Z0DA 2R751 4YRKA 1DB3A 2BSAA 1B93A 1V5WA 2TSYB 1QVFS 2XJ9A 2WPDA 5AUNB 1U65A 2OCPA 2A7YA 4RTOA 1G60A 1E6LA 5AW5A 2CT8A 3JAWA 1JFFA 3B2EA 5D3MA 4HCZA 3OYDA 1G38A 2FEAA 1PU2A 2KWIA 2PRJA 1KEPA 1I1OA 4FP9A 3FR7A 2FR8C 1BX0A 3NIBA 3DZJA 2D8HA