2EIFA

Eukaryotic translation initiation factor 5a from methanococcus jannaschii
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
133
structure length
133
Chain Sequence
MVIIMPGTKQVNVGSLKVGQYVMIDGVPCEIVDISVSKPGKHGGAKARVVGIGIFEKVKKEFVAPTSSKVEVPIIDRRKGQVLAIMGDMVQIMDLQTYETLELPIPEGIEGLEPGGEVEYIEAVGQYKITRVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (EUKARYOTIC TRANSLATION INITIATION FACTOR 5A)
publication title Crystal structures of eukaryotic translation initiation factor 5A from Methanococcus jannaschii at 1.8 A resolution.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Gene regulation
total genus 23
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 1998-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2eifA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2eifA02
3HKSA 2UXCQ 3UDIA 4IO9A 3CCLT 1CSPA 3M4PA 5C0XJ 1UE5A 5C4XH 3L2PA 1XPUA 2VW9A 1QVCA 3RR5A 4C3HH 3L0OA 1EOVA 5M5YH 1NJIC 4R4OA 3CCQT 3CCSA 2QA4A 1VQBA 2JK8A 1JJ2S 3J7ZC 5IWAL 3CCET 4GN3B 1X3GA 4X66L 2BA1A 4NPSA 3NENA 3KF8B 2OQKA 4DV1Q 3L7ZC 2LXJA 2IHFA 1E1OA 3HOYH 2HHHQ 3AFPA 4JI6Q 3EBEA 4IPHA 3J80i 1Q86C 2JA7G 4DUYQ 4XIGS 2UUBL 4LFCQ 4DV4L 4DV0L 4BBSH 3FKIG 5M5WH 1CKOA 2ZM6L 1WJJA 2I5LX 2PNHA 4IJLA 5GQOA 4A3MH 1R9TH 4DR5L 3S24A 1TXYA 2UU9Q 2OTLA 5AJ3L 3TRZA 2RHSB 4GN5A 5IYDG 4XTCS 3FHWA 4APVA 2JEAI 4YCUA 1HNXL 1VQFA 2Q2UA 1L1OA 3BU2A 4HJ8A 1Q86U 4A3BG 1VQ9T 2CKKA 3K80C 4LNQA 2WB1E 4YCWA 2R7DA 1K83H 3I56A 3U50C 4OWWB 4HJ5A 1Y1WG 1LYLA 2ID0A 1K0RA 1N33Q 1D7QA 1OXVA 1VQAA 4DR3L 1HNWL 1QVFS 1UWVA 5BR8L 4C2MH 2OWOA 2F4VQ 2D0OA 1H95A 1C9OA 2RHQB 2JA8G 1SSFA 3B6YA 4H02A 5M3FH 2PQAA 1VQ6T 4J15A 4DKAC 2YTYA 3J81c 4O2DA 4AIMA 2IX1A 4JYAL 4DV6Q 4IOCA 3M9BA 4PMWA 4HJ9A 4TQUS 3CCQA 2WB1G 4LF8Q 5GAHC 3D31A 5J26A 3S1MH 3HOWH 3S14H 3CC2T 2MWOA 1VQLA 4EX5A 4A4IA 4OONA 1N34Q 1OXXK 1C0AA 4BY1G 2AWOA 1GM5A 3ER0A 2IT1A 1L0WA 1VQMA 4JBJA 3RLOA 3RLFA 3STBC 2LCLA 2VQFQ 4DR1L 3I55T 3ULLA 3F2CA 4IJHA 4OXPA 1OXSC 1QUQB 4JI5L 2BH8A 3CCUT 1K9MU 1MJEA 1P16A 3PO2G 1I5FA 2AMCB 2VQEL 2PI2E 3G4SA 2E2JH 1YJNA 1KL9A 1FJGQ 4B3RL 2R93H 1Q81C 4A3DG 3CCRA 2WFWA 1KQSA 1YI2T 1VQDA 3CXCS 2OTJT 2AKWB 1UE7A 4A3EH 4JCVE 5LMUQ 2E2IH 3I4NG 5EAYA 1XMOL 4AQYL 4LF7Q 3OTOQ 1VQPT 2N3SA 4Y52H 4LF4Q 2R7FA 3W1GA 1WFQA 5K36G 3S17H 2YYZA 3K0XA 1KAWA 1MJCA 2CQOA 4YWMA 3PO3G 1PH4A 5M3MH 3E0EA 3E9HA 4BA2I 2IHEA 4BBRH 5GROA 4JI8Q 3TEHB 3S16H 1LM0A 2K75A 4GKJQ 4RG1A 5J3BA 3PUZA 3IRBA 4KHPL 1WCMH 4FDBA 4QQBX 5GAGC 5E7NA 1B8AA 1J6QA 5IP7G 3J81i 1N36Q 2UXCL 3AEVA 2R7ZH 3J7AF 3GTPH 1XTDA 1HR0Q 2JA5H 3HFZB 1NZ9A 1YVCA 1RIPA 1VS0A 1VQ8T 2E8GA 2ZTDA 1K73U 3CCVA 5LMNQ 1EQRA 4P72A 3ZJYC 4GOPB 2B29A 2LSSA 4QQDA 1CSQA 1TWCH 3U4ZA 4A3LG 4NXNQ 1EIYB 1TWAH 4NXMQ 4OO1G 3LGLA 2ZJQA 4JI2Q 4JI6L 3K7UC 4A3GG 1RL2A 1NY4A 4DUYL 4R4QA 1X6OA 4LFCL 3FP9A 5IYBG 4A3KH 1Q12A 3CD6A 4Y7NH 2NVTH 3J80E 2ALYB 3G6EA 1PH8A 4A3CH 1KRTA 3I4MH 3HOXH 3P8BB 1Z47A 4KHZA 3TREA 4YHHQ 5IAYA 5M5XH 4P71A 4P75A 1VQ5T 3J7A5 1PYSB 1AE2A 1SN8A 1TWGH 1HR0W 3HOZG 5DM7R 2E5LL 1YIJT 4DV5Q 3STBD 4YTLA 3GO5A 2HIVA 4DV7Q 1PH3A 1VQJA 1N33L 2JA6G 2NVQH 1B7YB 1XNQQ 1M90U 5LMNW 4GNXC 3LGFA 2F4VL 1D8LA 2IY5B 4HIMA 1S72A 1N32Q 4IFDI 1Y1VG 4DR2Q 2ES2A 3GDEA 2DUDA 4DV6L 5FLMH 1EIFA 1XMQQ 2EQSA 4C3IH 2JOYA 4YY3L 3KF6A 1AH9A 4LF8L 3CC4T 3TS0A 4JC0A 3GTMH 1YITA 1X55A 5LL6S 1N8RC 5JJKA 1J5EL 1NBWA 4UP7A 3W1BA 1BBUA 4GKKQ 2B63H 1AE3A 4A3FH 4K0KQ 1U5KA 3G71A 1I6HH 1YJWA 1N34L 1GKHA 3I4OA 3CC7T 1NJIU 2JA9A 2VQFL 2R92G 1HH2P 3JAMc 2Y0SE 5C3EG 2CCZA 1Q82C 1IBLQ 1W2BA 4R4CA 3K8AA 1S3OA 3CCJT 1G51A 4LF6L 1BKBA 1G291 4WJ4A 1BVSA 5GADC 4JI3Q 5IE8A 1YHQT 1PA6A 1SMXA 4LUVA 3UE1A 2F3IA 3PV0A 2ASBA 2KENA 4DUZQ 3H0GH 4X65Q 2MNAA 3MEFA 2UUCQ 1O7IA 1WI5A 3CMET 2QEXT 4IOAA 5LMUL 3PGZA 1VQOT 3F8TA 3ICEA 1E24A 1VQHA 4JOIC 4GNXB 2N49A 1IBKQ 2R6GA 4LF7L 1Q1EA 3OTOL 1PVOA 1UE1A 2Y0SG 2MO0A 4A3IH 3CPWA 4LF4L 2R93G 1KRSA 4JI7Q 3CCLA 4O0AA 3UE0A 1Q8KA 2UXDL 1V9PA 4JBKA 4TVAB 3U4VA 1G6PA 4A3EG 3M7NA 4JI8L 4L5TA 4GKJL 5JJLA 3LH0A 2XTIA 3BZCA 3EN2A 1I94Q 1W2BS 3I2ZA 1YZ6A 3M4QA 1UE6A 1N36L 2YTVA 3CCEA 1QZHA 4RG2A 1HR0L 3KDFB 1VQ4T 3DLLA 5FJ8G 3T1YQ 3S2HH 4OO1I 1L2FA 1I50H 1CKNB 4JI1Q 4UP8A 3CMAT 3J81E 4BBRG 3CQZH 4PG3A 4X62Q 4A75A 5LMNL 1WOCA 3CCMT 1WCMG 3CP0A 2YV5A 3JC66 4R4IA 2JQOA 4PZ6A 2L3RA 2K50A 4NXNL 5FLXc 3CF5A 1SRUA 2NZOA 3F2DA 3RN2A 4OX9Q 4JV5Q 4JI4L 3E9IA 3CPWS 2Z6KC 2ZTCA 4JG2A 3JAMi 1XJVA 2E70A 2UXBQ 5DLQE 1VQEA 1VQNT 4YWKA 4A93H 5IYDH 2K4KA 4GLAC 2A8VA 1VQ9A 3KYHC 3K81C 2MWPA 2IG0A 5C44G 2UUBQ 1NPPA 4LF5Q 1QVGA 3KJPA 1LUZA 3KOJA 1GO3E 4YHHL 4GNXA 4A3BH 3A74A 1X56A 2NN6I 2JNGA 1Y1WH 3A5ZB 3T1HQ 1Q81U 2D0PA 3AFQA 2NVXH 4IPDA 1YJ9T 5IP9H 5HY6A 4B3TL 1YHBA 1VQ6A 4POGA 4LF9L 4DV5L 2JEBI 3ULPA 4A3CG 1XNRL 4DV7L 2BA0A 1JE5A 4LWCA 3HOVG 4A3JG 4UP9A 1EFWA 4L5QA 4JI0Q 1IBMQ 1XNQL 2KHJA 4DR4Q 2KDSA 1UEBA 3HOUG 1T9HA 4X64Q 1N32L 1VQKT 3RLNA 1KQSS 4DR2L 3CC2A 1VQCA 2AWNA 1I3QH 3D0FA 1KHIA 2OCEA 2V1CC 3H15A 4L5RC 4GOPC 1XMQL 4P74A 2A19A 1YEZA 5ELOA 4RMFA 3GD7A 3ULJA 3KJOA 4DV1L 2LXKA 1PH5A 1QUQA 5JJIA 4BXXH 3I55A 5C4XG 5IT9c 2HHHL 2VUMH 1ASZA 4LFBQ 4B3SQ 3KFUA 1SROA 4GKKL 4K0KL 1QZGA 3CCUA 2HQLA 4KI0A 3LGJA 1K8AC 3S15H 4TVRA 3GTGH 1KD1C 2GN5A 4DK3C 5HGQA 1YI2A 2MQHA 3F1ZA 3CCST 2UU9L 3GTOH 2QA4T 4JOIA 1JT8A 2OTJA 1TWHH 1IBLL 4A3DH 4MZ9A 4DR6Q 3HOYG 1P8LA 1IL2A 2YU9H 4X34A 4LFAQ 1KC8C 5H1SE 3GTQH 4DR1Q 2B63G 3VDYA 4A3FG 1VQPA 1HNZQ 3J81j 1VQGA 4BBSG 4DUZL 4A3MG 1E7ZA 4X65L 2VL6A 4GN4B 1HZBA 2UUCL 3S1RH 1KD1U 3ERSX 3NEMA 5IYCH 3CW2C 4B3MQ 1PYBA 1PH9A 1SR3A 1IBKL 2EXDA 1YBYA 1PFSA 2Q2HA 4HJAA 1GD7A 2VZAA 3UDFA 1VQ7T 3M4OH 4JI7L 3A0JA 2N8NA 4LUOA 4DV3Q 2WP8J 2VUMG 5C0XI 4IFDG 3H0GG 2Q2IA 4AQYQ 3M3YH 1X65A 3MXNB 1M1KC 4PZ8A 1VQ8A 1E22A 1B70B 5JEAJ 4ALPA 4GOPA 3PIPA 2K5HA 4DAYB 1PH6A 1I94L 1JMCA 4BY7H 3I56T 1A8VA 1PH2A 1Y14B 1IZ6A 2Z6KA 1YNXA 5M3FG 2MFIA 4R1JA 4MNOA 4OWXB 4C3JH 2Z0SA 3DB3A 4BA1I 4JI1L 4DV2Q 1PHJA 4IFDJ 3DB4A 4X62L 4UY8C 2ATWA 1FVIA 4WJ3M 2PQAB 1M1KU 3H3VI 4A3GH 3G48A 2B3GA 3PCOB 4DR6L 4OX9L 3HOWG 4DR7L 1KXLA 1HZCA 5IYBH 2CKZB 4JV5L 1HJPA 1X54A 1WYDA 1FJGL 1N8RU 2DO3A 4DNIA 2UXBL 1LTLA 1VQLT 2HIXA 3W5OA 2I5HA 1EWIA 4DAMA 1QVFA 4LUZA 3WWVA 1VQ5A 3KLWA 3JAME 2KCTA 5GAEC 3M85A 2GVAA 1VQMT 2DGYA 2K52A 4JBWA 1Q46A 1Q82U 4QL5A 1YIJA 1M1GA 2K5NA 2OQ0A 4LF5L 3RZOH 3GTLH 4EQ5A 4DR7Q 3HOZH 2I0QA 1U0LA 2VS1A 3NELA 1NPRA 2L15A 4YWLA 3TS2A 2CWPA 2JA6H 3PUXA 4A93G 2HT1A 3G4ST 1CKMA 1YJNT 3T1HL 1IYJB 1VQ7A 1VQIA 1EQQA 3CCRT 2G3RA 2UUAQ 3K7AH 1EUJA 3PUWA 1A62A 1S40A 1GVPA 1ASYA 3H3VH 1Y1VH 1PH1A 2LVMA 4QGUA 4ME3A 4R4TA 4JI0L 4DR4L 1IBML 2KBNA 1OTCA 1MKHA 2AHOB 2E5LQ 1JB7A 2RF4A 3CC4A 4X64L 4HIDA 3S1NH 1DGSA 3HKZE 5M3MG 1XPOA 5IP9G 1XNIA 3UDXA 2VNUD 1IXRA 4JBMA 2MO1A 2CWAA 3CC7A 2LQ8A 2N78A 1SLJA 2JA7H 1HZAA 4NXML 2R7ZG 1FL0A 5C4JH 4LW1A 2JA5G 3FKIH 4P73A 4QY7A 1OXUA 1A0IA 3CXCA 1Q7YC 4JI2L 3CCJA 5IWAQ 4LFBL 4B3SL 3F2BA 2R92H 4YY3Q 5C3EH 4X66Q 2ZJPA 3SGIA 1X3EA 1YHQA 1K9MC 2ZTEA 4OWTB 4MTNA 4QJFA 1JJGA 1K8GA 3NBHB 3HKZG 1J5EQ 1Q1BA 5ELNA 3S2DH 3CCVT 5FLXE 4DV4Q 2QGQA 3CMEA 2QEXA 2VY3A 2ZM6Q 4DV0Q 4BXXG 1VQOA 1YHAA 4LFAL 4DR5Q 2MI6A 4PZ7A 4HJ7A 3UDGA 3PUVA 1Q7YU 1A63A 5AJ3Q 1HNZL 1E3PA 2NN6G 4KLKA 2XHCA 4A3KG 4IPCA 3PIOA 1HZ9A 2JJQA 2EIFA 4GLXA 2E2HH 4L5SA 1HNXQ 4LF6Q 2XGTA 1EYGA 2JA8H 3KBGA 2WAQE 3I4MG 3CD6T 2F52A 3HOXG 1BBWA 1VCIA 3I7FA 4B3ML 2IX0A 3U58A 3BJUA 4DK6C 4POFA 3G6ET 2KHIA 1X3FA 3KDFA 1TWFH 1X9NA 1PH7A 4DV3L 4DR3Q 3GTKH 1VQ4A 1CKNA 2GVBA 2JVVA 2PMZE 3Q8DA 5BR8Q 2JE6I 3S1QH 1HNWQ 3CMAA 1CUKA 4HIKA 5IYCG 4HIOA 2PI2A 5FJ8H 1PV4A 2UXDQ 1L1OC 1QVGS 1K73C 1SE8A 3CCMA 2NVYH 4DPGA 4BY1H 2Q2TA 4ZN3A 4AYBE 4AH6A 2WAQG 4JYAQ 2JUFA 3CAMA 3PSIA 1NE3A 2YTXA 4A76A 3OYYA 3OW2A 3AYHB 4UPAA 2NZHA 1KIXA 4DV2L 1S72T 4GLVB 4GS3A 2C35B 2ZJRA 4NB3A 5FLMG 4X6AH 3PO2H 1VQNA 4CRIA 1NMFA 4BY7G 2H5XA 1FGUA 4QIWE 5IT9E 4JI3L 3BZKA 3PF4A 3AQQA 3KF6B 4IPGA 4YCVA 2KVQG 5IY0A 1YITT 3EIVA 3J80c 3RN5A 1XPRA 2I5MX 4JI5Q 4AYBG 1N9WA 5C44H 1E1TA 3I4NH 1NMGA 1V1QA 5JEAG 1K8AU 1Z9FA 3RNUA 3G71T 2D62A 1YJWT 2K14A 2E6ZA 2VQEQ 4ZN1A 1W3SA 4JI4Q 4B3RQ 1YJ9A 3CPFA 2A1AA 1JJCB 3PF5A 2RCNA 3PUYA 3PO3H 2OTLT 2FXQA 1JJ2A 2KCMA 3OW2S 1KC8U 5A2QE 1K3RA 1M90C 1XMOQ 3HOVH 5IP7H 1V43A 5C0XG 1VQKA 1C7YA 4A3JH 1SFOH 1L1OB 2UUAL 3A5UA 3HOUH 3RZDH 2BH2A 1MIUA 4A3IG 3GTJH 2K5VA 4B3TQ 3TQYA 3DM3A 3T1YL 2CFMA 4LF9Q 4KHPQ 1XNRQ 1NTGA 4A3LH 1OXTA
chains in the Genus database with same CATH superfamily
1UB4A 3VRYA 3VS7A 4KD3A 2CREA 1UGQB 2DX1A 1DM0B 1RTNA 3UDIA 4MDXA 4PJOD 3L2PA 1ABOA 1V1PA 1XPUA 2VW9A 4KUDK 4N0AA 1QVCA 1M90R 1NJIC 4AFQC 3CCSA 5EPJA 1BCPC 3NGPA 1M2VA 4D8KA 1U1SA 1X2QA 3UPUA 1JJ2S 3A54A 4MMKA 1ACMB 3DWQA 2VWFA 4GN3B 4UHVA 2K5FA 1B1ZA 1S5BD 3NENA 1EOTA 4PJOA 2E5KA 1X2KA 1VIEA 4OMLA 1B3AA 4JRKA 5M3MB 4DV1Q 5E4WC 1M5Q1 2D9TA 3TVTA 4JI6Q 3EBEA 3HOYH 4IIMA 2CZ7B 4PNOA 4G7OC 4F7UB 3CMEQ 2JZ2A 1PMRA 1Z7TA 2D0QB 1WJJA 4IJLA 5GQOA 2D1XA 1H92A 1SYGA 2X4WA 4NOYA 4EGVA 2KY9A 5NUCA 4QF4A 2UU9Q 2RHSB 4RHSA 3K5LA 1WX6A 1NJIR 4YCUA 2J05A 2K3BA 3MXNA 3MEWA 3FEOA 1B9NA 3HKZB 2EYOA 1JJ2P 3L3OC 1UNSA 3V7CA 2KROA 1Q86U 4A3BG 1TWAB 2RDGA 3FEWX 4YCWA 5C5MA 4OGQC 1EY6A 1WFWA 1TTHB 1K83H 5JOBA 4OWWB 5LJ3d 1LYLA 2ID0A 1V8QA 1HJDA 3HFNA 2RCFA 2DETA 5KYYA 3QJYA 1WJRA 2M1HA 5BR8L 1MHNA 3EG2A 1TH7A 4X9CA 2D0OA 4BI3A 2V8KA 1I07A 2X4XA 2RHQB 3CU7A 4H02A 2JA8G 1Q95G 2NVTB 2EJMA 2LX7A 4HAEA 2HMAA 1BQQT 4CDEC 4Y28E 5GANe 4KMUC 2AZSA 3BVGA 4DV6Q 4FYYB 1R0BG 2DL8A 2JTMA 3FRNA 2KRMA 1OZ3A 2B8AA 2ED0A 3LW5E 3JB9H 2KR3A 3RERA 1KIKA 3S1MH 4KK7A 1PYWD 1WD0A 3S14H 2K5LA 2MWOA 1VQLA 3CC2T 3L2UA 3ERQA 5I2YA 1N34Q 5C4ZA 3W2DA 2XMFA 1GM5A 2IT1A 3SHWA 2VQFQ 1OPKA 2COZA 3QXEB 2X3WD 2WAQB 3H0HA 1O75A 4IJHA 1OXSC 2QEJC 1K9MU 3E1SA 1P16A 1O80A 2F03A 2VQEL 4OB0B 1PTOD 1QB5D 1YJNA 1VF5C 3P1HA 2E2JH 1TUCA 1Q81C 1JWSD 2WFWA 4LK1C 3SK4A 3GTMB 1GCQA 1KFZA 4A3EH 3G1JA 2AKWB 5C5LA 3OOCA 1SMYD 3QDRB 5LMUQ 1B34B 2DEQA 2MMPA 4UC4A 5IGFA 4LF7Q 4IZ8A 3OTOQ 1QCBD 4AYBB 2YXYA 3HRUA 3E19A 2R7FA 3W1GA 4E47A 3K0XA 1KAWA 1MJCA 3NPFA 3NWTA 1JU5C 3OYHA 3G6JB 3E0EA 1TS3A 4BA2I 5GROA 3TEHB 4C8QC 2CUDA 2K75A 3S16H 2F5KA 1WCMH 4QQBX 1PG5B 1Q81R 5E7NA 4D8DA 2YWWA 2AKKA 4AFUC 1J6QA 2VB2X 4TRDA 2R7ZH 4ZK9B 1HR0Q 4M77C 4HT8A 1D1KA 2EQMA 2AK5A 1RIPA 1VS0A 3IFTA 5FRMA 3JV3A 2F0MA 4CC3A 4BDYA 3CCVA 4D6WA 3CCSQ 1ABQA 2K03A 4A3IB 1X75C 4QQDA 3HOZB 3U4ZA 4A3LG 3OYFA 1FXXA 4VUBA 1EYDA 2XWJB 4NXMQ 2JM9A 1YCSB 2DTIA 2PNIA 2ZJQA 1UJYA 4M78D 4JI2Q 2FYKA 2SOBA 3K7AB 4LFCL 2A74C 5IYBG 1XOVA 2DRMA 1B3QA 3CD6A 2Q8RE 4Y7NH 2DVJA 2ALYB 1PH8A 1I50B 2VB3X 1UJ0A 3EHQA 4M78A 3EVQA 2KI7A 1SXTA 3ZBDA 3FB9A 4PMCA 3GP7A 1JQYD 1SN8A 2JA7B 2DRKA 4JUVA 1PFNA 3QWNA 3R3OA 1CZWA 2E5LL 3STBD 2HIVA 1VMCA 4DV7Q 5C3EB 4M77B 4F17A 5GAOl 1B7YB 5LMNW 2AQ3B 1S5FD 2KT8A 5KYIA 1S72A 3CBOA 3I73A 5D3IB 2YUQA 3OW2P 5JJZA 3GDEA 5GMKi 1ENCA 1W6JA 1LVKA 1QLYA 1ZYRC 2DUDA 2RQXA 4KY5A 3R93A 1Y1WB 2KMTA 1T0JA 2EAYA 3E2UA 2RHZA 5LL6S 2E2HB 1NBWA 4X3SA 2DM1A 2V1QA 1BBUA 4A3FH 4J6XA 4RCOA 2HBPA 1AWJA 1U5KA 4O42A 2B63H 1G3WA 2PVOB 3UA6A 3HRTA 4M7DD 5CBAE 1D3BB 1D1CA 3H8ZA 1HH2P 5CV4A 3FDTA 2L89A 2WSEE 3JB9G 2CCZA 1IBLQ 3BYYB 2B86A 3CCJT 1MI2A 1K1ZA 4EMKA 2DL4A 2WB1B 2HL5C 4RGTA 1WGSA 1JEGA 1YHQT 1UGRB 3LWIA 1SEBD 3UE1A 1D6EC 2F3IA 3PV0A 4M7DA 1B4OA 2JTEA 4BY1B 2UUCQ 1WI5A 2VUMB 5CQXA 1KQ2A 4XQQA 1VQHA 2I2LA 2R6GA 4XDXA 4HN7A 1QOHA 1UE1A 2Y0SG 2MO0A 4LF4L 3CPWA 2MGSA 2KYMA 3CCLA 2QDLA 2HAXA 2KRNA 4KJOA 1MMNA 1HYOA 3BFMA 4A3EG 2YU9B 3GTQB 5JJLA 3BZCA 2OAUA 4ODGA 3PIP3 2FVUA 2O4XA 5IXFA 3J80L 1N36L 5C44B 3KF8A 3DLLA 3T1YQ 1U4LA 4EQPA 2F2WA 2NUCA 4K14A 2CH4A 2QQAA 3CC2Q 5F2DA 3OYJA 1GOZA 4PG3A 3PO3B 3CCVQ 4K8JA 3M4OB 1WCMG 1Y8NB 1XYIA 2HSEB 3X25B 1QJOA 4RKUE 1STAA 1SRUA 2NZOA 3ME9A 4KKUA 3JAMi 2EYFA 1G2SA 4ZQ3A 2KHSA 4BDZA 1PFBA 1VQEA 4YWKA 3RMSA 2L12A 1I5LA 4JRIA 5GAN4 3VYGA 2RI2A 3CD6Q 1SAPA 3M0PA 2M0OA 2B2TC 3H9NA 2E1HA 3K81C 2MWPA 2A6HC 4JRQA 2UUBQ 1NPPA 2JXMB 5M5WH 1CK1A 1CQVA 2JMCA 4ILWA 3OW7A 3A74A 4CGYB 1X56A 4HCCA 1FD7D 2K9GA 1VDZA 5K5PA 4HEDA 3VA7A 4A3GB 3T9NA 3QOLA 3C94A 2HDAA 1VQ6A 1QWYA 4DV5L 2JEBI 3ULPA 1XNRL 3MA2B 2BA0A 5EKIA 4LWCA 5HK3A 3TSZA 1XNQL 5DEHA 2V8JA 1ET6A 1WJQA 2PTKA 2XVSA 4X64Q 1OV3A 1S72Q 1CA5A 3JB9F 5E1FA 4A93B 2COYA 1UECA 1WXTA 2P0KA 4M75B 2K5QA 2AWNA 4OL7A 5I2XA 3MP6A 4DR2L 3RZOB 2OCEA 3H15A 1XMQL 4X3TA 4AG1C 4M75E 1F2ZA 3VS6A 1YEZA 2DNCA 4RMFA 2JA6B 3EFRA 5LJ5g 3I55A 2JMAA 5C4XG 2E76C 1QMCA 2CZ6B 2E4HA 3I35A 2X4JA 3H94A 2HQLA 1QZGA 3VKIA 1BCMA 1N5ZA 1PSEA 1Y1VB 4TVRA 2RM4A 3GTGH 5HGQA 3TP5A 1ET9A 3GTOH 1JT8A 2DMOA 2EJFC 4RKLA 4A3DH 3ULRB 1QCOA 1P8LA 4LFAQ 1QQJA 5H1SE 1CKAA 2KEAA 2B63G 4A3FG 5CR2A 2ZPFB 2QK0A 2J4XA 1MMGA 4BBSG 2EYQA 4XK8E 5LJ5j 4P5NA 1E7ZA 1YNND 1RAFB 5HURA 1C6VX 4U68A 1N6AA 4B3MQ 1PH9A 2KE9A 5AT1B 3UT1A 4PFOA 3UATA 4KH1B 1AWWA 4QT7A 1EYCA 1PFSA 1SR3A 2ROTA 2VZAA 1WA7A 1HQMC 3CCLQ 1O78A 3PMTA 2N8NA 2YRDA 4IFDG 4KGVB 4M7AE 2QDBA 3ONAB 3BVMA 1X65A 5CMDA 4XTWA 1M1KC 5IXBA 5T1GA 1VQ8A 1EL0A 4J1MA 4ALPA 2IX3A 4HTHA 4DAYB 4FF4A 4QCLA 2R5MA 3KLSX 1WTVA 1PH2A 4KHVA 2CZ1B 1IZ6A 1Y14B 1YNXA 2Z6KA 4AG2C 5M3FG 3L9AX 4M7DE 2R93B 2Z0SA 4BA1I 4JI1L 5CQYA 2E41A 1MNEA 4AFZC 1WLPB 4C92E 1FNWA 2KEEA 4X62L 4UY8C 3OS1A 1DONA 3QHSA 3C3LA 2PQAB 3QB3A 3CBMA 5EC7A 4A54A 5GAN2 3H3VI 4DK1A 3NTKA 2CW0D 2E2IB 4DR6L 2B3GA 4DR7L 2E5QA 3HOWG 3S1QB 1M1KR 5D6XA 1HJPA 1X54A 1FYNA 2DO3A 4DNIA 2UXBL 5G3LD 2HIXA 4LNPA 2JN0A 4DAMA 4J5YA 1TUDA 1JXMA 4DNRB 1UDLA 4E2FB 2K52A 3M55A 1DYQA 1IXDA 2C0IA 1YIJA 1A3TA 2QF7A 2OQ0A 3E5SA 3DEPA 5KIXA 3HOZH 1WDXA 2I0QA 1U0LA 3NELA 2JA5B 1X43A 2CWPA 4DQ2A 2XKOC 3G4ST 1YNJC 1KABA 1VQIA 1HFNA 3JCMc 5I2SA 2G3RA 1VQ6Q 4BACA 2IPOB 2F0SA 3K7AH 4J9CA 2JT4A 1KDCA 2TMPA 1KLGD 2SNMA 3M54A 4EMHA 4LUDA 5I21A 3GQBA 4A63B 1QILA 5FU6C 1JB7A 3CC4A 1WJSA 1XPOA 1YNNC 5M3MG 2VNUD 2J6KA 4JLIA 5I9OA 4O6JA 2MO1A 3GBQA 2RBMA 2WKCA 2KQWA 4F7UG 1SLJA 2JA7H 5GMKl 2DPPB 4OMNA 1HZAA 4KT0E 3A8JE 4RTXA 4LW1A 3HOVB 4OMQA 3I55Q 3A8HB 1Q7YC 2DJGC 3Q1JA 2R92H 2DYIA 5C3EH 2ZJPA 1X3EA 2ZTEA 1K9MC 1PSFA 3PNWC 1VF7A 4OWTB 4DFAA 3GTJB 1K8GA 4B08A 3HKZG 3QO2A 3R8BA 1G3YA 3TN2A 2NVQB 3VUBA 4E7SA 1RAAB 2QEXA 1S5CD 2AUKA 2ZM6Q 2O2OA 1VQOA 4WTOB 1S5ED 3OYIA 3K58A 1IREB 3QZ5B 2VXWA 3PUVA 4FP5D 1NYGA 2DVEA 3PIOA 4GLXA 4BWGB 1OO9B 2E2HH 1HNXQ 3MFYA 1YWPA 1Q7YR 1VCIA 4C5HA 2CT3A 1K9MR 3BJUA 3G6ET 2CP3A 2KHIA 2DIGA 3HOYB 1B44D 3F2UA 3KDFA 1RHPA 1I6HB 3M7GA 2A08A 3GTKH 2KXDA 6AT1B 2PMZE 1HNWQ 5IODA 2JE6I 1UUEA 4EQNA 5IOCA 4HIKA 5EGTA 4V2SA 2UXDQ 1L1OC 3GTGB 3I4LA 4BY1H 4JYAQ 2Q2TA 5CKEA 3EAEA 1I4RA 2WAQG 2RQRA 3ZEHA 1NE3A 2EYLA 3Q24A 1WXBA 4FCYA 1EY8A 1MSHA 4BI4A 3GOXA 4GLVB 4CDDC 2B8FA 1IKLA 3H0GB 1OPLA 1BIBA 1VQNA 1FGUA 1WTPA 3IKJA 2D8HA 2EE1A 4PFPA 2KUMA 3G7ZA 3T53B 1YITT 3EIVA 4OO1I 4J6YA 3MP1A 1TOVA 2HL3A 1G3TA 2YUOA 4LE9A 4JS4A 1E1TA 1M4VA 2I5MX 1K8AU 1Z9FA 5C44H 1R0CB 2D62A 3SWNC 5I11A 1YJWT 2PZWA 4ZN1A 4C1NK 4K6DA 4JI4Q 1YJ9A 4FYWB 1SSHA 1FMWA 1JJCB 3OBYA 1BK2A 1YIJQ 1PRTB 2RCNA 3SK8A 3PO3H 1SYFA 1MHWC 2WSCE 1JJ2A 3S14B 5CV6A 1XMOQ 2COWA 4L59A 3V8LA 4A3JH 1L1OB 4PV1C 1EIHA 3A5UA 3HOUH 3NUCA 1GUWA 1SHGA 2BH2A 3C95A 4LN2A 1MIUA 2M00A 3J7AV 4KJNA 4IUVA 4A3IG 2OJ2A 2ZXRA 4IQZA 4LDYA 4LF9Q 3CC4Q 2E2JB 3HKSA 3HRZC 4IO9A 1MMDA 2HQEA 5IH2A 1UE5A 1BOSA 1MNDA 1QCFA 3S3MA 1T0HA 1NG2A 2DNEA 2SEBD 3RR5A 4C3HH 1B53A 2VKNA 3META 3RNJA 1G8XA 2F3WA 3CCET 3NHNA 1X3GA 4X66L 3OMGA 2BA1A 5FO7B 4ZNXA 1Y71A 2V8IA 3L7ZC 1E1OA 2ZXOA 2LQWA 3OYAA 1CQFA 2HHHQ 3S16B 2F0DA 3C1EA 3J80i 5DY9A 2JA7G 4DUYQ 4XIGS 3O8VA 3VR2A 3PMIA 2QEXQ 5FO9B 1G2TA 1VQOQ 3K5NA 4K6LA 2R7ZB 4DR5L 2MOXA 2DKGA 2FPEA 1I0CA 3M4YA 4M77G 1A15A 5ISRA 1BCOA 1ZUUA 3HP3A 3TRZA 3V05A 2ATCB 5GMKe 1YN8A 1B9MA 3CRLC 2AIRB 2KECA 1I3QB 2FMMA 4XT3B 4APVA 4BY6C 2K28A 3L2ZA 3G4SQ 4QVDA 4OP0A 2F0WA 1VQ9T 2CKKA 2R7DA 4XU2A 3EGXA 1HTPA 4HJ5A 1Y1WG 1N33Q 1VQAA 1Y8PB 4DR3L 3FPUB 5IGEA 4C2MH 4F04B 3QKJA 3GNGA 3L2WA 1SSFA 2CZ0B 3DKMA 3X3MA 1KTKA 4A53A 2MPMA 5J22A 1BXTA 3T56B 3LH5A 5LJ3e 3EGDA 4AIMA 1JOQA 4MDWA 1IW7D 4YIJA 3BDCA 3HG9A 1H9SB 1STYA 4HJ9A 3JRZA 3MWYW 2WB1G 3URGA 1LCKA 4RA8A 1MUZA 2CP7A 1WHHA 2YSQA 4EX5A 1VQNQ 4A4IA 3S1RB 3NXWA 1WTQA 2LJ1A 1OXXK 1M1FA 4BY1G 2O9SA 2FZKB 5CKFA 3ER0A 3VS5A 2VUMG 1VQMA 4JBJA 4F7UA 2LCLA 3SHLA 4DR1L 5E4XA 2GFAA 2RJFA 2DF6A 4OXPA 3RD4A 4ELZC 3A8LB 4K11A 3CCUT 1I5FA 3A8IE 2R93H 4OB1B 1FJGQ 2NUPA 1EY7A 4B3RL 1YJ9Q 1I4XA 1TXQA 3PGGA 5CAIA 5KCOA 2NTSA 1VQDA 3JCMJ 2AUJD 2Z9HA 2OTJT 1UE7A 1JORA 2IJ0A 3OSVA 1BCPD 4RAUC 2E2IH 4KH0B 3G6EQ 1RCVD 1WFQA 2L3PA 1SDFA 1PC0A 1WI7A 3VUZA 3C4SA 2YYZA 3A56A 3S17H 1HHVA 3PO3G 1JXOA 1Q90A 3E9HA 2IHEA 3EG9A 4JI8Q 4C0GA 2MK5A 3R6NA 1LM0A 1UGVA 4RCCA 5GAOm 4RG1A 4KHPL 2JXBA 4FDBA 2BUDA 4J7FA 1QWEA 4QIWB 2UXCL 3E3XA 3KLSA 4C0DB 4FO2A 3VR6A 2JA5H 2J7IA 1TU0B 1NZ9A 2DJZA 1NCVA 3HFZB 4PNYA 4BD3A 2BE9B 1BB9A 3CQTA 1K73U 5LMNQ 4GOPB 2VGMA 1Y7XA 1M9SA 1F1BB 4NXNQ 3X20B 1RAHB 1BO0A 3EG3A 2BE7D 1N27A 2RSOA 5ELEA 1EIYB 2LKVA 2EQJA 4K5XA 1X6BA 1RI9A 2NLUA 3N5BB 5CVIA 1YITQ 3K7UC 3MXGA 4JI6L 4A3GG 1NY4A 5CV9A 3JCMe 3FP9A 2NN6H 2EGAA 2EYMA 1Q12A 2DTHA 1RDPD 3VYHB 2KNBB 5CBEE 1V1CA 2VC8A 1SNOA 4A3CH 1KRTA 2K04A 3A7AB 1S1NA 1CHQD 2XDBA 4CDCC 4YHHQ 1D09B 2RI3A 1M3AA 3I70A 3OYLA 5IAYA 5EJWA 2EPDA 2G9HD 3DHQA 1AE2A 1JQQA 3D4RA 4L8JA 2R61A 3FKIB 3MPUB 5GAOq 3J81L 2NVQH 4YTLA 1G91A 2JA6G 1RAGB 1RAEB 2EGEA 2F4VL 2LMJA 2CQAA 1GUTA 1QKWA 1Y1VG 3UA7A 1EZ6A 4KKSA 2P0PA 2ES2A 2N88A 4DV6L 1D1BA 1EIFA 5GJVB 2EQSA 3FJ5A 4ME5A 2JOYA 4C3IH 3KF6A 2CHBD 2HNIA 4O1NA 4DN4M 5DNFA 4JC0A 1GBQA 2RJEA 2H8HA 4XYQA 1X55A 4FYDA 5HCKA 4GKKQ 4F14A 4K0KQ 1I6HH 1AE3A 4HVWA 3G71A 2KT1A 3V7RA 1N34L 2DXCA 1GKHA 2MAMA 3HPWA 1X3QA 3CC7T 3JSCA 2BZYA 1VQMQ 2VQFL 2RHUA 3MEAA 4C8QD 5KRUA 3CKIB 1CHPD 2XICA 1G51A 2AT1B 2L3QA 2OEOA 3D4WA 4DK0A 3BW1A 1PA6A 2EYXA 4M77D 3TZDA 1E6GA 3T51B 1ENAA 5I9PA 3H0GH 4X65Q 2PVGB 4C8QA 3PVQA 2NVYB 2Z4HA 1Y96B 3F70A 1SRMA 2E10A 3PGZA 3F8TA 5LMUL 1VQ9Q 2EYPA 3FLGA 1IBKQ 4LF7L 3OTOL 4M77A 1PXUA 2RH2A 2R93G 4JI7Q 5KGUA 1M27C 1DZ1A 2PUKB 1Q8KA 3GTOB 3RIRA 4TVAB 2YHTA 3U4VA 4A3DB 3WVDB 1LT6D 4FT4A 3L1AA 1RACB 4XU0A 2EBPA 3LH0A 3REAB 4OMMA 3M0QA 2LY7A 3EA6A 3EN2A 2K7VA 3I3CA 3KUPA 1VYUA 3M4QA 1BBXC 2V4DA 1QCNA 1LV9A 3I4NB 4RCNA 1HR0L 1VQ4T 2VV5A 4M8AA 5FJ8G 1TUGB 2C06A 3KLRA 1GUSA 4UP8A 3A8GB 3SB2A 3CMAT 5C4HA 3J81E 3CQZH 5A0DA 1OU8A 3T16A 3CCMT 4M75F 4FT2A 1NAPA 4CKEA 3X3NA 4R4IA 4PZ6A 2K50A 1PD0A 4OX9Q 3CF5A 1I8FA 4JV5Q 2RD1A 2ZPBB 3E9IA 2D6FA 3D3RA 2MYSA 2X4YA 2B2WC 5DLQE 2IWHA 2HQHA 3RZDB 5IYDH 1JOKA 3MC0B 4GLAC 4DA4A 3OQ5A 3E9GA 1X69A 1ZYRD 2IG0A 4LF5Q 1QVGA 1LUZA 1BDOA 1GO3E 2DN8A 3S3NA 5EQ0A 2Z4IA 1W1FA 2NN6I 4KY7A 4LDXA 2QTXA 4IUQA 2JNGA 5CKDA 2NVXH 3QUIA 3MHXA 4B3TL 3PVLA 4R55A 4L63B 1N9RA 4A3CG 4DV7L 4N8FA 1JE5A 3HOVG 3HZXA 2DL7A 5IGCA 2E74C 4PKCC 1IBMQ 5DM73 2KHJA 2KDSA 1VQKT 3RLNA 2FB7A 1AVZC 4M7AF 1ML0D 1EZZB 1RD9D 3CC2A 4OMFB 2IW3A 5JAVA 1AFPA 1I3QH 2GA4B 4F87A 1KHIA 2F0KA 4HA8A 2RA4A 2GBQA 1M3BA 4DF7A 1WQ7A 2PU9B 4K5VA 2A19A 5KYWA 2A73B 5ELOA 3GD7A 1PH5A 3BS1A 1QUQA 1BI0A 4BXXH 1PFMA 1UTIA 4M7DF 3I72A 4LFBQ 3G71Q 3EHRA 4C92F 1K8AC 4B9XA 5KE3A 4KN7C 5LHY1 1KD1C 2GN5A 1V1PB 3NFCA 2MQHA 3OIPA 1FX7A 3EFOA 4NS5A 2QA4T 2GQVA 1IBLL 2QQRA 4CC4B 4PLLA 4MZ9A 1ESRA 2AHJB 3HOYG 1IL2A 2B39A 4MZPA 1NBEB 2ZPIB 3EGUA 4QVZA 2LNHB 8ATCB 2YDLA 2HCIA 4PJOB 2AQ2B 5M5XB 2K3XA 1E2ZA 2OI3A 4FVMA 2VL6A 5KYXA 2UUCL 3S1RH 2FHDA 2UXCQ 3BZDB 5K36H 3NEMA 2DA9A 2R92B 4PJOE 4X9DA 1K8AR 4IALA 4HJAA 1KD1R 3TS2A 2EYJA 4GBQA 3MFGA 3BDUA 4DV3Q 5C0XI 5CO7A 5GAOn 5KYUA 5KCHA 3H0GG 1K9AA 3MXNB 1WTWA 5JEAJ 1JMCA 1VYVA 1PH6A 1LTTD 1UAPA 3H0FA 4HSVA 3I56T 1L0XB 4L6TB 2FPDA 2A6HD 1E7OA 3ND9A 4KUIA 1PZID 4V190 1KQ1A 1KNEA 2MFIA 4BI8B 3NK9A 3NP8A 5KYYB 1EY9A 4MNOA 4LJZC 4R1JA 4DXFA 1PHJA 4C8QE 4JLGA 3C46A 3DB4A 2B2TA 3EFSA 5GMKm 1CSKA 2GCXA 2PZ1A 2NYSA 4HCKA 1RKNA 2ZAEA 4IN3A 2CDTA 3GTKB 4J8OA 1HZCA 3OYNA 4OIKA 1AZEA 2CKZB 2K5WA 2DD4A 4ZGJB 3IFDA 2V1RA 2EJGC 3HS0C 1N8RU 4Q5WA 3MAQA 4HCZA 3E0JA 2W10A 1QVFA 1NEBA 2ZXPA 5GAEC 3LLRA 3M85A 2GVAA 4BE0A 2NB0A 2DGYA 1EFNA 1Q82U 5IHIA 4OELB 1MSGA 2DTOA 3GTLH 4LFBL 4PMBA 2Q8TA 2M51A 4I7AA 4J9GA 4IURA 4JZ3A 2L15A 1JB0E 5DLOA 5EG2A 1SBBB 3D6CA 3DM1A 3PUXA 4YWLA 3O13A 2HT1A 1EQQA 1YCYA 1EY0A 2K6AA 3CCRT 3TSWA 2UUAQ 5L23A 2XN9C 1EUJA 1TWCB 1ASYA 3PE0A 3H3VH 4DAYA 1PH1A 3I91A 2A37A 3OYBA 2KBNA 2E5LQ 3QBYA 2RF4A 4QB4A 4X64L 5IT9L 1LTAD 1TY2A 2K33A 2O9VA 4M75C 2QAZA 1IXRA 4C1NI 3VJPA 2F0EA 3RKYA 3REBB 1ONLA 4JBMA 4ATOA 2CWAA 1Y07A 3CMAQ 3HSBA 1IKMA 2GF7A 2EJFA 2LQ8A 2A6EC 2R7ZG 2QI2A 4JJBA 1FL0A 4QUFA 4NL2A 3FKIH 3CCMQ 1OXUA 2K57A 3JCMW 2F0PA 3BYTB 4A3JB 3CCJA 5IWAQ 3HOUB 1YHQA 4LMQD 4LXCA 4MTNA 4NMZA 4QJFA 1TWGB 1JJGA 5IHKA 1AEXA 4Z02A 2P4TA 3S2DH 5FLXE 2B2YC 4DV4Q 5C6SA 2E12A 1F2MA 2VY3A 4DV0Q 4BXXG 2JS0A 4LFAL 2HCCA 4PZ7A 3UDGA 4ANJA 1RLPC 1A63A 5AJ3Q 1E3PA 1Q3LA 1M2OA 1A3VA 4KLKA 3RUXA 1H8KA 2NBFA 4CKBA 1HZ9A 4C3HB 2EIFA 1O9SA 1RTOA 3GV3A 2DZCA 2XGTA 2PPBC 1EYGA 2ENMA 1WTXA 2QW7A 3V96A 4F7XA 2F2XA 2DAQA 3H0IA 4J83A 2DZ9A 1A3UA 2EYHA 3I7FA 4B3ML 1M8AA 2FHTA 4O5VA 1D0XA 4FW2A 4M7AC 1A0NB 1LJOA 2DE0X 2LJ0A 3LX7A 1PRTF 1X9NA 1PH7A 4M78B 3OWFA 1QP2A 2VYTA 1CKNA 5CC4A 3VR3A 2NUZA 1EU3A 4TKOB 4BS9A 3GIBA 1CUKA 5IN1A 4DBRA 2CYZB 4R56A 2PI2A 4BB7A 1PV4A 4M78E 1QVGS 1K73C 3M0UA 5FRNA 1SE8A 2XDDA 2NVYH 4ZN3A 2RN8A 1R4PB 3E9FA 1D5MC 3PSIA 3Q23A 4A76A 3AYHB 1RUWA 4RTVA 4E7ZA 2NZHA 4JJCA 1SE3A 2ZZDA 2EYYA 1QW1A 1WHKA 2A69D 4GS3A 2OT2A 1YNJD 2J06A 4AMCA 4NB3A 4UAIA 4XXEA 2QKIC 2D5DA 3K5MA 3A8MB 1K28A 2C9OA 3N52A 1B2TA 5IT9E 4JI3L 4C2MB 5ELDA 2QA4Q 3RN5A 4YCVA 2XI9A 2KVQG 1EY4A 1XTCD 3MEUA 1ZKOA 4JI5Q 2RHXA 3I4NH 1K73R 2GFUA 3JCMX 1C48A 1PHTA 1WQWA 2E6ZA 1QVGP 2C0TA 2P4RA 1W3SA 1SJED 3VR4A 1B7TA 1I81A 4M7AB 2A1AA 4RFBA 2NWGA 3PUYA 4IUNA 2KYBA 2OTLT 2IPKD 5FWBA 1OYXA 2BKDN 2A7YA 4E7KA 1KC8U 2FFKB 1F77A 1K3RA 4ZUIA 4K8IA 4I65A 4EMKB 5GMKh 5IP7H 4IIOA 1C7YA 3V8JA 4KBMB 2CSIA 1LABA 2NUTB 4J9BA 5EKLA 4M7DB 4PL6A 3LX0A 3RZDH 3MJXA 1U1TA 5KYLA 1OU9A 1LTGD 4C92B 2O2LD 2ROLA 1TT2A 3GPLA 2E2DC 1AD5A 4X1VA 1XNRQ 1NTGA 1A2TA 2ICEC 5FW9A 3SR1A 1MMAA 1G5VA 2KK4A 4EQOA 5JPMC 4OO1H 1WHLA 1O7YA 5C0XJ 4M4ZA 3Q0AA 4JRPA 2R3ZA 1AWOA 1WNLA 1EEID 1EOVA 5LJ3h 5M5YH 4RCBA 4R4OA 2F0QA 1VQBA 3KUFA 3M58A 1D1AA 1JICA 2K4YA 3JB9D 2HQXA 3CCJQ 2QQSA 2O4XB 2ICIA 5ELBA 3J7ZC 3S17B 4ZKBB 4C5IA 4NPSA 3CRKC 1YHQQ 3KF8B 1EQVA 2LXJA 2IHFA 4FW1A 3AFPA 4G57A 4IPHA 3NMZC 3J7YW 1SKUB 1Q86C 1D5ZC 2FMCA 4ULLA 1PD1A 3MEVA 4OB3B 5GMKj 4F16A 3FKIG 2ZM6L 1CKOA 2PNHA 4A3MH 1AHJB 1G83A 3S24A 1SG5A 2HZYA 1H9MA 2OTLA 2A69C 1Z9ZA 1WHMA 2F4IA 1WPYA 2JEAI 2L3SA 1QWFA 1FNUA 3JCMb 1HNXL 1V29B 3R2IA 2G5DA 4ZRZA 1VQFA 2Q2UA 2X3XD 1L1OA 3CCRQ 3BU2A 4KULA 3S6WA 4HJ8A 3K80C 3P8HA 4HMIA 4LNQA 3SD4A 2HD0A 4PJLA 4AT1B 1AEYA 1BYMA 1K0RA 1Q86R 1D7QA 1OXVA 3DMUA 1GRIA 3RR6A 1HNWL 1QVFS 2EFIA 1C9OA 2DYBA 4XTZA 4FU6A 2EPBA 4J15A 1TWHB 3KBXA 3J81c 1I6VC 4JYAL 1O7LA 4IOCA 4E7JA 4PMWA 4TQUS 2SRCA 2ECZA 2EVBA 4KGZB 4LF8Q 2GTJA 2JW4A 3D31A 3EJIA 1D2BA 3SWNA 3AMUA 3BDLA 1RLQC 2VB6A 4BE1A 2GQIA 4A4HA 4JJDA 5J39A 1NSNS 1C0AA 1L0WA 4JS5A 1M8MA 1GUGA 3RLOA 1T3SA 1QVFP 2EQUA 2MJ8A 3LYIA 3EROA 3UWNA 4OF1A 1VYTA 4C5EA 5CR3A 2BH8A 4PJMA 5FWCA 1MJEA 3M3YB 1D0YA 2EYWA 2AMCB 2PI2E 1NYFA 3G4SA 3L2RA 1TS5A 4C3IB 4A3DG 3JCMh 1YI2T 2PNRC 1H3HA 2PMZB 3P8DA 1Z6HA 4NP5A 1PRTC 2F1MA 1EX4A 1SEMA 1QE6A 2IL8A 2L1BA 5C0MA 4JVZA 3URYA 5FK9C 5EPKA 3I4NG 5EAYA 1XMOL 4AQYL 1VQPT 1SNPA 4Y52H 3NBIA 4N4GA 3I9QA 1GCPA 2FRWA 4OIJA 3X26B 2RNAA 1G2BA 1D5XC 3OSOA 4GKJQ 5J3BA 1R8OB 3PUZA 3IRBA 2HDLA 5GAGC 1AZPA 1JRIA 5IP7G 2SDFA 3AEVA 1HXDA 3S3OA 1XTDA 3J7AF 2B2VC 2DK3A 2O5IC 1YVCA 1U5SA 3NBHA 5GAN5 5EPLA 2E8GA 1KG1A 1I5OB 2LDMA 3HHTB 2ZTDA 5ELCA 3QYGB 2QGFB 4P72A 3ZJYC 3BY7A 4DNTB 3MXPA 4BUGA 2B29A 1ENFA 1CSQA 5GAMe 1TWCH 2LSSA 3MVVA 4FSXA 1XXGA 4OO1G 5IGBA 2L5QA 3NWSA 1PTOH 4DUYL 4R4QA 2EY5A 4A3KH 3M56A 1WXUA 1BI2A 4K2KA 4H13C 2LX9A 3S9WA 4A4KA 3FDRA 4ZYSA 3G6EA 2OTLQ 3S1NB 2LNVA 3I4MH 3HOXH 1VOMA 3P8BB 1Z47A 3OIQA 3TREA 3CQZB 3T13A 4RGMA 2XDPA 2ABLA 1U3OA 4P71A 3VA5A 1VQ5T 2X6LA 1HUNA 1TWGH 1DOLA 3HOZG 5DM7R 2O5JC 1SF9A 1VIFA 3TSSA 1PH3A 3GO5A 4DEYA 2B2UC 4S3SA 1VQJA 1N33L 3MXUA 5LJ3f 3HL8A 5LJ5e 4GNXC 3LGFA 1D8LA 2D2CC 4HIMA 4RG8A 4A4FA 1FWZA 2A68C 3TP6A 1N32Q 4ELYC 5GANh 5D65A 2YLCA 1SYEA 1NR2A 5FLMH 1SRLA 2MCNA 4YY3L 1ZQ1A 3TS0A 2NVXB 2EW3A 4E6IA 1YITA 2WIIB 2A28A 2Q8IB 1N8RC 5JJKA 1J5EL 2RQWA 4PJOG 1JBMA 4FL6A 1YJWA 1ZXTA 4EPCA 2CUBA 4B9WA 2KEDA 5GANg 5JEAH 4DU9A 2JA9A 2R92G 1FR3A 3EH1A 2Y0SE 1WYXA 2EVRA 5C3EG 3X24B 2FL7A 1Q82C 3K8AA 1KK7A 2HCKA 2RQTA 4LF6L 2J7ZA 4KD4A 2IIMA 1G291 1BVSA 3CEYA 5GADC 5IE8A 1SMXA 4MMLA 3L2VA 2LQNA 1O7ZA 2XSCA 2JN4A 3C12A 1MGQA 2DFUA 4R0KA 4C56C 4DUZQ 2GNCA 1SYCA 2HUGA 2NYZD 4ZUJA 3OYMA 3MEFA 2F0GA 4WCIA 4HVUA 1N8RR 3CMET 4JW0A 5CGKA 1G8ZD 1RAIB 4OMOA 1ILQA 3MTSA 2HKQB 2QASA 1E24A 1UGSB 1GHJA 1X3PA 2XIWA 4JOIC 4GNXB 4QQGA 1Q1EA 5GANj 4HCEA 3A8OB 3PO2B 2EY2A 3VS2A 1Q82R 3DXJC 1TQOA 3MEHA 1G6PA 5BN5A 1U9RA 1C0MA 4JI8L 3CBPA 4DBFA 4E6RA 2EOTA 1LACA 1I94Q 1W2BS 1WHJA 3FPPA 1YZ6A 2K2VA 1UE6A 2L2PA 3OB9A 2YTVA 3CCEA 3NTIA 4RG2A 3RBBB 3DWPA 3KDFB 1UG1A 1GL5A 3BG3A 4C0DC 4CI0C 4H44C 1L2FA 3S2HH 2FPFA 1MV0B 1G6ZA 3R2TA 1LT5D 1L0YB 3AT1B 3RDVA 1OOTA 2EQKA 5LMNL 1WOCA 4K2LA 4A75A 3VS4A 4A4GA 2YV5A 2HKNA 1GUNA 4GOPC 5FLXc 2L3RA 3JCMf 1GBRA 2RK2A 1RJTA 4NXNL 3F2DA 1CZGA 4RTWA 3MCAB 2VXFA 1LTSD 3RNUA 3FC3A 4MZTA 2ZTCA 1H95A 1XJVA 1PKTA 4IUPA 2KGTA 4DEXA 2XD0A 1F9PA 2HD3A 4J6WA 4KKTA 3TBIB 5BN3A 3H3VC 1YI2Q 3WOEA 1VQ9A 2BE5C 3KYHC 2OWOA 4N4IA 5C44G 2E3HA 3M0RA 3OYKA 1EQTA 3KJPA 3KOJA 5KEEA 4YHHL 4A3BH 1SNQA 5COYA 2DBMA 1LTBD 2K79A 3AFQA 3T1HQ 2VUBA 3WXMB 3MO8A 3RKXA 2R5AA 5HY6A 2V26A 1YHBA 2DXBA 4POGA 4H0LC 2DNUA 4PJOF 1ZSZC 2BIVA 3NQIA 5KE2A 4K5WA 4A3JG 2BZXA 3FJPA 3A7LA 4L5QA 4UP9A 3WOFA 4JI0Q 4DR4Q 2PO4A 4RTZA 3QO3A 3VYUA 1T9HA 3HOUG 3GNFB 3TQ7P 2FINB 2H1EA 1XX8A 3MP8A 4G7ZC 1VQCA 5CYUA 3GTLB 2V1CC 2PZTA 4L5RC 3QG1A 3VS3A 2PQWA 2M0YA 2RO0A 8AT1B 4ZCKA 3H09A 5JJIA 4DV1L 2LXKA 2K3YA 4GLKA 4KRTA 4C0ZA 5IT9c 1IL8A 1ASZA 4B3SQ 3KFUA 2ENBA 4GKKL 2DERA 4K0KL 3CCUA 4KI0A 2ZGWA 2DY7A 4C3HG 1YJWQ 1KDBA 3C1FA 2LCSA 4X3UA 3S15H 2YUPA 3ZL7C 2QQBA 1D1IA 1ICFB 1JO8A 4HT9A 2NWMA 3CCST 3F1ZA 2UU9L 1TR5A 1B34A 3LWHA 2OTJA 1TWHH 2KJXA 1BUVT 1WTHA 2QG9B 1KC8C 4M75G 4RUGA 4DR1Q 4CJ2C 2F5TX 4M78G 4PK4A 5M3FB 3VDYA 1HNZQ 4HSPA 3OSSC 1VQGA 4XTXA 1EIGA 2LJ3A 1PWTA 2F0TA 2K01A 4X65L 1ZSZB 3C2PA 1JOOA 4WF2A 1PYBA 1J3TA 1IBKL 3VYRA 5GANf 3D7SB 1YBYA 1TG0A 2RJDA 3TZUA 1ZBJA 1IYUA 4QW2A 1VQ7T 2PW7A 3Q6SA 1BNZA 4JI7L 2QXFA 3A0JA 4LUOA 3S2DB 3K59A 1IYVA 1NNXA 3RESA 4DOVA 1OEBA 4PZ8A 3M3YH 3MHBA 4RWSC 1KC8R 1E22A 3VYTA 2AQ1B 2MHVA 4RGOS 1ZHIA 1VA7A 2LT1A 1LLRD 5C6AA 1A8VA 1JE4A 3CCEQ 3EGXB 1HFGA 2PYKA 2B2WA 3THKA 1JWUD 1WHGA 4OWXB 4DV2Q 1TY0A 3HTRA 2O88A 1M1KU 4M7AG 1PTOF 2LZ6B 3G48A 2RHYA 3EGDB 2DJQA 3VRZA 2L11A 4Y91A 4OX9L 1STGA 5IYBH 4JV5L 1SYDA 5CKBA 2JSOA 3LNNA 1VQLT 3M5AA 3W5OA 1JWMD 1BIAA 3V7SA 2I5HA 1K0SA 5C0XH 1T5EA 4M7DG 4BBRB 1W6XA 2SEMA 4OMPA 3JCMQ 3JAME 2KCTA 3KLWA 2F2VA 1AW7A 4C92G 4JBWA 1Q46A 4LF5L 2Z8LA 1KLUD 1H9RA 1AZQA 3GTPB 1BU1A 1C1AA 2XWBB 2VS1A 5KH6A 1NPRA 2X69A 4EIKA 1GFCA 1YJNT 2IVWA 4F7UE 1VQ7A 3W3AA 1HK9A 2EKHA 2X35A 2NUPB 1P92A 1JB3A 4QQ6A 2AKLA 5E3FA 3PUWA 2JM8A 3NTHA 1GVPA 4FIBA 2F0NA 2LVMA 4QGUA 4ME3A 4R4TA 1IBML 1LT4D 2F0LA 2L0AA 2P84A 1HD3A 3V8KA 3S1NH 1DGSA 1EY5A 2HDMA 3HKZE 3M4GA 4JDSA 1X27A 2K5IA 1XNIA 1I4PA 3UDXA 2FRYA 1D3BA 4XU3A 1F2YA 1ZEQX 1FMVA 4M78F 1JR0D 3AHUA 3CC7A 2EY6A 3OYEA 3AU7A 3EG9B 1BCPB 1PZJD 1STEA 5C4JH 4NXML 2JA5G 4P73A 4FXDA 1NEGA 9ATCB 3CXCA 4JI2L 3OS0A 2H3EB 2DXTA 3TCJA 4A4EA 2FJ2A 3P20A 1M8VA 4TSSA 4NL3A 3CCUQ 1W70A 3ZYYX 3F2BA 3SGIA 4CBVA 5A2QL 2OF1A 2R57A 4DAPA 1QG7A 3CCVT 4XU1A 2EGCA 2FZGB 4N0AC 4XT1B 2OTJQ 2RQVA 2QGQA 2F0HA 2DLPA 2P0QA 2BCOA 3N6RA 1TIID 2F1LA 3M0SA 1HPCA 4KGXB 1NLOC 2A36A 2E6NA 1Q7YU 2NN6G 2RSNA 2WV6D 3H91A 4AYBG 5A35A 5I4DA 2JJQA 5M5YB 4QUCA 4PJOC 5FROA 3ND8A 2EJ9A 3OYDA 4CHTB 3KBGA 3QYHB 2WAQE 2DBKA 3CD6T 1BBWA 4J8QA 4X3KA 3U58A 2RJCA 4DK6C 4POFA 2GTOA 4J6HA 2RPNA 1X3FA 1W4SA 2F69A 1TWFH 5HGTA 4DV3L 1VQ4A 2GVBA 3Q8DA 2JVVA 4N8X1 5BR8Q 4MN3A 4DGZA 4JPBW 1EZ8A 1PNJA 2K32A 3CMAA 4XQNA 4A3MB 3U9OA 2KBTA 4LD9K 4EDUA 4XTUA 3CCMA 4DPGA 1R77A 4AYBE 4PJNA 1G3SA 3I5RA 3L2QA 2EJGA 2JUFA 4IUUA 4DBQA 2YTXA 4FYVB 3OYYA 4XAXB 3CAMA 2VVKA 3IL8A 2Z1CA 2PVDB 1S72T 2KOLA 2ZJRA 2C35B 4X6AH 3DEOA 3PO2H 1HQRD 4XTYA 4C3IG 4LUEA 4DAVA 5CIUA 5D3DA 2EXZA 1M2VB 1QNUA 3I5SA 3A1PA 2LC4A 2ZPHB 4LD6A 2F3VA 3JCMd 3AQQA 3KF6B 4IPGA 2VASA 3QWYA 3JCMP 2L9HA 3ZFJA 1LPLA 1GHKA 4CJ1B 1YWOA 1STHA 1PCXA 3PIO3 2K14A 3NHHA 4HR7B 1CKBA 4M75D 2VQEQ 1V76A 1ILPA 2TSSA 2D9UA 3CPFA 1YNZA 2VXEA 2A6ED 1F9SA 3VS0A 5CKHA 1EWHA 1PLFA 1LTRD 3OW2S 5A2QE 4II1A 2HBWA 1GUOA 4M75A 5C0XG 1V43A 1VQ7Q 1VQKA 3LWEA 3LWUA 2UUAL 2K6DA 1PDQA 2FO0A 5DAUA 4C8QB 4CC2A 2DJFC 5FLXL 5AYFA 5ECAA 1GCQC 5D6YA 4B3TQ 4OEMB 1RF2D 5I6WA 3T1YL 2CFMA 2KAFA 5GAN6 5M9OA 2BDOA 5T1IA 2KVMA 3UDCA 3PQIA 4FF2A 3CCLT 3D4DA 4ORZA 3PTAA 1CSPA 4PJJA 1PTOC 2F0IA 3UF4A 1WIEA 2Z6BA 3G7LA 2O31A 3M4PA 5C4XH 3HFOA 4OHJA 5BN4A 2F4VQ 2B2YA 3CC7Q 2K5DA 3L0OA 2D0NA 4M77E 4Z9CB 2YRCA 3CCQT 1SMYC 2QA4A 4J9HA 2JK8A 3HGBA 2RDFA 4GZYC 4M7AD 4PFZA 5IWAL 2E65A 3KFVA 5CV5A 2OQKA 4U673 2CP2A 4ESRA 1CA6A 1HA6A 1VQLQ 4J9EA 1DJ7B 4RTTA 2UUBL 4LFCQ 2EY1A 4DV4L 4DV0L 4BBSH 4JJNK 1R9TH 4M7AA 2I5LX 1ZUYA 2WSFE 3JB9I 1TXYA 4WORA 4C92D 5AJ3L 3EH2A 2N55A 4GN5A 1TS4A 3FHWA 3GF5A 4XTCS 3SE0A 3V2TA 5IYDG 2FZCB 4QMGA 4XQ3A 3WVEB 2YRVA 1YJNQ 2NUTA 3SK5A 3TMEA 4IFDH 2SNSA 2WB1E 1N9SA 1KAAA 2DL5A 4C92A 3I56A 2H4OA 3U50C 1DD2A 3I8ZA 2J0TD 2PW5A 5GANd 4G7HC 1PTOB 5EBCA 1VQ4Q 1IO6A 1UWVA 4XTVA 4M78C 3OA6A 2L0CA 3PFSA 5C3XA 4A3KB 2CP0A 4J7IA 1IGQA 4OB2B 5GAN7 4J9DA 3B6YA 4WJWA 5M3FH 4ME7A 2PQAA 1VQ6T 3I4MB 2CP6A 4DKAC 2YTYA 3HOXB 4O2DA 2IX1A 3M59A 3QSUA 2X6GA 3M9BA 3CCQA 1BI1A 1E2VA 2EKOA 4RTYA 5J26A 1SHFA 1D0ZA 2BOSA 3NPPA 5GAHC 4FF3A 3HOWH 1MV3A 2QGGA 4ZAIA 1KSWA 1SSOA 1PKSA 4OONA 4HVVA 1SJHD 2AWOA 3RLFA 3STBC 3EG0A 3QPHA 4JZ4A 1UGPB 5GAMh 5KYWB 2NZ1D 3I55T 1F9QA 3ULLA 1U8RA 1KHCA 3F2CA 1QUQB 4JI5L 1LOJA 3M57A 1AN8A 4XQJA 3PO2G 4C5GA 5I2MA 2K1BA 2DD5A 1M30A 1KL9A 4Z89A 3CCRA 4RKBA 1KQSA 4R8IA 4BY7B 1ZUKA 3CXCS 3EFOB 4JCVE 5L37A 2I46A 5KYNA 4Y92A 5GAMg 4C3JB 3PMFA 3R6OA 3HRSA 1DOMA 4EMKC 2N3SA 1VQKQ 4LF4Q 2I0NA 5K36G 2HEQA 2CQOA 1W6KA 2QQ9A 4YWMA 1SNMA 4M7DC 1PH4A 2GGRA 5M3MH 3H41A 5KYXB 1ESFA 2NTTA 3NE5B 4BBRH 2F0FA 3FVQA 4CJ0B 4C92C 2RVLA 4UDUC 4BE2A 2XU8A 2F0JA 2ZPEB 2PCFB 1B8AA 3SXHA 2L5TA 3J81i 1HCZA 5LJ5h 1N36Q 3GTPH 1RADB 3T4AC 3INZA 1OX9A 5GAOp 5GAMj 5KYUB 3CXCP 1VQ8T 3MZ5A 5G3LF 1K76A 1PRLC 3A8KE 2KRSA 1EQRA 1F9RA 3EFXD 4N4HA 4HCSA 2EQIA 1BBZA 4KN4C 2HSPA 5TSSA 1K4US 1TWAH 4Z8AA 4FM4B 5J1ZA 1B50A 2C5CA 3LGLA 1H9KA 1RL2A 4DOWA 1X6OA 2Y4XA 1IRXA 2YT6A 4LAAA 2NVTH 3S2HB 3EG1A 3J80E 4LDVA 2JYOA 1FMKA 2DXUA 3SFMA 4KHZA 4FYXB 1SE4A 5M5XH 4GY5A 4JK1C 4P75A 1UUPA 3J7A5 2OX7A 1PYSB 3P75A 3WDNA 1Y57A 2RB6A 4B6MA 4E7LA 1HR0W 1KDAA 3CHBD 4L6V5 1YIJT 3O5ZA 3I56Q 4DV5Q 1ZA2B 4F8MA 1YFNA 2G9DA 2R58A 1XNQQ 1M90U 2IY5B 3SEMA 2RKSA 1NM7A 4PQXA 4IFDI 1TSFA 3OYCA 1FNVA 1S4ZA 4DR2Q 4ZKCB 1NUCA 1DCZA 4LDUA 4MHEA 1QVPA 3U23A 2E75C 3TP8A 4A3BB 1EEFD 2EDGA 1XMQQ 1PRTD 2JJ9A 2K05A 5FKAC 5CORA 2QILA 4QVCA 3CCQQ 2B8GA 1H9JA 4LF8L 3CC4T 3GTMH 2BZ8A 1AH9A 1JCKB 3OS5A 5EKKA 2KQ3A 1ZX6A 4UP7A 3W1BA 2JA8B 4XYOA 2CVRA 1GJXA 4H7BA 1NE8A 1CTMA 3I4OA 2LT4A 5LJ3g 1HUMA 1U4RA 3IAYA 1OULA 1NJIU 1TS9A 3JAMc 4IKFA 1AOJA 2DEUA 4CC7A 1SPKA 1W2BA 2ZPGB 1SNCA 3NQTA 1S3OA 4R4CA 4L5GA 3H6ZA 4IUTA 1BKBA 4WJ4A 5KNBA 4ZTJA 1IHZA 4JI3Q 1HTLD 2CT4A 2PQEA 3BVZA 4LUVA 2RI5A 3H6MA 1AZGB 2ASBA 1UE9A 2KENA 1PRMC 2E3IA 2Y90A 4HMJA 4MTKA 2MNAA 2WINB 1H641 1O7IA 4RHRA 2QEXT 3A98A 4IOAA 1VQOT 3ICEA 3ASKA 5EBDA 2N49A 2M02A 3QOJA 5LJ3j 2DL3A 3JB9J 5LL6X 2B2VA 1NLPC 3S15B 1Y8OB 1PVOA 4A3IH 1TS2A 2ZT9C 1KRSA 1ZA1B 5C3WA 1OZ2A 2X51A 4EMGA 4O0AA 3UE0A 2UXDL 1V9PA 4E7HA 1BR9A 2KXCA 1X32A 3OHXC 4JBKA 1EFID 2I07B 3DWAA 2RA2A 3HEJA 4L5TA 1WTOA 3M7NA 1TVXA 4GKJL 3QZ9B 2M2LA 1X6GA 2XTIA 5GAN3 3C0CA 3I2ZA 3TDQA 3OPOA 3UI2A 1CM9A 1QZHA 1RABB 5GAMf 1I50H 5GAN8 2LP5A 1CKNB 4JI1Q 3TEEA 4RMOA 1CI3M 1DOKA 2QCPX 4Z88A 4BBRG 4X62Q 4ID6A 2CP5A 1I4HA 1IB8A 2OAWA 2M9VA 2ESWA 3CP0A 3IQLA 2JTFA 2JQOA 3JC66 2FEIA 4DR6Q 3RN2A 4DR7Q 4QKUA 3PT9A 1RI0A 1M4ZA 4JI4L 2LTOA 3CPWS 2LRQA 2Z6KC 4JG2A 1SFOB 2E70A 2UXBQ 2RHIA 1Y0MA 2A68D 2KCNA 1VQNT 1LO5D 4A93H 3KXTA 2K4KA 4HKEA 3DLMA 2A8VA 1WD1A 1UHCA 2B2UA 2A3LA 1LT3D 3SDZA 3GV6A 4KV6A 4J9FA 4GNXA 2YUNA 3OMCA 5GJWB 1KJWA 1UEAB 1Y1WH 3A5ZB 4ZLTF 2KA7A 4FNFA 3JCMg 1Q81U 2D0PA 4IPDA 5LJ5f 5GAOr 1YJ9T 4RTUA 1KNAA 1PZKD 4F88A 5IP9H 5HK0A 5FOBB 2K2MA 1EWCA 3MKDA 2CS7A 2CW0C 4LF9L 3CPWP 1H9SA 5KNCA 2L4NA 2QDYB 1OI1A 5FU6B 1SYBA 1EFWA 1UEBA 5FU7C 4ZGDB 1N32L 1CFMA 3EQLC 3GP8A 1KQSS 5JVG3 5ELFA 3D0FA 5M5WB 1C4QA 1DJRD 1VQ8Q 1XQHA 5D6WA 5L8RE 3OYGA 3KK7A 3K6OA 1Q8IA 4P74A 3ULJA 3SVMA 3KJOA 1BF4A 3QR8A 1SNDA 3FIFA 1C8CA 2HHHL 2VUMH 1S5DD 1SROA 3DUZA 1M3CA 5CV7A 7AT1B 1IHWA 5AFWA 5A0LA 3LGJA 3ITPA 1J8IA 1MD2D 1GXIE 4NDXA 2XRSD 4DK3C 2EZVA 1YI2A 3D8GA 1H3ZA 4LDWA 1K83B 1PM3A 1IHVA 1FGBD 4JOIA 4FF1A 1A6XA 2WKDA 1Y69U 2BTTA 4MIUA 1MGSA 1KQSP 2YU9H 4X34A 5JVH3 3GTQH 1VQPA 3J81j 3QIAA 4DUZL 4A3MG 2C0OA 1STBA 5C4JB 4GN4B 4GLMA 3QDFA 1HZBA 1I4GA 4R8NA 4NW2A 5IGDA 4KY6A 1KD1U 3K57A 5HKCA 3ERSX 5IYCH 1HSQA 3CW2C 4WRDA 2XK0A 4N9PA 4AFSC 2EXDA 5FU7B 1J9OA 2Q2HA 3FMCA 3RMHA 3S1MB 1GD7A 5DM63 3UDFA 1OX8A 3M4OH 1ZBXA 3TU4K 2WP8J 4M1UB 4F7UF 2Q2IA 4AQYQ 1HRJA 4PLIA 1I4QA 2G6FX 1B70B 4V0BA 4GOPA 3PIPA 2K5HA 1I94L 4BY7H 4OGEA 1E2WA 2BE5D 1ICWA 2LQKA 2MPXC 1EU4A 2Y0SB 2DY8A 3A55A 4C3JH 2D8JA 3M9QA 4ZGEB 1QNKA 3DB3A 4HXJA 1I4K1 2A0FB 1NR4A 3P7JA 2ATWA 4IFDJ 1FVIA 4WJ3M 4A3EB 4RGNA 2XG8D 1TWFB 4A3GH 3PCOB 2A5HA 2WACA 1II3A 5IIFA 1KXLA 3VR5A 2ZCFB 1K8MA 1HA5A 3VV0A 5FO8B 1WYDA 1B07A 1FJGL 1A2UA 1BCPF 4MZMA 1T3LA 2EYZA 2LCCA 3QWXX 1LTLA 3SWNB 1VMPA 2RDHA 1EWIA 1LTID 4LUZA 2J6FA 1VQ5A 3WWVA 2VGNA 4J9IA 1HXYD 3BE3A 1ZSZA 4C8QG 2J6OA 1VQMT 3RKWA 1WCMB 2F0UA 4QL5A 1M1GA 4E7IA 2K5NA 1I1JA 3RZOH 2FG0A 4EQ5A 2W0ZA 3VU3C 4ABNA 4EVOA 2BDNA 1AP0A 3Q22A 2JA6H 4A93G 3T1HL 1CKMA 1K3BC 1IYJB 5CCAA 2P5ZX 2QTVA 2MF2A 2L55A 3OBWA 3JCMV 1A62A 1S40A 1QP3A 3I90A 2CH4W 1Y1VH 2M9UA 1STNA 4JI0L 2AZVA 4DR4L 1OTCA 1MKHA 3E6ZX 1U06A 1UFFA 2AHOB 4HIDA 1V1OA 3X28B 1XWEA 5IP9G 3OS2A 2LFNA 2RF0A 2Y4YA 1TKWB 5JPNC 3NSWA 2EWNA 4Y7NB 2N78A 3D6WA 3RUZA 2K7AA 2RMOA 1U4MA 2Z0WA 1T5XD 4QY7A 2MIOA 1A0IA 1AT1B 4P2CB 1E6HA 1OQKA 1U4PA 4B3SL 2MP1A 4YY3Q 4X66Q 1W2BP 1RODA 3NBHB 2RQUA 3M53A 1Z9QA 1SE2A 1J5EQ 2DIQA 1Q1BA 5ELNA 1Y96A 3SK6A 3CMEA 1ZLMA 1YHAA 4DXGA 3FRPB 4DR5Q 2MI6A 4OGCA 4CKCA 1WZOA 4HJ7A 5C4XB 1ZSGA 1VQPQ 1HNZL 2XHCA 1IGUA 4A3KG 4IPCA 4LF6Q 4BY6B 1VUBA 2KSSA 3GLXA 3OWEB 4FSSA 4L5SA 2JA8H 4FXKC 2E64A 3I4MG 4C0FA 3QJ6A 2F52A 3HOXG 3HP9A 2IX0A 2CGHA 4OVAA 3M0TA 4G4KA 2CSQA 1F2LA 2F0VA 3TP7A 1AWXA 5CK9A 4DR3Q 4A3FB 2B63B 2L8DA 3U9SA 3S1QH 4BBSB 1R9TB 3AB9A 4KTAA 1BI3A 4HIOA 2XRQD 5IYCG 5FJ8H 1E0BA 3JAML 2XNAC 1XJWB 1QKXA 1K8OA 2XIDA 1K0XA 1X01A 1R4QB 4Q0FA 4AH6A 5KNDA 1WVLA 2ED1A 3SEBA 3OW2A 4UPAA 5I6YA 4C8QF 1KIXA 4DV2L 3K5OA 4I7ZC 3BDOA 5GAMd 5FLMG 1FYCA 5IGGA 4FXGC 4CRIA 1NMFA 4BY7G 2H5XA 4N9TA 4M77F 4QIWE 2QYZA 5IHNA 1JC7A 3QIIA 3BZKA 3PF4A 4C3JG 1XPRA 4RH6A 5IY0A 1EYAA 3J80c 4ZTFA 4NKLA 2PUOB 1N9WA 2YLBA 4WFN3 1NMGA 1V1QA 2JP1A 3K0YA 5JEAG 3G71T 1TWBA 1VQ5Q 1YP5A 2O01E 1UHFA 5CV8A 4B3RQ 2F0OA 2X9HA 3PF5A 4DA2A 1CT1D 2MUYA 2FXQA 3VYSA 1IW7C 3HOWB 3OY9A 5I22A 2KCMA 1WTRA 2JS2A 1TU2B 5A0GA 4Q5VA 2KCCA 2LMCB 2LS01 1M90C 4R9WA 2DILA 3HOVH 5D7UA 3RMQA 3VS1A 1GFDA 1LNXA 2PZUA 1SFOH 2M16A 2OXPA 4DBHA 5LJ5d 1DXMA 3L42A 3GTJH 2K5VA 4HCBA 2RK1A 4CDFC 3TQYA 3DM3A 5D14A 4KHPQ 1GXDC 1OXTA 2H3JA 1ARKA 4A3LH 1MBYA
chains in the Genus database with same CATH topology
1UB4A 2UXCQ 3UDIA 1UGQB 4MDXA 4PJOD 3L2PA 1XPUA 2VW9A 4KUDK 4N0AA 1QVCA 1NJIC 3CCSA 1U1SA 3UPUA 1JJ2S 4MMKA 4GN3B 2K5FA 3NENA 4PJOA 4DV1Q 1VIEA 4JRKA 3HOYH 4JI6Q 1M5Q1 2D9TA 3EBEA 2CZ7B 4PNOA 4F7UB 2JZ2A 5M5WH 2D0QB 1WJJA 4IJLA 5GQOA 2X4WA 4NOYA 2KY9A 2UU9Q 2RHSB 4YCUA 3MEWA 3FEOA 3V7CA 1Q86U 4A3BG 4YCWA 1K83H 4OWWB 5LJ3d 1LYLA 2ID0A 3HFNA 3QJYA 1WJRA 2M1HA 5BR8L 1MHNA 4X9CA 1TH7A 2D0OA 2OWOA 4BI3A 2V8KA 2X4XA 2RHQB 2F4VQ 2JA8G 4H02A 4Y28E 5GANe 4DV6Q 2JTMA 3FRNA 3RERA 1OZ3A 2B8AA 3LW5E 3JB9H 3S1MH 3S14H 2K5LA 2MWOA 1VQLA 3CC2T 3L2UA 1N34Q 1GM5A 2IT1A 2VQFQ 3QXEB 1O75A 4IJHA 1OXSC 1K9MU 3E1SA 1P16A 2VQEL 4OB0B 2E2JH 1YJNA 1Q81C 2WFWA 4A3EH 2AKWB 3QDRB 5LMUQ 1B34B 2DEQA 2MMPA 4UC4A 4LF7Q 3OTOQ 3HRUA 3E19A 2R7FA 3W1GA 4E47A 3K0XA 1KAWA 1MJCA 3OYHA 3E0EA 4BA2I 5GROA 3TEHB 4C8QC 3S16H 2K75A 2F5KA 1WCMH 4QQBX 5E7NA 1J6QA 2R7ZH 1HR0Q 4M77C 4HT8A 2EQMA 1RIPA 1VS0A 5FRMA 4BDYA 3CCVA 4D6WA 1X75C 4QQDA 3U4ZA 4A3LG 3OYFA 1FXXA 4VUBA 4NXMQ 2DTIA 2ZJQA 4M78D 4JI2Q 2FYKA 4LFCL 5IYBG 1XOVA 3CD6A 4Y7NH 2ALYB 1PH8A 4M78A 3ZBDA 3FB9A 1SN8A 4JUVA 2E5LL 3STBD 2HIVA 4DV7Q 4M77B 5GAOl 1B7YB 5LMNW 1S72A 3CBOA 3GDEA 5GMKi 2DUDA 2KMTA 2EAYA 5LL6S 2RHZA 1NBWA 1BBUA 2B63H 4A3FH 4J6XA 1U5KA 2HBPA 1G3WA 2PVOB 3HRTA 4M7DD 1D3BB 3H8ZA 1HH2P 2L89A 2WSEE 3JB9G 2CCZA 1IBLQ 3CCJT 4EMKA 1WGSA 1YHQT 1UGRB 3LWIA 3UE1A 2F3IA 3PV0A 4M7DA 2UUCQ 1WI5A 5CQXA 1KQ2A 1VQHA 2I2LA 2R6GA 1UE1A 2Y0SG 2MO0A 4LF4L 3CPWA 3CCLA 2HAXA 3BFMA 4A3EG 5JJLA 3BZCA 2OAUA 2FVUA 2O4XA 1N36L 3DLLA 3T1YQ 2QQAA 3OYJA 4PG3A 1WCMG 3X25B 4RKUE 1SRUA 2NZOA 3ME9A 3JAMi 4BDZA 1VQEA 4YWKA 3RMSA 1I5LA 4JRIA 5GAN4 3VYGA 2RI2A 2M0OA 2E1HA 3K81C 2MWPA 4JRQA 2UUBQ 1NPPA 3A74A 1X56A 4HCCA 3T9NA 3C94A 1VQ6A 4DV5L 2JEBI 3ULPA 1XNRL 2BA0A 4LWCA 5HK3A 1XNQL 2V8JA 1WJQA 4X64Q 3JB9F 4M75B 2P0KA 4DR2L 2AWNA 3MP6A 2OCEA 3H15A 1XMQL 4M75E 1YEZA 4RMFA 3EFRA 5LJ5g 3I55A 5C4XG 2CZ6B 2X4JA 1QZGA 2HQLA 3VKIA 1PSEA 4TVRA 2RM4A 3GTGH 5HGQA 3GTOH 1JT8A 4A3DH 1P8LA 4LFAQ 5H1SE 2B63G 4A3FG 5CR2A 2ZPFB 4BBSG 2EYQA 4XK8E 5LJ5j 4P5NA 1E7ZA 1N6AA 4B3MQ 1PH9A 3UT1A 1SR3A 1PFSA 2VZAA 2N8NA 3PMTA 4IFDG 4M7AE 1X65A 4XTWA 1M1KC 1VQ8A 4ALPA 4DAYB 2R5MA 1PH2A 2CZ1B 1IZ6A 1Y14B 1YNXA 2Z6KA 5M3FG 4M7DE 2Z0SA 4BA1I 4JI1L 5CQYA 2E41A 4C92E 4X62L 4UY8C 3OS1A 3QHSA 2PQAB 3CBMA 5GAN2 4A54A 3H3VI 3NTKA 4DR6L 2B3GA 4DR7L 2E5QA 3HOWG 5D6XA 1HJPA 1X54A 2DO3A 4DNIA 2UXBL 2HIXA 2JN0A 4DAMA 4J5YA 2K52A 3M55A 1YIJA 2OQ0A 3HOZH 2I0QA 1U0LA 3NELA 2CWPA 4DQ2A 2XKOC 3G4ST 1VQIA 3JCMc 5I2SA 2G3RA 4BACA 3K7AH 3M54A 4EMHA 5I21A 5FU6C 1JB7A 3CC4A 1WJSA 1XPOA 5M3MG 2VNUD 4JLIA 4O6JA 2MO1A 2KQWA 4F7UG 1SLJA 2JA7H 5GMKl 2DPPB 1HZAA 4KT0E 4LW1A 3A8HB 1Q7YC 3Q1JA 2R92H 5C3EH 2ZJPA 1X3EA 2ZTEA 1K9MC 1PSFA 3PNWC 4OWTB 1K8GA 3HKZG 1G3YA 3VUBA 2QEXA 2ZM6Q 1VQOA 3OYIA 1IREB 3QZ5B 3PUVA 2DVEA 3PIOA 4GLXA 2E2HH 1HNXQ 1VCIA 4C5HA 3BJUA 3G6ET 2KHIA 2DIGA 3KDFA 3GTKH 1HNWQ 2PMZE 2JE6I 4HIKA 4V2SA 2UXDQ 1L1OC 4BY1H 4JYAQ 2Q2TA 5CKEA 3EAEA 2WAQG 3ZEHA 1NE3A 4BI4A 3GOXA 4GLVB 1BIBA 1VQNA 1FGUA 3G7ZA 1YITT 3EIVA 4OO1I 4J6YA 3MP1A 2I5MX 4AYBG 1G3TA 5C44H 1E1TA 4JS4A 3RNUA 1K8AU 1Z9FA 2D62A 4JI4Q 3SWNC 1YJWT 4ZN1A 1YJ9A 1JJCB 3PO3H 2RCNA 3OBYA 2WSCE 1JJ2A 1XMOQ 4L59A 3V8LA 4A3JH 1L1OB 3A5UA 3HOUH 2BH2A 3C95A 1MIUA 4IUVA 4A3IG 4LDYA 4LF9Q 3HKSA 4IO9A 2HQEA 1UE5A 3S3MA 3RR5A 4C3HH 3META 3CCET 1X3GA 4X66L 3OMGA 2BA1A 1Y71A 2V8IA 3L7ZC 1E1OA 3OYAA 2HHHQ 3J80i 5DY9A 2JA7G 4DUYQ 4XIGS 3O8VA 3PMIA 4DR5L 2DKGA 3M4YA 4M77G 3TRZA 5GMKe 4APVA 4BY6C 3L2ZA 4QVDA 4OP0A 1VQ9T 2CKKA 2R7DA 4XU2A 4HJ5A 1Y1WG 1N33Q 1VQAA 4DR3L 4C2MH 3GNGA 3QKJA 3L2WA 1SSFA 2CZ0B 3DKMA 4A53A 5LJ3e 4AIMA 4MDWA 4HJ9A 3JRZA 2WB1G 3URGA 4EX5A 4A4IA 1OXXK 1M1FA 4BY1G 5CKFA 3ER0A 2VUMG 1VQMA 4JBJA 4F7UA 2LCLA 4DR1L 2GFAA 2RJFA 4OXPA 4ELZC 3A8LB 3CCUT 1I5FA 2R93H 4OB1B 1FJGQ 4B3RL 3PGGA 5CAIA 5KCOA 1VQDA 3JCMJ 2OTJT 1UE7A 3OSVA 2E2IH 1WFQA 3S17H 2YYZA 3VUZA 3C4SA 3PO3G 3E9HA 2IHEA 4JI8Q 4C0GA 1LM0A 4RCCA 5GAOm 4RG1A 4KHPL 4FDBA 2BUDA 4J7FA 2UXCL 4C0DB 2JA5H 2DJZA 1NZ9A 3HFZB 4BD3A 1K73U 5LMNQ 4GOPB 2VGMA 1Y7XA 1M9SA 4NXNQ 3X20B 1N27A 1EIYB 2EQJA 2NLUA 4JI6L 3N5BB 5CVIA 3K7UC 4A3GG 1NY4A 3JCMe 3FP9A 1Q12A 2DTHA 3VYHB 2VC8A 4A3CH 1KRTA 4YHHQ 2XDBA 2RI3A 3OYLA 5IAYA 1AE2A 5GAOq 2NVQH 4YTLA 2JA6G 2F4VL 1Y1VG 2P0PA 2ES2A 4DV6L 1EIFA 2EQSA 4C3IH 2JOYA 3KF6A 2HNIA 4JC0A 2RJEA 1X55A 4GKKQ 4K0KQ 1I6HH 1AE3A 3G71A 3V7RA 1N34L 2DXCA 1GKHA 2MAMA 3HPWA 3CC7T 3JSCA 2VQFL 2RHUA 3MEAA 4C8QD 2XICA 1G51A 3BW1A 1PA6A 4M77D 3H0GH 4X65Q 2PVGB 4C8QA 1Y96B 3F70A 2E10A 3PGZA 5LMUL 3F8TA 1IBKQ 3FLGA 4LF7L 3OTOL 4M77A 2RH2A 2R93G 4JI7Q 2PUKB 1Q8KA 3RIRA 4TVAB 2YHTA 3U4VA 3WVDB 4FT4A 3L1AA 4XU0A 3LH0A 3EN2A 3M4QA 1HR0L 1VQ4T 2VV5A 5FJ8G 2C06A 4UP8A 3A8GB 3SB2A 3CMAT 3J81E 3CQZH 5A0DA 3CCMT 4M75F 4FT2A 4R4IA 4PZ6A 2K50A 4OX9Q 3CF5A 1I8FA 4JV5Q 2RD1A 2ZPBB 3E9IA 2D6FA 2X4YA 5DLQE 5IYDH 4GLAC 4DA4A 3OQ5A 3E9GA 2IG0A 4LF5Q 1QVGA 1LUZA 1GO3E 3S3NA 2NN6I 4LDXA 2QTXA 4IUQA 2JNGA 5CKDA 2NVXH 3QUIA 3MHXA 4B3TL 4R55A 1N9RA