4M77B

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISSTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
total genus 20
structure length 91
sequence length 91
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77B00
3QHSA 2EJFA 2DTIA 3AHUA 5GAOr 5GAN2 4M75B 5GANf 3JB9J 4C92A 3QSUA 1KQ1A 3QUIA 2DJZA 1LOJA 2DXUA 1YCYA 2E10A 1N9RA 2E41A 2YLBA 4NL2A 4N0AA 4PNOA 4X9DA 5GAOp 5GAOq 4PJOC 4XTVA 1M5Q1 3JCMQ 3RKXA 4A53A 4C8QA 4J6XA 4XTXA 1WPYA 4M7DF 2RB6A 4M75C 4M7AC 4MMLA 5GAMh 4X9CA 4M75E 5GAN4 2E64A 2QTXA 5GAMj 1JRIA 5GANg 1KQ2A 4QVDA 3SWNB 2RD1A 4EMKB 2JN0A 4XU3A 2EJGA 3L2ZA 5LJ3g 3RUXA 3JCMP 4J6YA 1HXDA 3BW1A 5GANe 4N0AC 1D3BA 4C8QF 2VXFA 4V2SA 4J5YA 4JRIA 3HFNA 3JB9F 4EMKA 4F7UB 4PJOA 5DY9A 2DTHA 4HT9A 1H641 5LJ5j 5GANd 2DZ9A 5GMKh 5GMKj 4NOYA 3JCMX 5GAN3 4C8QB 4XQ3A 4HA8A 2Y90A 4C92E 5GANh 5GAOm 3JB9D 5GMKl 5GMKi 3QO3A 3FB9A 4EMGA 1M8VA 4M77B 4A54A 3HFOA 1Y96B 2DTOA 5GMKe 2CGHA 5LJ5d 5GMKm 4PJOD 4EMHA 3EFRA 3JCMJ 4PJOF 3JCMh 3JCMc 4F7UG 3L1AA 5GAOl 4C92F 1Y96A 3V7RA 3V8KA 3JCMd 4M77A 1B34B 2I2LA 3BDUA 4M78B 4C92C 4M77C 4C8QE 4M77G 4M7DC 4M78D 3EFSA 1U1SA 3JCMe 2DEQA 4PJOB 4M7DA 1HK9A 2K57A 5LJ3f 1WQ7A 1U1TA 4RCBA 5LJ5g 1I5LA 2YHTA 3RKWA 4HT8A 3JB9H 3V8JA 4M7DD 2ZGWA 3JCMg 5GANj 3PGGA 4M78G 2RA2A 2YLCA 4PJOE 1LJOA 4XU1A 4PJOG 2E65A 4JUVA 1I8FA 2FYKA 4M78E 4F7UF 4QVCA 4RCCA 4M7DE 5GAMd 4XU0A 2EWNA 2DVEA 4XU2A 3GIBA 4M7AG 4M7AE 1WNLA 2DKGA 5GAN5 4M75D 2EAYA 3INZA 2DXTA 3JCMf 4F7UE 4EMKC 4M7DG 3M4GA 1I81A 3RKYA 3JB9I 4Y91A 4M77E 3BFMA 3V7SA 4C8QC 4XTZA 4OP0A 5GAN7 2RM4A 4M7AB 3JCMV 4J6WA 4M77D 5GAMg 3FJPA 5LJ3e 5I21A 3V8LA 1B34A 3JCMb 4M78A 2HNIA 4C8QD 4NL3A 1BIBA 4C8QG 5GAN8 2DZCA 5LJ5f 3RERA 3V7CA 4XTUA 4WF2A 5LJ3j 4M7AF 5LJ3h 4M75F 3VU3C 3FIFA 5GAMe 4M7AD 5LJ3d 4C92G 2E1HA 5GAMf 3JCMW 4JLIA 2FB7A 2EJ9A 4XTYA 1WQWA 5LJ5h 1TH7A 3HSBA 3SB2A 5CAIA 3JB9G 4M7AA 4M78F 4M75G 4MMKA 1MGQA 1JBMA 1I4K1 4M78C 3RIRA 1D3BB 2VC8A 4M7DB 4DQ2A 4F7UA 4C92B 1N9SA 4M75A 5LJ5e 4C92D 3SWNC 1X01A 2VXEA 5GAOn 1BIAA 3RESA 4JRKA 5GAN6 4XTWA 1LNXA 3BY7A 3SWNA 4M77F
chains in the Genus database with same CATH superfamily
2D1XA 4LDXA 2OTJQ 1WXTA 2XIDA 1UDLA 1MMDA 4IURA 4FW2A 4A53A 2J7IA 1EZZB 3BE3A 1Q81U 3EFOA 1B3QA 2FPFA 2EYWA 1YHQA 1R0CB 4OMQA 1X6BA 1SRMA 3QWXX 2RF0A 4IUPA 3BW1A 2XDDA 4J5YA 1PC0A 2F69A 3HL8A 1H641 2DZ9A 5KE2A 5KE3A 5GANh 5KCHA 2R57A 1Q7YR 2PTKA 3OYAA 3O5ZA 4C5EA 4XK8E 1ZBJA 1E7OA 2KT1A 5FLXE 2GQIA 4Z88A 2GBQA 1TTHB 4C5HA 4PJOB 1M27C 2MWPA 4MDXA 1YITQ 1M3BA 1I5LA 2YHTA 3LYIA 4HT8A 1VQ8T 3OYBA 2JM9A 4CC2A 4JUVA 2ZZDA 3U23A 4BE0A 1OI1A 1MMAA 3M0UA 3CXCA 4M75D 2DJQA 3OS0A 3L2UA 1G3SA 2J6FA 2JUFA 3S3OA 2LCCA 5CKFA 4M78A 6AT1B 2RQUA 4E7IA 3V7CA 1ZA1B 4WF2A 3NPFA 3NHNA 4KULA 1M1GA 1QWEA 2EPDA 4N4IA 2V8KA 4HCZA 1NJIR 1MGQA 3OS5A 1M2VB 4F7UA 2RJEA 1OYXA 2F1LA 3J80E 3BY7A 5IHKA 5CR2A 4M75B 3GBQA 3C4SA 5D6YA 3CCQT 4JJBA 3OW2A 4NL2A 2L3RA 1FYNA 3CCMA 3N5BB 1KQ2A 2ZPHB 1ZX6A 3CCJA 5M9OA 1AHJB 2QGGA 2RN8A 1VQ6Q 4J7IA 2EQJA 1OPLA 2RQVA 5DY9A 2DTHA 2RI3A 3RMSA 2C06A 3OS2A 3WVDB 1MHNA 2CP2A 1BCMA 3I55T 1H3ZA 5A0LA 4F7UG 1IB8A 1JXOA 3UWNA 3JCMd 4A4GA 4C5IA 1IGUA 1RLPC 1N8RU 1VQLA 3M58A 3CC7T 2DL3A 2F5KA 3C95A 4BE2A 4RTVA 2K2MA 4J9FA 1M8MA 1U1TA 4RCBA 3VS7A 1O9SA 2RHXA 2J6KA 1BCOA 1VQMT 2R5AA 3I55Q 1UG1A 4M4ZA 3CC4T 3CCST 4M7AG 5GAN5 2FRYA 3VRYA 2QEXA 4J9CA 3H9NA 1S72T 3CMAA 3PMIA 4RG8A 3A8HB 4A4KA 3ER0A 4XAXB 5LJ3e 2CH4W 4JDSA 2DERA 2DL8A 1BYMA 2HNIA 2O4XB 2QA4A 4OB1B 1J3TA 4HVWA 2DVJA 1Q7YU 1KD1R 1QKWA 3CCET 3CCUT 5KYYA 1UJYA 3RR6A 4CC4B 4II1A 1W70A 1YFNA 1T0HA 2OJ2A 5D7UA 3E2UA 3EH1A 1M4ZA 2X4XA 1RAEB 4C92A 3QSUA 1KQ1A 3QUIA 1KC8R 1T3SA 1YCYA 2CP0A 3MEAA 3MP6A 2O31A 1VQ9A 4M7DF 4MMLA 1PKSA 5GAMh 2E6ZA 2PNIA 2FG0A 1QW1A 2RD1A 4IUQA 4N4GA 4J9BA 3L2ZA 1UJ0A 3RUXA 4J6YA 1MMGA 2RNAA 2A37A 4C8QF 2IIMA 3JB9F 4VUBA 3M4YA 1WXBA 1W1FA 3LGFA 3QG1A 5GMKj 1HSQA 2KR3A 2DL7A 4E7ZA 2Y90A 5GMKl 3RBBB 3QKJA 3QO3A 2EQUA 1M1FA 2IPOB 1N8RC 1Z9ZA 2ROTA 2OTJT 5CQXA 1YJNA 4M77C 2AHJB 3OYNA 5LJ3f 1PCXA 1TG0A 1ZLMA 1JO8A 1H3HA 1T3LA 3G1JA 2EKOA 1P92A 4AFQC 3WVEB 1TU0B 4BI4A 5FU7C 3QWYA 2AZSA 2BKDN 1M1KU 3CCLQ 1YI2A 2KDSA 4DOVA 3VS4A 2O4XA 4RTUA 4ATOA 3L2VA 1NYGA 1WNLA 3LWIA 1SEMA 3JCMf 4E7LA 3M4GA 4PFOA 2RK1A 2EKHA 3ZBDA 4J6WA 2CZ6B 5KYWA 3V8LA 1KJWA 1V76A 5I2SA 3VKIA 2QGFB 3EG9A 1X69A 2D8HA 2BUDA 3CC4Q 1VQ7A 2FB7A 2W0ZA 1WJQA 2YUNA 5GJWB 3KXTA 2DA9A 3SB2A 4M7AA 2OTLA 2HKNA 3MEUA 1I4K1 2VC8A 4DQ2A 2AK5A 3PE0A 3M0PA 4KGXB 3EHQA 2L3PA 5GAOr 4M77F 5GAN2 4RTZA 4J83A 2XMFA 5FU6C 1VQOA 2K7AA 3TEEA 2DLPA 4PJLA 4PNOA 3HRTA 3RKXA 2X4JA 2PVOB 2E3HA 3QXEB 2JTMA 4DBRA 2NLUA 1M90C 3CCVQ 5IAYA 5LJ3g 1YJNQ 1PM3A 1AOJA 4JZ3A 1JB0E 2OX7A 4EMKA 2RI2A 2CT4A 3VS5A 1WI7A 1XNIA 1X75C 3R6OA 4OGEA 2JTEA 2E5KA 4PJOD 2RHIA 3PNWC 4EMHA 3JCMJ 3CCMQ 5GJVB 4FCYA 4MDWA 1B34B 3L42A 2KE9A 4L59A 4TVRA 2NUTB 2V8IA 2KXCA 3CXCP 1Q86C 2V1QA 3CD6Q 3S3NA 2EVRA 1PNJA 4L5GA 1V29B 1Z9QA 4PJOE 1LJOA 1BK2A 1KHIA 2ATCB 2QDLA 3F70A 1GCPA 1UHCA 1VQ5Q 3G71A 1SPKA 1X27A 1Q82C 2DXTA 2KNBB 2DD5A 1VQ4T 1NJIU 5FRNA 5J26A 3V7SA 4C0DC 5GAN7 2DBKA 5GAMg 4LUEA 1YJ9T 4E7KA 1I0CA 5DM7R 2CREA 1IZ6A 1G3YA 4KGZB 2GTJA 5CKDA 3VS1A 4XTYA 3OMCA 1ABOA 2JNGA 2L3SA 1WHLA 1VQ8Q 4M78C 3DB3A 4OMOA 4FYVB 2VXEA 3QZ9B 1XOVA 3CBPA 2VUBA 3QJYA 2RHZA 2E41A 3KBGA 1QCOA 4ME7A 2L89A 5GAN4 1D0ZA 3PMTA 2GNCA 2LT1A 1R0BG 3UA6A 3LH0A 3H6ZA 1OX8A 1D1AA 3SWNB 3OYJA 2LJ3A 1NLPC 2EJGA 2YWWA 3CCRQ 1YJNT 2HBWA 2VXFA 4JZ4A 1NEBA 2MCNA 3IQLA 2RHYA 3P8BB 3M53A 1HD3A 2DTOA 5LJ5d 4J9DA 5GMKm 3C0CA 2K3YA 2X4WA 1VQOT 3V7RA 1PHTA 4M77A 3L2QA 2DILA 1VQ6A 4J7FA 4BI8B 4M77G 1VQLT 5KYUA 3A8MB 3BDLA 3EGXB 2ZAEA 2GF7A 2QI2A 4MZPA 2RI5A 3JB9H 2DYBA 2KK4A 1UGPB 3G4ST 4QVCA 2WSCE 2H8HA 4Z89A 1H8KA 2DVEA 1W2BA 1YWOA 1X43A 4HCKA 1S72A 3GIBA 3SHWA 1NJIC 1Q81R 3L2WA 2Y4XA 1Y07A 4Y91A 4KBMB 1FMWA 2PVDB 3ME9A 1KHCA 3X20B 4LD9K 2COZA 5GAN8 3MEWA 1BB9A 2E1HA 2WSEE 2HBPA 2DPPB 4LUDA 4O6JA 1YI2Q 1TH7A 2DRKA 5AYFA 2E3IA 3URGA 2GFUA 2VVKA 4IUTA 4M7DB 5HK3A 4RTYA 2DF6A 2GFAA 3CEYA 3VS3A 3CCJT 1CKBA 3QZ5B 5GAOn 2XHCA 1IXDA 4WCIA 2IG0A 3H8ZA 2FEIA 2DJZA 5IH2A 2EQKA 1WHJA 1UTIA 1RI0A 3G7ZA 2LMJA 4HVVA 3DB4A 5D6WA 3MPUB 2EGEA 2L3QA 4X34A 2DYIA 2C0OA 4LNPA 3QDFA 4E2FB 3CXCS 1JJ2S 1D3BA 4GLKA 1X2KA 4HT9A 2DNUA 4F14A 1SF9A 2JZ2A 4O5VA 4MZTA 2ED1A 2YT6A 4Y28E 3T9NA 1KQSP 2D0QB 3OSSC 2EYXA 5LL6S 3P8DA 1Y96A 1AVZC 2EQIA 2F5TX 4M78B 4OVAA 4C8QE 4M78D 2CH4A 3MO8A 1EIFA 3PVQA 1I07A 4CRIA 8ATCB 2QEXQ 4EIKA 1XJWB 1WYXA 5KYXB 1RI9A 3OW2S 2D8JA 1OEBA 5DLQE 2EIFA 4PJOG 1WJRA 4XU0A 4A4EA 2RK2A 5FWBA 3EG2A 4AFZC 3EG0A 1GRIA 3NGPA 4ZTFA 1I81A 1PRLC 3EG1A 1M30A 3HRSA 1GFCA 1OQKA 3THKA 1BI3A 2QQSA 2K5IA 1QVGS 4Z02A 5A0GA 3CC4A 2CT3A 4M7AF 1Y57A 1YJWT 4C92G 2BE7D 4CC7A 1RADB 2PZ1A 2LX9A 3MCAB 5CIUA 1VQPA 2M1HA 1YBYA 2DL5A 2K5LA 2O2OA 2E70A 3M57A 2EFIA 1SHFA 3SWNC 1X01A 2KRSA 1AWJA 3INZA 4OMFB 5EG2A 2KQWA 5ECAA 3M55A 3QBYA 5GAOp 2K79A 4C8QA 1HJDA 2JMAA 4R55A 2FRWA 2X9HA 1Q82R 4RUGA 5KCOA 1VQNQ 1NLOC 1KSWA 3OYHA 5FRMA 1GBRA 2MWOA 1VQNT 2CP3A 1G83A 3ZEHA 4LE9A 4NOYA 3JCMX 4C8QB 5GAOm 2HD0A 4BY6C 1UHFA 3M9QA 1YHQQ 1UGSB 1BU1A 2I0NA 4F04B 3HPWA 2HEQA 2MI6A 1Q95G 3LW5E 3CCVA 3Q1JA 3FLGA 3EFSA 2KSSA 1EX4A 4IIOA 3VUBA 1HK9A 4KH1B 3JRZA 3V8JA 1VQKQ 4MZMA 5GANj 1ZQ1A 4A4FA 3UDCA 1E6HA 2QQAA 3G6ET 2Z0WA 2H3JA 3E19A 3META 4E7JA 1K1ZA 3X26B 2K4YA 4XTZA 4M7AB 4FSXA 3SD4A 4PJMA 2DO3A 2B8AA 1UGVA 4C8QG 2DZCA 2JJ9A 2CZ0B 1K9MR 1UGQB 3CBMA 1AD5A 5GAMf 3CC2A 1NM7A 1VQPQ 3CC7A 1RAGB 2JM8A 1QVGP 3DLMA 2D6FA 2ZPEB 2HCKA 1VA7A 2EGCA 1LNXA 3SWNA 2G3RA 4N4HA 2VGNA 2RQRA 1RACB 1LOJA 1X2QA 2P0KA 4BB7A 4J9EA 2XD0A 1BBZA 1D1CA 3CPWA 1Q81C 5CO7A 3GNGA 3A5ZB 2LP5A 4HCCA 5HY6A 1KD1U 1OU8A 2JN0A 3G6EA 4JJCA 2RHUA 3JCMP 3M56A 2J6OA 2KGTA 4KUIA 2KYBA 1VQ4Q 3TSZA 5IHIA 1G3WA 5GAN3 2DFUA 3M0TA 4PL6A 5GMKi 1KD1C 2ZCFB 3HFOA 3UA7A 2M51A 2JVVA 3JCMc 4C92F 2DETA 3CD6T 1PD0A 4WTOB 3A8LB 3BDUA 4HCBA 1WA7A 1M90R 4M7DA 3CCJQ 3OYGA 1KK7A 4ZN1A 5FWCA 2XK0A 4M7DD 4BDZA 1GCQA 3EHRA 3EFOB 4M78E 4GBQA 1UFFA 1NYFA 1H92A 1IREB 2BTTA 3H0FA 2B86A 2LQKA 1C6VX 4F17A 2KI7A 4B9XA 1DJ7B 2YDLA 5DLOA 4ORZA 1E6GA 1RAAB 1BIBA 1TUCA 2HQEA 3G71T 4JRQA 3CCLT 1UE9A 3I56T 3CCQQ 4LD6A 1D09B 2DEUA 5KH6A 3FC3A 2QDYB 4DOWA 2P0QA 2SRCA 4ELYC 3WXMB 3I55A 4RTWA 5GANf 2OAUA 1W4SA 1K8AC 1YNZA 2E10A 1N9RA 2L8DA 3PIOA 2C0IA 4ZN3A 3OYFA 2GGRA 4X9CA 5GAMj 4OB3B 4BDYA 2WACA 3C94A 4FM4B 4RTXA 4RMOA 4QQGA 1TXQA 2DMOA 2MAMA 4JLGA 3VYHB 2ED0A 4HVUA 3RNJA 1WHGA 3OS1A 1GL5A 3HFNA 3MKDA 2RJFA 2MYSA 2V8JA 1ZSZC 3ASKA 4FIBA 4E6RA 1K4US 4PLIA 1C1AA 4PJOF 4ZNXA 3OYYA 4D8KA 5GAOl 5A0DA 2XI9A 4J8OA 2WSFE 3QJ6A 4DBHA 1JJ2A 4FYXB 1WQ7A 2LCSA 1U8RA 4R0KA 2ZGWA 3CPWP 4PFPA 4AT1B 3CCUQ 1AWXA 1SSHA 2P0PA 2K3XA 2L2PA 1B7TA 4QW2A 3NTHA 2O9SA 3P8HA 5KYWB 1YJ9Q 4E7HA 3AT1B 4PKCC 1VQ9T 2RMOA 3JCMb 4QVZA 3H0HA 5I11A 4ZGDB 1AT1B 1VYTA 2EGAA 4JLIA 3OYKA 4B9WA 2LX7A 2MIOA 2GTOA 5CAIA 4C0GA 3JB9G 2BE9B 1VQKT 3X25B 1MUZA 1WXUA 3EAEA 2H3EB 2QYZA 5CVIA 1Q86R 1ZUKA 2ZPGB 1ZSZA 2G6FX 4HKEA 5GAOq 3J81E 2O9VA 3SFMA 1ZBXA 2JS0A 1YITA 2HQXA 1SKUB 3VJPA 3VYGA 1KQSA 4ZGEB 1AWWA 2YUOA 4R56A 2EW3A 2KBTA 1YJ9A 2XKOC 2P84A 3CCLA 4OMLA 3CD6A 4DBFA 2ROLA 3GLXA 1VQNA 2LQ8A 2LC4A 4JRIA 1WLPB 4KH0B 5C0MA 1QCNA 5GANd 4BE1A 5HCKA 5IN1A 2QQ9A 1IO6A 4ZGJB 3CCSQ 2BZYA 1R77A 2K9GA 2DM1A 2KY9A 2MPXC 2ABLA 3CPFA 2A28A 1GFDA 3OSVA 1N5ZA 3L1AA 3SDZA 3OY9A 3HP9A 2NUPB 4X1VA 1PSFA 4C92C 2L0AA 1OV3A 2KMTA 4BACA 1WHHA 1BKBA 2RO0A 3C12A 2X3XD 3UATA 2CS7A 3LLRA 1VQOQ 5FU6B 1RAHB 1YP5A 1A0NB 4JJNK 1QWFA 4M78G 2FO0A 2L5QA 2MF2A 1LVKA 1C0MA 1ZHIA 3PFSA 4P5NA 3M0RA 5GAMd 3FEOA 2EWNA 1YJWQ 1OZ3A 1KG1A 2X35A 2VWFA 2X51A 1FMVA 1RLQC 3RMQA 1VQ9Q 2HMAA 1QQJA 1UEBA 4C8QC 2E4HA 4FYWB 2QTVA 2RM4A 3PTAA 1OOTA 5I21A 2GCXA 2A36A 3L2RA 3RERA 2CP6A 3VV0A 3QYGB 4EDUA 1NPRA 2K6DA 2W10A 1RL2A 4PLLA 1UGRB 3GPLA 5I22A 2FVUA 3RESA 1W2BS 3QHSA 4C0FA 2DTIA 3M59A 1K73U 4X9DA 1QP2A 5A2QE 3PVLA 4J6XA 2HSPA 4XTXA 3CMAQ 4M7AC 4M75E 2NUTA 2P4TA 2DXBA 2JMCA 4C0ZA 4J9IA 2YRCA 3EG3A 2ZPBB 1JEGA 4IIMA 2EBPA 2HL3A 2LJ0A 2E6NA 4IUVA 2A0FB 1M1KC 4PJJA 3A98A 1QVFS 4AFUC 3CMAT 2RQWA 3M0SA 1Y96B 1BI0A 2DXCA 3JCMh 3NFCA 2NUZA 4Y92A 2LTOA 2QASA 2ZPIB 3LX7A 4FSSA 2QA4T 3EGDA 1M2OA 1YITT 2DEQA 4Q5WA 2VKNA 2CZ7B 3OYMA 4JS4A 1EFNA 2FHDA 3M54A 1K9AA 1RAIB 4JS5A 2RA2A 3I56Q 4XU1A 2FYKA 2CSIA 3TCJA 2KT8A 3MP1A 4XU2A 4M7AE 1W2BP 1PKTA 4OMNA 2IVWA 4EMKC 3OW2P 1G2BA 1W6XA 1UECA 3I5SA 1WZOA 4C8QD 2PUOB 4XTUA 5LJ3j 2MK5A 1K0XA 3GF5A 4M7AD 2FPDA 1TUDA 2DBMA 1Y71A 3JCMW 1N27A 2EJ9A 4A63B 1K8AU 3ZFJA 5HKCA 2LNVA 1VQMA 2DK3A 5CKHA 1R8OB 3A1PA 2JOYA 4C92B 2NUPA 1MNDA 2JTFA 4LDWA 2F2WA 3OB9A 4JRKA 5GAN6 3CC7Q 2DD4A 1YIJA 2YSQA 1JXMA 1ACMB 2DXUA 4YTLA 2QQBA 2AT1B 4XTVA 1UB4A 3H41A 2M02A 3TSWA 3CC2Q 1BI2A 4XU3A 3OYDA 4LDVA 3CCEA 3CCRT 2CP5A 4BY6B 4N0AC 1YCSB 3VUZA 2ENMA 2CP7A 2FZKB 5GMKh 4PJOA 4C92E 1D1BA 2EYZA 2CGHA 1GBQA 1MV0B 2SEMA 1WGSA 3DLLA 3EH2A 2QEXT 3ULRB 1M3AA 3CBOA 1VQKA 1VQ8A 1SHGA 2QA4Q 5IXBA 5LJ5g 2QAZA 2PU9B 4D8DA 2R58A 3VS0A 1K73R 3TQ7P 3OYCA 3JCMg 4KRTA 4F7UF 1I8FA 3A8OB 2M0YA 4FW1A 3NMZC 2NYSA 3HHTB 1CKAA 1WHMA 4KT0E 3HTRA 1OPKA 3LGLA 3DKMA 4M77D 2Y4YA 3I5RA 5J3BA 2LVMA 1B34A 2LCLA 1I1JA 1IRXA 2HQHA 2YUPA 1VQ5T 3VU3C 3KFVA 5LJ3d 1TS9A 2LDMA 1WIEA 4DBQA 2V26A 1F1BB 3PIPA 4M75G 1PRMC 1V1CA 1JBMA 2KRNA 2LZ6B 4M75A 1WHKA 1QVGA 2OTLQ 1K76A 4A54A 4PJNA 1JQQA 3O8VA 3CMET 3CCMT 5FU7B 4CI0C 2QK0A 8AT1B 1VQPT 4B6MA 1OULA 3JCMQ 3G71Q 4M75C 2YXYA 2D0NA 2E64A 5CCAA 1ZA2B 2XU8A 1K9MU 1MNEA 4EMKB 1XTDA 4E47A 1AWOA 2ZPFB 2VGMA 1I5OB 1JJ2P 3CC2T 2YRDA 4BUGA 3JB9D 4XQ3A 4HA8A 1S72Q 1ABQA 1M3CA 1SSFA 2FZCB 2F2VA 1K9MC 1K8AR 3QIIA 4IUUA 2AKLA 1N6AA 2CSQA 2I2LA 4J9HA 1U1SA 1SRLA 3JCMe 5L23A 5L8RE 4ANJA 1VQLQ 4OF1A 4K11A 2F2XA 2XICA 3RKWA 3EGXA 3GOXA 1KIKA 3JSCA 4AG1C 1KC8C 2YLCA 3CPWS 1NE8A 1G5VA 1OU9A 3EGUA 3OYLA 1IHWA 1K0SA 3EG9B 2D9TA 2ESWA 1Q7YC 2R5MA 4FYYB 4F7UE 1AEYA 2J06A 3OBYA 2LRQA 4LDYA 3MJXA 1TUGB 2FL7A 1WX6A 4M77E 2AZVA 4OP0A 3OMGA 1RAFB 1KC8U 3JCMV 2EYQA 3FJPA 2RJCA 2CYZB 3NTKA 4A4HA 3TVTA 1WFWA 2J05A 1Y0MA 3G4SQ 2GQVA 3LWHA 3M5AA 1ZSZB 1WQWA 3HSBA 3I56A 2COYA 4M78F 4LN2A 2PVGB 2MMPA 2VASA 2LQWA 5LJ5e 1U3OA 4JRPA 3EGDB 3UF4A 4DA4A 1PWTA 1TOVA 2OAWA 3AHUA 1U5SA 4NS5A 2DX1A 2KYMA 2HAXA 2X4YA 4J9GA 5C6SA 3JAME 4PJOC 1M9SA 1TWBA 1M5Q1 2JXBA 4AG2C 2HL5C 2RB6A 2DL4A 4OMPA 5KYNA 3PT9A 2CUBA 2O88A 1VIEA 1QVFP 2RJDA 2PQWA 2JW4A 1X6OA 5D6XA 2MOXA 2X3WD 2FPEA 2QXFA 3RDVA 1GXIE 4ELZC 1M2VA 4F7UB 2BZXA 3J7AF 4C0DB 3VS6A 4AMCA 2OI3A 2O01E 4EMGA 3FB9A 3HKSA 1M8VA 1FXXA 4GLMA 1QVFA 5GMKe 2QG9B 2LNHB 5IT9E 2EYYA 2P4RA 3CMEQ 1VYVA 3M0QA 4QKUA 5EC7A 4QQDA 1T0JA 2HDAA 2VYTA 1VYUA 3FJ5A 2OTLT 2XG8D 1OZ2A 2CDTA 1NBEB 3D7SB 2CZ1B 1YI2T 5KYYB 2E65A 1U06A 2K3BA 4CC3A 2DIQA 1YHQT 4KGVB 2AKKA 3MP8A 2A7YA 2EAYA 3TU4K 4M7DG 3JB9I 2HZYA 4FT2A 4BD3A 3X24B 2CKKA 2EQMA 4BI3A 3CCVT 3REBB 3CCRA 5LJ5f 3MEVA 1ZUYA 4DEYA 3CCSA 3OQ5A 1Y7XA 4LDUA 4OB2B 1NG2A 4OMMA 2PUKB 1UUEA 3CMEA 1ZSGA 1VQMQ 1WDXA 2KAFA 1D3BB 1QVPA 2JT4A 4C92D 1QMCA 2YRVA 1XQHA 1PSEA 2BIVA 4ESRA 4KUDK 3V8KA 5IHNA 1LCKA 1S1NA 3SEMA 1VQ7Q 2YLBA 2K2VA 4N0AA 2V1RA 4E7SA 1WPYA 4Z8AA 4EPCA 3I9QA 1LPLA 2QTXA 3REAB 4QVDA 4LXCA 4QT7A 4RG2A 5CKEA 5GANe 1VQ6T 4V2SA 3E9GA 1JU5C 2AIRB 3UT1A 3S3MA 2KEAA 2LJ1A 4AFSC 3CQTA 1GCQC 4C5GA 1NEGA 3QYHB 3EFRA 3G4SA 3GNFB 1VQ5A 3I35A 2DIGA 1QLYA 1FMKA 2ECZA 4M7DC 5I2MA 5FROA 1Q82U 2E5QA 1D0XA 3OBWA 1FWZA 4GY5A 2KVQG 1KQSS 4RTTA 5FW9A 3PGGA 2KRMA 4FT4A 4M7DE 2M0OA 4FL6A 4JPBW 2DKGA 1N8RR 2DAQA 1ZUUA 1MV3A 1MMNA 1IHVA 2HSEB 2QQRA 4UC4A 4NL3A 3MHXA 2XDBA 1Q86U 1YIJT 5LJ3h 2COWA 3FIFA 1PG5B 1VUBA 4F16A 5AT1B 5KYXA 3E1SA 1NZ9A 3CCUA 3VRZA 1G8XA 3FDRA 3VS2A 1RABB 3OYIA 1N9SA 3HRUA 4QQ6A 3S6WA 4XTWA 5CQYA 2EJFA 1BI1A 2LQNA 3JB9J 3QDRB 2M9UA 2A3LA 4D6WA 4IKFA 3CCEQ 1D0YA 2CUDA 1QP3A 2KXDA 1PD1A 4FU6A 2RQTA 1YIJQ 1M90U 1JRIA 3LH5A 3R6NA 5GANg 2M16A 1YJWA 1YWPA 2LT4A 1HXDA 1CSKA 1NPPA 1K73C 4JJDA 3CCQA 1VOMA 2XDPA 5LJ5j 5KYUB 3A8GB 3QPHA 3G6EQ 2DRMA 1RUWA 3UPUA 4M77B 1G3TA 3JV3A 1HYOA 2OTJA 1QKXA 4RKUE 1X6GA 2K5FA 2VB6A 2A08A 1OX9A 4PK4A 5CK9A 2K57A 3NTIA 2BZ8A 3OYEA 3KUFA 1TSFA 2YUQA 1WJSA 2HKQB 2DE0X 1YN8A 1KFZA 4DEXA 2NWMA 4ZTJA 1AZEA 4RCCA 7AT1B 1SG5A 2FZGB 2RH2A 3E9FA 1VIFA 4OGCA 1O75A 3RKYA 5IXFA 2RPNA 3FRNA 3BFMA 3X28B 5CKBA 3TREA 2JS2A 1ARKA 3H0IA 4L6V5 1FX7A 4HXJA 1M1KR 4M75F 3ZL7C 5GAMe 3OA6A 1B07A 2E12A 1VQ7T 9ATCB 1VQ4A 5LJ5h 1QCFA 5J39A 3GP8A 1IGQA 3RIRA 4MMKA 5HK0A 2KROA 4OB0B 1AZGB 1BIAA 2C0TA 4PFZA 2VV5A
chains in the Genus database with same CATH topology
3I55A 4LDXA 5GANf 3CBPA 2OAUA 1W4SA 2VUBA 2XIDA 3O8VA 3QJYA 3CMET 2RHZA 5FU7B 4CI0C 3CCMT 2E10A 1N9RA 2E41A 2L8DA 3KBGA 3PIOA 4IURA 4ME7A 1VQPT 3JCMQ 2L89A 4A53A 4ZN3A 4M75C 3OYFA 4X9CA 5GAN4 3PMTA 2E64A 2LT1A 5GAMj 4OB3B 5CCAA 1Q81U 4BDYA 2XU8A 1K9MU 2WACA 3LH0A 3H6ZA 3SWNB 3OYJA 4EMKB 3C94A 4FM4B 2EJGA 4RMOA 1XTDA 4QQGA 1YHQA 4E47A 2MAMA 4JLGA 3VYHB 2ZPFB 2VGMA 3BW1A 4IUPA 2XDDA 1YJNT 2VXFA 3OS1A 4J5YA 3HFNA 2RJFA 2F69A 2V8JA 3HL8A 3CC2T 1H641 2DZ9A 5KE2A 5KE3A 4BUGA 3JB9D 4XQ3A 4HA8A 5GANh 3ASKA 5KCHA 2RHYA 3P8BB 3M53A 4FIBA 2R57A 1SSFA 3OYAA 1K9MC 4C5EA 4XK8E 2DTOA 3QIIA 5LJ5d 4IUUA 5GMKm 2K3YA 4PLIA 1N6AA 4PJOF 3OYYA 5GAOl 5FLXE 2X4WA 1VQOT 3V7RA 5A0DA 4M77A 3L2QA 2XI9A 1VQ6A 2I2LA 4J7FA 4BI8B 4M77G 4J8OA 1U1SA 3JCMe 2WSFE 4C5HA 1VQLT 5L8RE 2MWPA 3A8MB 3BDLA 3QJ6A 1JJ2A 1WQ7A 2GF7A 4MDXA 2QI2A 4OF1A 2XICA 4MZPA 1I5LA 2YHTA 2RI5A 3RKWA 3GOXA 3LYIA 1U8RA 4HT8A 1VQ8T 3JB9H 3JSCA 3OYBA 1KC8C 2ZGWA 2YLCA 3CPWS 2KK4A 1NE8A 4JUVA 1UGPB 2ZZDA 4QVCA 3G4ST 4BE0A 3OYLA 1G5VA 1OI1A 2WSCE 1W2BA 2P0PA 2DVEA 2D9TA 1S72A 3GIBA 1NJIC 1Q7YC 2R5MA 2K3XA 4M75D 3L2WA 3CXCA 2Y4XA 4QW2A 3OS0A 3L2UA 1Y07A 4F7UE 3NTHA 3OBYA 1G3SA 2LRQA 3P8HA 2JUFA 4LDYA 4Y91A 3S3OA 4M77E 2FL7A 4OP0A 3OMGA 4KBMB 1KC8U 3JCMV 2EYQA 2PVDB 4E7HA 3ME9A 3FJPA 1KHCA 4PKCC 2LCCA 2RJCA 2CYZB 3X20B 1VQ9T 3NTKA 5CKFA 3JCMb 4M78A 4A4HA 4LD9K 4QVZA 4E7IA 5GAN8 4ZGDB 3MEWA 3V7CA 4WF2A 4KULA 1M1GA 2E1HA 2WSEE 2HBPA 4JLIA 2DPPB 3OYKA 2GQVA 4B9WA 3LWHA 4O6JA 3M5AA 1WQWA 1TH7A 3HSBA 3I56A 5AYFA 5CAIA 4C0GA 3JB9G 4M78F 4N4IA 2V8KA 1VQKT 3X25B 4HCZA 2PVGB 2MMPA 1MGQA 2GFUA 4IUTA 3URGA 3OS5A 4M7DB 3EAEA 4F7UA 5HK3A 2GFAA 3CEYA 3CCJT 5LJ5e 2RJEA 4JRPA 1OYXA 5CVIA 3QZ5B 5GAOn 3J80E 2XHCA 3BY7A 4DA4A 3AHUA 4NS5A 5CR2A 4M75B 2IG0A 3C4SA 3H8ZA 5D6YA 2ZPGB 2HAXA 2DJZA 2X4YA 5C6SA 3JAME 3CCQT 4HKEA 3OW2A 4PJOC 1M9SA 2EQKA 4NL2A 5GAOq 3J81E 2L3RA 3SFMA 3CCMA 1RI0A 1M5Q1 1ZBXA 3G7ZA 1YITA 2RB6A 3N5BB 3PT9A 2HQXA 3VJPA 3VYGA 3DB4A 5D6WA 1KQSA 4ZGEB 4X34A 1KQ2A 2ZPHB 4R56A 1VIEA 3CCJA 5M9OA 1YJ9A 2XKOC 2RJDA 1AHJB 2PQWA 1X6OA 3CCLA 5D6XA 4J7IA 2EQJA 3CD6A 3GLXA 3CXCS 2QXFA 1JJ2S 1VQNA 1D3BA 2LQ8A 2LC4A 4JRIA 4GLKA 1GXIE 4ELZC 4F7UB 5C0MA 5DY9A 2DTHA 2RI3A 3RMSA 4HT9A 3J7AF 5GANd 4BE1A 2C06A 4C0DB 3OS2A 3WVDB 5IN1A 2JZ2A 2QQ9A 4O5VA 1MHNA 4MZTA 4ZGJB 2O01E 4Y28E 3FB9A 3HKSA 4EMGA 3T9NA 1FXXA 1M8VA 1QVFA 2KY9A 2D0QB 3CPFA 5GMKe 3OSSC 3I55T 5LL6S 1H3ZA 3P8DA 3OSVA 5IT9E 5A0LA 4F7UG 3L1AA 3OY9A 3SDZA 1Y96A 3UWNA 3JCMd 3HP9A 4A4GA 2F5TX 4C5IA 1PSFA 4QQDA 1N8RU 4M78B 3M58A 4OVAA 4C92C 2F5KA 4C8QE 3C95A 2KMTA 4M78D 4BACA 3CC7T 4BE2A 3MO8A 1BKBA 2VYTA 1EIFA 2RO0A 1U1TA 4CRIA 2OTLT 2XG8D 1OZ2A 3C12A 4RCBA 2CS7A 3LLRA 1O9SA 2RHXA 5FU6B 3OW2S 4JJNK 2CZ1B 4M78G 1YI2T 1VQMT 2L5QA 2EIFA 2MF2A 5DLQE 2E65A 4PJOG 1ZHIA 2R5AA 1WJRA 3PFSA 4P5NA 5GAMd 3FEOA 4XU0A 2EWNA 2RK2A 4A4EA 3CC4T 3CCST 1OZ3A 2DIQA 1YHQT 4M7AG 5GAN5 1KG1A 2X35A 3MP8A 2QEXA 2A7YA 1S72T 2EAYA 3TU4K 3RMQA 4M7DG 4ZTFA 3JB9I 1I81A 4FT2A 3CMAA 3PMIA 4RG8A 3A8HB 1UEBA 4A4KA 4BD3A 4C8QC 3ER0A 3HRSA 3X24B 2CKKA 2EQMA 2RM4A 3PTAA 4XAXB 5LJ3e 5I21A 1BI3A 2QQSA 2K5IA 4BI3A 1QVGS 3CCVT 4JDSA 1BYMA 2GCXA 2HNIA 2O4XB 2QA4A 4Z02A 5A0GA 3CCRA 3L2RA 5LJ5f 3MEVA 4OB1B 3CC4A 3RERA 3CCSA 4M7AF 3OQ5A 4PJOB 1Y7XA 1Q7YU 4LDUA 4OB2B 1YJWT 4C92G 2PUKB 3CMEA 3CCET 3CCUT 3VV0A 2LX9A 3MCAB 3QYGB 4EDUA 5CIUA 1VQPA 2M1HA 4II1A 1YBYA 2K5LA 1NPRA 2E70A 3M57A 1RL2A 2EFIA 1UGRB 1D3BB 2KAFA 4PLLA 1QVPA 3GPLA 4C92D 3SWNC 1X01A 2YRVA 1XQHA 1PSEA 2BIVA 2FVUA 3RESA 4KUDK 3INZA 3V8KA 1M4ZA 3QHSA 2X4XA 4OMFB 4C0FA 1W2BS 2DTIA 3M59A 5EG2A 4C92A 3QSUA 1KQ1A 2KQWA 3QUIA 1K73U 3M55A 3QBYA 1YCYA 4X9DA 2YLBA 2K2VA 5GAOp 1QP2A 4N0AA 3MEAA 5A2QE 3MP6A 4C8QA 4J6XA 4XTXA 1WPYA 1VQ9A 4M7DF 4M7AC 4MMLA 5GAMh 4R55A 2E6ZA 4M75E 4EPCA 2QTXA 4QVDA 1QW1A 2P4TA 2DXBA 2RD1A 4IUQA 4N4GA 5KCOA 4RG2A 3L2ZA 5CKEA 3RUXA 4J6YA 5GANe 3OYHA 4C0ZA 4C8QF 1VQ6T 4V2SA 3E9GA 2ZPBB 5FRMA 2MWOA 1VQNT 4VUBA 3M4YA 3JB9F 3LGFA 3ZEHA 3QG1A 3UT1A 2E6NA 4IUVA 4NOYA 5GMKj 3JCMX 4C8QB 1M1KC 5GAOm 2Y90A 2HD0A 4BY6C 3S3MA 3M9QA 5GMKl 3QKJA 3QO3A 3CMAT 1QVFS 2EQUA 1M1FA 4A54A 1UGSB 1Y96B 4C5GA 3HPWA 1BI0A 3QYHB 3EFRA 2DXCA 1N8RC 3G4SA 3GNFB 3JCMh 3NFCA 2MI6A 1VQ5A 3LW5E 3CCVA 2DIGA 2LTOA 2ZPIB 2OTJT 5CQXA 3Q1JA 3LX7A 5I2MA 2QA4T 1YJNA 4M77C 4M7DC 2AHJB 3FLGA 3EFSA 5FROA 2KSSA 3OYNA 2DEQA 1YITT 4Q5WA 3VUBA 1HK9A 1Q82U 2E5QA 5LJ3f 3OBWA 1FWZA 2CZ7B 3OYMA 2EKOA 4JS4A 3JRZA 4GY5A 1P92A 3V8JA 3WVEB 2KVQG 2FHDA 4MZMA 3M54A 4BI4A 5GANj 1KQSS 3PGGA 5FU7C 4JS5A 2RA2A 1ZQ1A 4A4FA 2BKDN 3UDCA 4FT4A 4XU1A 4M7DE 2FYKA 1M1KU 3TCJA 2KDSA 1YI2A 4DOVA 2M0OA 4FL6A 2QQAA 2O4XA 3MP1A 4XU2A 3G6ET 4ATOA 3L2VA 1WNLA 2DKGA 2H3JA 3E19A 3META 3LWIA 4M7AE 4E7JA 3X26B 3JCMf 2IVWA 4EMKC 4E7LA 3M4GA 1VQLA 2K4YA 4XTZA 2RK1A 4M7AB 4FSXA 3ZBDA 4J6WA 3SD4A 2CZ6B 2DAQA 3V8LA 2QQRA 2DO3A 2B8AA 4UC4A 5I2SA 4C8QD 3MHXA 3VKIA 4NL3A 2XDBA 4C8QG 2PUOB 2DZCA 1Q86U 1YIJT 4XTUA 5LJ3j 2CZ0B 5LJ3h 3FIFA 3GF5A 2BUDA 4M7AD 1UGQB 3CBMA 1VUBA 1VQ7A 1Y71A 5GAMf 3JCMW 3CC2A 2FB7A 1N27A 1WJQA 2EJ9A 3CC7A 1K8AU 3E1SA 3ZFJA 3KXTA 1NZ9A 5HKCA 3DLMA 3SB2A 3CCUA 2LNVA 2D6FA 4M7AA 2OTLA 1VQMA 2DK3A 5CKHA 2ZPEB 1I4K1 3FDRA 3MEUA 2VC8A 1R8OB 4DQ2A 2JOYA 4C92B 3OYIA 1N9SA 3HRUA 4LDWA 2JTFA 4QQ6A 3S6WA 3OB9A 4JRKA 5GAN6 4XTWA 1LNXA 5GAOr 2DD4A 4M77F 3SWNA 1YIJA 5CQYA 2EJFA 2G3RA 1BI1A 5GAN2 3JB9J 4N4HA 3QDRB 4J83A 2M9UA 2VGNA 2A3LA 5FU6C 4D6WA 1LOJA 2P0KA 2DXUA 4YTLA 3TEEA 4BB7A 1VQOA 4IKFA 2QQBA 4PNOA 2XD0A 4XTVA 1UB4A 3HRTA 3RKXA 1QP3A 3CPWA 1Q81C 5CO7A 2X4JA 3A5ZB 3GNGA 4FU6A 2PVOB 3QXEB 1M90U 4HCCA 1JRIA 5GANg 2JTMA 5HY6A 1KD1U 2NLUA 1M90C 1BI2A 2M16A 2JN0A 4XU3A 1YJWA 3OYDA 3G6EA 5IAYA 4LDVA 2RHUA 5LJ3g 3CCEA 2LT4A 3M56A 3JCMP 3CCRT 1HXDA 4BY6B 4N0AC 4KUIA 1NPPA 1K73C 1JB0E 4EMKA 3CCQA 2RI2A 2XDPA 3VUZA 5LJ5j 5GMKh 1G3WA 4PJOA 5GAN3 4C92E 1XNIA 1X75C 3A8GB 3QPHA 4PL6A 5GMKi 3UPUA 4M77B 1G3TA 3R6OA 4OGEA 2ZCFB 1KD1C 3HFOA 4PJOD 2RHIA 3PNWC 2CGHA 4EMHA 3JCMJ 2JVVA 3JCMc 4C92F 2OTJA 3CD6T 4MDWA 4RKUE 1B34B 1WGSA 2K5FA 3A8LB 3L42A 3DLLA 2QEXT 3BDUA 4L59A 4HCBA 4TVRA 5CK9A 4M7DA 2K57A 3CBOA 3NTIA 2V8IA 3OYEA 1VQKA 3OYGA 3KUFA 4ZN1A 1VQ8A 5LJ5g 2PU9B 2R58A 1Q86C 1K8AC 2XK0A 3S3NA 4M7DD 4BDZA 3OYCA 3JCMg 4L5GA 1V29B 1WJSA 4PJOE 1LJOA 1KHIA 3F70A 1I8FA 4F7UF 4M78E 4ZTJA 4RCCA 3A8OB 2RH2A 1IREB 3E9FA 3G71A 1VIFA 4OGCA 1O75A 2LQKA 1Q82C 2DXTA 3RKYA 2DD5A 3HHTB 1VQ4T 1NJIU 5FRNA 3FRNA 5J26A 4B9XA 3BFMA 3V7SA 3X28B 4KT0E 5CKBA 4C0DC 3TREA 1DJ7B 5GAN7 3LGLA 3DKMA 4M77D 5GAMg 2Y4YA 5J3BA 2LVMA 5DLOA 4E7KA 1B34A 1YJ9T 2LCLA 4L6V5 1FX7A 5DM7R 1BIBA 1IZ6A 1G3YA 4M75F 3VU3C 5GAMe 1VQ5T 2HQEA 5CKDA 3G71T 5LJ3d 3OA6A 4JRQA 2E12A 2LDMA 3CCLT 3I56T 1VQ7T 4XTYA 1VQ4A 4LD6A 5LJ5h 3OMCA 3GP8A 5KH6A 5J39A 2JNGA 3PIPA 2QDYB 3FC3A 4M75G 4MMKA 3RIRA 1JBMA 4M78C 5HK0A 3DB3A 4DOWA 4M75A 4OB0B 2P0QA 1QVGA 2VXEA 3QZ9B 1BIAA 4ELYC 1XOVA 2VV5A 3WXMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QHS A;  2EJF A;  2DTI A;  3AHU A;  5GAO r;  5GAN 2;  4M75 B;  5GAN f;  3JB9 J;  4C92 A;  3QSU A;  1KQ1 A;  3QUI A;  2DJZ A;  1LOJ A;  2DXU A;  1YCY A;  2E10 A;  1N9R A;  2E41 A;  2YLB A;  4NL2 A;  4N0A A;  4PNO A;  4X9D A;  5GAO p;  5GAO q;  4PJO C;  4XTV A;  1M5Q 1;  3JCM Q;  3RKX A;  4A53 A;  4C8Q A;  4J6X A;  4XTX A;  1WPY A;  4M7D F;  2RB6 A;  4M75 C;  4M7A C;  4MML A;  5GAM h;  4X9C A;  4M75 E;  5GAN 4;  2E64 A;  2QTX A;  5GAM j;  1JRI A;  5GAN g;  1KQ2 A;  4QVD A;  3SWN B;  2RD1 A;  4EMK B;  2JN0 A;  4XU3 A;  2EJG A;  3L2Z A;  5LJ3 g;  3RUX A;  3JCM P;  4J6Y A;  1HXD A;  3BW1 A;  5GAN e;  4N0A C;  1D3B A;  4C8Q F;  2VXF A;  4V2S A;  4J5Y A;  4JRI A;  3HFN A;  3JB9 F;  4EMK A;  4F7U B;  4PJO A;  5DY9 A;  2DTH A;  4HT9 A;  1H64 1;  5LJ5 j;  5GAN d;  2DZ9 A;  5GMK h;  5GMK j;  4NOY A;  3JCM X;  5GAN 3;  4C8Q B;  4XQ3 A;  4HA8 A;  2Y90 A;  4C92 E;  5GAN h;  5GAO m;  3JB9 D;  5GMK l;  5GMK i;  3QO3 A;  3FB9 A;  4EMG A;  1M8V A;  4M77 B;  4A54 A;  3HFO A;  1Y96 B;  2DTO A;  5GMK e;  2CGH A;  5LJ5 d;  5GMK m;  4PJO D;  4EMH A;  3EFR A;  3JCM J;  4PJO F;  3JCM h;  3JCM c;  4F7U G;  3L1A A;  5GAO l;  4C92 F;  1Y96 A;  3V7R A;  3V8K A;  3JCM d;  4M77 A;  1B34 B;  2I2L A;  3BDU A;  4M78 B;  4C92 C;  4M77 C;  4C8Q E;  4M77 G;  4M7D C;  4M78 D;  3EFS A;  1U1S A;  3JCM e;  2DEQ A;  4PJO B;  4M7D A;  1HK9 A;  2K57 A;  5LJ3 f;  1WQ7 A;  1U1T A;  4RCB A;  5LJ5 g;  1I5L A;  2YHT A;  3RKW A;  4HT8 A;  3JB9 H;  3V8J A;  4M7D D;  2ZGW A;  3JCM g;  5GAN j;  3PGG A;  4M78 G;  2RA2 A;  2YLC A;  4PJO E;  1LJO A;  4XU1 A;  4PJO G;  2E65 A;  4JUV A;  1I8F A;  2FYK A;  4M78 E;  4F7U F;  4QVC A;  4RCC A;  4M7D E;  5GAM d;  4XU0 A;  2EWN A;  2DVE A;  4XU2 A;  3GIB A;  4M7A G;  4M7A E;  1WNL A;  2DKG A;  5GAN 5;  4M75 D;  2EAY A;  3INZ A;  2DXT A;  3JCM f;  4F7U E;  4EMK C;  4M7D G;  3M4G A;  1I81 A;  3RKY A;  3JB9 I;  4Y91 A;  4M77 E;  3BFM A;  3V7S A;  4C8Q C;  4XTZ A;  4OP0 A;  5GAN 7;  2RM4 A;  4M7A B;  3JCM V;  4J6W A;  4M77 D;  5GAM g;  3FJP A;  5LJ3 e;  5I21 A;  3V8L A;  1B34 A;  3JCM b;  4M78 A;  2HNI A;  4C8Q D;  4NL3 A;  1BIB A;  4C8Q G;  5GAN 8;  2DZC A;  5LJ5 f;  3RER A;  3V7C A;  4XTU A;  4WF2 A;  5LJ3 j;  4M7A F;  5LJ3 h;  4M75 F;  3VU3 C;  3FIF A;  5GAM e;  4M7A D;  5LJ3 d;  4C92 G;  2E1H A;  5GAM f;  3JCM W;  4JLI A;  2FB7 A;  2EJ9 A;  4XTY A;  1WQW A;  5LJ5 h;  1TH7 A;  3HSB A;  3SB2 A;  5CAI A;  3JB9 G;  4M7A A;  4M78 F;  4M75 G;  4MMK A;  1MGQ A;  1JBM A;  1I4K 1;  4M78 C;  3RIR A;  1D3B B;  2VC8 A;  4M7D B;  4DQ2 A;  4F7U A;  4C92 B;  1N9S A;  4M75 A;  5LJ5 e;  4C92 D;  3SWN C;  1X01 A;  2VXE A;  5GAO n;  1BIA A;  3RES A;  4JRK A;  5GAN 6;  4XTW A;  1LNX A;  3BY7 A;  3SWN A;  4M77 F; 
#chains in the Genus database with same CATH topology
 2D1X A;  4LDX A;  2OTJ Q;  1WXT A;  2XID A;  1UDL A;  1MMD A;  4IUR A;  4FW2 A;  4A53 A;  2J7I A;  1EZZ B;  3BE3 A;  1Q81 U;  3EFO A;  1B3Q A;  2FPF A;  2EYW A;  1YHQ A;  1R0C B;  4OMQ A;  1X6B A;  1SRM A;  3QWX X;  2RF0 A;  4IUP A;  3BW1 A;  2XDD A;  4J5Y A;  1PC0 A;  2F69 A;  3HL8 A;  1H64 1;  2DZ9 A;  5KE2 A;  5KE3 A;  5GAN h;  5KCH A;  2R57 A;  1Q7Y R;  2PTK A;  3OYA A;  3O5Z A;  4C5E A;  4XK8 E;  1ZBJ A;  1E7O A;  2KT1 A;  5FLX E;  2GQI A;  4Z88 A;  2GBQ A;  1TTH B;  4C5H A;  4PJO B;  1M27 C;  2MWP A;  4MDX A;  1YIT Q;  1M3B A;  1I5L A;  2YHT A;  3LYI A;  4HT8 A;  1VQ8 T;  3OYB A;  2JM9 A;  4CC2 A;  4JUV A;  2ZZD A;  3U23 A;  4BE0 A;  1OI1 A;  1MMA A;  3M0U A;  3CXC A;  4M75 D;  2DJQ A;  3OS0 A;  3L2U A;  1G3S A;  2J6F A;  2JUF A;  3S3O A;  2LCC A;  5CKF A;  4M78 A;  6AT1 B;  2RQU A;  4E7I A;  3V7C A;  1ZA1 B;  4WF2 A;  3NPF A;  3NHN A;  4KUL A;  1M1G A;  1QWE A;  2EPD A;  4N4I A;  2V8K A;  4HCZ A;  1NJI R;  1MGQ A;  3OS5 A;  1M2V B;  4F7U A;  2RJE A;  1OYX A;  2F1L A;  3J80 E;  3BY7 A;  5IHK A;  5CR2 A;  4M75 B;  3GBQ A;  3C4S A;  5D6Y A;  3CCQ T;  4JJB A;  3OW2 A;  4NL2 A;  2L3R A;  1FYN A;  3CCM A;  3N5B B;  1KQ2 A;  2ZPH B;  1ZX6 A;  3CCJ A;  5M9O A;  1AHJ B;  2QGG A;  2RN8 A;  1VQ6 Q;  4J7I A;  2EQJ A;  1OPL A;  2RQV A;  5DY9 A;  2DTH A;  2RI3 A;  3RMS A;  2C06 A;  3OS2 A;  3WVD B;  1MHN A;  2CP2 A;  1BCM A;  3I55 T;  1H3Z A;  5A0L A;  4F7U G;  1IB8 A;  1JXO A;  3UWN A;  3JCM d;  4A4G A;  4C5I A;  1IGU A;  1RLP C;  1N8R U;  1VQL A;  3M58 A;  3CC7 T;  2DL3 A;  2F5K A;  3C95 A;  4BE2 A;  4RTV A;  2K2M A;  4J9F A;  1M8M A;  1U1T A;  4RCB A;  3VS7 A;  1O9S A;  2RHX A;  2J6K A;  1BCO A;  1VQM T;  2R5A A;  3I55 Q;  1UG1 A;  4M4Z A;  3CC4 T;  3CCS T;  4M7A G;  5GAN 5;  2FRY A;  3VRY A;  2QEX A;  4J9C A;  3H9N A;  1S72 T;  3CMA A;  3PMI A;  4RG8 A;  3A8H B;  4A4K A;  3ER0 A;  4XAX B;  5LJ3 e;  2CH4 W;  4JDS A;  2DER A;  2DL8 A;  1BYM A;  2HNI A;  2O4X B;  2QA4 A;  4OB1 B;  1J3T A;  4HVW A;  2DVJ A;  1Q7Y U;  1KD1 R;  1QKW A;  3CCE T;  3CCU T;  5KYY A;  1UJY A;  3RR6 A;  4CC4 B;  4II1 A;  1W70 A;  1YFN A;  1T0H A;  2OJ2 A;  5D7U A;  3E2U A;  3EH1 A;  1M4Z A;  2X4X A;  1RAE B;  4C92 A;  3QSU A;  1KQ1 A;  3QUI A;  1KC8 R;  1T3S A;  1YCY A;  2CP0 A;  3MEA A;  3MP6 A;  2O31 A;  1VQ9 A;  4M7D F;  4MML A;  1PKS A;  5GAM h;  2E6Z A;  2PNI A;  2FG0 A;  1QW1 A;  2RD1 A;  4IUQ A;  4N4G A;  4J9B A;  3L2Z A;  1UJ0 A;  3RUX A;  4J6Y A;  1MMG A;  2RNA A;  2A37 A;  4C8Q F;  2IIM A;  3JB9 F;  4VUB A;  3M4Y A;  1WXB A;  1W1F A;  3LGF A;  3QG1 A;  5GMK j;  1HSQ A;  2KR3 A;  2DL7 A;  4E7Z A;  2Y90 A;  5GMK l;  3RBB B;  3QKJ A;  3QO3 A;  2EQU A;  1M1F A;  2IPO B;  1N8R C;  1Z9Z A;  2ROT A;  2OTJ T;  5CQX A;  1YJN A;  4M77 C;  2AHJ B;  3OYN A;  5LJ3 f;  1PCX A;  1TG0 A;  1ZLM A;  1JO8 A;  1H3H A;  1T3L A;  3G1J A;  2EKO A;  1P92 A;  4AFQ C;  3WVE B;  1TU0 B;  4BI4 A;  5FU7 C;  3QWY A;  2AZS A;  2BKD N;  1M1K U;  3CCL Q;  1YI2 A;  2KDS A;  4DOV A;  3VS4 A;  2O4X A;  4RTU A;  4ATO A;  3L2V A;  1NYG A;  1WNL A;  3LWI A;  1SEM A;  3JCM f;  4E7L A;  3M4G A;  4PFO A;  2RK1 A;  2EKH A;  3ZBD A;  4J6W A;  2CZ6 B;  5KYW A;  3V8L A;  1KJW A;  1V76 A;  5I2S A;  3VKI A;  2QGF B;  3EG9 A;  1X69 A;  2D8H A;  2BUD A;  3CC4 Q;  1VQ7 A;  2FB7 A;  2W0Z A;  1WJQ A;  2YUN A;  5GJW B;  3KXT A;  2DA9 A;  3SB2 A;  4M7A A;  2OTL A;  2HKN A;  3MEU A;  1I4K 1;  2VC8 A;  4DQ2 A;  2AK5 A;  3PE0 A;  3M0P A;  4KGX B;  3EHQ A;  2L3P A;  5GAO r;  4M77 F;  5GAN 2;  4RTZ A;  4J83 A;  2XMF A;  5FU6 C;  1VQO A;  2K7A A;  3TEE A;  2DLP A;  4PJL A;  4PNO A;  3HRT A;  3RKX A;  2X4J A;  2PVO B;  2E3H A;  3QXE B;  2JTM A;  4DBR A;  2NLU A;  1M90 C;  3CCV Q;  5IAY A;  5LJ3 g;  1YJN Q;  1PM3 A;  1AOJ A;  4JZ3 A;  1JB0 E;  2OX7 A;  4EMK A;  2RI2 A;  2CT4 A;  3VS5 A;  1WI7 A;  1XNI A;  1X75 C;  3R6O A;  4OGE A;  2JTE A;  2E5K A;  4PJO D;  2RHI A;  3PNW C;  4EMH A;  3JCM J;  3CCM Q;  5GJV B;  4FCY A;  4MDW A;  1B34 B;  3L42 A;  2KE9 A;  4L59 A;  4TVR A;  2NUT B;  2V8I A;  2KXC A;  3CXC P;  1Q86 C;  2V1Q A;  3CD6 Q;  3S3N A;  2EVR A;  1PNJ A;  4L5G A;  1V29 B;  1Z9Q A;  4PJO E;  1LJO A;  1BK2 A;  1KHI A;  2ATC B;  2QDL A;  3F70 A;  1GCP A;  1UHC A;  1VQ5 Q;  3G71 A;  1SPK A;  1X27 A;  1Q82 C;  2DXT A;  2KNB B;  2DD5 A;  1VQ4 T;  1NJI U;  5FRN A;  5J26 A;  3V7S A;  4C0D C;  5GAN 7;  2DBK A;  5GAM g;  4LUE A;  1YJ9 T;  4E7K A;  1I0C A;  5DM7 R;  2CRE A;  1IZ6 A;  1G3Y A;  4KGZ B;  2GTJ A;  5CKD A;  3VS1 A;  4XTY A;  3OMC A;  1ABO A;  2JNG A;  2L3S A;  1WHL A;  1VQ8 Q;  4M78 C;  3DB3 A;  4OMO A;  4FYV B;  2VXE A;  3QZ9 B;  1XOV A;  3CBP A;  2VUB A;  3QJY A;  2RHZ A;  2E41 A;  3KBG A;  1QCO A;  4ME7 A;  2L89 A;  5GAN 4;  1D0Z A;  3PMT A;  2GNC A;  2LT1 A;  1R0B G;  3UA6 A;  3LH0 A;  3H6Z A;  1OX8 A;  1D1A A;  3SWN B;  3OYJ A;  2LJ3 A;  1NLP C;  2EJG A;  2YWW A;  3CCR Q;  1YJN T;  2HBW A;  2VXF A;  4JZ4 A;  1NEB A;  2MCN A;  3IQL A;  2RHY A;  3P8B B;  3M53 A;  1HD3 A;  2DTO A;  5LJ5 d;  4J9D A;  5GMK m;  3C0C A;  2K3Y A;  2X4W A;  1VQO T;  3V7R A;  1PHT A;  4M77 A;  3L2Q A;  2DIL A;  1VQ6 A;  4J7F A;  4BI8 B;  4M77 G;  1VQL T;  5KYU A;  3A8M B;  3BDL A;  3EGX B;  2ZAE A;  2GF7 A;  2QI2 A;  4MZP A;  2RI5 A;  3JB9 H;  2DYB A;  2KK4 A;  1UGP B;  3G4S T;  4QVC A;  2WSC E;  2H8H A;  4Z89 A;  1H8K A;  2DVE A;  1W2B A;  1YWO A;  1X43 A;  4HCK A;  1S72 A;  3GIB A;  3SHW A;  1NJI C;  1Q81 R;  3L2W A;  2Y4X A;  1Y07 A;  4Y91 A;  4KBM B;  1FMW A;  2PVD B;  3ME9 A;  1KHC A;  3X20 B;  4LD9 K;  2COZ A;  5GAN 8;  3MEW A;  1BB9 A;  2E1H A;  2WSE E;  2HBP A;  2DPP B;  4LUD A;  4O6J A;  1YI2 Q;  1TH7 A;  2DRK A;  5AYF A;  2E3I A;  3URG A;  2GFU A;  2VVK A;  4IUT A;  4M7D B;  5HK3 A;  4RTY A;  2DF6 A;  2GFA A;  3CEY A;  3VS3 A;  3CCJ T;  1CKB A;  3QZ5 B;  5GAO n;  2XHC A;  1IXD A;  4WCI A;  2IG0 A;  3H8Z A;  2FEI A;  2DJZ A;  5IH2 A;  2EQK A;  1WHJ A;  1UTI A;  1RI0 A;  3G7Z A;  2LMJ A;  4HVV A;  3DB4 A;  5D6W A;  3MPU B;  2EGE A;  2L3Q A;  4X34 A;  2DYI A;  2C0O A;  4LNP A;  3QDF A;  4E2F B;  3CXC S;  1JJ2 S;  1D3B A;  4GLK A;  1X2K A;  4HT9 A;  2DNU A;  4F14 A;  1SF9 A;  2JZ2 A;  4O5V A;  4MZT A;  2ED1 A;  2YT6 A;  4Y28 E;  3T9N A;  1KQS P;  2D0Q B;  3OSS C;  2EYX A;  5LL6 S;  3P8D A;  1Y96 A;  1AVZ C;  2EQI A;  2F5T X;  4M78 B;  4OVA A;  4C8Q E;  4M78 D;  2CH4 A;  3MO8 A;  1EIF A;  3PVQ A;  1I07 A;  4CRI A;  8ATC B;  2QEX Q;  4EIK A;  1XJW B;  1WYX A;  5KYX B;  1RI9 A;  3OW2 S;  2D8J A;  1OEB A;  5DLQ E;  2EIF A;  4PJO G;  1WJR A;  4XU0 A;  4A4E A;  2RK2 A;  5FWB A;  3EG2 A;  4AFZ C;  3EG0 A;  1GRI A;  3NGP A;  4ZTF A;  1I81 A;  1PRL C;  3EG1 A;  1M30 A;  3HRS A;  1GFC A;  1OQK A;  3THK A;  1BI3 A;  2QQS A;  2K5I A;  1QVG S;  4Z02 A;  5A0G A;  3CC4 A;  2CT3 A;  4M7A F;  1Y57 A;  1YJW T;  4C92 G;  2BE7 D;  4CC7 A;  1RAD B;  2PZ1 A;  2LX9 A;  3MCA B;  5CIU A;  1VQP A;  2M1H A;  1YBY A;  2DL5 A;  2K5L A;  2O2O A;  2E70 A;  3M57 A;  2EFI A;  1SHF A;  3SWN C;  1X01 A;  2KRS A;  1AWJ A;  3INZ A;  4OMF B;  5EG2 A;  2KQW A;  5ECA A;  3M55 A;  3QBY A;  5GAO p;  2K79 A;  4C8Q A;  1HJD A;  2JMA A;  4R55 A;  2FRW A;  2X9H A;  1Q82 R;  4RUG A;  5KCO A;  1VQN Q;  1NLO C;  1KSW A;  3OYH A;  5FRM A;  1GBR A;  2MWO A;  1VQN T;  2CP3 A;  1G83 A;  3ZEH A;  4LE9 A;  4NOY A;  3JCM X;  4C8Q B;  5GAO m;  2HD0 A;  4BY6 C;  1UHF A;  3M9Q A;  1YHQ Q;  1UGS B;  1BU1 A;  2I0N A;  4F04 B;  3HPW A;  2HEQ A;  2MI6 A;  1Q95 G;  3LW5 E;  3CCV A;  3Q1J A;  3FLG A;  3EFS A;  2KSS A;  1EX4 A;  4IIO A;  3VUB A;  1HK9 A;  4KH1 B;  3JRZ A;  3V8J A;  1VQK Q;  4MZM A;  5GAN j;  1ZQ1 A;  4A4F A;  3UDC A;  1E6H A;  2QQA A;  3G6E T;  2Z0W A;  2H3J A;  3E19 A;  3MET A;  4E7J A;  1K1Z A;  3X26 B;  2K4Y A;  4XTZ A;  4M7A B;  4FSX A;  3SD4 A;  4PJM A;  2DO3 A;  2B8A A;  1UGV A;  4C8Q G;  2DZC A;  2JJ9 A;  2CZ0 B;  1K9M R;  1UGQ B;  3CBM A;  1AD5 A;  5GAM f;  3CC2 A;  1NM7 A;  1VQP Q;  3CC7 A;  1RAG B;  2JM8 A;  1QVG P;  3DLM A;  2D6F A;  2ZPE B;  2HCK A;  1VA7 A;  2EGC A;  1LNX A;  3SWN A;  2G3R A;  4N4H A;  2VGN A;  2RQR A;  1RAC B;  1LOJ A;  1X2Q A;  2P0K A;  4BB7 A;  4J9E A;  2XD0 A;  1BBZ A;  1D1C A;  3CPW A;  1Q81 C;  5CO7 A;  3GNG A;  3A5Z B;  2LP5 A;  4HCC A;  5HY6 A;  1KD1 U;  1OU8 A;  2JN0 A;  3G6E A;  4JJC A;  2RHU A;  3JCM P;  3M56 A;  2J6O A;  2KGT A;  4KUI A;  2KYB A;  1VQ4 Q;  3TSZ A;  5IHI A;  1G3W A;  5GAN 3;  2DFU A;  3M0T A;  4PL6 A;  5GMK i;  1KD1 C;  2ZCF B;  3HFO A;  3UA7 A;  2M51 A;  2JVV A;  3JCM c;  4C92 F;  2DET A;  3CD6 T;  1PD0 A;  4WTO B;  3A8L B;  3BDU A;  4HCB A;  1WA7 A;  1M90 R;  4M7D A;  3CCJ Q;  3OYG A;  1KK7 A;  4ZN1 A;  5FWC A;  2XK0 A;  4M7D D;  4BDZ A;  1GCQ A;  3EHR A;  3EFO B;  4M78 E;  4GBQ A;  1UFF A;  1NYF A;  1H92 A;  1IRE B;  2BTT A;  3H0F A;  2B86 A;  2LQK A;  1C6V X;  4F17 A;  2KI7 A;  4B9X A;  1DJ7 B;  2YDL A;  5DLO A;  4ORZ A;  1E6G A;  1RAA B;  1BIB A;  1TUC A;  2HQE A;  3G71 T;  4JRQ A;  3CCL T;  1UE9 A;  3I56 T;  3CCQ Q;  4LD6 A;  1D09 B;  2DEU A;  5KH6 A;  3FC3 A;  2QDY B;  4DOW A;  2P0Q A;  2SRC A;  4ELY C;  3WXM B;  3I55 A;  4RTW A;  5GAN f;  2OAU A;  1W4S A;  1K8A C;  1YNZ A;  2E10 A;  1N9R A;  2L8D A;  3PIO A;  2C0I A;  4ZN3 A;  3OYF A;  2GGR A;  4X9C A;  5GAM j;  4OB3 B;  4BDY A;  2WAC A;  3C94 A;  4FM4 B;  4RTX A;  4RMO A;  4QQG A;  1TXQ A;  2DMO A;  2MAM A;  4JLG A;  3VYH B;  2ED0 A;  4HVU A;  3RNJ A;  1WHG A;  3OS1 A;  1GL5 A;  3HFN A;  3MKD A;  2RJF A;  2MYS A;  2V8J A;  1ZSZ C;  3ASK A;  4FIB A;  4E6R A;  1K4U S;  4PLI A;  1C1A A;  4PJO F;  4ZNX A;  3OYY A;  4D8K A;  5GAO l;  5A0D A;  2XI9 A;  4J8O A;  2WSF E;  3QJ6 A;  4DBH A;  1JJ2 A;  4FYX B;  1WQ7 A;  2LCS A;  1U8R A;  4R0K A;  2ZGW A;  3CPW P;  4PFP A;  4AT1 B;  3CCU Q;  1AWX A;  1SSH A;  2P0P A;  2K3X A;  2L2P A;  1B7T A;  4QW2 A;  3NTH A;  2O9S A;  3P8H A;  5KYW B;  1YJ9 Q;  4E7H A;  3AT1 B;  4PKC C;  1VQ9 T;  2RMO A;  3JCM b;  4QVZ A;  3H0H A;  5I11 A;  4ZGD B;  1AT1 B;  1VYT A;  2EGA A;  4JLI A;  3OYK A;  4B9W A;  2LX7 A;  2MIO A;  2GTO A;  5CAI A;  4C0G A;  3JB9 G;  2BE9 B;  1VQK T;  3X25 B;  1MUZ A;  1WXU A;  3EAE A;  2H3E B;  2QYZ A;  5CVI A;  1Q86 R;  1ZUK A;  2ZPG B;  1ZSZ A;  2G6F X;  4HKE A;  5GAO q;  3J81 E;  2O9V A;  3SFM A;  1ZBX A;  2JS0 A;  1YIT A;  2HQX A;  1SKU B;  3VJP A;  3VYG A;  1KQS A;  4ZGE B;  1AWW A;  2YUO A;  4R56 A;  2EW3 A;  2KBT A;  1YJ9 A;  2XKO C;  2P84 A;  3CCL A;  4OML A;  3CD6 A;  4DBF A;  2ROL A;  3GLX A;  1VQN A;  2LQ8 A;  2LC4 A;  4JRI A;  1WLP B;  4KH0 B;  5C0M A;  1QCN A;  5GAN d;  4BE1 A;  5HCK A;  5IN1 A;  2QQ9 A;  1IO6 A;  4ZGJ B;  3CCS Q;  2BZY A;  1R77 A;  2K9G A;  2DM1 A;  2KY9 A;  2MPX C;  2ABL A;  3CPF A;  2A28 A;  1GFD A;  3OSV A;  1N5Z A;  3L1A A;  3SDZ A;  3OY9 A;  3HP9 A;  2NUP B;  4X1V A;  1PSF A;  4C92 C;  2L0A A;  1OV3 A;  2KMT A;  4BAC A;  1WHH A;  1BKB A;  2RO0 A;  3C12 A;  2X3X D;  3UAT A;  2CS7 A;  3LLR A;  1VQO Q;  5FU6 B;  1RAH B;  1YP5 A;  1A0N B;  4JJN K;  1QWF A;  4M78 G;  2FO0 A;  2L5Q A;  2MF2 A;  1LVK A;  1C0M A;  1ZHI A;  3PFS A;  4P5N A;  3M0R A;  5GAM d;  3FEO A;  2EWN A;  1YJW Q;  1OZ3 A;  1KG1 A;  2X35 A;  2VWF A;  2X51 A;  1FMV A;  1RLQ C;  3RMQ A;  1VQ9 Q;  2HMA A;  1QQJ A;  1UEB A;  4C8Q C;  2E4H A;  4FYW B;  2QTV A;  2RM4 A;  3PTA A;  1OOT A;  5I21 A;  2GCX A;  2A36 A;  3L2R A;  3RER A;  2CP6 A;  3VV0 A;  3QYG B;  4EDU A;  1NPR A;  2K6D A;  2W10 A;  1RL2 A;  4PLL A;  1UGR B;  3GPL A;  5I22 A;  2FVU A;  3RES A;  1W2B S;  3QHS A;  4C0F A;  2DTI A;  3M59 A;  1K73 U;  4X9D A;  1QP2 A;  5A2Q E;  3PVL A;  4J6X A;  2HSP A;  4XTX A;  3CMA Q;  4M7A C;  4M75 E;  2NUT A;  2P4T A;  2DXB A;  2JMC A;  4C0Z A;  4J9I A;  2YRC A;  3EG3 A;  2ZPB B;  1JEG A;  4IIM A;  2EBP A;  2HL3 A;  2LJ0 A;  2E6N A;  4IUV A;  2A0F B;  1M1K C;  4PJJ A;  3A98 A;  1QVF S;  4AFU C;  3CMA T;  2RQW A;  3M0S A;  1Y96 B;  1BI0 A;  2DXC A;  3JCM h;  3NFC A;  2NUZ A;  4Y92 A;  2LTO A;  2QAS A;  2ZPI B;  3LX7 A;  4FSS A;  2QA4 T;  3EGD A;  1M2O A;  1YIT T;  2DEQ A;  4Q5W A;  2VKN A;  2CZ7 B;  3OYM A;  4JS4 A;  1EFN A;  2FHD A;  3M54 A;  1K9A A;  1RAI B;  4JS5 A;  2RA2 A;  3I56 Q;  4XU1 A;  2FYK A;  2CSI A;  3TCJ A;  2KT8 A;  3MP1 A;  4XU2 A;  4M7A E;  1W2B P;  1PKT A;  4OMN A;  2IVW A;  4EMK C;  3OW2 P;  1G2B A;  1W6X A;  1UEC A;  3I5S A;  1WZO A;  4C8Q D;  2PUO B;  4XTU A;  5LJ3 j;  2MK5 A;  1K0X A;  3GF5 A;  4M7A D;  2FPD A;  1TUD A;  2DBM A;  1Y71 A;  3JCM W;  1N27 A;  2EJ9 A;  4A63 B;  1K8A U;  3ZFJ A;  5HKC A;  2LNV A;  1VQM A;  2DK3 A;  5CKH A;  1R8O B;  3A1P A;  2JOY A;  4C92 B;  2NUP A;  1MND A;  2JTF A;  4LDW A;  2F2W A;  3OB9 A;  4JRK A;  5GAN 6;  3CC7 Q;  2DD4 A;  1YIJ A;  2YSQ A;  1JXM A;  1ACM B;  2DXU A;  4YTL A;  2QQB A;  2AT1 B;  4XTV A;  1UB4 A;  3H41 A;  2M02 A;  3TSW A;  3CC2 Q;  1BI2 A;  4XU3 A;  3OYD A;  4LDV A;  3CCE A;  3CCR T;  2CP5 A;  4BY6 B;  4N0A C;  1YCS B;  3VUZ A;  2ENM A;  2CP7 A;  2FZK B;  5GMK h;  4PJO A;  4C92 E;  1D1B A;  2EYZ A;  2CGH A;  1GBQ A;  1MV0 B;  2SEM A;  1WGS A;  3DLL A;  3EH2 A;  2QEX T;  3ULR B;  1M3A A;  3CBO A;  1VQK A;  1VQ8 A;  1SHG A;  2QA4 Q;  5IXB A;  5LJ5 g;  2QAZ A;  2PU9 B;  4D8D A;  2R58 A;  3VS0 A;  1K73 R;  3TQ7 P;  3OYC A;  3JCM g;  4KRT A;  4F7U F;  1I8F A;  3A8O B;  2M0Y A;  4FW1 A;  3NMZ C;  2NYS A;  3HHT B;  1CKA A;  1WHM A;  4KT0 E;  3HTR A;  1OPK A;  3LGL A;  3DKM A;  4M77 D;  2Y4Y A;  3I5R A;  5J3B A;  2LVM A;  1B34 A;  2LCL A;  1I1J A;  1IRX A;  2HQH A;  2YUP A;  1VQ5 T;  3VU3 C;  3KFV A;  5LJ3 d;  1TS9 A;  2LDM A;  1WIE A;  4DBQ A;  2V26 A;  1F1B B;  3PIP A;  4M75 G;  1PRM C;  1V1C A;  1JBM A;  2KRN A;  2LZ6 B;  4M75 A;  1WHK A;  1QVG A;  2OTL Q;  1K76 A;  4A54 A;  4PJN A;  1JQQ A;  3O8V A;  3CME T;  3CCM T;  5FU7 B;  4CI0 C;  2QK0 A;  8AT1 B;  1VQP T;  4B6M A;  1OUL A;  3JCM Q;  3G71 Q;  4M75 C;  2YXY A;  2D0N A;  2E64 A;  5CCA A;  1ZA2 B;  2XU8 A;  1K9M U;  1MNE A;  4EMK B;  1XTD A;  4E47 A;  1AWO A;  2ZPF B;  2VGM A;  1I5O B;  1JJ2 P;  3CC2 T;  2YRD A;  4BUG A;  3JB9 D;  4XQ3 A;  4HA8 A;  1S72 Q;  1ABQ A;  1M3C A;  1SSF A;  2FZC B;  2F2V A;  1K9M C;  1K8A R;  3QII A;  4IUU A;  2AKL A;  1N6A A;  2CSQ A;  2I2L A;  4J9H A;  1U1S A;  1SRL A;  3JCM e;  5L23 A;  5L8R E;  4ANJ A;  1VQL Q;  4OF1 A;  4K11 A;  2F2X A;  2XIC A;  3RKW A;  3EGX A;  3GOX A;  1KIK A;  3JSC A;  4AG1 C;  1KC8 C;  2YLC A;  3CPW S;  1NE8 A;  1G5V A;  1OU9 A;  3EGU A;  3OYL A;  1IHW A;  1K0S A;  3EG9 B;  2D9T A;  2ESW A;  1Q7Y C;  2R5M A;  4FYY B;  4F7U E;  1AEY A;  2J06 A;  3OBY A;  2LRQ A;  4LDY A;  3MJX A;  1TUG B;  2FL7 A;  1WX6 A;  4M77 E;  2AZV A;  4OP0 A;  3OMG A;  1RAF B;  1KC8 U;  3JCM V;  2EYQ A;  3FJP A;  2RJC A;  2CYZ B;  3NTK A;  4A4H A;  3TVT A;  1WFW A;  2J05 A;  1Y0M A;  3G4S Q;  2GQV A;  3LWH A;  3M5A A;  1ZSZ B;  1WQW A;  3HSB A;  3I56 A;  2COY A;  4M78 F;  4LN2 A;  2PVG B;  2MMP A;  2VAS A;  2LQW A;  5LJ5 e;  1U3O A;  4JRP A;  3EGD B;  3UF4 A;  4DA4 A;  1PWT A;  1TOV A;  2OAW A;  3AHU A;  1U5S A;  4NS5 A;  2DX1 A;  2KYM A;  2HAX A;  2X4Y A;  4J9G A;  5C6S A;  3JAM E;  4PJO C;  1M9S A;  1TWB A;  1M5Q 1;  2JXB A;  4AG2 C;  2HL5 C;  2RB6 A;  2DL4 A;  4OMP A;  5KYN A;  3PT9 A;  2CUB A;  2O88 A;  1VIE A;  1QVF P;  2RJD A;  2PQW A;  2JW4 A;  1X6O A;  5D6X A;  2MOX A;  2X3W D;  2FPE A;  2QXF A;  3RDV A;  1GXI E;  4ELZ C;  1M2V A;  4F7U B;  2BZX A;  3J7A F;  4C0D B;  3VS6 A;  4AMC A;  2OI3 A;  2O01 E;  4EMG A;  3FB9 A;  3HKS A;  1M8V A;  1FXX A;  4GLM A;  1QVF A;  5GMK e;  2QG9 B;  2LNH B;  5IT9 E;  2EYY A;  2P4R A;  3CME Q;  1VYV A;  3M0Q A;  4QKU A;  5EC7 A;  4QQD A;  1T0J A;  2HDA A;  2VYT A;  1VYU A;  3FJ5 A;  2OTL T;  2XG8 D;  1OZ2 A;  2CDT A;  1NBE B;  3D7S B;  2CZ1 B;  1YI2 T;  5KYY B;  2E65 A;  1U06 A;  2K3B A;  4CC3 A;  2DIQ A;  1YHQ T;  4KGV B;  2AKK A;  3MP8 A;  2A7Y A;  2EAY A;  3TU4 K;  4M7D G;  3JB9 I;  2HZY A;  4FT2 A;  4BD3 A;  3X24 B;  2CKK A;  2EQM A;  4BI3 A;  3CCV T;  3REB B;  3CCR A;  5LJ5 f;  3MEV A;  1ZUY A;  4DEY A;  3CCS A;  3OQ5 A;  1Y7X A;  4LDU A;  4OB2 B;  1NG2 A;  4OMM A;  2PUK B;  1UUE A;  3CME A;  1ZSG A;  1VQM Q;  1WDX A;  2KAF A;  1D3B B;  1QVP A;  2JT4 A;  4C92 D;  1QMC A;  2YRV A;  1XQH A;  1PSE A;  2BIV A;  4ESR A;  4KUD K;  3V8K A;  5IHN A;  1LCK A;  1S1N A;  3SEM A;  1VQ7 Q;  2YLB A;  2K2V A;  4N0A A;  2V1R A;  4E7S A;  1WPY A;  4Z8A A;  4EPC A;  3I9Q A;  1LPL A;  2QTX A;  3REA B;  4QVD A;  4LXC A;  4QT7 A;  4RG2 A;  5CKE A;  5GAN e;  1VQ6 T;  4V2S A;  3E9G A;  1JU5 C;  2AIR B;  3UT1 A;  3S3M A;  2KEA A;  2LJ1 A;  4AFS C;  3CQT A;  1GCQ C;  4C5G A;  1NEG A;  3QYH B;  3EFR A;  3G4S A;  3GNF B;  1VQ5 A;  3I35 A;  2DIG A;  1QLY A;  1FMK A;  2ECZ A;  4M7D C;  5I2M A;  5FRO A;  1Q82 U;  2E5Q A;  1D0X A;  3OBW A;  1FWZ A;  4GY5 A;  2KVQ G;  1KQS S;  4RTT A;  5FW9 A;  3PGG A;  2KRM A;  4FT4 A;  4M7D E;  2M0O A;  4FL6 A;  4JPB W;  2DKG A;  1N8R R;  2DAQ A;  1ZUU A;  1MV3 A;  1MMN A;  1IHV A;  2HSE B;  2QQR A;  4UC4 A;  4NL3 A;  3MHX A;  2XDB A;  1Q86 U;  1YIJ T;  5LJ3 h;  2COW A;  3FIF A;  1PG5 B;  1VUB A;  4F16 A;  5AT1 B;  5KYX A;  3E1S A;  1NZ9 A;  3CCU A;  3VRZ A;  1G8X A;  3FDR A;  3VS2 A;  1RAB B;  3OYI A;  1N9S A;  3HRU A;  4QQ6 A;  3S6W A;  4XTW A;  5CQY A;  2EJF A;  1BI1 A;  2LQN A;  3JB9 J;  3QDR B;  2M9U A;  2A3L A;  4D6W A;  4IKF A;  3CCE Q;  1D0Y A;  2CUD A;  1QP3 A;  2KXD A;  1PD1 A;  4FU6 A;  2RQT A;  1YIJ Q;  1M90 U;  1JRI A;  3LH5 A;  3R6N A;  5GAN g;  2M16 A;  1YJW A;  1YWP A;  2LT4 A;  1HXD A;  1CSK A;  1NPP A;  1K73 C;  4JJD A;  3CCQ A;  1VOM A;  2XDP A;  5LJ5 j;  5KYU B;  3A8G B;  3QPH A;  3G6E Q;  2DRM A;  1RUW A;  3UPU A;  4M77 B;  1G3T A;  3JV3 A;  1HYO A;  2OTJ A;  1QKX A;  4RKU E;  1X6G A;  2K5F A;  2VB6 A;  2A08 A;  1OX9 A;  4PK4 A;  5CK9 A;  2K57 A;  3NTI A;  2BZ8 A;  3OYE A;  3KUF A;  1TSF A;  2YUQ A;  1WJS A;  2HKQ B;  2DE0 X;  1YN8 A;  1KFZ A;  4DEX A;  2NWM A;  4ZTJ A;  1AZE A;  4RCC A;  7AT1 B;  1SG5 A;  2FZG B;  2RH2 A;  3E9F A;  1VIF A;  4OGC A;  1O75 A;  3RKY A;  5IXF A;  2RPN A;  3FRN A;  3BFM A;  3X28 B;  5CKB A;  3TRE A;  2JS2 A;  1ARK A;  3H0I A;  4L6V 5;  1FX7 A;  4HXJ A;  1M1K R;  4M75 F;  3ZL7 C;  5GAM e;  3OA6 A;  1B07 A;  2E12 A;  1VQ7 T;  9ATC B;  1VQ4 A;  5LJ5 h;  1QCF A;  5J39 A;  3GP8 A;  1IGQ A;  3RIR A;  4MMK A;  5HK0 A;  2KRO A;  4OB0 B;  1AZG B;  1BIA A;  2C0T A;  4PFZ A;  2VV5 A; 
#chains in the Genus database with same CATH homology
 3I55 A;  4LDX A;  5GAN f;  3CBP A;  2OAU A;  1W4S A;  2VUB A;  2XID A;  3O8V A;  3QJY A;  3CME T;  2RHZ A;  5FU7 B;  4CI0 C;  3CCM T;  2E10 A;  1N9R A;  2E41 A;  2L8D A;  3KBG A;  3PIO A;  4IUR A;  4ME7 A;  1VQP T;  3JCM Q;  2L89 A;  4A53 A;  4ZN3 A;  4M75 C;  3OYF A;  4X9C A;  5GAN 4;  3PMT A;  2E64 A;  2LT1 A;  5GAM j;  4OB3 B;  5CCA A;  1Q81 U;  4BDY A;  2XU8 A;  1K9M U;  2WAC A;  3LH0 A;  3H6Z A;  3SWN B;  3OYJ A;  4EMK B;  3C94 A;  4FM4 B;  2EJG A;  4RMO A;  1XTD A;  4QQG A;  1YHQ A;  4E47 A;  2MAM A;  4JLG A;  3VYH B;  2ZPF B;  2VGM A;  3BW1 A;  4IUP A;  2XDD A;  1YJN T;  2VXF A;  3OS1 A;  4J5Y A;  3HFN A;  2RJF A;  2F69 A;  2V8J A;  3HL8 A;  3CC2 T;  1H64 1;  2DZ9 A;  5KE2 A;  5KE3 A;  4BUG A;  3JB9 D;  4XQ3 A;  4HA8 A;  5GAN h;  3ASK A;  5KCH A;  2RHY A;  3P8B B;  3M53 A;  4FIB A;  2R57 A;  1SSF A;  3OYA A;  1K9M C;  4C5E A;  4XK8 E;  2DTO A;  3QII A;  5LJ5 d;  4IUU A;  5GMK m;  2K3Y A;  4PLI A;  1N6A A;  4PJO F;  3OYY A;  5GAO l;  5FLX E;  2X4W A;  1VQO T;  3V7R A;  5A0D A;  4M77 A;  3L2Q A;  2XI9 A;  1VQ6 A;  2I2L A;  4J7F A;  4BI8 B;  4M77 G;  4J8O A;  1U1S A;  3JCM e;  2WSF E;  4C5H A;  1VQL T;  5L8R E;  2MWP A;  3A8M B;  3BDL A;  3QJ6 A;  1JJ2 A;  1WQ7 A;  2GF7 A;  4MDX A;  2QI2 A;  4OF1 A;  2XIC A;  4MZP A;  1I5L A;  2YHT A;  2RI5 A;  3RKW A;  3GOX A;  3LYI A;  1U8R A;  4HT8 A;  1VQ8 T;  3JB9 H;  3JSC A;  3OYB A;  1KC8 C;  2ZGW A;  2YLC A;  3CPW S;  2KK4 A;  1NE8 A;  4JUV A;  1UGP B;  2ZZD A;  4QVC A;  3G4S T;  4BE0 A;  3OYL A;  1G5V A;  1OI1 A;  2WSC E;  1W2B A;  2P0P A;  2DVE A;  2D9T A;  1S72 A;  3GIB A;  1NJI C;  1Q7Y C;  2R5M A;  2K3X A;  4M75 D;  3L2W A;  3CXC A;  2Y4X A;  4QW2 A;  3OS0 A;  3L2U A;  1Y07 A;  4F7U E;  3NTH A;  3OBY A;  1G3S A;  2LRQ A;  3P8H A;  2JUF A;  4LDY A;  4Y91 A;  3S3O A;  4M77 E;  2FL7 A;  4OP0 A;  3OMG A;  4KBM B;  1KC8 U;  3JCM V;  2EYQ A;  2PVD B;  4E7H A;  3ME9 A;  3FJP A;  1KHC A;  4PKC C;  2LCC A;  2RJC A;  2CYZ B;  3X20 B;  1VQ9 T;  3NTK A;  5CKF A;  3JCM b;  4M78 A;  4A4H A;  4LD9 K;  4QVZ A;  4E7I A;  5GAN 8;  4ZGD B;  3MEW A;  3V7C A;  4WF2 A;  4KUL A;  1M1G A;  2E1H A;  2WSE E;  2HBP A;  4JLI A;  2DPP B;  3OYK A;  2GQV A;  4B9W A;  3LWH A;  4O6J A;  3M5A A;  1WQW A;  1TH7 A;  3HSB A;  3I56 A;  5AYF A;  5CAI A;  4C0G A;  3JB9 G;  4M78 F;  4N4I A;  2V8K A;  1VQK T;  3X25 B;  4HCZ A;  2PVG B;  2MMP A;  1MGQ A;  2GFU A;  4IUT A;  3URG A;  3OS5 A;  4M7D B;  3EAE A;  4F7U A;  5HK3 A;  2GFA A;  3CEY A;  3CCJ T;  5LJ5 e;  2RJE A;  4JRP A;  1OYX A;  5CVI A;  3QZ5 B;  5GAO n;  3J80 E;  2XHC A;  3BY7 A;  4DA4 A;  3AHU A;  4NS5 A;  5CR2 A;  4M75 B;  2IG0 A;  3C4S A;  3H8Z A;  5D6Y A;  2ZPG B;  2HAX A;  2DJZ A;  2X4Y A;  5C6S A;  3JAM E;  3CCQ T;  4HKE A;  3OW2 A;  4PJO C;  1M9S A;  2EQK A;  4NL2 A;  5GAO q;  3J81 E;  2L3R A;  3SFM A;  3CCM A;  1RI0 A;  1M5Q 1;  1ZBX A;  3G7Z A;  1YIT A;  2RB6 A;  3N5B B;  3PT9 A;  2HQX A;  3VJP A;  3VYG A;  3DB4 A;  5D6W A;  1KQS A;  4ZGE B;  4X34 A;  1KQ2 A;  2ZPH B;  4R56 A;  1VIE A;  3CCJ A;  5M9O A;  1YJ9 A;  2XKO C;  2RJD A;  1AHJ B;  2PQW A;  1X6O A;  3CCL A;  5D6X A;  4J7I A;  2EQJ A;  3CD6 A;  3GLX A;  3CXC S;  2QXF A;  1JJ2 S;  1VQN A;  1D3B A;  2LQ8 A;  2LC4 A;  4JRI A;  4GLK A;  1GXI E;  4ELZ C;  4F7U B;  5C0M A;  5DY9 A;  2DTH A;  2RI3 A;  3RMS A;  4HT9 A;  3J7A F;  5GAN d;  4BE1 A;  2C06 A;  4C0D B;  3OS2 A;  3WVD B;  5IN1 A;  2JZ2 A;  2QQ9 A;  4O5V A;  1MHN A;  4MZT A;  4ZGJ B;  2O01 E;  4Y28 E;  3FB9 A;  3HKS A;  4EMG A;  3T9N A;  1FXX A;  1M8V A;  1QVF A;  2KY9 A;  2D0Q B;  3CPF A;  5GMK e;  3OSS C;  3I55 T;  5LL6 S;  1H3Z A;  3P8D A;  3OSV A;  5IT9 E;  5A0L A;  4F7U G;  3L1A A;  3OY9 A;  3SDZ A;  1Y96 A;  3UWN A;  3JCM d;  3HP9 A;  4A4G A;  2F5T X;  4C5I A;  1PSF A;  4QQD A;  1N8R U;  4M78 B;  3M58 A;  4OVA A;  4C92 C;  2F5K A;  4C8Q E;  3C95 A;  2KMT A;  4M78 D;  4BAC A;  3CC7 T;  4BE2 A;  3MO8 A;  1BKB A;  2VYT A;  1EIF A;  2RO0 A;  1U1T A;  4CRI A;  2OTL T;  2XG8 D;  1OZ2 A;  3C12 A;  4RCB A;  2CS7 A;  3LLR A;  1O9S A;  2RHX A;  5FU6 B;  3OW2 S;  4JJN K;  2CZ1 B;  4M78 G;  1YI2 T;  1VQM T;  2L5Q A;  2EIF A;  2MF2 A;  5DLQ E;  2E65 A;  4PJO G;  1ZHI A;  2R5A A;  1WJR A;  3PFS A;  4P5N A;  5GAM d;  3FEO A;  4XU0 A;  2EWN A;  2RK2 A;  4A4E A;  3CC4 T;  3CCS T;  1OZ3 A;  2DIQ A;  1YHQ T;  4M7A G;  5GAN 5;  1KG1 A;  2X35 A;  3MP8 A;  2QEX A;  2A7Y A;  1S72 T;  2EAY A;  3TU4 K;  3RMQ A;  4M7D G;  4ZTF A;  3JB9 I;  1I81 A;  4FT2 A;  3CMA A;  3PMI A;  4RG8 A;  3A8H B;  1UEB A;  4A4K A;  4BD3 A;  4C8Q C;  3ER0 A;  3HRS A;  3X24 B;  2CKK A;  2EQM A;  2RM4 A;  3PTA A;  4XAX B;  5LJ3 e;  5I21 A;  1BI3 A;  2QQS A;  2K5I A;  4BI3 A;  1QVG S;  3CCV T;  4JDS A;  1BYM A;  2GCX A;  2HNI A;  2O4X B;  2QA4 A;  4Z02 A;  5A0G A;  3CCR A;  3L2R A;  5LJ5 f;  3MEV A;  4OB1 B;  3CC4 A;  3RER A;  3CCS A;  4M7A F;  3OQ5 A;  4PJO B;  1Y7X A;  1Q7Y U;  4LDU A;  4OB2 B;  1YJW T;  4C92 G;  2PUK B;  3CME A;  3CCE T;  3CCU T;  3VV0 A;  2LX9 A;  3MCA B;  3QYG B;  4EDU A;  5CIU A;  1VQP A;  2M1H A;  4II1 A;  1YBY A;  2K5L A;  1NPR A;  2E70 A;  3M57 A;  1RL2 A;  2EFI A;  1UGR B;  1D3B B;  2KAF A;  4PLL A;  1QVP A;  3GPL A;  4C92 D;  3SWN C;  1X01 A;  2YRV A;  1XQH A;  1PSE A;  2BIV A;  2FVU A;  3RES A;  4KUD K;  3INZ A;  3V8K A;  1M4Z A;  3QHS A;  2X4X A;  4OMF B;  4C0F A;  1W2B S;  2DTI A;  3M59 A;  5EG2 A;  4C92 A;  3QSU A;  1KQ1 A;  2KQW A;  3QUI A;  1K73 U;  3M55 A;  3QBY A;  1YCY A;  4X9D A;  2YLB A;  2K2V A;  5GAO p;  1QP2 A;  4N0A A;  3MEA A;  5A2Q E;  3MP6 A;  4C8Q A;  4J6X A;  4XTX A;  1WPY A;  1VQ9 A;  4M7D F;  4M7A C;  4MML A;  5GAM h;  4R55 A;  2E6Z A;  4M75 E;  4EPC A;  2QTX A;  4QVD A;  1QW1 A;  2P4T A;  2DXB A;  2RD1 A;  4IUQ A;  4N4G A;  5KCO A;  4RG2 A;  3L2Z A;  5CKE A;  3RUX A;  4J6Y A;  5GAN e;  3OYH A;  4C0Z A;  4C8Q F;  1VQ6 T;  4V2S A;  3E9G A;  2ZPB B;  5FRM A;  2MWO A;  1VQN T;  4VUB A;  3M4Y A;  3JB9 F;  3LGF A;  3ZEH A;  3QG1 A;  3UT1 A;  2E6N A;  4IUV A;  4NOY A;  5GMK j;  3JCM X;  4C8Q B;  1M1K C;  5GAO m;  2Y90 A;  2HD0 A;  4BY6 C;  3S3M A;  3M9Q A;  5GMK l;  3QKJ A;  3QO3 A;  3CMA T;  1QVF S;  2EQU A;  1M1F A;  4A54 A;  1UGS B;  1Y96 B;  4C5G A;  3HPW A;  1BI0 A;  3QYH B;  3EFR A;  2DXC A;  1N8R C;  3G4S A;  3GNF B;  3JCM h;  3NFC A;  2MI6 A;  1VQ5 A;  3LW5 E;  3CCV A;  2DIG A;  2LTO A;  2ZPI B;  2OTJ T;  5CQX A;  3Q1J A;  3LX7 A;  5I2M A;  2QA4 T;  1YJN A;  4M77 C;  4M7D C;  2AHJ B;  3FLG A;  3EFS A;  5FRO A;  2KSS A;  3OYN A;  2DEQ A;  1YIT T;  4Q5W A;  3VUB A;  1HK9 A;  1Q82 U;  2E5Q A;  5LJ3 f;  3OBW A;  1FWZ A;  2CZ7 B;  3OYM A;  2EKO A;  4JS4 A;  3JRZ A;  4GY5 A;  1P92 A;  3V8J A;  3WVE B;  2KVQ G;  2FHD A;  4MZM A;  3M54 A;  4BI4 A;  5GAN j;  1KQS S;  3PGG A;  5FU7 C;  4JS5 A;  2RA2 A;  1ZQ1 A;  4A4F A;  2BKD N;  3UDC A;  4FT4 A;  4XU1 A;  4M7D E;  2FYK A;  1M1K U;  3TCJ A;  2KDS A;  1YI2 A;  4DOV A;  2M0O A;  4FL6 A;  2QQA A;  2O4X A;  3MP1 A;  4XU2 A;  3G6E T;  4ATO A;  3L2V A;  1WNL A;  2DKG A;  2H3J A;  3E19 A;  3MET A;  3LWI A;  4M7A E;  4E7J A;  3X26 B;  3JCM f;  2IVW A;  4EMK C;  4E7L A;  3M4G A;  1VQL A;  2K4Y A;  4XTZ A;  2RK1 A;  4M7A B;  4FSX A;  3ZBD A;  4J6W A;  3SD4 A;  2CZ6 B;  2DAQ A;  3V8L A;  2QQR A;  2DO3 A;  2B8A A;  4UC4 A;  5I2S A;  4C8Q D;  3MHX A;  3VKI A;  4NL3 A;  2XDB A;  4C8Q G;  2PUO B;  2DZC A;  1Q86 U;  1YIJ T;  4XTU A;  5LJ3 j;  2CZ0 B;  5LJ3 h;  3FIF A;  3GF5 A;  2BUD A;  4M7A D;  1UGQ B;  3CBM A;  1VUB A;  1VQ7 A;  1Y71 A;  5GAM f;  3JCM W;  3CC2 A;  2FB7 A;  1N27 A;  1WJQ A;  2EJ9 A;  3CC7 A;  1K8A U;  3E1S A;  3ZFJ A;  3KXT A;  1NZ9 A;  5HKC A;  3DLM A;  3SB2 A;  3CCU A;  2LNV A;  2D6F A;  4M7A A;  2OTL A;  1VQM A;  2DK3 A;  5CKH A;  2ZPE B;  1I4K 1;  3FDR A;  3MEU A;  2VC8 A;  1R8O B;  4DQ2 A;  2JOY A;  4C92 B;  3OYI A;  1N9S A;  3HRU A;  4LDW A;  2JTF A;  4QQ6 A;  3S6W A;  3OB9 A;  4JRK A;  5GAN 6;  4XTW A;  1LNX A;  5GAO r;  2DD4 A;  4M77 F;  3SWN A;  1YIJ A;  5CQY A;  2EJF A;  2G3R A;  1BI1 A;  5GAN 2;  3JB9 J;  4N4H A;  3QDR B;  4J83 A;  2M9U A;  2VGN A;  2A3L A;  5FU6 C;  4D6W A;  1LOJ A;  2P0K A;  2DXU A;  4YTL A;  3TEE A;  4BB7 A;  1VQO A;  4IKF A;  2QQB A;  4PNO A;  2XD0 A;  4XTV A;  1UB4 A;  3HRT A;  3RKX A;  1QP3 A;  3CPW A;  1Q81 C;  5CO7 A;  2X4J A;  3A5Z B;  3GNG A;  4FU6 A;  2PVO B;  3QXE B;  1M90 U;  4HCC A;  1JRI A;  5GAN g;  2JTM A;  5HY6 A;  1KD1 U;  2NLU A;  1M90 C;  1BI2 A;  2M16 A;  2JN0 A;  4XU3 A;  1YJW A;  3OYD A;  3G6E A;  5IAY A;  4LDV A;  2RHU A;  5LJ3 g;  3CCE A;  2LT4 A;  3M56 A;  3JCM P;  3CCR T;  1HXD A;  4BY6 B;  4N0A C;  4KUI A;  1NPP A;  1K73 C;  1JB0 E;  4EMK A;  3CCQ A;  2RI2 A;  2XDP A;  3VUZ A;  5LJ5 j;  5GMK h;  1G3W A;  4PJO A;  5GAN 3;  4C92 E;  1XNI A;  1X75 C;  3A8G B;  3QPH A;  4PL6 A;  5GMK i;  3UPU A;  4M77 B;  1G3T A;  3R6O A;  4OGE A;  2ZCF B;  1KD1 C;  3HFO A;  4PJO D;  2RHI A;  3PNW C;  2CGH A;  4EMH A;  3JCM J;  2JVV A;  3JCM c;  4C92 F;  2OTJ A;  3CD6 T;  4MDW A;  4RKU E;  1B34 B;  1WGS A;  2K5F A;  3A8L B;  3L42 A;  3DLL A;  2QEX T;  3BDU A;  4L59 A;  4HCB A;  4TVR A;  5CK9 A;  4M7D A;  2K57 A;  3CBO A;  3NTI A;  2V8I A;  3OYE A;  1VQK A;  3OYG A;  3KUF A;  4ZN1 A;  1VQ8 A;  5LJ5 g;  2PU9 B;  2R58 A;  1Q86 C;  1K8A C;  2XK0 A;  3S3N A;  4M7D D;  4BDZ A;  3OYC A;  3JCM g;  4L5G A;  1V29 B;  1WJS A;  4PJO E;  1LJO A;  1KHI A;  3F70 A;  1I8F A;  4F7U F;  4M78 E;  4ZTJ A;  4RCC A;  3A8O B;  2RH2 A;  1IRE B;  3E9F A;  3G71 A;  1VIF A;  4OGC A;  1O75 A;  2LQK A;  1Q82 C;  2DXT A;  3RKY A;  2DD5 A;  3HHT B;  1VQ4 T;  1NJI U;  5FRN A;  3FRN A;  5J26 A;  4B9X A;  3BFM A;  3V7S A;  3X28 B;  4KT0 E;  5CKB A;  4C0D C;  3TRE A;  1DJ7 B;  5GAN 7;  3LGL A;  3DKM A;  4M77 D;  5GAM g;  2Y4Y A;  5J3B A;  2LVM A;  5DLO A;  4E7K A;  1B34 A;  1YJ9 T;  2LCL A;  4L6V 5;  1FX7 A;  5DM7 R;  1BIB A;  1IZ6 A;  1G3Y A;  4M75 F;  3VU3 C;  5GAM e;  1VQ5 T;  2HQE A;  5CKD A;  3G71 T;  5LJ3 d;  3OA6 A;  4JRQ A;  2E12 A;  2LDM A;  3CCL T;  3I56 T;  1VQ7 T;  4XTY A;  1VQ4 A;  4LD6 A;  5LJ5 h;  3OMC A;  3GP8 A;  5KH6 A;  5J39 A;  2JNG A;  3PIP A;  2QDY B;  3FC3 A;  4M75 G;  4MMK A;  3RIR A;  1JBM A;  4M78 C;  5HK0 A;  3DB3 A;  4DOW A;  4M75 A;  4OB0 B;  2P0Q A;  1QVG A;  2VXE A;  3QZ9 B;  1BIA A;  4ELY C;  1XOV A;  2VV5 A;  3WXM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...