2L5QA

Solution nmr structure of bvu_3817 from bacteroides vulgatus, northeast structural genomics consortium target bvr159
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
142
structure length
142
Chain Sequence
MLKTILSIAGKPGLYKLISQGKNMLIVETVDAAKKRVPAYAHDKVISLADIAMYTDAEEVPLSEVLEAVKKKENGAVASINYKKASADELHAYFAEVLPNYDRDRVHNGDIKKLISWYNILVNNGITEFVEAPALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target BvR159
rcsb
source organism Bacteroides vulgatus
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 26
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2010-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18347 DUF5606 Domain of unknown function (DUF5606)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1650 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2l5qA02
2.30.30.730 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2l5qA01
2L5QA
chains in the Genus database with same CATH superfamily
2AKLA 3F8MA 3O8HA 3FXOA 2PVGB 1H9TA 2DO3A 3TSWA 3S1NJ 4J00A 2O2OA 4X34A 3GFLA 3ZMTA 4ESBA 1BI1A 4UUSA 4RLFA 1RADB 2KFDA 4LK1F 1UG2A 2HDCA 1QP2A 4BE0A 4M77F 2XSJC 3WE3A 3K2ZA 1K8AU 3TSZA 4J83A 3IRRA 4LD9K 4M6XA 2KAFA 3GZ6A 2YU9J 1X1CA 4XKVA 2IS1A 1TSFA 2K5IA 2W10A 2YXYA 1OCRH 4M7AA 3BZCA 1ZH5A 2W25A 2IA0A 1OYXA 4DA4A 4N9IA 2FX0A 1VQ8A 1IO6A 5K5OA 2JPBA 4LUEA 3L7WA 1VOMA 3CO6C 4A4EA 4UVCA 1H8AC 2LJ3A 5I22A 1Z9CA 3DTEA 1A31A 4M78D 3E6MA 1ZN2A 4XSXF 3M0RA 2JA7J 3BROA 4A5MA 1T95A 3GMEA 3MD2A 1LEAA 1VQ7I 3HEFA 4XICA 4B4CA 5IH2A 3SHFA 2E1HA 1NG6A 1B07A 3HOVJ 2XHCA 4M77G 2QEXT 2QF7A 4Z2YA 4D9JA 1G8XA 3ZMUA 1CSKA 1BJZA 4AYBN 1VIFA 2P5KA 4CICA 2RHUA 4M7DA 2LQKA 3ONQA 2RQWA 2HQ5A 2IPOB 5IAYA 1AWXA 1K83J 3PIPA 3ECOA 3CCQQ 3JCMc 2CQKA 5LHGA 2XDPA 1CF7A 2YDLA 4J6WA 2MC4A 5CYVA 3H0HA 3QPLA 2M0OA 4J8OA 1KD1U 2LK2A 3FZVA 4XLNF 1SG5A 2FU4A 4ZDOA 2C0IA 2KQWA 3OYBA 2OAUA 3AT1B 2VIXA 3M59A 1VQ9Q 2KJCA 3NAUA 4BJ5C 2BE7D 1VQMQ 3CC7T 1LVKA 2FMYA 1Z6RA 2QSHX 4RTXA 2FE3A 2L3DA 3UR3C 4EM0B 1OYIA 2LCSA 1HC8A 2COYA 1EV7A 1JTYA 3GX4X 1ZRFA 4IRIA 1JXOA 1T2KA 4E7SA 2R0QC 2F2XA 1I5LA 2O88A 1HA8A 2GWRA 3JCMh 1FSEA 1LE8A 1R00A 1KQ1A 3HRMA 3HTRA 1YI2I 1SD5A 3OW2S 1LFUP 4PFOA 4DOZA 3DPLC 4N4NB 4E6KG 1BW6A 2DQLA 3TDUC 3ZMSA 1IF1A 3OYJA 4C92A 2QEXA 5KE2A 4F7UF 4HT9A 2OTJA 1OQYA 2EQUA 5GTIC 3MEXA 2QBYB 1YJWT 4U7BA 1ETKA 2DFEA 2EV6A 3MO8A 3F0CA 4HF0A 2W85A 4FQGA 4ZYAA 2FRWA 5GPAA 1IDZA 3CMEA 2G6FX 3DV8A 3CC2T 3WXMB 2BW3A 1BCOA 5FLXK 1K78B 1P4AA 2X4HA 4KH1B 5GAMh 1YW9A 3BTJA 3HUGB 3ZGKA 5HDKA 2QENA 2DZCA 3OS1A 3J80Z 4OB3B 2ZAEA 2KI7A 4XLCA 2C06A 1X1AA 2DOAA 3ZEHA 3I5UA 3CCSQ 1IN7A 1AT1B 4RB0A 5EJCA 3ZR8X 3N97A 5HS9A 2M34A 4LN2A 3GTJJ 1HF0A 3S16J 2JVVA 1CQTA 2DX1A 4QSHA 3MCZA 1ZGWA 2X4YA 2XAGA 1YFNA 3JAMK 3O2PE 4MHGA 2MMPA 1KGSA 3GIBA 2ZSIB 1QGPA 4JRKA 3OL3A 1X3WB 5E18F 3ISPA 3JRDA 2NVXJ 2A37A 2KL4A 6PAXA 5GANg 4XU2A 2DK5A 2P4WA 4M3EA 5FU7B 3G71A 3CCLA 3OOPA 4DZPA 4J9HA 1VQOT 4CI0C 2OI3A 2E35A 2VB6A 2CT3A 4XQFA 4DOWA 1WQ7A 2IP2A 3JRBA 4F93B 4IUQA 1K78A 4CRIA 4B6MA 2PQ8A 1P7IA 4U0VA 2J5OA 1ZG3A 2DJZA 5GAN2 2KISA 1FOKA 3E2UA 3JSOA 1IUFA 3CCJQ 4PJOE 4XR6A 2M7AA 3CC4A 3FJPA 2MG4A 5HVQC 2CP6A 4NC6A 3K4CA 4KUMA 1M1EB 2JA2A 4D7NA 1BK2A 1LCKA 2NRAC 2OBPA 2ZC2A 1Y56A 5J4VA 3DTIA 4OF1A 4E7ZA 2YLBA 2DMOA 4YIFA 4IUVA 2FEZA 4BDZA 1WXTA 4JK1X 1VTNC 2WADA 1SRLA 1FEXA 1RL2A 1LDDA 4XAXB 1YIJA 1T6SA 2PMHA 2KT8A 4ZYEA 4B43A 4IHVA 3F8FA 1J75A 4IEJA 1MV0B 1SFKA 3MQ0A 2ACJA 2C6YA 4XSZF 3M1EA 3RCOA 3NPFA 4J9EA 1T0JA 4KH0B 1WH7A 2E7WA 2IS4A 3VYTB 1IB8A 1ZR4A 4QQ6A 1TNTA 4M7AD 1F5TA 2JA8J 5LLQA 1FC3A 3B6CA 3S1MJ 2CU7A 1XS9A 1R1UA 1ETVA 2K9QA 1CKBA 3O8GA 3TEDA 1PUFB 2V8IA 3FMQA 4D0PA 1IXCA 3OS5A 4FSSA 3KP5A 2XPVA 2RQTA 3FJ5A 1HDPA 1WHJA 3KEOA 5FFXA 3L2UA 4PJOA 1JUPA 1TWFJ 2ZKZA 3WTVC 1M1GA 3S3OA 1RLPC 3A8GB 4XK8E 2RGVA 1YE9A 1J3TA 2HYGD 3KEYA 3TW7A 3WG9A 2CZ1B 1XB4A 1KK7A 2M8EA 5B1BH 2QQRA 2BBYA 5D6XA 2VV5A 1I3QJ 2X1EA 3AHUA 4F3QA 2Q1ZB 3FM5A 3EHRA 3DB4A 5J4YA 4XL9A 3W2AA 3M4GA 2RHIA 4ABZA 3FXMA 3JCMg 4FIBA 1W5TA 3GBQA 4ITVA 2JJ7A 5EG0B 1IRZA 3K9TA 4H0EA 4NC8A 5DY9A 1BOAA 1VQ5I 3OYAA 1YIOA 4BQAA 4KN4X 4C92E 5M5YJ 1VQMI 5AIPA 1S7OA 2EWNA 1X6BA 2KRHA 3VU3C 4II2A 1XC5A 4UB8C 2IGKA 1LDJA 2KT0A 5A0LA 2EYQA 2XRLA 1E3HA 3D5LA 3M9AA 4RB2C 1OEBA 1V5FA 4KISA 3C12A 3ZQLA 4P1WA 1G3WA 2LR8A 3I59B 5FO5A 3P8HA 1LJOA 4FE4A 2ABLA 3MP6A 1DP7P 2WTEA 2LNBA 4YG2F 2P0QA 3CCRT 2PFBA 2XAUA 3CCET 3AG4H 2V1UA 3S2DJ 1YI2Q 5KVRA 3Q0VA 2O01E 3J80E 2FBIA 3T8TA 3OSGA 4M77B 1PC0A 1J59A 3QDFA 1GL5A 2DPUA 2DTOA 1Z67A 2RREA 3F21A 1XSDA 5F64A 2QQAA 1UGSB 2XDDA 1N8RU 4G6DA 1Y8RB 1TP4A 1ETQA 1PP8F 5F27A 2YRCA 4RTVA 2E1MC 1UELB 3IQLA 2FB7A 1A35A 1MGQA 1KG1A 1EH8A 3V7SA 4UC4A 1XCBA 2H8RA 1Y39A 3GF5A 4JQFA 4PCQA 2FNPA 4L0YB 5GAN6 1VQPT 1XGOA 2R7VA 5KYNA 4RBOA 1VQ6I 1JBMA 3VWBA 2AHQA 1OCPA 4KGVB 2X4JA 1OPKA 1YRNB 4XTZA 1B7TA 5EGOA 4XIDA 1HK9A 2LP5A 5EGOB 4I0AA 3GTGJ 1QQIA 2WY7Q 4AUXA 5IT9K 1F43A 4AIHA 5BS6A 1B9MA 1KA8A 2CUJA 3OYMA 2V1DA 1R23A 1T39A 4OMZA 1Z9ZA 2DOEA 3K1NA 3C1DA 3SZGA 4RMNA 1I1SA 3CBMA 1PWTA 5L3CA 4M74A 5HOOA 2BZTA 1UUEA 1O7FA 4FCYA 2ESNA 2CT4A 4AU7A 2DTHA 2EBPA 3PSFA 2KNBB 1BBZA 1YIJI 3UA7A 3HKZA 3NEUA 1LOJA 2IIMA 2PUKB 1Z7LA 3ABTA 3C2GA 1SAXA 2JA5J 3BG6A 4EMHA 2RJCA 3X24B 3M0PA 2VKHA 4M75B 2CUBA 2L9NA 5LGUA 3CMMA 2UXXA 4PGGA 4E7HA 3FXRA 1TW3A 1LVAA 3VEPA 2CMPA 2CW0F 2OZUA 2CW7A 1HXDA 2GBQA 5IYCJ 1HSQA 1E17A 2JTMA 1TWHJ 5K1YA 2K6DA 3CBPA 2IXSA 2NVQJ 4KGXB 1S72A 3CCEI 2K3FA 1D3YA 2OJED 3CCRI 3TO6A 1TT5B 4ENNA 2BXYA 1N77A 1T3SA 2QGGA 1S7AA 1Z1DA 3P8BB 1ZLJA 2EW3A 3KYDB 2I0NA 2F4MB 2DETA 4WF2A 3H35A 3LFKA 2DA9A 1RLQC 2J6OA 5EZGA 3W6JB 3QPSA 3EDPA 4KNYA 5CIUA 1RUOA 5D4SA 2FNAA 4NBQA 2QTXA 4OB1B 1AZEA 4C8QB 2DA1A 1WPYA 4J01A 5KE3A 2DFHA 3QWXX 3CC7I 1Q82U 1Q7YR 2QUFA 3I71A 3MP8A 2IGOA 4WK8F 2RHXA 2NNNA 4G12A 1O4XA 3HSRA 1HKQA 2GBYA 3EAEA 5E8GA 5GMKh 2DN0A 4OMYA 4WXCA 4W1UA 2JM8A 2OTJQ 4A6DA 5CR2A 2GZWA 1N27A 3DEUA 2X48A 2OC6A 1V55H 3BWGA 1MD0A 2KMUA 4XU3A 1MDMA 2EYXA 2DXUA 3NHNA 4M6YA 2XHKA 3CCST 1VF9A 3MEUA 2DJQA 2JK3A 2R3SA 2Y31A 2YX4A 1WHLA 1FPQA 3HHTB 4F14A 1XCVA 4FT4A 4AM3A 3NTIA 1DGRM 2F2WA 3EG2A 1JJ2P 2RB6A 4QLCU 4IIOA 3RKYA 3HDDA 3OW2P 2BY2A 4FYXB 2CG4A 2JNGA 2QYOA 3WTUC 3OYIA 1B6AA 2WC2A 1VQ8I 1VQ4I 2B9SA 3KXTA 4X9CA 4LNPA 3QQAA 2KT1A 4XRSG 4IUTA 2IS6A 1I8FA 4CC2A 1XTAA 2DT6A 2LRDA 3K1MA 2V9VA 2I2LA 2RJFA 3GP8A 4P55A 4AVPA 5ICCA 1KQ2A 2P5VA 4BXUA 4QQDA 2ELJA 1K6YA 2FHDA 1I1GA 3BFMA 3SWNB 3CCQA 3HG9A 1ARKA 5GPCA 4GBQA 4C8QE 4XOTA 3CCQI 1UFMA 2Q8KA 1WX6A 1P4XA 2RVCA 2HSPA 4BD3A 4I76A 2KQRA 1VQ5Q 1SSHA 1FBUA 3QYEA 2R7DA 1REPC 2DXIA 2F5DA 1K9MC 3G4SI 1QPMA 3JR9A 1M4ZA 5IN1A 3PNYA 3VYHB 3JCMX 1O3TA 5E17F 2LSOA 1ZRDA 1RACB 3D7SB 3RUXA 5KH6A 1UB4A 1Q81R 2EFPA 2ISYA 1VQ5T 4UB6C 3PNVA 2XGEA 2Y4XA 3LX7A 1P7JA 4MFEA 5B3SH 3O8VA 3EUKL 3G7ZA 2JUCA 2ZFUA 3C18A 2MAMA 3HKZN 2VE9A 1R77A 3LW5E 3OSSC 2RNGA 5FKLA 4C8QD 4ON0A 1ODDA 1WJRA 4AYBA 2V8JA 4D5FA 4J7FA 2PI0A 4YIRX 2R7UA 1IGQA 5FD6A 3MEAA 4VUBA 1KONA 2XC7A 4LDUA 4J9FA 3HYIA 5GMKj 3IWFA 5LD2C 2FEIA 3HM5A 3HXLA 3K4BA 5D6WA 4S05A 2ZFWA 2EAYA 2RMOA 1QA6A 4X1VA 2VT3A 4PLIA 1XGMA 4LDVA 5CO7A 1BR2A 4ATOA 3RESA 3E0JB 5K7HA 3QSUA 4M7AF 5CVUA 3FK7A 3BQYA 3GTMJ 1VQNA 2ESHA 4E6RA 3META 3VS6A 1Z91A 2D2WA 2XIDA 5CKTA 1FMKA 1FP2A 5HNHA 2KXDA 2PU9B 1JU5C 2FXAA 2K27A 1SVLA 3WVDB 2A6HF 4XLFA 2ED0A 4XLEA 3INZA 5GMKm 2F5VA 1NJIU 1RC9A 2LVMA 4BY6B 1RAHB 4MTDA 2HDWA 1K4TA 2AT1B 4V2FA 2D0QB 2RQRA 3VS1A 4ELZC 2HVQA 3JCMP 1YJ9T 3RZDJ 2YSQA 4IKFA 2VJ5A 2Y9YA 2VPRA 3WTXC 2X3WD 2K7AA 5JHFA 3MKZA 3BW1A 3RR6A 3A8HB 3PO3J 4WX9A 1IN5A 3AG3H 5H6QA 2MABA 2CWEA 4RCBA 4QVDA 2P0PA 1YIJQ 3V8KA 3B73A 1KZHA 4Y52J 1UB9A 1RAIB 4C2MJ 1AOYA 1WIEA 4ASNA 1IDYA 3B02A 3D5RC 3ULQB 1K0SA 2HZDA 2VC1A 2KYMA 1Q81U 2L3QA 4JJDA 3ZQIA 3MEWA 2VASA 2OA4A 2QA4I 3PMIA 1YI2T 3HJEA 3LAJA 2CGPA 1IREB 4M78G 3I56Q 1YITQ 4M78B 3CCRQ 3MFKA 1TS9A 5DCMB 5EEHA 3TQNA 2K5FA 1PKTA 2X9DA 3MVPA 1OOTA 2DFFA 2CQ7A 1I5ZA 2MLKA 3QWLA 3TOAA 3LSKA 5IT3A 3SXYA 1J7KA 1OZ3A 5GAOr 1S72Q 1FLIA 4A93J 2FZKB 1WYXA 2RQVA 4A63B 2Z99A 5GANh 1Y6IA 1FSHA 2EKHA 2K02A 1JJ2S 5AIQA 4J6YA 3CC7Q 1KU2A 1XMXA 4ME7A 3QPHA 4DNCA 1YHQT 4O5VA 5DYMA 5J40A 3JB9D 1X1BA 4EDUA 4J9CA 4BHPA 4KIBA 4RB3C 1IW7F 3JRFA 3EQLF 2OTJI 4HOBA 4D7MA 1OX9A 4UUVA 2J5PA 2X6OA 4EVIA 1IG7A 2LQNA 2K9SA 3EGXB 2QA4T 2HAXA 2EGEA 2BZXA 2MH9A 5D5UB 3CPWS 1N8RC 1EH6A 2GA1A 2P6TA 3LL7A 2HMAA 1N25A 1T0FC 1DUXC 4HVWA 2VKNA 5C0MA 1Z77A 2VXDA 1QBJA 2X1CA 3CCEA 4XOPA 3TVTA 4BQNA 1Q95G 2LTPA 4N4OB 4OMFB 2BW3B 5KCMA 1YN8A 2IVWA 1ZTRA 3MWMA 4QVZA 1WI3A 2GLOA 2GTOA 1AVZC 4DW6A 5KYYB 3KETA 2D5VA 1I3AA 1WHKA 4CZZA 2CV2A 1SF9A 2HEQA 3RKXA 2VKEA 3JB9J 3TDZC 4I6ZA 3S32A 3HHGA 1XGNA 2LNVA 1VQ8Q 3MKWB 3M55A 1K79A 4JS4A 1PVEA 3EUHA 1VQPI 2QKMB 1JO8A 4C92G 3JRHA 3M8EA 2EIFA 3E5UA 2MYSA 1OYYA 3S1RJ 2MIOA 1LNWA 3S6WA 2DXCA 5K5QA 2L0KA 3GTLJ 1UDLA 2X1DA 1JKRC 5HCKA 5M9OA 1WHGA 3O6BB 4BS9A 4KN7X 1ZGAA 4IRHA 2KMTA 5LJ5j 1NK3P 2HQNA 1OLTA 5LJ3e 4RGXA 5ED4A 5L8RE 1VQ6A 2QXFA 1QO0D 1Z7UA 4M7AE 3I3LA 2XGCA 4L5IA 4FE7A 1WJDA 1V5GA 3TKYA 1OZ2A 4P5NA 4NL2A 5GAEJ 4FW2A 4M77E 1ACMB 2DJIA 3A4CA 3BG7A 2GIVA 4L9TA 1ZG5A 1UGRB 4A4FA 1K8AR 3JREA 1SFXA 2XGXA 1LUJB 2XAFA 2F2EA 2Y48A 3LOCA 1YCSB 3PT9A 1P9QC 2EGAA 3OBWA 2AQFA 3J81E 3JCMd 4XRFA 1RI0A 4PK4A 2ETHA 2JTVA 1WJCA 5F0HA 4M3GA 2E6NA 4WXHA 5ILSA 4EJUA 1T08B 2DTIA 2R58A 1NG7A 1GV5A 4G94A 5FU6C 2HKNA 3TMOA 4CC4B 4D8KA 4RB1A 2AK5A 2R7RA 4AWXB 3CTAA 1D0YA 2UUZA 4HPQA 4FYYB 4I2OA 5F0CA 1MH4A 2GTJA 3BR3A 2PMZN 1HW2A 4M78F 2VC0A 1EA3A 4IL6C 4XU0A 3HHHA 2FRHA 4OB2B 2DZ9A 3COAC 3M4YA 4RCCA 1Q82R 3DU5A 1W70A 2EINH 1X69A 2EFIA 5B1AH 1VYUA 1MJAA 2QZ8A 5GAOq 4JBAA 1TUDA 2QTVA 4RGRA 2P4TA 2P6SA 2FZCB 3BTCA 5JLXA 1JUMA 2LKSA 2ZJPF 4ZGEB 2D1VA 4MZMA 4Q5SF 3L2QA 5FKNA 2V4JC 1MMAA 3PTAA 3CC4Q 3CF2A 4ESJA 1IZ1A 3EYYA 4LJZF 1R9TJ 2NUPA 3ZMDA 2NUPB 2DLLA 4WCGA 1E2XA 1VQOA 1VQKQ 5FROA 1QVGP 2EYZA 1NH3A 1R4MB 3MHXA 3G1JA 3OYGA 4ZN1A 4BEHB 3FRNA 1ZSZC 4HT8A 1LPLA 5F04A 5D4RA 4M75A 1QHHD 4CH7A 1Q81C 1ZHIA 2EJFA 2FPFA 4E47A 1Q7YC 4B3AA 3HRTA 1RAGB 3ZN1A 1SVOA 3PVLA 3ZQHA 3I56A 1YITA 2K40A 5JHUA 1GFDA 1S1NA 1WNLA 1BOBA 2DDBA 3BR6A 5DEQA 5KHDA 3PNWC 2FYKA 3R6NA 3I55T 1QZEA 4RG8A 1MBGA 2F6CA 2NXNB 3DEEA 2ELKA 3CQZJ 4XN3A 1ZR2A 1X43A 2O9SA 5GAN3 5IT9E 3KLOA 1FOXA 2EFOA 2FD5A 3NMZC 4HDUA 3K7AJ 1ZRCA 1EX4A 1E6HA 4GY5A 5GANf 4TV7A 2NUZA 1J9IA 3KP6A 3E6CC 1ABQA 2KZVA 2DFUA 3L2CA 1P2FA 5KNLA 1C0WA 2IT0A 4XTUA 1ZUKA 5LJ5g 4JX6A 1AKHA 2E71A 2E2JJ 1EJ9A 1VYVA 3VSLA 1SSFA 3K0LA 4ZNXA 1WJSA 1GXQA 2OD5A 2EJRA 5KAFC 5LEJA 4HSRA 2X6YA 3RTRA 1F4KA 1A5JA 2KRMA 3SWNA 1WWXA 3QP5A 4MZPA 4M7AC 2XAHA 2HKXA 3T9NA 3IHUA 4A6EA 5J1UA 2L9VA 3ME9A 4EJVA 3WU1B 3KP3A 1XD7A 2B63J 5ILUA 2QQ9A 1UG0A 2ZPGB 2WSCE 4M3BA 4F7ZA 3I0TA 4J5YA 3JCMW 2Z33A 2PVDB 2PN6A 3CMEQ 2FBHA 5GMKe 1K9MR 3BE3A 5BOXA 1HCRA 4JP0A 4ZC3A 1YS6A 1HQCA 2G9WA 2ZCWA 2ZMEA 2ZB9A 1XDUA 3CCUA 2LQ8A 2BZ8A 4XTWA 4A3IJ 3HFNA 2DAOA 3G73A 3GOXA 2AQEA 1P92A 4M6VA 3JRZA 1VI0A 3JCMb 2KDOA 4BY1J 4M78C 2RH2A 3CEYA 3LWHA 4PL6A 3I4MJ 2SRCA 5FB2A 3KPHA 2HEOA 1KC8C 5IHKA 2LREA 2R7QA 3CPFA 1WGXA 4FM4B 5LJ3d 3FF5A 4MDWA 5LJ5e 5AT1B 1YJNA 1OYWA 2GQIA 1YJWQ 2A07F 5C6SA 3QU6A 3M8JA 1NHAA 2P0WA 3D0SA 1A04A 4YFNF 3EGUA 4CCMA 2NVYJ 3BG5A 3JW4A 1SFUA 2HVSA 1MV3A 2VYTA 1V76A 5GAN8 1BL0A 2L89A 4BACA 3ZCOA 3OYYA 1J2XA 2DT7B 3FBNB 2L9SA 4EJOA 2XSDC 2G7HA 2LLKA 2EZKA 2ZMEB 3JCMe 1MH3A 4G6QA 4F52A 1EFNA 1LFBA 1PJRA 1V29B 3FDRA 3CMAA 3CDLA 3HOYJ 3HUGA 1JGSA 5BPIA 3ML6A 5HY6A 4EATA 3R4KA 5KYXB 2XI9A 3PIOF 5D6EA 5FLVA 3GTKJ 4OMOA 4UHTA 4L18B 4AFUC 3W3CA 3FBIB 3K4LA 3V4GA 3QJ6A 4IIMA 2Z16A 2KY9A 4J9GA 1VQLQ 2IS2A 4HW0A 2JSPA 3SDZA 4JX5A 1VQMT 2ZJQF 1MKMA 2LCCA 1QHGA 4MIMA 3A8OB 4HVVA 1VQ9T 3FC3A 3A01A 1RR7A 2ECCA 2WAQA 2K3PA 3RKWA 3RI4A 1XNIA 2QEXI 2ZZDA 1ON1A 3SZTA 3A1YA 1RETA 2L01A 3BCAA 1WQWA 4N4GA 3F8NA 3TP3A 4JJNK 1U8BA 5J6XA 3DLMA 4R55A 4Y7NJ 4XRMA 1FYMA 1GVJA 2B0LA 4RTYA 3L00A 3KYCB 1HSJA 3A0BC 3QYGB 8AT1B 2F4IA 1Y7XA 1OU9A 3CCJA 2RM4A 1VYTA 1TW2A 5GMKi 1FY7A 3E5XA 2J06A 2VLAA 3JB9I 1Q86C 2W00A 3K4KA 3GYHX 4MQ9F 2RNAA 4CO8A 2QCOA 1TZLA 3CUOA 3FHZA 1HDDC 2LD5A 1S9HA 4GFBA 2CP2A 2CYYA 3OOUA 4C0ZA 3FXLA 4FT8A 2OAWA 4LITA 2DMPA 4HV6A 2BUDA 4EGZA 3SHWA 5K7ZA 3OYLA 5J39A 1ZK8A 2VQHA 3LSHA 2XV4S 3PQJA 4QTRA 2DPDA 1XOVA 2XVCA 4M78E 3OA6A 3PJRA 3DEWA 1MNEA 5D5VB 1V54H 2CUDA 4M77C 2YT6A 1K8AC 2EH3A 2HCKA 2QDLA 3HC7A 2YX7A 5JI6A 5HDNA 2JVGA 3BZ6A 1X2MA 4M9XA 2YUQA 1K73R 1OU8A 3EUAA 4MLOA 1HD3A 1YP5A 4MNUA 4OU0A 2CP7A 1WFXA 2WB1A 3M9QA 4IJAA 2X51A 4J9DA 4M7DE 3R6SA 4YEJA 2V1QA 4FW1A 1N8RR 2EVRA 4OGCA 1KQ9A 1USSA 3IL2A 1UTIA 5KYYA 4WCIA 2KGTA 1MZBA 4HX8A 2OX7A 2DNUA 2XG8D 2JW4A 1PUFA 1XJWB 4XKCA 4RM2A 8ATCB 2RA2A 2E1OA 2QQSA 1YG2A 4A3GJ 3DPUA 2WAFA 3K1PA 4M9SA 3BT9A 4PJOF 3MCAB 2IPQX 5IYBJ 1W36C 1QZZA 3A02A 2EFWA 3EGXA 3OMCA 3V7RA 3J7AY 2QA4Q 2LFBA 3HIFA 2M9UA 3VS2A 1VQLA 3G1LA 2DYIA 2M1BA 3CCQT 1Q82C 3EG3A 1DDNA 1ZHFA 2AO9A 4BHBA 2M7BA 1QQJA 5LEKA 2XMFA 3GCMA 5CKDA 4YTLA 3W6KB 1AHJB 2RNJA 4J9BA 5FU6B 3M0TA 2V9KA 5EEGA 1OMIA 3SZPA 4CYCA 2RAEA 3K6GA 3ZQGA 1SFOJ 3AG2H 2P8TA 2ZNZA 3CZ6A 2LY9A 3GBGA 3ROUA 3CMEI 5BQTA 2QKLB 2E10A 4B9WA 1W2BA 2XK0A 4A5NA 2A28A 2I8DA 1T3LA 4NUBA 2GA2A 2V7FA 3X20B 1FIAA 1YRNA 1K7AA 1Y96B 2O7OA 2XUBA 5GADJ 1M1FA 3LAPA 3CC4T 2K85A 1ABOA 2AKKA 2A6EF 2LF7A 2QSGX 3GF2A 1Z6TA 1M90U 4LIVA 5DD8A 1C1AA 3CC2I 2F1LA 1FNNA 2R5MA 2VJ4A 2CUFA 2LKXA 4CYDA 1MSFC 2DO7A 2M45A 1X01A 5CJ9A 4CC3A 4HKEA 5EC7A 4UNOA 3CCMT 1YQAA 3Q0UA 1TOVA 5F1RA 1YJWI 2RHZA 1S5LC 2DE0X 3LSMA 3K10A 4KYWA 6AT1B 3VS4A 1UG1A 4AVZA 1Y1VJ 1U9OA 3F6OA 5F6FA 4F7UB 5D6FA 3R61A 4F92B 4M77D 3SQNA 2GXAA 2R93J 4C9YA 1WZ2A 2R7FA 2COMA 2FOWA 1JI8A 2VKDA 3BOQA 3UDCA 4FTHA 1IXSB 3H3UA 5B66C 2JVHA 2CREA 2C0TA 3FB9A 3H92A 3HOXJ 3HGYA 1E6GA 2PZ1A 4HAMA 4LGWA 3RQ4A 1LQ1A 1JT0A 2JMCA 4PJ0C 4JUVA 3N5BB 1SKUB 4KT5C 4DJAA 3I4NJ 4YIIA 1TTHB 5I2MA 5LJ3h 3VRZA 1QVGS 3QKJA 4A3LJ 1W0UA 3H5RA 2DMNA 4KFCA 3S1QJ 3PFIA 5GAMg 3ASOH 4A69C 2DA7A 3GXOA 4M75F 1TWAJ 4ZDPA 2WY8Q 1M3AA 2FO0A 3CLQA 2RI3A 4CZCA 2DBMA 4L5EA 5EDNA 3LA2A 1MMGA 2DTRA 4PJMA 5D8LB 2R7TA 1FBSA 2VE8A 4QT7A 1N75A 1U5TC 1R49A 1Q7YU 2IEKA 1U06A 3BQZA 1YIJT 1VQNT 2HI3A 4HNVA 3PNTA 2DL7A 4PJNA 1R6RA 3RJPA 1X6OA 2EQKA 1IGUA 2QGFB 5GAN5 1KIKA 2QM3A 3AG1H 4HNUA 4ENKA 1QKWA 3MZYA 3OYFA 1HSTA 2RC4A 4CSWA 3RERA 2FL7A 2LTOA 3J81K 3D1NI 4UVBA 3OYKA 1YX5A 2DVJA 1M1KR 1USTA 3C0CA 4HCCA 4U7DA 4FT2A 1DU0A 2BY1A 2ID6A 1R7JA 2OCCH 3JSPA 5GANe 2C0OA 5IY5H 3CUQC 2OJ2A 2GCXA 4JLGA 3A5ZB 5FKMA 5E8IA 1A0NB 2QK0A 2JMWA 1M2VB 3LLRA 4ZZLA 4BNCA 3Q9SA 1I1JA 3AKZA 2GFUA 3WU0A 4AIJA 2F48A 4ZN3A 2MCNA 2NVUB 3FM3A 1Y1WJ 4HF2A 1QVFP 2M30A 4FETA 4OMPA 2B7EA 3ZN0A 2OQGA 1NZ9A 2DVEA 3REAB 2BXZA 2R92J 3TO9A 5FRMA 1YLFA 3E3VA 2IAIA 2K7LA 1NLPC 2ROLA 3DU6A 2EILH 4L9VA 5J8FA 2M4KA 3F23A 4G9YA 1PD0A 1MDMB 4KULA 1R5GA 3TU4K 2YUPA 1CF7B 5C3EJ 2AS5F 4XONA 2CDTA 1P4WA 3F72A 3W6VA 4BXXJ 4RAYA 3A8LB 1BU1A 3LMMA 5H20A 2Z0WA 2VBXA 4F17A 1YHQQ 3DKYA 3C2HA 1MSEC 2NOGA 3E9GA 4J9IA 1K73U 2E2IJ 5HS8A 1BR1A 2MGQA 5CQGA 4F55A 3M8FA 3QAHA 1N6AA 1ONVA 1VQOQ 1VQKA 1G3TA 1SD6A 1SMYF 2L7MP 5J26A 2HYFA 4AIKA 1TU0B 2DYBA 3EG1A 3CXCP 1MNMC 4FASD 3I55I 2HQAA 1M2OA 1O75A 4C92C 4KRTA 4DQ2A 2CSIA 2TDXA 3GFJA 5E3MA 4ZZDA 2DD4A 1Y0UA 3PE0A 4JRPA 1D1CA 2JQ7A 1M8MA 2ISZA 4MMLA 2O9VA 4XU1A 2M9HA 4EM1A 1F36A 2ZPBB 2DD5A 4R8HA 3OB9A 1QP3A 2ECZA 1POGA 3X26B 2D0NA 5FD5A 1R5HA 1SMTA 5IOYA 2EA4A 2GOXB 3FISA 2HS5A 4CCNA 3AAFA 3C4SA 3JV3A 4RG2A 2A3LA 2DL4A 3UKGA 2MBFA 2DU9A 3KCCA 3LSIA 1BI0A 3AL0C 3M57A 2M51A 2L3RA 4FL6A 3S3NA 5DM6F 3CQTA 1RIOH 3CBOA 2COZA 4AFSC 3H5NA 3Q0WA 4A3KJ 3S15J 5GAGJ 1YI2A 1FOYA 3CF5F 2EYWA 4BQQA 9ANTA 2H3EB 4L6V5 5KYUB 3OL4A 1PM3A 2JOYA 2EZHA 4OMQA 5I21A 2V1XA 3GLXA 2ATCB 4M7DC 4HQEA 3DLAA 2WBMA 3IH2A 4ETSA 1Y71A 2K9GA 2E65A 2MWOA 4F04B 4U87A 2PMZA 2HTJA 4IPAA 4DEYA 2EV0A 2YR2A 2X4WA 4C8QG 3SDBA 1Z3XA 1U2WA 2JXBA 3B6AA 2CH0A 4XORA 3ZP5A 1RUNA 4OIRF 3THKA 4D5CA 2QQBA 3BP8A 2QBYA 5CQYA 2COBA 2XDVA 3WTYC 4RTWA 1TQIA 2ICWG 3QP6A 4CUGA 2V79A 1UGQB 2VN2A 3R60A 2AIRB 1T33A 1WH5A 1YFHA 1Y0MA 1ENHA 4FISA 2P5LC 4N0AC 2FPDA 2DJNA 2K2VA 4Z6YA 1OQKA 3TOBA 2P7CB 3LSRA 2ID3A 1BYMA 4LFUA 2FZGB 4XTVA 2XGDA 1DPRA 3HPGA 3KLNA 1D5YA 5HK3A 2HQHA 4RTUA 2OV7A 2XAQA 3C3WA 3KZYA 3CDIA 1ZAOA 5J1YA 2CV1A 3IP4B 3PO2J 5KYUA 2STWA 1TL8A 3LQRA 1AHDP 1X6GA 2AZVA 3KYLA 1QCNA 1K1ZA 1GCQC 1WVRA 1TXQA 2CZ7B 3LSJA 4LDXA 2HQXA 2HOSA 4S04A 3G71I 2LT1A 1YOVB 2HYJA 2P84A 1ZLKA 1RR8C 1BC8C 1UECA 1ZX6A 2EZLA 3E97A 4UUTA 1NK2P 3VYSB 4KMFA 2IGNA 2JA6J 4KJZA 3QODA 3DKMA 2LMDA 3ZOBA 2HQEA 2MF2A 2VXEA 1PNJA 2EB7A 5AYFA 2AZSA 3TREA 2K4YA 4MDXA 3ABMH 5HNFA 2KIUA 4YFKF 4PUSA 1PHTA 4LLGF 1RPWA 1C0MA 4BGDA 3SFIA 2IBDA 4DBQA 4LB5A 3LWIA 3K70D 4MFDA 4IOCF 1SD4A 1A6IA 3H36A 4S0HB 4B8XA 4N0BA 2Z2SB 4N0AA 4OMLA 4L5JA 3DKXA 5L3BA 3IV5A 4OINF 2HZTA 4E7JA 1VA7A 3H9QA 1L0OC 1G3YA 4AD9A 2MLGA 5J47A 2ADUA 1W4MA 3I59A 4JRIA 2A08A 4KIGA 2DODA 2QLZA 1MMNA 1YW8A 2YLCA 1QVPA 4EPCA 1QLYA 1WHUA 2KIQA 5FRNA 5E79C 2JTFA 2JZ2A 3ELKA 4XTYA 1QVUA 2DPPB 1F1BB 1JTXA 2DBBA 2FA5A 3M53A 1O57A 4ZYDA 1HJDA 3VYRB 3HKSA 1HW1A 5C4JJ 1IJWC 3BLYA 2K57A 1JXSA 2LRQA 4UUSB 3P9IA 4K11A 1KD1R 2W7NA 1M8VA 2CP0A 4LE9A 4Q4ZF 2R7OA 3DP7A 4PNOA 2Y30A 4PKCC 3IC7A 2PLYA 1ZSZA 1XPXA 5M5XJ 4DYCA 2CSOA 2R5YA 4LB6B 2M4GA 3G4SQ 2HU9A 4GGGA 1YHQI 2DW4A 3KFWX 3QYFA 2KPMA 1R0BG 4JPBW 2Q2EA 1WHMA 3CPWP 4CA0A 4D1QA 4BH9A 2GAUA 1UEBA 4Y33A 2L4MA 4ZGDB 2V1NA 3OS2A 3A98A 4KGZB 3M5AA 1VUBA 1BA5A 5IXFA 1J09A 1ZREA 4IX7A 2W57A 2UZKA 3VYUB 3C95A 4M77A 2K3XA 4XQ3A 4B9XA 4DBHA 1RKWA 3SJMA 1EF4A 1FBQA 2IGMA 1SAUA 1YCYA 3PMTA 3CPWA 4KIFA 2LBFB 1NM7A 1MMSA 1JKOC 2HDDA 1APLC 2FJ1A 3GZNB 1VIEA 3G2BA 1GUUA 4M73A 2XICA 5TISC 4ZTJA 2HL3A 1M1KC 5KCHA 4C5HA 5LFAA 2R5YB 1QU3A 4IUUA 1JE8A 3RZOJ 2WV0A 3BPVA 5FFZA 3RNJA 3S93A 5IHIA 2ENMA 4HX4A 3CXCA 5ICFA 3TBIA 2CJJA 1Z21A 3BC8A 3RYRA 1F9NA 5E3OA 1ON2A 4X0GA 1BI2A 2E5KA 2M87A 4IXAA 1ZELA 2KSSA 2L7ZA 2P81A 1YJ9I 2EKOA 3GFMA 2KR3A 3S2WA 7AT1B 4QIWN 4XNFA 3V7CA 2CQXA 4HLYA 4BY6C 1YJ9A 2EIJH 2A69F 4I0BA 5KK1A 3F3XA 1W1WE 4AC0A 1FOWA 3EG9B 4ENJA 3EG9A 5LJ3j 5F0FA 2AXLA 1ZYRF 4HDVA 2OQRA 4A53A 1UFFA 2DEUA 4A3JJ 1OV3A 2XROA 5DDGA 2E70A 2QASA 4HYEA 3DWLE 3TL4X 1TUGB 1GBRA 4HX7A 4ANJA 1ETXA 2V8KA 5LRRA 3RIRA 3G71T 2O8KA 1TUCA 3VUZA 1FIPA 1X2QA 1I07A 3RBBB 2ECBA 1I4K1 1Z0XA 4YELA 1HW5A 1PG5B 3QU3A 3HOWJ 2CP5A 4PSWA 1JEGA 3J7AF 1UHSA 1BM9A 3IKVA 1U6GA 1M3BA 1U3OA 2J7IA 1YWOA 4MEXF 4LDWA 1PDNC 2LMJA 2GGRA 1X19A 3EUHC 4M72A 2VBZA 5GTHC 1PP7U 4A0ZA 3PSIA 3HOZJ 5H6RA 4FYWB 3MEVA 1UHWA 1ITYA 1H8KA 1UJ0A 4UXNA 1T0HA 4JS5A 2LYCA 4EJWA 2COWA 2Y2ZA 4AG1C 1QVFS 1NG2A 4GYGA 1OR7C 4BI3A 4HQMA 1ORKA 2M16A 4WXDA 4O3MA 4BI4A 2KDSA 1BIAA 1RRJA 5CVIA 1N78A 2XKOC 1S72T 1X3ZB 2MA3A 1AKHB 3H8ZA 3DLLF 2KDZA 3WVEB 2FVUA 1TC3C 4Q48A 3C7JA 5KYWA 4ORZA 3FKJA 2VC8A 1T0FA 1YJWA 3JCUC 5K7FA 1XG1A 4RLQA 1FYKA 3DXJF 1OKRA 4FYVB 2LCLA 3CCRA 1H88C 3OYNA 2KROA 3BG9A 4A4HA 5HLGA 3G1OA 2O6GE 1RI7A 3OIPA 1H89C 2HKQB 3LWFA 2HPIA 1H3ZA 2VJIA 3CMYA 2RQUA 5HDGA 5M3FJ 2IRFG 1ZBJA 1ULYA 1XSVA 2M1HA 2H6BA 2MC3A 1XGSA 2E1NA 2Y69H 1ZA1B 2OCEA 2PTKA 3JB9H 2E36A 2VBWA 4A4GA 2E5ZA 2RQPA 1RI9A 2X3XD 2GQQA 2DMQA 3KUFA 4J7IA 1M2VA 3ABKH 4A3BJ 3REBB 3BCBA 5GAN4 4UVAA 1R1VA 3AL0B 2XB5A 2LZ6B 1ZG1A 3WTZA 1H9GA 2LQWA 1IN8A 1UCRA 1AWJA 2JUFA 1B8IA 2Y4YA 3BR5A 1VQ4Q 2RPNA 1ZUUA 2PBIA 2K5LA 2OUMA 3CCVI 2FOKA 4I7HA 3CDHA 3BJAA 2XAJA 2VXZA 2RK2A 3JAME 2DXBA 4F7UG 1FTZA 1YWPA 4LG0B 2G7UA 2IG0A 3U2RA 4C3JJ 4EM2A 2GM4A 1GBQA 1VQ9I 1NLOC 3M54A 2DRMA 3G3ZA 1X1PA 2JJ9A 4ZYHA 4X1EA 3M1CA 3CJTB 4EV0A 2PQWA 3BDLA 1QWFA 3CMAT 5L3GA 2L4AA 3OIQA 3JTGA 1QW1A 1XQHA 1JRIA 2MK5A 4B1RA 3BY6A 2OTLI 2E2HJ 5FWBA 4XK4A 4L59A 1TTYA 2EBIA 4IRGA 3T5XA 1OJLA 1AOJA 1NEBA 3OW2A 3VDXA 2LG4A 5CQEA 2K2MA 3PFSA 2ZJ2A 4C5GA 4NNJA 2CQNA 1GLNA 1D09B 1H641 2EGCA 2WACA 3H9NA 4OMNA 2LC2A 2CFOA 4RS8A 1Z05A 1V1CA 2L8DA 3EHQA 4Z89A 3VSKA 1W7PA 4NQWB 3VJPA 1J5YA 2F2VA 3DBLB 1R58A 2F5EA 5D6YA 1AA7A 1BBYA 1UGPB 3VFZA 3KIOA 2DAQA 1YX3A 2FG0A 3OQ5A 1IN4A 3MJXA 1ZBXA 3K4JA 1N9RA 3IH4A 2VWFA 3VRYA 2AXTC 5CLSA 2JMAA 3LSGA 2DF6A 5FW9A 1NJIR 1U3EM 1G2BA 5LGNA 1VQMA 1H92A 1N5ZA 4XLPF 1FXXA 1C6VX 5EEAA 1SPKA 3QO3A 2A68F 3P9KA 4BXFA 3P5JA 2MH2A 1QVFA 1JHHA 4G7OF 2DRKA 3VKIA 1MNDA 2Q2EB 3ZMVA 2YRVA 2Y0SA 1QNTA 3E1SA 2FSWA 1FZPB 1JB0E 5LJ3g 2K5CA 1QRYA 2XF5A 4D8DA 1R71A 5A2QE 4PJOG 5E3LA 1Y0NA 4QVCA 2DI3A 2XF7A 2XRNA 3GTPJ 5GAMd 2D1XA 2F5FA 2ED1A 3LQQA 2X6WA 2HVRA 4HZFA 2NS8A 2X0LA 4CCJA 1JJ8C 2V1RA 3CP8A 1Q1VA 2EV5A 3JTHA 3M07A 2R7ZJ 3A1PA 1KC8U 1KQSP 1B9NA 3R6OA 1VQNI 5TJJA 3C94A 2J6FA 3GNFB 4A0YA 4LK0F 3A01B 2X85A 5HLTA 4HCKA 2L5QA 4OAYA 3DFGA 3SDGA 3DLLA 1LJ9A 4QKUA 3CD6A 5EG0A 1R0CB 1IHVA 1NEGA 2A05A 2HXIA 2D8JA 4EMKA 2DYSH 4LD6A 4M75E 1KQSS 4ZYGA 1M30A 3HSEA 2YPRA 2JM9A 2KK4A 2P0KA 2EIKH 3I56I 1B1BA 3ZQ7A 1YITI 1B72A 1KSWA 1T38A 2K9NA 2VONA 1YBYA 3FX3A 3EFSA 1VQLT 1BIBA 1OPCA 5LRSA 3OYHA 2K4BA 2J05A 3I53A 4Y28E 5M3MJ 2A61A 4L9NA 3CD6T 2GXBA 5GAMf 2HOEA 1PRMC 1NTCA 4WTOB 4V2GA 3RDVA 2CS3A 2V9PA 3EPZA 1TQMA 4I09A 2EPDA 1R36A 1IZ6A 1MJ9A 3I4PA 4Z8AA 5LJ5d 1QVTA 4MMKA 1V4RA 4IHSA 1JJ6C 4M7DF 3L1AA 3KP2A 1WJ5A 3Q5FA 2CZ0B 4XTXA 2KRSA 2I10A 1ETWA 5J1RA 3EFRA 5KCOA 1K76A 2BYVE 2SEMA 2LX9A 2YS9A 5GJWB 4IO9F 3VS3A 2G0EA 3A0HC 2CV0A 1UE9A 3A8MB 2CQQA 1SC7A 2EA2A 1B72B 3KEQA 2CS7A 2EFNA 3F6VA 4I99C 3S14J 1B34A 1TT0A 2R5ZB 5J8CA 1WJQA 3EG0A 3UWNA 5GAMj 2CZ6B 4AFQC 5EYRA 1KU7A 1FTTA 3JAMZ 2XPUA 3TEEA 2MWPA 2H1LA 1X3UA 3M3YJ 3L2WA 2QAZA 4ESFA 2E3IA 2E7XA 2F5KA 2VGNA 3OMGA 4BHCA 4L5GA 5CQXA 1NYFA 1D1BA 5GAOm 1RESA 4HBLA 3CCUI 1MIJA 1I0CA 3ZRGA 3FXQA 3H3VK 3I58A 5CKEA 2YSRA 1Y07A 1K9AA 2KKOA 4WWCA 4M75G 3CMET 1GHCA 2HOTA 3LGLA 2CKKA 2OZ6A 1JKQC 1W7PB 4NQWA 3QJYA 4XN0A 4DYQA 2CW8A 2WWYA 4BBSJ 4U88A 1PD1A 2JRMA 1VZ0A 2WAQN 2VODA 2RI5A 3QWYA 1YNZA 4EMKC 3HOUJ 2BY3A 3FXUA 4KA4A 2ZPFB 2BEOA 2CUZA 1SHFA 3J7AO 3QYBA 1D8KA 4A12A 5FWCA 4ZH4F 4JRQA 4EQQA 4BB7A 3HOTA 2DEQA 4M78A 2GXGA 3HBLA 3TGNA 2JPCA 4OOIA 4JLIA 3M7GA 2R5ZA 4B3XA 2O5RA 5CVRA 1A36A 4CC7A 3RPQA 5A0GA 4M3DA 4GDFA 3PGGA 4TVRA 2ZMEC 2VQGA 3LSPA 1D8JA 4NL3A 3QBYA 3OYDA 2HDAA 1X58A 1NE8A 1KQ0A 5D5WB 1DP3A 3MPUB 3OR1C 1BKBA 3HFOA 4HLXA 3H41A 2JSCA 1MBHA 1X2NA 1WSUA 2R7SA 2GFAA 3LYIA 1LNXA 2X35A 4IOAF 3CCSA 1I6XA 5FKKA 2YUNA 2MFZA 2JZYA 1IV6A 5A2QZ 4G6TB 2JT4A 3T1BA 2G3RA 1PUEE 3IAM2 2ZPIB 2HGCA 3SWNC 1BJAA 1WQ2A 3DF8A 4HA8A 3NARA 3E5QA 4RAZA 4U0YA 1MBFA 5HODA 4A3CJ 2CP3A 2H3JA 3WGHA 1XTDA 4XLAA 2QEXQ 3QZ5B 3BG3A 3WU2C 2VOOA 1ACIA 2H94A 2JWTA 3NWSA 4E7LA 2R4GA 2YUOA 3CCMQ 3VS0A 1VQ4T 1VQ6Q 5E1XA 4X6AJ 1Q86R 2NNYA 3ZQFA 2ROTA 1TNSA 3FEOA 3NGPA 4M71A 2FQ3A 3K4MA 4E70A 1YJ9Q 4KUDK 2CUEA 3Q1JA 2E12A 4OIQF 2M02A 2BHZA 4RMOA 5LHIA 4B48A 1WKMA 2ESWA 3VPRA 3HL2A 1JUSA 3A03A 1L3LA 1KJWA 1OCCH 2L3SA 5GAOn 2BOLA 1DPUA 1YW7A 1X2KA 3X28B 2BIVA 1VQ7A 4HXJA 4QWQA 1TWBA 4C0DB 5AONA 4ENMA 3EGDB 1XSXA 1LDKB 2XU8A 2LBFA 3EGDA 4DOVA 3M58A 1XDSA 2M5WA 3QPTA 4Y13A 1VQKI 4M75C 4AMCA 2DDAA 3NFCA 3UNGC 1MJBA 5DTDA 2A0FB 4JDSA 5FU7C 3SYTA 1K4US 1KFZA 1T56A 3CCYA 1NPPA 1U5SA 1ZSZB 4LIUA 2LC4A 4HCZA 4ELYC 1AWWA 4OAZA 4CYCB 2KVQG 3OR2C 4QPQA 4NOYA 5GJVB 1ERDA 2JN6A 2HNHA 3WHBA 3QOPA 4P9FA 2O9LA 3TW6A 2O61A 2YUSA 1RABB 1ZQ3P 3CD6I 2JN0A 3I54A 3GWZA 2EYYA 2RJDA 2M8GX 2WSEE 4I02A 2E34A 1WGSA 3OYCA 3I5RA 2WA0A 3FWEA 3MZHA 4RAFA 4CCLA 3UPUA 4GXOA 1BCMA 2DIGA 2DM1A 2PNIA 3RDIA 5DS9A 2Q0OA 1IAWA 1I81A 1Z9QA 3I35A 3CC7A 3GFIA 1IRGA 5L3EA 2OAZA 3RMSA 1T98A 1KYWA 1FJLA 1BN5A 4RTZA 4ZGJB 3P9CA 1E7OA 3Q9VA 4MEYF 3L09A 2BGCA 2DOFA 2XF6A 4HRIA 4I01A 4P9UA 2HD0A 5CKBA 5GP9A 4EMGA 4BEHA 5EF6A 4GLMA 3BR1A 1AD5A 1SHGA 1M3CA 2KIFA 2W84A 2CH4W 2HNIA 2BE9B 2LJ1A 1PKSA 2HSEB 3MKLA 2Z3YA 4M7AB 1YJNQ 5DV5A 4C2TA 5IT9Z 1UHFA 2VL8A 2VXFA 4UV9A 2DA3A 1VQKT 3HZJA 2D8HA 2RN7A 1U9NA 1OX8A 4AFZC 3KP4A 4II1A 1U78A 1Y57A 4JZ4A 1PSEA 2RK1A 1OPLA 2VQCA 3DBRB 1MBJA 4II3A 4RGSA 4A2UA 1KHIA 2HL5C 2WSFE 4N4IA 2O8XA 5DUIA 4Y92A 1OR7A 2K3BA 2QYZA 5L23A 4RGUA 2ZGWA 3SFMA 1HKSA 3GO5A 4LLNA 1QCFA 2DKGA 5F08A 2KLOA 4DBRA 5BPDA 2L0AA 2ZXJA 4FU6A 3DBHB 2E6ZA 3UF4A 1N9SA 4IZZA 2HBPA 3KZIC 2LDMA 2L9RA 3PIOA 2H8HA 2HR3A 2KEAA 3E6DA 4MQVA 4KBMB 4P96A 3GTOJ 3RPUA 3RSNA 5LL6S 2DT5A 3FLGA 1IV8A 5J3BA 2ZXWH 1FMVA 2O03A 3I64A 3FDYA 1K4SA 3L1PA 1P6RA 2W4SA 3RKQA 1WDXA 2KRNA 4DZJA 1KQSA 3E9FA 2D6FA 3UA6A 1GXIE 5LJ5f 4BYYA 3CP2A 2ZXIA 2HPMA 1LKXA 2DIQA 2P7VB 4JZ3A 2LOOA 2ZXHA 1R5ID 2IW5A 2K3YA 3M0QA 4L9JA 3U21A 4OB0B 1OISA 3IH3A 4LDYA 2FRYA 5I11A 3QXEB 4FX4A 4CCOA 3HPWA 3ECHA 3U1KA 4PZJA 3F8BA 2LY2A 3K2AA 3BTLA 3L9FA 3BZKA 5L3FA 1EZZB 2X9HA 3OBYA 3MP1A 5GANj 2OPTA 1MGTA 1KC8R 1NJIC 1W36D 2KHMA 3VB2A 1R4NB 3CMAI 4C0FA 5A0DA 2QA4A 4DGWB 4K2EA 4IHWA 3JCMf 5CCAA 5GAHJ 3I55A 2VPLA 2EQJA 4CHUA 5HLHA 2DL3A 3H0GJ 2BTTA 3ASNH 4V2SA 3OS0A 1O3RA 1RAAB 3L2RA 1WLPB 1VQ4A 1M90R 2MPXC 1JHFA 2ZO4A 3IWZA 3CCVT 1M1KU 3BDUA 3CJRB 1AZGB 1X1DA 2STTA 2Z1DA 3T8RA 2A3SA 5IYDJ 2E3HA 2DCEA 2EQIA 1J0RA 1AWCA 2HOAA 2BE5F 2K9LA 4XLHA 2X4XA 1HYOA 5C4XJ 4MZTA 1HKTA 4DIQA 3BR2A 1AWOA 3M0SA 3DB3A 2PEXA 1VQ9A 2LP0A 3HTUA 2O4XB 4KT0E 2L54A 4M4ZA 2FUG2 3H0IA 1QVGA 3WGGA 1VQ8T 1XX5A 3LA3A 2GQVA 1X27A 1YS7A 4HSTA 1B4AA 3PUFA 2VT2A 5DLOA 3CCUT 2QDYB 1TLHB 2OTLA 4J19A 5KYXA 1BW5A 3VS5A 2RDPA 3LFUA 4E7KA 3ZL7C 3TCJA 4DBFA 1M27C 4BY7J 1QZYA 3HPHA 2O31A 4BBRJ 3T0YA 4F91B 1MMDA 4BJTA 3VS7A 1WJFA 3BDDA 4C3IJ 3LA7A 1X75C 4LMYA 5KAIC 3GZ5A 2MSYA 2MOXA 5FLMJ 2DQRA 1S29A 2PG4A 1ETYA 2CRGA 5E1ZB 3WG7H 3WODF 2ZNYA 4JYKA 5J3LA 5BMZA 1YO5C 1OI1A 1ZA2B 2DLPA 2KP6A 1A6QA 3NWTA 3CCEQ 3KFVA 5DCMA 4EMKB 2DMUA 4BKXA 2HTSA 1WHHA 1WJBA 2HWVA 1W4SA 1W6XA 3GNGA 2L7FP 4KUIA 1W1FA 4H4KC 3CLOA 2D1HA 5A2QK 3M4OJ 3HSBA 4Z88A 3ER0A 3KX2A 1LB2A 4PJJA 4C3HJ 4PFZA 5IHNA 2L2PA 3H9JA 2JT1A 2RF0A 2YWWA 3L2VA 4NHJA 4HEA2 4UV8A 1D0ZA 5IOZA 2H8WA 5HLIA 4A3MJ 1ZUYA 1IGNA 4PJOB 2IJLA 4B44A 1I5OB 4EIKA 1H3HA 1FX7A 4FX0A 1VQOI 2CGHA 4AG2C 2VI6A 4GCVA 3I56T 2X6XA 4CGZA 3DTKA 1RAEB 1YITT 3L2ZA 1WZOA 4NDLA 1SVMA 1OCZH 3I55Q 2CSQA 2W48A 2NS7A 2FMLA 2F4OB 4Q5WA 3E19A 3F9KA 5D5XB 3WE2A 2RHYA 1YTYA 3VUBA 4IHYA 2E1CA 2V6CA 1QKXA 2CO5A 1B34B 4EMSA 4RKUE 2EPFA 2BY0A 1W5SA 3DCFA 4RM3A 3F22A 3H6ZA 2FF4A 4EGYA 1GCQA 3EYIA 5CVJA 1NBEB 3SD4A 2QQ8A 1U8RA 2H1KA 1TWGJ 3P7NA 5DM7F 2EZIA 1HOMA 4C30A 4EJTA 4PDKA 3CCUQ 2EQMA 1E3PA 3SB2A 1S7EA 1JGGA 3FIFA 3ESWB 2OF7A 1IRFA 1V3FA 1GFCA 2M3AA 3JB9F 3CO7C 3KZZA 2DA4A 3S3MA 1VQPQ 4MGRA 4PLLA 4M7AG 2RO0A 1OCOH 1B3QA 3JCMV 1G5VA 1WI7A 1WXUA 1JXMA 4F7UE 3V8JA 1WA7A 1ZSGA 5I2SA 4HCBA 5L3DA 3WTSC 3H1CA 1GDTA 3J81Z 5IXBA 4ZDLA 5IPAA 2HFHA 5LJ3f 1SD7A 4IHXA 2QWWA 3G6ET 2N8GA 3WHCA 2D45A 2DMTA 5FJ8J 2NVTJ 3RMQA 3I9V2 1IRXA 2J6KA 1NYGA 2KRFA 3W2WA 3CCLQ 1AEYA 2NYXA 4C0DC 2DL5A 1TG0A 2OTJT 1UJYA 3ZFJA 3HGGA 4A0XA 4JJCA 1FYLA 1STZA 2MI6A 2RJEA 3FIWA 1YHQA 2Y9ZA 2DK8A 4LG0A 5JR3A 2NUTA 1KD1C 1X4PA 1RAFB 2XD0A 3HB9A 3SEQA 2L02A 2Y0MA 2ZBKA 3OWTA 3CCJT 4PJLA 5C44J 1LEBA 3NQOA 2HQRA 4BQOA 1RZ4A 3R0JA 3J7ZI 1BC7C 3M0UA 2OTLT 5IP7J 5GMKl 4G7HF 4GO1A 1SFEA 3A2KA 1FMWA 3BY7A 3HRUA 2VUMJ 1D0XA 1OULA 1D5VA 4IHTA 2L3PA 2O0YA 2H6CA 3J7YJ 3JRCA 1WI9A 3P8DA 2PJPA 2LH9A 3RQIA 4R0KA 2H09A 3ZQQA 3REOA 2RV8A 3PUBA 3FXJA 1I50J 1OCTC 1UAAA 2BVMA 3QOEA 1KYZA 2ZSHB 3DKWA 3H9GA 1G59A 4NS5A 3G71Q 2UXNA 1UJ8A 4RDUA 2DILA 1CGPA 3FHNA 3U1DA 3CCMI 3LGFA 3ASKA 1U5TB 3JSCA 3I5SA 2XPWA 1VQ7T 4G7ZF 4GYIA 2L7KA 3ZXSA 2R7XA 2RKHA 1FWZA 3G6EQ 4NC7A 5D8KB 1MHNA 1WJAA 3ZQCA 1K61A 2KIMA 2RI2A 4E7IA 1SEMA 1IN6A 1U1TA 2I5UA 2GF7A 3E7LA 1FYNA 4JJBA 5CK9A 3JRGA 2NUTB 1FP1D 2KBTA 3CC4I 2IVMA 2LF8A 5GAOl 2WV1A 5IP6A 2LNHB 4MTEA 3JRIA 1CKAA 4LOCA 3UT1A 1DGWY 1LPQA 4QQGA 5DCFA 3IUOA 5EG2A 3V42A 1MUZA 2LVSA 3RYPA 3CUQB 5JVTA 3MKDA 4C8QA 3S8PA 3OYEA 2K9MA 4Y15A 2ZPEB 1G3SA 3OMYA 2MD0A 3ZPLA 3QYHB 2PUOB 1VQ7Q 4L0ZB 4KICA 4JX4A 4OVAA 3X25B 3FMRA 2VOPA 2JS2A 1DJ7B 2VBYA 5LJ5h 2VQLA 4M9ZA 2R57A 4OGEA 2JRTA 3E6BA 5B5EC 1O3QA 2W24A 2H27A 2FBKA 2NOJB 3KP7A 3LSTA 1GXPA 4PJOD 4YRVA 4KT6A 2ZCFB 2F69A 2W0ZA 3UATA 4Y4RA 2A36A 3OIOA 2R5AA 4G8XA 3JCMJ 4Z02A 2ZJRF 3CD6Q 4ZTFA 3M56A 3N4MA 1S72I 4KITB 3HOSA 4V19K 2ME0A 3QIIA 3JCMQ 5ICGA 2PVOB 2DA2A 4CXFA 3CCMA 3JRAA 1H0MA 5ICEA 3RPUD 3FK6A 3OV8A 4A3DJ 4B47A 5ECAA 2BHYA 2LX7A 2TRTA 3CUQA 3NRVA 3V8LA 3QDRB 4OP0A 5DM7R 1M90C 1VFCA 5FLXE 5HS7A 1WPKA 4QPOA 5E3NA 1IHWA 3PQKA 4LLLA 5FKOA 1W0TA 3F8CA 3GPLA 1EIFA 4N9HA 1LE8B 1R22A 2O3FA 4JOMA 3G4ST 4W97A 1K0XA 1R1TA 4MO7A 1HBXG 2EJGA 1HLVA 3VOEA 1LFPA 3HRSA 1IUYA 2K86A 3TO7A 4EEFG 4C5EA 3WGIA 1YJNI 3R0AA 1PSFA 2VVKA 4C92B 2DBKA 4F7UA 2M0YA 2A7YA 4BAYA 4IVNA 2K79A 4HG2A 1U5TA 3L42A 3H3ZA 1WXBA 1WRJA 5LHHA 2QGUA 3IRQA 1WFWA 3HP9A 2EK5A 1M5Q1 2HXOA 1BI3A 4P5OA 1TQPA 4A3EJ 1D1AA 4LXCA 1SEUA 4LG3A 1U0JA 3HSFA 4IF4A 4B09A 4DYRA 4FHTA 5DLQE 4IUPA 1OFCX 2W1OA 4YFXF 3NTHA 2XIGA 1IXDA 3MMYB 2QSFX 1M9SA 2A6TA 3D5SC 4PFPA 4ESRA 1W7PD 4BDYA 3GEZA 1JT6A 2PMUA 3CCSI 3OSVA 3PVQA 1G83A 3BPXA 3QUIA 4OIOF 1UHMA 2M2EA 1EKEA 3AFHA 3GVAA 3ZBDA 2KJBA 1X4OA 3CXCS 3MZ8A 4OWRB 5E1WA 2HZYA 3QHSA 4M7DB 2LY1A 5HK0A 1Q86U 3BR0A 1T8IA 2L2OA 1D3BB 2LDUA 4F16A 3KBGA 1GV2A 3MN2A 2E41A 3VV0A 2CFXA 1ZGJA 3QG1A 4XMYA 4PJOC 4M75D 3PFYA 4Y91A 1KU9A 3TQ7P 2V6EA 3IAS2 2E19A 1K6OA 2XKPA 3HTSB 2DXTA 2NYSA 4XKBA 4BUGA 1UMQA 4R1HA 1ETOA 2NS0A 2VUBA 4OIPF 3CMAQ 3NTKA 2F5TX 3QZ9B 4DEXA 2IA1A 3EH1A 1I39A 2BV6A 4ZJZA 1VQLI 3CCJI 2RD1A 3EETA 3GLLA 2E4HA 1WJEA 2KE9A 3CJQB 3GW2A 3BJ6A 2E1MB 2IA2A 3SEZA 3WTWC 5JVGF 2JTEA 1DQUA 3X2QH 2VJJA 1SANA 2UV1A 4HVUA 4O6JA 4LD5A 1MBEA 3VODA 2YHTA 1ZQ1A 3HL8A 4C92F 2NAZA 2CH4A 2MD5A 3N05A 3K69A 4C8QF 4Q47A 4N4HA 3SEMA 4IQ4A 2Z5UA 3H0DA 2KRCA 2YU3A 2XKOA 1D3BA 3O3KA 4C5IA 2M0MA 4BE1A 2VKVA 5CVVA 3G6EI 3LH0A 3SFZA 3PIPF 3ERMA 1IXRC 5H2FC 1GRIA 1JQQA 4D6WA 2DTZA 1QCOA 1S8NA 1G2HA 2QG9B 2W82A 3U23A 2O4XA 2MW8A 1RUWA 4CCKA 2JS0A 5CPRB 1XN7A 1QWEA 1K73C 2LT4A 1KQ8A 1E3OC 4M3FA 2NWMA 5EZHA 2E64A 1I27A 3ERED 3F70A 4PGHA 2LKPA 3EFOB 3LH5A 1W5CC 2WB1N 3K70C 3GTQJ 2EFQA 2QI2A 2DL8A 3ULRB 4A54A 4A3FJ 1RKTA 2GOMA 5JLWA 4R56A 3C2BA 2KYBA 2PJRA 1VQ6T 1TBXA 2BKDN 1E0EA 3ZMZA 4A4KA 2V26A 1AU7A 2Y0SN 1VQ5A 2E60A 2EQRA 2WAEA 5DUKA 2XB0X 3PL8A 4BUPA 5FLXZ 3I9QA 1O3SA 4BI8B 2NLUA 4PSXA 3FKIJ 4RA2A 4X9DA 5GAN7 4LUDA 2TCTA 5TGTA 3J80K 2PX9A 1S3JA 4RTTA 3CCVQ 3CCVA 1I6HJ 4Y3OA 1GCPA 2AHJB 2QVOA 3H5AA 4R79A 3Q3SA 2XASA 1WCMJ 5K5RA 3ABLH 2GIZA 2RN8A 1K9MU 1IC8A 1KHCA 1RNLA 1YYVA 5LBQA 3EH2A 3JB9G 5TRDA 3ABUA 2DA6A 2EJ9A 3H0FA 1Q1HA 4C8QC 3K4NA 4I98B 1VNDA 4GLKA 3G6EA 5GAMe 5D7UA 9ATCB 2D9TA 3DQVC 1O9SA 3URGA 3CESA 4BE2A 4BL0B 2HBWA 2DYRH 1TH7A 2OTLQ 1B59A 3W2VA 5DD4A 1ZARA 2LJ0A 1QPIA 1SRMA 2VGMA 1XMAA 1KU3A 1BR4A 4CDGA 2PJRB 1G6NA 3IKTA 3GUDA 5LGTA 1UHCA 2HKOA 2R7WA 3S17J 2UWMA 2ME6A 2KZGA 1FT9A 2JUGA 5ERIA 3S2HJ 1IO2A 4HNTA 4IQJA 1R8OB 1W2BS 1XMKA 3FXKA 4XRSA 1PYVA 2FQ4A 3OY9A 4GRIA 4AIDA 4UY8I 2B8AA 4AT1B 5JFRA 2KXCA 5CKFA 3VYGA 1DU6A 2Y75A 1GT0C 1V5EA 1NPRA 2B86A 1G4DA 2K4JA 3CCLT 4C92D 3CJNA 1O7LA 4XKWA 5GAOp 2A5WA 2ZPHB 1ZKGA 5ILVA 1Y8QB 3LNQA 2F5CA 2FPEA 2GNCA 3O5ZA 4KDPA 1QMCA 3BJOA 4J6XA 2CYZB 4QW2A 2DFIA 4RAGA 3MKYB 1MW7A 2RQQA 4Y17A 3CC2Q 2ELHA 1PCXA 5F1JA 1U1SA 4C0GA 4HF1A 1EH7A 1VQPA 4IURA 4M7DG 5CAIA 2XDBA 2DA5A 4XBFA 3BTIA 3U9GA 4NB5A 4FSXA 2M0CA 3CCLI 1B8IB 1BB9A 1YJNT 5M5WJ 5CKHA 1UZCA 4C2UA 5KYWB 2E5QA 2OU2A 2DERA 1VQNQ 2Z9OA 1F1ZA 3KE2A 2Y90A 4RUGA 1JKPC 3FMSA 4OMMA 4HV5A 2P4RA 1ZLMA 1GVDA 5GANd 3OSFA 3QRFF 2DK3A 4M7DD 5E20A 4XM3A 3TP0A 2A5YB 3G1MA 4U0WA 1Z3YA 3MAJA 3CC2A 2YRDA 3G4SA 1TWCJ 4E4HA 4BU2A 1UGVA 5FGMA 3PM1A 1JJ2A 5BNGA 5HKCA 2EIMH 4BJ6C 3DPTA 3EFOA 1Y96A 1MBKA 4KMUX 1PRLC 2BVLA 4E2FB 1W2BP 3WTTC 2BZYA 1S6LA 5IP9J 2E5NA
chains in the Genus database with same CATH topology
2PVGB 2DO3A 4J00A 4X34A 1BI1A 4RLFA 1QP2A 4M77F 4BE0A 2XSJC 1K8AU 4J83A 4LD9K 2KAFA 2IS1A 1X1CA 4XKVA 2K5IA 4M7AA 1OYXA 4DA4A 1VQ8A 4A4EA 3DTEA 4M78D 1T95A 3MD2A 2E1HA 1NG6A 2XHCA 4M77G 2QEXT 1Q82U 4D9JA 1VIFA 1G8XA 2RHUA 4M7DA 2LQKA 3ONQA 5IAYA 3PIPA 3JCMc 2XDPA 4J6WA 1KD1U 2MC4A 4J8OA 2M0OA 4ZDOA 2KQWA 3OYBA 2OAUA 2VIXA 3M59A 4BJ5C 1LVKA 3UR3C 4E7SA 1I5LA 1HA8A 1KQ1A 3OW2S 4PFOA 4DOZA 3DPLC 4N4NB 4E6KG 4C92A 2QEXA 3OYJA 5KE2A 4F7UF 4HT9A 2OTJA 2EQUA 1YJWT 4U7BA 3MO8A 4ZYAA 3CMEA 3CC2T 3WXMB 2BW3A 5GAMh 3ZGKA 2DZCA 3HUGB 3OS1A 4OB3B 4XLCA 2C06A 1X1AA 2DOAA 3ZEHA 3ZR8X 2JVVA 2X4YA 2MMPA 3GIBA 2ZSIB 4JRKA 3OL3A 2KL4A 5GANg 4XU2A 5FU7B 3G71A 3CCLA 1VQOT 4CI0C 4DOWA 2VB6A 4XQFA 1WQ7A 4F93B 4IUQA 4CRIA 2DJZA 5GAN2 4PJOE 4XR6A 2M7AA 3CC4A 3FJPA 5HVQC 3K4CA 2JA2A 1Y56A 4OF1A 3DTIA 4E7ZA 2YLBA 4IUVA 4BDZA 2WADA 1RL2A 4XAXB 1YIJA 4B43A 1SFKA 3RCOA 2IS4A 3VYTB 4QQ6A 4M7AD 2V8IA 3OS5A 3L2UA 4PJOA 3A8GB 4XK8E 1M1GA 3S3OA 1YE9A 3KEYA 2CZ1B 5D6XA 2QQRA 2VV5A 3AHUA 2X1EA 4F3QA 2Q1ZB 3JCMg 3DB4A 4XL9A 3W2AA 3M4GA 2RHIA 4FIBA 4ITVA 5DY9A 4NC8A 3OYAA 4C92E 3VU3C 2EWNA 2KRHA 4II2A 2IGKA 5A0LA 2EYQA 3D5LA 1V5FA 4KISA 3C12A 4P1WA 1G3WA 3P8HA 1LJOA 3MP6A 2P0QA 3CCRT 2XAUA 3CCET 2O01E 3J80E 4M77B 2DTOA 2RREA 1UGSB 2QQAA 2XDDA 1N8RU 2E1MC 1UELB 2FB7A 1MGQA 1KG1A 3V7SA 4UC4A 3GF5A 4JQFA 1VQPT 5GAN6 2R7VA 1JBMA 3VWBA 2X4JA 4XTZA 1HK9A 2WY7Q 3OYMA 2CUJA 3SZGA 4RMNA 3CBMA 5HOOA 4M77A 3CBOA 4AU7A 2DTHA 3PSFA 3HKZA 1LOJA 2PUKB 1Q86C 1Z7LA 3C2GA 4EMHA 3BG6A 2RJCA 3X24B 2VKHA 4M75B 2L9NA 3CMMA 4E7HA 2CMPA 2JTMA 2CW7A 1HXDA 3CBPA 1S72A 2IXSA 1N77A 3P8BB 4WF2A 3H35A 5CIUA 4OB1B 2QTXA 4C8QB 1WPYA 4J01A 5KE3A 3MP8A 2IGOA 3EAEA 5GMKh 5CR2A 1N27A 2OC6A 4XU3A 2KMUA 2DXUA 3CCST 3MEUA 3HHTB 4FT4A 3NTIA 1DGRM 2RB6A 3RKYA 2JNGA 3OYIA 3KXTA 4X9CA 4IUTA 2IS6A 1I8FA 2LRDA 2DT6A 2RJFA 2I2LA 3GP8A 1KQ2A 4QQDA 2ELJA 1K6YA 2FHDA 3BFMA 3SWNB 3CCQA 3HG9A 4C8QE 4XOTA 4BD3A 2KQRA 1K9MC 3QYEA 2DXIA 1M4ZA 5IN1A 3PNYA 3VYHB 3JCMX 5KH6A 3RUXA 1UB4A 3PNVA 3LX7A 2Y4XA 3O8VA 3EUKL 3G7ZA 3OSSC 2ZFUA 2MAMA 3LW5E 2RNGA 4C8QD 2V8JA 1WJRA 4AYBA 4J7FA 3MEAA 2R7UA 4VUBA 1KONA 2XC7A 4LDUA 5GMKj 5LD2C 3HXLA 3K4BA 5D6WA 2EAYA 4PLIA 4M7AF 4LDVA 5CO7A 1BR2A 4ATOA 3RESA 3E0JB 3QSUA 1VQNA 3META 2XIDA 5CKTA 5HNHA 2PU9B 3WVDB 4XLFA 4XLEA 3INZA 5GMKm 2F5VA 1NJIU 2LVMA 4BY6B 4ELZC 2D0QB 2HDWA 1YJ9T 2HVQA 4IKFA 2VJ5A 5JHFA 3MKZA 3BW1A 3A8HB 2MABA 4RCBA 4QVDA 2P0PA 3V8KA 3D5RC 2HZDA 1Q81U 3MEWA 2VASA 3PMIA 1YI2T 1IREB 4M78B 2K5FA 3LSKA 5GAOr 1OZ3A 5GANh 1Y6IA 1JJ2S 4J6YA 4ME7A 3QPHA 1YHQT 4O5VA 3JB9D 1X1BA 4EDUA 2QA4T 2HAXA 3CPWS 1N8RC 3LL7A 1T0FC 5C0MA 2VXDA 2X1CA 3CCEA 4XOPA 4BQNA 4N4OB 4OMFB 2BW3B 5KCMA 2IVWA 4QVZA 2CV2A 3RKXA 3JB9J 3S32A 2LNVA 3MKWB 3M55A 4JS4A 2QKMB 4C92G 2EIFA 2MYSA 3S6WA 2DXCA 2X1DA 5M9OA 4BS9A 2KMTA 5LJ5j 5LJ3e 1OLTA 5L8RE 1VQ6A 2QXFA 4M7AE 3I3LA 1WJDA 1V5GA 4P5NA 1OZ2A 4NL2A 4M77E 2DJIA 3A4CA 3BG7A 1UGRB 4A4FA 3PT9A 1P9QC 3OBWA 2AQFA 3J81E 3JCMd 1RI0A 4PK4A 1WJCA 2E6NA 2DTIA 2R58A 1NG7A 5FU6C 3TMOA 2R7RA 1D0YA 2UUZA 4HPQA 4M78F 1EA3A 4XU0A 4OB2B 2DZ9A 3M4YA 4RCCA 3DU5A 2EFIA 5GAOq 2P4TA 4ZGEB 4MZMA 3L2QA 2V4JC 1MMAA 3PTAA 3CF2A 1VQOA 5FROA 3MHXA 3OYGA 4ZN1A 4BEHB 3FRNA 4HT8A 4M75A 1QHHD 4CH7A 1Q81C 1ZHIA 2EJFA 1Q7YC 4E47A 3HRTA 3I56A 1YITA 1WNLA 1BOBA 5KHDA 3I55T 3PNWC 2FYKA 4RG8A 2F6CA 4XN3A 2QA4A 3DEEA 5GAN3 5IT9E 4GY5A 5GANf 2KZVA 5KNLA 5LJ5g 4XTUA 3VSLA 1SSFA 1WJSA 3JCMh 4HSRA 2X6YA 3RTRA 3SWNA 4M7AC 4MZPA 3T9NA 3ME9A 2QQ9A 1UG0A 2ZPGB 2WSCE 4J5YA 3JCMW 2PVDB 5GMKe 4ZC3A 3CCUA 2LQ8A 4XTWA 3HFNA 3GOXA 2AQEA 1P92A 3JRZA 3JCMb 2KDOA 4M78C 2RH2A 3CEYA 3LWHA 4PL6A 1KC8C 2LREA 2R7QA 3CPFA 4FM4B 5LJ3d 4MDWA 5LJ5e 1YJNA 5C6SA 3M8JA 2P0WA 4CCMA 2VYTA 2HVSA 5GAN8 2L89A 4BACA 3ZCOA 3OYYA 2DT7B 2L9SA 3FBNB 3JCMe 4F52A 1PJRA 1V29B 3FDRA 3CMAA 5HY6A 4EATA 2XI9A 3W3CA 3FBIB 3K4LA 3QJ6A 2Z16A 2KY9A 2IS2A 3SDZA 2JSPA 1VQMT 3A8OB 2LCCA 1QHGA 1VQ9T 3FC3A 2WAQA 2K3PA 3RKWA 1XNIA 2ZZDA 3A1YA 3BCAA 1WQWA 4N4GA 4JJNK 3DLMA 4R55A 3QYGB 2F4IA 1Y7XA 3CCJA 2RM4A 5GMKi 2VLAA 3JB9I 2W00A 3K4KA 1TZLA 1S9HA 3OOUA 4C0ZA 4LITA 2BUDA 3OYLA 5J39A 2VQHA 3LSHA 4M78E 4RMOA 3JCMP 1XOVA 3OA6A 3PJRA 4M77C 1MNEA 1K8AC 3HC7A 2JVGA 3EUAA 4MLOA 1WFXA 2WB1A 3M9QA 2X51A 4M7DE 4YEJA 4OGCA 2XG8D 4XKCA 4RM2A 2RA2A 2QQSA 3DPUA 2WAFA 4PJOF 3MCAB 1W36C 3OMCA 3J7AY 3V7RA 1VQLA 2M9UA 3CCQT 1Q82C 2M7BA 5CKDA 4YTLA 1AHJB 5FU6B 2V9KA 3K6GA 3GBGA 3CZ6A 2E10A 1W2BA 4B9WA 2QKLB 2XK0A 2I8DA 4NUBA 2V7FA 3X20B 1Y96B 1M1FA 3CC4T 1M90U 4LIVA 2R5MA 2VJ4A 1X01A 4HKEA 3CCMT 2RHZA 3LSMA 3K10A 4AVZA 4F7UB 4F92B 4M77D 4C9YA 1JI8A 2VKDA 3UDCA 2JVHA 3FB9A 3RQ4A 4JUVA 3N5BB 4DJAA 5LJ3h 5I2MA 1QVGS 3QKJA 3H5RA 5GAMg 4M75F 4ZDPA 2WY8Q 2RI3A 4CZCA 1MMGA 4PJMA 2R7TA 1N75A 1Q7YU 1YIJT 1VQNT 3PNTA 4PJNA 1R6RA 1X6OA 2EQKA 5GAN5 4HNUA 3OYFA 4CSWA 3RERA 2FL7A 2LTOA 3OYKA 1YX5A 4HCCA 4FT2A 5GANe 4JLGA 2GCXA 3A5ZB 3LLRA 2GFUA 3AKZA 4ZN3A 4FETA 1NZ9A 2DVEA 5FRMA 3DU6A 2M4KA 4KULA 3TU4K 4XONA 3A8LB 3LMMA 3DKYA 3C2HA 3E9GA 1K73U 1BR1A 4F55A 5CQGA 1N6AA 1VQKA 1G3TA 5J26A 4FASD 2HQAA 1O75A 4C92C 4DQ2A 2DD4A 4JRPA 1D1CA 4MMLA 4XU1A 2ZPBB 2DD5A 3OB9A 1QP3A 3X26B 5GAMj 4CCNA 2GOXB 3C4SA 4RG2A 2A3LA 3AL0C 3LSIA 1BI0A 3M57A 2L3RA 4FL6A 3S3NA 3H5NA 1YI2A 4BQQA 4L6V5 3OL4A 2JOYA 5I21A 3GLXA 4M7DC 3DLAA 2WBMA 1Y71A 2MWOA 2E65A 4U87A 2PMZA 2X4WA 4C8QG 3SDBA 1Z3XA 4XORA 2CH0A 2QQBA 5CQYA 2XDVA 4CUGA 1UGQB 4N0AC 2K2VA 1BYMA 4XTVA 3HPGA 5HK3A 2OV7A 2CV1A 3IP4B 3KYLA 4LDXA 2CZ7B 2HQXA 2LT1A 3VYSB 2IGNA 4KJZA 3QODA 3DKMA 2MF2A 2HQEA 2VXEA 5AYFA 3TREA 2K4YA 4MDXA 5HNFA 4PUSA 4BGDA 4DBQA 3LWIA 3K70D 2Z2SB 4N0AA 3DKXA 4E7JA 3H9QA 1G3YA 4JRIA 2YLCA 1MMNA 1QVPA 4EPCA 5FRNA 2JTFA 2JZ2A 4XTYA 2DPPB 3M53A 3VYRB 3HKSA 3BLYA 2K57A 2LRQA 2W7NA 1M8VA 4PNOA 2R7OA 4PKCC 2M4GA 2HU9A 3QYFA 2KPMA 4CA0A 4D1QA 1UEBA 4Y33A 4ZGDB 2V1NA 3OS2A 3M5AA 1VUBA 1J09A 4IX7A 3C95A 4B9XA 3VYUB 4XQ3A 2K3XA 2IGMA 1SAUA 1YCYA 3PMTA 3CPWA 2LBFB 1VIEA 3G2BA 2XICA 4ZTJA 1M1KC 5KCHA 4C5HA 5LFAA 1QU3A 4IUUA 3S93A 3CXCA 3TBIA 1Z21A 3BC8A 4X0GA 1BI2A 1ZELA 2KSSA 2EKOA 1YJ9A 4XNFA 3V7CA 4BY6C 5LJ3j 4A53A 2E70A 3DWLE 3TL4X 4ANJA 2V8KA 3RIRA 3G71T 3VUZA 1I4K1 4YELA 4PSWA 3J7AF 4LDWA 1X19A 3EUHC 3PSIA 3MEVA 4JS5A 2LYCA 1QVFS 1OR7C 4BI3A 2M16A 4BI4A 2KDSA 1BIAA 5CVIA 1N78A 2XKOC 1S72T 3H8ZA 3WVEB 2FVUA 3FKJA 2VC8A 1YJWA 4RLQA 2LCLA 3CCRA 3OYNA 4A4HA 3OIPA 2HPIA 1H3ZA 2VJIA 2M1HA 3JB9H 4A4GA 2E5ZA 3KUFA 4J7IA 5GAN4 3BCBA 3AL0B 2JUFA 2Y4YA 2K5LA 2OUMA 2VXZA 2RK2A 3JAME 2DXBA 4F7UG 2IG0A 3M54A 2PQWA 3M1CA 3BDLA 3CMAT 1XQHA 3OIQA 1QW1A 1JRIA 4L59A 3OW2A 3VDXA 2LG4A 5CQEA 3PFSA 4C5GA 4NNJA 1H641 1GLNA 2WACA 2LC2A 2CFOA 2L8DA 3VSKA 4NQWB 3VJPA 5D6YA 1AA7A 1UGPB 3OQ5A 2DAQA 1YX3A 1ZBXA 3K4JA 1N9RA 3LSGA 1VQMA 1FXXA 3QO3A 4BXFA 1QVFA 3VKIA 1MNDA 2Q2EB 2YRVA 2Y0SA 3E1SA 1JB0E 5LJ3g 2K5CA 2XF5A 5A2QE 4PJOG 4QVCA 2XF7A 5GAMd 2X6WA 2HVRA 4CCJA 3CP8A 1KC8U 3R6OA 3C94A 3GNFB 2X85A 5HLTA 2L5QA 4OAYA 3DLLA 3CD6A 4EMKA 4LD6A 4M75E 1KQSS 2KK4A 2P0KA 3EFSA 1YBYA 1VQLT 1BIBA 3OYHA 4Y28E 3CD6T 5GAMf 2CS3A 3EPZA 1IZ6A 5LJ5d 4MMKA 4M7DF 3L1AA 1WJ5A 2CZ0B 4XTXA 5KCOA 3EFRA 2LX9A 2CV0A 3A8MB 2CS7A 2RHXA 1WJQA 1B34A 1TT0A 3UWNA 2CZ6B 3TEEA 2MWPA 3OMGA 3L2WA 4L5GA 2VGNA 2F5KA 5CQXA 1D1BA 5GAOm 3ZRGA 5CKEA 1Y07A 4M75G 3CMET 3LGLA 2CKKA 3QJYA 4XN0A 2CW8A 1VZ0A 2RI5A 4EMKC 2ZPFB 2CUZA 3QYBA 4JRQA 4BB7A 3HOTA 2DEQA 4M78A 4JLIA 4B3XA 2O5RA 5A0GA 3PGGA 4TVRA 2VQGA 4NL3A 3QBYA 3OYDA 1NE8A 1DP3A 3OR1C 1BKBA 3HFOA 3LYIA 2R7SA 2GFAA 1LNXA 2X35A 3CCSA 2MFZA 4G6TB 2G3RA 3IAM2 2ZPIB 3SWNC 4HA8A 2H3JA 1XTDA 4XLAA 3QZ5B 4E7LA 3NWSA 2R4GA 1VQ4T 3FEOA 3K4MA 4KUDK 3Q1JA 2E12A 4B48A 3HL2A 5GAOn 2BOLA 3X28B 2BIVA 1VQ7A 4C0DB 1LDKB 2XU8A 2LBFA 4DOVA 3M58A 4M75C 3NFCA 3UNGC 4JDSA 5FU7C 3SYTA 1NPPA 2LC4A 4LIUA 4HCZA 4ELYC 4OAZA 4NOYA 2KVQG 3OR2C 4QPQA 3CC7T 1ERDA 2HNHA 2JN0A 2RJDA 2WSEE 1WGSA 3OYCA 2WA0A 4CCLA 3UPUA 2DIGA 1I81A 3CC7A 3RMSA 4ZGJB 2XF6A 4HRIA 5CKBA 2HD0A 4EMGA 4BEHA 2HNIA 4M7AB 4C2TA 2VXFA 2VL8A 1VQKT 4II1A 1PSEA 2RK1A 2VQCA 4II3A 2WSFE 1KHIA 4N4IA 2ZGWA 3SFMA 2DKGA 2KLOA 4DBRA 4FU6A 2E6ZA 1N9SA 4IZZA 2HBPA 2LDMA 3PIOA 4KBMB 3RSNA 5LL6S 3FLGA 5J3BA 1FMVA 3FDYA 2D6FA 2W4SA 1KQSA 3E9FA 1GXIE 5LJ5f 3CP2A 2ZXIA 2HPMA 1LKXA 2DIQA 2LOOA 2ZXHA 2K3YA 3U21A 4OB0B 4LDYA 3QXEB 4CCOA 3HPWA 2LY2A 3OBYA 5GANj 3MP1A 1NJIC 1W36D 2KHMA 4C0FA 5A0DA 4DGWB 3JCMf 5CCAA 3I55A 2VPLA 2EQJA 4V2SA 3OS0A 1VQ4A 3L2RA 3CCVT 1M1KU 3BDUA 3CJRB 1X1DA 2Z1DA 2DCEA 2K9LA 4XLHA 2X4XA 4MZTA 4DIQA 3DB3A 1VQ9A 2O4XB 4KT0E 1QVGA 2FUG2 1VQ8T 2GQVA 4HSTA 5DLOA 3CCUT 2QDYB 2OTLA 3LFUA 4E7KA 3TCJA 3HPHA 4F91B 1MMDA 4BJTA 1WJFA 1X75C 4M78G 1OI1A 2KP6A 3NWTA 4EMKB 3GNGA 1WJBA 1W4SA 4KUIA 4H4KC 3HSBA 3ER0A 3KX2A 4PJJA 3H9JA 3L2VA 4HEA2 1D0ZA 4PJOB 4B44A 1FX7A 2CGHA 3I56T 2X6XA 1YITT 3DTKA 3L2ZA 4Q5WA 3E19A 3F9KA 2RHYA 3VUBA 1B34B 4RKUE 4RM3A 3H6ZA 3SD4A 1U8RA 4C30A 2EQMA 3SB2A 3FIFA 2M3AA 3JB9F 3S3MA 4PLLA 4M7AG 2RO0A 3JCMV 1G5VA 4F7UE 3V8JA 5I2SA 4HCBA 4ZDLA 5LJ3f 3G6ET 3RMQA 3I9V2 1IRXA 3W2WA 4C0DC 2OTJT 3ZFJA 2MI6A 2RJEA 1YHQA 1KD1C 1X4PA 2XD0A 3SEQA 3OWTA 3CCJT 4PJLA 4BQOA 2OTLT 5GMKl 3A2KA 1FMWA 3BY7A 3HRUA 1D0XA 3P8DA 2LH9A 1VQ5T 3ZQQA 1UAAA 3PUBA 2BVMA 3QOEA 2ZSHB 1G59A 3H9GA 4NS5A 3LGFA 3FHNA 3ASKA 3JSCA 1VQ7T 3ZXSA 2L7KA 2R7XA 1FWZA 4NC7A 1MHNA 1WJAA 2RI2A 4E7IA 1U1TA 2GF7A 5CK9A 5GAOl 3UT1A 1DGWY