2L5QA

Solution nmr structure of bvu_3817 from bacteroides vulgatus, northeast structural genomics consortium target bvr159
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
142
structure length
142
Chain Sequence
MLKTILSIAGKPGLYKLISQGKNMLIVETVDAAKKRVPAYAHDKVISLADIAMYTDAEEVPLSEVLEAVKKKENGAVASINYKKASADELHAYFAEVLPNYDRDRVHNGDIKKLISWYNILVNNGITEFVEAPALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Northeast Structural Genomics Consortium Target BvR159
rcsb
source organism Bacteroides vulgatus
molecule tags Structural genomics, unknown function
total genus 26
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2010-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18347 DUF5606 Domain of unknown function (DUF5606)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1650 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2l5qA02
2.30.30.730 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2l5qA01
2L5QA
chains in the Genus database with same CATH superfamily
1X6GA 3JRDA 3GLXA 2KR3A 4M6XA 1PKSA 3WTWC 2QEXQ 4LFUA 1RUWA 5EG0B 3CCLQ 3OYFA 1H0MA 2DI3A 4AT1B 3HKZN 2DA4A 4LG0B 1N75A 1R8OB 1LEBA 4A4HA 1DU6A 2LY9A 2H8WA 3BR5A 2PMHA 5JLWA 2XSDC 2KEAA 2EGCA 2BE9B 2E7WA 4P1WA 3HGYA 4AYBN 3CPFA 1YIJI 5EEHA 1BOAA 4HQMA 1WQWA 2Y0MA 2XROA 2F2EA 2ELJA 3TEEA 3QKJA 5KK1A 1LE8A 4DOZA 5LGUA 1UTIA 1APLC 2V1QA 4JRKA 4QVCA 1OJLA 3F8FA 1NJIC 4C8QC 1LQ1A 1Q1VA 5EYRA 3DV8A 2QQSA 3GNFB 4N4HA 1Z7LA 4MNUA 2HVRA 5KCOA 5LJ5d 2IS4A 3O5ZA 5F0FA 3OBWA 4M77G 4KITB 2WBMA 1QQJA 3TL4X 5B1AH 3NAUA 3HOVJ 1U8RA 4RDUA 2R7VA 1PHTA 3HPWA 5LJ5g 2MSYA 1GLNA 1VI0A 4I7HA 4M78D 2UXXA 2HOTA 3G71A 2PI0A 1YITT 1VQ5Q 2K5CA 4I09A 4L5EA 2PVOB 3E2UA 2K02A 1NLOC 2QI2A 2EQKA 4OGCA 5GANh 3DU6A 3WTSC 4IUTA 3H5RA 4CCNA 1OR7C 3M54A 5M3MJ 2OUMA 2DL3A 3AG4H 3EG2A 1ENHA 4EJTA 3UDCA 4B9WA 1NG7A 2DAQA 4XK8E 3E3VA 3E5QA 4E47A 4HF0A 1R71A 4IOCF 1BI2A 2SRCA 1IO2A 4YFNF 3TQNA 1Q1HA 2GM4A 1TW3A 1QP2A 2IVMA 2XB0X 4HDUA 4M75B 3JW4A 3SDBA 4B44A 3E6CC 2CQ7A 4MDWA 4LK0F 1FTZA 4RKUE 1WFXA 2HMAA 5TGTA 4Z8AA 1SHFA 3SHFA 1SRMA 1SD7A 5FRNA 4AUXA 4YFXF 1P2FA 2PU9B 4EMKB 5IHIA 1OYXA 1N27A 2NVYJ 3LWHA 2A36A 5D6WA 3U1KA 1S72Q 4PJOC 3CCQQ 5FLMJ 3JRGA 2CDTA 4BKXA 1ZN2A 4J7IA 2W4SA 1N25A 2DLLA 3DEUA 5DD4A 4MTEA 2A68F 1S1NA 1LFBA 3AAFA 3CCRQ 2M9UA 4GO1A 1XMXA 3DXJF 2GLOA 4G8XA 5E1ZB 1B07A 5EZGA 5FO5A 3IWZA 1C1AA 1UB4A 1Q81R 2KY9A 1MBKA 1MD0A 4M3GA 2H1KA 5GAHJ 5GJWB 1MBJA 2Z9OA 4XL9A 2GGRA 1R1TA 3RQ4A 4A3FJ 2FMLA 1B8IB 5D6XA 4D1QA 2XKOA 3ZQQA 4KRTA 4OB3B 5IT9K 1HA8A 3BY6A 4CSWA 3L2QA 4KA4A 1ZA1B 1LNXA 5FGMA 3E5UA 5JVGF 3EG9A 2ZPHB 4XAXB 4JRPA 3BZCA 1JUPA 2RA2A 3CMMA 3UWNA 2Q8KA 1QGPA 1NTCA 5CVRA 2R5YA 2DA6A 4HYEA 4JYKA 4L9VA 3ZRGA 3S1NJ 4JRQA 3U1DA 3WU1B 1AKHB 2RO0A 3TVTA 1PD0A 2GBQA 2L0KA 1YQAA 4OGEA 1F4KA 2QTXA 3M9AA 2DXIA 4N4IA 3DLLF 1BB9A 2GA1A 1B34B 2HKNA 1UCRA 2CO5A 4PUSA 4PJJA 5KE3A 3DBLB 1Z9ZA 2XICA 3VS7A 2X6XA 4Z6YA 2L9RA 1VQ4T 3M0SA 2AT1B 2CG4A 3MKLA 2NYSA 2VQCA 1WNLA 5GANf 3S14J 1RI7A 4AIJA 1BI0A 1VZ0A 2CQQA 2RV8A 2ZB9A 1G59A 4J9HA 3CJRB 1EH7A 4BL0B 2OPTA 1FYNA 3OYBA 1RUNA 8ATCB 2Y48A 2VC1A 1YJ9T 2Z2SB 3OMCA 4WX9A 2K7AA 4LUEA 2IA1A 3J7AF 3CD6I 1FEXA 1Z7UA 3IUOA 3M4GA 1YHQT 4MZMA 3E9FA 5CCAA 3BR2A 3ZMSA 1C0MA 1WZ2A 2JT4A 3JCMd 2DERA 1QP3A 1Y1WJ 4DIQA 3EFOA 4XTYA 2G7UA 1NYGA 4RS8A 1T2KA 3JCMg 1RLQC 5J3BA 4C5GA 2YUOA 3KFVA 2IA0A 3DBHB 3CCMT 3GIBA 2EKOA 4LK1F 1X3WB 4BY6C 1L0OC 3KEOA 3GTOJ 2XPUA 4PFZA 3EGDB 3ASNH 2JVHA 5KH6A 5KVRA 1BC8C 2GIVA 2LTOA 1VQ6A 4M7AG 2GQQA 1IN8A 3LSGA 1W0TA 3FMSA 2NVUB 1FYMA 5FRMA 3UATA 1Q86U 1SMTA 4ON0A 3JRAA 4P5NA 5LLQA 5B3SH 3CQZJ 4ZGJB 2Z99A 3LQRA 3R61A 2TDXA 5JI6A 5DM6F 4A12A 3H6ZA 1VTNC 4B8XA 1ZGWA 1X2NA 3CMAI 4MDXA 5EJCA 3T5XA 3IC7A 4HCKA 2VOOA 2OTJT 4IIMA 2K4YA 2E1MB 2M34A 3CPWA 2UZKA 4L18B 3E6DA 4OMPA 3S3NA 4N4NB 4A3IJ 1RPWA 3FZVA 2NUPA 3CMEQ 4U0YA 1O7FA 4NUBA 1OPKA 4G6DA 3GZ6A 2E2JJ 1YJWA 1NEGA 3UA7A 4NS5A 4Y4RA 2E3IA 1SAUA 1Z91A 2NNNA 2ADUA 1KA8A 3GVAA 3K10A 5LHGA 1W6XA 2FZCB 1JUSA 2WAFA 1TG0A 3PNWC 2D1XA 1UE9A 4MZTA 2G7HA 1U5TA 4XLCA 2MG4A 3C3WA 2FPFA 3CC2T 1KQ2A 2H6CA 2C0TA 2Q0OA 2X4WA 1JKQC 1VQ9A 2E1OA 3ZQCA 1UHCA 2MH9A 1ZRCA 4QTRA 4OAYA 1D1BA 1WI3A 2IVWA 2EA4A 4HEA2 2OCCH 2WSFE 1OMIA 2DOAA 3ROUA 2X3WD 2NXNB 3ZP5A 2V79A 2DD4A 3KEYA 1IGNA 2NUZA 4M75G 2BY0A 5IT3A 5GP9A 1IV6A 2MYSA 2IP2A 3ECHA 1AZGB 3HHGA 2CSIA 2WTEA 4FSXA 1D8JA 3IRQA 2DXTA 1Z05A 3DB4A 2A61A 1TLHB 3CLQA 2O9LA 5FLVA 5IT9Z 4HVWA 4D8KA 2C6YA 4ESFA 4G12A 5GADJ 2X0LA 1BJAA 3PIOF 2LD5A 5A0DA 3MCAB 3JRHA 5J1YA 3SZGA 2QGGA 4U0VA 4F91B 1V3FA 1XJWB 1TWBA 4Y28E 1H9GA 2VT2A 1WHGA 2JZYA 1YS6A 3QUIA 3I53A 5D7UA 1ZREA 2Q2EB 3F23A 1J0RA 5AIPA 4YTLA 2QUFA 1FPQA 3NARA 4L0YB 1QWFA 3BG3A 1IO6A 1TUDA 3RESA 2W57A 5GANg 2EW3A 4LITA 1Z0XA 2NVXJ 1BR2A 1JUMA 3T8RA 1IN6A 4XQ3A 4ELYC 4R56A 4C5EA 3WTUC 4KDPA 3BZKA 3WTZA 1IGQA 3SWNC 4ZYGA 3O8VA 1Q86C 3IH4A 2GAUA 4A3EJ 3H41A 2RJFA 3I56A 2OTLI 2QSGX 1XCBA 2QCOA 2GWRA 2HOSA 2O9SA 3CXCA 3CPWS 1J3TA 1H3ZA 1JGSA 3RUXA 2H1LA 4HV6A 3ZGKA 3ZMUA 4Q4ZF 2HYJA 1KU9A 3HRTA 4CCMA 3A01A 2CV2A 1VQKQ 3CO7C 1T39A 3M7GA 4C8QB 2JMAA 1AKHA 5A0GA 3JTGA 1I27A 4R1HA 4BNCA 1XX5A 2DT7B 1B4AA 4RAGA 1CKAA 2EPDA 2F1LA 2QASA 1AZEA 2VLAA 2BBYA 3KETA 2CP7A 1M2VA 4LDVA 2DIQA 1WGXA 3GBGA 1UECA 3WTXC 2R7FA 3D0SA 3HUGB 3HEFA 4LB5A 4FYWB 1G5VA 1YS7A 2YX7A 4BXUA 5BMZA 4QSHA 2DLPA 3P8HA 4M77C 4PLLA 2QEXT 3CCEA 5J47A 1GBQA 2EQUA 2K3BA 4C5IA 2FE3A 1Q7YU 2DA5A 3CTAA 3FKIJ 3OBYA 1OQYA 1F1ZA 1KC8U 2MPXC 3LQQA 2ID3A 1JT6A 4ZH4F 5HLTA 4PK4A 1FYKA 2FA5A 3RQIA 1LJOA 2JTEA 4IQJA 1NPPA 1S6LA 4PZJA 3SDZA 6AT1B 3OYIA 1YJWQ 4X9CA 2DMQA 4A2UA 1VUBA 2AK5A 4EMHA 3R6NA 2OJ2A 4XKVA 2WADA 4EMSA 4EEFG 5LRRA 4OU0A 1FMWA 1GVDA 3K4CA 3QYFA 3ZPLA 2G3RA 1RAGB 2EH3A 4LJZF 2QGFB 2M7AA 2DFIA 1YI2I 1FOKA 2DZCA 5CKEA 5CKFA 4R0KA 2OD5A 4M3DA 1P7JA 1G8XA 2DT5A 1HDDC 1U1TA 4MLOA 4HLYA 2HGCA 3EGDA 4E7IA 2MF2A 1OEBA 3OL4A 3QPTA 3CCYA 3CZ6A 1I1SA 1G3TA 1VQ9Q 4HX7A 2QKLB 3M4OJ 3DQVC 2LQKA 3RPUD 2HVSA 2E6ZA 4ESBA 2EJ9A 2KROA 4Y13A 4JX6A 2LJ3A 1G3YA 1W2BA 4KGXB 2EWNA 1H9TA 9ANTA 2RHIA 4RTTA 1YIJT 1X1BA 1C6VX 3H0GJ 5KAFC 3QXEB 3VYGA 1M4ZA 3OIQA 3DTIA 2ZJRF 4WK8F 3CCVT 1S7OA 2PMZA 3BTLA 4KULA 4C3JJ 3VS0A 2EILH 2ZO4A 4DBFA 2VL8A 1IRFA 4ZZDA 2QQRA 2OJED 1X1DA 2KDSA 1YN8A 1T08B 2MD5A 1ZTRA 4U7DA 4OMZA 3LSRA 1BR1A 1ZUUA 1HC8A 1JJ6C 4Z02A 1YW9A 2DILA 4RM2A 1YJNI 5GAN7 2XAHA 3HOZJ 3SD4A 2K9QA 4RGXA 3A1PA 5J39A 3FWEA 1WJDA 1RAAB 2E3HA 3REBB 1P92A 2LLKA 2RAEA 4D5FA 2DMNA 1E0EA 1X2KA 2JWTA 4NHJA 3RNJA 1K73U 4LB6B 4ZDPA 5M3FJ 2MI6A 1DP7P 1W7PD 2W24A 5IYDJ 1VIEA 2DX1A 3N97A 4M3FA 2KYMA 3HOYJ 2VT3A 4JDSA 2E2HJ 3EGXB 1B1BA 1SANA 2DKGA 2RQRA 3CCSA 4D7MA 2DA2A 5JFRA 2BEOA 1Y6IA 3S1MJ 4RCBA 3KP4A 2ZCWA 2P4RA 2JM9A 3CCJA 4ENNA 2WA0A 2QBYA 2D1HA 3E5XA 3I55A 4F7UA 4L5JA 3ELKA 1UAAA 1OOTA 2N8GA 3NTKA 4KH1B 3I71A 2M8EA 2W85A 4OF1A 5DM7R 4JP0A 2KFDA 3Q9SA 3L2CA 2CQXA 2E41A 2PNIA 1U8BA 2NOGA 3VS1A 1G6NA 2RJEA 1FY7A 5E18F 3R6OA 2H94A 1KGSA 1YITI 1E3OC 5M5YJ 4XU0A 4I76A 2IG0A 3CESA 1QHGA 2JT1A 4FX0A 1Z77A 2EFQA 5CYVA 3VS5A 1KC8C 2E7XA 4HBLA 5JVTA 1XOVA 2RPNA 3VS2A 4HPQA 2VJJA 1VQLT 5DM7F 5EGOA 5CQYA 3RCOA 4RBOA 3ZN0A 3WTTC 2B9SA 2CH0A 5D8KB 3J7AY 5HVQC 3EUKL 4I98B 1I3AA 2FBIA 1Y0UA 5A2QK 4ZYAA 5D8LB 1V4RA 1XCVA 3K70D 3TCJA 3B02A 3RIRA 1A31A 2KRFA 1I39A 2XASA 3BR0A 3EH1A 2RN7A 2L3DA 1WLPB 4MGRA 2LY1A 3FK6A 2O31A 2A3LA 2QM3A 5GAMj 3I5SA 3JRIA 2OZ6A 4ESJA 3MZ8A 3OV8A 2OF7A 1IN5A 1M3AA 2CH4W 1W2BS 3CP2A 3NWTA 2OAUA 2R57A 4XR6A 1KU2A 3ER0A 4LGWA 2L2OA 3FXRA 4G6QA 5D6FA 1CF7A 4DEYA 5FFXA 1GFCA 4PSWA 3LSTA 5IPAA 1ARKA 5HS9A 4HKEA 1YJ9A 2R7SA 4P96A 2UWMA 4EIKA 3OOUA 4E70A 4C92F 1VQNA 5GAMe 4OIPF 5KYYB 1YTYA 2ZNYA 2VONA 2L89A 1PDNC 1TQMA 2KE9A 2CRGA 1YHQA 4Z88A 1XG1A 1M1GA 4J8OA 5GPAA 1Q82C 1NZ9A 4M7DC 2E1CA 1WI7A 2QF7A 2XIGA 1HD3A 2VQLA 1PM3A 2IJLA 1RI9A 1RIOH 3C12A 4XONA 3BPVA 1XSDA 3FJPA 2L5QA 2COYA 3G6EI 5LJ5j 4LOCA 3BG6A 3I4PA 3H8ZA 4C5HA 2EJFA 4PDKA 1KQ0A 1OR7A 2DCEA 2W1OA 3PFIA 3ZFJA 1OCRH 2W25A 1QHHD 3ZMZA 4ABZA 3IL2A 4EMGA 5HKCA 1HQCA 2V1DA 3TSZA 3CMET 4BI8B 1HK9A 1VQOT 2D8JA 1K73C 2O01E 2GQVA 3MPUB 2OC6A 2YUQA 3K4KA 3FF5A 1CSKA 2VKNA 4XN3A 5CVIA 1PVEA 3JSCA 1U78A 3KIOA 5LJ5e 2RF0A 4M3BA 5FKLA 5IP9J 2FUG2 3L2UA 1VQ4I 3GTLJ 1BK2A 3B6CA 4LDYA 3BJOA 1I50J 4LG3A 4WCGA 4C0DC 3IWFA 1D3YA 4NC8A 1VQMI 1NH3A 1R4MB 2K9MA 3GX4X 1MGQA 1Q7YC 1LVKA 2PBIA 4M75C 1T33A 1HSQA 1GBRA 5K5QA 3MEXA 2DK5A 1OYYA 4B3AA 5K1YA 1O3TA 3ML6A 3V42A 4O6JA 3BPXA 5DDGA 4FL6A 3CCSQ 5HY6A 3DBRB 4PJOA 3C7JA 4JS5A 1YJWT 1KD1R 2F4OB 1DP3A 5E3MA 2HD0A 4EMKC 1R49A 2PZ1A 4X0GA 2QG9B 1S7AA 3FIWA 3K1MA 3PFSA 2QWWA 1E3PA 2VBZA 3E6BA 3F8BA 3TEDA 3VU3C 5CKDA 2TCTA 4MTDA 1S3JA 2XRNA 2FG0A 2LDMA 2QGUA 2CP6A 4BQOA 3JB9F 1IF1A 4HXJA 1D3BB 2GF7A 1GV5A 3OR2C 2QQ8A 5CAIA 3CCMI 2O03A 3HYIA 2PLYA 2PVDB 3RJPA 1LFPA 3SWNB 2VKEA 2ZMEC 1SF9A 2MK5A 1OISA 2L3RA 1MMGA 2I2LA 4J6XA 1GCQC 1I07A 2WC2A 2HXOA 4A53A 1T6SA 2J6KA 3HHHA 4P5OA 4XLPF 3K9TA 2XDDA 3VKIA 1B6AA 4KJZA 4AD9A 1UUEA 3TMOA 1R1VA 2IBDA 1YP5A 3OR1C 5FLXZ 2E70A 3L7WA 3BE3A 2XF7A 4JK1X 4IHWA 4X6AJ 2D9TA 2LTPA 2L02A 3MJXA 4EM1A 1JGGA 3EUHC 5H2FC 3HG9A 1M1KR 1O3SA 5E20A 2OTJI 4RAFA 2ZJ2A 1KONA 4L5IA 1WYXA 2V8JA 3FIFA 1D8KA 3L00A 3UKGA 2J5PA 3LL7A 4M77B 3CCUQ 3VRYA 1UFMA 1YRNA 1LKXA 2DM1A 2NUTA 4EDUA 3TOBA 1MIJA 4BJ5C 4ZTFA 2DD5A 3EGXA 2ESWA 5GAMf 1XGMA 2KL4A 2HSPA 2KDZA 4HCBA 3A0HC 1IV8A 1JRIA 1ZQ1A 3UF4A 3W3CA 2E2IJ 5E3OA 4EGZA 1JO8A 3RYRA 2VJ4A 4A4FA 4BUGA 4CYCA 4HNTA 2CUBA 1JTYA 2LJ0A 3QHSA 5IOZA 3VS4A 3QWXX 3X24B 1VQKT 1MNMC 1YX3A 1MNEA 1ZARA 1MJBA 1HSJA 2R4GA 1Y8QB 3C1DA 3G3ZA 3KYDB 5LHIA 1NK2P 3VS6A 4ELZC 4XQFA 3KZYA 4XTVA 2LKSA 2ROTA 1BU1A 2J05A 1P7IA 3M57A 4RA2A 2HPMA 4RLFA 5FFZA 1PSEA 4E7SA 4U7BA 3CC2I 4D6WA 3RZOJ 2XAJA 4FM4B 3VV0A 1QVFA 3F8MA 2ZXWH 3T9NA 4CI0C 1WJ5A 4Y52J 1R9TJ 1F43A 1E6HA 1WHJA 4UB6C 1ABQA 4XLFA 2JM8A 4GYGA 3EFSA 2FJ1A 1FBSA 1ZBXA 4DW6A 1QZZA 2YS9A 5LJ5f 3PFYA 4BS9A 4UB8C 2JPBA 3F8NA 1U3EM 4FTHA 2HU9A 4M74A 2FRWA 3HPHA 2YRCA 1X2MA 3S17J 5F08A 3BW1A 2LP5A 1LFUP 3FM3A 2OTLT 2DJZA 2ZPBB 4KICA 4VUBA 3OYYA 4PGHA 1KQ1A 3MEUA 2O6GE 5C4XJ 5IP7J 3A98A 3JCMe 2AIRB 3BFMA 4J6YA 1NJIU 4A0YA 1ETOA 3CC4Q 3JB9D 4F52A 4C8QE 1IDZA 3GTMJ 2E1MC 4BI4A 5JLXA 1JT0A 5DUKA 3AG1H 5C6SA 3GFIA 5ECAA 1KQSP 2XPWA 4BJTA 2ISYA 2Z5UA 1MSEC 5KYYA 2R7ZJ 4KIGA 5LRSA 1STZA 3DKXA 3JAMZ 1JEGA 3SFIA 1YG2A 3K7AJ 5EEAA 2BVLA 1GXPA 3HOWJ 3OYDA 2R3SA 4M78F 4X1VA 1M27C 4DBHA 1EJ9A 4XOTA 1AWOA 3ISPA 1WHUA 2V9KA 2XVCA 1MUZA 3H9GA 2BZ8A 3HSFA 4ZDOA 4DEXA 4II2A 2RQWA 5TJJA 5GAOq 4FE7A 2HFHA 2CUEA 3GWZA 3WODF 1O3QA 4JS4A 1D1AA 1WI9A 3WHCA 2MMPA 3PVLA 3JCMX 1LEAA 1VQ8T 3JSOA 2Y9ZA 1ZHFA 1BN5A 2H3JA 5GMKm 4HVUA 2X1EA 4N0BA 4I02A 2RN8A 3M1EA 4XKCA 2DA9A 4IPAA 5K7HA 1MBEA 4BB7A 2BV6A 4F93B 4AG1C 1FBQA 3S1QJ 1WCMJ 1Z21A 2OA4A 3J7AO 2FNAA 1JXMA 2FD5A 1A35A 2FRHA 1UELB 2Y0SN 4UUSB 2HR3A 3CMYA 2QEXI 1HYOA 2XDBA 2PQ8A 3GTKJ 4PJOE 3KCCA 3D1NI 4BE2A 1FYLA 4B43A 3HL2A 2DBKA 2EJRA 2GQIA 3C95A 2WSCE 4M7AF 4HG2A 2IGKA 1QVFS 2ZNZA 2IGMA 3CBOA 2HNHA 4KH0B 2BVMA 4J9BA 1TL8A 3PSFA 2XMFA 2ZJPF 2LCSA 4IEJA 2E19A 3KP7A 4EJUA 5KYXA 3OW2A 2RB6A 2DFEA 4FHTA 3OL3A 1U6GA 1ERDA 1V76A 1T38A 1K0SA 1JJ2A 4HVVA 2COBA 4LD5A 1R5GA 3R0JA 4ETSA 1BW5A 4C92B 1D3BA 2M0YA 3CC7Q 5J26A 4F3QA 1E17A 1DDNA 4IURA 5L3GA 1U9NA 2XC7A 5GANj 3PQKA 2VC0A 3SWNA 4IVNA 2OQRA 3ZMVA 3JB9J 1UGPB 1Z3XA 5E3LA 2JJ7A 3O8GA 3ZN1A 1ZA2B 5H6QA 4XRSG 1WZOA 2AKKA 1I6XA 2FQ4A 4KUMA 4F7UF 4Q5SF 3CF2A 5D4RA 3MAJA 2DBBA 4IHVA 2DU9A 4LIVA 1TQIA 3VPRA 3JCMf 2M7BA 1OZ2A 4KGZB 5GANe 1Y7XA 4MQ9F 4M7DB 3N4MA 2DRMA 3CCVI 2WY7Q 3V7RA 2KRMA 1TTYA 4A0XA 2HQEA 1IG7A 1JKOC 3FXJA 4OMNA 2MA3A 1ZUKA 2FB7A 3S32A 4M77A 1Y71A 1Z9CA 1HKSA 2RI3A 1JTXA 3C2HA 1K9MR 2FSWA 2L9SA 3JTHA 1IN7A 2XGEA 2VKHA 4N4OB 5GAEJ 1K9AA 1G83A 3SHWA 1ZLMA 5HK0A 1WQ2A 1H92A 4G94A 5GAOr 4B1RA 3EUAA 4Y15A 5LL6S 1BI3A 2ME0A 2LRDA 3LSMA 1KIKA 3ERED 2EQIA 3FXUA 2DL5A 3TU4K 1MBGA 2IIMA 2ECCA 5FKOA 1UGSB 5HLGA 1X3ZB 1CKBA 5E17F 5HLIA 3Q1JA 4A0ZA 1NJIR 3S2WA 1IZ6A 1AT1B 3AG2H 1T0JA 4S04A 4C0DB 4FU6A 1YFHA 3TP3A 1WJFA 2M0MA 3K4NA 1KQ9A 3PQJA 5E79C 2BE7D 5CKTA 1XDSA 1QVGP 3LSHA 3CXCP 1TS9A 1R58A 2HPIA 2X9DA 3F9KA 4PJMA 4NC7A 2DYIA 5EC7A 5JHFA 4FYXB 4M4ZA 3SJMA 2DNUA 3WTVC 2HAXA 3H9QA 4MHGA 5KCMA 1WA7A 2EAYA 1ZR4A 3LOCA 3H3ZA 2DODA 3LGLA 3NTIA 2FYKA 1RC9A 1CQTA 3D7SB 3K4BA 3QPSA 4M7AD 1HKQA 3LH0A 2DXBA 3OW2S 4A54A 1VNDA 3HKZA 1Y96A 1ACIA 4JPBW 4V19K 3HRMA 3J7ZI 4KNYA 3FM5A 1VQLI 5GJVB 1JJ2S 3ZMTA 2H09A 2CGHA 3CEYA 2ZMEB 3LA2A 3CD6A 3LAPA 1E7OA 2VXDA 4AYBA 3QPHA 1IAWA 3ZOBA 1L3LA 4N0AC 5DCMB 3VB2A 3WE3A 1VQOA 2X35A 2Y4YA 1AWCA 2YR2A 3AKZA 5FKNA 2FEZA 2YSQA 4AFUC 2W48A 1I8FA 1TC3C 3G6ET 2QA4Q 2R7DA 3HTSB 3FEOA 3HL8A 1VQ7Q 1I1GA 3CP8A 5F1JA 4UVBA 3GF2A 4J9FA 1FLIA 2RQUA 5CIUA 4HX4A 4A3MJ 2HZDA 5DY9A 3BTCA 1NE8A 4LDWA 2JPCA 3ABMH 1V5GA 3IP4B 4V2FA 2PJRB 3G4ST 5CPRB 1YCSB 3MKZA 1ULYA 2GZWA 1LB2A 1MMSA 5F6FA 3QPLA 1BI1A 3CJQB 1V29B 4NQWB 3MEWA 1O57A 1R7JA 1K78B 1SRLA 5DCFA 2VQGA 3CMAA 4OWRB 1IXRC 2KI7A 2BIVA 2RQQA 2E64A 3DLMA 4JUVA 4MMKA 3I59A 3KLNA 2XSJC 3A03A 1OCOH 1VF9A 3GZNB 3MQ0A 3SFZA 5GAOn 1FOYA 1ZH5A 2O4XB 3F70A 2JXBA 4XU3A 5FKKA 2MIOA 2HXIA 3MMYB 3RMSA 2DEUA 2G9WA 2UXNA 2JK3A 3AG3H 3JCMb 1IXCA 1S8NA 3L2WA 3BG7A 4IL6C 2LT4A 4HT8A 1M90R 1XGOA 3BLYA 3OSSC 3PIPA 3P7NA 1OLTA 1QPIA 3FXLA 1RETA 2KMTA 4M3EA 5CVJA 2KYBA 3SEZA 3TOAA 5K7ZA 1G3SA 3OYNA 3IQLA 3RR6A 5LJ3d 1ETKA 3H35A 1K76A 1YFNA 4PJLA 1Z67A 2CGPA 3K4JA 1VQOI 2CFOA 1BA5A 1WXUA 4HAMA 3CMEI 1JKPC 1LPLA 1WXTA 3INZA 4UHTA 1QMCA 3V8LA 4RGRA 3G71Q 5GAGJ 2V9PA 3WGGA 2XRLA 1SG5A 4LXCA 3HOUJ 2YWWA 3EYYA 2STWA 2R7WA 1WVRA 2K2VA 3OYCA 3CQTA 3CUQC 3RERA 2QTVA 1TTHB 3H0DA 1GL5A 3PNVA 3RKWA 3H3UA 2COWA 1U06A 3EHRA 2K40A 3RKQA 2V4JC 3SFMA 1UG1A 2E36A 2RQPA 5LBQA 2K5IA 3GBQA 4C92G 5ILUA 1S9HA 3KUFA 4II1A 2V7FA 1W5TA 2XF5A 4FQGA 3TBIA 1X58A 3JCMJ 2KRSA 2V8IA 4M78B 5E1XA 3QYEA 4L9TA 5GAN3 4Z2YA 4NC6A 5EG0A 1FBUA 1A6QA 2RNGA 1OPCA 2LC2A 3DEWA 4RB2C 3S3MA 4LG0A 1N8RU 3OS2A 3M4YA 1PYVA 5DUIA 2HDCA 2WAQN 3ABKH 2EGAA 4O5VA 3RKYA 1LDDA 1UHMA 4JBAA 4R55A 4BEHB 5ICCA 2EYZA 3JV3A 1GHCA 3DTKA 4A5MA 4M77E 5KHDA 3S3OA 2IPOB 3CO6C 1VQMT 3BZ6A 2KJCA 2XKPA 4M7DG 4CZCA 1RL2A 2BY3A 1R36A 3R60A 1T95A 1PG5B 2XG8D 3A8LB 5DV5A 2F5FA 4IXAA 2FL7A 4II3A 2XK0A 1ABOA 1ZBJA 2D6FA 3PT9A 1FJLA 3HIFA 2LCLA 5KNLA 3CD6Q 3U2RA 3CC4T 2GXAA 4RLQA 1BYMA 2K4JA 3C18A 1PRLC 3BWGA 3RI4A 1PUFB 2VWFA 4K11A 1UHWA 3UPUA 1TWGJ 1R6RA 4EM2A 1WWXA 2K86A 2LK2A 1UHFA 3L1AA 4M7AB 2DJQA 2OTLA 3E9GA 4UUVA 2R5MA 3I5UA 2DTZA 1NM7A 4JOMA 4KN4X 1E6GA 3LFUA 4ESRA 2A28A 1IXSB 5LFAA 1XGNA 3F21A 4JJCA 1BCMA 4L59A 5I22A 4PFPA 1UJ8A 4M75A 5F27A 1HKTA 1OX8A 4ZNXA 2BGCA 1QPMA 3X20B 3JB9G 1J5YA 2LX9A 2GXGA 1YBYA 1XGSA 4Y33A 4QLCU 1DQUA 2FBKA 3M56A 4J9CA 2HDDA 1EZZB 1VQKI 4EMKA 2CU7A 1SAXA 2Y30A 2CUFA 2DETA 2MFZA 2QSHX 2IPQX 2NWMA 5KYUB 5E8GA 2E10A 5J6XA 1R22A 2DYSH 1T3SA 3OYGA 1SC7A 1O9SA 1KYZA 2EJGA 1W36D 1VQPT 1MH3A 3RPQA 4BD3A 1GCQA 3D5SC 4JJBA 1X1PA 1POGA 1KK7A 2B0LA 2E65A 4CH7A 5GAOp 2R7OA 1MMAA 4OAZA 1B8IA 2NRAC 3M53A 1YI2A 2C06A 3QYHB 1WJAA 3VODA 4F17A 1N77A 4FX4A 3JRFA 4A3BJ 1FXXA 2P6SA 1ZUYA 2O7OA 1TW2A 3IKVA 4AWXB 3MZYA 4XIDA 2CSQA 2P0PA 4W1UA 5A2QE 1QKWA 3AT1B 5CVVA 1PRMC 3K4MA 3TO7A 2VYTA 4OIQF 2WY8Q 3BP8A 3QBYA 4KUIA 4IZZA 4G7HF 1VQ6Q 2CP3A 2ZAEA 3CC7T 3COAC 2EZIA 1B34A 2IA2A 1N8RC 1XSXA 1QRYA 3JB9I 1DPUA 2LSOA 1M8MA 4JLIA 1K78A 2MLGA 1KU7A 1BIBA 1G2BA 3MP8A 3JRCA 3CCLT 3LFKA 2K3PA 3GCMA 4XSZF 1Q86R 1ZLJA 1XNIA 1UGRB 2NOJB 1JHFA 3HKSA 2RHXA 1M5Q1 1FIAA 2HYFA 3DP7A 4CICA 1SSFA 2KHMA 1W4SA 2PVGB 2HKXA 2K7LA 3V7SA 4DBQA 4E7HA 3K70C 4OINF 2A7YA 2AQEA 3A1YA 4BU2A 5HNFA 3DPLC 1OCZH 2XAFA 1J75A 4WWCA 1VYTA 5J4VA 2DFUA 3G1JA 3OYHA 3VUBA 4AC0A 4ZN3A 2O3FA 4GDFA 5D5UB 4KISA 3FKJA 3SYTA 1F36A 1SVMA 1TZLA 5GMKi 2L01A 3ESWB 2E71A 3LX7A 2P7CB 2ID6A 2DDAA 1VQ8I 2VOPA 3Q5FA 1USSA 1Y07A 2ZXIA 2DTHA 4GY5A 4E6KG 4U0WA 5K5OA 1VQ5T 1U3OA 2HDAA 2BHYA 1BOBA 4JZ4A 3J81E 1Y57A 2LYCA 5BOXA 2FHDA 2ABLA 5E3NA 2PN6A 1SEMA 2VJIA 4C92E 3ZR8X 3HZJA 3QYGB 2X51A 3A2KA 4UUTA 1ZRDA 3I5RA 4XTXA 2M1BA 2GOMA 1YX5A 2FZGB 2QZ8A 4RAYA 3HB9A 1O3RA 2QYOA 1B7TA 3KYCB 1VIFA 1V1CA 1QBJA 1I1JA 2JVVA 4J5YA 1RESA 2KK4A 1XTDA 3A0BC 3NWSA 4D7NA 4ZYEA 1BCOA 2H8HA 3VYHB 1YITA 1DGWY 3H1CA 2AKLA 4M78G 3EETA 3JCMc 2F2WA 4KGVB 1U2WA 3K0LA 1W1WE 1SVLA 3HBLA 3OYKA 2IXSA 4EGYA 2ELHA 1FSHA 1LNWA 1Q82U 4BY7J 4QQGA 3BQYA 2RI5A 4BXXJ 2KMUA 4M7DE 1P6RA 2EFOA 2ME6A 3PGGA 1NLPC 2VQHA 4BEHA 2X9HA 3ZQ7A 3FX3A 1S72T 3CDHA 3CCQT 3LNQA 4L5GA 3CDLA 4CCLA 1O75A 1UJ0A 4UY8I 2FRYA 4OIRF 2BUDA 3QQAA 1QVPA 3CCRT 4RB0A 3MHXA 1TWCJ 3FK7A 1NEBA 3GTGJ 2LC4A 3QZ5B 2RD1A 4G7OF 2CH4A 4FETA 3WG9A 2EBIA 5LEJA 1XPXA 2HCKA 3QWLA 2K5FA 4DOWA 2DXCA 3OYJA 1TWHJ 2XDVA 2LT1A 4RUGA 4PNOA 1QW1A 3TKYA 3S2HJ 1Q95G 2DEQA 4LUDA 2LVMA 2EIMH 3M59A 2M51A 3JCMQ 4CCJA 5FWCA 4ZYDA 1M1FA 1ONVA 2ICWG 4AFZC 1YI2Q 2QA4T 1HW1A 3BTIA 4EJVA 4C3IJ 2LX7A 3M58A 2LY2A 3O6BB 1H89C 1M9SA 2OU2A 4FW1A 2M9HA 2W82A 4QW2A 3I56Q 4XRFA 1F5TA 2CP5A 4M75E 1SFEA 2D45A 2X1CA 1LOJA 3W6KB 2LREA 3IHUA 4QVDA 5GMKl 2ZPGB 1MV0B 3SB2A 1DU0A 1KSWA 2HKQB 3W2VA 4ATOA 1TOVA 5KCHA 4FCYA 4WXCA 3CBMA 2IS6A 3BJAA 3FISA 4R8HA 2VXFA 2CZ0B 1H3HA 3GO5A 1G4DA 2ZJQF 2PQWA 2AXTC 4E7KA 1WHMA 4AG2C 4A5NA 2GTOA 3G6EA 2P4WA 3OIPA 4C0FA 2LVSA 2YU3A 2XAGA 3N05A 3CCEQ 2Q1ZB 2Y9YA 2HTSA 2PMUA 3CUQB 3RKXA 2IS2A 5FU6C 1YIJA 2VUBA 2VJ5A 4YIIA 3VSLA 2HTJA 1G2HA 4F7UG 3SQNA 3H9JA 2K27A 2V1UA 1IDYA 3JR9A 2LMJA 1Z6TA 2GA2A 2ZKZA 2RHUA 5IXBA 2YLBA 2Q2EA 4NBQA 4DOVA 1QCOA 1T0FC 1ZX6A 1SD4A 1PSFA 2MOXA 2HL5C 2VC8A 1YJNQ 3CBPA 2VODA 3VS3A 2YSRA 1RAEB 1MMNA 3O3KA 4BDZA 1SFUA 1X4OA 2DN0A 2RJCA 4C92C 2HBWA 1VQ4A 3W6VA 1NYFA 1KC8R 3X28B 2VASA 1C0WA 2GTJA 3A5ZB 2EKHA 1VQMA 1GV2A 4CGZA 4V2SA 3I9V2 5F0CA 5B1BH 4CYDA 4R79A 2KQRA 1MSFC 2D0NA 4GLMA 3G71T 1ETWA 2JVGA 2VI6A 3HM5A 4IOAF 1D0YA 4B3XA 4QVZA 3QSUA 3PIPF 4HSTA 2DFHA 4RTYA 1K8AU 2XI9A 3KP2A 4BHCA 4ZJZA 1Y39A 1EX4A 4LD6A 4C8QA 4XOPA 2JA7J 2L7KA 2EYWA 1ON1A 4C2MJ 3JSPA 3MEAA 2O8XA 3TW7A 4IUUA 3RSNA 1PC0A 3G1OA 4KFCA 2QXFA 2J5OA 3GXOA 2HOAA 3U9GA 4C30A 1MHNA 4Y92A 2A5YB 3E19A 3C2BA 3HUGA 3MWMA 3IRRA 1PP7U 3CCMA 5ICFA 2DQLA 2OQGA 4XKWA 3A8OB 1YITQ 2LBFB 2NNYA 3SZPA 2ZZDA 2YUSA 2CV1A 5B5EC 3J81K 2RGVA 1WJSA 5HS7A 4WTOB 1X3UA 1OX9A 3KP6A 5IOYA 1YOVB 2VBYA 3G4SI 4U88A 2KP6A 1HBXG 4U87A 2QDYB 4BHBA 1FX7A 1I6HJ 2HQXA 2M45A 1SHGA 4AFSC 1VYVA 4A4EA 5GAOl 2AXLA 2IGOA 2XAQA 5F64A 2B7EA 2FZKB 3QP6A 3DLAA 3WGIA 4I2OA 3MKDA 2AO9A 3EG0A 1AVZC 3L2RA 2OTJA 2JTMA 1KZHA 1HLVA 4IUQA 3SXYA 3GTQJ 1QVTA 3E1SA 5TRDA 4FW2A 3LAJA 2L8DA 2X48A 2DDBA 2EBPA 1EH8A 2P81A 4HF1A 2Y90A 4QWQA 1FWZA 2F5DA 4G9YA 2CZ7B 1U5TC 4M9ZA 2KT1A 1XMAA 2OCEA 2EIFA 4J9IA 1KD1C 2X4JA 1I81A 2O8KA 1WHLA 3CCJQ 1K73R 2JQ7A 4ZZLA 3P8BB 1TNSA 2FXAA 2RDPA 4ZTJA 3FRNA 1GCPA 3I55Q 1UMQA 3CCUI 5DS9A 3TW6A 4BY1J 4BQAA 2JA2A 2JW4A 2CQKA 2J6OA 2XV4S 2KKOA 1W7PB 4KUDK 4N0AA 1D0XA 1K83J 2Z16A 2A69F 4GCVA 4MQVA 4HQEA 1FMVA 2E6NA 2JS0A 5GAN6 3J80E 3DPTA 3CC2A 5CQGA 1Q7YR 4HOBA 7AT1B 2ZSIB 3DLLA 5L3BA 1RKTA 1ZKGA 3FC3A 4IHXA 4FIBA 3V7CA 3KLOA 4A4GA 3TP0A 4LLLA 1U1SA 3GUDA 1ZYRF 3C0CA 4D0PA 3G73A 4LLNA 3REOA 1SKUB 5FU7B 5FW9A 2E5QA 4L6V5 2X4HA 4RG8A 1DPRA 2ELKA 5K5RA 3Q9VA 1J2XA 3TQ7P 4A3GJ 2XD0A 3LSJA 3PL8A 3BC8A 2R5AA 1SD6A 4LNPA 2KQWA 1MKMA 4AIHA 5F0HA 4Z89A 3GOXA 2CWEA 3HP9A 5IN1A 1OV3A 3AHUA 3OYLA 2KT0A 2ACJA 2D0QB 2J7IA 2GOXB 2FPEA 4UNOA 1JU5C 1I4K1 3PVQA 1IGUA 3HFNA 2M4KA 3QIIA 4F55A 1MH4A 3HC7A 1K8AC 2P0QA 3FJ5A 3X2QH 5J4YA 2HQRA 5GAN5 1LVAA 1VQMQ 3VDXA 1UEBA 2CP2A 2V8KA 5KYWB 4ASNA 3OS1A 4PL6A 5A2QZ 1IZ1A 5IYBJ 4PSXA 5L3EA 3H9NA 2BW3B 1YJ9Q 2XIDA 4RTVA 4E7JA 1LE8B 5GAN8 3ASOH 2QSFX 1VQNQ 2MH2A 1T98A 4GRIA 4A3JJ 3CC4I 1JXOA 1V5FA 4KT0E 1YHQQ 2GBYA 1QA6A 4M72A 2PX9A 1ZRFA 2FOWA 1AD5A 2DRKA 4QKUA 4CC3A 2BY2A 2CT4A 1W1FA 4FSSA 2CQNA 2ZC2A 2ZBKA 2O61A 4OB1B 4J6WA 4L0ZB 3MZHA 5I2SA 2BXYA 1P4AA 2EB7A 2QQAA 5M5WJ 1KHCA 3OY9A 5GTHC 4MZPA 4LD9K 1BJZA 2WB1N 5L3FA 2LZ6B 2B86A 2DYBA 3HRUA 2C0OA 3SEQA 4BJ6C 2EFNA 2KZGA 2EA2A 5CR2A 3M0RA 4IIOA 2IAIA 2F5EA 3K1PA 1HCRA 1OU8A 1ETQA 3BDDA 4BHPA 2AZVA 2X3XD 2YUNA 2MCNA 2RNJA 5KYNA 2BE5F 3WG7H 1A04A 1ZG3A 3VSKA 1QWEA 5LJ3e 3OA6A 3BDUA 2QEXA 2DT6A 5IHNA 2A6EF 3BR6A 3WTYC 3HSRA 4A3DJ 3FBIB 1EF4A 3BCAA 2HVQA 1HDPA 2DMPA 1EV7A 1Y1VJ 4M78C 1MBFA 1RKWA 3J81Z 3KPHA 2H8RA 1AEYA 1KQSA 2JUGA 4Q48A 2JN6A 2COZA 2EFIA 2B8AA 1EH6A 4FE4A 5HDNA 2JN0A 4DA4A 1MZBA 2MLKA 3KX2A 3NGPA 5AT1B 1RRJA 4WXHA 2VIXA 1W0UA 2DQRA 2IRFG 3OS5A 1X2QA 3VUZA 2MAMA 3FHZA 1VQ9T 5E8IA 1VQPI 3TO6A 2L3PA 5LJ3h 3DFGA 2CYYA 4IRIA 4C0ZA 2RM4A 4UVCA 2K6DA 4JJDA 5IP6A 1QCNA 1UZCA 3EGUA 2EPFA 5LGTA 2R7TA 1B3QA 3MEVA 4TVRA 1ZK8A 4DZPA 2EZLA 2DA1A 3SEMA 2CREA 2NYXA 2HDWA 3OMYA 1OI1A 2P6TA 1R4NB 3BR1A 3F3XA 2JA5J 3ZBDA 4NL3A 2JZ2A 3KP5A 2YXYA 3EG9B 2OI3A 3META 4JJNK 3CC7I 2M3AA 3R0AA 4E7LA 2EYYA 2P5VA 3K2AA 1J7KA 1FC3A 3QOPA 4EATA 2R5YB 1S7EA 3CJNA 1IB8A 2RQTA 3PIOA 2B63J 2ZXJA 2DIGA 3EFRA 2UV1A 4I99C 1Y8RB 2CUDA 2VGNA 5HLHA 3PTAA 2DO7A 5EEGA 3CCLI 3LA7A 2M4GA 3QJYA 3CCVA 1OQKA 2E60A 2MABA 5ICGA 2FBHA 4RB1A 2OX7A 1MW7A 2DW4A 3J80K 2XHCA 2G0EA 2DJIA 2OZUA 3P9CA 2F5TX 2WSEE 3PO2J 3KXTA 1PNJA 2DXUA 1Z9QA 5FU6B 5A0LA 3ULQB 4XKBA 2ZPIB 1Q81U 3JCUC 2DJNA 4CZZA 4IO9F 3CCQA 1P4WA 1ACMB 2LMDA 4CA0A 4B4CA 3MP6A 3I56T 3WU2C 2CT3A 3QZ9B 1D09B 5ERIA 1BR4A 2MWOA 2K9GA 3GP8A 3D5RC 5BPIA 3M5AA 4J9GA 1AHDP 2MC4A 2KRNA 2RC4A 1DGRM 4KYWA 2RHZA 2YLCA 4KN7X 2VB6A 5CK9A 1VQ5I 3EG1A 1OCTC 3GPLA 1GXQA 3RDVA 1W4MA 2DVEA 3CPWP 4LMYA 2QLZA 2NS7A 3V8JA 3EFOB 4XRSA 3LW5E 1TH7A 4GBQA 3CLOA 3HXLA 1QZYA 2JRMA 2K79A 3CCET 1A36A 3M9QA 3ASKA 3C94A 3FXMA 1WPKA 3RMQA 3ZCOA 2NS0A 1J09A 2AHQA 2QQ9A 3BQZA 4A93J 5LJ3f 1N6AA 3VWBA 3O8HA 5JR3A 3WGHA 3LLRA 2VE9A 5C4JJ 3M0UA 2W10A 2K9LA 2HI3A 2Y69H 5AONA 3T0YA 4I0AA 3QYBA 2YHTA 2EGEA 1RACB 4CRIA 3OB9A 1PJRA 1V5EA 5FROA 3JCMV 2DYRH 1VQLA 4RTUA 4AFQC 5GMKh 1K9MC 2GIZA 1A6IA 4LE9A 4BI3A 4KIFA 3EYIA 2F48A 3F6VA 4F16A 1S72I 2DTRA 1ZELA 2EFPA 2HYGD 3FXQA 3CCQI 4IHYA 2L0AA 2Y0SA 3LSKA 2FF4A 2P0KA 4RAZA 1IUFA 5KYWA 5GAOm 2NUPB 2YUPA 4PKCC 3CCRI 4A6EA 3EPZA 2E5ZA 3ECOA 2BW3A 2F4IA 3I4MJ 1BKBA 2HEQA 4FT2A 4L9JA 2FNPA 1UDLA 3BG9A 2BTTA 5BNGA 1JBMA 2M1HA 3KE2A 1ITYA 1UFFA 1UG0A 3I0TA 4Q47A 4J01A 5CVUA 2XUBA 3DEEA 2MWPA 1YIOA 3Q0WA 1OULA 2QA4I 3RZDJ 2OBPA 1VQ7I 4XU2A 1U5TB 2VBWA 2WACA 4B6MA 3MFKA 2K2MA 2HS5A 4A69C 3M1CA 3HOXJ 2P7VB 1NBEB 1SFXA 3LYIA 1WJBA 3HOTA 2WWYA 4BE0A 1WXBA 2DTOA 1EKEA 4NL2A 2QK0A 4C8QF 1X1AA 1OKRA 2NS8A 2KBTA 3H0HA 3HSEA 1QNTA 5J40A 3H0FA 3L2ZA 4FT8A 3OOPA 1HJDA 1QU3A 3OS0A 2RH2A 9ATCB 2CSOA 2H3EB 1E2XA 1YIJQ 2O2OA 1Q81C 4OMOA 4QQ6A 3JCMP 4XNFA 3R6SA 1ZQ3P 2KIMA 2XGCA 3QODA 1OU9A 2DK8A 2QAZA 5GAN4 3CCVQ 3F22A 2DA7A 5K7FA 4ZGDB 4AVZA 1H641 2LQNA 4YELA 3BOQA 4CC4B 4X1EA 3CMEA 2ETHA 3DTEA 3QRFF 3RBBB 2A08A 3CCST 3I35A 1HW5A 4XN0A 4S05A 4E4HA 3HTRA 2GFAA 5J1UA 2EVRA 4BH9A 2K3FA 3CCJT 1M8VA 4RM3A 1K4US 3BR3A 3I55T 3LSPA 4X9DA 4OOIA 3Q0UA 1YCYA 2BZYA 2KIQA 5J1RA 4ZGEB 2ROLA 1FP1D 2XU8A 4D9JA 1K0XA 3ZQHA 1R1UA 3F0CA 2V26A 1R5HA 3J80Z 3G71I 1ZSZC 1TT5B 3NEUA 1XD7A 4YFKF 3UR3C 4OMLA 2L7ZA 4B48A 4PJOF 4C2TA 2V6EA 4HRIA 4C9YA 1IN4A 2Y31A 2ISZA 4RTWA 3MN2A 2KNBB 3MD2A 3A8MB 2HEOA 5AYFA 1PCXA 2FU4A 1SVOA 4AIKA 2JTFA 3URGA 2P84A 5BQTA 4IF4A 2JTVA 3GFJA 2CW8A 4XBFA 3A01B 1SMYF 3VEPA 1UG2A 5D5VB 2Z33A 2EQMA 4JRIA 2JS2A 3ZL7C 1M90C 5C44J 1FMKA 3A02A 1RUOA 2VKVA 4UUSA 1Y0MA 2X85A 2W84A 2KRHA 4DNCA 5B66C 1TQPA 2X1DA 3G1MA 1W36C 6PAXA 2CS7A 1MJAA 2DF6A 1B9MA 2LNBA 1M2VB 4ZN1A 4ORZA 3CCUT 4B9XA 4BE1A 5D5XB 4IHTA 5F04A 2HBPA 3QOEA 1ETVA 1VQLQ 5LJ3g 2DZ9A 2F69A 1K7AA 2X6OA 1ZAOA 4HCCA 1R00A 4XK4A 1KYWA 2EV0A 5CKBA 2JUCA 1K6OA 4JZ3A 5IXFA 1VFCA 1AOJA 2EIJH 3IAS2 1T0FA 3IV5A 4CHUA 3NMZC 2EK5A 1W2BP 1RR7A 4KMFA 1U0JA 5JHUA 3PE0A 2PG4A 3EG3A 2JSCA 4C8QD 4C92A 1VQNT 3M3YJ 4N9IA 3ZEHA 2E34A 2EINH 5ICEA 2VBXA 4M7AC 1K4TA 2DPDA 3H36A 4CUGA 2D5VA 1BIAA 1R0BG 3B73A 3HTUA 2P0WA 3LH5A 3PUBA 2VE8A 1AU7A 1W5SA 1LCKA 3QDFA 4M73A 1ZLKA 2CJJA 2R93J 1VQKA 2F6CA 2ZSHB 2R7XA 3F72A 2BXZA 3W6JB 3V8KA 5CKHA 1RAHB 1YNZA 4KT5C 3KEQA 2DAOA 3A4CA 3VYSB 3C4SA 3QU6A 4XTZA 1WRJA 2DPPB 1D1CA 4MEYF 3K69A 1JKRC 4XU1A 3A8GB 1BBYA 1EIFA 4M7DA 3DWLE 4GXOA 1MMDA 2CFXA 1GT0C 3BY7A 3OSVA 2R7RA 2EYQA 4BUPA 3JRBA 3OYEA 1IHVA 1M30A 4Y91A 3H3VK 1O7LA 3M8JA 3M55A 2KRCA 1TXQA 2HQ5A 2UUZA 2COMA 3GNGA 4I6ZA 4G6TB 2JMWA 1PWTA 1ETYA 2DA3A 4PCQA 4RTZA 2VKDA 1K6YA 3ZXSA 5L8RE 3H5AA 1NPRA 3A8HB 3GW2A 1VQOQ 4PJOD 1I5OB 1Z6RA 2F5KA 3AL0C 3GTPJ 3FB9A 4H4KC 2LKPA 3I9QA 2M16A 2A05A 4XICA 3W2AA 4JX5A 1X01A 2IS1A 2P8TA 3S6WA 2BKDN 2XPVA 4DJAA 2KAFA 1WQ7A 3TO9A 1KQSS 4G7ZF 2J06A 4GLKA 1P9QC 3P8DA 5L3CA 4A4KA 4IUVA 1FT9A 2R5ZB 1R5ID 3E7LA 2JSPA 2WV0A 1SFOJ 2OAWA 2RJDA 2WV1A 1RLPC 4HNUA 2NVTJ 3V4GA 2L3QA 3IAM2 2KISA 3FXOA 3CMAQ 2HKOA 1R77A 2EV5A 5IYCJ 4M6YA 3TDUC 2KXCA 2DOFA 3NRVA 2M87A 2HQNA 2QBYB 2DOEA 2L7MP 4ANJA 2R0QC 1VQ6I 4LIUA 1KQ8A 2YDLA 4F7UB 3DKWA 2K3YA 2VGMA 3DCFA 4A3CJ 3M8EA 4UV9A 5GPCA 2DVJA 1T56A 2BY1A 3ABTA 1M3BA 2CZ1B 5D5WB 3JREA 2JUFA 4DYQA 4CC2A 1AOYA 4LN2A 2WAQA 4UXNA 3FLGA 4BACA 1ZG1A 1UGVA 4J7FA 2ZMEA 2ATCB 4XRMA 3FDYA 2ZFWA 3FMQA 5D4SA 1PKTA 2V1NA 1N9SA 1X6OA 2RNAA 5DCMA 1VQ8A 3HRSA 2MW8A 1WSUA 4PJNA 1T0HA 4Y17A 5EGOB 4BBRJ 4CCOA 1VA7A 2W7NA 2I0NA 3REAB 2TRTA 3K4LA 4DQ2A 3GYHX 3NTHA 3UT1A 4LDXA 1FIPA 2ZXHA 3M8FA 3BCBA 2ECZA 4XLNF 4EPCA 1YJWI 2WAEA 4EV0A 2FVUA 5DLOA 3EQLF 5FLXE 4ZC3A 2DMUA 3DPUA 1UHSA 3EDPA 3EUHA 4EM0B 2X4YA 5FU7C 1WGSA 4KT6A 5GANd 3X26B 1TUGB 2PJRA 1WKMA 2E5KA 4F04B 2HZTA 4BBSJ 2C0IA 2GFUA 4NQWA 3H0IA 2K9SA 1H8KA 1Z1DA 2NLUA 3DKYA 3WXMB 1X4PA 3GTJJ 5LGNA 3PSIA 5DEQA 4XTWA 1OCPA 4BAYA 2L3SA 2LH9A 1CF7B 2HSEB 3U23A 1VQ9I 1R23A 5E1WA 1J9IA 3WHBA 3K1NA 3OSFA 2QYZA 4C0GA 3GZ5A 1IJWC 4IRGA 1K4SA 3G2BA 4P9UA 2YRDA 5IHKA 3WU0A 1EFNA 3AFHA 3QG1A 3DKMA 5DD8A 4HF2A 1RI0A 2HL3A 2PMZN 5IAYA 1R0CB 2CV0A 1YWOA 2K4BA 1FTTA 1ZHIA 1M1EB 2HOEA 2Y75A 2Z3YA 1GFDA 4Q5WA 1GUUA 5CLSA 4IRHA 3OSGA 1A5JA 3E6MA 2GXBA 3LWIA 1N8RR 2E12A 5EG2A 4M71A 3KZZA 2EFWA 1WJCA 2KZVA 1WDXA 1OFCX 2KPMA 2FQ3A 1FSEA 3S16J 2YX4A 1KG1A 3GFLA 4BQQA 5IY5H 2LP0A 1GRIA 3QP5A 4PFOA 1TP4A 2CMPA 2L9NA 2QQBA 1LDKB 3K6GA 3LGFA 4JLGA 1B59A 1BW6A 4YIRX 1S29A 1VOMA 3LWFA 1OYIA 1U9OA 3C2GA 3HJEA 2OTLQ 1WH5A 1HF0A 1XQHA 4M77F 3H92A 5HDKA 4KIBA 3PUFA 5D6EA 1JHHA 2CW0F 1RADB 1ZGJA 2EIKH 4F14A 4F7ZA 1ZR2A 5FWBA 4WXDA 4BQNA 4CC7A 5IH2A 1FZPB 5GTIC 4C2UA 1QLYA 2L7FP 4TV7A 1YYVA 2O9VA 4M78A 2D8HA 2KVQG 5DTDA 3JCMW 1YO5C 1OCCH 1XS9A 2RK1A 3DF8A 4ENMA 3I56I 2YPRA 2CKKA 5I11A 4PJOB 1P4XA 4EVIA 3L9FA 1TSFA 1QVGS 3CXCS 5CQXA 1LUJB 2M5WA 2A6HF 2EQRA 5LEKA 2RQVA 1QKXA 3JAME 1BL0A 2A0FB 4CDGA 2QVOA 3S8PA 3U21A 2F2XA 2LQWA 1QO0D 3FDRA 1MDMB 1PP8F 1USTA 3IH2A 3NFCA 2FPDA 3BT9A 1ZSZB 2O88A 1FOXA 3ZQFA 3L1PA 1T3LA 4FYVB 3WVEB 1B72B 3TDZC 1TNTA 3BG5A 2L54A 2DBMA 3CCEI 4M9SA 5FB2A 1D5VA 4XTUA 1PUFA 1VQ8Q 1NG2A 1BM9A 4IKFA 1UGQB 1SD5A 4CO8A 4M7AA 2A5WA 2XKOC 2VVKA 1VQ7T 3L09A 2GCXA 1IREB 4V2GA 1YW7A 5DLQE 1BBZA 4QPOA 1SSHA 2JNGA 4LDUA 2PTKA 1GDTA 1HXDA 1MGTA 1OYWA 3KFWX 4J9DA 2M30A 3O2PE 5HOOA 1HOMA 5KE2A 1KD1U 1ODDA 5CQEA 1IUYA 3KBGA 4RGUA 1QVFP 1G3WA 2R5ZA 2XDPA 1KHIA 5HNHA 4J83A 5HODA 4A3KJ 1YRNB 1PD1A 2DL7A 2NUTB 1TWFJ 2XGXA 4AM3A 2Y4XA 3I54A 4A63B 4RMOA 4B09A 4XORA 2MBFA 1A0NB 3EAEA 1RR8C 1QQIA 3RDIA 5L3DA 4QPQA 1ON2A 4D5CA 2FOKA 3J7YJ 3OYAA 1REPC 3MKWB 3QJ6A 4CYCB 4OB0B 4HA8A 2KJBA 2VN2A 2XHKA 3M0TA 5KYUA 4AMCA 1DUXC 3M07A 5FLXK 1TUCA 1W70A 2K5LA 3G4SA 2ZFUA 3K2ZA 4HV5A 4S0HB 5J8FA 2KGTA 2YRVA 2QKMB 3PNTA 3QWYA 4PLIA 4RCCA 5M5XJ 4IQ4A 4JX4A 3G7ZA 3MO8A 2K3XA 4M77D 1M1KU 3Q0VA 2EQJA 2E5NA 4BY6B 2KIUA 4YIFA 1F9NA 3N5BB 2ZPEB 3LMMA 3Q3SA 5FD5A 1Y56A 4AVPA 2RI2A 1I5LA 1RZ4A 2YT6A 5I21A 5HDGA 2H27A 4WF2A 5EDNA 3PNYA 1O4XA 3I4NJ 3PMIA 5CO7A 4DZJA 1GXIE 3D5LA 4BXFA 2DO3A 3FHNA 2VXZA 2XB5A 2K57A 3PO3J 1NG6A 1H8AC 2DPUA 3CCUA 5H6RA 3T8TA 4EJOA 3MKYB 1RABB 4IHSA 3E0JB 4OIOF 2EYXA 3E97A 3CCSI 1TBXA 2VXEA 5D6YA 4MFEA 1QVUA 5C3EJ 4GGGA 1OPLA 5DYMA 3CCJI 2OAZA 4ENJA 1H88C 2HZYA 4B47A 2BZXA 4DYRA 3I55I 4XSXF 3AL0B 3WVDB 2RVCA 4MFDA 4XMYA 5M9OA 1YJNA 2M02A 4D8DA 3MVPA 5L23A 3JRZA 1AA7A 4C8QG 2VUMJ 3OYMA 4E2FB 2MC3A 2LDUA 2L9VA 2M0OA 2ESHA 1X19A 1KFZA 1VYUA 2FO0A 1Q82R 1CGPA 2P5KA 1MV3A 4OVAA 2EV6A 3GLLA 3ZQIA 2LNVA 4OMFB 2I5UA 5J3LA 3VYUB 3P9IA 5BS6A 3PJRA 3CD6T 1WJEA 2R92J 3DU5A 4HX8A 2W00A 1RAFB 1U5SA 5GAMh 3OW2P 4UC4A 4IUPA 2J6FA 3UNGC 2CW7A 2IT0A 3M0QA 4M7DF 2MD0A 3L2VA 1WHKA 4P9FA 3TSWA 1JJ2P 2E1HA 4HNVA 2X6YA 4OMQA 5ED4A 3JAMK 4M78E 2BOLA 3TGNA 2JMCA 3UA6A 3KZIC 3I3LA 4OMMA 1NK3P 1M3CA 5EZHA 1WX6A 1RNLA 1D0ZA 3QAHA 4DYCA 2BYVE 2LKXA 4HSRA 8AT1B 1LPQA 3CC4A 4HT9A 4NDLA 2L4AA 2FMYA 1B9NA 3EH2A 1X6BA 1ZG5A 2LRQA 4BDYA 3QU3A 2X4XA 1IHWA 2XF6A 2V9VA 5C0MA 4NB5A 2A07F 4QQDA 1X69A 1AWJA 1YJ9I 3CMAT 1KU3A 4PJOG 3GFMA 3I64A 4X34A 2DE0X 2GNCA 4QT7A 5I2MA 1VQNI 4HZFA 3G6EQ 4GFBA 1WH7A 3LSIA 5FD6A 4OMYA 5KYXB 3L42A 5LJ5h 4BYYA 2JRTA 1XTAA 2LOOA 5HK3A 2ECBA 1IC8A 1YHQI 3BTJA 4N9HA 1YLFA 1UJYA 2LNHB 1LJ9A 3NPFA 1MDMA 1I0CA 4M75F 1M1KC 3G4SQ 3G1LA 2JA8J 5AIQA 1ORKA 1ZSZA 2CP0A 2DL8A 4KMUX 3S93A 4XM3A 3FMRA 4YEJA 3W2WA 1Z3YA 3FBNB 4Y7NJ 2BHZA 1NHAA 1J59A 1D5YA 1B72A 3WE2A 1I5ZA 4A3LJ 2F4MB 2KSSA 3ZQLA 4ZDLA 2V1RA 2KT8A 3KP3A 4M7AE 3BDLA 3I58A 2JOYA 3OIOA 3ZQGA 1VQ4Q 2D1VA 3SZTA 2F2VA 3ERMA 2ZCFB 1K1ZA 5HCKA 4ME7A 2R7UA 2AHJB 2ESNA 2IGNA 1AWXA 3ULRB 2CYZB 1K61A 2JA6J 1JI8A 2KDOA 1K79A 4YG2F 1X27A 2RREA 4ZYHA 4FYYB 1Y0NA 2Z1DA 2FX0A 4A6DA 1VQPA 2IW5A 5ILVA 1QZEA 1VQ6T 2Y2ZA 4NNJA 2JJ9A 3OWTA 4JQFA 4LLGF 2ENMA 4C92D 2PJPA 1XB4A 1MBHA 3RYPA 4FASD 1YW8A 3R4KA 1BC7C 3EHQA 1JE8A 4NOYA 3ABUA 3PMTA 1WPYA 5FJ8J 3OMGA 4F7UE 3HFOA 1MNDA 2M0CA 2O0YA 2MGQA 1K8AR 3P9KA 4W97A 3HDDA 3S15J 3CCMQ 4I01A 5LJ3j 4F92B 3CJTB 4FISA 2LF7A 3CUQA 1M2OA 2ED1A 1WJRA 2ED0A 1UB9A 1FNNA 1QVGA 1SEUA 4H0EA 2PUOB 1WHHA 3CC7A 4O3MA 2P4TA 1ZGAA 3CDIA 2DMOA 4ENKA 4CCKA 2YU9J 2NVQJ 2VV5A 4M7DD 4UVAA 4RTXA 2CS3A 4Y3OA 3B6AA 4BGDA 3CCLA 2AS5F 2EZKA 4M6VA 1JQQA 2QENA 2RKHA 2LF8A 5BPDA 2FEIA 2CZ6B 1ETXA 4MIMA 2OTJQ 1V54H 3KYLA 2A37A 3PM1A 3F6OA 2P5LC 1JJ8C 1JXSA 2LJ1A 3HSBA 3ONQA 2L4MA 2F5VA 3H5NA 4C3HJ 2SEMA 4N4GA 4E7ZA 1K9MU 4MEXF 4EJWA 2K85A 3NQOA 4PJ0C 3IKTA 2HQHA 4OB2B 3VJPA 4E6RA 2R7QA 3BROA 5LHHA 3FXKA 4XLEA 1XSVA 5TISC 4CXFA 1EA3A 4YRVA 2CUJA 2RMOA 4RB3C 2DMTA 2HWVA 3NHNA 2PFBA 1WIEA 1Y96B 1N9RA 1V55H 1IXDA 1WJQA 2CUZA 5J8CA 4MMLA 1SFKA 2K9NA 4RG2A 2OV7A 1VQ5A 5F1RA 2H6BA 1X43A 2M8GX 4PGGA 2PEXA 3SDGA 2QDLA 1FOWA 2Z0WA 4M75D 2LBFA 3VYTB 3T1BA 2KXDA 1TU0B 3QO3A 1MJ9A 1DJ7B 2AZSA 3CC2Q 2O5RA 3MCZA 3BJ6A 2LR8A 2DFFA 2KIFA 4M9XA 1PUEE 4MO7A 3RPUA 4AU7A 1SPKA 3X25B 1I3QJ 1LDJA 3HOSA 4J19A 2EZHA 4WCIA 3GF5A 4XLHA 5EF6A 3OQ5A 2AQFA 2X6WA 4KBMB 3JCMh 2DK3A 4HW0A 1E3HA 4J9EA 4L9NA 3VYRB 1X1CA 2LG4A 4K2EA 2A6TA 2D2WA 2VPRA 3JB9H 3GEZA 4IX7A 3CF5F 4AIDA 2DL4A 1GVJA 2WB1A 5KAIC 2E35A 3ZMDA 4DGWB 3VRZA 3GMEA 5GAN2 5LD2C 3QDRB 5H20A 3I59B 1N78A 3LA3A 5IT9E 2I8DA 1TT0A 2A3SA 2IEKA 4HDVA 3ABLH 1TWAJ 4HLXA 3S1RJ 3MP1A 1FP2A 1S72A 1YI2T 4EQQA 2HNIA 2RHYA 2KLOA 4UV8A 1YE9A 2STTA 2XAUA 3P5JA 5HS8A 1F1BB 1IRZA 1N5ZA 4P55A 3RTRA 2NAZA 3DB3A 4FT4A 5GMKj 3CCRA 1XMKA 1IW7F 1ZSGA 2LQ8A 5FKMA 3M0PA 3HGGA 1W7PA 1KJWA 1RAIB 1OZ3A 2HQAA 1VQPQ 4DBRA 2L2PA 4I0BA 3ME9A 1T8IA 1YWPA 2ZPFB 1AHJB 2BZTA 2DTIA 2LCCA 2R58A 2F5CA 1XC5A 2M2EA 4XLAA 1W5CC 3CUOA 3IH3A 3VFZA 2QA4A 2V1XA 2VPLA 1IRGA 4QIWN 1IRXA 3HHTB 3TREA 5GMKe 1VQ7A 1JB0E 2V6CA 2RK2A 1HW2A 4OP0A 2W0ZA 4GYIA 5ILSA 2E4HA 5CJ9A 2LFBA 4RMNA 5GAMd 1XN7A 4ITVA 3S2DJ 3HPGA 1X75C 4IJAA 3F8CA 4RGSA 4J00A 2PUKB 5GAMg 1AWWA 3THKA 2G6FX 1YJNT 1XDUA 2XGDA 2O4XA 4HCZA 1S5LC 3VOEA 1WFWA 1QCFA 1M90U 1HSTA 2ZGWA 2E1NA 2I10A
chains in the Genus database with same CATH topology
3GLXA 3OYFA 1N75A 1R8OB 4A4HA 4P1WA 3CPFA 1WQWA 3TEEA 2ELJA 3QKJA 4DOZA 4QVCA 4JRKA 1NJIC 4C8QC 4N4HA 2QQSA 3GNFB 5LJ5d 1Z7LA 5KCOA 2HVRA 2IS4A 3OBWA 4M77G 4KITB 2WBMA 3HPWA 3TL4X 5LJ5g 2R7VA 1U8RA 4RMOA 3G71A 1GLNA 4M78D 1YITT 2K5CA 2PVOB 2QI2A 2EQKA 4OGCA 5GANh 3DU6A 4IUTA 3H5RA 4CCNA 1OR7C 3M54A 2OUMA 3UDCA 4B9WA 1NG7A 2DAQA 4XK8E 4E47A 1BI2A 1QP2A 4M75B 3SDBA 4B44A 4MDWA 4RKUE 1WFXA 5TGTA 5FRNA 2PU9B 4EMKB 1OYXA 1N27A 3LWHA 5D6WA 4PJOC 4J7IA 2W4SA 2M9UA 1UB4A 2KY9A 4XL9A 5D6XA 3RQ4A 4D1QA 3ZQQA 4OB3B 1HA8A 4CSWA 3L2QA 1LNXA 2ZPHB 4XAXB 4JRPA 2RA2A 3CMMA 3UWNA 3ZRGA 4JRQA 2RO0A 4OGEA 2QTXA 4N4IA 2DXIA 1B34B 4PUSA 4PJJA 5KE3A 2XICA 2X6XA 1VQ4T 2VQCA 1WNLA 5GANf 1VQMT 1BI0A 1VZ0A 1G59A 3CJRB 4BL0B 3OYBA 1YJ9T 2Z2SB 3OMCA 3J7AF 3IUOA 3M4GA 1YHQT 4MZMA 3E9FA 5CCAA 3JCMd 1QP3A 4DIQA 4XTYA 3JCMg 5J3BA 4C5GA 3CCMT 2EKOA 4BY6C 2JVHA 5KH6A 2LTOA 1VQ6A 3LSGA 5FRMA 1Q86U 4P5NA 4ZGJB 4MDXA 2OTJT 2K4YA 2E1MB 3CPWA 3S3NA 4N4NB 4NUBA 1YJWA 4NS5A 4Y4RA 1SAUA 3K10A 2WAFA 3PNWC 4MZTA 4XLCA 1KQ2A 3CC2T 2X4WA 1VQ9A 4OAYA 1D1BA 2IVWA 4HEA2 2WSFE 2DOAA 2DD4A 3KEYA 4M75G 2MYSA 4FSXA 2DXTA 3DB4A 5A0DA 3MCAB 3SZGA 4F91B 4Y28E 3QUIA 2Q2EB 4YTLA 3RESA 5GANg 4LITA 1BR2A 4XQ3A 4R56A 4ELYC 4C5EA 3SWNC 3O8VA 1Q86C 2RJFA 3I56A 3CPWS 1H3ZA 3RUXA 3ZGKA 2CV2A 4CCMA 3HRTA 4C8QB 5A0GA 2DT7B 2VLAA 4LDVA 2DIQA 3GBGA 1G5VA 3HUGB 2QEXT 4M77C 3P8HA 4PLLA 3CCEA 2EQUA 4C5IA 3OBYA 1KC8U 5HLTA 4PK4A 1LJOA 4IQJA 1NPPA 3SDZA 3OYIA 4X9CA 1VUBA 4EMHA 4XKVA 2WADA 1FMWA 3K4CA 3QYFA 2G3RA 2M7AA 5CKEA 2DZCA 5CKFA 1G8XA 1U1TA 4MLOA 4E7IA 2MF2A 3OL4A 3CZ6A 1G3TA 2QKLB 3DQVC 2LQKA 3RPUD 2HVSA 2E6ZA 2EJ9A 1G3YA 1W2BA 2EWNA 2RHIA 1YIJT 1X1BA 3QXEB 3VYGA 1M4ZA 3OIQA 3DTIA 3CCVT 2PMZA 4KULA 2VL8A 2QQRA 1X1DA 2KDSA 1BR1A 4Z02A 5GAN7 4RM2A 3SD4A 5J39A 1WJDA 1E0EA 1P92A 1K73U 4ZDPA 2MI6A 1VIEA 4JDSA 3CCSA 2DKGA 1Y6IA 4RCBA 3CCJA 2WA0A 3I55A 4F7UA 1UAAA 3NTKA 4OF1A 5DM7R 2E41A 2RJEA 3R6OA 4XU0A 2IG0A 3CESA 1QHGA 1KC8C 1XOVA 4HPQA 2VJJA 1VQLT 5CQYA 3RCOA 2CH0A 3J7AY 5HVQC 3EUKL 4ZYAA 3TCJA 3K70D 3RIRA 2LY1A 2A3LA 5GAMj 1W2BS 3CP2A 3NWTA 2OAUA 2R57A 4XR6A 3ER0A 2L2OA 4PSWA 4HKEA 1YJ9A 2R7SA 2UWMA 3OOUA 4C92F 1VQNA 5GAMe 2L89A 1YHQA 1M1GA 4J8OA 1Q82C 1NZ9A 4M7DC 2VQLA 3C12A 4XONA 3FJPA 2L5QA 5LJ5j 3BG6A 3H8ZA 4C5HA 2EJFA 2DCEA 2W1OA 3ZFJA 4EMGA 1QHHD 1VQOT 5HKCA 3CMET 4BI8B 1HK9A 1K73C 2O01E 2GQVA 2OC6A 3K4KA 4XN3A 5CVIA 3JSCA 5LJ5e 3L2UA 2FUG2 4LDYA 4LG3A 4C0DC 4NC8A 2K9MA 1MGQA 1Q7YC 1LVKA 4M75C 4FL6A 3V42A 4O6JA 4PJOA 5HY6A 4JS5A 1DP3A 2HD0A 4EMKC 4X0GA 3PFSA 3VU3C 5CKDA 2LDMA 4BQOA 3JB9F 1D3BB 2GF7A 3OR2C 5CAIA 2PVDB 1LFPA 3SWNB 2L3RA 1MMGA 2I2LA 4J6XA 4A53A 4P5OA 2XDDA 3VKIA 4KJZA 2RJDA 2E70A 3TMOA 3H6ZA 3OR1C 2XF7A 2D9TA 3EUHC 3HG9A 1KONA 3FIFA 2V8JA 3LL7A 4M77B 1LKXA 4EDUA 4BJ5C 4ZTFA 2DD5A 5GAMf 2KL4A 4HCBA 1ZQ1A 1JRIA 3W3CA 4BUGA 4A4FA 2VJ4A 4HNTA 3QHSA 3X24B 1VQKT 1YX3A 1MNEA 2R4GA 3X28B 4ELZC 4XQFA 4XTVA 3M57A 2HPMA 4RLFA 1PSEA 4E7SA 4U7BA 4D6WA 4FM4B 3VV0A 1QVFA 3T9NA 4CI0C 1WJ5A 4XLFA 3EFSA 1ZBXA 5LJ5f 3PFYA 4BS9A 2HU9A 3BW1A 3HPHA 2OTLT 2DJZA 2ZPBB 4VUBA 3OYYA 1KQ1A 3MEUA 3JCMe 3BFMA 4J6YA 1NJIU 3JB9D 4F52A 4C8QE 2E1MC 4BI4A 5C6SA 4BJTA 3DKXA 2BVLA 3OYDA 4M78F 4XOTA 2V9KA 3H9GA 4ZDOA 4II2A 5GAOq 4JS4A 1D1AA 2MMPA 3JCMX 1VQ8T 2H3JA 5GMKm 2X1EA 4XKCA 4BB7A 1YIJA 4F93B 2FB7A 1Z21A 1UELB 2XDBA 4PJOE 4BE2A 4B43A 3HL2A 3C95A 2WSCE 4M7AF 4HG2A 2IGKA 1QVFS 2IGMA 3CBOA 2HNHA 2BVMA 3PSFA 3OW2A 2RB6A 3OL3A 1ERDA 1JJ2A 4C92B 1D3BA 5J26A 4F3QA 4IURA 2XC7A 5GANj 3SWNA 1UGPB 1Z3XA 2K5IA 4F7UF 3CF2A 4LIVA 3JCMf 2M7BA 1OZ2A 5GANe 1Y7XA 4M7DB 2WY7Q 3V7RA 2HQEA 4M77A 3S32A 1Y71A 2RI3A 3C2HA 2L9SA 2VKHA 4N4OB 5HK0A 5GAOr 3EUAA 5LL6S 1BI3A 2LRDA 3LSMA 3TU4K 1UGSB 3Q1JA 1IZ6A 4C0DB 4FU6A 1WJFA 2M0MA 3K4NA 5CKTA 3LSHA 2HPIA 3F9KA 4PJMA 4NC7A 5JHFA 2HAXA 3H9QA 5KCMA 2EAYA 3LGLA 3NTIA 2FYKA 3K4BA 4M7AD 3LH0A 2DXBA 3OW2S 4A54A 3HKZA 1Y96A 1JJ2S 2CGHA 3CEYA 3CD6A 2VXDA 4AYBA 3QPHA 4N0AC 1VQOA 2X35A 2Y4YA 3AKZA 1I8FA 3G6ET 3FEOA 3HL8A 3CP8A 5CIUA 2HZDA 5DY9A 1NE8A 4LDWA 1V5GA 3IP4B 3G4ST 2PJRB 5CPRB 3MKZA 3CJQB 1BI1A 1V29B 4NQWB 3MEWA 2VQGA 3CMAA 4OWRB 2BIVA 2RQQA 2E64A 3DLMA 4JUVA 4MMKA 2XSJC 5GAOn 3F70A 4XU3A 3MMYB 3RMSA 3JCMb 3L2WA 3BG7A 2LT4A 4HT8A 3BLYA 3OSSC 3PIPA 1OLTA 2KMTA 3SEZA 3OYNA 1G3SA 5LJ3d 3H35A 4PJLA 3K4JA 4Y91A 2CFOA 3INZA 3V8LA 2R7WA 2K2VA 3RERA 3OYCA 3H0DA 3PNVA 3RKWA 3SFMA 2V4JC 4C92G 1S9HA 3KUFA 4II1A 2V7FA 3TBIA 2XF5A 3JCMJ 2V8IA 4M78B 5GAN3 3QYEA 2RNGA 2LC2A 3S3MA 1N8RU 3M4YA 3OS2A 1PYVA 4O5VA 3RKYA 4R55A 4BEHB 3DTKA 4M77E 5KHDA 3S3OA 4M7DG 4CZCA 1RL2A 1T95A 2XG8D 3A8LB 2FL7A 4II3A 2D6FA 3PT9A 2LCLA 5KNLA 3CC4T 1BYMA 4RLQA 3UPUA 1R6RA 3L1AA 4M7AB 2OTLA 3E9GA 2R5MA 4JOMA 3LFUA 5LFAA 4L59A 4PFPA 4M75A 3X20B 3JB9G 2LX9A 1YBYA 4Y33A 1DQUA 3M56A 4EMKA 2MFZA 2E10A 3OYGA 1O9SA 2EJGA 1W36D 1VQPT 4BD3A 3D5SC 2E65A 5GAOp 4CH7A 2R7OA 1MMAA 4OAZA 3M53A 1YI2A 2C06A 3QYHB 1WJAA 1N77A 1FXXA 2P0PA 5A2QE 3K4MA 2VYTA 2WY8Q 4KUIA 3QBYA 4IZZA 3CC7T 1B34A 1N8RC 3JB9I 4JLIA 1BIBA 3MP8A 3CCLT 2K3PA 1XNIA 1UGRB 2NOJB 3HKSA 2RHXA 1M5Q1 1SSFA 2PVGB 2KHMA 1W4SA 4DBQA 4E7HA 2A7YA 3V7SA 3K70C 2AQEA 3A1YA 4BU2A 5HNFA 3DPLC 3VUBA 1YJNA 3OYHA 4ZN3A 4KISA 3FKJA 3SYTA 1TZLA 5GMKi 3LX7A 1Y07A 2DTHA 2ZXIA 4GY5A 4E6KG 1VQ5T 1BOBA 3J81E 2LYCA 2FHDA 4C92E 2VJIA 3ZR8X 3QYGB 2X51A 3A2KA 4XTXA 2GOMA 1YX5A 2XK0A 2JVVA 4J5YA 1VIFA 2KK4A 1XTDA 3NWSA 3VYHB 1YITA 1DGWY 4M78G 3JCMc 3OYKA 2IXSA 1Q82U 4QQGA 2RI5A 2KMUA 4M7DE 3PGGA 2VQHA 4BEHA 1S72T 3CCQT 4L5GA 4CCLA 1O75A 2BUDA 1QVPA 3CCRT 3MHXA 2LC4A 3QZ5B 2RD1A 4FETA 2K5FA 4DOWA 2DXCA 3OYJA 2XDVA 2LT1A 4PNOA 1QW1A 2DEQA 2LVMA 3M59A 3JCMQ 4CCJA 1M1FA 2QA4T 3M58A 4M7AG 1Q7YU 2LY2A 4QW2A 1M9SA 2W82A 4M75E 2X1CA 1LOJA 4QVDA 2LREA 5GMKl 2ZPGB 3SB2A 3W2VA 4ATOA 5KCHA 3CBMA 2IS6A 2VXFA 2CZ0B 2PQWA 4E7KA 3G6EA 3OIPA 4C0FA 3N05A 2Q1ZB 3RKXA 5FU6C 2IS2A 2VUBA 2VJ5A 3VSLA 4F7UG 3H9JA 2RHUA 2YLBA 4DOVA 1T0FC 2VC8A 1PSFA 3CBPA 1MMNA 4BDZA 1X4OA 2RJCA 4C92C 1VQ4A 2VASA 3A5ZB 1VQMA 4V2SA 3I9V2 4R79A 2KQRA 3G71T 2JVGA 1D0YA 4B3XA 4QVZA 3QSUA 4HSTA 1K8AU 2XI9A 4ZJZA 4LD6A 4C8QA 4XOPA 3MEAA 2L7KA 4IUUA 3RSNA 2QXFA 4C30A 1MHNA 3E19A 3CCMA 4XKWA 3A8OB 2LBFB 2ZZDA 2CV1A 1WJSA 2KP6A 2QDYB 4U87A 1FX7A 2HQXA 4A4EA 5GAOl 2IGOA 3DLAA 3L2RA 2OTJA 2JTMA 4IUQA 3E1SA 2L8DA 2Y90A 1FWZA 2CZ7B 2EIFA 1KD1C 2X4JA 1I81A 3P8BB 4ZTJA 3FRNA 2JA2A 4KUDK 4N0AA 1D0XA 2Z16A 2E6NA 1FMVA 5GAN6 3J80E 3DPTA 3CC2A 5CQGA 2ZSIB 3DLLA 3FC3A 4FIBA 3V7CA 4A4GA 1U1SA 5FU7B 2E5QA 4L6V5 4RG8A 2XD0A 3PL8A 3BC8A 2R5AA 2KQWA 3GOXA 3HP9A 5IN1A 3AHUA 3OYLA 2D0QB 2GOXB 1I4K1 3HFNA 2M4KA 3QIIA 4F55A 3HC7A 1K8AC 2P0QA 5GAN5 3VDXA 1UEBA 2V8KA 3OS1A 4PL6A 4PSXA 2BW3B 2XIDA 4E7JA 5GAN8 4GRIA 4KT0E 1V5FA 4OB1B 4J6WA 5I2SA 2QQAA 1KHCA 3OY9A 4MZPA 4LD9K 3HRUA 3SEQA 4BJ6C 5CR2A 1YJWT 3VSKA 2QEXA 5LJ3e 3OA6A 3BDUA 2DT6A 3FBIB 2HVQA 3BCAA 4M78C 2JUGA 2EFIA 2JN0A 4DA4A 2B8AA 3KX2A 2VIXA 3VUZA 3OS5A 2MAMA 1VQ9T 5LJ3h 4C0ZA 2RM4A 2R7TA 4TVRA 3MEVA 2HDWA 3OMYA 1OI1A 3ZBDA 4NL3A 2JZ2A 3META 4JJNK 2M3AA 4E7LA 3PIOA 4EATA 4M7AC 2DIGA 2UV1A 2VGNA 3PTAA 2M4GA 3QJYA 3CCVA 2E60A 2MABA 1MW7A 2XHCA 2DJIA 2F5TX 2WSEE 3KXTA 2DXUA 5FU6B 5A0LA 1Q81U 4XKBA 2ZPIB 3CCQA 4CA0A 3MP6A 3I56T 3QZ9B 2MWOA 1BR4A 3GP8A 3D5RC 3M5AA 2MC4A 1DGRM 2RHZA 2YLCA 2VB6A 5CK9A 3GPLA 2DVEA 3V8JA 3LW5E 1TH7A 3HXLA 3CCET 3M9QA 3ASKA 3C94A 3RMQA 3ZCOA 1J09A 5LJ3f 2QQ9A 1N6AA 3VWBA 3LLRA 2K9LA 2YHTA 3QYBA 4CRIA 3OB9A 1PJRA 1V5EA 5FROA 3JCMV 1VQLA 5GMKh 1K9MC 4BI3A 1ZELA 2Y0SA 3LSKA 2P0KA 5GAOm 4PKCC 3EPZA 2E5ZA 2BW3A 2F4IA 1BKBA 4FT2A 1JBMA 2M1HA 1UG0A 4J01A 3DEEA 2MWPA 4XU2A 2WACA 3M1CA 3LYIA 1WJBA 3HOTA 4BE0A 2DTOA 4NL2A 4C8QF 1X1AA 3L2ZA 1QU3A 3OS0A 2RH2A 1Q81C 4QQ6A 3JCMP 4XNFA 3QODA 5GAN4 4ZGDB 4AVZA 1H641 4YELA 3CMEA 3DTEA 3CCST 4XN0A 4E4HA 2GFAA 3CCJT 1M8VA 4RM3A 3I55T 4X9DA 1YCYA 4ZGEB 2XU8A 4D9JA 2V26A 4PJOF 3UR3C 4B48A 4C2TA 2V6EA 4HRIA 4C9YA 3MD2A 3A8MB 5AYFA 2JTFA 3URGA 2CW8A 4JRIA 1M90C 2EQMA 1KQSA 2X85A 2KRHA 3EFRA 4IUVA 2X1DA 1W36C 4ZN1A 3JB9J 2CS7A 3CCUT 4B9XA 4BE1A 2HBPA 3QOEA 5LJ3g 2DZ9A 2F69A 4HCCA 5CKBA 3IAS2 1U0JA 1VQNT 4C8QD 4C92A 3ZEHA 4CUGA 1BIAA 2P0WA 3PUBA 1VQKA 2F6CA 2ZSHB 2R7XA 5CKHA 3V8KA 4XTZA 3A4CA 3C4SA 3VYSB 2DPPB 1D1CA 4XU1A 3A8GB 1EIFA 4M7DA 3DWLE 1MMDA 3BY7A 3OSVA 2R7RA 2EYQA 4BUPA 3OYEA 3M8JA 3M55A 2KRCA 2UUZA 3GNGA 4G6TB 2VKDA 1K6YA 3ZXSA 5L8RE 3H5AA 1NPRA 3A8HB 4PJOD 2F5KA 3AL0C 3FB9A 4H4KC 2M16A 3W2AA 1X01A 2IS1A 3S6WA 2BKDN 4DJAA 2KAFA 1WQ7A 1KQSS 4GLKA 4A4KA 1P9QC 3P8DA 2JSPA 4HNUA 3IAM2 4ANJA 4LIUA 4F7UB 2K3YA 2VGMA 2CZ1B 2JUFA 2WAQA 3FLGA 4BACA 4J7FA 3FDYA 2V1NA 1N9SA 1X6OA 1VQ8A 3HRSA 4PJNA 1QVGA 4CCOA 3CXCA 2W7NA 3K4LA 3UT1A 4DQ2A 3NTHA 4LDXA 2ZXHA 3BCBA 4EPCA 2WAEA 2FVUA 5DLOA 5FLXE 4ZC3A 2X4YA 3DPUA 5FU7C 1WGSA 4KT6A 5GANd 3X26B 2PJRA 2GFUA 2NLUA 3DKYA 3WXMB 1X4PA 3PSIA 4XTWA 2LH9A 3GIBA 4C0GA 3G2BA 3AFHA 3QG1A 3DKMA 1RI0A 5IAYA 2CV0A 1ZHIA 4Q5WA 3LWIA 2E12A 5EG2A 1WJCA 2KZVA 2KPMA 1KG1A 4BQQA 4PFOA 2L9NA 2CMPA 2QQBA 1LDKB 3K6GA 3LGFA 4JLGA 3C2GA 1XQHA 4M77F 4BQNA 4C2UA 4M78A 2KVQG 3JCMW 2RK1A 2CKKA 4PJOB 1QVGS 3CXCS 5CQXA 3JAME 3S8PA 3U21A 3FDRA 3NFCA 3WVEB 4XTUA 4IKFA 1UGQB 4M7AA 2A5WA 2XKOC 1VQ7T 2GCXA 1IREB 5DLQE 4QPOA 2JNGA 4LDUA 1HXDA 5HOOA 5KE2A 1KD1U 5CQEA 3KBGA 1G3WA 2XDPA 1KHIA 5HNHA 4J83A 2Y4XA 4XORA 3EAEA 4QPQA 3OYAA 3MKWB 3QJ6A 4OB0B