3I56Q

Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome/antibiotic
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
total genus 15
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3i56Q00
1VQ7Q 2OTJQ 2QEXQ 1NJIR 3CXCP 2OTLQ 3CCEQ 1VQ6Q 1YJNQ 1QVFP 3G6EQ 2QA4Q 3G4SQ 1S72Q 1YI2Q 1VQ5Q 1M90R 1JJ2P 3CCRQ 1QVGP 1W2BP 1VQNQ 3CPWP 1M1KR 3I56Q 3CD6Q 3I55Q 3CCUQ 1VQPQ 1YJ9Q 3CCJQ 3CC4Q 3CCQQ 3CCVQ 1YITQ 1Q82R 1N8RR 1VQ8Q 1VQLQ 1KQSP 1VQ4Q 1VQ9Q 1YJWQ 1YHQQ 3CMEQ 3CCLQ 1Q7YR 3CC2Q 1K73R 3G71Q 1YIJQ 1Q81R 1Q86R 3CC7Q 1VQMQ 3OW2P 1K8AR 1VQKQ 1VQOQ 1KC8R 1K9MR 3CCSQ 3CCMQ 3CMAQ 1KD1R
chains in the Genus database with same CATH superfamily
3H8ZA 3X26B 2NUPA 3GPLA 2E41A 2FRYA 2DETA 4C92D 4E7SA 2JNGA 5KCHA 2YLCA 3QJ6A 1YCYA 3CD6A 2EGAA 4QVZA 1X69A 2BZ8A 1GCQA 1FMWA 2X3XD 5LJ3e 2DL5A 2CZ6B 1M30A 1CKAA 2KYMA 1VQ8A 2MI6A 1SSHA 1NEBA 1WDXA 3M0TA 4LUDA 2IIMA 3CCJT 2RPNA 1RAAB 3M59A 4OB0B 2A28A 3FEOA 3INZA 3EAEA 4LE9A 1FXXA 3EFOB 4EMKA 2GGRA 1KQSP 1Q95G 1MNDA 3FDRA 2DD5A 1RAIB 2RI2A 2I2LA 2KQWA 3RKXA 3REBB 3MEAA 3HL8A 1VQKA 2Y4XA 4LD9K 4N0AA 4M77G 4EMKC 2DMOA 2K4YA 1K8AR 1P92A 3JCMW 5ECAA 1M90U 1VQ6Q 4M78A 1VQOT 4E7KA 1JXOA 3JCMX 2WACA 2JS0A 2RN8A 2L8DA 3OSSC 1EZZB 4JDSA 2MMPA 2YRVA 1WHJA 2M16A 2ATCB 3CMEA 3MP6A 1FX7A 2BTTA 1VOMA 4E2FB 1K73U 4M7DD 1W2BS 2R5MA 1VYVA 1PSFA 3C12A 3DB4A 2DE0X 2RH2A 1YJWT 2QQAA 1AVZC 5L23A 1R0CB 5KYUB 4OGEA 1YHQT 5EG2A 3V7RA 2XHCA 2CP3A 3OW2A 5IAYA 1UB4A 4PJOA 2NLUA 5D6YA 3HSBA 3CCMT 1TTHB 3H41A 4M75A 2FHDA 4BY6B 1YIJQ 5CKDA 3M57A 2YT6A 1H8KA 4FYXB 5GMKh 3OS5A 2KDSA 3MEWA 1M90R 5GAN5 3LWHA 1VQOA 1OOTA 4DA4A 3CC4Q 4ME7A 4KT0E 2FRWA 3MHXA 3CCUT 4M75F 1PHTA 1R8OB 4M7AF 2PTKA 2X4JA 2LQWA 1YITA 1U1TA 1KK7A 2IG0A 5GANf 2P84A 3G4SQ 2PNIA 1NPRA 4F7UE 1KC8C 1MMNA 4A63B 2CT3A 2V1RA 5KYNA 3SEMA 4M78C 2RK1A 3OYFA 4A4KA 2JT4A 2XMFA 1KC8U 3P8DA 1VQLA 1NYFA 5GAN8 3JB9H 2QYZA 3M54A 2A37A 1AT1B 2CP0A 3DKMA 3QJYA 2QQRA 1U1SA 1VQ8T 1U3OA 3G6EQ 1R77A 2M51A 2VVKA 4X1VA 3I5RA 3CCUQ 1XJWB 2OTJT 2D1XA 4E7HA 4LDVA 5C6SA 4AMCA 4K11A 4OMLA 2HBWA 3PTAA 3SDZA 3L2WA 2E12A 3VS6A 3UT1A 4C92G 2NYSA 1YWPA 3OQ5A 4HCZA 5CQXA 4ELZC 3RMQA 2RA2A 4PNOA 4M7AC 5LJ5g 1Q82U 1GRIA 1V1CA 3O5ZA 2FB7A 3G6EA 4M7AB 2EYWA 3OYDA 3I55Q 2DA9A 2HD0A 3PT9A 1XNIA 1GFCA 1VQMQ 1I5LA 3G6ET 3GBQA 1X27A 3VS4A 2JJ9A 1AZEA 1W2BA 4C8QG 4ZN1A 2CDTA 5HKCA 2QTXA 1JB0E 1D0YA 3M0QA 4XK8E 3J81E 3IQLA 2KEAA 2K5IA 2G3RA 3ULRB 4B9XA 1TUCA 3SWNB 3UWNA 3NTIA 4A4HA 3EFOA 1PG5B 1MV0B 2X9HA 3EGXA 2QASA 4FYWB 2OTLQ 2CP6A 3JCMJ 2KAFA 2E6NA 5GMKm 1BCOA 1NEGA 2AIRB 3CCEA 2RHXA 2LT1A 3JCMf 2LX7A 5I22A 4II1A 4M7AD 4N4GA 4J9FA 2QA4A 3V8LA 4HVVA 3M56A 1K9AA 1OQKA 3EH2A 3P8HA 1A0NB 5FRNA 4RTTA 2ROLA 3U23A 2K5FA 1PCXA 1KFZA 1BB9A 4LDUA 1YJ9Q 3QDFA 3CCJQ 2KRNA 2SRCA 1VQMT 3CBMA 2PVGB 1M1FA 3R6NA 3OYEA 2J6OA 2EGCA 3VS3A 5KYWA 2XK0A 3G4ST 5I2MA 2GFUA 2V8JA 1ABOA 2DXCA 5HK3A 2DVEA 1WXUA 5KYYB 4BUGA 1K8AU 1JJ2A 4PJOE 3PIPA 3QUIA 5DY9A 1YNZA 4AT1B 4XTYA 2XDDA 3OS2A 4FIBA 4GBQA 2VWFA 3VRYA 5DLOA 1N9SA 2YDLA 1I8FA 1IGQA 3JV3A 2RJCA 1PKTA 2DTHA 3S3OA 1D09B 1PM3A 5IHNA 3CPFA 1VQPT 1O9SA 2F2WA 5I21A 5HCKA 1QVGP 4LDYA 2CGHA 4ZGEB 2O88A 2CKKA 5FLXE 3LGLA 3E19A 1K9MU 1UEBA 4RG8A 2DRMA 2FZCB 3M58A 5IHIA 1WXTA 2B86A 2DJZA 2FZKB 5M9OA 4PJOD 4R0KA 3FC3A 2VKNA 4XU1A 1WHLA 3URGA 1VQLT 1Y0MA 4JRIA 4C8QC 2XIDA 2E1HA 4QQGA 1M27C 2PVOB 4BB7A 2LCCA 4CC2A 3RKWA 3EFSA 2ABLA 1QKXA 1QP2A 2O4XB 1SKUB 4PK4A 1YCSB 3JB9F 1RABB 4ZNXA 2DK3A 5GMKi 2RQTA 4RTYA 4OB2B 2HL5C 1K9MC 2KY9A 1WJRA 1UGSB 1RUWA 5CKBA 1G5VA 2HL3A 4M7DC 1YI2Q 2CP2A 4QVDA 3OB9A 2ZPHB 4OGCA 2Y90A 3G1JA 2COWA 2X51A 3CCQQ 2DIGA 2RJFA 4M78B 4D6WA 2F69A 2JMAA 3RKYA 1VIEA 3CC2Q 3L2VA 3MJXA 8ATCB 1IXDA 2NWMA 5GAN7 3ZL7C 4J9CA 2HZYA 1MMDA 2O9SA 1QWEA 1G83A 3N5BB 4X34A 1TOVA 2CP5A 3BFMA 1M8VA 2AZVA 1D1AA 1KJWA 4MZTA 2LVMA 5CAIA 4L6V5 4IKFA 3FLGA 1M3AA 3OY9A 4Y92A 6AT1B 2DL3A 1IREB 2KNBB 2D0NA 1IZ6A 1QVPA 2K6DA 3EHQA 1M1GA 1T3SA 5GAOr 3SWNA 2JS2A 5DM7R 2CUDA 3NPFA 4FW1A 3CC7T 2VYTA 4J7IA 4MZMA 1Q7YR 2E4HA 2RQVA 3H0HA 3T9NA 1M1KC 1UHCA 4C92B 4JZ3A 1SF9A 2BIVA 3QWXX 5LJ5e 1SEMA 5C0MA 1NJIU 1WQWA 3E9FA 1C6VX 1ZBXA 4M77D 2LC4A 1KQ1A 1JU5C 1W4SA 3CC4A 3VS5A 2HQEA 3I55T 4J9DA 1K8AC 2VASA 4LDXA 2KT1A 1WHGA 2OI3A 2H8HA 1ZUUA 2KMTA 2QQSA 1VA7A 5IN1A 4C8QB 5LJ3d 2I0NA 3EH1A 3M0UA 4PFOA 2RJDA 2DYBA 1PSEA 1GBQA 2ED1A 2RF0A 2RHZA 2LCSA 3VUBA 2GTOA 4ZN3A 3SFMA 2KVQG 4L5GA 3PVQA 2LP5A 3TU4K 2R58A 4HXJA 5CVIA 5DLQE 2YHTA 1GBRA 3CCRQ 3JCMQ 2M0YA 4RMOA 4V2SA 2X35A 4JPBW 2A08A 1Q81U 5LJ5h 4J5YA 1VUBA 3GNGA 5GMKj 3MCAB 3NFCA 4LNPA 3HRUA 1QCOA 2KRMA 5FW9A 1CSKA 3NMZC 1VQOQ 1KQSA 3I56T 3RESA 3G7ZA 2OTJA 2DJQA 3QKJA 1BI3A 3ZFJA 4JJBA 3MEUA 4F7UF 3THKA 1PRLC 2FVUA 2EPDA 3UF4A 1YIJA 3I56A 1QLYA 1ZLMA 3HFOA 5CKHA 4JUVA 2D0QB 1TG0A 4HVWA 1HXDA 1TUGB 2CZ7B 4B9WA 4C8QD 3TSWA 4XTVA 1YI2A 1VQNQ 3CCJA 1UFFA 1M3BA 2BUDA 3H9NA 4RTVA 3L1AA 3C95A 1E6HA 1GFDA 3PIOA 1OZ3A 2ZPFB 4E6RA 3JCMc 3X20B 1EIFA 2RB6A 2DXTA 1WHHA 2VGNA 1HK9A 1B07A 1YITT 3LH0A 3TQ7P 3OYIA 2C0OA 1VQ5Q 2X4WA 3ZBDA 1BCMA 4PJOC 2V1QA 2D6FA 1J3TA 4RTWA 5LJ3g 1NYGA 3SWNC 3UDCA 3CXCS 4C8QA 1WGSA 4JS4A 4N4HA 4J9GA 4PJMA 5GMKl 1NLPC 3AHUA 4GLMA 4E7JA 3PFSA 3RMSA 3C4SA 3OBYA 3OS1A 4HT8A 1AWWA 3JB9G 2QEXA 2DO3A 3PMIA 1UGRB 4M75B 4PKCC 3VS2A 1N9RA 5GAMf 3SHWA 5KYYA 1U5SA 1YBYA 2VC8A 2ZAEA 1X6OA 4M7DA 3HHTB 3A8MB 4J83A 4X9DA 3JB9J 1TS9A 2M9UA 3OW2P 4F7UG 1VQ9T 1MUZA 3M0SA 2EYXA 2YUNA 4HVUA 3BY7A 1YJ9T 1JJ2S 4C8QE 4M4ZA 1PNJA 4TVRA 2BE9B 2JM8A 5D6WA 1UUEA 1WA7A 3VYGA 2FL7A 4PJJA 1I07A 5HY6A 4AFSC 1JRIA 2QTVA 4M7DF 1OPKA 1QCNA 4RG2A 2DLPA 1GCQC 2L3SA 2L3QA 5IXBA 1IGUA 2D8JA 2G6FX 1OEBA 5GANh 3JCMP 4PJLA 1NJIR 1M9SA 4FT4A 1NJIC 1W2BP 1RAEB 3CCQA 4P5NA 5LL6S 4JS5A 2KYBA 4XU3A 5GJVB 5KYWB 1Q82R 4IUVA 1UJYA 3CC2A 2DBMA 1MMAA 4C92E 2DM1A 2K2VA 4C0FA 5LJ5f 1OX9A 4RTUA 1KSWA 2DEQA 4F14A 4QW2A 3KBGA 2O4XA 2K7AA 1TUDA 2VV5A 5GAN6 4BE0A 4A4FA 2R5AA 3G71A 2XD0A 4PJOF 1Y96B 4BE2A 2HAXA 1VQLQ 2VUBA 5GMKe 2HQHA 2YUQA 2LNHB 2LRQA 1JBMA 4M77B 3QYGB 4J6YA 3OYJA 3RNJA 1VQMA 1BI2A 2K3BA 4F04B 2DXBA 1G3YA 1N8RU 5FU7B 1ZA1B 1ZX6A 3CC7A 2E10A 3QYHB 5GAN2 4F16A 3OW2S 2F5TX 5A0GA 3VS1A 2GCXA 3FJ5A 3V8KA 2A0FB 2KSSA 2EYYA 1K73R 1UECA 2M02A 2KRSA 5A0LA 1BU1A 4PL6A 2SEMA 3MP1A 2X4XA 2RO0A 3OA6A 3PVLA 5CIUA 2EW3A 2JN0A 2K3YA 3P8BB 1LVKA 2DILA 2C0IA 2RJEA 2HKNA 2KT8A 4J9IA 1YHQQ 1X6BA 2J05A 3I5SA 4M78E 1XQHA 2CZ1B 2E3HA 2JTFA 4QQ6A 5KYXB 1SHGA 1YI2T 2DEUA 4BACA 2LNVA 3OYYA 4B6MA 3CCQT 4OMPA 2DZCA 1G3TA 2COYA 1VQ4T 3WVEB 4D8KA 1VQ5A 1B34A 1LJOA 4GY5A 4KGVB 3VU3C 4FSSA 3E9GA 1G3SA 2X4YA 3L2RA 1OYXA 5CKFA 1KIKA 5CO7A 1KC8R 3BW1A 1VQ4A 2F5KA 1MNEA 1MMGA 4MZPA 1Z9ZA 3CCEQ 5J3BA 2NUTA 1FWZA 5D6XA 1KQ2A 3L2ZA 2KBTA 3NTKA 4OMOA 1WQ7A 5AYFA 5GAOl 5CR2A 1WHKA 3KUFA 3VJPA 3OSVA 4DBQA 4PJOG 3S6WA 4M78D 1NZ9A 3J80E 2QDYB 1QVFP 4PJOB 2GNCA 1FMKA 4OVAA 2V8KA 1YP5A 3EG2A 2OTLT 2QDLA 1H3ZA 4LUEA 1T0JA 1VQNT 3BDLA 1H92A 4PJNA 1G8XA 1IRXA 1UHFA 4EIKA 2ZPBB 3GNFB 1LNXA 1NPPA 3EHRA 4AFZC 3OMCA 3DB3A 3HP9A 2JTEA 2DL4A 5GAN4 1X2QA 2DYIA 4IUTA 9ATCB 1N27A 2CSIA 1M90C 1VQ7A 1WPYA 2EYZA 3BDUA 2ZPGB 4RUGA 1QCFA 3L2QA 1VQKT 1HD3A 1SSFA 3G4SA 2DL7A 1KQSS 2O01E 4ORZA 3LW5E 3M4GA 1VQ9A 3CCVT 1K0XA 2OTJQ 1TSFA 3JB9D 2L0AA 3CMET 4C5GA 3M4YA 1N8RR 4F7UA 1N6AA 3PNWC 3M55A 1W70A 3AT1B 1C0MA 5IHKA 5GAOn 3A98A 1Z9QA 2L5QA 2EQIA 1Q7YC 4HA8A 4FCYA 1Y71A 2E70A 1D1CA 2DF6A 3CXCA 1RI0A 1HSQA 2M1HA 1PRMC 3HKSA 3QDRB 4Z8AA 1OV3A 3Q1JA 1BYMA 5KCOA 4E7ZA 3JCMd 2LQKA 2ZPEB 2A36A 2EQMA 1I1JA 2IVWA 5CQYA 2CH4W 1ZSZB 3NHNA 1K4US 3X28B 2GF7A 4M75E 2AHJB 2PUOB 4DEYA 4C5HA 2HKQB 3MO8A 4JJCA 4YTLA 5CK9A 1D0ZA 1TWBA 4RKUE 1YITQ 4KGXB 2R57A 8AT1B 3NTHA 2KXCA 1YHQA 2BZYA 2DKGA 4XU0A 2RI5A 1VQPA 1Q81R 2LCLA 4C5IA 3DLLA 1ZSGA 1BBZA 4E7IA 3EG9A 1OU8A 2A3LA 3CMAA 3CCSQ 2KR3A 2FG0A 2E6ZA 4WCIA 1UGPB 1S72Q 1I4K1 4FU6A 1KG1A 1BI1A 3RDVA 4M7AG 1TXQA 3O8VA 1WX6A 2GQVA 2PVDB 3EGUA 1M2VB 3CPWA 3FIFA 4C0GA 3CMAQ 1WI7A 4A4GA 2A7YA 3V7SA 3M53A 1YN8A 3QXEB 5KE3A 3X24B 3VUZA 4NS5A 4XU2A 5GAN3 1YJNT 2LJ3A 4J8OA 2Z0WA 5IH2A 4KH1B 1RL2A 4ZTJA 3PE0A 1BKBA 2M0OA 5GANe 5I2SA 1WJQA 2AZSA 4BY6C 1LPLA 3EG0A 3I55A 2KROA 2HBPA 1S72T 2DBKA 1YJ9A 4QQDA 1AEYA 3LYIA 4HKEA 2GFAA 4PLLA 2RHIA 2LJ0A 3FJPA 2L3RA 4IUPA 4Q5WA 2V26A 2VXFA 4M77A 4O6JA 1B7TA 3WVDB 2AKKA 4M75D 1D1BA 1D0XA 3DLMA 1Y96A 3CQTA 3GP8A 2DIQA 1QVGS 3M5AA 3OYNA 4MDWA 5LJ3j 3A8LB 3OMGA 3L42A 4OMQA 1WJSA 1X6GA 1VQ8Q 3I35A 2QGFB 3VRZA 1CKBA 3VKIA 1ABQA 4J6WA 2CS7A 2E5KA 4ELYC 2XI9A 2VGMA 1ACMB 2DRKA 1I5OB 1C1AA 2P0KA 2QK0A 2EAYA 5FRMA 1NE8A 4RTXA 2QQBA 2LTOA 3J7AF 3OYKA 4M77E 2AK5A 2HCKA 4AFQC 4OB1B 1RAGB 3M0PA 1W1FA 1PWTA 2DPPB 4BI4A 5I11A 1UTIA 2RHYA 3QBYA 3H6ZA 4MMLA 4XTWA 1NG2A 4N0AC 3RBBB 3H0FA 2LJ1A 2CSQA 2DX1A 3HRSA 2ZZDA 2GBQA 4M7DG 4FW2A 3I56Q 3JCMV 2DD4A 2QA4T 3TSZA 2EQUA 4WTOB 2WSCE 3OYLA 3JRZA 7AT1B 2KGTA 1Q86R 5A2QE 5CCAA 4NOYA 4OMNA 1T3LA 4ZTFA 3LWIA 5A0DA 1WZOA 3A8HB 1QQJA 2QGGA 3EG1A 4IURA 4C5EA 3CPWS 2QI2A 3CCVQ 3CBOA 2KI7A 2EKOA 4L59A 1IHWA 1B3QA 1PD1A 3CBPA 3C94A 2CH4A 4BD3A 1VQKQ 4FM4B 1Y07A 4BDZA 3QZ5B 2DXUA 2HQXA 2DTIA 3NGPA 3JCMg 1WXBA 4A4EA 1X75C 2EGEA 1E7OA 3CPWP 2DERA 5LJ5j 2QEXT 4VUBA 4FYVB 3CEYA 4FSXA 1X43A 1ZUKA 4KULA 2F2XA 2W0ZA 2BKDN 1XOVA 4WF2A 1Q82C 2CP7A 1XTDA 1AWJA 5KYXA 4HCBA 1TU0B 1YJNA 2JXBA 1QMCA 2P4RA 2FPEA 4ATOA 3ER0A 3OS0A 2NUPB 3CCRT 4Z88A 1AWXA 2J6FA 3C0CA 5GJWB 5LJ3f 1K9MR 3RR6A 3CCUA 1G3WA 5KE2A 2JTMA 1AOJA 4XQ3A 3QPHA 2MWOA 3MKDA 3CC2T 3GLXA 4DBFA 3EGXB 1VQ6A 3L2UA 2L3PA 5L8RE 5KH6A 1G2BA 2F1LA 3X25B 1LCKA 2LQNA 2X3WD 4KUIA 4ESRA 1HYOA 2ROTA 2MF2A 3EFRA 2QEXQ 2COZA 2PZ1A 4MDXA 1MGQA 2KE9A 2BE7D 2ED0A 1UGQB 2BZXA 4Z02A 1RAFB 1AHJB 1PD0A 1JEGA 4LDWA 4RCBA 2ZGWA 3EGDB 1YJWA 3QZ9B 1NBEB 2EFIA 2D8HA 4E7LA 4EDUA 2QQ9A 2MAMA 2WSEE 4D8DA 1RACB 2D9TA 2HDAA 3CXCP 1ZHIA 2PU9B 2YWWA 2QA4Q 2NUZA 2DL8A 1UDLA 4Y28E 2YUOA 2KXDA 3JCMh 4R55A 2K79A 5FROA 5KYUA 2RI3A 5GANg 5IT9E 2RQRA 1O75A 1EFNA 1M8MA 1RADB 3UA6A 1KHCA 2YUPA 2O9VA 2L2PA 4EPCA 5CKEA 1QVFA 3FRNA 1Q86U 4M75G 1IB8A 1Y7XA 3PGGA 4N4IA 3OYHA 2EQKA 4PFPA 1UG1A 3LGFA 1DJ7B 4C92C 1WNLA 3E2UA 2DAQA 2ZPIB 4EMHA 4DOWA 1FMVA 1TH7A 5GAMe 1B34B 2CREA 2ECZA 3MEVA 2AKLA 3I9QA 1M3CA 1ZBJA 5FWCA 2RQUA 2DVJA 4M77F 3S3MA 1QWFA 3M0RA 3CCST 2PQWA 1GL5A 3FB9A 2LQ8A 4A54A 5GAMh 2MPXC 3OBWA 2MWPA 4JJDA 1F1BB 1BI0A 1WFWA 2LT4A 1ZQ1A 1D3BA 2GQIA 4JRQA 4CC7A 1ARKA 2RM4A 2WSFE 1EX4A 1GXIE 3META 1VQ4Q 4RCCA 1RI9A 4CRIA 1S1NA 1U06A 3SB2A 2L89A 3V7CA 3KXTA 2RD1A 4KBMB 3LX7A 1OZ2A 4BI3A 4OB3B 2EKHA 4ZGJB 1QVFS 4M7DB 2AT1B 5GANj 1I81A 1E6GA 1M2OA 2JZ2A 2E64A 5D7UA 1I0CA 4DEXA 1VQNA 4IUUA 3RERA 4IIOA 1QVGA 1W6XA 1RLQC 2GTJA 4GLKA 4DBHA 2XICA 1SRLA 2DZ9A 1MHNA 3HTRA 1M1KU 3TEEA 4J6XA 2LMJA 2OAUA 3JB9I 4CC4B 2JMCA 5LJ5d 2FPDA 1X01A 1JQQA 2J6KA 2JM9A 4ZGDB 4J9BA 4JJNK 3D7SB 2EVRA 2YLBA 5GAOq 1WIEA 1YFNA 1GCPA 2QG9B 2XDPA 2HSEB 1Q86C 1FYNA 1VQ5T 2LX9A 3A8GB 2V8IA 3CCMQ 4BI8B 1PKSA 4QKUA 2CUBA 4F7UB 4EMKB 1H641 1JXMA 3JCMe 3LLRA 3OYGA 1Q81C 2EJGA 4Y91A 3CCVA 1BIAA 2EBPA 4IUQA 3CCLT 4XTXA 3GOXA 2O2OA 4M78G 2E5QA 2JOYA 3VYHB 3ME9A 3RIRA 3SD4A 3CC7Q 1AD5A 3HPWA 2XG8D 3CD6T 2EWNA 1M2VA 4DOVA 4AG1C 3ZEHA 1NLOC 4OF1A 2YXYA 3UATA 3MP8A 1VQ9Q 4PFZA 1OPLA 2CT4A 4KGZB 2P0QA 2W10A 2NUTB 3OYBA 1BK2A 2FPFA 1BIBA 1QW1A 4ANJA 1ZUYA 3ASKA 3GF5A 3UPUA 4M7DE 1YJNQ 2QAZA 4UC4A 1RLPC 4OP0A 1PC0A 1WYXA 4C0DC 3V8JA 2FYKA 2EJFA 2HSPA 3REAB 1KHIA 5IXFA 2PUKB 2VXEA 3VV0A 2O31A 3GIBA 3CMEQ 4IIMA 1SPKA 4M7AA 1K73C 1VQ6T 1UJ0A 1RAHB 2XU8A 3JSCA 1Y57A 1KD1C 2OAWA 4NL2A 2IPOB 2FZGB 3QO3A 3QIIA 4EMGA 2OJ2A 2K57A 3OYAA 5GANd 4JLIA 2EJ9A 3BE3A 4KUDK 3R6OA 3TREA 2RQWA 4NL3A 2F2VA 5HK0A 2C06A 2DNUA 3CCSA 2H3EB 4AG2C 3HRTA 1VYUA 2ENMA 3A5ZB 2HEQA 3VS7A 2K3XA 4LXCA 1KD1R 4JZ4A 2KK4A 3HFNA 2ZCFB 3OYMA 3PMTA 2FO0A 1OI1A 2XDBA 2JVVA 5J39A 4J9EA 1M1KR 2E65A 2H3JA 4HT9A 2MIOA 2J7IA 1SHFA 2P0PA 2OTLA 1YJWQ 1N5ZA 1ZSZA 4JRPA 4F17A 1S72A 3A1PA 1ZA2B 4C8QF 4E47A 3CCRA 5EC7A 1LOJA 5GAOp 4M75C 4C92A 3CC4T 1JJ2P 1QP3A 4J7FA 1OX8A 1H3HA 4FT2A 2CYZB 1K0SA 1YIJT 3QWYA 4OMFB 4AFUC 1MV3A 1WHMA 1WLPB 1SRMA 2VB6A 2K2MA 3WXMB 1X2KA 1VYTA 5GAMg 2B8AA 4DQ2A 4MMKA 1VQ7Q 2FEIA 4M78F 1KD1U 3JCMb 4C92F 3E1SA 3UA7A 1K76A 3CMAT 1AZGB 1R0BG 1V76A 4CC3A 2MCNA 4KH0B 2HMAA 3CCLQ 2JUFA 1K1ZA 4O5VA 2JW4A 3CCET 4RTZA 3OYCA 4M7AE 3CCMA 4HCCA 2HNIA 3F70A 3QHSA 2ESWA 2RHUA 5FU6B 3H0IA 2EYQA 4C0DB 4QT7A 3EG9B 2K5LA 4LN2A 3CCLA 1VIFA 4OMMA 4CI0C 2YRDA 4BE1A 2EQJA 2MOXA 4R56A 1OULA 3G71T 2XKOC 5GAMj 1ZSZC 1JO8A 2LDMA 1U8RA 2DFUA 4JRKA 2CZ0B 2E3IA 1V29B 4X9CA 4FL6A 1IO6A 1QKWA 2EIFA 2K9GA 1N8RC 1YWOA 2P4TA 4JLGA 1VQ7T 3QG1A 3MPUB 3RUXA 1HJDA 5J26A 1UGVA 2RNAA 1OU9A 4LD6A 2MYSA 3VS0A 3EGDA 4XAXB 4XTUA 3TVTA 2Y4YA 2J06A 5GAMd 4FYYB 1M5Q1 1SG5A 4BDYA 2C0TA 1VQPQ 2OX7A 5FWBA 2RMOA 1D3BB 5GAOm 4HCKA 1Q7YU 3QSUA 3JAME 5AT1B 4PLIA 1AWOA 2DTOA 3TCJA 2YRCA 5LJ3h 5FU6C 3LH5A 4J9HA 1UE9A 1NM7A 3KFVA 3S3NA 4XTZA 3CD6Q 1IHVA 3A8OB 4M77C 1T0HA 2LZ6B 2RK2A 3M9QA 3EG3A 2QXFA 4KRTA 4A53A 4QVCA 3G71Q 2YSQA 4Z89A 5FU7C 4DBRA 1M4ZA 2MK5A 4C0ZA
chains in the Genus database with same CATH topology
1VQ7Q 2OTJQ 2QEXQ 1NJIR 3CXCP 2OTLQ 3CCEQ 1VQ6Q 1YJNQ 1QVFP 3G6EQ 2QA4Q 3G4SQ 1S72Q 1YI2Q 1VQ5Q 1M90R 1JJ2P 3CCRQ 1QVGP 1W2BP 1VQNQ 3CPWP 1M1KR 3I56Q 3CD6Q 3I55Q 3CCUQ 1VQPQ 1YJ9Q 3CCJQ 3CC4Q 3CCQQ 3CCVQ 1YITQ 1Q82R 1N8RR 1VQ8Q 1VQLQ 1KQSP 1VQ4Q 1VQ9Q 1YJWQ 1YHQQ 3CMEQ 3CCLQ 1Q7YR 3CC2Q 1K73R 3G71Q 1YIJQ 1Q81R 1Q86R 3CC7Q 1VQMQ 3OW2P 1K8AR 1VQKQ 1VQOQ 1KC8R 1K9MR 3CCSQ 3CCMQ 3CMAQ 1KD1R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 Q;  2OTJ Q;  2QEX Q;  1NJI R;  3CXC P;  2OTL Q;  3CCE Q;  1VQ6 Q;  1YJN Q;  1QVF P;  3G6E Q;  2QA4 Q;  3G4S Q;  1S72 Q;  1YI2 Q;  1VQ5 Q;  1M90 R;  1JJ2 P;  3CCR Q;  1QVG P;  1W2B P;  1VQN Q;  3CPW P;  1M1K R;  3I56 Q;  3CD6 Q;  3I55 Q;  3CCU Q;  1VQP Q;  1YJ9 Q;  3CCJ Q;  3CC4 Q;  3CCQ Q;  3CCV Q;  1YIT Q;  1Q82 R;  1N8R R;  1VQ8 Q;  1VQL Q;  1KQS P;  1VQ4 Q;  1VQ9 Q;  1YJW Q;  1YHQ Q;  3CME Q;  3CCL Q;  1Q7Y R;  3CC2 Q;  1K73 R;  3G71 Q;  1YIJ Q;  1Q81 R;  1Q86 R;  3CC7 Q;  1VQM Q;  3OW2 P;  1K8A R;  1VQK Q;  1VQO Q;  1KC8 R;  1K9M R;  3CCS Q;  3CCM Q;  3CMA Q;  1KD1 R; 
#chains in the Genus database with same CATH topology
 3H8Z A;  3X26 B;  2NUP A;  3GPL A;  2E41 A;  2FRY A;  2DET A;  4C92 D;  4E7S A;  2JNG A;  5KCH A;  2YLC A;  3QJ6 A;  1YCY A;  3CD6 A;  2EGA A;  4QVZ A;  1X69 A;  2BZ8 A;  1GCQ A;  1FMW A;  2X3X D;  5LJ3 e;  2DL5 A;  2CZ6 B;  1M30 A;  1CKA A;  2KYM A;  1VQ8 A;  2MI6 A;  1SSH A;  1NEB A;  1WDX A;  3M0T A;  4LUD A;  2IIM A;  3CCJ T;  2RPN A;  1RAA B;  3M59 A;  4OB0 B;  2A28 A;  3FEO A;  3INZ A;  3EAE A;  4LE9 A;  1FXX A;  3EFO B;  4EMK A;  2GGR A;  1KQS P;  1Q95 G;  1MND A;  3FDR A;  2DD5 A;  1RAI B;  2RI2 A;  2I2L A;  2KQW A;  3RKX A;  3REB B;  3MEA A;  3HL8 A;  1VQK A;  2Y4X A;  4LD9 K;  4N0A A;  4M77 G;  4EMK C;  2DMO A;  2K4Y A;  1K8A R;  1P92 A;  3JCM W;  5ECA A;  1M90 U;  1VQ6 Q;  4M78 A;  1VQO T;  4E7K A;  1JXO A;  3JCM X;  2WAC A;  2JS0 A;  2RN8 A;  2L8D A;  3OSS C;  1EZZ B;  4JDS A;  2MMP A;  2YRV A;  1WHJ A;  2M16 A;  2ATC B;  3CME A;  3MP6 A;  1FX7 A;  2BTT A;  1VOM A;  4E2F B;  1K73 U;  4M7D D;  1W2B S;  2R5M A;  1VYV A;  1PSF A;  3C12 A;  3DB4 A;  2DE0 X;  2RH2 A;  1YJW T;  2QQA A;  1AVZ C;  5L23 A;  1R0C B;  5KYU B;  4OGE A;  1YHQ T;  5EG2 A;  3V7R A;  2XHC A;  2CP3 A;  3OW2 A;  5IAY A;  1UB4 A;  4PJO A;  2NLU A;  5D6Y A;  3HSB A;  3CCM T;  1TTH B;  3H41 A;  4M75 A;  2FHD A;  4BY6 B;  1YIJ Q;  5CKD A;  3M57 A;  2YT6 A;  1H8K A;  4FYX B;  5GMK h;  3OS5 A;  2KDS A;  3MEW A;  1M90 R;  5GAN 5;  3LWH A;  1VQO A;  1OOT A;  4DA4 A;  3CC4 Q;  4ME7 A;  4KT0 E;  2FRW A;  3MHX A;  3CCU T;  4M75 F;  1PHT A;  1R8O B;  4M7A F;  2PTK A;  2X4J A;  2LQW A;  1YIT A;  1U1T A;  1KK7 A;  2IG0 A;  5GAN f;  2P84 A;  3G4S Q;  2PNI A;  1NPR A;  4F7U E;  1KC8 C;  1MMN A;  4A63 B;  2CT3 A;  2V1R A;  5KYN A;  3SEM A;  4M78 C;  2RK1 A;  3OYF A;  4A4K A;  2JT4 A;  2XMF A;  1KC8 U;  3P8D A;  1VQL A;  1NYF A;  5GAN 8;  3JB9 H;  2QYZ A;  3M54 A;  2A37 A;  1AT1 B;  2CP0 A;  3DKM A;  3QJY A;  2QQR A;  1U1S A;  1VQ8 T;  1U3O A;  3G6E Q;  1R77 A;  2M51 A;  2VVK A;  4X1V A;  3I5R A;  3CCU Q;  1XJW B;  2OTJ T;  2D1X A;  4E7H A;  4LDV A;  5C6S A;  4AMC A;  4K11 A;  4OML A;  2HBW A;  3PTA A;  3SDZ A;  3L2W A;  2E12 A;  3VS6 A;  3UT1 A;  4C92 G;  2NYS A;  1YWP A;  3OQ5 A;  4HCZ A;  5CQX A;  4ELZ C;  3RMQ A;  2RA2 A;  4PNO A;  4M7A C;  5LJ5 g;  1Q82 U;  1GRI A;  1V1C A;  3O5Z A;  2FB7 A;  3G6E A;  4M7A B;  2EYW A;  3OYD A;  3I55 Q;  2DA9 A;  2HD0 A;  3PT9 A;  1XNI A;  1GFC A;  1VQM Q;  1I5L A;  3G6E T;  3GBQ A;  1X27 A;  3VS4 A;  2JJ9 A;  1AZE A;  1W2B A;  4C8Q G;  4ZN1 A;  2CDT A;  5HKC A;  2QTX A;  1JB0 E;  1D0Y A;  3M0Q A;  4XK8 E;  3J81 E;  3IQL A;  2KEA A;  2K5I A;  2G3R A;  3ULR B;  4B9X A;  1TUC A;  3SWN B;  3UWN A;  3NTI A;  4A4H A;  3EFO A;  1PG5 B;  1MV0 B;  2X9H A;  3EGX A;  2QAS A;  4FYW B;  2OTL Q;  2CP6 A;  3JCM J;  2KAF A;  2E6N A;  5GMK m;  1BCO A;  1NEG A;  2AIR B;  3CCE A;  2RHX A;  2LT1 A;  3JCM f;  2LX7 A;  5I22 A;  4II1 A;  4M7A D;  4N4G A;  4J9F A;  2QA4 A;  3V8L A;  4HVV A;  3M56 A;  1K9A A;  1OQK A;  3EH2 A;  3P8H A;  1A0N B;  5FRN A;  4RTT A;  2ROL A;  3U23 A;  2K5F A;  1PCX A;  1KFZ A;  1BB9 A;  4LDU A;  1YJ9 Q;  3QDF A;  3CCJ Q;  2KRN A;  2SRC A;  1VQM T;  3CBM A;  2PVG B;  1M1F A;  3R6N A;  3OYE A;  2J6O A;  2EGC A;  3VS3 A;  5KYW A;  2XK0 A;  3G4S T;  5I2M A;  2GFU A;  2V8J A;  1ABO A;  2DXC A;  5HK3 A;  2DVE A;  1WXU A;  5KYY B;  4BUG A;  1K8A U;  1JJ2 A;  4PJO E;  3PIP A;  3QUI A;  5DY9 A;  1YNZ A;  4AT1 B;  4XTY A;  2XDD A;  3OS2 A;  4FIB A;  4GBQ A;  2VWF A;  3VRY A;  5DLO A;  1N9S A;  2YDL A;  1I8F A;  1IGQ A;  3JV3 A;  2RJC A;  1PKT A;  2DTH A;  3S3O A;  1D09 B;  1PM3 A;  5IHN A;  3CPF A;  1VQP T;  1O9S A;  2F2W A;  5I21 A;  5HCK A;  1QVG P;  4LDY A;  2CGH A;  4ZGE B;  2O88 A;  2CKK A;  5FLX E;  3LGL A;  3E19 A;  1K9M U;  1UEB A;  4RG8 A;  2DRM A;  2FZC B;  3M58 A;  5IHI A;  1WXT A;  2B86 A;  2DJZ A;  2FZK B;  5M9O A;  4PJO D;  4R0K A;  3FC3 A;  2VKN A;  4XU1 A;  1WHL A;  3URG A;  1VQL T;  1Y0M A;  4JRI A;  4C8Q C;  2XID A;  2E1H A;  4QQG A;  1M27 C;  2PVO B;  4BB7 A;  2LCC A;  4CC2 A;  3RKW A;  3EFS A;  2ABL A;  1QKX A;  1QP2 A;  2O4X B;  1SKU B;  4PK4 A;  1YCS B;  3JB9 F;  1RAB B;  4ZNX A;  2DK3 A;  5GMK i;  2RQT A;  4RTY A;  4OB2 B;  2HL5 C;  1K9M C;  2KY9 A;  1WJR A;  1UGS B;  1RUW A;  5CKB A;  1G5V A;  2HL3 A;  4M7D C;  1YI2 Q;  2CP2 A;  4QVD A;  3OB9 A;  2ZPH B;  4OGC A;  2Y90 A;  3G1J A;  2COW A;  2X51 A;  3CCQ Q;  2DIG A;  2RJF A;  4M78 B;  4D6W A;  2F69 A;  2JMA A;  3RKY A;  1VIE A;  3CC2 Q;  3L2V A;  3MJX A;  8ATC B;  1IXD A;  2NWM A;  5GAN 7;  3ZL7 C;  4J9C A;  2HZY A;  1MMD A;  2O9S A;  1QWE A;  1G83 A;  3N5B B;  4X34 A;  1TOV A;  2CP5 A;  3BFM A;  1M8V A;  2AZV A;  1D1A A;  1KJW A;  4MZT A;  2LVM A;  5CAI A;  4L6V 5;  4IKF A;  3FLG A;  1M3A A;  3OY9 A;  4Y92 A;  6AT1 B;  2DL3 A;  1IRE B;  2KNB B;  2D0N A;  1IZ6 A;  1QVP A;  2K6D A;  3EHQ A;  1M1G A;  1T3S A;  5GAO r;  3SWN A;  2JS2 A;  5DM7 R;  2CUD A;  3NPF A;  4FW1 A;  3CC7 T;  2VYT A;  4J7I A;  4MZM A;  1Q7Y R;  2E4H A;  2RQV A;  3H0H A;  3T9N A;  1M1K C;  1UHC A;  4C92 B;  4JZ3 A;  1SF9 A;  2BIV A;  3QWX X;  5LJ5 e;  1SEM A;  5C0M A;  1NJI U;  1WQW A;  3E9F A;  1C6V X;  1ZBX A;  4M77 D;  2LC4 A;  1KQ1 A;  1JU5 C;  1W4S A;  3CC4 A;  3VS5 A;  2HQE A;  3I55 T;  4J9D A;  1K8A C;  2VAS A;  4LDX A;  2KT1 A;  1WHG A;  2OI3 A;  2H8H A;  1ZUU A;  2KMT A;  2QQS A;  1VA7 A;  5IN1 A;  4C8Q B;  5LJ3 d;  2I0N A;  3EH1 A;  3M0U A;  4PFO A;  2RJD A;  2DYB A;  1PSE A;  1GBQ A;  2ED1 A;  2RF0 A;  2RHZ A;  2LCS A;  3VUB A;  2GTO A;  4ZN3 A;  3SFM A;  2KVQ G;  4L5G A;  3PVQ A;  2LP5 A;  3TU4 K;  2R58 A;  4HXJ A;  5CVI A;  5DLQ E;  2YHT A;  1GBR A;  3CCR Q;  3JCM Q;  2M0Y A;  4RMO A;  4V2S A;  2X35 A;  4JPB W;  2A08 A;  1Q81 U;  5LJ5 h;  4J5Y A;  1VUB A;  3GNG A;  5GMK j;  3MCA B;  3NFC A;  4LNP A;  3HRU A;  1QCO A;  2KRM A;  5FW9 A;  1CSK A;  3NMZ C;  1VQO Q;  1KQS A;  3I56 T;  3RES A;  3G7Z A;  2OTJ A;  2DJQ A;  3QKJ A;  1BI3 A;  3ZFJ A;  4JJB A;  3MEU A;  4F7U F;  3THK A;  1PRL C;  2FVU A;  2EPD A;  3UF4 A;  1YIJ A;  3I56 A;  1QLY A;  1ZLM A;  3HFO A;  5CKH A;  4JUV A;  2D0Q B;  1TG0 A;  4HVW A;  1HXD A;  1TUG B;  2CZ7 B;  4B9W A;  4C8Q D;  3TSW A;  4XTV A;  1YI2 A;  1VQN Q;  3CCJ A;  1UFF A;  1M3B A;  2BUD A;  3H9N A;  4RTV A;  3L1A A;  3C95 A;  1E6H A;  1GFD A;  3PIO A;  1OZ3 A;  2ZPF B;  4E6R A;  3JCM c;  3X20 B;  1EIF A;  2RB6 A;  2DXT A;  1WHH A;  2VGN A;  1HK9 A;  1B07 A;  1YIT T;  3LH0 A;  3TQ7 P;  3OYI A;  2C0O A;  1VQ5 Q;  2X4W A;  3ZBD A;  1BCM A;  4PJO C;  2V1Q A;  2D6F A;  1J3T A;  4RTW A;  5LJ3 g;  1NYG A;  3SWN C;  3UDC A;  3CXC S;  4C8Q A;  1WGS A;  4JS4 A;  4N4H A;  4J9G A;  4PJM A;  5GMK l;  1NLP C;  3AHU A;  4GLM A;  4E7J A;  3PFS A;  3RMS A;  3C4S A;  3OBY A;  3OS1 A;  4HT8 A;  1AWW A;  3JB9 G;  2QEX A;  2DO3 A;  3PMI A;  1UGR B;  4M75 B;  4PKC C;  3VS2 A;  1N9R A;  5GAM f;  3SHW A;  5KYY A;  1U5S A;  1YBY A;  2VC8 A;  2ZAE A;  1X6O A;  4M7D A;  3HHT B;  3A8M B;  4J83 A;  4X9D A;  3JB9 J;  1TS9 A;  2M9U A;  3OW2 P;  4F7U G;  1VQ9 T;  1MUZ A;  3M0S A;  2EYX A;  2YUN A;  4HVU A;  3BY7 A;  1YJ9 T;  1JJ2 S;  4C8Q E;  4M4Z A;  1PNJ A;  4TVR A;  2BE9 B;  2JM8 A;  5D6W A;  1UUE A;  1WA7 A;  3VYG A;  2FL7 A;  4PJJ A;  1I07 A;  5HY6 A;  4AFS C;  1JRI A;  2QTV A;  4M7D F;  1OPK A;  1QCN A;  4RG2 A;  2DLP A;  1GCQ C;  2L3S A;  2L3Q A;  5IXB A;  1IGU A;  2D8J A;  2G6F X;  1OEB A;  5GAN h;  3JCM P;  4PJL A;  1NJI R;  1M9S A;  4FT4 A;  1NJI C;  1W2B P;  1RAE B;  3CCQ A;  4P5N A;  5LL6 S;  4JS5 A;  2KYB A;  4XU3 A;  5GJV B;  5KYW B;  1Q82 R;  4IUV A;  1UJY A;  3CC2 A;  2DBM A;  1MMA A;  4C92 E;  2DM1 A;  2K2V A;  4C0F A;  5LJ5 f;  1OX9 A;  4RTU A;  1KSW A;  2DEQ A;  4F14 A;  4QW2 A;  3KBG A;  2O4X A;  2K7A A;  1TUD A;  2VV5 A;  5GAN 6;  4BE0 A;  4A4F A;  2R5A A;  3G71 A;  2XD0 A;  4PJO F;  1Y96 B;  4BE2 A;  2HAX A;  1VQL Q;  2VUB A;  5GMK e;  2HQH A;  2YUQ A;  2LNH B;  2LRQ A;  1JBM A;  4M77 B;  3QYG B;  4J6Y A;  3OYJ A;  3RNJ A;  1VQM A;  1BI2 A;  2K3B A;  4F04 B;  2DXB A;  1G3Y A;  1N8R U;  5FU7 B;  1ZA1 B;  1ZX6 A;  3CC7 A;  2E10 A;  3QYH B;  5GAN 2;  4F16 A;  3OW2 S;  2F5T X;  5A0G A;  3VS1 A;  2GCX A;  3FJ5 A;  3V8K A;  2A0F B;  2KSS A;  2EYY A;  1K73 R;  1UEC A;  2M02 A;  2KRS A;  5A0L A;  1BU1 A;  4PL6 A;  2SEM A;  3MP1 A;  2X4X A;  2RO0 A;  3OA6 A;  3PVL A;  5CIU A;  2EW3 A;  2JN0 A;  2K3Y A;  3P8B B;  1LVK A;  2DIL A;  2C0I A;  2RJE A;  2HKN A;  2KT8 A;  4J9I A;  1YHQ Q;  1X6B A;  2J05 A;  3I5S A;  4M78 E;  1XQH A;  2CZ1 B;  2E3H A;  2JTF A;  4QQ6 A;  5KYX B;  1SHG A;  1YI2 T;  2DEU A;  4BAC A;  2LNV A;  3OYY A;  4B6M A;  3CCQ T;  4OMP A;  2DZC A;  1G3T A;  2COY A;  1VQ4 T;  3WVE B;  4D8K A;  1VQ5 A;  1B34 A;  1LJO A;  4GY5 A;  4KGV B;  3VU3 C;  4FSS A;  3E9G A;  1G3S A;  2X4Y A;  3L2R A;  1OYX A;  5CKF A;  1KIK A;  5CO7 A;  1KC8 R;  3BW1 A;  1VQ4 A;  2F5K A;  1MNE A;  1MMG A;  4MZP A;  1Z9Z A;  3CCE Q;  5J3B A;  2NUT A;  1FWZ A;  5D6X A;  1KQ2 A;  3L2Z A;  2KBT A;  3NTK A;  4OMO A;  1WQ7 A;  5AYF A;  5GAO l;  5CR2 A;  1WHK A;  3KUF A;  3VJP A;  3OSV A;  4DBQ A;  4PJO G;  3S6W A;  4M78 D;  1NZ9 A;  3J80 E;  2QDY B;  1QVF P;  4PJO B;  2GNC A;  1FMK A;  4OVA A;  2V8K A;  1YP5 A;  3EG2 A;  2OTL T;  2QDL A;  1H3Z A;  4LUE A;  1T0J A;  1VQN T;  3BDL A;  1H92 A;  4PJN A;  1G8X A;  1IRX A;  1UHF A;  4EIK A;  2ZPB B;  3GNF B;  1LNX A;  1NPP A;  3EHR A;  4AFZ C;  3OMC A;  3DB3 A;  3HP9 A;  2JTE A;  2DL4 A;  5GAN 4;  1X2Q A;  2DYI A;  4IUT A;  9ATC B;  1N27 A;  2CSI A;  1M90 C;  1VQ7 A;  1WPY A;  2EYZ A;  3BDU A;  2ZPG B;  4RUG A;  1QCF A;  3L2Q A;  1VQK T;  1HD3 A;  1SSF A;  3G4S A;  2DL7 A;  1KQS S;  2O01 E;  4ORZ A;  3LW5 E;  3M4G A;  1VQ9 A;  3CCV T;  1K0X A;  2OTJ Q;  1TSF A;  3JB9 D;  2L0A A;  3CME T;  4C5G A;  3M4Y A;  1N8R R;  4F7U A;  1N6A A;  3PNW C;  3M55 A;  1W70 A;  3AT1 B;  1C0M A;  5IHK A;  5GAO n;  3A98 A;  1Z9Q A;  2L5Q A;  2EQI A;  1Q7Y C;  4HA8 A;  4FCY A;  1Y71 A;  2E70 A;  1D1C A;  2DF6 A;  3CXC A;  1RI0 A;  1HSQ A;  2M1H A;  1PRM C;  3HKS A;  3QDR B;  4Z8A A;  1OV3 A;  3Q1J A;  1BYM A;  5KCO A;  4E7Z A;  3JCM d;  2LQK A;  2ZPE B;  2A36 A;  2EQM A;  1I1J A;  2IVW A;  5CQY A;  2CH4 W;  1ZSZ B;  3NHN A;  1K4U S;  3X28 B;  2GF7 A;  4M75 E;  2AHJ B;  2PUO B;  4DEY A;  4C5H A;  2HKQ B;  3MO8 A;  4JJC A;  4YTL A;  5CK9 A;  1D0Z A;  1TWB A;  4RKU E;  1YIT Q;  4KGX B;  2R57 A;  8AT1 B;  3NTH A;  2KXC A;  1YHQ A;  2BZY A;  2DKG A;  4XU0 A;  2RI5 A;  1VQP A;  1Q81 R;  2LCL A;  4C5I A;  3DLL A;  1ZSG A;  1BBZ A;  4E7I A;  3EG9 A;  1OU8 A;  2A3L A;  3CMA A;  3CCS Q;  2KR3 A;  2FG0 A;  2E6Z A;  4WCI A;  1UGP B;  1S72 Q;  1I4K 1;  4FU6 A;  1KG1 A;  1BI1 A;  3RDV A;  4M7A G;  1TXQ A;  3O8V A;  1WX6 A;  2GQV A;  2PVD B;  3EGU A;  1M2V B;  3CPW A;  3FIF A;  4C0G A;  3CMA Q;  1WI7 A;  4A4G A;  2A7Y A;  3V7S A;  3M53 A;  1YN8 A;  3QXE B;  5KE3 A;  3X24 B;  3VUZ A;  4NS5 A;  4XU2 A;  5GAN 3;  1YJN T;  2LJ3 A;  4J8O A;  2Z0W A;  5IH2 A;  4KH1 B;  1RL2 A;  4ZTJ A;  3PE0 A;  1BKB A;  2M0O A;  5GAN e;  5I2S A;  1WJQ A;  2AZS A;  4BY6 C;  1LPL A;  3EG0 A;  3I55 A;  2KRO A;  2HBP A;  1S72 T;  2DBK A;  1YJ9 A;  4QQD A;  1AEY A;  3LYI A;  4HKE A;  2GFA A;  4PLL A;  2RHI A;  2LJ0 A;  3FJP A;  2L3R A;  4IUP A;  4Q5W A;  2V26 A;  2VXF A;  4M77 A;  4O6J A;  1B7T A;  3WVD B;  2AKK A;  4M75 D;  1D1B A;  1D0X A;  3DLM A;  1Y96 A;  3CQT A;  3GP8 A;  2DIQ A;  1QVG S;  3M5A A;  3OYN A;  4MDW A;  5LJ3 j;  3A8L B;  3OMG A;  3L42 A;  4OMQ A;  1WJS A;  1X6G A;  1VQ8 Q;  3I35 A;  2QGF B;  3VRZ A;  1CKB A;  3VKI A;  1ABQ A;  4J6W A;  2CS7 A;  2E5K A;  4ELY C;  2XI9 A;  2VGM A;  1ACM B;  2DRK A;  1I5O B;  1C1A A;  2P0K A;  2QK0 A;  2EAY A;  5FRM A;  1NE8 A;  4RTX A;  2QQB A;  2LTO A;  3J7A F;  3OYK A;  4M77 E;  2AK5 A;  2HCK A;  4AFQ C;  4OB1 B;  1RAG B;  3M0P A;  1W1F A;  1PWT A;  2DPP B;  4BI4 A;  5I11 A;  1UTI A;  2RHY A;  3QBY A;  3H6Z A;  4MML A;  4XTW A;  1NG2 A;  4N0A C;  3RBB B;  3H0F A;  2LJ1 A;  2CSQ A;  2DX1 A;  3HRS A;  2ZZD A;  2GBQ A;  4M7D G;  4FW2 A;  3I56 Q;  3JCM V;  2DD4 A;  2QA4 T;  3TSZ A;  2EQU A;  4WTO B;  2WSC E;  3OYL A;  3JRZ A;  7AT1 B;  2KGT A;  1Q86 R;  5A2Q E;  5CCA A;  4NOY A;  4OMN A;  1T3L A;  4ZTF A;  3LWI A;  5A0D A;  1WZO A;  3A8H B;  1QQJ A;  2QGG A;  3EG1 A;  4IUR A;  4C5E A;  3CPW S;  2QI2 A;  3CCV Q;  3CBO A;  2KI7 A;  2EKO A;  4L59 A;  1IHW A;  1B3Q A;  1PD1 A;  3CBP A;  3C94 A;  2CH4 A;  4BD3 A;  1VQK Q;  4FM4 B;  1Y07 A;  4BDZ A;  3QZ5 B;  2DXU A;  2HQX A;  2DTI A;  3NGP A;  3JCM g;  1WXB A;  4A4E A;  1X75 C;  2EGE A;  1E7O A;  3CPW P;  2DER A;  5LJ5 j;  2QEX T;  4VUB A;  4FYV B;  3CEY A;  4FSX A;  1X43 A;  1ZUK A;  4KUL A;  2F2X A;  2W0Z A;  2BKD N;  1XOV A;  4WF2 A;  1Q82 C;  2CP7 A;  1XTD A;  1AWJ A;  5KYX A;  4HCB A;  1TU0 B;  1YJN A;  2JXB A;  1QMC A;  2P4R A;  2FPE A;  4ATO A;  3ER0 A;  3OS0 A;  2NUP B;  3CCR T;  4Z88 A;  1AWX A;  2J6F A;  3C0C A;  5GJW B;  5LJ3 f;  1K9M R;  3RR6 A;  3CCU A;  1G3W A;  5KE2 A;  2JTM A;  1AOJ A;  4XQ3 A;  3QPH A;  2MWO A;  3MKD A;  3CC2 T;  3GLX A;  4DBF A;  3EGX B;  1VQ6 A;  3L2U A;  2L3P A;  5L8R E;  5KH6 A;  1G2B A;  2F1L A;  3X25 B;  1LCK A;  2LQN A;  2X3W D;  4KUI A;  4ESR A;  1HYO A;  2ROT A;  2MF2 A;  3EFR A;  2QEX Q;  2COZ A;  2PZ1 A;  4MDX A;  1MGQ A;  2KE9 A;  2BE7 D;  2ED0 A;  1UGQ B;  2BZX A;  4Z02 A;  1RAF B;  1AHJ B;  1PD0 A;  1JEG A;  4LDW A;  4RCB A;  2ZGW A;  3EGD B;  1YJW A;  3QZ9 B;  1NBE B;  2EFI A;  2D8H A;  4E7L A;  4EDU A;  2QQ9 A;  2MAM A;  2WSE E;  4D8D A;  1RAC B;  2D9T A;  2HDA A;  3CXC P;  1ZHI A;  2PU9 B;  2YWW A;  2QA4 Q;  2NUZ A;  2DL8 A;  1UDL A;  4Y28 E;  2YUO A;  2KXD A;  3JCM h;  4R55 A;  2K79 A;  5FRO A;  5KYU A;  2RI3 A;  5GAN g;  5IT9 E;  2RQR A;  1O75 A;  1EFN A;  1M8M A;  1RAD B;  3UA6 A;  1KHC A;  2YUP A;  2O9V A;  2L2P A;  4EPC A;  5CKE A;  1QVF A;  3FRN A;  1Q86 U;  4M75 G;  1IB8 A;  1Y7X A;  3PGG A;  4N4I A;  3OYH A;  2EQK A;  4PFP A;  1UG1 A;  3LGF A;  1DJ7 B;  4C92 C;  1WNL A;  3E2U A;  2DAQ A;  2ZPI B;  4EMH A;  4DOW A;  1FMV A;  1TH7 A;  5GAM e;  1B34 B;  2CRE A;  2ECZ A;  3MEV A;  2AKL A;  3I9Q A;  1M3C A;  1ZBJ A;  5FWC A;  2RQU A;  2DVJ A;  4M77 F;  3S3M A;  1QWF A;  3M0R A;  3CCS T;  2PQW A;  1GL5 A;  3FB9 A;  2LQ8 A;  4A54 A;  5GAM h;  2MPX C;  3OBW A;  2MWP A;  4JJD A;  1F1B B;  1BI0 A;  1WFW A;  2LT4 A;  1ZQ1 A;  1D3B A;  2GQI A;  4JRQ A;  4CC7 A;  1ARK A;  2RM4 A;  2WSF E;  1EX4 A;  1GXI E;  3MET A;  1VQ4 Q;  4RCC A;  1RI9 A;  4CRI A;  1S1N A;  1U06 A;  3SB2 A;  2L89 A;  3V7C A;  3KXT A;  2RD1 A;  4KBM B;  3LX7 A;  1OZ2 A;  4BI3 A;  4OB3 B;  2EKH A;  4ZGJ B;  1QVF S;  4M7D B;  2AT1 B;  5GAN j;  1I81 A;  1E6G A;  1M2O A;  2JZ2 A;  2E64 A;  5D7U A;  1I0C A;  4DEX A;  1VQN A;  4IUU A;  3RER A;  4IIO A;  1QVG A;  1W6X A;  1RLQ C;  2GTJ A;  4GLK A;  4DBH A;  2XIC A;  1SRL A;  2DZ9 A;  1MHN A;  3HTR A;  1M1K U;  3TEE A;  4J6X A;  2LMJ A;  2OAU A;  3JB9 I;  4CC4 B;  2JMC A;  5LJ5 d;  2FPD A;  1X01 A;  1JQQ A;  2J6K A;  2JM9 A;  4ZGD B;  4J9B A;  4JJN K;  3D7S B;  2EVR A;  2YLB A;  5GAO q;  1WIE A;  1YFN A;  1GCP A;  2QG9 B;  2XDP A;  2HSE B;  1Q86 C;  1FYN A;  1VQ5 T;  2LX9 A;  3A8G B;  2V8I A;  3CCM Q;  4BI8 B;  1PKS A;  4QKU A;  2CUB A;  4F7U B;  4EMK B;  1H64 1;  1JXM A;  3JCM e;  3LLR A;  3OYG A;  1Q81 C;  2EJG A;  4Y91 A;  3CCV A;  1BIA A;  2EBP A;  4IUQ A;  3CCL T;  4XTX A;  3GOX A;  2O2O A;  4M78 G;  2E5Q A;  2JOY A;  3VYH B;  3ME9 A;  3RIR A;  3SD4 A;  3CC7 Q;  1AD5 A;  3HPW A;  2XG8 D;  3CD6 T;  2EWN A;  1M2V A;  4DOV A;  4AG1 C;  3ZEH A;  1NLO C;  4OF1 A;  2YXY A;  3UAT A;  3MP8 A;  1VQ9 Q;  4PFZ A;  1OPL A;  2CT4 A;  4KGZ B;  2P0Q A;  2W10 A;  2NUT B;  3OYB A;  1BK2 A;  2FPF A;  1BIB A;  1QW1 A;  4ANJ A;  1ZUY A;  3ASK A;  3GF5 A;  3UPU A;  4M7D E;  1YJN Q;  2QAZ A;  4UC4 A;  1RLP C;  4OP0 A;  1PC0 A;  1WYX A;  4C0D C;  3V8J A;  2FYK A;  2EJF A;  2HSP A;  3REA B;  1KHI A;  5IXF A;  2PUK B;  2VXE A;  3VV0 A;  2O31 A;  3GIB A;  3CME Q;  4IIM A;  1SPK A;  4M7A A;  1K73 C;  1VQ6 T;  1UJ0 A;  1RAH B;  2XU8 A;  3JSC A;  1Y57 A;  1KD1 C;  2OAW A;  4NL2 A;  2IPO B;  2FZG B;  3QO3 A;  3QII A;  4EMG A;  2OJ2 A;  2K57 A;  3OYA A;  5GAN d;  4JLI A;  2EJ9 A;  3BE3 A;  4KUD K;  3R6O A;  3TRE A;  2RQW A;  4NL3 A;  2F2V A;  5HK0 A;  2C06 A;  2DNU A;  3CCS A;  2H3E B;  4AG2 C;  3HRT A;  1VYU A;  2ENM A;  3A5Z B;  2HEQ A;  3VS7 A;  2K3X A;  4LXC A;  1KD1 R;  4JZ4 A;  2KK4 A;  3HFN A;  2ZCF B;  3OYM A;  3PMT A;  2FO0 A;  1OI1 A;  2XDB A;  2JVV A;  5J39 A;  4J9E A;  1M1K R;  2E65 A;  2H3J A;  4HT9 A;  2MIO A;  2J7I A;  1SHF A;  2P0P A;  2OTL A;  1YJW Q;  1N5Z A;  1ZSZ A;  4JRP A;  4F17 A;  1S72 A;  3A1P A;  1ZA2 B;  4C8Q F;  4E47 A;  3CCR A;  5EC7 A;  1LOJ A;  5GAO p;  4M75 C;  4C92 A;  3CC4 T;  1JJ2 P;  1QP3 A;  4J7F A;  1OX8 A;  1H3H A;  4FT2 A;  2CYZ B;  1K0S A;  1YIJ T;  3QWY A;  4OMF B;  4AFU C;  1MV3 A;  1WHM A;  1WLP B;  1SRM A;  2VB6 A;  2K2M A;  3WXM B;  1X2K A;  1VYT A;  5GAM g;  2B8A A;  4DQ2 A;  4MMK A;  1VQ7 Q;  2FEI A;  4M78 F;  1KD1 U;  3JCM b;  4C92 F;  3E1S A;  3UA7 A;  1K76 A;  3CMA T;  1AZG B;  1R0B G;  1V76 A;  4CC3 A;  2MCN A;  4KH0 B;  2HMA A;  3CCL Q;  2JUF A;  1K1Z A;  4O5V A;  2JW4 A;  3CCE T;  4RTZ A;  3OYC A;  4M7A E;  3CCM A;  4HCC A;  2HNI A;  3F70 A;  3QHS A;  2ESW A;  2RHU A;  5FU6 B;  3H0I A;  2EYQ A;  4C0D B;  4QT7 A;  3EG9 B;  2K5L A;  4LN2 A;  3CCL A;  1VIF A;  4OMM A;  4CI0 C;  2YRD A;  4BE1 A;  2EQJ A;  2MOX A;  4R56 A;  1OUL A;  3G71 T;  2XKO C;  5GAM j;  1ZSZ C;  1JO8 A;  2LDM A;  1U8R A;  2DFU A;  4JRK A;  2CZ0 B;  2E3I A;  1V29 B;  4X9C A;  4FL6 A;  1IO6 A;  1QKW A;  2EIF A;  2K9G A;  1N8R C;  1YWO A;  2P4T A;  4JLG A;  1VQ7 T;  3QG1 A;  3MPU B;  3RUX A;  1HJD A;  5J26 A;  1UGV A;  2RNA A;  1OU9 A;  4LD6 A;  2MYS A;  3VS0 A;  3EGD A;  4XAX B;  4XTU A;  3TVT A;  2Y4Y A;  2J06 A;  5GAM d;  4FYY B;  1M5Q 1;  1SG5 A;  4BDY A;  2C0T A;  1VQP Q;  2OX7 A;  5FWB A;  2RMO A;  1D3B B;  5GAO m;  4HCK A;  1Q7Y U;  3QSU A;  3JAM E;  5AT1 B;  4PLI A;  1AWO A;  2DTO A;  3TCJ A;  2YRC A;  5LJ3 h;  5FU6 C;  3LH5 A;  4J9H A;  1UE9 A;  1NM7 A;  3KFV A;  3S3N A;  4XTZ A;  3CD6 Q;  1IHV A;  3A8O B;  4M77 C;  1T0H A;  2LZ6 B;  2RK2 A;  3M9Q A;  3EG3 A;  2QXF A;  4KRT A;  4A53 A;  4QVC A;  3G71 Q;  2YSQ A;  4Z89 A;  5FU7 C;  4DBR A;  1M4Z A;  2MK5 A;  4C0Z A; 
#chains in the Genus database with same CATH homology
 1VQ7 Q;  2OTJ Q;  2QEX Q;  1NJI R;  3CXC P;  2OTL Q;  3CCE Q;  1VQ6 Q;  1YJN Q;  1QVF P;  3G6E Q;  2QA4 Q;  3G4S Q;  1S72 Q;  1YI2 Q;  1VQ5 Q;  1M90 R;  1JJ2 P;  3CCR Q;  1QVG P;  1W2B P;  1VQN Q;  3CPW P;  1M1K R;  3I56 Q;  3CD6 Q;  3I55 Q;  3CCU Q;  1VQP Q;  1YJ9 Q;  3CCJ Q;  3CC4 Q;  3CCQ Q;  3CCV Q;  1YIT Q;  1Q82 R;  1N8R R;  1VQ8 Q;  1VQL Q;  1KQS P;  1VQ4 Q;  1VQ9 Q;  1YJW Q;  1YHQ Q;  3CME Q;  3CCL Q;  1Q7Y R;  3CC2 Q;  1K73 R;  3G71 Q;  1YIJ Q;  1Q81 R;  1Q86 R;  3CC7 Q;  1VQM Q;  3OW2 P;  1K8A R;  1VQK Q;  1VQO Q;  1KC8 R;  1K9M R;  3CCS Q;  3CCM Q;  3CMA Q;  1KD1 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...