2MOXA

Solution structure of tandem sh3 domain of sorbin and sh3 domain-containing protein 1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
143
structure length
143
Chain Sequence
QHMSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIFPRTYIELLPPAEKAQPKKLTPVQVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVIKRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sorbin and SH3 domain-containing protein 1
publication title Structural investigation of the interaction between the tandem SH3 domains of c-Cbl-associated protein and vinculin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 17
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2014-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2moxA02
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2moxA01
1JEGA 2EYWA 1XOVA 2E5KA 2PTKA 1SHGA 4HVWA 1OOTA 1HSQA 1J3TA 3UATA 3TSZA 1GCQA 2FG0A 4OMLA 1M27C 2RQRA 3CQTA 3RBBB 1AWJA 2RQVA 1T3LA 3RNJA 2DF6A 2EBPA 2FPEA 4HCKA 4J9DA 1BU1A 4J9FA 1G83A 3PVQA 3VS0A 2J6FA 2RQUA 4RTVA 2O2OA 5IHNA 1EFNA 3M0PA 2NUZA 3C0CA 2EGEA 1Y57A 2CSIA 1E6HA 2O31A 4IIMA 3R6NA 3REBB 2DM1A 5FWBA 2VWFA 3PE0A 1OPKA 4FSSA 1X2QA 1PHTA 4Y92A 2EVRA 4AG2C 4GLMA 4HVVA 3EGUA 2F2XA 1NLPC 2K7AA 2H8HA 1NEBA 2EKHA 1QWEA 3O5ZA 1WYXA 2GBQA 1A0NB 4EIKA 2VVKA 2RNAA 2EYXA 1PWTA 3I5SA 2W10A 4JZ4A 2EYYA 4DEYA 1GFDA 1X6GA 2LJ3A 1N5ZA 2J7IA 1ZUUA 2F2WA 3M0QA 2J05A 1QLYA 1WA7A 2M0YA 2DNUA 1KIKA 2LP5A 2BZXA 3THKA 3QWYA 2GNCA 2W0ZA 2RN8A 4X1VA 1U3OA 1I0CA 2DRMA 1AVZC 2ESWA 1WXBA 2MOXA 5L23A 1PKSA 4LNPA 2JS0A 2FRYA 1TG0A 1GCQC 2BZYA 3QWXX 3VS5A 2A37A 1FYNA 2AKLA 1LCKA 2SEMA 1MUZA 4JJBA 1SRLA 2DBKA 2DL7A 2FRWA 1H3HA 2KRNA 2EPDA 3A98A 4AFZC 2M51A 2GGRA 2NWMA 4OMMA 1CKAA 5IHIA 1VYUA 2GQIA 1AWXA 2JS2A 1KFZA 2KT8A 2ED1A 2HEQA 3EG0A 4WCIA 4LE9A 1OV3A 4JPBW 1GBQA 2AK5A 2BTTA 3FJ5A 1AWWA 3REAB 2C0TA 4A63B 1K0SA 1Y0MA 1Z9QA 3I9QA 2QDLA 2CUBA 2LJ1A 4JJCA 5IXFA 1H8KA 2CH4W 3I5RA 2CUDA 2KE9A 1E6GA 3VS2A 5I22A 1K0XA 4RTZA 3VRZA 1VYTA 4ESRA 3M0UA 2LNHB 1K9AA 2L3PA 2AKKA 2LJ0A 1I07A 1Z9ZA 5GJVB 1WX6A 1M30A 4AFUC 2AZSA 2G6FX 1PKTA 2DA9A 1KJWA 2KNBB 5FWCA 2KYBA 1NYFA 1W1FA 4IIOA 1AZGB 2K3BA 3VRYA 2K2MA 3U23A 3UA6A 1SHFA 2JM9A 1AD5A 1AEYA 4F16A 3VS7A 1PNJA 2C0IA 3EHRA 1UDLA 2A36A 2CT4A 1HJDA 2KRSA 1YN8A 2KXCA 2RMOA 2KROA 1WXTA 1T0JA 1JQQA 1OEBA 1S1NA 1UGVA 5IXBA 2ROLA 1SEMA 1GCPA 4Z8AA 2O9VA 4HVUA 3VS1A 5IHKA 3I35A 2FO0A 1QKXA 1GRIA 2LX7A 4CC2A 1M3AA 1JO8A 1NYGA 1G2BA 1T3SA 1UJYA 2X3WD 2LCSA 2JW4A 1X69A 1M8MA 4LUDA 1YWOA 2DE0X 2FPDA 3EG2A 1RLQC 2PNIA 1E7OA 1QCFA 1NLOC 3H0FA 2KBTA 2SRCA 3SHWA 1UTIA 4M4ZA 2YUNA 1ZBJA 1UFFA 2AZVA 2DVJA 1AOJA 1X6BA 4JJDA 2DL8A 2O88A 1WI7A 2ECZA 1YNZA 1MV0B 4CC3A 2YT6A 2DX1A 2L0AA 1H92A 3EHQA 1U5SA 2EYZA 2L3SA 3KFVA 1X2KA 2J6KA 2F2VA 2K6DA 4RTYA 1RUWA 1UE9A 2KEAA 1VA7A 4QT7A 1JXOA 2I0NA 2GTOA 5GJWB 1ZSGA 2ENMA 1KSWA 2K9GA 4J9HA 1CSKA 1M3CA 2OI3A 4OMPA 4ORZA 2OJ2A 1ZUYA 4GBQA 3PVLA 2JMCA 3EG1A 4K11A 1SSHA 3ZL7C 1WFWA 2RF0A 3TVTA 1K4US 2L2PA 1YCSB 1UHFA 2DL3A 2ED0A 2RQTA 1WLPB 5IH2A 4LN2A 1AWOA 4LUEA 4JZ3A 4R0KA 5I11A 4J9IA 2BZ8A 1GL5A 1W6XA 2B86A 2LQNA 4RTTA 1ZX6A 2RQWA 1JU5C 1PRMC 2YUOA 1GBRA 1PRLC 2KR3A 1BBZA 4HXJA 4D8KA 2L3QA 2DLPA 2J06A 2JM8A 2D1XA 2HCKA 1RI9A 2KYMA 3M0TA 3TSWA 1RLPC 5FW9A 2DRKA 4J9CA 1K1ZA 1IO6A 2GTJA 2HBWA 1BB9A 1UG1A 1WIEA 4DEXA 1B3QA 1W70A 1ZUKA 1B07A 3VS4A 1OPLA 3VS6A 3GBQA 4AFQC 2HDAA 2J6OA 1CKBA 4CC7A 1NG2A 5HCKA 1ABQA 2V1RA 3H0HA 2XMFA 2DL5A 1U06A 4OMNA 4E6RA 2ABLA 1GFCA 2DJQA 2D0NA 3NMZC 2CH4A 3H41A 1ABOA 2JMAA 2OAWA 2CSQA 2CREA 4RTUA 3LH5A 2RPNA 2V1QA 1V1CA 1M3BA 1X43A 2A08A 1UUEA 3EG3A 3SEMA 2P4RA 1NM7A 2D8JA 4AG1C 4RTWA 2X3XD 2EGCA 4F17A 1VYVA 2FEIA 3NPFA 4F14A 3ULRB 4CC4B 2LMJA 1SPKA 3IQLA 1WDXA 2JT4A 2EW3A 2HSPA 5ECAA 2DILA 2DBMA 2DMOA 1YWPA 2MIOA 2CT3A 2KGTA 2YUPA 4OMQA 4J9GA 3NGPA 1JXMA 1UHCA 3JV3A 4J9EA 4Z89A 2KXDA 4AFSC 2KRMA 3M0RA 2C0OA 1MV3A 3NHNA 1ZLMA 1AZEA 4ZNXA 1YP5A 3VS3A 3H0IA 1T0HA 1NEGA 4D8DA 2LQWA 2IIMA 2K79A 1QWFA 4RUGA 2YUQA 1HD3A 2O9SA 4KRTA 1TUDA 2KT1A 1QKWA 2YDLA 2LZ6B 2JXBA 1I1JA 4RTXA 2ROTA 2D8HA 1WXUA 4J9BA 1ARKA 1FMKA 4OMOA 1X27A 2A28A 5EC7A 1K76A 1BK2A 2VKNA 1UECA 1SRMA 4Z88A 1TUCA 2EQIA 3UF4A 3UA7A 2EGAA 2MCNA 3M0SA 2DYBA 2PZ1A 2YSQA 2FPFA 2JTEA 2DL4A 2CDTA 1UJ0A
chains in the Genus database with same CATH superfamily
4C5HA 4FSXA 2E5KA 1TOVA 2AIRB 1XJWB 1I4K1 2PTKA 3CPFA 2OTLT 1SHGA 4FL6A 1HSQA 1VQ5Q 3OBWA 3EFRA 3TSZA 1GCQA 4OMLA 1BI2A 1M27C 2RQRA 3M5AA 1RAIB 4PFOA 1AWJA 2RK1A 3VJPA 4PJOG 1YHQA 2V8JA 2RQVA 1T3LA 3JCMW 1UGQB 3SWNA 1M90C 2CS7A 4EMKB 4Y28E 3LLRA 5LJ3g 2BE9B 3FRNA 3G6EA 5GAOl 2M02A 4J9FA 1G83A 3PVQA 4C5IA 2RQUA 4RTVA 3M0PA 2EKOA 1KG1A 2EGEA 2CSIA 2O31A 2XI9A 1VQ6A 2DM1A 3QSUA 5FWBA 5HY6A 2VV5A 5LJ5e 3JB9D 1OU9A 2LC4A 2YLBA 2HBPA 1PHTA 3OS5A 1K73C 2EVRA 3I55A 1LJOA 2K7AA 4PK4A 2OTLA 1RACB 2GBQA 2VYTA 2YRDA 4EIKA 2PVOB 1PWTA 2E1HA 3JCMV 2MPXC 2QK0A 2EIFA 2EYYA 4WF2A 2LJ3A 4GY5A 3CPWS 2RM4A 1QLYA 1NJIR 3QWYA 2GNCA 1IZ6A 4AT1B 2DRMA 2MI6A 1WXBA 2MOXA 2PUOB 3MP8A 2M16A 5LL6S 5GAN6 2VXFA 2JUFA 5GAOm 1TG0A 1M9SA 1SRLA 2BUDA 2KRNA 5GMKe 5D6WA 2NWMA 1TSFA 3OW2A 3JB9F 5IHIA 2JS2A 2JNGA 1X75C 1NZ9A 1M90R 1OV3A 1AWWA 3WVDB 4HT9A 2JTMA 3X26B 2EQMA 3CCLQ 3RKWA 2QDLA 2LJ1A 4JJCA 5IXFA 2CH4W 3I5RA 5EG2A 3EFOA 5KYYA 3HHTB 4PKCC 1NPPA 4LD6A 4A53A 1K9AA 3QPHA 4E2FB 2ZPEB 1I07A 1K73R 2HL3A 3H9NA 4AFUC 3CMAQ 1KD1C 2DIQA 3OS0A 1QVGS 2MK5A 2JVVA 2ZPFB 3PMTA 2DFUA 5HKCA 1R8OB 1W1FA 4R55A 4OMFB 4IIOA 4J6WA 2RHIA 1AZGB 2K3BA 3VRYA 4PJOD 1VQ5T 1SHFA 1IXDA 4BDYA 1AEYA 4PFPA 3QJ6A 4F16A 4MZMA 3QDRB 4F04B 3EHRA 1UDLA 2YWWA 2KRSA 3E9GA 3RESA 3G71Q 2RMOA 1SKUB 5GAN8 3NTKA 1MMNA 1S1NA 2YRCA 2K57A 2HD0A 4MDXA 1UGRB 2FZKB 3ZBDA 2DTIA 3M53A 2QAZA 5GAOp 1VQ9Q 2X9HA 3CCRQ 1EX4A 1GXIE 5GAMd 1QCOA 3EGXA 2LCSA 4JS4A 4C92C 3OYLA 3PMIA 1X69A 2DETA 2R5AA 4LUDA 4N0AC 1Q81U 2G3RA 2PNIA 4BDZA 1E7OA 3G1JA 1VQKQ 2HAXA 2WACA 4XTWA 4XTZA 2AT1B 3MP1A 2F5KA 2JTFA 5DM7R 1VQ5A 4TVRA 2DVJA 4JLGA 1YIJQ 2DL8A 2O88A 2RI3A 3Q1JA 5HK0A 1QVFS 2P4TA 1EIFA 1YNZA 1B34B 4PJOC 4E7IA 3QZ9B 4PJOF 1U5SA 3QJYA 2OAUA 1N8RC 1RAAB 3BE3A 2J6KA 1YBYA 4BE0A 4IUPA 2YHTA 2QQRA 3MEVA 2V26A 1VA7A 4N0AA 2I0NA 1WQ7A 3V8KA 2RB6A 1MMGA 1KD1R 1WQWA 4IUUA 2K9GA 1M3CA 2GFAA 1ZUYA 3EGDA 4GBQA 3PVLA 4BY6C 5A0LA 3EG1A 5CKEA 3X20B 4A4KA 2M9UA 4IURA 1JB0E 4C0DB 4PJOA 3DB4A 1WLPB 4PJJA 1AWOA 3L2UA 4JZ3A 4F7UA 2P84A 1XTDA 2LQNA 4RTTA 2RQWA 3JCMe 3CCLT 2KR3A 3CEYA 4D8KA 2ZGWA 3GPLA 2LRQA 4R56A 1OX8A 5DY9A 1VQLQ 5CKHA 1HYOA 5KYXB 1UG1A 2LCLA 4BI3A 1YITQ 1WZOA 2EYQA 3OY9A 2J6OA 3CMAT 1NG2A 2DD5A 5GANj 4P5NA 4LDWA 5CQYA 1ABQA 3H0HA 1XQHA 4RCCA 2X51A 2DL5A 4J7IA 2R57A 4IUVA 3NTIA 2D0NA 2RH2A 1ABOA 2JMAA 1X6OA 3A8HB 2CREA 3BDUA 5LJ3h 2RPNA 3OW2S 2V1QA 5FU6B 3L42A 1OYXA 3C95A 2QEXQ 4JRPA 3OYDA 1N8RR 2D8JA 3V7CA 4F17A 2EGCA 3CCLA 1Q7YC 4CC4B 2LMJA 4II1A 3META 2YXYA 5GAMg 4M7DE 3AT1B 5ECAA 2DILA 2DBMA 3F70A 3RERA 2YUPA 2KGTA 2E6ZA 3QUIA 3UT1A 4C0ZA 1VQ9T 4J9GA 3CCRT 1M1KU 4DOVA 1JXMA 3FC3A 1VQOT 1UHCA 3JV3A 2F1LA 2VXEA 1IHWA 3VUZA 1I5LA 4E47A 1G3WA 4ZNXA 4EMKA 1YP5A 5FU7B 3CMAA 3H0IA 3LX7A 1VQKT 3HPWA 1AHJB 4RUGA 1MNDA 1HD3A 4KRTA 1JJ2S 5D6XA 2KT1A 2LZ6B 3JRZA 3LGLA 1YIJT 2ROTA 1W2BA 5LJ5d 5DLOA 2E4HA 4OMOA 3T9NA 1ACMB 4A4GA 2COZA 5A0DA 2A28A 4KUDK 3MP6A 2CZ6B 3PNWC 1K76A 2O01E 2EQIA 2K5LA 1VQPQ 2DYBA 4PLIA 3QZ5B 5I2SA 4M77C 3GLXA 4M7DB 1JEGA 2MWOA 2EYWA 3OYYA 2VB6A 2DAQA 3C94A 1RAHB 5LJ3d 1OOTA 4QVCA 1VQOA 2XU8A 2L89A 3UATA 2FG0A 2RHXA 3FIFA 4OP0A 3CXCP 4Y91A 2RHUA 2BE7D 2BIVA 1VQKA 2DF6A 4PJLA 2PVDB 3J80E 3I56Q 1WHLA 1BU1A 1YIJA 3TU4K 1Q7YR 2DIGA 1EFNA 1Q82U 3MEWA 4IIMA 3R6NA 4E7SA 2F5TX 5GANe 2IVWA 3M55A 5KCHA 3TREA 3M4YA 4FSSA 3CBMA 4B9XA 4HVVA 3EGUA 3DLMA 2E3IA 5I2MA 2HQXA 3RIRA 1NLPC 1YITT 2RI2A 1G5VA 2H8HA 2LTOA 5GAOr 1A0NB 1C6VX 2VVKA 5GAMf 3OBYA 1TU0B 1N5ZA 2J7IA 1UGPB 1ZUUA 1Q86C 1WJRA 2CP2A 1KIKA 2BZXA 2RN8A 2QEXT 1WHMA 1U3OA 2KI7A 2KQWA 3CD6A 3V7SA 1WHJA 4M7DG 2MMPA 4E7JA 4FT4A 2FRYA 2ZPGB 1GCQC 3QWXX 3E19A 2A37A 2GCXA 3L2WA 4E7LA 1MUZA 2DBKA 2DL7A 2FHDA 4QVZA 4M78E 1YJWQ 2EPDA 3A98A 3JCMP 1M2VB 2GGRA 1AWXA 4FW1A 2E65A 2RA2A 1K8AC 1VQNQ 4WCIA 4JPBW 1GBQA 2AK5A 2BTTA 2QA4Q 5LJ5g 2PUKB 4A63B 4X34A 3L2ZA 3PGGA 1K0SA 4MMKA 3OMGA 2DVEA 1Y0MA 2CP5A 3CCMQ 3BDLA 4C5GA 5HK3A 1KHCA 1QVFA 2FL7A 1E6GA 4BUGA 3VS2A 1K0XA 2QEXA 1WHKA 4PL6A 2LNHB 2QQ9A 5CR2A 3A5ZB 2LJ0A 3TCJA 1VQPT 5GJVB 4F7UG 1WX6A 1IRXA 5CIUA 1M30A 2G6FX 2QASA 5FWCA 3G4SQ 3EH1A 2QI2A 1H641 3NFCA 4M78B 4RKUE 1B34A 1WHHA 3U23A 3UA6A 2GQVA 1B7TA 1AD5A 3LWIA 1Q86R 3VS7A 2XIDA 4M7AE 4ANJA 1OI1A 1PNJA 2MF2A 3CBOA 3WVEB 5C6SA 1HJDA 2A36A 3CCQT 1YN8A 3PFSA 1FX7A 1QMCA 4FW2A 4OVAA 3VV0A 1VQ8A 3I56T 3ZEHA 3OYIA 2RHZA 1OEBA 4M75E 1SEMA 1GCPA 2O9VA 1U8RA 3VS1A 1W2BS 5IHKA 2CP6A 3UWNA 3GF5A 1XNIA 2LX7A 2H3EB 4DA4A 1M3AA 3M59A 2E41A 1NYGA 4HCZA 1VQPA 2DXCA 2X3WD 3M4GA 4O5VA 2JW4A 2D0QB 2JZ2A 1M8MA 2FPDA 3HTRA 3VU3C 1SG5A 1K8AR 1NLOC 4JUVA 3O8VA 5GMKi 1FMVA 2KBTA 4OGEA 2DZ9A 1IGUA 1PSFA 3L1AA 1ZBJA 1RAFB 4JLIA 1X6BA 4JJDA 4JRIA 1WI7A 4M7AB 1BYMA 4FT2A 1MV0B 3CCQA 4CC3A 5GAN2 2KVQG 2L0AA 2EJFA 1H92A 1VIEA 3I56A 1Y07A 2DYIA 4L59A 3KFVA 2COYA 5KYXA 4M7DD 1KC8C 1UEBA 4RTYA 4M75B 3HFOA 5GAMh 4QT7A 5L8RE 5LJ5f 2P0QA 1QVGP 2IPOB 2GTOA 5GJWB 1ZSGA 2VGNA 2ENMA 2RK2A 4M78G 2LNVA 4OMPA 3HRSA 1I5OB 2PQWA 1S72Q 4E7KA 2QQBA 5IN1A 1V29B 4MDWA 5GMKl 1KQSP 1SSHA 3E9FA 3ZL7C 2RF0A 1QP2A 2KSSA 4NS5A 4FM4B 3TVTA 2L2PA 1K4US 1YCSB 1UHFA 2DL3A 2ED0A 2RQTA 5IH2A 1VQNT 2HSEB 4R0KA 2H3JA 4J9IA 5D6YA 4BI8B 2NUPB 4C8QE 3JCMQ 2KDSA 1GL5A 5LJ3f 3C4SA 1D3BB 2B86A 2QA4T 2Z0WA 1ZX6A 2NUTB 3OYMA 3PIOA 4BE1A 1GBRA 1Y96B 3CCMT 1JJ2A 3CBPA 3J81E 2HMAA 1M4ZA 2L3QA 2DLPA 3GOXA 2J06A 1M1KC 3M0TA 3CC2Q 1K1ZA 1F1BB 3DKMA 4QQGA 4DEXA 4M7DF 1OPLA 4N4GA 4CC7A 1K9MC 1PC0A 4OF1A 2V1RA 5KYNA 1VQ7Q 3QO3A 1IHVA 1G3TA 1U06A 3KUFA 3QG1A 4B6MA 4E6RA 1GFCA 3NMZC 1VUBA 3H41A 2OAWA 2ZPIB 4ZN3A 3DB3A 3QYHB 2XDBA 4RTUA 1NJIU 1VQNA 4C8QB 5J39A 1X43A 1Q95G 2A7YA 2X35A 3JB9H 4IKFA 1D1AA 5GMKm 3EG3A 2QA4A 1NM7A 1KC8R 5CAIA 4M7DA 4F14A 4HCCA 2QTXA 2JT4A 4XAXB 3FLGA 1M2OA 2MIOA 3V8LA 3QYGB 1KK7A 4QQDA 2YRVA 3M0RA 5C0MA 2C0OA 1MV3A 1IGQA 3JCMg 3VS3A 4F7UF 1T0HA 1ZSZB 2LQWA 4HKEA 2K79A 4XU0A 5IT9E 1QKWA 2YDLA 4RMOA 2V8KA 1VQ4Q 2JXBA 2RHYA 1I1JA 4Q5WA 2O4XB 1FXXA 1ARKA 3EAEA 2OTJQ 1K73U 2VKNA 4Z88A 3FEOA 2EGAA 2MCNA 1N27A 4J83A 4RG2A 5CCAA 2K3XA 4ELZC 2RO0A 5DLQE 4XTXA 2ZPHB 1K9MR 4JRQA 2LDMA 4LDYA 4HVWA 2E3HA 1S72T 5KCOA 4N4HA 3RDVA 1R0BG 2Y4YA 5LJ5h 2QQSA 3RNJA 1HXDA 1P92A 3CCUQ 2E70A 2EFIA 4J8OA 1ZHIA 4J7FA 3M9QA 2KY9A 3SD4A 1C0MA 1WJSA 4J6XA 2F69A 3VS0A 2O2OA 5IHNA 2NUZA 3C12A 3C0CA 1Y57A 3REBB 1LNXA 2VWFA 4FU6A 1LPLA 1BI3A 5KYWB 1M2VA 3GIBA 3CCVQ 3CC2T 4EMKC 1OX9A 3G71T 4ATOA 2A3LA 2DZCA 4ZGJB 3QXEB 4B9WA 3O5ZA 2RNAA 4M78F 2W10A 4DEYA 1X6GA 1TXQA 1C1AA 5GAOq 1G8XA 3M0QA 4X9CA 3ZFJA 2J05A 4CRIA 1YJ9Q 1YHQQ 2M0YA 2DNUA 2LP5A 4DBFA 3THKA 2HQEA 3TQ7P 5GMKh 2L3RA 3EG9B 7AT1B 3X25B 4J6YA 4JS5A 1O75A 2K5IA 1KD1U 5L23A 1PKSA 4IUTA 2JS0A 4EMGA 4M78A 1TH7A 3VKIA 3N5BB 4C0FA 3CC2A 1LCKA 2SEMA 4JJBA 3OS2A 2FRWA 1BIAA 3EH2A 4MMLA 5J3BA 4D6WA 4AFZC 1ZA2B 4OMMA 3OYEA 3G71A 2GQIA 4XTYA 2HNIA 2XHCA 2KT8A 1D0YA 2DJZA 2HEQA 2KMTA 4LE9A 5FRMA 4C92E 1KQ1A 5GANg 4DQ2A 1AT1B 4JRKA 2RJEA 1VQ4T 1YI2Q 1LVKA 1VQ9A 1H8KA 2ZAEA 1NBEB 4XK8E 3CCRA 4ZN1A 3MHXA 2X4WA 2CUDA 4PLLA 2KE9A 5I22A 4JJNK 4RTZA 2DKGA 2LVMA 1VYTA 2K2VA 2KK4A 2L3PA 3HFNA 2OTJT 2AKKA 3HRTA 3OQ5A 1Z9ZA 3OSVA 3DLLA 3KBGA 1YJNQ 3NTHA 2AZSA 1PKTA 2KNBB 3QKJA 1NYFA 3BY7A 9ATCB 4M7AA 1MGQA 3P8DA 2K2MA 5CK9A 4XU2A 4FCYA 4BACA 3OYFA 4X9DA 2QG9B 2C0IA 1N8RU 4NL2A 1G3SA 2KXCA 4C92B 4C5EA 4M75A 1VQLT 4L5GA 2KROA 1WXTA 1T0JA 1JQQA 4ZTJA 1ZA1B 2ROLA 3ASKA 3JCMb 2FO0A 1Y71A 3H8ZA 2YLCA 4KGVB 1JBMA 2OTJA 4PNOA 1TUGB 1OZ2A 1BCOA 1JO8A 3OS1A 2ATCB 2R58A 4BB7A 1UJYA 1RABB 5AT1B 1I8FA 5AYFA 4KBMB 4A4EA 4EMHA 3CCVT 3HSBA 1FWZA 1PM3A 3HP9A 4FYWB 1YFNA 4ZTFA 2DE0X 3EG2A 2NUPA 1I81A 1QCFA 3E1SA 1D3BA 5KH6A 4OGCA 5LJ3j 2SRCA 2CP3A 2NUTA 3FB9A 1UTIA 2X4XA 2YUNA 1UFFA 3QBYA 1Y96A 1UGSB 4VUBA 3LH0A 2YT6A 3E2UA 1KQSA 3S3MA 4BY6B 3EHQA 1VQLA 5CKBA 1YJ9T 2EYZA 3PTAA 1YHQT 4ELYC 2F2VA 1YITA 1RUWA 1X01A 1UE9A 4ZGDB 2QQAA 1NPRA 3JB9I 4LXCA 2DXTA 1JXOA 2MAMA 1MMDA 2CZ1B 3M54A 2DD4A 2LQKA 3FDRA 4J9HA 2V8IA 1CSKA 3PT9A 2OI3A 1M1GA 2P0KA 4ORZA 2OJ2A 5GAN3 3JCMh 3CCVA 2JMCA 4K11A 1PSEA 4C8QA 2RJFA 1ZSZC 4C92G 1JRIA 2IG0A 4LD9K 2EJGA 2L5QA 1PG5B 4LUEA 1Q81C 2BZ8A 3S3OA 3MCAB 2RJDA 1W6XA 1Q7YU 3P8HA 5CO7A 3MJXA 3QIIA 2D6FA 3OMCA 1PRMC 2DXUA 1W2BP 2M1HA 4DOWA 3ER0A 4NOYA 1BBZA 4HXJA 2VASA 1YI2T 3X24B 2D1XA 1YJ9A 4C0DC 1RADB 3CPWP 5M9OA 2Y4XA 1QP3A 1WPYA 3TSWA 4Z02A 5KE3A 4E7HA 2DRKA 1IO6A 2HBWA 5GAOn 1BB9A 1WIEA 3BW1A 1YJNT 1B3QA 2NYSA 1ZSZA 2KAFA 3HKSA 1D09B 1ZUKA 1B07A 3VS4A 3VS6A 3HL8A 4PJMA 3GBQA 3MO8A 4AFQC 4DBRA 5HCKA 2XMFA 2O4XA 3VYHB 1M1FA 4OMNA 2DJQA 4M77E 1BI1A 5FRNA 4QKUA 5D7UA 1V1CA 1M3BA 1YCYA 3V8JA 3L2VA 3AHUA 1KQ2A 2A08A 1D1CA 4J5YA 4RTWA 2EWNA 3A8GB 1QVPA 3NPFA 5CVIA 3ULRB 1YI2A 1N9SA 1D0XA 1SPKA 3JCMd 4XTUA 4KGZB 5FLXE 2XG8D 1TWBA 5LJ3e 1QQJA 3VUBA 1YWPA 2K3YA 2CT3A 2QXFA 5KE2A 1U1TA 3NGPA 2CP0A 5FU6C 3HRUA 5J26A 4J9EA 1YJNA 2KXDA 1MHNA 3NHNA 1AZEA 5CQXA 5FROA 3JB9J 1NEGA 3MKDA 4MZPA 1OU8A 1Q81R 1G3YA 4YTLA 2DPPB 2O9SA 3RR6A 1TUDA 3RKXA 4M77B 5GAN4 4JDSA 3CC7Q 1FMKA 2ZPBB 4E7ZA 1X27A 5KYWA 1N9RA 5EC7A 4WTOB 1UECA 4KT0E 5FU7C 4MZTA 1YJWT 3UF4A 3UA7A 1ZBXA 3JSCA 3M0SA 2YSQA 2JTEA 3CCEQ 2CDTA 3CCSQ 1TTHB 4OB2B 4EPCA 1XOVA 4RCBA 3CMEQ 3LW5E 2RI5A 1VIFA 4BI4A 1Q86U 3D7SB 1J3TA 1V76A 2X4YA 3CQTA 4RG8A 3RBBB 4C92D 5A2QE 1BCMA 5GANh 5I21A 2EBPA 2FPEA 4HCKA 4J9DA 3EG9A 4NL3A 2DTOA 4M7DC 2EQUA 4FYXB 2J6FA 2LQ8A 3GNGA 2OX7A 3S3NA 3G4ST 1E6HA 1N6AA 1SF9A 2C06A 1QVFP 4M7AG 1OQKA 4C0GA 2FZGB 5KYUB 1KQSS 2RD1A 2RJCA 1YJWA 3L2RA 3PE0A 4N4IA 1OPKA 1X2QA 3OYCA 4Y92A 2QYZA 2CKKA 1RAEB 4AG2C 1K8AU 4GLMA 2K4YA 1MMAA 2VC8A 2F2XA 2PU9B 3H6ZA 4M75G 2M0OA 2GF7A 4HT8A 1NEBA 2EKHA 1QWEA 4M77G 1WYXA 3CCMA 2EYXA 1NE8A 3I5SA 2ZCFB 4FIBA 4JZ4A 1GFDA 2K5FA 1VQOQ 2F2WA 4HA8A 2QDYB 4QW2A 4LDVA 1WA7A 3MEUA 1BI0A 4C92F 2E10A 4V2SA 3SWNB 2W0ZA 4ME7A 4X1VA 1M90U 2VUBA 2GFUA 2I2LA 1I0CA 1AVZC 3G4SA 2ESWA 2EQKA 2XDPA 4LNPA 2LT4A 1Q82C 3SDZA 2BZYA 3VS5A 1FYNA 2AKLA 3OB9A 5GANd 4OB1B 1H3HA 2DERA 3RUXA 2M51A 1M1KR 1CKAA 5GAN7 1VYUA 1VQMQ 3CXCA 4C92A 1RAGB 4L6V5 1KFZA 4QQ6A 2ED1A 3EG0A 3QHSA 3FJ5A 2PVGB 3REAB 2C0TA 3UDCA 3PIPA 4M78D 1Z9QA 3I9QA 2WSEE 2CUBA 1QCNA 4PJNA 3RKYA 8AT1B 5GAMj 3CC7T 1D0ZA 3FJPA 1RI0A 3VRZA 1PCXA 3OW2P 4ESRA 4C8QG 3M0UA 3CC4Q 4OB3B 4LDUA 2QGFB 1SSFA 2VGMA 3CCET 3LWHA 1W4SA 3CCST 2DEUA 3CD6Q 1D1BA 3JCMJ 2DA9A 1KJWA 2KYBA 3VYGA 1FMWA 2CP7A 4DBQA 3CMET 2XKOC 1OZ3A 3MPUB 3OYGA 2JM9A 1IB8A 3EFSA 2B8AA 2CT4A 1PD0A 1KC8U 2CYZB 4A4FA 2P0PA 1RL2A 4DBHA 3BFMA 1UGVA 1TS9A 5IXBA 4Z8AA 1JJ2P 3CC7A 4M78C 1WNLA 4M7AD 3CCJQ 3L2QA 2E64A 4HVUA 1M5Q1 3I35A 4FYYB 1S72A 1ZQ1A 1QKXA 1GRIA 3J7AF 1Q82R 2FYKA 3OYNA 1VQ7T 4CC2A 1WJQA 4OB0B 3EFOB 3LYIA 5KYYB 1G2BA 1T3SA 4XU1A 3P8BB 4M75D 2DK3A 3CCEA 4IUQA 3CCSA 1YWOA 3JCMf 1RLQC 2E5QA 3JCMX 4M77D 3H0FA 2XK0A 3CMEA 2E6NA 3SHWA 4M4ZA 1EZZB 2AZVA 3G6EQ 1AOJA 2ECZA 1H3ZA 3G7ZA 1QW1A 1VOMA 1IREB 2DX1A 1VQ6Q 3OSSC 1PD1A 4LDXA 2L3SA 1KHIA 1X2KA 1R77A 3A8LB 4XTVA 2K6DA 2NLUA 2CZ0B 2KEAA 1WGSA 1VQ8Q 2JJ9A 3I55Q 4XQ3A 2A0FB 1K9MU 3OYKA 1VQ7A 8ATCB 4M7AC 2OTLQ 1M8VA 1KSWA 3KXTA 4M7AF 2AHJB 2HZYA 2HKQB 2EQJA 3CPWA 4O6JA 1WFWA 4HCBA 4QVDA 2LT1A 3EGXB 5GAMe 2JOYA 4M75C 3OYBA 3X28B 1VQMT 2ZZDA 4LN2A 2L8DA 5I11A 3JCMc 3SFMA 4M75F 3INZA 4PJOE 3RMQA 3A8MB 3R6OA 4F7UE 1JU5C 4M77F 2FB7A 2YUOA 4PFZA 4ZGEB 3SB2A 2DO3A 3LGFA 1UB4A 1PRLC 2HL5C 3MEAA 4XU3A 1LOJA 2JM8A 3RMSA 1BIBA 4C8QD 2HCKA 1RI9A 2R5MA 2KYMA 3CCQQ 1RLPC 4KUIA 5FW9A 4J9CA 3JB9G 2GTJA 3I55T 2COWA 3CC4T 1DJ7B 2HKNA 2E12A 1WHGA 4KULA 1HK9A 3CCUT 1W70A 4BD3A 3CD6T 3UPUA 2LCCA 2HDAA 1CKBA 5LJ5j 1VQ4A 2MWPA 4A54A 4M77A 2FVUA 2DEQA 3A1PA 1U1SA 5CKFA 2CZ7B 4A4HA 2Y90A 2ABLA 2CH4A 3EGDB 3OYJA 2WSCE 2XICA 3OYHA 2CSQA 1VQMA 3LH5A 2QTVA 2LX9A 5A0GA 6AT1B 2CGHA 2QGGA 3CXCS 4PJOB 2BKDN 3OA6A 1UUEA 2HQHA 3SEMA 2P4RA 4AMCA 4F7UB 2JN0A 4AG1C 3TEEA 2X3XD 3OYAA 4BE2A 1VYVA 2FEIA 2EJ9A 2FZCB 5GAN5 4CI0C 4GLKA 1QVGA 3CCJT 3IQLA 1WDXA 1BKBA 4KH1B 2EW3A 2HSPA 2DMOA 1OULA 4OMQA 2MYSA 3WXMB 3CC4A 3M58A 1MNEA 3A8OB 4C8QC 4UC4A 4Z89A 3CCUA 4AFSC 4C8QF 2KRMA 1O9SA 4EDUA 1ZLMA 3V7RA 4FYVB 4KGXB 3M57A 4D8DA 2IIMA 1QWFA 2YUQA 3ME9A 2DTHA 5GANf 3GNFB 2DXBA 3URGA 5GMKj 3G6ET 4RTXA 2XDDA 2WSFE 2D8HA 1WXUA 4J9BA 5KYUA 3JAME 5IAYA 3SWNC 3GP8A 1VQ6T 2XD0A 2D9TA 1NJIC 1BK2A 1SRMA 1R0CB 1TUCA 3S6WA 3QDFA 2PZ1A 1Y7XA 2FPFA 2X4JA 2DL4A 2EAYA 1VQ8T 3CCJA 3M56A 1UJ0A 4KH0B 5CKDA
chains in the Genus database with same CATH topology
1JEGA 2EYWA 1XOVA 2E5KA 2PTKA 1SHGA 4HVWA 1OOTA 1HSQA 1J3TA 3UATA 3TSZA 1GCQA 2FG0A 4OMLA 1M27C 2RQRA 3CQTA 3RBBB 1AWJA 2RQVA 1T3LA 3RNJA 2DF6A 2EBPA 2FPEA 4HCKA 4J9DA 1BU1A 4J9FA 1G83A 3PVQA 3VS0A 2J6FA 2RQUA 4RTVA 2O2OA 5IHNA 1EFNA 3M0PA 2NUZA 3C0CA 2EGEA 1Y57A 2CSIA 1E6HA 2O31A 4IIMA 3R6NA 3REBB 2DM1A 5FWBA 2VWFA 3PE0A 1OPKA 4FSSA 1X2QA 1PHTA 4Y92A 2EVRA 4AG2C 4GLMA 4HVVA 3EGUA 2F2XA 1NLPC 2K7AA 2H8HA 1NEBA 2EKHA 1QWEA 3O5ZA 1WYXA 2GBQA 1A0NB 4EIKA 2VVKA 2RNAA 2EYXA 1PWTA 3I5SA 2W10A 4JZ4A 2EYYA 4DEYA 1GFDA 1X6GA 2LJ3A 1N5ZA 2J7IA 1ZUUA 2F2WA 3M0QA 2J05A 1QLYA 1WA7A 2M0YA 2DNUA 1KIKA 2LP5A 2BZXA 3THKA 3QWYA 2GNCA 2W0ZA 2RN8A 4X1VA 1U3OA 1I0CA 2DRMA 1AVZC 2ESWA 1WXBA 2MOXA 5L23A 1PKSA 4LNPA 2JS0A 2FRYA 1TG0A 1GCQC 2BZYA 3QWXX 3VS5A 2A37A 1FYNA 2AKLA 1LCKA 2SEMA 1MUZA 4JJBA 1SRLA 2DBKA 2DL7A 2FRWA 1H3HA 2KRNA 2EPDA 3A98A 4AFZC 2M51A 2GGRA 2NWMA 4OMMA 1CKAA 5IHIA 1VYUA 2GQIA 1AWXA 2JS2A 1KFZA 2KT8A 2ED1A 2HEQA 3EG0A 4WCIA 4LE9A 1OV3A 4JPBW 1GBQA 2AK5A 2BTTA 3FJ5A 1AWWA 3REAB 2C0TA 4A63B 1K0SA 1Y0MA 1Z9QA 3I9QA 2QDLA 2CUBA 2LJ1A 4JJCA 5IXFA 1H8KA 2CH4W 3I5RA 2CUDA 2KE9A 1E6GA 3VS2A 5I22A 1K0XA 4RTZA 3VRZA 1VYTA 4ESRA 3M0UA 2LNHB 1K9AA 2L3PA 2AKKA 2LJ0A 1I07A 1Z9ZA 5GJVB 1WX6A 1M30A 4AFUC 2AZSA 2G6FX 1PKTA 2DA9A 1KJWA 2KNBB 5FWCA 2KYBA 1NYFA 1W1FA 4IIOA 1AZGB 2K3BA 3VRYA 2K2MA 3U23A 3UA6A 1SHFA 2JM9A 1AD5A 1AEYA 4F16A 3VS7A 1PNJA 2C0IA 3EHRA 1UDLA 2A36A 2CT4A 1HJDA 2KRSA 1YN8A 2KXCA 2RMOA 2KROA 1WXTA 1T0JA 1JQQA 1OEBA 1S1NA 1UGVA 5IXBA 2ROLA 1SEMA 1GCPA 4Z8AA 2O9VA 4HVUA 3VS1A 5IHKA 3I35A 2FO0A 1QKXA 1GRIA 2LX7A 4CC2A 1M3AA 1JO8A 1NYGA 1G2BA 1T3SA 1UJYA 2X3WD 2LCSA 2JW4A 1X69A 1M8MA 4LUDA 1YWOA 2DE0X 2FPDA 3EG2A 1RLQC 2PNIA 1E7OA 1QCFA 1NLOC 3H0FA 2KBTA 2SRCA 3SHWA 1UTIA 4M4ZA 2YUNA 1ZBJA 1UFFA 2AZVA 2DVJA 1AOJA 1X6BA 4JJDA 2DL8A 2O88A 1WI7A 2ECZA 1YNZA 1MV0B 4CC3A 2YT6A 2DX1A 2L0AA 1H92A 3EHQA 1U5SA 2EYZA 2L3SA 3KFVA 1X2KA 2J6KA 2F2VA 2K6DA 4RTYA 1RUWA 1UE9A 2KEAA 1VA7A 4QT7A 1JXOA 2I0NA 2GTOA 5GJWB 1ZSGA 2ENMA 1KSWA 2K9GA 4J9HA 1CSKA 1M3CA 2OI3A 4OMPA 4ORZA 2OJ2A 1ZUYA 4GBQA 3PVLA 2JMCA 3EG1A 4K11A 1SSHA 3ZL7C 1WFWA 2RF0A 3TVTA 1K4US 2L2PA 1YCSB 1UHFA 2DL3A 2ED0A 2RQTA 1WLPB 5IH2A 4LN2A 1AWOA 4LUEA 4JZ3A 4R0KA 5I11A 4J9IA 2BZ8A 1GL5A 1W6XA 2B86A 2LQNA 4RTTA 1ZX6A 2RQWA 1JU5C 1PRMC 2YUOA 1GBRA 1PRLC 2KR3A 1BBZA 4HXJA 4D8KA 2L3QA 2DLPA 2J06A 2JM8A 2D1XA 2HCKA 1RI9A 2KYMA 3M0TA 3TSWA 1RLPC 5FW9A 2DRKA 4J9CA 1K1ZA 1IO6A 2GTJA 2HBWA 1BB9A 1UG1A 1WIEA 4DEXA 1B3QA 1W70A 1ZUKA 1B07A 3VS4A 1OPLA 3VS6A 3GBQA 4AFQC 2HDAA 2J6OA 1CKBA 4CC7A 1NG2A 5HCKA 1ABQA 2V1RA 3H0HA 2XMFA 2DL5A 1U06A 4OMNA 4E6RA 2ABLA 1GFCA 2DJQA 2D0NA 3NMZC 2CH4A 3H41A 1ABOA 2JMAA 2OAWA 2CSQA 2CREA 4RTUA 3LH5A 2RPNA 2V1QA 1V1CA 1M3BA 1X43A 2A08A 1UUEA 3EG3A 3SEMA 2P4RA 1NM7A 2D8JA 4AG1C 4RTWA 2X3XD 2EGCA 4F17A 1VYVA 2FEIA 3NPFA 4F14A 3ULRB 4CC4B 2LMJA 1SPKA 3IQLA 1WDXA 2JT4A 2EW3A 2HSPA 5ECAA 2DILA 2DBMA 2DMOA 1YWPA 2MIOA 2CT3A 2KGTA 2YUPA 4OMQA 4J9GA 3NGPA 1JXMA 1UHCA 3JV3A 4J9EA 4Z89A 2KXDA 4AFSC 2KRMA 3M0RA 2C0OA 1MV3A 3NHNA 1ZLMA 1AZEA 4ZNXA 1YP5A 3VS3A 3H0IA 1T0HA 1NEGA 4D8DA 2LQWA 2IIMA 2K79A 1QWFA 4RUGA 2YUQA 1HD3A 2O9SA 4KRTA 1TUDA 2KT1A 1QKWA 2YDLA 2LZ6B 2JXBA 1I1JA 4RTXA 2ROTA 2D8HA 1WXUA 4J9BA 1ARKA 1FMKA 4OMOA 1X27A 2A28A 5EC7A 1K76A 1BK2A 2VKNA 1UECA 1SRMA 4Z88A 1TUCA 2EQIA 3UF4A 3UA7A 2EGAA 2MCNA 3M0SA 2DYBA 2PZ1A 2YSQA 2FPFA 2JTEA 2DL4A 2CDTA 1UJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JEG A;  2EYW A;  1XOV A;  2E5K A;  2PTK A;  1SHG A;  4HVW A;  1OOT A;  1HSQ A;  1J3T A;  3UAT A;  3TSZ A;  1GCQ A;  2FG0 A;  4OML A;  1M27 C;  2RQR A;  3CQT A;  3RBB B;  1AWJ A;  2RQV A;  1T3L A;  3RNJ A;  2DF6 A;  2EBP A;  2FPE A;  4HCK A;  4J9D A;  1BU1 A;  4J9F A;  1G83 A;  3PVQ A;  3VS0 A;  2J6F A;  2RQU A;  4RTV A;  2O2O A;  5IHN A;  1EFN A;  3M0P A;  2NUZ A;  3C0C A;  2EGE A;  1Y57 A;  2CSI A;  1E6H A;  2O31 A;  4IIM A;  3R6N A;  3REB B;  2DM1 A;  5FWB A;  2VWF A;  3PE0 A;  1OPK A;  4FSS A;  1X2Q A;  1PHT A;  4Y92 A;  2EVR A;  4AG2 C;  4GLM A;  4HVV A;  3EGU A;  2F2X A;  1NLP C;  2K7A A;  2H8H A;  1NEB A;  2EKH A;  1QWE A;  3O5Z A;  1WYX A;  2GBQ A;  1A0N B;  4EIK A;  2VVK A;  2RNA A;  2EYX A;  1PWT A;  3I5S A;  2W10 A;  4JZ4 A;  2EYY A;  4DEY A;  1GFD A;  1X6G A;  2LJ3 A;  1N5Z A;  2J7I A;  1ZUU A;  2F2W A;  3M0Q A;  2J05 A;  1QLY A;  1WA7 A;  2M0Y A;  2DNU A;  1KIK A;  2LP5 A;  2BZX A;  3THK A;  3QWY A;  2GNC A;  2W0Z A;  2RN8 A;  4X1V A;  1U3O A;  1I0C A;  2DRM A;  1AVZ C;  2ESW A;  1WXB A;  2MOX A;  5L23 A;  1PKS A;  4LNP A;  2JS0 A;  2FRY A;  1TG0 A;  1GCQ C;  2BZY A;  3QWX X;  3VS5 A;  2A37 A;  1FYN A;  2AKL A;  1LCK A;  2SEM A;  1MUZ A;  4JJB A;  1SRL A;  2DBK A;  2DL7 A;  2FRW A;  1H3H A;  2KRN A;  2EPD A;  3A98 A;  4AFZ C;  2M51 A;  2GGR A;  2NWM A;  4OMM A;  1CKA A;  5IHI A;  1VYU A;  2GQI A;  1AWX A;  2JS2 A;  1KFZ A;  2KT8 A;  2ED1 A;  2HEQ A;  3EG0 A;  4WCI A;  4LE9 A;  1OV3 A;  4JPB W;  1GBQ A;  2AK5 A;  2BTT A;  3FJ5 A;  1AWW A;  3REA B;  2C0T A;  4A63 B;  1K0S A;  1Y0M A;  1Z9Q A;  3I9Q A;  2QDL A;  2CUB A;  2LJ1 A;  4JJC A;  5IXF A;  1H8K A;  2CH4 W;  3I5R A;  2CUD A;  2KE9 A;  1E6G A;  3VS2 A;  5I22 A;  1K0X A;  4RTZ A;  3VRZ A;  1VYT A;  4ESR A;  3M0U A;  2LNH B;  1K9A A;  2L3P A;  2AKK A;  2LJ0 A;  1I07 A;  1Z9Z A;  5GJV B;  1WX6 A;  1M30 A;  4AFU C;  2AZS A;  2G6F X;  1PKT A;  2DA9 A;  1KJW A;  2KNB B;  5FWC A;  2KYB A;  1NYF A;  1W1F A;  4IIO A;  1AZG B;  2K3B A;  3VRY A;  2K2M A;  3U23 A;  3UA6 A;  1SHF A;  2JM9 A;  1AD5 A;  1AEY A;  4F16 A;  3VS7 A;  1PNJ A;  2C0I A;  3EHR A;  1UDL A;  2A36 A;  2CT4 A;  1HJD A;  2KRS A;  1YN8 A;  2KXC A;  2RMO A;  2KRO A;  1WXT A;  1T0J A;  1JQQ A;  1OEB A;  1S1N A;  1UGV A;  5IXB A;  2ROL A;  1SEM A;  1GCP A;  4Z8A A;  2O9V A;  4HVU A;  3VS1 A;  5IHK A;  3I35 A;  2FO0 A;  1QKX A;  1GRI A;  2LX7 A;  4CC2 A;  1M3A A;  1JO8 A;  1NYG A;  1G2B A;  1T3S A;  1UJY A;  2X3W D;  2LCS A;  2JW4 A;  1X69 A;  1M8M A;  4LUD A;  1YWO A;  2DE0 X;  2FPD A;  3EG2 A;  1RLQ C;  2PNI A;  1E7O A;  1QCF A;  1NLO C;  3H0F A;  2KBT A;  2SRC A;  3SHW A;  1UTI A;  4M4Z A;  2YUN A;  1ZBJ A;  1UFF A;  2AZV A;  2DVJ A;  1AOJ A;  1X6B A;  4JJD A;  2DL8 A;  2O88 A;  1WI7 A;  2ECZ A;  1YNZ A;  1MV0 B;  4CC3 A;  2YT6 A;  2DX1 A;  2L0A A;  1H92 A;  3EHQ A;  1U5S A;  2EYZ A;  2L3S A;  3KFV A;  1X2K A;  2J6K A;  2F2V A;  2K6D A;  4RTY A;  1RUW A;  1UE9 A;  2KEA A;  1VA7 A;  4QT7 A;  1JXO A;  2I0N A;  2GTO A;  5GJW B;  1ZSG A;  2ENM A;  1KSW A;  2K9G A;  4J9H A;  1CSK A;  1M3C A;  2OI3 A;  4OMP A;  4ORZ A;  2OJ2 A;  1ZUY A;  4GBQ A;  3PVL A;  2JMC A;  3EG1 A;  4K11 A;  1SSH A;  3ZL7 C;  1WFW A;  2RF0 A;  3TVT A;  1K4U S;  2L2P A;  1YCS B;  1UHF A;  2DL3 A;  2ED0 A;  2RQT A;  1WLP B;  5IH2 A;  4LN2 A;  1AWO A;  4LUE A;  4JZ3 A;  4R0K A;  5I11 A;  4J9I A;  2BZ8 A;  1GL5 A;  1W6X A;  2B86 A;  2LQN A;  4RTT A;  1ZX6 A;  2RQW A;  1JU5 C;  1PRM C;  2YUO A;  1GBR A;  1PRL C;  2KR3 A;  1BBZ A;  4HXJ A;  4D8K A;  2L3Q A;  2DLP A;  2J06 A;  2JM8 A;  2D1X A;  2HCK A;  1RI9 A;  2KYM A;  3M0T A;  3TSW A;  1RLP C;  5FW9 A;  2DRK A;  4J9C A;  1K1Z A;  1IO6 A;  2GTJ A;  2HBW A;  1BB9 A;  1UG1 A;  1WIE A;  4DEX A;  1B3Q A;  1W70 A;  1ZUK A;  1B07 A;  3VS4 A;  1OPL A;  3VS6 A;  3GBQ A;  4AFQ C;  2HDA A;  2J6O A;  1CKB A;  4CC7 A;  1NG2 A;  5HCK A;  1ABQ A;  2V1R A;  3H0H A;  2XMF A;  2DL5 A;  1U06 A;  4OMN A;  4E6R A;  2ABL A;  1GFC A;  2DJQ A;  2D0N A;  3NMZ C;  2CH4 A;  3H41 A;  1ABO A;  2JMA A;  2OAW A;  2CSQ A;  2CRE A;  4RTU A;  3LH5 A;  2RPN A;  2V1Q A;  1V1C A;  1M3B A;  1X43 A;  2A08 A;  1UUE A;  3EG3 A;  3SEM A;  2P4R A;  1NM7 A;  2D8J A;  4AG1 C;  4RTW A;  2X3X D;  2EGC A;  4F17 A;  1VYV A;  2FEI A;  3NPF A;  4F14 A;  3ULR B;  4CC4 B;  2LMJ A;  1SPK A;  3IQL A;  1WDX A;  2JT4 A;  2EW3 A;  2HSP A;  5ECA A;  2DIL A;  2DBM A;  2DMO A;  1YWP A;  2MIO A;  2CT3 A;  2KGT A;  2YUP A;  4OMQ A;  4J9G A;  3NGP A;  1JXM A;  1UHC A;  3JV3 A;  4J9E A;  4Z89 A;  2KXD A;  4AFS C;  2KRM A;  3M0R A;  2C0O A;  1MV3 A;  3NHN A;  1ZLM A;  1AZE A;  4ZNX A;  1YP5 A;  3VS3 A;  3H0I A;  1T0H A;  1NEG A;  4D8D A;  2LQW A;  2IIM A;  2K79 A;  1QWF A;  4RUG A;  2YUQ A;  1HD3 A;  2O9S A;  4KRT A;  1TUD A;  2KT1 A;  1QKW A;  2YDL A;  2LZ6 B;  2JXB A;  1I1J A;  4RTX A;  2ROT A;  2D8H A;  1WXU A;  4J9B A;  1ARK A;  1FMK A;  4OMO A;  1X27 A;  2A28 A;  5EC7 A;  1K76 A;  1BK2 A;  2VKN A;  1UEC A;  1SRM A;  4Z88 A;  1TUC A;  2EQI A;  3UF4 A;  3UA7 A;  2EGA A;  2MCN A;  3M0S A;  2DYB A;  2PZ1 A;  2YSQ A;  2FPF A;  2JTE A;  2DL4 A;  2CDT A;  1UJ0 A; 
#chains in the Genus database with same CATH topology
 4C5H A;  4FSX A;  2E5K A;  1TOV A;  2AIR B;  1XJW B;  1I4K 1;  2PTK A;  3CPF A;  2OTL T;  1SHG A;  4FL6 A;  1HSQ A;  1VQ5 Q;  3OBW A;  3EFR A;  3TSZ A;  1GCQ A;  4OML A;  1BI2 A;  1M27 C;  2RQR A;  3M5A A;  1RAI B;  4PFO A;  1AWJ A;  2RK1 A;  3VJP A;  4PJO G;  1YHQ A;  2V8J A;  2RQV A;  1T3L A;  3JCM W;  1UGQ B;  3SWN A;  1M90 C;  2CS7 A;  4EMK B;  4Y28 E;  3LLR A;  5LJ3 g;  2BE9 B;  3FRN A;  3G6E A;  5GAO l;  2M02 A;  4J9F A;  1G83 A;  3PVQ A;  4C5I A;  2RQU A;  4RTV A;  3M0P A;  2EKO A;  1KG1 A;  2EGE A;  2CSI A;  2O31 A;  2XI9 A;  1VQ6 A;  2DM1 A;  3QSU A;  5FWB A;  5HY6 A;  2VV5 A;  5LJ5 e;  3JB9 D;  1OU9 A;  2LC4 A;  2YLB A;  2HBP A;  1PHT A;  3OS5 A;  1K73 C;  2EVR A;  3I55 A;  1LJO A;  2K7A A;  4PK4 A;  2OTL A;  1RAC B;  2GBQ A;  2VYT A;  2YRD A;  4EIK A;  2PVO B;  1PWT A;  2E1H A;  3JCM V;  2MPX C;  2QK0 A;  2EIF A;  2EYY A;  4WF2 A;  2LJ3 A;  4GY5 A;  3CPW S;  2RM4 A;  1QLY A;  1NJI R;  3QWY A;  2GNC A;  1IZ6 A;  4AT1 B;  2DRM A;  2MI6 A;  1WXB A;  2MOX A;  2PUO B;  3MP8 A;  2M16 A;  5LL6 S;  5GAN 6;  2VXF A;  2JUF A;  5GAO m;  1TG0 A;  1M9S A;  1SRL A;  2BUD A;  2KRN A;  5GMK e;  5D6W A;  2NWM A;  1TSF A;  3OW2 A;  3JB9 F;  5IHI A;  2JS2 A;  2JNG A;  1X75 C;  1NZ9 A;  1M90 R;  1OV3 A;  1AWW A;  3WVD B;  4HT9 A;  2JTM A;  3X26 B;  2EQM A;  3CCL Q;  3RKW A;  2QDL A;  2LJ1 A;  4JJC A;  5IXF A;  2CH4 W;  3I5R A;  5EG2 A;  3EFO A;  5KYY A;  3HHT B;  4PKC C;  1NPP A;  4LD6 A;  4A53 A;  1K9A A;  3QPH A;  4E2F B;  2ZPE B;  1I07 A;  1K73 R;  2HL3 A;  3H9N A;  4AFU C;  3CMA Q;  1KD1 C;  2DIQ A;  3OS0 A;  1QVG S;  2MK5 A;  2JVV A;  2ZPF B;  3PMT A;  2DFU A;  5HKC A;  1R8O B;  1W1F A;  4R55 A;  4OMF B;  4IIO A;  4J6W A;  2RHI A;  1AZG B;  2K3B A;  3VRY A;  4PJO D;  1VQ5 T;  1SHF A;  1IXD A;  4BDY A;  1AEY A;  4PFP A;  3QJ6 A;  4F16 A;  4MZM A;  3QDR B;  4F04 B;  3EHR A;  1UDL A;  2YWW A;  2KRS A;  3E9G A;  3RES A;  3G71 Q;  2RMO A;  1SKU B;  5GAN 8;  3NTK A;  1MMN A;  1S1N A;  2YRC A;  2K57 A;  2HD0 A;  4MDX A;  1UGR B;  2FZK B;  3ZBD A;  2DTI A;  3M53 A;  2QAZ A;  5GAO p;  1VQ9 Q;  2X9H A;  3CCR Q;  1EX4 A;  1GXI E;  5GAM d;  1QCO A;  3EGX A;  2LCS A;  4JS4 A;  4C92 C;  3OYL A;  3PMI A;  1X69 A;  2DET A;  2R5A A;  4LUD A;  4N0A C;  1Q81 U;  2G3R A;  2PNI A;  4BDZ A;  1E7O A;  3G1J A;  1VQK Q;  2HAX A;  2WAC A;  4XTW A;  4XTZ A;  2AT1 B;  3MP1 A;  2F5K A;  2JTF A;  5DM7 R;  1VQ5 A;  4TVR A;  2DVJ A;  4JLG A;  1YIJ Q;  2DL8 A;  2O88 A;  2RI3 A;  3Q1J A;  5HK0 A;  1QVF S;  2P4T A;  1EIF A;  1YNZ A;  1B34 B;  4PJO C;  4E7I A;  3QZ9 B;  4PJO F;  1U5S A;  3QJY A;  2OAU A;  1N8R C;  1RAA B;  3BE3 A;  2J6K A;  1YBY A;  4BE0 A;  4IUP A;  2YHT A;  2QQR A;  3MEV A;  2V26 A;  1VA7 A;  4N0A A;  2I0N A;  1WQ7 A;  3V8K A;  2RB6 A;  1MMG A;  1KD1 R;  1WQW A;  4IUU A;  2K9G A;  1M3C A;  2GFA A;  1ZUY A;  3EGD A;  4GBQ A;  3PVL A;  4BY6 C;  5A0L A;  3EG1 A;  5CKE A;  3X20 B;  4A4K A;  2M9U A;  4IUR A;  1JB0 E;  4C0D B;  4PJO A;  3DB4 A;  1WLP B;  4PJJ A;  1AWO A;  3L2U A;  4JZ3 A;  4F7U A;  2P84 A;  1XTD A;  2LQN A;  4RTT A;  2RQW A;  3JCM e;  3CCL T;  2KR3 A;  3CEY A;  4D8K A;  2ZGW A;  3GPL A;  2LRQ A;  4R56 A;  1OX8 A;  5DY9 A;  1VQL Q;  5CKH A;  1HYO A;  5KYX B;  1UG1 A;  2LCL A;  4BI3 A;  1YIT Q;  1WZO A;  2EYQ A;  3OY9 A;  2J6O A;  3CMA T;  1NG2 A;  2DD5 A;  5GAN j;  4P5N A;  4LDW A;  5CQY A;  1ABQ A;  3H0H A;  1XQH A;  4RCC A;  2X51 A;  2DL5 A;  4J7I A;  2R57 A;  4IUV A;  3NTI A;  2D0N A;  2RH2 A;  1ABO A;  2JMA A;  1X6O A;  3A8H B;  2CRE A;  3BDU A;  5LJ3 h;  2RPN A;  3OW2 S;  2V1Q A;  5FU6 B;  3L42 A;  1OYX A;  3C95 A;  2QEX Q;  4JRP A;  3OYD A;  1N8R R;  2D8J A;  3V7C A;  4F17 A;  2EGC A;  3CCL A;  1Q7Y C;  4CC4 B;  2LMJ A;  4II1 A;  3MET A;  2YXY A;  5GAM g;  4M7D E;  3AT1 B;  5ECA A;  2DIL A;  2DBM A;  3F70 A;  3RER A;  2YUP A;  2KGT A;  2E6Z A;  3QUI A;  3UT1 A;  4C0Z A;  1VQ9 T;  4J9G A;  3CCR T;  1M1K U;  4DOV A;  1JXM A;  3FC3 A;  1VQO T;  1UHC A;  3JV3 A;  2F1L A;  2VXE A;  1IHW A;  3VUZ A;  1I5L A;  4E47 A;  1G3W A;  4ZNX A;  4EMK A;  1YP5 A;  5FU7 B;  3CMA A;  3H0I A;  3LX7 A;  1VQK T;  3HPW A;  1AHJ B;  4RUG A;  1MND A;  1HD3 A;  4KRT A;  1JJ2 S;  5D6X A;  2KT1 A;  2LZ6 B;  3JRZ A;  3LGL A;  1YIJ T;  2ROT A;  1W2B A;  5LJ5 d;  5DLO A;  2E4H A;  4OMO A;  3T9N A;  1ACM B;  4A4G A;  2COZ A;  5A0D A;  2A28 A;  4KUD K;  3MP6 A;  2CZ6 B;  3PNW C;  1K76 A;  2O01 E;  2EQI A;  2K5L A;  1VQP Q;  2DYB A;  4PLI A;  3QZ5 B;  5I2S A;  4M77 C;  3GLX A;  4M7D B;  1JEG A;  2MWO A;  2EYW A;  3OYY A;  2VB6 A;  2DAQ A;  3C94 A;  1RAH B;  5LJ3 d;  1OOT A;  4QVC A;  1VQO A;  2XU8 A;  2L89 A;  3UAT A;  2FG0 A;  2RHX A;  3FIF A;  4OP0 A;  3CXC P;  4Y91 A;  2RHU A;  2BE7 D;  2BIV A;  1VQK A;  2DF6 A;  4PJL A;  2PVD B;  3J80 E;  3I56 Q;  1WHL A;  1BU1 A;  1YIJ A;  3TU4 K;  1Q7Y R;  2DIG A;  1EFN A;  1Q82 U;  3MEW A;  4IIM A;  3R6N A;  4E7S A;  2F5T X;  5GAN e;  2IVW A;  3M55 A;  5KCH A;  3TRE A;  3M4Y A;  4FSS A;  3CBM A;  4B9X A;  4HVV A;  3EGU A;  3DLM A;  2E3I A;  5I2M A;  2HQX A;  3RIR A;  1NLP C;  1YIT T;  2RI2 A;  1G5V A;  2H8H A;  2LTO A;  5GAO r;  1A0N B;  1C6V X;  2VVK A;  5GAM f;  3OBY A;  1TU0 B;  1N5Z A;  2J7I A;  1UGP B;  1ZUU A;  1Q86 C;  1WJR A;  2CP2 A;  1KIK A;  2BZX A;  2RN8 A;  2QEX T;  1WHM A;  1U3O A;  2KI7 A;  2KQW A;  3CD6 A;  3V7S A;  1WHJ A;  4M7D G;  2MMP A;  4E7J A;  4FT4 A;  2FRY A;  2ZPG B;  1GCQ C;  3QWX X;  3E19 A;  2A37 A;  2GCX A;  3L2W A;  4E7L A;  1MUZ A;  2DBK A;  2DL7 A;  2FHD A;  4QVZ A;  4M78 E;  1YJW Q;  2EPD A;  3A98 A;  3JCM P;  1M2V B;  2GGR A;  1AWX A;  4FW1 A;  2E65 A;  2RA2 A;  1K8A C;  1VQN Q;  4WCI A;  4JPB W;  1GBQ A;  2AK5 A;  2BTT A;  2QA4 Q;  5LJ5 g;  2PUK B;  4A63 B;  4X34 A;  3L2Z A;  3PGG A;  1K0S A;  4MMK A;  3OMG A;  2DVE A;  1Y0M A;  2CP5 A;  3CCM Q;  3BDL A;  4C5G A;  5HK3 A;  1KHC A;  1QVF A;  2FL7 A;  1E6G A;  4BUG A;  3VS2 A;  1K0X A;  2QEX A;  1WHK A;  4PL6 A;  2LNH B;  2QQ9 A;  5CR2 A;  3A5Z B;  2LJ0 A;  3TCJ A;  1VQP T;  5GJV B;  4F7U G;  1WX6 A;  1IRX A;  5CIU A;  1M30 A;  2G6F X;  2QAS A;  5FWC A;  3G4S Q;  3EH1 A;  2QI2 A;  1H64 1;  3NFC A;  4M78 B;  4RKU E;  1B34 A;  1WHH A;  3U23 A;  3UA6 A;  2GQV A;  1B7T A;  1AD5 A;  3LWI A;  1Q86 R;  3VS7 A;  2XID A;  4M7A E;  4ANJ A;  1OI1 A;  1PNJ A;  2MF2 A;  3CBO A;  3WVE B;  5C6S A;  1HJD A;  2A36 A;  3CCQ T;  1YN8 A;  3PFS A;  1FX7 A;  1QMC A;  4FW2 A;  4OVA A;  3VV0 A;  1VQ8 A;  3I56 T;  3ZEH A;  3OYI A;  2RHZ A;  1OEB A;  4M75 E;  1SEM A;  1GCP A;  2O9V A;  1U8R A;  3VS1 A;  1W2B S;  5IHK A;  2CP6 A;  3UWN A;  3GF5 A;  1XNI A;  2LX7 A;  2H3E B;  4DA4 A;  1M3A A;  3M59 A;  2E41 A;  1NYG A;  4HCZ A;  1VQP A;  2DXC A;  2X3W D;  3M4G A;  4O5V A;  2JW4 A;  2D0Q B;  2JZ2 A;  1M8M A;  2FPD A;  3HTR A;  3VU3 C;  1SG5 A;  1K8A R;  1NLO C;  4JUV A;  3O8V A;  5GMK i;  1FMV A;  2KBT A;  4OGE A;  2DZ9 A;  1IGU A;  1PSF A;  3L1A A;  1ZBJ A;  1RAF B;  4JLI A;  1X6B A;  4JJD A;  4JRI A;  1WI7 A;  4M7A B;  1BYM A;  4FT2 A;  1MV0 B;  3CCQ A;  4CC3 A;  5GAN 2;  2KVQ G;  2L0A A;  2EJF A;  1H92 A;  1VIE A;  3I56 A;  1Y07 A;  2DYI A;  4L59 A;  3KFV A;  2COY A;  5KYX A;  4M7D D;  1KC8 C;  1UEB A;  4RTY A;  4M75 B;  3HFO A;  5GAM h;  4QT7 A;  5L8R E;  5LJ5 f;  2P0Q A;  1QVG P;  2IPO B;  2GTO A;  5GJW B;  1ZSG A;  2VGN A;  2ENM A;  2RK2 A;  4M78 G;  2LNV A;  4OMP A;  3HRS A;  1I5O B;  2PQW A;  1S72 Q;  4E7K A;  2QQB A;  5IN1 A;  1V29 B;  4MDW A;  5GMK l;  1KQS P;  1SSH A;  3E9F A;  3ZL7 C;  2RF0 A;  1QP2 A;  2KSS A;  4NS5 A;  4FM4 B;  3TVT A;  2L2P A;  1K4U S;  1YCS B;  1UHF A;  2DL3 A;  2ED0 A;  2RQT A;  5IH2 A;  1VQN T;  2HSE B;  4R0K A;  2H3J A;  4J9I A;  5D6Y A;  4BI8 B;  2NUP B;  4C8Q E;  3JCM Q;  2KDS A;  1GL5 A;  5LJ3 f;  3C4S A;  1D3B B;  2B86 A;  2QA4 T;  2Z0W A;  1ZX6 A;  2NUT B;  3OYM A;  3PIO A;  4BE1 A;  1GBR A;  1Y96 B;  3CCM T;  1JJ2 A;  3CBP A;  3J81 E;  2HMA A;  1M4Z A;  2L3Q A;  2DLP A;  3GOX A;  2J06 A;  1M1K C;  3M0T A;  3CC2 Q;  1K1Z A;  1F1B B;  3DKM A;  4QQG A;  4DEX A;  4M7D F;  1OPL A;  4N4G A;  4CC7 A;  1K9M C;  1PC0 A;  4OF1 A;  2V1R A;  5KYN A;  1VQ7 Q;  3QO3 A;  1IHV A;  1G3T A;  1U06 A;  3KUF A;  3QG1 A;  4B6M A;  4E6R A;  1GFC A;  3NMZ C;  1VUB A;  3H41 A;  2OAW A;  2ZPI B;  4ZN3 A;  3DB3 A;  3QYH B;  2XDB A;  4RTU A;  1NJI U;  1VQN A;  4C8Q B;  5J39 A;  1X43 A;  1Q95 G;  2A7Y A;  2X35 A;  3JB9 H;  4IKF A;  1D1A A;  5GMK m;  3EG3 A;  2QA4 A;  1NM7 A;  1KC8 R;  5CAI A;  4M7D A;  4F14 A;  4HCC A;  2QTX A;  2JT4 A;  4XAX B;  3FLG A;  1M2O A;  2MIO A;  3V8L A;  3QYG B;  1KK7 A;  4QQD A;  2YRV A;  3M0R A;  5C0M A;  2C0O A;  1MV3 A;  1IGQ A;  3JCM g;  3VS3 A;  4F7U F;  1T0H A;  1ZSZ B;  2LQW A;  4HKE A;  2K79 A;  4XU0 A;  5IT9 E;  1QKW A;  2YDL A;  4RMO A;  2V8K A;  1VQ4 Q;  2JXB A;  2RHY A;  1I1J A;  4Q5W A;  2O4X B;  1FXX A;  1ARK A;  3EAE A;  2OTJ Q;  1K73 U;  2VKN A;  4Z88 A;  3FEO A;  2EGA A;  2MCN A;  1N27 A;  4J83 A;  4RG2 A;  5CCA A;  2K3X A;  4ELZ C;  2RO0 A;  5DLQ E;  4XTX A;  2ZPH B;  1K9M R;  4JRQ A;  2LDM A;  4LDY A;  4HVW A;  2E3H A;  1S72 T;  5KCO A;  4N4H A;  3RDV A;  1R0B G;  2Y4Y A;  5LJ5 h;  2QQS A;  3RNJ A;  1HXD A;  1P92 A;  3CCU Q;  2E70 A;  2EFI A;  4J8O A;  1ZHI A;  4J7F A;  3M9Q A;  2KY9 A;  3SD4 A;  1C0M A;  1WJS A;  4J6X A;  2F69 A;  3VS0 A;  2O2O A;  5IHN A;  2NUZ A;  3C12 A;  3C0C A;  1Y57 A;  3REB B;  1LNX A;  2VWF A;  4FU6 A;  1LPL A;  1BI3 A;  5KYW B;  1M2V A;  3GIB A;  3CCV Q;  3CC2 T;  4EMK C;  1OX9 A;  3G71 T;  4ATO A;  2A3L A;  2DZC A;  4ZGJ B;  3QXE B;  4B9W A;  3O5Z A;  2RNA A;  4M78 F;  2W10 A;  4DEY A;  1X6G A;  1TXQ A;  1C1A A;  5GAO q;  1G8X A;  3M0Q A;  4X9C A;  3ZFJ A;  2J05 A;  4CRI A;  1YJ9 Q;  1YHQ Q;  2M0Y A;  2DNU A;  2LP5 A;  4DBF A;  3THK A;  2HQE A;  3TQ7 P;  5GMK h;  2L3R A;  3EG9 B;  7AT1 B;  3X25 B;  4J6Y A;  4JS5 A;  1O75 A;  2K5I A;  1KD1 U;  5L23 A;  1PKS A;  4IUT A;  2JS0 A;  4EMG A;  4M78 A;  1TH7 A;  3VKI A;  3N5B B;  4C0F A;  3CC2 A;  1LCK A;  2SEM A;  4JJB A;  3OS2 A;  2FRW A;  1BIA A;  3EH2 A;  4MML A;  5J3B A;  4D6W A;  4AFZ C;  1ZA2 B;  4OMM A;  3OYE A;  3G71 A;  2GQI A;  4XTY A;  2HNI A;  2XHC A;  2KT8 A;  1D0Y A;  2DJZ A;  2HEQ A;  2KMT A;  4LE9 A;  5FRM A;  4C92 E;  1KQ1 A;  5GAN g;  4DQ2 A;  1AT1 B;  4JRK A;  2RJE A;  1VQ4 T;  1YI2 Q;  1LVK A;  1VQ9 A;  1H8K A;  2ZAE A;  1NBE B;  4XK8 E;  3CCR A;  4ZN1 A;  3MHX A;  2X4W A;  2CUD A;  4PLL A;  2KE9 A;  5I22 A;  4JJN K;  4RTZ A;  2DKG A;  2LVM A;  1VYT A;  2K2V A;  2KK4 A;  2L3P A;  3HFN A;  2OTJ T;  2AKK A;  3HRT A;  3OQ5 A;  1Z9Z A;  3OSV A;  3DLL A;  3KBG A;  1YJN Q;  3NTH A;  2AZS A;  1PKT A;  2KNB B;  3QKJ A;  1NYF A;  3BY7 A;  9ATC B;  4M7A A;  1MGQ A;  3P8D A;  2K2M A;  5CK9 A;  4XU2 A;  4FCY A;  4BAC A;  3OYF A;  4X9D A;  2QG9 B;  2C0I A;  1N8R U;  4NL2 A;  1G3S A;  2KXC A;  4C92 B;  4C5E A;  4M75 A;  1VQL T;  4L5G A;  2KRO A;  1WXT A;  1T0J A;  1JQQ A;  4ZTJ A;  1ZA1 B;  2ROL A;  3ASK A;  3JCM b;  2FO0 A;  1Y71 A;  3H8Z A;  2YLC A;  4KGV B;  1JBM A;  2OTJ A;  4PNO A;  1TUG B;  1OZ2 A;  1BCO A;  1JO8 A;  3OS1 A;  2ATC B;  2R58 A;  4BB7 A;  1UJY A;  1RAB B;  5AT1 B;  1I8F A;  5AYF A;  4KBM B;  4A4E A;  4EMH A;  3CCV T;  3HSB A;  1FWZ A;  1PM3 A;  3HP9 A;  4FYW B;  1YFN A;  4ZTF A;  2DE0 X;  3EG2 A;  2NUP A;  1I81 A;  1QCF A;  3E1S A;  1D3B A;  5KH6 A;  4OGC A;  5LJ3 j;  2SRC A;  2CP3 A;  2NUT A;  3FB9 A;  1UTI A;  2X4X A;  2YUN A;  1UFF A;  3QBY A;  1Y96 A;  1UGS B;  4VUB A;  3LH0 A;  2YT6 A;  3E2U A;  1KQS A;  3S3M A;  4BY6 B;  3EHQ A;  1VQL A;  5CKB A;  1YJ9 T;  2EYZ A;  3PTA A;  1YHQ T;  4ELY C;  2F2V A;  1YIT A;  1RUW A;  1X01 A;  1UE9 A;  4ZGD B;  2QQA A;  1NPR A;  3JB9 I;  4LXC A;  2DXT A;  1JXO A;  2MAM A;  1MMD A;  2CZ1 B;  3M54 A;  2DD4 A;  2LQK A;  3FDR A;  4J9H A;  2V8I A;  1CSK A;  3PT9 A;  2OI3 A;  1M1G A;  2P0K A;  4ORZ A;  2OJ2 A;  5GAN 3;  3JCM h;  3CCV A;  2JMC A;  4K11 A;  1PSE A;  4C8Q A;  2RJF A;  1ZSZ C;  4C92 G;  1JRI A;  2IG0 A;  4LD9 K;  2EJG A;  2L5Q A;  1PG5 B;  4LUE A;  1Q81 C;  2BZ8 A;  3S3O A;  3MCA B;  2RJD A;  1W6X A;  1Q7Y U;  3P8H A;  5CO7 A;  3MJX A;  3QII A;  2D6F A;  3OMC A;  1PRM C;  2DXU A;  1W2B P;  2M1H A;  4DOW A;  3ER0 A;  4NOY A;  1BBZ A;  4HXJ A;  2VAS A;  1YI2 T;  3X24 B;  2D1X A;  1YJ9 A;  4C0D C;  1RAD B;  3CPW P;  5M9O A;  2Y4X A;  1QP3 A;  1WPY A;  3TSW A;  4Z02 A;  5KE3 A;  4E7H A;  2DRK A;  1IO6 A;  2HBW A;  5GAO n;  1BB9 A;  1WIE A;  3BW1 A;  1YJN T;  1B3Q A;  2NYS A;  1ZSZ A;  2KAF A;  3HKS A;  1D09 B;  1ZUK A;  1B07 A;  3VS4 A;  3VS6 A;  3HL8 A;  4PJM A;  3GBQ A;  3MO8 A;  4AFQ C;  4DBR A;  5HCK A;  2XMF A;  2O4X A;  3VYH B;  1M1F A;  4OMN A;  2DJQ A;  4M77 E;  1BI1 A;  5FRN A;  4QKU A;  5D7U A;  1V1C A;  1M3B A;  1YCY A;  3V8J A;  3L2V A;  3AHU A;  1KQ2 A;  2A08 A;  1D1C A;  4J5Y A;  4RTW A;  2EWN A;  3A8G B;  1QVP A;  3NPF A;  5CVI A;  3ULR B;  1YI2 A;  1N9S A;  1D0X A;  1SPK A;  3JCM d;  4XTU A;  4KGZ B;  5FLX E;  2XG8 D;  1TWB A;  5LJ3 e;  1QQJ A;  3VUB A;  1YWP A;  2K3Y A;  2CT3 A;  2QXF A;  5KE2 A;  1U1T A;  3NGP A;  2CP0 A;  5FU6 C;  3HRU A;  5J26 A;  4J9E A;  1YJN A;  2KXD A;  1MHN A;  3NHN A;  1AZE A;  5CQX A;  5FRO A;  3JB9 J;  1NEG A;  3MKD A;  4MZP A;  1OU8 A;  1Q81 R;  1G3Y A;  4YTL A;  2DPP B;  2O9S A;  3RR6 A;  1TUD A;  3RKX A;  4M77 B;  5GAN 4;  4JDS A;  3CC7 Q;  1FMK A;  2ZPB B;  4E7Z A;  1X27 A;  5KYW A;  1N9R A;  5EC7 A;  4WTO B;  1UEC A;  4KT0 E;  5FU7 C;  4MZT A;  1YJW T;  3UF4 A;  3UA7 A;  1ZBX A;  3JSC A;  3M0S A;  2YSQ A;  2JTE A;  3CCE Q;  2CDT A;  3CCS Q;  1TTH B;  4OB2 B;  4EPC A;  1XOV A;  4RCB A;  3CME Q;  3LW5 E;  2RI5 A;  1VIF A;  4BI4 A;  1Q86 U;  3D7S B;  1J3T A;  1V76 A;  2X4Y A;  3CQT A;  4RG8 A;  3RBB B;  4C92 D;  5A2Q E;  1BCM A;  5GAN h;  5I21 A;  2EBP A;  2FPE A;  4HCK A;  4J9D A;  3EG9 A;  4NL3 A;  2DTO A;  4M7D C;  2EQU A;  4FYX B;  2J6F A;  2LQ8 A;  3GNG A;  2OX7 A;  3S3N A;  3G4S T;  1E6H A;  1N6A A;  1SF9 A;  2C06 A;  1QVF P;  4M7A G;  1OQK A;  4C0G A;  2FZG B;  5KYU B;  1KQS S;  2RD1 A;  2RJC A;  1YJW A;  3L2R A;  3PE0 A;  4N4I A;  1OPK A;  1X2Q A;  3OYC A;  4Y92 A;  2QYZ A;  2CKK A;  1RAE B;  4AG2 C;  1K8A U;  4GLM A;  2K4Y A;  1MMA A;  2VC8 A;  2F2X A;  2PU9 B;  3H6Z A;  4M75 G;  2M0O A;  2GF7 A;  4HT8 A;  1NEB A;  2EKH A;  1QWE A;  4M77 G;  1WYX A;  3CCM A;  2EYX A;  1NE8 A;  3I5S A;  2ZCF B;  4FIB A;  4JZ4 A;  1GFD A;  2K5F A;  1VQO Q;  2F2W A;  4HA8 A;  2QDY B;  4QW2 A;  4LDV A;  1WA7 A;  3MEU A;  1BI0 A;  4C92 F;  2E10 A;  4V2S A;  3SWN B;  2W0Z A;  4ME7 A;  4X1V A;  1M90 U;  2VUB A;  2GFU A;  2I2L A;  1I0C A;  1AVZ C;  3G4S A;  2ESW A;  2EQK A;  2XDP A;  4LNP A;  2LT4 A;  1Q82 C;  3SDZ A;  2BZY A;  3VS5 A;  1FYN A;  2AKL A;  3OB9 A;  5GAN d;  4OB1 B;  1H3H A;  2DER A;  3RUX A;  2M51 A;  1M1K R;  1CKA A;  5GAN 7;  1VYU A;  1VQM Q;  3CXC A;  4C92 A;  1RAG B;  4L6V 5;  1KFZ A;  4QQ6 A;  2ED1 A;  3EG0 A;  3QHS A;  3FJ5 A;  2PVG B;  3REA B;  2C0T A;  3UDC A;  3PIP A;  4M78 D;  1Z9Q A;  3I9Q A;  2WSE E;  2CUB A;  1QCN A;  4PJN A;  3RKY A;  8AT1 B;  5GAM j;  3CC7 T;  1D0Z A;  3FJP A;  1RI0 A;  3VRZ A;  1PCX A;  3OW2 P;  4ESR A;  4C8Q G;  3M0U A;  3CC4 Q;  4OB3 B;  4LDU A;  2QGF B;  1SSF A;  2VGM A;  3CCE T;  3LWH A;  1W4S A;  3CCS T;  2DEU A;  3CD6 Q;  1D1B A;  3JCM J;  2DA9 A;  1KJW A;  2KYB A;  3VYG A;  1FMW A;  2CP7 A;  4DBQ A;  3CME T;  2XKO C;  1OZ3 A;  3MPU B;  3OYG A;  2JM9 A;  1IB8 A;  3EFS A;  2B8A A;  2CT4 A;  1PD0 A;  1KC8 U;  2CYZ B;  4A4F A;  2P0P A;  1RL2 A;  4DBH A;  3BFM A;  1UGV A;  1TS9 A;  5IXB A;  4Z8A A;  1JJ2 P;  3CC7 A;  4M78 C;  1WNL A;  4M7A D;  3CCJ Q;  3L2Q A;  2E64 A;  4HVU A;  1M5Q 1;  3I35 A;  4FYY B;  1S72 A;  1ZQ1 A;  1QKX A;  1GRI A;  3J7A F;  1Q82 R;  2FYK A;  3OYN A;  1VQ7 T;  4CC2 A;  1WJQ A;  4OB0 B;  3EFO B;  3LYI A;  5KYY B;  1G2B A;  1T3S A;  4XU1 A;  3P8B B;  4M75 D;  2DK3 A;  3CCE A;  4IUQ A;  3CCS A;  1YWO A;  3JCM f;  1RLQ C;  2E5Q A;  3JCM X;  4M77 D;  3H0F A;  2XK0 A;  3CME A;  2E6N A;  3SHW A;  4M4Z A;  1EZZ B;  2AZV A;  3G6E Q;  1AOJ A;  2ECZ A;  1H3Z A;  3G7Z A;  1QW1 A;  1VOM A;  1IRE B;  2DX1 A;  1VQ6 Q;  3OSS C;  1PD1 A;  4LDX A;  2L3S A;  1KHI A;  1X2K A;  1R77 A;  3A8L B;  4XTV A;  2K6D A;  2NLU A;  2CZ0 B;  2KEA A;  1WGS A;  1VQ8 Q;  2JJ9 A;  3I55 Q;  4XQ3 A;  2A0F B;  1K9M U;  3OYK A;  1VQ7 A;  8ATC B;  4M7A C;  2OTL Q;  1M8V A;  1KSW A;  3KXT A;  4M7A F;  2AHJ B;  2HZY A;  2HKQ B;  2EQJ A;  3CPW A;  4O6J A;  1WFW A;  4HCB A;  4QVD A;  2LT1 A;  3EGX B;  5GAM e;  2JOY A;  4M75 C;  3OYB A;  3X28 B;  1VQM T;  2ZZD A;  4LN2 A;  2L8D A;  5I11 A;  3JCM c;  3SFM A;  4M75 F;  3INZ A;  4PJO E;  3RMQ A;  3A8M B;  3R6O A;  4F7U E;  1JU5 C;  4M77 F;  2FB7 A;  2YUO A;  4PFZ A;  4ZGE B;  3SB2 A;  2DO3 A;  3LGF A;  1UB4 A;  1PRL C;  2HL5 C;  3MEA A;  4XU3 A;  1LOJ A;  2JM8 A;  3RMS A;  1BIB A;  4C8Q D;  2HCK A;  1RI9 A;  2R5M A;  2KYM A;  3CCQ Q;  1RLP C;  4KUI A;  5FW9 A;  4J9C A;  3JB9 G;  2GTJ A;  3I55 T;  2COW A;  3CC4 T;  1DJ7 B;  2HKN A;  2E12 A;  1WHG A;  4KUL A;  1HK9 A;  3CCU T;  1W70 A;  4BD3 A;  3CD6 T;  3UPU A;  2LCC A;  2HDA A;  1CKB A;  5LJ5 j;  1VQ4 A;  2MWP A;  4A54 A;  4M77 A;  2FVU A;  2DEQ A;  3A1P A;  1U1S A;  5CKF A;  2CZ7 B;  4A4H A;  2Y90 A;  2ABL A;  2CH4 A;  3EGD B;  3OYJ A;  2WSC E;  2XIC A;  3OYH A;  2CSQ A;  1VQM A;  3LH5 A;  2QTV A;  2LX9 A;  5A0G A;  6AT1 B;  2CGH A;  2QGG A;  3CXC S;  4PJO B;  2BKD N;  3OA6 A;  1UUE A;  2HQH A;  3SEM A;  2P4R A;  4AMC A;  4F7U B;  2JN0 A;  4AG1 C;  3TEE A;  2X3X D;  3OYA A;  4BE2 A;  1VYV A;  2FEI A;  2EJ9 A;  2FZC B;  5GAN 5;  4CI0 C;  4GLK A;  1QVG A;  3CCJ T;  3IQL A;  1WDX A;  1BKB A;  4KH1 B;  2EW3 A;  2HSP A;  2DMO A;  1OUL A;  4OMQ A;  2MYS A;  3WXM B;  3CC4 A;  3M58 A;  1MNE A;  3A8O B;  4C8Q C;  4UC4 A;  4Z89 A;  3CCU A;  4AFS C;  4C8Q F;  2KRM A;  1O9S A;  4EDU A;  1ZLM A;  3V7R A;  4FYV B;  4KGX B;  3M57 A;  4D8D A;  2IIM A;  1QWF A;  2YUQ A;  3ME9 A;  2DTH A;  5GAN f;  3GNF B;  2DXB A;  3URG A;  5GMK j;  3G6E T;  4RTX A;  2XDD A;  2WSF E;  2D8H A;  1WXU A;  4J9B A;  5KYU A;  3JAM E;  5IAY A;  3SWN C;  3GP8 A;  1VQ6 T;  2XD0 A;  2D9T A;  1NJI C;  1BK2 A;  1SRM A;  1R0C B;  1TUC A;  3S6W A;  3QDF A;  2PZ1 A;  1Y7X A;  2FPF A;  2X4J A;  2DL4 A;  2EAY A;  1VQ8 T;  3CCJ A;  3M56 A;  1UJ0 A;  4KH0 B;  5CKD A; 
#chains in the Genus database with same CATH homology
 1JEG A;  2EYW A;  1XOV A;  2E5K A;  2PTK A;  1SHG A;  4HVW A;  1OOT A;  1HSQ A;  1J3T A;  3UAT A;  3TSZ A;  1GCQ A;  2FG0 A;  4OML A;  1M27 C;  2RQR A;  3CQT A;  3RBB B;  1AWJ A;  2RQV A;  1T3L A;  3RNJ A;  2DF6 A;  2EBP A;  2FPE A;  4HCK A;  4J9D A;  1BU1 A;  4J9F A;  1G83 A;  3PVQ A;  3VS0 A;  2J6F A;  2RQU A;  4RTV A;  2O2O A;  5IHN A;  1EFN A;  3M0P A;  2NUZ A;  3C0C A;  2EGE A;  1Y57 A;  2CSI A;  1E6H A;  2O31 A;  4IIM A;  3R6N A;  3REB B;  2DM1 A;  5FWB A;  2VWF A;  3PE0 A;  1OPK A;  4FSS A;  1X2Q A;  1PHT A;  4Y92 A;  2EVR A;  4AG2 C;  4GLM A;  4HVV A;  3EGU A;  2F2X A;  1NLP C;  2K7A A;  2H8H A;  1NEB A;  2EKH A;  1QWE A;  3O5Z A;  1WYX A;  2GBQ A;  1A0N B;  4EIK A;  2VVK A;  2RNA A;  2EYX A;  1PWT A;  3I5S A;  2W10 A;  4JZ4 A;  2EYY A;  4DEY A;  1GFD A;  1X6G A;  2LJ3 A;  1N5Z A;  2J7I A;  1ZUU A;  2F2W A;  3M0Q A;  2J05 A;  1QLY A;  1WA7 A;  2M0Y A;  2DNU A;  1KIK A;  2LP5 A;  2BZX A;  3THK A;  3QWY A;  2GNC A;  2W0Z A;  2RN8 A;  4X1V A;  1U3O A;  1I0C A;  2DRM A;  1AVZ C;  2ESW A;  1WXB A;  2MOX A;  5L23 A;  1PKS A;  4LNP A;  2JS0 A;  2FRY A;  1TG0 A;  1GCQ C;  2BZY A;  3QWX X;  3VS5 A;  2A37 A;  1FYN A;  2AKL A;  1LCK A;  2SEM A;  1MUZ A;  4JJB A;  1SRL A;  2DBK A;  2DL7 A;  2FRW A;  1H3H A;  2KRN A;  2EPD A;  3A98 A;  4AFZ C;  2M51 A;  2GGR A;  2NWM A;  4OMM A;  1CKA A;  5IHI A;  1VYU A;  2GQI A;  1AWX A;  2JS2 A;  1KFZ A;  2KT8 A;  2ED1 A;  2HEQ A;  3EG0 A;  4WCI A;  4LE9 A;  1OV3 A;  4JPB W;  1GBQ A;  2AK5 A;  2BTT A;  3FJ5 A;  1AWW A;  3REA B;  2C0T A;  4A63 B;  1K0S A;  1Y0M A;  1Z9Q A;  3I9Q A;  2QDL A;  2CUB A;  2LJ1 A;  4JJC A;  5IXF A;  1H8K A;  2CH4 W;  3I5R A;  2CUD A;  2KE9 A;  1E6G A;  3VS2 A;  5I22 A;  1K0X A;  4RTZ A;  3VRZ A;  1VYT A;  4ESR A;  3M0U A;  2LNH B;  1K9A A;  2L3P A;  2AKK A;  2LJ0 A;  1I07 A;  1Z9Z A;  5GJV B;  1WX6 A;  1M30 A;  4AFU C;  2AZS A;  2G6F X;  1PKT A;  2DA9 A;  1KJW A;  2KNB B;  5FWC A;  2KYB A;  1NYF A;  1W1F A;  4IIO A;  1AZG B;  2K3B A;  3VRY A;  2K2M A;  3U23 A;  3UA6 A;  1SHF A;  2JM9 A;  1AD5 A;  1AEY A;  4F16 A;  3VS7 A;  1PNJ A;  2C0I A;  3EHR A;  1UDL A;  2A36 A;  2CT4 A;  1HJD A;  2KRS A;  1YN8 A;  2KXC A;  2RMO A;  2KRO A;  1WXT A;  1T0J A;  1JQQ A;  1OEB A;  1S1N A;  1UGV A;  5IXB A;  2ROL A;  1SEM A;  1GCP A;  4Z8A A;  2O9V A;  4HVU A;  3VS1 A;  5IHK A;  3I35 A;  2FO0 A;  1QKX A;  1GRI A;  2LX7 A;  4CC2 A;  1M3A A;  1JO8 A;  1NYG A;  1G2B A;  1T3S A;  1UJY A;  2X3W D;  2LCS A;  2JW4 A;  1X69 A;  1M8M A;  4LUD A;  1YWO A;  2DE0 X;  2FPD A;  3EG2 A;  1RLQ C;  2PNI A;  1E7O A;  1QCF A;  1NLO C;  3H0F A;  2KBT A;  2SRC A;  3SHW A;  1UTI A;  4M4Z A;  2YUN A;  1ZBJ A;  1UFF A;  2AZV A;  2DVJ A;  1AOJ A;  1X6B A;  4JJD A;  2DL8 A;  2O88 A;  1WI7 A;  2ECZ A;  1YNZ A;  1MV0 B;  4CC3 A;  2YT6 A;  2DX1 A;  2L0A A;  1H92 A;  3EHQ A;  1U5S A;  2EYZ A;  2L3S A;  3KFV A;  1X2K A;  2J6K A;  2F2V A;  2K6D A;  4RTY A;  1RUW A;  1UE9 A;  2KEA A;  1VA7 A;  4QT7 A;  1JXO A;  2I0N A;  2GTO A;  5GJW B;  1ZSG A;  2ENM A;  1KSW A;  2K9G A;  4J9H A;  1CSK A;  1M3C A;  2OI3 A;  4OMP A;  4ORZ A;  2OJ2 A;  1ZUY A;  4GBQ A;  3PVL A;  2JMC A;  3EG1 A;  4K11 A;  1SSH A;  3ZL7 C;  1WFW A;  2RF0 A;  3TVT A;  1K4U S;  2L2P A;  1YCS B;  1UHF A;  2DL3 A;  2ED0 A;  2RQT A;  1WLP B;  5IH2 A;  4LN2 A;  1AWO A;  4LUE A;  4JZ3 A;  4R0K A;  5I11 A;  4J9I A;  2BZ8 A;  1GL5 A;  1W6X A;  2B86 A;  2LQN A;  4RTT A;  1ZX6 A;  2RQW A;  1JU5 C;  1PRM C;  2YUO A;  1GBR A;  1PRL C;  2KR3 A;  1BBZ A;  4HXJ A;  4D8K A;  2L3Q A;  2DLP A;  2J06 A;  2JM8 A;  2D1X A;  2HCK A;  1RI9 A;  2KYM A;  3M0T A;  3TSW A;  1RLP C;  5FW9 A;  2DRK A;  4J9C A;  1K1Z A;  1IO6 A;  2GTJ A;  2HBW A;  1BB9 A;  1UG1 A;  1WIE A;  4DEX A;  1B3Q A;  1W70 A;  1ZUK A;  1B07 A;  3VS4 A;  1OPL A;  3VS6 A;  3GBQ A;  4AFQ C;  2HDA A;  2J6O A;  1CKB A;  4CC7 A;  1NG2 A;  5HCK A;  1ABQ A;  2V1R A;  3H0H A;  2XMF A;  2DL5 A;  1U06 A;  4OMN A;  4E6R A;  2ABL A;  1GFC A;  2DJQ A;  2D0N A;  3NMZ C;  2CH4 A;  3H41 A;  1ABO A;  2JMA A;  2OAW A;  2CSQ A;  2CRE A;  4RTU A;  3LH5 A;  2RPN A;  2V1Q A;  1V1C A;  1M3B A;  1X43 A;  2A08 A;  1UUE A;  3EG3 A;  3SEM A;  2P4R A;  1NM7 A;  2D8J A;  4AG1 C;  4RTW A;  2X3X D;  2EGC A;  4F17 A;  1VYV A;  2FEI A;  3NPF A;  4F14 A;  3ULR B;  4CC4 B;  2LMJ A;  1SPK A;  3IQL A;  1WDX A;  2JT4 A;  2EW3 A;  2HSP A;  5ECA A;  2DIL A;  2DBM A;  2DMO A;  1YWP A;  2MIO A;  2CT3 A;  2KGT A;  2YUP A;  4OMQ A;  4J9G A;  3NGP A;  1JXM A;  1UHC A;  3JV3 A;  4J9E A;  4Z89 A;  2KXD A;  4AFS C;  2KRM A;  3M0R A;  2C0O A;  1MV3 A;  3NHN A;  1ZLM A;  1AZE A;  4ZNX A;  1YP5 A;  3VS3 A;  3H0I A;  1T0H A;  1NEG A;  4D8D A;  2LQW A;  2IIM A;  2K79 A;  1QWF A;  4RUG A;  2YUQ A;  1HD3 A;  2O9S A;  4KRT A;  1TUD A;  2KT1 A;  1QKW A;  2YDL A;  2LZ6 B;  2JXB A;  1I1J A;  4RTX A;  2ROT A;  2D8H A;  1WXU A;  4J9B A;  1ARK A;  1FMK A;  4OMO A;  1X27 A;  2A28 A;  5EC7 A;  1K76 A;  1BK2 A;  2VKN A;  1UEC A;  1SRM A;  4Z88 A;  1TUC A;  2EQI A;  3UF4 A;  3UA7 A;  2EGA A;  2MCN A;  3M0S A;  2DYB A;  2PZ1 A;  2YSQ A;  2FPF A;  2JTE A;  2DL4 A;  2CDT A;  1UJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...