4M77B

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISSTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 20
structure length 91
sequence length 91
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77B00
2HNIA 4NOYA 2K57A 4M75B 3VU3C 5LJ3f 5LJ5f 5GANd 4PJOE 2CGHA 2DEQA 4M78E 4F7UE 4M7AD 2DKGA 4M77D 4C8QG 4NL3A 3JCMV 4XTXA 3JCMe 2E41A 4C92A 2DZCA 4PJOG 4XTWA 3V8JA 4XTZA 3JCMf 5DY9A 4M78G 4F7UG 3JB9G 5GAN8 2RB6A 5GAN3 2E10A 3M4GA 4M7DD 2EJGA 4M7AA 4M7AC 3JCMb 4M77A 4M77C 4HT9A 1D3BB 2YLCA 3RUXA 2VXEA 4DQ2A 5GANg 4C8QB 5GAOr 2YHTA 3QO3A 4M7DB 2E64A 5GMKe 4XTUA 3INZA 4PJOB 2E1HA 3HFOA 4M75D 4EMKA 1HXDA 3QSUA 3FJPA 4MMKA 4C92F 4F7UB 3AHUA 4M7DA 5GANh 4M7DC 4QVDA 3RKXA 4JRIA 5GAMf 3V7CA 3BW1A 3V7RA 2DZ9A 2YLBA 3SWNB 4M7AF 3FB9A 4HA8A 4M77F 4M75A 4M75C 3JCMc 2DXUA 1Y96B 1TH7A 5GMKi 3RESA 5GAOn 3RKYA 3RERA 4C92G 5GAN4 4X9DA 5GAMj 5LJ3j 5LJ5j 3HFNA 4C8QD 1WNLA 2Y90A 3EFRA 4PJOD 4A53A 1U1SA 4XU0A 4M78D 4XTVA 3JB9D 5GAMd 5LJ3d 5LJ5d 3L2ZA 1D3BA 1B34B 2DXTA 4J5YA 3JCMX 1KQ2A 4C8QA 4C8QC 1WQWA 4JUVA 4M78B 4OP0A 5GAN7 1KQ1A 4QVCA 2FYKA 3JCMd 2EWNA 5GAOl 4NL2A 5GAN2 4N0AA 4N0AC 3L1AA 3JCMW 4PJOA 4XQ3A 4M78A 1LNXA 4M78C 4F7UA 3RKWA 2I2LA 3GIBA 2EJFA 3BDUA 2DTHA 4C92E 5GANe 5GAOq 3JCMP 3EFSA 5GMKj 5LJ3g 5LJ5g 2VC8A 1HK9A 5GAMg 1X01A 3SWNC 3SWNA 5I21A 2VXFA 3JCMJ 2JN0A 2RD1A 2DVEA 4JRKA 4PNOA 4EMHA 5CAIA 5GMKm 4XTYA 2DTOA 1Y96A 4XU2A 5GAOp 3V8KA 4M7AE 4M77E 1BIAA 1U1TA 4RCCA 5GAMh 1LJOA 5LJ3h 3JCMg 5LJ5h 3HSBA 1I4K1 3JB9H 1YCYA 2EJ9A 3JB9J 4M7DF 4PJOF 3JB9I 4C92D 2E65A 4M7AG 4M77G 4XU3A 4V2SA 3JCMh 4M7DE 4M75F 4WF2A 4C92B 1BIBA 1I8FA 4EMGA 1B34A 4PJOC 2DJZA 4X9CA 4M7DG 1WQ7A 4C92C 4RCBA 3V7SA 3FIFA 5GANf 1M8VA 3PGGA 4M75E 5GAN6 5GAN5 2QTXA 4M7AB 4HT8A 4M77B 2RA2A 3BFMA 1JRIA 1JBMA 1MGQA 2ZGWA 4M75G 3SB2A 5GMKh 3QUIA 5LJ3e 3BY7A 2RM4A 4J6WA 1I5LA 3RIRA 5GMKl 4EMKB 4C8QE 4C8QF 4J6XA 1H641 1I81A 2FB7A 4A54A 4J6YA 4JLIA 1N9RA 5GANj 1N9SA 4EMKC 3V8LA 3QHSA 4Y91A 4M78F 4F7UF 3JCMQ 5GAOm 3JB9F 1LOJA 1WPYA 5GAMe 1M5Q1 4MMLA 5LJ5e 4XU1A 2DTIA 2EAYA
chains in the Genus database with same CATH superfamily
1QP3A 3OS0A 2HQEA 1OZ2A 1UHFA 1N6AA 3JCMV 1Y07A 4M78G 2KSSA 3FDRA 3CBPA 3NTIA 3QZ5B 1S72Q 1UJYA 4M7AC 2OTLQ 2YLCA 3RMQA 1VQ5Q 3A98A 1TS9A 4AFUC 1PHTA 2MMPA 2EQMA 1UGRB 1WJRA 4BI3A 2YDLA 3OQ5A 2RK1A 1WNLA 1NE8A 1YNZA 3NPFA 1X2QA 1CKBA 1G5VA 1NYFA 3NTKA 1GCQC 2JJ9A 2FVUA 4M78B 1VYUA 1PWTA 3HRTA 1VIFA 4NL3A 2VB6A 1YIJT 2CS7A 3CCLQ 2JW4A 3PVLA 2KDSA 4FW1A 3RBBB 1VQPT 1X01A 1D09B 4BDZA 4JRKA 1Y96A 4M77E 4X34A 1VQPA 2EBPA 2OI3A 1G2BA 1JU5C 1Y7XA 4M7DF 2DNUA 4JJBA 2E65A 4V2SA 2P4TA 2R5MA 1VQ8T 2VASA 2B8AA 1GFDA 3C0CA 3T9NA 3CCQQ 1I0CA 5HKCA 4NS5A 2ZPHB 1VQ8A 2XD0A 3M0QA 3OS1A 2PZ1A 4M75G 5I22A 1I5LA 3PMTA 3C12A 2ED1A 1MV0B 2CP7A 4ZTJA 1WPYA 3R6NA 2O31A 3E19A 4LNPA 5EG2A 1VQ9Q 3G71Q 4C92A 3VS4A 1YCSB 2D1XA 5DY9A 4F7UG 4FIBA 3TQ7P 3QWXX 2DETA 3RUXA 3LW5E 1W1FA 3A8MB 2XMFA 3EGXB 1ZBJA 1RI9A 5FU7C 3REBB 3X26B 2XIDA 3A8GB 3RKXA 3GOXA 4J9CA 4FYWB 1AWJA 2DL5A 4M77F 4BB7A 3RESA 1Y0MA 3SDZA 2JNGA 3M0PA 3SFMA 4KGVB 1AVZC 4JLGA 4HVUA 5GAMj 4AMCA 2LCCA 3M0UA 3CQTA 4PK4A 1EX4A 1TU0B 1WHLA 2DXTA 3J7AF 3FC3A 4E47A 3FEOA 1JB0E 2CZ0B 2Y4YA 5CVIA 1IGUA 4QQDA 3CC2Q 1YFNA 3LGLA 4KUIA 4QVZA 1HK9A 3UA6A 2VXFA 1ZHIA 3M56A 1QWFA 3DB3A 4F16A 3MCAB 2EYZA 2MPXC 2COZA 3L2QA 3OYKA 2CP0A 1NZ9A 5I11A 1M1FA 2DJZA 4X9CA 2OAWA 2P84A 3G4SQ 3SD4A 1SHFA 3M5AA 3PT9A 3TU4K 1P92A 1K0XA 3BY7A 2X4YA 4EMKB 3PTAA 3CEYA 5KYWA 3X28B 1FYNA 4E7HA 5GAMe 2E4HA 3J80E 2DTIA 1R77A 3VU3C 3MEWA 4FL6A 3OYNA 2CREA 4Q5WA 4B6MA 1N8RC 1KFZA 3KFVA 5CKBA 4XTZA 2QA4Q 5GAN8 1NLOC 2RQWA 1NM7A 4XAXB 3CPWP 4HCCA 2ABLA 1D3BB 5GAOr 1I1JA 4LUEA 2FPFA 2E64A 2K9GA 4FM4B 3RDVA 1X75C 2YUPA 2CUDA 4IIMA 4QVDA 4JRIA 1VQ7T 3QG1A 1SEMA 1SSFA 5KYXA 4HA8A 5CIUA 4D8DA 2RJDA 2SEMA 4CI0C 5DM7R 1VQ7A 1B07A 2K3XA 3GLXA 2FHDA 2F69A 2CYZB 5I2MA 5IXFA 1AD5A 1FXXA 1IXDA 2K5IA 2XKOC 3PIOA 5ECAA 1UFFA 4QVCA 1KIKA 3CCSQ 4N0AC 3ULRB 3RNJA 1S72T 2OTLT 1WXUA 4PFPA 2I0NA 3KXTA 3H41A 4J83A 1S72A 2OTLA 3V8KA 2KY9A 4WCIA 1ZSGA 1VQ5T 1GFCA 2CDTA 2L2PA 4BY6C 3MJXA 5AT1B 2K2MA 2O4XB 2LT4A 2RHIA 1BBZA 2A0FB 1VQ5A 2PVOB 4OMPA 1QVFS 3O5ZA 1B34A 2VYTA 5GAN5 2KT8A 1FMKA 2AIRB 3CCEQ 5FRNA 5GMKh 4RTTA 2YWWA 1UECA 2EVRA 2DERA 4JPBW 2FEIA 2XK0A 1OULA 4MMLA 3CCLT 5LJ5f 4PJOE 4BDYA 2FZCB 3ME9A 4OGCA 3CMAQ 3CCLA 1OEBA 2DZCA 2RMOA 3V8JA 3JCMf 3VS3A 2PTKA 1K0SA 2RB6A 2CP2A 1UG1A 2EYQA 2ZPFB 1G3SA 4ESRA 1W4SA 5GANg 4OB1B 5CO7A 4BI8B 1ZUYA 2DE0X 1AWOA 2B86A 1KD1R 3HFOA 4J9HA 3CCQT 4HVWA 4CRIA 2XICA 5KYYA 1BCOA 1TWBA 2HBWA 1VQMQ 2E3IA 1G3TA 2QYZA 1VQOQ 1UGPB 3CCQA 3VS6A 1BK2A 2EYYA 4PJMA 5FROA 2XDDA 3OYMA 4GY5A 4YTLA 1VQ9T 4ZNXA 2QXFA 3G71T 2KK4A 1KQ2A 4C8QC 1VQ9A 5GAN2 1LNXA 3G71A 1U5SA 2LMJA 2DTHA 2VC8A 5A2QE 4PLLA 5GMKm 4AT1B 3I55Q 2HAXA 3CBMA 3OSVA 5LJ5h 1YCYA 4B9XA 4PJOF 2K2VA 3JB9I 2AKKA 2KYMA 3A5ZB 2EQKA 3L2WA 4P5NA 3CCJQ 3JCMh 3ZBDA 1FMVA 5FWBA 1OPLA 4Z02A 4KRTA 4M7AB 4E6RA 1VYTA 3VS7A 4Z88A 4ELYC 3OYFA 1D0YA 1MGQA 2E6ZA 3VUZA 2RI3A 1IREB 3M53A 3NMZC 2EPDA 1KD1U 3JB9F 2FO0A 1QCOA 2F5KA 2ZZDA 7AT1B 3CC2T 5LJ3f 1AEYA 1K76A 4XK8E 4M78E 4L6V5 4XTXA 2J7IA 1FMWA 3CC2A 2F2XA 3VRYA 1HSQA 1WX6A 2QQSA 2DFUA 4M77C 1Q81R 2CZ1B 2K6DA 2YHTA 3INZA 2HZYA 4DOVA 1UHCA 3H0HA 2LX9A 3G4ST 1PSFA 5CKEA 1PRLC 1IGQA 1VQ4Q 4ZN1A 3G4SA 4RTZA 4C0DC 2H3EB 4N4IA 3EH1A 1Q7YC 1X2KA 3OB9A 1YITQ 2DILA 3HRUA 5KCOA 2XDPA 2GCXA 2KMTA 4XTVA 4DEXA 1RAEB 4C0FA 2A7YA 2FYKA 3EGXA 2QA4T 5A0DA 2BUDA 1Q95G 4A4EA 3M0RA 1D1CA 1EIFA 3META 2KEAA 4J9IA 2QA4A 5I21A 3SWNC 1PKSA 2RD1A 2CP6A 2NUZA 5CAIA 4GLMA 1YI2Q 3VV0A 5IHIA 5LJ3h 1BU1A 2EJ9A 2GFAA 2OX7A 2E12A 2RPNA 2IG0A 3OMGA 1U8RA 3HRSA 4FSXA 1GXIE 2JXBA 3CC7Q 2XDBA 4C92C 3OW2S 1B7TA 2JMCA 3NGPA 4M75E 5C6SA 2E3HA 1C0MA 2BE7D 4ELZC 3OMCA 1W2BS 1ZSZA 3SB2A 2DL8A 4II1A 5FU7B 1V76A 2K5LA 1Q81U 1I81A 2DO3A 2HEQA 4QKUA 1NEGA 1UDLA 3S3NA 1G83A 4OB2B 4LDXA 3MEVA 4OMOA 3CXCP 4F7UE 1WHKA 3EG3A 1FX7A 5GAN3 1V29B 4M7DD 4MZMA 3GNFB 4HT9A 1JXOA 2DX1A 2FZGB 2V8IA 4FCYA 2OTJQ 1WI7A 4EMKA 8AT1B 1G8XA 1DJ7B 5FLXE 4M7DA 1WGSA 2E5QA 3C94A 1SF9A 4Y92A 2JT4A 3CCET 3QDFA 2VGNA 1GCPA 4X9DA 3CCEA 2VV5A 1UJ0A 1RAFB 3MEAA 1PSEA 2J05A 3QIIA 3U23A 5HK0A 5CKDA 1W70A 3PMIA 1D3BA 3CMAT 3OBYA 4OP0A 1KQSS 3SHWA 5CQYA 4UC4A 3CMAA 3G1JA 3GBQA 4KH0B 2X51A 2PVGB 1WHJA 2RJCA 3WVDB 1K8AC 1WZOA 2HKNA 2X9HA 3MO8A 3JB9H 1I4K1 1WYXA 5KYNA 4ZGDB 3ER0A 4XU3A 1UGSB 1VQOT 4BI4A 1H3ZA 2LQ8A 3S3OA 1TOVA 3WXMB 1OOTA 1VQOA 2H3JA 3X25B 4AFSC 3L2RA 1YWPA 3EFOB 2K79A 2QGFB 3E2UA 2M51A 1JBMA 2ZGWA 2P4RA 3WVEB 1YIJA 2AT1B 2QQAA 3OS2A 4C8QF 1RAIB 3OYEA 4MZTA 4R0KA 2E6NA 1MMGA 4JLIA 5CCAA 5GANj 1SG5A 4LDWA 2YUQA 1M2OA 2O4XA 5GJVB 1TSFA 3NTHA 2BZXA 2DEQA 4FSSA 1BI2A 1K4US 3VRZA 1IZ6A 1KC8R 1GL5A 2KYBA 3E9GA 3CCJT 4LE9A 2RH2A 1WHGA 2FZKB 4QT7A 3QO3A 2D8JA 1LPLA 3HHTB 4J9GA 3IQLA 5IHKA 3A1PA 5KE2A 3CC4Q 2FPEA 8ATCB 3MP1A 1QVGP 3RERA 1SKUB 4BY6B 3M59A 2DK3A 2R5AA 2X4JA 4A53A 5FW9A 4LD9K 5LJ5d 3L2ZA 4A4HA 2OAUA 1JJ2S 1I5OB 1MNEA 3JCMd 4PJOC 4PJNA 4C92E 1TUDA 3HL8A 5GANe 1KHIA 2JN0A 1D0XA 2EQUA 4JJCA 2EYXA 4RCCA 4PLIA 2XI9A 4CC3A 2QDLA 3JB9J 3M57A 3A8LB 3MKDA 1VQ4T 4C5IA 2IVWA 1QVFP 1I8FA 1VQ4A 1VQ6Q 4M7DG 1YITT 1RI0A 5LL6S 1AWXA 1ZSZB 2MF2A 1KC8U 3BFMA 3VUBA 1YITA 3QUIA 2G6FX 4J7FA 1OX9A 1WXBA 4RKUE 2LJ3A 4R56A 4A54A 4J6YA 1NJIR 1KJWA 1PKTA 2D0QB 2IIMA 2RQVA 3CPWA 1FWZA 2JZ2A 4M7AD 1AWWA 2MOXA 2EKHA 4XTWA 3UDCA 4J9DA 2VUBA 1MMAA 4J9BA 2X3WD 2E10A 3TSZA 2GFUA 4M7AA 4DQ2A 2DL4A 4C8QB 3M9QA 4M7DB 3CC7T 5KYUB 2AK5A 3FJPA 4C92F 4R55A 1R0CB 1QMCA 2EFIA 3CC7A 3V7CA 3BW1A 3QPHA 5IAYA 4JZ3A 4ZN3A 1M3BA 5CKHA 1XJWB 2SRCA 4A4FA 1LVKA 2NWMA 3GF5A 1OU8A 1YN8A 4GLKA 5C0MA 5LJ3d 4OVAA 2HSEB 4AG1C 2HKQB 2HL3A 3SEMA 5GAN7 1OPKA 1KQ1A 2DL3A 3QBYA 4M78C 1IB8A 2EQJA 2MAMA 2RN8A 2DXBA 1C1AA 2JS0A 4C5GA 1ARKA 2OTJT 4IIOA 1Z9QA 1MNDA 5GAMh 3HSBA 1NG2A 3CBOA 2OTJA 1NJIU 1ZX6A 3QDRB 4WF2A 2QK0A 2DVJA 5FU6C 2MYSA 4RCBA 3CCRQ 2VGMA 4M77B 1RLQC 2RA2A 5IHNA 4DBQA 3UWNA 3VS1A 3EHRA 3EG1A 2LCLA 2F2VA 2MWPA 3OYYA 3BE3A 4HVVA 4KGXB 1N9RA 1M30A 4PL6A 3KUFA 1WDXA 4LUDA 2WSFE 4RUGA 4C0GA 3VJPA 2O9VA 2L5QA 1BI3A 3OSSC 2RHXA 4TVRA 3JCMb 2MI6A 4IUTA 2L3QA 3EG9A 1ZBXA 2M0OA 2LC4A 2FL7A 2FRYA 3QSUA 3X20B 2BTTA 1ZUKA 2F1LA 2BE9B 1UTIA 3V7RA 2W10A 1YHQQ 1XOVA 3SWNB 1G3YA 2L3PA 2QQBA 4JRQA 2RO0A 4LN2A 4M75C 3EAEA 3QKJA 2Z0WA 1WFWA 1ZLMA 4IUUA 3HFNA 1RUWA 1E6GA 2YRCA 2HQXA 3H8ZA 2K3BA 3D7SB 2FRWA 2QQRA 2EYWA 1YJNQ 3JB9D 2P0KA 2QI2A 2VWFA 3LYIA 2RK2A 1MUZA 2LNHB 4Z89A 1M9SA 2F2WA 2RJFA 1BI0A 4CC2A 2EQIA 1M1KR 1K1ZA 3E9FA 2EW3A 4FT2A 4O5VA 3OYLA 1WA7A 3EG0A 2DBMA 2KRMA 3LWHA 1U1TA 1BI1A 1LJOA 2CZ7B 3GPLA 2KBTA 2ESWA 4LD6A 2JM8A 1OYXA 4M7AG 4LDUA 1Q82R 2E70A 5J26A 1PG5B 3OYIA 3M0TA 1UE9A 3BDLA 1WQ7A 2L8DA 3OW2P 3EGUA 3HKSA 3JRZA 2QDYB 3CD6Q 4J7IA 1W2BP 1AHJB 4J6WA 1M90C 4J6XA 1KD1C 3I5RA 4EMKC 3QHSA 1MMNA 2CT4A 2DMOA 2F5TX 3JV3A 4KUDK 2HNIA 2K57A 4EDUA 1Q86R 5IH2A 2DKGA 2EGEA 2DD5A 4CC4B 3GP8A 2EJGA 3EFOA 3OYHA 2M9UA 2FG0A 2E1HA 2OJ2A 1VQ6T 1M3CA 4J9EA 4MMKA 1K73R 4FYVB 2DXCA 1VQ6A 5J39A 2DYBA 4JS5A 1M1KU 3JCMc 1VYVA 2CKKA 1NPRA 2K5FA 4IUPA 4FU6A 2R58A 2KE9A 4RG2A 4N4HA 2HSPA 2RHYA 1QCFA 5DLQE 1Q82U 1H92A 4RG8A 4JUVA 1KQSP 3PNWC 2EWNA 4N0AA 5HCKA 3JCMW 4XQ3A 2IPOB 4J8OA 2KNBB 1AZEA 2C0IA 3EHQA 1N27A 2V1RA 6AT1B 2DVEA 4PNOA 1TG0A 4XTYA 3EGDB 4ZTFA 4DBRA 2JMAA 4A63B 1T3LA 1OI1A 2R57A 4FT4A 4C0ZA 2A37A 1JO8A 4QQ6A 1Q86U 3FIFA 2CP5A 3PGGA 3DB4A 4E7SA 1K9AA 1A0NB 4KULA 4DBFA 2BZYA 2YUNA 1W6XA 2V26A 3CXCA 5KE3A 2FB7A 5D6YA 4MDXA 2M1HA 4Y91A 5GAOm 4M78F 1WHHA 1K9MC 3REAB 1N5ZA 3MPUB 1K73U 2QASA 2X4WA 2GTOA 1U06A 2CGHA 1RAHB 2E41A 5CQXA 1TXQA 3H0FA 3TEEA 4K11A 2RJEA 4D8KA 3JB9G 4E7KA 3EG9B 3DLLA 4LXCA 2GBQA 3CCST 4XTUA 4EPCA 4PJOB 1M8MA 3CCRT 1OQKA 2RHUA 3CCSA 2DYIA 5CR2A 2DM1A 2DZ9A 3FB9A 3CCRA 3CPFA 1RLPC 4RTVA 3RKYA 2NYSA 3Q1JA 1QQJA 5CKFA 4C8QD 4BD3A 2NUTB 2VKNA 3VS0A 3EFRA 5GAMd 3P8DA 4DEYA 1ABOA 3JCMX 4C8QA 2JTEA 1JJ2P 5CK9A 1PD1A 1X27A 4DBHA 5KYUA 3RKWA 2I2LA 2M0YA 3GIBA 1VUBA 2KXDA 2EJFA 2YXYA 1V1CA 3EFSA 2O2OA 5LJ5g 1G3WA 3G6EQ 3CCMQ 2WSCE 4BUGA 2RQRA 3JAME 2GTJA 1K8AR 1ZUUA 3JCMg 4FYXB 3UF4A 4IUVA 3ZEHA 3TCJA 1YHQT 3VS5A 4M7DE 4M75F 3VYHB 2AKLA 2JVVA 1YHQA 1B3QA 1SHGA 1X6BA 3I5SA 1KSWA 2ZPIB 1YJ9Q 1UEBA 2DF6A 4OMLA 5L8RE 1YJNT 3QWYA 1HJDA 3KBGA 1M2VB 2KXCA 2ZPGB 4KT0E 1VA7A 1QLYA 1YJNA 1NBEB 4X1VA 2L0AA 4F7UF 1VQMT 2NUPA 1YP5A 2LZ6B 1RAAB 2DJQA 1VQMA 4M77D 4ANJA 1IHVA 2HDAA 2RI2A 2P0QA 1QCNA 2EGAA 5GJWB 4OF1A 2DA9A 3LH0A 3O8VA 3S6WA 4M77A 1SRMA 1LCKA 3OYGA 1WIEA 4HCKA 4B9WA 2QGGA 1QVGA 3I56Q 2BZ8A 1RL2A 3CD6T 4VUBA 3NHNA 4AFQC 3I55T 1SPKA 2ROTA 2KVQG 2LJ0A 1GRIA 1PM3A 2LTOA 3CD6A 1VQNQ 1UUEA 1Y57A 1GBRA 3I55A 2Y90A 4A4KA 1K8AU 1XTDA 5D6WA 5DLOA 1UB4A 1WXTA 4RTYA 3UT1A 4E2FB 5FU6B 4GBQA 3CCJA 4FW2A 4PJJA 3L42A 3LWIA 3MP8A 5GAOl 3M55A 3L1AA 2X4XA 2FPDA 4PFZA 1BKBA 2NLUA 5LJ3g 5GANf 2PUOB 3RR6A 1T0JA 3SWNA 1MMDA 3QJYA 4LDYA 1VIEA 1QVFA 2ECZA 4ATOA 3ASKA 4EIKA 1I07A 1WHMA 4C92D 3PIPA 3NFCA 3LLRA 2KT1A 2GNCA 2RI5A 1C6VX 4E7LA 1GBQA 2LNVA 3CXCS 1RADB 1M8VA 1KC8C 2CSQA 4C5EA 1H3HA 3OS5A 5A0GA 2RM4A 4A4GA 3RIRA 1VQKQ 3F70A 1NYGA 3M0SA 4QQGA 2LVMA 4HXJA 1M5Q1 2RNAA 1BYMA 2EAYA 4M75B 5IXBA 4RTWA 1S1NA 4C8QG 2KI7A 2CH4A 1HYOA 1VOMA 2RF0A 1IO6A 5M9OA 2DEUA 1RACB 2E5KA 4E7ZA 5IN1A 1UGQB 1H8KA 2VXEA 4KH1B 3UATA 2MCNA 2AHJB 5FWCA 4F7UB 2QEXQ 5GANh 2JTMA 3ZL7C 1CKAA 2GGRA 3ZFJA 3TVTA 5GAMf 2V8KA 2YLBA 1X6GA 4RTUA 3OA6A 2DXUA 1YI2T 1N8RR 3CCUQ 5L23A 4E7JA 1KK7A 1PCXA 3OY9A 1EZZB 2LCSA 1YI2A 2O88A 1U3OA 1OV3A 4XU0A 2AZVA 2GQIA 3R6OA 4D6WA 1EFNA 4IURA 4PJLA 2ZAEA 1R0BG 2H8HA 1QKWA 4OMQA 3LH5A 1YJWQ 3BDUA 4RTXA 3JCMP 2XHCA 5GMKj 2KRSA 4OB0B 2AZSA 1F1BB 2K3YA 4XU2A 4M7AE 2C0OA 4KGZB 3H0IA 1NJIC 2MK5A 1WLPB 4JJDA 1WJSA 3CCVQ 2M02A 3QYGB 4HKEA 4M77G 4WTOB 4F04B 4ZGJB 3CMEQ 1GCQA 1SSHA 2DPPB 4EMGA 3FLGA 2DRKA 2LQKA 2RQUA 4DA4A 2JUFA 1X69A 3A8OB 2D6FA 2DIGA 5FRMA 2CT3A 1JRIA 4O6JA 2HQHA 3URGA 2NUPB 3EGDA 2CUBA 3V8LA 1T3SA 2ROLA 2BKDN 2ZPBB 3HP9A 2LT1A 4BE2A 2C0TA 3G6ET 4PFOA 5D6XA 3CCMT 1QVGS 3N5BB 1N8RU 5J3BA 1ZQ1A 4OGEA 3G6EA 3CCMA 2D9TA 3M58A 1X43A 3M4GA 3JSCA 5IT9E 1HD3A 4JRPA 2DRMA 2QTVA 5GMKe 1MV3A 3I35A 2M16A 5EC7A 1D1BA 3OYJA 1YJ9T 2K4YA 1IHWA 3HPWA 4C0DB 5I2SA 4M7AF 2EIFA 1JEGA 1QVPA 1YJ9A 4F14A 1Y96B 3MHXA 2DBKA 3C95A 3S3MA 5GAOn 1Z9ZA 4C92G 2PQWA 5GAN4 3QYHB 5LJ5j 3OYAA 2PUKB 3TREA 2PU9B 2RQTA 2V1QA 4PJOD 1VQLQ 2HBPA 4J9FA 4HCZA 4QW2A 4JDSA 1NLPC 1AZGB 1E7OA 4PJOA 2KROA 2YSQA 2LQWA 2YT6A 3M4YA 3FRNA 1OX8A 1UGVA 2G3RA 2MIOA 2YRDA 5GAOp 4Z8AA 5AYFA 3H6ZA 1BIAA 2LP5A 3I56T 2KGTA 2JM9A 3LGFA 3GNGA 3OW2A 2JTFA 2NUTA 2CP3A 1TUCA 3QZ9B 1MHNA 2K7AA 4FYYB 2VVKA 1TUGB 5HK3A 3I56A 4C92B 2WSEE 4M4ZA 1W2BA 1M27C 5KH6A 4MDWA 2W0ZA 4DOWA 1VQNT 2V8JA 2MWOA 2HD0A 5GAN6 4AG2C 2O01E 1PRMC 3DKMA 4JJNK 1VQNA 1ZSZC 2X35A 2J6OA 1XNIA 2D0NA 1H641 1QW1A 1M90R 3CC4T 1N9SA 1SRLA 2DLPA 2ENMA 4HCBA 1IRXA 1BCMA 2A36A 5LJ5e 2L3RA 1AT1B 3OYBA 3CC4A 3L2UA 3JCMe 4AFZC 1T0HA 3DLMA 1X6OA 3M54A 1YIJQ 2EGCA 3OYDA 3CPWS 1D0ZA 1CSKA 2CSIA 2A28A 1VQPQ 2BIVA 1M2VA 5KCHA 4M7DC 1M1KC 2HCKA 2YUOA 1JQQA 2LRQA 1KHCA 3RMSA 1BB9A 3EG2A 4ME7A 5HY6A 1VQ8Q 2Y4XA 3AT1B 1VQKT 1YWOA 1ZA1B 5LJ3j 1KQSA 3C4SA 2GQVA 2LJ1A 1VQKA 1Q82C 4M78D 2J6FA 4J5YA 2A3LA 1OZ3A 2COYA 4LDVA 4NL2A 4M78A 3PVQA 4E7IA 2QG9B 4Y28E 5GAOq 1RABB 3PFSA 5GAMg 1QKXA 1ACMB 3UA7A 1ZA2B 2A08A 4EMHA 1XQHA 1QWEA 5A0LA 2DTOA 2L3SA 1Q7YR 5KYWB 1AOJA 1KG1A 1R8OB 2D8HA 3MP6A 2CZ6B 2KR3A 2QEXT 4RMOA 4KBMB 4ZGEB 4BE0A 1M90U 4IKFA 4ORZA 1PC0A 2P0PA 2DIQA 2QQ9A 3P8BB 4L59A 2QEXA 3VYGA 4PKCC 1Q86C 4JZ4A 3EH2A 3CCUT 4BACA 4OB3B 2J06A 1M4ZA 9ATCB 1RAGB 2EKOA 1NEBA 3J81E 4HT8A 2CH4W 3CCUA 2DD4A 2PVDB 3QXEB 2QAZA 1PD0A 1YBYA 4C5HA 3JCMQ 1YJWT 1K73C 1K9MR 5LJ3e 4XU1A 5KYXB 4NOYA 1O75A 2JS2A 5GANd 4CC7A 1TTHB 2HL5C 4F17A 1YJWA 4PJOG 1NPPA 2J6KA 3CCVT 2KAFA 1M3AA 2DAQA 2LDMA 1Q81C 3CMET 3HTRA 3CCVA 4JS4A 4M75D 4L5GA 1HXDA 4OMFB 3CMEA 1QP2A 3FJ5A 2ZCFB 3AHUA 1WJQA 5D7UA 2HMAA 3OBWA 2L89A 2C06A 2DL7A 3A8HB 4M75A 2PNIA 4N4GA 1TH7A 5GMKi 3X24B 2X3XD 1JJ2A 3UPUA 1Q7YU 2GF7A 1J3TA 1U1SA 1Y71A 2LX7A 1PNJA 2KQWA 4BE1A 1B34B 3QJ6A 3VKIA 3H9NA 1WQWA 3I9QA 4F7UA 2KRNA 4IUQA 2COWA 3PE0A 4MZPA 2JOYA 3JCMJ 2YRVA 2XU8A 3E1SA 2ATCB 2LQNA 1M1GA 3VS2A 2RHZA 1K9MU 1OU9A 2WACA 2ZPEB 3L2VA 1BIBA 4OMNA 1D1AA 2XG8D 3V7SA 2ED0A 2QTXA 1JXMA 3MEUA 3THKA 1VQLT 1ABQA 1VQ7Q 3TSWA 4OMMA 3P8HA 2O9SA 5GMKl 1VQLA 3G7ZA 5KYYB 1O9SA 3LX7A 3OYCA 1LOJA 1E6HA 4C8QE
chains in the Genus database with same CATH topology
1QP3A 3OS0A 4M75B 2WSFE 5LJ3f 3CC2T 2HQEA 4XK8E 1OZ2A 4M78E 4L6V5 4C8QG 1N6AA 4XTXA 3JCMV 3VJPA 4C0GA 2L5QA 1Y07A 1BI3A 3CC2A 3OSSC 2RHXA 4M78G 2KSSA 3FDRA 5M9OA 3CBPA 2QQSA 3NTIA 5IN1A 3QZ5B 4TVRA 4M7AC 3JCMb 2MI6A 4M77C 2YLCA 1UGQB 3RMQA 4IUTA 2VXEA 2CZ1B 1ZBXA 2YHTA 2M0OA 2LC4A 2FL7A 3INZA 3QSUA 3X20B 4DOVA 2AHJB 4F7UB 2LX9A 3G4ST 5GANh 1PSFA 2JTMA 3ZFJA 5CKEA 5GAMf 2V8KA 3V7RA 1XOVA 2YLBA 1G3YA 2QQBA 3SWNB 4ZN1A 2RO0A 3OA6A 3G4SA 4JRQA 4M75C 2DXUA 2MMPA 4C0DC 1YI2T 2EQMA 1UGRB 4N4IA 3EAEA 3QKJA 1Q7YC 1WJRA 4IUUA 4BI3A 3OQ5A 4E7JA 3OB9A 3HFNA 2RK1A 3OY9A 1WNLA 2HQXA 3H8ZA 3HRUA 5KCOA 1YI2A 2XDPA 1NE8A 4XU0A 2QQRA 2GCXA 2KMTA 3JB9D 4XTVA 3R6OA 2P0KA 1G5VA 2QI2A 3LYIA 3NTKA 2RK2A 4C0FA 1M9SA 2A7YA 2RJFA 2FVUA 4M78B 4D6WA 4IURA 1BI0A 1VIFA 2FYKA 3HRTA 4NL3A 2QA4T 5A0DA 2BUDA 1YIJT 4A4EA 3BDUA 1EIFA 2CS7A 3E9FA 3META 3JCMP 2XHCA 2KDSA 1VQPT 5GMKj 2QA4A 1X01A 3SWNC 4FT2A 4O5VA 5I21A 4OB0B 3OYLA 4BDZA 2RD1A 4JRKA 2K3YA 5CAIA 4XU2A 1Y96A 4M7AE 3LWHA 3VV0A 4M77E 4X34A 1U1TA 1VQPA 1NJIC 1BI1A 1LJOA 1Y7XA 2CZ7B 5LJ3h 3GPLA 4M7DF 2GFAA 2EJ9A 1WJSA 2E12A 4LD6A 1OYXA 2E65A 2IG0A 3OMGA 3QYGB 4LDUA 4HKEA 4M77G 4M7AG 1U8RA 3HRSA 4FSXA 4ZGJB 4V2SA 1GXIE 2E70A 2P4TA 2R5MA 5J26A 2DPPB 1VQ8T 3OYIA 4EMGA 2B8AA 3FLGA 3BDLA 1WQ7A 4C92C 2L8DA 3OW2S 2XDBA 2LQKA 3T9NA 4M75E 4NS5A 2ZPHB 5C6SA 5HKCA 4DA4A 3HKSA 1VQ8A 2JUFA 3A8OB 3JRZA 2D6FA 2XD0A 2DIGA 4ELZC 5FRMA 2QDYB 3OMCA 1JRIA 4J7IA 3OS1A 1W2BS 1AHJB 4M75G 3SB2A 4J6WA 4II1A 4O6JA 1I5LA 5FU7B 1Q81U 2K5LA 4J6XA 3URGA 1M90C 1I81A 2DO3A 3PMTA 1KD1C 3C12A 4EMKC 3V8LA 3QHSA 4ZTJA 1WPYA 3E19A 2F5TX 3S3NA 4KUDK 2BKDN 2HNIA 2K57A 5EG2A 2ZPBB 4OB2B 4EDUA 3HP9A 4LDXA 3MEVA 2LT1A 4F7UE 4BE2A 3G6ET 2DKGA 5D6XA 3CCMT 4C92A 1QVGS 3N5BB 1N8RU 1FX7A 5DY9A 1ZQ1A 5J3BA 4F7UG 4FIBA 4OGEA 5GAN3 2DD5A 3G6EA 3CCMA 2D9TA 3M58A 1V29B 3M4GA 3JSCA 2EJGA 4MZMA 3GP8A 4M7DD 3GNFB 4HT9A 3OYHA 2M9UA 5IT9E 3RUXA 3LW5E 2V8IA 3A8MB 4JRPA 5GMKe 5FU7C 2E1HA 4EMKA 1VQ6T 1DJ7B 4MMKA 3X26B 5FLXE 4M7DA 2M16A 2XIDA 1WGSA 2E5QA 3A8GB 3C94A 2K4YA 3OYJA 1YJ9T 3RKXA 3HPWA 3GOXA 2DXCA 4C0DB 1VQ6A 5J39A 4JS5A 1M1KU 3CCET 5I2SA 4M7AF 2EIFA 1QVPA 4M77F 3JCMc 1YJ9A 1Y96B 2CKKA 4BB7A 1NPRA 2VGNA 3MHXA 3C95A 3RESA 5GAOn 3S3MA 3SDZA 2JNGA 4C92G 2PQWA 5GAN4 3QYHB 4X9DA 2K5FA 3SFMA 5GAMj 4JLGA 3CCEA 5LJ5j 4IUPA 2VV5A 3OYAA 2LCCA 4FU6A 2PUKB 3TREA 2R58A 3MEAA 1PSEA 2PU9B 4RG2A 4PJOD 4N4HA 3QIIA 5HK0A 2RHYA 5CKDA 2HBPA 5DLQE 1Q82U 3PMIA 4HCZA 4QW2A 1D3BA 2DXTA 3OBYA 4JDSA 3CMAT 4RG8A 4E47A 3FC3A 4JUVA 4OP0A 3J7AF 1KQSS 3FEOA 5CQYA 1JB0E 3PNWC 2EWNA 4PJOA 4N0AA 4UC4A 3JCMW 2CZ0B 4XQ3A 3CMAA 2Y4YA 4J8OA 5CVIA 3M4YA 3FRNA 4QQDA 2PVGB 4KUIA 3LGLA 4QVZA 2RJCA 1HK9A 1N27A 2VXFA 3WVDB 1ZHIA 2G3RA 3M56A 2DVEA 4PNOA 1K8AC 4XTYA 3DB3A 5GAOp 5AYFA 3H6ZA 1BIAA 3MO8A 4ZTFA 3MCAB 3JB9H 1I4K1 3I56T 3LGFA 3GNGA 3OW2A 4ZGDB 3L2QA 2JTFA 3ER0A 4XU3A 3OYKA 1UGSB 3QZ9B 1OI1A 1MHNA 1VQOT 2R57A 5HK3A 4FT4A 4BI4A 4C0ZA 3I56A 4C92B 1NZ9A 1H3ZA 2WSEE 2LQ8A 3S3OA 1W2BA 4QQ6A 1M1FA 3WXMB 5KH6A 4MDWA 4DOWA 2DJZA 4X9CA 1VQOA 1Q86U 1VQNT 2H3JA 2V8JA 3FIFA 3SD4A 3X25B 2MWOA 2HD0A 3M5AA 3DB4A 3PGGA 5GAN6 3L2RA 3PT9A 3TU4K 2O01E 2EAYA 4KULA 1VQNA 3DKMA 4JJNK 1JBMA 1P92A 2ZGWA 1YIJA 3WVEB 3BY7A 2X4YA 2QQAA 2X35A 3OS2A 1XNIA 4EMKB 4C8QF 3CXCA 1H641 5KE3A 3OYEA 2FB7A 5D6YA 1QW1A 4MZTA 3PTAA 2E6NA 4JLIA 5CCAA 3CC4T 3CEYA 1N9SA 2M1HA 3X28B 5GANj 4Y91A 5GAOm 4M78F 4LDWA 1K9MC 4HCBA 4E7HA 5GAMe 5LJ5e 3J80E 2DTIA 2L3RA 3VU3C 2O4XA 1K73U 2X4WA 3MEWA 3NTHA 4FL6A 3OYBA 3CC4A 2CGHA 3OYNA 4MDXA 2DEQA 3L2UA 4Q5WA 1BI2A 1N8RC 3JCMe 2E41A 5CQXA 5CKBA 3TEEA 4XTZA 2RJEA 1IZ6A 3DLMA 3JB9G 5GAN8 1X6OA 3M54A 3OYDA 3CPWS 4E7KA 4XAXB 4HCCA 3DLLA 3E9GA 3CCJT 1D3BB 2RH2A 5GAOr 2BIVA 3QO3A 2E64A 4FM4B 3HHTB 4XTUA 4EPCA 3CCST 4PJOB 1X75C 5KCHA 4M7DC 5KE2A 4QVDA 3CCRT 2RHUA 1M1KC 4JRIA 3CCSA 5CR2A 2LRQA 1KHCA 1VQ7T 2DZ9A 3QG1A 3RMSA 1SSFA 3FB9A 4HA8A 4ME7A 5CIUA 3CCRA 3MP1A 5HY6A 3CPFA 2RJDA 2Y4XA 4CI0C 3RKYA 5DM7R 1VQKT 3Q1JA 1VQ7A 3RERA 2K3XA 4BY6B 5CKFA 5LJ3j 3GLXA 2FHDA 4C8QD 1KQSA 2F69A 3M59A 2CYZB 4BD3A 5I2MA 2DK3A 2R5AA 2GQVA 2X4JA 3C4SA 3EFRA 4A53A 1VQKA 1Q82C 4M78D 4LD9K 5GAMd 5LJ5d 3P8DA 1FXXA 3L2ZA 2K5IA 2XKOC 4J5YA 2OAUA 4A4HA 3JCMX 4C8QA 3PIOA 1JJ2S 5CK9A 2A3LA 1OZ3A 4QVCA 3JCMd 4LDVA 4NL2A 4PJOC 4N0AC 4M78A 3RKWA 2I2LA 4E7IA 1VUBA 3GIBA 2EJFA 4Y28E 4C92E 1S72T 3HL8A 5GANe 5GAOq 2OTLT 3PFSA 3EFSA 5GAMg 5LJ5g 1G3WA 1KHIA 3KXTA 2JN0A 4J83A 4EMHA 2WSCE 1XQHA 2EQUA 4BUGA 2DTOA 5A0LA 3JAME 1S72A 3V8KA 2OTLA 1KG1A 1R8OB 2KY9A 4RCCA 3MP6A 2CZ6B 2XI9A 4PLIA 3JCMg 4RMOA 2QEXT 1VQ5T 4KBMB 4IUVA 4BY6C 4ZGEB 4BE0A 3ZEHA 3M57A 3JB9J 1M90U 4IKFA 3TCJA 2O4XB 2P0PA 3A8LB 2LT4A 2DIQA 2RHIA 1VQ4T 1YHQT 2QQ9A 3P8BB 4L59A 2QEXA 1VQ5A 4M7DE 2PVOB 3VYGA 4M75F 4PKCC 3VYHB 4C5IA 1Q86C 2IVWA 1QVFS 1I8FA 2JVVA 1B34A 1VQ4A 1YHQA 3CCUT 4BACA 4M7DG 4OB3B 1M4ZA 1YITT 1RI0A 2VYTA 2ZPIB 5LL6S 2EKOA 5GAN5 3J81E 4HT8A 2MF2A 1UEBA 5L8RE 1YJNT 1KC8U 3BFMA 3CCUA 2DD4A 3VUBA 3KBGA 5FRNA 5GMKh 1YITA 3QUIA 2ZPGB 4J7FA 2PVDB 4R56A 4KT0E 4RKUE 3QXEB 4C8QE 1YBYA 1YJNA 4C5HA 4A54A 4J6YA 4F7UF 3JCMQ 1VQMT 1YJWT 1K73C 2XK0A 5LJ3e 4MMLA 3CCLT 4XU1A 2D0QB 4NOYA 1O75A 3CPWA 5LJ5f 1FWZA 5GANd 2JZ2A 4BDYA 4PJOE 3ME9A 4M7AD 1YJWA 1VQMA 4OGCA 4M77D 3CCLA 2DZCA 4PJOG 4XTWA 3V8JA 2RI2A 2P0QA 3JCMf 3UDCA 1NPPA 2VUBA 2RB6A 3CCVT 2KAFA 4OF1A 2DAQA 2E10A 2LDMA 2EYQA 2ZPFB 2GFUA 3LH0A 3O8VA 3S6WA 1G3SA 4M77A 1Q81C 3CMET 4M7AA 1W4SA 3OYGA 4DQ2A 5GANg 4OB1B 5CO7A 4BI8B 4C8QB 3CCVA 3M9QA 4B9WA 4M7DB 3CC7T 4JS4A 3HFOA 4M75D 4L5GA 1HXDA 4OMFB 3FJPA 4C92F 1QP2A 3CMEA 1QVGA 2ZCFB 4R55A 4CRIA 1WJQA 3CCQT 3AHUA 2XICA 3OBWA 2EFIA 1RL2A 3CC7A 3V7CA 3BW1A 3QPHA 1G3TA 2L89A 4VUBA 1UGPB 5IAYA 2C06A 3CD6T 3CCQA 3A8HB 4M75A 4ZN3A 3I55T 5CKHA 4N4GA 1TH7A 5GMKi 2KVQG 3X24B 2LTOA 3CD6A 1JJ2A 4A4FA 3UPUA 1Q7YU 3I55A 2Y90A 2GF7A 4A4KA 1K8AU 5FROA 2XDDA 3GF5A 1U1SA 1XTDA 5D6WA 3OYMA 4GLKA 4GY5A 5DLOA 1UB4A 5LJ3d 4YTLA 1Y71A 5C0MA 3UT1A 1VQ9T 4OVAA 2KQWA 2QXFA 5FU6B 3G71T 1B34B 3QJ6A 4BE1A 3CCJA 2KK4A 3VKIA 1KQ2A 4C8QC 1WQWA 3LWIA 3L42A 5GAN7 3MP8A 1KQ1A 5GAOl 1VQ9A 5GAN2 3M55A 3L1AA 3QBYA 1LNXA 4M78C 4F7UA 2MAMA 2EQJA 2X4XA 4IUQA 3G71A 2DXBA 2DTHA 4C5GA 1BKBA 2NLUA 4MZPA 2JOYA 5LJ3g 5GANf 2PUOB 2VC8A 3SWNA 5A2QE 3JCMJ 2OTJT 3QJYA 4PLLA 2YRVA 5GMKm 2XU8A 4LDYA 3E1SA 1VIEA 2HAXA 1QVFA 5GAMh 3CBMA 3OSVA 5LJ5h 3HSBA 3CBOA 3ASKA 1YCYA 4ATOA 4B9XA 2OTJA 4PJOF 2K2VA 3JB9I 4C92D 1NJIU 3A5ZB 2EQKA 1M1GA 3NFCA 3PIPA 3LLRA 3L2WA 4P5NA 2RHZA 2RI5A 3JCMh 3ZBDA 4E7LA 1K9MU 2WACA 2ZPEB 3QDRB 3L2VA 4WF2A 1BIBA 2LNVA 3CXCS 5FU6C 2XG8D 4Z02A 4RCBA 3V7SA 1M8VA 1KC8C 2QTXA 4M7AB 2VGMA 4C5EA 4M77B 2RA2A 3MEUA 1VQLT 4ELYC 3OYFA 3UWNA 3OS5A 1MGQA 2E6ZA 3P8HA 5A0GA 2RM4A 4A4GA 3VUZA 2LCLA 3RIRA 5GMKl 2MWPA 2RI3A 1VQLA 3OYYA 1IREB 3M53A 3F70A 1N9RA 3G7ZA 4PL6A 1O9SA 3KUFA 3LX7A 3OYCA 1KD1U 4QQGA 1LOJA 3JB9F 2LVMA 1M5Q1 1BYMA 2F5KA 2ZZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HNI A;  4NOY A;  2K57 A;  4M75 B;  3VU3 C;  5LJ3 f;  5LJ5 f;  5GAN d;  4PJO E;  2CGH A;  2DEQ A;  4M78 E;  4F7U E;  4M7A D;  2DKG A;  4M77 D;  4C8Q G;  4NL3 A;  3JCM V;  4XTX A;  3JCM e;  2E41 A;  4C92 A;  2DZC A;  4PJO G;  4XTW A;  3V8J A;  4XTZ A;  3JCM f;  5DY9 A;  4M78 G;  4F7U G;  3JB9 G;  5GAN 8;  2RB6 A;  5GAN 3;  2E10 A;  3M4G A;  4M7D D;  2EJG A;  4M7A A;  4M7A C;  3JCM b;  4M77 A;  4M77 C;  4HT9 A;  1D3B B;  2YLC A;  3RUX A;  2VXE A;  4DQ2 A;  5GAN g;  4C8Q B;  5GAO r;  2YHT A;  3QO3 A;  4M7D B;  2E64 A;  5GMK e;  4XTU A;  3INZ A;  4PJO B;  2E1H A;  3HFO A;  4M75 D;  4EMK A;  1HXD A;  3QSU A;  3FJP A;  4MMK A;  4C92 F;  4F7U B;  3AHU A;  4M7D A;  5GAN h;  4M7D C;  4QVD A;  3RKX A;  4JRI A;  5GAM f;  3V7C A;  3BW1 A;  3V7R A;  2DZ9 A;  2YLB A;  3SWN B;  4M7A F;  3FB9 A;  4HA8 A;  4M77 F;  4M75 A;  4M75 C;  3JCM c;  2DXU A;  1Y96 B;  1TH7 A;  5GMK i;  3RES A;  5GAO n;  3RKY A;  3RER A;  4C92 G;  5GAN 4;  4X9D A;  5GAM j;  5LJ3 j;  5LJ5 j;  3HFN A;  4C8Q D;  1WNL A;  2Y90 A;  3EFR A;  4PJO D;  4A53 A;  1U1S A;  4XU0 A;  4M78 D;  4XTV A;  3JB9 D;  5GAM d;  5LJ3 d;  5LJ5 d;  3L2Z A;  1D3B A;  1B34 B;  2DXT A;  4J5Y A;  3JCM X;  1KQ2 A;  4C8Q A;  4C8Q C;  1WQW A;  4JUV A;  4M78 B;  4OP0 A;  5GAN 7;  1KQ1 A;  4QVC A;  2FYK A;  3JCM d;  2EWN A;  5GAO l;  4NL2 A;  5GAN 2;  4N0A A;  4N0A C;  3L1A A;  3JCM W;  4PJO A;  4XQ3 A;  4M78 A;  1LNX A;  4M78 C;  4F7U A;  3RKW A;  2I2L A;  3GIB A;  2EJF A;  3BDU A;  2DTH A;  4C92 E;  5GAN e;  5GAO q;  3JCM P;  3EFS A;  5GMK j;  5LJ3 g;  5LJ5 g;  2VC8 A;  1HK9 A;  5GAM g;  1X01 A;  3SWN C;  3SWN A;  5I21 A;  2VXF A;  3JCM J;  2JN0 A;  2RD1 A;  2DVE A;  4JRK A;  4PNO A;  4EMH A;  5CAI A;  5GMK m;  4XTY A;  2DTO A;  1Y96 A;  4XU2 A;  5GAO p;  3V8K A;  4M7A E;  4M77 E;  1BIA A;  1U1T A;  4RCC A;  5GAM h;  1LJO A;  5LJ3 h;  3JCM g;  5LJ5 h;  3HSB A;  1I4K 1;  3JB9 H;  1YCY A;  2EJ9 A;  3JB9 J;  4M7D F;  4PJO F;  3JB9 I;  4C92 D;  2E65 A;  4M7A G;  4M77 G;  4XU3 A;  4V2S A;  3JCM h;  4M7D E;  4M75 F;  4WF2 A;  4C92 B;  1BIB A;  1I8F A;  4EMG A;  1B34 A;  4PJO C;  2DJZ A;  4X9C A;  4M7D G;  1WQ7 A;  4C92 C;  4RCB A;  3V7S A;  3FIF A;  5GAN f;  1M8V A;  3PGG A;  4M75 E;  5GAN 6;  5GAN 5;  2QTX A;  4M7A B;  4HT8 A;  4M77 B;  2RA2 A;  3BFM A;  1JRI A;  1JBM A;  1MGQ A;  2ZGW A;  4M75 G;  3SB2 A;  5GMK h;  3QUI A;  5LJ3 e;  3BY7 A;  2RM4 A;  4J6W A;  1I5L A;  3RIR A;  5GMK l;  4EMK B;  4C8Q E;  4C8Q F;  4J6X A;  1H64 1;  1I81 A;  2FB7 A;  4A54 A;  4J6Y A;  4JLI A;  1N9R A;  5GAN j;  1N9S A;  4EMK C;  3V8L A;  3QHS A;  4Y91 A;  4M78 F;  4F7U F;  3JCM Q;  5GAO m;  3JB9 F;  1LOJ A;  1WPY A;  5GAM e;  1M5Q 1;  4MML A;  5LJ5 e;  4XU1 A;  2DTI A;  2EAY A; 
#chains in the Genus database with same CATH topology
 1QP3 A;  3OS0 A;  2HQE A;  1OZ2 A;  1UHF A;  1N6A A;  3JCM V;  1Y07 A;  4M78 G;  2KSS A;  3FDR A;  3CBP A;  3NTI A;  3QZ5 B;  1S72 Q;  1UJY A;  4M7A C;  2OTL Q;  2YLC A;  3RMQ A;  1VQ5 Q;  3A98 A;  1TS9 A;  4AFU C;  1PHT A;  2MMP A;  2EQM A;  1UGR B;  1WJR A;  4BI3 A;  2YDL A;  3OQ5 A;  2RK1 A;  1WNL A;  1NE8 A;  1YNZ A;  3NPF A;  1X2Q A;  1CKB A;  1G5V A;  1NYF A;  3NTK A;  1GCQ C;  2JJ9 A;  2FVU A;  4M78 B;  1VYU A;  1PWT A;  3HRT A;  1VIF A;  4NL3 A;  2VB6 A;  1YIJ T;  2CS7 A;  3CCL Q;  2JW4 A;  3PVL A;  2KDS A;  4FW1 A;  3RBB B;  1VQP T;  1X01 A;  1D09 B;  4BDZ A;  4JRK A;  1Y96 A;  4M77 E;  4X34 A;  1VQP A;  2EBP A;  2OI3 A;  1G2B A;  1JU5 C;  1Y7X A;  4M7D F;  2DNU A;  4JJB A;  2E65 A;  4V2S A;  2P4T A;  2R5M A;  1VQ8 T;  2VAS A;  2B8A A;  1GFD A;  3C0C A;  3T9N A;  3CCQ Q;  1I0C A;  5HKC A;  4NS5 A;  2ZPH B;  1VQ8 A;  2XD0 A;  3M0Q A;  3OS1 A;  2PZ1 A;  4M75 G;  5I22 A;  1I5L A;  3PMT A;  3C12 A;  2ED1 A;  1MV0 B;  2CP7 A;  4ZTJ A;  1WPY A;  3R6N A;  2O31 A;  3E19 A;  4LNP A;  5EG2 A;  1VQ9 Q;  3G71 Q;  4C92 A;  3VS4 A;  1YCS B;  2D1X A;  5DY9 A;  4F7U G;  4FIB A;  3TQ7 P;  3QWX X;  2DET A;  3RUX A;  3LW5 E;  1W1F A;  3A8M B;  2XMF A;  3EGX B;  1ZBJ A;  1RI9 A;  5FU7 C;  3REB B;  3X26 B;  2XID A;  3A8G B;  3RKX A;  3GOX A;  4J9C A;  4FYW B;  1AWJ A;  2DL5 A;  4M77 F;  4BB7 A;  3RES A;  1Y0M A;  3SDZ A;  2JNG A;  3M0P A;  3SFM A;  4KGV B;  1AVZ C;  4JLG A;  4HVU A;  5GAM j;  4AMC A;  2LCC A;  3M0U A;  3CQT A;  4PK4 A;  1EX4 A;  1TU0 B;  1WHL A;  2DXT A;  3J7A F;  3FC3 A;  4E47 A;  3FEO A;  1JB0 E;  2CZ0 B;  2Y4Y A;  5CVI A;  1IGU A;  4QQD A;  3CC2 Q;  1YFN A;  3LGL A;  4KUI A;  4QVZ A;  1HK9 A;  3UA6 A;  2VXF A;  1ZHI A;  3M56 A;  1QWF A;  3DB3 A;  4F16 A;  3MCA B;  2EYZ A;  2MPX C;  2COZ A;  3L2Q A;  3OYK A;  2CP0 A;  1NZ9 A;  5I11 A;  1M1F A;  2DJZ A;  4X9C A;  2OAW A;  2P84 A;  3G4S Q;  3SD4 A;  1SHF A;  3M5A A;  3PT9 A;  3TU4 K;  1P92 A;  1K0X A;  3BY7 A;  2X4Y A;  4EMK B;  3PTA A;  3CEY A;  5KYW A;  3X28 B;  1FYN A;  4E7H A;  5GAM e;  2E4H A;  3J80 E;  2DTI A;  1R77 A;  3VU3 C;  3MEW A;  4FL6 A;  3OYN A;  2CRE A;  4Q5W A;  4B6M A;  1N8R C;  1KFZ A;  3KFV A;  5CKB A;  4XTZ A;  2QA4 Q;  5GAN 8;  1NLO C;  2RQW A;  1NM7 A;  4XAX B;  3CPW P;  4HCC A;  2ABL A;  1D3B B;  5GAO r;  1I1J A;  4LUE A;  2FPF A;  2E64 A;  2K9G A;  4FM4 B;  3RDV A;  1X75 C;  2YUP A;  2CUD A;  4IIM A;  4QVD A;  4JRI A;  1VQ7 T;  3QG1 A;  1SEM A;  1SSF A;  5KYX A;  4HA8 A;  5CIU A;  4D8D A;  2RJD A;  2SEM A;  4CI0 C;  5DM7 R;  1VQ7 A;  1B07 A;  2K3X A;  3GLX A;  2FHD A;  2F69 A;  2CYZ B;  5I2M A;  5IXF A;  1AD5 A;  1FXX A;  1IXD A;  2K5I A;  2XKO C;  3PIO A;  5ECA A;  1UFF A;  4QVC A;  1KIK A;  3CCS Q;  4N0A C;  3ULR B;  3RNJ A;  1S72 T;  2OTL T;  1WXU A;  4PFP A;  2I0N A;  3KXT A;  3H41 A;  4J83 A;  1S72 A;  2OTL A;  3V8K A;  2KY9 A;  4WCI A;  1ZSG A;  1VQ5 T;  1GFC A;  2CDT A;  2L2P A;  4BY6 C;  3MJX A;  5AT1 B;  2K2M A;  2O4X B;  2LT4 A;  2RHI A;  1BBZ A;  2A0F B;  1VQ5 A;  2PVO B;  4OMP A;  1QVF S;  3O5Z A;  1B34 A;  2VYT A;  5GAN 5;  2KT8 A;  1FMK A;  2AIR B;  3CCE Q;  5FRN A;  5GMK h;  4RTT A;  2YWW A;  1UEC A;  2EVR A;  2DER A;  4JPB W;  2FEI A;  2XK0 A;  1OUL A;  4MML A;  3CCL T;  5LJ5 f;  4PJO E;  4BDY A;  2FZC B;  3ME9 A;  4OGC A;  3CMA Q;  3CCL A;  1OEB A;  2DZC A;  2RMO A;  3V8J A;  3JCM f;  3VS3 A;  2PTK A;  1K0S A;  2RB6 A;  2CP2 A;  1UG1 A;  2EYQ A;  2ZPF B;  1G3S A;  4ESR A;  1W4S A;  5GAN g;  4OB1 B;  5CO7 A;  4BI8 B;  1ZUY A;  2DE0 X;  1AWO A;  2B86 A;  1KD1 R;  3HFO A;  4J9H A;  3CCQ T;  4HVW A;  4CRI A;  2XIC A;  5KYY A;  1BCO A;  1TWB A;  2HBW A;  1VQM Q;  2E3I A;  1G3T A;  2QYZ A;  1VQO Q;  1UGP B;  3CCQ A;  3VS6 A;  1BK2 A;  2EYY A;  4PJM A;  5FRO A;  2XDD A;  3OYM A;  4GY5 A;  4YTL A;  1VQ9 T;  4ZNX A;  2QXF A;  3G71 T;  2KK4 A;  1KQ2 A;  4C8Q C;  1VQ9 A;  5GAN 2;  1LNX A;  3G71 A;  1U5S A;  2LMJ A;  2DTH A;  2VC8 A;  5A2Q E;  4PLL A;  5GMK m;  4AT1 B;  3I55 Q;  2HAX A;  3CBM A;  3OSV A;  5LJ5 h;  1YCY A;  4B9X A;  4PJO F;  2K2V A;  3JB9 I;  2AKK A;  2KYM A;  3A5Z B;  2EQK A;  3L2W A;  4P5N A;  3CCJ Q;  3JCM h;  3ZBD A;  1FMV A;  5FWB A;  1OPL A;  4Z02 A;  4KRT A;  4M7A B;  4E6R A;  1VYT A;  3VS7 A;  4Z88 A;  4ELY C;  3OYF A;  1D0Y A;  1MGQ A;  2E6Z A;  3VUZ A;  2RI3 A;  1IRE B;  3M53 A;  3NMZ C;  2EPD A;  1KD1 U;  3JB9 F;  2FO0 A;  1QCO A;  2F5K A;  2ZZD A;  7AT1 B;  3CC2 T;  5LJ3 f;  1AEY A;  1K76 A;  4XK8 E;  4M78 E;  4L6V 5;  4XTX A;  2J7I A;  1FMW A;  3CC2 A;  2F2X A;  3VRY A;  1HSQ A;  1WX6 A;  2QQS A;  2DFU A;  4M77 C;  1Q81 R;  2CZ1 B;  2K6D A;  2YHT A;  3INZ A;  2HZY A;  4DOV A;  1UHC A;  3H0H A;  2LX9 A;  3G4S T;  1PSF A;  5CKE A;  1PRL C;  1IGQ A;  1VQ4 Q;  4ZN1 A;  3G4S A;  4RTZ A;  4C0D C;  2H3E B;  4N4I A;  3EH1 A;  1Q7Y C;  1X2K A;  3OB9 A;  1YIT Q;  2DIL A;  3HRU A;  5KCO A;  2XDP A;  2GCX A;  2KMT A;  4XTV A;  4DEX A;  1RAE B;  4C0F A;  2A7Y A;  2FYK A;  3EGX A;  2QA4 T;  5A0D A;  2BUD A;  1Q95 G;  4A4E A;  3M0R A;  1D1C A;  1EIF A;  3MET A;  2KEA A;  4J9I A;  2QA4 A;  5I21 A;  3SWN C;  1PKS A;  2RD1 A;  2CP6 A;  2NUZ A;  5CAI A;  4GLM A;  1YI2 Q;  3VV0 A;  5IHI A;  5LJ3 h;  1BU1 A;  2EJ9 A;  2GFA A;  2OX7 A;  2E12 A;  2RPN A;  2IG0 A;  3OMG A;  1U8R A;  3HRS A;  4FSX A;  1GXI E;  2JXB A;  3CC7 Q;  2XDB A;  4C92 C;  3OW2 S;  1B7T A;  2JMC A;  3NGP A;  4M75 E;  5C6S A;  2E3H A;  1C0M A;  2BE7 D;  4ELZ C;  3OMC A;  1W2B S;  1ZSZ A;  3SB2 A;  2DL8 A;  4II1 A;  5FU7 B;  1V76 A;  2K5L A;  1Q81 U;  1I81 A;  2DO3 A;  2HEQ A;  4QKU A;  1NEG A;  1UDL A;  3S3N A;  1G83 A;  4OB2 B;  4LDX A;  3MEV A;  4OMO A;  3CXC P;  4F7U E;  1WHK A;  3EG3 A;  1FX7 A;  5GAN 3;  1V29 B;  4M7D D;  4MZM A;  3GNF B;  4HT9 A;  1JXO A;  2DX1 A;  2FZG B;  2V8I A;  4FCY A;  2OTJ Q;  1WI7 A;  4EMK A;  8AT1 B;  1G8X A;  1DJ7 B;  5FLX E;  4M7D A;  1WGS A;  2E5Q A;  3C94 A;  1SF9 A;  4Y92 A;  2JT4 A;  3CCE T;  3QDF A;  2VGN A;  1GCP A;  4X9D A;  3CCE A;  2VV5 A;  1UJ0 A;  1RAF B;  3MEA A;  1PSE A;  2J05 A;  3QII A;  3U23 A;  5HK0 A;  5CKD A;  1W70 A;  3PMI A;  1D3B A;  3CMA T;  3OBY A;  4OP0 A;  1KQS S;  3SHW A;  5CQY A;  4UC4 A;  3CMA A;  3G1J A;  3GBQ A;  4KH0 B;  2X51 A;  2PVG B;  1WHJ A;  2RJC A;  3WVD B;  1K8A C;  1WZO A;  2HKN A;  2X9H A;  3MO8 A;  3JB9 H;  1I4K 1;  1WYX A;  5KYN A;  4ZGD B;  3ER0 A;  4XU3 A;  1UGS B;  1VQO T;  4BI4 A;  1H3Z A;  2LQ8 A;  3S3O A;  1TOV A;  3WXM B;  1OOT A;  1VQO A;  2H3J A;  3X25 B;  4AFS C;  3L2R A;  1YWP A;  3EFO B;  2K79 A;  2QGF B;  3E2U A;  2M51 A;  1JBM A;  2ZGW A;  2P4R A;  3WVE B;  1YIJ A;  2AT1 B;  2QQA A;  3OS2 A;  4C8Q F;  1RAI B;  3OYE A;  4MZT A;  4R0K A;  2E6N A;  1MMG A;  4JLI A;  5CCA A;  5GAN j;  1SG5 A;  4LDW A;  2YUQ A;  1M2O A;  2O4X A;  5GJV B;  1TSF A;  3NTH A;  2BZX A;  2DEQ A;  4FSS A;  1BI2 A;  1K4U S;  3VRZ A;  1IZ6 A;  1KC8 R;  1GL5 A;  2KYB A;  3E9G A;  3CCJ T;  4LE9 A;  2RH2 A;  1WHG A;  2FZK B;  4QT7 A;  3QO3 A;  2D8J A;  1LPL A;  3HHT B;  4J9G A;  3IQL A;  5IHK A;  3A1P A;  5KE2 A;  3CC4 Q;  2FPE A;  8ATC B;  3MP1 A;  1QVG P;  3RER A;  1SKU B;  4BY6 B;  3M59 A;  2DK3 A;  2R5A A;  2X4J A;  4A53 A;  5FW9 A;  4LD9 K;  5LJ5 d;  3L2Z A;  4A4H A;  2OAU A;  1JJ2 S;  1I5O B;  1MNE A;  3JCM d;  4PJO C;  4PJN A;  4C92 E;  1TUD A;  3HL8 A;  5GAN e;  1KHI A;  2JN0 A;  1D0X A;  2EQU A;  4JJC A;  2EYX A;  4RCC A;  4PLI A;  2XI9 A;  4CC3 A;  2QDL A;  3JB9 J;  3M57 A;  3A8L B;  3MKD A;  1VQ4 T;  4C5I A;  2IVW A;  1QVF P;  1I8F A;  1VQ4 A;  1VQ6 Q;  4M7D G;  1YIT T;  1RI0 A;  5LL6 S;  1AWX A;  1ZSZ B;  2MF2 A;  1KC8 U;  3BFM A;  3VUB A;  1YIT A;  3QUI A;  2G6F X;  4J7F A;  1OX9 A;  1WXB A;  4RKU E;  2LJ3 A;  4R56 A;  4A54 A;  4J6Y A;  1NJI R;  1KJW A;  1PKT A;  2D0Q B;  2IIM A;  2RQV A;  3CPW A;  1FWZ A;  2JZ2 A;  4M7A D;  1AWW A;  2MOX A;  2EKH A;  4XTW A;  3UDC A;  4J9D A;  2VUB A;  1MMA A;  4J9B A;  2X3W D;  2E10 A;  3TSZ A;  2GFU A;  4M7A A;  4DQ2 A;  2DL4 A;  4C8Q B;  3M9Q A;  4M7D B;  3CC7 T;  5KYU B;  2AK5 A;  3FJP A;  4C92 F;  4R55 A;  1R0C B;  1QMC A;  2EFI A;  3CC7 A;  3V7C A;  3BW1 A;  3QPH A;  5IAY A;  4JZ3 A;  4ZN3 A;  1M3B A;  5CKH A;  1XJW B;  2SRC A;  4A4F A;  1LVK A;  2NWM A;  3GF5 A;  1OU8 A;  1YN8 A;  4GLK A;  5C0M A;  5LJ3 d;  4OVA A;  2HSE B;  4AG1 C;  2HKQ B;  2HL3 A;  3SEM A;  5GAN 7;  1OPK A;  1KQ1 A;  2DL3 A;  3QBY A;  4M78 C;  1IB8 A;  2EQJ A;  2MAM A;  2RN8 A;  2DXB A;  1C1A A;  2JS0 A;  4C5G A;  1ARK A;  2OTJ T;  4IIO A;  1Z9Q A;  1MND A;  5GAM h;  3HSB A;  1NG2 A;  3CBO A;  2OTJ A;  1NJI U;  1ZX6 A;  3QDR B;  4WF2 A;  2QK0 A;  2DVJ A;  5FU6 C;  2MYS A;  4RCB A;  3CCR Q;  2VGM A;  4M77 B;  1RLQ C;  2RA2 A;  5IHN A;  4DBQ A;  3UWN A;  3VS1 A;  3EHR A;  3EG1 A;  2LCL A;  2F2V A;  2MWP A;  3OYY A;  3BE3 A;  4HVV A;  4KGX B;  1N9R A;  1M30 A;  4PL6 A;  3KUF A;  1WDX A;  4LUD A;  2WSF E;  4RUG A;  4C0G A;  3VJP A;  2O9V A;  2L5Q A;  1BI3 A;  3OSS C;  2RHX A;  4TVR A;  3JCM b;  2MI6 A;  4IUT A;  2L3Q A;  3EG9 A;  1ZBX A;  2M0O A;  2LC4 A;  2FL7 A;  2FRY A;  3QSU A;  3X20 B;  2BTT A;  1ZUK A;  2F1L A;  2BE9 B;  1UTI A;  3V7R A;  2W10 A;  1YHQ Q;  1XOV A;  3SWN B;  1G3Y A;  2L3P A;  2QQB A;  4JRQ A;  2RO0 A;  4LN2 A;  4M75 C;  3EAE A;  3QKJ A;  2Z0W A;  1WFW A;  1ZLM A;  4IUU A;  3HFN A;  1RUW A;  1E6G A;  2YRC A;  2HQX A;  3H8Z A;  2K3B A;  3D7S B;  2FRW A;  2QQR A;  2EYW A;  1YJN Q;  3JB9 D;  2P0K A;  2QI2 A;  2VWF A;  3LYI A;  2RK2 A;  1MUZ A;  2LNH B;  4Z89 A;  1M9S A;  2F2W A;  2RJF A;  1BI0 A;  4CC2 A;  2EQI A;  1M1K R;  1K1Z A;  3E9F A;  2EW3 A;  4FT2 A;  4O5V A;  3OYL A;  1WA7 A;  3EG0 A;  2DBM A;  2KRM A;  3LWH A;  1U1T A;  1BI1 A;  1LJO A;  2CZ7 B;  3GPL A;  2KBT A;  2ESW A;  4LD6 A;  2JM8 A;  1OYX A;  4M7A G;  4LDU A;  1Q82 R;  2E70 A;  5J26 A;  1PG5 B;  3OYI A;  3M0T A;  1UE9 A;  3BDL A;  1WQ7 A;  2L8D A;  3OW2 P;  3EGU A;  3HKS A;  3JRZ A;  2QDY B;  3CD6 Q;  4J7I A;  1W2B P;  1AHJ B;  4J6W A;  1M90 C;  4J6X A;  1KD1 C;  3I5R A;  4EMK C;  3QHS A;  1MMN A;  2CT4 A;  2DMO A;  2F5T X;  3JV3 A;  4KUD K;  2HNI A;  2K57 A;  4EDU A;  1Q86 R;  5IH2 A;  2DKG A;  2EGE A;  2DD5 A;  4CC4 B;  3GP8 A;  2EJG A;  3EFO A;  3OYH A;  2M9U A;  2FG0 A;  2E1H A;  2OJ2 A;  1VQ6 T;  1M3C A;  4J9E A;  4MMK A;  1K73 R;  4FYV B;  2DXC A;  1VQ6 A;  5J39 A;  2DYB A;  4JS5 A;  1M1K U;  3JCM c;  1VYV A;  2CKK A;  1NPR A;  2K5F A;  4IUP A;  4FU6 A;  2R58 A;  2KE9 A;  4RG2 A;  4N4H A;  2HSP A;  2RHY A;  1QCF A;  5DLQ E;  1Q82 U;  1H92 A;  4RG8 A;  4JUV A;  1KQS P;  3PNW C;  2EWN A;  4N0A A;  5HCK A;  3JCM W;  4XQ3 A;  2IPO B;  4J8O A;  2KNB B;  1AZE A;  2C0I A;  3EHQ A;  1N27 A;  2V1R A;  6AT1 B;  2DVE A;  4PNO A;  1TG0 A;  4XTY A;  3EGD B;  4ZTF A;  4DBR A;  2JMA A;  4A63 B;  1T3L A;  1OI1 A;  2R57 A;  4FT4 A;  4C0Z A;  2A37 A;  1JO8 A;  4QQ6 A;  1Q86 U;  3FIF A;  2CP5 A;  3PGG A;  3DB4 A;  4E7S A;  1K9A A;  1A0N B;  4KUL A;  4DBF A;  2BZY A;  2YUN A;  1W6X A;  2V26 A;  3CXC A;  5KE3 A;  2FB7 A;  5D6Y A;  4MDX A;  2M1H A;  4Y91 A;  5GAO m;  4M78 F;  1WHH A;  1K9M C;  3REA B;  1N5Z A;  3MPU B;  1K73 U;  2QAS A;  2X4W A;  2GTO A;  1U06 A;  2CGH A;  1RAH B;  2E41 A;  5CQX A;  1TXQ A;  3H0F A;  3TEE A;  4K11 A;  2RJE A;  4D8K A;  3JB9 G;  4E7K A;  3EG9 B;  3DLL A;  4LXC A;  2GBQ A;  3CCS T;  4XTU A;  4EPC A;  4PJO B;  1M8M A;  3CCR T;  1OQK A;  2RHU A;  3CCS A;  2DYI A;  5CR2 A;  2DM1 A;  2DZ9 A;  3FB9 A;  3CCR A;  3CPF A;  1RLP C;  4RTV A;  3RKY A;  2NYS A;  3Q1J A;  1QQJ A;  5CKF A;  4C8Q D;  4BD3 A;  2NUT B;  2VKN A;  3VS0 A;  3EFR A;  5GAM d;  3P8D A;  4DEY A;  1ABO A;  3JCM X;  4C8Q A;  2JTE A;  1JJ2 P;  5CK9 A;  1PD1 A;  1X27 A;  4DBH A;  5KYU A;  3RKW A;  2I2L A;  2M0Y A;  3GIB A;  1VUB A;  2KXD A;  2EJF A;  2YXY A;  1V1C A;  3EFS A;  2O2O A;  5LJ5 g;  1G3W A;  3G6E Q;  3CCM Q;  2WSC E;  4BUG A;  2RQR A;  3JAM E;  2GTJ A;  1K8A R;  1ZUU A;  3JCM g;  4FYX B;  3UF4 A;  4IUV A;  3ZEH A;  3TCJ A;  1YHQ T;  3VS5 A;  4M7D E;  4M75 F;  3VYH B;  2AKL A;  2JVV A;  1YHQ A;  1B3Q A;  1SHG A;  1X6B A;  3I5S A;  1KSW A;  2ZPI B;  1YJ9 Q;  1UEB A;  2DF6 A;  4OML A;  5L8R E;  1YJN T;  3QWY A;  1HJD A;  3KBG A;  1M2V B;  2KXC A;  2ZPG B;  4KT0 E;  1VA7 A;  1QLY A;  1YJN A;  1NBE B;  4X1V A;  2L0A A;  4F7U F;  1VQM T;  2NUP A;  1YP5 A;  2LZ6 B;  1RAA B;  2DJQ A;  1VQM A;  4M77 D;  4ANJ A;  1IHV A;  2HDA A;  2RI2 A;  2P0Q A;  1QCN A;  2EGA A;  5GJW B;  4OF1 A;  2DA9 A;  3LH0 A;  3O8V A;  3S6W A;  4M77 A;  1SRM A;  1LCK A;  3OYG A;  1WIE A;  4HCK A;  4B9W A;  2QGG A;  1QVG A;  3I56 Q;  2BZ8 A;  1RL2 A;  3CD6 T;  4VUB A;  3NHN A;  4AFQ C;  3I55 T;  1SPK A;  2ROT A;  2KVQ G;  2LJ0 A;  1GRI A;  1PM3 A;  2LTO A;  3CD6 A;  1VQN Q;  1UUE A;  1Y57 A;  1GBR A;  3I55 A;  2Y90 A;  4A4K A;  1K8A U;  1XTD A;  5D6W A;  5DLO A;  1UB4 A;  1WXT A;  4RTY A;  3UT1 A;  4E2F B;  5FU6 B;  4GBQ A;  3CCJ A;  4FW2 A;  4PJJ A;  3L42 A;  3LWI A;  3MP8 A;  5GAO l;  3M55 A;  3L1A A;  2X4X A;  2FPD A;  4PFZ A;  1BKB A;  2NLU A;  5LJ3 g;  5GAN f;  2PUO B;  3RR6 A;  1T0J A;  3SWN A;  1MMD A;  3QJY A;  4LDY A;  1VIE A;  1QVF A;  2ECZ A;  4ATO A;  3ASK A;  4EIK A;  1I07 A;  1WHM A;  4C92 D;  3PIP A;  3NFC A;  3LLR A;  2KT1 A;  2GNC A;  2RI5 A;  1C6V X;  4E7L A;  1GBQ A;  2LNV A;  3CXC S;  1RAD B;  1M8V A;  1KC8 C;  2CSQ A;  4C5E A;  1H3H A;  3OS5 A;  5A0G A;  2RM4 A;  4A4G A;  3RIR A;  1VQK Q;  3F70 A;  1NYG A;  3M0S A;  4QQG A;  2LVM A;  4HXJ A;  1M5Q 1;  2RNA A;  1BYM A;  2EAY A;  4M75 B;  5IXB A;  4RTW A;  1S1N A;  4C8Q G;  2KI7 A;  2CH4 A;  1HYO A;  1VOM A;  2RF0 A;  1IO6 A;  5M9O A;  2DEU A;  1RAC B;  2E5K A;  4E7Z A;  5IN1 A;  1UGQ B;  1H8K A;  2VXE A;  4KH1 B;  3UAT A;  2MCN A;  2AHJ B;  5FWC A;  4F7U B;  2QEX Q;  5GAN h;  2JTM A;  3ZL7 C;  1CKA A;  2GGR A;  3ZFJ A;  3TVT A;  5GAM f;  2V8K A;  2YLB A;  1X6G A;  4RTU A;  3OA6 A;  2DXU A;  1YI2 T;  1N8R R;  3CCU Q;  5L23 A;  4E7J A;  1KK7 A;  1PCX A;  3OY9 A;  1EZZ B;  2LCS A;  1YI2 A;  2O88 A;  1U3O A;  1OV3 A;  4XU0 A;  2AZV A;  2GQI A;  3R6O A;  4D6W A;  1EFN A;  4IUR A;  4PJL A;  2ZAE A;  1R0B G;  2H8H A;  1QKW A;  4OMQ A;  3LH5 A;  1YJW Q;  3BDU A;  4RTX A;  3JCM P;  2XHC A;  5GMK j;  2KRS A;  4OB0 B;  2AZS A;  1F1B B;  2K3Y A;  4XU2 A;  4M7A E;  2C0O A;  4KGZ B;  3H0I A;  1NJI C;  2MK5 A;  1WLP B;  4JJD A;  1WJS A;  3CCV Q;  2M02 A;  3QYG B;  4HKE A;  4M77 G;  4WTO B;  4F04 B;  4ZGJ B;  3CME Q;  1GCQ A;  1SSH A;  2DPP B;  4EMG A;  3FLG A;  2DRK A;  2LQK A;  2RQU A;  4DA4 A;  2JUF A;  1X69 A;  3A8O B;  2D6F A;  2DIG A;  5FRM A;  2CT3 A;  1JRI A;  4O6J A;  2HQH A;  3URG A;  2NUP B;  3EGD A;  2CUB A;  3V8L A;  1T3S A;  2ROL A;  2BKD N;  2ZPB B;  3HP9 A;  2LT1 A;  4BE2 A;  2C0T A;  3G6E T;  4PFO A;  5D6X A;  3CCM T;  1QVG S;  3N5B B;  1N8R U;  5J3B A;  1ZQ1 A;  4OGE A;  3G6E A;  3CCM A;  2D9T A;  3M58 A;  1X43 A;  3M4G A;  3JSC A;  5IT9 E;  1HD3 A;  4JRP A;  2DRM A;  2QTV A;  5GMK e;  1MV3 A;  3I35 A;  2M16 A;  5EC7 A;  1D1B A;  3OYJ A;  1YJ9 T;  2K4Y A;  1IHW A;  3HPW A;  4C0D B;  5I2S A;  4M7A F;  2EIF A;  1JEG A;  1QVP A;  1YJ9 A;  4F14 A;  1Y96 B;  3MHX A;  2DBK A;  3C95 A;  3S3M A;  5GAO n;  1Z9Z A;  4C92 G;  2PQW A;  5GAN 4;  3QYH B;  5LJ5 j;  3OYA A;  2PUK B;  3TRE A;  2PU9 B;  2RQT A;  2V1Q A;  4PJO D;  1VQL Q;  2HBP A;  4J9F A;  4HCZ A;  4QW2 A;  4JDS A;  1NLP C;  1AZG B;  1E7O A;  4PJO A;  2KRO A;  2YSQ A;  2LQW A;  2YT6 A;  3M4Y A;  3FRN A;  1OX8 A;  1UGV A;  2G3R A;  2MIO A;  2YRD A;  5GAO p;  4Z8A A;  5AYF A;  3H6Z A;  1BIA A;  2LP5 A;  3I56 T;  2KGT A;  2JM9 A;  3LGF A;  3GNG A;  3OW2 A;  2JTF A;  2NUT A;  2CP3 A;  1TUC A;  3QZ9 B;  1MHN A;  2K7A A;  4FYY B;  2VVK A;  1TUG B;  5HK3 A;  3I56 A;  4C92 B;  2WSE E;  4M4Z A;  1W2B A;  1M27 C;  5KH6 A;  4MDW A;  2W0Z A;  4DOW A;  1VQN T;  2V8J A;  2MWO A;  2HD0 A;  5GAN 6;  4AG2 C;  2O01 E;  1PRM C;  3DKM A;  4JJN K;  1VQN A;  1ZSZ C;  2X35 A;  2J6O A;  1XNI A;  2D0N A;  1H64 1;  1QW1 A;  1M90 R;  3CC4 T;  1N9S A;  1SRL A;  2DLP A;  2ENM A;  4HCB A;  1IRX A;  1BCM A;  2A36 A;  5LJ5 e;  2L3R A;  1AT1 B;  3OYB A;  3CC4 A;  3L2U A;  3JCM e;  4AFZ C;  1T0H A;  3DLM A;  1X6O A;  3M54 A;  1YIJ Q;  2EGC A;  3OYD A;  3CPW S;  1D0Z A;  1CSK A;  2CSI A;  2A28 A;  1VQP Q;  2BIV A;  1M2V A;  5KCH A;  4M7D C;  1M1K C;  2HCK A;  2YUO A;  1JQQ A;  2LRQ A;  1KHC A;  3RMS A;  1BB9 A;  3EG2 A;  4ME7 A;  5HY6 A;  1VQ8 Q;  2Y4X A;  3AT1 B;  1VQK T;  1YWO A;  1ZA1 B;  5LJ3 j;  1KQS A;  3C4S A;  2GQV A;  2LJ1 A;  1VQK A;  1Q82 C;  4M78 D;  2J6F A;  4J5Y A;  2A3L A;  1OZ3 A;  2COY A;  4LDV A;  4NL2 A;  4M78 A;  3PVQ A;  4E7I A;  2QG9 B;  4Y28 E;  5GAO q;  1RAB B;  3PFS A;  5GAM g;  1QKX A;  1ACM B;  3UA7 A;  1ZA2 B;  2A08 A;  4EMH A;  1XQH A;  1QWE A;  5A0L A;  2DTO A;  2L3S A;  1Q7Y R;  5KYW B;  1AOJ A;  1KG1 A;  1R8O B;  2D8H A;  3MP6 A;  2CZ6 B;  2KR3 A;  2QEX T;  4RMO A;  4KBM B;  4ZGE B;  4BE0 A;  1M90 U;  4IKF A;  4ORZ A;  1PC0 A;  2P0P A;  2DIQ A;  2QQ9 A;  3P8B B;  4L59 A;  2QEX A;  3VYG A;  4PKC C;  1Q86 C;  4JZ4 A;  3EH2 A;  3CCU T;  4BAC A;  4OB3 B;  2J06 A;  1M4Z A;  9ATC B;  1RAG B;  2EKO A;  1NEB A;  3J81 E;  4HT8 A;  2CH4 W;  3CCU A;  2DD4 A;  2PVD B;  3QXE B;  2QAZ A;  1PD0 A;  1YBY A;  4C5H A;  3JCM Q;  1YJW T;  1K73 C;  1K9M R;  5LJ3 e;  4XU1 A;  5KYX B;  4NOY A;  1O75 A;  2JS2 A;  5GAN d;  4CC7 A;  1TTH B;  2HL5 C;  4F17 A;  1YJW A;  4PJO G;  1NPP A;  2J6K A;  3CCV T;  2KAF A;  1M3A A;  2DAQ A;  2LDM A;  1Q81 C;  3CME T;  3HTR A;  3CCV A;  4JS4 A;  4M75 D;  4L5G A;  1HXD A;  4OMF B;  3CME A;  1QP2 A;  3FJ5 A;  2ZCF B;  3AHU A;  1WJQ A;  5D7U A;  2HMA A;  3OBW A;  2L89 A;  2C06 A;  2DL7 A;  3A8H B;  4M75 A;  2PNI A;  4N4G A;  1TH7 A;  5GMK i;  3X24 B;  2X3X D;  1JJ2 A;  3UPU A;  1Q7Y U;  2GF7 A;  1J3T A;  1U1S A;  1Y71 A;  2LX7 A;  1PNJ A;  2KQW A;  4BE1 A;  1B34 B;  3QJ6 A;  3VKI A;  3H9N A;  1WQW A;  3I9Q A;  4F7U A;  2KRN A;  4IUQ A;  2COW A;  3PE0 A;  4MZP A;  2JOY A;  3JCM J;  2YRV A;  2XU8 A;  3E1S A;  2ATC B;  2LQN A;  1M1G A;  3VS2 A;  2RHZ A;  1K9M U;  1OU9 A;  2WAC A;  2ZPE B;  3L2V A;  1BIB A;  4OMN A;  1D1A A;  2XG8 D;  3V7S A;  2ED0 A;  2QTX A;  1JXM A;  3MEU A;  3THK A;  1VQL T;  1ABQ A;  1VQ7 Q;  3TSW A;  4OMM A;  3P8H A;  2O9S A;  5GMK l;  1VQL A;  3G7Z A;  5KYY B;  1O9S A;  3LX7 A;  3OYC A;  1LOJ A;  1E6H A;  4C8Q E; 
#chains in the Genus database with same CATH homology
 1QP3 A;  3OS0 A;  4M75 B;  2WSF E;  5LJ3 f;  3CC2 T;  2HQE A;  4XK8 E;  1OZ2 A;  4M78 E;  4L6V 5;  4C8Q G;  1N6A A;  4XTX A;  3JCM V;  3VJP A;  4C0G A;  2L5Q A;  1Y07 A;  1BI3 A;  3CC2 A;  3OSS C;  2RHX A;  4M78 G;  2KSS A;  3FDR A;  5M9O A;  3CBP A;  2QQS A;  3NTI A;  5IN1 A;  3QZ5 B;  4TVR A;  4M7A C;  3JCM b;  2MI6 A;  4M77 C;  2YLC A;  1UGQ B;  3RMQ A;  4IUT A;  2VXE A;  2CZ1 B;  1ZBX A;  2YHT A;  2M0O A;  2LC4 A;  2FL7 A;  3INZ A;  3QSU A;  3X20 B;  4DOV A;  2AHJ B;  4F7U B;  2LX9 A;  3G4S T;  5GAN h;  1PSF A;  2JTM A;  3ZFJ A;  5CKE A;  5GAM f;  2V8K A;  3V7R A;  1XOV A;  2YLB A;  1G3Y A;  2QQB A;  3SWN B;  4ZN1 A;  2RO0 A;  3OA6 A;  3G4S A;  4JRQ A;  4M75 C;  2DXU A;  2MMP A;  4C0D C;  1YI2 T;  2EQM A;  1UGR B;  4N4I A;  3EAE A;  3QKJ A;  1Q7Y C;  1WJR A;  4IUU A;  4BI3 A;  3OQ5 A;  4E7J A;  3OB9 A;  3HFN A;  2RK1 A;  3OY9 A;  1WNL A;  2HQX A;  3H8Z A;  3HRU A;  5KCO A;  1YI2 A;  2XDP A;  1NE8 A;  4XU0 A;  2QQR A;  2GCX A;  2KMT A;  3JB9 D;  4XTV A;  3R6O A;  2P0K A;  1G5V A;  2QI2 A;  3LYI A;  3NTK A;  2RK2 A;  4C0F A;  1M9S A;  2A7Y A;  2RJF A;  2FVU A;  4M78 B;  4D6W A;  4IUR A;  1BI0 A;  1VIF A;  2FYK A;  3HRT A;  4NL3 A;  2QA4 T;  5A0D A;  2BUD A;  1YIJ T;  4A4E A;  3BDU A;  1EIF A;  2CS7 A;  3E9F A;  3MET A;  3JCM P;  2XHC A;  2KDS A;  1VQP T;  5GMK j;  2QA4 A;  1X01 A;  3SWN C;  4FT2 A;  4O5V A;  5I21 A;  4OB0 B;  3OYL A;  4BDZ A;  2RD1 A;  4JRK A;  2K3Y A;  5CAI A;  4XU2 A;  1Y96 A;  4M7A E;  3LWH A;  3VV0 A;  4M77 E;  4X34 A;  1U1T A;  1VQP A;  1NJI C;  1BI1 A;  1LJO A;  1Y7X A;  2CZ7 B;  5LJ3 h;  3GPL A;  4M7D F;  2GFA A;  2EJ9 A;  1WJS A;  2E12 A;  4LD6 A;  1OYX A;  2E65 A;  2IG0 A;  3OMG A;  3QYG B;  4LDU A;  4HKE A;  4M77 G;  4M7A G;  1U8R A;  3HRS A;  4FSX A;  4ZGJ B;  4V2S A;  1GXI E;  2E70 A;  2P4T A;  2R5M A;  5J26 A;  2DPP B;  1VQ8 T;  3OYI A;  4EMG A;  2B8A A;  3FLG A;  3BDL A;  1WQ7 A;  4C92 C;  2L8D A;  3OW2 S;  2XDB A;  2LQK A;  3T9N A;  4M75 E;  4NS5 A;  2ZPH B;  5C6S A;  5HKC A;  4DA4 A;  3HKS A;  1VQ8 A;  2JUF A;  3A8O B;  3JRZ A;  2D6F A;  2XD0 A;  2DIG A;  4ELZ C;  5FRM A;  2QDY B;  3OMC A;  1JRI A;  4J7I A;  3OS1 A;  1W2B S;  1AHJ B;  4M75 G;  3SB2 A;  4J6W A;  4II1 A;  4O6J A;  1I5L A;  5FU7 B;  1Q81 U;  2K5L A;  4J6X A;  3URG A;  1M90 C;  1I81 A;  2DO3 A;  3PMT A;  1KD1 C;  3C12 A;  4EMK C;  3V8L A;  3QHS A;  4ZTJ A;  1WPY A;  3E19 A;  2F5T X;  3S3N A;  4KUD K;  2BKD N;  2HNI A;  2K57 A;  5EG2 A;  2ZPB B;  4OB2 B;  4EDU A;  3HP9 A;  4LDX A;  3MEV A;  2LT1 A;  4F7U E;  4BE2 A;  3G6E T;  2DKG A;  5D6X A;  3CCM T;  4C92 A;  1QVG S;  3N5B B;  1N8R U;  1FX7 A;  5DY9 A;  1ZQ1 A;  5J3B A;  4F7U G;  4FIB A;  4OGE A;  5GAN 3;  2DD5 A;  3G6E A;  3CCM A;  2D9T A;  3M58 A;  1V29 B;  3M4G A;  3JSC A;  2EJG A;  4MZM A;  3GP8 A;  4M7D D;  3GNF B;  4HT9 A;  3OYH A;  2M9U A;  5IT9 E;  3RUX A;  3LW5 E;  2V8I A;  3A8M B;  4JRP A;  5GMK e;  5FU7 C;  2E1H A;  4EMK A;  1VQ6 T;  1DJ7 B;  4MMK A;  3X26 B;  5FLX E;  4M7D A;  2M16 A;  2XID A;  1WGS A;  2E5Q A;  3A8G B;  3C94 A;  2K4Y A;  3OYJ A;  1YJ9 T;  3RKX A;  3HPW A;  3GOX A;  2DXC A;  4C0D B;  1VQ6 A;  5J39 A;  4JS5 A;  1M1K U;  3CCE T;  5I2S A;  4M7A F;  2EIF A;  1QVP A;  4M77 F;  3JCM c;  1YJ9 A;  1Y96 B;  2CKK A;  4BB7 A;  1NPR A;  2VGN A;  3MHX A;  3C95 A;  3RES A;  5GAO n;  3S3M A;  3SDZ A;  2JNG A;  4C92 G;  2PQW A;  5GAN 4;  3QYH B;  4X9D A;  2K5F A;  3SFM A;  5GAM j;  4JLG A;  3CCE A;  5LJ5 j;  4IUP A;  2VV5 A;  3OYA A;  2LCC A;  4FU6 A;  2PUK B;  3TRE A;  2R58 A;  3MEA A;  1PSE A;  2PU9 B;  4RG2 A;  4PJO D;  4N4H A;  3QII A;  5HK0 A;  2RHY A;  5CKD A;  2HBP A;  5DLQ E;  1Q82 U;  3PMI A;  4HCZ A;  4QW2 A;  1D3B A;  2DXT A;  3OBY A;  4JDS A;  3CMA T;  4RG8 A;  4E47 A;  3FC3 A;  4JUV A;  4OP0 A;  3J7A F;  1KQS S;  3FEO A;  5CQY A;  1JB0 E;  3PNW C;  2EWN A;  4PJO A;  4N0A A;  4UC4 A;  3JCM W;  2CZ0 B;  4XQ3 A;  3CMA A;  2Y4Y A;  4J8O A;  5CVI A;  3M4Y A;  3FRN A;  4QQD A;  2PVG B;  4KUI A;  3LGL A;  4QVZ A;  2RJC A;  1HK9 A;  1N27 A;  2VXF A;  3WVD B;  1ZHI A;  2G3R A;  3M56 A;  2DVE A;  4PNO A;  1K8A C;  4XTY A;  3DB3 A;  5GAO p;  5AYF A;  3H6Z A;  1BIA A;  3MO8 A;  4ZTF A;  3MCA B;  3JB9 H;  1I4K 1;  3I56 T;  3LGF A;  3GNG A;  3OW2 A;  4ZGD B;  3L2Q A;  2JTF A;  3ER0 A;  4XU3 A;  3OYK A;  1UGS B;  3QZ9 B;  1OI1 A;  1MHN A;  1VQO T;  2R57 A;  5HK3 A;  4FT4 A;  4BI4 A;  4C0Z A;  3I56 A;  4C92 B;  1NZ9 A;  1H3Z A;  2WSE E;  2LQ8 A;  3S3O A;  1W2B A;  4QQ6 A;  1M1F A;  3WXM B;  5KH6 A;  4MDW A;  4DOW A;  2DJZ A;  4X9C A;  1VQO A;  1Q86 U;  1VQN T;  2H3J A;  2V8J A;  3FIF A;  3SD4 A;  3X25 B;  2MWO A;  2HD0 A;  3M5A A;  3DB4 A;  3PGG A;  5GAN 6;  3L2R A;  3PT9 A;  3TU4 K;  2O01 E;  2EAY A;  4KUL A;  1VQN A;  3DKM A;  4JJN K;  1JBM A;  1P92 A;  2ZGW A;  1YIJ A;  3WVE B;  3BY7 A;  2X4Y A;  2QQA A;  2X35 A;  3OS2 A;  1XNI A;  4EMK B;  4C8Q F;  3CXC A;  1H64 1;  5KE3 A;  3OYE A;  2FB7 A;  5D6Y A;  1QW1 A;  4MZT A;  3PTA A;  2E6N A;  4JLI A;  5CCA A;  3CC4 T;  3CEY A;  1N9S A;  2M1H A;  3X28 B;  5GAN j;  4Y91 A;  5GAO m;  4M78 F;  4LDW A;  1K9M C;  4HCB A;  4E7H A;  5GAM e;  5LJ5 e;  3J80 E;  2DTI A;  2L3R A;  3VU3 C;  2O4X A;  1K73 U;  2X4W A;  3MEW A;  3NTH A;  4FL6 A;  3OYB A;  3CC4 A;  2CGH A;  3OYN A;  4MDX A;  2DEQ A;  3L2U A;  4Q5W A;  1BI2 A;  1N8R C;  3JCM e;  2E41 A;  5CQX A;  5CKB A;  3TEE A;  4XTZ A;  2RJE A;  1IZ6 A;  3DLM A;  3JB9 G;  5GAN 8;  1X6O A;  3M54 A;  3OYD A;  3CPW S;  4E7K A;  4XAX B;  4HCC A;  3DLL A;  3E9G A;  3CCJ T;  1D3B B;  2RH2 A;  5GAO r;  2BIV A;  3QO3 A;  2E64 A;  4FM4 B;  3HHT B;  4XTU A;  4EPC A;  3CCS T;  4PJO B;  1X75 C;  5KCH A;  4M7D C;  5KE2 A;  4QVD A;  3CCR T;  2RHU A;  1M1K C;  4JRI A;  3CCS A;  5CR2 A;  2LRQ A;  1KHC A;  1VQ7 T;  2DZ9 A;  3QG1 A;  3RMS A;  1SSF A;  3FB9 A;  4HA8 A;  4ME7 A;  5CIU A;  3CCR A;  3MP1 A;  5HY6 A;  3CPF A;  2RJD A;  2Y4X A;  4CI0 C;  3RKY A;  5DM7 R;  1VQK T;  3Q1J A;  1VQ7 A;  3RER A;  2K3X A;  4BY6 B;  5CKF A;  5LJ3 j;  3GLX A;  2FHD A;  4C8Q D;  1KQS A;  2F69 A;  3M59 A;  2CYZ B;  4BD3 A;  5I2M A;  2DK3 A;  2R5A A;  2GQV A;  2X4J A;  3C4S A;  3EFR A;  4A53 A;  1VQK A;  1Q82 C;  4M78 D;  4LD9 K;  5GAM d;  5LJ5 d;  3P8D A;  1FXX A;  3L2Z A;  2K5I A;  2XKO C;  4J5Y A;  2OAU A;  4A4H A;  3JCM X;  4C8Q A;  3PIO A;  1JJ2 S;  5CK9 A;  2A3L A;  1OZ3 A;  4QVC A;  3JCM d;  4LDV A;  4NL2 A;  4PJO C;  4N0A C;  4M78 A;  3RKW A;  2I2L A;  4E7I A;  1VUB A;  3GIB A;  2EJF A;  4Y28 E;  4C92 E;  1S72 T;  3HL8 A;  5GAN e;  5GAO q;  2OTL T;  3PFS A;  3EFS A;  5GAM g;  5LJ5 g;  1G3W A;  1KHI A;  3KXT A;  2JN0 A;  4J83 A;  4EMH A;  2WSC E;  1XQH A;  2EQU A;  4BUG A;  2DTO A;  5A0L A;  3JAM E;  1S72 A;  3V8K A;  2OTL A;  1KG1 A;  1R8O B;  2KY9 A;  4RCC A;  3MP6 A;  2CZ6 B;  2XI9 A;  4PLI A;  3JCM g;  4RMO A;  2QEX T;  1VQ5 T;  4KBM B;  4IUV A;  4BY6 C;  4ZGE B;  4BE0 A;  3ZEH A;  3M57 A;  3JB9 J;  1M90 U;  4IKF A;  3TCJ A;  2O4X B;  2P0P A;  3A8L B;  2LT4 A;  2DIQ A;  2RHI A;  1VQ4 T;  1YHQ T;  2QQ9 A;  3P8B B;  4L59 A;  2QEX A;  1VQ5 A;  4M7D E;  2PVO B;  3VYG A;  4M75 F;  4PKC C;  3VYH B;  4C5I A;  1Q86 C;  2IVW A;  1QVF S;  1I8F A;  2JVV A;  1B34 A;  1VQ4 A;  1YHQ A;  3CCU T;  4BAC A;  4M7D G;  4OB3 B;  1M4Z A;  1YIT T;  1RI0 A;  2VYT A;  2ZPI B;  5LL6 S;  2EKO A;  5GAN 5;  3J81 E;  4HT8 A;  2MF2 A;  1UEB A;  5L8R E;  1YJN T;  1KC8 U;  3BFM A;  3CCU A;  2DD4 A;  3VUB A;  3KBG A;  5FRN A;  5GMK h;  1YIT A;  3QUI A;  2ZPG B;  4J7F A;  2PVD B;  4R56 A;  4KT0 E;  4RKU E;  3QXE B;  4C8Q E;  1YBY A;  1YJN A;  4C5H A;  4A54 A;  4J6Y A;  4F7U F;  3JCM Q;  1VQM T;  1YJW T;  1K73 C;  2XK0 A;  5LJ3 e;  4MML A;  3CCL T;  4XU1 A;  2D0Q B;  4NOY A;  1O75 A;  3CPW A;  5LJ5 f;  1FWZ A;  5GAN d;  2JZ2 A;  4BDY A;  4PJO E;  3ME9 A;  4M7A D;  1YJW A;  1VQM A;  4OGC A;  4M77 D;  3CCL A;  2DZC A;  4PJO G;  4XTW A;  3V8J A;  2RI2 A;  2P0Q A;  3JCM f;  3UDC A;  1NPP A;  2VUB A;  2RB6 A;  3CCV T;  2KAF A;  4OF1 A;  2DAQ A;  2E10 A;  2LDM A;  2EYQ A;  2ZPF B;  2GFU A;  3LH0 A;  3O8V A;  3S6W A;  1G3S A;  4M77 A;  1Q81 C;  3CME T;  4M7A A;  1W4S A;  3OYG A;  4DQ2 A;  5GAN g;  4OB1 B;  5CO7 A;  4BI8 B;  4C8Q B;  3CCV A;  3M9Q A;  4B9W A;  4M7D B;  3CC7 T;  4JS4 A;  3HFO A;  4M75 D;  4L5G A;  1HXD A;  4OMF B;  3FJP A;  4C92 F;  1QP2 A;  3CME A;  1QVG A;  2ZCF B;  4R55 A;  4CRI A;  1WJQ A;  3CCQ T;  3AHU A;  2XIC A;  3OBW A;  2EFI A;  1RL2 A;  3CC7 A;  3V7C A;  3BW1 A;  3QPH A;  1G3T A;  2L89 A;  4VUB A;  1UGP B;  5IAY A;  2C06 A;  3CD6 T;  3CCQ A;  3A8H B;  4M75 A;  4ZN3 A;  3I55 T;  5CKH A;  4N4G A;  1TH7 A;  5GMK i;  2KVQ G;  3X24 B;  2LTO A;  3CD6 A;  1JJ2 A;  4A4F A;  3UPU A;  1Q7Y U;  3I55 A;  2Y90 A;  2GF7 A;  4A4K A;  1K8A U;  5FRO A;  2XDD A;  3GF5 A;  1U1S A;  1XTD A;  5D6W A;  3OYM A;  4GLK A;  4GY5 A;  5DLO A;  1UB4 A;  5LJ3 d;  4YTL A;  1Y71 A;  5C0M A;  3UT1 A;  1VQ9 T;  4OVA A;  2KQW A;  2QXF A;  5FU6 B;  3G71 T;  1B34 B;  3QJ6 A;  4BE1 A;  3CCJ A;  2KK4 A;  3VKI A;  1KQ2 A;  4C8Q C;  1WQW A;  3LWI A;  3L42 A;  5GAN 7;  3MP8 A;  1KQ1 A;  5GAO l;  1VQ9 A;  5GAN 2;  3M55 A;  3L1A A;  3QBY A;  1LNX A;  4M78 C;  4F7U A;  2MAM A;  2EQJ A;  2X4X A;  4IUQ A;  3G71 A;  2DXB A;  2DTH A;  4C5G A;  1BKB A;  2NLU A;  4MZP A;  2JOY A;  5LJ3 g;  5GAN f;  2PUO B;  2VC8 A;  3SWN A;  5A2Q E;  3JCM J;  2OTJ T;  3QJY A;  4PLL A;  2YRV A;  5GMK m;  2XU8 A;  4LDY A;  3E1S A;  1VIE A;  2HAX A;  1QVF A;  5GAM h;  3CBM A;  3OSV A;  5LJ5 h;  3HSB A;  3CBO A;  3ASK A;  1YCY A;  4ATO A;  4B9X A;  2OTJ A;  4PJO F;  2K2V A;  3JB9 I;  4C92 D;  1NJI U;  3A5Z B;  2EQK A;  1M1G A;  3NFC A;  3PIP A;  3LLR A;  3L2W A;  4P5N A;  2RHZ A;  2RI5 A;  3JCM h;  3ZBD A;  4E7L A;  1K9M U;  2WAC A;  2ZPE B;  3QDR B;  3L2V A;  4WF2 A;  1BIB A;  2LNV A;  3CXC S;  5FU6 C;  2XG8 D;  4Z02 A;  4RCB A;  3V7S A;  1M8V A;  1KC8 C;  2QTX A;  4M7A B;  2VGM A;  4C5E A;  4M77 B;  2RA2 A;  3MEU A;  1VQL T;  4ELY C;  3OYF A;  3UWN A;  3OS5 A;  1MGQ A;  2E6Z A;  3P8H A;  5A0G A;  2RM4 A;  4A4G A;  3VUZ A;  2LCL A;  3RIR A;  5GMK l;  2MWP A;  2RI3 A;  1VQL A;  3OYY A;  1IRE B;  3M53 A;  3F70 A;  1N9R A;  3G7Z A;  4PL6 A;  1O9S A;  3KUF A;  3LX7 A;  3OYC A;  1KD1 U;  4QQG A;  1LOJ A;  3JB9 F;  2LVM A;  1M5Q 1;  1BYM A;  2F5K A;  2ZZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...