4M77B

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISSTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 20
structure length 91
sequence length 91
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77B00
4M7AB 4C92C 2CGHA 2I2LA 3BFMA 2DXTA 4M78C 5LJ5f 3JB9D 1I81A 4PNOA 4C92A 1I5LA 4M78A 5LJ3j 4M7DC 1KQ1A 4DQ2A 4M7AD 3RERA 1I4K1 4C8QC 2K57A 4M7DA 1Y96B 1HK9A 3RKYA 5GAN4 1MGQA 5GAOn 4C8QA 5GAN3 3JCMJ 4M7DD 4WF2A 4C8QD 5GMKe 4PJOE 1HXDA 2RB6A 4PJOF 1BIBA 4NOYA 5LJ5d 1H641 4MMLA 3L2ZA 4Y91A 4J5YA 5I21A 4NL2A 4M77B 4F7UB 4XU0A 4EMKB 5LJ5g 2FB7A 4X9CA 5CAIA 3RIRA 5GAN5 4X9DA 2YLCA 2VC8A 5GAMe 4M77D 4EMKA 2DTIA 4J6YA 3QSUA 4XTXA 3JB9H 2DXUA 4PJOG 3FIFA 3PGGA 4C92B 5GMKm 4M78B 2EJ9A 2HNIA 5LJ3e 4JRIA 1WQWA 3V8JA 4M7DB 5GAN7 4HT8A 3SB2A 4NL3A 3JB9J 5GMKi 3JCMe 1TH7A 4C8QB 3V8LA 1LJOA 4M78D 4C92D 4PJOC 2FYKA 4JRKA 4XQ3A 4PJOA 1N9SA 3BW1A 3HFNA 5GAOr 5GANd 3EFSA 4RCBA 1LNXA 4HA8A 2E64A 1LOJA 4QVCA 3L1AA 3QHSA 5GAN6 3FJPA 4M75E 4M75F 5GANg 1BIAA 4N0AC 1D3BA 3INZA 2DVEA 5GANh 4N0AA 3GIBA 4JUVA 4XTUA 2YHTA 1YCYA 1U1TA 3BY7A 2YLBA 4XTVA 4M7DG 5LJ5j 3QO3A 2DEQA 5GAN2 5GANf 1B34A 4PJOB 4M7AF 3QUIA 4M75G 5GMKh 4QVDA 5GAMd 5GMKl 5GAOm 3V8KA 3JCMP 3JCMX 2DTHA 2VXEA 1X01A 2DKGA 4J6XA 3FB9A 4PJOD 4OP0A 3AHUA 3BDUA 5GAMg 2EJFA 4M75C 3JB9I 5LJ3d 2EWNA 4EMHA 3JB9G 4M75A 3JCMc 1WNLA 5GAMh 1D3BB 4XTYA 5GAOp 2QTXA 3EFRA 2E65A 2JN0A 3JCMd 4V2SA 3SWNC 4HT9A 4M7AG 5LJ3g 4XU2A 2DZCA 1N9RA 2RM4A 4M77F 4M77E 1WPYA 4XU3A 3SWNA 3V7CA 3VU3C 4A54A 4F7UF 2VXFA 4F7UE 2E10A 5LJ3h 3JCMg 5LJ5e 4EMGA 5GAMf 4M7AC 2Y90A 1B34B 3JCMh 4XU1A 5GANj 2RD1A 4J6WA 3JCMb 3RKWA 1M5Q1 3JCMV 5GAN8 3JB9F 4M7AA 4XTWA 4C92E 5LJ3f 4M78E 4M78F 2EAYA 3HFOA 2DTOA 5DY9A 4C92F 3JCMW 3RESA 4M7AE 1I8FA 4M77G 4M7DE 4F7UG 2DJZA 4M7DF 3M4GA 2DZ9A 3JCMf 1Y96A 4MMKA 4A53A 3JCMQ 4C8QE 4C8QF 2ZGWA 4M75B 5GMKj 3RUXA 1KQ2A 2E1HA 2E41A 1M8VA 3RKXA 5GANe 5GAOl 4JLIA 1JRIA 4M77C 5GAOq 4EMKC 2RA2A 2EJGA 1JBMA 1WQ7A 4M75D 4M77A 3SWNB 1U1SA 3V7SA 4C92G 4F7UA 4M78G 5LJ5h 3V7RA 4XTZA 5GAMj 4RCCA 3HSBA 4C8QG
chains in the Genus database with same CATH superfamily
4LDYA 2PTKA 2DF6A 3ME9A 4C92A 1Z9QA 3OW2A 2OI3A 3TEEA 1DJ7B 3CCLA 1Y96B 2KBTA 1ZHIA 1WDXA 4IKFA 3LH0A 1H641 1IXDA 4FIBA 1O75A 5HKCA 4PFPA 4EMKB 5LJ5g 4LDWA 2AKKA 1D09B 3C12A 5KYXB 1YJNA 4PFOA 1W70A 3QZ9B 3V8JA 5M9OA 1K1ZA 2RQTA 1AT1B 5CKEA 4M78D 4JRKA 1OV3A 1WHGA 3MHXA 1M2VA 1JEGA 1G8XA 2VVKA 3OYFA 2G6FX 4HCZA 1NLOC 3GIBA 4LDVA 2ZPEB 3BY7A 1RAGB 1GRIA 4ANJA 2JTFA 4C0GA 2OTLA 1OI1A 2X4JA 1JB0E 1WHMA 1M1KC 1J3TA 4QQ6A 1QVFS 5DM7R 5GAMg 4CC2A 2D6FA 1SRMA 4M75A 3M0UA 2L0AA 1MMNA 4HCBA 4FM4B 4XU2A 2KRNA 1AZGB 2RQRA 4EMGA 5GAMf 4LUEA 4KBMB 2CP2A 2O9VA 1YHQT 1W6XA 1K9AA 3VKIA 3JCMW 4A4HA 1CKAA 3HKSA 1K9MU 4M7DE 4A53A 4C8QF 2NWMA 1SSFA 2M51A 1X27A 2ZPIB 4HKEA 4J7IA 1M2OA 1WQ7A 4F7UA 1AOJA 2YUNA 2QA4Q 1UJ0A 2KRMA 1UGRB 2MWPA 2L3RA 2A7YA 3MKDA 2IIMA 1C0MA 2CH4W 1TUDA 5I11A 4OMNA 2X4YA 1T3SA 2RJDA 5IXBA 1WZOA 2KROA 3G71T 3FJ5A 1FX7A 2LX7A 5I21A 3C95A 1PG5B 1UGPB 2BE9B 2QASA 2YLCA 4EMKA 3I55Q 4OMOA 1RLQC 2KT8A 3ASKA 3CMAQ 3I5SA 1LCKA 1F1BB 1O9SA 1UDLA 3META 1ZX6A 4C0ZA 3JB9J 5GMKi 2KXCA 2FYKA 2VASA 1Z9ZA 4JZ4A 4NS5A 5GAOr 4FYVB 1N8RU 3OYIA 1Q81C 4L6V5 2KAFA 2E64A 3EAEA 3QPHA 2JS0A 2BZ8A 2V8JA 1BIAA 1S72Q 2DVEA 1RABB 4J9EA 2GBQA 3EGXA 1PD0A 1VQ6T 3HHTB 2FRYA 2QA4A 3OYNA 3X28B 2JW4A 1B3QA 3A8MB 4EMHA 4F14A 5GAOp 1YBYA 1ARKA 3EFRA 2W10A 3SWNC 1PM3A 3CCJQ 4M77E 3RDVA 2V8IA 2HQEA 2DL8A 2I0NA 2LDMA 5C6SA 2ENMA 4C5GA 4Z88A 3ZEHA 4FW2A 2MWOA 3CMAA 3UDCA 3M4GA 3H8ZA 3CPWP 3CCMQ 3TSWA 2AT1B 1VQPQ 3QYGB 1X6GA 3RMSA 2C0OA 2HKNA 4E6RA 2YXYA 1MUZA 4M78C 1S72A 5KE3A 2L89A 3RKYA 1K9MR 3EFOA 2Z0WA 2K2MA 1Y57A 2RH2A 4E7HA 3PE0A 3RIRA 4X9DA 4EIKA 3CD6T 2RI5A 2EQMA 1IO6A 1AWJA 1ZUKA 4XTXA 3QSUA 2D8HA 3CMEQ 4M7DB 3CCJA 4NL3A 5HCKA 3G4SQ 1TH7A 4OF1A 2M16A 2ZPBB 3L2WA 3DB4A 5HY6A 4QT7A 2XG8D 4DA4A 2DMOA 1GFDA 3L1AA 1SF9A 2COZA 3CCMA 3QG1A 4XTUA 4IUUA 2V8KA 4BI3A 3CCVT 1VQPA 4J9BA 4LNPA 4CI0C 1TUGB 1HSQA 1YITQ 5CK9A 1N8RR 4IIOA 4OP0A 2OTJT 3SEMA 1NJIR 3CC7T 2BZXA 1WPYA 3CCUQ 3S3MA 1PRLC 2OAUA 5LL6S 1EZZB 1NPPA 3EHRA 3JB9F 1PHTA 4C92E 1M1KU 4KH0B 5DY9A 2RPNA 3PIPA 1VYTA 2DJZA 3CMEA 1GCQC 2GFAA 3KUFA 4RUGA 1WJRA 1TTHB 2XMFA 4FSSA 2E1HA 2NUPB 3G4SA 3CQTA 1OYXA 4LDXA 1VQOT 5HK0A 3HSBA 4M7AB 2RQUA 4LXCA 1BB9A 1PNJA 3JSCA 2EYXA 2HKQB 4YTLA 2K4YA 4HXJA 3CC4Q 3CCQQ 3OYYA 4C8QC 2H3JA 2R5MA 4KUDK 1YIJT 4PJOF 5LJ5d 4FYWB 4KGVB 4NL2A 4M77B 1YITA 2GGRA 1CKBA 1UB4A 4J6YA 2QI2A 4ELZC 1M8MA 2HAXA 5CKHA 3CCUA 1BK2A 1UTIA 4L5GA 1B7TA 4ATOA 1SG5A 4JJBA 1ZA1B 4JJDA 1MMAA 3OMGA 1NEGA 1NM7A 3S3NA 2HL3A 4C0FA 4M75E 5IN1A 3G6ET 1H3HA 2EYQA 3VJPA 4FT2A 1SHGA 5LJ5j 2DM1A 1NPRA 5KCHA 3PVQA 3I35A 5J39A 2LX9A 4QVDA 5GAMd 2JUFA 3EG2A 2DL5A 1Q81U 2ZPFB 1K0XA 1MHNA 2DKGA 4PJOD 1KJWA 2KXDA 5IHIA 2RHXA 2RO0A 3CC4A 1RADB 3CCQA 3OBYA 4L59A 2V26A 4XTYA 1VQ8Q 3H0FA 4F7UE 4D6WA 4IUQA 4C0DB 2A28A 2LQNA 3QIIA 4AFSC 1YJWQ 3MCAB 3GP8A 1VYVA 1JJ2P 3HTRA 5KYYB 2DERA 2NUZA 2AZSA 1QLYA 1E6HA 2EJGA 2FG0A 1M1FA 1UHCA 1JQQA 1ZQ1A 4OGEA 3I56Q 1BI2A 3GNFB 5GAMj 2P0KA 3EGDA 4IUPA 1ZSZB 1X6OA 2E5KA 2ABLA 2CREA 1M1KR 1OU9A 4M7DD 1OZ3A 2EGAA 2GF7A 3QXEB 1IGUA 2A36A 4J5YA 3J81E 2QQSA 1KFZA 2RHUA 4DBFA 1W4SA 3GNGA 2EYZA 2HCKA 2RK2A 1C6VX 2ROTA 1XOVA 4O6JA 3FIFA 5EG2A 4J9FA 4C92B 2EJ9A 5A2QE 1VQ8A 1VQNT 4AG2C 3VS0A 3TSZA 1UUEA 3OYMA 2QXFA 1OQKA 1YJWA 3ULRB 5D7UA 3OYKA 5KYNA 3HRTA 1EIFA 4GBQA 3LW5E 3M9QA 3OYDA 1W1FA 3HL8A 2YRVA 3NGPA 3L2UA 1NJIC 2YLBA 2HBPA 2HQXA 4MZPA 3T9NA 1GFCA 3EG3A 5GMKh 3I56A 4F04B 2EKOA 2LQWA 1T3LA 2KYBA 3M0SA 2JM8A 5J3BA 2JT4A 3F70A 1X69A 4ESRA 4HT9A 4M7AG 1YI2T 2KNBB 4XAXB 3V7CA 1I1JA 3SWNA 5CKFA 2CT3A 4OB3B 2O88A 3OYAA 5LJ5e 3CCST 2JTEA 3U23A 5I22A 5FWBA 4B6MA 3ZFJA 4M77G 1BI0A 4PJMA 4TVRA 4RTYA 1RAHB 4M75B 1H92A 1YWOA 1KQ2A 2PZ1A 1D0ZA 2CP6A 2EYYA 2P4TA 1NLPC 3V7RA 4R56A 4LN2A 3QKJA 4IUTA 4AFUC 2JTMA 4OMPA 3P8HA 3CCLT 1W2BA 4LD9K 2R5AA 4M78A 3CC2T 2LCCA 2CYZB 4J8OA 3RERA 3JCMJ 1JJ2S 4QQGA 1KSWA 3DB3A 1VQ5Q 5GJWB 3L2ZA 2NYSA 4F7UB 5CKDA 1YJNT 4JRPA 5C0MA 3GF5A 5GAMe 4KT0E 3MEUA 3L2VA 1BI3A 2IPOB 2C0TA 2FHDA 1NZ9A 3PGGA 3D7SB 2HSEB 4MDXA 3Q1JA 4PJOC 3LYIA 4XQ3A 1WA7A 1OOTA 3BW1A 2HL5C 4DBRA 4RCBA 4E47A 1JO8A 4CC3A 2KSSA 3FJPA 2F1LA 1GL5A 1BCOA 2OTLT 4HCCA 1VQKQ 2EPDA 2PUKB 2X35A 3O8VA 2OJ2A 1Y71A 4J6XA 5FU6C 1QWEA 2VGNA 2EJFA 3JB9I 3FC3A 1MV3A 1Q95G 1IHWA 3VRZA 3NTKA 4RKUE 1VQ5A 3EGXB 2DIQA 5L23A 4N4GA 1KG1A 2HQHA 4PLLA 3M53A 3CCRQ 1VQ7Q 2CZ7B 4E7JA 1N6AA 2CP7A 3FRNA 4E7ZA 2H8HA 4HCKA 1BCMA 5IT9E 1UFFA 1PRMC 2OX7A 3NTHA 3PMTA 1GCQA 2FPDA 2K6DA 3CXCS 4JLIA 1MV0B 2CUDA 1V1CA 3JCMQ 4DOVA 4C92G 1Y0MA 1XQHA 2WSFE 5KYWA 2EQUA 3TU4K 4AFZC 1IREB 1HJDA 2LT4A 3LWIA 2YUPA 4C8QA 2RB6A 1VQKA 1LVKA 1AD5A 3EG1A 1VQMT 2DYBA 2F69A 4K11A 2BZYA 3LH5A 2JZ2A 4QVZA 1QP2A 2LP5A 1E7OA 2DTIA 6AT1B 2P84A 3CBMA 2F2XA 2HNIA 3WXMB 2PNIA 2GQVA 1I07A 3SB2A 1M4ZA 3EFOB 2F5KA 3REBB 3E2UA 3CCRA 1KD1C 3HFNA 1Q86C 5IXFA 1VQ7A 4B9XA 3EH2A 3CCEQ 2FL7A 2JXBA 3A8OB 3X24B 2HSPA 2KMTA 3OSVA 3C94A 3P8BB 1FXXA 1TOVA 2QA4T 2EW3A 1IZ6A 2KT1A 1B34A 1WGSA 4A4FA 4X34A 3QUIA 1WHLA 4M75G 1YN8A 1KIKA 1G3TA 1U5SA 4CRIA 4BDYA 2DYIA 2GTOA 2MOXA 3A8HB 4JLGA 2LT1A 2DZCA 2RHYA 4RTWA 1NJIU 1R8OB 2KVQG 2FZGB 3RBBB 1QVGA 2E70A 2JMAA 2PU9B 5CIUA 2CH4A 2J06A 3CMAT 4M7AE 2HEQA 3RESA 4BI8B 3MEAA 4F7UG 5IHNA 4ZN1A 1M90C 2VKNA 2E41A 2XI9A 2RHZA 3H9NA 1RUWA 1U1SA 3OYJA 1GBRA 1S72T 3MEWA 1TUCA 4ZTFA 3CCEA 5FU7C 2I2LA 3BFMA 4Z89A 3EH1A 1I81A 5EC7A 3UF4A 4BI4A 3I55A 1MGQA 3EG9A 2XIDA 2B8AA 4AT1B 2YDLA 5FWCA 1MNEA 2DJQA 4PKCC 5CR2A 2VC8A 2RJEA 2LNVA 3OYEA 2XDPA 3CCJT 3HRUA 1FMKA 2A37A 3FLGA 2EYWA 2MK5A 3CEYA 2LTOA 4DEXA 3RMQA 1PSEA 4OMMA 1M1GA 3CCMT 1MNDA 2XK0A 1VQPT 4JDSA 4N0AC 4RG2A 5GANh 2MYSA 3CBOA 3L42A 5FW9A 1U1TA 2YWWA 3VS2A 1H3ZA 3MO8A 1KC8C 1NBEB 1QWFA 2P0PA 1R0BG 3CPFA 5GAOm 2MMPA 2VB6A 4ZN3A 4BB7A 3QBYA 2X51A 4WCIA 1VQ9Q 4OGCA 2QTXA 3WVDB 3JCMh 4PLIA 3CMET 3VS5A 1WJSA 3JV3A 4M78E 2OTJQ 3H6ZA 1VQ4Q 2XHCA 3G4ST 2DZ9A 1YJ9Q 2FVUA 2VV5A 1WJQA 5GAOl 3E9FA 4OMLA 3V7SA 2J6FA 5IH2A 5FRNA 4FT4A 2RI3A 2E6ZA 1ZA2B 3NFCA 2CGHA 2DXTA 1YFNA 1HK9A 1QQJA 2E5QA 3OS1A 2R57A 2DBMA 2HD0A 1YITT 2CZ0B 1M30A 2KK4A 1RAAB 4E7SA 1OULA 2QEXQ 1ZSGA 3BE3A 4FSXA 4KH1B 4PJLA 4BACA 2LMJA 2KE9A 3EGDB 3M59A 1WHKA 1VQ9A 3OB9A 3CCUT 3VS4A 1YP5A 2P4RA 3DLLA 4HT8A 1IGQA 2FEIA 3GPLA 4PJOA 2RK1A 1N9SA 2BKDN 4KUIA 3M0QA 3CPWS 3OA6A 3J80E 2OTJA 5GANg 1Q7YU 1GCPA 3PNWC 1UGSB 3PVLA 1VQ4A 2QQRA 2YRCA 2L3QA 3PFSA 4HVVA 1YJ9A 5CQYA 3TVTA 1KQSP 2QG9B 4O5VA 4BY6C 4Z8AA 3M0PA 5GANf 1BI1A 1KD1U 4KULA 4HVUA 2QQ9A 1Q86U 3CC4T 3JCMX 3CCQT 4FYYB 1M3BA 2RN8A 2DL7A 3JB9G 3S6WA 4V2SA 3KXTA 2F5TX 4XU3A 3JCMb 1TSFA 1VUBA 1SKUB 4J9CA 4ORZA 3JCMg 4BE2A 1WLPB 2QEXA 1PSFA 2RD1A 7AT1B 1BBZA 1WX6A 1W2BP 1JU5C 1ABOA 1M9SA 4RG8A 4M7DF 3JCMf 2EFIA 4C8QE 3OS2A 4Z02A 3O5ZA 5GMKj 2BTTA 4BE1A 4FYXB 3UA7A 4PK4A 4EMKC 3SWNB 2IG0A 2J7IA 4XTZA 5A0LA 4VUBA 3X25B 4GY5A 5A0DA 3QDRB 2X9HA 3LGLA 1T0HA 2QDLA 2JNGA 1M90U 1UG1A 2EKHA 2DE0X 3OW2P 3KFVA 4DBHA 3A1PA 3GBQA 5KCOA 4HVWA 5CQXA 3A8GB 1K8AC 1VQ8T 3VS7A 1Q82R 2ESWA 4M78B 4C5IA 1WHHA 5DLQE 1YJWT 1NE8A 4IUVA 5AYFA 1ZUYA 2ZPHB 3FDRA 2DETA 5D6WA 1K0SA 2LRQA 3QJ6A 5KYUA 3AT1B 1QKXA 1SRLA 2DVJA 4DEYA 2EGEA 1RL2A 3I56T 3PMIA 2DEQA 3SDZA 4AFQC 4M7AF 3EG0A 2SRCA 1SEMA 1XNIA 2K5IA 3VS6A 4D8DA 3JCMc 1IB8A 2PVOB 1Q7YR 5I2SA 2VYTA 2DBKA 4M77F 1MMDA 1AWXA 5LJ3h 1KC8U 2FO0A 3M5AA 3THKA 4ZGJB 1KQSS 4PL6A 5FROA 4RTTA 2DEUA 1U3OA 1KD1R 2ECZA 3G7ZA 2DTOA 1M3CA 1Q86R 2KI7A 4N4HA 2EVRA 3PTAA 4MMKA 2DA9A 2ZGWA 2CSIA 3NHNA 3GLXA 4JS4A 3HPWA 1R77A 3N5BB 2K2VA 4LDUA 4F17A 1JBMA 5LJ5h 1IRXA 1N5ZA 4A4EA 2RI2A 4N4IA 1QMCA 2LC4A 3NMZC 2DXCA 4PNOA 1VQLQ 4RTZA 1KQ1A 4M7AD 2E3IA 2RJFA 4E2FB 2L2PA 5GMKe 4OB0B 2K3BA 2NUTA 2D8JA 4Y91A 5KE2A 2JMCA 2D0QB 4XU0A 2GQIA 4X9CA 1ZBJA 4M77D 5KYWB 3M0TA 4MZTA 3RR6A 3M57A 2X3XD 3CC2Q 2R58A 4J7FA 4FCYA 2CP0A 5GAN7 3OSSC 1KHCA 1TWBA 4C8QB 1M90R 1RAFB 3OW2S 1ZUUA 1QP3A 3M54A 5CO7A 5AT1B 4QVCA 2F2WA 1D3BA 1CSKA 3MPUB 4MZMA 5FRMA 4N0AA 4JUVA 1VOMA 4CC4B 3CBPA 4JJNK 4KRTA 4BDZA 4A63B 2QGFB 2EGCA 3H0HA 1QVGP 1ABQA 4J83A 3VS1A 1E6GA 1FMWA 3OYLA 1M3AA 2DTHA 1X01A 2EIFA 1VQLA 1VQ5T 1FWZA 2E65A 2VGMA 5LJ3g 2RM4A 2L8DA 2O01E 3A98A 4J9GA 4A54A 2QQAA 2VXFA 1UECA 3VUBA 1B07A 5GJVB 2Y90A 1B34B 4XU1A 1JJ2A 5GAN8 3RNJA 4DOWA 2D1XA 5LJ3f 4C92F 1KK7A 2YUQA 3CC2A 4FW1A 4QW2A 4R0KA 2E4HA 2LJ3A 2XKOC 5GAOq 1JRIA 2RQVA 2M1HA 2QDYB 4M78G 1T0JA 3NTIA 2DILA 1TU0B 4JRQA 4RCCA 1KC8R 5LJ5f 2FPFA 1Q82C 2RHIA 4M7DC 4DQ2A 2YUOA 3OS5A 4OMFB 1VQKT 2CKKA 3S3OA 4QQDA 2LZ6B 4PJOE 1JXMA 2KYMA 2O31A 4J9IA 2P0QA 2Y4XA 1Y7XA 5CAIA 4C5HA 2O4XA 4Q5WA 3LGFA 3JB9H 2DXBA 3OY9A 2COWA 1YHQQ 1X6BA 3QWXX 5A0GA 2COYA 3CCRT 1WQWA 3EG9B 3JAME 1VQ7T 3V8LA 4C92D 1VQMQ 2XICA 1TS9A 5GANd 2PQWA 1SSHA 3LWHA 1H8KA 1G5VA 4II1A 2QYZA 4HA8A 4AMCA 5GAN6 1K8AU 4M75F 2ZCFB 2YHTA 1Q7YC 4XTVA 3GOXA 2DL4A 4E7KA 4AG1C 5CCAA 5GAN2 1FMVA 3OYBA 1QVFA 3CXCA 3G71Q 5ECAA 2AHJB 4WTOB 3MP6A 4ELYC 3OYGA 1MMGA 2DX1A 1K73U 1WNLA 4PFZA 3EGUA 2K5LA 3JCMd 3M4YA 1D1BA 1PWTA 2AK5A 3QZ5B 1X43A 4F7UF 2E10A 3SD4A 1WIEA 1WHJA 3PIOA 3KBGA 3M55A 4RTUA 5IHKA 3QDFA 4M7AC 5GANj 2XD0A 3JCMV 1AEYA 3IQLA 1QVGS 2A08A 8AT1B 1VYUA 1YHQA 1Y96A 5FLXE 3WVEB 1V29B 3RUXA 1M8VA 3RKXA 2X3WD 4M77C 3VRYA 1RI9A 3UATA 1VQMA 2RA2A 4M75D 3CCET 2CUBA 4D8KA 2WSEE 2E3HA 4KGZB 4RTXA 5KYXA 4C8QG 1VQ6Q 3I55T 2D0NA 1LPLA 1AHJB 1I4K1 4Y92A 5GAOn 1G3YA 2MIOA 1X2QA 2E12A 4C8QD 1HXDA 2KY9A 1BIBA 4NOYA 4UC4A 5J26A 2DFUA 2FB7A 5GAN5 3G71A 1UJYA 2CP5A 4JPBW 1UGQB 1WXTA 3X20B 2WSCE 1G3WA 3DKMA 2DXUA 2G3RA 2MPXC 4PJNA 3R6NA 1RACB 1RLPC 2DRMA 2F2VA 5I2MA 3NPFA 3PT9A 1X2KA 2ZPGB 3I5RA 1M27C 1Y07A 2M0YA 2LJ0A 2M0OA 3G1JA 2AIRB 3A5ZB 2LNHB 2O9SA 1QCNA 1AWOA 5CVIA 4C0DC 2KEAA 1K76A 5CKBA 2RJCA 2DIGA 2ED0A 2LJ1A 2GTJA 4PJOB 3REAB 2EQJA 1OPLA 1ACMB 3E19A 1EX4A 1VA7A 4J9HA 5HK3A 1VQ6A 3FB9A 2K7AA 3TREA 1OPKA 3AHUA 1QCOA 2K79A 2M9UA 3BDLA 2EWNA 3CD6Q 1K8AR 3HP9A 1N9RA 3I9QA 3VU3C 2J05A 1RAEB 1I0CA 3JRZA 5DLOA 5IAYA 1ZSZC 2DD4A 4A4KA 2CP3A 1D1CA 4LD6A 2C06A 2BE7D 2QQBA 2DLPA 3HRSA 5FU6B 1NG2A 2EQIA 3M56A 2H3EB 1D0XA 2LCSA 1K73R 4ZGEB 3CCVQ 3QYHB 4ZNXA 3MJXA 4EDUA 5GANe 1TXQA 4C92C 3E1SA 2B86A 2LCLA 2VUBA 4B9WA 4X1VA 1FYNA 2K3XA 2DNUA 2FZKB 2RNAA 3MEVA 1YWPA 3CC7Q 4R55A 1G3SA 1VQ9T 2ROLA 1RAIB 2BIVA 1Q82U 3CD6A 2ED1A 4J9DA 3JCMe 1LJOA 1OU8A 2QGGA 1U8RA 4JJCA 4OMQA 2DRKA 3EFSA 1VQ4T 1WXBA 1YJ9T 1BYMA 2KQWA 3OYHA 1VQOQ 2DK3A 3QHSA 5KH6A 2KRSA 2V1RA 2NLUA 2L3SA 1YCYA 4LUDA 4E7LA 2A3LA 2K3YA 2IVWA 3CCVA 4JZ3A 4BUGA 1V76A 2MF2A 1YIJQ 1OX8A 2XU8A 1D0YA 4M75C 5LJ3d 3J7AF 2ZAEA 5KYUB 1G83A 4OB1B 1PCXA 3R6OA 9ATCB 2CS7A 1OEBA 2QEXT 4BD3A 4KGXB 1GBQA 3OQ5A 1BU1A 3CC7A 2HBWA 2CDTA 2AKLA 5D6XA 2ATCB 2EAYA 2KR3A 1HD3A 4P5NA 3URGA 3SFMA 2X4XA 4Y28E 3G6EQ 2LQKA 3C4SA 2FRWA 1QCFA 2QTVA 2GNCA 2C0IA 2HMAA 1VQOA 1A0NB 3JB9D 2D9TA 5LJ3j 4ZGDB 1WFWA 3ZL7C 4M7DA 3CPWA 1U06A 2A0FB 5GAN4 2JOYA 4ZTJA 1QVPA 4BE0A 1XTDA 4FU6A 4M4ZA 1YIJA 3SHWA 4QKUA 2DL3A 2PVDB 1WXUA 3DLMA 4XK8E 1R0CB 1C1AA 1P92A 4PJOG 2J6OA 8ATCB 1IHVA 3H0IA 5FU7B 4DBQA 2MCNA 2DD5A 1PKSA 4RMOA 2CZ6B 4FL6A 3UWNA 2GFUA 2JM9A 2NUTB 2LQ8A 3UPUA 1NEBA 2DO3A 3P8DA 1K4US 1AVZC 1LNXA 2WACA 2K9GA 3TQ7P 1QKWA 1JXOA 3INZA 3VUZA 2KGTA 3M58A 2QK0A 1UEBA 2V1QA 2YRDA 1TG0A 2YT6A 2LVMA 3G6EA 4PJJA 1G2BA 2FPEA 3UT1A 3VYHB 1ZBXA 1PD1A 3QJYA 2DAQA 1KHIA 1UE9A 2BUDA 3H41A 1K9MC 2CT4A 1ZLMA 3OYCA 1NYGA 1D3BB 2NUPA 3L2RA 1SPKA 1UGVA 2JN0A 3OS0A 1K73C 4M7DG 2OAWA 2VWFA 4ME7A 4JS5A 2K5FA 1VQNQ 3M0RA 4J6WA 4M7AA 3RKWA 1M5Q1 4XTWA 3EHQA 2ZZDA 4OB2B 2X4WA 3ZBDA 3OBWA 2E6NA 4GLKA 2EQKA 2HDAA 4A4GA 3LX7A 4M77A 3C0CA 1D1AA 2JS2A 4MDWA 5D6YA 2JJ9A 1NYFA 2M02A 3UA6A 4OVAA 1I5LA 1I5OB 3ER0A 2AZVA 2K57A 5GAN3 4WF2A 2SEMA 4MMLA 2FZCB 2MI6A 1N8RC 1YI2Q 3MP1A 1PC0A 3CCSQ 2EBPA 2XDDA 1BKBA 4CC7A 5GMKm 1UHFA 2CSQA 5LJ3e 4JRIA 4EPCA 2QAZA 1W2BS 2PUOB 1M2VB 4GLMA 1YCSB 2L5QA 1VQNA 1QVFP 3CXCP 3L2QA 2O4XB 1XJWB 3A8LB 2YSQA 1LOJA 2RF0A 1KQSA 1N27A 3QWYA 2J6KA 2RMOA 3CCLQ 1OX9A 1S1NA 4IIMA 1VIEA 1HYOA 3VYGA 3QO3A 3MP8A 2PVGB 4IURA 4LE9A 1VQLT 3VV0A 5GMKl 1SHFA 3V8KA 3JCMP 1Q81R 2VXEA 3VS3A 1YJNQ 1X75C 3BDUA 2MAMA 2RQWA 5KYYA 2KDSA 5GAMh 3TCJA 3OMCA 4RTVA 1RI0A 5L8RE 2O2OA 4BY6B 2HZYA 1YI2A 1WI7A 1WYXA 2JVVA 1ZSZA 1VIFA 3CCSA 4M78F 3HFOA 2DPPB 1AZEA 3E9GA 1I8FA 2GCXA 4C5EA 1OZ2A 3LLRA 3FEOA 2W0ZA 2Y4YA 1GXIE 1QW1A 4E7IA 1AWWA 2CZ1B 1PKTA 2L3PA 2OTLQ 3X26B 2XDBA 1YNZA 1EFNA 4F16A
chains in the Genus database with same CATH topology
4IUPA 3NFCA 4LDYA 2CGHA 3I55T 2DXTA 3ME9A 4C92A 1X6OA 3OW2A 1AHJB 1DJ7B 1I4K1 3TEEA 3CCLA 1Y96B 1HK9A 5GAOn 4M7DD 1G3YA 2E5QA 3OS1A 1ZHIA 2R57A 1OZ3A 2HD0A 2E12A 4C8QD 1YITT 1HXDA 2CZ0B 2KY9A 1BIBA 4NOYA 3LH0A 1H641 4UC4A 4IKFA 2GF7A 3QXEB 2KK4A 4FIBA 1O75A 5J26A 4J5YA 5HKCA 3J81E 2QQSA 4EMKB 2RHUA 2FB7A 5LJ5g 5GAN5 3G71A 4LDWA 1UGQB 1W4SA 3GNGA 4FSXA 3X20B 2WSCE 1G3WA 2RK2A 3C12A 4BACA 3M59A 3DKMA 1YJNA 1XOVA 1NJIU 2DXUA 1VQ9A 4O6JA 2G3RA 3FIFA 3OB9A 5EG2A 3CCUT 1QVFA 4C92B 2EJ9A 5A2QE 1VQ8A 3QZ9B 3V8JA 5M9OA 3DLLA 4HT8A 1VQNT 5CKEA 4M78D 5I2MA 3GPLA 4JRKA 4PJOA 3PT9A 3OYMA 2ZPGB 2RK1A 1N9SA 2BKDN 2QXFA 1Y07A 4KUIA 3MHXA 1YJWA 2M0OA 3CPWS 3OA6A 3OYKA 3J80E 3HRTA 1EIFA 3OYFA 3A5ZB 2OTJA 5GANg 1Q7YU 3PNWC 1UGSB 4HCZA 3LW5E 3M9QA 1VQ4A 2QQRA 3OYDA 1YJ9A 3PFSA 3GIBA 3HL8A 2YRVA 5CQYA 5CVIA 4LDVA 2ZPEB 4C0DC 3L2UA 3BY7A 2YLBA 4O5VA 4BY6C 1NJIC 5CKBA 2HBPA 2HQXA 2RJCA 2JTFA 2DIGA 4MZPA 3T9NA 1OI1A 4C0GA 2OTLA 5GANf 2X4JA 1BI1A 1JB0E 1KD1U 4PJOB 5GMKh 2EQJA 4KULA 3I56A 2QQ9A 2EKOA 1Q86U 3CC4T 3E19A 3JCMX 3CCQT 1M1KC 5HK3A 1VQ6A 3FB9A 4QQ6A 3TREA 1QVFS 3AHUA 5DM7R 5GAMg 2D6FA 5J3BA 2M9UA 3BDLA 2EWNA 3JB9G 4M75A 3S6WA 3F70A 4V2SA 3KXTA 4HCBA 4HT9A 3HP9A 4M7AG 4FM4B 4XU2A 1YI2T 2F5TX 1N9RA 4XAXB 4XU3A 3V7CA 3SWNA 3VU3C 1VUBA 3JCMb 5CKFA 4OB3B 3JCMg 3OYAA 5LJ5e 4EMGA 3JRZA 5GAMf 3CCST 5DLOA 4BE2A 4KBMB 5IAYA 2QEXA 1PSFA 2RD1A 2DD4A 4A4KA 1YHQT 4LD6A 2C06A 3VKIA 3JCMW 4A4HA 3ZFJA 3HKSA 4M77G 2QQBA 1M9SA 4RG8A 3HRSA 1K9MU 1BI0A 4TVRA 3JCMf 2EFIA 4A53A 1VQLT 4M7DF 5FU6B 4C8QE 4C8QF 3OS2A 1SSFA 4M75B 4Z02A 5GMKj 1KQ2A 3M56A 4BE1A 2ZPIB 4HKEA 4J7IA 4EMKC 2P4TA 3SWNB 1WQ7A 4F7UA 4ZGEB 3QYHB 2IG0A 3V7RA 4R56A 4XTZA 3QKJA 4IUTA 4EDUA 5A0LA 1UGRB 5GANe 2JTMA 3CCLT 3P8HA 2MWPA 4VUBA 3X25B 4C92C 2R5AA 1W2BA 4LD9K 2L3RA 2A7YA 3E1SA 4GY5A 4M78A 5A0DA 3QDRB 2LCCA 3CC2T 2CYZB 3LGLA 2LCLA 2VUBA 4J8OA 4B9WA 3RERA 2JNGA 2X4YA 2RJDA 1M90U 3JCMJ 1JJ2S 4QQGA 2K3XA 3DB3A 3G71T 3L2ZA 5KCOA 1FX7A 5I21A 3C95A 3MEVA 1UGPB 4F7UB 5CKDA 5CQXA 1YJNT 4JRPA 4R55A 1G3SA 5C0MA 3GF5A 1VQ9T 2YLCA 5GAMe 4KT0E 4EMKA 3A8GB 1K8AC 3MEUA 1VQ8T 3L2VA 2BIVA 1BI3A 4M7DE 3ASKA 2FHDA 1Q82U 3CD6A 1NZ9A 3PGGA 4M78B 4C5IA 1O9SA 3META 4C0ZA 3JB9J 5DLQE 5GMKi 3JCMe 3Q1JA 1YJWT 4MDXA 4PJOC 1LJOA 2FYKA 3LYIA 1NE8A 4XQ3A 4IUVA 1U8RA 4NS5A 5AYFA 5GAOr 3BW1A 2ZPHB 1N8RU 3FDRA 3EFSA 3OYIA 1VQ4T 1Q81C 4RCBA 4L6V5 5D6WA 4E47A 1YJ9T 2KQWA 1BYMA 2KAFA 2E64A 3EAEA 3OYHA 2LRQA 2DK3A 2KSSA 3FJPA 3QHSA 3QPHA 2V8JA 1BIAA 3QJ6A 5KH6A 2DVEA 2NLUA 2OTLT 1YCYA 4HCCA 1RL2A 3I56T 4E7LA 2A3LA 2K3YA 2IVWA 3PMIA 2DEQA 3CCVA 4BUGA 1VQ6T 3SDZA 3HHTB 4M7AF 2MF2A 2QA4A 2PUKB 2X35A 3O8VA 3OYNA 1XNIA 1Y71A 2K5IA 3CC7T 3X28B 2XU8A 4J6XA 5FU6C 2VGNA 2EJFA 4M75C 3JB9I 5LJ3d 3FC3A 3A8MB 4EMHA 3J7AF 3JCMc 1YBYA 5GAOp 3EFRA 4OB1B 2PVOB 3SWNC 5I2SA 2VYTA 3R6OA 2CS7A 3NTKA 4M77E 4M77F 2V8IA 4RKUE 2QEXT 1VQ5A 4BD3A 2HQEA 2DIQA 1KG1A 4N4GA 5LJ3h 3OQ5A 4PLLA 1KC8U 3M53A 3M5AA 4ZGJB 1KQSS 4PL6A 5FROA 3CC7A 2LDMA 2CZ7B 5C6SA 4E7JA 1N6AA 3FRNA 4C5GA 3ZEHA 5D6XA 2EAYA 3G7ZA 2DTOA 5IT9E 2MWOA 3CMAA 4N4HA 3UDCA 3M4GA 3PTAA 4MMKA 3H8ZA 3NTHA 2ZGWA 3PMTA 4P5NA 3URGA 3GLXA 3SFMA 3CXCS 2X4XA 4JS4A 4JLIA 3HPWA 4Y28E 2LQKA 3N5BB 2K2VA 4LDUA 1JBMA 3QYGB 3JCMQ 3RMSA 5LJ5h 4DOVA 4C92G 3C4SA 1XQHA 2WSFE 4A4EA 2EQUA 2RI2A 4N4IA 2LC4A 4M78C 3JB9D 1VQOA 3TU4K 2D9TA 2DXCA 4PNOA 1S72A 5LJ3j 1KQ1A 5KE3A 4ZGDB 1IREB 4M7AD 2L89A 2RJFA 4M7DA 2LT4A 3CPWA 3LWIA 3RKYA 5GAN4 2JOYA 4C8QA 1QVPA 4ZTJA 5GMKe 2RB6A 4BE0A 4OB0B 1VQKA 1VQMT 1XTDA 4Y91A 2F69A 4FU6A 2RH2A 5KE2A 4E7HA 2D0QB 4XU0A 1YIJA 4X9CA 3RIRA 2JZ2A 4X9DA 4QVZA 1QP2A 3CD6T 2PVDB 2RI5A 3DLMA 4M77D 4XK8E 2DTIA 2EQMA 4MZTA 4XTXA 3M57A 1P92A 3QSUA 4PJOG 2R58A 3CBMA 4J7FA 5FU7B 2HNIA 3WXMB 2GQVA 4M7DB 2DD5A 5GAN7 3CCJA 3SB2A 4NL3A 1M4ZA 3OSSC 1KHCA 4RMOA 1TH7A 4C8QB 2CZ6B 2F5KA 4FL6A 4OF1A 3UWNA 2GFUA 3CCRA 1KD1C 2LQ8A 2M16A 2ZPBB 3L2WA 3DB4A 3HFNA 3OW2S 5HY6A 3UPUA 2DO3A 3P8DA 1Q86C 1VQ7A 4B9XA 1QP3A 3M54A 1LNXA 2XG8D 2WACA 2FL7A 5CO7A 4DA4A 3A8OB 4QVCA 3L1AA 3X24B 1D3BA 3INZA 4MZMA 3VUZA 5FRMA 3M58A 4N0AA 3CCMA 3QG1A 4JUVA 4IUUA 2V8KA 1UEBA 4XTUA 4BI3A 3CBPA 3CCVT 1VQPA 2KMTA 3OSVA 3C94A 3P8BB 4JJNK 4CI0C 2LVMA 1FXXA 3G6EA 2QA4T 1IZ6A 4BDZA 1B34A 1WGSA 4A4FA 4X34A 3QUIA 3UT1A 4M75G 3VYHB 4J83A 1ZBXA 1G3TA 5CK9A 3OYLA 3QJYA 2DTHA 1X01A 2DAQA 1KHIA 4CRIA 4BDYA 2BUDA 4OP0A 2OTJT 1K9MC 2EIFA 1VQLA 3A8HB 1VQ5T 4JLGA 1FWZA 3OYCA 1D3BB 3L2RA 2E65A 2JN0A 2VGMA 2LT1A 5LJ3g 2DZCA 2RHYA 2L8DA 2O01E 1WPYA 2RM4A 3OS0A 4A54A 3S3MA 1K73C 2QQAA 2VXFA 4M7DG 2OAUA 4ME7A 4JS5A 5LL6S 1R8OB 2KVQG 3VUBA 1NPPA 2K5FA 1QVGA 2E70A 2Y90A 1B34B 2PU9B 4XU1A 5CIUA 1JJ2A 4J6WA 3CMAT 4M7AA 3RKWA 1M5Q1 5GAN8 3JB9F 4XTWA 4DOWA 4C92E 5LJ3f 4C92F 5DY9A 1M1KU 4M7AE 3RESA 4BI8B 3MEAA 3CC2A 4F7UG 2DJZA 3PIPA 3CMEA 2GFAA 2ZZDA 2X4WA 3KUFA 4OB2B 3OBWA 4QW2A 1WJRA 2E6NA 3ZBDA 4GLKA 2EQKA 1M90C 2E1HA 2E41A 4A4GA 3LX7A 2XI9A 2XKOC 2RHZA 5GAOq 1JRIA 3G4SA 4M77A 2M1HA 2QDYB 1U1SA 3OYJA 4M78G 1OYXA 3NTIA 4LDXA 1VQOT 4MDWA 5D6YA 1S72T 5HK0A 4JRQA 4RCCA 3MEWA 4ZTFA 3HSBA 3CCEA 4M7AB 4OVAA 5FU7C 2I2LA 3BFMA 5LJ5f 3JSCA 1Q82C 1I81A 1I5LA 2RHIA 4YTLA 2K4YA 4M7DC 4DQ2A 3ER0A 3OS5A 3OYYA 4OMFB 1VQKT 4C8QC 2H3JA 2K57A 2R5MA 2CKKA 4BI4A 3I55A 3S3OA 1MGQA 2XIDA 2B8AA 4QQDA 5GAN3 4KUDK 4WF2A 1YIJT 4PJOE 4PJOF 5LJ5d 4MMLA 4NL2A 2MI6A 2P0QA 2Y4XA 4M77B 1N8RC 1YITA 1Y7XA 5CAIA 4PKCC 4C5HA 5CR2A 2O4XA 3MP1A 2VC8A 4Q5WA 2RJEA 2LNVA 3LGFA 3OYEA 2XDPA 1UB4A 2XDDA 4J6YA 3CCJT 3JB9H 2DXBA 3OY9A 2QI2A 3HRUA 1BKBA 4ELZC 5GMKm 5A0GA 2HAXA 5LJ3e 4JRIA 1WQWA 3CCRT 5CKHA 3FLGA 3CCUA 3JAME 4EPCA 1VQ7T 3V8LA 4C92D 1W2BS 2PUOB 2XICA 2L5QA 4L5GA 4ATOA 1VQNA 3CEYA 5GANd 2LTOA 2PQWA 3RMQA 1PSEA 3LWHA 1G5VA 1M1GA 3L2QA 2O4XB 4II1A 3CCMT 4HA8A 3OMGA 3A8LB 2XK0A 1LOJA 3S3NA 4C0FA 5GAN6 4M75E 4JDSA 1N27A 4M75F 1VQPT 4N0AC 4RG2A 1K8AU 2ZCFB 5IN1A 1KQSA 3G6ET 5GANh 3CBOA 2EYQA 3L42A 2YHTA 1Q7YC 1U1TA 4ZN1A 1VIEA 4XTVA 3VJPA 4FT2A 3VYGA 3GOXA 4E7KA 1H3ZA 3MO8A 5LJ5j 1KC8C 3QO3A 3MP8A 5CCAA 2PVGB 1NPRA 5GAN2 2P0PA 5KCHA 4IURA 5J39A 2LX9A 4QVDA 3CPFA 2JUFA 3VV0A 5GMKl 2MMPA 5GAMd 3V8KA 2AHJB 5GAOm 3OYBA 3CXCA 3JCMP 2ZPFB 1Q81U 1MHNA 2VXEA 2DKGA 3MP6A 4PJOD 4ZN3A 4ELYC 1X75C 4BB7A 3OYGA 3BDUA 3QBYA 2RHXA 2MAMA 2RO0A 3CC4A 3CCQA 3OBYA 4L59A 2KDSA 1WNLA 5GAMh 4OGCA 4XTYA 1K73U 2QTXA 2K5LA 3JCMd 3TCJA 3M4YA 3WVDB 3OMCA 3QZ5B 4F7UF 4F7UE 1RI0A 4D6WA 5L8RE 4IUQA 2E10A 3SD4A 4C0DB 4BY6B 3QIIA 3PIOA 1YI2A 3KBGA 3M55A 4M7AC 3JCMh 5GANj 2JVVA 3MCAB 4PLIA 3CMET 3JCMV 3GP8A 2XD0A 1VIFA 1WJSA 1QVGS 3CCSA 4M78E 4M78F 3HFOA 3H6ZA 2DPPB 3E9GA 1I8FA 2GCXA 2XHCA 4C5EA 3G4ST 1YHQA 2DZ9A 1Y96A 5FLXE 1OZ2A 3LLRA 3WVEB 2FVUA 3FEOA 1V29B 3RUXA 2Y4YA 1M8VA 2VV5A 3RKXA 1WJQA 5GAOl 1GXIE 4M77C 1QW1A 4E7IA 2CZ1B 3E9FA 1VQMA 2RA2A 2EJGA 3V7SA 4M75D 3CCET 1M1FA 3X26B 2XDBA 2WSEE 1ZQ1A 4OGEA 5FRNA 1BI2A 3GNFB 4FT4A 2RI3A 2E6ZA 5GAMj 2P0KA 4C8QG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7A B;  4C92 C;  2CGH A;  2I2L A;  3BFM A;  2DXT A;  4M78 C;  5LJ5 f;  3JB9 D;  1I81 A;  4PNO A;  4C92 A;  1I5L A;  4M78 A;  5LJ3 j;  4M7D C;  1KQ1 A;  4DQ2 A;  4M7A D;  3RER A;  1I4K 1;  4C8Q C;  2K57 A;  4M7D A;  1Y96 B;  1HK9 A;  3RKY A;  5GAN 4;  1MGQ A;  5GAO n;  4C8Q A;  5GAN 3;  3JCM J;  4M7D D;  4WF2 A;  4C8Q D;  5GMK e;  4PJO E;  1HXD A;  2RB6 A;  4PJO F;  1BIB A;  4NOY A;  5LJ5 d;  1H64 1;  4MML A;  3L2Z A;  4Y91 A;  4J5Y A;  5I21 A;  4NL2 A;  4M77 B;  4F7U B;  4XU0 A;  4EMK B;  5LJ5 g;  2FB7 A;  4X9C A;  5CAI A;  3RIR A;  5GAN 5;  4X9D A;  2YLC A;  2VC8 A;  5GAM e;  4M77 D;  4EMK A;  2DTI A;  4J6Y A;  3QSU A;  4XTX A;  3JB9 H;  2DXU A;  4PJO G;  3FIF A;  3PGG A;  4C92 B;  5GMK m;  4M78 B;  2EJ9 A;  2HNI A;  5LJ3 e;  4JRI A;  1WQW A;  3V8J A;  4M7D B;  5GAN 7;  4HT8 A;  3SB2 A;  4NL3 A;  3JB9 J;  5GMK i;  3JCM e;  1TH7 A;  4C8Q B;  3V8L A;  1LJO A;  4M78 D;  4C92 D;  4PJO C;  2FYK A;  4JRK A;  4XQ3 A;  4PJO A;  1N9S A;  3BW1 A;  3HFN A;  5GAO r;  5GAN d;  3EFS A;  4RCB A;  1LNX A;  4HA8 A;  2E64 A;  1LOJ A;  4QVC A;  3L1A A;  3QHS A;  5GAN 6;  3FJP A;  4M75 E;  4M75 F;  5GAN g;  1BIA A;  4N0A C;  1D3B A;  3INZ A;  2DVE A;  5GAN h;  4N0A A;  3GIB A;  4JUV A;  4XTU A;  2YHT A;  1YCY A;  1U1T A;  3BY7 A;  2YLB A;  4XTV A;  4M7D G;  5LJ5 j;  3QO3 A;  2DEQ A;  5GAN 2;  5GAN f;  1B34 A;  4PJO B;  4M7A F;  3QUI A;  4M75 G;  5GMK h;  4QVD A;  5GAM d;  5GMK l;  5GAO m;  3V8K A;  3JCM P;  3JCM X;  2DTH A;  2VXE A;  1X01 A;  2DKG A;  4J6X A;  3FB9 A;  4PJO D;  4OP0 A;  3AHU A;  3BDU A;  5GAM g;  2EJF A;  4M75 C;  3JB9 I;  5LJ3 d;  2EWN A;  4EMH A;  3JB9 G;  4M75 A;  3JCM c;  1WNL A;  5GAM h;  1D3B B;  4XTY A;  5GAO p;  2QTX A;  3EFR A;  2E65 A;  2JN0 A;  3JCM d;  4V2S A;  3SWN C;  4HT9 A;  4M7A G;  5LJ3 g;  4XU2 A;  2DZC A;  1N9R A;  2RM4 A;  4M77 F;  4M77 E;  1WPY A;  4XU3 A;  3SWN A;  3V7C A;  3VU3 C;  4A54 A;  4F7U F;  2VXF A;  4F7U E;  2E10 A;  5LJ3 h;  3JCM g;  5LJ5 e;  4EMG A;  5GAM f;  4M7A C;  2Y90 A;  1B34 B;  3JCM h;  4XU1 A;  5GAN j;  2RD1 A;  4J6W A;  3JCM b;  3RKW A;  1M5Q 1;  3JCM V;  5GAN 8;  3JB9 F;  4M7A A;  4XTW A;  4C92 E;  5LJ3 f;  4M78 E;  4M78 F;  2EAY A;  3HFO A;  2DTO A;  5DY9 A;  4C92 F;  3JCM W;  3RES A;  4M7A E;  1I8F A;  4M77 G;  4M7D E;  4F7U G;  2DJZ A;  4M7D F;  3M4G A;  2DZ9 A;  3JCM f;  1Y96 A;  4MMK A;  4A53 A;  3JCM Q;  4C8Q E;  4C8Q F;  2ZGW A;  4M75 B;  5GMK j;  3RUX A;  1KQ2 A;  2E1H A;  2E41 A;  1M8V A;  3RKX A;  5GAN e;  5GAO l;  4JLI A;  1JRI A;  4M77 C;  5GAO q;  4EMK C;  2RA2 A;  2EJG A;  1JBM A;  1WQ7 A;  4M75 D;  4M77 A;  3SWN B;  1U1S A;  3V7S A;  4C92 G;  4F7U A;  4M78 G;  5LJ5 h;  3V7R A;  4XTZ A;  5GAM j;  4RCC A;  3HSB A;  4C8Q G; 
#chains in the Genus database with same CATH topology
 4LDY A;  2PTK A;  2DF6 A;  3ME9 A;  4C92 A;  1Z9Q A;  3OW2 A;  2OI3 A;  3TEE A;  1DJ7 B;  3CCL A;  1Y96 B;  2KBT A;  1ZHI A;  1WDX A;  4IKF A;  3LH0 A;  1H64 1;  1IXD A;  4FIB A;  1O75 A;  5HKC A;  4PFP A;  4EMK B;  5LJ5 g;  4LDW A;  2AKK A;  1D09 B;  3C12 A;  5KYX B;  1YJN A;  4PFO A;  1W70 A;  3QZ9 B;  3V8J A;  5M9O A;  1K1Z A;  2RQT A;  1AT1 B;  5CKE A;  4M78 D;  4JRK A;  1OV3 A;  1WHG A;  3MHX A;  1M2V A;  1JEG A;  1G8X A;  2VVK A;  3OYF A;  2G6F X;  4HCZ A;  1NLO C;  3GIB A;  4LDV A;  2ZPE B;  3BY7 A;  1RAG B;  1GRI A;  4ANJ A;  2JTF A;  4C0G A;  2OTL A;  1OI1 A;  2X4J A;  1JB0 E;  1WHM A;  1M1K C;  1J3T A;  4QQ6 A;  1QVF S;  5DM7 R;  5GAM g;  4CC2 A;  2D6F A;  1SRM A;  4M75 A;  3M0U A;  2L0A A;  1MMN A;  4HCB A;  4FM4 B;  4XU2 A;  2KRN A;  1AZG B;  2RQR A;  4EMG A;  5GAM f;  4LUE A;  4KBM B;  2CP2 A;  2O9V A;  1YHQ T;  1W6X A;  1K9A A;  3VKI A;  3JCM W;  4A4H A;  1CKA A;  3HKS A;  1K9M U;  4M7D E;  4A53 A;  4C8Q F;  2NWM A;  1SSF A;  2M51 A;  1X27 A;  2ZPI B;  4HKE A;  4J7I A;  1M2O A;  1WQ7 A;  4F7U A;  1AOJ A;  2YUN A;  2QA4 Q;  1UJ0 A;  2KRM A;  1UGR B;  2MWP A;  2L3R A;  2A7Y A;  3MKD A;  2IIM A;  1C0M A;  2CH4 W;  1TUD A;  5I11 A;  4OMN A;  2X4Y A;  1T3S A;  2RJD A;  5IXB A;  1WZO A;  2KRO A;  3G71 T;  3FJ5 A;  1FX7 A;  2LX7 A;  5I21 A;  3C95 A;  1PG5 B;  1UGP B;  2BE9 B;  2QAS A;  2YLC A;  4EMK A;  3I55 Q;  4OMO A;  1RLQ C;  2KT8 A;  3ASK A;  3CMA Q;  3I5S A;  1LCK A;  1F1B B;  1O9S A;  1UDL A;  3MET A;  1ZX6 A;  4C0Z A;  3JB9 J;  5GMK i;  2KXC A;  2FYK A;  2VAS A;  1Z9Z A;  4JZ4 A;  4NS5 A;  5GAO r;  4FYV B;  1N8R U;  3OYI A;  1Q81 C;  4L6V 5;  2KAF A;  2E64 A;  3EAE A;  3QPH A;  2JS0 A;  2BZ8 A;  2V8J A;  1BIA A;  1S72 Q;  2DVE A;  1RAB B;  4J9E A;  2GBQ A;  3EGX A;  1PD0 A;  1VQ6 T;  3HHT B;  2FRY A;  2QA4 A;  3OYN A;  3X28 B;  2JW4 A;  1B3Q A;  3A8M B;  4EMH A;  4F14 A;  5GAO p;  1YBY A;  1ARK A;  3EFR A;  2W10 A;  3SWN C;  1PM3 A;  3CCJ Q;  4M77 E;  3RDV A;  2V8I A;  2HQE A;  2DL8 A;  2I0N A;  2LDM A;  5C6S A;  2ENM A;  4C5G A;  4Z88 A;  3ZEH A;  4FW2 A;  2MWO A;  3CMA A;  3UDC A;  3M4G A;  3H8Z A;  3CPW P;  3CCM Q;  3TSW A;  2AT1 B;  1VQP Q;  3QYG B;  1X6G A;  3RMS A;  2C0O A;  2HKN A;  4E6R A;  2YXY A;  1MUZ A;  4M78 C;  1S72 A;  5KE3 A;  2L89 A;  3RKY A;  1K9M R;  3EFO A;  2Z0W A;  2K2M A;  1Y57 A;  2RH2 A;  4E7H A;  3PE0 A;  3RIR A;  4X9D A;  4EIK A;  3CD6 T;  2RI5 A;  2EQM A;  1IO6 A;  1AWJ A;  1ZUK A;  4XTX A;  3QSU A;  2D8H A;  3CME Q;  4M7D B;  3CCJ A;  4NL3 A;  5HCK A;  3G4S Q;  1TH7 A;  4OF1 A;  2M16 A;  2ZPB B;  3L2W A;  3DB4 A;  5HY6 A;  4QT7 A;  2XG8 D;  4DA4 A;  2DMO A;  1GFD A;  3L1A A;  1SF9 A;  2COZ A;  3CCM A;  3QG1 A;  4XTU A;  4IUU A;  2V8K A;  4BI3 A;  3CCV T;  1VQP A;  4J9B A;  4LNP A;  4CI0 C;  1TUG B;  1HSQ A;  1YIT Q;  5CK9 A;  1N8R R;  4IIO A;  4OP0 A;  2OTJ T;  3SEM A;  1NJI R;  3CC7 T;  2BZX A;  1WPY A;  3CCU Q;  3S3M A;  1PRL C;  2OAU A;  5LL6 S;  1EZZ B;  1NPP A;  3EHR A;  3JB9 F;  1PHT A;  4C92 E;  1M1K U;  4KH0 B;  5DY9 A;  2RPN A;  3PIP A;  1VYT A;  2DJZ A;  3CME A;  1GCQ C;  2GFA A;  3KUF A;  4RUG A;  1WJR A;  1TTH B;  2XMF A;  4FSS A;  2E1H A;  2NUP B;  3G4S A;  3CQT A;  1OYX A;  4LDX A;  1VQO T;  5HK0 A;  3HSB A;  4M7A B;  2RQU A;  4LXC A;  1BB9 A;  1PNJ A;  3JSC A;  2EYX A;  2HKQ B;  4YTL A;  2K4Y A;  4HXJ A;  3CC4 Q;  3CCQ Q;  3OYY A;  4C8Q C;  2H3J A;  2R5M A;  4KUD K;  1YIJ T;  4PJO F;  5LJ5 d;  4FYW B;  4KGV B;  4NL2 A;  4M77 B;  1YIT A;  2GGR A;  1CKB A;  1UB4 A;  4J6Y A;  2QI2 A;  4ELZ C;  1M8M A;  2HAX A;  5CKH A;  3CCU A;  1BK2 A;  1UTI A;  4L5G A;  1B7T A;  4ATO A;  1SG5 A;  4JJB A;  1ZA1 B;  4JJD A;  1MMA A;  3OMG A;  1NEG A;  1NM7 A;  3S3N A;  2HL3 A;  4C0F A;  4M75 E;  5IN1 A;  3G6E T;  1H3H A;  2EYQ A;  3VJP A;  4FT2 A;  1SHG A;  5LJ5 j;  2DM1 A;  1NPR A;  5KCH A;  3PVQ A;  3I35 A;  5J39 A;  2LX9 A;  4QVD A;  5GAM d;  2JUF A;  3EG2 A;  2DL5 A;  1Q81 U;  2ZPF B;  1K0X A;  1MHN A;  2DKG A;  4PJO D;  1KJW A;  2KXD A;  5IHI A;  2RHX A;  2RO0 A;  3CC4 A;  1RAD B;  3CCQ A;  3OBY A;  4L59 A;  2V26 A;  4XTY A;  1VQ8 Q;  3H0F A;  4F7U E;  4D6W A;  4IUQ A;  4C0D B;  2A28 A;  2LQN A;  3QII A;  4AFS C;  1YJW Q;  3MCA B;  3GP8 A;  1VYV A;  1JJ2 P;  3HTR A;  5KYY B;  2DER A;  2NUZ A;  2AZS A;  1QLY A;  1E6H A;  2EJG A;  2FG0 A;  1M1F A;  1UHC A;  1JQQ A;  1ZQ1 A;  4OGE A;  3I56 Q;  1BI2 A;  3GNF B;  5GAM j;  2P0K A;  3EGD A;  4IUP A;  1ZSZ B;  1X6O A;  2E5K A;  2ABL A;  2CRE A;  1M1K R;  1OU9 A;  4M7D D;  1OZ3 A;  2EGA A;  2GF7 A;  3QXE B;  1IGU A;  2A36 A;  4J5Y A;  3J81 E;  2QQS A;  1KFZ A;  2RHU A;  4DBF A;  1W4S A;  3GNG A;  2EYZ A;  2HCK A;  2RK2 A;  1C6V X;  2ROT A;  1XOV A;  4O6J A;  3FIF A;  5EG2 A;  4J9F A;  4C92 B;  2EJ9 A;  5A2Q E;  1VQ8 A;  1VQN T;  4AG2 C;  3VS0 A;  3TSZ A;  1UUE A;  3OYM A;  2QXF A;  1OQK A;  1YJW A;  3ULR B;  5D7U A;  3OYK A;  5KYN A;  3HRT A;  1EIF A;  4GBQ A;  3LW5 E;  3M9Q A;  3OYD A;  1W1F A;  3HL8 A;  2YRV A;  3NGP A;  3L2U A;  1NJI C;  2YLB A;  2HBP A;  2HQX A;  4MZP A;  3T9N A;  1GFC A;  3EG3 A;  5GMK h;  3I56 A;  4F04 B;  2EKO A;  2LQW A;  1T3L A;  2KYB A;  3M0S A;  2JM8 A;  5J3B A;  2JT4 A;  3F70 A;  1X69 A;  4ESR A;  4HT9 A;  4M7A G;  1YI2 T;  2KNB B;  4XAX B;  3V7C A;  1I1J A;  3SWN A;  5CKF A;  2CT3 A;  4OB3 B;  2O88 A;  3OYA A;  5LJ5 e;  3CCS T;  2JTE A;  3U23 A;  5I22 A;  5FWB A;  4B6M A;  3ZFJ A;  4M77 G;  1BI0 A;  4PJM A;  4TVR A;  4RTY A;  1RAH B;  4M75 B;  1H92 A;  1YWO A;  1KQ2 A;  2PZ1 A;  1D0Z A;  2CP6 A;  2EYY A;  2P4T A;  1NLP C;  3V7R A;  4R56 A;  4LN2 A;  3QKJ A;  4IUT A;  4AFU C;  2JTM A;  4OMP A;  3P8H A;  3CCL T;  1W2B A;  4LD9 K;  2R5A A;  4M78 A;  3CC2 T;  2LCC A;  2CYZ B;  4J8O A;  3RER A;  3JCM J;  1JJ2 S;  4QQG A;  1KSW A;  3DB3 A;  1VQ5 Q;  5GJW B;  3L2Z A;  2NYS A;  4F7U B;  5CKD A;  1YJN T;  4JRP A;  5C0M A;  3GF5 A;  5GAM e;  4KT0 E;  3MEU A;  3L2V A;  1BI3 A;  2IPO B;  2C0T A;  2FHD A;  1NZ9 A;  3PGG A;  3D7S B;  2HSE B;  4MDX A;  3Q1J A;  4PJO C;  3LYI A;  4XQ3 A;  1WA7 A;  1OOT A;  3BW1 A;  2HL5 C;  4DBR A;  4RCB A;  4E47 A;  1JO8 A;  4CC3 A;  2KSS A;  3FJP A;  2F1L A;  1GL5 A;  1BCO A;  2OTL T;  4HCC A;  1VQK Q;  2EPD A;  2PUK B;  2X35 A;  3O8V A;  2OJ2 A;  1Y71 A;  4J6X A;  5FU6 C;  1QWE A;  2VGN A;  2EJF A;  3JB9 I;  3FC3 A;  1MV3 A;  1Q95 G;  1IHW A;  3VRZ A;  3NTK A;  4RKU E;  1VQ5 A;  3EGX B;  2DIQ A;  5L23 A;  4N4G A;  1KG1 A;  2HQH A;  4PLL A;  3M53 A;  3CCR Q;  1VQ7 Q;  2CZ7 B;  4E7J A;  1N6A A;  2CP7 A;  3FRN A;  4E7Z A;  2H8H A;  4HCK A;  1BCM A;  5IT9 E;  1UFF A;  1PRM C;  2OX7 A;  3NTH A;  3PMT A;  1GCQ A;  2FPD A;  2K6D A;  3CXC S;  4JLI A;  1MV0 B;  2CUD A;  1V1C A;  3JCM Q;  4DOV A;  4C92 G;  1Y0M A;  1XQH A;  2WSF E;  5KYW A;  2EQU A;  3TU4 K;  4AFZ C;  1IRE B;  1HJD A;  2LT4 A;  3LWI A;  2YUP A;  4C8Q A;  2RB6 A;  1VQK A;  1LVK A;  1AD5 A;  3EG1 A;  1VQM T;  2DYB A;  2F69 A;  4K11 A;  2BZY A;  3LH5 A;  2JZ2 A;  4QVZ A;  1QP2 A;  2LP5 A;  1E7O A;  2DTI A;  6AT1 B;  2P84 A;  3CBM A;  2F2X A;  2HNI A;  3WXM B;  2PNI A;  2GQV A;  1I07 A;  3SB2 A;  1M4Z A;  3EFO B;  2F5K A;  3REB B;  3E2U A;  3CCR A;  1KD1 C;  3HFN A;  1Q86 C;  5IXF A;  1VQ7 A;  4B9X A;  3EH2 A;  3CCE Q;  2FL7 A;  2JXB A;  3A8O B;  3X24 B;  2HSP A;  2KMT A;  3OSV A;  3C94 A;  3P8B B;  1FXX A;  1TOV A;  2QA4 T;  2EW3 A;  1IZ6 A;  2KT1 A;  1B34 A;  1WGS A;  4A4F A;  4X34 A;  3QUI A;  1WHL A;  4M75 G;  1YN8 A;  1KIK A;  1G3T A;  1U5S A;  4CRI A;  4BDY A;  2DYI A;  2GTO A;  2MOX A;  3A8H B;  4JLG A;  2LT1 A;  2DZC A;  2RHY A;  4RTW A;  1NJI U;  1R8O B;  2KVQ G;  2FZG B;  3RBB B;  1QVG A;  2E70 A;  2JMA A;  2PU9 B;  5CIU A;  2CH4 A;  2J06 A;  3CMA T;  4M7A E;  2HEQ A;  3RES A;  4BI8 B;  3MEA A;  4F7U G;  5IHN A;  4ZN1 A;  1M90 C;  2VKN A;  2E41 A;  2XI9 A;  2RHZ A;  3H9N A;  1RUW A;  1U1S A;  3OYJ A;  1GBR A;  1S72 T;  3MEW A;  1TUC A;  4ZTF A;  3CCE A;  5FU7 C;  2I2L A;  3BFM A;  4Z89 A;  3EH1 A;  1I81 A;  5EC7 A;  3UF4 A;  4BI4 A;  3I55 A;  1MGQ A;  3EG9 A;  2XID A;  2B8A A;  4AT1 B;  2YDL A;  5FWC A;  1MNE A;  2DJQ A;  4PKC C;  5CR2 A;  2VC8 A;  2RJE A;  2LNV A;  3OYE A;  2XDP A;  3CCJ T;  3HRU A;  1FMK A;  2A37 A;  3FLG A;  2EYW A;  2MK5 A;  3CEY A;  2LTO A;  4DEX A;  3RMQ A;  1PSE A;  4OMM A;  1M1G A;  3CCM T;  1MND A;  2XK0 A;  1VQP T;  4JDS A;  4N0A C;  4RG2 A;  5GAN h;  2MYS A;  3CBO A;  3L42 A;  5FW9 A;  1U1T A;  2YWW A;  3VS2 A;  1H3Z A;  3MO8 A;  1KC8 C;  1NBE B;  1QWF A;  2P0P A;  1R0B G;  3CPF A;  5GAO m;  2MMP A;  2VB6 A;  4ZN3 A;  4BB7 A;  3QBY A;  2X51 A;  4WCI A;  1VQ9 Q;  4OGC A;  2QTX A;  3WVD B;  3JCM h;  4PLI A;  3CME T;  3VS5 A;  1WJS A;  3JV3 A;  4M78 E;  2OTJ Q;  3H6Z A;  1VQ4 Q;  2XHC A;  3G4S T;  2DZ9 A;  1YJ9 Q;  2FVU A;  2VV5 A;  1WJQ A;  5GAO l;  3E9F A;  4OML A;  3V7S A;  2J6F A;  5IH2 A;  5FRN A;  4FT4 A;  2RI3 A;  2E6Z A;  1ZA2 B;  3NFC A;  2CGH A;  2DXT A;  1YFN A;  1HK9 A;  1QQJ A;  2E5Q A;  3OS1 A;  2R57 A;  2DBM A;  2HD0 A;  1YIT T;  2CZ0 B;  1M30 A;  2KK4 A;  1RAA B;  4E7S A;  1OUL A;  2QEX Q;  1ZSG A;  3BE3 A;  4FSX A;  4KH1 B;  4PJL A;  4BAC A;  2LMJ A;  2KE9 A;  3EGD B;  3M59 A;  1WHK A;  1VQ9 A;  3OB9 A;  3CCU T;  3VS4 A;  1YP5 A;  2P4R A;  3DLL A;  4HT8 A;  1IGQ A;  2FEI A;  3GPL A;  4PJO A;  2RK1 A;  1N9S A;  2BKD N;  4KUI A;  3M0Q A;  3CPW S;  3OA6 A;  3J80 E;  2OTJ A;  5GAN g;  1Q7Y U;  1GCP A;  3PNW C;  1UGS B;  3PVL A;  1VQ4 A;  2QQR A;  2YRC A;  2L3Q A;  3PFS A;  4HVV A;  1YJ9 A;  5CQY A;  3TVT A;  1KQS P;  2QG9 B;  4O5V A;  4BY6 C;  4Z8A A;  3M0P A;  5GAN f;  1BI1 A;  1KD1 U;  4KUL A;  4HVU A;  2QQ9 A;  1Q86 U;  3CC4 T;  3JCM X;  3CCQ T;  4FYY B;  1M3B A;  2RN8 A;  2DL7 A;  3JB9 G;  3S6W A;  4V2S A;  3KXT A;  2F5T X;  4XU3 A;  3JCM b;  1TSF A;  1VUB A;  1SKU B;  4J9C A;  4ORZ A;  3JCM g;  4BE2 A;  1WLP B;  2QEX A;  1PSF A;  2RD1 A;  7AT1 B;  1BBZ A;  1WX6 A;  1W2B P;  1JU5 C;  1ABO A;  1M9S A;  4RG8 A;  4M7D F;  3JCM f;  2EFI A;  4C8Q E;  3OS2 A;  4Z02 A;  3O5Z A;  5GMK j;  2BTT A;  4BE1 A;  4FYX B;  3UA7 A;  4PK4 A;  4EMK C;  3SWN B;  2IG0 A;  2J7I A;  4XTZ A;  5A0L A;  4VUB A;  3X25 B;  4GY5 A;  5A0D A;  3QDR B;  2X9H A;  3LGL A;  1T0H A;  2QDL A;  2JNG A;  1M90 U;  1UG1 A;  2EKH A;  2DE0 X;  3OW2 P;  3KFV A;  4DBH A;  3A1P A;  3GBQ A;  5KCO A;  4HVW A;  5CQX A;  3A8G B;  1K8A C;  1VQ8 T;  3VS7 A;  1Q82 R;  2ESW A;  4M78 B;  4C5I A;  1WHH A;  5DLQ E;  1YJW T;  1NE8 A;  4IUV A;  5AYF A;  1ZUY A;  2ZPH B;  3FDR A;  2DET A;  5D6W A;  1K0S A;  2LRQ A;  3QJ6 A;  5KYU A;  3AT1 B;  1QKX A;  1SRL A;  2DVJ A;  4DEY A;  2EGE A;  1RL2 A;  3I56 T;  3PMI A;  2DEQ A;  3SDZ A;  4AFQ C;  4M7A F;  3EG0 A;  2SRC A;  1SEM A;  1XNI A;  2K5I A;  3VS6 A;  4D8D A;  3JCM c;  1IB8 A;  2PVO B;  1Q7Y R;  5I2S A;  2VYT A;  2DBK A;  4M77 F;  1MMD A;  1AWX A;  5LJ3 h;  1KC8 U;  2FO0 A;  3M5A A;  3THK A;  4ZGJ B;  1KQS S;  4PL6 A;  5FRO A;  4RTT A;  2DEU A;  1U3O A;  1KD1 R;  2ECZ A;  3G7Z A;  2DTO A;  1M3C A;  1Q86 R;  2KI7 A;  4N4H A;  2EVR A;  3PTA A;  4MMK A;  2DA9 A;  2ZGW A;  2CSI A;  3NHN A;  3GLX A;  4JS4 A;  3HPW A;  1R77 A;  3N5B B;  2K2V A;  4LDU A;  4F17 A;  1JBM A;  5LJ5 h;  1IRX A;  1N5Z A;  4A4E A;  2RI2 A;  4N4I A;  1QMC A;  2LC4 A;  3NMZ C;  2DXC A;  4PNO A;  1VQL Q;  4RTZ A;  1KQ1 A;  4M7A D;  2E3I A;  2RJF A;  4E2F B;  2L2P A;  5GMK e;  4OB0 B;  2K3B A;  2NUT A;  2D8J A;  4Y91 A;  5KE2 A;  2JMC A;  2D0Q B;  4XU0 A;  2GQI A;  4X9C A;  1ZBJ A;  4M77 D;  5KYW B;  3M0T A;  4MZT A;  3RR6 A;  3M57 A;  2X3X D;  3CC2 Q;  2R58 A;  4J7F A;  4FCY A;  2CP0 A;  5GAN 7;  3OSS C;  1KHC A;  1TWB A;  4C8Q B;  1M90 R;  1RAF B;  3OW2 S;  1ZUU A;  1QP3 A;  3M54 A;  5CO7 A;  5AT1 B;  4QVC A;  2F2W A;  1D3B A;  1CSK A;  3MPU B;  4MZM A;  5FRM A;  4N0A A;  4JUV A;  1VOM A;  4CC4 B;  3CBP A;  4JJN K;  4KRT A;  4BDZ A;  4A63 B;  2QGF B;  2EGC A;  3H0H A;  1QVG P;  1ABQ A;  4J83 A;  3VS1 A;  1E6G A;  1FMW A;  3OYL A;  1M3A A;  2DTH A;  1X01 A;  2EIF A;  1VQL A;  1VQ5 T;  1FWZ A;  2E65 A;  2VGM A;  5LJ3 g;  2RM4 A;  2L8D A;  2O01 E;  3A98 A;  4J9G A;  4A54 A;  2QQA A;  2VXF A;  1UEC A;  3VUB A;  1B07 A;  5GJV B;  2Y90 A;  1B34 B;  4XU1 A;  1JJ2 A;  5GAN 8;  3RNJ A;  4DOW A;  2D1X A;  5LJ3 f;  4C92 F;  1KK7 A;  2YUQ A;  3CC2 A;  4FW1 A;  4QW2 A;  4R0K A;  2E4H A;  2LJ3 A;  2XKO C;  5GAO q;  1JRI A;  2RQV A;  2M1H A;  2QDY B;  4M78 G;  1T0J A;  3NTI A;  2DIL A;  1TU0 B;  4JRQ A;  4RCC A;  1KC8 R;  5LJ5 f;  2FPF A;  1Q82 C;  2RHI A;  4M7D C;  4DQ2 A;  2YUO A;  3OS5 A;  4OMF B;  1VQK T;  2CKK A;  3S3O A;  4QQD A;  2LZ6 B;  4PJO E;  1JXM A;  2KYM A;  2O31 A;  4J9I A;  2P0Q A;  2Y4X A;  1Y7X A;  5CAI A;  4C5H A;  2O4X A;  4Q5W A;  3LGF A;  3JB9 H;  2DXB A;  3OY9 A;  2COW A;  1YHQ Q;  1X6B A;  3QWX X;  5A0G A;  2COY A;  3CCR T;  1WQW A;  3EG9 B;  3JAM E;  1VQ7 T;  3V8L A;  4C92 D;  1VQM Q;  2XIC A;  1TS9 A;  5GAN d;  2PQW A;  1SSH A;  3LWH A;  1H8K A;  1G5V A;  4II1 A;  2QYZ A;  4HA8 A;  4AMC A;  5GAN 6;  1K8A U;  4M75 F;  2ZCF B;  2YHT A;  1Q7Y C;  4XTV A;  3GOX A;  2DL4 A;  4E7K A;  4AG1 C;  5CCA A;  5GAN 2;  1FMV A;  3OYB A;  1QVF A;  3CXC A;  3G71 Q;  5ECA A;  2AHJ B;  4WTO B;  3MP6 A;  4ELY C;  3OYG A;  1MMG A;  2DX1 A;  1K73 U;  1WNL A;  4PFZ A;  3EGU A;  2K5L A;  3JCM d;  3M4Y A;  1D1B A;  1PWT A;  2AK5 A;  3QZ5 B;  1X43 A;  4F7U F;  2E10 A;  3SD4 A;  1WIE A;  1WHJ A;  3PIO A;  3KBG A;  3M55 A;  4RTU A;  5IHK A;  3QDF A;  4M7A C;  5GAN j;  2XD0 A;  3JCM V;  1AEY A;  3IQL A;  1QVG S;  2A08 A;  8AT1 B;  1VYU A;  1YHQ A;  1Y96 A;  5FLX E;  3WVE B;  1V29 B;  3RUX A;  1M8V A;  3RKX A;  2X3W D;  4M77 C;  3VRY A;  1RI9 A;  3UAT A;  1VQM A;  2RA2 A;  4M75 D;  3CCE T;  2CUB A;  4D8K A;  2WSE E;  2E3H A;  4KGZ B;  4RTX A;  5KYX A;  4C8Q G;  1VQ6 Q;  3I55 T;  2D0N A;  1LPL A;  1AHJ B;  1I4K 1;  4Y92 A;  5GAO n;  1G3Y A;  2MIO A;  1X2Q A;  2E12 A;  4C8Q D;  1HXD A;  2KY9 A;  1BIB A;  4NOY A;  4UC4 A;  5J26 A;  2DFU A;  2FB7 A;  5GAN 5;  3G71 A;  1UJY A;  2CP5 A;  4JPB W;  1UGQ B;  1WXT A;  3X20 B;  2WSC E;  1G3W A;  3DKM A;  2DXU A;  2G3R A;  2MPX C;  4PJN A;  3R6N A;  1RAC B;  1RLP C;  2DRM A;  2F2V A;  5I2M A;  3NPF A;  3PT9 A;  1X2K A;  2ZPG B;  3I5R A;  1M27 C;  1Y07 A;  2M0Y A;  2LJ0 A;  2M0O A;  3G1J A;  2AIR B;  3A5Z B;  2LNH B;  2O9S A;  1QCN A;  1AWO A;  5CVI A;  4C0D C;  2KEA A;  1K76 A;  5CKB A;  2RJC A;  2DIG A;  2ED0 A;  2LJ1 A;  2GTJ A;  4PJO B;  3REA B;  2EQJ A;  1OPL A;  1ACM B;  3E19 A;  1EX4 A;  1VA7 A;  4J9H A;  5HK3 A;  1VQ6 A;  3FB9 A;  2K7A A;  3TRE A;  1OPK A;  3AHU A;  1QCO A;  2K79 A;  2M9U A;  3BDL A;  2EWN A;  3CD6 Q;  1K8A R;  3HP9 A;  1N9R A;  3I9Q A;  3VU3 C;  2J05 A;  1RAE B;  1I0C A;  3JRZ A;  5DLO A;  5IAY A;  1ZSZ C;  2DD4 A;  4A4K A;  2CP3 A;  1D1C A;  4LD6 A;  2C06 A;  2BE7 D;  2QQB A;  2DLP A;  3HRS A;  5FU6 B;  1NG2 A;  2EQI A;  3M56 A;  2H3E B;  1D0X A;  2LCS A;  1K73 R;  4ZGE B;  3CCV Q;  3QYH B;  4ZNX A;  3MJX A;  4EDU A;  5GAN e;  1TXQ A;  4C92 C;  3E1S A;  2B86 A;  2LCL A;  2VUB A;  4B9W A;  4X1V A;  1FYN A;  2K3X A;  2DNU A;  2FZK B;  2RNA A;  3MEV A;  1YWP A;  3CC7 Q;  4R55 A;  1G3S A;  1VQ9 T;  2ROL A;  1RAI B;  2BIV A;  1Q82 U;  3CD6 A;  2ED1 A;  4J9D A;  3JCM e;  1LJO A;  1OU8 A;  2QGG A;  1U8R A;  4JJC A;  4OMQ A;  2DRK A;  3EFS A;  1VQ4 T;  1WXB A;  1YJ9 T;  1BYM A;  2KQW A;  3OYH A;  1VQO Q;  2DK3 A;  3QHS A;  5KH6 A;  2KRS A;  2V1R A;  2NLU A;  2L3S A;  1YCY A;  4LUD A;  4E7L A;  2A3L A;  2K3Y A;  2IVW A;  3CCV A;  4JZ3 A;  4BUG A;  1V76 A;  2MF2 A;  1YIJ Q;  1OX8 A;  2XU8 A;  1D0Y A;  4M75 C;  5LJ3 d;  3J7A F;  2ZAE A;  5KYU B;  1G83 A;  4OB1 B;  1PCX A;  3R6O A;  9ATC B;  2CS7 A;  1OEB A;  2QEX T;  4BD3 A;  4KGX B;  1GBQ A;  3OQ5 A;  1BU1 A;  3CC7 A;  2HBW A;  2CDT A;  2AKL A;  5D6X A;  2ATC B;  2EAY A;  2KR3 A;  1HD3 A;  4P5N A;  3URG A;  3SFM A;  2X4X A;  4Y28 E;  3G6E Q;  2LQK A;  3C4S A;  2FRW A;  1QCF A;  2QTV A;  2GNC A;  2C0I A;  2HMA A;  1VQO A;  1A0N B;  3JB9 D;  2D9T A;  5LJ3 j;  4ZGD B;  1WFW A;  3ZL7 C;  4M7D A;  3CPW A;  1U06 A;  2A0F B;  5GAN 4;  2JOY A;  4ZTJ A;  1QVP A;  4BE0 A;  1XTD A;  4FU6 A;  4M4Z A;  1YIJ A;  3SHW A;  4QKU A;  2DL3 A;  2PVD B;  1WXU A;  3DLM A;  4XK8 E;  1R0C B;  1C1A A;  1P92 A;  4PJO G;  2J6O A;  8ATC B;  1IHV A;  3H0I A;  5FU7 B;  4DBQ A;  2MCN A;  2DD5 A;  1PKS A;  4RMO A;  2CZ6 B;  4FL6 A;  3UWN A;  2GFU A;  2JM9 A;  2NUT B;  2LQ8 A;  3UPU A;  1NEB A;  2DO3 A;  3P8D A;  1K4U S;  1AVZ C;  1LNX A;  2WAC A;  2K9G A;  3TQ7 P;  1QKW A;  1JXO A;  3INZ A;  3VUZ A;  2KGT A;  3M58 A;  2QK0 A;  1UEB A;  2V1Q A;  2YRD A;  1TG0 A;  2YT6 A;  2LVM A;  3G6E A;  4PJJ A;  1G2B A;  2FPE A;  3UT1 A;  3VYH B;  1ZBX A;  1PD1 A;  3QJY A;  2DAQ A;  1KHI A;  1UE9 A;  2BUD A;  3H41 A;  1K9M C;  2CT4 A;  1ZLM A;  3OYC A;  1NYG A;  1D3B B;  2NUP A;  3L2R A;  1SPK A;  1UGV A;  2JN0 A;  3OS0 A;  1K73 C;  4M7D G;  2OAW A;  2VWF A;  4ME7 A;  4JS5 A;  2K5F A;  1VQN Q;  3M0R A;  4J6W A;  4M7A A;  3RKW A;  1M5Q 1;  4XTW A;  3EHQ A;  2ZZD A;  4OB2 B;  2X4W A;  3ZBD A;  3OBW A;  2E6N A;  4GLK A;  2EQK A;  2HDA A;  4A4G A;  3LX7 A;  4M77 A;  3C0C A;  1D1A A;  2JS2 A;  4MDW A;  5D6Y A;  2JJ9 A;  1NYF A;  2M02 A;  3UA6 A;  4OVA A;  1I5L A;  1I5O B;  3ER0 A;  2AZV A;  2K57 A;  5GAN 3;  4WF2 A;  2SEM A;  4MML A;  2FZC B;  2MI6 A;  1N8R C;  1YI2 Q;  3MP1 A;  1PC0 A;  3CCS Q;  2EBP A;  2XDD A;  1BKB A;  4CC7 A;  5GMK m;  1UHF A;  2CSQ A;  5LJ3 e;  4JRI A;  4EPC A;  2QAZ A;  1W2B S;  2PUO B;  1M2V B;  4GLM A;  1YCS B;  2L5Q A;  1VQN A;  1QVF P;  3CXC P;  3L2Q A;  2O4X B;  1XJW B;  3A8L B;  2YSQ A;  1LOJ A;  2RF0 A;  1KQS A;  1N27 A;  3QWY A;  2J6K A;  2RMO A;  3CCL Q;  1OX9 A;  1S1N A;  4IIM A;  1VIE A;  1HYO A;  3VYG A;  3QO3 A;  3MP8 A;  2PVG B;  4IUR A;  4LE9 A;  1VQL T;  3VV0 A;  5GMK l;  1SHF A;  3V8K A;  3JCM P;  1Q81 R;  2VXE A;  3VS3 A;  1YJN Q;  1X75 C;  3BDU A;  2MAM A;  2RQW A;  5KYY A;  2KDS A;  5GAM h;  3TCJ A;  3OMC A;  4RTV A;  1RI0 A;  5L8R E;  2O2O A;  4BY6 B;  2HZY A;  1YI2 A;  1WI7 A;  1WYX A;  2JVV A;  1ZSZ A;  1VIF A;  3CCS A;  4M78 F;  3HFO A;  2DPP B;  1AZE A;  3E9G A;  1I8F A;  2GCX A;  4C5E A;  1OZ2 A;  3LLR A;  3FEO A;  2W0Z A;  2Y4Y A;  1GXI E;  1QW1 A;  4E7I A;  1AWW A;  2CZ1 B;  1PKT A;  2L3P A;  2OTL Q;  3X26 B;  2XDB A;  1YNZ A;  1EFN A;  4F16 A; 
#chains in the Genus database with same CATH homology
 4IUP A;  3NFC A;  4LDY A;  2CGH A;  3I55 T;  2DXT A;  3ME9 A;  4C92 A;  1X6O A;  3OW2 A;  1AHJ B;  1DJ7 B;  1I4K 1;  3TEE A;  3CCL A;  1Y96 B;  1HK9 A;  5GAO n;  4M7D D;  1G3Y A;  2E5Q A;  3OS1 A;  1ZHI A;  2R57 A;  1OZ3 A;  2HD0 A;  2E12 A;  4C8Q D;  1YIT T;  1HXD A;  2CZ0 B;  2KY9 A;  1BIB A;  4NOY A;  3LH0 A;  1H64 1;  4UC4 A;  4IKF A;  2GF7 A;  3QXE B;  2KK4 A;  4FIB A;  1O75 A;  5J26 A;  4J5Y A;  5HKC A;  3J81 E;  2QQS A;  4EMK B;  2RHU A;  2FB7 A;  5LJ5 g;  5GAN 5;  3G71 A;  4LDW A;  1UGQ B;  1W4S A;  3GNG A;  4FSX A;  3X20 B;  2WSC E;  1G3W A;  2RK2 A;  3C12 A;  4BAC A;  3M59 A;  3DKM A;  1YJN A;  1XOV A;  1NJI U;  2DXU A;  1VQ9 A;  4O6J A;  2G3R A;  3FIF A;  3OB9 A;  5EG2 A;  3CCU T;  1QVF A;  4C92 B;  2EJ9 A;  5A2Q E;  1VQ8 A;  3QZ9 B;  3V8J A;  5M9O A;  3DLL A;  4HT8 A;  1VQN T;  5CKE A;  4M78 D;  5I2M A;  3GPL A;  4JRK A;  4PJO A;  3PT9 A;  3OYM A;  2ZPG B;  2RK1 A;  1N9S A;  2BKD N;  2QXF A;  1Y07 A;  4KUI A;  3MHX A;  1YJW A;  2M0O A;  3CPW S;  3OA6 A;  3OYK A;  3J80 E;  3HRT A;  1EIF A;  3OYF A;  3A5Z B;  2OTJ A;  5GAN g;  1Q7Y U;  3PNW C;  1UGS B;  4HCZ A;  3LW5 E;  3M9Q A;  1VQ4 A;  2QQR A;  3OYD A;  1YJ9 A;  3PFS A;  3GIB A;  3HL8 A;  2YRV A;  5CQY A;  5CVI A;  4LDV A;  2ZPE B;  4C0D C;  3L2U A;  3BY7 A;  2YLB A;  4O5V A;  4BY6 C;  1NJI C;  5CKB A;  2HBP A;  2HQX A;  2RJC A;  2JTF A;  2DIG A;  4MZP A;  3T9N A;  1OI1 A;  4C0G A;  2OTL A;  5GAN f;  2X4J A;  1BI1 A;  1JB0 E;  1KD1 U;  4PJO B;  5GMK h;  2EQJ A;  4KUL A;  3I56 A;  2QQ9 A;  2EKO A;  1Q86 U;  3CC4 T;  3E19 A;  3JCM X;  3CCQ T;  1M1K C;  5HK3 A;  1VQ6 A;  3FB9 A;  4QQ6 A;  3TRE A;  1QVF S;  3AHU A;  5DM7 R;  5GAM g;  2D6F A;  5J3B A;  2M9U A;  3BDL A;  2EWN A;  3JB9 G;  4M75 A;  3S6W A;  3F70 A;  4V2S A;  3KXT A;  4HCB A;  4HT9 A;  3HP9 A;  4M7A G;  4FM4 B;  4XU2 A;  1YI2 T;  2F5T X;  1N9R A;  4XAX B;  4XU3 A;  3V7C A;  3SWN A;  3VU3 C;  1VUB A;  3JCM b;  5CKF A;  4OB3 B;  3JCM g;  3OYA A;  5LJ5 e;  4EMG A;  3JRZ A;  5GAM f;  3CCS T;  5DLO A;  4BE2 A;  4KBM B;  5IAY A;  2QEX A;  1PSF A;  2RD1 A;  2DD4 A;  4A4K A;  1YHQ T;  4LD6 A;  2C06 A;  3VKI A;  3JCM W;  4A4H A;  3ZFJ A;  3HKS A;  4M77 G;  2QQB A;  1M9S A;  4RG8 A;  3HRS A;  1K9M U;  1BI0 A;  4TVR A;  3JCM f;  2EFI A;  4A53 A;  1VQL T;  4M7D F;  5FU6 B;  4C8Q E;  4C8Q F;  3OS2 A;  1SSF A;  4M75 B;  4Z02 A;  5GMK j;  1KQ2 A;  3M56 A;  4BE1 A;  2ZPI B;  4HKE A;  4J7I A;  4EMK C;  2P4T A;  3SWN B;  1WQ7 A;  4F7U A;  4ZGE B;  3QYH B;  2IG0 A;  3V7R A;  4R56 A;  4XTZ A;  3QKJ A;  4IUT A;  4EDU A;  5A0L A;  1UGR B;  5GAN e;  2JTM A;  3CCL T;  3P8H A;  2MWP A;  4VUB A;  3X25 B;  4C92 C;  2R5A A;  1W2B A;  4LD9 K;  2L3R A;  2A7Y A;  3E1S A;  4GY5 A;  4M78 A;  5A0D A;  3QDR B;  2LCC A;  3CC2 T;  2CYZ B;  3LGL A;  2LCL A;  2VUB A;  4J8O A;  4B9W A;  3RER A;  2JNG A;  2X4Y A;  2RJD A;  1M90 U;  3JCM J;  1JJ2 S;  4QQG A;  2K3X A;  3DB3 A;  3G71 T;  3L2Z A;  5KCO A;  1FX7 A;  5I21 A;  3C95 A;  3MEV A;  1UGP B;  4F7U B;  5CKD A;  5CQX A;  1YJN T;  4JRP A;  4R55 A;  1G3S A;  5C0M A;  3GF5 A;  1VQ9 T;  2YLC A;  5GAM e;  4KT0 E;  4EMK A;  3A8G B;  1K8A C;  3MEU A;  1VQ8 T;  3L2V A;  2BIV A;  1BI3 A;  4M7D E;  3ASK A;  2FHD A;  1Q82 U;  3CD6 A;  1NZ9 A;  3PGG A;  4M78 B;  4C5I A;  1O9S A;  3MET A;  4C0Z A;  3JB9 J;  5DLQ E;  5GMK i;  3JCM e;  3Q1J A;  1YJW T;  4MDX A;  4PJO C;  1LJO A;  2FYK A;  3LYI A;  1NE8 A;  4XQ3 A;  4IUV A;  1U8R A;  4NS5 A;  5AYF A;  5GAO r;  3BW1 A;  2ZPH B;  1N8R U;  3FDR A;  3EFS A;  3OYI A;  1VQ4 T;  1Q81 C;  4RCB A;  4L6V 5;  5D6W A;  4E47 A;  1YJ9 T;  2KQW A;  1BYM A;  2KAF A;  2E64 A;  3EAE A;  3OYH A;  2LRQ A;  2DK3 A;  2KSS A;  3FJP A;  3QHS A;  3QPH A;  2V8J A;  1BIA A;  3QJ6 A;  5KH6 A;  2DVE A;  2NLU A;  2OTL T;  1YCY A;  4HCC A;  1RL2 A;  3I56 T;  4E7L A;  2A3L A;  2K3Y A;  2IVW A;  3PMI A;  2DEQ A;  3CCV A;  4BUG A;  1VQ6 T;  3SDZ A;  3HHT B;  4M7A F;  2MF2 A;  2QA4 A;  2PUK B;  2X35 A;  3O8V A;  3OYN A;  1XNI A;  1Y71 A;  2K5I A;  3CC7 T;  3X28 B;  2XU8 A;  4J6X A;  5FU6 C;  2VGN A;  2EJF A;  4M75 C;  3JB9 I;  5LJ3 d;  3FC3 A;  3A8M B;  4EMH A;  3J7A F;  3JCM c;  1YBY A;  5GAO p;  3EFR A;  4OB1 B;  2PVO B;  3SWN C;  5I2S A;  2VYT A;  3R6O A;  2CS7 A;  3NTK A;  4M77 E;  4M77 F;  2V8I A;  4RKU E;  2QEX T;  1VQ5 A;  4BD3 A;  2HQE A;  2DIQ A;  1KG1 A;  4N4G A;  5LJ3 h;  3OQ5 A;  4PLL A;  1KC8 U;  3M53 A;  3M5A A;  4ZGJ B;  1KQS S;  4PL6 A;  5FRO A;  3CC7 A;  2LDM A;  2CZ7 B;  5C6S A;  4E7J A;  1N6A A;  3FRN A;  4C5G A;  3ZEH A;  5D6X A;  2EAY A;  3G7Z A;  2DTO A;  5IT9 E;  2MWO A;  3CMA A;  4N4H A;  3UDC A;  3M4G A;  3PTA A;  4MMK A;  3H8Z A;  3NTH A;  2ZGW A;  3PMT A;  4P5N A;  3URG A;  3GLX A;  3SFM A;  3CXC S;  2X4X A;  4JS4 A;  4JLI A;  3HPW A;  4Y28 E;  2LQK A;  3N5B B;  2K2V A;  4LDU A;  1JBM A;  3QYG B;  3JCM Q;  3RMS A;  5LJ5 h;  4DOV A;  4C92 G;  3C4S A;  1XQH A;  2WSF E;  4A4E A;  2EQU A;  2RI2 A;  4N4I A;  2LC4 A;  4M78 C;  3JB9 D;  1VQO A;  3TU4 K;  2D9T A;  2DXC A;  4PNO A;  1S72 A;  5LJ3 j;  1KQ1 A;  5KE3 A;  4ZGD B;  1IRE B;  4M7A D;  2L89 A;  2RJF A;  4M7D A;  2LT4 A;  3CPW A;  3LWI A;  3RKY A;  5GAN 4;  2JOY A;  4C8Q A;  1QVP A;  4ZTJ A;  5GMK e;  2RB6 A;  4BE0 A;  4OB0 B;  1VQK A;  1VQM T;  1XTD A;  4Y91 A;  2F69 A;  4FU6 A;  2RH2 A;  5KE2 A;  4E7H A;  2D0Q B;  4XU0 A;  1YIJ A;  4X9C A;  3RIR A;  2JZ2 A;  4X9D A;  4QVZ A;  1QP2 A;  3CD6 T;  2PVD B;  2RI5 A;  3DLM A;  4M77 D;  4XK8 E;  2DTI A;  2EQM A;  4MZT A;  4XTX A;  3M57 A;  1P92 A;  3QSU A;  4PJO G;  2R58 A;  3CBM A;  4J7F A;  5FU7 B;  2HNI A;  3WXM B;  2GQV A;  4M7D B;  2DD5 A;  5GAN 7;  3CCJ A;  3SB2 A;  4NL3 A;  1M4Z A;  3OSS C;  1KHC A;  4RMO A;  1TH7 A;  4C8Q B;  2CZ6 B;  2F5K A;  4FL6 A;  4OF1 A;  3UWN A;  2GFU A;  3CCR A;  1KD1 C;  2LQ8 A;  2M16 A;  2ZPB B;  3L2W A;  3DB4 A;  3HFN A;  3OW2 S;  5HY6 A;  3UPU A;  2DO3 A;  3P8D A;  1Q86 C;  1VQ7 A;  4B9X A;  1QP3 A;  3M54 A;  1LNX A;  2XG8 D;  2WAC A;  2FL7 A;  5CO7 A;  4DA4 A;  3A8O B;  4QVC A;  3L1A A;  3X24 B;  1D3B A;  3INZ A;  4MZM A;  3VUZ A;  5FRM A;  3M58 A;  4N0A A;  3CCM A;  3QG1 A;  4JUV A;  4IUU A;  2V8K A;  1UEB A;  4XTU A;  4BI3 A;  3CBP A;  3CCV T;  1VQP A;  2KMT A;  3OSV A;  3C94 A;  3P8B B;  4JJN K;  4CI0 C;  2LVM A;  1FXX A;  3G6E A;  2QA4 T;  1IZ6 A;  4BDZ A;  1B34 A;  1WGS A;  4A4F A;  4X34 A;  3QUI A;  3UT1 A;  4M75 G;  3VYH B;  4J83 A;  1ZBX A;  1G3T A;  5CK9 A;  3OYL A;  3QJY A;  2DTH A;  1X01 A;  2DAQ A;  1KHI A;  4CRI A;  4BDY A;  2BUD A;  4OP0 A;  2OTJ T;  1K9M C;  2EIF A;  1VQL A;  3A8H B;  1VQ5 T;  4JLG A;  1FWZ A;  3OYC A;  1D3B B;  3L2R A;  2E65 A;  2JN0 A;  2VGM A;  2LT1 A;  5LJ3 g;  2DZC A;  2RHY A;  2L8D A;  2O01 E;  1WPY A;  2RM4 A;  3OS0 A;  4A54 A;  3S3M A;  1K73 C;  2QQA A;  2VXF A;  4M7D G;  2OAU A;  4ME7 A;  4JS5 A;  5LL6 S;  1R8O B;  2KVQ G;  3VUB A;  1NPP A;  2K5F A;  1QVG A;  2E70 A;  2Y90 A;  1B34 B;  2PU9 B;  4XU1 A;  5CIU A;  1JJ2 A;  4J6W A;  3CMA T;  4M7A A;  3RKW A;  1M5Q 1;  5GAN 8;  3JB9 F;  4XTW A;  4DOW A;  4C92 E;  5LJ3 f;  4C92 F;  5DY9 A;  1M1K U;  4M7A E;  3RES A;  4BI8 B;  3MEA A;  3CC2 A;  4F7U G;  2DJZ A;  3PIP A;  3CME A;  2GFA A;  2ZZD A;  2X4W A;  3KUF A;  4OB2 B;  3OBW A;  4QW2 A;  1WJR A;  2E6N A;  3ZBD A;  4GLK A;  2EQK A;  1M90 C;  2E1H A;  2E41 A;  4A4G A;  3LX7 A;  2XI9 A;  2XKO C;  2RHZ A;  5GAO q;  1JRI A;  3G4S A;  4M77 A;  2M1H A;  2QDY B;  1U1S A;  3OYJ A;  4M78 G;  1OYX A;  3NTI A;  4LDX A;  1VQO T;  4MDW A;  5D6Y A;  1S72 T;  5HK0 A;  4JRQ A;  4RCC A;  3MEW A;  4ZTF A;  3HSB A;  3CCE A;  4M7A B;  4OVA A;  5FU7 C;  2I2L A;  3BFM A;  5LJ5 f;  3JSC A;  1Q82 C;  1I81 A;  1I5L A;  2RHI A;  4YTL A;  2K4Y A;  4M7D C;  4DQ2 A;  3ER0 A;  3OS5 A;  3OYY A;  4OMF B;  1VQK T;  4C8Q C;  2H3J A;  2K57 A;  2R5M A;  2CKK A;  4BI4 A;  3I55 A;  3S3O A;  1MGQ A;  2XID A;  2B8A A;  4QQD A;  5GAN 3;  4KUD K;  4WF2 A;  1YIJ T;  4PJO E;  4PJO F;  5LJ5 d;  4MML A;  4NL2 A;  2MI6 A;  2P0Q A;  2Y4X A;  4M77 B;  1N8R C;  1YIT A;  1Y7X A;  5CAI A;  4PKC C;  4C5H A;  5CR2 A;  2O4X A;  3MP1 A;  2VC8 A;  4Q5W A;  2RJE A;  2LNV A;  3LGF A;  3OYE A;  2XDP A;  1UB4 A;  2XDD A;  4J6Y A;  3CCJ T;  3JB9 H;  2DXB A;  3OY9 A;  2QI2 A;  3HRU A;  1BKB A;  4ELZ C;  5GMK m;  5A0G A;  2HAX A;  5LJ3 e;  4JRI A;  1WQW A;  3CCR T;  5CKH A;  3FLG A;  3CCU A;  3JAM E;  4EPC A;  1VQ7 T;  3V8L A;  4C92 D;  1W2B S;  2PUO B;  2XIC A;  2L5Q A;  4L5G A;  4ATO A;  1VQN A;  3CEY A;  5GAN d;  2LTO A;  2PQW A;  3RMQ A;  1PSE A;  3LWH A;  1G5V A;  1M1G A;  3L2Q A;  2O4X B;  4II1 A;  3CCM T;  4HA8 A;  3OMG A;  3A8L B;  2XK0 A;  1LOJ A;  3S3N A;  4C0F A;  5GAN 6;  4M75 E;  4JDS A;  1N27 A;  4M75 F;  1VQP T;  4N0A C;  4RG2 A;  1K8A U;  2ZCF B;  5IN1 A;  1KQS A;  3G6E T;  5GAN h;  3CBO A;  2EYQ A;  3L42 A;  2YHT A;  1Q7Y C;  1U1T A;  4ZN1 A;  1VIE A;  4XTV A;  3VJP A;  4FT2 A;  3VYG A;  3GOX A;  4E7K A;  1H3Z A;  3MO8 A;  5LJ5 j;  1KC8 C;  3QO3 A;  3MP8 A;  5CCA A;  2PVG B;  1NPR A;  5GAN 2;  2P0P A;  5KCH A;  4IUR A;  5J39 A;  2LX9 A;  4QVD A;  3CPF A;  2JUF A;  3VV0 A;  5GMK l;  2MMP A;  5GAM d;  3V8K A;  2AHJ B;  5GAO m;  3OYB A;  3CXC A;  3JCM P;  2ZPF B;  1Q81 U;  1MHN A;  2VXE A;  2DKG A;  3MP6 A;  4PJO D;  4ZN3 A;  4ELY C;  1X75 C;  4BB7 A;  3OYG A;  3BDU A;  3QBY A;  2RHX A;  2MAM A;  2RO0 A;  3CC4 A;  3CCQ A;  3OBY A;  4L59 A;  2KDS A;  1WNL A;  5GAM h;  4OGC A;  4XTY A;  1K73 U;  2QTX A;  2K5L A;  3JCM d;  3TCJ A;  3M4Y A;  3WVD B;  3OMC A;  3QZ5 B;  4F7U F;  4F7U E;  1RI0 A;  4D6W A;  5L8R E;  4IUQ A;  2E10 A;  3SD4 A;  4C0D B;  4BY6 B;  3QII A;  3PIO A;  1YI2 A;  3KBG A;  3M55 A;  4M7A C;  3JCM h;  5GAN j;  2JVV A;  3MCA B;  4PLI A;  3CME T;  3JCM V;  3GP8 A;  2XD0 A;  1VIF A;  1WJS A;  1QVG S;  3CCS A;  4M78 E;  4M78 F;  3HFO A;  3H6Z A;  2DPP B;  3E9G A;  1I8F A;  2GCX A;  2XHC A;  4C5E A;  3G4S T;  1YHQ A;  2DZ9 A;  1Y96 A;  5FLX E;  1OZ2 A;  3LLR A;  3WVE B;  2FVU A;  3FEO A;  1V29 B;  3RUX A;  2Y4Y A;  1M8V A;  2VV5 A;  3RKX A;  1WJQ A;  5GAO l;  1GXI E;  4M77 C;  1QW1 A;  4E7I A;  2CZ1 B;  3E9F A;  1VQM A;  2RA2 A;  2EJG A;  3V7S A;  4M75 D;  3CCE T;  1M1F A;  3X26 B;  2XDB A;  2WSE E;  1ZQ1 A;  4OGE A;  5FRN A;  1BI2 A;  3GNF B;  4FT4 A;  2RI3 A;  2E6Z A;  5GAM j;  2P0K A;  4C8Q G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...