4PLIA

Structure of the chromodomain of mrg2 in complex with h3k36me3
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
57
structure length
57
Chain Sequence
HFEEGERVLAKHSDCFYEAKVLKVEFKDNEWKYFVHYIGWNKSWDEWIRLDCLLKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords At1g02740
publication title Regulation of arabidopsis flowering by the histone mark readers MRG1/2 via interaction with CONSTANS to modulate FT expression.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 10
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4pliA00
3OMGA 2EQKA 2RJDA 1OYXA 5IN1A 4IUUA 2D9TA 4EDUA 2M1HA 2WACA 3M9QA 1WJSA 3FDRA 4BD3A 2X4XA 2G3RA 3EAEA 1OZ2A 2BUDA 3LX7A 4N4GA 4RG2A 4X34A 4II1A 2L89A 2O4XB 4A4FA 2RHXA 5CIUA 2F5KA 3OYKA 2R58A 4E7IA 3S3OA 3P8HA 2E5QA 4A4GA 3KUFA 2DIQA 5C6SA 3L2VA 3MEVA 2MWPA 2BKDN 2X35A 1XNIA 2EQUA 2B8AA 2PQWA 3NTHA 2RJFA 5M9OA 2LCCA 1MHNA 5D6WA 4OVAA 2RJCA 3OYHA 3DB4A 3FC3A 2IG0A 5KCHA 2R5AA 2FHDA 2LDMA 2O4XA 2RO0A 4NS5A 4QVZA 5J39A 3OYBA 3S3MA 2RHZA 3S6WA 3L2QA 2RI2A 3OYEA 5FROA 4LD6A 3GOXA 4QQDA 3FLGA 3BDLA 1H3ZA 3MEWA 2M0OA 4IURA 2EQJA 2GFUA 4BE0A 3L2RA 3OYDA 2EQMA 4BE1A 4FU6A 3QIIA 4HCZA 3OA6A 2HQEA 5KCOA 2YRVA 3FEOA 4E7KA 4ZTFA 5C0MA 4ZTJA 2XK0A 2XDPA 1G5VA 2CKKA 3MP6A 2EFIA 3DB3A 3SD4A 3MEUA 3E9GA 5FRNA 3QKJA 3OS2A 4BDYA 3ME9A 3ZEHA 3C4SA 3OY9A 3LYIA 3LGFA 4A4HA 1SSFA 2LTOA 2QQSA 4PL6A 5IAYA 2RJEA 2HQXA 4L59A 2DIGA 4IUQA 4N4HA 2X4WA 5D6YA 2K3XA 2BIVA 2DAQA 2JZ2A 2RHIA 3O8VA 5FRMA 3UWNA 1OI1A 3CEYA 3PMTA 2EKOA 4C5GA 4Q5WA 5KH6A 3ASKA 4A4EA 3QJ6A 2L3RA 3H8ZA 3OYNA 3DLMA 4BDZA 4BE2A 4QQGA 2R57A 4E7HA 3META 3P8DA 4IKFA 1WJRA 3OYLA 3LLRA 3S3NA 3E9FA 3OS0A 4B9WA 2L8DA 2GF7A 1N27A 4C5IA 2GFAA 5KE2A 4E7JA 1RI0A 2R5MA 3PMIA 3L2UA 4PLIA 3OYAA 3OYMA 3L2WA 2RI5A 2LVMA 4GY5A 3NTIA 2JTFA 4E7LA 3OYGA 2M16A 3LH0A 4QW2A 3LGLA 3MO8A 1WGSA 4UC4A 4IUVA 2RHYA 2P0KA 3OQ5A 3MP8A 3UT1A 2RHUA 3H6ZA 3OYJA 2K3YA 2X4YA 3F70A 4FL6A 4B9XA 3PFSA 5D6XA 2QQRA 1WJQA 3QBYA 3MEAA 4IUPA 4PLLA 3L42A 5J26A 2E6NA 4Z02A 3Q1JA 4CRIA 3OYIA 3NTKA 4C5EA 3OB9A 4IUTA 2RI3A 3OYCA 3OS1A 3OMCA 1KHCA 3MP1A 2LRQA 4N4IA 1OZ3A 2VYTA 4QQ6A 4BACA 4C5HA 2NLUA 3PNWC 5KE3A 2MWOA 3OYFA
chains in the Genus database with same CATH superfamily
2JT4A 1GBQA 1YWOA 3A8MB 3HPWA 1OX9A 2WSCE 4DEYA 1Q86U 2X4XA 2CZ6B 3V8JA 4D6WA 2F5KA 1N5ZA 4X9CA 3AHUA 4DOWA 2DRMA 4BUGA 2HQHA 2RJFA 4EMKC 1D1BA 1MHNA 2JN0A 3UF4A 1VQNQ 2RHZA 4J9GA 2FZKB 1KC8C 1Y7XA 3BDLA 4PJMA 1WHLA 4IURA 5GAN8 2JTMA 1PWTA 1AWWA 1OX8A 2JJ9A 2HMAA 1M2VA 4QKUA 5GAN4 4MZTA 1YHQT 2K6DA 2XMFA 1H641 4LDWA 5A0DA 4OGEA 3RKXA 1ZA1B 5D6YA 4ZGEB 4FSSA 4M7DC 1BBZA 4DEXA 1YITT 4RCBA 4OB1B 3LH5A 1CKBA 2XU8A 3EHQA 2PVDB 1ZSZB 1LCKA 3IQLA 2C0TA 2FEIA 3RKYA 4B6MA 3CCJA 4XTYA 2AKKA 3JB9I 4RG8A 2QA4Q 1M1KU 3SWNB 2ROTA 4HA8A 4LXCA 4UC4A 3U23A 3OQ5A 5CR2A 3TSWA 1D1CA 3I56A 5D6XA 3VS4A 1WHHA 1KQSS 1IHVA 3M0SA 2X9HA 1NE8A 4C5EA 1T0HA 3JCMg 1ZQ1A 4M7AD 3VS6A 2OTLA 4HVWA 2CUDA 3CPFA 1UJ0A 4FYXB 3HTRA 3JV3A 4C0DB 4FCYA 2RM4A 2GQIA 2DL7A 1NJIR 2RK2A 2DZ9A 4LUDA 5C6SA 3L2VA 3QJYA 4N0AA 4GLMA 2EQUA 3RUXA 2PQWA 2KI7A 4C8QB 2ZPGB 2LMJA 1Q81U 2V8KA 2OTJA 4LD6A 3M0TA 1ZA2B 1WPYA 2GGRA 1VYTA 4XK8E 2W10A 4CI0C 1TU0B 3JSCA 4JJCA 1B7TA 3CMEA 2RK1A 1SKUB 2KSSA 3BY7A 2DD5A 3RDVA 2RQVA 4BI4A 3VRYA 3ME9A 1JJ2P 3CC7T 2DAQA 2GTJA 1YI2Q 1WQWA 3CEYA 1YJ9Q 2EKOA 2DETA 4DBFA 3QSUA 3I9QA 2RNAA 1G8XA 4DOVA 2D8HA 4TVRA 2OJ2A 3OYLA 1VQPT 4B9WA 3BDUA 4OB0B 4F7UA 4M77C 4JZ4A 3GP8A 1ZSZC 2FRWA 3LGLA 4KRTA 1KIKA 1NM7A 5IH2A 1PKSA 2A37A 2ZPFB 4M75D 3M56A 4J6YA 2K2MA 3QBYA 3SWNC 2RH2A 4V2SA 2KXDA 1JXOA 1W1FA 2O2OA 1T3SA 1B3QA 5LJ5j 5FLXE 1ZBXA 2CGHA 1G3TA 1TUDA 4QQ6A 3PVQA 3H9NA 4X1VA 1BCMA 2DXTA 3REAB 1X6GA 2MOXA 3OBYA 4OF1A 4ELYC 3C95A 2K5FA 3KXTA 3JB9D 3KUFA 1SEMA 1IZ6A 4C0DC 1GFDA 3EHRA 4PJLA 1WDXA 2ED0A 5CQYA 3RKWA 3I5SA 2LCCA 2QASA 3J80E 2DMOA 2FHDA 4QVZA 3CD6T 2P4RA 3CCET 1AD5A 4F7UE 1G3SA 4F7UF 3MCAB 3E19A 1UFFA 1BB9A 2FYKA 1MNEA 4C8QC 5A0LA 1NJIC 1VQ7T 3G71A 2HQEA 2PVGB 2A0FB 1UGPB 1VQOQ 1YBYA 2RQUA 4Z89A 5GAMf 5KYNA 3OY9A 1EX4A 5LJ5d 4FYWB 2RHIA 3O8VA 3HRTA 3CCUA 1IB8A 1X2QA 5GAN6 4OMQA 1AVZC 2MF2A 4MMKA 2QG9B 2YRDA 4BDZA 2KEAA 2R57A 1AZGB 3JCMQ 3S3NA 2KROA 4EPCA 2XI9A 1E6GA 2QDLA 2EYXA 1B34A 3OW2S 1VQ4A 4E7LA 3SDZA 1PC0A 1WX6A 5FWBA 4CC7A 3SFMA 3OYJA 4LDUA 2QQRA 2Y90A 1XTDA 3L42A 1SG5A 1Q86R 3QXEB 2CZ7B 3EGUA 2QQAA 2M51A 2XDBA 2CZ1B 1ARKA 2DM1A 4BACA 2F2VA 3TCJA 2JTEA 1QVGA 5ECAA 3RMSA 3OMGA 1V1CA 3EG2A 4HXJA 1OYXA 1Z9QA 4QVDA 1GCQC 1AOJA 4ZGJB 1VQNA 2JMCA 4M7AG 4R0KA 2A7YA 4E7IA 3THKA 2ENMA 5LL6S 1M4ZA 2X35A 1S72A 1XNIA 2CZ0B 1IO6A 3EGDB 2Y4XA 3NTHA 1VQ6T 3GNGA 3QDFA 2IG0A 1H3ZA 2K4YA 4NS5A 1WFWA 2DTHA 4M7AE 2RN8A 4PJNA 2DJZA 4M7AF 5HCKA 2P0QA 5IXFA 1E6HA 3TSZA 4KULA 1AWOA 1M90U 1G2BA 2SRCA 1ZBJA 2EQJA 4AFQC 5GAOm 2F2WA 4NL2A 3VKIA 4MDXA 2ABLA 1U1TA 4KT0E 3BFMA 5C0MA 1K9AA 5KYYB 3DB3A 3E9GA 3C4SA 2DBMA 2OAWA 4HT9A 4M77A 3GIBA 5IHIA 3CBMA 4RMOA 2JZ2A 2QA4A 2G6FX 5KYUA 1I07A 2M9UA 3QDRB 1YIJQ 4M75A 2C0IA 1AT1B 3PMTA 4F14A 5KH6A 3I55T 1LJOA 3DLMA 3A98A 4E7HA 1YNZA 2JM9A 1C0MA 3M5AA 3JCMb 2GNCA 2EYQA 4KGXB 4PLIA 3EFOB 3I5RA 2JM8A 3M54A 1BK2A 2EYYA 1UHCA 1QWEA 4PJOG 3NPFA 1VYUA 1LNXA 3Q1JA 3UPUA 1QVGP 3PT9A 4JUVA 3ULRB 2KDSA 1N9RA 5LJ3g 4J7IA 3NGPA 1OULA 1E7OA 4PJOE 3PNWC 4OMMA 5D7UA 4PNOA 3VRZA 4KBMB 2ZPHB 1VQ9T 5IN1A 2EWNA 1VQLA 2D6FA 1Q86C 2DL4A 1WYXA 1OZ2A 3LX7A 1NPRA 1FMKA 3EGXA 4II1A 5CIUA 3OYKA 1CSKA 2E41A 4M75E 1K73U 4M75F 1S1NA 2E5QA 4AMCA 1VQKT 3CBOA 2L3QA 2VVKA 2CT3A 4FSXA 1M1FA 2M0YA 5M9OA 1QCFA 2LDMA 2DTOA 1K1ZA 4FM4B 4VUBA 2MYSA 3NFCA 4ORZA 3L1AA 5FW9A 2B86A 1SRMA 3GF5A 1IREB 5LJ5e 2LQWA 2MI6A 5GMKi 1YI2A 4C92D 1D0ZA 2E3IA 4E7KA 2YUQA 1ACMB 2O9SA 4FW1A 2E3HA 1M30A 3SD4A 3G6EA 1Q7YR 1J3TA 3JCMf 1MUZA 3JB9F 1IGQA 2X4JA 1PM3A 2HQXA 4N4HA 1Z9ZA 2KAFA 4A4KA 2J6KA 2LNVA 4OP0A 1IXDA 2AK5A 1AWJA 3CCST 1X6OA 1AEYA 3QPHA 4ANJA 5HK0A 1ZX6A 2R5MA 2FO0A 3CD6Q 1QCNA 2RI5A 3NMZC 2KRMA 2NUPB 1TS9A 4J6XA 2GQVA 1ZSGA 1JBMA 2JUFA 1VQ7Q 2E6NA 2DE0X 2DO3A 4XQ3A 3OBWA 2VGNA 5GANf 3M4YA 4LDYA 4E6RA 3NHNA 2X3WD 1U8RA 2VB6A 3KBGA 2YT6A 4MZMA 2O9VA 1NLPC 4M78D 2ZCFB 5GAOq 1K76A 2FPFA 3H0IA 3VU3C 3LWIA 2MAMA 1RACB 4RTTA 2O88A 1YFNA 2HSEB 1KJWA 1MV3A 4DBRA 1WLPB 3G4ST 1VQOA 3OSSC 3R6NA 1K0XA 1N8RU 1RL2A 2VWFA 4M7AB 1W2BA 5GJWB 1Y71A 1K8AU 1C6VX 2VKNA 3L2RA 4ZN3A 3CMAT 3WVEB 1A0NB 2WSEE 5FU6B 5FRNA 3MKDA 1YJWQ 5GAMj 1X69A 5I21A 2RA2A 3D7SB 4L59A 2P0PA 2V26A 1RAAB 2ROLA 2JS2A 4J5YA 2YHTA 1T0JA 2QEXA 3VS3A 4A63B 1WIEA 2K2VA 5IHNA 4A54A 4EMHA 1VQ6Q 2CSQA 1Q7YC 1I0CA 1QCOA 2GFAA 4GBQA 3VS1A 3PMIA 3OSVA 2ZZDA 1OQKA 1WHMA 3CCVT 1YJNQ 2CUBA 2H3JA 4LN2A 3LW5E 2LJ0A 2RHYA 2DD4A 1TSFA 1PSEA 1M1GA 4M7DD 3F70A 1JJ2A 1VQ5Q 3PFSA 2ED1A 1FXXA 3HSBA 4PLLA 3J81E 1QP3A 1UUEA 1OV3A 4A53A 2EKHA 4MZPA 5EC7A 2EQIA 4XU3A 3SEMA 3OB9A 2EJ9A 4CC2A 2KT1A 2RI3A 1NEBA 2AT1B 1U3OA 2XHCA 3EG9A 2NLUA 3A8OB 3OYFA 4PJOB 4FT4A 3M0PA 3I35A 4GLKA 1D0YA 5KYXB 3I55Q 4J9HA 1UG1A 3CCMQ 2ZPEB 1WJSA 1WXBA 2LQ8A 5GAMd 2YRCA 2DA9A 3QG1A 2O4XB 3CCJT 1EIFA 1M90R 4NL3A 3P8HA 3CPWS 1QP2A 4C92A 3CC2Q 1KG1A 2AIRB 3M55A 1SF9A 1GRIA 2B8AA 3H41A 1NYFA 3GLXA 3H0HA 3X20B 1W2BP 2VC8A 2KMTA 2J7IA 3I56T 2JOYA 4JJBA 3C94A 2DK3A 3OYEA 1V29B 3HKSA 5KYWA 1QLYA 2DF6A 4QQDA 4RTVA 2D0NA 2JS0A 3JCMV 1Y96B 2YLBA 2MPXC 3VUZA 1YIJA 2OTLT 2LZ6B 3JCMP 4M7AC 2QXFA 1UTIA 2EFIA 1TWBA 2KRNA 1VQ9Q 1D3BA 3ZEHA 1JQQA 1M8MA 2YDLA 4HT8A 3LGFA 1TUGB 2X3XD 5HKCA 5FU6C 1AZEA 4Q5WA 2CP3A 2EJFA 5J3BA 3ER0A 1NBEB 3P8DA 2CH4W 2KBTA 2KYMA 3JB9J 2L8DA 2HDAA 4JRQA 2YUPA 3OYAA 4PKCC 4C92E 1NEGA 2DYIA 2JTFA 4C92F 3OYGA 1NYGA 2KVQG 2OTJT 2DL5A 1FWZA 4IUVA 4E7SA 2BE7D 2NUTB 4M78A 2HNIA 4FT2A 1WNLA 3P8BB 3CMET 1R8OB 2FZGB 2K9GA 1KQSA 1K9MU 3HRSA 3OS1A 2DXBA 1FYNA 5LJ5h 4KH1B 1VOMA 1N6AA 4M77D 1KC8U 4LNPA 4AFSC 3EAEA 3CCSQ 3CXCS 1HD3A 2HKNA 4PJOC 5GAOn 2DLPA 3CC4Q 2CP0A 5CO7A 4IIMA 1VQ8A 2IIMA 3A1PA 4LDXA 5EG2A 5CAIA 5GAOl 4EMKA 2PVOB 8ATCB 2YXYA 4JPBW 5L8RE 2Z0WA 1DJ7B 1M90C 1WHGA 2AHJB 4M78E 4M78F 2EQMA 4F7UG 4BE1A 3QIIA 5KCOA 2YRVA 4BY6B 3CCLA 3URGA 5LJ3f 2GBQA 3CCQA 1Y07A 3BE3A 3LYIA 4J9BA 5FWCA 2OX7A 2QQBA 4M7DA 1MNDA 2X51A 1JB0E 2F2XA 4A4EA 4C8QD 4ZGDB 2F1LA 3UDCA 4RTXA 3HP9A 4E2FB 4F04B 3INZA 1WI7A 1UB4A 8AT1B 3QO3A 4DBHA 4LUEA 4PK4A 3X28B 3G4SQ 2DX1A 2M16A 4QW2A 4XU0A 2NUZA 1NPPA 2P0KA 2P84A 1Q82U 1KQSP 2DRKA 4QT7A 2DEUA 3CCRA 3G71T 3CMAQ 4XTZA 2E64A 3OS5A 4MDWA 1KFZA 2V8IA 5GANj 2M02A 4PFPA 1N9SA 1KHIA 1EZZB 5GAMe 1PSFA 5GMKm 1KD1U 4FYYB 3CCUT 2W0ZA 1VQMA 3RMQA 2DILA 3LWHA 1UGVA 3PIOA 2K5LA 2K57A 2G3RA 1TG0A 4JZ3A 1N8RR 1SSHA 3PVLA 3VYGA 4HKEA 4JS5A 1UE9A 1YHQQ 4M7DE 4M7DF 4EMGA 4JJDA 2DIQA 1VQ4T 1BI1A 4HVUA 3CCVQ 3L2ZA 2ATCB 3VUBA 3E2UA 1M5Q1 2FB7A 1M2VB 3VS2A 1RI9A 2BTTA 2DYBA 3QUIA 3M58A 4R56A 2HSPA 1YITQ 1YJWA 5A2QE 3EH2A 2YSQA 2I0NA 1QWFA 4L6V5 1KQ1A 2BZYA 1OPLA 2HBWA 1QVFS 5DM7R 3CBPA 4XU1A 1G83A 1RABB 2J6FA 1BYMA 1SSFA 3WVDB 1VQ6A 3QWXX 1IGUA 4BY6C 2D0QB 2RF0A 3M4GA 4LD9K 3V8KA 5GANd 1VQNT 2A3LA 3CCJQ 2PZ1A 1YJNA 1ZHIA 4BE2A 1MMNA 3GBQA 1UGSB 5GAN5 1S72T 1VQ5A 2DERA 3EG0A 3L2UA 1QVPA 3OW2A 5DLQE 3TVTA 3CXCP 1ZSZA 1JEGA 1M1KR 1JO8A 4FL6A 2EPDA 2P4TA 4NOYA 4RTZA 1HK9A 1Y0MA 3SWNA 4D8DA 2HD0A 5GMKj 4RCCA 3CCMA 2ESWA 2NWMA 2QAZA 2E1HA 4XTVA 2AKLA 3N5BB 2MWOA 2QA4T 3CC2A 2YLCA 1RAEB 2VUBA 1RAGB 1YWPA 3TEEA 2VXEA 1ABOA 4L5GA 4BB7A 2QGGA 1GXIE 4C0FA 2KXCA 1PG5B 4M77G 3MEVA 3CC7Q 2QGFB 2KYBA 2MIOA 2CP2A 1WA7A 4M75G 2R5AA 2V1RA 3X25B 2L3SA 3DKMA 1N8RC 4M77E 3M57A 1Q81R 4M77F 3RERA 4BE0A 2GCXA 2LC4A 4C8QA 1VQPQ 2AZVA 1T3LA 2DXCA 2XDPA 2DL8A 5FU7B 2LX9A 2OI3A 4J9CA 2CP6A 4WF2A 1VQLT 4MMLA 1O75A 1UECA 1ZUYA 3V7SA 1LPLA 1JU5C 1BU1A 1I8FA 1D0XA 3M0QA 4M4ZA 2IPOB 4F7UB 3JB9G 3ZBDA 1RAIB 4HCKA 2VGMA 5GAMg 2QTVA 3OW2P 1YJ9A 1K9MR 3VS5A 2A36A 2H8HA 3HHTB 3NTIA 1SRLA 4J9IA 2D1XA 2RHUA 3QZ9B 2DZCA 2C06A 2ECZA 4BI3A 1YI2T 4CRIA 2BE9B 2CT4A 4CC4B 3G6ET 1OZ3A 4AFZC 1YN8A 4C8QE 1XOVA 3JCMe 3CQTA 4C8QF 4C5HA 1OU8A 4DQ2A 5DY9A 3CC4A 4J9FA 4K11A 1U06A 3CCEQ 1M1KC 1HSQA 3X24B 4OB3B 3FIFA 2HZYA 4IUUA 2D9TA 1RADB 2SEMA 4Y92A 1UEBA 2KRSA 1QKWA 3FB9A 1GCQA 2BUDA 1TXQA 2MK5A 3RIRA 4RG2A 1M9SA 1OEBA 5CQXA 1QVFP 7AT1B 2DNUA 3HFOA 3HFNA 4N0AC 2E5KA 2F5TX 4KGZB 4WTOB 2MWPA 4PJJA 2CDTA 1QKXA 4OVAA 1KQ2A 1H3HA 3OYBA 3H0FA 1M3CA 5GAN3 3QHSA 4KGVB 1VIFA 5FROA 1Q95G 5L23A 2KY9A 2MMPA 4XTUA 1BI0A 1R0CB 5GANe 3DLLA 3E1SA 3OA6A 2HKQB 1QQJA 1H8KA 4ELZC 1WHJA 5LJ3j 1U1SA 3M59A 3JRZA 3A8GB 2X4WA 1Q81C 5GAMh 5FU7C 1TH7A 1SHGA 1YCYA 2DEQA 4QVCA 1Q82R 2ZAEA 1B34B 1I81A 2EGEA 1ABQA 1W6XA 4JRKA 1O9SA 2PUKB 4RKUE 3CMAA 4C5IA 2K7AA 1VQOT 4HCBA 3MO8A 1KD1R 3JB9H 3EFSA 2COYA 4B9XA 2RQRA 3A8HB 1XQHA 3MEAA 4EIKA 1K9MC 1X75C 4ZNXA 2VYTA 3WXMB 3EFRA 2BZXA 1YHQA 5KE3A 2LX7A 1X6BA 4LDVA 2QEXT 3CCVA 3HL8A 2DKGA 3RBBB 4EDUA 3GPLA 2JNGA 5LJ3d 4XTXA 1S72Q 4X34A 1WXUA 3J7AF 2CP5A 3C0CA 1YITA 4AG1C 3S3OA 4E47A 3UA6A 5D6WA 4XTWA 3OYHA 1V76A 2RO0A 1MV0B 1LVKA 2DL3A 1CKAA 2IVWA 3EGDA 5LJ5g 2XIDA 1M27C 2XG8D 2RQTA 3EG1A 4C0ZA 5GMKe 4M77B 1HJDA 2COWA 4KUIA 2A28A 4OMNA 3QWYA 5KYUB 2VV5A 1G5VA 5AYFA 4M75B 2FVUA 1RAFB 2CREA 2LNHB 2EBPA 4HVVA 3REBB 4FYVB 1G3YA 1MMAA 2DIGA 5I11A 1RLPC 2JXBA 4DBQA 4HCCA 1OI1A 2DXUA 5KYYA 3QZ5B 3QJ6A 3OYNA 2L5QA 1TOVA 4QQGA 1WJRA 3OS0A 2QK0A 2PTKA 4E7JA 1RI0A 3UATA 3OYMA 3L2WA 1NLOC 3LH0A 1Q82C 2CYZB 2QQ9A 5HY6A 3M0RA 4C92G 1WJQA 5GMKl 1YIJT 3EFOA 1VQKQ 3A8LB 3PE0A 1BIAA 3OMCA 1NZ9A 2LRQA 2LQNA 1VQLQ 4KUDK 2VASA 2EVRA 2E4HA 3EGXB 1KD1C 2ZGWA 5I2SA 3FJ5A 2RJDA 1X43A 4J83A 3M53A 3CC7A 2HAXA 4Y28E 2M1HA 1I4K1 3OYYA 1M3BA 2KQWA 5GANg 1KK7A 2L89A 1BKBA 1TUCA 1M2OA 1I1JA 4A4GA 3CPWA 3FRNA 2QI2A 1GCPA 1IRXA 1VQPA 1K73R 5GAOp 6AT1B 2KNBB 1Y57A 3DB4A 4P5NA 1AHJB 4FW2A 3V8LA 3L2QA 1FMVA 1W70A 1K0SA 2EYZA 3FLGA 3AT1B 3MEWA 3G6EQ 2Y4YA 1UDLA 5GAN2 4PJOD 3QYGB 4FU6A 1Q7YU 3FEOA 4ZTFA 2L2PA 4BDYA 4M78G 2QTXA 3SHWA 4PL6A 2K3XA 4M75C 3JCMh 1LOJA 5CK9A 4C5GA 2J05A 2D8JA 2CH4A 3KFVA 3VYHB 1VQ8T 2LCSA 3G1JA 1VA7A 1SHFA 2K79A 2GF7A 1N27A 5KE2A 2BZ8A 4GY5A 2LVMA 4X9DA 3MPUB 2RPNA 1QW1A 4Z88A 3MP8A 1WHKA 2GTOA 1UGQB 2DPPB 2X4YA 3H6ZA 3CD6A 4JLIA 3CCEA 4Y91A 2J06A 2O01E 4PFZA 5J26A 2MCNA 3OYIA 2NUPA 5CKHA 1VYVA 3CCLT 1JXMA 1WQ7A 3OYCA 2YUNA 1KHCA 1YP5A 3CCQT 1VIEA 3MP1A 5LJ3e 4N4IA 2KE9A 1QVGS 1VQ7A 5GANh 2EQKA 2PNIA 1H92A 1X2KA 1HXDA 3M9QA 4JDSA 3TREA 1X01A 1WZOA 3CPWP 2L3PA 3CXCA 1QMCA 2O31A 4A4FA 3PIPA 1PRLC 1UHFA 1ZUUA 2LJ1A 1W4SA 3O5ZA 1YCSB 3M0UA 3ZFJA 1FX7A 4Z8AA 3TU4K 4M7DG 2HL3A 4XAXB 1D09B 3CCRT 3S3MA 4OB2B 1PHTA 3S6WA 3BW1A 2DJQA 3RNJA 3HRUA 3C12A 3JCMd 5IXBA 9ATCB 1RAHB 1K8AR 1I5LA 1K73C 1PKTA 1WXTA 4F16A 2WSFE 3MP6A 4M7AA 3QKJA 3V7CA 1VQMT 2YUOA 2XICA 2QEXQ 4J7FA 4J8OA 2LTOA 5IAYA 3JCMJ 2DFUA 2FG0A 2A08A 1ZUKA 3VS7A 3ASKA 3H8ZA 2FRYA 4CC3A 2L0AA 3META 3G7ZA 5CKBA 3SB2A 5GAOr 1RLQC 4OMFB 3JCMc 1IHWA 1YJWT 1KSWA 2QYZA 2EGCA 3UT1A 2JMAA 2K3YA 4RTUA 2QDYB 2EIFA 3EG9B 3MJXA 1NG2A 4BI8B 2K5IA 1FMWA 2HL5C 5CVIA 2E65A 5I2MA 4IIOA 2KR3A 4AG2C 3JAME 5GMKh 2V8JA 3T9NA 3I56Q 1MGQA 1JRIA 4C92B 2LQKA 2E70A 1YJNT 1P92A 2WACA 5I22A 3FDRA 4BD3A 1U5SA 2RMOA 2NYSA 4N4GA 1VQ5T 4YTLA 4OGCA 2OTLQ 4PJOA 2R58A 3I55A 3RR6A 1C1AA 4ATOA 4J6WA 2E6ZA 5KYXA 5KYWB 4LE9A 4JS4A 2XDDA 1R0BG 3A5ZB 1GFCA 2BKDN 1UGRB 2I2LA 4R55A 2ZPIB 1I5OB 2EYWA 2HEQA 2RJCA 3FC3A 2VXFA 3JCMX 2O4XA 2ZPBB 5DLOA 2PU9B 2FPDA 4E7ZA 5CKFA 3QYHB 5IT9E 2LP5A 1BI2A 5GAN7 1D3BB 5CKEA 4ZN1A 3CCMT 1NJIU 2GFUA 1BCOA 1F1BB 5IHKA 2DTIA 4OMOA 4ZTJA 1M3AA 4JJNK 3CC2T 2OTJQ 3OS2A 1QVFA 4RTYA 4A4HA 2E12A 3MHXA 4JRIA 1Y96A 2K3BA 2QQSA 2RJEA 1VUBA 2DVJA 2F69A 4IUQA 3CMEQ 2JW4A 5CCAA 2E10A 1AWXA 1PRMC 1TTHB 1VQ9A 5A0GA 1K8AC 2L3RA 4J9EA 4WCIA 4RUGA 3LLRA 2YWWA 2CSIA 4M78B 3UA7A 1VQKA 4PJOF 2EJGA 2OAUA 1MMDA 3X26B 5AT1B 4J9DA 2KT8A 3VS0A 2HBPA 3EH1A 1G3WA 4IUPA 3V7RA 2RB6A 4Z02A 1B07A 1PCXA 1PD0A 4IUTA 4O5VA 5LJ5f 5CKDA 2NUTA 4JRPA 2KGTA 1RUWA 1HYOA 2EGAA 2RQWA 4XU2A 2JVVA 3VV0A 2V1QA 4F17A 4C8QG 4JLGA 1VQ8Q 1KC8R 2XKOC 2DVEA 1X27A 3RESA 1SPKA 3ZL7C 4C92C 2RHXA 1R77A 4EMKB 1YJ9T 5HK3A 2J6OA 3CCSA 3PGGA 2FL7A 1M8VA 2DBKA 1XJWB 2FPEA 5KCHA 3FJPA 5J39A 2RI2A 1MMGA 3GOXA 4ESRA 1W2BS 2C0OA 3CCLQ 1OOTA 2M0OA 4FIBA 3CCQQ 4AT1B 4RTWA 3OYDA 4KH0B 1BIBA 1OPKA 4O6JA 4HCZA 4OMPA 3CC4T 3TQ7P 2XK0A 4M7DB 2CP7A 2CKKA 2RD1A 3MEUA 2LT4A 2KK4A 2LJ3A 1GBRA 1PD1A 5LJ3h 4ME7A 2FZCB 2BIVA 5FRMA 3UWNA 3G71Q 3JCMW 2H3EB 2LCLA 5GJVB 4DA4A 1ZLMA 1K4US 4IKFA 3GNFB 3E9FA 3PTAA 3EG3A 2COZA 4AFUC 3CCRQ 3CCUQ 4PFOA 2XD0A 2AZSA 1WGSA 4M78C 2LT1A 2EW3A 1OU9A 1JJ2S 4C0GA 3G4SA 4D8KA 2EAYA 4OMLA 3VJPA 1EFNA 2PUOB 3NTKA 1BI3A 2HCKA 1VQ4Q 3R6OA 1VQMQ 2CS7A 1UJYA 1PNJA 1D1AA 1GL5A
chains in the Genus database with same CATH topology
3CCUT 4PNOA 5I2SA 3A8MB 2ZPHB 4KBMB 1VQ9T 1VQMA 2RJDA 3HPWA 3RMQA 4J83A 3M53A 5IN1A 3CC7A 4Y28E 2M1HA 2HAXA 4MDXA 1I4K1 2EWNA 3OYYA 3LWHA 2WSCE 1Q86U 1VQLA 2KQWA 3PIOA 1Q86C 2K5LA 2K57A 2G3RA 2CZ6B 2X4XA 1OZ2A 3LX7A 3V8JA 5GANg 1NPRA 3VYGA 4HKEA 4JS5A 4II1A 2L89A 1BKBA 4D6WA 5CIUA 3OYKA 2F5KA 4M7DE 2E41A 4M75E 4M7DF 1K73U 4M75F 2E5QA 4EMGA 4A4GA 1VQKT 3CPWA 3CBOA 2DIQA 3FRNA 1VQ4T 1BI1A 2QI2A 4X9CA 1VQPA 3L2ZA 4FSXA 1M1FA 4BUGA 3VUBA 4DOWA 5GAOp 3AHUA 2RJFA 4EMKC 1M5Q1 5M9OA 1MHNA 3DB4A 2FB7A 2JN0A 2LDMA 2DTOA 4P5NA 1AHJB 4FM4B 4VUBA 2RHZA 3V8LA 3L2QA 3NFCA 3QUIA 3M58A 4R56A 1YJWA 1KC8C 3L1AA 5A2QE 3FLGA 1Y7XA 3BDLA 3MEWA 4IURA 2Y4YA 3GF5A 1IREB 4L6V5 5LJ5e 5GAN8 2JTMA 5GAN2 2MI6A 1KQ1A 4PJOD 5GMKi 1YI2A 3QYGB 4C92D 4FU6A 5GAN4 4MZTA 1Q7YU 1YHQT 4E7KA 3FEOA 4ZTFA 1H641 3G6EA 3SD4A 1QVFS 4BDYA 5DM7R 3CBPA 4M78G 4LDWA 4XU1A 3JCMf 5A0DA 3JB9F 4OGEA 2X4JA 1BYMA 1SSFA 2QTXA 3WVDB 1VQ6A 4PL6A 4BY6C 2HQXA 4N4HA 5D6YA 2D0QB 3RKXA 4ZGEB 2KAFA 3M4GA 2K3XA 3V8KA 4M75C 4A4KA 3JCMh 5GANd 4LD9K 1VQNT 4M7DC 1LOJA 2A3LA 5CK9A 4C5GA 2LNVA 3VYHB 1YITT 1YJNA 4RCBA 4OP0A 4OB1B 1ZHIA 1VQ8T 4BE2A 2XU8A 1UGSB 5GAN5 3CCST 2PVDB 1S72T 1VQ5A 1X6OA 3RKYA 3QPHA 5HK0A 3CCJA 2GF7A 4XTYA 1N27A 5KE2A 3JB9I 3L2UA 2R5MA 4RG8A 1M1KU 2RI5A 2LVMA 4GY5A 1QVPA 4X9DA 3SWNB 3OW2A 5DLQE 1QW1A 4HA8A 4UC4A 3OQ5A 3MP8A 4J6XA 3H6ZA 1UGQB 2DPPB 2X4YA 5CR2A 3CD6A 4FL6A 2GQVA 2P4TA 4JLIA 4Y91A 3CCEA 3I56A 4NOYA 1JBMA 5D6XA 1HK9A 2O01E 2JUFA 5J26A 2E6NA 1KQSS 3SWNA 3OYIA 3CCLT 2HD0A 2DO3A 5CKHA 1NE8A 4C5EA 5GMKj 4RCCA 4XQ3A 1WQ7A 3OBWA 3OYCA 3CCMA 1KHCA 2VGNA 5GANf 1VIEA 3MP1A 3JCMg 3M4YA 4LDYA 4N4IA 5LJ3e 3CCQT 1QVGS 1ZQ1A 1VQ7A 2E1HA 4M7AD 2OTLA 1U8RA 4XTVA 5GANh 3KBGA 3CPFA 3N5BB 2MWOA 2QA4T 4MZMA 3CC2A 2EQKA 4M78D 2YLCA 2ZCFB 5GAOq 2VUBA 4JDSA 1HXDA 3M9QA 3TREA 1X01A 3VU3C 4C0DB 3TEEA 3LWIA 2VXEA 4L5GA 4BB7A 1GXIE 2RM4A 3CXCA 4C0FA 4A4FA 3PIPA 1W4SA 2MAMA 2RK2A 2DZ9A 4M77G 3ZFJA 5C6SA 3QJYA 1FX7A 3MEVA 3L2VA 4N0AA 3RUXA 2EQUA 2PQWA 3TU4K 4M7DG 4C8QB 4M75G 2R5AA 3G4ST 2ZPGB 1VQOA 4XAXB 3X25B 1Q81U 3OSSC 3CCRT 2V8KA 4OB2B 3S3MA 3S6WA 3BW1A 2OTJA 1N8RU 1RL2A 3DKMA 4LD6A 1N8RC 4M7AB 1WPYA 1W2BA 4M77E 4XK8E 3M57A 1Y71A 1K8AU 4M77F 4CI0C 3HRUA 3JSCA 3CMEA 4BE0A 2RK1A 2GCXA 2LC4A 3C12A 4C8QA 3JCMd 3L2RA 3RERA 2KSSA 3BY7A 4ZN3A 3CMAT 2DD5A 3WVEB 1I5LA 1K73C 2WSEE 2DXCA 4BI4A 2XDPA 2WSFE 3MP6A 5FU6B 5FU7B 4M7AA 5FRNA 2LX9A 3QKJA 3ME9A 3V7CA 1VQMT 5GAMj 2XICA 5I21A 4J7FA 4J8OA 2RA2A 3CC7T 2LTOA 5IAYA 4WF2A 3JCMJ 4L59A 1VQLT 2P0PA 4MMLA 2DAQA 1O75A 3V7SA 1WQWA 1I8FA 4J5YA 3CEYA 2YHTA 2EKOA 4F7UB 2QEXA 3JB9G 3ZBDA 3ASKA 3QSUA 3H8ZA 2VGMA 3META 4DOVA 4TVRA 2K2VA 3OYLA 5GAMg 1VQPT 4A54A 3G7ZA 4B9WA 5CKBA 4EMHA 1YJ9A 3BDUA 1Q7YC 4OB0B 2GFAA 3PMIA 3SB2A 5GAOr 3OSVA 4F7UA 3HHTB 4OMFB 4M77C 3NTIA 3JCMc 2ZZDA 3GP8A 3CCVT 1YJWT 2H3JA 3LGLA 3LW5E 3UT1A 2RHYA 2DD4A 1PSEA 2RHUA 2K3YA 1M1GA 3QZ9B 4M7DD 2ZPFB 3F70A 4M75D 2DZCA 2QDYB 3M56A 4J6YA 1JJ2A 3PFSA 2EIFA 2C06A 3QBYA 1FXXA 3SWNC 2RH2A 4BI3A 4PLLA 1YI2T 3HSBA 3J81E 1QP3A 4CRIA 4A53A 4MZPA 4BI8B 2K5IA 4XU3A 5CVIA 3OB9A 2EJ9A 2E65A 2RI3A 5I2MA 5FLXE 5LJ5j 1ZBXA 3G6ET 2CGHA 1G3TA 2D6FA 1OZ3A 4QQ6A 4C8QE 3JAME 1XOVA 3JCMe 5GMKh 4C8QF 2XHCA 4C5HA 2V8JA 4DQ2A 3CC4A 5DY9A 2NLUA 2DXTA 3A8OB 3T9NA 1M1KC 3X24B 4OB3B 3OYFA 4PJOB 4FT4A 1MGQA 3FIFA 1JRIA 4C92B 4GLKA 3OBYA 2LQKA 2E70A 4OF1A 1YJNT 4IUUA 2D9TA 1P92A 1UEBA 2WACA 2ZPEB 1WJSA 4ELYC 3FDRA 3FB9A 2LQ8A 4BD3A 2BUDA 3C95A 4N4GA 2K5FA 5GAMd 4YTLA 1VQ5T 3RIRA 4RG2A 4OGCA 1M9SA 2O4XB 3QG1A 3CCJT 4PJOA 5CQXA 1EIFA 2R58A 3I55A 4NL3A 3P8HA 3HFOA 1QP2A 4C92A 3KXTA 3KUFA 4J6WA 3CPWS 3JB9D 3HFNA 4N0AC 4ATOA 2E6ZA 1IZ6A 1KG1A 2F5TX 2XDDA 4C0DC 3A5ZB 2MWPA 2BKDN 3M55A 1UGRB 4JS4A 2I2LA 5CQYA 2B8AA 3RKWA 4R55A 2ZPIB 3GLXA 3X20B 2LCCA 3J80E 4OVAA 2RJCA 1KQ2A 3FC3A 2VXFA 3JCMX 2FHDA 2O4XA 2ZPBB 2VC8A 4QVZA 3OYBA 2KMTA 3CCET 3CD6T 3I56T 5DLOA 3QHSA 2PU9B 4F7UE 5GAN3 2JOYA 1G3SA 4F7UF 3C94A 1VIFA 2DK3A 3OYEA 5FROA 1V29B 3E19A 3HKSA 3MCAB 4QQDA 5CKFA 3QYHB 2KY9A 2MMPA 5IT9E 2FYKA 1BI2A 5GAN7 4XTUA 1D3BB 5CKEA 4C8QC 4ZN1A 1BI0A 5A0LA 3CCMT 1NJIU 2GFUA 3JCMV 1NJIC 1Y96B 2YLBA 5GANe 3DLLA 3E1SA 1VQ7T 3G71A 3VUZA 1YIJA 3OA6A 3JCMP 2DTIA 2HQEA 2PVGB 2OTLT 4M7AC 1UGPB 4ELZC 4ZTJA 1YBYA 2QXFA 4JJNK 2EFIA 3CC2T 5LJ3j 3OS2A 1D3BA 1U1SA 3M59A 3ZEHA 5GAMf 3OY9A 1QVFA 3JRZA 4HT8A 3LGFA 4A4HA 2E12A 3MHXA 4JRIA 1Y96A 2QQSA 3A8GB 2RJEA 5LJ5d 1VUBA 2F69A 4IUQA 2X4WA 5CCAA 2RHIA 3O8VA 3HRTA 5FU7C 5FU6C 1TH7A 5HKCA 5GAMh 2E10A 1Q81C 3CCUA 1YCYA 2DEQA 1VQ9A 5GAN6 4QVCA 5A0GA 4Q5WA 1B34B 2MF2A 2EJFA 1I81A 4MMKA 5J3BA 1K8AC 2L3RA 3ER0A 4BDZA 2R57A 3P8DA 4JRKA 3JCMQ 1O9SA 3LLRA 3S3NA 2PUKB 4M78B 4RKUE 4EPCA 3JB9J 2L8DA 2XI9A 3CMAA 4JRQA 4C5IA 1VQKA 4PJOF 2EJGA 4PKCC 3OYAA 1B34A 1VQOT 4C92E 2OAUA 3OW2S 1VQ4A 4E7LA 2JTFA 4C92F 3OYGA 3X26B 2KVQG 3SDZA 2OTJT 4HCBA 1FWZA 3MO8A 4IUVA 3JB9H 3SFMA 3EFSA 3OYJA 2HBPA 4M78A 2HNIA 4FT2A 1WNLA 4B9XA 3P8BB 3CMET 1R8OB 1G3WA 4LDUA 2QQRA 3A8HB 4IUPA 1XQHA 3MEAA 2Y90A 3V7RA 1XTDA 2RB6A 3L42A 4Z02A 1KQSA 3QXEB 2CZ7B 4IUTA 4O5VA 3HRSA 2QQAA 5LJ5f 1K9MU 1K9MC 5CKDA 3OS1A 2XDBA 1X75C 2CZ1B 2DXBA 4JRPA 4BACA 2VYTA 3TCJA 3WXMB 3EFRA 1YHQA 1QVGA 5LJ5h 1N6AA 4XU2A 3RMSA 4M77D 5KE3A 3OMGA 4LDVA 1KC8U 2JVVA 3VV0A 1OYXA 2QEXT 3CCVA 3HL8A 2DKGA 4C8QG 4JLGA 4QVDA 4EDUA 4ZGJB 3GPLA 2JNGA 5LJ3d 3EAEA 4XTXA 1VQNA 2XKOC 2DVEA 3CXCS 4PJOC 3RESA 5GAOn 4X34A 3J7AF 4C92C 4EMKB 2RHXA 1YJ9T 4M7AG 2A7YA 4E7IA 1YITA 3S3OA 4E47A 1VQ8A 5CO7A 5HK3A 5LL6S 3CCSA 3PGGA 1M4ZA 2X35A 1S72A 1XNIA 2CZ0B 4LDXA 2FL7A 2Y4XA 3NTHA 1VQ6T 5EG2A 5CAIA 5D6WA 3GNGA 4XTWA 5GAOl 1M8VA 3OYHA 2IG0A 5KCHA 4EMKA 2K4YA 2RO0A 4NS5A 1H3ZA 3FJPA 5J39A 2DTHA 4M7AE 2PVOB 4M7AF 2DJZA 2RI2A 3GOXA 1W2BS 2P0QA 4KULA 5L8RE 2IVWA 5LJ5g 1DJ7B 1M90U 2XIDA 2M0OA 5GMKe 2XG8D 4C0ZA 1M90C 2AHJB 2EQJA 4FIBA 4M78E 4M77B 4M78F 5GAOm 3OYDA 1BIBA 2EQMA 4NL2A 3VKIA 4O6JA 4F7UG 1U1TA 4KUIA 4BE1A 3QIIA 4HCZA 4KT0E 3BFMA 5KCOA 2YRVA 3CC4T 4BY6B 3CCLA 2VV5A 5C0MA 2XK0A 4M7DB 1G5VA 5AYFA 4M75B 2CKKA 2FVUA 2RD1A 3DB3A 5LJ3f 3MEUA 3E9GA 3URGA 3CCQA 2LT4A 2KK4A 1Y07A 3C4SA 3LYIA 4HT9A 4M77A 3GIBA 1G3YA 5LJ3h 2DIGA 3CBMA 4ME7A 4RMOA 2BIVA 2JZ2A 2QA4A 5FRMA 4HCCA 2M9UA 2QQBA 3QDRB 3UWNA 4M7DA 3JCMW 4M75A 1OI1A 2DXUA 3PMTA 1JB0E 3QZ5B 2LCLA 5KH6A 4A4EA 3I55T 3QJ6A 1LJOA 4C8QD 3OYNA 2L5QA 3DLMA 4ZGDB 4DA4A 4QQGA 4E7HA 3UDCA 4IKFA 3GNFB 3HP9A 3INZA 1WJRA 1UB4A 3QO3A 3E9FA 3M5AA 3OS0A 3PTAA 3JCMb 4E7JA 1RI0A 2EYQA 3X28B 4PLIA 3OYMA 4V2SA 3L2WA 2XD0A 3M54A 2M16A 3LH0A 4QW2A 4XU0A 1NPPA 1WGSA 4M78C 2P0KA 1Q82U 2LT1A 1Q82C 1JJ2S 4C0GA 2CYZB 2QQ9A 4PJOG 3G4SA 2EAYA 5HY6A 3VJPA 3CCRA 4C92G 1WJQA 5GMKl 3G71T 1YIJT 1LNXA 4XTZA 3Q1JA 3UPUA 2PUOB 3NTKA 2E64A 3PT9A 3OS5A 1BI3A 2KDSA 4JUVA 1N9RA 4MDWA 2V8IA 4J7IA 3A8LB 5LJ3g 1BIAA 3OMCA 1NZ9A 5GANj 2LRQA 3R6OA 1N9SA 1KHIA 2CS7A 5GAMe 1PSFA 4PJOE 4KUDK 3PNWC 5GMKm 1KD1U 1KD1C 2ZGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OMG A;  2EQK A;  2RJD A;  1OYX A;  5IN1 A;  4IUU A;  2D9T A;  4EDU A;  2M1H A;  2WAC A;  3M9Q A;  1WJS A;  3FDR A;  4BD3 A;  2X4X A;  2G3R A;  3EAE A;  1OZ2 A;  2BUD A;  3LX7 A;  4N4G A;  4RG2 A;  4X34 A;  4II1 A;  2L89 A;  2O4X B;  4A4F A;  2RHX A;  5CIU A;  2F5K A;  3OYK A;  2R58 A;  4E7I A;  3S3O A;  3P8H A;  2E5Q A;  4A4G A;  3KUF A;  2DIQ A;  5C6S A;  3L2V A;  3MEV A;  2MWP A;  2BKD N;  2X35 A;  1XNI A;  2EQU A;  2B8A A;  2PQW A;  3NTH A;  2RJF A;  5M9O A;  2LCC A;  1MHN A;  5D6W A;  4OVA A;  2RJC A;  3OYH A;  3DB4 A;  3FC3 A;  2IG0 A;  5KCH A;  2R5A A;  2FHD A;  2LDM A;  2O4X A;  2RO0 A;  4NS5 A;  4QVZ A;  5J39 A;  3OYB A;  3S3M A;  2RHZ A;  3S6W A;  3L2Q A;  2RI2 A;  3OYE A;  5FRO A;  4LD6 A;  3GOX A;  4QQD A;  3FLG A;  3BDL A;  1H3Z A;  3MEW A;  2M0O A;  4IUR A;  2EQJ A;  2GFU A;  4BE0 A;  3L2R A;  3OYD A;  2EQM A;  4BE1 A;  4FU6 A;  3QII A;  4HCZ A;  3OA6 A;  2HQE A;  5KCO A;  2YRV A;  3FEO A;  4E7K A;  4ZTF A;  5C0M A;  4ZTJ A;  2XK0 A;  2XDP A;  1G5V A;  2CKK A;  3MP6 A;  2EFI A;  3DB3 A;  3SD4 A;  3MEU A;  3E9G A;  5FRN A;  3QKJ A;  3OS2 A;  4BDY A;  3ME9 A;  3ZEH A;  3C4S A;  3OY9 A;  3LYI A;  3LGF A;  4A4H A;  1SSF A;  2LTO A;  2QQS A;  4PL6 A;  5IAY A;  2RJE A;  2HQX A;  4L59 A;  2DIG A;  4IUQ A;  4N4H A;  2X4W A;  5D6Y A;  2K3X A;  2BIV A;  2DAQ A;  2JZ2 A;  2RHI A;  3O8V A;  5FRM A;  3UWN A;  1OI1 A;  3CEY A;  3PMT A;  2EKO A;  4C5G A;  4Q5W A;  5KH6 A;  3ASK A;  4A4E A;  3QJ6 A;  2L3R A;  3H8Z A;  3OYN A;  3DLM A;  4BDZ A;  4BE2 A;  4QQG A;  2R57 A;  4E7H A;  3MET A;  3P8D A;  4IKF A;  1WJR A;  3OYL A;  3LLR A;  3S3N A;  3E9F A;  3OS0 A;  4B9W A;  2L8D A;  2GF7 A;  1N27 A;  4C5I A;  2GFA A;  5KE2 A;  4E7J A;  1RI0 A;  2R5M A;  3PMI A;  3L2U A;  4PLI A;  3OYA A;  3OYM A;  3L2W A;  2RI5 A;  2LVM A;  4GY5 A;  3NTI A;  2JTF A;  4E7L A;  3OYG A;  2M16 A;  3LH0 A;  4QW2 A;  3LGL A;  3MO8 A;  1WGS A;  4UC4 A;  4IUV A;  2RHY A;  2P0K A;  3OQ5 A;  3MP8 A;  3UT1 A;  2RHU A;  3H6Z A;  3OYJ A;  2K3Y A;  2X4Y A;  3F70 A;  4FL6 A;  4B9X A;  3PFS A;  5D6X A;  2QQR A;  1WJQ A;  3QBY A;  3MEA A;  4IUP A;  4PLL A;  3L42 A;  5J26 A;  2E6N A;  4Z02 A;  3Q1J A;  4CRI A;  3OYI A;  3NTK A;  4C5E A;  3OB9 A;  4IUT A;  2RI3 A;  3OYC A;  3OS1 A;  3OMC A;  1KHC A;  3MP1 A;  2LRQ A;  4N4I A;  1OZ3 A;  2VYT A;  4QQ6 A;  4BAC A;  4C5H A;  2NLU A;  3PNW C;  5KE3 A;  2MWO A;  3OYF A; 
#chains in the Genus database with same CATH topology
 2JT4 A;  1GBQ A;  1YWO A;  3A8M B;  3HPW A;  1OX9 A;  2WSC E;  4DEY A;  1Q86 U;  2X4X A;  2CZ6 B;  3V8J A;  4D6W A;  2F5K A;  1N5Z A;  4X9C A;  3AHU A;  4DOW A;  2DRM A;  4BUG A;  2HQH A;  2RJF A;  4EMK C;  1D1B A;  1MHN A;  2JN0 A;  3UF4 A;  1VQN Q;  2RHZ A;  4J9G A;  2FZK B;  1KC8 C;  1Y7X A;  3BDL A;  4PJM A;  1WHL A;  4IUR A;  5GAN 8;  2JTM A;  1PWT A;  1AWW A;  1OX8 A;  2JJ9 A;  2HMA A;  1M2V A;  4QKU A;  5GAN 4;  4MZT A;  1YHQ T;  2K6D A;  2XMF A;  1H64 1;  4LDW A;  5A0D A;  4OGE A;  3RKX A;  1ZA1 B;  5D6Y A;  4ZGE B;  4FSS A;  4M7D C;  1BBZ A;  4DEX A;  1YIT T;  4RCB A;  4OB1 B;  3LH5 A;  1CKB A;  2XU8 A;  3EHQ A;  2PVD B;  1ZSZ B;  1LCK A;  3IQL A;  2C0T A;  2FEI A;  3RKY A;  4B6M A;  3CCJ A;  4XTY A;  2AKK A;  3JB9 I;  4RG8 A;  2QA4 Q;  1M1K U;  3SWN B;  2ROT A;  4HA8 A;  4LXC A;  4UC4 A;  3U23 A;  3OQ5 A;  5CR2 A;  3TSW A;  1D1C A;  3I56 A;  5D6X A;  3VS4 A;  1WHH A;  1KQS S;  1IHV A;  3M0S A;  2X9H A;  1NE8 A;  4C5E A;  1T0H A;  3JCM g;  1ZQ1 A;  4M7A D;  3VS6 A;  2OTL A;  4HVW A;  2CUD A;  3CPF A;  1UJ0 A;  4FYX B;  3HTR A;  3JV3 A;  4C0D B;  4FCY A;  2RM4 A;  2GQI A;  2DL7 A;  1NJI R;  2RK2 A;  2DZ9 A;  4LUD A;  5C6S A;  3L2V A;  3QJY A;  4N0A A;  4GLM A;  2EQU A;  3RUX A;  2PQW A;  2KI7 A;  4C8Q B;  2ZPG B;  2LMJ A;  1Q81 U;  2V8K A;  2OTJ A;  4LD6 A;  3M0T A;  1ZA2 B;  1WPY A;  2GGR A;  1VYT A;  4XK8 E;  2W10 A;  4CI0 C;  1TU0 B;  3JSC A;  4JJC A;  1B7T A;  3CME A;  2RK1 A;  1SKU B;  2KSS A;  3BY7 A;  2DD5 A;  3RDV A;  2RQV A;  4BI4 A;  3VRY A;  3ME9 A;  1JJ2 P;  3CC7 T;  2DAQ A;  2GTJ A;  1YI2 Q;  1WQW A;  3CEY A;  1YJ9 Q;  2EKO A;  2DET A;  4DBF A;  3QSU A;  3I9Q A;  2RNA A;  1G8X A;  4DOV A;  2D8H A;  4TVR A;  2OJ2 A;  3OYL A;  1VQP T;  4B9W A;  3BDU A;  4OB0 B;  4F7U A;  4M77 C;  4JZ4 A;  3GP8 A;  1ZSZ C;  2FRW A;  3LGL A;  4KRT A;  1KIK A;  1NM7 A;  5IH2 A;  1PKS A;  2A37 A;  2ZPF B;  4M75 D;  3M56 A;  4J6Y A;  2K2M A;  3QBY A;  3SWN C;  2RH2 A;  4V2S A;  2KXD A;  1JXO A;  1W1F A;  2O2O A;  1T3S A;  1B3Q A;  5LJ5 j;  5FLX E;  1ZBX A;  2CGH A;  1G3T A;  1TUD A;  4QQ6 A;  3PVQ A;  3H9N A;  4X1V A;  1BCM A;  2DXT A;  3REA B;  1X6G A;  2MOX A;  3OBY A;  4OF1 A;  4ELY C;  3C95 A;  2K5F A;  3KXT A;  3JB9 D;  3KUF A;  1SEM A;  1IZ6 A;  4C0D C;  1GFD A;  3EHR A;  4PJL A;  1WDX A;  2ED0 A;  5CQY A;  3RKW A;  3I5S A;  2LCC A;  2QAS A;  3J80 E;  2DMO A;  2FHD A;  4QVZ A;  3CD6 T;  2P4R A;  3CCE T;  1AD5 A;  4F7U E;  1G3S A;  4F7U F;  3MCA B;  3E19 A;  1UFF A;  1BB9 A;  2FYK A;  1MNE A;  4C8Q C;  5A0L A;  1NJI C;  1VQ7 T;  3G71 A;  2HQE A;  2PVG B;  2A0F B;  1UGP B;  1VQO Q;  1YBY A;  2RQU A;  4Z89 A;  5GAM f;  5KYN A;  3OY9 A;  1EX4 A;  5LJ5 d;  4FYW B;  2RHI A;  3O8V A;  3HRT A;  3CCU A;  1IB8 A;  1X2Q A;  5GAN 6;  4OMQ A;  1AVZ C;  2MF2 A;  4MMK A;  2QG9 B;  2YRD A;  4BDZ A;  2KEA A;  2R57 A;  1AZG B;  3JCM Q;  3S3N A;  2KRO A;  4EPC A;  2XI9 A;  1E6G A;  2QDL A;  2EYX A;  1B34 A;  3OW2 S;  1VQ4 A;  4E7L A;  3SDZ A;  1PC0 A;  1WX6 A;  5FWB A;  4CC7 A;  3SFM A;  3OYJ A;  4LDU A;  2QQR A;  2Y90 A;  1XTD A;  3L42 A;  1SG5 A;  1Q86 R;  3QXE B;  2CZ7 B;  3EGU A;  2QQA A;  2M51 A;  2XDB A;  2CZ1 B;  1ARK A;  2DM1 A;  4BAC A;  2F2V A;  3TCJ A;  2JTE A;  1QVG A;  5ECA A;  3RMS A;  3OMG A;  1V1C A;  3EG2 A;  4HXJ A;  1OYX A;  1Z9Q A;  4QVD A;  1GCQ C;  1AOJ A;  4ZGJ B;  1VQN A;  2JMC A;  4M7A G;  4R0K A;  2A7Y A;  4E7I A;  3THK A;  2ENM A;  5LL6 S;  1M4Z A;  2X35 A;  1S72 A;  1XNI A;  2CZ0 B;  1IO6 A;  3EGD B;  2Y4X A;  3NTH A;  1VQ6 T;  3GNG A;  3QDF A;  2IG0 A;  1H3Z A;  2K4Y A;  4NS5 A;  1WFW A;  2DTH A;  4M7A E;  2RN8 A;  4PJN A;  2DJZ A;  4M7A F;  5HCK A;  2P0Q A;  5IXF A;  1E6H A;  3TSZ A;  4KUL A;  1AWO A;  1M90 U;  1G2B A;  2SRC A;  1ZBJ A;  2EQJ A;  4AFQ C;  5GAO m;  2F2W A;  4NL2 A;  3VKI A;  4MDX A;  2ABL A;  1U1T A;  4KT0 E;  3BFM A;  5C0M A;  1K9A A;  5KYY B;  3DB3 A;  3E9G A;  3C4S A;  2DBM A;  2OAW A;  4HT9 A;  4M77 A;  3GIB A;  5IHI A;  3CBM A;  4RMO A;  2JZ2 A;  2QA4 A;  2G6F X;  5KYU A;  1I07 A;  2M9U A;  3QDR B;  1YIJ Q;  4M75 A;  2C0I A;  1AT1 B;  3PMT A;  4F14 A;  5KH6 A;  3I55 T;  1LJO A;  3DLM A;  3A98 A;  4E7H A;  1YNZ A;  2JM9 A;  1C0M A;  3M5A A;  3JCM b;  2GNC A;  2EYQ A;  4KGX B;  4PLI A;  3EFO B;  3I5R A;  2JM8 A;  3M54 A;  1BK2 A;  2EYY A;  1UHC A;  1QWE A;  4PJO G;  3NPF A;  1VYU A;  1LNX A;  3Q1J A;  3UPU A;  1QVG P;  3PT9 A;  4JUV A;  3ULR B;  2KDS A;  1N9R A;  5LJ3 g;  4J7I A;  3NGP A;  1OUL A;  1E7O A;  4PJO E;  3PNW C;  4OMM A;  5D7U A;  4PNO A;  3VRZ A;  4KBM B;  2ZPH B;  1VQ9 T;  5IN1 A;  2EWN A;  1VQL A;  2D6F A;  1Q86 C;  2DL4 A;  1WYX A;  1OZ2 A;  3LX7 A;  1NPR A;  1FMK A;  3EGX A;  4II1 A;  5CIU A;  3OYK A;  1CSK A;  2E41 A;  4M75 E;  1K73 U;  4M75 F;  1S1N A;  2E5Q A;  4AMC A;  1VQK T;  3CBO A;  2L3Q A;  2VVK A;  2CT3 A;  4FSX A;  1M1F A;  2M0Y A;  5M9O A;  1QCF A;  2LDM A;  2DTO A;  1K1Z A;  4FM4 B;  4VUB A;  2MYS A;  3NFC A;  4ORZ A;  3L1A A;  5FW9 A;  2B86 A;  1SRM A;  3GF5 A;  1IRE B;  5LJ5 e;  2LQW A;  2MI6 A;  5GMK i;  1YI2 A;  4C92 D;  1D0Z A;  2E3I A;  4E7K A;  2YUQ A;  1ACM B;  2O9S A;  4FW1 A;  2E3H A;  1M30 A;  3SD4 A;  3G6E A;  1Q7Y R;  1J3T A;  3JCM f;  1MUZ A;  3JB9 F;  1IGQ A;  2X4J A;  1PM3 A;  2HQX A;  4N4H A;  1Z9Z A;  2KAF A;  4A4K A;  2J6K A;  2LNV A;  4OP0 A;  1IXD A;  2AK5 A;  1AWJ A;  3CCS T;  1X6O A;  1AEY A;  3QPH A;  4ANJ A;  5HK0 A;  1ZX6 A;  2R5M A;  2FO0 A;  3CD6 Q;  1QCN A;  2RI5 A;  3NMZ C;  2KRM A;  2NUP B;  1TS9 A;  4J6X A;  2GQV A;  1ZSG A;  1JBM A;  2JUF A;  1VQ7 Q;  2E6N A;  2DE0 X;  2DO3 A;  4XQ3 A;  3OBW A;  2VGN A;  5GAN f;  3M4Y A;  4LDY A;  4E6R A;  3NHN A;  2X3W D;  1U8R A;  2VB6 A;  3KBG A;  2YT6 A;  4MZM A;  2O9V A;  1NLP C;  4M78 D;  2ZCF B;  5GAO q;  1K76 A;  2FPF A;  3H0I A;  3VU3 C;  3LWI A;  2MAM A;  1RAC B;  4RTT A;  2O88 A;  1YFN A;  2HSE B;  1KJW A;  1MV3 A;  4DBR A;  1WLP B;  3G4S T;  1VQO A;  3OSS C;  3R6N A;  1K0X A;  1N8R U;  1RL2 A;  2VWF A;  4M7A B;  1W2B A;  5GJW B;  1Y71 A;  1K8A U;  1C6V X;  2VKN A;  3L2R A;  4ZN3 A;  3CMA T;  3WVE B;  1A0N B;  2WSE E;  5FU6 B;  5FRN A;  3MKD A;  1YJW Q;  5GAM j;  1X69 A;  5I21 A;  2RA2 A;  3D7S B;  4L59 A;  2P0P A;  2V26 A;  1RAA B;  2ROL A;  2JS2 A;  4J5Y A;  2YHT A;  1T0J A;  2QEX A;  3VS3 A;  4A63 B;  1WIE A;  2K2V A;  5IHN A;  4A54 A;  4EMH A;  1VQ6 Q;  2CSQ A;  1Q7Y C;  1I0C A;  1QCO A;  2GFA A;  4GBQ A;  3VS1 A;  3PMI A;  3OSV A;  2ZZD A;  1OQK A;  1WHM A;  3CCV T;  1YJN Q;  2CUB A;  2H3J A;  4LN2 A;  3LW5 E;  2LJ0 A;  2RHY A;  2DD4 A;  1TSF A;  1PSE A;  1M1G A;  4M7D D;  3F70 A;  1JJ2 A;  1VQ5 Q;  3PFS A;  2ED1 A;  1FXX A;  3HSB A;  4PLL A;  3J81 E;  1QP3 A;  1UUE A;  1OV3 A;  4A53 A;  2EKH A;  4MZP A;  5EC7 A;  2EQI A;  4XU3 A;  3SEM A;  3OB9 A;  2EJ9 A;  4CC2 A;  2KT1 A;  2RI3 A;  1NEB A;  2AT1 B;  1U3O A;  2XHC A;  3EG9 A;  2NLU A;  3A8O B;  3OYF A;  4PJO B;  4FT4 A;  3M0P A;  3I35 A;  4GLK A;  1D0Y A;  5KYX B;  3I55 Q;  4J9H A;  1UG1 A;  3CCM Q;  2ZPE B;  1WJS A;  1WXB A;  2LQ8 A;  5GAM d;  2YRC A;  2DA9 A;  3QG1 A;  2O4X B;  3CCJ T;  1EIF A;  1M90 R;  4NL3 A;  3P8H A;  3CPW S;  1QP2 A;  4C92 A;  3CC2 Q;  1KG1 A;  2AIR B;  3M55 A;  1SF9 A;  1GRI A;  2B8A A;  3H41 A;  1NYF A;  3GLX A;  3H0H A;  3X20 B;  1W2B P;  2VC8 A;  2KMT A;  2J7I A;  3I56 T;  2JOY A;  4JJB A;  3C94 A;  2DK3 A;  3OYE A;  1V29 B;  3HKS A;  5KYW A;  1QLY A;  2DF6 A;  4QQD A;  4RTV A;  2D0N A;  2JS0 A;  3JCM V;  1Y96 B;  2YLB A;  2MPX C;  3VUZ A;  1YIJ A;  2OTL T;  2LZ6 B;  3JCM P;  4M7A C;  2QXF A;  1UTI A;  2EFI A;  1TWB A;  2KRN A;  1VQ9 Q;  1D3B A;  3ZEH A;  1JQQ A;  1M8M A;  2YDL A;  4HT8 A;  3LGF A;  1TUG B;  2X3X D;  5HKC A;  5FU6 C;  1AZE A;  4Q5W A;  2CP3 A;  2EJF A;  5J3B A;  3ER0 A;  1NBE B;  3P8D A;  2CH4 W;  2KBT A;  2KYM A;  3JB9 J;  2L8D A;  2HDA A;  4JRQ A;  2YUP A;  3OYA A;  4PKC C;  4C92 E;  1NEG A;  2DYI A;  2JTF A;  4C92 F;  3OYG A;  1NYG A;  2KVQ G;  2OTJ T;  2DL5 A;  1FWZ A;  4IUV A;  4E7S A;  2BE7 D;  2NUT B;  4M78 A;  2HNI A;  4FT2 A;  1WNL A;  3P8B B;  3CME T;  1R8O B;  2FZG B;  2K9G A;  1KQS A;  1K9M U;  3HRS A;  3OS1 A;  2DXB A;  1FYN A;  5LJ5 h;  4KH1 B;  1VOM A;  1N6A A;  4M77 D;  1KC8 U;  4LNP A;  4AFS C;  3EAE A;  3CCS Q;  3CXC S;  1HD3 A;  2HKN A;  4PJO C;  5GAO n;  2DLP A;  3CC4 Q;  2CP0 A;  5CO7 A;  4IIM A;  1VQ8 A;  2IIM A;  3A1P A;  4LDX A;  5EG2 A;  5CAI A;  5GAO l;  4EMK A;  2PVO B;  8ATC B;  2YXY A;  4JPB W;  5L8R E;  2Z0W A;  1DJ7 B;  1M90 C;  1WHG A;  2AHJ B;  4M78 E;  4M78 F;  2EQM A;  4F7U G;  4BE1 A;  3QII A;  5KCO A;  2YRV A;  4BY6 B;  3CCL A;  3URG A;  5LJ3 f;  2GBQ A;  3CCQ A;  1Y07 A;  3BE3 A;  3LYI A;  4J9B A;  5FWC A;  2OX7 A;  2QQB A;  4M7D A;  1MND A;  2X51 A;  1JB0 E;  2F2X A;  4A4E A;  4C8Q D;  4ZGD B;  2F1L A;  3UDC A;  4RTX A;  3HP9 A;  4E2F B;  4F04 B;  3INZ A;  1WI7 A;  1UB4 A;  8AT1 B;  3QO3 A;  4DBH A;  4LUE A;  4PK4 A;  3X28 B;  3G4S Q;  2DX1 A;  2M16 A;  4QW2 A;  4XU0 A;  2NUZ A;  1NPP A;  2P0K A;  2P84 A;  1Q82 U;  1KQS P;  2DRK A;  4QT7 A;  2DEU A;  3CCR A;  3G71 T;  3CMA Q;  4XTZ A;  2E64 A;  3OS5 A;  4MDW A;  1KFZ A;  2V8I A;  5GAN j;  2M02 A;  4PFP A;  1N9S A;  1KHI A;  1EZZ B;  5GAM e;  1PSF A;  5GMK m;  1KD1 U;  4FYY B;  3CCU T;  2W0Z A;  1VQM A;  3RMQ A;  2DIL A;  3LWH A;  1UGV A;  3PIO A;  2K5L A;  2K57 A;  2G3R A;  1TG0 A;  4JZ3 A;  1N8R R;  1SSH A;  3PVL A;  3VYG A;  4HKE A;  4JS5 A;  1UE9 A;  1YHQ Q;  4M7D E;  4M7D F;  4EMG A;  4JJD A;  2DIQ A;  1VQ4 T;  1BI1 A;  4HVU A;  3CCV Q;  3L2Z A;  2ATC B;  3VUB A;  3E2U A;  1M5Q 1;  2FB7 A;  1M2V B;  3VS2 A;  1RI9 A;  2BTT A;  2DYB A;  3QUI A;  3M58 A;  4R56 A;  2HSP A;  1YIT Q;  1YJW A;  5A2Q E;  3EH2 A;  2YSQ A;  2I0N A;  1QWF A;  4L6V 5;  1KQ1 A;  2BZY A;  1OPL A;  2HBW A;  1QVF S;  5DM7 R;  3CBP A;  4XU1 A;  1G83 A;  1RAB B;  2J6F A;  1BYM A;  1SSF A;  3WVD B;  1VQ6 A;  3QWX X;  1IGU A;  4BY6 C;  2D0Q B;  2RF0 A;  3M4G A;  4LD9 K;  3V8K A;  5GAN d;  1VQN T;  2A3L A;  3CCJ Q;  2PZ1 A;  1YJN A;  1ZHI A;  4BE2 A;  1MMN A;  3GBQ A;  1UGS B;  5GAN 5;  1S72 T;  1VQ5 A;  2DER A;  3EG0 A;  3L2U A;  1QVP A;  3OW2 A;  5DLQ E;  3TVT A;  3CXC P;  1ZSZ A;  1JEG A;  1M1K R;  1JO8 A;  4FL6 A;  2EPD A;  2P4T A;  4NOY A;  4RTZ A;  1HK9 A;  1Y0M A;  3SWN A;  4D8D A;  2HD0 A;  5GMK j;  4RCC A;  3CCM A;  2ESW A;  2NWM A;  2QAZ A;  2E1H A;  4XTV A;  2AKL A;  3N5B B;  2MWO A;  2QA4 T;  3CC2 A;  2YLC A;  1RAE B;  2VUB A;  1RAG B;  1YWP A;  3TEE A;  2VXE A;  1ABO A;  4L5G A;  4BB7 A;  2QGG A;  1GXI E;  4C0F A;  2KXC A;  1PG5 B;  4M77 G;  3MEV A;  3CC7 Q;  2QGF B;  2KYB A;  2MIO A;  2CP2 A;  1WA7 A;  4M75 G;  2R5A A;  2V1R A;  3X25 B;  2L3S A;  3DKM A;  1N8R C;  4M77 E;  3M57 A;  1Q81 R;  4M77 F;  3RER A;  4BE0 A;  2GCX A;  2LC4 A;  4C8Q A;  1VQP Q;  2AZV A;  1T3L A;  2DXC A;  2XDP A;  2DL8 A;  5FU7 B;  2LX9 A;  2OI3 A;  4J9C A;  2CP6 A;  4WF2 A;  1VQL T;  4MML A;  1O75 A;  1UEC A;  1ZUY A;  3V7S A;  1LPL A;  1JU5 C;  1BU1 A;  1I8F A;  1D0X A;  3M0Q A;  4M4Z A;  2IPO B;  4F7U B;  3JB9 G;  3ZBD A;  1RAI B;  4HCK A;  2VGM A;  5GAM g;  2QTV A;  3OW2 P;  1YJ9 A;  1K9M R;  3VS5 A;  2A36 A;  2H8H A;  3HHT B;  3NTI A;  1SRL A;  4J9I A;  2D1X A;  2RHU A;  3QZ9 B;  2DZC A;  2C06 A;  2ECZ A;  4BI3 A;  1YI2 T;  4CRI A;  2BE9 B;  2CT4 A;  4CC4 B;  3G6E T;  1OZ3 A;  4AFZ C;  1YN8 A;  4C8Q E;  1XOV A;  3JCM e;  3CQT A;  4C8Q F;  4C5H A;  1OU8 A;  4DQ2 A;  5DY9 A;  3CC4 A;  4J9F A;  4K11 A;  1U06 A;  3CCE Q;  1M1K C;  1HSQ A;  3X24 B;  4OB3 B;  3FIF A;  2HZY A;  4IUU A;  2D9T A;  1RAD B;  2SEM A;  4Y92 A;  1UEB A;  2KRS A;  1QKW A;  3FB9 A;  1GCQ A;  2BUD A;  1TXQ A;  2MK5 A;  3RIR A;  4RG2 A;  1M9S A;  1OEB A;  5CQX A;  1QVF P;  7AT1 B;  2DNU A;  3HFO A;  3HFN A;  4N0A C;  2E5K A;  2F5T X;  4KGZ B;  4WTO B;  2MWP A;  4PJJ A;  2CDT A;  1QKX A;  4OVA A;  1KQ2 A;  1H3H A;  3OYB A;  3H0F A;  1M3C A;  5GAN 3;  3QHS A;  4KGV B;  1VIF A;  5FRO A;  1Q95 G;  5L23 A;  2KY9 A;  2MMP A;  4XTU A;  1BI0 A;  1R0C B;  5GAN e;  3DLL A;  3E1S A;  3OA6 A;  2HKQ B;  1QQJ A;  1H8K A;  4ELZ C;  1WHJ A;  5LJ3 j;  1U1S A;  3M59 A;  3JRZ A;  3A8G B;  2X4W A;  1Q81 C;  5GAM h;  5FU7 C;  1TH7 A;  1SHG A;  1YCY A;  2DEQ A;  4QVC A;  1Q82 R;  2ZAE A;  1B34 B;  1I81 A;  2EGE A;  1ABQ A;  1W6X A;  4JRK A;  1O9S A;  2PUK B;  4RKU E;  3CMA A;  4C5I A;  2K7A A;  1VQO T;  4HCB A;  3MO8 A;  1KD1 R;  3JB9 H;  3EFS A;  2COY A;  4B9X A;  2RQR A;  3A8H B;  1XQH A;  3MEA A;  4EIK A;  1K9M C;  1X75 C;  4ZNX A;  2VYT A;  3WXM B;  3EFR A;  2BZX A;  1YHQ A;  5KE3 A;  2LX7 A;  1X6B A;  4LDV A;  2QEX T;  3CCV A;  3HL8 A;  2DKG A;  3RBB B;  4EDU A;  3GPL A;  2JNG A;  5LJ3 d;  4XTX A;  1S72 Q;  4X34 A;  1WXU A;  3J7A F;  2CP5 A;  3C0C A;  1YIT A;  4AG1 C;  3S3O A;  4E47 A;  3UA6 A;  5D6W A;  4XTW A;  3OYH A;  1V76 A;  2RO0 A;  1MV0 B;  1LVK A;  2DL3 A;  1CKA A;  2IVW A;  3EGD A;  5LJ5 g;  2XID A;  1M27 C;  2XG8 D;  2RQT A;  3EG1 A;  4C0Z A;  5GMK e;  4M77 B;  1HJD A;  2COW A;  4KUI A;  2A28 A;  4OMN A;  3QWY A;  5KYU B;  2VV5 A;  1G5V A;  5AYF A;  4M75 B;  2FVU A;  1RAF B;  2CRE A;  2LNH B;  2EBP A;  4HVV A;  3REB B;  4FYV B;  1G3Y A;  1MMA A;  2DIG A;  5I11 A;  1RLP C;  2JXB A;  4DBQ A;  4HCC A;  1OI1 A;  2DXU A;  5KYY A;  3QZ5 B;  3QJ6 A;  3OYN A;  2L5Q A;  1TOV A;  4QQG A;  1WJR A;  3OS0 A;  2QK0 A;  2PTK A;  4E7J A;  1RI0 A;  3UAT A;  3OYM A;  3L2W A;  1NLO C;  3LH0 A;  1Q82 C;  2CYZ B;  2QQ9 A;  5HY6 A;  3M0R A;  4C92 G;  1WJQ A;  5GMK l;  1YIJ T;  3EFO A;  1VQK Q;  3A8L B;  3PE0 A;  1BIA A;  3OMC A;  1NZ9 A;  2LRQ A;  2LQN A;  1VQL Q;  4KUD K;  2VAS A;  2EVR A;  2E4H A;  3EGX B;  1KD1 C;  2ZGW A;  5I2S A;  3FJ5 A;  2RJD A;  1X43 A;  4J83 A;  3M53 A;  3CC7 A;  2HAX A;  4Y28 E;  2M1H A;  1I4K 1;  3OYY A;  1M3B A;  2KQW A;  5GAN g;  1KK7 A;  2L89 A;  1BKB A;  1TUC A;  1M2O A;  1I1J A;  4A4G A;  3CPW A;  3FRN A;  2QI2 A;  1GCP A;  1IRX A;  1VQP A;  1K73 R;  5GAO p;  6AT1 B;  2KNB B;  1Y57 A;  3DB4 A;  4P5N A;  1AHJ B;  4FW2 A;  3V8L A;  3L2Q A;  1FMV A;  1W70 A;  1K0S A;  2EYZ A;  3FLG A;  3AT1 B;  3MEW A;  3G6E Q;  2Y4Y A;  1UDL A;  5GAN 2;  4PJO D;  3QYG B;  4FU6 A;  1Q7Y U;  3FEO A;  4ZTF A;  2L2P A;  4BDY A;  4M78 G;  2QTX A;  3SHW A;  4PL6 A;  2K3X A;  4M75 C;  3JCM h;  1LOJ A;  5CK9 A;  4C5G A;  2J05 A;  2D8J A;  2CH4 A;  3KFV A;  3VYH B;  1VQ8 T;  2LCS A;  3G1J A;  1VA7 A;  1SHF A;  2K79 A;  2GF7 A;  1N27 A;  5KE2 A;  2BZ8 A;  4GY5 A;  2LVM A;  4X9D A;  3MPU B;  2RPN A;  1QW1 A;  4Z88 A;  3MP8 A;  1WHK A;  2GTO A;  1UGQ B;  2DPP B;  2X4Y A;  3H6Z A;  3CD6 A;  4JLI A;  3CCE A;  4Y91 A;  2J06 A;  2O01 E;  4PFZ A;  5J26 A;  2MCN A;  3OYI A;  2NUP A;  5CKH A;  1VYV A;  3CCL T;  1JXM A;  1WQ7 A;  3OYC A;  2YUN A;  1KHC A;  1YP5 A;  3CCQ T;  1VIE A;  3MP1 A;  5LJ3 e;  4N4I A;  2KE9 A;  1QVG S;  1VQ7 A;  5GAN h;  2EQK A;  2PNI A;  1H92 A;  1X2K A;  1HXD A;  3M9Q A;  4JDS A;  3TRE A;  1X01 A;  1WZO A;  3CPW P;  2L3P A;  3CXC A;  1QMC A;  2O31 A;  4A4F A;  3PIP A;  1PRL C;  1UHF A;  1ZUU A;  2LJ1 A;  1W4S A;  3O5Z A;  1YCS B;  3M0U A;  3ZFJ A;  1FX7 A;  4Z8A A;  3TU4 K;  4M7D G;  2HL3 A;  4XAX B;  1D09 B;  3CCR T;  3S3M A;  4OB2 B;  1PHT A;  3S6W A;  3BW1 A;  2DJQ A;  3RNJ A;  3HRU A;  3C12 A;  3JCM d;  5IXB A;  9ATC B;  1RAH B;  1K8A R;  1I5L A;  1K73 C;  1PKT A;  1WXT A;  4F16 A;  2WSF E;  3MP6 A;  4M7A A;  3QKJ A;  3V7C A;  1VQM T;  2YUO A;  2XIC A;  2QEX Q;  4J7F A;  4J8O A;  2LTO A;  5IAY A;  3JCM J;  2DFU A;  2FG0 A;  2A08 A;  1ZUK A;  3VS7 A;  3ASK A;  3H8Z A;  2FRY A;  4CC3 A;  2L0A A;  3MET A;  3G7Z A;  5CKB A;  3SB2 A;  5GAO r;  1RLQ C;  4OMF B;  3JCM c;  1IHW A;  1YJW T;  1KSW A;  2QYZ A;  2EGC A;  3UT1 A;  2JMA A;  2K3Y A;  4RTU A;  2QDY B;  2EIF A;  3EG9 B;  3MJX A;  1NG2 A;  4BI8 B;  2K5I A;  1FMW A;  2HL5 C;  5CVI A;  2E65 A;  5I2M A;  4IIO A;  2KR3 A;  4AG2 C;  3JAM E;  5GMK h;  2V8J A;  3T9N A;  3I56 Q;  1MGQ A;  1JRI A;  4C92 B;  2LQK A;  2E70 A;  1YJN T;  1P92 A;  2WAC A;  5I22 A;  3FDR A;  4BD3 A;  1U5S A;  2RMO A;  2NYS A;  4N4G A;  1VQ5 T;  4YTL A;  4OGC A;  2OTL Q;  4PJO A;  2R58 A;  3I55 A;  3RR6 A;  1C1A A;  4ATO A;  4J6W A;  2E6Z A;  5KYX A;  5KYW B;  4LE9 A;  4JS4 A;  2XDD A;  1R0B G;  3A5Z B;  1GFC A;  2BKD N;  1UGR B;  2I2L A;  4R55 A;  2ZPI B;  1I5O B;  2EYW A;  2HEQ A;  2RJC A;  3FC3 A;  2VXF A;  3JCM X;  2O4X A;  2ZPB B;  5DLO A;  2PU9 B;  2FPD A;  4E7Z A;  5CKF A;  3QYH B;  5IT9 E;  2LP5 A;  1BI2 A;  5GAN 7;  1D3B B;  5CKE A;  4ZN1 A;  3CCM T;  1NJI U;  2GFU A;  1BCO A;  1F1B B;  5IHK A;  2DTI A;  4OMO A;  4ZTJ A;  1M3A A;  4JJN K;  3CC2 T;  2OTJ Q;  3OS2 A;  1QVF A;  4RTY A;  4A4H A;  2E12 A;  3MHX A;  4JRI A;  1Y96 A;  2K3B A;  2QQS A;  2RJE A;  1VUB A;  2DVJ A;  2F69 A;  4IUQ A;  3CME Q;  2JW4 A;  5CCA A;  2E10 A;  1AWX A;  1PRM C;  1TTH B;  1VQ9 A;  5A0G A;  1K8A C;  2L3R A;  4J9E A;  4WCI A;  4RUG A;  3LLR A;  2YWW A;  2CSI A;  4M78 B;  3UA7 A;  1VQK A;  4PJO F;  2EJG A;  2OAU A;  1MMD A;  3X26 B;  5AT1 B;  4J9D A;  2KT8 A;  3VS0 A;  2HBP A;  3EH1 A;  1G3W A;  4IUP A;  3V7R A;  2RB6 A;  4Z02 A;  1B07 A;  1PCX A;  1PD0 A;  4IUT A;  4O5V A;  5LJ5 f;  5CKD A;  2NUT A;  4JRP A;  2KGT A;  1RUW A;  1HYO A;  2EGA A;  2RQW A;  4XU2 A;  2JVV A;  3VV0 A;  2V1Q A;  4F17 A;  4C8Q G;  4JLG A;  1VQ8 Q;  1KC8 R;  2XKO C;  2DVE A;  1X27 A;  3RES A;  1SPK A;  3ZL7 C;  4C92 C;  2RHX A;  1R77 A;  4EMK B;  1YJ9 T;  5HK3 A;  2J6O A;  3CCS A;  3PGG A;  2FL7 A;  1M8V A;  2DBK A;  1XJW B;  2FPE A;  5KCH A;  3FJP A;  5J39 A;  2RI2 A;  1MMG A;  3GOX A;  4ESR A;  1W2B S;  2C0O A;  3CCL Q;  1OOT A;  2M0O A;  4FIB A;  3CCQ Q;  4AT1 B;  4RTW A;  3OYD A;  4KH0 B;  1BIB A;  1OPK A;  4O6J A;  4HCZ A;  4OMP A;  3CC4 T;  3TQ7 P;  2XK0 A;  4M7D B;  2CP7 A;  2CKK A;  2RD1 A;  3MEU A;  2LT4 A;  2KK4 A;  2LJ3 A;  1GBR A;  1PD1 A;  5LJ3 h;  4ME7 A;  2FZC B;  2BIV A;  5FRM A;  3UWN A;  3G71 Q;  3JCM W;  2H3E B;  2LCL A;  5GJV B;  4DA4 A;  1ZLM A;  1K4U S;  4IKF A;  3GNF B;  3E9F A;  3PTA A;  3EG3 A;  2COZ A;  4AFU C;  3CCR Q;  3CCU Q;  4PFO A;  2XD0 A;  2AZS A;  1WGS A;  4M78 C;  2LT1 A;  2EW3 A;  1OU9 A;  1JJ2 S;  4C0G A;  3G4S A;  4D8K A;  2EAY A;  4OML A;  3VJP A;  1EFN A;  2PUO B;  3NTK A;  1BI3 A;  2HCK A;  1VQ4 Q;  3R6O A;  1VQM Q;  2CS7 A;  1UJY A;  1PNJ A;  1D1A A;  1GL5 A; 
#chains in the Genus database with same CATH homology
 3CCU T;  4PNO A;  5I2S A;  3A8M B;  2ZPH B;  4KBM B;  1VQ9 T;  1VQM A;  2RJD A;  3HPW A;  3RMQ A;  4J83 A;  3M53 A;  5IN1 A;  3CC7 A;  4Y28 E;  2M1H A;  2HAX A;  4MDX A;  1I4K 1;  2EWN A;  3OYY A;  3LWH A;  2WSC E;  1Q86 U;  1VQL A;  2KQW A;  3PIO A;  1Q86 C;  2K5L A;  2K57 A;  2G3R A;  2CZ6 B;  2X4X A;  1OZ2 A;  3LX7 A;  3V8J A;  5GAN g;  1NPR A;  3VYG A;  4HKE A;  4JS5 A;  4II1 A;  2L89 A;  1BKB A;  4D6W A;  5CIU A;  3OYK A;  2F5K A;  4M7D E;  2E41 A;  4M75 E;  4M7D F;  1K73 U;  4M75 F;  2E5Q A;  4EMG A;  4A4G A;  1VQK T;  3CPW A;  3CBO A;  2DIQ A;  3FRN A;  1VQ4 T;  1BI1 A;  2QI2 A;  4X9C A;  1VQP A;  3L2Z A;  4FSX A;  1M1F A;  4BUG A;  3VUB A;  4DOW A;  5GAO p;  3AHU A;  2RJF A;  4EMK C;  1M5Q 1;  5M9O A;  1MHN A;  3DB4 A;  2FB7 A;  2JN0 A;  2LDM A;  2DTO A;  4P5N A;  1AHJ B;  4FM4 B;  4VUB A;  2RHZ A;  3V8L A;  3L2Q A;  3NFC A;  3QUI A;  3M58 A;  4R56 A;  1YJW A;  1KC8 C;  3L1A A;  5A2Q E;  3FLG A;  1Y7X A;  3BDL A;  3MEW A;  4IUR A;  2Y4Y A;  3GF5 A;  1IRE B;  4L6V 5;  5LJ5 e;  5GAN 8;  2JTM A;  5GAN 2;  2MI6 A;  1KQ1 A;  4PJO D;  5GMK i;  1YI2 A;  3QYG B;  4C92 D;  4FU6 A;  5GAN 4;  4MZT A;  1Q7Y U;  1YHQ T;  4E7K A;  3FEO A;  4ZTF A;  1H64 1;  3G6E A;  3SD4 A;  1QVF S;  4BDY A;  5DM7 R;  3CBP A;  4M78 G;  4LDW A;  4XU1 A;  3JCM f;  5A0D A;  3JB9 F;  4OGE A;  2X4J A;  1BYM A;  1SSF A;  2QTX A;  3WVD B;  1VQ6 A;  4PL6 A;  4BY6 C;  2HQX A;  4N4H A;  5D6Y A;  2D0Q B;  3RKX A;  4ZGE B;  2KAF A;  3M4G A;  2K3X A;  3V8K A;  4M75 C;  4A4K A;  3JCM h;  5GAN d;  4LD9 K;  1VQN T;  4M7D C;  1LOJ A;  2A3L A;  5CK9 A;  4C5G A;  2LNV A;  3VYH B;  1YIT T;  1YJN A;  4RCB A;  4OP0 A;  4OB1 B;  1ZHI A;  1VQ8 T;  4BE2 A;  2XU8 A;  1UGS B;  5GAN 5;  3CCS T;  2PVD B;  1S72 T;  1VQ5 A;  1X6O A;  3RKY A;  3QPH A;  5HK0 A;  3CCJ A;  2GF7 A;  4XTY A;  1N27 A;  5KE2 A;  3JB9 I;  3L2U A;  2R5M A;  4RG8 A;  1M1K U;  2RI5 A;  2LVM A;  4GY5 A;  1QVP A;  4X9D A;  3SWN B;  3OW2 A;  5DLQ E;  1QW1 A;  4HA8 A;  4UC4 A;  3OQ5 A;  3MP8 A;  4J6X A;  3H6Z A;  1UGQ B;  2DPP B;  2X4Y A;  5CR2 A;  3CD6 A;  4FL6 A;  2GQV A;  2P4T A;  4JLI A;  4Y91 A;  3CCE A;  3I56 A;  4NOY A;  1JBM A;  5D6X A;  1HK9 A;  2O01 E;  2JUF A;  5J26 A;  2E6N A;  1KQS S;  3SWN A;  3OYI A;  3CCL T;  2HD0 A;  2DO3 A;  5CKH A;  1NE8 A;  4C5E A;  5GMK j;  4RCC A;  4XQ3 A;  1WQ7 A;  3OBW A;  3OYC A;  3CCM A;  1KHC A;  2VGN A;  5GAN f;  1VIE A;  3MP1 A;  3JCM g;  3M4Y A;  4LDY A;  4N4I A;  5LJ3 e;  3CCQ T;  1QVG S;  1ZQ1 A;  1VQ7 A;  2E1H A;  4M7A D;  2OTL A;  1U8R A;  4XTV A;  5GAN h;  3KBG A;  3CPF A;  3N5B B;  2MWO A;  2QA4 T;  4MZM A;  3CC2 A;  2EQK A;  4M78 D;  2YLC A;  2ZCF B;  5GAO q;  2VUB A;  4JDS A;  1HXD A;  3M9Q A;  3TRE A;  1X01 A;  3VU3 C;  4C0D B;  3TEE A;  3LWI A;  2VXE A;  4L5G A;  4BB7 A;  1GXI E;  2RM4 A;  3CXC A;  4C0F A;  4A4F A;  3PIP A;  1W4S A;  2MAM A;  2RK2 A;  2DZ9 A;  4M77 G;  3ZFJ A;  5C6S A;  3QJY A;  1FX7 A;  3MEV A;  3L2V A;  4N0A A;  3RUX A;  2EQU A;  2PQW A;  3TU4 K;  4M7D G;  4C8Q B;  4M75 G;  2R5A A;  3G4S T;  2ZPG B;  1VQO A;  4XAX B;  3X25 B;  1Q81 U;  3OSS C;  3CCR T;  2V8K A;  4OB2 B;  3S3M A;  3S6W A;  3BW1 A;  2OTJ A;  1N8R U;  1RL2 A;  3DKM A;  4LD6 A;  1N8R C;  4M7A B;  1WPY A;  1W2B A;  4M77 E;  4XK8 E;  3M57 A;  1Y71 A;  1K8A U;  4M77 F;  4CI0 C;  3HRU A;  3JSC A;  3CME A;  4BE0 A;  2RK1 A;  2GCX A;  2LC4 A;  3C12 A;  4C8Q A;  3JCM d;  3L2R A;  3RER A;  2KSS A;  3BY7 A;  4ZN3 A;  3CMA T;  2DD5 A;  3WVE B;  1I5L A;  1K73 C;  2WSE E;  2DXC A;  4BI4 A;  2XDP A;  2WSF E;  3MP6 A;  5FU6 B;  5FU7 B;  4M7A A;  5FRN A;  2LX9 A;  3QKJ A;  3ME9 A;  3V7C A;  1VQM T;  5GAM j;  2XIC A;  5I21 A;  4J7F A;  4J8O A;  2RA2 A;  3CC7 T;  2LTO A;  5IAY A;  4WF2 A;  3JCM J;  4L59 A;  1VQL T;  2P0P A;  4MML A;  2DAQ A;  1O75 A;  3V7S A;  1WQW A;  1I8F A;  4J5Y A;  3CEY A;  2YHT A;  2EKO A;  4F7U B;  2QEX A;  3JB9 G;  3ZBD A;  3ASK A;  3QSU A;  3H8Z A;  2VGM A;  3MET A;  4DOV A;  4TVR A;  2K2V A;  3OYL A;  5GAM g;  1VQP T;  4A54 A;  3G7Z A;  4B9W A;  5CKB A;  4EMH A;  1YJ9 A;  3BDU A;  1Q7Y C;  4OB0 B;  2GFA A;  3PMI A;  3SB2 A;  5GAO r;  3OSV A;  4F7U A;  3HHT B;  4OMF B;  4M77 C;  3NTI A;  3JCM c;  2ZZD A;  3GP8 A;  3CCV T;  1YJW T;  2H3J A;  3LGL A;  3LW5 E;  3UT1 A;  2RHY A;  2DD4 A;  1PSE A;  2RHU A;  2K3Y A;  1M1G A;  3QZ9 B;  4M7D D;  2ZPF B;  3F70 A;  4M75 D;  2DZC A;  2QDY B;  3M56 A;  4J6Y A;  1JJ2 A;  3PFS A;  2EIF A;  2C06 A;  3QBY A;  1FXX A;  3SWN C;  2RH2 A;  4BI3 A;  4PLL A;  1YI2 T;  3HSB A;  3J81 E;  1QP3 A;  4CRI A;  4A53 A;  4MZP A;  4BI8 B;  2K5I A;  4XU3 A;  5CVI A;  3OB9 A;  2EJ9 A;  2E65 A;  2RI3 A;  5I2M A;  5FLX E;  5LJ5 j;  1ZBX A;  3G6E T;  2CGH A;  1G3T A;  2D6F A;  1OZ3 A;  4QQ6 A;  4C8Q E;  3JAM E;  1XOV A;  3JCM e;  5GMK h;  4C8Q F;  2XHC A;  4C5H A;  2V8J A;  4DQ2 A;  3CC4 A;  5DY9 A;  2NLU A;  2DXT A;  3A8O B;  3T9N A;  1M1K C;  3X24 B;  4OB3 B;  3OYF A;  4PJO B;  4FT4 A;  1MGQ A;  3FIF A;  1JRI A;  4C92 B;  4GLK A;  3OBY A;  2LQK A;  2E70 A;  4OF1 A;  1YJN T;  4IUU A;  2D9T A;  1P92 A;  1UEB A;  2WAC A;  2ZPE B;  1WJS A;  4ELY C;  3FDR A;  3FB9 A;  2LQ8 A;  4BD3 A;  2BUD A;  3C95 A;  4N4G A;  2K5F A;  5GAM d;  4YTL A;  1VQ5 T;  3RIR A;  4RG2 A;  4OGC A;  1M9S A;  2O4X B;  3QG1 A;  3CCJ T;  4PJO A;  5CQX A;  1EIF A;  2R58 A;  3I55 A;  4NL3 A;  3P8H A;  3HFO A;  1QP2 A;  4C92 A;  3KXT A;  3KUF A;  4J6W A;  3CPW S;  3JB9 D;  3HFN A;  4N0A C;  4ATO A;  2E6Z A;  1IZ6 A;  1KG1 A;  2F5T X;  2XDD A;  4C0D C;  3A5Z B;  2MWP A;  2BKD N;  3M55 A;  1UGR B;  4JS4 A;  2I2L A;  5CQY A;  2B8A A;  3RKW A;  4R55 A;  2ZPI B;  3GLX A;  3X20 B;  2LCC A;  3J80 E;  4OVA A;  2RJC A;  1KQ2 A;  3FC3 A;  2VXF A;  3JCM X;  2FHD A;  2O4X A;  2ZPB B;  2VC8 A;  4QVZ A;  3OYB A;  2KMT A;  3CCE T;  3CD6 T;  3I56 T;  5DLO A;  3QHS A;  2PU9 B;  4F7U E;  5GAN 3;  2JOY A;  1G3S A;  4F7U F;  3C94 A;  1VIF A;  2DK3 A;  3OYE A;  5FRO A;  1V29 B;  3E19 A;  3HKS A;  3MCA B;  4QQD A;  5CKF A;  3QYH B;  2KY9 A;  2MMP A;  5IT9 E;  2FYK A;  1BI2 A;  5GAN 7;  4XTU A;  1D3B B;  5CKE A;  4C8Q C;  4ZN1 A;  1BI0 A;  5A0L A;  3CCM T;  1NJI U;  2GFU A;  3JCM V;  1NJI C;  1Y96 B;  2YLB A;  5GAN e;  3DLL A;  3E1S A;  1VQ7 T;  3G71 A;  3VUZ A;  1YIJ A;  3OA6 A;  3JCM P;  2DTI A;  2HQE A;  2PVG B;  2OTL T;  4M7A C;  1UGP B;  4ELZ C;  4ZTJ A;  1YBY A;  2QXF A;  4JJN K;  2EFI A;  3CC2 T;  5LJ3 j;  3OS2 A;  1D3B A;  1U1S A;  3M59 A;  3ZEH A;  5GAM f;  3OY9 A;  1QVF A;  3JRZ A;  4HT8 A;  3LGF A;  4A4H A;  2E12 A;  3MHX A;  4JRI A;  1Y96 A;  2QQS A;  3A8G B;  2RJE A;  5LJ5 d;  1VUB A;  2F69 A;  4IUQ A;  2X4W A;  5CCA A;  2RHI A;  3O8V A;  3HRT A;  5FU7 C;  5FU6 C;  1TH7 A;  5HKC A;  5GAM h;  2E10 A;  1Q81 C;  3CCU A;  1YCY A;  2DEQ A;  1VQ9 A;  5GAN 6;  4QVC A;  5A0G A;  4Q5W A;  1B34 B;  2MF2 A;  2EJF A;  1I81 A;  4MMK A;  5J3B A;  1K8A C;  2L3R A;  3ER0 A;  4BDZ A;  2R57 A;  3P8D A;  4JRK A;  3JCM Q;  1O9S A;  3LLR A;  3S3N A;  2PUK B;  4M78 B;  4RKU E;  4EPC A;  3JB9 J;  2L8D A;  2XI9 A;  3CMA A;  4JRQ A;  4C5I A;  1VQK A;  4PJO F;  2EJG A;  4PKC C;  3OYA A;  1B34 A;  1VQO T;  4C92 E;  2OAU A;  3OW2 S;  1VQ4 A;  4E7L A;  2JTF A;  4C92 F;  3OYG A;  3X26 B;  2KVQ G;  3SDZ A;  2OTJ T;  4HCB A;  1FWZ A;  3MO8 A;  4IUV A;  3JB9 H;  3SFM A;  3EFS A;  3OYJ A;  2HBP A;  4M78 A;  2HNI A;  4FT2 A;  1WNL A;  4B9X A;  3P8B B;  3CME T;  1R8O B;  1G3W A;  4LDU A;  2QQR A;  3A8H B;  4IUP A;  1XQH A;  3MEA A;  2Y90 A;  3V7R A;  1XTD A;  2RB6 A;  3L42 A;  4Z02 A;  1KQS A;  3QXE B;  2CZ7 B;  4IUT A;  4O5V A;  3HRS A;  2QQA A;  5LJ5 f;  1K9M U;  1K9M C;  5CKD A;  3OS1 A;  2XDB A;  1X75 C;  2CZ1 B;  2DXB A;  4JRP A;  4BAC A;  2VYT A;  3TCJ A;  3WXM B;  3EFR A;  1YHQ A;  1QVG A;  5LJ5 h;  1N6A A;  4XU2 A;  3RMS A;  4M77 D;  5KE3 A;  3OMG A;  4LDV A;  1KC8 U;  2JVV A;  3VV0 A;  1OYX A;  2QEX T;  3CCV A;  3HL8 A;  2DKG A;  4C8Q G;  4JLG A;  4QVD A;  4EDU A;  4ZGJ B;  3GPL A;  2JNG A;  5LJ3 d;  3EAE A;  4XTX A;  1VQN A;  2XKO C;  2DVE A;  3CXC S;  4PJO C;  3RES A;  5GAO n;  4X34 A;  3J7A F;  4C92 C;  4EMK B;  2RHX A;  1YJ9 T;  4M7A G;  2A7Y A;  4E7I A;  1YIT A;  3S3O A;  4E47 A;  1VQ8 A;  5CO7 A;  5HK3 A;  5LL6 S;  3CCS A;  3PGG A;  1M4Z A;  2X35 A;  1S72 A;  1XNI A;  2CZ0 B;  4LDX A;  2FL7 A;  2Y4X A;  3NTH A;  1VQ6 T;  5EG2 A;  5CAI A;  5D6W A;  3GNG A;  4XTW A;  5GAO l;  1M8V A;  3OYH A;  2IG0 A;  5KCH A;  4EMK A;  2K4Y A;  2RO0 A;  4NS5 A;  1H3Z A;  3FJP A;  5J39 A;  2DTH A;  4M7A E;  2PVO B;  4M7A F;  2DJZ A;  2RI2 A;  3GOX A;  1W2B S;  2P0Q A;  4KUL A;  5L8R E;  2IVW A;  5LJ5 g;  1DJ7 B;  1M90 U;  2XID A;  2M0O A;  5GMK e;  2XG8 D;  4C0Z A;  1M90 C;  2AHJ B;  2EQJ A;  4FIB A;  4M78 E;  4M77 B;  4M78 F;  5GAO m;  3OYD A;  1BIB A;  2EQM A;  4NL2 A;  3VKI A;  4O6J A;  4F7U G;  1U1T A;  4KUI A;  4BE1 A;  3QII A;  4HCZ A;  4KT0 E;  3BFM A;  5KCO A;  2YRV A;  3CC4 T;  4BY6 B;  3CCL A;  2VV5 A;  5C0M A;  2XK0 A;  4M7D B;  1G5V A;  5AYF A;  4M75 B;  2CKK A;  2FVU A;  2RD1 A;  3DB3 A;  5LJ3 f;  3MEU A;  3E9G A;  3URG A;  3CCQ A;  2LT4 A;  2KK4 A;  1Y07 A;  3C4S A;  3LYI A;  4HT9 A;  4M77 A;  3GIB A;  1G3Y A;  5LJ3 h;  2DIG A;  3CBM A;  4ME7 A;  4RMO A;  2BIV A;  2JZ2 A;  2QA4 A;  5FRM A;  4HCC A;  2M9U A;  2QQB A;  3QDR B;  3UWN A;  4M7D A;  3JCM W;  4M75 A;  1OI1 A;  2DXU A;  3PMT A;  1JB0 E;  3QZ5 B;  2LCL A;  5KH6 A;  4A4E A;  3I55 T;  3QJ6 A;  1LJO A;  4C8Q D;  3OYN A;  2L5Q A;  3DLM A;  4ZGD B;  4DA4 A;  4QQG A;  4E7H A;  3UDC A;  4IKF A;  3GNF B;  3HP9 A;  3INZ A;  1WJR A;  1UB4 A;  3QO3 A;  3E9F A;  3M5A A;  3OS0 A;  3PTA A;  3JCM b;  4E7J A;  1RI0 A;  2EYQ A;  3X28 B;  4PLI A;  3OYM A;  4V2S A;  3L2W A;  2XD0 A;  3M54 A;  2M16 A;  3LH0 A;  4QW2 A;  4XU0 A;  1NPP A;  1WGS A;  4M78 C;  2P0K A;  1Q82 U;  2LT1 A;  1Q82 C;  1JJ2 S;  4C0G A;  2CYZ B;  2QQ9 A;  4PJO G;  3G4S A;  2EAY A;  5HY6 A;  3VJP A;  3CCR A;  4C92 G;  1WJQ A;  5GMK l;  3G71 T;  1YIJ T;  1LNX A;  4XTZ A;  3Q1J A;  3UPU A;  2PUO B;  3NTK A;  2E64 A;  3PT9 A;  3OS5 A;  1BI3 A;  2KDS A;  4JUV A;  1N9R A;  4MDW A;  2V8I A;  4J7I A;  3A8L B;  5LJ3 g;  1BIA A;  3OMC A;  1NZ9 A;  5GAN j;  2LRQ A;  3R6O A;  1N9S A;  1KHI A;  2CS7 A;  5GAM e;  1PSF A;  4PJO E;  4KUD K;  3PNW C;  5GMK m;  1KD1 U;  1KD1 C;  2ZGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...