2L5QA

Solution nmr structure of bvu_3817 from bacteroides vulgatus, northeast structural genomics consortium target bvr159
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
142
structure length
142
Chain Sequence
MLKTILSIAGKPGLYKLISQGKNMLIVETVDAAKKRVPAYAHDKVISLADIAMYTDAEEVPLSEVLEAVKKKENGAVASINYKKASADELHAYFAEVLPNYDRDRVHNGDIKKLISWYNILVNNGITEFVEAPALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Northeast Structural Genomics Consortium Target BvR159
rcsb
source organism Bacteroides vulgatus
total genus 26
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2010-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18347 DUF5606 Domain of unknown function (DUF5606)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1650 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2l5qA02
2.30.30.730 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2l5qA01
2L5QA
chains in the Genus database with same CATH superfamily
1U5SA 2EJRA 2XDVA 2DE0X 1UE9A 3VYTB 3P5JA 3EGXB 3CP8A 3I56Q 1UG0A 3V7CA 3QIIA 1K6OA 3CCLT 2O4XA 3I59A 2FF4A 3FM5A 1UG2A 2R7XA 1G3SA 4Y4RA 3CCET 3RQ4A 1TP4A 4OB0B 4ITVA 3DLAA 4F7UA 2COZA 1RKTA 4XN0A 1MNMC 2DA5A 4C92D 4D6WA 2ZPIB 3VDXA 3ZPLA 1ZUKA 3NWSA 1D3BA 1EIFA 4M7DG 2NYSA 2OZ6A 3NFCA 2QGFB 1VQNA 2DIGA 2X9DA 2ECZA 1WRJA 3WHCA 2F2XA 5HCKA 2NVQJ 5E79C 1QPMA 3I64A 2XV4S 2F5CA 2E5QA 1OPLA 2O5RA 2E64A 3WG7H 1LFPA 3LW5E 3K4CA 3ZRGA 4LLGF 2Y48A 4AD9A 1NH3A 2LMDA 2XUBA 1VQNI 2DVEA 4A3MJ 2IG0A 2KEAA 1NTCA 2WTEA 1B3QA 4CYDA 3FXQA 5A2QZ 1QU3A 4F7UF 1YFHA 1LJ9A 4FCYA 4A3IJ 1I81A 4FYWB 2KRFA 2M87A 4ENKA 3LSHA 2BHZA 4BBSJ 4D7MA 4BQNA 2E3HA 4M77E 3FXRA 3TOBA 2KT0A 4HV5A 3RIRA 3B6AA 1QRYA 3MKLA 5HDGA 3LAJA 3PFYA 1Y0NA 2BKDN 3KYCB 3V4GA 2NUZA 2RHZA 4LDVA 4EIKA 1WI7A 4M78D 2W84A 3K9TA 4M6XA 2IS4A 4HX8A 1J09A 2XGEA 4I02A 4C5GA 2K4JA 1N75A 3OB9A 1XGSA 2COWA 3LSMA 5HS8A 5J1UA 1M8MA 2H09A 4AT1B 2A6TA 2CUDA 5KYYB 1Q7YU 4XBFA 2DYIA 4FT2A 1VA7A 4M7AD 1SD4A 4RKUE 2EFPA 2ZCWA 3J7AY 4BL0B 2D1HA 1Z3YA 2AHQA 1R0CB 1M90U 1B1BA 3CCVI 4IOAF 1GDTA 2F69A 2AKKA 2ID3A 2DW4A 4PLIA 4D9JA 1JGGA 3F8NA 3I55Q 3HRTA 3G6EA 1YI2T 3KCCA 3PFIA 4MTEA 2DYSH 1H9TA 1TNTA 1WNLA 4LDXA 2JS0A 1YO5C 2KQWA 2NVYJ 5EJCA 1FYNA 1ENHA 4OP0A 5IOZA 2MBFA 3ZOBA 4HBLA 2DTOA 2C06A 1Q95G 5AIPA 3BDDA 5E1ZB 2DL3A 1ZBJA 2RHIA 4C30A 5KYYA 5LJ3g 1PKSA 2MH2A 2V9PA 1HD3A 2CP0A 3F22A 4RTZA 1KIKA 3PNVA 3H5NA 1O3QA 4X1EA 1GVJA 5GMKj 3VS7A 5JVTA 3NTKA 2WY7Q 4D7NA 4FIBA 3JCMV 4C92B 2TRTA 4XLPF 4BHBA 2GFAA 2R58A 3AG1H 3ZMZA 1ODDA 4BJ6C 4HF2A 1VF9A 1M3BA 5EG2A 2JJ7A 4E7SA 1JKOC 3Q0WA 2IA0A 4QVZA 1WI3A 3EYIA 2CKKA 2MD0A 3NPFA 1GL5A 2HQNA 2YS9A 4EMSA 5H20A 3R6SA 2VI6A 4XKBA 3KPHA 5FKKA 1NYGA 3JW4A 3HSBA 2M5WA 4FW1A 2JSPA 2ZNZA 2R7FA 3LH0A 4QPOA 1HKQA 2XU8A 1W5CC 5D8KB 4OAYA 4UB8C 2IRFG 2K4YA 3HBLA 4G9YA 4L0ZB 3Q3SA 1ZG1A 2MC3A 2CV2A 2CV0A 2YHTA 5KYXB 1A31A 2EQIA 5DM7R 2FRHA 1XDUA 3GZ5A 4RAYA 1VQ4T 4XSXF 1BN5A 1E17A 4HG2A 1XD7A 2DJZA 1VQ7A 3V7SA 3WGHA 2K79A 1Z9ZA 4E70A 2PVOB 1T95A 4M78B 5B1BH 4NNJA 1IRGA 4NC6A 1YRNA 1I0CA 3K4KA 3G4SQ 1K73R 4WXHA 3R6OA 1DU0A 2Y75A 3GTMJ 4C92C 2PFBA 2Z99A 1H9GA 3QQAA 4A0YA 1ZREA 4YIRX 1RL2A 1H0MA 2DLPA 2RH2A 3JV3A 3M1EA 3L42A 3BP8A 2P0QA 2HL3A 2CUZA 4M7AB 3RZOJ 1LVKA 3T1BA 3GTQJ 3RPQA 4I98B 3V8LA 4CRIA 2HKOA 4XOTA 4C3IJ 5KYXA 4KUMA 3OQ5A 2X48A 5FKMA 1A0NB 1VQKQ 2XAQA 4YRVA 4E7IA 4EM1A 1MHNA 4JLIA 1UB9A 3E9GA 2BHYA 1XG1A 4HOBA 4BD3A 4BB7A 4C92G 4DEXA 1OPKA 2GXBA 2M1HA 4C5EA 4M78A 4OB3B 4Y28E 4ATOA 4LXCA 5GMKi 3VYGA 3JTGA 3M1CA 2DF6A 1VQ8A 1FIPA 1R4MB 2L9VA 5KE3A 3OY9A 1KYZA 5CVIA 2X4WA 2L01A 3R61A 2J6KA 2VGNA 2ZGWA 1YOVB 1OX9A 1Y56A 5LRSA 2DODA 3D5LA 1Y57A 5FLVA 1IN8A 2BXZA 3SZTA 3HB9A 5CK9A 4GFBA 3UA6A 2DPPB 2VN2A 2HKNA 1QQIA 4E47A 3CMEA 2DOAA 4HSRA 1U1SA 3HRMA 3LQQA 4BXXJ 5E3NA 2EIFA 5FROA 3HSEA 2JVGA 1GBRA 3ZQLA 4NC8A 2DFFA 4MDWA 2YR2A 3JRZA 3HJEA 2EV0A 1N8RR 3CPWS 1H92A 1SHGA 2JS2A 4B6MA 4W97A 2F5EA 5HKCA 3LSGA 1KFZA 5FB2A 2A08A 4AWXB 3DCFA 5B3SH 5C44J 1LNXA 1W1FA 1TW3A 3VS1A 1VQMQ 5LJ5g 3WTYC 1EF4A 1UDLA 4D8KA 1IXDA 3E9FA 3CC7A 3MZ8A 1IB8A 2MC4A 4C3HJ 3F8CA 1LB2A 2G6FX 1NK3P 2M2EA 1VQNQ 4NL2A 4UNOA 4M7AG 1UHSA 1WXTA 3K4LA 1GV5A 2L7MP 1IRZA 1KU9A 1KHIA 3M54A 2DTZA 5ERIA 3DBLB 3I53A 1VFCA 3F23A 1PUFA 2ZJPF 2D0NA 1MJ9A 2F1LA 3O6BB 2JZYA 3R6NA 4DYRA 4B44A 4F3QA 1LDKB 2KRMA 3JAME 1ZSZC 2DFEA 3ULQB 1WGXA 1ZRDA 1MBHA 2YRDA 3PMTA 5IP6A 4BS9A 5GJWB 3TL4X 1O9SA 4R0KA 3TO9A 5GTHC 3CPWA 3WU1B 1TWAJ 4LMYA 2Z0WA 1ETOA 1Q86U 2V1UA 3HRUA 4CO8A 4JRIA 1TQIA 3H35A 3UATA 4HLYA 4RAZA 2QQAA 2EQUA 4KH1B 3B02A 3SB2A 1V76A 2V6CA 4PSWA 2VOPA 5KCHA 1X3ZB 3JTHA 4OAZA 1R0BG 4CXFA 1W4MA 1B9MA 1KQ0A 3F72A 4A3KJ 1IZ6A 4BI8B 4HCCA 4BE2A 3OYEA 1PCXA 1TS9A 1KD1U 4B3XA 3KP2A 5DM7F 1TUDA 5J1RA 1BI1A 2E5KA 4XQ3A 3CCVQ 4PJJA 2P5KA 2F5VA 3OS0A 2PUKB 4PLLA 1AKHA 2RN8A 3HOYJ 1P92A 2EZLA 2E12A 2JTMA 2RHUA 3E2UA 3BR0A 1GHCA 2H1KA 3C18A 2NS0A 1B07A 3E5XA 2G7HA 2HYGD 3ME9A 2XHKA 1NJIU 3EH2A 2LSOA 3I58A 1RUWA 3G6ET 3IH2A 5FRMA 3C2GA 4BDYA 1UJYA 2MK5A 3C94A 3L1AA 1MSFC 3AG3H 1RLPC 2E1CA 5DM6F 5EGOB 3S1RJ 1D0ZA 3DKYA 5DCMA 1LCKA 1NLPC 1PWTA 4ETSA 2IW5A 5LRRA 3Q9VA 1Z1DA 3CEYA 1HDDC 1XDSA 1FMVA 3QWLA 5KK1A 5IYDJ 4GY5A 2ECCA 4LD9K 4DQ2A 5CQEA 2LOOA 4LIUA 1U9NA 1IV6A 1EJ9A 4JRKA 2LTOA 2ZZDA 1VQ6I 1JT6A 2WB1N 2FNPA 4EMKC 2P4RA 2WACA 2JA6J 1DPRA 1OFCX 3V8KA 2R7WA 1X01A 3JRCA 3ERMA 4LDWA 4LNPA 1NHAA 2EIMH 1VZ0A 3QAHA 3ABKH 1AVZC 4M9ZA 3A8MB 1H8AC 4YFNF 4GDFA 3JREA 1Q7YC 4IHTA 1UHFA 2KMUA 3DBHB 1BM9A 1UZCA 5EGOA 2RQRA 2L9NA 2M4KA 2G0EA 2X6OA 2ZFWA 5D8LB 5C4XJ 1IHVA 5GAOp 1CQTA 5FU7C 1K8AR 1M90C 2M9UA 5LEKA 4XRMA 2PQWA 2E1MC 1GCQA 5LJ3f 3DLLA 2O03A 4JX4A 2KYMA 8ATCB 3O8HA 2X4JA 3JRIA 2O6GE 4M78F 3ABLH 2CW0F 3OWTA 2KIQA 2VQHA 3C2BA 4FU6A 3BZ6A 1POGA 3IV5A 2DA6A 1YWPA 2MFZA 3EH1A 2CP3A 2LKPA 1BBYA 4CICA 3VRYA 2XC7A 4HVWA 2XRLA 2YDLA 4N0BA 5EYRA 3SHFA 5L3FA 4MTDA 4AFZC 1VQ7T 2G9WA 1ZGJA 4MNUA 4EEFG 3MKDA 3F8FA 3P9CA 4KA4A 1YG2A 2MLKA 2P0WA 1VQLT 3BY6A 3CZ6A 1R1TA 3RMQA 2QSGX 1QCOA 1EV7A 1MSEC 2QWWA 3GLLA 3DU5A 4BXUA 1FTZA 3BW1A 2FEIA 1QVGP 2DOEA 2ZKZA 2DX1A 4JRPA 2J5PA 2HPMA 3ZN0A 1TNSA 1JU5C 2RI2A 2I2LA 1RI7A 2GOMA 2V8KA 4RTTA 4P1WA 2XAFA 2XIGA 2K9SA 4DNCA 2XSJC 3C2HA 1OYYA 5JFRA 2UWMA 5GAOr 4J9CA 1B59A 3I3LA 1K9MU 2X0LA 3CCSI 3O2PE 2R5ZA 3JCMg 3EFSA 1MDMA 1GLNA 3PNYA 4CCJA 1NEBA 2IP2A 3L2UA 4Z8AA 4JJCA 3MZYA 2CS3A 2QLZA 2EZIA 4E7ZA 2JMWA 1S3JA 1XMXA 3IHUA 4UUSB 3IL2A 4IOCF 1K4SA 3B6CA 1BA5A 1E7OA 5FGMA 2FB7A 2DEQA 4N4NB 3FXOA 3FMSA 3HFNA 3FMRA 3BT9A 4N0AA 4C8QC 2AT1B 3CO7C 5BPDA 3G1JA 5IT9K 3MCZA 1VQ8T 3FXJA 3RUXA 2LVSA 2LRDA 2HOTA 2ZJRF 4WTOB 4A3EJ 1A6QA 4II3A 4LG3A 2LYCA 1WCMJ 1YHQI 1PC0A 2CP7A 3DWLE 3FXLA 1Y8QB 4M71A 1MGQA 5F0HA 3H3UA 1G3TA 2I8DA 3RMSA 2BUDA 5C6SA 4HF0A 1IF1A 1XNIA 1OI1A 3LGFA 1QBJA 3CMET 3DU6A 5LGUA 3GTOJ 2CW8A 1X2KA 2W85A 4M77F 1WIEA 3WVEB 1D1CA 2OU2A 4C8QG 2D6FA 2DL4A 1RAAB 3M8JA 2GOXB 5AONA 1XMAA 4XRSA 1SFXA 1UGQB 3QKJA 4BY6B 2CW7A 2GIZA 3THKA 3BLYA 1WXBA 4CC3A 2DA3A 1BW5A 4B9XA 5I11A 4N9HA 3JCMJ 1SD5A 3GWZA 3A1YA 1KU2A 4P96A 1AZGB 1MMGA 5GPCA 3HPWA 4U7BA 3W6VA 2F48A 1BKBA 3CC7T 4HZFA 4QTRA 4ENJA 5F0FA 3FHZA 1L0OC 4XM3A 1D1AA 2DLLA 3NTHA 1ULYA 1WDXA 2EQMA 1FOYA 4XTYA 2Z9OA 1KQSP 4OF1A 1U5TB 1MJBA 3FBNB 1PVEA 2JPCA 3Q5FA 2CZ0B 2MYSA 1BI3A 5LJ3j 3H9JA 1MNDA 1YLFA 4IRGA 2K5FA 3ESWB 1USTA 2B8AA 2KK4A 1FY7A 2ISZA 4O3MA 4PJNA 1F5TA 3QYFA 3M4GA 3CXCS 1OQYA 3K69A 5LJ5f 4Y3OA 3T8RA 4RB3C 1FMWA 2E60A 2QG9B 3CMAI 2HQRA 2RGVA 3JCMb 5GAN4 4BY6C 4EJTA 2EBPA 2QKMB 4ELYC 5GAEJ 4ON0A 1IJWC 4UB6C 2LREA 4LB6B 1PRMC 3LH5A 3QOEA 4D5FA 4PJOC 3MP6A 2QDYB 2HMAA 4OGCA 4F91B 4BYYA 1QCNA 4JRQA 5AIQA 3FK7A 3QZ9B 2XHCA 5IT3A 1W36D 4Q5WA 1OISA 1ZBXA 2A3SA 1WXUA 1FOWA 4LE9A 2QA4A 1V29B 4RGXA 3KP3A 3A8GB 4A63B 4M3FA 5KH6A 4CC2A 4BHPA 1YTYA 1AT1B 4R1HA 1I5OB 4VUBA 4M7DE 2HQ5A 2CGHA 4ZN3A 5GAN8 1B34B 2DL8A 4NQWA 1XN7A 4A2UA 1LUJB 5CKFA 1U5TC 1A35A 3CXCA 1ON1A 2L3SA 2QA4I 4PJOG 1QO0D 4IQ4A 1YIOA 1ITYA 2KNBB 2KY9A 1CKAA 4E6KG 4ENNA 3IAM2 2K4BA 3FDYA 1VQPI 1T39A 6PAXA 4ZYDA 2EGCA 2EJ9A 2BY2A 1MMAA 4BBRJ 4HNTA 3OW2P 1V1CA 2HWVA 2EPFA 4RA2A 1N77A 1VQ6Q 1JQQA 3HP9A 1GT0C 2HDWA 2Y9ZA 4CHUA 4GLKA 1Q86C 3BG3A 2BV6A 2L0AA 4PUSA 3HOXJ 3I56A 3JRFA 4XICA 5GAMd 3CDIA 3N97A 4JS4A 1JXSA 2CZ7B 1E0EA 3PQJA 3VYSB 1OCCH 5GANd 3ERED 3QWXX 1WZOA 3O8GA 4G6DA 5CQXA 1Q86R 4M6VA 3CTAA 4F7UE 5DV5A 1Y0UA 2M16A 2HDCA 2EAYA 1KD1C 4CYCB 2JJ9A 5M5WJ 2L2PA 3M4OJ 5GAOm 3CP2A 5K5QA 3CUQB 1YJNT 2VT2A 5AYFA 3AT1B 3LSPA 3SD4A 1ZR4A 3D5RC 4AIHA 2QYZA 1KD1R 1T56A 4Y52J 1IXSB 2K6DA 2ENMA 1NJIC 1BI2A 4BEHA 2UXNA 1FWZA 4C2MJ 1SKUB 2A7YA 1UELB 4II2A 3DLMA 5CKEA 3X20B 4R8HA 5FWBA 2JT1A 1UECA 2LC2A 3TDZC 1TUGB 2HVQA 4PNOA 1OYIA 3UKGA 1LPQA 3PE0A 3JCMP 4F7ZA 3BTIA 1Y8RB 2W57A 2K3BA 2LK2A 5J47A 3JB9G 4RCCA 1KJWA 2VOOA 2BZXA 4M9XA 2RQVA 4XTWA 5CKBA 2DQRA 3HYIA 1O3TA 3CUQA 3NAUA 3LWIA 2KMTA 2ACJA 2LCSA 2WSFE 4J9IA 3MD2A 2NXNB 3N4MA 1PM3A 4IO9F 1X6GA 5FFXA 2JUCA 3M0UA 4AUXA 4C9YA 4CCKA 3EFOB 1BR4A 4X9CA 2L02A 2Q2EB 1JTXA 2NS7A 2KSSA 1STZA 4M3DA 1K79A 1SRMA 1Y0MA 1TWCJ 1ZX6A 5HY6A 5LJ5j 3CCSQ 3QSUA 3SQNA 3EHRA 2MA3A 4E2FB 2KBTA 3K4NA 1T0JA 4FISA 1QZZA 3ONQA 3VYUB 5M3MJ 3I55A 2AHJB 2KDSA 1OU9A 2LQNA 2EK5A 1YIJT 3EUHC 2HVRA 4Q5SF 2HTJA 2PU9B 4PZJA 3OYNA 1YJWT 2OF7A 2KZGA 3ASKA 1O7LA 3DPLC 2MPXC 2P6TA 5GAMh 1YHQQ 5M3FJ 4N4IA 2PNIA 2L7KA 1TT0A 2QVOA 3K10A 3EFOA 4R56A 5GANh 2QTXA 2E6ZA 3GEZA 2Q2EA 2RV8A 3LGLA 3SHWA 4L5IA 2RQTA 5JLXA 3MKYB 1MKMA 4P9UA 2M4GA 1YW7A 1TT5B 4KITB 1R36A 2MLGA 2RNGA 2LDMA 3BC8A 2W24A 4A6DA 3ECHA 4OMPA 2A68F 1J7KA 2D8JA 4EPCA 1S6LA 3UA7A 2KDOA 4J9EA 2GNCA 1DQUA 1PDNC 3ASOH 1UJ0A 2QDLA 4UUVA 1EH8A 1W0TA 1XOVA 3RDVA 3T8TA 4JYKA 1MNEA 1MBGA 1QQJA 2LKSA 1GCPA 2FYKA 2EYYA 4JZ3A 3FX3A 4N4GA 2H1LA 1S9HA 2XGXA 1NLOC 2CUFA 3RNJA 4JX6A 1TU0B 3BQYA 5M5YJ 2DXTA 3TVTA 1UJ8A 5HLHA 2MSYA 1EZZB 4HVUA 1O3SA 4A54A 3JRGA 4ZZDA 4KMFA 2IPOB 2XF7A 4K2EA 4MEYF 5GJVB 3QBYA 5I2MA 3SWNA 1X75C 3WTUC 1SAXA 2O9LA 1M2VB 4MIMA 4JS5A 1ZYRF 5IXFA 1G59A 2H6CA 2L9SA 4KFCA 4BUGA 5LHGA 1ERDA 4IPAA 4LIVA 3UF4A 4C92E 2CUJA 2JM8A 3DXJF 4CCLA 2QUFA 3OSVA 1HA8A 5D4SA 1UMQA 1RAFB 2BY1A 1JT0A 1ARKA 2BGCA 4J9HA 4AIDA 1OR7C 3M8FA 4HX7A 4E4HA 1TLHB 2AKLA 3G4SA 3KLOA 3OYDA 1WJBA 3K70C 3QDFA 3NEUA 3CMAQ 4YIFA 1IN5A 2CS7A 3W2VA 2MAMA 3CCQQ 1IRFA 2HTSA 1WVRA 2QSHX 4IJAA 5KNLA 2AQEA 2EFNA 3S15J 2AZSA 3H9GA 3HGGA 1M2VA 3CPFA 2GTJA 3EFRA 1VQNT 2KT1A 3HUGB 3ASNH 1M4ZA 1YW9A 1T0HA 3O3KA 4M75D 1E3OC 1QMCA 2K86A 2R5AA 3CLOA 4ZDLA 2OTLI 1U06A 4MMLA 4EMGA 1OCRH 3IWFA 1VQKA 1RRJA 4DIQA 2HL5C 4KT0E 5GMKl 3LA3A 2DMUA 3KEYA 2I0NA 4RTXA 2A5WA 2LKXA 2DILA 4A3BJ 3HFOA 2VJJA 4M78E 1G3WA 2EA4A 1YCSB 4K11A 4LD5A 4J00A 2KRCA 3BJAA 3O8VA 2VJ5A 2QA4Q 3QU3A 3E97A 3WTXC 3JCUC 3CCRA 1MBFA 1X2NA 5EZGA 4WXCA 4DW6A 1UAAA 2R5MA 4RCBA 1VQPQ 2GWRA 3ZQQA 4M7DA 5DY9A 4A12A 2NUPB 3UWNA 3VSKA 3KBGA 2DFHA 4M7AE 2UV1A 2VQGA 3RJPA 1HC8A 1K61A 4MFEA 2DT6A 2EB7A 3CCRI 3HUGA 3VS6A 3CC4A 4UV9A 1Z0XA 4G7HF 1FP2A 4V2SA 3F3XA 3PIPA 2PMHA 2Y9YA 3LWFA 3FMQA 2DTHA 2KZVA 2Y0SA 4B09A 1I4K1 3ULRB 3H3ZA 2Q0OA 4C0DC 2YSRA 3NMZC 4F14A 3CC4I 3I56T 1M8VA 2LJ1A 3VB2A 1TWBA 1P7IA 3NWTA 4BJTA 1Z9CA 3S2DJ 1D5VA 4A3LJ 1T38A 1AHDP 2MMPA 1VQOQ 1W7PD 3A02A 4G7ZF 4Z6YA 4DGWB 2EQJA 3INZA 2KROA 1VQMA 2EINH 2NUPA 3FB9A 2A36A 1G5VA 5ICEA 4BY7J 2JXBA 3RZDJ 3PO3J 4HNVA 2JSCA 2DBMA 3OSFA 3HGYA 2XDBA 1Z6TA 4KIFA 5D6XA 3OL4A 1W70A 4JUVA 3VS3A 2BY0A 2CP2A 2A05A 3FK6A 1VQMI 2OD5A 3KUFA 3DPUA 4KYWA 1AA7A 2M9HA 3PM1A 4J5YA 2M0OA 3P8HA 5FKLA 2EIJH 2WWYA 1JE8A 5LLQA 5FLXE 3TGNA 2YLCA 5F0CA 4MFDA 2GQQA 3EGXA 1NZ9A 2PEXA 2VJIA 3DP7A 3IC7A 3HPHA 3JAMK 3ER0A 2ZJQF 3S1QJ 4RG8A 1FP1D 1WKMA 1OCTC 2KR3A 2QQRA 3VUZA 1VQ5I 3TP0A 2JK3A 4XLCA 5DDGA 3OYLA 2XDDA 1NG2A 1PYVA 1ETXA 3DTKA 2VBWA 1U2WA 4HRIA 3QU6A 3SFIA 1LEBA 3DV8A 3RKYA 2CJJA 2Y2ZA 4M75B 4CGZA 2PTKA 2QK0A 1QWFA 3ZQHA 1S7EA 2KISA 1WSUA 4BDZA 2DN0A 1ZKGA 1I8FA 5BNGA 1K83J 4MZTA 1AZEA 2R57A 2HS5A 2ZPGB 1LOJA 3CCVA 1QHGA 2YX4A 3MWMA 1D8JA 4ZYEA 1HBXG 2QYOA 3R0JA 3H0HA 3BR5A 1O57A 5HS9A 3G73A 1G2HA 1Z05A 3TCJA 2GZWA 2J6FA 2NUTB 2HEQA 1HW1A 2VXEA 4IL6C 1X1CA 1RADB 3M0TA 4HA8A 1N78A 4DBFA 2DEUA 1PSFA 1XGMA 1XB4A 3SXYA 1WHHA 3I55T 1I3QJ 4BQQA 5CQYA 2YXYA 1MMDA 2BYVE 1OZ3A 3J81Z 1XX5A 2EQRA 4OVAA 1ABOA 1RLQC 3IKVA 2E2HJ 3FJPA 2OC6A 2E2JJ 2COMA 2ZPFB 3H0IA 2KRNA 1WJDA 3GF5A 2CFOA 5GAN5 1QVFP 2LT4A 3QWYA 2HOEA 4QW2A 3MMYB 1FYKA 3L7WA 1QZYA 1P7JA 2E1HA 3OSSC 2D1XA 4M9SA 4J9FA 2E36A 2XB0X 5GAOn 5BOXA 1XMKA 2KAFA 1MMSA 3KYDB 1RUNA 1HKTA 1X4OA 3OYHA 2NOJB 2QENA 1N27A 3H41A 3MEXA 4C3JJ 4M75C 5D6WA 4EATA 4CZZA 1W7PB 1TBXA 4DZJA 5IAYA 2OAWA 2ZSIB 2CT4A 4IVNA 1HKSA 1D0YA 2JQ7A 3KEQA 1MV3A 4YTLA 3QODA 1ZQ1A 4LN2A 1U3OA 2K3FA 1T08B 1ETQA 2X85A 4WXDA 4A93J 2HSEB 3UT1A 5D6YA 2Y31A 2DMNA 2LR8A 4U88A 3GMEA 4WX9A 4CA0A 2XKOC 4A4HA 2M7BA 2VBYA 3VS2A 4M75G 2HU9A 5IHKA 4D1QA 5HODA 1JXOA 2ICWG 3GTKJ 1M1FA 1J3TA 5I22A 2NNNA 2N8GA 3PUBA 3VV0A 4IURA 3A8OB 3DKWA 5L3GA 3KZYA 3GVAA 2R92J 5I21A 1B8IB 4BQAA 2JN6A 1TOVA 2ELHA 2EA2A 4FE7A 3S6WA 2CMPA 1WH7A 4BE1A 4JPBW 2QAZA 2X6YA 4C92A 2A69F 4M7DF 4FW2A 1E2XA 2DVJA 4EDUA 3HOWJ 1X1DA 3NTIA 4CZCA 3MVPA 2DK3A 2A28A 3ZCOA 1X43A 4PKCC 4C0ZA 5M9OA 4X9DA 1K4TA 5DLQE 1F4KA 3G4ST 3A0HC 2W10A 2MWPA 4ELZC 2OI3A 3PIPF 2COYA 2HVSA 4MO7A 1WHUA 2DCEA 3OOPA 1VQOT 5FKOA 1BYMA 2RD1A 2KYBA 3SEZA 1F1ZA 3E5QA 2OTLQ 3OYJA 1K9AA 3A1PA 2J7IA 5EEHA 1B8IA 2KXCA 1HCRA 1GVDA 2KXDA 1T8IA 4J7FA 2XAGA 1QLYA 2OQRA 4L9NA 2ZB9A 2ZO4A 1ZGWA 1M1KC 1VQKT 4FE4A 2MG4A 4MQVA 5CVJA 3JCMQ 3JRDA 2PG4A 4XL9A 1SMYF 3M0SA 1TH7A 1QW1A 2IGNA 2ZXHA 2DYBA 1YJNI 3CQZJ 2F5DA 4AFQC 2ECBA 1M30A 2F2VA 1QVFS 1YFNA 3T9NA 2GXGA 3CCRQ 2EYWA 1Q82U 3K4MA 1GXQA 2OUMA 4I7HA 4RB0A 2JUFA 2HEOA 4AMCA 1VI0A 2UXXA 3G71I 2DPUA 4A4FA 5J4VA 2ZXIA 4KNYA 2D2WA 1G83A 4M7AA 4DZPA 1ZSZB 1DUXC 4C5HA 3PO2J 3FF5A 2QBYB 3IH3A 3CC4Q 2WC2A 3OR1C 2LH9A 1RR7A 1SC7A 1I39A 1IC8A 1SF9A 4UC4A 1D0XA 2NVXJ 2M0MA 3H8ZA 4B1RA 4FX4A 3H36A 2KL4A 4IXAA 2KPMA 2CQKA 2ZC2A 1V5FA 1ZH5A 3BG6A 3HHTB 3M7GA 2X51A 3SJMA 3H9QA 1RPWA 2HDDA 3ABMH 4RGRA 4DYCA 4U0YA 4JJDA 4FHTA 1VQMT 1QVFA 2MWOA 2KI7A 2K9GA 2V1QA 3L2RA 4C5IA 6AT1B 4JQFA 2XROA 3HOTA 3ZR8X 2DMPA 2VIXA 3TSZA 2RDPA 5FFZA 1IGNA 3CCJA 4WK8F 1ZSZA 4OWRB 4P5OA 1MBJA 2DDBA 4RB2C 2IAIA 1SFUA 2QBYA 1FTTA 3FXMA 4FM4B 4QT7A 3EUAA 4RB1A 4IUUA 3WTTC 2GBYA 1R5ID 3VYRB 3BR1A 1WWXA 2DXBA 2TCTA 4FETA 2VQLA 2LQKA 4M72A 1IUYA 1PP8F 5IXBA 1K9MC 3LSIA 3CCJI 2DPDA 3DB3A 1XSDA 1ZR2A 2CQXA 2KQRA 1SMTA 3AAFA 1EFNA 2K5LA 3C0CA 2QF7A 4F16A 2VXFA 1VQ5Q 4DJAA 3D1NI 3IAS2 1X4PA 3IRRA 1N9SA 2JNGA 2VYTA 1X2QA 3VWBA 2HZYA 5GAMe 5HDKA 1LKXA 4S05A 1ZUUA 1JUSA 4C8QD 3DBRB 2LX9A 2DL7A 2VPRA 1MMNA 4RLFA 4EM0B 3MJXA 5GANe 2A37A 2NYXA 2JMAA 4YG2F 4LK0F 2LMJA 4ZZLA 1S29A 2JA7J 4JX5A 5HLGA 4FL6A 3KP6A 5KYNA 1ZK8A 2K40A 3JRHA 4Y7NJ 4X6AJ 4EMKB 2E2IJ 2CT3A 2Q8KA 2P81A 4CCOA 3JB9J 4F52A 2Z33A 1M3AA 4EGYA 1LVAA 3BG7A 5JHUA 2VE8A 1X27A 3ZEHA 2IBDA 3OMYA 3CCVT 2XIDA 5IT9E 2K7LA 3EQLF 2IVMA 2IT0A 2FZCB 2HBPA 3G2BA 2EBIA 2FX0A 2M02A 2MF2A 3GNFB 1PHTA 1YWOA 2ZMEB 4U0VA 3OS2A 3SDZA 4QQDA 4JDSA 3V42A 3PQKA 2YUOA 3JCMf 4P55A 4I01A 4M74A 1W6XA 5FU7B 4A4KA 4ZGJB 7AT1B 4M73A 4OOIA 4HV6A 1ACMB 4AYBA 2E1MB 2CH4W 3GOXA 1BR2A 1C0WA 3T5XA 1OCPA 2HYFA 4A0ZA 3H0GJ 4RTYA 1X2MA 2OAUA 4FSSA 4EMKA 1SVLA 2X6XA 4UY8I 3DPTA 1VQ6A 1VQ9I 4HT9A 3H1CA 1FMKA 4C92F 3HHGA 4M77C 2J06A 5GAN7 4CSWA 2ESWA 1HSTA 2CYYA 1BOBA 3M8EA 4D5CA 3VJPA 1X6BA 2AXLA 4HCKA 5CIUA 2K9NA 4MDXA 3HZJA 2P4WA 1QKWA 4A53A 3GP8A 1RABB 4RBOA 5FU6C 5FWCA 3ABUA 1R58A 3CF2A 2FVUA 2MI6A 2QI2A 3MEWA 4OIRF 2RHXA 1DJ7B 2DETA 4M77G 5IN1A 1R8OB 5K1YA 3N5BB 1P4XA 4ZGEB 4KUDK 2L0KA 2ZMEC 3HSRA 1JBMA 2VGMA 4BACA 3VS0A 3RKQA 4RTWA 2H3EB 1R00A 3GF2A 2BVMA 2F2EA 4XU0A 1AWWA 4PJOD 2CGPA 4XTVA 1HQCA 2HDAA 3CD6I 1I6HJ 1IN7A 4XK8E 3TBIA 1FLIA 2DRKA 1OLTA 1Q7YR 4ZNXA 2CUBA 3CCUA 5DTDA 1T6SA 2XK0A 2RKHA 1Y71A 2DA2A 1M90R 4TVRA 4C8QB 4E6RA 2CREA 2M34A 3HTRA 4A3JJ 1PD0A 3FXKA 1WZ2A 2GIVA 2VE9A 3CCUI 4C0FA 1GUUA 4M7AF 4N4OB 5LHIA 2LRQA 3CC2A 3VSLA 1FXXA 2YPRA 1H3HA 3E6MA 5IHNA 1S72Q 2JRMA 2UZKA 4PL6A 3VODA 2NVTJ 1M1GA 2HOSA 2FHDA 4QQGA 1J5YA 1TTYA 2HR3A 4PCQA 3RI4A 3M58A 3K1NA 2R7VA 1LFUP 2FXAA 3CC2I 3CCSA 3CF5F 1MW7A 4XOPA 4OIPF 2EWNA 4HCBA 3QP6A 3KFWX 4X34A 1G8XA 2HNHA 1VQLQ 5CLSA 5GAOq 3AL0C 3CJNA 4X1VA 1J0RA 5L8RE 4FASD 3GLXA 3P7NA 4FX0A 1VIEA 2VKEA 2A07F 4P5NA 4C8QA 3PIOA 1YJNQ 1VYVA 4DEYA 4MZPA 2DBBA 3M53A 1SFEA 4EVIA 5D6FA 4QPQA 1H88C 1BU1A 2RJFA 1QKXA 2FL7A 2O3FA 3G71Q 4UXNA 3BQZA 1YHQA 4RAFA 3K2ZA 5HDNA 2QZ8A 2QEXI 2XDPA 1JJ2P 1TZLA 1JTYA 4QSHA 1QP3A 2K3YA 3U23A 3JB9D 1M3CA 2ZBKA 4PDKA 2FG0A 2LJ0A 2EJFA 3PMIA 1WJRA 3RTRA 4I0BA 2L89A 3FWEA 1IXCA 1CKBA 3I4PA 5LFAA 2EKHA 4EJOA 3QHSA 4ZYAA 1PUEE 1MUZA 2WAFA 2P4TA 1ETWA 3BR2A 9ATCB 4PK4A 1SPKA 5KCOA 4XN3A 4ZTJA 2RAEA 2DERA 1TC3C 2P5VA 2V9KA 3KX2A 1CGPA 3TSWA 2XB5A 4S0HB 2L3PA 2CH4A 1TUCA 2H6BA 1C0MA 2IEKA 3WG9A 4UUSA 4IHVA 1OX8A 1GV2A 5E8GA 3ZXSA 1S5LC 5FRNA 3X24B 5CVUA 4M6YA 4PJOB 3EPZA 4BQOA 4ORZA 1RAGB 2RI5A 2RMOA 1JO8A 2FSWA 1R71A 2DZCA 4Z88A 5CO7A 4E7HA 1IN6A 1N5ZA 5E1XA 3CCJQ 2DMOA 1LJOA 2E1OA 4OMZA 2I10A 3ECOA 3GZNB 2DIQA 1Q82C 3M3YJ 4HAMA 3GFMA 5J8CA 2V8IA 2EJGA 3GTGJ 2B0LA 1YITI 1WHJA 1IW7F 1WJSA 3HEFA 1CF7B 2ID6A 4RAGA 2X35A 3EGUA 1DU6A 2LY1A 4CC4B 4BKXA 4XNFA 4HXJA 3NGPA 3CMAA 2DYRH 5L3CA 4B48A 2OAZA 2JA8J 2V26A 2DFIA 1Q82R 4PJOA 3CCQA 1YJ9I 1JJ8C 3QJYA 4KGVB 2KHMA 2F5TX 1JKRC 4KT5C 1R77A 3TOAA 1QNTA 5CPRB 3GUDA 2E41A 2RI3A 4AG1C 3W2AA 1QVGS 2GLOA 1PD1A 3D5SC 2DXUA 2JPBA 1Z67A 1WJQA 1T0FA 5E1WA 1AHJB 2QTVA 1RC9A 3HL8A 2A0FB 3CCQI 5KYWB 4ABZA 1AOYA 4B8XA 2VV5A 2KRHA 3E7LA 3K6GA 1ZRCA 4GLMA 1LDDA 2ZFUA 1CSKA 2R3SA 2RO0A 4A0XA 1U5TA 5GAN6 1BCMA 4GGGA 2NS8A 1XTDA 2L2OA 1J9IA 5C0MA 3RYRA 1CF7A 1YX5A 1Z77A 2EFOA 4DYQA 4V2FA 3S17J 1UGRB 3J7YJ 1WHKA 2WY8Q 3QYHB 1WQWA 4RMOA 1VQPA 2O9SA 5HVQC 4NHJA 3RERA 4XAXB 3DKXA 1FYMA 4U0WA 3F8MA 3DLLF 3CCMI 2VODA 1VQ9Q 4BNCA 3EAEA 1ZSGA 4HYEA 1DP3A 2DTRA 3E6DA 3I5UA 5KVRA 3BE3A 1QVGA 1U8RA 4FQGA 3VS4A 3MQ0A 3G3ZA 3E0JB 1YNZA 2ZCFB 5KYWA 3CESA 2V1NA 4D0PA 4BU2A 3S8PA 2A3LA 2DKGA 1VQ6T 3VYHB 1ZHFA 3BDUA 4HQEA 1QVPA 4XTZA 3LNQA 4OMQA 3ZBDA 5IPAA 2M8GX 3GO5A 1IAWA 1TSFA 3ZFJA 3TU4K 3LFKA 2XAHA 2AZVA 1X19A 2EFIA 3TW7A 1OZ2A 1WH5A 1ZLMA 2G3RA 1WPYA 2LCLA 4RTVA 4XQFA 4KT6A 2ZPEB 1F36A 3IH4A 3GW2A 3OIOA 4IEJA 2DA7A 3Q0UA 4TV7A 1E3HA 1Z21A 3WODF 2L4AA 3K70D 1RAEB 3F70A 1B34A 1UHCA 2X1EA 2EILH 1LDJA 5L3DA 1KQ8A 2ZXWH 4XKCA 3BOQA 1FC3A 5ILUA 2STWA 2A6EF 2RJDA 3OMCA 2YRVA 4EMHA 2M0YA 1QPIA 4LG0B 1EKEA 1G2BA 3JB9I 3CD6Q 1DGWY 3J80K 2OTJA 1RI9A 1ABQA 1WA7A 1W2BP 2W7NA 2LQ8A 3A03A 3PIOF 4FYYB 1YX3A 4IHYA 2JUGA 3F0CA 1NYFA 1KQSS 3J7ZI 4HDUA 1J2XA 2X4YA 2PBIA 5FLXK 3QDRB 2J5OA 4KN7X 3A8HB 2FA5A 4PJLA 1YS6A 2OTJI 2RVCA 2L3DA 2H8WA 2M7AA 2GCXA 3CCUQ 2PN6A 2NRAC 2VT3A 4QWQA 4L18B 5K7HA 1FSHA 2UUZA 2L7FP 1HSJA 1I27A 1MGTA 3AKZA 1WQ2A 2XAJA 1Q81C 2JA2A 1NEGA 1NJIR 2BZYA 3CCLI 5HOOA 4CYCA 1A6IA 3E6BA 3CCEI 3S3NA 2R4GA 1FPQA 4LG0A 1X69A 3OYIA 2BTTA 1IUFA 5FD5A 2AO9A 2YUPA 1SANA 2E1NA 3S93A 3V7RA 1QP2A 3CC2Q 2VLAA 1KGSA 3I71A 2K57A 4RTUA 4NL3A 2PJRB 1H641 4QVDA 1QVUA 2E3IA 2KGTA 1KSWA 2JVVA 2VBXA 2AQFA 3AG2H 4Y17A 4GRIA 4ZGDB 1KQSA 2OA4A 2V4JC 3FJ5A 3K4JA 3EUHA 4MEXF 5CR2A 2MABA 3CCST 1Y07A 4YFKF 2CSOA 3RSNA 1E6HA 5FW9A 3K4BA 5CVRA 2DRMA 4I2OA 4XU1A 2GF7A 3FLGA 5J40A 2BE7D 2XI9A 3QZ5B 5A2QK 2O2OA 2LT1A 2BVLA 2WAEA 2FMLA 5H6RA 4PFPA 1QA6A 2FZGB 2BE5F 4KULA 2QEXQ 1KC8U 4HF1A 4ZDPA 3L2VA 5CCAA 3BZCA 5IT9Z 4M75E 1AEYA 3OW2S 1RR8C 3FRNA 3RR6A 2F4OB 4BHCA 1X6OA 1YHQT 2PJRA 3HPGA 5F04A 3OYGA 1U3EM 2MOXA 2FO0A 3S16J 4AFUC 3FBIB 1H3ZA 3WTSC 2DI3A 1I5LA 1QVTA 2DA1A 2PMZA 2RJCA 1RZ4A 2M1BA 2R7OA 5TISC 1RAHB 3GTPJ 3JRBA 1KU7A 4GXOA 4KIGA 4PJOF 2M3AA 2FRWA 3PUFA 5J8FA 2KP6A 2KIFA 1IO6A 2H3JA 1LFBA 3GTJJ 1VYTA 4Y91A 4KGZB 4PJMA 2L54A 2J6OA 4YFXF 4UHTA 1R49A 4YEJA 3KXTA 2NLUA 3ZQGA 5DCFA 1YI2I 3GXOA 3OW2A 1AU7A 1S7OA 2YLBA 2IVWA 2VKHA 4XMYA 1M1KU 3L9FA 1OQKA 2YT6A 1WHMA 2DQLA 1GRIA 4CI0C 3SFZA 4IQJA 3ZQ7A 2VC1A 2HKXA 1V5GA 2GGRA 3PGGA 1OR7A 1Z91A 2CUEA 2KT8A 5BS6A 1KONA 1OEBA 2CQQA 5DD8A 5HS7A 3DB4A 4IUTA 1ETYA 1YITQ 3R60A 1PJRA 4JP0A 4BE0A 2DD5A 1WJEA 2E5ZA 2WAQA 2V6EA 2X3XD 1K9MR 1SSFA 1JGSA 3RQIA 3ZGKA 2RJEA 2ELKA 3OL3A 3QYBA 2PLYA 2W00A 3CJQB 3VFZA 2LVMA 1YJ9Q 3E3VA 4R79A 3GFIA 2W0ZA 4V19K 3W6KB 2GA1A 3KETA 4IHXA 1UHWA 3CMAT 2BW3B 1WQ7A 4F7UG 4J19A 3EG1A 3CCQT 2VC0A 3G7ZA 2EGEA 5J39A 5GMKm 3D0SA 5EEGA 2SEMA 4C0DB 2OTLA 2Y0MA 2CV1A 2KRSA 1SFOJ 1BOAA 3R4KA 3MP8A 1WJAA 5GAN2 3GTLJ 1PSEA 4LDUA 3KE2A 2E71A 2WAQN 2HOAA 3ROUA 2CO5A 1RIOH 2WV0A 4ESFA 3MEVA 2YWWA 1R7JA 2RQPA 1UUEA 2L8DA 4N9IA 1XGNA 4J83A 1VQ4A 4Y92A 2K9QA 5FO5A 3HRSA 2QXFA 3I5RA 5FD6A 1IDYA 4GYIA 2XASA 3BY7A 2QA4T 3CCMQ 3PT9A 2H8HA 1UB4A 4XLEA 2VWFA 2BW3A 4A3GJ 1Y96B 1NG7A 1Y6IA 2A5YB 3TW6A 4ZYGA 1VQ4I 1VQPT 3WVDB 1ZG5A 5E3OA 2X4XA 3QJ6A 4F55A 1Q1VA 4B47A 2R0QC 2QGGA 2R7QA 1Z6RA 2V1DA 1C6VX 5HNFA 3WTVC 3BFMA 4EJWA 4RDUA 4QIWN 1P9QC 5GAMj 2W82A 2A61A 1H89C 1RKWA 2OBPA 3EGDB 3S3MA 2LQWA 1OCZH 3L00A 5CVVA 4LD6A 3FHNA 2IA2A 5GANj 2GA2A 3CLQA 1ZQ3P 5KYUB 2V79A 1XSVA 4AFSC 3TP3A 3IUOA 1XJWB 1GBQA 2LNBA 3ML6A 1Y39A 3X26B 1DPUA 1W1WE 1WPKA 3NRVA 1PRLC 3ZQFA 2HKQB 2VKNA 2ZJ2A 1Y96A 4U87A 3HC7A 1XCVA 1QGPA 4WF2A 2X6WA 4DBRA 2LZ6B 3TEDA 3P8BB 4J7IA 1IRXA 2YU9J 2DM1A 2FEZA 4RGUA 3A98A 4P9FA 2HQHA 4AIKA 2ABLA 4AIJA 4IIOA 3CQTA 3RBBB 2DOFA 5IH2A 3I9V2 2RREA 5FLXZ 4ZN1A 1MJAA 1FBUA 5LJ3e 3EGDA 3J80E 2IJLA 1GXPA 1J59A 2L3QA 5GMKh 4LGWA 2YRCA 2OTJQ 4EJVA 1U9OA 2DDAA 3CBOA 2Y0SN 3M9AA 5K7FA 4OMFB 1KA8A 2LP0A 1R5HA 5F1JA 1VQ5A 2H8RA 2K27A 3CCLQ 4R55A 4BI4A 3L2QA 2JTVA 3RESA 5AT1B 3CCEQ 2VKVA 2DT5A 5JVGF 1BL0A 1R22A 2IS2A 3S32A 4C2TA 2IIMA 3EG9B 2VXDA 3OS1A 3L2ZA 3BROA 1OU8A 3GBQA 3VRZA 4BI3A 1K78B 5A0GA 2KVQG 3GNGA 2AK5A 1M1EB 2VJ4A 3CUOA 3UR3C 3ZP5A 2ROLA 4ESJA 3PFSA 5J26A 3PVLA 4DA4A 1U6GA 1IHWA 2LY2A 2R7SA 4XKVA 2ED1A 3WGGA 3BPVA 2DMQA 3CBPA 4HVVA 2JTFA 3VS5A 2VKDA 3BTCA 4NS5A 3LSJA 2RQQA 4LITA 4KUIA 1EH7A 1HW2A 1YCYA 5F27A 1ZRFA 1HSQA 1WYXA 5EZHA 1G6NA 2PX9A 5CJ9A 3X25B 5KCMA 3DEWA 2WADA 1H8KA 1X1PA 5HK0A 5A2QE 2DZ9A 1FT9A 4XR6A 5LHHA 1S7AA 3LA7A 4JOMA 4UVBA 3EG9A 1L3LA 4L6V5 2WBMA 3ZMUA 1LQ1A 1K78A 1RETA 4M75A 1I07A 1FIAA 3O5ZA 5DYMA 2KE9A 2RHYA 4XTUA 1K8AU 2QQ8A 4EV0A 3QPSA 5KAIC 3RKXA 1Z7LA 1MD0A 2FE3A 2M51A 1UFMA 3EG0A 4KIBA 2P0KA 3M0PA 1ACIA 5H6QA 2DO7A 5CKTA 5BQTA 1JKPC 1P4AA 2C0IA 3OBYA 4EQQA 4HQMA 3HTSB 1XCBA 3S2WA 5J6XA 2EH3A 3TEEA 2FQ4A 2NUTA 3VU3C 1SD6A 1M2OA 2XKOA 3RDIA 4C2UA 5EF6A 2ESNA 5HLIA 5E18F 4LLNA 2RB6A 4J9DA 4XTXA 2XGDA 3KEOA 3QUIA 3ZMSA 4HDVA 4E7JA 4KN4X 3NARA 4HNUA 1YI2Q 4L9VA 3MKWB 4LB5A 4JJBA 2CFXA 3KZZA 2CP6A 2M8EA 3ZL7C 5CAIA 4J6WA 2KDZA 1UTIA 2XG8D 2XGCA 2FBHA 3OYBA 2X1CA 3OV8A 2JWTA 1JEGA 3J81E 1KQ2A 3EETA 4PFOA 3G6EI 4QQ6A 1WGSA 2HNIA 3W6JB 2KJCA 3I9QA 4DOZA 4XK4A 2DA4A 2WV1A 2Z3YA 5JR3A 3L2CA 4QVCA 5BPIA 2VUBA 1KC8C 4EGZA 3EDPA 3OOUA 5TRDA 1TTHB 5D5UB 1I3AA 1A04A 3G1MA 1I5ZA 2M30A 1W7PA 1X3WB 2G7UA 5KAFC 3HHHA 1M5Q1 4IF4A 3W2WA 4EM2A 3DEUA 3MCAB 4GCVA 5LL6S 3U2RA 1R6RA 5B5EC 3IRQA 2OQGA 3QPHA 5IP9J 1ZELA 4MGRA 3S14J 3JSOA 1IN4A 1KC8R 3VUBA 1Y1VJ 3U1KA 2ADUA 2EZHA 3QPLA 2JOYA 2BEOA 1X1BA 2VL8A 3BDLA 2M45A 2XF6A 1YRNB 4OIQF 1SRLA 5LJ5e 2K9LA 2KJBA 1FJLA 1S72A 3FM3A 3A2KA 4LDYA 3M59A 4G94A 3JCMX 3URGA 2W48A 3M07A 4M77D 2R7RA 2OTLT 3M4YA 1T98A 2ZXJA 1S72I 2B86A 1VQLA 2D1VA 2CP5A 2HXOA 3A0BC 3GBGA 5FKNA 5ED4A 3WTWC 2HD0A 1A5JA 4L5GA 3DQVC 3F6VA 2LCCA 4C8QE 2XRNA 1BR1A 4Q4ZF 2IGKA 1OMIA 4I09A 3VEPA 3S1NJ 1SSHA 1YJNA 2DU9A 1V5EA 2VXZA 4BUPA 4WWCA 5L3EA 1IXRC 3QXEB 4C0GA 2W25A 3VOEA 1YE9A 4FT8A 3T0YA 1VQLI 1HDPA 2VUMJ 3ELKA 1VQ4Q 1SFKA 2XPWA 4JLGA 2DA9A 3G71A 2IGMA 4RLQA 3W3CA 3WHBA 2YUSA 4A3FJ 3CCRT 2LF8A 1M1KR 3AG4H 2LD5A 2KLOA 1VQ7I 3C95A 1KG1A 4PGHA 4XORA 3NHNA 1MBKA 3RKWA 3KP4A 2X3WD 4Z02A 2BIVA 4A4EA 3CC4T 2Z16A 1I1GA 3I4NJ 2RM4A 4IIMA 4Z2YA 1KQ1A 2RNJA 4ZDOA 4IHSA 4F92B 1U1TA 3ZMVA 2Z5UA 4B3AA 4ESBA 2FRYA 2Y90A 4MHGA 1VOMA 1R23A 2QQBA 4G12A 4CH7A 4DBQA 3RPUD 2NWMA 2TDXA 3BWGA 2PVDB 2ZPHB 1XTAA 3KP7A 3REBB 3OMGA 3I54A 2DFUA 1OYXA 1FBQA 3FDRA 2A6HF 1SVMA 1QHHD 2OJ2A 2LBFB 4FT4A 1ORKA 2B63J 2FOKA 5DUKA 1FSEA 5LGNA 2HGCA 1OULA 1OCOH 1R5GA 4MLOA 1IGQA 2FU4A 3GZ6A 1I1JA 1RI0A 4M78C 1V3FA 4GBQA 1VQ8I 2HI3A 4BGDA 3LFUA 4H4KC 1N8RC 1TQPA 1YQAA 4EJUA 4PSXA 5D4RA 4RM2A 1JHHA 1LNWA 2F2WA 1YS7A 1EA3A 2M0CA 2RQUA 2JMCA 2ME0A 3EYYA 3JAMZ 2EYZA 1PUFB 3QOPA 2HQEA 2O8KA 1IO2A 2E19A 2ROTA 3K7AJ 1MV0B 3H6ZA 3EG3A 4QKUA 4M7AC 4YIIA 4M3EA 4JK1X 2P6SA 1WX6A 1VQ5T 3FXUA 4LLLA 3SEMA 3CMEI 4HEA2 4M75F 5IYCJ 1B4AA 4M78G 2X9HA 4PJOE 2LBFA 4XLNF 2RQWA 3GFJA 3BTJA 1T33A 2P7CB 5ICCA 1M9SA 4M77B 2HFHA 4A6EA 1ZHIA 4AVZA 3DFGA 3BG9A 3AFHA 4B4CA 2K2MA 1OJLA 2OX7A 3QRFF 3J7AF 1HK9A 3LMMA 3META 5FU6B 1ZLKA 1BC7C 2EGAA 2EZKA 3CC7I 2J05A 1UFFA 2ATCB 3FZVA 3SZPA 5H2FC 3FISA 3P8DA 2JTEA 4J6XA 1RACB 1AKHB 3ISPA 3OYKA 1WFWA 2EKOA 4OGEA 2QCOA 2EV5A 1BB9A 1X1AA 4AU7A 1APLC 3QPTA 1VIFA 2CZ1B 3EG2A 4M77A 3OYYA 5LJ3d 1VQ9A 5F1RA 3HOUJ 2RK2A 2VQCA 8AT1B 5F6FA 3Q0VA 5DLOA 4H0EA 1AWCA 2E4HA 1HW5A 2CQNA 1I50J 2FUG2 2D45A 3HSFA 3H3VK 1VTNC 5DCMB 1GXIE 4L5JA 2XVCA 2MCNA 2K3XA 3LOCA 1NPRA 3K1MA 4HX4A 1T3LA 3TQ7P 1Q81U 4LOCA 3S2HJ 2DD4A 2O31A 4KGXB 3M56A 3EHQA 1JB0E 3WXMB 4PGGA 1KZHA 1P6RA 1U8BA 2DL5A 4IUVA 2EFQA 5IOYA 3JCMe 4NUBA 1PKTA 1FNNA 2ZMEA 4IX7A 2WB1A 1REPC 1FZPB 1YN8A 1ZA2B 3MHXA 3K0LA 1MIJA 4AYBN 2EV6A 3G1OA 2CSQA 3LSKA 3G6EQ 1FBSA 4AG2C 1SAUA 3CD6A 2FMYA 3M0QA 5I2SA 2JRTA 1MZBA 2BY3A 2V1XA 2QQSA 3AL0B 4MMKA 2L9RA 1OOTA 5LGTA 1WJCA 5DD4A 2VVKA 4ZH4F 5JI6A 3RPUA 1U78A 3HKSA 3LL7A 4M4ZA 3HOZJ 2BE9B 3HTUA 2ISYA 3FKIJ 2CH0A 3UPUA 3L09A 3CDHA 4HSTA 1N25A 1WFXA 4RUGA 4XIDA 4OU0A 2DO3A 3C4SA 4Y15A 4CUGA 2QQ9A 4ANJA 2JA5J 2ED0A 3PVQA 5F08A 3FIFA 4F04B 4CCNA 1K8AC 3MN2A 2ELJA 1KQ9A 4KBMB 1HXDA 2JVHA 4O6JA 5GAMg 3OR2C 4U7DA 1V4RA 2CQ7A 1XS9A 4L0YB 1S72T 2IS6A 1HYOA 1RAIB 4BXFA 2HCKA 5GANg 1O75A 2DJQA 3BJ6A 2AS5F 2LX7A 2EVRA 2O9VA 3FEOA 4J9BA 3E6CC 4L9TA 5LJ3h 1W5SA 1Z3XA 2FBIA 2BXYA 2GAUA 1FOKA 1YP5A 4II1A 4OB1B 1G3YA 1B72B 4XU3A 1OYWA 3HL2A 3HG9A 4KDPA 1WHLA 1AWOA 4GYGA 3P9KA 4G6TB 4XLAA 2P5LC 5DUIA 3RCOA 2R5ZB 2LTPA 2MH9A 1DGRM 1ETKA 1S8NA 2QM3A 1MDMB 1GCQC 3PNTA 3H0FA 4J9GA 2QEXA 3LA2A 2VASA 4LUEA 3U9GA 4BJ5C 1FOXA 1VQ7Q 3TDUC 3M0RA 3G71T 1K6YA 5GAHJ 3GCMA 2JM9A 3S1MJ 2EYXA 3FKJA 3B73A 3NQOA 2IS1A 3CJTB 2FJ1A 1TW2A 2DK8A 2Y30A 3MPUB 3VKIA 2EIKH 3C1DA 4CC7A 4IZZA 5GMKe 3CXCP 3CCYA 3HKZA 3ZN1A 1Y1WJ 2BZ8A 5GPAA 4YELA 2DTIA 4OMNA 1I6XA 1U0JA 3REOA 3ZMDA 4A3DJ 1FX7A 1R4NB 4Y13A 1JKQC 3M5AA 4OMOA 3VPRA 4M3BA 5D5WB 2VPLA 3LSTA 1AD5A 3QO3A 4IKFA 3JSPA 2O0YA 2Y69H 1B72A 2IGOA 1JRIA 2VC8A 4JBAA 1ZGAA 2R93J 3BCBA 1D1BA 2KIUA 2OV7A 3HIFA 3DTIA 1HLVA 3CMMA 1UG1A 2GBQA 2HQAA 4ZYHA 2WA0A 2DAQA 1X58A 2XMFA 5LJ5d 3TKYA 2E70A 4UUTA 1YIJA 4LJZF 2IPQX 3R0AA 2FNAA 2OPTA 1PNJA 1YJWA 2YU3A 2R7TA 1TWHJ 2RK1A 1MH3A 5HK3A 5A0LA 2Z1DA 5J4YA 3OYMA 2PZ1A 2RA2A 1J75A 2C6YA 3QYEA 2LP5A 3ZQCA 5D7UA 3LWHA 3HKZN 1YIJI 1VQ8Q 5B1AH 5DEQA 2FPDA 1WLPB 4WCGA 1V55H 2DJNA 3BCAA 4NC7A 1IZ1A 3GX4X 1YJWI 2VBZA 1YW8A 4GO1A 3GYHX 2DXCA 5ECAA 4I76A 5IHIA 2B9SA 3CCJT 1YITA 4XLFA 2PI0A 2FQ3A 4N0AC 4A69C 4IUQA 1BIAA 2PQ8A 3KIOA 3BG5A 3A4CA 2L4MA 1ZG3A 1D09B 2MD5A 5GAGJ 4RS8A 1C1AA 4KJZA 4LUDA 1O7FA 3CMEQ 5FLMJ 1SG5A 2DAOA 2DBKA 2K5IA 1K4US 2WSEE 1YJ9A 2E7XA 2HBWA 5ICFA 1K7AA 4DBHA 3IWZA 2DK5A 5E3MA 2YUNA 5GTIC 3H5RA 3ZMTA 2X4HA 3BZKA 3H0DA 2E10A 2ESHA 1B7TA 2PVGB 3BTLA 4J6YA 4OMMA 4ZC3A 4X0GA 2JZ2A 3WE3A 2RN7A 4V2GA 5E3LA 2AXTC 1BW6A 2P7VB 3CDLA 3P9IA 2V9VA 2KFDA 1AWJA 3CO6C 1ON2A 3KP5A 2MIOA 3HXLA 4RGSA 1KHCA 3CC7Q 2HAXA 1B6AA 3LQRA 2XF5A 1R1UA 3WU0A 5KHDA 1I1SA 3C12A 2CDTA 3CPWP 2BBYA 2YSQA 2EQKA 2LG4A 4JZ4A 4LK1F 3JSCA 4A3CJ 4CDGA 3HOVJ 3SDBA 4Q48A 4KICA 2NNYA 1JHFA 4ME7A 4G6QA 2OJED 1KYWA 2XD0A 4CCMA 5ILVA 2F5FA 3CCMA 1SD7A 2K5CA 1P4WA 4XRSG 3TMOA 5LBQA 5K5OA 4I99C 1AWXA 3MZHA 2E35A 1BJAA 4G8XA 5EEAA 2O7OA 1BBZA 5J1YA 4NQWB 3OYCA 3JRAA 1JJ2S 4FYVB 3E1SA 1LPLA 1F1BB 5JHFA 5GADJ 1VQ9T 3GIBA 2CU7A 4FTHA 1K73C 5LJ5h 4IUPA 3OIPA 2GFUA 1NG6A 4ENMA 4W1UA 2K2VA 2QASA 2DMTA 4FSXA 5J3BA 3OYFA 1S1NA 2CRGA 4E7LA 3F6OA 1WHGA 3BR6A 1JUPA 2Y4XA 1D5YA 3D7SB 1UHMA 3MAJA 1T0FC 2E7WA 3SYTA 4S04A 5EG0B 5IP7J 4BY1J 4JJNK 2V7FA 4XRFA 3F8BA 5L23A 4HT8A 2XSDC 1ZN2A 1HOMA 4HCZA 4L5EA 5EDNA 3UDCA 1NK2P 3QG1A 1TXQA 2VONA 2EFWA 2P0PA 1EH6A 2HYJA 3TO7A 4RM3A 3OS5A 1JJ2A 2SRCA 3LLRA 3DKMA 2E5NA 5IYBJ 2HZTA 3SDGA 4XONA 3K2AA 2LLKA 2X1DA 4BAYA 1SEUA 1FYLA 1IG7A 1E6GA 2QSFX 2C0OA 3SFMA 3TREA 3CD6T 5C4JJ 3I35A 1ZA1B 4OINF 4DOWA 3LSRA 2FPEA 2Y4YA 2LJ3A 3MO8A 1T2KA 5GAN3 4ZJZA 4XKWA 1D3YA 5TJJA 4FYXB 1RNLA 4C8QF 5A0DA 5B66C 1OKRA 3G1LA 4BEHB 1DDNA 2E65A 3IKTA 5LD2C 1X3UA 1SVOA 1UGSB 2PMUA 3EUKL 1ZUYA 2F5KA 2Q1ZB 3IQLA 2LF7A 1XSXA 2R7DA 2DXIA 1VNDA 2D0QB 2P8TA 5EG0A 2XPUA 3WTZA 3CCLA 2LNVA 3CCUT 1PP7U 3CCEA 5K7ZA 4I0AA 2ZNYA 1NE8A 2V8JA 1BI0A 3I56I 1NBEB 1R9TJ 1GFDA 1WJ5A 4KH0B 2FOWA 3M9QA 1ZARA 2FBKA 2IA1A 2RC4A 1SEMA 1XPXA 2O8XA 3QYGB 3CC2T 2CSIA 3GPLA 4KMUX 1VYUA 3QP5A 3K1PA 2XAUA 3F9KA 4KISA 1IREB 3V8JA 2L5QA 3JCMd 3MEAA 1Q81R 2CWEA 5HLTA 1TWGJ 2ZPBB 5GAOl 2NVUB 4IRIA 4RG2A 3FIWA 2STTA 4KRTA 4Y33A 3J7AO 3N05A 4I6ZA 3JCMW 2Z2SB 3ZQIA 3KYLA 4AM3A 1K1ZA 4UVAA 4HLXA 1BCOA 4OB2B 2GTOA 1YBYA 2QEXT 1GFCA 3E19A 3UNGC 1Q1HA 5GAMf 3H5AA 4MQ9F 2KKOA 3JR9A 2O61A 2R7UA 4J8OA 1RESA 3A8LB 1KK7A 4F7UB 2FPFA 2LDUA 5BMZA 2I5UA 1BIBA 3CJRB 5ILSA 1BC8C 2V1RA 3M57A 5GANf 2O88A 2IXSA 3A01B 1W0UA 4M7DD 5L3BA 5FJ8J 5E17F 4BH9A 1ZAOA 3F21A 3SZGA 1JXMA 5D6EA 2LNHB 4ZTFA 4WCIA 1R1VA 3SEQA 3CUQC 5DS9A 5M5XJ 1KU3A 4J01A 1FEXA 2JW4A 2GXAA 3AHUA 2ZAEA 3HOSA 2HPIA 4NDLA 5D5VB 1Y7XA 3OBWA 5ICGA 4IRHA 4ESRA 3LYIA 3TO6A 1YYVA 2F4MB 3H92A 2L3RA 1NPPA 4O5VA 2K9MA 2RPNA 4LFUA 5K5RA 4XU2A 1YI2A 1O3RA 2ME6A 2YX7A 4B9WA 1YIJQ 1IV8A 2XICA 3ABTA 4UV8A 4Q47A 3A5ZB 1XGOA 1O4XA 1YJWQ 1A36A 1ONVA 3C7JA 3MFKA 2OZUA 4XSZF 1SHFA 3TQNA 4F17A 4MZMA 3I55I 1K73U 1W2BS 3DTEA 3J81K 5CQGA 1F43A 2WSCE 5E8IA 3L2WA 1D8KA 3L1PA 3A01A 1UCRA 4G7OF 1PG5B 1W4SA 2H94A 4UVCA 5LEJA 2GM4A 2HQXA 1XC5A 2K7AA 1JJ6C 4NB5A 1BJZA 2PMZN 3PSIA 3SWNB 1K76A 2EYQA 4NOYA 3OIQA 1HF0A 4HKEA 3PJRA 2E34A 5CYVA 1T3SA 1YITT 2NAZA 2LC4A 1XQHA 3S3OA 2GQVA 2P84A 2R7ZJ 2K02A 1OPCA 1OV3A 2EPDA 1W36C 1VUBA 3RYPA 1V54H 3WGIA 2FD5A 3I4MJ 3MKZA 2EW3A 3JCMh 3Q9SA 1QZEA 1YJ9T 1DP7P 1EX4A 5GP9A 3CBMA 4IHWA 1B9NA 1LEAA 2DT7B 1QWEA 1UGVA 1WJFA 1HJDA 3IP4B 3LX7A 3REAB 1W2BA 2KIMA 2LFBA 3BJOA 1JI8A 2HSPA 1QCFA 3BR3A 1K0SA 2E6NA 3DF8A 3Q1JA 3PSFA 4QLCU 1K0XA 3U21A 2CZ6B 4RMNA 3GFLA 3HM5A 3PL8A 1G4DA 3LAPA 3PNWC 3JB9F 3C3WA 2DNUA 3JCMc 2PUOB 5D5XB 3MP1A 2JT4A 2F6CA 2QKLB 4E7KA 4L9JA 3X28B 5JLWA 2CYZB 3SWNC 2YUQA 4PJ0C 3KLNA 4OIOF 1ZLJA 4Z89A 1F9NA 1UGPB 3CCMT 1N8RU 3I5SA 3BPXA 5CKDA 3U1DA 2K3PA 2PJPA 3COAC 1AOJA 1N6AA 1N9RA 1UEBA 4DOVA 1Z7UA 1VQOA 3OYAA 2R5YB 4M7DB 5TGTA 3WE2A 2BZTA 4OMLA 2W4SA 2DJIA 2D5VA 3G4SI 3E5UA 2CG4A 4PFZA 4AC0A 2HXIA 2NOGA 2OCEA 5E20A 3HDDA 4D8DA 4OMYA 1MH4A 2HZDA 2MW8A 1VQOI 2JN0A 1IGUA 1LE8B 1ZTRA 1Z9QA 4HW0A 4HPQA 1USSA 2XPVA 2D8HA 4L59A 1JUMA 1E3PA 1MBEA 2F4IA 2LY9A 2OCCH 2COBA 2VB6A 5J3LA 3X2QH 3KZIC 2FZKB 1TQMA 2O01E 1TL8A 1IDZA 2L7ZA 3OA6A 3MEUA 5EC7A 1TWFJ 4M3GA 1VQKI 4A5MA 1TG0A 2O4XB 3I59B 1ETVA 2H27A 3I0TA 4AVPA 3H9NA 5CKHA 2B7EA 4XLHA 4ASNA 2R5YA 5KE2A 3JB9H 1RUOA 1M27C 1P2FA 2XKPA 5F64A 2ETHA 3J80Z 2GQIA 2K85A 2W1OA 3PTAA 1D3BB 5IY5H 3FC3A 3WU2C 4B43A 3CMYA 9ANTA 1NM7A 3M55A 1W5TA 2C0TA 2D9TA 2MGQA 5C3EJ 4NBQA 5HNHA 4F93B 1LE8A 2AIRB 4N4HA 4A4GA 4A5NA 2BOLA 3KFVA 2OTJT 1WI9A 3DEEA 1BK2A 2RNAA 4M7DC 2RF0A 3OSGA 2ZSHB 5KYUA 2QGUA
chains in the Genus database with same CATH topology
2XDVA 3VYTB 3CP8A 1UG0A 3V7CA 3QIIA 3CCLT 2O4XA 2R7XA 3CCET 1G3SA 4Y4RA 3RQ4A 4OB0B 4ITVA 3DLAA 4C92D 4XN0A 4D6WA 2ZPIB 3VDXA 3NWSA 1D3BA 1EIFA 4M7DG 3NFCA 1VQNA 2DIGA 2E5QA 2E64A 2O5RA 1LFPA 3LW5E 3K4CA 3ZRGA 2DVEA 2IG0A 1QU3A 4F7UF 1I81A 3LSHA 4BQNA 4M77E 3RIRA 3PFYA 2BKDN 2RHZA 4M78D 2IS4A 1J09A 4C5GA 1N75A 3OB9A 3LSMA 2A6TA 1Q7YU 4FT2A 4M7AD 4RKUE 3J7AY 4BL0B 1Z3YA 1M90U 2F69A 4PLIA 4D9JA 1YI2T 3HRTA 3G6EA 4LDXA 1WNLA 2KQWA 4OP0A 2DTOA 2C06A 2RHIA 5LJ3g 4C30A 3PNVA 3H5NA 5GMKj 3NTKA 2WY7Q 4FIBA 3JCMV 4C92B 2GFAA 2R58A 4BJ6C 5EG2A 4E7SA 4QVZA 2CKKA 2MD0A 4XKBA 3HSBA 2JSPA 3LH0A 4QPOA 2XU8A 4OAYA 2K4YA 2CV2A 2CV0A 2YHTA 5DM7R 1VQ4T 4HG2A 2DJZA 1VQ7A 3V7SA 2PVOB 1T95A 4M78B 4NNJA 3K4KA 3R6OA 4C92C 1RL2A 2RH2A 3L42A 2P0QA 2CUZA 4M7AB 1LVKA 3V8LA 4CRIA 4XOTA 3OQ5A 4YRVA 1MHNA 4E7IA 4JLIA 4BD3A 3E9GA 4C92G 4BB7A 2M1HA 4C5EA 4M78A 4OB3B 4Y28E 4ATOA 5GMKi 3VYGA 3M1CA 1VQ8A 5KE3A 3OY9A 5CVIA 2X4WA 2VGNA 2ZGWA 1Y56A 3D5LA 5CK9A 4E47A 2DPPB 3CMEA 2DOAA 4HSRA 1U1SA 2EIFA 5FROA 2JVGA 4NC8A 4MDWA 3JRZA 3CPWS 5HKCA 3LSGA 1LNXA 5LJ5g 3E9FA 3CC7A 2MC4A 4NL2A 4M7AG 3K4LA 1KHIA 3M54A 4B44A 4F3QA 1LDKB 3JAME 3PMTA 4BS9A 3TL4X 1O9SA 3CPWA 1Q86U 3HRUA 4JRIA 3H35A 2QQAA 2EQUA 3SB2A 4PSWA 5KCHA 4OAZA 1IZ6A 4BI8B 4BE2A 3OYEA 1KD1U 4B3XA 4XQ3A 1BI1A 4PJJA 2PUKB 2F5VA 3OS0A 4PLLA 1P92A 2JTMA 2E12A 2RHUA 3ME9A 1NJIU 3G6ET 5FRMA 3C2GA 4BDYA 3C94A 3L1AA 1D0ZA 3DKYA 3CEYA 4GY5A 1FMVA 4LD9K 4DQ2A 5CQEA 2LOOA 4LIUA 4JRKA 2LTOA 2ZZDA 4EMKC 2WACA 3V8KA 2R7WA 1X01A 4LDWA 1VZ0A 3A8MB 1Q7YC 2KMUA 2L9NA 2M4KA 5GAOp 5FU7C 1M90C 2M9UA 5LJ3f 3DLLA 2E1MC 2X4JA 4M78F 3OWTA 2VQHA 4FU6A 2MFZA 2XC7A 1VQ7T 2P0WA 3CZ6A 3RMQA 3DU5A 3BW1A 4JRPA 2V8KA 2HPMA 4XK8E 2RI2A 2I2LA 2GOMA 4P1WA 2XSJC 3C2HA 5GAOr 2UWMA 3I3LA 1K9MU 3JCMg 3EFSA 1GLNA 3PNYA 4CCJA 3L2UA 2CS3A 4E7ZA 4F7UE 4LDVA 2FB7A 2DEQA 4N4NB 3HFNA 4N0AA 1VQ8T 4C8QC 3RUXA 2LRDA 4LG3A 4II3A 2LYCA 3DWLE 1MGQA 2I8DA 1G3TA 3RMSA 2BUDA 5C6SA 1XNIA 3LGFA 1OI1A 3CMET 3DU6A 2CW8A 4M77F 3WVEB 2D6FA 1D1CA 4C8QG 3M8JA 2GOXB 1UGQB 3QKJA 4BY6B 2CW7A 3BLYA 4B9XA 3JCMJ 3A1YA 1MMGA 3HPWA 4U7BA 1BKBA 3CC7T 4XM3A 1D1AA 3NTHA 2EQMA 4XTYA 4OF1A 3FBNB 2CZ0B 2MYSA 1BI3A 5LJ3j 3H9JA 1MNDA 2K5FA 2B8AA 2KK4A 4PJNA 3CXCS 3QYFA 3M4GA 5LJ5f 4Y3OA 1FMWA 2E60A 3JCMb 5GAN4 4BY6C 2QKMB 4ELYC 2LREA 4PJOC 3QOEA 3MP6A 2QDYB 4OGCA 4F91B 4JRQA 3QZ9B 2XHCA 1W36D 4Q5WA 1ZBXA 2QA4A 1V29B 3A8GB 5KH6A 4VUBA 4M7DE 2CGHA 4ZN3A 5GAN8 1B34B 5CKFA 3CXCA 4PJOG 4IQ4A 2KY9A 2MAMA 4E6KG 3IAM2 3FDYA 2EJ9A 4HNTA 1MMAA 1N77A 3HP9A 2HDWA 4GLKA 1Q86C 4PUSA 3I56A 5GAMd 4JS4A 2CZ7B 1E0EA 3VYSB 5GANd 5CQXA 2M16A 2EAYA 1KD1C 5GAOm 3CP2A 5AYFA 3SD4A 3D5RC 1NJIC 1BI2A 2A7YA 4BEHA 1FWZA 5CKEA 3X20B 1UELB 4II2A 3DLMA 2LC2A 2HVQA 4PNOA 3JCMP 3JB9G 4RCCA 4XTWA 5CKBA 3LWIA 2KMTA 2WSFE 3MD2A 4C9YA 4CCKA 1BR4A 4X9CA 2Q2EB 2KSSA 5HY6A 5LJ5j 3QSUA 3K4NA 3ONQA 3VYUB 3I55A 2AHJB 2KDSA 1YIJT 3EUHC 2HVRA 2PU9B 1YJWT 3OYNA 3ASKA 3DPLC 5GAMh 4N4IA 2L7KA 1TT0A 3K10A 4R56A 5GANh 2QTXA 2E6ZA 3LGLA 3MKYB 2M4GA 4KITB 2RNGA 2LDMA 3BC8A 4EPCA 2KDOA 1DQUA 3JCMf 1XOVA 1MNEA 2FYKA 4N4GA 1S9HA 2DXTA 4A54A 1K9MC 5I2MA 2XF7A 3QBYA 3SWNA 1X75C 4JS5A 1G59A 2L9SA 4BUGA 1ERDA 4LIVA 4C92E 2CUJA 4CCLA 3OSVA 1HA8A 1OR7C 4E4HA 3G4SA 3OYDA 1WJBA 3K70C 2CS7A 3W2VA 5KNLA 2AQEA 3H9GA 3CPFA 3EFRA 3HUGB 1M4ZA 4M75D 2R5AA 4ZDLA 4MMLA 4EMGA 1VQKA 4KT0E 4DIQA 5GMKl 3KEYA 2A5WA 4M78E 2VJJA 3HFOA 1G3WA 4J00A 2KRCA 3O8VA 2VJ5A 3CCRA 1UAAA 4RCBA 2R5MA 3ZQQA 4M7DA 5DY9A 3UWNA 3VSKA 3KBGA 4M7AE 2UV1A 2VQGA 2DT6A 3CC4A 4V2SA 3PIPA 2DTHA 2KZVA 2Y0SA 4C0DC 1I4K1 1M8VA 3I56T 3NWTA 4BJTA 2MMPA 3INZA 4DGWB 2EQJA 1VQMA 3FB9A 1G5VA 5D6XA 3OL4A 3KUFA 3DPUA 1AA7A 4J5YA 2M0OA 3P8HA 5FLXE 2YLCA 1NZ9A 2VJIA 3HPHA 3ER0A 4RG8A 2QQRA 3VUZA 4XLCA 3OYLA 2XDDA 1PYVA 3DTKA 4HRIA 4M75B 3RKYA 4BDZA 1I8FA 4MZTA 2R57A 2ZPGB 1LOJA 3CCVA 1QHGA 3TCJA 2VXEA 1X1CA 4HA8A 1N78A 1PSFA 3I55T 4BQQA 5CQYA 1MMDA 1OZ3A 4OVAA 3FJPA 2OC6A 2ZPFB 1WJDA 3GF5A 2CFOA 5GAN5 2LT4A 4QW2A 3MMYB 2E1HA 3OSSC 5GAOn 2KAFA 1X4OA 3OYHA 2NOJB 4M75C 1N27A 5D6WA 4EATA 5IAYA 2ZSIB 1D0YA 4YTLA 3QODA 1ZQ1A 2X85A 3UT1A 5D6YA 2XDBA 2XKOC 4CA0A 4A4HA 2M7BA 4M75G 2HU9A 4D1QA 1M1FA 3PUBA 3VV0A 4IURA 3A8OB 5I21A 3S6WA 2CMPA 4BE1A 2X6YA 4C92A 4M7DF 4EDUA 1X1DA 3NTIA 4CZCA 2DK3A 4PKCC 3ZCOA 5M9OA 4C0ZA 4X9DA 5DLQE 3G4ST 2MWPA 4ELZC 2HVSA 2DCEA 1VQOT 1BYMA 2RD1A 3SEZA 3OYJA 4J7FA 1M1KC 1VQKT 3JCMQ 4XL9A 1TH7A 1QW1A 2IGNA 2ZXHA 1QVFS 3T9NA 1Q82U 3K4MA 2OUMA 2JUFA 4A4FA 2ZXIA 4M7AA 4C5HA 3OR1C 2LH9A 4UC4A 1D0XA 2M0MA 3H8ZA 2KL4A 2KPMA 1V5FA 3BG6A 3HHTB 2X51A 3H9QA 1VQMT 1QVFA 2MWOA 4C5IA 3L2RA 4JQFA 3HOTA 3ZR8X 2VIXA 3CCJA 1VQNT 4OWRB 4P5OA 3M5AA 4FM4B 4HCCA 3EUAA 4IUUA 3VYRB 2DXBA 4FETA 2LQKA 2VQLA 3LSIA 3DB3A 2KQRA 2K5LA 2VXFA 4DJAA 3IAS2 1X4PA 1N9SA 2JNGA 2VYTA 3VWBA 5GAMe 1LKXA 4C8QD 2LX9A 1MMNA 4RLFA 5GANe 4FL6A 4EMKB 4CCOA 3JB9J 4F52A 3BG7A 3ZEHA 3OMYA 3CCVT 2XIDA 2HBPA 3G2BA 2MF2A 3GNFB 3OS2A 3SDZA 4QQDA 4JDSA 3V42A 4A4KA 5FU7B 4ZGJB 4AYBA 2E1MB 3GOXA 1BR2A 2OAUA 4EMKA 2X6XA 4HT9A 3DPTA 1VQ6A 4C92F 4M77C 4CSWA 1BOBA 3VJPA 5CIUA 4MDXA 3GP8A 4A53A 5FU6C 3CF2A 2FVUA 2MI6A 2QI2A 3MEWA 2RHXA 1DJ7B 4M77G 5IN1A 1R8OB 4KUDK 3N5BB 4ZGEB 1JBMA 2VGMA 4BACA 2BVMA 4XU0A 4PJOD 4XTVA 3TBIA 1OLTA 3CCUA 2XK0A 1Y71A 4TVRA 4C8QB 4C0FA 4M7AF 4N4OB 3CC2A 2LRQA 3VSLA 1FXXA 4PL6A 1M1GA 2FHDA 4QQGA 3M58A 2R7VA 3CCSA 1MW7A 4XOPA 2EWNA 4HCBA 4X34A 1G8XA 2HNHA 5GAOq 3AL0C 5L8RE 4FASD 1VIEA 3GLXA 4P5NA 4C8QA 3PIOA 4MZPA 3M53A 4QPQA 2RJFA 2FL7A 1YHQA 2XDPA 1TZLA 2K3YA 3JB9D 2EJFA 3PMIA 1WJRA 3RTRA 2L89A 5LFAA 3QHSA 4ZYAA 2P4TA 2WAFA 4PK4A 5KCOA 4XN3A 4ZTJA 2V9KA 3KX2A 3ZXSA 5FRNA 3X24B 4PJOB 3EPZA 4BQOA 2RI5A 2DZCA 5CO7A 4E7HA 1LJOA 2DIQA 1Q82C 2V8IA 2EJGA 1WJSA 2X35A 2LY1A 4XNFA 3CMAA 4B48A 2V26A 4PJOA 3CCQA 3QJYA 2KHMA 2F5TX 5CPRB 2RI3A 2E41A 1QVGS 3W2AA 3D5SC 2DXUA 1WJQA 1AHJB 3HL8A 2VV5A 2KRHA 3K6GA 2ZFUA 2RO0A 5GAN6 1XTDA 2L2OA 5C0MA 1YX5A 1UGRB 2WY8Q 3QYHB 1WQWA 4RMOA 1VQPA 5HVQC 3RERA 4XAXB 3DKXA 3EAEA 1DP3A 1QVGA 1U8RA 3E0JB 2ZCFB 3CESA 2V1NA 2DKGA 4BU2A 3S8PA 2A3LA 1VQ6T 3VYHB 3ZBDA 3BDUA 4XTZA 1QVPA 3ZFJA 3TU4K 1X19A 2EFIA 1OZ2A 2G3RA 1WPYA 2LCLA 4XQFA 4KT6A 2ZPEB 3L2VA 4EMHA 3K70D 1Z21A 3F70A 1B34A 2X1EA 4XKCA 3OMCA 2RJDA 2YRVA 3JB9I 1DGWY 2OTJA 2W7NA 2LQ8A 1YX3A 2JUGA 1KQSS 2X4YA 3QDRB 3A8HB 4PJLA 2M7AA 2GCXA 2UUZA 3AKZA 1Q81C 2JA2A 5HOOA 3S3NA 2R4GA 3OYIA 3S93A 1QP2A 3V7RA 2VLAA 4NL3A 2K57A 2PJRB 1H641 4QVDA 2JVVA 2AQFA 4GRIA 4ZGDB 1KQSA 2V4JC 5CR2A 3K4JA 3CCST 2MABA 1Y07A 3RSNA 3K4BA 4XU1A 2GF7A 3FLGA 2XI9A 3QZ5B 2LT1A 2BVLA 2WAEA 1KC8U 4PFPA 4KULA 4ZDPA 5CCAA 4M75E 3OW2S 3FRNA 1YHQT 1X6OA 2PJRA 3HPGA 3OYGA 3FBIB 1H3ZA 1I5LA 2PMZA 2RJCA 2R7OA 4PJOF 2M3AA 2KP6A 2H3JA 4Y91A 4PJMA 4YEJA 3KXTA 2NLUA 3OW2A 1M1KU 2YLBA 2IVWA 2VKHA 4XMYA 4CI0C 4IQJA 1V5GA 3PGGA 1KONA 3DB4A 4IUTA 1PJRA 4BE0A 2DD5A 1WJEA 2E5ZA 2WAQA 2V6EA 1SSFA 3ZGKA 2RJEA 3OL3A 3QYBA 2W00A 3CJQB 2LVMA 4R79A 3CMAT 2BW3B 1WQ7A 4F7UG 3CCQT 3G7ZA 5J39A 5GMKm 2OTLA 4C0DB 2CV1A 3MP8A 1WJAA 5GAN2 1PSEA 4LDUA 3MEVA 4J83A 2L8DA 1VQ4A 2QXFA 3HRSA 3BY7A 2QA4T 3PT9A 1UB4A 4XLEA 2BW3A 1Y96B 1NG7A 1Y6IA 1VQPT 3WVDB 2X4XA 3QJ6A 4F55A 4B47A 2R7QA 5HNFA 3BFMA 1P9QC 5GAMj 2W82A 3S3MA 4LD6A 3FHNA 5GANj 3IUOA 3X26B 1Y96A 4U87A 3HC7A 4DBRA 4J7IA 2X6WA 3P8BB 4WF2A 1IRXA 3I9V2 2RREA 4ZN1A 5LJ3e 3J80E 5GMKh 3CBOA 4OMFB 1VQ5A 4R55A 4BI4A 3L2QA 3RESA 2IS2A 3S32A 4C2TA 3L2ZA 2VXDA 3OS1A 4BI3A 5A0GA 2KVQG 3GNGA 3PFSA 2VJ4A 3UR3C 5J26A 4DA4A 2LY2A 2R7SA 4XKVA 3CBPA 2JTFA 2VKDA 4NS5A 4KUIA 2RQQA 4LITA 1YCYA 3X25B 5KCMA 5HK0A 2WADA 5A2QE 2DZ9A 4XR6A 4JOMA 4L6V5 2WBMA 4M75A 2RHYA 4XTUA 1K8AU 3RKXA 1Z7LA 2P0KA 3OBYA 5CKTA 3TEEA 3VU3C 4C2UA 2RB6A 4XTXA 3QUIA 4E7JA 4HNUA 3MKWB 5CAIA 4J6WA 2XG8D 3OYBA 2X1CA 3J81E 1KQ2A 4PFOA 4QQ6A 1WGSA 2HNIA 4DOZA 1KC8C 4QVCA 2VUBA 3OOUA 1M5Q1 3W2WA 3MCAB 5LL6S 1QP3A 1R6RA 3QPHA 1ZELA 3VUBA 2JOYA 3BDLA 1X1BA 2VL8A 5LJ5e 5GAN7 2XF6A 1S72A 2K9LA 4LDYA 3A2KA 3M59A 3JCMX 3URGA 4M77D 2R7RA 2OTLT 3M4YA 1VQLA 3GBGA 2HD0A 4L5GA 3DQVC 1K73C 2LCCA 4C8QE 1BR1A 2IGKA 1YJNA 2VXZA 1V5EA 4BUPA 4C0GA 3QXEB 1YE9A 1SFKA 4JLGA 3G71A 2IGMA 4RLQA 3W3CA 3CCRT 2KLOA 3C95A 1KG1A 4XORA 3RKWA 4Z02A 2BIVA 4A4EA 3CC4T 2Z16A 2RM4A 1KQ1A 4ZDOA 4F92B 1U1TA 2Y90A 2QQBA 4CH7A 4DBQA 3RPUD 2PVDB 2ZPHB 3OMGA 1OYXA 3FDRA 1QHHD 2LBFB 4FT4A 4MLOA 1RI0A 4M78C 4BGDA 3LFUA 4H4KC 1N8RC 4PSXA 4RM2A 1EA3A 2HQEA 3H6ZA 4M7AC 1VQ5T 4M75F 4HEA2 4M78G 4PJOE 2LBFA 1M9SA 4M77B 1ZHIA 4AVZA 3AFHA 3J7AF 1HK9A 3LMMA 3META 5FU6B 3P8DA 4OGEA 4J6XA 2EKOA 3OYKA 1X1AA 4AU7A 1VIFA 2CZ1B 4M77A 3OYYA 5LJ3d 1VQ9A 2RK2A 2VQCA 5DLOA 2FUG2 2K3XA 1NPRA 1Q81U 2DD4A 3M56A 1JB0E 3WXMB 4IUVA 3JCMe 4NUBA 4IX7A 2WB1A 3MHXA 3LSKA 1SAUA 3CD6A 5I2SA 2QQSA 3AL0B 4MMKA 1WJCA 3HKSA 3LL7A 3UPUA 2CH0A 4HSTA 1WFXA 2DO3A 3C4SA 4CUGA 4ANJA 2QQ9A 3FIFA 1K8AC 4CCNA 2ELJA 4KBMB 1HXDA 2JVHA 4O6JA 5GAMg 3OR2C 1S72T 2IS6A 4BXFA 5GANg 1O75A 3FEOA 5LJ3h 1Z3XA 1VQLT 4II1A 4XU3A 4OB1B 1G3YA 3HL2A 3HG9A 4XLAA 4G6TB 1YJNT 3M57A 4JUVA 3RCOA 2PQWA 1DGRM 3PNTA 2QEXA 2VASA 4BJ5C 3G71T 1K6YA 3FKJA 2IS1A 3VKIA 5GMKe 4IZZA 3HKZA 2DTIA 4YELA 1U0JA 1FX7A 2VPLA 3QO3A 4IKFA 1JRIA 2VC8A 2IGOA 3BCBA 1D1BA 2OV7A 3DTIA 3CMMA 2HQAA 2DAQA 2WA0A 5LJ5d 2E70A 1YIJA 1YJWA 2R7TA 2RK1A 5HK3A 5A0LA 2Z1DA 2RA2A 3OYMA 3QYEA 3LWHA 4NC7A 3BCAA 2DXCA 3CCJT 1YITA 4XLFA 4N0AC