2EIFA

Eukaryotic translation initiation factor 5a from methanococcus jannaschii
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
133
structure length
133
Chain Sequence
MVIIMPGTKQVNVGSLKVGQYVMIDGVPCEIVDISVSKPGKHGGAKARVVGIGIFEKVKKEFVAPTSSKVEVPIIDRRKGQVLAIMGDMVQIMDLQTYETLELPIPEGIEGLEPGGEVEYIEAVGQYKITRVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords PROTEIN (EUKARYOTIC TRANSLATION INITIATION FACTOR 5A)
publication title Crystal structures of eukaryotic translation initiation factor 5A from Methanococcus jannaschii at 1.8 A resolution.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 23
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 1998-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
A PF08207 EFP_N Elongation factor P (EF-P) KOW-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2eifA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2eifA02
1WCMG 1TWCH 1ASYA 1VQPA 4JI2Q 4IFDJ 2VQEQ 4JI1L 3I55A 2OCEA 1LM0A 1N8RC 5M5YH 3F2CA 4ALPA 1PH7A 1T9HA 4A93G 5IT9E 2VQEL 1HNZQ 4UY8C 1XPUA 3AYHB 1V9PA 1WJJA 4A3EG 4R4TA 3K0XA 1XPRA 3J80c 1VCIA 1K8AU 4GN5A 2BH8A 1D8LA 4POGA 3PSIA 4JG2A 3PF5A 1YIJA 1JE5A 3GTMH 2E2JH 3H0GG 1G51A 3CCST 2K75A 4EX5A 2CCZA 3RZDH 3BU2A 1QZGA 3JAMi 1YITT 2LXJA 5C4XH 4DV0Q 5IY0A 4B3RQ 4X6AH 5LMNQ 4O0AA 1YVCA 3EIVA 4A3CG 1Q8KA 1XMQQ 2WP8J 2E70A 4DV0L 2MO1A 2UU9Q 5LMNL 2I5HA 3M4QA 1TWHH 1Q1EA 4P71A 1XMQL 5FLXc 4L5SA 4A3LH 5A2QE 1VQEA 2UU9L 3JAME 1KD1U 1H95A 5IP9G 1K9MU 4AIMA 3HOXH 4JBKA 4A3GH 1UEBA 4ZN1A 5M3FG 1X3EA 3PO2H 5M3MG 2LXKA 2QA4A 3CPFA 2NZOA 3GTJH 1SN8A 1X3FA 4DUYL 4JI7Q 4JI0Q 4H02A 1VQ4A 1YJNT 1K0RA 2ID0A 3GTKH 5IYDG 1V1QA 4DV2Q 2D62A 2E8GA 2E2HH 1GM5A 1XTDA 3CCVT 2VZAA 3CPWA 1WOCA 4EQ5A 4A76A 2BH2A 4A4IA 4DV2L 2WB1E 4HJ7A 3F2BA 4NXNQ 3KDFA 3CD6T 1OXSC 1LUZA 3CXCS 2YV5A 3S24A 2PQAB 4NXNL 4OWXB 3S17H 4HJ9A 2UXDL 2K4KA 3CCSA 3UDFA 4XIGS 2L15A 1KHIA 1GD7A 3RLNA 3GDEA 1YITA 3L2PA 3B6YA 1HR0W 1HZCA 3K8AA 2I5MX 2B29A 3E0EA 2B63H 4C2MH 1YI2T 4AYBG 4GOPC 1NE3A 2UXBQ 1W2BS 4MZ9A 4R4OA 2R93G 1VQ7A 2R7ZH 4LFAL 1Q81U 4BBSG 4NXMQ 1FJGL 4BXXH 1PFSA 2MNAA 4NB3A 2JA5G 1P8LA 1Q82C 4BY7G 3OW2S 1KC8C 4P72A 1NMFA 4NXML 1A63A 5GROA 4KHZA 2EIFA 2PNHA 5IYBG 3KJOA 2ZJRA 4P73A 3U4ZA 4JBJA 3HKSA 1VQLA 1YJNA 5H1SE 1YHBA 1NPRA 1K83H 1X65A 1S3OA 3CCVA 2GVAA 4TVRA 2UUAQ 1XNQQ 2WAQG 2ZTEA 4OXPA 2KBNA 4GKJQ 3CD6A 4A3FG 2A19A 1SLJA 1XNRQ 2UUAL 4IPDA 2JOYA 1XNQL 1G6PA 4JC0A 3RR5A 3CQZH 4BBRH 4GOPB 1PH6A 4GKJL 1XNRL 4DR4Q 3KF6B 3HOYG 3OYYA 3K7UC 1CKMA 2OQ0A 3ULLA 4DR4L 1SRUA 4L5QA 4UP8A 3T1HQ 4B3SQ 2MO0A 5BR8Q 1YI2A 3TS0A 3I4NH 1VQNA 4B3SL 1IL2A 4AYBE 4DNIA 1L1OB 2JJQA 4TVAB 1PHJA 4ME3A 4R4CA 4JI3Q 3RNUA 3GTGH 1DGSA 3FHWA 4DR5Q 1QVCA 1YZ6A 4R1JA 4X34A 4JI3L 4LUOA 4K0KL 4DR2Q 3IRBA 1VQAA 1V43A 1NBWA 3J81j 4DR5L 2VUMH 3M4OH 2B3GA 4IOCA 1KQSS 5HY6A 1YJWA 1IXRA 1QUQA 1X54A 3LH0A 2D0PA 4YY3Q 3GTPH 3H3VH 4UP7A 5C4XG 3K7AH 2ES2A 1CKOA 2DO3A 4YY3L 5ELOA 1EIFA 1IYJB 3S1MH 4LWCA 1W2BA 1KAWA 1N9WA 4A3LG 3RLOA 3PUZA 4DR1Q 4J15A 1OTCA 2WAQE 3CCQT 1P16A 3CPWS 4PG3A 3UDIA 3OTOL 2GVBA 4C3IH 3J7A5 1Q7YC 3K80C 5E7NA 1XMOQ 3HOXG 1RL2A 3A5UA 1PH4A 4A3GG 2UUBQ 3PO2G 1XMOL 3GTLH 1Y1VG 1XJVA 3CCUA 3G71T 1HNXQ 1MJCA 5HGQA 3M85A 4AQYL 1PH1A 1UWVA 2IT1A 4DAYB 4X62Q 1Q86C 2CWAA 2VS1A 2IHFA 1JJ2S 1K3RA 1VQDA 3H3VI 2HHHQ 4JI2L 1K8AC 1VQBA 2WB1G 2ATWA 2OQKA 2KDSA 1RIPA 2HHHL 1HNZL 3PO3G 3AQQA 4QQBX 1A0IA 4GLAC 4YWKA 1Z9FA 3U50C 1M1KU 2AMCB 2Q2IA 1OXUA 2AKWB 2R6GA 1C7YA 1E7ZA 2LQ8A 3T1YQ 3CC4A 4RG2A 2B63G 4L5TA 2BA1A 1Y1WH 2YU9H 3T1YL 1FVIA 1I50H 2PI2E 3A5ZB 1A62A 3Q8DA 2IG0A 1UE7A 5C44G 2R7ZG 1ASZA 1VQ5T 3S1QH 4LF8Q 4B3RL 3CCJT 3CCQA 4OX9Q 1M90C 3RN2A 3DB3A 2MWPA 1VQMT 1K9MC 2ZM6Q 1WFQA 4BXXG 1SE8A 4LF8L 4JYAQ 4OX9L 2JNGA 1KQSA 1AE3A 3G6EA 3S14H 3CCLT 4B3MQ 3MEFA 1PH2A 4KHPQ 4WJ3M 4LF9Q 1X9NA 2DGYA 4QL5A 4HJAA 1Y1VH 3I2ZA 2LVMA 2MI6A 1UE6A 2CKKA 1Y14B 2ZJPA 3KF6A 2JEAI 3LGFA 2VL6A 1N34Q 2E2IH 2JA7H 1CKNA 2KHJA 4JI0L 5IWAQ 4R4QA 2YTVA 1N34L 3TREA 3FKIH 4JCVE 1G291 4NPSA 4BBRG 1S40A 5IWAL 3M3YH 5IYCH 2JE6I 4A75A 3L0OA 1EUJA 1VS0A 3H15A 1IBKQ 2FXQA 1KRTA 3J81i 2F4VQ 3PO3H 1YNXA 1GVPA 1WYDA 3LGLA 4ZN3A 1MJEA 4DK6C 1IBKL 4KLKA 1IBMQ 3PCOB 2F4VL 1QVFA 2EQSA 1OXXK 4JI6L 3P8BB 1IZ6A 4JI8Q 1IBML 1JJ2A 3JC66 3I4NG 3TRZA 1GKHA 1N32Q 1JJCB 1PYSB 3KOJA 4JI5Q 3J81E 1VQ5A 2NVTH 4R4IA 3CCJA 2XHCA 3VDYA 4A3JH 1E3PA 2RHSB 4JI5L 4LFCQ 2VY3A 1VQMA 4CRIA 1LTLA 5C44H 1GO3E 1HR0Q 2UXBL 4LFCL 2VUMG 2VQFQ 2NVXH 1HR0L 4LF4Q 3CCLA 2HT1A 2VQFL 3F2DA 2ZTDA 5LMUQ 4A3BG 4RG1A 1IBLQ 1J6QA 1VQHA 3D31A 5C0XI 5LMUL 3J80i 1IBLL 4JI6Q 1JJGA 3PUVA 1KIXA 2JA9A 1NJIC 4GS3A 1K73U 4IJHA 4GNXA 1EOVA 1X55A 2HIVA 3E9IA 4QY7A 1U0LA 4DV6Q 1JB7A 4QJFA 1YEZA 3BZKA 1I94Q 4DR6Q 5JJKA 2QGQA 5GADC 2K50A 5IT9c 5IAYA 5C3EH 4DV6L 2Y0SG 1N33Q 3J80E 4LF5Q 1PYBA 4DV1Q 3I4MG 2K14A 4IOAA 3L7ZC 3NELA 4OONA 2E6ZA 4LF5L 3KYHC 4DV1L 1SMXA 1W3SA 4JOIA 2AWNA 3PF4A 2HIXA 4Y52H 4A3IH 5ELNA 4HJ5A 5LL6S 1Q46A 1VQ6T 1MIUA 2CQOA 1EIYB 3E9HA 3T1HL 2UXCQ 5FJ8H 2ZJQA 5BR8L 1VQIA 3HOUH 2JA8H 2UXCL 2RF4A 4A3KG 4YCWA 5FLXE 4LF7Q 4LUZA 2Z0SA 1X56A 3AFPA 1JMCA 3J7ZC 4LF7L 2Q2TA 5EAYA 1HNWQ 4DAMA 4DK3C 3CCMT 3JAMc 4DR2L 4GKKQ 1SSFA 1CSPA 3W1GA 3KBGA 4LUVA 3DLLA 4IPHA 1Y1WG 4GKKL 4DV5Q 3NEMA 2LCLA 1CUKA 3G4ST 2KCTA 4JI7L 1E24A 1UE5A 4DR3Q 3HOZG 4LW1A 1VQCA 1KRSA 2HQLA 4UPAA 1PH8A 1K8GA 4PZ6A 2NVYH 1L0WA 1VQPT 4APVA 4OWWB 1C0AA 5K36G 1X3GA 4JBMA 3A0JA 5DLQE 3DM3A 4DR1L 3F1ZA 3J7AF 2Y0SE 3GD7A 2KVQG 4GNXC 2JQOA 1I6HH 3CMET 3HKZE 3SGIA 3I4MH 1U5KA 2K52A 2K5VA 1S72T 1QVGA 2UUBL 2CKZB 1VQ8T 1BKBA 2A1AA 2AHOB 2BA0A 5JJLA 1JT8A 2PQAA 1KXLA 4DUZQ 1HNXL 1QVFS 1VQ6A 5AJ3Q 2JA7G 4GLXA 2RHQB 4X62L 1UE1A 2KCMA 2OTLT 2F52A 2PMZE 3EN2A 3FKIG 3NBHB 4JBWA 4RMFA 1HZBA 4DUZL 1PH3A 1KL9A 4BA2I 1C9OA 5JEAG 1BBWA 1XNIA 5IYCG 4X65Q 5C0XG 4JV5Q 3U58A 4IFDI 4A3KH 1N32L 1EQRA 5IP7H 2IX1A 3KLWA 4JV5L 2LSSA 3KFUA 4A3DH 3CCMA 2R7FA 4BY1H 3PGZA 2R92H 3DB4A 1D7QA 3RLFA 3KJPA 3EBEA 1HZ9A 4WJ4A 3TQYA 3G4SA 3S2HH 3BZCA 3AEVA 2JA6H 4A3JG 3HOZH 4UP9A 1B7YB 1VQ4T 3HFZB 3PV0A 1Q86U 1KD1C 3ICEA 4GN3B 1TWFH 1PVOA 4HJ8A 1N36Q 1J5EQ 1VQ9T 3I7FA 4HIKA 2KHIA 1N8RU 2NN6I 2YTXA 3CMEA 3I4OA 2ZM6L 1N36L 1J5EL 4L5RC 3S16H 4JYAL 1S72A 3PUWA 3G71A 1O7IA 3NENA 2A8VA 1VQ8A 3M4PA 4OWTB 5LMNW 4B3ML 1WI5A 4IPGA 4GOPA 1VQKT 2K5NA 4LF9L 2XGTA 2VNUD 4HIDA 5JJIA 3MXNB 3CF5A 1VQJA 2OTLA 1M1GA 2I5LX 2MQHA 1TWAH 5J3BA 5C3EG 1I3QH 4HIMA 2JEBI 3LGJA 3S15H 1QUQB 4BA1I 1TWGH 5FLMH 2Q2UA 2NVQH 1NTGA 1VQ7T 2C35B 4B3TQ 4YCUA 4P75A 2N78A 1L1OA 3S2DH 1HH2P 1L2FA 2H5XA 1M90U 3HOVH 2Z6KA 4B3TL 4PZ8A 4GLVB 2D0OA 5IE8A 4DR7Q 4A3MH 4A3IG 4YHHQ 2JVVA 2IHEA 1NY4A 3STBC 4DUYQ 4LF6Q 3PUYA 4DR7L 3HOWG 1TXYA 1SROA 5FJ8G 1X6OA 3CMAT 2N8NA 4YHHL 1R9TH 4MNOA 4LF6L 2JA8G 3HOUG 3TS2A 4JI8L 3GTOH 4LFBQ 1Q81C 1VQLT 3CCET 4IJLA 1EQQA 1WCMH 4DPGA 2IX0A 4IO9A 4LFBL 3ULPA 3F8TA 1VQ9A 1E22A 1Z47A 1E1OA 2PI2A 5M5WH 3CCRT 4A93H 2UXDQ 1VQGA 2EXDA 2VW9A 1PH9A 4A3EH 4AH6A 4LF4L 3RZOH 5GAHC 4PMWA 4IFDG 2ALYB 2UUCQ 3I56T 4OO1I 1QVGS 1VQKA 2Q2HA 3M9BA 4YCVA 1K73C 1OXTA 2KENA 2ASBA 5GAGC 2OWOA 3H0GH 2UUCL 5M5XH 2MWOA 5J26A 4KI0A 5GQOA 1NPPA 2RCNA 4XTCS 2MFIA 3CC2T 1VQNT 4MTNA 4LFAQ 3RN5A 4A3CH 1HJPA 2AWOA 5GAEC 1FJGQ 2CFMA 3W1BA 1I94L 1SR3A 4DR6L 3HKZG 1PH5A 4GN4B 2N3SA 1A8VA 3CW2C 5JEAJ 2R7DA 4POFA 5C0XJ 1N33L 4PZ7A 4X66Q 2IY5B 1Q1BA 1YJWT 1YHQT 5IP9H 2CWPA 1HZAA 2NN6G 3CMAA 1L1OC 1Q82U 2G3RA 2K5HA 1KC8U 4X66L 5C4JH 5M3FH 4DV4Q 1EWIA 2Z6KC 3WWVA 5M3MH 1BBUA 2JK8A 4O2DA 3CCEA 3HOWH 4C3JH 3PUXA 4HIOA 1YJ9T 4DV4L 4KHPL 3UE1A 3STBD 3ERSX 3U4VA 5IP7G 3S1RH 4A3BH 1AH9A 5IYDH 1NJIU 4A3DG 3GTQH 2QEXT 4BY1G 1CSQA 3CCRA 1VQOT 1PA6A 2R92G 4LNQA 1AE2A 2E5LQ 1QZHA 3UE0A 3CC7T 1HNWL 1B70B 3I56A 4TQUS 2WFWA 4DKAC 2F3IA 4DV3Q 4DV7Q 4YTLA 1NMGA 2E5LL 2JA6G 1CKNB 3CCUT 1I5FA 2ZTCA 4DV3L 4DV7L 4QIWE 2OTJT 4DV5L 3AFQA 1EYGA 3KDFB 3CAMA 3W5OA 4DR3L 1BVSA 1YBYA 3CC2A 3BJUA 2YYZA 3FP9A 1NZ9A 3PIOA 4YWLA 3ZJYC 3I55T 4QGUA 1E1TA 1B8AA 1EFWA 4K0KQ 2I0QA 3TEHB 3UDGA 3CXCA 1Q12A 1SFOH 3ER0A 2R93H 4FDBA 2L3RA 3ULJA 4JI4Q 5DM7R 1FGUA 2GN5A 2YTYA 4BBSH 1VQFA 1YHQA 3S1NH 2JA5H 1YIJT 4X64Q 1XPOA 4JI4L 4BY7H 3PIPA 1PV4A 3CC4T 4X64L 4IPCA 5IYBH 2V1CC 3D0FA 1YJ9A 4Y7NH 5AJ3L 3GO5A 4JOIC 3A74A 3G48A 3J81c 2JUFA 4OO1G 5FLMG 4QQDA 3OTOQ 2QEXA 1VQOA 3KF8B 1FL0A 1M1KC 4X65L 3HOVG 2N49A 3UDXA 1LYLA 4A3MG 3K81C 3M7NA 4A3FH 3OW2A 3CC7A 3G6ET 1Q7YU 2DUDA 4C3HH 4AQYQ 4P74A 4YWMA 1OXVA 2NZHA 3CP0A 4GNXB 2XTIA 1YHAA 3HOYH 2OTJA 2QA4T 4JI1Q 1MKHA
chains in the Genus database with same CATH superfamily
4QVZA 1VQPA 4IFDJ 3FB9A 1TY2A 1BOSA 3I55A 4JLGA 2OCEA 3HL8A 5M5YH 1T9HA 3E3XA 4K2LA 1HNZQ 5DNFA 4RGTA 1WJJA 2SOBA 2A6HD 5CV4A 4A3EG 2OXPA 3AHUA 2DL4A 1ZYRC 3P20A 1Y0MA 1BXTA 1D8LA 4JG2A 3GTMH 1JE5A 1G51A 3H0GB 1W1FA 2K75A 5M5XB 2CCZA 2F5TX 4EQPA 1GUSA 1YITT 3JAMi 5KGUA 5LJ5e 2G9DA 1AD5A 5LMNQ 4M7AF 3PVQA 1Q8KA 2YUPA 2GNCA 2CP0A 4DV0L 1KIKA 1TWHH 4V2SA 1VOMA 1VQEA 4I65A 3MXGA 1CKBA 3JAME 2EYMA 2NTTA 1K9MU 1RCVD 2LRQA 2P84A 1HA5A 4EQOA 4A3GH 3OS0A 3CCSQ 2MPMA 1OQKA 2LXKA 4KKTA 2A36A 4C3JB 4DUYL 1Q95G 5IIFA 5EPKA 4H02A 2E3IA 1VQ4A 1K0RA 3OHXC 3L2WA 4A3BG 3I73A 3GTKH 2VZAA 3P8HA 2CSIA 4N0AA 3HRZC 3F2BA 2EXZA 1OXSC 4KHVA 1LUZA 3CXCS 2K1BA 4RGNA 2WKDA 2IJ0A 3S17H 4HJ9A 4FSXA 4G7HC 1RUWA 2K4KA 1D0YA 1TOVA 5D14A 2QILA 1I81A 1JBMA 1HR0W 1YJNQ 1U1SA 3GV6A 2OAUA 1NLOC 1SNQA 2FHTA 4AYBB 2CGHA 4MZ9A 3UT1A 4JZ3A 2PYKA 1PRTF 2R93G 1HSQA 1PTOD 2LX9A 3JCMg 4BBSG 4NXMQ 2L5QA 3PQIA 4BXXH 4F7UE 4NB3A 2HMAA 2ED0A 1RACB 4KUIA 1KC8C 1EY9A 4BY7B 3JCMQ 2RPNA 1BI0A 1M90R 2EIFA 3KJOA 1GL5A 1OPKA 5GAOr 3HKSA 1VQLA 2NUTB 1NPRA 1VQNQ 1K83H 1B3QA 3CCVA 4M77B 3VRZA 1EYDA 2DL3A 4JJBA 2L5TA 4FF4A 1W6XA 2UUAQ 4C92D 2WAQB 3T9NA 2KBNA 4GKJQ 1G83A 1U06A 4C5IA 4A3FB 2FHDA 4C3HG 4JC0A 3OYFA 1XXGA 4F7XA 1XNRL 1YJWQ 2B2UC 3HOYG 2KNBB 3MEUA 3OYYA 1NG2A 4L59A 1HJDA 4HMJA 3RESA 4ESRA 2J6OA 1MMAA 4LK1C 3T1HQ 1JOOA 5BR8Q 4FF1A 2ECZA 2FPDA 1YJ9Q 3CBMA 3TS0A 5M5YB 3A56A 3L2VA 1JU5C 2RNAA 4AFZC 4TVAB 1PHJA 4F04B 2QQRA 4M75F 3MXNA 1ARKA 2CP2A 3FHWA 2RDHA 1QVCA 3MA2B 3WXMB 1HTPA 3J81j 3GTMB 1UFFA 1KQSS 2B2YC 3RBBB 1X54A 2K2VA 3LH0A 4J83A 3CCUQ 3H3VH 5C4XG 5KYYB 1PXUA 1WXBA 2X4WA 2A69C 5G3LF 3A7AB 2F2XA 5GMKm 2EY1A 3S1MH 2XK0A 3FDTA 1U3OA 1TWHB 1A6XA 2EYYA 2F0EA 5DM63 4A3LG 1CHQD 1PFBA 1PM3A 1JE4A 1P16A 5EQ0A 3NBIA 4PG3A 2EBPA 4C3IH 3J7A5 1Q7YC 4CGYB 4E7SA 1XMOQ 3HOXG 3J7AV 4A3GB 4HSVA 2LDMA 1XJVA 1Y1VB 1CSKA 4M7DC 4PJOC 2EQKA 1KQ1A 2EWNA 1GUOA 3V2TA 4OMPA 3OSVA 2IHFA 2LZ6B 2SRCA 2RJCA 2DEUA 4KULA 2K33A 1M9SA 4BACA 3OOCA 4J8OA 1VUBA 4A4EA 2R3ZA 3JV3A 2QG9B 2WB1G 3AB9A 2IY5B 1QWYA 4LN2A 2XDBA 2ZXRA 3S17B 2MK5A 1CQFA 3PO3B 4DGZA 5GAOp 4ZKBB 1HYOA 2MGSA 2R6GA 1OXUA 2B63G 1EFNA 2BE5D 3MEWA 2BA1A 1G3WA 5DLOA 6AT1B 1A2TA 2OF1A 3Q8DA 2AUKA 1C6VX 1UE7A 5C44G 1EU3A 4HT9A 2CW0D 4UAIA 3CCQA 1PDQA 3VYSA 3M55A 5K36H 2ATCB 2MWPA 1VQMT 1K9MC 1WFQA 5I6WA 2EGCA 2FFKB 4OX9L 1HFNA 1KQSA 1D5MC 1NLPC 4F7UB 3G6EA 4A3EB 3ERQA 1BCMA 4LF9Q 1X9NA 5KYWA 5EG2A 1RAGB 2BTTA 4ZGEB 3OSSC 1Z6HA 1XQHA 2DGYA 1K83B 3LGFA 3S3OA 1RKNA 2VL6A 5EBCA 5GAMe 5KH6A 4H0LC 2JA7H 3CCJQ 2KK4A 3R6OA 1EEFD 1DJ7B 1NNXA 1B34B 3TREA 4FCYA 4QT7A 1EY6A 1G291 3TU4K 1KNEA 4L6V5 4NPSA 4ZAIA 1WHMA 5C0XH 7AT1B 2JE6I 4A75A 1EUJA 1VS0A 3CCLQ 3H15A 3I35A 2P0QA 1M4VA 2EQMA 1JB0E 3QHSA 1GVPA 1MJEA 5GANe 1JEGA 3SDZA 1SEBD 1TKWB 3CCVQ 1QP3A 1WPYA 2B8GA 2NVTH 3BVMA 2COZA 2RM4A 4OMNA 4JJDA 1E3PA 1NYGA 1Q90A 2VY3A 1LTLA 3M54A 3TZDA 2VQFQ 4JK1C 4R8IA 2F0WA 1PKSA 2HT1A 1WD0A 1QVPA 4FU6A 2DK3A 1GUWA 5LMUQ 2K5DA 4RKBA 4M78C 4RG1A 1VMPA 3F2UA 4EMKC 1WTWA 1VQHA 1STEA 3PFSA 2JMCA 3LWUA 2ZPIB 3J80i 3S1MB 2L3QA 1KIXA 1UUEA 3VV0A 4CC7A 4DQ2A 4DA2A 4ELZC 4CKEA 1IHWA 1K73U 4PJMA 4QY7A 3BZKA 4UC4A 1J8IA 2QGQA 5GADC 2K50A 2HQEA 5IAYA 3UWNA 1O9SA 1J9OA 2Y0SG 1OZ3A 3J80E 1PTOH 1PYBA 4J8QA 3PIO3 2K14A 3K0YA 1N33Q 3NELA 3RKXA 1CT1D 4HAEA 2DJGC 4LF5L 4BWGB 1PC0A 1WQWA 3QZ5B 2F3VA 1H9KA 2AWNA 2KXDA 3K5OA 1GHJA 3GQBA 2HIXA 4Y52H 4A3IH 5GAMh 1HA6A 4HJ5A 5LL6S 2UXCQ 2WSCE 1EIYB 4ID6A 3KBXA 4RTTA 2ZJQA 4J6YA 2JXBA 4RTZA 2RF4A 1G8ZD 1XOVA 2CZ0B 1LTRD 3EAEA 5FLXE 4MZMA 3VYUA 4NP5A 3THKA 4JJNK 3TP8A 1VDZA 3EGXB 4ORZA 5EAYA 5GANf 3JAMc 1PD1A 4GKKQ 2MF2A 1SSFA 1CSPA 3FRPB 3NHHA 4LUVA 1S5FD 2OJ2A 3DWAA 4LXCA 5JOBA 2X6GA 4OIKA 3MC0B 2AIRB 3G4ST 4IFDH 3HOZG 3K5NA 4LUDA 1NEBA 1VQCA 4WJWA 1L0WA 4YIJA 1VQPT 1SYFA 2QK0A 4APVA 4OWWB 4CKCA 5DLQE 4FYXB 4M7AC 2NTSA 2XRSD 4Z02A 4ILWA 5FU7B 3F1ZA 4FIBA 5CO7A 1PYWD 3NQIA 2KVQG 3OYKA 3SGIA 2O4XA 3I4MH 1U5KA 2K52A 2PZ1A 3EH1A 4AMCA 1VQ8T 1BKBA 5GJWB 1SE4A 2A1AA 2X3WD 2AHOB 4XQNA 2K6AA 2EW3A 3QJYA 3ITPA 1QVFS 1HNXL 2GFAA 2K6DA 1VQ6A 4FP5D 2JA7B 4X62L 2GF7A 1UE1A 2BUDA 2NYZD 3LX0A 2FPEA 5LJ5g 2PMZE 1WX6A 1Y96B 3FKIG 3NBHB 4RMFA 5JJIA 1KL9A 1C9OA 5JEAG 2YT6A 5A0DA 2NVQB 1DXMA 5BN4A 3PMTA 2KSSA 3KLWA 4JV5L 2YWWA 2CYZB 4A3DH 2O31A 1I4PA 1ZSZB 4EIKA 2R92H 4RH6A 4JDSA 3G71Q 3R6NA 3RLFA 4RGMA 3KJPA 1RADB 4JZ4A 9ATCB 1OULA 2LP5A 3AEVA 2NVTB 3N52A 3EG2A 4NL2A 3OMCA 1B7YB 4PJOG 3OYLA 4M7DG 1VQ4T 3HFZB 5C5MA 1KD1C 2CZ6B 2VB6A 3V8JA 2VXWA 4GN3B 1N36Q 1PVOA 2NUTA 3HRTA 1IW7C 4QUCA 1TXQA 1QMCA 1YCYA 1N8RU 4M77A 3CMEA 4JYAL 1J5EL 1YFNA 2X6LA 3IKJA 4QMGA 1SJED 3S16H 1C1AA 1D1AA 2J6FA 2F0SA 5FW9A 2A8VA 2XVSA 5LMNW 1KQSP 1PRLC 2RHXA 2DM1A 1TS4A 2K5NA 2RHYA 2K04A 2DJZA 3MEHA 2EYJA 1SMYD 1VQJA 2I5LX 1OX9A 2C0IA 4PMBA 5C3EG 2FO0A 5GMKj 4HIMA 2I0NA 1PTOB 2OAWA 1CKAA 4BA1I 1TWGH 1NTGA 3S2DH 3V96A 1EY8A 1WIEA 2KEDA 1GFCA 1NCVA 1M2OA 5HURA 2YSQA 4PZ8A 4GLVB 2D0OA 2EOTA 4G7ZC 4E47A 3MP6A 4A3IB 2JVVA 1G3YA 3HFNA 5LJ3d 3L9AX 4JW0A 4DUYQ 4LF6Q 5JVH3 2QAZA 1JWMD 1TXYA 1M1KR 3HOWB 4YHHL 4LDUA 2N8NA 2PW5A 3OIQA 2FB7A 4LFBQ 3GTOH 1Q81C 1VQLT 4OMQA 4ZNXA 2NUPA 5KYYA 1B4OA 1E2ZA 4R0KA 4C92B 2L11A 4X3TA 1U9RA 5EJWA 2L89A 1E22A 3KUPA 1D1KA 3CCRT 5KNBA 4FW2A 4A3EH 4LF4L 4AG2C 5IGBA 5GAHC 2KR3A 1W6JA 2A6EC 3V8LA 2ALYB 2QQAA 2DF6A 3OMGA 1VQKA 3OYBA 1K73C 2ABLA 1QKXA 5GAGC 5CC4A 1ZYRD 2L0CA 5LL6X 3UATA 2OWOA 2JA6G 1LV9A 5GQOA 1P92A 2V1RA 2MFIA 4MTNA 5LJ3h 4K5VA 5GAEC 1SFOB 4DR6L 1I4RA 3QR8A 1QCFA 4XK8E 4N4IA 3MTSA 1PH5A 4POFA 5JEAJ 2K4YA 2R7DA 2RVLA 1RAFB 2DXBA 3IFTA 4RCOA 1Q1BA 2EQIA 1YHQT 1HZAA 2NB0A 2F2WA 1L1OC 1SJHD 2K5HA 4IUPA 2NN6G 4X66L 5J1ZA 4ZUJA 4DV4Q 4M78G 3X24B 5C5LA 2V26A 3VDYA 2JS0A 2Z1CA 4K5WA 2E64A 1KG1A 3PUXA 2PMZB 3M0RA 2KECA 4PMCA 3UE1A 3STBD 4KHPL 3L2QA 4J9GA 1FYNA 2N55A 1UUPA 1OPLA 2F0HA 4WORA 3TP5A 1BYMA 4A3BH 4A3DB 3DEPA 4BY1G 1CSQA 3MP1A 1PA6A 2R92B 1WHKA 4CJ1B 1F2LA 4PJOA 4DAVA 1VMCA 2Z4IA 1Y07A 2PU9B 5HKCA 4MIUA 4DKAC 1TQOA 2Z6BA 5E4XA 2M1HA 2YRDA 3URYA 4CKBA 5E4WC 2ZTCA 2DEQA 2J06A 4DBRA 2YUOA 4KMUC 2CUDA 1HK9A 4OMFB 2P5ZX 3CAMA 5JJZA 4DV5L 1BVSA 4HVVA 1ZUKA 4YWLA 3FJPA 2RQTA 4K5XA 3UDGA 3RERA 3DWPA 2R93H 2RN8A 2L3RA 2KHSA 5DM7R 1MGQA 1B34A 3ASKA 1KFZA 2HBWA 1FGUA 4PJLA 1NR2A 1SNCA 3SK5A 4BBSH 1VYUA 1YIJT 4X64Q 4JI4L 1FYCA 3PIPA 1L0YB 3TMEA 1M5Q1 3PVLA 3REBB 1CM9A 4RHRA 1PV4A 2LMCB 2ENBA 3OYCA 2V1CC 1Q3LA 4XU2A 3H91A 3GO5A 4JOIC 3BS1A 3A74A 3G48A 1TWGB 2QEXA 4C8QF 1AWWA 1MV3A 4OB2B 4X9DA 1MMDA 3ZYYX 1GXIE 2N49A 3UPUA 3JCMc 3UDXA 1B3AA 1IL8A 3EA6A 3IAYA 1TSFA 5KE3A 3KFVA 4M7AG 3K81C 1WJSA 2F0IA 4IUUA 3G6ET 2DUDA 4C3HH 3UDCA 1FD7D 2DN8A 3I9QA 2K3XA 4LDWA 2LX7A 1EIGA 1PKTA 3HOYH 2OTJA 3GTOB 5FU6C 1MKHA 4A54A 1RTOA 3C1EA 1WCMG 2DXUA 4FYYB 5CV9A 3ND9A 4JI1L 1QKWA 1AT1B 2ZGWA 5GAMg 1N8RC 3F2CA 1ESRA 2CH4W 4EMGA 2VQEL 1V9PA 3ME9A 2KOLA 3N6RA 5GAN3 2PTKA 3HPWA 5CR2A 3M0TA 1VCIA 4N8X1 4R4TA 4UHVA 1K8AU 4XYOA 1UECA 4DOVA 2XMFA 4GLMA 4POGA 3PF5A 2E2JH 3M4GA 2B8AA 5CBAE 2A3LA 2F2VA 2LS01 3RZDH 2QA4Q 2E1HA 3BU2A 4OF1A 5CV6A 2EVBA 3T4AC 5IXBA 1QZGA 2LXJA 5C4XH 3CEYA 2E5LL 4A3CG 4FM4B 4K11A 1XMQQ 1CTMA 1T5XD 1SEMA 3S3NA 1KTKA 3L2RA 4KH1B 1Q1EA 2A69D 4P71A 5FLXc 3D4WA 5A2QE 4A4GA 4A3LH 3C1FA 2UU9L 5LJ5j 3LX7A 1AZQA 1OZ2A 5C3XA 2EJ9A 5I9OA 1KNAA 1H95A 2KXCA 3C94A 2E2DC 3HOXH 2LQKA 5CAIA 4JBKA 1FNUA 1UEBA 1UDLA 3X28B 4ZN1A 3EGXA 5M3FG 4X66Q 3CPFA 2NZOA 1ZQ1A 3A8HB 1YITQ 1X3FA 2RQRA 4JI7Q 3QWXX 3BDUA 1M27C 2D0NA 3DM1A 2RHZA 1QVFP 2K7VA 2Z4HA 2RJEA 3VS0A 1ENCA 3GNGA 2E8GA 4A3BB 2F5KA 3CPWA 4M7DD 4PJOD 4A76A 4DV2L 2WB1E 2TSSA 3VUZA 4QUFA 3KDFA 2V4DA 4IZ8A 3CD6T 5CV5A 2FZCB 4A4HA 4NXNL 4HCZA 2RBMA 2X9HA 2PW7A 2UXDL 3PMIA 4AG1C 4C0GA 2G9HD 2K03A 3CCSA 1XWEA 3UDFA 3NP8A 3Q24A 2L15A 5GJVB 3VKIA 1LT6D 5L8RE 4ZRZA 2RSNA 4K14A 4E7KA 3K8AA 1D0XA 2B29A 3E0EA 1K1ZA 1XPRA 4F7UF 2B63H 2EGEA 1YI2T 5T1IA 2QQ9A 4HCBA 4R4OA 1AZEA 2PNIA 4PQXA 3HFOA 2R93B 4LFAL 2DNEA 4PLLA 3REAB 2GCXA 3QWNA 4BBSB 1D0ZA 2DZ9A 3V7CA 1P8LA 1MHNA 4J9HA 3OYNA 3I4LA 2X4JA 3KF8A 3U9OA 5GROA 4M75G 5IGEA 1A63A 2EJMA 4KHZA 2KRNA 2PNHA 2F0VA 5IYBG 1ZSZA 5FO7B 4JBJA 4DFAA 1YJNA 4FW1A 4HKEA 3M57A 5KYLA 3TSZA 1M1FA 4FYVB 1X65A 2GVAA 3O13A 4J9BA 2ZTEA 2MOXA 3QO2A 4CJ2C 2A19A 1SLJA 1XNQL 4C3HB 3KLSX 1D1IA 2UUAL 3A8MB 3HHTB 4KT0E 1O7ZA 2XG8D 1ZBJA 2QGFB 3OWFA 3GIBA 5D3DA 3HOYB 2ZT9C 4DR4L 2OQ0A 1DJRD 1SRUA 3MXPA 2F0LA 4B3SQ 1TH7A 1ZBXA 2CP3A 2V8KA 2KVMA 3KK7A 1VQNA 4NL3A 4AYBE 3QBYA 2JJQA 4JI3Q 2QXFA 3K59A 4QW2A 4CC3A 1W70A 2EGAA 3FDRA 1JOKA 2BCOA 3QOJA 2XI9A 4LDXA 4DR5Q 1C4QA 2JTMA 1K0XA 1XJWB 1VQAA 1F77A 2C5CA 1LABA 2JP1A 4OHJA 8AT1B 3O5ZA 2B3GA 2E2JB 1QCNA 5HY6A 1YJWA 4EQNA 4ELYC 3RZDB 4YY3Q 2DAQA 1RAAB 1F9QA 2F1MA 3K58A 5C4XB 4BE0A 2OTJQ 2ES2A 1V8QA 5ELOA 4M78D 4M77E 1Q82R 3E0JA 2ZPGB 1AEXA 1SKUB 1QP2A 1OTCA 2WAQE 1EWCA 1X3QA 3UDIA 3OTOL 4XT3B 1HUMA 2NUZA 1QB5D 4M4ZA 3FPUB 4C92A 5CR3A 3HOXB 3A5UA 1PH4A 4KGXB 2AKLA 3PO2G 2HKQB 4DF7A 1SRMA 2A0FB 3OW7A 1IYVA 5CMDA 1OYXA 3CCUA 3H09A 1HNXQ 2HEQA 5A0LA 3CC4Q 1UWVA 2QASA 4XDXA 4DAYB 5C4HA 2P0PA 1Q86C 2DMOA 3D4RA 4X62Q 2VS1A 3MHBA 3FVQA 1K3RA 1EX4A 3V05A 3A8KE 2HHHQ 4JI2L 2B2WC 2QTVA 3ZFJA 5JAVA 5GAN2 1K8AC 2WB1B 2ATWA 1WTXA 5GAN5 2D8JA 1X32A 1WJRA 3OYMA 2IPKD 1BCPF 3RMQA 3NWTA 3DMUA 4ME7A 3U50C 2AKWB 2KJXA 3DEOA 3I91A 4CDEC 2LQ8A 3X26B 3T1YQ 1AWJA 2KYBA 4RTWA 3JCMX 4XTVA 2DETA 4O42A 1JC7A 2B63B 2YU9H 2FRWA 3Q1JA 2R58A 1FVIA 2DJFC 3A5ZB 2IG0A 3S1QH 4Y28E 4ZGJB 5C44B 1VQ5T 3T51B 4LF8Q 4B3RL 3DB3A 3L42A 1KDCA 3R2IA 4BS9A 4JYAQ 1SE8A 1I6VC 1R8OB 4LD6A 4KK7A 3SHLA 2CH4A 1QWEA 3KLRA 3W2DA 1CK1A 3MEFA 2EAYA 5GAN6 4M7AD 2FMMA 1R77A 2K3BA 2P0KA 1Y1VH 3I2ZA 1UE6A 2EJGC 2ZJPA 3KF6A 2JEAI 3MJXA 1N34Q 1LJOA 2ESWA 2K01A 2O4XB 2YTVA 2K2MA 3QIIA 1V1OA 1VQMQ 5LJ5d 1H9JA 3FKIH 2F3WA 4BBRG 1S40A 5IWAL 5JEAH 1I4XA 1ENFA 1DD2A 4IURA 1G6ZA 1HPCA 3L0OA 2AHJB 5GAMj 2RHUA 2KRSA 3CPWP 1WTQA 3J81i 1IBKQ 1WGSA 3PO3H 2BOSA 4HEDA 1RJTA 3VS7A 1IBMQ 4DNRB 2F4VL 2EQSA 1MGSA 5FRMA 1OXXK 3P8BB 4DOWA 3JC66 5A2QL 2F4IA 4OX9Q 4JUVA 1GKHA 4F14A 2VASA 1ET9A 1JJCB 3KOJA 4JI5Q 2LC4A 3J81E 4Y92A 4PJOE 4PJNA 1D3BB 2CREA 3BW1A 3QPHA 3CCJA 4R4IA 3RD4A 1K76A 4CRIA 4DA4A 1A3VA 4KY6A 1X43A 2UXBL 4LFCL 3VS3A 2VUMG 5IXFA 1HR0L 3MCAB 4LF4Q 3CCLA 4PLIA 1LLRD 1VIFA 3F2DA 4B9XA 1O75A 5CGKA 1KABA 2KY9A 4XTWA 1KD1R 5LJ5h 1M30A 1IW7D 1DOKA 1IBLL 2JTEA 2VB3X 2JN4A 2R61A 3K6OA 1DONA 1NJIC 1M8AA 4OVAA 5DAUA 4JI6L 4J7FA 1EOVA 2HIVA 1JB7A 4DV6Q 3I3CA 4DR6Q 5JJKA 2NLUA 4G4KA 5C3EH 4RMOA 3D7SB 5JPMC 1RLPC 2OT2A 2Y0SB 4DV1Q 2QW7A 2E6ZA 5KYXA 4VUBA 1SMXA 4JOIA 1K28A 5FKAC 2F1LA 3SXHA 1GJXA 2CZ7B 2RA2A 1B9NA 2E10A 4QVCA 4Y91A 2CQOA 4LFCQ 3JCMP 4JS4A 1UGRB 4A3KG 1TUCA 4YCWA 4V190 1E0BA 4LF7Q 2BE9B 2P4RA 1R4PB 1RABB 2LT4A 1E2WA 3K5MA 1F9SA 1Y8OB 4ZQ3A 4DAMA 4EPCA 1QNKA 1Q81R 4DR2L 1U1TA 3QXEB 1D5ZC 1JR0D 2MHVA 4EGVA 4IPHA 2NUPB 1Y1WG 3RNJA 2YU9B 4DV5Q 2NUCA 1CUKA 2E4HA 3NEMA 5HK0A 3HP3A 1E24A 3VS6A 1UE5A 4LW1A 3S1QB 1PH8A 2DD5A 2M16A 1K8GA 2K7AA 4RCBA 1TS3A 2A6ED 2NVYH 4PZ6A 3QDFA 2RQWA 5IHKA 4HT8A 1EOTA 4JBMA 2GGRA 2GA4B 4J9IA 5FK9C 4DR1L 1V1PA 1EY4A 4WF2A 4GNXC 4NDXA 3LYIA 1BI2A 3CBPA 1S72T 1QVGA 2UUBL 2IW3A 1JT8A 1RLQC 4JRKA 5IH2A 3G4SQ 2BA0A 4DUZQ 1BR9A 3VYTA 1RODA 2NN6H 2KA7A 3P8DA 2PCFB 3VS4A 4AFSC 1ET6A 8ATCB 4E7HA 1IKLA 3FKIB 5IYCG 3GPLA 1XNIA 4E7JA 1BBWA 3VR6A 3NFCA 1N32L 2RMOA 2AZSA 3OYHA 1TS2A 3QB3A 3CCMA 2R7FA 4BY1H 3HTRA 5KYUA 2SDFA 2M51A 1U4MA 1VQ8Q 3EBEA 4WJ4A 3TQYA 2HDAA 4PL6A 4E7IA 1BBXC 2FINB 1UGVA 5D6XA 1S5DD 4A3JG 2VVKA 2CSQA 3N5BB 1TS9A 1X2QA 5GMKl 4UP9A 1M2VB 4M7DB 4PJOB 1H9RA 2EYFA 4J6XA 1D2BA 1VQ9T 1LTID 3I7FA 5D65A 4HIKA 4OIJA 2KHIA 2EDGA 4KRTA 1EZ8A 4F88A 2ZM6L 1PHTA 1GBQA 4FT2A 2R57A 3PUWA 4QKUA 3G71A 5AFWA 4X9CA 4JLIA 3DHQA 1WI5A 2K5QA 4TRDA 4AT1B 5LJ3j 3VA5A 3SEBA 3M9QA 3CF5A 2OTLA 1M1GA 1DZ1A 2WV6D 1I3QH 5C3EB 1KJWA 4MN3A 2X35A 1QUQB 5EBDA 2NVQH 4IQZA 4B3TQ 3A8IE 4YCUA 4P75A 2DTOA 1HH2P 3EFSA 1M90U 2Z6KA 4HVWA 1I5OB 2YHTA 1WTVA 2OX7A 4A63B 4IUVA 1LT5D 1SROA 3CMAT 2B86A 3HOUG 2JA8G 1AW7A 2F0UA 3TS2A 4JI8L 3JAML 4DEYA 4QVDA 3CCET 1EQQA 1WCMH 4J6HA 2B8FA 2IX0A 4IO9A 3ULPA 3TEEA 3F8TA 3Q0AA 1AH9A 5GAMd 2A7YA 1AWOA 1E1OA 1NUCA 4C56C 2UXDQ 3EG9A 2EXDA 4I7AA 4FVMA 2E76C 3RZOH 4RTUA 4PV1C 2XD0A 4PMWA 2ZPEB 2RDFA 3GTKB 1TU2B 2NYSA 3I56T 4R9WA 2RF0A 1ACMB 2DXCA 2KENA 1F2YA 4K8JA 3TQ7P 5KNDA 2UUCL 2MWOA 4J9DA 1AHJB 5J26A 1BQQT 2NVYB 5CYUA 1NPPA 5D7UA 1QCBD 1ABOA 5CKEA 5GANd 1UJYA 4DAYA 3CC2T 1VQNT 4LFAQ 4A3CH 1D6EC 1JWUD 5E3FA 3VU3C 2X3XD 3SHWA 2MIOA 4HN7A 3CCRQ 3W1BA 1W6KA 4NKLA 2ZPHB 3HKZG 1M3BA 4X3SA 1RAHB 1SSOA 3J81L 4KGZB 1PZID 1YJWT 1FNVA 3GV3A 2G3RA 2CUBA 2KT1A 3ONAB 5CBEE 5M3FH 3WWVA 3HOWH 2H8HA 4M78B 2JK8A 4O2DA 1B44D 2YDLA 4EMKB 1X6BA 2R5MA 2COYA 4C92E 2DIGA 3FRNA 2KE9A 1YJ9T 1PLFA 3D4DA 3ERSX 3X3MA 2K79A 3EFOB 2IL8A 5IP7G 4GZYC 1FX7A 3A8GB 4A4FA 2KQ3A 2HQHA 2K5FA 4MZTA 3TSWA 1VQOT 4CDDC 4BY1B 1T3LA 1YWOA 4DU9A 2EYZA 5FRNA 2DNCA 1EZZB 2BZYA 5GANh 3UE0A 3CC7T 1B70B 4DV7Q 1YHQQ 2WFWA 1BCPC 2JM8A 2D9UA 3BDCA 1NMGA 3G7LA 4TQUS 4DV3Q 1TUDA 4C8QG 1CKNB 3CCUT 1I5FA 3A7LA 3CU7A 2RQUA 1TWCB 5C6AA 3QG1A 1F9RA 1QJOA 3HS0C 1LO5D 3KDFB 2RSOA 4DR3L 3X20B 2OEOA 3BJUA 1YNJC 2YYZA 3FP9A 2G5DA 3OA6A 3I55T 1EFWA 5GMKi 1B8AA 4OGQC 2HZYA 3VYRA 2I0QA 2QGGA 4X3KA 3CRKC 1SFOH 3ER0A 3CCMQ 2K32A 3T53B 3FLGA 1YNNC 2CP6A 1H8KA 2DA9A 1TIID 2BE7D 2JMAA 2W10A 1XPOA 3WDNA 3JB9I 1WI7A 1ZEQX 1SRLA 2FG0A 4L63B 4DBHA 1UEAB 3M5AA 4BY6C 2BDNA 4IPCA 5IYBH 1QVGP 1I3QB 3FEWX 4Y7NH 4FXGC 4Z8AA 4KTAA 4RG8A 3J81c 2JUFA 3NPFA 3ND8A 4QQDA 1TUGB 1HQRD 5BN5A 5FLMG 4H13C 3OTOQ 2RQXA 1QQJA 4OB1B 2I46A 3KF8B 1FL0A 4X65L 1MV0B 3VR4A 2LQNA 2DVEA 1D3BA 4A3MG 2JTFA 1DYQA 3OW2A 3WVDB 2EJGA 4M7AB 2A5HA 1JQQA 2L12A 2HKNA 4XU0A 5EC7A 4XTUA 4P74A 1OXVA 2NZHA 2XTIA 3TCJA 3OWEB 3VUBA 5EKKA 2OTLQ 1ASYA 1B1ZA 1WCMB 1Y57A 4JI2Q 4PFZA 4ALPA 5AYFA 4A93G 4UY8C 1V29B 1XPUA 2YUQA 3AYHB 2K5WA 2XDPA 3K0XA 3RZOB 1V76A 1PRTC 1KK7A 2J7ZA 4G7OC 3VS5A 1QE6A 1F1BB 4J7IA 1S4ZA 2BH8A 2E74C 1BNZA 3RUZA 2DIQA 2L3SA 4LE9A 3Q22A 4EX5A 3H6MA 1EL0A 1SAPA 4OMOA 4R56A 2FRYA 4DV0Q 4X6AH 4B3RQ 3RKWA 1G2TA 4O0AA 1YVCA 4E2FB 5KCHA 4WTOB 2MO1A 1QLYA 2QEJC 2G6FX 5LMNL 3DKMA 2I5HA 3PTAA 3M4QA 1Y69U 1KSWA 4OO1H 3SWNC 4H44C 1O7LA 4D6WA 4OEMB 1NE8A 1K0SA 1GCQC 2DFUA 3NMZC 2PVDB 1X3EA 2Z9HA 5M3MG 5M3FB 3PO2H 2QA4A 1GXDC 1X2KA 3GLXA 1SN8A 4IUQA 2VC8A 4ATOA 1LTSD 1V1QA 2D62A 1YCSB 1HD3A 2J6KA 3CCVT 1STAA 1GM5A 1WOCA 2B2UA 4A4IA 1VQ7Q 5CQXA 4HJ7A 3AMUA 2M2LA 1Q86R 4M75C 2YV5A 4J9EA 4OWXB 2O88A 1GRIA 3OBWA 1IGUA 4JJCA 1ZUYA 2EQJA 1ML0D 4C5HA 2DRMA 2K9GA 3KUFA 1NBEB 1RHPA 2AQ3B 1GD7A 1STNA 2M0OA 3GDEA 1YITA 1QCOA 5IHIA 5KYNA 2I5MX 4C2MH 2JS2A 2PZUA 3BYTB 4KBMB 3EFXD 4XQ3A 4GOPC 3C3LA 1NE3A 2UXBQ 2KGTA 2VXEA 5CQYA 1W2BS 1F2ZA 1GUGA 2B2YA 2GTOA 3CD6Q 1FWZA 5IGDA 4RA8A 2JA5G 1BB9A 2QDLA 2WSEE 1NMFA 3JB9F 1VF7A 4NXML 1ILQA 4M75B 1H92A 2V1QA 1SSHA 2ZJRA 4P73A 4Y7NB 3U4ZA 4DK0A 5H1SE 1YI2Q 2EYPA 2A73B 2PNRC 1S3OA 3V7SA 2ROTA 2ZCFB 4C3IG 4OGEA 4K6LA 1JCKB 3M7GA 4OXPA 1X6GA 1XNRQ 1PRMC 3H0FA 2JOYA 1M2VA 3M0SA 3NTKA 3SD4A 4BE1A 4M7DA 1GFDA 4F16A 4O5VA 2O2LD 3RR5A 4BBRH 4GOPB 1PH6A 3KF6B 3ZBDA 4GKJL 3VS1A 1KLGD 1UTIA 3K7UC 3RMHA 3ULLA 2PO4A 3LNNA 4L5QA 4UP8A 4QCLA 3J80L 1QILA 4J1MA 3NXWA 2E5QA 1O80A 1MD2D 4DNIA 1L1OB 2F0OA 1X75C 3RNUA 5IOCA 1Q8IA 3MAQA 4N8FA 4K0KL 1EY0A 3EG3A 1X69A 3JCMe 1WTOA 4DR2Q 5EPJA 3MVVA 1M8VA 3G6JB 1NBWA 2F0TA 2VUMH 4IOCA 4M77F 1QUQA 4BDZA 5FLXL 2XWBB 2COWA 2EYOA 2XRQD 3K7AH 2LJ0A 4PKCC 2N88A 3UA6A 1O78A 1K8MA 1EIFA 5D6WA 1IYJB 1I4QA 1MI2A 4FNFA 2LNVA 1W2BA 1KAWA 4QB4A 1KC8R 3HZXA 1LVKA 3HRUA 3RLOA 4DR1Q 3CCQT 4CHTB 3WOFA 3CPWS 2HDLA 2RDGA 2GVBA 4M8AA 3K80C 5E7NA 3T56B 1AWXA 3LH5A 4FL6A 1U4PA 3OYDA 1NJIR 1HRJA 2DXTA 1S5CD 2UUBQ 5CKDA 1ZKOA 3W3AA 2ZXPA 1XMOL 3PO2B 1ENAA 1JWSD 2DY8A 3G71T 3AT1B 1N9SA 4P5NA 5HGQA 1D1BA 3M85A 2QF7A 4AQYL 2RJDA 1ONLA 2FJ2A 4LAAA 1H641 4HCEA 1LT3D 1IHZA 1ESFA 1SE3A 3A54A 3C46A 3H3VI 1I0CA 5IGCA 2M9UA 2H3JA 5ISRA 5KYXB 2D8HA 3HRSA 2OQKA 2KDSA 4OB3B 3SB2A 4QQGA 3AQQA 3MHXA 2DBMA 4GLAC 2AZVA 1LT4D 4YWKA 2QQBA 4DN4M 1M1KU 2AMCB 2Q2IA 3EHRA 1F2MA 4KY5A 3A8JE 2WINB 4C0DC 1STYA 3CC4A 4RG2A 5GAN4 4C2MB 5GANg 1Y1WH 4Q5WA 3JCMf 1IHVA 3EG0A 5TSSA 3SR1A 1S5BD 4D8DA 2K5LA 2R7ZG 1OU9A 3GBQA 1VYTA 2HQXA 2LCCA 1C0MA 5FU6B 1SYCA 5G3LD 3RN2A 1SHGA 4M78A 3MZ5A 2ZM6Q 1RI0A 4EMKA 3EGUA 2JNGA 4WRDA 4LUEA 3OYJA 1G5VA 2CP5A 2DTIA 3EFOA 3S14H 2XNAC 2NWMA 4RGOS 1EY5A 3M59A 4HVUA 1G91A 1PH2A 4WJ3M 2TMPA 2RI3A 4HJAA 2LVMA 2MI6A 1Q7YR 3BDOA 4CDCC 2CKKA 3TN2A 1V1PB 4BI8B 4RHSA 5GAOq 3EVQA 3EQLC 1VQ5Q 1CKNA 2KHJA 4JI0L 1R4QB 4R4QA 1DCZA 1B7TA 2KEAA 2DTHA 4XT1B 5I22A 2L8DA 4JCVE 4CI0C 4BBRB 5IYCH 1TT2A 4K8IA 1E7OA 2FXQA 3SFMA 4PK4A 4PJOF 1YNXA 1L0XB 1EZ6A 1WYDA 2BKDN 2NBFA 2XWJB 4KLKA 3BG3A 1FXXA 1SF9A 3M4YA 1IZ6A 2EJFC 4JI8Q 3I4NG 2DYBA 4RFBA 3TRZA 2XU8A 1N32Q 2KEEA 3EJIA 4Q0FA 4MHEA 2LKVA 5COYA 1SYBA 4HCCA 2RHSB 4A3JH 5KYUB 1VQMA 5C44H 1EWHA 2XSCA 4BE2A 2VUMB 4KUDK 1VIEA 2NVXH 3QWYA 3RUXA 1Y71A 3QJ6A 3ZL7C 4ZLTF 1CHPD 2E75C 2JXMB 2WIIB 3Q6SA 2ENMA 5FO9B 2VQFL 2WKCA 1XYIA 3K7AB 3D6WA 1BU1A 1K9MR 4ULLA 4EVOA 5C0XI 3Q23A 4GLKA 3M0UA 5LMUL 4M7AA 3E9GA 3OPOA 4OMLA 3FC3A 3PUVA 4DXFA 2JA9A 3S9WA 2AUJD 4IJHA 2C9OA 1X55A 3E9IA 3X3NA 1U0LA 1YEZA 4P2CB 3C4SA 1A15A 4J9CA 2X69A 4HXJA 4LF5Q 2JM9A 1IGQA 1A2UA 2EZVA 4I7ZC 3I4MG 4OONA 3RDVA 5A35A 2A37A 5C3WA 1FMWA 1G3SA 3PF4A 3MFGA 5AT1B 1IYUA 4EDUA 1Q46A 1VQ6T 4F17A 5A0GA 3E9HA 4F87A 4RUGA 1VQIA 3HOUH 3TVTA 1PFNA 2JA8H 2UXCL 2AT1B 4A3KB 1M8MA 2Z0SA 4LMQD 5C4ZA 4ANJA 1X56A 1PSFA 2FPFA 4O1NA 3J7ZC 3OS1A 4DK3C 4C0FA 3HOUB 1GCPA 2ZAEA 4JRPA 3IQLA 2M0YA 1WNLA 1DOLA 1EYAA 2ZPBB 1JQYD 3VA7A 1Y1WB 4HCSA 4GKKL 2LCLA 1GUTA 2RQVA 4N4HA 2KCTA 1JRIA 1YNZA 3DXJC 5KRUA 4DR3Q 4UPAA 4IUNA 4MDWA 3EG9B 2IX3A 1TWFB 2PZWA 3MP8A 1T0HA 2DPPB 1VF5C 2OI3A 3J7AF 1W2BP 1AZGB 1U5SA 2Y0SE 3I8ZA 3GD7A 4CC2A 3AU7A 3S14B 2EE1A 2JQOA 3CMET 3HKZE 5FROA 1BI1A 1TY0A 2EPDA 3M56A 3ZEHA 1H9SB 2F0DA 2K5VA 1UB4A 2MAMA 2DY7A 1ICFB 5JJLA 1KXLA 3V7RA 1K9AA 4ZTFA 4CJ0B 1I5LA 3CKIB 3SWNA 2KCMA 2WACA 1RD9D 2F52A 2B39A 3EN2A 1W4SA 4JBWA 1UG1A 4E6IA 1PH3A 4Z89A 2RO0A 4X65Q 4JV5Q 4IFDI 5BN3A 5T1GA 1WXUA 5IP7H 1RF2D 2LSSA 2K3YA 2CDTA 1N6AA 1B2TA 1S72Q 1D7QA 2VGNA 1UE9A 1PNJA 1CZGA 1J3TA 4OB0B 3G4SA 1SDFA 4MZPA 2ICIA 4NW2A 3BZCA 2QQSA 2JA6H 3HOZH 4A3JB 2VGMA 4M75A 1BCPD 1QNUA 3I72A 3PV0A 2QYZA 2DBKA 2NVXB 1ZHIA 1J5EQ 5M5WB 2DYIA 2C0TA 3VR2A 1SPKA 1EEID 2EY2A 1N36L 2C0OA 1YNJD 1O7IA 2QTXA 1VQ8A 3M4PA 4OWTB 1H9MA 3M53A 1M3AA 4B3ML 4GOPA 1VQKT 2LY7A 1TWBA 2XGTA 1YNND 2MYSA 4HIDA 2RH2A 5CORA 1VYVA 2MQHA 2O9VA 1TWAH 1KDBA 2KAFA 2JEBI 2J05A 3VJPA 1VQ9Q 4FSSA 3S15H 3JCMb 1ZUUA 1NSNS 5KEEA 2X51A 5FLMH 2C35B 2N78A 1L1OA 1L2FA 3BE3A 4BI4A 2H5XA 2RI5A 1WHGA 2DJQA 5IE8A 4DR7Q 2SEMA 1EQTA 4A3MH 1EYCA 4YHHQ 2D0QB 2IHEA 2E41A 1NY4A 2HNIA 2O2OA 1DM0B 3STBC 5FJ8G 5ELFA 5CVIA 2RKSA 4MNOA 2MPXC 3A55A 2CS7A 4LF6L 4HMIA 2JA8B 5KE2A 4MMLA 1GUNA 3EROA 5CKFA 4M7DE 5KYIA 4RCCA 3PE0A 1LTAD 3A1PA 2XICA 3LWHA 4LFBL 5GANj 4Z9CB 3VS2A 2MUYA 1BCOA 1Z47A 2F69A 1B53A 2PI2A 4ZYSA 3K57A 4A93H 1I1JA 3H94A 1PMRA 1VQGA 2VW9A 2L2PA 1PH9A 3M58A 4AH6A 1Z9QA 4FYWB 1PTOF 4OO1I 2J7IA 1QVGS 3MWYW 4YCVA 4M77C 3CMAQ 3TDQA 1PRTD 1XTCD 1GBRA 2XIWA 3NTIA 3NK9A 4QIWB 2VXFA 2EYWA 2H4OA 4KI0A 3CCEQ 2RCNA 2AK5A 2RD1A 3HP9A 5K5PA 3RN5A 1HJPA 1SBBB 4AFQC 2AWOA 1OOTA 2F0QA 2CFMA 1I94L 2HCKA 1MMGA 4WFN3 3DWQA 4C8QC 4GN4B 3HKZB 2N3SA 1A8VA 3CW2C 4R8NA 3BVGA 4C92F 2C06A 1S5ED 4PZ7A 1TVXA 3QO3A 3E6ZX 3I56Q 3NUCA 5LJ5f 2PVGB 2VYTA 1UHFA 2CWPA 3L2ZA 3OY9A 3PT9A 1Q82U 4BDYA 5C4JH 4KHPQ 1WFWA 5M3MH 3KFUA 1BBUA 1NR4A 2QKIC 3NWSA 4HIOA 4DV4L 3CC2Q 3A8OB 3U4VA 3E5SA 3S1RH 2V8IA 3GTQH 2QEXT 2AQ1B 2VB2X 3CCRA 1I4K1 2MMPA 4IIMA 1AE2A 1EFID 1QZHA 1AEYA 2ZPFB 2CZ1B 3VR3A 3GTJB 4MTKA 1HNWL 5ECAA 3OYGA 2L4NA 3LW5E 4YTLA 1SHFA 1WXTA 1JB3A 2JA6B 2VV5A 4M75D 4C8QB 4FYDA 2KI7A 3OQ5A 3IFDA 3OIPA 3HOZB 1UGQB 1LTGD 2OTJT 3AFQA 1EYGA 3S6WA 2E65A 1SG5A 3HG9A 3ZJYC 1NZ9A 3PIOA 4K0KQ 2HL5C 3CRLC 2EPBA 4QGUA 1HFGA 3MO8A 4FXDA 5IHNA 1K73R 2JN0A 1VQOQ 4OP0A 2D2CC 4J5YA 3TEHB 3CXCA 2F03A 1RAIB 2O01E 2EYLA 4OMMA 1X3PA 4FDBA 3A8LB 4OL7A 1WHJA 2EKHA 1EY7A 2HCIA 3CC7Q 2YTYA 1JXMA 3GP8A 4N9TA 4JI4Q 2SNMA 1VQFA 1WDXA 1YHQA 3S1NH 2JA5H 4LD9K 4AFUC 1ZA1B 3TBIB 2A28A 2A68C 2KT8A 4K6DA 2BIVA 3CC4T 2YLBA 4M78E 1TWAB 4QF4A 4X64L 3RMSA 1VQPQ 1UAPA 5AJ3L 4JRQA 3S15B 3I55Q 2K05A 2HUGA 2HSEB 5GAOm 5EGTA 1FGBD 2DERA 3HOVG 3INZA 1E6GA 3BVZA 2DNUA 4KKUA 3M7NA 4A3MB 2F0PA 5I9PA 1G3TA 2XKOC 4AQYQ 1UGPB 3WVEB 3CP0A 4GNXB 1SNPA 1YHAA 1ZSGA 5L23A 4JI1Q 1T0JA 1SXTA 4B08A 4J6WA 1TWCH 2O5JC 2AKKA 2LMJA 5ELEA 2Q8TA 3U23A 2VQEQ 2LJ3A 1PH7A 1LM0A 2L55A 3D3RA 2DVJA 5IT9E 2DILA 4A93B 3NTHA 2F0NA 1MMNA 1OI1A 2X4XA 3H41A 5GAN7 3R8BA 3WOEA 2Z8LA 5I2MA 2YRVA 1PZJD 5LHY1 4GN5A 2EJFA 2D6FA 2JT4A 1QW1A 2CT4A 3FMCA 1YIJA 3PSIA 1AZPA 3H0GG 3CCST 1H3HA 5M9OA 2Q8RE 4U673 5IY0A 3IL8A 1VQ4Q 4L5GA 4KKSA 1X27A 1JXOA 4C5EA 3EIVA 2WP8J 2E70A 3J7YW 2UU9Q 4IIOA 3I5RA 2RCFA 1G8XA 4L5SA 4RTYA 1XMQL 1OEBA 2A08A 2DZCA 1KD1U 5GAOl 4M7AE 5IP9G 4AIMA 4JRIA 2L0AA 1Y8NB 2FEIA 5C4JB 3UF4A 3M0PA 5M3MB 4C3JG 3GTJH 2LNHB 1CZWA 2Y4XA 3H6ZA 2LCSA 5ELCA 4KY7A 4JI0Q 3R3OA 1YJNT 1C48A 1STBA 1T3SA 2ID0A 2DRKA 4RTXA 5IYDG 4DV2Q 3S1RB 2E2HH 4JI7L 3GTQB 1XTDA 1KHCA 4HA8A 3JB9G 3FEOA 2PZTA 4EQ5A 4KJOA 5KNCA 1WTPA 2BH2A 3H3VC 1IKMA 4NXNQ 4DR7L 2D5DA 4XU3A 2YUNA 3S24A 3C95A 4BB7A 2PQAB 1TS5A 2A74C 4B9WA 1STHA 5KCOA 1N8RR 3CBOA 1RAEB 3L1AA 2KBTA 4E7LA 1JO8A 4XIGS 1KHIA 2DKGA 1II3A 3RLNA 3SVMA 3L2PA 3B6YA 1H9SA 1VQLQ 1HZCA 3RIRA 1MSHA 1BUVT 1WQ7A 4II1A 3JCMV 4AYBG 3J80c 3CQTA 1LTBD 2EYQA 1MBYA 2DX1A 2QDBA 1M3CA 1VQ7A 4HSPA 2R7ZH 1M4ZA 1Q81U 3L3OC 1FJGL 1PFSA 2MNAA 3S1NB 2JA5B 2E6NA 3EGDB 3RKYA 1Q82C 4BY7G 3OW2S 4P72A 1IRXA 3E9FA 4KN4C 3TP7A 4XAXB 4BUGA 3VYGA 2B2VC 1YHBA 4M77G 1UNSA 4TVRA 1XNQQ 4XXEA 4PJJA 2WAQG 4C3IB 1A3TA 1WHLA 3CD6A 4A3FG 4D8KA 4IPDA 4X3UA 3BYYB 1G6PA 3CQZH 5C0MA 1LCKA 5HGTA 2XDDA 4DR4Q 1TTHB 3PNWC 1T5EA 1LPLA 4ZUIA 1CKMA 5GAMf 4GY5A 2B2WA 4NS5A 2F0FA 1JORA 2E3HA 2MO0A 2A6HC 1VA7A 2L3PA 5FU7C 1YI2A 3I4NH 4DNTB 4B3SL 1IL2A 5CCAA 4GBQA 1PCXA 3GP7A 3E19A 4ME3A 4R4CA 3TZUA 1QWFA 3X25B 1DGSA 3GTGH 1YZ6A 4R1JA 4X34A 4JI3L 4LUOA 5FOBB 3IRBA 3LWEA 1V43A 4DR5L 1WA7A 3M4OH 4WCIA 3MPUB 2I2LA 2D0PA 1IXRA 4S3SA 3CXCP 4CC4B 3CHBD 4M75E 3GTPH 2X4YA 4UP7A 2L9HA 5I6YA 3I90A 3V8KA 3I5SA 1CKOA 1N5ZA 2DO3A 4YY3L 1AP0A 1BK2A 4UDUC 1BCPB 4LWCA 1U4LA 1N9WA 3NE5B 3NHNA 4F8MA 1UJ0A 3F70A 3OBYA 1A0NB 2BDOA 3PUZA 4J15A 1ZSZC 4IALA 5DY9A 2ED1A 3P7JA 1Y7XA 1RL2A 4A3GG 1GOZA 2M00A 2KRMA 2CT3A 3JB9J 3M0QA 4IUTA 1YIJQ 4NMZA 4V0BA 1JICA 1Y1VG 2ICEC 5DEHA 3GTLH 4G57A 2DL8A 1MJCA 3QSUA 2PQEA 1PH1A 3P1HA 1ZX6A 2IT1A 1B07A 3HGBA 2Y90A 2CWAA 1HUNA 2E2HB 2RB6A 1IREB 1JJ2S 2I07B 4ODGA 1VQDA 5CIUA 4TKOB 3FPPA 1ZXTA 4BY6B 3CCQQ 1F9PA 1VQBA 5I2YA 1KLUD 2KYMA 2IWHA 2PPBC 4EMHA 1RIPA 2HHHL 1HNZL 3PO3G 3I70A 5I11A 1OV3A 1R0BG 1D09B 3GOXA 2DE0X 2YLCA 1WYXA 4XTYA 3G6EQ 1LOJA 1A0IA 1SYDA 1Z9FA 1B50A 2HD3A 1C7YA 1E7ZA 1LACA 1WJQA 2JJ9A 1SNMA 4L5TA 4J9FA 1CA6A 4KD4A 1ILPA 1PTOC 3T1YL 1I50H 2B2TC 3T16A 2PI2E 4JPBW 1MNDA 1EQVA 4HCKA 1A62A 4KN7C 2JZ2A 1ICWA 1K8OA 1U4RA 1ASZA 2R7ZB 1HXYD 3U9SA 3CCJT 1FR3A 3A98A 1STGA 1ABQA 1M90C 1UHCA 3QOLA 3K5LA 4BXXG 1BBZA 4LF8L 2M9VA 1G2BA 1NYFA 5LJ3e 4XU1A 1I4HA 4F7UG 3H9NA 1AE3A 3D8GA 1C8CA 3CCLT 2RJFA 1TR5A 4B3MQ 2MCNA 2XN9C 4JS5A 2PUKB 2LQWA 1A3UA 1PRTB 3C0CA 4QL5A 5IT9L 4C92C 1YWPA 5CKHA 1KAAA 5KIXA 2W0ZA 1Y14B 4XQJA 4Q5VA 2P4TA 1OO9B 1RTNA 2HCCA 2RHIA 3MFYA 2E2IH 4O6JA 5EKLA 1CQVA 3OB9A 4LNPA 4C8QA 2CQAA 5IWAQ 4X1VA 4H7BA 2LJ1A 4ZCKA 1N34L 3M3YH 3CQZB 3HSBA 4KJNA 2E5KA 3C2PA 4FXKC 5D3IB 4C1NK 2O5IC 1KRTA 2MP1A 4ZK9B 1FMVA 2F4VQ 3SWNB 2ZXOA 2H3EB 3JSCA 3LGLA 4ZN3A 1IBKL 5I2SA 4DK6C 1K8AR 3PCOB 1QVFA 1ZLMA 1I4GA 3MKDA 1IBML 3BFMA 1JJ2A 1H3ZA 3T13A 1CA5A 3I4NB 2EKOA 3EG1A 1PYSB 5JPNC 3TP6A 3OYIA 1WHHA 1EU4A 1NAPA 1PD0A 1VQ5A 1AN8A 1SYEA 3NGPA 2XHCA 1BIBA 4DEXA 2K28A 5ELDA 2J4XA 4JI5L 1IO6A 3GTGB 1HR0Q 1GO3E 2ZZDA 3DUZA 2DL7A 3NQTA 3M4OB 3G1JA 1BF4A 3GTPB 1LTTD 2ZTDA 2KUMA 1IBLQ 1J6QA 5IN1A 2H1EA 2J0TD 1U8RA 3D31A 1JJGA 4JI6Q 1HHVA 1MNEA 4MDXA 2HDMA 1QG7A 1HXDA 1NEGA 4GS3A 2IVWA 1I8FA 4GNXA 5IODA 5LJ3f 2LFNA 4E6RA 4QJFA 2GFUA 1I94Q 1N9RA 5IT9c 3E2UA 3JB9D 4DV6L 4NOYA 4ME5A 1MHWC 4IOAA 2D9TA 3JCMW 3I4MB 3GTLB 5NUCA 2BZ8A 3L7ZC 2EVRA 1WTHA 3BZDB 1X01A 2XIDA 1OU8A 2GQVA 4PNOA 1QOHA 2BZXA 2QDYB 4N0AC 3KYHC 3FJ5A 1W3SA 4DV1L 3NPPA 1WLPB 4DBQA 2M02A 5ELNA 4L8JA 4ABNA 2KCCA 3OYEA 2WSFE 1MIUA 2F0KA 3T1HL 5FJ8H 2IIMA 2JW4A 5I4DA 5BR8L 4MMKA 3BY7A 4R55A 2VWFA 4LUZA 1I07A 2NZ1D 3AFPA 4HTHA 1JMCA 1UGSB 4LF7L 3QYHB 2BE5C 2Q2TA 3META 1HNWQ 3CCMT 3W1GA 3KBGA 3OSOA 5FWBA 3DLLA 2PUOB 1PZKD 2CW0C 1KDAA 2FVUA 1I50B 2F0MA 3MXUA 4F7UA 1VQ6Q 4RWSC 5HCKA 1KRSA 2HQLA 2VUBA 5K36G 1C0AA 3GF5A 1BDOA 2F0GA 3EHQA 4LDYA 4M77D 1X3GA 3VYHB 1R0CB 2QCPX 3A0JA 3DM3A 3NSWA 2EYXA 5GAOn 3S16B 1YP5A 1I6HH 4KH0B 1KQ2A 3OS5A 4DAPA 1WVLA 2HD0A 1HQMC 3JCMd 3PMFA 3UA7A 2CKZB 1FNWA 4E7ZA 3OW2P 2PQAA 3SK6A 4RCNA 4C8QD 5CKBA 5DM73 5AJ3Q 1Z9ZA 2JA7G 4GLXA 2E2IB 2RHQB 3ULJA 2OTLT 2GQIA 2KCNA 2O9SA 4C1NI 4DXGA 4DUZL 4Z88A 1HZBA 4BA2I 2JSOA 4N9PA 4DK1A 3M3YB 5C0XG 5JVG3 4LJZC 4RTVA 3U58A 4A3KH 3S2DB 1EQRA 2IX1A 3S3MA 1SNDA 2PVOB 1PG5B 3CMEQ 4XTZA 3PGZA 1IXDA 2DL5A 4K2KA 1SE2A 2GBQA 3DB4A 4TSSA 1LNXA 1OX8A 1HZ9A 3OYAA 2F0JA 3H0HA 4KD3A 4HR7B 3S2HH 3EGDA 2EY6A 4C0ZA 4QQBX 2AQ2B 2SEBD 2RK2A 3JCMh 3PGGA 1Q86U 1SYGA 5EKIA 3ICEA 5J39A 3QUIA 1TWFH 4XQQA 2NWGA 4HJ8A 4A4KA 5E1FA 4FO2A 3ULRB 5EPLA 1Z7TA 2NN6I 2YTXA 4L5RC 3I4OA 2SNSA 1S72A 3R93A 3H0IA 2KROA 5CK9A 1PFMA 1Y8PB 3NENA 5GMKe 2RK1A 4IPGA 2HL3A 4LF9L 4DBFA 2VNUD 3DLMA 3QDRB 3MXNB 2EFIA 3MEAA 2Z0WA 4C0DB 3TSSA 3URGA 5J3BA 1TU0B 3LGJA 2K5IA 2A68D 4L6TB 3LLRA 1G2SA 2Q2UA 2HAXA 2RA4A 5HK3A 1VQ7T 5ELBA 3KLSA 5J22A 3EFRA 2R5AA 3HOVH 4M7DF 4B3TL 2HBPA 2B2VA 4A3IG 1VQKQ 1HCZA 2FZGB 2YXYA 4ZTJA 3PUYA 3HOWG 1GHKA 1X6OA 4RKLA 1R9TH 2D1XA 4OGCA 4KV6A 3C12A 4FT4A 4XTXA 2KQWA 4IJLA 4C92G 5I2XA 4DPGA 1BO0A 1JJ2P 3FIFA 2YRCA 1XX8A 4PFOA 1VQ9A 1MSGA 4BI3A 4QQ6A 1WTRA 3QYGB 4U68A 1DOMA 5M5WH 4FF2A 1RI9A 1IB8A 3D6CA 5F2DA 4IFDG 3RR6A 5GAN8 2UUCQ 1EIHA 1TG0A 5D6YA 2EYHA 2Q2HA 2LTOA 3M9BA 1CI3M 1OXTA 5FWCA 2ASBA 1AFPA 3H0GH 4XYQA 5M5XH 4B6MA 4PNYA 4LDVA 1D5XC 3L2UA 1HTLD 4PFPA 2L1BA 4XTCS 5FO8B 3HEJA 4OELB 1FJGQ 1I6HB 4C5GA 1SR3A 3NBHA 1Y96A 2CP7A 3OS2A 4IKFA 1RDPD 4N4GA 1N33L 5GMKh 5C0XJ 2CVRA 3LWIA 2DD4A 5IP9H 2MJ8A 2ROLA 3CMAA 1PSEA 1KC8U 3BDLA 1MUZA 1S1NA 1EWIA 2Z6KC 3PIP3 4FF3A 2GTJA 3CCEA 5I21A 4C3JH 2E12A 2FZKB 1FMKA 2VKNA 3KXTA 3E1SA 3O8VA 5IYDH 1NJIU 4A3DG 2Y4YA 1O7YA 3JB9H 5KYWB 2R92G 1NM7A 4LNQA 2HSPA 3SEMA 2E5LQ 1V1CA 2PQWA 2FMCA 3S2HB 3I56A 1CFMA 2IPOB 2F3IA 1WZOA 3JCMJ 1WD1A 5IGFA 4IN3A 5CV8A 4DV7L 4DV3L 4QIWE 3EH2A 3VRYA 3QIAA 1BI3A 1B9MA 2EY5A 2RI2A 4M1UB 3W5OA 1N27A 2DLPA 4CBVA 1YBYA 1E6HA 3CC2A 2Q8IB 3JRZA 1E1TA 3SK8A 2QEXQ 3P75A 1K3BC 3UI2A 2KMTA 3SK4A 4BD3A 1Q12A 4M78F 2V8JA 4KGVB 3QKJA 4RAUC 1SMYC 2GN5A 3VR5A 5C6SA 2B2TA 3G7ZA 4BY7H 3MEVA 3QZ9B 3GNFB 4ZGDB 2QI2A 3D0FA 1YJ9A 3SE0A 5L37A 4JVZA 5CV7A 4CDFC 2JYOA 4OO1G 1K4US 1D1CA 4A53A 2CHBD 1GCQA 2FL7A 3R2TA 1VQOA 1AOJA 1M1KC 2LT1A 1YN8A 3HOVB 5IGGA 1PWTA 2EQUA 2FYKA 1LYLA 3H8ZA 4A3FH 5LJ3g 3CC7A 2K57A 4RKUE 1Q7YU 4ZKCB 1AVZC 1BIAA 4YWMA 1R9TB 4C8QE 1ZA2B 2QA4T 1E2VA 1JOQA 1SNOA
chains in the Genus database with same CATH topology
4QVZA 1VQPA 4IFDJ 3FB9A 3I55A 4JLGA 2OCEA 3HL8A 5M5YH 1T9HA 1HNZQ 1WJJA 4A3EG 3AHUA 1D8LA 4JG2A 3GTMH 1JE5A 1G51A 2K75A 2CCZA 2F5TX 3JAMi 1YITT 5LJ5e 5LMNQ 4M7AF 1Q8KA 4DV0L 1TWHH 4V2SA 1VQEA 3JAME 1K9MU 2LRQA 4A3GH 3OS0A 2LXKA 4DUYL 4H02A 1VQ4A 1K0RA 3L2WA 4A3BG 2VZAA 3P8HA 3F2BA 4N0AA 1OXSC 1LUZA 3CXCS 3S17H 4HJ9A 4FSXA 2K4KA 1I81A 1JBMA 1HR0W 1U1SA 2OAUA 2CGHA 4MZ9A 3UT1A 2R93G 2LX9A 3JCMg 4BBSG 4NXMQ 2L5QA 4BXXH 4F7UE 4NB3A 4KUIA 1KC8C 3JCMQ 1BI0A 2EIFA 3KJOA 5GAOr 3HKSA 1VQLA 1NPRA 1K83H 3CCVA 4M77B 2UUAQ 4C92D 3T9NA 2KBNA 4GKJQ 4C5IA 2FHDA 4JC0A 3OYFA 1XNRL 3HOYG 3MEUA 3OYYA 4L59A 3RESA 3T1HQ 5BR8Q 3CBMA 3TS0A 3L2VA 4TVAB 1PHJA 2QQRA 4M75F 3FHWA 1QVCA 3WXMB 3J81j 1KQSS 1X54A 2K2VA 3LH0A 4J83A 3H3VH 5C4XG 2X4WA 5GMKm 3S1MH 2XK0A 4A3LG 1P16A 4PG3A 3J7A5 4C3IH 1Q7YC 1XMOQ 3HOXG 2LDMA 1XJVA 4M7DC 4PJOC 2EQKA 1KQ1A 2EWNA 3OSVA 2IHFA 2RJCA 4KULA 1M9SA 4BACA 4J8OA 1VUBA 4A4EA 2WB1G 2XDBA 5GAOp 2R6GA 1OXUA 2B63G 3MEWA 2BA1A 1G3WA 5DLOA 3Q8DA 1UE7A 5C44G 4HT9A 3CCQA 3M55A 1VQMT 2MWPA 1K9MC 1WFQA 4OX9L 1KQSA 3G6EA 4F7UB 4LF9Q 1X9NA 5EG2A 4ZGEB 2DGYA 3OSSC 1XQHA 3LGFA 3S3OA 2VL6A 5GAMe 5KH6A 2JA7H 2KK4A 3R6OA 1DJ7B 1B34B 3TREA 1G291 4NPSA 3TU4K 4L6V5 2JE6I 4A75A 1EUJA 1VS0A 3H15A 2P0QA 2EQMA 1JB0E 3QHSA 1GVPA 1MJEA 5GANe 3SDZA 1QP3A 1WPYA 2NVTH 2RM4A 1E3PA 2VY3A 1LTLA 3M54A 2VQFQ 2HT1A 1QVPA 4FU6A 2DK3A 5LMUQ 4M78C 4RG1A 4EMKC 1VQHA 3PFSA 3J80i 2ZPIB 1KIXA 3VV0A 4DQ2A 4ELZC 1K73U 4QY7A 3BZKA 4UC4A 2QGQA 5GADC 2K50A 2HQEA 5IAYA 3UWNA 1O9SA 2Y0SG 1N33Q 1OZ3A 3J80E 1PYBA 2K14A 3NELA 3RKXA 4LF5L 1WQWA 3QZ5B 2AWNA 2HIXA 4Y52H 4A3IH 5GAMh 4HJ5A 5LL6S 2UXCQ 2WSCE 1EIYB 2ZJQA 4J6YA 2RF4A 1XOVA 2CZ0B 3EAEA 5FLXE 4MZMA 4JJNK 5EAYA 5GANf 3JAMc 4GKKQ 2MF2A 1SSFA 1CSPA 4LUVA 3G4ST 3HOZG 1VQCA 1L0WA 1VQPT 4APVA 4OWWB 5DLQE 4M7AC 4Z02A 5FU7B 3F1ZA 4FIBA 5CO7A 2KVQG 3OYKA 3SGIA 2O4XA 3I4MH 1U5KA 2K52A 1VQ8T 1BKBA 2A1AA 2AHOB 3QJYA 1HNXL 1QVFS 2GFAA 1VQ6A 4X62L 2GF7A 1UE1A 2BUDA 3NBHB 2PMZE 5LJ5g 5JJIA 1Y96B 3FKIG 4RMFA 1KL9A 1C9OA 5JEAG 5A0DA 3PMTA 2KSSA 3KLWA 4JV5L 2CYZB 4A3DH 2R92H 4JDSA 3RLFA 3KJPA 3AEVA 4NL2A 3OMCA 1B7YB 4PJOG 3OYLA 4M7DG 1VQ4T 3HFZB 1KD1C 2CZ6B 3V8JA 4GN3B 1PVOA 1N36Q 3HRTA 1YCYA 1N8RU 4M77A 3CMEA 4JYAL 1J5EL 3S16H 2A8VA 5LMNW 2RHXA 2K5NA 2RHYA 2DJZA 1VQJA 2I5LX 5C3EG 5GMKj 4HIMA 4BA1I 1TWGH 1NTGA 3S2DH 4PZ8A 4GLVB 2D0OA 4E47A 3MP6A 2JVVA 1G3YA 3HFNA 5LJ3d 4DUYQ 4LF6Q 4DR7L 1TXYA 4YHHL 4LDUA 2N8NA 2FB7A 4LFBQ 3GTOH 1Q81C 1VQLT 4C92B 2L89A 1E22A 3CCRT 4A3EH 4LF4L 5GAHC 3V8LA 2ALYB 2QQAA 3OMGA 1VQKA 3OYBA 1K73C 5GAGC 2OWOA 5GQOA 1P92A 2MFIA 4MTNA 5LJ3h 5GAEC 4DR6L 4XK8E 4N4IA 1PH5A 4POFA 5JEAJ 2K4YA 2R7DA 2DXBA 1Q1BA 1YHQT 1HZAA 2NN6G 1L1OC 4X66L 2K5HA 4IUPA 4DV4Q 3VDYA 4M78G 3X24B 2E64A 1KG1A 3PUXA 4KHPL 3UE1A 3STBD 3L2QA 4A3BH 1AH9A 1BYMA 4BY1G 1CSQA 3MP1A 1PA6A 4PJOA 1Y07A 2PU9B 5HKCA 4DKAC 2M1HA 2ZTCA 2DEQA 4DV5L 1HK9A 4OMFB 3CAMA 1BVSA 4YWLA 3FJPA 3UDGA 3RERA 2R93H 2L3RA 5DM7R 1MGQA 1B34A 3ASKA 1FGUA 4BBSH 1YIJT 4X64Q 4JI4L 3PIPA 1M5Q1 1PV4A 3OYCA 2V1CC 4XU2A 3GO5A 4JOIC 3A74A 3G48A 2QEXA 4C8QF 4OB2B 4X9DA 1GXIE 2N49A 3UPUA 3JCMc 3UDXA 3K81C 5KE3A 4M7AG 1WJSA 4IUUA 3G6ET 2DUDA 4C3HH 3UDCA 2K3XA 4LDWA 3HOYH 2OTJA 1MKHA 5FU6C 4A54A 1WCMG 2DXUA 4JI1L 2ZGWA 5GAMg 1N8RC 3F2CA 4EMGA 2VQEL 1V9PA 3ME9A 5GAN3 4R4TA 3HPWA 5CR2A 3J80c 1VCIA 1XPRA 1K8AU 4DOVA 4POGA 3PF5A 2E2JH 3M4GA 2B8AA 2A3LA 3RZDH 2E1HA 3BU2A 4OF1A 1QZGA 2LXJA 5C4XH 3CEYA 4A3CG 4FM4B 1XMQQ 3S3NA 3L2RA 1Q1EA 4P71A 5FLXc 4A3LH 5A2QE 4A4GA 2UU9L 5LJ5j 3LX7A 1OZ2A 2EJ9A 1H95A 3C94A 3HOXH 2LQKA 5CAIA 4JBKA 1UEBA 3X28B 4ZN1A 5M3FG 3CPFA 2NZOA 1ZQ1A 3A8HB 1X3FA 4JI7Q 3BDUA 2RHZA 2RJEA 3GNGA 2E8GA 2F5KA 3CPWA 4M7DD 4PJOD 4A76A 4DV2L 2WB1E 3VUZA 3KDFA 3CD6T 4A4HA 4NXNL 4HCZA 2UXDL 3PMIA 4C0GA 3CCSA 3UDFA 2L15A 3VKIA 5L8RE 4E7KA 3K8AA 2B29A 3E0EA 2B63H 4F7UF 1YI2T 2QQ9A 4HCBA 4R4OA 3HFOA 4LFAL 4PLLA 2GCXA 2DZ9A 3V7CA 1P8LA 1MHNA 3OYNA 1A63A 2X4JA 5GROA 4M75G 4KHZA 5IYBG 2PNHA 4JBJA 1YJNA 4HKEA 3M57A 1M1FA 1X65A 2GVAA 2ZTEA 2A19A 1SLJA 1XNQL 3A8MB 3HHTB 4KT0E 2XG8D 3GIBA 4DR4L 2OQ0A 1SRUA 4B3SQ 1TH7A 1ZBXA 2V8KA 1VQNA 4NL3A 4AYBE 3QBYA 2JJQA 4JI3Q 2QXFA 4QW2A 3FDRA 4DR5Q 2XI9A 4LDXA 2JTMA 1VQAA 2B3GA 5HY6A 1YJWA 4ELYC 4YY3Q 2DAQA 4BE0A 2ES2A 5ELOA 4M78D 4M77E 2ZPGB 1QP2A 1OTCA 2WAQE 3UDIA 3OTOL 4C92A 3A5UA 1PH4A 3PO2G 1OYXA 3CCUA 1HNXQ 5A0LA 1UWVA 4DAYB 4X62Q 2P0PA 1Q86C 2VS1A 1K3RA 2HHHQ 4JI2L 3ZFJA 5GAN2 1K8AC 2ATWA 5GAN5 1WJRA 3OYMA 3RMQA 3U50C 4ME7A 2AKWB 2LQ8A 3X26B 3T1YQ 3JCMX 4XTVA 2YU9H 3Q1JA 2R58A 1FVIA 3A5ZB 2IG0A 3S1QH 4Y28E 4ZGJB 4B3RL 1VQ5T 4LF8Q 3DB3A 3L42A 4JYAQ 1SE8A 1R8OB 4LD6A 3MEFA 2EAYA 5GAN6 4M7AD 2P0KA 1Y1VH 3I2ZA 1UE6A 2ZJPA 3KF6A 2JEAI 1N34Q 1LJOA 2O4XB 2YTVA 3QIIA 5LJ5d 3FKIH 4BBRG 1S40A 5IWAL 4IURA 3L0OA 2AHJB 5GAMj 2RHUA 1IBKQ 3J81i 1WGSA 3PO3H 1IBMQ 2F4VL 2EQSA 1OXXK 5FRMA 3P8BB 4DOWA 3JC66 4JUVA 1GKHA 1JJCB 3KOJA 4JI5Q 2LC4A 3J81E 4PJOE 1D3BB 3CCJA 4R4IA 3BW1A 3QPHA 4CRIA 4DA4A 2UXBL 4LFCL 2VUMG 1HR0L 3MCAB 4LF4Q