4M77B

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
b'MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISSTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 20
structure length 91
sequence length 91
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77B00
5GMKi 3GIBA 5GAMg 1N9RA 3QHSA 4XU3A 4X9CA 5GAOq 4M78A 3JCMP 4A53A 4F7UB 2DTOA 4QVDA 4M7AD 4V2SA 3L1AA 4XU2A 3JCMV 2YHTA 3QUIA 3VU3C 5GMKm 5GAN4 4HT8A 4M7AB 4M75C 3QSUA 3JB9I 4M75E 3JCMg 4C92F 4JRIA 4J6YA 4PJOF 4EMGA 5LJ5f 3BFMA 4PJOG 4EMKA 4F7UA 4X9DA 3JB9H 1YCYA 2FB7A 2JN0A 3V8JA 1BIBA 3BW1A 4C92D 1HK9A 4N0AC 1B34B 3RKWA 5LJ3f 5GAOn 5CAIA 4M7AA 4PJOD 3V8KA 3JCMJ 1I4K1 2DVEA 4C92B 4M78B 5LJ5e 5GANd 2I2LA 5GAMf 3JB9F 1WQWA 4MMKA 5LJ5j 4XTUA 2K57A 3L2ZA 3JCMb 5LJ3e 2EWNA 4XTXA 5GMKl 5GAN8 2E1HA 1LJOA 4J6XA 4EMHA 3QO3A 4C92A 2RB6A 5LJ3j 2DTHA 3EFSA 5GAOm 4Y91A 2DJZA 4JUVA 5GAN3 3JB9D 1KQ2A 4EMKB 2ZGWA 5GAMe 5GMKh 3JCMf 5DY9A 4J5YA 2DKGA 4M78C 1U1TA 3JCMc 2E41A 5GANf 5GAMj 3JB9J 4M78E 4M7DF 1D3BB 2RD1A 4M77F 3M4GA 3INZA 4M75G 4HA8A 5GAN2 1Y96A 4M77G 4M7DG 4DQ2A 1X01A 4XQ3A 2DZCA 2HNIA 2QTXA 5GANg 2DTIA 2E64A 1TH7A 3JCMe 4M7DD 4M77D 1WQ7A 5GANe 2Y90A 3RKXA 3SWNA 4EMKC 1D3BA 4F7UE 1KQ1A 3PGGA 5GANj 3FB9A 2YLCA 4RCCA 4XU1A 3BY7A 4M7AC 4PJOB 1LNXA 4M7AE 5GAOl 4WF2A 3AHUA 4C8QF 1I81A 1M5Q1 4C8QG 4M7DA 5GAOp 4XTVA 2YLBA 4M77A 4NL3A 1Y96B 2E65A 2VC8A 4J6WA 4C8QD 4PJOA 3FIFA 3V7CA 2DZ9A 3JCMQ 5LJ5h 2EJGA 1H641 4C92C 3HFOA 4JRKA 4PNOA 4RCBA 4PJOC 4C92E 3SWNB 4PJOE 2RM4A 2VXFA 4M75F 4QVCA 5LJ3h 3RERA 2E10A 4M75D 4A54A 4C8QA 1N9SA 5GAMh 2EAYA 4XTZA 4M7DB 4M75B 4NL2A 4NOYA 4M77B 4F7UG 3RIRA 3JCMW 1LOJA 1BIAA 1U1SA 1I8FA 3SWNC 1MGQA 4XTYA 3RUXA 5LJ5d 2DXUA 5I21A 4M7AG 2DEQA 3RESA 1JRIA 3JCMh 5GAOr 2CGHA 3V7SA 4M75A 5LJ3d 5GANh 1WPYA 3BDUA 4M7DC 5GAN5 4M77C 3SB2A 4M7DE 4M77E 5GAMd 1JBMA 3V8LA 1HXDA 4M78F 3RKYA 3HFNA 2EJFA 4XTWA 4XU0A 4C8QB 4M78G 4N0AA 4C92G 1WNLA 1M8VA 2RA2A 4M78D 4OP0A 2VXEA 4JLIA 4MMLA 3FJPA 5LJ5g 5GAN7 1I5LA 2EJ9A 2DXTA 3JCMd 3V7RA 5GMKe 3EFRA 4HT9A 4F7UF 5LJ3g 3HSBA 2FYKA 4C8QC 5GAN6 5GMKj 3JB9G 3JCMX 4C8QE 4M7AF 1B34A
chains in the Genus database with same CATH superfamily
1N9RA 4KH0B 3MHXA 4F7UB 3KBGA 3L1AA 3R6NA 5GMKm 1AOJA 2QQAA 2YHTA 1QKXA 1WFWA 3DKMA 1E6GA 1U3OA 4C92F 1WHHA 4LXCA 4C92D 5GAOn 2B86A 2I2LA 3EGXA 4OMMA 3VS1A 1GCPA 4FM4B 1VUBA 3OW2A 2CUDA 3NTHA 4RTVA 1VQ4A 3QDFA 2DETA 1FMKA 5IHNA 2E41A 2OTJA 4FYVB 3UPUA 4M77F 1CKAA 1D0YA 1GXIE 4BDYA 2KNBB 1AD5A 2K3YA 4M77D 1NBEB 2KY9A 4HVUA 3RKXA 3CC7T 1D3BA 4F7UE 4Q5WA 2YLCA 2O9SA 2GNCA 3PT9A 1QQJA 1WHMA 3LGFA 1E7OA 3META 3OS1A 2KE9A 4J6WA 2QI2A 4JRKA 4RCBA 4PJOC 3CXCS 1W2BS 1UGRB 2QQBA 1SRLA 4KBMB 4PL6A 2X4YA 3GLXA 2XMFA 3MPUB 1M2VA 1ABQA 2DYBA 2DL4A 2FG0A 5HCKA 2X4JA 3CC2Q 3RUXA 2PTKA 4LUDA 4FSSA 3CCLQ 1Y7XA 4DEYA 2K7AA 2CT4A 4BDZA 1BK2A 1Q7YR 1JBMA 2M1HA 3G6ET 1UJYA 1S1NA 4FW1A 1D1AA 4KULA 2A08A 2LJ1A 3PFSA 1WHGA 2LT4A 1W4SA 4LNPA 5GAN7 1TUGB 1E6HA 2ZPGB 5GMKe 1TUCA 2LX9A 5LJ3g 2EYZA 2FYKA 4JS4A 4ZGDB 2HQXA 3MJXA 3CPWS 1NYFA 4A4FA 2ZZDA 2ED0A 2EW3A 2FPFA 1X43A 1VQPQ 3BFMA 2JTFA 5DLQE 5CO7A 4RTXA 5CKFA 3CMEQ 3L2QA 5FU6B 4M78B 2NWMA 4FT4A 3OA6A 3RR6A 3BDLA 2P0PA 1M1GA 4OVAA 2XG8D 4JUVA 2M9UA 3G1JA 2F2XA 1VQOA 1RACB 3TSZA 1AVZC 3QYHB 3M0SA 2HSPA 1YWOA 2QQ9A 3E1SA 3MO8A 1JJ2A 4EIKA 2XD0A 5GAOl 4WF2A 3NGPA 1XQHA 4NL3A 1MV3A 3OYHA 3HRSA 3OYJA 3MP6A 2DMOA 4N4HA 3WVEB 2EFIA 3M0PA 4TVRA 2CS7A 4MZTA 1M3AA 1TOVA 3OQ5A 5FRMA 1YJWA 1ZSGA 1U06A 2GQVA 4PJJA 1KFZA 2CH4A 4E7LA 2K5IA 1F1BB 2DEQA 1EFNA 4C0GA 4CC7A 2MWPA 2VKNA 3P8HA 3JV3A 1QVGA 1I07A 2J6KA 3IQLA 4P5NA 1FMWA 3G6EA 1UEBA 1VA7A 3VUZA 3ULRB 2AZVA 4MMLA 3QWYA 4R56A 1W1FA 4J9FA 4F7UF 3LX7A 2YWWA 3J81E 2A36A 1UDLA 4DOWA 3QHSA 5GAOq 2RI2A 3WVDB 4V2SA 2E6ZA 1MMAA 5IXFA 2KT1A 5I2SA 2NLUA 2HL3A 2FHDA 2DEUA 2K3BA 3L2WA 3CC4T 3MKDA 2RJEA 3CCVA 2EQMA 1BBZA 3HRTA 3QWXX 1Q82C 3MEVA 4XTUA 4XTXA 4RKUE 3O5ZA 2RB6A 3EFSA 1RAIB 3PIOA 4E7JA 2J6FA 2E4HA 1YITT 2C0IA 2QTVA 4M78C 1U8RA 4HA8A 3VRYA 2JMCA 2I0NA 4EPCA 1BKBA 1JB0E 2RI5A 1G3WA 2L8DA 1GCQC 2PUKB 2M0YA 1PRMC 2C06A 2PVGB 1FX7A 1M27C 3EG9B 3UATA 4J9BA 4OB2B 2KGTA 3EFOA 2QQRA 2KDSA 2WSCE 5LJ5h 2HKQB 2JT4A 5A0GA 2YXYA 1KQSS 1ARKA 3CCEQ 5FRNA 2HEQA 2JTMA 4M7DB 3JCMW 1TUDA 2V8JA 1VQ7A 1FMVA 1VQ5Q 2DXUA 2JS2A 2HD0A 1Y71A 2HKNA 2KR3A 1K8AR 2JW4A 2RH2A 2X35A 2QEXA 2NYSA 3SB2A 1BCMA 4MZMA 4C92G 2EJFA 1YIJQ 1MV0B 1RAFB 3M0QA 3ZFJA 2LC4A 2BE9B 2KRSA 4KUDK 2OAWA 3CCRT 2CP0A 3SHWA 2FRYA 4CC2A 3HSBA 3DLMA 2B8AA 4C0DB 3CD6Q 1M1KR 2DBKA 4X9CA 2L3PA 4CRIA 4HXJA 1GBRA 4XU2A 3QUIA 5CKEA 4J7IA 2P4RA 1WHJA 2OX7A 2JZ2A 1N8RR 3CMET 2DL3A 2LVMA 4X9DA 2XK0A 1YCYA 2FVUA 3BW1A 2ABLA 2QGFB 3CCUQ 4KGXB 2FZKB 5A0DA 1IZ6A 5GAMf 2L2PA 2F2VA 1GL5A 2YRVA 4OGCA 2ZCFB 3VUBA 2KYMA 2X51A 1KQ2A 1WLPB 1VQ6T 2ZGWA 2CYZB 4J5YA 1RADB 2K2VA 3C12A 2JVVA 1YITA 4B9WA 2RHXA 1Y96A 4LDVA 3M53A 2KXDA 1TSFA 3M55A 4LE9A 1GRIA 1UG1A 2OAUA 1SHGA 2CZ1B 4Y28E 1BB9A 3OYAA 1H8KA 2PUOB 1XTDA 3EGDB 2LP5A 1RAHB 4VUBA 2X3WD 1Q86C 1M9SA 2V8IA 4F04B 2R5MA 4OB1B 1C1AA 5LJ3h 1TXQA 2EPDA 4IURA 2R57A 2DERA 2R5AA 5KYUA 5KYYA 1SRMA 3CC2A 1NZ9A 4M75B 2MAMA 3A1PA 4M77B 1T3SA 4PJNA 4BI3A 1PM3A 2BIVA 3H0HA 3CCLA 1SPKA 1OZ3A 3CC7Q 4M7DC 3EHQA 1PC0A 2COYA 1VQ8Q 5J26A 2MWOA 4PFZA 2DILA 3M54A 3CCJT 1HSQA 2DD5A 1RAEB 4GLMA 2RQWA 1EZZB 1D1BA 4C8QE 3QBYA 2RQUA 1VQMT 1ZUKA 3TVTA 2DD4A 5I11A 4BD3A 2JUFA 3OW2P 3L2UA 2GQIA 1T3LA 1ZA1B 1VQPA 3OYDA 4E47A 4M75E 4C0DC 4J9IA 1WHLA 2JXBA 4JRIA 4AFSC 2BZ8A 4PJOG 1NJIU 5M9OA 2J7IA 1UGQB 3CMEA 4FT2A 4N0AC 4Z88A 3QZ9B 4M7AA 1D09B 3LH0A 1KC8U 1ZSZA 4RUGA 1SEMA 2LNHB 4HKEA 4ORZA 3CBOA 2DBMA 5CKBA 3I5RA 2XKOC 4J9CA 4A4EA 1NEBA 2E64A 4Z89A 2F5TX 1V29B 1K8AC 4XU1A 1TS9A 2MF2A 1M5Q1 1O9SA 1WXUA 4OMLA 4BUGA 1PCXA 3S3MA 2DYIA 3G7ZA 4C92C 3A5ZB 3CCET 3OYEA 1WA7A 1YHQQ 1HD3A 2GCXA 3ZBDA 1YBYA 1M1KC 1VQ5T 3VS2A 3NFCA 1B07A 4F7UG 1JQQA 2X4XA 2RK2A 1ZA2B 1KD1R 1WJQA 2CT3A 4II1A 2L5QA 2RHUA 1IXDA 1YCSB 3LYIA 2LNVA 1UUEA 4M77C 3CMAQ 1RI0A 5IHKA 1WJRA 5GAMd 2QASA 4E7HA 4GLKA 1T0JA 3CD6T 1UTIA 1I5LA 3FJPA 3VYGA 1YNZA 4HT9A 1OPKA 1SKUB 1RLPC 1M4ZA 3LWHA 3TSWA 2A3LA 4Z02A 1B34A 3OS5A 3HHTB 1PNJA 5GAN4 3AT1B 3NMZC 1AWWA 1D1CA 3NTIA 3CCUT 3QXEB 3P8BB 1QVFS 2P84A 1QVPA 2DVEA 4E7KA 2JOYA 4JPBW 1Q81C 4BI8B 1MNDA 2E5KA 5CK9A 3QJ6A 5GMKh 3M56A 2PZ1A 5GANf 5GAMj 1D3BB 3DB4A 5KH6A 2LX7A 2X4WA 1AWJA 1K9AA 3QZ5B 2QK0A 2FRWA 4K11A 4F14A 1I1JA 1Y07A 3FB9A 3OYBA 1QCOA 2CSQA 1OV3A 1YI2Q 4C8QF 2YRDA 4F16A 3CC4Q 2PU9B 3CCMQ 2AK5A 2LCCA 4AFQC 4C8QD 2HSEB 4FL6A 1QVGP 4M75F 2C0OA 3OYKA 3CCEA 3RNJA 3RERA 2E3HA 1PKTA 1YITQ 3PMTA 1QMCA 4M75D 2JJ9A 1N9SA 1VQ5A 2LMJA 4E7ZA 1G2BA 1PKSA 1G5VA 3V7SA 1DJ7B 1VQ8T 3L2RA 1JU5C 1YIJA 2HQEA 1Q82R 3VS4A 4M78G 1PHTA 4J7FA 3HL8A 2RA2A 4CC3A 3ASKA 5KYXA 4JLIA 3CD6A 2L3QA 1VQ9T 3JCMX 2DL7A 4BACA 3H8ZA 3E19A 5GMKi 1G3SA 2GFUA 2RQTA 4XU3A 1MUZA 1UFFA 2FO0A 4A53A 3FC3A 1X6OA 4HT8A 2E70A 4QQDA 2EBPA 3JB9H 1VYVA 3CCUA 4DEXA 1W70A 3PVLA 1VQLQ 2ESWA 2ZPIB 1X2QA 3Q1JA 3VV0A 2YUNA 4JLGA 2LCLA 2OI3A 1NG2A 4C5GA 3VYHB 2OJ2A 4JS5A 2LJ0A 3L42A 5GAN8 1B7TA 3CCRQ 5FROA 1K1ZA 5GAOm 5GAMe 3JCMf 5DY9A 2EKHA 2KBTA 2D8JA 1VQKQ 4PK4A 4HCBA 1KD1C 2EIFA 2MPXC 2EGCA 5FWCA 1QWFA 3LGLA 4D8KA 4FYWB 3HKSA 3UT1A 1YP5A 1YHQT 4J83A 3V7CA 4A4KA 3SD4A 1UHFA 1H641 3VS6A 3J7AF 2GTJA 4PKCC 1HJDA 2DA9A 2ECZA 1VQ6Q 2LQ8A 4LD9K 1OQKA 2BZXA 3C94A 4DBFA 3X28B 3CC7A 4L6V5 2VUBA 1FXXA 3CMAT 2KRNA 2MCNA 5AYFA 3BDUA 1VQ8A 3FLGA 2EYWA 3RKYA 4RG8A 2JMAA 2E12A 1QLYA 3UF4A 2DXTA 2DXBA 2W10A 2LRQA 2J06A 1IGQA 5GAN6 1VQ9A 3EH2A 3THKA 1N6AA 4M78A 4BY6B 4HVVA 3MP1A 4L5GA 1K9MR 5IXBA 1M8MA 2NUPB 1Q86R 1GCQA 2PVOB 2MMPA 4E7SA 2GTOA 2J6OA 1T0HA 1YN8A 2O01E 4OMPA 1I4K1 2XICA 1WXTA 1MHNA 2DIGA 4JZ3A 3CCJQ 1M30A 2JS0A 5HK0A 2NUTB 3A8MB 2DJZA 1QCFA 2C0TA 4EMKB 2KMTA 1M90R 1OX9A 1VQMQ 4M7DG 2KSSA 3INZA 2KAFA 3VS7A 1WQ7A 1YI2T 5GANj 3CCMT 2EYYA 1QW1A 4GY5A 3D7SB 4GBQA 1K73R 4ZGEB 5KCHA 2EQKA 2M16A 1A0NB 2ED1A 4A63B 4PLIA 4QT7A 4E2FB 2VC8A 1YHQA 2EGAA 5FU6C 4PNOA 1AEYA 2DJQA 2CDTA 3SWNB 4ZTJA 4HCCA 3PTAA 4AFZC 2VWFA 4Y92A 2M0OA 4LDUA 4OMFB 2A37A 4NL2A 4RTTA 2DXCA 4RTZA 2AT1B 4XTYA 5GAOr 1UE9A 3PE0A 3CCSQ 5FU7B 3CMAA 2RJCA 2CP7A 2ZPBB 5A0LA 2D6FA 3GNFB 4JZ4A 1IO6A 3H0IA 3HFNA 3OY9A 3CXCA 2CH4W 1W2BA 5C6SA 4C5EA 4BE0A 2EJ9A 4A4HA 2DIQA 3JCMd 5IAYA 2YT6A 3GF5A 1RUWA 1BCOA 3WXMB 2DRMA 1NEGA 4OF1A 5GAMg 5FWBA 2FZGB 5CQYA 1BI0A 1VQLT 5I22A 1UGSB 2GBQA 2G6FX 3MEUA 3QJYA 1JEGA 1YJ9T 1KC8C 1UGVA 1UHCA 4BY6C 2DRKA 2CZ6B 1NM7A 1WHKA 3MEAA 4J9DA 1R8OB 2K57A 3L2ZA 4L59A 4E7IA 3S3OA 1VQKT 3I56T 2PQWA 3QYGB 3UDCA 3SDZA 3CPWA 1M2OA 1K0XA 1V76A 3MCAB 3GOXA 1U1TA 3EG9A 3JSCA 5GAOp 2DAQA 1JXOA 4M75G 2RNAA 4M77G 2WACA 5GJWB 2HQHA 4ZN1A 5GANe 2KVQG 2HL5C 4EMKC 4CI0C 1OOTA 1YI2A 2VYTA 2ZPHB 1PG5B 4NS5A 3CC4A 1MMNA 3CCMA 1VYUA 5KYWA 4M7DA 1ZQ1A 2O2OA 3CPFA 4X1VA 5CCAA 9ATCB 1B3QA 2IIMA 5KYUB 2EKOA 2KEAA 3TCJA 8AT1B 2XU8A 8ATCB 2CZ7B 1OEBA 3CBPA 1YJNT 2FL7A 1OI1A 3RIRA 2GF7A 3SWNC 1XNIA 4AG2C 4C0ZA 2OTLT 3OSVA 1K9MC 3A8HB 4QKUA 4PJLA 1R0BG 6AT1B 2CGHA 1JXMA 1H92A 1KK7A 4CC4B 1M3CA 2D0QB 3GPLA 3C0CA 1Q81R 4C8QB 1ZBXA 4FW2A 2F1LA 4N0AA 2K4YA 4JDSA 3MP8A 3TREA 2D1XA 1WZOA 4JJNK 4D8DA 4J9HA 1M90C 3OW2S 2QDLA 3KFVA 2YSQA 5IH2A 1H3HA 1KHIA 3NHNA 4M7AB 3FRNA 2LZ6B 4J6YA 3ZEHA 1VQLA 2MYSA 1NLPC 2R58A 1WXBA 2RQVA 2FB7A 1K73C 2RHZA 5CKHA 1R77A 2FZCB 3S3NA 4R0KA 3LW5E 3CCRA 2G3RA 1X2KA 2EWNA 2QA4Q 4LDWA 2SRCA 3FJ5A 4C92A 1VQ9Q 1VQKA 3EGDA 1CSKA 1Q7YU 3M4GA 5FLXE 3JCMe 1OYXA 1K4US 2Y4YA 2RI3A 3H9NA 1LNXA 4M7AE 1I81A 2RJDA 4M77A 2P0QA 2XHCA 2DO3A 3JCMQ 2V8KA 2D0NA 3HPWA 1VQ6A 1M1FA 3VS0A 5D6YA 1S72Q 5I2MA 2E10A 4JRPA 3M57A 4FYXB 1WDXA 2K5FA 1WX6A 3CCST 3I55Q 2LQKA 3RESA 4B6MA 1ABOA 1TWBA 2QQSA 3G4SQ 2VV5A 2FEIA 1AZEA 1PSEA 3V8LA 2K5LA 1X27A 3ER0A 5IT9E 2ZPEB 1KQSA 1IREB 3EFRA 5EC7A 1I5OB 3A8LB 4C8QC 2DE0X 2IPOB 1VQ4T 3CEYA 2OTJT 1WJSA 2F69A 2O4XB 4LDYA 2QGGA 3VS5A 4M75C 2RF0A 1K0SA 3PIPA 2DVJA 2CREA 2EVRA 3OYCA 1BI1A 2BE7D 2CP2A 2W0ZA 1JJ2S 4DBQA 3CCJA 2AKLA 1WQWA 2RHIA 3RMQA 1PSFA 1G3TA 4J8OA 1RAGB 4YTLA 2DTHA 3EG3A 4Y91A 5GAN3 4WTOB 2CP6A 2EYQA 1VQMA 1XJWB 3JB9J 1P92A 4KT0E 2JTEA 3EHRA 1R0CB 5GAN2 2XIDA 4XQ3A 2EQUA 2QTXA 2ZPFB 3EGXB 1N27A 5IN1A 2CP5A 1OX8A 3OYMA 2AIRB 4JRQA 4XTVA 2DL8A 3ME9A 4PJOA 3FIFA 2A28A 2DZ9A 1QVGS 5CKDA 3HFOA 4PJOE 2RM4A 4QVCA 5KCOA 2PNIA 4PFOA 3TU4K 4ZTFA 5GAMh 1SSHA 3DLLA 1LOJA 2CSIA 3CCSA 2COZA 1VQNQ 2P4TA 5D7UA 3LH5A 4ESRA 5KYXB 4DBRA 4N4IA 2F5KA 1M2VB 3M4YA 4XU0A 2MIOA 3HRUA 4IIOA 4IUTA 2DF6A 3N5BB 2K2MA 1PD1A 1QVFP 5J39A 1WYXA 4A4GA 7AT1B 2LQWA 2EQIA 3CCQQ 2QYZA 5KE3A 4M7AF 5CQXA 1NLOC 3JCMP 4OMOA 4E6RA 5HKCA 2LDMA 3H6ZA 4J9EA 4M7AD 4XAXB 2VGNA 1LCKA 1VQOT 2JM8A 3QSUA 3JB9I 1H3ZA 3JCMg 5KE2A 1RLQC 5LJ5f 2VB6A 4F7UA 1AWXA 1IGUA 2VASA 2KXCA 1X75C 2QA4T 3JCMJ 2A7YA 3QPHA 3M0RA 4R55A 1HYOA 4RG2A 5LL6S 4BE2A 5GMKl 1I0CA 4OMNA 1K8AU 3QO3A 4ZNXA 1KIKA 1X6GA 4IUVA 2X3XD 3JCMc 3URGA 3J80E 1YJWT 3OBWA 1X69A 4RTYA 2BKDN 2DFUA 2HNIA 2V1QA 1CKBA 3I9QA 4JJDA 4ME7A 4AG1C 2Y90A 3KUFA 4IUQA 2O31A 1YJ9Q 1U5SA 4RCCA 3BY7A 3R6OA 1M1KU 1GFCA 4IUPA 3OYFA 3JAME 1RABB 1S72T 1ZLMA 4O6JA 2HMAA 5A2QE 5IHIA 3I56Q 1N8RU 1PD0A 1NJIR 1VIFA 2RQRA 3CXCP 2EGEA 3I55T 1W2BP 3C95A 1BI2A 2EAYA 4XTZA 4IIMA 3OYNA 4NOYA 4B9XA 3OSSC 2YUQA 1U1SA 3G4ST 1KC8R 1NYGA 2SEMA 1XOVA 3OYGA 4LUEA 2O88A 3A8OB 1Q95G 1BU1A 3JRZA 1VIEA 1VOMA 1W6XA 2KT8A 2RMOA 1VYTA 3PNWC 2L0AA 3RBBB 3DB3A 2KRMA 3CCVT 5J3BA 5L23A 3GP8A 4HCZA 1ACMB 1TTHB 4AFUC 3G71Q 4N4GA 5CIUA 2Z0WA 1YJNQ 1WGSA 1BI3A 3CPWP 1Q81U 2OTLQ 1UECA 1AWOA 5GJVB 4PJOF 2DL5A 2NUZA 3UA6A 1HK9A 5LJ3f 4PJOD 3V8KA 4FSXA 2CP3A 5GANd 2QA4A 2J05A 3EG1A 3VJPA 2WSFE 1ZUUA 1RL2A 2MI6A 1EIFA 5L8RE 1FWZA 2QXFA 4M78E 2RD1A 1BYMA 3UA7A 2L3RA 2DZCA 1RAAB 3X20B 4J9GA 1NE8A 4QQ6A 1VQ7T 3ZL7C 1QVFA 3M58A 4OB0B 2YRCA 2QEXT 2YLBA 3EH1A 1TG0A 1S72A 3SFMA 2EJGA 2DPPB 4KGVB 2A0FB 3REAB 4BE1A 2O9VA 3E9FA 1YFNA 3KXTA 3I55A 1MMGA 1NPPA 2CKKA 1G3YA 4C5HA 1VQNT 3H0FA 3EFOB 1BIAA 2K79A 4X34A 2VVKA 5LJ5d 2HBPA 3G4SA 4HCKA 1K76A 3A8GB 1JRIA 4MDXA 5GANh 4OB3B 5GAN5 3OS2A 5CAIA 4XTWA 2HBWA 3CCQT 2E6NA 2F2WA 2D9TA 1X6BA 2NUPA 2H3JA 2JNGA 1D0ZA 1YWPA 2ATCB 2QG9B 1AT1B 3QDRB 3GIBA 1M3BA 1ZUYA 2RHYA 4HVWA 1SF9A 2BTTA 1G83A 2NUTA 2LCSA 2RPNA 4EMGA 4EMKA 2LTOA 4ZGJB 2JN0A 4DOVA 3V8JA 2DNUA 3I35A 3HTRA 2CZ0B 2X9HA 4M4ZA 3RMSA 3JB9F 2IVWA 5LJ5j 3M0TA 1Q7YC 3JCMb 1KD1U 3QG1A 3JB9D 1NJIC 3HP9A 4OMQA 5FW9A 2DKGA 4MZPA 2RK1A 1VQ4Q 1X01A 2OTJQ 1TH7A 3CC2T 5D6WA 2VGMA 4KH1B 5KYWB 3SWNA 1PWTA 3EG0A 3VRZA 3CCLT 1V1CA 2LJ3A 3AHUA 3OYLA 5HK3A 4FCYA 4RTUA 4C8QG 3TEEA 1OU8A 1Y96B 2E65A 2M02A 2LT1A 1NPRA 5AT1B 2V1RA 1UGPB 2LQNA 3U23A 3M9QA 3OYIA 3OMCA 4A54A 2XDDA 1KQSP 3FEOA 1MMDA 1MGQA 1OZ2A 5HY6A 5I21A 1VQNA 4M7AG 3REBB 3JCMh 5LJ3d 1VQPT 2CUBA 4M7DE 2KQWA 2YUPA 3LLRA 5KYYB 4M78F 2HDAA 1FYNA 2JM9A 4F17A 1WNLA 1QCNA 4M78D 4OP0A 2VXEA 1IB8A 2HCKA 4KGZB 3CCQA 3V7RA 3G71T 1UB4A 1SHFA 3C4SA 1LPLA 3OB9A 3QKJA 1OU9A 2DTOA 4QVDA 1N5ZA 3VU3C 3M59A 2L3SA 4ATOA 3L2VA 2EYXA 4ELYC 1KG1A 2QAZA 2RN8A 2DX1A 5FU7C 2H3EB 4C92B 5LJ5e 3F70A 1EX4A 2K6DA 1QP3A 2ROLA 4UC4A 4C5IA 3S6WA 2RO0A 2AKKA 4J6XA 5LJ3j 2WSEE 3I5SA 3T9NA 1QP2A 1Y0MA 2PVDB 1Q82U 1UJ0A 4DQ2A 1ZHIA 4LN2A 2KROA 4Z8AA 3BE3A 2MOXA 2H8HA 1VQOQ 1SSFA 1ZSZB 3NPFA 1YJ9A 1OPLA 2P0KA 1WI7A 1PRLC 1KQ1A 3PGGA 4ZN3A 1C6VX 3X25B 2K9GA 3H41A 3I56A 2E3IA 2XDPA 4C0FA 3SEMA 3TQ7P 4C92E 2ENMA 2HZYA 2VXFA 4EDUA 4D6WA 1QKWA 4DBHA 3UWNA 3E2UA 1WIEA 2BUDA 4C8QA 1YJWQ 4DA4A 2IG0A 1QWEA 3E9GA 2V26A 4KUIA 4PLLA 1D0XA 1J3TA 1G8XA 4JJCA 1Z9ZA 4M75A 1WPYA 3VKIA 4M77E 3X24B 2KYBA 3QIIA 4QVZA 2YDLA 4XK8E 1Z9QA 1SG5A 3G6EQ 1GBQA 5DM7R 1GFDA 4BB7A 4WCIA 2Y4XA 3G71A 1C0MA 1YJNA 4MDWA 3A98A 2OTLA 5ECAA 3JCMV 2RJFA 1O75A 5EG2A 1IRXA 4PJMA 3GBQA 2M51A 3LWIA 3GNGA 1BIBA 2YUOA 1B34B 3RKWA 4KRTA 3OYYA 2DK3A 2DM1A 2KI7A 1IHVA 2COWA 4MMKA 3PMIA 5LJ3e 2E1HA 3CCVQ 3P8DA 3CBMA 1LJOA 2QDYB 3NTKA 4RTWA 4EMHA 5D6XA 2BZYA 1OULA 1ZBJA 3X26B 4M7DF 5CVIA 5C0MA 2ZAEA 3EG2A 4RMOA 4FU6A 2GFAA 5GANg 3OS0A 2DTIA 2E5QA 4M7DD 4IKFA 3RDVA 4BI4A 5CR2A 4FYYB 3OBYA 3VS3A 4ELZC 4O5VA 4M7AC 4PJOB 4QQGA 2EQJA 1IHWA 4LD6A 2GGRA 3EGUA 3M5AA 1N8RC 1ZX6A 3O8VA 1TU0B 1YIJT 4ANJA 1ZSZC 2L89A 1KJWA 2AZSA 2FPDA 2DLPA 1K9MU 4IUUA 2KK4A 4LDXA 2XI9A 1Q86U 4FIBA 2K3XA 1KHCA 2HAXA 1KSWA 5DLOA 4PFPA 1I8FA 2MK5A 1MNEA 4OGEA 3CQTA 2D8HA 1VQ7Q 3EAEA 2XDBA 2ROTA 4QW2A 4AMCA 3MEWA 5KYNA 1M90U 4AT1B 3PVQA 1HXDA 2FPEA 2QEXQ 4JJBA 3FDRA 2O4XA 1JO8A 1LVKA 1M8VA 5LJ5g 1AHJB 2AHJB 1Y57A 1RI9A 1JJ2P 3M0UA 3OMGA 5GMKj 3JB9G 1AZGB 1K73U
chains in the Genus database with same CATH topology
4HCZA 3QBYA 3WXMB 4OF1A 5GAMg 1N9RA 4N4GA 5CIUA 1VQMT 5CQYA 3MHXA 2DD4A 1WGSA 4F7UB 1BI3A 4BD3A 2JUFA 3L2UA 3KBGA 3L1AA 5GMKm 2QQAA 2YHTA 1Q81U 3DKMA 1VQPA 1BI0A 3OYDA 1VQLT 4E47A 1UGSB 4M75E 4C0DC 3MEUA 3QJYA 4C92F 4JRIA 4PJOF 1YJ9T 1KC8C 4PJOG 1NJIU 5M9OA 3CMEA 1UGQB 4FT2A 4BY6C 4C92D 1HK9A 4N0AC 3QZ9B 4M7AA 5LJ3f 5GAOn 4PJOD 2CZ6B 3V8KA 4FSXA 3MEAA 5GANd 2QA4A 2I2LA 3LH0A 1KC8U 1R8OB 2K57A 3L2ZA 4L59A 4E7IA 4HKEA 3VJPA 3S3OA 1VQKT 2WSFE 2PQWA 3I56T 4FM4B 1VUBA 3QYGB 3OW2A 3CBOA 3UDCA 3NTHA 3SDZA 1VQ4A 1RL2A 3CPWA 2MI6A 3MCAB 3GOXA 1U1TA 2E41A 1EIFA 5CKBA 5L8RE 1FWZA 2QXFA 2XKOC 3JSCA 4M78E 2DAQA 2RD1A 4M77F 4A4EA 4M75G 2L3RA 5GAOp 3UPUA 4M77G 1BYMA 1GXIE 2DZCA 2WACA 4ZN1A 4BDYA 2E64A 3X20B 2K3YA 2F5TX 4M77D 5GANe 2KVQG 2KY9A 1NE8A 4QQ6A 1VQ7T 3RKXA 3CC7T 4EMKC 1QVFA 1D3BA 1V29B 4Q5WA 4F7UE 4CI0C 1YI2A 2YLCA 1K8AC 2VYTA 4XU1A 3M58A 4OB0B 3PT9A 2ZPHB 4NS5A 2MF2A 3CC4A 3CCMA 1M5Q1 3LGFA 3META 3OS1A 4M7DA 1ZQ1A 1O9SA 2QEXT 2YLBA 3CPFA 4J6WA 4BUGA 5CCAA 3S3MA 1S72A 2QI2A 3SFMA 2EJGA 3G7ZA 2DPPB 4JRKA 4C92C 3A5ZB 4RCBA 4PJOC 2EKOA 4BE1A 3CCET 3OYEA 3CXCS 1W2BS 2GCXA 1UGRB 3ZBDA 2QQBA 4KBMB 1YBYA 4PL6A 3TCJA 3E9FA 2X4YA 3GLXA 1M1KC 1VQ5T 3KXTA 3NFCA 2XU8A 3I55A 1NPPA 2CZ7B 2CKKA 3CBPA 2FL7A 1G3YA 4C5HA 1OI1A 4F7UG 1YJNT 3RIRA 1VQNT 2GF7A 1BIAA 2X4XA 4X34A 3SWNC 2RK2A 2X4JA 1XNIA 3RUXA 5LJ5d 4C0ZA 2OTLT 2HBPA 3G4SA 3OSVA 1K9MC 1WJQA 4MDXA 3A8GB 1JRIA 3A8HB 4II1A 2CGHA 2L5QA 5GANh 2RHUA 1Y7XA 3LYIA 4OB3B 2LNVA 5GAN5 2D0QB 4M77C 3GPLA 3OS2A 4BDZA 1RI0A 5GAMd 1WJRA 1JBMA 2M1HA 4C8QB 1ZBXA 5CAIA 3G6ET 4XTWA 4N0AA 4KULA 2K4YA 4E7HA 3PFSA 4GLKA 3MP8A 4JDSA 3CCQT 2LT4A 3CD6T 1W4SA 2E6NA 1I5LA 3FJPA 3TREA 5GAN7 3VYGA 4JJNK 2D9TA 4HT9A 2ZPGB 5GMKe 2H3JA 1M4ZA 2LX9A 5LJ3g 2FYKA 2JNGA 3LWHA 4JS4A 2A3LA 4Z02A 1B34A 1M90C 3QDRB 3GIBA 3OS5A 3OW2S 4ZGDB 2HQXA 3HHTB 2RHYA 3CPWS 5GAN4 1KHIA 4M7AB 4A4FA 2ZZDA 3FRNA 3NTIA 4J6YA 3ZEHA 3CCUT 4EMGA 1VQLA 3QXEB 3BFMA 4EMKA 2R58A 2LTOA 3P8BB 4ZGJB 2JN0A 2FB7A 2JTFA 5DLQE 3V8JA 4DOVA 1K73C 1QVFS 5CO7A 2RHZA 1QVPA 5CKHA 5CKFA 3L2QA 2DVEA 5FU6B 2CZ0B 4M78B 4FT4A 4E7KA 2JOYA 3RMSA 3LW5E 3OA6A 3S3NA 3CCRA 3JB9F 3BDLA 2IVWA 2G3RA 5LJ5j 1Q81C 2P0PA 3JCMb 1Q7YC 2EWNA 4BI8B 1KD1U 4LDWA 3QG1A 5CK9A 1M1GA 4OVAA 4C92A 3JB9D 2XG8D 1VQKA 1NJIC 4JUVA 2M9UA 3HP9A 3QJ6A 5GMKh 3M56A 2DKGA 4MZPA 2RK1A 5GANf 5GAMj 1Q7YU 1D3BB 3DB4A 3M4GA 5KH6A 1VQOA 1X01A 2X4WA 5FLXE 1TH7A 3CC2T 3JCMe 3QZ5B 5D6WA 3QYHB 2VGMA 3SWNA 1OYXA 2Y4YA 2QQ9A 3E1SA 3MO8A 1Y07A 3FB9A 3CCLT 1JJ2A 3OYBA 2RI3A 1LNXA 2XD0A 4M7AE 5GAOl 4WF2A 3AHUA 4C8QF 1I81A 2RJDA 3OYLA 5HK3A 4C8QG 3TEEA 1XQHA 4M77A 4NL3A 3OYHA 3HRSA 2PU9B 1Y96B 2E65A 2LCCA 2P0QA 3OYJA 3MP6A 2XHCA 4C8QD 4N4HA 3WVEB 2DO3A 3JCMQ 2EFIA 4TVRA 2LT1A 2V8KA 3HPWA 1NPRA 1VQ6A 1M1FA 4FL6A 1UGPB 2CS7A 4M75F 4MZTA 5D6YA 5I2MA 3M9QA 3OQ5A 5FRMA 1YJWA 3OYKA 3CCEA 3RERA 2E10A 3OYIA 3OMCA 4JRPA 2GQVA 3M57A 3PMTA 4M75D 2K5FA 4A54A 1N9SA 2XDDA 1VQ5A 3FEOA 3CCST 4E7LA 2K5IA 1MGQA 1OZ2A 5HY6A 2LQKA 5I21A 1VQNA 2DEQA 4M7AG 3RESA 3JCMh 4C0GA 1G5VA 3V7SA 1DJ7B 2QQSA 5LJ3d 1VQPT 1VQ8T 3L2RA 2VV5A 2MWPA 5IT9E 1YIJA 3P8HA 4M7DE 1PSEA 2KQWA 2HQEA 1QVGA 3LLRA 4PJOB 3V8LA 4M78F 2K5LA 4P5NA 4M78G 3G6EA 4J7FA 1UEBA 3ER0A 1WNLA 3HL8A 2RA2A 3VUZA 3ASKA 2ZPEB 4M78D 4OP0A 2VXEA 4JLIA 4MMLA 1KQSA 3CCQA 1IREB 3CD6A 3V7RA 4R56A 3EFRA 3G71T 1UB4A 4F7UF 1VQ9T 3LX7A 3A8LB 3C4SA 4C8QC 3J81E 3JCMX 4BACA 3H8ZA 3E19A 5GMKi 1G3SA 2GFUA 3OB9A 4DOWA 1VQ4T 3QHSA 4XU3A 3CEYA 5GAOq 3QKJA 4A53A 3FC3A 2OTJT 1WJSA 2DTOA 2F69A 2O4XB 1X6OA 2RI2A 4LDYA 3WVDB 4QVDA 4V2SA 2E6ZA 3VU3C 4HT8A 2E70A 3M59A 5I2SA 2NLUA 4M75C 2FHDA 4ATOA 3L2VA 4QQDA 4ELYC 1KG1A 3JB9H 3PIPA 3OYCA 3CCUA 3L2WA 1BI1A 2ZPIB 5FU7C 1JJ2S 3Q1JA 3VV0A 4C92B 2RJEA 3CC4T 2OTJA 5LJ5e 3F70A 4JLGA 3CCJA 2LCLA 1QP3A 3CCVA 4UC4A 1WQWA 2EQMA 3HRTA 4C5GA 3VYHB 2RHIA 3RMQA 3MEVA 1PSFA 4XTUA 3S6WA 4C5IA 4JS5A 4XTXA 3L42A 1G3TA 4J8OA 2RO0A 4RKUE 5GAN8 4YTLA 4J6XA 1Q82C 5LJ3j 2WSEE 2RB6A 3T9NA 2DTHA 3EFSA 5FROA 4Y91A 5GAOm 5GAN3 2EYQA 5GAMe 3PIOA 3GP8A 3JCMf 5DY9A 1QP2A 4E7JA 1YITT 1VQMA 4M78C 3JB9J 2PVDB 1Q82U 1P92A 4KT0E 1U8RA 4HA8A 5GAN2 2XIDA 4DQ2A 4XQ3A 1ZHIA 2EQUA 4HCBA 2QTXA 2ZPFB 4EPCA 1BKBA 1JB0E 2RI5A 1SSFA 1YJ9A 1KD1C 1N27A 2EIFA 5IN1A 1G3WA 2P0KA 2L8DA 2PUKB 1KQ1A 3PGGA 4ZN3A 3OYMA 2C06A 2PVGB 3LGLA 3X25B 1FX7A 4JRQA 3HKSA 4XTVA 3ME9A 3UT1A 4OB2B 1YHQT 4J83A 2QQRA 4PJOA 3FIFA 2KDSA 3V7CA 4A4KA 2DZ9A 2WSCE 3I56A 5LJ5h 2XDPA 3SD4A 1H641 4C0FA 3HFOA 5CKDA 1QVGS 3J7AF 4PKCC 4C92E 4PJOE 2RM4A 2VXFA 5A0GA 4QVCA 4EDUA 5KCOA 4D6WA 2LQ8A 4LD9K 3UWNA 3TU4K 4ZTFA 2BUDA 3C94A 1KQSS 4C8QA 5GAMh 5FRNA 4DA4A 3DLLA 2JTMA 4M7DB 3X28B 2IG0A 3JCMW 2V8JA 3E9GA 1LOJA 1VQ7A 3CC7A 4KUIA 4L6V5 3CCSA 2DXUA 4PLLA 2VUBA 2HD0A 1FXXA 1Y71A 3CMAT 4M75A 1WPYA 2P4TA 3VKIA 2RH2A 2X35A 5AYFA 3BDUA 2QEXA 1VQ8A 3FLGA 3SB2A 4N4IA 4M77E 2F5KA 3M4YA 4MZMA 4XU0A 2EJFA 3RKYA 4RG8A 3X24B 3HRUA 4C92G 2E12A 4IUTA 3ZFJA 2LC4A 3QIIA 4QVZA 4XK8E 4KUDK 3N5BB 5DM7R 2DXTA 2DXBA 4BB7A 5J39A 3CCRT 2Y4XA 4A4GA 2LRQA 3HSBA 3DLMA 3G71A 2B8AA 5GAN6 4C0DB 1VQ9A 5KE3A 1YJNA 4MDWA 4M7AF 5CQXA 1N6AA 4X9CA 3JCMP 4M78A 4CRIA 4BY6B 2OTLA 5HKCA 2LDMA 3H6ZA 4M7AD 4XAXB 3CC2A 2VGNA 4XU2A 3JCMV 1VQOT 2RJFA 3MP1A 1O75A 3QUIA 4L5GA 5CKEA 4J7IA 3QSUA 5EG2A 3JB9I 1H3ZA 3JCMg 2JZ2A 5KE2A 3CMET 2LVMA 5LJ5f 4F7UA 4X9DA 2XK0A 2PVOB 2MMPA 3LWIA 1YCYA 3GNGA 2FVUA 1BIBA 3BW1A 1X75C 1B34B 3RKWA 2O01E 3OYYA 2QA4T 2A7YA 3JCMJ 1I4K1 3QPHA 2XICA 2DK3A 4R55A 5A0DA 1IZ6A 5LL6S 4RG2A 5GAMf 4MMKA 1MHNA 2DIGA 3PMIA 4BE2A 5LJ3e 5GMKl 2YRVA 2E1HA 3P8DA 4OGCA 3CBMA 5HK0A 1LJOA 2QDYB 2ZCFB 3NTKA 3QO3A 3A8MB 5D6XA 3VUBA 4EMHA 1K8AU 2DJZA 1KQ2A 1VQ6T 4EMKB 2KMTA 2ZGWA 2CYZB 4J5YA 3J80E 4IUVA 3URGA 3JCMc 3X26B 4M7DF 2K2VA 3C12A 3OBWA 1YJWT 2JVVA 5CVIA 4B9WA 5C0MA 1YITA 2KSSA 2RHXA 3INZA 4M7DG 1Y96A 2KAFA 4RMOA 2BKDN 3M53A 4FU6A 4LDVA 2HNIA 2GFAA 3M55A 5GANg 3OS0A 2DTIA 2E5QA 4M7DD 4IKFA 2OAUA 4ME7A 1WQ7A 2Y90A 1YI2T 2CZ1B 4Y28E 3KUFA 4IUQA 3OYAA 4BI4A 5GANj 5CR2A 3OBYA 4RCCA 3BY7A 2PUOB 4O5VA 1XTDA 4ELZC 3R6OA 4QQGA 2EQJA 3CCMT 1QW1A 4GY5A 4LD6A 1M1KU 4M7AC 4IUPA 4ZGEB 5KCHA 3OYFA 2EQKA 2M16A 3M5AA 4VUBA 1N8RC 3O8VA 1YIJT 3JAME 2L89A 1S72T 1Q86C 4PLIA 2VC8A 1M9SA 4O6JA 2V8IA 5A2QE 1YHQA 2R5MA 4PNOA 4OB1B 5FU6C 1K9MU 4IUUA 3SWNB 2KK4A 4ZTJA 4HCCA 4LDXA 1N8RU 2XI9A 5LJ3h 1Q86U 4FIBA 2K3XA 1KHCA 1VIFA 2R57A 4IURA 3I55T 2R5AA 2HAXA 3PTAA 5DLOA 3C95A 1BI2A 2EAYA 4XTZA 2M0OA 1NZ9A 4LDUA 4OMFB 3OYNA 4M75B 4NL2A 2MAMA 3OSSC 4M77B 4NOYA 4B9XA 2DXCA 1U1SA 3G4ST 1I8FA 4BI3A 4XTYA 1XOVA 2BIVA 4OGEA 3CCLA 3EAEA 1OZ3A 2XDBA 3OYGA 5GAOr 4QW2A 5FU7B 3CMAA 3MEWA 2RJCA 2ZPBB 5A0LA 4M7DC 3A8OB 1M90U 3JRZA 2D6FA 3GNFB 1HXDA 3HFNA 3FDRA 1VIEA 2O4XA 3OY9A 3CXCA 1W2BA 5J26A 2MWOA 1M8VA 5C6SA 3M54A 4C5EA 5LJ5g 1AHJB 2AHJB 4BE0A 3CCJT 3PNWC 2DD5A 2EJ9A 2DIQA 3DB3A 4A4HA 3JCMd 3CCVT 5IAYA 5J3BA 3OMGA 5GMKj 3JB9G 4C8QE 3GF5A 1K73U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GMK i;  3GIB A;  5GAM g;  1N9R A;  3QHS A;  4XU3 A;  4X9C A;  5GAO q;  4M78 A;  3JCM P;  4A53 A;  4F7U B;  2DTO A;  4QVD A;  4M7A D;  4V2S A;  3L1A A;  4XU2 A;  3JCM V;  2YHT A;  3QUI A;  3VU3 C;  5GMK m;  5GAN 4;  4HT8 A;  4M7A B;  4M75 C;  3QSU A;  3JB9 I;  4M75 E;  3JCM g;  4C92 F;  4JRI A;  4J6Y A;  4PJO F;  4EMG A;  5LJ5 f;  3BFM A;  4PJO G;  4EMK A;  4F7U A;  4X9D A;  3JB9 H;  1YCY A;  2FB7 A;  2JN0 A;  3V8J A;  1BIB A;  3BW1 A;  4C92 D;  1HK9 A;  4N0A C;  1B34 B;  3RKW A;  5LJ3 f;  5GAO n;  5CAI A;  4M7A A;  4PJO D;  3V8K A;  3JCM J;  1I4K 1;  2DVE A;  4C92 B;  4M78 B;  5LJ5 e;  5GAN d;  2I2L A;  5GAM f;  3JB9 F;  1WQW A;  4MMK A;  5LJ5 j;  4XTU A;  2K57 A;  3L2Z A;  3JCM b;  5LJ3 e;  2EWN A;  4XTX A;  5GMK l;  5GAN 8;  2E1H A;  1LJO A;  4J6X A;  4EMH A;  3QO3 A;  4C92 A;  2RB6 A;  5LJ3 j;  2DTH A;  3EFS A;  5GAO m;  4Y91 A;  2DJZ A;  4JUV A;  5GAN 3;  3JB9 D;  1KQ2 A;  4EMK B;  2ZGW A;  5GAM e;  5GMK h;  3JCM f;  5DY9 A;  4J5Y A;  2DKG A;  4M78 C;  1U1T A;  3JCM c;  2E41 A;  5GAN f;  5GAM j;  3JB9 J;  4M78 E;  4M7D F;  1D3B B;  2RD1 A;  4M77 F;  3M4G A;  3INZ A;  4M75 G;  4HA8 A;  5GAN 2;  1Y96 A;  4M77 G;  4M7D G;  4DQ2 A;  1X01 A;  4XQ3 A;  2DZC A;  2HNI A;  2QTX A;  5GAN g;  2DTI A;  2E64 A;  1TH7 A;  3JCM e;  4M7D D;  4M77 D;  1WQ7 A;  5GAN e;  2Y90 A;  3RKX A;  3SWN A;  4EMK C;  1D3B A;  4F7U E;  1KQ1 A;  3PGG A;  5GAN j;  3FB9 A;  2YLC A;  4RCC A;  4XU1 A;  3BY7 A;  4M7A C;  4PJO B;  1LNX A;  4M7A E;  5GAO l;  4WF2 A;  3AHU A;  4C8Q F;  1I81 A;  1M5Q 1;  4C8Q G;  4M7D A;  5GAO p;  4XTV A;  2YLB A;  4M77 A;  4NL3 A;  1Y96 B;  2E65 A;  2VC8 A;  4J6W A;  4C8Q D;  4PJO A;  3FIF A;  3V7C A;  2DZ9 A;  3JCM Q;  5LJ5 h;  2EJG A;  1H64 1;  4C92 C;  3HFO A;  4JRK A;  4PNO A;  4RCB A;  4PJO C;  4C92 E;  3SWN B;  4PJO E;  2RM4 A;  2VXF A;  4M75 F;  4QVC A;  5LJ3 h;  3RER A;  2E10 A;  4M75 D;  4A54 A;  4C8Q A;  1N9S A;  5GAM h;  2EAY A;  4XTZ A;  4M7D B;  4M75 B;  4NL2 A;  4NOY A;  4M77 B;  4F7U G;  3RIR A;  3JCM W;  1LOJ A;  1BIA A;  1U1S A;  1I8F A;  3SWN C;  1MGQ A;  4XTY A;  3RUX A;  5LJ5 d;  2DXU A;  5I21 A;  4M7A G;  2DEQ A;  3RES A;  1JRI A;  3JCM h;  5GAO r;  2CGH A;  3V7S A;  4M75 A;  5LJ3 d;  5GAN h;  1WPY A;  3BDU A;  4M7D C;  5GAN 5;  4M77 C;  3SB2 A;  4M7D E;  4M77 E;  5GAM d;  1JBM A;  3V8L A;  1HXD A;  4M78 F;  3RKY A;  3HFN A;  2EJF A;  4XTW A;  4XU0 A;  4C8Q B;  4M78 G;  4N0A A;  4C92 G;  1WNL A;  1M8V A;  2RA2 A;  4M78 D;  4OP0 A;  2VXE A;  4JLI A;  4MML A;  3FJP A;  5LJ5 g;  5GAN 7;  1I5L A;  2EJ9 A;  2DXT A;  3JCM d;  3V7R A;  5GMK e;  3EFR A;  4HT9 A;  4F7U F;  5LJ3 g;  3HSB A;  2FYK A;  4C8Q C;  5GAN 6;  5GMK j;  3JB9 G;  3JCM X;  4C8Q E;  4M7A F;  1B34 A; 
#chains in the Genus database with same CATH topology
 1N9R A;  4KH0 B;  3MHX A;  4F7U B;  3KBG A;  3L1A A;  3R6N A;  5GMK m;  1AOJ A;  2QQA A;  2YHT A;  1QKX A;  1WFW A;  3DKM A;  1E6G A;  1U3O A;  4C92 F;  1WHH A;  4LXC A;  4C92 D;  5GAO n;  2B86 A;  2I2L A;  3EGX A;  4OMM A;  3VS1 A;  1GCP A;  4FM4 B;  1VUB A;  3OW2 A;  2CUD A;  3NTH A;  4RTV A;  1VQ4 A;  3QDF A;  2DET A;  1FMK A;  5IHN A;  2E41 A;  2OTJ A;  4FYV B;  3UPU A;  4M77 F;  1CKA A;  1D0Y A;  1GXI E;  4BDY A;  2KNB B;  1AD5 A;  2K3Y A;  4M77 D;  1NBE B;  2KY9 A;  4HVU A;  3RKX A;  3CC7 T;  1D3B A;  4F7U E;  4Q5W A;  2YLC A;  2O9S A;  2GNC A;  3PT9 A;  1QQJ A;  1WHM A;  3LGF A;  1E7O A;  3MET A;  3OS1 A;  2KE9 A;  4J6W A;  2QI2 A;  4JRK A;  4RCB A;  4PJO C;  3CXC S;  1W2B S;  1UGR B;  2QQB A;  1SRL A;  4KBM B;  4PL6 A;  2X4Y A;  3GLX A;  2XMF A;  3MPU B;  1M2V A;  1ABQ A;  2DYB A;  2DL4 A;  2FG0 A;  5HCK A;  2X4J A;  3CC2 Q;  3RUX A;  2PTK A;  4LUD A;  4FSS A;  3CCL Q;  1Y7X A;  4DEY A;  2K7A A;  2CT4 A;  4BDZ A;  1BK2 A;  1Q7Y R;  1JBM A;  2M1H A;  3G6E T;  1UJY A;  1S1N A;  4FW1 A;  1D1A A;  4KUL A;  2A08 A;  2LJ1 A;  3PFS A;  1WHG A;  2LT4 A;  1W4S A;  4LNP A;  5GAN 7;  1TUG B;  1E6H A;  2ZPG B;  5GMK e;  1TUC A;  2LX9 A;  5LJ3 g;  2EYZ A;  2FYK A;  4JS4 A;  4ZGD B;  2HQX A;  3MJX A;  3CPW S;  1NYF A;  4A4F A;  2ZZD A;  2ED0 A;  2EW3 A;  2FPF A;  1X43 A;  1VQP Q;  3BFM A;  2JTF A;  5DLQ E;  5CO7 A;  4RTX A;  5CKF A;  3CME Q;  3L2Q A;  5FU6 B;  4M78 B;  2NWM A;  4FT4 A;  3OA6 A;  3RR6 A;  3BDL A;  2P0P A;  1M1G A;  4OVA A;  2XG8 D;  4JUV A;  2M9U A;  3G1J A;  2F2X A;  1VQO A;  1RAC B;  3TSZ A;  1AVZ C;  3QYH B;  3M0S A;  2HSP A;  1YWO A;  2QQ9 A;  3E1S A;  3MO8 A;  1JJ2 A;  4EIK A;  2XD0 A;  5GAO l;  4WF2 A;  3NGP A;  1XQH A;  4NL3 A;  1MV3 A;  3OYH A;  3HRS A;  3OYJ A;  3MP6 A;  2DMO A;  4N4H A;  3WVE B;  2EFI A;  3M0P A;  4TVR A;  2CS7 A;  4MZT A;  1M3A A;  1TOV A;  3OQ5 A;  5FRM A;  1YJW A;  1ZSG A;  1U06 A;  2GQV A;  4PJJ A;  1KFZ A;  2CH4 A;  4E7L A;  2K5I A;  1F1B B;  2DEQ A;  1EFN A;  4C0G A;  4CC7 A;  2MWP A;  2VKN A;  3P8H A;  3JV3 A;  1QVG A;  1I07 A;  2J6K A;  3IQL A;  4P5N A;  1FMW A;  3G6E A;  1UEB A;  1VA7 A;  3VUZ A;  3ULR B;  2AZV A;  4MML A;  3QWY A;  4R56 A;  1W1F A;  4J9F A;  4F7U F;  3LX7 A;  2YWW A;  3J81 E;  2A36 A;  1UDL A;  4DOW A;  3QHS A;  5GAO q;  2RI2 A;  3WVD B;  4V2S A;  2E6Z A;  1MMA A;  5IXF A;  2KT1 A;  5I2S A;  2NLU A;  2HL3 A;  2FHD A;  2DEU A;  2K3B A;  3L2W A;  3CC4 T;  3MKD A;  2RJE A;  3CCV A;  2EQM A;  1BBZ A;  3HRT A;  3QWX X;  1Q82 C;  3MEV A;  4XTU A;  4XTX A;  4RKU E;  3O5Z A;  2RB6 A;  3EFS A;  1RAI B;  3PIO A;  4E7J A;  2J6F A;  2E4H A;  1YIT T;  2C0I A;  2QTV A;  4M78 C;  1U8R A;  4HA8 A;  3VRY A;  2JMC A;  2I0N A;  4EPC A;  1BKB A;  1JB0 E;  2RI5 A;  1G3W A;  2L8D A;  1GCQ C;  2PUK B;  2M0Y A;  1PRM C;  2C06 A;  2PVG B;  1FX7 A;  1M27 C;  3EG9 B;  3UAT A;  4J9B A;  4OB2 B;  2KGT A;  3EFO A;  2QQR A;  2KDS A;  2WSC E;  5LJ5 h;  2HKQ B;  2JT4 A;  5A0G A;  2YXY A;  1KQS S;  1ARK A;  3CCE Q;  5FRN A;  2HEQ A;  2JTM A;  4M7D B;  3JCM W;  1TUD A;  2V8J A;  1VQ7 A;  1FMV A;  1VQ5 Q;  2DXU A;  2JS2 A;  2HD0 A;  1Y71 A;  2HKN A;  2KR3 A;  1K8A R;  2JW4 A;  2RH2 A;  2X35 A;  2QEX A;  2NYS A;  3SB2 A;  1BCM A;  4MZM A;  4C92 G;  2EJF A;  1YIJ Q;  1MV0 B;  1RAF B;  3M0Q A;  3ZFJ A;  2LC4 A;  2BE9 B;  2KRS A;  4KUD K;  2OAW A;  3CCR T;  2CP0 A;  3SHW A;  2FRY A;  4CC2 A;  3HSB A;  3DLM A;  2B8A A;  4C0D B;  3CD6 Q;  1M1K R;  2DBK A;  4X9C A;  2L3P A;  4CRI A;  4HXJ A;  1GBR A;  4XU2 A;  3QUI A;  5CKE A;  4J7I A;  2P4R A;  1WHJ A;  2OX7 A;  2JZ2 A;  1N8R R;  3CME T;  2DL3 A;  2LVM A;  4X9D A;  2XK0 A;  1YCY A;  2FVU A;  3BW1 A;  2ABL A;  2QGF B;  3CCU Q;  4KGX B;  2FZK B;  5A0D A;  1IZ6 A;  5GAM f;  2L2P A;  2F2V A;  1GL5 A;  2YRV A;  4OGC A;  2ZCF B;  3VUB A;  2KYM A;  2X51 A;  1KQ2 A;  1WLP B;  1VQ6 T;  2ZGW A;  2CYZ B;  4J5Y A;  1RAD B;  2K2V A;  3C12 A;  2JVV A;  1YIT A;  4B9W A;  2RHX A;  1Y96 A;  4LDV A;  3M53 A;  2KXD A;  1TSF A;  3M55 A;  4LE9 A;  1GRI A;  1UG1 A;  2OAU A;  1SHG A;  2CZ1 B;  4Y28 E;  1BB9 A;  3OYA A;  1H8K A;  2PUO B;  1XTD A;  3EGD B;  2LP5 A;  1RAH B;  4VUB A;  2X3W D;  1Q86 C;  1M9S A;  2V8I A;  4F04 B;  2R5M A;  4OB1 B;  1C1A A;  5LJ3 h;  1TXQ A;  2EPD A;  4IUR A;  2R57 A;  2DER A;  2R5A A;  5KYU A;  5KYY A;  1SRM A;  3CC2 A;  1NZ9 A;  4M75 B;  2MAM A;  3A1P A;  4M77 B;  1T3S A;  4PJN A;  4BI3 A;  1PM3 A;  2BIV A;  3H0H A;  3CCL A;  1SPK A;  1OZ3 A;  3CC7 Q;  4M7D C;  3EHQ A;  1PC0 A;  2COY A;  1VQ8 Q;  5J26 A;  2MWO A;  4PFZ A;  2DIL A;  3M54 A;  3CCJ T;  1HSQ A;  2DD5 A;  1RAE B;  4GLM A;  2RQW A;  1EZZ B;  1D1B A;  4C8Q E;  3QBY A;  2RQU A;  1VQM T;  1ZUK A;  3TVT A;  2DD4 A;  5I11 A;  4BD3 A;  2JUF A;  3OW2 P;  3L2U A;  2GQI A;  1T3L A;  1ZA1 B;  1VQP A;  3OYD A;  4E47 A;  4M75 E;  4C0D C;  4J9I A;  1WHL A;  2JXB A;  4JRI A;  4AFS C;  2BZ8 A;  4PJO G;  1NJI U;  5M9O A;  2J7I A;  1UGQ B;  3CME A;  4FT2 A;  4N0A C;  4Z88 A;  3QZ9 B;  4M7A A;  1D09 B;  3LH0 A;  1KC8 U;  1ZSZ A;  4RUG A;  1SEM A;  2LNH B;  4HKE A;  4ORZ A;  3CBO A;  2DBM A;  5CKB A;  3I5R A;  2XKO C;  4J9C A;  4A4E A;  1NEB A;  2E64 A;  4Z89 A;  2F5T X;  1V29 B;  1K8A C;  4XU1 A;  1TS9 A;  2MF2 A;  1M5Q 1;  1O9S A;  1WXU A;  4OML A;  4BUG A;  1PCX A;  3S3M A;  2DYI A;  3G7Z A;  4C92 C;  3A5Z B;  3CCE T;  3OYE A;  1WA7 A;  1YHQ Q;  1HD3 A;  2GCX A;  3ZBD A;  1YBY A;  1M1K C;  1VQ5 T;  3VS2 A;  3NFC A;  1B07 A;  4F7U G;  1JQQ A;  2X4X A;  2RK2 A;  1ZA2 B;  1KD1 R;  1WJQ A;  2CT3 A;  4II1 A;  2L5Q A;  2RHU A;  1IXD A;  1YCS B;  3LYI A;  2LNV A;  1UUE A;  4M77 C;  3CMA Q;  1RI0 A;  5IHK A;  1WJR A;  5GAM d;  2QAS A;  4E7H A;  4GLK A;  1T0J A;  3CD6 T;  1UTI A;  1I5L A;  3FJP A;  3VYG A;  1YNZ A;  4HT9 A;  1OPK A;  1SKU B;  1RLP C;  1M4Z A;  3LWH A;  3TSW A;  2A3L A;  4Z02 A;  1B34 A;  3OS5 A;  3HHT B;  1PNJ A;  5GAN 4;  3AT1 B;  3NMZ C;  1AWW A;  1D1C A;  3NTI A;  3CCU T;  3QXE B;  3P8B B;  1QVF S;  2P84 A;  1QVP A;  2DVE A;  4E7K A;  2JOY A;  4JPB W;  1Q81 C;  4BI8 B;  1MND A;  2E5K A;  5CK9 A;  3QJ6 A;  5GMK h;  3M56 A;  2PZ1 A;  5GAN f;  5GAM j;  1D3B B;  3DB4 A;  5KH6 A;  2LX7 A;  2X4W A;  1AWJ A;  1K9A A;  3QZ5 B;  2QK0 A;  2FRW A;  4K11 A;  4F14 A;  1I1J A;  1Y07 A;  3FB9 A;  3OYB A;  1QCO A;  2CSQ A;  1OV3 A;  1YI2 Q;  4C8Q F;  2YRD A;  4F16 A;  3CC4 Q;  2PU9 B;  3CCM Q;  2AK5 A;  2LCC A;  4AFQ C;  4C8Q D;  2HSE B;  4FL6 A;  1QVG P;  4M75 F;  2C0O A;  3OYK A;  3CCE A;  3RNJ A;  3RER A;  2E3H A;  1PKT A;  1YIT Q;  3PMT A;  1QMC A;  4M75 D;  2JJ9 A;  1N9S A;  1VQ5 A;  2LMJ A;  4E7Z A;  1G2B A;  1PKS A;  1G5V A;  3V7S A;  1DJ7 B;  1VQ8 T;  3L2R A;  1JU5 C;  1YIJ A;  2HQE A;  1Q82 R;  3VS4 A;  4M78 G;  1PHT A;  4J7F A;  3HL8 A;  2RA2 A;  4CC3 A;  3ASK A;  5KYX A;  4JLI A;  3CD6 A;  2L3Q A;  1VQ9 T;  3JCM X;  2DL7 A;  4BAC A;  3H8Z A;  3E19 A;  5GMK i;  1G3S A;  2GFU A;  2RQT A;  4XU3 A;  1MUZ A;  1UFF A;  2FO0 A;  4A53 A;  3FC3 A;  1X6O A;  4HT8 A;  2E70 A;  4QQD A;  2EBP A;  3JB9 H;  1VYV A;  3CCU A;  4DEX A;  1W70 A;  3PVL A;  1VQL Q;  2ESW A;  2ZPI B;  1X2Q A;  3Q1J A;  3VV0 A;  2YUN A;  4JLG A;  2LCL A;  2OI3 A;  1NG2 A;  4C5G A;  3VYH B;  2OJ2 A;  4JS5 A;  2LJ0 A;  3L42 A;  5GAN 8;  1B7T A;  3CCR Q;  5FRO A;  1K1Z A;  5GAO m;  5GAM e;  3JCM f;  5DY9 A;  2EKH A;  2KBT A;  2D8J A;  1VQK Q;  4PK4 A;  4HCB A;  1KD1 C;  2EIF A;  2MPX C;  2EGC A;  5FWC A;  1QWF A;  3LGL A;  4D8K A;  4FYW B;  3HKS A;  3UT1 A;  1YP5 A;  1YHQ T;  4J83 A;  3V7C A;  4A4K A;  3SD4 A;  1UHF A;  1H64 1;  3VS6 A;  3J7A F;  2GTJ A;  4PKC C;  1HJD A;  2DA9 A;  2ECZ A;  1VQ6 Q;  2LQ8 A;  4LD9 K;  1OQK A;  2BZX A;  3C94 A;  4DBF A;  3X28 B;  3CC7 A;  4L6V 5;  2VUB A;  1FXX A;  3CMA T;  2KRN A;  2MCN A;  5AYF A;  3BDU A;  1VQ8 A;  3FLG A;  2EYW A;  3RKY A;  4RG8 A;  2JMA A;  2E12 A;  1QLY A;  3UF4 A;  2DXT A;  2DXB A;  2W10 A;  2LRQ A;  2J06 A;  1IGQ A;  5GAN 6;  1VQ9 A;  3EH2 A;  3THK A;  1N6A A;  4M78 A;  4BY6 B;  4HVV A;  3MP1 A;  4L5G A;  1K9M R;  5IXB A;  1M8M A;  2NUP B;  1Q86 R;  1GCQ A;  2PVO B;  2MMP A;  4E7S A;  2GTO A;  2J6O A;  1T0H A;  1YN8 A;  2O01 E;  4OMP A;  1I4K 1;  2XIC A;  1WXT A;  1MHN A;  2DIG A;  4JZ3 A;  3CCJ Q;  1M30 A;  2JS0 A;  5HK0 A;  2NUT B;  3A8M B;  2DJZ A;  1QCF A;  2C0T A;  4EMK B;  2KMT A;  1M90 R;  1OX9 A;  1VQM Q;  4M7D G;  2KSS A;  3INZ A;  2KAF A;  3VS7 A;  1WQ7 A;  1YI2 T;  5GAN j;  3CCM T;  2EYY A;  1QW1 A;  4GY5 A;  3D7S B;  4GBQ A;  1K73 R;  4ZGE B;  5KCH A;  2EQK A;  2M16 A;  1A0N B;  2ED1 A;  4A63 B;  4PLI A;  4QT7 A;  4E2F B;  2VC8 A;  1YHQ A;  2EGA A;  5FU6 C;  4PNO A;  1AEY A;  2DJQ A;  2CDT A;  3SWN B;  4ZTJ A;  4HCC A;  3PTA A;  4AFZ C;  2VWF A;  4Y92 A;  2M0O A;  4LDU A;  4OMF B;  2A37 A;  4NL2 A;  4RTT A;  2DXC A;  4RTZ A;  2AT1 B;  4XTY A;  5GAO r;  1UE9 A;  3PE0 A;  3CCS Q;  5FU7 B;  3CMA A;  2RJC A;  2CP7 A;  2ZPB B;  5A0L A;  2D6F A;  3GNF B;  4JZ4 A;  1IO6 A;  3H0I A;  3HFN A;  3OY9 A;  3CXC A;  2CH4 W;  1W2B A;  5C6S A;  4C5E A;  4BE0 A;  2EJ9 A;  4A4H A;  2DIQ A;  3JCM d;  5IAY A;  2YT6 A;  3GF5 A;  1RUW A;  1BCO A;  3WXM B;  2DRM A;  1NEG A;  4OF1 A;  5GAM g;  5FWB A;  2FZG B;  5CQY A;  1BI0 A;  1VQL T;  5I22 A;  1UGS B;  2GBQ A;  2G6F X;  3MEU A;  3QJY A;  1JEG A;  1YJ9 T;  1KC8 C;  1UGV A;  1UHC A;  4BY6 C;  2DRK A;  2CZ6 B;  1NM7 A;  1WHK A;  3MEA A;  4J9D A;  1R8O B;  2K57 A;  3L2Z A;  4L59 A;  4E7I A;  3S3O A;  1VQK T;  3I56 T;  2PQW A;  3QYG B;  3UDC A;  3SDZ A;  3CPW A;  1M2O A;  1K0X A;  1V76 A;  3MCA B;  3GOX A;  1U1T A;  3EG9 A;  3JSC A;  5GAO p;  2DAQ A;  1JXO A;  4M75 G;  2RNA A;  4M77 G;  2WAC A;  5GJW B;  2HQH A;  4ZN1 A;  5GAN e;  2KVQ G;  2HL5 C;  4EMK C;  4CI0 C;  1OOT A;  1YI2 A;  2VYT A;  2ZPH B;  1PG5 B;  4NS5 A;  3CC4 A;  1MMN A;  3CCM A;  1VYU A;  5KYW A;  4M7D A;  1ZQ1 A;  2O2O A;  3CPF A;  4X1V A;  5CCA A;  9ATC B;  1B3Q A;  2IIM A;  5KYU B;  2EKO A;  2KEA A;  3TCJ A;  8AT1 B;  2XU8 A;  8ATC B;  2CZ7 B;  1OEB A;  3CBP A;  1YJN T;  2FL7 A;  1OI1 A;  3RIR A;  2GF7 A;  3SWN C;  1XNI A;  4AG2 C;  4C0Z A;  2OTL T;  3OSV A;  1K9M C;  3A8H B;  4QKU A;  4PJL A;  1R0B G;  6AT1 B;  2CGH A;  1JXM A;  1H92 A;  1KK7 A;  4CC4 B;  1M3C A;  2D0Q B;  3GPL A;  3C0C A;  1Q81 R;  4C8Q B;  1ZBX A;  4FW2 A;  2F1L A;  4N0A A;  2K4Y A;  4JDS A;  3MP8 A;  3TRE A;  2D1X A;  1WZO A;  4JJN K;  4D8D A;  4J9H A;  1M90 C;  3OW2 S;  2QDL A;  3KFV A;  2YSQ A;  5IH2 A;  1H3H A;  1KHI A;  3NHN A;  4M7A B;  3FRN A;  2LZ6 B;  4J6Y A;  3ZEH A;  1VQL A;  2MYS A;  1NLP C;  2R58 A;  1WXB A;  2RQV A;  2FB7 A;  1K73 C;  2RHZ A;  5CKH A;  1R77 A;  2FZC B;  3S3N A;  4R0K A;  3LW5 E;  3CCR A;  2G3R A;  1X2K A;  2EWN A;  2QA4 Q;  4LDW A;  2SRC A;  3FJ5 A;  4C92 A;  1VQ9 Q;  1VQK A;  3EGD A;  1CSK A;  1Q7Y U;  3M4G A;  5FLX E;  3JCM e;  1OYX A;  1K4U S;  2Y4Y A;  2RI3 A;  3H9N A;  1LNX A;  4M7A E;  1I81 A;  2RJD A;  4M77 A;  2P0Q A;  2XHC A;  2DO3 A;  3JCM Q;  2V8K A;  2D0N A;  3HPW A;  1VQ6 A;  1M1F A;  3VS0 A;  5D6Y A;  1S72 Q;  5I2M A;  2E10 A;  4JRP A;  3M57 A;  4FYX B;  1WDX A;  2K5F A;  1WX6 A;  3CCS T;  3I55 Q;  2LQK A;  3RES A;  4B6M A;  1ABO A;  1TWB A;  2QQS A;  3G4S Q;  2VV5 A;  2FEI A;  1AZE A;  1PSE A;  3V8L A;  2K5L A;  1X27 A;  3ER0 A;  5IT9 E;  2ZPE B;  1KQS A;  1IRE B;  3EFR A;  5EC7 A;  1I5O B;  3A8L B;  4C8Q C;  2DE0 X;  2IPO B;  1VQ4 T;  3CEY A;  2OTJ T;  1WJS A;  2F69 A;  2O4X B;  4LDY A;  2QGG A;  3VS5 A;  4M75 C;  2RF0 A;  1K0S A;  3PIP A;  2DVJ A;  2CRE A;  2EVR A;  3OYC A;  1BI1 A;  2BE7 D;  2CP2 A;  2W0Z A;  1JJ2 S;  4DBQ A;  3CCJ A;  2AKL A;  1WQW A;  2RHI A;  3RMQ A;  1PSF A;  1G3T A;  4J8O A;  1RAG B;  4YTL A;  2DTH A;  3EG3 A;  4Y91 A;  5GAN 3;  4WTO B;  2CP6 A;  2EYQ A;  1VQM A;  1XJW B;  3JB9 J;  1P92 A;  4KT0 E;  2JTE A;  3EHR A;  1R0C B;  5GAN 2;  2XID A;  4XQ3 A;  2EQU A;  2QTX A;  2ZPF B;  3EGX B;  1N27 A;  5IN1 A;  2CP5 A;  1OX8 A;  3OYM A;  2AIR B;  4JRQ A;  4XTV A;  2DL8 A;  3ME9 A;  4PJO A;  3FIF A;  2A28 A;  2DZ9 A;  1QVG S;  5CKD A;  3HFO A;  4PJO E;  2RM4 A;  4QVC A;  5KCO A;  2PNI A;  4PFO A;  3TU4 K;  4ZTF A;  5GAM h;  1SSH A;  3DLL A;  1LOJ A;  2CSI A;  3CCS A;  2COZ A;  1VQN Q;  2P4T A;  5D7U A;  3LH5 A;  4ESR A;  5KYX B;  4DBR A;  4N4I A;  2F5K A;  1M2V B;  3M4Y A;  4XU0 A;  2MIO A;  3HRU A;  4IIO A;  4IUT A;  2DF6 A;  3N5B B;  2K2M A;  1PD1 A;  1QVF P;  5J39 A;  1WYX A;  4A4G A;  7AT1 B;  2LQW A;  2EQI A;  3CCQ Q;  2QYZ A;  5KE3 A;  4M7A F;  5CQX A;  1NLO C;  3JCM P;  4OMO A;  4E6R A;  5HKC A;  2LDM A;  3H6Z A;  4J9E A;  4M7A D;  4XAX B;  2VGN A;  1LCK A;  1VQO T;  2JM8 A;  3QSU A;  3JB9 I;  1H3Z A;  3JCM g;  5KE2 A;  1RLQ C;  5LJ5 f;  2VB6 A;  4F7U A;  1AWX A;  1IGU A;  2VAS A;  2KXC A;  1X75 C;  2QA4 T;  3JCM J;  2A7Y A;  3QPH A;  3M0R A;  4R55 A;  1HYO A;  4RG2 A;  5LL6 S;  4BE2 A;  5GMK l;  1I0C A;  4OMN A;  1K8A U;  3QO3 A;  4ZNX A;  1KIK A;  1X6G A;  4IUV A;  2X3X D;  3JCM c;  3URG A;  3J80 E;  1YJW T;  3OBW A;  1X69 A;  4RTY A;  2BKD N;  2DFU A;  2HNI A;  2V1Q A;  1CKB A;  3I9Q A;  4JJD A;  4ME7 A;  4AG1 C;  2Y90 A;  3KUF A;  4IUQ A;  2O31 A;  1YJ9 Q;  1U5S A;  4RCC A;  3BY7 A;  3R6O A;  1M1K U;  1GFC A;  4IUP A;  3OYF A;  3JAM E;  1RAB B;  1S72 T;  1ZLM A;  4O6J A;  2HMA A;  5A2Q E;  5IHI A;  3I56 Q;  1N8R U;  1PD0 A;  1NJI R;  1VIF A;  2RQR A;  3CXC P;  2EGE A;  3I55 T;  1W2B P;  3C95 A;  1BI2 A;  2EAY A;  4XTZ A;  4IIM A;  3OYN A;  4NOY A;  4B9X A;  3OSS C;  2YUQ A;  1U1S A;  3G4S T;  1KC8 R;  1NYG A;  2SEM A;  1XOV A;  3OYG A;  4LUE A;  2O88 A;  3A8O B;  1Q95 G;  1BU1 A;  3JRZ A;  1VIE A;  1VOM A;  1W6X A;  2KT8 A;  2RMO A;  1VYT A;  3PNW C;  2L0A A;  3RBB B;  3DB3 A;  2KRM A;  3CCV T;  5J3B A;  5L23 A;  3GP8 A;  4HCZ A;  1ACM B;  1TTH B;  4AFU C;  3G71 Q;  4N4G A;  5CIU A;  2Z0W A;  1YJN Q;  1WGS A;  1BI3 A;  3CPW P;  1Q81 U;  2OTL Q;  1UEC A;  1AWO A;  5GJV B;  4PJO F;  2DL5 A;  2NUZ A;  3UA6 A;  1HK9 A;  5LJ3 f;  4PJO D;  3V8K A;  4FSX A;  2CP3 A;  5GAN d;  2QA4 A;  2J05 A;  3EG1 A;  3VJP A;  2WSF E;  1ZUU A;  1RL2 A;  2MI6 A;  1EIF A;  5L8R E;  1FWZ A;  2QXF A;  4M78 E;  2RD1 A;  1BYM A;  3UA7 A;  2L3R A;  2DZC A;  1RAA B;  3X20 B;  4J9G A;  1NE8 A;  4QQ6 A;  1VQ7 T;  3ZL7 C;  1QVF A;  3M58 A;  4OB0 B;  2YRC A;  2QEX T;  2YLB A;  3EH1 A;  1TG0 A;  1S72 A;  3SFM A;  2EJG A;  2DPP B;  4KGV B;  2A0F B;  3REA B;  4BE1 A;  2O9V A;  3E9F A;  1YFN A;  3KXT A;  3I55 A;  1MMG A;  1NPP A;  2CKK A;  1G3Y A;  4C5H A;  1VQN T;  3H0F A;  3EFO B;  1BIA A;  2K79 A;  4X34 A;  2VVK A;  5LJ5 d;  2HBP A;  3G4S A;  4HCK A;  1K76 A;  3A8G B;  1JRI A;  4MDX A;  5GAN h;  4OB3 B;  5GAN 5;  3OS2 A;  5CAI A;  4XTW A;  2HBW A;  3CCQ T;  2E6N A;  2F2W A;  2D9T A;  1X6B A;  2NUP A;  2H3J A;  2JNG A;  1D0Z A;  1YWP A;  2ATC B;  2QG9 B;  1AT1 B;  3QDR B;  3GIB A;  1M3B A;  1ZUY A;  2RHY A;  4HVW A;  1SF9 A;  2BTT A;  1G83 A;  2NUT A;  2LCS A;  2RPN A;  4EMG A;  4EMK A;  2LTO A;  4ZGJ B;  2JN0 A;  4DOV A;  3V8J A;  2DNU A;  3I35 A;  3HTR A;  2CZ0 B;  2X9H A;  4M4Z A;  3RMS A;  3JB9 F;  2IVW A;  5LJ5 j;  3M0T A;  1Q7Y C;  3JCM b;  1KD1 U;  3QG1 A;  3JB9 D;  1NJI C;  3HP9 A;  4OMQ A;  5FW9 A;  2DKG A;  4MZP A;  2RK1 A;  1VQ4 Q;  1X01 A;  2OTJ Q;  1TH7 A;  3CC2 T;  5D6W A;  2VGM A;  4KH1 B;  5KYW B;  3SWN A;  1PWT A;  3EG0 A;  3VRZ A;  3CCL T;  1V1C A;  2LJ3 A;  3AHU A;  3OYL A;  5HK3 A;  4FCY A;  4RTU A;  4C8Q G;  3TEE A;  1OU8 A;  1Y96 B;  2E65 A;  2M02 A;  2LT1 A;  1NPR A;  5AT1 B;  2V1R A;  1UGP B;  2LQN A;  3U23 A;  3M9Q A;  3OYI A;  3OMC A;  4A54 A;  2XDD A;  1KQS P;  3FEO A;  1MMD A;  1MGQ A;  1OZ2 A;  5HY6 A;  5I21 A;  1VQN A;  4M7A G;  3REB B;  3JCM h;  5LJ3 d;  1VQP T;  2CUB A;  4M7D E;  2KQW A;  2YUP A;  3LLR A;  5KYY B;  4M78 F;  2HDA A;  1FYN A;  2JM9 A;  4F17 A;  1WNL A;  1QCN A;  4M78 D;  4OP0 A;  2VXE A;  1IB8 A;  2HCK A;  4KGZ B;  3CCQ A;  3V7R A;  3G71 T;  1UB4 A;  1SHF A;  3C4S A;  1LPL A;  3OB9 A;  3QKJ A;  1OU9 A;  2DTO A;  4QVD A;  1N5Z A;  3VU3 C;  3M59 A;  2L3S A;  4ATO A;  3L2V A;  2EYX A;  4ELY C;  1KG1 A;  2QAZ A;  2RN8 A;  2DX1 A;  5FU7 C;  2H3E B;  4C92 B;  5LJ5 e;  3F70 A;  1EX4 A;  2K6D A;  1QP3 A;  2ROL A;  4UC4 A;  4C5I A;  3S6W A;  2RO0 A;  2AKK A;  4J6X A;  5LJ3 j;  2WSE E;  3I5S A;  3T9N A;  1QP2 A;  1Y0M A;  2PVD B;  1Q82 U;  1UJ0 A;  4DQ2 A;  1ZHI A;  4LN2 A;  2KRO A;  4Z8A A;  3BE3 A;  2MOX A;  2H8H A;  1VQO Q;  1SSF A;  1ZSZ B;  3NPF A;  1YJ9 A;  1OPL A;  2P0K A;  1WI7 A;  1PRL C;  1KQ1 A;  3PGG A;  4ZN3 A;  1C6V X;  3X25 B;  2K9G A;  3H41 A;  3I56 A;  2E3I A;  2XDP A;  4C0F A;  3SEM A;  3TQ7 P;  4C92 E;  2ENM A;  2HZY A;  2VXF A;  4EDU A;  4D6W A;  1QKW A;  4DBH A;  3UWN A;  3E2U A;  1WIE A;  2BUD A;  4C8Q A;  1YJW Q;  4DA4 A;  2IG0 A;  1QWE A;  3E9G A;  2V26 A;  4KUI A;  4PLL A;  1D0X A;  1J3T A;  1G8X A;  4JJC A;  1Z9Z A;  4M75 A;  1WPY A;  3VKI A;  4M77 E;  3X24 B;  2KYB A;  3QII A;  4QVZ A;  2YDL A;  4XK8 E;  1Z9Q A;  1SG5 A;  3G6E Q;  1GBQ A;  5DM7 R;  1GFD A;  4BB7 A;  4WCI A;  2Y4X A;  3G71 A;  1C0M A;  1YJN A;  4MDW A;  3A98 A;  2OTL A;  5ECA A;  3JCM V;  2RJF A;  1O75 A;  5EG2 A;  1IRX A;  4PJM A;  3GBQ A;  2M51 A;  3LWI A;  3GNG A;  1BIB A;  2YUO A;  1B34 B;  3RKW A;  4KRT A;  3OYY A;  2DK3 A;  2DM1 A;  2KI7 A;  1IHV A;  2COW A;  4MMK A;  3PMI A;  5LJ3 e;  2E1H A;  3CCV Q;  3P8D A;  3CBM A;  1LJO A;  2QDY B;  3NTK A;  4RTW A;  4EMH A;  5D6X A;  2BZY A;  1OUL A;  1ZBJ A;  3X26 B;  4M7D F;  5CVI A;  5C0M A;  2ZAE A;  3EG2 A;  4RMO A;  4FU6 A;  2GFA A;  5GAN g;  3OS0 A;  2DTI A;  2E5Q A;  4M7D D;  4IKF A;  3RDV A;  4BI4 A;  5CR2 A;  4FYY B;  3OBY A;  3VS3 A;  4ELZ C;  4O5V A;  4M7A C;  4PJO B;  4QQG A;  2EQJ A;  1IHW A;  4LD6 A;  2GGR A;  3EGU A;  3M5A A;  1N8R C;  1ZX6 A;  3O8V A;  1TU0 B;  1YIJ T;  4ANJ A;  1ZSZ C;  2L89 A;  1KJW A;  2AZS A;  2FPD A;  2DLP A;  1K9M U;  4IUU A;  2KK4 A;  4LDX A;  2XI9 A;  1Q86 U;  4FIB A;  2K3X A;  1KHC A;  2HAX A;  1KSW A;  5DLO A;  4PFP A;  1I8F A;  2MK5 A;  1MNE A;  4OGE A;  3CQT A;  2D8H A;  1VQ7 Q;  3EAE A;  2XDB A;  2ROT A;  4QW2 A;  4AMC A;  3MEW A;  5KYN A;  1M90 U;  4AT1 B;  3PVQ A;  1HXD A;  2FPE A;  2QEX Q;  4JJB A;  3FDR A;  2O4X A;  1JO8 A;  1LVK A;  1M8V A;  5LJ5 g;  1AHJ B;  2AHJ B;  1Y57 A;  1RI9 A;  1JJ2 P;  3M0U A;  3OMG A;  5GMK j;  3JB9 G;  1AZG B;  1K73 U; 
#chains in the Genus database with same CATH homology
 4HCZ A;  3QBY A;  3WXM B;  4OF1 A;  5GAM g;  1N9R A;  4N4G A;  5CIU A;  1VQM T;  5CQY A;  3MHX A;  2DD4 A;  1WGS A;  4F7U B;  1BI3 A;  4BD3 A;  2JUF A;  3L2U A;  3KBG A;  3L1A A;  5GMK m;  2QQA A;  2YHT A;  1Q81 U;  3DKM A;  1VQP A;  1BI0 A;  3OYD A;  1VQL T;  4E47 A;  1UGS B;  4M75 E;  4C0D C;  3MEU A;  3QJY A;  4C92 F;  4JRI A;  4PJO F;  1YJ9 T;  1KC8 C;  4PJO G;  1NJI U;  5M9O A;  3CME A;  1UGQ B;  4FT2 A;  4BY6 C;  4C92 D;  1HK9 A;  4N0A C;  3QZ9 B;  4M7A A;  5LJ3 f;  5GAO n;  4PJO D;  2CZ6 B;  3V8K A;  4FSX A;  3MEA A;  5GAN d;  2QA4 A;  2I2L A;  3LH0 A;  1KC8 U;  1R8O B;  2K57 A;  3L2Z A;  4L59 A;  4E7I A;  4HKE A;  3VJP A;  3S3O A;  1VQK T;  2WSF E;  2PQW A;  3I56 T;  4FM4 B;  1VUB A;  3QYG B;  3OW2 A;  3CBO A;  3UDC A;  3NTH A;  3SDZ A;  1VQ4 A;  1RL2 A;  3CPW A;  2MI6 A;  3MCA B;  3GOX A;  1U1T A;  2E41 A;  1EIF A;  5CKB A;  5L8R E;  1FWZ A;  2QXF A;  2XKO C;  3JSC A;  4M78 E;  2DAQ A;  2RD1 A;  4M77 F;  4A4E A;  4M75 G;  2L3R A;  5GAO p;  3UPU A;  4M77 G;  1BYM A;  1GXI E;  2DZC A;  2WAC A;  4ZN1 A;  4BDY A;  2E64 A;  3X20 B;  2K3Y A;  2F5T X;  4M77 D;  5GAN e;  2KVQ G;  2KY9 A;  1NE8 A;  4QQ6 A;  1VQ7 T;  3RKX A;  3CC7 T;  4EMK C;  1QVF A;  1D3B A;  1V29 B;  4Q5W A;  4F7U E;  4CI0 C;  1YI2 A;  2YLC A;  1K8A C;  2VYT A;  4XU1 A;  3M58 A;  4OB0 B;  3PT9 A;  2ZPH B;  4NS5 A;  2MF2 A;  3CC4 A;  3CCM A;  1M5Q 1;  3LGF A;  3MET A;  3OS1 A;  4M7D A;  1ZQ1 A;  1O9S A;  2QEX T;  2YLB A;  3CPF A;  4J6W A;  4BUG A;  5CCA A;  3S3M A;  1S72 A;  2QI2 A;  3SFM A;  2EJG A;  3G7Z A;  2DPP B;  4JRK A;  4C92 C;  3A5Z B;  4RCB A;  4PJO C;  2EKO A;  4BE1 A;  3CCE T;  3OYE A;  3CXC S;  1W2B S;  2GCX A;  1UGR B;  3ZBD A;  2QQB A;  4KBM B;  1YBY A;  4PL6 A;  3TCJ A;  3E9F A;  2X4Y A;  3GLX A;  1M1K C;  1VQ5 T;  3KXT A;  3NFC A;  2XU8 A;  3I55 A;  1NPP A;  2CZ7 B;  2CKK A;  3CBP A;  2FL7 A;  1G3Y A;  4C5H A;  1OI1 A;  4F7U G;  1YJN T;  3RIR A;  1VQN T;  2GF7 A;  1BIA A;  2X4X A;  4X34 A;  3SWN C;  2RK2 A;  2X4J A;  1XNI A;  3RUX A;  5LJ5 d;  4C0Z A;  2OTL T;  2HBP A;  3G4S A;  3OSV A;  1K9M C;  1WJQ A;  4MDX A;  3A8G B;  1JRI A;  3A8H B;  4II1 A;  2CGH A;  2L5Q A;  5GAN h;  2RHU A;  1Y7X A;  3LYI A;  4OB3 B;  2LNV A;  5GAN 5;  2D0Q B;  4M77 C;  3GPL A;  3OS2 A;  4BDZ A;  1RI0 A;  5GAM d;  1WJR A;  1JBM A;  2M1H A;  4C8Q B;  1ZBX A;  5CAI A;  3G6E T;  4XTW A;  4N0A A;  4KUL A;  2K4Y A;  4E7H A;  3PFS A;  4GLK A;  3MP8 A;  4JDS A;  3CCQ T;  2LT4 A;  3CD6 T;  1W4S A;  2E6N A;  1I5L A;  3FJP A;  3TRE A;  5GAN 7;  3VYG A;  4JJN K;  2D9T A;  4HT9 A;  2ZPG B;  5GMK e;  2H3J A;  1M4Z A;  2LX9 A;  5LJ3 g;  2FYK A;  2JNG A;  3LWH A;  4JS4 A;  2A3L A;  4Z02 A;  1B34 A;  1M90 C;  3QDR B;  3GIB A;  3OS5 A;  3OW2 S;  4ZGD B;  2HQX A;  3HHT B;  2RHY A;  3CPW S;  5GAN 4;  1KHI A;  4M7A B;  4A4F A;  2ZZD A;  3FRN A;  3NTI A;  4J6Y A;  3ZEH A;  3CCU T;  4EMG A;  1VQL A;  3QXE B;  3BFM A;  4EMK A;  2R58 A;  2LTO A;  3P8B B;  4ZGJ B;  2JN0 A;  2FB7 A;  2JTF A;  5DLQ E;  3V8J A;  4DOV A;  1K73 C;  1QVF S;  5CO7 A;  2RHZ A;  1QVP A;  5CKH A;  5CKF A;  3L2Q A;  2DVE A;  5FU6 B;  2CZ0 B;  4M78 B;  4FT4 A;  4E7K A;  2JOY A;  3RMS A;  3LW5 E;  3OA6 A;  3S3N A;  3CCR A;  3JB9 F;  3BDL A;  2IVW A;  2G3R A;  5LJ5 j;  1Q81 C;  2P0P A;  3JCM b;  1Q7Y C;  2EWN A;  4BI8 B;  1KD1 U;  4LDW A;  3QG1 A;  5CK9 A;  1M1G A;  4OVA A;  4C92 A;  3JB9 D;  2XG8 D;  1VQK A;  1NJI C;  4JUV A;  2M9U A;  3HP9 A;  3QJ6 A;  5GMK h;  3M56 A;  2DKG A;  4MZP A;  2RK1 A;  5GAN f;  5GAM j;  1Q7Y U;  1D3B B;  3DB4 A;  3M4G A;  5KH6 A;  1VQO A;  1X01 A;  2X4W A;  5FLX E;  1TH7 A;  3CC2 T;  3JCM e;  3QZ5 B;  5D6W A;  3QYH B;  2VGM A;  3SWN A;  1OYX A;  2Y4Y A;  2QQ9 A;  3E1S A;  3MO8 A;  1Y07 A;  3FB9 A;  3CCL T;  1JJ2 A;  3OYB A;  2RI3 A;  1LNX A;  2XD0 A;  4M7A E;  5GAO l;  4WF2 A;  3AHU A;  4C8Q F;  1I81 A;  2RJD A;  3OYL A;  5HK3 A;  4C8Q G;  3TEE A;  1XQH A;  4M77 A;  4NL3 A;  3OYH A;  3HRS A;  2PU9 B;  1Y96 B;  2E65 A;  2LCC A;  2P0Q A;  3OYJ A;  3MP6 A;  2XHC A;  4C8Q D;  4N4H A;  3WVE B;  2DO3 A;  3JCM Q;  2EFI A;  4TVR A;  2LT1 A;  2V8K A;  3HPW A;  1NPR A;  1VQ6 A;  1M1F A;  4FL6 A;  1UGP B;  2CS7 A;  4M75 F;  4MZT A;  5D6Y A;  5I2M A;  3M9Q A;  3OQ5 A;  5FRM A;  1YJW A;  3OYK A;  3CCE A;  3RER A;  2E10 A;  3OYI A;  3OMC A;  4JRP A;  2GQV A;  3M57 A;  3PMT A;  4M75 D;  2K5F A;  4A54 A;  1N9S A;  2XDD A;  1VQ5 A;  3FEO A;  3CCS T;  4E7L A;  2K5I A;  1MGQ A;  1OZ2 A;  5HY6 A;  2LQK A;  5I21 A;  1VQN A;  2DEQ A;  4M7A G;  3RES A;  3JCM h;  4C0G A;  1G5V A;  3V7S A;  1DJ7 B;  2QQS A;  5LJ3 d;  1VQP T;  1VQ8 T;  3L2R A;  2VV5 A;  2MWP A;  5IT9 E;  1YIJ A;  3P8H A;  4M7D E;  1PSE A;  2KQW A;  2HQE A;  1QVG A;  3LLR A;  4PJO B;  3V8L A;  4M78 F;  2K5L A;  4P5N A;  4M78 G;  3G6E A;  4J7F A;  1UEB A;  3ER0 A;  1WNL A;  3HL8 A;  2RA2 A;  3VUZ A;  3ASK A;  2ZPE B;  4M78 D;  4OP0 A;  2VXE A;  4JLI A;  4MML A;  1KQS A;  3CCQ A;  1IRE B;  3CD6 A;  3V7R A;  4R56 A;  3EFR A;  3G71 T;  1UB4 A;  4F7U F;  1VQ9 T;  3LX7 A;  3A8L B;  3C4S A;  4C8Q C;  3J81 E;  3JCM X;  4BAC A;  3H8Z A;  3E19 A;  5GMK i;  1G3S A;  2GFU A;  3OB9 A;  4DOW A;  1VQ4 T;  3QHS A;  4XU3 A;  3CEY A;  5GAO q;  3QKJ A;  4A53 A;  3FC3 A;  2OTJ T;  1WJS A;  2DTO A;  2F69 A;  2O4X B;  1X6O A;  2RI2 A;  4LDY A;  3WVD B;  4QVD A;  4V2S A;  2E6Z A;  3VU3 C;  4HT8 A;  2E70 A;  3M59 A;  5I2S A;  2NLU A;  4M75 C;  2FHD A;  4ATO A;  3L2V A;  4QQD A;  4ELY C;  1KG1 A;  3JB9 H;  3PIP A;  3OYC A;  3CCU A;  3L2W A;  1BI1 A;  2ZPI B;  5FU7 C;  1JJ2 S;  3Q1J A;  3VV0 A;  4C92 B;  2RJE A;  3CC4 T;  2OTJ A;  5LJ5 e;  3F70 A;  4JLG A;  3CCJ A;  2LCL A;  1QP3 A;  3CCV A;  4UC4 A;  1WQW A;  2EQM A;  3HRT A;  4C5G A;  3VYH B;  2RHI A;  3RMQ A;  3MEV A;  1PSF A;  4XTU A;  3S6W A;  4C5I A;  4JS5 A;  4XTX A;  3L42 A;  1G3T A;  4J8O A;  2RO0 A;  4RKU E;  5GAN 8;  4YTL A;  4J6X A;  1Q82 C;  5LJ3 j;  2WSE E;  2RB6 A;  3T9N A;  2DTH A;  3EFS A;  5FRO A;  4Y91 A;  5GAO m;  5GAN 3;  2EYQ A;  5GAM e;  3PIO A;  3GP8 A;  3JCM f;  5DY9 A;  1QP2 A;  4E7J A;  1YIT T;  1VQM A;  4M78 C;  3JB9 J;  2PVD B;  1Q82 U;  1P92 A;  4KT0 E;  1U8R A;  4HA8 A;  5GAN 2;  2XID A;  4DQ2 A;  4XQ3 A;  1ZHI A;  2EQU A;  4HCB A;  2QTX A;  2ZPF B;  4EPC A;  1BKB A;  1JB0 E;  2RI5 A;  1SSF A;  1YJ9 A;  1KD1 C;  1N27 A;  2EIF A;  5IN1 A;  1G3W A;  2P0K A;  2L8D A;  2PUK B;  1KQ1 A;  3PGG A;  4ZN3 A;  3OYM A;  2C06 A;  2PVG B;  3LGL A;  3X25 B;  1FX7 A;  4JRQ A;  3HKS A;  4XTV A;  3ME9 A;  3UT1 A;  4OB2 B;  1YHQ T;  4J83 A;  2QQR A;  4PJO A;  3FIF A;  2KDS A;  3V7C A;  4A4K A;  2DZ9 A;  2WSC E;  3I56 A;  5LJ5 h;  2XDP A;  3SD4 A;  1H64 1;  4C0F A;  3HFO A;  5CKD A;  1QVG S;  3J7A F;  4PKC C;  4C92 E;  4PJO E;  2RM4 A;  2VXF A;  5A0G A;  4QVC A;  4EDU A;  5KCO A;  4D6W A;  2LQ8 A;  4LD9 K;  3UWN A;  3TU4 K;  4ZTF A;  2BUD A;  3C94 A;  1KQS S;  4C8Q A;  5GAM h;  5FRN A;  4DA4 A;  3DLL A;  2JTM A;  4M7D B;  3X28 B;  2IG0 A;  3JCM W;  2V8J A;  3E9G A;  1LOJ A;  1VQ7 A;  3CC7 A;  4KUI A;  4L6V 5;  3CCS A;  2DXU A;  4PLL A;  2VUB A;  2HD0 A;  1FXX A;  1Y71 A;  3CMA T;  4M75 A;  1WPY A;  2P4T A;  3VKI A;  2RH2 A;  2X35 A;  5AYF A;  3BDU A;  2QEX A;  1VQ8 A;  3FLG A;  3SB2 A;  4N4I A;  4M77 E;  2F5K A;  3M4Y A;  4MZM A;  4XU0 A;  2EJF A;  3RKY A;  4RG8 A;  3X24 B;  3HRU A;  4C92 G;  2E12 A;  4IUT A;  3ZFJ A;  2LC4 A;  3QII A;  4QVZ A;  4XK8 E;  4KUD K;  3N5B B;  5DM7 R;  2DXT A;  2DXB A;  4BB7 A;  5J39 A;  3CCR T;  2Y4X A;  4A4G A;  2LRQ A;  3HSB A;  3DLM A;  3G71 A;  2B8A A;  5GAN 6;  4C0D B;  1VQ9 A;  5KE3 A;  1YJN A;  4MDW A;  4M7A F;  5CQX A;  1N6A A;  4X9C A;  3JCM P;  4M78 A;  4CRI A;  4BY6 B;  2OTL A;  5HKC A;  2LDM A;  3H6Z A;  4M7A D;  4XAX B;  3CC2 A;  2VGN A;  4XU2 A;  3JCM V;  1VQO T;  2RJF A;  3MP1 A;  1O75 A;  3QUI A;  4L5G A;  5CKE A;  4J7I A;  3QSU A;  5EG2 A;  3JB9 I;  1H3Z A;  3JCM g;  2JZ2 A;  5KE2 A;  3CME T;  2LVM A;  5LJ5 f;  4F7U A;  4X9D A;  2XK0 A;  2PVO B;  2MMP A;  3LWI A;  1YCY A;  3GNG A;  2FVU A;  1BIB A;  3BW1 A;  1X75 C;  1B34 B;  3RKW A;  2O01 E;  3OYY A;  2QA4 T;  2A7Y A;  3JCM J;  1I4K 1;  3QPH A;  2XIC A;  2DK3 A;  4R55 A;  5A0D A;  1IZ6 A;  5LL6 S;  4RG2 A;  5GAM f;  4MMK A;  1MHN A;  2DIG A;  3PMI A;  4BE2 A;  5LJ3 e;  5GMK l;  2YRV A;  2E1H A;  3P8D A;  4OGC A;  3CBM A;  5HK0 A;  1LJO A;  2QDY B;  2ZCF B;  3NTK A;  3QO3 A;  3A8M B;  5D6X A;  3VUB A;  4EMH A;  1K8A U;  2DJZ A;  1KQ2 A;  1VQ6 T;  4EMK B;  2KMT A;  2ZGW A;  2CYZ B;  4J5Y A;  3J80 E;  4IUV A;  3URG A;  3JCM c;  3X26 B;  4M7D F;  2K2V A;  3C12 A;  3OBW A;  1YJW T;  2JVV A;  5CVI A;  4B9W A;  5C0M A;  1YIT A;  2KSS A;  2RHX A;  3INZ A;  4M7D G;  1Y96 A;  2KAF A;  4RMO A;  2BKD N;  3M53 A;  4FU6 A;  4LDV A;  2HNI A;  2GFA A;  3M55 A;  5GAN g;  3OS0 A;  2DTI A;  2E5Q A;  4M7D D;  4IKF A;  2OAU A;  4ME7 A;  1WQ7 A;  2Y90 A;  1YI2 T;  2CZ1 B;  4Y28 E;  3KUF A;  4IUQ A;  3OYA A;  4BI4 A;  5GAN j;  5CR2 A;  3OBY A;  4RCC A;  3BY7 A;  2PUO B;  4O5V A;  1XTD A;  4ELZ C;  3R6O A;  4QQG A;  2EQJ A;  3CCM T;  1QW1 A;  4GY5 A;  4LD6 A;  1M1K U;  4M7A C;  4IUP A;  4ZGE B;  5KCH A;  3OYF A;  2EQK A;  2M16 A;  3M5A A;  4VUB A;  1N8R C;  3O8V A;  1YIJ T;  3JAM E;  2L89 A;  1S72 T;  1Q86 C;  4PLI A;  2VC8 A;  1M9S A;  4O6J A;  2V8I A;  5A2Q E;  1YHQ A;  2R5M A;  4PNO A;  4OB1 B;  5FU6 C;  1K9M U;  4IUU A;  3SWN B;  2KK4 A;  4ZTJ A;  4HCC A;  4LDX A;  1N8R U;  2XI9 A;  5LJ3 h;  1Q86 U;  4FIB A;  2K3X A;  1KHC A;  1VIF A;  2R57 A;  4IUR A;  3I55 T;  2R5A A;  2HAX A;  3PTA A;  5DLO A;  3C95 A;  1BI2 A;  2EAY A;  4XTZ A;  2M0O A;  1NZ9 A;  4LDU A;  4OMF B;  3OYN A;  4M75 B;  4NL2 A;  2MAM A;  3OSS C;  4M77 B;  4NOY A;  4B9X A;  2DXC A;  1U1S A;  3G4S T;  1I8F A;  4BI3 A;  4XTY A;  1XOV A;  2BIV A;  4OGE A;  3CCL A;  3EAE A;  1OZ3 A;  2XDB A;  3OYG A;  5GAO r;  4QW2 A;  5FU7 B;  3CMA A;  3MEW A;  2RJC A;  2ZPB B;  5A0L A;  4M7D C;  3A8O B;  1M90 U;  3JRZ A;  2D6F A;  3GNF B;  1HXD A;  3HFN A;  3FDR A;  1VIE A;  2O4X A;  3OY9 A;  3CXC A;  1W2B A;  5J26 A;  2MWO A;  1M8V A;  5C6S A;  3M54 A;  4C5E A;  5LJ5 g;  1AHJ B;  2AHJ B;  4BE0 A;  3CCJ T;  3PNW C;  2DD5 A;  2EJ9 A;  2DIQ A;  3DB3 A;  4A4H A;  3JCM d;  3CCV T;  5IAY A;  5J3B A;  3OMG A;  5GMK j;  3JB9 G;  4C8Q E;  3GF5 A;  1K73 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...