4PLIA

Structure of the chromodomain of mrg2 in complex with h3k36me3
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
57
structure length
57
Chain Sequence
HFEEGERVLAKHSDCFYEAKVLKVEFKDNEWKYFVHYIGWNKSWDEWIRLDCLLKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords At1g02740
publication title Regulation of arabidopsis flowering by the histone mark readers MRG1/2 via interaction with CONSTANS to modulate FT expression.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription
total genus 10
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pliA00
2VYTA 3SD4A 4IUPA 3OYKA 3DB3A 2K3YA 3ZEHA 5D6YA 4ZTJA 3MP8A 3MP6A 2RJEA 5CIUA 1SSFA 2MWOA 3E9GA 4C5GA 3DLMA 5KH6A 3OYJA 3L2VA 5M9OA 4QQ6A 2FHDA 2RHYA 2D9TA 2DIGA 3OYDA 3PNWC 4BDYA 3L2WA 2EQKA 1WGSA 3OS0A 2EQMA 2K3XA 3P8DA 4IUUA 4A4EA 1KHCA 2CKKA 3OQ5A 5KE2A 4FU6A 2LCCA 2LVMA 5D6WA 3KUFA 3LH0A 2R57A 3OMCA 3OA6A 2RI5A 3S3OA 1WJSA 3OYIA 4IURA 5J26A 4IKFA 4OVAA 3E9FA 3UT1A 4BE2A 3H6ZA 4L59A 3OYCA 4BE1A 3OYNA 1WJRA 3OYGA 4QW2A 2E5QA 3LX7A 2R5MA 5D6XA 2WACA 2BKDN 2EQUA 3BDLA 5IN1A 2L8DA 2RI3A 4FL6A 3OYEA 3S3MA 5C0MA 3UWNA 4A4HA 3H8ZA 2IG0A 3MEVA 4E7JA 3P8HA 4A4FA 2DAQA 3OYHA 5FROA 4B9WA 4C5HA 2BUDA 2LTOA 4RG2A 2EKOA 3QIIA 2X35A 3L2UA 1OZ3A 2L89A 2RJCA 2HQXA 3PMTA 3LLRA 2B8AA 3DB4A 5KE3A 4C5EA 3OYAA 4BACA 4E7LA 2LRQA 2PQWA 2XK0A 2L3RA 3NTIA 5J39A 3OYMA 3QKJA 2G3RA 1G5VA 3LGLA 4PLLA 4A4GA 3GOXA 2M1HA 2RJDA 3OYFA 4QVZA 2R58A 1OYXA 2F5KA 3M9QA 3QBYA 5IAYA 1MHNA 1WJQA 2GFUA 4BE0A 4Q5WA 3NTHA 2O4XB 3FLGA 4PL6A 5FRMA 2DIQA 2RJFA 5FRNA 4ZTFA 3ME9A 2RHZA 4BDZA 4GY5A 1OZ2A 2RO0A 4C5IA 1XNIA 2JTFA 2M0OA 2RHXA 3FEOA 3FDRA 2RHIA 3MEWA 3OB9A 2BIVA 2GF7A 2EFIA 2GFAA 4II1A 3Q1JA 2EQJA 4LD6A 2RI2A 4N4GA 1OI1A 4UC4A 2O4XA 3FC3A 1N27A 3EAEA 3L2QA 4NS5A 2E6NA 5C6SA 4N4IA 4E7HA 3S6WA 3S3NA 2NLUA 3META 3OMGA 4Z02A 2QQSA 3C4SA 3OYLA 2YRVA 3LYIA 5KCOA 4IUVA 2P0KA 3MEAA 3ASKA 3OS1A 3QJ6A 3L42A 4HCZA 3OY9A 2X4WA 4EDUA 1RI0A 4CRIA 3CEYA 3MP1A 3PFSA 4IUQA 2JZ2A 2XDPA 4BD3A 3O8VA 3F70A 2MWPA 4PLIA 2HQEA 4B9XA 3L2RA 2QQRA 2M16A 4QQGA 3LGFA 3MEUA 5KCHA 3NTKA 4IUTA 2X4XA 4E7KA 4X34A 1H3ZA 2RHUA 3OS2A 4E7IA 4N4HA 2R5AA 2X4YA 3OYBA 4QQDA 3PMIA 3MO8A 2LDMA
chains in the Genus database with same CATH superfamily
3VYGA 5HCKA 4M77D 1MV3A 3MP8A 5KH6A 1HSQA 4OMLA 2RB6A 3EHRA 3CC7T 1N9RA 2JJ9A 1Q86U 1M8VA 1LOJA 4XTZA 3EGDA 1FX7A 4FU6A 3GPLA 1K9MC 1KD1R 3TCJA 5DM7R 4L59A 1RABB 1PD0A 3EH2A 1PSFA 2DKGA 5FU7C 2L8DA 4M7DF 4A4HA 3X26B 3G4SQ 2K4YA 2DD4A 2DL4A 2CZ6B 5HKCA 4DQ2A 1LCKA 4ME7A 2CH4W 1RAIB 4F17A 3H0HA 2JTEA 3LGLA 3OYFA 3QDRB 3HKSA 5EC7A 3CCJA 4CI0C 1UGSB 4Q5WA 3OBYA 1HXDA 1WXUA 5FRMA 3QXEB 5FRNA 3MJXA 4ZTFA 5FU6B 3FEOA 3C0CA 2RHIA 4KUIA 1ARKA 4PNOA 1TOVA 1UEBA 3CC2A 1WX6A 5GAMg 3I56T 3QZ9B 1EX4A 4RTWA 2P0KA 1YI2T 4ZNXA 2E3IA 3G6EA 2XDPA 3O8VA 4B9XA 4RKUE 3JCMJ 1U3OA 4HA8A 1RAGB 5LJ5e 4E7ZA 2OTLQ 2QAZA 4VUBA 4N4HA 1RI9A 1PSEA 5GAN4 2GCXA 9ATCB 4GBQA 1UHFA 2K3YA 2HBPA 4RCBA 5M9OA 3PTAA 1U8RA 4JRKA 4FYXB 4X9CA 1NLPC 4KGXB 3TQ7P 3OYDA 2VWFA 4LXCA 1R77A 3OW2S 4FW1A 3C95A 1IRXA 4M7DG 2C0OA 1JXOA 3M55A 2JXBA 2LVMA 4RTYA 1KD1U 3I35A 3M0SA 1ZA1B 2M02A 2OJ2A 1K73C 4C92B 2KR3A 2FRYA 4OB3B 3ZFJA 5LJ5j 4JJNK 3EFOA 1VQ7T 2V8JA 1W2BS 1YWOA 3CCQQ 1NPPA 3IQLA 4B9WA 4XAXB 1YJ9T 2X35A 2YRDA 2RQRA 1KC8C 2PQWA 4XQ3A 4J9EA 1QVFS 1TU0B 2VASA 3VS0A 3M9QA 2LX9A 1Q81R 1OV3A 3JAME 4PL6A 1IGUA 1YBYA 1KIKA 1NBEB 3VS3A 3X20B 3MKDA 2DEUA 2RO0A 4V2SA 3FDRA 2PUKB 2FL7A 3V7SA 3FJPA 2EQJA 3Q1JA 4LD6A 1M2OA 2E12A 2DL7A 3KXTA 1XJWB 1X75C 1JJ2A 3CC4Q 2MI6A 1W1FA 2CT3A 3JCMV 1SG5A 1ZX6A 1M1GA 1VQ6T 2PVDB 4BD3A 3HRSA 3V7RA 5EG2A 2XMFA 1KQ1A 4QQGA 4OMNA 4L6V5 1JQQA 1QCNA 2CP6A 2R5AA 3CCQA 1ZSZB 2XG8D 3L1AA 3OYKA 2EJFA 3EG9B 2LC4A 3L2VA 2FG0A 1I5LA 1I4K1 1YJWQ 1ZBJA 3URGA 1WHKA 3CCRT 5IT9E 1S1NA 3BW1A 1SPKA 1QKXA 8AT1B 4JRPA 3WVDB 4LDXA 3RERA 3UATA 1H8KA 3E9FA 2Z0WA 3HHTB 4JJBA 4BI8B 1ZSZC 1WJRA 1M30A 2NUZA 2P4TA 1UE9A 1MMDA 3R6OA 1UECA 3FRNA 2RNAA 3QO3A 3CC4A 3JCMW 2EKOA 2LCLA 1KQ2A 3M0QA 4ELZC 4LNPA 4PJMA 2C0IA 4AFZC 2E65A 2EGEA 2DL8A 3CQTA 1C6VX 3GF5A 2KNBB 1RAFB 2LX7A 1Q81U 2KRSA 4C0FA 3CCSQ 2LT4A 4M78B 1K9MR 1VQLQ 4DBQA 2L5QA 3HPWA 3ME9A 2KYBA 1B34B 4EPCA 1VQ4A 1AVZC 2JUFA 2DILA 1W6XA 1YJWA 4K11A 3J81E 4DA4A 1D1BA 4LDUA 4XK8E 5GMKm 1VA7A 4NS5A 3RIRA 1VQ9Q 3C12A 5FWCA 2QQAA 4AFUC 3ASKA 3JB9H 2CZ0B 1PNJA 1D0YA 1G8XA 1U5SA 4PFZA 1ZUUA 2KSSA 4M78C 1EFNA 2O01E 3P8BB 4LDYA 4ANJA 1H3ZA 3VS6A 5A0DA 4BB7A 5LJ5d 4KH1B 5GAMf 1GRIA 2K2MA 3UA7A 2RA2A 2H3JA 2K2VA 5D6YA 2CP5A 4J9IA 3VRYA 1KD1C 2BZ8A 4M75D 3THKA 1ZSZA 2E41A 4M7DE 4BDYA 5A2QE 2F2XA 3G4ST 2VC8A 4C0ZA 2PU9B 3EG9A 3ZBDA 1NEGA 1MNEA 4KRTA 1QMCA 4PJOG 4LDVA 4OGEA 1CKAA 3G7ZA 4IKFA 3JCMP 2J7IA 3LX7A 3PIOA 2EQUA 3U23A 2MAMA 2NYSA 1NLOC 5CR2A 2KRNA 1X2KA 2QGGA 2K6DA 4E7JA 1VQ9A 2DXCA 1OULA 2FVUA 1QVGS 4M7AB 4PJOC 4P5NA 3CPWS 2V1RA 1MMNA 2KROA 1PKTA 2LJ1A 2RJCA 4PJNA 3LLRA 5I22A 5GANf 1BKBA 1WLPB 4C8QB 2AT1B 1IZ6A 3WXMB 2HCKA 2B86A 2DETA 3M58A 1WA7A 1BIAA 3H9NA 2M1HA 4HXJA 4J83A 2AIRB 4M77B 1NZ9A 1KK7A 4BE0A 3VJPA 1K9MU 1QW1A 2FZGB 4FM4B 2KDSA 2HL3A 2F5TX 2LZ6B 3MPUB 2A3LA 2L3PA 3CXCP 4M7AC 2EKHA 4RMOA 2KVQG 2O9SA 5HK3A 4C8QC 2OTLT 4M78A 2CZ7B 5GAMh 1B34A 1YJNQ 2E4HA 1AOJA 2A36A 4R56A 3JCMg 2QA4Q 4BY6B 2DF6A 1RI0A 4AT1B 4M77C 2FPFA 1KC8R 2JS2A 3RDVA 1PCXA 4LUDA 4F7UB 2RPNA 2DVJA 2RHUA 2V26A 2YDLA 1QKWA 2VYTA 4R0KA 1IGQA 3G71Q 2CYZB 2W10A 4RTVA 5ECAA 1IHWA 4BY6C 4DOVA 1WGSA 2KI7A 2GBQA 3CCQT 2K9GA 2OX7A 4HVUA 1QP2A 3OQ5A 3T9NA 2ECZA 1B3QA 5GAOl 1IXDA 5L23A 4LE9A 2E64A 1UUEA 1WHHA 4KBMB 2E1HA 4PJOA 2H8HA 3OYCA 4A63B 2E5QA 3TSZA 3PE0A 3A8OB 5I2MA 3S3MA 2OTJQ 5C0MA 1AZEA 3M0TA 4RCCA 4PK4A 4A4FA 1YJNA 1G2BA 4F16A 2FYKA 3E2UA 2QA4A 2GTJA 3TVTA 1UGVA 3DKMA 4N0AA 1Q81C 3CCLQ 1VQNQ 4RTXA 4JS4A 1VIFA 4MMLA 1G3YA 4M7AA 3M4GA 3JRZA 1KG1A 1R0BG 1PD1A 4C8QA 3CC4T 1Q95G 3FLGA 4X1VA 4JS5A 3RMSA 2XKOC 1OZ2A 3OSSC 1UGQB 4M77A 2GF7A 4D8DA 3OSVA 3A8GB 1N27A 5GAMe 1WPYA 1AT1B 4PFOA 3EGXB 2O2OA 4HT9A 1K4US 1X2QA 4IUQA 4AMCA 1RLPC 1YJWT 2HSEB 1M90C 2MWPA 1UGPB 1FWZA 3HRTA 2OTJA 2BE7D 5KCHA 2WSEE 1X27A 1QWFA 3PVLA 3JB9I 2QG9B 2CP7A 4F7UA 1NE8A 3ZEHA 2W0ZA 3H41A 3LW5E 1VQNA 1WZOA 3I5RA 1AWJA 5GAMj 3GNFB 4FW2A 4A4EA 4F14A 5GANe 3SHWA 2ZPIB 2AZSA 2SEMA 4HCCA 2DJZA 3OMCA 2LQWA 4WF2A 2RK1A 1LVKA 3CCJQ 3H6ZA 2RQUA 4Y92A 1X6OA 2R5MA 2WACA 4O6JA 4QT7A 3JCMQ 2QTVA 2DJQA 2O9VA 2K5FA 2VVKA 3CC2Q 2F2WA 1UJYA 3CCST 1VQLT 4HT8A 1OZ3A 2L89A 1ZSGA 2JW4A 1N6AA 1BCMA 3J80E 2EIFA 2QI2A 1TS9A 1WQWA 2CUBA 3OS5A 3BY7A 2L3RA 1ZUYA 3CCVQ 3VS1A 5GAOn 2QDLA 3G6EQ 2ABLA 2NUTB 5GANj 1D1CA 1VQ9T 4MMKA 2HKQB 2F1LA 1GBQA 1NG2A 4FIBA 1BI0A 1PRMC 1AZGB 3REBB 2EFIA 3EH1A 4C92F 2F69A 1F1BB 1BBZA 3JV3A 3HSBA 3L2QA 2YLBA 2DNUA 2EGAA 3META 4CC3A 2P4RA 2KXDA 2QQSA 3OYLA 4EMHA 1AEYA 3QJ6A 3JB9F 4LN2A 1D0ZA 3CEYA 1MNDA 2HEQA 3EGXA 3AT1B 2CP0A 1IO6A 5CKFA 4OMPA 4PLIA 3M54A 2MCNA 4DEXA 3UF4A 1UHCA 4X34A 3CMAT 3PMIA 5FW9A 5LJ3f 4Z89A 4TVRA 4XTVA 1VQMA 1OEBA 1KQSA 1AD5A 1C0MA 3CCVA 3JCMf 1MUZA 1K8AR 4NOYA 2KT8A 1JJ2S 2LCCA 5FU6C 5IHIA 4KULA 1TG0A 1WJSA 3OYIA 2Y4XA 4BE2A 2EJGA 2G6FX 4BE1A 2BZXA 4A53A 4JJDA 2DLPA 2ESWA 2BKDN 2RI3A 3CBPA 2RH2A 3CXCA 3M0PA 2JTMA 2ZPFB 5GAOm 4JRIA 2DYBA 5GANg 4J9CA 2L2PA 1YCSB 5CKHA 1KJWA 1Q7YC 3C94A 3M0RA 2D1XA 3CCUA 3EG2A 2EYZA 4F04B 1YJNT 4C92G 1N8RC 3GLXA 1DJ7B 4EIKA 2IIMA 2BE9B 4M75B 2NUTA 6AT1B 1OPLA 1Y96B 3M5AA 4BDZA 3JB9G 2RF0A 3DLLA 3EG0A 1SRLA 2BIVA 4N4GA 1FMWA 2D0QB 3NGPA 3D7SB 2KAFA 2VXFA 1XQHA 4N4IA 4C92C 1RAAB 2CZ1B 3M0UA 2DTIA 5GAMd 3G71T 3QG1A 3JCMh 4HCZA 1VQKQ 4J9GA 4KT0E 3GBQA 3ZL7C 4MZMA 5I21A 3LWIA 4M75C 3LGFA 5GAOr 2P84A 4OP0A 1JEGA 1YHQQ 4XTYA 1IHVA 2MPXC 4XU1A 2XI9A 4MDWA 2EJ9A 4JPBW 4ZTJA 2KMTA 2RJEA 2MWOA 2M51A 4PJJA 2RN8A 1UFFA 2AHJB 2KGTA 3SB2A 1D1AA 4M78F 2OTJT 1M3BA 1M27C 1K8AU 2P0PA 1D0XA 2C06A 2QASA 3VS5A 3SDZA 3GP8A 4X9DA 2MIOA 4E47A 1D3BB 2ED1A 5GANd 1XOVA 4IURA 3CCLT 2RQVA 1VQNT 3VS4A 1NPRA 3V8KA 1M90R 2VUBA 3BDLA 1SKUB 4A4KA 1C1AA 3UWNA 1VQ4Q 3MEVA 3FB9A 3P8HA 1SF9A 1B7TA 2BUDA 1BU1A 4IIMA 2LMJA 4J9HA 1TH7A 1VQKA 1NM7A 4ZN1A 2V1QA 3VUBA 4J9FA 3INZA 4JLIA 3OW2A 4BACA 2EYYA 1Y07A 4LD9K 1WDXA 5HY6A 3A1PA 1T0JA 1KHIA 3A8MB 1YHQA 2LQ8A 2F5KA 1HD3A 3RR6A 2QGFB 3E19A 1K0XA 1MMAA 4PJOF 1RADB 4C92A 4HVWA 1ZQ1A 4C5IA 3VUZA 2BZYA 3JCMX 3EAEA 3NMZC 4J6XA 4J7IA 4M75A 4AG2C 2KY9A 3JCMe 2YUNA 1VYTA 5AT1B 4JLGA 3FJ5A 4M7AF 4RTUA 3I9QA 2MMPA 4M78G 4C8QF 1QP3A 2VGNA 4E7IA 3R6NA 3OYBA 1BCOA 1P92A 2ZAEA 3TU4K 2K79A 4FT4A 1AWWA 2X4JA 3CCJT 1X01A 3MP6A 1SSFA 4M77F 3VU3C 1X6GA 5CCAA 1VQOQ 4JJCA 3JSCA 2RMOA 4RTTA 3OS0A 3CC2T 4Z8AA 4JDSA 1X43A 2I2LA 4HCKA 2EYXA 4XTXA 1YN8A 2L3QA 1M1KR 5IXBA 1Y57A 3OYNA 2ZPEB 1M90U 3RUXA 3CCVT 4M7DD 3G6ET 3CCEQ 2XHCA 2EYQA 1ZHIA 3OBWA 2ENMA 1E6GA 2KQWA 2QYZA 1YNZA 2J6KA 1K76A 4C5HA 4F7UF 4DBFA 3KFVA 4RG2A 5LL6S 2EQIA 3QYHB 4Y91A 2KRMA 1Z9QA 1I81A 2MF2A 3BFMA 2G3RA 1G5VA 2FRWA 2A08A 5GJWB 1WJQA 4ORZA 4JZ4A 4J9BA 1RACB 2FEIA 1KQSP 2PVGB 4FT2A 3CC7A 3N5BB 3PGGA 1K0SA 2JTFA 2M0OA 2RM4A 4XTWA 1VQOA 4UC4A 4M7AG 2EW3A 3FC3A 1FXXA 1MMGA 3S6WA 3S3NA 3OMGA 4Z02A 4C8QG 2YRVA 5KCOA 4IUVA 3PT9A 3VS2A 4OF1A 2BTTA 1GCQC 1Q7YR 1QVPA 4OB2B 2DERA 4N0AC 1WHLA 4M77G 3CCEA 1K1ZA 4DBRA 2COWA 1UDLA 5GAOp 2KE9A 2X4XA 4AFQC 1N8RR 5LJ3g 1K8AC 1E7OA 3DB3A 1VQPQ 4PFPA 3DLMA 4RUGA 2O31A 2RHYA 5GAOq 3CBOA 2EQKA 4QVCA 1ZBXA 4PJLA 5CQYA 2KT1A 2DZ9A 3I5SA 3P8DA 2E70A 2NUPB 3QJYA 2LP5A 3KUFA 3QWXX 4F7UG 1M1KU 3NPFA 5J26A 3UT1A 4MDXA 1LJOA 1H3HA 4FYVB 3SFMA 4C0DB 3SEMA 5D6XA 1U06A 3I56A 1MGQA 1YIJQ 2JMAA 2KEAA 3HTRA 3VS7A 2ATCB 3AHUA 2QK0A 2PNIA 5GANh 5KE3A 2V8KA 2HAXA 2DK3A 4C5EA 1ABQA 5CQXA 1SEMA 2LRQA 1S72Q 2FB7A 3QKJA 3V7CA 1OU8A 4PLLA 1OOTA 1NYFA 2Y4YA 4QVZA 4C0DC 1OYXA 7AT1B 2GFUA 1VQKT 1VQPA 1RLQC 2DIQA 5IHNA 1PKSA 3JCMc 1D09B 4ESRA 2AKKA 2DXUA 1V29B 1XNIA 2OAUA 1GCQA 2ZPBB 3MEWA 1SRMA 1OI1A 2J06A 4XU3A 5C6SA 1YHQT 2DYIA 1M9SA 2YLCA 2FPDA 2HQHA 3RESA 3ULRB 1WHMA 1Q82C 2H3EB 1WNLA 1Q7YU 2JM9A 1OPKA 3MP1A 2I0NA 5GAN2 5GAN8 4M78E 1VQ7A 3JCMd 1YIJA 1Y0MA 3HP9A 4ZN3A 1OU9A 1N8RU 2QQ9A 1FMVA 4B6MA 2LDMA 2QTXA 5DLQE 4EMKB 3OW2P 3OYJA 1S72A 2EAYA 2KYMA 2FHDA 3RKXA 1VQ4T 2OAWA 3L2WA 2D8JA 2X3XD 2NWMA 3M56A 1YITQ 2HD0A 2YUOA 3QZ5B 1I5OB 2AZVA 3RMQA 2MYSA 3S3OA 5GJVB 4ZGEB 1W2BP 2AK5A 1ABOA 2NUPA 4EMKC 4PJOD 2KBTA 5A0GA 2YT6A 1TUDA 5KYUB 4OMQA 1B07A 1ZA2B 4PJOE 1HYOA 2IVWA 4CC7A 2YSQA 1YP5A 1QVFP 1VQ8Q 3I55Q 1PM3A 4AG1C 2JM8A 1H641 3QSUA 5CKEA 2JN0A 3OYMA 2DXTA 3EGUA 2RJDA 2JMCA 3BDUA 5IAYA 2XDBA 4DBHA 3NTHA 2HBWA 2DVEA 1VYUA 1CKBA 1Y7XA 1XTDA 3CCRA 4GY5A 4M7AE 2RD1A 3OB9A 2DTOA 1VQMQ 4BUGA 4CC4B 1O75A 4C8QE 4QVDA 5FU7B 1YITA 3CXCS 3C4SA 3LH5A 5I11A 3LYIA 3X24B 1VOMA 2CP2A 4ZGDB 2J05A 3QWYA 2LNHB 3WVEB 4M77E 2DX1A 2FO0A 2HZYA 2QQBA 3GNGA 3VRZA 1VQOT 4J6YA 2HQEA 1JRIA 1E6HA 2X4YA 3EFOB 4IUPA 1VQ8A 3I55A 4RG8A 4NL3A 5CIUA 2LCSA 3X28B 2FPEA 4OGCA 3CCET 2QXFA 2CDTA 1M1KC 1M3AA 2DIGA 2K7AA 3EG1A 3PNWC 4M75F 4HVVA 4EMKA 3CCUQ 4IUUA 2CKKA 4F7UE 5J3BA 2YRCA 3CCMQ 4J9DA 2M0YA 3LH0A 1WIEA 2ZPGB 1BK2A 1QWEA 1G3SA 2YWWA 1ACMB 1IB8A 2GQVA 1T0HA 2V8IA 5GMKl 2YUQA 4OB1B 2JNGA 2J6OA 2JS0A 3H8ZA 1BI1A 2IG0A 2DAQA 3OYHA 2SRCA 2EYWA 2KXCA 3PMTA 3PIPA 2AKLA 5KYUA 5CAIA 2XK0A 4J5YA 1RUWA 4WCIA 5HK0A 5KYYB 5CKBA 4A4GA 1TUCA 1J3TA 3TEEA 1TWBA 4LUEA 5IH2A 1MHNA 4J6WA 3J7AF 1M1FA 1WHGA 1M4ZA 1T3SA 3A98A 5GAN6 2DMOA 3QHSA 3L2ZA 3G4SA 1IREB 2QEXQ 1RL2A 4HKEA 1GXIE 4KGVB 2XICA 1CSKA 3PVQA 4JRQA 3CMEQ 5D7UA 3CCMA 4XU0A 2PVOB 1VQPT 1R0CB 4M7DB 2QA4T 5KYNA 5CVIA 2EBPA 1PC0A 3JCMb 2L3SA 5GMKh 3NTKA 3UPUA 1N5ZA 4M75G 4QQDA 3OYEA 1K9AA 1VQ5Q 3A8HB 5LJ3h 1VYVA 3A8LB 1G3WA 1NJIC 1U1TA 1WHJA 4C5GA 1ZUKA 1YIJT 3E1SA 2DE0X 3EFRA 3G1JA 4M7DC 4LDWA 1V1CA 3NHNA 3BE3A 2K3XA 1KHCA 5KE2A 3M59A 2DO3A 3V8LA 2DRKA 1Q82R 3CD6Q 1EZZB 1S72T 2QEXA 2IPOB 2OTLA 4QW2A 3VYHB 1QVGP 4OB0B 5KYWB 3CPWP 2GNCA 4FL6A 3CMEA 2D0NA 1Y71A 1T3LA 2EPDA 2WSCE 2D6FA 2B8AA 3DB4A 4HCBA 4JZ3A 1W70A 1GCPA 3UA6A 3QDFA 1KSWA 2LQKA 2GTOA 3KBGA 2R58A 2ZPHB 2JOYA 1I8FA 2CSIA 3QBYA 2QDYB 5IXFA 1VQ5A 3CBMA 2O4XB 5KYYA 2RQWA 1WFWA 3FIFA 1GL5A 2M9UA 1I07A 1HK9A 1M2VB 4II1A 1VUBA 2JT4A 2ZCFB 1Q86C 2Y90A 3RNJA 1RAEB 4D8KA 1TTHB 4E7SA 1H92A 2CSQA 2COYA 2GQIA 3CD6A 1HJDA 4O5VA 3GIBA 1MV0B 2JZ2A 3ER0A 3L2RA 5LJ5g 2LT1A 1JO8A 5KYXB 2M16A 1W2BA 5GMKe 3MEUA 2DD5A 1TSFA 4E7KA 1OQKA 1YITT 2LJ0A 4JUVA 4M7DA 4E6RA 2DBMA 2ED0A 1UTIA 1QCOA 5LJ3e 3MCAB 2LJ3A 1Y96A 4KGZB 3QPHA 1BI2A 2K5LA 2VB6A 1FMKA 3EHQA 2HKNA 1QVFA 3HRUA 1I1JA 2D9TA 3EG3A 4MZTA 1W4SA 4L5GA 1VQ8T 2R57A 3I55T 1Q82U 2MOXA 5CK9A 4KUDK 4A54A 3OYGA 5GMKj 1M8MA 1GBRA 2ROLA 1ZLMA 5FWBA 2XIDA 3MHXA 3RBBB 3CC7Q 1A0NB 2XU8A 5LJ3j 2DTHA 3H0FA 1QCFA 5KYWA 5GAN5 3L2UA 3JB9J 4XTUA 3H0IA 3OYAA 3RKWA 1VQMT 2FZCB 3EFSA 2A0FB 2F2VA 2E10A 2CUDA 1PG5B 3GOXA 2ZGWA 3TSWA 3HFOA 4BI3A 5GAN7 1FYNA 3TREA 1D3BA 1WXBA 2LQNA 5IHKA 3LWHA 2RHXA 2DL5A 2O88A 4C92D 4YTLA 4D6WA 1BIBA 2GFAA 3V8JA 2RI2A 2O4XA 1TXQA 1UGRB 4E2FB 2A7YA 4E7HA 1JB0E 4C92E 2DRMA 3JB9D 4ATOA 2DA9A 1M2VA 2CP3A 3HFNA 3OS1A 2K57A 2HNIA 4J7FA 1G83A 2JVVA 4PJOB 4M4ZA 1AWXA 1JXMA 1PWTA 3UDCA 2VKNA 4M75E 4NL2A 2P0QA 1WQ7A 3CMAQ 2K5IA 2L0AA 3CCUT 5I2SA 3CCSA 1VQLA 2PTKA 1M5Q1 3I56Q 3CCMT 3SD4A 4CC2A 1WI7A 3HL8A 5KYXA 1YI2Q 4C0GA 1NEBA 3E9GA 4FCYA 2E6ZA 1U1SA 1KFZA 1TUGB 2VV5A 3VKIA 2YXYA 3OA6A 1GFCA 2DM1A 3OYYA 5A0LA 3VV0A 4GLMA 1PHTA 4FYYB 2GGRA 2K3BA 1SHGA 4WTOB 1RAHB 1K73R 5FROA 4FYWB 2LTOA 1I0CA 3QIIA 4PKCC 1X6BA 1YFNA 2QEXT 1NJIR 4E7LA 5GMKi 3NTIA 5J39A 3CMAA 3CMET 2KK4A 1VQ7Q 3M57A 4BI4A 4DEYA 4Y28E 3CPFA 5AYFA 1YJ9Q 3A5ZB 1YI2A 2E3HA 2EGCA 2RHZA 3O5ZA 4QKUA 2WSFE 1YCYA 1X69A 4AFSC 1LNXA 2CH4A 1AWOA 5GAN3 2E6NA 4Z88A 1VQ5T 2A28A 2LNVA 1V76A 5DLOA 2DBKA 2DZCA 5L8RE 2X4WA 3RKYA 4EDUA 4CRIA 2RK2A 3SWNB 1M3CA 3X25B 3M53A 2D8HA 4GLKA 2DFUA 4OMFB 1QVGA 3CPWA 2ROTA 2OI3A 8ATCB 2RQTA 1EIFA 3CD6T 1UJ0A 3EGDB 4RTZA 4M78D 5LJ3d 4QQ6A 2DL3A 1VQ6Q 4OMOA 3NFCA 5FLXE 1JJ2P 1WYXA 1QLYA 1LPLA 4MZPA 5CKDA 3SWNC 1Q86R 2EQMA 1NYGA 2YUPA 4FSXA 1PRLC 1YJ9A 2XD0A 5D6WA 5LJ5f 2DPPB 2MK5A 2RI5A 4OVAA 4DOWA 1JU5C 5IN1A 2X3WD 3CCRQ 1AHJB 2X9HA 4XU2A 3QYGB 3G71A 2EVRA 1K73U 2CGHA 3QUIA 2HQXA 3M4YA 1BYMA 2PUOB 1WXTA 1NJIU 5CO7A 2C0TA 1BI3A 3REAB 1VIEA 1OX9A 2J6FA 1UB4A 1YWPA 1GFDA 1R8OB 1QQJA 2CS7A 2HL5C 1N9SA 4IIOA 2CREA 1KC8U 4OMMA 1JBMA 1SSHA 1O9SA 2RJFA 2CT4A 2EWNA 1G3TA 1OX8A 5DY9A 2E5KA 1VQ6A 2X51A 4ZGJB 1SHFA 2PZ1A 1Z9ZA 2A37A 1KQSS 1UG1A 2YHTA 2FZKB 2NLUA 2VXEA 3CCLA 2XDDA 4KH0B 3MEAA 4EMGA 3L42A 3OY9A 2VGMA 4M7AD 2DXBA 3PFSA 4J8OA 2HSPA 1BB9A 3F70A 2COZA 4C8QD 2QQRA 5LJ5h 2ZZDA 2HMAA 4IUTA 4FSSA 2HDAA 2DEQA 4R55A 3OS2A 4ELYC 3SWNA 3MO8A
chains in the Genus database with same CATH topology
3A8HB 2VYTA 5LJ3h 3VYGA 4FT4A 3A8LB 4M77D 2X4JA 3CCJT 1X01A 2CYZB 1G3WA 3MP8A 3MP6A 5KH6A 1NJIC 1SSFA 1U1TA 4M77F 4C5GA 3VU3C 1YIJT 4BY6C 3E1SA 2RB6A 5CCAA 4DOVA 3EFRA 1N9RA 3CC7T 3JSCA 4LDWA 4M7DC 1WGSA 1Q86U 1M8VA 1LOJA 4XTZA 3OS0A 2K3XA 3CCQT 3CC2T 1KHCA 1FX7A 1QP2A 3OQ5A 4JDSA 3T9NA 5GAOl 5KE2A 3M59A 4FU6A 2DO3A 2I2LA 4XTXA 3V8LA 2E64A 3GPLA 1K9MC 4KBMB 3TCJA 2E1HA 4PJOA 5DM7R 3OYCA 4L59A 1S72T 3OYNA 2QEXA 2ZPEB 2OTLA 4QW2A 3RUXA 2E5QA 3VYHB 3CCVT 1M90U 1PSFA 2DKGA 4OB0B 5FU7C 4M7DD 3A8OB 3G6ET 2L8DA 2EYQA 2XHCA 4FL6A 5I2MA 3S3MA 1ZHIA 3OBWA 4A4HA 5C0MA 4M7DF 3CMEA 3X26B 2K4YA 4RCCA 2DD4A 2KQWA 4A4FA 1YJNA 1Y71A 2CZ6B 5HKCA 2WSCE 2FYKA 4C5HA 4F7UF 4RG2A 2QA4A 4DQ2A 5LL6S 4ME7A 3QYHB 2D6FA 2B8AA 3DB4A 3DKMA 4N0AA 4Y91A 1Q81C 1I81A 4HCBA 4JS4A 4M7AC 3G71T 1VIFA 2MF2A 4MMLA 1G3YA 3BFMA 4M7AA 2G3RA 3M4GA 1G5VA 3JRZA 3LGLA 1KG1A 2LQKA 3OYFA 3KBGA 3QDRB 2R58A 2ZPHB 3HKSA 2JOYA 4C8QA 3CC4T 3CCJA 4CI0C 1I8FA 1UGSB 3QBYA 2QDYB 1WJQA 1VQ5A 3CBMA 3OBYA 2O4XB 3FLGA 4Q5WA 1HXDA 5FRMA 3QXEB 5FRNA 3FIFA 4JS5A 4ZTFA 2PVGB 4M7AE 4FT2A 2XKOC 3RMSA 3CC7A 5FU6B 3N5BB 1OZ2A 3PGGA 2JTFA 1UGQB 2RM4A 2M0OA 2M9UA 2RHIA 1HK9A 3FEOA 3OSSC 2GF7A 4II1A 4KUIA 4M77A 4PNOA 4XTWA 4UC4A 1UEBA 1VQOA 3CC2A 1VUBA 4M7AG 5GAMg 3OSVA 3A8GB 2ZCFB 1N27A 5GAMe 1WPYA 2Y90A 3FC3A 1Q86C 3I56T 1FXXA 3S6WA 3S3NA 3OMGA 4Z02A 3QZ9B 4C8QG 2YRVA 5KCOA 4IUVA 4HT9A 2P0KA 1YI2T 3PT9A 4OF1A 3CD6A 4O5VA 1QVPA 3G6EA 3GIBA 4OB2B 4IUQA 2JZ2A 2XDPA 4N0AC 1YJWT 3O8VA 3ER0A 1M90C 2MWPA 4M77G 4B9XA 4RKUE 3L2RA 3CCEA 5LJ5g 2LT1A 3JCMJ 1UGPB 1FWZA 2M16A 3HRTA 4HA8A 4D6WA 5GMKe 3MEUA 5KCHA 5LJ5e 1W2BA 5GAOp 2DD5A 2X4XA 4E7KA 2WSEE 4VUBA 1YITT 4JUVA 4N4HA 4M7DA 1PSEA 5GAN4 2GCXA 5LJ3g 3JB9I 5LJ3e 1K8AC 3DB3A 3MCAB 4F7UA 1NE8A 2K3YA 1Y96A 3ZEHA 3LW5E 3QPHA 1BI2A 1VQNA 2K5LA 2HBPA 4RCBA 3DLMA 5M9OA 3PTAA 1U8RA 4JRKA 4X9CA 1QVFA 2RHYA 3HRUA 2D9TA 5GAMj 3GNFB 5GAOq 3CBOA 3OYDA 2EQKA 4QVCA 1ZBXA 5CQYA 3OW2S 2DZ9A 3C95A 1W4SA 3P8DA 4L5GA 2E70A 4MZTA 4A4EA 5GANe 4M7DG 2ZPIB 3M55A 3QJYA 2LVMA 1VQ8T 4HCCA 3KUFA 2R57A 2DJZA 3OMCA 3I55T 1Q82U 1KD1U 4F7UG 4WF2A 1M1KU 1K73C 2RK1A 5J26A 4C92B 3UT1A 5CK9A 4KUDK 1LJOA 3H6ZA 4MDXA 4OB3B 4A54A 3SFMA 4C0DB 3OYGA 3ZFJA 5GMKj 5LJ5j 1X6OA 2R5MA 5D6XA 3I56A 1MGQA 2WACA 4O6JA 4JJNK 2XIDA 3MHXA 3JCMQ 1VQ7T 2XU8A 2V8JA 1W2BS 5LJ3j 2K5FA 1NPPA 1YJ9T 4B9WA 4XAXB 2DTHA 3AHUA 3CCST 1VQLT 5GAN5 2X35A 4HT8A 3L2UA 1OZ3A 2L89A 3JB9J 5GANh 4XTUA 1N6AA 5KE3A 2V8KA 3J80E 2HAXA 2EIFA 2DK3A 4C5EA 2QI2A 5CQXA 3OYAA 1KC8C 1WQWA 2LRQA 2PQWA 3BY7A 3OS5A 3EFSA 2L3RA 2FB7A 4XQ3A 3RKWA 3QKJA 1VQMT 2E10A 3V7CA 5GAOn 1QVFS 4PLLA 5GANj 3GOXA 2ZGWA 1VQ9T 4MMKA 3HFOA 2Y4YA 4QVZA 4C0DC 4BI3A 5GAN7 1OYXA 3M9QA 2LX9A 2GFUA 3TREA 1D3BA 3JAME 1VQKT 1VQPA 4PL6A 2DIQA 1YBYA 1BI0A 4FIBA 3JCMc 3X20B 2DXUA 2RO0A 1V29B 3LWHA 1XNIA 2OAUA 2RHXA 4V2SA 2ZPBB 3FDRA 2PUKB 3MEWA 2FL7A 4C92D 4YTLA 3V7SA 1BIBA 2EFIA 2GFAA 3FJPA 2EQJA 3Q1JA 2RI2A 4LD6A 1OI1A 3V8JA 2O4XA 4C92F 2E12A 2F69A 3HSBA 1UGRB 4XU3A 3KXTA 2YLBA 2A7YA 5C6SA 3L2QA 1JB0E 1M9SA 2YLCA 4E7HA 3META 1X75C 3RESA 4C92E 2QQSA 3OYLA 1JJ2A 3JB9D 4EMHA 4ATOA 3HFNA 3OS1A 2K57A 2MI6A 3QJ6A 1Q82C 3JB9F 1WNLA 1Q7YU 2HNIA 4J7FA 2JVVA 3CEYA 3MP1A 3JCMV 4PJOB 1M1GA 5GAN2 1VQ6T 2PVDB 5GAN8 4BD3A 3HRSA 5CKFA 4M78E 1VQ7A 3JCMd 4PLIA 5EG2A 3UDCA 3V7RA 1YIJA 3M54A 4M75E 4NL2A 1KQ1A 2P0QA 3HP9A 4QQGA 1WQ7A 2K5IA 4L6V5 4ZN3A 3CCUT 4X34A 5I2SA 3CCSA 1VQLA 1N8RU 2QQ9A 1M5Q1 2R5AA 3CCQA 3CCMT 3CMAT 3PMIA 2LDMA 2XG8D 3SD4A 2QTXA 3L1AA 5LJ3f 3OYKA 3HL8A 2EJFA 4TVRA 4XTVA 1VQMA 5DLQE 4EMKB 4C0GA 2LC4A 3L2VA 3E9GA 1KQSA 1I5LA 3OYJA 1S72A 1I4K1 2EAYA 2E6ZA 2FHDA 3RKXA 3JCMf 3CCVA 1U1SA 3URGA 3CCRT 5IT9E 1VQ4T 3L2WA 2VV5A 3M56A 3BW1A 3VKIA 4NOYA 2HD0A 3QZ5B 4JRPA 2LCCA 5FU6C 3RMQA 1JJ2S 3WVDB 4KULA 3OA6A 4LDXA 3S3OA 3OYYA 3RERA 1WJSA 3OYIA 2Y4XA 4ZGEB 5A0LA 3E9FA 3HHTB 4BE2A 2EJGA 4BE1A 4BI8B 2OTJA 1WJRA 4A53A 3VV0A 4EMKC 2P4TA 2BKDN 4PJOD 2RI3A 3R6OA 3FRNA 3CBPA 5A0GA 2RH2A 3CXCA 2JTMA 2ZPFB 3QO3A 5GAOm 5FROA 3CC4A 4PJOE 2IVWA 4JRIA 3JCMW 2LTOA 5GANg 2EKOA 2LCLA 3QIIA 4PKCC 1KQ2A 4ELZC 5CKHA 1Q7YC 3C94A 2QEXT 1H641 3QSUA 4E7LA 5CKEA 5GMKi 2JN0A 3NTIA 5J39A 2DXTA 3OYMA 3CCUA 4BDZA 2E65A 3JB9G 3CMAA 3CMET 2RJDA 3GF5A 1YJNT 2KK4A 4C92G 1N8RC 3GLXA 1DJ7B 3BDUA 1Q81U 3M57A 4BI4A 5IAYA 4Y28E 3CPFA 2XDBA 5AYFA 3NTHA 4C0FA 3A5ZB 1YI2A 2DVEA 2LT4A 4M78B 4M75B 2L5QA 3HPWA 3ME9A 1B34B 1XTDA 2WSFE 1Y7XA 1Y96B 1YCYA 2RHZA 3M5AA 4GY5A 4EPCA 2JUFA 3DLLA 2RD1A 1VQ4A 3OB9A 1YJWA 3J81E 1LNXA 2BIVA 2DTOA 4DA4A 4N4GA 4BUGA 2D0QB 1O75A 4LDUA 4XK8E 4C8QE 2KAFA 2VXFA 5GMKm 4QVDA 1XQHA 5GAN3 4NS5A 2E6NA 3RIRA 4N4IA 5FU7B 1YITA 3C12A 3CXCS 1VQ5T 2QQAA 3C4SA 4C92C 2LNVA 2CZ1B 3LYIA 3X24B 2DTIA 5DLOA 2DZCA 4ZGDB 3ASKA 3QG1A 5L8RE 4HCZA 3JCMh 5GAMd 2X4WA 3RKYA 2CZ0B 3WVEB 4EDUA 4M77E 4CRIA 3JB9H 2QQBA 2RK2A 3SWNB 4KT0E 3GNGA 1VQOT 4J6YA 2KSSA 2HQEA 4M78C 4MZMA 3X25B 5I21A 3LWIA 4M75C 2O01E 3M53A 1JRIA 3LGFA 3P8BB 4GLKA 5GAOr 4LDYA 4OP0A 4OMFB 1H3ZA 1QVGA 2X4YA 5A0DA 4XTYA 4BB7A 3CPWA 5LJ5d 4IUPA 1EIFA 1VQ8A 4XU1A 2XI9A 5GAMf 4MDWA 3I55A 3CD6T 2EJ9A 4RG8A 2RA2A 2H3JA 2K2VA 5D6YA 4ZTJA 4NL3A 2KMTA 2RJEA 5CIUA 2MWOA 3X28B 4M78D 5LJ3d 4QQ6A 1KD1C 3NFCA 4M75D 2AHJB 2QXFA 4OGCA 5FLXE 1YHQT 1M1KC 3CCET 2DIGA 3SB2A 2E41A 4M78F 4M7DE 2OTJT 3PNWC 4BDYA 5A2QE 3G4ST 4M75F 2VC8A 1K8AU 4MZPA 5CKDA 2P0PA 3SWNC 4C0ZA 2PU9B 4EMKA 2C06A 2EQMA 3CCRA 4IUUA 3SDZA 3ZBDA 2CKKA 4F7UE 4PJOG 4FSXA 5J3BA 3GP8A 1YJ9A 4X9DA 5D6WA 5LJ5f 2XD0A 2DPPB 3LH0A 4LDVA 4OGEA 2RI5A 4E47A 1D3BB 2ZPGB 5GANd 3G7ZA 1XOVA 4IURA 3CCLT 4IKFA 4OVAA 1VQNT 1G3SA 3JCMP 1NPRA 3V8KA 2GQVA 2V8IA 4DOWA 5GMKl 3LX7A 4OB1B 3PIOA 2VUBA 2EQUA 2JNGA 3BDLA 5IN1A 4A4KA 2MAMA 3UWNA 3H8ZA 1BI1A 1AHJB 2IG0A 5CR2A 3MEVA 3FB9A 4XU2A 4E7JA 1VQ9A 2DXCA 3QYGB 3P8HA 3G71A 1K73U 2DAQA 2FVUA 3OYHA 1QVGS 2BUDA 2CGHA 4M7AB 4PJOC 4P5NA 3CPWS 1TH7A 1VQKA 3QUIA 2RJCA 2HQXA 3M4YA 3LLRA 3PMTA 2PUOB 3VUBA 4ZN1A 5GANf 3PIPA 1BYMA 1BKBA 1NJIU 3INZA 4JLIA 4C8QB 3OW2A 5CAIA 5CO7A 1IZ6A 3WXMB 4BACA 1Y07A 2XK0A 1BI3A 4J5YA 3M58A 4LD9K 1BIAA 1VIEA 5HY6A 5HK0A 5CKBA 1UB4A 4A4GA 1R8OB 1KHIA 2M1HA 3A8MB 3TEEA 2CS7A 1N9SA 1YHQA 2LQ8A 4J83A 2F5KA 4M77B 1NZ9A 3E19A 1MHNA 4BE0A 4J6WA 1KC8U 3J7AF 1JBMA 1M1FA 3VJPA 1K9MU 4PJOF 1O9SA 4C92A 1QW1A 1M4ZA 2RJFA 4FM4B 2KDSA 2EWNA 5GAN6 1G3TA 2F5TX 1ZQ1A 5DY9A 3QHSA 2A3LA 4C5IA 3L2ZA 3VUZA 1IREB 3G4SA 1VQ6A 4ZGJB 1RL2A 4HKEA 4RMOA 1GXIE 2KVQG 2XICA 5HK3A 3JCMX 4JRQA 4C8QC 2OTLT 4M78A 2CZ7B 3EAEA 5GAMh 1KQSS 4J6XA 4J7IA 4M75A 2YHTA 1B34A 2NLUA 2VXEA 2KY9A 3CCLA 3CCMA 4XU0A 2PVOB 4R56A 2XDDA 3JCMg 1VQPT 3MEAA 4EMGA 4BY6B 3L42A 3JCMe 3OY9A 2VGMA 1RI0A 4M7AD 4M7DB 2DXBA 3PFSA 4J8OA 4M77C 4JLGA 2QA4T 4M7AF 3F70A 5CVIA 4C8QD 4F7UB 2QQRA 3JCMb 5GMKh 5LJ5h 2ZZDA 3NTKA 4IUTA 3UPUA 2MMPA 4M78G 4C8QF 1QP3A 2DEQA 2RHUA 2VGNA 4R55A 3OS2A 4M75G 4E7IA 4ELYC 3SWNA 3OYBA 4QQDA 3OYEA 1P92A 3MO8A 3TU4K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VYT A;  3SD4 A;  4IUP A;  3OYK A;  3DB3 A;  2K3Y A;  3ZEH A;  5D6Y A;  4ZTJ A;  3MP8 A;  3MP6 A;  2RJE A;  5CIU A;  1SSF A;  2MWO A;  3E9G A;  4C5G A;  3DLM A;  5KH6 A;  3OYJ A;  3L2V A;  5M9O A;  4QQ6 A;  2FHD A;  2RHY A;  2D9T A;  2DIG A;  3OYD A;  3PNW C;  4BDY A;  3L2W A;  2EQK A;  1WGS A;  3OS0 A;  2EQM A;  2K3X A;  3P8D A;  4IUU A;  4A4E A;  1KHC A;  2CKK A;  3OQ5 A;  5KE2 A;  4FU6 A;  2LCC A;  2LVM A;  5D6W A;  3KUF A;  3LH0 A;  2R57 A;  3OMC A;  3OA6 A;  2RI5 A;  3S3O A;  1WJS A;  3OYI A;  4IUR A;  5J26 A;  4IKF A;  4OVA A;  3E9F A;  3UT1 A;  4BE2 A;  3H6Z A;  4L59 A;  3OYC A;  4BE1 A;  3OYN A;  1WJR A;  3OYG A;  4QW2 A;  2E5Q A;  3LX7 A;  2R5M A;  5D6X A;  2WAC A;  2BKD N;  2EQU A;  3BDL A;  5IN1 A;  2L8D A;  2RI3 A;  4FL6 A;  3OYE A;  3S3M A;  5C0M A;  3UWN A;  4A4H A;  3H8Z A;  2IG0 A;  3MEV A;  4E7J A;  3P8H A;  4A4F A;  2DAQ A;  3OYH A;  5FRO A;  4B9W A;  4C5H A;  2BUD A;  2LTO A;  4RG2 A;  2EKO A;  3QII A;  2X35 A;  3L2U A;  1OZ3 A;  2L89 A;  2RJC A;  2HQX A;  3PMT A;  3LLR A;  2B8A A;  3DB4 A;  5KE3 A;  4C5E A;  3OYA A;  4BAC A;  4E7L A;  2LRQ A;  2PQW A;  2XK0 A;  2L3R A;  3NTI A;  5J39 A;  3OYM A;  3QKJ A;  2G3R A;  1G5V A;  3LGL A;  4PLL A;  4A4G A;  3GOX A;  2M1H A;  2RJD A;  3OYF A;  4QVZ A;  2R58 A;  1OYX A;  2F5K A;  3M9Q A;  3QBY A;  5IAY A;  1MHN A;  1WJQ A;  2GFU A;  4BE0 A;  4Q5W A;  3NTH A;  2O4X B;  3FLG A;  4PL6 A;  5FRM A;  2DIQ A;  2RJF A;  5FRN A;  4ZTF A;  3ME9 A;  2RHZ A;  4BDZ A;  4GY5 A;  1OZ2 A;  2RO0 A;  4C5I A;  1XNI A;  2JTF A;  2M0O A;  2RHX A;  3FEO A;  3FDR A;  2RHI A;  3MEW A;  3OB9 A;  2BIV A;  2GF7 A;  2EFI A;  2GFA A;  4II1 A;  3Q1J A;  2EQJ A;  4LD6 A;  2RI2 A;  4N4G A;  1OI1 A;  4UC4 A;  2O4X A;  3FC3 A;  1N27 A;  3EAE A;  3L2Q A;  4NS5 A;  2E6N A;  5C6S A;  4N4I A;  4E7H A;  3S6W A;  3S3N A;  2NLU A;  3MET A;  3OMG A;  4Z02 A;  2QQS A;  3C4S A;  3OYL A;  2YRV A;  3LYI A;  5KCO A;  4IUV A;  2P0K A;  3MEA A;  3ASK A;  3OS1 A;  3QJ6 A;  3L42 A;  4HCZ A;  3OY9 A;  2X4W A;  4EDU A;  1RI0 A;  4CRI A;  3CEY A;  3MP1 A;  3PFS A;  4IUQ A;  2JZ2 A;  2XDP A;  4BD3 A;  3O8V A;  3F70 A;  2MWP A;  4PLI A;  2HQE A;  4B9X A;  3L2R A;  2QQR A;  2M16 A;  4QQG A;  3LGF A;  3MEU A;  5KCH A;  3NTK A;  4IUT A;  2X4X A;  4E7K A;  4X34 A;  1H3Z A;  2RHU A;  3OS2 A;  4E7I A;  4N4H A;  2R5A A;  2X4Y A;  3OYB A;  4QQD A;  3PMI A;  3MO8 A;  2LDM A; 
#chains in the Genus database with same CATH topology
 3VYG A;  5HCK A;  4M77 D;  1MV3 A;  3MP8 A;  5KH6 A;  1HSQ A;  4OML A;  2RB6 A;  3EHR A;  3CC7 T;  1N9R A;  2JJ9 A;  1Q86 U;  1M8V A;  1LOJ A;  4XTZ A;  3EGD A;  1FX7 A;  4FU6 A;  3GPL A;  1K9M C;  1KD1 R;  3TCJ A;  5DM7 R;  4L59 A;  1RAB B;  1PD0 A;  3EH2 A;  1PSF A;  2DKG A;  5FU7 C;  2L8D A;  4M7D F;  4A4H A;  3X26 B;  3G4S Q;  2K4Y A;  2DD4 A;  2DL4 A;  2CZ6 B;  5HKC A;  4DQ2 A;  1LCK A;  4ME7 A;  2CH4 W;  1RAI B;  4F17 A;  3H0H A;  2JTE A;  3LGL A;  3OYF A;  3QDR B;  3HKS A;  5EC7 A;  3CCJ A;  4CI0 C;  1UGS B;  4Q5W A;  3OBY A;  1HXD A;  1WXU A;  5FRM A;  3QXE B;  5FRN A;  3MJX A;  4ZTF A;  5FU6 B;  3FEO A;  3C0C A;  2RHI A;  4KUI A;  1ARK A;  4PNO A;  1TOV A;  1UEB A;  3CC2 A;  1WX6 A;  5GAM g;  3I56 T;  3QZ9 B;  1EX4 A;  4RTW A;  2P0K A;  1YI2 T;  4ZNX A;  2E3I A;  3G6E A;  2XDP A;  3O8V A;  4B9X A;  4RKU E;  3JCM J;  1U3O A;  4HA8 A;  1RAG B;  5LJ5 e;  4E7Z A;  2OTL Q;  2QAZ A;  4VUB A;  4N4H A;  1RI9 A;  1PSE A;  5GAN 4;  2GCX A;  9ATC B;  4GBQ A;  1UHF A;  2K3Y A;  2HBP A;  4RCB A;  5M9O A;  3PTA A;  1U8R A;  4JRK A;  4FYX B;  4X9C A;  1NLP C;  4KGX B;  3TQ7 P;  3OYD A;  2VWF A;  4LXC A;  1R77 A;  3OW2 S;  4FW1 A;  3C95 A;  1IRX A;  4M7D G;  2C0O A;  1JXO A;  3M55 A;  2JXB A;  2LVM A;  4RTY A;  1KD1 U;  3I35 A;  3M0S A;  1ZA1 B;  2M02 A;  2OJ2 A;  1K73 C;  4C92 B;  2KR3 A;  2FRY A;  4OB3 B;  3ZFJ A;  5LJ5 j;  4JJN K;  3EFO A;  1VQ7 T;  2V8J A;  1W2B S;  1YWO A;  3CCQ Q;  1NPP A;  3IQL A;  4B9W A;  4XAX B;  1YJ9 T;  2X35 A;  2YRD A;  2RQR A;  1KC8 C;  2PQW A;  4XQ3 A;  4J9E A;  1QVF S;  1TU0 B;  2VAS A;  3VS0 A;  3M9Q A;  2LX9 A;  1Q81 R;  1OV3 A;  3JAM E;  4PL6 A;  1IGU A;  1YBY A;  1KIK A;  1NBE B;  3VS3 A;  3X20 B;  3MKD A;  2DEU A;  2RO0 A;  4V2S A;  3FDR A;  2PUK B;  2FL7 A;  3V7S A;  3FJP A;  2EQJ A;  3Q1J A;  4LD6 A;  1M2O A;  2E12 A;  2DL7 A;  3KXT A;  1XJW B;  1X75 C;  1JJ2 A;  3CC4 Q;  2MI6 A;  1W1F A;  2CT3 A;  3JCM V;  1SG5 A;  1ZX6 A;  1M1G A;  1VQ6 T;  2PVD B;  4BD3 A;  3HRS A;  3V7R A;  5EG2 A;  2XMF A;  1KQ1 A;  4QQG A;  4OMN A;  4L6V 5;  1JQQ A;  1QCN A;  2CP6 A;  2R5A A;  3CCQ A;  1ZSZ B;  2XG8 D;  3L1A A;  3OYK A;  2EJF A;  3EG9 B;  2LC4 A;  3L2V A;  2FG0 A;  1I5L A;  1I4K 1;  1YJW Q;  1ZBJ A;  3URG A;  1WHK A;  3CCR T;  5IT9 E;  1S1N A;  3BW1 A;  1SPK A;  1QKX A;  8AT1 B;  4JRP A;  3WVD B;  4LDX A;  3RER A;  3UAT A;  1H8K A;  3E9F A;  2Z0W A;  3HHT B;  4JJB A;  4BI8 B;  1ZSZ C;  1WJR A;  1M30 A;  2NUZ A;  2P4T A;  1UE9 A;  1MMD A;  3R6O A;  1UEC A;  3FRN A;  2RNA A;  3QO3 A;  3CC4 A;  3JCM W;  2EKO A;  2LCL A;  1KQ2 A;  3M0Q A;  4ELZ C;  4LNP A;  4PJM A;  2C0I A;  4AFZ C;  2E65 A;  2EGE A;  2DL8 A;  3CQT A;  1C6V X;  3GF5 A;  2KNB B;  1RAF B;  2LX7 A;  1Q81 U;  2KRS A;  4C0F A;  3CCS Q;  2LT4 A;  4M78 B;  1K9M R;  1VQL Q;  4DBQ A;  2L5Q A;  3HPW A;  3ME9 A;  2KYB A;  1B34 B;  4EPC A;  1VQ4 A;  1AVZ C;  2JUF A;  2DIL A;  1W6X A;  1YJW A;  4K11 A;  3J81 E;  4DA4 A;  1D1B A;  4LDU A;  4XK8 E;  5GMK m;  1VA7 A;  4NS5 A;  3RIR A;  1VQ9 Q;  3C12 A;  5FWC A;  2QQA A;  4AFU C;  3ASK A;  3JB9 H;  2CZ0 B;  1PNJ A;  1D0Y A;  1G8X A;  1U5S A;  4PFZ A;  1ZUU A;  2KSS A;  4M78 C;  1EFN A;  2O01 E;  3P8B B;  4LDY A;  4ANJ A;  1H3Z A;  3VS6 A;  5A0D A;  4BB7 A;  5LJ5 d;  4KH1 B;  5GAM f;  1GRI A;  2K2M A;  3UA7 A;  2RA2 A;  2H3J A;  2K2V A;  5D6Y A;  2CP5 A;  4J9I A;  3VRY A;  1KD1 C;  2BZ8 A;  4M75 D;  3THK A;  1ZSZ A;  2E41 A;  4M7D E;  4BDY A;  5A2Q E;  2F2X A;  3G4S T;  2VC8 A;  4C0Z A;  2PU9 B;  3EG9 A;  3ZBD A;  1NEG A;  1MNE A;  4KRT A;  1QMC A;  4PJO G;  4LDV A;  4OGE A;  1CKA A;  3G7Z A;  4IKF A;  3JCM P;  2J7I A;  3LX7 A;  3PIO A;  2EQU A;  3U23 A;  2MAM A;  2NYS A;  1NLO C;  5CR2 A;  2KRN A;  1X2K A;  2QGG A;  2K6D A;  4E7J A;  1VQ9 A;  2DXC A;  1OUL A;  2FVU A;  1QVG S;  4M7A B;  4PJO C;  4P5N A;  3CPW S;  2V1R A;  1MMN A;  2KRO A;  1PKT A;  2LJ1 A;  2RJC A;  4PJN A;  3LLR A;  5I22 A;  5GAN f;  1BKB A;  1WLP B;  4C8Q B;  2AT1 B;  1IZ6 A;  3WXM B;  2HCK A;  2B86 A;  2DET A;  3M58 A;  1WA7 A;  1BIA A;  3H9N A;  2M1H A;  4HXJ A;  4J83 A;  2AIR B;  4M77 B;  1NZ9 A;  1KK7 A;  4BE0 A;  3VJP A;  1K9M U;  1QW1 A;  2FZG B;  4FM4 B;  2KDS A;  2HL3 A;  2F5T X;  2LZ6 B;  3MPU B;  2A3L A;  2L3P A;  3CXC P;  4M7A C;  2EKH A;  4RMO A;  2KVQ G;  2O9S A;  5HK3 A;  4C8Q C;  2OTL T;  4M78 A;  2CZ7 B;  5GAM h;  1B34 A;  1YJN Q;  2E4H A;  1AOJ A;  2A36 A;  4R56 A;  3JCM g;  2QA4 Q;  4BY6 B;  2DF6 A;  1RI0 A;  4AT1 B;  4M77 C;  2FPF A;  1KC8 R;  2JS2 A;  3RDV A;  1PCX A;  4LUD A;  4F7U B;  2RPN A;  2DVJ A;  2RHU A;  2V26 A;  2YDL A;  1QKW A;  2VYT A;  4R0K A;  1IGQ A;  3G71 Q;  2CYZ B;  2W10 A;  4RTV A;  5ECA A;  1IHW A;  4BY6 C;  4DOV A;  1WGS A;  2KI7 A;  2GBQ A;  3CCQ T;  2K9G A;  2OX7 A;  4HVU A;  1QP2 A;  3OQ5 A;  3T9N A;  2ECZ A;  1B3Q A;  5GAO l;  1IXD A;  5L23 A;  4LE9 A;  2E64 A;  1UUE A;  1WHH A;  4KBM B;  2E1H A;  4PJO A;  2H8H A;  3OYC A;  4A63 B;  2E5Q A;  3TSZ A;  3PE0 A;  3A8O B;  5I2M A;  3S3M A;  2OTJ Q;  5C0M A;  1AZE A;  3M0T A;  4RCC A;  4PK4 A;  4A4F A;  1YJN A;  1G2B A;  4F16 A;  2FYK A;  3E2U A;  2QA4 A;  2GTJ A;  3TVT A;  1UGV A;  3DKM A;  4N0A A;  1Q81 C;  3CCL Q;  1VQN Q;  4RTX A;  4JS4 A;  1VIF A;  4MML A;  1G3Y A;  4M7A A;  3M4G A;  3JRZ A;  1KG1 A;  1R0B G;  1PD1 A;  4C8Q A;  3CC4 T;  1Q95 G;  3FLG A;  4X1V A;  4JS5 A;  3RMS A;  2XKO C;  1OZ2 A;  3OSS C;  1UGQ B;  4M77 A;  2GF7 A;  4D8D A;  3OSV A;  3A8G B;  1N27 A;  5GAM e;  1WPY A;  1AT1 B;  4PFO A;  3EGX B;  2O2O A;  4HT9 A;  1K4U S;  1X2Q A;  4IUQ A;  4AMC A;  1RLP C;  1YJW T;  2HSE B;  1M90 C;  2MWP A;  1UGP B;  1FWZ A;  3HRT A;  2OTJ A;  2BE7 D;  5KCH A;  2WSE E;  1X27 A;  1QWF A;  3PVL A;  3JB9 I;  2QG9 B;  2CP7 A;  4F7U A;  1NE8 A;  3ZEH A;  2W0Z A;  3H41 A;  3LW5 E;  1VQN A;  1WZO A;  3I5R A;  1AWJ A;  5GAM j;  3GNF B;  4FW2 A;  4A4E A;  4F14 A;  5GAN e;  3SHW A;  2ZPI B;  2AZS A;  2SEM A;  4HCC A;  2DJZ A;  3OMC A;  2LQW A;  4WF2 A;  2RK1 A;  1LVK A;  3CCJ Q;  3H6Z A;  2RQU A;  4Y92 A;  1X6O A;  2R5M A;  2WAC A;  4O6J A;  4QT7 A;  3JCM Q;  2QTV A;  2DJQ A;  2O9V A;  2K5F A;  2VVK A;  3CC2 Q;  2F2W A;  1UJY A;  3CCS T;  1VQL T;  4HT8 A;  1OZ3 A;  2L89 A;  1ZSG A;  2JW4 A;  1N6A A;  1BCM A;  3J80 E;  2EIF A;  2QI2 A;  1TS9 A;  1WQW A;  2CUB A;  3OS5 A;  3BY7 A;  2L3R A;  1ZUY A;  3CCV Q;  3VS1 A;  5GAO n;  2QDL A;  3G6E Q;  2ABL A;  2NUT B;  5GAN j;  1D1C A;  1VQ9 T;  4MMK A;  2HKQ B;  2F1L A;  1GBQ A;  1NG2 A;  4FIB A;  1BI0 A;  1PRM C;  1AZG B;  3REB B;  2EFI A;  3EH1 A;  4C92 F;  2F69 A;  1F1B B;  1BBZ A;  3JV3 A;  3HSB A;  3L2Q A;  2YLB A;  2DNU A;  2EGA A;  3MET A;  4CC3 A;  2P4R A;  2KXD A;  2QQS A;  3OYL A;  4EMH A;  1AEY A;  3QJ6 A;  3JB9 F;  4LN2 A;  1D0Z A;  3CEY A;  1MND A;  2HEQ A;  3EGX A;  3AT1 B;  2CP0 A;  1IO6 A;  5CKF A;  4OMP A;  4PLI A;  3M54 A;  2MCN A;  4DEX A;  3UF4 A;  1UHC A;  4X34 A;  3CMA T;  3PMI A;  5FW9 A;  5LJ3 f;  4Z89 A;  4TVR A;  4XTV A;  1VQM A;  1OEB A;  1KQS A;  1AD5 A;  1C0M A;  3CCV A;  3JCM f;  1MUZ A;  1K8A R;  4NOY A;  2KT8 A;  1JJ2 S;  2LCC A;  5FU6 C;  5IHI A;  4KUL A;  1TG0 A;  1WJS A;  3OYI A;  2Y4X A;  4BE2 A;  2EJG A;  2G6F X;  4BE1 A;  2BZX A;  4A53 A;  4JJD A;  2DLP A;  2ESW A;  2BKD N;  2RI3 A;  3CBP A;  2RH2 A;  3CXC A;  3M0P A;  2JTM A;  2ZPF B;  5GAO m;  4JRI A;  2DYB A;  5GAN g;  4J9C A;  2L2P A;  1YCS B;  5CKH A;  1KJW A;  1Q7Y C;  3C94 A;  3M0R A;  2D1X A;  3CCU A;  3EG2 A;  2EYZ A;  4F04 B;  1YJN T;  4C92 G;  1N8R C;  3GLX A;  1DJ7 B;  4EIK A;  2IIM A;  2BE9 B;  4M75 B;  2NUT A;  6AT1 B;  1OPL A;  1Y96 B;  3M5A A;  4BDZ A;  3JB9 G;  2RF0 A;  3DLL A;  3EG0 A;  1SRL A;  2BIV A;  4N4G A;  1FMW A;  2D0Q B;  3NGP A;  3D7S B;  2KAF A;  2VXF A;  1XQH A;  4N4I A;  4C92 C;  1RAA B;  2CZ1 B;  3M0U A;  2DTI A;  5GAM d;  3G71 T;  3QG1 A;  3JCM h;  4HCZ A;  1VQK Q;  4J9G A;  4KT0 E;  3GBQ A;  3ZL7 C;  4MZM A;  5I21 A;  3LWI A;  4M75 C;  3LGF A;  5GAO r;  2P84 A;  4OP0 A;  1JEG A;  1YHQ Q;  4XTY A;  1IHV A;  2MPX C;  4XU1 A;  2XI9 A;  4MDW A;  2EJ9 A;  4JPB W;  4ZTJ A;  2KMT A;  2RJE A;  2MWO A;  2M51 A;  4PJJ A;  2RN8 A;  1UFF A;  2AHJ B;  2KGT A;  3SB2 A;  1D1A A;  4M78 F;  2OTJ T;  1M3B A;  1M27 C;  1K8A U;  2P0P A;  1D0X A;  2C06 A;  2QAS A;  3VS5 A;  3SDZ A;  3GP8 A;  4X9D A;  2MIO A;  4E47 A;  1D3B B;  2ED1 A;  5GAN d;  1XOV A;  4IUR A;  3CCL T;  2RQV A;  1VQN T;  3VS4 A;  1NPR A;  3V8K A;  1M90 R;  2VUB A;  3BDL A;  1SKU B;  4A4K A;  1C1A A;  3UWN A;  1VQ4 Q;  3MEV A;  3FB9 A;  3P8H A;  1SF9 A;  1B7T A;  2BUD A;  1BU1 A;  4IIM A;  2LMJ A;  4J9H A;  1TH7 A;  1VQK A;  1NM7 A;  4ZN1 A;  2V1Q A;  3VUB A;  4J9F A;  3INZ A;  4JLI A;  3OW2 A;  4BAC A;  2EYY A;  1Y07 A;  4LD9 K;  1WDX A;  5HY6 A;  3A1P A;  1T0J A;  1KHI A;  3A8M B;  1YHQ A;  2LQ8 A;  2F5K A;  1HD3 A;  3RR6 A;  2QGF B;  3E19 A;  1K0X A;  1MMA A;  4PJO F;  1RAD B;  4C92 A;  4HVW A;  1ZQ1 A;  4C5I A;  3VUZ A;  2BZY A;  3JCM X;  3EAE A;  3NMZ C;  4J6X A;  4J7I A;  4M75 A;  4AG2 C;  2KY9 A;  3JCM e;  2YUN A;  1VYT A;  5AT1 B;  4JLG A;  3FJ5 A;  4M7A F;  4RTU A;  3I9Q A;  2MMP A;  4M78 G;  4C8Q F;  1QP3 A;  2VGN A;  4E7I A;  3R6N A;  3OYB A;  1BCO A;  1P92 A;  2ZAE A;  3TU4 K;  2K79 A;  4FT4 A;  1AWW A;  2X4J A;  3CCJ T;  1X01 A;  3MP6 A;  1SSF A;  4M77 F;  3VU3 C;  1X6G A;  5CCA A;  1VQO Q;  4JJC A;  3JSC A;  2RMO A;  4RTT A;  3OS0 A;  3CC2 T;  4Z8A A;  4JDS A;  1X43 A;  2I2L A;  4HCK A;  2EYX A;  4XTX A;  1YN8 A;  2L3Q A;  1M1K R;  5IXB A;  1Y57 A;  3OYN A;  2ZPE B;  1M90 U;  3RUX A;  3CCV T;  4M7D D;  3G6E T;  3CCE Q;  2XHC A;  2EYQ A;  1ZHI A;  3OBW A;  2ENM A;  1E6G A;  2KQW A;  2QYZ A;  1YNZ A;  2J6K A;  1K76 A;  4C5H A;  4F7U F;  4DBF A;  3KFV A;  4RG2 A;  5LL6 S;  2EQI A;  3QYH B;  4Y91 A;  2KRM A;  1Z9Q A;  1I81 A;  2MF2 A;  3BFM A;  2G3R A;  1G5V A;  2FRW A;  2A08 A;  5GJW B;  1WJQ A;  4ORZ A;  4JZ4 A;  4J9B A;  1RAC B;  2FEI A;  1KQS P;  2PVG B;  4FT2 A;  3CC7 A;  3N5B B;  3PGG A;  1K0S A;  2JTF A;  2M0O A;  2RM4 A;  4XTW A;  1VQO A;  4UC4 A;  4M7A G;  2EW3 A;  3FC3 A;  1FXX A;  1MMG A;  3S6W A;  3S3N A;  3OMG A;  4Z02 A;  4C8Q G;  2YRV A;  5KCO A;  4IUV A;  3PT9 A;  3VS2 A;  4OF1 A;  2BTT A;  1GCQ C;  1Q7Y R;  1QVP A;  4OB2 B;  2DER A;  4N0A C;  1WHL A;  4M77 G;  3CCE A;  1K1Z A;  4DBR A;  2COW A;  1UDL A;  5GAO p;  2KE9 A;  2X4X A;  4AFQ C;  1N8R R;  5LJ3 g;  1K8A C;  1E7O A;  3DB3 A;  1VQP Q;  4PFP A;  3DLM A;  4RUG A;  2O31 A;  2RHY A;  5GAO q;  3CBO A;  2EQK A;  4QVC A;  1ZBX A;  4PJL A;  5CQY A;  2KT1 A;  2DZ9 A;  3I5S A;  3P8D A;  2E70 A;  2NUP B;  3QJY A;  2LP5 A;  3KUF A;  3QWX X;  4F7U G;  1M1K U;  3NPF A;  5J26 A;  3UT1 A;  4MDX A;  1LJO A;  1H3H A;  4FYV B;  3SFM A;  4C0D B;  3SEM A;  5D6X A;  1U06 A;  3I56 A;  1MGQ A;  1YIJ Q;  2JMA A;  2KEA A;  3HTR A;  3VS7 A;  2ATC B;  3AHU A;  2QK0 A;  2PNI A;  5GAN h;  5KE3 A;  2V8K A;  2HAX A;  2DK3 A;  4C5E A;  1ABQ A;  5CQX A;  1SEM A;  2LRQ A;  1S72 Q;  2FB7 A;  3QKJ A;  3V7C A;  1OU8 A;  4PLL A;  1OOT A;  1NYF A;  2Y4Y A;  4QVZ A;  4C0D C;  1OYX A;  7AT1 B;  2GFU A;  1VQK T;  1VQP A;  1RLQ C;  2DIQ A;  5IHN A;  1PKS A;  3JCM c;  1D09 B;  4ESR A;  2AKK A;  2DXU A;  1V29 B;  1XNI A;  2OAU A;  1GCQ A;  2ZPB B;  3MEW A;  1SRM A;  1OI1 A;  2J06 A;  4XU3 A;  5C6S A;  1YHQ T;  2DYI A;  1M9S A;  2YLC A;  2FPD A;  2HQH A;  3RES A;  3ULR B;  1WHM A;  1Q82 C;  2H3E B;  1WNL A;  1Q7Y U;  2JM9 A;  1OPK A;  3MP1 A;  2I0N A;  5GAN 2;  5GAN 8;  4M78 E;  1VQ7 A;  3JCM d;  1YIJ A;  1Y0M A;  3HP9 A;  4ZN3 A;  1OU9 A;  1N8R U;  2QQ9 A;  1FMV A;  4B6M A;  2LDM A;  2QTX A;  5DLQ E;  4EMK B;  3OW2 P;  3OYJ A;  1S72 A;  2EAY A;  2KYM A;  2FHD A;  3RKX A;  1VQ4 T;  2OAW A;  3L2W A;  2D8J A;  2X3X D;  2NWM A;  3M56 A;  1YIT Q;  2HD0 A;  2YUO A;  3QZ5 B;  1I5O B;  2AZV A;  3RMQ A;  2MYS A;  3S3O A;  5GJV B;  4ZGE B;  1W2B P;  2AK5 A;  1ABO A;  2NUP A;  4EMK C;  4PJO D;  2KBT A;  5A0G A;  2YT6 A;  1TUD A;  5KYU B;  4OMQ A;  1B07 A;  1ZA2 B;  4PJO E;  1HYO A;  2IVW A;  4CC7 A;  2YSQ A;  1YP5 A;  1QVF P;  1VQ8 Q;  3I55 Q;  1PM3 A;  4AG1 C;  2JM8 A;  1H64 1;  3QSU A;  5CKE A;  2JN0 A;  3OYM A;  2DXT A;  3EGU A;  2RJD A;  2JMC A;  3BDU A;  5IAY A;  2XDB A;  4DBH A;  3NTH A;  2HBW A;  2DVE A;  1VYU A;  1CKB A;  1Y7X A;  1XTD A;  3CCR A;  4GY5 A;  4M7A E;  2RD1 A;  3OB9 A;  2DTO A;  1VQM Q;  4BUG A;  4CC4 B;  1O75 A;  4C8Q E;  4QVD A;  5FU7 B;  1YIT A;  3CXC S;  3C4S A;  3LH5 A;  5I11 A;  3LYI A;  3X24 B;  1VOM A;  2CP2 A;  4ZGD B;  2J05 A;  3QWY A;  2LNH B;  3WVE B;  4M77 E;  2DX1 A;  2FO0 A;  2HZY A;  2QQB A;  3GNG A;  3VRZ A;  1VQO T;  4J6Y A;  2HQE A;  1JRI A;  1E6H A;  2X4Y A;  3EFO B;  4IUP A;  1VQ8 A;  3I55 A;  4RG8 A;  4NL3 A;  5CIU A;  2LCS A;  3X28 B;  2FPE A;  4OGC A;  3CCE T;  2QXF A;  2CDT A;  1M1K C;  1M3A A;  2DIG A;  2K7A A;  3EG1 A;  3PNW C;  4M75 F;  4HVV A;  4EMK A;  3CCU Q;  4IUU A;  2CKK A;  4F7U E;  5J3B A;  2YRC A;  3CCM Q;  4J9D A;  2M0Y A;  3LH0 A;  1WIE A;  2ZPG B;  1BK2 A;  1QWE A;  1G3S A;  2YWW A;  1ACM B;  1IB8 A;  2GQV A;  1T0H A;  2V8I A;  5GMK l;  2YUQ A;  4OB1 B;  2JNG A;  2J6O A;  2JS0 A;  3H8Z A;  1BI1 A;  2IG0 A;  2DAQ A;  3OYH A;  2SRC A;  2EYW A;  2KXC A;  3PMT A;  3PIP A;  2AKL A;  5KYU A;  5CAI A;  2XK0 A;  4J5Y A;  1RUW A;  4WCI A;  5HK0 A;  5KYY B;  5CKB A;  4A4G A;  1TUC A;  1J3T A;  3TEE A;  1TWB A;  4LUE A;  5IH2 A;  1MHN A;  4J6W A;  3J7A F;  1M1F A;  1WHG A;  1M4Z A;  1T3S A;  3A98 A;  5GAN 6;  2DMO A;  3QHS A;  3L2Z A;  3G4S A;  1IRE B;  2QEX Q;  1RL2 A;  4HKE A;  1GXI E;  4KGV B;  2XIC A;  1CSK A;  3PVQ A;  4JRQ A;  3CME Q;  5D7U A;  3CCM A;  4XU0 A;  2PVO B;  1VQP T;  1R0C B;  4M7D B;  2QA4 T;  5KYN A;  5CVI A;  2EBP A;  1PC0 A;  3JCM b;  2L3S A;  5GMK h;  3NTK A;  3UPU A;  1N5Z A;  4M75 G;  4QQD A;  3OYE A;  1K9A A;  1VQ5 Q;  3A8H B;  5LJ3 h;  1VYV A;  3A8L B;  1G3W A;  1NJI C;  1U1T A;  1WHJ A;  4C5G A;  1ZUK A;  1YIJ T;  3E1S A;  2DE0 X;  3EFR A;  3G1J A;  4M7D C;  4LDW A;  1V1C A;  3NHN A;  3BE3 A;  2K3X A;  1KHC A;  5KE2 A;  3M59 A;  2DO3 A;  3V8L A;  2DRK A;  1Q82 R;  3CD6 Q;  1EZZ B;  1S72 T;  2QEX A;  2IPO B;  2OTL A;  4QW2 A;  3VYH B;  1QVG P;  4OB0 B;  5KYW B;  3CPW P;  2GNC A;  4FL6 A;  3CME A;  2D0N A;  1Y71 A;  1T3L A;  2EPD A;  2WSC E;  2D6F A;  2B8A A;  3DB4 A;  4HCB A;  4JZ3 A;  1W70 A;  1GCP A;  3UA6 A;  3QDF A;  1KSW A;  2LQK A;  2GTO A;  3KBG A;  2R58 A;  2ZPH B;  2JOY A;  1I8F A;  2CSI A;  3QBY A;  2QDY B;  5IXF A;  1VQ5 A;  3CBM A;  2O4X B;  5KYY A;  2RQW A;  1WFW A;  3FIF A;  1GL5 A;  2M9U A;  1I07 A;  1HK9 A;  1M2V B;  4II1 A;  1VUB A;  2JT4 A;  2ZCF B;  1Q86 C;  2Y90 A;  3RNJ A;  1RAE B;  4D8K A;  1TTH B;  4E7S A;  1H92 A;  2CSQ A;  2COY A;  2GQI A;  3CD6 A;  1HJD A;  4O5V A;  3GIB A;  1MV0 B;  2JZ2 A;  3ER0 A;  3L2R A;  5LJ5 g;  2LT1 A;  1JO8 A;  5KYX B;  2M16 A;  1W2B A;  5GMK e;  3MEU A;  2DD5 A;  1TSF A;  4E7K A;  1OQK A;  1YIT T;  2LJ0 A;  4JUV A;  4M7D A;  4E6R A;  2DBM A;  2ED0 A;  1UTI A;  1QCO A;  5LJ3 e;  3MCA B;  2LJ3 A;  1Y96 A;  4KGZ B;  3QPH A;  1BI2 A;  2K5L A;  2VB6 A;  1FMK A;  3EHQ A;  2HKN A;  1QVF A;  3HRU A;  1I1J A;  2D9T A;  3EG3 A;  4MZT A;  1W4S A;  4L5G A;  1VQ8 T;  2R57 A;  3I55 T;  1Q82 U;  2MOX A;  5CK9 A;  4KUD K;  4A54 A;  3OYG A;  5GMK j;  1M8M A;  1GBR A;  2ROL A;  1ZLM A;  5FWB A;  2XID A;  3MHX A;  3RBB B;  3CC7 Q;  1A0N B;  2XU8 A;  5LJ3 j;  2DTH A;  3H0F A;  1QCF A;  5KYW A;  5GAN 5;  3L2U A;  3JB9 J;  4XTU A;  3H0I A;  3OYA A;  3RKW A;  1VQM T;  2FZC B;  3EFS A;  2A0F B;  2F2V A;  2E10 A;  2CUD A;  1PG5 B;  3GOX A;  2ZGW A;  3TSW A;  3HFO A;  4BI3 A;  5GAN 7;  1FYN A;  3TRE A;  1D3B A;  1WXB A;  2LQN A;  5IHK A;  3LWH A;  2RHX A;  2DL5 A;  2O88 A;  4C92 D;  4YTL A;  4D6W A;  1BIB A;  2GFA A;  3V8J A;  2RI2 A;  2O4X A;  1TXQ A;  1UGR B;  4E2F B;  2A7Y A;  4E7H A;  1JB0 E;  4C92 E;  2DRM A;  3JB9 D;  4ATO A;  2DA9 A;  1M2V A;  2CP3 A;  3HFN A;  3OS1 A;  2K57 A;  2HNI A;  4J7F A;  1G83 A;  2JVV A;  4PJO B;  4M4Z A;  1AWX A;  1JXM A;  1PWT A;  3UDC A;  2VKN A;  4M75 E;  4NL2 A;  2P0Q A;  1WQ7 A;  3CMA Q;  2K5I A;  2L0A A;  3CCU T;  5I2S A;  3CCS A;  1VQL A;  2PTK A;  1M5Q 1;  3I56 Q;  3CCM T;  3SD4 A;  4CC2 A;  1WI7 A;  3HL8 A;  5KYX A;  1YI2 Q;  4C0G A;  1NEB A;  3E9G A;  4FCY A;  2E6Z A;  1U1S A;  1KFZ A;  1TUG B;  2VV5 A;  3VKI A;  2YXY A;  3OA6 A;  1GFC A;  2DM1 A;  3OYY A;  5A0L A;  3VV0 A;  4GLM A;  1PHT A;  4FYY B;  2GGR A;  2K3B A;  1SHG A;  4WTO B;  1RAH B;  1K73 R;  5FRO A;  4FYW B;  2LTO A;  1I0C A;  3QII A;  4PKC C;  1X6B A;  1YFN A;  2QEX T;  1NJI R;  4E7L A;  5GMK i;  3NTI A;  5J39 A;  3CMA A;  3CME T;  2KK4 A;  1VQ7 Q;  3M57 A;  4BI4 A;  4DEY A;  4Y28 E;  3CPF A;  5AYF A;  1YJ9 Q;  3A5Z B;  1YI2 A;  2E3H A;  2EGC A;  2RHZ A;  3O5Z A;  4QKU A;  2WSF E;  1YCY A;  1X69 A;  4AFS C;  1LNX A;  2CH4 A;  1AWO A;  5GAN 3;  2E6N A;  4Z88 A;  1VQ5 T;  2A28 A;  2LNV A;  1V76 A;  5DLO A;  2DBK A;  2DZC A;  5L8R E;  2X4W A;  3RKY A;  4EDU A;  4CRI A;  2RK2 A;  3SWN B;  1M3C A;  3X25 B;  3M53 A;  2D8H A;  4GLK A;  2DFU A;  4OMF B;  1QVG A;  3CPW A;  2ROT A;  2OI3 A;  8ATC B;  2RQT A;  1EIF A;  3CD6 T;  1UJ0 A;  3EGD B;  4RTZ A;  4M78 D;  5LJ3 d;  4QQ6 A;  2DL3 A;  1VQ6 Q;  4OMO A;  3NFC A;  5FLX E;  1JJ2 P;  1WYX A;  1QLY A;  1LPL A;  4MZP A;  5CKD A;  3SWN C;  1Q86 R;  2EQM A;  1NYG A;  2YUP A;  4FSX A;  1PRL C;  1YJ9 A;  2XD0 A;  5D6W A;  5LJ5 f;  2DPP B;  2MK5 A;  2RI5 A;  4OVA A;  4DOW A;  1JU5 C;  5IN1 A;  2X3W D;  3CCR Q;  1AHJ B;  2X9H A;  4XU2 A;  3QYG B;  3G71 A;  2EVR A;  1K73 U;  2CGH A;  3QUI A;  2HQX A;  3M4Y A;  1BYM A;  2PUO B;  1WXT A;  1NJI U;  5CO7 A;  2C0T A;  1BI3 A;  3REA B;  1VIE A;  1OX9 A;  2J6F A;  1UB4 A;  1YWP A;  1GFD A;  1R8O B;  1QQJ A;  2CS7 A;  2HL5 C;  1N9S A;  4IIO A;  2CRE A;  1KC8 U;  4OMM A;  1JBM A;  1SSH A;  1O9S A;  2RJF A;  2CT4 A;  2EWN A;  1G3T A;  1OX8 A;  5DY9 A;  2E5K A;  1VQ6 A;  2X51 A;  4ZGJ B;  1SHF A;  2PZ1 A;  1Z9Z A;  2A37 A;  1KQS S;  1UG1 A;  2YHT A;  2FZK B;  2NLU A;  2VXE A;  3CCL A;  2XDD A;  4KH0 B;  3MEA A;  4EMG A;  3L42 A;  3OY9 A;  2VGM A;  4M7A D;  2DXB A;  3PFS A;  4J8O A;  2HSP A;  1BB9 A;  3F70 A;  2COZ A;  4C8Q D;  2QQR A;  5LJ5 h;  2ZZD A;  2HMA A;  4IUT A;  4FSS A;  2HDA A;  2DEQ A;  4R55 A;  3OS2 A;  4ELY C;  3SWN A;  3MO8 A; 
#chains in the Genus database with same CATH homology
 3A8H B;  2VYT A;  5LJ3 h;  3VYG A;  4FT4 A;  3A8L B;  4M77 D;  2X4J A;  3CCJ T;  1X01 A;  2CYZ B;  1G3W A;  3MP8 A;  3MP6 A;  5KH6 A;  1NJI C;  1SSF A;  1U1T A;  4M77 F;  4C5G A;  3VU3 C;  1YIJ T;  4BY6 C;  3E1S A;  2RB6 A;  5CCA A;  4DOV A;  3EFR A;  1N9R A;  3CC7 T;  3JSC A;  4LDW A;  4M7D C;  1WGS A;  1Q86 U;  1M8V A;  1LOJ A;  4XTZ A;  3OS0 A;  2K3X A;  3CCQ T;  3CC2 T;  1KHC A;  1FX7 A;  1QP2 A;  3OQ5 A;  4JDS A;  3T9N A;  5GAO l;  5KE2 A;  3M59 A;  4FU6 A;  2DO3 A;  2I2L A;  4XTX A;  3V8L A;  2E64 A;  3GPL A;  1K9M C;  4KBM B;  3TCJ A;  2E1H A;  4PJO A;  5DM7 R;  3OYC A;  4L59 A;  1S72 T;  3OYN A;  2QEX A;  2ZPE B;  2OTL A;  4QW2 A;  3RUX A;  2E5Q A;  3VYH B;  3CCV T;  1M90 U;  1PSF A;  2DKG A;  4OB0 B;  5FU7 C;  4M7D D;  3A8O B;  3G6E T;  2L8D A;  2EYQ A;  2XHC A;  4FL6 A;  5I2M A;  3S3M A;  1ZHI A;  3OBW A;  4A4H A;  5C0M A;  4M7D F;  3CME A;  3X26 B;  2K4Y A;  4RCC A;  2DD4 A;  2KQW A;  4A4F A;  1YJN A;  1Y71 A;  2CZ6 B;  5HKC A;  2WSC E;  2FYK A;  4C5H A;  4F7U F;  4RG2 A;  2QA4 A;  4DQ2 A;  5LL6 S;  4ME7 A;  3QYH B;  2D6F A;  2B8A A;  3DB4 A;  3DKM A;  4N0A A;  4Y91 A;  1Q81 C;  1I81 A;  4HCB A;  4JS4 A;  4M7A C;  3G71 T;  1VIF A;  2MF2 A;  4MML A;  1G3Y A;  3BFM A;  4M7A A;  2G3R A;  3M4G A;  1G5V A;  3JRZ A;  3LGL A;  1KG1 A;  2LQK A;  3OYF A;  3KBG A;  3QDR B;  2R58 A;  2ZPH B;  3HKS A;  2JOY A;  4C8Q A;  3CC4 T;  3CCJ A;  4CI0 C;  1I8F A;  1UGS B;  3QBY A;  2QDY B;  1WJQ A;  1VQ5 A;  3CBM A;  3OBY A;  2O4X B;  3FLG A;  4Q5W A;  1HXD A;  5FRM A;  3QXE B;  5FRN A;  3FIF A;  4JS5 A;  4ZTF A;  2PVG B;  4M7A E;  4FT2 A;  2XKO C;  3RMS A;  3CC7 A;  5FU6 B;  3N5B B;  1OZ2 A;  3PGG A;  2JTF A;  1UGQ B;  2RM4 A;  2M0O A;  2M9U A;  2RHI A;  1HK9 A;  3FEO A;  3OSS C;  2GF7 A;  4II1 A;  4KUI A;  4M77 A;  4PNO A;  4XTW A;  4UC4 A;  1UEB A;  1VQO A;  3CC2 A;  1VUB A;  4M7A G;  5GAM g;  3OSV A;  3A8G B;  2ZCF B;  1N27 A;  5GAM e;  1WPY A;  2Y90 A;  3FC3 A;  1Q86 C;  3I56 T;  1FXX A;  3S6W A;  3S3N A;  3OMG A;  4Z02 A;  3QZ9 B;  4C8Q G;  2YRV A;  5KCO A;  4IUV A;  4HT9 A;  2P0K A;  1YI2 T;  3PT9 A;  4OF1 A;  3CD6 A;  4O5V A;  1QVP A;  3G6E A;  3GIB A;  4OB2 B;  4IUQ A;  2JZ2 A;  2XDP A;  4N0A C;  1YJW T;  3O8V A;  3ER0 A;  1M90 C;  2MWP A;  4M77 G;  4B9X A;  4RKU E;  3L2R A;  3CCE A;  5LJ5 g;  2LT1 A;  3JCM J;  1UGP B;  1FWZ A;  2M16 A;  3HRT A;  4HA8 A;  4D6W A;  5GMK e;  3MEU A;  5KCH A;  5LJ5 e;  1W2B A;  5GAO p;  2DD5 A;  2X4X A;  4E7K A;  2WSE E;  4VUB A;  1YIT T;  4JUV A;  4N4H A;  4M7D A;  1PSE A;  5GAN 4;  2GCX A;  5LJ3 g;  3JB9 I;  5LJ3 e;  1K8A C;  3DB3 A;  3MCA B;  4F7U A;  1NE8 A;  2K3Y A;  1Y96 A;  3ZEH A;  3LW5 E;  3QPH A;  1BI2 A;  1VQN A;  2K5L A;  2HBP A;  4RCB A;  3DLM A;  5M9O A;  3PTA A;  1U8R A;  4JRK A;  4X9C A;  1QVF A;  2RHY A;  3HRU A;  2D9T A;  5GAM j;  3GNF B;  5GAO q;  3CBO A;  3OYD A;  2EQK A;  4QVC A;  1ZBX A;  5CQY A;  3OW2 S;  2DZ9 A;  3C95 A;  1W4S A;  3P8D A;  4L5G A;  2E70 A;  4MZT A;  4A4E A;  5GAN e;  4M7D G;  2ZPI B;  3M55 A;  3QJY A;  2LVM A;  1VQ8 T;  4HCC A;  3KUF A;  2R57 A;  2DJZ A;  3OMC A;  3I55 T;  1Q82 U;  1KD1 U;  4F7U G;  4WF2 A;  1M1K U;  1K73 C;  2RK1 A;  5J26 A;  4C92 B;  3UT1 A;  5CK9 A;  4KUD K;  1LJO A;  3H6Z A;  4MDX A;  4OB3 B;  4A54 A;  3SFM A;  4C0D B;  3OYG A;  3ZFJ A;  5GMK j;  5LJ5 j;  1X6O A;  2R5M A;  5D6X A;  3I56 A;  1MGQ A;  2WAC A;  4O6J A;  4JJN K;  2XID A;  3MHX A;  3JCM Q;  1VQ7 T;  2XU8 A;  2V8J A;  1W2B S;  5LJ3 j;  2K5F A;  1NPP A;  1YJ9 T;  4B9W A;  4XAX B;  2DTH A;  3AHU A;  3CCS T;  1VQL T;  5GAN 5;  2X35 A;  4HT8 A;  3L2U A;  1OZ3 A;  2L89 A;  3JB9 J;  5GAN h;  4XTU A;  1N6A A;  5KE3 A;  2V8K A;  3J80 E;  2HAX A;  2EIF A;  2DK3 A;  4C5E A;  2QI2 A;  5CQX A;  3OYA A;  1KC8 C;  1WQW A;  2LRQ A;  2PQW A;  3BY7 A;  3OS5 A;  3EFS A;  2L3R A;  2FB7 A;  4XQ3 A;  3RKW A;  3QKJ A;  1VQM T;  2E10 A;  3V7C A;  5GAO n;  1QVF S;  4PLL A;  5GAN j;  3GOX A;  2ZGW A;  1VQ9 T;  4MMK A;  3HFO A;  2Y4Y A;  4QVZ A;  4C0D C;  4BI3 A;  5GAN 7;  1OYX A;  3M9Q A;  2LX9 A;  2GFU A;  3TRE A;  1D3B A;  3JAM E;  1VQK T;  1VQP A;  4PL6 A;  2DIQ A;  1YBY A;  1BI0 A;  4FIB A;  3JCM c;  3X20 B;  2DXU A;  2RO0 A;  1V29 B;  3LWH A;  1XNI A;  2OAU A;  2RHX A;  4V2S A;  2ZPB B;  3FDR A;  2PUK B;  3MEW A;  2FL7 A;  4C92 D;  4YTL A;  3V7S A;  1BIB A;  2EFI A;  2GFA A;  3FJP A;  2EQJ A;  3Q1J A;  2RI2 A;  4LD6 A;  1OI1 A;  3V8J A;  2O4X A;  4C92 F;  2E12 A;  2F69 A;  3HSB A;  1UGR B;  4XU3 A;  3KXT A;  2YLB A;  2A7Y A;  5C6S A;  3L2Q A;  1JB0 E;  1M9S A;  2YLC A;  4E7H A;  3MET A;  1X75 C;  3RES A;  4C92 E;  2QQS A;  3OYL A;  1JJ2 A;  3JB9 D;  4EMH A;  4ATO A;  3HFN A;  3OS1 A;  2K57 A;  2MI6 A;  3QJ6 A;  1Q82 C;  3JB9 F;  1WNL A;  1Q7Y U;  2HNI A;  4J7F A;  2JVV A;  3CEY A;  3MP1 A;  3JCM V;  4PJO B;  1M1G A;  5GAN 2;  1VQ6 T;  2PVD B;  5GAN 8;  4BD3 A;  3HRS A;  5CKF A;  4M78 E;  1VQ7 A;  3JCM d;  4PLI A;  5EG2 A;  3UDC A;  3V7R A;  1YIJ A;  3M54 A;  4M75 E;  4NL2 A;  1KQ1 A;  2P0Q A;  3HP9 A;  4QQG A;  1WQ7 A;  2K5I A;  4L6V 5;  4ZN3 A;  3CCU T;  4X34 A;  5I2S A;  3CCS A;  1VQL A;  1N8R U;  2QQ9 A;  1M5Q 1;  2R5A A;  3CCQ A;  3CCM T;  3CMA T;  3PMI A;  2LDM A;  2XG8 D;  3SD4 A;  2QTX A;  3L1A A;  5LJ3 f;  3OYK A;  3HL8 A;  2EJF A;  4TVR A;  4XTV A;  1VQM A;  5DLQ E;  4EMK B;  4C0G A;  2LC4 A;  3L2V A;  3E9G A;  1KQS A;  1I5L A;  3OYJ A;  1S72 A;  1I4K 1;  2EAY A;  2E6Z A;  2FHD A;  3RKX A;  3JCM f;  3CCV A;  1U1S A;  3URG A;  3CCR T;  5IT9 E;  1VQ4 T;  3L2W A;  2VV5 A;  3M56 A;  3BW1 A;  3VKI A;  4NOY A;  2HD0 A;  3QZ5 B;  4JRP A;  2LCC A;  5FU6 C;  3RMQ A;  1JJ2 S;  3WVD B;  4KUL A;  3OA6 A;  4LDX A;  3S3O A;  3OYY A;  3RER A;  1WJS A;  3OYI A;  2Y4X A;  4ZGE B;  5A0L A;  3E9F A;  3HHT B;  4BE2 A;  2EJG A;  4BE1 A;  4BI8 B;  2OTJ A;  1WJR A;  4A53 A;  3VV0 A;  4EMK C;  2P4T A;  2BKD N;  4PJO D;  2RI3 A;  3R6O A;  3FRN A;  3CBP A;  5A0G A;  2RH2 A;  3CXC A;  2JTM A;  2ZPF B;  3QO3 A;  5GAO m;  5FRO A;  3CC4 A;  4PJO E;  2IVW A;  4JRI A;  3JCM W;  2LTO A;  5GAN g;  2EKO A;  2LCL A;  3QII A;  4PKC C;  1KQ2 A;  4ELZ C;  5CKH A;  1Q7Y C;  3C94 A;  2QEX T;  1H64 1;  3QSU A;  4E7L A;  5CKE A;  5GMK i;  2JN0 A;  3NTI A;  5J39 A;  2DXT A;  3OYM A;  3CCU A;  4BDZ A;  2E65 A;  3JB9 G;  3CMA A;  3CME T;  2RJD A;  3GF5 A;  1YJN T;  2KK4 A;  4C92 G;  1N8R C;  3GLX A;  1DJ7 B;  3BDU A;  1Q81 U;  3M57 A;  4BI4 A;  5IAY A;  4Y28 E;  3CPF A;  2XDB A;  5AYF A;  3NTH A;  4C0F A;  3A5Z B;  1YI2 A;  2DVE A;  2LT4 A;  4M78 B;  4M75 B;  2L5Q A;  3HPW A;  3ME9 A;  1B34 B;  1XTD A;  2WSF E;  1Y7X A;  1Y96 B;  1YCY A;  2RHZ A;  3M5A A;  4GY5 A;  4EPC A;  2JUF A;  3DLL A;  2RD1 A;  1VQ4 A;  3OB9 A;  1YJW A;  3J81 E;  1LNX A;  2BIV A;  2DTO A;  4DA4 A;  4N4G A;  4BUG A;  2D0Q B;  1O75 A;  4LDU A;  4XK8 E;  4C8Q E;  2KAF A;  2VXF A;  5GMK m;  4QVD A;  1XQH A;  5GAN 3;  4NS5 A;  2E6N A;  3RIR A;  4N4I A;  5FU7 B;  1YIT A;  3C12 A;  3CXC S;  1VQ5 T;  2QQA A;  3C4S A;  4C92 C;  2LNV A;  2CZ1 B;  3LYI A;  3X24 B;  2DTI A;  5DLO A;  2DZC A;  4ZGD B;  3ASK A;  3QG1 A;  5L8R E;  4HCZ A;  3JCM h;  5GAM d;  2X4W A;  3RKY A;  2CZ0 B;  3WVE B;  4EDU A;  4M77 E;  4CRI A;  3JB9 H;  2QQB A;  2RK2 A;  3SWN B;  4KT0 E;  3GNG A;  1VQO T;  4J6Y A;  2KSS A;  2HQE A;  4M78 C;  4MZM A;  3X25 B;  5I21 A;  3LWI A;  4M75 C;  2O01 E;  3M53 A;  1JRI A;  3LGF A;  3P8B B;  4GLK A;  5GAO r;  4LDY A;  4OP0 A;  4OMF B;  1H3Z A;  1QVG A;  2X4Y A;  5A0D A;  4XTY A;  4BB7 A;  3CPW A;  5LJ5 d;  4IUP A;  1EIF A;  1VQ8 A;  4XU1 A;  2XI9 A;  5GAM f;  4MDW A;  3I55 A;  3CD6 T;  2EJ9 A;  4RG8 A;  2RA2 A;  2H3J A;  2K2V A;  5D6Y A;  4ZTJ A;  4NL3 A;  2KMT A;  2RJE A;  5CIU A;  2MWO A;  3X28 B;  4M78 D;  5LJ3 d;  4QQ6 A;  1KD1 C;  3NFC A;  4M75 D;  2AHJ B;  2QXF A;  4OGC A;  5FLX E;  1YHQ T;  1M1K C;  3CCE T;  2DIG A;  3SB2 A;  2E41 A;  4M78 F;  4M7D E;  2OTJ T;  3PNW C;  4BDY A;  5A2Q E;  3G4S T;  4M75 F;  2VC8 A;  1K8A U;  4MZP A;  5CKD A;  2P0P A;  3SWN C;  4C0Z A;  2PU9 B;  4EMK A;  2C06 A;  2EQM A;  3CCR A;  4IUU A;  3SDZ A;  3ZBD A;  2CKK A;  4F7U E;  4PJO G;  4FSX A;  5J3B A;  3GP8 A;  1YJ9 A;  4X9D A;  5D6W A;  5LJ5 f;  2XD0 A;  2DPP B;  3LH0 A;  4LDV A;  4OGE A;  2RI5 A;  4E47 A;  1D3B B;  2ZPG B;  5GAN d;  3G7Z A;  1XOV A;  4IUR A;  3CCL T;  4IKF A;  4OVA A;  1VQN T;  1G3S A;  3JCM P;  1NPR A;  3V8K A;  2GQV A;  2V8I A;  4DOW A;  5GMK l;  3LX7 A;  4OB1 B;  3PIO A;  2VUB A;  2EQU A;  2JNG A;  3BDL A;  5IN1 A;  4A4K A;  2MAM A;  3UWN A;  3H8Z A;  1BI1 A;  1AHJ B;  2IG0 A;  5CR2 A;  3MEV A;  3FB9 A;  4XU2 A;  4E7J A;  1VQ9 A;  2DXC A;  3QYG B;  3P8H A;  3G71 A;  1K73 U;  2DAQ A;  2FVU A;  3OYH A;  1QVG S;  2BUD A;  2CGH A;  4M7A B;  4PJO C;  4P5N A;  3CPW S;  1TH7 A;  1VQK A;  3QUI A;  2RJC A;  2HQX A;  3M4Y A;  3LLR A;  3PMT A;  2PUO B;  3VUB A;  4ZN1 A;  5GAN f;  3PIP A;  1BYM A;  1BKB A;  1NJI U;  3INZ A;  4JLI A;  4C8Q B;  3OW2 A;  5CAI A;  5CO7 A;  1IZ6 A;  3WXM B;  4BAC A;  1Y07 A;  2XK0 A;  1BI3 A;  4J5Y A;  3M58 A;  4LD9 K;  1BIA A;  1VIE A;  5HY6 A;  5HK0 A;  5CKB A;  1UB4 A;  4A4G A;  1R8O B;  1KHI A;  2M1H A;  3A8M B;  3TEE A;  2CS7 A;  1N9S A;  1YHQ A;  2LQ8 A;  4J83 A;  2F5K A;  4M77 B;  1NZ9 A;  3E19 A;  1MHN A;  4BE0 A;  4J6W A;  1KC8 U;  3J7A F;  1JBM A;  1M1F A;  3VJP A;  1K9M U;  4PJO F;  1O9S A;  4C92 A;  1QW1 A;  1M4Z A;  2RJF A;  4FM4 B;  2KDS A;  2EWN A;  5GAN 6;  1G3T A;  2F5T X;  1ZQ1 A;  5DY9 A;  3QHS A;  2A3L A;  4C5I A;  3L2Z A;  3VUZ A;  1IRE B;  3G4S A;  1VQ6 A;  4ZGJ B;  1RL2 A;  4HKE A;  4RMO A;  1GXI E;  2KVQ G;  2XIC A;  5HK3 A;  3JCM X;  4JRQ A;  4C8Q C;  2OTL T;  4M78 A;  2CZ7 B;  3EAE A;  5GAM h;  1KQS S;  4J6X A;  4J7I A;  4M75 A;  2YHT A;  1B34 A;  2NLU A;  2VXE A;  2KY9 A;  3CCL A;  3CCM A;  4XU0 A;  2PVO B;  4R56 A;  2XDD A;  3JCM g;  1VQP T;  3MEA A;  4EMG A;  4BY6 B;  3L42 A;  3JCM e;  3OY9 A;  2VGM A;  1RI0 A;  4M7A D;  4M7D B;  2DXB A;  3PFS A;  4J8O A;  4M77 C;  4JLG A;  2QA4 T;  4M7A F;  3F70 A;  5CVI A;  4C8Q D;  4F7U B;  2QQR A;  3JCM b;  5GMK h;  5LJ5 h;  2ZZD A;  3NTK A;  4IUT A;  3UPU A;  2MMP A;  4M78 G;  4C8Q F;  1QP3 A;  2DEQ A;  2RHU A;  2VGN A;  4R55 A;  3OS2 A;  4M75 G;  4E7I A;  4ELY C;  3SWN A;  3OYB A;  4QQD A;  3OYE A;  1P92 A;  3MO8 A;  3TU4 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...