2FRWA

Solution structure of the second sh3 domain of human adaptor protein nck2
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
57
structure length
57
Chain Sequence
IPAFVKFAYVAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQIGWFPSNYVLEEVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic protein NCK2
publication title Structural Insight into the Binding Diversity between the Human Nck2 SH3 Domains and Proline-Rich Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 5
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2frwA00
2GTOA 2NUZA 4CC4B 2DM1A 4AFUC 2DL7A 2KRSA 2LP5A 2RMOA 1SHFA 3ZL7C 3PVQA 1UUEA 1WYXA 1H3HA 2YT6A 4AFQC 1ZUKA 4OMPA 4DEXA 1Y0MA 4HVVA 1PRLC 1M3AA 2FEIA 2LJ1A 3M0UA 2D0NA 1QKXA 3TVTA 1SHGA 4KRTA 2KT1A 3REAB 1FYNA 1VA7A 2EW3A 1X69A 2CSIA 2LX7A 3IQLA 2EPDA 4JZ4A 4X1VA 3VS6A 1HJDA 1GCPA 2EKHA 1K4US 2KROA 2FPFA 1WXUA 1WA7A 1U06A 3REBB 5I22A 1GCQA 2EYXA 1PRMC 2MIOA 2DILA 1TUDA 1SRLA 2LJ0A 4A63B 1GL5A 4OMOA 3M0TA 2DYBA 2PZ1A 1AWOA 2EQIA 2B86A 1ZX6A 1YWPA 2C0IA 2FRYA 4D8KA 2J05A 1E6GA 2D8HA 2J7IA 2JTEA 1E6HA 3VS0A 3UF4A 2FG0A 4J9EA 2YDLA 4Z8AA 1EFNA 4JJDA 2ESWA 4OMQA 1VYTA 2GNCA 2HBWA 4J9IA 1WFWA 2K79A 3M0RA 2PTKA 2ROLA 2DX1A 1NYGA 1W1FA 1T0JA 2DF6A 3GBQA 4J9GA 4AFZC 1AZGB 2ROTA 1JXMA 3I9QA 4JJBA 1OPLA 4OMLA 3TSZA 3JV3A 1RLQC 4J9BA 1PWTA 2DL8A 2L2PA 1U3OA 2QDLA 4CC7A 2DA9A 2RPNA 3SHWA 2L0AA 2J06A 2EBPA 3QWXX 4LUDA 2DRKA 5EC7A 4DEYA 1TG0A 1X43A 1PHTA 5FWBA 4OMMA 2KE9A 3RNJA 4EIKA 1K0SA 4RTWA 2JMCA 1J3TA 1SEMA 2EYYA 2CUBA 1U5SA 1WXTA 2O9VA 1HD3A 2KEAA 1T3SA 2RQRA 2KGTA 1KIKA 2CSQA 1UE9A 2EYZA 1ZUYA 2D1XA 1SRMA 1UGVA 4CC2A 2ED1A 2DL4A 1GFCA 2FO0A 3M0SA 2CDTA 2HDAA 2HSPA 1Y57A 1S1NA 2YUQA 4LN2A 1NLPC 2GTJA 2MOXA 1MUZA 1CKAA 1JXOA 3NHNA 4J9DA 1OOTA 2DL5A 4RUGA 2CREA 2SEMA 2PNIA 1NLOC 1QWEA 2KNBB 3EG3A 3QWYA 3UA6A 1MV0B 1NG2A 2LQNA 3UATA 1K76A 2K2MA 3EG2A 2O88A 2OI3A 2W0ZA 2JMAA 2JT4A 3H0HA 3U23A 1QCFA 1M27C 3UA7A 3H0FA 4JPBW 2FPEA 1OPKA 5IH2A 2HCKA 3EHRA 1WDXA 2ABLA 2FRWA 2NWMA 1BB9A 1AWWA 2DLPA 2V1RA 2JW4A 2EVRA 2KXCA 2C0OA 2J6FA 4WCIA 1GRIA 1UDLA 4ZNXA 2K7AA 1RI9A 1ZBJA 1JO8A 3VS4A 1VYUA 1KSWA 2VWFA 1KFZA 1E7OA 2BTTA 1ARKA 4J9HA 4OMNA 5GJWB 2X3WD 4RTZA 2DRMA 1PKTA 2DL3A 1G2BA 1GBRA 1WLPB 3LH5A 1OV3A 2L3SA 2RQTA 1M30A 5GJVB 2A36A 4FSSA 1PNJA 1H8KA 4F17A 1MV3A 2KR3A 3M0QA 4HVUA 1AOJA 2FPDA 2CH4A 1BK2A 2YUNA 1CSKA 4LUEA 1BU1A 2DNUA 3H41A 4RTUA 5I11A 2KBTA 2DVJA 2G6FX 1FMKA 1QLYA 1WXBA 2GQIA 4QT7A 3C0CA 3EHQA 5FWCA 2F2XA 1AZEA 1X6GA 2EGCA 1ABOA 1M3CA 2YUPA 4HCKA 2O9SA 4ESRA 5L23A 1AWXA 2XMFA 1AD5A 3CQTA 1AEYA 2OJ2A 2YSQA 1JU5C 5IHKA 5ECAA 2GGRA 2A08A 1K1ZA 2YUOA 1NEBA 4F14A 1QWFA 3A98A 1ZSGA 3TSWA 4RTTA 2KRNA 4J9FA 2JM9A 2DE0X 5IHIA 1UJYA 2JS0A 2K9GA 1YN8A 4JZ3A 3KFVA 3VS2A 3RBBB 2V1QA 4M4ZA 1M3BA 2ECZA 4Y92A 1X27A 1X2QA 4HXJA 1ZUUA 1B07A 2OAWA 1YP5A 3NMZC 1KJWA 2JS2A 2M51A 1AVZC 1NYFA 2L3PA 2AKLA 2K6DA 4Z89A 3NPFA 3VS3A 1UHCA 1I07A 2BZYA 2F2WA 1ZLMA 1I1JA 2I0NA 2LZ6B 1N5ZA 1HSQA 4AFSC 4GLMA 2EGAA 2C0TA 4D8DA 3H0IA 2VKNA 2J6KA 1W6XA 3PE0A 4AG1C 2ENMA 3EG0A 2CT3A 3VRZA 2X3XD 2L3QA 1RUWA 2DMOA 2D8JA 1BBZA 1VYVA 2ED0A 4IIOA 4ORZA 3VS5A 4LE9A 1YCSB 2DJQA 4R0KA 2EYWA 3VS1A 1UJ0A 2JM8A 2AZSA 4Z88A 1K9AA 2EGEA 4AG2C 3THKA 2SRCA 2RQWA 4IIMA 3R6NA 1YNZA 1PKSA 4JJCA 1H92A 2LQWA 1WI7A 2O31A 2M0YA 1OEBA 2LNHB 2CH4W 2A28A 2CUDA 1LCKA 1UG1A 1GCQC 5HCKA 4GBQA 1JEGA 3O5ZA 4K11A 4F16A 1I0CA 1Z9ZA 2KYMA 2DBMA 2F2VA 1QKWA 1TUCA 2JXBA 1RLPC 1AWJA 3VRYA 1UTIA 2DBKA 3I35A 2E5KA 2LJ3A 2CT4A 3NGPA 2RNAA 2K3BA 5IXFA 1K0XA 3ULRB 1UECA 2IIMA 1W70A 2AKKA 1NM7A 1XOVA 2AK5A 2MCNA 2KXDA 3M0PA 1Z9QA 4LNPA 5FW9A 1B3QA 1A0NB 5IXBA 1T3LA 3SEMA 3VS7A 2RQUA 2KT8A 2RQVA 1JQQA 1GBQA 3I5RA 3I5SA 3PVLA 1X2KA 4J9CA 4RTVA 1GFDA 1SPKA 1IO6A 4CC3A 1X6BA 4HVWA 4E6RA 2VVKA 1NEGA 2KRMA 2RN8A 1ABQA 3EG1A 4RTYA 1M8MA 1WIEA 2KYBA 2H8HA 2LCSA 1CKBA 2J6OA 3FJ5A 2HEQA 1UFFA 5IHNA 1UHFA 1V1CA 1G83A 2LMJA 2O2OA 2GBQA 3EGUA 4RTXA 2AZVA 1WX6A 1YWOA 2BZ8A 2BZXA 2A37A 2RF0A 2W10A 1SSHA 2P4RA 1T0HA
chains in the Genus database with same CATH superfamily
2GTOA 5CO7A 2DL7A 2KI7A 2KRSA 3X26B 1LVKA 1R77A 1SHFA 2K4YA 1UUEA 1WYXA 4IUVA 4PFZA 1QMCA 4FYXB 4M7DA 5KYNA 3MJXA 1Q82U 2LDMA 5LJ5g 5GAN8 1F1BB 4Y91A 5A2QE 1RAHB 4DBFA 2L3RA 1YIJT 4N4IA 3RUXA 4M7AE 5KYXA 2LX7A 1QVFP 3IQLA 4QVCA 1UGRB 1HJDA 2OTJQ 3CD6A 2FPFA 4EMKA 4L6V5 4OB1B 3CCSA 5CKBA 1KQ2A 4BI3A 3I56T 3L42A 2EYXA 5CIUA 1PRMC 3HKSA 2ZCFB 1Q86C 2DILA 1TUDA 1GL5A 1YFNA 4FYVB 1M1FA 1YCYA 2DYBA 4M7AB 2DXTA 2ZPGB 1Q7YR 2FRYA 5DLOA 3JCMW 1X75C 2J05A 1E6GA 1JRIA 2DAQA 3VS0A 2PUKB 1VOMA 1VQ7Q 4BY6B 1N8RU 4Z8AA 1SF9A 5LJ3h 1VQ9T 3MP8A 2O01E 2GNCA 4E47A 3JRZA 2QI2A 2X4YA 3HHTB 2BIVA 3CCVA 4HCBA 5GMKi 5GAOl 1C6VX 3OYLA 2X4XA 4J9GA 4AFZC 1M2VB 3V8KA 4DBHA 2QA4T 3I9QA 4JJBA 4IUUA 1OPLA 1FMVA 4C92C 3EG9B 4OMLA 2RA2A 4PKCC 2D6FA 4PJOD 2DL8A 2L2PA 4CC7A 3PFSA 2RPNA 3SHWA 2J06A 4NL2A 1VQ8T 4OVAA 5EC7A 4X34A 2DRKA 2HZYA 1TG0A 3RESA 1X43A 3CCJA 1HXDA 3G6EQ 2M16A 2QEXQ 4XTYA 2P0KA 3EGDB 4RTWA 4YTLA 2LCCA 1U5SA 1T3SA 2A0FB 3E1SA 1M5Q1 3HP9A 3OYKA 1VQ4A 4EDUA 3BW1A 4OGCA 4KBMB 4TVRA 2F5KA 3G1JA 5GAMh 1B7TA 2ED1A 3M0SA 2HDAA 4JRKA 1Y57A 4B6MA 1M1KU 1S1NA 4C92G 1YI2T 1Q82C 3M4YA 5GAN7 3CCLT 1M2OA 2QK0A 4NOYA 1RAAB 4MMLA 3V7RA 3L2VA 1TOVA 3OW2A 3EG2A 2O88A 1R0CB 2OI3A 4PJLA 5GANd 1QCFA 3UA7A 2FPEA 4PLIA 5IH2A 2ABLA 4XTUA 3VYGA 2FRWA 2E1HA 2PQWA 2OTLA 4XU2A 2E10A 3CC2T 5CQYA 4WCIA 1YJ9A 1PG5B 1GRIA 4LXCA 4AMCA 5LJ3g 1KSWA 5GANh 3OYMA 3G7ZA 4FYYB 4M7DD 4J9HA 1IRXA 4OMNA 5GAN5 1GBRA 1OV3A 2MWPA 3JB9G 4KUIA 5GJVB 2A36A 1PNJA 1WGSA 2M1HA 2DEUA 1JJ2P 4QQDA 1WJRA 1MV3A 2CZ0B 3M0QA 1I5LA 2XIDA 2FPDA 5GMKh 2YUNA 4N0AC 3NTKA 3C94A 2P0QA 4J6XA 4FW2A 2DXCA 2QG9B 2HL5C 1VQMA 4FSXA 1ZBXA 2GF7A 4J83A 1B34B 2H3JA 3QSUA 5GAN2 1Y96B 1W2BA 3M57A 2VYTA 1M3CA 3RIRA 2DIGA 3UT1A 4QKUA 4KH1B 5L23A 1AWXA 2PVDB 2XMFA 1AEYA 2OJ2A 1Y07A 1JU5C 2LNVA 3S3NA 5ECAA 3S6WA 4C0ZA 2YLBA 5C0MA 1M9SA 5GAMg 1S72A 1D1AA 1K1ZA 2LC4A 2YUOA 4DQ2A 2E4HA 1YITT 1NEBA 1BCOA 3OW2S 1QP3A 5IHIA 1YN8A 2IG0A 3GP8A 4C8QF 3OYEA 3OYJA 2HMAA 3RBBB 2V1QA 2ECZA 5CKHA 1U8RA 3G71Q 1B07A 1M1KC 2GFAA 3OBYA 1KJWA 3JCMP 3CC4T 2QGGA 4C8QG 2L3PA 3QXEB 3JCMd 5LL6S 3CCRT 1I07A 1WHGA 2KY9A 2JTMA 4QQ6A 8AT1B 1IREB 1N5ZA 1YHQQ 1HSQA 4D8DA 3LGFA 1MMGA 2FZGB 4XTVA 4HCCA 2R5AA 5GANg 1G3SA 1RUWA 2DMOA 2D8JA 2M0OA 2LQKA 1OU9A 1VYVA 2A3LA 1BKBA 2DJQA 2I2LA 4Z88A 1K9AA 3THKA 3I56Q 4BE0A 3R6NA 4PNOA 1H92A 1GXIE 1WI7A 2QYZA 4F7UG 2CUDA 5IN1A 1GCQC 2K3XA 4GBQA 1JEGA 4K11A 3CMET 2JTFA 3CCQA 4M77F 5KCHA 1W2BS 4MDWA 1TUCA 2K57A 1KC8U 3E9FA 2DEQA 3VRYA 1UTIA 2DBKA 4M78F 1XQHA 2CT4A 4M7AA 1VQ9Q 4M77G 3CEYA 2RJFA 1RACB 4JRPA 1MMAA 1UECA 3MEVA 2RI2A 3A8LB 3CPWS 5AT1B 3CXCA 4M78G 3CCVT 1N9RA 2YRCA 1XOVA 3GNFB 2AK5A 2DK3A 3M0PA 3CC7T 4KUDK 4LNPA 3H6ZA 2RHIA 2CP2A 2WSEE 1VQ6A 4NS5A 5DY9A 2VV5A 5I2MA 1KQSA 1VQ5T 3JCMb 3VS7A 2HKNA 4C5GA 4RTVA 3N5BB 2QDYB 1UGPB 1WHHA 5GAN4 1EIFA 3OS0A 1QW1A 3L2ZA 4J8OA 2RN8A 3EG1A 3S3OA 4C8QD 1M2VA 2KQWA 1JBMA 1TUGB 5D7UA 3EG9A 3PMIA 3JB9I 3VV0A 1UHFA 1V1CA 5FRNA 2LMJA 2V8KA 4P5NA 4PK4A 1YWOA 3C12A 1TS9A 1WZOA 2W10A 1SSHA 3SWNC 4FT4A 3CCUA 2DM1A 4IKFA 2LP5A 2OX7A 1M1GA 2VC8A 2PU9B 2RMOA 3EGDA 4E7JA 4M75F 1H3HA 2COYA 3I55Q 3JB9H 3CCLQ 2YT6A 2WSCE 5GAOp 4OMPA 1OX8A 5A0DA 2D0NA 3Q1JA 1QKXA 1WHJA 4M75G 3MEWA 1QVPA 3FB9A 2M02A 1VQLA 2E3HA 1FYNA 3NTHA 2CSIA 2DXBA 3X20B 2EWNA 3DB4A 4X1VA 1D3BB 2OTLT 2RH2A 3CC2Q 3WXMB 2O4XB 1MHNA 4A4GA 1UGQB 2LRQA 3REBB 2XKOC 2QQ9A 1NJIC 3X24B 2LJ0A 3G4SQ 4EMGA 2X35A 3M0TA 2FVUA 3OS1A 3WVDB 2DZCA 4M78D 4D8KA 3QYHB 1KQSS 2JTEA 1E6HA 3G4SA 4A4HA 3HFNA 3L2QA 5D6YA 2CKKA 3QG1A 3M59A 4J9EA 2YDLA 3WVEB 2DERA 2JN0A 3GPLA 2V26A 1X01A 4PJOC 4J9IA 4XQ3A 2EQMA 1K8AC 1OQKA 2PTKA 5CVIA 2DX1A 1OULA 1T0JA 2PVGB 2VB6A 3RERA 3C95A 3VUBA 1Q95G 1RAIB 3V7SA 5KH6A 1WNLA 1XTDA 3ME9A 6AT1B 5J26A 4A4EA 4J9BA 1PWTA 2QDLA 5CCAA 3QWXX 3LW5E 2YHTA 1B34A 4DEYA 5KYWB 2DTOA 4F7UB 4E7LA 1PHTA 1Y96A 5A0LA 3RNJA 1IZ6A 4C0FA 3VJPA 2EYYA 3MO8A 4PJOG 3HRUA 3R6OA 3CCEA 3QZ9B 2HL3A 1WHLA 4M75D 4IUQA 4MZTA 4DOVA 4CC2A 3CC4Q 3UPUA 1GFCA 2FO0A 1RABB 1LJOA 2BE9B 2YUQA 3CCRQ 1NLPC 2RI5A 2DO3A 2RM4A 1D1BA 2KAFA 1JXOA 3NHNA 4J9DA 4KT0E 1OOTA 3QBYA 1NPRA 2DL5A 2SEMA 1VQNT 1NLOC 2LQNA 1W2BP 4OGEA 1ZA2B 1K76A 4IURA 1MNEA 2ZAEA 4KGXB 3U23A 4ZTJA 4JJNK 3H0FA 4R55A 1OPKA 5AYFA 2HCKA 2QQRA 2DLPA 2L8DA 2X4JA 1Q7YC 3F70A 2OTJA 4Y28E 4OB3B 2MF2A 4ZNXA 3M4GA 1JO8A 1VYUA 4B9WA 4JRQA 2FB7A 2RK1A 1ARKA 3KUFA 2AIRB 2YRDA 2DL3A 4M7DF 3OMCA 1WJSA 4J5YA 4MDXA 1R0BG 3C4SA 4FSSA 3HFOA 2DFUA 4F17A 5A0GA 2RI3A 2RJEA 1K73R 1C1AA 3X28B 2QGFB 4BB7A 4M7DG 2CH4A 1VQ7A 2EKOA 4LUEA 3JCMe 1VQKQ 3H41A 5CQXA 3M53A 1PM3A 4JUVA 1RAEB 2BKDN 3OYDA 1PD1A 3CC7Q 3LH0A 2E5QA 4FCYA 1VQKA 2EIFA 3EHQA 3JCMf 5KCOA 2QQAA 2L5QA 4FM4B 2EGCA 3QIIA 1ABOA 2YUPA 2EQKA 1MNDA 2O9SA 1YJNT 1SKUB 4IUTA 3L2WA 1P92A 2F69A 3UWNA 2HQHA 5IHKA 1YJWT 2GGRA 2A08A 2VXEA 1OZ3A 2XDBA 3GLXA 4KGVB 3A98A 2DTHA 2DE0X 3V8JA 1Q81R 3JCMV 4NL3A 3G6EA 2RHUA 2QEXA 4JZ3A 4E7HA 2XI9A 2BUDA 3M54A 4M4ZA 3EH1A 1X27A 2LQ8A 2M9UA 1UEBA 4HXJA 2DZ9A 2OAWA 5GAN3 1YP5A 1OX9A 4A54A 3CXCP 2AKLA 2K6DA 4ZGEB 4ZGJB 1MGQA 1UHCA 4J7IA 2MK5A 3VS3A 4E2FB 3L2RA 2F2WA 1ZLMA 2B8AA 1I1JA 2R5MA 1D1CA 1NZ9A 2LZ6B 4X9DA 2V8IA 1PD0A 3TU4K 2VGMA 3H0IA 1KQSP 1H3ZA 2J6KA 3QJYA 4JDSA 3T9NA 3EG0A 4PJOE 4O5VA 1QVGP 1VQLT 1U1TA 1VIEA 1IHVA 3TCJA 3A8OB 7AT1B 4D6WA 1W4SA 4BD3A 2DETA 3CCMQ 2FZCB 3QYGB 3VS5A 1PSEA 1IGUA 2JM8A 2AZSA 4IIMA 1TSFA 1PKSA 3CCMA 4PJOB 3UDCA 2LQWA 2O31A 1VUBA 2M0YA 1IHWA 1OEBA 3OS5A 1VQPQ 2CH4W 2A28A 2QQBA 1XNIA 1ZHIA 3OB9A 1UG1A 1D3BA 2GFUA 2XD0A 1V76A 1I0CA 1Z9ZA 2O4XA 2F2VA 2DTIA 2XU8A 1RI0A 1ZQ1A 3VKIA 2RO0A 1VIFA 4N0AA 3CMAQ 1I81A 4ME7A 3I35A 2JZ2A 3HL8A 3PTAA 4ZTFA 5IXFA 1M8VA 1WHMA 1XJWB 5KE3A 3LGLA 5HKCA 3DB3A 2ZPBB 2XICA 4C8QC 2MCNA 2L89A 3OY9A 3EFOB 1N8RR 1QP2A 3RKYA 3OQ5A 3OSVA 3ZFJA 2JVVA 3OYAA 5J39A 2RQUA 1VQOT 5KE2A 3I5RA 1GFDA 5LJ5e 2IVWA 1KHCA 3QZ5B 4RKUE 2E6ZA 3M9QA 1IO6A 4KH0B 3J81E 1X6BA 4HVWA 3JB9J 2DJZA 2KRMA 1ABQA 3VU3C 3A8GB 3CPWA 1D0ZA 3TQ7P 5DM7R 2LCSA 1QVFA 2J6OA 3AHUA 3FLGA 3FJ5A 1K9MR 2HEQA 5LJ5f 1UFFA 2F1LA 4RTXA 5IAYA 3EGUA 1WX6A 2QASA 2BZXA 4F04B 1FMWA 4ATOA 1T0HA 5KYWA 4F7UA 2NUZA 4HKEA 3SB2A 4CC4B 3MHXA 9ATCB 3G71A 3ZL7C 2G3RA 5CAIA 2NUTB 1ZUKA 5J3BA 3LYIA 1Y0MA 1PRLC 1VQNQ 1M3AA 2FEIA 3TEEA 1YIJQ 2LJ1A 3FRNA 3LLRA 3M0UA 2QTXA 2CP7A 3HSBA 3CBPA 1YHQA 3TVTA 1SHGA 2VGNA 4M77C 3JCMh 3REAB 1FX7A 1O9SA 2CZ1B 1YIJA 3CD6T 4M78C 2E41A 4WF2A 2RD1A 1GCPA 1K4US 3RMQA 4C92E 2KROA 3CCST 1MMDA 1WA7A 2YWWA 5GAOr 1RADB 3ER0A 4A53A 2X9HA 2OTJT 1V29B 2XDPA 2E6NA 1NJIU 1GCQA 2H3EB 2DIQA 5EG2A 3I56A 4EPCA 1BYMA 1AWOA 3NFCA 2KSSA 2IPOB 4N4GA 2B86A 1YWPA 3PIPA 2D8HA 2VUBA 4C92B 2J7IA 4FYWB 1Y7XA 1C0MA 3UF4A 2FG0A 1LNXA 4PFOA 4JS5A 4BI8B 1VYTA 4FW1A 1UB4A 2HBWA 2MI6A 2K79A 4ELZC 1K8AU 3M0RA 3QPHA 2AT1B 2KK4A 1VQ9A 1QVFS 3VUZA 3QO3A 2QA4Q 2DF6A 2JOYA 3RR6A 2ROTA 3H8ZA 5CKEA 1JXMA 5L8RE 4IUPA 3ZBDA 1N27A 1VQ8Q 1RLQC 3P8BB 1YJNQ 4M75C 1U3OA 2DA9A 4BY6C 4C0DC 3CCJT 3S3MA 3SDZA 1KD1C 4LUDA 3OA6A 2MPXC 4OMMA 2KE9A 3H9NA 4RCBA 1OU8A 1SEMA 4M7AF 3M5AA 2O9VA 1KD1R 1VQ4T 1HD3A 2QEXT 3E19A 2EFIA 2KGTA 2XK0A 4ZN3A 4LDWA 2EYZA 2CP6A 4C5EA 3JCMg 1ZUYA 1ZA1B 2D1XA 2OAUA 2DPPB 3RKWA 1YI2Q 4M7AG 1M90R 1UGVA 3PIOA 2DL4A 2CDTA 4O6JA 4HCZA 2GTJA 3GIBA 4QQGA 1CKAA 1TXQA 4N4HA 4MZPA 1U1SA 3I55A 3CCLA 3EG3A 1MV0B 2LTOA 2QTVA 2CZ7B 5GAOn 3UATA 5GAOq 3M58A 2K2MA 2E65A 1JJ2A 2W0ZA 2JMAA 2JT4A 5LJ5d 3H0HA 3FC3A 4JPBW 3EHRA 4C8QE 1RAFB 3OYCA 1BB9A 1AWWA 3EFSA 2V1RA 1Q7YU 2E3IA 2JW4A 2EVRA 2V8JA 1YJ9T 4DOWA 1G3WA 2GQVA 2KXCA 2C0OA 2HQXA 3KXTA 1ZSZC 3L1AA 3CC2A 2K7AA 1ZBJA 2VWFA 1KFZA 1E7OA 3E2UA 1UGSB 2P0PA 5GJWB 2X3WD 4C8QB 2F5TX 1PKTA 1G2BA 1D0YA 2CP5A 1R8OB 4LDYA 5GAMe 1M30A 3OW2P 4E7SA 4DA4A 1H8KA 4PJOA 3DLMA 3OMGA 4HVUA 1N6AA 1WPYA 1AOJA 3ASKA 3BDUA 3JCMQ 2JUFA 1CSKA 2DNUA 4F7UE 4AT1B 5GAMf 1VQMT 1BIAA 2DVJA 2FYKA 1FMKA 2G6FX 3INZA 1BIBA 4L59A 1QLYA 3FDRA 1KC8R 2Y90A 3J7AF 4QT7A 2E12A 3C0CA 4KULA 1X6OA 5GMKl 5HK3A 4VUBA 3QHSA 3HPWA 4MMKA 1KQ1A 5FWCA 2F2XA 4XU3A 1X6GA 2HAXA 2D9TA 4LDXA 4M77E 4OB0B 4ESRA 2COWA 1AD5A 1S72T 1YITQ 2YSQA 4PJNA 4M7AD 3EFOA 2MYSA 3GNGA 4M78E 2RJDA 3OYGA 3MCAB 4F14A 1QWFA 4R56A 2MAMA 2D0QB 1ZSGA 3TSWA 1O75A 3FJPA 2KRNA 4J9FA 1YITA 2JM9A 1JJ2S 4LDUA 2JS0A 5HY6A 4FL6A 3D7SB 3KFVA 3MEAA 4M77B 2JJ9A 3E9GA 2JS2A 5KYYB 4M78B 2Y4YA 2CP0A 2RHXA 3G71T 1IXDA 2ZGWA 3CC4A 2BZYA 2K3YA 2I0NA 3CCRA 2EQUA 3PGGA 4AFSC 1LPLA 4GLMA 4GY5A 4BUGA 2ENMA 1YHQT 4M7DC 3VRZA 2X3XD 2L3QA 4XK8E 4C5IA 5M9OA 2NUTA 2R58A 4DBRA 1BBZA 3CD6Q 2ED0A 3PT9A 3CPWP 2VASA 4LE9A 3CCSQ 3GOXA 4R0KA 3VS1A 1UJ0A 4RG2A 4OMFB 2EGEA 2SRCA 1IGQA 3O8VA 2HSEB 4M75E 4EMKC 3CMEQ 4XU0A 1IB8A 4BACA 1K73C 2EJ9A 2LNHB 3JCMJ 1NE8A 3CCQT 1BI2A 1LCKA 2YRVA 5KYUB 5HCKA 3O5ZA 2JNGA 5LJ3d 2XG8D 4J6YA 2KYMA 3M55A 4JRIA 3CMEA 2JXBA 3EFRA 1OYXA 1TTHB 4C5HA 1AWJA 3HRSA 1SG5A 1Q86R 2QXFA 1AHJB 2ATCB 4X9CA 1YBYA 4M75B 3RKXA 3CCVQ 1JB0E 4C0DB 1K0XA 2WSFE 2IIMA 4C92A 1BI1A 2AKKA 1NM7A 1DJ7B 1Z9QA 1VQ5Q 2R57A 1VQ6T 1EZZB 4JLIA 5HK0A 5FW9A 3SWNB 2X4WA 2QQSA 4CI0C 5IXBA 3CC7A 3SEMA 1Q81C 2KT8A 1JQQA 1GBQA 2P4TA 5LJ5j 3I5SA 3PVLA 2LVMA 5CKDA 1HK9A 1VQ5A 1K9MU 2NYSA 3CCJQ 1I5OB 5FROA 4CC3A 1H641 4E6RA 3FIFA 1WQWA 2ZPFB 2ZPEB 4QVZA 2KYBA 2H8HA 1G3TA 1G8XA 5GAMd 3A8MB 1VQ4Q 1G83A 2GBQA 4J6WA 3J80E 2RF0A 3CCUT 4BE2A 3CBMA 5I21A 4KGZB 2DKGA 2E64A 3HRTA 2A7YA 4PJJA 4FU6A 2NUPB 1PC0A 3SD4A 4AFUC 2X51A 4C92F 3A1PA 3PVQA 4RG8A 4AFQC 4QW2A 1ZSZB 4DEXA 4HVVA 4XTXA 1RL2A 3JCMc 2EQJA 5CR2A 2LX9A 3I55T 3RMSA 2DXUA 5D6XA 2RK2A 2YLCA 4KRTA 2KT1A 3BDLA 2LT4A 8ATCB 2OTLQ 1VA7A 1M4ZA 2EW3A 1X69A 1Q82R 2EPDA 4JZ4A 3VS6A 3SFMA 2EKHA 3OYBA 1YJ9Q 1TU0B 3EGXB 1WXUA 1U06A 2EAYA 4RCCA 2WACA 5I22A 2MIOA 1SRLA 4A63B 4OMOA 2Y4XA 4HT9A 5FU7C 2FL7A 2PZ1A 4C0GA 3BY7A 2EQIA 4EMHA 1TH7A 3G4ST 1ZX6A 2RJCA 4DBQA 4ZN1A 3JB9F 1MMNA 2C0IA 1VQPA 4Z02A 3RDVA 4J7FA 2EYQA 2CYZB 2HKQB 1N8RC 1EFNA 4B9XA 4JJDA 1BI3A 1G3YA 2ESWA 4ELYC 4OMQA 3CMAA 2C06A 1OZ2A 1TWBA 1WFWA 4C8QA 1VQMQ 3MP1A 2HQEA 2EJFA 2ROLA 3QUIA 1NYGA 1W1FA 1QCOA 3A5ZB 3NTIA 4A4FA 4BDZA 3GBQA 4A4KA 1AZGB 2DYIA 3OS2A 1D0XA 3EAEA 5FU6C 1K9MC 3TSZA 3JV3A 5IT9E 4M7DE 3MKDA 1S72Q 1NBEB 1ACMB 2Z0WA 2L0AA 1KD1U 2EBPA 1KK7A 5FWBA 4CRIA 1LOJA 3V8LA 4EIKA 1K0SA 3CCET 3OYHA 2JMCA 3ZEHA 1M90U 1J3TA 2CUBA 1WXTA 4C92D 2MWOA 2KEAA 2RQRA 2ZPIB 3LX7A 4M7DB 3TREA 1KIKA 2CSQA 1UE9A 2HNIA 4V2SA 5LJ3j 3EH2A 1SRMA 2CP3A 2K5IA 2CGHA 4Q5WA 2NLUA 2HSPA 4LN2A 2GCXA 2LCLA 2MOXA 1MUZA 3QKJA 5KYXB 4RUGA 2CREA 4M77A 1AT1B 2PNIA 5I2SA 2KNBB 1QWEA 3QWYA 3UA6A 3V7CA 2ZZDA 5FLXE 1NG2A 4EMKB 1VQNA 3OYFA 4UC4A 1M1KR 2PVOB 5KYYA 4M78A 3URGA 1SSFA 1M27C 4FT2A 4XU1A 4LDVA 2QAZA 1WDXA 2RB6A 2NWMA 3QDRB 4E7ZA 4BI4A 2ZPHB 4XTZA 3P8DA 1G5VA 1EX4A 2J6FA 4F7UF 3META 5FRMA 3JB9D 1UDLA 1RI9A 3VS4A 2BTTA 3CCQQ 1PSFA 2AHJB 3GF5A 2MMPA 4RTZA 2DRMA 4FIBA 2RHYA 2KDSA 4XAXB 4ZGDB 1WLPB 3LH5A 2DD5A 5GAMj 3MP6A 2L3SA 2RQTA 1I8FA 1VQ7T 3OYNA 3LWHA 2KR3A 3CPFA 5KYUA 1BK2A 2LT1A 1BU1A 4RTUA 2EJGA 5I11A 2COZA 3QDFA 4M7AC 2KBTA 1VQKT 1WXBA 2CS7A 4RMOA 1VQ6Q 2GQIA 4II1A 2QA4A 3AT1B 4M75A 1AZEA 2XDDA 4LD9K 1YJWQ 2YXYA 4HCKA 1NPPA 1WJQA 3CQTA 1VQ8A 5GANj 3DLLA 3MPUB 3A8HB 3PMTA 1YJNA 4L5GA 1QQJA 3VYHB 1QVGA 3MEUA 3SWNA 1YJWA 1M90C 2RHZA 2XHCA 3G6ET 2K5LA 4RTTA 4JS4A 3KBGA 4QVDA 1UJYA 2K9GA 2P84A 5GAN6 5CK9A 3CCUQ 3VS2A 1PCXA 5LJ3e 5GMKm 1M3BA 4PL6A 4Y92A 1KG1A 1X2QA 1ZUUA 3JSCA 5GMKj 3NMZC 2M51A 3BFMA 4PFPA 1AVZC 4MZMA 1NYFA 3CBOA 3LWIA 4Z89A 1YI2A 3NPFA 2BE7D 4XTWA 1D09B 5LJ3f 2EGAA 2C0TA 1WHKA 2CZ6B 3HTRA 3L2UA 3P8HA 1VQLQ 2DVEA 2NUPA 2VKNA 1W6XA 4WTOB 3PE0A 4AG1C 4HA8A 4LD6A 2CT3A 5FU7B 4OB2B 1HYOA 1ZSZA 4IIOA 4ORZA 2PUOB 1YCSB 1I4K1 5C6SA 4OF1A 2EYWA 4GLKA 4AG2C 3CCMT 5LJ5h 2RQWA 1YNZA 1QCNA 4JJCA 4JLGA 1K73U 1N9SA 2KMTA 4BE1A 3OSSC 1Q86U 3M56A 3OYYA 4M77D 3X25B 3CXCS 4ANJA 1RAGB 4F16A 4E7IA 1OI1A 3EGXA 4PJMA 1VQPT 2DBMA 4E7KA 1QKWA 1RLPC 1KC8C 3JCMX 3OYIA 3OBWA 1NJIR 5FU6B 5DLQE 2E5KA 2LJ3A 2HBPA 1QVGS 3NGPA 3CMAT 2RNAA 2K3BA 4OP0A 3ULRB 4PLLA 5CKFA 1W70A 2KXDA 1VQOQ 2VXFA 1FWZA 1B3QA 1A0NB 1KHIA 1T3LA 1Q81U 2RQVA 1K8AR 2K2VA 1X2KA 3DKMA 4J9CA 5GANe 3JAME 1SPKA 1VQOA 2E70A 4BDYA 1FXXA 2FZKB 2VVKA 1NEGA 4RTYA 2FHDA 2K5FA 1M8MA 4PJOF 1WQ7A 1WIEA 3CCEQ 1Y71A 1CKBA 4HT8A 1BCMA 5D6WA 5GANf 1BI0A 3FEOA 2DD4A 2HD0A 5IHNA 2O2OA 2AZVA 2BZ8A 2A37A 3PNWC 2KVQG 2P4RA 5GMKe 5GAOm 3QJ6A 3BE3A
chains in the Genus database with same CATH topology
2GTOA 2NUZA 4CC4B 2DM1A 4AFUC 2DL7A 2KRSA 2LP5A 2RMOA 1SHFA 3ZL7C 3PVQA 1UUEA 1WYXA 1H3HA 2YT6A 4AFQC 1ZUKA 4OMPA 4DEXA 1Y0MA 4HVVA 1PRLC 1M3AA 2FEIA 2LJ1A 3M0UA 2D0NA 1QKXA 3TVTA 1SHGA 4KRTA 2KT1A 3REAB 1FYNA 1VA7A 2EW3A 1X69A 2CSIA 2LX7A 3IQLA 2EPDA 4JZ4A 4X1VA 3VS6A 1HJDA 1GCPA 2EKHA 1K4US 2KROA 2FPFA 1WXUA 1WA7A 1U06A 3REBB 5I22A 1GCQA 2EYXA 1PRMC 2MIOA 2DILA 1TUDA 1SRLA 2LJ0A 4A63B 1GL5A 4OMOA 3M0TA 2DYBA 2PZ1A 1AWOA 2EQIA 2B86A 1ZX6A 1YWPA 2C0IA 2FRYA 4D8KA 2J05A 1E6GA 2D8HA 2J7IA 2JTEA 1E6HA 3VS0A 3UF4A 2FG0A 4J9EA 2YDLA 4Z8AA 1EFNA 4JJDA 2ESWA 4OMQA 1VYTA 2GNCA 2HBWA 4J9IA 1WFWA 2K79A 3M0RA 2PTKA 2ROLA 2DX1A 1NYGA 1W1FA 1T0JA 2DF6A 3GBQA 4J9GA 4AFZC 1AZGB 2ROTA 1JXMA 3I9QA 4JJBA 1OPLA 4OMLA 3TSZA 3JV3A 1RLQC 4J9BA 1PWTA 2DL8A 2L2PA 1U3OA 2QDLA 4CC7A 2DA9A 2RPNA 3SHWA 2L0AA 2J06A 2EBPA 3QWXX 4LUDA 2DRKA 5EC7A 4DEYA 1TG0A 1X43A 1PHTA 5FWBA 4OMMA 2KE9A 3RNJA 4EIKA 1K0SA 4RTWA 2JMCA 1J3TA 1SEMA 2EYYA 2CUBA 1U5SA 1WXTA 2O9VA 1HD3A 2KEAA 1T3SA 2RQRA 2KGTA 1KIKA 2CSQA 1UE9A 2EYZA 1ZUYA 2D1XA 1SRMA 1UGVA 4CC2A 2ED1A 2DL4A 1GFCA 2FO0A 3M0SA 2CDTA 2HDAA 2HSPA 1Y57A 1S1NA 2YUQA 4LN2A 1NLPC 2GTJA 2MOXA 1MUZA 1CKAA 1JXOA 3NHNA 4J9DA 1OOTA 2DL5A 4RUGA 2CREA 2SEMA 2PNIA 1NLOC 1QWEA 2KNBB 3EG3A 3QWYA 3UA6A 1MV0B 1NG2A 2LQNA 3UATA 1K76A 2K2MA 3EG2A 2O88A 2OI3A 2W0ZA 2JMAA 2JT4A 3H0HA 3U23A 1QCFA 1M27C 3UA7A 3H0FA 4JPBW 2FPEA 1OPKA 5IH2A 2HCKA 3EHRA 1WDXA 2ABLA 2FRWA 2NWMA 1BB9A 1AWWA 2DLPA 2V1RA 2JW4A 2EVRA 2KXCA 2C0OA 2J6FA 4WCIA 1GRIA 1UDLA 4ZNXA 2K7AA 1RI9A 1ZBJA 1JO8A 3VS4A 1VYUA 1KSWA 2VWFA 1KFZA 1E7OA 2BTTA 1ARKA 4J9HA 4OMNA 5GJWB 2X3WD 4RTZA 2DRMA 1PKTA 2DL3A 1G2BA 1GBRA 1WLPB 3LH5A 1OV3A 2L3SA 2RQTA 1M30A 5GJVB 2A36A 4FSSA 1PNJA 1H8KA 4F17A 1MV3A 2KR3A 3M0QA 4HVUA 1AOJA 2FPDA 2CH4A 1BK2A 2YUNA 1CSKA 4LUEA 1BU1A 2DNUA 3H41A 4RTUA 5I11A 2KBTA 2DVJA 2G6FX 1FMKA 1QLYA 1WXBA 2GQIA 4QT7A 3C0CA 3EHQA 5FWCA 2F2XA 1AZEA 1X6GA 2EGCA 1ABOA 1M3CA 2YUPA 4HCKA 2O9SA 4ESRA 5L23A 1AWXA 2XMFA 1AD5A 3CQTA 1AEYA 2OJ2A 2YSQA 1JU5C 5IHKA 5ECAA 2GGRA 2A08A 1K1ZA 2YUOA 1NEBA 4F14A 1QWFA 3A98A 1ZSGA 3TSWA 4RTTA 2KRNA 4J9FA 2JM9A 2DE0X 5IHIA 1UJYA 2JS0A 2K9GA 1YN8A 4JZ3A 3KFVA 3VS2A 3RBBB 2V1QA 4M4ZA 1M3BA 2ECZA 4Y92A 1X27A 1X2QA 4HXJA 1ZUUA 1B07A 2OAWA 1YP5A 3NMZC 1KJWA 2JS2A 2M51A 1AVZC 1NYFA 2L3PA 2AKLA 2K6DA 4Z89A 3NPFA 3VS3A 1UHCA 1I07A 2BZYA 2F2WA 1ZLMA 1I1JA 2I0NA 2LZ6B 1N5ZA 1HSQA 4AFSC 4GLMA 2EGAA 2C0TA 4D8DA 3H0IA 2VKNA 2J6KA 1W6XA 3PE0A 4AG1C 2ENMA 3EG0A 2CT3A 3VRZA 2X3XD 2L3QA 1RUWA 2DMOA 2D8JA 1BBZA 1VYVA 2ED0A 4IIOA 4ORZA 3VS5A 4LE9A 1YCSB 2DJQA 4R0KA 2EYWA 3VS1A 1UJ0A 2JM8A 2AZSA 4Z88A 1K9AA 2EGEA 4AG2C 3THKA 2SRCA 2RQWA 4IIMA 3R6NA 1YNZA 1PKSA 4JJCA 1H92A 2LQWA 1WI7A 2O31A 2M0YA 1OEBA 2LNHB 2CH4W 2A28A 2CUDA 1LCKA 1UG1A 1GCQC 5HCKA 4GBQA 1JEGA 3O5ZA 4K11A 4F16A 1I0CA 1Z9ZA 2KYMA 2DBMA 2F2VA 1QKWA 1TUCA 2JXBA 1RLPC 1AWJA 3VRYA 1UTIA 2DBKA 3I35A 2E5KA 2LJ3A 2CT4A 3NGPA 2RNAA 2K3BA 5IXFA 1K0XA 3ULRB 1UECA 2IIMA 1W70A 2AKKA 1NM7A 1XOVA 2AK5A 2MCNA 2KXDA 3M0PA 1Z9QA 4LNPA 5FW9A 1B3QA 1A0NB 5IXBA 1T3LA 3SEMA 3VS7A 2RQUA 2KT8A 2RQVA 1JQQA 1GBQA 3I5RA 3I5SA 3PVLA 1X2KA 4J9CA 4RTVA 1GFDA 1SPKA 1IO6A 4CC3A 1X6BA 4HVWA 4E6RA 2VVKA 1NEGA 2KRMA 2RN8A 1ABQA 3EG1A 4RTYA 1M8MA 1WIEA 2KYBA 2H8HA 2LCSA 1CKBA 2J6OA 3FJ5A 2HEQA 1UFFA 5IHNA 1UHFA 1V1CA 1G83A 2LMJA 2O2OA 2GBQA 3EGUA 4RTXA 2AZVA 1WX6A 1YWOA 2BZ8A 2BZXA 2A37A 2RF0A 2W10A 1SSHA 2P4RA 1T0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GTO A;  2NUZ A;  4CC4 B;  2DM1 A;  4AFU C;  2DL7 A;  2KRS A;  2LP5 A;  2RMO A;  1SHF A;  3ZL7 C;  3PVQ A;  1UUE A;  1WYX A;  1H3H A;  2YT6 A;  4AFQ C;  1ZUK A;  4OMP A;  4DEX A;  1Y0M A;  4HVV A;  1PRL C;  1M3A A;  2FEI A;  2LJ1 A;  3M0U A;  2D0N A;  1QKX A;  3TVT A;  1SHG A;  4KRT A;  2KT1 A;  3REA B;  1FYN A;  1VA7 A;  2EW3 A;  1X69 A;  2CSI A;  2LX7 A;  3IQL A;  2EPD A;  4JZ4 A;  4X1V A;  3VS6 A;  1HJD A;  1GCP A;  2EKH A;  1K4U S;  2KRO A;  2FPF A;  1WXU A;  1WA7 A;  1U06 A;  3REB B;  5I22 A;  1GCQ A;  2EYX A;  1PRM C;  2MIO A;  2DIL A;  1TUD A;  1SRL A;  2LJ0 A;  4A63 B;  1GL5 A;  4OMO A;  3M0T A;  2DYB A;  2PZ1 A;  1AWO A;  2EQI A;  2B86 A;  1ZX6 A;  1YWP A;  2C0I A;  2FRY A;  4D8K A;  2J05 A;  1E6G A;  2D8H A;  2J7I A;  2JTE A;  1E6H A;  3VS0 A;  3UF4 A;  2FG0 A;  4J9E A;  2YDL A;  4Z8A A;  1EFN A;  4JJD A;  2ESW A;  4OMQ A;  1VYT A;  2GNC A;  2HBW A;  4J9I A;  1WFW A;  2K79 A;  3M0R A;  2PTK A;  2ROL A;  2DX1 A;  1NYG A;  1W1F A;  1T0J A;  2DF6 A;  3GBQ A;  4J9G A;  4AFZ C;  1AZG B;  2ROT A;  1JXM A;  3I9Q A;  4JJB A;  1OPL A;  4OML A;  3TSZ A;  3JV3 A;  1RLQ C;  4J9B A;  1PWT A;  2DL8 A;  2L2P A;  1U3O A;  2QDL A;  4CC7 A;  2DA9 A;  2RPN A;  3SHW A;  2L0A A;  2J06 A;  2EBP A;  3QWX X;  4LUD A;  2DRK A;  5EC7 A;  4DEY A;  1TG0 A;  1X43 A;  1PHT A;  5FWB A;  4OMM A;  2KE9 A;  3RNJ A;  4EIK A;  1K0S A;  4RTW A;  2JMC A;  1J3T A;  1SEM A;  2EYY A;  2CUB A;  1U5S A;  1WXT A;  2O9V A;  1HD3 A;  2KEA A;  1T3S A;  2RQR A;  2KGT A;  1KIK A;  2CSQ A;  1UE9 A;  2EYZ A;  1ZUY A;  2D1X A;  1SRM A;  1UGV A;  4CC2 A;  2ED1 A;  2DL4 A;  1GFC A;  2FO0 A;  3M0S A;  2CDT A;  2HDA A;  2HSP A;  1Y57 A;  1S1N A;  2YUQ A;  4LN2 A;  1NLP C;  2GTJ A;  2MOX A;  1MUZ A;  1CKA A;  1JXO A;  3NHN A;  4J9D A;  1OOT A;  2DL5 A;  4RUG A;  2CRE A;  2SEM A;  2PNI A;  1NLO C;  1QWE A;  2KNB B;  3EG3 A;  3QWY A;  3UA6 A;  1MV0 B;  1NG2 A;  2LQN A;  3UAT A;  1K76 A;  2K2M A;  3EG2 A;  2O88 A;  2OI3 A;  2W0Z A;  2JMA A;  2JT4 A;  3H0H A;  3U23 A;  1QCF A;  1M27 C;  3UA7 A;  3H0F A;  4JPB W;  2FPE A;  1OPK A;  5IH2 A;  2HCK A;  3EHR A;  1WDX A;  2ABL A;  2FRW A;  2NWM A;  1BB9 A;  1AWW A;  2DLP A;  2V1R A;  2JW4 A;  2EVR A;  2KXC A;  2C0O A;  2J6F A;  4WCI A;  1GRI A;  1UDL A;  4ZNX A;  2K7A A;  1RI9 A;  1ZBJ A;  1JO8 A;  3VS4 A;  1VYU A;  1KSW A;  2VWF A;  1KFZ A;  1E7O A;  2BTT A;  1ARK A;  4J9H A;  4OMN A;  5GJW B;  2X3W D;  4RTZ A;  2DRM A;  1PKT A;  2DL3 A;  1G2B A;  1GBR A;  1WLP B;  3LH5 A;  1OV3 A;  2L3S A;  2RQT A;  1M30 A;  5GJV B;  2A36 A;  4FSS A;  1PNJ A;  1H8K A;  4F17 A;  1MV3 A;  2KR3 A;  3M0Q A;  4HVU A;  1AOJ A;  2FPD A;  2CH4 A;  1BK2 A;  2YUN A;  1CSK A;  4LUE A;  1BU1 A;  2DNU A;  3H41 A;  4RTU A;  5I11 A;  2KBT A;  2DVJ A;  2G6F X;  1FMK A;  1QLY A;  1WXB A;  2GQI A;  4QT7 A;  3C0C A;  3EHQ A;  5FWC A;  2F2X A;  1AZE A;  1X6G A;  2EGC A;  1ABO A;  1M3C A;  2YUP A;  4HCK A;  2O9S A;  4ESR A;  5L23 A;  1AWX A;  2XMF A;  1AD5 A;  3CQT A;  1AEY A;  2OJ2 A;  2YSQ A;  1JU5 C;  5IHK A;  5ECA A;  2GGR A;  2A08 A;  1K1Z A;  2YUO A;  1NEB A;  4F14 A;  1QWF A;  3A98 A;  1ZSG A;  3TSW A;  4RTT A;  2KRN A;  4J9F A;  2JM9 A;  2DE0 X;  5IHI A;  1UJY A;  2JS0 A;  2K9G A;  1YN8 A;  4JZ3 A;  3KFV A;  3VS2 A;  3RBB B;  2V1Q A;  4M4Z A;  1M3B A;  2ECZ A;  4Y92 A;  1X27 A;  1X2Q A;  4HXJ A;  1ZUU A;  1B07 A;  2OAW A;  1YP5 A;  3NMZ C;  1KJW A;  2JS2 A;  2M51 A;  1AVZ C;  1NYF A;  2L3P A;  2AKL A;  2K6D A;  4Z89 A;  3NPF A;  3VS3 A;  1UHC A;  1I07 A;  2BZY A;  2F2W A;  1ZLM A;  1I1J A;  2I0N A;  2LZ6 B;  1N5Z A;  1HSQ A;  4AFS C;  4GLM A;  2EGA A;  2C0T A;  4D8D A;  3H0I A;  2VKN A;  2J6K A;  1W6X A;  3PE0 A;  4AG1 C;  2ENM A;  3EG0 A;  2CT3 A;  3VRZ A;  2X3X D;  2L3Q A;  1RUW A;  2DMO A;  2D8J A;  1BBZ A;  1VYV A;  2ED0 A;  4IIO A;  4ORZ A;  3VS5 A;  4LE9 A;  1YCS B;  2DJQ A;  4R0K A;  2EYW A;  3VS1 A;  1UJ0 A;  2JM8 A;  2AZS A;  4Z88 A;  1K9A A;  2EGE A;  4AG2 C;  3THK A;  2SRC A;  2RQW A;  4IIM A;  3R6N A;  1YNZ A;  1PKS A;  4JJC A;  1H92 A;  2LQW A;  1WI7 A;  2O31 A;  2M0Y A;  1OEB A;  2LNH B;  2CH4 W;  2A28 A;  2CUD A;  1LCK A;  1UG1 A;  1GCQ C;  5HCK A;  4GBQ A;  1JEG A;  3O5Z A;  4K11 A;  4F16 A;  1I0C A;  1Z9Z A;  2KYM A;  2DBM A;  2F2V A;  1QKW A;  1TUC A;  2JXB A;  1RLP C;  1AWJ A;  3VRY A;  1UTI A;  2DBK A;  3I35 A;  2E5K A;  2LJ3 A;  2CT4 A;  3NGP A;  2RNA A;  2K3B A;  5IXF A;  1K0X A;  3ULR B;  1UEC A;  2IIM A;  1W70 A;  2AKK A;  1NM7 A;  1XOV A;  2AK5 A;  2MCN A;  2KXD A;  3M0P A;  1Z9Q A;  4LNP A;  5FW9 A;  1B3Q A;  1A0N B;  5IXB A;  1T3L A;  3SEM A;  3VS7 A;  2RQU A;  2KT8 A;  2RQV A;  1JQQ A;  1GBQ A;  3I5R A;  3I5S A;  3PVL A;  1X2K A;  4J9C A;  4RTV A;  1GFD A;  1SPK A;  1IO6 A;  4CC3 A;  1X6B A;  4HVW A;  4E6R A;  2VVK A;  1NEG A;  2KRM A;  2RN8 A;  1ABQ A;  3EG1 A;  4RTY A;  1M8M A;  1WIE A;  2KYB A;  2H8H A;  2LCS A;  1CKB A;  2J6O A;  3FJ5 A;  2HEQ A;  1UFF A;  5IHN A;  1UHF A;  1V1C A;  1G83 A;  2LMJ A;  2O2O A;  2GBQ A;  3EGU A;  4RTX A;  2AZV A;  1WX6 A;  1YWO A;  2BZ8 A;  2BZX A;  2A37 A;  2RF0 A;  2W10 A;  1SSH A;  2P4R A;  1T0H A; 
#chains in the Genus database with same CATH topology
 2GTO A;  5CO7 A;  2DL7 A;  2KI7 A;  2KRS A;  3X26 B;  1LVK A;  1R77 A;  1SHF A;  2K4Y A;  1UUE A;  1WYX A;  4IUV A;  4PFZ A;  1QMC A;  4FYX B;  4M7D A;  5KYN A;  3MJX A;  1Q82 U;  2LDM A;  5LJ5 g;  5GAN 8;  1F1B B;  4Y91 A;  5A2Q E;  1RAH B;  4DBF A;  2L3R A;  1YIJ T;  4N4I A;  3RUX A;  4M7A E;  5KYX A;  2LX7 A;  1QVF P;  3IQL A;  4QVC A;  1UGR B;  1HJD A;  2OTJ Q;  3CD6 A;  2FPF A;  4EMK A;  4L6V 5;  4OB1 B;  3CCS A;  5CKB A;  1KQ2 A;  4BI3 A;  3I56 T;  3L42 A;  2EYX A;  5CIU A;  1PRM C;  3HKS A;  2ZCF B;  1Q86 C;  2DIL A;  1TUD A;  1GL5 A;  1YFN A;  4FYV B;  1M1F A;  1YCY A;  2DYB A;  4M7A B;  2DXT A;  2ZPG B;  1Q7Y R;  2FRY A;  5DLO A;  3JCM W;  1X75 C;  2J05 A;  1E6G A;  1JRI A;  2DAQ A;  3VS0 A;  2PUK B;  1VOM A;  1VQ7 Q;  4BY6 B;  1N8R U;  4Z8A A;  1SF9 A;  5LJ3 h;  1VQ9 T;  3MP8 A;  2O01 E;  2GNC A;  4E47 A;  3JRZ A;  2QI2 A;  2X4Y A;  3HHT B;  2BIV A;  3CCV A;  4HCB A;  5GMK i;  5GAO l;  1C6V X;  3OYL A;  2X4X A;  4J9G A;  4AFZ C;  1M2V B;  3V8K A;  4DBH A;  2QA4 T;  3I9Q A;  4JJB A;  4IUU A;  1OPL A;  1FMV A;  4C92 C;  3EG9 B;  4OML A;  2RA2 A;  4PKC C;  2D6F A;  4PJO D;  2DL8 A;  2L2P A;  4CC7 A;  3PFS A;  2RPN A;  3SHW A;  2J06 A;  4NL2 A;  1VQ8 T;  4OVA A;  5EC7 A;  4X34 A;  2DRK A;  2HZY A;  1TG0 A;  3RES A;  1X43 A;  3CCJ A;  1HXD A;  3G6E Q;  2M16 A;  2QEX Q;  4XTY A;  2P0K A;  3EGD B;  4RTW A;  4YTL A;  2LCC A;  1U5S A;  1T3S A;  2A0F B;  3E1S A;  1M5Q 1;  3HP9 A;  3OYK A;  1VQ4 A;  4EDU A;  3BW1 A;  4OGC A;  4KBM B;  4TVR A;  2F5K A;  3G1J A;  5GAM h;  1B7T A;  2ED1 A;  3M0S A;  2HDA A;  4JRK A;  1Y57 A;  4B6M A;  1M1K U;  1S1N A;  4C92 G;  1YI2 T;  1Q82 C;  3M4Y A;  5GAN 7;  3CCL T;  1M2O A;  2QK0 A;  4NOY A;  1RAA B;  4MML A;  3V7R A;  3L2V A;  1TOV A;  3OW2 A;  3EG2 A;  2O88 A;  1R0C B;  2OI3 A;  4PJL A;  5GAN d;  1QCF A;  3UA7 A;  2FPE A;  4PLI A;  5IH2 A;  2ABL A;  4XTU A;  3VYG A;  2FRW A;  2E1H A;  2PQW A;  2OTL A;  4XU2 A;  2E10 A;  3CC2 T;  5CQY A;  4WCI A;  1YJ9 A;  1PG5 B;  1GRI A;  4LXC A;  4AMC A;  5LJ3 g;  1KSW A;  5GAN h;  3OYM A;  3G7Z A;  4FYY B;  4M7D D;  4J9H A;  1IRX A;  4OMN A;  5GAN 5;  1GBR A;  1OV3 A;  2MWP A;  3JB9 G;  4KUI A;  5GJV B;  2A36 A;  1PNJ A;  1WGS A;  2M1H A;  2DEU A;  1JJ2 P;  4QQD A;  1WJR A;  1MV3 A;  2CZ0 B;  3M0Q A;  1I5L A;  2XID A;  2FPD A;  5GMK h;  2YUN A;  4N0A C;  3NTK A;  3C94 A;  2P0Q A;  4J6X A;  4FW2 A;  2DXC A;  2QG9 B;  2HL5 C;  1VQM A;  4FSX A;  1ZBX A;  2GF7 A;  4J83 A;  1B34 B;  2H3J A;  3QSU A;  5GAN 2;  1Y96 B;  1W2B A;  3M57 A;  2VYT A;  1M3C A;  3RIR A;  2DIG A;  3UT1 A;  4QKU A;  4KH1 B;  5L23 A;  1AWX A;  2PVD B;  2XMF A;  1AEY A;  2OJ2 A;  1Y07 A;  1JU5 C;  2LNV A;  3S3N A;  5ECA A;  3S6W A;  4C0Z A;  2YLB A;  5C0M A;  1M9S A;  5GAM g;  1S72 A;  1D1A A;  1K1Z A;  2LC4 A;  2YUO A;  4DQ2 A;  2E4H A;  1YIT T;  1NEB A;  1BCO A;  3OW2 S;  1QP3 A;  5IHI A;  1YN8 A;  2IG0 A;  3GP8 A;  4C8Q F;  3OYE A;  3OYJ A;  2HMA A;  3RBB B;  2V1Q A;  2ECZ A;  5CKH A;  1U8R A;  3G71 Q;  1B07 A;  1M1K C;  2GFA A;  3OBY A;  1KJW A;  3JCM P;  3CC4 T;  2QGG A;  4C8Q G;  2L3P A;  3QXE B;  3JCM d;  5LL6 S;  3CCR T;  1I07 A;  1WHG A;  2KY9 A;  2JTM A;  4QQ6 A;  8AT1 B;  1IRE B;  1N5Z A;  1YHQ Q;  1HSQ A;  4D8D A;  3LGF A;  1MMG A;  2FZG B;  4XTV A;  4HCC A;  2R5A A;  5GAN g;  1G3S A;  1RUW A;  2DMO A;  2D8J A;  2M0O A;  2LQK A;  1OU9 A;  1VYV A;  2A3L A;  1BKB A;  2DJQ A;  2I2L A;  4Z88 A;  1K9A A;  3THK A;  3I56 Q;  4BE0 A;  3R6N A;  4PNO A;  1H92 A;  1GXI E;  1WI7 A;  2QYZ A;  4F7U G;  2CUD A;  5IN1 A;  1GCQ C;  2K3X A;  4GBQ A;  1JEG A;  4K11 A;  3CME T;  2JTF A;  3CCQ A;  4M77 F;  5KCH A;  1W2B S;  4MDW A;  1TUC A;  2K57 A;  1KC8 U;  3E9F A;  2DEQ A;  3VRY A;  1UTI A;  2DBK A;  4M78 F;  1XQH A;  2CT4 A;  4M7A A;  1VQ9 Q;  4M77 G;  3CEY A;  2RJF A;  1RAC B;  4JRP A;  1MMA A;  1UEC A;  3MEV A;  2RI2 A;  3A8L B;  3CPW S;  5AT1 B;  3CXC A;  4M78 G;  3CCV T;  1N9R A;  2YRC A;  1XOV A;  3GNF B;  2AK5 A;  2DK3 A;  3M0P A;  3CC7 T;  4KUD K;  4LNP A;  3H6Z A;  2RHI A;  2CP2 A;  2WSE E;  1VQ6 A;  4NS5 A;  5DY9 A;  2VV5 A;  5I2M A;  1KQS A;  1VQ5 T;  3JCM b;  3VS7 A;  2HKN A;  4C5G A;  4RTV A;  3N5B B;  2QDY B;  1UGP B;  1WHH A;  5GAN 4;  1EIF A;  3OS0 A;  1QW1 A;  3L2Z A;  4J8O A;  2RN8 A;  3EG1 A;  3S3O A;  4C8Q D;  1M2V A;  2KQW A;  1JBM A;  1TUG B;  5D7U A;  3EG9 A;  3PMI A;  3JB9 I;  3VV0 A;  1UHF A;  1V1C A;  5FRN A;  2LMJ A;  2V8K A;  4P5N A;  4PK4 A;  1YWO A;  3C12 A;  1TS9 A;  1WZO A;  2W10 A;  1SSH A;  3SWN C;  4FT4 A;  3CCU A;  2DM1 A;  4IKF A;  2LP5 A;  2OX7 A;  1M1G A;  2VC8 A;  2PU9 B;  2RMO A;  3EGD A;  4E7J A;  4M75 F;  1H3H A;  2COY A;  3I55 Q;  3JB9 H;  3CCL Q;  2YT6 A;  2WSC E;  5GAO p;  4OMP A;  1OX8 A;  5A0D A;  2D0N A;  3Q1J A;  1QKX A;  1WHJ A;  4M75 G;  3MEW A;  1QVP A;  3FB9 A;  2M02 A;  1VQL A;  2E3H A;  1FYN A;  3NTH A;  2CSI A;  2DXB A;  3X20 B;  2EWN A;  3DB4 A;  4X1V A;  1D3B B;  2OTL T;  2RH2 A;  3CC2 Q;  3WXM B;  2O4X B;  1MHN A;  4A4G A;  1UGQ B;  2LRQ A;  3REB B;  2XKO C;  2QQ9 A;  1NJI C;  3X24 B;  2LJ0 A;  3G4S Q;  4EMG A;  2X35 A;  3M0T A;  2FVU A;  3OS1 A;  3WVD B;  2DZC A;  4M78 D;  4D8K A;  3QYH B;  1KQS S;  2JTE A;  1E6H A;  3G4S A;  4A4H A;  3HFN A;  3L2Q A;  5D6Y A;  2CKK A;  3QG1 A;  3M59 A;  4J9E A;  2YDL A;  3WVE B;  2DER A;  2JN0 A;  3GPL A;  2V26 A;  1X01 A;  4PJO C;  4J9I A;  4XQ3 A;  2EQM A;  1K8A C;  1OQK A;  2PTK A;  5CVI A;  2DX1 A;  1OUL A;  1T0J A;  2PVG B;  2VB6 A;  3RER A;  3C95 A;  3VUB A;  1Q95 G;  1RAI B;  3V7S A;  5KH6 A;  1WNL A;  1XTD A;  3ME9 A;  6AT1 B;  5J26 A;  4A4E A;  4J9B A;  1PWT A;  2QDL A;  5CCA A;  3QWX X;  3LW5 E;  2YHT A;  1B34 A;  4DEY A;  5KYW B;  2DTO A;  4F7U B;  4E7L A;  1PHT A;  1Y96 A;  5A0L A;  3RNJ A;  1IZ6 A;  4C0F A;  3VJP A;  2EYY A;  3MO8 A;  4PJO G;  3HRU A;  3R6O A;  3CCE A;  3QZ9 B;  2HL3 A;  1WHL A;  4M75 D;  4IUQ A;  4MZT A;  4DOV A;  4CC2 A;  3CC4 Q;  3UPU A;  1GFC A;  2FO0 A;  1RAB B;  1LJO A;  2BE9 B;  2YUQ A;  3CCR Q;  1NLP C;  2RI5 A;  2DO3 A;  2RM4 A;  1D1B A;  2KAF A;  1JXO A;  3NHN A;  4J9D A;  4KT0 E;  1OOT A;  3QBY A;  1NPR A;  2DL5 A;  2SEM A;  1VQN T;  1NLO C;  2LQN A;  1W2B P;  4OGE A;  1ZA2 B;  1K76 A;  4IUR A;  1MNE A;  2ZAE A;  4KGX B;  3U23 A;  4ZTJ A;  4JJN K;  3H0F A;  4R55 A;  1OPK A;  5AYF A;  2HCK A;  2QQR A;  2DLP A;  2L8D A;  2X4J A;  1Q7Y C;  3F70 A;  2OTJ A;  4Y28 E;  4OB3 B;  2MF2 A;  4ZNX A;  3M4G A;  1JO8 A;  1VYU A;  4B9W A;  4JRQ A;  2FB7 A;  2RK1 A;  1ARK A;  3KUF A;  2AIR B;  2YRD A;  2DL3 A;  4M7D F;  3OMC A;  1WJS A;  4J5Y A;  4MDX A;  1R0B G;  3C4S A;  4FSS A;  3HFO A;  2DFU A;  4F17 A;  5A0G A;  2RI3 A;  2RJE A;  1K73 R;  1C1A A;  3X28 B;  2QGF B;  4BB7 A;  4M7D G;  2CH4 A;  1VQ7 A;  2EKO A;  4LUE A;  3JCM e;  1VQK Q;  3H41 A;  5CQX A;  3M53 A;  1PM3 A;  4JUV A;  1RAE B;  2BKD N;  3OYD A;  1PD1 A;  3CC7 Q;  3LH0 A;  2E5Q A;  4FCY A;  1VQK A;  2EIF A;  3EHQ A;  3JCM f;  5KCO A;  2QQA A;  2L5Q A;  4FM4 B;  2EGC A;  3QII A;  1ABO A;  2YUP A;  2EQK A;  1MND A;  2O9S A;  1YJN T;  1SKU B;  4IUT A;  3L2W A;  1P92 A;  2F69 A;  3UWN A;  2HQH A;  5IHK A;  1YJW T;  2GGR A;  2A08 A;  2VXE A;  1OZ3 A;  2XDB A;  3GLX A;  4KGV B;  3A98 A;  2DTH A;  2DE0 X;  3V8J A;  1Q81 R;  3JCM V;  4NL3 A;  3G6E A;  2RHU A;  2QEX A;  4JZ3 A;  4E7H A;  2XI9 A;  2BUD A;  3M54 A;  4M4Z A;  3EH1 A;  1X27 A;  2LQ8 A;  2M9U A;  1UEB A;  4HXJ A;  2DZ9 A;  2OAW A;  5GAN 3;  1YP5 A;  1OX9 A;  4A54 A;  3CXC P;  2AKL A;  2K6D A;  4ZGE B;  4ZGJ B;  1MGQ A;  1UHC A;  4J7I A;  2MK5 A;  3VS3 A;  4E2F B;  3L2R A;  2F2W A;  1ZLM A;  2B8A A;  1I1J A;  2R5M A;  1D1C A;  1NZ9 A;  2LZ6 B;  4X9D A;  2V8I A;  1PD0 A;  3TU4 K;  2VGM A;  3H0I A;  1KQS P;  1H3Z A;  2J6K A;  3QJY A;  4JDS A;  3T9N A;  3EG0 A;  4PJO E;  4O5V A;  1QVG P;  1VQL T;  1U1T A;  1VIE A;  1IHV A;  3TCJ A;  3A8O B;  7AT1 B;  4D6W A;  1W4S A;  4BD3 A;  2DET A;  3CCM Q;  2FZC B;  3QYG B;  3VS5 A;  1PSE A;  1IGU A;  2JM8 A;  2AZS A;  4IIM A;  1TSF A;  1PKS A;  3CCM A;  4PJO B;  3UDC A;  2LQW A;  2O31 A;  1VUB A;  2M0Y A;  1IHW A;  1OEB A;  3OS5 A;  1VQP Q;  2CH4 W;  2A28 A;  2QQB A;  1XNI A;  1ZHI A;  3OB9 A;  1UG1 A;  1D3B A;  2GFU A;  2XD0 A;  1V76 A;  1I0C A;  1Z9Z A;  2O4X A;  2F2V A;  2DTI A;  2XU8 A;  1RI0 A;  1ZQ1 A;  3VKI A;  2RO0 A;  1VIF A;  4N0A A;  3CMA Q;  1I81 A;  4ME7 A;  3I35 A;  2JZ2 A;  3HL8 A;  3PTA A;  4ZTF A;  5IXF A;  1M8V A;  1WHM A;  1XJW B;  5KE3 A;  3LGL A;  5HKC A;  3DB3 A;  2ZPB B;  2XIC A;  4C8Q C;  2MCN A;  2L89 A;  3OY9 A;  3EFO B;  1N8R R;  1QP2 A;  3RKY A;  3OQ5 A;  3OSV A;  3ZFJ A;  2JVV A;  3OYA A;  5J39 A;  2RQU A;  1VQO T;  5KE2 A;  3I5R A;  1GFD A;  5LJ5 e;  2IVW A;  1KHC A;  3QZ5 B;  4RKU E;  2E6Z A;  3M9Q A;  1IO6 A;  4KH0 B;  3J81 E;  1X6B A;  4HVW A;  3JB9 J;  2DJZ A;  2KRM A;  1ABQ A;  3VU3 C;  3A8G B;  3CPW A;  1D0Z A;  3TQ7 P;  5DM7 R;  2LCS A;  1QVF A;  2J6O A;  3AHU A;  3FLG A;  3FJ5 A;  1K9M R;  2HEQ A;  5LJ5 f;  1UFF A;  2F1L A;  4RTX A;  5IAY A;  3EGU A;  1WX6 A;  2QAS A;  2BZX A;  4F04 B;  1FMW A;  4ATO A;  1T0H A;  5KYW A;  4F7U A;  2NUZ A;  4HKE A;  3SB2 A;  4CC4 B;  3MHX A;  9ATC B;  3G71 A;  3ZL7 C;  2G3R A;  5CAI A;  2NUT B;  1ZUK A;  5J3B A;  3LYI A;  1Y0M A;  1PRL C;  1VQN Q;  1M3A A;  2FEI A;  3TEE A;  1YIJ Q;  2LJ1 A;  3FRN A;  3LLR A;  3M0U A;  2QTX A;  2CP7 A;  3HSB A;  3CBP A;  1YHQ A;  3TVT A;  1SHG A;  2VGN A;  4M77 C;  3JCM h;  3REA B;  1FX7 A;  1O9S A;  2CZ1 B;  1YIJ A;  3CD6 T;  4M78 C;  2E41 A;  4WF2 A;  2RD1 A;  1GCP A;  1K4U S;  3RMQ A;  4C92 E;  2KRO A;  3CCS T;  1MMD A;  1WA7 A;  2YWW A;  5GAO r;  1RAD B;  3ER0 A;  4A53 A;  2X9H A;  2OTJ T;  1V29 B;  2XDP A;  2E6N A;  1NJI U;  1GCQ A;  2H3E B;  2DIQ A;  5EG2 A;  3I56 A;  4EPC A;  1BYM A;  1AWO A;  3NFC A;  2KSS A;  2IPO B;  4N4G A;  2B86 A;  1YWP A;  3PIP A;  2D8H A;  2VUB A;  4C92 B;  2J7I A;  4FYW B;  1Y7X A;  1C0M A;  3UF4 A;  2FG0 A;  1LNX A;  4PFO A;  4JS5 A;  4BI8 B;  1VYT A;  4FW1 A;  1UB4 A;  2HBW A;  2MI6 A;  2K79 A;  4ELZ C;  1K8A U;  3M0R A;  3QPH A;  2AT1 B;  2KK4 A;  1VQ9 A;  1QVF S;  3VUZ A;  3QO3 A;  2QA4 Q;  2DF6 A;  2JOY A;  3RR6 A;  2ROT A;  3H8Z A;  5CKE A;  1JXM A;  5L8R E;  4IUP A;  3ZBD A;  1N27 A;  1VQ8 Q;  1RLQ C;  3P8B B;  1YJN Q;  4M75 C;  1U3O A;  2DA9 A;  4BY6 C;  4C0D C;  3CCJ T;  3S3M A;  3SDZ A;  1KD1 C;  4LUD A;  3OA6 A;  2MPX C;  4OMM A;  2KE9 A;  3H9N A;  4RCB A;  1OU8 A;  1SEM A;  4M7A F;  3M5A A;  2O9V A;  1KD1 R;  1VQ4 T;  1HD3 A;  2QEX T;  3E19 A;  2EFI A;  2KGT A;  2XK0 A;  4ZN3 A;  4LDW A;  2EYZ A;  2CP6 A;  4C5E A;  3JCM g;  1ZUY A;  1ZA1 B;  2D1X A;  2OAU A;  2DPP B;  3RKW A;  1YI2 Q;  4M7A G;  1M90 R;  1UGV A;  3PIO A;  2DL4 A;  2CDT A;  4O6J A;  4HCZ A;  2GTJ A;  3GIB A;  4QQG A;  1CKA A;  1TXQ A;  4N4H A;  4MZP A;  1U1S A;  3I55 A;  3CCL A;  3EG3 A;  1MV0 B;  2LTO A;  2QTV A;  2CZ7 B;  5GAO n;  3UAT A;  5GAO q;  3M58 A;  2K2M A;  2E65 A;  1JJ2 A;  2W0Z A;  2JMA A;  2JT4 A;  5LJ5 d;  3H0H A;  3FC3 A;  4JPB W;  3EHR A;  4C8Q E;  1RAF B;  3OYC A;  1BB9 A;  1AWW A;  3EFS A;  2V1R A;  1Q7Y U;  2E3I A;  2JW4 A;  2EVR A;  2V8J A;  1YJ9 T;  4DOW A;  1G3W A;  2GQV A;  2KXC A;  2C0O A;  2HQX A;  3KXT A;  1ZSZ C;  3L1A A;  3CC2 A;  2K7A A;  1ZBJ A;  2VWF A;  1KFZ A;  1E7O A;  3E2U A;  1UGS B;  2P0P A;  5GJW B;  2X3W D;  4C8Q B;  2F5T X;  1PKT A;  1G2B A;  1D0Y A;  2CP5 A;  1R8O B;  4LDY A;  5GAM e;  1M30 A;  3OW2 P;  4E7S A;  4DA4 A;  1H8K A;  4PJO A;  3DLM A;  3OMG A;  4HVU A;  1N6A A;  1WPY A;  1AOJ A;  3ASK A;  3BDU A;  3JCM Q;  2JUF A;  1CSK A;  2DNU A;  4F7U E;  4AT1 B;  5GAM f;  1VQM T;  1BIA A;  2DVJ A;  2FYK A;  1FMK A;  2G6F X;  3INZ A;  1BIB A;  4L59 A;  1QLY A;  3FDR A;  1KC8 R;  2Y90 A;  3J7A F;  4QT7 A;  2E12 A;  3C0C A;  4KUL A;  1X6O A;  5GMK l;  5HK3 A;  4VUB A;  3QHS A;  3HPW A;  4MMK A;  1KQ1 A;  5FWC A;  2F2X A;  4XU3 A;  1X6G A;  2HAX A;  2D9T A;  4LDX A;  4M77 E;  4OB0 B;  4ESR A;  2COW A;  1AD5 A;  1S72 T;  1YIT Q;  2YSQ A;  4PJN A;  4M7A D;  3EFO A;  2MYS A;  3GNG A;  4M78 E;  2RJD A;  3OYG A;  3MCA B;  4F14 A;  1QWF A;  4R56 A;  2MAM A;  2D0Q B;  1ZSG A;  3TSW A;  1O75 A;  3FJP A;  2KRN A;  4J9F A;  1YIT A;  2JM9 A;  1JJ2 S;  4LDU A;  2JS0 A;  5HY6 A;  4FL6 A;  3D7S B;  3KFV A;  3MEA A;  4M77 B;  2JJ9 A;  3E9G A;  2JS2 A;  5KYY B;  4M78 B;  2Y4Y A;  2CP0 A;  2RHX A;  3G71 T;  1IXD A;  2ZGW A;  3CC4 A;  2BZY A;  2K3Y A;  2I0N A;  3CCR A;  2EQU A;  3PGG A;  4AFS C;  1LPL A;  4GLM A;  4GY5 A;  4BUG A;  2ENM A;  1YHQ T;  4M7D C;  3VRZ A;  2X3X D;  2L3Q A;  4XK8 E;  4C5I A;  5M9O A;  2NUT A;  2R58 A;  4DBR A;  1BBZ A;  3CD6 Q;  2ED0 A;  3PT9 A;  3CPW P;  2VAS A;  4LE9 A;  3CCS Q;  3GOX A;  4R0K A;  3VS1 A;  1UJ0 A;  4RG2 A;  4OMF B;  2EGE A;  2SRC A;  1IGQ A;  3O8V A;  2HSE B;  4M75 E;  4EMK C;  3CME Q;  4XU0 A;  1IB8 A;  4BAC A;  1K73 C;  2EJ9 A;  2LNH B;  3JCM J;  1NE8 A;  3CCQ T;  1BI2 A;  1LCK A;  2YRV A;  5KYU B;  5HCK A;  3O5Z A;  2JNG A;  5LJ3 d;  2XG8 D;  4J6Y A;  2KYM A;  3M55 A;  4JRI A;  3CME A;  2JXB A;  3EFR A;  1OYX A;  1TTH B;  4C5H A;  1AWJ A;  3HRS A;  1SG5 A;  1Q86 R;  2QXF A;  1AHJ B;  2ATC B;  4X9C A;  1YBY A;  4M75 B;  3RKX A;  3CCV Q;  1JB0 E;  4C0D B;  1K0X A;  2WSF E;  2IIM A;  4C92 A;  1BI1 A;  2AKK A;  1NM7 A;  1DJ7 B;  1Z9Q A;  1VQ5 Q;  2R57 A;  1VQ6 T;  1EZZ B;  4JLI A;  5HK0 A;  5FW9 A;  3SWN B;  2X4W A;  2QQS A;  4CI0 C;  5IXB A;  3CC7 A;  3SEM A;  1Q81 C;  2KT8 A;  1JQQ A;  1GBQ A;  2P4T A;  5LJ5 j;  3I5S A;  3PVL A;  2LVM A;  5CKD A;  1HK9 A;  1VQ5 A;  1K9M U;  2NYS A;  3CCJ Q;  1I5O B;  5FRO A;  4CC3 A;  1H64 1;  4E6R A;  3FIF A;  1WQW A;  2ZPF B;  2ZPE B;  4QVZ A;  2KYB A;  2H8H A;  1G3T A;  1G8X A;  5GAM d;  3A8M B;  1VQ4 Q;  1G83 A;  2GBQ A;  4J6W A;  3J80 E;  2RF0 A;  3CCU T;  4BE2 A;  3CBM A;  5I21 A;  4KGZ B;  2DKG A;  2E64 A;  3HRT A;  2A7Y A;  4PJJ A;  4FU6 A;  2NUP B;  1PC0 A;  3SD4 A;  4AFU C;  2X51 A;  4C92 F;  3A1P A;  3PVQ A;  4RG8 A;  4AFQ C;  4QW2 A;  1ZSZ B;  4DEX A;  4HVV A;  4XTX A;  1RL2 A;  3JCM c;  2EQJ A;  5CR2 A;  2LX9 A;  3I55 T;  3RMS A;  2DXU A;  5D6X A;  2RK2 A;  2YLC A;  4KRT A;  2KT1 A;  3BDL A;  2LT4 A;  8ATC B;  2OTL Q;  1VA7 A;  1M4Z A;  2EW3 A;  1X69 A;  1Q82 R;  2EPD A;  4JZ4 A;  3VS6 A;  3SFM A;  2EKH A;  3OYB A;  1YJ9 Q;  1TU0 B;  3EGX B;  1WXU A;  1U06 A;  2EAY A;  4RCC A;  2WAC A;  5I22 A;  2MIO A;  1SRL A;  4A63 B;  4OMO A;  2Y4X A;  4HT9 A;  5FU7 C;  2FL7 A;  2PZ1 A;  4C0G A;  3BY7 A;  2EQI A;  4EMH A;  1TH7 A;  3G4S T;  1ZX6 A;  2RJC A;  4DBQ A;  4ZN1 A;  3JB9 F;  1MMN A;  2C0I A;  1VQP A;  4Z02 A;  3RDV A;  4J7F A;  2EYQ A;  2CYZ B;  2HKQ B;  1N8R C;  1EFN A;  4B9X A;  4JJD A;  1BI3 A;  1G3Y A;  2ESW A;  4ELY C;  4OMQ A;  3CMA A;  2C06 A;  1OZ2 A;  1TWB A;  1WFW A;  4C8Q A;  1VQM Q;  3MP1 A;  2HQE A;  2EJF A;  2ROL A;  3QUI A;  1NYG A;  1W1F A;  1QCO A;  3A5Z B;  3NTI A;  4A4F A;  4BDZ A;  3GBQ A;  4A4K A;  1AZG B;  2DYI A;  3OS2 A;  1D0X A;  3EAE A;  5FU6 C;  1K9M C;  3TSZ A;  3JV3 A;  5IT9 E;  4M7D E;  3MKD A;  1S72 Q;  1NBE B;  1ACM B;  2Z0W A;  2L0A A;  1KD1 U;  2EBP A;  1KK7 A;  5FWB A;  4CRI A;  1LOJ A;  3V8L A;  4EIK A;  1K0S A;  3CCE T;  3OYH A;  2JMC A;  3ZEH A;  1M90 U;  1J3T A;  2CUB A;  1WXT A;  4C92 D;  2MWO A;  2KEA A;  2RQR A;  2ZPI B;  3LX7 A;  4M7D B;  3TRE A;  1KIK A;  2CSQ A;  1UE9 A;  2HNI A;  4V2S A;  5LJ3 j;  3EH2 A;  1SRM A;  2CP3 A;  2K5I A;  2CGH A;  4Q5W A;  2NLU A;  2HSP A;  4LN2 A;  2GCX A;  2LCL A;  2MOX A;  1MUZ A;  3QKJ A;  5KYX B;  4RUG A;  2CRE A;  4M77 A;  1AT1 B;  2PNI A;  5I2S A;  2KNB B;  1QWE A;  3QWY A;  3UA6 A;  3V7C A;  2ZZD A;  5FLX E;  1NG2 A;  4EMK B;  1VQN A;  3OYF A;  4UC4 A;  1M1K R;  2PVO B;  5KYY A;  4M78 A;  3URG A;  1SSF A;  1M27 C;  4FT2 A;  4XU1 A;  4LDV A;  2QAZ A;  1WDX A;  2RB6 A;  2NWM A;  3QDR B;  4E7Z A;  4BI4 A;  2ZPH B;  4XTZ A;  3P8D A;  1G5V A;  1EX4 A;  2J6F A;  4F7U F;  3MET A;  5FRM A;  3JB9 D;  1UDL A;  1RI9 A;  3VS4 A;  2BTT A;  3CCQ Q;  1PSF A;  2AHJ B;  3GF5 A;  2MMP A;  4RTZ A;  2DRM A;  4FIB A;  2RHY A;  2KDS A;  4XAX B;  4ZGD B;  1WLP B;  3LH5 A;  2DD5 A;  5GAM j;  3MP6 A;  2L3S A;  2RQT A;  1I8F A;  1VQ7 T;  3OYN A;  3LWH A;  2KR3 A;  3CPF A;  5KYU A;  1BK2 A;  2LT1 A;  1BU1 A;  4RTU A;  2EJG A;  5I11 A;  2COZ A;  3QDF A;  4M7A C;  2KBT A;  1VQK T;  1WXB A;  2CS7 A;  4RMO A;  1VQ6 Q;  2GQI A;  4II1 A;  2QA4 A;  3AT1 B;  4M75 A;  1AZE A;  2XDD A;  4LD9 K;  1YJW Q;  2YXY A;  4HCK A;  1NPP A;  1WJQ A;  3CQT A;  1VQ8 A;  5GAN j;  3DLL A;  3MPU B;  3A8H B;  3PMT A;  1YJN A;  4L5G A;  1QQJ A;  3VYH B;  1QVG A;  3MEU A;  3SWN A;  1YJW A;  1M90 C;  2RHZ A;  2XHC A;  3G6E T;  2K5L A;  4RTT A;  4JS4 A;  3KBG A;  4QVD A;  1UJY A;  2K9G A;  2P84 A;  5GAN 6;  5CK9 A;  3CCU Q;  3VS2 A;  1PCX A;  5LJ3 e;  5GMK m;  1M3B A;  4PL6 A;  4Y92 A;  1KG1 A;  1X2Q A;  1ZUU A;  3JSC A;  5GMK j;  3NMZ C;  2M51 A;  3BFM A;  4PFP A;  1AVZ C;  4MZM A;  1NYF A;  3CBO A;  3LWI A;  4Z89 A;  1YI2 A;  3NPF A;  2BE7 D;  4XTW A;  1D09 B;  5LJ3 f;  2EGA A;  2C0T A;  1WHK A;  2CZ6 B;  3HTR A;  3L2U A;  3P8H A;  1VQL Q;  2DVE A;  2NUP A;  2VKN A;  1W6X A;  4WTO B;  3PE0 A;  4AG1 C;  4HA8 A;  4LD6 A;  2CT3 A;  5FU7 B;  4OB2 B;  1HYO A;  1ZSZ A;  4IIO A;  4ORZ A;  2PUO B;  1YCS B;  1I4K 1;  5C6S A;  4OF1 A;  2EYW A;  4GLK A;  4AG2 C;  3CCM T;  5LJ5 h;  2RQW A;  1YNZ A;  1QCN A;  4JJC A;  4JLG A;  1K73 U;  1N9S A;  2KMT A;  4BE1 A;  3OSS C;  1Q86 U;  3M56 A;  3OYY A;  4M77 D;  3X25 B;  3CXC S;  4ANJ A;  1RAG B;  4F16 A;  4E7I A;  1OI1 A;  3EGX A;  4PJM A;  1VQP T;  2DBM A;  4E7K A;  1QKW A;  1RLP C;  1KC8 C;  3JCM X;  3OYI A;  3OBW A;  1NJI R;  5FU6 B;  5DLQ E;  2E5K A;  2LJ3 A;  2HBP A;  1QVG S;  3NGP A;  3CMA T;  2RNA A;  2K3B A;  4OP0 A;  3ULR B;  4PLL A;  5CKF A;  1W70 A;  2KXD A;  1VQO Q;  2VXF A;  1FWZ A;  1B3Q A;  1A0N B;  1KHI A;  1T3L A;  1Q81 U;  2RQV A;  1K8A R;  2K2V A;  1X2K A;  3DKM A;  4J9C A;  5GAN e;  3JAM E;  1SPK A;  1VQO A;  2E70 A;  4BDY A;  1FXX A;  2FZK B;  2VVK A;  1NEG A;  4RTY A;  2FHD A;  2K5F A;  1M8M A;  4PJO F;  1WQ7 A;  1WIE A;  3CCE Q;  1Y71 A;  1CKB A;  4HT8 A;  1BCM A;  5D6W A;  5GAN f;  1BI0 A;  3FEO A;  2DD4 A;  2HD0 A;  5IHN A;  2O2O A;  2AZV A;  2BZ8 A;  2A37 A;  3PNW C;  2KVQ G;  2P4R A;  5GMK e;  5GAO m;  3QJ6 A;  3BE3 A; 
#chains in the Genus database with same CATH homology
 2GTO A;  2NUZ A;  4CC4 B;  2DM1 A;  4AFU C;  2DL7 A;  2KRS A;  2LP5 A;  2RMO A;  1SHF A;  3ZL7 C;  3PVQ A;  1UUE A;  1WYX A;  1H3H A;  2YT6 A;  4AFQ C;  1ZUK A;  4OMP A;  4DEX A;  1Y0M A;  4HVV A;  1PRL C;  1M3A A;  2FEI A;  2LJ1 A;  3M0U A;  2D0N A;  1QKX A;  3TVT A;  1SHG A;  4KRT A;  2KT1 A;  3REA B;  1FYN A;  1VA7 A;  2EW3 A;  1X69 A;  2CSI A;  2LX7 A;  3IQL A;  2EPD A;  4JZ4 A;  4X1V A;  3VS6 A;  1HJD A;  1GCP A;  2EKH A;  1K4U S;  2KRO A;  2FPF A;  1WXU A;  1WA7 A;  1U06 A;  3REB B;  5I22 A;  1GCQ A;  2EYX A;  1PRM C;  2MIO A;  2DIL A;  1TUD A;  1SRL A;  2LJ0 A;  4A63 B;  1GL5 A;  4OMO A;  3M0T A;  2DYB A;  2PZ1 A;  1AWO A;  2EQI A;  2B86 A;  1ZX6 A;  1YWP A;  2C0I A;  2FRY A;  4D8K A;  2J05 A;  1E6G A;  2D8H A;  2J7I A;  2JTE A;  1E6H A;  3VS0 A;  3UF4 A;  2FG0 A;  4J9E A;  2YDL A;  4Z8A A;  1EFN A;  4JJD A;  2ESW A;  4OMQ A;  1VYT A;  2GNC A;  2HBW A;  4J9I A;  1WFW A;  2K79 A;  3M0R A;  2PTK A;  2ROL A;  2DX1 A;  1NYG A;  1W1F A;  1T0J A;  2DF6 A;  3GBQ A;  4J9G A;  4AFZ C;  1AZG B;  2ROT A;  1JXM A;  3I9Q A;  4JJB A;  1OPL A;  4OML A;  3TSZ A;  3JV3 A;  1RLQ C;  4J9B A;  1PWT A;  2DL8 A;  2L2P A;  1U3O A;  2QDL A;  4CC7 A;  2DA9 A;  2RPN A;  3SHW A;  2L0A A;  2J06 A;  2EBP A;  3QWX X;  4LUD A;  2DRK A;  5EC7 A;  4DEY A;  1TG0 A;  1X43 A;  1PHT A;  5FWB A;  4OMM A;  2KE9 A;  3RNJ A;  4EIK A;  1K0S A;  4RTW A;  2JMC A;  1J3T A;  1SEM A;  2EYY A;  2CUB A;  1U5S A;  1WXT A;  2O9V A;  1HD3 A;  2KEA A;  1T3S A;  2RQR A;  2KGT A;  1KIK A;  2CSQ A;  1UE9 A;  2EYZ A;  1ZUY A;  2D1X A;  1SRM A;  1UGV A;  4CC2 A;  2ED1 A;  2DL4 A;  1GFC A;  2FO0 A;  3M0S A;  2CDT A;  2HDA A;  2HSP A;  1Y57 A;  1S1N A;  2YUQ A;  4LN2 A;  1NLP C;  2GTJ A;  2MOX A;  1MUZ A;  1CKA A;  1JXO A;  3NHN A;  4J9D A;  1OOT A;  2DL5 A;  4RUG A;  2CRE A;  2SEM A;  2PNI A;  1NLO C;  1QWE A;  2KNB B;  3EG3 A;  3QWY A;  3UA6 A;  1MV0 B;  1NG2 A;  2LQN A;  3UAT A;  1K76 A;  2K2M A;  3EG2 A;  2O88 A;  2OI3 A;  2W0Z A;  2JMA A;  2JT4 A;  3H0H A;  3U23 A;  1QCF A;  1M27 C;  3UA7 A;  3H0F A;  4JPB W;  2FPE A;  1OPK A;  5IH2 A;  2HCK A;  3EHR A;  1WDX A;  2ABL A;  2FRW A;  2NWM A;  1BB9 A;  1AWW A;  2DLP A;  2V1R A;  2JW4 A;  2EVR A;  2KXC A;  2C0O A;  2J6F A;  4WCI A;  1GRI A;  1UDL A;  4ZNX A;  2K7A A;  1RI9 A;  1ZBJ A;  1JO8 A;  3VS4 A;  1VYU A;  1KSW A;  2VWF A;  1KFZ A;  1E7O A;  2BTT A;  1ARK A;  4J9H A;  4OMN A;  5GJW B;  2X3W D;  4RTZ A;  2DRM A;  1PKT A;  2DL3 A;  1G2B A;  1GBR A;  1WLP B;  3LH5 A;  1OV3 A;  2L3S A;  2RQT A;  1M30 A;  5GJV B;  2A36 A;  4FSS A;  1PNJ A;  1H8K A;  4F17 A;  1MV3 A;  2KR3 A;  3M0Q A;  4HVU A;  1AOJ A;  2FPD A;  2CH4 A;  1BK2 A;  2YUN A;  1CSK A;  4LUE A;  1BU1 A;  2DNU A;  3H41 A;  4RTU A;  5I11 A;  2KBT A;  2DVJ A;  2G6F X;  1FMK A;  1QLY A;  1WXB A;  2GQI A;  4QT7 A;  3C0C A;  3EHQ A;  5FWC A;  2F2X A;  1AZE A;  1X6G A;  2EGC A;  1ABO A;  1M3C A;  2YUP A;  4HCK A;  2O9S A;  4ESR A;  5L23 A;  1AWX A;  2XMF A;  1AD5 A;  3CQT A;  1AEY A;  2OJ2 A;  2YSQ A;  1JU5 C;  5IHK A;  5ECA A;  2GGR A;  2A08 A;  1K1Z A;  2YUO A;  1NEB A;  4F14 A;  1QWF A;  3A98 A;  1ZSG A;  3TSW A;  4RTT A;  2KRN A;  4J9F A;  2JM9 A;  2DE0 X;  5IHI A;  1UJY A;  2JS0 A;  2K9G A;  1YN8 A;  4JZ3 A;  3KFV A;  3VS2 A;  3RBB B;  2V1Q A;  4M4Z A;  1M3B A;  2ECZ A;  4Y92 A;  1X27 A;  1X2Q A;  4HXJ A;  1ZUU A;  1B07 A;  2OAW A;  1YP5 A;  3NMZ C;  1KJW A;  2JS2 A;  2M51 A;  1AVZ C;  1NYF A;  2L3P A;  2AKL A;  2K6D A;  4Z89 A;  3NPF A;  3VS3 A;  1UHC A;  1I07 A;  2BZY A;  2F2W A;  1ZLM A;  1I1J A;  2I0N A;  2LZ6 B;  1N5Z A;  1HSQ A;  4AFS C;  4GLM A;  2EGA A;  2C0T A;  4D8D A;  3H0I A;  2VKN A;  2J6K A;  1W6X A;  3PE0 A;  4AG1 C;  2ENM A;  3EG0 A;  2CT3 A;  3VRZ A;  2X3X D;  2L3Q A;  1RUW A;  2DMO A;  2D8J A;  1BBZ A;  1VYV A;  2ED0 A;  4IIO A;  4ORZ A;  3VS5 A;  4LE9 A;  1YCS B;  2DJQ A;  4R0K A;  2EYW A;  3VS1 A;  1UJ0 A;  2JM8 A;  2AZS A;  4Z88 A;  1K9A A;  2EGE A;  4AG2 C;  3THK A;  2SRC A;  2RQW A;  4IIM A;  3R6N A;  1YNZ A;  1PKS A;  4JJC A;  1H92 A;  2LQW A;  1WI7 A;  2O31 A;  2M0Y A;  1OEB A;  2LNH B;  2CH4 W;  2A28 A;  2CUD A;  1LCK A;  1UG1 A;  1GCQ C;  5HCK A;  4GBQ A;  1JEG A;  3O5Z A;  4K11 A;  4F16 A;  1I0C A;  1Z9Z A;  2KYM A;  2DBM A;  2F2V A;  1QKW A;  1TUC A;  2JXB A;  1RLP C;  1AWJ A;  3VRY A;  1UTI A;  2DBK A;  3I35 A;  2E5K A;  2LJ3 A;  2CT4 A;  3NGP A;  2RNA A;  2K3B A;  5IXF A;  1K0X A;  3ULR B;  1UEC A;  2IIM A;  1W70 A;  2AKK A;  1NM7 A;  1XOV A;  2AK5 A;  2MCN A;  2KXD A;  3M0P A;  1Z9Q A;  4LNP A;  5FW9 A;  1B3Q A;  1A0N B;  5IXB A;  1T3L A;  3SEM A;  3VS7 A;  2RQU A;  2KT8 A;  2RQV A;  1JQQ A;  1GBQ A;  3I5R A;  3I5S A;  3PVL A;  1X2K A;  4J9C A;  4RTV A;  1GFD A;  1SPK A;  1IO6 A;  4CC3 A;  1X6B A;  4HVW A;  4E6R A;  2VVK A;  1NEG A;  2KRM A;  2RN8 A;  1ABQ A;  3EG1 A;  4RTY A;  1M8M A;  1WIE A;  2KYB A;  2H8H A;  2LCS A;  1CKB A;  2J6O A;  3FJ5 A;  2HEQ A;  1UFF A;  5IHN A;  1UHF A;  1V1C A;  1G83 A;  2LMJ A;  2O2O A;  2GBQ A;  3EGU A;  4RTX A;  2AZV A;  1WX6 A;  1YWO A;  2BZ8 A;  2BZX A;  2A37 A;  2RF0 A;  2W10 A;  1SSH A;  2P4R A;  1T0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...