2L5QA

Solution nmr structure of bvu_3817 from bacteroides vulgatus, northeast structural genomics consortium target bvr159
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
142
structure length
142
Chain Sequence
MLKTILSIAGKPGLYKLISQGKNMLIVETVDAAKKRVPAYAHDKVISLADIAMYTDAEEVPLSEVLEAVKKKENGAVASINYKKASADELHAYFAEVLPNYDRDRVHNGDIKKLISWYNILVNNGITEFVEAPALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Northeast Structural Genomics Consortium Target BvR159
rcsb
source organism Bacteroides vulgatus
molecule tags Structural genomics, unknown function
total genus 26
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2010-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18347 DUF5606 Domain of unknown function (DUF5606)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1650 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2l5qA02
2.30.30.730 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2l5qA01
2L5QA
chains in the Genus database with same CATH superfamily
1UUEA 1CSKA 1YIJQ 5IN1A 1HBXG 4PKCC 2OBPA 4G6QA 4HQEA 2VJJA 1OYXA 4AVZA 1OYIA 2OJED 2YUOA 2EQJA 2DPUA 1K79A 3GTKJ 1KIKA 3JCMP 4LLNA 2DW4A 2DXUA 2FMYA 2MAMA 1XTAA 3LGFA 1SHFA 4MQVA 4PJNA 4OMFB 2JT4A 1M1KR 2KVQG 1SFOJ 4HX7A 1NHAA 4MTDA 2R92J 3RSNA 5M3MJ 1GRIA 2CS3A 2VXDA 2ZNYA 3J80K 1VIEA 2COBA 3BTIA 2F4IA 2HKQB 3LH5A 1J3TA 4AG2C 3A01B 4IQ4A 1MZBA 2F4OB 1SG5A 2E5ZA 2YPRA 3MKLA 1VQLA 1WWXA 3RPUA 2OQGA 3KX2A 2W10A 3J80E 1FYKA 1VNDA 3OS1A 3ZMUA 2VUBA 4LXCA 2HCKA 3H9JA 3I53A 2DMOA 3PT9A 1HKSA 2RI2A 1LB2A 3L2ZA 4JJBA 1D0ZA 4PJ0C 5FKLA 1WSUA 1WVRA 1T95A 5FFZA 4U0WA 3ZQGA 4KA4A 1TL8A 1V55H 1ULYA 2F5KA 4L9JA 1MJ9A 2HQXA 4C8QB 4U0YA 1H92A 1RKTA 1O9SA 4XTVA 2X4HA 2E6ZA 1UHSA 2QCOA 3QAHA 3NTHA 1M4ZA 1Q1HA 5GMKm 3H92A 3PFYA 1HF0A 1QW1A 3GFMA 3GTGJ 1VQ7T 2DPPB 3CD6Q 1VQ8T 2J6FA 3HPWA 1S1NA 3GFJA 2F5EA 3ZN1A 1OFCX 2BVLA 2XD0A 4XTYA 5EG2A 4M3EA 2FL7A 1I5LA 3M0SA 2D9TA 2V6CA 3NARA 4PZJA 1ZUKA 3JSOA 3HOUJ 5AONA 2KLOA 1UGPB 1FIAA 3I54A 3RQ4A 3FX3A 4AIHA 1FLIA 1SAXA 1M1KC 2OAZA 3NTIA 4NC6A 2W25A 2IVMA 2MH9A 3PM1A 4XONA 1FYMA 2VQCA 2D5VA 4A3BJ 1ACIA 4UXNA 3R61A 1M1GA 3OQ5A 3QO3A 4IIMA 2MA3A 1ZSGA 2GXAA 2VQGA 3W3CA 1X1AA 2QSFX 1IRXA 1Z67A 4BHCA 4NL2A 5GAMd 3CCJA 1EV7A 3CCLT 1MV3A 1H3ZA 1RAGB 1VQKQ 1VQ6A 4A6EA 1WJCA 2HKXA 4XLAA 4A0ZA 2QYOA 1WZ2A 2WACA 3C4SA 1VQ9T 4HCCA 5HDNA 2P4WA 1SFXA 3S32A 3J81K 4C5IA 4EM1A 2H6CA 4A0YA 2DIQA 3CCVQ 3LA7A 3P7NA 2O8XA 4ZYAA 1C1AA 4CC3A 3S17J 1DU6A 1KD1U 4F7UA 1U5TA 2Q1ZB 1OCTC 1RC9A 1OZ3A 1M90R 4ANJA 1PHTA 2X9HA 1V4RA 2VUMJ 2OC6A 4OAYA 3ZXSA 2IAIA 3NPFA 3HDDA 4MGRA 3AFHA 3L2CA 1BW5A 2RPNA 4J9DA 2STTA 5L3DA 1JO8A 3I56Q 3DKYA 1JJ2S 1I4K1 2RH2A 4XU1A 4YIRX 2K9NA 4Y52J 2LNHB 3EGDA 2OZ6A 2OD5A 3BCBA 2H3EB 2ENMA 4KULA 4X34A 2KKOA 5K5QA 3I5RA 2KISA 3CCQQ 1XN7A 2OV7A 1FC3A 2V1NA 2O9LA 2DXTA 2RF0A 2VB6A 3GFLA 1VQ7I 3CMAQ 3E5QA 4OB0B 3HOYJ 1VQ8I 4YFXF 2XDDA 1T08B 5E1WA 1PKTA 2GTOA 1T3SA 3G4ST 4PFZA 3LA3A 1P7IA 1XB4A 3MCZA 4M78D 1ONVA 1H9GA 1ODDA 3L2VA 2ZPHB 3VUBA 4KIGA 3F8MA 5E8GA 1JKPC 2VXZA 5I21A 5GAN8 1B34A 4QWQA 2PX9A 4RAFA 5GAMg 1MD0A 1I6XA 1DPUA 1RESA 1M3BA 1IUFA 4JUVA 3ASOH 2K5IA 3X24B 3DF8A 3VDXA 2EZHA 4A3FJ 1CGPA 4C0FA 1YHQT 1BIBA 4D0PA 4XQFA 2O31A 5J3LA 3OYNA 2L54A 4DQ2A 3K4NA 2CP2A 3AT1B 3CCLI 3GFIA 2IP2A 4A6DA 2KR3A 3AG4H 1YITQ 1K78B 2HZYA 1YFHA 2ROLA 2LFBA 2GZWA 2LT4A 1VQ9I 5KCMA 3HTRA 1M90C 2QEXQ 4FHTA 3LQRA 4M7AG 3BR1A 2MLGA 4U87A 4RA2A 3DLLA 1ARKA 2L9VA 2YS9A 3D5LA 5CKTA 1OV3A 4JZ4A 1B1BA 2A07F 1W1FA 1WFWA 1YJNQ 9ATCB 2QQAA 3CC7A 3SFIA 1U78A 4FSXA 3FC3A 2ID6A 4XRFA 1B7TA 1UJYA 2CP5A 3E2UA 2CFOA 3HRTA 2DM1A 2QKMB 1K9AA 4CCLA 2XAQA 1O3QA 2EYYA 3A8MB 3SWNA 1SSHA 3IAS2 4KBMB 2LNBA 3KEYA 5J40A 2HOTA 2E41A 5LGNA 2FG0A 4HRIA 1IHVA 1N25A 2YLBA 3JV3A 4N9IA 3LH0A 1T56A 2IPQX 2JTVA 5A0DA 1G2BA 4BE0A 1SVLA 3GTPJ 2GBYA 1ZG1A 2WAQN 2LRDA 3G4SI 2J6KA 1Z9CA 1EH7A 1ZGWA 3ZMVA 1TUCA 3PFSA 4M78G 5AYFA 4L5EA 3GLXA 1DP7P 5GANd 3DPUA 4DYQA 4R79A 4M6YA 2E2JJ 2KEAA 3CXCS 4U88A 1MBKA 2VBYA 2CGPA 4C92F 1DPRA 2L2PA 1FPQA 1S8NA 3C1DA 5E1XA 4E4HA 1SFEA 2QA4Q 3CC4A 1K73C 2YUSA 5D6YA 2FBIA 1J09A 3M1EA 3JCMe 1SSFA 3LGLA 1YHQI 4R55A 3ROUA 4ENNA 1I0CA 3I4MJ 3LFUA 1MBJA 3URGA 4BACA 2EFPA 3OYAA 4ZYHA 3KP5A 5EGOB 4HX4A 3W2AA 1X43A 5FRNA 1HDPA 1TWFJ 3OOPA 2E1OA 4BJ6C 4OIRF 1F5TA 1Q7YR 2K2VA 5HKCA 4XRMA 3S1RJ 1ACMB 2JTEA 3CD6T 4FQGA 4PUSA 3PGGA 2KIUA 1PP8F 2EINH 3JRAA 1AT1B 1JJ8C 1YIJA 3MZHA 2KXDA 1O75A 3A0HC 4NNJA 1F1ZA 1R5HA 1ZGAA 3FMSA 1MBFA 4I02A 2CZ1B 3QUIA 3ELKA 3KYLA 5CCAA 2GQIA 1IO2A 2VWFA 3QZ5B 1Y96B 2FEIA 1W4MA 5EF6A 1O3RA 2A7YA 2CW8A 2VYTA 3VS4A 2LF7A 2P8TA 4M7DF 3CO6C 5KVRA 4CA0A 1N8RR 2VN2A 3HHGA 4FTHA 1X6GA 4C0DC 4J6YA 3GUDA 5HNFA 3JREA 2CP6A 2E1MC 4BAYA 4AYBA 1ZELA 2F5TX 2HL3A 2ZXHA 3CLOA 2WB1N 3TDUC 3VRZA 3P9IA 2K2MA 5C0MA 1CKBA 2NS7A 1YI2Q 3CC2A 2GNCA 3CQTA 4HDUA 1VQKT 4BBRJ 4XRSA 1TUDA 5GPCA 2A08A 2K3XA 1Q86R 3LSTA 4VUBA 3CCRA 3RDIA 4UV8A 4PK4A 4HNVA 1MHNA 4A3JJ 2RMOA 4OP0A 3OIOA 4BHBA 2VL8A 3CCVT 2M0CA 3FBIB 1KQ8A 3I55A 1M2VB 2VGMA 1TC3C 4RTXA 1AWWA 1P2FA 2VJ5A 1VQNQ 4JS4A 3HUGA 1AD5A 2E7WA 4HVWA 3I56T 2LQNA 1SFUA 2X6WA 2LCSA 5F1JA 5DV5A 1Q7YC 2A37A 2E36A 1B72A 3K9TA 2CUJA 4EJVA 5K7FA 2DE0X 5LJ5g 4QT7A 1MMAA 2K4YA 3MJXA 5IHIA 2FOWA 2KBTA 5CKEA 3X26B 2H1KA 2BUDA 4QVCA 4L6V5 3CCEA 3KLOA 2V1UA 1R71A 3OA6A 3CD6I 3DCFA 3MVPA 4M7DC 3QU6A 1PJRA 5L3BA 2F4MB 3S3NA 1K6OA 3UA7A 2L5QA 3M7GA 1QCFA 2XF5A 2O6GE 4CDGA 3LAJA 3D7SB 4RLFA 1QGPA 4J6WA 2WTEA 2JMWA 3WGHA 4BD3A 2H27A 4EPCA 4XTXA 1LJOA 5GANe 3JCMV 3BG7A 2EQIA 4IHXA 2B0LA 5FLXE 1WHLA 5EZGA 1C0WA 2DA5A 3PO2J 2D1VA 3WVDB 2JNGA 3CUOA 3CMEQ 1GCQA 4C92B 4BEHA 2RREA 5FFXA 5CQXA 1VQKI 1YITT 2OTLQ 5K5RA 2LBFA 2QEXT 5J4YA 2EZLA 3CCVI 3V7RA 4ZN3A 3UA6A 3TP3A 3CTAA 3EPZA 3EYYA 1PG5B 1XMKA 3Q0VA 1ETVA 1CKAA 1PM3A 2W24A 4KIBA 1MMDA 2TRTA 4C3IJ 3RCOA 1QA6A 3VYRB 4WF2A 2CUDA 4JRQA 4XQ3A 4EM2A 2CQXA 3W2VA 3I56I 2V8KA 1VYTA 1R0BG 3P8BB 3ZBDA 1V29B 1G3SA 2W85A 3HJEA 2XAGA 3BY6A 1GLNA 3MP1A 3DP7A 2VQLA 5IHKA 4M71A 3BR2A 3S6WA 1ETYA 3G1MA 1OCPA 2KJCA 4XU3A 3G71A 2DYRH 3U9GA 4AU7A 3REOA 3KE2A 3OSVA 1XOVA 2XGDA 4PFOA 2KROA 1RLPC 5FU7C 1NJIR 2HKOA 4OMPA 2Q8KA 3K1NA 3X25B 5CAIA 1SRLA 1HSTA 1W2BA 4C30A 3HOZJ 2BE9B 2DD4A 1UG2A 4RTWA 1VQ5Q 2PBIA 2K4JA 4C8QG 2Z5UA 1RUWA 1K76A 3MKZA 2J06A 2WV0A 5HLHA 2M45A 2RKHA 4G8XA 1OR7C 2QA4T 2EZIA 1LVAA 4OMNA 2DO7A 3H0HA 4Y33A 1RNLA 2KMUA 1R58A 4DOWA 3CCSA 5JI6A 1VQMQ 4CC7A 4DZJA 1IJWC 4DYCA 3VS1A 1BA5A 1FNNA 1NLOC 3NFCA 2QBYA 4CXFA 4OB3B 4ELZC 5GAN4 1F9NA 5B1AH 3OBWA 1UHMA 5C4JJ 1G5VA 5L3CA 1E6GA 5KYWB 2CSIA 4CO8A 2JOYA 1NH3A 1YITI 1VF9A 5LGTA 1ZARA 2HQAA 2E71A 2M4KA 4HQMA 4EJWA 4RB2C 1PC0A 1ZLJA 2QEXI 1JJ2P 2RNGA 4RCCA 5I2SA 3MFKA 2PMZN 5E79C 2TDXA 4A3IJ 3EG3A 1IRFA 3SDGA 4DW6A 2I0NA 1QO0D 5FLVA 5BNGA 2CQKA 3A1YA 4B47A 2DYSH 3LQQA 5GAMe 4EMKB 3J7AY 4IUUA 4ZZLA 4LD5A 1LQ1A 2XPWA 5ED4A 1VIFA 5BQTA 5LJ5h 2HZTA 3HG9A 2CV1A 2IXSA 4ELYC 2KYBA 5GAMf 4CYCB 1IRZA 2IIMA 1NJIC 2PG4A 2HBPA 2QUFA 3S15J 4I99C 3HOTA 3KPHA 1AWJA 3JRDA 2HQHA 1N8RU 3IWFA 2RN8A 2VT3A 4L59A 1YI2T 2Y75A 4BY6C 2AIRB 1Z9ZA 3ZP5A 4BQQA 5GAOm 3U1DA 2P7VB 2H3JA 1YLFA 1R77A 2AKKA 3ZEHA 3BJ6A 2P7CB 5CK9A 3R0JA 1I5OB 1Q86U 4M3FA 4YIIA 1A04A 4ESBA 2QA4I 1VQNT 2BZTA 2RAEA 3HFNA 2MWOA 4OMLA 2AT1B 4HCKA 2GXGA 4BDYA 4Q5SF 3GNFB 3OMGA 4DGWB 2RDPA 4ZZDA 2QWWA 2DAQA 2O4XB 5F27A 1P7JA 2CSQA 2RK2A 4IUPA 3QSUA 2G0EA 1JUPA 1SANA 3PSFA 4PSWA 3L2UA 4ENJA 1JXMA 2CP3A 1CQTA 3M8JA 3HKZN 5CKBA 1U2WA 3D0SA 4R1HA 3VFZA 1K4SA 1H8AC 3EAEA 3H35A 1QPIA 2M1HA 3M5AA 5DTDA 1UHCA 1YJ9A 3ZR8X 1HQCA 2L4AA 3S8PA 1D0XA 3BZ6A 4JP0A 1VZ0A 1XS9A 3W6VA 5HCKA 2DEUA 3B73A 3EUHA 2YX4A 1LE8B 5HS7A 3X20B 1RLQC 2EIMH 3FZVA 1U3OA 3MKWB 5B5EC 1W7PA 4RB3C 1NK3P 1M3CA 4EJTA 4MMLA 4E47A 4M9XA 4J9IA 3Q1JA 2R7OA 2JTFA 3Q0UA 3M3YJ 2KYMA 4IJAA 3TP0A 2HYGD 2Q2EB 3KLNA 4L9NA 1UB9A 1OU8A 5HK3A 3H0IA 1V5EA 4BY7J 1BJAA 3PNVA 4X6AJ 3CMET 3J7AF 1R0CB 1E7OA 4UB8C 2QK0A 2QYZA 1YI2I 2GTJA 1N78A 2K9GA 2YHTA 4MLOA 4QQ6A 2LTOA 2LVSA 1ZK8A 3M55A 2OTLT 2HVQA 1FOYA 1WJEA 1I81A 3HRUA 5KE2A 2K9SA 2E7XA 4HT8A 1Y0UA 2K9LA 4OMYA 2R7UA 1N27A 1X1PA 2KZVA 3RZDJ 1X01A 1MDMA 1WRJA 4UVBA 1U5TC 3V7SA 4DZPA 4BGDA 3HM5A 3TEDA 3QDRB 4J6XA 2N8GA 1VQNI 1UG1A 2KIQA 4CI0C 5CYVA 2DJNA 1UG0A 3OYLA 1JT6A 3T5XA 1JKQC 2GLOA 3ZPLA 2X4WA 4JK1X 1X3ZB 2IA1A 4G6TB 5EG0B 1UDLA 1V76A 4FU6A 5FWBA 4F7UB 1TLHB 2ISYA 2M34A 2DOAA 5TJJA 1BN5A 1IDYA 1USTA 4A12A 1LOJA 2FEZA 2JVHA 2NUZA 1Q1VA 1J75A 2ZMEB 1ZRCA 3FRNA 3HOSA 3P9CA 4M9SA 1NYFA 2QGFB 1UJ0A 5HVQC 4K11A 5FU7B 4D9JA 3CZ6A 2EJFA 5ILSA 1TQMA 4RTTA 3EFOA 3LW5E 4DNCA 3EFSA 3HOWJ 3K1PA 2ID3A 2NVUB 1SHGA 2NYSA 1OPCA 2Z0WA 1WHKA 1VQ5T 5BOXA 2HQRA 3QYBA 1RAFB 3PIPA 3VS7A 5E3LA 1X6BA 3SEMA 1Y8RB 4LOCA 4QQDA 1ZYRF 3BPVA 3H0GJ 4HKEA 3VYTB 3ZRGA 2BE5F 2DL4A 3PIOF 4RCBA 4LJZF 4BU2A 4JBAA 3MKYB 1ZSZA 1SD5A 2DT5A 4MO7A 2B63J 5LJ3d 1VQMT 4Y15A 4F7UF 4RB1A 3FHNA 3HBLA 4UNOA 2Y30A 2QG9B 1YO5C 3EG9A 4OB2B 3OIPA 3CMEI 3CDHA 5DM7R 3FDRA 1FMKA 2A6HF 4XTWA 1LNWA 5LJ5f 5L3EA 2FMLA 2OTLI 4D8KA 2DT6A 1IZ1A 1UGRB 3NMZC 3KXTA 1JU5C 4HF2A 2MPXC 3DEEA 3WTZA 4YELA 4HBLA 1S29A 2RNJA 3CLQA 4ZYGA 1SMYF 2WSFE 1X58A 5EC7A 4XU0A 3KFWX 3BG3A 1T39A 7AT1B 3KP6A 1YWOA 2IT0A 1D8JA 1UZCA 2L3DA 3F22A 2XPVA 1VQOI 4BYYA 3C95A 1KU3A 2LJ3A 3SWNC 3SZTA 1WXBA 2VKDA 1WI3A 2TCTA 3IQLA 3BG9A 2Y4XA 4JX6A 2KIMA 2PMUA 4KUDK 2RN7A 1LPQA 3KCCA 3H1CA 1FEXA 4RMNA 1S6LA 1YJWA 2BYVE 3LSJA 3G2BA 1NK2P 4RAYA 2HBWA 4XAXB 5M5XJ 3CCJQ 1WLPB 3ASKA 1K61A 3VYSB 1VUBA 3WTVC 1PP7U 1R49A 2HDAA 4M75A 3TDZC 4F7UE 1VQ6Q 1FOWA 4II3A 4M77A 2D6FA 4F17A 1VQ5I 4AIDA 2BW3B 5L3GA 4UUSA 5E3OA 2D45A 1WXTA 2RJDA 4L5GA 2KQRA 1FYLA 1IAWA 4XU2A 1JEGA 1A6IA 4Y17A 4CCKA 4Q48A 4QQGA 4NUBA 2P0KA 1SD4A 2DQLA 2H6BA 4M6VA 3MD2A 3I3LA 4A0XA 1VQMI 2RJEA 3GO5A 3V8LA 1H0MA 2CP7A 3JB9H 3DLMA 2ISZA 1PD0A 1KD1R 1WHJA 3HFOA 1XDSA 3HOXJ 1R7JA 1W2BS 2O01E 3MEWA 1WHMA 3BR6A 4B1RA 1VA7A 1X3WB 1X4PA 1WDXA 3GMEA 3EHRA 3SHWA 4TV7A 3M4GA 2E10A 1G3TA 4ZJZA 5J1RA 2NUTA 1IN8A 5AT1B 3LWFA 3X2QH 1Z3YA 3M0TA 4GDFA 1IGUA 1CF7B 3I4PA 1XC5A 4IHYA 4C92G 4L5JA 3JCMg 1E3OC 4A4EA 2G9WA 5H6RA 4B09A 1GV2A 1BBYA 3OW2A 4XK4A 3CQZJ 1ZHIA 3DTEA 4QKUA 2QDLA 3OWTA 2E2IJ 2F48A 2DTOA 2KNBB 3LOCA 1ZG5A 2OTLA 2HPMA 2DA9A 1OPKA 3EGXB 4PNOA 4UVCA 4M3DA 2JA5J 3RNJA 1GUUA 3E5XA 3OYBA 3VU3C 1W5TA 3MKDA 2IPOB 3H0FA 1VI0A 4OU0A 1UJ8A 5FO5A 2XB5A 1HKQA 1QZZA 1U5TB 5D5XB 1QLYA 1W70A 5DCMB 3EETA 2E34A 4EMSA 3FDYA 3INZA 2FNPA 4ESRA 1KD1C 3JSPA 1R6RA 1U9NA 4ENMA 2L0AA 3OBYA 3WE2A 2XAUA 4NQWB 1V1CA 4YG2F 2JT1A 3M8FA 2LJ1A 2ZFWA 2LVMA 4CUGA 4KGXB 1IO6A 4MDWA 1FMWA 3QODA 2VKEA 3EGDB 1HA8A 5J3BA 4QIWN 2NNYA 2IS2A 2KAFA 2JA7J 1MUZA 2R5MA 4N0AA 3E3VA 3ERED 2NLUA 2CQ7A 4V2FA 1JB0E 3CCMA 2EA2A 3K10A 4MTEA 4M7AA 2EJRA 2C0IA 1G4DA 1QBJA 3GZ5A 1ZLKA 3IHUA 4B44A 3M54A 5FWCA 4J00A 4IHWA 5GAMj 4J8OA 1KQ9A 2ZSHB 3NRVA 5CVVA 1HCRA 1WQ7A 1KHCA 3QQAA 5KYYA 4J9CA 4N9HA 5D6FA 1EX4A 2WB1A 3V8JA 4JPBW 4A2UA 2LMJA 1KU2A 2DODA 3O6BB 3TO7A 2VJ4A 4IOAF 5EZHA 2KDZA 1I6HJ 2YT6A 3O2PE 2A36A 4F55A 1FBUA 4CC4B 4V2SA 2P0WA 2V1DA 3BG5A 3SEZA 2XV4S 3WTWC 1AHDP 3HTSB 2W48A 4A3DJ 1JRIA 1RAEB 1YTYA 2OU2A 2OTJT 2VC8A 3C7JA 1GT0C 4A3MJ 3R6OA 4LK0F 5EEGA 4CZZA 2DL3A 2MCNA 2EFOA 2FOKA 5CLSA 4CCOA 1H8KA 4Y13A 2K27A 1K9MU 2DJZA 4M7DD 2L3SA 3NWSA 2KRMA 1GCQC 5B66C 1WI9A 3C2HA 1RL2A 2NUPB 1Q81R 4J19A 5A2QK 3B02A 3PUBA 1LCKA 4M75D 1TBXA 5F0HA 2V9VA 3FKIJ 2E3HA 2MK5A 5EJCA 5IYCJ 3K4KA 3T1BA 4IKFA 3VPRA 3E9GA 5KYXB 2WC2A 1IXRC 4Y28E 2ESNA 3D1NI 4HV5A 3DBLB 5E18F 2EBIA 5KK1A 4NHJA 3Q5FA 1TSFA 2FYKA 3M0UA 2E64A 1WHUA 4YFKF 2R7ZJ 1AWXA 3OYMA 2L3PA 2L9RA 3I59A 4L9VA 1KU7A 1R5ID 4B9WA 4F93B 3SWNB 1OX9A 2DFFA 4QPOA 2LJ0A 3RKWA 1WA7A 3CJNA 5GAN5 1G3YA 4JQFA 5FKMA 5GAEJ 3ABTA 3LSPA 5H20A 1XPXA 3P5JA 2X4YA 4LUEA 3HL8A 2KP6A 3F9KA 4D1QA 4FYXB 5DCFA 3P9KA 1SC7A 2HSPA 3QPHA 1EZZB 1LKXA 3F3XA 3HXLA 3CCJT 4G7ZF 4JRKA 3EH1A 5ECAA 2FPDA 3BCAA 2J7IA 4XL9A 2LKSA 5ILUA 2X1CA 3JCMh 4N4NB 4HAMA 3GEZA 2X4XA 1VQ4Q 3WGIA 1D1BA 2CW0F 3BJOA 3N97A 1BU1A 1VYUA 2FPFA 4DOVA 2ZXJA 3CCRQ 1TNSA 2LOOA 2VBZA 2XIGA 4KN7X 3CJTB 2ZJ2A 2QSHX 1T0FA 4L0ZB 2OTJI 1Z7LA 2CUZA 5HLIA 3RI4A 1GHCA 2BIVA 4GY5A 3VS3A 4DA4A 1FMVA 2IGMA 4XKCA 2MC3A 3DPTA 3M53A 4RDUA 2L7FP 2CH4W 4HCBA 4E7ZA 4C2UA 4WXCA 2X3XD 1K4US 1JGSA 4NOYA 3SXYA 2DYBA 3JRHA 1KGSA 1IN5A 4GFBA 1WIEA 3EG0A 1M3AA 1RI0A 2CUFA 2PZ1A 4OF1A 2W84A 1TU0B 4WK8F 1D8KA 2ADUA 5IP7J 2Z16A 3GVAA 2CZ0B 4PLIA 1Z3XA 4CYDA 5FW9A 3TVTA 3CCEQ 5D8KB 2XAJA 4HOBA 2LSOA 3UATA 4XLPF 5DEQA 5DUKA 1VQ7A 1QHGA 2XRNA 3CUQA 3MEVA 4A4FA 2CG4A 2BHZA 1VQ8A 2K3FA 1Q82R 2AHQA 5DD4A 3K0LA 4RGUA 2JQ7A 3S1QJ 2VBXA 4IEJA 3VV0A 1BM9A 3QOEA 2ECCA 1QKXA 5HLTA 2JPCA 4OMZA 3NHNA 5E3NA 5KAIC 4A3LJ 3I9V2 3IKVA 5GJWB 3Q0WA 4G9YA 5FKOA 3L1AA 3R0AA 3A4CA 4MZTA 5KYNA 1ZBJA 3RKXA 1LEBA 2E12A 2X3WD 2EJ9A 2GIVA 1BR2A 3VS2A 1E6HA 2WBMA 3E97A 4ZTJA 1K0XA 3DKWA 1LDJA 3PL8A 3CCJI 1QCNA 4MDXA 2GXBA 2BTTA 4GLKA 3UKGA 1Y8QB 1QKWA 2AZSA 2X35A 5CQYA 3CCLA 1RR7A 5HY6A 4AM3A 3QIIA 1VQ9A 2BKDN 2A28A 3A02A 2WAFA 2ABLA 5LJ5j 2A3LA 2XG8D 2LP5A 2R93J 2F6CA 3HUGB 4XORA 5CO7A 4A3GJ 3DBHB 4YIFA 3I58A 3FIWA 1D3YA 4LK1F 2HDDA 2EGEA 1MMNA 1NEGA 2MWPA 5DUIA 4X0GA 2AXTC 5CQEA 2JMCA 4RTZA 3A5ZB 3TW7A 5IXFA 1BOBA 2IGNA 2KRCA 1IW7F 3RPUD 3V7CA 1N6AA 3PMTA 2BXYA 4F7ZA 3ZQCA 3G71Q 5GAOr 2ELKA 4CHUA 3BDLA 2DRKA 5JVGF 3QWXX 1Z77A 1FY7A 4BE2A 5LJ3e 1TNTA 1NLPC 2VXEA 4JJCA 1KYZA 1XGOA 2OCCH 1EH8A 1UMQA 3EUHC 3D5SC 4LIUA 3TOAA 3QYHB 4OGEA 2KJBA 2XRLA 2JSCA 2V9PA 4PFPA 2XF6A 1X2NA 3W2WA 1FTTA 1JKOC 1K0SA 5HNHA 1BI2A 5FRMA 2RJFA 4XOPA 5J4VA 2ZJRF 3DB4A 3EUAA 4DBFA 1ON1A 3ZQ7A 1DUXC 3A01A 4IXAA 3G73A 2W00A 2M9UA 4BUPA 3VS0A 1U8BA 3SD4A 3E0JB 2JJ7A 4RGXA 4GBQA 2LY1A 3I71A 3S2HJ 3I9QA 4RBOA 1JXOA 5GMKl 5FU6C 2DXIA 4LD9K 2X48A 3F6VA 3KP3A 5D4SA 1IN4A 4DBHA 5GAN3 2PJRB 3M1CA 3BTCA 2L3QA 2ME0A 2XIDA 4JS5A 1T33A 2NVQJ 1AKHA 3PQKA 3DKMA 2XUBA 5IT9Z 4X1VA 4XIDA 4J9GA 4HG2A 3WODF 5IPAA 2JPBA 3HKZA 5KAFC 1E2XA 1WJBA 1YX3A 2FNAA 2NYXA 2HDCA 1B07A 1G83A 4C8QA 2QENA 1Q81U 2Z3YA 3H36A 3HC7A 2DL7A 1Z6RA 3IAM2 1X27A 3OYCA 3IP4B 2O9SA 4KGVB 2LQKA 2CMPA 3QP6A 1KSWA 1YIJT 1W2BP 2VPLA 3OW2S 2V9KA 2QASA 3J81E 1YOVB 4XBFA 2E19A 5GAGJ 1TWHJ 3GBGA 3KZIC 4KNYA 5C6SA 3JCMf 3VYGA 2X6OA 4JYKA 1VFCA 3JAMK 1JQQA 3H9NA 1AWOA 4CGZA 2GQVA 1DGRM 4BB7A 1ENHA 2X0LA 4PLLA 3AG2H 4XLFA 4B3XA 3SDZA 4EJOA 4J7FA 3THKA 1QVGA 1MNDA 1Y07A 3ZMSA 2DFIA 2EFQA 2WSEE 1YJNI 1BJZA 2DZ9A 1AWCA 4NS5A 1QNTA 4AWXB 3F21A 1XJWB 3A8GB 3JCMc 2MD0A 2IS6A 4LMYA 1VQ4T 3IH4A 2DOFA 1O3SA 2EKHA 3CCRT 5DLOA 4DBQA 2RQWA 4KT6A 5GANg 2JUCA 4M6XA 3I55T 2PMHA 3FJ5A 5F64A 2ZGWA 1NJIU 1BCOA 4I98B 5HODA 1ZSZC 2HL5C 2ZPBB 3KUFA 1BL0A 5GMKe 4NC8A 2DETA 2HVSA 2EFNA 1SPKA 2CREA 2P6TA 2QBYB 1XTDA 3KBGA 1IN7A 4EM0B 2ZJPF 2F2VA 1S9HA 2CQNA 2G7HA 2Y2ZA 4EQQA 2R5ZB 3VOEA 4H4KC 1YQAA 3F70A 3WXMB 4Q5WA 3GPLA 2R7RA 2EJGA 4JX4A 5GAMh 3HB9A 4KMFA 5GAN2 3CCET 1PVEA 5DS9A 4KISA 1A35A 1A36A 3QKJA 4EMHA 5J39A 2XDVA 1BW6A 3FJPA 4Z88A 4X1EA 4LG0B 3LLRA 1WH7A 4JLIA 2HNHA 4EVIA 2DD5A 4XK8E 3CD6A 3BLYA 1STZA 2O8KA 2YUQA 5KHDA 3HL2A 2LC4A 1UGSB 1GL5A 3WTUC 1GXIE 1U0JA 4YEJA 2LDUA 3PQJA 3T0YA 4BJTA 3DB3A 3LX7A 2BHYA 1Q82U 1XQHA 3VRYA 2F5DA 3CCQT 1HSJA 1T98A 3OYFA 3G1OA 4FE4A 5HS8A 3PIPF 4LN2A 2ZSIB 5KH6A 3DTKA 1N77A 2FX0A 4L0YB 2O0YA 4JOMA 1FXXA 3CCUQ 3CMAT 2KPMA 4F7UG 4G6DA 4KIFA 3DEWA 2MABA 3DKXA 2F5VA 2R58A 2R5AA 1DP3A 2RQTA 3LYIA 4LDYA 2EWNA 2CZ7B 2DX1A 1ITYA 1FSEA 1HW2A 1GCPA 1N8RC 1PUEE 4PJOA 3AL0C 2X51A 2FSWA 2YLCA 4M75C 2B7EA 2QZ8A 4M77C 3CJQB 1QZEA 3RPQA 3GZ6A 4Y3OA 1T8IA 1VQ4I 3CCRI 2CUEA 3BR0A 4MFDA 1O7FA 1W4SA 1TW2A 2LYCA 1K78A 2JWTA 2GA2A 3GZNB 1X75C 5HLGA 1JKRC 3I55I 1N9RA 2K86A 1Z0XA 2JW4A 2PU9B 1Q86C 2HQ5A 2K5LA 2DA6A 2FUG2 5GPAA 4J9EA 3BY7A 3F8BA 3E1SA 3E6BA 4XR6A 2HI3A 1YP5A 1ZX6A 2L0KA 5CPRB 4QTRA 1YCYA 4UUTA 2D0QB 4W1UA 2DU9A 4RAGA 2WY7Q 3TO9A 5A0LA 3G71T 1PYVA 4RAZA 4ZDPA 2E70A 2RHUA 2YSQA 2GCXA 1HLVA 1ZAOA 3CCEI 4LUDA 1ZRDA 2L4MA 5A2QZ 3K1MA 2DJIA 3OMCA 5CKFA 4GCVA 4S04A 4A3KJ 4BY1J 2K5CA 2FF4A 2Y0MA 5LHIA 2BGCA 1AVZC 5BPIA 4N4HA 4ESJA 2M4GA 2R4GA 2E2HJ 4ZDOA 1PUFA 3QP5A 5IOZA 2E6NA 1W7PB 4I0AA 5FB2A 3FM5A 5K7ZA 2NVXJ 4IVNA 1A5JA 3M9QA 4HF1A 1B6AA 3A8HB 4M75F 1HW5A 2E35A 3LNQA 2D0NA 4M77F 3CCQI 3PMIA 3RESA 3E6MA 3FM3A 4D5CA 1EKEA 1W0TA 1FJLA 1QVUA 4FX4A 2MF2A 3P8HA 1GBQA 1K73U 1RPWA 4B3AA 1QVFA 3CMAI 5FU6B 1B8IA 2QSGX 3LMMA 2JA8J 2HOSA 3HSEA 3FEOA 2FZGB 5I22A 1YX5A 1IGQA 4MZPA 3FMQA 2K85A 2DMPA 2DF6A 1WCMJ 1X1DA 2QXFA 3ZQIA 1MBHA 3K4CA 3S3OA 4BXXJ 1IUYA 2VASA 2ACJA 1UFFA 2HQEA 3L2WA 1TS9A 5GANh 1IHWA 2EFIA 3GTOJ 3BR3A 4ZGEB 3QZ9B 2QF7A 5BS6A 5HDKA 3PNWC 5GAN6 3TCJA 1OZ2A 2HFHA 3GW2A 3JRFA 5F0FA 4D5FA 3JCMb 2BV6A 1U1SA 1MJBA 3L2RA 2EQUA 2P0QA 1WPKA 4M7DE 3HIFA 3I5UA 3SHFA 4N0AC 5GAOp 2LH9A 4LB5A 2EVRA 4QPQA 3HKSA 5CVIA 3BR5A 1FOXA 4JJNK 2FBHA 2V79A 3SQNA 1MBEA 1Y56A 3G71I 1ZA1B 3O8HA 4M75E 1QWFA 4M7AC 4M77E 1UGVA 3MP6A 1SMTA 1M5Q1 5TRDA 2HZDA 3M58A 1H89C 2Y90A 5ICFA 3N5BB 1YJWQ 3VSLA 4EMGA 2O9VA 5GP9A 2VOOA 4LIVA 1YJNT 3ABKH 2R7TA 1EA3A 2ZO4A 1OQYA 1RAAB 3IV5A 4BE1A 2MG4A 3PVQA 3KETA 2QDYB 1S7AA 2DDBA 3PVLA 4C0DB 3CP8A 4Q4ZF 3TGNA 4IIOA 1XGNA 4KJZA 3I55Q 1NG7A 3SFZA 4E70A 2E1MB 2UZKA 1EIFA 1I8FA 3T8RA 1IG7A 1FOKA 3ULRB 4B9XA 4C2MJ 3A03A 3ISPA 3KZZA 3QPLA 2DTZA 3L1PA 3MWMA 1M2VA 2RHIA 5D5VB 1NZ9A 4JZ3A 1X19A 3HP9A 2SEMA 4LDXA 4C3HJ 2L89A 2CGHA 4BS9A 3WHBA 3OS5A 3ERMA 1XSXA 2BY0A 3ZOBA 1BB9A 5I2MA 3BTJA 2DA4A 3K4JA 1I1JA 2OX7A 4AMCA 3QYEA 5ILVA 4ASNA 3IKTA 3KEQA 2VE9A 4P5OA 1AOYA 2XGEA 2M8GX 4KT5C 2DJQA 2ZXWH 3CDLA 1LPLA 3DXJF 4LDVA 4F16A 2WADA 4AC0A 4IUQA 1DU0A 2R57A 1IREB 3RDVA 2A0FB 2LP0A 2JZ2A 3BFMA 4YTLA 2Y31A 2UXNA 5DM6F 3WTSC 2R5YB 1D09B 3VKIA 1ERDA 1GBRA 3VYUB 3LSHA 4BH9A 1T3LA 1W1WE 3ONQA 5F04A 4AIJA 1X2QA 5BPDA 2M5WA 3EUKL 1UGQB 3QDFA 3QJ6A 2DK8A 1NBEB 3CCUT 3KIOA 1TG0A 2QGGA 3RYRA 4M7DB 2EILH 2PJPA 2HQNA 1G2HA 3I64A 1Y71A 2KRFA 5CVUA 1HD3A 2JMAA 1R00A 3AL0B 3RTRA 3A1PA 4M75B 3VJPA 4C2TA 1YI2A 1UCRA 4M77B 4HSRA 5FROA 4M73A 2AQEA 3LSGA 2Z99A 2PVDB 2X85A 1NG2A 2X4JA 4A69C 3GF2A 2NWMA 4C92A 1ETKA 3ZFJA 3CXCA 2LR8A 1RACB 3BROA 2CW7A 1QWEA 1VQPA 1XX5A 1T0FC 3E9FA 4XTZA 4MIMA 1BR4A 2DCEA 5HK0A 3PO3J 3LA2A 3I0TA 1T6SA 1PSEA 1VQNA 2EZKA 3NAUA 2EW3A 2J6OA 2Y9ZA 6AT1B 5L23A 2VBWA 1QVGS 2JUGA 2MOXA 3A8LB 4M7AE 1N5ZA 1ZRFA 1WJSA 1I1GA 4RM3A 9ANTA 1MV0B 3OW2P 1S72Q 3MN2A 2Y48A 1GXPA 1X1CA 2QQ8A 2UV1A 5AIQA 4HDVA 5IAYA 3R6NA 1BIAA 1SVMA 3CCMQ 1ZBXA 3K6GA 1GXQA 3C18A 2B86A 2LMDA 3FXRA 2NUTB 2XI9A 2XMFA 1ON2A 3B6CA 1U6GA 3C3WA 1JTXA 4V19K 3CUQC 1OULA 4GYGA 2FE3A 2IW5A 4HCZA 1M8VA 4UB6C 1N9SA 2LY9A 3QPTA 5IT3A 1ZH5A 1PCXA 4KRTA 4BNCA 2XROA 3AKZA 3I4NJ 1TUGB 4LGWA 5CJ9A 5H2FC 5J8CA 3QXEB 1KQSA 2HMAA 2DYIA 5GANf 2RHZA 2WSCE 4OVAA 4IO9F 3FK7A 3EG2A 3CCUI 1SEUA 1XSVA 2COZA 4XICA 1KC8R 2EIKH 1ETOA 1FSHA 2L7ZA 3JAMZ 2C0OA 3A0BC 3MZ8A 1Y7XA 1WPYA 1HSQA 3C0CA 1SD7A 2HWVA 1M30A 3JRZA 2FZKB 1S7OA 2DNUA 2HYJA 4GLMA 3DQVC 1VQLQ 2AQFA 4L5IA 2NOJB 3K70D 2FRYA 1SFKA 3F72A 4PDKA 1I50J 1JUSA 1XMAA 4MQ9F 5I11A 5D6WA 1K9MR 3L00A 4Y4RA 1YRNA 3M4YA 5KYWA 2EYXA 3H3ZA 1HJDA 1YG2A 4CH7A 3N4MA 1ZR2A 3OMYA 3G1JA 2DL8A 4IQJA 2K7AA 5C44J 3REAB 3GTQJ 2YRVA 4ZNXA 3H5AA 2XK0A 4A54A 3BQYA 1H3HA 4CCNA 1ZQ3P 3SZGA 1VQOA 4EMKA 3ER0A 2DMNA 4HT9A 1K8AR 4XM3A 2AZVA 5GAOl 1WJDA 4OB1B 2JS2A 2R3SA 3WU2C 1X69A 4FM4B 2XAFA 2W1OA 2RHXA 3BWGA 3M8EA 2KL4A 4CYCA 1OOTA 8AT1B 4LITA 5IP9J 4EGYA 1MGQA 2E5QA 5KYYB 4KT0E 3EG1A 4IHVA 3HSRA 5H6QA 4P9FA 2B8AA 4KMUX 4LDWA 3ZQQA 2LLKA 3HHHA 1HC8A 3HHTB 2YRCA 4LNPA 1MH4A 4E7KA 4ENKA 2MMPA 4I09A 1DQUA 2DTRA 4KFCA 4HA8A 2DXBA 2RK1A 4A4GA 1T38A 1BI1A 4IRHA 4E7SA 1E0EA 2GQQA 3BG6A 1HOMA 1QVPA 5FKNA 3BE3A 3E6CC 4AG1C 5IT9K 4J9FA 3PTAA 4LD6A 2ME6A 2ZPFB 2KT0A 5IXBA 1I1SA 2X1DA 3TKYA 1REPC 5B3SH 4BY6B 1KQ1A 3VSKA 1M2OA 4OIOF 1VQMA 4CICA 1OCOH 3ABLH 5HOOA 5IT9E 1J59A 2VODA 5LJ3g 2F69A 2HSEB 3META 1VQOT 1W7PD 3ZMZA 2DFHA 3U23A 2F1LA 2XGXA 5E20A 3OL3A 4C8QC 2DDAA 1QCOA 2DKGA 1TTYA 2CWEA 6PAXA 3M56A 2DT7B 2ZAEA 1AZGB 1SEMA 3I5SA 4J7IA 4M4ZA 2PTKA 2HU9A 3DLLF 4KICA 1LDKB 3E6DA 2DLPA 2EK5A 2CRGA 2K9MA 4L18B 2HDWA 3UDCA 3ASNH 3I59B 1QVFS 1IDZA 1TT5B 1MMGA 2BEOA 3G6EA 5CVRA 1X6OA 1ZKGA 3PUFA 1O57A 3MEXA 4OINF 2X6XA 3SJMA 3RZOJ 1XCVA 3BQZA 2IS4A 1R4MB 3GIBA 2WY8Q 5J6XA 2WA0A 3CCYA 4KN4X 2RM4A 4FIBA 1SAUA 4FT8A 4I76A 1O3TA 1W6XA 2GF7A 4N4OB 1G3WA 4D8DA 2W82A 3HSBA 2EIJH 2Q2EA 5LD2C 4FYVB 2R7XA 5HDGA 2WAQA 3BTLA 1ZQ1A 2EB7A 4HEA2 2QAZA 3JB9D 2JA2A 1V5GA 2VC0A 2B9SA 3CF2A 1Y39A 1QMCA 2LT1A 4RGRA 2P6SA 3QU3A 3R4KA 3REBB 3CCLQ 4BI8B 1BI0A 1KU9A 2K57A 4RM2A 4CZCA 2XB0X 2HYFA 2XSJC 2ZBKA 4KITB 3PJRA 3RUXA 1D3BA 1B59A 2DN0A 4R8HA 3QRFF 3BPXA 3MP8A 4JDSA 2BY3A 5DM7F 1K4TA 5IYBJ 5K1YA 1JXSA 2GBQA 2CSOA 3M9AA 4U0VA 1OYWA 2GAUA 2IVWA 3R6SA 2RQPA 5L3FA 4P55A 5JVTA 2FZCB 4BI3A 2VQHA 2EYZA 3JTHA 1QHHD 3FXQA 5J1YA 1FYNA 2MC4A 2VONA 5J1UA 2Z1DA 3RMQA 1S72T 3EQLF 4HV6A 3S2DJ 2JJ9A 3H6ZA 1OLTA 3CCMT 1WXUA 4BXUA 4LE9A 2KFDA 4ITVA 2G6FX 2BZXA 3ZQHA 1X1BA 2EPFA 5GADJ 2ZMEA 4MHGA 2KSSA 2CJJA 3CUQB 4QSHA 1F36A 3FHZA 3FXUA 2R7QA 4R0KA 4F91B 2K4BA 3SEQA 2DZCA 2VT2A 4UHTA 1Y0NA 3ML6A 2JK3A 2HS5A 1H88C 2XHCA 2I2LA 5FGMA 3GOXA 2QQ9A 1ZHFA 1WJ5A 2G3RA 4E7HA 4AIKA 1YWPA 1SD6A 2MI6A 5GAHJ 4FL6A 3LSRA 4IPAA 4E7LA 5KYUA 1YS6A 2D1XA 3DU6A 2FD5A 5F08A 3TSWA 2ATCB 2FO0A 4IUVA 4H0EA 2COWA 1WHGA 5GJVB 5FJ8J 2PFBA 2D1HA 2M87A 2M9HA 3FXKA 2UWMA 4B48A 4C8QE 3D5RC 4XTUA 1H9TA 4AUXA 3TEEA 1Z6TA 1KC8U 1VQLT 4PJOC 2ZZDA 1B34B 3KP4A 1BKBA 4ME7A 1FP2A 3WGGA 3L7WA 3GTLJ 2EIFA 5D6XA 5LGUA 1IXDA 5LEJA 2JVGA 5D5WB 2M16A 4FISA 3CC4Q 5DYMA 2JTMA 1LVKA 2X6YA 3W6KB 2E4HA 2LQ8A 1O4XA 4KYWA 2FQ3A 2KRNA 2O03A 4LB6B 1M27C 3FXOA 2KHMA 2EYWA 2RHYA 4IZZA 2X9DA 3BW1A 1W5SA 4HX8A 4M78A 4P1WA 5LJ3h 1I39A 4FT4A 3U21A 3KZYA 3QWYA 4II1A 1OCRH 2YXYA 1SVOA 3R60A 4F92B 2O2OA 3A2KA 2V1RA 5LL6S 2DTIA 4M77D 4GYIA 4QVDA 2FXAA 1S72I 2NXNB 3MHXA 2DK3A 2V8IA 4C5EA 5GAOn 3VYHB 1OX8A 5IYDJ 2DFEA 4Z2YA 3CCMI 3CBPA 3FBNB 4A5MA 3M57A 1RRJA 4F04B 5A2QE 1K8AU 2QTXA 1XGMA 2F2EA 1OEBA 1B9MA 1Z05A 2E1NA 1POGA 4C9YA 3SFMA 2VKHA 2EQMA 2ZKZA 1NPRA 2ROTA 1JTYA 1JBMA 3OSFA 2BE7D 4XLHA 1ETXA 4A93J 4PJOF 1PDNC 1Z1DA 2RQUA 3M0PA 1U9OA 3K7AJ 2FA5A 4ZH4F 2BW3A 3CO7C 2RQRA 4FYWB 1EH6A 2OTJA 1OMIA 2WAEA 1NM7A 1TTHB 1P4AA 4RGSA 1HK9A 4DEXA 3H8ZA 3QBYA 1E3PA 4QW2A 4RTYA 2LG4A 3CDIA 3VS5A 3CC2Q 2LKPA 1VQ6T 2YU9J 3OYHA 5AIPA 1AKHB 1KQ0A 3H3UA 4XNFA 4CCJA 2LY2A 1VQLI 1DJ7B 1TQIA 2DAOA 1Y0MA 1ZG3A 4Y92A 1ZA2B 2PQWA 1QVGP 4XKBA 3K2ZA 5ICGA 2ZPGB 1WHHA 4ZYEA 4FCYA 4QVZA 4P5NA 2NRAC 3SB2A 1ETWA 4TVRA 4IHTA 2XICA 1Q81C 2KRSA 3CBMA 1KQSS 3ECOA 4M7DG 2KK4A 4RUGA 3VODA 1MSFC 1MGTA 2HEOA 4FE7A 4RMOA 2L01A 2LDMA 5IHNA 3X28B 5GAN7 4M75G 5CVJA 1Z7UA 4M77G 2E65A 3TBIA 1QVTA 2F5FA 1CF7A 2MD5A 5DD8A 4G12A 1IC8A 2DMUA 3M0QA 3JTGA 2VI6A 2QQSA 4BXFA 4FW1A 4PJOE 1GDTA 1MH3A 1R22A 5GANj 3FWEA 1VTNC 2NNNA 1R4NB 2RD1A 1BC7C 4UVAA 3OYEA 5J26A 1GFCA 4N4IA 3CPWA 1S3JA 3OY9A 2M51A 2AK5A 4AT1B 3K70C 4RTUA 2P0PA 5GMKh 3ZQFA 2JRTA 3J7YJ 2Z9OA 2CT4A 3EGXA 1WJAA 3LAPA 1TQPA 3OIQA 2I10A 2K02A 5JLXA 1V54H 3OS0A 2ZB9A 3PIOA 4DJAA 4GRIA 4M7AD 8ATCB 1AA7A 1YBYA 5DCMA 1OPLA 3HTUA 5IP6A 2ELJA 3E7LA 2O7OA 1LUJB 1QP3A 5EEAA 1I3AA 1XMXA 2HXIA 3L9FA 1VQ6I 4II2A 2H8HA 2BZYA 2QQBA 4NQWA 2DVEA 1RZ4A 2BY2A 1KQ2A 3JW4A 3TREA 1EJ9A 1JJ6C 3WTTC 4GXOA 2R7DA 4J01A 4G7OF 2CP0A 3O8VA 2EV5A 3M4OJ 1WI7A 2W0ZA 3RKYA 1BK2A 2M0OA 4XLNF 2PMZA 3CMMA 2KT1A 2OPTA 3MZYA 3S14J 2JN0A 1UELB 2FU4A 2FHDA 3CC7T 1SRMA 1NTCA 1JT0A 2EPDA 2I8DA 1B72B 1F4KA 5C4XJ 4RS8A 3V42A 3A8OB 2PI0A 2JZYA 3J7ZI 3FIFA 3TQ7P 5F1RA 3DV8A 1D1AA 2ESHA 1RUOA 4M9ZA 5JFRA 4HLXA 4PSXA 2FQ4A 1Q82C 3MPUB 4KH0B 1ZTRA 3SYTA 2V6EA 1YN8A 2QQRA 3GXOA 2JUFA 4HVVA 1RETA 4UC4A 1IB8A 3FK6A 4YRVA 1KK7A 3G4SA 3IL2A 5GAOq 2H8RA 4J5YA 3WU1B 1M1FA 3MCAB 4PJOB 5LJ3f 3FXMA 4MEYF 3GBQA 4U7DA 4N4GA 2E1CA 1V5FA 2XKOA 3OS2A 2VGNA 1K73R 4KGZB 1NG6A 1GVDA 3HPGA 5EDNA 5M3FJ 2STWA 4C92C 4DIQA 2NUPA 3ZGKA 4LG3A 2Y0SN 4FYYB 4HVUA 1M9SA 3CC4T 4OWRB 2ETHA 1I07A 3LWHA 3L09A 3TW6A 3CCSQ 1RI9A 3KFVA 5KYXA 3VS6A 2E1HA 1TH7A 1H641 2EBPA 1IXCA 2HD0A 3G7ZA 4PJLA 4BEHB 4HW0A 4DYRA 3EYIA 1YHQA 3BZKA 1MKMA 1SKUB 1X4OA 2OQRA 2LBFB 2AS5F 2JRMA 3H41A 2XVCA 4AFZC 2DILA 1TOVA 4HZFA 3F6OA 1QVFP 4JLGA 4IURA 1UFMA 3ULQB 3GNGA 3RQIA 3IH2A 4JRIA 2EGAA 4OGCA 4I6ZA 5TGTA 3VEPA 3GTMJ 5HS9A 2F2XA 5D7UA 4ETSA 3FB9A 2YDLA 2JA6J 2IG0A 1S5LC 3CC7I 1FBSA 1PUFB 3QHSA 1M8MA 2W4SA 2YU3A 1YJNA 4D7MA 3M0RA 3U2RA 1M1KU 1X3UA 1SF9A 2VJIA 4CCMA 1APLC 3UPUA 1ORKA 1W36C 1B8IB 3JAME 2OA4A 1MMSA 1T0JA 2CFXA 3CC2T 2DERA 2DL5A 1IRGA 3FXLA 5J47A 2H09A 1MNMC 1WYXA 2CKKA 4F14A 4IRIA 4BUGA 3DBRB 1A6QA 2P4RA 3LFKA 2XKPA 3JRBA 4OMQA 1OQKA 2RC4A 1ZN2A 2R0QC 2DBMA 1R1VA 4XLEA 3QPSA 3F23A 4P9UA 1UE9A 3C12A 2RI3A 2XASA 1WJFA 2IGKA 2BBYA 2YSRA 3O8GA 3TOBA 3CC4I 1KHIA 4HSTA 1Q95G 2XHKA 1J0RA 1R5GA 2QLZA 3GLLA 2EGCA 2VLAA 2Q0OA 5CQGA 2XSDC 4XN0A 5D6EA 2OAWA 5LJ5d 3CJRB 5L8RE 4ON0A 3JB9F 3KP7A 2DK5A 2K9QA 1ABQA 4EMKC 1VYVA 3TSZA 4WCGA 1NE8A 2LX7A 3UT1A 4NBQA 5LHGA 2E5NA 3ZL7C 5JHUA 4D6WA 1NEBA 1YJ9Q 1QU3A 4C0ZA 2Z33A 4MEXF 3HOVJ 2KE9A 3E19A 1WFXA 1RABB 1JJ2A 2D8JA 4C92E 1HXDA 5LRSA 2V4JC 3BJAA 4M74A 4Q47A 1YIJI 1FIPA 4R56A 3HPHA 3P8DA 3HGGA 4FT2A 4LDUA 2VPRA 1PSFA 2HXOA 3F0CA 3FKJA 2A5YB 1UTIA 5D4RA 1FWZA 2LREA 1VQ4A 3JRGA 2PUOB 5ERIA 3O5ZA 2COMA 3K2AA 4J9BA 1S7EA 1VQPQ 3BC8A 3FISA 3DU5A 4ZC3A 1GFDA 4MZMA 1LDDA 4BQNA 5M5WJ 4MMKA 2AKLA 2DQRA 3CC2I 1R9TJ 4HPQA 2CYZB 5LFAA 2OAUA 2KDSA 1XNIA 3IUOA 4BQAA 2RVCA 3S16J 2NS8A 1U1TA 2FB7A 4UUVA 2Y4YA 4A53A 1M90U 1VQKA 2CU7A 1X2MA 2GWRA 4LFUA 4NC7A 2XGCA 3OOUA 1WGXA 2K3BA 1WH5A 2UXXA 3CCVA 3JB9J 4Z6YA 2O61A 1QP2A 1USSA 2RNAA 5LBQA 1U8RA 2K5FA 2VC1A 3UWNA 4BKXA 4OAZA 4AD9A 2ZC2A 3SDBA 3H0DA 2H94A 1KJWA 2LCLA 4WTOB 2HEQA 3ZMDA 3I56A 2L7KA 3W6JB 3CXCP 4ZGJB 1Z91A 3OYJA 5FLXK 3H9QA 1T2KA 3K4BA 4PGHA 3CEYA 3VUZA 1N75A 5E1ZB 1JGGA 1AZEA 3T8TA 4C8QD 3CCQA 2R7VA 3CPFA 3PNYA 4MFEA 3QJYA 4IX7A 4I2OA 2M7AA 3IH3A 1BOAA 2CQQA 3GYHX 2J5OA 3G3ZA 4XN3A 3CMAA 2QKLB 2JS0A 2FJ1A 1OJLA 3V4GA 2GM4A 3A98A 2K7LA 1WKMA 3HZJA 5ICCA 2PJRA 2QI2A 3LWIA 3K4LA 2GIZA 4IUTA 1XD7A 2P5KA 4I0BA 3J80Z 1XSDA 4ZYDA 1U5SA 3MO8A 4A63B 4JRPA 3Q3SA 1Z21A 2RA2A 2ZCWA 3TL4X 1XG1A 4X9DA 4NL3A 3CCST 2RGVA 5E8IA 1WX6A 2X1EA 3C2GA 3WVEB 2BOLA 1TW3A 2IA0A 4A3CJ 2KMTA 3GF5A 4HNTA 2Y9YA 3LSKA 2LD5A 4YFNF 2R7SA 4WWCA 4EJUA 1KQSP 1FZPB 2JXBA 2J5PA 2IA2A 2CV2A 3QWLA 3CPWS 1VQOQ 2EAYA 2PLYA 4O3MA 2P4TA 2QGUA 1YITA 1YE9A 1QPMA 2H8WA 2EH3A 5EGOA 2R7WA 2HTSA 1RIOH 1MDMB 3F8FA 4L9TA 2QEXA 2XC7A 3IWZA 2MIOA 2DBKA 2GA1A 3DTIA 2Y69H 5FLMJ 4BDZA 2ZMEC 4AFUC 2VV5A 2YR2A 3RERA 1MJAA 2K3PA 2DLLA 2DIGA 3H9GA 4FETA 4PCQA 5DDGA 2DPDA 3CESA 2FPEA 1RAHB 2CO5A 3ZN0A 2ZPIB 1O7LA 1AEYA 3ZQLA 1P4XA 2GOXB 2MGQA 1WZOA 2DA3A 1LNXA 2OI3A 2ZCFB 5CIUA 1C0MA 1B4AA 1U3EM 4XSZF 4IRGA 4B4CA 1LJ9A 1Y96A 4DEYA 1YW8A 1TWGJ 2CUBA 2M0MA 2O3FA 3EDPA 3HRMA 5D8LB 3WG7H 3C94A 2A68F 2BY1A 1BCMA 5F0CA 1D5VA 3ME9A 2UUZA 3H5RA 4IF4A 1PKSA 2EYQA 3EFOB 2P5LC 4E7IA 2MFZA 3CMYA 2A61A 1L0OC 2K40A 3GWZA 4OIQF 5KNLA 1KYWA 3MAJA 1UHFA 2HAXA 2C6YA 2CZ6B 1A0NB 5DLQE 1D1CA 3BDDA 4AFQC 2KY9A 4ABZA 1W5CC 2PQ8A 2R5ZA 1J5YA 2FVUA 2L02A 1YRNB 1YNZA 2OCEA 4E7JA 1ZSZB 4A4KA 2H1LA 4OMMA 3J7AO 1K7AA 1B9NA 2RO0A 2QA4A 1XGSA 4J83A 3L42A 3EG9B 4D7NA 3CCSI 1G59A 3OL4A 2FRHA 2ESWA 2K6DA 2QTVA 4LG0A 4U7BA 1F1BB 1Q7YU 2DA1A 4P96A 4M78C 3RIRA 4EEFG 3J81Z 5K7HA 1IF1A 2A3SA 3UF4A 3G6EQ 2ELHA 2VOPA 4PJOD 5CKHA 1LFBA 4JX5A 1KFZA 4C3JJ 1UHWA 4KH1B 2YWWA 1YJ9T 4IL6C 4PGGA 2DO3A 2LC2A 2LKXA 1YFNA 3AG3H 2CH4A 4Z89A 3TU4K 5FD6A 2HVRA 3MEAA 2O5RA 2A69F 3IRRA 5KE3A 2IS1A 2LX9A 4M7AF 2PEXA 3ABMH 2DBBA 4ESFA 4S05A 2FRWA 3NQOA 4RB0A 3OYGA 1XDUA 2AHJB 1MSEC 2P81A 5LEKA 2L9NA 3FLGA 4XRSG 1TWBA 1U06A 2JSPA 3ECHA 2PVGB 2RQVA 3NGPA 2EV6A 3Q9VA 5TISC 4HXJA 2L2OA 1OU9A 2HKNA 5LLQA 3HRSA 3GX4X 2LRQA 1P6RA 1RAIB 3S3MA 4XKWA 2E3IA 5LJ3j 3GP8A 3RYPA 1IZ6A 4G7HF 2K3YA 2RI5A 1JUMA 1VQPT 2V1QA 4WXHA 2DXCA 3H3VK 2IGOA 4FASD 1AOJA 2ECZA 3ESWB 4BJ5C 3FMRA 5GTHC 3OV8A 4M72A 1E3HA 3HGYA 2M7BA 3PNTA 4AVPA 4OMOA 1IXSB 5LHHA 4RG2A 5GMKi 1PD1A 3OB9A 3LSIA 1PWTA 4ZN1A 4M78F 4UUSB 2YUNA 2QVOA 3F8NA 2NVYJ 1Y6IA 2WV1A 3WTXC 1PRMC 2ED0A 1J2XA 2V7FA 1NYGA 4LLLA 1Y1VJ 1G8XA 3ZMTA 4ZTFA 2YUPA 2KI7A 3KP2A 3CBOA 5E17F 3RBBB 5CKDA 1KA8A 2L7MP 1OISA 2DA2A 1FP1D 2Z2SB 2CT3A 1WGSA 1FX7A 1I3QJ 4KDPA 1A31A 2VE8A 1HKTA 2E5KA 2HNIA 4XKVA 2PUKB 5ICEA 2JVVA 1L3LA 4DOZA 3C2BA 2HPIA 4AFSC 4PJOG 1M1EB 4FW2A 2G7UA 3PSIA 2LK2A 1RUNA 2CDTA 4OOIA 2AO9A 5JR3A 2KXCA 2ZFUA 3QYGB 1RR8C 1WQ2A 5C3EJ 1YJ9I 1YS7A 3S2WA 4RTVA 2ICWG 3WE3A 3S93A 2VVKA 3NWTA 3CCUA 2HOEA 2KIFA 4KUMA 3LSMA 2MSYA 3RMSA 2HOAA 2BZ8A 3VB2A 1FTZA 2YX7A 2CYYA 1JI8A 4O5VA 4WCIA 2SRCA 1FBQA 4EV0A 4C0GA 1BR1A 2MBFA 3S1NJ 4W97A 1VOMA 2E60A 3DFGA 3IC7A 4M78E 1D3BB 1LFUP 1T0HA 2DEQA 3BZCA 4XMYA 4EGZA 1VQPI 1JE8A 4AYBN 4CSWA 2R7FA 2JM9A 2VKVA 1GVJA 3DEUA 1R23A 1F43A 3KEOA 3EGUA 3CMEA 1TWCJ 1YYVA 2P5VA 3OYKA 3MMYB 2XU8A 2DRMA 3BOQA 1YW9A 5EYRA 1UECA 3OYDA 5K5OA 1W0UA 1MIJA 3COAC 3NTKA 4E2FB 2DA7A 5GMKj 2EA4A 1LFPA 2A6TA 3TMOA 2ZPEB 3EHQA 3CC7Q 1KZHA 1FT9A 1EF4A 2I5UA 4O6JA 5J8FA 2COYA 2XF7A 2DVJA 1OCCH 2MYSA 3RKQA 3JB9I 3M07A 2PVOB 3FXJA 1DDNA 2IEKA 3WHCA 1ETQA 1E17A 4I01A 3BT9A 1RADB 3TO6A 2IJLA 4PL6A 3JCMW 4B8XA 1WQWA 2M2EA 3UR3C 3JCMX 4BL0B 4M7AB 2DMQA 5M5YJ 5KYUB 3DPLC 2DTHA 1JHHA 4EATA 1B3QA 4RLQA 4ZDLA 3JRCA 1R1TA 1IV6A 1NPPA 2OTJQ 2MLKA 3JRIA 5IY5H 1YJWT 1V3FA 1P9QC 1TP4A 4KUIA 2MH2A 3JSCA 4LLGF 1AU7A 5LJ5e 3LL7A 4HYEA 4ZGDB 4HLYA 3QYFA 4GGGA 2M0YA 2EKOA 4F52A 1AHJB 3EFRA 5A0GA 2M30A 2D2WA 2RJCA 4Z02A 2XKOC 3GTJJ 1ZUYA 3VWBA 1OI1A 1KC8C 1VQ5A 1IGNA 2KGTA 1R8OB 1MNEA 2GOMA 2OF7A 3GCMA 5F6FA 5FD5A 3N05A 4B43A 5IOYA 1HYOA 2V26A 3K69A 2EQRA 3E5UA 3V8KA 2BVMA 4IHSA 5CR2A 1TWAJ 3RR6A 1ZR4A 1YIOA 5GTIC 3OR1C 2NS0A 3JCUC 1UEBA 1C6VX 1KG1A 1Z9QA 2RB6A 4M78B 2ZNZA 3FF5A 2OZUA 1K9MC 3G6ET 4PJJA 1BBZA 1WNLA 2O4XA 1QQJA 2HR3A 4F3QA 2PNIA 2R5YA 1LEAA 4E6RA 2BXZA 4IOCF 2VKNA 5IH2A 4RG8A 1G6NA 3WG9A 4C92D 3OYIA 5KCOA 1D0YA 1K83J 2M3AA 3Q9SA 4A5NA 2KDOA 3RJPA 4V2GA 4NB5A 2F2WA 1VQ7Q 1BI3A 2P84A 1VQ8Q 4UY8I 4A3EJ 2LQWA 1K8AC 3SZPA 4PJMA 4M7DA 3PFIA 2A5WA 4FX0A 2V1XA 1LE8A 2J05A 4RKUE 3JCMd 4XOTA 1D5YA 1RKWA 2M02A 1QQIA 2DOEA 2IBDA 1DGWY 2GFUA 3MQ0A 3OSSC 3JR9A 1RI7A 4J9HA 2O88A 2L9SA 2PN6A 2EV0A 3OR2C 3BP8A 3OYYA 3M59A 1IV8A 5M9OA 2Y0SA 5DY9A 3IRQA 4CRIA 5EEHA 2JM8A 2XDBA 3KYCB 4BQOA 1JHFA 5FLXZ 1YJWI 2XAHA 1P4WA 4GO1A 5FKKA 3QG1A 1I5ZA 2NVTJ 3HEFA 4G94A 2LCCA 2VIXA 4FSSA 2EQKA 2DFUA 4DBRA 4HF0A 2M1BA 4NDLA 1UAAA 3ABUA 3WTYC 2LF8A 1YW7A 1MBGA 1TZLA 3ZCOA 3S1MJ 2WWYA 1X2KA 2CS7A 1VQ9Q 4XLCA 1OKRA 4BHPA 4ORZA 2OUMA 3CP2A 3U1KA 2CV0A 4C8QF 2ECBA 3TQNA 3CPWP 4M3BA 2DI3A 1WJRA 2NOGA 1PNJA 1IN6A 1W36D 2GGRA 1J9IA 2GFAA 2A6EF 1R36A 2L3RA 4ATOA 2V8JA 2NAZA 2EFWA 4UV9A 1EFNA 3OSGA 2XDPA 2HGCA 1HW1A 4N0BA 5EG0A 3G6EI 1Y57A 1ZLMA 5KCHA 1OCZH 4C5GA 4BI4A 3PE0A 1Y1WJ 2RQQA 4WX9A 2VXFA 2ZXIA 3HSFA 3O3KA 3I35A 1BC8C 2CH0A 3AAFA 1MW7A 4E6KG 2KT8A 5JHFA 4Y91A 2ZJQF 1ABOA 2AXLA 3DWLE 3WU0A 4CC2A 3G4SQ 2LTPA 3L2QA 1OYYA 4X9CA 1QRYA 4Z8AA 2W57A 3DLAA 2XPUA 3H5NA 3CF5F 3EH2A 1I27A 2RV8A 2ED1A 2K79A 2DMTA 3MEUA 2YRDA 3JCMJ 1K6YA 1KONA 2FBKA 3T9NA 3B6AA 2C0TA 3BDUA 2C06A 5LRRA 1OR7A 1BYMA 1WJQA 3G1LA 4K2EA 3JCMQ 3AG1H 5BMZA 3UNGC 4OIPF 2LNVA 4B6MA 4EIKA 5B1BH 4Y7NJ 1YHQQ 2IRFG 2OJ2A 4BBSJ 4QLCU 3JB9G 4S0HB 5JLWA 2MW8A 4XSXF 1QZYA 4HNUA 1ZGJA 5D5UB 3QOPA 1J7KA 2L8DA 1P92A 4C5HA 2KRHA 1ZUUA 4M3GA 1HDDC 2W7NA 4JJDA 1TT0A 2M8EA 2HTJA 4I7HA 1TXQA 1S72A 2QM3A 4A4HA 1ZREA 2A05A 2F5CA 3KYDB 1UB4A 3F8CA 4EDUA 2JN6A 3HYIA 1YCSB 3AHUA 4WXDA 5E3MA 1K1ZA 2D8HA 1GV5A 1XCBA 3NEUA 1PRLC 2KQWA 3K4MA 2LZ6B 1R1UA 4MNUA 2KZGA
chains in the Genus database with same CATH topology
4PKCC 1OYXA 2VJJA 4AVZA 2EQJA 3JCMP 2DXUA 2MAMA 3LGFA 4PJNA 4OMFB 2KVQG 3RSNA 1VIEA 2CS3A 2VXDA 2F4IA 4IQ4A 2E5ZA 1VQLA 3KX2A 3J80E 3OS1A 2VUBA 3H9JA 3PT9A 2RI2A 3L2ZA 1D0ZA 1T95A 2F5KA 2HQXA 4C8QB 1O9SA 2E6ZA 5GMKm 3NTHA 1M4ZA 3PFYA 1QW1A 1VQ7T 2DPPB 1VQ8T 3HPWA 2BVLA 2XD0A 4XTYA 5EG2A 2FL7A 1I5LA 2D9TA 1UGPB 2KLOA 3RQ4A 1M1KC 3NTIA 4XONA 2VQCA 1M1GA 3OQ5A 3QO3A 2VQGA 3W3CA 1X1AA 3CCJA 1IRXA 4NL2A 5GAMd 3CCLT 1H3ZA 1VQ6A 1WJCA 4XLAA 2WACA 3C4SA 4HCCA 1VQ9T 3S32A 4C5IA 2DIQA 4ZYAA 1KD1U 4F7UA 2Q1ZB 1OZ3A 4ANJA 2OC6A 4OAYA 3ZXSA 3J81E 3AFHA 3DKYA 1JJ2S 1I4K1 2RH2A 4XU1A 3BCBA 4KULA 4X34A 2OV7A 2V1NA 2DXTA 2VB6A 4OB0B 3G4ST 2XDDA 4M78D 2ZPHB 3VUBA 3L2VA 2VXZA 5I21A 1B34A 5GAMg 4JUVA 2K5IA 3X24B 4C0FA 3VDXA 1YHQT 1BIBA 4XQFA 3OYNA 4DQ2A 3K4NA 1M90C 2LT4A 5KCMA 4M7AG 4U87A 3DLLA 3D5LA 5CKTA 2QQAA 3CC7A 4FSXA 3FC3A 2CFOA 3HRTA 2QKMB 4CCLA 3A8MB 3SWNA 3IAS2 4KBMB 3KEYA 2E41A 3H6ZA 3LH0A 4HRIA 2YLBA 5A0DA 4BE0A 2LRDA 4M78G 3PFSA 5AYFA 5GANd 3GLXA 3DPUA 4R79A 4C92F 4E4HA 3CC4A 1K73C 5D6YA 1J09A 3JCMe 1SSFA 3LGLA 4R55A 3URGA 3LFUA 4BACA 3OYAA 3W2AA 5FRNA 4BJ6C 2K2VA 5HKCA 3CD6T 4PUSA 3PGGA 1YIJA 1O75A 4NNJA 2CZ1B 3QUIA 5CCAA 3KYLA 3QZ5B 1Y96B 2A7YA 2VYTA 2CW8A 4CA0A 4C0DC 4J6YA 5HNFA 2E1MC 4AYBA 1ZELA 2F5TX 2ZXHA 5C0MA 3CC2A 1VQKT 2K3XA 4VUBA 3CCRA 4PK4A 1MHNA 3CCVT 4OP0A 2VL8A 3FBIB 3I55A 2VGMA 2VJ5A 4JS4A 3I56T 2X6WA 1Q7YC 2CUJA 5LJ5g 1MMAA 2K4YA 5CKEA 3X26B 4QVCA 2BUDA 3CCEA 4L6V5 3OA6A 4M7DC 1PJRA 3S3NA 2L5QA 2XF5A 4RLFA 4J6WA 4BD3A 4EPCA 4XTXA 1LJOA 3JCMV 3BG7A 5FLXE 3WVDB 2JNGA 4C92B 4BEHA 2RREA 5CQXA 1YITT 2LBFA 2QEXT 3V7RA 4ZN3A 3EPZA 1MMDA 3RCOA 3VYRB 4WF2A 4JRQA 4XQ3A 3W2VA 2V8KA 3P8BB 3ZBDA 1V29B 1G3SA 3MP1A 1GLNA 2VQLA 3S6WA 4XU3A 3G71A 4AU7A 3OSVA 1XOVA 4PFOA 5FU7C 3X25B 1W2BA 5CAIA 4C30A 2DD4A 4C8QG 3MKZA 2QA4T 1OR7C 4Y33A 2KMUA 4DOWA 3CCSA 3NFCA 4ELZC 5GAN4 4OB3B 3OBWA 2JOYA 2HQAA 2M4KA 2RNGA 4RCCA 5I2SA 4B47A 3A1YA 5GAMe 4EMKB 3J7AY 4IUUA 1VIFA 5LJ5h 3HG9A 2CV1A 2IXSA 4ELYC 5GAMf 1NJIC 2HBPA 3HOTA 1N8RU 4L59A 1YI2T 4BY6C 5GAOm 4BQQA 2H3JA 3ZEHA 5CK9A 1Q86U 1VQNT 3HFNA 2MWOA 4BDYA 3OMGA 3GNFB 4DGWB 2DAQA 2O4XB 2RK2A 4IUPA 1G5VA 3QSUA 3PSFA 4PSWA 3L2UA 5IN1A 5CKBA 3M8JA 3EAEA 3H35A 2M1HA 3M5AA 1YJ9A 3ZR8X 3S8PA 1D0XA 1VZ0A 3X20B 3MKWB 4MMLA 4E47A 3Q1JA 2R7OA 2JTFA 2Q2EB 5HK3A 1V5EA 3PNVA 3CMET 3J7AF 4QQ6A 1N78A 2YHTA 4MLOA 2LTOA 3M55A 2OTLT 2HVQA 1WJEA 1I81A 3HRUA 5KE2A 4HT8A 2K9LA 2R7UA 1N27A 2KZVA 1X01A 4BGDA 3V7SA 3QDRB 4J6XA 4CI0C 1UG0A 3OYLA 2X4WA 1VQOT 5GANe 4G6TB 4FU6A 2DOAA 1LOJA 2JVHA 3FRNA 3HOSA 5HVQC 5FU7B 4D9JA 3CZ6A 2EJFA 3LW5E 3EFSA 1VQ5T 3QYBA 3PIPA 4QQDA 4HKEA 3VYTB 3ZRGA 4RCBA 1JJ2A 4BU2A 3MKYB 5LJ3d 1VQMT 4F7UF 3FHNA 4OB2B 3OIPA 5DM7R 3FDRA 4XTWA 5LJ5f 2DT6A 1UGRB 3KXTA 3DEEA 4YELA 2WSFE 4XU0A 3C95A 3SWNC 2VKDA 2Y4XA 4KUDK 4RMNA 1YJWA 4XAXB 3G2BA 3ASKA 3VYSB 1VUBA 4F7UE 4M75A 2D6FA 4II3A 4M77A 2BW3B 4L5GA 2RJDA 2KQRA 4XU2A 4CCKA 4QQGA 4NUBA 2P0KA 3MD2A 3I3LA 2RJEA 3V8LA 3JB9H 3DLMA 3HFOA 1W2BS 2O01E 3MEWA 1X4PA 3M4GA 2E10A 4ZJZA 1G3TA 1Z3YA 4C92G 3JCMg 4A4EA 3OW2A 1ZHIA 3DTEA 3OWTA 2DTOA 2HPMA 4PNOA 3OYBA 3VU3C 4F7UB 3FDYA 3INZA 1KD1C 1R6RA 3OBYA 2LVMA 2XAUA 4NQWB 4MDWA 4MZMA 4CUGA 5J3BA 1FMWA 3QODA 1HA8A 4N0AA 2KAFA 2IS2A 2R5MA 2NLUA 1JB0E 3CCMA 3K10A 4M7AA 3M54A 5GAMj 4B44A 4J00A 4J8OA 2ZSHB 1WQ7A 1KHCA 2WB1A 3V8JA 2VJ4A 4F55A 2P0WA 3SEZA 1JRIA 2OTJT 2VC8A 3R6OA 4M7DD 4CCOA 1K9MU 2DJZA 3NWSA 3C2HA 1RL2A 4M75D 4IKFA 3K4KA 3E9GA 4Y28E 3CXCS 2FYKA 5GAN8 2E64A 3OYMA 4B9WA 4F93B 3SWNB 4QPOA 3RKWA 5GAN5 1G3YA 4JQFA 2X4YA 3HL8A 2KP6A 3F9KA 4D1QA 3CCJT 3QPHA 1LKXA 3HXLA 4JRKA 3BCAA 4XL9A 2X1CA 3JCMh 4N4NB 2X4XA 1D1BA 4DOVA 2LOOA 2BIVA 4GY5A 1Z7LA 2CUZA 4DA4A 1FMVA 2IGMA 4XKCA 3DPTA 3M53A 4HCBA 4E7ZA 4C2UA 4NOYA 1RI0A 4OF1A 4PLIA 2CZ0B 2Z16A 1Z3XA 1VQ7A 1QHGA 4A4FA 3MEVA 1VQ8A 3VV0A 3QOEA 5HLTA 3I9V2 3L1AA 4MZTA 3A4CA 3RKXA 2E12A 2EJ9A 1BR2A 2WBMA 4ZTJA 3PL8A 4MDXA 4GLKA 5CQYA 3CCLA 2X35A 5HY6A 3QIIA 1VQ9A 2BKDN 5LJ5j 2WAFA 2A3LA 2XG8D 2F6CA 3HUGB 4XORA 5CO7A 1MMNA 2MWPA 4X0GA 5CQEA 3A5ZB 1BOBA 2IGNA 2KRCA 3RPUD 1N6AA 3V7CA 3PMTA 3BDLA 4BE2A 5LJ3e 2VXEA 3EUHC 3QYHB 1YJNT 4OGEA 3D5SC 4LIUA 4PFPA 3W2WA 2XF6A 5HNHA 5FRMA 1BI2A 2RJFA 4XOPA 3DB4A 3EUAA 2W00A 2M9UA 4BUPA 3SD4A 3E0JB 2LY1A 5GMKl 5FU6C 2DXIA 4LD9K 5GAN3 4JS5A 2PJRB 3M1CA 2XIDA 3DKMA 4HG2A 3HKZA 1WJBA 1YX3A 4C8QA 1Q81U 3HC7A 3IAM2 3OYCA 3IP4B 2LQKA 2CMPA 1YIJT 2VPLA 3OW2S 2V9KA 3GBGA 5C6SA 3JCMf 3VYGA 2GQVA 1DGRM 4BB7A 4PLLA 4XLFA 4B3XA 3SDZA 4J7FA 1QVGA 1MNDA 1Y07A 2WSEE 2DZ9A 4NS5A 3A8GB 3JCMc 2MD0A 2IS6A 1VQ4T 3CCRT 5DLOA 4DBQA 4KT6A 5GANg 3I55T 2ZGWA 2ZPBB 3KUFA 5GMKe 4NC8A 2HVSA 1XTDA 3KBGA 1S9HA 4H4KC 3F70A 3WXMB 4Q5WA 3GPLA 2R7RA 2EJGA 5GAMh 5GAN2 3CCET 4KISA 3QKJA 4EMHA 5J39A 2XDVA 3FJPA 3LLRA 4JLIA 2HNHA 2DD5A 4XK8E 3CD6A 3BLYA 5KHDA 3HL2A 2LC4A 1UGSB 1GXIE 1U0JA 4YEJA 4BJTA 3DB3A 3LX7A 1Q82U 1XQHA 3CCQT 3OYFA 5KH6A 2ZSIB 3DTKA 1N77A 1FXXA 4JOMA 3CMAT 2KPMA 4F7UG 3DKXA 3LYIA 2MABA 2F5VA 2R58A 2R5AA 1DP3A 4LDYA 2EWNA 2CZ7B 1N8RC 4PJOA 3AL0C 2X51A 2YLCA 4M75C 4M77C 3CJQB 4Y3OA 1W4SA 2LYCA 1X75C 5GAOr 1N9RA 2PU9B 1Q86C 2K5LA 2FUG2 3BY7A 3E1SA 4XR6A 5CPRB 1YCYA 2D0QB 2WY7Q 5A0LA 3G71T 1PYVA 4ZDPA 2E70A 2RHUA 2GCXA 2DJIA 3OMCA 5CKFA 2K5CA 4N4HA 4M7DF 2M4GA 2R4GA 4ZDOA 2E6NA 3M9QA 3A8HB 4M75F 4M77F 3PMIA 3RESA 2MF2A 1K73U 3P8HA 1QVFA 5FU6B 3LMMA 3FEOA 1YX5A 4MZPA 1X1DA 2QXFA 3S3OA 3K4CA 2HQEA 2VASA 3L2WA 5GANh 2EFIA 4ZGEB 3QZ9B 3PNWC 5GAN6 3TCJA 1OZ2A 3JCMb 1U1SA 3L2RA 2EQUA 2P0QA 4M7DE 4N0AC 5GAOp 2LH9A 4QPQA 3HKSA 5CVIA 4JJNK 1Y56A 4M75E 4M7AC 4M77E 3MP6A 1M5Q1 2HZDA 3M58A 3N5BB 2Y90A 3VSLA 4EMGA 4LIVA 2R7TA 1EA3A 4BE1A 2QDYB 4C0DB 3CP8A 4KJZA 1NG7A 1EIFA 2E1MB 1I8FA 4B9XA 2RHIA 1NZ9A 4LDXA 1X19A 3HP9A 2L89A 2CGHA 4BS9A 3OS5A 5I2MA 3K4JA 3QYEA 4P5OA 4LDVA 2WADA 4IUQA 2R57A 1IREB 2JZ2A 4YTLA 3BFMA 3VKIA 1ERDA 3VYUB 3LSHA 3ONQA 3QJ6A 3EUKL 1UGQB 3CCUT 4M7DB 1Y71A 3AL0B 3VJPA 3RTRA 4M75B 4C2TA 1YI2A 4M77B 4HSRA 5FROA 2AQEA 3LSGA 2PVDB 2X85A 2X4JA 4C92A 3ZFJA 3CXCA 2CW7A 1VQPA 1T0FC 3E9FA 4XTZA 1BR4A 2DCEA 5HK0A 1VQNA 1PSEA 1QVGS 4M7AE 2JUGA 3A8LB 1WJSA 4RM3A 1X1CA 2UV1A 5IAYA 1BIAA 1ZBXA 3K6GA 2XI9A 1M8VA 4HCZA 1N9SA 3AKZA 3QXEB 1KQSA 5GANf 2RHZA 2WSCE 4OVAA 1Y7XA 3JRZA 1WPYA 3DQVC 2AQFA 2NOJB 3K70D 1SFKA 5D6WA 4Y4RA 3M4YA 4CH7A 3OMYA 4IQJA 2YRVA 3H5AA 2XK0A 4A54A 4CCNA 3SZGA 1VQOA 4EMKA 3ER0A 4HT9A 4XM3A 5GAOl 1WJDA 4OB1B 4FM4B 2RHXA 2W1OA 2KL4A 4LITA 1MGQA 2E5QA 4KT0E 2B8AA 4LDWA 3ZQQA 3HHTB 4E7KA 2MMPA 1DQUA 4HA8A 2DXBA 2RK1A 4A4GA 4E7SA 1E0EA 1BI1A 3BG6A 1QVPA 3PTAA 4LD6A 2ZPFB 2X1DA 4BY6B 1KQ1A 3VSKA 1VQMA 5HOOA 5IT9E 5LJ3g 2F69A 3META 3OL3A 4C8QC 2DKGA 3M56A 4J7IA 2DT7B 2HU9A 1LDKB 2K9MA 3UDCA 2HDWA 1QVFS 1MMGA 3G6EA 1X6OA 2X6XA 2IS4A 3GIBA 2WY8Q 2WA0A 2RM4A 4FIBA 1SAUA 2GF7A 4N4OB 1G3WA 2W82A 3HSBA 5LD2C 2R7XA 2WAQA 1ZQ1A 4HEA2 3JB9D 2JA2A 1V5GA 3CF2A 2LT1A 4BI8B 1BI0A 2K57A 4RM2A 4CZCA 2XSJC 4KITB 3PJRA 3RUXA 1D3BA 3MP8A 4JDSA 2IVWA 4BI3A 2VQHA 1QHHD 1S72T 2MC4A 2Z1DA 3RMQA 1OLTA 3CCMT 4ITVA 1X1BA 2KSSA 2R7QA 4F91B 3SEQA 2DZCA 2XHCA 2I2LA 3GOXA 2QQ9A 1WJ5A 2G3RA 4E7HA 2MI6A 4FL6A 4E7LA 3DU6A 4IUVA 2UWMA 4C8QE 4B48A 3D5RC 4XTUA 1VQLT 3TEEA 1KC8U 4PJOC 2ZZDA 1B34B 1BKBA 4ME7A 2EIFA 5D6XA 2JVGA 2M16A 2JTMA 1LVKA 2X6YA 2LQ8A 2KHMA 2RHYA 4IZZA 3BW1A 4M78A 4P1WA 5LJ3h 4FT4A 3U21A 4II1A 4F92B 4QVDA 3A2KA 5LL6S 2DTIA 4M77D 3MHXA 2DK3A 2V8IA 4C5EA 5GAOn 3VYHB 3CBPA 3FBNB 5A2QE 3M57A 1K8AU 2QTXA 4C9YA 3SFMA 2VKHA 2EQMA 1NPRA 1JBMA 4XLHA 4PJOF 2BW3A 2OTJA 2WAEA 1HK9A 3H8ZA 3QBYA 4QW2A 2LG4A 1VQ6T 3OYHA 4XNFA 4CCJA 2LY2A 1DJ7B 2PQWA 4XKBA 2ZPGB 3SB2A 4QVZA 4P5NA 4TVRA 2XICA 1Q81C 1KQSS 3CBMA 4M7DG 2KK4A 4RMOA 2LDMA 3X28B 5GAN7 4M75G 4M77G 2E65A 3TBIA 2QQSA 4BXFA 4PJOE 5GANj 2RD1A 3OYEA 5J26A 4N4IA 3CPWA 3OY9A 3K70C 2P0PA 5GMKh 1WJAA 3OIQA 3OS0A 3PIOA 4DJAA 4GRIA 4M7AD 1AA7A 1YBYA 2ELJA 1QP3A 4II2A 2DVEA 2QQBA 1KQ2A 3TREA 4J01A 3O8VA 2M0OA 3RKYA 2PMZA 3CMMA 2JN0A 1UELB 2FHDA 3CC7T 2I8DA 3V42A 3A8OB 3FIFA 1D1AA 4PSXA 1Q82C 3SYTA 2V6EA 2QQRA 2JUFA 4UC4A 4YRVA 3G4SA 5GAOq 4J5YA 1M1FA 3MCAB 4PJOB 5LJ3f 4N4GA 1V5FA 3OS2A 2VGNA 1NG6A 3HPGA 4C92C 4DIQA 3ZGKA 4LG3A 3CC4T 1M9SA 4OWRB 3LWHA 2E1HA 1TH7A 1H641 3G7ZA 1YHQA 2HD0A 4PJLA 4BEHB 1X4OA 2LBFB 4JLGA 4IURA 3GNGA 4JRIA 4OGCA 5TGTA 3FB9A 2IG0A 3QHSA 2W4SA 1YJNA 1M1KU 2VJIA 4CCMA 3UPUA 1W36C 3JAME 3CC2T 2CKKA 4BUGA 3C12A 4XLEA 2RI3A 1WJFA 2IGKA 1KHIA 4HSTA 2VLAA 5CQGA 4XN0A 5LJ5d 3CJRB 5L8RE 3JB9F 4EMKC 3UT1A 1NE8A 2E5NA 4D6WA 1QU3A 4C0ZA 3E19A 1WFXA 4C92E 1HXDA 4R56A 2V4JC 3HPHA 3P8DA 4FT2A 4LDUA 1PSFA 3FKJA 1FWZA 2LREA 1VQ4A 2PUOB 3BC8A 3DU5A 4ZC3A 4BQNA 4MMKA 4HPQA 2CYZB 5LFAA 2OAUA 2KDSA 1XNIA 3IUOA 4XTVA 2FB7A 2Y4YA 4A53A 1U1TA 1M90U 1VQKA 4NC7A 3OOUA 3CCVA 3JB9J 1QP2A 2K5FA 1U8RA 3UWNA 4OAZA 3SDBA 3H0DA 2LCLA 3I56A 2L7KA 4ZGJB 3OYJA 3H9QA 3K4BA 3CEYA 3VUZA 1N75A 4C8QD 3CCQA 2R7VA 3CPFA 3PNYA 3QJYA 4IX7A 2M7AA 4XN3A 3CMAA 2QKLB 2PJRA 2QI2A 3LWIA 3K4LA 4IUTA 3MO8A 4JRPA 1Z21A 2RA2A 3TL4X 4X9DA 4NL3A 3CCST 2X1EA 3C2GA 3WVEB 2BOLA 2KMTA 3GF5A 4HNTA 3LSKA 2R7SA 2CV2A 3CPWS 2EAYA 2P4TA 1YITA 1YE9A 2R7WA 2QEXA 2XC7A 3DTIA 4BDZA 2VV5A 3RERA 2K3PA 2DIGA 3H9GA 4FETA 3CESA 2ZPIB 2ZCFB 2GOXB 5CIUA 1LNXA 1Y96A 3C94A 2M0MA 3ME9A 2UUZA 3H5RA 2EYQA 4E7IA 2MFZA 5KNLA 2HAXA 2CZ6B 5DLQE 1D1CA 2KY9A 2FVUA 4E7JA 4A4KA 2RO0A 2QA4A