4M77B

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
91
structure length
91
Chain Sequence
MLFFSFFKTLVDQEVVVELKNDIEIKGTLQSVDQFLNLKLDNISSTDEKKYPHLGSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 20
structure length 91
sequence length 91
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77B00
4C92D 5I21A 5LJ3g 2Y90A 4C8QF 5GAN5 4N0AC 3V7CA 3JCMP 3RESA 4M7AA 2E65A 5GANh 4PJOD 1M8VA 1U1TA 3RKXA 2ZGWA 3JCMW 4M77D 4M75G 4HT9A 3BFMA 1BIBA 3GIBA 2FB7A 4V2SA 4M78C 4M7AG 4C8QA 4XU2A 2DVEA 4XU3A 5GANe 5LJ5f 5GAMj 4HT8A 3RIRA 1BIAA 5GAMd 3JCMb 4EMKB 3SWNB 4C92E 5GAMg 3JB9G 2RM4A 4C8QG 4XTXA 3PGGA 5GMKi 5GAOn 2DTHA 3JB9I 4PJOE 3V8KA 4C92B 5LJ5h 1JBMA 4MMLA 1I81A 4X9DA 3JCMd 4J5YA 5GMKh 2EWNA 4C92F 3V7RA 4EMGA 4PNOA 4MMKA 2VXFA 1I5LA 4PJOB 2YHTA 1MGQA 3BW1A 3M4GA 4PJOF 2DEQA 2DJZA 3EFRA 3FB9A 4M77B 5GANj 4EMKA 3SWNA 3BY7A 5LJ5e 3BDUA 2EJGA 4M77F 3V8LA 5GANd 3JB9F 5GMKe 4XTVA 4M75C 2RA2A 5GANg 4C92A 2DTOA 3L2ZA 2DZ9A 4M7DD 3JCMJ 1YCYA 4M7AC 4JLIA 1TH7A 3AHUA 4QVDA 4PJOA 2RB6A 3JCMV 4F7UE 3HSBA 5GAN2 3QUIA 4XU1A 4RCBA 4NL3A 5CAIA 1I4K1 4M77A 5GAOl 4C92G 3JCMc 1N9RA 4F7UB 4Y91A 2HNIA 1LOJA 4XQ3A 4J6WA 1D3BB 4PJOG 1HXDA 4C8QC 4F7UF 4J6XA 4M77C 2CGHA 4XTYA 5LJ5j 4M78D 4XTWA 1U1SA 4M77G 1WQWA 2DXTA 4XU0A 4EMHA 4OP0A 5GMKj 2FYKA 3RERA 4WF2A 4A53A 5LJ5d 4HA8A 4M7DE 5LJ5g 3HFOA 1M5Q1 3V8JA 3FJPA 1LJOA 4F7UA 4A54A 2DZCA 5GAOq 4M7DB 1H641 1D3BA 2I2LA 3EFSA 3QHSA 2K57A 4M7DF 2VC8A 3JB9H 3INZA 4F7UG 2E41A 3SWNC 4EMKC 3JCMX 2YLCA 1Y96B 2DKGA 5LJ3f 1B34B 4M78E 1KQ1A 1WQ7A 2YLBA 4C92C 3SB2A 5GAN6 4DQ2A 4M78B 5GAOm 4M7DA 5GAN7 2DXUA 1KQ2A 4PJOC 4M75D 2E1HA 4M78F 4NOYA 3JCMh 3JCMQ 4N0AA 4RCCA 4M7AD 1JRIA 2E10A 5LJ3h 1LNXA 2EJFA 2DTIA 3L1AA 1Y96A 2QTXA 4NL2A 3V7SA 1B34A 1I8FA 4QVCA 4M7DG 3QSUA 3JCMe 3HFNA 4M78A 5DY9A 5GAMf 3FIFA 4C8QD 3JB9D 2EJ9A 2JN0A 5LJ3e 5GMKl 5GMKm 4JRKA 4XTUA 2RD1A 4J6YA 1X01A 3RKYA 4M75E 4M78G 3JCMf 3VU3C 1WNLA 4M7AE 5GAN4 1HK9A 5GAMh 3JB9J 4M75B 4X9CA 3RUXA 4M7AB 2E64A 4M75F 5GAN3 5GAOp 1N9SA 5GANf 5GAN8 4M7AF 1WPYA 2VXEA 3RKWA 4C8QE 4JRIA 5GAOr 5GAMe 5LJ3j 4JUVA 4M77E 3JCMg 4M7DC 3QO3A 4XTZA 2EAYA 4C8QB 5LJ3d 4M75A
chains in the Genus database with same CATH superfamily
5I21A 5CKHA 2E65A 5GANh 2DETA 2A3LA 1I07A 1YHQA 4RTWA 1TS9A 1JO8A 2QXFA 3A98A 1BIAA 1HD3A 2X4WA 3I56Q 2DA9A 1N8RR 2JXBA 1JJ2P 4AFZC 2MIOA 2FVUA 3GNFB 4C8QG 1YIJQ 1BKBA 4F04B 2RI3A 2DRKA 2GGRA 3PIPA 1I1JA 3PFSA 1QWEA 5CR2A 1NPPA 3SWNA 4HVVA 1QP2A 1B3QA 4ZGEB 2XI9A 3S6WA 5KE3A 5GAN2 2XDDA 1KC8C 3CMAT 2LX9A 2OTJT 1H3HA 4Z89A 2EBPA 4C5HA 4XTWA 2HSEB 3CQTA 2EKHA 2SEMA 3OYJA 2YUQA 4IKFA 1M5Q1 3VS1A 4A54A 4JS4A 2QG9B 3EH2A 1Y0MA 2XMFA 3CC7T 1GFCA 2HAXA 1VQ4A 2KI7A 1YBYA 3SB2A 4DQ2A 4E7LA 1YJWQ 2GCXA 4M78F 4HCKA 4M7AD 8ATCB 5KH6A 2LQNA 3HFNA 3FIFA 5FRMA 2K3YA 2L3SA 4XTUA 3I5RA 1Q7YR 2XKOC 2A08A 2HKNA 3M58A 2FEIA 5GAN4 3VS4A 4X9CA 2LP5A 4ATOA 1OZ3A 3E1SA 3RKWA 3OA6A 2FHDA 2LT4A 4M77E 5LJ3d 5KCOA 4M75A 4A63B 4JRPA 3L42A 1O75A 1Q86U 4IURA 2RJEA 2ZGWA 4BDYA 3CPWS 4GY5A 1QVGA 3HTRA 2E6NA 2JS2A 3X24B 3QWXX 5GAMd 4EMKB 2ZAEA 3E9FA 2OI3A 4J7IA 1QVFP 4MZPA 2XU8A 1QCOA 5AYFA 4R55A 3A8OB 5GANj 4M77B 2CZ7B 3BY7A 3M0RA 3M0UA 3REBB 1YI2Q 2CZ0B 1NG2A 2LCCA 5GANg 4KH0B 1TUDA 4RMOA 3CCJA 1Q82R 1G83A 3M0QA 5GAOl 2RF0A 4C8QC 1X27A 2L0AA 4FU6A 3HL8A 2RQRA 4M78D 4XU0A 1CKAA 2AIRB 2DVJA 4HA8A 1YITQ 2I0NA 1VA7A 2HZYA 2R58A 2WSEE 5GAOq 3S3OA 3C94A 1K0SA 3PT9A 2F5TX 1WXTA 1Z9QA 4RKUE 3S3MA 4PFPA 2E41A 4HCBA 2R5AA 2YLBA 4IUPA 4NOYA 3TVTA 4ZN1A 2P84A 2O31A 1I8FA 1M1FA 3JCMe 1M1KR 2IIMA 1ZA1B 2DLPA 2GTOA 2JN0A 4KT0E 1WA7A 4Y28E 2CYZB 2DIQA 2X9HA 2B86A 1RLPC 3OW2P 1WNLA 4AG2C 2DL5A 4ELYC 1M2VB 4LDVA 3EG9A 2F2VA 1K8AC 1KHCA 2NUTB 4OGCA 4BDZA 3VRYA 1K73C 2F69A 2FL7A 1BCMA 1M3BA 1I5OB 2DFUA 1M90C 1GCQA 2KVQG 2QGGA 3CC2T 2FB7A 2DF6A 3CEYA 3OBYA 1E6HA 3EGDB 2MPXC 1W2BP 2ZZDA 3EFOB 5CKFA 1KHIA 2K7AA 5I2MA 2CT3A 2D0QB 4RTYA 4HXJA 1UFFA 2JM9A 4X9DA 2YT6A 2X4XA 3QYHB 1OYXA 2VB6A 4M77F 1VQ9A 2ZPGB 3OS5A 4XTVA 1VQPT 3NHNA 3VS0A 1RAIB 1Q81R 2HQEA 4NL3A 2EYXA 1I4K1 1U3OA 4C0DB 5CKDA 3ZL7C 2HL5C 2CP6A 3UA7A 4M77C 1WXUA 3CD6A 1X69A 4EDUA 4FL6A 1PNJA 4N4GA 1Y71A 4JDSA 3URGA 3VS3A 1WDXA 1XQHA 2WACA 2K57A 4Z8AA 2PTKA 2VC8A 2P0QA 2JW4A 1KD1R 1K1ZA 3OMGA 1RAHB 2EFIA 3CCVT 1TWBA 3VUZA 4F14A 3JCMh 1K76A 4Y92A 1OU9A 1IGUA 5DY9A 1MV3A 2O9VA 4JRKA 1JB0E 2X3XD 4KUIA 2HSPA 2KT1A 1H8KA 4AFUC 2FZCB 2L3PA 3RMQA 2AKLA 3C12A 1BI1A 1ARKA 1PSEA 1N6AA 3OYMA 1OPLA 4PL6A 1VQ8A 1VQ5T 4M77D 2BZYA 1QKWA 5KYYB 4XU3A 4QQ6A 1M3CA 5KYUB 1FYNA 3CCET 3M54A 2YUNA 5FWBA 2NUPB 3WVDB 5GAOn 1YNZA 3OS2A 4J9EA 2PUOB 3OS0A 1WJRA 4EMGA 2K2VA 2VXFA 1MGQA 1VYTA 2DEQA 1WI7A 2AK5A 5GMKe 5FU7B 3HHTB 3QZ9B 4KGVB 2M02A 3M5AA 5FU6C 3WXMB 3PMTA 2LRQA 2G3RA 2EVRA 1WXBA 4F7UB 5CQYA 1VQ6T 1MUZA 8AT1B 4JJNK 2FYKA 2ENMA 2FRWA 2LVMA 2NLUA 2DD5A 2RK2A 4IUQA 1UE9A 1OV3A 1OQKA 4E7KA 1D3BA 3QHSA 3CCVQ 2EQKA 3VYGA 2DX1A 2AKKA 4DEYA 5LJ3f 4LN2A 1G3WA 2K3BA 4CC3A 2D8HA 4F16A 3JCMQ 3CPFA 2MAMA 4DA4A 2QQBA 3VS2A 2ZPHB 2V1RA 1MHNA 5GAMf 3R6NA 5LJ3e 2BTTA 1D0XA 1WHMA 2CDTA 2P0KA 1E7OA 1TUGB 1ZA2B 1Q7YU 1VQLQ 4M7AE 5FROA 5I11A 2RN8A 4ZGJB 1VQMT 1M27C 2MI6A 2VXEA 1FMWA 1VQ5Q 1Q95G 5GAMe 1NJIR 1ZX6A 3JCMg 3VRZA 3H9NA 3G1JA 1C6VX 1ZSGA 3CCEQ 1U06A 4OMPA 3ZEHA 4M7AG 2CH4A 4RTTA 2CSQA 4C8QA 3RIRA 3CMAA 1IGQA 2OTJA 3QWYA 4CC4B 4HCZA 4ANJA 3KXTA 2DXBA 2CKKA 3JCMd 1BK2A 5IHNA 5GMKh 2F2XA 1QLYA 1AEYA 1WGSA 5KYWB 1PD1A 1JXOA 1ZSZB 5IXFA 2DTOA 4IUVA 1XJWB 2XICA 3PVLA 5KYXB 3JCMV 3NMZC 3CC7A 4BE2A 5D6XA 2LQKA 4F7UF 4JLGA 3LGFA 4BACA 3HKSA 3HRUA 4OB2B 4YTLA 3OYYA 3RERA 5FU7C 4OB0B 3I56T 2LNVA 3AT1B 3RMSA 4X34A 1ZUKA 3QJYA 4GLMA 5KCHA 1X43A 3FJ5A 1YJ9T 1IB8A 4A4KA 4M78E 2ED0A 1GBRA 3UDCA 2EQJA 1CSKA 5FW9A 4RCCA 3CXCS 2EPDA 5LJ3h 3QBYA 2DTIA 1NPRA 3OYHA 2ESWA 2LDMA 3M9QA 4CRIA 4CI0C 5A0DA 5GMKm 3I55A 1M1KU 1VQMQ 2VGNA 4IIMA 3RKYA 2B8AA 3CMEA 4M78G 6AT1B 3CCQA 5GAMh 3EGXB 1AWJA 1UGSB 2DD4A 4E7ZA 2YDLA 5GAN3 2O4XB 1MMDA 3NPFA 4A4HA 3EHQA 5KYNA 1BI0A 3DB4A 2AZSA 5GAN5 1SSHA 2YUOA 4ZTJA 1K9MC 3NTIA 1X6GA 3MO8A 4C5EA 3GP8A 2KEAA 3OS1A 2LCLA 4HT8A 1KK7A 1VQOQ 2FPFA 4Z02A 1NLPC 3CBMA 4FYVB 4MMLA 2C06A 3C95A 1G3SA 4PFZA 2PQWA 2XHCA 3H8ZA 2ATCB 1JJ2S 2CP0A 1ZBXA 2DZ9A 4ZN3A 1WLPB 1AOJA 3LH0A 4M7AC 1VQNT 1RAEB 2RHYA 2GFAA 2DNUA 2JTFA 3PIOA 1PRLC 1PWTA 1N9RA 1Q81U 1KJWA 2XD0A 3CCUQ 3N5BB 2FPDA 2E5QA 4J6XA 1AZEA 1SRLA 2MWPA 1RABB 5GMKj 1YJ9Q 4IUUA 2DYBA 1LJOA 1NE8A 1W4SA 4L59A 4DEXA 3DLLA 3L2QA 3KFVA 2D0NA 4FT2A 5CVIA 3CBOA 3MEWA 1SRMA 1Y96B 3H0IA 4O6JA 3QZ5B 2CP7A 3RBBB 1YI2T 1KD1U 2RH2A 2FZKB 2DRMA 3L1AA 1Y57A 1K4US 1B34A 1UGRB 2X35A 4OMFB 1B07A 1PC0A 4FSSA 3C0CA 3CCST 3X26B 2DAQA 3L2RA 4AFSC 4XAXB 3CC2A 1N5ZA 4RG8A 5D6YA 1YITT 4DOWA 2EW3A 2KY9A 1X75C 3TU4K 2GBQA 3A8MB 5LJ3j 4LDXA 3A5ZB 2EAYA 4XTZA 1K8AU 2JM8A 2MOXA 5LJ3g 4JJDA 1K73U 3RKXA 5J3BA 3L2VA 4BI4A 1VQPA 3LH5A 3MP1A 1M1GA 4QT7A 4M78C 4XU2A 2DVEA 2M16A 2QQSA 2OTLT 5GAMj 3PVQA 1UG1A 1N27A 4LUDA 2OJ2A 4IIOA 4PLLA 5GAMg 2E3IA 2ZPFB 4D6WA 1WHKA 3KBGA 3PGGA 2ROLA 2DL8A 1RI0A 4C5IA 4C92B 2EGCA 5IN1A 2ECZA 3V7RA 4ZGDB 4PJOB 1VQNQ 2NUZA 2DL3A 2D9TA 2QA4Q 3MEAA 5J39A 5LL6S 2KQWA 2G6FX 2RB6A 1QVFS 3OYEA 2FZGB 3G6ET 4PJJA 2HNIA 3CCLA 1PD0A 3CCVA 3CPWA 4M77G 2LNHB 1WX6A 3M0TA 2EYYA 2A7YA 1OX8A 3X28B 4AT1B 4M7DB 2DBKA 4UC4A 3EFSA 1QVGP 2K3XA 4WTOB 3NTHA 2W0ZA 1RAGB 3INZA 1WHLA 2BZXA 1KC8R 2HQHA 4L5GA 2GFUA 2LTOA 3CCSQ 1R0CB 3THKA 2PVDB 2GF7A 2Z0WA 5FLXE 5M9OA 3UA6A 1EX4A 2HQXA 1G5VA 1BB9A 3M55A 3X20B 3QYGB 2BE9B 1VQ5A 2HKQB 1X01A 2RQWA 3JCMf 2ABLA 3ULRB 3VU3C 1H92A 1VQKQ 1P92A 4JS5A 2CP3A 4R56A 1TU0B 1RADB 3GLXA 1SSFA 2LCSA 1IREB 2DL4A 4GLKA 4PLIA 1TUCA 1QVPA 2OTLQ 2YRDA 1NJIU 3OW2S 3TSZA 3GBQA 4Z88A 2GNCA 5DLOA 4II1A 4OVAA 5HCKA 2J6FA 2O9SA 3OB9A 2RHIA 3UATA 5HY6A 1PSFA 1IRXA 5D6WA 3SWNB 3D7SB 5GMKi 1VQ6A 1VQ7T 1T3LA 1UJ0A 1V1CA 2QAZA 4ELZC 2PU9B 4C92F 3M4GA 4PJOF 1YP5A 2KRSA 2JMCA 4MZMA 3TCJA 4E7IA 1WHGA 3G6EQ 3BDUA 3J80E 1W2BS 2X4YA 1QCFA 1QCNA 1HSQA 1FXXA 1DJ7B 4LD9K 1U1SA 3SDZA 4OP0A 4KGXB 4WF2A 3TQ7P 4KGZB 4JJCA 4EIKA 2DL7A 1RUWA 4M7DF 2J7IA 4LDWA 3E19A 2L2PA 4EMKC 2V8JA 2YLCA 2VASA 4C0GA 5GAN6 1VQMA 4A4FA 2V8IA 1KIKA 1SEMA 2XDPA 1WFWA 4KBMB 1Q86C 1NYGA 5HK0A 1XNIA 2QK0A 3MCAB 7AT1B 3OQ5A 4BUGA 2EJ9A 2ZCFB 1PKSA 4RUGA 1BI3A 1LPLA 3OYDA 1X2KA 4BD3A 4M75B 2JTEA 3RUXA 1N9SA 3L2WA 1YHQQ 3UT1A 4E7HA 3OYFA 1ZQ1A 4C92D 1AWOA 5EC7A 5CIUA 4M7AA 4PJLA 4PJOD 1U1TA 3O5ZA 4JJBA 3QPHA 1VQ7Q 1RL2A 2CSIA 2ZPEB 1KFZA 1Z9ZA 2J6KA 4J9DA 2E70A 3M4YA 3VS6A 3G4ST 1OOTA 1K0XA 2D1XA 2KRNA 4RTVA 1K8AR 1JBMA 1BCOA 3UWNA 1VQLT 4PNOA 1K73R 3I56A 5CKBA 1YIJA 3F70A 2FPEA 2HBPA 1M90R 1PM3A 3OYCA 1YJ9A 4OMNA 4M7DD 4JLIA 2BE7D 1V76A 2P4RA 1M4ZA 4F7UE 1W1FA 3HSBA 2VVKA 1YN8A 3FRNA 4E6RA 1KQSA 2OAUA 1LOJA 2F5KA 1IO6A 2DMOA 1QW1A 4RG2A 1QQJA 4FYYB 3VKIA 2IG0A 1IHVA 5GJWB 1AWWA 3JB9H 3EG2A 3U23A 4F7UG 3EG0A 3I9QA 3VYHB 4P5NA 3CCRT 4DBQA 5CO7A 2DXUA 1IZ6A 2RJFA 2MMPA 2L8DA 2MCNA 2DYIA 1LNXA 4DOVA 1R8OB 4QVCA 4M78A 2CZ1B 2Y4YA 1JQQA 1YJWA 3EG9B 4E47A 4C0DC 2J05A 3FLGA 4MDXA 5D7UA 5DM7R 4OGEA 2E64A 3QXEB 4M75F 1ZUYA 3GPLA 1YJNT 2COWA 5C0MA 9ATCB 4J83A 4FM4B 3JB9F 2KXDA 3CCMT 3G4SQ 4R0KA 1EZZB 2KBTA 1VQNA 4LD6A 4BE1A 3FDRA 2DJQA 2KMTA 2DXCA 5CKEA 2YHTA 2BZ8A 1VYVA 3M56A 4IUTA 4B6MA 5CK9A 2FO0A 2VUBA 3L2ZA 5CQXA 3M59A 2DE0X 3VUBA 2RHUA 2KRMA 3VS7A 3HPWA 1HJDA 4Y91A 1YI2A 2YSQA 3MP8A 4ZNXA 1YCSB 4XTYA 4JZ3A 2LJ0A 1WQWA 2HCKA 5LJ5d 5L23A 1NEGA 3HFOA 3V8JA 1VQOT 3CCRQ 3CCSA 5J26A 3JCMX 2DKGA 1YITA 1KQ1A 2VGMA 1TOVA 3O8VA 1G3TA 1T0HA 1XOVA 2RI5A 4PJNA 4M75D 2E1HA 1KC8U 4FW1A 5HKCA 2C0IA 3UPUA 1JRIA 1WJSA 1WHJA 2YXYA 1MMNA 3IQLA 3JB9D 3CCUT 1YJNQ 2RD1A 1S72T 2YWWA 5IAYA 5A2QE 2PUKB 2OTLA 4PKCC 1N8RC 3JB9J 1SHGA 4J9GA 2CREA 3JV3A 2RHXA 2K5IA 3A8LB 1VIFA 2KAFA 3CCMQ 3RR6A 1MNEA 3RESA 3H6ZA 2ZPIB 2D6FA 2QI2A 4J7FA 4HT9A 5AT1B 3CXCA 1F1BB 3KUFA 5KE2A 2XDBA 2PVGB 3OYIA 1VIEA 2M9UA 2LZ6B 1JXMA 3JCMb 1RAFB 3OSVA 1I5LA 3OYKA 4VUBA 4QW2A 4EMKA 3HRSA 2QQ9A 4J9CA 4MDWA 4E7JA 3DB3A 5IH2A 1J3TA 4QVDA 4M77A 2D8JA 2KR3A 4XQ3A 1D3BB 4QQGA 3MPUB 2BKDN 2WSFE 2BUDA 1D0YA 2VKNA 2XG8D 3M57A 4OMQA 1UECA 2I2LA 4D8DA 1Q7YC 4ORZA 1GCPA 2KROA 3EAEA 3DKMA 1IHWA 1QP3A 1D09B 1ABOA 2EIFA 2RJCA 2QA4T 1JJ2A 4J9BA 2KT8A 1KQ2A 4FW2A 2HDAA 1ZLMA 1S72Q 1WYXA 2IPOB 1ZSZC 3QG1A 3ASKA 2P0PA 2W10A 2DO3A 2QYZA 1NZ9A 1WIEA 2NWMA 2J6OA 4OB3B 4OMOA 1VQ8Q 3SFMA 2EKOA 1VQ7A 1NM7A 3M0PA 4C8QB 2JT4A 2QEXT 4N0AC 3VS5A 1U8RA 1M2VA 2A0FB 2RI2A 4FCYA 3EG1A 1S1NA 2NUTA 1Q82C 3REAB 1PHTA 3GF5A 3LLRA 1C0MA 2X51A 2K5LA 5I22A 1R0BG 4C92E 1UGPB 3OYNA 2X4JA 4XTXA 2DTHA 4PJOE 3GOXA 3FEOA 2DK3A 2O88A 4MMKA 1M3AA 3EGDA 1VQKT 1QMCA 2KDSA 2DJZA 2EYWA 3EFOA 1WJQA 5EG2A 2XIDA 3V8LA 1K9MR 2RA2A 1GXIE 1YWPA 4MZTA 2RQTA 1I0CA 1M90U 3QUIA 4XU1A 2R57A 4C92G 1MMAA 1U5SA 4PJOG 2RQVA 4NS5A 2WSCE 4Q5WA 1O9SA 4B9XA 4ME7A 4M7DE 1M1KC 2ROTA 2EGEA 4M4ZA 5IT9E 2Y4XA 2DZCA 1RAAB 2CS7A 2QASA 2KE9A 2HL3A 2KNBB 1CKBA 2CH4W 3ZBDA 2COZA 3JSCA 3ZFJA 4FIBA 1QKXA 2CT4A 5IHKA 4NL2A 1QVGS 4M7DG 4LDUA 2JS0A 1QVFA 5IXBA 4QQDA 4KH1B 2JNGA 2RJDA 3QSUA 3I55T 5IHIA 3CMET 3Q1JA 1VYUA 4BB7A 3RNJA 2PNIA 3G71T 5GJVB 3CCQT 1UEBA 3MJXA 2JUFA 2QEXQ 1YFNA 2HEQA 5HK3A 1M8MA 3CPWP 3G4SA 2E4HA 5GAN8 4A4EA 1D1AA 2YRCA 4GBQA 1T3SA 3T9NA 1VQLA 3EH1A 2R5MA 2V8KA 3CMAQ 4C8QF 5I2SA 2K2MA 2AT1B 3JCMP 2OTJQ 2RO0A 2QQAA 4LE9A 1Q81C 4V2SA 2M0OA 5LJ5f 3EG3A 3OY9A 1K9AA 3CCEA 2KK4A 1OX9A 1NYFA 2RPNA 1NEBA 3CC4T 5KYYA 1I81A 1TSFA 2FG0A 2M1HA 1UB4A 3H0FA 5KYUA 2V1QA 2COYA 2L3RA 3CC7Q 3P8HA 3FB9A 1PRMC 2EYZA 3P8DA 1GRIA 4FYXB 5LJ5e 1MMGA 2NUPA 5GANd 4HVWA 1WHHA 1YHQT 2X3WD 1ABQA 2E5KA 4JZ4A 1KD1C 5CAIA 3CCRA 3OW2A 2JVVA 3JCMc 4DBFA 1LCKA 3MEVA 2HD0A 3QDFA 3MKDA 4XK8E 1D1CA 3SD4A 4LXCA 4F7UA 3MEUA 1H641 1EIFA 3LGLA 3R6OA 4TVRA 4CC2A 1B34B 1WQ7A 4C92C 5GAN7 3LW5E 3LWHA 4K11A 3I55Q 1YJNA 4PJOC 1W2BA 3CMEQ 1R77A 2LQWA 1V29B 4N4IA 2E10A 2KYMA 2EJFA 3I35A 2QTXA 3G71Q 3CCQQ 2CZ6B 1QWFA 1MNDA 2CUDA 3I5SA 1TXQA 2YRVA 3SEMA 1UDLA 4C8QD 1BI2A 3CCMA 4FSXA 4AFQC 1OULA 3CBPA 1JEGA 3MHXA 4M75E 1FX7A 1GBQA 1VQ4T 3NFCA 5FU6B 4AMCA 1M30A 2LT1A 5GAOp 3OMCA 1WPYA 1BU1A 1UHCA 2SRCA 4M7DC 1G8XA 2GQVA 1JU5C 3J81E 3ER0A 1M8VA 4KUDK 3E9GA 4M75G 3BFMA 3GIBA 2AZVA 3CC4Q 2F1LA 3JAME 4BI8B 3M53A 4J9HA 3JB9G 1RACB 2RM4A 2DIGA 3JB9I 1RI9A 5LJ5h 3A8HB 4N4HA 2P4TA 2RQUA 1FWZA 1VQOA 3QDRB 2QQRA 5CCAA 3FC3A 2DEUA 5FRNA 3JRZA 2ED1A 3EGUA 2E6ZA 2O01E 2K6DA 1AVZC 4ESRA 2OX7A 5KYWA 3CCLT 3PMIA 2H3EB 4L6V5 4J6WA 1ZSZA 2RHZA 2EYQA 4EMHA 1PG5B 3P8BB 5KYXA 3FJPA 3HRTA 3DLMA 2KSSA 5A0GA 3QIIA 3CCUA 2K79A 1BBZA 3CCJT 3HP9A 1A0NB 1HYOA 4QVZA 1G2BA 1S72A 1XTDA 4RTZA 3SWNC 1BYMA 1UJYA 1YWOA 2QTVA 3MP6A 4C5GA 5GAOm 4PK4A 1ACMB 2DBMA 3TEEA 1IXDA 4N0AA 4BY6B 1X6BA 1E6GA 1NJIC 3CC2Q 2DERA 3L2UA 1KQSS 5DLQE 4CC7A 1SHFA 1OU8A 2RK1A 3OYGA 1VQ4Q 1SG5A 5GMKl 2IVWA 2ZPBB 2GQIA 4OMLA 1KQSP 4QKUA 2E3HA 2L89A 3LX7A 1AHJB 1Y7XA 3EHRA 2KXCA 2OAWA 1Y07A 3WVEB 3OBWA 1N8RU 2DPPB 1VQPQ 4HVUA 4LUEA 4RTXA 4JUVA 3E2UA 1Q86R 3EGXA 3BDLA 5GAOr 2Y90A 3OSSC 3TREA 2A37A 3UF4A 1UUEA 2O4XA 4RTUA 1AT1B 3JCMW 2H3JA 2A36A 1WZOA 2GTJA 3TSWA 1MV0B 2JTMA 4J9IA 4X1VA 3H41A 3V8KA 2KGTA 1ZBJA 2MYSA 4J5YA 2EWNA 1ZHIA 4LDYA 4AG1C 2L3QA 4OB1B 1FMVA 1M2OA 2K5FA 2M0YA 3CCLQ 4D8KA 3PTAA 3PNWC 4M75C 4JPBW 2QDYB 3OYLA 1YCYA 1D1BA 2HMAA 4C0FA 4JRQA 3AHUA 2MF2A 1K9MU 4LNPA 4KULA 2QA4A 3META 3RDVA 1AZGB 1T0JA 2CUBA 1GL5A 1NBEB 1OI1A 5LJ5j 3CCJQ 2QDLA 4A53A 3LWIA 4OF1A 2KYBA 5LJ5g 2LQ8A 2CP5A 2AHJB 2LMJA 1VQ9T 4F17A 2DM1A 2MWOA 3G7ZA 1PCXA 4ZTFA 3VV0A 2NYSA 3J7AF 3LYIA 1H3ZA 1UTIA 2VWFA 4J9FA 3H0HA 4O5VA 3CD6T 1VOMA 1Y96A 5ECAA 2LJ1A 4BE0A 4B9WA 2QEXA 2HBWA 4PJMA 1UGVA 4DBRA 1SF9A 2A28A 2C0TA 2M51A 1OZ2A 2JZ2A 4J6YA 1GFDA 3X25B 2EQUA 2L5QA 1C1AA 4A4GA 4E7SA 1HK9A 4BY6C 1OPKA 3OYBA 1RLQC 2YUPA 2K9GA 4M7AB 1PKTA 5GANf 3BE3A 5L8RE 1SPKA 2C0OA 2LC4A 3NTKA 1TTHB 1VQKA 2O2OA 4J8OA 1X6OA 3V7CA 1W6XA 2DILA 1UHFA 2J06A 1D0ZA 4WCIA 1VQ6Q 4FT4A 1X2QA 5FWCA 1BIBA 2RNAA 1AD5A 5GANe 2LJ3A 1EFNA 2QGFB 4E2FB 4BI3A 4HKEA 1Q82U 1ZUUA 4DBHA 3NGPA 1FMKA 4C0ZA 2RMOA 4HCCA 3SHWA 3BW1A 3EFRA 1YIJT 5C6SA 4KRTA 3GNGA 2EJGA 3A1PA 2MK5A 1VQ8T 1TG0A 2VV5A 4C92A 2EQMA 3JCMJ 2CP2A 1TH7A 4PJOA 1GCQC 2JOYA 3PE0A 4RCBA 1AWXA 2V26A 5A0LA 3G6EA 1HXDA 1VQ9Q 3OYAA 2CGHA 1NLOC 2JJ9A 2BIVA 2DXTA 4FYWB 3QKJA 2JMAA 1M9SA 2PVOB 1KSWA 3CXCP 2EQIA 3VJPA 2H8HA 1KG1A 1LVKA 3G71A 3CD6Q 4M78B 4M7DA 2PZ1A 2FRYA 3M0SA 3V7SA 3C4SA 2E12A 1VUBA 2EGAA 1UGQB 1YJWT 3QJ6A 4PFOA 4OMMA 2VYTA 1SKUB 4EPCA 1OEBA 2F2WA 2K4YA 3S3NA 1W70A 1B7TA 4M7AF 2LX7A 4C8QE 4JRIA 3A8GB 3CC4A 3ME9A 3QO3A 1G3YA 2XK0A
chains in the Genus database with same CATH topology
4C92D 5I21A 4C8QF 5I2SA 3JCMP 5CKHA 5CIUA 4M7AA 2E65A 5GANh 2A3LA 2RO0A 4PJOD 1U1TA 2QQAA 3QPHA 1YHQA 3ZEHA 1RL2A 1Q81C 4V2SA 4M7AG 2M0OA 4C8QA 2QXFA 2ZPEB 5LJ5f 3RIRA 1BIAA 2X4WA 3CMAA 3OY9A 3CCEA 2OTJA 2E70A 3M4YA 2KK4A 2FVUA 3GNFB 4HCZA 4C8QG 3G4ST 1BKBA 3KXTA 2RI3A 2DXBA 2CKKA 1JBMA 3JCMd 1I81A 3CC4T 2M1HA 5GMKh 1UB4A 3UWNA 3PIPA 1VQLT 4PNOA 3PFSA 2L3RA 5CR2A 3P8HA 3I56A 1NPPA 5CKBA 3FB9A 1WGSA 3P8DA 3SWNA 5LJ5e 1QP2A 5GANd 1YIJA 3F70A 2HBPA 1YHQT 2DTOA 4IUVA 3OYCA 1YJ9A 4M7DD 4JLIA 4ZGEB 2XI9A 2XICA 3S6WA 1M4ZA 1KD1C 3JCMV 4F7UE 5KE3A 3HSBA 5GAN2 2XDDA 1KC8C 3FRNA 3CC7A 4BE2A 1KQSA 2LX9A 5CAIA 3CCRA 3OW2A 3CMAT 2JVVA 5D6XA 2OAUA 3JCMc 2OTJT 3MEVA 1LOJA 4C5HA 2F5KA 2LQKA 4F7UF 2HD0A 4JLGA 3LGFA 4XTWA 4BACA 3HKSA 3HRUA 4OB2B 4XK8E 3OYYA 4YTLA 1QW1A 3RERA 5FU7C 3OYJA 4IKFA 4OB0B 4RG2A 3I56T 1M5Q1 2LNVA 3SD4A 4F7UA 3RMSA 3VKIA 4A54A 4X34A 3MEUA 4JS4A 1H641 3QJYA 5KCHA 2IG0A 3JB9H 1YJ9T 4F7UG 1EIFA 3LGLA 3R6OA 3VYHB 4TVRA 4A4KA 1B34B 4M78E 3CC7T 4P5NA 2HAXA 1VQ4A 3CCRT 1WQ7A 4C92C 3UDCA 1YBYA 3SB2A 4DQ2A 5GAN7 3LW5E 2EQJA 5CO7A 2DXUA 3LWHA 4E7LA 1YJNA 4PJOC 2GCXA 1W2BA 4M78F 1IZ6A 2RJFA 4RCCA 3CXCS 2MMPA 4M7AD 1V29B 4N4IA 2E10A 2L8DA 5LJ3h 1LNXA 2EJFA 2DTIA 3QBYA 2QTXA 4DOVA 1R8OB 4QVCA 5KH6A 2CZ6B 1NPRA 3OYHA 2YRVA 3HFNA 4M78A 2CZ1B 3FIFA 2LDMA 4C8QD 3M9QA 4CRIA 4CI0C 2Y4YA 5A0DA 5GMKm 2K3YA 3I55A 1YJWA 1BI2A 4XTUA 3T9NA 3CCMA 2VGNA 4FSXA 1M1KU 3RKYA 2B8AA 2XKOC 3CBPA 4E47A 3CMEA 3MHXA 4C0DC 4M75E 4M78G 3M58A 3CCQA 1FX7A 3FLGA 5GAN4 1VQ4T 5GAMh 4MDXA 4X9CA 1UGSB 2DD4A 3NFCA 5FU6B 5DM7R 4OGEA 2E64A 2LT1A 3QXEB 4M75F 3OMCA 5GAN3 5GAOp 3GPLA 1YJNT 2O4XB 1WPYA 4ATOA 1OZ3A 3E1SA 3RKWA 3OA6A 2FHDA 2LT4A 4M77E 4A4HA 5C0MA 4M7DC 2GQVA 5LJ3d 4J83A 5KCOA 3J81E 1BI0A 3DB4A 3ER0A 4FM4B 4M75A 3JB9F 5GAN5 4JRPA 3L42A 1M8VA 1O75A 4KUDK 1Q86U 4ZTJA 4IURA 3CCMT 2RJEA 2ZGWA 3NTIA 4BDYA 1K9MC 3E9GA 3MO8A 4M75G 3BFMA 4C5EA 3GP8A 3GIBA 3CPWS 4GY5A 3OS1A 1QVGA 2E6NA 1VQNA 3JAME 2LCLA 4LD6A 4BI8B 4HT8A 4BE1A 3FDRA 3X24B 3M53A 2KMTA 5GAMd 4Z02A 4EMKB 3E9FA 3JB9G 2RM4A 3CBMA 2DXCA 4J7IA 2DIGA 3JB9I 5CKEA 5LJ5h 4MZPA 4MMLA 3A8HB 4N4HA 2XU8A 2C06A 2P4TA 5AYFA 3C95A 1G3SA 1FWZA 2YHTA 4R55A 3A8OB 2PQWA 5GANj 4M77B 3M56A 4IUTA 1VQOA 2CZ7B 2XHCA 3BY7A 2QQRA 3H8ZA 3QDRB 2CZ0B 5CCAA 3FC3A 1JJ2S 5CK9A 1ZBXA 5FRNA 3JRZA 2LCCA 5GANg 3CCJA 4RMOA 2VUBA 3L2ZA 2DZ9A 5CQXA 4ZN3A 3LH0A 4M7AC 1VQNT 2RHYA 2E6ZA 2O01E 2GFAA 3M59A 2JTFA 3VUBA 3PIOA 2RHUA 5GAOl 1N9RA 3HPWA 3CCLT 1Q81U 3PMIA 4Y91A 1YI2A 2XD0A 4L6V5 4C8QC 4J6WA 3N5BB 2E5QA 2RHZA 3MP8A 4J6XA 4XTYA 4FU6A 3HL8A 4M78D 2EYQA 1WQWA 2MWPA 4XU0A 4EMHA 5GMKj 3P8BB 5LJ5d 4IUUA 4HA8A 3HFOA 3V8JA 3FJPA 1VQOT 1LJOA 1NE8A 1W4SA 4L59A 2R58A 3CCSA 3HRTA 3DLMA 2KSSA 2WSEE 5J26A 5A0GA 5GAOq 3QIIA 3S3OA 3DLLA 3L2QA 3CCUA 3C94A 3CCJT 3HP9A 2F5TX 3PT9A 4FT2A 4QVZA 4RKUE 5CVIA 3CBOA 1XTDA 3MEWA 3S3MA 1S72A 2E41A 3SWNC 3JCMX 4HCBA 1BYMA 1Y96B 2DKGA 2R5AA 4O6JA 1YITA 1KQ1A 3QZ5B 2VGMA 2YLBA 3O8VA 1G3TA 3MP6A 4C5GA 1XOVA 5GAOm 1YI2T 2RI5A 1KD1U 4IUPA 4M75D 2E1HA 4NOYA 3TEEA 1KC8U 2RH2A 4N0AA 4BY6B 4ZN1A 5HKCA 1NJIC 3UPUA 1JRIA 1WJSA 3L1AA 3L2UA 1B34A 1UGRB 1I8FA 1M1FA 2X35A 4OMFB 5DLQE 1KQSS 2RK1A 3JCMe 3OYGA 3CCST 3X26B 3JB9D 2JN0A 2DAQA 5GMKl 2IVWA 2ZPBB 3CCUT 4KT0E 3L2RA 2RD1A 4Y28E 1S72T 2CYZB 2DIQA 4XAXB 5IAYA 3CC2A 5A2QE 2PUKB 1WNLA 2OTLA 4PKCC 4RG8A 2L89A 5D6YA 1YITT 1N8RC 4DOWA 3JB9J 3LX7A 1AHJB 1Y7XA 2RHXA 4ELYC 1Y07A 4LDVA 3WVEB 3OBWA 1N8RU 2DPPB 1X75C 2K5IA 2KY9A 3A8LB 3TU4K 1VIFA 2KAFA 1K8AC 3A8MB 5LJ3j 1KHCA 4JUVA 4OGCA 4LDXA 4BDZA 3A5ZB 2EAYA 2F69A 4XTZA 1K73C 2FL7A 1K8AU 3BDLA 5LJ3g 5GAOr 2Y90A 3OSSC 3TREA 3RESA 1K73U 3RKXA 1M90C 2O4XA 3H6ZA 1VQ9A 2KVQG 2ZPIB 2D6FA 5J3BA 3L2VA 4BI4A 3JCMW 2QI2A 4J7FA 1VQPA 3MP1A 4HT9A 3CXCA 1M1GA 3CC2T 2FB7A 2H3JA 3KUFA 4M78C 5KE2A 2XDBA 3CEYA 2DVEA 2M16A 2QQSA 4XU2A 5GAMj 2OTLT 2PVGB 3OBYA 3OYIA 1VIEA 1N27A 2M9UA 2ZZDA 5CKFA 1KHIA 4PLLA 3JCMb 5GAMg 2ZPFB 4D6WA 5I2MA 3KBGA 2JTMA 3PGGA 2D0QB 1RI0A 3V8KA 4C5IA 4C92B 5IN1A 4X9DA 3OSVA 4J5YA 4LDYA 2EWNA 1ZHIA 3V7RA 4ZGDB 4PJOB 1I5LA 3OYKA 4OB1B 2D9TA 4VUBA 4QW2A 4EMKA 2X4XA 3HRSA 3MEAA 2K5FA 2QQ9A 3QYHB 1OYXA 4M77F 4MDWA 5J39A 2ZPGB 3OS5A 3PNWC 5LL6S 4XTVA 3PTAA 4E7JA 4M75C 1VQPT 3DB3A 2QDYB 3OYLA 2KQWA 1YCYA 4C0FA 4JRQA 3AHUA 2MF2A 4QVDA 2RB6A 1QVFS 1K9MU 3OYEA 2HQEA 4NL3A 1I4K1 4M77A 4KULA 3G6ET 4C0DB 5CKDA 2QA4A 3META 2HNIA 4XQ3A 3CCLA 3CCVA 1D3BB 4QQGA 2BKDN 4M77C 2WSFE 5LJ5j 1OI1A 3CPWA 4M77G 3CD6A 2BUDA 4A53A 4EDUA 3LWIA 4OF1A 2A7YA 2XG8D 4FL6A 5LJ5g 2LQ8A 3M57A 4N4GA 3X28B 2AHJB 1Y71A 4JDSA 3URGA 4M7DB 4UC4A 1VQ9T 2I2LA 1XQHA 2WACA 3EFSA 2K3XA 2K57A 1Q7YC 2MWOA 3G7ZA 2VC8A 3NTHA 2P0QA 4ZTFA 3INZA 3EAEA 3VV0A 3DKMA 1QP3A 3J7AF 3LYIA 3OMGA 2EIFA 2RJCA 2QA4T 4L5GA 2GFUA 2LTOA 1H3ZA 2EFIA 1JJ2A 3CCVT 2PVDB 2GF7A 3VUZA 1KQ2A 3JCMh 3CD6T 4O5VA 5FLXE 1Y96A 5M9OA 4BE0A 4B9WA 2HQXA 2QEXA 1G5VA 3QG1A 3M55A 3X20B 5DY9A 3QYGB 4JRKA 1VQ5A 1OZ2A 2JZ2A 1X01A 1JB0E 3ASKA 2P0PA 4J6YA 3X25B 2EQUA 4KUIA 3JCMf 2L5QA 3VU3C 2DO3A 4A4GA 1HK9A 4BY6C 1P92A 3OYBA 4JS5A 1NZ9A 4R56A 3GLXA 1SSFA 4M7AB 4OB3B 3RMQA 1IREB 5GANf 3SFMA 4GLKA 2EKOA 5L8RE 1VQ7A 4PLIA 2LC4A 3C12A 4C8QB 2QEXT 1QVPA 3NTKA 5FRMA 1VQKA 1BI1A 4J8OA 4N0AC 1X6OA 3V7CA 3OW2S 1NJIU 1PSEA 1N6AA 1U8RA 3OYMA 2RI2A 4PL6A 1VQ8A 5DLOA 1VQ5T 4FT4A 4M77D 1BIBA 4II1A 4OVAA 1Q82C 4XU3A 3OB9A 5GANe 4QQ6A 2RHIA 3GF5A 3LLRA 5HY6A 3CCET 1PSFA 5D6WA 3M54A 4BI3A 2K5LA 4HKEA 1Q82U 3SWNB 4C92E 1UGPB 3OYNA 2X4JA 4XTXA 3WVDB 5GMKi 5GAOn 2DTHA 3OS2A 1VQ7T 4C0ZA 1VQ6A 2PUOB 3FEOA 3OS0A 1WJRA 3GOXA 4PJOE 4ELZC 2DK3A 2PU9B 4EMGA 4C92F 4HCCA 2K2VA 2VXFA 4MMKA 1VQKT 1MGQA 2KDSA 3BW1A 3M4GA 4PJOF 2DEQA 2DJZA 3EFRA 1WJQA 5EG2A 4MZMA 3TCJA 4E7IA 1YIJT 5C6SA 2XIDA 3BDUA 2EJGA 3GNGA 3V8LA 3J80E 1W2BS 1VQ8T 5GMKe 5FU7B 3HHTB 3QZ9B 2VV5A 2RA2A 1GXIE 3M5AA 4C92A 5FU6C 2EQMA 3JCMJ 4MZTA 3WXMB 1TH7A 1M90U 3PMTA 4PJOA 2LRQA 2G3RA 2JOYA 3QUIA 4XU1A 4RCBA 2R57A 2X4YA 4C92G 4F7UB 5A0LA 5CQYA 3G6EA 4PJOG 1HXDA 1FXXA 1DJ7B 3OYAA 1VQ6T 4NS5A 2CGHA 4LD9K 2WSCE 4Q5WA 1O9SA 4B9XA 1U1SA 2BIVA 2DXTA 3SDZA 4JJNK 4ME7A 4OP0A 2FYKA 2RK2A 2LVMA 4WF2A 2NLUA 2DD5A 3QKJA 4IUQA 4M7DE 1M1KC 5IT9E 2Y4XA 2DZCA 1M9SA 2PVOB 4E7KA 1D3BA 1QVFA 2CS7A 3QHSA 4M7DF 3VJPA 2EQKA 3VYGA 4LDWA 1KG1A 3E19A 4EMKC 3G71A 2V8JA 2YLCA 5LJ3f 3ZBDA 4C0GA 3JSCA 3ZFJA 4FIBA 5GAN6 4M78B 4M7DA 1G3WA 1VQMA 4A4FA 3JCMQ 3CPFA 2V8IA 2MAMA 3V7SA 4NL2A 1QVGS 4M7DG 4DA4A 2XDPA 2QQBA 3C4SA 4KBMB 4LDUA 2E12A 5HK0A 1Q86C 4QQDA 1XNIA 2JNGA 2RJDA 2ZPHB 3MCAB 1VUBA 3QSUA 1MHNA 1UGQB 5GAMf 3I55T 3OQ5A 4BUGA 1YJWT 3QJ6A 2EJ9A 2ZCFB 5LJ3e 2VYTA 4EPCA 3CMET 3Q1JA 1BI3A 4BB7A 3G71T 3CCQT 2K4YA 3OYDA 2P0KA 1UEBA 2JUFA 4M7AE 1Q7YU 4BD3A 5FROA 4M75B 3RUXA 3S3NA 5HK3A 4ZGJB 1VQMT 1N9SA 3G4SA 5GAN8 4M7AF 3L2WA 2MI6A 2VXEA 4A4EA 4C8QE 4JRIA 5GAMe 3A8GB 3UT1A 4E7HA 3CC4A 3JCMg 3OYFA 3ME9A 3QO3A 1G3YA 2XK0A 1VQLA 1ZQ1A 2R5MA 2V8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C92 D;  5I21 A;  5LJ3 g;  2Y90 A;  4C8Q F;  5GAN 5;  4N0A C;  3V7C A;  3JCM P;  3RES A;  4M7A A;  2E65 A;  5GAN h;  4PJO D;  1M8V A;  1U1T A;  3RKX A;  2ZGW A;  3JCM W;  4M77 D;  4M75 G;  4HT9 A;  3BFM A;  1BIB A;  3GIB A;  2FB7 A;  4V2S A;  4M78 C;  4M7A G;  4C8Q A;  4XU2 A;  2DVE A;  4XU3 A;  5GAN e;  5LJ5 f;  5GAM j;  4HT8 A;  3RIR A;  1BIA A;  5GAM d;  3JCM b;  4EMK B;  3SWN B;  4C92 E;  5GAM g;  3JB9 G;  2RM4 A;  4C8Q G;  4XTX A;  3PGG A;  5GMK i;  5GAO n;  2DTH A;  3JB9 I;  4PJO E;  3V8K A;  4C92 B;  5LJ5 h;  1JBM A;  4MML A;  1I81 A;  4X9D A;  3JCM d;  4J5Y A;  5GMK h;  2EWN A;  4C92 F;  3V7R A;  4EMG A;  4PNO A;  4MMK A;  2VXF A;  1I5L A;  4PJO B;  2YHT A;  1MGQ A;  3BW1 A;  3M4G A;  4PJO F;  2DEQ A;  2DJZ A;  3EFR A;  3FB9 A;  4M77 B;  5GAN j;  4EMK A;  3SWN A;  3BY7 A;  5LJ5 e;  3BDU A;  2EJG A;  4M77 F;  3V8L A;  5GAN d;  3JB9 F;  5GMK e;  4XTV A;  4M75 C;  2RA2 A;  5GAN g;  4C92 A;  2DTO A;  3L2Z A;  2DZ9 A;  4M7D D;  3JCM J;  1YCY A;  4M7A C;  4JLI A;  1TH7 A;  3AHU A;  4QVD A;  4PJO A;  2RB6 A;  3JCM V;  4F7U E;  3HSB A;  5GAN 2;  3QUI A;  4XU1 A;  4RCB A;  4NL3 A;  5CAI A;  1I4K 1;  4M77 A;  5GAO l;  4C92 G;  3JCM c;  1N9R A;  4F7U B;  4Y91 A;  2HNI A;  1LOJ A;  4XQ3 A;  4J6W A;  1D3B B;  4PJO G;  1HXD A;  4C8Q C;  4F7U F;  4J6X A;  4M77 C;  2CGH A;  4XTY A;  5LJ5 j;  4M78 D;  4XTW A;  1U1S A;  4M77 G;  1WQW A;  2DXT A;  4XU0 A;  4EMH A;  4OP0 A;  5GMK j;  2FYK A;  3RER A;  4WF2 A;  4A53 A;  5LJ5 d;  4HA8 A;  4M7D E;  5LJ5 g;  3HFO A;  1M5Q 1;  3V8J A;  3FJP A;  1LJO A;  4F7U A;  4A54 A;  2DZC A;  5GAO q;  4M7D B;  1H64 1;  1D3B A;  2I2L A;  3EFS A;  3QHS A;  2K57 A;  4M7D F;  2VC8 A;  3JB9 H;  3INZ A;  4F7U G;  2E41 A;  3SWN C;  4EMK C;  3JCM X;  2YLC A;  1Y96 B;  2DKG A;  5LJ3 f;  1B34 B;  4M78 E;  1KQ1 A;  1WQ7 A;  2YLB A;  4C92 C;  3SB2 A;  5GAN 6;  4DQ2 A;  4M78 B;  5GAO m;  4M7D A;  5GAN 7;  2DXU A;  1KQ2 A;  4PJO C;  4M75 D;  2E1H A;  4M78 F;  4NOY A;  3JCM h;  3JCM Q;  4N0A A;  4RCC A;  4M7A D;  1JRI A;  2E10 A;  5LJ3 h;  1LNX A;  2EJF A;  2DTI A;  3L1A A;  1Y96 A;  2QTX A;  4NL2 A;  3V7S A;  1B34 A;  1I8F A;  4QVC A;  4M7D G;  3QSU A;  3JCM e;  3HFN A;  4M78 A;  5DY9 A;  5GAM f;  3FIF A;  4C8Q D;  3JB9 D;  2EJ9 A;  2JN0 A;  5LJ3 e;  5GMK l;  5GMK m;  4JRK A;  4XTU A;  2RD1 A;  4J6Y A;  1X01 A;  3RKY A;  4M75 E;  4M78 G;  3JCM f;  3VU3 C;  1WNL A;  4M7A E;  5GAN 4;  1HK9 A;  5GAM h;  3JB9 J;  4M75 B;  4X9C A;  3RUX A;  4M7A B;  2E64 A;  4M75 F;  5GAN 3;  5GAO p;  1N9S A;  5GAN f;  5GAN 8;  4M7A F;  1WPY A;  2VXE A;  3RKW A;  4C8Q E;  4JRI A;  5GAO r;  5GAM e;  5LJ3 j;  4JUV A;  4M77 E;  3JCM g;  4M7D C;  3QO3 A;  4XTZ A;  2EAY A;  4C8Q B;  5LJ3 d;  4M75 A; 
#chains in the Genus database with same CATH topology
 5I21 A;  5CKH A;  2E65 A;  5GAN h;  2DET A;  2A3L A;  1I07 A;  1YHQ A;  4RTW A;  1TS9 A;  1JO8 A;  2QXF A;  3A98 A;  1BIA A;  1HD3 A;  2X4W A;  3I56 Q;  2DA9 A;  1N8R R;  2JXB A;  1JJ2 P;  4AFZ C;  2MIO A;  2FVU A;  3GNF B;  4C8Q G;  1YIJ Q;  1BKB A;  4F04 B;  2RI3 A;  2DRK A;  2GGR A;  3PIP A;  1I1J A;  3PFS A;  1QWE A;  5CR2 A;  1NPP A;  3SWN A;  4HVV A;  1QP2 A;  1B3Q A;  4ZGE B;  2XI9 A;  3S6W A;  5KE3 A;  5GAN 2;  2XDD A;  1KC8 C;  3CMA T;  2LX9 A;  2OTJ T;  1H3H A;  4Z89 A;  2EBP A;  4C5H A;  4XTW A;  2HSE B;  3CQT A;  2EKH A;  2SEM A;  3OYJ A;  2YUQ A;  4IKF A;  1M5Q 1;  3VS1 A;  4A54 A;  4JS4 A;  2QG9 B;  3EH2 A;  1Y0M A;  2XMF A;  3CC7 T;  1GFC A;  2HAX A;  1VQ4 A;  2KI7 A;  1YBY A;  3SB2 A;  4DQ2 A;  4E7L A;  1YJW Q;  2GCX A;  4M78 F;  4HCK A;  4M7A D;  8ATC B;  5KH6 A;  2LQN A;  3HFN A;  3FIF A;  5FRM A;  2K3Y A;  2L3S A;  4XTU A;  3I5R A;  1Q7Y R;  2XKO C;  2A08 A;  2HKN A;  3M58 A;  2FEI A;  5GAN 4;  3VS4 A;  4X9C A;  2LP5 A;  4ATO A;  1OZ3 A;  3E1S A;  3RKW A;  3OA6 A;  2FHD A;  2LT4 A;  4M77 E;  5LJ3 d;  5KCO A;  4M75 A;  4A63 B;  4JRP A;  3L42 A;  1O75 A;  1Q86 U;  4IUR A;  2RJE A;  2ZGW A;  4BDY A;  3CPW S;  4GY5 A;  1QVG A;  3HTR A;  2E6N A;  2JS2 A;  3X24 B;  3QWX X;  5GAM d;  4EMK B;  2ZAE A;  3E9F A;  2OI3 A;  4J7I A;  1QVF P;  4MZP A;  2XU8 A;  1QCO A;  5AYF A;  4R55 A;  3A8O B;  5GAN j;  4M77 B;  2CZ7 B;  3BY7 A;  3M0R A;  3M0U A;  3REB B;  1YI2 Q;  2CZ0 B;  1NG2 A;  2LCC A;  5GAN g;  4KH0 B;  1TUD A;  4RMO A;  3CCJ A;  1Q82 R;  1G83 A;  3M0Q A;  5GAO l;  2RF0 A;  4C8Q C;  1X27 A;  2L0A A;  4FU6 A;  3HL8 A;  2RQR A;  4M78 D;  4XU0 A;  1CKA A;  2AIR B;  2DVJ A;  4HA8 A;  1YIT Q;  2I0N A;  1VA7 A;  2HZY A;  2R58 A;  2WSE E;  5GAO q;  3S3O A;  3C94 A;  1K0S A;  3PT9 A;  2F5T X;  1WXT A;  1Z9Q A;  4RKU E;  3S3M A;  4PFP A;  2E41 A;  4HCB A;  2R5A A;  2YLB A;  4IUP A;  4NOY A;  3TVT A;  4ZN1 A;  2P84 A;  2O31 A;  1I8F A;  1M1F A;  3JCM e;  1M1K R;  2IIM A;  1ZA1 B;  2DLP A;  2GTO A;  2JN0 A;  4KT0 E;  1WA7 A;  4Y28 E;  2CYZ B;  2DIQ A;  2X9H A;  2B86 A;  1RLP C;  3OW2 P;  1WNL A;  4AG2 C;  2DL5 A;  4ELY C;  1M2V B;  4LDV A;  3EG9 A;  2F2V A;  1K8A C;  1KHC A;  2NUT B;  4OGC A;  4BDZ A;  3VRY A;  1K73 C;  2F69 A;  2FL7 A;  1BCM A;  1M3B A;  1I5O B;  2DFU A;  1M90 C;  1GCQ A;  2KVQ G;  2QGG A;  3CC2 T;  2FB7 A;  2DF6 A;  3CEY A;  3OBY A;  1E6H A;  3EGD B;  2MPX C;  1W2B P;  2ZZD A;  3EFO B;  5CKF A;  1KHI A;  2K7A A;  5I2M A;  2CT3 A;  2D0Q B;  4RTY A;  4HXJ A;  1UFF A;  2JM9 A;  4X9D A;  2YT6 A;  2X4X A;  3QYH B;  1OYX A;  2VB6 A;  4M77 F;  1VQ9 A;  2ZPG B;  3OS5 A;  4XTV A;  1VQP T;  3NHN A;  3VS0 A;  1RAI B;  1Q81 R;  2HQE A;  4NL3 A;  2EYX A;  1I4K 1;  1U3O A;  4C0D B;  5CKD A;  3ZL7 C;  2HL5 C;  2CP6 A;  3UA7 A;  4M77 C;  1WXU A;  3CD6 A;  1X69 A;  4EDU A;  4FL6 A;  1PNJ A;  4N4G A;  1Y71 A;  4JDS A;  3URG A;  3VS3 A;  1WDX A;  1XQH A;  2WAC A;  2K57 A;  4Z8A A;  2PTK A;  2VC8 A;  2P0Q A;  2JW4 A;  1KD1 R;  1K1Z A;  3OMG A;  1RAH B;  2EFI A;  3CCV T;  1TWB A;  3VUZ A;  4F14 A;  3JCM h;  1K76 A;  4Y92 A;  1OU9 A;  1IGU A;  5DY9 A;  1MV3 A;  2O9V A;  4JRK A;  1JB0 E;  2X3X D;  4KUI A;  2HSP A;  2KT1 A;  1H8K A;  4AFU C;  2FZC B;  2L3P A;  3RMQ A;  2AKL A;  3C12 A;  1BI1 A;  1ARK A;  1PSE A;  1N6A A;  3OYM A;  1OPL A;  4PL6 A;  1VQ8 A;  1VQ5 T;  4M77 D;  2BZY A;  1QKW A;  5KYY B;  4XU3 A;  4QQ6 A;  1M3C A;  5KYU B;  1FYN A;  3CCE T;  3M54 A;  2YUN A;  5FWB A;  2NUP B;  3WVD B;  5GAO n;  1YNZ A;  3OS2 A;  4J9E A;  2PUO B;  3OS0 A;  1WJR A;  4EMG A;  2K2V A;  2VXF A;  1MGQ A;  1VYT A;  2DEQ A;  1WI7 A;  2AK5 A;  5GMK e;  5FU7 B;  3HHT B;  3QZ9 B;  4KGV B;  2M02 A;  3M5A A;  5FU6 C;  3WXM B;  3PMT A;  2LRQ A;  2G3R A;  2EVR A;  1WXB A;  4F7U B;  5CQY A;  1VQ6 T;  1MUZ A;  8AT1 B;  4JJN K;  2FYK A;  2ENM A;  2FRW A;  2LVM A;  2NLU A;  2DD5 A;  2RK2 A;  4IUQ A;  1UE9 A;  1OV3 A;  1OQK A;  4E7K A;  1D3B A;  3QHS A;  3CCV Q;  2EQK A;  3VYG A;  2DX1 A;  2AKK A;  4DEY A;  5LJ3 f;  4LN2 A;  1G3W A;  2K3B A;  4CC3 A;  2D8H A;  4F16 A;  3JCM Q;  3CPF A;  2MAM A;  4DA4 A;  2QQB A;  3VS2 A;  2ZPH B;  2V1R A;  1MHN A;  5GAM f;  3R6N A;  5LJ3 e;  2BTT A;  1D0X A;  1WHM A;  2CDT A;  2P0K A;  1E7O A;  1TUG B;  1ZA2 B;  1Q7Y U;  1VQL Q;  4M7A E;  5FRO A;  5I11 A;  2RN8 A;  4ZGJ B;  1VQM T;  1M27 C;  2MI6 A;  2VXE A;  1FMW A;  1VQ5 Q;  1Q95 G;  5GAM e;  1NJI R;  1ZX6 A;  3JCM g;  3VRZ A;  3H9N A;  3G1J A;  1C6V X;  1ZSG A;  3CCE Q;  1U06 A;  4OMP A;  3ZEH A;  4M7A G;  2CH4 A;  4RTT A;  2CSQ A;  4C8Q A;  3RIR A;  3CMA A;  1IGQ A;  2OTJ A;  3QWY A;  4CC4 B;  4HCZ A;  4ANJ A;  3KXT A;  2DXB A;  2CKK A;  3JCM d;  1BK2 A;  5IHN A;  5GMK h;  2F2X A;  1QLY A;  1AEY A;  1WGS A;  5KYW B;  1PD1 A;  1JXO A;  1ZSZ B;  5IXF A;  2DTO A;  4IUV A;  1XJW B;  2XIC A;  3PVL A;  5KYX B;  3JCM V;  3NMZ C;  3CC7 A;  4BE2 A;  5D6X A;  2LQK A;  4F7U F;  4JLG A;  3LGF A;  4BAC A;  3HKS A;  3HRU A;  4OB2 B;  4YTL A;  3OYY A;  3RER A;  5FU7 C;  4OB0 B;  3I56 T;  2LNV A;  3AT1 B;  3RMS A;  4X34 A;  1ZUK A;  3QJY A;  4GLM A;  5KCH A;  1X43 A;  3FJ5 A;  1YJ9 T;  1IB8 A;  4A4K A;  4M78 E;  2ED0 A;  1GBR A;  3UDC A;  2EQJ A;  1CSK A;  5FW9 A;  4RCC A;  3CXC S;  2EPD A;  5LJ3 h;  3QBY A;  2DTI A;  1NPR A;  3OYH A;  2ESW A;  2LDM A;  3M9Q A;  4CRI A;  4CI0 C;  5A0D A;  5GMK m;  3I55 A;  1M1K U;  1VQM Q;  2VGN A;  4IIM A;  3RKY A;  2B8A A;  3CME A;  4M78 G;  6AT1 B;  3CCQ A;  5GAM h;  3EGX B;  1AWJ A;  1UGS B;  2DD4 A;  4E7Z A;  2YDL A;  5GAN 3;  2O4X B;  1MMD A;  3NPF A;  4A4H A;  3EHQ A;  5KYN A;  1BI0 A;  3DB4 A;  2AZS A;  5GAN 5;  1SSH A;  2YUO A;  4ZTJ A;  1K9M C;  3NTI A;  1X6G A;  3MO8 A;  4C5E A;  3GP8 A;  2KEA A;  3OS1 A;  2LCL A;  4HT8 A;  1KK7 A;  1VQO Q;  2FPF A;  4Z02 A;  1NLP C;  3CBM A;  4FYV B;  4MML A;  2C06 A;  3C95 A;  1G3S A;  4PFZ A;  2PQW A;  2XHC A;  3H8Z A;  2ATC B;  1JJ2 S;  2CP0 A;  1ZBX A;  2DZ9 A;  4ZN3 A;  1WLP B;  1AOJ A;  3LH0 A;  4M7A C;  1VQN T;  1RAE B;  2RHY A;  2GFA A;  2DNU A;  2JTF A;  3PIO A;  1PRL C;  1PWT A;  1N9R A;  1Q81 U;  1KJW A;  2XD0 A;  3CCU Q;  3N5B B;  2FPD A;  2E5Q A;  4J6X A;  1AZE A;  1SRL A;  2MWP A;  1RAB B;  5GMK j;  1YJ9 Q;  4IUU A;  2DYB A;  1LJO A;  1NE8 A;  1W4S A;  4L59 A;  4DEX A;  3DLL A;  3L2Q A;  3KFV A;  2D0N A;  4FT2 A;  5CVI A;  3CBO A;  3MEW A;  1SRM A;  1Y96 B;  3H0I A;  4O6J A;  3QZ5 B;  2CP7 A;  3RBB B;  1YI2 T;  1KD1 U;  2RH2 A;  2FZK B;  2DRM A;  3L1A A;  1Y57 A;  1K4U S;  1B34 A;  1UGR B;  2X35 A;  4OMF B;  1B07 A;  1PC0 A;  4FSS A;  3C0C A;  3CCS T;  3X26 B;  2DAQ A;  3L2R A;  4AFS C;  4XAX B;  3CC2 A;  1N5Z A;  4RG8 A;  5D6Y A;  1YIT T;  4DOW A;  2EW3 A;  2KY9 A;  1X75 C;  3TU4 K;  2GBQ A;  3A8M B;  5LJ3 j;  4LDX A;  3A5Z B;  2EAY A;  4XTZ A;  1K8A U;  2JM8 A;  2MOX A;  5LJ3 g;  4JJD A;  1K73 U;  3RKX A;  5J3B A;  3L2V A;  4BI4 A;  1VQP A;  3LH5 A;  3MP1 A;  1M1G A;  4QT7 A;  4M78 C;  4XU2 A;  2DVE A;  2M16 A;  2QQS A;  2OTL T;  5GAM j;  3PVQ A;  1UG1 A;  1N27 A;  4LUD A;  2OJ2 A;  4IIO A;  4PLL A;  5GAM g;  2E3I A;  2ZPF B;  4D6W A;  1WHK A;  3KBG A;  3PGG A;  2ROL A;  2DL8 A;  1RI0 A;  4C5I A;  4C92 B;  2EGC A;  5IN1 A;  2ECZ A;  3V7R A;  4ZGD B;  4PJO B;  1VQN Q;  2NUZ A;  2DL3 A;  2D9T A;  2QA4 Q;  3MEA A;  5J39 A;  5LL6 S;  2KQW A;  2G6F X;  2RB6 A;  1QVF S;  3OYE A;  2FZG B;  3G6E T;  4PJJ A;  2HNI A;  3CCL A;  1PD0 A;  3CCV A;  3CPW A;  4M77 G;  2LNH B;  1WX6 A;  3M0T A;  2EYY A;  2A7Y A;  1OX8 A;  3X28 B;  4AT1 B;  4M7D B;  2DBK A;  4UC4 A;  3EFS A;  1QVG P;  2K3X A;  4WTO B;  3NTH A;  2W0Z A;  1RAG B;  3INZ A;  1WHL A;  2BZX A;  1KC8 R;  2HQH A;  4L5G A;  2GFU A;  2LTO A;  3CCS Q;  1R0C B;  3THK A;  2PVD B;  2GF7 A;  2Z0W A;  5FLX E;  5M9O A;  3UA6 A;  1EX4 A;  2HQX A;  1G5V A;  1BB9 A;  3M55 A;  3X20 B;  3QYG B;  2BE9 B;  1VQ5 A;  2HKQ B;  1X01 A;  2RQW A;  3JCM f;  2ABL A;  3ULR B;  3VU3 C;  1H92 A;  1VQK Q;  1P92 A;  4JS5 A;  2CP3 A;  4R56 A;  1TU0 B;  1RAD B;  3GLX A;  1SSF A;  2LCS A;  1IRE B;  2DL4 A;  4GLK A;  4PLI A;  1TUC A;  1QVP A;  2OTL Q;  2YRD A;  1NJI U;  3OW2 S;  3TSZ A;  3GBQ A;  4Z88 A;  2GNC A;  5DLO A;  4II1 A;  4OVA A;  5HCK A;  2J6F A;  2O9S A;  3OB9 A;  2RHI A;  3UAT A;  5HY6 A;  1PSF A;  1IRX A;  5D6W A;  3SWN B;  3D7S B;  5GMK i;  1VQ6 A;  1VQ7 T;  1T3L A;  1UJ0 A;  1V1C A;  2QAZ A;  4ELZ C;  2PU9 B;  4C92 F;  3M4G A;  4PJO F;  1YP5 A;  2KRS A;  2JMC A;  4MZM A;  3TCJ A;  4E7I A;  1WHG A;  3G6E Q;  3BDU A;  3J80 E;  1W2B S;  2X4Y A;  1QCF A;  1QCN A;  1HSQ A;  1FXX A;  1DJ7 B;  4LD9 K;  1U1S A;  3SDZ A;  4OP0 A;  4KGX B;  4WF2 A;  3TQ7 P;  4KGZ B;  4JJC A;  4EIK A;  2DL7 A;  1RUW A;  4M7D F;  2J7I A;  4LDW A;  3E19 A;  2L2P A;  4EMK C;  2V8J A;  2YLC A;  2VAS A;  4C0G A;  5GAN 6;  1VQM A;  4A4F A;  2V8I A;  1KIK A;  1SEM A;  2XDP A;  1WFW A;  4KBM B;  1Q86 C;  1NYG A;  5HK0 A;  1XNI A;  2QK0 A;  3MCA B;  7AT1 B;  3OQ5 A;  4BUG A;  2EJ9 A;  2ZCF B;  1PKS A;  4RUG A;  1BI3 A;  1LPL A;  3OYD A;  1X2K A;  4BD3 A;  4M75 B;  2JTE A;  3RUX A;  1N9S A;  3L2W A;  1YHQ Q;  3UT1 A;  4E7H A;  3OYF A;  1ZQ1 A;  4C92 D;  1AWO A;  5EC7 A;  5CIU A;  4M7A A;  4PJL A;  4PJO D;  1U1T A;  3O5Z A;  4JJB A;  3QPH A;  1VQ7 Q;  1RL2 A;  2CSI A;  2ZPE B;  1KFZ A;  1Z9Z A;  2J6K A;  4J9D A;  2E70 A;  3M4Y A;  3VS6 A;  3G4S T;  1OOT A;  1K0X A;  2D1X A;  2KRN A;  4RTV A;  1K8A R;  1JBM A;  1BCO A;  3UWN A;  1VQL T;  4PNO A;  1K73 R;  3I56 A;  5CKB A;  1YIJ A;  3F70 A;  2FPE A;  2HBP A;  1M90 R;  1PM3 A;  3OYC A;  1YJ9 A;  4OMN A;  4M7D D;  4JLI A;  2BE7 D;  1V76 A;  2P4R A;  1M4Z A;  4F7U E;  1W1F A;  3HSB A;  2VVK A;  1YN8 A;  3FRN A;  4E6R A;  1KQS A;  2OAU A;  1LOJ A;  2F5K A;  1IO6 A;  2DMO A;  1QW1 A;  4RG2 A;  1QQJ A;  4FYY B;  3VKI A;  2IG0 A;  1IHV A;  5GJW B;  1AWW A;  3JB9 H;  3EG2 A;  3U23 A;  4F7U G;  3EG0 A;  3I9Q A;  3VYH B;  4P5N A;  3CCR T;  4DBQ A;  5CO7 A;  2DXU A;  1IZ6 A;  2RJF A;  2MMP A;  2L8D A;  2MCN A;  2DYI A;  1LNX A;  4DOV A;  1R8O B;  4QVC A;  4M78 A;  2CZ1 B;  2Y4Y A;  1JQQ A;  1YJW A;  3EG9 B;  4E47 A;  4C0D C;  2J05 A;  3FLG A;  4MDX A;  5D7U A;  5DM7 R;  4OGE A;  2E64 A;  3QXE B;  4M75 F;  1ZUY A;  3GPL A;  1YJN T;  2COW A;  5C0M A;  9ATC B;  4J83 A;  4FM4 B;  3JB9 F;  2KXD A;  3CCM T;  3G4S Q;  4R0K A;  1EZZ B;  2KBT A;  1VQN A;  4LD6 A;  4BE1 A;  3FDR A;  2DJQ A;  2KMT A;  2DXC A;  5CKE A;  2YHT A;  2BZ8 A;  1VYV A;  3M56 A;  4IUT A;  4B6M A;  5CK9 A;  2FO0 A;  2VUB A;  3L2Z A;  5CQX A;  3M59 A;  2DE0 X;  3VUB A;  2RHU A;  2KRM A;  3VS7 A;  3HPW A;  1HJD A;  4Y91 A;  1YI2 A;  2YSQ A;  3MP8 A;  4ZNX A;  1YCS B;  4XTY A;  4JZ3 A;  2LJ0 A;  1WQW A;  2HCK A;  5LJ5 d;  5L23 A;  1NEG A;  3HFO A;  3V8J A;  1VQO T;  3CCR Q;  3CCS A;  5J26 A;  3JCM X;  2DKG A;  1YIT A;  1KQ1 A;  2VGM A;  1TOV A;  3O8V A;  1G3T A;  1T0H A;  1XOV A;  2RI5 A;  4PJN A;  4M75 D;  2E1H A;  1KC8 U;  4FW1 A;  5HKC A;  2C0I A;  3UPU A;  1JRI A;  1WJS A;  1WHJ A;  2YXY A;  1MMN A;  3IQL A;  3JB9 D;  3CCU T;  1YJN Q;  2RD1 A;  1S72 T;  2YWW A;  5IAY A;  5A2Q E;  2PUK B;  2OTL A;  4PKC C;  1N8R C;  3JB9 J;  1SHG A;  4J9G A;  2CRE A;  3JV3 A;  2RHX A;  2K5I A;  3A8L B;  1VIF A;  2KAF A;  3CCM Q;  3RR6 A;  1MNE A;  3RES A;  3H6Z A;  2ZPI B;  2D6F A;  2QI2 A;  4J7F A;  4HT9 A;  5AT1 B;  3CXC A;  1F1B B;  3KUF A;  5KE2 A;  2XDB A;  2PVG B;  3OYI A;  1VIE A;  2M9U A;  2LZ6 B;  1JXM A;  3JCM b;  1RAF B;  3OSV A;  1I5L A;  3OYK A;  4VUB A;  4QW2 A;  4EMK A;  3HRS A;  2QQ9 A;  4J9C A;  4MDW A;  4E7J A;  3DB3 A;  5IH2 A;  1J3T A;  4QVD A;  4M77 A;  2D8J A;  2KR3 A;  4XQ3 A;  1D3B B;  4QQG A;  3MPU B;  2BKD N;  2WSF E;  2BUD A;  1D0Y A;  2VKN A;  2XG8 D;  3M57 A;  4OMQ A;  1UEC A;  2I2L A;  4D8D A;  1Q7Y C;  4ORZ A;  1GCP A;  2KRO A;  3EAE A;  3DKM A;  1IHW A;  1QP3 A;  1D09 B;  1ABO A;  2EIF A;  2RJC A;  2QA4 T;  1JJ2 A;  4J9B A;  2KT8 A;  1KQ2 A;  4FW2 A;  2HDA A;  1ZLM A;  1S72 Q;  1WYX A;  2IPO B;  1ZSZ C;  3QG1 A;  3ASK A;  2P0P A;  2W10 A;  2DO3 A;  2QYZ A;  1NZ9 A;  1WIE A;  2NWM A;  2J6O A;  4OB3 B;  4OMO A;  1VQ8 Q;  3SFM A;  2EKO A;  1VQ7 A;  1NM7 A;  3M0P A;  4C8Q B;  2JT4 A;  2QEX T;  4N0A C;  3VS5 A;  1U8R A;  1M2V A;  2A0F B;  2RI2 A;  4FCY A;  3EG1 A;  1S1N A;  2NUT A;  1Q82 C;  3REA B;  1PHT A;  3GF5 A;  3LLR A;  1C0M A;  2X51 A;  2K5L A;  5I22 A;  1R0B G;  4C92 E;  1UGP B;  3OYN A;  2X4J A;  4XTX A;  2DTH A;  4PJO E;  3GOX A;  3FEO A;  2DK3 A;  2O88 A;  4MMK A;  1M3A A;  3EGD A;  1VQK T;  1QMC A;  2KDS A;  2DJZ A;  2EYW A;  3EFO A;  1WJQ A;  5EG2 A;  2XID A;  3V8L A;  1K9M R;  2RA2 A;  1GXI E;  1YWP A;  4MZT A;  2RQT A;  1I0C A;  1M90 U;  3QUI A;  4XU1 A;  2R57 A;  4C92 G;  1MMA A;  1U5S A;  4PJO G;  2RQV A;  4NS5 A;  2WSC E;  4Q5W A;  1O9S A;  4B9X A;  4ME7 A;  4M7D E;  1M1K C;  2ROT A;  2EGE A;  4M4Z A;  5IT9 E;  2Y4X A;  2DZC A;  1RAA B;  2CS7 A;  2QAS A;  2KE9 A;  2HL3 A;  2KNB B;  1CKB A;  2CH4 W;  3ZBD A;  2COZ A;  3JSC A;  3ZFJ A;  4FIB A;  1QKX A;  2CT4 A;  5IHK A;  4NL2 A;  1QVG S;  4M7D G;  4LDU A;  2JS0 A;  1QVF A;  5IXB A;  4QQD A;  4KH1 B;  2JNG A;  2RJD A;  3QSU A;  3I55 T;  5IHI A;  3CME T;  3Q1J A;  1VYU A;  4BB7 A;  3RNJ A;  2PNI A;  3G71 T;  5GJV B;  3CCQ T;  1UEB A;  3MJX A;  2JUF A;  2QEX Q;  1YFN A;  2HEQ A;  5HK3 A;  1M8M A;  3CPW P;  3G4S A;  2E4H A;  5GAN 8;  4A4E A;  1D1A A;  2YRC A;  4GBQ A;  1T3S A;  3T9N A;  1VQL A;  3EH1 A;  2R5M A;  2V8K A;  3CMA Q;  4C8Q F;  5I2S A;  2K2M A;  2AT1 B;  3JCM P;  2OTJ Q;  2RO0 A;  2QQA A;  4LE9 A;  1Q81 C;  4V2S A;  2M0O A;  5LJ5 f;  3EG3 A;  3OY9 A;  1K9A A;  3CCE A;  2KK4 A;  1OX9 A;  1NYF A;  2RPN A;  1NEB A;  3CC4 T;  5KYY A;  1I81 A;  1TSF A;  2FG0 A;  2M1H A;  1UB4 A;  3H0F A;  5KYU A;  2V1Q A;  2COY A;  2L3R A;  3CC7 Q;  3P8H A;  3FB9 A;  1PRM C;  2EYZ A;  3P8D A;  1GRI A;  4FYX B;  5LJ5 e;  1MMG A;  2NUP A;  5GAN d;  4HVW A;  1WHH A;  1YHQ T;  2X3W D;  1ABQ A;  2E5K A;  4JZ4 A;  1KD1 C;  5CAI A;  3CCR A;  3OW2 A;  2JVV A;  3JCM c;  4DBF A;  1LCK A;  3MEV A;  2HD0 A;  3QDF A;  3MKD A;  4XK8 E;  1D1C A;  3SD4 A;  4LXC A;  4F7U A;  3MEU A;  1H64 1;  1EIF A;  3LGL A;  3R6O A;  4TVR A;  4CC2 A;  1B34 B;  1WQ7 A;  4C92 C;  5GAN 7;  3LW5 E;  3LWH A;  4K11 A;  3I55 Q;  1YJN A;  4PJO C;  1W2B A;  3CME Q;  1R77 A;  2LQW A;  1V29 B;  4N4I A;  2E10 A;  2KYM A;  2EJF A;  3I35 A;  2QTX A;  3G71 Q;  3CCQ Q;  2CZ6 B;  1QWF A;  1MND A;  2CUD A;  3I5S A;  1TXQ A;  2YRV A;  3SEM A;  1UDL A;  4C8Q D;  1BI2 A;  3CCM A;  4FSX A;  4AFQ C;  1OUL A;  3CBP A;  1JEG A;  3MHX A;  4M75 E;  1FX7 A;  1GBQ A;  1VQ4 T;  3NFC A;  5FU6 B;  4AMC A;  1M30 A;  2LT1 A;  5GAO p;  3OMC A;  1WPY A;  1BU1 A;  1UHC A;  2SRC A;  4M7D C;  1G8X A;  2GQV A;  1JU5 C;  3J81 E;  3ER0 A;  1M8V A;  4KUD K;  3E9G A;  4M75 G;  3BFM A;  3GIB A;  2AZV A;  3CC4 Q;  2F1L A;  3JAM E;  4BI8 B;  3M53 A;  4J9H A;  3JB9 G;  1RAC B;  2RM4 A;  2DIG A;  3JB9 I;  1RI9 A;  5LJ5 h;  3A8H B;  4N4H A;  2P4T A;  2RQU A;  1FWZ A;  1VQO A;  3QDR B;  2QQR A;  5CCA A;  3FC3 A;  2DEU A;  5FRN A;  3JRZ A;  2ED1 A;  3EGU A;  2E6Z A;  2O01 E;  2K6D A;  1AVZ C;  4ESR A;  2OX7 A;  5KYW A;  3CCL T;  3PMI A;  2H3E B;  4L6V 5;  4J6W A;  1ZSZ A;  2RHZ A;  2EYQ A;  4EMH A;  1PG5 B;  3P8B B;  5KYX A;  3FJP A;  3HRT A;  3DLM A;  2KSS A;  5A0G A;  3QII A;  3CCU A;  2K79 A;  1BBZ A;  3CCJ T;  3HP9 A;  1A0N B;  1HYO A;  4QVZ A;  1G2B A;  1S72 A;  1XTD A;  4RTZ A;  3SWN C;  1BYM A;  1UJY A;  1YWO A;  2QTV A;  3MP6 A;  4C5G A;  5GAO m;  4PK4 A;  1ACM B;  2DBM A;  3TEE A;  1IXD A;  4N0A A;  4BY6 B;  1X6B A;  1E6G A;  1NJI C;  3CC2 Q;  2DER A;  3L2U A;  1KQS S;  5DLQ E;  4CC7 A;  1SHF A;  1OU8 A;  2RK1 A;  3OYG A;  1VQ4 Q;  1SG5 A;  5GMK l;  2IVW A;  2ZPB B;  2GQI A;  4OML A;  1KQS P;  4QKU A;  2E3H A;  2L89 A;  3LX7 A;  1AHJ B;  1Y7X A;  3EHR A;  2KXC A;  2OAW A;  1Y07 A;  3WVE B;  3OBW A;  1N8R U;  2DPP B;  1VQP Q;  4HVU A;  4LUE A;  4RTX A;  4JUV A;  3E2U A;  1Q86 R;  3EGX A;  3BDL A;  5GAO r;  2Y90 A;  3OSS C;  3TRE A;  2A37 A;  3UF4 A;  1UUE A;  2O4X A;  4RTU A;  1AT1 B;  3JCM W;  2H3J A;  2A36 A;  1WZO A;  2GTJ A;  3TSW A;  1MV0 B;  2JTM A;  4J9I A;  4X1V A;  3H41 A;  3V8K A;  2KGT A;  1ZBJ A;  2MYS A;  4J5Y A;  2EWN A;  1ZHI A;  4LDY A;  4AG1 C;  2L3Q A;  4OB1 B;  1FMV A;  1M2O A;  2K5F A;  2M0Y A;  3CCL Q;  4D8K A;  3PTA A;  3PNW C;  4M75 C;  4JPB W;  2QDY B;  3OYL A;  1YCY A;  1D1B A;  2HMA A;  4C0F A;  4JRQ A;  3AHU A;  2MF2 A;  1K9M U;  4LNP A;  4KUL A;  2QA4 A;  3MET A;  3RDV A;  1AZG B;  1T0J A;  2CUB A;  1GL5 A;  1NBE B;  1OI1 A;  5LJ5 j;  3CCJ Q;  2QDL A;  4A53 A;  3LWI A;  4OF1 A;  2KYB A;  5LJ5 g;  2LQ8 A;  2CP5 A;  2AHJ B;  2LMJ A;  1VQ9 T;  4F17 A;  2DM1 A;  2MWO A;  3G7Z A;  1PCX A;  4ZTF A;  3VV0 A;  2NYS A;  3J7A F;  3LYI A;  1H3Z A;  1UTI A;  2VWF A;  4J9F A;  3H0H A;  4O5V A;  3CD6 T;  1VOM A;  1Y96 A;  5ECA A;  2LJ1 A;  4BE0 A;  4B9W A;  2QEX A;  2HBW A;  4PJM A;  1UGV A;  4DBR A;  1SF9 A;  2A28 A;  2C0T A;  2M51 A;  1OZ2 A;  2JZ2 A;  4J6Y A;  1GFD A;  3X25 B;  2EQU A;  2L5Q A;  1C1A A;  4A4G A;  4E7S A;  1HK9 A;  4BY6 C;  1OPK A;  3OYB A;  1RLQ C;  2YUP A;  2K9G A;  4M7A B;  1PKT A;  5GAN f;  3BE3 A;  5L8R E;  1SPK A;  2C0O A;  2LC4 A;  3NTK A;  1TTH B;  1VQK A;  2O2O A;  4J8O A;  1X6O A;  3V7C A;  1W6X A;  2DIL A;  1UHF A;  2J06 A;  1D0Z A;  4WCI A;  1VQ6 Q;  4FT4 A;  1X2Q A;  5FWC A;  1BIB A;  2RNA A;  1AD5 A;  5GAN e;  2LJ3 A;  1EFN A;  2QGF B;  4E2F B;  4BI3 A;  4HKE A;  1Q82 U;  1ZUU A;  4DBH A;  3NGP A;  1FMK A;  4C0Z A;  2RMO A;  4HCC A;  3SHW A;  3BW1 A;  3EFR A;  1YIJ T;  5C6S A;  4KRT A;  3GNG A;  2EJG A;  3A1P A;  2MK5 A;  1VQ8 T;  1TG0 A;  2VV5 A;  4C92 A;  2EQM A;  3JCM J;  2CP2 A;  1TH7 A;  4PJO A;  1GCQ C;  2JOY A;  3PE0 A;  4RCB A;  1AWX A;  2V26 A;  5A0L A;  3G6E A;  1HXD A;  1VQ9 Q;  3OYA A;  2CGH A;  1NLO C;  2JJ9 A;  2BIV A;  2DXT A;  4FYW B;  3QKJ A;  2JMA A;  1M9S A;  2PVO B;  1KSW A;  3CXC P;  2EQI A;  3VJP A;  2H8H A;  1KG1 A;  1LVK A;  3G71 A;  3CD6 Q;  4M78 B;  4M7D A;  2PZ1 A;  2FRY A;  3M0S A;  3V7S A;  3C4S A;  2E12 A;  1VUB A;  2EGA A;  1UGQ B;  1YJW T;  3QJ6 A;  4PFO A;  4OMM A;  2VYT A;  1SKU B;  4EPC A;  1OEB A;  2F2W A;  2K4Y A;  3S3N A;  1W70 A;  1B7T A;  4M7A F;  2LX7 A;  4C8Q E;  4JRI A;  3A8G B;  3CC4 A;  3ME9 A;  3QO3 A;  1G3Y A;  2XK0 A; 
#chains in the Genus database with same CATH homology
 4C92 D;  5I21 A;  4C8Q F;  5I2S A;  3JCM P;  5CKH A;  5CIU A;  4M7A A;  2E65 A;  5GAN h;  2A3L A;  2RO0 A;  4PJO D;  1U1T A;  2QQA A;  3QPH A;  1YHQ A;  3ZEH A;  1RL2 A;  1Q81 C;  4V2S A;  4M7A G;  2M0O A;  4C8Q A;  2QXF A;  2ZPE B;  5LJ5 f;  3RIR A;  1BIA A;  2X4W A;  3CMA A;  3OY9 A;  3CCE A;  2OTJ A;  2E70 A;  3M4Y A;  2KK4 A;  2FVU A;  3GNF B;  4HCZ A;  4C8Q G;  3G4S T;  1BKB A;  3KXT A;  2RI3 A;  2DXB A;  2CKK A;  1JBM A;  3JCM d;  1I81 A;  3CC4 T;  2M1H A;  5GMK h;  1UB4 A;  3UWN A;  3PIP A;  1VQL T;  4PNO A;  3PFS A;  2L3R A;  5CR2 A;  3P8H A;  3I56 A;  1NPP A;  5CKB A;  3FB9 A;  1WGS A;  3P8D A;  3SWN A;  5LJ5 e;  1QP2 A;  5GAN d;  1YIJ A;  3F70 A;  2HBP A;  1YHQ T;  2DTO A;  4IUV A;  3OYC A;  1YJ9 A;  4M7D D;  4JLI A;  4ZGE B;  2XI9 A;  2XIC A;  3S6W A;  1M4Z A;  1KD1 C;  3JCM V;  4F7U E;  5KE3 A;  3HSB A;  5GAN 2;  2XDD A;  1KC8 C;  3FRN A;  3CC7 A;  4BE2 A;  1KQS A;  2LX9 A;  5CAI A;  3CCR A;  3OW2 A;  3CMA T;  2JVV A;  5D6X A;  2OAU A;  3JCM c;  2OTJ T;  3MEV A;  1LOJ A;  4C5H A;  2F5K A;  2LQK A;  4F7U F;  2HD0 A;  4JLG A;  3LGF A;  4XTW A;  4BAC A;  3HKS A;  3HRU A;  4OB2 B;  4XK8 E;  3OYY A;  4YTL A;  1QW1 A;  3RER A;  5FU7 C;  3OYJ A;  4IKF A;  4OB0 B;  4RG2 A;  3I56 T;  1M5Q 1;  2LNV A;  3SD4 A;  4F7U A;  3RMS A;  3VKI A;  4A54 A;  4X34 A;  3MEU A;  4JS4 A;  1H64 1;  3QJY A;  5KCH A;  2IG0 A;  3JB9 H;  1YJ9 T;  4F7U G;  1EIF A;  3LGL A;  3R6O A;  3VYH B;  4TVR A;  4A4K A;  1B34 B;  4M78 E;  3CC7 T;  4P5N A;  2HAX A;  1VQ4 A;  3CCR T;  1WQ7 A;  4C92 C;  3UDC A;  1YBY A;  3SB2 A;  4DQ2 A;  5GAN 7;  3LW5 E;  2EQJ A;  5CO7 A;  2DXU A;  3LWH A;  4E7L A;  1YJN A;  4PJO C;  2GCX A;  1W2B A;  4M78 F;  1IZ6 A;  2RJF A;  4RCC A;  3CXC S;  2MMP A;  4M7A D;  1V29 B;  4N4I A;  2E10 A;  2L8D A;  5LJ3 h;  1LNX A;  2EJF A;  2DTI A;  3QBY A;  2QTX A;  4DOV A;  1R8O B;  4QVC A;  5KH6 A;  2CZ6 B;  1NPR A;  3OYH A;  2YRV A;  3HFN A;  4M78 A;  2CZ1 B;  3FIF A;  2LDM A;  4C8Q D;  3M9Q A;  4CRI A;  4CI0 C;  2Y4Y A;  5A0D A;  5GMK m;  2K3Y A;  3I55 A;  1YJW A;  1BI2 A;  4XTU A;  3T9N A;  3CCM A;  2VGN A;  4FSX A;  1M1K U;  3RKY A;  2B8A A;  2XKO C;  3CBP A;  4E47 A;  3CME A;  3MHX A;  4C0D C;  4M75 E;  4M78 G;  3M58 A;  3CCQ A;  1FX7 A;  3FLG A;  5GAN 4;  1VQ4 T;  5GAM h;  4MDX A;  4X9C A;  1UGS B;  2DD4 A;  3NFC A;  5FU6 B;  5DM7 R;  4OGE A;  2E64 A;  2LT1 A;  3QXE B;  4M75 F;  3OMC A;  5GAN 3;  5GAO p;  3GPL A;  1YJN T;  2O4X B;  1WPY A;  4ATO A;  1OZ3 A;  3E1S A;  3RKW A;  3OA6 A;  2FHD A;  2LT4 A;  4M77 E;  4A4H A;  5C0M A;  4M7D C;  2GQV A;  5LJ3 d;  4J83 A;  5KCO A;  3J81 E;  1BI0 A;  3DB4 A;  3ER0 A;  4FM4 B;  4M75 A;  3JB9 F;  5GAN 5;  4JRP A;  3L42 A;  1M8V A;  1O75 A;  4KUD K;  1Q86 U;  4ZTJ A;  4IUR A;  3CCM T;  2RJE A;  2ZGW A;  3NTI A;  4BDY A;  1K9M C;  3E9G A;  3MO8 A;  4M75 G;  3BFM A;  4C5E A;  3GP8 A;  3GIB A;  3CPW S;  4GY5 A;  3OS1 A;  1QVG A;  2E6N A;  1VQN A;  3JAM E;  2LCL A;  4LD6 A;  4BI8 B;  4HT8 A;  4BE1 A;  3FDR A;  3X24 B;  3M53 A;  2KMT A;  5GAM d;  4Z02 A;  4EMK B;  3E9F A;  3JB9 G;  2RM4 A;  3CBM A;  2DXC A;  4J7I A;  2DIG A;  3JB9 I;  5CKE A;  5LJ5 h;  4MZP A;  4MML A;  3A8H B;  4N4H A;  2XU8 A;  2C06 A;  2P4T A;  5AYF A;  3C95 A;  1G3S A;  1FWZ A;  2YHT A;  4R55 A;  3A8O B;  2PQW A;  5GAN j;  4M77 B;  3M56 A;  4IUT A;  1VQO A;  2CZ7 B;  2XHC A;  3BY7 A;  2QQR A;  3H8Z A;  3QDR B;  2CZ0 B;  5CCA A;  3FC3 A;  1JJ2 S;  5CK9 A;  1ZBX A;  5FRN A;  3JRZ A;  2LCC A;  5GAN g;  3CCJ A;  4RMO A;  2VUB A;  3L2Z A;  2DZ9 A;  5CQX A;  4ZN3 A;  3LH0 A;  4M7A C;  1VQN T;  2RHY A;  2E6Z A;  2O01 E;  2GFA A;  3M59 A;  2JTF A;  3VUB A;  3PIO A;  2RHU A;  5GAO l;  1N9R A;  3HPW A;  3CCL T;  1Q81 U;  3PMI A;  4Y91 A;  1YI2 A;  2XD0 A;  4L6V 5;  4C8Q C;  4J6W A;  3N5B B;  2E5Q A;  2RHZ A;  3MP8 A;  4J6X A;  4XTY A;  4FU6 A;  3HL8 A;  4M78 D;  2EYQ A;  1WQW A;  2MWP A;  4XU0 A;  4EMH A;  5GMK j;  3P8B B;  5LJ5 d;  4IUU A;  4HA8 A;  3HFO A;  3V8J A;  3FJP A;  1VQO T;  1LJO A;  1NE8 A;  1W4S A;  4L59 A;  2R58 A;  3CCS A;  3HRT A;  3DLM A;  2KSS A;  2WSE E;  5J26 A;  5A0G A;  5GAO q;  3QII A;  3S3O A;  3DLL A;  3L2Q A;  3CCU A;  3C94 A;  3CCJ T;  3HP9 A;  2F5T X;  3PT9 A;  4FT2 A;  4QVZ A;  4RKU E;  5CVI A;  3CBO A;  1XTD A;  3MEW A;  3S3M A;  1S72 A;  2E41 A;  3SWN C;  3JCM X;  4HCB A;  1BYM A;  1Y96 B;  2DKG A;  2R5A A;  4O6J A;  1YIT A;  1KQ1 A;  3QZ5 B;  2VGM A;  2YLB A;  3O8V A;  1G3T A;  3MP6 A;  4C5G A;  1XOV A;  5GAO m;  1YI2 T;  2RI5 A;  1KD1 U;  4IUP A;  4M75 D;  2E1H A;  4NOY A;  3TEE A;  1KC8 U;  2RH2 A;  4N0A A;  4BY6 B;  4ZN1 A;  5HKC A;  1NJI C;  3UPU A;  1JRI A;  1WJS A;  3L1A A;  3L2U A;  1B34 A;  1UGR B;  1I8F A;  1M1F A;  2X35 A;  4OMF B;  5DLQ E;  1KQS S;  2RK1 A;  3JCM e;  3OYG A;  3CCS T;  3X26 B;  3JB9 D;  2JN0 A;  2DAQ A;  5GMK l;  2IVW A;  2ZPB B;  3CCU T;  4KT0 E;  3L2R A;  2RD1 A;  4Y28 E;  1S72 T;  2CYZ B;  2DIQ A;  4XAX B;  5IAY A;  3CC2 A;  5A2Q E;  2PUK B;  1WNL A;  2OTL A;  4PKC C;  4RG8 A;  2L89 A;  5D6Y A;  1YIT T;  1N8R C;  4DOW A;  3JB9 J;  3LX7 A;  1AHJ B;  1Y7X A;  2RHX A;  4ELY C;  1Y07 A;  4LDV A;  3WVE B;  3OBW A;  1N8R U;  2DPP B;  1X75 C;  2K5I A;  2KY9 A;  3A8L B;  3TU4 K;  1VIF A;  2KAF A;  1K8A C;  3A8M B;  5LJ3 j;  1KHC A;  4JUV A;  4OGC A;  4LDX A;  4BDZ A;  3A5Z B;  2EAY A;  2F69 A;  4XTZ A;  1K73 C;  2FL7 A;  1K8A U;  3BDL A;  5LJ3 g;  5GAO r;  2Y90 A;  3OSS C;  3TRE A;  3RES A;  1K73 U;  3RKX A;  1M90 C;  2O4X A;  3H6Z A;  1VQ9 A;  2KVQ G;  2ZPI B;  2D6F A;  5J3B A;  3L2V A;  4BI4 A;  3JCM W;  2QI2 A;  4J7F A;  1VQP A;  3MP1 A;  4HT9 A;  3CXC A;  1M1G A;  3CC2 T;  2FB7 A;  2H3J A;  3KUF A;  4M78 C;  5KE2 A;  2XDB A;  3CEY A;  2DVE A;  2M16 A;  2QQS A;  4XU2 A;  5GAM j;  2OTL T;  2PVG B;  3OBY A;  3OYI A;  1VIE A;  1N27 A;  2M9U A;  2ZZD A;  5CKF A;  1KHI A;  4PLL A;  3JCM b;  5GAM g;  2ZPF B;  4D6W A;  5I2M A;  3KBG A;  2JTM A;  3PGG A;  2D0Q B;  1RI0 A;  3V8K A;  4C5I A;  4C92 B;  5IN1 A;  4X9D A;  3OSV A;  4J5Y A;  4LDY A;  2EWN A;  1ZHI A;  3V7R A;  4ZGD B;  4PJO B;  1I5L A;  3OYK A;  4OB1 B;  2D9T A;  4VUB A;  4QW2 A;  4EMK A;  2X4X A;  3HRS A;  3MEA A;  2K5F A;  2QQ9 A;  3QYH B;  1OYX A;  4M77 F;  4MDW A;  5J39 A;  2ZPG B;  3OS5 A;  3PNW C;  5LL6 S;  4XTV A;  3PTA A;  4E7J A;  4M75 C;  1VQP T;  3DB3 A;  2QDY B;  3OYL A;  2KQW A;  1YCY A;  4C0F A;  4JRQ A;  3AHU A;  2MF2 A;  4QVD A;  2RB6 A;  1QVF S;  1K9M U;  3OYE A;  2HQE A;  4NL3 A;  1I4K 1;  4M77 A;  4KUL A;  3G6E T;  4C0D B;  5CKD A;  2QA4 A;  3MET A;  2HNI A;  4XQ3 A;  3CCL A;  3CCV A;  1D3B B;  4QQG A;  2BKD N;  4M77 C;  2WSF E;  5LJ5 j;  1OI1 A;  3CPW A;  4M77 G;  3CD6 A;  2BUD A;  4A53 A;  4EDU A;  3LWI A;  4OF1 A;  2A7Y A;  2XG8 D;  4FL6 A;  5LJ5 g;  2LQ8 A;  3M57 A;  4N4G A;  3X28 B;  2AHJ B;  1Y71 A;  4JDS A;  3URG A;  4M7D B;  4UC4 A;  1VQ9 T;  2I2L A;  1XQH A;  2WAC A;  3EFS A;  2K3X A;  2K57 A;  1Q7Y C;  2MWO A;  3G7Z A;  2VC8 A;  3NTH A;  2P0Q A;  4ZTF A;  3INZ A;  3EAE A;  3VV0 A;  3DKM A;  1QP3 A;  3J7A F;  3LYI A;  3OMG A;  2EIF A;  2RJC A;  2QA4 T;  4L5G A;  2GFU A;  2LTO A;  1H3Z A;  2EFI A;  1JJ2 A;  3CCV T;  2PVD B;  2GF7 A;  3VUZ A;  1KQ2 A;  3JCM h;  3CD6 T;  4O5V A;  5FLX E;  1Y96 A;  5M9O A;  4BE0 A;  4B9W A;  2HQX A;  2QEX A;  1G5V A;  3QG1 A;  3M55 A;  3X20 B;  5DY9 A;  3QYG B;  4JRK A;  1VQ5 A;  1OZ2 A;  2JZ2 A;  1X01 A;  1JB0 E;  3ASK A;  2P0P A;  4J6Y A;  3X25 B;  2EQU A;  4KUI A;  3JCM f;  2L5Q A;  3VU3 C;  2DO3 A;  4A4G A;  1HK9 A;  4BY6 C;  1P92 A;  3OYB A;  4JS5 A;  1NZ9 A;  4R56 A;  3GLX A;  1SSF A;  4M7A B;  4OB3 B;  3RMQ A;  1IRE B;  5GAN f;  3SFM A;  4GLK A;  2EKO A;  5L8R E;  1VQ7 A;  4PLI A;  2LC4 A;  3C12 A;  4C8Q B;  2QEX T;  1QVP A;  3NTK A;  5FRM A;  1VQK A;  1BI1 A;  4J8O A;  4N0A C;  1X6O A;  3V7C A;  3OW2 S;  1NJI U;  1PSE A;  1N6A A;  1U8R A;  3OYM A;  2RI2 A;  4PL6 A;  1VQ8 A;  5DLO A;  1VQ5 T;  4FT4 A;  4M77 D;  1BIB A;  4II1 A;  4OVA A;  1Q82 C;  4XU3 A;  3OB9 A;  5GAN e;  4QQ6 A;  2RHI A;  3GF5 A;  3LLR A;  5HY6 A;  3CCE T;  1PSF A;  5D6W A;  3M54 A;  4BI3 A;  2K5L A;  4HKE A;  1Q82 U;  3SWN B;  4C92 E;  1UGP B;  3OYN A;  2X4J A;  4XTX A;  3WVD B;  5GMK i;  5GAO n;  2DTH A;  3OS2 A;  1VQ7 T;  4C0Z A;  1VQ6 A;  2PUO B;  3FEO A;  3OS0 A;  1WJR A;  3GOX A;  4PJO E;  4ELZ C;  2DK3 A;  2PU9 B;  4EMG A;  4C92 F;  4HCC A;  2K2V A;  2VXF A;  4MMK A;  1VQK T;  1MGQ A;  2KDS A;  3BW1 A;  3M4G A;  4PJO F;  2DEQ A;  2DJZ A;  3EFR A;  1WJQ A;  5EG2 A;  4MZM A;  3TCJ A;  4E7I A;  1YIJ T;  5C6S A;  2XID A;  3BDU A;  2EJG A;  3GNG A;  3V8L A;  3J80 E;  1W2B S;  1VQ8 T;  5GMK e;  5FU7 B;  3HHT B;  3QZ9 B;  2VV5 A;  2RA2 A;  1GXI E;  3M5A A;  4C92 A;  5FU6 C;  2EQM A;  3JCM J;  4MZT A;  3WXM B;  1TH7 A;  1M90 U;  3PMT A;  4PJO A;  2LRQ A;  2G3R A;  2JOY A;  3QUI A;  4XU1 A;  4RCB A;  2R57 A;  2X4Y A;  4C92 G;  4F7U B;  5A0L A;  5CQY A;  3G6E A;  4PJO G;  1HXD A;  1FXX A;  1DJ7 B;  3OYA A;  1VQ6 T;  4NS5 A;  2CGH A;  4LD9 K;  2WSC E;  4Q5W A;  1O9S A;  4B9X A;  1U1S A;  2BIV A;  2DXT A;  3SDZ A;  4JJN K;  4ME7 A;  4OP0 A;  2FYK A;  2RK2 A;  2LVM A;  4WF2 A;  2NLU A;  2DD5 A;  3QKJ A;  4IUQ A;  4M7D E;  1M1K C;  5IT9 E;  2Y4X A;  2DZC A;  1M9S A;  2PVO B;  4E7K A;  1D3B A;  1QVF A;  2CS7 A;  3QHS A;  4M7D F;  3VJP A;  2EQK A;  3VYG A;  4LDW A;  1KG1 A;  3E19 A;  4EMK C;  3G71 A;  2V8J A;  2YLC A;  5LJ3 f;  3ZBD A;  4C0G A;  3JSC A;  3ZFJ A;  4FIB A;  5GAN 6;  4M78 B;  4M7D A;  1G3W A;  1VQM A;  4A4F A;  3JCM Q;  3CPF A;  2V8I A;  2MAM A;  3V7S A;  4NL2 A;  1QVG S;  4M7D G;  4DA4 A;  2XDP A;  2QQB A;  3C4S A;  4KBM B;  4LDU A;  2E12 A;  5HK0 A;  1Q86 C;  4QQD A;  1XNI A;  2JNG A;  2RJD A;  2ZPH B;  3MCA B;  1VUB A;  3QSU A;  1MHN A;  1UGQ B;  5GAM f;  3I55 T;  3OQ5 A;  4BUG A;  1YJW T;  3QJ6 A;  2EJ9 A;  2ZCF B;  5LJ3 e;  2VYT A;  4EPC A;  3CME T;  3Q1J A;  1BI3 A;  4BB7 A;  3G71 T;  3CCQ T;  2K4Y A;  3OYD A;  2P0K A;  1UEB A;  2JUF A;  4M7A E;  1Q7Y U;  4BD3 A;  5FRO A;  4M75 B;  3RUX A;  3S3N A;  5HK3 A;  4ZGJ B;  1VQM T;  1N9S A;  3G4S A;  5GAN 8;  4M7A F;  3L2W A;  2MI6 A;  2VXE A;  4A4E A;  4C8Q E;  4JRI A;  5GAM e;  3A8G B;  3UT1 A;  4E7H A;  3CC4 A;  3JCM g;  3OYF A;  3ME9 A;  3QO3 A;  1G3Y A;  2XK0 A;  1VQL A;  1ZQ1 A;  2R5M A;  2V8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...