4PLIA

Structure of the chromodomain of mrg2 in complex with h3k36me3
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
57
structure length
57
Chain Sequence
b'HFEEGERVLAKHSDCFYEAKVLKVEFKDNEWKYFVHYIGWNKSWDEWIRLDCLLKHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords At1g02740
molecule tags Transcription
source organism Arabidopsis thaliana
publication title Regulation of arabidopsis flowering by the histone mark readers MRG1/2 via interaction with CONSTANS to modulate FT expression.
pubmed doi rcsb
total genus 10
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pliA00
2CKKA 3LYIA 2RI3A 3OS2A 2RHYA 3M9QA 4UC4A 5FROA 3C4SA 4IUUA 2DAQA 3PFSA 4N4IA 3MP1A 1WJSA 4ZTFA 2K3XA 2G3RA 3E9GA 3OYGA 1OZ2A 3LGFA 1SSFA 2EFIA 4C5IA 1H3ZA 3E9FA 3NTKA 5CIUA 3DLMA 3P8DA 3L2QA 4LD6A 3OS0A 4E7JA 2P0KA 3QBYA 4C5HA 3P8HA 4NS5A 4X34A 2JTFA 1MHNA 2R57A 4E7HA 1RI0A 2M16A 4RG2A 2GF7A 4IUTA 4E7LA 4EDUA 3QIIA 2R58A 2RJDA 2E5QA 4FU6A 1G5VA 3MEAA 1OZ3A 3LX7A 2GFUA 3L2UA 4QVZA 3L2WA 2LDMA 4QQ6A 3OYNA 2GFAA 2RI2A 2JZ2A 2XK0A 3OB9A 2PQWA 4Z02A 2R5MA 3CEYA 5C0MA 3MP8A 2QQSA 2X4WA 4Q5WA 2B8AA 2O4XA 4IURA 5IN1A 3S3NA 4PL6A 2BIVA 2FHDA 2F5KA 4A4GA 3OY9A 3OYBA 4BDYA 2QQRA 5IAYA 1WJQA 3NTIA 1WJRA 1XNIA 2EQUA 3PMIA 2L89A 2BKDN 3S6WA 2EKOA 2L3RA 4C5GA 3S3MA 2RHZA 3FC3A 5D6XA 4IUPA 4GY5A 4QQGA 5KCHA 3KUFA 3MP6A 3OYLA 5KCOA 4II1A 3MEUA 2M1HA 5FRNA 2K3YA 3QJ6A 2MWOA 4PLLA 2RJEA 3ASKA 2IG0A 3OYCA 2RO0A 3EAEA 3OYFA 4E7IA 4BDZA 2RHIA 2MWPA 3L2VA 4N4HA 1WGSA 4BACA 3LH0A 3OYIA 2EQKA 4QW2A 3L2RA 3FEOA 3H8ZA 3OQ5A 3GOXA 3Q1JA 3BDLA 2R5AA 2D9TA 3UT1A 3UWNA 4HCZA 4N4GA 2RHXA 3MEVA 4ZTJA 5KE3A 3OYHA 2X4XA 4OVAA 5D6WA 4A4EA 5J26A 5FRMA 3ZEHA 3FLGA 4FL6A 2EQMA 2LTOA 3DB4A 3OMGA 3PNWC 3QKJA 3OYJA 4L59A 4BE0A 3PMTA 2RJCA 5KH6A 4B9WA 3O8VA 3OA6A 3OYDA 1OI1A 2X4YA 3OMCA 5KE2A 3NTHA 4QQDA 2M0OA 2LCCA 3OYAA 5C6SA 2NLUA 4E7KA 2HQEA 2RJFA 3L42A 2E6NA 2RHUA 3MO8A 4IUQA 1N27A 4C5EA 2BUDA 4CRIA 2EQJA 2L8DA 2WACA 4BD3A 3LLRA 4BE2A 3F70A 3OYKA 2LRQA 2XDPA 4A4FA 4A4HA 1KHCA 5J39A 2DIGA 2LVMA 3MEWA 3META 2O4XB 3FDRA 4IKFA 3LGLA 4BE1A 5D6YA 3S3OA 3OYMA 3DB3A 2HQXA 3OS1A 3SD4A 2VYTA 3OYEA 2DIQA 3ME9A 2X35A 5M9OA 3H6ZA 2RI5A 4PLIA 4B9XA 1OYXA 4IUVA 2YRVA
chains in the Genus database with same CATH superfamily
2RHYA 3C4SA 3PVQA 1YHQQ 2EYXA 4C8QF 1JXOA 2ZPBB 3E9GA 1QWFA 1IHVA 1ZBJA 3LW5E 5GJWB 1YJWA 2K57A 4XAXB 1Z9ZA 1KC8C 5GMKl 2DVJA 2BE9B 1OULA 5I2SA 1MHNA 2K7AA 1AD5A 3M5AA 4C92B 2PUOB 4FSXA 1TUDA 1Q81C 4A4KA 5EG2A 3CC2T 4M7DC 3BY7A 2J06A 4OP0A 3JCMQ 4V2SA 3REBB 1JXMA 4A4GA 2D1XA 2X3WD 2EKHA 1YNZA 3CBMA 3NTIA 1PNJA 2EQUA 3NGPA 5FLXE 2DTHA 4J5YA 3M57A 4ZGEB 2CSIA 4M77G 4X9CA 1D0XA 1UEBA 5GAOp 2PZ1A 2PUKB 4F7UB 2QA4T 4PLLA 3CPWP 2A3LA 1UB4A 3M56A 4ELYC 4M78G 4JRQA 4CI0C 5KYYB 4ESRA 2EQKA 2LNVA 2EJGA 3JCMd 5GAOr 4K11A 3GOXA 1Y07A 2ROLA 5KYUA 5A2QE 1NG2A 4OB2B 1QW1A 1I1JA 3CCSQ 4F7UA 2QEXQ 3M0TA 2E5KA 2HCKA 2OTLT 3QHSA 2FRYA 1M2VB 1Y7XA 4J9EA 3I56Q 2ZCFB 2ZZDA 4P5NA 4O6JA 3CCJA 3QXEB 3LWHA 1JJ2A 1PRLC 4J9IA 1TS9A 1NPRA 1NE8A 4XK8E 3G71A 2ROTA 2BZXA 3A8OB 3RIRA 4M7DE 3EH1A 2HDAA 4FT2A 1M3CA 5LJ3g 1NJIC 1VA7A 2QEXT 1OU8A 1SHGA 4EMKB 4LDWA 5GAOl 3FRNA 4J9DA 3JB9H 2MMPA 1BB9A 2KRSA 2YSQA 1WHLA 4FU6A 3MEAA 4TVRA 5LJ3h 2V8IA 2EBPA 2JJ9A 4PJOB 2B8AA 3T9NA 1YITA 2KNBB 1C6VX 2DK3A 3CCUQ 3GP8A 5GMKj 2OTLA 4RG8A 5GJVB 3S6WA 1W2BP 2NWMA 1YFNA 3CCJQ 5KCHA 3MP6A 5KCOA 3RERA 2DYBA 2ENMA 2YT6A 1M90C 2MWOA 3V8KA 4NL3A 2CP0A 2RO0A 5LJ3j 4LXCA 3TQ7P 2HL3A 1RUWA 2CDTA 3JCMV 1Q7YC 1W4SA 5LJ5g 4J83A 2QEXA 1QKXA 1QCFA 2DXCA 5CAIA 2VGMA 1WHMA 3UT1A 4F16A 4JLGA 4ZTJA 2M0YA 3REAB 2H3JA 3OMGA 4J9GA 1YP5A 2RJCA 1LVKA 1UGSB 3G6EQ 1ABOA 3ER0A 2GTJA 2XG8D 4IUQA 3DLLA 4OMQA 2RHUA 2XDBA 5FWCA 4C92G 1Q82U 3G6ET 3OYKA 2O01E 2JVVA 1OU9A 1TTHB 1QCNA 3JB9D 3LH5A 2HD0A 1N5ZA 1QVPA 3QO3A 4CC3A 1BBZA 2DKGA 5CKHA 4PJMA 1U8RA 1PWTA 2P0QA 3IQLA 1M1GA 4M75B 3PFSA 3SWNC 1J3TA 3WXMB 1N8RC 5GAMh 2QTXA 2KI7A 4OB0B 8AT1B 1K9MU 3CCQT 4X34A 2JTFA 5GANg 2GF7A 3INZA 2PNIA 1MV3A 1I0CA 1OZ3A 2KT1A 1NEBA 1YJWQ 4QVZA 3L2WA 3GLXA 2CUDA 3VYGA 3I55Q 2JS0A 4FYXB 4JJNK 3VJPA 3CC2A 1G2BA 2EAYA 1Y57A 3BDUA 2ESWA 3BE3A 4QQGA 3EG0A 2KEAA 3JCMb 4KULA 1SPKA 1JBMA 1ZA1B 1YJNA 4E7IA 2QDYB 4OGEA 1WLPB 3PE0A 4OMLA 1SSHA 1Q95G 5GAMg 3EHRA 3OQ5A 1UECA 3Q1JA 3RBBB 4PFPA 1GXIE 4J8OA 1AZGB 2DRMA 1JJ2P 5CKDA 2F69A 4A4EA 4GBQA 1WXBA 3DB4A 1R0CB 2C06A 3QKJA 3CC4A 4C92F 1NYFA 5CR2A 1ZSZB 1VQ5T 1LOJA 4B9WA 1U3OA 3NFCA 3EFRA 3QDRB 1WQ7A 2KROA 1ARKA 2K79A 5GAN8 4CRIA 1BYMA 2SRCA 3X28B 3OSVA 1IHWA 1M3BA 3RNJA 3META 5CVIA 4BI8B 2E3HA 2D0NA 1UJ0A 2DMOA 1WFWA 4E6RA 1WHGA 3TSWA 5LJ5d 5HKCA 1I8FA 3HRUA 3LYIA 4FT4A 3MP1A 3VS0A 4ZTFA 1CKBA 2G3RA 4EPCA 2J6KA 2KGTA 3OW2S 1Y71A 2FG0A 2KAFA 4JJBA 2KYBA 1SRMA 4M77F 1S1NA 5CO7A 2P84A 2OAUA 3CMAQ 2P4RA 1QLYA 4M78D 2C0OA 2PTKA 4D8KA 4KGZB 3C94A 4C8QE 2DBMA 2LJ1A 2OTJA 3M0UA 1BI3A 2F5TX 4WTOB 2BIVA 1U1TA 2FHDA 1D1BA 4BDYA 3M58A 2QQRA 1YIJQ 4EMKC 1BI0A 3SHWA 1WHKA 3WVEB 1PSEA 3MJXA 2AIRB 2HZYA 4C92A 1KQSA 1VQ6A 2F2WA 3MEUA 3EH2A 3I35A 1MNDA 1UUEA 3M0PA 1TG0A 2Z0WA 4FYYB 4BDZA 4JJCA 3E1SA 4HXJA 1Q86U 1BIBA 4PJOC 4Y28E 1NBEB 3CCVQ 2XDDA 4MDWA 3EGXA 1E7OA 3JV3A 4LUDA 1M27C 1UHCA 4DBFA 1RI9A 2IPOB 3M0SA 2W10A 2OX7A 1YWPA 3PGGA 2ZPGB 3VS2A 3OMCA 4QQDA 3QUIA 4DBRA 1NLPC 2QASA 2EQJA 1MMGA 3M53A 2QQAA 1SRLA 2LQKA 1KSWA 2AKKA 4M78E 2OJ2A 1JQQA 3JB9J 1W1FA 2XMFA 2EPDA 1VQMQ 7AT1B 2RI5A 1RAEB 4XU0A 1KQ2A 2KQWA 3M54A 4IUUA 3CCRA 1N8RR 4CC7A 4JRIA 2ZPHB 3CXCA 4C5IA 4CC4B 2X51A 2DL7A 1FMKA 4N0AA 1UGRB 1JO8A 2CZ6B 3P8HA 4NS5A 2R57A 1H3HA 2EYZA 2DE0X 3CD6T 1KQ1A 2COZA 1RAFB 3FJPA 4XTWA 4KT0E 3H0FA 2PQWA 3HTRA 2DVEA 3VS4A 2QI2A 3R6OA 1PG5B 1RLQC 1Y96B 4F14A 1HSQA 4AFUC 4FCYA 3OYBA 1PD0A 2V8JA 1XNIA 2VGNA 1UFFA 2QXFA 3O5ZA 2EQIA 2JM8A 3CCST 4IUPA 1ZSZA 3C95A 2E10A 2O9VA 1YBYA 5CK9A 2I2LA 2EYQA 4QVDA 2L0AA 1OPKA 1NLOC 2QA4A 1QQJA 1Q82R 1F1BB 1UGVA 3SFMA 1U5SA 1D1AA 4AFZC 2DL4A 3CCEA 4FSSA 2A36A 1WZOA 5AT1B 1VQ4T 1YN8A 3UA6A 2NUZA 5IHNA 3PMTA 4M78A 5A0LA 3OA6A 1PKTA 4C5EA 1IRXA 2YUQA 4M77A 1YIJT 2ZPEB 1QVGP 1BK2A 2DIGA 4X1VA 4EMKA 1E6GA 2K9GA 3S3OA 2KT8A 1VQ9Q 4R55A 2MYSA 2HQXA 4PJLA 4LDUA 3SD4A 2KR3A 2KVQG 2J6OA 3QWYA 4XTZA 3M9QA 3G71T 1K76A 1ZSZC 1FXXA 1PHTA 3QDFA 2EFIA 2KRNA 3GNFB 4DQ2A 5A0GA 1VQMA 3DLMA 1UJYA 2KXCA 5DLOA 2CZ7B 1EZZB 3RMSA 4HVWA 2ATCB 2ZPIB 3I5RA 2F2VA 3NHNA 1GFDA 2RJDA 3CPFA 1IGUA 1LJOA 1YITT 4FIBA 2RPNA 1OV3A 3C0CA 5IN1A 1UGPB 4BB7A 3A8MB 5GAOq 4M7DG 2XICA 2FRWA 3KBGA 5IAYA 1VQOQ 2QGGA 1FYNA 1B07A 3PMIA 1YJ9Q 3CC7Q 1FMWA 2YUNA 3DKMA 2DXBA 1B3QA 3OYLA 3QPHA 3KUFA 1KD1C 4DEXA 5GAOn 3BW1A 1WNLA 2X4JA 2K3YA 3CCMT 1X6OA 1YWOA 4E7SA 3OYFA 1YCYA 3HHTB 5GANj 2K5LA 1VQ6Q 2JMCA 2D0QB 3HKSA 1GBRA 5J26A 4FL6A 4M7DF 3JB9I 2LTOA 1X2KA 2V26A 1S72T 2CT4A 5KH6A 1KHIA 4LDYA 4PKCC 3OYDA 2CH4A 1VQMT 1HXDA 5KE2A 1XTDA 5GAN5 2EJFA 2RJFA 2RNAA 1R77A 3PT9A 3F70A 1MMDA 1QVGA 3OS5A 4HVVA 4PNOA 2AHJB 2FPDA 5HY6A 4JZ4A 3L2ZA 3QZ5B 2RN8A 2JS2A 1UG1A 2VYTA 5LJ5f 3BDLA 4B9XA 3V8JA 1X6GA 1VQ6T 3E19A 3CMET 2ZPFB 5DY9A 3TCJA 1Y96A 5CIUA 3P8DA 5GAN3 1TH7A 1IO6A 1T3SA 3CBPA 4RTYA 1KD1R 4M7AE 1BCMA 3HFNA 2GFUA 4NOYA 2LDMA 1VQOT 3OYNA 2GFAA 4C8QB 2FYKA 1K4US 2O2OA 3MP8A 2X4WA 1ZQ1A 1JRIA 4JLIA 3JRZA 4L6V5 3RESA 2LQWA 2JTMA 1EIFA 1G3YA 1VQPT 4OGCA 3HSBA 4RTZA 2RH2A 4GY5A 1KIKA 1OX8A 4II1A 1PRMC 1YI2T 2COYA 4ORZA 3QZ9B 1W70A 3ASKA 1OX9A 1EFNA 1B7TA 1YJNQ 2DPPB 2XHCA 3LH0A 5IHKA 1M1KC 5GMKi 4Z8AA 2D9TA 5KE3A 1PSFA 1YI2Q 1HJDA 2ECZA 3JCMX 1K9MR 2RB6A 3V7CA 1QKWA 2RMOA 4J6YA 2X4YA 3I55A 1I4K1 1K8AR 3AT1B 5FU6C 4OMPA 3EFOB 2LRQA 5GMKh 3CC7A 1YJ9A 2JTEA 2DX1A 4N0AC 3RMQA 4D6WA 1VQOA 1VQ4Q 2K4YA 5GAOm 2RQWA 1VQKA 4M77E 2YLBA 3CQTA 2RI3A 4JZ3A 2L3SA 2L3QA 2COWA 4MZTA 3M4YA 2B86A 4B6MA 3L2QA 3OYYA 1SHFA 1Z9QA 1M1KR 1B34B 1Y0MA 5CCAA 5J3BA 4C8QG 4E7LA 4RKUE 4RTUA 3A98A 3ZFJA 2E5QA 5LJ3d 2KE9A 5HCKA 4Z02A 1A0NB 4XU2A 4C0DC 2LJ0A 3GBQA 3G6EA 1NM7A 4HA8A 8ATCB 4JUVA 3G4SQ 3VS6A 2RD1A 2YLCA 3X25B 1ZUYA 3JCMc 5HK3A 3A8GB 1CKAA 3I56T 4EMHA 2RHZA 1VQ8A 1RAHB 4F04B 1AWOA 2KMTA 2BTTA 2KBTA 1KC8R 1O75A 4J7IA 2HAXA 2E1HA 3THKA 2O88A 1V1CA 1ACMB 2DFUA 2MWPA 4BACA 4PJJA 1X75C 2BZ8A 1M2OA 4JJDA 4ZNXA 2R5AA 2DJQA 5CQXA 4OVAA 2YUOA 1O9SA 3CC7T 3UA7A 2QA4Q 1BKBA 4KGXB 4M7AA 5AYFA 3KXTA 4HKEA 4RUGA 2KSSA 5C6SA 5KYWB 2KXDA 1N27A 1KFZA 2DTIA 3PTAA 4FW1A 4BE2A 1ZLMA 3GIBA 3M0QA 1VQ7A 4AFQC 1BCOA 2ZAEA 4PJOA 2DZ9A 5D6YA 4BI3A 1JB0E 1TUCA 4UC4A 4N4IA 2DL3A 2DZCA 3OYGA 1WIEA 2A37A 3RKWA 3GNGA 1H3ZA 4M7AD 3G71Q 1WHHA 3QBYA 2GBQA 2CZ1B 2W0ZA 2GNCA 3QIIA 2J05A 5GAMe 2QQ9A 3LX7A 1PC0A 2FPFA 3BFMA 2CGHA 3I56A 4LUEA 5IXFA 2JZ2A 2XK0A 3CCRQ 1VQKT 4C0GA 3CCJT 1T0HA 3EG3A 3CCMA 2Y90A 1WDXA 3PIPA 3CCUT 2K5IA 3GF5A 2KRMA 2QTVA 2EW3A 1SG5A 2D8JA 4R56A 1WHJA 3VUBA 2HQHA 4XU3A 1MGQA 1VYUA 2M1HA 3CCLT 3NMZC 1AVZC 3QJ6A 1ZUUA 2MCNA 3CXCS 1RL2A 1U1SA 5L8RE 1WGSA 3OYIA 4C8QC 2DYIA 1ZBXA 2DA9A 2P4TA 5DLQE 2X3XD 3HL8A 1H8KA 4GLKA 3M0RA 2ZGWA 3JCMW 2FZKB 1X27A 4E47A 3CC4T 2K5FA 3CCVA 3FLGA 2NYSA 3RR6A 2OTJT 1NJIR 3KFVA 1QMCA 2J6FA 1M90U 4WCIA 2EIFA 4PJOD 3MKDA 5EC7A 4BD3A 3VRYA 1H641 1Q7YU 2QG9B 2O4XB 4J9HA 3RKXA 3LGLA 3CD6Q 4M75A 1FX7A 2LT4A 3OYMA 1W2BA 1MV0B 2VWFA 4M4ZA 3OYEA 2DIQA 1X2QA 2E12A 2GQVA 2OTJQ 5CKFA 4DBQA 2KYMA 2RK2A 1X6BA 1UHFA 4DBHA 3EGDB 5FU6B 3OS0A 1K73U 3EHQA 5GMKe 1TSFA 2K6DA 4E7HA 1Q82C 4IUTA 1QVFA 4KUDK 2LCSA 4GLMA 1WXUA 2CZ0B 1ZX6A 2M51A 4JRPA 1VQLT 4HT9A 4E7ZA 4RTTA 4LDXA 2O4XA 1NYGA 4KBMB 4M77B 2DO3A 1BI1A 3EFSA 3CD6A 1G3TA 5IXBA 2L89A 1YJWT 3X24B 4NL2A 2L5QA 5GMKm 1X43A 2RK1A 5CKEA 5I2MA 3UPUA 3EG9A 2MI6A 2CS7A 4Z88A 3CCQQ 1Q81R 3OBWA 3FB9A 2YRDA 1UE9A 5IHIA 1D3BB 1M9SA 4N4HA 2MK5A 3L2RA 4C0DB 3FEOA 1W6XA 4A53A 3MHXA 2K2MA 1S72A 2X4XA 1NJIU 2OI3A 1NPPA 1KQSP 1M90R 3V8LA 1MMNA 4ANJA 4QT7A 3O8VA 2DL5A 2O9SA 4PJOF 3OYAA 3PVLA 1C1AA 4E2FB 4CC2A 3HRSA 2BUDA 1M30A 3LLRA 2NUTA 1MUZA 4A4FA 5KYYA 2E4HA 5J39A 2AZSA 3ZBDA 4M75G 2JMAA 3P8BB 1GFCA 2EYWA 3QSUA 3JCMf 2X35A 4HCKA 4AT1B 1OYXA 2YXYA 3J81E 2LQ8A 2LT1A 2DEUA 4VUBA 1B34A 1G3WA 3E9FA 2VV5A 2HNIA 1FWZA 4BY6B 1FMVA 1ZUKA 2VB6A 2M16A 1SF9A 4C0ZA 3UDCA 1HK9A 4O5VA 3L2UA 3J7AF 3EGUA 1E6HA 2A0FB 1GRIA 4QVCA 3VRZA 1VQPA 1QVGS 4YTLA 2GQIA 1K0SA 3C12A 2M9UA 1GCQA 4XTYA 1WJRA 2DLPA 3S3MA 3QYGB 1VQ7Q 1TWBA 2HKQB 2K3BA 4F7UG 2LX9A 3M55A 2KY9A 5IT9E 4ELZC 1GBQA 5LJ5h 1HYOA 1JEGA 2Y4YA 2D8HA 3EG1A 3H8ZA 6AT1B 1D3BA 5FW9A 1GL5A 4MMLA 2HMAA 3M4GA 4M7AF 3CPWS 2VASA 5D6WA 2JUFA 2FL7A 3ZEHA 5I22A 3JB9F 2JM9A 4AG1C 3CCMQ 1IREB 4M7AG 5KYXA 4HT8A 2LZ6B 2FO0A 1I81A 3L1AA 2XI9A 5GANe 5LJ5e 2FZCB 2WACA 4OB1B 1ZHIA 2MAMA 1M3AA 2IIMA 3I9QA 1VQ8Q 1XOVA 1KG1A 1IZ6A 3MEWA 3FDRA 2OTLQ 4Y91A 4BE1A 3CCUA 3WVDB 3I5SA 1YITQ 4PK4A 4JPBW 5M9OA 2EGAA 2GCXA 4AFSC 3A5ZB 4OB3B 1VIFA 2RQUA 3TVTA 4HVUA 2MPXC 2YWWA 3LGFA 1AT1B 1AOJA 2M02A 3CPWA 2DF6A 4KH1B 2F1LA 1BI2A 4RG2A 3EG9B 2R58A 1VYTA 3G1JA 1XQHA 1H92A 2ED1A 3JCMP 4QQ6A 2VUBA 3OB9A 4FYVB 2R5MA 1PD1A 1VQKQ 2C0TA 3CCRT 1VQ4A 4JDSA 4FM4B 3V7SA 2EGCA 4IIOA 2XIDA 1C0MA 2BE7D 2LMJA 4LE9A 2BKDN 2LQNA 9ATCB 5D6XA 3JCMh 4XTXA 1HD3A 4J9BA 4PFOA 1WX6A 2JN0A 2AZVA 4KRTA 4FW2A 2CP7A 1RLPC 4ZN3A 1VQ5A 1PCXA 2GTOA 1ABQA 2SEMA 1YHQT 4DA4A 4ZGJB 3CCSA 2E3IA 1AWXA 4R0KA 5KYWA 2DD5A 4M77C 2RQRA 1RADB 3A1PA 2DL8A 4MMKA 4F17A 2QAZA 4BI4A 2DJZA 3G4SA 1QP3A 4L5GA 2DNUA 4X9DA 2LCCA 1SEMA 2PVOB 1K73C 2X9HA 2L8DA 4QKUA 5I21A 5L23A 3VS5A 1VQLQ 4KH0B 1G83A 4ZGDB 4ME7A 5FU7B 1PM3A 2HBPA 1AWJA 3OBYA 3VS7A 4M75D 4BUGA 2CKKA 1MMAA 1RABB 1QVFP 2K3XA 5HK0A 5LJ5j 1QWEA 1TU0B 4J9FA 2DILA 2YRCA 4M75E 1M4ZA 2NUPB 2QGFB 2BZYA 3FJ5A 4PJOG 4WF2A 1K0XA 5IH2A 2DERA 2DBKA 1ZSGA 1T0JA 1Q7YR 2PVGB 1KK7A 4M7DA 1QP2A 4JRKA 1YHQA 2C0IA 1Q86C 5C0MA 3G4ST 4Q5WA 3EGDA 1YJ9T 1NEGA 4A63B 3N5BB 3OY9A 2JW4A 3URGA 2DXTA 1YI2A 1AEYA 2A08A 2EKOA 1X01A 4PFZA 4BY6C 2JNGA 5GANh 1JJ2S 1LCKA 3SWNA 3RDVA 3G7ZA 4OMFB 4RTXA 4M77D 3OYCA 2CYZB 2I0NA 3MPUB 3ZL7C 4Z89A 4OF1A 4C8QD 2FB7A 2AKLA 3JCMg 4D8DA 2Y4XA 4XU1A 4AG2C 2HKNA 3CCVT 4XQ3A 1K8AU 3CCLQ 1M2VA 3MEVA 1VOMA 3TREA 3JSCA 3VU3C 2HSEB 2E65A 3H41A 1VUBA 1K1ZA 3PNWC 2HSPA 2JXBA 2A7YA 1KD1U 4RTVA 3NTHA 2M0OA 5CQYA 2EVRA 4E7KA 2HQEA 3EFOA 1KQSS 1I5LA 1RAAB 3V7RA 1WA7A 2GGRA 2LVMA 4M78B 3HRTA 2F2XA 3H9NA 4IKFA 4C0FA 1XJWB 5GAMf 1MNEA 4EIKA 2LNHB 4J6XA 1M8MA 2P0PA 1ZA2B 3HP9A 3M59A 4IUVA 3OS2A 4Y92A 1M1FA 1VQNA 1N6AA 3OSSC 4ZN1A 3RUXA 2FZGB 1YJNT 4XTUA 4AMCA 2VVKA 2L3PA 1AHJB 1M8VA 1IXDA 3QYHB 1IGQA 1EX4A 3X20B 4C92E 4PJOE 3CCET 3CMEA 1VQLA 5ECAA 1WI7A 3UF4A 2RI2A 5D7UA 1LPLA 2QDLA 1BU1A 3CEYA 3VKIA 3PIOA 2QQSA 2WSFE 3D7SB 3S3NA 1N9RA 1M5Q1 4M7AC 4OMOA 4PL6A 2LP5A 2F5KA 5KYUB 1VQ9A 4J7FA 2DRKA 3ULRB 4RCBA 5GANf 1W2BS 1VQ8T 2LC4A 1RAIB 1KC8U 3SDZA 4MZPA 5FRNA 4MDXA 3QG1A 1VQ5Q 4DOVA 1V29B 2QYZA 3VUZA 1Q81U 3L2VA 2DTOA 4MZMA 5GAMd 1I5OB 1QVFS 2IVWA 5I11A 3UWNA 4HCZA 2FVUA 3OYHA 3VS1A 2RM4A 2DXUA 1WQWA 1N9SA 4L59A 2HBWA 1OI1A 2VC8A 4F7UF 2PVDB 5LJ3f 3L42A 2E6NA 2EJ9A 2NUPA 3MO8A 1VQ7T 2AK5A 1VQNT 3HFOA 1U06A 2EYYA 4C92C 3SB2A 4IIMA 2CP3A 2K2VA 1RAGB 4ATOA 3DB3A 2CP2A 2AT1B 1VIEA 2KDSA 1PKSA 4JS5A 1YCSB 2J7IA 4J9CA 3LWIA 4M7DB 1UGQB 5DM7R 1RACB 5CKBA 3EGXB 4LDVA 3A8HB 1WJSA 5A0DA 3CBOA 5LL6S 2DETA 4HCBA 5GAN6 3E2UA 1OZ2A 1SSFA 4LD6A 3JCMJ 2V1RA 4C8QA 2HL5C 2XKOC 3TSZA 3UATA 2E70A 4EDUA 2DM1A 5FU7C 4M75F 3TEEA 2RQVA 1K73R 2MF2A 1D09B 1OEBA 2LCLA 3QWXX 1D0YA 1V76A 2JOYA 1WJQA 2CSQA 3HPWA 5KYNA 2L3RA 4C5GA 3EG2A 4OMNA 3CCEQ 2XD0A 4PJNA 1IB8A 2CT3A 1AWWA 4A54A 4C92D 2RJEA 2IG0A 3EAEA 2E6ZA 2JT4A 4EMGA 3GPLA 4QW2A 3CMAT 1R8OB 3AHUA 3OW2A 1KJWA 4RMOA 4N4GA 1GCQC 3CXCP 5FWBA 1JU5C 2O31A 1VQ9T 1I07A 2MOXA 3OYJA 4J6WA 1X69A 2D6FA 1VQPQ 3A8LB 1TOVA 4DOWA 3H0IA 4DEYA 3JCMe 1QCOA 3FIFA 2VXFA 2FPEA 1KHCA 1R0BG 1YIJA 2V8KA 2VKNA 3NPFA 2EGEA 4RTWA 4KGVB 2YHTA 1Q86R 2L2PA 3VS3A 4HCCA 3J80E 2YRVA 5GANd 5FROA 2DAQA 1UDLA 3JB9G 2CH4W 2LJ3A 4FYWB 1NZ9A 2EWNA 2RQTA 1UTIA 3JAME 3CMEQ 3NTKA 5GAN2 1D1CA 2YUPA 4E7JA 3OW2P 2P0KA 4C5HA 4LNPA 2YDLA 1RI0A 1WXTA 5KYXB 1G5VA 4M78C 1BIAA 3VYHB 1SKUB 2KK4A 3MCAB 1VQNQ 1LNXA 2VXEA 4IURA 1M1KU 2CP5A 1K8AC 1DJ7B 4LN2A 2E64A 3R6NA 1GCPA 5LJ3e 1G3SA 1WYXA 2CREA 1N8RU 2QQBA 1S72Q 1P92A 1K9MC 4M78F 3FC3A 1CSKA 1D0ZA 2DEQA 2CUBA 3I55T 3RKYA 5GAN4 3X26B 2WSCE 2XU8A 2RHIA 2RF0A 2FEIA 2ABLA 4RCCA 3CCQA 5GAN7 3CC4Q 1TUGB 4OMMA 1OPLA 2WSEE 2G6FX 3VV0A 1VYVA 4M7AB 2RHXA 1T3LA 1OQKA 3CCLA 5FRMA 1TXQA 1OOTA 2EQMA 1AZEA 2ED0A 2QK0A 4M75C 4XTVA 3SWNB 4BE0A 4LD9K 2V1QA 2H8HA 2E41A 2DD4A 3H0HA 2NLUA 3QJYA 2A28A 2CP6A 2PU9B 2RA2A 2MIOA 4KUIA 2NUTB 2XDPA 3SEMA 4A4HA 1G8XA 1K9AA 2LX7A 3CMAA 4M7DD 5GAMj 4F7UE 3OS1A 1WPYA 3CC2Q 3ME9A 3TU4K 3U23A 2OAWA 3H6ZA 4JS4A 4PLIA 2H3EB 2HEQA
chains in the Genus database with same CATH topology
2CKKA 2KQWA 2RHYA 3M54A 4UC4A 3C4SA 4IUUA 4N4IA 3CCRA 2K3XA 2ZPBB 2DZCA 3E9GA 4C8QF 5HK0A 5LJ5j 3OYGA 4JRIA 2ZPHB 3CXCA 3LW5E 1YJWA 3RKWA 3GNGA 2K57A 4XAXB 4C5IA 4M7AD 1H3ZA 1KC8C 4M75E 5GMKl 4N0AA 1M4ZA 4WF2A 1UGRB 3QBYA 3P8HA 2CZ6B 4NS5A 4PJOG 2CZ1B 1MHNA 5I2SA 2R57A 2PVGB 3QIIA 3M5AA 4C92B 5GAMe 2QQ9A 3LX7A 3CD6T 1QP2A 4JRKA 4M7DA 2PUOB 3BFMA 4FSXA 1KQ1A 2CGHA 1Q81C 4A4KA 3I56A 3FJPA 4XTWA 4KT0E 2JZ2A 2XK0A 2PQWA 1YHQA 2DVEA 5EG2A 1Q86C 3CC2T 5C0MA 1VQKT 4M7DC 3BY7A 4C0GA 4OP0A 3G4ST 4Q5WA 3JCMQ 3CCJT 2QI2A 3R6OA 4V2SA 1Y96B 3CCMA 2Y90A 1YJ9T 3N5BB 3OY9A 4A4GA 3OYBA 3PIPA 3CCUT 3CBMA 3URGA 3NTIA 2K5IA 2V8JA 2DXTA 1XNIA 2EQUA 2VGNA 3GF5A 1YI2A 2QXFA 2EKOA 1X01A 4BY6C 2JNGA 5FLXE 5GANh 2DTHA 4J5YA 4IUPA 3VUBA 4R56A 3CCST 3C95A 3SWNA 1JJ2S 3M57A 4ZGEB 4M77G 4X9CA 2E10A 1UEBA 1MGQA 4XU3A 1YBYA 2M1HA 3G7ZA 4OMFB 5CK9A 5GAOp 3CCLT 2I2LA 2PUKB 4F7UB 3QJ6A 2QA4T 4M77D 4PLLA 2A3LA 1UB4A 3OYCA 3M56A 2EYQA 4QVDA 4ELYC 1RL2A 4M78G 3CXCS 4JRQA 2CYZB 1U1SA 4CI0C 5L8RE 1WGSA 3OYIA 4C8QC 2EQKA 4OF1A 2QA4A 1ZBXA 2EJGA 2LNVA 2P4TA 2FB7A 5DLQE 4C8QD 3JCMg 3HL8A 3JCMd 3SFMA 2Y4XA 3GOXA 1Y07A 4XU1A 3CCVT 4GLKA 4XQ3A 5A2QE 1K8AU 2ZGWA 3CCEA 3JCMW 3MEVA 4OB2B 1QW1A 4E47A 3CC4T 3TREA 2K5FA 3CCVA 3FLGA 1VQ4T 3JSCA 3VU3C 4F7UA 2E65A 1VUBA 3PNWC 2OTLT 3PMTA 2OTJT 2A7YA 3QHSA 1KD1U 1Y7XA 4M78A 5A0LA 3OA6A 3NTHA 2M0OA 5CQYA 4E7KA 2HQEA 4C5EA 1M90U 2ZCFB 1KQSS 1I5LA 2EIFA 4PJOD 4M77A 3V7RA 2ZZDA 4BD3A 4P5NA 4O6JA 3CCJA 1H641 2ZPEB 3QXEB 1YIJT 3LWHA 2DIGA 2LVMA 4M78B 1Q7YU 2O4XB 3HRTA 1JJ2A 4EMKA 3RKXA 4IKFA 3LGLA 4M75A 4C0FA 3S3OA 1FX7A 2LT4A 3OYMA 1W2BA 1NPRA 1NE8A 4R55A 4XK8E 2HQXA 4LDUA 5GAMf 3SD4A 3G71A 3OYEA 2DIQA 2E12A 2KVQG 3A8OB 4J6XA 3RIRA 4M7DE 2GQVA 4FT2A 2P0PA 1NJIC 3HP9A 3M59A 4IUVA 5CKFA 5LJ3g 4XTZA 3OS2A 3M9QA 3G71T 1M1FA 1VQNA 2RK2A 2QEXT 1N6AA 3OSSC 4ZN1A 3RUXA 1FXXA 4EMKB 4LDWA 2EFIA 1YJNT 4XTUA 3GNFB 4DQ2A 5GAOl 5A0GA 1VQMA 3DLMA 3FRNA 5FU6B 3OS0A 1K73U 5GMKe 5DLOA 1AHJB 3JB9H 1M8VA 4E7HA 2MMPA 2CZ7B 1Q82C 3QYHB 4IUTA 3RMSA 4KUDK 1QVFA 2ZPIB 2RJDA 4FU6A 3X20B 4C92E 4PJOE 3CCET 3MEAA 3CMEA 4TVRA 1VQLA 2CZ0B 5LJ3h 3CPFA 2V8IA 2RI2A 1LJOA 1YITT 4JRPA 1VQLT 4FIBA 4HT9A 3CEYA 4PJOB 3VKIA 3PIOA 2QQSA 2WSFE 4LDXA 2B8AA 2O4XA 3T9NA 5IN1A 1UGPB 1N9RA 4KBMB 1M5Q1 4M77B 3S3NA 1YITA 4BB7A 3A8MB 4PL6A 2DO3A 5GAOq 4M7AC 2F5KA 4M7DG 2XICA 2DK3A 3KBGA 1VQ9A 1BI1A 4J7FA 5IAYA 3GP8A 3EFSA 3CD6A 5GMKj 1G3TA 4RCBA 3PMIA 5GANf 1W2BS 2LC4A 1VQ8T 2L89A 3DKMA 4RG8A 3S6WA 2DXBA 3X24B 3SDZA 4NL2A 1YJWT 1KC8U 2L5QA 5GMKm 5KCHA 3OYLA 2RK1A 3KUFA 3MP6A 3QPHA 4MZPA 5CKEA 5I2MA 5KCOA 5GAOn 3UPUA 3RERA 3BW1A 1WNLA 2MI6A 5FRNA 2CS7A 4MDXA 2X4JA 3QG1A 2K3YA 4DOVA 1M90C 2MWOA 3CCMT 1V29B 3V8KA 3OBWA 3FB9A 1X6OA 4NL3A 2RO0A 3OYFA 3VUZA 1YCYA 5LJ3j 1D3BB 1M9SA 1Q81U 3L2VA 4N4HA 2DTOA 3JCMV 3HHTB 5GANj 1Q7YC 1W4SA 2K5LA 4MZMA 5LJ5g 4J83A 5GAMd 4C0DB 3L2RA 2QEXA 3FEOA 2DXCA 2D0QB 1QVFS 3HKSA 4A53A 5CAIA 2IVWA 2VGMA 3MHXA 3UT1A 3UWNA 4HCZA 4JLGA 4ZTJA 1S72A 2FVUA 2X4XA 3OYHA 5J26A 4FL6A 2H3JA 1NJIU 2RM4A 3JB9I 2LTOA 4M7DF 2DXUA 1WQWA 3OMGA 1N9SA 1NPPA 1S72T 4L59A 3V8LA 2RJCA 5KH6A 1KHIA 1UGSB 3O8VA 4LDYA 4PKCC 1OI1A 3OYDA 1HXDA 1VQMT 5KE2A 1XTDA 3ER0A 5GAN5 4PJOF 3OYAA 2VC8A 4F7UF 2EJFA 2PVDB 2XG8D 3L42A 2RJFA 4IUQA 2E6NA 2EJ9A 2RHUA 3MO8A 5LJ3f 3HRSA 2BUDA 1VQ7T 2XDBA 3PT9A 4C92G 1Q82U 3LLRA 1VQNT 3F70A 3G6ET 3HFOA 3OYKA 4A4FA 2O01E 1QVGA 2JVVA 3OS5A 4PNOA 4C92C 5J39A 2AHJB 3SB2A 5HY6A 3L2ZA 3QZ5B 3JB9D 2HD0A 3ZBDA 4M75G 2K2VA 1QVPA 3QO3A 3P8BB 4ATOA 3DB3A 2DKGA 3QSUA 5CKHA 1VIEA 3JCMf 2VYTA 2KDSA 4JS5A 2X35A 5LJ5f 3LWIA 4M7DB 3BDLA 1UGQB 4B9XA 1OYXA 3V8JA 5DM7R 3J81E 1U8RA 2LQ8A 5CKBA 2LT1A 2P0QA 4LDVA 1M1GA 1VQ6T 4M75B 3PFSA 3E19A 3A8HB 3SWNC 2ZPFB 3CMET 4VUBA 1WJSA 1B34A 5DY9A 5A0DA 3CBOA 5LL6S 1G3WA 4HCBA 3TCJA 5GAN6 1OZ2A 3WXMB 1N8RC 5GAMh 1SSFA 2QTXA 3E9FA 4OB0B 2VV5A 1Y96A 1K9MU 5CIUA 2HNIA 3P8DA 5GAN3 4LD6A 3JCMJ 1FWZA 4BY6B 3CCQT 4X34A 2JTFA 4C8QA 1TH7A 2XKOC 2M16A 5GANg 2GF7A 2E70A 3CBPA 3INZA 4EDUA 4M7AE 4C0ZA 3HFNA 3UDCA 1OZ3A 1HK9A 4O5VA 5FU7C 2GFUA 3L2UA 4QVZA 3L2WA 4NOYA 2LDMA 3GLXA 1VQOT 3OYNA 2GFAA 3J7AF 4C8QB 2FYKA 4M75F 3VYGA 3MP8A 2X4WA 3TEEA 4QVCA 1VQPA 1ZQ1A 2MF2A 1JRIA 4JLIA 1QVGS 3JRZA 2LCLA 3VJPA 4L6V5 4YTLA 4JJNK 3C12A 3RESA 3CC2A 2JTMA 2M9UA 1EIFA 1G3YA 2EAYA 2JOYA 4OGCA 4XTYA 1VQPT 3HSBA 3BDUA 1WJQA 1WJRA 3HPWA 3S3MA 3QYGB 2L3RA 4C5GA 2XD0A 2RH2A 4GY5A 4QQGA 4II1A 1YI2T 4F7UG 2LX9A 3M55A 4A54A 4KULA 2KY9A 3QZ9B 3JCMb 4ELZC 5IT9E 1JBMA 4C92D 2RJEA 3ASKA 2IG0A 1YJNA 3EAEA 2E6ZA 4E7IA 4EMGA 2DPPB 2QDYB 4OGEA 2XHCA 3GPLA 5LJ5h 3LH0A 4QW2A 2Y4YA 3CMAT 3DLLA 5GAMg 3H8ZA 3OQ5A 1R8OB 3Q1JA 3AHUA 1M1KC 5GMKi 3OW2A 1D3BA 2D9TA 1GXIE 4RMOA 4MMLA 4J8OA 3M4GA 4N4GA 4M7AF 3CPWS 5KE3A 1PSFA 5CKDA 2F69A 5D6WA 4A4EA 2JUFA 2FL7A 3ZEHA 1VQ9T 3DB4A 3JB9F 2C06A 3JCMX 3QKJA 2RB6A 3V7CA 4C92F 3CC4A 3OYJA 4J6WA 5CR2A 1IREB 1VQ5T 4J6YA 1LOJA 4B9WA 2D6FA 4M7AG 4HT8A 3NFCA 3A8LB 3EFRA 2X4YA 3I55A 1I81A 1I4K1 3L1AA 4DOWA 2XI9A 3QDRB 1WQ7A 5FU6C 5GANe 5LJ5e 3JCMe 5GAN8 4CRIA 2WACA 1ZHIA 2MAMA 4OB1B 3FIFA 2VXFA 3X28B 1BYMA 1XOVA 3OSVA 1KG1A 2LRQA 5GMKh 1IZ6A 1KHCA 3MEWA 3META 5CVIA 4BI8B 3CC7A 3FDRA 1YJ9A 4Y91A 4N0AC 4BE1A 3RMQA 4D6WA 5GAOr 1VQOA 1YIJA 2V8KA 3CCUA 3WVDB 2K4YA 5GAOm 1VQKA 4M77E 2YHTA 2YLBA 4HCCA 5LJ5d 5M9OA 3J80E 5HKCA 1I8FA 2GCXA 3HRUA 2YRVA 3LYIA 2RI3A 3A5ZB 4OB3B 1VIFA 5FROA 4FT4A 5GANd 2DAQA 3MP1A 4ZTFA 2G3RA 4EPCA 3JB9G 1NZ9A 2EWNA 3LGFA 4MZTA 3OW2S 3M4YA 1Y71A 1KQ2A 3JAME 2KAFA 3NTKA 5GAN2 3L2QA 3OYYA 3CPWA 4E7JA 4M77F 2P0KA 5CO7A 1B34B 4C5HA 2OAUA 1BI2A 1RI0A 4RG2A 5J3BA 4C8QG 5CCAA 4E7LA 4RKUE 3ZFJA 2R58A 1G5VA 2E5QA 4M78C 5LJ3d 1BIAA 3VYHB 4M78D 1XQHA 2KK4A 3JCMP 4QQ6A 3MCAB 2VUBA 3C94A 4Z02A 3OB9A 4C8QE 4XU2A 2R5MA 4C0DC 1LNXA 3G6EA 2OTJA 2VXEA 1BI3A 2F5TX 4IURA 1M1KU 4HA8A 4JUVA 1K8AC 1DJ7B 2RD1A 2BIVA 1U1TA 2E64A 2FHDA 2YLCA 5LJ3e 1G3SA 3X25B 3CCRT 4BDYA 3M58A 4JDSA 4FM4B 2QQRA 1VQ4A 3V7SA 1N8RU 4EMKC 2XIDA 2QQBA 1KD1C 1BI0A 3JCMc 5HK3A 1P92A 3A8GB 3WVEB 1K9MC 2BKDN 4M78F 3I56T 4EMHA 1PSEA 2RHZA 3FC3A 2DEQA 5D6XA 1VQ8A 3I55T 3JCMh 4C92A 1KQSA 3RKYA 1VQ6A 4XTXA 3MEUA 5GAN4 3X26B 2KMTA 2WSCE 2JN0A 1O75A 2XU8A 4J7IA 2HAXA 2E1HA 2OTLA 4BDZA 2RHIA 2MWPA 4BACA 4ZN3A 4RCCA 3E1SA 3CCQA 5GAN7 1X75C 1VQ5A 1Q86U 1BIBA 4PJOC 4Y28E 1YHQT 4DA4A 4ZGJB 2XDDA 3CCSA 2R5AA 2WSEE 4MDWA 3VV0A 2DD5A 4M77C 4M7AB 2RHXA 3CCLA 5CQXA 5FRMA 4OVAA 4MMKA 2EQMA 1O9SA 4M75C 4XTVA 3SWNB 3CC7T 4BI4A 2DJZA 4BE0A 4LD9K 3G4SA 1BKBA 1QP3A 3PGGA 4M7AA 5AYFA 2E41A 3KXTA 2DD4A 2ZPGB 4L5GA 3OMCA 4QQDA 4X9DA 2LCCA 3QUIA 4HKEA 2NLUA 2KSSA 3QJYA 5C6SA 2PVOB 1K73C 1N27A 2EQJA 2L8DA 2PU9B 2RA2A 5I21A 2DTIA 3M53A 4KUIA 2QQAA 3PTAA 4BE2A 3GIBA 2XDPA 4A4HA 1VQ7A 2LQKA 4PJOA 4M78E 4ZGDB 2DZ9A 4ME7A 5D6YA 2HBPA 5FU7B 4BI3A 3CMAA 3OBYA 4M7DD 5GAMj 3JB9J 4F7UE 3OS1A 1WPYA 3ME9A 4M75D 4BUGA 3TU4K 3H6ZA 4JS4A 2RI5A 4PLIA 1JB0E 4XU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CKK A;  3LYI A;  2RI3 A;  3OS2 A;  2RHY A;  3M9Q A;  4UC4 A;  5FRO A;  3C4S A;  4IUU A;  2DAQ A;  3PFS A;  4N4I A;  3MP1 A;  1WJS A;  4ZTF A;  2K3X A;  2G3R A;  3E9G A;  3OYG A;  1OZ2 A;  3LGF A;  1SSF A;  2EFI A;  4C5I A;  1H3Z A;  3E9F A;  3NTK A;  5CIU A;  3DLM A;  3P8D A;  3L2Q A;  4LD6 A;  3OS0 A;  4E7J A;  2P0K A;  3QBY A;  4C5H A;  3P8H A;  4NS5 A;  4X34 A;  2JTF A;  1MHN A;  2R57 A;  4E7H A;  1RI0 A;  2M16 A;  4RG2 A;  2GF7 A;  4IUT A;  4E7L A;  4EDU A;  3QII A;  2R58 A;  2RJD A;  2E5Q A;  4FU6 A;  1G5V A;  3MEA A;  1OZ3 A;  3LX7 A;  2GFU A;  3L2U A;  4QVZ A;  3L2W A;  2LDM A;  4QQ6 A;  3OYN A;  2GFA A;  2RI2 A;  2JZ2 A;  2XK0 A;  3OB9 A;  2PQW A;  4Z02 A;  2R5M A;  3CEY A;  5C0M A;  3MP8 A;  2QQS A;  2X4W A;  4Q5W A;  2B8A A;  2O4X A;  4IUR A;  5IN1 A;  3S3N A;  4PL6 A;  2BIV A;  2FHD A;  2F5K A;  4A4G A;  3OY9 A;  3OYB A;  4BDY A;  2QQR A;  5IAY A;  1WJQ A;  3NTI A;  1WJR A;  1XNI A;  2EQU A;  3PMI A;  2L89 A;  2BKD N;  3S6W A;  2EKO A;  2L3R A;  4C5G A;  3S3M A;  2RHZ A;  3FC3 A;  5D6X A;  4IUP A;  4GY5 A;  4QQG A;  5KCH A;  3KUF A;  3MP6 A;  3OYL A;  5KCO A;  4II1 A;  3MEU A;  2M1H A;  5FRN A;  2K3Y A;  3QJ6 A;  2MWO A;  4PLL A;  2RJE A;  3ASK A;  2IG0 A;  3OYC A;  2RO0 A;  3EAE A;  3OYF A;  4E7I A;  4BDZ A;  2RHI A;  2MWP A;  3L2V A;  4N4H A;  1WGS A;  4BAC A;  3LH0 A;  3OYI A;  2EQK A;  4QW2 A;  3L2R A;  3FEO A;  3H8Z A;  3OQ5 A;  3GOX A;  3Q1J A;  3BDL A;  2R5A A;  2D9T A;  3UT1 A;  3UWN A;  4HCZ A;  4N4G A;  2RHX A;  3MEV A;  4ZTJ A;  5KE3 A;  3OYH A;  2X4X A;  4OVA A;  5D6W A;  4A4E A;  5J26 A;  5FRM A;  3ZEH A;  3FLG A;  4FL6 A;  2EQM A;  2LTO A;  3DB4 A;  3OMG A;  3PNW C;  3QKJ A;  3OYJ A;  4L59 A;  4BE0 A;  3PMT A;  2RJC A;  5KH6 A;  4B9W A;  3O8V A;  3OA6 A;  3OYD A;  1OI1 A;  2X4Y A;  3OMC A;  5KE2 A;  3NTH A;  4QQD A;  2M0O A;  2LCC A;  3OYA A;  5C6S A;  2NLU A;  4E7K A;  2HQE A;  2RJF A;  3L42 A;  2E6N A;  2RHU A;  3MO8 A;  4IUQ A;  1N27 A;  4C5E A;  2BUD A;  4CRI A;  2EQJ A;  2L8D A;  2WAC A;  4BD3 A;  3LLR A;  4BE2 A;  3F70 A;  3OYK A;  2LRQ A;  2XDP A;  4A4F A;  4A4H A;  1KHC A;  5J39 A;  2DIG A;  2LVM A;  3MEW A;  3MET A;  2O4X B;  3FDR A;  4IKF A;  3LGL A;  4BE1 A;  5D6Y A;  3S3O A;  3OYM A;  3DB3 A;  2HQX A;  3OS1 A;  3SD4 A;  2VYT A;  3OYE A;  2DIQ A;  3ME9 A;  2X35 A;  5M9O A;  3H6Z A;  2RI5 A;  4PLI A;  4B9X A;  1OYX A;  4IUV A;  2YRV A; 
#chains in the Genus database with same CATH topology
 2RHY A;  3C4S A;  3PVQ A;  1YHQ Q;  2EYX A;  4C8Q F;  1JXO A;  2ZPB B;  3E9G A;  1QWF A;  1IHV A;  1ZBJ A;  3LW5 E;  5GJW B;  1YJW A;  2K57 A;  4XAX B;  1Z9Z A;  1KC8 C;  5GMK l;  2DVJ A;  2BE9 B;  1OUL A;  5I2S A;  1MHN A;  2K7A A;  1AD5 A;  3M5A A;  4C92 B;  2PUO B;  4FSX A;  1TUD A;  1Q81 C;  4A4K A;  5EG2 A;  3CC2 T;  4M7D C;  3BY7 A;  2J06 A;  4OP0 A;  3JCM Q;  4V2S A;  3REB B;  1JXM A;  4A4G A;  2D1X A;  2X3W D;  2EKH A;  1YNZ A;  3CBM A;  3NTI A;  1PNJ A;  2EQU A;  3NGP A;  5FLX E;  2DTH A;  4J5Y A;  3M57 A;  4ZGE B;  2CSI A;  4M77 G;  4X9C A;  1D0X A;  1UEB A;  5GAO p;  2PZ1 A;  2PUK B;  4F7U B;  2QA4 T;  4PLL A;  3CPW P;  2A3L A;  1UB4 A;  3M56 A;  4ELY C;  4M78 G;  4JRQ A;  4CI0 C;  5KYY B;  4ESR A;  2EQK A;  2LNV A;  2EJG A;  3JCM d;  5GAO r;  4K11 A;  3GOX A;  1Y07 A;  2ROL A;  5KYU A;  5A2Q E;  1NG2 A;  4OB2 B;  1QW1 A;  1I1J A;  3CCS Q;  4F7U A;  2QEX Q;  3M0T A;  2E5K A;  2HCK A;  2OTL T;  3QHS A;  2FRY A;  1M2V B;  1Y7X A;  4J9E A;  3I56 Q;  2ZCF B;  2ZZD A;  4P5N A;  4O6J A;  3CCJ A;  3QXE B;  3LWH A;  1JJ2 A;  1PRL C;  4J9I A;  1TS9 A;  1NPR A;  1NE8 A;  4XK8 E;  3G71 A;  2ROT A;  2BZX A;  3A8O B;  3RIR A;  4M7D E;  3EH1 A;  2HDA A;  4FT2 A;  1M3C A;  5LJ3 g;  1NJI C;  1VA7 A;  2QEX T;  1OU8 A;  1SHG A;  4EMK B;  4LDW A;  5GAO l;  3FRN A;  4J9D A;  3JB9 H;  2MMP A;  1BB9 A;  2KRS A;  2YSQ A;  1WHL A;  4FU6 A;  3MEA A;  4TVR A;  5LJ3 h;  2V8I A;  2EBP A;  2JJ9 A;  4PJO B;  2B8A A;  3T9N A;  1YIT A;  2KNB B;  1C6V X;  2DK3 A;  3CCU Q;  3GP8 A;  5GMK j;  2OTL A;  4RG8 A;  5GJV B;  3S6W A;  1W2B P;  2NWM A;  1YFN A;  3CCJ Q;  5KCH A;  3MP6 A;  5KCO A;  3RER A;  2DYB A;  2ENM A;  2YT6 A;  1M90 C;  2MWO A;  3V8K A;  4NL3 A;  2CP0 A;  2RO0 A;  5LJ3 j;  4LXC A;  3TQ7 P;  2HL3 A;  1RUW A;  2CDT A;  3JCM V;  1Q7Y C;  1W4S A;  5LJ5 g;  4J83 A;  2QEX A;  1QKX A;  1QCF A;  2DXC A;  5CAI A;  2VGM A;  1WHM A;  3UT1 A;  4F16 A;  4JLG A;  4ZTJ A;  2M0Y A;  3REA B;  2H3J A;  3OMG A;  4J9G A;  1YP5 A;  2RJC A;  1LVK A;  1UGS B;  3G6E Q;  1ABO A;  3ER0 A;  2GTJ A;  2XG8 D;  4IUQ A;  3DLL A;  4OMQ A;  2RHU A;  2XDB A;  5FWC A;  4C92 G;  1Q82 U;  3G6E T;  3OYK A;  2O01 E;  2JVV A;  1OU9 A;  1TTH B;  1QCN A;  3JB9 D;  3LH5 A;  2HD0 A;  1N5Z A;  1QVP A;  3QO3 A;  4CC3 A;  1BBZ A;  2DKG A;  5CKH A;  4PJM A;  1U8R A;  1PWT A;  2P0Q A;  3IQL A;  1M1G A;  4M75 B;  3PFS A;  3SWN C;  1J3T A;  3WXM B;  1N8R C;  5GAM h;  2QTX A;  2KI7 A;  4OB0 B;  8AT1 B;  1K9M U;  3CCQ T;  4X34 A;  2JTF A;  5GAN g;  2GF7 A;  3INZ A;  2PNI A;  1MV3 A;  1I0C A;  1OZ3 A;  2KT1 A;  1NEB A;  1YJW Q;  4QVZ A;  3L2W A;  3GLX A;  2CUD A;  3VYG A;  3I55 Q;  2JS0 A;  4FYX B;  4JJN K;  3VJP A;  3CC2 A;  1G2B A;  2EAY A;  1Y57 A;  3BDU A;  2ESW A;  3BE3 A;  4QQG A;  3EG0 A;  2KEA A;  3JCM b;  4KUL A;  1SPK A;  1JBM A;  1ZA1 B;  1YJN A;  4E7I A;  2QDY B;  4OGE A;  1WLP B;  3PE0 A;  4OML A;  1SSH A;  1Q95 G;  5GAM g;  3EHR A;  3OQ5 A;  1UEC A;  3Q1J A;  3RBB B;  4PFP A;  1GXI E;  4J8O A;  1AZG B;  2DRM A;  1JJ2 P;  5CKD A;  2F69 A;  4A4E A;  4GBQ A;  1WXB A;  3DB4 A;  1R0C B;  2C06 A;  3QKJ A;  3CC4 A;  4C92 F;  1NYF A;  5CR2 A;  1ZSZ B;  1VQ5 T;  1LOJ A;  4B9W A;  1U3O A;  3NFC A;  3EFR A;  3QDR B;  1WQ7 A;  2KRO A;  1ARK A;  2K79 A;  5GAN 8;  4CRI A;  1BYM A;  2SRC A;  3X28 B;  3OSV A;  1IHW A;  1M3B A;  3RNJ A;  3MET A;  5CVI A;  4BI8 B;  2E3H A;  2D0N A;  1UJ0 A;  2DMO A;  1WFW A;  4E6R A;  1WHG A;  3TSW A;  5LJ5 d;  5HKC A;  1I8F A;  3HRU A;  3LYI A;  4FT4 A;  3MP1 A;  3VS0 A;  4ZTF A;  1CKB A;  2G3R A;  4EPC A;  2J6K A;  2KGT A;  3OW2 S;  1Y71 A;  2FG0 A;  2KAF A;  4JJB A;  2KYB A;  1SRM A;  4M77 F;  1S1N A;  5CO7 A;  2P84 A;  2OAU A;  3CMA Q;  2P4R A;  1QLY A;  4M78 D;  2C0O A;  2PTK A;  4D8K A;  4KGZ B;  3C94 A;  4C8Q E;  2DBM A;  2LJ1 A;  2OTJ A;  3M0U A;  1BI3 A;  2F5T X;  4WTO B;  2BIV A;  1U1T A;  2FHD A;  1D1B A;  4BDY A;  3M58 A;  2QQR A;  1YIJ Q;  4EMK C;  1BI0 A;  3SHW A;  1WHK A;  3WVE B;  1PSE A;  3MJX A;  2AIR B;  2HZY A;  4C92 A;  1KQS A;  1VQ6 A;  2F2W A;  3MEU A;  3EH2 A;  3I35 A;  1MND A;  1UUE A;  3M0P A;  1TG0 A;  2Z0W A;  4FYY B;  4BDZ A;  4JJC A;  3E1S A;  4HXJ A;  1Q86 U;  1BIB A;  4PJO C;  4Y28 E;  1NBE B;  3CCV Q;  2XDD A;  4MDW A;  3EGX A;  1E7O A;  3JV3 A;  4LUD A;  1M27 C;  1UHC A;  4DBF A;  1RI9 A;  2IPO B;  3M0S A;  2W10 A;  2OX7 A;  1YWP A;  3PGG A;  2ZPG B;  3VS2 A;  3OMC A;  4QQD A;  3QUI A;  4DBR A;  1NLP C;  2QAS A;  2EQJ A;  1MMG A;  3M53 A;  2QQA A;  1SRL A;  2LQK A;  1KSW A;  2AKK A;  4M78 E;  2OJ2 A;  1JQQ A;  3JB9 J;  1W1F A;  2XMF A;  2EPD A;  1VQM Q;  7AT1 B;  2RI5 A;  1RAE B;  4XU0 A;  1KQ2 A;  2KQW A;  3M54 A;  4IUU A;  3CCR A;  1N8R R;  4CC7 A;  4JRI A;  2ZPH B;  3CXC A;  4C5I A;  4CC4 B;  2X51 A;  2DL7 A;  1FMK A;  4N0A A;  1UGR B;  1JO8 A;  2CZ6 B;  3P8H A;  4NS5 A;  2R57 A;  1H3H A;  2EYZ A;  2DE0 X;  3CD6 T;  1KQ1 A;  2COZ A;  1RAF B;  3FJP A;  4XTW A;  4KT0 E;  3H0F A;  2PQW A;  3HTR A;  2DVE A;  3VS4 A;  2QI2 A;  3R6O A;  1PG5 B;  1RLQ C;  1Y96 B;  4F14 A;  1HSQ A;  4AFU C;  4FCY A;  3OYB A;  1PD0 A;  2V8J A;  1XNI A;  2VGN A;  1UFF A;  2QXF A;  3O5Z A;  2EQI A;  2JM8 A;  3CCS T;  4IUP A;  1ZSZ A;  3C95 A;  2E10 A;  2O9V A;  1YBY A;  5CK9 A;  2I2L A;  2EYQ A;  4QVD A;  2L0A A;  1OPK A;  1NLO C;  2QA4 A;  1QQJ A;  1Q82 R;  1F1B B;  1UGV A;  3SFM A;  1U5S A;  1D1A A;  4AFZ C;  2DL4 A;  3CCE A;  4FSS A;  2A36 A;  1WZO A;  5AT1 B;  1VQ4 T;  1YN8 A;  3UA6 A;  2NUZ A;  5IHN A;  3PMT A;  4M78 A;  5A0L A;  3OA6 A;  1PKT A;  4C5E A;  1IRX A;  2YUQ A;  4M77 A;  1YIJ T;  2ZPE B;  1QVG P;  1BK2 A;  2DIG A;  4X1V A;  4EMK A;  1E6G A;  2K9G A;  3S3O A;  2KT8 A;  1VQ9 Q;  4R55 A;  2MYS A;  2HQX A;  4PJL A;  4LDU A;  3SD4 A;  2KR3 A;  2KVQ G;  2J6O A;  3QWY A;  4XTZ A;  3M9Q A;  3G71 T;  1K76 A;  1ZSZ C;  1FXX A;  1PHT A;  3QDF A;  2EFI A;  2KRN A;  3GNF B;  4DQ2 A;  5A0G A;  1VQM A;  3DLM A;  1UJY A;  2KXC A;  5DLO A;  2CZ7 B;  1EZZ B;  3RMS A;  4HVW A;  2ATC B;  2ZPI B;  3I5R A;  2F2V A;  3NHN A;  1GFD A;  2RJD A;  3CPF A;  1IGU A;  1LJO A;  1YIT T;  4FIB A;  2RPN A;  1OV3 A;  3C0C A;  5IN1 A;  1UGP B;  4BB7 A;  3A8M B;  5GAO q;  4M7D G;  2XIC A;  2FRW A;  3KBG A;  5IAY A;  1VQO Q;  2QGG A;  1FYN A;  1B07 A;  3PMI A;  1YJ9 Q;  3CC7 Q;  1FMW A;  2YUN A;  3DKM A;  2DXB A;  1B3Q A;  3OYL A;  3QPH A;  3KUF A;  1KD1 C;  4DEX A;  5GAO n;  3BW1 A;  1WNL A;  2X4J A;  2K3Y A;  3CCM T;  1X6O A;  1YWO A;  4E7S A;  3OYF A;  1YCY A;  3HHT B;  5GAN j;  2K5L A;  1VQ6 Q;  2JMC A;  2D0Q B;  3HKS A;  1GBR A;  5J26 A;  4FL6 A;  4M7D F;  3JB9 I;  2LTO A;  1X2K A;  2V26 A;  1S72 T;  2CT4 A;  5KH6 A;  1KHI A;  4LDY A;  4PKC C;  3OYD A;  2CH4 A;  1VQM T;  1HXD A;  5KE2 A;  1XTD A;  5GAN 5;  2EJF A;  2RJF A;  2RNA A;  1R77 A;  3PT9 A;  3F70 A;  1MMD A;  1QVG A;  3OS5 A;  4HVV A;  4PNO A;  2AHJ B;  2FPD A;  5HY6 A;  4JZ4 A;  3L2Z A;  3QZ5 B;  2RN8 A;  2JS2 A;  1UG1 A;  2VYT A;  5LJ5 f;  3BDL A;  4B9X A;  3V8J A;  1X6G A;  1VQ6 T;  3E19 A;  3CME T;  2ZPF B;  5DY9 A;  3TCJ A;  1Y96 A;  5CIU A;  3P8D A;  5GAN 3;  1TH7 A;  1IO6 A;  1T3S A;  3CBP A;  4RTY A;  1KD1 R;  4M7A E;  1BCM A;  3HFN A;  2GFU A;  4NOY A;  2LDM A;  1VQO T;  3OYN A;  2GFA A;  4C8Q B;  2FYK A;  1K4U S;  2O2O A;  3MP8 A;  2X4W A;  1ZQ1 A;  1JRI A;  4JLI A;  3JRZ A;  4L6V 5;  3RES A;  2LQW A;  2JTM A;  1EIF A;  1G3Y A;  1VQP T;  4OGC A;  3HSB A;  4RTZ A;  2RH2 A;  4GY5 A;  1KIK A;  1OX8 A;  4II1 A;  1PRM C;  1YI2 T;  2COY A;  4ORZ A;  3QZ9 B;  1W70 A;  3ASK A;  1OX9 A;  1EFN A;  1B7T A;  1YJN Q;  2DPP B;  2XHC A;  3LH0 A;  5IHK A;  1M1K C;  5GMK i;  4Z8A A;  2D9T A;  5KE3 A;  1PSF A;  1YI2 Q;  1HJD A;  2ECZ A;  3JCM X;  1K9M R;  2RB6 A;  3V7C A;  1QKW A;  2RMO A;  4J6Y A;  2X4Y A;  3I55 A;  1I4K 1;  1K8A R;  3AT1 B;  5FU6 C;  4OMP A;  3EFO B;  2LRQ A;  5GMK h;  3CC7 A;  1YJ9 A;  2JTE A;  2DX1 A;  4N0A C;  3RMQ A;  4D6W A;  1VQO A;  1VQ4 Q;  2K4Y A;  5GAO m;  2RQW A;  1VQK A;  4M77 E;  2YLB A;  3CQT A;  2RI3 A;  4JZ3 A;  2L3S A;  2L3Q A;  2COW A;  4MZT A;  3M4Y A;  2B86 A;  4B6M A;  3L2Q A;  3OYY A;  1SHF A;  1Z9Q A;  1M1K R;  1B34 B;  1Y0M A;  5CCA A;  5J3B A;  4C8Q G;  4E7L A;  4RKU E;  4RTU A;  3A98 A;  3ZFJ A;  2E5Q A;  5LJ3 d;  2KE9 A;  5HCK A;  4Z02 A;  1A0N B;  4XU2 A;  4C0D C;  2LJ0 A;  3GBQ A;  3G6E A;  1NM7 A;  4HA8 A;  8ATC B;  4JUV A;  3G4S Q;  3VS6 A;  2RD1 A;  2YLC A;  3X25 B;  1ZUY A;  3JCM c;  5HK3 A;  3A8G B;  1CKA A;  3I56 T;  4EMH A;  2RHZ A;  1VQ8 A;  1RAH B;  4F04 B;  1AWO A;  2KMT A;  2BTT A;  2KBT A;  1KC8 R;  1O75 A;  4J7I A;  2HAX A;  2E1H A;  3THK A;  2O88 A;  1V1C A;  1ACM B;  2DFU A;  2MWP A;  4BAC A;  4PJJ A;  1X75 C;  2BZ8 A;  1M2O A;  4JJD A;  4ZNX A;  2R5A A;  2DJQ A;  5CQX A;  4OVA A;  2YUO A;  1O9S A;  3CC7 T;  3UA7 A;  2QA4 Q;  1BKB A;  4KGX B;  4M7A A;  5AYF A;  3KXT A;  4HKE A;  4RUG A;  2KSS A;  5C6S A;  5KYW B;  2KXD A;  1N27 A;  1KFZ A;  2DTI A;  3PTA A;  4FW1 A;  4BE2 A;  1ZLM A;  3GIB A;  3M0Q A;  1VQ7 A;  4AFQ C;  1BCO A;  2ZAE A;  4PJO A;  2DZ9 A;  5D6Y A;  4BI3 A;  1JB0 E;  1TUC A;  4UC4 A;  4N4I A;  2DL3 A;  2DZC A;  3OYG A;  1WIE A;  2A37 A;  3RKW A;  3GNG A;  1H3Z A;  4M7A D;  3G71 Q;  1WHH A;  3QBY A;  2GBQ A;  2CZ1 B;  2W0Z A;  2GNC A;  3QII A;  2J05 A;  5GAM e;  2QQ9 A;  3LX7 A;  1PC0 A;  2FPF A;  3BFM A;  2CGH A;  3I56 A;  4LUE A;  5IXF A;  2JZ2 A;  2XK0 A;  3CCR Q;  1VQK T;  4C0G A;  3CCJ T;  1T0H A;  3EG3 A;  3CCM A;  2Y90 A;  1WDX A;  3PIP A;  3CCU T;  2K5I A;  3GF5 A;  2KRM A;  2QTV A;  2EW3 A;  1SG5 A;  2D8J A;  4R56 A;  1WHJ A;  3VUB A;  2HQH A;  4XU3 A;  1MGQ A;  1VYU A;  2M1H A;  3CCL T;  3NMZ C;  1AVZ C;  3QJ6 A;  1ZUU A;  2MCN A;  3CXC S;  1RL2 A;  1U1S A;  5L8R E;  1WGS A;  3OYI A;  4C8Q C;  2DYI A;  1ZBX A;  2DA9 A;  2P4T A;  5DLQ E;  2X3X D;  3HL8 A;  1H8K A;  4GLK A;  3M0R A;  2ZGW A;  3JCM W;  2FZK B;  1X27 A;  4E47 A;  3CC4 T;  2K5F A;  3CCV A;  3FLG A;  2NYS A;  3RR6 A;  2OTJ T;  1NJI R;  3KFV A;  1QMC A;  2J6F A;  1M90 U;  4WCI A;  2EIF A;  4PJO D;  3MKD A;  5EC7 A;  4BD3 A;  3VRY A;  1H64 1;  1Q7Y U;  2QG9 B;  2O4X B;  4J9H A;  3RKX A;  3LGL A;  3CD6 Q;  4M75 A;  1FX7 A;  2LT4 A;  3OYM A;  1W2B A;  1MV0 B;  2VWF A;  4M4Z A;  3OYE A;  2DIQ A;  1X2Q A;  2E12 A;  2GQV A;  2OTJ Q;  5CKF A;  4DBQ A;  2KYM A;  2RK2 A;  1X6B A;  1UHF A;  4DBH A;  3EGD B;  5FU6 B;  3OS0 A;  1K73 U;  3EHQ A;  5GMK e;  1TSF A;  2K6D A;  4E7H A;  1Q82 C;  4IUT A;  1QVF A;  4KUD K;  2LCS A;  4GLM A;  1WXU A;  2CZ0 B;  1ZX6 A;  2M51 A;  4JRP A;  1VQL T;  4HT9 A;  4E7Z A;  4RTT A;  4LDX A;  2O4X A;  1NYG A;  4KBM B;  4M77 B;  2DO3 A;  1BI1 A;  3EFS A;  3CD6 A;  1G3T A;  5IXB A;  2L89 A;  1YJW T;  3X24 B;  4NL2 A;  2L5Q A;  5GMK m;  1X43 A;  2RK1 A;  5CKE A;  5I2M A;  3UPU A;  3EG9 A;  2MI6 A;  2CS7 A;  4Z88 A;  3CCQ Q;  1Q81 R;  3OBW A;  3FB9 A;  2YRD A;  1UE9 A;  5IHI A;  1D3B B;  1M9S A;  4N4H A;  2MK5 A;  3L2R A;  4C0D B;  3FEO A;  1W6X A;  4A53 A;  3MHX A;  2K2M A;  1S72 A;  2X4X A;  1NJI U;  2OI3 A;  1NPP A;  1KQS P;  1M90 R;  3V8L A;  1MMN A;  4ANJ A;  4QT7 A;  3O8V A;  2DL5 A;  2O9S A;  4PJO F;  3OYA A;  3PVL A;  1C1A A;  4E2F B;  4CC2 A;  3HRS A;  2BUD A;  1M30 A;  3LLR A;  2NUT A;  1MUZ A;  4A4F A;  5KYY A;  2E4H A;  5J39 A;  2AZS A;  3ZBD A;  4M75 G;  2JMA A;  3P8B B;  1GFC A;  2EYW A;  3QSU A;  3JCM f;  2X35 A;  4HCK A;  4AT1 B;  1OYX A;  2YXY A;  3J81 E;  2LQ8 A;  2LT1 A;  2DEU A;  4VUB A;  1B34 A;  1G3W A;  3E9F A;  2VV5 A;  2HNI A;  1FWZ A;  4BY6 B;  1FMV A;  1ZUK A;  2VB6 A;  2M16 A;  1SF9 A;  4C0Z A;  3UDC A;  1HK9 A;  4O5V A;  3L2U A;  3J7A F;  3EGU A;  1E6H A;  2A0F B;  1GRI A;  4QVC A;  3VRZ A;  1VQP A;  1QVG S;  4YTL A;  2GQI A;  1K0S A;  3C12 A;  2M9U A;  1GCQ A;  4XTY A;  1WJR A;  2DLP A;  3S3M A;  3QYG B;  1VQ7 Q;  1TWB A;  2HKQ B;  2K3B A;  4F7U G;  2LX9 A;  3M55 A;  2KY9 A;  5IT9 E;  4ELZ C;  1GBQ A;  5LJ5 h;  1HYO A;  1JEG A;  2Y4Y A;  2D8H A;  3EG1 A;  3H8Z A;  6AT1 B;  1D3B A;  5FW9 A;  1GL5 A;  4MML A;  2HMA A;  3M4G A;  4M7A F;  3CPW S;  2VAS A;  5D6W A;  2JUF A;  2FL7 A;  3ZEH A;  5I22 A;  3JB9 F;  2JM9 A;  4AG1 C;  3CCM Q;  1IRE B;  4M7A G;  5KYX A;  4HT8 A;  2LZ6 B;  2FO0 A;  1I81 A;  3L1A A;  2XI9 A;  5GAN e;  5LJ5 e;  2FZC B;  2WAC A;  4OB1 B;  1ZHI A;  2MAM A;  1M3A A;  2IIM A;  3I9Q A;  1VQ8 Q;  1XOV A;  1KG1 A;  1IZ6 A;  3MEW A;  3FDR A;  2OTL Q;  4Y91 A;  4BE1 A;  3CCU A;  3WVD B;  3I5S A;  1YIT Q;  4PK4 A;  4JPB W;  5M9O A;  2EGA A;  2GCX A;  4AFS C;  3A5Z B;  4OB3 B;  1VIF A;  2RQU A;  3TVT A;  4HVU A;  2MPX C;  2YWW A;  3LGF A;  1AT1 B;  1AOJ A;  2M02 A;  3CPW A;  2DF6 A;  4KH1 B;  2F1L A;  1BI2 A;  4RG2 A;  3EG9 B;  2R58 A;  1VYT A;  3G1J A;  1XQH A;  1H92 A;  2ED1 A;  3JCM P;  4QQ6 A;  2VUB A;  3OB9 A;  4FYV B;  2R5M A;  1PD1 A;  1VQK Q;  2C0T A;  3CCR T;  1VQ4 A;  4JDS A;  4FM4 B;  3V7S A;  2EGC A;  4IIO A;  2XID A;  1C0M A;  2BE7 D;  2LMJ A;  4LE9 A;  2BKD N;  2LQN A;  9ATC B;  5D6X A;  3JCM h;  4XTX A;  1HD3 A;  4J9B A;  4PFO A;  1WX6 A;  2JN0 A;  2AZV A;  4KRT A;  4FW2 A;  2CP7 A;  1RLP C;  4ZN3 A;  1VQ5 A;  1PCX A;  2GTO A;  1ABQ A;  2SEM A;  1YHQ T;  4DA4 A;  4ZGJ B;  3CCS A;  2E3I A;  1AWX A;  4R0K A;  5KYW A;  2DD5 A;  4M77 C;  2RQR A;  1RAD B;  3A1P A;  2DL8 A;  4MMK A;  4F17 A;  2QAZ A;  4BI4 A;  2DJZ A;  3G4S A;  1QP3 A;  4L5G A;  2DNU A;  4X9D A;  2LCC A;  1SEM A;  2PVO B;  1K73 C;  2X9H A;  2L8D A;  4QKU A;  5I21 A;  5L23 A;  3VS5 A;  1VQL Q;  4KH0 B;  1G83 A;  4ZGD B;  4ME7 A;  5FU7 B;  1PM3 A;  2HBP A;  1AWJ A;  3OBY A;  3VS7 A;  4M75 D;  4BUG A;  2CKK A;  1MMA A;  1RAB B;  1QVF P;  2K3X A;  5HK0 A;  5LJ5 j;  1QWE A;  1TU0 B;  4J9F A;  2DIL A;  2YRC A;  4M75 E;  1M4Z A;  2NUP B;  2QGF B;  2BZY A;  3FJ5 A;  4PJO G;  4WF2 A;  1K0X A;  5IH2 A;  2DER A;  2DBK A;  1ZSG A;  1T0J A;  1Q7Y R;  2PVG B;  1KK7 A;  4M7D A;  1QP2 A;  4JRK A;  1YHQ A;  2C0I A;  1Q86 C;  5C0M A;  3G4S T;  4Q5W A;  3EGD A;  1YJ9 T;  1NEG A;  4A63 B;  3N5B B;  3OY9 A;  2JW4 A;  3URG A;  2DXT A;  1YI2 A;  1AEY A;  2A08 A;  2EKO A;  1X01 A;  4PFZ A;  4BY6 C;  2JNG A;  5GAN h;  1JJ2 S;  1LCK A;  3SWN A;  3RDV A;  3G7Z A;  4OMF B;  4RTX A;  4M77 D;  3OYC A;  2CYZ B;  2I0N A;  3MPU B;  3ZL7 C;  4Z89 A;  4OF1 A;  4C8Q D;  2FB7 A;  2AKL A;  3JCM g;  4D8D A;  2Y4X A;  4XU1 A;  4AG2 C;  2HKN A;  3CCV T;  4XQ3 A;  1K8A U;  3CCL Q;  1M2V A;  3MEV A;  1VOM A;  3TRE A;  3JSC A;  3VU3 C;  2HSE B;  2E65 A;  3H41 A;  1VUB A;  1K1Z A;  3PNW C;  2HSP A;  2JXB A;  2A7Y A;  1KD1 U;  4RTV A;  3NTH A;  2M0O A;  5CQY A;  2EVR A;  4E7K A;  2HQE A;  3EFO A;  1KQS S;  1I5L A;  1RAA B;  3V7R A;  1WA7 A;  2GGR A;  2LVM A;  4M78 B;  3HRT A;  2F2X A;  3H9N A;  4IKF A;  4C0F A;  1XJW B;  5GAM f;  1MNE A;  4EIK A;  2LNH B;  4J6X A;  1M8M A;  2P0P A;  1ZA2 B;  3HP9 A;  3M59 A;  4IUV A;  3OS2 A;  4Y92 A;  1M1F A;  1VQN A;  1N6A A;  3OSS C;  4ZN1 A;  3RUX A;  2FZG B;  1YJN T;  4XTU A;  4AMC A;  2VVK A;  2L3P A;  1AHJ B;  1M8V A;  1IXD A;  3QYH B;  1IGQ A;  1EX4 A;  3X20 B;  4C92 E;  4PJO E;  3CCE T;  3CME A;  1VQL A;  5ECA A;  1WI7 A;  3UF4 A;  2RI2 A;  5D7U A;  1LPL A;  2QDL A;  1BU1 A;  3CEY A;  3VKI A;  3PIO A;  2QQS A;  2WSF E;  3D7S B;  3S3N A;  1N9R A;  1M5Q 1;  4M7A C;  4OMO A;  4PL6 A;  2LP5 A;  2F5K A;  5KYU B;  1VQ9 A;  4J7F A;  2DRK A;  3ULR B;  4RCB A;  5GAN f;  1W2B S;  1VQ8 T;  2LC4 A;  1RAI B;  1KC8 U;  3SDZ A;  4MZP A;  5FRN A;  4MDX A;  3QG1 A;  1VQ5 Q;  4DOV A;  1V29 B;  2QYZ A;  3VUZ A;  1Q81 U;  3L2V A;  2DTO A;  4MZM A;  5GAM d;  1I5O B;  1QVF S;  2IVW A;  5I11 A;  3UWN A;  4HCZ A;  2FVU A;  3OYH A;  3VS1 A;  2RM4 A;  2DXU A;  1WQW A;  1N9S A;  4L59 A;  2HBW A;  1OI1 A;  2VC8 A;  4F7U F;  2PVD B;  5LJ3 f;  3L42 A;  2E6N A;  2EJ9 A;  2NUP A;  3MO8 A;  1VQ7 T;  2AK5 A;  1VQN T;  3HFO A;  1U06 A;  2EYY A;  4C92 C;  3SB2 A;  4IIM A;  2CP3 A;  2K2V A;  1RAG B;  4ATO A;  3DB3 A;  2CP2 A;  2AT1 B;  1VIE A;  2KDS A;  1PKS A;  4JS5 A;  1YCS B;  2J7I A;  4J9C A;  3LWI A;  4M7D B;  1UGQ B;  5DM7 R;  1RAC B;  5CKB A;  3EGX B;  4LDV A;  3A8H B;  1WJS A;  5A0D A;  3CBO A;  5LL6 S;  2DET A;  4HCB A;  5GAN 6;  3E2U A;  1OZ2 A;  1SSF A;  4LD6 A;  3JCM J;  2V1R A;  4C8Q A;  2HL5 C;  2XKO C;  3TSZ A;  3UAT A;  2E70 A;  4EDU A;  2DM1 A;  5FU7 C;  4M75 F;  3TEE A;  2RQV A;  1K73 R;  2MF2 A;  1D09 B;  1OEB A;  2LCL A;  3QWX X;  1D0Y A;  1V76 A;  2JOY A;  1WJQ A;  2CSQ A;  3HPW A;  5KYN A;  2L3R A;  4C5G A;  3EG2 A;  4OMN A;  3CCE Q;  2XD0 A;  4PJN A;  1IB8 A;  2CT3 A;  1AWW A;  4A54 A;  4C92 D;  2RJE A;  2IG0 A;  3EAE A;  2E6Z A;  2JT4 A;  4EMG A;  3GPL A;  4QW2 A;  3CMA T;  1R8O B;  3AHU A;  3OW2 A;  1KJW A;  4RMO A;  4N4G A;  1GCQ C;  3CXC P;  5FWB A;  1JU5 C;  2O31 A;  1VQ9 T;  1I07 A;  2MOX A;  3OYJ A;  4J6W A;  1X69 A;  2D6F A;  1VQP Q;  3A8L B;  1TOV A;  4DOW A;  3H0I A;  4DEY A;  3JCM e;  1QCO A;  3FIF A;  2VXF A;  2FPE A;  1KHC A;  1R0B G;  1YIJ A;  2V8K A;  2VKN A;  3NPF A;  2EGE A;  4RTW A;  4KGV B;  2YHT A;  1Q86 R;  2L2P A;  3VS3 A;  4HCC A;  3J80 E;  2YRV A;  5GAN d;  5FRO A;  2DAQ A;  1UDL A;  3JB9 G;  2CH4 W;  2LJ3 A;  4FYW B;  1NZ9 A;  2EWN A;  2RQT A;  1UTI A;  3JAM E;  3CME Q;  3NTK A;  5GAN 2;  1D1C A;  2YUP A;  4E7J A;  3OW2 P;  2P0K A;  4C5H A;  4LNP A;  2YDL A;  1RI0 A;  1WXT A;  5KYX B;  1G5V A;  4M78 C;  1BIA A;  3VYH B;  1SKU B;  2KK4 A;  3MCA B;  1VQN Q;  1LNX A;  2VXE A;  4IUR A;  1M1K U;  2CP5 A;  1K8A C;  1DJ7 B;  4LN2 A;  2E64 A;  3R6N A;  1GCP A;  5LJ3 e;  1G3S A;  1WYX A;  2CRE A;  1N8R U;  2QQB A;  1S72 Q;  1P92 A;  1K9M C;  4M78 F;  3FC3 A;  1CSK A;  1D0Z A;  2DEQ A;  2CUB A;  3I55 T;  3RKY A;  5GAN 4;  3X26 B;  2WSC E;  2XU8 A;  2RHI A;  2RF0 A;  2FEI A;  2ABL A;  4RCC A;  3CCQ A;  5GAN 7;  3CC4 Q;  1TUG B;  4OMM A;  1OPL A;  2WSE E;  2G6F X;  3VV0 A;  1VYV A;  4M7A B;  2RHX A;  1T3L A;  1OQK A;  3CCL A;  5FRM A;  1TXQ A;  1OOT A;  2EQM A;  1AZE A;  2ED0 A;  2QK0 A;  4M75 C;  4XTV A;  3SWN B;  4BE0 A;  4LD9 K;  2V1Q A;  2H8H A;  2E41 A;  2DD4 A;  3H0H A;  2NLU A;  3QJY A;  2A28 A;  2CP6 A;  2PU9 B;  2RA2 A;  2MIO A;  4KUI A;  2NUT B;  2XDP A;  3SEM A;  4A4H A;  1G8X A;  1K9A A;  2LX7 A;  3CMA A;  4M7D D;  5GAM j;  4F7U E;  3OS1 A;  1WPY A;  3CC2 Q;  3ME9 A;  3TU4 K;  3U23 A;  2OAW A;  3H6Z A;  4JS4 A;  4PLI A;  2H3E B;  2HEQ A; 
#chains in the Genus database with same CATH homology
 2CKK A;  2KQW A;  2RHY A;  3M54 A;  4UC4 A;  3C4S A;  4IUU A;  4N4I A;  3CCR A;  2K3X A;  2ZPB B;  2DZC A;  3E9G A;  4C8Q F;  5HK0 A;  5LJ5 j;  3OYG A;  4JRI A;  2ZPH B;  3CXC A;  3LW5 E;  1YJW A;  3RKW A;  3GNG A;  2K57 A;  4XAX B;  4C5I A;  4M7A D;  1H3Z A;  1KC8 C;  4M75 E;  5GMK l;  4N0A A;  1M4Z A;  4WF2 A;  1UGR B;  3QBY A;  3P8H A;  2CZ6 B;  4NS5 A;  4PJO G;  2CZ1 B;  1MHN A;  5I2S A;  2R57 A;  2PVG B;  3QII A;  3M5A A;  4C92 B;  5GAM e;  2QQ9 A;  3LX7 A;  3CD6 T;  1QP2 A;  4JRK A;  4M7D A;  2PUO B;  3BFM A;  4FSX A;  1KQ1 A;  2CGH A;  1Q81 C;  4A4K A;  3I56 A;  3FJP A;  4XTW A;  4KT0 E;  2JZ2 A;  2XK0 A;  2PQW A;  1YHQ A;  2DVE A;  5EG2 A;  1Q86 C;  3CC2 T;  5C0M A;  1VQK T;  4M7D C;  3BY7 A;  4C0G A;  4OP0 A;  3G4S T;  4Q5W A;  3JCM Q;  3CCJ T;  2QI2 A;  3R6O A;  4V2S A;  1Y96 B;  3CCM A;  2Y90 A;  1YJ9 T;  3N5B B;  3OY9 A;  4A4G A;  3OYB A;  3PIP A;  3CCU T;  3CBM A;  3URG A;  3NTI A;  2K5I A;  2V8J A;  2DXT A;  1XNI A;  2EQU A;  2VGN A;  3GF5 A;  1YI2 A;  2QXF A;  2EKO A;  1X01 A;  4BY6 C;  2JNG A;  5FLX E;  5GAN h;  2DTH A;  4J5Y A;  4IUP A;  3VUB A;  4R56 A;  3CCS T;  3C95 A;  3SWN A;  1JJ2 S;  3M57 A;  4ZGE B;  4M77 G;  4X9C A;  2E10 A;  1UEB A;  1MGQ A;  4XU3 A;  1YBY A;  2M1H A;  3G7Z A;  4OMF B;  5CK9 A;  5GAO p;  3CCL T;  2I2L A;  2PUK B;  4F7U B;  3QJ6 A;  2QA4 T;  4M77 D;  4PLL A;  2A3L A;  1UB4 A;  3OYC A;  3M56 A;  2EYQ A;  4QVD A;  4ELY C;  1RL2 A;  4M78 G;  3CXC S;  4JRQ A;  2CYZ B;  1U1S A;  4CI0 C;  5L8R E;  1WGS A;  3OYI A;  4C8Q C;  2EQK A;  4OF1 A;  2QA4 A;  1ZBX A;  2EJG A;  2LNV A;  2P4T A;  2FB7 A;  5DLQ E;  4C8Q D;  3JCM g;  3HL8 A;  3JCM d;  3SFM A;  2Y4X A;  3GOX A;  1Y07 A;  4XU1 A;  3CCV T;  4GLK A;  4XQ3 A;  5A2Q E;  1K8A U;  2ZGW A;  3CCE A;  3JCM W;  3MEV A;  4OB2 B;  1QW1 A;  4E47 A;  3CC4 T;  3TRE A;  2K5F A;  3CCV A;  3FLG A;  1VQ4 T;  3JSC A;  3VU3 C;  4F7U A;  2E65 A;  1VUB A;  3PNW C;  2OTL T;  3PMT A;  2OTJ T;  2A7Y A;  3QHS A;  1KD1 U;  1Y7X A;  4M78 A;  5A0L A;  3OA6 A;  3NTH A;  2M0O A;  5CQY A;  4E7K A;  2HQE A;  4C5E A;  1M90 U;  2ZCF B;  1KQS S;  1I5L A;  2EIF A;  4PJO D;  4M77 A;  3V7R A;  2ZZD A;  4BD3 A;  4P5N A;  4O6J A;  3CCJ A;  1H64 1;  2ZPE B;  3QXE B;  1YIJ T;  3LWH A;  2DIG A;  2LVM A;  4M78 B;  1Q7Y U;  2O4X B;  3HRT A;  1JJ2 A;  4EMK A;  3RKX A;  4IKF A;  3LGL A;  4M75 A;  4C0F A;  3S3O A;  1FX7 A;  2LT4 A;  3OYM A;  1W2B A;  1NPR A;  1NE8 A;  4R55 A;  4XK8 E;  2HQX A;  4LDU A;  5GAM f;  3SD4 A;  3G71 A;  3OYE A;  2DIQ A;  2E12 A;  2KVQ G;  3A8O B;  4J6X A;  3RIR A;  4M7D E;  2GQV A;  4FT2 A;  2P0P A;  1NJI C;  3HP9 A;  3M59 A;  4IUV A;  5CKF A;  5LJ3 g;  4XTZ A;  3OS2 A;  3M9Q A;  3G71 T;  1M1F A;  1VQN A;  2RK2 A;  2QEX T;  1N6A A;  3OSS C;  4ZN1 A;  3RUX A;  1FXX A;  4EMK B;  4LDW A;  2EFI A;  1YJN T;  4XTU A;  3GNF B;  4DQ2 A;  5GAO l;  5A0G A;  1VQM A;  3DLM A;  3FRN A;  5FU6 B;  3OS0 A;  1K73 U;  5GMK e;  5DLO A;  1AHJ B;  3JB9 H;  1M8V A;  4E7H A;  2MMP A;  2CZ7 B;  1Q82 C;  3QYH B;  4IUT A;  3RMS A;  4KUD K;  1QVF A;  2ZPI B;  2RJD A;  4FU6 A;  3X20 B;  4C92 E;  4PJO E;  3CCE T;  3MEA A;  3CME A;  4TVR A;  1VQL A;  2CZ0 B;  5LJ3 h;  3CPF A;  2V8I A;  2RI2 A;  1LJO A;  1YIT T;  4JRP A;  1VQL T;  4FIB A;  4HT9 A;  3CEY A;  4PJO B;  3VKI A;  3PIO A;  2QQS A;  2WSF E;  4LDX A;  2B8A A;  2O4X A;  3T9N A;  5IN1 A;  1UGP B;  1N9R A;  4KBM B;  1M5Q 1;  4M77 B;  3S3N A;  1YIT A;  4BB7 A;  3A8M B;  4PL6 A;  2DO3 A;  5GAO q;  4M7A C;  2F5K A;  4M7D G;  2XIC A;  2DK3 A;  3KBG A;  1VQ9 A;  1BI1 A;  4J7F A;  5IAY A;  3GP8 A;  3EFS A;  3CD6 A;  5GMK j;  1G3T A;  4RCB A;  3PMI A;  5GAN f;  1W2B S;  2LC4 A;  1VQ8 T;  2L89 A;  3DKM A;  4RG8 A;  3S6W A;  2DXB A;  3X24 B;  3SDZ A;  4NL2 A;  1YJW T;  1KC8 U;  2L5Q A;  5GMK m;  5KCH A;  3OYL A;  2RK1 A;  3KUF A;  3MP6 A;  3QPH A;  4MZP A;  5CKE A;  5I2M A;  5KCO A;  5GAO n;  3UPU A;  3RER A;  3BW1 A;  1WNL A;  2MI6 A;  5FRN A;  2CS7 A;  4MDX A;  2X4J A;  3QG1 A;  2K3Y A;  4DOV A;  1M90 C;  2MWO A;  3CCM T;  1V29 B;  3V8K A;  3OBW A;  3FB9 A;  1X6O A;  4NL3 A;  2RO0 A;  3OYF A;  3VUZ A;  1YCY A;  5LJ3 j;  1D3B B;  1M9S A;  1Q81 U;  3L2V A;  4N4H A;  2DTO A;  3JCM V;  3HHT B;  5GAN j;  1Q7Y C;  1W4S A;  2K5L A;  4MZM A;  5LJ5 g;  4J83 A;  5GAM d;  4C0D B;  3L2R A;  2QEX A;  3FEO A;  2DXC A;  2D0Q B;  1QVF S;  3HKS A;  4A53 A;  5CAI A;  2IVW A;  2VGM A;  3MHX A;  3UT1 A;  3UWN A;  4HCZ A;  4JLG A;  4ZTJ A;  1S72 A;  2FVU A;  2X4X A;  3OYH A;  5J26 A;  4FL6 A;  2H3J A;  1NJI U;  2RM4 A;  3JB9 I;  2LTO A;  4M7D F;  2DXU A;  1WQW A;  3OMG A;  1N9S A;  1NPP A;  1S72 T;  4L59 A;  3V8L A;  2RJC A;  5KH6 A;  1KHI A;  1UGS B;  3O8V A;  4LDY A;  4PKC C;  1OI1 A;  3OYD A;  1HXD A;  1VQM T;  5KE2 A;  1XTD A;  3ER0 A;  5GAN 5;  4PJO F;  3OYA A;  2VC8 A;  4F7U F;  2EJF A;  2PVD B;  2XG8 D;  3L42 A;  2RJF A;  4IUQ A;  2E6N A;  2EJ9 A;  2RHU A;  3MO8 A;  5LJ3 f;  3HRS A;  2BUD A;  1VQ7 T;  2XDB A;  3PT9 A;  4C92 G;  1Q82 U;  3LLR A;  1VQN T;  3F70 A;  3G6E T;  3HFO A;  3OYK A;  4A4F A;  2O01 E;  1QVG A;  2JVV A;  3OS5 A;  4PNO A;  4C92 C;  5J39 A;  2AHJ B;  3SB2 A;  5HY6 A;  3L2Z A;  3QZ5 B;  3JB9 D;  2HD0 A;  3ZBD A;  4M75 G;  2K2V A;  1QVP A;  3QO3 A;  3P8B B;  4ATO A;  3DB3 A;  2DKG A;  3QSU A;  5CKH A;  1VIE A;  3JCM f;  2VYT A;  2KDS A;  4JS5 A;  2X35 A;  5LJ5 f;  3LWI A;  4M7D B;  3BDL A;  1UGQ B;  4B9X A;  1OYX A;  3V8J A;  5DM7 R;  3J81 E;  1U8R A;  2LQ8 A;  5CKB A;  2LT1 A;  2P0Q A;  4LDV A;  1M1G A;  1VQ6 T;  4M75 B;  3PFS A;  3E19 A;  3A8H B;  3SWN C;  2ZPF B;  3CME T;  4VUB A;  1WJS A;  1B34 A;  5DY9 A;  5A0D A;  3CBO A;  5LL6 S;  1G3W A;  4HCB A;  3TCJ A;  5GAN 6;  1OZ2 A;  3WXM B;  1N8R C;  5GAM h;  1SSF A;  2QTX A;  3E9F A;  4OB0 B;  2VV5 A;  1Y96 A;  1K9M U;  5CIU A;  2HNI A;  3P8D A;  5GAN 3;  4LD6 A;  3JCM J;  1FWZ A;  4BY6 B;  3CCQ T;  4X34 A;  2JTF A;  4C8Q A;  1TH7 A;  2XKO C;  2M16 A;  5GAN g;  2GF7 A;  2E70 A;  3CBP A;  3INZ A;  4EDU A;  4M7A E;  4C0Z A;  3HFN A;  3UDC A;  1OZ3 A;  1HK9 A;  4O5V A;  5FU7 C;  2GFU A;  3L2U A;  4QVZ A;  3L2W A;  4NOY A;  2LDM A;  3GLX A;  1VQO T;  3OYN A;  2GFA A;  3J7A F;  4C8Q B;  2FYK A;  4M75 F;  3VYG A;  3MP8 A;  2X4W A;  3TEE A;  4QVC A;  1VQP A;  1ZQ1 A;  2MF2 A;  1JRI A;  4JLI A;  1QVG S;  3JRZ A;  2LCL A;  3VJP A;  4L6V 5;  4YTL A;  4JJN K;  3C12 A;  3RES A;  3CC2 A;  2JTM A;  2M9U A;  1EIF A;  1G3Y A;  2EAY A;  2JOY A;  4OGC A;  4XTY A;  1VQP T;  3HSB A;  3BDU A;  1WJQ A;  1WJR A;  3HPW A;  3S3M A;  3QYG B;  2L3R A;  4C5G A;  2XD0 A;  2RH2 A;  4GY5 A;  4QQG A;  4II1 A;  1YI2 T;  4F7U G;  2LX9 A;  3M55 A;  4A54 A;  4KUL A;  2KY9 A;  3QZ9 B;  3JCM b;  4ELZ C;  5IT9 E;  1JBM A;  4C92 D;  2RJE A;  3ASK A;  2IG0 A;  1YJN A;  3EAE A;  2E6Z A;  4E7I A;  4EMG A;  2DPP B;  2QDY B;  4OGE A;  2XHC A;  3GPL A;  5LJ5 h;  3LH0 A;  4QW2 A;  2Y4Y A;  3CMA T;  3DLL A;  5GAM g;  3H8Z A;  3OQ5 A;  1R8O B;  3Q1J A;  3AHU A;  1M1K C;  5GMK i;  3OW2 A;  1D3B A;  2D9T A;  1GXI E;  4RMO A;  4MML A;  4J8O A;  3M4G A;  4N4G A;  4M7A F;  3CPW S;  5KE3 A;  1PSF A;  5CKD A;  2F69 A;  5D6W A;  4A4E A;  2JUF A;  2FL7 A;  3ZEH A;  1VQ9 T;  3DB4 A;  3JB9 F;  2C06 A;  3JCM X;  3QKJ A;  2RB6 A;  3V7C A;  4C92 F;  3CC4 A;  3OYJ A;  4J6W A;  5CR2 A;  1IRE B;  1VQ5 T;  4J6Y A;  1LOJ A;  4B9W A;  2D6F A;  4M7A G;  4HT8 A;  3NFC A;  3A8L B;  3EFR A;  2X4Y A;  3I55 A;  1I81 A;  1I4K 1;  3L1A A;  4DOW A;  2XI9 A;  3QDR B;  1WQ7 A;  5FU6 C;  5GAN e;  5LJ5 e;  3JCM e;  5GAN 8;  4CRI A;  2WAC A;  1ZHI A;  2MAM A;  4OB1 B;  3FIF A;  2VXF A;  3X28 B;  1BYM A;  1XOV A;  3OSV A;  1KG1 A;  2LRQ A;  5GMK h;  1IZ6 A;  1KHC A;  3MEW A;  3MET A;  5CVI A;  4BI8 B;  3CC7 A;  3FDR A;  1YJ9 A;  4Y91 A;  4N0A C;  4BE1 A;  3RMQ A;  4D6W A;  5GAO r;  1VQO A;  1YIJ A;  2V8K A;  3CCU A;  3WVD B;  2K4Y A;  5GAO m;  1VQK A;  4M77 E;  2YHT A;  2YLB A;  4HCC A;  5LJ5 d;  5M9O A;  3J80 E;  5HKC A;  1I8F A;  2GCX A;  3HRU A;  2YRV A;  3LYI A;  2RI3 A;  3A5Z B;  4OB3 B;  1VIF A;  5FRO A;  4FT4 A;  5GAN d;  2DAQ A;  3MP1 A;  4ZTF A;  2G3R A;  4EPC A;  3JB9 G;  1NZ9 A;  2EWN A;  3LGF A;  4MZT A;  3OW2 S;  3M4Y A;  1Y71 A;  1KQ2 A;  3JAM E;  2KAF A;  3NTK A;  5GAN 2;  3L2Q A;  3OYY A;  3CPW A;  4E7J A;  4M77 F;  2P0K A;  5CO7 A;  1B34 B;  4C5H A;  2OAU A;  1BI2 A;  1RI0 A;  4RG2 A;  5J3B A;  4C8Q G;  5CCA A;  4E7L A;  4RKU E;  3ZFJ A;  2R58 A;  1G5V A;  2E5Q A;  4M78 C;  5LJ3 d;  1BIA A;  3VYH B;  4M78 D;  1XQH A;  2KK4 A;  3JCM P;  4QQ6 A;  3MCA B;  2VUB A;  3C94 A;  4Z02 A;  3OB9 A;  4C8Q E;  4XU2 A;  2R5M A;  4C0D C;  1LNX A;  3G6E A;  2OTJ A;  2VXE A;  1BI3 A;  2F5T X;  4IUR A;  1M1K U;  4HA8 A;  4JUV A;  1K8A C;  1DJ7 B;  2RD1 A;  2BIV A;  1U1T A;  2E64 A;  2FHD A;  2YLC A;  5LJ3 e;  1G3S A;  3X25 B;  3CCR T;  4BDY A;  3M58 A;  4JDS A;  4FM4 B;  2QQR A;  1VQ4 A;  3V7S A;  1N8R U;  4EMK C;  2XID A;  2QQB A;  1KD1 C;  1BI0 A;  3JCM c;  5HK3 A;  1P92 A;  3A8G B;  3WVE B;  1K9M C;  2BKD N;  4M78 F;  3I56 T;  4EMH A;  1PSE A;  2RHZ A;  3FC3 A;  2DEQ A;  5D6X A;  1VQ8 A;  3I55 T;  3JCM h;  4C92 A;  1KQS A;  3RKY A;  1VQ6 A;  4XTX A;  3MEU A;  5GAN 4;  3X26 B;  2KMT A;  2WSC E;  2JN0 A;  1O75 A;  2XU8 A;  4J7I A;  2HAX A;  2E1H A;  2OTL A;  4BDZ A;  2RHI A;  2MWP A;  4BAC A;  4ZN3 A;  4RCC A;  3E1S A;  3CCQ A;  5GAN 7;  1X75 C;  1VQ5 A;  1Q86 U;  1BIB A;  4PJO C;  4Y28 E;  1YHQ T;  4DA4 A;  4ZGJ B;  2XDD A;  3CCS A;  2R5A A;  2WSE E;  4MDW A;  3VV0 A;  2DD5 A;  4M77 C;  4M7A B;  2RHX A;  3CCL A;  5CQX A;  5FRM A;  4OVA A;  4MMK A;  2EQM A;  1O9S A;  4M75 C;  4XTV A;  3SWN B;  3CC7 T;  4BI4 A;  2DJZ A;  4BE0 A;  4LD9 K;  3G4S A;  1BKB A;  1QP3 A;  3PGG A;  4M7A A;  5AYF A;  2E41 A;  3KXT A;  2DD4 A;  2ZPG B;  4L5G A;  3OMC A;  4QQD A;  4X9D A;  2LCC A;  3QUI A;  4HKE A;  2NLU A;  2KSS A;  3QJY A;  5C6S A;  2PVO B;  1K73 C;  1N27 A;  2EQJ A;  2L8D A;  2PU9 B;  2RA2 A;  5I21 A;  2DTI A;  3M53 A;  4KUI A;  2QQA A;  3PTA A;  4BE2 A;  3GIB A;  2XDP A;  4A4H A;  1VQ7 A;  2LQK A;  4PJO A;  4M78 E;  4ZGD B;  2DZ9 A;  4ME7 A;  5D6Y A;  2HBP A;  5FU7 B;  4BI3 A;  3CMA A;  3OBY A;  4M7D D;  5GAM j;  3JB9 J;  4F7U E;  3OS1 A;  1WPY A;  3ME9 A;  4M75 D;  4BUG A;  3TU4 K;  3H6Z A;  4JS4 A;  2RI5 A;  4PLI A;  1JB0 E;  4XU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...