2EIFA

Eukaryotic translation initiation factor 5a from methanococcus jannaschii
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
133
structure length
133
Chain Sequence
b'MVIIMPGTKQVNVGSLKVGQYVMIDGVPCEIVDISVSKPGKHGGAKARVVGIGIFEKVKKEFVAPTSSKVEVPIIDRRKGQVLAIMGDMVQIMDLQTYETLELPIPEGIEGLEPGGEVEYIEAVGQYKITRVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (EUKARYOTIC TRANSLATION INITIATION FACTOR 5A)
molecule tags Gene regulation
source organism Methanocaldococcus jannaschii
publication title Crystal structures of eukaryotic translation initiation factor 5A from Methanococcus jannaschii at 1.8 A resolution.
pubmed doi rcsb
total genus 23
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 1998-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2eifA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2eifA02
2VS1A 1MJEA 4LFBL 1CSQA 1A63A 3KJPA 3CCRA 3A5ZB 2NN6I 1KRTA 3DLLA 1XJVA 1PH7A 4IFDI 4C3IH 2OTLT 3IRBA 4R1JA 1PYBA 3OW2A 1MKHA 5IYBH 2V1CC 1VS0A 2UUCL 1VQIA 1VQ7A 3OTOL 1VQAA 3KFUA 1X54A 2UXDQ 1VQ5T 2BA0A 2BH8A 2YTVA 2YTYA 2MNAA 4JBWA 4LF8Q 1MIUA 5GROA 4JI1Q 1MJCA 5IYBG 4LWCA 2JA5H 4K0KL 4QIWE 2QA4A 5IE8A 2R7ZH 1VQLT 2Q2IA 3EIVA 3CC7A 1M90U 2DGYA 1CSPA 2MWPA 3CCMA 3M9BA 3OTOQ 3F2CA 4GKJQ 3CCQA 5IYCG 2ALYB 5LMNW 2ZJRA 3BZKA 3K7AH 4OXPA 4DR2L 1ASYA 4IPGA 4HJ9A 4DR5Q 1PVOA 1Y14B 3I4MH 1LM0A 2JK8A 4TVAB 4X64L 2UXBQ 5C3EG 1VQ6T 2K5HA 4JV5L 2EIFA 2KCMA 4APVA 1S3OA 1YVCA 4H02A 4A3JH 2Q2TA 1WCMH 4B3TL 1VQ4A 3PF4A 4A3EH 4LFBQ 2VUMH 1YJNA 1FL0A 3CMEA 4GN4B 5C3EH 4IPDA 1UE5A 4GKKL 1NPRA 4YCVA 3KJOA 2A1AA 4GLVB 4A3FG 5GAGC 1NJIC 5IWAQ 4DV7L 3J7AF 4HIKA 2K14A 1EWIA 3PUZA 4OO1G 3T1YL 4L5TA 4JI7L 1SSFA 4OWWB 4JI8Q 1VQDA 3CCJT 4C3JH 3F8TA 3CAMA 3D0FA 4MTNA 3M4OH 4QGUA 1Q8KA 1TWFH 1YJWT 1GVPA 1FGUA 1W2BS 2CWPA 4DR4Q 3ZJYC 4X62L 3VDYA 1P8LA 4PZ6A 5IP9H 5FJ8H 4GOPB 4A3MH 4JI7Q 2IHEA 1Q7YU 2ZM6L 5M3FH 3A0JA 1JJ2S 3S2DH 2ASBA 1QVFS 3FP9A 2Z6KA 4GNXC 4DR7L 1Q7YC 2JJQA 1CUKA 5JJKA 1X56A 4DK6C 1SRUA 1N33L 5ELOA 4DV4Q 4OO1I 2IY5B 1YHQA 5JEAJ 1OTCA 1XMOQ 2I5MX 4R4IA 1E7ZA 3I2ZA 3PUXA 4R4OA 1VCIA 2XHCA 2JVVA 1PH2A 1VQJA 1VQ8A 1BBWA 1CKOA 1NMFA 3AQQA 1HR0W 2OCEA 2NVXH 1FVIA 1E3PA 3I56T 2HIVA 5M5XH 4LFCQ 1QVCA 3LGJA 1N9WA 3TEHB 1XNRQ 1GKHA 2DUDA 4IPCA 4A93G 3KF6B 1YHQT 4LF4Q 5C4JH 2F4VQ 4X64Q 1PH9A 2JA5G 3U4ZA 4B3SL 3CPWA 4A3CG 4B3RL 1Y1VH 1Q82C 3M4PA 4DV6Q 3HOZG 1Q46A 3TRZA 1YI2A 3I7FA 1I6HH 1KQSS 1K83H 1BKBA 1BVSA 2IT1A 1X55A 3J80i 1OXXK 1V9PA 3BZCA 1KC8U 2ZTCA 3GDEA 3GTPH 3S14H 4EX5A 4A3GH 2UXDL 1EQQA 4DV6L 3TS0A 3UE0A 4IO9A 1EQRA 3FHWA 4C3HH 1X9NA 4JI2L 5IP7G 1N36L 2HT1A 3H15A 3DM3A 2IX1A 2CQOA 5M5YH 2ZTDA 4OWTB 5LMUQ 1ASZA 5M3MH 1XPRA 1V1QA 5IAYA 4J15A 2I5HA 3AFPA 4DUYQ 3KYHC 5M3MG 1YJ9T 3PF5A 1HNXQ 3CCST 4JC0A 4X65Q 1Q1BA 1YZ6A 3K80C 3J81j 2R7DA 4JBMA 1UE1A 1B8AA 4JV5Q 3CMAT 1XNQQ 2B63H 3W5OA 1SFOH 4X6AH 3G71A 1QVGS 4A4IA 4ME3A 4PZ7A 3T1HL 1PH3A 2LSSA 3S1QH 2CWAA 4P73A 3M85A 4LF9L 4DV5Q 1XTDA 2KVQG 1JMCA 1NMGA 2K75A 4JI6Q 2JA6G 3G48A 4EQ5A 5HY6A 4DPGA 2UU9L 2RCNA 3W1BA 4JOIC 4DR1L 3AYHB 2JA7G 5IT9E 2N8NA 1IBMQ 1C7YA 2UUAL 3CC2A 4NXMQ 3RN2A 1KIXA 1VQBA 2QEXT 4DV0L 1YITT 2KBNA 1VQNT 2FXQA 2NVTH 2D62A 2VL6A 5JJIA 4JBKA 1WOCA 2AMCB 3GTGH 5FLMH 1PH1A 2Z0SA 1VQ4T 4B3MQ 1YJNT 1VQGA 4DAMA 4YTLA 3HOXH 1XMQL 1J5EL 2R93G 1HZ9A 3ULLA 4AH6A 1X65A 2DO3A 1L1OC 2MFIA 3H0GH 1N33Q 3HOWG 2KENA 1VQNA 1M1KC 4DV4L 1E1TA 4BY1G 3ICEA 2PNHA 2WP8J 4QY7A 1SLJA 2BA1A 2UXCQ 4DAYB 2ATWA 3HOVH 1VQLA 4DK3C 1NBWA 4POGA 1A8VA 1M1GA 1J6QA 4A3IG 3CCQT 1UEBA 3FKIH 4BBRG 1EFWA 3ULJA 1IYJB 2E70A 1K0RA 2Z6KC 1W2BA 1TWCH 2K52A 4GNXA 2E5LL 2UUBL 2PMZE 2NN6G 1Q1EA 4GLXA 4UPAA 3HOUG 4DR4L 4BA2I 1YIJT 3CQZH 4HJ7A 1G51A 3HOUH 1IXRA 1JE5A 3K0XA 5IY0A 3STBD 1EYGA 4LF6L 4KHPL 3PGZA 2KHIA 4LF8L 2OQKA 1PH5A 3RLFA 1L1OB 1NE3A 4POFA 3G6ET 4WJ4A 1X3GA 4BBSG 4JI5Q 4GN5A 3HOVG 2N49A 2MO1A 5GAHC 4JI0L 4FDBA 4QQDA 1XMQQ 1J5EQ 3H0GG 3HOWH 1WFQA 4YCWA 4RG1A 4PMWA 4NPSA 1Y1WG 2K5VA 4DUYL 3G6EA 1EUJA 1RIPA 1PHJA 1E24A 4YHHQ 1E22A 1UWVA 2GN5A 3LGFA 3RLNA 4GOPA 1PA6A 3CCLT 2JEBI 3S24A 2IX0A 4NXNQ 1IBML 5C44G 1HNZQ 4DV1L 2UUAQ 3DB3A 3JAME 3H3VI 3NBHB 4PZ8A 4JI1L 3HOZH 4GOPC 2Q2UA 4HJ5A 4K0KQ 2ZTEA 4LF9Q 4A3LH 1RL2A 4MZ9A 4RMFA 4X66L 1HR0L 2OTJA 4A93H 2F52A 1N34Q 3CCUA 3CCLA 4HIMA 3PV0A 1OXTA 1VQFA 2JA8H 3I56A 2VQEL 4IPHA 3P8BB 4IOCA 3CCSA 2HIXA 1N32Q 4HJAA 2LXJA 2JE6I 2K50A 1GD7A 5A2QE 3CCVT 1K3RA 2A8VA 1K9MC 3KF6A 2L3RA 4JI0Q 3L0OA 3PUYA 1YNXA 1I94Q 1VQPT 2I0QA 3KF8B 3CCRT 2WFWA 1XPOA 3OYYA 3ERSX 3AEVA 1XMOL 1VQ9A 1SMXA 1N8RC 2L15A 5HGQA 1N36Q 3J7A5 2PI2A 1Q86U 4R4QA 3D31A 1KD1U 1VQMT 5IYDH 2WAQG 5IP9G 4A3MG 2ZM6Q 2ID0A 5C0XI 3K8AA 5IYCH 4DV1Q 2VNUD 2R6GA 1TXYA 3U58A 4DR1Q 4BY7G 3SGIA 2UUCQ 3BJUA 2YU9H 3M3YH 2MQHA 2PI2E 4A3FH 1FJGQ 1VQMA 4ZN1A 1Z9FA 3UDFA 3T1YQ 3PO2H 5IP7H 4ZN3A 3CMAA 1D7QA 3NENA 3TREA 3EN2A 3G71T 4LFCL 1KL9A 2VUMG 4LF7Q 3LH0A 2YYZA 4AQYQ 3L7ZC 1KRSA 3S2HH 2VW9A 4DR6L 4O2DA 5FLXE 4DUZL 1I94L 1S72T 1AE2A 2OTLA 3CPFA 1E1OA 3K7UC 1PH8A 4R4TA 1VQCA 3KDFA 2NVYH 1B7YB 1TWHH 4P72A 1K8AC 3GTMH 1IBKL 4BXXH 3CC2T 5AJ3L 4YY3Q 2JOYA 2KDSA 2QEXA 1EOVA 1YITA 3HFZB 4JOIA 2BH2A 3KLWA 3J80E 1K8AU 4A75A 3RR5A 1IBLL 4IOAA 2E5LQ 2R92H 4X66Q 2QA4T 5FJ8G 3CCJA 3RN5A 3CC7T 1WJJA 3JAMi 3CCMT 3I4NG 2EXDA 1YJWA 1HNWL 4KI0A 1LUZA 3BU2A 5C4XG 4HIDA 2HQLA 3GTOH 3I55T 4LUOA 1IZ6A 4DV5L 4JI6L 3PIOA 1SR3A 2K4KA 2B29A 2D0OA 1JB7A 4LF4L 2F4VL 1T9HA 1NY4A 3HKSA 2WAQE 1P16A 2Q2HA 2VZAA 1GO3E 4LUZA 5IYDG 5DM7R 4HJ8A 1XNQL 1A62A 3M7NA 1PH4A 1NTGA 3T1HQ 3MXNB 1X3FA 2XGTA 3CW2C 1U0LA 3OW2S 1OXUA 2XTIA 1CKNB 1VQOT 4QL5A 4X65L 4A3BG 4GNXB 4JI2Q 3ER0A 1WCMG 3JC66 2D0PA 5C0XJ 4ALPA 1N32L 5C4XH 2MI6A 3PO2G 2ZJPA 1M1KU 4KLKA 2CKKA 5LMUL 4TVRA 1NJIU 3U4VA 3UDIA 3NEMA 5LMNQ 3Q8DA 1U5KA 2R92G 2R7FA 2AKWB 4OWXB 2B3GA 3RLOA 5IT9c 1VQKT 5C44H 4WJ3M 1W3SA 1BBUA 1VQEA 4HIOA 2UU9Q 4LFAQ 2R7ZG 4B3RQ 2E6ZA 1WI5A 1HZCA 1V43A 1IBKQ 5J26A 2LQ8A 3PSIA 4C2MH 2Y0SE 5AJ3Q 4TQUS 4DV3L 1Y1VG 4QJFA 2JA9A 1L0WA 4JYAL 4JG2A 4DNIA 4IJHA 4DV2Q 4YWKA 5GAEC 1A0IA 4A3KH 3GTKH 3H3VH 1XPUA 1XNRL 5BR8Q 4MNOA 1I5FA 1VQ8T 4A3JG 1Q82U 2PQAA 1KXLA 4A3DG 3I4MG 5C0XG 3S1NH 4JI5L 1UE6A 2MWOA 1D8LA 5BR8L 2K5NA 4LF7L 1B70B 1JJCB 1I50H 1YHBA 4B3ML 1GM5A 2NZHA 3S17H 2OTJT 2ZJQA 4P75A 4LF6Q 4GKJL 4JI3L 3K81C 3CCUT 4KHPQ 5K36G 2A19A 1K9MU 4GN3B 2JA7H 2IG0A 2VQFL 3J7ZC 1H95A 2UUBQ 3B6YA 4X62Q 3STBC 3HOYG 2N3SA 1CKMA 4DR3L 4LFAL 2VY3A 2UXCL 3GD7A 3PUWA 4JI8L 2F3IA 4BY7H 3CC4T 1SN8A 1JT8A 1VQ7T 3TQYA 1VQPA 2OQ0A 1K8GA 4A3DH 1QUQA 2QGQA 4BXXG 2GVAA 4KHZA 5ELNA 5M5WH 2B63G 1TWAH 1VQ9T 2UXBL 3J81i 4OX9Q 4GKKQ 1YJ9A 1S72A 3KDFB 4IFDG 3PO3G 2GVBA 1SE8A 1KC8C 2CCZA 3GTLH 3S16H 2WB1E 4DUZQ 2H5XA 2JA8G 2YTXA 2NVQH 1TWGH 4YWMA 3W1GA 4P74A 3UDXA 2VQEQ 3PIPA 2JQOA 4XTCS 1Q86C 3ULPA 1SROA 4A3EG 4GLAC 1QZGA 3PO3H 2AWOA 2WB1G 2YV5A 3GTJH 4QQBX 3J81E 1AE3A 2RHQB 1X6OA 1PFSA 3F1ZA 4UP9A 1G291 1C9OA 1WYDA 1YEZA 4DR2Q 2KCTA 4JYAQ 3CCEA 2RHSB 3JAMc 5GADC 4LNQA 1PYSB 1HR0Q 1N8RU 4LF5L 3UE1A 1N34L 2LXKA 3KOJA 2JA6H 2I5LX 1PH6A 3A5UA 5LMNL 1QUQB 1VQ5A 1HNWQ 4A3CH 1YIJA 4A3IH 4B3SQ 4LF5Q 4GS3A 1DGSA 2E8GA 1Y1WH 3S15H 3CCET 1JJ2A 3F2BA 3CD6T 2ES2A 4NXNL 2HHHL 3E0EA 5JEAG 3PCOB 4PG3A 3F2DA 3I4NH 1QVFA 4Y7NH 4IFDJ 1VQOA 4DKAC 1HNXL 1S40A 3L2PA 1EIYB 4UY8C 1M90C 2AHOB 4UP7A 2G3RA 1VQ6A 1VQHA 3PUVA 4JBJA 1O7IA 2HHHQ 1KHIA 1Z47A 4DV2L 2E2HH 4O0AA 1OXVA 5DLQE 4YWLA 3A74A 3CD6A 3EBEA 1OXSC 3CMET 1XNIA 4RG2A 2LCLA 3M4QA 5FLMG 4L5RC 3G4ST 4DR7Q 1VQKA 3I55A 2C35B 2MO0A 5M3FG 3GO5A 1KQSA 2E2JH 3UDGA 2N78A 4DR3Q 2JUFA 4A76A 4L5QA 3S1RH 3E9IA 2NZOA 3KBGA 4A3LG 4YCUA 3J80c 4X34A 4AIMA 3WWVA 1NZ9A 5J3BA 4JI3Q 2AWNA 4YY3L 1K73C 4JI4Q 5GQOA 1JJGA 1LTLA 3E9HA 3I4OA 4LW1A 1NPPA 3G4SA 4NB3A 1HNZL 4CRIA 3S1MH 1IBLQ 3RZOH 4AYBE 3DB4A 1K73U 1L2FA 1CKNA 4BBRH 3GTQH 1HZAA 1HZBA 3FKIG 3NELA 5FLXc 1I3QH 1HH2P 2CFMA 3TS2A 4AYBG 1YBYA 4IJLA 4R4CA 4XIGS 4A3KG 4A3BH 3CP0A 4UP8A 3HKZG 5H1SE 4AQYL 1G6PA 1L1OA 2JNGA 2CKZB 5EAYA 3CCVA 3RNUA 4BY1H 4DR6Q 1Q12A 4OX9L 2EQSA 1YHAA 3CF5A 4L5SA 2Y0SG 3CXCA 1LYLA 1KD1C 3HKZE 1QVGA 4B3TQ 4DV3Q 4BBSH 1FJGL 3HOXG 2R93H 5JJLA 3MEFA 4P71A 2JEAI 1C0AA 4NXML 4DR5L 3CXCS 4DV0Q 2E2IH 3CPWS 1UE7A 2IHFA 4JCVE 2VQFQ 1IL2A 1PV4A 4A3GG 2OWOA 1EIFA 3CC4A 4JI4L 2LVMA 3U50C 1YI2T 2RF4A 3AFQA 4LUVA 3HOYH 1AH9A 4Y52H 1KAWA 1QZHA 2KHJA 3J81c 1Q81U 5IWAL 4YHHL 2PQAB 4DV7Q 5LL6S 3RZDH 5E7NA 4BA1I 1X3EA 4OONA 1HJPA 1R9TH 3LGLA 1Q81C
chains in the Genus database with same CATH superfamily
3OY9A 1I5OB 4BE2A 2MJ8A 1CSQA 2E41A 2KROA 4FXDA 4LE9A 3EHRA 2JM9A 3GNGA 4A4FA 2HCKA 1GUWA 1PRMC 4BDYA 1VOMA 1M3AA 1PH7A 2FHDA 2K05A 4RFBA 2ROTA 1FR3A 1G2SA 1I4K1 3FRPB 3OW2A 4R1JA 3F70A 3T16A 1X69A 3VYRA 1D3BB 4N9PA 1VS0A 2UUCL 1QQJA 5JOBA 1X54A 1VQ5T 1T5EA 1NE8A 4JBWA 4LF8Q 5GROA 4JI1Q 2D9TA 4C8QG 2JA5H 1M8MA 4QIWE 2DTHA 2C06A 2K57A 2YLCA 4O1NA 1BCPC 3NWTA 2EWNA 3DEOA 2QAZA 3HOWB 5IYCG 2GTJA 2NBFA 2EGAA 2M00A 3M7GA 4OHJA 3J80L 3TDQA 1QVPA 4DR2L 2L8DA 1Y14B 5L37A 1SPKA 2DRKA 1VQ6T 4J9EA 2EIFA 2M51A 4APVA 3HPWA 4E7HA 1VQ4A 4A3EH 4C92F 2KQWA 5KYWA 1FL0A 2K04A 1F9SA 1ZLMA 5C3EH 4JLGA 1D3BA 1NPRA 1UAPA 4X9DA 2JA7B 4HTHA 3MTSA 1HSQA 5IWAQ 3EG0A 4J9DA 3J7AF 3EFOB 4HIKA 2K14A 4AT1B 1N9SA 2KMTA 4K5XA 1JOKA 5M5YB 4L5TA 4E7LA 3CCJT 5I6WA 5GAMe 4C3JH 3CAMA 1SDFA 3PIO3 3DWPA 1TWFH 4DR4Q 2RQTA 4EMKB 2VYTA 3Q22A 4PZ6A 5I6YA 1GCQC 1Q7YU 1EWCA 5LL6X 2ZM6L 1CM9A 2ASBA 3FP9A 3CPWP 1SJHD 2E12A 1X56A 3PNWC 4I7AA 5ELOA 4C8QF 1YHQA 2EJGC 5JEAJ 3C1EA 4NDXA 1XMOQ 2XD0A 2F2VA 2FYKA 3VKIA 1ENFA 3H0HA 4R4OA 3GTJB 1I4QA 1PH2A 4P5NA 3NFCA 3A7LA 1CKOA 3I4NG 1K0SA 2DMOA 2F0FA 1MGQA 1QE6A 3URYA 1UNSA 3F2UA 5GAMg 4CC3A 1QVCA 4A3EB 1N9WA 3IKJA 4O5VA 2WKCA 1JXOA 3OMGA 3JCMc 3BDUA 4HR7B 4J6HA 2KGTA 4A3GB 4A93G 4HA8A 1KTKA 5C4JH 4X64Q 4P2CB 2JA5G 2F03A 3VS1A 5IH2A 1GXDC 3M4PA 4DV6Q 3HOZG 3UF4A 2LZ6B 5ELCA 3C95A 4F88A 5IYCH 1MUZA 1X55A 2I07B 3EGDB 1OXXK 1V9PA 1EU4A 2ZTCA 3BZCA 3OMCA 3OWEB 1RI0A 2F0HA 3M4OB 4IO9A 2NZ1D 1Z9ZA 5IHKA 1X9NA 5IP7G 2NVXB 3DM3A 1BU1A 3VA7A 4OO1H 2HBWA 2CQOA 2AIRB 4JPBW 3X3MA 4KKTA 2NUPB 3EA6A 5IN1A 1IW7D 1J8IA 1LT4D 4A4EA 1L0XB 1SHGA 1RACB 4XAXB 1A2TA 3GLXA 2MCNA 1G3SA 4X65Q 1AZPA 4AG2C 2J05A 2F2WA 2CZ0B 4PLIA 2PU9B 1MHWC 2B63H 1RDPD 1QVGS 1EY9A 4EQPA 5FO9B 2AKLA 1PH3A 2RMOA 4BWGB 5CV4A 2CP2A 4OVAA 2IWHA 2X4WA 2JS0A 3RERA 1XTDA 2KVQG 4IQZA 1JMCA 1KG1A 2JA6G 3RZDB 4EQ5A 1Y8OB 2CDTA 4FYVB 2UU9L 4OIKA 1H9RA 2ED0A 2EBPA 4DR1L 2JA7G 4MMKA 1IBMQ 1C7YA 2DJQA 3ZEHA 3CC2A 2C9OA 3J7YW 2X3XD 1RTOA 3X26B 4Y92A 2DXUA 2FPEA 2F0WA 3EG9A 4LDVA 2OI3A 4J6XA 4O42A 1PCXA 5FLMH 1SMYD 2JYOA 1VQ4T 2V1QA 1UJ0A 1EOTA 1EY7A 5CK9A 4C92D 2W10A 1VYVA 3VR2A 1WLPB 1XMQL 3HOXH 2R93G 1VQ6Q 2K1BA 3ULLA 1LPLA 1EFNA 1OOTA 3I35A 1A3UA 1L1OC 3HOWG 3WVDB 2J6OA 1HTPA 4DV4L 4BY1G 1VQMQ 1BR9A 4DFAA 2PNHA 3ICEA 1SLJA 4FM4B 4M75A 5E4XA 4DAYB 2ATWA 3TP7A 4DK3C 4AFUC 3HSBA 1M1GA 4EMKA 4A3IG 3CCQT 1UEBA 1WHGA 4BBRG 1Y8NB 3ULJA 2B86A 2E70A 2Z6KC 4FW1A 2K52A 4LJZC 2PMZE 2NN6G 4DR4L 1A2UA 1WHMA 3A8HB 2HDMA 2MF2A 5GMKe 4KHVA 1I1JA 4XTVA 1IXRA 1XTCD 2XNAC 1EYGA 1PFBA 2L12A 2OQKA 3RR6A 1F2ZA 1PH5A 4M77G 2KAFA 4A53A 2K5DA 2A73B 2M16A 2MAMA 2SDFA 4GN5A 3UA6A 2RK2A 4J5YA 1LACA 5ELDA 3T4AC 3KUPA 4Q0FA 5JEAH 1XMQQ 3R2TA 3HOWH 4FIBA 1WFQA 3NUCA 1D6EC 4RG1A 4PMWA 1G8XA 3EHQA 4LDWA 3I3CA 3NQTA 2K5VA 4WJWA 3G6EA 1LABA 1RI9A 1PHJA 2VASA 2O2OA 4YHHQ 1WTVA 1E22A 1UWVA 4HVWA 4GLMA 3I4LA 3RLNA 3PO3B 4CJ2C 3S24A 2IX0A 4NXNQ 3MA2B 1FNWA 3A8LB 4J9BA 1K4US 2YRCA 2K7VA 2G9DA 2ZAEA 5IIFA 3S15B 3M0PA 4KULA 3HOZH 4GOPC 4D8KA 1NLPC 2CZ6B 4HVUA 3GOXA 2K5IA 4K2LA 4RMFA 4A3DB 1HR0L 1N9RA 2BCOA 5ELEA 3W1GA 3CCUA 4LDUA 2B8GA 1Y0MA 1OXTA 3GNFB 2ZPGB 3TSSA 1HQMC 1VDZA 4BY7B 2B2WA 5CV9A 1H9SA 1YJ9Q 2LNHB 1UDLA 4HCKA 3U23A 5GMKh 2H1EA 3A56A 3C12A 4PJOB 5J22A 4K6LA 3NHNA 2OT2A 3LWIA 1VQPT 2E5QA 4XTZA 3QZ9B 3CCRT 2J6FA 3WVEB 4KD4A 4J9GA 5KYUB 5TSSA 1XMOL 5IHIA 1CKBA 1OZ3A 2XDBA 2DVEA 1VQMT 2RQRA 2ZT9C 4PJOG 3I90A 3ME9A 2KJXA 2VNUD 4N8X1 4DV1Q 4LN2A 1WNLA 2EFIA 4BY7G 2HBPA 2XK0A 4PKCC 5CMDA 2PW7A 2COYA 2YU9H 4IALA 2MQHA 2E64A 4J6YA 4TKOB 3TP8A 5M9OA 1FWZA 4A3FH 3PO2H 4ATOA 3CMAA 2SNMA 1G6ZA 4LFCL 1LTID 4ZK9B 2A5HA 3RD4A 2FO0A 2DBKA 1CZGA 1MMNA 2YYZA 1QCOA 3C46A 2VW9A 4DR6L 3RZOB 4FXKC 4M78F 1AE2A 1PH8A 2MPXC 3T56B 1FYNA 1VQCA 3BDOA 1B7YB 1UHCA 1Z7TA 1X01A 3OSVA 1TU2B 5AJ3L 2JOYA 1TS4A 5D14A 3NHHA 2EW3A 1GFDA 2K2MA 1VQKQ 3BG3A 1D2BA 2HD0A 3SE0A 5GMKi 2R92H 4HT9A 3RN5A 4J9FA 2HZYA 3MP6A 2CZ1B 1SNOA 2P0PA 2HL5C 3KFUA 1PWTA 3GTOH 4M78D 2ZPIB 4LUOA 2CH4A 3PIOA 5D6WA 1FNVA 2CP6A 2D0OA 1JB7A 2I46A 3EGUA 1ZX6A 3GP8A 1NY4A 2WAQE 1P16A 5EKKA 4CDCC 4UAIA 2K9GA 4JJBA 5CKBA 5DM7R 2RO0A 1A62A 4M75B 3T1HQ 3CCSQ 2KQ3A 3OA6A 4M75F 4XU3A 4Z89A 2RSOA 1OXUA 2Z4HA 4MHEA 3CCVQ 4JI2Q 4IUTA 4ALPA 2D0PA 1U5SA 4IUUA 3G4SQ 3PO2G 3ZYYX 3BW1A 4TVRA 2L3PA 1NJIU 2Q8IB 3CXCP 3NEMA 2HQHA 2QTXA 3Q8DA 3E2UA 2CS7A 1QG7A 5ISRA 4RTYA 3RLOA 5IT9c 4XT1B 1W3SA 1B1ZA 1K9AA 1VQEA 3E0JA 1PRTC 4HIOA 2UU9Q 1VQ5Q 2R7ZG 1RODA 1AOJA 2HCCA 4B3RQ 2E6ZA 2AKKA 1I4HA 1S5FD 1V43A 2IPOB 4XU0A 5J26A 2F0MA 3PSIA 4C2MH 4DV3L 2JN4A 4C3IB 2B2VC 4HEDA 2FMMA 4DV2Q 4JDSA 3GTKH 1Y1VB 2BKDN 5KYUA 1PTOH 3TSZA 1O80A 4MNOA 5BR8Q 2JA6B 1AFPA 3M9QA 3SB2A 2B39A 1PZKD 1ENAA 2D0QB 1D1KA 1IHVA 1DCZA 2EJMA 2JMCA 1QW1A 4HMJA 3G6JB 4XTYA 1K73R 1MNEA 3AHUA 1UE6A 2VVKA 1D8LA 3NQIA 2LS01 4LF7L 4EMHA 1JJCB 4EQOA 1I50H 5AFWA 1RAAB 5FO8B 2ATCB 2NZHA 1YNNC 1R4QB 2LTOA 4P75A 4LF6Q 2EVBA 4GKJL 5K36G 3VS3A 4RKUE 4GN3B 4RKLA 3S16B 1RABB 2JS2A 3OHXC 2EY5A 1BCPD 3QSUA 2FMCA 3HOYG 1Y1WB 2VY3A 2UXCL 1MI2A 3GD7A 1T3SA 1L0YB 1EIHA 3GV6A 4BACA 1DYQA 1QUQA 4E7KA 1ZKOA 5ELNA 3GQBA 5KYXB 1SYFA 3IFDA 3IL8A 2MPMA 4JK1C 3OYKA 2A28A 4ZKCB 3HOZB 2NTTA 3DWQA 1SE8A 4U68A 2QDLA 2H5XA 3Q0AA 1U9RA 3OS2A 1LT5D 2Q8TA 1TWCB 4F17A 1IHWA 1JJ2P 1GXIE 2JQOA 1SROA 4RKBA 1GUSA 4XTCS 3ULPA 4A3EG 1IGUA 4DF7A 4RG8A 3N5BB 5EJWA 4RTWA 3J81E 3GPLA 1AE3A 2B2WC 4UP9A 5HK3A 1AP0A 1JRIA 2FRWA 2EQMA 5CR2A 1SF9A 2IW3A 1EZZB 4C5HA 2EYXA 1N34L 3M5AA 2LXKA 4BBSB 4PLLA 1RTNA 1TS2A 2CW0D 1PH6A 3DXJC 3A5UA 4M78G 3SK4A 4XDXA 3VUZA 4A3CH 1I5LA 3K5NA 3C0CA 2NVYB 5IGFA 4ID6A 2V4DA 4FF3A 2MMPA 3TP5A 2FHTA 4M77D 3JB9J 4NXNL 1LTGD 1CQVA 4MIUA 1AEYA 1M1FA 5CC4A 1HNXL 4Q5VA 1S40A 2HMAA 2HSEB 4TSSA 1WX6A 3H0IA 4RCCA 5LJ3d 3CMEQ 1H9JA 3VS4A 3KK7A 3QB3A 1RLQC 4X3TA 1KHIA 1ML0D 1Z47A 1STNA 2E2HH 4FP5D 5DLQE 5C3WA 4CI0C 3A74A 3CD6A 2RNAA 1TR5A 1X2KA 3X24B 3CMET 4RG2A 2DYBA 4ZTFA 4K14A 2NUTB 4XQNA 4M77A 2XDPA 1C8CA 5M3FG 2MO0A 3TEEA 3QUIA 4AG1C 1AWOA 5D3IB 2N78A 4A3MB 2E2JH 2QDYB 1PRTD 4AFQC 2E65A 3H3VC 1GJXA 3QWXX 2KYMA 1ZSZC 3KBGA 3E9IA 5JVH3 2NLUA 3J80c 4X34A 4AIMA 4QF4A 4JI4Q 1UG1A 1K73C 4YY3L 5GQOA 1JJGA 1XWEA 1LTLA 1S5DD 4LW1A 1HNZL 2RB6A 2KR3A 3P8DA 1IBLQ 1HQRD 1I81A 3RZOH 3S1MH 2CREA 4VUBA 4G7ZC 1NJIR 3S17B 1L2FA 3RKXA 4XTWA 4PFOA 4CGYB 3GTQH 4G4KA 2KNBB 4KN7C 4M75C 5FRNA 1U4RA 1HH2P 5GANf 3TS2A 2KXCA 1JE4A 3DUZA 3MXPA 3TN2A 1YBYA 4IJLA 1X2QA 4XIGS 2NWGA 3CP0A 3HKZG 4PQXA 5H1SE 1L1OA 4DR6Q 5EAYA 1RAGB 1BI0A 2RCFA 4OX9L 3M0RA 4Q5WA 3JAML 5M5WB 1AWJA 3BZDB 4JZ4A 3NBIA 3TSWA 2Y0SG 1JOQA 1KD1C 1QVGA 4IUQA 4DV3Q 2K5WA 1FJGL 1BIAA 3MEFA 3L1AA 3ZFJA 4CKCA 4NXML 1K3BC 1UUEA 4C2MB 4DR5L 4DV0Q 2CH4W 4V2SA 4DBQA 2DY8A 1C0MA 2RHUA 1PV4A 2YHTA 3CC4Q 4C1NI 2L89A 4JI4L 3I91A 2RF4A 1G3WA 3HOYH 1MMGA 1RAFB 3OYJA 5FU6C 3J81c 3AB9A 3R6OA 2F0JA 4FF4A 1Q81U 2PQAB 3M3YB 4BUGA 5LL6S 4YIJA 4BA1I 2F0EA 3HOVB 3QIIA 1Q81C 1VQOQ 2ZPFB 2E6NA 2JT4A 4C0DB 3CCRA 1WYXA 3UWNA 3QXEB 4M4ZA 3FIFA 3DLLA 1XJVA 2WIIB 4IFDI 2VXEA 3IRBA 1C4QA 2KRSA 1KDCA 3IFTA 5D6YA 4LD9K 1D09B 2EYOA 2KSSA 4R8IA 4BE0A 1GFCA 1VQ7A 3KF8A 1VQAA 1KHCA 3OTOL 1Q95G 3VS0A 5LJ5e 1S5CD 2BA0A 2BH8A 1WJRA 2YTVA 3DHQA 3R2IA 2MNAA 1BI2A 1MIUA 3QDFA 4M7DB 3VYHB 2LCCA 5IE8A 5IGCA 3EIVA 1B44D 2DGYA 3LLRA 4M77F 3CCMA 1JB0E 5DEHA 4ELZC 2A0FB 2ZJRA 3BZKA 1R77A 3K7AH 2Z1CA 4M78C 1CTMA 4OXPA 5LJ5d 2QI2A 3OYFA 3I4MH 3P7JA 4RGOS 2RHXA 3OSOA 4TVAB 4MDWA 3VJPA 5C3EG 2JW4A 4A3JH 4B3TL 4N0AC 1WCMH 3JCMQ 2QASA 3CKIB 3R6NA 4C8QC 1YJNA 3CMEA 3MZ5A 3ZBDA 3X20B 4GKKL 4YCVA 1U4PA 2A1AA 4GLVB 5EPLA 4A3FG 1NJIC 2RH2A 2LY7A 4OO1G 4QUCA 1UE9A 4PFPA 1SE4A 1VA7A 3CHBD 3JB9F 5C3EB 4JI8Q 4OWWB 3D0FA 3C1FA 1IGQA 1F77A 1Q8KA 1FGUA 1W2BS 2CWPA 3ZJYC 2CT4A 1EY4A 2PCFB 1P8LA 4ILWA 5IP9H 4A3MH 1WD1A 2E2JB 1KD1R 1LTAD 1DJ7B 1M1KR 5M3FH 3S2DH 3JCMd 1DOLA 1UUPA 2Z6KA 3QKJA 2JJQA 4C92G 4M8AA 2F5TX 1WTWA 1N33L 3H6ZA 4C0FA 2IY5B 3MEAA 1PRTB 2GQIA 2ED1A 3WXMB 5HKCA 3JB9D 1E7ZA 3PUXA 4QKUA 1LV9A 4ZKBB 4Y7NB 1UGPB 3AQQA 1NMFA 1LTBD 1HR0W 4F7UF 3L2RA 2DL7A 1E3PA 1FVIA 1V29B 4M7AB 1JC7A 3N6RA 2P84A 3V7CA 3GV3A 4DXGA 3GTLB 2DUDA 5FWCA 4CC7A 3JCMJ 1VYTA 4IPCA 2O5IC 4LMQD 4OGCA 1ZEQX 3U4ZA 1Q81R 3CPWA 2NYZD 5FO7B 2VC8A 4RWSC 3H9NA 1YNND 3MPUB 3LNNA 1B9MA 2L9HA 1KQSS 2IT1A 1BKBA 3S2HB 3J80i 4LDXA 1YJWQ 1KC8U 1AWWA 1WTHA 4KMUC 1NBEB 4DBRA 1WHHA 1PMRA 3TS0A 1TY0A 3UE0A 4C3HH 3FHWA 1PD1A 3A8IE 4GZYC 1N36L 3FDRA 3H15A 2LJ1A 2EPBA 4HCZA 2KEDA 3IAYA 3I9QA 3OS5A 4RTUA 3I55Q 2ZTDA 4OWTB 1F9PA 5D65A 3OBYA 1C6VX 2LMCB 1ASZA 1QWEA 2RI5A 1YWPA 1XPRA 1HFGA 1V1QA 1BUVT 2HUGA 2O5JC 4DA2A 3AFPA 2SOBA 4O6JA 3EQLC 4DUYQ 5M3MG 1K76A 1KJWA 2A3LA 1JQYD 4JC0A 2QXFA 4KKSA 1Q1BA 1YZ6A 4E6RA 1IYUA 3J81j 2R7DA 1UE1A 4ULLA 4X6AH 2EVRA 1XNQQ 3W5OA 5GANj 4A4IA 4FF1A 5I9OA 1HCZA 3T1HL 4HCEA 3UT1A 3HKZB 3CCQQ 5AYFA 5CV5A 2CWAA 3GTKB 1NMGA 4JI6Q 2XDDA 5CQXA 2PZTA 3G48A 3OQ5A 3H94A 4JOIC 1XJWB 1KLUD 3AYHB 2F0QA 5IGGA 4C8QE 1ZBXA 2UUAL 2BE7D 4NXMQ 5GAMf 4DV0L 2YUNA 1VQNT 1IO6A 1ZUYA 2PTKA 2D62A 2DAQA 4JBKA 2BIVA 1Y7XA 1N8RR 1BCPB 2F69A 2EJ9A 4BDZA 1ESFA 1DD2A 2J6KA 1YJNT 1BCPF 4E7SA 1VQGA 4DAMA 4YTLA 3O8VA 1J5EL 4TRDA 2YU9B 5T1IA 4UHVA 4AH6A 1X65A 2ECZA 2SNSA 2DO3A 1S1NA 3H0GH 5LHY1 1N6AA 4L5GA 2BOSA 1M1KC 4XQQA 4DNRB 3E9FA 4DAPA 2DNUA 4XQ3A 2WP8J 3D4DA 5LJ5h 4QY7A 1KQ2A 2OF1A 4EGVA 1NYFA 3EFRA 3HOVH 4PJOD 4M7DA 1NBWA 3UA7A 1A8VA 1J6QA 3FKIH 2VXFA 2EYPA 1Y69U 2QTVA 2E5LL 5HGTA 3V7RA 4F7UA 5I2SA 1TWGB 3HOUG 3KLRA 4UPAA 3MHBA 1SE2A 2KYBA 3K0XA 5IY0A 3K6OA 3STBD 4LF6L 4A54A 1I6VC 2E2DC 1M3CA 3U9OA 3QG1A 4BS9A 3C94A 3MJXA 4OB3B 1AN8A 3SR1A 3OYGA 8ATCB 1X3GA 4BBSG 3Q6SA 2DXBA 2LJ0A 4IUPA 3E19A 2XI9A 3V96A 2B63B 2X3WD 2Y4XA 1QCFA 2FZGB 1LO5D 4FDBA 4C5EA 5ELFA 4JI0L 1PZID 3G1JA 4H7BA 3H0GG 1CK1A 4CDFC 4FXGC 3PVQA 1QWFA 1XX8A 4NPSA 1WVLA 1K28A 2L5QA 1D1AA 2GF7A 1SAPA 2PVOB 4CHTB 3GTQB 1YHQQ 3CCLT 1G2TA 2VUMB 2FINB 3DB3A 3META 3JCMh 3JAME 4L59A 1PM3A 1NM7A 1EX4A 5CBAE 2HD3A 5JVG3 2Q2UA 1T0JA 2F0VA 3MWYW 1GUTA 2F0GA 2X9HA 2J06A 4NOYA 4RCBA 4MZ9A 2OTJA 2L55A 3GTMB 1MHNA 1N34Q 4HIMA 2DXCA 4FT2A 1IW7C 1SFOB 1O9SA 2VQEL 4E7IA 2ZGWA 4IOCA 2GGRA 4Z88A 3CCEQ 2JTFA 2R3ZA 2O31A 1HTLD 2JE6I 2LXJA 4ZQ3A 5BN3A 5C0XH 2RJFA 1RJTA 2WAQB 4RGTA 1HUNA 3A7AB 1T0HA 2L3RA 2B2TA 3L0OA 4JI0Q 3CQZB 5GAOl 2DYIA 1I94Q 5IGBA 2I0QA 3PGGA 2EGCA 3BDCA 1SHFA 1RD9D 4K11A 1VQ9A 1CZWA 1N8RC 2L15A 3BVMA 4R0KA 1WQ7A 1N36Q 1F2LA 4R4QA 2CYZB 3CCUQ 4DBHA 4D8DA 1U1SA 4OMOA 2ID0A 2ZM6Q 5CKDA 1K0XA 3HL8A 5C0XI 2QW7A 1ZSZA 2R6GA 2FPFA 3RMSA 3U58A 2J7IA 2M1HA 1G2BA 3TVTA 3VS2A 5EPJA 5NUCA 2D9UA 2UUCQ 4C3JB 2E2HB 3OYNA 2YDLA 2PI2E 2H3JA 3UDFA 1Z9FA 2K32A 2CGHA 1D7QA 4R55A 2VUBA 3OS0A 3OYIA 2KBTA 3OYCA 1KL9A 2MP1A 1UECA 3EGXA 4II1A 4PJJA 4LF7Q 3LH0A 2PVDB 3S2HH 3NSWA 2COZA 1KRSA 5FLXE 2HQEA 2EQKA 3SD4A 1H8KA 3QPHA 1S72T 1I94L 2EZVA 5L23A 2NVYH 3DEPA 1UGVA 3GTMH 4F7UB 1IBKL 3CC2T 1UB4A 3ONAB 3W3AA 1W70A 1EOVA 3HFZB 2BH2A 1JICA 5IGDA 3INZA 1F9RA 4ZTJA 2D5DA 2XRSD 3RR5A 2E5LQ 4IOAA 2C0OA 4X66Q 2A68D 1YWOA 4ELYC 1TS9A 2IL8A 3JAMi 3CCMT 2DD4A 3BVZA 1QOHA 2K6DA 3BU2A 5C4XG 1C1AA 4OB1B 1WI7A 3I55T 3ITPA 1A6XA 2VWFA 3OBWA 3PT9A 2B29A 2QF7A 2K7AA 2XRQD 2MOXA 4NW2A 4HJ8A 1PLFA 4EQNA 1PH4A 5AT1B 1NTGA 3NK9A 3CBOA 4RAUC 2ZXPA 3MP1A 1AZEA 1X3FA 1U0LA 3OW2S 2FRYA 1FYCA 2GNCA 1VQOT 4QL5A 5BN5A 4A3BG 4QCLA 2RJCA 2B8AA 3ER0A 3JC66 5C0XJ 2MI6A 2DZ9A 2DEQA 3I72A 2CKKA 1O75A 3U4VA 3UDIA 2E10A 2F0IA 2R7FA 2IX3A 1PSEA 2KT8A 2AKWB 3GTOB 1BOSA 1BBUA 1NNXA 3MXGA 2VB6A 1SG5A 4M1UB 2RM4A 1PSFA 2FJ2A 2Y4YA 4RTZA 1F1BB 2EY2A 4OGEA 4WTOB 3ND8A 3SWNC 2K01A 4A3JB 1JQQA 2YRVA 4TQUS 2DJGC 2CP0A 2PQWA 3KLSA 2JA9A 4MMLA 4FYYB 4GY5A 4F14A 1PFMA 4X9CA 3NPPA 4H13C 4IJHA 4YWKA 4FNFA 2AZSA 5J1ZA 5GAEC 1XPUA 2K5LA 2DL4A 4HCSA 4BD3A 4HAEA 3HRZC 4ZRZA 5C4ZA 3E1SA 1VIEA 4LUEA 2ZCFB 2W0ZA 3S9WA 5LJ3h 1HYOA 2XIWA 1GUOA 2GFUA 4AFZC 5BR8L 3MAQA 1SEBD 1YHBA 2LNVA 2XVSA 5GAOm 4KT0E 4BI8B 1P92A 2ZJQA 4J1MA 3CCUT 5T1GA 3M0SA 2JA7H 3G7LA 1W1FA 1K8MA 4KD3A 2D1XA 1J3TA 1OU8A 2N3SA 3MFGA 1CKMA 3M4YA 1ZQ1A 3C4SA 3EVQA 1SYGA 2F3IA 3PUWA 1W6KA 4BY7H 5KNBA 1NEBA 3A54A 1JT8A 1JWUD 3SDZA 1VQPA 2OQ0A 4G57A 4A3DH 2QGQA 4QQBX 1E2WA 2B63G 5CBEE 3OYAA 4C0DC 2UXBL 3J81i 4OX9Q 4GKKQ 4IIMA 5J39A 1S72A 4C8QD 2X6GA 3PO3G 2GVBA 5CV8A 1KC8C 2CCZA 4BY6B 1H9MA 3GTLH 2WB1E 4DUZQ 3CBMA 1M3BA 4P74A 3UDXA 2DX1A 3PO3H 3CCLQ 4ZGJB 1CFMA 4GLAC 1CHQD 4C92A 2AWOA 4KY5A 2TSSA 5IODA 1OTCA 5IP7H 2RHQB 1X6OA 1PFSA 1ZBJA 3F1ZA 1YEZA 3A8JE 3G7ZA 4DR2Q 2C0IA 2KCTA 3J7AV 3FJPA 1II3A 4DK0A 5C6AA 2PZ1A 3A98A 1XXGA 3RMHA 4D6WA 4LDYA 2EOTA 1WIEA 3OYEA 2O01E 4M77B 1IKLA 2O88A 2BDNA 2MUYA 3QYGB 1B34B 2HSPA 1WQWA 2E4HA 4N9TA 3MHXA 2DL5A 3EGXB 2RK1A 3HHTB 1MSHA 4FYWB 1DGSA 2L5TA 5GAMj 1KSWA 4GS3A 5I9PA 3CCET 5KNDA 1Y1WH 1SXTA 1B50A 2ES2A 2HHHL 5JEAG 4NL2A 3R93A 4BBRB 4FW2A 2F2XA 3I4NH 1NYGA 4Y7NH 4IFDJ 1VQOA 1QWYA 3K59A 4E2FB 3L2PA 3P1HA 4UP7A 2LQKA 5GAN6 4M7AD 4C8QA 1DOMA 1Z6HA 4JBJA 3VA5A 5KE3A 4N0AA 4DV2L 4O0AA 5I21A 3L2QA 1OXSC 1YNJC 4L5RC 2LCLA 1CA5A 5FLMG 1D5XC 1YNZA 2L3SA 4DR7Q 4J7IA 5C5LA 3FDTA 1WXTA 2R93B 3HTRA 3OIPA 4DR3Q 5FKAC 2B2VA 2HDAA 4L5QA 1ILPA 4M77E 5FRMA 1UGQB 1KIKA 1WPYA 1HUMA 4YCUA 3OPOA 2PZWA 1FD7D 4JI3Q 2AWNA 4FT4A 2O4XB 4K2KA 4RHRA 5LJ3f 1QNKA 3QYHB 3E9HA 3QJYA 3I4OA 3G4SA 3REAB 1I3QB 4CRIA 1WGSA 1IRXA 4A4GA 1ABQA 5GANh 1NLOC 1ARKA 2A69C 3BFMA 2A6HC 3C3LA 4BBRH 5CO7A 4Z8AA 4EVOA 5GJWB 5EBCA 2CFMA 1TXQA 3CQTA 1RCVD 1FMVA 4QW2A 2L1BA 4A3BH 1G6PA 4A4HA 2CKZB 4RTXA 1KNAA 1TS5A 1X43A 3CF5A 1TS3A 4LNPA 1VQPQ 1LYLA 3HKZE 3NMZC 3QOLA 4DK1A 5CORA 4B3TQ 1RKNA 4BBSH 2X69A 2OEOA 1EY6A 2DL8A 2RI2A 4KGZB 4H0LC 3CXCS 2EY6A 2AK5A 2G5DA 2RDHA 4MDXA 3HFOA 1KC8R 5FK9C 2YLBA 1IL2A 5CR3A 2PMZB 3NPFA 4BB7A 1BO0A 2LVMA 1EQVA 1YI2T 4LUVA 1AH9A 2A37A 4KJOA 2DPPB 4CDDC 2KHJA 2V8KA 3SWNB 1PXUA 3QBYA 4ABNA 4DV7Q 4QMGA 2HCIA 2JTEA 3TCJA 1ICWA 3EH1A 4QT7A 1KK7A 2Z6BA 3D7SB 1SNPA 1MD2D 4OONA 3LGLA 1BNZA 2E74C 1LJOA 3Q1JA 3L3OC 1TVXA 1M9SA 4JRQA 4PV1C 2PUOB 2J0TD 3TQ7P 3JB9I 4DBFA 2SEBD 3KJPA 4DQ2A 4A93B 3RKYA 5GANe 1KRTA 2E3IA 5A0DA 2E75C 2KXDA 2FPDA 5I2XA 5CYUA 1B9NA 1PYBA 1VYUA 1STEA 2RHIA 2CZ7B 3BY7A 4F7XA 1IKMA 3OYDA 1PDQA 3MFYA 4OL7A 1HFNA 3FKIB 1MNDA 5IYBG 4LWCA 3VYSA 1X3PA 5CIUA 2QA4A 2QQAA 4FU6A 2EQUA 1VQLT 1I4GA 1M90U 1JWMD 2Q2IA 3OTOQ 2MWPA 4A3FB 3F2CA 3D6WA 5LMNW 2RHZA 1Y96B 1ZXTA 4FO2A 3CRKC 4IPGA 4HJ9A 1GL5A 4J9CA 3FEOA 1J9OA 3OSSC 2A6EC 4X64L 5FLXL 2UXBQ 1K8OA 5GMKl 1O7YA 2KCMA 2Q2TA 2HL3A 4M78E 3M53A 1VQ4Q 2M02A 1X6BA 4Y91A 3D6CA 1CT1D 1U4LA 1UE5A 1OX9A 5GAGC 5LJ5g 2DTOA 1SJED 1TWBA 4DV7L 2UXDQ 4BI3A 1B3QA 1STYA 1A3VA 3V05A 4JI7L 2O4XA 1Y8PB 2D0NA 4M78A 1PRLC 1KABA 2LFNA 3SK5A 1LTTD 2VB3X 4QGUA 1I4RA 4CBVA 2QILA 2DBMA 1Y96A 3SK6A 3M4OH 1M8AA 1JOOA 2JXMB 2KHSA 5E3FA 4X62L 3KXTA 4GOPB 5L8RE 3V8KA 5FJ8H 1UTIA 5KNCA 3GTPH 1IHZA 1PG5B 2P4RA 1JJ2S 1W6JA 2CVRA 4DR7L 3FLGA 4C8QB 1Q7YC 3HZXA 2KEAA 5GAMd 2R61A 1U4MA 5E1FA 3VYUA 4DK6C 3K5MA 3VYGA 2BE5C 2ICEC 4WRDA 1HXYD 1TT2A 5FU7C 4KJNA 4EPCA 3I2ZA 1XQHA 3JCMX 1VCIA 4DGZA 2XHCA 2JVVA 3OIQA 2COWA 2P0QA 3VR5A 5C4HA 2OCEA 3SFMA 3I56T 4FVMA 1DJRD 2DD5A 2I0NA 3LGJA 2FG0A 1GKHA 3MP8A 2DKGA 2DK3A 2OX7A 2RQVA 1YHQT 2JA8B 1KAAA 1PH9A 4B3SL 4ZLTF 4KY7A 1Q82C 3TRZA 1LCKA 1YI2A 3TBIB 3I7FA 1WHKA 2PUKB 1I6HH 3UE1A 1K83H 1BVSA 5C4JB 1ZA2B 3S14H 1VMCA 2Y0SB 4EX5A 2KCCA 3CC7Q 2UXDL 2O9SA 3GTGB 1ICFB 4JLIA 1EQRA 4JI2L 2HT1A 3P20A 5IXFA 4RTTA 2E76C 2IX1A 2K3BA 3GBQA 5M5YH 1WTRA 1E0BA 4I7ZC 1UFFA 1DOKA 5A2QL 2A74C 1IL8A 2D6FA 5IAYA 4PJOE 1QKWA 4J15A 2I5HA 3PF5A 1YJ9T 4OIJA 2BE9B 1ZUKA 1F2MA 1SBBB 4CC2A 4DEXA 4JV5Q 2QK0A 3D8GA 2LX7A 2Q8RE 5GAMh 3G71A 1QCBD 4E7JA 2LSSA 5CV6A 3O13A 3I4MB 3S1QH 2CUBA 3QDRB 3QO3A 4GLKA 2VV5A 3QO2A 2EE1A 3M85A 4A3KB 1TWFB 2A68C 1WTQA 1D0XA 2XICA 1SEMA 4DOVA 2WV6D 4B6MA 4WFN3 1UJYA 3W1BA 4CJ1B 2N8NA 4IN3A 2KE9A 1SE3A 4MZMA 2NWMA 1EY5A 5DNFA 1KIXA 1WHJA 1VQBA 4AMCA 2QEXT 1YITT 2KBNA 3M54A 1H3ZA 2FXQA 2PO4A 4E6IA 2NVTH 2VL6A 2RQUA 2RDFA 3CU7A 4C3HB 3DLMA 5JJIA 2EYYA 2AMCB 3GTGH 1BB9A 5KCHA 4OB0B 5DM73 3VRYA 3J81L 4M77C 3Q24A 1O78A 2V8IA 4RMOA 1N33Q 1X3QA 4OF1A 1LNXA 1E1TA 2YXYA 1I4PA 4RH6A 5GMKm 2BA1A 2UXCQ 1Q7YR 3H09A 3PIP3 3JRZA 3VS5A 3W2DA 3I56Q 1IYJB 1D5MC 1UHFA 1YI2Q 1W2BA 2X4JA 2GCXA 5EG2A 1TWCH 4GNXA 2UUBL 1CSKA 2JN0A 3MEHA 2NN6H 1D0ZA 3PGZA 2KHIA 4J9IA 2KK4A 1PFNA 3RLFA 4R8NA 1R4PB 3G6ET 2YUPA 3HEJA 3K58A 1YCSB 3S1QB 3GTPB 4JI5Q 4WJ4A 4Z02A 1Q82R 1M5Q1 1WHLA 2B2TC 2A69D 2N49A 3HP9A 2MO1A 2DIGA 4M7AA 1TOVA 1OX8A 2RJDA 2N88A 2EAYA 5GAHC 3PVLA 2OTLQ 1R8OB 2HAXA 3AU7A 3NXWA 4XXEA 1Y1WG 3HGBA 4DUYL 5F2DA 3HOYB 2QG9B 1RIPA 1CKAA 1E24A 2NVTB 5G3LD 2BUDA 4LD6A 5GAOn 4PJLA 1Y71A 2RD1A 4R56A 2M0YA 2JEBI 2JXBA 2UUAQ 4DV1L 1SSHA 1OPLA 1HK9A 2FB7A 1H92A 1VMPA 1FNUA 1R0BG 2LRQA 4DEYA 4EMKC 1PTOC 1A15A 2F0KA 4JI1L 3VR3A 1ZUUA 2IVWA 2C5CA 1YIJQ 2ZTEA 4LF9Q 5DY9A 5HURA 1RL2A 5FWBA 2P5ZX 5CV7A 4X66L 1JR0D 4A93H 4C56C 1B4OA 5D3DA 4ME7A 4MZTA 4JW0A 4IPHA 2EYFA 2HIXA 1MGSA 3Q23A 3QWNA 2XMFA 5FU7B 2K50A 2XIDA 2BE5D 3NWSA 4JJCA 4DXFA 3PUYA 4L63B 1HPCA 1YNXA 3OYLA 2JMAA 3KF8B 4NMZA 2N55A 2Z8LA 3KFVA 1UEAB 2QQSA 2B2UC 1OQKA 3I73A 1SMXA 5HGQA 2ICIA 5FU6B 4C5GA 2PI2A 3NE5B 2Z0WA 5GAN2 3D31A 3HS0C 3N52A 4IUNA 3S1NB 2ZXOA 3MCAB 2XSCA 3A8KE 3K8AA 2TMPA 4S3SA 1TXYA 3JB9G 4OELB 4DR1Q 1UGRB 1X75C 4KY6A 3PFSA 1TUDA 4XTXA 2L0AA 2O2LD 5IT9L 1WJQA 3M3YH 4BI4A 1RAHB 4ZN1A 1VQMA 2ENMA 1U8RA 2ABLA 1QILA 1H641 1ILQA 3EN2A 1AD5A 4ME5A 4JS4A 1WFWA 2EKHA 1OO9B 2RDGA 4RTVA 3MEVA 4O2DA 3E6ZX 1BK2A 1E1OA 3CPFA 4R4TA 1ZYRC 5DLOA 1AWXA 2DJFC 1PKSA 1TWHH 2GFAA 4MTKA 1N27A 1K8AC 2BZYA 4BXXH 1LLRD 4UDUC 4M7AF 4YY3Q 2ZXRA 2KDSA 1EFID 1B3AA 3RKWA 1AZGB 2AUKA 1VIFA 4JOIA 3KLWA 1K8AU 4A75A 5FROA 1IBLL 3EG1A 2QA4T 5FJ8G 3SVMA 1WJJA 3HRTA 1TG0A 1YJWA 4N4HA 1LUZA 1NUCA 4KI0A 3VS6A 1RADB 2QGGA 3NTHA 1G8ZD 4E7ZA 4ZUJA 2K4KA 5FOBB 1T9HA 4FSSA 3HKSA 5A0GA 1KDAA 2Q2HA 1BI3A 1YN8A 3NP8A 1XNQL 1SRLA 3THKA 5LJ3g 1Y07A 5I4DA 2AZVA 5GMKj 2PW5A 2WSEE 3S3MA 4JUVA 1C48A 1VF5C 1CKNB 2PVGB 3A8OB 4X65L 2CP5A 5G3LF 4DAVA 2LDMA 4FCYA 1WCMG 1N32L 4OMFB 2DY7A 4QVCA 5C4XH 4QQGA 1M1KU 4KLKA 3ULRB 5LMNQ 2EPDA 1JXMA 2CHBD 1U5KA 1OPKA 1FMKA 1TU0B 2CUDA 2D8HA 2B3GA 3UI2A 4WJ3M 4E47A 3MEWA 2E1HA 4NS5A 1HA6A 1WI5A 3MC0B 5IOCA 3K5OA 2EYLA 3OB9A 2F3VA 2LQ8A 5AJ3Q 4RCNA 4PFZA 1BI1A 2RKSA 4QJFA 2H8HA 2F0PA 1L0WA 1TY2A 4J9HA 2CSIA 5GJVB 5IHNA 1M8VA 4PJNA 1YFNA 1EYCA 1I5FA 4A3JG 2V8JA 2G6FX 1Q82U 1KXLA 1M2VA 1QMCA 2RA2A 5EC7A 5KGUA 5C0XG 3I4MG 4JI5L 4A3DG 2FFKB 1NG2A 1QNUA 2KY9A 4OMNA 1BBXC 3JSCA 4BY6C 5KCOA 2LT4A 2OTJT 4KHPQ 2D8JA 3K81C 4JI3L 2A19A 1FX7A 2HKQB 1K9MU 1PZJD 3M0QA 2MK5A 1OYXA 3K57A 2VQFL 3FPPA 2UUBQ 3STBC 2IJ0A 3JCMb 4DR3L 2EYJA 4ZUIA 1PTOD 1K8AR 2WSFE 3CC4T 5COYA 5CAIA 1IYVA 3VS7A 1B34A 2DEUA 4BXXG 1V1PA 5M5WH 1VQ9T 1B07A 2K3YA 3T13A 1MMAA 1YJ9A 1MBYA 4IURA 4IFDG 5LJ3j 2OJ2A 3S16H 4CDEC 2JA8G 2YTXA 2NVQH 3M4GA 1TWGH 1JWSD 4XYQA 2KRNA 3PIPA 2GQVA 1Q86C 4L6TB 4PMBA 1I50B 1MSGA 2WB1G 3GTJH 3LX7A 1PTOF 2F1MA 2FEIA 2MHVA 1G291 1H3HA 4XU1A 1WYDA 2NVQB 3BE3A 5KYWB 1CI3M 2LQWA 1SNMA 3JAMc 4KTAA 5GADC 4GNXC 2ZPEB 1PYSB 1BCMA 2VGNA 5LJ3e 4LF5L 4EDUA 2KEEA 1LT3D 4A3IB 2EQIA 2JA6H 2EXZA 2I5LX 3EFOA 2XU8A 1SYDA 5C3XA 2RI3A 1EY8A 4C5IA 5IXBA 4PL6A 1VQNQ 1YIJA 4BY1B 4A3IH 4B3SQ 3L9AX 2YRDA 1BQQT 5JPNC 2DVJA 1VQLQ 3EAEA 3CD6T 1LOJA 3PQIA 2E5KA 3URGA 4PNOA 3E0EA 4PG3A 3JCMf 3EFXD 1SYBA 1S4ZA 1NR2A 4UY8C 8AT1B 5FW9A 5EKLA 1EIYB 1HD3A 4OMMA 4UC4A 3EG9B 2LKVA 1VQHA 1RF2D 3V2TA 2HHHQ 3HRUA 3S14B 1GCPA 3QOJA 2DILA 1OXVA 4YWLA 5I22A 1VF7A 4KKUA 1V76A 5GAOp 3M4QA 1S5BD 2PNRC 3HRSA 3I55A 1U06A 3NTIA 4DNTB 3UDGA 2XG8D 3FB9A 2JUFA 5CQYA 1STAA 2F0UA 3WWVA 5J3BA 3PE0A 2RBMA 4J83A 4M7DF 1H9KA 2LQNA 4PJOA 3SHLA 1WTOA 3FVQA 2YUQA 3M58A 4CJ0B 1D0YA 1M2VB 2HKNA 2M0OA 1YITQ 3FKIG 5FLXc 4R4CA 4FSXA 1M4ZA 3WOEA 2LC4A 1WA7A 3LWHA 1VQ8Q 3CCVA 4IUVA 4XT3B 3R8BA 2EYHA 3RNUA 1WTXA 2AT1B 4NP5A 1WD0A 4M7AE 1YHAA 3NGPA 4L5SA 4K5VA 1Q8IA 3CXCA 1KLGD 2L0CA 2XWJB 4IFDH 1I4XA 1C0AA 1NAPA 4JRIA 1WJSA 4PJOC 2LP5A 4J6WA 2JA5B 1UE7A 2YWWA 2VQFQ 2L2PA 4JCVE 5KH6A 2NUZA 3BYYB 4A3GG 1SSOA 3CC4A 3T51B 1OI1A 1Q86R 2B2YA 2LJ3A 4Y28E 1E2ZA 3HP3A 4I65A 1KAWA 4PMCA 3I4NB 2F3WA 1OV3A 4J8OA 4QUFA 4YHHL 1W6XA 5E7NA 1X3EA 4M75E 4HKEA 1HJPA 2X35A 1IB8A 3OYMA 2DETA 2VS1A 3D4WA 2OXPA 1MJEA 4LFBL 3CBPA 4IIOA 1A63A 1I0CA 2B2UA 3A5ZB 2NN6I 3D4RA 1GUGA 2MIOA 1MV3A 3GP7A 1ZSGA 2OTLT 3KBXA 4C3IH 2DTIA 3HOUB 3DKMA 1ZYRD 1MKHA 4RHSA 4HXJA 1NCVA 1ZA1B 5GANd 1TH7A 2R58A 2V1CC 5IYBH 1VQIA 2CP7A 4OMPA 4F7UE 1MV0B 1BDOA 3RUXA 1Z9QA 2EKOA 2HQXA 2YTYA 1B53A 1SYCA 2WINB 1O7ZA 4PNYA 1I07A 1MJCA 1Q3LA 1V1PB 4K0KL 4ESRA 3VYTA 2R7ZH 1BBZA 3M9BA 3CC7A 3L2ZA 1CSPA 3CCMQ 4FF2A 1EEFD 3CCQA 4GKJQ 2ALYB 2ZPHB 3E3XA 4K8JA 4RA8A 4Z9CB 2X6LA 1ASYA 2Z4IA 1V8QA 2FVUA 3BS1A 1GRIA 1E6GA 4HT8A 1OEBA 2A36A 4DR5Q 1LM0A 2JK8A 1D1BA 2MGSA 4HCCA 2K5HA 4CKBA 4JV5L 2KCNA 1X27A 2NTSA 1PNJA 1RUWA 1S3OA 1YVCA 4H02A 3PF4A 3SK8A 4LFBQ 2VUMH 3OYHA 4GN4B 3JCMe 4IPDA 2H4OA 4LXCA 1SNCA 3KJOA 2OTJQ 3H41A 3FPUB 5KE2A 1D1CA 2R57A 2DL3A 3PMIA 1DXMA 1X32A 5CKFA 1QCNA 1EWIA 3PUZA 4HN7A 2OAUA 3TZUA 3T1YL 2LMJA 5ELBA 1SSFA 4ZCKA 3U9SA 1VQDA 3TMEA 3F8TA 4MTNA 4DAYA 3I5RA 4F8MA 1YJWT 1GVPA 3L2WA 2WSCE 1Q90A 4XTUA 3VDYA 1AEXA 3UDCA 4WCIA 4JI7Q 1STBA 2DLPA 1TIID 2IHEA 2BTTA 2A6HD 2F0OA 1R9TB 3A0JA 1PD0A 3G6EQ 1GHJA 1QVFS 1TQOA 2D2CC 3NBHA 2QGFB 1IXDA 1RLPC 2X51A 3RESA 1CUKA 4HSPA 2FZCB 3RIRA 5JJKA 1SRUA 2K79A 3V8JA 1ACMB 4DV4Q 4OO1I 4G7OC 2R5MA 3JV3A 4FYDA 4OEMB 4KN4C 2I5MX 4R4IA 4JJDA 4C92E 3K0YA 3SHWA 2PPBC 4RCOA 5BN4A 1EWHA 5EQ0A 1VQJA 1VQ8A 1BBWA 3BYTB 2NVXH 1G3TA 2LCSA 4V190 4JJNK 2HIVA 1KNEA 4LFCQ 5ECAA 5M5XH 1HA5A 3TEHB 1XNRQ 4MN3A 1GUNA 2B2YC 3KF6B 3LWUA 2PYKA 4LF4Q 1E2VA 2F4VQ 2EYMA 4A3CG 4B3RL 1Y1VH 1VUBA 1Q46A 2K5FA 3SWNA 1GOZA 3IQLA 4L8JA 5IGEA 3VV0A 3HOXB 2E3HA 2P4TA 4M7AG 1N5ZA 3GDEA 2DNEA 2K5QA 4A3GH 2RA4A 1SKUB 1CQFA 3CD6Q 1EQQA 4DV6L 4LK1C 2QA4Q 2EGEA 4XK8E 1PYWD 1PKTA 3PMFA 1KDBA 2WACA 2DRMA 2FZKB 5GAN7 5KYYA 1RHPA 5EGTA 4AYBB 5LMUQ 2PZUA 4JRPA 3D3RA 5M3MH 2RVLA 4L6V5 1S5ED 4C92B 1E7OA 4ODGA 3REBB 3TU4K 1ONLA 3KYHC 1T3LA 1HNXQ 3CCST 4B9WA 1STHA 2K03A 3V8LA 3K80C 2EQJA 2BDOA 4JBMA 1YNJD 4N4IA 1B8AA 3CMAT 1AT1B 1SFOH 1QLYA 2ESWA 2NB0A 2SRCA 4ME3A 4C1NK 4PZ7A 2GTOA 2RF0A 5C5MA 2KECA 4HMIA 1G91A 3T53B 3VR4A 2K2VA 4P73A 4LF9L 2C0TA 3CMAQ 4DV5Q 2XKOC 2K75A 1OU9A 3GIBA 1NEGA 5HY6A 1DM0B 4DPGA 2F0LA 4DU9A 2RCNA 3BVGA 4A4KA 1K9MR 5IT9E 3P8HA 3V7SA 3JCMP 2F4IA 3RN2A 3OW2P 2NUPA 1WTPA 1ET6A 4G7HC 1G83A 4M75D 2OAWA 1WOCA 1PH1A 2Z0SA 2ENBA 1W2BP 4J8QA 4B3MQ 3K5LA 1EYAA 1TUGB 2P0KA 3CCRQ 1BXTA 1HZ9A 2NUTA 2VXWA 3S2DB 4KGVB 4CC4B 4PJMA 2MFIA 4OGQC 2QEJC 4HSVA 2KENA 5KIXA 5CCAA 1VQNA 2RSNA 5KYXA 5JAVA 3FMCA 3C2PA 1EU3A 4A3BB 1VQLA 2DE0X 3RDVA 4POGA 1RAIB 2DF6A 1GCQA 5KEEA 2VGMA 1B7TA 1EFWA 2AUJD 1K0RA 2AHJB 3MKDA 3DMUA 1Q1EA 1EZ6A 4GLXA 1O7LA 2AQ2B 1KFZA 4BA2I 1YIJT 3CQZH 1JB3A 4HJ7A 5D7UA 3PMTA 1G51A 3HOUH 5HCKA 1JE5A 1F2YA 5LJ5f 4ORZA 4QIWB 4KHPL 4JRKA 2VB2X 2DM1A 4LF8L 5C4XB 1L1OB 1NE3A 4POFA 1SRMA 4AFSC 4X3SA 5E4WC 2KVMA 3HOVG 4OP0A 1I6HB 1PHTA 1VQ7Q 5D6XA 1CHPD 1YJNQ 4XYOA 3A8GB 1J5EQ 4QQDA 2RJEA 3CEYA 4IKFA 3SXHA 2VKNA 2WB1B 4YCWA 4F7UG 4X1VA 2F0TA 4C0GA 4DA4A 2EJGA 9ATCB 1EUJA 4X3KA 3FRNA 4FYXB 4DOWA 2F5KA 4MZPA 3LGFA 2GN5A 4GOPA 2MYSA 2CQAA 1PA6A 2DJZA 4ZGDB 3ND9A 3KUFA 5C44G 1HNZQ 1IBML 3RBBB 4EMGA 3MO8A 3QJ6A 4B9XA 4M7DE 3NBHB 3H3VI 3ERQA 3RUZA 4PZ8A 3H91A 1Y57A 5I2MA 3E5SA 4HJ5A 4F87A 4K0KQ 4A3LH 2YT6A 4OMLA 3FC3A 2JJ9A 4C3JG 2F52A 1STGA 2A6ED 3CCLA 2J7ZA 1TWHB 3PV0A 5A35A 1VQFA 2JA8H 3I56A 2RQWA 1BCOA 2GBQA 2L3QA 1ENCA 3P8BB 1ET9A 2DNCA 2XN9C 1R0CB 3CCSA 1AW7A 2DZCA 4HJAA 2QKIC 1GD7A 5A2QE 3I8ZA 3CCVT 1XYIA 2YSQA 1K3RA 1K9MC 3KF6A 4OB2B 1S72Q 3TP6A 1V1OA 3MXUA 2A8VA 5HK0A 2QQ9A 1QZGA 5KRUA 3S6WA 1ABOA 4M7AC 2KT1A 4KH1B 1N32Q 2WFWA 1XPOA 4WF2A 2DN8A 3OYYA 2EYWA 5CKEA 3ERSX 3AEVA 3CC2Q 2A08A 3JCMg 4QVZA 3LW5E 3J7A5 2FL7A 2K3XA 1E6HA 1Q86U 1KD1U 3S3OA 1HXDA 1SYEA 2WAQG 5IP9G 4A3MG 5IYDH 2R92B 2EY1A 5M3FB 2EYZA 3L2VA 3QZ5B 2DFUA 2DXTA 5GAN8 3P75A 5KYYB 3SGIA 3S3NA 1A0NB 1H9SB 4NL3A 1ESRA 3G71Q 3BJUA 3QR8A 4N8FA 4WORA 1FJGQ 4B08A 1FGBD 3T1YQ 3AMUA 1LTRD 2JZ2A 4ZN3A 3RNJA 2K28A 3TREA 3NENA 5K36H 3G71T 4DN4M 5JJZA 2VUMG 4M7DC 4QQ6A 4AQYQ 3L7ZC 3SEBA 3VUBA 1MMDA 4DUZL 1FXXA 4GBQA 3EROA 2E2IB 2OTLA 4BE1A 1WCMB 3K7UC 5JPMC 3EH2A 2H3EB 3KDFA 2EYQA 4M78B 2BZ8A 2RHYA 5GAN4 2JP1A 2ZZDA 1TWAB 4P72A 2NUCA 4C0ZA 3H0GB 2QEXA 1F9QA 1YITA 1HRJA 3J80E 2IPKD 1OULA 3CCJA 2J4XA 4K6DA 3CC7T 1BF4A 3OWFA 2CSQA 1WXUA 2EXDA 3R3OA 2CW0C 1HNWL 4HIDA 2HQLA 2BZXA 5GANg 5KYIA 1IZ6A 1PC0A 3HFNA 4DV5L 4JI6L 2HDLA 1SR3A 1WDXA 4LF4L 2F4VL 2L11A 3X25B 2VZAA 3WDNA 1GO3E 1SNQA 4LUZA 3UATA 5IYDG 1OZ2A 4X3UA 3M7NA 3LX0A 3MVVA 3MXNB 3UPUA 2EDGA 1IREB 2Y90A 4KUDK 3T9NA 2XGTA 3CW2C 4OMQA 2QQBA 2XTIA 1K83B 2ROLA 2CP3A 4GNXB 3EG2A 2F0NA 3NTKA 1T5XD 2F0SA 2ZPBB 5I11A 4R9WA 4JVZA 2ZJPA 1B2TA 4LUDA 5LMUL 1YP5A 1UGSB 2K6AA 2R92G 2NYSA 4ANJA 2R5AA 4OWXB 5C6SA 2EJFA 1VQKT 2RPNA 3RMQA 4ZYSA 5C44H 1QB5D 4K8IA 3EFSA 3PTAA 1M90R 4LFAQ 1AZQA 1EYDA 1I8FA 3JCMW 1HZCA 1QP2A 1IBKQ 3QHSA 1K1ZA 4ZNXA 6AT1B 2Y0SE 5GAN3 1Y1VG 3JCMV 1QKXA 1VQ9Q 2M9VA 4JYAL 4JG2A 4DNIA 3X28B 3HG9A 1A0IA 4A3KH 4C3IG 3H3VH 1RAEB 1XNRL 1VQ8T 2PQAA 1EQTA 1TUCA 2X4XA 7AT1B 1TTHB 3S1NH 2R7ZB 1LVKA 4RUGA 2SEMA 4A63B 2MWOA 4FL6A 3ZL7C 2M2LA 5EBDA 2K5NA 5GAOq 1B70B 4KV6A 4B3ML 1GM5A 3LH5A 5M3MB 5CVIA 3S17H 4V0BA 5C44B 1LT6D 3QWYA 4KK7A 1H95A 2IG0A 3J7ZC 3PO2B 4F04B 3B6YA 1QVFP 4X62Q 3CCJQ 1EY0A 1NSNS 1DZ1A 3H6MA 4LFAL 2L4NA 3OW7A 2RQXA 4JI8L 1M2OA 5LJ5j 1SN8A 1VQ7T 3TQYA 3A55A 2QEXQ 1PRTF 1K8GA 4M75G 1BIBA 2JTMA 4KH0B 4M7DD 2GVAA 2KOLA 1TWAH 3K7AB 4KHZA 2QYZA 3M57A 5CGKA 3L2UA 3KDFB 2RN8A 2AQ3B 2KRMA 1ZHIA 3VU3C 2AQ1B 2F0DA 2QCPX 5I2YA 4YWMA 4QB4A 1G3YA 2VQEQ 1D1IA 3SEMA 3GF5A 1TKWB 2YV5A 3VR6A 3S1MB 1C9OA 4JYAQ 2KUMA 1M27C 1TSFA 4KGXB 3CCEA 2RHSB 4LNQA 1GBRA 2V26A 4QVDA 5KYNA 1N8RU 1HR0Q 2QDBA 3KOJA 4EIKA 1PVOA 5LMNL 2LX9A 1EEID 5A0LA 3L42A 1VQ5A 1QUQB 2IIMA 2KI7A 4JZ3A 2DERA 2PNIA 2B8FA 3M0UA 3EG3A 1HNWQ 1EIGA 4H44C 4LF5Q 1DONA 1WXBA 2E8GA 4ZGEB 1SMYC 2GA4B 1M30A 3M59A 1JJ2A 3MXNA 3F2BA 3S15H 1XOVA 2V1RA 1A3TA 5C0MA 3ASKA 2G9HD 2DA9A 4F16A 3X3NA 1V1CA 1LTSD 1FMWA 4KBMB 3PCOB 4JS5A 2HEQA 1QVFA 1SNDA 3F2DA 2O9VA 4DKAC 5K5PA 1YCYA 1EL0A 5CKHA 2CT3A 1M90C 2AHOB 1GBQA 2I2LA 3A1PA 2G3RA 1AVZC 1VQ6A 3PUVA 2PQEA 1O7IA 4PJOF 2F1LA 4ZAIA 3M56A 2KA7A 4HCBA 3EBEA 4K5WA 1XNIA 1BYMA 2JSOA 2K4YA 3G4ST 3S1RB 4PK4A 1VQKA 2C35B 3AT1B 3GO5A 2DIQA 1KQSA 3VRZA 4KUIA 1JORA 1EZ8A 3BDLA 4A76A 3I70A 4U673 1QP3A 2A7YA 3S1RH 4A3LG 2NZOA 4C3HG 1HHVA 3M0TA 1NZ9A 1QVGP 2EJFC 1HJDA 4NB3A 1KQ1A 1NPPA 4RGMA 3MEUA 1AHJB 3M55A 3I5SA 1X6GA 1JO8A 2HNIA 3EJIA 1JEGA 3KLSX 4AYBE 3FEWX 1JU5C 3DB4A 3A8MB 1K73U 4M7DG 1CKNA 3EGDA 3WOFA 1HZAA 1QJOA 1HZBA 3NELA 3DWAA 2QQRA 3CRLC 1I3QH 4XQJA 4AYBG 2JM8A 5EKIA 4HVVA 3O5ZA 4A3KG 4UP8A 4AQYL 1JCKB 2JNGA 1D5ZC 2Z9HA 3DM1A 5DM63 2X4YA 1Q12A 1JBMA 3OYBA 4BY1H 1U1TA 1PTOB 2EQSA 4N4GA 2K33A 2LT1A 1ZSZB 4LAAA 4RGNA 5GAN5 4CKEA 3TZDA 5JJLA 3HOXG 2R93H 4P71A 2JEAI 1NR4A 4XU2A 3OS1A 3JB9H 1CA6A 2XWBB 3FJ5A 2E2IH 5M5XB 4KRTA 3CPWS 1G5VA 3H0FA 2YUOA 2IHFA 1WZOA 3H8ZA 4IZ8A 5DAUA 3E9GA 2OWOA 1EIFA 1GHKA 5EPKA 1M4VA 3U50C 3AFQA 3QIAA 1W4SA 4Y52H 1QZHA 2WKDA 5KYLA 2M9UA 1KQSP 5IWAL 3OOCA 3LYIA 4C92C 1U3OA 4J7FA 5GAOr 3RZDH 4NKLA 3LWEA 1R9TH
chains in the Genus database with same CATH topology
3OY9A 4BE2A 1CSQA 2E41A 4A4FA 3GNGA 4BDYA 1PH7A 2FHDA 4R1JA 1I4K1 3OW2A 3F70A 1D3BB 1VS0A 2UUCL 1X54A 1VQ5T 1NE8A 4JBWA 4LF8Q 5GROA 4JI1Q 2D9TA 4C8QG 2JA5H 4QIWE 2DTHA 2C06A 2K57A 2YLCA 2EWNA 5IYCG 1QVPA 4DR2L 2L8DA 1Y14B 1VQ6T 2EIFA 4APVA 3HPWA 4E7HA 1VQ4A 4A3EH 4C92F 2KQWA 1FL0A 5C3EH 4JLGA 1D3BA 1NPRA 4X9DA 5IWAQ 3J7AF 4HIKA 2K14A 1N9SA 2KMTA 4L5TA 4E7LA 3CCJT 5GAMe 4C3JH 3CAMA 1TWFH 4DR4Q 4EMKB 2VYTA 4PZ6A 1Q7YU 2ZM6L 2ASBA 3FP9A 2E12A 1X56A 3PNWC 5ELOA 4C8QF 1YHQA 5JEAJ 1XMOQ 2XD0A 2FYKA 3VKIA 4R4OA 1PH2A 4P5NA 3NFCA 3I4NG 1CKOA 1MGQA 5GAMg 1QVCA 1N9WA 4O5VA 3JCMc 3OMGA 4A93G 3BDUA 4HA8A 5C4JH 4X64Q 2JA5G 3M4PA 4DV6Q 3HOZG 3C95A 5IYCH 1X55A 3GTPH 1OXXK 1V9PA 3BZCA 2ZTCA 3OMCA 1RI0A 4IO9A 1X9NA 5IP7G 3DM3A 2CQOA 5IN1A 4A4EA 4XAXB 3GLXA 4X65Q 1G3SA 2CZ0B 4PLIA 2PU9B 2B63H 1QVGS 1PH3A 4OVAA 2X4WA 3RERA 1XTDA 2KVQG 1JMCA 2JA6G 1KG1A 4EQ5A 2UU9L 4DR1L 2JA7G 4MMKA 1IBMQ 1C7YA 3ZEHA 3CC2A 3X26B 2DXUA 4LDVA 4J6XA 5FLMH 1VQ4T 5CK9A 4C92D 1XMQL 3HOXH 2R93G 3ULLA 1L1OC 3HOWG 3WVDB 4DV4L 4BY1G 3ICEA 2PNHA 1SLJA 4FM4B 4M75A 4DAYB 2ATWA 4DK3C 3HSBA 1M1GA 4EMKA 4A3IG 3CCQT 1UEBA 4BBRG 3ULJA 2E70A 2Z6KC 2K52A 2PMZE 2NN6G 4DR4L 3A8HB 2MF2A 5GMKe 1IXRA 4XTVA 1EYGA 2OQKA 1PH5A 4M77G 2KAFA 4A53A 2M16A 2MAMA 4GN5A 2RK2A 4J5YA 1XMQQ 3HOWH 4FIBA 1WFQA 4RG1A 4PMWA 4LDWA 2K5VA 3G6EA 1PHJA 4YHHQ 1E22A 1UWVA 3RLNA 3S24A 2IX0A 4NXNQ 3A8LB 4KULA 3HOZH 4GOPC 2CZ6B 3GOXA 2K5IA 4RMFA 1HR0L 1N9RA 3CCUA 4LDUA 1OXTA 3GNFB 2ZPGB 5GMKh 3C12A 4PJOB 3LWIA 1VQPT 2E5QA 3QZ9B 4XTZA 3CCRT 3WVEB 1XMOL 1OZ3A 2XDBA 2DVEA 1VQMT 4PJOG 3ME9A 2VNUD 4DV1Q 1WNLA 2EFIA 4BY7G 2HBPA 2XK0A 4PKCC 2YU9H 2MQHA 2E64A 4J6YA 4A3FH 3PO2H 5M9OA 1FWZA 4ATOA 3CMAA 4LFCL 2YYZA 2VW9A 4DR6L 4M78F 1AE2A 1PH8A 1VQCA 1B7YB 1X01A 3OSVA 5AJ3L 2JOYA 2HD0A 5GMKi 2R92H 4HT9A 3RN5A 3MP6A 2CZ1B 2P0PA 3GTOH 4M78D 2ZPIB 4LUOA 3PIOA 5D6WA 2D0OA 1JB7A 3GP8A 1NY4A 2WAQE 1P16A 5CKBA 5DM7R 2RO0A 1A62A 4M75B 3T1HQ 3OA6A 4M75F 4XU3A 1OXUA 4JI2Q 4IUTA 4ALPA 2D0PA 4IUUA 3PO2G 3BW1A 4TVRA 1NJIU 3NEMA 3Q8DA 2QTXA 2CS7A 3RLOA 5IT9c 1W3SA 1VQEA 4HIOA 2UU9Q 2R7ZG 4B3RQ 2E6ZA 1V43A 4XU0A 5J26A 3PSIA 4C2MH 4DV3L 4DV2Q 4JDSA 3GTKH 2BKDN 5BR8Q 4MNOA 3M9QA 3SB2A 2D0QB 1QW1A 4XTYA 1UE6A 3AHUA 1D8LA 4LF7L 4EMHA 1JJCB 1I50H 2NZHA 2LTOA 4P75A 4LF6Q 4GKJL 5K36G 4RKUE 4GN3B 3QSUA 3HOYG 2VY3A 2UXCL 3GD7A 4BACA 1QUQA 4E7KA 5ELNA 3OYKA 1SE8A 2H5XA 3OS2A 3W1GA 2UXBQ 2JQOA 1GXIE 4XTCS 3ULPA 1SROA 4A3EG 1QZGA 4RG8A 3N5BB 3J81E 3GPLA 1AE3A 4UP9A 5HK3A 1JRIA 2EQMA 5CR2A 4C5HA 1N34L 3M5AA 2LXKA 4PLLA 1PH6A 3A5UA 4M78G 3VUZA 4A3CH 1I5LA 2MMPA 4M77D 3JB9J 4NXNL 1M1FA 1HNXL 1S40A 4RCCA 5LJ3d 1KHIA 1Z47A 2E2HH 5DLQE 4CI0C 3A74A 3CD6A 3X24B 3CMET 4RG2A 4ZTFA 4M77A 2XDPA 5M3FG 2MO0A 3TEEA 3QUIA 2E2JH 2N78A 2QDYB 2E65A 3E9IA 3KBGA 2NLUA 3J80c 4X34A 4AIMA 4JI4Q 4YY3L 1K73C 5GQOA 1JJGA 1LTLA 4LW1A 1HNZL 2RB6A 3S1MH 3P8DA 1IBLQ 3RZOH 1I81A 4VUBA 1L2FA 4XTWA 3RKXA 3GTQH 4M75C 5FRNA 1HH2P 5GANf 3TS2A 1YBYA 4IJLA 4XIGS 3CP0A 5H1SE 3HKZG 1L1OA 4DR6Q 5EAYA 1BI0A 4OX9L 4Q5WA 2Y0SG 1KD1C 1QVGA 4IUQA 4DV3Q 1FJGL 1BIAA 3MEFA 3L1AA 3ZFJA 4NXML 4DR5L 4DV0Q 4V2SA 2RHUA 1PV4A 2YHTA 2L89A 4JI4L 2RF4A 1G3WA 3HOYH 3OYJA 5FU6C 3J81c 3R6OA 1Q81U 2PQAB 4BUGA 5LL6S 4BA1I 3QIIA 1Q81C 2ZPFB 2E6NA 4C0DB 3CCRA 3UWNA 3QXEB 3FIFA 3DLLA 1XJVA 4IFDI 2VXEA 3IRBA 5D6YA 4LD9K 2KSSA 4BE0A 1VQ7A 3OTOL 1VQAA 1KHCA 3KFUA 5LJ5e 2BA0A 2BH8A 2YTVA 2MNAA 2UXDQ 1WJRA 1BI2A 1MIUA 4M7DB 3VYHB 2LCCA 5IE8A 3EIVA 2DGYA 3LLRA 4M77F 3CCMA 1JB0E 4ELZC 2ZJRA 3BZKA 3K7AH 4M78C 4OXPA 5LJ5d 2QI2A 3OYFA 3I4MH 4TVAB 2RHXA 5C3EG 4MDWA 3VJPA 4A3JH 4B3TL 4N0AC 1WCMH 3JCMQ 1YJNA 4C8QC 3CMEA 3ZBDA 3X20B 4GKKL 4YCVA 2A1AA 4GLVB 4A3FG 1NJIC 2RH2A 4OO1G 3JB9F 4OWWB 4JI8Q 3D0FA 1Q8KA 1FGUA 1W2BS 2CWPA 3ZJYC 1P8LA 5IP9H 4A3MH 1DJ7B 5M3FH 3S2DH 3JCMd 2Z6KA 3QKJA 2JJQA 4C92G 2F5TX 1N33L 3H6ZA 4C0FA 2IY5B 3MEAA 5HKCA 3WXMB 3JB9D 1E7ZA 3PUXA 1UGPB 3AQQA 1NMFA 1HR0W 4F7UF 3L2RA 1FVIA 1E3PA 1V29B 4M7AB 3V7CA 2DUDA 4IPCA 3JCMJ 4OGCA 3U4ZA 3CPWA 2VC8A 1KQSS 2IT1A 1BKBA 3J80i 4LDXA 1KC8U 3TS0A 3UE0A 4C3HH 3FHWA 1N36L 3FDRA 3H15A 4HCZA 3OS5A 2ZTDA 4OWTB 3OBYA 1ASZA 2RI5A 1XPRA 1V1QA 3AFPA 4DUYQ 4O6JA 5M3MG 2A3LA 4JC0A 2QXFA 1Q1BA 1YZ6A 3J81j 2R7DA 1UE1A 4X6AH 1XNQQ 3W5OA 5GANj 4A4IA 3T1HL 3UT1A 5AYFA 2CWAA 1NMGA 4JI6Q 2XDDA 5CQXA 3G48A 3OQ5A 4JOIC 3AYHB 4C8QE 1ZBXA 2UUAL 4NXMQ 5GAMf 4DV0L 1VQNT 2D62A 2DAQA 4JBKA 2BIVA 1Y7XA 2F69A 2EJ9A 4BDZA 1YJNT 1VQGA 4DAMA 4YTLA 3O8VA 1J5EL 4AH6A 1X65A 2DO3A 3H0GH 1N6AA 4L5GA 1M1KC 3E9FA 4QY7A 4XQ3A 2WP8J 5LJ5h 1KQ2A 3EFRA 3HOVH 4PJOD 4M7DA 1NBWA 1A8VA 1J6QA 3FKIH 2VXFA 2E5LL 3V7RA 4F7UA 5I2SA 3HOUG 4UPAA 3K0XA 5IY0A 3STBD 4LF6L 4A54A 3QG1A 3C94A 4OB3B 3OYGA 1X3GA 4BBSG 2DXBA 4IUPA 3E19A 2XI9A 2Y4XA 4JI0L 4FDBA 4C5EA 3H0GG 4NPSA 2L5QA 2GF7A 2PVOB 3CCLT 3DB3A 3META 3JCMh 3JAME 4L59A 2Q2UA 4MZ9A 4RCBA 4NOYA 2OTJA 1MHNA 1N34Q 4HIMA 2DXCA 4FT2A 1O9SA 2VQEL 4E7IA 2ZGWA 4IOCA 2JTFA 1N32Q 2LXJA 2JE6I 2RJFA 2L3RA 4JI0Q 3L0OA 5GAOl 1I94Q 2I0QA 3PGGA 1VQ9A