4PLIA

Structure of the chromodomain of mrg2 in complex with h3k36me3
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
57
structure length
57
Chain Sequence
HFEEGERVLAKHSDCFYEAKVLKVEFKDNEWKYFVHYIGWNKSWDEWIRLDCLLKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords At1g02740
publication title Regulation of arabidopsis flowering by the histone mark readers MRG1/2 via interaction with CONSTANS to modulate FT expression.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription
total genus 10
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pliA00
1H3ZA 4CRIA 4IUUA 2LVMA 2K3XA 4OVAA 4PLIA 2EQKA 4BE0A 4E7KA 4IURA 3ME9A 3MP6A 4FU6A 3Q1JA 3QKJA 4IUPA 3SD4A 5KH6A 3OYEA 3FC3A 2VYTA 2M16A 3UT1A 3QJ6A 2M1HA 4FL6A 2R5MA 2EKOA 3QBYA 3UWNA 3L2UA 4PL6A 2FHDA 1OI1A 3L2QA 3OMGA 2GF7A 4GY5A 4HCZA 3EAEA 4B9WA 4C5GA 3O8VA 2XDPA 2M0OA 1WJQA 5FROA 4E7JA 5D6YA 4BDYA 1WGSA 2BUDA 3LH0A 5KCOA 4IUQA 3E9FA 3PMIA 5D6WA 2RO0A 4E7IA 1OZ2A 2EQUA 2O4XB 2BIVA 2JTFA 4N4HA 4C5IA 3MEUA 2BKDN 2L3RA 1OYXA 3LGLA 3P8HA 2B8AA 3OYFA 2WACA 3OYKA 3NTHA 2R5AA 3DB4A 2RHZA 3LX7A 4QQGA 1WJSA 3OYCA 3LYIA 4IUTA 3OYHA 1MHNA 3FDRA 4Q5WA 4QQDA 4A4GA 2EFIA 2RI3A 3L2RA 3MP8A 4BDZA 3FEOA 4X34A 2F5KA 3L2WA 3OQ5A 5D6XA 3ASKA 2RI5A 5FRNA 4BD3A 4UC4A 2QQRA 4NS5A 3PMTA 4A4FA 3LGFA 2DIGA 5C0MA 3OS0A 2EQJA 2LTOA 5M9OA 2X4XA 2XK0A 3MEWA 3PFSA 3OYJA 2MWPA 4LD6A 2G3RA 3MO8A 4BE1A 3DLMA 3OYAA 5IAYA 4IUVA 2RI2A 4N4GA 2PQWA 3OYIA 5C6SA 1KHCA 3OYBA 3KUFA 4BE2A 2RJDA 3QIIA 3CEYA 2L89A 4ZTJA 3OS2A 3OYMA 3S3OA 5J39A 2O4XA 3S3MA 2NLUA 3BDLA 2K3YA 3META 5CIUA 2QQSA 4QW2A 1OZ3A 3ZEHA 4E7LA 1SSFA 3NTKA 4IKFA 4Z02A 2CKKA 2HQXA 3OB9A 4L59A 2X4YA 3S3NA 4E7HA 2LDMA 2RJCA 3MEVA 3M9QA 4QVZA 2GFAA 3OMCA 4EDUA 3GOXA 1RI0A 2R58A 5KCHA 4RG2A 4C5HA 2X35A 1XNIA 2RHYA 4B9XA 3MP1A 3NTIA 4II1A 3P8DA 2DIQA 3LLRA 4PLLA 2GFUA 3L2VA 2DAQA 1N27A 3H6ZA 2RHXA 5J26A 1WJRA 3OYDA 2E5QA 3F70A 3S6WA 4QQ6A 3OY9A 2MWOA 5KE3A 2IG0A 5FRMA 3H8ZA 2JZ2A 3DB3A 3MEAA 3PNWC 3C4SA 4N4IA 2LCCA 4BACA 4A4EA 2LRQA 2X4WA 2RHUA 4C5EA 5KE2A 2RJEA 3OS1A 3OYGA 2E6NA 2D9TA 2L8DA 3L42A 2R57A 4A4HA 2RHIA 3OYLA 2EQMA 2RJFA 3FLGA 3OYNA 3OA6A 2HQEA 5IN1A 2YRVA 4ZTFA 2P0KA 1G5VA 3E9GA
chains in the Genus database with same CATH superfamily
2KNBB 2WSCE 3QO3A 1YITQ 4OMQA 4RTYA 4EMKB 1PKSA 3PVLA 3ME9A 3A8GB 1N9RA 4ZN1A 4J9EA 2HD0A 4FL6A 4HVVA 3M0TA 2RN8A 1RI9A 3SDZA 3HKSA 3A5ZB 3O8VA 1AVZC 5KYNA 1TWBA 3H41A 4M77F 4E7IA 3PMIA 1VYTA 4DBQA 2DLPA 1PC0A 2DF6A 3DKMA 2L3RA 2W0ZA 2K5LA 1U3OA 2A36A 2OJ2A 1TUDA 3EH1A 3CCLT 1NE8A 4HT8A 2VXEA 3RBBB 1SHFA 4O6JA 2E64A 2DA9A 4N0AA 2DVJA 1KD1C 4PJOA 2RK1A 2MOXA 2CP6A 4A4FA 3G6EA 5M9OA 3M4YA 1K9AA 2XK0A 5KYUB 4LD6A 1UB4A 3MO8A 4YTLA 2FPFA 1IHVA 1JRIA 4BE1A 2E41A 2NYSA 1LNXA 5IHIA 3CPWA 1FWZA 4LE9A 1X43A 2NLUA 2OTLQ 4J7FA 4FCYA 3PVQA 3VU3C 1R77A 4EMKC 1EFNA 1YWPA 5KCHA 4AFZC 4BI8B 1VOMA 3MP1A 4E7SA 1K9MR 3RKYA 4MDXA 1ACMB 1HJDA 4QQ6A 2F2XA 2EGAA 3C4SA 1BI2A 2GTOA 4M78B 2K79A 2VC8A 3JSCA 2L8DA 1Q86R 4RMOA 1RAEB 2HQEA 4EMHA 2LCLA 5HKCA 1N6AA 5A0DA 1UG1A 2L0AA 3G71Q 1BIBA 2LVMA 4OVAA 1G3TA 1VA7A 4KH0B 1IRXA 1M1KR 1G3WA 5IXBA 2M16A 2CP5A 2D0QB 5CAIA 4PL6A 4DQ2A 2YUPA 2KK4A 4M75E 4M4ZA 2QTVA 1U5SA 2QASA 1VQ4A 5D6YA 1YNZA 4BB7A 2ZPHB 2RO0A 4WF2A 1OZ2A 4A54A 3M5AA 2PTKA 1VQKA 1IO6A 3OYFA 5FU7B 3JB9I 1JO8A 5AYFA 2FRWA 3JCMg 4ZNXA 1NJIR 2EJGA 3M0SA 3J80E 2LQWA 1K73U 2AK5A 3LGFA 2DIGA 3OS0A 2DX1A 4JS4A 1X27A 2YWWA 3RIRA 5GAOl 1UE9A 1Q82C 2FZGB 2VUBA 1AHJB 1RLQC 4M78C 2O4XA 3G6EQ 2EPDA 1E6GA 1K9MC 4LDVA 1FXXA 4DBHA 2QGFB 4M7DG 3CBOA 4L5GA 5FLXE 2GFAA 3X26B 1YBYA 1NBEB 1T3LA 1BB9A 5EG2A 1Q86C 1N27A 3H6ZA 3HFOA 3UA6A 2J06A 2CT3A 4FW1A 3JCMJ 2ECZA 3CCVA 1WXUA 5GJWB 4N4IA 4OMFB 1QCFA 5CR2A 3BDUA 3TCJA 1YJNA 1S72T 4J6WA 4D6WA 2K5FA 4OB1B 5FU7C 2E5KA 2YRVA 1IREB 5FU6B 1J3TA 2BZ8A 4JJBA 2KAFA 4JJNK 4QVDA 2HCKA 2DO3A 2DZ9A 3A1PA 4JLIA 2DMOA 4NOYA 2VV5A 2C06A 4IIOA 4HCKA 1U1SA 3M59A 2KRMA 1G3YA 3VS2A 4QT7A 2JM8A 3SHWA 2XDPA 4M75G 3QYHB 1W2BA 4HKEA 5KCOA 2FPEA 3I56T 3CQTA 2BKDN 3H0HA 1Y57A 2CUBA 4QQGA 1WIEA 3QDFA 2QQ9A 1D3BB 1VQ4Q 1VQMT 1OPLA 1I1JA 2K3BA 4EMKA 2ESWA 4JJDA 3NPFA 4FIBA 1V1CA 4FYYB 1VQKQ 2IIMA 5GJVB 1N9SA 1WHJA 2MAMA 1MNDA 1UGVA 3EFOB 2YUOA 4J6YA 1Q7YU 2E3HA 3OYAA 2F2VA 1WI7A 5LJ3j 1TS9A 2H3EB 1UUEA 2Y4XA 4ZTJA 2COWA 2QEXT 3OYMA 2QK0A 1ABOA 3KBGA 2O31A 5GMKj 3WVEB 5CKEA 3CCSA 4M77C 5CK9A 8ATCB 2WSEE 5LJ3e 2CKKA 3M53A 3S3NA 4OMMA 2KEAA 1RI0A 5GMKe 4RTWA 5GMKl 2FEIA 3BE3A 1KC8U 4XU2A 1Y0MA 4C8QD 5J26A 2Y4YA 5DLQE 2KR3A 2JW4A 1TG0A 3PNWC 2X3WD 1WYXA 2R57A 3EGUA 3HTRA 2DNUA 4RTVA 1UTIA 1H3ZA 2K6DA 2X3XD 1AZEA 2LQ8A 2YT6A 5GAOp 4M7AD 3CCVQ 4JUVA 4FU6A 1YJNQ 1OI1A 5GAN4 3L2QA 4KUIA 4Y28E 3RMQA 2M9UA 2W10A 1PHTA 2A0FB 2M0OA 4E7JA 2J6KA 2HKNA 1BU1A 2VGMA 1R0BG 2BE7D 2X51A 3CBPA 1QKWA 3M0PA 4C5IA 1MMGA 2J7IA 5IT9E 4M78A 1IGQA 2R5AA 3V7CA 3A8LB 3DB4A 4PJOB 2CYZB 5IXFA 3VS7A 3CCJT 1QVFA 2KT1A 3PGGA 2CZ0B 5I2MA 1QP2A 1ZUUA 3FIFA 1JB0E 3RERA 4OMLA 2E3IA 4J5YA 1RAFB 1VQPA 3C12A 2M51A 4N4GA 4HVUA 4E2FB 1VQ5T 3QIIA 5HY6A 2RQVA 2K2MA 5CKBA 4FYXB 1YJ9T 4E7LA 1NLOC 1K0SA 2ZZDA 3FRNA 3RMSA 4E7HA 4F04B 2LDMA 2LJ3A 2SEMA 4RG2A 2V26A 4B9XA 3ZBDA 4HA8A 1B07A 1VQ6A 2GTJA 1UGQB 3HRTA 2KSSA 4C92E 2RHXA 1WJRA 2ZPEB 3OY9A 1OU8A 1T0JA 3G7ZA 1QVPA 1E6HA 5DLOA 1CSKA 5FWBA 3JB9D 2E6NA 1RACB 4AFUC 3FC3A 4A63B 2ZAEA 1QKXA 4N0AC 1KQ2A 4PJOC 4IUUA 2BTTA 1YFNA 1UGPB 3H0IA 3JCMW 4J83A 1JXOA 2VYTA 3H0FA 2M1HA 2VXFA 2QQBA 3I35A 4EIKA 4J9HA 1X6BA 2KT8A 2DFUA 2JNGA 2XD0A 2CT4A 2EQIA 3CD6T 4XU0A 2J05A 3E9FA 1M8MA 3OBWA 3JCMQ 1BI0A 3NTHA 1H641 5FW9A 2FVUA 5GAOq 1AEYA 3OW2P 3FDRA 3OW2S 1VQ9T 3CCMT 3V8KA 1XTDA 3I5RA 1ZQ1A 2OTJT 4KRTA 4BD3A 4M78F 4FYWB 1KFZA 1HSQA 4ORZA 1JJ2A 1M8VA 2DL7A 1Y7XA 3REBB 3SEMA 3OS5A 3DLMA 4J9DA 1WDXA 3A8MB 2HQHA 2D1XA 4FM4B 4BE2A 1A0NB 4RTTA 3M55A 3MHXA 2QA4A 2AZSA 2OTJA 1ZUKA 5IH2A 4HCBA 1VQPQ 5GANj 3MKDA 4MDWA 2RJCA 1D3BA 1BKBA 4DBFA 3QZ5B 1LVKA 1KD1R 1IZ6A 3VUZA 4J7IA 3G4SA 3F70A 2ZCFB 3EFOA 2DJZA 4C92A 2YSQA 1KIKA 3DB3A 5GAMf 1K8AU 2AIRB 2DTIA 3INZA 4BI4A 3L42A 2J6OA 2EYQA 1VQLA 1WXBA 3OYLA 3OSSC 2XIDA 3FLGA 1VQ6Q 3E9GA 1YP5A 2A3LA 1YIJT 3VYHB 2E12A 4NL3A 1EZZB 3X20B 5KH6A 2DE0X 2YRCA 4M75B 3G71A 5GMKi 2R5MA 2KMTA 1D0ZA 3GNGA 4GY5A 3CC4A 3UATA 3PIOA 2ZPGB 4IUQA 2KROA 2JTFA 3SFMA 5I11A 1SKUB 2WACA 4QKUA 4HXJA 1GBRA 2K9GA 3EH2A 1G83A 3OBYA 3FEOA 1UDLA 2KQWA 3CC7T 1OULA 2K57A 2O88A 3KXTA 2OX7A 2G3RA 2KI7A 1ARKA 2HSEB 3EHRA 1M90U 4FSXA 4PK4A 4GBQA 3CCET 4MZMA 4C8QG 1RABB 3LWHA 1MMDA 3CC7A 2OI3A 5CKFA 1VIEA 2YLCA 5A2QE 4L6V5 4X9DA 1TUGB 1QVGP 1QVGS 3R6OA 1WNLA 5LJ3f 1VQ9Q 2FZKB 1RAAB 2QA4Q 4M75C 2OTJQ 3LLRA 2RB6A 4M7AG 3CCLA 4B6MA 3JB9H 2E5QA 4RCCA 2RM4A 4Y92A 2RD1A 3H8ZA 1BK2A 5IHNA 1Q82R 1ZA2B 5AT1B 1HK9A 3V8JA 4M7DE 4A4HA 2EQMA 4D8DA 4XU1A 4M78D 4KH1B 3RKXA 1G5VA 1BCOA 3G4SQ 4JDSA 4XU3A 3EG9B 1ZSZA 2EYXA 4XQ3A 4ATOA 3MP6A 3WXMB 3Q1JA 1QCNA 1MNEA 1VQLQ 3VV0A 1KHIA 2YHTA 5A0GA 2HAXA 2E70A 2AKLA 1HYOA 2D8JA 4P5NA 1ZBJA 2O01E 2RQUA 1UJYA 1X6OA 4BDYA 5GAN2 3QDRB 2BIVA 3CMAT 2JS2A 4XTZA 1PRMC 3TEEA 3M0QA 3LX7A 3OYCA 1G2BA 1NZ9A 3CC4Q 1D0YA 3CCUT 4A53A 3EGDA 3L2WA 1UGSB 3OQ5A 2RI5A 1KSWA 1K73R 3RKWA 4ESRA 2CUDA 2DTHA 1YI2T 2VVKA 4AFQC 4IUVA 4HT9A 3ER0A 1KHCA 3GIBA 2ED1A 3CEYA 1M3BA 1PKTA 3S3OA 1BCMA 4AG1C 1FYNA 4JRKA 5LJ5j 3CMET 3JB9G 4ANJA 3I55T 2LP5A 4R0KA 3EFSA 1ZX6A 2HZYA 1XNIA 1VQNT 4A4KA 3CCRT 4ELZC 3HFNA 1M1KU 3BY7A 2EWNA 2GFUA 3CC7Q 3VRZA 3L2VA 4PJOF 1K76A 5EC7A 2BZXA 4OB0B 3PT9A 3BFMA 2RHUA 1LPLA 1X6GA 1R8OB 4F7UG 5GAMj 1QWEA 3QYGB 3GPLA 1T0HA 2DXCA 3QPHA 3REAB 4M7DA 1AWOA 4DOWA 4PJJA 3CCLQ 3GNFB 3SWNB 4M77D 1I4K1 2A37A 4KUDK 2CGHA 5GAMe 1YWOA 2A7YA 3R6NA 1AOJA 2GCXA 1NJIU 2E4HA 3QBYA 4JZ4A 3UPUA 1WJQA 4O5VA 2DTOA 1WGSA 5D6WA 2EYWA 2DXUA 3VS0A 1RL2A 2DL8A 3LGLA 1IB8A 2Z0WA 3O5ZA 4IUTA 1K73C 2GGRA 3M56A 1X69A 4DOVA 4OF1A 4QQDA 2KBTA 2EFIA 3MP8A 4BDZA 1B7TA 4C0GA 4XTWA 5D6XA 4J9FA 2KRNA 3OSVA 1S72A 4LN2A 2B86A 2CH4A 5I22A 4X9CA 3VYGA 5HK3A 4M75A 4KT0E 3VS5A 9ATCB 2RQWA 2VWFA 1Q7YR 1NM7A 3G1JA 1FMWA 2ZPIB 3CC2T 2JTEA 2ZPBB 3QSUA 2QTXA 2PNIA 5HCKA 3HL8A 1OZ3A 1WHKA 2LT1A 3GLXA 1PSEA 2MYSA 2RPNA 1VQ8T 4QVZA 3I56A 3E19A 1OX8A 2DD4A 2CP3A 2FYKA 2X35A 1BIAA 4C92B 5L8RE 3EG0A 5KYWB 5GAN3 2GNCA 1GCQA 1G3SA 3HSBA 1RAGB 3JRZA 2XDBA 5FRMA 1CKBA 1VQMA 3QZ9B 5GANf 2JUFA 3I5SA 4C5EA 5FU6C 1XJWB 2RQTA 1PNJA 3VJPA 4F17A 3MCAB 1VQ8A 2VB6A 3L1AA 5IN1A 3IQLA 4ZTFA 2DXBA 1LCKA 2PU9B 4LD9K 2A08A 1N8RU 2DEQA 3JV3A 2QEXA 3UT1A 2L3PA 1I81A 1I8FA 2DILA 1WXTA 2DL4A 3HRSA 5LJ3h 2V1RA 3RDVA 5FROA 1KJWA 1ZSGA 2CP2A 3LH0A 4ELYC 1AWWA 5GMKh 1W6XA 2LMJA 4GLKA 2XKOC 1NEBA 2CREA 2RHZA 1MV3A 1ZHIA 1SEMA 1C1AA 2PZ1A 4A4GA 5CKHA 4PJOD 1AT1B 1Q7YC 3ZL7C 3A98A 3EG9A 3ASKA 1SRMA 2QAZA 4NS5A 5CCAA 2CH4W 2JT4A 4C92C 1M5Q1 2HL3A 2K5IA 3OYJA 4JRPA 4C8QB 1YJWT 1JXMA 1QW1A 1SRLA 1CKAA 3OYIA 5C6SA 3JAME 3KUFA 4JS5A 2QDLA 2CZ1B 1VQOT 2DK3A 5LL6S 1S72Q 4M75F 3BDLA 2YDLA 3CXCP 2YUQA 1M1FA 1KQSP 3CXCS 1KQSS 2XU8A 3NTKA 5LJ3d 1KC8C 3MEVA 2DRMA 2XICA 4M7AB 2AKKA 4C5HA 4DA4A 2DIQA 3EG1A 1VQOA 3CCJA 2EBPA 2NWMA 2IG0A 2YRDA 4Z89A 5I21A 2LCCA 1LOJA 3I56Q 1YCYA 2FRYA 2D9TA 1ZSZB 1RAIB 2LQNA 3GF5A 1I07A 4OGCA 4PFZA 4RTUA 2KE9A 4C0FA 2EQKA 1VQMQ 1VQ5A 5DY9A 4J9BA 3JCMP 3QKJA 2K2VA 1WHGA 4XTUA 4V2SA 3OW2A 3CPFA 1VQ8Q 1T3SA 1YJ9A 4B9WA 1D1CA 3M0UA 3M58A 2MMPA 4TVRA 2A28A 4OMPA 2EQUA 2QEXQ 2NUPA 3DLLA 1ZBXA 2V1QA 3EGDB 2J6FA 4X1VA 1GCPA 3M57A 1YITT 1Q81U 1HD3A 1QLYA 4PFOA 2RI3A 3SWNA 3VUBA 1D1BA 3X25B 1ABQA 3L2ZA 5FWCA 2EQJA 1NPRA 2X4XA 4OMOA 5IAYA 2L2PA 3PTAA 2RI2A 1PM3A 5KYYB 1NLPC 5KYXB 2RJDA 1Y07A 4AMCA 2HKQB 2EKHA 2L89A 3M54A 1ZSZC 2DVEA 2ENMA 5J3BA 2BZYA 2QQSA 4K11A 3RESA 3LH5A 4Z02A 1MMNA 3CD6A 1PG5B 1GL5A 3TVTA 1YN8A 1WPYA 5GAN7 3GOXA 2LX7A 1BI3A 1R0CB 4FW2A 4M77G 3H9NA 1UGRB 4C8QE 3TSZA 3QUIA 5I2SA 1VQ9A 3CCMA 2XDDA 2EYZA 1TU0B 2ROTA 4M7DB 5LJ5f 1VYVA 3GBQA 1YJWQ 3EHQA 3V8LA 1VQOQ 4NL2A 2KDSA 1NYFA 3CCJQ 4PJNA 3HRUA 4J6XA 2DL3A 2DPPB 4M7AE 1GRIA 1SG5A 3SD4A 2K7AA 5GANe 4BY6B 2ZPFB 4C0DB 2YLBA 3QWYA 5KYWA 4BUGA 4JPBW 4XAXB 3OYYA 4WTOB 1VQ5Q 5CQXA 2DYBA 1WHLA 3M4GA 1E7OA 3GP8A 1MMAA 1B34B 1YJ9Q 5GAN6 5GANh 5HK0A 1RLPC 2EYYA 1OOTA 4RUGA 2HBPA 2JOYA 3L2RA 1TUCA 2F5KA 2XG8D 2YUNA 4FT4A 1QVGA 3J81E 2C0IA 2MWPA 1WLPB 1ZLMA 1YIJA 2PQWA 1KD1U 3OYBA 1M30A 4M7DC 1WFWA 4MZTA 5J39A 2MPXC 2CSQA 2KGTA 3FJPA 1VIFA 2DZCA 4OB3B 1MUZA 2XHCA 4KGZB 5CIUA 3HHTB 2ROLA 4L59A 5GMKm 3QXEB 4JRQA 3JB9J 4FT2A 1X01A 4ZGDB 4II1A 4BY6C 1K8AC 4C0DC 2HBWA 2DAQA 1XQHA 5GANd 2KY9A 5ECAA 4R56A 4JJCA 4C8QA 3CD6Q 2JTMA 1JU5C 1PCXA 2EAYA 1FMVA 5KE2A 3OS1A 2RJEA 5LJ3g 3VS1A 1OPKA 3G6ET 1UJ0A 4CC2A 1D1AA 2C0TA 1OQKA 3KFVA 1RADB 3CCMQ 4E7KA 1NPPA 2LNHB 1UHFA 3CCEA 4RKUE 1LJOA 4M7AA 2F69A 3JCMc 1PWTA 5GAOn 2MCNA 2ZGWA 2HDAA 2FHDA 4DEYA 4PJOG 4F7UE 3NMZC 1GFDA 4WCIA 2FL7A 2L3SA 4J9IA 3MEUA 1PD0A 3P8HA 1QQJA 4C92F 2CSIA 2FZCB 3C0CA 4OGEA 3LYIA 3OYHA 2LJ0A 1Z9QA 4IIMA 2O2OA 2VASA 4X34A 3PIPA 1BI1A 1GCQC 1M90C 4PKCC 4MMLA 1I0CA 2KYBA 2AHJB 3LWIA 4LDUA 4ZGJB 1PSFA 1NEGA 2ED0A 2FO0A 2KRSA 3D7SB 3URGA 2QQAA 2CP7A 5CKDA 3META 4HCCA 1Q82U 3SB2A 1M4ZA 1JBMA 4LDWA 1AZGB 1YIJQ 2X4YA 2NUZA 1VQ4T 1K1ZA 3OMCA 4EDUA 4ZN3A 3CMAA 2NUTA 1EX4A 1VQKT 3JCMX 1SPKA 1K9MU 2HMAA 1AWXA 3MJXA 4ME7A 3CPWP 2DD5A 1X75C 4PFPA 3CPWS 2IPOB 2JJ9A 1OV3A 2MWOA 2JZ2A 3CCUA 1M9SA 5KYYA 5KYXA 3A8HB 2RF0A 1Q86U 2PUOB 1M27C 1OU9A 1DJ7B 2RJFA 2HSPA 3OYNA 2DL5A 1YI2A 3EG2A 4CRIA 2KYMA 2EVRA 3TSWA 4C8QF 4OB2B 3ZFJA 3E1SA 3UA7A 5LJ5e 1QCOA 1N5ZA 3QJ6A 2EKOA 2LNVA 3C94A 4XK8E 4C5GA 2NUPB 3JCMf 4JRIA 4KGVB 3CMEA 1M2VB 4GLMA 3I55A 1M2OA 4Y91A 4F7UA 4CI0C 2GQVA 4M7AF 3CCEQ 4LNPA 1VQNA 1P92A 3CCRA 1HXDA 2B8AA 4CC4B 5GAN8 5LJ5h 4HVWA 4PNOA 1WHMA 1VUBA 1C0MA 1WZOA 1Y71A 2YXYA 2F1LA 1MGQA 3CCVT 3JCMb 2RQRA 2FG0A 2P84A 2AT1B 1U1TA 2QQRA 2M02A 4LDXA 3EGXB 1YJNT 3UDCA 1WQ7A 1Z9ZA 4J9CA 4R55A 2PVGB 4AG2C 4FYVB 4XTVA 3LW5E 4PJMA 4E47A 1WX6A 5GAMh 2COYA 1PD1A 2K3YA 2EIFA 1TTHB 4QW2A 1B3QA 1SF9A 2GQIA 1B34A 2FB7A 1M1KC 2P0QA 3QHSA 1I5OB 2HQXA 2O9VA 2P4RA 4M77B 1OEBA 3M9QA 1M3CA 2H8HA 3ULRB 2VGNA 4EPCA 2MF2A 5LJ5d 2CS7A 3FJ5A 4C92D 2F2WA 1JQQA 2EGEA 6AT1B 1M1GA 2L5QA 3RUXA 1K0XA 3CMAQ 2KVQG 3SWNC 4KULA 3WVDB 4M78E 1NJIC 3T9NA 1BBZA 1QP3A 2COZA 2HNIA 1FX7A 4ZGEB 4PLIA 1UHCA 3E2UA 2DKGA 1KK7A 3CCUQ 2JM9A 1X2KA 1N8RR 1Y96A 3EFRA 2LT4A 4IUPA 4AT1B 5GAMd 3OYEA 3CC2A 5GANg 1KC8R 4Z8AA 1X2QA 3JB9F 1ZUYA 1NYGA 2GBQA 3JCMV 2JMCA 3OMGA 3CCST 1YI2Q 3CBMA 2P4TA 5CVIA 2E65A 2K4YA 4LUEA 2I0NA 3I9QA 3V7SA 3CCQT 2CZ6B 3X28B 3OYKA 2I2LA 2JXBA 2QDYB 1O75A 4F7UF 3CMEQ 5IHKA 3I55Q 1WHHA 2V8KA 3A8OB 3CXCA 1KQSA 4M7DF 2OAUA 5FRNA 2V8IA 1VQNQ 3CCRQ 2DYIA 1W2BP 3NGPA 2X4JA 1W2BS 3VRYA 3CCQA 3PFSA 2D8HA 1D09B 2EJFA 2JN0A 4VUBA 2HEQA 2JS0A 1TXQA 5KYUA 1XOVA 4FSSA 3S3MA 3N5BB 1C6VX 2CP0A 2LQKA 4QVCA 4DEXA 4RG8A 1SSFA 4OP0A 2L3QA 1TSFA 4KGXB 2R58A 1MV0B 4RTZA 4PLLA 2LX9A 1RUWA 1F1BB 5CO7A 2V8JA 2DBKA 5D7UA 2H3JA 1K4US 4A4EA 2LRQA 2X4WA 2PUKB 4C0ZA 3OYGA 1N8RC 2JVVA 3QWXX 1AD5A 1M3AA 4DBRA 2E6ZA 1RAHB 4M78G 1YHQT 1YJWA 1VQPT 2K3XA 4M77E 1VQ7T 4IURA 4BI3A 2F5TX 1H92A 4HCZA 2GF7A 3EAEA 1KG1A 2E1HA 2HL5C 1GBQA 2BUDA 1AWJA 1YHQA 1W1FA 3CC2Q 1OYXA 3P8BB 2QGGA 1VQ7A 2ABLA 5L23A 1QMCA 1FMKA 4EMGA 1VQ6T 1WJSA 2EW3A 1PRLC 4CC3A 1MHNA 3JCMe 4OMNA 3VS3A 4KBMB 2ATCB 1Q81R 1V76A 2CDTA 1EIFA 2KXCA 5DM7R 1UECA 4UC4A 1WA7A 1H3HA 2D6FA 3PMTA 4C8QC 3VS6A 5C0MA 2LTOA 1WQWA 2PVDB 1UEBA 3M0RA 4F14A 2XI9A 3NHNA 2QXFA 2VKNA 2QYZA 1QWFA 1M2VA 3CCSQ 2RMOA 3OS2A 2DJQA 2SRCA 3JCMh 2PVOB 2XMFA 1QVFP 1IHWA 4AFSC 3UF4A 1QVFS 2MI6A 2NUTB 1IXDA 3CCQQ 3ZEHA 4M7AC 3MPUB 1W70A 3OB9A 3J7AF 5GAOm 2RA2A 2O9SA 4CC7A 2E10A 1ZA1B 1W4SA 2RHYA 1H8KA 4RTXA 3P8DA 2FPDA 4J8OA 3U23A 3EGXA 3TREA 3BW1A 3OYDA 1YITA 3EG3A 5KE3A 4Z88A 1YCSB 3RNJA 3MEAA 1GFCA 1KQ1A 4J9GA 1JEGA 1SHGA 1IGUA 5CQYA 3VKIA 2EJ9A 1UFFA 3NFCA 4M7DD 1V29B 2AZVA 1GXIE 4XTXA 1VYUA 3OA6A 1U8RA 4F16A 4E6RA 4BE0A 3TQ7P 2X9HA 2LZ6B 4LXCA 3HPWA 3QJYA 5LJ5g 4M77A 2P0PA 2QI2A 3JCMd 3RR6A 3X24B 4F7UB 2QA4T 3UWNA 3L2UA 2BE9B 1S1NA 2DERA 4JZ3A 2M0YA 7AT1B 1K8AR 1NG2A 1U06A 2KXDA 3FB9A 2RH2A 2OTLT 1Q81C 1G8XA 2O4XB 4N4HA 3PE0A 2MK5A 1O9SA 8AT1B 5GAOr 5GAMg 3G4ST 4Q5WA 3V7RA 4D8KA 4PJOE 1Q95G 1BYMA 1YHQQ 2LJ1A 3QG1A 4M75D 1VQLT 1VQ7Q 2OTLA 2C0OA 2CZ7B 2DRKA 3TU4K 2OAWA 2IVWA 2JMAA 4JLGA 3HP9A 3AT1B 4C92G 1TH7A 3G71T 4LUDA 2DBMA 1D0XA 2DEUA 4RCBA 2D0NA 4IKFA 2RK2A 3CC4T 3C95A 5GAN5 1JJ2P 1I5LA 1SSHA 1JJ2S 2LC4A 1OX9A 4E7ZA 4MZPA 2DM1A 2EGCA 3NTIA 2MIOA 4MMKA 2WSFE 1M90R 3S6WA 1TOVA 2DXTA 3AHUA 3VS4A 4PJLA 2Y90A 4LDYA 4BACA 2G6FX 2DETA 4XTYA 3THKA 2RHIA 2LCSA 1Y96B 2QG9B 2RNAA 2P0KA 5A0LA 3MEWA
chains in the Genus database with same CATH topology
1KQ2A 4N0AC 4PJOC 4CRIA 2WSCE 3QO3A 4IUUA 4C8QF 4OB2B 4EMKB 2PU9B 4LD9K 3ZFJA 3E1SA 1UGPB 1N8RU 3ME9A 2DEQA 5LJ5e 3A8GB 1N9RA 4ZN1A 3FC3A 2QEXA 3JCMW 4J83A 2VYTA 3UT1A 2HD0A 3QJ6A 2M1HA 4FL6A 2VXFA 1I81A 2QQBA 2EKOA 3SDZA 2LNVA 1I8FA 3C94A 4XK8E 4C5GA 3HKSA 3A5ZB 3JCMf 4JRIA 3O8VA 2JNGA 3HRSA 5LJ3h 3CMEA 3I55A 2XD0A 4Y91A 5FROA 4F7UA 3CD6T 4CI0C 4XU0A 4M77F 3LH0A 2GQVA 4E7IA 3E9FA 3PMIA 4ELYC 4M7AF 3OBWA 1VQNA 3DKMA 1P92A 3CCRA 1HXDA 3JCMQ 2L3RA 1BI0A 5GMKh 2B8AA 2K5LA 3NTHA 1H641 4GLKA 2FVUA 2XKOC 5GAN8 2RHZA 5LJ5h 5GAOq 4PNOA 1ZHIA 3CCLT 1VUBA 3FDRA 1NE8A 3OW2S 1VQ9T 4HT8A 3CCMT 2VXEA 3V8KA 1XTDA 1Y71A 4A4GA 5CKHA 4PJOD 3CCVT 1MGQA 1ZQ1A 3JCMb 1Q7YC 2OTJT 3ASKA 4BD3A 4O6JA 1U1TA 2E64A 4M78F 4N0AA 1KD1C 4PJOA 2QQRA 2RK1A 4NS5A 5CCAA 4LDXA 4A4FA 4C92C 1YJNT 3G6EA 1M5Q1 1JJ2A 1M8VA 1Y7XA 2K5IA 3M4YA 3UDCA 2XK0A 5M9OA 1WQ7A 3OYJA 3OS5A 1UB4A 3MO8A 4LD6A 3DLMA 1JRIA 4YTLA 4C8QB 2E41A 4R55A 4BE1A 1YJWT 1QW1A 2PVGB 3A8MB 4XTVA 1LNXA 4FM4B 3LW5E 5C6SA 3JAME 3KUFA 3OYIA 4JS5A 4BE2A 2CZ1B 3M55A 4E47A 1VQOT 3CPWA 3MHXA 1FWZA 5GAMh 2QA4A 2DK3A 5LL6S 2NLUA 4M75F 3BDLA 2K3YA 2OTJA 2EIFA 1M1FA 4QW2A 4J7FA 3CXCS 1KQSS 2XU8A 1B34A 2FB7A 3NTKA 1M1KC 2P0QA 3QHSA 4HCBA 5LJ3d 2HQXA 3VU3C 5GANj 4MDWA 4EMKC 1KC8C 4M77B 2RJCA 3MEVA 2XICA 4M7AB 3M9QA 1BKBA 1D3BA 5KCHA 4C5HA 4DA4A 4BI8B 3QZ5B 3MP1A 2DIQA 2VGNA 4EPCA 1VQOA 2MF2A 5LJ5d 2CS7A 4C92D 3RKYA 4MDXA 1IZ6A 3VUZA 4J7IA 3G4SA 3CCJA 3F70A 4QQ6A 2ZCFB 2DJZA 2IG0A 1M1GA 2L5QA 4C92A 3RUXA 3DB3A 5GAMf 3C4SA 5I21A 1K8AU 2LCCA 1BI2A 1LOJA 1YCYA 4M78B 2DTIA 3INZA 4BI4A 2VC8A 3JSCA 2D9TA 2L8DA 3L42A 2KVQG 2EYQA 1VQLA 4RMOA 3OYLA 3SWNC 3OSSC 4KULA 2XIDA 3FLGA 4M78E 2HQEA 3WVDB 3GF5A 4EMHA 1NJIC 2LCLA 5HKCA 4OGCA 3E9GA 3T9NA 1N6AA 2A3LA 1QP3A 5A0DA 2HNIA 1BIBA 1FX7A 2LVMA 4OVAA 4PLIA 4C0FA 1G3TA 2EQKA 4ZGEB 1YIJT 3VYHB 2DKGA 2E12A 4NL3A 5DY9A 1VQ5A 1G3WA 3X20B 3JCMP 3QKJA 1Y96A 2K2VA 2LT4A 3EFRA 4IUPA 5KH6A 4XTUA 5GAMd 2M16A 3OYEA 5GANg 2D0QB 3CC2A 3OW2A 4V2SA 4M75B 5CAIA 3G71A 5GMKi 3JB9F 2R5MA 3CPFA 4PL6A 3JCMV 4DQ2A 1YJ9A 2KMTA 3GNGA 3OMGA 4GY5A 4B9WA 2KK4A 3CBMA 4M75E 3CCST 2P4TA 5CVIA 2E65A 2K4YA 3CC4A 3M58A 1VQ4A 3PIOA 2MMPA 5D6YA 2ZPGB 4BB7A 4TVRA 4IUQA 2ZPHB 2RO0A 4WF2A 1OZ2A 2EQUA 2JTFA 3V7SA 4A54A 3M5AA 2CZ6B 3CCQT 3SFMA 1VQKA 3X28B 3OYFA 3DLLA 1ZBXA 2WACA 3OYKA 2I2LA 5FU7B 3JB9I 5AYFA 2QDYB 3M57A 3JCMg 1YITT 1O75A 4F7UF 1Q81U 3OBYA 2RI3A 3SWNA 2EJGA 2V8KA 3A8OB 3FEOA 3VUBA 3CXCA 1KQSA 2KQWA 4M7DF 2OAUA 3CC7T 5FRNA 2V8IA 3X25B 2K57A 3J80E 3L2ZA 1K73U 2X4JA 3LGFA 2DIGA 1W2BS 3KXTA 3OS0A 2EQJA 3CCQA 1NPRA 2X4XA 3PFSA 4JS4A 2G3RA 3RIRA 5IAYA 5GAOl 3PTAA 2EJFA 2JN0A 2RI2A 4VUBA 1Q82C 1M90U 2RJDA 1Y07A 2VUBA 4FSXA 3CCET 2L89A 3M54A 4MZMA 1AHJB 4M78C 4C8QG 1XOVA 3LWHA 2O4XA 3S3MA 2DVEA 3N5BB 2LQKA 3CC7A 5J3BA 3RESA 2QQSA 5CKFA 1VIEA 4QVCA 2YLCA 4RG8A 5A2QE 4L6V5 1SSFA 4OP0A 4Z02A 1K9MC 4LDVA 4X9DA 3CD6A 1FXXA 4M7DG 3CBOA 1WPYA 1QVGS 5GAN7 3R6OA 4L5GA 5FLXE 2GFAA 3GOXA 2R58A 1BI3A 1WNLA 5LJ3f 3X26B 1YBYA 4M75C 4M77G 3LLRA 4PLLA 2RB6A 4M7AG 2LX9A 5EG2A 1UGRB 1Q86C 1N27A 4C8QE 3H6ZA 3CCLA 3HFOA 3QUIA 5CO7A 2E5QA 5I2SA 3JB9H 3JCMJ 2V8JA 4RCCA 3CCMA 1VQ9A 2RM4A 2XDDA 2RD1A 3H8ZA 3CCVA 4M7DB 2H3JA 5LJ5f 4N4IA 4OMFB 4A4EA 2LRQA 2X4WA 2PUKB 5CR2A 4C0ZA 3OYGA 3BDUA 3TCJA 1HK9A 1YJNA 3V8JA 1N8RC 2JVVA 4A4HA 1S72T 3V8LA 4J6WA 4D6WA 2K5FA 2EQMA 4XU1A 4M78D 4OB1B 5FU7C 2YRVA 4NL2A 1IREB 5FU6B 2E6ZA 3RKXA 1G5VA 2KDSA 4M78G 1YHQT 1YJWA 1VQPT 4JDSA 2K3XA 3HRUA 2KAFA 4M77E 4XU3A 4J6XA 4JJNK 2DPPB 4XQ3A 4QVDA 4M7AE 4ATOA 1VQ7T 4IURA 3MP6A 3WXMB 2DO3A 3Q1JA 3SD4A 2DZ9A 4JLIA 4NOYA 5GANe 4BI3A 4BY6B 2VV5A 2ZPFB 2F5TX 4C0DB 3VV0A 1KHIA 2YHTA 5A0GA 1U1SA 3M59A 2YLBA 2C06A 2HAXA 2E70A 1G3YA 4HCZA 2GF7A 3EAEA 4P5NA 4BUGA 1KG1A 2XDPA 2O01E 4M75G 2E1HA 3QYHB 1W2BA 4BDYA 1X6OA 2BUDA 4HKEA 4XAXB 5GAN2 3OYYA 5KCOA 1YHQA 3QDRB 2BIVA 5CQXA 3I56T 3CMAT 2BKDN 4XTZA 1OYXA 3M4GA 3P8BB 3GP8A 1VQ7A 3TEEA 1B34B 1VQ6T 3LX7A 4QQGA 1WJSA 4EMGA 3OYCA 5GAN6 1MHNA 3JCMe 5HK0A 5GANh 1NZ9A 4KBMB 2QQ9A 1D3BB 2HBPA 1VQMT 2JOYA 3L2RA 3CCUT 1EIFA 4A53A 2F5KA 4EMKA 1UGSB 3OQ5A 3L2WA 5DM7R 2RI5A 2XG8D 4FIBA 4UC4A 2D6FA 3PMTA 1N9SA 4C8QC 2MAMA 5C0MA 4FT4A 1QVGA 2LTOA 3RKWA 3J81E 2DTHA 1YI2T 4J6YA 1WQWA 2MWPA 1Q7YU 2PVDB 3OYAA 1UEBA 4IUVA 4HT9A 1YIJA 2XI9A 3ER0A 5LJ3j 2PQWA 2QXFA 1KD1U 1KHCA 3OYBA 2Y4XA 4M7DC 3GIBA 3CEYA 4ZTJA 2QEXT 3OS2A 3JCMh 4MZTA 3OYMA 3S3OA 2PVOB 5J39A 3KBGA 5GMKj 3FJPA 1VIFA 2DZCA 2MI6A 1QVFS 4OB3B 5CIUA 2XHCA 3WVEB 5CKEA 3CCSA 4M77C 5CK9A 4JRKA 3ZEHA 2WSEE 5LJ3e 5LJ5j 4M7AC 3HHTB 2CKKA 3CMET 3M53A 3JB9G 3OB9A 4L59A 5GMKm 5GAOm 3I55T 3S3NA 2RA2A 3J7AF 3EFSA 2E10A 3QXEB 4JRQA 3JB9J 1W4SA 1RI0A 4FT2A 5GMKe 1X01A 1XNIA 4A4KA 4ZGDB 3CCRT 2RHYA 3HFNA 4ELZC 5GMKl 1VQNT 4II1A 4BY6C 3BY7A 3P8DA 1M1KU 1K8AC 4J8OA 4C0DC 2EWNA 2GFUA 1KC8U 4XU2A 2DAQA 3L2VA 1XQHA 3TREA 4C8QD 3BW1A 5J26A 4PJOF 5GANd 3OYDA 1YITA 2KY9A 2Y4YA 5DLQE 5KE3A 4R56A 4C8QA 4OB0B 3PT9A 3MEAA 1KQ1A 2JTMA 3BFMA 3PNWC 5CQYA 3VKIA 2EAYA 5KE2A 2RHUA 2EJ9A 3OS1A 1R8OB 2RJEA 4F7UG 5GAMj 4M7DE 3NFCA 3QYGB 1V29B 5LJ3g 4M7DD 2R57A 1GXIE 4XTXA 3GPLA 3G6ET 3OA6A 2DXCA 1U8RA 3QPHA 4M7DA 4DOWA 1H3ZA 3GNFB 3SWNB 2LQ8A 4M77D 1I4K1 5GAOp 1NPPA 4BE0A 4E7KA 4M7AD 4KUDK 4JUVA 2CGHA 4FU6A 3HPWA 3QJYA 5GAMe 3CCEA 5LJ5g 2A7YA 2P0PA 2QI2A 4M77A 4RKUE 3JCMd 1LJOA 2GCXA 1NJIU 4M7AA 2F69A 3X24B 3JCMc 4F7UB 5GAOn 2QA4T 2ZGWA 3QBYA 3UWNA 3L2UA 2FHDA 1OI1A 4PJOG 5GAN4 3L2QA 4KUIA 4Y28E 3RMQA 4F7UE 2M9UA 3UPUA 2M0OA 1WJQA 4E7JA 3FB9A 4O5VA 2DTOA 1WGSA 2FL7A 2RH2A 2VGMA 5D6WA 3CBPA 1Q81C 2OTLT 2O4XB 4N4HA 2DXUA 4C5IA 3MEUA 1RL2A 3LGLA 3P8HA 5IT9E 1O9SA 4M78A 4C92F 2R5AA 3V7CA 3A8LB 5GAOr 3DB4A 4OGEA 4PJOB 2CYZB 3LYIA 4IUTA 3OYHA 5GAMg 1K73C 3M56A 4DOVA 3G4ST 3CCJT 4Q5WA 4OF1A 4QQDA 1QVFA 3V7RA 2EFIA 3PGGA 4PJOE 3MP8A 2CZ0B 4X34A 4C0GA 3PIPA 4BDZA 1BYMA 4XTWA 5D6XA 1BI1A 3QG1A 4M75D 5I2MA 3OSVA 1QP2A 1M90C 1S72A 4PKCC 1VQLT 4MMLA 5HK3A 4X9CA 3VYGA 2OTLA 4M75A 3FIFA 1JB0E 4KT0E 3RERA 4J5YA 2CZ7B 1VQPA 2AHJB 3C12A 4N4GA 3LWIA 2ZPIB 4LDUA 1PSFA 4ZGJB 2IVWA 4JLGA 3TU4K 1VQ5T 3QIIA 5HY6A 3HP9A 4C92G 1TH7A 2ZPBB 3CC2T 3QSUA 3G71T 2QTXA 3URGA 2QQAA 5CKBA 5CKDA 3META 4HCCA 1Q82U 1YJ9T 3SB2A 3HL8A 1M4ZA 1OZ3A 1JBMA 4RCBA 4E7LA 4IKFA 2RK2A 2LT1A 4LDWA 2ZZDA 3FRNA 3RMSA 3CC4T 2X4YA 3GLXA 1PSEA 3C95A 4E7HA 2LDMA 5GAN5 1VQ4T 1I5LA 1JJ2S 1VQ8T 4QVZA 2LC4A 3I56A 3OMCA 4EDUA 3E19A 4ZN3A 3CMAA 2DD4A 4RG2A 2FYKA 2X35A 4MZPA 1BIAA 1VQKT 4C92B 4B9XA 3JCMX 4JRPA 3NTIA 3ZBDA 5L8RE 1K9MU 4HA8A 5GAN3 1VQ6A 4MMKA 4ME7A 2WSFE 1UGQB 3HRTA 2DD5A 1X75C 2KSSA 2RHXA 4C92E 1WJRA 3CPWS 3HSBA 1G3SA 3S6WA 2ZPEB 3JRZA 3OY9A 2XDBA 2DXTA 2MWOA 5FRMA 3AHUA 1VQMA 2JZ2A 3QZ9B 3CCUA 1M9SA 3G7ZA 2Y90A 4LDYA 4BACA 1QVPA 2JUFA 5GANf 4C5EA 5DLOA 3JB9D 3A8HB 4XTYA 5FU6C 2E6NA 2PUOB 1Q86U 3VJPA 1DJ7B 2RHIA 3MCAB 1VQ8A 3L1AA 2RJFA 3OYNA 1Y96B 5IN1A 4ZTFA 1YI2A 2DXBA 2P0KA 5A0LA 3MEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H3Z A;  4CRI A;  4IUU A;  2LVM A;  2K3X A;  4OVA A;  4PLI A;  2EQK A;  4BE0 A;  4E7K A;  4IUR A;  3ME9 A;  3MP6 A;  4FU6 A;  3Q1J A;  3QKJ A;  4IUP A;  3SD4 A;  5KH6 A;  3OYE A;  3FC3 A;  2VYT A;  2M16 A;  3UT1 A;  3QJ6 A;  2M1H A;  4FL6 A;  2R5M A;  2EKO A;  3QBY A;  3UWN A;  3L2U A;  4PL6 A;  2FHD A;  1OI1 A;  3L2Q A;  3OMG A;  2GF7 A;  4GY5 A;  4HCZ A;  3EAE A;  4B9W A;  4C5G A;  3O8V A;  2XDP A;  2M0O A;  1WJQ A;  5FRO A;  4E7J A;  5D6Y A;  4BDY A;  1WGS A;  2BUD A;  3LH0 A;  5KCO A;  4IUQ A;  3E9F A;  3PMI A;  5D6W A;  2RO0 A;  4E7I A;  1OZ2 A;  2EQU A;  2O4X B;  2BIV A;  2JTF A;  4N4H A;  4C5I A;  3MEU A;  2BKD N;  2L3R A;  1OYX A;  3LGL A;  3P8H A;  2B8A A;  3OYF A;  2WAC A;  3OYK A;  3NTH A;  2R5A A;  3DB4 A;  2RHZ A;  3LX7 A;  4QQG A;  1WJS A;  3OYC A;  3LYI A;  4IUT A;  3OYH A;  1MHN A;  3FDR A;  4Q5W A;  4QQD A;  4A4G A;  2EFI A;  2RI3 A;  3L2R A;  3MP8 A;  4BDZ A;  3FEO A;  4X34 A;  2F5K A;  3L2W A;  3OQ5 A;  5D6X A;  3ASK A;  2RI5 A;  5FRN A;  4BD3 A;  4UC4 A;  2QQR A;  4NS5 A;  3PMT A;  4A4F A;  3LGF A;  2DIG A;  5C0M A;  3OS0 A;  2EQJ A;  2LTO A;  5M9O A;  2X4X A;  2XK0 A;  3MEW A;  3PFS A;  3OYJ A;  2MWP A;  4LD6 A;  2G3R A;  3MO8 A;  4BE1 A;  3DLM A;  3OYA A;  5IAY A;  4IUV A;  2RI2 A;  4N4G A;  2PQW A;  3OYI A;  5C6S A;  1KHC A;  3OYB A;  3KUF A;  4BE2 A;  2RJD A;  3QII A;  3CEY A;  2L89 A;  4ZTJ A;  3OS2 A;  3OYM A;  3S3O A;  5J39 A;  2O4X A;  3S3M A;  2NLU A;  3BDL A;  2K3Y A;  3MET A;  5CIU A;  2QQS A;  4QW2 A;  1OZ3 A;  3ZEH A;  4E7L A;  1SSF A;  3NTK A;  4IKF A;  4Z02 A;  2CKK A;  2HQX A;  3OB9 A;  4L59 A;  2X4Y A;  3S3N A;  4E7H A;  2LDM A;  2RJC A;  3MEV A;  3M9Q A;  4QVZ A;  2GFA A;  3OMC A;  4EDU A;  3GOX A;  1RI0 A;  2R58 A;  5KCH A;  4RG2 A;  4C5H A;  2X35 A;  1XNI A;  2RHY A;  4B9X A;  3MP1 A;  3NTI A;  4II1 A;  3P8D A;  2DIQ A;  3LLR A;  4PLL A;  2GFU A;  3L2V A;  2DAQ A;  1N27 A;  3H6Z A;  2RHX A;  5J26 A;  1WJR A;  3OYD A;  2E5Q A;  3F70 A;  3S6W A;  4QQ6 A;  3OY9 A;  2MWO A;  5KE3 A;  2IG0 A;  5FRM A;  3H8Z A;  2JZ2 A;  3DB3 A;  3MEA A;  3PNW C;  3C4S A;  4N4I A;  2LCC A;  4BAC A;  4A4E A;  2LRQ A;  2X4W A;  2RHU A;  4C5E A;  5KE2 A;  2RJE A;  3OS1 A;  3OYG A;  2E6N A;  2D9T A;  2L8D A;  3L42 A;  2R57 A;  4A4H A;  2RHI A;  3OYL A;  2EQM A;  2RJF A;  3FLG A;  3OYN A;  3OA6 A;  2HQE A;  5IN1 A;  2YRV A;  4ZTF A;  2P0K A;  1G5V A;  3E9G A; 
#chains in the Genus database with same CATH topology
 2KNB B;  2WSC E;  3QO3 A;  1YIT Q;  4OMQ A;  4RTY A;  4EMK B;  1PKS A;  3PVL A;  3ME9 A;  3A8G B;  1N9R A;  4ZN1 A;  4J9E A;  2HD0 A;  4FL6 A;  4HVV A;  3M0T A;  2RN8 A;  1RI9 A;  3SDZ A;  3HKS A;  3A5Z B;  3O8V A;  1AVZ C;  5KYN A;  1TWB A;  3H41 A;  4M77 F;  4E7I A;  3PMI A;  1VYT A;  4DBQ A;  2DLP A;  1PC0 A;  2DF6 A;  3DKM A;  2L3R A;  2W0Z A;  2K5L A;  1U3O A;  2A36 A;  2OJ2 A;  1TUD A;  3EH1 A;  3CCL T;  1NE8 A;  4HT8 A;  2VXE A;  3RBB B;  1SHF A;  4O6J A;  2E64 A;  2DA9 A;  4N0A A;  2DVJ A;  1KD1 C;  4PJO A;  2RK1 A;  2MOX A;  2CP6 A;  4A4F A;  3G6E A;  5M9O A;  3M4Y A;  1K9A A;  2XK0 A;  5KYU B;  4LD6 A;  1UB4 A;  3MO8 A;  4YTL A;  2FPF A;  1IHV A;  1JRI A;  4BE1 A;  2E41 A;  2NYS A;  1LNX A;  5IHI A;  3CPW A;  1FWZ A;  4LE9 A;  1X43 A;  2NLU A;  2OTL Q;  4J7F A;  4FCY A;  3PVQ A;  3VU3 C;  1R77 A;  4EMK C;  1EFN A;  1YWP A;  5KCH A;  4AFZ C;  4BI8 B;  1VOM A;  3MP1 A;  4E7S A;  1K9M R;  3RKY A;  4MDX A;  1ACM B;  1HJD A;  4QQ6 A;  2F2X A;  2EGA A;  3C4S A;  1BI2 A;  2GTO A;  4M78 B;  2K79 A;  2VC8 A;  3JSC A;  2L8D A;  1Q86 R;  4RMO A;  1RAE B;  2HQE A;  4EMH A;  2LCL A;  5HKC A;  1N6A A;  5A0D A;  1UG1 A;  2L0A A;  3G71 Q;  1BIB A;  2LVM A;  4OVA A;  1G3T A;  1VA7 A;  4KH0 B;  1IRX A;  1M1K R;  1G3W A;  5IXB A;  2M16 A;  2CP5 A;  2D0Q B;  5CAI A;  4PL6 A;  4DQ2 A;  2YUP A;  2KK4 A;  4M75 E;  4M4Z A;  2QTV A;  1U5S A;  2QAS A;  1VQ4 A;  5D6Y A;  1YNZ A;  4BB7 A;  2ZPH B;  2RO0 A;  4WF2 A;  1OZ2 A;  4A54 A;  3M5A A;  2PTK A;  1VQK A;  1IO6 A;  3OYF A;  5FU7 B;  3JB9 I;  1JO8 A;  5AYF A;  2FRW A;  3JCM g;  4ZNX A;  1NJI R;  2EJG A;  3M0S A;  3J80 E;  2LQW A;  1K73 U;  2AK5 A;  3LGF A;  2DIG A;  3OS0 A;  2DX1 A;  4JS4 A;  1X27 A;  2YWW A;  3RIR A;  5GAO l;  1UE9 A;  1Q82 C;  2FZG B;  2VUB A;  1AHJ B;  1RLQ C;  4M78 C;  2O4X A;  3G6E Q;  2EPD A;  1E6G A;  1K9M C;  4LDV A;  1FXX A;  4DBH A;  2QGF B;  4M7D G;  3CBO A;  4L5G A;  5FLX E;  2GFA A;  3X26 B;  1YBY A;  1NBE B;  1T3L A;  1BB9 A;  5EG2 A;  1Q86 C;  1N27 A;  3H6Z A;  3HFO A;  3UA6 A;  2J06 A;  2CT3 A;  4FW1 A;  3JCM J;  2ECZ A;  3CCV A;  1WXU A;  5GJW B;  4N4I A;  4OMF B;  1QCF A;  5CR2 A;  3BDU A;  3TCJ A;  1YJN A;  1S72 T;  4J6W A;  4D6W A;  2K5F A;  4OB1 B;  5FU7 C;  2E5K A;  2YRV A;  1IRE B;  5FU6 B;  1J3T A;  2BZ8 A;  4JJB A;  2KAF A;  4JJN K;  4QVD A;  2HCK A;  2DO3 A;  2DZ9 A;  3A1P A;  4JLI A;  2DMO A;  4NOY A;  2VV5 A;  2C06 A;  4IIO A;  4HCK A;  1U1S A;  3M59 A;  2KRM A;  1G3Y A;  3VS2 A;  4QT7 A;  2JM8 A;  3SHW A;  2XDP A;  4M75 G;  3QYH B;  1W2B A;  4HKE A;  5KCO A;  2FPE A;  3I56 T;  3CQT A;  2BKD N;  3H0H A;  1Y57 A;  2CUB A;  4QQG A;  1WIE A;  3QDF A;  2QQ9 A;  1D3B B;  1VQ4 Q;  1VQM T;  1OPL A;  1I1J A;  2K3B A;  4EMK A;  2ESW A;  4JJD A;  3NPF A;  4FIB A;  1V1C A;  4FYY B;  1VQK Q;  2IIM A;  5GJV B;  1N9S A;  1WHJ A;  2MAM A;  1MND A;  1UGV A;  3EFO B;  2YUO A;  4J6Y A;  1Q7Y U;  2E3H A;  3OYA A;  2F2V A;  1WI7 A;  5LJ3 j;  1TS9 A;  2H3E B;  1UUE A;  2Y4X A;  4ZTJ A;  2COW A;  2QEX T;  3OYM A;  2QK0 A;  1ABO A;  3KBG A;  2O31 A;  5GMK j;  3WVE B;  5CKE A;  3CCS A;  4M77 C;  5CK9 A;  8ATC B;  2WSE E;  5LJ3 e;  2CKK A;  3M53 A;  3S3N A;  4OMM A;  2KEA A;  1RI0 A;  5GMK e;  4RTW A;  5GMK l;  2FEI A;  3BE3 A;  1KC8 U;  4XU2 A;  1Y0M A;  4C8Q D;  5J26 A;  2Y4Y A;  5DLQ E;  2KR3 A;  2JW4 A;  1TG0 A;  3PNW C;  2X3W D;  1WYX A;  2R57 A;  3EGU A;  3HTR A;  2DNU A;  4RTV A;  1UTI A;  1H3Z A;  2K6D A;  2X3X D;  1AZE A;  2LQ8 A;  2YT6 A;  5GAO p;  4M7A D;  3CCV Q;  4JUV A;  4FU6 A;  1YJN Q;  1OI1 A;  5GAN 4;  3L2Q A;  4KUI A;  4Y28 E;  3RMQ A;  2M9U A;  2W10 A;  1PHT A;  2A0F B;  2M0O A;  4E7J A;  2J6K A;  2HKN A;  1BU1 A;  2VGM A;  1R0B G;  2BE7 D;  2X51 A;  3CBP A;  1QKW A;  3M0P A;  4C5I A;  1MMG A;  2J7I A;  5IT9 E;  4M78 A;  1IGQ A;  2R5A A;  3V7C A;  3A8L B;  3DB4 A;  4PJO B;  2CYZ B;  5IXF A;  3VS7 A;  3CCJ T;  1QVF A;  2KT1 A;  3PGG A;  2CZ0 B;  5I2M A;  1QP2 A;  1ZUU A;  3FIF A;  1JB0 E;  3RER A;  4OML A;  2E3I A;  4J5Y A;  1RAF B;  1VQP A;  3C12 A;  2M51 A;  4N4G A;  4HVU A;  4E2F B;  1VQ5 T;  3QII A;  5HY6 A;  2RQV A;  2K2M A;  5CKB A;  4FYX B;  1YJ9 T;  4E7L A;  1NLO C;  1K0S A;  2ZZD A;  3FRN A;  3RMS A;  4E7H A;  4F04 B;  2LDM A;  2LJ3 A;  2SEM A;  4RG2 A;  2V26 A;  4B9X A;  3ZBD A;  4HA8 A;  1B07 A;  1VQ6 A;  2GTJ A;  1UGQ B;  3HRT A;  2KSS A;  4C92 E;  2RHX A;  1WJR A;  2ZPE B;  3OY9 A;  1OU8 A;  1T0J A;  3G7Z A;  1QVP A;  1E6H A;  5DLO A;  1CSK A;  5FWB A;  3JB9 D;  2E6N A;  1RAC B;  4AFU C;  3FC3 A;  4A63 B;  2ZAE A;  1QKX A;  4N0A C;  1KQ2 A;  4PJO C;  4IUU A;  2BTT A;  1YFN A;  1UGP B;  3H0I A;  3JCM W;  4J83 A;  1JXO A;  2VYT A;  3H0F A;  2M1H A;  2VXF A;  2QQB A;  3I35 A;  4EIK A;  4J9H A;  1X6B A;  2KT8 A;  2DFU A;  2JNG A;  2XD0 A;  2CT4 A;  2EQI A;  3CD6 T;  4XU0 A;  2J05 A;  3E9F A;  1M8M A;  3OBW A;  3JCM Q;  1BI0 A;  3NTH A;  1H64 1;  5FW9 A;  2FVU A;  5GAO q;  1AEY A;  3OW2 P;  3FDR A;  3OW2 S;  1VQ9 T;  3CCM T;  3V8K A;  1XTD A;  3I5R A;  1ZQ1 A;  2OTJ T;  4KRT A;  4BD3 A;  4M78 F;  4FYW B;  1KFZ A;  1HSQ A;  4ORZ A;  1JJ2 A;  1M8V A;  2DL7 A;  1Y7X A;  3REB B;  3SEM A;  3OS5 A;  3DLM A;  4J9D A;  1WDX A;  3A8M B;  2HQH A;  2D1X A;  4FM4 B;  4BE2 A;  1A0N B;  4RTT A;  3M55 A;  3MHX A;  2QA4 A;  2AZS A;  2OTJ A;  1ZUK A;  5IH2 A;  4HCB A;  1VQP Q;  5GAN j;  3MKD A;  4MDW A;  2RJC A;  1D3B A;  1BKB A;  4DBF A;  3QZ5 B;  1LVK A;  1KD1 R;  1IZ6 A;  3VUZ A;  4J7I A;  3G4S A;  3F70 A;  2ZCF B;  3EFO A;  2DJZ A;  4C92 A;  2YSQ A;  1KIK A;  3DB3 A;  5GAM f;  1K8A U;  2AIR B;  2DTI A;  3INZ A;  4BI4 A;  3L42 A;  2J6O A;  2EYQ A;  1VQL A;  1WXB A;  3OYL A;  3OSS C;  2XID A;  3FLG A;  1VQ6 Q;  3E9G A;  1YP5 A;  2A3L A;  1YIJ T;  3VYH B;  2E12 A;  4NL3 A;  1EZZ B;  3X20 B;  5KH6 A;  2DE0 X;  2YRC A;  4M75 B;  3G71 A;  5GMK i;  2R5M A;  2KMT A;  1D0Z A;  3GNG A;  4GY5 A;  3CC4 A;  3UAT A;  3PIO A;  2ZPG B;  4IUQ A;  2KRO A;  2JTF A;  3SFM A;  5I11 A;  1SKU B;  2WAC A;  4QKU A;  4HXJ A;  1GBR A;  2K9G A;  3EH2 A;  1G83 A;  3OBY A;  3FEO A;  1UDL A;  2KQW A;  3CC7 T;  1OUL A;  2K57 A;  2O88 A;  3KXT A;  2OX7 A;  2G3R A;  2KI7 A;  1ARK A;  2HSE B;  3EHR A;  1M90 U;  4FSX A;  4PK4 A;  4GBQ A;  3CCE T;  4MZM A;  4C8Q G;  1RAB B;  3LWH A;  1MMD A;  3CC7 A;  2OI3 A;  5CKF A;  1VIE A;  2YLC A;  5A2Q E;  4L6V 5;  4X9D A;  1TUG B;  1QVG P;  1QVG S;  3R6O A;  1WNL A;  5LJ3 f;  1VQ9 Q;  2FZK B;  1RAA B;  2QA4 Q;  4M75 C;  2OTJ Q;  3LLR A;  2RB6 A;  4M7A G;  3CCL A;  4B6M A;  3JB9 H;  2E5Q A;  4RCC A;  2RM4 A;  4Y92 A;  2RD1 A;  3H8Z A;  1BK2 A;  5IHN A;  1Q82 R;  1ZA2 B;  5AT1 B;  1HK9 A;  3V8J A;  4M7D E;  4A4H A;  2EQM A;  4D8D A;  4XU1 A;  4M78 D;  4KH1 B;  3RKX A;  1G5V A;  1BCO A;  3G4S Q;  4JDS A;  4XU3 A;  3EG9 B;  1ZSZ A;  2EYX A;  4XQ3 A;  4ATO A;  3MP6 A;  3WXM B;  3Q1J A;  1QCN A;  1MNE A;  1VQL Q;  3VV0 A;  1KHI A;  2YHT A;  5A0G A;  2HAX A;  2E70 A;  2AKL A;  1HYO A;  2D8J A;  4P5N A;  1ZBJ A;  2O01 E;  2RQU A;  1UJY A;  1X6O A;  4BDY A;  5GAN 2;  3QDR B;  2BIV A;  3CMA T;  2JS2 A;  4XTZ A;  1PRM C;  3TEE A;  3M0Q A;  3LX7 A;  3OYC A;  1G2B A;  1NZ9 A;  3CC4 Q;  1D0Y A;  3CCU T;  4A53 A;  3EGD A;  3L2W A;  1UGS B;  3OQ5 A;  2RI5 A;  1KSW A;  1K73 R;  3RKW A;  4ESR A;  2CUD A;  2DTH A;  1YI2 T;  2VVK A;  4AFQ C;  4IUV A;  4HT9 A;  3ER0 A;  1KHC A;  3GIB A;  2ED1 A;  3CEY A;  1M3B A;  1PKT A;  3S3O A;  1BCM A;  4AG1 C;  1FYN A;  4JRK A;  5LJ5 j;  3CME T;  3JB9 G;  4ANJ A;  3I55 T;  2LP5 A;  4R0K A;  3EFS A;  1ZX6 A;  2HZY A;  1XNI A;  1VQN T;  4A4K A;  3CCR T;  4ELZ C;  3HFN A;  1M1K U;  3BY7 A;  2EWN A;  2GFU A;  3CC7 Q;  3VRZ A;  3L2V A;  4PJO F;  1K76 A;  5EC7 A;  2BZX A;  4OB0 B;  3PT9 A;  3BFM A;  2RHU A;  1LPL A;  1X6G A;  1R8O B;  4F7U G;  5GAM j;  1QWE A;  3QYG B;  3GPL A;  1T0H A;  2DXC A;  3QPH A;  3REA B;  4M7D A;  1AWO A;  4DOW A;  4PJJ A;  3CCL Q;  3GNF B;  3SWN B;  4M77 D;  1I4K 1;  2A37 A;  4KUD K;  2CGH A;  5GAM e;  1YWO A;  2A7Y A;  3R6N A;  1AOJ A;  2GCX A;  1NJI U;  2E4H A;  3QBY A;  4JZ4 A;  3UPU A;  1WJQ A;  4O5V A;  2DTO A;  1WGS A;  5D6W A;  2EYW A;  2DXU A;  3VS0 A;  1RL2 A;  2DL8 A;  3LGL A;  1IB8 A;  2Z0W A;  3O5Z A;  4IUT A;  1K73 C;  2GGR A;  3M56 A;  1X69 A;  4DOV A;  4OF1 A;  4QQD A;  2KBT A;  2EFI A;  3MP8 A;  4BDZ A;  1B7T A;  4C0G A;  4XTW A;  5D6X A;  4J9F A;  2KRN A;  3OSV A;  1S72 A;  4LN2 A;  2B86 A;  2CH4 A;  5I22 A;  4X9C A;  3VYG A;  5HK3 A;  4M75 A;  4KT0 E;  3VS5 A;  9ATC B;  2RQW A;  2VWF A;  1Q7Y R;  1NM7 A;  3G1J A;  1FMW A;  2ZPI B;  3CC2 T;  2JTE A;  2ZPB B;  3QSU A;  2QTX A;  2PNI A;  5HCK A;  3HL8 A;  1OZ3 A;  1WHK A;  2LT1 A;  3GLX A;  1PSE A;  2MYS A;  2RPN A;  1VQ8 T;  4QVZ A;  3I56 A;  3E19 A;  1OX8 A;  2DD4 A;  2CP3 A;  2FYK A;  2X35 A;  1BIA A;  4C92 B;  5L8R E;  3EG0 A;  5KYW B;  5GAN 3;  2GNC A;  1GCQ A;  1G3S A;  3HSB A;  1RAG B;  3JRZ A;  2XDB A;  5FRM A;  1CKB A;  1VQM A;  3QZ9 B;  5GAN f;  2JUF A;  3I5S A;  4C5E A;  5FU6 C;  1XJW B;  2RQT A;  1PNJ A;  3VJP A;  4F17 A;  3MCA B;  1VQ8 A;  2VB6 A;  3L1A A;  5IN1 A;  3IQL A;  4ZTF A;  2DXB A;  1LCK A;  2PU9 B;  4LD9 K;  2A08 A;  1N8R U;  2DEQ A;  3JV3 A;  2QEX A;  3UT1 A;  2L3P A;  1I81 A;  1I8F A;  2DIL A;  1WXT A;  2DL4 A;  3HRS A;  5LJ3 h;  2V1R A;  3RDV A;  5FRO A;  1KJW A;  1ZSG A;  2CP2 A;  3LH0 A;  4ELY C;  1AWW A;  5GMK h;  1W6X A;  2LMJ A;  4GLK A;  2XKO C;  1NEB A;  2CRE A;  2RHZ A;  1MV3 A;  1ZHI A;  1SEM A;  1C1A A;  2PZ1 A;  4A4G A;  5CKH A;  4PJO D;  1AT1 B;  1Q7Y C;  3ZL7 C;  3A98 A;  3EG9 A;  3ASK A;  1SRM A;  2QAZ A;  4NS5 A;  5CCA A;  2CH4 W;  2JT4 A;  4C92 C;  1M5Q 1;  2HL3 A;  2K5I A;  3OYJ A;  4JRP A;  4C8Q B;  1YJW T;  1JXM A;  1QW1 A;  1SRL A;  1CKA A;  3OYI A;  5C6S A;  3JAM E;  3KUF A;  4JS5 A;  2QDL A;  2CZ1 B;  1VQO T;  2DK3 A;  5LL6 S;  1S72 Q;  4M75 F;  3BDL A;  2YDL A;  3CXC P;  2YUQ A;  1M1F A;  1KQS P;  3CXC S;  1KQS S;  2XU8 A;  3NTK A;  5LJ3 d;  1KC8 C;  3MEV A;  2DRM A;  2XIC A;  4M7A B;  2AKK A;  4C5H A;  4DA4 A;  2DIQ A;  3EG1 A;  1VQO A;  3CCJ A;  2EBP A;  2NWM A;  2IG0 A;  2YRD A;  4Z89 A;  5I21 A;  2LCC A;  1LOJ A;  3I56 Q;  1YCY A;  2FRY A;  2D9T A;  1ZSZ B;  1RAI B;  2LQN A;  3GF5 A;  1I07 A;  4OGC A;  4PFZ A;  4RTU A;  2KE9 A;  4C0F A;  2EQK A;  1VQM Q;  1VQ5 A;  5DY9 A;  4J9B A;  3JCM P;  3QKJ A;  2K2V A;  1WHG A;  4XTU A;  4V2S A;  3OW2 A;  3CPF A;  1VQ8 Q;  1T3S A;  1YJ9 A;  4B9W A;  1D1C A;  3M0U A;  3M58 A;  2MMP A;  4TVR A;  2A28 A;  4OMP A;  2EQU A;  2QEX Q;  2NUP A;  3DLL A;  1ZBX A;  2V1Q A;  3EGD B;  2J6F A;  4X1V A;  1GCP A;  3M57 A;  1YIT T;  1Q81 U;  1HD3 A;  1QLY A;  4PFO A;  2RI3 A;  3SWN A;  3VUB A;  1D1B A;  3X25 B;  1ABQ A;  3L2Z A;  5FWC A;  2EQJ A;  1NPR A;  2X4X A;  4OMO A;  5IAY A;  2L2P A;  3PTA A;  2RI2 A;  1PM3 A;  5KYY B;  1NLP C;  5KYX B;  2RJD A;  1Y07 A;  4AMC A;  2HKQ B;  2EKH A;  2L89 A;  3M54 A;  1ZSZ C;  2DVE A;  2ENM A;  5J3B A;  2BZY A;  2QQS A;  4K11 A;  3RES A;  3LH5 A;  4Z02 A;  1MMN A;  3CD6 A;  1PG5 B;  1GL5 A;  3TVT A;  1YN8 A;  1WPY A;  5GAN 7;  3GOX A;  2LX7 A;  1BI3 A;  1R0C B;  4FW2 A;  4M77 G;  3H9N A;  1UGR B;  4C8Q E;  3TSZ A;  3QUI A;  5I2S A;  1VQ9 A;  3CCM A;  2XDD A;  2EYZ A;  1TU0 B;  2ROT A;  4M7D B;  5LJ5 f;  1VYV A;  3GBQ A;  1YJW Q;  3EHQ A;  3V8L A;  1VQO Q;  4NL2 A;  2KDS A;  1NYF A;  3CCJ Q;  4PJN A;  3HRU A;  4J6X A;  2DL3 A;  2DPP B;  4M7A E;  1GRI A;  1SG5 A;  3SD4 A;  2K7A A;  5GAN e;  4BY6 B;  2ZPF B;  4C0D B;  2YLB A;  3QWY A;  5KYW A;  4BUG A;  4JPB W;  4XAX B;  3OYY A;  4WTO B;  1VQ5 Q;  5CQX A;  2DYB A;  1WHL A;  3M4G A;  1E7O A;  3GP8 A;  1MMA A;  1B34 B;  1YJ9 Q;  5GAN 6;  5GAN h;  5HK0 A;  1RLP C;  2EYY A;  1OOT A;  4RUG A;  2HBP A;  2JOY A;  3L2R A;  1TUC A;  2F5K A;  2XG8 D;  2YUN A;  4FT4 A;  1QVG A;  3J81 E;  2C0I A;  2MWP A;  1WLP B;  1ZLM A;  1YIJ A;  2PQW A;  1KD1 U;  3OYB A;  1M30 A;  4M7D C;  1WFW A;  4MZT A;  5J39 A;  2MPX C;  2CSQ A;  2KGT A;  3FJP A;  1VIF A;  2DZC A;  4OB3 B;  1MUZ A;  2XHC A;  4KGZ B;  5CIU A;  3HHT B;  2ROL A;  4L59 A;  5GMK m;  3QXE B;  4JRQ A;  3JB9 J;  4FT2 A;  1X01 A;  4ZGD B;  4II1 A;  4BY6 C;  1K8A C;  4C0D C;  2HBW A;  2DAQ A;  1XQH A;  5GAN d;  2KY9 A;  5ECA A;  4R56 A;  4JJC A;  4C8Q A;  3CD6 Q;  2JTM A;  1JU5 C;  1PCX A;  2EAY A;  1FMV A;  5KE2 A;  3OS1 A;  2RJE A;  5LJ3 g;  3VS1 A;  1OPK A;  3G6E T;  1UJ0 A;  4CC2 A;  1D1A A;  2C0T A;  1OQK A;  3KFV A;  1RAD B;  3CCM Q;  4E7K A;  1NPP A;  2LNH B;  1UHF A;  3CCE A;  4RKU E;  1LJO A;  4M7A A;  2F69 A;  3JCM c;  1PWT A;  5GAO n;  2MCN A;  2ZGW A;  2HDA A;  2FHD A;  4DEY A;  4PJO G;  4F7U E;  3NMZ C;  1GFD A;  4WCI A;  2FL7 A;  2L3S A;  4J9I A;  3MEU A;  1PD0 A;  3P8H A;  1QQJ A;  4C92 F;  2CSI A;  2FZC B;  3C0C A;  4OGE A;  3LYI A;  3OYH A;  2LJ0 A;  1Z9Q A;  4IIM A;  2O2O A;  2VAS A;  4X34 A;  3PIP A;  1BI1 A;  1GCQ C;  1M90 C;  4PKC C;  4MML A;  1I0C A;  2KYB A;  2AHJ B;  3LWI A;  4LDU A;  4ZGJ B;  1PSF A;  1NEG A;  2ED0 A;  2FO0 A;  2KRS A;  3D7S B;  3URG A;  2QQA A;  2CP7 A;  5CKD A;  3MET A;  4HCC A;  1Q82 U;  3SB2 A;  1M4Z A;  1JBM A;  4LDW A;  1AZG B;  1YIJ Q;  2X4Y A;  2NUZ A;  1VQ4 T;  1K1Z A;  3OMC A;  4EDU A;  4ZN3 A;  3CMA A;  2NUT A;  1EX4 A;  1VQK T;  3JCM X;  1SPK A;  1K9M U;  2HMA A;  1AWX A;  3MJX A;  4ME7 A;  3CPW P;  2DD5 A;  1X75 C;  4PFP A;  3CPW S;  2IPO B;  2JJ9 A;  1OV3 A;  2MWO A;  2JZ2 A;  3CCU A;  1M9S A;  5KYY A;  5KYX A;  3A8H B;  2RF0 A;  1Q86 U;  2PUO B;  1M27 C;  1OU9 A;  1DJ7 B;  2RJF A;  2HSP A;  3OYN A;  2DL5 A;  1YI2 A;  3EG2 A;  4CRI A;  2KYM A;  2EVR A;  3TSW A;  4C8Q F;  4OB2 B;  3ZFJ A;  3E1S A;  3UA7 A;  5LJ5 e;  1QCO A;  1N5Z A;  3QJ6 A;  2EKO A;  2LNV A;  3C94 A;  4XK8 E;  4C5G A;  2NUP B;  3JCM f;  4JRI A;  4KGV B;  3CME A;  1M2V B;  4GLM A;  3I55 A;  1M2O A;  4Y91 A;  4F7U A;  4CI0 C;  2GQV A;  4M7A F;  3CCE Q;  4LNP A;  1VQN A;  1P92 A;  3CCR A;  1HXD A;  2B8A A;  4CC4 B;  5GAN 8;  5LJ5 h;  4HVW A;  4PNO A;  1WHM A;  1VUB A;  1C0M A;  1WZO A;  1Y71 A;  2YXY A;  2F1L A;  1MGQ A;  3CCV T;  3JCM b;  2RQR A;  2FG0 A;  2P84 A;  2AT1 B;  1U1T A;  2QQR A;  2M02 A;  4LDX A;  3EGX B;  1YJN T;  3UDC A;  1WQ7 A;  1Z9Z A;  4J9C A;  4R55 A;  2PVG B;  4AG2 C;  4FYV B;  4XTV A;  3LW5 E;  4PJM A;  4E47 A;  1WX6 A;  5GAM h;  2COY A;  1PD1 A;  2K3Y A;  2EIF A;  1TTH B;  4QW2 A;  1B3Q A;  1SF9 A;  2GQI A;  1B34 A;  2FB7 A;  1M1K C;  2P0Q A;  3QHS A;  1I5O B;  2HQX A;  2O9V A;  2P4R A;  4M77 B;  1OEB A;  3M9Q A;  1M3C A;  2H8H A;  3ULR B;  2VGN A;  4EPC A;  2MF2 A;  5LJ5 d;  2CS7 A;  3FJ5 A;  4C92 D;  2F2W A;  1JQQ A;  2EGE A;  6AT1 B;  1M1G A;  2L5Q A;  3RUX A;  1K0X A;  3CMA Q;  2KVQ G;  3SWN C;  4KUL A;  3WVD B;  4M78 E;  1NJI C;  3T9N A;  1BBZ A;  1QP3 A;  2COZ A;  2HNI A;  1FX7 A;  4ZGE B;  4PLI A;  1UHC A;  3E2U A;  2DKG A;  1KK7 A;  3CCU Q;  2JM9 A;  1X2K A;  1N8R R;  1Y96 A;  3EFR A;  2LT4 A;  4IUP A;  4AT1 B;  5GAM d;  3OYE A;  3CC2 A;  5GAN g;  1KC8 R;  4Z8A A;  1X2Q A;  3JB9 F;  1ZUY A;  1NYG A;  2GBQ A;  3JCM V;  2JMC A;  3OMG A;  3CCS T;  1YI2 Q;  3CBM A;  2P4T A;  5CVI A;  2E65 A;  2K4Y A;  4LUE A;  2I0N A;  3I9Q A;  3V7S A;  3CCQ T;  2CZ6 B;  3X28 B;  3OYK A;  2I2L A;  2JXB A;  2QDY B;  1O75 A;  4F7U F;  3CME Q;  5IHK A;  3I55 Q;  1WHH A;  2V8K A;  3A8O B;  3CXC A;  1KQS A;  4M7D F;  2OAU A;  5FRN A;  2V8I A;  1VQN Q;  3CCR Q;  2DYI A;  1W2B P;  3NGP A;  2X4J A;  1W2B S;  3VRY A;  3CCQ A;  3PFS A;  2D8H A;  1D09 B;  2EJF A;  2JN0 A;  4VUB A;  2HEQ A;  2JS0 A;  1TXQ A;  5KYU A;  1XOV A;  4FSS A;  3S3M A;  3N5B B;  1C6V X;  2CP0 A;  2LQK A;  4QVC A;  4DEX A;  4RG8 A;  1SSF A;  4OP0 A;  2L3Q A;  1TSF A;  4KGX B;  2R58 A;  1MV0 B;  4RTZ A;  4PLL A;  2LX9 A;  1RUW A;  1F1B B;  5CO7 A;  2V8J A;  2DBK A;  5D7U A;  2H3J A;  1K4U S;  4A4E A;  2LRQ A;  2X4W A;  2PUK B;  4C0Z A;  3OYG A;  1N8R C;  2JVV A;  3QWX X;  1AD5 A;  1M3A A;  4DBR A;  2E6Z A;  1RAH B;  4M78 G;  1YHQ T;  1YJW A;  1VQP T;  2K3X A;  4M77 E;  1VQ7 T;  4IUR A;  4BI3 A;  2F5T X;  1H92 A;  4HCZ A;  2GF7 A;  3EAE A;  1KG1 A;  2E1H A;  2HL5 C;  1GBQ A;  2BUD A;  1AWJ A;  1YHQ A;  1W1F A;  3CC2 Q;  1OYX A;  3P8B B;  2QGG A;  1VQ7 A;  2ABL A;  5L23 A;  1QMC A;  1FMK A;  4EMG A;  1VQ6 T;  1WJS A;  2EW3 A;  1PRL C;  4CC3 A;  1MHN A;  3JCM e;  4OMN A;  3VS3 A;  4KBM B;  2ATC B;  1Q81 R;  1V76 A;  2CDT A;  1EIF A;  2KXC A;  5DM7 R;  1UEC A;  4UC4 A;  1WA7 A;  1H3H A;  2D6F A;  3PMT A;  4C8Q C;  3VS6 A;  5C0M A;  2LTO A;  1WQW A;  2PVD B;  1UEB A;  3M0R A;  4F14 A;  2XI9 A;  3NHN A;  2QXF A;  2VKN A;  2QYZ A;  1QWF A;  1M2V A;  3CCS Q;  2RMO A;  3OS2 A;  2DJQ A;  2SRC A;  3JCM h;  2PVO B;  2XMF A;  1QVF P;  1IHW A;  4AFS C;  3UF4 A;  1QVF S;  2MI6 A;  2NUT B;  1IXD A;  3CCQ Q;  3ZEH A;  4M7A C;  3MPU B;  1W70 A;  3OB9 A;  3J7A F;  5GAO m;  2RA2 A;  2O9S A;  4CC7 A;  2E10 A;  1ZA1 B;  1W4S A;  2RHY A;  1H8K A;  4RTX A;  3P8D A;  2FPD A;  4J8O A;  3U23 A;  3EGX A;  3TRE A;  3BW1 A;  3OYD A;  1YIT A;  3EG3 A;  5KE3 A;  4Z88 A;  1YCS B;  3RNJ A;  3MEA A;  1GFC A;  1KQ1 A;  4J9G A;  1JEG A;  1SHG A;  1IGU A;  5CQY A;  3VKI A;  2EJ9 A;  1UFF A;  3NFC A;  4M7D D;  1V29 B;  2AZV A;  1GXI E;  4XTX A;  1VYU A;  3OA6 A;  1U8R A;  4F16 A;  4E6R A;  4BE0 A;  3TQ7 P;  2X9H A;  2LZ6 B;  4LXC A;  3HPW A;  3QJY A;  5LJ5 g;  4M77 A;  2P0P A;  2QI2 A;  3JCM d;  3RR6 A;  3X24 B;  4F7U B;  2QA4 T;  3UWN A;  3L2U A;  2BE9 B;  1S1N A;  2DER A;  4JZ3 A;  2M0Y A;  7AT1 B;  1K8A R;  1NG2 A;  1U06 A;  2KXD A;  3FB9 A;  2RH2 A;  2OTL T;  1Q81 C;  1G8X A;  2O4X B;  4N4H A;  3PE0 A;  2MK5 A;  1O9S A;  8AT1 B;  5GAO r;  5GAM g;  3G4S T;  4Q5W A;  3V7R A;  4D8K A;  4PJO E;  1Q95 G;  1BYM A;  1YHQ Q;  2LJ1 A;  3QG1 A;  4M75 D;  1VQL T;  1VQ7 Q;  2OTL A;  2C0O A;  2CZ7 B;  2DRK A;  3TU4 K;  2OAW A;  2IVW A;  2JMA A;  4JLG A;  3HP9 A;  3AT1 B;  4C92 G;  1TH7 A;  3G71 T;  4LUD A;  2DBM A;  1D0X A;  2DEU A;  4RCB A;  2D0N A;  4IKF A;  2RK2 A;  3CC4 T;  3C95 A;  5GAN 5;  1JJ2 P;  1I5L A;  1SSH A;  1JJ2 S;  2LC4 A;  1OX9 A;  4E7Z A;  4MZP A;  2DM1 A;  2EGC A;  3NTI A;  2MIO A;  4MMK A;  2WSF E;  1M90 R;  3S6W A;  1TOV A;  2DXT A;  3AHU A;  3VS4 A;  4PJL A;  2Y90 A;  4LDY A;  4BAC A;  2G6F X;  2DET A;  4XTY A;  3THK A;  2RHI A;  2LCS A;  1Y96 B;  2QG9 B;  2RNA A;  2P0K A;  5A0L A;  3MEW A; 
#chains in the Genus database with same CATH homology
 1KQ2 A;  4N0A C;  4PJO C;  4CRI A;  2WSC E;  3QO3 A;  4IUU A;  4C8Q F;  4OB2 B;  4EMK B;  2PU9 B;  4LD9 K;  3ZFJ A;  3E1S A;  1UGP B;  1N8R U;  3ME9 A;  2DEQ A;  5LJ5 e;  3A8G B;  1N9R A;  4ZN1 A;  3FC3 A;  2QEX A;  3JCM W;  4J83 A;  2VYT A;  3UT1 A;  2HD0 A;  3QJ6 A;  2M1H A;  4FL6 A;  2VXF A;  1I81 A;  2QQB A;  2EKO A;  3SDZ A;  2LNV A;  1I8F A;  3C94 A;  4XK8 E;  4C5G A;  3HKS A;  3A5Z B;  3JCM f;  4JRI A;  3O8V A;  2JNG A;  3HRS A;  5LJ3 h;  3CME A;  3I55 A;  2XD0 A;  4Y91 A;  5FRO A;  4F7U A;  3CD6 T;  4CI0 C;  4XU0 A;  4M77 F;  3LH0 A;  2GQV A;  4E7I A;  3E9F A;  3PMI A;  4ELY C;  4M7A F;  3OBW A;  1VQN A;  3DKM A;  1P92 A;  3CCR A;  1HXD A;  3JCM Q;  2L3R A;  1BI0 A;  5GMK h;  2B8A A;  2K5L A;  3NTH A;  1H64 1;  4GLK A;  2FVU A;  2XKO C;  5GAN 8;  2RHZ A;  5LJ5 h;  5GAO q;  4PNO A;  1ZHI A;  3CCL T;  1VUB A;  3FDR A;  1NE8 A;  3OW2 S;  1VQ9 T;  4HT8 A;  3CCM T;  2VXE A;  3V8K A;  1XTD A;  1Y71 A;  4A4G A;  5CKH A;  4PJO D;  3CCV T;  1MGQ A;  1ZQ1 A;  3JCM b;  1Q7Y C;  2OTJ T;  3ASK A;  4BD3 A;  4O6J A;  1U1T A;  2E64 A;  4M78 F;  4N0A A;  1KD1 C;  4PJO A;  2QQR A;  2RK1 A;  4NS5 A;  5CCA A;  4LDX A;  4A4F A;  4C92 C;  1YJN T;  3G6E A;  1M5Q 1;  1JJ2 A;  1M8V A;  1Y7X A;  2K5I A;  3M4Y A;  3UDC A;  2XK0 A;  5M9O A;  1WQ7 A;  3OYJ A;  3OS5 A;  1UB4 A;  3MO8 A;  4LD6 A;  3DLM A;  1JRI A;  4YTL A;  4C8Q B;  2E41 A;  4R55 A;  4BE1 A;  1YJW T;  1QW1 A;  2PVG B;  3A8M B;  4XTV A;  1LNX A;  4FM4 B;  3LW5 E;  5C6S A;  3JAM E;  3KUF A;  3OYI A;  4JS5 A;  4BE2 A;  2CZ1 B;  3M55 A;  4E47 A;  1VQO T;  3CPW A;  3MHX A;  1FWZ A;  5GAM h;  2QA4 A;  2DK3 A;  5LL6 S;  2NLU A;  4M75 F;  3BDL A;  2K3Y A;  2OTJ A;  2EIF A;  1M1F A;  4QW2 A;  4J7F A;  3CXC S;  1KQS S;  2XU8 A;  1B34 A;  2FB7 A;  3NTK A;  1M1K C;  2P0Q A;  3QHS A;  4HCB A;  5LJ3 d;  2HQX A;  3VU3 C;  5GAN j;  4MDW A;  4EMK C;  1KC8 C;  4M77 B;  2RJC A;  3MEV A;  2XIC A;  4M7A B;  3M9Q A;  1BKB A;  1D3B A;  5KCH A;  4C5H A;  4DA4 A;  4BI8 B;  3QZ5 B;  3MP1 A;  2DIQ A;  2VGN A;  4EPC A;  1VQO A;  2MF2 A;  5LJ5 d;  2CS7 A;  4C92 D;  3RKY A;  4MDX A;  1IZ6 A;  3VUZ A;  4J7I A;  3G4S A;  3CCJ A;  3F70 A;  4QQ6 A;  2ZCF B;  2DJZ A;  2IG0 A;  1M1G A;  2L5Q A;  4C92 A;  3RUX A;  3DB3 A;  5GAM f;  3C4S A;  5I21 A;  1K8A U;  2LCC A;  1BI2 A;  1LOJ A;  1YCY A;  4M78 B;  2DTI A;  3INZ A;  4BI4 A;  2VC8 A;  3JSC A;  2D9T A;  2L8D A;  3L42 A;  2KVQ G;  2EYQ A;  1VQL A;  4RMO A;  3OYL A;  3SWN C;  3OSS C;  4KUL A;  2XID A;  3FLG A;  4M78 E;  2HQE A;  3WVD B;  3GF5 A;  4EMH A;  1NJI C;  2LCL A;  5HKC A;  4OGC A;  3E9G A;  3T9N A;  1N6A A;  2A3L A;  1QP3 A;  5A0D A;  2HNI A;  1BIB A;  1FX7 A;  2LVM A;  4OVA A;  4PLI A;  4C0F A;  1G3T A;  2EQK A;  4ZGE B;  1YIJ T;  3VYH B;  2DKG A;  2E12 A;  4NL3 A;  5DY9 A;  1VQ5 A;  1G3W A;  3X20 B;  3JCM P;  3QKJ A;  1Y96 A;  2K2V A;  2LT4 A;  3EFR A;  4IUP A;  5KH6 A;  4XTU A;  5GAM d;  2M16 A;  3OYE A;  5GAN g;  2D0Q B;  3CC2 A;  3OW2 A;  4V2S A;  4M75 B;  5CAI A;  3G71 A;  5GMK i;  3JB9 F;  2R5M A;  3CPF A;  4PL6 A;  3JCM V;  4DQ2 A;  1YJ9 A;  2KMT A;  3GNG A;  3OMG A;  4GY5 A;  4B9W A;  2KK4 A;  3CBM A;  4M75 E;  3CCS T;  2P4T A;  5CVI A;  2E65 A;  2K4Y A;  3CC4 A;  3M58 A;  1VQ4 A;  3PIO A;  2MMP A;  5D6Y A;  2ZPG B;  4BB7 A;  4TVR A;  4IUQ A;  2ZPH B;  2RO0 A;  4WF2 A;  1OZ2 A;  2EQU A;  2JTF A;  3V7S A;  4A54 A;  3M5A A;  2CZ6 B;  3CCQ T;  3SFM A;  1VQK A;  3X28 B;  3OYF A;  3DLL A;  1ZBX A;  2WAC A;  3OYK A;  2I2L A;  5FU7 B;  3JB9 I;  5AYF A;  2QDY B;  3M57 A;  3JCM g;  1YIT T;  1O75 A;  4F7U F;  1Q81 U;  3OBY A;  2RI3 A;  3SWN A;  2EJG A;  2V8K A;  3A8O B;  3FEO A;  3VUB A;  3CXC A;  1KQS A;  2KQW A;  4M7D F;  2OAU A;  3CC7 T;  5FRN A;  2V8I A;  3X25 B;  2K57 A;  3J80 E;  3L2Z A;  1K73 U;  2X4J A;  3LGF A;  2DIG A;  1W2B S;  3KXT A;  3OS0 A;  2EQJ A;  3CCQ A;  1NPR A;  2X4X A;  3PFS A;  4JS4 A;  2G3R A;  3RIR A;  5IAY A;  5GAO l;  3PTA A;  2EJF A;  2JN0 A;  2RI2 A;  4VUB A;  1Q82 C;  1M90 U;  2RJD A;  1Y07 A;  2VUB A;  4FSX A;  3CCE T;  2L89 A;  3M54 A;  4MZM A;  1AHJ B;  4M78 C;  4C8Q G;  1XOV A;  3LWH A;  2O4X A;  3S3M A;  2DVE A;  3N5B B;  2LQK A;  3CC7 A;  5J3B A;  3RES A;  2QQS A;  5CKF A;  1VIE A;  4QVC A;  2YLC A;  4RG8 A;  5A2Q E;  4L6V 5;  1SSF A;  4OP0 A;  4Z02 A;  1K9M C;  4LDV A;  4X9D A;  3CD6 A;  1FXX A;  4M7D G;  3CBO A;  1WPY A;  1QVG S;  5GAN 7;  3R6O A;  4L5G A;  5FLX E;  2GFA A;  3GOX A;  2R58 A;  1BI3 A;  1WNL A;  5LJ3 f;  3X26 B;  1YBY A;  4M75 C;  4M77 G;  3LLR A;  4PLL A;  2RB6 A;  4M7A G;  2LX9 A;  5EG2 A;  1UGR B;  1Q86 C;  1N27 A;  4C8Q E;  3H6Z A;  3CCL A;  3HFO A;  3QUI A;  5CO7 A;  2E5Q A;  5I2S A;  3JB9 H;  3JCM J;  2V8J A;  4RCC A;  3CCM A;  1VQ9 A;  2RM4 A;  2XDD A;  2RD1 A;  3H8Z A;  3CCV A;  4M7D B;  2H3J A;  5LJ5 f;  4N4I A;  4OMF B;  4A4E A;  2LRQ A;  2X4W A;  2PUK B;  5CR2 A;  4C0Z A;  3OYG A;  3BDU A;  3TCJ A;  1HK9 A;  1YJN A;  3V8J A;  1N8R C;  2JVV A;  4A4H A;  1S72 T;  3V8L A;  4J6W A;  4D6W A;  2K5F A;  2EQM A;  4XU1 A;  4M78 D;  4OB1 B;  5FU7 C;  2YRV A;  4NL2 A;  1IRE B;  5FU6 B;  2E6Z A;  3RKX A;  1G5V A;  2KDS A;  4M78 G;  1YHQ T;  1YJW A;  1VQP T;  4JDS A;  2K3X A;  3HRU A;  2KAF A;  4M77 E;  4XU3 A;  4J6X A;  4JJN K;  2DPP B;  4XQ3 A;  4QVD A;  4M7A E;  4ATO A;  1VQ7 T;  4IUR A;  3MP6 A;  3WXM B;  2DO3 A;  3Q1J A;  3SD4 A;  2DZ9 A;  4JLI A;  4NOY A;  5GAN e;  4BI3 A;  4BY6 B;  2VV5 A;  2ZPF B;  2F5T X;  4C0D B;  3VV0 A;  1KHI A;  2YHT A;  5A0G A;  1U1S A;  3M59 A;  2YLB A;  2C06 A;  2HAX A;  2E70 A;  1G3Y A;  4HCZ A;  2GF7 A;  3EAE A;  4P5N A;  4BUG A;  1KG1 A;  2XDP A;  2O01 E;  4M75 G;  2E1H A;  3QYH B;  1W2B A;  4BDY A;  1X6O A;  2BUD A;  4HKE A;  4XAX B;  5GAN 2;  3OYY A;  5KCO A;  1YHQ A;  3QDR B;  2BIV A;  5CQX A;  3I56 T;  3CMA T;  2BKD N;  4XTZ A;  1OYX A;  3M4G A;  3P8B B;  3GP8 A;  1VQ7 A;  3TEE A;  1B34 B;  1VQ6 T;  3LX7 A;  4QQG A;  1WJS A;  4EMG A;  3OYC A;  5GAN 6;  1MHN A;  3JCM e;  5HK0 A;  5GAN h;  1NZ9 A;  4KBM B;  2QQ9 A;  1D3B B;  2HBP A;  1VQM T;  2JOY A;  3L2R A;  3CCU T;  1EIF A;  4A53 A;  2F5K A;  4EMK A;  1UGS B;  3OQ5 A;  3L2W A;  5DM7 R;  2RI5 A;  2XG8 D;  4FIB A;  4UC4 A;  2D6F A;  3PMT A;  1N9S A;  4C8Q C;  2MAM A;  5C0M A;  4FT4 A;  1QVG A;  2LTO A;  3RKW A;  3J81 E;  2DTH A;  1YI2 T;  4J6Y A;  1WQW A;  2MWP A;  1Q7Y U;  2PVD B;  3OYA A;  1UEB A;  4IUV A;  4HT9 A;  1YIJ A;  2XI9 A;  3ER0 A;  5LJ3 j;  2PQW A;  2QXF A;  1KD1 U;  1KHC A;  3OYB A;  2Y4X A;  4M7D C;  3GIB A;  3CEY A;  4ZTJ A;  2QEX T;  3OS2 A;  3JCM h;  4MZT A;  3OYM A;  3S3O A;  2PVO B;  5J39 A;  3KBG A;  5GMK j;  3FJP A;  1VIF A;  2DZC A;  2MI6 A;  1QVF S;  4OB3 B;  5CIU A;  2XHC A;  3WVE B;  5CKE A;  3CCS A;  4M77 C;  5CK9 A;  4JRK A;  3ZEH A;  2WSE E;  5LJ3 e;  5LJ5 j;  4M7A C;  3HHT B;  2CKK A;  3CME T;  3M53 A;  3JB9 G;  3OB9 A;  4L59 A;  5GMK m;  5GAO m;  3I55 T;  3S3N A;  2RA2 A;  3J7A F;  3EFS A;  2E10 A;  3QXE B;  4JRQ A;  3JB9 J;  1W4S A;  1RI0 A;  4FT2 A;  5GMK e;  1X01 A;  1XNI A;  4A4K A;  4ZGD B;  3CCR T;  2RHY A;  3HFN A;  4ELZ C;  5GMK l;  1VQN T;  4II1 A;  4BY6 C;  3BY7 A;  3P8D A;  1M1K U;  1K8A C;  4J8O A;  4C0D C;  2EWN A;  2GFU A;  1KC8 U;  4XU2 A;  2DAQ A;  3L2V A;  1XQH A;  3TRE A;  4C8Q D;  3BW1 A;  5J26 A;  4PJO F;  5GAN d;  3OYD A;  1YIT A;  2KY9 A;  2Y4Y A;  5DLQ E;  5KE3 A;  4R56 A;  4C8Q A;  4OB0 B;  3PT9 A;  3MEA A;  1KQ1 A;  2JTM A;  3BFM A;  3PNW C;  5CQY A;  3VKI A;  2EAY A;  5KE2 A;  2RHU A;  2EJ9 A;  3OS1 A;  1R8O B;  2RJE A;  4F7U G;  5GAM j;  4M7D E;  3NFC A;  3QYG B;  1V29 B;  5LJ3 g;  4M7D D;  2R57 A;  1GXI E;  4XTX A;  3GPL A;  3G6E T;  3OA6 A;  2DXC A;  1U8R A;  3QPH A;  4M7D A;  4DOW A;  1H3Z A;  3GNF B;  3SWN B;  2LQ8 A;  4M77 D;  1I4K 1;  5GAO p;  1NPP A;  4BE0 A;  4E7K A;  4M7A D;  4KUD K;  4JUV A;  2CGH A;  4FU6 A;  3HPW A;  3QJY A;  5GAM e;  3CCE A;  5LJ5 g;  2A7Y A;  2P0P A;  2QI2 A;  4M77 A;  4RKU E;  3JCM d;  1LJO A;  2GCX A;  1NJI U;  4M7A A;  2F69 A;  3X24 B;  3JCM c;  4F7U B;  5GAO n;  2QA4 T;  2ZGW A;  3QBY A;  3UWN A;  3L2U A;  2FHD A;  1OI1 A;  4PJO G;  5GAN 4;  3L2Q A;  4KUI A;  4Y28 E;  3RMQ A;  4F7U E;  2M9U A;  3UPU A;  2M0O A;  1WJQ A;  4E7J A;  3FB9 A;  4O5V A;  2DTO A;  1WGS A;  2FL7 A;  2RH2 A;  2VGM A;  5D6W A;  3CBP A;  1Q81 C;  2OTL T;  2O4X B;  4N4H A;  2DXU A;  4C5I A;  3MEU A;  1RL2 A;  3LGL A;  3P8H A;  5IT9 E;  1O9S A;  4M78 A;  4C92 F;  2R5A A;  3V7C A;  3A8L B;  5GAO r;  3DB4 A;  4OGE A;  4PJO B;  2CYZ B;  3LYI A;  4IUT A;  3OYH A;  5GAM g;  1K73 C;  3M56 A;  4DOV A;  3G4S T;  3CCJ T;  4Q5W A;  4OF1 A;  4QQD A;  1QVF A;  3V7R A;  2EFI A;  3PGG A;  4PJO E;  3MP8 A;  2CZ0 B;  4X34 A;  4C0G A;  3PIP A;  4BDZ A;  1BYM A;  4XTW A;  5D6X A;  1BI1 A;  3QG1 A;  4M75 D;  5I2M A;  3OSV A;  1QP2 A;  1M90 C;  1S72 A;  4PKC C;  1VQL T;  4MML A;  5HK3 A;  4X9C A;  3VYG A;  2OTL A;  4M75 A;  3FIF A;  1JB0 E;  4KT0 E;  3RER A;  4J5Y A;  2CZ7 B;  1VQP A;  2AHJ B;  3C12 A;  4N4G A;  3LWI A;  2ZPI B;  4LDU A;  1PSF A;  4ZGJ B;  2IVW A;  4JLG A;  3TU4 K;  1VQ5 T;  3QII A;  5HY6 A;  3HP9 A;  4C92 G;  1TH7 A;  2ZPB B;  3CC2 T;  3QSU A;  3G71 T;  2QTX A;  3URG A;  2QQA A;  5CKB A;  5CKD A;  3MET A;  4HCC A;  1Q82 U;  1YJ9 T;  3SB2 A;  3HL8 A;  1M4Z A;  1OZ3 A;  1JBM A;  4RCB A;  4E7L A;  4IKF A;  2RK2 A;  2LT1 A;  4LDW A;  2ZZD A;  3FRN A;  3RMS A;  3CC4 T;  2X4Y A;  3GLX A;  1PSE A;  3C95 A;  4E7H A;  2LDM A;  5GAN 5;  1VQ4 T;  1I5L A;  1JJ2 S;  1VQ8 T;  4QVZ A;  2LC4 A;  3I56 A;  3OMC A;  4EDU A;  3E19 A;  4ZN3 A;  3CMA A;  2DD4 A;  4RG2 A;  2FYK A;  2X35 A;  4MZP A;  1BIA A;  1VQK T;  4C92 B;  4B9X A;  3JCM X;  4JRP A;  3NTI A;  3ZBD A;  5L8R E;  1K9M U;  4HA8 A;  5GAN 3;  1VQ6 A;  4MMK A;  4ME7 A;  2WSF E;  1UGQ B;  3HRT A;  2DD5 A;  1X75 C;  2KSS A;  2RHX A;  4C92 E;  1WJR A;  3CPW S;  3HSB A;  1G3S A;  3S6W A;  2ZPE B;  3JRZ A;  3OY9 A;  2XDB A;  2DXT A;  2MWO A;  5FRM A;  3AHU A;  1VQM A;  2JZ2 A;  3QZ9 B;  3CCU A;  1M9S A;  3G7Z A;  2Y90 A;  4LDY A;  4BAC A;  1QVP A;  2JUF A;  5GAN f;  4C5E A;  5DLO A;  3JB9 D;  3A8H B;  4XTY A;  5FU6 C;  2E6N A;  2PUO B;  1Q86 U;  3VJP A;  1DJ7 B;  2RHI A;  3MCA B;  1VQ8 A;  3L1A A;  2RJF A;  3OYN A;  1Y96 B;  5IN1 A;  4ZTF A;  1YI2 A;  2DXB A;  2P0K A;  5A0L A;  3MEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...