4M77B

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISSTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
total genus 20
structure length 91
sequence length 91
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77B00
4N0AA 4F7UB 1I81A 2VXFA 4M77A 4M77C 4XTWA 4N0AC 4F7UA 3V8LA 5LJ5j 3JCMd 4C92F 2CGHA 1WPYA 3GIBA 4C92A 5LJ3f 5GAN4 3HFNA 5GAN7 3VU3C 5GAOq 3JCMP 1BIAA 3SB2A 4PJOB 3JCMc 4C8QD 2ZGWA 3HSBA 4M7AD 4M7DD 5GAOp 2YLCA 4XU3A 3JCMQ 1I5LA 3L2ZA 4C8QF 4M75A 4RCCA 3V8JA 5GAN5 4M7AF 4M7AA 1I8FA 4XTYA 5GMKj 2E1HA 4JRKA 3HFOA 1N9SA 2FYKA 4M78B 5GANe 3AHUA 3JB9J 4PJOD 1WQ7A 2Y90A 4EMKC 4XTVA 2DEQA 2EJ9A 2YHTA 4MMKA 4C92E 4M7AC 2RD1A 4J6YA 1X01A 3M4GA 4F7UF 3RERA 4M77D 4PNOA 3SWNA 1M8VA 1YCYA 4C8QG 4J5YA 3JCMX 3FB9A 3RUXA 3L1AA 3JCMf 5GANh 4V2SA 4HT8A 3QHSA 5GMKi 2DTOA 1I4K1 3V8KA 3JCMg 4M7AG 3EFSA 2DKGA 4XTUA 5CAIA 5GMKm 5GAOm 2DTIA 4DQ2A 1D3BB 2VXEA 4M75E 4NL3A 5GAOr 5GAOl 4A53A 4M75F 2DZ9A 1U1TA 2DVEA 2DJZA 3BW1A 4Y91A 4C92D 3EFRA 4PJOG 4C92G 4M75D 1TH7A 3V7CA 5GAMg 5GAMj 1D3BA 4M77G 4X9CA 4JUVA 4XQ3A 3JB9H 3V7RA 4PJOC 5GAMe 5GAMf 3QUIA 4XU1A 4X9DA 1JBMA 4HA8A 3JCMW 3BDUA 3JB9I 4NOYA 4M78G 1BIBA 1LNXA 4C92C 4M78A 4C8QE 5GANd 4OP0A 3RKYA 1MGQA 4JRIA 4M78C 3RESA 5GAOn 1HXDA 1M5Q1 2QTXA 4M78D 4QVDA 1WNLA 4A54A 3JB9D 2K57A 4M7DC 4M77F 5LJ5g 4M75B 1WQWA 4JLIA 1B34B 2JN0A 3SWNC 5GAN8 5GAMd 4PJOA 3V7SA 4PJOF 5GAN3 5LJ5h 4NL2A 5LJ3g 1JRIA 3FJPA 1LJOA 4EMKA 2DZCA 1H641 4M77B 1LOJA 2E10A 3JCMh 4M78E 4C8QB 4XTZA 3RKXA 5LJ3h 2RA2A 4M7AB 4C8QA 4C8QC 5GAN6 2E64A 5GMKh 5GANf 4M7DB 2RB6A 3BFMA 1U1SA 4M78F 2VC8A 2EAYA 4M7DG 3BY7A 3JB9F 3FIFA 3SWNB 3JB9G 1B34A 4M7DF 4MMLA 4C92B 4M7DA 1Y96A 4PJOE 4EMHA 5LJ5d 4RCBA 4M77E 5GMKe 4F7UE 4HT9A 1N9RA 4M75G 2FB7A 2I2LA 1KQ1A 5GMKl 5GANj 1Y96B 2HNIA 3PGGA 2EWNA 5GAMh 3JCMV 5DY9A 2YLBA 5LJ3e 2E65A 4XU2A 4XTXA 2EJFA 5LJ3j 1KQ2A 4M7AE 4M7DE 2DXTA 3RIRA 5LJ3d 5LJ5e 2DXUA 2E41A 3JCMJ 2RM4A 3INZA 4M75C 3RKWA 4QVCA 4EMKB 3JCMb 3QO3A 5GANg 5I21A 3JCMe 3QSUA 5GAN2 2EJGA 4WF2A 4J6WA 4J6XA 4EMGA 4F7UG 4XU0A 2DTHA 1HK9A 5LJ5f
chains in the Genus database with same CATH superfamily
1XJWB 1VQKT 4JRPA 5FU7C 4XTWA 2X4JA 3ZFJA 4C0FA 1S72A 1SPKA 5L8RE 2R5MA 4BI4A 1UHCA 3EGXA 3TCJA 1F1BB 4M75A 5GAN5 4JLGA 4M7AF 3QPHA 2DVJA 3G71T 2QGGA 2C0IA 2EJ9A 4FYYB 4M7AC 1KQSP 3L2VA 1AD5A 1ZUUA 4J5YA 4O6JA 1KC8U 2FPEA 3EG1A 2PUKB 6AT1B 1G83A 1BYMA 2HSPA 1WHHA 1VQLQ 2LQWA 4AFQC 2DJZA 1LVKA 4C92D 1YI2A 3CCQA 3R6OA 3V7CA 3OA6A 5GAMg 2FZKB 3JB9H 2HQEA 4ZTFA 2XIDA 4XU1A 3JCMW 2MAMA 1WHKA 3BE3A 1X6OA 1Q86R 4EIKA 3TU4K 4ELYC 3TSZA 2H3EB 2PVGB 4DBHA 4NL2A 1Q82R 1ZX6A 3OS1A 1RUWA 2DZCA 4BD3A 1VQLT 1WA7A 5FU7B 2P4TA 2K2VA 3M54A 2OX7A 4FT2A 2VC8A 1W6XA 4LUEA 1TU0B 1NM7A 4ZGEB 3M4YA 2DAQA 4D8KA 1KSWA 4WTOB 2YLBA 2DK3A 4Z8AA 2HQXA 2XI9A 1M1KU 4PJJA 4MZTA 4IUVA 2PZ1A 2RM4A 4M75C 3JCMb 4EMKB 3CCMT 5I21A 5IH2A 1C0MA 4J9GA 1VIFA 3OYBA 3PIOA 1BCOA 4M77A 3X28B 4F7UA 4N0AC 3JCMd 1OU9A 2KDSA 4LE9A 4LN2A 4ZGJB 2CP3A 3OQ5A 1YJWQ 3OYYA 2CUDA 2M16A 3JCMQ 3AT1B 4DOVA 1AOJA 1YI2Q 1ABQA 4RTTA 1VQLA 4LDUA 4XTVA 2DL7A 1OZ3A 1X27A 3CC7Q 4IUPA 3G4SA 1GRIA 4Y92A 1YCYA 3H0HA 3JCMX 3A8LB 1VQ9Q 3L1AA 1JXOA 1UJ0A 5GANh 1YJNQ 1I4K1 3V8KA 3CCST 4J83A 1PNJA 3HRUA 1BKBA 1ZQ1A 2CH4A 3CC7A 3CCQT 4KGZB 3VS6A 4XQ3A 1QQJA 2CT3A 1YJNA 4AG2C 2P0PA 3QZ9B 2KYMA 2RQWA 2K3BA 5CK9A 2LCLA 3LGLA 3M55A 2FL7A 4C5IA 5GAN8 1VQ8Q 2WSFE 1VQOT 1NBEB 4FYWB 4C8QA 3X24B 4LNPA 3J81E 2RB6A 2XDPA 5KYWA 4BE2A 2CP5A 3VS7A 3ZEHA 2COZA 3C4SA 2XMFA 5GANj 4EDUA 1NPPA 2ZPFB 1R0BG 5FWBA 2E3IA 2OTLT 1IHWA 1WXTA 4QW2A 4M7AE 3CMET 2L89A 4QKUA 3PIPA 2GNCA 3LWHA 3JCMe 2H3JA 2ROTA 4AFZC 1GCPA 4GBQA 3L2QA 4BY6C 4AT1B 3I56T 2RHXA 2H8HA 4WCIA 1QP2A 1KC8C 1VQ6T 2FZCB 2HEQA 2WACA 4PKCC 5A0DA 3CC7T 1N9SA 1Y71A 1QVGS 2KY9A 4EMKC 1SRLA 3EG9B 1OOTA 2LJ1A 2ATCB 4F16A 1NYGA 5I11A 2JMCA 3GNGA 1VQNA 3M9QA 1KG1A 3GBQA 2QXFA 1Q82C 5IXBA 3OB9A 1BBZA 3GNFB 3UWNA 2M1HA 2MCNA 4M75E 3ASKA 5KYNA 3CMEA 1TG0A 2PVDB 2LT1A 1M9SA 2FVUA 1X43A 2MI6A 4BI3A 2CT4A 1YP5A 3D7SB 2ABLA 1WLPB 4JZ4A 3I5SA 4FW1A 3HRSA 1E7OA 3MEAA 1BIBA 4C92C 3MO8A 2RI3A 4L5GA 4CRIA 3H9NA 1B34B 1IREB 2P84A 3MPUB 3VUBA 2A08A 1LJOA 2RQUA 4M77B 3RNJA 2J05A 5J39A 2RHZA 2K7AA 4Z89A 4M75G 4D8DA 2MWOA 1M3CA 2CZ7B 3NGPA 2MIOA 1XTDA 4ORZA 3CCEA 2OTJT 5DY9A 1BB9A 2K5IA 3OS2A 2AT1B 2J6OA 3L42A 4QVZA 4XTXA 5KH6A 3O5ZA 2RQRA 2DETA 2E41A 1M1GA 5KYXA 2LMJA 3OYNA 3QG1A 4F7UB 3RERA 5GAN4 3JCMP 3M59A 3OYDA 2HQHA 3U23A 3PMIA 3L2ZA 2A36A 4JRQA 5EG2A 3CBOA 5D6WA 1ZLMA 2HKNA 4C0GA 2EGAA 2NUTB 2KEAA 3DLLA 2F1LA 4PNOA 1M27C 4C8QG 1YHQQ 1SHFA 2DNUA 3OW2A 1NZ9A 1NE8A 4FSSA 2CP6A 2GQVA 4M75F 2JNGA 1BCMA 4OF1A 3GPLA 4E7IA 3RMQA 3CC2Q 2EQKA 3SDZA 2XDDA 2DFUA 5I2SA 2QA4Q 2OAWA 5GAOn 1K9MC 2KBTA 1D09B 1QVFA 4OMMA 3I55T 1M1KC 4J9EA 1IGQA 2B8AA 1OEBA 4FL6A 2DILA 2HSEB 1K73U 4C8QB 1KD1C 2E64A 4OVAA 3RR6A 2SRCA 4M7DG 2DIQA 1A0NB 3SWNB 1LCKA 1UG1A 2MF2A 3KBGA 2A28A 2KSSA 4C5GA 1N9RA 5CKHA 1KQ1A 1Y96B 3P8DA 3E9FA 5DLQE 4JJDA 4C0DC 1YI2T 1SF9A 2E65A 3M0UA 1JB0E 1VQ4Q 4HKEA 2DXTA 1Y57A 4J9FA 5LJ5e 2DXUA 3EG3A 4E7SA 3SFMA 3CCRT 2CP0A 5GAN2 3HL8A 4MDXA 4XU0A 2DTHA 4L6V5 3TREA 8AT1B 3A8HB 2V1QA 3A5ZB 4RUGA 5D6XA 1SRMA 2CSIA 1TTHB 1I07A 4HXJA 4QQ6A 4C8QD 3CC2A 3MCAB 1PSEA 1NPRA 3V8JA 1SSHA 1Y7XA 4XTYA 2AZSA 2QQAA 1Q81U 5GANe 4C92E 2V8IA 2DL5A 4Z88A 1S72T 3CCQQ 1X01A 1MMGA 1X6GA 4FIBA 1B7TA 5CVIA 5CR2A 3PVLA 1W4SA 2JVVA 2F2XA 1WJRA 4J7IA 2PNIA 1QVGP 2BZ8A 2JTEA 4DQ2A 3CCLQ 1YJ9A 1P92A 4OB3B 1Q7YR 2IPOB 4E47A 1E6HA 3VUZA 2FO0A 4PJNA 4JS4A 5GJVB 3KXTA 1ZUYA 3HTRA 3QUIA 3VYHB 3G71Q 4X1VA 3CXCS 1LNXA 5IAYA 1QVFP 2DMOA 3JB9D 4M77F 1K0XA 4JLIA 2K2MA 2ENMA 1ARKA 3VS1A 1OZ2A 2E10A 5IHIA 3CC4T 1RL2A 3CCMQ 1NJIR 2ZPEB 3CPWP 2EPDA 4N4GA 3VKIA 1H3HA 3X25B 3NHNA 1Y96A 2Y4XA 4RCBA 1YITT 4BY6B 2L5QA 3QBYA 1OU8A 4CC2A 4GLKA 2KGTA 2NUZA 1RABB 3OYKA 2QAZA 1HSQA 3CCVA 2QQSA 3INZA 4IUQA 3QSUA 5I2MA 1LPLA 3CCSA 3HKSA 1D1CA 1VQPQ 1S1NA 3H41A 4KT0E 4ZN1A 4N0AA 3M0SA 5LJ3f 1RACB 2YLCA 4C8QF 2YRCA 3CCUT 3VRYA 2E1HA 5LL6S 2M0YA 3MEWA 1Q7YC 1RAEB 2YHTA 2ZAEA 1VOMA 3M4GA 1TS9A 3SWNA 2RN8A 3VJPA 2QEXA 2D8HA 4PK4A 2E6ZA 5J26A 3OS0A 1CSKA 1AT1B 4A4FA 2Y4YA 1K76A 2E5KA 3RBBB 1Q86C 2LT4A 3OMCA 3QJ6A 3CPWS 4KGXB 3NTIA 4RKUE 4PJOC 1RLQC 2KRMA 2O88A 1YHQA 2MYSA 2RJEA 4HVVA 2RI2A 2JXBA 3RESA 1GFCA 4R0KA 1HXDA 1J3TA 1JQQA 2W10A 2E5QA 1QVFS 3SWNC 2J7IA 2CREA 1VQ4A 4C8QC 3CCSQ 4L59A 1AZEA 1JJ2S 2JTMA 3CCVQ 4BACA 3PVQA 1VQNT 1CKAA 1SSFA 3LLRA 1TXQA 3REAB 4DEYA 4FYXB 2QG9B 1PHTA 2EYQA 3DB3A 1BU1A 1FYNA 2F2VA 3ZBDA 2COWA 2DD4A 3UA6A 4XU2A 2V26A 2X9HA 1KQ2A 1KHCA 3QJYA 1E6GA 4BE0A 1BK2A 3QDRB 3I56A 3QO3A 1T0HA 4BB7A 1K0SA 5KYXB 3CCUA 4EMGA 2K3YA 3GF5A 4RTXA 2LQNA 2XDBA 5LJ5j 2DBKA 4UC4A 2NWMA 2JW4A 3A1PA 2GGRA 4QQDA 2YSQA 4RCCA 4M7AA 3VS4A 1UECA 3R6NA 2ZPGB 1NJIC 2RI5A 1ZSZB 2KT8A 4MMKA 4RTUA 1W70A 3T9NA 4J6YA 1SEMA 2EVRA 4LDVA 3I5RA 1RAAB 1VQ7A 3MEVA 3G71A 3QHSA 3G4SQ 1AEYA 1TWBA 1HJDA 3EFOB 2BE7D 2X3XD 5A2QE 2K5FA 4F04B 5GAOm 2ZPHB 2VXEA 4ATOA 2DZ9A 5CKDA 1KQSA 1KD1U 2C06A 1WZOA 1NYFA 4HCBA 1N8RC 5KE3A 1YJWA 1K8AU 2JS2A 3LWIA 2EKHA 2PTKA 4FU6A 2X4WA 4A54A 2O01E 2K57A 1V1CA 1D1AA 2M02A 5GAN3 3MKDA 5LJ5h 2J06A 1M90U 3QWYA 1JRIA 4MDWA 3QDFA 1VQ6A 1UGPB 1WIEA 4XTZA 5LJ3h 4M7AB 1WX6A 2MMPA 2BZYA 3CCRQ 2FPDA 3M0RA 3EH1A 2KQWA 3FIFA 1PRLC 3JB9G 1I1JA 4M7DA 2OTLQ 2F5TX 4PFOA 2O9VA 2LP5A 4LDYA 2DF6A 1BI1A 2I2LA 4JJCA 5FW9A 4PLIA 7AT1B 5GMKl 3OYEA 4ZTJA 1K4US 2BUDA 1FMVA 1VYUA 4OB0B 2X4YA 3EHQA 1OULA 1VQPA 2KRNA 4A4HA 2EJFA 2PVOB 1WI7A 2JTFA 5CKEA 3FLGA 5HK0A 1XNIA 1YJWT 1PWTA 2R58A 3CD6Q 5IHKA 3CEYA 4J6XA 2F69A 4FCYA 1C6VX 3WVEB 3UA7A 4C92F 1OX9A 3X26B 1AVZC 1SHGA 4P5NA 3UF4A 2ZGWA 2OTLA 1FMWA 1W2BA 3CMAA 1NLOC 1T0JA 2LC4A 2P4RA 3L2WA 4R55A 3S3MA 1QWFA 1U5SA 2GBQA 2CYZB 5HCKA 4HCKA 4XK8E 1M8VA 1TUCA 2DO3A 3A98A 1KK7A 2FHDA 1PKTA 3JCMg 2FRYA 1N8RU 2L3RA 1X69A 3QYHB 3ULRB 2DIGA 2KYBA 2NUPB 3RDVA 4CC4B 4J7FA 1D0XA 1KHIA 2EFIA 2QQ9A 4Y91A 4F14A 2LNVA 4C92G 4M75D 1TH7A 1VYVA 5FRNA 5HK3A 1RADB 1QVGA 3FJ5A 2CS7A 2KE9A 3CQTA 3L2UA 3RKYA 4DOWA 4QVDA 3EGXB 1OQKA 2AK5A 4Z02A 1V29B 3CCET 3NMZC 1VQ7Q 2OTJA 4PJOF 2G3RA 3OSVA 3E1SA 1BI3A 5L23A 1YFNA 3PTAA 1FWZA 1UEBA 1PG5B 2DERA 2LTOA 1WGSA 3N5BB 1UE9A 4M7DF 3CC4A 1VQKA 2D0QB 2YRDA 1M1KR 2BIVA 2LX7A 2EWNA 2C0OA 5KYUB 5GAMh 1KIKA 1YCSB 4OMLA 4J9DA 5FRMA 3PT9A 4M7DE 1ZA1B 1M30A 2LJ0A 4KUDK 3CCMA 3FRNA 3UATA 3EGUA 1BI0A 1JO8A 1QP3A 4WF2A 1JJ2A 2L3SA 4HCZA 4FYVB 1HK9A 3QIIA 1IB8A 2G6FX 1ACMB 3CXCP 1I81A 4JJBA 4NL3A 2X3WD 2VVKA 5KYYA 5GAOq 3CPWA 2M51A 3OS5A 3HSBA 4XU3A 2RHIA 1MV3A 2PQWA 1YJ9T 2RF0A 1UDLA 3O8VA 3HFOA 4IUUA 2JZ2A 2QDLA 1X2KA 3WVDB 1TUDA 2GFAA 3M57A 2JS0A 2DEUA 4HT8A 2DTOA 1AWXA 4DBFA 4RTVA 1MNEA 2CH4W 2DKGA 1PRMC 2FRWA 5KYYB 1RAHB 2X4XA 2KI7A 1M3AA 2NYSA 5GAMj 3QZ5B 1H8KA 1IZ6A 3CCJT 2RHYA 2CP7A 3BDUA 2KVQG 1VYTA 2YUQA 4KH1B 2K6DA 1D0ZA 2QK0A 4M78C 2LNHB 4JZ3A 4BUGA 3OYJA 5FLXE 3OW2S 4M7DC 2DBMA 3VV0A 1MV0B 2HBPA 3TQ7P 3EH2A 3H8ZA 1QKXA 4KULA 2HAXA 2VASA 3JCMh 1KQSS 3KUFA 1G3TA 1I5OB 3JV3A 5GMKh 1M3BA 1SG5A 2GFUA 1K1ZA 5FWCA 1UJYA 4J9HA 3J7AF 2LDMA 5LJ5d 2VB6A 2CP2A 4HT9A 3DLMA 1YIJQ 2KROA 4KRTA 4YTLA 3OYHA 2HNIA 4PJLA 2DL4A 3OW2P 2OAUA 1VQ6Q 1YWOA 2BTTA 3FDRA 1WXUA 1QLYA 1MMDA 4ESRA 1YNZA 3M5AA 4VUBA 4J9IA 1T3LA 4FW2A 3RMSA 5IXFA 2P0QA 2NUPA 2X51A 1CKBA 3E19A 3VU3C 4PJOB 2QQBA 1IO6A 2Z0WA 4DBRA 1AWJA 2ROLA 5GMKj 1ZBJA 4N4IA 1VQ8A 2YDLA 2IVWA 3TSWA 5ECAA 1X75C 2M9UA 2K5LA 3F70A 2RK2A 3MJXA 3DB4A 3CC2T 1YWPA 4GLMA 2ED1A 4CC7A 3M58A 2QI2A 4IUTA 2XU8A 1W2BS 3VYGA 5GAOl 4OMOA 2CDTA 1ZA2B 2JUFA 4PJOG 2NUTA 2DXCA 3CD6T 1D3BA 3OYFA 2D1XA 2DXBA 5GAMf 1YHQT 1VQOA 1OPLA 3SHWA 3UT1A 4RTWA 5C6SA 5D6YA 2QGFB 2D8JA 2EKOA 3WXMB 1WDXA 4B9XA 4J8OA 4R56A 4PFZA 2LX9A 2VKNA 4PLLA 4C5HA 3G6ET 3CMAQ 5GANf 2DX1A 5GAN6 4M7DB 1JXMA 1DJ7B 1OPKA 2D9TA 4LD6A 3CCEQ 3QWXX 1W1FA 3H0FA 3A8OB 2EBPA 2DRMA 2MK5A 1OYXA 2RJFA 2EQIA 2DE0X 3I9QA 4KBMB 1PCXA 2HKQB 2BE9B 3JCMJ 2X35A 3RKWA 3A8MB 2VYTA 3Q1JA 3V8LA 2EQUA 4OGEA 2A37A 3CCRA 3ER0A 1M2OA 4M7DD 1WXBA 2K4YA 1K73C 3GOXA 1YN8A 3IQLA 4E7ZA 3JB9J 1Z9ZA 4JPBW 2ZPBB 2RD1A 3CBPA 1UFFA 1XQHA 2AZVA 2YUNA 3JCMf 2QEXQ 2RQVA 1GXIE 2A0FB 2HMAA 3JRZA 2E4HA 3MP8A 2RNAA 4DBQA 3MP6A 4TVRA 3I55A 1X6BA 2R5AA 2SEMA 2EQJA 1JJ2P 4Y28E 1C1AA 1KJWA 2DPPB 3HP9A 5FROA 3EG0A 4OB2B 2P0KA 3PMTA 2E12A 4C8QE 4OP0A 1MGQA 2KXDA 1VQ5T 4O5VA 1WQWA 1MNDA 1H3ZA 2NLUA 3VRZA 2FPFA 1TSFA 4C0DB 1H641 1UGQB 1I5LA 2CKKA 1QMCA 3SEMA 2V8KA 1AWOA 1U1SA 1M4ZA 4M78F 4BDYA 3TEEA 2HL5C 4J9BA 4MMLA 2MOXA 2QTVA 4EMHA 4LD9K 4E6RA 4QT7A 1PD0A 2FB7A 2KNBB 1G3WA 3SD4A 1BI2A 4GY5A 2RJDA 2JOYA 2QA4T 4RG2A 2JM8A 2O31A 1K73R 2QDYB 3NTHA 2YRVA 2EYYA 2BKDN 2AKLA 2M0OA 2DYBA 4LDWA 1G2BA 1WHMA 1YIJA 1BIAA 3THKA 4J9CA 5A0GA 1MMNA 3CCJA 5J3BA 4AG1C 1M1FA 2V8JA 2L3PA 3CPFA 2RPNA 2OTJQ 1O75A 5IN1A 3P8BB 1WQ7A 1EZZB 1ZBXA 2DEQA 2BZXA 4C5EA 1MUZA 4M77D 1GCQC 2EQMA 1K8AR 4V2SA 3ME9A 1PC0A 1XOVA 4HCCA 2KRSA 3EFSA 4F17A 3GP8A 5GMKm 4ZGDB 4JJNK 1VUBA 2DRKA 2XHCA 2O4XA 3CXCA 2LQKA 1M90R 2ECZA 3MHXA 4X9CA 2E70A 4IKFA 2DLPA 1OI1A 1VQMA 2B86A 1M90C 3CMEQ 1V76A 4M78A 1OV3A 3OYGA 1B3QA 2WSEE 1NLPC 4M78D 3FEOA 1MMAA 5LJ5g 1IHVA 2KXCA 3DKMA 1K9AA 5LJ3g 1NJIU 4EMKA 1WFWA 4PFPA 3MP1A 1Q7YU 5DM7R 2JJ9A 1YITA 2IIMA 3TVTA 1W2BP 3C12A 4JDSA 2EAYA 3JB9F 2HBWA 1UUEA 4XAXB 4Q5WA 1VQPT 1U06A 1IRXA 3C95A 2ED0A 3NFCA 2EW3A 4MZMA 5GMKe 3LGFA 3M0QA 1Q82U 2HZYA 2ZZDA 3JCMV 5KCOA 2J6FA 2EYXA 5IT9E 1D1BA 2XG8D 2K79A 3HPWA 3OYMA 1ZUKA 1WHGA 1AZGB 1D0YA 2VXFA 2YUPA 2GTJA 4LUDA 1PD1A 1QCNA 2CGHA 3E2UA 3HFNA 1GCQA 1GL5A 3CC4Q 1YJNT 5I22A 5CIUA 1IXDA 3JSCA 2FYKA 4M78B 4ANJA 2LJ3A 4CC3A 2LCCA 1R0CB 1G5VA 5CKBA 3RUXA 2L0AA 2COYA 1T3SA 1ZSGA 1JEGA 2C0TA 1UTIA 1HD3A 2DTIA 4OMPA 2CZ0B 4KH0B 1VQOQ 1QVPA 3C94A 1U8RA 1R8OB 2DVEA 4IIOA 3EFRA 5CCAA 4PJMA 3CBMA 1WHLA 2E3HA 1Q95G 3V7RA 1ZHIA 1JU5C 1JBMA 2IG0A 3HHTB 3PE0A 4M78G 2GQIA 3PFSA 1G3YA 3G7ZA 2RJCA 2ZPIB 1K8AC 2FEIA 1RAIB 1WNLA 4BI8B 3S6WA 5GAMd 3S3OA 1WHJA 4B6MA 1RAFB 5CQXA 2DM1A 3H6ZA 3G6EA 4M78E 1K9MU 4RMOA 2O9SA 4NS5A 4IURA 4DA4A 1WJSA 4HVWA 1GBRA 2XD0A 2JMAA 4E7HA 1GFDA 2MWPA 2DD5A 4JS5A 1FX7A 3H0IA 4AFUC 2VGNA 1RI0A 2W0ZA 1UHFA 1PSFA 2L2PA 4FSXA 3PNWC 3UPUA 5LJ3j 3CD6A 2JT4A 1UB4A 2FG0A 1UGSB 2KMTA 3OYAA 1EX4A 3OYIA 1ZSZC 2CSQA 4K11A 3ZL7C 4OMFB 3M0PA 4C92A 3EGDB 3SB2A 2F2WA 5KYUA 4E7LA 1MHNA 3QKJA 5IHNA 1VQ4T 3I55Q 4JRKA 3L2RA 4BDZA 2Y90A 2XICA 3LW5E 3NTKA 4F7UF 3REBB 1O9SA 4E2FB 4A4EA 4A63B 4QQGA 1PKSA 2EYZA 2QASA 3JAME 2K3XA 5CAIA 2QEXT 2D6FA 4A53A 5EC7A 4EPCA 4IIMA 2O4XB 1VQ5A 4M77G 1FMKA 5GAMe 3LH0A 4II1A 3G1JA 2K9GA 1Q81R 3EAEA 1M5Q1 3UDCA 9ATCB 4M75B 2EIFA 4CI0C 2D0NA 1PM3A 2J6KA 2PU9B 3S3NA 3RKXA 3HRTA 2LQ8A 1NEGA 2OI3A 3KFVA 3G4ST 4ZN3A 1N5ZA 3EFOA 1S72Q 1QWEA 1YBYA 1X2QA 4OB1B 2XK0A 3M53A 5GJWB 2O2OA 1ZSZA 1ABOA 4E7JA 2RH2A 1Q81C 1N27A 4HVUA 2E6NA 3RIRA 2L8DA 1I0CA 4AFSC 4ZNXA 2YT6A 4QVCA 1KD1R 2EYWA 3G6EQ 3CMAT 2VGMA 4J6WA 3I35A 2AKKA 4FT4A 1Z9QA 2QA4A 1KC8R 1VQ7T 4M77C 3GIBA 3OBYA 2KR3A 1WPYA 1B07A 5DLOA 3JCMc 4M7AD 4AMCA 2RO0A 2I0NA 1QCFA 2KAFA 3EG2A 4OMQA 1QW1A 4B9WA 1AWWA 1I8FA 1TOVA 3LH5A 3AHUA 5KCHA 2EGEA 4A4KA 2VWFA 1M8MA 3EG9A 1WJQA 3EHRA 3FB9A 1VQ9A 1M2VA 2FZGB 3VS5A 5GMKi 3M0TA 1UGRB 3E9GA 1GBQA 4M7AG 4A4GA 2YXYA 1R77A 2WSCE 4XTUA 2GF7A 1VIEA 2RQTA 1U1TA 2VV5A 3BW1A 5D7UA 2HDAA 3P8HA 2CZ1B 2JM9A 2MPXC 5CO7A 4HA8A 3JB9I 3J80E 1U3OA 4NOYA 5GANd 1M2VB 2JN0A 5A0LA 1N8RR 4PJOA 3X20B 3M56A 4PJOD 3CCVT 1RI9A 5AT1B 2RHUA 3NPFA 4RG8A 4ME7A 1H92A 2ESWA 1B34A 1IGUA 4LDXA 5HKCA 4M77E 4F7UE 4OMNA 4KGVB 1G8XA 2DA9A 4X34A 1RAGB 4DEXA 3PGGA 2A7YA 2A3LA 5LJ3e 8ATCB 2L3QA 1HYOA 1K9MR 5LJ3d 5HY6A 2DJQA 2HL3A 2RK1A 1YITQ 2YWWA 4F7UG 3C0CA 2LCSA 5LJ5f 3VS3A 5FU6C 5GAN7 2R57A 3OSSC 1G3SA 4MZPA 1UGVA 2V1RA 5GAOp 1VQ9T 2QQRA 4KUIA 1KFZA 3A8GB 4E7KA 1VQMQ 5CKFA 1VQ5Q 3OMGA 2CUBA 1YIJT 4RTYA 3VS2A 2CZ6B 1Y0MA 2GTOA 4N4HA 5M9OA 1VQNQ 2DL8A 3QXEB 1SKUB 3META 3MEUA 4D6WA 2KT1A 2LRQA 5GAOr 1EFNA 1D3BB 1QKWA 2ZCFB 1RLPC 3CCLT 2DYIA 2F5KA 1TUGB 1AHJB 3BDLA 2LVMA 1EIFA 4JUVA 5C0MA 1VQMT 1NG2A 4X9DA 1Q86U 1QCOA 2KK4A 4PL6A 1YJ9Q 3CCLA 5FU6B 3LX7A 3OYLA 4C0ZA 3EGDA 3URGA 3CCJQ 4JRIA 2HCKA 2RMOA 2AHJB 2QTXA 2AIRB 3QYGB 2YUOA 1FXXA 3V7SA 5KYWB 4ELZC 3FJPA 1LOJA 5CQYA 3FC3A 2EGCA 2PUOB 2RA2A 3OY9A 3OYCA 3OBWA 2VUBA 3BFMA 3LYIA 3BY7A 1OX8A 1NEBA 1VQKQ 2GCXA 4C92B 4PJOE 4OGCA 4FM4B 1VQ8T 1VA7A 2HD0A 4RTZA 3CCUQ 1N6AA 4BE1A 2XKOC 2OJ2A 3I56Q 2DL3A 3VS0A 5GANg 4M4ZA 5KE2A 2QYZA 1Y07A 3GLXA 2EJGA 4LXCA 2LZ6B 5AYFA 1WYXA
chains in the Genus database with same CATH topology
3TREA 3QIIA 1VQKT 3A8HB 3A5ZB 1I81A 2VXFA 5D6XA 5FU7C 4XTWA 4NL3A 2X4JA 4JRPA 2CGHA 3ZFJA 3HFNA 4C0FA 1S72A 5L8RE 2R5MA 4QQ6A 5GAOq 3CPWA 4C8QD 3CC2A 4BI4A 3OS5A 3MCAB 3HSBA 1PSEA 1YJNT 4XU3A 1NPRA 2RHIA 3TCJA 4M75A 3V8JA 5GAN5 4JLGA 4M7AF 2PQWA 1YJ9T 3QPHA 1Y7XA 4XTYA 3G71T 5CIUA 3O8VA 3JSCA 3HFOA 2FYKA 2QQAA 4M78B 5GANe 1Q81U 4IUUA 2LCCA 2EJ9A 2JZ2A 4C92E 4M7AC 2V8IA 3WVDB 1S72T 1G5VA 1X01A 3L2VA 5CKBA 4FIBA 2GFAA 3M57A 5CVIA 4J5YA 4O6JA 3RUXA 5CR2A 1KC8U 1W4SA 2JVVA 4HT8A 2PUKB 2DTOA 1WJRA 4J7IA 2DKGA 1BYMA 2DTIA 4DQ2A 1YJ9A 2CZ0B 1P92A 1QVPA 3C94A 4OB3B 1U8RA 2X4XA 1R8OB 2DVEA 2DJZA 4C92D 1YI2A 3EFRA 4E47A 3CCQA 5CCAA 3VUZA 3R6OA 3CBMA 3V7CA 3OA6A 5GAMg 5GAMj 3QZ5B 4JS4A 3JB9H 3KXTA 2HQEA 3V7RA 1ZHIA 4ZTFA 2XIDA 3QUIA 1IZ6A 4XU1A 1JBMA 2RHYA 3CCJT 3VYHB 3JCMW 2IG0A 3BDUA 2KVQG 2MAMA 3HHTB 4M7AE 4M78G 3CXCS 1LNXA 3PFSA 1G3YA 3G7ZA 2RJCA 4M78C 1X6OA 2ZPIB 5IAYA 1K8AC 4BUGA 1WNLA 4BI8B 3JB9D 3OYJA 5FLXE 4M77F 3OW2S 3TU4K 4JLIA 3VV0A 3S6WA 2HBPA 4ELYC 5GAMd 3S3OA 2PVGB 3H8ZA 4NL2A 1OZ2A 3OS1A 4KULA 5CQXA 2DZCA 4BD3A 1VQLT 5FU7B 2HAXA 2E10A 3H6ZA 2P4TA 2K2VA 4M78E 3KUFA 1G3TA 3JCMh 3G6EA 3CC4T 1KQSS 5GMKh 1K9MU 4RMOA 3M54A 1RL2A 4NS5A 4IURA 2ZPEB 4DA4A 4FT2A 1WJSA 2VC8A 4N4GA 3VKIA 2GFUA 2XD0A 3X25B 3J7AF 1Y96A 4E7HA 2LDMA 2Y4XA 5LJ5d 4ZGEB 3M4YA 4RCBA 2MWPA 4HT9A 2DD5A 3DLMA 4BY6B 1YITT 2L5QA 4JS5A 4YTLA 1FX7A 2DAQA 3OYHA 2HNIA 3QBYA 2VGNA 2YLBA 2DK3A 1RI0A 2OAUA 1PSFA 4GLKA 3PNWC 2HQXA 4FSXA 2XI9A 5LJ3j 3UPUA 1M1KU 3FDRA 1UB4A 3OYKA 3CD6A 4MZTA 3CCVA 1UGSB 2KMTA 2QQSA 4IUVA 3OYAA 2RM4A 3INZA 4M75C 3JCMb 4IUQA 4EMKB 3OYIA 3CCMT 3QSUA 5I21A 5I2MA 3M5AA 3CCSA 1VIFA 3OYBA 4VUBA 3HKSA 4OMFB 3PIOA 4KT0E 4ZN1A 4N0AA 4M77A 3X28B 3RMSA 4F7UA 4N0AC 3JCMd 2P0QA 4C92A 5LJ3f 2KDSA 4ZGJB 3E19A 3VU3C 4PJOB 3OQ5A 3SB2A 2QQBA 3OYYA 2M16A 2YLCA 3JCMQ 4E7LA 1MHNA 3QKJA 4C8QF 1VQ4T 4DOVA 3CCUT 5GMKj 2E1HA 4JRKA 5LL6S 4N4IA 1VQ8A 1VQLA 3MEWA 2IVWA 3L2RA 4BDZA 2Y90A 4LDUA 2XICA 1Q7YC 4XTVA 4PJOD 2YHTA 3LW5E 1OZ3A 3NTKA 3M4GA 4F7UF 4IUPA 3SWNA 1O9SA 1X75C 3G4SA 1YCYA 2M9UA 3VJPA 4A4EA 3JCMX 2K5LA 3A8LB 2QEXA 3L1AA 3F70A 2E6ZA 5GANh 2RK2A 4QQGA 3DB4A 5J26A 3OS0A 3CC2T 1I4K1 3V8KA 4A4FA 2Y4YA 3M58A 2QI2A 3JAME 2K3XA 5CAIA 3CCST 4IUTA 4J83A 2QEXT 2XU8A 3HRUA 1W2BS 1BKBA 1ZQ1A 3VYGA 4A53A 5GAOl 2D6FA 1Q86C 2JUFA 2LT4A 4PJOG 4EPCA 3CC7A 3CCQT 2O4XB 2DXCA 3OMCA 3QJ6A 3CD6T 3CPWS 1D3BA 4M77G 4RKUE 3NTIA 4XQ3A 3OYFA 1VQ5A 4PJOC 5GAMe 2DXBA 3LH0A 4II1A 5GAMf 1YJNA 1YHQT 1YHQA 1VQOA 2P0PA 2RJEA 3QZ9B 3UT1A 5C6SA 2RI2A 3RESA 5CK9A 2LCLA 5D6YA 3EAEA 1HXDA 1M5Q1 2EKOA 3LGLA 3UDCA 3M55A 2FL7A 3WXMB 4B9XA 4C5IA 2E5QA 5GAN8 4M75B 1QVFS 3SWNC 2EIFA 4J8OA 4CI0C 4R56A 2WSFE 1VQOT 1VQ4A 2LX9A 4PLLA 4C5HA 2PU9B 4C8QC 3G6ET 3RKXA 5GANf 3S3NA 3HRTA 4C8QA 4M7DB 5GAN6 2LQ8A 3X24B 3J81E 4L59A 2RB6A 2XDPA 1JJ2S 2JTMA 3G4ST 4ZN3A 4BACA 4BE2A 1VQNT 1SSFA 1DJ7B 3ZEHA 2D9TA 3LLRA 4LD6A 3C4SA 1YBYA 4OB1B 2XK0A 3M53A 3A8OB 5GANj 4EDUA 1NPPA 2ZPFB 2EYQA 3DB3A 3ZBDA 2DD4A 2OTLT 4XU2A 4E7JA 2RH2A 4QW2A 1OYXA 1N27A 1Q81C 1KQ2A 2RJFA 2E6NA 1KHCA 2L89A 3QJYA 2L8DA 3RIRA 3CMET 4KBMB 4BE0A 3QDRB 3I56A 3PIPA 3JCMJ 4QVCA 2X35A 3RKWA 3QO3A 3LWHA 3JCMe 2H3JA 3A8MB 4BB7A 3CMAT 2VGMA 3CCUA 4J6WA 4EMGA 2K3YA 2VYTA 3GF5A 3Q1JA 4FT4A 1VQ9T 2QA4A 1VQ7T 2XDBA 4M77C 3GIBA 5LJ5j 3OBYA 3V8LA 2EQUA 1WPYA 4OGEA 4UC4A 3L2QA 3CCRA 3ER0A 4BY6C 5DLOA 3I56T 3JCMc 4M7AD 4M7DD 2RHXA 4QQDA 1QP2A 2RO0A 1KC8C 2K4YA 1K73C 4RCCA 3GOXA 2KAFA 4B9WA 1VQ6T 1QW1A 4M7AA 2WACA 1I8FA 1NJIC 2ZPGB 4PKCC 5A0DA 3CC7T 1N9SA 1Y71A 2RI5A 1QVGS 3AHUA 5KCHA 3JB9J 2KY9A 4EMKC 4A4KA 4MMKA 3T9NA 2ZPBB 2RD1A 4J6YA 4LDVA 1WJQA 3CBPA 3MEVA 1VQ7A 3GNGA 3FB9A 1VQNA 1XQHA 3M9QA 3JCMf 1VQ9A 1GXIE 1KG1A 3G71A 2QXFA 1Q82C 3QHSA 3JRZA 5GMKi 3OB9A 3GNFB 1UGRB 3MP8A 3E9GA 5A2QE 4A4GA 2K5FA 3UWNA 4M7AG 2WSCE 4XTUA 5GAOm 2ZPHB 2M1HA 2GF7A 4M75E 2VXEA 3ASKA 4ATOA 3MP6A 3CMEA 1VIEA 2PVDB 4TVRA 2DZ9A 5CKDA 1U1TA 3I55A 2LT1A 2VV5A 3BW1A 1KD1U 1M9SA 2R5AA 1KQSA 4HCBA 2FVUA 3P8HA 2CZ1B 2MI6A 2EQJA 4BI3A 1N8RC 4Y28E 5KE3A 1YJWA 1K8AU 3HP9A 2DPPB 5CO7A 4HA8A 5FROA 4OB2B 3HRSA 3JB9I 3J80E 3LWIA 3MEAA 4NOYA 1BIBA 4C92C 2P0KA 3PMTA 2E12A 4C8QE 3MO8A 5GANd 4OP0A 2RI3A 1MGQA 4FU6A 1VQ5T 2X4WA 4L5GA 4A54A 2O01E 4CRIA 2K57A 1WQWA 4O5VA 1B34B 1IREB 2JN0A 5A0LA 2C06A 4PJOA 1H3ZA 3VUBA 5GAN3 2NLUA 3X20B 5LJ5h 1M90U 4M7DC 1JRIA 4MDWA 1LJOA 4C0DB 1H641 1UGQB 1UGPB 3M56A 4M77B 1VQ6A 3CCVT 4XTZA 2CKKA 5LJ3h 4M7AB 1I5LA 2MMPA 2V8KA 5J39A 1U1SA 1M4ZA 2RHZA 2RHUA 4M78F 4RG8A 4BDYA 2KQWA 3FIFA 4ME7A 3TEEA 3JB9G 1B34A 4MMLA 4M7DA 4LDXA 2F5TX 4EMHA 4LD9K 4LDYA 5HKCA 4M77E 4F7UE 1BI1A 4M75G 2FB7A 2I2LA 2MWOA 2CZ7B 4PLIA 1G3WA 1XTDA 3SD4A 4X34A 5GMKl 1BI2A 3OYEA 3PGGA 2A7YA 4GY5A 4ZTJA 2A3LA 3CCEA 2OTJT 2BUDA 2X4YA 5DY9A 2K5IA 4OB0B 2RJDA 2JOYA 4QVZA 5LJ3e 3L42A 3OS2A 4XTXA 2QA4T 4RG2A 4A4HA 2EJFA 5KH6A 2PVOB 2JTFA 5CKEA 3FLGA 5LJ3d 5HK0A 5HY6A 1XNIA 2E41A 1YJWT 1M1GA 2QDYB 2RK1A 3NTHA 2R58A 2YRVA 2BKDN 4F7UG 3CEYA 4J6XA 2F69A 5LJ5f 3OYNA 3QG1A 4F7UB 2M0OA 5FU6C 3WVEB 4LDWA 3RERA 4C92F 5GAN4 5GAN7 1YIJA 2R57A 3OSSC 3X26B 1G3SA 4MZPA 3JCMP 1BIAA 3M59A 4P5NA 3OYDA 2ZGWA 5A0GA 2OTLA 3PMIA 5GAOp 3CCJA 3CMAA 5J3BA 1W2BA 2LC4A 3L2ZA 1M1FA 2QQRA 2V8JA 4KUIA 5EG2A 4R55A 3L2WA 4JRQA 3CBOA 3CPFA 5D6WA 3S3MA 3A8GB 2CYZB 1O75A 4C0GA 4E7KA 5IN1A 3P8BB 5CKFA 1WQ7A 1ZBXA 2DEQA 3OMGA 3DLLA 1YIJT 4XK8E 4C5EA 4M77D 4PNOA 2CZ6B 1M8VA 4C8QG 2EQMA 4N4HA 5M9OA 3QXEB 2DO3A 4V2SA 3ME9A 3META 3MEUA 1XOVA 3OW2A 2FHDA 1NZ9A 4D6WA 3JCMg 4HCCA 1NE8A 3GP8A 2LRQA 3EFSA 1N8RU 2L3RA 5GMKm 3QYHB 5GAOr 4ZGDB 1D3BB 2DIGA 1VUBA 4JJNK 2GQVA 2XHCA 2O4XA 4J7FA 4M75F 3CXCA 2JNGA 2ZCFB 1KHIA 2QQ9A 2EFIA 2F5KA 2LQKA 4OF1A 4Y91A 3GPLA 3CCLT 2LNVA 4C92G 4E7IA 1AHJB 1TH7A 3BDLA 4M75D 3RMQA 5HK3A 5FRNA 2LVMA 3MHXA 4X9CA 1EIFA 2E70A 4JUVA 1QVGA 4IKFA 5C0MA 1VQMA 1OI1A 2CS7A 2EQKA 4X9DA 3SDZA 1VQMT 1M90C 1Q86U 4PL6A 2KK4A 2XDDA 3CCLA 3L2UA 5FU6B 5I2SA 3LX7A 3OYLA 4M78A 4C0ZA 3URGA 3OYGA 3RKYA 4JRIA 2WSEE 5GAOn 2AHJB 4DOWA 4M78D 2QTXA 3FEOA 4QVDA 1K9MC 5LJ5g 3QYGB 4Z02A 1V29B 1FXXA 3CCET 1QVFA 2OTJA 3DKMA 4PJOF 3V7SA 3I55T 2G3RA 3OSVA 1M1KC 5LJ3g 4ELZC 1NJIU 2B8AA 3FJPA 4EMKA 3E1SA 1BI3A 4FL6A 1Q7YU 3MP1A 1LOJA 5CQYA 3FC3A 5DM7R 4C8QB 1YITA 1K73U 1KD1C 2PUOB 2RA2A 3OY9A 1FWZA 3OYCA 2E64A 1UEBA 3PTAA 3OBWA 2VUBA 3C12A 4JDSA 4OVAA 3BFMA 2LTOA 1WGSA 3N5BB 2EAYA 3LYIA 4M7DG 2DIQA 3BY7A 3SWNB 3JB9F 4XAXB 4Q5WA 2MF2A 2GCXA 3KBGA 4M7DF 4C92B 4PJOE 1VQPT 4OGCA 3CC4A 3C95A 4FM4B 3NFCA 4MZMA 5GMKe 1VQ8T 2KSSA 4C5GA 1N9RA 1VQKA 2D0QB 5CKHA 1KQ1A 3LGFA 1Q82U 2HD0A 2BIVA 1Y96B 3P8DA 3E9FA 5DLQE 2EWNA 5GAMh 2ZZDA 3JCMV 5KCOA 4C0DC 1N6AA 2E65A 4BE1A 1YI2T 5FRMA 5IT9E 1JB0E 3PT9A 2XG8D 4HKEA 4M7DE 2DXTA 2XKOC 5LJ5e 2DXUA 3HPWA 3SFMA 3CCRT 3CCMA 3OYMA 5GANg 4KUDK 3FRNA 1BI0A 5KE2A 5GAN2 1VQPA 1QP3A 1Y07A 3GLXA 2EJGA 3HL8A 4WF2A 1JJ2A 4HCZA 5AYFA 4MDXA 4XU0A 2DTHA 1HK9A 4L6V5
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N0A A;  4F7U B;  1I81 A;  2VXF A;  4M77 A;  4M77 C;  4XTW A;  4N0A C;  4F7U A;  3V8L A;  5LJ5 j;  3JCM d;  4C92 F;  2CGH A;  1WPY A;  3GIB A;  4C92 A;  5LJ3 f;  5GAN 4;  3HFN A;  5GAN 7;  3VU3 C;  5GAO q;  3JCM P;  1BIA A;  3SB2 A;  4PJO B;  3JCM c;  4C8Q D;  2ZGW A;  3HSB A;  4M7A D;  4M7D D;  5GAO p;  2YLC A;  4XU3 A;  3JCM Q;  1I5L A;  3L2Z A;  4C8Q F;  4M75 A;  4RCC A;  3V8J A;  5GAN 5;  4M7A F;  4M7A A;  1I8F A;  4XTY A;  5GMK j;  2E1H A;  4JRK A;  3HFO A;  1N9S A;  2FYK A;  4M78 B;  5GAN e;  3AHU A;  3JB9 J;  4PJO D;  1WQ7 A;  2Y90 A;  4EMK C;  4XTV A;  2DEQ A;  2EJ9 A;  2YHT A;  4MMK A;  4C92 E;  4M7A C;  2RD1 A;  4J6Y A;  1X01 A;  3M4G A;  4F7U F;  3RER A;  4M77 D;  4PNO A;  3SWN A;  1M8V A;  1YCY A;  4C8Q G;  4J5Y A;  3JCM X;  3FB9 A;  3RUX A;  3L1A A;  3JCM f;  5GAN h;  4V2S A;  4HT8 A;  3QHS A;  5GMK i;  2DTO A;  1I4K 1;  3V8K A;  3JCM g;  4M7A G;  3EFS A;  2DKG A;  4XTU A;  5CAI A;  5GMK m;  5GAO m;  2DTI A;  4DQ2 A;  1D3B B;  2VXE A;  4M75 E;  4NL3 A;  5GAO r;  5GAO l;  4A53 A;  4M75 F;  2DZ9 A;  1U1T A;  2DVE A;  2DJZ A;  3BW1 A;  4Y91 A;  4C92 D;  3EFR A;  4PJO G;  4C92 G;  4M75 D;  1TH7 A;  3V7C A;  5GAM g;  5GAM j;  1D3B A;  4M77 G;  4X9C A;  4JUV A;  4XQ3 A;  3JB9 H;  3V7R A;  4PJO C;  5GAM e;  5GAM f;  3QUI A;  4XU1 A;  4X9D A;  1JBM A;  4HA8 A;  3JCM W;  3BDU A;  3JB9 I;  4NOY A;  4M78 G;  1BIB A;  1LNX A;  4C92 C;  4M78 A;  4C8Q E;  5GAN d;  4OP0 A;  3RKY A;  1MGQ A;  4JRI A;  4M78 C;  3RES A;  5GAO n;  1HXD A;  1M5Q 1;  2QTX A;  4M78 D;  4QVD A;  1WNL A;  4A54 A;  3JB9 D;  2K57 A;  4M7D C;  4M77 F;  5LJ5 g;  4M75 B;  1WQW A;  4JLI A;  1B34 B;  2JN0 A;  3SWN C;  5GAN 8;  5GAM d;  4PJO A;  3V7S A;  4PJO F;  5GAN 3;  5LJ5 h;  4NL2 A;  5LJ3 g;  1JRI A;  3FJP A;  1LJO A;  4EMK A;  2DZC A;  1H64 1;  4M77 B;  1LOJ A;  2E10 A;  3JCM h;  4M78 E;  4C8Q B;  4XTZ A;  3RKX A;  5LJ3 h;  2RA2 A;  4M7A B;  4C8Q A;  4C8Q C;  5GAN 6;  2E64 A;  5GMK h;  5GAN f;  4M7D B;  2RB6 A;  3BFM A;  1U1S A;  4M78 F;  2VC8 A;  2EAY A;  4M7D G;  3BY7 A;  3JB9 F;  3FIF A;  3SWN B;  3JB9 G;  1B34 A;  4M7D F;  4MML A;  4C92 B;  4M7D A;  1Y96 A;  4PJO E;  4EMH A;  5LJ5 d;  4RCB A;  4M77 E;  5GMK e;  4F7U E;  4HT9 A;  1N9R A;  4M75 G;  2FB7 A;  2I2L A;  1KQ1 A;  5GMK l;  5GAN j;  1Y96 B;  2HNI A;  3PGG A;  2EWN A;  5GAM h;  3JCM V;  5DY9 A;  2YLB A;  5LJ3 e;  2E65 A;  4XU2 A;  4XTX A;  2EJF A;  5LJ3 j;  1KQ2 A;  4M7A E;  4M7D E;  2DXT A;  3RIR A;  5LJ3 d;  5LJ5 e;  2DXU A;  2E41 A;  3JCM J;  2RM4 A;  3INZ A;  4M75 C;  3RKW A;  4QVC A;  4EMK B;  3JCM b;  3QO3 A;  5GAN g;  5I21 A;  3JCM e;  3QSU A;  5GAN 2;  2EJG A;  4WF2 A;  4J6W A;  4J6X A;  4EMG A;  4F7U G;  4XU0 A;  2DTH A;  1HK9 A;  5LJ5 f; 
#chains in the Genus database with same CATH topology
 1XJW B;  1VQK T;  4JRP A;  5FU7 C;  4XTW A;  2X4J A;  3ZFJ A;  4C0F A;  1S72 A;  1SPK A;  5L8R E;  2R5M A;  4BI4 A;  1UHC A;  3EGX A;  3TCJ A;  1F1B B;  4M75 A;  5GAN 5;  4JLG A;  4M7A F;  3QPH A;  2DVJ A;  3G71 T;  2QGG A;  2C0I A;  2EJ9 A;  4FYY B;  4M7A C;  1KQS P;  3L2V A;  1AD5 A;  1ZUU A;  4J5Y A;  4O6J A;  1KC8 U;  2FPE A;  3EG1 A;  2PUK B;  6AT1 B;  1G83 A;  1BYM A;  2HSP A;  1WHH A;  1VQL Q;  2LQW A;  4AFQ C;  2DJZ A;  1LVK A;  4C92 D;  1YI2 A;  3CCQ A;  3R6O A;  3V7C A;  3OA6 A;  5GAM g;  2FZK B;  3JB9 H;  2HQE A;  4ZTF A;  2XID A;  4XU1 A;  3JCM W;  2MAM A;  1WHK A;  3BE3 A;  1X6O A;  1Q86 R;  4EIK A;  3TU4 K;  4ELY C;  3TSZ A;  2H3E B;  2PVG B;  4DBH A;  4NL2 A;  1Q82 R;  1ZX6 A;  3OS1 A;  1RUW A;  2DZC A;  4BD3 A;  1VQL T;  1WA7 A;  5FU7 B;  2P4T A;  2K2V A;  3M54 A;  2OX7 A;  4FT2 A;  2VC8 A;  1W6X A;  4LUE A;  1TU0 B;  1NM7 A;  4ZGE B;  3M4Y A;  2DAQ A;  4D8K A;  1KSW A;  4WTO B;  2YLB A;  2DK3 A;  4Z8A A;  2HQX A;  2XI9 A;  1M1K U;  4PJJ A;  4MZT A;  4IUV A;  2PZ1 A;  2RM4 A;  4M75 C;  3JCM b;  4EMK B;  3CCM T;  5I21 A;  5IH2 A;  1C0M A;  4J9G A;  1VIF A;  3OYB A;  3PIO A;  1BCO A;  4M77 A;  3X28 B;  4F7U A;  4N0A C;  3JCM d;  1OU9 A;  2KDS A;  4LE9 A;  4LN2 A;  4ZGJ B;  2CP3 A;  3OQ5 A;  1YJW Q;  3OYY A;  2CUD A;  2M16 A;  3JCM Q;  3AT1 B;  4DOV A;  1AOJ A;  1YI2 Q;  1ABQ A;  4RTT A;  1VQL A;  4LDU A;  4XTV A;  2DL7 A;  1OZ3 A;  1X27 A;  3CC7 Q;  4IUP A;  3G4S A;  1GRI A;  4Y92 A;  1YCY A;  3H0H A;  3JCM X;  3A8L B;  1VQ9 Q;  3L1A A;  1JXO A;  1UJ0 A;  5GAN h;  1YJN Q;  1I4K 1;  3V8K A;  3CCS T;  4J83 A;  1PNJ A;  3HRU A;  1BKB A;  1ZQ1 A;  2CH4 A;  3CC7 A;  3CCQ T;  4KGZ B;  3VS6 A;  4XQ3 A;  1QQJ A;  2CT3 A;  1YJN A;  4AG2 C;  2P0P A;  3QZ9 B;  2KYM A;  2RQW A;  2K3B A;  5CK9 A;  2LCL A;  3LGL A;  3M55 A;  2FL7 A;  4C5I A;  5GAN 8;  1VQ8 Q;  2WSF E;  1VQO T;  1NBE B;  4FYW B;  4C8Q A;  3X24 B;  4LNP A;  3J81 E;  2RB6 A;  2XDP A;  5KYW A;  4BE2 A;  2CP5 A;  3VS7 A;  3ZEH A;  2COZ A;  3C4S A;  2XMF A;  5GAN j;  4EDU A;  1NPP A;  2ZPF B;  1R0B G;  5FWB A;  2E3I A;  2OTL T;  1IHW A;  1WXT A;  4QW2 A;  4M7A E;  3CME T;  2L89 A;  4QKU A;  3PIP A;  2GNC A;  3LWH A;  3JCM e;  2H3J A;  2ROT A;  4AFZ C;  1GCP A;  4GBQ A;  3L2Q A;  4BY6 C;  4AT1 B;  3I56 T;  2RHX A;  2H8H A;  4WCI A;  1QP2 A;  1KC8 C;  1VQ6 T;  2FZC B;  2HEQ A;  2WAC A;  4PKC C;  5A0D A;  3CC7 T;  1N9S A;  1Y71 A;  1QVG S;  2KY9 A;  4EMK C;  1SRL A;  3EG9 B;  1OOT A;  2LJ1 A;  2ATC B;  4F16 A;  1NYG A;  5I11 A;  2JMC A;  3GNG A;  1VQN A;  3M9Q A;  1KG1 A;  3GBQ A;  2QXF A;  1Q82 C;  5IXB A;  3OB9 A;  1BBZ A;  3GNF B;  3UWN A;  2M1H A;  2MCN A;  4M75 E;  3ASK A;  5KYN A;  3CME A;  1TG0 A;  2PVD B;  2LT1 A;  1M9S A;  2FVU A;  1X43 A;  2MI6 A;  4BI3 A;  2CT4 A;  1YP5 A;  3D7S B;  2ABL A;  1WLP B;  4JZ4 A;  3I5S A;  4FW1 A;  3HRS A;  1E7O A;  3MEA A;  1BIB A;  4C92 C;  3MO8 A;  2RI3 A;  4L5G A;  4CRI A;  3H9N A;  1B34 B;  1IRE B;  2P84 A;  3MPU B;  3VUB A;  2A08 A;  1LJO A;  2RQU A;  4M77 B;  3RNJ A;  2J05 A;  5J39 A;  2RHZ A;  2K7A A;  4Z89 A;  4M75 G;  4D8D A;  2MWO A;  1M3C A;  2CZ7 B;  3NGP A;  2MIO A;  1XTD A;  4ORZ A;  3CCE A;  2OTJ T;  5DY9 A;  1BB9 A;  2K5I A;  3OS2 A;  2AT1 B;  2J6O A;  3L42 A;  4QVZ A;  4XTX A;  5KH6 A;  3O5Z A;  2RQR A;  2DET A;  2E41 A;  1M1G A;  5KYX A;  2LMJ A;  3OYN A;  3QG1 A;  4F7U B;  3RER A;  5GAN 4;  3JCM P;  3M59 A;  3OYD A;  2HQH A;  3U23 A;  3PMI A;  3L2Z A;  2A36 A;  4JRQ A;  5EG2 A;  3CBO A;  5D6W A;  1ZLM A;  2HKN A;  4C0G A;  2EGA A;  2NUT B;  2KEA A;  3DLL A;  2F1L A;  4PNO A;  1M27 C;  4C8Q G;  1YHQ Q;  1SHF A;  2DNU A;  3OW2 A;  1NZ9 A;  1NE8 A;  4FSS A;  2CP6 A;  2GQV A;  4M75 F;  2JNG A;  1BCM A;  4OF1 A;  3GPL A;  4E7I A;  3RMQ A;  3CC2 Q;  2EQK A;  3SDZ A;  2XDD A;  2DFU A;  5I2S A;  2QA4 Q;  2OAW A;  5GAO n;  1K9M C;  2KBT A;  1D09 B;  1QVF A;  4OMM A;  3I55 T;  1M1K C;  4J9E A;  1IGQ A;  2B8A A;  1OEB A;  4FL6 A;  2DIL A;  2HSE B;  1K73 U;  4C8Q B;  1KD1 C;  2E64 A;  4OVA A;  3RR6 A;  2SRC A;  4M7D G;  2DIQ A;  1A0N B;  3SWN B;  1LCK A;  1UG1 A;  2MF2 A;  3KBG A;  2A28 A;  2KSS A;  4C5G A;  1N9R A;  5CKH A;  1KQ1 A;  1Y96 B;  3P8D A;  3E9F A;  5DLQ E;  4JJD A;  4C0D C;  1YI2 T;  1SF9 A;  2E65 A;  3M0U A;  1JB0 E;  1VQ4 Q;  4HKE A;  2DXT A;  1Y57 A;  4J9F A;  5LJ5 e;  2DXU A;  3EG3 A;  4E7S A;  3SFM A;  3CCR T;  2CP0 A;  5GAN 2;  3HL8 A;  4MDX A;  4XU0 A;  2DTH A;  4L6V 5;  3TRE A;  8AT1 B;  3A8H B;  2V1Q A;  3A5Z B;  4RUG A;  5D6X A;  1SRM A;  2CSI A;  1TTH B;  1I07 A;  4HXJ A;  4QQ6 A;  4C8Q D;  3CC2 A;  3MCA B;  1PSE A;  1NPR A;  3V8J A;  1SSH A;  1Y7X A;  4XTY A;  2AZS A;  2QQA A;  1Q81 U;  5GAN e;  4C92 E;  2V8I A;  2DL5 A;  4Z88 A;  1S72 T;  3CCQ Q;  1X01 A;  1MMG A;  1X6G A;  4FIB A;  1B7T A;  5CVI A;  5CR2 A;  3PVL A;  1W4S A;  2JVV A;  2F2X A;  1WJR A;  4J7I A;  2PNI A;  1QVG P;  2BZ8 A;  2JTE A;  4DQ2 A;  3CCL Q;  1YJ9 A;  1P92 A;  4OB3 B;  1Q7Y R;  2IPO B;  4E47 A;  1E6H A;  3VUZ A;  2FO0 A;  4PJN A;  4JS4 A;  5GJV B;  3KXT A;  1ZUY A;  3HTR A;  3QUI A;  3VYH B;  3G71 Q;  4X1V A;  3CXC S;  1LNX A;  5IAY A;  1QVF P;  2DMO A;  3JB9 D;  4M77 F;  1K0X A;  4JLI A;  2K2M A;  2ENM A;  1ARK A;  3VS1 A;  1OZ2 A;  2E10 A;  5IHI A;  3CC4 T;  1RL2 A;  3CCM Q;  1NJI R;  2ZPE B;  3CPW P;  2EPD A;  4N4G A;  3VKI A;  1H3H A;  3X25 B;  3NHN A;  1Y96 A;  2Y4X A;  4RCB A;  1YIT T;  4BY6 B;  2L5Q A;  3QBY A;  1OU8 A;  4CC2 A;  4GLK A;  2KGT A;  2NUZ A;  1RAB B;  3OYK A;  2QAZ A;  1HSQ A;  3CCV A;  2QQS A;  3INZ A;  4IUQ A;  3QSU A;  5I2M A;  1LPL A;  3CCS A;  3HKS A;  1D1C A;  1VQP Q;  1S1N A;  3H41 A;  4KT0 E;  4ZN1 A;  4N0A A;  3M0S A;  5LJ3 f;  1RAC B;  2YLC A;  4C8Q F;  2YRC A;  3CCU T;  3VRY A;  2E1H A;  5LL6 S;  2M0Y A;  3MEW A;  1Q7Y C;  1RAE B;  2YHT A;  2ZAE A;  1VOM A;  3M4G A;  1TS9 A;  3SWN A;  2RN8 A;  3VJP A;  2QEX A;  2D8H A;  4PK4 A;  2E6Z A;  5J26 A;  3OS0 A;  1CSK A;  1AT1 B;  4A4F A;  2Y4Y A;  1K76 A;  2E5K A;  3RBB B;  1Q86 C;  2LT4 A;  3OMC A;  3QJ6 A;  3CPW S;  4KGX B;  3NTI A;  4RKU E;  4PJO C;  1RLQ C;  2KRM A;  2O88 A;  1YHQ A;  2MYS A;  2RJE A;  4HVV A;  2RI2 A;  2JXB A;  3RES A;  1GFC A;  4R0K A;  1HXD A;  1J3T A;  1JQQ A;  2W10 A;  2E5Q A;  1QVF S;  3SWN C;  2J7I A;  2CRE A;  1VQ4 A;  4C8Q C;  3CCS Q;  4L59 A;  1AZE A;  1JJ2 S;  2JTM A;  3CCV Q;  4BAC A;  3PVQ A;  1VQN T;  1CKA A;  1SSF A;  3LLR A;  1TXQ A;  3REA B;  4DEY A;  4FYX B;  2QG9 B;  1PHT A;  2EYQ A;  3DB3 A;  1BU1 A;  1FYN A;  2F2V A;  3ZBD A;  2COW A;  2DD4 A;  3UA6 A;  4XU2 A;  2V26 A;  2X9H A;  1KQ2 A;  1KHC A;  3QJY A;  1E6G A;  4BE0 A;  1BK2 A;  3QDR B;  3I56 A;  3QO3 A;  1T0H A;  4BB7 A;  1K0S A;  5KYX B;  3CCU A;  4EMG A;  2K3Y A;  3GF5 A;  4RTX A;  2LQN A;  2XDB A;  5LJ5 j;  2DBK A;  4UC4 A;  2NWM A;  2JW4 A;  3A1P A;  2GGR A;  4QQD A;  2YSQ A;  4RCC A;  4M7A A;  3VS4 A;  1UEC A;  3R6N A;  2ZPG B;  1NJI C;  2RI5 A;  1ZSZ B;  2KT8 A;  4MMK A;  4RTU A;  1W70 A;  3T9N A;  4J6Y A;  1SEM A;  2EVR A;  4LDV A;  3I5R A;  1RAA B;  1VQ7 A;  3MEV A;  3G71 A;  3QHS A;  3G4S Q;  1AEY A;  1TWB A;  1HJD A;  3EFO B;  2BE7 D;  2X3X D;  5A2Q E;  2K5F A;  4F04 B;  5GAO m;  2ZPH B;  2VXE A;  4ATO A;  2DZ9 A;  5CKD A;  1KQS A;  1KD1 U;  2C06 A;  1WZO A;  1NYF A;  4HCB A;  1N8R C;  5KE3 A;  1YJW A;  1K8A U;  2JS2 A;  3LWI A;  2EKH A;  2PTK A;  4FU6 A;  2X4W A;  4A54 A;  2O01 E;  2K57 A;  1V1C A;  1D1A A;  2M02 A;  5GAN 3;  3MKD A;  5LJ5 h;  2J06 A;  1M90 U;  3QWY A;  1JRI A;  4MDW A;  3QDF A;  1VQ6 A;  1UGP B;  1WIE A;  4XTZ A;  5LJ3 h;  4M7A B;  1WX6 A;  2MMP A;  2BZY A;  3CCR Q;  2FPD A;  3M0R A;  3EH1 A;  2KQW A;  3FIF A;  1PRL C;  3JB9 G;  1I1J A;  4M7D A;  2OTL Q;  2F5T X;  4PFO A;  2O9V A;  2LP5 A;  4LDY A;  2DF6 A;  1BI1 A;  2I2L A;  4JJC A;  5FW9 A;  4PLI A;  7AT1 B;  5GMK l;  3OYE A;  4ZTJ A;  1K4U S;  2BUD A;  1FMV A;  1VYU A;  4OB0 B;  2X4Y A;  3EHQ A;  1OUL A;  1VQP A;  2KRN A;  4A4H A;  2EJF A;  2PVO B;  1WI7 A;  2JTF A;  5CKE A;  3FLG A;  5HK0 A;  1XNI A;  1YJW T;  1PWT A;  2R58 A;  3CD6 Q;  5IHK A;  3CEY A;  4J6X A;  2F69 A;  4FCY A;  1C6V X;  3WVE B;  3UA7 A;  4C92 F;  1OX9 A;  3X26 B;  1AVZ C;  1SHG A;  4P5N A;  3UF4 A;  2ZGW A;  2OTL A;  1FMW A;  1W2B A;  3CMA A;  1NLO C;  1T0J A;  2LC4 A;  2P4R A;  3L2W A;  4R55 A;  3S3M A;  1QWF A;  1U5S A;  2GBQ A;  2CYZ B;  5HCK A;  4HCK A;  4XK8 E;  1M8V A;  1TUC A;  2DO3 A;  3A98 A;  1KK7 A;  2FHD A;  1PKT A;  3JCM g;  2FRY A;  1N8R U;  2L3R A;  1X69 A;  3QYH B;  3ULR B;  2DIG A;  2KYB A;  2NUP B;  3RDV A;  4CC4 B;  4J7F A;  1D0X A;  1KHI A;  2EFI A;  2QQ9 A;  4Y91 A;  4F14 A;  2LNV A;  4C92 G;  4M75 D;  1TH7 A;  1VYV A;  5FRN A;  5HK3 A;  1RAD B;  1QVG A;  3FJ5 A;  2CS7 A;  2KE9 A;  3CQT A;  3L2U A;  3RKY A;  4DOW A;  4QVD A;  3EGX B;  1OQK A;  2AK5 A;  4Z02 A;  1V29 B;  3CCE T;  3NMZ C;  1VQ7 Q;  2OTJ A;  4PJO F;  2G3R A;  3OSV A;  3E1S A;  1BI3 A;  5L23 A;  1YFN A;  3PTA A;  1FWZ A;  1UEB A;  1PG5 B;  2DER A;  2LTO A;  1WGS A;  3N5B B;  1UE9 A;  4M7D F;  3CC4 A;  1VQK A;  2D0Q B;  2YRD A;  1M1K R;  2BIV A;  2LX7 A;  2EWN A;  2C0O A;  5KYU B;  5GAM h;  1KIK A;  1YCS B;  4OML A;  4J9D A;  5FRM A;  3PT9 A;  4M7D E;  1ZA1 B;  1M30 A;  2LJ0 A;  4KUD K;  3CCM A;  3FRN A;  3UAT A;  3EGU A;  1BI0 A;  1JO8 A;  1QP3 A;  4WF2 A;  1JJ2 A;  2L3S A;  4HCZ A;  4FYV B;  1HK9 A;  3QII A;  1IB8 A;  2G6F X;  1ACM B;  3CXC P;  1I81 A;  4JJB A;  4NL3 A;  2X3W D;  2VVK A;  5KYY A;  5GAO q;  3CPW A;  2M51 A;  3OS5 A;  3HSB A;  4XU3 A;  2RHI A;  1MV3 A;  2PQW A;  1YJ9 T;  2RF0 A;  1UDL A;  3O8V A;  3HFO A;  4IUU A;  2JZ2 A;  2QDL A;  1X2K A;  3WVD B;  1TUD A;  2GFA A;  3M57 A;  2JS0 A;  2DEU A;  4HT8 A;  2DTO A;  1AWX A;  4DBF A;  4RTV A;  1MNE A;  2CH4 W;  2DKG A;  1PRM C;  2FRW A;  5KYY B;  1RAH B;  2X4X A;  2KI7 A;  1M3A A;  2NYS A;  5GAM j;  3QZ5 B;  1H8K A;  1IZ6 A;  3CCJ T;  2RHY A;  2CP7 A;  3BDU A;  2KVQ G;  1VYT A;  2YUQ A;  4KH1 B;  2K6D A;  1D0Z A;  2QK0 A;  4M78 C;  2LNH B;  4JZ3 A;  4BUG A;  3OYJ A;  5FLX E;  3OW2 S;  4M7D C;  2DBM A;  3VV0 A;  1MV0 B;  2HBP A;  3TQ7 P;  3EH2 A;  3H8Z A;  1QKX A;  4KUL A;  2HAX A;  2VAS A;  3JCM h;  1KQS S;  3KUF A;  1G3T A;  1I5O B;  3JV3 A;  5GMK h;  1M3B A;  1SG5 A;  2GFU A;  1K1Z A;  5FWC A;  1UJY A;  4J9H A;  3J7A F;  2LDM A;  5LJ5 d;  2VB6 A;  2CP2 A;  4HT9 A;  3DLM A;  1YIJ Q;  2KRO A;  4KRT A;  4YTL A;  3OYH A;  2HNI A;  4PJL A;  2DL4 A;  3OW2 P;  2OAU A;  1VQ6 Q;  1YWO A;  2BTT A;  3FDR A;  1WXU A;  1QLY A;  1MMD A;  4ESR A;  1YNZ A;  3M5A A;  4VUB A;  4J9I A;  1T3L A;  4FW2 A;  3RMS A;  5IXF A;  2P0Q A;  2NUP A;  2X51 A;  1CKB A;  3E19 A;  3VU3 C;  4PJO B;  2QQB A;  1IO6 A;  2Z0W A;  4DBR A;  1AWJ A;  2ROL A;  5GMK j;  1ZBJ A;  4N4I A;  1VQ8 A;  2YDL A;  2IVW A;  3TSW A;  5ECA A;  1X75 C;  2M9U A;  2K5L A;  3F70 A;  2RK2 A;  3MJX A;  3DB4 A;  3CC2 T;  1YWP A;  4GLM A;  2ED1 A;  4CC7 A;  3M58 A;  2QI2 A;  4IUT A;  2XU8 A;  1W2B S;  3VYG A;  5GAO l;  4OMO A;  2CDT A;  1ZA2 B;  2JUF A;  4PJO G;  2NUT A;  2DXC A;  3CD6 T;  1D3B A;  3OYF A;  2D1X A;  2DXB A;  5GAM f;  1YHQ T;  1VQO A;  1OPL A;  3SHW A;  3UT1 A;  4RTW A;  5C6S A;  5D6Y A;  2QGF B;  2D8J A;  2EKO A;  3WXM B;  1WDX A;  4B9X A;  4J8O A;  4R56 A;  4PFZ A;  2LX9 A;  2VKN A;  4PLL A;  4C5H A;  3G6E T;  3CMA Q;  5GAN f;  2DX1 A;  5GAN 6;  4M7D B;  1JXM A;  1DJ7 B;  1OPK A;  2D9T A;  4LD6 A;  3CCE Q;  3QWX X;  1W1F A;  3H0F A;  3A8O B;  2EBP A;  2DRM A;  2MK5 A;  1OYX A;  2RJF A;  2EQI A;  2DE0 X;  3I9Q A;  4KBM B;  1PCX A;  2HKQ B;  2BE9 B;  3JCM J;  2X35 A;  3RKW A;  3A8M B;  2VYT A;  3Q1J A;  3V8L A;  2EQU A;  4OGE A;  2A37 A;  3CCR A;  3ER0 A;  1M2O A;  4M7D D;  1WXB A;  2K4Y A;  1K73 C;  3GOX A;  1YN8 A;  3IQL A;  4E7Z A;  3JB9 J;  1Z9Z A;  4JPB W;  2ZPB B;  2RD1 A;  3CBP A;  1UFF A;  1XQH A;  2AZV A;  2YUN A;  3JCM f;  2QEX Q;  2RQV A;  1GXI E;  2A0F B;  2HMA A;  3JRZ A;  2E4H A;  3MP8 A;  2RNA A;  4DBQ A;  3MP6 A;  4TVR A;  3I55 A;  1X6B A;  2R5A A;  2SEM A;  2EQJ A;  1JJ2 P;  4Y28 E;  1C1A A;  1KJW A;  2DPP B;  3HP9 A;  5FRO A;  3EG0 A;  4OB2 B;  2P0K A;  3PMT A;  2E12 A;  4C8Q E;  4OP0 A;  1MGQ A;  2KXD A;  1VQ5 T;  4O5V A;  1WQW A;  1MND A;  1H3Z A;  2NLU A;  3VRZ A;  2FPF A;  1TSF A;  4C0D B;  1H64 1;  1UGQ B;  1I5L A;  2CKK A;  1QMC A;  3SEM A;  2V8K A;  1AWO A;  1U1S A;  1M4Z A;  4M78 F;  4BDY A;  3TEE A;  2HL5 C;  4J9B A;  4MML A;  2MOX A;  2QTV A;  4EMH A;  4LD9 K;  4E6R A;  4QT7 A;  1PD0 A;  2FB7 A;  2KNB B;  1G3W A;  3SD4 A;  1BI2 A;  4GY5 A;  2RJD A;  2JOY A;  2QA4 T;  4RG2 A;  2JM8 A;  2O31 A;  1K73 R;  2QDY B;  3NTH A;  2YRV A;  2EYY A;  2BKD N;  2AKL A;  2M0O A;  2DYB A;  4LDW A;  1G2B A;  1WHM A;  1YIJ A;  1BIA A;  3THK A;  4J9C A;  5A0G A;  1MMN A;  3CCJ A;  5J3B A;  4AG1 C;  1M1F A;  2V8J A;  2L3P A;  3CPF A;  2RPN A;  2OTJ Q;  1O75 A;  5IN1 A;  3P8B B;  1WQ7 A;  1EZZ B;  1ZBX A;  2DEQ A;  2BZX A;  4C5E A;  1MUZ A;  4M77 D;  1GCQ C;  2EQM A;  1K8A R;  4V2S A;  3ME9 A;  1PC0 A;  1XOV A;  4HCC A;  2KRS A;  3EFS A;  4F17 A;  3GP8 A;  5GMK m;  4ZGD B;  4JJN K;  1VUB A;  2DRK A;  2XHC A;  2O4X A;  3CXC A;  2LQK A;  1M90 R;  2ECZ A;  3MHX A;  4X9C A;  2E70 A;  4IKF A;  2DLP A;  1OI1 A;  1VQM A;  2B86 A;  1M90 C;  3CME Q;  1V76 A;  4M78 A;  1OV3 A;  3OYG A;  1B3Q A;  2WSE E;  1NLP C;  4M78 D;  3FEO A;  1MMA A;  5LJ5 g;  1IHV A;  2KXC A;  3DKM A;  1K9A A;  5LJ3 g;  1NJI U;  4EMK A;  1WFW A;  4PFP A;  3MP1 A;  1Q7Y U;  5DM7 R;  2JJ9 A;  1YIT A;  2IIM A;  3TVT A;  1W2B P;  3C12 A;  4JDS A;  2EAY A;  3JB9 F;  2HBW A;  1UUE A;  4XAX B;  4Q5W A;  1VQP T;  1U06 A;  1IRX A;  3C95 A;  2ED0 A;  3NFC A;  2EW3 A;  4MZM A;  5GMK e;  3LGF A;  3M0Q A;  1Q82 U;  2HZY A;  2ZZD A;  3JCM V;  5KCO A;  2J6F A;  2EYX A;  5IT9 E;  1D1B A;  2XG8 D;  2K79 A;  3HPW A;  3OYM A;  1ZUK A;  1WHG A;  1AZG B;  1D0Y A;  2VXF A;  2YUP A;  2GTJ A;  4LUD A;  1PD1 A;  1QCN A;  2CGH A;  3E2U A;  3HFN A;  1GCQ A;  1GL5 A;  3CC4 Q;  1YJN T;  5I22 A;  5CIU A;  1IXD A;  3JSC A;  2FYK A;  4M78 B;  4ANJ A;  2LJ3 A;  4CC3 A;  2LCC A;  1R0C B;  1G5V A;  5CKB A;  3RUX A;  2L0A A;  2COY A;  1T3S A;  1ZSG A;  1JEG A;  2C0T A;  1UTI A;  1HD3 A;  2DTI A;  4OMP A;  2CZ0 B;  4KH0 B;  1VQO Q;  1QVP A;  3C94 A;  1U8R A;  1R8O B;  2DVE A;  4IIO A;  3EFR A;  5CCA A;  4PJM A;  3CBM A;  1WHL A;  2E3H A;  1Q95 G;  3V7R A;  1ZHI A;  1JU5 C;  1JBM A;  2IG0 A;  3HHT B;  3PE0 A;  4M78 G;  2GQI A;  3PFS A;  1G3Y A;  3G7Z A;  2RJC A;  2ZPI B;  1K8A C;  2FEI A;  1RAI B;  1WNL A;  4BI8 B;  3S6W A;  5GAM d;  3S3O A;  1WHJ A;  4B6M A;  1RAF B;  5CQX A;  2DM1 A;  3H6Z A;  3G6E A;  4M78 E;  1K9M U;  4RMO A;  2O9S A;  4NS5 A;  4IUR A;  4DA4 A;  1WJS A;  4HVW A;  1GBR A;  2XD0 A;  2JMA A;  4E7H A;  1GFD A;  2MWP A;  2DD5 A;  4JS5 A;  1FX7 A;  3H0I A;  4AFU C;  2VGN A;  1RI0 A;  2W0Z A;  1UHF A;  1PSF A;  2L2P A;  4FSX A;  3PNW C;  3UPU A;  5LJ3 j;  3CD6 A;  2JT4 A;  1UB4 A;  2FG0 A;  1UGS B;  2KMT A;  3OYA A;  1EX4 A;  3OYI A;  1ZSZ C;  2CSQ A;  4K11 A;  3ZL7 C;  4OMF B;  3M0P A;  4C92 A;  3EGD B;  3SB2 A;  2F2W A;  5KYU A;  4E7L A;  1MHN A;  3QKJ A;  5IHN A;  1VQ4 T;  3I55 Q;  4JRK A;  3L2R A;  4BDZ A;  2Y90 A;  2XIC A;  3LW5 E;  3NTK A;  4F7U F;  3REB B;  1O9S A;  4E2F B;  4A4E A;  4A63 B;  4QQG A;  1PKS A;  2EYZ A;  2QAS A;  3JAM E;  2K3X A;  5CAI A;  2QEX T;  2D6F A;  4A53 A;  5EC7 A;  4EPC A;  4IIM A;  2O4X B;  1VQ5 A;  4M77 G;  1FMK A;  5GAM e;  3LH0 A;  4II1 A;  3G1J A;  2K9G A;  1Q81 R;  3EAE A;  1M5Q 1;  3UDC A;  9ATC B;  4M75 B;  2EIF A;  4CI0 C;  2D0N A;  1PM3 A;  2J6K A;  2PU9 B;  3S3N A;  3RKX A;  3HRT A;  2LQ8 A;  1NEG A;  2OI3 A;  3KFV A;  3G4S T;  4ZN3 A;  1N5Z A;  3EFO A;  1S72 Q;  1QWE A;  1YBY A;  1X2Q A;  4OB1 B;  2XK0 A;  3M53 A;  5GJW B;  2O2O A;  1ZSZ A;  1ABO A;  4E7J A;  2RH2 A;  1Q81 C;  1N27 A;  4HVU A;  2E6N A;  3RIR A;  2L8D A;  1I0C A;  4AFS C;  4ZNX A;  2YT6 A;  4QVC A;  1KD1 R;  2EYW A;  3G6E Q;  3CMA T;  2VGM A;  4J6W A;  3I35 A;  2AKK A;  4FT4 A;  1Z9Q A;  2QA4 A;  1KC8 R;  1VQ7 T;  4M77 C;  3GIB A;  3OBY A;  2KR3 A;  1WPY A;  1B07 A;  5DLO A;  3JCM c;  4M7A D;  4AMC A;  2RO0 A;  2I0N A;  1QCF A;  2KAF A;  3EG2 A;  4OMQ A;  1QW1 A;  4B9W A;  1AWW A;  1I8F A;  1TOV A;  3LH5 A;  3AHU A;  5KCH A;  2EGE A;  4A4K A;  2VWF A;  1M8M A;  3EG9 A;  1WJQ A;  3EHR A;  3FB9 A;  1VQ9 A;  1M2V A;  2FZG B;  3VS5 A;  5GMK i;  3M0T A;  1UGR B;  3E9G A;  1GBQ A;  4M7A G;  4A4G A;  2YXY A;  1R77 A;  2WSC E;  4XTU A;  2GF7 A;  1VIE A;  2RQT A;  1U1T A;  2VV5 A;  3BW1 A;  5D7U A;  2HDA A;  3P8H A;  2CZ1 B;  2JM9 A;  2MPX C;  5CO7 A;  4HA8 A;  3JB9 I;  3J80 E;  1U3O A;  4NOY A;  5GAN d;  1M2V B;  2JN0 A;  5A0L A;  1N8R R;  4PJO A;  3X20 B;  3M56 A;  4PJO D;  3CCV T;  1RI9 A;  5AT1 B;  2RHU A;  3NPF A;  4RG8 A;  4ME7 A;  1H92 A;  2ESW A;  1B34 A;  1IGU A;  4LDX A;  5HKC A;  4M77 E;  4F7U E;  4OMN A;  4KGV B;  1G8X A;  2DA9 A;  4X34 A;  1RAG B;  4DEX A;  3PGG A;  2A7Y A;  2A3L A;  5LJ3 e;  8ATC B;  2L3Q A;  1HYO A;  1K9M R;  5LJ3 d;  5HY6 A;  2DJQ A;  2HL3 A;  2RK1 A;  1YIT Q;  2YWW A;  4F7U G;  3C0C A;  2LCS A;  5LJ5 f;  3VS3 A;  5FU6 C;  5GAN 7;  2R57 A;  3OSS C;  1G3S A;  4MZP A;  1UGV A;  2V1R A;  5GAO p;  1VQ9 T;  2QQR A;  4KUI A;  1KFZ A;  3A8G B;  4E7K A;  1VQM Q;  5CKF A;  1VQ5 Q;  3OMG A;  2CUB A;  1YIJ T;  4RTY A;  3VS2 A;  2CZ6 B;  1Y0M A;  2GTO A;  4N4H A;  5M9O A;  1VQN Q;  2DL8 A;  3QXE B;  1SKU B;  3MET A;  3MEU A;  4D6W A;  2KT1 A;  2LRQ A;  5GAO r;  1EFN A;  1D3B B;  1QKW A;  2ZCF B;  1RLP C;  3CCL T;  2DYI A;  2F5K A;  1TUG B;  1AHJ B;  3BDL A;  2LVM A;  1EIF A;  4JUV A;  5C0M A;  1VQM T;  1NG2 A;  4X9D A;  1Q86 U;  1QCO A;  2KK4 A;  4PL6 A;  1YJ9 Q;  3CCL A;  5FU6 B;  3LX7 A;  3OYL A;  4C0Z A;  3EGD A;  3URG A;  3CCJ Q;  4JRI A;  2HCK A;  2RMO A;  2AHJ B;  2QTX A;  2AIR B;  3QYG B;  2YUO A;  1FXX A;  3V7S A;  5KYW B;  4ELZ C;  3FJP A;  1LOJ A;  5CQY A;  3FC3 A;  2EGC A;  2PUO B;  2RA2 A;  3OY9 A;  3OYC A;  3OBW A;  2VUB A;  3BFM A;  3LYI A;  3BY7 A;  1OX8 A;  1NEB A;  1VQK Q;  2GCX A;  4C92 B;  4PJO E;  4OGC A;  4FM4 B;  1VQ8 T;  1VA7 A;  2HD0 A;  4RTZ A;  3CCU Q;  1N6A A;  4BE1 A;  2XKO C;  2OJ2 A;  3I56 Q;  2DL3 A;  3VS0 A;  5GAN g;  4M4Z A;  5KE2 A;  2QYZ A;  1Y07 A;  3GLX A;  2EJG A;  4LXC A;  2LZ6 B;  5AYF A;  1WYX A; 
#chains in the Genus database with same CATH homology
 3TRE A;  3QII A;  1VQK T;  3A8H B;  3A5Z B;  1I81 A;  2VXF A;  5D6X A;  5FU7 C;  4XTW A;  4NL3 A;  2X4J A;  4JRP A;  2CGH A;  3ZFJ A;  3HFN A;  4C0F A;  1S72 A;  5L8R E;  2R5M A;  4QQ6 A;  5GAO q;  3CPW A;  4C8Q D;  3CC2 A;  4BI4 A;  3OS5 A;  3MCA B;  3HSB A;  1PSE A;  1YJN T;  4XU3 A;  1NPR A;  2RHI A;  3TCJ A;  4M75 A;  3V8J A;  5GAN 5;  4JLG A;  4M7A F;  2PQW A;  1YJ9 T;  3QPH A;  1Y7X A;  4XTY A;  3G71 T;  5CIU A;  3O8V A;  3JSC A;  3HFO A;  2FYK A;  2QQA A;  4M78 B;  5GAN e;  1Q81 U;  4IUU A;  2LCC A;  2EJ9 A;  2JZ2 A;  4C92 E;  4M7A C;  2V8I A;  3WVD B;  1S72 T;  1G5V A;  1X01 A;  3L2V A;  5CKB A;  4FIB A;  2GFA A;  3M57 A;  5CVI A;  4J5Y A;  4O6J A;  3RUX A;  5CR2 A;  1KC8 U;  1W4S A;  2JVV A;  4HT8 A;  2PUK B;  2DTO A;  1WJR A;  4J7I A;  2DKG A;  1BYM A;  2DTI A;  4DQ2 A;  1YJ9 A;  2CZ0 B;  1P92 A;  1QVP A;  3C94 A;  4OB3 B;  1U8R A;  2X4X A;  1R8O B;  2DVE A;  2DJZ A;  4C92 D;  1YI2 A;  3EFR A;  4E47 A;  3CCQ A;  5CCA A;  3VUZ A;  3R6O A;  3CBM A;  3V7C A;  3OA6 A;  5GAM g;  5GAM j;  3QZ5 B;  4JS4 A;  3JB9 H;  3KXT A;  2HQE A;  3V7R A;  1ZHI A;  4ZTF A;  2XID A;  3QUI A;  1IZ6 A;  4XU1 A;  1JBM A;  2RHY A;  3CCJ T;  3VYH B;  3JCM W;  2IG0 A;  3BDU A;  2KVQ G;  2MAM A;  3HHT B;  4M7A E;  4M78 G;  3CXC S;  1LNX A;  3PFS A;  1G3Y A;  3G7Z A;  2RJC A;  4M78 C;  1X6O A;  2ZPI B;  5IAY A;  1K8A C;  4BUG A;  1WNL A;  4BI8 B;  3JB9 D;  3OYJ A;  5FLX E;  4M77 F;  3OW2 S;  3TU4 K;  4JLI A;  3VV0 A;  3S6W A;  2HBP A;  4ELY C;  5GAM d;  3S3O A;  2PVG B;  3H8Z A;  4NL2 A;  1OZ2 A;  3OS1 A;  4KUL A;  5CQX A;  2DZC A;  4BD3 A;  1VQL T;  5FU7 B;  2HAX A;  2E10 A;  3H6Z A;  2P4T A;  2K2V A;  4M78 E;  3KUF A;  1G3T A;  3JCM h;  3G6E A;  3CC4 T;  1KQS S;  5GMK h;  1K9M U;  4RMO A;  3M54 A;  1RL2 A;  4NS5 A;  4IUR A;  2ZPE B;  4DA4 A;  4FT2 A;  1WJS A;  2VC8 A;  4N4G A;  3VKI A;  2GFU A;  2XD0 A;  3X25 B;  3J7A F;  1Y96 A;  4E7H A;  2LDM A;  2Y4X A;  5LJ5 d;  4ZGE B;  3M4Y A;  4RCB A;  2MWP A;  4HT9 A;  2DD5 A;  3DLM A;  4BY6 B;  1YIT T;  2L5Q A;  4JS5 A;  4YTL A;  1FX7 A;  2DAQ A;  3OYH A;  2HNI A;  3QBY A;  2VGN A;  2YLB A;  2DK3 A;  1RI0 A;  2OAU A;  1PSF A;  4GLK A;  3PNW C;  2HQX A;  4FSX A;  2XI9 A;  5LJ3 j;  3UPU A;  1M1K U;  3FDR A;  1UB4 A;  3OYK A;  3CD6 A;  4MZT A;  3CCV A;  1UGS B;  2KMT A;  2QQS A;  4IUV A;  3OYA A;  2RM4 A;  3INZ A;  4M75 C;  3JCM b;  4IUQ A;  4EMK B;  3OYI A;  3CCM T;  3QSU A;  5I21 A;  5I2M A;  3M5A A;  3CCS A;  1VIF A;  3OYB A;  4VUB A;  3HKS A;  4OMF B;  3PIO A;  4KT0 E;  4ZN1 A;  4N0A A;  4M77 A;  3X28 B;  3RMS A;  4F7U A;  4N0A C;  3JCM d;  2P0Q A;  4C92 A;  5LJ3 f;  2KDS A;  4ZGJ B;  3E19 A;  3VU3 C;  4PJO B;  3OQ5 A;  3SB2 A;  2QQB A;  3OYY A;  2M16 A;  2YLC A;  3JCM Q;  4E7L A;  1MHN A;  3QKJ A;  4C8Q F;  1VQ4 T;  4DOV A;  3CCU T;  5GMK j;  2E1H A;  4JRK A;  5LL6 S;  4N4I A;  1VQ8 A;  1VQL A;  3MEW A;  2IVW A;  3L2R A;  4BDZ A;  2Y90 A;  4LDU A;  2XIC A;  1Q7Y C;  4XTV A;  4PJO D;  2YHT A;  3LW5 E;  1OZ3 A;  3NTK A;  3M4G A;  4F7U F;  4IUP A;  3SWN A;  1O9S A;  1X75 C;  3G4S A;  1YCY A;  2M9U A;  3VJP A;  4A4E A;  3JCM X;  2K5L A;  3A8L B;  2QEX A;  3L1A A;  3F70 A;  2E6Z A;  5GAN h;  2RK2 A;  4QQG A;  3DB4 A;  5J26 A;  3OS0 A;  3CC2 T;  1I4K 1;  3V8K A;  4A4F A;  2Y4Y A;  3M58 A;  2QI2 A;  3JAM E;  2K3X A;  5CAI A;  3CCS T;  4IUT A;  4J83 A;  2QEX T;  2XU8 A;  3HRU A;  1W2B S;  1BKB A;  1ZQ1 A;  3VYG A;  4A53 A;  5GAO l;  2D6F A;  1Q86 C;  2JUF A;  2LT4 A;  4PJO G;  4EPC A;  3CC7 A;  3CCQ T;  2O4X B;  2DXC A;  3OMC A;  3QJ6 A;  3CD6 T;  3CPW S;  1D3B A;  4M77 G;  4RKU E;  3NTI A;  4XQ3 A;  3OYF A;  1VQ5 A;  4PJO C;  5GAM e;  2DXB A;  3LH0 A;  4II1 A;  5GAM f;  1YJN A;  1YHQ T;  1YHQ A;  1VQO A;  2P0P A;  2RJE A;  3QZ9 B;  3UT1 A;  5C6S A;  2RI2 A;  3RES A;  5CK9 A;  2LCL A;  5D6Y A;  3EAE A;  1HXD A;  1M5Q 1;  2EKO A;  3LGL A;  3UDC A;  3M55 A;  2FL7 A;  3WXM B;  4B9X A;  4C5I A;  2E5Q A;  5GAN 8;  4M75 B;  1QVF S;  3SWN C;  2EIF A;  4J8O A;  4CI0 C;  4R56 A;  2WSF E;  1VQO T;  1VQ4 A;  2LX9 A;  4PLL A;  4C5H A;  2PU9 B;  4C8Q C;  3G6E T;  3RKX A;  5GAN f;  3S3N A;  3HRT A;  4C8Q A;  4M7D B;  5GAN 6;  2LQ8 A;  3X24 B;  3J81 E;  4L59 A;  2RB6 A;  2XDP A;  1JJ2 S;  2JTM A;  3G4S T;  4ZN3 A;  4BAC A;  4BE2 A;  1VQN T;  1SSF A;  1DJ7 B;  3ZEH A;  2D9T A;  3LLR A;  4LD6 A;  3C4S A;  1YBY A;  4OB1 B;  2XK0 A;  3M53 A;  3A8O B;  5GAN j;  4EDU A;  1NPP A;  2ZPF B;  2EYQ A;  3DB3 A;  3ZBD A;  2DD4 A;  2OTL T;  4XU2 A;  4E7J A;  2RH2 A;  4QW2 A;  1OYX A;  1N27 A;  1Q81 C;  1KQ2 A;  2RJF A;  2E6N A;  1KHC A;  2L89 A;  3QJY A;  2L8D A;  3RIR A;  3CME T;  4KBM B;  4BE0 A;  3QDR B;  3I56 A;  3PIP A;  3JCM J;  4QVC A;  2X35 A;  3RKW A;  3QO3 A;  3LWH A;  3JCM e;  2H3J A;  3A8M B;  4BB7 A;  3CMA T;  2VGM A;  3CCU A;  4J6W A;  4EMG A;  2K3Y A;  2VYT A;  3GF5 A;  3Q1J A;  4FT4 A;  1VQ9 T;  2QA4 A;  1VQ7 T;  2XDB A;  4M77 C;  3GIB A;  5LJ5 j;  3OBY A;  3V8L A;  2EQU A;  1WPY A;  4OGE A;  4UC4 A;  3L2Q A;  3CCR A;  3ER0 A;  4BY6 C;  5DLO A;  3I56 T;  3JCM c;  4M7A D;  4M7D D;  2RHX A;  4QQD A;  1QP2 A;  2RO0 A;  1KC8 C;  2K4Y A;  1K73 C;  4RCC A;  3GOX A;  2KAF A;  4B9W A;  1VQ6 T;  1QW1 A;  4M7A A;  2WAC A;  1I8F A;  1NJI C;  2ZPG B;  4PKC C;  5A0D A;  3CC7 T;  1N9S A;  1Y71 A;  2RI5 A;  1QVG S;  3AHU A;  5KCH A;  3JB9 J;  2KY9 A;  4EMK C;  4A4K A;  4MMK A;  3T9N A;  2ZPB B;  2RD1 A;  4J6Y A;  4LDV A;  1WJQ A;  3CBP A;  3MEV A;  1VQ7 A;  3GNG A;  3FB9 A;  1VQN A;  1XQH A;  3M9Q A;  3JCM f;  1VQ9 A;  1GXI E;  1KG1 A;  3G71 A;  2QXF A;  1Q82 C;  3QHS A;  3JRZ A;  5GMK i;  3OB9 A;  3GNF B;  1UGR B;  3MP8 A;  3E9G A;  5A2Q E;  4A4G A;  2K5F A;  3UWN A;  4M7A G;  2WSC E;  4XTU A;  5GAO m;  2ZPH B;  2M1H A;  2GF7 A;  4M75 E;  2VXE A;  3ASK A;  4ATO A;  3MP6 A;  3CME A;  1VIE A;  2PVD B;  4TVR A;  2DZ9 A;  5CKD A;  1U1T A;  3I55 A;  2LT1 A;  2VV5 A;  3BW1 A;  1KD1 U;  1M9S A;  2R5A A;  1KQS A;  4HCB A;  2FVU A;  3P8H A;  2CZ1 B;  2MI6 A;  2EQJ A;  4BI3 A;  1N8R C;  4Y28 E;  5KE3 A;  1YJW A;  1K8A U;  3HP9 A;  2DPP B;  5CO7 A;  4HA8 A;  5FRO A;  4OB2 B;  3HRS A;  3JB9 I;  3J80 E;  3LWI A;  3MEA A;  4NOY A;  1BIB A;  4C92 C;  2P0K A;  3PMT A;  2E12 A;  4C8Q E;  3MO8 A;  5GAN d;  4OP0 A;  2RI3 A;  1MGQ A;  4FU6 A;  1VQ5 T;  2X4W A;  4L5G A;  4A54 A;  2O01 E;  4CRI A;  2K57 A;  1WQW A;  4O5V A;  1B34 B;  1IRE B;  2JN0 A;  5A0L A;  2C06 A;  4PJO A;  1H3Z A;  3VUB A;  5GAN 3;  2NLU A;  3X20 B;  5LJ5 h;  1M90 U;  4M7D C;  1JRI A;  4MDW A;  1LJO A;  4C0D B;  1H64 1;  1UGQ B;  1UGP B;  3M56 A;  4M77 B;  1VQ6 A;  3CCV T;  4XTZ A;  2CKK A;  5LJ3 h;  4M7A B;  1I5L A;  2MMP A;  2V8K A;  5J39 A;  1U1S A;  1M4Z A;  2RHZ A;  2RHU A;  4M78 F;  4RG8 A;  4BDY A;  2KQW A;  3FIF A;  4ME7 A;  3TEE A;  3JB9 G;  1B34 A;  4MML A;  4M7D A;  4LDX A;  2F5T X;  4EMH A;  4LD9 K;  4LDY A;  5HKC A;  4M77 E;  4F7U E;  1BI1 A;  4M75 G;  2FB7 A;  2I2L A;  2MWO A;  2CZ7 B;  4PLI A;  1G3W A;  1XTD A;  3SD4 A;  4X34 A;  5GMK l;  1BI2 A;  3OYE A;  3PGG A;  2A7Y A;  4GY5 A;  4ZTJ A;  2A3L A;  3CCE A;  2OTJ T;  2BUD A;  2X4Y A;  5DY9 A;  2K5I A;  4OB0 B;  2RJD A;  2JOY A;  4QVZ A;  5LJ3 e;  3L42 A;  3OS2 A;  4XTX A;  2QA4 T;  4RG2 A;  4A4H A;  2EJF A;  5KH6 A;  2PVO B;  2JTF A;  5CKE A;  3FLG A;  5LJ3 d;  5HK0 A;  5HY6 A;  1XNI A;  2E41 A;  1YJW T;  1M1G A;  2QDY B;  2RK1 A;  3NTH A;  2R58 A;  2YRV A;  2BKD N;  4F7U G;  3CEY A;  4J6X A;  2F69 A;  5LJ5 f;  3OYN A;  3QG1 A;  4F7U B;  2M0O A;  5FU6 C;  3WVE B;  4LDW A;  3RER A;  4C92 F;  5GAN 4;  5GAN 7;  1YIJ A;  2R57 A;  3OSS C;  3X26 B;  1G3S A;  4MZP A;  3JCM P;  1BIA A;  3M59 A;  4P5N A;  3OYD A;  2ZGW A;  5A0G A;  2OTL A;  3PMI A;  5GAO p;  3CCJ A;  3CMA A;  5J3B A;  1W2B A;  2LC4 A;  3L2Z A;  1M1F A;  2QQR A;  2V8J A;  4KUI A;  5EG2 A;  4R55 A;  3L2W A;  4JRQ A;  3CBO A;  3CPF A;  5D6W A;  3S3M A;  3A8G B;  2CYZ B;  1O75 A;  4C0G A;  4E7K A;  5IN1 A;  3P8B B;  5CKF A;  1WQ7 A;  1ZBX A;  2DEQ A;  3OMG A;  3DLL A;  1YIJ T;  4XK8 E;  4C5E A;  4M77 D;  4PNO A;  2CZ6 B;  1M8V A;  4C8Q G;  2EQM A;  4N4H A;  5M9O A;  3QXE B;  2DO3 A;  4V2S A;  3ME9 A;  3MET A;  3MEU A;  1XOV A;  3OW2 A;  2FHD A;  1NZ9 A;  4D6W A;  3JCM g;  4HCC A;  1NE8 A;  3GP8 A;  2LRQ A;  3EFS A;  1N8R U;  2L3R A;  5GMK m;  3QYH B;  5GAO r;  4ZGD B;  1D3B B;  2DIG A;  1VUB A;  4JJN K;  2GQV A;  2XHC A;  2O4X A;  4J7F A;  4M75 F;  3CXC A;  2JNG A;  2ZCF B;  1KHI A;  2QQ9 A;  2EFI A;  2F5K A;  2LQK A;  4OF1 A;  4Y91 A;  3GPL A;  3CCL T;  2LNV A;  4C92 G;  4E7I A;  1AHJ B;  1TH7 A;  3BDL A;  4M75 D;  3RMQ A;  5HK3 A;  5FRN A;  2LVM A;  3MHX A;  4X9C A;  1EIF A;  2E70 A;  4JUV A;  1QVG A;  4IKF A;  5C0M A;  1VQM A;  1OI1 A;  2CS7 A;  2EQK A;  4X9D A;  3SDZ A;  1VQM T;  1M90 C;  1Q86 U;  4PL6 A;  2KK4 A;  2XDD A;  3CCL A;  3L2U A;  5FU6 B;  5I2S A;  3LX7 A;  3OYL A;  4M78 A;  4C0Z A;  3URG A;  3OYG A;  3RKY A;  4JRI A;  2WSE E;  5GAO n;  2AHJ B;  4DOW A;  4M78 D;  2QTX A;  3FEO A;  4QVD A;  1K9M C;  5LJ5 g;  3QYG B;  4Z02 A;  1V29 B;  1FXX A;  3CCE T;  1QVF A;  2OTJ A;  3DKM A;  4PJO F;  3V7S A;  3I55 T;  2G3R A;  3OSV A;  1M1K C;  5LJ3 g;  4ELZ C;  1NJI U;  2B8A A;  3FJP A;  4EMK A;  3E1S A;  1BI3 A;  4FL6 A;  1Q7Y U;  3MP1 A;  1LOJ A;  5CQY A;  3FC3 A;  5DM7 R;  4C8Q B;  1YIT A;  1K73 U;  1KD1 C;  2PUO B;  2RA2 A;  3OY9 A;  1FWZ A;  3OYC A;  2E64 A;  1UEB A;  3PTA A;  3OBW A;  2VUB A;  3C12 A;  4JDS A;  4OVA A;  3BFM A;  2LTO A;  1WGS A;  3N5B B;  2EAY A;  3LYI A;  4M7D G;  2DIQ A;  3BY7 A;  3SWN B;  3JB9 F;  4XAX B;  4Q5W A;  2MF2 A;  2GCX A;  3KBG A;  4M7D F;  4C92 B;  4PJO E;  1VQP T;  4OGC A;  3CC4 A;  3C95 A;  4FM4 B;  3NFC A;  4MZM A;  5GMK e;  1VQ8 T;  2KSS A;  4C5G A;  1N9R A;  1VQK A;  2D0Q B;  5CKH A;  1KQ1 A;  3LGF A;  1Q82 U;  2HD0 A;  2BIV A;  1Y96 B;  3P8D A;  3E9F A;  5DLQ E;  2EWN A;  5GAM h;  2ZZD A;  3JCM V;  5KCO A;  4C0D C;  1N6A A;  2E65 A;  4BE1 A;  1YI2 T;  5FRM A;  5IT9 E;  1JB0 E;  3PT9 A;  2XG8 D;  4HKE A;  4M7D E;  2DXT A;  2XKO C;  5LJ5 e;  2DXU A;  3HPW A;  3SFM A;  3CCR T;  3CCM A;  3OYM A;  5GAN g;  4KUD K;  3FRN A;  1BI0 A;  5KE2 A;  5GAN 2;  1VQP A;  1QP3 A;  1Y07 A;  3GLX A;  2EJG A;  3HL8 A;  4WF2 A;  1JJ2 A;  4HCZ A;  5AYF A;  4MDX A;  4XU0 A;  2DTH A;  1HK9 A;  4L6V 5; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...