2L5QA

Solution nmr structure of bvu_3817 from bacteroides vulgatus, northeast structural genomics consortium target bvr159
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
142
structure length
142
Chain Sequence
MLKTILSIAGKPGLYKLISQGKNMLIVETVDAAKKRVPAYAHDKVISLADIAMYTDAEEVPLSEVLEAVKKKENGAVASINYKKASADELHAYFAEVLPNYDRDRVHNGDIKKLISWYNILVNNGITEFVEAPALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target BvR159
rcsb
source organism Bacteroides vulgatus
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 26
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2010-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18347 DUF5606 Domain of unknown function (DUF5606)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1650 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2l5qA02
2.30.30.730 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2l5qA01
2L5QA
chains in the Genus database with same CATH superfamily
2KRCA 1RI9A 1IHVA 4PJLA 1IO2A 1KQ9A 2HR3A 3BQYA 2KEAA 1X3ZB 2G9WA 4A3JJ 4ZDOA 4J9EA 1M3CA 1OV3A 4Y92A 3TREA 5LJ5d 1PUEE 3WXMB 1X2QA 3HOUJ 3N97A 2OJ2A 2OD5A 2R0QC 1ABQA 1QWEA 5KYUA 2YSQA 1QU3A 4F55A 2M1HA 3UATA 4CICA 1ZK8A 2X6XA 5K5OA 3DP7A 3DBRB 1YIJA 2AT1B 3OYHA 2X9HA 1W70A 5CQEA 2DILA 2M45A 2X85A 2XDDA 1H89C 3GIBA 1Z3YA 2LG4A 2IIMA 3ESWB 1NPRA 4XRSG 2COZA 2LY1A 4KIGA 1P6RA 2BKDN 2EBIA 3FHNA 1SAXA 2KR3A 2RB6A 4KNYA 2V8IA 1KD1U 2AXTC 3ERED 1HDPA 1BI2A 3RUXA 1OOTA 1W2BS 1R1TA 2JNGA 2MPXC 4CC7A 3FXOA 5E1ZB 4MLOA 5KYUB 2KMTA 5LHHA 1PCXA 4PJOA 4HVWA 3M0PA 1ZG1A 5GJVB 1HBXG 5D8KB 1LEAA 2YX4A 3PFIA 4XLFA 4QIWN 1IGNA 4BJ5C 1IGUA 3M5AA 3BOQA 2R7UA 4OB2B 1XX5A 2JSPA 4RTTA 2BE7D 3ZQHA 3H0HA 4C8QF 2QCOA 3HUGA 1SFEA 1OI1A 2EQJA 1P2FA 2JJ9A 1FNNA 2FPFA 4G12A 1P4AA 4ZZLA 5D5VB 4BY6B 3CC7Q 3NTIA 3I4MJ 3CMEI 3VS5A 1M5Q1 3EH1A 1RLPC 3KETA 1XSXA 1VOMA 1YBYA 3FM5A 3TO6A 3OMGA 3J7AO 3CD6Q 2OAUA 3PGGA 1WJ5A 4V19K 3G71T 4D7MA 1WH5A 2H6CA 2M4KA 4CGZA 2J5PA 3LSJA 5CQXA 5GMKm 3BTCA 2W0ZA 5EDNA 3M8EA 3A01B 1UFFA 5J39A 2CG4A 1K9AA 1VQ7A 1VIEA 9ANTA 2RHXA 1MSEC 1K0XA 2R7QA 3SDGA 1QGPA 3JREA 1ZREA 1LNWA 5EZGA 2KJBA 1POGA 5D8LB 1WHUA 4AYBN 4C3HJ 2CV1A 4NNJA 5CVUA 4OGCA 4R56A 4WK8F 3B02A 2VONA 1HW1A 1TWGJ 1HQCA 2DOFA 4II3A 3FJ5A 3CPWP 3Q9SA 4W97A 1YTYA 3JCMf 1FOYA 5CKFA 2CUFA 2P0WA 4UHTA 3ZQCA 4BJ6C 1BR1A 1I50J 1PG5B 2RHIA 4EMHA 2WBMA 4LG0B 1D8JA 4OF1A 2BUDA 1HXDA 2WAFA 3VYHB 2GGRA 2WAQA 3AHUA 4C5HA 4F7UA 5CQGA 4U7DA 2DN0A 4M9SA 2L9VA 5LJ5f 4LDXA 4A0XA 1QVPA 1LUJB 2ZXIA 1HOMA 1PSEA 5IXBA 4M6YA 2ZCFB 1Z3XA 3CCMT 3CUOA 1UHCA 4BHBA 1N8RU 2QQ9A 4F92B 2PTKA 1VQMT 1IXDA 2KIFA 4HKEA 1JJ8C 4U0YA 4LLLA 1FMVA 1ZN2A 4HNVA 3OR2C 3DWLE 2VYTA 3FXRA 2H3EB 5A0GA 2DLPA 5HLHA 1X3UA 2OUMA 3MZYA 4O5VA 3HOVJ 3HEFA 3NRVA 2WSFE 4M7DE 4IRGA 2K27A 4AT1B 5EEGA 2RHYA 1UCRA 2FQ4A 1LVAA 2JN6A 1G59A 1SFXA 3QKJA 4G7ZF 3I35A 3DV8A 3CMEQ 4XONA 2QDLA 2O7OA 1O4XA 4YIIA 4MZMA 5HS9A 2DMTA 3LSMA 2XHKA 3S3NA 5CO7A 4CI0C 1VQOA 2HNIA 3JAMK 4XK8E 5LEKA 5GAMh 2WB1N 2VE8A 2ZXWH 3QYEA 3CCLT 2ZKZA 2F4OB 5I21A 4GGGA 1AEYA 1O9SA 2ELKA 4M78E 1X1AA 3KP2A 4RM3A 5M3MJ 1W36C 1ULYA 3QG1A 2FU4A 3CPFA 3RQ4A 4XSZF 2WB1A 3MHXA 4J9FA 1UGPB 1SD4A 2O8KA 1AHJB 2CT3A 2RD1A 4JJDA 1KQ2A 2NVYJ 4PJNA 4B43A 1VQKT 1VQNQ 3DQVC 3LOCA 1VQNA 3CCQA 4PJJA 3S1QJ 2E1NA 4N9HA 3BR6A 3H3UA 4R1HA 4DBHA 3CC4I 1U8RA 2DI3A 4YFKF 2NVXJ 3M0UA 3TW6A 3JB9J 3RMQA 4FQGA 4Z6YA 4N4GA 1KQ8A 2HTJA 4LIVA 1IAWA 2ZPEB 3K4JA 3OIQA 5IOYA 2GTOA 2SRCA 2JVGA 3VEPA 4PSWA 5KHDA 2BE9B 4A12A 2ZPGB 3CMET 4B4CA 1P7JA 3LX7A 4XLEA 5J1UA 5C4XJ 1X2NA 4C5EA 4J8OA 2J5OA 3LA2A 3TO7A 4EJUA 1SRMA 2F5EA 4JYKA 3BQZA 3IAS2 3QOPA 1HYOA 4J9HA 2PZ1A 1CGPA 5I2MA 3IH3A 4AIJA 3G3ZA 1JBMA 4N0BA 2L3DA 3FHZA 2A05A 1IF1A 2KXCA 2LVMA 2YUNA 2HNHA 1Q7YU 1PD0A 1J9IA 1ON1A 4NBQA 4JJCA 5C6SA 3IRRA 1NG2A 4JX4A 3GCMA 1U3OA 2LRQA 3H8ZA 3BG6A 5LJ5j 2EBPA 4F14A 1BN5A 2A3SA 4M71A 5J6XA 4BDZA 2EQKA 4HT9A 2M3AA 2UXXA 4UUTA 3CQTA 3LSKA 3J7AY 4P5NA 3K0LA 4IVNA 1R5ID 1F9NA 4KN7X 1RUWA 4Q5WA 2GTJA 2CRGA 2V9KA 1HKQA 3M53A 1UHSA 2HWVA 4M77A 2M9HA 4PJOC 3G71Q 3DTEA 3IL2A 2A6HF 5HDNA 5J8CA 1TTHB 2DAOA 3QU3A 4U88A 2O88A 3EG0A 4JLIA 5DM6F 2AQFA 2DA7A 3CCMI 1K61A 1SHFA 5GAN6 4EM1A 1YX5A 3MJXA 4QLCU 1QVTA 5JHUA 4LLGF 4ENMA 1T39A 1E17A 1L0OC 4OOIA 2MD5A 3OYKA 3GFJA 5IT9Z 2KT8A 2P0KA 3CO7C 3CCEA 3QUIA 1IRXA 1D0YA 1P7IA 1D1AA 2FRHA 1HA8A 5J26A 5I11A 5K1YA 3M0TA 1M90U 4FHTA 1ZH5A 2VGMA 3LH5A 1CF7A 2HEQA 5IN1A 4L5IA 5LJ5e 4CUGA 3X25B 2RVCA 3J81Z 4A5NA 1OYYA 3MFKA 1JUSA 3JRCA 2CKKA 2LQNA 2RQTA 3I5SA 3G2BA 4C92G 3HSFA 1OULA 2CP0A 2DFUA 3QDRB 1X1PA 1KU2A 4FTHA 1EIFA 4A3KJ 2FL7A 4FM4B 4J7FA 4C5IA 1JB0E 1WSUA 3SJMA 2C0IA 1JGSA 1T6SA 2OTJT 1RADB 3X2QH 3HZJA 2F2VA 4P1WA 4LNPA 2O9SA 4RTVA 2G7HA 2XIDA 2KLOA 1LDDA 3A1YA 4BBRJ 4CYCA 3LNQA 4OMFB 1SC7A 3I56A 3ERMA 3CMAA 4PJOE 1UB9A 4Y15A 4LD6A 4PNOA 4RLQA 2BTTA 3O8GA 1RZ4A 3S3MA 1S5LC 2BEOA 2F4MB 2BZXA 3MP1A 5A2QZ 3LSRA 1N77A 3PQKA 5HVQC 1GCQA 4M9ZA 3U21A 4BQNA 1A35A 3DB3A 3H9NA 2Y9ZA 2V26A 1YG2A 2KDZA 1UB4A 3RIRA 3OQ5A 2HL5C 1YRNA 4ZJZA 1Y71A 3EFRA 4EM0B 3CC4T 1N8RC 4RLFA 2KQWA 3DU6A 2R7WA 2V6EA 3OYMA 1MBFA 2ZO4A 1E7OA 2K2MA 3A98A 1RR8C 3QYGB 4M7DD 2H27A 3EG9A 4JRKA 1FP2A 4G9YA 3PMIA 2P7VB 1FWZA 1HDDC 3KZIC 5J4VA 1U1SA 1WJAA 2DJQA 3E9FA 3QIIA 2Z16A 4JJBA 1ACIA 2DQRA 3REAB 5GAMd 3CCMQ 2FZGB 3AG1H 5AYFA 3WU1B 3FBIB 2K79A 1MKMA 1UG2A 4M3DA 3KE2A 4JS5A 4NOYA 1VQMA 3MAJA 2JA6J 3E3VA 2LT1A 3N5BB 2FZCB 4L9JA 1JJ6C 3PJRA 2Y0SN 2JPBA 3BG5A 1U9OA 3LSHA 3ZOBA 5ILUA 3RKQA 1U1TA 2GBQA 4HG2A 1MGQA 3PNYA 1OU9A 1GV5A 2VIXA 1O3SA 1KQSA 3G6EI 2HZYA 1WI3A 1FLIA 2YU3A 4PKCC 3BTIA 1DP7P 1KD1R 4N4NB 2X51A 2KT0A 2UZKA 5LD2C 1E6GA 1J0RA 3DF8A 3P7NA 4F3QA 5E3NA 2FYKA 4AFSC 3W2AA 1RACB 2CQNA 2F6CA 4M7AF 1J09A 4PK4A 2ZZDA 2VUBA 4E7SA 4MDWA 2FOWA 3FC3A 3ULRB 3PL8A 1V3FA 4HX4A 4CO8A 1YHQI 2DL3A 5LJ3g 1VQ4A 3DKYA 3QO3A 2VBYA 4EMKC 3JAME 2P4WA 3ZMTA 2LDUA 2ZSIB 3GFMA 3ULQB 3RKYA 3Q0UA 2KK4A 3ZBDA 3JCMQ 2CUEA 2FJ1A 3DEUA 4L9VA 3FB9A 1FC3A 1OZ3A 2EPDA 2YSRA 3OYAA 2FX0A 2QKLB 4BBSJ 2LC4A 1T95A 4AC0A 2LMJA 2XSJC 2OU2A 2R7VA 3G71A 4IUVA 2EFNA 2QZ8A 1A36A 2VBWA 1NBEB 3WTYC 2KIQA 2X6YA 4I09A 4LG0A 1YO5C 1ZSGA 2MMPA 3JRAA 3ZN1A 2RPNA 4F7UE 3ZQGA 4IHTA 1VQ4I 1R0BG 4J9GA 4M3EA 2CUBA 1RL2A 2CZ6B 4D8KA 1BBZA 2GFUA 3T8RA 2QEXQ 1WI9A 4GBQA 1B8IA 2DYRH 4XNFA 3GTJJ 4GRIA 2KYMA 3NWSA 3M0RA 1V5EA 3RNJA 1A6QA 4D0PA 1OPLA 1USTA 2XB5A 2A07F 3H0IA 4D5CA 2J6KA 4ELZC 1S8NA 2FNPA 2MBFA 4B9XA 1ZHIA 3CXCS 5L3BA 3X20B 1DGRM 4BEHB 3DB4A 2IS1A 1YRNB 1J5YA 2M0YA 3CCQT 2NUPA 1ABOA 2WC2A 4NQWA 2E3IA 4R0KA 3SWNA 4YIRX 4IHWA 1BM9A 2LCSA 3NTKA 1CKAA 3QQAA 2K3FA 3G6EQ 2E5ZA 2JA8J 2VWFA 4C8QG 2DEUA 1QVFA 1YW9A 2VL8A 2GAUA 1TWFJ 1IGQA 3A8GB 1N5ZA 5L3GA 3CC7A 1TG0A 2Q0OA 2EV6A 2R93J 2E65A 3SEMA 3F22A 2FBKA 2EFPA 2E1MC 2AKKA 2JK3A 1YITT 2X48A 4A4KA 2AHJB 2COBA 2LF7A 2MFZA 1IXSB 2IGKA 3LWFA 1Y7XA 1ZBXA 2DL4A 1LFUP 2RJFA 5F0CA 2L2PA 3HL8A 2LCLA 4X9CA 2OAZA 4U0VA 4WX9A 2VT3A 1LJOA 1PM3A 3TEDA 3VODA 4GCVA 4AWXB 2K3PA 1AVZC 5FLMJ 2DFHA 1B59A 5DCMB 4AM3A 1V5GA 4ITVA 3ZMZA 2R7ZJ 1X69A 2E64A 4DEXA 4QW2A 3J7AF 2PBIA 2QK0A 2IXSA 2P5KA 2VXZA 2WSCE 1VQNI 4D5FA 1QLYA 4HX8A 4F91B 4F7UF 2BIVA 4Y7NJ 3CP8A 5M5XJ 2KZVA 3WG9A 3AAFA 3DXJF 3QP6A 1RC9A 1VF9A 2RAEA 3E5QA 2CSIA 5I22A 3I55Q 1MMDA 1QVFS 5ICEA 1AU7A 3MKLA 2HBWA 5GJWB 4RAYA 2GOXB 3H0GJ 1KJWA 1X6BA 2VASA 4ZN1A 4FE7A 2EAYA 3A5ZB 5KYWA 2MWPA 2HQNA 4XKVA 2ESNA 1JKOC 3NFCA 2IP2A 4HT8A 5C44J 5FB2A 3T5XA 3FWEA 1D1BA 2GQQA 2DK5A 2V1RA 1ETXA 2HDDA 2XAUA 3CJNA 2J6FA 3M59A 1WJFA 2XRNA 4CCMA 3ABKH 2DMQA 2BY3A 3S3OA 1LDJA 5FWCA 3VS0A 5GAN8 1O57A 1XG1A 2AHQA 1YI2T 3JCMc 5L3EA 3JW4A 3HOYJ 1ETKA 3RZDJ 1QP2A 2DJIA 4DA4A 4RCCA 3QPTA 2L89A 3JSOA 2PVDB 2ZB9A 5FROA 2WY7Q 2QTXA 2FMLA 3JCMW 5GAOn 3LL7A 2NUPB 2RQVA 3VUBA 4ESRA 2DA4A 5C4JJ 4RGSA 1MBKA 2QDYB 1X3WB 2IPOB 2L7MP 3CUQB 5D7UA 2EFQA 1QWFA 2VB6A 3EYIA 3GPLA 4LOCA 3UA7A 2P6TA 4JBAA 5IYBJ 4ESBA 2QGFB 1D5VA 5FLVA 1RKWA 4JP0A 2O4XA 2V9VA 5F08A 1ACMB 2OQRA 4B6MA 2I8DA 4L5EA 5EJCA 3SXYA 2AKLA 4G6TB 1SVMA 5B1BH 4YFXF 4N4IA 4M75E 4RKUE 2D6FA 1A04A 2CT4A 2O01E 4UNOA 1SG5A 3V42A 3VFZA 3EH2A 5CAIA 2GIVA 1VYTA 3L2QA 2JS2A 2PN6A 1HF0A 2F2EA 4HEA2 3HOSA 3DLLF 1M4ZA 2A61A 3ZMSA 1ZX6A 1B4AA 5EG0A 2UXNA 4PJMA 1WXUA 4PGGA 4C0FA 4EDUA 2H09A 2MA3A 1NK3P 1ZRCA 2EGAA 4FASD 2EGCA 4UB6C 1WLPB 4BQOA 4HW0A 3MVPA 3SZPA 2KVQG 3H9QA 4RB0A 1ZRDA 2KSSA 5GAOr 4BEHA 1PD1A 2JW4A 3PIPF 1WI7A 2F1LA 5CKBA 3MKWB 1IXRC 1BCOA 3PUBA 1YITI 3G7ZA 2M0MA 2XF5A 3OIOA 5DYMA 5GP9A 1FTZA 1MV3A 3CCRT 1W0TA 4XQFA 1BOAA 3UA6A 1PNJA 1TW3A 1J2XA 4MFDA 3RKXA 3FXKA 3G73A 2P81A 4M75B 3BDDA 2YHTA 1XD7A 4DW6A 4XU0A 5AT1B 4C8QA 5LGUA 4M73A 1YJWT 3ABMH 3CCJT 1U5TB 1S72Q 1VUBA 2P84A 1I1JA 1FP1D 1TWCJ 3E7LA 3FISA 2DFFA 3RYRA 1TC3C 3U9GA 4XOTA 3KEQA 1M2VA 1X1CA 5FU6C 4CSWA 4GLMA 2DODA 1VQNT 5GAN2 2X1CA 2VGNA 5J40A 4WCGA 1SAUA 5D5WB 2H8WA 2VKVA 3CP2A 2PMHA 1X6OA 4UUSB 5EF6A 1I1SA 1FT9A 2A7YA 3AG3H 2BZ8A 1I0CA 5IHNA 4RBOA 1LE8A 1EH6A 4B1RA 5GPCA 1R9TJ 1FYMA 4CH7A 4IKFA 1YIJT 2QSFX 4RM2A 3I58A 1WHGA 2K40A 3CUQC 3U1KA 4B3AA 5ILVA 1JO8A 4CRIA 3CCSQ 3RR6A 4XKCA 1U5TA 5K5QA 2M16A 3J81K 2PJRB 4ZNXA 2FBHA 1PHTA 4IUPA 1USSA 1XSVA 3CJTB 3LA3A 3IP4B 3FEOA 3F72A 4HCBA 3VB2A 2EIJH 3LAJA 5CK9A 1JGGA 4KMUX 3ASKA 2B8AA 3M0QA 1M1GA 1Y96A 5GANj 4LD5A 4C2UA 2IRFG 1PP8F 2ZPBB 3INZA 3NMZC 1YI2I 3CMAQ 2YUOA 1T0HA 2QGGA 2DFEA 2MC3A 3BY7A 3W6JB 3CD6A 3CCVI 2NOGA 1VQ5I 3VKIA 3HPHA 3P5JA 3C94A 3A8MB 3DLMA 3CCJQ 3T8TA 1S72T 1MHNA 4EM2A 2ID3A 2K2VA 4RB2C 1W5TA 4LIUA 4PUSA 1DPUA 2DL8A 3KX2A 2DTZA 3THKA 4LK1F 4KGVB 4QVZA 4HA8A 2A5WA 4RGRA 2DXUA 2QXFA 4HCCA 3QRFF 2HVSA 4ORZA 5GAMf 3QPSA 4YELA 2P6SA 3HG9A 3HRUA 1Y39A 3H3VK 1YWOA 4HBLA 3HPGA 2O31A 1H8AC 3UKGA 2L54A 3LQQA 3OYIA 1SRLA 2IEKA 2E2IJ 2RNAA 2R7FA 1R22A 3LGFA 4Y33A 1YJWA 2HEOA 2EYWA 2VT2A 5H20A 4HQEA 2MIOA 5DM7R 4M3GA 5F0FA 1ARKA 2XGDA 3R6NA 2HYGD 1ZQ1A 2K9NA 1Y0NA 3WE2A 4XRFA 1LCKA 5E18F 4E47A 3COAC 4KICA 3DKXA 3L2ZA 3CO6C 3CC2I 2HKOA 1IHWA 3IKVA 4GLKA 2VLAA 5FFZA 1IN6A 2QQSA 1U78A 4WCIA 4AFUC 2F5CA 2ZBKA 5BOXA 3G4SQ 4JX6A 2ZPHB 2FBIA 1R5HA 3K70D 4ON0A 1X19A 3CCSI 2NUZA 2K3XA 2K7LA 2KL4A 2K9QA 1YYVA 4BHCA 2R58A 4QQ6A 1M30A 2RO0A 2ROTA 1OR7C 4E70A 2FOKA 1MMNA 3A4CA 3LA7A 2RMOA 3J7YJ 1SFOJ 2X4XA 1R4NB 3V7RA 2KDOA 3A8HB 1UHWA 2WY8Q 4ENNA 3OSVA 2CDTA 5JLXA 2YPRA 1EF4A 4LUEA 5FD6A 1XJWB 3I5RA 1KQ0A 1YJWI 1OQYA 2DA1A 3OA6A 5BPDA 5FU7C 4M7AB 2W82A 2XPVA 3M1CA 1K83J 4J6WA 1WHLA 4M75D 1VQ7I 2CGPA 3H92A 1WJSA 2L01A 3EGXB 3KFVA 3MEAA 2DMPA 3BR5A 3F3XA 2O0YA 3ZQIA 1GUUA 2BVMA 2M1BA 1WPKA 1VQ5Q 4C92D 2NVTJ 4K11A 1B1BA 2PFBA 2NOJB 2XAFA 2FEZA 4FW1A 4RB3C 1ERDA 2PUOB 4BY6C 1E3OC 1D5YA 4ESJA 1KSWA 2JVHA 4BU2A 5K7HA 3HHHA 4WXCA 2V1UA 3HP9A 2M7AA 4A53A 2XDPA 1VQ9Q 4QQDA 5M5YJ 1VQ9A 2RHUA 4BE0A 3VS4A 4IRIA 2VOPA 3CMAI 1AD5A 1TTYA 1TLHB 3MMYB 2ME6A 3QZ5B 4MDXA 2FNAA 3VS2A 2HXOA 1IO6A 1ZHFA 2E71A 5GTIC 2F5VA 1ETYA 2CYYA 3I5UA 2PI0A 3OSGA 4IHVA 2G3RA 2G0EA 2MAMA 1KONA 1NYFA 2HYFA 1YJNQ 3A03A 3SD4A 4B09A 3CESA 3AG4H 3JB9G 1KG1A 5E3OA 1J3TA 3JTGA 2MF2A 3GUDA 2FZKB 2IVWA 3FXMA 4X1VA 3HPWA 4BXUA 1BIAA 2EFIA 4IIMA 1IREB 2NS8A 3OYNA 5FRMA 1OPKA 2D8JA 3G4SI 2AZVA 1VQ5T 4BE1A 4HDUA 2MWOA 2O8XA 4FU6A 3VSKA 5FU7B 3X28B 2LKPA 3MP8A 3UNGC 4M7AC 2HPIA 5ED4A 2VKDA 1FYLA 2BY0A 1LE8B 4C30A 1UTIA 2Z3YA 5CQYA 2Z2SB 5KYNA 1S3JA 4IJAA 3S2WA 4M78B 1TWBA 1K4SA 1BOBA 2JQ7A 4J6YA 3D1NI 1U06A 2GLOA 3CD6T 1YI2A 5LRRA 1XPXA 4KUMA 1M2VB 5L3CA 2KNBB 1U6GA 3ER0A 3PSFA 1VQOT 5TRDA 4LLNA 2QLZA 1VQLT 2QBYB 2DT5A 4P55A 3OR1C 5J1RA 4HX7A 2ZFUA 1WJQA 2FA5A 1XTDA 1DPRA 3KIOA 3CDIA 4R8HA 1DDNA 2DL7A 4OMOA 1QVGP 1XNIA 3M1EA 1LVKA 2VXFA 3F0CA 2RI2A 4OB1B 1Q1HA 2BY1A 2CFXA 4HOBA 2YLBA 1VQ8I 4ZZDA 1XS9A 1F36A 1B34B 2VQGA 5LL6S 3LWHA 2PJRA 4BXXJ 4BXFA 1NZ9A 3SB2A 3CC2T 1YITA 1TT5B 5ILSA 3VRZA 3K6GA 3WGHA 4F52A 5LBQA 2GBYA 3BTJA 3SFMA 1IW7F 3I9QA 1UEBA 1YCSB 1GXQA 3CMMA 4IEJA 5ICCA 2RGVA 2Y90A 3R61A 2B86A 2FEIA 5FLXE 3RYPA 2GOMA 2L3RA 3V4GA 5J1YA 3BFMA 3QWLA 2XAHA 4CCOA 1CSKA 1LNXA 1T33A 1T3LA 1JKPC 4OMZA 4OVAA 4P5OA 2X0LA 4QKUA 1NEBA 4KITB 1UGVA 3G4SA 4OIRF 3R0AA 2DVJA 1B34A 5C3EJ 2EILH 1P4XA 4LG3A 1GCPA 5EG2A 1K6YA 3OYBA 3BZKA 4HF0A 3GF5A 4KIBA 3L2CA 3HKZN 4GDFA 1GCQC 2H1LA 3HJEA 3U1DA 2Y2ZA 2ATCB 1R49A 2TDXA 3I59A 2LJ3A 1IRFA 2QBYA 3FF5A 1RAAB 1VQLA 4HDVA 4XL9A 4BE2A 2DMNA 4NDLA 1FJLA 5FD5A 1IN5A 4N9IA 1D8KA 2IW5A 1I5ZA 4II2A 4ESFA 3H0FA 1J7KA 2RREA 3GZ5A 2E2JJ 4OMYA 2LVSA 1A31A 1NYGA 4F16A 4UC4A 1ORKA 2FF4A 2NNYA 1YITQ 2KY9A 2MK5A 3BR3A 2QQ8A 4KT6A 1M8VA 3ZMVA 3M8FA 3PMTA 4F7UB 3F21A 4ZYEA 1UJ0A 3IH4A 3CMAT 3RZOJ 4C92A 3HFOA 2E3HA 2XKPA 1ODDA 4I98B 4BUPA 1G4DA 1YIJQ 1ZA2B 3OYYA 4XU2A 4C0DB 1KA8A 4XRSA 1O7FA 2KQRA 1T98A 2BZYA 1KK7A 2JM8A 1AT1B 3E2UA 1K9MR 2ADUA 2DA3A 2YX7A 1FMWA 4GO1A 1ZSZC 1RESA 1ZKGA 3ME9A 4HYEA 5HODA 2L0AA 3J80K 2O61A 4BY7J 1ZRFA 3C18A 3PM1A 3G4ST 3CZ6A 1UAAA 2E6ZA 1HW5A 4XLNF 2ZCWA 2KGTA 4Z02A 5DEQA 2Y75A 5KAIC 3S14J 1I81A 3G1JA 4F17A 2M9UA 4BNCA 5LRSA 2CREA 1BJZA 2RF0A 1IB8A 1Y56A 3MN2A 2OTLI 2H94A 2RQWA 4CYCB 1M3AA 1ZBJA 4A2UA 2JTVA 3F8NA 3K10A 1MBHA 1I07A 1R77A 3C4SA 4UB8C 1AOYA 2PMZA 1YJNT 3RTRA 4QT7A 3HRMA 4B47A 2ELHA 3FXUA 2ZFWA 2STTA 4FE4A 2WWYA 1I27A 2E7XA 2R5YB 2F2XA 1TP4A 4IRHA 4E7JA 1O3QA 1X4PA 4LDWA 3VS1A 3G1OA 5TISC 2CH4W 2QEXT 1VQ8T 4OINF 1W36D 3DKWA 2HKXA 3L42A 5IH2A 2LC2A 4Z2YA 3ZPLA 2CH0A 2ID6A 3D5RC 2LP0A 1GL5A 2HQEA 1VA7A 3JRIA 1NLPC 2DYIA 2EFWA 2LJ0A 3F8FA 3FK7A 2DE0X 1ZAOA 4AFQC 5FKLA 1WPYA 3JB9F 4L5GA 1JKRC 1K73R 2VJ4A 2WAQN 2VI6A 3PO3J 2F4IA 1TNTA 5CLSA 1KGSA 2VOOA 2HDAA 2L7FP 3HGYA 4HVVA 2QGUA 3DEWA 1NH3A 2K6DA 2EZHA 1YFHA 2YRVA 2KXDA 2E5QA 3H5AA 4ZYAA 4S05A 4I76A 1M3BA 3GYHX 4BI8B 1IRGA 5HDGA 1R58A 5GAN3 3QOEA 3L2RA 2P5LC 5FRNA 4XLAA 3WU0A 3MQ0A 2KAFA 3OY9A 1WHHA 2OI3A 2RQPA 3OYCA 4I01A 3KPHA 3HTSB 4IUUA 2ISZA 2Y48A 2E1CA 4YRVA 3WHCA 1RABB 5EZHA 1GV2A 3S17J 4X0GA 1SSHA 2GCXA 2JS0A 3BE3A 1GBRA 1JQQA 3TSWA 2PLYA 1UG1A 3F6OA 3NEUA 4K2EA 2VVKA 1TBXA 1CKBA 1KD1C 4L59A 1WRJA 4CA0A 2BGCA 2H3JA 1X2MA 1W0UA 2ED1A 3EG1A 2NYXA 4DOZA 3CCRA 1R00A 1O3TA 1Q82U 2KIMA 4G8XA 3JRZA 2K5LA 2GA1A 3S93A 2RK2A 2R92J 2OPTA 2RQRA 2HXIA 3FIFA 4AUXA 1VQ5A 3OMYA 1Z0XA 3PSIA 1FZPB 2D8HA 3E9GA 4PFPA 3M4GA 1YJWQ 4B3XA 1GRIA 3V7CA 1XMKA 1Y96B 1GHCA 1SHGA 1K9MC 1Z1DA 2ZJ2A 2OTJA 3OS2A 3REBB 2K5FA 1OCRH 2DJNA 2Q2EB 1S7EA 2LR8A 5GTHC 2EIKH 3GLXA 2FRYA 2YLCA 2YRCA 1WGXA 4WXHA 3EDPA 4XIDA 2QKMB 1C0MA 1Q95G 1WDXA 3VS7A 1RI7A 1W7PB 2LBFA 3KP5A 4IHSA 3EG2A 3EGUA 3OSSC 3WVEB 1VQ9I 2HFHA 2PX9A 1SVLA 1X1BA 5CVIA 3ZN0A 4C3IJ 4PLIA 2JWTA 1MMGA 4WXDA 1ZUUA 2P5VA 4UUSA 2EKHA 2LD5A 4ZYDA 3CBMA 3MKZA 5GAOq 5FKKA 1PP7U 4KN4X 1F43A 2OTLT 4OMNA 5E79C 3LFKA 4MTEA 3OSFA 4DYRA 3NAUA 2DPUA 1SMYF 2EPFA 2HU9A 3KP4A 2LKXA 1YJNI 2K9LA 3ABUA 3QJ6A 4RG2A 5DD8A 1LQ1A 1KYZA 4BDYA 2JTMA 2VKEA 1RKTA 2RN8A 3WG7H 3VRYA 4DBFA 4RMNA 4RAGA 1OCCH 2MH2A 1MBGA 1AA7A 5F0HA 5EGOA 4A3CJ 4FSSA 4ME7A 1VQ6I 3BG3A 2DTHA 2KYBA 2Z0WA 5HLGA 4UY8I 3WTZA 5HDKA 4A4HA 2BYVE 2QF7A 2B0LA 4YFNF 4HNTA 1JKQC 5FGMA 4C92C 4C5GA 3K2AA 5D4SA 3SDZA 2L5QA 1OU8A 5CPRB 5FO5A 3E1SA 1SEMA 1V1CA 2OZ6A 3JCMd 5GANg 2PMZN 1MNDA 1RI0A 4EJVA 4A93J 5GAOp 1M8MA 4MEYF 2GQIA 4LUDA 1Q81U 4ZDPA 5FJ8J 1MMAA 2X4JA 3L2WA 2ECCA 4OAZA 3HRSA 1HW2A 1JU5C 3HSRA 2BW3B 1ZSZA 5GMKj 2L9RA 1XMAA 2JA2A 1Y6IA 4WTOB 1S29A 1JE8A 1TNSA 5L3FA 3JCMb 4BACA 2XPWA 3HL2A 1ONVA 2X6WA 4MIMA 3EUHA 2L3SA 3TVTA 3WVDB 3PIPA 3CCJA 1W2BP 1IJWC 4HV6A 3O5ZA 3QWXX 3V7SA 3KZYA 3C12A 2VKNA 1X58A 4G7OF 4J9DA 3CCRQ 5E1WA 4BQQA 4OMLA 3WE3A 2DOAA 1QHGA 1I5LA 1WHMA 1WKMA 2R7OA 3SZTA 5HCKA 1WQWA 2LKSA 4XKWA 1MMSA 1GVDA 4C92E 5HLIA 1CF7B 1IN4A 2P8TA 2JVVA 4JZ4A 4RGXA 2LLKA 3LQRA 3FXQA 2MLKA 2Q1ZB 3E97A 4EJWA 2RM4A 2LP5A 4J83A 2HQAA 4KFCA 2FXAA 2KFDA 1R4MB 4C8QC 3GBQA 2BBYA 4J19A 4CC2A 3BZ6A 2AIRB 4EMGA 3H36A 3DPTA 1B72A 4HVUA 1OFCX 3I0TA 2V1XA 3I56I 3DBLB 2P0QA 3JSCA 1DGWY 1W2BA 3WTVC 5H6RA 3TOBA 2D1VA 2OX7A 2W57A 2VC1A 2JA7J 2D9TA 4PZJA 1RRJA 4KT0E 4MFEA 3ZFJA 1QZYA 4DQ2A 3K4CA 5E3MA 2NUTA 5GAMe 4HXJA 5LHGA 2DEQA 2EV5A 1MJBA 5HNHA 4M78C 1U2WA 4M75F 2C0OA 1D3YA 4PFZA 2CZ0B 5E3LA 5LFAA 1R23A 3J80Z 2HCKA 3KEOA 5IAYA 1YS7A 3K1PA 2DXTA 2MD0A 1AKHB 5ICFA 2CYZB 1M1KR 3HSBA 1ENHA 3MEUA 2XVCA 1T0JA 1X4OA 2RC4A 4DOVA 1JXOA 4Y3OA 3QYFA 3OL3A 3GMEA 4CCNA 1D3BB 2ICWG 4NUBA 2ESWA 2FSWA 1MGTA 2MC4A 1YW7A 1SD5A 3K4BA 1XB4A 1R6RA 2JPCA 2EQIA 1NM7A 2DMUA 1B07A 1NJIR 1H641 2PUKB 1E3HA 1MJ9A 2CV0A 1K8AU 4AFZC 3GEZA 4TV7A 2JRTA 1VQKI 1BJAA 2HQ5A 2KROA 1I3AA 4I0BA 4NL2A 3GWZA 4AYBA 4J9CA 2AO9A 1JEGA 1OYIA 2K9GA 3QBYA 1V76A 2LCCA 1X01A 4UVAA 2VUMJ 1X1DA 5IT9E 2M0OA 4II1A 1NLOC 1QVGS 1VQ6T 1JUPA 3CLOA 2IGNA 1BW5A 5KYWB 4JRQA 4CCKA 4M7DB 1B3QA 2RN7A 3FDRA 5HK3A 4UUVA 4QTRA 5LJ3d 3EUAA 2YU9J 2ABLA 1N75A 2JOYA 4ENKA 4PL6A 5GAHJ 2X3WD 3I9V2 2V6CA 2DL5A 2KRSA 1UELB 1QCFA 3RCOA 1H88C 4KDPA 1JRIA 2HOSA 2B9SA 2CGHA 4M78F 2XDVA 2HSEB 1QO0D 4IQJA 1YJ9A 4HNUA 4KH0B 4NQWB 1KC8U 4XTUA 2BVLA 4VUBA 4X34A 3VS3A 2IGMA 5CKEA 2RNJA 4H0EA 5FW9A 5CR2A 1UJ8A 4OGEA 2L9NA 2M02A 4XLHA 2VN2A 4IF4A 2DD4A 2NWMA 3PVQA 4U87A 2PVGB 3M3YJ 3RPQA 3CMEA 1GVJA 2JN0A 4DBRA 2QG9B 3W2VA 1K73U 2RQUA 3ZEHA 2ACJA 1R1UA 1SVOA 2FQ3A 3IWZA 2Q8KA 1Z9QA 3KXTA 2K57A 1Q82R 5EEAA 3V8JA 2UUZA 3PTAA 3D5SC 4XTXA 1WJCA 3MEVA 4B8XA 1XOVA 1YX3A 4D7NA 3R6SA 4N0AC 2VBZA 5IP7J 4AG1C 3WTUC 1RUOA 4E2FB 1W4MA 4A5MA 5GAGJ 2MI6A 1JHFA 2OJED 2VPRA 3GX4X 2R5ZA 2E41A 3P8HA 2X9DA 4YEJA 1EV7A 2L0KA 2V1NA 3Q0WA 2V4JC 1GDTA 3IHUA 1QW1A 1RAHB 4NC7A 3QHSA 2DTOA 2RNGA 2IS6A 1Y07A 3IC7A 1S1NA 2F2WA 2Y4XA 3GNGA 3VS6A 4DZPA 1VQKQ 1V29B 1KIKA 1Y8RB 1YP5A 2ZMEA 4XAXB 1OLTA 3OV8A 2OZUA 2CJJA 3Q9VA 4IZZA 3H9JA 2EIFA 3PO2J 2FRWA 4RTYA 1N78A 5LJ5g 3RI4A 1X27A 3FBNB 4A3GJ 1JUMA 1KHCA 2QYZA 2XICA 1Z6TA 2LSOA 2CUJA 5AIPA 2VPLA 4M7DA 2CU7A 1I4K1 1OISA 5GANe 3H41A 1FSEA 1T0FC 1KZHA 3JCMX 1W5SA 1XSDA 1IDYA 2XGXA 1UZCA 5DUKA 5KVRA 4M75G 3CDLA 2OTJI 4TVRA 1G5VA 2R57A 3EUHC 1HJDA 4HSRA 3DTKA 1RAEB 1OKRA 2V8JA 3M4YA 1IZ6A 4OIPF 1TT0A 2EQRA 2CQKA 2XIGA 5FKNA 3A01A 2CP3A 4JZ3A 2V79A 1NPPA 2A68F 3MD2A 3RSNA 5HY6A 3JB9I 4XTYA 1Q86U 2XDBA 3DTIA 3K4KA 4B48A 4PFOA 2RDPA 3GNFB 1IRZA 5GANf 2WV1A 3QDFA 3CCLA 1MZBA 2IBDA 2MSYA 2ZNZA 2MGQA 2R5ZB 5GAN5 1JJ2P 1Q82C 1VFCA 1REPC 2O9VA 1C1AA 2CS3A 2DU9A 3TO9A 2CZ7B 4AG2C 1PC0A 3F6VA 1LKXA 4KMFA 2FHDA 3FRNA 4M6VA 3P8BB 5IP6A 2JUFA 6PAXA 2ZPIB 2GXGA 1AWCA 2IS2A 1XGNA 3LMMA 2QQRA 3T9NA 2R7DA 3ZQ7A 3ZXSA 1XTAA 5J8FA 2LQ8A 2FG0A 4XBFA 1H3ZA 2CH4A 5GADJ 5D6XA 1HC8A 3E5UA 1K1ZA 1PWTA 2O4XB 5FU6B 4Z8AA 4M7AE 3MCZA 3OMCA 2L7KA 3LYIA 4A3MJ 2CQ7A 1QQJA 4PJOB 2FMYA 4QPOA 1XGSA 3ZP5A 3E6DA 4I99C 2HQRA 3QJYA 2JRMA 1M1FA 1JHHA 2K4JA 2MABA 2R7SA 1JJ2A 4DIQA 2L9SA 3S15J 5C0MA 2K4YA 3K9TA 2WAEA 3BPVA 5I2SA 4M3FA 3KYDB 4NC8A 4OIOF 3MPUB 4E6KG 2DT7B 3G6ET 1TXQA 4M77D 3CBPA 1QQIA 4ZTJA 2DYBA 2HPMA 1RAIB 3M56A 5GMKe 1Q86R 1FOXA 2EW3A 1Z05A 1F1ZA 4X1EA 1E0EA 3SDBA 3HB9A 3O8HA 3M58A 3BG9A 5CJ9A 5DS9A 3PIOA 2DBBA 2EA2A 3O3KA 1NK2P 2GNCA 2CQXA 3C0CA 3PNVA 3BW1A 4OP0A 2B7EA 2A37A 1WJRA 1JTXA 3GTLJ 3O8VA 2JT1A 1W4SA 3CCVQ 5CVJA 3H0DA 3LSTA 1HK9A 1YHQT 1RPWA 2B63J 2FPEA 5LJ3h 2IAIA 3VOEA 1S7OA 3GZNB 2X4HA 3REOA 3CCET 2PVOB 3MKYB 2MH9A 3RJPA 1OQKA 1ZA1B 2MG4A 3GP8A 3OYDA 3JB9H 3NQOA 3G1MA 2JXBA 2DQLA 1YWPA 4IURA 1VI0A 4LE9A 3E6BA 1ZTRA 4LN2A 3M9AA 7AT1B 1VQMI 3BY6A 2NS7A 2F5DA 1EJ9A 1B9MA 2F5FA 1P92A 3OL4A 5JFRA 2VODA 1G83A 1JXMA 2R7TA 2Z1DA 1AWOA 4P9UA 3CCUA 4ZYGA 2AK5A 3K4LA 4RTXA 4UV9A 3ZQQA 3EGXA 2HOEA 1TU0B 4RG8A 5A0LA 1IG7A 3AFHA 1VQ4T 2EWNA 4ASNA 3T0YA 1KFZA 1LPQA 3C95A 1MIJA 2EK5A 3M4OJ 2E6NA 1VYUA 8ATCB 5GMKl 4LDVA 4H4KC 1AZGB 1KHIA 3EPZA 2EQUA 2AQEA 2BV6A 2HAXA 1RAGB 1ZGAA 1WGSA 2XU8A 3TSZA 5KYYB 1V4RA 2YS9A 3KFWX 2NNNA 4KA4A 2C0TA 2F69A 3CCLI 1FBSA 4Y52J 2NAZA 1ITYA 3GXOA 2H6BA 1SD7A 3ZMDA 3T1BA 2H8RA 2XF6A 1EFNA 2WSEE 2L2OA 1ZGJA 2KIUA 3CCQI 3GTGJ 5E17F 1JXSA 1HSJA 5F27A 1RETA 3L00A 2DJZA 2EVRA 3J80E 1T08B 3META 4L6V5 1V54H 1WJDA 2BW3A 4I2OA 2EFOA 1AOJA 1GT0C 4A4EA 1B9NA 4QQGA 1H9TA 1S72A 1KQSS 4EJOA 1N6AA 4J01A 2V1QA 3S6WA 3TCJA 5IT3A 2DMOA 4M77B 2DD5A 4BY1J 4BL0B 2N8GA 5FLXZ 3TL4X 2XROA 1AWXA 4EMKA 2PNIA 2E5NA 2KRFA 3TEEA 2DW4A 3PNTA 2RI3A 3RKWA 4BD3A 1Z77A 2KZGA 1B7TA 2ZAEA 1IUFA 1M9SA 2D0NA 5GAMg 1SANA 1BC8C 1DU0A 1YFNA 1C0WA 3OS1A 2DXBA 3R6OA 1VQ7Q 1QPIA 2E60A 1FOWA 4RDUA 5IXFA 3JCMP 1I6XA 2GM4A 2ZMEC 2JTFA 4XRMA 3OWTA 2CP7A 1Y0UA 1MW7A 3F23A 3KP3A 2CO5A 3FMSA 2M5WA 3SEQA 1MDMB 3WGIA 1S9HA 3GO5A 5B3SH 4CCLA 1U3EM 1I5OB 2P4TA 4XOPA 2A36A 4KUIA 3SYTA 3RERA 1UDLA 1VQMQ 1ZR2A 5TJJA 3HXLA 3LFUA 2A08A 3U2RA 4G6QA 2IA0A 3L2UA 1RR7A 1T8IA 2R5AA 1S6LA 4ABZA 2DO3A 2LX7A 4IUQA 2FVUA 4KBMB 4XLCA 3DEEA 3MWMA 5HKCA 1K8AR 4M74A 5IT9K 4N4OB 2LRDA 1Q86C 1KQSP 3I54A 3AG2H 1GLNA 2QUFA 3TOAA 3C2HA 3QP5A 1MNMC 4CC3A 1OYWA 4FW2A 3F8MA 2EJGA 2ETHA 1IV6A 1XDUA 3HOWJ 1PVEA 2VKHA 3KUFA 3M0SA 1I3QJ 3P9IA 2BHZA 3EHQA 2HGCA 1Z6RA 2BXZA 2JSCA 2Y30A 5KYXA 4LD9K 1K78A 3GTQJ 2EGEA 3J7ZI 3ONQA 3SWNC 4BQAA 4M75A 4A0YA 3FX3A 4A6DA 5GAEJ 3QYBA 1Z9CA 1PKSA 4CYDA 3CC4Q 2KISA 5F04A 1VQLQ 2A69F 1WCMJ 3VYTB 3OBWA 3CXCA 1QMCA 5DV5A 1QRYA 3CCEI 2HL3A 2DAQA 1LPLA 1T56A 2M87A 3H5NA 1R7JA 2CV2A 3CCUI 2JA5J 2COWA 3IUOA 2EINH 2LNVA 2M30A 4KRTA 3E6CC 2I2LA 2M51A 4IQ4A 1FIAA 4PGHA 4XTVA 3BR1A 3ECHA 3MZ8A 4LJZF 3D0SA 4BGDA 2HQXA 4LXCA 3N05A 5GMKh 3IKTA 5KE2A 5LGTA 1R1VA 4RAFA 4E7KA 2XGEA 2ZSHB 2BHYA 4E7LA 1BB9A 4XICA 2LTPA 1D0XA 3GOXA 2XAQA 1K4US 1BCMA 2OAWA 1YQAA 2R4GA 4IHXA 1R5GA 5LJ5h 2IGOA 4QWQA 5F1JA 2P0PA 3OYGA 5DLQE 2JUCA 3PUFA 2K9SA 1VQ8Q 1I1GA 1LFBA 4CZCA 2HS5A 2PU9B 2DKGA 5HNFA 4HCKA 5KCOA 1M27C 1VZ0A 2ELJA 2Z33A 1N27A 3CXCP 2W7NA 2Z99A 1BR2A 1SKUB 2NLUA 1FIPA 2DTRA 2QTVA 2COYA 5FKOA 3FMQA 3DLAA 1FBQA 4C2TA 1W7PD 2C06A 5HS7A 4LMYA 1GFCA 3ZQFA 2ZGWA 1CQTA 1U0JA 1WFXA 1TUGB 4DZJA 3JCMg 4L18B 3GTPJ 1WHKA 2WA0A 2CUZA 2ESHA 4IX7A 1WVRA 1YW8A 4A3FJ 1O7LA 1VIFA 1VYVA 2QWWA 4JS4A 4O3MA 1WIEA 4BKXA 1LDKB 1IN7A 2Z5UA 2DETA 5K7ZA 4NB5A 1R0CB 4KGZB 4HF2A 2E7WA 3CLQA 3VWBA 1SFKA 1MBJA 2GIZA 4MMLA 2XKOA 2GZWA 4GXOA 3W6VA 1YLFA 2X1DA 3LWIA 2CSOA 5KCHA 1G3YA 1WQ7A 1KU3A 1PYVA 2E2HJ 4RTUA 2QVOA 5BMZA 1JT0A 3JRBA 1YI2Q 3DCFA 2EZKA 2L4AA 2CP5A 2M2EA 3F8CA 1Z67A 4RGUA 4MZTA 3UWNA 5IPAA 1MNEA 2RJCA 1H92A 2V7FA 2SEMA 3HM5A 3CCJI 2IJLA 2E35A 2XD0A 1K73C 2DF6A 2HI3A 2K7AA 3CJRB 5F64A 1MV0B 1X75C 2DYSH 2FUG2 1WZ2A 4O6JA 1G3WA 4ETSA 5HLTA 4JOMA 2JM9A 1OCZH 4XSXF 5ECAA 4D6WA 4I0AA 3EAEA 3W6KB 2ZNYA 3TKYA 3I55I 2E19A 4OU0A 2TRTA 3NWTA 3GVAA 4A0ZA 4ZGDB 3TMOA 5B1AH 3S8PA 1DJ7B 4EGZA 4BUGA 1N9SA 1U8BA 3GW2A 4FL6A 1YIJI 5H6QA 2Z9OA 3NARA 3HOZJ 2CFOA 3UR3C 2ZC2A 4W1UA 3BTLA 5E8IA 1SSFA 2ZPFB 2QSGX 5ERIA 3AL0B 5LGNA 2IA1A 3VYSB 3KP7A 3SFIA 4AVPA 2GQVA 3MEWA 2FO0A 1AZEA 2FB7A 1Z9ZA 3TU4K 4C9YA 2DA5A 2OC6A 1ZG5A 3CC2Q 3UDCA 2YWWA 1TW2A 2LK2A 2LY2A 2DPPB 3A0BC 2NUTB 4PSXA 4M7AG 1BIBA 3HHTB 3FMRA 3PE0A 1M2OA 4V2GA 5BNGA 4ZTFA 1ZUKA 2LNHB 5CYVA 1JT6A 4HRIA 2DT6A 3WU2C 3CCUT 1TZLA 5CKHA 3F70A 4C92B 1G2HA 4BS9A 4A3DJ 5LHIA 3KEYA 2HKQB 2L3PA 1C6VX 1L3LA 1RUNA 1QVUA 2DXIA 1D09B 3I55A 2EZLA 3EQLF 4F04B 2HZDA 2CMPA 2COMA 4C92F 1HSQA 1QZEA 2CQQA 2DX1A 3BG7A 2Y9YA 2IS4A 3CCVA 1AKHA 1T3SA 2ED0A 4LB6B 1EA3A 1WFWA 2YXYA 4Y91A 1NG7A 4QVCA 1VQPA 2D45A 2KE9A 5FFXA 3A8LB 3MKDA 2K5IA 4ATOA 2DVEA 4FYVB 3GTKJ 3VYGA 1Y57A 2OBPA 2KP6A 2KMUA 3GF2A 3L09A 1XN7A 2ZJQF 1P9QC 4DJAA 2V9PA 3C7JA 5KNLA 4M4ZA 4S04A 3JCMh 2M7BA 2HOAA 1IZ1A 3CF5F 2O5RA 4B44A 2EH3A 1RNLA 3EETA 4EV0A 1BU1A 1XGMA 3R60A 5L8RE 2O3FA 1MUZA 2DIQA 4JJNK 2WV0A 1E6HA 4I02A 2HDCA 2DM1A 4FCYA 2EB7A 2DK3A 4IIOA 3KCCA 3HOTA 1MBEA 2TCTA 4Q47A 5TGTA 1OJLA 4BYYA 2K3BA 3EGDA 1HKSA 4RA2A 4BH9A 1I8FA 3CCST 1SPKA 1T38A 1NHAA 1NEGA 1F4KA 5J3LA 1BA5A 1QCOA 2GFAA 3GTOJ 1F1BB 2JTEA 3M57A 1YHQA 2R5MA 4DBQA 1Q7YC 4MEXF 3HC7A 3DPLC 2DK8A 4ZDLA 1VQOQ 4OAYA 3A8OB 5FLXK 4EEFG 3PIOF 3H35A 5JLWA 2HTSA 5EGOB 1FX7A 4DNCA 3JRGA 2DPDA 4M7AD 3LSIA 5D6YA 3QWYA 2E34A 2Y0SA 4JPBW 2JMAA 3ELKA 1WNLA 2MYSA 5M3FJ 2QA4Q 1VQ7T 3C1DA 4UV8A 2W84A 4RS8A 2KPMA 2EJ9A 4AU7A 2KI7A 1P4WA 3WODF 4LGWA 1TSFA 1TH7A 1GBQA 2W4SA 3NTHA 4KGXB 4DGWB 5GAMj 2ECBA 4G94A 3ZRGA 4IHYA 3I55T 4AVZA 2QASA 2DA2A 2X6OA 3SFZA 1G2BA 4MO7A 4NL3A 3MP6A 4M77E 2HVQA 4BAYA 2HZTA 3W3CA 3I3LA 4RMOA 4M7DF 1KYWA 1WA7A 2D1HA 1JTYA 3HRTA 1UGRB 1LFPA 3CF2A 1Z21A 5AIQA 5IYCJ 2E70A 1WJEA 3M9QA 4J6XA 4GY5A 2ME0A 2LQKA 1W6XA 3KP6A 1M90R 1FYKA 3FM3A 2DZCA 3FXJA 2YR2A 3HDDA 1W1FA 3RMSA 1BW6A 9ATCB 3OOPA 5DCFA 1HCRA 3PT9A 4A3EJ 3BJ6A 1G6NA 5E1XA 4A54A 3C3WA 1OYXA 1YS6A 3SEZA 2XKOC 3M55A 2X1EA 3PVLA 4EIKA 2GXAA 5JR3A 3FDYA 1ZGWA 1UHFA 1X43A 1VQKA 4FT4A 2CWEA 4OMMA 4DYQA 1M1EB 4LDYA 2FD5A 1ETQA 4MTDA 2NYSA 4HZFA 2LNBA 3U23A 5JVTA 3EHRA 3I4PA 5EG0B 4CZZA 2QI2A 3VYUB 1Z91A 4EATA 2O6GE 3AL0C 4RTWA 2R7RA 3VSLA 3JCMV 1K9MU 4CXFA 1DU6A 1A5JA 4M7DG 4KUDK 5KAFC 3BR0A 2VQLA 1O3RA 1VQOI 1VQ6Q 4XLPF 2D1XA 1YJ9Q 1VQLI 1TL8A 4J9BA 3EG9B 1OX8A 2WACA 3UPUA 2XHCA 2HYJA 4KT5C 2XRLA 4KJZA 4A6EA 4OIQF 4Q5SF 1RLQC 4J5YA 1Q7YR 4HPQA 2Y0MA 2CZ1B 2L02A 3B6AA 1OMIA 1BI0A 2G7UA 5GMKi 3CTAA 1Q1VA 1V55H 3CUQA 1WHJA 4PJ0C 1APLC 2A5YB 4F7ZA 3OIPA 4JLGA 1JJ2S 1A6IA 2KRMA 4ZN3A 4BB7A 2OA4A 3OYLA 2VE9A 5M5WJ 2Y31A 5LJ3f 4M7DC 5DY9A 8AT1B 2XPUA 3L1AA 4YTLA 2GA2A 1T0FA 2VXDA 3S1RJ 1AWJA 3OS0A 3SZGA 2XASA 3GBGA 1ZELA 4FETA 3QSUA 4GYGA 1R36A 1KU9A 1QNTA 3QODA 3KLNA 4Y13A 2E1MB 2ECZA 4HF1A 3CCRI 1O75A 1OX9A 3OBYA 3ZL7C 4MQ9F 3KLOA 5A2QK 2X4WA 4I7HA 2RK1A 1X6GA 1B6AA 1W1WE 3P8DA 1K7AA 5GANd 1ZG3A 2W25A 5HOOA 3PNWC 4JQFA 3WGGA 2HMAA 3NPFA 5EC7A 4JDSA 4M7AA 3MO8A 4B9WA 1Y8QB 5J3BA 4JK1X 1HD3A 2W1OA 2KKOA 4XKBA 4KULA 1VQ6A 3BWGA 4ZC3A 2J06A 1UGQB 3LLRA 1OEBA 1K76A 2YUPA 2EJFA 2VXEA 2LH9A 1MJAA 3K69A 4GFBA 2GWRA 2LJ1A 2VJJA 4NHJA 2KRHA 4A3LJ 4S0HB 2M0CA 1ON2A 2LF8A 1QKWA 2V1DA 1XGOA 2VQCA 1LEBA 2VQHA 1B72B 3HTRA 5BPIA 1PUFB 3D7SB 3TDZC 4CDGA 3QAHA 4F7UG 1QKXA 3HIFA 2O9LA 2QAZA 4D9JA 2RV8A 5CIUA 4A3BJ 1FTTA 4D8DA 2VBXA 4OB3B 4U7BA 1FOKA 1HLVA 3WTWC 3RESA 2LZ6B 3WTXC 1WZOA 2OCEA 3IAM2 1DP3A 4FSXA 4HV5A 2R5YA 2RQQA 5AONA 4P96A 1HSTA 4XN0A 4BJTA 1BR4A 4EPCA 1E3PA 3K1NA 2DNUA 2XI9A 4PDKA 4XM3A 3LSPA 1OR7A 4UVCA 1U5SA 1FBUA 3TW7A 2LT4A 4OMQA 3LSGA 2AS5F 3RDIA 1QPMA 2CP6A 1VQPT 1N9RA 2R7XA 4M77F 3CCVT 1YHQQ 3VYRB 2PG4A 3E19A 1S72I 1UHMA 4KIFA 4F93B 2BXYA 2ROLA 1HKTA 2QQBA 3H9GA 5L23A 3SWNB 3RDVA 3DU5A 4ANJA 1WJBA 4KYWA 1QBJA 4MNUA 2DRKA 2YUQA 2H1KA 5IHIA 5BQTA 3KYCB 1X2KA 2LYCA 2OQGA 3KZZA 1BKBA 1TUDA 2HQHA 3A0HC 2L4MA 3GLLA 4EJTA 1SF9A 2RKHA 2X35A 2OV7A 1FPQA 2PJPA 2LX9A 5DDGA 3O6BB 3K70C 1NJIU 4ELYC 3HBLA 3CQZJ 3Q0VA 3JRFA 2DBMA 3S2HJ 3S1NJ 1VQ4Q 1QVGA 1ZQ3P 4X9DA 2XB0X 1IC8A 4LB5A 4XK4A 4C8QB 1UGSB 1BI1A 2QEXI 2W24A 3ZQLA 4FX0A 2NVQJ 2YT6A 2K5CA 4FYYB 4XN3A 1UMQA 3R0JA 4QPQA 1RIOH 5GANh 4OB0B 3CDHA 2XG8D 4DEYA 2JJ7A 2JMWA 3QU6A 2DFIA 1PDNC 1VQPQ 5HK0A 1OPCA 1XC5A 2NXNB 2PEXA 3BR2A 1OCOH 2XF7A 2ZMEB 2PQ8A 4WF2A 3Q3SA 1GXPA 2HVRA 1BK2A 3A1PA 2RJEA 3B6CA 3BP8A 4CHUA 4RTZA 1UECA 3QYHB 1ETVA 3DKMA 2E36A 1K8AC 3ROUA 3SHFA 1TWHJ 4A4FA 2A3LA 2DA9A 3L2VA 2E4HA 2QM3A 3IQLA 1SD6A 4LK0F 1YJ9T 2HOTA 3K1MA 3TDUC 3ZMUA 3R4KA 5E8GA 4Q4ZF 1KQ1A 3QZ9B 4PJOF 4GYIA 3CC2A 5DTDA 4KH1B 3IH2A 4LITA 4E7ZA 4AIHA 3L1PA 3I59B 4M77C 2D2WA 1YN8A 4A63B 1QP3A 2LMDA 3BLYA 3B73A 5LJ3e 1W7PA 2LBFB 1PRMC 2UWMA 2JMCA 4AD9A 2LREA 2RH2A 3M54A 3X26B 5KYXB 4L5JA 3I53A 1A0NB 2E1HA 5FWBA 2JZYA 4M6XA 2DLLA 2MOXA 6AT1B 2K4BA 3A2KA 5EEHA 2GF7A 1EH7A 1VTNC 5L3DA 4M72A 1PKTA 3VJPA 1H9GA 4EQQA 4LFUA 4XORA 2XV4S 2XC7A 5KCMA 4JX5A 3VPRA 3BPXA 2LDMA 4M78A 2CW8A 4MZPA 1PSFA 4RCBA 2XK0A 3BCAA 3HTUA 2X3XD 2L7ZA 1WYXA 3JB9D 2EYYA 4V2FA 3RPUA 3ZGKA 1T2KA 2EYZA 3OW2A 1N25A 3IWFA 2MW8A 2DRMA 2NS0A 4Y28E 1QHHD 1WH7A 2K9MA 4HQMA 1K4TA 2P7CB 3QPHA 1XDSA 1VNDA 2BZTA 3OYFA 3H5RA 3EYYA 2DBKA 3C2BA 5D5XB 3HGGA 1QA6A 2E1OA 2ZJRF 1FEXA 3G1LA 2LY9A 4E4HA 2QA4I 1MSFC 3Q1JA 3JAMZ 2QEXA 3JR9A 2STWA 5ICGA 3E0JB 1Q81R 1XMXA 3HUGB 4C8QD 4Z89A 3HOXJ 2EQMA 3D5LA 3GZ6A 3BROA 2F48A 1VQPI 5JI6A 1K79A 2DCEA 2E10A 3E5XA 1TUCA 1Y0MA 3LH0A 5D4RA 3N4MA 1IDZA 2I5UA 4R79A 1ZR4A 2CS7A 1MH4A 2EYQA 5LLQA 4C0GA 1YJNA 3CCSA 1U5TC 3MEXA 4JRPA 1VQ9T 3HYIA 2HKNA 3DLLA 2IG0A 1ZARA 2LQWA 1PUFA 1YNZA 2OTLA 4J9IA 4Z88A 3GFLA 4M75C 4XMYA 3WTTC 3K4MA 2IVMA 4EVIA 2RI5A 4MQVA 4M78D 1FY7A 3L7WA 1KU7A 5BS6A 3PQJA 3LAPA 1K0SA 1D3BA 3CD6I 2ENMA 1TOVA 5D6WA 2X4YA 3OW2S 4L0YB 5LEJA 4IOCF 4LDUA 5KYYA 3J81E 5JVGF 3ECOA 1Y1VJ 3H1CA 3K7AJ 1IXCA 4I6ZA 2EV0A 4RAZA 2NRAC 2RHZA 1OZ2A 3EG3A 1STZA 4JUVA 5IHKA 5DCMA 1BI3A 3BJAA 3HHGA 4OWRB 5KK1A 1V5FA 3GFIA 4E7IA 3URGA 2ZXHA 1TS9A 3S2DJ 4N4HA 3CJQB 4QSHA 2DO7A 3PFYA 3S16J 3VU3C 3P9KA 2UV1A 4UXNA 2DDAA 4BI3A 4MMKA 5CCAA 3ZCOA 4J7IA 1G8XA 1YIOA 5IP9J 3GTMJ 1LOJA 1R8OB 4NC6A 3ML6A 3EUKL 5GAOm 3RPUD 1IUYA 1Z7UA 1YCYA 2DIGA 2J05A 3G6EA 4MGRA 4DOWA 4V2SA 1G3SA 4PCQA 1WQ2A 2D0QB 4L9TA 3BDLA 3I56Q 4AMCA 2EZIA 2I0NA 1QVFP 4EGYA 1MH3A 2W85A 1H3HA 5IY5H 2DOEA 2KHMA 3OOUA 1FSHA 2E5KA 3KBGA 4XU1A 3FZVA 3JCUC 3OYJA 3TP0A 1SFUA 3HSEA 4ZYHA 2XAJA 3BT9A 2F5KA 2HD0A 5GPAA 5B66C 4P9FA 1YJ9I 3OB9A 3MZHA 4FT2A 1AWWA 5GAOl 1F5TA 3ASOH 4N0AA 4M77G 2PQWA 2KDSA 5DLOA 1KC8R 2F5TX 2L3QA 4C2MJ 1DQUA 1H8KA 2KT1A 2IPQX 3BC8A 1EKEA 1TQPA 2XAGA 5GAN7 3WHBA 3FXLA 1I6HJ 1N8RR 3NHNA 1AHDP 1VQ8A 2A6EF 2XSDC 1NJIC 3TBIA 3VDXA 1JI8A 3A02A 4NS5A 4YG2F 2A0FB 4IUTA 4Y17A 1Q81C 5E20A 5JHFA 2H8HA 3H3ZA 3ZR8X 2BOLA 2IA2A 4EMSA 3ABTA 4C3JJ 5K5RA 3UT1A 3ABLH 4FX4A 3MCAB 2VJ5A 4G7HF 2W00A 2P4RA 1NE8A 2M4GA 3CC7T 3DPUA 2A6TA 1GXIE 2ZXJA 2Y69H 4Y4RA 3K2ZA 3L9FA 5K7FA 3AKZA 2K02A 1SMTA 3WTSC 1RAFB 3HKSA 2WADA 3RQIA 1ZYRF 2J7IA 3X24B 1SEUA 3CEYA 3Q5FA 1G3TA 2DXCA 2QQAA 4IO9F 4FYXB 4L0ZB 5CKDA 4L9NA 3EFSA 1UE9A 2CSQA 3I56T 2DDBA 5J4YA 4RUGA 2EA4A 3AT1B 4JRIA 5GAN4 2C6YA 4U0WA 4YIFA 2KRNA 1UJYA 2MCNA 1UFMA 2E12A 2QA4T 4A69C 5EYRA 4E7HA 2XGCA 4BI4A 4AIDA 2G6FX 4CC4B 1MD0A 1FMKA 1BL0A 1D0ZA 3VUZA 1W5CC 3EFOA 3FJPA 1R71A 3IRQA 3O2PE 1PJRA 5DM7F 5A0DA 3UF4A 4X6AJ 1B8IB 3BDUA 2HBPA 3OS5A 1M1KU 3CCLQ 5H2FC 2EKOA 3CC4A 3JRHA 1J59A 1FXXA 1BC7C 3CCQQ 2OCCH 1ZLJA 5DUIA 1U9NA 2W48A 1J75A 2DERA 4WWCA 2KBTA 5IOZA 2RJDA 4HLXA 3I71A 1KC8C 3FKIJ 4PJOD 3FLGA 4CCJA 3JRDA 1ZSZB 5D6EA 4XTWA 5D5UB 1D1CA 1TQIA 1E2XA 2QENA 3CCMA 5DD4A 3JSPA 2FE3A 1M90C 2AXLA 3PFSA 2GXBA 5HS8A 3QXEB 2BE5F 2Y4YA 2NVUB 3M7GA 1YOVB 5FKMA 3HFNA 4C0ZA 3HKZA 3OW2P 1YE9A 1GFDA 2VV5A 3K4NA 2CW0F 3BCBA 4BHPA 2YDLA 2D5VA 5A2QE 4FT8A 1MDMA 5F1RA 4IL6C 2V8KA 4D1QA 2LTOA 3TGNA 2YUSA 2M8GX 2R3SA 4DYCA 2ZJPF 3S1MJ 3TQ7P 2VJIA 2JZ2A 1PRLC 3S32A 3EFOB 1K78B 2Q2EA 3C2GA 4M3BA 3W2WA 3F8BA 3IV5A 2CP2A 3JV3A 1ETOA 4C8QE 2J6OA 3FKJA 3CPWA 1EZZB 2QA4A 3V8KA 3OYEA 2M34A 2AZSA 3VV0A 1UG0A 3CCYA 3V8LA 4G6DA 1FYNA 4M78G 1BYMA 5CKTA 3TP3A 3F9KA 2FPDA 4A4GA 1S7AA 3SHWA 5KE3A 4IPAA 3E6MA 4ZH4F 4XR6A 1LB2A 4OMPA 1NG6A 4IOAF 1Y1WJ 1H0MA 4XTZA 3JCMJ 3G71I 3KYLA 1IV8A 3LW5E 3JCMe 2QYOA 2IT0A 2KJCA 1EH8A 4XU3A 5IYDJ 1TWAJ 4XQ3A 2RA2A 1LJ9A 2EJRA 5D6FA 1ETWA 2LFBA 3ASNH 3P9CA 4ENJA 4A3IJ 2ISYA 1EX4A 5B5EC 2VC8A 1OCPA 1OCTC 3BJOA 2LOOA 2HDWA 3SQNA 1ZLKA 1WXBA 4PJOG 2DA6A 1TQMA 4HCZA 3RBBB 2OTLQ 2OTJQ 1WWXA 4Q48A 4HSTA 1WX6A 1IN8A 2O03A 2BY2A 3CMYA 2K86A 1XCVA 4IXAA 2QSHX 5J47A 2EYXA 3LGLA 4QVDA 2DZ9A 2OF7A 4AIKA 3I4NJ 2L8DA 4PLLA 4E6RA 2DTIA 2YRDA 3DBHB 3CCEQ 3CPWS 1K6OA 2JUGA 3M8JA 4HLYA 1UUEA 1ZLMA 4C0DC 4R55A 3CCUQ 4RB1A 1BBYA 4HAMA 4EMKB 2K85A 1NTCA 1XQHA 4J00A 3FIWA 2XUBA 4MHGA 3CC7I 3DFGA 3NGPA 2HSPA 3EGDB 4UVBA 3M07A 1M1KC 3BZCA 2WTEA 3H6ZA 3QPLA 5LJ3j 2I10A 2JT4A 2XMFA 2CW7A 2A28A 5M9OA 5CVRA 1XCBA 2M8EA 1QCNA 4FIBA 2PMUA 2MLGA 1QZZA 4FISA 1DUXC 5F6FA 4ZGEB 3TQNA 4FYWB 4ZGJB 1I39A 2VC0A 2CUDA 1ZUYA 2K3YA 3JTHA 1WXTA 4M9XA 2O2OA 2W10A 3I64A 4KISA 3CBOA 1Z7LA 2EIMH 5CVVA 5KH6A 3ISPA 3FK6A
chains in the Genus database with same CATH topology
2KRCA 4PJLA 4ZDOA 5LJ5d 3TREA 3WXMB 1QU3A 4F55A 2M1HA 2X6XA 1YIJA 3OYHA 2XDDA 3GIBA 5CQEA 2X85A 1Z3YA 2LG4A 1NPRA 2LY1A 2BKDN 3FHNA 2RB6A 2V8IA 1KD1U 1BI2A 3RUXA 1W2BS 2JNGA 4MLOA 2KMTA 4PJOA 4MZPA 3M5AA 4XLFA 4BJ5C 2R7UA 4OB2B 2JSPA 4C8QF 1OI1A 2EQJA 4BY6B 3NTIA 1M5Q1 1YBYA 3OMGA 2OAUA 3PGGA 1WJ5A 3G71T 2M4KA 5CQXA 5GMKm 5J39A 1VQ7A 1VIEA 2RHXA 2R7QA 2CV1A 4OGCA 4NNJA 4R56A 4II3A 3JCMf 5CKFA 2P0WA 2RHIA 4BJ6C 1BR1A 4EMHA 2WBMA 4OF1A 2BUDA 2WAFA 1HXDA 3AHUA 2WAQA 4F7UA 5CQGA 5LJ5f 4LDXA 1QVPA 2ZXIA 1PSEA 3CCMT 2ZCFB 1Z3XA 1N8RU 2QQ9A 4F92B 1VQMT 4HKEA 1FMVA 3OR2C 3DWLE 2VYTA 5A0GA 2OUMA 4O5VA 2WSFE 4M7DE 2RHYA 1G59A 3QKJA 4XONA 4MZMA 3LSMA 3S3NA 5CO7A 4CI0C 1VQOA 2HNIA 4XK8E 5GAMh 3CCLT 3QYEA 5I21A 1O9SA 4M78E 1X1AA 4RM3A 1W36C 3QG1A 3CPFA 3RQ4A 3MHXA 2WB1A 1KQ2A 1UGPB 2RD1A 1AHJB 4PJNA 4B43A 1VQKT 3DQVC 1VQNA 3CCQA 4PJJA 1U8RA 3JB9J 3RMQA 4N4GA 2ZPEB 4LIVA 3K4JA 3OIQA 2JVGA 3CMET 4PSWA 5KHDA 2ZPGB 3LX7A 4XLEA 4C5EA 4J8OA 3IAS2 5I2MA 1JBMA 2LVMA 2HNHA 1Q7YU 5C6SA 2LRQA 3H8ZA 3BG6A 5LJ5j 4BDZA 2EQKA 4HT9A 2M3AA 4P5NA 3LSKA 3J7AY 4Q5WA 2V9KA 3M53A 4M77A 4PJOC 3DTEA 4JLIA 2AQFA 5GAN6 1YX5A 1JJ2S 3CBMA 4C0DC 2P0KA 3CCEA 3QUIA 1IRXA 1D0YA 5J26A 1D1AA 1HA8A 1M90U 2VGMA 5IN1A 5LJ5e 4CUGA 3X25B 2CKKA 3G2BA 4C92G 3QDRB 1EIFA 2FL7A 4FM4B 4J7FA 4C5IA 1JB0E 2OTJT 4P1WA 2XIDA 2KLOA 3A1YA 4OMFB 3I56A 3CMAA 4PJOE 1YJ9A 4LD6A 4PNOA 4RLQA 3S3MA 3MP1A 1N77A 5HVQC 3U21A 4BQNA 3DB3A 2V26A 1UB4A 3RIRA 3OQ5A 1Y71A 4ZJZA 3EFRA 3CC4T 1N8RC 4RLFA 2KQWA 3DU6A 2R7WA 2V6EA 3OYMA 3QYGB 4M7DD 4JRKA 3PMIA 1FWZA 1U1SA 3QIIA 1WJAA 3E9FA 5GAMd 2Z16A 5AYFA 3FBIB 4JS5A 4NOYA 1VQMA 2LT1A 3N5BB 3PJRA 3LSHA 1U1TA 4HG2A 1MGQA 3PNYA 2VIXA 1KQSA 4PKCC 4N4NB 2X51A 5LD2C 4F3QA 2FYKA 3W2AA 2F6CA 4M7AF 1J09A 4PK4A 2ZZDA 2VUBA 4E7SA 4MDWA 3FC3A 3PL8A 5LJ3g 1VQ4A 3DKYA 3QO3A 4EMKC 3JAME 3ZBDA 2ZSIB 3RKYA 2KK4A 3JCMQ 3FB9A 1OZ3A 3OYAA 2QKLB 2LC4A 1T95A 2XSJC 2R7VA 3G71A 2X6YA 2MMPA 4F7UE 1RL2A 2CZ6B 2GFUA 4XNFA 4GRIA 3NWSA 1V5EA 4ELZC 4B9XA 1ZHIA 3CXCS 3X20B 1DGRM 4BEHB 3DB4A 2IS1A 3CCQT 3SWNA 3NTKA 2E5ZA 1QVFA 4C8QG 2VL8A 3A8GB 3CC7A 2E65A 2E1MC 1YITT 4A4KA 2AHJB 2MFZA 2IGKA 1Y7XA 1ZBXA 2RJFA 3HL8A 2LCLA 1LJOA 2K3PA 1V5GA 4ITVA 2E64A 4QW2A 3J7AF 2IXSA 2VXZA 2WSCE 4F91B 4F7UF 2BIVA 3CP8A 2KZVA 1QVFS 1MMDA 2GOXB 2VASA 4ZN1A 2EAYA 3A5ZB 2MWPA 4XKVA 3NFCA 4HT8A 1D1BA 2XAUA 3M59A 1WJFA 4CCMA 3S3OA 5GAN8 1YI2T 3JCMc 1QP2A 2DJIA 4DA4A 4RCCA 2L89A 2PVDB 5FROA 2WY7Q 2QTXA 3JCMW 5GAOn 3LL7A 3VUBA 2QDYB 2VB6A 3GPLA 2O4XA 2I8DA 4G6TB 4N4IA 2D6FA 4RKUE 4M75E 2O01E 3V42A 5CAIA 3L2QA 4HEA2 3HOSA 1M4ZA 3MP6A 4PJMA 4C0FA 4EDUA 4FASD 4BQOA 2KVQG 5GAOr 3H9QA 2KSSA 4BEHA 5CKBA 3MKWB 3PUBA 3G7ZA 2M0MA 2XF5A 3CCRT 4XQFA 3RKXA 4M75B 4XU0A 2YHTA 4C8QA 1YJWT 3CCJT 1VUBA 4XOTA 1VQNT 5FU6C 1X1CA 4CSWA 2X1CA 2VGNA 1SAUA 1X6OA 3CP2A 2A7YA 4IKFA 4CH7A 1YIJT 4RM2A 4XKCA 2M16A 2PJRB 4IUPA 3IP4B 3FEOA 4HCBA 5CK9A 3ASKA 2B8AA 1M1GA 1Y96A 5GANj 4C2UA 2ZPBB 3INZA 3BY7A 3CD6A 3VKIA 3HPHA 3C94A 3A8MB 3DLMA 1S72T 1MHNA 2K2VA 4LIUA 4PUSA 3KX2A 4QVZA 4HA8A 2A5WA 2DXUA 4HCCA 2QXFA 2HVSA 5GAMf 4YELA 3HG9A 3HRUA 3HPGA 3OYIA 3LGFA 4Y33A 1YJWA 5DM7R 1ZQ1A 4E47A 3DKXA 3L2ZA 4GLKA 2VLAA 2QQSA 2ZPHB 3K70D 1X19A 2K3XA 2KL4A 4QQ6A 2R58A 2RO0A 1OR7C 3A4CA 1MMNA 2X4XA 3V7RA 2KDOA 3A8HB 3OSVA 2WY8Q 3OA6A 5FU7C 4M7AB 2W82A 3M1CA 4J6WA 4M75D 1WJSA 3MEAA 2BVMA 4C92D 2NOJB 1ERDA 2PUOB 4BY6C 2JVHA 4BU2A 3HP9A 2M7AA 4A53A 2XDPA 4QQDA 1VQ9A 2RHUA 4BE0A 3QZ5B 3MMYB 4MDXA 2F5VA 2G3RA 2MAMA 1KONA 3SD4A 3CESA 3JB9G 1KG1A 2MF2A 2IVWA 3HPWA 1BIAA 2EFIA 1IREB 3OYNA 5FRMA 1VQ5T 4BE1A 2MWOA 4FU6A 3VSKA 5FU7B 3X28B 4M7AC 3MP8A 3UNGC 2HPIA 2VKDA 4C30A 5CQYA 2Z2SB 4M78B 1BOBA 4J6YA 3CD6T 1YI2A 3ER0A 3PSFA 1VQOT 1VQLT 3OR1C 2ZFUA 1WJQA 1XTDA 1XNIA 1LVKA 2VXFA 2RI2A 4OB1B 2YLBA 1B34B 5LL6S 2VQGA 3LWHA 2PJRA 4BXFA 1NZ9A 3SB2A 3CC2T 1YITA 3K6GA 4F52A 3SFMA 1UEBA 3CMMA 2Y90A 5FLXE 3BFMA 2GOMA 2L3RA 4CCOA 1LNXA 4OVAA 4P5OA 4KITB 3G4SA 1B34A 5EG2A 4LG3A 1K6YA 3OYBA 3GF5A 1VQLA 4XL9A 4BE2A 4II2A 2RREA 4UC4A 2KY9A 1M8VA 4KT6A 3PMTA 4F7UB 3CMAT 4C92A 3HFOA 4BUPA 3OYYA 4XU2A 4C0DB 2KQRA 1FMWA 3ME9A 3G4ST 3CZ6A 1UAAA 2E6ZA 4Z02A 1I81A 2M9UA 1Y56A 3K10A 1YJNT 3C4SA 2PMZA 3RTRA 4B47A 4E7JA 4LDWA 1X4PA 2QEXT 1VQ8T 1W36D 2LC2A 2CH0A 3D5RC 2HQEA 1WPYA 3JB9F 4L5GA 2VJ4A 2F4IA 2YRVA 3H5AA 4ZYAA 4BI8B 5GAN3 3QOEA 2KAFA 3L2RA 5FRNA 4XLAA 4CRIA 3OY9A 3OYCA 4IUUA 4YRVA 4X0GA 2GCXA 1KD1C 4L59A 4CA0A 2H3JA 4DOZA 1Q82U 3JRZA 2K5LA 3S93A 2RK2A 3FIFA 1VQ5A 3OMYA 3PSIA 3M4GA 4PFPA 4B3XA 3V7CA 1Y96B 1K9MC 2OTJA 3OS2A 2K5FA 3CCJA 2Q2EB 2YLCA 3GLXA 2QKMB 2LBFA 3OSSC 4PLIA 5CVIA 1X1BA 1MMGA 3MKZA 5GAOq 2OTLT 2HU9A 2K9LA 3QJ6A 4RG2A 4BDYA 2JTMA 4RMNA 1AA7A 4ME7A 2DTHA 4A4HA 4HNTA 4C92C 4C5GA 3SDZA 2L5QA 5CPRB 3E1SA 3JCMd 5GANg 1MNDA 1RI0A 1Q81U 4ZDPA 1MMAA 2X4JA 3L2WA 4OAZA 3HRSA 2BW3B 5GMKj 2JA2A 1Y6IA 3JCMb 4BACA 3HL2A 3PIPA 2X6WA 3WVDB 3V7SA 3C12A 4BQQA 2DOAA 1QHGA 1I5LA 2R7OA 1WQWA 4XKWA 4C92E 2JVVA 2Q1ZB 2RM4A 4J83A 2HQAA 4C8QC 4EMGA 3DPTA 3JSCA 1W2BA 2P0QA 1DGWY 2D9TA 4KT0E 3ZFJA 4DQ2A 3K4CA 5GAMe 2DEQA 4M78C 5HNHA 4M75F 2CZ0B 5LFAA 5IAYA 2DXTA 2MD0A 2CYZB 3HSBA 3MEUA 1X4OA 4DOVA 4Y3OA 3QYFA 3OL3A 4CCNA 1D3BB 4NUBA 2MC4A 3K4BA 1R6RA 1H641 2PUKB 2CV0A 1K8AU 4NL2A 4AYBA 3QBYA 2LCCA 1X01A 5IT9E 1X1DA 2M0OA 4II1A 1QVGS 1VQ6T 2IGNA 4JRQA 4CCKA 5HK3A 3FDRA 5LJ3d 3EUAA 2JOYA 1N75A 4PL6A 3I9V2 1UELB 3RCOA 1JRIA 2CGHA 4M78F 2XDVA 4IQJA 4HNUA 4NQWB 1KC8U 4XTUA 2BVLA 4VUBA 4X34A 2IGMA 5CKEA 5CR2A 4OGEA 2L9NA 4XLHA 2DD4A 4U87A 2PVGB 3CMEA 2JN0A 4DBRA 3W2VA 3ZEHA 3KXTA 2K57A 3V8JA 2UUZA 3PTAA 3D5SC 4XTXA 1WJCA 3MEVA 1XOVA 1YX3A 4N0AC 2MI6A 2E41A 3P8HA 4YEJA 2V1NA 2V4JC 1QW1A 3QHSA 4NC7A 2DTOA 2RNGA 2IS6A 1Y07A 2Y4XA 3GNGA 1V29B 4XAXB 1OLTA 4IZZA 3H9JA 2EIFA 5LJ5g 1N78A 3FBNB 1KHCA 2XICA 2VPLA 2CUJA 4M7DA 1I4K1 5GANe 1T0FC 3JCMX 4M75G 4TVRA 1G5VA 2R57A 3EUHC 4HSRA 3DTKA 2V8JA 3M4YA 1IZ6A 1TT0A 1NPPA 3MD2A 3RSNA 5HY6A 3JB9I 1Q86U 4XTYA 2XDBA 3DTIA 3K4KA 4B48A 4PFOA 3GNFB 5GANf 3CCLA 5GAN5 2CS3A 2CZ7B 1LKXA 2FHDA 3FRNA 3P8BB 2JUFA 2ZPIB 2IS2A 3LMMA 2QQRA 3T9NA 3ZXSA 2LQ8A 1H3ZA 5D6XA 2O4XB 4M7AE 5FU6B 3OMCA 2L7KA 3LYIA 4PJOB 4QPOA 3QJYA 1M1FA 2MABA 2R7SA 1JJ2A 4DIQA 2L9SA 5C0MA 2K4YA 5I2SA 2WAEA 4NC8A 4E6KG 2DT7B 3G6ET 4M77D 3CBPA 4ZTJA 3M56A 2HPMA 1E0EA 3SDBA 3M58A 3PIOA 3PNVA 3BW1A 4OP0A 1WJRA 3O8VA 1YHQT 1W4SA 1HK9A 3H0DA 5LJ3h 3CCET 2PVOB 3MKYB 3GP8A 3OYDA 3JB9H 4IURA 3OL4A 1P92A 2R7TA 2Z1DA 3CCUA 3K4LA 3ZQQA 4RG8A 5A0LA 1VQ4T 3AFHA 2EWNA 3C95A 2E6NA 5GMKl 4LDVA 4H4KC 1KHIA 3EPZA 2EQUA 2AQEA 2HAXA 1WGSA 2XU8A 2F69A 2WSEE 2XF6A 4C5HA 2L2OA 2E5QA 3J80E 2DJZA 3META 4L6V5 1WJDA 2BW3A 4A4EA 4QQGA 1KQSS 1S72A 1N6AA 4J01A 3S6WA 3TCJA 4M77B 2DD5A 4BL0B 3TL4X 4EMKA 2E5NA 4BD3A 3PNTA 2RI3A 3RKWA 1M9SA 5GAMg 2DXBA 3OS1A 3R6OA 2E60A 3JCMP 2JTFA 3OWTA 1MW7A 3SEQA 4IUVA 1S9HA 2P4TA 4CCLA 4XOPA 4KUIA 3SYTA 3RERA 3HXLA 3LFUA 3E9GA 3L2UA 2R5AA 4IUQA 2DO3A 2FVUA 4KBMB 4XLCA 3DEEA 5HKCA 4N4OB 2LRDA 1Q86C 1GLNA 3C2HA 2EJGA 2VKHA 3KUFA 1K73U 4LD9K 3ONQA 3SWNC 4M75A 3QYBA 3VYTB 3OBWA 3CXCA 2DAQA 3H5NA 2CV2A 3IUOA 2LNVA 2I2LA 4IQ4A 4XTVA 4BGDA 2HQXA 5GMKh 3N05A 5KE2A 4E7KA 2ZSHB 4E7LA 1D0XA 3GOXA 2R4GA 5LJ5h 2IGOA 2P0PA 3OYGA 5DLQE 4CZCA 2PU9B 2DKGA 5HNFA 5KCOA 1VZ0A 2ELJA 1N27A 2W7NA 1BR2A 2NLUA 3DLAA 4C2TA 2C06A 2ZGWA 1U0JA 1WFXA 3JCMg 2WA0A 2CUZA 4IX7A 1VIFA 4JS4A 1LDKB 3VWBA 1SFKA 4MMLA 3LWIA 2X1DA 5KCHA 1G3YA 1WQ7A 1PYVA 4MZTA 3UWNA 2RJCA 1MNEA 2V7FA 2XD0A 1K73C 3CJRB 1X75C 2FUG2 4O6JA 1G3WA 5HLTA 4JOMA 4D6WA 3EAEA 3NWTA 4ZGDB 3TMOA 3S8PA 1DJ7B 4BUGA 1N9SA 4FL6A 3L42A 2ZPFB 2CFOA 3UR3C 1SSFA 3AL0B 3VYSB 2GQVA 3MEWA 2FB7A 3TU4K 4C9YA 2OC6A 3UDCA 2LY2A 2DPPB 4PSXA 4M7AG 1BIBA 3HHTB 4ZTFA 4HRIA 2DT6A 3CCUT 1TZLA 5CKHA 3F70A 4C92B 4BS9A 3KEYA 2DXIA 3I55A 2HZDA 2CMPA 4C92F 3BG7A 2IS4A 3CCVA 1EA3A 4Y91A 4QVCA 1VQPA 1NG7A 3A8LB 2K5IA 4ATOA 2DVEA 3VYGA 2KP6A 2KMUA 1P9QC 4DJAA 5KNLA 3JCMh 2M7BA 2O5RA 4B44A 5L8RE 2DIQA 4JJNK 2DK3A 3HOTA 5TGTA 1I8FA 3CCST 2GFAA 4X9CA 3M57A 1YHQA 2R5MA 4DBQA 1Q7YC 3HC7A 3DPLC 4ZDLA 4OAYA 3A8OB 5GAOp 3H35A 1FX7A 4M7AD 3LSIA 5D6YA 2Y0SA 1WNLA 2MYSA 1VQ7T 2KPMA 2EJ9A 4AU7A 1TH7A 2W4SA 3NTHA 4DGWB 5GAMj 3I55T 3ZRGA 4AVZA 4NL3A 4M77E 2HVQA 4RMOA 3W3CA 3I3LA 3HRTA 1UGRB 1LFPA 3CF2A 1Z21A 2E70A 1WJEA 3M9QA 4J6XA 4GY5A 2LQKA 2DZCA 3PT9A 4A54A 1OYXA 3SEZA 2XKOC 3M55A 2X1EA 3FDYA 1VQKA 4FT4A 4LDYA 2QI2A 3VYUB 4EATA 3AL0C 2R7RA 3VSLA 3JCMV 1K9MU 4M7DG 4KUDK 2VQLA 2WACA 3UPUA 2XHCA 4KJZA 4J5YA 4HPQA 2CZ1B 5GMKi 1BI0A 3OIPA 4JLGA 4ZN3A 4BB7A 3OYLA 5LJ3f 4M7DC 5DY9A 3L1AA 4YTLA 2VXDA 3OS0A 3SZGA 3GBGA 1ZELA 4FETA 3QSUA 3QODA 2E1MB 1O75A 3OBYA 2X4WA 2RK1A 3P8DA 5GANd 5HOOA 3PNWC 4JQFA 4M7AA 4JDSA 3MO8A 4B9WA 5J3BA 4KULA 2W1OA 1VQ6A 4XKBA 4ZC3A 3LLRA 1UGQB 2EJFA 2VXEA 2LH9A 2VJJA 2KRHA 2VQCA 2VQHA 4F7UG 4D9JA 5CIUA 4OB3B 4U7BA 3RESA 3IAM2 1DP3A 4FSXA 2RQQA 4BJTA 4XN0A 1BR4A 4EPCA 2XI9A 4XM3A 3CCRA 2LT4A 1VQPT 3LSGA 1N9RA 2R7XA 4M77F 3CCVT 3VYRB 3E19A 4F93B 3H9GA 2QQBA 3SWNB 3DU5A 4ANJA 1WJBA 2LYCA 1BKBA 2X35A 2OV7A 2LX9A 3K70C 1NJIU 4ELYC 1QVGA 4X9DA 4C8QB 4M7DB 1UGSB 1BI1A 2K5CA 4XN3A 4QPQA 5GANh 4OB0B 2XG8D 5HK0A 3OYKA 2XF7A 4WF2A 3RMSA 2HVRA 2RJEA 3QYHB 3DKMA 1K8AC 4A4FA 2A3LA 3L2VA 1YJ9T 1KQ1A 3QZ9B 4PJOF 3CC2A 4E7ZA 4LITA 4M77C 1QP3A 3BLYA 5LJ3e 2LBFB 3X26B 2UWMA 3M54A 2LREA 2RH2A 2E1HA 3A2KA