2MOXA

Solution structure of tandem sh3 domain of sorbin and sh3 domain-containing protein 1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
143
structure length
143
Chain Sequence
QHMSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIFPRTYIELLPPAEKAQPKKLTPVQVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVIKRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural investigation of the interaction between the tandem SH3 domains of c-Cbl-associated protein and vinculin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Sorbin and SH3 domain-containing protein 1
total genus 17
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2014-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2moxA02
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2moxA01
2O9SA 2EGEA 2DNUA 4J9CA 4X1VA 1I07A 3M0TA 1K1ZA 2KRNA 3EG2A 1T3LA 5GJWB 1A0NB 1SEMA 1SRLA 1AVZC 1UJ0A 1NLOC 3M0PA 2YT6A 3H0HA 2LQNA 4RTVA 2MCNA 5EC7A 1T3SA 3KFVA 3RBBB 3VS4A 1KSWA 4OMPA 3UF4A 1QKXA 1ZUKA 2YUNA 1NM7A 1KJWA 2J05A 2JMCA 3SEMA 3U23A 2YUOA 2LJ1A 1GCQC 2W0ZA 2RNAA 2LCSA 1ZUUA 2EVRA 4IIMA 2YSQA 1V1CA 2A37A 2KRMA 2LMJA 3PVQA 4LN2A 1UDLA 3JV3A 2DJQA 2GTJA 3R6NA 4IIOA 1SSHA 1X6BA 1KIKA 2KXDA 2NWMA 3VRYA 3REAB 1UE9A 2XMFA 1NLPC 1K0XA 4RUGA 1IO6A 4AFQC 4GBQA 1AD5A 3VS1A 3H0IA 4DEXA 2K3BA 5IHKA 1YWPA 2SRCA 2FPDA 1TUDA 3I9QA 5ECAA 1JXOA 4HXJA 4HCKA 1K76A 1HJDA 2CH4A 1ZSGA 2J6FA 1JXMA 2L3SA 3M0UA 2KBTA 3EG3A 3NGPA 2RQUA 2VVKA 4D8KA 1UG1A 2JT4A 2FPFA 2F2XA 2P4RA 4Z89A 4M4ZA 2J6KA 2HSPA 5FW9A 1AZEA 2ROTA 2RQTA 1N5ZA 1S1NA 4Y92A 1BBZA 2G6FX 4J9FA 1OPLA 2BTTA 2RPNA 4DEYA 4J9GA 3VS5A 3VS7A 4FSSA 5HCKA 5FWCA 2V1RA 2QDLA 1PWTA 2DL7A 2A36A 3EG1A 4F16A 2ESWA 2K2MA 1X6GA 3O5ZA 2CH4W 4LE9A 1GCPA 1GFDA 2DILA 2DL3A 1M27C 2RQWA 2SEMA 3TSZA 1NG2A 2OJ2A 3VS0A 1EFNA 1M3CA 2HDAA 2I0NA 2J06A 4Z88A 4JZ3A 1TUCA 2H8HA 1U5SA 2W10A 1W6XA 2KT8A 3TVTA 2ROLA 1UTIA 2AKKA 3EHQA 1YN8A 1Z9QA 1HD3A 2GNCA 2FEIA 1WDXA 1M3AA 1NEGA 4AFZC 1E7OA 2KROA 2DX1A 1W1FA 3ULRB 3CQTA 4R0KA 1H92A 1FMKA 2E5KA 3IQLA 4OMOA 2RN8A 3NMZC 2ED0A 2MOXA 1UHCA 2KGTA 1WYXA 1CKAA 2BZ8A 4JPBW 4F14A 2DE0X 1AWJA 3FJ5A 1T0HA 1Z9ZA 4AG1C 1B07A 1ARKA 2A08A 5GJVB 2JM9A 2DBKA 1VYTA 1H8KA 2KXCA 3M0QA 1VA7A 2AK5A 2L3PA 4ESRA 1XOVA 1YCSB 2DL8A 3UA6A 2DLPA 2BZYA 1E6HA 1UFFA 2ABLA 2EW3A 2FPEA 2IIMA 2FO0A 2KEAA 3REBB 2K7AA 3EG0A 1AWXA 1WIEA 1GCQA 2M0YA 1M8MA 3I5RA 1X43A 1AOJA 2L3QA 5IH2A 2DF6A 1G2BA 2EBPA 2LP5A 2O31A 1LCKA 2GGRA 4WCIA 1U3OA 1K0SA 2DVJA 4LUEA 4OMMA 2NUZA 1K9AA 1PKSA 2LJ3A 2DRMA 3VS3A 1ZUYA 3I35A 4D8DA 2ED1A 1RLQC 1J3TA 3M0SA 4ZNXA 1PRMC 3EHRA 2YUQA 1OPKA 2F2WA 3UA7A 2AZVA 2PNIA 5L23A 2CSQA 1OOTA 2D0NA 1GBRA 1TG0A 2KE9A 2KYBA 4HVWA 1MUZA 1WFWA 2LNHB 1PKTA 1WA7A 2CT3A 2PTKA 1OV3A 4K11A 2CT4A 1JQQA 1GFCA 2LJ0A 1M30A 2ENMA 2VKNA 1RUWA 2DYBA 2YUPA 4AFSC 2RMOA 4JJBA 2RQVA 1MV0B 1SPKA 3EGUA 3ZL7C 1ABOA 1AWWA 2MIOA 1GBQA 2EYWA 1U06A 1JO8A 3QWXX 2DA9A 1I0CA 1PHTA 1JEGA 1GL5A 2KRSA 3TSWA 2O88A 2CUBA 4GLMA 1MV3A 1X2KA 2D8HA 2KNBB 2M51A 4KRTA 2J7IA 1CSKA 1BU1A 1UUEA 4HVUA 4CC4B 2V1QA 2EGCA 4CC3A 4A63B 2PZ1A 2D8JA 2JS0A 3I5SA 4OMQA 1QWEA 4OMNA 2K6DA 2CDTA 2K79A 3M0RA 4RTYA 3SHWA 2O9VA 1OEBA 1QWFA 1HSQA 1Y57A 2F2VA 4AG2C 2JS2A 2GBQA 2DBMA 1YWOA 2JMAA 2OI3A 1ZLMA 1UGVA 3H0FA 2CSIA 2KR3A 2JM8A 2C0IA 1SHGA 2RQRA 2YDLA 2K9GA 2RF0A 1JU5C 5I11A 2EYXA 5IXBA 2O2OA 3PVLA 1X27A 3LH5A 1PRLC 4J9DA 2CREA 3UATA 1YNZA 1PNJA 1AWOA 1AEYA 1RI9A 2DL5A 3QWYA 2VWFA 2B86A 1I1JA 1RLPC 2BZXA 3PE0A 2DMOA 2LZ6B 3VS6A 1NEBA 1NYGA 1WXUA 3RNJA 1WXBA 2DRKA 1FYNA 2JXBA 1SRMA 4ORZA 1GRIA 4RTUA 4RTTA 2L2PA 5IXFA 2D1XA 2GQIA 2HBWA 4JJDA 1UJYA 1ABQA 2C0TA 3VS2A 1ZX6A 1KFZA 2JW4A 2JTEA 4HVVA 4RTWA 4JZ4A 1VYVA 1ZBJA 1UECA 1QKWA 1W70A 4Z8AA 1WI7A 1B3QA 4J9BA 1T0JA 1Y0MA 2EKHA 1WX6A 4OMLA 2L0AA 3A98A 2AZSA 2OAWA 1BK2A 2HEQA 3NHNA 1NYFA 4LNPA 2HCKA 4EIKA 1QCFA 4CC2A 2EPDA 1QLYA 2J6OA 4JJCA 1BB9A 1AZGB 3C0CA 1X2QA 4LUDA 2EYYA 1G83A 3THKA 2EQIA 2C0OA 4J9IA 4QT7A 1UHFA 2X3XD 1E6GA 3VRZA 1H3HA 2LQWA 2FG0A 3NPFA 4J9EA 2X3WD 2DM1A 3GBQA 4F17A 5IHNA 1K4US 4RTXA 1X69A 4J9HA 2EGAA 1SHFA 1VYUA 4CC7A 4RTZA 5I22A 5FWBA 2ECZA 3H41A 2KT1A 2LX7A 1M3BA 5IHIA 2AKLA 2CUDA 1CKBA 1WXTA 4E6RA 2FRYA 2KYMA 1WLPB 2A28A 2GTOA 2DL4A 1YP5A 2FRWA 2EYZA 4AFUC
chains in the Genus database with same CATH superfamily
2O9SA 5CAIA 5KE3A 3OS1A 1MMGA 2DNUA 4J9CA 1VQLT 1K1ZA 1M2VA 1NPPA 1T3LA 2RHZA 1NE8A 5GAMe 1UJ0A 1NLOC 3RMSA 1D0YA 4C8QB 3C95A 1MMAA 1K8AC 4AMCA 4FM4B 2KSSA 1T3SA 2CP7A 3CCQQ 2DXBA 1I5OB 3VS4A 2RM4A 1HXDA 4UC4A 2HL3A 4C5EA 3OMCA 1QKXA 2G3RA 4Q5WA 2DZ9A 1X75C 5J3BA 4M7AC 4J7FA 2RNAA 1BI0A 2XIDA 1ZUUA 4IIMA 3OS5A 1VIEA 2A37A 2HAXA 1JB0E 1UGPB 5CKFA 3HRTA 2GTJA 4IIOA 1SSHA 4MZPA 1IB8A 2KXDA 3VYGA 1N8RU 3OSVA 1NPRA 1K0XA 1IO6A 3TQ7P 4AFQC 1UEBA 4M7AG 4R55A 3VS1A 3CCRA 2CZ7B 3H0IA 2CYZB 2VUBA 3CCMQ 4M77C 5ECAA 4DA4A 4M7AD 2H3EB 1NJIU 1JXOA 4XQ3A 4HXJA 2E3HA 1K76A 1H641 3CC2A 2LT4A 2CH4A 1VQMA 3CCRT 4PL6A 4IUPA 1I8FA 4LDYA 2KBTA 4FIBA 2VVKA 1UG1A 1UGRB 3V7RA 3MPUB 4KUIA 4M78E 4DBFA 2GFAA 1C1AA 4R56A 3CCEA 4PJOB 2HSPA 1AZEA 4KGXB 1K8AU 1O9SA 3JCMg 1S1NA 2O4XA 4M75D 1BBZA 2G6FX 2ZPEB 4M78A 1OPLA 2A0FB 4PJNA 4J9GA 1WGSA 5HCKA 3JB9D 2XHCA 4BI8B 3X20B 1PWTA 3EGXB 2COZA 3EG1A 4KH0B 4F16A 3CMEQ 3O5ZA 1I4K1 2I2LA 3GPLA 1GCPA 2DILA 4LDVA 2DL3A 1M27C 3S3NA 1NG2A 3QXEB 4JUVA 3VS0A 4X9DA 2MK5A 3EH2A 2WSEE 2I0NA 4JZ3A 2E41A 3L2VA 3G4SA 3OQ5A 2C06A 2JZ2A 4DBQA 3A8HB 3KBGA 3EHQA 4J83A 2HKNA 1XJWB 1Z9QA 2FEIA 4AFZC 2KROA 2DX1A 4L5GA 2E5KA 3IQLA 4ZN1A 2DIQA 2M0OA 1D0XA 1CKAA 2OTJA 2K5FA 1K73R 1AWJA 3CCEQ 2RHXA 3LWIA 1T0HA 2EQUA 2DERA 2A08A 1NJIR 2RHIA 2KXCA 3M0QA 2L3PA 1XOVA 4HA8A 4F04B 2DLPA 2BZYA 2FPEA 4FSXA 4DOVA 4LXCA 3EG0A 5LJ3f 1WIEA 4OMFB 1GCQA 1M8MA 3I5RA 2KY9A 1M2VB 4M7AE 2X4YA 2LP5A 2GGRA 1U3OA 4MZTA 3CD6Q 1M90C 5IAYA 1D09B 4A4HA 1W4SA 5HY6A 2LCLA 1J3TA 3M0SA 4ZNXA 3JCMb 3QDRB 4E7KA 3G7ZA 2Y4YA 2F2WA 3UA7A 2CSQA 4M75E 1ZSZA 1YITA 5GMKi 2KE9A 4YTLA 1S72A 1WFWA 3OYKA 1QVGS 3JAME 3MEVA 5DLOA 5GAN2 4HKEA 3JCMJ 3GP8A 3OA6A 4JJBA 1YITQ 4QVZA 1MV0B 3ZL7C 2RI3A 1Q86R 3RKWA 4NS5A 3GIBA 2MIOA 4VUBA 3NTHA 5AYFA 2EYWA 3OS0A 2QASA 4MZMA 2KRSA 4OB1B 2JJ9A 3X25B 3OYJA 2CUBA 1VQ6Q 5CCAA 1X2KA 2M51A 5GMKe 1UUEA 4CC4B 4OVAA 1D3BA 2LVMA 3CCVQ 2BKDN 4A63B 4RCBA 1ACMB 2PZ1A 1QMCA 2JS0A 3I5SA 2RJCA 3RESA 3CC2Q 1FX7A 3SWNA 2QQSA 2XDBA 1VQMQ 3SHWA 3P8HA 1U8RA 8ATCB 2YRVA 1YWOA 2JMAA 1LOJA 1M90U 1UGVA 3M5AA 2O4XB 3OYGA 2PUKB 3J81E 4C0DB 5GAMh 4FT2A 2WACA 3FC3A 2KR3A 2JM8A 1BIBA 2VGNA 3QJ6A 3DLLA 1Q7YR 1ZSZB 4PJLA 1NJIC 1JU5C 4KUDK 2DAQA 4PFZA 3E2UA 3MP1A 3PMIA 2O2OA 1DJ7B 1X27A 3I56T 1PRLC 4EMKA 2CREA 2LT1A 1YJNQ 4FW1A 1WQ7A 3RIRA 4M77G 1RI9A 3QWYA 3OBYA 4C8QC 2B86A 2BZXA 1LVKA 2WSFE 1YHQT 4IKFA 2XDPA 3M9QA 1WXUA 3RNJA 2MWOA 2JXBA 4B9WA 5A2QE 2NUPA 1QCOA 3F70A 1YJ9Q 4RTTA 5IXFA 2D1XA 2HBWA 2GQIA 2IPOB 1MHNA 3ASKA 1OX9A 1ZX6A 3EFRA 3JCMX 4F7UG 4J6YA 3CBOA 4HVVA 3FIFA 4JZ4A 1VYVA 4RKUE 1ZBJA 4JDSA 3L2UA 1B3QA 1YJ9A 1K9MC 4C92D 4OMLA 2OTJQ 2PU9B 2MYSA 3OB9A 4LNPA 3GLXA 1VQ8Q 3N5BB 3GF5A 4JJCA 1YJ9T 1RABB 3C0CA 1W2BP 2JTFA 2EQIA 3CMAT 4QT7A 2KVQG 1UHFA 1YJWA 2COYA 2X3XD 4HCBA 3NPFA 4DBRA 1G3WA 3GBQA 4EMKB 4F17A 4XTYA 5GAOl 3PIOA 2E6ZA 1KQ1A 2EJGA 3CBMA 5FWBA 1YJWQ 2XU8A 1TOVA 2FZKB 3G71T 1WXTA 1AHJB 3L1AA 2O01E 3E9FA 2DD5A 1Y96A 2KYMA 4F7UF 1VQ4A 2QEXQ 3NTKA 3JCMc 3CMET 2VASA 2D9TA 2MPXC 3OY9A 4X1VA 4HT8A 5GAN8 1MNEA 2KRNA 3EG2A 5GJWB 1A0NB 3RMQA 3ZEHA 1AVZC 2YT6A 2Y4XA 3H0HA 4XTZA 1RAEB 3CC4A 4CRIA 3O8VA 1ZSZC 3CPWS 2KI7A 3I55A 3NTIA 1VQ6T 2KQWA 1F1BB 1YIJT 3KFVA 5DLQE 2FB7A 2E10A 2FZCB 4N0AA 1YBYA 2X51A 5M9OA 5D6WA 1WQWA 2YUNA 2YUOA 3CXCA 2KDSA 2P4TA 1HYOA 2LX9A 2YSQA 2OTLA 1G3SA 1V1CA 4BUGA 1OZ3A 3M56A 2KRMA 3PVQA 2K57A 1UDLA 2DJQA 3R6NA 2YRCA 1X6BA 3CCLQ 2NWMA 2JUFA 3VRYA 5FRMA 2VXEA 1MMDA 3HL8A 1AD5A 1IGQA 4A4KA 1WZOA 1TTHB 5DY9A 5GAMg 1YWPA 1M2OA 2DD4A 1S72Q 2SRCA 4BE2A 2DYIA 1PCXA 4X34A 2PUOB 4FYWB 1UGQB 2CZ0B 4J6XA 1NBEB 1ZSGA 3OS2A 2DPPB 4C8QE 1RAGB 2L3SA 5FU7C 2QGFB 5KYXB 3EG3A 4D8KA 4J7IA 5C0MA 2CKKA 1R8OB 2FPFA 2K4YA 4Z89A 4A54A 4RCCA 5FW9A 3UWNA 1N5ZA 4J9FA 4A4GA 2RPNA 5FLXE 4DEYA 4FSSA 4BY6B 2HD0A 3TEEA 1FMWA 4FCYA 3QJYA 3R6OA 2A36A 4OB2B 2CH4W 2LQKA 2PVOB 4M75C 4ZGJB 1VQPA 2RHUA 2FZGB 1EFNA 4C92F 1M3CA 3JCMV 4A4EA 2HDAA 3V7SA 2RJEA 1U5SA 2PQWA 1BKBA 3TVTA 1U1TA 3ZBDA 3LYIA 4C92E 2GNCA 4E7JA 1KHCA 5LJ5d 1VQ9Q 3ULRB 1Q86U 4KGVB 3CQTA 4R0KA 1FMKA 2QXFA 5FROA 3QG1A 2MOXA 4OF1A 3TREA 1C0MA 2BZ8A 4JPBW 3CMAQ 4DOWA 4M7DE 3FJ5A 3LGLA 3MO8A 2XD0A 3UA6A 1MNDA 1K73U 4JLGA 1OX8A 5LJ3e 2EW3A 2FO0A 1BI1A 3REBB 2AHJB 5J26A 1AWXA 2Z0WA 5I21A 2QA4A 3EGDA 2HL5C 2DF6A 1G2BA 3MP6A 5KH6A 5KCHA 1K0SA 3LLRA 3JSCA 2CP3A 2NUZA 3P8DA 2RO0A 2LJ3A 2DO3A 4WF2A 5KYUB 1TS9A 1Q7YU 2E12A 3CXCP 4XTWA 1TXQA 5D6XA 2HMAA 4C5IA 1YHQQ 3HFOA 1VQ9A 3CCET 3CCLT 2AZVA 2HZYA 2PNIA 5GAOm 1Q82U 1OOTA 4FT4A 4OGCA 2AT1B 2ZPIB 4KT0E 1D1AA 3FJPA 1GBRA 1RADB 2E65A 5CVIA 2KYBA 4ZTFA 2D0QB 2GFUA 2A7YA 1D1BA 2ATCB 3ME9A 5LJ5f 1OV3A 4K11A 3GOXA 1JQQA 2E1HA 2RK1A 4HCZA 5D6YA 1BCMA 1VQNQ 2LJ0A 1M30A 1B34A 2ENMA 2QG9B 2DYBA 4AFSC 2OTJT 4RG8A 1QVFP 4E2FB 4M7DF 3FB9A 1GXIE 3ER0A 3CCVA 5LJ5j 2DKGA 3QYGB 1RACB 1JEGA 1JO8A 2DA9A 3EFOB 1PHTA 4RMOA 4BD3A 3PIPA 3JCMh 1WHJA 4QQDA 4M78C 1WHHA 1SG5A 2KNBB 4F7UA 4KRTA 1NZ9A 1CSKA 1BU1A 4HVUA 1RAFB 1JJ2P 3CXCS 4JRIA 2D8JA 2QQBA 4OMNA 2X35A 4AT1B 2QTXA 4IURA 4PJOD 2O9VA 3D7SB 5LJ3g 1OEBA 1Y57A 2F2VA 4AG2C 2QDYB 2MAMA 2JS2A 5CKDA 5CQYA 1ZLMA 3M54A 4M7DB 5FU7B 4FW2A 3PGGA 3G71Q 3OYMA 3L2ZA 1D1CA 5CIUA 2C0IA 5CR2A 2YDLA 2RF0A 1YITT 1VQKT 1S72T 3JCMW 4J9DA 1Q82C 3UATA 1YNZA 1M9SA 3J80E 2X9HA 1AWOA 2DL5A 1FXXA 5C6SA 1R0BG 3X24B 4ZGEB 4B9XA 4IUVA 1AT1B 4QQ6A 3VYHB 5KYYB 3CPFA 1IREB 3DB3A 3A5ZB 2LRQA 4RTUA 2VXFA 1WPYA 2L2PA 3EH1A 4JJDA 1N6AA 2JOYA 5D7UA 2XDDA 1ABQA 3VS2A 2ZCFB 4FU6A 3CCJA 1VQ8T 4M7AA 5CQXA 3INZA 1VQNA 1W2BS 1KK7A 4ELYC 4Z8AA 1G3TA 2DZCA 1K9MR 2EKHA 1WX6A 3HKSA 2AZSA 3E19A 1BK2A 3FEOA 3JRZA 2JN0A 3NHNA 1VQNT 4EIKA 2EQJA 3OYFA 1QCFA 3FDRA 2DXCA 5GAMd 1QLYA 3RKYA 1AZGB 1X2QA 4LUDA 2F5KA 1G83A 2E5QA 5KYNA 3OW2S 5A0DA 4PFPA 3OYHA 3VRZA 2LQWA 3CCMA 2DM1A 2LC4A 1LJOA 1U1SA 4RTXA 2L5QA 2EGAA 1P92A 4C0DC 5I22A 1EX4A 3LX7A 3URGA 4JRPA 2KT1A 1IHWA 5GANe 2AKLA 4PFOA 1YHQA 1RAAB 1MMNA 1M90R 1HK9A 1RL2A 4OB0B 4ATOA 4F7UE 3TU4K 3SWNB 1YIJQ 3QUIA 2LNVA 3SDZA 3M4YA 4M75G 3CD6A 1LNXA 3M53A 1EZZB 3M0TA 3JCMQ 4FYYB 1Q7YC 3HTRA 4E7HA 2DEQA 1SEMA 2DTOA 3PT9A 1KG1A 3M0PA 4PK4A 3QIIA 1KC8U 2QGGA 3Q1JA 3CCUA 1G8XA 5EC7A 2MCNA 2GQVA 2P0QA 3WXMB 3SD4A 1Q82R 1KD1C 4FYVB 5LJ5g 4JS4A 4F7UB 2QEXT 2R5AA 1PD1A 4QKUA 1Y96B 3RDVA 4OMPA 1ZUKA 1JRIA 1KJWA 5IT9E 5I2MA 3CCUT 3G1JA 2JMCA 2NUTB 3SEMA 2EJ9A 3U23A 2LJ1A 1GCQC 1YJWT 2LCSA 4L59A 2EVRA 5GAN5 1WHMA 4BI4A 4BE0A 1UGSB 1BCOA 3VJPA 4A4FA 2K3YA 4C92B 2R58A 5L8RE 3MP8A 2YXYA 2BUDA 4M75A 1X6OA 1QQJA 2F1LA 1KIKA 3UPUA 5GANj 4XU3A 3G71A 1NLPC 3A8GB 3CMAA 4GBQA 1JJ2A 2YLBA 3HHTB 3L2RA 2K3BA 5IHKA 1OULA 2FPDA 1TUDA 3CCQA 2XI9A 3EG9A 1SKUB 5KYUA 1JXMA 4Z02A 1PSEA 4X9CA 1M1FA 3CCRQ 2CP5A 3M4GA 2DTIA 3BY7A 3A8MB 3CCQT 3CC7Q 2DIGA 2OAUA 2DETA 2JT4A 4OB3B 2F2XA 5GAN4 1M5Q1 1QP3A 3CMEA 2ROTA 4Y28E 1PC0A 5A0LA 1W2BA 2BTTA 2M9UA 3VS5A 5FWCA 2QDLA 3J7AF 2DL7A 3EFSA 3OYIA 1ZA1B 3LWHA 2X4XA 3OYYA 3G6EA 2RI5A 2K2MA 1X6GA 2SEMA 3TSZA 2OJ2A 5KYXA 1KC8R 2HQHA 3LW5E 2J06A 3RR6A 3OMGA 2H8HA 2W10A 1W6XA 2AKKA 1HD3A 1WDXA 1QVFA 2YLCA 1NEGA 4XAXB 4MDXA 5LJ3j 3WVEB 1Y07A 1N8RC 3QKJA 3VU3C 2EWNA 2EQKA 3WVDB 3NMZC 4EMKC 2ED0A 1UHCA 3EG9B 3JB9H 2DE0X 3JB9J 5FU6C 3OYCA 1O75A 1Z9ZA 4C8QA 1B07A 1ARKA 2JM9A 2DBKA 1VYTA 1H8KA 2AK5A 2ZZDA 1TUGB 2DL8A 3BW1A 1E6HA 1UFFA 1I81A 5GANg 1XNIA 2M0YA 1KQ2A 1X43A 3MCAB 3VUZA 2L3QA 3M55A 5IH2A 1IXDA 1LCKA 4LDXA 4WCIA 4LD9K 2MF2A 2CP6A 4ELZC 2QQRA 4LUEA 3LGFA 4EMGA 4OMMA 4C8QD 1XQHA 1ZA2B 1K9AA 4QVDA 5EG2A 2DRMA 4M77D 3DLMA 2AIRB 3UDCA 3VS3A 3HPWA 2QTVA 3I35A 3CPWA 3FLGA 4D8DA 3CBPA 1RLQC 3RKXA 2XKOC 5GAOn 2VYTA 4M77B 2NUTA 2YUQA 1OPKA 4C0GA 1IGUA 4KH1B 4Y91A 3QZ9B 1IZ6A 3L2WA 5LJ5e 2D0NA 1TU0B 3MEWA 2FHDA 1YJNT 4HVWA 2LNHB 1PKTA 2RH2A 1N9SA 3TCJA 2M16A 2PTKA 5KE2A 2QQAA 2RK2A 1SSFA 3PTAA 2VKNA 1VQ7A 2YUPA 2RMOA 4HCCA 2LDMA 2RQVA 1SPKA 3EGUA 4C5GA 1Y7XA 1BI3A 3KXTA 4PKCC 3CC4Q 1GBQA 4KULA 3V8JA 1U06A 3QWXX 1GL5A 3TSWA 3MHXA 2O88A 1K9MU 4GLMA 4A53A 2VGMA 1VQMT 7AT1B 2J7IA 2RJDA 1C6VX 1BIAA 1YIJA 2V1QA 2EGCA 2LQ8A 2M02A 3JCMe 2X4WA 2B8AA 1QWEA 2EIFA 1PM3A 2K79A 3MEUA 4RTYA 3L42A 1QWFA 3GNFB 2EFIA 4PJMA 3DB4A 2GBQA 8AT1B 2DBMA 5GANf 2OI3A 3QZ5B 1UB4A 3JCMP 3SFMA 4GY5A 2E3IA 2L89A 2VB6A 4BI3A 1QVGP 4E7IA 2K3XA 1VQOA 2JNGA 1RAIB 3FRNA 4PJOC 5GAMj 1ZHIA 4M78F 2RQRA 5DM7R 5GAN7 5I11A 2EYXA 2GF7A 4OGEA 3GNGA 2BIVA 2YRDA 1VQOT 3LH5A 4C5HA 1Q95G 2GCXA 1YCYA 1OI1A 4V2SA 1AEYA 2E4HA 1RAHB 1RLPC 1WJQA 2QQ9A 3PE0A 2DMOA 4II1A 3CCVT 1NYGA 2DRKA 1FYNA 1YI2Q 3S6WA 1PG5B 1SRMA 3C12A 1X01A 4ORZA 2EKOA 5CKEA 2QA4Q 1N9RA 1VIFA 1UJYA 1VQ5Q 1JBMA 2DFUA 1ZBXA 2RI2A 2MWPA 2P0KA 2JTEA 2PVDB 4RTWA 1VQLA 5CKBA 1QKWA 5AT1B 1WHGA 2DTHA 5GANh 3HFNA 4M7DC 4LD6A 2FYKA 6AT1B 3VV0A 2L0AA 3A98A 2OAWA 1RI0A 1XTDA 4CI0C 2EYQA 4BY6C 2HCKA 2YWWA 2RHYA 4XU1A 4CC2A 2EPDA 2J6OA 1QP2A 1BB9A 4LDUA 5KYYA 4LDWA 2EYYA 5GAOp 2L3RA 2VC8A 3THKA 2XICA 1KQSP 4J9IA 1VQPT 3CPWP 2RD1A 4M7AB 2V8IA 4EDUA 2JTMA 2BE7D 2FG0A 4PJOA 5HK3A 4M78G 5IHNA 3KUFA 1X69A 3BDLA 4J9HA 1SHFA 1QW1A 4RTZA 3EFOA 3H41A 2XK0A 2E70A 4C92C 4M7DG 3OW2P 1G3YA 3JCMd 2CUDA 2A3LA 3JCMf 1CKBA 2ZGWA 5GAN6 4E7LA 4N0AC 2ZPHB 1WHKA 2ZPFB 4HT9A 1OU9A 5LJ3d 2A28A 3OSSC 4M7AF 2KAFA 2DL4A 1M1KC 1B7TA 4TVRA 1TWBA 2R5MA 3QYHB 4AFUC 2EGEA 4QQGA 4DBHA 5GMKh 4C0FA 3CCJT 2M1HA 1VQ8A 2DXTA 2R57A 3CC2T 1I07A 5I2SA 4B6MA 2KMTA 5IN1A 2OX7A 1OQKA 1SRLA 4P5NA 9ATCB 2LQNA 4BE1A 1K8AR 4RTVA 2IG0A 5GAMf 1KQSA 2QAZA 2F69A 4PJOF 4E7SA 4JS5A 3RBBB 1YFNA 1PD0A 1KSWA 3UF4A 1VQ5A 2CZ6B 4BDZA 3RUXA 1NM7A 3EGDB 3T9NA 3JB9I 2K5LA 2J05A 3X28B 3CEYA 1V76A 2W0ZA 4ZN3A 3META 3M58A 3CCLA 2HSEB 1VQ5T 3CCMT 2LMJA 4NL3A 3S3MA 4LN2A 3V8LA 1R77A 3JV3A 5GAN3 4L6V5 2DEUA 3MEAA 2ZPBB 2FL7A 4EMHA 2OTLQ 4C8QF 3G4ST 4J6WA 1UE9A 3REAB 4PJOE 2PVGB 2XMFA 3I56A 4ME7A 4RUGA 2H3JA 2NUPB 3PMTA 4DEXA 3I9QA 5KYWB 1D0ZA 1BYMA 4E7ZA 3CD6T 4HCKA 1K73C 1HJDA 3EGXA 3C4SA 2J6FA 1OYXA 5LJ5h 3OYLA 4MMKA 4C92A 1VQ7Q 2EQMA 3MKDA 1WHLA 3M0UA 1Y71A 3NGPA 1N27A 2RQUA 3M57A 4BACA 4WTOB 2P4RA 2QYZA 2QEXA 2RB6A 4OP0A 4M4ZA 2J6KA 2K2VA 1FMVA 2EJFA 1Q81R 2RQTA 3EAEA 4Y92A 3S3OA 3QPHA 4D6WA 3VUBA 1VQLQ 3VS7A 3RERA 2COWA 2V1RA 3UT1A 5FU6B 3QBYA 2XG8D 2MI6A 3H8ZA 1M1KR 3I56Q 2ESWA 3HRUA 1ZQ1A 1VQKA 1I5LA 4LE9A 3L2QA 1GFDA 2RQWA 2MMPA 3CCSQ 3ZFJA 4XTXA 5GMKj 4XU0A 4M7DA 1B34B 4IUQA 4Z88A 2VV5A 4ZTJA 1TUCA 3VKIA 1JJ2S 3AT1B 4PJJA 2KT8A 2ROLA 1UTIA 5A0GA 2ZAEA 1YN8A 3OW2A 1M3AA 1QCNA 1MGQA 1E7OA 4FL6A 1KD1R 4C92G 1W1FA 1N8RR 1H92A 5KYWA 4OMOA 2RN8A 4BB7A 1OZ2A 4PJOG 2KGTA 1WYXA 2F5TX 2X4JA 3HSBA 4F14A 3H9NA 4XU2A 2QI2A 4C8QG 4AG1C 4PNOA 5GJVB 1VA7A 4ESRA 2EAYA 4ANJA 1YCSB 2ABLA 1PSFA 4RG2A 2IIMA 1QVFS 2KEAA 2K7AA 2V8KA 3OBWA 2LCCA 1AOJA 4NOYA 2EBPA 2O31A 3CC4T 4JJNK 2DVJA 3QSUA 1PKSA 2CP0A 2DJZA 4PLLA 1QVGA 1M8VA 1FWZA 1ZUYA 2HQXA 3JB9F 5GMKm 3X26B 1KQSS 2ED1A 3I55Q 1KC8C 1PRMC 4M78D 3EHRA 1M1KU 2OTLT 3BFMA 5L23A 1EIFA 4QW2A 2BE9B 4NL2A 1TG0A 4GLKA 2JVVA 3G6EQ 1MUZA 1WA7A 2YHTA 4N4IA 2CT3A 1OU8A 1Q81U 2V8JA 4IUTA 1D3BB 1H3ZA 1BI2A 2CT4A 5CK9A 1GFCA 1QVPA 3OYNA 1R0CB 4O5VA 1RUWA 3A8OB 2P0PA 2HBPA 3HP9A 1ABOA 1AWWA 4PLIA 1Q86C 3CCUQ 5LJ3h 2LTOA 2KK4A 1I0CA 3A1PA 3E9GA 2HKQB 1VOMA 3SB2A 5GAOr 3M59A 3OYAA 4N4GA 1MV3A 2D8HA 1VQ4Q 3MJXA 4MDWA 4EPCA 4CC3A 1LPLA 4J5YA 4OMQA 2K6DA 2CDTA 2RJFA 1TH7A 3M0RA 3CCJQ 3HRSA 4C0ZA 1HSQA 5KCOA 2RA2A 2CP2A 4J8OA 4O6JA 5J39A 2WSCE 2IVWA 3SWNC 3JB9G 2HNIA 3H0FA 2CSIA 3C94A 3P8BB 1M1GA 1TSFA 2E64A 3V7CA 1SHGA 2K9GA 2DK3A 4FYXB 1IRXA 4MMLA 3CCST 5HK0A 1WNLA 5IXBA 3PVLA 5GANd 5FRNA 2CZ1B 4E47A 1PNJA 2HQEA 2E6NA 4JLIA 2VWFA 4M75B 3OYDA 1VQPQ 1Q81C 3A8LB 3CCSA 1I1JA 3DKMA 3BE3A 2LZ6B 3PNWC 1V29B 3VS6A 3CC7A 1NEBA 1WXBA 3I55T 4IUUA 5GAOq 4M78B 1VQ4T 2NLUA 2Y90A 1GRIA 1YJNA 2FVUA 2C0TA 4JRQA 1KFZA 3CC7T 2JW4A 1UECA 1IHVA 1W70A 3NFCA 3BDUA 1VQ7T 4JRKA 1WI7A 3PFSA 2P84A 1YI2A 1KD1U 4J9BA 1T0JA 1Y0MA 3E1SA 4M75F 4XTVA 2HEQA 2DXUA 4M77A 1G5VA 1NYFA 5HKCA 1VQ6A 2QA4T 5GMKl 4ZGDB 1YI2T 1VUBA 3LH0A 2DVEA 1WJRA 3OYEA 2CS7A 4XTUA 4M7DD 3H6ZA 3G6ET 2V26A 3G4SQ 3QDFA 4QVCA 2C0OA 3QO3A 2QK0A 1M4ZA 1E6GA 1H3HA 3V8KA 4J9EA 4BDYA 2X3WD 3OYBA 1KHIA 2D6FA 1VQ9T 1K4US 4M77F 1VYUA 4CC7A 1VQOQ 4XK8E 5CKHA 1SF9A 2NYSA 2ECZA 5CO7A 1WJSA 2L8DA 4N4HA 3QHSA 1VQKQ 2LX7A 4KGZB 1M3BA 2ZPGB 5IHIA 4KBMB 4M77E 4E6RA 2FRYA 3AHUA 4DQ2A 2CGHA 1WLPB 2GTOA 5LL6S 2K5IA 1YP5A 2FRWA 2EYZA
chains in the Genus database with same CATH topology
2O9SA 2EGEA 2DNUA 4J9CA 4X1VA 1I07A 3M0TA 1K1ZA 2KRNA 3EG2A 1T3LA 5GJWB 1A0NB 1SEMA 1SRLA 1AVZC 1UJ0A 1NLOC 3M0PA 2YT6A 3H0HA 2LQNA 4RTVA 2MCNA 5EC7A 1T3SA 3KFVA 3RBBB 3VS4A 1KSWA 4OMPA 3UF4A 1QKXA 1ZUKA 2YUNA 1NM7A 1KJWA 2J05A 2JMCA 3SEMA 3U23A 2YUOA 2LJ1A 1GCQC 2W0ZA 2RNAA 2LCSA 1ZUUA 2EVRA 4IIMA 2YSQA 1V1CA 2A37A 2KRMA 2LMJA 3PVQA 4LN2A 1UDLA 3JV3A 2DJQA 2GTJA 3R6NA 4IIOA 1SSHA 1X6BA 1KIKA 2KXDA 2NWMA 3VRYA 3REAB 1UE9A 2XMFA 1NLPC 1K0XA 4RUGA 1IO6A 4AFQC 4GBQA 1AD5A 3VS1A 3H0IA 4DEXA 2K3BA 5IHKA 1YWPA 2SRCA 2FPDA 1TUDA 3I9QA 5ECAA 1JXOA 4HXJA 4HCKA 1K76A 1HJDA 2CH4A 1ZSGA 2J6FA 1JXMA 2L3SA 3M0UA 2KBTA 3EG3A 3NGPA 2RQUA 2VVKA 4D8KA 1UG1A 2JT4A 2FPFA 2F2XA 2P4RA 4Z89A 4M4ZA 2J6KA 2HSPA 5FW9A 1AZEA 2ROTA 2RQTA 1N5ZA 1S1NA 4Y92A 1BBZA 2G6FX 4J9FA 1OPLA 2BTTA 2RPNA 4DEYA 4J9GA 3VS5A 3VS7A 4FSSA 5HCKA 5FWCA 2V1RA 2QDLA 1PWTA 2DL7A 2A36A 3EG1A 4F16A 2ESWA 2K2MA 1X6GA 3O5ZA 2CH4W 4LE9A 1GCPA 1GFDA 2DILA 2DL3A 1M27C 2RQWA 2SEMA 3TSZA 1NG2A 2OJ2A 3VS0A 1EFNA 1M3CA 2HDAA 2I0NA 2J06A 4Z88A 4JZ3A 1TUCA 2H8HA 1U5SA 2W10A 1W6XA 2KT8A 3TVTA 2ROLA 1UTIA 2AKKA 3EHQA 1YN8A 1Z9QA 1HD3A 2GNCA 2FEIA 1WDXA 1M3AA 1NEGA 4AFZC 1E7OA 2KROA 2DX1A 1W1FA 3ULRB 3CQTA 4R0KA 1H92A 1FMKA 2E5KA 3IQLA 4OMOA 2RN8A 3NMZC 2ED0A 2MOXA 1UHCA 2KGTA 1WYXA 1CKAA 2BZ8A 4JPBW 4F14A 2DE0X 1AWJA 3FJ5A 1T0HA 1Z9ZA 4AG1C 1B07A 1ARKA 2A08A 5GJVB 2JM9A 2DBKA 1VYTA 1H8KA 2KXCA 3M0QA 1VA7A 2AK5A 2L3PA 4ESRA 1XOVA 1YCSB 2DL8A 3UA6A 2DLPA 2BZYA 1E6HA 1UFFA 2ABLA 2EW3A 2FPEA 2IIMA 2FO0A 2KEAA 3REBB 2K7AA 3EG0A 1AWXA 1WIEA 1GCQA 2M0YA 1M8MA 3I5RA 1X43A 1AOJA 2L3QA 5IH2A 2DF6A 1G2BA 2EBPA 2LP5A 2O31A 1LCKA 2GGRA 4WCIA 1U3OA 1K0SA 2DVJA 4LUEA 4OMMA 2NUZA 1K9AA 1PKSA 2LJ3A 2DRMA 3VS3A 1ZUYA 3I35A 4D8DA 2ED1A 1RLQC 1J3TA 3M0SA 4ZNXA 1PRMC 3EHRA 2YUQA 1OPKA 2F2WA 3UA7A 2AZVA 2PNIA 5L23A 2CSQA 1OOTA 2D0NA 1GBRA 1TG0A 2KE9A 2KYBA 4HVWA 1MUZA 1WFWA 2LNHB 1PKTA 1WA7A 2CT3A 2PTKA 1OV3A 4K11A 2CT4A 1JQQA 1GFCA 2LJ0A 1M30A 2ENMA 2VKNA 1RUWA 2DYBA 2YUPA 4AFSC 2RMOA 4JJBA 2RQVA 1MV0B 1SPKA 3EGUA 3ZL7C 1ABOA 1AWWA 2MIOA 1GBQA 2EYWA 1U06A 1JO8A 3QWXX 2DA9A 1I0CA 1PHTA 1JEGA 1GL5A 2KRSA 3TSWA 2O88A 2CUBA 4GLMA 1MV3A 1X2KA 2D8HA 2KNBB 2M51A 4KRTA 2J7IA 1CSKA 1BU1A 1UUEA 4HVUA 4CC4B 2V1QA 2EGCA 4CC3A 4A63B 2PZ1A 2D8JA 2JS0A 3I5SA 4OMQA 1QWEA 4OMNA 2K6DA 2CDTA 2K79A 3M0RA 4RTYA 3SHWA 2O9VA 1OEBA 1QWFA 1HSQA 1Y57A 2F2VA 4AG2C 2JS2A 2GBQA 2DBMA 1YWOA 2JMAA 2OI3A 1ZLMA 1UGVA 3H0FA 2CSIA 2KR3A 2JM8A 2C0IA 1SHGA 2RQRA 2YDLA 2K9GA 2RF0A 1JU5C 5I11A 2EYXA 5IXBA 2O2OA 3PVLA 1X27A 3LH5A 1PRLC 4J9DA 2CREA 3UATA 1YNZA 1PNJA 1AWOA 1AEYA 1RI9A 2DL5A 3QWYA 2VWFA 2B86A 1I1JA 1RLPC 2BZXA 3PE0A 2DMOA 2LZ6B 3VS6A 1NEBA 1NYGA 1WXUA 3RNJA 1WXBA 2DRKA 1FYNA 2JXBA 1SRMA 4ORZA 1GRIA 4RTUA 4RTTA 2L2PA 5IXFA 2D1XA 2GQIA 2HBWA 4JJDA 1UJYA 1ABQA 2C0TA 3VS2A 1ZX6A 1KFZA 2JW4A 2JTEA 4HVVA 4RTWA 4JZ4A 1VYVA 1ZBJA 1UECA 1QKWA 1W70A 4Z8AA 1WI7A 1B3QA 4J9BA 1T0JA 1Y0MA 2EKHA 1WX6A 4OMLA 2L0AA 3A98A 2AZSA 2OAWA 1BK2A 2HEQA 3NHNA 1NYFA 4LNPA 2HCKA 4EIKA 1QCFA 4CC2A 2EPDA 1QLYA 2J6OA 4JJCA 1BB9A 1AZGB 3C0CA 1X2QA 4LUDA 2EYYA 1G83A 3THKA 2EQIA 2C0OA 4J9IA 4QT7A 1UHFA 2X3XD 1E6GA 3VRZA 1H3HA 2LQWA 2FG0A 3NPFA 4J9EA 2X3WD 2DM1A 3GBQA 4F17A 5IHNA 1K4US 4RTXA 1X69A 4J9HA 2EGAA 1SHFA 1VYUA 4CC7A 4RTZA 5I22A 5FWBA 2ECZA 3H41A 2KT1A 2LX7A 1M3BA 5IHIA 2AKLA 2CUDA 1CKBA 1WXTA 4E6RA 2FRYA 2KYMA 1WLPB 2A28A 2GTOA 2DL4A 1YP5A 2FRWA 2EYZA 4AFUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O9S A;  2EGE A;  2DNU A;  4J9C A;  4X1V A;  1I07 A;  3M0T A;  1K1Z A;  2KRN A;  3EG2 A;  1T3L A;  5GJW B;  1A0N B;  1SEM A;  1SRL A;  1AVZ C;  1UJ0 A;  1NLO C;  3M0P A;  2YT6 A;  3H0H A;  2LQN A;  4RTV A;  2MCN A;  5EC7 A;  1T3S A;  3KFV A;  3RBB B;  3VS4 A;  1KSW A;  4OMP A;  3UF4 A;  1QKX A;  1ZUK A;  2YUN A;  1NM7 A;  1KJW A;  2J05 A;  2JMC A;  3SEM A;  3U23 A;  2YUO A;  2LJ1 A;  1GCQ C;  2W0Z A;  2RNA A;  2LCS A;  1ZUU A;  2EVR A;  4IIM A;  2YSQ A;  1V1C A;  2A37 A;  2KRM A;  2LMJ A;  3PVQ A;  4LN2 A;  1UDL A;  3JV3 A;  2DJQ A;  2GTJ A;  3R6N A;  4IIO A;  1SSH A;  1X6B A;  1KIK A;  2KXD A;  2NWM A;  3VRY A;  3REA B;  1UE9 A;  2XMF A;  1NLP C;  1K0X A;  4RUG A;  1IO6 A;  4AFQ C;  4GBQ A;  1AD5 A;  3VS1 A;  3H0I A;  4DEX A;  2K3B A;  5IHK A;  1YWP A;  2SRC A;  2FPD A;  1TUD A;  3I9Q A;  5ECA A;  1JXO A;  4HXJ A;  4HCK A;  1K76 A;  1HJD A;  2CH4 A;  1ZSG A;  2J6F A;  1JXM A;  2L3S A;  3M0U A;  2KBT A;  3EG3 A;  3NGP A;  2RQU A;  2VVK A;  4D8K A;  1UG1 A;  2JT4 A;  2FPF A;  2F2X A;  2P4R A;  4Z89 A;  4M4Z A;  2J6K A;  2HSP A;  5FW9 A;  1AZE A;  2ROT A;  2RQT A;  1N5Z A;  1S1N A;  4Y92 A;  1BBZ A;  2G6F X;  4J9F A;  1OPL A;  2BTT A;  2RPN A;  4DEY A;  4J9G A;  3VS5 A;  3VS7 A;  4FSS A;  5HCK A;  5FWC A;  2V1R A;  2QDL A;  1PWT A;  2DL7 A;  2A36 A;  3EG1 A;  4F16 A;  2ESW A;  2K2M A;  1X6G A;  3O5Z A;  2CH4 W;  4LE9 A;  1GCP A;  1GFD A;  2DIL A;  2DL3 A;  1M27 C;  2RQW A;  2SEM A;  3TSZ A;  1NG2 A;  2OJ2 A;  3VS0 A;  1EFN A;  1M3C A;  2HDA A;  2I0N A;  2J06 A;  4Z88 A;  4JZ3 A;  1TUC A;  2H8H A;  1U5S A;  2W10 A;  1W6X A;  2KT8 A;  3TVT A;  2ROL A;  1UTI A;  2AKK A;  3EHQ A;  1YN8 A;  1Z9Q A;  1HD3 A;  2GNC A;  2FEI A;  1WDX A;  1M3A A;  1NEG A;  4AFZ C;  1E7O A;  2KRO A;  2DX1 A;  1W1F A;  3ULR B;  3CQT A;  4R0K A;  1H92 A;  1FMK A;  2E5K A;  3IQL A;  4OMO A;  2RN8 A;  3NMZ C;  2ED0 A;  2MOX A;  1UHC A;  2KGT A;  1WYX A;  1CKA A;  2BZ8 A;  4JPB W;  4F14 A;  2DE0 X;  1AWJ A;  3FJ5 A;  1T0H A;  1Z9Z A;  4AG1 C;  1B07 A;  1ARK A;  2A08 A;  5GJV B;  2JM9 A;  2DBK A;  1VYT A;  1H8K A;  2KXC A;  3M0Q A;  1VA7 A;  2AK5 A;  2L3P A;  4ESR A;  1XOV A;  1YCS B;  2DL8 A;  3UA6 A;  2DLP A;  2BZY A;  1E6H A;  1UFF A;  2ABL A;  2EW3 A;  2FPE A;  2IIM A;  2FO0 A;  2KEA A;  3REB B;  2K7A A;  3EG0 A;  1AWX A;  1WIE A;  1GCQ A;  2M0Y A;  1M8M A;  3I5R A;  1X43 A;  1AOJ A;  2L3Q A;  5IH2 A;  2DF6 A;  1G2B A;  2EBP A;  2LP5 A;  2O31 A;  1LCK A;  2GGR A;  4WCI A;  1U3O A;  1K0S A;  2DVJ A;  4LUE A;  4OMM A;  2NUZ A;  1K9A A;  1PKS A;  2LJ3 A;  2DRM A;  3VS3 A;  1ZUY A;  3I35 A;  4D8D A;  2ED1 A;  1RLQ C;  1J3T A;  3M0S A;  4ZNX A;  1PRM C;  3EHR A;  2YUQ A;  1OPK A;  2F2W A;  3UA7 A;  2AZV A;  2PNI A;  5L23 A;  2CSQ A;  1OOT A;  2D0N A;  1GBR A;  1TG0 A;  2KE9 A;  2KYB A;  4HVW A;  1MUZ A;  1WFW A;  2LNH B;  1PKT A;  1WA7 A;  2CT3 A;  2PTK A;  1OV3 A;  4K11 A;  2CT4 A;  1JQQ A;  1GFC A;  2LJ0 A;  1M30 A;  2ENM A;  2VKN A;  1RUW A;  2DYB A;  2YUP A;  4AFS C;  2RMO A;  4JJB A;  2RQV A;  1MV0 B;  1SPK A;  3EGU A;  3ZL7 C;  1ABO A;  1AWW A;  2MIO A;  1GBQ A;  2EYW A;  1U06 A;  1JO8 A;  3QWX X;  2DA9 A;  1I0C A;  1PHT A;  1JEG A;  1GL5 A;  2KRS A;  3TSW A;  2O88 A;  2CUB A;  4GLM A;  1MV3 A;  1X2K A;  2D8H A;  2KNB B;  2M51 A;  4KRT A;  2J7I A;  1CSK A;  1BU1 A;  1UUE A;  4HVU A;  4CC4 B;  2V1Q A;  2EGC A;  4CC3 A;  4A63 B;  2PZ1 A;  2D8J A;  2JS0 A;  3I5S A;  4OMQ A;  1QWE A;  4OMN A;  2K6D A;  2CDT A;  2K79 A;  3M0R A;  4RTY A;  3SHW A;  2O9V A;  1OEB A;  1QWF A;  1HSQ A;  1Y57 A;  2F2V A;  4AG2 C;  2JS2 A;  2GBQ A;  2DBM A;  1YWO A;  2JMA A;  2OI3 A;  1ZLM A;  1UGV A;  3H0F A;  2CSI A;  2KR3 A;  2JM8 A;  2C0I A;  1SHG A;  2RQR A;  2YDL A;  2K9G A;  2RF0 A;  1JU5 C;  5I11 A;  2EYX A;  5IXB A;  2O2O A;  3PVL A;  1X27 A;  3LH5 A;  1PRL C;  4J9D A;  2CRE A;  3UAT A;  1YNZ A;  1PNJ A;  1AWO A;  1AEY A;  1RI9 A;  2DL5 A;  3QWY A;  2VWF A;  2B86 A;  1I1J A;  1RLP C;  2BZX A;  3PE0 A;  2DMO A;  2LZ6 B;  3VS6 A;  1NEB A;  1NYG A;  1WXU A;  3RNJ A;  1WXB A;  2DRK A;  1FYN A;  2JXB A;  1SRM A;  4ORZ A;  1GRI A;  4RTU A;  4RTT A;  2L2P A;  5IXF A;  2D1X A;  2GQI A;  2HBW A;  4JJD A;  1UJY A;  1ABQ A;  2C0T A;  3VS2 A;  1ZX6 A;  1KFZ A;  2JW4 A;  2JTE A;  4HVV A;  4RTW A;  4JZ4 A;  1VYV A;  1ZBJ A;  1UEC A;  1QKW A;  1W70 A;  4Z8A A;  1WI7 A;  1B3Q A;  4J9B A;  1T0J A;  1Y0M A;  2EKH A;  1WX6 A;  4OML A;  2L0A A;  3A98 A;  2AZS A;  2OAW A;  1BK2 A;  2HEQ A;  3NHN A;  1NYF A;  4LNP A;  2HCK A;  4EIK A;  1QCF A;  4CC2 A;  2EPD A;  1QLY A;  2J6O A;  4JJC A;  1BB9 A;  1AZG B;  3C0C A;  1X2Q A;  4LUD A;  2EYY A;  1G83 A;  3THK A;  2EQI A;  2C0O A;  4J9I A;  4QT7 A;  1UHF A;  2X3X D;  1E6G A;  3VRZ A;  1H3H A;  2LQW A;  2FG0 A;  3NPF A;  4J9E A;  2X3W D;  2DM1 A;  3GBQ A;  4F17 A;  5IHN A;  1K4U S;  4RTX A;  1X69 A;  4J9H A;  2EGA A;  1SHF A;  1VYU A;  4CC7 A;  4RTZ A;  5I22 A;  5FWB A;  2ECZ A;  3H41 A;  2KT1 A;  2LX7 A;  1M3B A;  5IHI A;  2AKL A;  2CUD A;  1CKB A;  1WXT A;  4E6R A;  2FRY A;  2KYM A;  1WLP B;  2A28 A;  2GTO A;  2DL4 A;  1YP5 A;  2FRW A;  2EYZ A;  4AFU C; 
#chains in the Genus database with same CATH topology
 2O9S A;  5CAI A;  5KE3 A;  3OS1 A;  1MMG A;  2DNU A;  4J9C A;  1VQL T;  1K1Z A;  1M2V A;  1NPP A;  1T3L A;  2RHZ A;  1NE8 A;  5GAM e;  1UJ0 A;  1NLO C;  3RMS A;  1D0Y A;  4C8Q B;  3C95 A;  1MMA A;  1K8A C;  4AMC A;  4FM4 B;  2KSS A;  1T3S A;  2CP7 A;  3CCQ Q;  2DXB A;  1I5O B;  3VS4 A;  2RM4 A;  1HXD A;  4UC4 A;  2HL3 A;  4C5E A;  3OMC A;  1QKX A;  2G3R A;  4Q5W A;  2DZ9 A;  1X75 C;  5J3B A;  4M7A C;  4J7F A;  2RNA A;  1BI0 A;  2XID A;  1ZUU A;  4IIM A;  3OS5 A;  1VIE A;  2A37 A;  2HAX A;  1JB0 E;  1UGP B;  5CKF A;  3HRT A;  2GTJ A;  4IIO A;  1SSH A;  4MZP A;  1IB8 A;  2KXD A;  3VYG A;  1N8R U;  3OSV A;  1NPR A;  1K0X A;  1IO6 A;  3TQ7 P;  4AFQ C;  1UEB A;  4M7A G;  4R55 A;  3VS1 A;  3CCR A;  2CZ7 B;  3H0I A;  2CYZ B;  2VUB A;  3CCM Q;  4M77 C;  5ECA A;  4DA4 A;  4M7A D;  2H3E B;  1NJI U;  1JXO A;  4XQ3 A;  4HXJ A;  2E3H A;  1K76 A;  1H64 1;  3CC2 A;  2LT4 A;  2CH4 A;  1VQM A;  3CCR T;  4PL6 A;  4IUP A;  1I8F A;  4LDY A;  2KBT A;  4FIB A;  2VVK A;  1UG1 A;  1UGR B;  3V7R A;  3MPU B;  4KUI A;  4M78 E;  4DBF A;  2GFA A;  1C1A A;  4R56 A;  3CCE A;  4PJO B;  2HSP A;  1AZE A;  4KGX B;  1K8A U;  1O9S A;  3JCM g;  1S1N A;  2O4X A;  4M75 D;  1BBZ A;  2G6F X;  2ZPE B;  4M78 A;  1OPL A;  2A0F B;  4PJN A;  4J9G A;  1WGS A;  5HCK A;  3JB9 D;  2XHC A;  4BI8 B;  3X20 B;  1PWT A;  3EGX B;  2COZ A;  3EG1 A;  4KH0 B;  4F16 A;  3CME Q;  3O5Z A;  1I4K 1;  2I2L A;  3GPL A;  1GCP A;  2DIL A;  4LDV A;  2DL3 A;  1M27 C;  3S3N A;  1NG2 A;  3QXE B;  4JUV A;  3VS0 A;  4X9D A;  2MK5 A;  3EH2 A;  2WSE E;  2I0N A;  4JZ3 A;  2E41 A;  3L2V A;  3G4S A;  3OQ5 A;  2C06 A;  2JZ2 A;  4DBQ A;  3A8H B;  3KBG A;  3EHQ A;  4J83 A;  2HKN A;  1XJW B;  1Z9Q A;  2FEI A;  4AFZ C;  2KRO A;  2DX1 A;  4L5G A;  2E5K A;  3IQL A;  4ZN1 A;  2DIQ A;  2M0O A;  1D0X A;  1CKA A;  2OTJ A;  2K5F A;  1K73 R;  1AWJ A;  3CCE Q;  2RHX A;  3LWI A;  1T0H A;  2EQU A;  2DER A;  2A08 A;  1NJI R;  2RHI A;  2KXC A;  3M0Q A;  2L3P A;  1XOV A;  4HA8 A;  4F04 B;  2DLP A;  2BZY A;  2FPE A;  4FSX A;  4DOV A;  4LXC A;  3EG0 A;  5LJ3 f;  1WIE A;  4OMF B;  1GCQ A;  1M8M A;  3I5R A;  2KY9 A;  1M2V B;  4M7A E;  2X4Y A;  2LP5 A;  2GGR A;  1U3O A;  4MZT A;  3CD6 Q;  1M90 C;  5IAY A;  1D09 B;  4A4H A;  1W4S A;  5HY6 A;  2LCL A;  1J3T A;  3M0S A;  4ZNX A;  3JCM b;  3QDR B;  4E7K A;  3G7Z A;  2Y4Y A;  2F2W A;  3UA7 A;  2CSQ A;  4M75 E;  1ZSZ A;  1YIT A;  5GMK i;  2KE9 A;  4YTL A;  1S72 A;  1WFW A;  3OYK A;  1QVG S;  3JAM E;  3MEV A;  5DLO A;  5GAN 2;  4HKE A;  3JCM J;  3GP8 A;  3OA6 A;  4JJB A;  1YIT Q;  4QVZ A;  1MV0 B;  3ZL7 C;  2RI3 A;  1Q86 R;  3RKW A;  4NS5 A;  3GIB A;  2MIO A;  4VUB A;  3NTH A;  5AYF A;  2EYW A;  3OS0 A;  2QAS A;  4MZM A;  2KRS A;  4OB1 B;  2JJ9 A;  3X25 B;  3OYJ A;  2CUB A;  1VQ6 Q;  5CCA A;  1X2K A;  2M51 A;  5GMK e;  1UUE A;  4CC4 B;  4OVA A;  1D3B A;  2LVM A;  3CCV Q;  2BKD N;  4A63 B;  4RCB A;  1ACM B;  2PZ1 A;  1QMC A;  2JS0 A;  3I5S A;  2RJC A;  3RES A;  3CC2 Q;  1FX7 A;  3SWN A;  2QQS A;  2XDB A;  1VQM Q;  3SHW A;  3P8H A;  1U8R A;  8ATC B;  2YRV A;  1YWO A;  2JMA A;  1LOJ A;  1M90 U;  1UGV A;  3M5A A;  2O4X B;  3OYG A;  2PUK B;  3J81 E;  4C0D B;  5GAM h;  4FT2 A;  2WAC A;  3FC3 A;  2KR3 A;  2JM8 A;  1BIB A;  2VGN A;  3QJ6 A;  3DLL A;  1Q7Y R;  1ZSZ B;  4PJL A;  1NJI C;  1JU5 C;  4KUD K;  2DAQ A;  4PFZ A;  3E2U A;  3MP1 A;  3PMI A;  2O2O A;  1DJ7 B;  1X27 A;  3I56 T;  1PRL C;  4EMK A;  2CRE A;  2LT1 A;  1YJN Q;  4FW1 A;  1WQ7 A;  3RIR A;  4M77 G;  1RI9 A;  3QWY A;  3OBY A;  4C8Q C;  2B86 A;  2BZX A;  1LVK A;  2WSF E;  1YHQ T;  4IKF A;  2XDP A;  3M9Q A;  1WXU A;  3RNJ A;  2MWO A;  2JXB A;  4B9W A;  5A2Q E;  2NUP A;  1QCO A;  3F70 A;  1YJ9 Q;  4RTT A;  5IXF A;  2D1X A;  2HBW A;  2GQI A;  2IPO B;  1MHN A;  3ASK A;  1OX9 A;  1ZX6 A;  3EFR A;  3JCM X;  4F7U G;  4J6Y A;  3CBO A;  4HVV A;  3FIF A;  4JZ4 A;  1VYV A;  4RKU E;  1ZBJ A;  4JDS A;  3L2U A;  1B3Q A;  1YJ9 A;  1K9M C;  4C92 D;  4OML A;  2OTJ Q;  2PU9 B;  2MYS A;  3OB9 A;  4LNP A;  3GLX A;  1VQ8 Q;  3N5B B;  3GF5 A;  4JJC A;  1YJ9 T;  1RAB B;  3C0C A;  1W2B P;  2JTF A;  2EQI A;  3CMA T;  4QT7 A;  2KVQ G;  1UHF A;  1YJW A;  2COY A;  2X3X D;  4HCB A;  3NPF A;  4DBR A;  1G3W A;  3GBQ A;  4EMK B;  4F17 A;  4XTY A;  5GAO l;  3PIO A;  2E6Z A;  1KQ1 A;  2EJG A;  3CBM A;  5FWB A;  1YJW Q;  2XU8 A;  1TOV A;  2FZK B;  3G71 T;  1WXT A;  1AHJ B;  3L1A A;  2O01 E;  3E9F A;  2DD5 A;  1Y96 A;  2KYM A;  4F7U F;  1VQ4 A;  2QEX Q;  3NTK A;  3JCM c;  3CME T;  2VAS A;  2D9T A;  2MPX C;  3OY9 A;  4X1V A;  4HT8 A;  5GAN 8;  1MNE A;  2KRN A;  3EG2 A;  5GJW B;  1A0N B;  3RMQ A;  3ZEH A;  1AVZ C;  2YT6 A;  2Y4X A;  3H0H A;  4XTZ A;  1RAE B;  3CC4 A;  4CRI A;  3O8V A;  1ZSZ C;  3CPW S;  2KI7 A;  3I55 A;  3NTI A;  1VQ6 T;  2KQW A;  1F1B B;  1YIJ T;  3KFV A;  5DLQ E;  2FB7 A;  2E10 A;  2FZC B;  4N0A A;  1YBY A;  2X51 A;  5M9O A;  5D6W A;  1WQW A;  2YUN A;  2YUO A;  3CXC A;  2KDS A;  2P4T A;  1HYO A;  2LX9 A;  2YSQ A;  2OTL A;  1G3S A;  1V1C A;  4BUG A;  1OZ3 A;  3M56 A;  2KRM A;  3PVQ A;  2K57 A;  1UDL A;  2DJQ A;  3R6N A;  2YRC A;  1X6B A;  3CCL Q;  2NWM A;  2JUF A;  3VRY A;  5FRM A;  2VXE A;  1MMD A;  3HL8 A;  1AD5 A;  1IGQ A;  4A4K A;  1WZO A;  1TTH B;  5DY9 A;  5GAM g;  1YWP A;  1M2O A;  2DD4 A;  1S72 Q;  2SRC A;  4BE2 A;  2DYI A;  1PCX A;  4X34 A;  2PUO B;  4FYW B;  1UGQ B;  2CZ0 B;  4J6X A;  1NBE B;  1ZSG A;  3OS2 A;  2DPP B;  4C8Q E;  1RAG B;  2L3S A;  5FU7 C;  2QGF B;  5KYX B;  3EG3 A;  4D8K A;  4J7I A;  5C0M A;  2CKK A;  1R8O B;  2FPF A;  2K4Y A;  4Z89 A;  4A54 A;  4RCC A;  5FW9 A;  3UWN A;  1N5Z A;  4J9F A;  4A4G A;  2RPN A;  5FLX E;  4DEY A;  4FSS A;  4BY6 B;  2HD0 A;  3TEE A;  1FMW A;  4FCY A;  3QJY A;  3R6O A;  2A36 A;  4OB2 B;  2CH4 W;  2LQK A;  2PVO B;  4M75 C;  4ZGJ B;  1VQP A;  2RHU A;  2FZG B;  1EFN A;  4C92 F;  1M3C A;  3JCM V;  4A4E A;  2HDA A;  3V7S A;  2RJE A;  1U5S A;  2PQW A;  1BKB A;  3TVT A;  1U1T A;  3ZBD A;  3LYI A;  4C92 E;  2GNC A;  4E7J A;  1KHC A;  5LJ5 d;  1VQ9 Q;  3ULR B;  1Q86 U;  4KGV B;  3CQT A;  4R0K A;  1FMK A;  2QXF A;  5FRO A;  3QG1 A;  2MOX A;  4OF1 A;  3TRE A;  1C0M A;  2BZ8 A;  4JPB W;  3CMA Q;  4DOW A;  4M7D E;  3FJ5 A;  3LGL A;  3MO8 A;  2XD0 A;  3UA6 A;  1MND A;  1K73 U;  4JLG A;  1OX8 A;  5LJ3 e;  2EW3 A;  2FO0 A;  1BI1 A;  3REB B;  2AHJ B;  5J26 A;  1AWX A;  2Z0W A;  5I21 A;  2QA4 A;  3EGD A;  2HL5 C;  2DF6 A;  1G2B A;  3MP6 A;  5KH6 A;  5KCH A;  1K0S A;  3LLR A;  3JSC A;  2CP3 A;  2NUZ A;  3P8D A;  2RO0 A;  2LJ3 A;  2DO3 A;  4WF2 A;  5KYU B;  1TS9 A;  1Q7Y U;  2E12 A;  3CXC P;  4XTW A;  1TXQ A;  5D6X A;  2HMA A;  4C5I A;  1YHQ Q;  3HFO A;  1VQ9 A;  3CCE T;  3CCL T;  2AZV A;  2HZY A;  2PNI A;  5GAO m;  1Q82 U;  1OOT A;  4FT4 A;  4OGC A;  2AT1 B;  2ZPI B;  4KT0 E;  1D1A A;  3FJP A;  1GBR A;  1RAD B;  2E65 A;  5CVI A;  2KYB A;  4ZTF A;  2D0Q B;  2GFU A;  2A7Y A;  1D1B A;  2ATC B;  3ME9 A;  5LJ5 f;  1OV3 A;  4K11 A;  3GOX A;  1JQQ A;  2E1H A;  2RK1 A;  4HCZ A;  5D6Y A;  1BCM A;  1VQN Q;  2LJ0 A;  1M30 A;  1B34 A;  2ENM A;  2QG9 B;  2DYB A;  4AFS C;  2OTJ T;  4RG8 A;  1QVF P;  4E2F B;  4M7D F;  3FB9 A;  1GXI E;  3ER0 A;  3CCV A;  5LJ5 j;  2DKG A;  3QYG B;  1RAC B;  1JEG A;  1JO8 A;  2DA9 A;  3EFO B;  1PHT A;  4RMO A;  4BD3 A;  3PIP A;  3JCM h;  1WHJ A;  4QQD A;  4M78 C;  1WHH A;  1SG5 A;  2KNB B;  4F7U A;  4KRT A;  1NZ9 A;  1CSK A;  1BU1 A;  4HVU A;  1RAF B;  1JJ2 P;  3CXC S;  4JRI A;  2D8J A;  2QQB A;  4OMN A;  2X35 A;  4AT1 B;  2QTX A;  4IUR A;  4PJO D;  2O9V A;  3D7S B;  5LJ3 g;  1OEB A;  1Y57 A;  2F2V A;  4AG2 C;  2QDY B;  2MAM A;  2JS2 A;  5CKD A;  5CQY A;  1ZLM A;  3M54 A;  4M7D B;  5FU7 B;  4FW2 A;  3PGG A;  3G71 Q;  3OYM A;  3L2Z A;  1D1C A;  5CIU A;  2C0I A;  5CR2 A;  2YDL A;  2RF0 A;  1YIT T;  1VQK T;  1S72 T;  3JCM W;  4J9D A;  1Q82 C;  3UAT A;  1YNZ A;  1M9S A;  3J80 E;  2X9H A;  1AWO A;  2DL5 A;  1FXX A;  5C6S A;  1R0B G;  3X24 B;  4ZGE B;  4B9X A;  4IUV A;  1AT1 B;  4QQ6 A;  3VYH B;  5KYY B;  3CPF A;  1IRE B;  3DB3 A;  3A5Z B;  2LRQ A;  4RTU A;  2VXF A;  1WPY A;  2L2P A;  3EH1 A;  4JJD A;  1N6A A;  2JOY A;  5D7U A;  2XDD A;  1ABQ A;  3VS2 A;  2ZCF B;  4FU6 A;  3CCJ A;  1VQ8 T;  4M7A A;  5CQX A;  3INZ A;  1VQN A;  1W2B S;  1KK7 A;  4ELY C;  4Z8A A;  1G3T A;  2DZC A;  1K9M R;  2EKH A;  1WX6 A;  3HKS A;  2AZS A;  3E19 A;  1BK2 A;  3FEO A;  3JRZ A;  2JN0 A;  3NHN A;  1VQN T;  4EIK A;  2EQJ A;  3OYF A;  1QCF A;  3FDR A;  2DXC A;  5GAM d;  1QLY A;  3RKY A;  1AZG B;  1X2Q A;  4LUD A;  2F5K A;  1G83 A;  2E5Q A;  5KYN A;  3OW2 S;  5A0D A;  4PFP A;  3OYH A;  3VRZ A;  2LQW A;  3CCM A;  2DM1 A;  2LC4 A;  1LJO A;  1U1S A;  4RTX A;  2L5Q A;  2EGA A;  1P92 A;  4C0D C;  5I22 A;  1EX4 A;  3LX7 A;  3URG A;  4JRP A;  2KT1 A;  1IHW A;  5GAN e;  2AKL A;  4PFO A;  1YHQ A;  1RAA B;  1MMN A;  1M90 R;  1HK9 A;  1RL2 A;  4OB0 B;  4ATO A;  4F7U E;  3TU4 K;  3SWN B;  1YIJ Q;  3QUI A;  2LNV A;  3SDZ A;  3M4Y A;  4M75 G;  3CD6 A;  1LNX A;  3M53 A;  1EZZ B;  3M0T A;  3JCM Q;  4FYY B;  1Q7Y C;  3HTR A;  4E7H A;  2DEQ A;  1SEM A;  2DTO A;  3PT9 A;  1KG1 A;  3M0P A;  4PK4 A;  3QII A;  1KC8 U;  2QGG A;  3Q1J A;  3CCU A;  1G8X A;  5EC7 A;  2MCN A;  2GQV A;  2P0Q A;  3WXM B;  3SD4 A;  1Q82 R;  1KD1 C;  4FYV B;  5LJ5 g;  4JS4 A;  4F7U B;  2QEX T;  2R5A A;  1PD1 A;  4QKU A;  1Y96 B;  3RDV A;  4OMP A;  1ZUK A;  1JRI A;  1KJW A;  5IT9 E;  5I2M A;  3CCU T;  3G1J A;  2JMC A;  2NUT B;  3SEM A;  2EJ9 A;  3U23 A;  2LJ1 A;  1GCQ C;  1YJW T;  2LCS A;  4L59 A;  2EVR A;  5GAN 5;  1WHM A;  4BI4 A;  4BE0 A;  1UGS B;  1BCO A;  3VJP A;  4A4F A;  2K3Y A;  4C92 B;  2R58 A;  5L8R E;  3MP8 A;  2YXY A;  2BUD A;  4M75 A;  1X6O A;  1QQJ A;  2F1L A;  1KIK A;  3UPU A;  5GAN j;  4XU3 A;  3G71 A;  1NLP C;  3A8G B;  3CMA A;  4GBQ A;  1JJ2 A;  2YLB A;  3HHT B;  3L2R A;  2K3B A;  5IHK A;  1OUL A;  2FPD A;  1TUD A;  3CCQ A;  2XI9 A;  3EG9 A;  1SKU B;  5KYU A;  1JXM A;  4Z02 A;  1PSE A;  4X9C A;  1M1F A;  3CCR Q;  2CP5 A;  3M4G A;  2DTI A;  3BY7 A;  3A8M B;  3CCQ T;  3CC7 Q;  2DIG A;  2OAU A;  2DET A;  2JT4 A;  4OB3 B;  2F2X A;  5GAN 4;  1M5Q 1;  1QP3 A;  3CME A;  2ROT A;  4Y28 E;  1PC0 A;  5A0L A;  1W2B A;  2BTT A;  2M9U A;  3VS5 A;  5FWC A;  2QDL A;  3J7A F;  2DL7 A;  3EFS A;  3OYI A;  1ZA1 B;  3LWH A;  2X4X A;  3OYY A;  3G6E A;  2RI5 A;  2K2M A;  1X6G A;  2SEM A;  3TSZ A;  2OJ2 A;  5KYX A;  1KC8 R;  2HQH A;  3LW5 E;  2J06 A;  3RR6 A;  3OMG A;  2H8H A;  2W10 A;  1W6X A;  2AKK A;  1HD3 A;  1WDX A;  1QVF A;  2YLC A;  1NEG A;  4XAX B;  4MDX A;  5LJ3 j;  3WVE B;  1Y07 A;  1N8R C;  3QKJ A;  3VU3 C;  2EWN A;  2EQK A;  3WVD B;  3NMZ C;  4EMK C;  2ED0 A;  1UHC A;  3EG9 B;  3JB9 H;  2DE0 X;  3JB9 J;  5FU6 C;  3OYC A;  1O75 A;  1Z9Z A;  4C8Q A;  1B07 A;  1ARK A;  2JM9 A;  2DBK A;  1VYT A;  1H8K A;  2AK5 A;  2ZZD A;  1TUG B;  2DL8 A;  3BW1 A;  1E6H A;  1UFF A;  1I81 A;  5GAN g;  1XNI A;  2M0Y A;  1KQ2 A;  1X43 A;  3MCA B;  3VUZ A;  2L3Q A;  3M55 A;  5IH2 A;  1IXD A;  1LCK A;  4LDX A;  4WCI A;  4LD9 K;  2MF2 A;  2CP6 A;  4ELZ C;  2QQR A;  4LUE A;  3LGF A;  4EMG A;  4OMM A;  4C8Q D;  1XQH A;  1ZA2 B;  1K9A A;  4QVD A;  5EG2 A;  2DRM A;  4M77 D;  3DLM A;  2AIR B;  3UDC A;  3VS3 A;  3HPW A;  2QTV A;  3I35 A;  3CPW A;  3FLG A;  4D8D A;  3CBP A;  1RLQ C;  3RKX A;  2XKO C;  5GAO n;  2VYT A;  4M77 B;  2NUT A;  2YUQ A;  1OPK A;  4C0G A;  1IGU A;  4KH1 B;  4Y91 A;  3QZ9 B;  1IZ6 A;  3L2W A;  5LJ5 e;  2D0N A;  1TU0 B;  3MEW A;  2FHD A;  1YJN T;  4HVW A;  2LNH B;  1PKT A;  2RH2 A;  1N9S A;  3TCJ A;  2M16 A;  2PTK A;  5KE2 A;  2QQA A;  2RK2 A;  1SSF A;  3PTA A;  2VKN A;  1VQ7 A;  2YUP A;  2RMO A;  4HCC A;  2LDM A;  2RQV A;  1SPK A;  3EGU A;  4C5G A;  1Y7X A;  1BI3 A;  3KXT A;  4PKC C;  3CC4 Q;  1GBQ A;  4KUL A;  3V8J A;  1U06 A;  3QWX X;  1GL5 A;  3TSW A;  3MHX A;  2O88 A;  1K9M U;  4GLM A;  4A53 A;  2VGM A;  1VQM T;  7AT1 B;  2J7I A;  2RJD A;  1C6V X;  1BIA A;  1YIJ A;  2V1Q A;  2EGC A;  2LQ8 A;  2M02 A;  3JCM e;  2X4W A;  2B8A A;  1QWE A;  2EIF A;  1PM3 A;  2K79 A;  3MEU A;  4RTY A;  3L42 A;  1QWF A;  3GNF B;  2EFI A;  4PJM A;  3DB4 A;  2GBQ A;  8AT1 B;  2DBM A;  5GAN f;  2OI3 A;  3QZ5 B;  1UB4 A;  3JCM P;  3SFM A;  4GY5 A;  2E3I A;  2L89 A;  2VB6 A;  4BI3 A;  1QVG P;  4E7I A;  2K3X A;  1VQO A;  2JNG A;  1RAI B;  3FRN A;  4PJO C;  5GAM j;  1ZHI A;  4M78 F;  2RQR A;  5DM7 R;  5GAN 7;  5I11 A;  2EYX A;  2GF7 A;  4OGE A;  3GNG A;  2BIV A;  2YRD A;  1VQO T;  3LH5 A;  4C5H A;  1Q95 G;  2GCX A;  1YCY A;  1OI1 A;  4V2S A;  1AEY A;  2E4H A;  1RAH B;  1RLP C;  1WJQ A;  2QQ9 A;  3PE0 A;  2DMO A;  4II1 A;  3CCV T;  1NYG A;  2DRK A;  1FYN A;  1YI2 Q;  3S6W A;  1PG5 B;  1SRM A;  3C12 A;  1X01 A;  4ORZ A;  2EKO A;  5CKE A;  2QA4 Q;  1N9R A;  1VIF A;  1UJY A;  1VQ5 Q;  1JBM A;  2DFU A;  1ZBX A;  2RI2 A;  2MWP A;  2P0K A;  2JTE A;  2PVD B;  4RTW A;  1VQL A;  5CKB A;  1QKW A;  5AT1 B;  1WHG A;  2DTH A;  5GAN h;  3HFN A;  4M7D C;  4LD6 A;  2FYK A;  6AT1 B;  3VV0 A;  2L0A A;  3A98 A;  2OAW A;  1RI0 A;  1XTD A;  4CI0 C;  2EYQ A;  4BY6 C;  2HCK A;  2YWW A;  2RHY A;  4XU1 A;  4CC2 A;  2EPD A;  2J6O A;  1QP2 A;  1BB9 A;  4LDU A;  5KYY A;  4LDW A;  2EYY A;  5GAO p;  2L3R A;  2VC8 A;  3THK A;  2XIC A;  1KQS P;  4J9I A;  1VQP T;  3CPW P;  2RD1 A;  4M7A B;  2V8I A;  4EDU A;  2JTM A;  2BE7 D;  2FG0 A;  4PJO A;  5HK3 A;  4M78 G;  5IHN A;  3KUF A;  1X69 A;  3BDL A;  4J9H A;  1SHF A;  1QW1 A;  4RTZ A;  3EFO A;  3H41 A;  2XK0 A;  2E70 A;  4C92 C;  4M7D G;  3OW2 P;  1G3Y A;  3JCM d;  2CUD A;  2A3L A;  3JCM f;  1CKB A;  2ZGW A;  5GAN 6;  4E7L A;  4N0A C;  2ZPH B;  1WHK A;  2ZPF B;  4HT9 A;  1OU9 A;  5LJ3 d;  2A28 A;  3OSS C;  4M7A F;  2KAF A;  2DL4 A;  1M1K C;  1B7T A;  4TVR A;  1TWB A;  2R5M A;  3QYH B;  4AFU C;  2EGE A;  4QQG A;  4DBH A;  5GMK h;  4C0F A;  3CCJ T;  2M1H A;  1VQ8 A;  2DXT A;  2R57 A;  3CC2 T;  1I07 A;  5I2S A;  4B6M A;  2KMT A;  5IN1 A;  2OX7 A;  1OQK A;  1SRL A;  4P5N A;  9ATC B;  2LQN A;  4BE1 A;  1K8A R;  4RTV A;  2IG0 A;  5GAM f;  1KQS A;  2QAZ A;  2F69 A;  4PJO F;  4E7S A;  4JS5 A;  3RBB B;  1YFN A;  1PD0 A;  1KSW A;  3UF4 A;  1VQ5 A;  2CZ6 B;  4BDZ A;  3RUX A;  1NM7 A;  3EGD B;  3T9N A;  3JB9 I;  2K5L A;  2J05 A;  3X28 B;  3CEY A;  1V76 A;  2W0Z A;  4ZN3 A;  3MET A;  3M58 A;  3CCL A;  2HSE B;  1VQ5 T;  3CCM T;  2LMJ A;  4NL3 A;  3S3M A;  4LN2 A;  3V8L A;  1R77 A;  3JV3 A;  5GAN 3;  4L6V 5;  2DEU A;  3MEA A;  2ZPB B;  2FL7 A;  4EMH A;  2OTL Q;  4C8Q F;  3G4S T;  4J6W A;  1UE9 A;  3REA B;  4PJO E;  2PVG B;  2XMF A;  3I56 A;  4ME7 A;  4RUG A;  2H3J A;  2NUP B;  3PMT A;  4DEX A;  3I9Q A;  5KYW B;  1D0Z A;  1BYM A;  4E7Z A;  3CD6 T;  4HCK A;  1K73 C;  1HJD A;  3EGX A;  3C4S A;  2J6F A;  1OYX A;  5LJ5 h;  3OYL A;  4MMK A;  4C92 A;  1VQ7 Q;  2EQM A;  3MKD A;  1WHL A;  3M0U A;  1Y71 A;  3NGP A;  1N27 A;  2RQU A;  3M57 A;  4BAC A;  4WTO B;  2P4R A;  2QYZ A;  2QEX A;  2RB6 A;  4OP0 A;  4M4Z A;  2J6K A;  2K2V A;  1FMV A;  2EJF A;  1Q81 R;  2RQT A;  3EAE A;  4Y92 A;  3S3O A;  3QPH A;  4D6W A;  3VUB A;  1VQL Q;  3VS7 A;  3RER A;  2COW A;  2V1R A;  3UT1 A;  5FU6 B;  3QBY A;  2XG8 D;  2MI6 A;  3H8Z A;  1M1K R;  3I56 Q;  2ESW A;  3HRU A;  1ZQ1 A;  1VQK A;  1I5L A;  4LE9 A;  3L2Q A;  1GFD A;  2RQW A;  2MMP A;  3CCS Q;  3ZFJ A;  4XTX A;  5GMK j;  4XU0 A;  4M7D A;  1B34 B;  4IUQ A;  4Z88 A;  2VV5 A;  4ZTJ A;  1TUC A;  3VKI A;  1JJ2 S;  3AT1 B;  4PJJ A;  2KT8 A;  2ROL A;  1UTI A;  5A0G A;  2ZAE A;  1YN8 A;  3OW2 A;  1M3A A;  1QCN A;  1MGQ A;  1E7O A;  4FL6 A;  1KD1 R;  4C92 G;  1W1F A;  1N8R R;  1H92 A;  5KYW A;  4OMO A;  2RN8 A;  4BB7 A;  1OZ2 A;  4PJO G;  2KGT A;  1WYX A;  2F5T X;  2X4J A;  3HSB A;  4F14 A;  3H9N A;  4XU2 A;  2QI2 A;  4C8Q G;  4AG1 C;  4PNO A;  5GJV B;  1VA7 A;  4ESR A;  2EAY A;  4ANJ A;  1YCS B;  2ABL A;  1PSF A;  4RG2 A;  2IIM A;  1QVF S;  2KEA A;  2K7A A;  2V8K A;  3OBW A;  2LCC A;  1AOJ A;  4NOY A;  2EBP A;  2O31 A;  3CC4 T;  4JJN K;  2DVJ A;  3QSU A;  1PKS A;  2CP0 A;  2DJZ A;  4PLL A;  1QVG A;  1M8V A;  1FWZ A;  1ZUY A;  2HQX A;  3JB9 F;  5GMK m;  3X26 B;  1KQS S;  2ED1 A;  3I55 Q;  1KC8 C;  1PRM C;  4M78 D;  3EHR A;  1M1K U;  2OTL T;  3BFM A;  5L23 A;  1EIF A;  4QW2 A;  2BE9 B;  4NL2 A;  1TG0 A;  4GLK A;  2JVV A;  3G6E Q;  1MUZ A;  1WA7 A;  2YHT A;  4N4I A;  2CT3 A;  1OU8 A;  1Q81 U;  2V8J A;  4IUT A;  1D3B B;  1H3Z A;  1BI2 A;  2CT4 A;  5CK9 A;  1GFC A;  1QVP A;  3OYN A;  1R0C B;  4O5V A;  1RUW A;  3A8O B;  2P0P A;  2HBP A;  3HP9 A;  1ABO A;  1AWW A;  4PLI A;  1Q86 C;  3CCU Q;  5LJ3 h;  2LTO A;  2KK4 A;  1I0C A;  3A1P A;  3E9G A;  2HKQ B;  1VOM A;  3SB2 A;  5GAO r;  3M59 A;  3OYA A;  4N4G A;  1MV3 A;  2D8H A;  1VQ4 Q;  3MJX A;  4MDW A;  4EPC A;  4CC3 A;  1LPL A;  4J5Y A;  4OMQ A;  2K6D A;  2CDT A;  2RJF A;  1TH7 A;  3M0R A;  3CCJ Q;  3HRS A;  4C0Z A;  1HSQ A;  5KCO A;  2RA2 A;  2CP2 A;  4J8O A;  4O6J A;  5J39 A;  2WSC E;  2IVW A;  3SWN C;  3JB9 G;  2HNI A;  3H0F A;  2CSI A;  3C94 A;  3P8B B;  1M1G A;  1TSF A;  2E64 A;  3V7C A;  1SHG A;  2K9G A;  2DK3 A;  4FYX B;  1IRX A;  4MML A;  3CCS T;  5HK0 A;  1WNL A;  5IXB A;  3PVL A;  5GAN d;  5FRN A;  2CZ1 B;  4E47 A;  1PNJ A;  2HQE A;  2E6N A;  4JLI A;  2VWF A;  4M75 B;  3OYD A;  1VQP Q;  1Q81 C;  3A8L B;  3CCS A;  1I1J A;  3DKM A;  3BE3 A;  2LZ6 B;  3PNW C;  1V29 B;  3VS6 A;  3CC7 A;  1NEB A;  1WXB A;  3I55 T;  4IUU A;  5GAO q;  4M78 B;  1VQ4 T;  2NLU A;  2Y90 A;  1GRI A;  1YJN A;  2FVU A;  2C0T A;  4JRQ A;  1KFZ A;  3CC7 T;  2JW4 A;  1UEC A;  1IHV A;  1W70 A;  3NFC A;  3BDU A;  1VQ7 T;  4JRK A;  1WI7 A;  3PFS A;  2P84 A;  1YI2 A;  1KD1 U;  4J9B A;  1T0J A;  1Y0M A;  3E1S A;  4M75 F;  4XTV A;  2HEQ A;  2DXU A;  4M77 A;  1G5V A;  1NYF A;  5HKC A;  1VQ6 A;  2QA4 T;  5GMK l;  4ZGD B;  1YI2 T;  1VUB A;  3LH0 A;  2DVE A;  1WJR A;  3OYE A;  2CS7 A;  4XTU A;  4M7D D;  3H6Z A;  3G6E T;  2V26 A;  3G4S Q;  3QDF A;  4QVC A;  2C0O A;  3QO3 A;  2QK0 A;  1M4Z A;  1E6G A;  1H3H A;  3V8K A;  4J9E A;  4BDY A;  2X3W D;  3OYB A;  1KHI A;  2D6F A;  1VQ9 T;  1K4U S;  4M77 F;  1VYU A;  4CC7 A;  1VQO Q;  4XK8 E;  5CKH A;  1SF9 A;  2NYS A;  2ECZ A;  5CO7 A;  1WJS A;  2L8D A;  4N4H A;  3QHS A;  1VQK Q;  2LX7 A;  4KGZ B;  1M3B A;  2ZPG B;  5IHI A;  4KBM B;  4M77 E;  4E6R A;  2FRY A;  3AHU A;  4DQ2 A;  2CGH A;  1WLP B;  2GTO A;  5LL6 S;  2K5I A;  1YP5 A;  2FRW A;  2EYZ A; 
#chains in the Genus database with same CATH homology
 2O9S A;  2EGE A;  2DNU A;  4J9C A;  4X1V A;  1I07 A;  3M0T A;  1K1Z A;  2KRN A;  3EG2 A;  1T3L A;  5GJW B;  1A0N B;  1SEM A;  1SRL A;  1AVZ C;  1UJ0 A;  1NLO C;  3M0P A;  2YT6 A;  3H0H A;  2LQN A;  4RTV A;  2MCN A;  5EC7 A;  1T3S A;  3KFV A;  3RBB B;  3VS4 A;  1KSW A;  4OMP A;  3UF4 A;  1QKX A;  1ZUK A;  2YUN A;  1NM7 A;  1KJW A;  2J05 A;  2JMC A;  3SEM A;  3U23 A;  2YUO A;  2LJ1 A;  1GCQ C;  2W0Z A;  2RNA A;  2LCS A;  1ZUU A;  2EVR A;  4IIM A;  2YSQ A;  1V1C A;  2A37 A;  2KRM A;  2LMJ A;  3PVQ A;  4LN2 A;  1UDL A;  3JV3 A;  2DJQ A;  2GTJ A;  3R6N A;  4IIO A;  1SSH A;  1X6B A;  1KIK A;  2KXD A;  2NWM A;  3VRY A;  3REA B;  1UE9 A;  2XMF A;  1NLP C;  1K0X A;  4RUG A;  1IO6 A;  4AFQ C;  4GBQ A;  1AD5 A;  3VS1 A;  3H0I A;  4DEX A;  2K3B A;  5IHK A;  1YWP A;  2SRC A;  2FPD A;  1TUD A;  3I9Q A;  5ECA A;  1JXO A;  4HXJ A;  4HCK A;  1K76 A;  1HJD A;  2CH4 A;  1ZSG A;  2J6F A;  1JXM A;  2L3S A;  3M0U A;  2KBT A;  3EG3 A;  3NGP A;  2RQU A;  2VVK A;  4D8K A;  1UG1 A;  2JT4 A;  2FPF A;  2F2X A;  2P4R A;  4Z89 A;  4M4Z A;  2J6K A;  2HSP A;  5FW9 A;  1AZE A;  2ROT A;  2RQT A;  1N5Z A;  1S1N A;  4Y92 A;  1BBZ A;  2G6F X;  4J9F A;  1OPL A;  2BTT A;  2RPN A;  4DEY A;  4J9G A;  3VS5 A;  3VS7 A;  4FSS A;  5HCK A;  5FWC A;  2V1R A;  2QDL A;  1PWT A;  2DL7 A;  2A36 A;  3EG1 A;  4F16 A;  2ESW A;  2K2M A;  1X6G A;  3O5Z A;  2CH4 W;  4LE9 A;  1GCP A;  1GFD A;  2DIL A;  2DL3 A;  1M27 C;  2RQW A;  2SEM A;  3TSZ A;  1NG2 A;  2OJ2 A;  3VS0 A;  1EFN A;  1M3C A;  2HDA A;  2I0N A;  2J06 A;  4Z88 A;  4JZ3 A;  1TUC A;  2H8H A;  1U5S A;  2W10 A;  1W6X A;  2KT8 A;  3TVT A;  2ROL A;  1UTI A;  2AKK A;  3EHQ A;  1YN8 A;  1Z9Q A;  1HD3 A;  2GNC A;  2FEI A;  1WDX A;  1M3A A;  1NEG A;  4AFZ C;  1E7O A;  2KRO A;  2DX1 A;  1W1F A;  3ULR B;  3CQT A;  4R0K A;  1H92 A;  1FMK A;  2E5K A;  3IQL A;  4OMO A;  2RN8 A;  3NMZ C;  2ED0 A;  2MOX A;  1UHC A;  2KGT A;  1WYX A;  1CKA A;  2BZ8 A;  4JPB W;  4F14 A;  2DE0 X;  1AWJ A;  3FJ5 A;  1T0H A;  1Z9Z A;  4AG1 C;  1B07 A;  1ARK A;  2A08 A;  5GJV B;  2JM9 A;  2DBK A;  1VYT A;  1H8K A;  2KXC A;  3M0Q A;  1VA7 A;  2AK5 A;  2L3P A;  4ESR A;  1XOV A;  1YCS B;  2DL8 A;  3UA6 A;  2DLP A;  2BZY A;  1E6H A;  1UFF A;  2ABL A;  2EW3 A;  2FPE A;  2IIM A;  2FO0 A;  2KEA A;  3REB B;  2K7A A;  3EG0 A;  1AWX A;  1WIE A;  1GCQ A;  2M0Y A;  1M8M A;  3I5R A;  1X43 A;  1AOJ A;  2L3Q A;  5IH2 A;  2DF6 A;  1G2B A;  2EBP A;  2LP5 A;  2O31 A;  1LCK A;  2GGR A;  4WCI A;  1U3O A;  1K0S A;  2DVJ A;  4LUE A;  4OMM A;  2NUZ A;  1K9A A;  1PKS A;  2LJ3 A;  2DRM A;  3VS3 A;  1ZUY A;  3I35 A;  4D8D A;  2ED1 A;  1RLQ C;  1J3T A;  3M0S A;  4ZNX A;  1PRM C;  3EHR A;  2YUQ A;  1OPK A;  2F2W A;  3UA7 A;  2AZV A;  2PNI A;  5L23 A;  2CSQ A;  1OOT A;  2D0N A;  1GBR A;  1TG0 A;  2KE9 A;  2KYB A;  4HVW A;  1MUZ A;  1WFW A;  2LNH B;  1PKT A;  1WA7 A;  2CT3 A;  2PTK A;  1OV3 A;  4K11 A;  2CT4 A;  1JQQ A;  1GFC A;  2LJ0 A;  1M30 A;  2ENM A;  2VKN A;  1RUW A;  2DYB A;  2YUP A;  4AFS C;  2RMO A;  4JJB A;  2RQV A;  1MV0 B;  1SPK A;  3EGU A;  3ZL7 C;  1ABO A;  1AWW A;  2MIO A;  1GBQ A;  2EYW A;  1U06 A;  1JO8 A;  3QWX X;  2DA9 A;  1I0C A;  1PHT A;  1JEG A;  1GL5 A;  2KRS A;  3TSW A;  2O88 A;  2CUB A;  4GLM A;  1MV3 A;  1X2K A;  2D8H A;  2KNB B;  2M51 A;  4KRT A;  2J7I A;  1CSK A;  1BU1 A;  1UUE A;  4HVU A;  4CC4 B;  2V1Q A;  2EGC A;  4CC3 A;  4A63 B;  2PZ1 A;  2D8J A;  2JS0 A;  3I5S A;  4OMQ A;  1QWE A;  4OMN A;  2K6D A;  2CDT A;  2K79 A;  3M0R A;  4RTY A;  3SHW A;  2O9V A;  1OEB A;  1QWF A;  1HSQ A;  1Y57 A;  2F2V A;  4AG2 C;  2JS2 A;  2GBQ A;  2DBM A;  1YWO A;  2JMA A;  2OI3 A;  1ZLM A;  1UGV A;  3H0F A;  2CSI A;  2KR3 A;  2JM8 A;  2C0I A;  1SHG A;  2RQR A;  2YDL A;  2K9G A;  2RF0 A;  1JU5 C;  5I11 A;  2EYX A;  5IXB A;  2O2O A;  3PVL A;  1X27 A;  3LH5 A;  1PRL C;  4J9D A;  2CRE A;  3UAT A;  1YNZ A;  1PNJ A;  1AWO A;  1AEY A;  1RI9 A;  2DL5 A;  3QWY A;  2VWF A;  2B86 A;  1I1J A;  1RLP C;  2BZX A;  3PE0 A;  2DMO A;  2LZ6 B;  3VS6 A;  1NEB A;  1NYG A;  1WXU A;  3RNJ A;  1WXB A;  2DRK A;  1FYN A;  2JXB A;  1SRM A;  4ORZ A;  1GRI A;  4RTU A;  4RTT A;  2L2P A;  5IXF A;  2D1X A;  2GQI A;  2HBW A;  4JJD A;  1UJY A;  1ABQ A;  2C0T A;  3VS2 A;  1ZX6 A;  1KFZ A;  2JW4 A;  2JTE A;  4HVV A;  4RTW A;  4JZ4 A;  1VYV A;  1ZBJ A;  1UEC A;  1QKW A;  1W70 A;  4Z8A A;  1WI7 A;  1B3Q A;  4J9B A;  1T0J A;  1Y0M A;  2EKH A;  1WX6 A;  4OML A;  2L0A A;  3A98 A;  2AZS A;  2OAW A;  1BK2 A;  2HEQ A;  3NHN A;  1NYF A;  4LNP A;  2HCK A;  4EIK A;  1QCF A;  4CC2 A;  2EPD A;  1QLY A;  2J6O A;  4JJC A;  1BB9 A;  1AZG B;  3C0C A;  1X2Q A;  4LUD A;  2EYY A;  1G83 A;  3THK A;  2EQI A;  2C0O A;  4J9I A;  4QT7 A;  1UHF A;  2X3X D;  1E6G A;  3VRZ A;  1H3H A;  2LQW A;  2FG0 A;  3NPF A;  4J9E A;  2X3W D;  2DM1 A;  3GBQ A;  4F17 A;  5IHN A;  1K4U S;  4RTX A;  1X69 A;  4J9H A;  2EGA A;  1SHF A;  1VYU A;  4CC7 A;  4RTZ A;  5I22 A;  5FWB A;  2ECZ A;  3H41 A;  2KT1 A;  2LX7 A;  1M3B A;  5IHI A;  2AKL A;  2CUD A;  1CKB A;  1WXT A;  4E6R A;  2FRY A;  2KYM A;  1WLP B;  2A28 A;  2GTO A;  2DL4 A;  1YP5 A;  2FRW A;  2EYZ A;  4AFU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...