2L5QA

Solution nmr structure of bvu_3817 from bacteroides vulgatus, northeast structural genomics consortium target bvr159
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
142
structure length
142
Chain Sequence
b'MLKTILSIAGKPGLYKLISQGKNMLIVETVDAAKKRVPAYAHDKVISLADIAMYTDAEEVPLSEVLEAVKKKENGAVASINYKKASADELHAYFAEVLPNYDRDRVHNGDIKKLISWYNILVNNGITEFVEAPALEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Northeast Structural Genomics Consortium Target BvR159
rcsb
source organism Bacteroides vulgatus
molecule tags Structural genomics, unknown function
total genus 26
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2010-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18347 DUF5606 Domain of unknown function (DUF5606)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1650 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2l5qA02
2.30.30.730 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2l5qA01
2L5QA
chains in the Genus database with same CATH superfamily
3QXEB 4HDUA 5L3EA 3CEYA 3F70A 3QWYA 4FSSA 1LCKA 1T98A 2H1LA 2K9GA 3C12A 2DL7A 2DQLA 3LW5E 5H6QA 4PFOA 2ZB9A 4XQ3A 5GAOl 1GFCA 2VOPA 1SFEA 2IGMA 1U2WA 3HHHA 3COAC 2LNHB 2HPIA 1EH7A 2RHUA 1PYVA 5LGNA 3ZN0A 3VUBA 5LJ3g 4IZZA 4LLNA 1ZUKA 2ZXHA 3LYIA 1VQ6A 2M8EA 4I0BA 1QWFA 1ZBJA 2XDVA 4C8QF 3CCUI 3CCQQ 1FYKA 2JT4A 4LDYA 2HD0A 3GLLA 2ZJPF 2X1EA 2CV2A 3CC2I 4A4KA 2MD5A 4XRSG 5AIQA 1ZN2A 3NTHA 4P96A 1FC3A 3QJYA 1QW1A 4H0EA 4A3IJ 3H0FA 4ZC3A 3FHZA 2NVXJ 4GO1A 1YQAA 4LK1F 4MTDA 2KROA 5E3MA 2K2VA 4HT9A 2KIUA 2ZMEB 1NYFA 5GPCA 3DXJF 1O9SA 2NUZA 2BZXA 2QK0A 2W10A 4RUGA 4DBFA 5CLSA 1K0SA 2KZVA 1QWEA 4RCBA 5F27A 3HOYJ 1V5FA 4OMFB 2DT7B 2XIDA 3EPZA 1I1SA 2LRDA 1ZGWA 3CC4T 1L3LA 4DIQA 1SC7A 3CCLT 1S7EA 1A04A 2J6KA 4Y17A 1JU5C 4M7AD 4G12A 3A8HB 5DUKA 2JK3A 2DW4A 2W00A 2QVOA 5CKBA 1JHFA 3JAMK 3B6AA 3I54A 1NG7A 3FXOA 4G6DA 3FWEA 2BZTA 2JTFA 4M6VA 2NVQJ 2EIFA 2KXCA 3ZMTA 1T95A 1VQPT 3CCLA 4RB1A 4KIFA 1DUXC 3INZA 3MHXA 1TT5B 5GAHJ 2JS2A 5KYYB 1RC9A 4HT8A 2FE3A 4ORZA 2ESHA 1HW1A 5IT3A 2KE9A 2V8IA 2KIMA 1U5TA 3MQ0A 3KYLA 4ZGEB 2MA3A 1USSA 2PJRB 4XU0A 3QYEA 4DA4A 5KE2A 1XX5A 2G7UA 3DTEA 3FLGA 1F1BB 5GAMh 2V26A 3KLNA 1PUFA 2YX4A 4FL6A 1X4OA 2VBWA 5FRMA 2DYIA 3K1NA 2XAHA 2IG0A 3E97A 3ZFJA 1T39A 1VNDA 1YHQI 3CMMA 4MDWA 1YI2T 2ABLA 3EG1A 2CREA 4HX4A 1OLTA 4QPQA 3MKDA 3PUFA 1FYNA 3TGNA 1W1FA 4M7DA 4ZN1A 5J39A 3EYIA 2CW7A 3MKYB 1TLHB 3OYFA 2M1HA 5IHNA 3F8CA 3BDDA 2UWMA 2RQVA 3VS4A 1ZK8A 1YI2A 4PFPA 5HLIA 1YITT 2X6WA 4UUSB 3R60A 2DXCA 2D1VA 4BI3A 1JJ8C 3G6ET 1VQMT 4KJZA 3TO7A 2KFDA 5CQXA 3F21A 4RLFA 3SZGA 1I3AA 1SD5A 3QWLA 2M1BA 3BROA 5EJCA 1VYTA 2QTVA 1V29B 2GGRA 2ESNA 1O75A 1UGPB 1QZEA 3HIFA 1K4TA 3HRUA 1BU1A 1NLPC 4XBFA 2A7YA 2YUQA 1H3HA 1WJFA 2A61A 2EB7A 1TH7A 2M0CA 4C92B 3PQJA 4BQNA 5KE3A 5BPIA 4CCOA 2O0YA 4HV6A 2JM8A 1CF7A 1N8RC 3ZMDA 4UUTA 3GTGJ 2RC4A 2EH3A 1R1UA 1VQ5Q 3OYCA 3M0UA 4CYDA 1HW5A 3IWZA 3VJPA 4U0WA 2EIKH 3ZMUA 2BUDA 1RL2A 2ISYA 2V1XA 4V2GA 4KT5C 3IUOA 4M7AC 5L3CA 3WE2A 4LDVA 5EG2A 2O01E 2EQKA 3TQ7P 4QVDA 4JJBA 4N4OB 2HQXA 2MFZA 2Y30A 1M90U 1WHLA 2BE9B 2CZ1B 2D6FA 3LSPA 2GBQA 1ZSZA 3CCSA 4LNPA 2F4OB 4Y7NJ 2HDDA 2RHIA 4PFZA 3ULRB 5K5RA 4XTZA 5KK1A 2LVMA 1IRFA 1IV8A 3TREA 2DJIA 2KZGA 2K3FA 1HBXG 2E1CA 4B3XA 1MMSA 3M0SA 1BA5A 1FLIA 3S8PA 5AT1B 3HRSA 4R79A 4BUPA 2O7OA 5FKKA 2L02A 4B6MA 1T38A 1FYMA 1SEUA 4L0YB 2P84A 4F55A 4A69C 1UFMA 3S1RJ 1W36D 3GTLJ 4BBSJ 2IXSA 3SXYA 2GNCA 2M02A 3MO8A 4M75E 2OV7A 1K9MC 4V2SA 1K79A 2HYFA 4EGZA 2RN7A 3EGXB 3GTQJ 1ETQA 4HDVA 4G6TB 2NAZA 4AU7A 2KIFA 1XNIA 1PNJA 5CO7A 3P9KA 2LQWA 5IXFA 4P9FA 3H5NA 2IPQX 1QCOA 4CRIA 2OTJT 1E6GA 2W0ZA 4BAYA 3BR1A 1ABQA 5LJ3e 3BG7A 2YSRA 4KISA 4ZGJB 3OS2A 1YJWI 2IJLA 3D5SC 1WHUA 2LYCA 2MD0A 4U0VA 2GFUA 1XDUA 3S3NA 2KRMA 3OSSC 1ENHA 1OR7C 5E20A 3TBIA 1N9SA 3JR9A 4LDXA 4II2A 4C30A 1SSHA 4GY5A 9ATCB 2OTJA 1YW8A 1YIOA 3JB9H 1TQPA 3EG9B 1BIBA 1MUZA 1MGTA 1LPLA 3G6EI 1VQMI 1KC8U 4HW0A 3ERMA 3ZMZA 2UV1A 4YG2F 4MTEA 3H9NA 2G3RA 2RN8A 1OYYA 5CVRA 4HXJA 5CYVA 3Q9VA 4FYVB 1NJIR 1BL0A 1YOVB 2MAMA 2OF7A 5GAEJ 2EBIA 1JXOA 3T9NA 5EZGA 2WAFA 3QPTA 1TZLA 4Q5SF 1PJRA 4M7AG 4DEYA 3EUAA 5GAMf 1QQIA 2BIVA 1N8RU 1VQ8T 5A2QK 3OL3A 2HS5A 3VS3A 2LDUA 1PWTA 3VU3C 2KXDA 3JAMZ 2X4HA 3V42A 5B66C 4YFNF 1M1EB 1XDSA 3FXKA 5HNFA 1BBZA 4XU3A 1U1SA 2IS1A 4W1UA 1ETKA 1PCXA 2WV1A 3NFCA 1VQ9A 3PNVA 1R49A 1UGRB 3LA2A 3CCJT 1WGXA 4OIQF 2DPUA 3OS1A 5ICGA 2L4AA 1KSWA 3P5JA 2BTTA 2QGFB 4M77A 2LNBA 2QEXT 4NQWB 2F5VA 3EUKL 2HMAA 2CG4A 3G4SI 1K8AC 2A3SA 4PGGA 1K73R 4PJOA 2PVGB 4OMOA 5A0DA 5KYXA 3ZQHA 2EGCA 3ZQLA 3ZPLA 2FRYA 4PJJA 1K6OA 5J4VA 5D7UA 5HS8A 4VUBA 1VQNQ 3CCJA 4C5GA 2QEXA 2QQ9A 4P1WA 3L2RA 3LL7A 1ZLJA 2R93J 4QLCU 1YIJQ 2P5KA 5J26A 2FOKA 4NUBA 3FBNB 3KZIC 4DYRA 1W36C 5DCMB 1APLC 5HDGA 3IL2A 2JVVA 4IHXA 1VFCA 2EV0A 4YRVA 1Z3XA 3VYGA 3V8LA 5BNGA 3QYFA 3TOAA 1PD1A 3M56A 2PX9A 1YO5C 1UJ8A 2DA6A 4A5NA 4XR6A 4AIJA 2JQ7A 4ELZC 1RAIB 3CC7T 5J47A 3SDGA 5CKHA 3BJOA 1J3TA 5HOOA 2DL4A 1N5ZA 3A8LB 3X25B 4L5EA 2ED1A 2BVMA 3ZRGA 5JLWA 3U21A 1TWCJ 3WU0A 1UG1A 3QDFA 5IT9Z 4GBQA 5L3DA 3JCMJ 3GIBA 1HCRA 1AOYA 3QYHB 1WQ2A 1Z1DA 3BTLA 4U88A 1H9TA 3ASOH 2EPDA 3I4PA 2EBPA 2BGCA 3VYTB 1OCTC 2FXAA 1JGGA 2LCLA 1D3BA 3L2ZA 5LJ3j 4KULA 1R8OB 1X69A 1HKSA 2ZKZA 5F0HA 2DJQA 1Y71A 4L5JA 2CUDA 3TW6A 3F3XA 1DU0A 3CPWA 2XUBA 3ABTA 2R57A 5IHIA 5C0MA 2RQPA 4JP0A 1QGPA 1I6HJ 1RABB 3RERA 4O5VA 4X0GA 5IY5H 3I59A 2NS0A 2DZCA 1MDMA 2DXTA 4OP0A 5LL6S 1H92A 1H0MA 1QPIA 4RGXA 5D8LB 2DQRA 4BYYA 3D5LA 3MCAB 4XL9A 4LGWA 1RUNA 1GV2A 1ORKA 4LG0A 2LCSA 3CD6Q 4RM2A 2AHJB 1UHSA 2MLGA 2MYSA 1YJNA 3VS0A 4NDLA 4OMPA 1M8VA 1WJEA 2LP0A 2VKEA 2F5DA 1UELB 1AVZC 2ZNZA 2VB6A 2R92J 2ZFWA 2HSPA 4M75F 5KYUA 4PSWA 2V1NA 2KK4A 4FM4B 3NWSA 2FBHA 5CVUA 1RUWA 2HCKA 3CUQA 2H94A 2UUZA 3LSIA 3HM5A 4HEA2 1NE8A 2E5QA 3GF2A 1NG6A 4HSRA 1D1CA 2X4WA 2H1KA 3PE0A 5F1RA 2KJCA 4A53A 3IKTA 2DIGA 3L1AA 4CC4B 1CQTA 3UF4A 2DO3A 4QWQA 4FX0A 5J40A 4M7DD 2LR8A 1JXSA 4C3IJ 2B9SA 1FTTA 2RJDA 1UG0A 2IT0A 1TOVA 5IHKA 2X1CA 2RMOA 3HL2A 4BY6B 1FOXA 2VUBA 1DU6A 3HFOA 2ATCB 4CXFA 2L7KA 2GA1A 1P92A 2ADUA 5F64A 1FP1D 1AWJA 2K7AA 5E3OA 1ULYA 2LTPA 1Z7LA 1MSFC 4RTWA 3KXTA 3GTPJ 4NHJA 3CC7I 4LLGF 5HS9A 1U5TB 3S1MJ 2XAQA 3BZKA 3GFLA 1MJBA 1MBEA 2X6OA 3I9V2 3HBLA 2R5YA 1JKPC 1SMTA 1Q81C 2E1MC 5FLXK 1RLQC 1VQKQ 2F4IA 1PUFB 4R1HA 3PJRA 5D4SA 2E3IA 3VS6A 2DA2A 1X3ZB 3FXUA 3H9JA 1XGOA 1MBHA 1FOKA 2COBA 2FO0A 3TDUC 2D2WA 4PDKA 2DMQA 5A2QZ 2HYGD 3ZQCA 4CO8A 5L23A 4J8OA 1NG2A 3KP7A 3E0JB 1IREB 2GXGA 1LFBA 4A3EJ 2CZ0B 2YLCA 2FMLA 1IG7A 3ME9A 3J7YJ 2BBYA 2RI5A 1YJ9T 1UAAA 3HPHA 1JHHA 5GAMg 1QVGS 3ZQ7A 1AZGB 2O88A 4WTOB 4OMYA 4I7HA 1I0CA 1K1ZA 1IW7F 2BY2A 3P9IA 4YFKF 2O61A 1FYLA 4HX8A 1REPC 3GZ6A 2AIRB 4UC4A 1KIKA 2P8TA 3FK6A 3T1BA 2YLBA 1QCNA 2KT1A 2E34A 2KQRA 1XCBA 2Y0MA 3M53A 2X9HA 5FFZA 3BG3A 3DU5A 1IXSB 1X01A 3K6GA 4M78C 2D0NA 3RMSA 1HXDA 2DTZA 3LSKA 3FDRA 3AT1B 4M7AE 3Q9SA 4ZGDB 3CCUQ 2QXFA 3F23A 4WK8F 1CF7B 3L1PA 4CI0C 2CUZA 2F69A 3BOQA 5FD6A 4XN3A 1GVJA 5HLHA 2IGKA 2K9SA 3BZCA 1VZ0A 2EQRA 5F0FA 3JRGA 4N4IA 4QW2A 3OR2C 4M6YA 2EZKA 2KBTA 1FP2A 3JCMV 3H3UA 2MI6A 4CH7A 5LJ3d 4S0HB 4DYQA 2CP5A 1OCOH 1GXPA 1Q1HA 5JFRA 3EG2A 3GBQA 3M9AA 5D4RA 4HLXA 3CMET 3QSUA 2LK2A 1PVEA 1Q7YR 4BY1J 3MEUA 2OAWA 4X9CA 2ZJ2A 1T0FA 4PJNA 1F5TA 2L3PA 1SMYF 2X4JA 1VF9A 1W2BA 2NNNA 1S29A 1W5SA 1S72Q 4XMYA 4ZYGA 2B63J 4DYCA 5I21A 5M3FJ 3U1DA 1M3CA 2O9VA 1Y7XA 3E5XA 1T0JA 2GF7A 1PSFA 2VC8A 2YT6A 1ETOA 4JS4A 4BJTA 1JUSA 1B1BA 2XRNA 1MHNA 1FBQA 4E7ZA 1HDPA 1XOVA 4J6XA 4PZJA 5GTHC 1A6QA 2LFBA 2XPUA 3HTRA 4IOAF 1EZZB 5DD8A 3ULQB 3L00A 2YS9A 3ZR8X 2ROLA 1QMCA 1KD1C 2EFIA 5CVIA 4IUQA 4BHCA 3HKZA 3I53A 2XSJC 4JRQA 3MKZA 3D7SB 2RA2A 4EJWA 4L6V5 3CPFA 3KYCB 1T2KA 2RD1A 3X24B 2E7WA 2VKDA 1YCSB 3O8GA 3KETA 3OIOA 4HAMA 2DYBA 3CCRT 1MW7A 2DYSH 3ZGKA 4EJOA 4BL0B 1JKOC 2XF5A 5JVGF 5HK0A 2ED0A 4YFXF 2OBPA 3TEDA 1WIEA 2DK3A 2ZPGB 3P9CA 1R9TJ 1H641 4MEYF 2GQVA 3I5RA 2YRVA 5IP7J 2GOMA 1I5ZA 4HZFA 1YHQQ 4M73A 3L42A 4UUVA 1GBRA 4Z89A 5D6EA 4BHBA 1A35A 2JTMA 2V9PA 3P8DA 1WI3A 3FMRA 1J9IA 2X48A 2HVRA 3Q0VA 2VGMA 1JJ6C 4JBAA 4MZMA 2Y9YA 3X26B 2WB1N 4C2TA 1D3YA 1BR1A 2K9LA 3MWMA 2QM3A 3QQAA 4Y33A 3H5AA 2CDTA 2KT8A 3RUXA 1YIJA 2OTLA 2DK8A 1Q86R 1O7LA 2HQ5A 1ZG5A 3IQLA 4BQOA 1JT6A 4ELYC 3SFIA 5E17F 3JAME 4JX4A 3L2VA 3FKJA 5E8GA 4M7DG 4C5IA 1XB4A 2PQWA 3K7AJ 3CMAT 2QZ8A 2KL4A 2M87A 2JSCA 2IRFG 4ABZA 1GCQC 1UHWA 4WXHA 5DTDA 3DKYA 2QA4T 4IKFA 5F6FA 3S1NJ 3OYHA 2IS6A 4EMKB 5CK9A 5B1BH 6PAXA 1XGNA 1TWBA 5HKCA 2RQWA 3SEMA 2L9RA 5ICEA 2FMYA 1IN7A 1HDDC 3G71T 5AYFA 3QYGB 2P6SA 3T8RA 1IRZA 2O3FA 1HSTA 5GAOm 3GP8A 1GFDA 1M8MA 2KJBA 3O8VA 2E2JJ 4PK4A 1E6HA 3BFMA 3VS2A 4XSXF 2JZYA 2P0KA 3EDPA 2DL5A 2JMCA 4F14A 2RAEA 4EMSA 4OIRF 4IPAA 1B3QA 3PVQA 4PJOB 3CCEI 3L9FA 2V6EA 2CQQA 1RAAB 4MZTA 5DDGA 2DXUA 5KYXB 4KBMB 5J8FA 2QCOA 4RA2A 4QT7A 5KYWA 3D1NI 5J1YA 5FLXZ 2RHZA 3X20B 2XDDA 1D8JA 2DL3A 2DMPA 3M1EA 2JRTA 3JRFA 4KH1B 3FMQA 3IP4B 3OYAA 1JJ2P 5K7FA 5FKMA 1X58A 3I56I 1YFNA 2XC7A 1HYOA 2YRDA 3KEYA 5BPDA 2XDBA 3CCMT 4G6QA 2AZSA 4DW6A 1VQNA 2XIGA 1XCVA 2RVCA 3H36A 4G8XA 3KLOA 5BMZA 4L18B 1WI9A 2NUPA 1XQHA 1WJAA 1J59A 1YG2A 2BW3B 3GW2A 1B4AA 3CD6A 3ASKA 5HDNA 3BQZA 2RPNA 2MABA 3CCVT 3FHNA 4HG2A 4KYWA 1IHWA 2EFQA 1X2QA 2L3DA 1T8IA 1OZ3A 3OW2A 4B1RA 3P8HA 1OCPA 3BJAA 3CUOA 5DM6F 2KGTA 5GAMe 3S1QJ 2CKKA 2CJJA 4AMCA 3S14J 3HL8A 2HQAA 3M07A 3OQ5A 3MFKA 4MIMA 5EC7A 1FWZA 4PJ0C 3ZMSA 1D3BB 1VQLI 3EGXA 3QJ6A 4M75B 3CTAA 1NBEB 1H3ZA 2K5FA 5C4JJ 1YJWQ 2CRGA 1WHHA 2KEAA 2NVUB 2K3YA 1Z21A 2R7VA 2L8DA 5KVRA 2HVSA 3C1DA 1OQKA 2A07F 3E19A 4P5NA 1S1NA 2C0IA 2OJ2A 2ZPHB 5GAOr 2Z2SB 1FMKA 1YITQ 4HOBA 3E5UA 3Q5FA 3I59B 3G6EQ 1VQMQ 4E6KG 3ZQFA 4ETSA 1QVFA 3IRQA 2FBKA 2XF7A 3EG9A 3FC3A 4N9IA 7AT1B 4LG0B 4UV8A 3LNQA 1LE8A 2J06A 2M4KA 2VC1A 2LF7A 2R7QA 4D1QA 3QU6A 5HLTA 2OA4A 2ZJRF 4FTHA 1RRJA 4RB3C 2KMUA 1QHHD 1VQ4I 3WTZA 3JSOA 3M4OJ 2YXYA 3DEWA 1USTA 1YYVA 3HSEA 3P8BB 4C3JJ 2GAUA 3MJXA 3CJNA 1VQKA 2P81A 1RAHB 1H9GA 1Y0UA 4UVAA 5C3EJ 1S9HA 3C2BA 1M5Q1 1IUFA 2KVQG 2OI3A 3OMGA 5GAN6 1FBUA 4FSXA 3LQRA 2CW8A 3OYMA 4LD6A 1MBFA 3S32A 3I5UA 1BC7C 3CUQB 2F2XA 2CFOA 1KQ0A 5K7HA 2L3RA 1SPKA 1T3LA 5DY9A 4MQVA 1E3PA 2KI7A 3J7AF 3ONQA 2GZWA 4DBRA 4MMKA 2A69F 3GFMA 1H89C 3G4SQ 5K5OA 3L2WA 5GP9A 2XU8A 4EIKA 2HQRA 3CPWP 1MKMA 2IA1A 4NQWA 4AUXA 2LREA 2EYWA 1LVAA 3CXCS 1TWAJ 1FPQA 3K4NA 4FX4A 1VQPI 1I07A 2STWA 2CQ7A 3J80K 3W3CA 1KQ8A 2FF4A 1B6AA 4XQFA 4BDYA 1HQCA 1XG1A 2M51A 2XDPA 1VQ7T 1TT0A 2CS3A 1MMDA 2M3AA 3X2QH 3DLLF 2MIOA 1SD7A 3DEUA 3H41A 4RG2A 4M9SA 3RKYA 2V8JA 1ZGAA 1WXTA 1HKQA 3I71A 1HF0A 1X1PA 2H8WA 2FJ1A 3I55T 4AG2C 5M5YJ 3OYJA 2QI2A 2DA3A 3SFZA 5DCMA 4F91B 3PFYA 2DFIA 2KKOA 4BKXA 2P5LC 2PLYA 1WFWA 3U2RA 2CV0A 2RHYA 3QDRB 5GMKe 4R55A 3CC2A 2VIXA 3MZHA 3S3OA 2BZ8A 2D8JA 4C8QA 4XTVA 1XC5A 1TTYA 4NL2A 5A2QE 3C18A 4LDWA 4BXFA 3S3MA 5GAMj 4MFEA 4XIDA 1J5YA 1QPMA 3PGGA 2E2IJ 1W4MA 2WB1A 2GIVA 2QBYB 3LGFA 1G5VA 3DTKA 2CUEA 1UTIA 1RZ4A 3GTKJ 1V54H 1W70A 2RQRA 1R1TA 3BTJA 4B9XA 2F5TX 1RADB 2VQHA 4F7UF 2HKXA 2DFHA 1U1TA 1WJ5A 1V55H 3N97A 2EWNA 3SYTA 2RH2A 2ZXJA 1GT0C 2HXOA 2EILH 1MBKA 2PMZN 1ABOA 4FHTA 1R0BG 1VQ6T 3HSFA 2XG8D 1OZ2A 2OCCH 3PM1A 4BQAA 3CCYA 5DS9A 1W1WE 5F1JA 1OCZH 1G4DA 1JB0E 1EX4A 1S6LA 5FU6C 3RNJA 3KIOA 2B0LA 4A12A 2LRQA 2O31A 4M7DE 2DTHA 2LH9A 4FU6A 1BB9A 4AD9A 5LFAA 1BBYA 3K1PA 3PNTA 4F3QA 1YFHA 2DOEA 3SQNA 2STTA 2JA8J 1OPKA 3JCMb 2L9SA 1V1CA 4MQ9F 2NS8A 5EGOB 1ETVA 1JE8A 1K78B 1RUOA 4IHVA 4XAXB 4ZDOA 4RMNA 1MH4A 3SDZA 2J05A 3WVEB 4QQ6A 2KMTA 2LX9A 3LGLA 3FK7A 3RSNA 1Z6TA 2AXLA 2LC4A 4RTZA 3V8KA 3JRIA 3G3ZA 1SVLA 3R6SA 2Y9ZA 2JTEA 2QKLB 1SSFA 1M1KR 4UV9A 1UE9A 5LEKA 4A3CJ 2K5LA 3NMZC 4MEXF 2AQFA 4HNUA 4IHSA 2EJRA 3A01B 3ECOA 1IXDA 4F52A 3AL0B 3CMYA 1F4KA 2Z99A 2IS4A 3KZZA 2V4JC 1Z91A 3MD2A 1RAEB 1S72I 3EGUA 1BI2A 3TW7A 2VLAA 3ZXSA 2L89A 1O57A 3VSKA 4EM0B 2VKVA 2VT2A 1I81A 4ZJZA 1OKRA 3RZDJ 1OULA 2M8GX 2XV4S 3EFOA 4ZYAA 3E2UA 2VKHA 4GXOA 4LD5A 3DU6A 4A0XA 1M90C 2NVTJ 3SB2A 2EA2A 2KRFA 3I55I 1AKHA 5LJ3f 3SWNC 4J9BA 4E6RA 5GAOp 1IUYA 2RF0A 3JCMf 3JB9D 2DBMA 1F9NA 2L0KA 4IEJA 5KNLA 1KQ1A 1SAXA 3M1CA 3Q0UA 1O3QA 1OX9A 2FRHA 4CA0A 4BNCA 3DKMA 4BJ5C 3CC7Q 1LDDA 2E71A 2K85A 2LY9A 4EM1A 5GMKj 3G1OA 1VQOI 3G1JA 1UHCA 2CH0A 4UNOA 4RTXA 3FKIJ 1O3TA 2FA5A 4MLOA 3D5RC 4C92D 3VYHB 3QU3A 2ZMEC 3HUGB 4F16A 3LSHA 4CICA 2ACJA 3GZNB 1ZSGA 3BY7A 1V4RA 4U7DA 4D9JA 2GXBA 3H35A 3WGGA 4CZCA 4LB5A 4OVAA 1KU9A 1N78A 4BE1A 1E3HA 2MGQA 1SRLA 2B8AA 2V1QA 3VSLA 1JRIA 5LLQA 2O2OA 1TW3A 3MP6A 5I2SA 4KN4X 4CUGA 3HPGA 5D6YA 2KP6A 1W2BP 5FW9A 4ENKA 1BOBA 2KRHA 1MV3A 2WSEE 3PMTA 4RTVA 4Y91A 4XLHA 4F92B 3PT9A 1YW9A 1VA7A 3A1PA 2XROA 3NGPA 5FWBA 4J6YA 3DBRB 3ZBDA 2GOXB 2XMFA 1YX5A 2DO7A 2EPFA 1O3SA 1NPRA 4CZZA 1DGWY 3EQLF 3QRFF 1O3RA 3AFHA 2JM9A 3BR5A 4DNCA 1M1FA 3FJPA 5LHHA 1I50J 4J9GA 1X2NA 4LK0F 4XN0A 1KC8C 3IH4A 1RI0A 2YSQA 5IT9K 1VIFA 2ZAEA 1RESA 5TISC 2HBPA 3J80Z 2CH4W 4BH9A 4XU2A 3OIPA 4LOCA 2XAJA 2RJCA 2EYXA 3LH0A 1GXIE 2L9NA 5GAMd 2E6NA 2I5UA 3GTOJ 3C2HA 3OSGA 3MPUB 3C7JA 4YIRX 3HPWA 4LITA 4WWCA 5D6XA 3MZYA 3J81K 4X6AJ 1X6OA 2E19A 1XMAA 3F6OA 1WZ2A 4EMGA 4LIUA 5EF6A 3BW1A 3DCFA 3WVDB 2VQCA 4E7SA 5FLXE 2M0MA 3F8NA 3QP5A 2ME0A 1WXUA 3K4CA 1K7AA 3DB4A 1YJWA 1X6GA 3BP8A 3QPHA 4EMHA 5KYWB 3CCST 1WSUA 2VBZA 3N4MA 2NS7A 3TQNA 2JA5J 1N25A 3CC4I 5IYDJ 5IOYA 1YBYA 1QVUA 2BKDN 2DEQA 4M78F 1JJ2S 3CCLI 3C94A 3E3VA 3KP2A 4DEXA 2QSGX 3LWIA 2BYVE 1U6GA 1SFXA 2QSHX 3CF2A 3WTWC 2ZPFB 1IB8A 4JLGA 2XSDC 3UA7A 3F72A 1WJQA 2NUPB 1G83A 3VFZA 3N05A 2DJZA 4AFQC 2VONA 3KYDB 5TRDA 1D1BA 5LJ5f 3HYIA 4QQDA 2EK5A 3L2QA 1WJBA 5LRSA 2HKOA 2O9LA 3RZOJ 3LLRA 4C92C 1N75A 1F36A 2QQSA 2E7XA 2XPVA 2XGEA 2DTOA 5IAYA 2DTRA 3BPVA 3HOSA 4E7JA 1EFNA 4N0AC 2XRLA 5CKEA 4P5OA 1YWPA 5GMKh 2FQ3A 2G0EA 2PMZA 2QLZA 3FM3A 1QLYA 3S16J 2KDZA 1X43A 2K6DA 2A0FB 4A4FA 2COMA 4NC6A 1YI2I 1Y96A 4QSHA 3EG0A 5J3BA 1EJ9A 2EQJA 3G4SA 4GFBA 1KU2A 2XB5A 4HX7A 3M4GA 2IP2A 1FIAA 2XK0A 2H8RA 4Y15A 3FB9A 4J9EA 1N8RR 2ROTA 2Y69H 2EJFA 2KRNA 1MMAA 5GJVB 3E5QA 3KFWX 1YITI 2P5VA 4MFDA 3OL4A 3NHNA 2D0QB 3TEEA 2LC2A 3ML6A 3GFJA 3AAFA 3I5SA 1VIEA 4BI8B 1LE8B 2YUPA 3KP6A 2K5IA 5BQTA 2I0NA 2W84A 4MZPA 1R6RA 4FETA 4EPCA 4CC3A 1K73C 4ZNXA 3MCZA 2L5QA 2QQAA 1ACIA 4PLIA 1ON1A 1MNEA 1HK9A 1DQUA 2DCEA 2GWRA 1VQ9T 1XS9A 2AKKA 2KPMA 4IOCF 1UMQA 3OW2P 1J0RA 2HNHA 3BPXA 4XTWA 4BUGA 2DN0A 2JPBA 1VTNC 2E70A 4EMKA 4CYCA 3EHRA 2R7UA 2Y48A 5L3GA 2HEQA 5CKFA 3JB9G 1E0EA 3FMSA 5HODA 3G73A 3O5ZA 4XKWA 3V8JA 3RTRA 2JRMA 4J83A 4XTXA 4KIGA 1QO0D 3EUHC 5ILSA 1ZUUA 2QASA 5J6XA 2HOAA 1C0WA 1SHGA 4CSWA 3EH1A 3DWLE 1LUJB 4ME7A 4Y4RA 1PUEE 3CCEQ 4JX6A 3AKZA 4OB3B 2WSFE 3WTYC 4C92G 1K61A 1SG5A 4KFCA 4FT2A 4JRIA 1I5LA 5L3BA 4F7UB 1FBSA 3TP3A 1OISA 3TOBA 1Q1VA 1U3OA 2K40A 2EFOA 2NVYJ 3CLOA 2LKXA 3MEXA 2CP7A 3BDLA 3REBB 2O03A 5GAN7 4F17A 3I56Q 2O8KA 2EV5A 4IIOA 2WBMA 2PI0A 3TL4X 4HLYA 4HYEA 4AIHA 4RTYA 1OYXA 4WF2A 5E79C 2CS7A 3CCQA 2Y31A 2W7NA 1G8XA 4L9JA 1NJIU 5ICCA 2IW5A 1RIOH 4C8QB 2BW3A 1WHKA 3JV3A 1LEAA 4G9YA 4M6XA 3QHSA 2QYOA 1NEGA 3VS7A 3ERED 3HG9A 4GCVA 4HF2A 1UGQB 1Y07A 1X2KA 2OTJI 2DOFA 2JN0A 3WHCA 3OR1C 3UKGA 4K11A 1IGNA 1AT1B 1VQLQ 3HKZN 2LJ3A 1IV6A 2K3XA 3QO3A 2QKMB 3QOEA 4M75A 4C5EA 1ARKA 1STZA 2FEZA 3J81Z 1MIJA 3W2VA 1LJOA 3M0RA 4YIIA 2DEUA 4NS5A 4IF4A 1E2XA 5E1ZB 4XTUA 1K73U 3KP3A 2O4XB 3SZTA 2E36A 3K4MA 2EIJH 1X19A 3G2BA 1KQ9A 2LG4A 3A0HC 3RPUA 4F93B 1XTDA 1YJNT 2DXIA 1K8AR 3GFIA 4A3BJ 3S2WA 2M30A 2KDOA 3M3YJ 3CMAQ 1X1DA 1R22A 1VQ4Q 2PG4A 2ZGWA 4MNUA 1VQ8I 2A08A 4XU1A 1R1VA 1HOMA 1RR7A 2K27A 2LP5A 1AZEA 3K4LA 2CGHA 4EJUA 4J9FA 3G71Q 1QVGA 3HTUA 3BR3A 4JDSA 1OX8A 2WADA 1J7KA 3IHUA 4ZTFA 5M3MJ 4B09A 2E2HJ 1EV7A 1U9OA 2E10A 4QKUA 3BT9A 2JVHA 2HGCA 3CCJI 4A3LJ 4L59A 6AT1B 1ZKGA 1FSEA 2RV8A 3DKWA 3SZPA 1BCMA 4J9IA 1QHGA 3FXRA 2QEXI 3VS1A 4KUMA 2GLOA 2OUMA 2KIQA 4QPOA 5J3LA 4IIMA 1MGQA 1WFXA 3VOEA 2F1LA 3RCOA 1MNDA 4CDGA 2ETHA 2EZIA 3OYBA 3PO3J 4ESFA 1VQPQ 4AM3A 2FD5A 2D5VA 3EFOB 3OB9A 2ZC2A 4XRFA 2WACA 4PNOA 1OJLA 2PBIA 1KYZA 3FXMA 1B8IA 2DTIA 1OV3A 3E9FA 1AKHB 3CCMQ 4HA8A 1B9NA 5I2MA 4QTRA 4PKCC 1Z05A 2RDPA 2Q8KA 3DBLB 1G3YA 3R0JA 2N8GA 2Y0SA 1WA7A 2TRTA 4I6ZA 3OWTA 2RB6A 3JSCA 3LQQA 2RQQA 2OC6A 3CF5F 3CCVQ 2KISA 4B9WA 3GCMA 1LJ9A 4IRHA 4WCIA 4PJMA 1KK7A 4RB2C 1YS6A 3JW4A 2M4GA 1MV0B 5KAIC 4HKEA 1EKEA 1Y6IA 4R56A 3ABMH 1VQ5A 1X75C 5E18F 2E65A 2ESWA 3E1SA 1WJDA 3BR6A 2CFXA 3OOPA 2F6CA 4AC0A 1TS9A 2P0QA 4A3FJ 1W7PB 2OZ6A 3DLMA 3IKVA 4CCMA 2Z33A 2V9KA 1KG1A 2QBYA 2L01A 1WHJA 4DZPA 1TXQA 3HRMA 3A2KA 1KQSS 1CKAA 2X1DA 3BY6A 3R4KA 5FGMA 2AT1B 2WV0A 3U9GA 2FZCB 2VODA 1G3WA 3HKSA 4M78B 2JJ9A 3OA6A 3HEFA 4OMQA 1TSFA 3KCCA 4BY6C 3OBWA 1Z9CA 1Q81R 1FT9A 3ISPA 1UB9A 3ZQIA 4FQGA 2DJNA 4MGRA 4Y3OA 1V5EA 1AD5A 3MKWB 1AHJB 3I4NJ 5ILUA 4DBHA 4CC7A 4Q4ZF 2DMTA 4QVCA 3BWGA 5DUIA 2FQ4A 3DPUA 5D5VB 1SRMA 2GFAA 2A6EF 5IOZA 2RM4A 3ABKH 2JNGA 4HCKA 5IXBA 3PIPF 4J5YA 1U5TC 2LOOA 4IHYA 2CP3A 5FU7B 1EA3A 5JHFA 2DLLA 2VJIA 4B3AA 1RKTA 4M9ZA 2OQGA 1UGSB 5DLOA 3OYDA 1D0ZA 3JCMe 5JI6A 1G6NA 2L7ZA 2QENA 3CDIA 4HF0A 3QG1A 1DJ7B 3I9QA 1PD0A 1TUDA 4PSXA 4A63B 4II1A 2QGUA 5LRRA 2CUBA 5EGOA 5E3LA 1K78A 1X3WB 3CO7C 1D5YA 2P0PA 4IHWA 2JTVA 4DJAA 2HDCA 4EM2A 3M8EA 3CDHA 3VDXA 5F04A 1BK2A 2R7XA 2YR2A 1ZLMA 3A8GB 5M9OA 3H1CA 4M7DC 2HWVA 5JR3A 1ZREA 3CBPA 4R0KA 3K69A 1SKUB 3I64A 4C92E 2F5KA 4IQJA 2J5OA 3DQVC 1R58A 3A01A 1TUCA 4V2FA 2JUFA 3PNWC 3Q0WA 3DB3A 2FG0A 2HVQA 5F08A 2OTLT 1TBXA 2BV6A 2H27A 1AWCA 4G7ZF 1AOJA 5ERIA 5E8IA 1BKBA 3W6KB 1OPCA 2NRAC 4A5MA 2EYZA 2CZ6B 2GCXA 3I55Q 2W4SA 2AHQA 4XM3A 4FISA 2H09A 1ZH5A 2XPWA 3B73A 4HBLA 4BU2A 1R0CB 4A0YA 3IV5A 1RAGB 3ER0A 2EIMH 5KCOA 2IVMA 5CVJA 3JTGA 1M1GA 2KAFA 3I3LA 1CGPA 1YNZA 1FJLA 1LFPA 2FNAA 1FMVA 4TV7A 2CP2A 3A5ZB 1VQOQ 3NTIA 1B72B 1R5GA 4M3FA 2K4YA 3QUIA 1VQNT 3I0TA 2CZ7B 5GMKm 5LBQA 1Y96B 2VYTA 1MD0A 1Y56A 4J9CA 4FYWB 3HB9A 4PJLA 2JOYA 3HUGA 3OYNA 2X4YA 2X51A 4J9DA 3WGHA 2XAFA 1QCFA 4M77D 3CCEA 1OQYA 1WXBA 4ITVA 1XPXA 5KYNA 1YIJT 4C0ZA 1E3OC 2LJ1A 1JT0A 3FBIB 2EFWA 1YJ9I 1ZSZC 3M58A 4HCZA 4GYGA 1IRXA 3CZ6A 1Z67A 3V7RA 3BG6A 2CO5A 3L09A 2IA2A 5L3FA 1YTYA 2X3WD 1BI1A 2JPCA 4II3A 4L9VA 2TDXA 2E35A 3I56A 5D6WA 3GMEA 2WY7Q 5KHDA 3EYYA 1IHVA 1Q82C 3S6WA 2DA1A 2QWWA 5DD4A 3LWHA 2K79A 2DPPB 1SHFA 2F2WA 1WH5A 4JJCA 4AIKA 2DA9A 4KT0E 4LIVA 1WDXA 2K86A 3DPTA 2ELJA 5GTIC 3OYYA 4M4ZA 4D7NA 4XLCA 1K6YA 2DT6A 3OSVA 2CW0F 1UG2A 2PMHA 1XSVA 2VT3A 3KE2A 3NARA 4OU0A 4CYCB 3OYEA 3BTCA 4CGZA 3JCMP 5EEHA 3QPLA 4B43A 1G2HA 2IVWA 2F2VA 4IO9F 2JA7J 4FT4A 2VPLA 2VE8A 2XKPA 3KEQA 3OIQA 2LT1A 2CUJA 3A1YA 3OBYA 1KD1R 1WHMA 1QZZA 1RR8C 3PNYA 2LNVA 1XD7A 1YRNB 4BS9A 1IXRC 1VQLA 1UUEA 3IAS2 3CMEI 4KRTA 1QQJA 2PJPA 4CC2A 4XOTA 1RACB 3PTAA 1ETWA 1TP4A 2JMWA 4EQQA 5EDNA 1TTHB 1S7AA 4C0DC 3CC4Q 2YU9J 3GOXA 2BY0A 2EFPA 3SEQA 4NC8A 4C3HJ 2W82A 1PRLC 3PFSA 3CCLQ 1QBJA 3IH2A 3RR6A 2HKNA 3KUFA 5J4YA 2C06A 3CD6T 2M0YA 2FZKB 4ZTJA 2VWFA 3ROUA 4FW2A 3BR2A 4C0FA 2E1NA 1ZYRF 3RPUD 4CHUA 4JS5A 4ZZLA 3HSBA 1TQMA 3WG7H 1IXCA 2OJED 1VQ4A 2RNGA 2R7ZJ 1XTAA 4L9TA 1Q86U 1X1AA 1I27A 2IGNA 1WRJA 2P7VB 3REOA 4Y52J 3UT1A 4EMKC 3UPUA 3MEAA 2ID3A 2NOGA 1BJZA 2QF7A 2CH4A 1A31A 2CT3A 5IT9E 4G7HF 3CXCA 2QUFA 1BOAA 3NAUA 1H8AC 3TO9A 2VE9A 2MBFA 5B1AH 1CKBA 4M7AF 3CCRI 1VOMA 4M77C 2VXDA 1WI7A 1IN8A 1FNNA 1YN8A 3PIOF 3M9QA 3URGA 3J7ZI 4ZYEA 5CKDA 4WXCA 1A0NB 1T3SA 1IRGA 2NNYA 3F8BA 1PP8F 1U9NA 2DE0X 2LCCA 3J81E 4BHPA 3JB9F 4PJOC 4U7BA 4A3DJ 3WXMB 2EZLA 4B8XA 1OR7A 2DA5A 2ELHA 1YI2Q 1IZ6A 2R4GA 2OTLI 2PUKB 4LE9A 1KZHA 1U8RA 4NL3A 4KMFA 5LD2C 2XI9A 2HOEA 2OX7A 2M9UA 3RJPA 5M5XJ 2PNIA 2BVLA 5GAOq 2MOXA 3JB9I 2O9SA 3RMQA 4C92F 1IGUA 1KFZA 1I6XA 3QYBA 1N6AA 2FHDA 2ZJQF 4MHGA 1AA7A 2QAZA 4WCGA 2G7HA 1Q82U 2DRKA 4ZH4F 3BE3A 2EZHA 2MK5A 1IO2A 3R61A 4BEHB 5CVVA 4RCCA 5GANh 1LDKB 3E6BA 1VYUA 4C8QG 4HVWA 5FKLA 5GADJ 1VQKT 5EZHA 3GX4X 4M3BA 3TP0A 1ETYA 2KR3A 3CMAI 2EQIA 1P9QC 3DLLA 4B4CA 4MMLA 1N77A 2QA4I 4LJZF 1R77A 4XKVA 5LJ5j 4DQ2A 3KZYA 3G71I 4BDZA 3R6OA 1TWHJ 2K3PA 4IXAA 5FLMJ 1EF4A 4E7LA 4XTYA 1WPKA 1XSDA 2R7SA 1WWXA 1U78A 3JCMh 2VBXA 8AT1B 2R7RA 3CO6C 1SVOA 3O8HA 2R7TA 1H8KA 2X35A 3A8MB 3K2AA 4Q47A 5EG0B 2QGGA 3LMMA 4FE4A 4RTTA 3M8FA 1IDZA 4D5FA 4C2UA 3CQZJ 3J7AO 2G6FX 2DFEA 2L2OA 2HU9A 5EYRA 1OU8A 2H8HA 2BE7D 2L4MA 2MF2A 2DETA 1HSQA 1GCPA 3FX3A 1Y1WJ 3WGIA 4RAZA 3GTJJ 2JN6A 4UHTA 4Z8AA 1K0XA 1B8IB 3JB9J 4RB0A 1WLPB 3CCUT 3UDCA 1FOWA 2VC0A 4BE0A 2YUNA 3CDLA 4M77G 4F7UA 2BOLA 5E1XA 1WQ7A 2J6OA 4JZ3A 3CCMI 2E1HA 3A02A 1RAFB 2F5FA 9ANTA 1B07A 1M9SA 2RJFA 3RBBB 3FISA 4A54A 3CC2T 4HCBA 4AWXB 5LGTA 4PJOG 3VKIA 2IPOB 2GBYA 1SFUA 1WJCA 4AT1B 2XKOA 3GEZA 2BZYA 5GAN2 2LX7A 3CCUA 3CCVI 1MBJA 4LXCA 5L8RE 3JCMd 4S05A 2M5WA 3BQYA 3PUBA 5HK3A 3N5BB 1QVGP 4OMMA 2CWEA 2FPDA 4HVUA 4RGUA 4HNVA 3NQOA 3OMCA 4JUVA 2VXEA 2W1OA 2HOSA 4F04B 1R36A 3CUQC 2CQNA 1Z9ZA 2DFFA 2JWTA 2K7LA 2F48A 3SEZA 4UY8I 2I8DA 1SFOJ 2WWYA 1BW5A 2A37A 2OTJQ 4XLNF 3GNGA 1B9MA 1P7JA 1MBGA 2W24A 1B34B 3F6VA 1V76A 2Z1DA 2GTJA 3DKXA 1RI9A 1UEBA 2Z3YA 2WA0A 5F0CA 1QA6A 1Z9QA 3VRYA 4ZDLA 2RNJA 2HDAA 2WAEA 2DL8A 2HSEB 1S72A 4BGDA 2B7EA 3PSIA 3EAEA 4YTLA 2UXNA 1HKTA 3GNFB 1OYIA 1M1KC 1E7OA 2V7FA 2JUCA 3VB2A 2L7MP 2OZUA 4ZYDA 3I58A 3OV8A 2EW3A 1ZGJA 2DK5A 2H6BA 2ZPBB 3UA6A 3F0CA 5JHUA 4JZ4A 3ZP5A 2O4XA 2MW8A 4EATA 1ZTRA 2XVCA 5CIUA 3ZQGA 1QVFS 4RKUE 3JRHA 2LBFB 3GVAA 3WTSC 3ECHA 3VPRA 5LEJA 4KNYA 1IN6A 3JRBA 4J00A 3WTVC 2EVRA 1VYVA 1VQ8Q 2FPFA 1UJYA 4HRIA 1ON2A 2ZO4A 4A0ZA 1CSKA 3M57A 1YHQT 4LLLA 3W6JB 3R0AA 3UATA 1R7JA 3UNGC 5KCMA 3U1KA 5LJ5e 5LJ5h 1OYWA 4A4EA 5C6SA 2OU2A 3OMYA 3DFGA 3ASNH 2EFNA 3CCJQ 4AG1C 3BG9A 4PJOD 2HPMA 1F43A 1FZPB 1BC8C 1YHQA 3WU1B 3LA7A 1LFUP 4S04A 2C6YA 2HTSA 3HOZJ 3TSZA 5HS7A 4BY7J 2QEXQ 2LKSA 2QQBA 4M3EA 2Z9OA 4PL6A 1VQ6Q 5GANf 1WJSA 4OGEA 2R7DA 2XAUA 1GDTA 3D0SA 1TQIA 1ZQ3P 2OAUA 3SWNB 3A4CA 3LSGA 2R0QC 3NPFA 2QDYB 4B44A 1FXXA 3ZOBA 1VQ7I 2EQUA 3LX7A 4FW1A 5DM7F 4XLFA 3QIIA 3RQIA 4LMYA 1PHTA 4N9HA 1ZG3A 2A6HF 1KGSA 3B6CA 3EETA 1LNXA 2EGAA 3HFNA 4XNFA 3WTXC 1JUPA 3OYLA 1QU3A 3SHFA 5LJ5d 1ZG1A 3HOVJ 1ZRFA 4O3MA 4JK1X 2E3HA 1JKRC 1JJ2A 1L0OC 2Z5UA 3CP2A 3RKQA 2GXAA 4AFUC 4KN7X 1IO6A 1SD4A 2KLOA 1SVMA 4KGVB 1T6SA 2CQXA 1JEGA 1TNTA 1P4XA 2VJ4A 4Q48A 2P4RA 1UFFA 2VJ5A 1T0FC 2CP0A 4X1EA 1PRMC 3ZEHA 4M71A 4XLAA 2Y2ZA 3LFKA 3AL0C 1G3SA 2KRCA 1QRYA 2LF8A 1WJRA 1M1KU 2V1RA 2YUOA 2EJ9A 3CC4A 1MJ9A 1W7PA 1LQ1A 4LFUA 4UB8C 5FFXA 1AHDP 3HOUJ 2CSQA 2ECZA 4X1VA 2TCTA 2HNIA 4ESBA 4BD3A 3F9KA 1BCOA 2RKHA 4Z02A 1VQ6I 4J9HA 2JT1A 3V4GA 1MMNA 5KCHA 3RDVA 1LNWA 2ZZDA 2P7CB 4RGSA 1BI3A 2P4TA 4Z6YA 4M78A 2RQTA 2LSOA 2K2MA 1DGRM 1YJNQ 2LT4A 3K1MA 2Z0WA 2W57A 4ZN3A 1K83J 1T33A 2EKHA 4XICA 1AU7A 4IJAA 1P6RA 5GAOn 2FSWA 4I98B 1ZUYA 2Y4XA 4JRKA 5CJ9A 4IQ4A 1QZYA 1UJ0A 2ZSIB 5EEGA 2MWPA 2D9TA 1FX7A 2DOAA 3SJMA 1D0YA 2ID6A 2DIQA 2FOWA 2FL7A 1T56A 4ZYHA 1M90R 2MSYA 1YJWT 1HJDA 3FIWA 1EH8A 2VL8A 3CJQB 1UHFA 4Z88A 2L7FP 5HY6A 1OCRH 4M7AB 2DMOA 2VI6A 3EFRA 3ZCOA 5IP9J 4IX7A 1JBMA 1ZARA 4XOPA 3DV8A 3O6BB 1V3FA 2M7BA 1ZLKA 3H3VK 2RQUA 1I3QJ 2VJJA 2YPRA 5CQEA 1LVKA 2LMDA 4XKBA 2GM4A 1C6VX 4IUPA 3A0BC 2P0WA 5GAN4 2MCNA 4KMUX 1HC8A 2V79A 2DM1A 4E7KA 3TVTA 3ESWB 1QNTA 2HFHA 3HC7A 3KP4A 2K57A 2AKLA 4E7HA 1GLNA 1YITA 5AIPA 2K4JA 1HD3A 4M77E 2A05A 3G6EA 1BW6A 1VQMA 1GL5A 1LEBA 2R7WA 4BJ6C 3H8ZA 3TDZC 5FO5A 5IYCJ 1HLVA 1ZRCA 2KRSA 2FUG2 3FZVA 2DVJA 4A3MJ 4PJOE 3M7GA 3QAHA 5GMKi 1QVTA 5JVTA 1ITYA 3C4SA 4PGHA 1W0UA 4HVVA 3H92A 2HZYA 3SHWA 3AHUA 4M7DF 5DYMA 2ISZA 1BR2A 1YX3A 2DKGA 2JJ7A 3VS5A 2P6TA 3K4KA 5GAN5 3G4ST 3F8FA 4O6JA 1PSEA 1R4NB 2XD0A 1NJIC 3H9GA 2VVKA 1KC8R 3HGYA 3FRNA 1U0JA 2Y0SN 3VEPA 4OIPF 1WPYA 2HI3A 3IH3A 1S5LC 3IAM2 1B72A 1FTZA 1GXQA 3M55A 1S3JA 2X0LA 1F1ZA 2RJEA 1IN4A 3FIFA 1Y0NA 1OEBA 1MMGA 3VYSB 1FOYA 1JI8A 3DP7A 2PU9B 1M2VB 1Y8QB 3ELKA 1WCMJ 1Z0XA 2R7OA 4C9YA 2VOOA 3GWZA 1NM7A 2EQMA 4I02A 2FYKA 2Q0OA 2RI2A 4RS8A 4N0AA 1YJ9Q 1QKXA 4NC7A 2L3SA 4IL6C 1JGSA 3HZJA 2QDLA 2WAQN 2L3QA 4QQGA 4X34A 2DF6A 2XICA 2SEMA 5KAFC 2R3SA 4XRMA 2NYSA 5GAN3 2DNUA 3EGDB 3A8OB 5FJ8J 1TUGB 3JRDA 2DFUA 1GCQA 5DV5A 3LH5A 2DDBA 4HV5A 2MC4A 1LPQA 1NLOC 4DOWA 3T8TA 2K5CA 1N27A 3THKA 1X4PA 1Z6RA 5TGTA 3ABUA 1UHMA 2HZTA 2Z16A 2V1DA 2PEXA 4RGRA 3K70D 5K7ZA 3EHQA 3JRZA 3MP8A 4HNTA 3CXCP 4EGYA 3MVPA 2K02A 2CP6A 5GANg 3LOCA 2C0OA 2WY8Q 1BI0A 1GVDA 3LA3A 3HRTA 2LQNA 1PM3A 1ZQ1A 2DD5A 3HOXJ 3PL8A 2EAYA 2L2PA 3RQ4A 4JJDA 2X3XD 2OPTA 2KNBB 4EV0A 1TC3C 1GRIA 3QKJA 1HA8A 3H0DA 1W4SA 1B59A 2KYBA 3GF5A 2LLKA 4LDUA 4I99C 4QIWN 3JCUC 1OI1A 2YDLA 4GDFA 3ZQQA 4UVBA 4AYBN 4XLPF 3CCSI 1YLFA 4OMZA 2V1UA 2IS2A 1UCRA 2MG4A 3CMEQ 1IN5A 2A5WA 2VQGA 4KT6A 4BACA 1YRNA 5CPRB 5D5WB 4A3JJ 2D45A 1OOTA 1WGSA 4OB0B 4A4GA 2QSFX 4IHTA 2COWA 4HF1A 1WKMA 3S17J 3JCMg 1TL8A 1K9MR 2M34A 2EA4A 1JTYA 2FVUA 3M54A 2F5EA 4I0AA 2WTEA 2LDMA 4HSTA 3WE3A 3TCJA 3CCQT 4KGXB 1JO8A 3H9QA 4C0GA 2MC3A 5FKNA 5E1WA 5A0LA 3CESA 1ZA1B 4GRIA 2HEOA 8ATCB 1KONA 2ZPEB 2DERA 1FEXA 2W85A 5IYBJ 1T0HA 1KU3A 4JPBW 1M30A 2DRMA 4J7IA 1DP7P 2XAGA 3DTIA 4LG3A 4XONA 5FLVA 4AFZC 1VQ8A 2MWOA 3E6CC 4KH0B 4N4NB 4H4KC 1Q95G 4YIFA 5M5WJ 1E17A 5J1RA 2I10A 5LGUA 4ENJA 2R5ZB 3REAB 3CJTB 1G59A 4UXNA 2CQKA 5DLQE 3CCRQ 3M0QA 4EJTA 4G7OF 1Z77A 3RKXA 2XASA 4EVIA 1YP5A 2AK5A 1KQ2A 1Z3YA 2ZBKA 3QOPA 5IPAA 1SAUA 1ZELA 1C1AA 3RYRA 4OF1A 3TSWA 4DOZA 2UXXA 4M9XA 2DT5A 3T5XA 1GV5A 1Y1VJ 3BTIA 3H0GJ 4C2MJ 2AZVA 2LJ0A 5CQYA 2OTLQ 2ZFUA 4OWRB 3F22A 3W6VA 3FXQA 1IAWA 2D1HA 1TWGJ 2EKOA 2DAQA 2VPRA 3K9TA 4OINF 5I11A 3ZN1A 2V6CA 5BS6A 3DLAA 4RLQA 1AWOA 2Q1ZB 1NH3A 2XKOC 2JS0A 1LKXA 2CSIA 1DPRA 3IWFA 2R5MA 3K70C 2SRCA 4M77F 4ZDPA 2YWWA 2DILA 2CMPA 2RREA 3JTHA 1BYMA 1Y8RB 4BEHA 1U06A 2DYRH 3H0IA 5C44J 2ZPIB 2V9VA 5H20A 2NUTA 3C3WA 1VQ9I 3OY9A 4PJOF 4C8QC 1TWFJ 1KQSA 3CC7A 2QA4Q 4KIBA 2HXIA 2HQEA 2XHCA 1D09B 3TU4K 2A36A 2OD5A 1PP7U 3OYIA 2HQHA 4AFSC 3META 3PVLA 4B47A 3TMOA 2GIZA 2KSSA 2UZKA 2ZCFB 1BM9A 1R4MB 1K4SA 2QTXA 3C95A 3H6ZA 3ABLH 2RGVA 4CCKA 2K9NA 2E12A 2ZNYA 1ZR4A 3M8JA 4R8HA 2R5AA 1NK3P 1H88C 1IGQA 1UB4A 5AONA 5EG0A 1QKWA 4BXUA 4XRSA 2MPXC 2Y90A 4Y92A 4F7ZA 4PLLA 1W7PD 3LAJA 4WXDA 1JUMA 3RKWA 5LJ5g 1DDNA 3HXLA 1ZR2A 1ONVA 1I1JA 2E5KA 4RG8A 1N9RA 3M0TA 4XK8E 3CCQI 3MP1A 1UZCA 3DEEA 2PUOB 1KYWA 2IBDA 2P4WA 3RDIA 4X9DA 2YU3A 4M78D 2EYQA 3WTTC 2AO9A 5DEQA 4KITB 1U8BA 3PO2J 4TVRA 3KFVA 1B7TA 4BB7A 2NYXA 2XGDA 5FROA 3WG9A 1RPWA 2K4BA 5K5QA 2MH2A 1TG0A 4FT8A 2E1MB 3K4JA 1R00A 4D8KA 1K8AU 3BDUA 4C5HA 1VQ5T 2NOJB 4UB6C 3OYGA 1HSJA 1MNMC 1WYXA 4F7UG 4N4GA 1Q81U 3MN2A 2G9WA 2YUSA 1FIPA 1ZHIA 1K9MU 3OYKA 1W5CC 2E60A 3H5RA 3W2WA 5H2FC 1KHCA 4M3DA 2CUFA 2OCEA 4ESJA 1ODDA 3PIPA 1XMKA 5DCFA 2DA4A 2HAXA 2M7AA 2W48A 3FM5A 1X1CA 2JVGA 4GYIA 2DZ9A 2WAQA 3AG4H 2XHKA 4LN2A 3GTMJ 2GA2A 3J7AY 1XGSA 3O2PE 1BN5A 2M45A 2HDWA 5DM7R 1P4WA 1J09A 2X6YA 5FKOA 5ECAA 3WHBA 3DF8A 1I4K1 2PMUA 3HGGA 2HR3A 3HJEA 4P55A 4XKCA 2E5NA 5ILVA 5D5UB 1B34A 2DVEA 2IIMA 3M59A 3M5AA 3EFSA 4A6DA 5GAGJ 5HLGA 4OB1B 3NEUA 2FRWA 4OGCA 2FBIA 3BLYA 4G94A 3VYRB 4AIDA 3IRRA 5IN1A 5GANe 1SF9A 1VI0A 4JJNK 3E9GA 3OOUA 1FSHA 3CPWS 4IRGA 3HHGA 1Q7YC 1YJNI 2EV6A 1LB2A 2X6XA 1DP3A 4E4HA 4KA4A 1NPPA 2D8HA 2ENMA 3S2HJ 1OCCH 4L0ZB 2HBWA 2BXZA 3BJ6A 2RK2A 4EJVA 2COYA 3JRAA 1FMWA 2YRCA 2EJGA 3JRCA 3PQKA 2JXBA 2GTOA 1X2MA 3FDYA 2M16A 1IJWC 1C0MA 3QZ5B 4AYBA 4E2FB 2LBFA 4RBOA 3CBMA 5GAN8 2HYJA 1AWWA 4A2UA 3I35A 2BE5F 3I4MJ 4FCYA 2DXBA 4M7DB 1JKQC 2Q2EA 1KU7A 3HTSB 2E5ZA 5LJ3h 2LD5A 1OMIA 4KUDK 3E7LA 4QVZA 1IC8A 2VASA 3DPLC 2L0AA 1XN7A 3SDBA 2PVDB 1SANA 4RAFA 4CCLA 4OB2B 4I09A 3HOTA 1K4US 1ERDA 1O7FA 3A03A 1NHAA 2HZDA 1YJ9A 4OIOF 3BZ6A 3JCMX 1SEMA 1WZOA 4MO7A 3A98A 3QBYA 1MZBA 4KGZB 4A4HA 2VUMJ 4E70A 2LMJA 4L5GA 2E4HA 2LKPA 5HDKA 4KDPA 1UECA 1WQWA 1VQ7Q 1WNLA 3SWNA 4ON0A 2FX0A 2A68F 2J5PA 2X85A 3JCMW 1JXMA 3CC2Q 3L2UA 5B5EC 2VQLA 3RPQA 1VQ5I 2CT4A 4YELA 4GLMA 4PUSA 5FU7C 3JCMc 1YE9A 3M0PA 1D8KA 3NRVA 1ACMB 2VBYA 2DMNA 1FY7A 4NBQA 4RAGA 5TJJA 1LOJA 1QVPA 3BC8A 4KICA 2ZMEA 5D6FA 4PCQA 2YHTA 4ESRA 1I1GA 3UR3C 1Q86C 3CCET 1YS7A 4C8QD 2YX7A 3KX2A 2MMPA 5ED4A 1K76A 2HL5C 2LQKA 2HQNA 3L7WA 2PN6A 3LAPA 1ZSZB 4D0PA 4EEFG 1PKSA 3CLQA 2R7FA 4N4HA 1YW7A 4MDXA 2PFBA 4BBRJ 1R5ID 2I2LA 4DOVA 3CMEA 2V8KA 1IDYA 4L9NA 1WHGA 3EG3A 2X9DA 1M2OA 1XMXA 4RMOA 3AG2H 3MAJA 3I56T 2EGEA 3HHTB 1ZRDA 3MEWA 1J75A 1W6XA 2X4XA 2XF6A 1P4AA 1DPUA 4OMLA 4J01A 1OPLA 1ZX6A 1GBQA 1AWXA 2FPEA 2FEIA 2DLPA 2FNPA 2HTJA 2AS5F 2JA6J 2ZSHB 2VGNA 1Q7YU 4JLIA 3GXOA 2DI3A 4XK4A 1NEBA 5GANj 2CV1A 4B48A 1KHIA 2NXNB 2RHXA 1RETA 4JYKA 5KYYA 1T08B 3TKYA 1M3BA 4FE7A 1R23A 1OU9A 5CAIA 3F8MA 5HCKA 1G3TA 1I5OB 2PJRA 1WX6A 3BG5A 4A6EA 4IUUA 4M74A 3Q1JA 3MEVA 1YCYA 3G7ZA 3SD4A 2QG9B 2E1OA 2LTOA 4M78G 2VN2A 2KYMA 2L9VA 2DDAA 4OAYA 1MSEC 1VQLT 4M72A 3WTUC 2AXTC 4BXXJ 3EH2A 3CCRA 3S15J 2DD4A 5I22A 1XGMA 3MMYB 1EIFA 2KHMA 4C0DB 2OAZA 3GZ5A 2E64A 1EH6A 2F2EA 3LSJA 5KH6A 3JSPA 2BHYA 4NB5A 2MLKA 2PVOB 4DBQA 4M7AA 3K4BA 3NWTA 4YEJA 2CGPA 2AQEA 2H3JA 1GHCA 2VV5A 1SFKA 3FEOA 3H0HA 2IAIA 4N0BA 4BE2A 2PZ1A 4XLEA 2CYYA 3PIOA 2K9MA 4UUSA 1OFCX 1D5VA 2W25A 2RI3A 2DBKA 4M75D 1NK2P 1QVFP 2KQWA 1NTCA 2DBBA 2Y75A 5J8CA 4I2OA 4HQEA 1VQ4T 1XSXA 3BCBA 5FD5A 3GUDA 1W2BS 3VYUB 1BIAA 3RI4A 1TW2A 1D1AA 2D1XA 2RK1A 4OMNA 1RI7A 2DODA 2DMUA 4D8DA 1ZA2B 3FXLA 2K3BA 4C92A 1NYGA 2BY1A 3X28B 3RESA 2ICWG 4ENMA 4M77B 3CMAA 5IH2A 1P7IA 1S8NA 1X3UA 2EINH 2IGOA 3LFUA 3RIRA 3C2GA 5JLXA 5D5XB 2QQ8A 3HOWJ 4IURA 5A0GA 2VKNA 3QWXX 1J2XA 2QA4A 4LD9K 5ICFA 2O8XA 4F7UE 5H6RA 4FYYB 3FJ5A 2LY2A 3G71A 2ELKA 5CR2A 2O5RA 5CCAA 1SD6A 4JX5A 4Z2YA 1Q82R 5IP6A 2A5YB 3ZMVA 5CQGA 4DGWB 4FYXB 2F5CA 4KUIA 2LQ8A 1VQNI 2M0OA 1ETXA 2LY1A 4IUTA 3GPLA 5LHGA 1K9AA 2L54A 4P9UA 3J80E 2CSOA 3T0YA 2DX1A 3QPSA 4JRPA 3E6DA 1Y39A 2RNAA 2XGXA 3U23A 3VRZA 4A3GJ 4I01A 5GPAA 2B86A 2E6ZA 3KEOA 2GQQA 1A6IA 2WSCE 2IA0A 1KD1U 1YIJI 1BR4A 3OS5A 4C8QE 4FIBA 3LSRA 4HPQA 2JMAA 1QP3A 2PQ8A 1X27A 2NLUA 1M2VA 1VQPA 2JSPA 2ZXIA 4RTUA 4Y13A 3IC7A 2R58A 3CBOA 1R5HA 5CKTA 4LUEA 4NNJA 3NTKA 4AVPA 1RNLA 1RLPC 4ENNA 4Q5WA 3CCMA 3P7NA 3V7SA 4I76A 3W2AA 2FU4A 3GBGA 2EYYA 3PSFA 2J6FA 3C0CA 2K9QA 1PKTA 2FZGB 3AG3H 2ME6A 2ECBA 2NUTB 2RO0A 3CQTA 4IVNA 3RYPA 3EGDA 4A3KJ 4U87A 5FRNA 2COZA 2H3EB 3VV0A 3CCVA 5HVQC 4GLKA 5J1UA 4WX9A 4BQQA 1U5SA 5E3NA 4IUVA 3ZL7C 2H6CA 4IRIA 1JQQA 2VXFA 3KBGA 4HQMA 2XB0X 1P2FA 1WVRA 2JA2A 3VWBA 3VUZA 3H3ZA 1I39A 4U0YA 3QP6A 3QODA 2E41A 4CCJA 3EUHA 4J7FA 4D5CA 2LZ6B 2PTKA 3HDDA 3QZ9B 1KA8A 1YWOA 4V19K 1ZHFA 1KJWA 4M75C 1MDMB 2A3LA 2JW4A 2JZ2A 2BHZA 4FASD 3FF5A 1PDNC 1I8FA 3GO5A 2Y4YA 3CCSQ 1XJWB 1UDLA 3LSMA 4M3GA 1ZBXA 2IEKA 4JOMA 2CU7A 1M27C 5FWCA 4D6WA 1M3AA 5HNHA 1X6BA 5GANd 3KP5A 4XORA 3BCAA 1G2BA 3CD6I 5C4XJ 1WH7A 2ZXWH 5BOXA 2GQIA 2QQRA 3UWNA 2J7IA 1MH3A 2MH9A 5FB2A 5KYUB 1MJAA 1IZ1A 3B02A 4RM3A 4J19A 2DPDA 1R71A 4AVZA 1POGA 2KDSA 4DZJA 3HP9A 3JCMQ 3SFMA 3MZ8A 1KQSP 4OOIA 3CJRB 3TO6A 1BJAA 2CYZB 4UVCA 2DA7A 3VODA 4J6WA 1UGVA 2ECCA 3G1LA 1V5GA 1TU0B 1TNSA 2M2EA 3G1MA 1W5TA 4OAZA 5EEAA 1HW2A 1IF1A 1AEYA 2HOTA 1PC0A 2KY9A 3Q3SA 4LB6B 4L5IA 4JQFA 2R5ZA 4CCNA 2HKQB 3OW2S 1S72T 3KPHA 3LSTA 3E6MA 5GMKl 1W0TA 3BR0A 3HSRA 1U3EM 4E47A 2M9HA 2BEOA 3JREA 1ZAOA 4ASNA 2BY3A 1VUBA 4BI4A 2BXYA 4RAYA 3M4YA 4E7IA 3V7CA 5LHIA 3O3KA 3WU2C 3OSFA 5FU6B 4ATOA 1A5JA 2A6TA 1M4ZA 1Y0MA 5GJWB 4K2EA 3PMIA 1VQ7A 4EDUA 2R5YB 2FB7A 4LUDA 2F4MB 3PFIA 3K2ZA 4RDUA 2VXZA 1NZ9A 1D0XA 1A36A 2KT0A 3OS0A 2JUGA 1Y57A 3GLXA 1O4XA 3S2DJ 1VQKI 4XSZF 3WODF 3GYHX 1PG5B 1S7OA 2C0TA 2O6GE 3I55A 1VQOT 2NWMA 3CP8A 4M75G 5B3SH 1JTXA 4Y28E 1LDJA 4GGGA 3K10A 2WC2A 4W97A 3AG1H 1RKWA 2OQRA 3LWFA 1VQ9Q 3K0LA 2HL3A 4ZZDA 3L2CA 4HCCA 3DBHB 2DU9A 4M78E 4A93J 2Q2EB 2QYZA 5D8KB 2LVSA 1Z7UA 1GUUA 1X1BA 3FXJA 5K1YA 1QP2A 4ANJA 2DAOA 4D7MA 2A28A 1VQOA 3S93A 4NOYA 3R6NA 3MKLA 2ZCWA 2XGCA
chains in the Genus database with same CATH topology
3QXEB 3F70A 3C12A 3LW5E 4PFOA 5GAOl 4XQ3A 2IGMA 2HPIA 2RHUA 1PYVA 3VUBA 5LJ3g 4IZZA 3LYIA 2ZXHA 1VQ6A 4C8QF 2XDVA 4LDYA 2HD0A 2X1EA 2CV2A 4A4KA 3NTHA 3QJYA 1QW1A 4ZC3A 4HT9A 2K2VA 1O9SA 2KZVA 4RCBA 1V5FA 4OMFB 2DT7B 2XIDA 3EPZA 3CC4T 2LRDA 4DIQA 3CCLT 4M7AD 3A8HB 2W00A 5CKBA 1NG7A 2JTFA 2EIFA 1T95A 3CCLA 3INZA 3MHXA 2V8IA 3KYLA 4ZGEB 4DA4A 2PJRB 4XU0A 3QYEA 5KE2A 3DTEA 3FLGA 5GAMh 2V26A 4FL6A 1X4OA 5FRMA 2IG0A 3ZFJA 4MDWA 3CMMA 1YI2T 1OLTA 4QPQA 4M7DA 4ZN1A 5J39A 2CW7A 3MKYB 3OYFA 2M1HA 2UWMA 1YI2A 4PFPA 1YITT 2X6WA 2DXCA 4BI3A 3G6ET 1VQMT 4KJZA 5CQXA 4RLFA 3SZGA 2XU8A 1V29B 1O75A 1UGPB 3HRUA 2A7YA 1WJFA 1TH7A 4C92B 4BQNA 5KE3A 4CCOA 1N8RC 3OYCA 3VJPA 2BUDA 1RL2A 3IUOA 4M7AC 4LDVA 5EG2A 2O01E 2EQKA 4QVDA 4N4OB 2HQXA 2MFZA 1M90U 2CZ1B 2D6FA 3CCSA 4XTZA 2LVMA 3TREA 2DJIA 4B3XA 3S8PA 4R79A 3HRSA 4BUPA 4F55A 1W36D 2IXSA 3MO8A 4M75E 2OV7A 1K9MC 4V2SA 4G6TB 4AU7A 1XNIA 5CO7A 2OTJT 4CRIA 3H5NA 5LJ3e 3BG7A 4KISA 4ZGJB 3OS2A 3D5SC 2LYCA 2GFUA 2MD0A 3OSSC 3S3NA 1OR7C 3TBIA 1N9SA 4LDXA 4II2A 4C30A 4GY5A 2OTJA 3JB9H 1BIBA 1KC8U 2UV1A 2G3RA 2MAMA 3T9NA 2WAFA 1TZLA 1PJRA 4M7AG 3EUAA 5GAMf 2BIVA 1N8RU 1VQ8T 3OL3A 3VU3C 3V42A 5HNFA 4XU3A 1U1SA 2IS1A 1VQ9A 3NFCA 3PNVA 1UGRB 3CCJT 3JCMc 4M77A 3OS1A 2QEXT 4NQWB 2F5VA 3EUKL 1K8AC 4PJOA 2PVGB 5A0DA 4PJJA 4VUBA 3CCJA 4C5GA 2QEXA 2QQ9A 4P1WA 3L2RA 3LL7A 5J26A 4NUBA 3FBNB 1W36C 2JVVA 3VYGA 4YRVA 1Z3XA 3V8LA 3QYFA 3M56A 1K9MU 4ELZC 4XR6A 3CC7T 5CKHA 5HOOA 3A8LB 3X25B 2BVMA 3ZRGA 3U21A 3GIBA 3JCMJ 3QYHB 5LJ3j 3VYTB 2LCLA 3L2ZA 1D3BA 4KULA 1R8OB 1Y71A 3CPWA 2R57A 3RERA 4X0GA 4O5VA 4OP0A 5LL6S 2DZCA 2DXTA 3D5LA 3MCAB 4XL9A 4RM2A 2AHJB 1YJNA 2MYSA 1M8VA 1WJEA 1UELB 2VB6A 4M75F 4PSWA 4FM4B 2V1NA 2KK4A 3NWSA 5KCOA 1Q81C 2UUZA 3LSIA 4HEA2 1NE8A 2E5QA 1NG6A 4HSRA 1D1CA 2X4WA 4A53A 2DIGA 3L1AA 2DO3A 4M7DD 2RJDA 1UG0A 2X1CA 3HL2A 4BY6B 2VUBA 3HFOA 2L7KA 1P92A 1Z7LA 3KXTA 3I9V2 2E1MC 2F4IA 3PJRA 3H9JA 4J8OA 3E0JB 1IREB 2CZ0B 2YLCA 3ME9A 1YJ9T 2RI5A 1UAAA 3HPHA 5GAMg 1QVGS 4UC4A 2YLBA 2KQRA 3M53A 3DU5A 1X01A 3K6GA 4M78C 3RMSA 3LSKA 1HXDA 3FDRA 4M7AE 4ZGDB 2QXFA 4CI0C 2CUZA 2F69A 4XN3A 1Q81U 2IGKA 4N4IA 1VZ0A 4QW2A 3OR2C 2MI6A 4CH7A 5LJ3d 3CMET 3QSUA 3MEUA 4X9CA 4PJNA 2X4JA 1W2BA 4XMYA 5I21A 1Y7XA 4JS4A 2VC8A 2GF7A 1PSFA 4BJTA 1MHNA 4E7ZA 1XOVA 4J6XA 3ZR8X 1KD1C 2EFIA 4IUQA 5CVIA 4JRQA 3HKZA 2XSJC 3MKZA 2RA2A 4L6V5 3CPFA 3X24B 2RD1A 2VKDA 3CCRT 1MW7A 3ZGKA 5HK0A 4BL0B 2XF5A 2DK3A 2ZPGB 1H641 2GQVA 2YRVA 2GOMA 3L42A 2JTMA 3P8DA 2HVRA 2VGMA 4MZMA 3X26B 4C2TA 4N0AC 1BR1A 2K9LA 4Y33A 3RUXA 3H5AA 1YIJA 2OTLA 4BQOA 3JAME 4M7DG 3L2VA 3FKJA 4C5IA 2PQWA 3CMAT 2KL4A 3DKYA 2QA4T 4IKFA 2IS6A 5CK9A 3OYHA 4EMKB 5HKCA 3G71T 5AYFA 3QYGB 3GP8A 5GAOm 3O8VA 4PK4A 3BFMA 2P0KA 4PJOB 2V6EA 4MZTA 2DXUA 4KBMB 2RHZA 3X20B 2XDDA 3IP4B 3OYAA 2XC7A 3KEYA 2XDBA 3CCMT 1XQHA 1WJAA 2BW3B 3CD6A 2MABA 3CCVT 3FHNA 4HG2A 1OZ3A 3OW2A 3P8HA 5GAMe 2CKKA 3HL8A 2HQAA 3OQ5A 1D3BB 1FWZA 3QJ6A 4M75B 1H3ZA 2K5FA 2K3YA 1Z21A 2R7VA 2L8DA 3E19A 2HVSA 4P5NA 2ZPHB 5GAOr 2Z2SB 4E6KG 1QVFA 2XF7A 3FC3A 2M4KA 2R7QA 4D1QA 5HLTA 4ELYC 2KMUA 1QHHD 3P8BB 1VQKA 1S9HA 1M5Q1 2KVQG 3OMGA 5GAN6 4FSXA 2CW8A 3OYMA 4LD6A 3S32A 2CFOA 2L3RA 5DY9A 3J7AF 3ONQA 4DBRA 4MMKA 3L2WA 2LREA 3CXCS 3K4NA 3W3CA 4XQFA 2XDPA 1VQ7T 1TT0A 2CS3A 1MMDA 2M3AA 4RG2A 2V8JA 3RKYA 3I55T 3OYJA 2QI2A 4F91B 3PFYA 3QDRB 3CC2A 2RHYA 2CV0A 5GMKe 4R55A 2VIXA 3S3OA 4C8QA 4XTVA 4NL2A 5A2QE 4LDWA 4BXFA 3S3MA 5GAMj 3PGGA 2WB1A 3LGFA 1G5VA 3DTKA 4B9XA 2F5TX 2VQHA 4F7UF 1U1TA 1WJ5A 2EWNA 3SYTA 2RH2A 1VQ6T 2XG8D 1OZ2A 1JB0E 5FU6C 2LRQA 4M7DE 2DTHA 2LH9A 4FU6A 5LFAA 4F3QA 3PNTA 3JCMb 2L9SA 4XAXB 3SDZA 4ZDOA 4RMNA 3WVEB 4QQ6A 3LGLA 2KMTA 2LX9A 3RSNA 2LC4A 3V8KA 2QKLB 1SSFA 2K5LA 2AQFA 4HNUA 4F52A 3AL0B 2IS4A 2V4JC 3MD2A 1BI2A 2VLAA 3ZXSA 2L89A 3VSKA 1I81A 4ZJZA 4ZYAA 2VKHA 3DU6A 1M90C 3SB2A 3SWNC 5GAOp 3JCMf 3JB9D 2E12A 1KQ1A 5KNLA 3DKMA 3M1CA 4CA0A 4BJ5C 5GMKj 2CH0A 4MLOA 3D5RC 4C92D 3VYHB 3HUGB 3LSHA 3BY7A 4D9JA 3H35A 4CZCA 1N78A 4BE1A 2B8AA 4OVAA 3MP6A 3VSLA 1JRIA 5I2SA 4CUGA 3HPGA 5D6YA 2KP6A 1BOBA 2KRHA 2WSEE 3PMTA 4Y91A 4XLHA 4F92B 3PT9A 4J6YA 3ZBDA 2GOXB 1YX5A 1NPRA 1DGWY 3FJPA 3AFHA 1M1FA 4XN0A 1KC8C 1RI0A 1VIFA 2HBPA 4XU2A 3OIPA 2RJCA 1GXIE 3LH0A 2L9NA 5GAMd 2E6NA 3C2HA 3HPWA 4LITA 5D6XA 1X6OA 4EMGA 4LIUA 3BW1A 3WVDB 2VQCA 4E7SA 5FLXE 2M0MA 3K4CA 3DB4A 1YJWA 3CCST 3QPHA 4EMHA 2BKDN 1YBYA 4M78F 4OB1B 2DEQA 1JJ2S 3C94A 3LWIA 3CF2A 2ZPFB 4JLGA 1WJQA 3N05A 2DJZA 1D1BA 5LJ5f 3JCMV 4QQDA 3LLRA 3L2QA 1WJBA 4C92C 1N75A 2QQSA 5IAYA 2DTOA 3HOSA 4E7JA 5CKEA 4P5OA 5GMKh 2PMZA 4A4FA 1Y96A 5J3BA 2EQJA 3G4SA 3M4GA 2XK0A 3FB9A 2EJFA 1MMAA 3OL4A 2D0QB 3TEEA 2LC2A 4BI8B 1VIEA 2K5IA 4EPCA 1K73C 4MZPA 1R6RA 4FETA 2L5QA 2QQAA 4PLIA 1MNEA 1HK9A 1DQUA 2DCEA 1VQ9T 2KPMA 2HNHA 4XTWA 2E70A 4EMKA 2R7UA 5CKFA 3JB9G 1E0EA 4XKWA 3V8JA 3RTRA 4J83A 4XTXA 3EUHC 4ME7A 4CSWA 3DWLE 4Y4RA 3AKZA 4OB3B 2WSFE 4C92G 1I5LA 4JRIA 4FT2A 4F7UB 3BDLA 5GAN7 2WBMA 3TL4X 1OYXA 4WF2A 2CS7A 3CCQA 2W7NA 1G8XA 1NJIU 4C8QB 2BW3A 3QHSA 3HG9A 1UGQB 1Y07A 2JN0A 3OR1C 2K3XA 3QO3A 2QKMB 3QOEA 4M75A 4C5EA 1LJOA 3W2VA 4NS5A 4XTUA 1K73U 2O4XB 3K4MA 1X19A 3G2BA 2LG4A 4F93B 1XTDA 1YJNT 2DXIA 2KDOA 1X1DA 2ZGWA 4XU1A 3K4LA 2CGHA 1QVGA 4JDSA 2WADA 4ZTFA 2E10A 2JVHA 4L59A 1QHGA 2OUMA 4QPOA 1MGQA 1WFXA 3RCOA 1MNDA 3OYBA 3OB9A 2WACA 4PNOA 2DTIA 3E9FA 4HA8A 5I2MA 4PKCC 4E47A 1G3YA 2Y0SA 3OWTA 2RB6A 3JSCA 2RQQA 2OC6A 4B9WA 4PJMA 2M4GA 4HKEA 1Y6IA 4R56A 1VQ5A 1X75C 2E65A 3E1SA 1WJDA 2F6CA 2P0QA 3DLMA 4CCMA 2V9KA 1KG1A 1KQSS 3A2KA 2X1DA 3OA6A 1G3WA 4M78B 4BY6C 3OBWA 3J80E 1AHJB 4Y3OA 1V5EA 3MKWB 4QVCA 3DPUA 2RM4A 2GFAA 2JNGA 4J5YA 2LOOA 5FU7B 1EA3A 5JHFA 2VJIA 1UGSB 3JCMe 5DLOA 3OYDA 1D0ZA 3QG1A 1DJ7B 4PSXA 4II1A 2P0PA 4DJAA 3A8GB 3VDXA 2R7XA 4M7DC 5M9OA 3CBPA 4C92E 2F5KA 4IQJA 3DQVC 2JUFA 3PNWC 3DB3A 2HVQA 1BKBA 2CZ6B 2GCXA 2W4SA 4XM3A 4BU2A 3ER0A 1M1GA 2KAFA 3I3LA 1LFPA 1FMVA 3A5ZB 3NTIA 2K4YA 3QUIA 1VQNT 2CZ7B 5GMKm 1Y96B 2VYTA 1Y56A 4PJLA 2JOYA 3OYNA 2X4YA 2X51A 3CCEA 4M77D 4ITVA 1YIJT 4C0ZA 3FBIB 3M58A 2OTLT 4HCZA 1VQNA 3HKSA 3CZ6A 1IRXA 3V7RA 4PJOD 3BG6A 1BI1A 4II3A 3I56A 5D6WA 2WY7Q 5KHDA 1Q82C 3S6WA 3LWHA 2DPPB 4KT0E 4LIVA 3OYYA 3DPTA 2ELJA 4XLCA 1K6YA 2DT6A 3OSVA 3X28B 5LJ5e 3JCMP 3OYEA 4B43A 2IVWA 4FT4A 2VPLA 2LT1A 4HT8A 3OIQA 3OBYA 2CUJA 3A1YA 3PNYA 2LNVA 4BS9A 1VQLA 3IAS2 4XOTA 3PTAA 4C0DC 3GOXA 3SEQA 4NC8A 3PFSA 2W82A 3KUFA 2C06A 3CD6T 4ZTJA 4C0FA 4JS5A 3HSBA 3RPUD 1VQ4A 2RNGA 1Q86U 1X1AA 2IGNA 3UT1A 4EMKC 3UPUA 3MEAA 5IT9E 3CXCA 4M7AF 4M77C 2VXDA 3M9QA 5CKDA 3URGA 2LCCA 3J81E 3JB9F 4PJOC 4U7BA 3WXMB 1IZ6A 2R4GA 2PUKB 4NL3A 1U8RA 5LD2C 2XI9A 2M9UA 2BVLA 5GAOq 3JB9I 3RMQA 4C92F 2FHDA 3QYBA 1N6AA 1Q82U 1AA7A 4BEHB 4RCCA 5GANh 1LDKB 1VQKT 1P9QC 3DLLA 4MMLA 1N77A 4XKVA 5LJ5j 4DQ2A 4BDZA 3R6OA 2K3PA 4XTYA 4E7LA 2R7SA 3JCMh 2R7RA 2R7TA 3A8MB 2X35A 3LMMA 4C2UA 2L2OA 2HU9A 2MF2A 3JB9J 3CCUT 3UDCA 4BE0A 4F7UA 4M77G 2BOLA 1WQ7A 2E1HA 1M9SA 4A54A 2RJFA 3CC2T 4HCBA 4PJOG 3VKIA 1WJCA 5GAN2 3CCUA 5L8RE 3JCMd 3PUBA 5HK3A 3N5BB 3OMCA 4JUVA 2VXEA 2W1OA 3SEZA 2I8DA 3GNGA 1B34B 2Z1DA 3DKXA 1UEBA 2WA0A 4ZDLA 2WAEA 1S72A 4BGDA 3PSIA 3EAEA 4YTLA 3GNFB 1M1KC 2V7FA 2ZPBB 2O4XA 4EATA 5CIUA 1QVFS 4RKUE 2LBFB 4J00A 4HRIA 3M57A 1YHQT 3UNGC 5KCMA 5LJ5h 4A4EA 5C6SA 3OMYA 2HPMA 1YHQA 2QQBA 4PL6A 5GANf 1WJSA 4OGEA 2XAUA 2OAUA 3SWNB 3A4CA 3LSGA 2QDYB 4B44A 1FXXA 2EQUA 3LX7A 4XLFA 3QIIA 1LNXA 3HFNA 4XNFA 3OYLA 1QU3A 5LJ5d 1JJ2A 3CP2A 2KLOA 2VJ4A 2VJ5A 1T0FC 3ZEHA 4XLAA 3AL0C 2KRCA 1G3SA 1WJRA 1M1KU 3CC4A 2EJ9A 2HNIA 4BD3A 3F9KA 4Z02A 1MMNA 5KCHA 2ZZDA 2P4TA 1BI3A 4M78A 1DGRM 2LT4A 4ZN3A 5GAOn 2Y4XA 4JRKA 4IQ4A 2ZSIB 2MWPA 2D9TA 2DOAA 1FX7A 1D0YA 2DIQA 2FL7A 1YJWT 2VL8A 3CJQB 4M7AB 5HY6A 3EFRA 3ZCOA 4IX7A 1JBMA 4XOPA 2M7BA 2VJJA 5CQEA 1LVKA 4XKBA 4IUPA 2P0WA 5GAN4 4E7KA 3HC7A 2K57A 4E7HA 1GLNA 1YITA 4M77E 3G6EA 1VQMA 2R7WA 4BJ6C 3H8ZA 2FUG2 4PJOE 5GMKi 3C4SA 3AHUA 4M7DF 1BR2A 1YX3A 2DKGA 5GAN5 3K4KA 3G4ST 4O6JA 1PSEA 2XD0A 1NJIC 3H9GA 3FRNA 1U0JA 1WPYA 4BUGA 3IAM2 3M55A 2RJEA 3FIFA 1MMGA 3VYSB 2PU9B 1JI8A 2RHIA 2EQMA 4C9YA 2R7OA 4N0AA 2FYKA 2RI2A 4NC7A 4X34A 4QQGA 2XICA 5GAN3 3A8OB 2MC4A 4DOWA 2K5CA 1N27A 1X4PA 5TGTA 3JRZA 4OF1A 2Z16A 3K70D 3MP8A 4HNTA 5GANg 2WY8Q 1BI0A 3CEYA 3HRTA 1ZQ1A 2DD5A 2EAYA 3PL8A 3RQ4A 4C8QD 3QKJA 1HA8A 3H0DA 1W4SA 3GF5A 4LDUA 1OI1A 3ZQQA 2IS2A 2A5WA 2VQGA 4KT6A 4BACA 4A4GA 5CPRB 1WGSA 4OB0B 3JCMg 2FVUA 3M54A 2LDMA 4HSTA 3TCJA 3CCQT 3H9QA 4C0GA 5A0LA 3CESA 4GRIA 1KONA 2ZPEB 4J7IA 4LG3A 3DTIA 4XONA 1VQ8A 2MWOA 4N4NB 4H4KC 1G59A 5DLQE 3RKXA 1KQ2A 1Z3YA 1SAUA 1ZELA 4DOZA 5CQYA 2ZFUA 4OWRB 2EKOA 2DAQA 3DLAA 4RLQA 2Q1ZB 2XKOC 1LKXA 2R5MA 3K70C 4M77F 4ZDPA 2CMPA 2RREA 1BYMA 4BEHA 2ZPIB 4PJOF 3OY9A 4C8QC 1KQSA 3CC7A 3TU4K 2XHCA 2HQEA 3OYIA 3META 4B47A 3TMOA 2KSSA 2ZCFB 2QTXA 3C95A 3H6ZA 4CCKA 3M8JA 2R5AA 1UB4A 2Y90A 4PLLA 3RKWA 5LJ5g 4RG8A 3HXLA 4XK8E 1N9RA 3MP1A 3DEEA 2PUOB 4X9DA 4M78D 2EYQA 4KITB 4TVRA 4BB7A 5FROA 2E1MB 3K4JA 1K8AU 3BDUA 4C5HA 1VQ5T 2NOJB 3OYGA 4F7UG 4N4GA 1ZHIA 3OYKA 2E60A 3H5RA 3W2WA 1KHCA 3PIPA 2HAXA 2M7AA 1X1CA 2JVGA 2DZ9A 2WAQA 3J7AY 2HDWA 5DM7R 1J09A 2X6YA 1I4K1 3ASKA 1B34A 2DVEA 3M59A 4XKCA 3M5AA 2E5NA 4C8QG 3EFSA 4OGCA 3BLYA 3VYRB 5IN1A 5GANe 4JJNK 3E9GA 3OOUA 3CPWS 1Q7YC 2X6XA 1DP3A 4E4HA 1NPPA 2RK2A 1FMWA 2EJGA 3QZ5B 3FDYA 2M16A 4AYBA 2LBFA 3CBMA 5GAN8 4M7DB