2FRWA

Solution structure of the second sh3 domain of human adaptor protein nck2
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
57
structure length
57
Chain Sequence
IPAFVKFAYVAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQIGWFPSNYVLEEVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Cytoplasmic protein NCK2
publication title Structural Insight into the Binding Diversity between the Human Nck2 SH3 Domains and Proline-Rich Proteins
pubmed doi rcsb
source organism Homo sapiens
total genus 5
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2frwA00
4Z8AA 2C0OA 1ZSGA 4EIKA 4M4ZA 2ED0A 2J05A 1SRLA 5I22A 1TG0A 3VS4A 4RTZA 2P4RA 2J6OA 1ZBJA 4JJDA 2F2XA 3O5ZA 3UA6A 4IIMA 1X69A 2EGEA 4DEXA 3VS7A 3VS0A 4F17A 1E6HA 1H92A 1K0SA 2DF6A 3R6NA 2FPEA 1I0CA 4CC4B 2LX7A 4IIOA 1AWWA 3I5RA 1WIEA 3REBB 2CH4A 2CT3A 2KRMA 1PRMC 2FPFA 1WXUA 1E7OA 4CC2A 1JEGA 2B86A 2JM8A 1BB9A 4RTTA 1WA7A 2CT4A 2FEIA 4RTWA 1RLQC 1YCSB 2LCSA 2J6FA 2JMAA 3M0QA 4X1VA 1K0XA 2RPNA 1NEBA 1X2QA 1QLYA 2AZSA 2LZ6B 1WX6A 2JS2A 1HSQA 2L3PA 1AWJA 2KROA 4GBQA 1KSWA 2RQTA 1MUZA 4Y92A 1UJ0A 2AKLA 2VKNA 2FO0A 1GCPA 4E6RA 3H0HA 2W10A 1SRMA 2LQNA 2E5KA 4RTVA 2EVRA 1B3QA 1TUDA 1JQQA 1ZX6A 1ZLMA 2KT8A 2X3WD 5GJWB 2YUPA 2DL3A 2HBWA 4HVWA 1GBQA 1GL5A 2DM1A 1MV0B 5IH2A 2KYMA 2BZXA 2HSPA 3EG2A 5FWBA 3A98A 4OMLA 1OEBA 1WDXA 2L2PA 3C0CA 2JXBA 3H41A 1M8MA 1SSHA 1RUWA 2RQWA 1JXOA 1K76A 2CSQA 2A28A 3IQLA 4J9EA 2JMCA 2O2OA 2RF0A 4J9DA 2W0ZA 2AK5A 3VS2A 1AEYA 2J6KA 2ESWA 3M0PA 2ROLA 2YDLA 2GGRA 2PTKA 4AFQC 3I35A 1UFFA 2VVKA 1FMKA 4R0KA 2LNHB 4CC3A 1FYNA 2EBPA 1VYUA 3UA7A 4OMOA 1KIKA 3PE0A 3M0RA 1WXBA 4ORZA 2KR3A 2KRSA 2RMOA 1YNZA 2GQIA 5FWCA 1SHFA 5EC7A 5IHIA 4LUDA 2J06A 2AZVA 2LJ1A 2JT4A 2DBMA 3RBBB 2DJQA 2K2MA 1Y0MA 2GTOA 2V1RA 1NLPC 2YUNA 1NM7A 1X6GA 3EHRA 1N5ZA 1BK2A 1M27C 2EYXA 4AFSC 1KFZA 1ZUYA 3PVLA 1MV3A 3QWXX 3H0IA 1NG2A 3M0SA 1K9AA 1QKXA 1GCQC 1GFCA 1QWFA 2QDLA 2V1QA 1VYVA 2D8HA 4OMNA 2DRMA 2ROTA 4AG1C 1WFWA 3TVTA 1EFNA 4ESRA 1W1FA 4FSSA 2GNCA 2JTEA 2L3SA 2RQVA 1HJDA 1U06A 2DLPA 2D8JA 2C0IA 2PZ1A 3RNJA 5IXBA 1NLOC 4JZ4A 1AZEA 1X43A 2HDAA 2AKKA 2YSQA 2MIOA 3CQTA 4HCKA 1G83A 1A0NB 2A08A 2EW3A 2DMOA 1RLPC 2YUQA 1WXTA 2GTJA 1HD3A 3VS1A 3ZL7C 2JS0A 2EYYA 2KYBA 1T0HA 1WYXA 4WCIA 2EKHA 1JU5C 2H8HA 5IHNA 3FJ5A 1QKWA 3UF4A 2DILA 2DYBA 4RTXA 1H8KA 2DRKA 1OPLA 4OMPA 1Y57A 2GBQA 2KRNA 1OV3A 3GBQA 3UATA 4JPBW 2NWMA 1JXMA 2DE0X 3VS6A 3H0FA 1KJWA 5FW9A 2DL7A 4AFUC 1SPKA 1V1CA 2FG0A 1AWXA 2BZ8A 1PHTA 1AD5A 1RI9A 1YP5A 1I1JA 2DVJA 4RTYA 4OMQA 2HCKA 2LJ0A 1PKSA 1H3HA 1WLPB 5IXFA 3NPFA 4J9GA 1NYFA 2XMFA 2DA9A 2YT6A 1J3TA 1BBZA 2LMJA 2OAWA 2DNUA 3M0UA 2K6DA 4LN2A 4F14A 5IHKA 4QT7A 5HCKA 4JJBA 2FRWA 2KT1A 4Z89A 1QWEA 1AOJA 4JJCA 1BU1A 2LQWA 2PNIA 2O31A 2SRCA 2RQUA 2FRYA 2D0NA 1W70A 2ABLA 5L23A 4HVUA 1PWTA 2EYWA 3I5SA 2L0AA 2ENMA 1PRLC 1NEGA 2DL8A 2KXDA 1UUEA 2RQRA 3EHQA 2A37A 2DL5A 2BZYA 1WI7A 3TSWA 1GBRA 1PKTA 1GRIA 1T0JA 2J7IA 2O9VA 2K79A 2LP5A 1TUCA 1M30A 2KE9A 4CC7A 2EGCA 2YUOA 1VA7A 2DBKA 1X2KA 2RN8A 1SEMA 4J9CA 3EG0A 2M51A 4LNPA 2I0NA 1CKBA 1YN8A 2KNBB 3VRZA 1I07A 2CSIA 2KXCA 1Z9ZA 1CKAA 2EPDA 2JW4A 2K9GA 4A63B 2EGAA 4J9HA 2M0YA 3TSZA 1SHGA 1PNJA 4JZ3A 2CREA 4D8KA 2EQIA 1UDLA 1QCFA 3PVQA 5ECAA 5GJVB 3SHWA 2L3QA 1GFDA 4RUGA 2SEMA 1X27A 1OPKA 4GLMA 1K1ZA 1AWOA 4LUEA 1ARKA 2F2VA 2F2WA 1XOVA 1U3OA 4Z88A 2EYZA 2MOXA 1S1NA 4F16A 3REAB 3NHNA 2DL4A 3M0TA 2X3XD 1LCKA 1YWPA 1UE9A 4LE9A 4RTUA 3NMZC 2D1XA 2O88A 2NUZA 3ULRB 1ABQA 4J9IA 1ABOA 2ED1A 2O9SA 1T3SA 2K3BA 3JV3A 3KFVA 1W6XA 2A36A 1M3CA 3NGPA 3U23A 3THKA 2LJ3A 2HEQA 1ZUUA 2DX1A 1YWOA 3EG1A 3EG3A 2CDTA 1B07A 1U5SA 1UJYA 2OI3A 1CSKA 1Z9QA 4DEYA 1M3BA 1UGVA 2JM9A 4OMMA 4K11A 1JO8A 1UG1A 2CUDA 2KGTA 1M3AA 1G2BA 3QWYA 1GCQA 2C0TA 2VWFA 2K7AA 2CUBA 1IO6A 4J9BA 2OJ2A 1AZGB 3EGUA 4ZNXA 1UHCA 2CH4W 4AFZC 2KBTA 1NYGA 1K4US 1X6BA 1UECA 3VRYA 4HVVA 1ZUKA 1AVZC 1VYTA 2BTTA 2ECZA 4AG2C 1T3LA 2RNAA 3VS5A 1UTIA 2MCNA 3VS3A 2IIMA 1OOTA 4KRTA 3SEMA 3I9QA 4D8DA 4HXJA 1UHFA 3LH5A 1E6GA 2FPDA 4J9FA 2KEAA 2G6FX 5I11A
chains in the Genus database with same CATH superfamily
3ZEHA 4J6YA 3E9FA 4IUTA 2QGFB 4JLGA 1GXIE 1SRLA 5I22A 1BI0A 3TCJA 1VQ9T 1N8RR 1KC8R 4C0GA 1X69A 1X6OA 4C92A 3QZ9B 4PJJA 3AT1B 2DZCA 4F17A 1E6HA 2DF6A 4J83A 2FPEA 1I0CA 4CC4B 4PJOA 2E3IA 1AWWA 5GAN2 4CI0C 2CH4A 2CT3A 4MDWA 4LDYA 3CCEA 1YHQA 4IUUA 2ZPEB 1BI2A 1E7OA 1JEGA 2WSEE 4QVZA 3RUXA 4RTWA 5GAN3 3OYDA 1YCSB 1VQ9A 4EMKA 2RJDA 2KI7A 4X1VA 1K0XA 2K57A 4C8QG 1YHQQ 3CCEQ 1X2QA 1OX8A 2LZ6B 4QQDA 5C0MA 1AWJA 3CPWS 4M75C 2RQTA 2E6ZA 4Y92A 2VKNA 2FO0A 1GCPA 4M7AA 3QZ5B 4KH0B 5A0GA 1VQ7T 2W10A 1TSFA 1W2BA 3OS5A 3JB9I 4RTVA 2KT8A 1JQQA 5GJWB 3EH2A 4RCBA 2YUPA 4C92B 2DM1A 3L42A 3VUBA 3DKMA 2K4YA 1MV0B 3PMIA 1G5VA 4FT2A 2HSPA 5GANh 4PJOB 5DY9A 2L2PA 1N27A 2RQWA 4M77C 1JXOA 5GAN5 4HCBA 2JMCA 1JJ2A 1Q86R 2RF0A 4N0AC 1VQ7A 1AEYA 2H3EB 4BI3A 4EMKB 4FCYA 9ATCB 2GGRA 4XTUA 1WHGA 1FMKA 3L2WA 2DD5A 4CC3A 1FYNA 3S3MA 3OMCA 1VQ7Q 2YRDA 3V8JA 3HRUA 4X9CA 4M7AC 1PD0A 5A0DA 1IREB 2BE7D 4M7AB 3SB2A 4XTXA 2AZVA 1OU9A 2LJ1A 2XD0A 1D1CA 3PIOA 2DJQA 2K2MA 4ZTJA 2DXBA 1I8FA 4OB0B 1M9SA 4BI8B 3CCJT 2A3LA 1X6GA 1N5ZA 2EYXA 3M55A 4KT0E 4AFSC 1K9MU 1R0CB 5GAMg 4M75G 1NG2A 4ELYC 3M0SA 1QKXA 2V1QA 1GCQC 2ATCB 3CMAT 1F1BB 2DRMA 1KQ1A 2KSSA 1WFWA 3TVTA 3CCST 1QVGA 1VQ4T 4BY6B 5IN1A 1RAHB 2GCXA 2X35A 4C92G 2M9UA 4FSSA 4JRQA 5KCHA 3CCJA 2RB6A 3JCMh 5KE2A 1M90U 2RQVA 2OTLT 1QVFA 3PIPA 2CP6A 2PZ1A 5IXBA 2LRQA 1LVKA 1NLOC 3X25B 2DEUA 2KMTA 5GAN6 2MIOA 5KYUA 2QK0A 2V8JA 1UGPB 3I56T 2DKGA 2A08A 3ASKA 1WXTA 4WF2A 4HA8A 4E2FB 2JS0A 2EYYA 1VQ4A 4DBRA 3FIFA 5CQXA 2LQKA 1YJ9Q 4M75E 5GMKh 4IKFA 2OTLA 2CGHA 3CMAQ 2DYBA 5LJ3d 3OYFA 2ZPGB 3SDZA 2LX9A 5EG2A 1ZA2B 3JCMJ 2F69A 3CCSQ 1M8VA 1VQ4Q 4MZMA 1U8RA 3UATA 3M58A 5CKFA 1K73U 3VS6A 3TQ7P 3H0FA 3CD6Q 4M7AG 2DXTA 2JN0A 3LYIA 2LCLA 1FX7A 3PFSA 4AFUC 1Y7XA 2FG0A 1AWXA 2E1HA 1Q7YU 4C0DB 1AD5A 1YP5A 4JUVA 4KULA 1WHMA 4JS4A 1Q81U 3I56Q 2HZYA 4X9DA 4JRPA 4FSXA 3VV0A 3MEVA 5IXFA 3E1SA 1NYFA 4M77E 5KYUB 1NJIC 3RKWA 2YT6A 3OYJA 2OAWA 2KDSA 5IHKA 5A0LA 2XU8A 4JJBA 5GAOm 1RAGB 3X24B 1QWEA 4OF1A 3PT9A 1BU1A 1KC8U 2A0FB 4LDUA 5GMKm 3NTHA 3CMET 3CXCA 2ABLA 4JRKA 1KD1R 2BIVA 2RM4A 1M1KC 4RMOA 3FDRA 2HL5C 2I2LA 4PFPA 1SF9A 3HRTA 3I5SA 8AT1B 2L0AA 2ENMA 2X4YA 3OBYA 2DL8A 1Y96A 1UUEA 1BCOA 3A8GB 3TSWA 2DFUA 2YLCA 2YHTA 1M30A 2KE9A 3CMEA 1O9SA 1VA7A 2DBKA 2BE9B 2VC8A 3G71A 1TS9A 1VQOT 3FB9A 3EG0A 4LNPA 5CVIA 1N9RA 3RESA 2HKQB 2KXCA 3CMEQ 1YJNT 3M57A 4J9HA 1ZSZC 4HKEA 4NL2A 4JRIA 4JZ3A 1KG1A 3JCMW 1RACB 4A4EA 4BB7A 3CCQT 4M78F 3GF5A 5GAOr 1UGRB 3L2VA 1JJ2S 3VU3C 3RDVA 3R6OA 1K1ZA 1VQOA 1AWOA 2LNVA 4LUEA 2F2VA 3HRSA 5GAOn 2F2WA 2EQUA 3BY7A 4Z88A 3QJ6A 1QMCA 2MOXA 4GLKA 1Y96B 2XDPA 4ATOA 2X3XD 1YJNA 1YWPA 1UE9A 2RHYA 3OW2P 4RCCA 2O88A 4AT1B 3T9NA 3ULRB 4Y28E 3CCLT 3CCQA 3KFVA 2A36A 4DA4A 4F7UE 4LDWA 1WHLA 1YJNQ 3V8KA 4N4IA 3SD4A 3QBYA 2JVVA 2WSFE 2MWPA 3J80E 3V8LA 4TVRA 4E7HA 4LDVA 1UGVA 4ZGJB 1IHVA 1JO8A 2CUDA 3CBPA 3JCMd 3CCLA 1M3AA 4RKUE 2OTJQ 3E19A 1BI1A 1IO6A 4QVCA 1MNDA 3EGUA 3FLGA 2XHCA 3A8MB 4ZNXA 4AFZC 1MGQA 2VUBA 1QVGS 4Q5WA 3CCLQ 4C92F 2QEXT 1X6BA 2VGMA 1UECA 1XTDA 4KGZB 2QQRA 3QIIA 2HNIA 3TREA 4C5EA 1ZUKA 5FRMA 4A53A 3CCVQ 3CPWP 3MP1A 4PJOF 5DLQE 1UTIA 2MCNA 2B8AA 2HMAA 3CC7T 4IUVA 3OYLA 1AHJB 2KQWA 2QQAA 3EFRA 4F04B 2CP0A 5D6XA 2OX7A 3SEMA 1ZA1B 2LQ8A 2NLUA 2G6FX 2CZ0B 4FIBA 4E7KA 4EIKA 2ZPHB 2ED0A 4R55A 3LH0A 4RTZA 2P4RA 1D0XA 5KYWA 3MJXA 1G3TA 2J6OA 2QEXA 4JJDA 3LGFA 2MMPA 1NPPA 3UA6A 1S72T 3CC4Q 1FWZA 2OAUA 4XTVA 2DAQA 3OYCA 3CC7A 1H92A 1K0SA 5GAMe 3UDCA 2LX7A 4JJNK 1K8AC 3I5RA 1WIEA 2QEXQ 3REBB 3JB9D 2KRMA 1PRMC 2HKNA 4FU6A 4ZN1A 4IURA 4OB1B 4CC2A 1K9MR 2B86A 1O75A 3MEWA 1BB9A 4RTTA 2LT1A 2LCSA 2L3RA 3MHXA 3BDLA 2JMAA 1LPLA 1S72A 1V29B 1QLYA 2AZSA 2X4XA 2JS2A 2Y4XA 1KSWA 2AHJB 2RI5A 3QG1A 3C95A 2X51A 1MUZA 5FU6C 4PL6A 2AKLA 1S72Q 5IT9E 5KYWB 4M78A 2LQNA 2E5KA 2X3WD 1UGQB 4KBMB 2HBWA 2DXUA 3CXCS 3EFSA 5IH2A 4C8QC 1WDXA 3MPUB 4DQ2A 3LW5E 1RUWA 2JTFA 2A28A 4DOWA 4J9EA 1V76A 2L5QA 5KH6A 5I2MA 1K73R 2Y90A 1KQSA 3PTAA 1I5OB 3M0PA 1QCNA 1H641 2RK2A 2PTKA 1QP3A 3I35A 1UFFA 2VVKA 1Q7YR 1HK9A 1VYUA 1KIKA 3OS1A 1WXBA 1LNXA 3GNGA 2KR3A 2KRSA 3P8BB 2RMOA 1YNZA 1VQPA 5FWCA 1G8XA 1SHFA 2P0KA 4M78C 3DLLA 2J06A 3URGA 2DPPB 2R57A 2DBMA 4M78B 2QGGA 1OI1A 4QQ6A 5GMKi 2V1RA 1NLPC 1NM7A 1JB0E 3E2UA 2VASA 1BIBA 1KFZA 3QHSA 1MV3A 2BUDA 3QWXX 1K9AA 1QWFA 1GFCA 3M4GA 4PJMA 1MMDA 4C8QD 2K5FA 4OMNA 2EKOA 4GY5A 4BE2A 1HYOA 4ZTFA 4AG1C 1EZZB 3ER0A 2P4TA 4ESRA 2GNCA 2FVUA 4PJLA 1U06A 2DLPA 4YTLA 2C0IA 3J7AF 1Q82C 1X43A 2AKKA 2DVEA 3JB9H 2GFUA 1G83A 4MMKA 2EW3A 2DMOA 2IVWA 2YUQA 2GTJA 1TUGB 1VQ9Q 1ACMB 1HD3A 3VS1A 4J6WA 4J7FA 4R56A 1PC0A 2KYBA 4WCIA 3RERA 1JU5C 3QYHB 1QKWA 3MP8A 2DILA 8ATCB 4C92C 4RTXA 1OPLA 3EH1A 4OMPA 1Y57A 2KRNA 4XU0A 3QO3A 5CCAA 3GBQA 4JPBW 2E6NA 2NWMA 1YIJA 4PJOC 3OYAA 1OZ3A 5FW9A 1V1CA 2CZ7B 4M78G 2GFAA 5KYXA 2E65A 1RI9A 1I1JA 2FZCB 1VQ5T 4OMQA 4EMKC 4C8QE 5LL6S 2R5AA 1WLPB 3NPFA 3QDRB 3A5ZB 1MMGA 1PD1A 5CR2A 5LJ5g 3M0UA 2VYTA 4IUPA 2XDBA 4LN2A 4F14A 5HCKA 3M53A 2EJFA 2FRWA 4E7IA 4Z89A 1M2OA 1VQ5A 1LOJA 4JJCA 4M75D 2LQWA 1JJ2P 2CZ1B 5KYNA 2FRYA 3RKYA 2D0NA 1W70A 1RAFB 3LWHA 1VQ5Q 4DOVA 4A4HA 4NS5A 4PFOA 1WJSA 5KYXB 1EIFA 1NEGA 3WVDB 1QP2A 2ZPIB 1I4K1 4L6V5 2DL5A 2YRCA 3HFNA 1GBRA 1PKTA 1WZOA 4M77D 4BY6C 2K79A 2LP5A 4LDXA 1NPRA 3BE3A 4B9WA 3OSVA 2ZCFB 2XKOC 2QXFA 1SEMA 3Q1JA 3QSUA 4XAXB 1CKBA 1YN8A 2KNBB 5GMKe 3HKSA 2QI2A 4PJOG 4XQ3A 1Z9ZA 4HT9A 3HHTB 2EPDA 4A63B 2EGAA 4QW2A 3CCJQ 1PNJA 3QKJA 1RADB 4D8KA 4M7AD 5FU7B 1UDLA 3PVQA 3SHWA 1QVGP 1NJIU 3CBMA 1X27A 3FEOA 1ARKA 1PM3A 2KVQG 1U3OA 2E70A 3REAB 3NHNA 2DL4A 2EQKA 1YBYA 3META 1PG5B 3DB4A 3PGGA 4J9IA 1XJWB 2ED1A 7AT1B 1T3SA 3JV3A 4C92E 2OTLQ 4C0DC 1M3CA 5LJ3g 3NGPA 3U23A 4PJOE 1RI0A 3X20B 1ZUUA 3KBGA 1M1KU 1XNIA 2QQ9A 1M90C 3EG1A 2CDTA 3V7RA 1D1AA 1VUBA 2PVOB 1U5SA 2OI3A 4DBFA 2F1LA 4OMMA 5HY6A 4PLIA 2KGTA 2QTXA 4M7DA 4BD3A 2C0TA 1SKUB 3JRZA 2VWFA 1Q95G 3MP6A 4J9BA 4XTZA 3JCMQ 5L8RE 2DYIA 2P0PA 1R8OB 1D3BA 5CKEA 2FB7A 1K4US 4M7AE 2IG0A 3G71T 2PQWA 4HVVA 2LT4A 1QCOA 1AVZC 1WQWA 2ECZA 1TU0B 2F5KA 2RNAA 2DD4A 2RHIA 3VS5A 1TOVA 3LLRA 3VS3A 2IIMA 1OOTA 2NUTA 2LTOA 1IB8A 3I9QA 4HXJA 3A8HB 1KHIA 3KXTA 1B34A 1N6AA 3JCMc 5I11A 2ZAEA 4Z8AA 3HFOA 4E7JA 2C0OA 1Q81C 1M2VA 5J39A 5CO7A 2Y4YA 5CKDA 3CCUT 1XQHA 1W2BS 5GAMf 4ME7A 3VS7A 3VS0A 2PVDB 5CKHA 4M7DB 3R6NA 3JB9J 4NOYA 4CRIA 5GANg 3FC3A 2L8DA 3BW1A 2ZPFB 2DO3A 4N4GA 3G71Q 4A4GA 1AT1B 3C94A 4OVAA 1N8RC 1KC8C 2EFIA 2NUPB 1D3BB 4FW1A 2FEIA 2J6FA 3JCMX 1VQMT 2X4WA 3CCUA 4QQGA 2RPNA 2RI2A 1NEBA 3OW2A 2CP3A 2NUTB 3EGDA 1OQKA 2KROA 4GBQA 1B34B 3J81E 2VXEA 3CCUQ 1VQOQ 3DB3A 1M2VB 2DIQA 4C5GA 4E6RA 3UPUA 3LGLA 1RABB 2DK3A 2EVRA 1TUDA 1MMNA 1VQMA 3GIBA 2DL3A 4AMCA 3CCQQ 3HSBA 1C6VX 2AT1B 3M9QA 2PUOB 2KYMA 2BZXA 5FWBA 3OMGA 3A98A 4KGXB 1OEBA 3VKIA 1TH7A 2JXBA 3H41A 1M8MA 1SSHA 2LVMA 1K76A 2CSQA 5FRNA 3IQLA 2FZGB 4J9DA 3VS2A 3FJPA 2J6KA 2ESWA 4OGCA 2ROLA 4OGEA 4AFQC 2AIRB 2LNHB 3EGDB 2EBPA 3JCMg 3L2UA 4M7DG 3D7SB 3OS0A 1TTHB 4LXCA 3SFMA 5LJ5e 1QVFS 1Q86C 4XU1A 4ORZA 5CAIA 2RD1A 1UB4A 2RK1A 4FYWB 4MZTA 3I55T 2GQIA 3G4ST 2A7YA 5EC7A 3VYGA 5IHIA 4E7ZA 4LUDA 1UEBA 3P8DA 2QDYB 2GTOA 1WHJA 4XK8E 1BYMA 1U1SA 3CC2A 3EHRA 5GAN7 3QUIA 2KAFA 3OYIA 4XTWA 5J3BA 1ZUYA 4OMFB 4MDXA 2QDLA 2E5QA 3MEAA 2D8HA 3I55A 4J7IA 3G4SA 2ROTA 4JLIA 1YFNA 3EFOA 3S3OA 1EFNA 2JZ2A 1VQ6T 2JTEA 3X26B 3CC7Q 1SG5A 1QW1A 3I55Q 3O8VA 1G3SA 3G4SQ 4JZ4A 2MAMA 1D0YA 3MKDA 3LWIA 2YSQA 3CQTA 4HCKA 1A0NB 3UWNA 3OYEA 2K3YA 3VYHB 1G3WA 3JSCA 2MYSA 4ZGEB 2E41A 2R58A 1OZ2A 4OP0A 2CP2A 4E7SA 3VJPA 1T0HA 3A8OB 2QASA 1VQ6A 2EIFA 2MPXC 5IHNA 3ZFJA 1H8KA 2DZ9A 5GAMh 3H8ZA 2GBQA 2HAXA 1JXMA 1QQJA 2CKKA 3CPFA 1NJIR 1VQNT 3OB9A 3QXEB 3EG9A 1WJRA 1SPKA 3QPHA 5C6SA 3EFOB 1U1TA 2BZ8A 1WHKA 2XK0A 2DVJA 2E12A 4B9XA 2HQXA 1VQPT 4BE1A 4RTYA 5LJ3e 3A1PA 1PKSA 1H3HA 4E47A 3G1JA 1IXDA 2RI3A 4NL3A 2DA9A 2QQSA 2D0QB 4LD6A 5M9OA 4VUBA 3HTRA 2LMJA 2DJZA 2VV5A 2X4JA 1VQNA 4PJNA 4QT7A 5D7UA 4FYYB 1M1KR 4A4KA 3M4YA 2FHDA 1VQ8T 2JJ9A 1AOJA 3CBOA 1X75C 3JCMV 5A2QE 1N9SA 2DXCA 2QQBA 2PNIA 1D1BA 2SRCA 2RQUA 3E9GA 4MMLA 2RJFA 2COYA 3PNWC 2VGNA 3JAME 1Q82U 1UGSB 4XTYA 2YLBA 1YCYA 1VQPQ 1PWTA 1P92A 1WNLA 1MMAA 3RIRA 3EG9B 2XDDA 2DTHA 3BDUA 2G3RA 4EDUA 3MO8A 2KXDA 1OYXA 4M75A 3SWNA 1VQ8A 2BZYA 1JBMA 1RAEB 4XU3A 1KD1C 1T0JA 2O9VA 1TUCA 3EAEA 2EGCA 2DETA 3QYGB 1X2KA 2M0OA 4J9CA 2PUKB 2R5MA 1VQ8Q 1HXDA 2COZA 3VRZA 1I07A 1NE8A 3OYHA 2JW4A 4ANJA 3NTIA 4JS5A 1YIJT 2QG9B 4BE0A 2HBPA 1SHGA 4PLLA 5GANe 4RG2A 1MHNA 3OYYA 4M77A 2CREA 2DTOA 2EQIA 2JUFA 1WQ7A 5ECAA 5GJVB 2L3QA 2KY9A 2SEMA 1RL2A 4A4FA 4N0AA 4O5VA 4M78D 4HCCA 4B6MA 1TWBA 4FL6A 1PSEA 1XOVA 2EYZA 1C1AA 1S1NA 2VB6A 4O6JA 4F16A 1YI2T 3M0TA 4HCZA 3SWNC 1LCKA 4RTUA 4M7DF 4M75B 2D1XA 3SWNB 2NYSA 2DTIA 2EAYA 2NUZA 2RHZA 2O9SA 1RAIB 2EWNA 3M59A 1LJOA 2ZPBB 1YJWT 3L2QA 4ZGDB 2CS7A 3C12A 4HT8A 2LJ3A 2HEQA 3RR6A 1YIJQ 5CKBA 1W2BP 4JDSA 3RKXA 3OSSC 5LJ5j 3RMQA 3EG3A 5KYYA 1B07A 1UJYA 1YI2A 2M02A 5J26A 4DEYA 4D6WA 1M3BA 1ZQ1A 4II1A 5LJ5d 1UG1A 2E64A 3MEUA 4M77B 1M4ZA 1G2BA 2QTVA 1GCQA 2QYZA 2HSEB 1YJWA 2CUBA 2OJ2A 2H3JA 1YI2Q 1AZGB 3NFCA 4UC4A 2QA4T 1UHCA 2CH4W 1WHHA 2CYZB 5HKCA 3ZBDA 1JRIA 4ELZC 1BI3A 5GAOq 1YJWQ 2MF2A 1VYTA 2BTTA 3JCMe 1IHWA 4M78E 5CIUA 4C0ZA 5GAMj 4L59A 2E10A 4DBHA 4C92D 4XU2A 3OS2A 4KRTA 4PJOD 5GAMd 1IGQA 1UHFA 1IRXA 1E6GA 2FPDA 2KEAA 2O4XA 1K8AR 2QA4A 1ZSGA 4M4ZA 2J05A 2M1HA 1TG0A 3VS4A 2LC4A 5KYYB 4BUGA 3MCAB 3OQ5A 4FYVB 1ZBJA 1FMWA 3TEEA 2F2XA 2EYQA 3O5ZA 3KUFA 4IIMA 2EGEA 4DEXA 5CK9A 4FT4A 3L1AA 1M1GA 2QA4Q 3JB9F 2EJGA 1YJ9T 4F7UA 4QVDA 4IIOA 4RG8A 2JOYA 4QKUA 3GPLA 4Z02A 1VOMA 4J5YA 2FPFA 2K5LA 2D6FA 1WXUA 1W4SA 5FU7C 3CD6T 1I81A 2JM8A 4J8OA 5KE3A 1WA7A 2CT4A 1RLQC 2FZKB 3M0QA 2JTMA 1FXXA 5I2SA 3DLMA 1KQSS 1QVFP 2RH2A 1WJQA 1WX6A 2L3PA 1HSQA 3G7ZA 4M77G 1D09B 3OYBA 1YJ9A 3CMAA 1K9MC 1UJ0A 2V8IA 5IAYA 2O4XB 4KUIA 5LJ3j 3CCSA 2JNGA 4LD9K 2RO0A 3M54A 3H0HA 3CD6A 1SRMA 5FROA 6AT1B 2COWA 1B3QA 1ZX6A 3CEYA 2LDMA 1ZLMA 4HVWA 1GBQA 1GL5A 1BIAA 3I56A 3GLXA 4F7UB 3EG2A 4OMLA 3C4SA 2HQEA 3C0CA 2CP7A 1VQKT 3OYKA 4WTOB 4C0FA 2CZ6B 2M16A 2DEQA 2O2OA 2W0ZA 2AK5A 2ZGWA 2MI6A 2CP5A 2K3XA 2YDLA 5DM7R 2D9TA 3RMSA 5LJ5f 4R0KA 2RJCA 2NUPA 3UA7A 4OMOA 4E7LA 3PE0A 3M0RA 2K2VA 4OB3B 4FYXB 3JCMP 1VQKA 1K73C 1M5Q1 4N4HA 1TXQA 5GAOp 1N8RU 2EQMA 3INZA 1ZSZA 2JT4A 2LCCA 3RBBB 1Y0MA 1Q7YC 1Y07A 1VIEA 1G3YA 1VQKQ 2YUNA 3ME9A 2PVGB 3CXCP 3FRNA 1BK2A 1M27C 4C8QF 2XIDA 3PVLA 3TU4K 1I5LA 5GANj 3H0IA 3PMTA 2RJEA 4M7DC 3P8HA 1Q82R 1VYVA 3WVEB 5GANd 3GNFB 1W1FA 3UT1A 2HD0A 1FMVA 4PK4A 1R77A 2L3SA 4PNOA 1HJDA 4F7UG 1OU8A 2D8JA 3RNJA 2GQVA 1AZEA 2HDAA 1NZ9A 2C06A 5HK0A 2O01E 4X34A 2PU9B 2E4HA 1ZSZB 3BFMA 3AHUA 1RLPC 2XG8D 1VIFA 5AT1B 5AYFA 3ZL7C 4BDZA 2EQJA 1OULA 1WYXA 3QJYA 5KCOA 3OBWA 2EKHA 2HQHA 2H8HA 1M1FA 2QAZA 3FJ5A 2OTJT 1NBEB 3UF4A 1YITT 3GOXA 2IPOB 2DRKA 3S3NA 1OV3A 1Q86U 4MZPA 2DE0X 4KGVB 4BDYA 1KJWA 4PFZA 2DL7A 1WPYA 2Z0WA 4C5IA 1VQMQ 4M7DD 5LJ3f 2XICA 1PHTA 1RAAB 3HP9A 3CCVT 3V7CA 5DLOA 2HCKA 1Y71A 2LJ0A 3X28B 4ZN3A 2OTJA 1KK7A 4J9GA 2XMFA 1YITA 3CC2T 5GAOl 5D6YA 3CPWA 4Y91A 1J3TA 4KH1B 2ZZDA 1BBZA 2DNUA 1DJ7B 2K6DA 3OA6A 5GMKl 3CCMT 5I21A 4M75F 1K8AU 1YITQ 2P0QA 2KT1A 3CC4T 3CCVA 1B7TA 1WGSA 2O31A 2RHUA 2X9HA 3OYNA 1KHCA 5GAN4 5L23A 1MNEA 5GMKj 4KUDK 2EJ9A 4HVUA 4EMHA 3CCRT 3OY9A 2MK5A 2EYWA 4FW2A 3JCMb 3EGXA 5D6WA 3CCMA 4BACA 1PRLC 3S6WA 3VUZA 4M77F 2YWWA 2BKDN 3CC2Q 2RQRA 1EX4A 3CC4A 3EHQA 2A37A 1BKBA 3G6ET 1WI7A 4DBQA 2J7IA 1GRIA 1D0ZA 2RHXA 2V26A 2F5TX 2YUOA 4J6XA 4CC7A 3CCMQ 4M7DE 4EMGA 1H3ZA 5HK3A 5LJ5h 2YXYA 2RN8A 2WSCE 3H9NA 2M51A 2I0NA 4FM4B 4IUQA 3V7SA 1C0MA 2CSIA 3CCRA 1CKAA 5GANf 1IZ6A 4M7AF 4C5HA 4EPCA 2K9GA 3N5BB 2XI9A 4C8QA 2M0YA 4P5NA 3TSZA 1ZHIA 3L2ZA 3G6EA 3CCRQ 3HPWA 2VXFA 1QCFA 1GFDA 1QVPA 4RUGA 2L89A 3LX7A 4BI4A 1OPKA 4GLMA 1R0BG 3G6EQ 3QDFA 3EGXB 1BCMA 3JB9G 1M90R 4LE9A 3NMZC 1X01A 5CQYA 2YRVA 1VQ6Q 5FU6B 1ABQA 1ABOA 2E3HA 2K3BA 1PCXA 1W6XA 1VQLT 2KK4A 2GF7A 3THKA 2DIGA 2P84A 1KQ2A 4OB2B 1OX9A 2DX1A 1YWOA 3WXMB 4PKCC 1CSKA 1Z9QA 2WACA 4C8QB 4A54A 2JM9A 4V2SA 1ZBXA 2HL3A 4K11A 2DERA 1KD1U 3QWYA 1VQLA 1IGUA 3A8LB 2K7AA 2MWOA 2FYKA 3GP8A 1PSFA 4L5GA 1SSFA 2KBTA 2RA2A 1VQNQ 1NYGA 2FL7A 1KQSP 3JCMf 3OYMA 3HL8A 1VQLQ 3VRYA 1Q81R 4F7UF 4AG2C 1T3LA 3H6ZA 3M56A 3L2RA 3OYGA 2K5IA 3F70A 5LJ3h 2V8KA 3OW2S 5FLXE 4D8DA 3M5AA 3NTKA 1YHQT 3CCET 3LH5A 4J9FA 5GAN8
chains in the Genus database with same CATH topology
4Z8AA 2C0OA 1ZSGA 4EIKA 4M4ZA 2ED0A 2J05A 1SRLA 5I22A 1TG0A 3VS4A 4RTZA 2P4RA 2J6OA 1ZBJA 4JJDA 2F2XA 3O5ZA 3UA6A 4IIMA 1X69A 2EGEA 4DEXA 3VS7A 3VS0A 4F17A 1E6HA 1H92A 1K0SA 2DF6A 3R6NA 2FPEA 1I0CA 4CC4B 2LX7A 4IIOA 1AWWA 3I5RA 1WIEA 3REBB 2CH4A 2CT3A 2KRMA 1PRMC 2FPFA 1WXUA 1E7OA 4CC2A 1JEGA 2B86A 2JM8A 1BB9A 4RTTA 1WA7A 2CT4A 2FEIA 4RTWA 1RLQC 1YCSB 2LCSA 2J6FA 2JMAA 3M0QA 4X1VA 1K0XA 2RPNA 1NEBA 1X2QA 1QLYA 2AZSA 2LZ6B 1WX6A 2JS2A 1HSQA 2L3PA 1AWJA 2KROA 4GBQA 1KSWA 2RQTA 1MUZA 4Y92A 1UJ0A 2AKLA 2VKNA 2FO0A 1GCPA 4E6RA 3H0HA 2W10A 1SRMA 2LQNA 2E5KA 4RTVA 2EVRA 1B3QA 1TUDA 1JQQA 1ZX6A 1ZLMA 2KT8A 2X3WD 5GJWB 2YUPA 2DL3A 2HBWA 4HVWA 1GBQA 1GL5A 2DM1A 1MV0B 5IH2A 2KYMA 2BZXA 2HSPA 3EG2A 5FWBA 3A98A 4OMLA 1OEBA 1WDXA 2L2PA 3C0CA 2JXBA 3H41A 1M8MA 1SSHA 1RUWA 2RQWA 1JXOA 1K76A 2CSQA 2A28A 3IQLA 4J9EA 2JMCA 2O2OA 2RF0A 4J9DA 2W0ZA 2AK5A 3VS2A 1AEYA 2J6KA 2ESWA 3M0PA 2ROLA 2YDLA 2GGRA 2PTKA 4AFQC 3I35A 1UFFA 2VVKA 1FMKA 4R0KA 2LNHB 4CC3A 1FYNA 2EBPA 1VYUA 3UA7A 4OMOA 1KIKA 3PE0A 3M0RA 1WXBA 4ORZA 2KR3A 2KRSA 2RMOA 1YNZA 2GQIA 5FWCA 1SHFA 5EC7A 5IHIA 4LUDA 2J06A 2AZVA 2LJ1A 2JT4A 2DBMA 3RBBB 2DJQA 2K2MA 1Y0MA 2GTOA 2V1RA 1NLPC 2YUNA 1NM7A 1X6GA 3EHRA 1N5ZA 1BK2A 1M27C 2EYXA 4AFSC 1KFZA 1ZUYA 3PVLA 1MV3A 3QWXX 3H0IA 1NG2A 3M0SA 1K9AA 1QKXA 1GCQC 1GFCA 1QWFA 2QDLA 2V1QA 1VYVA 2D8HA 4OMNA 2DRMA 2ROTA 4AG1C 1WFWA 3TVTA 1EFNA 4ESRA 1W1FA 4FSSA 2GNCA 2JTEA 2L3SA 2RQVA 1HJDA 1U06A 2DLPA 2D8JA 2C0IA 2PZ1A 3RNJA 5IXBA 1NLOC 4JZ4A 1AZEA 1X43A 2HDAA 2AKKA 2YSQA 2MIOA 3CQTA 4HCKA 1G83A 1A0NB 2A08A 2EW3A 2DMOA 1RLPC 2YUQA 1WXTA 2GTJA 1HD3A 3VS1A 3ZL7C 2JS0A 2EYYA 2KYBA 1T0HA 1WYXA 4WCIA 2EKHA 1JU5C 2H8HA 5IHNA 3FJ5A 1QKWA 3UF4A 2DILA 2DYBA 4RTXA 1H8KA 2DRKA 1OPLA 4OMPA 1Y57A 2GBQA 2KRNA 1OV3A 3GBQA 3UATA 4JPBW 2NWMA 1JXMA 2DE0X 3VS6A 3H0FA 1KJWA 5FW9A 2DL7A 4AFUC 1SPKA 1V1CA 2FG0A 1AWXA 2BZ8A 1PHTA 1AD5A 1RI9A 1YP5A 1I1JA 2DVJA 4RTYA 4OMQA 2HCKA 2LJ0A 1PKSA 1H3HA 1WLPB 5IXFA 3NPFA 4J9GA 1NYFA 2XMFA 2DA9A 2YT6A 1J3TA 1BBZA 2LMJA 2OAWA 2DNUA 3M0UA 2K6DA 4LN2A 4F14A 5IHKA 4QT7A 5HCKA 4JJBA 2FRWA 2KT1A 4Z89A 1QWEA 1AOJA 4JJCA 1BU1A 2LQWA 2PNIA 2O31A 2SRCA 2RQUA 2FRYA 2D0NA 1W70A 2ABLA 5L23A 4HVUA 1PWTA 2EYWA 3I5SA 2L0AA 2ENMA 1PRLC 1NEGA 2DL8A 2KXDA 1UUEA 2RQRA 3EHQA 2A37A 2DL5A 2BZYA 1WI7A 3TSWA 1GBRA 1PKTA 1GRIA 1T0JA 2J7IA 2O9VA 2K79A 2LP5A 1TUCA 1M30A 2KE9A 4CC7A 2EGCA 2YUOA 1VA7A 2DBKA 1X2KA 2RN8A 1SEMA 4J9CA 3EG0A 2M51A 4LNPA 2I0NA 1CKBA 1YN8A 2KNBB 3VRZA 1I07A 2CSIA 2KXCA 1Z9ZA 1CKAA 2EPDA 2JW4A 2K9GA 4A63B 2EGAA 4J9HA 2M0YA 3TSZA 1SHGA 1PNJA 4JZ3A 2CREA 4D8KA 2EQIA 1UDLA 1QCFA 3PVQA 5ECAA 5GJVB 3SHWA 2L3QA 1GFDA 4RUGA 2SEMA 1X27A 1OPKA 4GLMA 1K1ZA 1AWOA 4LUEA 1ARKA 2F2VA 2F2WA 1XOVA 1U3OA 4Z88A 2EYZA 2MOXA 1S1NA 4F16A 3REAB 3NHNA 2DL4A 3M0TA 2X3XD 1LCKA 1YWPA 1UE9A 4LE9A 4RTUA 3NMZC 2D1XA 2O88A 2NUZA 3ULRB 1ABQA 4J9IA 1ABOA 2ED1A 2O9SA 1T3SA 2K3BA 3JV3A 3KFVA 1W6XA 2A36A 1M3CA 3NGPA 3U23A 3THKA 2LJ3A 2HEQA 1ZUUA 2DX1A 1YWOA 3EG1A 3EG3A 2CDTA 1B07A 1U5SA 1UJYA 2OI3A 1CSKA 1Z9QA 4DEYA 1M3BA 1UGVA 2JM9A 4OMMA 4K11A 1JO8A 1UG1A 2CUDA 2KGTA 1M3AA 1G2BA 3QWYA 1GCQA 2C0TA 2VWFA 2K7AA 2CUBA 1IO6A 4J9BA 2OJ2A 1AZGB 3EGUA 4ZNXA 1UHCA 2CH4W 4AFZC 2KBTA 1NYGA 1K4US 1X6BA 1UECA 3VRYA 4HVVA 1ZUKA 1AVZC 1VYTA 2BTTA 2ECZA 4AG2C 1T3LA 2RNAA 3VS5A 1UTIA 2MCNA 3VS3A 2IIMA 1OOTA 4KRTA 3SEMA 3I9QA 4D8DA 4HXJA 1UHFA 3LH5A 1E6GA 2FPDA 4J9FA 2KEAA 2G6FX 5I11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z8A A;  2C0O A;  1ZSG A;  4EIK A;  4M4Z A;  2ED0 A;  2J05 A;  1SRL A;  5I22 A;  1TG0 A;  3VS4 A;  4RTZ A;  2P4R A;  2J6O A;  1ZBJ A;  4JJD A;  2F2X A;  3O5Z A;  3UA6 A;  4IIM A;  1X69 A;  2EGE A;  4DEX A;  3VS7 A;  3VS0 A;  4F17 A;  1E6H A;  1H92 A;  1K0S A;  2DF6 A;  3R6N A;  2FPE A;  1I0C A;  4CC4 B;  2LX7 A;  4IIO A;  1AWW A;  3I5R A;  1WIE A;  3REB B;  2CH4 A;  2CT3 A;  2KRM A;  1PRM C;  2FPF A;  1WXU A;  1E7O A;  4CC2 A;  1JEG A;  2B86 A;  2JM8 A;  1BB9 A;  4RTT A;  1WA7 A;  2CT4 A;  2FEI A;  4RTW A;  1RLQ C;  1YCS B;  2LCS A;  2J6F A;  2JMA A;  3M0Q A;  4X1V A;  1K0X A;  2RPN A;  1NEB A;  1X2Q A;  1QLY A;  2AZS A;  2LZ6 B;  1WX6 A;  2JS2 A;  1HSQ A;  2L3P A;  1AWJ A;  2KRO A;  4GBQ A;  1KSW A;  2RQT A;  1MUZ A;  4Y92 A;  1UJ0 A;  2AKL A;  2VKN A;  2FO0 A;  1GCP A;  4E6R A;  3H0H A;  2W10 A;  1SRM A;  2LQN A;  2E5K A;  4RTV A;  2EVR A;  1B3Q A;  1TUD A;  1JQQ A;  1ZX6 A;  1ZLM A;  2KT8 A;  2X3W D;  5GJW B;  2YUP A;  2DL3 A;  2HBW A;  4HVW A;  1GBQ A;  1GL5 A;  2DM1 A;  1MV0 B;  5IH2 A;  2KYM A;  2BZX A;  2HSP A;  3EG2 A;  5FWB A;  3A98 A;  4OML A;  1OEB A;  1WDX A;  2L2P A;  3C0C A;  2JXB A;  3H41 A;  1M8M A;  1SSH A;  1RUW A;  2RQW A;  1JXO A;  1K76 A;  2CSQ A;  2A28 A;  3IQL A;  4J9E A;  2JMC A;  2O2O A;  2RF0 A;  4J9D A;  2W0Z A;  2AK5 A;  3VS2 A;  1AEY A;  2J6K A;  2ESW A;  3M0P A;  2ROL A;  2YDL A;  2GGR A;  2PTK A;  4AFQ C;  3I35 A;  1UFF A;  2VVK A;  1FMK A;  4R0K A;  2LNH B;  4CC3 A;  1FYN A;  2EBP A;  1VYU A;  3UA7 A;  4OMO A;  1KIK A;  3PE0 A;  3M0R A;  1WXB A;  4ORZ A;  2KR3 A;  2KRS A;  2RMO A;  1YNZ A;  2GQI A;  5FWC A;  1SHF A;  5EC7 A;  5IHI A;  4LUD A;  2J06 A;  2AZV A;  2LJ1 A;  2JT4 A;  2DBM A;  3RBB B;  2DJQ A;  2K2M A;  1Y0M A;  2GTO A;  2V1R A;  1NLP C;  2YUN A;  1NM7 A;  1X6G A;  3EHR A;  1N5Z A;  1BK2 A;  1M27 C;  2EYX A;  4AFS C;  1KFZ A;  1ZUY A;  3PVL A;  1MV3 A;  3QWX X;  3H0I A;  1NG2 A;  3M0S A;  1K9A A;  1QKX A;  1GCQ C;  1GFC A;  1QWF A;  2QDL A;  2V1Q A;  1VYV A;  2D8H A;  4OMN A;  2DRM A;  2ROT A;  4AG1 C;  1WFW A;  3TVT A;  1EFN A;  4ESR A;  1W1F A;  4FSS A;  2GNC A;  2JTE A;  2L3S A;  2RQV A;  1HJD A;  1U06 A;  2DLP A;  2D8J A;  2C0I A;  2PZ1 A;  3RNJ A;  5IXB A;  1NLO C;  4JZ4 A;  1AZE A;  1X43 A;  2HDA A;  2AKK A;  2YSQ A;  2MIO A;  3CQT A;  4HCK A;  1G83 A;  1A0N B;  2A08 A;  2EW3 A;  2DMO A;  1RLP C;  2YUQ A;  1WXT A;  2GTJ A;  1HD3 A;  3VS1 A;  3ZL7 C;  2JS0 A;  2EYY A;  2KYB A;  1T0H A;  1WYX A;  4WCI A;  2EKH A;  1JU5 C;  2H8H A;  5IHN A;  3FJ5 A;  1QKW A;  3UF4 A;  2DIL A;  2DYB A;  4RTX A;  1H8K A;  2DRK A;  1OPL A;  4OMP A;  1Y57 A;  2GBQ A;  2KRN A;  1OV3 A;  3GBQ A;  3UAT A;  4JPB W;  2NWM A;  1JXM A;  2DE0 X;  3VS6 A;  3H0F A;  1KJW A;  5FW9 A;  2DL7 A;  4AFU C;  1SPK A;  1V1C A;  2FG0 A;  1AWX A;  2BZ8 A;  1PHT A;  1AD5 A;  1RI9 A;  1YP5 A;  1I1J A;  2DVJ A;  4RTY A;  4OMQ A;  2HCK A;  2LJ0 A;  1PKS A;  1H3H A;  1WLP B;  5IXF A;  3NPF A;  4J9G A;  1NYF A;  2XMF A;  2DA9 A;  2YT6 A;  1J3T A;  1BBZ A;  2LMJ A;  2OAW A;  2DNU A;  3M0U A;  2K6D A;  4LN2 A;  4F14 A;  5IHK A;  4QT7 A;  5HCK A;  4JJB A;  2FRW A;  2KT1 A;  4Z89 A;  1QWE A;  1AOJ A;  4JJC A;  1BU1 A;  2LQW A;  2PNI A;  2O31 A;  2SRC A;  2RQU A;  2FRY A;  2D0N A;  1W70 A;  2ABL A;  5L23 A;  4HVU A;  1PWT A;  2EYW A;  3I5S A;  2L0A A;  2ENM A;  1PRL C;  1NEG A;  2DL8 A;  2KXD A;  1UUE A;  2RQR A;  3EHQ A;  2A37 A;  2DL5 A;  2BZY A;  1WI7 A;  3TSW A;  1GBR A;  1PKT A;  1GRI A;  1T0J A;  2J7I A;  2O9V A;  2K79 A;  2LP5 A;  1TUC A;  1M30 A;  2KE9 A;  4CC7 A;  2EGC A;  2YUO A;  1VA7 A;  2DBK A;  1X2K A;  2RN8 A;  1SEM A;  4J9C A;  3EG0 A;  2M51 A;  4LNP A;  2I0N A;  1CKB A;  1YN8 A;  2KNB B;  3VRZ A;  1I07 A;  2CSI A;  2KXC A;  1Z9Z A;  1CKA A;  2EPD A;  2JW4 A;  2K9G A;  4A63 B;  2EGA A;  4J9H A;  2M0Y A;  3TSZ A;  1SHG A;  1PNJ A;  4JZ3 A;  2CRE A;  4D8K A;  2EQI A;  1UDL A;  1QCF A;  3PVQ A;  5ECA A;  5GJV B;  3SHW A;  2L3Q A;  1GFD A;  4RUG A;  2SEM A;  1X27 A;  1OPK A;  4GLM A;  1K1Z A;  1AWO A;  4LUE A;  1ARK A;  2F2V A;  2F2W A;  1XOV A;  1U3O A;  4Z88 A;  2EYZ A;  2MOX A;  1S1N A;  4F16 A;  3REA B;  3NHN A;  2DL4 A;  3M0T A;  2X3X D;  1LCK A;  1YWP A;  1UE9 A;  4LE9 A;  4RTU A;  3NMZ C;  2D1X A;  2O88 A;  2NUZ A;  3ULR B;  1ABQ A;  4J9I A;  1ABO A;  2ED1 A;  2O9S A;  1T3S A;  2K3B A;  3JV3 A;  3KFV A;  1W6X A;  2A36 A;  1M3C A;  3NGP A;  3U23 A;  3THK A;  2LJ3 A;  2HEQ A;  1ZUU A;  2DX1 A;  1YWO A;  3EG1 A;  3EG3 A;  2CDT A;  1B07 A;  1U5S A;  1UJY A;  2OI3 A;  1CSK A;  1Z9Q A;  4DEY A;  1M3B A;  1UGV A;  2JM9 A;  4OMM A;  4K11 A;  1JO8 A;  1UG1 A;  2CUD A;  2KGT A;  1M3A A;  1G2B A;  3QWY A;  1GCQ A;  2C0T A;  2VWF A;  2K7A A;  2CUB A;  1IO6 A;  4J9B A;  2OJ2 A;  1AZG B;  3EGU A;  4ZNX A;  1UHC A;  2CH4 W;  4AFZ C;  2KBT A;  1NYG A;  1K4U S;  1X6B A;  1UEC A;  3VRY A;  4HVV A;  1ZUK A;  1AVZ C;  1VYT A;  2BTT A;  2ECZ A;  4AG2 C;  1T3L A;  2RNA A;  3VS5 A;  1UTI A;  2MCN A;  3VS3 A;  2IIM A;  1OOT A;  4KRT A;  3SEM A;  3I9Q A;  4D8D A;  4HXJ A;  1UHF A;  3LH5 A;  1E6G A;  2FPD A;  4J9F A;  2KEA A;  2G6F X;  5I11 A; 
#chains in the Genus database with same CATH topology
 3ZEH A;  4J6Y A;  3E9F A;  4IUT A;  2QGF B;  4JLG A;  1GXI E;  1SRL A;  5I22 A;  1BI0 A;  3TCJ A;  1VQ9 T;  1N8R R;  1KC8 R;  4C0G A;  1X69 A;  1X6O A;  4C92 A;  3QZ9 B;  4PJJ A;  3AT1 B;  2DZC A;  4F17 A;  1E6H A;  2DF6 A;  4J83 A;  2FPE A;  1I0C A;  4CC4 B;  4PJO A;  2E3I A;  1AWW A;  5GAN 2;  4CI0 C;  2CH4 A;  2CT3 A;  4MDW A;  4LDY A;  3CCE A;  1YHQ A;  4IUU A;  2ZPE B;  1BI2 A;  1E7O A;  1JEG A;  2WSE E;  4QVZ A;  3RUX A;  4RTW A;  5GAN 3;  3OYD A;  1YCS B;  1VQ9 A;  4EMK A;  2RJD A;  2KI7 A;  4X1V A;  1K0X A;  2K57 A;  4C8Q G;  1YHQ Q;  3CCE Q;  1X2Q A;  1OX8 A;  2LZ6 B;  4QQD A;  5C0M A;  1AWJ A;  3CPW S;  4M75 C;  2RQT A;  2E6Z A;  4Y92 A;  2VKN A;  2FO0 A;  1GCP A;  4M7A A;  3QZ5 B;  4KH0 B;  5A0G A;  1VQ7 T;  2W10 A;  1TSF A;  1W2B A;  3OS5 A;  3JB9 I;  4RTV A;  2KT8 A;  1JQQ A;  5GJW B;  3EH2 A;  4RCB A;  2YUP A;  4C92 B;  2DM1 A;  3L42 A;  3VUB A;  3DKM A;  2K4Y A;  1MV0 B;  3PMI A;  1G5V A;  4FT2 A;  2HSP A;  5GAN h;  4PJO B;  5DY9 A;  2L2P A;  1N27 A;  2RQW A;  4M77 C;  1JXO A;  5GAN 5;  4HCB A;  2JMC A;  1JJ2 A;  1Q86 R;  2RF0 A;  4N0A C;  1VQ7 A;  1AEY A;  2H3E B;  4BI3 A;  4EMK B;  4FCY A;  9ATC B;  2GGR A;  4XTU A;  1WHG A;  1FMK A;  3L2W A;  2DD5 A;  4CC3 A;  1FYN A;  3S3M A;  3OMC A;  1VQ7 Q;  2YRD A;  3V8J A;  3HRU A;  4X9C A;  4M7A C;  1PD0 A;  5A0D A;  1IRE B;  2BE7 D;  4M7A B;  3SB2 A;  4XTX A;  2AZV A;  1OU9 A;  2LJ1 A;  2XD0 A;  1D1C A;  3PIO A;  2DJQ A;  2K2M A;  4ZTJ A;  2DXB A;  1I8F A;  4OB0 B;  1M9S A;  4BI8 B;  3CCJ T;  2A3L A;  1X6G A;  1N5Z A;  2EYX A;  3M55 A;  4KT0 E;  4AFS C;  1K9M U;  1R0C B;  5GAM g;  4M75 G;  1NG2 A;  4ELY C;  3M0S A;  1QKX A;  2V1Q A;  1GCQ C;  2ATC B;  3CMA T;  1F1B B;  2DRM A;  1KQ1 A;  2KSS A;  1WFW A;  3TVT A;  3CCS T;  1QVG A;  1VQ4 T;  4BY6 B;  5IN1 A;  1RAH B;  2GCX A;  2X35 A;  4C92 G;  2M9U A;  4FSS A;  4JRQ A;  5KCH A;  3CCJ A;  2RB6 A;  3JCM h;  5KE2 A;  1M90 U;  2RQV A;  2OTL T;  1QVF A;  3PIP A;  2CP6 A;  2PZ1 A;  5IXB A;  2LRQ A;  1LVK A;  1NLO C;  3X25 B;  2DEU A;  2KMT A;  5GAN 6;  2MIO A;  5KYU A;  2QK0 A;  2V8J A;  1UGP B;  3I56 T;  2DKG A;  2A08 A;  3ASK A;  1WXT A;  4WF2 A;  4HA8 A;  4E2F B;  2JS0 A;  2EYY A;  1VQ4 A;  4DBR A;  3FIF A;  5CQX A;  2LQK A;  1YJ9 Q;  4M75 E;  5GMK h;  4IKF A;  2OTL A;  2CGH A;  3CMA Q;  2DYB A;  5LJ3 d;  3OYF A;  2ZPG B;  3SDZ A;  2LX9 A;  5EG2 A;  1ZA2 B;  3JCM J;  2F69 A;  3CCS Q;  1M8V A;  1VQ4 Q;  4MZM A;  1U8R A;  3UAT A;  3M58 A;  5CKF A;  1K73 U;  3VS6 A;  3TQ7 P;  3H0F A;  3CD6 Q;  4M7A G;  2DXT A;  2JN0 A;  3LYI A;  2LCL A;  1FX7 A;  3PFS A;  4AFU C;  1Y7X A;  2FG0 A;  1AWX A;  2E1H A;  1Q7Y U;  4C0D B;  1AD5 A;  1YP5 A;  4JUV A;  4KUL A;  1WHM A;  4JS4 A;  1Q81 U;  3I56 Q;  2HZY A;  4X9D A;  4JRP A;  4FSX A;  3VV0 A;  3MEV A;  5IXF A;  3E1S A;  1NYF A;  4M77 E;  5KYU B;  1NJI C;  3RKW A;  2YT6 A;  3OYJ A;  2OAW A;  2KDS A;  5IHK A;  5A0L A;  2XU8 A;  4JJB A;  5GAO m;  1RAG B;  3X24 B;  1QWE A;  4OF1 A;  3PT9 A;  1BU1 A;  1KC8 U;  2A0F B;  4LDU A;  5GMK m;  3NTH A;  3CME T;  3CXC A;  2ABL A;  4JRK A;  1KD1 R;  2BIV A;  2RM4 A;  1M1K C;  4RMO A;  3FDR A;  2HL5 C;  2I2L A;  4PFP A;  1SF9 A;  3HRT A;  3I5S A;  8AT1 B;  2L0A A;  2ENM A;  2X4Y A;  3OBY A;  2DL8 A;  1Y96 A;  1UUE A;  1BCO A;  3A8G B;  3TSW A;  2DFU A;  2YLC A;  2YHT A;  1M30 A;  2KE9 A;  3CME A;  1O9S A;  1VA7 A;  2DBK A;  2BE9 B;  2VC8 A;  3G71 A;  1TS9 A;  1VQO T;  3FB9 A;  3EG0 A;  4LNP A;  5CVI A;  1N9R A;  3RES A;  2HKQ B;  2KXC A;  3CME Q;  1YJN T;  3M57 A;  4J9H A;  1ZSZ C;  4HKE A;  4NL2 A;  4JRI A;  4JZ3 A;  1KG1 A;  3JCM W;  1RAC B;  4A4E A;  4BB7 A;  3CCQ T;  4M78 F;  3GF5 A;  5GAO r;  1UGR B;  3L2V A;  1JJ2 S;  3VU3 C;  3RDV A;  3R6O A;  1K1Z A;  1VQO A;  1AWO A;  2LNV A;  4LUE A;  2F2V A;  3HRS A;  5GAO n;  2F2W A;  2EQU A;  3BY7 A;  4Z88 A;  3QJ6 A;  1QMC A;  2MOX A;  4GLK A;  1Y96 B;  2XDP A;  4ATO A;  2X3X D;  1YJN A;  1YWP A;  1UE9 A;  2RHY A;  3OW2 P;  4RCC A;  2O88 A;  4AT1 B;  3T9N A;  3ULR B;  4Y28 E;  3CCL T;  3CCQ A;  3KFV A;  2A36 A;  4DA4 A;  4F7U E;  4LDW A;  1WHL A;  1YJN Q;  3V8K A;  4N4I A;  3SD4 A;  3QBY A;  2JVV A;  2WSF E;  2MWP A;  3J80 E;  3V8L A;  4TVR A;  4E7H A;  4LDV A;  1UGV A;  4ZGJ B;  1IHV A;  1JO8 A;  2CUD A;  3CBP A;  3JCM d;  3CCL A;  1M3A A;  4RKU E;  2OTJ Q;  3E19 A;  1BI1 A;  1IO6 A;  4QVC A;  1MND A;  3EGU A;  3FLG A;  2XHC A;  3A8M B;  4ZNX A;  4AFZ C;  1MGQ A;  2VUB A;  1QVG S;  4Q5W A;  3CCL Q;  4C92 F;  2QEX T;  1X6B A;  2VGM A;  1UEC A;  1XTD A;  4KGZ B;  2QQR A;  3QII A;  2HNI A;  3TRE A;  4C5E A;  1ZUK A;  5FRM A;  4A53 A;  3CCV Q;  3CPW P;  3MP1 A;  4PJO F;  5DLQ E;  1UTI A;  2MCN A;  2B8A A;  2HMA A;  3CC7 T;  4IUV A;  3OYL A;  1AHJ B;  2KQW A;  2QQA A;  3EFR A;  4F04 B;  2CP0 A;  5D6X A;  2OX7 A;  3SEM A;  1ZA1 B;  2LQ8 A;  2NLU A;  2G6F X;  2CZ0 B;  4FIB A;  4E7K A;  4EIK A;  2ZPH B;  2ED0 A;  4R55 A;  3LH0 A;  4RTZ A;  2P4R A;  1D0X A;  5KYW A;  3MJX A;  1G3T A;  2J6O A;  2QEX A;  4JJD A;  3LGF A;  2MMP A;  1NPP A;  3UA6 A;  1S72 T;  3CC4 Q;  1FWZ A;  2OAU A;  4XTV A;  2DAQ A;  3OYC A;  3CC7 A;  1H92 A;  1K0S A;  5GAM e;  3UDC A;  2LX7 A;  4JJN K;  1K8A C;  3I5R A;  1WIE A;  2QEX Q;  3REB B;  3JB9 D;  2KRM A;  1PRM C;  2HKN A;  4FU6 A;  4ZN1 A;  4IUR A;  4OB1 B;  4CC2 A;  1K9M R;  2B86 A;  1O75 A;  3MEW A;  1BB9 A;  4RTT A;  2LT1 A;  2LCS A;  2L3R A;  3MHX A;  3BDL A;  2JMA A;  1LPL A;  1S72 A;  1V29 B;  1QLY A;  2AZS A;  2X4X A;  2JS2 A;  2Y4X A;  1KSW A;  2AHJ B;  2RI5 A;  3QG1 A;  3C95 A;  2X51 A;  1MUZ A;  5FU6 C;  4PL6 A;  2AKL A;  1S72 Q;  5IT9 E;  5KYW B;  4M78 A;  2LQN A;  2E5K A;  2X3W D;  1UGQ B;  4KBM B;  2HBW A;  2DXU A;  3CXC S;  3EFS A;  5IH2 A;  4C8Q C;  1WDX A;  3MPU B;  4DQ2 A;  3LW5 E;  1RUW A;  2JTF A;  2A28 A;  4DOW A;  4J9E A;  1V76 A;  2L5Q A;  5KH6 A;  5I2M A;  1K73 R;  2Y90 A;  1KQS A;  3PTA A;  1I5O B;  3M0P A;  1QCN A;  1H64 1;  2RK2 A;  2PTK A;  1QP3 A;  3I35 A;  1UFF A;  2VVK A;  1Q7Y R;  1HK9 A;  1VYU A;  1KIK A;  3OS1 A;  1WXB A;  1LNX A;  3GNG A;  2KR3 A;  2KRS A;  3P8B B;  2RMO A;  1YNZ A;  1VQP A;  5FWC A;  1G8X A;  1SHF A;  2P0K A;  4M78 C;  3DLL A;  2J06 A;  3URG A;  2DPP B;  2R57 A;  2DBM A;  4M78 B;  2QGG A;  1OI1 A;  4QQ6 A;  5GMK i;  2V1R A;  1NLP C;  1NM7 A;  1JB0 E;  3E2U A;  2VAS A;  1BIB A;  1KFZ A;  3QHS A;  1MV3 A;  2BUD A;  3QWX X;  1K9A A;  1QWF A;  1GFC A;  3M4G A;  4PJM A;  1MMD A;  4C8Q D;  2K5F A;  4OMN A;  2EKO A;  4GY5 A;  4BE2 A;  1HYO A;  4ZTF A;  4AG1 C;  1EZZ B;  3ER0 A;  2P4T A;  4ESR A;  2GNC A;  2FVU A;  4PJL A;  1U06 A;  2DLP A;  4YTL A;  2C0I A;  3J7A F;  1Q82 C;  1X43 A;  2AKK A;  2DVE A;  3JB9 H;  2GFU A;  1G83 A;  4MMK A;  2EW3 A;  2DMO A;  2IVW A;  2YUQ A;  2GTJ A;  1TUG B;  1VQ9 Q;  1ACM B;  1HD3 A;  3VS1 A;  4J6W A;  4J7F A;  4R56 A;  1PC0 A;  2KYB A;  4WCI A;  3RER A;  1JU5 C;  3QYH B;  1QKW A;  3MP8 A;  2DIL A;  8ATC B;  4C92 C;  4RTX A;  1OPL A;  3EH1 A;  4OMP A;  1Y57 A;  2KRN A;  4XU0 A;  3QO3 A;  5CCA A;  3GBQ A;  4JPB W;  2E6N A;  2NWM A;  1YIJ A;  4PJO C;  3OYA A;  1OZ3 A;  5FW9 A;  1V1C A;  2CZ7 B;  4M78 G;  2GFA A;  5KYX A;  2E65 A;  1RI9 A;  1I1J A;  2FZC B;  1VQ5 T;  4OMQ A;  4EMK C;  4C8Q E;  5LL6 S;  2R5A A;  1WLP B;  3NPF A;  3QDR B;  3A5Z B;  1MMG A;  1PD1 A;  5CR2 A;  5LJ5 g;  3M0U A;  2VYT A;  4IUP A;  2XDB A;  4LN2 A;  4F14 A;  5HCK A;  3M53 A;  2EJF A;  2FRW A;  4E7I A;  4Z89 A;  1M2O A;  1VQ5 A;  1LOJ A;  4JJC A;  4M75 D;  2LQW A;  1JJ2 P;  2CZ1 B;  5KYN A;  2FRY A;  3RKY A;  2D0N A;  1W70 A;  1RAF B;  3LWH A;  1VQ5 Q;  4DOV A;  4A4H A;  4NS5 A;  4PFO A;  1WJS A;  5KYX B;  1EIF A;  1NEG A;  3WVD B;  1QP2 A;  2ZPI B;  1I4K 1;  4L6V 5;  2DL5 A;  2YRC A;  3HFN A;  1GBR A;  1PKT A;  1WZO A;  4M77 D;  4BY6 C;  2K79 A;  2LP5 A;  4LDX A;  1NPR A;  3BE3 A;  4B9W A;  3OSV A;  2ZCF B;  2XKO C;  2QXF A;  1SEM A;  3Q1J A;  3QSU A;  4XAX B;  1CKB A;  1YN8 A;  2KNB B;  5GMK e;  3HKS A;  2QI2 A;  4PJO G;  4XQ3 A;  1Z9Z A;  4HT9 A;  3HHT B;  2EPD A;  4A63 B;  2EGA A;  4QW2 A;  3CCJ Q;  1PNJ A;  3QKJ A;  1RAD B;  4D8K A;  4M7A D;  5FU7 B;  1UDL A;  3PVQ A;  3SHW A;  1QVG P;  1NJI U;  3CBM A;  1X27 A;  3FEO A;  1ARK A;  1PM3 A;  2KVQ G;  1U3O A;  2E70 A;  3REA B;  3NHN A;  2DL4 A;  2EQK A;  1YBY A;  3MET A;  1PG5 B;  3DB4 A;  3PGG A;  4J9I A;  1XJW B;  2ED1 A;  7AT1 B;  1T3S A;  3JV3 A;  4C92 E;  2OTL Q;  4C0D C;  1M3C A;  5LJ3 g;  3NGP A;  3U23 A;  4PJO E;  1RI0 A;  3X20 B;  1ZUU A;  3KBG A;  1M1K U;  1XNI A;  2QQ9 A;  1M90 C;  3EG1 A;  2CDT A;  3V7R A;  1D1A A;  1VUB A;  2PVO B;  1U5S A;  2OI3 A;  4DBF A;  2F1L A;  4OMM A;  5HY6 A;  4PLI A;  2KGT A;  2QTX A;  4M7D A;  4BD3 A;  2C0T A;  1SKU B;  3JRZ A;  2VWF A;  1Q95 G;  3MP6 A;  4J9B A;  4XTZ A;  3JCM Q;  5L8R E;  2DYI A;  2P0P A;  1R8O B;  1D3B A;  5CKE A;  2FB7 A;  1K4U S;  4M7A E;  2IG0 A;  3G71 T;  2PQW A;  4HVV A;  2LT4 A;  1QCO A;  1AVZ C;  1WQW A;  2ECZ A;  1TU0 B;  2F5K A;  2RNA A;  2DD4 A;  2RHI A;  3VS5 A;  1TOV A;  3LLR A;  3VS3 A;  2IIM A;  1OOT A;  2NUT A;  2LTO A;  1IB8 A;  3I9Q A;  4HXJ A;  3A8H B;  1KHI A;  3KXT A;  1B34 A;  1N6A A;  3JCM c;  5I11 A;  2ZAE A;  4Z8A A;  3HFO A;  4E7J A;  2C0O A;  1Q81 C;  1M2V A;  5J39 A;  5CO7 A;  2Y4Y A;  5CKD A;  3CCU T;  1XQH A;  1W2B S;  5GAM f;  4ME7 A;  3VS7 A;  3VS0 A;  2PVD B;  5CKH A;  4M7D B;  3R6N A;  3JB9 J;  4NOY A;  4CRI A;  5GAN g;  3FC3 A;  2L8D A;  3BW1 A;  2ZPF B;  2DO3 A;  4N4G A;  3G71 Q;  4A4G A;  1AT1 B;  3C94 A;  4OVA A;  1N8R C;  1KC8 C;  2EFI A;  2NUP B;  1D3B B;  4FW1 A;  2FEI A;  2J6F A;  3JCM X;  1VQM T;  2X4W A;  3CCU A;  4QQG A;  2RPN A;  2RI2 A;  1NEB A;  3OW2 A;  2CP3 A;  2NUT B;  3EGD A;  1OQK A;  2KRO A;  4GBQ A;  1B34 B;  3J81 E;  2VXE A;  3CCU Q;  1VQO Q;  3DB3 A;  1M2V B;  2DIQ A;  4C5G A;  4E6R A;  3UPU A;  3LGL A;  1RAB B;  2DK3 A;  2EVR A;  1TUD A;  1MMN A;  1VQM A;  3GIB A;  2DL3 A;  4AMC A;  3CCQ Q;  3HSB A;  1C6V X;  2AT1 B;  3M9Q A;  2PUO B;  2KYM A;  2BZX A;  5FWB A;  3OMG A;  3A98 A;  4KGX B;  1OEB A;  3VKI A;  1TH7 A;  2JXB A;  3H41 A;  1M8M A;  1SSH A;  2LVM A;  1K76 A;  2CSQ A;  5FRN A;  3IQL A;  2FZG B;  4J9D A;  3VS2 A;  3FJP A;  2J6K A;  2ESW A;  4OGC A;  2ROL A;  4OGE A;  4AFQ C;  2AIR B;  2LNH B;  3EGD B;  2EBP A;  3JCM g;  3L2U A;  4M7D G;  3D7S B;  3OS0 A;  1TTH B;  4LXC A;  3SFM A;  5LJ5 e;  1QVF S;  1Q86 C;  4XU1 A;  4ORZ A;  5CAI A;  2RD1 A;  1UB4 A;  2RK1 A;  4FYW B;  4MZT A;  3I55 T;  2GQI A;  3G4S T;  2A7Y A;  5EC7 A;  3VYG A;  5IHI A;  4E7Z A;  4LUD A;  1UEB A;  3P8D A;  2QDY B;  2GTO A;  1WHJ A;  4XK8 E;  1BYM A;  1U1S A;  3CC2 A;  3EHR A;  5GAN 7;  3QUI A;  2KAF A;  3OYI A;  4XTW A;  5J3B A;  1ZUY A;  4OMF B;  4MDX A;  2QDL A;  2E5Q A;  3MEA A;  2D8H A;  3I55 A;  4J7I A;  3G4S A;  2ROT A;  4JLI A;  1YFN A;  3EFO A;  3S3O A;  1EFN A;  2JZ2 A;  1VQ6 T;  2JTE A;  3X26 B;  3CC7 Q;  1SG5 A;  1QW1 A;  3I55 Q;  3O8V A;  1G3S A;  3G4S Q;  4JZ4 A;  2MAM A;  1D0Y A;  3MKD A;  3LWI A;  2YSQ A;  3CQT A;  4HCK A;  1A0N B;  3UWN A;  3OYE A;  2K3Y A;  3VYH B;  1G3W A;  3JSC A;  2MYS A;  4ZGE B;  2E41 A;  2R58 A;  1OZ2 A;  4OP0 A;  2CP2 A;  4E7S A;  3VJP A;  1T0H A;  3A8O B;  2QAS A;  1VQ6 A;  2EIF A;  2MPX C;  5IHN A;  3ZFJ A;  1H8K A;  2DZ9 A;  5GAM h;  3H8Z A;  2GBQ A;  2HAX A;  1JXM A;  1QQJ A;  2CKK A;  3CPF A;  1NJI R;  1VQN T;  3OB9 A;  3QXE B;  3EG9 A;  1WJR A;  1SPK A;  3QPH A;  5C6S A;  3EFO B;  1U1T A;  2BZ8 A;  1WHK A;  2XK0 A;  2DVJ A;  2E12 A;  4B9X A;  2HQX A;  1VQP T;  4BE1 A;  4RTY A;  5LJ3 e;  3A1P A;  1PKS A;  1H3H A;  4E47 A;  3G1J A;  1IXD A;  2RI3 A;  4NL3 A;  2DA9 A;  2QQS A;  2D0Q B;  4LD6 A;  5M9O A;  4VUB A;  3HTR A;  2LMJ A;  2DJZ A;  2VV5 A;  2X4J A;  1VQN A;  4PJN A;  4QT7 A;  5D7U A;  4FYY B;  1M1K R;  4A4K A;  3M4Y A;  2FHD A;  1VQ8 T;  2JJ9 A;  1AOJ A;  3CBO A;  1X75 C;  3JCM V;  5A2Q E;  1N9S A;  2DXC A;  2QQB A;  2PNI A;  1D1B A;  2SRC A;  2RQU A;  3E9G A;  4MML A;  2RJF A;  2COY A;  3PNW C;  2VGN A;  3JAM E;  1Q82 U;  1UGS B;  4XTY A;  2YLB A;  1YCY A;  1VQP Q;  1PWT A;  1P92 A;  1WNL A;  1MMA A;  3RIR A;  3EG9 B;  2XDD A;  2DTH A;  3BDU A;  2G3R A;  4EDU A;  3MO8 A;  2KXD A;  1OYX A;  4M75 A;  3SWN A;  1VQ8 A;  2BZY A;  1JBM A;  1RAE B;  4XU3 A;  1KD1 C;  1T0J A;  2O9V A;  1TUC A;  3EAE A;  2EGC A;  2DET A;  3QYG B;  1X2K A;  2M0O A;  4J9C A;  2PUK B;  2R5M A;  1VQ8 Q;  1HXD A;  2COZ A;  3VRZ A;  1I07 A;  1NE8 A;  3OYH A;  2JW4 A;  4ANJ A;  3NTI A;  4JS5 A;  1YIJ T;  2QG9 B;  4BE0 A;  2HBP A;  1SHG A;  4PLL A;  5GAN e;  4RG2 A;  1MHN A;  3OYY A;  4M77 A;  2CRE A;  2DTO A;  2EQI A;  2JUF A;  1WQ7 A;  5ECA A;  5GJV B;  2L3Q A;  2KY9 A;  2SEM A;  1RL2 A;  4A4F A;  4N0A A;  4O5V A;  4M78 D;  4HCC A;  4B6M A;  1TWB A;  4FL6 A;  1PSE A;  1XOV A;  2EYZ A;  1C1A A;  1S1N A;  2VB6 A;  4O6J A;  4F16 A;  1YI2 T;  3M0T A;  4HCZ A;  3SWN C;  1LCK A;  4RTU A;  4M7D F;  4M75 B;  2D1X A;  3SWN B;  2NYS A;  2DTI A;  2EAY A;  2NUZ A;  2RHZ A;  2O9S A;  1RAI B;  2EWN A;  3M59 A;  1LJO A;  2ZPB B;  1YJW T;  3L2Q A;  4ZGD B;  2CS7 A;  3C12 A;  4HT8 A;  2LJ3 A;  2HEQ A;  3RR6 A;  1YIJ Q;  5CKB A;  1W2B P;  4JDS A;  3RKX A;  3OSS C;  5LJ5 j;  3RMQ A;  3EG3 A;  5KYY A;  1B07 A;  1UJY A;  1YI2 A;  2M02 A;  5J26 A;  4DEY A;  4D6W A;  1M3B A;  1ZQ1 A;  4II1 A;  5LJ5 d;  1UG1 A;  2E64 A;  3MEU A;  4M77 B;  1M4Z A;  1G2B A;  2QTV A;  1GCQ A;  2QYZ A;  2HSE B;  1YJW A;  2CUB A;  2OJ2 A;  2H3J A;  1YI2 Q;  1AZG B;  3NFC A;  4UC4 A;  2QA4 T;  1UHC A;  2CH4 W;  1WHH A;  2CYZ B;  5HKC A;  3ZBD A;  1JRI A;  4ELZ C;  1BI3 A;  5GAO q;  1YJW Q;  2MF2 A;  1VYT A;  2BTT A;  3JCM e;  1IHW A;  4M78 E;  5CIU A;  4C0Z A;  5GAM j;  4L59 A;  2E10 A;  4DBH A;  4C92 D;  4XU2 A;  3OS2 A;  4KRT A;  4PJO D;  5GAM d;  1IGQ A;  1UHF A;  1IRX A;  1E6G A;  2FPD A;  2KEA A;  2O4X A;  1K8A R;  2QA4 A;  1ZSG A;  4M4Z A;  2J05 A;  2M1H A;  1TG0 A;  3VS4 A;  2LC4 A;  5KYY B;  4BUG A;  3MCA B;  3OQ5 A;  4FYV B;  1ZBJ A;  1FMW A;  3TEE A;  2F2X A;  2EYQ A;  3O5Z A;  3KUF A;  4IIM A;  2EGE A;  4DEX A;  5CK9 A;  4FT4 A;  3L1A A;  1M1G A;  2QA4 Q;  3JB9 F;  2EJG A;  1YJ9 T;  4F7U A;  4QVD A;  4IIO A;  4RG8 A;  2JOY A;  4QKU A;  3GPL A;  4Z02 A;  1VOM A;  4J5Y A;  2FPF A;  2K5L A;  2D6F A;  1WXU A;  1W4S A;  5FU7 C;  3CD6 T;  1I81 A;  2JM8 A;  4J8O A;  5KE3 A;  1WA7 A;  2CT4 A;  1RLQ C;  2FZK B;  3M0Q A;  2JTM A;  1FXX A;  5I2S A;  3DLM A;  1KQS S;  1QVF P;  2RH2 A;  1WJQ A;  1WX6 A;  2L3P A;  1HSQ A;  3G7Z A;  4M77 G;  1D09 B;  3OYB A;  1YJ9 A;  3CMA A;  1K9M C;  1UJ0 A;  2V8I A;  5IAY A;  2O4X B;  4KUI A;  5LJ3 j;  3CCS A;  2JNG A;  4LD9 K;  2RO0 A;  3M54 A;  3H0H A;  3CD6 A;  1SRM A;  5FRO A;  6AT1 B;  2COW A;  1B3Q A;  1ZX6 A;  3CEY A;  2LDM A;  1ZLM A;  4HVW A;  1GBQ A;  1GL5 A;  1BIA A;  3I56 A;  3GLX A;  4F7U B;  3EG2 A;  4OML A;  3C4S A;  2HQE A;  3C0C A;  2CP7 A;  1VQK T;  3OYK A;  4WTO B;  4C0F A;  2CZ6 B;  2M16 A;  2DEQ A;  2O2O A;  2W0Z A;  2AK5 A;  2ZGW A;  2MI6 A;  2CP5 A;  2K3X A;  2YDL A;  5DM7 R;  2D9T A;  3RMS A;  5LJ5 f;  4R0K A;  2RJC A;  2NUP A;  3UA7 A;  4OMO A;  4E7L A;  3PE0 A;  3M0R A;  2K2V A;  4OB3 B;  4FYX B;  3JCM P;  1VQK A;  1K73 C;  1M5Q 1;  4N4H A;  1TXQ A;  5GAO p;  1N8R U;  2EQM A;  3INZ A;  1ZSZ A;  2JT4 A;  2LCC A;  3RBB B;  1Y0M A;  1Q7Y C;  1Y07 A;  1VIE A;  1G3Y A;  1VQK Q;  2YUN A;  3ME9 A;  2PVG B;  3CXC P;  3FRN A;  1BK2 A;  1M27 C;  4C8Q F;  2XID A;  3PVL A;  3TU4 K;  1I5L A;  5GAN j;  3H0I A;  3PMT A;  2RJE A;  4M7D C;  3P8H A;  1Q82 R;  1VYV A;  3WVE B;  5GAN d;  3GNF B;  1W1F A;  3UT1 A;  2HD0 A;  1FMV A;  4PK4 A;  1R77 A;  2L3S A;  4PNO A;  1HJD A;  4F7U G;  1OU8 A;  2D8J A;  3RNJ A;  2GQV A;  1AZE A;  2HDA A;  1NZ9 A;  2C06 A;  5HK0 A;  2O01 E;  4X34 A;  2PU9 B;  2E4H A;  1ZSZ B;  3BFM A;  3AHU A;  1RLP C;  2XG8 D;  1VIF A;  5AT1 B;  5AYF A;  3ZL7 C;  4BDZ A;  2EQJ A;  1OUL A;  1WYX A;  3QJY A;  5KCO A;  3OBW A;  2EKH A;  2HQH A;  2H8H A;  1M1F A;  2QAZ A;  3FJ5 A;  2OTJ T;  1NBE B;  3UF4 A;  1YIT T;  3GOX A;  2IPO B;  2DRK A;  3S3N A;  1OV3 A;  1Q86 U;  4MZP A;  2DE0 X;  4KGV B;  4BDY A;  1KJW A;  4PFZ A;  2DL7 A;  1WPY A;  2Z0W A;  4C5I A;  1VQM Q;  4M7D D;  5LJ3 f;  2XIC A;  1PHT A;  1RAA B;  3HP9 A;  3CCV T;  3V7C A;  5DLO A;  2HCK A;  1Y71 A;  2LJ0 A;  3X28 B;  4ZN3 A;  2OTJ A;  1KK7 A;  4J9G A;  2XMF A;  1YIT A;  3CC2 T;  5GAO l;  5D6Y A;  3CPW A;  4Y91 A;  1J3T A;  4KH1 B;  2ZZD A;  1BBZ A;  2DNU A;  1DJ7 B;  2K6D A;  3OA6 A;  5GMK l;  3CCM T;  5I21 A;  4M75 F;  1K8A U;  1YIT Q;  2P0Q A;  2KT1 A;  3CC4 T;  3CCV A;  1B7T A;  1WGS A;  2O31 A;  2RHU A;  2X9H A;  3OYN A;  1KHC A;  5GAN 4;  5L23 A;  1MNE A;  5GMK j;  4KUD K;  2EJ9 A;  4HVU A;  4EMH A;  3CCR T;  3OY9 A;  2MK5 A;  2EYW A;  4FW2 A;  3JCM b;  3EGX A;  5D6W A;  3CCM A;  4BAC A;  1PRL C;  3S6W A;  3VUZ A;  4M77 F;  2YWW A;  2BKD N;  3CC2 Q;  2RQR A;  1EX4 A;  3CC4 A;  3EHQ A;  2A37 A;  1BKB A;  3G6E T;  1WI7 A;  4DBQ A;  2J7I A;  1GRI A;  1D0Z A;  2RHX A;  2V26 A;  2F5T X;  2YUO A;  4J6X A;  4CC7 A;  3CCM Q;  4M7D E;  4EMG A;  1H3Z A;  5HK3 A;  5LJ5 h;  2YXY A;  2RN8 A;  2WSC E;  3H9N A;  2M51 A;  2I0N A;  4FM4 B;  4IUQ A;  3V7S A;  1C0M A;  2CSI A;  3CCR A;  1CKA A;  5GAN f;  1IZ6 A;  4M7A F;  4C5H A;  4EPC A;  2K9G A;  3N5B B;  2XI9 A;  4C8Q A;  2M0Y A;  4P5N A;  3TSZ A;  1ZHI A;  3L2Z A;  3G6E A;  3CCR Q;  3HPW A;  2VXF A;  1QCF A;  1GFD A;  1QVP A;  4RUG A;  2L89 A;  3LX7 A;  4BI4 A;  1OPK A;  4GLM A;  1R0B G;  3G6E Q;  3QDF A;  3EGX B;  1BCM A;  3JB9 G;  1M90 R;  4LE9 A;  3NMZ C;  1X01 A;  5CQY A;  2YRV A;  1VQ6 Q;  5FU6 B;  1ABQ A;  1ABO A;  2E3H A;  2K3B A;  1PCX A;  1W6X A;  1VQL T;  2KK4 A;  2GF7 A;  3THK A;  2DIG A;  2P84 A;  1KQ2 A;  4OB2 B;  1OX9 A;  2DX1 A;  1YWO A;  3WXM B;  4PKC C;  1CSK A;  1Z9Q A;  2WAC A;  4C8Q B;  4A54 A;  2JM9 A;  4V2S A;  1ZBX A;  2HL3 A;  4K11 A;  2DER A;  1KD1 U;  3QWY A;  1VQL A;  1IGU A;  3A8L B;  2K7A A;  2MWO A;  2FYK A;  3GP8 A;  1PSF A;  4L5G A;  1SSF A;  2KBT A;  2RA2 A;  1VQN Q;  1NYG A;  2FL7 A;  1KQS P;  3JCM f;  3OYM A;  3HL8 A;  1VQL Q;  3VRY A;  1Q81 R;  4F7U F;  4AG2 C;  1T3L A;  3H6Z A;  3M56 A;  3L2R A;  3OYG A;  2K5I A;  3F70 A;  5LJ3 h;  2V8K A;  3OW2 S;  5FLX E;  4D8D A;  3M5A A;  3NTK A;  1YHQ T;  3CCE T;  3LH5 A;  4J9F A;  5GAN 8; 
#chains in the Genus database with same CATH homology
 4Z8A A;  2C0O A;  1ZSG A;  4EIK A;  4M4Z A;  2ED0 A;  2J05 A;  1SRL A;  5I22 A;  1TG0 A;  3VS4 A;  4RTZ A;  2P4R A;  2J6O A;  1ZBJ A;  4JJD A;  2F2X A;  3O5Z A;  3UA6 A;  4IIM A;  1X69 A;  2EGE A;  4DEX A;  3VS7 A;  3VS0 A;  4F17 A;  1E6H A;  1H92 A;  1K0S A;  2DF6 A;  3R6N A;  2FPE A;  1I0C A;  4CC4 B;  2LX7 A;  4IIO A;  1AWW A;  3I5R A;  1WIE A;  3REB B;  2CH4 A;  2CT3 A;  2KRM A;  1PRM C;  2FPF A;  1WXU A;  1E7O A;  4CC2 A;  1JEG A;  2B86 A;  2JM8 A;  1BB9 A;  4RTT A;  1WA7 A;  2CT4 A;  2FEI A;  4RTW A;  1RLQ C;  1YCS B;  2LCS A;  2J6F A;  2JMA A;  3M0Q A;  4X1V A;  1K0X A;  2RPN A;  1NEB A;  1X2Q A;  1QLY A;  2AZS A;  2LZ6 B;  1WX6 A;  2JS2 A;  1HSQ A;  2L3P A;  1AWJ A;  2KRO A;  4GBQ A;  1KSW A;  2RQT A;  1MUZ A;  4Y92 A;  1UJ0 A;  2AKL A;  2VKN A;  2FO0 A;  1GCP A;  4E6R A;  3H0H A;  2W10 A;  1SRM A;  2LQN A;  2E5K A;  4RTV A;  2EVR A;  1B3Q A;  1TUD A;  1JQQ A;  1ZX6 A;  1ZLM A;  2KT8 A;  2X3W D;  5GJW B;  2YUP A;  2DL3 A;  2HBW A;  4HVW A;  1GBQ A;  1GL5 A;  2DM1 A;  1MV0 B;  5IH2 A;  2KYM A;  2BZX A;  2HSP A;  3EG2 A;  5FWB A;  3A98 A;  4OML A;  1OEB A;  1WDX A;  2L2P A;  3C0C A;  2JXB A;  3H41 A;  1M8M A;  1SSH A;  1RUW A;  2RQW A;  1JXO A;  1K76 A;  2CSQ A;  2A28 A;  3IQL A;  4J9E A;  2JMC A;  2O2O A;  2RF0 A;  4J9D A;  2W0Z A;  2AK5 A;  3VS2 A;  1AEY A;  2J6K A;  2ESW A;  3M0P A;  2ROL A;  2YDL A;  2GGR A;  2PTK A;  4AFQ C;  3I35 A;  1UFF A;  2VVK A;  1FMK A;  4R0K A;  2LNH B;  4CC3 A;  1FYN A;  2EBP A;  1VYU A;  3UA7 A;  4OMO A;  1KIK A;  3PE0 A;  3M0R A;  1WXB A;  4ORZ A;  2KR3 A;  2KRS A;  2RMO A;  1YNZ A;  2GQI A;  5FWC A;  1SHF A;  5EC7 A;  5IHI A;  4LUD A;  2J06 A;  2AZV A;  2LJ1 A;  2JT4 A;  2DBM A;  3RBB B;  2DJQ A;  2K2M A;  1Y0M A;  2GTO A;  2V1R A;  1NLP C;  2YUN A;  1NM7 A;  1X6G A;  3EHR A;  1N5Z A;  1BK2 A;  1M27 C;  2EYX A;  4AFS C;  1KFZ A;  1ZUY A;  3PVL A;  1MV3 A;  3QWX X;  3H0I A;  1NG2 A;  3M0S A;  1K9A A;  1QKX A;  1GCQ C;  1GFC A;  1QWF A;  2QDL A;  2V1Q A;  1VYV A;  2D8H A;  4OMN A;  2DRM A;  2ROT A;  4AG1 C;  1WFW A;  3TVT A;  1EFN A;  4ESR A;  1W1F A;  4FSS A;  2GNC A;  2JTE A;  2L3S A;  2RQV A;  1HJD A;  1U06 A;  2DLP A;  2D8J A;  2C0I A;  2PZ1 A;  3RNJ A;  5IXB A;  1NLO C;  4JZ4 A;  1AZE A;  1X43 A;  2HDA A;  2AKK A;  2YSQ A;  2MIO A;  3CQT A;  4HCK A;  1G83 A;  1A0N B;  2A08 A;  2EW3 A;  2DMO A;  1RLP C;  2YUQ A;  1WXT A;  2GTJ A;  1HD3 A;  3VS1 A;  3ZL7 C;  2JS0 A;  2EYY A;  2KYB A;  1T0H A;  1WYX A;  4WCI A;  2EKH A;  1JU5 C;  2H8H A;  5IHN A;  3FJ5 A;  1QKW A;  3UF4 A;  2DIL A;  2DYB A;  4RTX A;  1H8K A;  2DRK A;  1OPL A;  4OMP A;  1Y57 A;  2GBQ A;  2KRN A;  1OV3 A;  3GBQ A;  3UAT A;  4JPB W;  2NWM A;  1JXM A;  2DE0 X;  3VS6 A;  3H0F A;  1KJW A;  5FW9 A;  2DL7 A;  4AFU C;  1SPK A;  1V1C A;  2FG0 A;  1AWX A;  2BZ8 A;  1PHT A;  1AD5 A;  1RI9 A;  1YP5 A;  1I1J A;  2DVJ A;  4RTY A;  4OMQ A;  2HCK A;  2LJ0 A;  1PKS A;  1H3H A;  1WLP B;  5IXF A;  3NPF A;  4J9G A;  1NYF A;  2XMF A;  2DA9 A;  2YT6 A;  1J3T A;  1BBZ A;  2LMJ A;  2OAW A;  2DNU A;  3M0U A;  2K6D A;  4LN2 A;  4F14 A;  5IHK A;  4QT7 A;  5HCK A;  4JJB A;  2FRW A;  2KT1 A;  4Z89 A;  1QWE A;  1AOJ A;  4JJC A;  1BU1 A;  2LQW A;  2PNI A;  2O31 A;  2SRC A;  2RQU A;  2FRY A;  2D0N A;  1W70 A;  2ABL A;  5L23 A;  4HVU A;  1PWT A;  2EYW A;  3I5S A;  2L0A A;  2ENM A;  1PRL C;  1NEG A;  2DL8 A;  2KXD A;  1UUE A;  2RQR A;  3EHQ A;  2A37 A;  2DL5 A;  2BZY A;  1WI7 A;  3TSW A;  1GBR A;  1PKT A;  1GRI A;  1T0J A;  2J7I A;  2O9V A;  2K79 A;  2LP5 A;  1TUC A;  1M30 A;  2KE9 A;  4CC7 A;  2EGC A;  2YUO A;  1VA7 A;  2DBK A;  1X2K A;  2RN8 A;  1SEM A;  4J9C A;  3EG0 A;  2M51 A;  4LNP A;  2I0N A;  1CKB A;  1YN8 A;  2KNB B;  3VRZ A;  1I07 A;  2CSI A;  2KXC A;  1Z9Z A;  1CKA A;  2EPD A;  2JW4 A;  2K9G A;  4A63 B;  2EGA A;  4J9H A;  2M0Y A;  3TSZ A;  1SHG A;  1PNJ A;  4JZ3 A;  2CRE A;  4D8K A;  2EQI A;  1UDL A;  1QCF A;  3PVQ A;  5ECA A;  5GJV B;  3SHW A;  2L3Q A;  1GFD A;  4RUG A;  2SEM A;  1X27 A;  1OPK A;  4GLM A;  1K1Z A;  1AWO A;  4LUE A;  1ARK A;  2F2V A;  2F2W A;  1XOV A;  1U3O A;  4Z88 A;  2EYZ A;  2MOX A;  1S1N A;  4F16 A;  3REA B;  3NHN A;  2DL4 A;  3M0T A;  2X3X D;  1LCK A;  1YWP A;  1UE9 A;  4LE9 A;  4RTU A;  3NMZ C;  2D1X A;  2O88 A;  2NUZ A;  3ULR B;  1ABQ A;  4J9I A;  1ABO A;  2ED1 A;  2O9S A;  1T3S A;  2K3B A;  3JV3 A;  3KFV A;  1W6X A;  2A36 A;  1M3C A;  3NGP A;  3U23 A;  3THK A;  2LJ3 A;  2HEQ A;  1ZUU A;  2DX1 A;  1YWO A;  3EG1 A;  3EG3 A;  2CDT A;  1B07 A;  1U5S A;  1UJY A;  2OI3 A;  1CSK A;  1Z9Q A;  4DEY A;  1M3B A;  1UGV A;  2JM9 A;  4OMM A;  4K11 A;  1JO8 A;  1UG1 A;  2CUD A;  2KGT A;  1M3A A;  1G2B A;  3QWY A;  1GCQ A;  2C0T A;  2VWF A;  2K7A A;  2CUB A;  1IO6 A;  4J9B A;  2OJ2 A;  1AZG B;  3EGU A;  4ZNX A;  1UHC A;  2CH4 W;  4AFZ C;  2KBT A;  1NYG A;  1K4U S;  1X6B A;  1UEC A;  3VRY A;  4HVV A;  1ZUK A;  1AVZ C;  1VYT A;  2BTT A;  2ECZ A;  4AG2 C;  1T3L A;  2RNA A;  3VS5 A;  1UTI A;  2MCN A;  3VS3 A;  2IIM A;  1OOT A;  4KRT A;  3SEM A;  3I9Q A;  4D8D A;  4HXJ A;  1UHF A;  3LH5 A;  1E6G A;  2FPD A;  4J9F A;  2KEA A;  2G6F X;  5I11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...