2MOXA

Solution structure of tandem sh3 domain of sorbin and sh3 domain-containing protein 1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
143
structure length
143
Chain Sequence
QHMSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIFPRTYIELLPPAEKAQPKKLTPVQVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVIKRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Sorbin and SH3 domain-containing protein 1
publication title Structural investigation of the interaction between the tandem SH3 domains of c-Cbl-associated protein and vinculin
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2014-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2moxA02
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2moxA01
3R6NA 2A36A 2JT4A 4OMOA 4DEXA 2D1XA 1GCQC 4DEYA 1FYNA 1WLPB 2BZ8A 1TG0A 1GCPA 1UTIA 3RBBB 2O88A 2G6FX 4OMLA 2MIOA 1X2QA 2DL5A 3H0IA 4OMMA 1K76A 4X1VA 2W10A 3CQTA 2YUQA 2DL8A 2O9VA 5FWCA 1UECA 4WCIA 2CSQA 4OMPA 1WX6A 1OOTA 1N5ZA 3UA7A 2O31A 2GBQA 1W70A 2D8JA 1K4US 1SHGA 2DLPA 4F17A 1E7OA 2EVRA 1NEBA 1UGVA 2KBTA 4RTYA 3NMZC 1JXOA 2O2OA 1IO6A 4J9FA 1Y57A 1S1NA 4J9BA 3VRYA 1NLPC 2PNIA 2ECZA 4CC2A 2AKKA 2FEIA 1PRLC 1OPLA 2L2PA 1GBQA 2HCKA 2RQTA 4RTXA 2JW4A 2MCNA 1BBZA 2PTKA 2L3PA 1ZLMA 5IH2A 1X27A 4GLMA 2H8HA 1JEGA 3I5RA 3FJ5A 1QWFA 1W1FA 1Z9QA 2EPDA 2K3BA 2ABLA 4OMQA 3TSWA 3U23A 1ZBJA 5I22A 3NHNA 1ZX6A 2RMOA 2ESWA 2OAWA 1GFCA 2KE9A 1PRMC 2KT1A 1ZUKA 2EYXA 2IIMA 2YDLA 4HCKA 1TUDA 2CREA 1ZUUA 1GBRA 1KJWA 4R0KA 2J05A 2KRMA 2DBMA 3VRZA 1QKWA 2EKHA 1T3LA 2GQIA 2RQRA 1J3TA 1UDLA 2AKLA 1HSQA 1WI7A 2LJ0A 4J9GA 2ROTA 2L3QA 2J06A 3RNJA 4JJDA 1BB9A 3REAB 1U3OA 1RLQC 1PNJA 2LQNA 2ED1A 2KGTA 4J9CA 1WXUA 1CKBA 2GNCA 2AZSA 2L0AA 1PKSA 4KRTA 4J9EA 4RUGA 4J9HA 2CT3A 2JMAA 1BK2A 2C0IA 1UJYA 2EYYA 4F14A 1SEMA 1X69A 4JJBA 2K9GA 2DRMA 2CT4A 4Z88A 2HSPA 1LCKA 3VS7A 2FPFA 1GFDA 4Z89A 2EBPA 2LZ6B 1H3HA 1TUCA 5IHNA 3UATA 5ECAA 2BZYA 3VS6A 4F16A 1OV3A 2RNAA 2CDTA 4RTUA 1VYVA 3KFVA 2E5KA 1CKAA 2FRYA 4CC7A 1YP5A 1SSHA 2DM1A 4CC3A 1UG1A 2V1QA 3THKA 2LCSA 1UFFA 3PVQA 4K11A 2KXDA 3SEMA 1K0XA 1UE9A 2DF6A 2M51A 3GBQA 2SEMA 1MV3A 5L23A 2DE0X 1ZSGA 4OMNA 2KYBA 2KRNA 2J6OA 4D8KA 2LX7A 4HXJA 1M27C 3EGUA 4Y92A 2KROA 1E6HA 2YT6A 4IIMA 1V1CA 2GTOA 1UUEA 3A98A 3EG1A 1RI9A 5IXFA 1AEYA 1ABOA 1T0JA 1B07A 1QCFA 1NYFA 2J6FA 5GJWB 2F2VA 1JO8A 2DL4A 1SHFA 1WXTA 5GJVB 4J9DA 2A28A 3PE0A 5IXBA 1SRLA 2DNUA 2X3WD 2X3XD 3H0HA 2M0YA 2K6DA 4AFSC 1YNZA 2DJQA 2W0ZA 2RQWA 4LUDA 4ORZA 3NGPA 1GRIA 1WFWA 2SRCA 2YUOA 4JZ3A 2KRSA 3M0PA 5HCKA 3I9QA 3TVTA 2LJ1A 1A0NB 1RLPC 4HVVA 1AWXA 2FPEA 2I0NA 3IQLA 1WYXA 4A63B 2ED0A 2HBWA 2VVKA 1H8KA 5I11A 2B86A 4LN2A 1NLOC 3H41A 3ZL7C 1ARKA 4HVWA 1W6XA 4JPBW 1M8MA 1T3SA 1X6BA 3M0QA 2JM8A 1YWPA 1AWJA 2DMOA 2QDLA 2RN8A 2KR3A 2JM9A 3EHQA 2DL7A 1XOVA 1E6GA 2EGAA 2NUZA 1GL5A 1AOJA 3VS0A 2F2XA 1M3BA 3EG3A 2EGEA 2O9SA 1AWOA 3VS2A 1FMKA 1U06A 2KXCA 3M0UA 4AFQC 4LE9A 1ABQA 4J9IA 1H92A 3QWXX 2DBKA 2HEQA 1KSWA 2RPNA 2DL3A 4ESRA 1YN8A 2BTTA 1KFZA 1NEGA 2MOXA 1PKTA 2HDAA 2DX1A 2K7AA 1JU5C 2JXBA 2V1RA 2YSQA 2XMFA 4CC4B 4IIOA 2LJ3A 2CH4W 1UJ0A 3M0TA 2EYWA 4FSSA 1CSKA 1QLYA 1X6GA 2YUPA 1QWEA 2CUDA 1K0SA 2CH4A 4QT7A 1HJDA 1AZGB 1YWOA 1SRMA 3TSZA 2JS2A 1AZEA 2EGCA 1I0CA 2P4RA 1G83A 2K79A 1M30A 4D8DA 1OEBA 3UA6A 3JV3A 2DILA 2GGRA 2L3SA 4LUEA 1M3AA 3NPFA 2LP5A 2LNHB 2LMJA 1PWTA 3I35A 1SPKA 1K1ZA 2NWMA 4EIKA 2ENMA 3M0RA 1JXMA 2BZXA 4HVUA 1WXBA 1X2KA 2OI3A 4Z8AA 2DVJA 2KNBB 3I5SA 5IHKA 1MUZA 1OPKA 2EQIA 4RTTA 1X43A 1WIEA 5FWBA 3REBB 3PVLA 4RTVA 2C0OA 3EG0A 1KIKA 3VS1A 2LQWA 1K9AA 2EW3A 1T0HA 2FPDA 2ROLA 1RUWA 2DA9A 2JS0A 1NYGA 4RTWA 2KT8A 1NG2A 3C0CA 3EG2A 3VS5A 2EYZA 1VYTA 2VKNA 3UF4A 1NM7A 2RF0A 3ULRB 2KEAA 2PZ1A 3QWYA 4ZNXA 2JMCA 2GTJA 2VWFA 3LH5A 2J7IA 2AK5A 3EHRA 1GCQA 1M3CA 1Z9ZA 2F2WA 2RQVA 3SHWA 4AG1C 1QKXA 1VA7A 2KYMA 1VYUA 2JTEA 1B3QA 2RQUA 4JZ4A 1UHFA 2D8HA 2CSIA 1Y0MA 1PHTA 4GBQA 4RTZA 1G2BA 1JQQA 2CUBA 1I07A 2FG0A 4AG2C 2FRWA 4E6RA 2FO0A 2YUNA 1BU1A 1YCSB 1EFNA 4JJCA 2D0NA 4LNPA 3VS4A 1AD5A 1UHCA 5IHIA 2AZVA 1I1JA 2A37A 2C0TA 5EC7A 4M4ZA 1WDXA 1AWWA 1ZUYA 2OJ2A 2A08A 4AFUC 3VS3A 4AFZC 1HD3A 1MV0B 5FW9A 3H0FA 3M0SA 1U5SA 1WA7A 2J6KA 1AVZC 3O5ZA 2K2MA 2DRKA 2DYBA
chains in the Genus database with same CATH superfamily
2A36A 4NL2A 2D1XA 3S3OA 1GCQC 1WPYA 2A7YA 4MMKA 2ZPIB 2LT4A 2H3JA 1RAHB 1X2QA 3HPWA 5C6SA 2DL5A 3H0IA 4OMMA 2BIVA 4X1VA 1OZ3A 3QHSA 4M77G 1YJNA 3CQTA 2YUQA 1GXIE 4C5GA 4C92B 2IVWA 3S3NA 3JRZA 1WJQA 3C95A 1OOTA 2E64A 2QA4Q 3CCRT 4A54A 1KQSP 4A4KA 1K4US 4C92D 1HYOA 1SHGA 5A0DA 2DLPA 4N4IA 4RTYA 4JUVA 3V8LA 1NE8A 4J9FA 2K4YA 1HXDA 2JJ9A 1NLPC 4XQ3A 4BB7A 2X4XA 3MKDA 4CC2A 2AKKA 1DJ7B 2DEQA 2JNGA 1OPLA 4E7KA 7AT1B 2DZ9A 5IH2A 1WHLA 3CXCA 1X27A 3OW2S 2EAYA 1Z9QA 3URGA 2XU8A 2ABLA 3QKJA 3CCVT 4OMQA 3TSWA 4ZGJB 3NHNA 3RKYA 4XTWA 1QVFA 1UGSB 3LWIA 1VQMT 4M75E 4BE1A 2MMPA 2P0PA 1PRMC 1S72Q 2EYXA 2YDLA 4M7AD 1TUDA 1RAFB 4J6YA 2CREA 1G3SA 1ZUUA 2J05A 1G8XA 3JCMg 2RQRA 5KYUB 1FX7A 4PJOF 1UDLA 4JRIA 4IUUA 2EJFA 1PM3A 1XTDA 2V8IA 5A2QE 1Q86C 1OZ2A 4M7DB 4J9GA 2ROTA 1VQOA 1BB9A 3REAB 2EQMA 3PGGA 5LJ5j 4M7DD 1EX4A 1QP2A 4C8QC 2XK0A 4IKFA 3CMET 3NTIA 5KYWB 2QASA 3ASKA 3L1AA 2GNCA 2XI9A 4HKEA 3GNGA 1BKBA 1Q81C 1BK2A 2C0IA 2EYYA 2QEXT 1VQLT 1N6AA 2VGNA 3S3MA 4JS4A 3EG9A 1LCKA 4OMFB 3DB3A 1GFDA 4Z89A 3P8DA 1H3HA 3UATA 5ECAA 2RJFA 3X26B 2BZYA 4ELZC 2KK4A 4J5YA 1BYMA 1LNXA 2FRYA 5I2SA 1SSHA 2QK0A 1UG1A 4N0AC 5GAN7 5GAOm 1M1KR 1YJWA 3SEMA 2ATCB 1C6VX 3F70A 1X75C 2DE0X 1YJ9A 2V8KA 3JCMQ 3L2UA 4OMNA 2YRVA 4XU2A 2J6OA 2LX7A 2CP7A 3CC4Q 4HXJA 5CQYA 2X51A 4DQ2A 3OYJA 4C92A 1OU9A 1OX9A 2KROA 3MPUB 4XU1A 2QGFB 2YT6A 4IIMA 5IXFA 3LYIA 1ABOA 2ZCFB 1PSFA 3CCLT 1NBEB 1B07A 5LJ5e 3G6ET 1N8RR 1QCFA 1VQ9A 4M78F 2DL4A 1TH7A 3TU4K 3PNWC 1WHMA 2Z0WA 1PC0A 5GANh 1SRLA 2DNUA 2K6DA 2QG9B 3CEYA 2OX7A 3NGPA 4RCCA 1GRIA 3CD6T 3FDRA 4ZGDB 2KRSA 3CBMA 4FL6A 3I9QA 1ZSZC 5D6YA 1A0NB 3MP6A 3I55A 5LJ3d 5GAMe 2FPEA 4M7AA 4M75B 3I56A 1M1KU 2LNVA 2FB7A 5I11A 2B86A 5GANf 3PIOA 1W2BP 1PD0A 1YITA 3CCJT 1YJNT 1BI1A 4LN2A 1NLOC 3H41A 4HVWA 2YLCA 4JPBW 1X6BA 3OYMA 3M0QA 5KYUA 3CPFA 1YWPA 1AWJA 4M77D 5IN1A 2C06A 2DL7A 2EGAA 4M7DA 1GL5A 1AOJA 5CVIA 4EPCA 3VKIA 5CAIA 2F2XA 1N8RU 2E10A 2O9SA 1FMKA 1U06A 4LE9A 3MP1A 4XU3A 3CPWA 3G71A 4BI3A 1H92A 3JCMP 2ZAEA 3HRUA 2HEQA 3JCMc 4BUGA 3N5BB 2DL3A 3CC2Q 5KYXB 3CCUA 1KD1R 1KFZA 4QVDA 2MI6A 2JXBA 2YSQA 1UB4A 3NTKA 4IIOA 2CH4W 2X35A 3A8HB 3OBYA 2G3RA 2EYWA 2DVEA 4UC4A 4PJOG 1X6GA 2VXEA 2WACA 4EDUA 2YUPA 2HD0A 1QWEA 3HFNA 4OP0A 2CH4A 2JZ2A 3OYEA 1M2VB 1YWOA 4JS5A 5CKEA 2OTLQ 1KQSA 4LDWA 5A0GA 3GIBA 1VQKQ 2LQKA 2EGCA 1I0CA 4F7UF 2P4RA 1G83A 2K79A 1KC8C 1M30A 1MMDA 2E6NA 4FT2A 3JV3A 2DILA 1U1TA 1AT1B 4LUEA 3KBGA 3NPFA 2YWWA 3HRTA 4LDUA 2LP5A 3CCET 5FU7C 2LMJA 1SPKA 1NJIC 2NWMA 1RACB 4MZMA 4EIKA 3CCQT 4BY6C 2COZA 3JCMV 2BZXA 2CZ0B 2OI3A 4C8QF 1YIJA 1KK7A 3I5SA 4FYVB 3RKXA 2RI2A 2DK3A 3LWHA 3FJPA 4C0FA 1VQ4T 1OPKA 4RTTA 1R0CB 1KD1U 1WIEA 3REBB 3ZEHA 4RTVA 1KIKA 3X28B 4MDWA 2RD1A 2D6FA 2LQWA 3M4YA 1BCOA 2EW3A 4HT9A 2FPDA 2CS7A 1RUWA 4J83A 2DA9A 2JS0A 2KT8A 4KULA 3UF4A 3KUFA 1M8VA 2RF0A 1YHQQ 3V8JA 2EIFA 3WVDB 4L5GA 3LH5A 2J7IA 3EHRA 4R55A 1OYXA 2RQVA 3META 4AG1C 4M77A 5GANg 2XD0A 1KQ2A 1UHFA 2D8HA 5FU6B 2CSIA 4M78G 4GBQA 1UGQB 2R58A 2ZPGB 1JB0E 1I07A 5GAMd 3VS4A 1AD5A 1UHCA 2MK5A 3GLXA 3P8HA 2JTFA 2QQAA 4J8OA 2L89A 2OJ2A 1XNIA 2A08A 3VS3A 1K8AC 4VUBA 2VASA 1MV0B 1YI2Q 5GAN2 4IUQA 1U5SA 2NLUA 3OW2P 1IHWA 2VGMA 2DRKA 1OULA 5KYXA 2JT4A 3CCMQ 1NPPA 1ZQ1A 1FYNA 4LD9K 2PQWA 3TREA 2BZ8A 1GCPA 4LD6A 4E7HA 1UTIA 3RBBB 1JJ2S 2G6FX 4C92E 2FYKA 3QJYA 1K76A 2W10A 1RAEB 1Q7YR 4WCIA 5GMKh 3L2QA 3EFSA 3CC7Q 2K3XA 1WX6A 3MEWA 4V2SA 1QVGS 4PL6A 2Y4XA 4QKUA 2PU9B 2EVRA 2KBTA 2E1HA 2PVGB 3DB4A 3OSSC 3V7SA 2EJGA 4Y91A 2M0OA 1S72A 3QIIA 5GAOn 3JAME 2K3YA 9ATCB 2PNIA 4ZTJA 3GPLA 1PRLC 4EMGA 1GBQA 5EG2A 8ATCB 3SWNA 1EIFA 1OI1A 2PTKA 4OGEA 1EZZB 4GLMA 3CMAQ 5KCHA 1W1FA 3GF5A 1W4SA 3UWNA 3RERA 1PSEA 3QUIA 1ZHIA 2RMOA 2DAQA 1TSFA 2ESWA 1VQ7T 1MNEA 3RR6A 1WQWA 2KE9A 1ZUKA 3OQ5A 1W2BA 1ZA2B 2DIGA 4D6WA 1QW1A 5KE2A 5HKCA 3DLLA 2NUTA 3GOXA 1GBRA 2CZ6B 3VRZA 5GAOr 1Q82C 4M7DE 3HHTB 1QKWA 1T3LA 1Q7YU 3QO3A 4F7UG 5LJ3j 3M53A 4PJOD 4MZPA 2AKLA 4C5HA 1HSQA 3GP8A 2RHXA 2FZGB 2LJ0A 3OYAA 3QSUA 2L3QA 4DBQA 5FROA 4E7IA 1ZA1B 1U3OA 1RAIB 1RLQC 1PNJA 3OA6A 2ED1A 2KGTA 4J9CA 2DERA 3EG9B 4X9CA 2RJCA 1VQPT 1IZ6A 4C8QG 4RUGA 2D0QB 2JOYA 4ELYC 3JB9J 1I5LA 3FIFA 4F14A 2QTVA 1SEMA 1X69A 2K9GA 1RABB 2DRMA 2PUKB 4N4HA 2CT4A 3CC4A 3VS7A 5HK0A 4HT8A 3X24B 1FWZA 3V7RA 1C0MA 1Q95G 2LZ6B 5IHNA 4BD3A 4XTYA 4RTUA 1CKAA 4PJJA 3CCRQ 1VQNA 5GMKm 1YP5A 2DM1A 2XG8D 3THKA 4AMCA 1QVFS 4K11A 2E65A 2KXDA 3M57A 2GFUA 5GAOl 4A4EA 2DO3A 2DD4A 3X20B 2SEMA 1MV3A 5L23A 5LL6S 2YRDA 1ZSGA 2DTIA 2KYBA 3T9NA 4D8KA 4PJLA 2ZGWA 5FRMA 5LJ3e 3G7ZA 4Y92A 3C12A 3Q1JA 3M5AA 1QQJA 3NFCA 1M1FA 5GAN3 1RI9A 1R8OB 4M78B 1IXDA 3SDZA 3CCST 3JCMd 3CCVQ 1XQHA 2HNIA 3M9QA 4XTZA 4J6XA 3BW1A 4M78D 2A3LA 4PNOA 1VQMQ 3M58A 2EQJA 4EMKB 4QVZA 3UPUA 2X3XD 1BIAA 2BE7D 2W0ZA 4LUDA 1UEBA 2WSFE 4ORZA 4M7AB 1WFWA 3ZFJA 4RMOA 2YUOA 4BDYA 2RHZA 5CCAA 2DD5A 2LJ1A 4QVCA 3VYGA 4HVVA 2QYZA 1AWXA 3J81E 1WYXA 4A63B 2ED0A 1G3TA 2HBWA 2LCLA 4M77E 1WHHA 3CMEQ 3AHUA 3ZL7C 4PJOA 1Y96A 1KHCA 1R0BG 3CC2A 2QEXQ 1IB8A 2LCCA 1VQLQ 1LPLA 4PKCC 2QDLA 2JM9A 3EHQA 1TS9A 1XOVA 1E6GA 3JB9H 5D6XA 1M3BA 1KG1A 1QCNA 3LH0A 2CP2A 4A4FA 1AWOA 2MAMA 1B7TA 1VQ6T 3M0UA 2OTLA 2MWPA 2LC4A 4C0DB 3QWXX 2L5QA 3OW2A 1VQKA 5GAMj 2K5FA 1Y71A 4PLLA 4ESRA 3EGXB 1PKTA 3M54A 2HZYA 4AT1B 5CK9A 2XMFA 4M75C 4N4GA 2AT1B 2JUFA 3VYHB 3A1PA 2LJ3A 4BI8B 2HAXA 1ZBXA 3CCLQ 1IGUA 2XICA 1SG5A 1BI2A 3G6EQ 1YCYA 2CUDA 1H3ZA 3VV0A 2VUBA 1RI0A 4F7UB 1Q86R 2R5AA 3JCMb 3S6WA 3UA6A 3CD6Q 3ER0A 5KH6A 4E7ZA 1Q81R 4M78A 1YHQA 2MPXC 1ACMB 2O4XB 3I35A 3JSCA 3DLMA 4C8QB 1K1ZA 5FRNA 4FCYA 4DOVA 4FW1A 3HP9A 1FMVA 1RADB 4Z8AA 3L2ZA 4C8QD 4OB2B 4EMKA 4LXCA 3G4SA 1HK9A 3OYIA 3CPWS 2QAZA 3CCJQ 4FYYB 1MUZA 4C5IA 4OVAA 3EG0A 3ME9A 1K9AA 1VQNT 4J7IA 4OB1B 2ROLA 4QQGA 2EYZA 1VYTA 1AHJB 4M77B 2PZ1A 3QWYA 2XDDA 5GMKi 2AHJB 4DBFA 2AK5A 5LJ5h 1GCQA 1Q86U 3E1SA 4FSXA 3JCMX 4IUTA 1QKXA 1YI2A 3HSBA 1VA7A 2KYMA 3CBPA 1IREB 1VYUA 2RQUA 1KQSS 2LDMA 4JRPA 4IURA 3CCMA 1Y0MA 1IHVA 3MEUA 2F5TX 4RTZA 1G2BA 3PTAA 2FG0A 4KGXB 2FHDA 1Q81U 1VQ5Q 2FRWA 4E6RA 4JJCA 2D0NA 2FZKB 3EFOA 1WNLA 4LNPA 2EQUA 5LJ5f 5CR2A 5IT9E 2OTJA 1I1JA 2A37A 2C0TA 3PFSA 2YRCA 1WDXA 3CC7A 1QCOA 3EAEA 2XDPA 5DLOA 4BDZA 1VQ8Q 3HL8A 3M55A 5FW9A 4KH0B 1WZOA 4HCBA 3M0SA 2L8DA 3HTRA 2J6KA 3O5ZA 2EJ9A 3OYGA 3RMQA 4DEXA 4OB3B 1WLPB 2DETA 3EGXA 5AYFA 2RK1A 1TG0A 3TEEA 2O88A 1ZSZB 2WSCE 3OYYA 2EKOA 2MIOA 1K73C 2EQKA 2P0KA 1G3WA 2DL8A 3CCEQ 1UECA 2HMAA 3MP8A 3CMAA 4OMPA 1VQOT 1N5ZA 1PD1A 3UA7A 3CCQQ 2L3RA 2D8JA 4F7UA 1M90C 5GAOq 1NEBA 1UGVA 1VQ4Q 3SWNB 1N9RA 1S1NA 1K9MC 4J9BA 4E7JA 4E47A 2QGGA 4EMHA 3L2WA 2ECZA 1Y7XA 5GAN4 2L2PA 1NZ9A 2DKGA 5GANd 2HCKA 2VYTA 2O4XA 4C8QA 2L3PA 1ZLMA 4IUVA 3M56A 3RMSA 2H8HA 2DJZA 1QWFA 5KYYB 5I22A 2NUTB 1ZX6A 3HFOA 2FL7A 3MO8A 2I2LA 4PJOE 1YJWT 1G5VA 4NS5A 1GFCA 2KT1A 5CIUA 4PFPA 4HCKA 1YJ9T 5CO7A 2KQWA 2HKNA 1D0XA 1KJWA 1X6OA 5KYNA 1U1SA 2KRMA 2DBMA 1J3TA 2JN0A 4DOWA 2MYSA 2F1LA 4JLIA 4M75F 1I5OB 4N0AA 5KE3A 2VV5A 4CI0C 1KC8R 2J06A 3LLRA 5L8RE 3RNJA 2H3EB 3CCRA 1VQ9T 2LQNA 5D7UA 3BFMA 1CKBA 3OYDA 2KDSA 1WHGA 4E7SA 2DEUA 1NJIR 4J6WA 4J9EA 4J9HA 2CT3A 3QJ6A 2JMAA 2M02A 1UJYA 2E4HA 2QA4A 3EGDB 4JJBA 3QG1A 2MWOA 2GQVA 4Z88A 2HSPA 3G4ST 1RL2A 3JCMe 3I55T 5LJ5g 4A4HA 2CZ7B 3DKMA 4FT4A 1D0ZA 4O5VA 2JVVA 3I56T 4F16A 2RNAA 1VYVA 3KFVA 3CCVA 3A8GB 1YITT 3MCAB 1UFFA 1X01A 1VQMA 4C0ZA 1K0XA 1UE9A 3OYLA 3GBQA 5GAN8 1W2BS 3MEVA 1H641 1ZSZA 3PMIA 4P5NA 4OB0B 4Q5WA 2KRNA 3JB9F 1I8FA 3EGUA 4M78E 1KC8U 1D1AA 1E6HA 2GTOA 1D3BA 1UUEA 4RKUE 3EG1A 4PFOA 4PJMA 2PVOB 2KI7A 2CKKA 1NJIU 5GJWB 2F2VA 4RG2A 4FU6A 1SHFA 3G71T 1WXTA 2P0QA 2OTJT 2QQBA 1MGQA 1VQ7Q 1FXXA 4M7AE 3LX7A 1XJWB 2RHUA 4F04B 5I21A 2A0FB 1UGRB 5CQXA 3CCUT 3H0HA 2M0YA 4NOYA 1FMWA 1YNZA 2DJQA 2QEXA 1VQLA 2SRCA 2AIRB 3FRNA 4BI4A 4JZ3A 4XTVA 3M0PA 4JDSA 5HCKA 2EFIA 4RCBA 5KYYA 1V76A 2P4TA 2I0NA 3IQLA 2LQ8A 4PJOB 1Y96B 2RHYA 2E6ZA 4B6MA 1H8KA 4C92C 3LGFA 3UDCA 2NYSA 4LDYA 2BKDN 3A8LB 3FLGA 1ARKA 1VQPQ 2X9HA 4B9WA 1T3SA 4Z02A 4MDXA 3LW5E 2JM8A 3L2VA 2DPPB 1TUGB 4DBRA 1RAAB 2RN8A 2QDYB 2ZPFB 1D09B 2NUZA 3INZA 4ATOA 3VS0A 4X34A 4XTXA 1C1AA 2EGEA 1WJSA 2E12A 3CCLA 3VS2A 4EMKC 2KXCA 3TQ7P 3OS2A 3G6EA 2HL5C 3SFMA 1YIJT 4AFQC 5CKFA 2E41A 2HQEA 1ABQA 4J9IA 4M7AC 2DBKA 3EGDA 5CKHA 3VUBA 1KSWA 3CXCS 1KHIA 2JTMA 1YN8A 2VB6A 2BTTA 2MOXA 2HDAA 3FC3A 2DX1A 3BY7A 2K7AA 2IPOB 1JU5C 3CD6A 1IRXA 3SD4A 2HKQB 3BDLA 4CC4B 4II1A 3SB2A 3M0TA 3RESA 2HBPA 4F7UE 1UGPB 1Q82R 4FSSA 1CSKA 2GF7A 4M75G 3CCSQ 3LGLA 1TOVA 4C0GA 5CKDA 1K0SA 4M7DC 1AZGB 4MZTA 3CCJA 1M5Q1 2M16A 4PLIA 3TSZA 4E2FB 4ZGEB 2JS2A 1AZEA 2LT1A 1B34A 2KVQG 4D8DA 1TXQA 1OEBA 3EFRA 5C0MA 1WHKA 3O8VA 4HCCA 4C8QE 1WQ7A 4KH1B 5FLXE 1M3AA 4IUPA 3QDRB 2LNHB 1QVPA 3PMTA 2QA4T 2ENMA 3M0RA 1OX8A 1JXMA 4C0DC 3V8KA 3QZ9B 2E5QA 1BIBA 2KNBB 5IHKA 4JJNK 1SF9A 3OB9A 2EQIA 4OF1A 5FWBA 3PVLA 2C0OA 4KUDK 4KGZB 3X25B 5GANj 1JBMA 1T0HA 2GCXA 2NUPA 1VQ5A 5LJ3h 5GAN6 4RTWA 4JLGA 1NG2A 3C0CA 3VS5A 3J7AF 2VKNA 1NM7A 1Q82U 3JB9G 3JCMJ 1VIEA 4C5EA 5DM7R 3ULRB 5J39A 1M1KC 4XK8E 4ZNXA 2VWFA 3CBOA 1M3CA 2F2WA 2GFAA 1VQ8A 1VQ6Q 3JB9I 1LJOA 4KGVB 4ZTFA 2ZPEB 2JTEA 3E9GA 1B3QA 3EFOB 1S72T 3OBWA 5KCOA 5LJ3f 1M1GA 4RG8A 1PHTA 2FVUA 1WHJA 1JQQA 2CUBA 3HKSA 2FZCB 2FO0A 2YUNA 3TCJA 1BU1A 2EWNA 2QQRA 1N8RC 5IHIA 2AZVA 3CCEA 1VUBA 4M4ZA 1M2OA 1PG5B 3EH2A 1AWWA 1O75A 3CCQA 1JRIA 2PVDB 2K2MA 2EYQA 2K2VA 1M4ZA 3R6NA 3RUXA 1VQ4A 4OMOA 4DEYA 5GANe 3QBYA 8AT1B 4M77C 2B8AA 3OYFA 2CP5A 4OMLA 3R6OA 2Y90A 2M9UA 3QPHA 6AT1B 2O9VA 5FWCA 2DTOA 2M1HA 2CSQA 2YXYA 2O31A 2GBQA 1W70A 4C92F 4F17A 1E7OA 2KAFA 4KT0E 2X4JA 3D7SB 3NMZC 1JXOA 2O2OA 1IO6A 1Y57A 3OS0A 4XAXB 5GAN5 3VRYA 1YBYA 2DXTA 1SSFA 1VQNQ 3CC4T 2RM4A 2FEIA 2RQTA 4RTXA 2E70A 2JW4A 1YJNQ 2KY9A 2MCNA 1BBZA 3C94A 2CP3A 2DXUA 4L6V5 1JEGA 3WXMB 3I5RA 2WSEE 3FJ5A 2EPDA 2K3BA 1F1BB 3U23A 1ZBJA 2HL3A 1VIFA 1KD1C 2OAWA 2RA2A 1WJRA 1JJ2P 2CGHA 4M7AF 2IIMA 1MMAA 3P8BB 4R0KA 2EKHA 2GQIA 5D6WA 4M75D 5IAYA 1WI7A 2DXBA 2RB6A 3UT1A 4WTOB 1O9SA 1QVGP 4KBMB 3HRSA 4JJDA 2K5IA 3E2UA 3QDFA 1TTHB 3SWNC 4M7DF 1WXUA 1BI0A 5M9OA 3ZBDA 3H8ZA 2AZSA 4NL3A 2L0AA 5GAMh 4GY5A 1PKSA 4KRTA 1I81A 2CYZB 5LJ3g 3V7CA 1QP3A 3QXEB 4PFZA 5KYWA 1MHNA 1KQ1A 4LDVA 2FPFA 3QZ5B 2IG0A 2EBPA 2ZPBB 1TUCA 4TVRA 3OMCA 3OYNA 3VS6A 1OV3A 1VQOQ 2CDTA 2E5KA 5GAMf 1VQ5T 2PUOB 3E9FA 4CC7A 4CC3A 2V1QA 1G3YA 4FM4B 2LCSA 2DYBA 2QQ9A 1VQ7A 2DF6A 3A8MB 2M51A 1QMCA 2DZCA 3AT1B 1MMNA 1D3BB 3CC2T 3OYHA 5J26A 1D1CA 3JB9D 1VQ8T 4BE2A 5FU6C 1M27C 2HSEB 3FEOA 4JRQA 2MF2A 2X4WA 1V1CA 4LDXA 2V8JA 3A98A 2R5MA 2RJDA 4J7FA 1AEYA 2E3HA 1T0JA 5GMKj 1NYFA 3L42A 2J6FA 5CKBA 5HY6A 1JO8A 1P92A 2VC8A 2OTLT 5I2MA 4BACA 4FYXB 1YJWQ 2LRQA 3A5ZB 2BE9B 5GJVB 2K5LA 2COWA 4J9DA 1VQKT 2A28A 5DY9A 3PE0A 5IXBA 1VQPA 1YJ9Q 4A53A 2X3WD 3M4GA 2RI3A 4AFSC 2DTHA 2BUDA 2RI5A 2RQWA 4FIBA 1OU8A 1N9SA 3CXCP 4MMLA 4DBHA 1U8RA 4L59A 3TVTA 4XTUA 1RLPC 4ANJA 1QVFP 1BCMA 2VVKA 1K73R 1VQ9Q 1IGQA 3OYCA 5LJ5d 1PCXA 2P84A 1MMGA 4C92G 4M75A 4X9DA 3L2RA 3VU3C 1W6XA 1M8MA 1LOJA 1Q7YC 1D1BA 1YFNA 2RHIA 1M90R 4M77F 2DMOA 3OMGA 2KR3A 3VUZA 3E19A 2HQHA 3G4SQ 1WGSA 1K9MR 1YHQT 4CRIA 4R56A 5HK3A 3OS1A 3OY9A 3I55Q 3EG3A 1Y07A 5GMKe 4KUIA 3I56Q 3QYGB 1I4K1 2YLBA 4JRKA 3CCSA 2YHTA 5FU7B 2KSSA 5J3BA 4QQDA 1YITQ 2QXFA 2CZ1B 3RIRA 3FB9A 4BY6B 2D9TA 4A4GA 3OYKA 3OS5A 2RPNA 4GLKA 2QQSA 3MJXA 3MEAA 1D0YA 4DA4A 1NEGA 3VJPA 4M7AG 5GMKl 2E3IA 2V1RA 4PJOC 2K57A 4OGCA 2XIDA 3H9NA 3BDUA 1UJ0A 1K73U 1MNDA 1LVKA 1QLYA 4PJNA 2RO0A 3RDVA 1YI2T 2HQXA 1HJDA 4QT7A 2OAUA 5GAMg 1B34B 2QTXA 3G71Q 1SRMA 2OTJQ 1M90U 3CCMT 4M7DG 4ZN3A 3BE3A 1R77A 2DFUA 4B9XA 3CCUQ 4BE0A 1K9MU 1M2VA 4E7LA 3EH1A 1BI3A 2GGRA 2KMTA 2L3SA 3CMEA 3JCMh 2DXCA 4YTLA 1PWTA 1K8AR 3CC7T 2F5KA 4Y28E 4ZN1A 2RJEA 2LVMA 5GAOp 4HVUA 1WXBA 1VQ6A 1X2KA 2RK2A 2DVJA 3H6ZA 2NUPB 3M59A 3PIPA 2DIQA 4FYWB 3G1JA 5DLQE 4QQ6A 1X43A 5A0LA 3RKWA 2R57A 4HA8A 3VS1A 3JCMf 1JJ2A 3MHXA 1SKUB 4XU0A 1NYGA 3NTHA 3EG2A 2LX9A 3WVEB 1V29B 3PT9A 2KEAA 2V26A 1M9SA 3CMAT 2JMCA 2GTJA 3OSVA 2XDBA 1Z9ZA 3GNFB 2XHCA 1QVGA 3SHWA 4M78C 2DYIA 1YIJQ 2XKOC 2CP0A 2LTOA 4JZ4A 5AT1B 2ZZDA 4FW2A 3KXTA 2VXFA 3QYHB 1RAGB 3C4SA 2F69A 4QW2A 4AG2C 1YCSB 2RH2A 1EFNA 4ME7A 1K8AU 2Y4YA 3JCMW 5EC7A 2COYA 1OQKA 1VOMA 1ZUYA 1TU0B 1N27A 1NPRA 3A8OB 2ZPHB 4AFUC 3CPWP 4AFZC 1TWBA 1HD3A 2QI2A 2X4YA 4WF2A 4O6JA 3H0FA 3J80E 1WA7A 2CP6A 3OYBA 4PK4A 1AVZC 2O01E 4HCZA 3PVQA
chains in the Genus database with same CATH topology
3R6NA 2A36A 2JT4A 4OMOA 4DEXA 2D1XA 1GCQC 4DEYA 1FYNA 1WLPB 2BZ8A 1TG0A 1GCPA 1UTIA 3RBBB 2O88A 2G6FX 4OMLA 2MIOA 1X2QA 2DL5A 3H0IA 4OMMA 1K76A 4X1VA 2W10A 3CQTA 2YUQA 2DL8A 2O9VA 5FWCA 1UECA 4WCIA 2CSQA 4OMPA 1WX6A 1OOTA 1N5ZA 3UA7A 2O31A 2GBQA 1W70A 2D8JA 1K4US 1SHGA 2DLPA 4F17A 1E7OA 2EVRA 1NEBA 1UGVA 2KBTA 4RTYA 3NMZC 1JXOA 2O2OA 1IO6A 4J9FA 1Y57A 1S1NA 4J9BA 3VRYA 1NLPC 2PNIA 2ECZA 4CC2A 2AKKA 2FEIA 1PRLC 1OPLA 2L2PA 1GBQA 2HCKA 2RQTA 4RTXA 2JW4A 2MCNA 1BBZA 2PTKA 2L3PA 1ZLMA 5IH2A 1X27A 4GLMA 2H8HA 1JEGA 3I5RA 3FJ5A 1QWFA 1W1FA 1Z9QA 2EPDA 2K3BA 2ABLA 4OMQA 3TSWA 3U23A 1ZBJA 5I22A 3NHNA 1ZX6A 2RMOA 2ESWA 2OAWA 1GFCA 2KE9A 1PRMC 2KT1A 1ZUKA 2EYXA 2IIMA 2YDLA 4HCKA 1TUDA 2CREA 1ZUUA 1GBRA 1KJWA 4R0KA 2J05A 2KRMA 2DBMA 3VRZA 1QKWA 2EKHA 1T3LA 2GQIA 2RQRA 1J3TA 1UDLA 2AKLA 1HSQA 1WI7A 2LJ0A 4J9GA 2ROTA 2L3QA 2J06A 3RNJA 4JJDA 1BB9A 3REAB 1U3OA 1RLQC 1PNJA 2LQNA 2ED1A 2KGTA 4J9CA 1WXUA 1CKBA 2GNCA 2AZSA 2L0AA 1PKSA 4KRTA 4J9EA 4RUGA 4J9HA 2CT3A 2JMAA 1BK2A 2C0IA 1UJYA 2EYYA 4F14A 1SEMA 1X69A 4JJBA 2K9GA 2DRMA 2CT4A 4Z88A 2HSPA 1LCKA 3VS7A 2FPFA 1GFDA 4Z89A 2EBPA 2LZ6B 1H3HA 1TUCA 5IHNA 3UATA 5ECAA 2BZYA 3VS6A 4F16A 1OV3A 2RNAA 2CDTA 4RTUA 1VYVA 3KFVA 2E5KA 1CKAA 2FRYA 4CC7A 1YP5A 1SSHA 2DM1A 4CC3A 1UG1A 2V1QA 3THKA 2LCSA 1UFFA 3PVQA 4K11A 2KXDA 3SEMA 1K0XA 1UE9A 2DF6A 2M51A 3GBQA 2SEMA 1MV3A 5L23A 2DE0X 1ZSGA 4OMNA 2KYBA 2KRNA 2J6OA 4D8KA 2LX7A 4HXJA 1M27C 3EGUA 4Y92A 2KROA 1E6HA 2YT6A 4IIMA 1V1CA 2GTOA 1UUEA 3A98A 3EG1A 1RI9A 5IXFA 1AEYA 1ABOA 1T0JA 1B07A 1QCFA 1NYFA 2J6FA 5GJWB 2F2VA 1JO8A 2DL4A 1SHFA 1WXTA 5GJVB 4J9DA 2A28A 3PE0A 5IXBA 1SRLA 2DNUA 2X3WD 2X3XD 3H0HA 2M0YA 2K6DA 4AFSC 1YNZA 2DJQA 2W0ZA 2RQWA 4LUDA 4ORZA 3NGPA 1GRIA 1WFWA 2SRCA 2YUOA 4JZ3A 2KRSA 3M0PA 5HCKA 3I9QA 3TVTA 2LJ1A 1A0NB 1RLPC 4HVVA 1AWXA 2FPEA 2I0NA 3IQLA 1WYXA 4A63B 2ED0A 2HBWA 2VVKA 1H8KA 5I11A 2B86A 4LN2A 1NLOC 3H41A 3ZL7C 1ARKA 4HVWA 1W6XA 4JPBW 1M8MA 1T3SA 1X6BA 3M0QA 2JM8A 1YWPA 1AWJA 2DMOA 2QDLA 2RN8A 2KR3A 2JM9A 3EHQA 2DL7A 1XOVA 1E6GA 2EGAA 2NUZA 1GL5A 1AOJA 3VS0A 2F2XA 1M3BA 3EG3A 2EGEA 2O9SA 1AWOA 3VS2A 1FMKA 1U06A 2KXCA 3M0UA 4AFQC 4LE9A 1ABQA 4J9IA 1H92A 3QWXX 2DBKA 2HEQA 1KSWA 2RPNA 2DL3A 4ESRA 1YN8A 2BTTA 1KFZA 1NEGA 2MOXA 1PKTA 2HDAA 2DX1A 2K7AA 1JU5C 2JXBA 2V1RA 2YSQA 2XMFA 4CC4B 4IIOA 2LJ3A 2CH4W 1UJ0A 3M0TA 2EYWA 4FSSA 1CSKA 1QLYA 1X6GA 2YUPA 1QWEA 2CUDA 1K0SA 2CH4A 4QT7A 1HJDA 1AZGB 1YWOA 1SRMA 3TSZA 2JS2A 1AZEA 2EGCA 1I0CA 2P4RA 1G83A 2K79A 1M30A 4D8DA 1OEBA 3UA6A 3JV3A 2DILA 2GGRA 2L3SA 4LUEA 1M3AA 3NPFA 2LP5A 2LNHB 2LMJA 1PWTA 3I35A 1SPKA 1K1ZA 2NWMA 4EIKA 2ENMA 3M0RA 1JXMA 2BZXA 4HVUA 1WXBA 1X2KA 2OI3A 4Z8AA 2DVJA 2KNBB 3I5SA 5IHKA 1MUZA 1OPKA 2EQIA 4RTTA 1X43A 1WIEA 5FWBA 3REBB 3PVLA 4RTVA 2C0OA 3EG0A 1KIKA 3VS1A 2LQWA 1K9AA 2EW3A 1T0HA 2FPDA 2ROLA 1RUWA 2DA9A 2JS0A 1NYGA 4RTWA 2KT8A 1NG2A 3C0CA 3EG2A 3VS5A 2EYZA 1VYTA 2VKNA 3UF4A 1NM7A 2RF0A 3ULRB 2KEAA 2PZ1A 3QWYA 4ZNXA 2JMCA 2GTJA 2VWFA 3LH5A 2J7IA 2AK5A 3EHRA 1GCQA 1M3CA 1Z9ZA 2F2WA 2RQVA 3SHWA 4AG1C 1QKXA 1VA7A 2KYMA 1VYUA 2JTEA 1B3QA 2RQUA 4JZ4A 1UHFA 2D8HA 2CSIA 1Y0MA 1PHTA 4GBQA 4RTZA 1G2BA 1JQQA 2CUBA 1I07A 2FG0A 4AG2C 2FRWA 4E6RA 2FO0A 2YUNA 1BU1A 1YCSB 1EFNA 4JJCA 2D0NA 4LNPA 3VS4A 1AD5A 1UHCA 5IHIA 2AZVA 1I1JA 2A37A 2C0TA 5EC7A 4M4ZA 1WDXA 1AWWA 1ZUYA 2OJ2A 2A08A 4AFUC 3VS3A 4AFZC 1HD3A 1MV0B 5FW9A 3H0FA 3M0SA 1U5SA 1WA7A 2J6KA 1AVZC 3O5ZA 2K2MA 2DRKA 2DYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R6N A;  2A36 A;  2JT4 A;  4OMO A;  4DEX A;  2D1X A;  1GCQ C;  4DEY A;  1FYN A;  1WLP B;  2BZ8 A;  1TG0 A;  1GCP A;  1UTI A;  3RBB B;  2O88 A;  2G6F X;  4OML A;  2MIO A;  1X2Q A;  2DL5 A;  3H0I A;  4OMM A;  1K76 A;  4X1V A;  2W10 A;  3CQT A;  2YUQ A;  2DL8 A;  2O9V A;  5FWC A;  1UEC A;  4WCI A;  2CSQ A;  4OMP A;  1WX6 A;  1OOT A;  1N5Z A;  3UA7 A;  2O31 A;  2GBQ A;  1W70 A;  2D8J A;  1K4U S;  1SHG A;  2DLP A;  4F17 A;  1E7O A;  2EVR A;  1NEB A;  1UGV A;  2KBT A;  4RTY A;  3NMZ C;  1JXO A;  2O2O A;  1IO6 A;  4J9F A;  1Y57 A;  1S1N A;  4J9B A;  3VRY A;  1NLP C;  2PNI A;  2ECZ A;  4CC2 A;  2AKK A;  2FEI A;  1PRL C;  1OPL A;  2L2P A;  1GBQ A;  2HCK A;  2RQT A;  4RTX A;  2JW4 A;  2MCN A;  1BBZ A;  2PTK A;  2L3P A;  1ZLM A;  5IH2 A;  1X27 A;  4GLM A;  2H8H A;  1JEG A;  3I5R A;  3FJ5 A;  1QWF A;  1W1F A;  1Z9Q A;  2EPD A;  2K3B A;  2ABL A;  4OMQ A;  3TSW A;  3U23 A;  1ZBJ A;  5I22 A;  3NHN A;  1ZX6 A;  2RMO A;  2ESW A;  2OAW A;  1GFC A;  2KE9 A;  1PRM C;  2KT1 A;  1ZUK A;  2EYX A;  2IIM A;  2YDL A;  4HCK A;  1TUD A;  2CRE A;  1ZUU A;  1GBR A;  1KJW A;  4R0K A;  2J05 A;  2KRM A;  2DBM A;  3VRZ A;  1QKW A;  2EKH A;  1T3L A;  2GQI A;  2RQR A;  1J3T A;  1UDL A;  2AKL A;  1HSQ A;  1WI7 A;  2LJ0 A;  4J9G A;  2ROT A;  2L3Q A;  2J06 A;  3RNJ A;  4JJD A;  1BB9 A;  3REA B;  1U3O A;  1RLQ C;  1PNJ A;  2LQN A;  2ED1 A;  2KGT A;  4J9C A;  1WXU A;  1CKB A;  2GNC A;  2AZS A;  2L0A A;  1PKS A;  4KRT A;  4J9E A;  4RUG A;  4J9H A;  2CT3 A;  2JMA A;  1BK2 A;  2C0I A;  1UJY A;  2EYY A;  4F14 A;  1SEM A;  1X69 A;  4JJB A;  2K9G A;  2DRM A;  2CT4 A;  4Z88 A;  2HSP A;  1LCK A;  3VS7 A;  2FPF A;  1GFD A;  4Z89 A;  2EBP A;  2LZ6 B;  1H3H A;  1TUC A;  5IHN A;  3UAT A;  5ECA A;  2BZY A;  3VS6 A;  4F16 A;  1OV3 A;  2RNA A;  2CDT A;  4RTU A;  1VYV A;  3KFV A;  2E5K A;  1CKA A;  2FRY A;  4CC7 A;  1YP5 A;  1SSH A;  2DM1 A;  4CC3 A;  1UG1 A;  2V1Q A;  3THK A;  2LCS A;  1UFF A;  3PVQ A;  4K11 A;  2KXD A;  3SEM A;  1K0X A;  1UE9 A;  2DF6 A;  2M51 A;  3GBQ A;  2SEM A;  1MV3 A;  5L23 A;  2DE0 X;  1ZSG A;  4OMN A;  2KYB A;  2KRN A;  2J6O A;  4D8K A;  2LX7 A;  4HXJ A;  1M27 C;  3EGU A;  4Y92 A;  2KRO A;  1E6H A;  2YT6 A;  4IIM A;  1V1C A;  2GTO A;  1UUE A;  3A98 A;  3EG1 A;  1RI9 A;  5IXF A;  1AEY A;  1ABO A;  1T0J A;  1B07 A;  1QCF A;  1NYF A;  2J6F A;  5GJW B;  2F2V A;  1JO8 A;  2DL4 A;  1SHF A;  1WXT A;  5GJV B;  4J9D A;  2A28 A;  3PE0 A;  5IXB A;  1SRL A;  2DNU A;  2X3W D;  2X3X D;  3H0H A;  2M0Y A;  2K6D A;  4AFS C;  1YNZ A;  2DJQ A;  2W0Z A;  2RQW A;  4LUD A;  4ORZ A;  3NGP A;  1GRI A;  1WFW A;  2SRC A;  2YUO A;  4JZ3 A;  2KRS A;  3M0P A;  5HCK A;  3I9Q A;  3TVT A;  2LJ1 A;  1A0N B;  1RLP C;  4HVV A;  1AWX A;  2FPE A;  2I0N A;  3IQL A;  1WYX A;  4A63 B;  2ED0 A;  2HBW A;  2VVK A;  1H8K A;  5I11 A;  2B86 A;  4LN2 A;  1NLO C;  3H41 A;  3ZL7 C;  1ARK A;  4HVW A;  1W6X A;  4JPB W;  1M8M A;  1T3S A;  1X6B A;  3M0Q A;  2JM8 A;  1YWP A;  1AWJ A;  2DMO A;  2QDL A;  2RN8 A;  2KR3 A;  2JM9 A;  3EHQ A;  2DL7 A;  1XOV A;  1E6G A;  2EGA A;  2NUZ A;  1GL5 A;  1AOJ A;  3VS0 A;  2F2X A;  1M3B A;  3EG3 A;  2EGE A;  2O9S A;  1AWO A;  3VS2 A;  1FMK A;  1U06 A;  2KXC A;  3M0U A;  4AFQ C;  4LE9 A;  1ABQ A;  4J9I A;  1H92 A;  3QWX X;  2DBK A;  2HEQ A;  1KSW A;  2RPN A;  2DL3 A;  4ESR A;  1YN8 A;  2BTT A;  1KFZ A;  1NEG A;  2MOX A;  1PKT A;  2HDA A;  2DX1 A;  2K7A A;  1JU5 C;  2JXB A;  2V1R A;  2YSQ A;  2XMF A;  4CC4 B;  4IIO A;  2LJ3 A;  2CH4 W;  1UJ0 A;  3M0T A;  2EYW A;  4FSS A;  1CSK A;  1QLY A;  1X6G A;  2YUP A;  1QWE A;  2CUD A;  1K0S A;  2CH4 A;  4QT7 A;  1HJD A;  1AZG B;  1YWO A;  1SRM A;  3TSZ A;  2JS2 A;  1AZE A;  2EGC A;  1I0C A;  2P4R A;  1G83 A;  2K79 A;  1M30 A;  4D8D A;  1OEB A;  3UA6 A;  3JV3 A;  2DIL A;  2GGR A;  2L3S A;  4LUE A;  1M3A A;  3NPF A;  2LP5 A;  2LNH B;  2LMJ A;  1PWT A;  3I35 A;  1SPK A;  1K1Z A;  2NWM A;  4EIK A;  2ENM A;  3M0R A;  1JXM A;  2BZX A;  4HVU A;  1WXB A;  1X2K A;  2OI3 A;  4Z8A A;  2DVJ A;  2KNB B;  3I5S A;  5IHK A;  1MUZ A;  1OPK A;  2EQI A;  4RTT A;  1X43 A;  1WIE A;  5FWB A;  3REB B;  3PVL A;  4RTV A;  2C0O A;  3EG0 A;  1KIK A;  3VS1 A;  2LQW A;  1K9A A;  2EW3 A;  1T0H A;  2FPD A;  2ROL A;  1RUW A;  2DA9 A;  2JS0 A;  1NYG A;  4RTW A;  2KT8 A;  1NG2 A;  3C0C A;  3EG2 A;  3VS5 A;  2EYZ A;  1VYT A;  2VKN A;  3UF4 A;  1NM7 A;  2RF0 A;  3ULR B;  2KEA A;  2PZ1 A;  3QWY A;  4ZNX A;  2JMC A;  2GTJ A;  2VWF A;  3LH5 A;  2J7I A;  2AK5 A;  3EHR A;  1GCQ A;  1M3C A;  1Z9Z A;  2F2W A;  2RQV A;  3SHW A;  4AG1 C;  1QKX A;  1VA7 A;  2KYM A;  1VYU A;  2JTE A;  1B3Q A;  2RQU A;  4JZ4 A;  1UHF A;  2D8H A;  2CSI A;  1Y0M A;  1PHT A;  4GBQ A;  4RTZ A;  1G2B A;  1JQQ A;  2CUB A;  1I07 A;  2FG0 A;  4AG2 C;  2FRW A;  4E6R A;  2FO0 A;  2YUN A;  1BU1 A;  1YCS B;  1EFN A;  4JJC A;  2D0N A;  4LNP A;  3VS4 A;  1AD5 A;  1UHC A;  5IHI A;  2AZV A;  1I1J A;  2A37 A;  2C0T A;  5EC7 A;  4M4Z A;  1WDX A;  1AWW A;  1ZUY A;  2OJ2 A;  2A08 A;  4AFU C;  3VS3 A;  4AFZ C;  1HD3 A;  1MV0 B;  5FW9 A;  3H0F A;  3M0S A;  1U5S A;  1WA7 A;  2J6K A;  1AVZ C;  3O5Z A;  2K2M A;  2DRK A;  2DYB A; 
#chains in the Genus database with same CATH topology
 2A36 A;  4NL2 A;  2D1X A;  3S3O A;  1GCQ C;  1WPY A;  2A7Y A;  4MMK A;  2ZPI B;  2LT4 A;  2H3J A;  1RAH B;  1X2Q A;  3HPW A;  5C6S A;  2DL5 A;  3H0I A;  4OMM A;  2BIV A;  4X1V A;  1OZ3 A;  3QHS A;  4M77 G;  1YJN A;  3CQT A;  2YUQ A;  1GXI E;  4C5G A;  4C92 B;  2IVW A;  3S3N A;  3JRZ A;  1WJQ A;  3C95 A;  1OOT A;  2E64 A;  2QA4 Q;  3CCR T;  4A54 A;  1KQS P;  4A4K A;  1K4U S;  4C92 D;  1HYO A;  1SHG A;  5A0D A;  2DLP A;  4N4I A;  4RTY A;  4JUV A;  3V8L A;  1NE8 A;  4J9F A;  2K4Y A;  1HXD A;  2JJ9 A;  1NLP C;  4XQ3 A;  4BB7 A;  2X4X A;  3MKD A;  4CC2 A;  2AKK A;  1DJ7 B;  2DEQ A;  2JNG A;  1OPL A;  4E7K A;  7AT1 B;  2DZ9 A;  5IH2 A;  1WHL A;  3CXC A;  1X27 A;  3OW2 S;  2EAY A;  1Z9Q A;  3URG A;  2XU8 A;  2ABL A;  3QKJ A;  3CCV T;  4OMQ A;  3TSW A;  4ZGJ B;  3NHN A;  3RKY A;  4XTW A;  1QVF A;  1UGS B;  3LWI A;  1VQM T;  4M75 E;  4BE1 A;  2MMP A;  2P0P A;  1PRM C;  1S72 Q;  2EYX A;  2YDL A;  4M7A D;  1TUD A;  1RAF B;  4J6Y A;  2CRE A;  1G3S A;  1ZUU A;  2J05 A;  1G8X A;  3JCM g;  2RQR A;  5KYU B;  1FX7 A;  4PJO F;  1UDL A;  4JRI A;  4IUU A;  2EJF A;  1PM3 A;  1XTD A;  2V8I A;  5A2Q E;  1Q86 C;  1OZ2 A;  4M7D B;  4J9G A;  2ROT A;  1VQO A;  1BB9 A;  3REA B;  2EQM A;  3PGG A;  5LJ5 j;  4M7D D;  1EX4 A;  1QP2 A;  4C8Q C;  2XK0 A;  4IKF A;  3CME T;  3NTI A;  5KYW B;  2QAS A;  3ASK A;  3L1A A;  2GNC A;  2XI9 A;  4HKE A;  3GNG A;  1BKB A;  1Q81 C;  1BK2 A;  2C0I A;  2EYY A;  2QEX T;  1VQL T;  1N6A A;  2VGN A;  3S3M A;  4JS4 A;  3EG9 A;  1LCK A;  4OMF B;  3DB3 A;  1GFD A;  4Z89 A;  3P8D A;  1H3H A;  3UAT A;  5ECA A;  2RJF A;  3X26 B;  2BZY A;  4ELZ C;  2KK4 A;  4J5Y A;  1BYM A;  1LNX A;  2FRY A;  5I2S A;  1SSH A;  2QK0 A;  1UG1 A;  4N0A C;  5GAN 7;  5GAO m;  1M1K R;  1YJW A;  3SEM A;  2ATC B;  1C6V X;  3F70 A;  1X75 C;  2DE0 X;  1YJ9 A;  2V8K A;  3JCM Q;  3L2U A;  4OMN A;  2YRV A;  4XU2 A;  2J6O A;  2LX7 A;  2CP7 A;  3CC4 Q;  4HXJ A;  5CQY A;  2X51 A;  4DQ2 A;  3OYJ A;  4C92 A;  1OU9 A;  1OX9 A;  2KRO A;  3MPU B;  4XU1 A;  2QGF B;  2YT6 A;  4IIM A;  5IXF A;  3LYI A;  1ABO A;  2ZCF B;  1PSF A;  3CCL T;  1NBE B;  1B07 A;  5LJ5 e;  3G6E T;  1N8R R;  1QCF A;  1VQ9 A;  4M78 F;  2DL4 A;  1TH7 A;  3TU4 K;  3PNW C;  1WHM A;  2Z0W A;  1PC0 A;  5GAN h;  1SRL A;  2DNU A;  2K6D A;  2QG9 B;  3CEY A;  2OX7 A;  3NGP A;  4RCC A;  1GRI A;  3CD6 T;  3FDR A;  4ZGD B;  2KRS A;  3CBM A;  4FL6 A;  3I9Q A;  1ZSZ C;  5D6Y A;  1A0N B;  3MP6 A;  3I55 A;  5LJ3 d;  5GAM e;  2FPE A;  4M7A A;  4M75 B;  3I56 A;  1M1K U;  2LNV A;  2FB7 A;  5I11 A;  2B86 A;  5GAN f;  3PIO A;  1W2B P;  1PD0 A;  1YIT A;  3CCJ T;  1YJN T;  1BI1 A;  4LN2 A;  1NLO C;  3H41 A;  4HVW A;  2YLC A;  4JPB W;  1X6B A;  3OYM A;  3M0Q A;  5KYU A;  3CPF A;  1YWP A;  1AWJ A;  4M77 D;  5IN1 A;  2C06 A;  2DL7 A;  2EGA A;  4M7D A;  1GL5 A;  1AOJ A;  5CVI A;  4EPC A;  3VKI A;  5CAI A;  2F2X A;  1N8R U;  2E10 A;  2O9S A;  1FMK A;  1U06 A;  4LE9 A;  3MP1 A;  4XU3 A;  3CPW A;  3G71 A;  4BI3 A;  1H92 A;  3JCM P;  2ZAE A;  3HRU A;  2HEQ A;  3JCM c;  4BUG A;  3N5B B;  2DL3 A;  3CC2 Q;  5KYX B;  3CCU A;  1KD1 R;  1KFZ A;  4QVD A;  2MI6 A;  2JXB A;  2YSQ A;  1UB4 A;  3NTK A;  4IIO A;  2CH4 W;  2X35 A;  3A8H B;  3OBY A;  2G3R A;  2EYW A;  2DVE A;  4UC4 A;  4PJO G;  1X6G A;  2VXE A;  2WAC A;  4EDU A;  2YUP A;  2HD0 A;  1QWE A;  3HFN A;  4OP0 A;  2CH4 A;  2JZ2 A;  3OYE A;  1M2V B;  1YWO A;  4JS5 A;  5CKE A;  2OTL Q;  1KQS A;  4LDW A;  5A0G A;  3GIB A;  1VQK Q;  2LQK A;  2EGC A;  1I0C A;  4F7U F;  2P4R A;  1G83 A;  2K79 A;  1KC8 C;  1M30 A;  1MMD A;  2E6N A;  4FT2 A;  3JV3 A;  2DIL A;  1U1T A;  1AT1 B;  4LUE A;  3KBG A;  3NPF A;  2YWW A;  3HRT A;  4LDU A;  2LP5 A;  3CCE T;  5FU7 C;  2LMJ A;  1SPK A;  1NJI C;  2NWM A;  1RAC B;  4MZM A;  4EIK A;  3CCQ T;  4BY6 C;  2COZ A;  3JCM V;  2BZX A;  2CZ0 B;  2OI3 A;  4C8Q F;  1YIJ A;  1KK7 A;  3I5S A;  4FYV B;  3RKX A;  2RI2 A;  2DK3 A;  3LWH A;  3FJP A;  4C0F A;  1VQ4 T;  1OPK A;  4RTT A;  1R0C B;  1KD1 U;  1WIE A;  3REB B;  3ZEH A;  4RTV A;  1KIK A;  3X28 B;  4MDW A;  2RD1 A;  2D6F A;  2LQW A;  3M4Y A;  1BCO A;  2EW3 A;  4HT9 A;  2FPD A;  2CS7 A;  1RUW A;  4J83 A;  2DA9 A;  2JS0 A;  2KT8 A;  4KUL A;  3UF4 A;  3KUF A;  1M8V A;  2RF0 A;  1YHQ Q;  3V8J A;  2EIF A;  3WVD B;  4L5G A;  3LH5 A;  2J7I A;  3EHR A;  4R55 A;  1OYX A;  2RQV A;  3MET A;  4AG1 C;  4M77 A;  5GAN g;  2XD0 A;  1KQ2 A;  1UHF A;  2D8H A;  5FU6 B;  2CSI A;  4M78 G;  4GBQ A;  1UGQ B;  2R58 A;  2ZPG B;  1JB0 E;  1I07 A;  5GAM d;  3VS4 A;  1AD5 A;  1UHC A;  2MK5 A;  3GLX A;  3P8H A;  2JTF A;  2QQA A;  4J8O A;  2L89 A;  2OJ2 A;  1XNI A;  2A08 A;  3VS3 A;  1K8A C;  4VUB A;  2VAS A;  1MV0 B;  1YI2 Q;  5GAN 2;  4IUQ A;  1U5S A;  2NLU A;  3OW2 P;  1IHW A;  2VGM A;  2DRK A;  1OUL A;  5KYX A;  2JT4 A;  3CCM Q;  1NPP A;  1ZQ1 A;  1FYN A;  4LD9 K;  2PQW A;  3TRE A;  2BZ8 A;  1GCP A;  4LD6 A;  4E7H A;  1UTI A;  3RBB B;  1JJ2 S;  2G6F X;  4C92 E;  2FYK A;  3QJY A;  1K76 A;  2W10 A;  1RAE B;  1Q7Y R;  4WCI A;  5GMK h;  3L2Q A;  3EFS A;  3CC7 Q;  2K3X A;  1WX6 A;  3MEW A;  4V2S A;  1QVG S;  4PL6 A;  2Y4X A;  4QKU A;  2PU9 B;  2EVR A;  2KBT A;  2E1H A;  2PVG B;  3DB4 A;  3OSS C;  3V7S A;  2EJG A;  4Y91 A;  2M0O A;  1S72 A;  3QII A;  5GAO n;  3JAM E;  2K3Y A;  9ATC B;  2PNI A;  4ZTJ A;  3GPL A;  1PRL C;  4EMG A;  1GBQ A;  5EG2 A;  8ATC B;  3SWN A;  1EIF A;  1OI1 A;  2PTK A;  4OGE A;  1EZZ B;  4GLM A;  3CMA Q;  5KCH A;  1W1F A;  3GF5 A;  1W4S A;  3UWN A;  3RER A;  1PSE A;  3QUI A;  1ZHI A;  2RMO A;  2DAQ A;  1TSF A;  2ESW A;  1VQ7 T;  1MNE A;  3RR6 A;  1WQW A;  2KE9 A;  1ZUK A;  3OQ5 A;  1W2B A;  1ZA2 B;  2DIG A;  4D6W A;  1QW1 A;  5KE2 A;  5HKC A;  3DLL A;  2NUT A;  3GOX A;  1GBR A;  2CZ6 B;  3VRZ A;  5GAO r;  1Q82 C;  4M7D E;  3HHT B;  1QKW A;  1T3L A;  1Q7Y U;  3QO3 A;  4F7U G;  5LJ3 j;  3M53 A;  4PJO D;  4MZP A;  2AKL A;  4C5H A;  1HSQ A;  3GP8 A;  2RHX A;  2FZG B;  2LJ0 A;  3OYA A;  3QSU A;  2L3Q A;  4DBQ A;  5FRO A;  4E7I A;  1ZA1 B;  1U3O A;  1RAI B;  1RLQ C;  1PNJ A;  3OA6 A;  2ED1 A;  2KGT A;  4J9C A;  2DER A;  3EG9 B;  4X9C A;  2RJC A;  1VQP T;  1IZ6 A;  4C8Q G;  4RUG A;  2D0Q B;  2JOY A;  4ELY C;  3JB9 J;  1I5L A;  3FIF A;  4F14 A;  2QTV A;  1SEM A;  1X69 A;  2K9G A;  1RAB B;  2DRM A;  2PUK B;  4N4H A;  2CT4 A;  3CC4 A;  3VS7 A;  5HK0 A;  4HT8 A;  3X24 B;  1FWZ A;  3V7R A;  1C0M A;  1Q95 G;  2LZ6 B;  5IHN A;  4BD3 A;  4XTY A;  4RTU A;  1CKA A;  4PJJ A;  3CCR Q;  1VQN A;  5GMK m;  1YP5 A;  2DM1 A;  2XG8 D;  3THK A;  4AMC A;  1QVF S;  4K11 A;  2E65 A;  2KXD A;  3M57 A;  2GFU A;  5GAO l;  4A4E A;  2DO3 A;  2DD4 A;  3X20 B;  2SEM A;  1MV3 A;  5L23 A;  5LL6 S;  2YRD A;  1ZSG A;  2DTI A;  2KYB A;  3T9N A;  4D8K A;  4PJL A;  2ZGW A;  5FRM A;  5LJ3 e;  3G7Z A;  4Y92 A;  3C12 A;  3Q1J A;  3M5A A;  1QQJ A;  3NFC A;  1M1F A;  5GAN 3;  1RI9 A;  1R8O B;  4M78 B;  1IXD A;  3SDZ A;  3CCS T;  3JCM d;  3CCV Q;  1XQH A;  2HNI A;  3M9Q A;  4XTZ A;  4J6X A;  3BW1 A;  4M78 D;  2A3L A;  4PNO A;  1VQM Q;  3M58 A;  2EQJ A;  4EMK B;  4QVZ A;  3UPU A;  2X3X D;  1BIA A;  2BE7 D;  2W0Z A;  4LUD A;  1UEB A;  2WSF E;  4ORZ A;  4M7A B;  1WFW A;  3ZFJ A;  4RMO A;  2YUO A;  4BDY A;  2RHZ A;  5CCA A;  2DD5 A;  2LJ1 A;  4QVC A;  3VYG A;  4HVV A;  2QYZ A;  1AWX A;  3J81 E;  1WYX A;  4A63 B;  2ED0 A;  1G3T A;  2HBW A;  2LCL A;  4M77 E;  1WHH A;  3CME Q;  3AHU A;  3ZL7 C;  4PJO A;  1Y96 A;  1KHC A;  1R0B G;  3CC2 A;  2QEX Q;  1IB8 A;  2LCC A;  1VQL Q;  1LPL A;  4PKC C;  2QDL A;  2JM9 A;  3EHQ A;  1TS9 A;  1XOV A;  1E6G A;  3JB9 H;  5D6X A;  1M3B A;  1KG1 A;  1QCN A;  3LH0 A;  2CP2 A;  4A4F A;  1AWO A;  2MAM A;  1B7T A;  1VQ6 T;  3M0U A;  2OTL A;  2MWP A;  2LC4 A;  4C0D B;  3QWX X;  2L5Q A;  3OW2 A;  1VQK A;  5GAM j;  2K5F A;  1Y71 A;  4PLL A;  4ESR A;  3EGX B;  1PKT A;  3M54 A;  2HZY A;  4AT1 B;  5CK9 A;  2XMF A;  4M75 C;  4N4G A;  2AT1 B;  2JUF A;  3VYH B;  3A1P A;  2LJ3 A;  4BI8 B;  2HAX A;  1ZBX A;  3CCL Q;  1IGU A;  2XIC A;  1SG5 A;  1BI2 A;  3G6E Q;  1YCY A;  2CUD A;  1H3Z A;  3VV0 A;  2VUB A;  1RI0 A;  4F7U B;  1Q86 R;  2R5A A;  3JCM b;  3S6W A;  3UA6 A;  3CD6 Q;  3ER0 A;  5KH6 A;  4E7Z A;  1Q81 R;  4M78 A;  1YHQ A;  2MPX C;  1ACM B;  2O4X B;  3I35 A;  3JSC A;  3DLM A;  4C8Q B;  1K1Z A;  5FRN A;  4FCY A;  4DOV A;  4FW1 A;  3HP9 A;  1FMV A;  1RAD B;  4Z8A A;  3L2Z A;  4C8Q D;  4OB2 B;  4EMK A;  4LXC A;  3G4S A;  1HK9 A;  3OYI A;  3CPW S;  2QAZ A;  3CCJ Q;  4FYY B;  1MUZ A;  4C5I A;  4OVA A;  3EG0 A;  3ME9 A;  1K9A A;  1VQN T;  4J7I A;  4OB1 B;  2ROL A;  4QQG A;  2EYZ A;  1VYT A;  1AHJ B;  4M77 B;  2PZ1 A;  3QWY A;  2XDD A;  5GMK i;  2AHJ B;  4DBF A;  2AK5 A;  5LJ5 h;  1GCQ A;  1Q86 U;  3E1S A;  4FSX A;  3JCM X;  4IUT A;  1QKX A;  1YI2 A;  3HSB A;  1VA7 A;  2KYM A;  3CBP A;  1IRE B;  1VYU A;  2RQU A;  1KQS S;  2LDM A;  4JRP A;  4IUR A;  3CCM A;  1Y0M A;  1IHV A;  3MEU A;  2F5T X;  4RTZ A;  1G2B A;  3PTA A;  2FG0 A;  4KGX B;  2FHD A;  1Q81 U;  1VQ5 Q;  2FRW A;  4E6R A;  4JJC A;  2D0N A;  2FZK B;  3EFO A;  1WNL A;  4LNP A;  2EQU A;  5LJ5 f;  5CR2 A;  5IT9 E;  2OTJ A;  1I1J A;  2A37 A;  2C0T A;  3PFS A;  2YRC A;  1WDX A;  3CC7 A;  1QCO A;  3EAE A;  2XDP A;  5DLO A;  4BDZ A;  1VQ8 Q;  3HL8 A;  3M55 A;  5FW9 A;  4KH0 B;  1WZO A;  4HCB A;  3M0S A;  2L8D A;  3HTR A;  2J6K A;  3O5Z A;  2EJ9 A;  3OYG A;  3RMQ A;  4DEX A;  4OB3 B;  1WLP B;  2DET A;  3EGX A;  5AYF A;  2RK1 A;  1TG0 A;  3TEE A;  2O88 A;  1ZSZ B;  2WSC E;  3OYY A;  2EKO A;  2MIO A;  1K73 C;  2EQK A;  2P0K A;  1G3W A;  2DL8 A;  3CCE Q;  1UEC A;  2HMA A;  3MP8 A;  3CMA A;  4OMP A;  1VQO T;  1N5Z A;  1PD1 A;  3UA7 A;  3CCQ Q;  2L3R A;  2D8J A;  4F7U A;  1M90 C;  5GAO q;  1NEB A;  1UGV A;  1VQ4 Q;  3SWN B;  1N9R A;  1S1N A;  1K9M C;  4J9B A;  4E7J A;  4E47 A;  2QGG A;  4EMH A;  3L2W A;  2ECZ A;  1Y7X A;  5GAN 4;  2L2P A;  1NZ9 A;  2DKG A;  5GAN d;  2HCK A;  2VYT A;  2O4X A;  4C8Q A;  2L3P A;  1ZLM A;  4IUV A;  3M56 A;  3RMS A;  2H8H A;  2DJZ A;  1QWF A;  5KYY B;  5I22 A;  2NUT B;  1ZX6 A;  3HFO A;  2FL7 A;  3MO8 A;  2I2L A;  4PJO E;  1YJW T;  1G5V A;  4NS5 A;  1GFC A;  2KT1 A;  5CIU A;  4PFP A;  4HCK A;  1YJ9 T;  5CO7 A;  2KQW A;  2HKN A;  1D0X A;  1KJW A;  1X6O A;  5KYN A;  1U1S A;  2KRM A;  2DBM A;  1J3T A;  2JN0 A;  4DOW A;  2MYS A;  2F1L A;  4JLI A;  4M75 F;  1I5O B;  4N0A A;  5KE3 A;  2VV5 A;  4CI0 C;  1KC8 R;  2J06 A;  3LLR A;  5L8R E;  3RNJ A;  2H3E B;  3CCR A;  1VQ9 T;  2LQN A;  5D7U A;  3BFM A;  1CKB A;  3OYD A;  2KDS A;  1WHG A;  4E7S A;  2DEU A;  1NJI R;  4J6W A;  4J9E A;  4J9H A;  2CT3 A;  3QJ6 A;  2JMA A;  2M02 A;  1UJY A;  2E4H A;  2QA4 A;  3EGD B;  4JJB A;  3QG1 A;  2MWO A;  2GQV A;  4Z88 A;  2HSP A;  3G4S T;  1RL2 A;  3JCM e;  3I55 T;  5LJ5 g;  4A4H A;  2CZ7 B;  3DKM A;  4FT4 A;  1D0Z A;  4O5V A;  2JVV A;  3I56 T;  4F16 A;  2RNA A;  1VYV A;  3KFV A;  3CCV A;  3A8G B;  1YIT T;  3MCA B;  1UFF A;  1X01 A;  1VQM A;  4C0Z A;  1K0X A;  1UE9 A;  3OYL A;  3GBQ A;  5GAN 8;  1W2B S;  3MEV A;  1H64 1;  1ZSZ A;  3PMI A;  4P5N A;  4OB0 B;  4Q5W A;  2KRN A;  3JB9 F;  1I8F A;  3EGU A;  4M78 E;  1KC8 U;  1D1A A;  1E6H A;  2GTO A;  1D3B A;  1UUE A;  4RKU E;  3EG1 A;  4PFO A;  4PJM A;  2PVO B;  2KI7 A;  2CKK A;  1NJI U;  5GJW B;  2F2V A;  4RG2 A;  4FU6 A;  1SHF A;  3G71 T;  1WXT A;  2P0Q A;  2OTJ T;  2QQB A;  1MGQ A;  1VQ7 Q;  1FXX A;  4M7A E;  3LX7 A;  1XJW B;  2RHU A;  4F04 B;  5I21 A;  2A0F B;  1UGR B;  5CQX A;  3CCU T;  3H0H A;  2M0Y A;  4NOY A;  1FMW A;  1YNZ A;  2DJQ A;  2QEX A;  1VQL A;  2SRC A;  2AIR B;  3FRN A;  4BI4 A;  4JZ3 A;  4XTV A;  3M0P A;  4JDS A;  5HCK A;  2EFI A;  4RCB A;  5KYY A;  1V76 A;  2P4T A;  2I0N A;  3IQL A;  2LQ8 A;  4PJO B;  1Y96 B;  2RHY A;  2E6Z A;  4B6M A;  1H8K A;  4C92 C;  3LGF A;  3UDC A;  2NYS A;  4LDY A;  2BKD N;  3A8L B;  3FLG A;  1ARK A;  1VQP Q;  2X9H A;  4B9W A;  1T3S A;  4Z02 A;  4MDX A;  3LW5 E;  2JM8 A;  3L2V A;  2DPP B;  1TUG B;  4DBR A;  1RAA B;  2RN8 A;  2QDY B;  2ZPF B;  1D09 B;  2NUZ A;  3INZ A;  4ATO A;  3VS0 A;  4X34 A;  4XTX A;  1C1A A;  2EGE A;  1WJS A;  2E12 A;  3CCL A;  3VS2 A;  4EMK C;  2KXC A;  3TQ7 P;  3OS2 A;  3G6E A;  2HL5 C;  3SFM A;  1YIJ T;  4AFQ C;  5CKF A;  2E41 A;  2HQE A;  1ABQ A;  4J9I A;  4M7A C;  2DBK A;  3EGD A;  5CKH A;  3VUB A;  1KSW A;  3CXC S;  1KHI A;  2JTM A;  1YN8 A;  2VB6 A;  2BTT A;  2MOX A;  2HDA A;  3FC3 A;  2DX1 A;  3BY7 A;  2K7A A;  2IPO B;  1JU5 C;  3CD6 A;  1IRX A;  3SD4 A;  2HKQ B;  3BDL A;  4CC4 B;  4II1 A;  3SB2 A;  3M0T A;  3RES A;  2HBP A;  4F7U E;  1UGP B;  1Q82 R;  4FSS A;  1CSK A;  2GF7 A;  4M75 G;  3CCS Q;  3LGL A;  1TOV A;  4C0G A;  5CKD A;  1K0S A;  4M7D C;  1AZG B;  4MZT A;  3CCJ A;  1M5Q 1;  2M16 A;  4PLI A;  3TSZ A;  4E2F B;  4ZGE B;  2JS2 A;  1AZE A;  2LT1 A;  1B34 A;  2KVQ G;  4D8D A;  1TXQ A;  1OEB A;  3EFR A;  5C0M A;  1WHK A;  3O8V A;  4HCC A;  4C8Q E;  1WQ7 A;  4KH1 B;  5FLX E;  1M3A A;  4IUP A;  3QDR B;  2LNH B;  1QVP A;  3PMT A;  2QA4 T;  2ENM A;  3M0R A;  1OX8 A;  1JXM A;  4C0D C;  3V8K A;  3QZ9 B;  2E5Q A;  1BIB A;  2KNB B;  5IHK A;  4JJN K;  1SF9 A;  3OB9 A;  2EQI A;  4OF1 A;  5FWB A;  3PVL A;  2C0O A;  4KUD K;  4KGZ B;  3X25 B;  5GAN j;  1JBM A;  1T0H A;  2GCX A;  2NUP A;  1VQ5 A;  5LJ3 h;  5GAN 6;  4RTW A;  4JLG A;  1NG2 A;  3C0C A;  3VS5 A;  3J7A F;  2VKN A;  1NM7 A;  1Q82 U;  3JB9 G;  3JCM J;  1VIE A;  4C5E A;  5DM7 R;  3ULR B;  5J39 A;  1M1K C;  4XK8 E;  4ZNX A;  2VWF A;  3CBO A;  1M3C A;  2F2W A;  2GFA A;  1VQ8 A;  1VQ6 Q;  3JB9 I;  1LJO A;  4KGV B;  4ZTF A;  2ZPE B;  2JTE A;  3E9G A;  1B3Q A;  3EFO B;  1S72 T;  3OBW A;  5KCO A;  5LJ3 f;  1M1G A;  4RG8 A;  1PHT A;  2FVU A;  1WHJ A;  1JQQ A;  2CUB A;  3HKS A;  2FZC B;  2FO0 A;  2YUN A;  3TCJ A;  1BU1 A;  2EWN A;  2QQR A;  1N8R C;  5IHI A;  2AZV A;  3CCE A;  1VUB A;  4M4Z A;  1M2O A;  1PG5 B;  3EH2 A;  1AWW A;  1O75 A;  3CCQ A;  1JRI A;  2PVD B;  2K2M A;  2EYQ A;  2K2V A;  1M4Z A;  3R6N A;  3RUX A;  1VQ4 A;  4OMO A;  4DEY A;  5GAN e;  3QBY A;  8AT1 B;  4M77 C;  2B8A A;  3OYF A;  2CP5 A;  4OML A;  3R6O A;  2Y90 A;  2M9U A;  3QPH A;  6AT1 B;  2O9V A;  5FWC A;  2DTO A;  2M1H A;  2CSQ A;  2YXY A;  2O31 A;  2GBQ A;  1W70 A;  4C92 F;  4F17 A;  1E7O A;  2KAF A;  4KT0 E;  2X4J A;  3D7S B;  3NMZ C;  1JXO A;  2O2O A;  1IO6 A;  1Y57 A;  3OS0 A;  4XAX B;  5GAN 5;  3VRY A;  1YBY A;  2DXT A;  1SSF A;  1VQN Q;  3CC4 T;  2RM4 A;  2FEI A;  2RQT A;  4RTX A;  2E70 A;  2JW4 A;  1YJN Q;  2KY9 A;  2MCN A;  1BBZ A;  3C94 A;  2CP3 A;  2DXU A;  4L6V 5;  1JEG A;  3WXM B;  3I5R A;  2WSE E;  3FJ5 A;  2EPD A;  2K3B A;  1F1B B;  3U23 A;  1ZBJ A;  2HL3 A;  1VIF A;  1KD1 C;  2OAW A;  2RA2 A;  1WJR A;  1JJ2 P;  2CGH A;  4M7A F;  2IIM A;  1MMA A;  3P8B B;  4R0K A;  2EKH A;  2GQI A;  5D6W A;  4M75 D;  5IAY A;  1WI7 A;  2DXB A;  2RB6 A;  3UT1 A;  4WTO B;  1O9S A;  1QVG P;  4KBM B;  3HRS A;  4JJD A;  2K5I A;  3E2U A;  3QDF A;  1TTH B;  3SWN C;  4M7D F;  1WXU A;  1BI0 A;  5M9O A;  3ZBD A;  3H8Z A;  2AZS A;  4NL3 A;  2L0A A;  5GAM h;  4GY5 A;  1PKS A;  4KRT A;  1I81 A;  2CYZ B;  5LJ3 g;  3V7C A;  1QP3 A;  3QXE B;  4PFZ A;  5KYW A;  1MHN A;  1KQ1 A;  4LDV A;  2FPF A;  3QZ5 B;  2IG0 A;  2EBP A;  2ZPB B;  1TUC A;  4TVR A;  3OMC A;  3OYN A;  3VS6 A;  1OV3 A;  1VQO Q;  2CDT A;  2E5K A;  5GAM f;  1VQ5 T;  2PUO B;  3E9F A;  4CC7 A;  4CC3 A;  2V1Q A;  1G3Y A;  4FM4 B;  2LCS A;  2DYB A;  2QQ9 A;  1VQ7 A;  2DF6 A;  3A8M B;  2M51 A;  1QMC A;  2DZC A;  3AT1 B;  1MMN A;  1D3B B;  3CC2 T;  3OYH A;  5J26 A;  1D1C A;  3JB9 D;  1VQ8 T;  4BE2 A;  5FU6 C;  1M27 C;  2HSE B;  3FEO A;  4JRQ A;  2MF2 A;  2X4W A;  1V1C A;  4LDX A;  2V8J A;  3A98 A;  2R5M A;  2RJD A;  4J7F A;  1AEY A;  2E3H A;  1T0J A;  5GMK j;  1NYF A;  3L42 A;  2J6F A;  5CKB A;  5HY6 A;  1JO8 A;  1P92 A;  2VC8 A;  2OTL T;  5I2M A;  4BAC A;  4FYX B;  1YJW Q;  2LRQ A;  3A5Z B;  2BE9 B;  5GJV B;  2K5L A;  2COW A;  4J9D A;  1VQK T;  2A28 A;  5DY9 A;  3PE0 A;  5IXB A;  1VQP A;  1YJ9 Q;  4A53 A;  2X3W D;  3M4G A;  2RI3 A;  4AFS C;  2DTH A;  2BUD A;  2RI5 A;  2RQW A;  4FIB A;  1OU8 A;  1N9S A;  3CXC P;  4MML A;  4DBH A;  1U8R A;  4L59 A;  3TVT A;  4XTU A;  1RLP C;  4ANJ A;  1QVF P;  1BCM A;  2VVK A;  1K73 R;  1VQ9 Q;  1IGQ A;  3OYC A;  5LJ5 d;  1PCX A;  2P84 A;  1MMG A;  4C92 G;  4M75 A;  4X9D A;  3L2R A;  3VU3 C;  1W6X A;  1M8M A;  1LOJ A;  1Q7Y C;  1D1B A;  1YFN A;  2RHI A;  1M90 R;  4M77 F;  2DMO A;  3OMG A;  2KR3 A;  3VUZ A;  3E19 A;  2HQH A;  3G4S Q;  1WGS A;  1K9M R;  1YHQ T;  4CRI A;  4R56 A;  5HK3 A;  3OS1 A;  3OY9 A;  3I55 Q;  3EG3 A;  1Y07 A;  5GMK e;  4KUI A;  3I56 Q;  3QYG B;  1I4K 1;  2YLB A;  4JRK A;  3CCS A;  2YHT A;  5FU7 B;  2KSS A;  5J3B A;  4QQD A;  1YIT Q;  2QXF A;  2CZ1 B;  3RIR A;  3FB9 A;  4BY6 B;  2D9T A;  4A4G A;  3OYK A;  3OS5 A;  2RPN A;  4GLK A;  2QQS A;  3MJX A;  3MEA A;  1D0Y A;  4DA4 A;  1NEG A;  3VJP A;  4M7A G;  5GMK l;  2E3I A;  2V1R A;  4PJO C;  2K57 A;  4OGC A;  2XID A;  3H9N A;  3BDU A;  1UJ0 A;  1K73 U;  1MND A;  1LVK A;  1QLY A;  4PJN A;  2RO0 A;  3RDV A;  1YI2 T;  2HQX A;  1HJD A;  4QT7 A;  2OAU A;  5GAM g;  1B34 B;  2QTX A;  3G71 Q;  1SRM A;  2OTJ Q;  1M90 U;  3CCM T;  4M7D G;  4ZN3 A;  3BE3 A;  1R77 A;  2DFU A;  4B9X A;  3CCU Q;  4BE0 A;  1K9M U;  1M2V A;  4E7L A;  3EH1 A;  1BI3 A;  2GGR A;  2KMT A;  2L3S A;  3CME A;  3JCM h;  2DXC A;  4YTL A;  1PWT A;  1K8A R;  3CC7 T;  2F5K A;  4Y28 E;  4ZN1 A;  2RJE A;  2LVM A;  5GAO p;  4HVU A;  1WXB A;  1VQ6 A;  1X2K A;  2RK2 A;  2DVJ A;  3H6Z A;  2NUP B;  3M59 A;  3PIP A;  2DIQ A;  4FYW B;  3G1J A;  5DLQ E;  4QQ6 A;  1X43 A;  5A0L A;  3RKW A;  2R57 A;  4HA8 A;  3VS1 A;  3JCM f;  1JJ2 A;  3MHX A;  1SKU B;  4XU0 A;  1NYG A;  3NTH A;  3EG2 A;  2LX9 A;  3WVE B;  1V29 B;  3PT9 A;  2KEA A;  2V26 A;  1M9S A;  3CMA T;  2JMC A;  2GTJ A;  3OSV A;  2XDB A;  1Z9Z A;  3GNF B;  2XHC A;  1QVG A;  3SHW A;  4M78 C;  2DYI A;  1YIJ Q;  2XKO C;  2CP0 A;  2LTO A;  4JZ4 A;  5AT1 B;  2ZZD A;  4FW2 A;  3KXT A;  2VXF A;  3QYH B;  1RAG B;  3C4S A;  2F69 A;  4QW2 A;  4AG2 C;  1YCS B;  2RH2 A;  1EFN A;  4ME7 A;  1K8A U;  2Y4Y A;  3JCM W;  5EC7 A;  2COY A;  1OQK A;  1VOM A;  1ZUY A;  1TU0 B;  1N27 A;  1NPR A;  3A8O B;  2ZPH B;  4AFU C;  3CPW P;  4AFZ C;  1TWB A;  1HD3 A;  2QI2 A;  2X4Y A;  4WF2 A;  4O6J A;  3H0F A;  3J80 E;  1WA7 A;  2CP6 A;  3OYB A;  4PK4 A;  1AVZ C;  2O01 E;  4HCZ A;  3PVQ A; 
#chains in the Genus database with same CATH homology
 3R6N A;  2A36 A;  2JT4 A;  4OMO A;  4DEX A;  2D1X A;  1GCQ C;  4DEY A;  1FYN A;  1WLP B;  2BZ8 A;  1TG0 A;  1GCP A;  1UTI A;  3RBB B;  2O88 A;  2G6F X;  4OML A;  2MIO A;  1X2Q A;  2DL5 A;  3H0I A;  4OMM A;  1K76 A;  4X1V A;  2W10 A;  3CQT A;  2YUQ A;  2DL8 A;  2O9V A;  5FWC A;  1UEC A;  4WCI A;  2CSQ A;  4OMP A;  1WX6 A;  1OOT A;  1N5Z A;  3UA7 A;  2O31 A;  2GBQ A;  1W70 A;  2D8J A;  1K4U S;  1SHG A;  2DLP A;  4F17 A;  1E7O A;  2EVR A;  1NEB A;  1UGV A;  2KBT A;  4RTY A;  3NMZ C;  1JXO A;  2O2O A;  1IO6 A;  4J9F A;  1Y57 A;  1S1N A;  4J9B A;  3VRY A;  1NLP C;  2PNI A;  2ECZ A;  4CC2 A;  2AKK A;  2FEI A;  1PRL C;  1OPL A;  2L2P A;  1GBQ A;  2HCK A;  2RQT A;  4RTX A;  2JW4 A;  2MCN A;  1BBZ A;  2PTK A;  2L3P A;  1ZLM A;  5IH2 A;  1X27 A;  4GLM A;  2H8H A;  1JEG A;  3I5R A;  3FJ5 A;  1QWF A;  1W1F A;  1Z9Q A;  2EPD A;  2K3B A;  2ABL A;  4OMQ A;  3TSW A;  3U23 A;  1ZBJ A;  5I22 A;  3NHN A;  1ZX6 A;  2RMO A;  2ESW A;  2OAW A;  1GFC A;  2KE9 A;  1PRM C;  2KT1 A;  1ZUK A;  2EYX A;  2IIM A;  2YDL A;  4HCK A;  1TUD A;  2CRE A;  1ZUU A;  1GBR A;  1KJW A;  4R0K A;  2J05 A;  2KRM A;  2DBM A;  3VRZ A;  1QKW A;  2EKH A;  1T3L A;  2GQI A;  2RQR A;  1J3T A;  1UDL A;  2AKL A;  1HSQ A;  1WI7 A;  2LJ0 A;  4J9G A;  2ROT A;  2L3Q A;  2J06 A;  3RNJ A;  4JJD A;  1BB9 A;  3REA B;  1U3O A;  1RLQ C;  1PNJ A;  2LQN A;  2ED1 A;  2KGT A;  4J9C A;  1WXU A;  1CKB A;  2GNC A;  2AZS A;  2L0A A;  1PKS A;  4KRT A;  4J9E A;  4RUG A;  4J9H A;  2CT3 A;  2JMA A;  1BK2 A;  2C0I A;  1UJY A;  2EYY A;  4F14 A;  1SEM A;  1X69 A;  4JJB A;  2K9G A;  2DRM A;  2CT4 A;  4Z88 A;  2HSP A;  1LCK A;  3VS7 A;  2FPF A;  1GFD A;  4Z89 A;  2EBP A;  2LZ6 B;  1H3H A;  1TUC A;  5IHN A;  3UAT A;  5ECA A;  2BZY A;  3VS6 A;  4F16 A;  1OV3 A;  2RNA A;  2CDT A;  4RTU A;  1VYV A;  3KFV A;  2E5K A;  1CKA A;  2FRY A;  4CC7 A;  1YP5 A;  1SSH A;  2DM1 A;  4CC3 A;  1UG1 A;  2V1Q A;  3THK A;  2LCS A;  1UFF A;  3PVQ A;  4K11 A;  2KXD A;  3SEM A;  1K0X A;  1UE9 A;  2DF6 A;  2M51 A;  3GBQ A;  2SEM A;  1MV3 A;  5L23 A;  2DE0 X;  1ZSG A;  4OMN A;  2KYB A;  2KRN A;  2J6O A;  4D8K A;  2LX7 A;  4HXJ A;  1M27 C;  3EGU A;  4Y92 A;  2KRO A;  1E6H A;  2YT6 A;  4IIM A;  1V1C A;  2GTO A;  1UUE A;  3A98 A;  3EG1 A;  1RI9 A;  5IXF A;  1AEY A;  1ABO A;  1T0J A;  1B07 A;  1QCF A;  1NYF A;  2J6F A;  5GJW B;  2F2V A;  1JO8 A;  2DL4 A;  1SHF A;  1WXT A;  5GJV B;  4J9D A;  2A28 A;  3PE0 A;  5IXB A;  1SRL A;  2DNU A;  2X3W D;  2X3X D;  3H0H A;  2M0Y A;  2K6D A;  4AFS C;  1YNZ A;  2DJQ A;  2W0Z A;  2RQW A;  4LUD A;  4ORZ A;  3NGP A;  1GRI A;  1WFW A;  2SRC A;  2YUO A;  4JZ3 A;  2KRS A;  3M0P A;  5HCK A;  3I9Q A;  3TVT A;  2LJ1 A;  1A0N B;  1RLP C;  4HVV A;  1AWX A;  2FPE A;  2I0N A;  3IQL A;  1WYX A;  4A63 B;  2ED0 A;  2HBW A;  2VVK A;  1H8K A;  5I11 A;  2B86 A;  4LN2 A;  1NLO C;  3H41 A;  3ZL7 C;  1ARK A;  4HVW A;  1W6X A;  4JPB W;  1M8M A;  1T3S A;  1X6B A;  3M0Q A;  2JM8 A;  1YWP A;  1AWJ A;  2DMO A;  2QDL A;  2RN8 A;  2KR3 A;  2JM9 A;  3EHQ A;  2DL7 A;  1XOV A;  1E6G A;  2EGA A;  2NUZ A;  1GL5 A;  1AOJ A;  3VS0 A;  2F2X A;  1M3B A;  3EG3 A;  2EGE A;  2O9S A;  1AWO A;  3VS2 A;  1FMK A;  1U06 A;  2KXC A;  3M0U A;  4AFQ C;  4LE9 A;  1ABQ A;  4J9I A;  1H92 A;  3QWX X;  2DBK A;  2HEQ A;  1KSW A;  2RPN A;  2DL3 A;  4ESR A;  1YN8 A;  2BTT A;  1KFZ A;  1NEG A;  2MOX A;  1PKT A;  2HDA A;  2DX1 A;  2K7A A;  1JU5 C;  2JXB A;  2V1R A;  2YSQ A;  2XMF A;  4CC4 B;  4IIO A;  2LJ3 A;  2CH4 W;  1UJ0 A;  3M0T A;  2EYW A;  4FSS A;  1CSK A;  1QLY A;  1X6G A;  2YUP A;  1QWE A;  2CUD A;  1K0S A;  2CH4 A;  4QT7 A;  1HJD A;  1AZG B;  1YWO A;  1SRM A;  3TSZ A;  2JS2 A;  1AZE A;  2EGC A;  1I0C A;  2P4R A;  1G83 A;  2K79 A;  1M30 A;  4D8D A;  1OEB A;  3UA6 A;  3JV3 A;  2DIL A;  2GGR A;  2L3S A;  4LUE A;  1M3A A;  3NPF A;  2LP5 A;  2LNH B;  2LMJ A;  1PWT A;  3I35 A;  1SPK A;  1K1Z A;  2NWM A;  4EIK A;  2ENM A;  3M0R A;  1JXM A;  2BZX A;  4HVU A;  1WXB A;  1X2K A;  2OI3 A;  4Z8A A;  2DVJ A;  2KNB B;  3I5S A;  5IHK A;  1MUZ A;  1OPK A;  2EQI A;  4RTT A;  1X43 A;  1WIE A;  5FWB A;  3REB B;  3PVL A;  4RTV A;  2C0O A;  3EG0 A;  1KIK A;  3VS1 A;  2LQW A;  1K9A A;  2EW3 A;  1T0H A;  2FPD A;  2ROL A;  1RUW A;  2DA9 A;  2JS0 A;  1NYG A;  4RTW A;  2KT8 A;  1NG2 A;  3C0C A;  3EG2 A;  3VS5 A;  2EYZ A;  1VYT A;  2VKN A;  3UF4 A;  1NM7 A;  2RF0 A;  3ULR B;  2KEA A;  2PZ1 A;  3QWY A;  4ZNX A;  2JMC A;  2GTJ A;  2VWF A;  3LH5 A;  2J7I A;  2AK5 A;  3EHR A;  1GCQ A;  1M3C A;  1Z9Z A;  2F2W A;  2RQV A;  3SHW A;  4AG1 C;  1QKX A;  1VA7 A;  2KYM A;  1VYU A;  2JTE A;  1B3Q A;  2RQU A;  4JZ4 A;  1UHF A;  2D8H A;  2CSI A;  1Y0M A;  1PHT A;  4GBQ A;  4RTZ A;  1G2B A;  1JQQ A;  2CUB A;  1I07 A;  2FG0 A;  4AG2 C;  2FRW A;  4E6R A;  2FO0 A;  2YUN A;  1BU1 A;  1YCS B;  1EFN A;  4JJC A;  2D0N A;  4LNP A;  3VS4 A;  1AD5 A;  1UHC A;  5IHI A;  2AZV A;  1I1J A;  2A37 A;  2C0T A;  5EC7 A;  4M4Z A;  1WDX A;  1AWW A;  1ZUY A;  2OJ2 A;  2A08 A;  4AFU C;  3VS3 A;  4AFZ C;  1HD3 A;  1MV0 B;  5FW9 A;  3H0F A;  3M0S A;  1U5S A;  1WA7 A;  2J6K A;  1AVZ C;  3O5Z A;  2K2M A;  2DRK A;  2DYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...