1LJOA

Crystal structure of an sm-like protein (af-sm2) from archaeoglobus fulgidus at 1.95a resolution
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
75
structure length
75
Chain Sequence
GAMVLPNQMVKSMVGKIIRVEMKGEENQLVGKLEGVDDYMNLYLTNAMECKGEEKVRSLGEIVLRGNNVVLIQPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Archaeal Sm-like protein AF-Sm2
publication title Archaeal Sm proteins form heptameric and hexameric complexes: crystal structures of the Sm1 and Sm2 proteins from the hyperthermophile Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Unknown function
total genus 15
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2002-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ljoA00
5GANd 4X9DA 3RKYA 5LJ5e 4M77G 1I5LA 5LJ3e 4M7DF 5GANf 2DJZA 4HT9A 2DEQA 3JCMX 4M7DG 4PJOA 4JRKA 4M78E 4MMKA 4M75B 3JB9J 2I2LA 4C8QF 1I4K1 3JB9I 4M7AB 5LJ5g 5LJ3g 5GAMh 4M78D 4RCBA 1N9RA 1B34B 2DZ9A 2EJGA 4M75E 2RD1A 1MGQA 3SWNA 4A53A 5GANe 5LJ3d 4M78G 4EMKA 4M7AE 3HFOA 3JCMg 4M75F 1LNXA 3JCMP 5LJ3f 3RERA 3INZA 3V7RA 3JCMd 4M7AD 4M77A 2DXTA 4M75G 3V8JA 3GIBA 4EMHA 2VXEA 3JCMf 5GAOl 4M7AG 5GAOp 5LJ5j 1YCYA 2FYKA 1WNLA 3L1AA 2CGHA 3V7CA 5LJ3j 2K57A 3AHUA 4M7DA 3JB9G 1BIBA 3HFNA 4C8QB 3FJPA 4M77C 4N0AA 2FB7A 3QUIA 2RA2A 5GAN2 4M7DD 3M4GA 4WF2A 2EAYA 3JCMb 1U1SA 4C8QE 2E1HA 2E65A 4M78A 3JCMe 1M5Q1 5I21A 2RB6A 4JRIA 1I8FA 4C92B 5GANj 5GMKi 1JBMA 5GAN7 3V8KA 2E10A 4C8QD 3JCMJ 1KQ1A 4XU1A 4M75A 4C92E 2YLBA 4C8QG 1KQ2A 4M7AA 5GMKe 5LJ5h 4J6XA 4J6WA 5LJ3h 4Y91A 2YHTA 4C92F 5GAN8 4PJOC 1B34A 2DTHA 4M75D 3FIFA 5GAN6 3EFRA 2EJ9A 4HA8A 4OP0A 3SB2A 4C92G 4JLIA 3SWNC 4NL2A 3JB9D 4EMKC 5GMKh 1I81A 4NL3A 1WQ7A 4QVCA 1HK9A 3PGGA 4XU0A 5GAN3 3QHSA 1N9SA 2YLCA 2JN0A 5GANh 1WPYA 4JUVA 4XTWA 3RKXA 2VC8A 2EWNA 4XTYA 4C8QA 4PJOF 4M7DC 3BDUA 4NOYA 5GAOm 4XTVA 3JCMc 2DZCA 3EFSA 3BFMA 4N0AC 5GMKj 4XTUA 4M77B 3VU3C 3BW1A 5GMKm 4C92A 1H641 4QVDA 5GAOq 4M7DE 3HSBA 1Y96B 1D3BB 4M78C 1BIAA 2RM4A 1U1TA 4M77E 5DY9A 1LOJA 2DKGA 4J5YA 3V8LA 4F7UB 1LJOA 4C92D 3V7SA 1X01A 4M77F 3RIRA 5GAMe 3JCMh 5GAOn 4M75C 4F7UE 4X9CA 4M7AC 1M8VA 4MMLA 4PNOA 4M78B 4F7UF 3QO3A 4RCCA 4PJOB 2VXFA 5CAIA 2E41A 4A54A 1HXDA 1TH7A 3L2ZA 4XTXA 3RKWA 4F7UG 2HNIA 3RUXA 1WQWA 2DVEA 2Y90A 4J6YA 4DQ2A 5GAMg 5GAN5 5GAN4 4PJOE 3SWNB 4XU2A 2QTXA 4M78F 3JCMV 2DTOA 2DXUA 4EMKB 2ZGWA 5GAMd 4PJOD 5GAMf 5LJ5d 4XTZA 3JCMW 3FB9A 3JB9H 4PJOG 4EMGA 3QSUA 5LJ5f 2EJFA 2E64A 4M7AF 4C8QC 4XU3A 5GAMj 4V2SA 4M7DB 1JRIA 3JB9F 5GAOr 1Y96A 3BY7A 5GANg 1D3BA 3RESA 4HT8A 3JCMQ 5GMKl 4F7UA 4C92C 2DTIA 4M77D 4XQ3A
chains in the Genus database with same CATH superfamily
5LJ5e 1BKBA 1I5LA 2CYZB 2E6NA 2HQEA 2DEQA 3CBOA 3GF5A 2Y4YA 3CBPA 1VQOA 3MHXA 3VYGA 4RCBA 1QVGS 4A53A 1G3YA 2E5QA 4O6JA 5LJ3d 3CC4T 1N5ZA 1PRLC 3GNGA 4OB2B 3REBB 3CCLA 3JCMP 4HCZA 4PFPA 1B3QA 1Z9ZA 2C0OA 1HSQA 3LX7A 5A2QE 1YIJA 3DB3A 4M7AG 2VYTA 3QWXX 2G3RA 3NTKA 3URGA 2RHIA 4BY6C 3M59A 3QUIA 1VQ9T 5GAN2 4WF2A 3CMAQ 5FWCA 3CC4Q 2A7YA 5IH2A 3QZ9B 1AT1B 3HRUA 3CBMA 1OX8A 2A37A 5KCOA 2L3RA 1Q7YU 1WZOA 3QZ5B 1KG1A 2LJ3A 2EYXA 4CI0C 1N9SA 1MV3A 3EGDB 2OX7A 3HRSA 3OYHA 2XKOC 2CZ6B 3QXEB 2E3HA 3MEWA 1XQHA 2LT1A 5IAYA 5M9OA 2O88A 4PL6A 3G4ST 1BYMA 2LDMA 3L2RA 5KYWB 1RAHB 2K79A 3LH0A 4CC3A 2DLPA 1QWEA 4J9CA 3OSSC 2KMTA 2VGMA 1JEGA 5J39A 1WQWA 3SWNB 4MZTA 4XU2A 1VIFA 3U23A 4QKUA 1EFNA 1FX7A 2HKNA 3JB9H 1QKXA 4D8DA 1YWOA 3QSUA 4XK8E 1RAFB 1Q81C 1BU1A 1ABQA 4RKUE 1E7OA 2RQUA 3G71Q 4IUQA 2A0FB 1WX6A 2GBQA 1Q7YR 4JJBA 2QEXA 1V29B 4IIMA 4C0DC 1VQ7A 2GTOA 5GJVB 3CC7Q 4AT1B 1G3WA 4N4GA 5LJ5g 4LNPA 5GANe 2HQXA 4M78G 1VIEA 2V1QA 3INZA 3VJPA 5KH6A 1X6OA 1KSWA 2FPFA 2VXEA 1Y71A 4KUDK 5AT1B 1VQPT 3THKA 2QA4T 5FU6B 3FEOA 1SHFA 4FW1A 2FB7A 1WXTA 1SG5A 1FWZA 2LC4A 2RB6A 4JRIA 4EDUA 5GMKi 5CCAA 1D1BA 3VS4A 4Z88A 2ZPGB 1OI1A 1KQSS 2E12A 4E2FB 1MMNA 2YHTA 2BIVA 1UHFA 4HA8A 4C5GA 1HJDA 1OZ3A 1SKUB 2FZGB 4BI4A 3J81E 2GCXA 1HK9A 2DL4A 3BE3A 1AD5A 1K8AC 1W4SA 3G6ET 2IPOB 2M0OA 3OYYA 4BI8B 3OS0A 2DL5A 4C0GA 3OYBA 5HY6A 2FZKB 1PD0A 1VQKT 2RM4A 1LOJA 2O31A 2HKQB 3V8LA 1D1AA 2E6ZA 5GAMe 1BB9A 5DM7R 2K4YA 1VQMA 1V1CA 1ZBJA 2R58A 3QWYA 2QAZA 1JJ2A 3PIPA 2QTXA 2AHJB 2JMCA 1VQKQ 3A98A 1VQOT 4FT2A 4LUEA 3C12A 4PJOG 2KY9A 3CCLT 1JO8A 3L2WA 3UA6A 4C5EA 3DLLA 2QQSA 3RESA 1YIJT 2ABLA 2K6DA 4N4HA 5CKFA 5IHKA 1OU8A 3OYMA 1QWFA 2J6OA 4M75B 1VQOQ 4BDZA 4OB3B 1I0CA 1WI7A 4NS5A 1F1BB 4M75F 1YBYA 1FYNA 1WGSA 3V7CA 2FRWA 1Q82U 4R0KA 5I2SA 1K4US 1JXOA 5I2MA 4M77C 1KD1C 4ANJA 1K73U 1T0HA 2EAYA 2QK0A 3JCMe 1WJSA 1I8FA 2D0NA 1QCNA 2ECZA 2YRDA 2FRYA 1VOMA 4EPCA 1QVGA 5LJ5h 1EX4A 4J6WA 3H0HA 1RAAB 1B34A 4JLGA 3FC3A 1VQ5Q 2G6FX 2M0YA 4M75D 1H3ZA 4NL2A 1RL2A 1BI3A 1ABOA 2DE0X 2OI3A 1W6XA 4L6V5 2KXDA 3A5ZB 3NTIA 1ZBXA 3SHWA 4J83A 3CCEA 1M2VB 1ZUYA 4M77E 4J5YA 3H0IA 2KROA 2DBMA 4A4EA 4O5VA 4X9CA 4MDWA 1ZUUA 3KXTA 4FU6A 4B9XA 2XDPA 5GAMg 2KVQG 1VQ7T 1U5SA 1RADB 2O4XB 4E7SA 4J9EA 5GAMf 1K73R 3JCMW 1PD1A 2EKOA 2DJQA 2EJFA 2KT8A 3OY9A 4C8QC 2LCLA 1Q86U 1SSHA 3JB9F 3SD4A 3OSVA 1QQJA 2HCKA 2RJCA 3BY7A 3PMIA 2Y4XA 3EG0A 4L59A 1ZQ1A 4XQ3A 4BI3A 2YRCA 1RI9A 2QEXQ 3H41A 1GBRA 1VQ7Q 2RO0A 4DBQA 1ZSZC 5AYFA 5FLXE 4M7AB 1GXIE 3O8VA 1AVZC 1Q81R 2EJGA 4JJNK 1MMDA 3H8ZA 3F70A 1S1NA 2QG9B 2DXTA 5GAOl 3S3OA 1YJNA 1GCQC 1YCYA 2EGCA 1YCSB 3HFNA 1T3LA 3WVEB 2XU8A 2CP0A 4C8QE 3OS2A 5A0DA 1VQ6A 3REAB 4L5GA 2K3XA 5IHNA 2KK4A 2JM9A 4PLLA 3FIFA 4M4ZA 1SEMA 4C92G 4JLIA 5HK3A 5HCKA 2OAWA 2K9GA 5GANh 3R6OA 4C8QA 1UGRB 2JMAA 1FMWA 4J9FA 4A4GA 2PQWA 4B6MA 5GAOp 1D0ZA 4J9DA 2RNAA 1FMKA 4HCKA 3CCUT 1KQSA 1RAIB 5FU7B 1LJOA 5A0LA 1K8AR 3OYEA 1ZSZA 5GAOn 2AKKA 4F7UE 4MMLA 1VQMQ 3M54A 2KDSA 1V76A 2RQWA 2LX9A 1IGQA 1K9MC 1ZUKA 3E1SA 2DXUA 3CMEA 3UF4A 2AIRB 1O75A 1GCQA 2QDLA 1K76A 2H3EB 5KYYB 4V2SA 4F04B 4HT8A 2P0QA 2DX1A 4OB0B 4F7UA 4LD6A 4PJJA 2DTIA 1BI2A 5L8RE 2LT4A 3JCMX 3EFOB 2E70A 4BDYA 1IXDA 5C0MA 2QQRA 5GAMh 2MPXC 1GFDA 2NLUA 2RHYA 3M0PA 4KUIA 7AT1B 3HFOA 3G4SA 4A4HA 2FPEA 3ZFJA 2RJEA 1D0XA 2KNBB 2CP6A 2EIFA 3TREA 2YWWA 4GY5A 1M3BA 3RMSA 1QMCA 4ZN1A 3MJXA 2E65A 5DLQE 1K9AA 3VYHB 2DEUA 3QJ6A 3EGXA 2LX7A 1N8RU 3M0RA 3EFRA 1KD1R 3ULRB 4J9IA 2M1HA 1OPKA 2CDTA 2P0PA 3VS6A 2IIMA 2ENMA 1VQNA 1GFCA 5EG2A 1M1GA 4KGXB 4MZPA 2JTEA 2EYQA 1PSFA 2P84A 5HKCA 5GMKj 3BFMA 4IUVA 4JS4A 3PT9A 5GAOq 2HD0A 3CCSQ 3CCEQ 3I5RA 1UJYA 2MIOA 1X01A 2K3YA 1VQPA 3JCMh 3X24B 1KHIA 2CH4A 2HSPA 1OZ2A 3GPLA 4PJOB 2P0KA 1W2BP 3ZEHA 3OMGA 4J9GA 2YXYA 4Z89A 1YJ9T 1KIKA 1MV0B 2D6FA 5LJ5d 3QG1A 2X4JA 1QCOA 1I5OB 1X6GA 5KYUB 1YJNT 2LVMA 3M0TA 2C0TA 2EYZA 1Q95G 4JJCA 4HKEA 3WVDB 2XDDA 5J26A 4F16A 4PK4A 3TU4K 3RBBB 1UECA 3LLRA 4KH1B 2DIQA 3ZL7C 1NLPC 2FEIA 1VQ8A 4C0FA 1VUBA 3JB9G 3X26B 2NUPB 4IIOA 2RA2A 1NJIC 2HEQA 2CP2A 1MMAA 2XK0A 1YITA 1VQ6Q 3CCMQ 2GQVA 3OYDA 3VRZA 2NYSA 2M02A 1PSEA 1K9MU 2CP7A 2B86A 3L2UA 3PE0A 3UPUA 4OP0A 4F17A 4J9BA 1WQ7A 5CKHA 3GP8A 4Y92A 3C95A 2YLCA 1YN8A 4JUVA 3OW2P 2ZPEB 3M53A 4M7DC 2GFUA 2DBKA 3A1PA 5IN1A 3E9GA 4XTVA 3EFSA 3CMET 1W70A 2L3PA 3RNJA 2GNCA 2A28A 1BIAA 2J6KA 2H3JA 1BI0A 2HSEB 2KQWA 3RIRA 3META 2O9VA 1M90U 1VQ9Q 1TS9A 2PNIA 2NUTB 4JS5A 2BE7D 1JXMA 2KI7A 2ZGWA 4RTTA 3ZBDA 3ME9A 2LTOA 2QQBA 3MP6A 2IVWA 3JSCA 1YWPA 1D3BA 1OPLA 2BZ8A 1TG0A 4M7DE 1K9MR 2CZ7B 5GANd 2ED1A 1I07A 5LJ3e 2VGNA 2O9SA 2V8KA 1QVFP 2JUFA 1NE8A 2COYA 3PMTA 4ZTFA 1N27A 2F2WA 2RD1A 1UGQB 3G4SQ 5KYXA 1Y0MA 4JDSA 2DERA 2RK1A 3EG2A 3HRTA 4EMHA 4M7DA 4JZ3A 3AHUA 3M0UA 1SPKA 2EQKA 3FDRA 2I0NA 1VQNT 1M90R 4C92B 1K0SA 3GNFB 4XU1A 3CCQA 1WLPB 2JNGA 3CXCP 3X28B 4J6XA 4OMLA 4Y91A 3CPWP 4C92F 2EW3A 2VKNA 4DA4A 2RI2A 3SB2A 4QQDA 2KR3A 5CKBA 4QVZA 2CSQA 4EMKC 1M1KC 4XU0A 1KC8C 3QHSA 3PNWC 1TTHB 3EHRA 3P8BB 3M55A 2CZ0B 1AZGB 4XAXB 4FIBA 1VYVA 2VWFA 4RTXA 2GF7A 3JCMc 2DZCA 1YJWA 3VU3C 2JS0A 3I5SA 1G3TA 2V26A 2DKGA 2CS7A 2XD0A 2JTFA 4C92D 1IHWA 2F2VA 1VQPQ 1U8RA 4OGCA 2KT1A 2QA4Q 3X25B 2CP5A 3AT1B 3QO3A 2JVVA 2X3XD 4Z8AA 3EG9B 1TH7A 3OB9A 2LQNA 3JCMV 1KJWA 3MEVA 1X27A 1IGUA 4LXCA 1NJIU 3OYFA 4K11A 1WXUA 4JZ4A 2D8JA 4P5NA 2QQ9A 1VQ8T 4LDYA 3HKSA 2PZ1A 3G6EQ 5KYNA 3ER0A 4ELZC 2L5QA 3MP8A 4MMKA 4C8QF 1YITT 5LJ3g 4HCBA 3OS1A 1MGQA 4EMKA 3CCUA 2LNHB 1PRMC 3S6WA 4IUPA 1SF9A 5LJ3f 2MK5A 3T9NA 3RERA 2KEAA 3JCMd 4RTUA 2K2MA 4Y28E 5LJ5j 3L1AA 2A3LA 4FW2A 1WNLA 2K5IA 3CCRT 2RQTA 3M0SA 4QW2A 1ARKA 4BUGA 2P4TA 3KFVA 1JBMA 5CKEA 3V8KA 4C8QD 1GCPA 1TU0B 1GRIA 3J80E 3TSZA 4BE2A 1YHQA 1KQ2A 3CCLQ 1FXXA 3JAME 4KULA 4HXJA 1PKSA 5CQYA 1YIJQ 1NJIR 1NZ9A 2R57A 2LJ1A 3SWNC 4J9HA 3QKJA 1I81A 3QBYA 2KAFA 2RQVA 2O01E 3OMCA 2AT1B 1UGSB 2KE9A 4XTWA 2EWNA 2DYIA 3R6NA 1ZSGA 5CR2A 2EQIA 2JOYA 2M16A 1M27C 2SEMA 1WFWA 3M9QA 3TCJA 3EAEA 1Y96B 4E7LA 1SRMA 3OYKA 2ESWA 1HYOA 2EVRA 3A8MB 4KGZB 3M56A 4PJMA 2PVDB 2X51A 1JU5C 1M8VA 3PVLA 2RH2A 2XDBA 1H92A 3UATA 2QGGA 2QDYB 3L2ZA 4QQGA 1PNJA 1AWWA 1Q81U 3VUZA 3EGDA 8AT1B 2SRCA 2HBWA 3RR6A 4WTOB 2KRNA 5FU6C 1PC0A 1R0CB 3MEAA 2J6FA 2HDAA 5KE2A 5FROA 5GMKl 5KYWA 4RG2A 2GGRA 1GL5A 2NWMA 2KSSA 2FG0A 2A08A 3JB9I 3LWIA 2D0QB 2OJ2A 2COZA 1C6VX 3PVQA 1N9RA 2JZ2A 4YTLA 3SWNA 2LCCA 4J7FA 2YUNA 5L23A 1G5VA 1E6GA 3CCQT 2CUBA 1MNEA 4M77A 3V8JA 4C0ZA 1R8OB 4Z02A 2K57A 2DL7A 2QTVA 1YJ9A 3M0QA 2DD5A 2J05A 5I21A 5GANj 1B07A 1DJ7B 3JCMJ 2JW4A 1YJWT 1K8AU 5LJ3h 2CT3A 9ATCB 1X43A 1TUGB 5GAN6 2FPDA 3JB9D 4ME7A 3PGGA 5GAN3 1SSFA 1WPYA 1VA7A 2MI6A 2RPNA 2EQMA 2RJFA 3OYNA 2VC8A 3CC2A 4XTYA 4E7ZA 1BCMA 1N6AA 5J3BA 2WSFE 3RMQA 4N0AC 4DBFA 1G8XA 2LMJA 5FWBA 5FW9A 1M1KR 2OTLA 2XIDA 3CEYA 1VQ5A 4M75C 1BCOA 2MOXA 3MPUB 3TQ7P 1D09B 4FYXB 2DETA 2OTJA 1VQ4T 2HQHA 2E41A 4XTXA 2HNIA 2L2PA 2DM1A 1EZZB 3FLGA 3FB9A 2VASA 1D0YA 3NMZC 2MYSA 5GAMj 2RI3A 2ZPFB 1G83A 4KGVB 3I56T 4BE0A 4X9DA 2DAQA 2CZ1B 1A0NB 4HT9A 1I1JA 1W1FA 4B9WA 3CMAA 1M9SA 4JRKA 3L2VA 3I9QA 1XTDA 4M75E 4R55A 2HBPA 3CCUQ 1KD1U 4FM4B 3JRZA 1TOVA 2XG8D 1YHQT 3O5ZA 4OMMA 3S3NA 3S3MA 2Z0WA 3HP9A 1AWOA 2ZPHB 1VQLT 1JJ2P 1RUWA 2ZCFB 4N0AA 5CK9A 2MAMA 4HVVA 1X2QA 5CIUA 1M5Q1 1NEBA 5GJWB 2GTJA 1KQ1A 2K7AA 4M75A 1YHQQ 4C8QG 5FRMA 3M58A 5GAN8 2ED0A 2B8AA 1TWBA 1OYXA 2EQUA 3Q1JA 4NL3A 2JS2A 4QVCA 1C0MA 2NUZA 2CT4A 2M9UA 1XOVA 1Q7YC 3SEMA 3QIIA 1AHJB 5CVIA 1WJQA 2EGAA 4BY6B 3C4SA 4PKCC 5IXFA 5GMKm 1H641 2DF6A 3GBQA 4DBHA 1U06A 2X4YA 4RTYA 3G71A 3CCJT 1IB8A 2K5FA 4M7AC 4ZTJA 2COWA 3HPWA 4ZNXA 4RCCA 2VXFA 4A54A 3CD6T 4F7UG 3CCVA 3HTRA 1YI2A 2KRMA 5GAN5 1M2OA 1PM3A 1QVGP 1M30A 2GFAA 3LGFA 4XTZA 3QDRB 4GBQA 1E6HA 2ZPBB 4HVWA 3OYIA 1IREB 2VB6A 2DXCA 2GQIA 3EG3A 1NM7A 5GAOr 2L3QA 2V8IA 2AKLA 3X20B 1B7TA 1UUEA 1IO6A 4ATOA 2ZZDA 3LH5A 3MEUA 2DZ9A 3E9FA 4M7AE 1OEBA 1LNXA 2YUQA 1OQKA 3KUFA 3V7RA 1H8KA 1YP5A 2L0AA 4ZGJB 1BBZA 1MHNA 3EH1A 3LYIA 1YJ9Q 4MDXA 2ZPIB 2DNUA 5FU7C 3CC2T 4LE9A 5GAN7 1T0JA 2DK3A 4C0DB 4M7AA 2RQRA 2LJ0A 2W0ZA 2R5MA 1WJRA 4AG2C 2OTLT 1YJNQ 2CUDA 1VYTA 2DL3A 1G3SA 1VQ5T 3MKDA 4PFOA 1QP2A 1YFNA 2OTJT 3J7AF 3CC2Q 1WHGA 5D7UA 3OBYA 4QQ6A 3NTHA 1UDLA 2FHDA 5I11A 3BDUA 4VUBA 2ROLA 2PVOB 2BUDA 3DKMA 2YDLA 5LL6S 3OYCA 3MCAB 1JB0E 3I35A 1AZEA 1KK7A 2LRQA 4M78C 4LUDA 2BZXA 1NG2A 2F5KA 2BZYA 2QYZA 3CCRA 1ACMB 2OTJQ 2KXCA 1R0BG 5CAIA 2J7IA 5GAN4 2DXBA 3CMAT 1TUCA 5A0GA 4KBMB 3CPFA 4FT4A 1X75C 1PKTA 4XU3A 4WCIA 4F14A 1Y07A 3QJYA 2YUOA 3D7SB 3VRYA 1QLYA 4E7IA 1W2BS 4ZN3A 3L42A 4FCYA 4RTZA 3VKIA 4M78E 4DOVA 2X4XA 4LDXA 3CMEQ 2L8DA 1B34B 4E7KA 3OYAA 1KQSP 2YT6A 1TUDA 3QPHA 4A4FA 3DLMA 4LN2A 2AZVA 2FYKA 5KYYA 1RACB 2CGHA 2FZCB 4FYVB 4JPBW 3TVTA 3FJPA 1SHGA 2V8JA 2KRSA 1UE9A 2DPPB 2XI9A 4M78A 2M51A 4OMQA 3EFOA 1WIEA 4AFUC 1RI0A 4HVUA 1Q82C 1PCXA 4CRIA 2YLBA 3HHTB 4PJOC 3UWNA 2F1LA 2K3BA 1K73C 1FMVA 2RN8A 4OF1A 4CC2A 4BE1A 4DOWA 3G71T 1NPPA 4JRQA 2AZSA 2DL8A 2DRKA 4KT0E 1U3OA 2QI2A 3E2UA 2A36A 5D6YA 4II1A 3CCVT 1YI2T 4NOYA 3CC7T 4M77B 1UGPB 1D1CA 1WYXA 4J8OA 2EFIA 4RUGA 4M77F 2PUOB 2EYYA 3MO8A 1CKAA 1LVKA 1WXBA 2YSQA 1UEBA 4IUUA 3PIOA 3CCVQ 1YI2Q 3RKWA 2JM8A 1Y57A 2DVEA 4J6YA 4PJLA 2BTTA 3OW2S 1VQNQ 4PJOE 3H0FA 1UB4A 5GAMd 2DTOA 1T3SA 1OULA 4R56A 1ZHIA 5LJ5f 1ZLMA 4OVAA 3QYGB 2DMOA 1JRIA 2LQKA 4OGEA 1RLPC 2XICA 4M77D 2FO0A 3OS5A 4Q5WA 1UHCA 2X3WD 1OV3A 5IT9E 4M7DG 4E7JA 1Q86C 4PJOA 4QT7A 1I4K1 1UFFA 3VS7A 1QKWA 5C6SA 1O9SA 1G2BA 3ASKA 1S72A 4BACA 1EIFA 3TEEA 3OYGA 4OMFB 1M4ZA 4IKFA 1XNIA 1PG5B 1MNDA 3FRNA 1VQ4A 5CQXA 4C8QB 3WXMB 4LDVA 2QGFB 4PJNA 4PLIA 5KYUA 2MF2A 4OMOA 1U1SA 4LD9K 1QVFS 2MMPA 3NHNA 1NPRA 2FVUA 1WA7A 1OX9A 1NEGA 3OQ5A 1ZSZB 3LW5E 5CKDA 4RTVA 4FYYB 3I56A 3NPFA 5ECAA 1VQ8Q 1ZA1B 4C5HA 2YRVA 4ORZA 2AK5A 2F5TX 1X69A 4JRPA 3VUBA 2NUPA 1YITQ 4MZMA 1VYUA 3VS5A 1Y7XA 2JT4A 4KH0B 2YUPA 4XTUA 1GBQA 1XJWB 3CXCS 3CPWS 1HD3A 4F7UB 1NYGA 1C1AA 1VQLA 3CCRQ 3E19A 4PNOA 4E6RA 4F7UF 3EG1A 3NFCA 2PUKB 4DQ2A 1KHCA 5KCHA 1X2KA 3N5BB 4D6WA 3OYLA 2E64A 4C5IA 5CO7A 5GANg 2C06A 4C92C 4TVRA 4E7HA 2F69A 4EIKA 1WHLA 5GANf 1JQQA 3H6ZA 3EGXB 2XMFA 1UTIA 2NUTA 1QCFA 4OMPA 5D6XA 3M4YA 1M1FA 2KYBA 1M8MA 3JV3A 4N4IA 3LWHA 2RJDA 2DVJA 2K2VA 3GIBA 2ZAEA 3CCJA 5LJ3j 1IHVA 1K1ZA 1BIBA 2RF0A 2ROTA 3EGUA 4FYWB 3CD6A 1UG1A 3UA7A 8ATCB 4X1VA 2H8HA 1W2BA 2DD4A 1NBEB 4BB7A 1LCKA 1M1KU 1KC8U 2DFUA 4C92E 1X6BA 4LDWA 3CCSA 5GMKe 2EPDA 3H9NA 1QP3A 4ELYC 2EJ9A 1ZX6A 5IXBA 1PHTA 2OAUA 3I55A 1AEYA 1QVPA 4BD3A 2XHCA 3QYHB 2JN0A 2QEXT 2MCNA 3RKXA 1Q82R 1N8RC 4A4KA 5HK0A 2KGTA 2PU9B 3RDVA 3P8DA 1AWJA 1AWXA 3BW1A 3PFSA 4C92A 3GOXA 3CCQQ 3KBGA 2KYMA 1OOTA 4IURA 4DEXA 4CC7A 1IRXA 3TSWA 3GLXA 2KBTA 3A8LB 4X34A 2JJ9A 3UDCA 4ZGDB 2X9HA 3G7ZA 2L89A 3A8GB 1YJWQ 4M7AF 4AMCA 3PTAA 1S72T 2L3SA 1KC8R 5IHIA 4FSXA 4RMOA 2EGEA 1M3CA 1MMGA 1RAEB 4M77G 5FRNA 3C0CA 2C0IA 4LDUA 3CCMA 2I2LA 3EG9A 1QW1A 4RTWA 3OW2A 1WHKA 3P8HA 2DILA 1S72Q 4JJDA 3JCMg 4AFZC 2JXBA 4M7AD 1WHHA 2RHZA 4E47A 3JCMf 4UC4A 1Q86R 1VQ4Q 5I22A 1VQMT 2RK2A 2QXFA 2K5LA 4KRTA 4ZGEB 3JCMb 4A63B 2E1HA 6AT1B 4IUTA 2E10A 3CC4A 2EQJA 4AFQC 2LNVA 4AG1C 2WACA 2E5KA 2DTHA 3I56Q 4OB1B 1P92A 1RAGB 2E3IA 1MUZA 1VQ9A 2PVGB 1RLQC 3OA6A 2BKDN 4GLKA 2EYWA 2LZ6B 3G1JA 3LGLA 4GLMA 3VS3A 1BK2A 3CQTA 2LCSA 2P4RA 3L2QA 2IG0A 2QQAA 1QVFA 2HMAA 2W10A 1WHJA 1D3BB 1U1TA 2MWPA 5DY9A 2QASA 3MP1A 3NGPA 1VQLQ 2DO3A 2DA9A 4M78B 3EH2A 2D8HA 1HXDA 2CREA 2J06A 1ZA2B 3BDLA 2VUBA 1LPLA 2BE9B 4M78F 4ESRA 1OU9A 2ATCB 1CSKA 4FSSA 5KYXB 2JTMA 1Z9QA 2CH4W 4EMGA 1M90C 2V1RA 1KFZA 4M7DB 3CXCA 1IZ6A 1WHMA 1Y96A 3CPWA 3M57A 2CP3A 2F2XA 3HL8A 4CC4B 1NYFA 3RKYA 3QDFA 4DBRA 4M7DF 2DJZA 1CKBA 2CKKA 3JB9J 3CC7A 1RABB 4M78D 5KE3A 3VS2A 2EKHA 3CCST 3CCET 2O2OA 4M75G 2MWOA 3CCJQ 4HCCA 2DIGA 1M2VA 3IQLA 2DRMA 3CD6Q 1NLOC 2R5AA 2VVKA 3I55T 4PFZA 4M7DD 3M4GA 4OMNA 2X35A 5D6WA 2O4XA 2CSIA 1R77A 3C94A 3DB4A 2WSEE 2E4HA 1M3AA 1TSFA 1UJ0A 2QA4A 3I55Q 2RHUA 2RMOA 2X4WA 2RI5A 3A8HB 1JJ2S 3A8OB 3VS0A 2WSCE 1AOJA 4J7IA 1K0XA 4PJOF 3UT1A 4D8KA 3M5AA 1YNZA 2LP5A 5GAOm 3SDZA 3OBWA 3OYJA 4QVDA 5DLOA 2HL3A 3HSBA 1TXQA 4RG8A 1J3TA 2HZYA 3V7SA 1WDXA 1N8RR 2FL7A 1H3HA 2LQ8A 3G6EA 2RHXA 3EHQA 5GMKh 4DEYA 1BI1A 3SFMA 2HAXA 3RUXA 2HL5C 2Y90A 2VV5A 1SRLA 3VV0A 3VS1A 4EMKB 1VQ6T 4PJOD 3CCMT 1VQKA 2EBPA 1UGVA 4FL6A 5EC7A 2D1XA 2DYBA 4AFSC 2OTLQ 2LQWA 3FJ5A 3JCMQ 1PWTA 2PTKA 2D9TA
chains in the Genus database with same CATH topology
5L8RE 1BKBA 3OS5A 4Q5WA 5LJ5e 2CYZB 1I5LA 2LT4A 2E6NA 2HQEA 2DEQA 3JCMX 2KSSA 3CBOA 2E70A 5IT9E 3GF5A 4BDYA 4E7JA 4M7DG 1Q86C 4PJOA 2Y4YA 5C0MA 3CBPA 1VQOA 1I4K1 3JB9I 2QQRA 3MHXA 2D0QB 3LWIA 3VYGA 5C6SA 5GAMh 4RCBA 1N9RA 2JZ2A 4YTLA 2NLUA 2RHYA 1O9SA 3SWNA 1G3YA 3ASKA 2LCCA 2E5QA 4J7FA 4KUIA 4O6JA 3GNGA 3HFOA 4OB2B 5LJ3d 4A53A 1EIFA 4A4HA 3G4SA 3CCQT 3TEEA 4HCZA 3OYGA 4BACA 3JCMP 4OMFB 3LX7A 4M77A 3V8JA 5A2QE 1YIJA 3ZFJA 4C0ZA 3DB3A 1M4ZA 2RJEA 1XNIA 2VYTA 1R8OB 4IKFA 4M7AG 2G3RA 4Z02A 2K57A 3FRNA 3NTKA 1VQ4A 3URGA 2EIFA 3TREA 2RHIA 5CQXA 4BY6C 3WXMB 4C8QB 4GY5A 3M59A 3QUIA 4LDVA 3RMSA 1VQ9T 4PLIA 5GAN2 4WF2A 1YJ9A 2DD5A 4ZN1A 2MF2A 1U1SA 2E65A 4LD9K 5I21A 5DLQE 2MMPA 5GANj 1QVFS 3VYHB 1DJ7B 1NPRA 2A7YA 2FVUA 3QJ6A 3JCMJ 3QZ9B 3OQ5A 1YJWT 1K8AU 3HRUA 3CBMA 5LJ3h 1N8RU 3LW5E 5CKDA 5KCOA 2L3RA 1Q7YU 5GAN6 3EFRA 3QZ5B 3I56A 1KG1A 3JB9D 2M1HA 4ME7A 3PGGA 2P0PA 5GAN3 4C5HA 1SSFA 4CI0C 1N9SA 2YRVA 1WPYA 3HRSA 3OYHA 2MI6A 2XKOC 2F5TX 2EQMA 2CZ6B 2RJFA 3VUBA 2VC8A 5EG2A 3OYNA 4JRPA 4XTYA 3CC2A 1VQNA 3QXEB 1N6AA 1M1GA 3MEWA 4MZMA 1XQHA 2LT1A 5J3BA 5IAYA 4MZPA 1Y7XA 2WSFE 2EYQA 1PSFA 5HKCA 5GMKj 5M9OA 3RMQA 3BFMA 4IUVA 4N0AC 4XTUA 4JS4A 3PT9A 5GAOq 2HD0A 3CXCS 4PL6A 3G4ST 1BYMA 2LDMA 3L2RA 3CPWS 4F7UB 2OTLA 1X01A 2XIDA 2K3YA 1VQPA 3CEYA 3JCMh 4M75C 1VQ5A 3X24B 1KHIA 3LH0A 1VQLA 3CCLA 1OZ2A 3E19A 4PNOA 3GPLA 2OTJA 4F7UF 1VQ4T 4PJOB 2P0KA 3NFCA 2E41A 3OSSC 3ZEHA 2KMTA 3OMGA 2PUKB 2VGMA 4XTXA 2HNIA 5J39A 1WQWA 1YJ9T 4DQ2A 1KHCA 3SWNB 4MZTA 4XU2A 5KCHA 1VIFA 3N5BB 4D6WA 1FX7A 3FLGA 3PIOA 2D6FA 5LJ5d 3FB9A 3JB9H 3QG1A 3QSUA 3OYLA 2E64A 4C5IA 2X4JA 4XK8E 5GAMj 2RI3A 2ZPFB 1Q81C 5CO7A 5GANg 4RKUE 2C06A 3I56T 4C92C 4BE0A 4TVRA 4E7HA 4IUQA 1YJNT 4X9DA 2F69A 2DAQA 2LVMA 2QEXA 2CZ1B 5GANf 1V29B 4HT9A 4C0DC 1VQ7A 3H6ZA 4B9WA 3CMAA 1M9SA 4JRKA 4LD6A 1G3WA 4N4GA 5LJ5g 3L2VA 4HKEA 1XTDA 4M75E 5D6XA 3WVDB 4R55A 5GANe 2HBPA 2HQXA 3M4YA 4M78G 1KD1U 2XDDA 5J26A 1M1FA 3JRZA 2XG8D 4FM4B 1VIEA 3TU4K 1YHQT 3LLRA 3INZA 4N4IA 3VJPA 3LWHA 5KH6A 1X6OA 2RJDA 3S3NA 2DIQA 2K2VA 3S3MA 3GIBA 2VXEA 1Y71A 3HP9A 1VQ8A 4C0FA 3CCJA 4KUDK 1VUBA 1VQPT 5LJ3j 2QA4T 1BIBA 3JB9G 2ZPHB 5FU6B 3X26B 1VQLT 3FEOA 2ZCFB 3CD6A 4N0AA 2FB7A 2RA2A 5CK9A 1NJIC 1FWZA 2MAMA 2XK0A 1YITA 5CIUA 1W2BA 1M5Q1 2LC4A 2DD4A 2RB6A 4JRIA 4EDUA 4BB7A 5GMKi 5CCAA 2GQVA 3OYDA 1M1KU 1KQ1A 1KC8U 4M75A 4C92E 4C8QG 3CCSA 4LDWA 1PSEA 2ZPGB 1OI1A 5GMKe 1KQSS 2E12A 5FRMA 3M58A 1K9MU 2YHTA 1QP3A 5GAN8 3L2UA 2BIVA 4ELYC 2B8AA 2EJ9A 4HA8A 1OYXA 4OP0A 4C5GA 3UPUA 1OZ3A 2EQUA 3Q1JA 4BI4A 2OAUA 3J81E 2GCXA 3I55A 4NL3A 3GP8A 1WQ7A 5CKHA 4QVCA 1HK9A 1QVPA 3C95A 4BD3A 2XHCA 3QYHB 2YLCA 2JN0A 2QEXT 4JUVA 1K8AC 2M9UA 1XOVA 1W4SA 3RKXA 3G6ET 2M0OA 4A4KA 3OYYA 1N8RC 2HAXA 5HK0A 4BI8B 2ZPEB 3OS0A 1Q7YC 3M53A 3QIIA 4M7DC 2GFUA 5IN1A 4C0GA 1AHJB 5CVIA 3OYBA 3E9GA 1WJQA 2PU9B 4XTVA 3EFSA 5HY6A 3P8DA 3C4SA 4PKCC 4BY6B 3CMET 3BW1A 5GMKm 3PFSA 1H641 4C92A 3GOXA 1VQKT 1BIAA 2RM4A 3KBGA 2H3JA 1BI0A 1LOJA 3V8LA 2KQWA 2X4YA 2E6ZA 4IURA 3META 3RIRA 5GAMe 3G71A 5DM7R 3CCJT 2K5FA 4M7AC 2K4YA 4ZTJA 3HPWA 1VQMA 1M90U 2R58A 3GLXA 4RCCA 2VXFA 3A8LB 4A54A 3CD6T 4X34A 4F7UG 3CCVA 1YI2A 1JJ2A 3UDCA 4JS5A 5GAN5 3PIPA 4ZGDB 3G7ZA 2QTXA 2AHJB 2L89A 2ZGWA 3A8GB 2GFAA 3LGFA 3ZBDA 4FT2A 4XTZA 1VQOT 3QDRB 3C12A 3ME9A 4PJOG 2ZPBB 2KY9A 2LTOA 2QQBA 3MP6A 2IVWA 3JSCA 4M7AF 3OYIA 3CCLT 3PTAA 1S72T 1IREB 3L2WA 2DXCA 4C5EA 5GAOr 3DLLA 2V8IA 2QQSA 1D3BA 3RESA 4FSXA 1YIJT 4RMOA 4M7DE 3X20B 2CZ7B 5GANd 4N4HA 5CKFA 4ATOA 4M77G 5LJ3e 2ZZDA 2VGNA 3OYMA 1G5VA 2V8KA 5FRNA 4M75B 2JUFA 1NE8A 4LDUA 2I2LA 3CCMA 1QW1A 4BDZA 3PMTA 3P8HA 3OW2A 4ZTFA 3MEUA 4OB3B 2DZ9A 1N27A 2RD1A 3E9FA 1UGQB 4M7AE 3JCMg 4NS5A 5GMKl 4M75F 1LNXA 4JDSA 3KUFA 2RK1A 1YBYA 3V7RA 4M7AD 2RHZA 4E47A 3HRTA 4EMHA 3JCMf 1WGSA 3V7CA 4UC4A 4M7DA 1Q82U 3AHUA 4ZGJB 5I2SA 5I2MA 1VQMT 1MHNA 4M77C 2RK2A 2EQKA 2QXFA 1KD1C 2K5LA 3FDRA 3LYIA 1K73U 4MDXA 4ZGEB 2EAYA 3JCMb 2E1HA 3JCMe 1VQNT 1WJSA 2ZPIB 1I8FA 5FU7C 4C92B 3CC2T 5GAN7 4IUTA 2E10A 3CC4A 2EQJA 2DK3A 3GNFB 4XU1A 4C0DB 3CCQA 2JNGA 4M7AA 2LNVA 4EPCA 3X28B 1QVGA 5LJ5h 4J6XA 4J6WA 4Y91A 2WACA 4C92F 1B34A 2DTHA 4JLGA 3FC3A 4M75D 4DA4A 2RI2A 2R5MA 3SB2A 4QQDA 5CKBA 1WJRA 2OTLT 4OB1B 4QVZA 4NL2A 1H3ZA 4EMKC 1P92A 1G3SA 1VQ5T 1VQ9A 2PVGB 1RL2A 4XU0A 1KC8C 1BI3A 3PNWC 3QHSA 1M1KC 1QP2A 2OTJT 3J7AF 3OA6A 3P8BB 4L6V5 3M55A 2BKDN 2CZ0B 4GLKA 4XAXB 3OBYA 3NTHA 4FIBA 3A5ZB 3LGLA 4QQ6A 3NTIA 1ZBXA 2FHDA 3BDUA 4VUBA 2GF7A 2PVOB 2BUDA 3DKMA 3JCMc 2DZCA 5LL6S 2IG0A 3MCAB 2QQAA 3OYCA 3VU3C 1JB0E 3L2QA 1YJWA 1QVFA 4J83A 3CCEA 1D3BB 2LRQA 4M78C 1G3TA 1U1TA 4M77E 2MWPA 4J5YA 2DKGA 5DY9A 2CS7A 2XD0A 3MP1A 2JTFA 4A4EA 4C92D 4O5VA 1U8RA 4OGCA 4X9CA 2F5KA 4MDWA 2DO3A 3X25B 3CCRA 4M78B 3QO3A 2JVVA 3KXTA 5CAIA 1HXDA 1TH7A 4FU6A 3OB9A 4B9XA 2XDPA 5GAMg 5GAN4 2KVQG 1VQ7T 3BDLA 2O4XB 2VUBA 2DXBA 4M78F 3JCMV 3CMAT 5A0GA 5GAMf 3JCMW 3MEVA 4KBMB 2JTMA 3CPFA 1X75C 4FT4A 2EKOA 4EMGA 1NJIU 1M90C 2EJFA 3OYFA 3OY9A 4C8QC 4XU3A 2LCLA 1Q86U 4M7DB 3CXCA 1IZ6A 3JB9F 3SD4A 1Y96A 3OSVA 2RJCA 3BY7A 3M57A 3PMIA 2Y4XA 2QQ9A 4P5NA 3CPWA 3HL8A 4L59A 1ZQ1A 1Y07A 4XQ3A 4LDYA 4BI3A 3QJYA 3RKYA 1VQ8T 3HKSA 4M7DF 2DJZA 2RO0A 4E7IA 1W2BS 4ZN3A 3ER0A 3L42A 2L5QA 4ELZC 3MP8A 3VKIA 4M78E 5AYFA 4MMKA 4DOVA 5FLXE 2CKKA 2X4XA 3JB9J 4C8QF 1YITT 4M7AB 3CC7A 4LDXA 1GXIE 5LJ3g 2L8DA 4M78D 3O8VA 4HCBA 1B34B 2EJGA 5KE3A 4JJNK 3OS1A 1MGQA 4E7KA 3OYAA 4EMKA 3CCUA 3S6WA 4IUPA 3T9NA 3QPHA 5LJ3f 3CCST 3CCET 3RERA 4A4FA 3H8ZA 3F70A 3JCMd 2DXTA 4M75G 3DLMA 2MWOA 5GAOl 3S3OA 1YJNA 4Y28E 5LJ5j 1YCYA 2A3LA 1WNLA 2DIGA 2CGHA 2FYKA 3L1AA 4HCCA 2K5IA 3HFNA 3CC4T 3CCRT 2R5AA 3FJPA 3I55T 2V8JA 4M7DD 3M4GA 4QW2A 3WVEB 2XU8A 4BUGA 4C8QE 2DPPB 2XI9A 4M78A 3OS2A 5A0DA 1VQ6A 4M77D 4L5GA 2P4TA 5CKEA 1JBMA 2K3XA 3V8KA 4C8QD 2X35A 1RI0A 2KK4A 1Q82C 5D6WA 3J80E 4CRIA 4BE2A 2YLBA 2O4XA 4PLLA 1YHQA 1KQ2A 3C94A 3HHTB 1FXXA 3DB4A 4PJOC 2WSEE 3JAME 4KULA 3UWNA 3FIFA 5CQYA 1K73C 4C92G 4OF1A 1NZ9A 4JLIA 2R57A 3SWNC 2QA4A 4BE1A 3QKJA 2RHUA 4DOWA 5HK3A 1I81A 3G71T 2X4WA 2RI5A 1NPPA 3QBYA 4JRQA 2KAFA 3A8HB 4KT0E 5GANh 3A8OB 2QI2A 1JJ2S 2O01E 2WSCE 3OMCA 1UGSB 4J7IA 4XTWA 2EWNA 3R6OA 4C8QA 5D6YA 4II1A 3CCVT 1YI2T 4PJOF 1UGRB 3UT1A 3M5AA 4NOYA 5CR2A 2JOYA 2M16A 2PQWA 4A4GA 3SDZA 5GAOp 5GAOm 3CC7T 3M9QA 3OBWA 4M77B 3TCJA 3OYJA 4QVDA 3EAEA 5DLOA 1S72A 1UGPB 1QVGS 3HSBA 1Y96B 4E7LA 3CCUT 4J8OA 2EFIA 3OYKA 1KQSA 5FU7B 1LJOA 4RG8A 3V7SA 5A0LA 3A8MB 3M56A 2PUOB 2PVDB 3MO8A 4M77F 5GAOn 3OYEA 4F7UE 1M8VA 4MMLA 2FL7A 2LQ8A 3M54A 2KDSA 1UEBA 2RH2A 2RHXA 3G6EA 2XDBA 4IUUA 2QDYB 3L2ZA 1BI1A 4QQGA 3RKWA 3SFMA 5GMKh 3RUXA 2Y90A 2DVEA 2LX9A 4J6YA 2VV5A 3OW2S 1Q81U 3VUZA 1K9MC 4PJOE 3VV0A 3E1SA 1UB4A 5GAMd 4EMKB 2DTOA 2DXUA 1VQ6T 3CMEA 4PJOD 3CCMT 1VQKA 1O75A 4R56A 1ZHIA 5LJ5f 5FU6C 4OVAA 3QYGB 4V2SA 4FL6A 1JRIA 2LQKA 3MEAA 4OGEA 5KE2A 4HT8A 2P0QA 2XICA 4OB0B 5FROA 3JCMQ 4F7UA 2D9TA 2DTIA 1BI2A 4RG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN d;  4X9D A;  3RKY A;  5LJ5 e;  4M77 G;  1I5L A;  5LJ3 e;  4M7D F;  5GAN f;  2DJZ A;  4HT9 A;  2DEQ A;  3JCM X;  4M7D G;  4PJO A;  4JRK A;  4M78 E;  4MMK A;  4M75 B;  3JB9 J;  2I2L A;  4C8Q F;  1I4K 1;  3JB9 I;  4M7A B;  5LJ5 g;  5LJ3 g;  5GAM h;  4M78 D;  4RCB A;  1N9R A;  1B34 B;  2DZ9 A;  2EJG A;  4M75 E;  2RD1 A;  1MGQ A;  3SWN A;  4A53 A;  5GAN e;  5LJ3 d;  4M78 G;  4EMK A;  4M7A E;  3HFO A;  3JCM g;  4M75 F;  1LNX A;  3JCM P;  5LJ3 f;  3RER A;  3INZ A;  3V7R A;  3JCM d;  4M7A D;  4M77 A;  2DXT A;  4M75 G;  3V8J A;  3GIB A;  4EMH A;  2VXE A;  3JCM f;  5GAO l;  4M7A G;  5GAO p;  5LJ5 j;  1YCY A;  2FYK A;  1WNL A;  3L1A A;  2CGH A;  3V7C A;  5LJ3 j;  2K57 A;  3AHU A;  4M7D A;  3JB9 G;  1BIB A;  3HFN A;  4C8Q B;  3FJP A;  4M77 C;  4N0A A;  2FB7 A;  3QUI A;  2RA2 A;  5GAN 2;  4M7D D;  3M4G A;  4WF2 A;  2EAY A;  3JCM b;  1U1S A;  4C8Q E;  2E1H A;  2E65 A;  4M78 A;  3JCM e;  1M5Q 1;  5I21 A;  2RB6 A;  4JRI A;  1I8F A;  4C92 B;  5GAN j;  5GMK i;  1JBM A;  5GAN 7;  3V8K A;  2E10 A;  4C8Q D;  3JCM J;  1KQ1 A;  4XU1 A;  4M75 A;  4C92 E;  2YLB A;  4C8Q G;  1KQ2 A;  4M7A A;  5GMK e;  5LJ5 h;  4J6X A;  4J6W A;  5LJ3 h;  4Y91 A;  2YHT A;  4C92 F;  5GAN 8;  4PJO C;  1B34 A;  2DTH A;  4M75 D;  3FIF A;  5GAN 6;  3EFR A;  2EJ9 A;  4HA8 A;  4OP0 A;  3SB2 A;  4C92 G;  4JLI A;  3SWN C;  4NL2 A;  3JB9 D;  4EMK C;  5GMK h;  1I81 A;  4NL3 A;  1WQ7 A;  4QVC A;  1HK9 A;  3PGG A;  4XU0 A;  5GAN 3;  3QHS A;  1N9S A;  2YLC A;  2JN0 A;  5GAN h;  1WPY A;  4JUV A;  4XTW A;  3RKX A;  2VC8 A;  2EWN A;  4XTY A;  4C8Q A;  4PJO F;  4M7D C;  3BDU A;  4NOY A;  5GAO m;  4XTV A;  3JCM c;  2DZC A;  3EFS A;  3BFM A;  4N0A C;  5GMK j;  4XTU A;  4M77 B;  3VU3 C;  3BW1 A;  5GMK m;  4C92 A;  1H64 1;  4QVD A;  5GAO q;  4M7D E;  3HSB A;  1Y96 B;  1D3B B;  4M78 C;  1BIA A;  2RM4 A;  1U1T A;  4M77 E;  5DY9 A;  1LOJ A;  2DKG A;  4J5Y A;  3V8L A;  4F7U B;  1LJO A;  4C92 D;  3V7S A;  1X01 A;  4M77 F;  3RIR A;  5GAM e;  3JCM h;  5GAO n;  4M75 C;  4F7U E;  4X9C A;  4M7A C;  1M8V A;  4MML A;  4PNO A;  4M78 B;  4F7U F;  3QO3 A;  4RCC A;  4PJO B;  2VXF A;  5CAI A;  2E41 A;  4A54 A;  1HXD A;  1TH7 A;  3L2Z A;  4XTX A;  3RKW A;  4F7U G;  2HNI A;  3RUX A;  1WQW A;  2DVE A;  2Y90 A;  4J6Y A;  4DQ2 A;  5GAM g;  5GAN 5;  5GAN 4;  4PJO E;  3SWN B;  4XU2 A;  2QTX A;  4M78 F;  3JCM V;  2DTO A;  2DXU A;  4EMK B;  2ZGW A;  5GAM d;  4PJO D;  5GAM f;  5LJ5 d;  4XTZ A;  3JCM W;  3FB9 A;  3JB9 H;  4PJO G;  4EMG A;  3QSU A;  5LJ5 f;  2EJF A;  2E64 A;  4M7A F;  4C8Q C;  4XU3 A;  5GAM j;  4V2S A;  4M7D B;  1JRI A;  3JB9 F;  5GAO r;  1Y96 A;  3BY7 A;  5GAN g;  1D3B A;  3RES A;  4HT8 A;  3JCM Q;  5GMK l;  4F7U A;  4C92 C;  2DTI A;  4M77 D;  4XQ3 A; 
#chains in the Genus database with same CATH topology
 5LJ5 e;  1BKB A;  1I5L A;  2CYZ B;  2E6N A;  2HQE A;  2DEQ A;  3CBO A;  3GF5 A;  2Y4Y A;  3CBP A;  1VQO A;  3MHX A;  3VYG A;  4RCB A;  1QVG S;  4A53 A;  1G3Y A;  2E5Q A;  4O6J A;  5LJ3 d;  3CC4 T;  1N5Z A;  1PRL C;  3GNG A;  4OB2 B;  3REB B;  3CCL A;  3JCM P;  4HCZ A;  4PFP A;  1B3Q A;  1Z9Z A;  2C0O A;  1HSQ A;  3LX7 A;  5A2Q E;  1YIJ A;  3DB3 A;  4M7A G;  2VYT A;  3QWX X;  2G3R A;  3NTK A;  3URG A;  2RHI A;  4BY6 C;  3M59 A;  3QUI A;  1VQ9 T;  5GAN 2;  4WF2 A;  3CMA Q;  5FWC A;  3CC4 Q;  2A7Y A;  5IH2 A;  3QZ9 B;  1AT1 B;  3HRU A;  3CBM A;  1OX8 A;  2A37 A;  5KCO A;  2L3R A;  1Q7Y U;  1WZO A;  3QZ5 B;  1KG1 A;  2LJ3 A;  2EYX A;  4CI0 C;  1N9S A;  1MV3 A;  3EGD B;  2OX7 A;  3HRS A;  3OYH A;  2XKO C;  2CZ6 B;  3QXE B;  2E3H A;  3MEW A;  1XQH A;  2LT1 A;  5IAY A;  5M9O A;  2O88 A;  4PL6 A;  3G4S T;  1BYM A;  2LDM A;  3L2R A;  5KYW B;  1RAH B;  2K79 A;  3LH0 A;  4CC3 A;  2DLP A;  1QWE A;  4J9C A;  3OSS C;  2KMT A;  2VGM A;  1JEG A;  5J39 A;  1WQW A;  3SWN B;  4MZT A;  4XU2 A;  1VIF A;  3U23 A;  4QKU A;  1EFN A;  1FX7 A;  2HKN A;  3JB9 H;  1QKX A;  4D8D A;  1YWO A;  3QSU A;  4XK8 E;  1RAF B;  1Q81 C;  1BU1 A;  1ABQ A;  4RKU E;  1E7O A;  2RQU A;  3G71 Q;  4IUQ A;  2A0F B;  1WX6 A;  2GBQ A;  1Q7Y R;  4JJB A;  2QEX A;  1V29 B;  4IIM A;  4C0D C;  1VQ7 A;  2GTO A;  5GJV B;  3CC7 Q;  4AT1 B;  1G3W A;  4N4G A;  5LJ5 g;  4LNP A;  5GAN e;  2HQX A;  4M78 G;  1VIE A;  2V1Q A;  3INZ A;  3VJP A;  5KH6 A;  1X6O A;  1KSW A;  2FPF A;  2VXE A;  1Y71 A;  4KUD K;  5AT1 B;  1VQP T;  3THK A;  2QA4 T;  5FU6 B;  3FEO A;  1SHF A;  4FW1 A;  2FB7 A;  1WXT A;  1SG5 A;  1FWZ A;  2LC4 A;  2RB6 A;  4JRI A;  4EDU A;  5GMK i;  5CCA A;  1D1B A;  3VS4 A;  4Z88 A;  2ZPG B;  1OI1 A;  1KQS S;  2E12 A;  4E2F B;  1MMN A;  2YHT A;  2BIV A;  1UHF A;  4HA8 A;  4C5G A;  1HJD A;  1OZ3 A;  1SKU B;  2FZG B;  4BI4 A;  3J81 E;  2GCX A;  1HK9 A;  2DL4 A;  3BE3 A;  1AD5 A;  1K8A C;  1W4S A;  3G6E T;  2IPO B;  2M0O A;  3OYY A;  4BI8 B;  3OS0 A;  2DL5 A;  4C0G A;  3OYB A;  5HY6 A;  2FZK B;  1PD0 A;  1VQK T;  2RM4 A;  1LOJ A;  2O31 A;  2HKQ B;  3V8L A;  1D1A A;  2E6Z A;  5GAM e;  1BB9 A;  5DM7 R;  2K4Y A;  1VQM A;  1V1C A;  1ZBJ A;  2R58 A;  3QWY A;  2QAZ A;  1JJ2 A;  3PIP A;  2QTX A;  2AHJ B;  2JMC A;  1VQK Q;  3A98 A;  1VQO T;  4FT2 A;  4LUE A;  3C12 A;  4PJO G;  2KY9 A;  3CCL T;  1JO8 A;  3L2W A;  3UA6 A;  4C5E A;  3DLL A;  2QQS A;  3RES A;  1YIJ T;  2ABL A;  2K6D A;  4N4H A;  5CKF A;  5IHK A;  1OU8 A;  3OYM A;  1QWF A;  2J6O A;  4M75 B;  1VQO Q;  4BDZ A;  4OB3 B;  1I0C A;  1WI7 A;  4NS5 A;  1F1B B;  4M75 F;  1YBY A;  1FYN A;  1WGS A;  3V7C A;  2FRW A;  1Q82 U;  4R0K A;  5I2S A;  1K4U S;  1JXO A;  5I2M A;  4M77 C;  1KD1 C;  4ANJ A;  1K73 U;  1T0H A;  2EAY A;  2QK0 A;  3JCM e;  1WJS A;  1I8F A;  2D0N A;  1QCN A;  2ECZ A;  2YRD A;  2FRY A;  1VOM A;  4EPC A;  1QVG A;  5LJ5 h;  1EX4 A;  4J6W A;  3H0H A;  1RAA B;  1B34 A;  4JLG A;  3FC3 A;  1VQ5 Q;  2G6F X;  2M0Y A;  4M75 D;  1H3Z A;  4NL2 A;  1RL2 A;  1BI3 A;  1ABO A;  2DE0 X;  2OI3 A;  1W6X A;  4L6V 5;  2KXD A;  3A5Z B;  3NTI A;  1ZBX A;  3SHW A;  4J83 A;  3CCE A;  1M2V B;  1ZUY A;  4M77 E;  4J5Y A;  3H0I A;  2KRO A;  2DBM A;  4A4E A;  4O5V A;  4X9C A;  4MDW A;  1ZUU A;  3KXT A;  4FU6 A;  4B9X A;  2XDP A;  5GAM g;  2KVQ G;  1VQ7 T;  1U5S A;  1RAD B;  2O4X B;  4E7S A;  4J9E A;  5GAM f;  1K73 R;  3JCM W;  1PD1 A;  2EKO A;  2DJQ A;  2EJF A;  2KT8 A;  3OY9 A;  4C8Q C;  2LCL A;  1Q86 U;  1SSH A;  3JB9 F;  3SD4 A;  3OSV A;  1QQJ A;  2HCK A;  2RJC A;  3BY7 A;  3PMI A;  2Y4X A;  3EG0 A;  4L59 A;  1ZQ1 A;  4XQ3 A;  4BI3 A;  2YRC A;  1RI9 A;  2QEX Q;  3H41 A;  1GBR A;  1VQ7 Q;  2RO0 A;  4DBQ A;  1ZSZ C;  5AYF A;  5FLX E;  4M7A B;  1GXI E;  3O8V A;  1AVZ C;  1Q81 R;  2EJG A;  4JJN K;  1MMD A;  3H8Z A;  3F70 A;  1S1N A;  2QG9 B;  2DXT A;  5GAO l;  3S3O A;  1YJN A;  1GCQ C;  1YCY A;  2EGC A;  1YCS B;  3HFN A;  1T3L A;  3WVE B;  2XU8 A;  2CP0 A;  4C8Q E;  3OS2 A;  5A0D A;  1VQ6 A;  3REA B;  4L5G A;  2K3X A;  5IHN A;  2KK4 A;  2JM9 A;  4PLL A;  3FIF A;  4M4Z A;  1SEM A;  4C92 G;  4JLI A;  5HK3 A;  5HCK A;  2OAW A;  2K9G A;  5GAN h;  3R6O A;  4C8Q A;  1UGR B;  2JMA A;  1FMW A;  4J9F A;  4A4G A;  2PQW A;  4B6M A;  5GAO p;  1D0Z A;  4J9D A;  2RNA A;  1FMK A;  4HCK A;  3CCU T;  1KQS A;  1RAI B;  5FU7 B;  1LJO A;  5A0L A;  1K8A R;  3OYE A;  1ZSZ A;  5GAO n;  2AKK A;  4F7U E;  4MML A;  1VQM Q;  3M54 A;  2KDS A;  1V76 A;  2RQW A;  2LX9 A;  1IGQ A;  1K9M C;  1ZUK A;  3E1S A;  2DXU A;  3CME A;  3UF4 A;  2AIR B;  1O75 A;  1GCQ A;  2QDL A;  1K76 A;  2H3E B;  5KYY B;  4V2S A;  4F04 B;  4HT8 A;  2P0Q A;  2DX1 A;  4OB0 B;  4F7U A;  4LD6 A;  4PJJ A;  2DTI A;  1BI2 A;  5L8R E;  2LT4 A;  3JCM X;  3EFO B;  2E70 A;  4BDY A;  1IXD A;  5C0M A;  2QQR A;  5GAM h;  2MPX C;  1GFD A;  2NLU A;  2RHY A;  3M0P A;  4KUI A;  7AT1 B;  3HFO A;  3G4S A;  4A4H A;  2FPE A;  3ZFJ A;  2RJE A;  1D0X A;  2KNB B;  2CP6 A;  2EIF A;  3TRE A;  2YWW A;  4GY5 A;  1M3B A;  3RMS A;  1QMC A;  4ZN1 A;  3MJX A;  2E65 A;  5DLQ E;  1K9A A;  3VYH B;  2DEU A;  3QJ6 A;  3EGX A;  2LX7 A;  1N8R U;  3M0R A;  3EFR A;  1KD1 R;  3ULR B;  4J9I A;  2M1H A;  1OPK A;  2CDT A;  2P0P A;  3VS6 A;  2IIM A;  2ENM A;  1VQN A;  1GFC A;  5EG2 A;  1M1G A;  4KGX B;  4MZP A;  2JTE A;  2EYQ A;  1PSF A;  2P84 A;  5HKC A;  5GMK j;  3BFM A;  4IUV A;  4JS4 A;  3PT9 A;  5GAO q;  2HD0 A;  3CCS Q;  3CCE Q;  3I5R A;  1UJY A;  2MIO A;  1X01 A;  2K3Y A;  1VQP A;  3JCM h;  3X24 B;  1KHI A;  2CH4 A;  2HSP A;  1OZ2 A;  3GPL A;  4PJO B;  2P0K A;  1W2B P;  3ZEH A;  3OMG A;  4J9G A;  2YXY A;  4Z89 A;  1YJ9 T;  1KIK A;  1MV0 B;  2D6F A;  5LJ5 d;  3QG1 A;  2X4J A;  1QCO A;  1I5O B;  1X6G A;  5KYU B;  1YJN T;  2LVM A;  3M0T A;  2C0T A;  2EYZ A;  1Q95 G;  4JJC A;  4HKE A;  3WVD B;  2XDD A;  5J26 A;  4F16 A;  4PK4 A;  3TU4 K;  3RBB B;  1UEC A;  3LLR A;  4KH1 B;  2DIQ A;  3ZL7 C;  1NLP C;  2FEI A;  1VQ8 A;  4C0F A;  1VUB A;  3JB9 G;  3X26 B;  2NUP B;  4IIO A;  2RA2 A;  1NJI C;  2HEQ A;  2CP2 A;  1MMA A;  2XK0 A;  1YIT A;  1VQ6 Q;  3CCM Q;  2GQV A;  3OYD A;  3VRZ A;  2NYS A;  2M02 A;  1PSE A;  1K9M U;  2CP7 A;  2B86 A;  3L2U A;  3PE0 A;  3UPU A;  4OP0 A;  4F17 A;  4J9B A;  1WQ7 A;  5CKH A;  3GP8 A;  4Y92 A;  3C95 A;  2YLC A;  1YN8 A;  4JUV A;  3OW2 P;  2ZPE B;  3M53 A;  4M7D C;  2GFU A;  2DBK A;  3A1P A;  5IN1 A;  3E9G A;  4XTV A;  3EFS A;  3CME T;  1W70 A;  2L3P A;  3RNJ A;  2GNC A;  2A28 A;  1BIA A;  2J6K A;  2H3J A;  1BI0 A;  2HSE B;  2KQW A;  3RIR A;  3MET A;  2O9V A;  1M90 U;  1VQ9 Q;  1TS9 A;  2PNI A;  2NUT B;  4JS5 A;  2BE7 D;  1JXM A;  2KI7 A;  2ZGW A;  4RTT A;  3ZBD A;  3ME9 A;  2LTO A;  2QQB A;  3MP6 A;  2IVW A;  3JSC A;  1YWP A;  1D3B A;  1OPL A;  2BZ8 A;  1TG0 A;  4M7D E;  1K9M R;  2CZ7 B;  5GAN d;  2ED1 A;  1I07 A;  5LJ3 e;  2VGN A;  2O9S A;  2V8K A;  1QVF P;  2JUF A;  1NE8 A;  2COY A;  3PMT A;  4ZTF A;  1N27 A;  2F2W A;  2RD1 A;  1UGQ B;  3G4S Q;  5KYX A;  1Y0M A;  4JDS A;  2DER A;  2RK1 A;  3EG2 A;  3HRT A;  4EMH A;  4M7D A;  4JZ3 A;  3AHU A;  3M0U A;  1SPK A;  2EQK A;  3FDR A;  2I0N A;  1VQN T;  1M90 R;  4C92 B;  1K0S A;  3GNF B;  4XU1 A;  3CCQ A;  1WLP B;  2JNG A;  3CXC P;  3X28 B;  4J6X A;  4OML A;  4Y91 A;  3CPW P;  4C92 F;  2EW3 A;  2VKN A;  4DA4 A;  2RI2 A;  3SB2 A;  4QQD A;  2KR3 A;  5CKB A;  4QVZ A;  2CSQ A;  4EMK C;  1M1K C;  4XU0 A;  1KC8 C;  3QHS A;  3PNW C;  1TTH B;  3EHR A;  3P8B B;  3M55 A;  2CZ0 B;  1AZG B;  4XAX B;  4FIB A;  1VYV A;  2VWF A;  4RTX A;  2GF7 A;  3JCM c;  2DZC A;  1YJW A;  3VU3 C;  2JS0 A;  3I5S A;  1G3T A;  2V26 A;  2DKG A;  2CS7 A;  2XD0 A;  2JTF A;  4C92 D;  1IHW A;  2F2V A;  1VQP Q;  1U8R A;  4OGC A;  2KT1 A;  2QA4 Q;  3X25 B;  2CP5 A;  3AT1 B;  3QO3 A;  2JVV A;  2X3X D;  4Z8A A;  3EG9 B;  1TH7 A;  3OB9 A;  2LQN A;  3JCM V;  1KJW A;  3MEV A;  1X27 A;  1IGU A;  4LXC A;  1NJI U;  3OYF A;  4K11 A;  1WXU A;  4JZ4 A;  2D8J A;  4P5N A;  2QQ9 A;  1VQ8 T;  4LDY A;  3HKS A;  2PZ1 A;  3G6E Q;  5KYN A;  3ER0 A;  4ELZ C;  2L5Q A;  3MP8 A;  4MMK A;  4C8Q F;  1YIT T;  5LJ3 g;  4HCB A;  3OS1 A;  1MGQ A;  4EMK A;  3CCU A;  2LNH B;  1PRM C;  3S6W A;  4IUP A;  1SF9 A;  5LJ3 f;  2MK5 A;  3T9N A;  3RER A;  2KEA A;  3JCM d;  4RTU A;  2K2M A;  4Y28 E;  5LJ5 j;  3L1A A;  2A3L A;  4FW2 A;  1WNL A;  2K5I A;  3CCR T;  2RQT A;  3M0S A;  4QW2 A;  1ARK A;  4BUG A;  2P4T A;  3KFV A;  1JBM A;  5CKE A;  3V8K A;  4C8Q D;  1GCP A;  1TU0 B;  1GRI A;  3J80 E;  3TSZ A;  4BE2 A;  1YHQ A;  1KQ2 A;  3CCL Q;  1FXX A;  3JAM E;  4KUL A;  4HXJ A;  1PKS A;  5CQY A;  1YIJ Q;  1NJI R;  1NZ9 A;  2R57 A;  2LJ1 A;  3SWN C;  4J9H A;  3QKJ A;  1I81 A;  3QBY A;  2KAF A;  2RQV A;  2O01 E;  3OMC A;  2AT1 B;  1UGS B;  2KE9 A;  4XTW A;  2EWN A;  2DYI A;  3R6N A;  1ZSG A;  5CR2 A;  2EQI A;  2JOY A;  2M16 A;  1M27 C;  2SEM A;  1WFW A;  3M9Q A;  3TCJ A;  3EAE A;  1Y96 B;  4E7L A;  1SRM A;  3OYK A;  2ESW A;  1HYO A;  2EVR A;  3A8M B;  4KGZ B;  3M56 A;  4PJM A;  2PVD B;  2X51 A;  1JU5 C;  1M8V A;  3PVL A;  2RH2 A;  2XDB A;  1H92 A;  3UAT A;  2QGG A;  2QDY B;  3L2Z A;  4QQG A;  1PNJ A;  1AWW A;  1Q81 U;  3VUZ A;  3EGD A;  8AT1 B;  2SRC A;  2HBW A;  3RR6 A;  4WTO B;  2KRN A;  5FU6 C;  1PC0 A;  1R0C B;  3MEA A;  2J6F A;  2HDA A;  5KE2 A;  5FRO A;  5GMK l;  5KYW A;  4RG2 A;  2GGR A;  1GL5 A;  2NWM A;  2KSS A;  2FG0 A;  2A08 A;  3JB9 I;  3LWI A;  2D0Q B;  2OJ2 A;  2COZ A;  1C6V X;  3PVQ A;  1N9R A;  2JZ2 A;  4YTL A;  3SWN A;  2LCC A;  4J7F A;  2YUN A;  5L23 A;  1G5V A;  1E6G A;  3CCQ T;  2CUB A;  1MNE A;  4M77 A;  3V8J A;  4C0Z A;  1R8O B;  4Z02 A;  2K57 A;  2DL7 A;  2QTV A;  1YJ9 A;  3M0Q A;  2DD5 A;  2J05 A;  5I21 A;  5GAN j;  1B07 A;  1DJ7 B;  3JCM J;  2JW4 A;  1YJW T;  1K8A U;  5LJ3 h;  2CT3 A;  9ATC B;  1X43 A;  1TUG B;  5GAN 6;  2FPD A;  3JB9 D;  4ME7 A;  3PGG A;  5GAN 3;  1SSF A;  1WPY A;  1VA7 A;  2MI6 A;  2RPN A;  2EQM A;  2RJF A;  3OYN A;  2VC8 A;  3CC2 A;  4XTY A;  4E7Z A;  1BCM A;  1N6A A;  5J3B A;  2WSF E;  3RMQ A;  4N0A C;  4DBF A;  1G8X A;  2LMJ A;  5FWB A;  5FW9 A;  1M1K R;  2OTL A;  2XID A;  3CEY A;  1VQ5 A;  4M75 C;  1BCO A;  2MOX A;  3MPU B;  3TQ7 P;  1D09 B;  4FYX B;  2DET A;  2OTJ A;  1VQ4 T;  2HQH A;  2E41 A;  4XTX A;  2HNI A;  2L2P A;  2DM1 A;  1EZZ B;  3FLG A;  3FB9 A;  2VAS A;  1D0Y A;  3NMZ C;  2MYS A;  5GAM j;  2RI3 A;  2ZPF B;  1G83 A;  4KGV B;  3I56 T;  4BE0 A;  4X9D A;  2DAQ A;  2CZ1 B;  1A0N B;  4HT9 A;  1I1J A;  1W1F A;  4B9W A;  3CMA A;  1M9S A;  4JRK A;  3L2V A;  3I9Q A;  1XTD A;  4M75 E;  4R55 A;  2HBP A;  3CCU Q;  1KD1 U;  4FM4 B;  3JRZ A;  1TOV A;  2XG8 D;  1YHQ T;  3O5Z A;  4OMM A;  3S3N A;  3S3M A;  2Z0W A;  3HP9 A;  1AWO A;  2ZPH B;  1VQL T;  1JJ2 P;  1RUW A;  2ZCF B;  4N0A A;  5CK9 A;  2MAM A;  4HVV A;  1X2Q A;  5CIU A;  1M5Q 1;  1NEB A;  5GJW B;  2GTJ A;  1KQ1 A;  2K7A A;  4M75 A;  1YHQ Q;  4C8Q G;  5FRM A;  3M58 A;  5GAN 8;  2ED0 A;  2B8A A;  1TWB A;  1OYX A;  2EQU A;  3Q1J A;  4NL3 A;  2JS2 A;  4QVC A;  1C0M A;  2NUZ A;  2CT4 A;  2M9U A;  1XOV A;  1Q7Y C;  3SEM A;  3QII A;  1AHJ B;  5CVI A;  1WJQ A;  2EGA A;  4BY6 B;  3C4S A;  4PKC C;  5IXF A;  5GMK m;  1H64 1;  2DF6 A;  3GBQ A;  4DBH A;  1U06 A;  2X4Y A;  4RTY A;  3G71 A;  3CCJ T;  1IB8 A;  2K5F A;  4M7A C;  4ZTJ A;  2COW A;  3HPW A;  4ZNX A;  4RCC A;  2VXF A;  4A54 A;  3CD6 T;  4F7U G;  3CCV A;  3HTR A;  1YI2 A;  2KRM A;  5GAN 5;  1M2O A;  1PM3 A;  1QVG P;  1M30 A;  2GFA A;  3LGF A;  4XTZ A;  3QDR B;  4GBQ A;  1E6H A;  2ZPB B;  4HVW A;  3OYI A;  1IRE B;  2VB6 A;  2DXC A;  2GQI A;  3EG3 A;  1NM7 A;  5GAO r;  2L3Q A;  2V8I A;  2AKL A;  3X20 B;  1B7T A;  1UUE A;  1IO6 A;  4ATO A;  2ZZD A;  3LH5 A;  3MEU A;  2DZ9 A;  3E9F A;  4M7A E;  1OEB A;  1LNX A;  2YUQ A;  1OQK A;  3KUF A;  3V7R A;  1H8K A;  1YP5 A;  2L0A A;  4ZGJ B;  1BBZ A;  1MHN A;  3EH1 A;  3LYI A;  1YJ9 Q;  4MDX A;  2ZPI B;  2DNU A;  5FU7 C;  3CC2 T;  4LE9 A;  5GAN 7;  1T0J A;  2DK3 A;  4C0D B;  4M7A A;  2RQR A;  2LJ0 A;  2W0Z A;  2R5M A;  1WJR A;  4AG2 C;  2OTL T;  1YJN Q;  2CUD A;  1VYT A;  2DL3 A;  1G3S A;  1VQ5 T;  3MKD A;  4PFO A;  1QP2 A;  1YFN A;  2OTJ T;  3J7A F;  3CC2 Q;  1WHG A;  5D7U A;  3OBY A;  4QQ6 A;  3NTH A;  1UDL A;  2FHD A;  5I11 A;  3BDU A;  4VUB A;  2ROL A;  2PVO B;  2BUD A;  3DKM A;  2YDL A;  5LL6 S;  3OYC A;  3MCA B;  1JB0 E;  3I35 A;  1AZE A;  1KK7 A;  2LRQ A;  4M78 C;  4LUD A;  2BZX A;  1NG2 A;  2F5K A;  2BZY A;  2QYZ A;  3CCR A;  1ACM B;  2OTJ Q;  2KXC A;  1R0B G;  5CAI A;  2J7I A;  5GAN 4;  2DXB A;  3CMA T;  1TUC A;  5A0G A;  4KBM B;  3CPF A;  4FT4 A;  1X75 C;  1PKT A;  4XU3 A;  4WCI A;  4F14 A;  1Y07 A;  3QJY A;  2YUO A;  3D7S B;  3VRY A;  1QLY A;  4E7I A;  1W2B S;  4ZN3 A;  3L42 A;  4FCY A;  4RTZ A;  3VKI A;  4M78 E;  4DOV A;  2X4X A;  4LDX A;  3CME Q;  2L8D A;  1B34 B;  4E7K A;  3OYA A;  1KQS P;  2YT6 A;  1TUD A;  3QPH A;  4A4F A;  3DLM A;  4LN2 A;  2AZV A;  2FYK A;  5KYY A;  1RAC B;  2CGH A;  2FZC B;  4FYV B;  4JPB W;  3TVT A;  3FJP A;  1SHG A;  2V8J A;  2KRS A;  1UE9 A;  2DPP B;  2XI9 A;  4M78 A;  2M51 A;  4OMQ A;  3EFO A;  1WIE A;  4AFU C;  1RI0 A;  4HVU A;  1Q82 C;  1PCX A;  4CRI A;  2YLB A;  3HHT B;  4PJO C;  3UWN A;  2F1L A;  2K3B A;  1K73 C;  1FMV A;  2RN8 A;  4OF1 A;  4CC2 A;  4BE1 A;  4DOW A;  3G71 T;  1NPP A;  4JRQ A;  2AZS A;  2DL8 A;  2DRK A;  4KT0 E;  1U3O A;  2QI2 A;  3E2U A;  2A36 A;  5D6Y A;  4II1 A;  3CCV T;  1YI2 T;  4NOY A;  3CC7 T;  4M77 B;  1UGP B;  1D1C A;  1WYX A;  4J8O A;  2EFI A;  4RUG A;  4M77 F;  2PUO B;  2EYY A;  3MO8 A;  1CKA A;  1LVK A;  1WXB A;  2YSQ A;  1UEB A;  4IUU A;  3PIO A;  3CCV Q;  1YI2 Q;  3RKW A;  2JM8 A;  1Y57 A;  2DVE A;  4J6Y A;  4PJL A;  2BTT A;  3OW2 S;  1VQN Q;  4PJO E;  3H0F A;  1UB4 A;  5GAM d;  2DTO A;  1T3S A;  1OUL A;  4R56 A;  1ZHI A;  5LJ5 f;  1ZLM A;  4OVA A;  3QYG B;  2DMO A;  1JRI A;  2LQK A;  4OGE A;  1RLP C;  2XIC A;  4M77 D;  2FO0 A;  3OS5 A;  4Q5W A;  1UHC A;  2X3W D;  1OV3 A;  5IT9 E;  4M7D G;  4E7J A;  1Q86 C;  4PJO A;  4QT7 A;  1I4K 1;  1UFF A;  3VS7 A;  1QKW A;  5C6S A;  1O9S A;  1G2B A;  3ASK A;  1S72 A;  4BAC A;  1EIF A;  3TEE A;  3OYG A;  4OMF B;  1M4Z A;  4IKF A;  1XNI A;  1PG5 B;  1MND A;  3FRN A;  1VQ4 A;  5CQX A;  4C8Q B;  3WXM B;  4LDV A;  2QGF B;  4PJN A;  4PLI A;  5KYU A;  2MF2 A;  4OMO A;  1U1S A;  4LD9 K;  1QVF S;  2MMP A;  3NHN A;  1NPR A;  2FVU A;  1WA7 A;  1OX9 A;  1NEG A;  3OQ5 A;  1ZSZ B;  3LW5 E;  5CKD A;  4RTV A;  4FYY B;  3I56 A;  3NPF A;  5ECA A;  1VQ8 Q;  1ZA1 B;  4C5H A;  2YRV A;  4ORZ A;  2AK5 A;  2F5T X;  1X69 A;  4JRP A;  3VUB A;  2NUP A;  1YIT Q;  4MZM A;  1VYU A;  3VS5 A;  1Y7X A;  2JT4 A;  4KH0 B;  2YUP A;  4XTU A;  1GBQ A;  1XJW B;  3CXC S;  3CPW S;  1HD3 A;  4F7U B;  1NYG A;  1C1A A;  1VQL A;  3CCR Q;  3E19 A;  4PNO A;  4E6R A;  4F7U F;  3EG1 A;  3NFC A;  2PUK B;  4DQ2 A;  1KHC A;  5KCH A;  1X2K A;  3N5B B;  4D6W A;  3OYL A;  2E64 A;  4C5I A;  5CO7 A;  5GAN g;  2C06 A;  4C92 C;  4TVR A;  4E7H A;  2F69 A;  4EIK A;  1WHL A;  5GAN f;  1JQQ A;  3H6Z A;  3EGX B;  2XMF A;  1UTI A;  2NUT A;  1QCF A;  4OMP A;  5D6X A;  3M4Y A;  1M1F A;  2KYB A;  1M8M A;  3JV3 A;  4N4I A;  3LWH A;  2RJD A;  2DVJ A;  2K2V A;  3GIB A;  2ZAE A;  3CCJ A;  5LJ3 j;  1IHV A;  1K1Z A;  1BIB A;  2RF0 A;  2ROT A;  3EGU A;  4FYW B;  3CD6 A;  1UG1 A;  3UA7 A;  8ATC B;  4X1V A;  2H8H A;  1W2B A;  2DD4 A;  1NBE B;  4BB7 A;  1LCK A;  1M1K U;  1KC8 U;  2DFU A;  4C92 E;  1X6B A;  4LDW A;  3CCS A;  5GMK e;  2EPD A;  3H9N A;  1QP3 A;  4ELY C;  2EJ9 A;  1ZX6 A;  5IXB A;  1PHT A;  2OAU A;  3I55 A;  1AEY A;  1QVP A;  4BD3 A;  2XHC A;  3QYH B;  2JN0 A;  2QEX T;  2MCN A;  3RKX A;  1Q82 R;  1N8R C;  4A4K A;  5HK0 A;  2KGT A;  2PU9 B;  3RDV A;  3P8D A;  1AWJ A;  1AWX A;  3BW1 A;  3PFS A;  4C92 A;  3GOX A;  3CCQ Q;  3KBG A;  2KYM A;  1OOT A;  4IUR A;  4DEX A;  4CC7 A;  1IRX A;  3TSW A;  3GLX A;  2KBT A;  3A8L B;  4X34 A;  2JJ9 A;  3UDC A;  4ZGD B;  2X9H A;  3G7Z A;  2L89 A;  3A8G B;  1YJW Q;  4M7A F;  4AMC A;  3PTA A;  1S72 T;  2L3S A;  1KC8 R;  5IHI A;  4FSX A;  4RMO A;  2EGE A;  1M3C A;  1MMG A;  1RAE B;  4M77 G;  5FRN A;  3C0C A;  2C0I A;  4LDU A;  3CCM A;  2I2L A;  3EG9 A;  1QW1 A;  4RTW A;  3OW2 A;  1WHK A;  3P8H A;  2DIL A;  1S72 Q;  4JJD A;  3JCM g;  4AFZ C;  2JXB A;  4M7A D;  1WHH A;  2RHZ A;  4E47 A;  3JCM f;  4UC4 A;  1Q86 R;  1VQ4 Q;  5I22 A;  1VQM T;  2RK2 A;  2QXF A;  2K5L A;  4KRT A;  4ZGE B;  3JCM b;  4A63 B;  2E1H A;  6AT1 B;  4IUT A;  2E10 A;  3CC4 A;  2EQJ A;  4AFQ C;  2LNV A;  4AG1 C;  2WAC A;  2E5K A;  2DTH A;  3I56 Q;  4OB1 B;  1P92 A;  1RAG B;  2E3I A;  1MUZ A;  1VQ9 A;  2PVG B;  1RLQ C;  3OA6 A;  2BKD N;  4GLK A;  2EYW A;  2LZ6 B;  3G1J A;  3LGL A;  4GLM A;  3VS3 A;  1BK2 A;  3CQT A;  2LCS A;  2P4R A;  3L2Q A;  2IG0 A;  2QQA A;  1QVF A;  2HMA A;  2W10 A;  1WHJ A;  1D3B B;  1U1T A;  2MWP A;  5DY9 A;  2QAS A;  3MP1 A;  3NGP A;  1VQL Q;  2DO3 A;  2DA9 A;  4M78 B;  3EH2 A;  2D8H A;  1HXD A;  2CRE A;  2J06 A;  1ZA2 B;  3BDL A;  2VUB A;  1LPL A;  2BE9 B;  4M78 F;  4ESR A;  1OU9 A;  2ATC B;  1CSK A;  4FSS A;  5KYX B;  2JTM A;  1Z9Q A;  2CH4 W;  4EMG A;  1M90 C;  2V1R A;  1KFZ A;  4M7D B;  3CXC A;  1IZ6 A;  1WHM A;  1Y96 A;  3CPW A;  3M57 A;  2CP3 A;  2F2X A;  3HL8 A;  4CC4 B;  1NYF A;  3RKY A;  3QDF A;  4DBR A;  4M7D F;  2DJZ A;  1CKB A;  2CKK A;  3JB9 J;  3CC7 A;  1RAB B;  4M78 D;  5KE3 A;  3VS2 A;  2EKH A;  3CCS T;  3CCE T;  2O2O A;  4M75 G;  2MWO A;  3CCJ Q;  4HCC A;  2DIG A;  1M2V A;  3IQL A;  2DRM A;  3CD6 Q;  1NLO C;  2R5A A;  2VVK A;  3I55 T;  4PFZ A;  4M7D D;  3M4G A;  4OMN A;  2X35 A;  5D6W A;  2O4X A;  2CSI A;  1R77 A;  3C94 A;  3DB4 A;  2WSE E;  2E4H A;  1M3A A;  1TSF A;  1UJ0 A;  2QA4 A;  3I55 Q;  2RHU A;  2RMO A;  2X4W A;  2RI5 A;  3A8H B;  1JJ2 S;  3A8O B;  3VS0 A;  2WSC E;  1AOJ A;  4J7I A;  1K0X A;  4PJO F;  3UT1 A;  4D8K A;  3M5A A;  1YNZ A;  2LP5 A;  5GAO m;  3SDZ A;  3OBW A;  3OYJ A;  4QVD A;  5DLO A;  2HL3 A;  3HSB A;  1TXQ A;  4RG8 A;  1J3T A;  2HZY A;  3V7S A;  1WDX A;  1N8R R;  2FL7 A;  1H3H A;  2LQ8 A;  3G6E A;  2RHX A;  3EHQ A;  5GMK h;  4DEY A;  1BI1 A;  3SFM A;  2HAX A;  3RUX A;  2HL5 C;  2Y90 A;  2VV5 A;  1SRL A;  3VV0 A;  3VS1 A;  4EMK B;  1VQ6 T;  4PJO D;  3CCM T;  1VQK A;  2EBP A;  1UGV A;  4FL6 A;  5EC7 A;  2D1X A;  2DYB A;  4AFS C;  2OTL Q;  2LQW A;  3FJ5 A;  3JCM Q;  1PWT A;  2PTK A;  2D9T A; 
#chains in the Genus database with same CATH homology
 5L8R E;  1BKB A;  3OS5 A;  4Q5W A;  5LJ5 e;  2CYZ B;  1I5L A;  2LT4 A;  2E6N A;  2HQE A;  2DEQ A;  3JCM X;  2KSS A;  3CBO A;  2E70 A;  5IT9 E;  3GF5 A;  4BDY A;  4E7J A;  4M7D G;  1Q86 C;  4PJO A;  2Y4Y A;  5C0M A;  3CBP A;  1VQO A;  1I4K 1;  3JB9 I;  2QQR A;  3MHX A;  2D0Q B;  3LWI A;  3VYG A;  5C6S A;  5GAM h;  4RCB A;  1N9R A;  2JZ2 A;  4YTL A;  2NLU A;  2RHY A;  1O9S A;  3SWN A;  1G3Y A;  3ASK A;  2LCC A;  2E5Q A;  4J7F A;  4KUI A;  4O6J A;  3GNG A;  3HFO A;  4OB2 B;  5LJ3 d;  4A53 A;  1EIF A;  4A4H A;  3G4S A;  3CCQ T;  3TEE A;  4HCZ A;  3OYG A;  4BAC A;  3JCM P;  4OMF B;  3LX7 A;  4M77 A;  3V8J A;  5A2Q E;  1YIJ A;  3ZFJ A;  4C0Z A;  3DB3 A;  1M4Z A;  2RJE A;  1XNI A;  2VYT A;  1R8O B;  4IKF A;  4M7A G;  2G3R A;  4Z02 A;  2K57 A;  3FRN A;  3NTK A;  1VQ4 A;  3URG A;  2EIF A;  3TRE A;  2RHI A;  5CQX A;  4BY6 C;  3WXM B;  4C8Q B;  4GY5 A;  3M59 A;  3QUI A;  4LDV A;  3RMS A;  1VQ9 T;  4PLI A;  5GAN 2;  4WF2 A;  1YJ9 A;  2DD5 A;  4ZN1 A;  2MF2 A;  1U1S A;  2E65 A;  4LD9 K;  5I21 A;  5DLQ E;  2MMP A;  5GAN j;  1QVF S;  3VYH B;  1DJ7 B;  1NPR A;  2A7Y A;  2FVU A;  3QJ6 A;  3JCM J;  3QZ9 B;  3OQ5 A;  1YJW T;  1K8A U;  3HRU A;  3CBM A;  5LJ3 h;  1N8R U;  3LW5 E;  5CKD A;  5KCO A;  2L3R A;  1Q7Y U;  5GAN 6;  3EFR A;  3QZ5 B;  3I56 A;  1KG1 A;  3JB9 D;  2M1H A;  4ME7 A;  3PGG A;  2P0P A;  5GAN 3;  4C5H A;  1SSF A;  4CI0 C;  1N9S A;  2YRV A;  1WPY A;  3HRS A;  3OYH A;  2MI6 A;  2XKO C;  2F5T X;  2EQM A;  2CZ6 B;  2RJF A;  3VUB A;  2VC8 A;  5EG2 A;  3OYN A;  4JRP A;  4XTY A;  3CC2 A;  1VQN A;  3QXE B;  1N6A A;  1M1G A;  3MEW A;  4MZM A;  1XQH A;  2LT1 A;  5J3B A;  5IAY A;  4MZP A;  1Y7X A;  2WSF E;  2EYQ A;  1PSF A;  5HKC A;  5GMK j;  5M9O A;  3RMQ A;  3BFM A;  4IUV A;  4N0A C;  4XTU A;  4JS4 A;  3PT9 A;  5GAO q;  2HD0 A;  3CXC S;  4PL6 A;  3G4S T;  1BYM A;  2LDM A;  3L2R A;  3CPW S;  4F7U B;  2OTL A;  1X01 A;  2XID A;  2K3Y A;  1VQP A;  3CEY A;  3JCM h;  4M75 C;  1VQ5 A;  3X24 B;  1KHI A;  3LH0 A;  1VQL A;  3CCL A;  1OZ2 A;  3E19 A;  4PNO A;  3GPL A;  2OTJ A;  4F7U F;  1VQ4 T;  4PJO B;  2P0K A;  3NFC A;  2E41 A;  3OSS C;  3ZEH A;  2KMT A;  3OMG A;  2PUK B;  2VGM A;  4XTX A;  2HNI A;  5J39 A;  1WQW A;  1YJ9 T;  4DQ2 A;  1KHC A;  3SWN B;  4MZT A;  4XU2 A;  5KCH A;  1VIF A;  3N5B B;  4D6W A;  1FX7 A;  3FLG A;  3PIO A;  2D6F A;  5LJ5 d;  3FB9 A;  3JB9 H;  3QG1 A;  3QSU A;  3OYL A;  2E64 A;  4C5I A;  2X4J A;  4XK8 E;  5GAM j;  2RI3 A;  2ZPF B;  1Q81 C;  5CO7 A;  5GAN g;  4RKU E;  2C06 A;  3I56 T;  4C92 C;  4BE0 A;  4TVR A;  4E7H A;  4IUQ A;  1YJN T;  4X9D A;  2F69 A;  2DAQ A;  2LVM A;  2QEX A;  2CZ1 B;  5GAN f;  1V29 B;  4HT9 A;  4C0D C;  1VQ7 A;  3H6Z A;  4B9W A;  3CMA A;  1M9S A;  4JRK A;  4LD6 A;  1G3W A;  4N4G A;  5LJ5 g;  3L2V A;  4HKE A;  1XTD A;  4M75 E;  5D6X A;  3WVD B;  4R55 A;  5GAN e;  2HBP A;  2HQX A;  3M4Y A;  4M78 G;  1KD1 U;  2XDD A;  5J26 A;  1M1F A;  3JRZ A;  2XG8 D;  4FM4 B;  1VIE A;  3TU4 K;  1YHQ T;  3LLR A;  3INZ A;  4N4I A;  3VJP A;  3LWH A;  5KH6 A;  1X6O A;  2RJD A;  3S3N A;  2DIQ A;  2K2V A;  3S3M A;  3GIB A;  2VXE A;  1Y71 A;  3HP9 A;  1VQ8 A;  4C0F A;  3CCJ A;  4KUD K;  1VUB A;  1VQP T;  5LJ3 j;  2QA4 T;  1BIB A;  3JB9 G;  2ZPH B;  5FU6 B;  3X26 B;  1VQL T;  3FEO A;  2ZCF B;  3CD6 A;  4N0A A;  2FB7 A;  2RA2 A;  5CK9 A;  1NJI C;  1FWZ A;  2MAM A;  2XK0 A;  1YIT A;  5CIU A;  1W2B A;  1M5Q 1;  2LC4 A;  2DD4 A;  2RB6 A;  4JRI A;  4EDU A;  4BB7 A;  5GMK i;  5CCA A;  2GQV A;  3OYD A;  1M1K U;  1KQ1 A;  1KC8 U;  4M75 A;  4C92 E;  4C8Q G;  3CCS A;  4LDW A;  1PSE A;  2ZPG B;  1OI1 A;  5GMK e;  1KQS S;  2E12 A;  5FRM A;  3M58 A;  1K9M U;  2YHT A;  1QP3 A;  5GAN 8;  3L2U A;  2BIV A;  4ELY C;  2B8A A;  2EJ9 A;  4HA8 A;  1OYX A;  4OP0 A;  4C5G A;  3UPU A;  1OZ3 A;  2EQU A;  3Q1J A;  4BI4 A;  2OAU A;  3J81 E;  2GCX A;  3I55 A;  4NL3 A;  3GP8 A;  1WQ7 A;  5CKH A;  4QVC A;  1HK9 A;  1QVP A;  3C95 A;  4BD3 A;  2XHC A;  3QYH B;  2YLC A;  2JN0 A;  2QEX T;  4JUV A;  1K8A C;  2M9U A;  1XOV A;  1W4S A;  3RKX A;  3G6E T;  2M0O A;  4A4K A;  3OYY A;  1N8R C;  2HAX A;  5HK0 A;  4BI8 B;  2ZPE B;  3OS0 A;  1Q7Y C;  3M53 A;  3QII A;  4M7D C;  2GFU A;  5IN1 A;  4C0G A;  1AHJ B;  5CVI A;  3OYB A;  3E9G A;  1WJQ A;  2PU9 B;  4XTV A;  3EFS A;  5HY6 A;  3P8D A;  3C4S A;  4PKC C;  4BY6 B;  3CME T;  3BW1 A;  5GMK m;  3PFS A;  1H64 1;  4C92 A;  3GOX A;  1VQK T;  1BIA A;  2RM4 A;  3KBG A;  2H3J A;  1BI0 A;  1LOJ A;  3V8L A;  2KQW A;  2X4Y A;  2E6Z A;  4IUR A;  3MET A;  3RIR A;  5GAM e;  3G71 A;  5DM7 R;  3CCJ T;  2K5F A;  4M7A C;  2K4Y A;  4ZTJ A;  3HPW A;  1VQM A;  1M90 U;  2R58 A;  3GLX A;  4RCC A;  2VXF A;  3A8L B;  4A54 A;  3CD6 T;  4X34 A;  4F7U G;  3CCV A;  1YI2 A;  1JJ2 A;  3UDC A;  4JS5 A;  5GAN 5;  3PIP A;  4ZGD B;  3G7Z A;  2QTX A;  2AHJ B;  2L89 A;  2ZGW A;  3A8G B;  2GFA A;  3LGF A;  3ZBD A;  4FT2 A;  4XTZ A;  1VQO T;  3QDR B;  3C12 A;  3ME9 A;  4PJO G;  2ZPB B;  2KY9 A;  2LTO A;  2QQB A;  3MP6 A;  2IVW A;  3JSC A;  4M7A F;  3OYI A;  3CCL T;  3PTA A;  1S72 T;  1IRE B;  3L2W A;  2DXC A;  4C5E A;  5GAO r;  3DLL A;  2V8I A;  2QQS A;  1D3B A;  3RES A;  4FSX A;  1YIJ T;  4RMO A;  4M7D E;  3X20 B;  2CZ7 B;  5GAN d;  4N4H A;  5CKF A;  4ATO A;  4M77 G;  5LJ3 e;  2ZZD A;  2VGN A;  3OYM A;  1G5V A;  2V8K A;  5FRN A;  4M75 B;  2JUF A;  1NE8 A;  4LDU A;  2I2L A;  3CCM A;  1QW1 A;  4BDZ A;  3PMT A;  3P8H A;  3OW2 A;  4ZTF A;  3MEU A;  4OB3 B;  2DZ9 A;  1N27 A;  2RD1 A;  3E9F A;  1UGQ B;  4M7A E;  3JCM g;  4NS5 A;  5GMK l;  4M75 F;  1LNX A;  4JDS A;  3KUF A;  2RK1 A;  1YBY A;  3V7R A;  4M7A D;  2RHZ A;  4E47 A;  3HRT A;  4EMH A;  3JCM f;  1WGS A;  3V7C A;  4UC4 A;  4M7D A;  1Q82 U;  3AHU A;  4ZGJ B;  5I2S A;  5I2M A;  1VQM T;  1MHN A;  4M77 C;  2RK2 A;  2EQK A;  2QXF A;  1KD1 C;  2K5L A;  3FDR A;  3LYI A;  1K73 U;  4MDX A;  4ZGE B;  2EAY A;  3JCM b;  2E1H A;  3JCM e;  1VQN T;  1WJS A;  2ZPI B;  1I8F A;  5FU7 C;  4C92 B;  3CC2 T;  5GAN 7;  4IUT A;  2E10 A;  3CC4 A;  2EQJ A;  2DK3 A;  3GNF B;  4XU1 A;  4C0D B;  3CCQ A;  2JNG A;  4M7A A;  2LNV A;  4EPC A;  3X28 B;  1QVG A;  5LJ5 h;  4J6X A;  4J6W A;  4Y91 A;  2WAC A;  4C92 F;  1B34 A;  2DTH A;  4JLG A;  3FC3 A;  4M75 D;  4DA4 A;  2RI2 A;  2R5M A;  3SB2 A;  4QQD A;  5CKB A;  1WJR A;  2OTL T;  4OB1 B;  4QVZ A;  4NL2 A;  1H3Z A;  4EMK C;  1P92 A;  1G3S A;  1VQ5 T;  1VQ9 A;  2PVG B;  1RL2 A;  4XU0 A;  1KC8 C;  1BI3 A;  3PNW C;  3QHS A;  1M1K C;  1QP2 A;  2OTJ T;  3J7A F;  3OA6 A;  3P8B B;  4L6V 5;  3M55 A;  2BKD N;  2CZ0 B;  4GLK A;  4XAX B;  3OBY A;  3NTH A;  4FIB A;  3A5Z B;  3LGL A;  4QQ6 A;  3NTI A;  1ZBX A;  2FHD A;  3BDU A;  4VUB A;  2GF7 A;  2PVO B;  2BUD A;  3DKM A;  3JCM c;  2DZC A;  5LL6 S;  2IG0 A;  3MCA B;  2QQA A;  3OYC A;  3VU3 C;  1JB0 E;  3L2Q A;  1YJW A;  1QVF A;  4J83 A;  3CCE A;  1D3B B;  2LRQ A;  4M78 C;  1G3T A;  1U1T A;  4M77 E;  2MWP A;  4J5Y A;  2DKG A;  5DY9 A;  2CS7 A;  2XD0 A;  3MP1 A;  2JTF A;  4A4E A;  4C92 D;  4O5V A;  1U8R A;  4OGC A;  4X9C A;  2F5K A;  4MDW A;  2DO3 A;  3X25 B;  3CCR A;  4M78 B;  3QO3 A;  2JVV A;  3KXT A;  5CAI A;  1HXD A;  1TH7 A;  4FU6 A;  3OB9 A;  4B9X A;  2XDP A;  5GAM g;  5GAN 4;  2KVQ G;  1VQ7 T;  3BDL A;  2O4X B;  2VUB A;  2DXB A;  4M78 F;  3JCM V;  3CMA T;  5A0G A;  5GAM f;  3JCM W;  3MEV A;  4KBM B;  2JTM A;  3CPF A;  1X75 C;  4FT4 A;  2EKO A;  4EMG A;  1NJI U;  1M90 C;  2EJF A;  3OYF A;  3OY9 A;  4C8Q C;  4XU3 A;  2LCL A;  1Q86 U;  4M7D B;  3CXC A;  1IZ6 A;  3JB9 F;  3SD4 A;  1Y96 A;  3OSV A;  2RJC A;  3BY7 A;  3M57 A;  3PMI A;  2Y4X A;  2QQ9 A;  4P5N A;  3CPW A;  3HL8 A;  4L59 A;  1ZQ1 A;  1Y07 A;  4XQ3 A;  4LDY A;  4BI3 A;  3QJY A;  3RKY A;  1VQ8 T;  3HKS A;  4M7D F;  2DJZ A;  2RO0 A;  4E7I A;  1W2B S;  4ZN3 A;  3ER0 A;  3L42 A;  2L5Q A;  4ELZ C;  3MP8 A;  3VKI A;  4M78 E;  5AYF A;  4MMK A;  4DOV A;  5FLX E;  2CKK A;  2X4X A;  3JB9 J;  4C8Q F;  1YIT T;  4M7A B;  3CC7 A;  4LDX A;  1GXI E;  5LJ3 g;  2L8D A;  4M78 D;  3O8V A;  4HCB A;  1B34 B;  2EJG A;  5KE3 A;  4JJN K;  3OS1 A;  1MGQ A;  4E7K A;  3OYA A;  4EMK A;  3CCU A;  3S6W A;  4IUP A;  3T9N A;  3QPH A;  5LJ3 f;  3CCS T;  3CCE T;  3RER A;  4A4F A;  3H8Z A;  3F70 A;  3JCM d;  2DXT A;  4M75 G;  3DLM A;  2MWO A;  5GAO l;  3S3O A;  1YJN A;  4Y28 E;  5LJ5 j;  1YCY A;  2A3L A;  1WNL A;  2DIG A;  2CGH A;  2FYK A;  3L1A A;  4HCC A;  2K5I A;  3HFN A;  3CC4 T;  3CCR T;  2R5A A;  3FJP A;  3I55 T;  2V8J A;  4M7D D;  3M4G A;  4QW2 A;  3WVE B;  2XU8 A;  4BUG A;  4C8Q E;  2DPP B;  2XI9 A;  4M78 A;  3OS2 A;  5A0D A;  1VQ6 A;  4M77 D;  4L5G A;  2P4T A;  5CKE A;  1JBM A;  2K3X A;  3V8K A;  4C8Q D;  2X35 A;  1RI0 A;  2KK4 A;  1Q82 C;  5D6W A;  3J80 E;  4CRI A;  4BE2 A;  2YLB A;  2O4X A;  4PLL A;  1YHQ A;  1KQ2 A;  3C94 A;  3HHT B;  1FXX A;  3DB4 A;  4PJO C;  2WSE E;  3JAM E;  4KUL A;  3UWN A;  3FIF A;  5CQY A;  1K73 C;  4C92 G;  4OF1 A;  1NZ9 A;  4JLI A;  2R57 A;  3SWN C;  2QA4 A;  4BE1 A;  3QKJ A;  2RHU A;  4DOW A;  5HK3 A;  1I81 A;  3G71 T;  2X4W A;  2RI5 A;  1NPP A;  3QBY A;  4JRQ A;  2KAF A;  3A8H B;  4KT0 E;  5GAN h;  3A8O B;  2QI2 A;  1JJ2 S;  2O01 E;  2WSC E;  3OMC A;  1UGS B;  4J7I A;  4XTW A;  2EWN A;  3R6O A;  4C8Q A;  5D6Y A;  4II1 A;  3CCV T;  1YI2 T;  4PJO F;  1UGR B;  3UT1 A;  3M5A A;  4NOY A;  5CR2 A;  2JOY A;  2M16 A;  2PQW A;  4A4G A;  3SDZ A;  5GAO p;  5GAO m;  3CC7 T;  3M9Q A;  3OBW A;  4M77 B;  3TCJ A;  3OYJ A;  4QVD A;  3EAE A;  5DLO A;  1S72 A;  1UGP B;  1QVG S;  3HSB A;  1Y96 B;  4E7L A;  3CCU T;  4J8O A;  2EFI A;  3OYK A;  1KQS A;  5FU7 B;  1LJO A;  4RG8 A;  3V7S A;  5A0L A;  3A8M B;  3M56 A;  2PUO B;  2PVD B;  3MO8 A;  4M77 F;  5GAO n;  3OYE A;  4F7U E;  1M8V A;  4MML A;  2FL7 A;  2LQ8 A;  3M54 A;  2KDS A;  1UEB A;  2RH2 A;  2RHX A;  3G6E A;  2XDB A;  4IUU A;  2QDY B;  3L2Z A;  1BI1 A;  4QQG A;  3RKW A;  3SFM A;  5GMK h;  3RUX A;  2Y90 A;  2DVE A;  2LX9 A;  4J6Y A;  2VV5 A;  3OW2 S;  1Q81 U;  3VUZ A;  1K9M C;  4PJO E;  3VV0 A;  3E1S A;  1UB4 A;  5GAM d;  4EMK B;  2DTO A;  2DXU A;  1VQ6 T;  3CME A;  4PJO D;  3CCM T;  1VQK A;  1O75 A;  4R56 A;  1ZHI A;  5LJ5 f;  5FU6 C;  4OVA A;  3QYG B;  4V2S A;  4FL6 A;  1JRI A;  2LQK A;  3MEA A;  4OGE A;  5KE2 A;  4HT8 A;  2P0Q A;  2XIC A;  4OB0 B;  5FRO A;  3JCM Q;  4F7U A;  2D9T A;  2DTI A;  1BI2 A;  4RG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...