3I56Q

Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 15
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3i56Q00
1M1KR 1VQPQ 1YI2Q 3I56Q 3CCRQ 3G6EQ 3CPWP 3CD6Q 1VQ4Q 3CCLQ 3CCQQ 1VQ8Q 3CCVQ 1Q82R 1VQNQ 1KQSP 3CMEQ 1NJIR 2QEXQ 1YIJQ 1K9MR 1VQ9Q 1K73R 3CCMQ 3G4SQ 1YITQ 1YJ9Q 1JJ2P 1S72Q 3CXCP 3OW2P 3CCEQ 3CCUQ 1QVFP 1K8AR 1VQ6Q 3CC7Q 1KC8R 3CMAQ 1VQ5Q 2OTLQ 3CCSQ 1VQOQ 3CC4Q 1QVGP 1M90R 1KD1R 3CC2Q 2OTJQ 1YJNQ 1W2BP 3G71Q 1Q81R 1VQKQ 2QA4Q 1YJWQ 3CCJQ 1VQMQ 1N8RR 1VQLQ 3I55Q 1VQ7Q 1Q86R 1Q7YR 1YHQQ
chains in the Genus database with same CATH superfamily
4XTZA 1WA7A 2DRKA 2RH2A 4L6V5 5GMKm 4ZTJA 1MV3A 4M78B 4LD9K 1IB8A 4FT2A 2FO0A 1G3TA 2LQKA 1B3QA 2EJFA 4C8QC 2CP5A 2QTVA 4J9IA 3HP9A 3CCQA 3QJ6A 3CCVA 3GOXA 4LDXA 4QW2A 4C8QE 3JCMP 1K1ZA 4F7UF 2E6ZA 1YJ9A 4F16A 4Q5WA 2M1HA 4LE9A 1ABOA 1OPLA 1OEBA 4LNPA 4IUTA 3OYFA 1WIEA 2L5QA 1NYFA 3QIIA 4JUVA 1YITQ 4DBRA 1UEBA 4DOVA 2GQVA 2J06A 3LYIA 1JXMA 4NS5A 2D6FA 1M2VB 5GAOl 1AT1B 3KXTA 4OGCA 3RKYA 1B34A 1K9MC 3VS5A 2YUNA 3QO3A 1G2BA 2BZYA 4M77C 1Q82U 2K2MA 3E19A 1YCSB 2RK1A 1OPKA 1UE9A 5LJ3f 1Q81C 5LJ5g 4FL6A 3OW2P 2LTOA 2P0QA 5GAN8 1VQPA 1HJDA 3G6EA 5IAYA 5CK9A 4FYXB 2DTOA 4QKUA 3HHTB 2MWOA 2MIOA 1RLQC 4FU6A 1YCYA 3EG2A 1BI0A 1MNDA 2E5KA 1PSFA 2XIDA 3J7AF 3META 1VQ8Q 3A8GB 2CZ0B 4M75D 2HQXA 2K5FA 2ED1A 2FYKA 3THKA 1SHGA 2RI2A 2K5IA 1RAEB 4OMMA 4ORZA 4M78F 5GAMe 4OB0B 4J8OA 2DETA 5CQXA 3L2ZA 1NLOC 2YRCA 5GMKh 3OA6A 2J7IA 2IVWA 3PIPA 4PNOA 4F17A 4DOWA 4UC4A 2RJCA 3E1SA 2L3QA 2QGGA 3OYNA 1Y96A 3P8DA 3PVLA 1YIJQ 1K9MR 4E7HA 2DZCA 1U1SA 2GCXA 2K79A 4XTYA 3CCUQ 1N9SA 1OULA 1ZUKA 3JAME 4JRQA 4BUGA 5GAN5 4N0AC 5IHIA 1Q81R 2P0KA 1M1GA 1BIAA 1OV3A 5HKCA 2FEIA 3G7ZA 1X2QA 2JMAA 3OMGA 2RD1A 3BFMA 3CCMA 2K3BA 2P4RA 2F1LA 4HKEA 4NL3A 1UG1A 1CKAA 4C8QD 2AT1B 1IRXA 4DQ2A 4C92C 1VQ9Q 3OYBA 3C94A 2PUOB 2RQRA 4PJOA 1VQOQ 1QVGA 2X3XD 4PJMA 5IH2A 2NLUA 3CCJQ 2O2OA 4J6YA 1M1KU 3OS2A 1X43A 1VQ5T 2KNBB 2DBKA 1KIKA 4X34A 4IIMA 1H92A 1WQ7A 2VYTA 2PVGB 1PKTA 4C92G 1M1FA 4M77D 4WTOB 5FU6B 2J6FA 2EGCA 2C0OA 3TU4K 2J6OA 2GTJA 2RQWA 3C12A 1QVFA 3JCMe 5HK0A 2HSEB 1YP5A 2D1XA 2ECZA 3MJXA 1VQ6T 2OJ2A 3V7SA 1PD0A 2RJDA 2KYMA 3JRZA 2L3RA 2QGFB 1JEGA 1VQ7T 2L0AA 2CH4W 2QG9B 2FPDA 2KY9A 1WXUA 2FZCB 2ABLA 4LXCA 4GBQA 3MHXA 4A53A 4PLIA 4QT7A 4HA8A 1T0JA 1PC0A 2L2PA 1OYXA 1VYVA 4M75B 3MP6A 1YJWT 1W1FA 4BD3A 2MCNA 1WNLA 1X6BA 2EYYA 1QP2A 2QQSA 4Y92A 4OB1B 2LQWA 3RKWA 4AFSC 2KXCA 4F7UG 2NUPA 1TSFA 2BE7D 2HEQA 5DY9A 1Q7YU 2K9GA 2Y4YA 3FJPA 2EGAA 4XTWA 1KK7A 5GAOr 3PMTA 1G3YA 3LWHA 1NZ9A 4PFPA 1BYMA 5KYUB 3CXCA 3CC7Q 2COZA 2HSPA 5A0DA 4EMKC 1PG5B 4QQ6A 1FMVA 1RACB 1BIBA 2K5LA 6AT1B 2Y90A 2RPNA 3VUBA 1M3CA 4C5EA 4EPCA 1G8XA 3OYDA 2K3YA 2KBTA 4C8QB 2DYBA 1VQ4Q 3V7RA 2DVEA 1QWEA 3C0CA 5KYXA 4M7DC 4J83A 4ATOA 1K0SA 1QVFP 1JJ2S 4AFUC 4E2FB 4BI8B 2EKHA 1YBYA 2KAFA 1WHGA 3M4YA 4KGVB 1K4US 3CCLA 3R6OA 1JBMA 4E7IA 4M7AC 1IO6A 2RHIA 1M1KR 1SRLA 2EIFA 1KHCA 2IG0A 3PGGA 1S72A 4OP0A 4PKCC 1RAIB 2DA9A 3OSVA 1D0XA 4M7AE 4M78G 2E41A 4BI4A 2E5QA 3M9QA 3X24B 3HTRA 2HKQB 1VQ5Q 3I5SA 1NBEB 3TSZA 2LC4A 2ZPEB 2RM4A 4M77B 3SEMA 3JCMc 1OX9A 1BI2A 1A0NB 1SRMA 5CKDA 2DYIA 4AG1C 2E70A 1QCNA 2W10A 4LN2A 2E10A 2KT8A 1UJ0A 4HT8A 3CC4A 4DBHA 1KQSA 2EGEA 1HXDA 1K73U 2EWNA 1VQLA 1PSEA 2DTHA 4AMCA 2LT4A 2KMTA 3LLRA 1YI2A 1D3BA 4JJCA 5GAOq 5KYNA 3OYKA 3H0HA 2EQUA 2C0TA 2QQ9A 4IUUA 4JDSA 3QBYA 1PHTA 2L89A 2ZPHB 1WHLA 2VKNA 1ZSZA 3IQLA 1MMAA 2NWMA 1AWWA 2DE0X 2JTFA 1WHHA 1M30A 2ROTA 1YJNQ 4FIBA 4J9FA 1KD1U 1ZA1B 5FLXE 1R77A 2FZGB 2EVRA 1S72T 1VQ7Q 3NMZC 2PTKA 3EFSA 1UDLA 5EG2A 4JJBA 3A1PA 2FPFA 3FLGA 3QKJA 4HCBA 3MEAA 3CBPA 4PJNA 4NOYA 4JRIA 2VWFA 3I55T 3ZBDA 3NTIA 2DL5A 1IXDA 3LWIA 2BE9B 3QYHB 3OQ5A 5HK3A 4J7FA 1VQ8A 5CIUA 3CMAT 4LDUA 1NJIC 1X6GA 4M77F 3VS4A 4HT9A 1WX6A 4BB7A 1M9SA 1VQMA 2EQIA 1NPRA 1KQ1A 4AFZC 4E7LA 1FX7A 4M7AD 3EG3A 2GF7A 4ZN3A 3M53A 1ZA2B 4JPBW 3BY7A 1O75A 2HDAA 1IREB 2LJ1A 2KVQG 4CC4B 2X35A 1D1AA 3D7SB 2OTJT 2H3EB 2KROA 2XICA 4B9WA 4XU0A 2JJ9A 2PNIA 1KQSP 4A54A 4F7UA 1K9AA 3QZ9B 2EYXA 1LNXA 1H8KA 2VUBA 2O4XB 2QDLA 1CSKA 4Z02A 3REBB 3CEYA 5CKBA 2E6NA 2YT6A 3CMEA 5LJ3g 1VQOA 1Y7XA 5FRMA 1NJIR 4L5GA 3M54A 3L2QA 3CCJA 3E9GA 5KCHA 4PJOC 1FXXA 3I35A 3INZA 3LW5E 1AZEA 1N8RC 1NEGA 2CH4A 2KXDA 1XNIA 2QA4Q 3JB9I 2A36A 1IHVA 2RK2A 1G3SA 2DL3A 5IN1A 2OAUA 4KULA 4RTXA 2DF6A 2YUQA 1FWZA 5GANf 1TS9A 3N5BB 4C92F 3L2UA 3UA6A 2R58A 5GANj 4K11A 1RI0A 1LCKA 5A0LA 1K9MU 3I5RA 1TWBA 1N6AA 4Y28E 5KCOA 1U5SA 2A37A 2LT1A 3BW1A 2B86A 2NYSA 1Q81U 3QDRB 1GCQC 5C6SA 4M78A 2FB7A 1IZ6A 4BI3A 4OVAA 3OSSC 1PWTA 1KC8C 4XTUA 3X20B 3RERA 3NGPA 5D6XA 5GAMg 3QJYA 4FSSA 2LRQA 4ZTFA 3PMIA 3NHNA 1QMCA 2COWA 1TTHB 3S6WA 2PVDB 1UGRB 1RAFB 4A4EA 1N8RR 1AOJA 4ZN1A 3TQ7P 2PVOB 4A4GA 2OTLT 2DMOA 2CKKA 3V8JA 4M75G 4EMKB 2ZPIB 4CRIA 3SB2A 2X4XA 4IKFA 3HRTA 2CP7A 2CYZB 1U06A 1T3SA 3OY9A 3JB9D 4DEXA 3CCRA 4XU3A 1TUDA 2AKLA 4M7DB 3I55Q 4C0GA 3EH1A 1W70A 4ZGJB 3VRYA 1GFCA 4M4ZA 1BCOA 3QHSA 4E7JA 4RG8A 1MUZA 4MZTA 4EMGA 5LJ3e 1YWPA 1WFWA 5GJVB 3UPUA 3EGDB 4M7AB 3V7CA 3EFOA 2RNAA 3M59A 1KC8R 1D0ZA 1WPYA 3GLXA 7AT1B 5CKFA 3CCSQ 2KSSA 1Q86C 4O6JA 3DKMA 3RIRA 3M4GA 3EHQA 3UA7A 1W2BA 2NUTB 3V8KA 4LD6A 2R57A 3PNWC 4OMOA 3OYHA 2VASA 2DKGA 5FU7C 3ME9A 4PJOD 4RG2A 2V8KA 4C8QG 3ZEHA 2RB6A 4AFQC 2DJQA 3J80E 3X25B 1WZOA 3L1AA 5CR2A 3VS2A 4OMFB 2JUFA 3OBYA 3VV0A 5KE2A 3OS0A 1VQ4A 2AZVA 4J9BA 5GAN2 1M8MA 3QXEB 2M9UA 1G5VA 3MP1A 2QI2A 4JS4A 3I56Q 3RR6A 1W6XA 4B9XA 2CP6A 2GTOA 1M4ZA 3RESA 3JCMg 3LX7A 1UHFA 3GF5A 3CCQT 3CCVT 2O88A 2YLBA 2ZPFB 4M77G 2A08A 2DNUA 4QVZA 1WJRA 1UTIA 4OF1A 4LUEA 2FL7A 4IIOA 3OYEA 1YJ9T 3VUZA 1Q86R 5D6WA 4QQGA 4KRTA 1VA7A 2XI9A 3QUIA 5IT9E 4M7DF 2MYSA 5I2MA 1K8AC 5GAN3 2DZ9A 1JB0E 3E9FA 4C0DC 2O01E 4D8DA 4OGEA 5GMKl 3BDLA 5GANd 3DB3A 2JTEA 5KE3A 4L59A 1YHQA 2ZZDA 1LVKA 2DRMA 4J7IA 1B7TA 3CD6A 2CT3A 4LDYA 4JLGA 2DXUA 2JN0A 4N4IA 2EJGA 2B8AA 2DAQA 1ZHIA 1QCOA 2KI7A 2GFAA 1ABQA 2D8HA 4DBFA 3M0QA 4RTWA 2GGRA 2BZXA 2F5TX 4Z88A 1VQPT 4WF2A 3G6ET 3CCEQ 2LCSA 1E6GA 2EFIA 1QVGS 2JS0A 1W2BP 5GAMj 1YN8A 2O9VA 3JB9H 1WHJA 3S3MA 2J6KA 1Z9QA 2IPOB 2PUKB 4OB3B 4FW2A 4BY6C 2BZ8A 4MMLA 4C0ZA 3RMQA 1ZSZC 1RL2A 1YJNA 1WXTA 1NPPA 2A28A 3JCMQ 5GAN4 3LH5A 5D6YA 4TVRA 1K8AR 1Y96B 2EQJA 4KUDK 1OU9A 3H0FA 2E64A 2MK5A 2EQKA 2SRCA 1XOVA 2MOXA 5CKHA 3G4SA 1RAHB 2M51A 1W4SA 2OI3A 1V1CA 2HQHA 3L2WA 4A4FA 3RBBB 1QVFS 1OI1A 3UT1A 3O5ZA 3UATA 2ZCFB 1M3BA 4P5NA 1ZUUA 4IUPA 3EHRA 3CCMT 4CC7A 1VQNA 4PJOB 2DERA 3ER0A 2PU9B 3VU3C 2YUPA 4LDVA 1VYTA 4LUDA 2KGTA 5FWBA 3T9NA 3MKDA 1VQKA 2CZ1B 4JZ3A 1TU0B 2CSIA 5IXBA 3FC3A 2DD5A 3A8OB 2V26A 4BDZA 3JCMW 4FYYB 1WHKA 4DBQA 4J6XA 1TXQA 4D8KA 5LJ5f 5CVIA 5LJ5j 1PKSA 3CBMA 2QEXA 4A4HA 5KYUA 3UF4A 1V76A 1KQ2A 3CPWA 1HYOA 1UJYA 1UUEA 3CC2A 3VKIA 4Z8AA 4F7UE 1WDXA 1QVGP 4JRPA 3EFRA 2DO3A 5I2SA 2F2WA 1QW1A 1RABB 1QWFA 3H6ZA 3EG1A 3PIOA 2HL5C 1G83A 4QVDA 4XK8E 2OAWA 3A8MB 2QA4A 1D1BA 1C0MA 4FYVB 3CPFA 1YJ9Q 3MPUB 3CXCS 5DLOA 2XHCA 2KEAA 1OU8A 2DK3A 2RHZA 4KUIA 5GANh 1LOJA 3GPLA 4JLIA 5ECAA 1VIEA 4X1VA 3P8HA 4DA4A 2KRMA 3CBOA 1GL5A 1NE8A 2O9SA 2HBWA 1KHIA 4JZ4A 5GMKe 2LCLA 3JCMX 1KFZA 1SPKA 2X51A 4M77A 2PQWA 2LMJA 4E7SA 2C0IA 1X75C 3HSBA 3VS6A 2CREA 1JXOA 3KUFA 2QQRA 2FZKB 2QQBA 4M78E 1D09B 5GAMd 4HVVA 1T3LA 3LH0A 2BTTA 4HXJA 2F5KA 2CZ6B 3SD4A 1YFNA 1IGUA 3Q1JA 1NJIU 3G71A 4XTVA 1H3ZA 4M75F 2VVKA 1SSFA 5FU7B 5KYWB 3VS1A 2XDDA 5LL6S 4M7DG 5FW9A 2EJ9A 2MPXC 2C06A 3CPWP 3VS7A 1M5Q1 5FWCA 3VYHB 2ESWA 1KQSS 1JQQA 2V1RA 2MWPA 3PFSA 4M7AG 2WSCE 2BIVA 2DXBA 4KGXB 3GBQA 5KYXB 2VXEA 4N0AA 3EG9A 4R56A 1UECA 2HBPA 1NEBA 1SEMA 2YUOA 3S3NA 1SHFA 1YITA 4MZMA 1PCXA 3CCSA 1C1AA 3H41A 4C8QF 4KH0B 1XTDA 3CCMQ 4C92A 3CXCP 1VQ6Q 2XDBA 3CCLT 3JCMJ 4FT4A 2CP3A 4N4HA 2DEUA 1EZZB 4C0DB 1N8RU 2E3HA 1SG5A 3QPHA 4XU2A 5IXFA 3SWNA 4Y91A 3RMSA 2JOYA 4ZGEB 4J5YA 3TCJA 3PTAA 4V2SA 4PFOA 1K76A 5LJ5d 3QWYA 2L8DA 1TUGB 5CQYA 1BCMA 2RI3A 3E2UA 5GMKi 1I1JA 3P8BB 3I56A 3RKXA 1RAGB 2RA2A 1AVZC 3MEVA 1YJWQ 3SFMA 2ZGWA 4MDWA 3BE3A 3CC4T 1D3BB 3JCMd 5CKEA 3OYCA 1VQLT 1ZBJA 4BDYA 1YI2T 1E6HA 5J3BA 3H9NA 3M0UA 1KC8U 4EMHA 2L3PA 3M0PA 4J6WA 4BY6B 2RHXA 1I07A 3QYGB 1ZSZB 1Y07A 4HVWA 4OMQA 2DILA 2JMCA 2X4YA 1YIJA 3URGA 2M02A 4ELZC 4JRKA 3CCUA 2K6DA 2DL8A 2JW4A 4X9DA 3KBGA 1WLPB 1M90C 2LQ8A 1GXIE 1VYUA 4ANJA 3HFOA 3UWNA 1JU5C 1R8OB 1NYGA 1NM7A 4PK4A 2R5MA 2YSQA 3M0SA 2VXFA 2RQTA 5GANe 2P0PA 1VQ9A 3ULRB 3CCEA 2OX7A 1KG1A 2FG0A 3SHWA 5FRNA 5GAMh 2MMPA 2DTIA 3JB9G 2JZ2A 4WCIA 1J3TA 1VQ8T 1I81A 3VS3A 2XD0A 1Y71A 2DLPA 2QTXA 3JCMV 1BBZA 2HKNA 3RNJA 1AWXA 1QKWA 2DFUA 1Q86U 3M55A 4HCCA 5D7UA 2H8HA 2QXFA 4FCYA 2CP0A 4C0FA 1VQMT 1OZ2A 2EPDA 2QQAA 2K2VA 3EH2A 1M90R 2JS2A 4EMKA 3OBWA 2CGHA 2L3SA 2DM1A 5HY6A 4PJOG 3HFNA 4II1A 1WGSA 1ARKA 5GAOp 1KJWA 1TG0A 1BKBA 1WI7A 4QVCA 2LDMA 4M7DA 2JNGA 2EYQA 1RLPC 3M57A 3M5AA 1IHWA 2WSFE 3CMET 2QASA 2XMFA 1MMNA 1VQOT 2RF0A 5J26A 3HRUA 4EDUA 4GLMA 1D0YA 3AHUA 1OOTA 1PD1A 3CCLQ 3L42A 1JO8A 4RCBA 3CCJT 1EFNA 1N9RA 2NUTA 1M2VA 4J9DA 3KFVA 5LJ5h 1S72Q 2H3JA 1GBQA 1K8AU 2GBQA 2P4TA 4R0KA 5IHKA 1PM3A 1X2KA 2X3WD 4ESRA 4MMKA 2AK5A 4O5VA 2GQIA 1XJWB 2MF2A 2F2VA 4E6RA 1U8RA 4C5IA 4GY5A 4RTTA 1E7OA 2HQEA 4XAXB 2LQNA 3JCMh 4X9CA 2E1HA 1N5ZA 3NFCA 3OYLA 5GAOn 4HCKA 5GJWB 3CMAQ 4FSXA 4A63B 3CC4Q 2DXTA 1RI9A 1W2BS 1I0CA 2HMAA 2X9HA 1VQLQ 5I21A 8AT1B 5KYYB 1EIFA 1YI2Q 3EGXB 5IHNA 2JXBA 3QZ5B 3CC7A 2PZ1A 5L8RE 4F04B 5GAN6 1F1BB 4AG2C 4C5HA 1OZ3A 1PNJA 3CQTA 4E47A 1ZQ1A 3RDVA 2DXCA 2OTJQ 4RKUE 1B07A 3FJ5A 2AIRB 5HCKA 3R6NA 1ZBXA 3OYGA 3GNFB 2ZPGB 2KR3A 1T0HA 2FRYA 5DLQE 2DX1A 1MV0B 3ASKA 4FM4B 2CUDA 4M77E 4OMPA 2RQUA 5LJ3j 3CCRT 1BU1A 1M27C 4AT1B 1S1NA 2E4HA 2COYA 1GRIA 1WHMA 3EFOB 1VUBA 5DM7R 4JS5A 1GCPA 2JT4A 5L23A 5CAIA 2WACA 1UHCA 4E7ZA 1FMKA 3C95A 1VQ5A 2G6FX 3U23A 4B6MA 3EG0A 1I5OB 2SEMA 1B34B 3M0RA 5A2QE 2W0ZA 2KT1A 5I11A 1FMWA 3TREA 1I8FA 4JJNK 2XKOC 5A0GA 3JSCA 4M7AF 4RUGA 3WXMB 1VQMQ 2D9TA 3VS0A 2GFUA 3CC7T 2KK4A 3TSWA 2XG8D 1AWJA 1Z9ZA 4KT0E 2YHTA 3HPWA 3EAEA 3MO8A 1VQ4T 4IUVA 2DJZA 2A0FB 2AZSA 3NTKA 5I22A 5GAMf 2DL7A 5FROA 3O8VA 4GLKA 1Y57A 2RI5A 1VQ6A 2VB6A 4ZGDB 2XU8A 2HD0A 2J05A 2M0OA 4OMNA 1P92A 3CMEQ 1ZX6A 1YWOA 2EAYA 3HKSA 1VQ7A 1WYXA 2OTLQ 4CC2A 1BB9A 4C92E 8ATCB 3MCAB 3G1JA 2P84A 3OYYA 3SWNC 3A98A 4D6WA 1Q82C 1RADB 1BK2A 1SSHA 4VUBA 2K57A 2CDTA 3GIBA 2JTMA 1K0XA 2KRSA 1YJWA 3HRSA 1YHQT 1N27A 3CD6T 4CC3A 5LJ5e 3S3OA 2KE9A 1KSWA 4M75A 1X01A 2CT4A 4QQDA 1GCQA 3MEUA 2EYWA 3JV3A 1AD5A 3I9QA 2VGNA 1VOMA 2YWWA 1MMGA 2NUZA 2JVVA 3X28B 2JM8A 2HNIA 3A8HB 3V8LA 2DPPB 2ENMA 2QDYB 1H641 2ZAEA 3OYAA 1I5LA 1UGSB 2QK0A 3OYIA 2YRDA 4FW1A 4N4GA 4XQ3A 2EW3A 4PJJA 1V29B 1YJNT 1M8VA 3CPWS 1Q82R 4RMOA 1EX4A 2O31A 2BKDN 4A4KA 1ZLMA 3OS5A 3ZL7C 2VC8A 2Y4XA 2I2LA 2X4WA 3WVEB 5KH6A 2V8JA 2K7AA 3JCMf 4C8QA 3JB9F 4IURA 5LJ3d 3G4ST 2V8IA 4XU1A 4XTXA 2AHJB 3CCRQ 4J9CA 2ED0A 3CCQQ 2D0QB 3CCVQ 4KH1B 1WJQA 3PVQA 3LGFA 4NL2A 4C5GA 3QWXX 4KBMB 1M1KC 2K4YA 1VQNT 3MP8A 2F69A 1IGQA 3SDZA 4PFZA 3OB9A 1BI3A 3FB9A 2D8JA 4C92D 3A5ZB 3TEEA 1AEYA 2XK0A 4EIKA 2LX9A 5KYWA 1VQKT 2R5AA 2DD4A 4PJOF 2JM9A 4E7KA 2G3RA 3FDRA 3M0TA 2E12A 2XDPA 4M78C 2QEXT 3L2RA 2AKKA 4MDXA 2ATCB 2LZ6B 2I0NA 3GP8A 1VQPQ 4BE1A 3G6EQ 3CC2T 1AHJB 2V1QA 4OMLA 2NUPB 2YXYA 4ME7A 5AYFA 2WSEE 4DEYA 2EBPA 3DLMA 4ZNXA 4R55A 1JJ2A 3F70A 1UGQB 4M7DE 1WQWA 1RUWA 2FVUA 4RTYA 3ZFJA 2Z0WA 3C4SA 4OB2B 1U1TA 4BE2A 1TUCA 2QA4T 1SKUB 1FYNA 5AT1B 2EKOA 3M56A 5GMKj 3I55A 2CSQA 1I4K1 1TOVA 1WXBA 1M90U 2RN8A 2RMOA 5GANg 2RJFA 2F2XA 3H0IA 1YHQQ 1HD3A 3CD6Q 3CMAA 1UFFA 2FPEA 5C0MA 1G3WA 3M58A 2K3XA 5EC7A 2E65A 2LX7A 1QCFA 2A3LA 1Q7YC 3RUXA 1WJSA 3OS1A 1VIFA 1QP3A 2MI6A 4HCZA 2KYBA 3AT1B 3TVTA 2DIGA 1NLPC 3HL8A 3G71T 2BUDA 2RJEA 2OTJA 1MMDA 2CZ7B 2LP5A 1HSQA 4PLLA 2CS7A 4PL6A 1QKXA 9ATCB 3DB4A 1D1CA 1TH7A 2RQVA 1BI1A 3DLLA 2QAZA 5LJ3h 3FEOA 1Y0MA 2LJ3A 5M9OA 3EG9B 3H8ZA 3FIFA 5CO7A 2O4XA 2HZYA 4M78D 5J39A 1JRIA 3QDFA 4JJDA 3G4SQ 2DEQA 1X6OA 1JJ2P 3QSUA 1AZGB 3J81E 1DJ7B 2CP2A 1HK9A 4RCCA 3EGUA 2ROLA 4C92B 1ACMB 1ZSGA 1X69A 1YITT 2RHYA 4M7DD 1Q7YR 3CCST 4MZPA 2IIMA 2KDSA 2VGMA 4RTVA 1UB4A 1VQNQ 3NPFA 1YNZA 1M2OA 3SWNB 4J9GA 3VRZA 5GAN7 3GNGA 3PT9A 1GBRA 3A8LB 4J9EA 1QLYA 1R0CB 4HVUA 1VQKQ 1U3OA 1NG2A 3UDCA 2VV5A 2D0NA 2ZPBB 2LNVA 2RHUA 1MHNA 4Z89A 1K73C 2MAMA 2DBMA 2E3IA 2QEXQ 2M0YA 3I56T 2M16A 1LPLA 5FU6C 1MGQA 2LNHB 1ZUYA 1XQHA 3CC2Q 2EQMA 3VYGA 1RAAB 3QG1A 2A7YA 2LCCA 4FYWB 3L2VA 1H3HA 2OTLA 1R0BG 2YRVA 4J9HA 1KD1C 2KQWA 4PJLA 2YDLA 1UGVA 1SF9A 5GAOm 4BACA 4PJOE 3OYMA 2LVMA 3PE0A 4F7UB 3WVDB 1YIJT 2RO0A 3NTHA 4YTLA 3CCUT 1LJOA 2LJ0A 1PRLC 1PRMC 4RTUA 4LDWA 2DL4A 4BE0A 1MNEA 4CI0C 4ELYC 1QQJA 2HCKA 2X4JA 2FRWA 1UGPB 3REAB 1K73R 1Q95G 3OW2S 3OW2A 2YLCA 4M75C 1QVPA 1AWOA 5CCAA 4IUQA 1VQ9T 4RTZA 3FRNA 3CCET 2HL3A 4M75E 2DVJA 3MEWA 2DIQA 3OYJA 2KRNA 3EGDA 1X27A 4M7AA 2QYZA 2EYZA 3VJPA 1O9SA 1CKBA 2HAXA 2GNCA 3LGLA 3OMCA 1OQKA 1M3AA 2CUBA 4F14A 5KYYA 3EGXA 1C6VX 1KD1R 3JB9J 3G71Q 2FHDA 4KGZB 3X26B 1OX8A 3BDUA 3JCMb 1GFDA
chains in the Genus database with same CATH topology
1M1KR 1VQPQ 1YI2Q 3I56Q 3CCRQ 3G6EQ 3CPWP 3CD6Q 1VQ4Q 3CCLQ 3CCQQ 1VQ8Q 3CCVQ 1Q82R 1VQNQ 1KQSP 3CMEQ 1NJIR 2QEXQ 1YIJQ 1K9MR 1VQ9Q 1K73R 3CCMQ 3G4SQ 1YITQ 1YJ9Q 1JJ2P 1S72Q 3CXCP 3OW2P 3CCEQ 3CCUQ 1QVFP 1K8AR 1VQ6Q 3CC7Q 1KC8R 3CMAQ 1VQ5Q 2OTLQ 3CCSQ 1VQOQ 3CC4Q 1QVGP 1M90R 1KD1R 3CC2Q 2OTJQ 1YJNQ 1W2BP 3G71Q 1Q81R 1VQKQ 2QA4Q 1YJWQ 3CCJQ 1VQMQ 1N8RR 1VQLQ 3I55Q 1VQ7Q 1Q86R 1Q7YR 1YHQQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1K R;  1VQP Q;  1YI2 Q;  3I56 Q;  3CCR Q;  3G6E Q;  3CPW P;  3CD6 Q;  1VQ4 Q;  3CCL Q;  3CCQ Q;  1VQ8 Q;  3CCV Q;  1Q82 R;  1VQN Q;  1KQS P;  3CME Q;  1NJI R;  2QEX Q;  1YIJ Q;  1K9M R;  1VQ9 Q;  1K73 R;  3CCM Q;  3G4S Q;  1YIT Q;  1YJ9 Q;  1JJ2 P;  1S72 Q;  3CXC P;  3OW2 P;  3CCE Q;  3CCU Q;  1QVF P;  1K8A R;  1VQ6 Q;  3CC7 Q;  1KC8 R;  3CMA Q;  1VQ5 Q;  2OTL Q;  3CCS Q;  1VQO Q;  3CC4 Q;  1QVG P;  1M90 R;  1KD1 R;  3CC2 Q;  2OTJ Q;  1YJN Q;  1W2B P;  3G71 Q;  1Q81 R;  1VQK Q;  2QA4 Q;  1YJW Q;  3CCJ Q;  1VQM Q;  1N8R R;  1VQL Q;  3I55 Q;  1VQ7 Q;  1Q86 R;  1Q7Y R;  1YHQ Q; 
#chains in the Genus database with same CATH topology
 4XTZ A;  1WA7 A;  2DRK A;  2RH2 A;  4L6V 5;  5GMK m;  4ZTJ A;  1MV3 A;  4M78 B;  4LD9 K;  1IB8 A;  4FT2 A;  2FO0 A;  1G3T A;  2LQK A;  1B3Q A;  2EJF A;  4C8Q C;  2CP5 A;  2QTV A;  4J9I A;  3HP9 A;  3CCQ A;  3QJ6 A;  3CCV A;  3GOX A;  4LDX A;  4QW2 A;  4C8Q E;  3JCM P;  1K1Z A;  4F7U F;  2E6Z A;  1YJ9 A;  4F16 A;  4Q5W A;  2M1H A;  4LE9 A;  1ABO A;  1OPL A;  1OEB A;  4LNP A;  4IUT A;  3OYF A;  1WIE A;  2L5Q A;  1NYF A;  3QII A;  4JUV A;  1YIT Q;  4DBR A;  1UEB A;  4DOV A;  2GQV A;  2J06 A;  3LYI A;  1JXM A;  4NS5 A;  2D6F A;  1M2V B;  5GAO l;  1AT1 B;  3KXT A;  4OGC A;  3RKY A;  1B34 A;  1K9M C;  3VS5 A;  2YUN A;  3QO3 A;  1G2B A;  2BZY A;  4M77 C;  1Q82 U;  2K2M A;  3E19 A;  1YCS B;  2RK1 A;  1OPK A;  1UE9 A;  5LJ3 f;  1Q81 C;  5LJ5 g;  4FL6 A;  3OW2 P;  2LTO A;  2P0Q A;  5GAN 8;  1VQP A;  1HJD A;  3G6E A;  5IAY A;  5CK9 A;  4FYX B;  2DTO A;  4QKU A;  3HHT B;  2MWO A;  2MIO A;  1RLQ C;  4FU6 A;  1YCY A;  3EG2 A;  1BI0 A;  1MND A;  2E5K A;  1PSF A;  2XID A;  3J7A F;  3MET A;  1VQ8 Q;  3A8G B;  2CZ0 B;  4M75 D;  2HQX A;  2K5F A;  2ED1 A;  2FYK A;  3THK A;  1SHG A;  2RI2 A;  2K5I A;  1RAE B;  4OMM A;  4ORZ A;  4M78 F;  5GAM e;  4OB0 B;  4J8O A;  2DET A;  5CQX A;  3L2Z A;  1NLO C;  2YRC A;  5GMK h;  3OA6 A;  2J7I A;  2IVW A;  3PIP A;  4PNO A;  4F17 A;  4DOW A;  4UC4 A;  2RJC A;  3E1S A;  2L3Q A;  2QGG A;  3OYN A;  1Y96 A;  3P8D A;  3PVL A;  1YIJ Q;  1K9M R;  4E7H A;  2DZC A;  1U1S A;  2GCX A;  2K79 A;  4XTY A;  3CCU Q;  1N9S A;  1OUL A;  1ZUK A;  3JAM E;  4JRQ A;  4BUG A;  5GAN 5;  4N0A C;  5IHI A;  1Q81 R;  2P0K A;  1M1G A;  1BIA A;  1OV3 A;  5HKC A;  2FEI A;  3G7Z A;  1X2Q A;  2JMA A;  3OMG A;  2RD1 A;  3BFM A;  3CCM A;  2K3B A;  2P4R A;  2F1L A;  4HKE A;  4NL3 A;  1UG1 A;  1CKA A;  4C8Q D;  2AT1 B;  1IRX A;  4DQ2 A;  4C92 C;  1VQ9 Q;  3OYB A;  3C94 A;  2PUO B;  2RQR A;  4PJO A;  1VQO Q;  1QVG A;  2X3X D;  4PJM A;  5IH2 A;  2NLU A;  3CCJ Q;  2O2O A;  4J6Y A;  1M1K U;  3OS2 A;  1X43 A;  1VQ5 T;  2KNB B;  2DBK A;  1KIK A;  4X34 A;  4IIM A;  1H92 A;  1WQ7 A;  2VYT A;  2PVG B;  1PKT A;  4C92 G;  1M1F A;  4M77 D;  4WTO B;  5FU6 B;  2J6F A;  2EGC A;  2C0O A;  3TU4 K;  2J6O A;  2GTJ A;  2RQW A;  3C12 A;  1QVF A;  3JCM e;  5HK0 A;  2HSE B;  1YP5 A;  2D1X A;  2ECZ A;  3MJX A;  1VQ6 T;  2OJ2 A;  3V7S A;  1PD0 A;  2RJD A;  2KYM A;  3JRZ A;  2L3R A;  2QGF B;  1JEG A;  1VQ7 T;  2L0A A;  2CH4 W;  2QG9 B;  2FPD A;  2KY9 A;  1WXU A;  2FZC B;  2ABL A;  4LXC A;  4GBQ A;  3MHX A;  4A53 A;  4PLI A;  4QT7 A;  4HA8 A;  1T0J A;  1PC0 A;  2L2P A;  1OYX A;  1VYV A;  4M75 B;  3MP6 A;  1YJW T;  1W1F A;  4BD3 A;  2MCN A;  1WNL A;  1X6B A;  2EYY A;  1QP2 A;  2QQS A;  4Y92 A;  4OB1 B;  2LQW A;  3RKW A;  4AFS C;  2KXC A;  4F7U G;  2NUP A;  1TSF A;  2BE7 D;  2HEQ A;  5DY9 A;  1Q7Y U;  2K9G A;  2Y4Y A;  3FJP A;  2EGA A;  4XTW A;  1KK7 A;  5GAO r;  3PMT A;  1G3Y A;  3LWH A;  1NZ9 A;  4PFP A;  1BYM A;  5KYU B;  3CXC A;  3CC7 Q;  2COZ A;  2HSP A;  5A0D A;  4EMK C;  1PG5 B;  4QQ6 A;  1FMV A;  1RAC B;  1BIB A;  2K5L A;  6AT1 B;  2Y90 A;  2RPN A;  3VUB A;  1M3C A;  4C5E A;  4EPC A;  1G8X A;  3OYD A;  2K3Y A;  2KBT A;  4C8Q B;  2DYB A;  1VQ4 Q;  3V7R A;  2DVE A;  1QWE A;  3C0C A;  5KYX A;  4M7D C;  4J83 A;  4ATO A;  1K0S A;  1QVF P;  1JJ2 S;  4AFU C;  4E2F B;  4BI8 B;  2EKH A;  1YBY A;  2KAF A;  1WHG A;  3M4Y A;  4KGV B;  1K4U S;  3CCL A;  3R6O A;  1JBM A;  4E7I A;  4M7A C;  1IO6 A;  2RHI A;  1M1K R;  1SRL A;  2EIF A;  1KHC A;  2IG0 A;  3PGG A;  1S72 A;  4OP0 A;  4PKC C;  1RAI B;  2DA9 A;  3OSV A;  1D0X A;  4M7A E;  4M78 G;  2E41 A;  4BI4 A;  2E5Q A;  3M9Q A;  3X24 B;  3HTR A;  2HKQ B;  1VQ5 Q;  3I5S A;  1NBE B;  3TSZ A;  2LC4 A;  2ZPE B;  2RM4 A;  4M77 B;  3SEM A;  3JCM c;  1OX9 A;  1BI2 A;  1A0N B;  1SRM A;  5CKD A;  2DYI A;  4AG1 C;  2E70 A;  1QCN A;  2W10 A;  4LN2 A;  2E10 A;  2KT8 A;  1UJ0 A;  4HT8 A;  3CC4 A;  4DBH A;  1KQS A;  2EGE A;  1HXD A;  1K73 U;  2EWN A;  1VQL A;  1PSE A;  2DTH A;  4AMC A;  2LT4 A;  2KMT A;  3LLR A;  1YI2 A;  1D3B A;  4JJC A;  5GAO q;  5KYN A;  3OYK A;  3H0H A;  2EQU A;  2C0T A;  2QQ9 A;  4IUU A;  4JDS A;  3QBY A;  1PHT A;  2L89 A;  2ZPH B;  1WHL A;  2VKN A;  1ZSZ A;  3IQL A;  1MMA A;  2NWM A;  1AWW A;  2DE0 X;  2JTF A;  1WHH A;  1M30 A;  2ROT A;  1YJN Q;  4FIB A;  4J9F A;  1KD1 U;  1ZA1 B;  5FLX E;  1R77 A;  2FZG B;  2EVR A;  1S72 T;  1VQ7 Q;  3NMZ C;  2PTK A;  3EFS A;  1UDL A;  5EG2 A;  4JJB A;  3A1P A;  2FPF A;  3FLG A;  3QKJ A;  4HCB A;  3MEA A;  3CBP A;  4PJN A;  4NOY A;  4JRI A;  2VWF A;  3I55 T;  3ZBD A;  3NTI A;  2DL5 A;  1IXD A;  3LWI A;  2BE9 B;  3QYH B;  3OQ5 A;  5HK3 A;  4J7F A;  1VQ8 A;  5CIU A;  3CMA T;  4LDU A;  1NJI C;  1X6G A;  4M77 F;  3VS4 A;  4HT9 A;  1WX6 A;  4BB7 A;  1M9S A;  1VQM A;  2EQI A;  1NPR A;  1KQ1 A;  4AFZ C;  4E7L A;  1FX7 A;  4M7A D;  3EG3 A;  2GF7 A;  4ZN3 A;  3M53 A;  1ZA2 B;  4JPB W;  3BY7 A;  1O75 A;  2HDA A;  1IRE B;  2LJ1 A;  2KVQ G;  4CC4 B;  2X35 A;  1D1A A;  3D7S B;  2OTJ T;  2H3E B;  2KRO A;  2XIC A;  4B9W A;  4XU0 A;  2JJ9 A;  2PNI A;  1KQS P;  4A54 A;  4F7U A;  1K9A A;  3QZ9 B;  2EYX A;  1LNX A;  1H8K A;  2VUB A;  2O4X B;  2QDL A;  1CSK A;  4Z02 A;  3REB B;  3CEY A;  5CKB A;  2E6N A;  2YT6 A;  3CME A;  5LJ3 g;  1VQO A;  1Y7X A;  5FRM A;  1NJI R;  4L5G A;  3M54 A;  3L2Q A;  3CCJ A;  3E9G A;  5KCH A;  4PJO C;  1FXX A;  3I35 A;  3INZ A;  3LW5 E;  1AZE A;  1N8R C;  1NEG A;  2CH4 A;  2KXD A;  1XNI A;  2QA4 Q;  3JB9 I;  2A36 A;  1IHV A;  2RK2 A;  1G3S A;  2DL3 A;  5IN1 A;  2OAU A;  4KUL A;  4RTX A;  2DF6 A;  2YUQ A;  1FWZ A;  5GAN f;  1TS9 A;  3N5B B;  4C92 F;  3L2U A;  3UA6 A;  2R58 A;  5GAN j;  4K11 A;  1RI0 A;  1LCK A;  5A0L A;  1K9M U;  3I5R A;  1TWB A;  1N6A A;  4Y28 E;  5KCO A;  1U5S A;  2A37 A;  2LT1 A;  3BW1 A;  2B86 A;  2NYS A;  1Q81 U;  3QDR B;  1GCQ C;  5C6S A;  4M78 A;  2FB7 A;  1IZ6 A;  4BI3 A;  4OVA A;  3OSS C;  1PWT A;  1KC8 C;  4XTU A;  3X20 B;  3RER A;  3NGP A;  5D6X A;  5GAM g;  3QJY A;  4FSS A;  2LRQ A;  4ZTF A;  3PMI A;  3NHN A;  1QMC A;  2COW A;  1TTH B;  3S6W A;  2PVD B;  1UGR B;  1RAF B;  4A4E A;  1N8R R;  1AOJ A;  4ZN1 A;  3TQ7 P;  2PVO B;  4A4G A;  2OTL T;  2DMO A;  2CKK A;  3V8J A;  4M75 G;  4EMK B;  2ZPI B;  4CRI A;  3SB2 A;  2X4X A;  4IKF A;  3HRT A;  2CP7 A;  2CYZ B;  1U06 A;  1T3S A;  3OY9 A;  3JB9 D;  4DEX A;  3CCR A;  4XU3 A;  1TUD A;  2AKL A;  4M7D B;  3I55 Q;  4C0G A;  3EH1 A;  1W70 A;  4ZGJ B;  3VRY A;  1GFC A;  4M4Z A;  1BCO A;  3QHS A;  4E7J A;  4RG8 A;  1MUZ A;  4MZT A;  4EMG A;  5LJ3 e;  1YWP A;  1WFW A;  5GJV B;  3UPU A;  3EGD B;  4M7A B;  3V7C A;  3EFO A;  2RNA A;  3M59 A;  1KC8 R;  1D0Z A;  1WPY A;  3GLX A;  7AT1 B;  5CKF A;  3CCS Q;  2KSS A;  1Q86 C;  4O6J A;  3DKM A;  3RIR A;  3M4G A;  3EHQ A;  3UA7 A;  1W2B A;  2NUT B;  3V8K A;  4LD6 A;  2R57 A;  3PNW C;  4OMO A;  3OYH A;  2VAS A;  2DKG A;  5FU7 C;  3ME9 A;  4PJO D;  4RG2 A;  2V8K A;  4C8Q G;  3ZEH A;  2RB6 A;  4AFQ C;  2DJQ A;  3J80 E;  3X25 B;  1WZO A;  3L1A A;  5CR2 A;  3VS2 A;  4OMF B;  2JUF A;  3OBY A;  3VV0 A;  5KE2 A;  3OS0 A;  1VQ4 A;  2AZV A;  4J9B A;  5GAN 2;  1M8M A;  3QXE B;  2M9U A;  1G5V A;  3MP1 A;  2QI2 A;  4JS4 A;  3I56 Q;  3RR6 A;  1W6X A;  4B9X A;  2CP6 A;  2GTO A;  1M4Z A;  3RES A;  3JCM g;  3LX7 A;  1UHF A;  3GF5 A;  3CCQ T;  3CCV T;  2O88 A;  2YLB A;  2ZPF B;  4M77 G;  2A08 A;  2DNU A;  4QVZ A;  1WJR A;  1UTI A;  4OF1 A;  4LUE A;  2FL7 A;  4IIO A;  3OYE A;  1YJ9 T;  3VUZ A;  1Q86 R;  5D6W A;  4QQG A;  4KRT A;  1VA7 A;  2XI9 A;  3QUI A;  5IT9 E;  4M7D F;  2MYS A;  5I2M A;  1K8A C;  5GAN 3;  2DZ9 A;  1JB0 E;  3E9F A;  4C0D C;  2O01 E;  4D8D A;  4OGE A;  5GMK l;  3BDL A;  5GAN d;  3DB3 A;  2JTE A;  5KE3 A;  4L59 A;  1YHQ A;  2ZZD A;  1LVK A;  2DRM A;  4J7I A;  1B7T A;  3CD6 A;  2CT3 A;  4LDY A;  4JLG A;  2DXU A;  2JN0 A;  4N4I A;  2EJG A;  2B8A A;  2DAQ A;  1ZHI A;  1QCO A;  2KI7 A;  2GFA A;  1ABQ A;  2D8H A;  4DBF A;  3M0Q A;  4RTW A;  2GGR A;  2BZX A;  2F5T X;  4Z88 A;  1VQP T;  4WF2 A;  3G6E T;  3CCE Q;  2LCS A;  1E6G A;  2EFI A;  1QVG S;  2JS0 A;  1W2B P;  5GAM j;  1YN8 A;  2O9V A;  3JB9 H;  1WHJ A;  3S3M A;  2J6K A;  1Z9Q A;  2IPO B;  2PUK B;  4OB3 B;  4FW2 A;  4BY6 C;  2BZ8 A;  4MML A;  4C0Z A;  3RMQ A;  1ZSZ C;  1RL2 A;  1YJN A;  1WXT A;  1NPP A;  2A28 A;  3JCM Q;  5GAN 4;  3LH5 A;  5D6Y A;  4TVR A;  1K8A R;  1Y96 B;  2EQJ A;  4KUD K;  1OU9 A;  3H0F A;  2E64 A;  2MK5 A;  2EQK A;  2SRC A;  1XOV A;  2MOX A;  5CKH A;  3G4S A;  1RAH B;  2M51 A;  1W4S A;  2OI3 A;  1V1C A;  2HQH A;  3L2W A;  4A4F A;  3RBB B;  1QVF S;  1OI1 A;  3UT1 A;  3O5Z A;  3UAT A;  2ZCF B;  1M3B A;  4P5N A;  1ZUU A;  4IUP A;  3EHR A;  3CCM T;  4CC7 A;  1VQN A;  4PJO B;  2DER A;  3ER0 A;  2PU9 B;  3VU3 C;  2YUP A;  4LDV A;  1VYT A;  4LUD A;  2KGT A;  5FWB A;  3T9N A;  3MKD A;  1VQK A;  2CZ1 B;  4JZ3 A;  1TU0 B;  2CSI A;  5IXB A;  3FC3 A;  2DD5 A;  3A8O B;  2V26 A;  4BDZ A;  3JCM W;  4FYY B;  1WHK A;  4DBQ A;  4J6X A;  1TXQ A;  4D8K A;  5LJ5 f;  5CVI A;  5LJ5 j;  1PKS A;  3CBM A;  2QEX A;  4A4H A;  5KYU A;  3UF4 A;  1V76 A;  1KQ2 A;  3CPW A;  1HYO A;  1UJY A;  1UUE A;  3CC2 A;  3VKI A;  4Z8A A;  4F7U E;  1WDX A;  1QVG P;  4JRP A;  3EFR A;  2DO3 A;  5I2S A;  2F2W A;  1QW1 A;  1RAB B;  1QWF A;  3H6Z A;  3EG1 A;  3PIO A;  2HL5 C;  1G83 A;  4QVD A;  4XK8 E;  2OAW A;  3A8M B;  2QA4 A;  1D1B A;  1C0M A;  4FYV B;  3CPF A;  1YJ9 Q;  3MPU B;  3CXC S;  5DLO A;  2XHC A;  2KEA A;  1OU8 A;  2DK3 A;  2RHZ A;  4KUI A;  5GAN h;  1LOJ A;  3GPL A;  4JLI A;  5ECA A;  1VIE A;  4X1V A;  3P8H A;  4DA4 A;  2KRM A;  3CBO A;  1GL5 A;  1NE8 A;  2O9S A;  2HBW A;  1KHI A;  4JZ4 A;  5GMK e;  2LCL A;  3JCM X;  1KFZ A;  1SPK A;  2X51 A;  4M77 A;  2PQW A;  2LMJ A;  4E7S A;  2C0I A;  1X75 C;  3HSB A;  3VS6 A;  2CRE A;  1JXO A;  3KUF A;  2QQR A;  2FZK B;  2QQB A;  4M78 E;  1D09 B;  5GAM d;  4HVV A;  1T3L A;  3LH0 A;  2BTT A;  4HXJ A;  2F5K A;  2CZ6 B;  3SD4 A;  1YFN A;  1IGU A;  3Q1J A;  1NJI U;  3G71 A;  4XTV A;  1H3Z A;  4M75 F;  2VVK A;  1SSF A;  5FU7 B;  5KYW B;  3VS1 A;  2XDD A;  5LL6 S;  4M7D G;  5FW9 A;  2EJ9 A;  2MPX C;  2C06 A;  3CPW P;  3VS7 A;  1M5Q 1;  5FWC A;  3VYH B;  2ESW A;  1KQS S;  1JQQ A;  2V1R A;  2MWP A;  3PFS A;  4M7A G;  2WSC E;  2BIV A;  2DXB A;  4KGX B;  3GBQ A;  5KYX B;  2VXE A;  4N0A A;  3EG9 A;  4R56 A;  1UEC A;  2HBP A;  1NEB A;  1SEM A;  2YUO A;  3S3N A;  1SHF A;  1YIT A;  4MZM A;  1PCX A;  3CCS A;  1C1A A;  3H41 A;  4C8Q F;  4KH0 B;  1XTD A;  3CCM Q;  4C92 A;  3CXC P;  1VQ6 Q;  2XDB A;  3CCL T;  3JCM J;  4FT4 A;  2CP3 A;  4N4H A;  2DEU A;  1EZZ B;  4C0D B;  1N8R U;  2E3H A;  1SG5 A;  3QPH A;  4XU2 A;  5IXF A;  3SWN A;  4Y91 A;  3RMS A;  2JOY A;  4ZGE B;  4J5Y A;  3TCJ A;  3PTA A;  4V2S A;  4PFO A;  1K76 A;  5LJ5 d;  3QWY A;  2L8D A;  1TUG B;  5CQY A;  1BCM A;  2RI3 A;  3E2U A;  5GMK i;  1I1J A;  3P8B B;  3I56 A;  3RKX A;  1RAG B;  2RA2 A;  1AVZ C;  3MEV A;  1YJW Q;  3SFM A;  2ZGW A;  4MDW A;  3BE3 A;  3CC4 T;  1D3B B;  3JCM d;  5CKE A;  3OYC A;  1VQL T;  1ZBJ A;  4BDY A;  1YI2 T;  1E6H A;  5J3B A;  3H9N A;  3M0U A;  1KC8 U;  4EMH A;  2L3P A;  3M0P A;  4J6W A;  4BY6 B;  2RHX A;  1I07 A;  3QYG B;  1ZSZ B;  1Y07 A;  4HVW A;  4OMQ A;  2DIL A;  2JMC A;  2X4Y A;  1YIJ A;  3URG A;  2M02 A;  4ELZ C;  4JRK A;  3CCU A;  2K6D A;  2DL8 A;  2JW4 A;  4X9D A;  3KBG A;  1WLP B;  1M90 C;  2LQ8 A;  1GXI E;  1VYU A;  4ANJ A;  3HFO A;  3UWN A;  1JU5 C;  1R8O B;  1NYG A;  1NM7 A;  4PK4 A;  2R5M A;  2YSQ A;  3M0S A;  2VXF A;  2RQT A;  5GAN e;  2P0P A;  1VQ9 A;  3ULR B;  3CCE A;  2OX7 A;  1KG1 A;  2FG0 A;  3SHW A;  5FRN A;  5GAM h;  2MMP A;  2DTI A;  3JB9 G;  2JZ2 A;  4WCI A;  1J3T A;  1VQ8 T;  1I81 A;  3VS3 A;  2XD0 A;  1Y71 A;  2DLP A;  2QTX A;  3JCM V;  1BBZ A;  2HKN A;  3RNJ A;  1AWX A;  1QKW A;  2DFU A;  1Q86 U;  3M55 A;  4HCC A;  5D7U A;  2H8H A;  2QXF A;  4FCY A;  2CP0 A;  4C0F A;  1VQM T;  1OZ2 A;  2EPD A;  2QQA A;  2K2V A;  3EH2 A;  1M90 R;  2JS2 A;  4EMK A;  3OBW A;  2CGH A;  2L3S A;  2DM1 A;  5HY6 A;  4PJO G;  3HFN A;  4II1 A;  1WGS A;  1ARK A;  5GAO p;  1KJW A;  1TG0 A;  1BKB A;  1WI7 A;  4QVC A;  2LDM A;  4M7D A;  2JNG A;  2EYQ A;  1RLP C;  3M57 A;  3M5A A;  1IHW A;  2WSF E;  3CME T;  2QAS A;  2XMF A;  1MMN A;  1VQO T;  2RF0 A;  5J26 A;  3HRU A;  4EDU A;  4GLM A;  1D0Y A;  3AHU A;  1OOT A;  1PD1 A;  3CCL Q;  3L42 A;  1JO8 A;  4RCB A;  3CCJ T;  1EFN A;  1N9R A;  2NUT A;  1M2V A;  4J9D A;  3KFV A;  5LJ5 h;  1S72 Q;  2H3J A;  1GBQ A;  1K8A U;  2GBQ A;  2P4T A;  4R0K A;  5IHK A;  1PM3 A;  1X2K A;  2X3W D;  4ESR A;  4MMK A;  2AK5 A;  4O5V A;  2GQI A;  1XJW B;  2MF2 A;  2F2V A;  4E6R A;  1U8R A;  4C5I A;  4GY5 A;  4RTT A;  1E7O A;  2HQE A;  4XAX B;  2LQN A;  3JCM h;  4X9C A;  2E1H A;  1N5Z A;  3NFC A;  3OYL A;  5GAO n;  4HCK A;  5GJW B;  3CMA Q;  4FSX A;  4A63 B;  3CC4 Q;  2DXT A;  1RI9 A;  1W2B S;  1I0C A;  2HMA A;  2X9H A;  1VQL Q;  5I21 A;  8AT1 B;  5KYY B;  1EIF A;  1YI2 Q;  3EGX B;  5IHN A;  2JXB A;  3QZ5 B;  3CC7 A;  2PZ1 A;  5L8R E;  4F04 B;  5GAN 6;  1F1B B;  4AG2 C;  4C5H A;  1OZ3 A;  1PNJ A;  3CQT A;  4E47 A;  1ZQ1 A;  3RDV A;  2DXC A;  2OTJ Q;  4RKU E;  1B07 A;  3FJ5 A;  2AIR B;  5HCK A;  3R6N A;  1ZBX A;  3OYG A;  3GNF B;  2ZPG B;  2KR3 A;  1T0H A;  2FRY A;  5DLQ E;  2DX1 A;  1MV0 B;  3ASK A;  4FM4 B;  2CUD A;  4M77 E;  4OMP A;  2RQU A;  5LJ3 j;  3CCR T;  1BU1 A;  1M27 C;  4AT1 B;  1S1N A;  2E4H A;  2COY A;  1GRI A;  1WHM A;  3EFO B;  1VUB A;  5DM7 R;  4JS5 A;  1GCP A;  2JT4 A;  5L23 A;  5CAI A;  2WAC A;  1UHC A;  4E7Z A;  1FMK A;  3C95 A;  1VQ5 A;  2G6F X;  3U23 A;  4B6M A;  3EG0 A;  1I5O B;  2SEM A;  1B34 B;  3M0R A;  5A2Q E;  2W0Z A;  2KT1 A;  5I11 A;  1FMW A;  3TRE A;  1I8F A;  4JJN K;  2XKO C;  5A0G A;  3JSC A;  4M7A F;  4RUG A;  3WXM B;  1VQM Q;  2D9T A;  3VS0 A;  2GFU A;  3CC7 T;  2KK4 A;  3TSW A;  2XG8 D;  1AWJ A;  1Z9Z A;  4KT0 E;  2YHT A;  3HPW A;  3EAE A;  3MO8 A;  1VQ4 T;  4IUV A;  2DJZ A;  2A0F B;  2AZS A;  3NTK A;  5I22 A;  5GAM f;  2DL7 A;  5FRO A;  3O8V A;  4GLK A;  1Y57 A;  2RI5 A;  1VQ6 A;  2VB6 A;  4ZGD B;  2XU8 A;  2HD0 A;  2J05 A;  2M0O A;  4OMN A;  1P92 A;  3CME Q;  1ZX6 A;  1YWO A;  2EAY A;  3HKS A;  1VQ7 A;  1WYX A;  2OTL Q;  4CC2 A;  1BB9 A;  4C92 E;  8ATC B;  3MCA B;  3G1J A;  2P84 A;  3OYY A;  3SWN C;  3A98 A;  4D6W A;  1Q82 C;  1RAD B;  1BK2 A;  1SSH A;  4VUB A;  2K57 A;  2CDT A;  3GIB A;  2JTM A;  1K0X A;  2KRS A;  1YJW A;  3HRS A;  1YHQ T;  1N27 A;  3CD6 T;  4CC3 A;  5LJ5 e;  3S3O A;  2KE9 A;  1KSW A;  4M75 A;  1X01 A;  2CT4 A;  4QQD A;  1GCQ A;  3MEU A;  2EYW A;  3JV3 A;  1AD5 A;  3I9Q A;  2VGN A;  1VOM A;  2YWW A;  1MMG A;  2NUZ A;  2JVV A;  3X28 B;  2JM8 A;  2HNI A;  3A8H B;  3V8L A;  2DPP B;  2ENM A;  2QDY B;  1H64 1;  2ZAE A;  3OYA A;  1I5L A;  1UGS B;  2QK0 A;  3OYI A;  2YRD A;  4FW1 A;  4N4G A;  4XQ3 A;  2EW3 A;  4PJJ A;  1V29 B;  1YJN T;  1M8V A;  3CPW S;  1Q82 R;  4RMO A;  1EX4 A;  2O31 A;  2BKD N;  4A4K A;  1ZLM A;  3OS5 A;  3ZL7 C;  2VC8 A;  2Y4X A;  2I2L A;  2X4W A;  3WVE B;  5KH6 A;  2V8J A;  2K7A A;  3JCM f;  4C8Q A;  3JB9 F;  4IUR A;  5LJ3 d;  3G4S T;  2V8I A;  4XU1 A;  4XTX A;  2AHJ B;  3CCR Q;  4J9C A;  2ED0 A;  3CCQ Q;  2D0Q B;  3CCV Q;  4KH1 B;  1WJQ A;  3PVQ A;  3LGF A;  4NL2 A;  4C5G A;  3QWX X;  4KBM B;  1M1K C;  2K4Y A;  1VQN T;  3MP8 A;  2F69 A;  1IGQ A;  3SDZ A;  4PFZ A;  3OB9 A;  1BI3 A;  3FB9 A;  2D8J A;  4C92 D;  3A5Z B;  3TEE A;  1AEY A;  2XK0 A;  4EIK A;  2LX9 A;  5KYW A;  1VQK T;  2R5A A;  2DD4 A;  4PJO F;  2JM9 A;  4E7K A;  2G3R A;  3FDR A;  3M0T A;  2E12 A;  2XDP A;  4M78 C;  2QEX T;  3L2R A;  2AKK A;  4MDX A;  2ATC B;  2LZ6 B;  2I0N A;  3GP8 A;  1VQP Q;  4BE1 A;  3G6E Q;  3CC2 T;  1AHJ B;  2V1Q A;  4OML A;  2NUP B;  2YXY A;  4ME7 A;  5AYF A;  2WSE E;  4DEY A;  2EBP A;  3DLM A;  4ZNX A;  4R55 A;  1JJ2 A;  3F70 A;  1UGQ B;  4M7D E;  1WQW A;  1RUW A;  2FVU A;  4RTY A;  3ZFJ A;  2Z0W A;  3C4S A;  4OB2 B;  1U1T A;  4BE2 A;  1TUC A;  2QA4 T;  1SKU B;  1FYN A;  5AT1 B;  2EKO A;  3M56 A;  5GMK j;  3I55 A;  2CSQ A;  1I4K 1;  1TOV A;  1WXB A;  1M90 U;  2RN8 A;  2RMO A;  5GAN g;  2RJF A;  2F2X A;  3H0I A;  1YHQ Q;  1HD3 A;  3CD6 Q;  3CMA A;  1UFF A;  2FPE A;  5C0M A;  1G3W A;  3M58 A;  2K3X A;  5EC7 A;  2E65 A;  2LX7 A;  1QCF A;  2A3L A;  1Q7Y C;  3RUX A;  1WJS A;  3OS1 A;  1VIF A;  1QP3 A;  2MI6 A;  4HCZ A;  2KYB A;  3AT1 B;  3TVT A;  2DIG A;  1NLP C;  3HL8 A;  3G71 T;  2BUD A;  2RJE A;  2OTJ A;  1MMD A;  2CZ7 B;  2LP5 A;  1HSQ A;  4PLL A;  2CS7 A;  4PL6 A;  1QKX A;  9ATC B;  3DB4 A;  1D1C A;  1TH7 A;  2RQV A;  1BI1 A;  3DLL A;  2QAZ A;  5LJ3 h;  3FEO A;  1Y0M A;  2LJ3 A;  5M9O A;  3EG9 B;  3H8Z A;  3FIF A;  5CO7 A;  2O4X A;  2HZY A;  4M78 D;  5J39 A;  1JRI A;  3QDF A;  4JJD A;  3G4S Q;  2DEQ A;  1X6O A;  1JJ2 P;  3QSU A;  1AZG B;  3J81 E;  1DJ7 B;  2CP2 A;  1HK9 A;  4RCC A;  3EGU A;  2ROL A;  4C92 B;  1ACM B;  1ZSG A;  1X69 A;  1YIT T;  2RHY A;  4M7D D;  1Q7Y R;  3CCS T;  4MZP A;  2IIM A;  2KDS A;  2VGM A;  4RTV A;  1UB4 A;  1VQN Q;  3NPF A;  1YNZ A;  1M2O A;  3SWN B;  4J9G A;  3VRZ A;  5GAN 7;  3GNG A;  3PT9 A;  1GBR A;  3A8L B;  4J9E A;  1QLY A;  1R0C B;  4HVU A;  1VQK Q;  1U3O A;  1NG2 A;  3UDC A;  2VV5 A;  2D0N A;  2ZPB B;  2LNV A;  2RHU A;  1MHN A;  4Z89 A;  1K73 C;  2MAM A;  2DBM A;  2E3I A;  2QEX Q;  2M0Y A;  3I56 T;  2M16 A;  1LPL A;  5FU6 C;  1MGQ A;  2LNH B;  1ZUY A;  1XQH A;  3CC2 Q;  2EQM A;  3VYG A;  1RAA B;  3QG1 A;  2A7Y A;  2LCC A;  4FYW B;  3L2V A;  1H3H A;  2OTL A;  1R0B G;  2YRV A;  4J9H A;  1KD1 C;  2KQW A;  4PJL A;  2YDL A;  1UGV A;  1SF9 A;  5GAO m;  4BAC A;  4PJO E;  3OYM A;  2LVM A;  3PE0 A;  4F7U B;  3WVD B;  1YIJ T;  2RO0 A;  3NTH A;  4YTL A;  3CCU T;  1LJO A;  2LJ0 A;  1PRL C;  1PRM C;  4RTU A;  4LDW A;  2DL4 A;  4BE0 A;  1MNE A;  4CI0 C;  4ELY C;  1QQJ A;  2HCK A;  2X4J A;  2FRW A;  1UGP B;  3REA B;  1K73 R;  1Q95 G;  3OW2 S;  3OW2 A;  2YLC A;  4M75 C;  1QVP A;  1AWO A;  5CCA A;  4IUQ A;  1VQ9 T;  4RTZ A;  3FRN A;  3CCE T;  2HL3 A;  4M75 E;  2DVJ A;  3MEW A;  2DIQ A;  3OYJ A;  2KRN A;  3EGD A;  1X27 A;  4M7A A;  2QYZ A;  2EYZ A;  3VJP A;  1O9S A;  1CKB A;  2HAX A;  2GNC A;  3LGL A;  3OMC A;  1OQK A;  1M3A A;  2CUB A;  4F14 A;  5KYY A;  3EGX A;  1C6V X;  1KD1 R;  3JB9 J;  3G71 Q;  2FHD A;  4KGZ B;  3X26 B;  1OX8 A;  3BDU A;  3JCM b;  1GFD A; 
#chains in the Genus database with same CATH homology
 1M1K R;  1VQP Q;  1YI2 Q;  3I56 Q;  3CCR Q;  3G6E Q;  3CPW P;  3CD6 Q;  1VQ4 Q;  3CCL Q;  3CCQ Q;  1VQ8 Q;  3CCV Q;  1Q82 R;  1VQN Q;  1KQS P;  3CME Q;  1NJI R;  2QEX Q;  1YIJ Q;  1K9M R;  1VQ9 Q;  1K73 R;  3CCM Q;  3G4S Q;  1YIT Q;  1YJ9 Q;  1JJ2 P;  1S72 Q;  3CXC P;  3OW2 P;  3CCE Q;  3CCU Q;  1QVF P;  1K8A R;  1VQ6 Q;  3CC7 Q;  1KC8 R;  3CMA Q;  1VQ5 Q;  2OTL Q;  3CCS Q;  1VQO Q;  3CC4 Q;  1QVG P;  1M90 R;  1KD1 R;  3CC2 Q;  2OTJ Q;  1YJN Q;  1W2B P;  3G71 Q;  1Q81 R;  1VQK Q;  2QA4 Q;  1YJW Q;  3CCJ Q;  1VQM Q;  1N8R R;  1VQL Q;  3I55 Q;  1VQ7 Q;  1Q86 R;  1Q7Y R;  1YHQ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...