2FRWA

Solution structure of the second sh3 domain of human adaptor protein nck2
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
57
structure length
57
Chain Sequence
b'IPAFVKFAYVAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQIGWFPSNYVLEEVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic protein NCK2
publication title Structural Insight into the Binding Diversity between the Human Nck2 SH3 Domains and Proline-Rich Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 5
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2006-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2frwA00
2FRYA 2D8HA 2D8JA 2CUDA 2PNIA 1YWOA 4J9GA 4JJCA 1AD5A 1AZGB 2KXCA 2NWMA 1W1FA 2PZ1A 2V1RA 1X27A 1MV0B 1E7OA 1QCFA 2KRSA 1YNZA 4OMLA 2DX1A 1K76A 4J9CA 5GJVB 1WYXA 1RLPC 2EKHA 5EC7A 3H41A 2RN8A 1NEBA 1JXMA 1UHFA 5I11A 2KT8A 1X2QA 2LZ6B 1VYTA 2ED0A 1G83A 2RQRA 2LJ1A 1X69A 2ESWA 3REAB 1MV3A 2EYZA 2FPFA 2O9VA 3SHWA 1YN8A 1I0CA 2DL3A 2KYMA 1BBZA 2IIMA 1GFDA 3VS0A 2EBPA 2B86A 1W70A 4LNPA 1T3LA 2GTOA 2F2VA 1WXTA 2BZXA 3M0UA 2EVRA 2EYYA 2O2OA 2CH4A 4HVVA 1PRMC 2KROA 2KRNA 2JM8A 2O31A 2H8HA 1UJ0A 2EGCA 2YT6A 4K11A 2FO0A 4AFZC 2C0OA 2LJ0A 2YDLA 3EG0A 4OMMA 2CH4W 3RNJA 1M8MA 1YCSB 2FPEA 2L3QA 2DNUA 4AFQC 2DA9A 1GCQA 2L3SA 1SHFA 4DEYA 2JXBA 1UDLA 1ZUUA 5IHKA 1SPKA 4IIOA 4JJBA 2GTJA 3I9QA 1ABOA 3GBQA 2EPDA 3EHRA 2K7AA 1PRLC 2M0YA 2EQIA 4CC7A 2VKNA 1NYGA 2EGEA 2J7IA 1ZBJA 2LX7A 1OEBA 1AWJA 1KJWA 2LQNA 1QLYA 1JEGA 1PKSA 1Z9QA 2D0NA 1JQQA 5FWBA 1T0JA 4JZ3A 4X1VA 3NMZC 1K4US 1GRIA 1U5SA 1HD3A 3ZL7C 1RI9A 2AK5A 3A98A 4LUDA 4J9FA 3VS1A 3PVLA 2GQIA 2O88A 2RPNA 4ESRA 1UUEA 2DILA 2AZSA 1Z9ZA 2KR3A 4AG2C 3FJ5A 1M3AA 1SRLA 1I1JA 4J9IA 2J6OA 1WI7A 2DL8A 3EG3A 2OI3A 2HBWA 2GNCA 1VYVA 4RUGA 2JS0A 2KEAA 4RTTA 1SRMA 3UF4A 2KYBA 3VRYA 1SHGA 1T3SA 4LUEA 3ULRB 1X43A 5IXFA 2GBQA 2VWFA 1BB9A 3EG2A 1GCPA 3M0QA 1GBRA 2OAWA 2K3BA 1UG1A 3VS5A 1NLOC 5L23A 1WXUA 1OOTA 1ZUYA 3CQTA 1U3OA 1QWFA 1B07A 2FRWA 3VS2A 1WFWA 1G2BA 4OMPA 3EG1A 1W6XA 1AVZC 1UFFA 2DL7A 2L0AA 2MOXA 3TSZA 2RQTA 1SEMA 3UA7A 2XMFA 1LCKA 2DL4A 3VS6A 4R0KA 2L2PA 1YWPA 3NHNA 3JV3A 2KRMA 1AWWA 3NPFA 2EW3A 1S1NA 1T0HA 4EIKA 3M0SA 2X3WD 2O9SA 5HCKA 1ARKA 1V1CA 3EGUA 2NUZA 1OPKA 4OMOA 2YSQA 1SSHA 3THKA 2K6DA 2BZYA 1U06A 2RMOA 4F16A 3REBB 2RQWA 1GL5A 3QWXX 3H0HA 4HXJA 2BTTA 1XOVA 2FEIA 4JJDA 4CC4B 4AFUC 2E5KA 3IQLA 1OPLA 2ROLA 4J9EA 2JMCA 2LP5A 1K1ZA 2F2WA 2A08A 1PKTA 3TSWA 4RTYA 2SEMA 4E6RA 1UGVA 2X3XD 4QT7A 5FWCA 1HJDA 4LN2A 4Y92A 2PTKA 4HVWA 3UA6A 4Z89A 1M30A 1Y0MA 4HCKA 5FW9A 2YUPA 2AKKA 3VS3A 1WLPB 3NGPA 5I22A 2ENMA 1J3TA 3H0FA 1RUWA 2HEQA 1NG2A 1NEGA 4GBQA 1B3QA 1MUZA 2BZ8A 2KBTA 1CKAA 1JU5C 2LCSA 2JS2A 3I35A 1H92A 2LNHB 5GJWB 2G6FX 3LH5A 3C0CA 1RLQC 2DRMA 1N5ZA 2DLPA 1AEYA 4OMNA 3RBBB 4JZ4A 2ED1A 3M0RA 2DE0X 2OJ2A 2AKLA 1PNJA 1HSQA 4HVUA 2LMJA 4M4ZA 4J9DA 1TUCA 2CSIA 1K0SA 2ROTA 3VRZA 3O5ZA 5IXBA 1H8KA 4D8DA 4F17A 4D8KA 1NM7A 3M0TA 2J6FA 2RQVA 1JO8A 1M3CA 2A28A 4Z8AA 1CSKA 1JXOA 2K2MA 1K0XA 2DF6A 2JM9A 1ABQA 4FSSA 2DRKA 4ORZA 4AFSC 3KFVA 1X2KA 4CC3A 2C0TA 4RTUA 2YUNA 1KSWA 2EYXA 1PHTA 4GLMA 1OV3A 2DBMA 1E6GA 4RTZA 2FG0A 2CT3A 2JT4A 1A0NB 1VA7A 1TUDA 1FMKA 2A36A 1EFNA 4WCIA 1KFZA 2CSQA 1YP5A 3VS7A 2QDLA 2RQUA 1AWOA 3UATA 3H0IA 2GGRA 1TG0A 2DM1A 1FYNA 1GBQA 2K79A 3R6NA 4IIMA 2KGTA 2F2XA 2KXDA 1UHCA 4F14A 2CUBA 2SRCA 2K9GA 2EYWA 2HSPA 1WXBA 2RF0A 2VVKA 3M0PA 2JTEA 2KT1A 2P4RA 1UECA 1PWTA 2JMAA 1IO6A 2DMOA 3TVTA 1KIKA 5ECAA 2DVJA 1WIEA 2W0ZA 3SEMA 1WDXA 1Y57A 2MIOA 1BU1A 1UJYA 4ZNXA 1BK2A 2YUQA 2LJ3A 1H3HA 2J6KA 1AOJA 2HCKA 3PVQA 1QWEA 2DJQA 1GFCA 2KNBB 2MCNA 2CDTA 2V1QA 2W10A 2J05A 1NLPC 2J06A 1ZUKA 1CKBA 1WA7A 4Z88A 2A37A 1E6HA 4CC2A 2KE9A 3I5RA 4RTWA 3U23A 1AZEA 3PE0A 1K9AA 1NYFA 3I5SA 3QWYA 5IHIA 1I07A 2EGAA 2LQWA 4J9HA 4AG1C 5IHNA 1ZSGA 4KRTA 1UE9A 1X6GA 1GCQC 2CREA 1X6BA 2DL5A 2M51A 2HDAA 1QKWA 2AZVA 2DBKA 4J9BA 1VYUA 2D1XA 2ABLA 1UTIA 2L3PA 4RTVA 2YUOA 4OMQA 2C0IA 2ECZA 3VS4A 1QKXA 4DEXA 2I0NA 1M3BA 1AWXA 3EHQA 5IH2A 2JW4A 1ZLMA 1M27C 4A63B 1WX6A 2CT4A 4RTXA 1ZX6A 4LE9A 2RNAA 2FPDA 4JPBW 2DYBA
chains in the Genus database with same CATH superfamily
2CGHA 2RI3A 5M9OA 4M7AE 1UGSB 2PNIA 1N8RC 1VQ5Q 4JJCA 1AZGB 4IUUA 2PUKB 5GMKi 4M75B 3RR6A 3FB9A 1X27A 1MV0B 3G6EQ 3SWNA 1D3BA 1E7OA 3CCVT 2KRSA 2MAMA 4LDYA 2RJCA 5IN1A 2NLUA 4OB2B 1PD1A 3CC4A 1ACMB 5EC7A 4E7IA 1JXMA 5I11A 4CRIA 1NJIR 4A54A 1X2QA 2ED0A 1OQKA 4M77E 3CPWP 4UC4A 2EYZA 3QG1A 2RA2A 3GLXA 5I2SA 3TQ7P 5D6WA 3HSBA 2PUOB 4LD9K 1RI0A 2B86A 4F7UB 1YI2Q 1VQNQ 2KSSA 3DLLA 3OY9A 1VQ4Q 2CH4A 4HVVA 4LD6A 2R57A 1KG1A 1WHLA 1UJ0A 3EG0A 1YJNQ 4ANJA 4XU3A 3RNJA 3TCJA 1M8VA 1YCSB 2L3QA 5L8RE 1Q81C 2HQXA 4N0AC 1VQKQ 2NUTA 5GMKe 4M7DB 5KYUA 1N8RR 1ZUUA 3WVEB 2KVQG 2A0FB 5IHKA 1O75A 3JCMW 4IIOA 1YITQ 2RI5A 1JB0E 4GY5A 1ABOA 3GBQA 4M78G 2DPPB 2EWNA 2K7AA 2DJZA 4QKUA 2HQHA 2VKNA 2EGEA 3V8JA 4A4HA 3A5ZB 3Q1JA 1OEBA 3QXEB 1AWJA 3M4GA 2QQBA 1QLYA 1ZSZA 1Z9QA 4ZTFA 1QQJA 4HT8A 2JOYA 4M7DC 3V7CA 1GRIA 1OX9A 2AK5A 5LJ3d 2F5KA 3PVLA 5KYYB 1NPRA 2GQIA 2KK4A 1WQ7A 4ESRA 2QASA 4DOWA 2OTLQ 2J6OA 1N9SA 2L3RA 3OQ5A 4D6WA 3CCQA 1PM3A 1TH7A 3VYHB 2OI3A 5KYWA 3MEVA 4RUGA 2JS0A 2KEAA 2Y4YA 2KYBA 4C92B 2ZPEB 3VRYA 4QQDA 1ZHIA 4PFZA 1V76A 3OMCA 4LUEA 3WXMB 3SB2A 5IXFA 1I5OB 1Q81R 4PJLA 2YRCA 4Z02A 4KUIA 2KI7A 1VQOA 1C1AA 1U3OA 3CC4Q 2FRWA 3OYMA 1TOVA 2MWOA 3MPUB 1C0MA 3PTAA 1VQPA 3EG1A 1UFFA 1WPYA 1Q7YC 2RHXA 4C92C 2L0AA 3TSZA 2DEQA 3FRNA 2RQTA 1SEMA 3X26B 5LJ5d 3JCMh 4BY6B 3OBYA 1OULA 3VS6A 3G71A 1LPLA 2L2PA 2HD0A 1YWPA 3NHNA 3JV3A 4QVDA 3URGA 5D7UA 2H3EB 1AWWA 4A53A 4RG8A 1OZ3A 1D09B 1M90C 5HCKA 3TREA 2XICA 2BKDN 1MHNA 1RABB 1ZBXA 1U06A 3H9NA 3S3NA 2RQWA 2JVVA 2V8KA 3M59A 2FEIA 2HMAA 3KBGA 2RHZA 4AFUC 1OPLA 4MZTA 3CCUA 1XTDA 3RKXA 3NFCA 1K1ZA 3NTHA 1PKTA 5A0LA 4RTYA 4ELYC 2R58A 4QT7A 1MMNA 2P0PA 1QVGA 1HJDA 3CCJQ 3X25B 4Z89A 3MO8A 4LDXA 3PMIA 3E9GA 5FW9A 2DERA 2YUPA 3CC2T 4E7LA 1UB4A 1VQ8A 5I22A 3NGPA 2ENMA 9ATCB 4BACA 3H0FA 1J3TA 3EGXA 1R0BG 4BI3A 2EFIA 3CCSA 3M53A 1YIJT 3J80E 4E7ZA 2JS2A 1KHCA 2V8JA 3I35A 4QQGA 1KQ2A 2NUPB 2B8AA 3LH5A 1Q7YR 2HSEB 1QCOA 3N5BB 1RLQC 2DLPA 2VYTA 1AEYA 3ZFJA 2VXFA 2HL3A 4ATOA 3CCLQ 1LNXA 4BE1A 3MCAB 2ED1A 4OVAA 2PVGB 2DE0X 2OJ2A 1MMAA 1PNJA 1TSFA 2R5MA 1HSQA 1TS9A 4M78B 1W2BS 2CSIA 2ROTA 4M7AD 3CCQQ 2X4JA 2ZCFB 1ZA2B 3CMEA 4D8DA 1KQSA 5FU6B 1M90R 1M1FA 1LVKA 4PJOA 2XIDA 1JO8A 3P8BB 3A8LB 4WTOB 4KUDK 5AYFA 2O4XB 4VUBA 4O5VA 4A4KA 1CSKA 2JM9A 4QVCA 1ABQA 3JAME 3CCEA 2CYZB 4AFSC 2HNIA 4BI8B 2CP2A 4CC3A 1K8AC 1DJ7B 4RTUA 5GAMg 2EYXA 3L2UA 1VQOQ 4EMKB 2DTOA 2CT3A 4M77D 3INZA 1VQPQ 2A36A 4BE0A 1YP5A 3VS7A 1R0CB 3H0IA 2BE9B 4J8OA 3G71Q 3GNGA 3R6NA 1TUGB 3OYKA 4CI0C 4F14A 4EMKC 3X20B 2KT1A 2P4RA 3GPLA 4Y28E 2DMOA 4JJNK 1WIEA 2IVWA 2QA4T 2W0ZA 3LW5E 2LT1A 3QKJA 1Y57A 6AT1B 3CMAA 3V8KA 4C5IA 1O9SA 4C8QD 1WHHA 2XI9A 3PVQA 1QW1A 3JB9I 2CDTA 2MK5A 3EFOA 3CCUQ 2A37A 1I5LA 1U1SA 2VGNA 4ME7A 2CKKA 5KE2A 5C6SA 3CCVA 1K9AA 1NYFA 2RHYA 1VQ9A 1PCXA 1M1GA 1IRXA 3CC7T 5GAMd 4JS5A 1K8AR 1VQ8Q 2XG8D 4J9HA 4BI4A 2ATCB 1NJIU 1U1TA 2QGFB 3CCSQ 3LGFA 1S72T 4FYXB 3EAEA 5GANd 4PJOE 2HDAA 3E19A 2DXTA 3H6ZA 2PVOB 2ABLA 2OTJA 4DBFA 3G1JA 1B34A 4OF1A 2C0IA 1BIAA 3VS4A 4R56A 2E70A 1XJWB 2GFAA 5IH2A 1ZLMA 3CXCA 4A63B 2PU9B 1QVGP 3FIFA 3JCMc 4FCYA 3CMEQ 2D8HA 2D8JA 5GAOl 1YWOA 2ZGWA 1QVFP 3M4YA 1AD5A 3OS5A 1EZZB 4IURA 1N8RU 2V1RA 4X34A 3CCEQ 1BCMA 3MEWA 1HK9A 1Y96A 2H3JA 1G8XA 4WF2A 3DKMA 4L5GA 4OMLA 3H8ZA 2DX1A 2RK1A 5KCHA 2D0QB 1RLPC 2IPOB 2EKHA 4XTUA 5FROA 1LOJA 2MWPA 1NEBA 2Y90A 1BKBA 4RCBA 2KT8A 3QIIA 1G83A 2E12A 4J83A 3JB9D 3JCMb 1N9RA 3QDFA 2O9VA 2KYMA 1KK7A 1KQSP 1FXXA 5KYXB 3M57A 1KD1C 4N4GA 3CCRT 2YXYA 1RAAB 3JSCA 2K4YA 2F5TX 3DB3A 4IUQA 2BZXA 4M77A 3OMGA 5LJ3e 1PRMC 1W4SA 5CCAA 2HZYA 2O31A 3A8OB 2ZPHB 3I56T 4K11A 3CMAQ 2FO0A 2LJ0A 3RMQA 5J26A 4AT1B 1GCQA 1Q81U 4PLLA 4DEYA 3T9NA 3OYGA 3OW2A 3BDLA 3C95A 4JRKA 2GTJA 2COZA 3I55T 3CCVQ 2RI2A 2EPDA 1VQ9Q 3BE3A 2MYSA 1NYGA 2J7IA 2X35A 4KGVB 4BDZA 2LX7A 4C8QA 2BIVA 3F70A 3M54A 2EKOA 1JQQA 3ER0A 2QEXT 2GQVA 5GMKm 3OYBA 4ZGJB 1K4US 2QGGA 3NMZC 1U5SA 1HD3A 2QTVA 4PKCC 2VXEA 1QCNA 3CBPA 2K3YA 4HCCA 2OTJQ 4J9FA 2RPNA 5DLQE 5LJ5e 2DILA 1KD1R 3FJ5A 5GAMf 1I1JA 2HAXA 1WI7A 2DL8A 5J39A 1VYVA 4RTTA 3QSUA 1QMCA 3META 4XU1A 4ELZC 4PFOA 1G3TA 4L59A 3M58A 2G3RA 5DM7R 2DYIA 1BB9A 2VWFA 3EG2A 3MEUA 4ZN3A 1M9SA 1GBRA 2K3BA 4E7SA 2LTOA 1NLOC 4XU0A 1D3BB 1WXUA 5FU7B 3L2QA 1YJWA 4C0DB 5C0MA 3CQTA 1D1CA 3JCMd 1QWFA 1JBMA 3CPWS 1SF9A 3EG9B 4M75C 4FYVB 2QQRA 3LX7A 5GAOm 1W6XA 3CC2A 5EG2A 2DVEA 2RM4A 5LJ3g 4JRIA 3MHXA 2V26A 3S3OA 3UA7A 3CXCP 1Q7YU 2EQUA 1M2VA 2RD1A 4B6MA 2KMTA 1Y07A 2E65A 5FU7C 4EMGA 2KRMA 4C0DC 4F7UA 1XQHA 2L89A 1S1NA 1T0HA 4ZGDB 2X3WD 2O9SA 4M7AF 1OPKA 1VUBA 1SSHA 2CP3A 1YJ9A 1M90U 3CD6T 2RMOA 4J6XA 3REBB 3OYEA 1GL5A 4C8QE 3QWXX 3H0HA 4HXJA 1XOVA 1VQ5T 2FHDA 3LYIA 2E5KA 2F69A 2YWWA 3JCMQ 4KT0E 1IHVA 2K57A 3GF5A 1EIFA 2LVMA 1BCOA 2NUTB 3G6ET 3TSWA 4E6RA 3HKSA 4PJJA 5KYUB 1YHQT 4TVRA 1WJQA 1MNEA 4M77F 2AKKA 4OMFB 2VB6A 1WLPB 5LJ5g 2QQSA 5HK0A 1RUWA 3M55A 1NEGA 4PJOD 1B3QA 2KBTA 1VQLT 1CKAA 3FLGA 1ZSZB 1H92A 5GJWB 2DXCA 2E4HA 4IUVA 3C0CA 2DRMA 4JLGA 1JJ2A 2JNGA 1NZ9A 3JCMP 4J7FA 2DIQA 4HVUA 2LMJA 4BUGA 3QYHB 1VQ4T 2YHTA 1D1AA 2M0OA 2XKOC 2JTFA 1X01A 3OW2P 2IG0A 4RKUE 4RMOA 3DLMA 2QXFA 4C8QF 2QA4A 1ZSZC 3EGDB 3M5AA 3M0TA 1YJNT 4LDWA 5KYWB 2RHIA 4Z8AA 3L42A 1Q82C 1VQKT 2K2MA 3FC3A 4A4FA 4HT9A 1B7TA 4FM4B 4XTZA 3KFVA 1X2KA 1WNLA 2LT4A 3HPWA 2V8IA 1KSWA 2PVDB 4GLMA 1YJWQ 3L2VA 2EQJA 1K8AU 1OV3A 4F7UE 4B9WA 4RTZA 4FW1A 1Q95G 3CC7A 1P92A 1A0NB 3CC2Q 2P84A 2RQUA 5IT9E 4KULA 2MF2A 2RK2A 5GAMe 4JLIA 2M02A 3EH2A 3HRUA 1OX8A 4JRQA 1FYNA 5GAOr 2KGTA 2F2XA 3HFOA 4M7DE 2Z0WA 3VUZA 1WXBA 5GANe 3M0PA 2JTEA 1U8RA 2MPXC 2OTLT 5ECAA 1PSFA 3M9QA 5GAN5 2CZ1B 3SEMA 2XHCA 4BY6C 4XTYA 2XK0A 1YJ9Q 4F04B 5GAN3 4PNOA 1QP2A 4QW2A 2LNVA 5CKDA 2HCKA 5GAN4 1QWEA 3SFMA 2RH2A 2W10A 2J05A 2J06A 4XK8E 1TXQA 1BYMA 3CBMA 4DBHA 1Q82R 2QI2A 1AZEA 1RACB 3PFSA 5IHIA 3RESA 3CC4T 4DA4A 4N4HA 4QQ6A 1ZSGA 2DO3A 4KRTA 4MMLA 2VUBA 1X6BA 2DL5A 5CAIA 1VOMA 4J9BA 3JB9H 4XU2A 1MNDA 2D1XA 2M16A 4C92E 4J5YA 2YUOA 2ECZA 1QKXA 2M1HA 2I0NA 2XD0A 3EHQA 3EFSA 4M7AG 1BIBA 1NE8A 3P8HA 1OYXA 3CCMT 1ZX6A 3E9FA 2RNAA 5FWCA 3C4SA 1F1BB 2QA4Q 1ZA1B 2CS7A 2FRYA 1VIFA 2CUDA 2HBPA 3I56A 5LJ3f 2VV5A 5KH6A 5HK3A 5A2QE 1PC0A 2E3IA 4M78C 2PZ1A 1QCFA 1YNZA 3HTRA 2XDBA 3CCJT 5FU6C 4J9CA 5GJVB 1WYXA 1JJ2P 5IAYA 2RN8A 4JS4A 1VQ6A 4M77G 4HA8A 1FMWA 5GANg 3CC7Q 3VUBA 2K3XA 2LJ1A 1AT1B 2DD4A 2QQ9A 1X69A 3REAB 2QYZA 2K5IA 1MV3A 3QO3A 1OZ2A 1WJSA 1YN8A 8AT1B 1BBZA 2IIMA 2ZZDA 2AHJB 2EBPA 1QVPA 1W70A 5CKHA 1T3LA 3CCLT 1KD1U 2F2VA 1WXTA 2EYYA 2EAYA 2KROA 1I4K1 2KRNA 2JM8A 4NS5A 2DTHA 2E6NA 3VKIA 2YT6A 4DBRA 5LJ5f 5HKCA 3BFMA 5CKBA 2YDLA 4C8QG 5GMKl 1M8MA 4AFQC 2L3SA 1SHFA 4NL3A 3GOXA 2JXBA 1UDLA 2E6ZA 4OGCA 4OP0A 3A1PA 4LDUA 4JJBA 3I9QA 4PJNA 4PL6A 3EHRA 1PRLC 2M0YA 3MJXA 2KQWA 4P5NA 1VQOT 5D6XA 2DFUA 4C0FA 1ZBJA 1M2OA 2E5QA 1KJWA 1VQPT 3BDUA 4EPCA 1PKSA 3JCMe 2CZ7B 1T0JA 4JZ3A 4X1VA 4M75D 1RI9A 3FEOA 3X24B 3A98A 3G71T 4LUDA 2JUFA 2HKQB 3RKYA 2DXUA 4FW2A 1B34B 2AZSA 1Z9ZA 2KR3A 3OS2A 8ATCB 3PMTA 5CKEA 1BI3A 2ZPIB 4J9IA 1QVFS 2FZCB 5HY6A 1VQMT 3OYFA 1WJRA 2OX7A 3HRTA 3EG3A 3CD6A 1TU0B 1SRMA 3UF4A 1SKUB 3QBYA 5A0DA 1T3SA 4LDVA 2QTXA 3ULRB 4ZGEB 1X43A 2XU8A 2GBQA 1D1BA 5GMKh 1UGPB 1GCPA 1X6OA 3M0QA 5GMKj 3OYYA 1Y96B 3EH1A 1ZUYA 4XQ3A 1PD0A 4PFPA 1MMGA 4V2SA 1B07A 3VS2A 4M7AB 1VQ6Q 1YHQA 1UGQB 1G2BA 4HCBA 4PJOF 1KQSS 2MOXA 2OAUA 3CCST 3E1SA 1H641 1ZQ1A 1VQLA 2E10A 1JRIA 1LCKA 4M7DD 1D0ZA 2C06A 2FZGB 4RG2A 4J6WA 2YRVA 3NPFA 2EW3A 5J3BA 4M7AC 3MP8A 2E41A 1ARKA 1V1CA 2HQEA 2QQAA 3EGUA 4BD3A 2NUZA 4M77B 2YSQA 1KQ1A 1D0YA 2BTTA 1BI2A 2QDYB 4JJDA 5I2MA 4XTVA 1IGQA 3NTIA 3IQLA 2GF7A 1WHJA 2X51A 3AT1B 1UEBA 3JRZA 1RL2A 3JCMg 2LP5A 3OYIA 3CCET 5FRMA 3HP9A 3OSVA 5CQYA 2LQ8A 2KDSA 2SEMA 2WSCE 3G4ST 1UGVA 2EJGA 2M9UA 4LN2A 4Y92A 2PTKA 3UA6A 3E2UA 3QUIA 5GAN2 4M77C 3OYCA 1K73C 2DAQA 3ME9A 2DETA 4PJMA 1PSEA 1RADB 1KC8U 4Q5WA 4GBQA 5CK9A 1MUZA 4C8QB 3R6OA 4C92D 1NPPA 3RKWA 4OB3B 1N6AA 2G6FX 1WHKA 2XDPA 2DK3A 4BDYA 3LH0A 2RJDA 4IKFA 1Q86U 4JZ4A 3M0RA 2MI6A 2AKLA 1MMDA 4M4ZA 2P0KA 4KGXB 3FDRA 4J9DA 1TUCA 2YLBA 1M1KC 1K0SA 2BUDA 3O5ZA 1H8KA 4F17A 3UDCA 2QAZA 4KBMB 5GANf 4D8KA 4M75A 2RJFA 1XNIA 3PGGA 3QPHA 3CD6Q 2J6FA 4E7HA 2RQVA 4J6YA 2P0QA 1JXOA 3OYHA 4NOYA 1UGRB 4FSSA 4ORZA 2X4YA 3SWNB 1Q82U 4FIBA 1RAFB 3MKDA 1VQ9T 2DBMA 1IGUA 2CZ6B 3CXCS 1YHQQ 3EG9A 5GAOp 1SG5A 1YIJA 1RAGB 2X4XA 1K73R 1AWOA 2QDLA 5GAOn 3OS1A 2X4WA 2CP0A 2CZ0B 2XDDA 4N0AA 2JTMA 2GGRA 3SWNC 1HYOA 1VQLQ 1M2VB 1GBQA 2K79A 1VQ7T 2OTJT 4IIMA 3X28B 4KH0B 2EYWA 2I2LA 4IUPA 1Y7XA 4B9XA 2RF0A 2VVKA 1UECA 2QG9B 2HL5C 1QP3A 2RHUA 2E3HA 4C5HA 2MIOA 1BU1A 2LQKA 4ZNXA 1BK2A 1KHIA 2YUQA 3CCMA 1H3HA 2J6KA 2AIRB 1AOJA 1M1KR 4M7DA 1TTHB 4E7JA 1K9MC 2MCNA 3L2ZA 5CR2A 2ZPBB 4FT4A 1NLPC 1CKBA 4CC2A 2RB6A 4E2FB 2YLCA 3I5RA 2DZCA 3S6WA 2WSEE 3OYNA 2EQMA 3LLRA 3I5SA 1KC8C 2FB7A 4M78D 1W2BA 2YRDA 3CCJA 1WQWA 3JCMV 2LQWA 1IHWA 4ZN1A 5IHNA 3VJPA 4PJOG 2ZPGB 1Q86C 3L1AA 5CQXA 3QJ6A 5DY9A 4ZTJA 4M75E 2DBKA 3CPFA 5KYYA 2L3PA 1YI2T 1VQNT 4RTVA 2ZPFB 4OMQA 1PG5B 1N27A 3OW2S 3OS0A 4DEXA 1OU8A 2Y4XA 4MDWA 3CCLA 3MEAA 3GP8A 5KYNA 3MP6A 1M27C 1WX6A 2CT4A 1IB8A 2VASA 4FT2A 5CO7A 4LE9A 2FPDA 4JPBW 3OB9A 5DLOA 4OB0B 4C92A 3A8MB 3EGDA 4J9GA 2L5QA 2KXCA 3TU4K 2NWMA 1W1FA 1OI1A 1YITT 5LL6S 4C5GA 1K9MR 4J7IA 2EQKA 2EJ9A 2DEUA 1K76A 4FL6A 3V8LA 2NYSA 3H41A 4II1A 3OBWA 2A3LA 4FSXA 1KC8R 1UHFA 4O6JA 2D6FA 5GAOq 4NL2A 2VC8A 2LZ6B 1VYTA 2QK0A 1YIJQ 1S72A 2RQRA 3VV0A 5D6YA 7AT1B 2ESWA 4OB1B 4M75F 4BE2A 2FPFA 2KY9A 3SHWA 3UT1A 1I0CA 2DL3A 1Q86R 1GFDA 3VS0A 4LNPA 4KH1B 3JCMf 2GTOA 3M0UA 1C6VX 2EVRA 1TWBA 2O2OA 3OYDA 1X75C 4FYWB 1M5Q1 2LRQA 4X9DA 1EX4A 5KCOA 1G3WA 2H8HA 2EGCA 3RIRA 1YBYA 4AFZC 2C0OA 3CCMQ 1VQMA 4OMMA 2CH4W 3OYLA 2FPEA 3J7AF 2DNUA 2DA9A 2FZKB 5CKFA 3FJPA 4XTXA 3TEEA 4F7UF 5AT1B 3ZEHA 1SPKA 3M56A 1V29B 4OGEA 1SSFA 1I8FA 2RJEA 1YJWT 2EQIA 4CC7A 3LWIA 5CVIA 2CP6A 3JB9F 2LX9A 3EGXB 2EIFA 3V7SA 2LQNA 4DOVA 1QVFA 2NUPA 1JEGA 2D0NA 5FWBA 3PIOA 4X9CA 4M7DF 3ZL7C 2FYKA 3CCRA 4HCZA 4MMKA 4EDUA 3VS1A 1G3SA 2O88A 3LWHA 1IZ6A 2LC4A 4M78A 1UUEA 3HRSA 2WACA 3OA6A 3JCMJ 4AG2C 1M3AA 1SRLA 3D7SB 3RDVA 4FYYB 3PNWC 5LJ3h 2PQWA 4XTWA 2AT1B 5LJ3j 2HBWA 2GNCA 3UWNA 1YJ9T 3JCMX 4PJOB 2DD5A 3GNFB 2O4XA 1W2BP 1VIEA 1SHGA 1BI1A 3NTKA 2F1LA 1JJ2S 3BY7A 2OAWA 1UG1A 3S3MA 1OU9A 3VS5A 3I55A 2KAFA 4EMKA 5L23A 3G4SA 2BE7D 4C5EA 1OOTA 3EFRA 1G3YA 4LXCA 1AHJB 1R8OB 3G7ZA 4PJOC 3PT9A 1WFWA 4OMPA 1D0XA 1AVZC 1HXDA 2DL7A 2QEXA 3O8VA 4C92F 1S72Q 3SD4A 3CEYA 2DTIA 2XMFA 1WHGA 2DL4A 2D9TA 4R0KA 2JZ2A 3J81E 4RCCA 2K2VA 1YFNA 4A4GA 4EIKA 4E47A 3CCQT 3M0SA 3OYAA 5LJ5h 5LJ5j 4PK4A 1WHMA 3RMSA 4OMOA 3THKA 1YCYA 2K6DA 2BZYA 4F16A 1VQMQ 1RAEB 3VU3C 2CP5A 3ZBDA 3EFOB 4CC4B 3VYGA 3QZ9B 4MDXA 3ASKA 2ROLA 4J9EA 2JMCA 2F2WA 2A08A 4C0GA 5CIUA 2K5FA 2X3XD 1G5VA 4FU6A 4HVWA 1M30A 1Y0MA 2L8DA 4HCKA 4M78E 3HL8A 1BI0A 5A0GA 3VS3A 2LCCA 2DIGA 2HEQA 1K73U 1NG2A 2E1HA 2VGMA 2BZ8A 1JU5C 2EYQA 4KGZB 2LCSA 3L2WA 2LNHB 4M75G 1N5ZA 3GIBA 3JB9J 1QVGS 3CCRQ 1RAHB 4OMNA 3RERA 3RBBB 3A8HB 5GAN7 1Y71A 2FVUA 1H3ZA 3P8DA 1VQ7A 1FX7A 4JUVA 4HKEA 1I81A 1MGQA 3CPWA 3SDZA 2LDMA 3VRZA 5IXBA 3I56Q 1M1KU 1IREB 1NM7A 1NBEB 1VQ5A 5FRNA 3QZ5B 4PLIA 3CCUT 1M3CA 2A28A 2R5AA 2DF6A 1K0XA 4YTLA 2DRKA 3MP1A 3G6EA 1M4ZA 4F7UG 2JJ9A 2C0TA 2CP7A 3I55Q 2YUNA 4M78F 2P4TA 3G4SQ 3BW1A 2JN0A 2LCLA 1PHTA 1VQ8T 4DBQA 5GAN8 1E6GA 3RUXA 2DKGA 3C12A 1WGSA 2FG0A 3JB9G 2E64A 2ZAEA 2JT4A 4M7AA 2A7YA 1WZOA 3QDRB 1VA7A 1TUDA 1FMKA 1IXDA 1EFNA 4WCIA 1FMVA 1KFZA 2CSQA 2QEXQ 3V7RA 3UATA 5KYXA 2MMPA 4R55A 1TG0A 4M7DG 3A8GB 2DM1A 4GLKA 5I21A 2KXDA 4XAXB 1UHCA 4AMCA 2CUBA 2SRCA 2K9GA 1YI2A 2RO0A 1VQNA 2HSPA 4Y91A 2WSFE 2COYA 2X9HA 1VQ4A 1PWTA 2JMAA 1IO6A 3TVTA 2DZ9A 1KIKA 4JDSA 2DVJA 3CMET 2GFUA 1WDXA 2DXBA 4DQ2A 1UJYA 4E7KA 2LJ3A 1YJNA 5KE3A 1GXIE 3PIPA 3QYGB 2DJQA 1GFCA 2COWA 3HFNA 2KNBB 3QHSA 1VQKA 2V1QA 2EJFA 1RAIB 1ZUKA 1WA7A 1K9MU 4Z88A 1E6HA 2KE9A 4RTWA 1YITA 3AHUA 3U23A 5GAN6 3PE0A 3QWYA 3KUFA 5FLXE 1NJIC 1I07A 2EGAA 4EMHA 4JRPA 3KXTA 1VQ6T 4AG1C 4MZMA 1LJOA 1R77A 3QJYA 4MZPA 1UE9A 1X6GA 1GCQC 4C92G 4A4EA 2CREA 4C0ZA 2M51A 2O01E 3CBOA 1QKWA 2FL7A 2AZVA 5GAMh 2K5LA 1VYUA 1UTIA 5GAMj 3C94A 4IUTA 3L2RA 2GCXA 3UPUA 3OYJA 1VQ7Q 4QVZA 2OTLA 1FWZA 4C8QC 1M3BA 1AWXA 5GANh 2JW4A 3HHTB 3LGLA 3CMAT 4N4IA 5GANj 2HKNA 4L6V5 4RTXA 4BB7A 3OSSC 3DB4A 3WVDB 2DYBA
chains in the Genus database with same CATH topology
2FRYA 2D8HA 2D8JA 2CUDA 2PNIA 1YWOA 4J9GA 4JJCA 1AD5A 1AZGB 2KXCA 2NWMA 1W1FA 2PZ1A 2V1RA 1X27A 1MV0B 1E7OA 1QCFA 2KRSA 1YNZA 4OMLA 2DX1A 1K76A 4J9CA 5GJVB 1WYXA 1RLPC 2EKHA 5EC7A 3H41A 2RN8A 1NEBA 1JXMA 1UHFA 5I11A 2KT8A 1X2QA 2LZ6B 1VYTA 2ED0A 1G83A 2RQRA 2LJ1A 1X69A 2ESWA 3REAB 1MV3A 2EYZA 2FPFA 2O9VA 3SHWA 1YN8A 1I0CA 2DL3A 2KYMA 1BBZA 2IIMA 1GFDA 3VS0A 2EBPA 2B86A 1W70A 4LNPA 1T3LA 2GTOA 2F2VA 1WXTA 2BZXA 3M0UA 2EVRA 2EYYA 2O2OA 2CH4A 4HVVA 1PRMC 2KROA 2KRNA 2JM8A 2O31A 2H8HA 1UJ0A 2EGCA 2YT6A 4K11A 2FO0A 4AFZC 2C0OA 2LJ0A 2YDLA 3EG0A 4OMMA 2CH4W 3RNJA 1M8MA 1YCSB 2FPEA 2L3QA 2DNUA 4AFQC 2DA9A 1GCQA 2L3SA 1SHFA 4DEYA 2JXBA 1UDLA 1ZUUA 5IHKA 1SPKA 4IIOA 4JJBA 2GTJA 3I9QA 1ABOA 3GBQA 2EPDA 3EHRA 2K7AA 1PRLC 2M0YA 2EQIA 4CC7A 2VKNA 1NYGA 2EGEA 2J7IA 1ZBJA 2LX7A 1OEBA 1AWJA 1KJWA 2LQNA 1QLYA 1JEGA 1PKSA 1Z9QA 2D0NA 1JQQA 5FWBA 1T0JA 4JZ3A 4X1VA 3NMZC 1K4US 1GRIA 1U5SA 1HD3A 3ZL7C 1RI9A 2AK5A 3A98A 4LUDA 4J9FA 3VS1A 3PVLA 2GQIA 2O88A 2RPNA 4ESRA 1UUEA 2DILA 2AZSA 1Z9ZA 2KR3A 4AG2C 3FJ5A 1M3AA 1SRLA 1I1JA 4J9IA 2J6OA 1WI7A 2DL8A 3EG3A 2OI3A 2HBWA 2GNCA 1VYVA 4RUGA 2JS0A 2KEAA 4RTTA 1SRMA 3UF4A 2KYBA 3VRYA 1SHGA 1T3SA 4LUEA 3ULRB 1X43A 5IXFA 2GBQA 2VWFA 1BB9A 3EG2A 1GCPA 3M0QA 1GBRA 2OAWA 2K3BA 1UG1A 3VS5A 1NLOC 5L23A 1WXUA 1OOTA 1ZUYA 3CQTA 1U3OA 1QWFA 1B07A 2FRWA 3VS2A 1WFWA 1G2BA 4OMPA 3EG1A 1W6XA 1AVZC 1UFFA 2DL7A 2L0AA 2MOXA 3TSZA 2RQTA 1SEMA 3UA7A 2XMFA 1LCKA 2DL4A 3VS6A 4R0KA 2L2PA 1YWPA 3NHNA 3JV3A 2KRMA 1AWWA 3NPFA 2EW3A 1S1NA 1T0HA 4EIKA 3M0SA 2X3WD 2O9SA 5HCKA 1ARKA 1V1CA 3EGUA 2NUZA 1OPKA 4OMOA 2YSQA 1SSHA 3THKA 2K6DA 2BZYA 1U06A 2RMOA 4F16A 3REBB 2RQWA 1GL5A 3QWXX 3H0HA 4HXJA 2BTTA 1XOVA 2FEIA 4JJDA 4CC4B 4AFUC 2E5KA 3IQLA 1OPLA 2ROLA 4J9EA 2JMCA 2LP5A 1K1ZA 2F2WA 2A08A 1PKTA 3TSWA 4RTYA 2SEMA 4E6RA 1UGVA 2X3XD 4QT7A 5FWCA 1HJDA 4LN2A 4Y92A 2PTKA 4HVWA 3UA6A 4Z89A 1M30A 1Y0MA 4HCKA 5FW9A 2YUPA 2AKKA 3VS3A 1WLPB 3NGPA 5I22A 2ENMA 1J3TA 3H0FA 1RUWA 2HEQA 1NG2A 1NEGA 4GBQA 1B3QA 1MUZA 2BZ8A 2KBTA 1CKAA 1JU5C 2LCSA 2JS2A 3I35A 1H92A 2LNHB 5GJWB 2G6FX 3LH5A 3C0CA 1RLQC 2DRMA 1N5ZA 2DLPA 1AEYA 4OMNA 3RBBB 4JZ4A 2ED1A 3M0RA 2DE0X 2OJ2A 2AKLA 1PNJA 1HSQA 4HVUA 2LMJA 4M4ZA 4J9DA 1TUCA 2CSIA 1K0SA 2ROTA 3VRZA 3O5ZA 5IXBA 1H8KA 4D8DA 4F17A 4D8KA 1NM7A 3M0TA 2J6FA 2RQVA 1JO8A 1M3CA 2A28A 4Z8AA 1CSKA 1JXOA 2K2MA 1K0XA 2DF6A 2JM9A 1ABQA 4FSSA 2DRKA 4ORZA 4AFSC 3KFVA 1X2KA 4CC3A 2C0TA 4RTUA 2YUNA 1KSWA 2EYXA 1PHTA 4GLMA 1OV3A 2DBMA 1E6GA 4RTZA 2FG0A 2CT3A 2JT4A 1A0NB 1VA7A 1TUDA 1FMKA 2A36A 1EFNA 4WCIA 1KFZA 2CSQA 1YP5A 3VS7A 2QDLA 2RQUA 1AWOA 3UATA 3H0IA 2GGRA 1TG0A 2DM1A 1FYNA 1GBQA 2K79A 3R6NA 4IIMA 2KGTA 2F2XA 2KXDA 1UHCA 4F14A 2CUBA 2SRCA 2K9GA 2EYWA 2HSPA 1WXBA 2RF0A 2VVKA 3M0PA 2JTEA 2KT1A 2P4RA 1UECA 1PWTA 2JMAA 1IO6A 2DMOA 3TVTA 1KIKA 5ECAA 2DVJA 1WIEA 2W0ZA 3SEMA 1WDXA 1Y57A 2MIOA 1BU1A 1UJYA 4ZNXA 1BK2A 2YUQA 2LJ3A 1H3HA 2J6KA 1AOJA 2HCKA 3PVQA 1QWEA 2DJQA 1GFCA 2KNBB 2MCNA 2CDTA 2V1QA 2W10A 2J05A 1NLPC 2J06A 1ZUKA 1CKBA 1WA7A 4Z88A 2A37A 1E6HA 4CC2A 2KE9A 3I5RA 4RTWA 3U23A 1AZEA 3PE0A 1K9AA 1NYFA 3I5SA 3QWYA 5IHIA 1I07A 2EGAA 2LQWA 4J9HA 4AG1C 5IHNA 1ZSGA 4KRTA 1UE9A 1X6GA 1GCQC 2CREA 1X6BA 2DL5A 2M51A 2HDAA 1QKWA 2AZVA 2DBKA 4J9BA 1VYUA 2D1XA 2ABLA 1UTIA 2L3PA 4RTVA 2YUOA 4OMQA 2C0IA 2ECZA 3VS4A 1QKXA 4DEXA 2I0NA 1M3BA 1AWXA 3EHQA 5IH2A 2JW4A 1ZLMA 1M27C 4A63B 1WX6A 2CT4A 4RTXA 1ZX6A 4LE9A 2RNAA 2FPDA 4JPBW 2DYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FRY A;  2D8H A;  2D8J A;  2CUD A;  2PNI A;  1YWO A;  4J9G A;  4JJC A;  1AD5 A;  1AZG B;  2KXC A;  2NWM A;  1W1F A;  2PZ1 A;  2V1R A;  1X27 A;  1MV0 B;  1E7O A;  1QCF A;  2KRS A;  1YNZ A;  4OML A;  2DX1 A;  1K76 A;  4J9C A;  5GJV B;  1WYX A;  1RLP C;  2EKH A;  5EC7 A;  3H41 A;  2RN8 A;  1NEB A;  1JXM A;  1UHF A;  5I11 A;  2KT8 A;  1X2Q A;  2LZ6 B;  1VYT A;  2ED0 A;  1G83 A;  2RQR A;  2LJ1 A;  1X69 A;  2ESW A;  3REA B;  1MV3 A;  2EYZ A;  2FPF A;  2O9V A;  3SHW A;  1YN8 A;  1I0C A;  2DL3 A;  2KYM A;  1BBZ A;  2IIM A;  1GFD A;  3VS0 A;  2EBP A;  2B86 A;  1W70 A;  4LNP A;  1T3L A;  2GTO A;  2F2V A;  1WXT A;  2BZX A;  3M0U A;  2EVR A;  2EYY A;  2O2O A;  2CH4 A;  4HVV A;  1PRM C;  2KRO A;  2KRN A;  2JM8 A;  2O31 A;  2H8H A;  1UJ0 A;  2EGC A;  2YT6 A;  4K11 A;  2FO0 A;  4AFZ C;  2C0O A;  2LJ0 A;  2YDL A;  3EG0 A;  4OMM A;  2CH4 W;  3RNJ A;  1M8M A;  1YCS B;  2FPE A;  2L3Q A;  2DNU A;  4AFQ C;  2DA9 A;  1GCQ A;  2L3S A;  1SHF A;  4DEY A;  2JXB A;  1UDL A;  1ZUU A;  5IHK A;  1SPK A;  4IIO A;  4JJB A;  2GTJ A;  3I9Q A;  1ABO A;  3GBQ A;  2EPD A;  3EHR A;  2K7A A;  1PRL C;  2M0Y A;  2EQI A;  4CC7 A;  2VKN A;  1NYG A;  2EGE A;  2J7I A;  1ZBJ A;  2LX7 A;  1OEB A;  1AWJ A;  1KJW A;  2LQN A;  1QLY A;  1JEG A;  1PKS A;  1Z9Q A;  2D0N A;  1JQQ A;  5FWB A;  1T0J A;  4JZ3 A;  4X1V A;  3NMZ C;  1K4U S;  1GRI A;  1U5S A;  1HD3 A;  3ZL7 C;  1RI9 A;  2AK5 A;  3A98 A;  4LUD A;  4J9F A;  3VS1 A;  3PVL A;  2GQI A;  2O88 A;  2RPN A;  4ESR A;  1UUE A;  2DIL A;  2AZS A;  1Z9Z A;  2KR3 A;  4AG2 C;  3FJ5 A;  1M3A A;  1SRL A;  1I1J A;  4J9I A;  2J6O A;  1WI7 A;  2DL8 A;  3EG3 A;  2OI3 A;  2HBW A;  2GNC A;  1VYV A;  4RUG A;  2JS0 A;  2KEA A;  4RTT A;  1SRM A;  3UF4 A;  2KYB A;  3VRY A;  1SHG A;  1T3S A;  4LUE A;  3ULR B;  1X43 A;  5IXF A;  2GBQ A;  2VWF A;  1BB9 A;  3EG2 A;  1GCP A;  3M0Q A;  1GBR A;  2OAW A;  2K3B A;  1UG1 A;  3VS5 A;  1NLO C;  5L23 A;  1WXU A;  1OOT A;  1ZUY A;  3CQT A;  1U3O A;  1QWF A;  1B07 A;  2FRW A;  3VS2 A;  1WFW A;  1G2B A;  4OMP A;  3EG1 A;  1W6X A;  1AVZ C;  1UFF A;  2DL7 A;  2L0A A;  2MOX A;  3TSZ A;  2RQT A;  1SEM A;  3UA7 A;  2XMF A;  1LCK A;  2DL4 A;  3VS6 A;  4R0K A;  2L2P A;  1YWP A;  3NHN A;  3JV3 A;  2KRM A;  1AWW A;  3NPF A;  2EW3 A;  1S1N A;  1T0H A;  4EIK A;  3M0S A;  2X3W D;  2O9S A;  5HCK A;  1ARK A;  1V1C A;  3EGU A;  2NUZ A;  1OPK A;  4OMO A;  2YSQ A;  1SSH A;  3THK A;  2K6D A;  2BZY A;  1U06 A;  2RMO A;  4F16 A;  3REB B;  2RQW A;  1GL5 A;  3QWX X;  3H0H A;  4HXJ A;  2BTT A;  1XOV A;  2FEI A;  4JJD A;  4CC4 B;  4AFU C;  2E5K A;  3IQL A;  1OPL A;  2ROL A;  4J9E A;  2JMC A;  2LP5 A;  1K1Z A;  2F2W A;  2A08 A;  1PKT A;  3TSW A;  4RTY A;  2SEM A;  4E6R A;  1UGV A;  2X3X D;  4QT7 A;  5FWC A;  1HJD A;  4LN2 A;  4Y92 A;  2PTK A;  4HVW A;  3UA6 A;  4Z89 A;  1M30 A;  1Y0M A;  4HCK A;  5FW9 A;  2YUP A;  2AKK A;  3VS3 A;  1WLP B;  3NGP A;  5I22 A;  2ENM A;  1J3T A;  3H0F A;  1RUW A;  2HEQ A;  1NG2 A;  1NEG A;  4GBQ A;  1B3Q A;  1MUZ A;  2BZ8 A;  2KBT A;  1CKA A;  1JU5 C;  2LCS A;  2JS2 A;  3I35 A;  1H92 A;  2LNH B;  5GJW B;  2G6F X;  3LH5 A;  3C0C A;  1RLQ C;  2DRM A;  1N5Z A;  2DLP A;  1AEY A;  4OMN A;  3RBB B;  4JZ4 A;  2ED1 A;  3M0R A;  2DE0 X;  2OJ2 A;  2AKL A;  1PNJ A;  1HSQ A;  4HVU A;  2LMJ A;  4M4Z A;  4J9D A;  1TUC A;  2CSI A;  1K0S A;  2ROT A;  3VRZ A;  3O5Z A;  5IXB A;  1H8K A;  4D8D A;  4F17 A;  4D8K A;  1NM7 A;  3M0T A;  2J6F A;  2RQV A;  1JO8 A;  1M3C A;  2A28 A;  4Z8A A;  1CSK A;  1JXO A;  2K2M A;  1K0X A;  2DF6 A;  2JM9 A;  1ABQ A;  4FSS A;  2DRK A;  4ORZ A;  4AFS C;  3KFV A;  1X2K A;  4CC3 A;  2C0T A;  4RTU A;  2YUN A;  1KSW A;  2EYX A;  1PHT A;  4GLM A;  1OV3 A;  2DBM A;  1E6G A;  4RTZ A;  2FG0 A;  2CT3 A;  2JT4 A;  1A0N B;  1VA7 A;  1TUD A;  1FMK A;  2A36 A;  1EFN A;  4WCI A;  1KFZ A;  2CSQ A;  1YP5 A;  3VS7 A;  2QDL A;  2RQU A;  1AWO A;  3UAT A;  3H0I A;  2GGR A;  1TG0 A;  2DM1 A;  1FYN A;  1GBQ A;  2K79 A;  3R6N A;  4IIM A;  2KGT A;  2F2X A;  2KXD A;  1UHC A;  4F14 A;  2CUB A;  2SRC A;  2K9G A;  2EYW A;  2HSP A;  1WXB A;  2RF0 A;  2VVK A;  3M0P A;  2JTE A;  2KT1 A;  2P4R A;  1UEC A;  1PWT A;  2JMA A;  1IO6 A;  2DMO A;  3TVT A;  1KIK A;  5ECA A;  2DVJ A;  1WIE A;  2W0Z A;  3SEM A;  1WDX A;  1Y57 A;  2MIO A;  1BU1 A;  1UJY A;  4ZNX A;  1BK2 A;  2YUQ A;  2LJ3 A;  1H3H A;  2J6K A;  1AOJ A;  2HCK A;  3PVQ A;  1QWE A;  2DJQ A;  1GFC A;  2KNB B;  2MCN A;  2CDT A;  2V1Q A;  2W10 A;  2J05 A;  1NLP C;  2J06 A;  1ZUK A;  1CKB A;  1WA7 A;  4Z88 A;  2A37 A;  1E6H A;  4CC2 A;  2KE9 A;  3I5R A;  4RTW A;  3U23 A;  1AZE A;  3PE0 A;  1K9A A;  1NYF A;  3I5S A;  3QWY A;  5IHI A;  1I07 A;  2EGA A;  2LQW A;  4J9H A;  4AG1 C;  5IHN A;  1ZSG A;  4KRT A;  1UE9 A;  1X6G A;  1GCQ C;  2CRE A;  1X6B A;  2DL5 A;  2M51 A;  2HDA A;  1QKW A;  2AZV A;  2DBK A;  4J9B A;  1VYU A;  2D1X A;  2ABL A;  1UTI A;  2L3P A;  4RTV A;  2YUO A;  4OMQ A;  2C0I A;  2ECZ A;  3VS4 A;  1QKX A;  4DEX A;  2I0N A;  1M3B A;  1AWX A;  3EHQ A;  5IH2 A;  2JW4 A;  1ZLM A;  1M27 C;  4A63 B;  1WX6 A;  2CT4 A;  4RTX A;  1ZX6 A;  4LE9 A;  2RNA A;  2FPD A;  4JPB W;  2DYB A; 
#chains in the Genus database with same CATH topology
 2CGH A;  2RI3 A;  5M9O A;  4M7A E;  1UGS B;  2PNI A;  1N8R C;  1VQ5 Q;  4JJC A;  1AZG B;  4IUU A;  2PUK B;  5GMK i;  4M75 B;  3RR6 A;  3FB9 A;  1X27 A;  1MV0 B;  3G6E Q;  3SWN A;  1D3B A;  1E7O A;  3CCV T;  2KRS A;  2MAM A;  4LDY A;  2RJC A;  5IN1 A;  2NLU A;  4OB2 B;  1PD1 A;  3CC4 A;  1ACM B;  5EC7 A;  4E7I A;  1JXM A;  5I11 A;  4CRI A;  1NJI R;  4A54 A;  1X2Q A;  2ED0 A;  1OQK A;  4M77 E;  3CPW P;  4UC4 A;  2EYZ A;  3QG1 A;  2RA2 A;  3GLX A;  5I2S A;  3TQ7 P;  5D6W A;  3HSB A;  2PUO B;  4LD9 K;  1RI0 A;  2B86 A;  4F7U B;  1YI2 Q;  1VQN Q;  2KSS A;  3DLL A;  3OY9 A;  1VQ4 Q;  2CH4 A;  4HVV A;  4LD6 A;  2R57 A;  1KG1 A;  1WHL A;  1UJ0 A;  3EG0 A;  1YJN Q;  4ANJ A;  4XU3 A;  3RNJ A;  3TCJ A;  1M8V A;  1YCS B;  2L3Q A;  5L8R E;  1Q81 C;  2HQX A;  4N0A C;  1VQK Q;  2NUT A;  5GMK e;  4M7D B;  5KYU A;  1N8R R;  1ZUU A;  3WVE B;  2KVQ G;  2A0F B;  5IHK A;  1O75 A;  3JCM W;  4IIO A;  1YIT Q;  2RI5 A;  1JB0 E;  4GY5 A;  1ABO A;  3GBQ A;  4M78 G;  2DPP B;  2EWN A;  2K7A A;  2DJZ A;  4QKU A;  2HQH A;  2VKN A;  2EGE A;  3V8J A;  4A4H A;  3A5Z B;  3Q1J A;  1OEB A;  3QXE B;  1AWJ A;  3M4G A;  2QQB A;  1QLY A;  1ZSZ A;  1Z9Q A;  4ZTF A;  1QQJ A;  4HT8 A;  2JOY A;  4M7D C;  3V7C A;  1GRI A;  1OX9 A;  2AK5 A;  5LJ3 d;  2F5K A;  3PVL A;  5KYY B;  1NPR A;  2GQI A;  2KK4 A;  1WQ7 A;  4ESR A;  2QAS A;  4DOW A;  2OTL Q;  2J6O A;  1N9S A;  2L3R A;  3OQ5 A;  4D6W A;  3CCQ A;  1PM3 A;  1TH7 A;  3VYH B;  2OI3 A;  5KYW A;  3MEV A;  4RUG A;  2JS0 A;  2KEA A;  2Y4Y A;  2KYB A;  4C92 B;  2ZPE B;  3VRY A;  4QQD A;  1ZHI A;  4PFZ A;  1V76 A;  3OMC A;  4LUE A;  3WXM B;  3SB2 A;  5IXF A;  1I5O B;  1Q81 R;  4PJL A;  2YRC A;  4Z02 A;  4KUI A;  2KI7 A;  1VQO A;  1C1A A;  1U3O A;  3CC4 Q;  2FRW A;  3OYM A;  1TOV A;  2MWO A;  3MPU B;  1C0M A;  3PTA A;  1VQP A;  3EG1 A;  1UFF A;  1WPY A;  1Q7Y C;  2RHX A;  4C92 C;  2L0A A;  3TSZ A;  2DEQ A;  3FRN A;  2RQT A;  1SEM A;  3X26 B;  5LJ5 d;  3JCM h;  4BY6 B;  3OBY A;  1OUL A;  3VS6 A;  3G71 A;  1LPL A;  2L2P A;  2HD0 A;  1YWP A;  3NHN A;  3JV3 A;  4QVD A;  3URG A;  5D7U A;  2H3E B;  1AWW A;  4A53 A;  4RG8 A;  1OZ3 A;  1D09 B;  1M90 C;  5HCK A;  3TRE A;  2XIC A;  2BKD N;  1MHN A;  1RAB B;  1ZBX A;  1U06 A;  3H9N A;  3S3N A;  2RQW A;  2JVV A;  2V8K A;  3M59 A;  2FEI A;  2HMA A;  3KBG A;  2RHZ A;  4AFU C;  1OPL A;  4MZT A;  3CCU A;  1XTD A;  3RKX A;  3NFC A;  1K1Z A;  3NTH A;  1PKT A;  5A0L A;  4RTY A;  4ELY C;  2R58 A;  4QT7 A;  1MMN A;  2P0P A;  1QVG A;  1HJD A;  3CCJ Q;  3X25 B;  4Z89 A;  3MO8 A;  4LDX A;  3PMI A;  3E9G A;  5FW9 A;  2DER A;  2YUP A;  3CC2 T;  4E7L A;  1UB4 A;  1VQ8 A;  5I22 A;  3NGP A;  2ENM A;  9ATC B;  4BAC A;  3H0F A;  1J3T A;  3EGX A;  1R0B G;  4BI3 A;  2EFI A;  3CCS A;  3M53 A;  1YIJ T;  3J80 E;  4E7Z A;  2JS2 A;  1KHC A;  2V8J A;  3I35 A;  4QQG A;  1KQ2 A;  2NUP B;  2B8A A;  3LH5 A;  1Q7Y R;  2HSE B;  1QCO A;  3N5B B;  1RLQ C;  2DLP A;  2VYT A;  1AEY A;  3ZFJ A;  2VXF A;  2HL3 A;  4ATO A;  3CCL Q;  1LNX A;  4BE1 A;  3MCA B;  2ED1 A;  4OVA A;  2PVG B;  2DE0 X;  2OJ2 A;  1MMA A;  1PNJ A;  1TSF A;  2R5M A;  1HSQ A;  1TS9 A;  4M78 B;  1W2B S;  2CSI A;  2ROT A;  4M7A D;  3CCQ Q;  2X4J A;  2ZCF B;  1ZA2 B;  3CME A;  4D8D A;  1KQS A;  5FU6 B;  1M90 R;  1M1F A;  1LVK A;  4PJO A;  2XID A;  1JO8 A;  3P8B B;  3A8L B;  4WTO B;  4KUD K;  5AYF A;  2O4X B;  4VUB A;  4O5V A;  4A4K A;  1CSK A;  2JM9 A;  4QVC A;  1ABQ A;  3JAM E;  3CCE A;  2CYZ B;  4AFS C;  2HNI A;  4BI8 B;  2CP2 A;  4CC3 A;  1K8A C;  1DJ7 B;  4RTU A;  5GAM g;  2EYX A;  3L2U A;  1VQO Q;  4EMK B;  2DTO A;  2CT3 A;  4M77 D;  3INZ A;  1VQP Q;  2A36 A;  4BE0 A;  1YP5 A;  3VS7 A;  1R0C B;  3H0I A;  2BE9 B;  4J8O A;  3G71 Q;  3GNG A;  3R6N A;  1TUG B;  3OYK A;  4CI0 C;  4F14 A;  4EMK C;  3X20 B;  2KT1 A;  2P4R A;  3GPL A;  4Y28 E;  2DMO A;  4JJN K;  1WIE A;  2IVW A;  2QA4 T;  2W0Z A;  3LW5 E;  2LT1 A;  3QKJ A;  1Y57 A;  6AT1 B;  3CMA A;  3V8K A;  4C5I A;  1O9S A;  4C8Q D;  1WHH A;  2XI9 A;  3PVQ A;  1QW1 A;  3JB9 I;  2CDT A;  2MK5 A;  3EFO A;  3CCU Q;  2A37 A;  1I5L A;  1U1S A;  2VGN A;  4ME7 A;  2CKK A;  5KE2 A;  5C6S A;  3CCV A;  1K9A A;  1NYF A;  2RHY A;  1VQ9 A;  1PCX A;  1M1G A;  1IRX A;  3CC7 T;  5GAM d;  4JS5 A;  1K8A R;  1VQ8 Q;  2XG8 D;  4J9H A;  4BI4 A;  2ATC B;  1NJI U;  1U1T A;  2QGF B;  3CCS Q;  3LGF A;  1S72 T;  4FYX B;  3EAE A;  5GAN d;  4PJO E;  2HDA A;  3E19 A;  2DXT A;  3H6Z A;  2PVO B;  2ABL A;  2OTJ A;  4DBF A;  3G1J A;  1B34 A;  4OF1 A;  2C0I A;  1BIA A;  3VS4 A;  4R56 A;  2E70 A;  1XJW B;  2GFA A;  5IH2 A;  1ZLM A;  3CXC A;  4A63 B;  2PU9 B;  1QVG P;  3FIF A;  3JCM c;  4FCY A;  3CME Q;  2D8H A;  2D8J A;  5GAO l;  1YWO A;  2ZGW A;  1QVF P;  3M4Y A;  1AD5 A;  3OS5 A;  1EZZ B;  4IUR A;  1N8R U;  2V1R A;  4X34 A;  3CCE Q;  1BCM A;  3MEW A;  1HK9 A;  1Y96 A;  2H3J A;  1G8X A;  4WF2 A;  3DKM A;  4L5G A;  4OML A;  3H8Z A;  2DX1 A;  2RK1 A;  5KCH A;  2D0Q B;  1RLP C;  2IPO B;  2EKH A;  4XTU A;  5FRO A;  1LOJ A;  2MWP A;  1NEB A;  2Y90 A;  1BKB A;  4RCB A;  2KT8 A;  3QII A;  1G83 A;  2E12 A;  4J83 A;  3JB9 D;  3JCM b;  1N9R A;  3QDF A;  2O9V A;  2KYM A;  1KK7 A;  1KQS P;  1FXX A;  5KYX B;  3M57 A;  1KD1 C;  4N4G A;  3CCR T;  2YXY A;  1RAA B;  3JSC A;  2K4Y A;  2F5T X;  3DB3 A;  4IUQ A;  2BZX A;  4M77 A;  3OMG A;  5LJ3 e;  1PRM C;  1W4S A;  5CCA A;  2HZY A;  2O31 A;  3A8O B;  2ZPH B;  3I56 T;  4K11 A;  3CMA Q;  2FO0 A;  2LJ0 A;  3RMQ A;  5J26 A;  4AT1 B;  1GCQ A;  1Q81 U;  4PLL A;  4DEY A;  3T9N A;  3OYG A;  3OW2 A;  3BDL A;  3C95 A;  4JRK A;  2GTJ A;  2COZ A;  3I55 T;  3CCV Q;  2RI2 A;  2EPD A;  1VQ9 Q;  3BE3 A;  2MYS A;  1NYG A;  2J7I A;  2X35 A;  4KGV B;  4BDZ A;  2LX7 A;  4C8Q A;  2BIV A;  3F70 A;  3M54 A;  2EKO A;  1JQQ A;  3ER0 A;  2QEX T;  2GQV A;  5GMK m;  3OYB A;  4ZGJ B;  1K4U S;  2QGG A;  3NMZ C;  1U5S A;  1HD3 A;  2QTV A;  4PKC C;  2VXE A;  1QCN A;  3CBP A;  2K3Y A;  4HCC A;  2OTJ Q;  4J9F A;  2RPN A;  5DLQ E;  5LJ5 e;  2DIL A;  1KD1 R;  3FJ5 A;  5GAM f;  1I1J A;  2HAX A;  1WI7 A;  2DL8 A;  5J39 A;  1VYV A;  4RTT A;  3QSU A;  1QMC A;  3MET A;  4XU1 A;  4ELZ C;  4PFO A;  1G3T A;  4L59 A;  3M58 A;  2G3R A;  5DM7 R;  2DYI A;  1BB9 A;  2VWF A;  3EG2 A;  3MEU A;  4ZN3 A;  1M9S A;  1GBR A;  2K3B A;  4E7S A;  2LTO A;  1NLO C;  4XU0 A;  1D3B B;  1WXU A;  5FU7 B;  3L2Q A;  1YJW A;  4C0D B;  5C0M A;  3CQT A;  1D1C A;  3JCM d;  1QWF A;  1JBM A;  3CPW S;  1SF9 A;  3EG9 B;  4M75 C;  4FYV B;  2QQR A;  3LX7 A;  5GAO m;  1W6X A;  3CC2 A;  5EG2 A;  2DVE A;  2RM4 A;  5LJ3 g;  4JRI A;  3MHX A;  2V26 A;  3S3O A;  3UA7 A;  3CXC P;  1Q7Y U;  2EQU A;  1M2V A;  2RD1 A;  4B6M A;  2KMT A;  1Y07 A;  2E65 A;  5FU7 C;  4EMG A;  2KRM A;  4C0D C;  4F7U A;  1XQH A;  2L89 A;  1S1N A;  1T0H A;  4ZGD B;  2X3W D;  2O9S A;  4M7A F;  1OPK A;  1VUB A;  1SSH A;  2CP3 A;  1YJ9 A;  1M90 U;  3CD6 T;  2RMO A;  4J6X A;  3REB B;  3OYE A;  1GL5 A;  4C8Q E;  3QWX X;  3H0H A;  4HXJ A;  1XOV A;  1VQ5 T;  2FHD A;  3LYI A;  2E5K A;  2F69 A;  2YWW A;  3JCM Q;  4KT0 E;  1IHV A;  2K57 A;  3GF5 A;  1EIF A;  2LVM A;  1BCO A;  2NUT B;  3G6E T;  3TSW A;  4E6R A;  3HKS A;  4PJJ A;  5KYU B;  1YHQ T;  4TVR A;  1WJQ A;  1MNE A;  4M77 F;  2AKK A;  4OMF B;  2VB6 A;  1WLP B;  5LJ5 g;  2QQS A;  5HK0 A;  1RUW A;  3M55 A;  1NEG A;  4PJO D;  1B3Q A;  2KBT A;  1VQL T;  1CKA A;  3FLG A;  1ZSZ B;  1H92 A;  5GJW B;  2DXC A;  2E4H A;  4IUV A;  3C0C A;  2DRM A;  4JLG A;  1JJ2 A;  2JNG A;  1NZ9 A;  3JCM P;  4J7F A;  2DIQ A;  4HVU A;  2LMJ A;  4BUG A;  3QYH B;  1VQ4 T;  2YHT A;  1D1A A;  2M0O A;  2XKO C;  2JTF A;  1X01 A;  3OW2 P;  2IG0 A;  4RKU E;  4RMO A;  3DLM A;  2QXF A;  4C8Q F;  2QA4 A;  1ZSZ C;  3EGD B;  3M5A A;  3M0T A;  1YJN T;  4LDW A;  5KYW B;  2RHI A;  4Z8A A;  3L42 A;  1Q82 C;  1VQK T;  2K2M A;  3FC3 A;  4A4F A;  4HT9 A;  1B7T A;  4FM4 B;  4XTZ A;  3KFV A;  1X2K A;  1WNL A;  2LT4 A;  3HPW A;  2V8I A;  1KSW A;  2PVD B;  4GLM A;  1YJW Q;  3L2V A;  2EQJ A;  1K8A U;  1OV3 A;  4F7U E;  4B9W A;  4RTZ A;  4FW1 A;  1Q95 G;  3CC7 A;  1P92 A;  1A0N B;  3CC2 Q;  2P84 A;  2RQU A;  5IT9 E;  4KUL A;  2MF2 A;  2RK2 A;  5GAM e;  4JLI A;  2M02 A;  3EH2 A;  3HRU A;  1OX8 A;  4JRQ A;  1FYN A;  5GAO r;  2KGT A;  2F2X A;  3HFO A;  4M7D E;  2Z0W A;  3VUZ A;  1WXB A;  5GAN e;  3M0P A;  2JTE A;  1U8R A;  2MPX C;  2OTL T;  5ECA A;  1PSF A;  3M9Q A;  5GAN 5;  2CZ1 B;  3SEM A;  2XHC A;  4BY6 C;  4XTY A;  2XK0 A;  1YJ9 Q;  4F04 B;  5GAN 3;  4PNO A;  1QP2 A;  4QW2 A;  2LNV A;  5CKD A;  2HCK A;  5GAN 4;  1QWE A;  3SFM A;  2RH2 A;  2W10 A;  2J05 A;  2J06 A;  4XK8 E;  1TXQ A;  1BYM A;  3CBM A;  4DBH A;  1Q82 R;  2QI2 A;  1AZE A;  1RAC B;  3PFS A;  5IHI A;  3RES A;  3CC4 T;  4DA4 A;  4N4H A;  4QQ6 A;  1ZSG A;  2DO3 A;  4KRT A;  4MML A;  2VUB A;  1X6B A;  2DL5 A;  5CAI A;  1VOM A;  4J9B A;  3JB9 H;  4XU2 A;  1MND A;  2D1X A;  2M16 A;  4C92 E;  4J5Y A;  2YUO A;  2ECZ A;  1QKX A;  2M1H A;  2I0N A;  2XD0 A;  3EHQ A;  3EFS A;  4M7A G;  1BIB A;  1NE8 A;  3P8H A;  1OYX A;  3CCM T;  1ZX6 A;  3E9F A;  2RNA A;  5FWC A;  3C4S A;  1F1B B;  2QA4 Q;  1ZA1 B;  2CS7 A;  2FRY A;  1VIF A;  2CUD A;  2HBP A;  3I56 A;  5LJ3 f;  2VV5 A;  5KH6 A;  5HK3 A;  5A2Q E;  1PC0 A;  2E3I A;  4M78 C;  2PZ1 A;  1QCF A;  1YNZ A;  3HTR A;  2XDB A;  3CCJ T;  5FU6 C;  4J9C A;  5GJV B;  1WYX A;  1JJ2 P;  5IAY A;  2RN8 A;  4JS4 A;  1VQ6 A;  4M77 G;  4HA8 A;  1FMW A;  5GAN g;  3CC7 Q;  3VUB A;  2K3X A;  2LJ1 A;  1AT1 B;  2DD4 A;  2QQ9 A;  1X69 A;  3REA B;  2QYZ A;  2K5I A;  1MV3 A;  3QO3 A;  1OZ2 A;  1WJS A;  1YN8 A;  8AT1 B;  1BBZ A;  2IIM A;  2ZZD A;  2AHJ B;  2EBP A;  1QVP A;  1W70 A;  5CKH A;  1T3L A;  3CCL T;  1KD1 U;  2F2V A;  1WXT A;  2EYY A;  2EAY A;  2KRO A;  1I4K 1;  2KRN A;  2JM8 A;  4NS5 A;  2DTH A;  2E6N A;  3VKI A;  2YT6 A;  4DBR A;  5LJ5 f;  5HKC A;  3BFM A;  5CKB A;  2YDL A;  4C8Q G;  5GMK l;  1M8M A;  4AFQ C;  2L3S A;  1SHF A;  4NL3 A;  3GOX A;  2JXB A;  1UDL A;  2E6Z A;  4OGC A;  4OP0 A;  3A1P A;  4LDU A;  4JJB A;  3I9Q A;  4PJN A;  4PL6 A;  3EHR A;  1PRL C;  2M0Y A;  3MJX A;  2KQW A;  4P5N A;  1VQO T;  5D6X A;  2DFU A;  4C0F A;  1ZBJ A;  1M2O A;  2E5Q A;  1KJW A;  1VQP T;  3BDU A;  4EPC A;  1PKS A;  3JCM e;  2CZ7 B;  1T0J A;  4JZ3 A;  4X1V A;  4M75 D;  1RI9 A;  3FEO A;  3X24 B;  3A98 A;  3G71 T;  4LUD A;  2JUF A;  2HKQ B;  3RKY A;  2DXU A;  4FW2 A;  1B34 B;  2AZS A;  1Z9Z A;  2KR3 A;  3OS2 A;  8ATC B;  3PMT A;  5CKE A;  1BI3 A;  2ZPI B;  4J9I A;  1QVF S;  2FZC B;  5HY6 A;  1VQM T;  3OYF A;  1WJR A;  2OX7 A;  3HRT A;  3EG3 A;  3CD6 A;  1TU0 B;  1SRM A;  3UF4 A;  1SKU B;  3QBY A;  5A0D A;  1T3S A;  4LDV A;  2QTX A;  3ULR B;  4ZGE B;  1X43 A;  2XU8 A;  2GBQ A;  1D1B A;  5GMK h;  1UGP B;  1GCP A;  1X6O A;  3M0Q A;  5GMK j;  3OYY A;  1Y96 B;  3EH1 A;  1ZUY A;  4XQ3 A;  1PD0 A;  4PFP A;  1MMG A;  4V2S A;  1B07 A;  3VS2 A;  4M7A B;  1VQ6 Q;  1YHQ A;  1UGQ B;  1G2B A;  4HCB A;  4PJO F;  1KQS S;  2MOX A;  2OAU A;  3CCS T;  3E1S A;  1H64 1;  1ZQ1 A;  1VQL A;  2E10 A;  1JRI A;  1LCK A;  4M7D D;  1D0Z A;  2C06 A;  2FZG B;  4RG2 A;  4J6W A;  2YRV A;  3NPF A;  2EW3 A;  5J3B A;  4M7A C;  3MP8 A;  2E41 A;  1ARK A;  1V1C A;  2HQE A;  2QQA A;  3EGU A;  4BD3 A;  2NUZ A;  4M77 B;  2YSQ A;  1KQ1 A;  1D0Y A;  2BTT A;  1BI2 A;  2QDY B;  4JJD A;  5I2M A;  4XTV A;  1IGQ A;  3NTI A;  3IQL A;  2GF7 A;  1WHJ A;  2X51 A;  3AT1 B;  1UEB A;  3JRZ A;  1RL2 A;  3JCM g;  2LP5 A;  3OYI A;  3CCE T;  5FRM A;  3HP9 A;  3OSV A;  5CQY A;  2LQ8 A;  2KDS A;  2SEM A;  2WSC E;  3G4S T;  1UGV A;  2EJG A;  2M9U A;  4LN2 A;  4Y92 A;  2PTK A;  3UA6 A;  3E2U A;  3QUI A;  5GAN 2;  4M77 C;  3OYC A;  1K73 C;  2DAQ A;  3ME9 A;  2DET A;  4PJM A;  1PSE A;  1RAD B;  1KC8 U;  4Q5W A;  4GBQ A;  5CK9 A;  1MUZ A;  4C8Q B;  3R6O A;  4C92 D;  1NPP A;  3RKW A;  4OB3 B;  1N6A A;  2G6F X;  1WHK A;  2XDP A;  2DK3 A;  4BDY A;  3LH0 A;  2RJD A;  4IKF A;  1Q86 U;  4JZ4 A;  3M0R A;  2MI6 A;  2AKL A;  1MMD A;  4M4Z A;  2P0K A;  4KGX B;  3FDR A;  4J9D A;  1TUC A;  2YLB A;  1M1K C;  1K0S A;  2BUD A;  3O5Z A;  1H8K A;  4F17 A;  3UDC A;  2QAZ A;  4KBM B;  5GAN f;  4D8K A;  4M75 A;  2RJF A;  1XNI A;  3PGG A;  3QPH A;  3CD6 Q;  2J6F A;  4E7H A;  2RQV A;  4J6Y A;  2P0Q A;  1JXO A;  3OYH A;  4NOY A;  1UGR B;  4FSS A;  4ORZ A;  2X4Y A;  3SWN B;  1Q82 U;  4FIB A;  1RAF B;  3MKD A;  1VQ9 T;  2DBM A;  1IGU A;  2CZ6 B;  3CXC S;  1YHQ Q;  3EG9 A;  5GAO p;  1SG5 A;  1YIJ A;  1RAG B;  2X4X A;  1K73 R;  1AWO A;  2QDL A;  5GAO n;  3OS1 A;  2X4W A;  2CP0 A;  2CZ0 B;  2XDD A;  4N0A A;  2JTM A;  2GGR A;  3SWN C;  1HYO A;  1VQL Q;  1M2V B;  1GBQ A;  2K79 A;  1VQ7 T;  2OTJ T;  4IIM A;  3X28 B;  4KH0 B;  2EYW A;  2I2L A;  4IUP A;  1Y7X A;  4B9X A;  2RF0 A;  2VVK A;  1UEC A;  2QG9 B;  2HL5 C;  1QP3 A;  2RHU A;  2E3H A;  4C5H A;  2MIO A;  1BU1 A;  2LQK A;  4ZNX A;  1BK2 A;  1KHI A;  2YUQ A;  3CCM A;  1H3H A;  2J6K A;  2AIR B;  1AOJ A;  1M1K R;  4M7D A;  1TTH B;  4E7J A;  1K9M C;  2MCN A;  3L2Z A;  5CR2 A;  2ZPB B;  4FT4 A;  1NLP C;  1CKB A;  4CC2 A;  2RB6 A;  4E2F B;  2YLC A;  3I5R A;  2DZC A;  3S6W A;  2WSE E;  3OYN A;  2EQM A;  3LLR A;  3I5S A;  1KC8 C;  2FB7 A;  4M78 D;  1W2B A;  2YRD A;  3CCJ A;  1WQW A;  3JCM V;  2LQW A;  1IHW A;  4ZN1 A;  5IHN A;  3VJP A;  4PJO G;  2ZPG B;  1Q86 C;  3L1A A;  5CQX A;  3QJ6 A;  5DY9 A;  4ZTJ A;  4M75 E;  2DBK A;  3CPF A;  5KYY A;  2L3P A;  1YI2 T;  1VQN T;  4RTV A;  2ZPF B;  4OMQ A;  1PG5 B;  1N27 A;  3OW2 S;  3OS0 A;  4DEX A;  1OU8 A;  2Y4X A;  4MDW A;  3CCL A;  3MEA A;  3GP8 A;  5KYN A;  3MP6 A;  1M27 C;  1WX6 A;  2CT4 A;  1IB8 A;  2VAS A;  4FT2 A;  5CO7 A;  4LE9 A;  2FPD A;  4JPB W;  3OB9 A;  5DLO A;  4OB0 B;  4C92 A;  3A8M B;  3EGD A;  4J9G A;  2L5Q A;  2KXC A;  3TU4 K;  2NWM A;  1W1F A;  1OI1 A;  1YIT T;  5LL6 S;  4C5G A;  1K9M R;  4J7I A;  2EQK A;  2EJ9 A;  2DEU A;  1K76 A;  4FL6 A;  3V8L A;  2NYS A;  3H41 A;  4II1 A;  3OBW A;  2A3L A;  4FSX A;  1KC8 R;  1UHF A;  4O6J A;  2D6F A;  5GAO q;  4NL2 A;  2VC8 A;  2LZ6 B;  1VYT A;  2QK0 A;  1YIJ Q;  1S72 A;  2RQR A;  3VV0 A;  5D6Y A;  7AT1 B;  2ESW A;  4OB1 B;  4M75 F;  4BE2 A;  2FPF A;  2KY9 A;  3SHW A;  3UT1 A;  1I0C A;  2DL3 A;  1Q86 R;  1GFD A;  3VS0 A;  4LNP A;  4KH1 B;  3JCM f;  2GTO A;  3M0U A;  1C6V X;  2EVR A;  1TWB A;  2O2O A;  3OYD A;  1X75 C;  4FYW B;  1M5Q 1;  2LRQ A;  4X9D A;  1EX4 A;  5KCO A;  1G3W A;  2H8H A;  2EGC A;  3RIR A;  1YBY A;  4AFZ C;  2C0O A;  3CCM Q;  1VQM A;  4OMM A;  2CH4 W;  3OYL A;  2FPE A;  3J7A F;  2DNU A;  2DA9 A;  2FZK B;  5CKF A;  3FJP A;  4XTX A;  3TEE A;  4F7U F;  5AT1 B;  3ZEH A;  1SPK A;  3M56 A;  1V29 B;  4OGE A;  1SSF A;  1I8F A;  2RJE A;  1YJW T;  2EQI A;  4CC7 A;  3LWI A;  5CVI A;  2CP6 A;  3JB9 F;  2LX9 A;  3EGX B;  2EIF A;  3V7S A;  2LQN A;  4DOV A;  1QVF A;  2NUP A;  1JEG A;  2D0N A;  5FWB A;  3PIO A;  4X9C A;  4M7D F;  3ZL7 C;  2FYK A;  3CCR A;  4HCZ A;  4MMK A;  4EDU A;  3VS1 A;  1G3S A;  2O88 A;  3LWH A;  1IZ6 A;  2LC4 A;  4M78 A;  1UUE A;  3HRS A;  2WAC A;  3OA6 A;  3JCM J;  4AG2 C;  1M3A A;  1SRL A;  3D7S B;  3RDV A;  4FYY B;  3PNW C;  5LJ3 h;  2PQW A;  4XTW A;  2AT1 B;  5LJ3 j;  2HBW A;  2GNC A;  3UWN A;  1YJ9 T;  3JCM X;  4PJO B;  2DD5 A;  3GNF B;  2O4X A;  1W2B P;  1VIE A;  1SHG A;  1BI1 A;  3NTK A;  2F1L A;  1JJ2 S;  3BY7 A;  2OAW A;  1UG1 A;  3S3M A;  1OU9 A;  3VS5 A;  3I55 A;  2KAF A;  4EMK A;  5L23 A;  3G4S A;  2BE7 D;  4C5E A;  1OOT A;  3EFR A;  1G3Y A;  4LXC A;  1AHJ B;  1R8O B;  3G7Z A;  4PJO C;  3PT9 A;  1WFW A;  4OMP A;  1D0X A;  1AVZ C;  1HXD A;  2DL7 A;  2QEX A;  3O8V A;  4C92 F;  1S72 Q;  3SD4 A;  3CEY A;  2DTI A;  2XMF A;  1WHG A;  2DL4 A;  2D9T A;  4R0K A;  2JZ2 A;  3J81 E;  4RCC A;  2K2V A;  1YFN A;  4A4G A;  4EIK A;  4E47 A;  3CCQ T;  3M0S A;  3OYA A;  5LJ5 h;  5LJ5 j;  4PK4 A;  1WHM A;  3RMS A;  4OMO A;  3THK A;  1YCY A;  2K6D A;  2BZY A;  4F16 A;  1VQM Q;  1RAE B;  3VU3 C;  2CP5 A;  3ZBD A;  3EFO B;  4CC4 B;  3VYG A;  3QZ9 B;  4MDX A;  3ASK A;  2ROL A;  4J9E A;  2JMC A;  2F2W A;  2A08 A;  4C0G A;  5CIU A;  2K5F A;  2X3X D;  1G5V A;  4FU6 A;  4HVW A;  1M30 A;  1Y0M A;  2L8D A;  4HCK A;  4M78 E;  3HL8 A;  1BI0 A;  5A0G A;  3VS3 A;  2LCC A;  2DIG A;  2HEQ A;  1K73 U;  1NG2 A;  2E1H A;  2VGM A;  2BZ8 A;  1JU5 C;  2EYQ A;  4KGZ B;  2LCS A;  3L2W A;  2LNH B;  4M75 G;  1N5Z A;  3GIB A;  3JB9 J;  1QVG S;  3CCR Q;  1RAH B;  4OMN A;  3RER A;  3RBB B;  3A8H B;  5GAN 7;  1Y71 A;  2FVU A;  1H3Z A;  3P8D A;  1VQ7 A;  1FX7 A;  4JUV A;  4HKE A;  1I81 A;  1MGQ A;  3CPW A;  3SDZ A;  2LDM A;  3VRZ A;  5IXB A;  3I56 Q;  1M1K U;  1IRE B;  1NM7 A;  1NBE B;  1VQ5 A;  5FRN A;  3QZ5 B;  4PLI A;  3CCU T;  1M3C A;  2A28 A;  2R5A A;  2DF6 A;  1K0X A;  4YTL A;  2DRK A;  3MP1 A;  3G6E A;  1M4Z A;  4F7U G;  2JJ9 A;  2C0T A;  2CP7 A;  3I55 Q;  2YUN A;  4M78 F;  2P4T A;  3G4S Q;  3BW1 A;  2JN0 A;  2LCL A;  1PHT A;  1VQ8 T;  4DBQ A;  5GAN 8;  1E6G A;  3RUX A;  2DKG A;  3C12 A;  1WGS A;  2FG0 A;  3JB9 G;  2E64 A;  2ZAE A;  2JT4 A;  4M7A A;  2A7Y A;  1WZO A;  3QDR B;  1VA7 A;  1TUD A;  1FMK A;  1IXD A;  1EFN A;  4WCI A;  1FMV A;  1KFZ A;  2CSQ A;  2QEX Q;  3V7R A;  3UAT A;  5KYX A;  2MMP A;  4R55 A;  1TG0 A;  4M7D G;  3A8G B;  2DM1 A;  4GLK A;  5I21 A;  2KXD A;  4XAX B;  1UHC A;  4AMC A;  2CUB A;  2SRC A;  2K9G A;  1YI2 A;  2RO0 A;  1VQN A;  2HSP A;  4Y91 A;  2WSF E;  2COY A;  2X9H A;  1VQ4 A;  1PWT A;  2JMA A;  1IO6 A;  3TVT A;  2DZ9 A;  1KIK A;  4JDS A;  2DVJ A;  3CME T;  2GFU A;  1WDX A;  2DXB A;  4DQ2 A;  1UJY A;  4E7K A;  2LJ3 A;  1YJN A;  5KE3 A;  1GXI E;  3PIP A;  3QYG B;  2DJQ A;  1GFC A;  2COW A;  3HFN A;  2KNB B;  3QHS A;  1VQK A;  2V1Q A;  2EJF A;  1RAI B;  1ZUK A;  1WA7 A;  1K9M U;  4Z88 A;  1E6H A;  2KE9 A;  4RTW A;  1YIT A;  3AHU A;  3U23 A;  5GAN 6;  3PE0 A;  3QWY A;  3KUF A;  5FLX E;  1NJI C;  1I07 A;  2EGA A;  4EMH A;  4JRP A;  3KXT A;  1VQ6 T;  4AG1 C;  4MZM A;  1LJO A;  1R77 A;  3QJY A;  4MZP A;  1UE9 A;  1X6G A;  1GCQ C;  4C92 G;  4A4E A;  2CRE A;  4C0Z A;  2M51 A;  2O01 E;  3CBO A;  1QKW A;  2FL7 A;  2AZV A;  5GAM h;  2K5L A;  1VYU A;  1UTI A;  5GAM j;  3C94 A;  4IUT A;  3L2R A;  2GCX A;  3UPU A;  3OYJ A;  1VQ7 Q;  4QVZ A;  2OTL A;  1FWZ A;  4C8Q C;  1M3B A;  1AWX A;  5GAN h;  2JW4 A;  3HHT B;  3LGL A;  3CMA T;  4N4I A;  5GAN j;  2HKN A;  4L6V 5;  4RTX A;  4BB7 A;  3OSS C;  3DB4 A;  3WVD B;  2DYB A; 
#chains in the Genus database with same CATH homology
 2FRY A;  2D8H A;  2D8J A;  2CUD A;  2PNI A;  1YWO A;  4J9G A;  4JJC A;  1AD5 A;  1AZG B;  2KXC A;  2NWM A;  1W1F A;  2PZ1 A;  2V1R A;  1X27 A;  1MV0 B;  1E7O A;  1QCF A;  2KRS A;  1YNZ A;  4OML A;  2DX1 A;  1K76 A;  4J9C A;  5GJV B;  1WYX A;  1RLP C;  2EKH A;  5EC7 A;  3H41 A;  2RN8 A;  1NEB A;  1JXM A;  1UHF A;  5I11 A;  2KT8 A;  1X2Q A;  2LZ6 B;  1VYT A;  2ED0 A;  1G83 A;  2RQR A;  2LJ1 A;  1X69 A;  2ESW A;  3REA B;  1MV3 A;  2EYZ A;  2FPF A;  2O9V A;  3SHW A;  1YN8 A;  1I0C A;  2DL3 A;  2KYM A;  1BBZ A;  2IIM A;  1GFD A;  3VS0 A;  2EBP A;  2B86 A;  1W70 A;  4LNP A;  1T3L A;  2GTO A;  2F2V A;  1WXT A;  2BZX A;  3M0U A;  2EVR A;  2EYY A;  2O2O A;  2CH4 A;  4HVV A;  1PRM C;  2KRO A;  2KRN A;  2JM8 A;  2O31 A;  2H8H A;  1UJ0 A;  2EGC A;  2YT6 A;  4K11 A;  2FO0 A;  4AFZ C;  2C0O A;  2LJ0 A;  2YDL A;  3EG0 A;  4OMM A;  2CH4 W;  3RNJ A;  1M8M A;  1YCS B;  2FPE A;  2L3Q A;  2DNU A;  4AFQ C;  2DA9 A;  1GCQ A;  2L3S A;  1SHF A;  4DEY A;  2JXB A;  1UDL A;  1ZUU A;  5IHK A;  1SPK A;  4IIO A;  4JJB A;  2GTJ A;  3I9Q A;  1ABO A;  3GBQ A;  2EPD A;  3EHR A;  2K7A A;  1PRL C;  2M0Y A;  2EQI A;  4CC7 A;  2VKN A;  1NYG A;  2EGE A;  2J7I A;  1ZBJ A;  2LX7 A;  1OEB A;  1AWJ A;  1KJW A;  2LQN A;  1QLY A;  1JEG A;  1PKS A;  1Z9Q A;  2D0N A;  1JQQ A;  5FWB A;  1T0J A;  4JZ3 A;  4X1V A;  3NMZ C;  1K4U S;  1GRI A;  1U5S A;  1HD3 A;  3ZL7 C;  1RI9 A;  2AK5 A;  3A98 A;  4LUD A;  4J9F A;  3VS1 A;  3PVL A;  2GQI A;  2O88 A;  2RPN A;  4ESR A;  1UUE A;  2DIL A;  2AZS A;  1Z9Z A;  2KR3 A;  4AG2 C;  3FJ5 A;  1M3A A;  1SRL A;  1I1J A;  4J9I A;  2J6O A;  1WI7 A;  2DL8 A;  3EG3 A;  2OI3 A;  2HBW A;  2GNC A;  1VYV A;  4RUG A;  2JS0 A;  2KEA A;  4RTT A;  1SRM A;  3UF4 A;  2KYB A;  3VRY A;  1SHG A;  1T3S A;  4LUE A;  3ULR B;  1X43 A;  5IXF A;  2GBQ A;  2VWF A;  1BB9 A;  3EG2 A;  1GCP A;  3M0Q A;  1GBR A;  2OAW A;  2K3B A;  1UG1 A;  3VS5 A;  1NLO C;  5L23 A;  1WXU A;  1OOT A;  1ZUY A;  3CQT A;  1U3O A;  1QWF A;  1B07 A;  2FRW A;  3VS2 A;  1WFW A;  1G2B A;  4OMP A;  3EG1 A;  1W6X A;  1AVZ C;  1UFF A;  2DL7 A;  2L0A A;  2MOX A;  3TSZ A;  2RQT A;  1SEM A;  3UA7 A;  2XMF A;  1LCK A;  2DL4 A;  3VS6 A;  4R0K A;  2L2P A;  1YWP A;  3NHN A;  3JV3 A;  2KRM A;  1AWW A;  3NPF A;  2EW3 A;  1S1N A;  1T0H A;  4EIK A;  3M0S A;  2X3W D;  2O9S A;  5HCK A;  1ARK A;  1V1C A;  3EGU A;  2NUZ A;  1OPK A;  4OMO A;  2YSQ A;  1SSH A;  3THK A;  2K6D A;  2BZY A;  1U06 A;  2RMO A;  4F16 A;  3REB B;  2RQW A;  1GL5 A;  3QWX X;  3H0H A;  4HXJ A;  2BTT A;  1XOV A;  2FEI A;  4JJD A;  4CC4 B;  4AFU C;  2E5K A;  3IQL A;  1OPL A;  2ROL A;  4J9E A;  2JMC A;  2LP5 A;  1K1Z A;  2F2W A;  2A08 A;  1PKT A;  3TSW A;  4RTY A;  2SEM A;  4E6R A;  1UGV A;  2X3X D;  4QT7 A;  5FWC A;  1HJD A;  4LN2 A;  4Y92 A;  2PTK A;  4HVW A;  3UA6 A;  4Z89 A;  1M30 A;  1Y0M A;  4HCK A;  5FW9 A;  2YUP A;  2AKK A;  3VS3 A;  1WLP B;  3NGP A;  5I22 A;  2ENM A;  1J3T A;  3H0F A;  1RUW A;  2HEQ A;  1NG2 A;  1NEG A;  4GBQ A;  1B3Q A;  1MUZ A;  2BZ8 A;  2KBT A;  1CKA A;  1JU5 C;  2LCS A;  2JS2 A;  3I35 A;  1H92 A;  2LNH B;  5GJW B;  2G6F X;  3LH5 A;  3C0C A;  1RLQ C;  2DRM A;  1N5Z A;  2DLP A;  1AEY A;  4OMN A;  3RBB B;  4JZ4 A;  2ED1 A;  3M0R A;  2DE0 X;  2OJ2 A;  2AKL A;  1PNJ A;  1HSQ A;  4HVU A;  2LMJ A;  4M4Z A;  4J9D A;  1TUC A;  2CSI A;  1K0S A;  2ROT A;  3VRZ A;  3O5Z A;  5IXB A;  1H8K A;  4D8D A;  4F17 A;  4D8K A;  1NM7 A;  3M0T A;  2J6F A;  2RQV A;  1JO8 A;  1M3C A;  2A28 A;  4Z8A A;  1CSK A;  1JXO A;  2K2M A;  1K0X A;  2DF6 A;  2JM9 A;  1ABQ A;  4FSS A;  2DRK A;  4ORZ A;  4AFS C;  3KFV A;  1X2K A;  4CC3 A;  2C0T A;  4RTU A;  2YUN A;  1KSW A;  2EYX A;  1PHT A;  4GLM A;  1OV3 A;  2DBM A;  1E6G A;  4RTZ A;  2FG0 A;  2CT3 A;  2JT4 A;  1A0N B;  1VA7 A;  1TUD A;  1FMK A;  2A36 A;  1EFN A;  4WCI A;  1KFZ A;  2CSQ A;  1YP5 A;  3VS7 A;  2QDL A;  2RQU A;  1AWO A;  3UAT A;  3H0I A;  2GGR A;  1TG0 A;  2DM1 A;  1FYN A;  1GBQ A;  2K79 A;  3R6N A;  4IIM A;  2KGT A;  2F2X A;  2KXD A;  1UHC A;  4F14 A;  2CUB A;  2SRC A;  2K9G A;  2EYW A;  2HSP A;  1WXB A;  2RF0 A;  2VVK A;  3M0P A;  2JTE A;  2KT1 A;  2P4R A;  1UEC A;  1PWT A;  2JMA A;  1IO6 A;  2DMO A;  3TVT A;  1KIK A;  5ECA A;  2DVJ A;  1WIE A;  2W0Z A;  3SEM A;  1WDX A;  1Y57 A;  2MIO A;  1BU1 A;  1UJY A;  4ZNX A;  1BK2 A;  2YUQ A;  2LJ3 A;  1H3H A;  2J6K A;  1AOJ A;  2HCK A;  3PVQ A;  1QWE A;  2DJQ A;  1GFC A;  2KNB B;  2MCN A;  2CDT A;  2V1Q A;  2W10 A;  2J05 A;  1NLP C;  2J06 A;  1ZUK A;  1CKB A;  1WA7 A;  4Z88 A;  2A37 A;  1E6H A;  4CC2 A;  2KE9 A;  3I5R A;  4RTW A;  3U23 A;  1AZE A;  3PE0 A;  1K9A A;  1NYF A;  3I5S A;  3QWY A;  5IHI A;  1I07 A;  2EGA A;  2LQW A;  4J9H A;  4AG1 C;  5IHN A;  1ZSG A;  4KRT A;  1UE9 A;  1X6G A;  1GCQ C;  2CRE A;  1X6B A;  2DL5 A;  2M51 A;  2HDA A;  1QKW A;  2AZV A;  2DBK A;  4J9B A;  1VYU A;  2D1X A;  2ABL A;  1UTI A;  2L3P A;  4RTV A;  2YUO A;  4OMQ A;  2C0I A;  2ECZ A;  3VS4 A;  1QKX A;  4DEX A;  2I0N A;  1M3B A;  1AWX A;  3EHQ A;  5IH2 A;  2JW4 A;  1ZLM A;  1M27 C;  4A63 B;  1WX6 A;  2CT4 A;  4RTX A;  1ZX6 A;  4LE9 A;  2RNA A;  2FPD A;  4JPB W;  2DYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...