2EIFA

Eukaryotic translation initiation factor 5a from methanococcus jannaschii
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
133
structure length
133
Chain Sequence
MVIIMPGTKQVNVGSLKVGQYVMIDGVPCEIVDISVSKPGKHGGAKARVVGIGIFEKVKKEFVAPTSSKVEVPIIDRRKGQVLAIMGDMVQIMDLQTYETLELPIPEGIEGLEPGGEVEYIEAVGQYKITRVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (EUKARYOTIC TRANSLATION INITIATION FACTOR 5A)
publication title Crystal structures of eukaryotic translation initiation factor 5A from Methanococcus jannaschii at 1.8 A resolution.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Gene regulation
total genus 23
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 1998-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2eifA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2eifA02
3CMEA 3F1ZA 2MWOA 1VQNT 4JOIC 3W1BA 3K81C 4RMFA 4GLAC 2IY5B 4JI2L 1WOCA 3I4NG 1N33Q 2R92G 1NY4A 4IFDG 4A3KH 1KC8U 5IY0A 4GNXA 3S1NH 1QVFS 1L1OA 3CAMA 5AJ3Q 1I94Q 2JA8G 3HOVG 5LMNW 2ID0A 1VQ6T 4NB3A 1W2BS 3K8AA 3CCRT 5IWAL 4LF4L 1K0RA 3FKIH 1BVSA 1UE6A 3CCLT 1KL9A 1LM0A 3HOUH 5C3EH 4X66Q 4DR5L 4FDBA 4LFCL 1FJGQ 4C3HH 1KXLA 4LFBQ 3FKIG 1SN8A 2AMCB 1O7IA 4DV0Q 4EX5A 1VQMA 4JI7L 5M3FH 2D62A 5JJIA 3HKZG 3CCVT 1IZ6A 2B29A 2HIVA 4DNIA 3HOYG 2OTJA 1IBMQ 3KJOA 3I4OA 2JEBI 1IBKL 2R7FA 3PF4A 4DR1Q 3M7NA 4L5QA 5FLMG 3G71T 2CWAA 4OWWB 1KHIA 3OYYA 2UXCQ 1HR0L 1YIJT 4RG2A 3IRBA 4GNXC 3K7UC 1WYDA 1L1OC 1KC8C 1EQQA 2JA9A 2KHJA 5IP7G 3CCJA 2ATWA 2R7ZH 1YJNT 4A3DH 5JEAG 1YITT 1VQ8T 2Q2TA 2YTVA 4YTLA 3CF5A 1SE8A 2R6GA 2WB1G 4LUVA 5IYBH 4UY8C 3H3VI 4DR7Q 1GM5A 4JBWA 2JJQA 2K52A 3J7AF 1UWVA 2NVXH 2VY3A 4A3DG 4DV6L 1TWHH 2UXDL 3GTMH 4YCUA 4OX9L 4GKKL 2JVVA 4X64L 2ES2A 4DV4Q 4B3ML 3GTPH 1RIPA 3KLWA 1BBUA 3J7A5 1SRUA 2F3IA 1Q7YC 4NXMQ 1I50H 3TS0A 1Q1BA 3RZDH 4DV5Q 2IX1A 1K8AC 2GVBA 4JBKA 3I2ZA 4LF7L 1Q82U 1YJWT 1UE7A 2WP8J 2V1CC 4C3IH 4JI5Q 2VUMG 2BH8A 4HIOA 1S72A 4JI4L 1PYBA 4LW1A 3TREA 4TVRA 4AIMA 1J5EL 2UUAQ 4QY7A 2PQAB 4P72A 2R7ZG 4R4QA 1VQ5A 5M5XH 3CC4T 1YI2T 2E8GA 5JJLA 1Y1WH 1NE3A 4DV1L 1P8LA 1VQAA 3S16H 3PGZA 1U5KA 2XGTA 3CCSA 1YVCA 3HOXH 2E5LQ 1Y1WG 3GTOH 5GAEC 4X65Q 2ZM6L 2JK8A 3NENA 1K83H 1VS0A 4A3CH 4O2DA 2JE6I 3CMET 3J80i 2LCLA 1JJ2S 1SSFA 5ELNA 5LMUL 4IFDI 4BA2I 1BKBA 2EIFA 3G6EA 4OO1I 1I6HH 3S2HH 4JI0Q 3PO3H 1KQSS 3KDFA 1HNXQ 2VQFL 5BR8L 1VQFA 1VQKA 1K3RA 3J80c 4KI0A 1A8VA 1Q82C 1B70B 1RL2A 3OW2A 1TXYA 1VQIA 2HIXA 3E9IA 1PYSB 3DB3A 2PI2E 4LUZA 4BBRH 5M3MG 4DR4Q 1HNWL 1PV4A 3STBC 3RLOA 4AQYL 1CKNB 4AYBE 1XJVA 3T1HQ 2BH2A 4C3JH 3S1QH 1QVCA 2QGQA 4GKJL 2K14A 3L2PA 4ME3A 1U0LA 4A3MG 4BBRG 4KLKA 5C44G 4DUZQ 1PH6A 4IPCA 4LF5Q 1TWGH 2ASBA 1KRTA 1VQMT 1E1TA 5H1SE 4R4OA 2C35B 2LXKA 1N34L 2OTJT 4A3GH 1HH2P 2F52A 1XPOA 3CQZH 3CMAA 3OTOL 2JNGA 1GO3E 1K8GA 4R4IA 1E3PA 3RNUA 2L15A 3JC66 4QIWE 5C0XJ 1IYJB 1YHQA 2RHSB 3HKSA 1QVFA 4LFAL 3J80E 5FJ8H 4GLVB 1N36Q 2MI6A 2E2JH 2VQEQ 4XTCS 3BU2A 1W2BA 2MO0A 3CCJT 3F2BA 4YY3L 1X56A 2JA5G 2RF4A 1YHAA 2E2HH 4A3FH 1VQPA 1M1KU 1PFSA 1KRSA 2VW9A 2QA4T 1X55A 1Z47A 4AH6A 2HHHL 3CCQA 2F4VQ 3P8BB 4ZN1A 3BZCA 5JEAJ 1PH2A 4LF6Q 1IBLQ 3ER0A 2Q2HA 2JQOA 3T1YL 3CD6A 2I5LX 4A3FG 4L5RC 3CW2C 3S14H 4WJ3M 4LF9Q 4TQUS 3CC7A 2CKKA 3BZKA 2XHCA 4DUYQ 1JJCB 1X3FA 3HOWG 3M4QA 1VQ4A 2IHEA 4BBSG 2HQLA 1CUKA 1OXSC 2IHFA 3S24A 4JI1L 3M4OH 3EN2A 1YEZA 3BJUA 3GTLH 2R93G 1S72T 2VNUD 5J26A 2KHIA 2ZJRA 3W5OA 1KIXA 2OWOA 4K0KL 1VQDA 1OXXK 2E70A 2XTIA 4TVAB 4KHPQ 1VQ5T 4OO1G 2EXDA 1QVGS 1MJCA 1M90C 3GTJH 1HNZL 1UEBA 1PH4A 3D0FA 1XNQQ 4ALPA 1TWFH 4A3KG 4YWLA 3CCEA 2I5MX 3DM3A 1JT8A 3CCST 3ULJA 4B3RQ 1I94L 1M1KC 1Q81U 3GTQH 3HOZH 1B7YB 4BA1I 5HY6A 4L5TA 1B8AA 3I55A 3CC2T 4JI2Q 4JBMA 2NZHA 1S40A 2NVTH 2NN6I 3U4VA 2DO3A 3G6ET 5K36G 2KENA 5JJKA 3HOUG 4GNXB 5C3EG 1L1OB 1Q86U 4H02A 1I5FA 5IP9H 3KYHC 1Y1VH 4X62L 2A19A 1VQOA 5LMNL 1PH8A 1VQKT 1GKHA 3FP9A 3S2DH 3WWVA 2WAQE 1E1OA 5M3FG 1LTLA 1NMFA 2FXQA 3K80C 2PMZE 4GS3A 1PA6A 1EQRA 2VZAA 2B63H 4HJ5A 2LSSA 3TQYA 3AFQA 4DR3L 1ASZA 4JV5Q 2G3RA 4LWCA 3G4SA 1YBYA 1WFQA 2A1AA 3A0JA 4BXXH 4JYAL 2B3GA 3GD7A 4DV2L 4UP7A 3ERSX 4HJ7A 1SFOH 1G51A 2UXCL 3F8TA 4A3JH 1WI5A 1N9WA 1YZ6A 3GTGH 3MXNB 4P74A 1IBKQ 2VS1A 2Y0SE 2Q2IA 5DLQE 1JJ2A 3PUXA 1Q81C 3DLLA 1SR3A 3J81i 1XTDA 4A3JG 4UP9A 4Y52H 4NXNL 5IYBG 4DKAC 1HR0Q 4DR7L 3LGFA 5IYDH 1KQSA 4O0AA 2A8VA 1YHQT 3AQQA 2LQ8A 1XMQL 3I56T 2E2IH 3GTKH 1Q86C 4PZ7A 2AWOA 1A62A 1Y14B 1E24A 5M5WH 3CCUA 2YTXA 4NXML 2GVAA 1HZBA 4DV6Q 3Q8DA 1QUQA 1X6OA 1VQPT 4OX9Q 4GKKQ 4X64Q 5GROA 3CCQT 2YYZA 3PIOA 4B3MQ 3AFPA 4JI8L 3ULPA 2UUAL 1JB7A 3CD6T 2IX0A 3LGLA 3S1MH 4L5SA 3PUWA 4DV7Q 3GDEA 3CC7T 3PF5A 2UU9L 4A93H 1YJ9T 4A3EH 4A3IH 1T9HA 2UUCL 3LH0A 5IAYA 4GOPB 2K50A 2Z0SA 1J5EQ 1D8LA 1N8RU 2UUBL 1HJPA 1CKMA 4YCVA 2H5XA 3UE0A 2K5NA 3HOXG 4HIKA 2E5LL 1K9MU 1PH1A 1XNRL 3J81E 1OXTA 1V1QA 5IYCH 4BY7H 1UE1A 4DV1Q 4A3CG 1I3QH 3PUYA 4JI6L 2NN6G 1WCMH 1N32Q 3UDFA 4OXPA 1HZ9A 2IT1A 4QJFA 5IYCG 3UDGA 3PO3G 4B3RL 1K73U 2N8NA 3CCET 4IFDJ 3EBEA 1VQ6A 2JA6H 4JI3L 4DV3L 4DK6C 2VL6A 5LMUQ 4YHHL 1VQ9A 4MTNA 3J7ZC 3I55T 2KCMA 3CP0A 4GLXA 3I4MH 3RZOH 5A2QE 3KDFB 4A3LH 1PH9A 1CKNA 4MZ9A 5BR8Q 2VQFQ 3VDYA 3T1HL 3CPFA 2OQKA 2I0QA 2ALYB 4P75A 4R4TA 2CCZA 1NPPA 1VQOT 1EWIA 1G291 1V9PA 1EYGA 1OXVA 2MNAA 4EQ5A 1NZ9A 3JAME 3E9HA 1HNWQ 4OWXB 1N8RC 2EQSA 4CRIA 3KF6A 3PUZA 4AQYQ 4A3GG 1K9MC 4GKJQ 4RG1A 3RN2A 1QVGA 2RCNA 5IE8A 3G71A 3M3YH 4NPSA 2QEXA 3ICEA 3TS2A 3RLNA 3DB4A 4B3TL 1YIJA 4JBJA 3UDXA 4BY1H 2ZTEA 3PSIA 3L0OA 4P73A 5FJ8G 1TWAH 4APVA 1N36L 4B3SQ 1K73C 5EAYA 3AEVA 3PO2H 1VQ8A 1C0AA 1XMOL 3OTOQ 1VQGA 3KOJA 1E22A 4DR6L 1NMGA 3F2DA 3M85A 4AYBG 3S1RH 1PVOA 2NVQH 1LYLA 3GO5A 3K7AH 1GD7A 4DR2L 4P71A 4POFA 1EFWA 1PHJA 4LF6L 4YWKA 3I7FA 2NZOA 1Q8KA 2YTYA 1BBWA 1DGSA 3E0EA 4LF9L 1FVIA 3CCUT 3MEFA 4PZ8A 1JMCA 4HIDA 5IT9c 3CCMA 4IJLA 3K0XA 4Y7NH 3L7ZC 3U58A 2JEAI 1JJGA 1NJIU 1M1GA 1AE2A 1VQBA 4DPGA 1N33L 1G6PA 4A75A 2MWPA 5C4XH 1SROA 3EIVA 3HKZE 3U4ZA 5FLXc 1QZHA 1Z9FA 2N49A 4JI1Q 5AJ3L 4UPAA 4POGA 1A0IA 1KAWA 3NELA 1HZCA 2LXJA 2PI2A 4K0KQ 5DM7R 3I4NH 2R92H 3KFUA 1J6QA 2UXBQ 3HOZG 3CPWS 4WJ4A 4X66L 1FJGL 4IPHA 3HOVH 1HNZQ 2JA8H 2I5HA 4LFBL 1OTCA 4DV0L 1EUJA 1VQCA 4PG3A 5IWAQ 4LF4Q 1AH9A 3A5ZB 5IT9E 2YU9H 5IP9G 3RN5A 1Y1VG 2WB1E 1Q1EA 1VQLA 4DR5Q 4IOAA 3G48A 1IBML 4LFCQ 4HJ8A 4GN4B 1E7ZA 4PMWA 2DGYA 4HJAA 4QGUA 4DR1L 2BA0A 3CXCS 5GQOA 1VQ9T 4A76A 4JI7Q 1NJIC 2B63G 5GAGC 5FLXE 5LMNQ 4X62Q 1HR0W 4JV5L 4BXXG 1Q7YU 1UE5A 4IOCA 2YV5A 2AWNA 3PIPA 5C0XG 2ZJQA 5FLMH 1SMXA 2KCTA 2MO1A 3CMAT 1K8AU 2IG0A 2AKWB 4GN3B 4J15A 2DUDA 3STBD 5HGQA 1V43A 4DR3Q 2BA1A 1XPRA 2OTLA 4JYAQ 2Z6KA 4GN5A 4YCWA 4DV2Q 5IP7H 1FL0A 3KJPA 2QEXT 2CQOA 3AYHB 3J81c 1HZAA 1VQ7A 5IYDG 2KVQG 2AHOB 4DV4L 1A63A 4KHZA 3M4PA 3KBGA 2R7DA 3PUVA 4UP8A 1X3GA 3A74A 4JC0A 4R4CA 2WAQG 2UXDQ 4DV5L 1X9NA 3HFZB 3S15H 4LF8Q 1GVPA 1Q46A 4NXNQ 4JI5L 2PNHA 4OWTB 2JOYA 2QA4A 4LF8L 4DAYB 1W3SA 1XMQQ 2PQAA 1L0WA 2N3SA 1YNXA 2RHQB 3JAMi 4LF7Q 1VQ4T 4DK3C 2VUMH 3SGIA 4JI4Q 4X6AH 4DV7L 2Y0SG 1YHBA 4A93G 1QUQB 4IPGA 4A3EG 1QZGA 1P16A 4A3IG 2WFWA 4X65L 4QL5A 3JAMc 1VQNA 1LUZA 2Z6KC 2MQHA 2JUFA 3CCMT 2KBNA 4GOPA 4JI8Q 1Q12A 1L2FA 1VCIA 2OQ0A 3NBHB 1XNIA 1S3OA 2UU9Q 2CWPA 4LUOA 1IXRA 5ELOA 4HJ9A 4JI0L 4BY7G 2ZM6Q 1HNXL 1KD1U 1X3EA 2UUCQ 3S17H 1WCMG 1ASYA 1N32L 1SLJA 3CCRA 2CKZB 1C9OA 2UUBQ 1R9TH 3CCLA 1XNRQ 4A4IA 4QQBX 2UXBL 1CSQA 4DAMA 4DR4L 4IJHA 5GADC 2D0PA 2JA6G 3CC2A 3H0GH 4OONA 1PH5A 4JI6Q 3KF8B 3J81j 1IL2A 4YWMA 3FHWA 2OCEA 2JA7H 4XIGS 1MKHA 3RLFA 4LF5L 1WJJA 4DUZL 4C2MH 3I4MG 3CCVA 4A3LG 4MNOA 1MJEA 3H0GG 1VQHA 2NVYH 2K5VA 5M3MH 3A5UA 1FGUA 1AE3A 4JI3Q 2GN5A 4LNQA 4DV3Q 3D31A 1CSPA 2JA7G 1VQLT 4YHHQ 2CFMA 4GOPC 1X65A 3TEHB 2HT1A 4IPDA 4A3MH 3G4ST 3ZJYC 1NBWA 2D0OA 5M5YH 5C44H 4X34A 1H95A 4A3BH 3RR5A 2E6ZA 5C4JH 1N34Q 5C0XI 3M9BA 1YJNA 1KD1C 1EIFA 2VQEL 1YITA 2ZTCA 4BY1G 3H3VH 4A3BG 1JE5A 1NTGA 1X54A 3KF6B 4JG2A 4B3SL 3CPWA 3ULLA 2Q2UA 3PO2G 4LFAQ 3PV0A 5GAHC 2L3RA 2OTLT 1D7QA 2F4VL 4JOIA 1PH3A 4B3TQ 2KDSA 1VQEA 2K4KA 2K75A 4YY3Q 1IBLL 2JA5H 3I56A 5E7NA 3TRZA 1VQ7T 3U50C 4DUYL 2LVMA 4HIMA 1M90U 5LL6S 3H15A 1EIYB 1OXUA 1XMOQ 3UE1A 3F2CA 1EOVA 1YJWA 2HHHQ 5J3BA 3CXCA 4DR6Q 1VQJA 3HOYH 3T1YQ 3PCOB 3B6YA 4PZ6A 2MFIA 3OW2S 1CKOA 4JCVE 3LGJA 4R1JA 3UDIA 3CC4A 1YI2A 4DR2Q 1XPUA 1PH7A 3HOWH 3W1GA 2ZJPA 4BBSH 4KHPL 4IO9A 4ZN3A 1TWCH 3NEMA 1MIUA 1YJ9A 2K5HA 1XNQL 2R93H 1NPRA 4QQDA 2ZTDA 5C4XG 1C7YA 2N78A
chains in the Genus database with same CATH superfamily
2YT6A 3F1ZA 2FVUA 2IY5B 5LJ3f 3I4NG 1Q3LA 1N33Q 1NY4A 2I07B 4F04B 2R92G 2E65A 3EHQA 4RKBA 3VYGA 3OYMA 3HOVG 3CAMA 2JA8G 2K32A 1UTIA 1BCOA 1B3QA 4KBMB 3R93A 3CCRT 3P8DA 3MEAA 2AHJB 2LCCA 2V26A 2E2HB 3CCLT 1LM0A 1AHJB 5J39A 1K3BC 4IZ8A 3QO3A 4FDBA 3E9FA 4C3HH 4LFBQ 4A4EA 3HOWB 2BUDA 1SN8A 4J9DA 3JCMX 4KY5A 4EX5A 3VR6A 2AKLA 1IHWA 2RHXA 2Y4YA 5GAOr 1WYXA 2D62A 5M3FH 4FW2A 3HKZG 3CCVT 3SEBA 4M7AE 3SE0A 1IBMQ 2MK5A 1Y71A 4QVZA 3I3CA 3NHNA 4M78A 4DR1Q 1BK2A 1KQ1A 1M1FA 5KCOA 5JAVA 3V8KA 1I4K1 3G71T 3E19A 3A8GB 2HAXA 2C0OA 5FLMG 2HEQA 3EG1A 1W6XA 2EYWA 4X1VA 1I8FA 1RKNA 1EQQA 1L1OC 1D1AA 2A69C 3CCJA 2F0KA 2LMCB 4HSVA 5IP7G 2ATWA 2JM8A 4KTAA 2K4YA 1WHLA 3X25B 5GANf 4ZKBB 3VYTA 4QUCA 2Z9HA 2R6GA 5IYBH 4RH6A 3KK7A 4JBWA 2O31A 2JJQA 1LNXA 4F7UA 8ATCB 1TWHH 2ZXPA 3GTMH 4YCUA 2BZXA 2Q8IB 4OX9L 4HVUA 2G5DA 4VUBA 1CKBA 2GNCA 2NVTB 4EQNA 2F3IA 2WSCE 1Q7YC 4K11A 3TSZA 4NXMQ 3SK6A 4MDXA 2QK0A 2F2XA 4HAEA 2GVBA 1NLPC 3DKMA 4JI5Q 2WP8J 2EJFA 5A2QL 2RCFA 1BF4A 3HRUA 4JS5A 4QY7A 1NJIR 2B63B 2R7ZG 2KUMA 1FR3A 3CC4T 1YI2T 5JJLA 2I2LA 1NE3A 2E4HA 4N4IA 3M55A 3Q1JA 4JJDA 2EOTA 2YSQA 2C5CA 2QCPX 1BUVT 2HDAA 1Y1WG 2JK8A 2DZ9A 1AN8A 3KBXA 4J7FA 2F0NA 2WSFE 4O2DA 3J80i 1JJ2S 1SSFA 5LMUL 4RTYA 1BKBA 2HL5C 4WF2A 3IKJA 4RCCA 2NZ1D 2FZCB 4LD9K 4LJZC 1KQSP 2K3BA 4M7AB 1T3LA 5LJ3j 5JPNC 2A6HC 3BYYB 2DIGA 5BR8L 1K3RA 2B8FA 3QDRB 2AZSA 2IPKD 3FEWX 3S2DH 4DAYB 4EMKB 1RL2A 1B70B 2YRCA 4NDXA 3E9IA 4C3IB 1PYSB 5M3MG 3RZOH 2RO0A 4BBRH 2UXBQ 5ISRA 1C0MA 1C48A 1V8QA 2QEJC 4AQYL 1RABB 4AYBE 5M5XB 3T1HQ 2ZZDA 2FPDA 1SG5A 3RR6A 4J6YA 3EH2A 4JVZA 3L2PA 2FO0A 4A3MG 1GHKA 1UHCA 4KLKA 2ASBA 1IB8A 1NBEB 2OTLQ 1H9MA 4KKUA 2DA9A 2EAYA 1HXDA 2CDTA 3O8VA 2OTJT 2L2PA 2M2LA 1VQ7Q 3CQZH 3CMAA 3OTOL 1TG0A 2WSEE 1GO3E 2K1BA 3E5SA 2LMJA 1IKMA 2NUCA 3JC66 2LNHB 3QYGB 3GOXA 2F0DA 3H6MA 4NOYA 4ZAIA 4X3UA 2EVBA 3J80E 5FJ8H 2XIDA 1WXUA 1YCYA 1N36Q 4D6WA 4XTCS 4M75E 5IH2A 4LDWA 4Q5WA 1WCMB 4NKLA 4YY3L 2X4XA 4E7JA 1MBYA 2FYKA 4IKFA 5EC7A 1EQVA 3M57A 1M1KU 1PFSA 5GANj 1X55A 4J7IA 4M77E 3S1QB 1PD1A 3G7ZA 3P8HA 1E7OA 2X3XD 2F0WA 4L5RC 4LF9Q 3OIQA 2R57A 2TSSA 1VQNQ 2F3WA 2GF7A 1LPLA 2DZCA 3M4QA 4BBSG 2HQLA 2VXEA 2PVOB 2O5IC 4A3GB 1FNWA 2AQ2B 3S24A 1IYVA 2A74C 5FLXL 3M4OH 3JCMJ 3BJUA 1S72T 1LTRD 3R8BA 1UDLA 1U8RA 4DNTB 1TS2A 4TVAB 4FCYA 1LT5D 4M7DC 3GTJH 2AQ3B 2JTMA 1VF5C 3FEOA 1KD1R 1UEBA 2DJFC 3MFYA 3I4LA 4OGQC 1QNUA 1TWFH 1JC7A 4C0GA 2O9VA 3CCEA 2I5MX 1JT8A 3CCST 5K36H 2F0PA 3ULJA 2KT1A 2K6DA 1PDQA 3GTQH 3HOZH 1ZA1B 5CKDA 4PFPA 2COWA 1B7YB 4OMNA 3QIAA 1DD2A 4QCLA 4HA8A 3G6ET 2KENA 3HP9A 4GNXB 5KYYA 3OYJA 3GPLA 2XNAC 1I5FA 1J3TA 4RKLA 5IP9H 4C3HG 4QMGA 1GKHA 2DTHA 4CC3A 3WWVA 3MKDA 5M3FG 3K80C 2PMZE 2R61A 3M7GA 1RLPC 4C92E 5IGCA 3TQYA 1YITQ 2J7ZA 3G4SA 1WA7A 1YBYA 1XXGA 1FWZA 3A0JA 4XT1B 1BBZA 2B3GA 3BFMA 1CA5A 4UP7A 1AWXA 2PPBC 1PRTD 2KXCA 1KFZA 1CQVA 3H09A 3K0YA 1G51A 2UXCL 1G91A 4M75F 4FYXB 1N9WA 4N0AA 2BE7D 4M77B 4BY6C 2F0IA 1JJ2A 4CI0C 4CDEC 3FIFA 2KROA 3L2RA 4IQZA 3UPUA 1RODA 5IYBG 4M77F 3EG0A 4DKAC 4DR7L 3LGFA 5A35A 1STBA 2R92B 1YHQT 2MPMA 2LQ8A 4LDXA 2DVJA 3RERA 2J0TD 5KYUA 4TSSA 3BW1A 3RBBB 3D4RA 1E24A 3CQTA 1F2MA 2YTXA 4BDYA 2GVAA 3OYLA 3JB9H 1Z7TA 4RGMA 1G5VA 1QUQA 1X6OA 2MCNA 2HUGA 4OX9Q 1JOQA 1H9RA 2XSCA 3C1FA 1STEA 2CUBA 3FMCA 3CBPA 3ULPA 2K6AA 2IX0A 4L5SA 1BI3A 2KSSA 1EY4A 3GDEA 3PF5A 2X4YA 1YJ9T 2PZWA 4IFDH 2DL7A 5GAN8 2JN0A 2ZCFB 2EYLA 1ZSZB 1P92A 3PVQA 1HJPA 4OP0A 1CKMA 3UF4A 1AFPA 4J8OA 1I3QH 2O2OA 2B2TC 5D3IB 1N32Q 3JCMd 3IFDA 1WJSA 3KFVA 4OXPA 1HZ9A 1SNDA 2DMOA 5IYCG 2ED0A 2XRSD 4C92B 2E76C 3CBOA 1RAGB 4IFDJ 2KA7A 1VQ6A 2EGCA 4XQQA 1WHJA 3H0FA 5LMUQ 4YHHL 4LDYA 4C92F 1VQ9A 1SEBD 1VYVA 1KABA 1SPKA 1EZZB 1ILPA 4CC7A 3KDFB 3KLSX 2L11A 3Q0AA 1CKNA 5BR8Q 3WVDB 1S5CD 1AVZC 4R4TA 3DEOA 1VQOT 1EWIA 2WKCA 1EYGA 5LJ5h 2MNAA 4RTZA 4EQ5A 1HYOA 5ELDA 4OWXB 5LJ5g 3CCJQ 3MEVA 1G3YA 3M4YA 1PD0A 1GFDA 4AQYQ 3M3YH 3MAQA 1IRXA 3ICEA 3TS2A 3RLNA 2DL5A 4B3TL 3UDXA 2QA4Q 2ZTEA 2CQAA 3P7JA 1AW7A 1X2QA 2L9HA 1DOKA 3U9SA 5FJ8G 1EEID 2G9DA 1LTAD 4XU0A 1RTNA 3WOEA 4APVA 3LWIA 3M56A 4PJOG 1VQ8A 3OYNA 3OW7A 2K9GA 3OTOQ 1VQGA 1WXBA 2FG0A 4R9WA 2CH4A 5GMKl 2VB6A 1B9NA 5A0DA 1IL8A 1BIBA 4KRTA 5DAUA 4XU1A 2YUPA 3ZFJA 1ZUUA 4BB7A 1EZ8A 2PVDB 2N78A 1Y57A 2LDMA 3GO5A 4POFA 1STAA 5KYLA 4LF6L 3I7FA 3EFRA 2KHSA 1CTMA 1ACMB 2XRQD 4OMPA 4CKCA 2PQWA 4OB0B 3MEFA 3HRTA 4HIDA 3CCMA 4U673 2DFUA 1MNDA 4J9FA 4MHEA 4DBRA 2HKNA 3U58A 2RPNA 3W2DA 1JJGA 4BY1B 1VQBA 1HA5A 2A73B 1SMYD 4RTTA 4JJNK 2MWPA 3CC2Q 1B3AA 4ANJA 1TWAB 5CK9A 3EIVA 4M78D 3U4ZA 4RTWA 5AJ3L 3PO2B 4POGA 1GUSA 4NL2A 2F5TX 2DL3A 2GFUA 2QDLA 2RQTA 3DM1A 2RHIA 4M8AA 2O5JC 2AQ1B 4JW0A 1HRJA 2ZPFB 3HOZG 4KUDK 1M2OA 3CPWS 4ZUIA 3S1RB 1FJGL 4IPHA 3P1HA 3TP8A 4WFN3 4Z8AA 3SK5A 2I5HA 2NVQB 3MFGA 2PUKB 1WVLA 1OTCA 4DV0L 4D8DA 3SB2A 4LF4Q 1PCXA 3A5ZB 3V2TA 4GLMA 5IP9G 4LDVA 2F0MA 2EE1A 5C0MA 1D3BB 5GANd 4J6HA 1BNZA 4HJ8A 4IOAA 1E7ZA 1PRLC 2B2YC 2DGYA 4Y7NB 4PKCC 4KKSA 4A76A 1QP2A 1OU9A 3THKA 2H1EA 2ESWA 5C0XH 4JV5L 4C0FA 4BBSB 2KJXA 2MF2A 1JXMA 4O6JA 1UE5A 3PIPA 1CK1A 1T5XD 2F0QA 3VRZA 2PYKA 4E6IA 2KCTA 4FF1A 1K8AU 2IG0A 4GN3B 4K6LA 2OAUA 3STBD 5DLOA 1WI7A 1BYMA 4E7HA 1BOSA 2Z6KA 5FO7B 1PMRA 2HDLA 1TUGB 1HQMC 4PJNA 3J81c 2CQOA 4L59A 1T0JA 3KLRA 4J5YA 1YWPA 2P84A 3T56B 2A0FB 1NYFA 1QCNA 3PUVA 2ECZA 1NCVA 4OIKA 2UXDQ 5CKEA 4DV5L 1X9NA 5FO9B 3QOJA 4OELB 4ZTFA 3C0CA 1Q8IA 1LTBD 2JOYA 3JB9G 1W3SA 2PQAA 5BN4A 2KEEA 1WFWA 1YNXA 4C3HB 2CUDA 5KEEA 3EVQA 3TSWA 1TWBA 1A3UA 4M7DE 2NUPA 2VKNA 3BS1A 4DK3C 2VUMH 3SGIA 5M3FB 4DV7L 1HD3A 1ML0D 1YHBA 1MMNA 1U1SA 1M27C 1KAAA 3MTSA 1AWJA 4IPGA 1GUTA 1P16A 2WFWA 3JAMc 2DNUA 1QCBD 2COYA 3EQLC 4GOPA 2AUJD 1EWCA 5EJWA 3CCEQ 2FZGB 4E7LA 1TQOA 3VS5A 3C1EA 1GBQA 1D1KA 3D8GA 4LUOA 2AIRB 3FDRA 4Y91A 3OYAA 2ZM6Q 5LJ3e 2EQJA 4FW1A 1SLJA 1EL0A 3NHHA 4O42A 4LMQD 5FU7B 2GTJA 3TU4K 1M3CA 5I9PA 1LVKA 3QPHA 2BE9B 1U4PA 2D0PA 2PW7A 3AT1B 3H0GH 4OONA 1QQJA 3C12A 3S3MA 1A3VA 2NTTA 3J81j 1G3TA 3R2TA 4NP5A 1WTWA 2JA7H 3ZYYX 1WJJA 2JMAA 4C2MH 4DUZL 4ZCKA 2NVYH 3A5UA 2K5VA 4JLGA 1FGUA 1AE3A 3MXGA 1BB9A 2P0PA 4YHHQ 3OYKA 4HMIA 3D4DA 3GP7A 1HTPA 5FWCA 1EU4A 3LWUA 2D0OA 2H3EB 2X3WD 1SJED 3ZJYC 4X34A 4A3BH 3RR5A 1ESRA 2QDYB 2R3ZA 5C4JH 4M7AC 1N34Q 1YJNA 2F1LA 1C1AA 1TT2A 1QWFA 4C8QG 2QYZA 5GMKj 4ME5A 1DJRD 2ZTCA 1I5LA 1JE5A 2LX7A 4EMKC 4UDUC 1X54A 3KF6B 3M0QA 1KTKA 1PWTA 4MIUA 3JCMb 3CPWA 3PIO3 2JP1A 5GAHC 1BCPD 2DPPB 2OTLT 1D7QA 2F4VL 4JOIA 1PH3A 1PC0A 4B3TQ 1T0HA 2E3IA 4CKEA 1VQ7T 3A8OB 4KJNA 4M7DF 1M90U 3HFNA 2L5QA 5ELBA 2SEMA 1YJWA 1Y96B 1YCSB 2HHHQ 4AFQC 1M3AA 3RZOB 1MV0B 3PCOB 5ELCA 3TP5A 1B34A 2M16A 3LLRA 3OW2S 1IW7C 4BBRB 5C44B 1ET9A 1XPUA 2VYTA 4HEDA 1PH7A 2XMFA 2ZJPA 4B6MA 4IO9A 4ZN3A 6AT1B 2NYSA 4BACA 1TWCH 4KY7A 1NG2A 1W1FA 2KE9A 2AZVA 4PJOA 3VYSA 3JB9J 4RGOS 3JCMQ 2R93H 1IHZA 5GAMh 5IGEA 4B3RL 2D5DA 3CMEA 3VR2A 2MWOA 4FYVB 1VQNT 5GAMg 4L8JA 3VR3A 3K81C 2OAWA 2RI3A 4GLAC 3KLSA 3HFOA 4JI2L 2JA5B 1PSFA 1QVFP 1I0CA 3LYIA 4HKEA 2E12A 4JJCA 1VQ9Q 3LNNA 4EGVA 5AJ3Q 1I94Q 3S1NH 2VB2X 3QR8A 4NB3A 4K5WA 3CEYA 4JUVA 1FD7D 4C5IA 1X69A 1JEGA 3VS1A 3HOYB 1UE6A 4QVCA 2KEDA 2O4XB 4DR5L 1FJGQ 5CBAE 2DIQA 1PTOH 3META 4WORA 2BDOA 1KXLA 3FKIG 1O7IA 4DV0Q 2Y4XA 4JI7L 5JJIA 2MGSA 2HIVA 4OGEA 2HDMA 1LTID 3I4OA 2DBMA 1ZEQX 1IBKL 4KUIA 1WTOA 1AEXA 1F2LA 2P4RA 1KHIA 2Z0WA 3OYYA 4OVAA 5FRMA 1O7ZA 5T1IA 4GNXC 4A3KB 1WYDA 5D6WA 2EYMA 1K1ZA 2KHJA 3D3RA 2RKSA 5KYNA 4F87A 1YITT 1STNA 1EFID 1SNCA 2WB1G 4FYWB 4UY8C 4HCKA 3M53A 3OB9A 1GUOA 2E6NA 1EYAA 4BDZA 4A3DG 3HOUB 5C3EB 5BN3A 3OIPA 5IODA 1LV9A 4X64L 2ES2A 3GTPH 4FIBA 2EY1A 3NGPA 4J9GA 2DK3A 4F16A 5I2SA 1JWSD 3CCMQ 1C6VX 4HCBA 1I50H 3PMIA 1Q1BA 4DV5Q 2DNCA 1LT6D 1UNSA 4M77C 3I2ZA 4LF7L 2VUMG 4XQ3A 4HIOA 1UGSB 2E41A 1PFMA 1PYBA 4LW1A 4AIMA 5JVG3 4ZUJA 2HCIA 1VQ5A 5M5XH 2E8GA 2JMCA 4XTUA 2RJEA 1Y1WH 4DV1L 3IQLA 1P8LA 1B07A 1VQAA 3CRKC 2CT3A 1PRTB 3S16H 3HPWA 3PGZA 1U5KA 1AD5A 3I73A 2QW7A 3HOXH 2E5LQ 3GTOH 4KJOA 4PFZA 2XWJB 1TUCA 1PRTF 5AFWA 2AUKA 2MAMA 4EQPA 2NVXB 1YWOA 2JE6I 4HCEA 5ELNA 1LTSD 4OO1I 2KOLA 2EIFA 5ECAA 1JICA 3S6WA 2YUQA 4JRIA 4JI7Q 1DZ1A 4IIMA 1KQSS 4K6DA 2IPOB 2VQFL 1VQFA 2CP6A 3RZDB 1VQKA 1SE4A 1TU0B 3F2UA 3LX0A 3J80c 1A8VA 3OW2A 1ZSZC 4DNRB 2JS2A 2F0SA 3J7YW 2PI2E 2A68C 1HNWL 3REBB 4DXFA 1PV4A 3RLOA 5G3LD 3HL8A 1A15A 1XJVA 1RAHB 2HNIA 3VS4A 2NUTB 1M8AA 1FMKA 1QE6A 3EFOB 3V8JA 3K57A 3L2ZA 4DUZQ 2F0GA 4IPCA 1TWGH 1SKUB 3SXHA 3TP6A 1O7LA 3BG3A 2LXKA 2M9UA 4CHTB 2Z8LA 1HH2P 2F52A 1Y8NB 1G8ZD 1HJDA 1K83B 3SHWA 1NNXA 1GUWA 1F9QA 1DOLA 1E3PA 1UEAB 4R4IA 2PVGB 5DM63 1EYCA 2L15A 3RNUA 5C0XJ 5JVH3 1WTRA 1I6HB 1IYJB 2NUZA 2RHSB 1JOOA 1KJWA 1PRMC 2HKQB 4E7KA 1ZYRD 1WTHA 3G6JB 4KN7C 1KNAA 4JI6L 3CCJT 2WINB 5CMDA 1NR4A 1YHAA 4Q5VA 2VW9A 2QA4T 2JM9A 4AH6A 1TY0A 2F4VQ 2JT4A 4M78E 3OWFA 3P8BB 3BZCA 4C3JB 2RK1A 3T1YL 5FROA 2A6ED 4A3FG 3S14H 1H9KA 4WJ3M 1PSEA 1AWOA 3O5ZA 1TU2B 1IYUA 4TQUS 5CV4A 2CKKA 2XHCA 4PJJA 2A08A 1JJCB 1TXQA 1X3FA 2L55A 3X3NA 1VQ4A 1Y0MA 3OYCA 3JRZA 4CJ0B 2V4DA 4KHVA 3NMZC 4LAAA 3EN2A 4E7SA 4HR7B 2R93G 5I4DA 3GNGA 3REAB 5GJVB 2KHIA 1KIXA 1VQDA 2ZPIB 2E70A 2XTIA 5DM73 3D7SB 4OEMB 4PL6A 2DTIA 2E2JB 4A4FA 3ME9A 5I21A 3D0FA 1PH4A 1KNEA 4M75G 4YWLA 3EJIA 4B3RQ 1M1KC 5JOBA 2K5WA 5E1FA 3CKIB 3PT9A 1B8AA 1UJ0A 3I55A 3CC2T 4JI2Q 2R5AA 3QWNA 2NN6I 2DO3A 1ZXTA 2V1QA 1VYUA 3PMTA 1Q86U 4H02A 1EY6A 1Y1VH 1PH8A 3MEWA 4K14A 3T51B 1YIJQ 1JCKB 3HEJA 2RMOA 3QUIA 2WAQE 1E1OA 4RAUC 5CV6A 1D1BA 3A98A 1LTLA 3H3VC 3MXPA 1PA6A 1YJNQ 1E2WA 3GTLB 2D0NA 3C3LA 4DR3L 1ASZA 3NTIA 3NBIA 1UG1A 2K2VA 4LWCA 1WFQA 3WDNA 3M0TA 2ZPEB 3ERSX 1SFOH 1BR9A 3J81L 2DF6A 2EVRA 4MTKA 5EG2A 3T9NA 4M78B 1OPKA 2VS1A 2SRCA 2Y0SE 1IBKQ 3DLLA 5D7UA 4A3JG 1OEBA 3M0SA 4BI3A 3ZL7C 1GCQC 4M78F 1M8MA 2R5MA 3DWPA 3OWEB 1KQSA 1D2BA 1YJWQ 1KDBA 3AQQA 1CHPD 1XMQL 3GTKH 2AWOA 4FT4A 3VA7A 1SNPA 2VXWA 3BY7A 4N9PA 5M5WH 1UUPA 2RHYA 4F7UB 1U4LA 2MJ8A 3Q8DA 1QKXA 1H3ZA 5GROA 2H8HA 2Q8TA 4X64Q 1K0SA 2YYZA 1GRIA 3AFPA 4JI8L 3JAML 2F03A 2X35A 2CW0D 3NBHA 3LX7A 1JB7A 2UUAL 3LGLA 3S1MH 2LT1A 3PUWA 3CMEQ 1STYA 4NS5A 3L1AA 4A3EH 4RGTA 3EGDA 2UUCL 3URGA 2QQBA 2PCFB 5IAYA 5CC4A 1N8RU 1D8LA 5CR2A 2DEUA 4G7HC 2UUBL 4YCVA 2KAFA 2H5XA 2K5NA 5KIXA 3HOXG 1XNRL 1K9MU 4Y28E 1TKWB 2LNVA 5IYCH 1WHGA 1V1QA 1V76A 4DV1Q 2BCOA 3WVEB 2E2IB 2EQMA 1H92A 1WPYA 4LE9A 2WAQB 1ZX6A 4M7AF 3E0JA 5C5LA 2RI5A 4OMMA 3IAYA 3FVQA 2O9SA 3SWNA 4N8FA 1K73U 2YLCA 2MMPA 3CCET 2JA6H 1QKWA 3L2VA 4JI3L 4DV3L 1HXYD 1X3QA 2VL6A 4DK6C 1SYGA 3J7ZC 3NSWA 2PQEA 3I4MH 2M00A 5CYUA 2V8JA 1X75C 2DN8A 1PH9A 2VQFQ 2Y0SB 4A93B 2OQKA 2I0QA 1I4GA 3UA7A 3EFXD 1NPPA 1G291 4A3IB 5GMKe 4UAIA 1NZ9A 2VUMB 1TVXA 5FU7C 1STGA 2K01A 3E9HA 1HNWQ 2ZPBB 4CRIA 3H0HA 2LC4A 4E6RA 2RDFA 2J05A 3MJXA 5IE8A 3G71A 4BY7B 3QZ9B 2QEXA 1U3OA 4JRQA 4PJOD 4HVVA 4A4HA 4HCZA 3PSIA 3L0OA 5ELEA 5C3XA 1S5ED 3AEVA 2D8JA 4DEXA 2E5KA 2B2VC 4FU6A 4KULA 1K8OA 3OSSC 1NMGA 5KNBA 3TEEA 3M85A 1ICWA 1HK9A 4KH0B 3K7AH 2DBKA 2EPDA 2AKKA 3H0GB 4DR2L 5KYIA 4QB4A 1PHJA 1U1TA 2X4JA 4GZYC 1BIAA 2JA7B 1BBWA 4RMOA 2DEQA 1DGSA 1FVIA 1VQ5Q 2HCKA 4JK1C 1B2TA 3ULRB 1WGSA 1JMCA 2NWGA 1EQTA 3L9AX 1EZ6A 2EYYA 2CT4A 2JYOA 2JEAI 1I4PA 4KD3A 5IIFA 1M1GA 4A3BB 1AE2A 5J1ZA 5CKBA 4E7IA 2G9HD 1G6PA 4AG1C 1SROA 3HKZE 1RACB 2B8GA 4KY6A 1FMVA 3EA6A 3OYFA 3GP8A 1HZCA 4J1MA 1EU3A 4K2LA 1VQKQ 1J6QA 3T16A 1BCPB 1XJWB 2LJ1A 1V29B 1CM9A 1DONA 3I5SA 2B86A 1EUJA 1BCPF 4PG3A 4JZ4A 4OB2B 2C9OA 5IT9E 4L6TB 4DQ2A 4N8X1 3SVMA 2V8IA 2BE5D 3RN5A 2YU9H 2NWMA 1AOJA 2DRKA 1VQLA 1Y1VG 4PMWA 1K9AA 2RJFA 4QGUA 1JBMA 2GQVA 1TS3A 1VQ9T 1Y7XA 1O80A 4RFBA 2EYZA 1WJRA 5KYYB 4J9BA 4LUDA 1HR0W 3OY9A 1SHGA 1II3A 1ENAA 2P5ZX 4M75A 3X3MA 2FB7A 3TZUA 1Q7YU 5C4XB 2XG8D 2RQVA 1OU8A 4E47A 2D9UA 3MCAB 1OZ3A 4RCOA 4BUGA 1O7YA 3I56Q 3PMFA 2ZJQA 1DCZA 3OSVA 4J15A 3EG3A 4DR3Q 3CRLC 2DUDA 1NEBA 3I4NB 1WQWA 2HQXA 4M77A 5GAN7 4H7BA 1GHJA 2F0LA 3HOVB 2QKIC 2JA8B 2MP1A 2DVEA 3K6OA 5JEAH 5DY9A 1A63A 3EG9A 2KVQG 2AHOB 1B7TA 2BIVA 2GFAA 3E1SA 3KBGA 4LNPA 3V7RA 1X3GA 2DXUA 3A74A 1G2TA 3JB9D 3S15H 3HFZB 3VS2A 1TTHB 1M1KR 3I91A 3OQ5A 1GVPA 3GF5A 2PNHA 2K5QA 3GBQA 4JRKA 1CFMA 4LF8L 1XMQQ 4XDXA 1SF9A 4ZTJA 2L3PA 2F5KA 5FU6C 1PG5B 2N3SA 2RHQB 3HKZB 4WJWA 3FDTA 4ZGJB 5KYUB 4FSXA 1TH7A 5KNCA 3RKYA 1BQQT 2O01E 1QUQB 5EGTA 4A3EG 4G57A 2EYQA 1LUZA 1E6GA 1RAEB 2JUFA 2RHZA 3CCMT 2KBNA 4JI8Q 1Q12A 1L2FA 1VCIA 2OQ0A 1UFFA 1XNIA 1S3OA 4AFZC 3QOLA 1WD0A 2Z6BA 1IXRA 1JWMD 3OYGA 1RI0A 3I55Q 3HHTB 2UUCQ 1X3EA 4ODGA 1ASYA 2VXFA 5GAN3 2LQKA 3K5MA 2FPFA 2UUBQ 1R9TH 3BYTB 1ONLA 3J80L 1XNRQ 3QG1A 3N52A 4C92A 2EW3A 4A4IA 4QQBX 2GBQA 2JJ9A 1HPCA 5GADC 2JA6G 4MZMA 1RD9D 1BXTA 1IL2A 3FHWA 2RDGA 3GTPB 3I4MG 4LF5L 2J6KA 1PRTC 3JCMh 4ATOA 1MJEA 1IXDA 5CV8A 1HSQA 1I50B 1AT1B 2EGEA 1F2ZA 2PZUA 2P0KA 3M5AA 2GN5A 2B2UC 4DFAA 1CSPA 3JCMg 3PIP3 4DV3Q 1AZQA 3BDLA 2R7ZB 1X65A 2EYJA 4K2KA 3TEHB 4IPDA 2YRDA 4C8QD 1NBWA 5M5YH 1JXOA 1H95A 3OS5A 2NLUA 1JB3A 1J8IA 1IREB 1EX4A 3UATA 4RHSA 3M9BA 1Y1WB 1CKAA 2HQEA 1MHWC 3S17B 2LJ0A 1DJ7B 1D1CA 1EIFA 3A55A 3QO2A 1W4SA 1YN8A 2BKDN 2KBTA 2RK2A 1WTPA 1NTGA 3MO8A 5GAN4 4I65A 5IHIA 1N9SA 3DWQA 4JG2A 4B3SL 5FW9A 3ULLA 2Q2UA 1FYNA 5TSSA 1MD2D 3IL8A 1O78A 2DY8A 5DEHA 2HD0A 2MIOA 1QP3A 1ZHIA 2B2WC 2EXZA 4YY3Q 4C1NI 2J06A 1CI3M 4RCNA 1SNQA 3TSSA 3U50C 2V8KA 3S3NA 4DUYL 4HIMA 5M3MB 4HXJA 3BDCA 2CP7A 2YRVA 4JS4A 1O9SA 1B1ZA 4H0LC 1EIHA 5KYXA 1DOMA 3GV3A 3UT1A 1XTCD 4PZ6A 2LY7A 3I90A 1QOHA 4A3MB 3JCMW 4JCVE 3RUZA 1EY0A 3LGJA 7AT1B 4R1JA 4DR2Q 1AZGB 1YFNA 3HOWH 3TN2A 4KHPL 4X3SA 3UI2A 4N4GA 2J4XA 3NEMA 5LJ3h 1CZGA 2ZXRA 5G3LF 5I6WA 1YJ9A 1I4RA 2F0VA 1XNQL 1NPRA 5LJ3g 3CHBD 2ZTDA 1ILQA 2RB6A 5E4XA 2BZYA 4OO1H 5CQYA 3W1BA 4RMFA 2QGGA 2ZAEA 2DJZA 1PYWD 5FK9C 3OYIA 1KC8U 5IY0A 4PLIA 1UECA 1QVFS 1L1OA 2EJGC 2OEOA 3C95A 5LMNW 1W2BP 3M0RA 1NSNS 2CVRA 3GNFB 2NBFA 4DAPA 5IWAL 3FKIH 1BVSA 1TY2A 4M1UB 1KL9A 2KCNA 4XAXB 2D8HA 2A37A 1D3BA 2FZKB 3QB3A 4LFCL 4RCBA 5AYFA 3DEPA 5D3DA 2KXDA 3CMAQ 5ELFA 2HCCA 1GCQA 5GAOm 1VQMA 3JCMe 1F9RA 1X3PA 1N6AA 4BWGB 1GJXA 1IZ6A 2B29A 4DNIA 4C56C 5EPKA 2QEXQ 1W6JA 3MXNA 1G3WA 4A4KA 2JEBI 1Z9QA 4DAVA 3M7NA 3QBYA 5GANh 4L5QA 1HUNA 2K03A 4F14A 1SXTA 2CWAA 5IHKA 4ULLA 1WXTA 4X3KA 3V05A 2UXCQ 3VV0A 5GANg 1YIJT 1ET6A 4RG2A 4X3TA 1NYGA 2JA9A 1YJNT 1SE3A 4A3DH 4XU2A 5JEAG 2EJ9A 3M54A 2J7IA 3OA6A 2Q2TA 2YTVA 3CF5A 5CKHA 4LUVA 4DR7Q 1YNND 2SNSA 1EIGA 2EPBA 2LCSA 2DAQA 3J7AF 2K52A 2Z4IA 4DV6L 4GKKL 4QQ6A 3OS2A 3M59A 1M2VB 3BE3A 3MHXA 1RIPA 3KLWA 1BBUA 3MWYW 1SRUA 3P20A 2BOSA 4KK7A 5L23A 2A3LA 1K28A 2EQUA 1GUNA 3A8JE 4TRDA 1SMYC 1VF7A 3DMUA 3ND8A 1DXMA 1PKTA 4M78C 5KGUA 1Q82U 3E9GA 1YJWT 1ARKA 4ZRZA 4C3IH 4JBKA 3S2DB 2KRNA 2KYMA 1LTTD 1YNJD 2BH8A 4JI4L 4LF8Q 4FYYB 1J5EL 4OB1B 2JXBA 4TVRA 2PQAB 5FO8B 1UUEA 3RKWA 2NUPB 2K3XA 3EGXA 4ID6A 4CDCC 4B9XA 1SFOB 1LT3D 3MHBA 1JWUD 3QZ5B 3NENA 2K5IA 1VS0A 3RESA 3QSUA 3HG9A 1TWHB 3CMET 1SRMA 3C46A 3GTMB 2NN6H 2QG9B 4RTUA 2KY9A 1VQLQ 1R0CB 1Y8OB 3PO3H 3OSOA 2L12A 1N27A 3GTKB 3G4SQ 3MZ5A 4PV1C 4KI0A 1TR5A 5C6AA 1JOKA 1TXYA 1VQIA 4LUZA 3DB3A 4CBVA 3OS1A 3STBC 3S1QH 2BH2A 2Z4HA 2F0OA 1D0ZA 4ME3A 1U0LA 4LF5Q 5HCKA 3Q23A 1FNUA 3S1MB 3OBYA 3NXWA 5H1SE 2F2WA 2C35B 2K33A 4R8IA 2K79A 2Q8RE 4A3GH 2O88A 5GANe 4JDSA 4A63B 2JNGA 2CREA 2JTEA 1K8GA 1UGPB 4QIWE 2YUOA 1QVFA 3U9OA 1I4HA 2L3SA 3T4AC 4LFAL 4GLVB 4J9EA 2MI6A 4JZ3A 3A7LA 3RDVA 3BU2A 3L42A 4M7DA 4XU3A 2DYBA 4YIJA 1QW1A 2BTTA 2EDGA 1G3SA 4BE0A 5C4HA 2A28A 2DD5A 2QQ9A 4A3FH 1ZA2B 1VQPA 1KRSA 5E4WC 1X32A 1Z9ZA 1Y96A 2F2VA 3CCQA 4PMCA 1S4ZA 4XYOA 5JEAJ 2DETA 4LF6Q 1YNJC 2JQOA 3CD6A 2QDBA 1OO9B 3CW2C 5CGKA 1E6HA 4DUYQ 3CC7A 2QILA 2ROLA 3H0IA 3D6CA 3C2PA 1UAPA 4HT8A 3HOWG 3WXMB 5I6YA 3NTHA 1LOJA 1OXSC 2IHFA 4FVMA 4JI1L 3CQZB 1B34B 1LTGD 1YEZA 3A7AB 4K0KL 1VQ6Q 1OXXK 1GOZA 4M75D 2K3YA 4KHPQ 3NTKA 1EFNA 1QVGP 4LD6A 1VQ5T 3RMQA 2EXDA 4OO1G 3PFSA 4PJOB 2VB3X 4RHRA 1XNQQ 1GUGA 2FHTA 3OOCA 4ZLTF 4XQNA 1MSGA 1O75A 1PXUA 2FPEA 5GAN2 3GV6A 1QNKA 5IHNA 2K57A 1I81A 1Q81U 4ME7A 3EHRA 2DL4A 4BA1I 2E5QA 5HY6A 1PTOD 1EY8A 4FXGC 5JJKA 1RADB 3SEMA 4A4GA 4DOWA 5COYA 2O4XA 1OV3A 4N4HA 3KYHC 2PZTA 3T13A 4X62L 3QHSA 3LH5A 5GAN6 1VQKT 3FP9A 5HKCA 2VC8A 2K5DA 1NMFA 2FXQA 4QIWB 2JSOA 2XKOC 3M4OB 1OOTA 3A1PA 4OMLA 2DE0X 3EG2A 4HJ5A 1CSKA 1VQ8Q 2F1MA 3BVZA 4DXGA 2LQWA 4Z02A 5FU6B 3VJPA 2A1AA 4JV5Q 1JRIA 1BCPC 4WCIA 1MMDA 3RNJA 4DV2L 4HJ7A 1K76A 3VS0A 2XDDA 3GTJB 3MP1A 4A3CG 1MHNA 2CHBD 4A3JH 2DM1A 1TWFB 1YZ6A 3GTGH 3OYEA 1CHQD 2Q2IA 3FJPA 4FF2A 4J9HA 4P5NA 1SR3A 1V1PA 2HD3A 1XTDA 3J81i 3GTQB 3HOZB 4UP9A 1H9SA 2EGAA 4CDFC 2L8DA 1RAAB 3GLXA 2HBWA 3KXTA 5IYDH 1NAPA 4O0AA 1VYTA 2A8VA 2KQWA 1R8OB 3I56T 3VR5A 3JCMV 4A54A 1Q86C 3PNWC 2B2TA 1M90R 1Y07A 1Y14B 1KIKA 4M7AG 1SSHA 4A53A 3CCUA 4NXML 2D9TA 2VV5A 5CKFA 1HHVA 4RTXA 1W70A 4DV6Q 1I5OB 2PZ1A 2DXTA 4GKKQ 2YLBA 4C3IG 4DK1A 3PIOA 5GMKi 1G2BA 4CGYB 4CJ1B 2DLPA 1YNZA 4AG2C 3BVMA 4RTVA 4DV7Q 1TOVA 1RHPA 2UU9L 5C3WA 4II1A 2GTOA 1MSHA 4N0AC 3FRPB 5FKAC 1PHTA 1KQ2A 2HL3A 1X43A 4C0DC 1G8XA 4MZPA 2K50A 3M9QA 4DOVA 1J5EQ 1WIEA 4GLKA 3R6NA 3A56A 1BI1A 2EYXA 1ZUKA 4QW2A 1FGBD 2VASA 2XK0A 3J81E 4NMZA 1U06A 1EYDA 3TDQA 4PK4A 1B4OA 1UE1A 1M4ZA 2B8AA 2PO4A 3H91A 3JSCA 1MNEA 1S5FD 2NN6G 1E2ZA 1OPLA 3KF8A 3M58A 3KUFA 3UDFA 1C8CA 5L8RE 2X9HA 4PFOA 4C8QE 2LTOA 1E2VA 5D14A 4OMFB 2MPXC 3PO3G 1F9PA 4KKTA 3K58A 3EBEA 1TUDA 1VDZA 1VQMQ 1IO6A 3I55T 2KCMA 4GLXA 3JB9F 1UE9A 1WX6A 2CGHA 3QKJA 4ESRA 1SYFA 2RQWA 5A2QE 1Y8PB 2E75C 1V1OA 5I11A 3T1HL 2RQUA 3CPFA 2ICEC 2ROTA 2CCZA 2YWWA 1ABOA 3AB9A 1OXVA 5K5PA 1FMWA 1JR0D 2EY6A 3JAME 1N8RC 1SYBA 3PUZA 3QIIA 2MHVA 3OPOA 4A3GG 1K9MC 1LLRD 2HBPA 1EOTA 1WNLA 2YXYA 4LN2A 2RCNA 4RG1A 3X20B 1I3QB 5LJ5f 4JBJA 4XTVA 4BY1H 2OXPA 1TWAH 2K28A 2RSNA 1N36L 3BDOA 3UDCA 2RNAA 1K73C 4HCCA 5EAYA 3PO2H 1C0AA 1XMOL 1PFNA 3KOJA 4NW2A 3C94A 4AYBG 3IFTA 1U5SA 3RD4A 3S1RH 2NVQH 1LYLA 4E7ZA 2A69D 4P71A 1EFWA 1BDOA 2QI2A 2LS01 1UJYA 2ENMA 1Q8KA 2YTYA 4LF9L 1H8KA 3SK8A 1ENFA 2XWBB 2XI9A 5D6XA 5AT1B 4PZ8A 5IT9c 4F7UE 4Y7NH 2B2YA 4XYQA 1RTOA 4ABNA 3M3YB 4IUTA 2CSQA 1NJIU 4C8QB 4IUVA 5KYWB 4XQJA 3EGUA 5NUCA 4DPGA 4EIKA 4KGVB 4A75A 4C8QF 1QZHA 1JU5C 2DNEA 4JI1Q 2LKVA 4UPAA 1A0IA 5I2MA 2HZYA 4FXKC 1X01A 4J6WA 1KAWA 2LXJA 2PI2A 3ITPA 3NELA 3J7AV 4JLIA 4K0KQ 5DM7R 4M77G 2M51A 3KFUA 2HSEB 3V7CA 1M4VA 1SNMA 4WJ4A 4X66L 1BU1A 4JJBA 4XTWA 3VU3C 1SEMA 3S14B 4KT0E 3JV3A 4FL6A 5GMKh 2RI2A 4RGNA 5FWBA 5JPMC 2QAZA 4GBQA 2DKGA 2JN4A 2WB1E 5LHY1 4DR5Q 2F69A 2JXMB 2K7AA 1A3TA 4QF4A 3MEHA 3CXCP 4HJAA 2BA0A 1AP0A 1MMGA 2DXBA 1X6GA 2HSPA 3EAEA 1OX8A 1PFBA 1XX8A 4KN4C 4D8KA 4S3SA 5FLXE 4C1NK 2AT1B 2RBMA 5GAGC 4JRPA 4X62Q 1X2KA 2A6HD 1EY7A 2AK5A 4LXCA 1ZYRC 1OYXA 1XQHA 4O1NA 1CT1D 4LUEA 1SMXA 3A8LB 2MO1A 3CMAT 1WD1A 4HSPA 2F0FA 1SE2A 1QJOA 4GN5A 4HMJA 4QVDA 4DV2Q 5E3FA 3V8LA 3L3OC 5GAOn 5IXBA 2QEXT 3Q22A 4DV4L 1VQPQ 1KG1A 2A6EC 5IYDG 3K59A 2EKHA 3M4PA 3CCQQ 2R7DA 2LZ6B 4PLLA 5LJ5j 5M9OA 2X6LA 1AZPA 4JC0A 3CD6Q 1E0BA 3DHQA 4U68A 1VOMA 4EMGA 3CC7Q 3NWTA 4C92G 4F7UF 2N55A 4KGZB 3FKIB 2QA4A 2KR3A 5CORA 4HVWA 4MZTA 3E6ZX 1A2UA 3VS6A 2L4NA 4H13C 3H9NA 3RIRA 2F0EA 4J9IA 4LF7Q 1SRLA 2NB0A 4F17A 1GXDC 4X6AH 3I72A 2RA2A 2X4WA 4X65L 4QL5A 2Z6KC 2MQHA 3QJ6A 1I4QA 3NBHB 5IOCA 3TP7A 4Y92A 2KT8A 3A8MB 2M0YA 4FT2A 5CIUA 4PJLA 2M02A 4HT9A 2RDHA 2UU9Q 1D0YA 4JI0L 2EWNA 4J6XA 2QTXA 2XICA 3EGDB 4ELZC 4M7AA 1KD1U 1OQKA 1PZKD 2WB1B 4C5EA 1HNXL 4BI8B 2FFKB 4A3DB 3CCRA 1N32L 2CKZB 1WQ7A 2LQNA 5CO7A 1C9OA 4DEYA 3N6RA 5F2DA 5IXFA 3CCLA 4EMKA 4DAYA 2YDLA 3Q6SA 4UC4A 4DAMA 1V1CA 2PTKA 2XU8A 3PGGA 4NL3A 4DR4L 1A6XA 3CC2A 5GAOp 4JI6Q 4M7DD 2RF0A 1Q86R 3HGBA 1VA7A 2RHUA 3X24B 1S5BD 3VA5A 4XIGS 3RLFA 4QUFA 1MGSA 2KECA 4PJMA 3SWNB 3K5LA 3CCVA 5DNFA 4DA4A 1UB4A 1VQHA 1KDAA 4L63B 3VS7A 3D31A 2VUBA 3OBWA 1I6VC 1VQLT 4GOPC 5IGGA 3HSBA 3NQIA 4L5GA 3G4ST 5C44H 4BI4A 3TCJA 1HFGA 5BN5A 2SOBA 2E6ZA 2GGRA 4OL7A 2FRWA 1SNOA 2RQXA 3TBIB 2VQEL 2E3HA 4I7AA 4BY1G 5KE3A 4OHJA 3NK9A 3MP8A 2EJMA 1WTVA 4XTZA 3PO2G 2RH2A 4DF7A 3PV0A 2L3RA 2MOXA 4ZGDB 1U9RA 3CCUQ 1EY9A 4WTOB 5D65A 1VQEA 2K4KA 2K75A 1IBLL 2JA5H 4R8NA 1D5MC 1GXIE 2XDPA 2CW0C 3TRZA 3PO3B 1GL5A 1AZEA 2L5TA 1B9MA 4C2MB 2LVMA 2NVYB 4K8IA 1OXUA 1QB5D 1XMOQ 1EOVA 5FRNA 1H641 5EBDA 2ZT9C 5IGBA 2ZGWA 2V1RA 3HOYH 5IN1A 1RI9A 3T1YQ 1HTLD 3PVLA 2KK4A 4B9WA 2MFIA 1XOVA 2D0QB 4UHVA 1L0YB 1QLYA 3CC4A 1YI2A 1EEFD 1KHCA 3H8ZA 5C4JB 2OI3A 1ZBJA 4QQGA 5A0LA 2FHDA 1K0XA 3EFSA 1BO0A 2BZ8A 2X51A 1G6ZA 2FMCA 3X26B 2KYBA 2LT4A 1N8RR 4XT3B 1PM3A 1WZOA 4ZGEB 2K05A 1RAFB 1S1NA 1K9MR 4QT7A 5CV9A 4LK1C 4JOIC 4BS9A 4FF4A 1WOCA 2E64A 2EQIA 4IFDG 4A3KH 3MVVA 1T5EA 1BI0A 5GAMf 4GNXA 2C0IA 3U23A 3KUPA 2ABLA 2WV6D 1K73R 2ID0A 1QWEA 2VGNA 3DLMA 1NLOC 1VQ6T 1W2BS 3K8AA 3P75A 4LF4L 1K0RA 4AYBB 4A3FB 1GBRA 1LT4D 4PQXA 3HOUH 3SHLA 1Q95G 4DBHA 1ICFB 4X66Q 2P0QA 3VUZA 5C3EH 3I8ZA 4IIOA 1VIFA 2QTVA 3A8HB 4C5GA 2AMCB 3M4GA 1TWCB 4WRDA 4PJOC 1H3HA 2EQKA 3QYHB 5JJZA 2L89A 1K8MA 4FO2A 3H41A 2R93B 2OTJA 2ENBA 3KJOA 2KQ3A 2R7FA 3PF4A 1BI2A 4AT1B 5I9OA 1N9RA 3OMGA 3L2WA 4OWWB 3FRNA 1HR0L 3OMCA 5GAN5 2HQHA 5HURA 1RCVD 3IRBA 4DA2A 3K7UC 4M75B 1D09B 1KC8C 2RJDA 2F0TA 2DD4A 3OHXC 4KD4A 3S1NB 1UGVA 4G4KA 3H94A 4C0DB 4OGCA 1VQ8T 1SYEA 4YTLA 2LX9A 1SE8A 3H3VI 2KGTA 1GM5A 3AU7A 1VQ4Q 1UWVA 2NVXH 4AFUC 2VY3A 2QF7A 4IUUA 2UXDL 2JVVA 5CBEE 1UHFA 1PTOB 1MMAA 4DV4Q 3EG9B 4B3ML 1NE8A 1ZLMA 2H3JA 3J7A5 4OMOA 1WHKA 2KCCA 1PTOF 3TS0A 3RZDH 4RUGA 1QWYA 2IX1A 4R56A 1K8AC 1UE7A 3NE5B 2V1CC 1AEYA 2ED1A 1ZSZA 1S72A 2UUAQ 5KE2A 3TREA 2C06A 2YHTA 5C6SA 4P72A 1D5XC 1JB0E 4R4QA 5KNDA 3HS0C 2ZXOA 2QASA 4F7XA 4ILWA 2CP3A 5CV5A 1NEGA 2WIIB 2XGTA 4A3JB 3CCSA 1YVCA 2SDFA 3GTGB 5GAEC 4X65Q 3BVGA 2BE5C 4J83A 2ZM6L 2D2CC 1K83H 4XXEA 4A3CH 1JJ2P 4IFDI 2LCLA 2PW5A 2O2LD 4BA2I 1C4QA 4R0KA 1IGUA 4L6V5 3G6EA 2SNMA 3S2HH 1I6HH 1R4QB 2F4IA 2K7VA 4JI0Q 3VR4A 2RN8A 1HNXQ 3KDFA 2FEIA 2GA4B 3PTAA 5LJ5d 4M7DG 1ZKOA 2QQSA 1VIEA 2JS0A 3CU7A 2PMZB 2DYIA 5GAMj 1Q82C 2HT1A 2HIXA 3SD4A 1U4RA 1EY5A 4DK0A 4DR4Q 1RF2D 2RM4A 2JW4A 1MUZA 1CKNB 3EROA 2NTSA 4C3JH 4GKJL 3SDZA 1QVCA 2CP2A 3M0UA 1OX9A 2K14A 2QGQA 4HCSA 5EKIA 2E1HA 2L0AA 1RUWA 1QMCA 4OF1A 1MGQA 1FNVA 4IALA 1TSFA 2VWFA 4BBRG 5C44G 1Q7YR 1PH6A 1KRTA 1VQMT 2RA4A 1E1TA 3S16B 4ZQ3A 4R4OA 2W10A 1N34L 3HOXB 3GTOB 5GMKm 1XPOA 3C4SA 4K5VA 1QCFA 1HA6A 2F0UA 1G83A 4DU9A 1F77A 2RVLA 1YHQA 3VS3A 3HKSA 3K5OA 2EY2A 4FP5D 3FC3A 3DXJC 2E2JH 3JCMP 2E2DC 2DJGC 2VQEQ 4G7ZC 1W2BA 2MO0A 3F2BA 1X56A 2JA5G 2RF4A 2KEAA 1LJOA 2E2HH 3M0PA 1IHVA 3MEUA 3DWAA 1D0XA 3MA2B 3RMSA 2M1HA 1BCMA 1Z47A 2EY5A 2HHHL 4ZN1A 1K4US 1PH2A 3HOYG 2EBPA 1OULA 1IBLQ 3ER0A 2Q2HA 5IT9L 1HFNA 2I5LX 2IWHA 5I2XA 1WLPB 1TWGB 3ZEHA 3BZKA 4FXDA 5LJ3d 3OS0A 2PUOB 3S9WA 2IHEA 5KYXB 4BE1A 1CUKA 3A54A 5CCAA 3QXEB 1SYDA 3RUXA 2VNUD 3TVTA 3GTLH 1UGRB 5J26A 2ZJRA 3W5OA 2OWOA 1I1JA 3CCRQ 3R6OA 1B44D 4DN4M 1KLUD 3R3OA 1QVGS 3CCLQ 1MJCA 1M90C 4DGZA 1HNZL 2EYHA 4HTHA 4ALPA 4CJ2C 1TS5A 4A3KG 3DM3A 1JQYD 1VMPA 2KRMA 1RAIB 2QQRA 3L2UA 4CKBA 1HCZA 4EDUA 2DERA 1I94L 1KDCA 3MP6A 2DJQA 4L5TA 1X27A 3CCVQ 1TIID 2K5FA 2NZHA 4JBMA 1S40A 2NVTH 3U4VA 5K36G 4C8QC 2I0NA 4RG8A 3UWNA 3HOUG 2IIMA 5CV7A 5C3EG 3CBMA 5D6YA 3HRSA 1L1OB 4IUPA 4JPBW 5LMNL 9ATCB 3G71Q 2A19A 1VQOA 2CH4W 1QG7A 4CC4B 2FJ2A 1A2TA 1QILA 4GS3A 1BBXC 1EQRA 2VZAA 2CZ6B 4RA8A 3VYRA 2B63H 2LSSA 3AFQA 2G3RA 5FOBB 1XYIA 4JYAL 4BXXH 4FM4B 1JO8A 3GD7A 1NUCA 1NM7A 4DBFA 4XTYA 1A0NB 3F8TA 1RDPD 1WI5A 5GAOl 4HN7A 3MXNB 2F0HA 2RJCA 4P74A 5LJ5e 4ZYSA 5DLQE 3PUXA 1Q81C 1WDXA 8AT1B 1R4PB 5HK3A 4V2SA 2F3VA 4Y52H 4NXNL 4Z88A 1HR0Q 2XVSA 1N5ZA 1R0BG 4M7AD 1IGQA 3NPFA 3L2QA 3TMEA 2E2IH 4PZ7A 1Y1VB 1IKLA 1A62A 1M2VA 3PQIA 1HUMA 4K8JA 3CC4Q 4DBQA 1YI2Q 4TKOB 4Z89A 2IVWA 1HZBA 3NQTA 1EWHA 3I5RA 1TS9A 1VQPT 1KLGD 3A8IE 1M5Q1 2OJ2A 2EYOA 5KCHA 3CCQT 5EKKA 1D5ZC 5IGDA 4B3MQ 2QQAA 3OYBA 3CD6T 1DYQA 4AFSC 1CZWA 1QCOA 2FRYA 3CC7T 4JI3Q 1MV3A 1ZSGA 4X9DA 1TS4A 4ZK9B 4A93H 2KI7A 3LW5E 3V7SA 2M0OA 3OYHA 1T9HA 3VYHB 4A3IH 2A5HA 3LH0A 2FMMA 4GOPB 4B08A 2Z0SA 1ESFA 3HTRA 1IW7D 3UE0A 1ZUYA 4HIKA 2E5LL 3I9QA 1PH1A 1KSWA 3BDUA 1OXTA 4BY7H 1KK7A 4X9CA 4Z9CB 4R55A 1SJHD 2LP5A 1KC8R 3EGXB 1PZID 3PUYA 1WCMH 2PNIA 3G7LA 3AMUA 4RKUE 2IT1A 4QJFA 3UDGA 4PJOE 2EJFC 4OMQA 5EPJA 5M5WB 1Y69U 5CR3A 1VUBA 2N8NA 2ZPHB 2DTOA 2VVKA 4E2FB 3AHUA 2LFNA 2K04A 2CS7A 4CC2A 1SSOA 2M9VA 4MTNA 2B2VA 1SHFA 5GAOq 3CP0A 2OTJQ 4A3LH 4MZ9A 2CP0A 3VDYA 1LCKA 4C3JG 1SYCA 2KMTA 3O13A 2ALYB 4P75A 4V0BA 4A3EB 2COZA 1V9PA 1K8AR 1U4MA 3DUZA 2GQIA 1JQQA 2CZ7B 3URYA 2DRMA 1NR2A 2EZVA 2EFIA 4GY5A 3GIBA 2EQSA 3KF6A 5CVIA 1YNNC 4GKJQ 2CSIA 3HZXA 3RN2A 1QVGA 4NPSA 2J6FA 3DB4A 4OIJA 1YIJA 5EQ0A 3LWHA 3SWNC 3ND9A 4P73A 4B3SQ 3FPUB 2JA6B 4J9CA 1OI1A 2K2MA 1E22A 2I46A 4DR6L 5C4ZA 3F2DA 3PE0A 3I4MB 2X6GA 4BD3A 4FF3A 1PVOA 1M30A 2YUNA 4C5HA 2XDBA 1GD7A 3SK4A 4M7DB 1S72Q 4YWKA 2PU9B 3G1JA 2NZOA 4KGXB 5I2YA 3NP8A 3E0EA 5GAMd 3Q24A 1Q82R 4PMBA 3CCUT 3I35A 2GCXA 2EYPA 2WKDA 1JORA 3JB9I 4IJLA 4EQOA 2KRSA 3TQ7P 4EMHA 3K0XA 2FL7A 3L7ZC 4MMLA 4EVOA 4ZNXA 3CCSQ 2CYZB 5L37A 2LRQA 4EPCA 3NWSA 2J6OA 2ICIA 2IX3A 1N33L 1D1IA 2D6FA 3TZDA 1MI2A 2Z1CA 5C4XH 4M77D 5FLXc 4XTXA 4PJOF 3G6EQ 1Z9FA 2N49A 1R77A 5HGTA 1RLQC 4G7OC 3FLGA 1CQFA 3I4NH 4Q0FA 4M78G 2R92H 1FX7A 5A0GA 3CPWP 1M9SA 4PNOA 4FNFA 3HOVH 2N88A 2CP5A 3K7AB 1HNZQ 2JA8H 1D6EC 2MYSA 2XN9C 3RKXA 4LFBL 4M4ZA 1VQCA 2DY7A 5IWAQ 2K5LA 3QWXX 3VRYA 3FPPA 1AH9A 1UGQB 4BY6B 1Q1EA 3G48A 1IBML 4LFCQ 3ONAB 3VUBA 2XD0A 2NYZD 3VKIA 4GN4B 4H44C 4DR1L 3CXCS 5GQOA 3F70A 2FINB 4F7UG 1GCPA 1NJIC 2B63G 3R2IA 3EH1A 3FB9A 3A8KE 1PKSA 5EKLA 3RMHA 5LMNQ 4IUQA 2L1BA 5LL6X 4BXXG 2DX1A 4IUNA 3HP3A 4FSSA 3QWYA 4IOCA 2JTFA 1YHQQ 2AWNA 2YV5A 3ZBDA 5C0XG 2A68D 5FLMH 2RQRA 4BE2A 1PLFA 3SFMA 1VMCA 1OZ2A 1Z6HA 2AKWB 3MC0B 2CZ1B 1H9JA 5HGQA 2CZ0B 4QKUA 1V43A 2BA1A 2EYFA 1XPRA 2OTLA 4JYAQ 1FYCA 3QDFA 4YCWA 1DM0B 5IP7H 2F0JA 3ASKA 5GJWB 1FL0A 3KJPA 2BDNA 5KH6A 3AYHB 1HZAA 1VQ7A 4KMUC 4KHZA 3K5NA 4C92D 2YU9B 4UP8A 4R4CA 1WHMA 2WAQG 1V1PB 3WOFA 3LWEA 1GFCA 1Q46A 1H9SB 4NXNQ 4F88A 4XK8E 4JI5L 1YJ9Q 4OWTB 4MN3A 3V96A 4IN3A 1F2YA 2IJ0A 3D4WA 4MMKA 2R58A 2RSOA 1L0WA 2QGFB 5CQXA 1YP5A 4M75C 4I7ZC 2W0ZA 3VYUA 3JAMi 1T3SA 1VQ4T 3N5BB 3H6ZA 2TMPA 2PNRC 4JI4Q 3ERQA 2Y0SG 4FYDA 4A93G 3SR1A 1ENCA 3T53B 4A3IG 2B2UA 1QZGA 2R7ZH 1JE4A 1VQNA 1I4XA 5CAIA 5KRUA 2OF1A 4V190 1PTOC 4KV6A 1CA6A 2QXFA 3E2UA 3I70A 2LJ3A 2CWPA 2DL8A 2E74C 2HMAA 5HK0A 2ZPGB 5ELOA 4HJ9A 2L0CA 3S17H 4BY7G 1M8VA 4ZKCB 1F9SA 3GQBA 1WCMG 3HRZC 2KNBB 1I07A 3BZDB 3INZA 3S15B 2L3QA 1Q81R 5GAMe 3OYDA 2E10A 2UXBL 1VQOQ 1CSQA 3MXUA 4IJHA 3NUCA 2B39A 3NPPA 1PH5A 1W6KA 4IURA 3KF8B 2P4TA 1ZQ1A 2NUTA 4YWMA 2B2WA 1WTQA 2OCEA 3EFOA 1MKHA 1L0XB 2H4OA 2D1XA 1J9OA 4MNOA 3H0GG 5M3MH 4A3LG 1S5DD 2IW3A 2A36A 4PNYA 2Y90A 1SDFA 4LNQA 2JZ2A 2JA7G 3UA6A 2CFMA 1PZJD 2XIWA 1ZBXA 4ELYC 1HQRD 2X69A 4A3MH 1QVPA 5I22A 3JCMf 4K5XA 5J22A 5C0XI 2DILA 2DXCA 1KD1C 1WJQA 1YITA 1B50A 5EBCA 4LDUA 1M3BA 3H3VH 2KVMA 4A3BG 1WTXA 1AWWA 1B53A 4CDDC 1R9TB 4C92C 1LABA 3QJYA 2A7YA 4LFAQ 1XWEA 4N9TA 3MPUB 2KDSA 2C0TA 4OB3B 4MDWA 1SBBB 3S2HB 2G6FX 2WACA 3I56A 5E7NA 1G2SA 4ORZA 2RD1A 1F1BB 5LL6S 3H15A 5T1GA 1EIYB 2EJGA 3UE1A 1LO5D 3F2CA 4RWSC 5J3BA 3CXCA 5EPLA 1WHHA 4F8MA 1PNJA 1VQJA 4AMCA 4DR6Q 3B6YA 3OW2P 1LACA 3E3XA 2OT2A 5IGFA 1STHA 3D6WA 1CKOA 4KH1B 2IL8A 5M5YB 3NFCA 1RJTA 3UDIA 2OX7A 2MUYA 2ATCB 3W1GA 1FXXA 4BBSH 3FJ5A 2EKOA 1ABQA 3X28B 3S3OA 3W3AA 4J8QA 4C8QA 1MIUA 3JCMc 5KYWA 2K5HA 1SAPA 5C5MA 1X6BA 4QQDA 2VGMA 4P2CB 5C4XG 1Q90A 1C7YA 2SEBD 4O5VA 4C0ZA
chains in the Genus database with same CATH topology
3F1ZA 2FVUA 2IY5B 5LJ3f 3I4NG 1N33Q 2R92G 1NY4A 2E65A 3VYGA 3OYMA 3HOVG 3CAMA 2JA8G 4KBMB 3CCRT 3P8DA 3MEAA 2AHJB 2LCCA 3CCLT 1LM0A 1AHJB 5J39A 3QO3A 4FDBA 3E9FA 4C3HH 4LFBQ 4A4EA 2BUDA 1SN8A 3JCMX 4EX5A 2RHXA 2Y4YA 5GAOr 2D62A 5M3FH 3HKZG 3CCVT 4M7AE 1IBMQ 1Y71A 4QVZA 4M78A 4DR1Q 1KQ1A 1M1FA 5KCOA 3V8KA 1I4K1 3G71T 3E19A 3A8GB 2HAXA 5FLMG 1I8FA 1EQQA 1L1OC 5IP7G 3CCJA 2ATWA 2K4YA 3X25B 5GANf 2R6GA 5IYBH 4JBWA 2JJQA 1LNXA 4F7UA 1TWHH 3GTMH 4YCUA 4OX9L 4VUBA 2F3IA 2WSCE 1Q7YC 4NXMQ 4MDXA 2GVBA 3DKMA 4JI5Q 2WP8J 2EJFA 3HRUA 4JS5A 4QY7A 2R7ZG 5JJLA 3CC4T 1YI2T 2I2LA 1NE3A 4N4IA 3M55A 3Q1JA 1Y1WG 2JK8A 2DZ9A 4J7FA 2WSFE 4O2DA 3J80i 1JJ2S 1SSFA 5LMUL 1BKBA 4WF2A 4RCCA 4LD9K 4M7AB 5LJ3j 5BR8L 2DIGA 1K3RA 3QDRB 4DAYB 4EMKB 1RL2A 1B70B 3RZOH 3E9IA 2UXBQ 1PYSB 5M3MG 2RO0A 4BBRH 4AQYL 4AYBE 3T1HQ 2ZZDA 4J6YA 3L2PA 4A3MG 4KLKA 2ASBA 2EAYA 1HXDA 3O8VA 2OTJT 3CQZH 3CMAA 3OTOL 2WSEE 1GO3E 3JC66 3QYGB 3GOXA 4NOYA 3J80E 5FJ8H 2XIDA 1YCYA 1N36Q 4D6WA 4XTCS 4M75E 4LDWA 4Q5WA 4YY3L 2X4XA 4E7JA 2FYKA 4IKFA 3M57A 1M1KU 1PFSA 5GANj 1X55A 4J7IA 4M77E 3G7ZA 3P8HA 4L5RC 4LF9Q 2R57A 2GF7A 2DZCA 3M4QA 4BBSG 2HQLA 2VXEA 2PVOB 3S24A 3M4OH 3JCMJ 3BJUA 1S72T 1U8RA 4TVAB 4M7DC 3GTJH 2JTMA 3FEOA 1UEBA 1TWFH 4C0GA 3CCEA 2I5MX 1JT8A 3CCST 3ULJA 3GTQH 3HOZH 5CKDA 1B7YB 4HA8A 3G6ET 2KENA 3HP9A 4GNXB 3GPLA 3OYJA 1I5FA 5IP9H 1GKHA 2DTHA 3WWVA 5M3FG 3K80C 2PMZE 4C92E 3TQYA 3G4SA 1YBYA 3A0JA 1FWZA 2B3GA 3BFMA 4UP7A 1G51A 2UXCL 4M75F 1N9WA 4N0AA 4BY6C 4M77B 1JJ2A 4CI0C 3FIFA 3L2RA 3UPUA 5IYBG 4M77F 4DKAC 4DR7L 3LGFA 1YHQT 2LQ8A 4LDXA 3RERA 3BW1A 1E24A 2YTXA 4BDYA 2GVAA 3OYLA 3JB9H 1G5VA 1QUQA 1X6OA 4OX9Q 3CBPA 3ULPA 2IX0A 4L5SA 1BI3A 2KSSA 3GDEA 3PF5A 2X4YA 1YJ9T 5GAN8 2JN0A 2ZCFB 1P92A 1HJPA 4OP0A 1CKMA 4J8OA 1I3QH 1N32Q 3JCMd 1WJSA 4OXPA 1HZ9A 5IYCG 4C92B 3CBOA 4IFDJ 1VQ6A 5LMUQ 4YHHL 4LDYA 4C92F 1VQ9A 3KDFB 1CKNA 5BR8Q 3WVDB 4R4TA 1VQOT 1EWIA 1EYGA 5LJ5h 2MNAA 4EQ5A 4OWXB 5LJ5g 4AQYQ 3MEVA 1G3YA 3M4YA 3M3YH 3ICEA 3TS2A 3RLNA 4B3TL 3UDXA 2ZTEA 5FJ8G 4XU0A 4APVA 3LWIA 3M56A 4PJOG 1VQ8A 3OYNA 3OTOQ 1VQGA 5GMKl 5A0DA 1BIBA 4XU1A 3ZFJA 4BB7A 2PVDB 2N78A 2LDMA 3GO5A 4POFA 4LF6L 3I7FA 3EFRA 2PQWA 4OB0B 3MEFA 3HRTA 4HIDA 3CCMA 3U58A 1JJGA 1VQBA 4JJNK 2MWPA 5CK9A 3EIVA 4M78D 3U4ZA 5AJ3L 4POGA 4NL2A 2F5TX 2GFUA 2RHIA 2ZPFB 3HOZG 4KUDK 3CPWS 1FJGL 4IPHA 2I5HA 2PUKB 1OTCA 4DV0L 3SB2A 4LF4Q 3A5ZB 5IP9G 4LDVA 5C0MA 1D3BB 5GANd 4IOAA 4HJ8A 1E7ZA 2DGYA 4PKCC 4A76A 1QP2A 4JV5L 4C0FA 2MF2A 4O6JA 1UE5A 3PIPA 2KCTA 1K8AU 2IG0A 4GN3B 3STBD 2OAUA 5DLOA 1BYMA 4E7HA 2Z6KA 3J81c 2CQOA 4L59A 4J5YA 3PUVA 2UXDQ 5CKEA 4DV5L 1X9NA 4ZTFA 2JOYA 3JB9G 1W3SA 2PQAA 1YNXA 4M7DE 4DK3C 2VUMH 3SGIA 4DV7L 1YHBA 1U1SA 4IPGA 1P16A 2WFWA 3JAMc 4GOPA 4E7LA 4LUOA 3FDRA 4Y91A 3OYAA 2ZM6Q 5LJ3e 2EQJA 1SLJA 5FU7B 3TU4K 3QPHA 2D0PA 3H0GH 4OONA 3C12A 3S3MA 3J81j 1G3TA 2JA7H 1WJJA 4DUZL 4C2MH 2NVYH 3A5UA 2K5VA 4JLGA 1FGUA 1AE3A 2P0PA 4YHHQ 3OYKA 3ZJYC 2D0OA 4X34A 4A3BH 3RR5A 2QDYB 5C4JH 4M7AC 1N34Q 1YJNA 4C8QG 5GMKj 2ZTCA 1I5LA 1JE5A 4EMKC 1X54A 3KF6B 3JCMb 3CPWA 5GAHC 2DPPB 2OTLT 1D7QA 2F4VL 4JOIA 1PH3A 4B3TQ 1VQ7T 3A8OB 4M7DF 1M90U 3HFNA 2L5QA 1YJWA 2HHHQ 1Y96B 3PCOB 1B34A 2M16A 3LLRA 3OW2S 1XPUA 2VYTA 1PH7A 2ZJPA 4IO9A 1TWCH 4ZN3A 4BACA 4PJOA 3JB9J 2R93H 3JCMQ 5GAMh 4B3RL 3CMEA 2MWOA 1VQNT 5GAMg 3K81C 4GLAC 2RI3A 3HFOA 4JI2L 1PSFA 3LYIA 4HKEA 2E12A 3S1NH 5AJ3Q 1I94Q 4NB3A 3CEYA 4JUVA 4C5IA 1UE6A 4QVCA 4DR5L 2O4XB 1FJGQ 2DIQA 3META 1KXLA 3FKIG 1O7IA 4DV0Q 2Y4XA 4JI7L 5JJIA 2HIVA 4OGEA 3I4OA 1IBKL 4KUIA 4OVAA 1KHIA 3OYYA 5FRMA 4GNXC 1WYDA 5D6WA 2KHJA 1YITT 2WB1G 4UY8C 3M53A 3OB9A 2E6NA 4A3DG 4BDZA 4X64L 2ES2A 3GTPH 4FIBA 5I2SA 2DK3A 4HCBA 1I50H 3PMIA 1Q1BA 4DV5Q 4M77C 3I2ZA 4LF7L 2VUMG 4XQ3A 4HIOA 1UGSB 2E41A 1PYBA 4LW1A 4AIMA 1VQ5A 5M5XH 2E8GA 4XTUA 2RJEA 1Y1WH 4DV1L 1P8LA 1VQAA 3S16H 3HPWA 3PGZA 1U5KA 3HOXH 2E5LQ 3GTOH 2MAMA 2JE6I 5ELNA 4OO1I 2EIFA 3S6WA 4JRIA 1KQSS 2VQFL 1VQFA 1VQKA 3J80c 1A8VA 3OW2A 2PI2E 1HNWL 1PV4A 3RLOA 3HL8A 1XJVA 2HNIA 3V8JA 3L2ZA 4DUZQ 4IPCA 1TWGH 2LXKA 2M9UA 1HH2P 2F52A 4R4IA 1E3PA 3RNUA 2PVGB 2L15A 5C0XJ 1IYJB 2RHSB 4E7KA 3CCJT 1YHAA 2VW9A 2QA4T 4AH6A 2F4VQ 4M78E 3P8BB 3BZCA 2RK1A 3T1YL 5FROA 4A3FG 3S14H 4WJ3M 1PSEA 4TQUS 2CKKA 2XHCA 1JJCB 1X3FA 1VQ4A 3OYCA 3JRZA 3EN2A 2R93G 3GNGA 2KHIA 1KIXA 1VQDA 2ZPIB 2E70A 2XTIA 4PL6A 2DTIA 4A4FA 3ME9A 5I21A 3D0FA 1PH4A 4M75G 4YWLA 4B3RQ 1M1KC 3PT9A 1B8AA 3I55A 3CC2T 4JI2Q 2R5AA 2NN6I 2DO3A 3PMTA 1Q86U 4H02A 1Y1VH 1PH8A 3MEWA 3S2DH 3QUIA 2WAQE 1E1OA 1LTLA 1PA6A 4DR3L 1ASZA 3NTIA 2K2VA 4LWCA 1WFQA 2ZPEB 3ERSX 1SFOH 5EG2A 3T9NA 4M78B 2VS1A 2Y0SE 1IBKQ 3DLLA 4A3JG 4BI3A 2R5MA 4M78F 1KQSA 3AQQA 1XMQL 3GTKH 2AWOA 4FT4A 3BY7A 5M5WH 2RHYA 4F7UB 3Q8DA 1H3ZA 5GROA 4X64Q 2YYZA 3AFPA 4JI8L 2X35A 1JB7A 2UUAL 3LX7A 3S1MH 3LGLA 2LT1A 3PUWA 4NS5A 3L1AA 4A3EH 2UUCL 3URGA 2QQBA 5IAYA 1N8RU 1D8LA 5CR2A 2UUBL 4YCVA 2KAFA 2H5XA 2K5NA 3HOXG 1XNRL 1K9MU 4Y28E 2LNVA 5IYCH 1V1QA 4DV1Q 3WVEB 2EQMA 1WPYA 4M7AF 2RI5A 3SWNA 1K73U 2YLCA 2MMPA