1LJOA

Crystal structure of an sm-like protein (af-sm2) from archaeoglobus fulgidus at 1.95a resolution
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
75
structure length
75
Chain Sequence
GAMVLPNQMVKSMVGKIIRVEMKGEENQLVGKLEGVDDYMNLYLTNAMECKGEEKVRSLGEIVLRGNNVVLIQPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Archaeal Sm proteins form heptameric and hexameric complexes: crystal structures of the Sm1 and Sm2 proteins from the hyperthermophile Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Unknown function
molecule keywords Archaeal Sm-like protein AF-Sm2
total genus 15
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2002-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ljoA00
4JRKA 4MMKA 4M7DG 4HA8A 4M77E 4C8QG 4PNOA 5GAN2 4M7DE 3HFNA 4J5YA 2DTOA 5GAMg 3JCMb 5LJ5e 3SB2A 4XTVA 4PJOB 4F7UE 2DEQA 4Y91A 3FIFA 4M78C 5GAOr 4XU1A 2RA2A 4M78B 3V7CA 3V8JA 4X9CA 4XTXA 2DJZA 4N0AA 5LJ3d 4M7AA 4C92B 5LJ3h 4EMKA 5GANg 5GAN3 3JCMP 2EWNA 4RCCA 4M7AF 2DXUA 2EJGA 4C92C 4C8QD 4PJOE 5GAN8 1B34A 4XU3A 3JCMe 2YLCA 5GAN6 4NOYA 5LJ3j 3V7RA 4QVCA 3EFRA 1HXDA 3EFSA 2FYKA 1Y96B 1I5LA 4PJOD 4HT8A 2QTXA 3L1AA 4M75F 5GANe 3AHUA 4X9DA 5LJ3e 5LJ5d 3RERA 5GMKm 1KQ1A 4RCBA 3RKWA 2DVEA 2HNIA 4C92D 4C8QC 5GAMf 1D3BB 4M77B 1WNLA 5GANj 4XU2A 4C8QB 5GAMe 4M77C 2E65A 3JCMc 4XTWA 1MGQA 4XQ3A 5GAN7 3JCMf 4F7UF 3JB9F 1M8VA 4PJOG 4NL3A 2VC8A 5GMKl 3JCMV 5GANd 4M7DF 4M78E 2JN0A 4M78G 1D3BA 4M77A 3JCMd 4M75G 4PJOF 4JLIA 4C8QA 5GAMh 3JCMW 4F7UG 3JB9J 3QSUA 2RB6A 2Y90A 4M78D 3V7SA 3JCMJ 1Y96A 2E10A 1N9RA 1BIBA 3HSBA 5LJ5g 4XTUA 5LJ5j 1KQ2A 3BDUA 1YCYA 5GAN5 2VXEA 1JBMA 1I81A 4NL2A 1LJOA 2DZCA 4XTZA 4QVDA 5CAIA 2DTHA 4C92A 4OP0A 1U1TA 3INZA 4M75B 4EMKC 2VXFA 4JUVA 4M7AC 2EAYA 1WPYA 4N0AC 3JCMh 4C92F 4M7AB 1N9SA 3RIRA 3RKYA 1X01A 4M78A 4M77G 4C8QE 3GIBA 4M78F 3RESA 1LNXA 1WQWA 4J6WA 4XTYA 5GAOq 4V2SA 5GAOl 5GAOn 2RD1A 4EMGA 3V8LA 2CGHA 3QHSA 5GANf 3JB9G 5GMKi 5LJ5f 1LOJA 3BFMA 2RM4A 4EMHA 4C8QF 2E64A 4MMLA 3FJPA 5GAMd 1B34B 3JCMX 2DTIA 4F7UB 4M77F 1H641 4M75C 4EMKB 2ZGWA 5LJ3f 4HT9A 4C92G 2YLBA 5LJ3g 3QUIA 4C92E 5GANh 4M7DB 2DXTA 2EJFA 4JRIA 3FB9A 5DY9A 4M7DC 3SWNC 4M7AE 2EJ9A 5GMKh 4DQ2A 4PJOA 3SWNB 1I4K1 3BW1A 4J6XA 3V8KA 3JCMQ 4A54A 2K57A 1I8FA 2I2LA 3BY7A 2FB7A 4J6YA 3JB9I 1HK9A 3SWNA 3VU3C 2E41A 4M7DA 3HFOA 4M7AG 1JRIA 3JCMg 4PJOC 2DKGA 3QO3A 3PGGA 2DZ9A 5GMKe 2E1HA 5GAOp 4M75D 1M5Q1 4M75A 4F7UA 3L2ZA 3RKXA 4A53A 5GAN4 3M4GA 1U1SA 4M77D 3RUXA 4M7AD 1BIAA 1WQ7A 5GAOm 3JB9H 4M7DD 5GMKj 5I21A 4XU0A 5LJ5h 1TH7A 4M75E 5GAMj 2YHTA 4WF2A 3JB9D
chains in the Genus database with same CATH superfamily
3PT9A 4J7FA 4MMKA 4HA8A 1VIFA 2HBPA 4C8QG 1YJ9A 1ZX6A 3OYJA 4XTVA 1QKWA 2H3JA 2QDLA 3V8JA 4PFPA 4XTXA 1UFFA 2QA4A 1G5VA 1G3SA 2HBWA 1VOMA 1SF9A 5GAN8 4XU3A 1HXDA 2K2MA 3QXEB 1KK7A 2AZVA 1Y96B 1TXQA 2AKKA 4OMLA 3L1AA 1I5LA 1BK2A 1PSFA 2O31A 4C92D 1JXMA 1M1GA 1TTHB 2DF6A 2LTOA 2EYWA 2QXFA 2L3RA 1VYUA 3QJ6A 2V26A 3VJPA 3NGPA 4B9XA 4FCYA 3C0CA 4AFZC 3I5SA 1WX6A 5FRMA 3J7AF 4PJOF 1K8AR 2B86A 2EYYA 4C0FA 5GAN5 2E6NA 2XI9A 2EQUA 4NL2A 1WHHA 1U1TA 3CCLA 2LP5A 3EG3A 1N9SA 7AT1B 4M78F 1GL5A 1D09B 3QYGB 3OW2P 2ATCB 4EPCA 1R77A 4BE0A 4HVUA 2LRQA 1CKAA 2EBPA 2EYQA 1BI1A 4OB2B 3X28B 4KULA 4EMKB 2A28A 2A08A 1N8RU 2ZPIB 2DXTA 3G71T 1UGPB 1D0YA 4RTUA 4C5HA 4J6YA 4RKUE 4M7AE 1O9SA 2J6KA 5FU6C 3JCMg 3OYHA 4FSSA 3ZL7C 3C4SA 3UF4A 2GF7A 1QVGA 5CQXA 2L5QA 3EGUA 4PNOA 5GAN2 3HFNA 1KQSP 2HKNA 1YNZA 3L2RA 3G1JA 2QGGA 3FIFA 3TQ7P 5IXBA 3M0TA 4M78B 1K0SA 1B34A 3JCMe 1IGQA 1M3AA 3HHTB 4QVCA 2BTTA 3EFRA 3M0UA 2FYKA 3DLLA 2SEMA 1BU1A 1WLPB 5GANj 2RQVA 1DJ7B 1ZHIA 4PFZA 5GAN7 1BI3A 2M9UA 3H8ZA 3CC7A 3S3MA 1M8VA 1PNJA 3RBBB 3VS4A 1YHQA 2CSIA 1Q86U 4LUEA 5GAMh 2VASA 2RJEA 3JB9J 4F7UG 2KK4A 3M57A 1N9RA 3H0IA 1JQQA 2MMPA 4HKEA 2VXEA 2DRKA 3PFSA 2OX7A 5CKHA 3INZA 1PD0A 1KQSS 2XHCA 4F14A 2RMOA 3MEWA 5KYXB 4X34A 2ROTA 2DA9A 5GAOl 3WVEB 3V8LA 1BCOA 3HPWA 2LVMA 5CK9A 5LJ5f 3BFMA 1MUZA 3CBPA 1W2BA 2QAZA 1VQ6A 1S1NA 2E64A 3G71Q 2O88A 3CCRA 4M7DB 4JRIA 1VQNT 3CCMT 3CD6T 1AWXA 1QVFA 3TSWA 2EPDA 2KRNA 5GMKe 2MOXA 4J83A 2MWPA 1Q7YU 3R6OA 2F5TX 3NPFA 1YP5A 2RHIA 2YHTA 2YRDA 2XDDA 3J81E 3JRZA 4M77E 4ZN3A 2OAWA 2M51A 4E7IA 2IIMA 1BCMA 3LH5A 3EAEA 1K73C 3PVLA 5CKEA 5CO7A 2RF0A 2JOYA 5LJ3h 3I56Q 4FL6A 2VYTA 4RTZA 2PNIA 2LCLA 1OU8A 2DL8A 2QTXA 2EGCA 1GFDA 2CP6A 3LWIA 4DBRA 1ZSZA 5FRNA 4M77C 4XTWA 2HQXA 2NWMA 1TUGB 3OQ5A 2QASA 1AOJA 3EG0A 2QA4T 1JO8A 3L42A 2GBQA 1QVFP 1IXDA 5A0GA 1KC8R 2ED0A 2QQRA 4NS5A 2JTFA 3GLXA 2P84A 3LGFA 1M2VB 4E7ZA 1QKXA 1SPKA 4M75B 4D6WA 3JCMh 4AFQC 2CUDA 4CC4B 4ZNXA 2FRWA 5GAOq 4RUGA 2MPXC 3QZ5B 5GANf 3NFCA 5IN1A 4PL6A 1Y0MA 4OMNA 1H3HA 2P4TA 1EFNA 1WHJA 1VQPA 2PQWA 1NYGA 1ZUKA 1PHTA 2ZGWA 4MZPA 5FLXE 1X6BA 2NUTB 3KFVA 2I2LA 3P8HA 2E41A 1YI2A 4MZTA 4FYWB 2YXYA 1GBQA 2E1HA 2LZ6B 2EQMA 1T0HA 4GY5A 2DL7A 4LDVA 3RKXA 1WQ7A 2DX1A 1D1BA 4Z88A 4XU0A 4IIMA 2OAUA 3CD6A 4M7DE 4HCCA 3CC2A 4J9EA 3A5ZB 2DBKA 1BI2A 4E7KA 2X35A 3I35A 4RCCA 5AYFA 1ZUYA 4NOYA 2K5IA 2BZYA 4F16A 1QVFS 1JXOA 1G83A 4DBHA 1YHQQ 3AHUA 2CUBA 1SSHA 2F2XA 2CDTA 4QT7A 1KJWA 5GAMf 1Z9ZA 2RJDA 2OJ2A 1OYXA 5KYWB 2COYA 5D6WA 3G4SA 4M7DF 2LCSA 1VQKA 2JN0A 4J7IA 4KUIA 3JCMd 4M75G 3CMEA 4JZ3A 4B6MA 4ZGJB 1KQSA 2RQUA 4HXJA 1Y7XA 2KBTA 2XU8A 5FWBA 5IT9E 1WI7A 1YCYA 1UGVA 2F69A 2DZCA 2VKNA 3CC4Q 3N5BB 3DB4A 5CAIA 3CC7T 2BIVA 3MHXA 4N0AC 4R55A 2DK3A 3BE3A 2KRMA 2EQIA 4C8QE 3CCQT 4JLGA 3M55A 3E2UA 4BACA 1P92A 1M4ZA 1LCKA 2CT4A 1K76A 3JB9G 2DXCA 1GCQC 3SDZA 3VS3A 4MMLA 1VQMA 2L0AA 4GLMA 1VQ7Q 2PUOB 2YLBA 5LJ3g 1XOVA 2OTJT 3GBQA 4QQ6A 3QZ9B 3SWNC 3OYBA 4DQ2A 2IG0A 3FC3A 2YDLA 2YUOA 2K57A 3PVQA 4BY6B 4PJOC 3REAB 4M7AG 4ORZA 3CPWP 5A0LA 3MP6A 1U1SA 1OULA 5GAOm 2D6FA 1VQPT 4RTVA 4O6JA 5DLQE 4XAXB 5CKDA 4JRKA 3LLRA 2EYXA 3G71A 3KUFA 2AKLA 3L2VA 1VQKT 5M9OA 3SB2A 1QVGS 2XIDA 5J26A 3HRUA 2I0NA 3QPHA 5LL6S 2AT1B 4WCIA 1JJ2A 4PJOE 1IZ6A 3NHNA 4OB0B 2K79A 1U3OA 2DEUA 4HT8A 1TSFA 3JV3A 1Q82R 2XKOC 2FRYA 2RQWA 2AHJB 2NUPB 4C8QC 4CRIA 1D3BB 3CCUA 4C8QB 2A3LA 1CKBA 4KGVB 3JCMV 1GBRA 3CC2T 2XD0A 3QWYA 1N5ZA 3JCMW 2K5LA 2CKKA 2A7YA 2D9TA 1S72T 2MK5A 1C1AA 5LJ5g 3CCEQ 4ZGEB 2XICA 1G3TA 4QVDA 4C5EA 1R0CB 4OP0A 3CC2Q 1X6OA 2VXFA 1KHIA 1YJ9Q 2GNCA 1HD3A 2DVJA 2GTOA 3RKYA 3HKSA 2HCKA 1FX7A 1WQWA 2O01E 3GNGA 4RTTA 2KRSA 4L59A 5GAOn 4A4EA 4EMGA 2RN8A 4DOVA 1YITT 4ZTJA 2IPOB 2LNHB 1M1FA 4PFOA 2LCCA 2OTLT 3EGDA 4F7UB 2KI7A 4FYVB 2BE9B 1WJRA 4QQDA 3FB9A 4M7DC 5HCKA 2JNGA 1AWWA 4BE1A 3PGGA 1K73U 1SHGA 3EGXA 3Q1JA 4J9CA 4RMOA 2PVOB 4A53A 1PRLC 1BIAA 1EX4A 3MPUB 5GMKj 4OMQA 2M1HA 2FZCB 3MKDA 1FMKA 1JB0E 3I9QA 2QA4Q 1ABQA 1ZA2B 2P4RA 4AMCA 3P8DA 3OS2A 1RADB 3KXTA 1V76A 2HQHA 4M7AF 5EC7A 3CCST 1IB8A 2HL5C 2KT1A 2YUNA 2MF2A 4FT2A 3CD6Q 4PJOD 1MV0B 1NE8A 3X24B 4M75F 3MCAB 5KYXA 2MIOA 3IQLA 2FPFA 5GAMe 4ZTFA 2G6FX 2O9VA 4JJDA 4OF1A 4PJOG 2VC8A 3ZFJA 3KBGA 4M77A 1NLPC 1CSKA 3M0PA 2NUPA 3CCRT 4C0DC 1RI0A 1BIBA 2OTJA 4A4FA 5IXFA 3PIPA 1VQ4A 2C0IA 1U5SA 2VB6A 2K5FA 2DYBA 1VQMT 1RAHB 2ENMA 2QDYB 2BE7D 3OS5A 2FL7A 2COZA 2ZPHB 3RIRA 2V8IA 2EFIA 4M77G 1LNXA 2HQEA 2JM9A 4ZN1A 3RR6A 1LVKA 2FVUA 3M0SA 2GFUA 2BKDN 4ELYC 3QYHB 2GQIA 3FDRA 1B34B 2KNBB 2CZ1B 3REBB 2LX7A 3U23A 4LDWA 4IUTA 4IUPA 2EJ9A 1IREB 4BDYA 2J05A 3SWNA 1K9MC 5CCAA 2M02A 4F7UA 2WSEE 4E47A 2A36A 3ASKA 3OYNA 2DFUA 3E9FA 3OYYA 1TH7A 4M75E 1K1ZA 1UG1A 3JB9D 2X4WA 3MP1A 2CZ7B 3CMAA 1V1CA 1WJSA 2DYIA 3JSCA 3P8BB 3VYHB 3V7CA 3SEMA 4N0AA 5GAN3 2BZ8A 3TEEA 1ARKA 3VUZA 2KROA 1AWJA 4UC4A 1QVPA 1N6AA 1VYVA 4FT4A 3O5ZA 2RNAA 4K11A 2DJQA 4FYYB 4KH1B 2YRCA 2DVEA 3CCJQ 1WXUA 1MGQA 4E7HA 2XK0A 2RJCA 2ZPGB 1M2VA 4PJMA 1X2KA 1VQLA 2RK1A 1YIJT 5IHKA 2FG0A 2MYSA 2Y4XA 1OEBA 4BE2A 1K4US 2E10A 2M0YA 2E3HA 2X4XA 4DEXA 5LJ5j 1KQ2A 2H8HA 1JBMA 4ME7A 3URGA 2QQAA 4ESRA 1VQLT 1M27C 2AZSA 4JUVA 3CCET 3SHWA 2RQTA 2X3XD 2RH2A 4V2SA 2XG8D 2DPPB 1YWOA 1MMAA 2CGHA 5GMKi 2ROLA 1Z9QA 5GAMd 1IO6A 3M59A 9ATCB 1M1KC 1EZZB 1PCXA 1W70A 1PM3A 3EG1A 3S6WA 5EG2A 3A1PA 3SWNB 2LNVA 3S3OA 3BY7A 1MHNA 2JS0A 4BY6C 1JRIA 1OZ2A 5GAOp 3CXCS 4N4HA 2EGEA 1U06A 1K8AC 4C0ZA 2PU9B 5KYYB 2D0NA 2PVDB 2MWOA 3FLGA 1WHLA 1WDXA 1SRLA 3CCRQ 1Q81C 1PG5B 1QVGP 2A0FB 5FU6B 4DBFA 1YHQT 3QBYA 3CCMQ 4OMFB 4X9CA 1WIEA 4B9WA 4KRTA 1TOVA 2VWFA 2VV5A 1MMDA 3PMTA 3GPLA 4C0GA 2CZ0B 3V7RA 2EIFA 2RI3A 1KG1A 3J80E 3CPWS 4J8OA 4L5GA 1ZA1B 2FO0A 2E6ZA 2JT4A 2YT6A 4XU2A 1M3BA 5CVIA 1QLYA 3JCMf 2K7AA 1X69A 3L2UA 1HSQA 4PLLA 4DA4A 1BYMA 1ABOA 1RABB 1H3ZA 2M0OA 2FPEA 1VQLQ 3CCLT 1T3SA 2QGFB 2JZ2A 2MAMA 3OMGA 3RNJA 5D7UA 2VGNA 1IRXA 2J7IA 1KC8U 3HP9A 3OW2A 2FHDA 1G8XA 5IH2A 1Q7YR 4DEYA 3LH0A 4AG2C 2DXBA 2DTHA 3VS6A 1UB4A 1GXIE 3EGXB 4EMKC 4R56A 1MMGA 2O4XB 3WXMB 2AIRB 1VQ9A 4II1A 1D1CA 1K9AA 3OYDA 1AWOA 1K0XA 3E9GA 1Y57A 5HK0A 2KR3A 4JJCA 5LJ3f 2V8KA 2QEXT 3X20B 1UUEA 5GMKh 4A54A 2DIGA 3AT1B 2JMCA 4AFSC 1YIJQ 5KYUB 1VQOT 3VS2A 4M77D 3RUXA 1OX8A 1GCQA 3LGLA 3NMZC 3E19A 1V29B 3H9NA 4M7DG 1YN8A 2JW4A 4J5YA 4Z02A 1VQ6T 1UGSB 4F7UE 3FRNA 4Y91A 4JRQA 4XU1A 4QW2A 5GAOr 1QP2A 2RA2A 1TUCA 1TU0B 1X6GA 2DERA 1RAIB 2A37A 2YLCA 4P5NA 4BI4A 3CMET 2L3SA 3EFOB 1SRMA 3VV0A 1R0BG 4X9DA 1RACB 5C6SA 1KQ1A 2R5AA 2V8JA 1VYTA 2V1RA 3UPUA 4D8DA 4KT0E 2RJFA 1NLOC 2L89A 5CIUA 3M53A 2CP5A 4JS4A 1ZSZB 2M16A 3EG9A 3F70A 3VUBA 2RHXA 4M78D 1OOTA 1SSFA 4C0DB 1VQPQ 4GLKA 4N4GA 3O8VA 3CCMA 1UJ0A 3HRSA 4QKUA 1LJOA 2P0KA 4J9BA 1K73R 1VQ5Q 4PKCC 3I55Q 1GFCA 1SEMA 3OA6A 1X01A 1M9SA 5J3BA 3RESA 2RHZA 3PNWC 3UWNA 1NG2A 2JTEA 2RM4A 3HRTA 2KQWA 3JAME 1N8RC 1NEGA 4CC7A 2DTIA 1YITQ 2LMJA 1NM7A 2RO0A 2ABLA 2DL4A 2WSCE 5GANh 4LN2A 5DY9A 4BD3A 1VQ7A 3G6EQ 3SFMA 4RTXA 2PUKB 1QP3A 2PZ1A 4A4KA 3OW2S 1IHWA 5D6YA 1RI9A 3VU3C 1U8RA 2KEAA 2O4XA 1KIKA 3RMQA 2LQNA 4PJNA 2GTJA 1B3QA 1JU5C 1S72Q 3X26B 4EIKA 1K8AU 1VQ8T 2KY9A 3LX7A 5A2QE 1WJQA 3QKJA 4ELZC 3G6ET 4C92B 5GANg 3JCMP 2LQWA 1UJYA 4LUDA 5LJ3j 3RDVA 1MV3A 2CP0A 1YI2T 3EHRA 4CC2A 2QEXQ 2K4YA 4RCBA 2FZKB 2HL3A 3CCQA 4J9IA 2W0ZA 3H41A 1PKSA 1YJWQ 4HCZA 3GF5A 3M5AA 3CCJA 3DLMA 4Z8AA 5KYNA 1UGQB 1VQMQ 4C8QA 4OMPA 1UECA 3CXCA 1XJWB 1PRMC 2PTKA 2HD0A 1UE9A 2L3PA 1VQOQ 1IHVA 3L2WA 1X43A 4OMMA 4DBQA 1KD1R 2EAYA 4C92F 1YBYA 1VQ5A 1YJWT 2FEIA 2QK0A 2JVVA 3A8LB 2KT8A 3VS0A 5D6XA 2WACA 1UHFA 4O5VA 1Q82U 2C06A 5L8RE 1ZBXA 2E3IA 3GP8A 1YJ9T 3CEYA 3G4SQ 4PJLA 3QIIA 2D0QB 2ECZA 1AZEA 2CZ6B 1M1KR 3BW1A 1VQ8A 1I8FA 1KFZA 1RLQC 1HK9A 2DZ9A 1RL2A 2LX9A 4HVWA 2RQRA 3NTKA 4M7AD 1R8OB 3WVDB 2LT4A 2L8DA 1T3LA 3M0RA 2QEXA 1BI0A 1VIEA 2ZPFB 4JJBA 3TU4K 5IHIA 3JCMb 3TCJA 1H8KA 1ZLMA 4PJOB 2QQ9A 3CBOA 3PE0A 1NJIU 1T0JA 3CXCP 2RI2A 1UHCA 1QW1A 2DXUA 2EJGA 3META 1YJNQ 3ZEHA 3OYIA 2X4JA 5GAN6 3GOXA 3OS0A 4E7JA 1M90R 1WFWA 2R5MA 1AT1B 5DLOA 3PIOA 1Q86C 3I55T 2G3RA 4JDSA 4BDZA 4JRPA 2WSFE 1A0NB 2IVWA 4XQ3A 4F7UF 1W1FA 1M8MA 3S3NA 5GMKl 3CMEQ 3MP8A 2K3XA 1D3BA 4MDXA 1ZSGA 3A8MB 3QG1A 3QDFA 2Y90A 4ZGDB 2BZXA 1Y96A 1UGRB 2NUZA 3I56A 1TG0A 2EKOA 1VQNA 2YUQA 4RG8A 4CC3A 2DILA 1Q86R 5AT1B 2R57A 2DD5A 3M54A 3OMCA 3E1SA 1PWTA 1WXTA 1TUDA 1PC0A 4J6WA 1X75C 2O2OA 2LJ0A 1RAFB 2CP3A 2KYMA 2EGAA 3R6NA 3EFOA 2E70A 2C0TA 1LOJA 1SG5A 1G3WA 4EMHA 1B07A 1YWPA 1VQ4Q 3DB3A 1H641 3A8OB 4FM4B 1ZUUA 2K6DA 3QUIA 1WYXA 5GJWB 1VQ6Q 2J6OA 2LQ8A 8AT1B 2RHUA 3H0FA 1NYFA 2CREA 5KE2A 2YRVA 4TVRA 1AVZC 2JM8A 2KXCA 3C95A 3CCVT 4MDWA 5KH6A 1PKTA 2DE0X 4PLIA 5LJ3d 1J3TA 1JEGA 2ZAEA 1BB9A 4M7AA 6AT1B 2EWNA 4E7SA 1NBEB 1C6VX 3EH2A 1SHFA 2VUBA 2Y4YA 2L3QA 3CMAT 2V1QA 3MJXA 2J6FA 3MEUA 1WGSA 5LJ3e 3HTRA 5GMKm 4JPBW 1WHKA 2DNUA 5DM7R 1QMCA 4LDUA 1ZBJA 2KE9A 2JUFA 3TREA 4BUGA 1GRIA 1O75A 4QVZA 4VUBA 3PTAA 1ZSZC 4Y92A 2DIQA 5FW9A 1W6XA 2XMFA 4GBQA 3V7SA 2DM1A 4IKFA 4IUUA 4FIBA 3OYAA 3PMIA 1KC8C 1VUBA 4J9FA 4C92A 4R0KA 4X1VA 2NYSA 1M1KU 1W2BP 3GIBA 1TS9A 2K9GA 3ULRB 1VQOA 2ZCFB 4KGXB 1QWEA 2HAXA 2EYZA 3QHSA 2OTLQ 4C8QF 1AEYA 3FJPA 5KYUA 1E6GA 3TVTA 4M75C 4HT9A 2EW3A 4C92G 3EG2A 3CQTA 2X51A 1RUWA 1YJWA 5C0MA 2ZZDA 2QQSA 1YITA 1MMNA 4ATOA 3QO3A 1M90C 5IAYA 4M75D 4E2FB 5J39A 3L2ZA 1LPLA 3NTHA 2ZPBB 1VQ9T 1RLPC 1X2QA 5I21A 2D8HA 2LJ1A 1OU9A 1KSWA 3CCLQ 1VA7A 5LJ5e 3A98A 1WXBA 2DO3A 2COWA 3M0QA 4FW2A 2DL3A 4C92C 1XTDA 2CP2A 2CP7A 2DMOA 2H3EB 4IURA 2OI3A 2JJ9A 2KMTA 5CQYA 4LDYA 2K2VA 3OBWA 2ZPEB 2CYZB 3G7ZA 2DAQA 3CCEA 3VRZA 5I11A 1VQ4T 2RK2A 3UATA 4OB1B 1TWBA 4BB7A 5FU7C 3M4YA 1UEBA 1EIFA 1FXXA 4FW1A 1OV3A 1YJNT 4OMOA 3QSUA 3OY9A 2LT1A 4ANJA 4LNPA 3CCUQ 2GCXA 4XTUA 1ACMB 1I07A 4Y28E 5KE3A 5I2MA 4LXCA 4M7AC 3QDRB 2B8AA 4M7AB 1OX9A 4J9DA 2HSPA 1NZ9A 3T9NA 2X9HA 1YIJA 1NEBA 3CC4A 1JJ2P 5KYYA 1M90U 4KBMB 2VVKA 1WHMA 2F1LA 5L23A 5KCHA 4C92E 2EJFA 1KD1C 3EH1A 1K9MR 3V8KA 1I4K1 3ZBDA 4J6XA 3JB9I 4M7DA 4RTYA 2DRMA 3M9QA 1OQKA 4QQGA 1GCPA 5GAN4 4E6RA 1Q81U 2E5QA 3VS5A 1AHJB 4RG2A 5IHNA 1VQ9Q 2KVQG 1MNEA 1BBZA 2D8JA 2K3YA 1N8RR 2HKQB 1WZOA 2OTLA 4HVVA 1Q95G 1HJDA 2LJ3A 5HKCA 1RAGB 2DJZA 4JZ4A 1VQNQ 2KYBA 4C8QD 4IIOA 3M56A 4LE9A 3TSZA 2XDBA 1OI1A 1Y07A 2RI5A 1UTIA 3OYEA 1PD1A 2E4HA 2VGMA 5GANe 3RERA 4F04B 3RKWA 3H0HA 1JJ2S 3HL8A 2E65A 4BI3A 1YI2Q 3X25B 4JLIA 5CKFA 2DETA 2RB6A 5KCOA 3DKMA 1D0XA 2K3BA 3OYFA 4PJJA 2F5KA 2CH4W 3D7SB 4OGEA 1QCNA 3OS1A 5HK3A 2KXDA 4D8KA 5ECAA 1WPYA 2C0OA 1QCFA 2CH4A 1FWZA 4XTYA 4EDUA 2QG9B 5FROA 3I5RA 2F2VA 3OBYA 1M3CA 2HMAA 4OGCA 2R58A 3UT1A 4CI0C 3GNFB 1AD5A 3OYLA 1FMWA 4WTOB 4PK4A 3CPWA 4A4GA 2O9SA 1I5OB 4J9GA 3CCVQ 3OYCA 3HFOA 2QYZA 1M5Q1 3M4GA 3JB9H 1OPLA 1YFNA 1KD1U 2FB7A 4WF2A 1Q7YC 3VYGA 2EQKA 2FZGB 2GQVA 2JS2A 2HZYA 1NJIC 5GAMg 4MZMA 3QJYA 1IGUA 4M78C 3UA7A 1M30A 2D1XA 3ER0A 4EMKA 2LDMA 2SRCA 4BI8B 4JS5A 2YSQA 3C94A 2CT3A 4HCKA 3UDCA 3EFSA 3LWHA 1QCOA 4C5IA 3OYGA 4C5GA 4A63B 5LJ5d 2JTMA 2HDAA 4KH0B 2HNIA 2DD4A 1WNLA 1QWFA 4LDXA 1X27A 4Q5WA 3JCMc 2EKHA 4AG1C 2RPNA 1WHGA 2MCNA 1F1BB 4M78E 4FU6A 1NPPA 2CS7A 8ATCB 2DL5A 2W10A 2KDSA 5CKBA 3OYKA 1I1JA 1I0CA 3RMSA 4KUDK 2QI2A 1MNDA 4KGZB 3EG9B 3A8HB 2J06A 1I81A 1Q82C 5KYWA 4FSXA 3CCUT 2MI6A 2KAFA 1W2BS 2F2WA 3FJ5A 1YJNA 2E5KA 1S72A 3CCJT 2RD1A 3ME9A 2JXBA 3UA6A 4AT1B 5CR2A 1K9MU 2DBMA 2DLPA 3JCMX 3VKIA 3CPFA 4A4HA 4F17A 2KGTA 4OVAA 3OSSC 1VQKQ 3CCSQ 3MO8A 2ESWA 1RAAB 5I22A 1D0ZA 4XK8E 3EHQA 2HSEB 3JCMQ 1VQ5T 5FWCA 2NUTA 2DKGA 1HYOA 3CC7Q 3CC4T 1VQ8Q 3BDLA 3CCQQ 4LD9K 1M2OA 4M7DD 1H92A 3A8GB 2YWWA 1UDLA 5LJ5h 3FEOA 4Z89A 3CCSA 2AK5A 2EVRA 3QWXX 2FPDA 1FYNA 2KSSA 3I55A 2Z0WA 3VS1A 2DTOA 1ZQ1A 1BKBA 2DEQA 3OSVA 2QQBA 1NPRA 2NLUA 4M4ZA 3M58A 5I2SA 1FMVA 3CMAQ 2OTJQ 3G4ST 2XDPA 3H6ZA 4E7LA 1W4SA 1G2BA 4DOWA 1D1AA 4RTWA 5GJVB 2ED1A 1OPKA 1QQJA 3CCVA 2RHYA 5HY6A 4M77B 3I56T 2GGRA 3JB9F 3OB9A 2P0QA 4NL3A 2P0PA 5GANd 4M78G 4J9HA 5FU7B 2YUPA 1PSEA 1G3YA 3LYIA 3JCMJ 4YTLA 5A0DA 3HSBA 4JJNK 3BDUA 3NTIA 2LC4A 4IUQA 4XTZA 2X3WD 3VS7A 2CSQA 2EQJA 1AZGB 1WA7A 1OZ3A 4HCBA 2QTVA 1Y71A 2JMAA 3L2QA 3C12A 4M78A 3OYMA 1N27A 1B7TA 4L6V5 2HEQA 4AFUC 1VQ7T 4IUVA 3LW5E 3VRYA 1RAEB 1XNIA 3THKA 4FYXB 4LD6A 1NJIR 1XQHA 3MEVA 4OB3B 4M77F 3MEAA 1YCSB 2PVGB 1KHCA 4PJOA 2L2PA 2LQKA 4N4IA 3CBMA 1E7OA 2GFAA 1SKUB 2BUDA 2X4YA 4M75A 3EGDB 1C0MA 3G6EA 2E12A 1Q81R 3SD4A 5GAMj 1E6HA
chains in the Genus database with same CATH topology
3PT9A 4J7FA 4JRKA 4MMKA 4HA8A 1VIFA 2HBPA 3LLRA 4C8QG 1YJ9A 4M7DG 3G71A 3KUFA 4J5YA 1VQKT 4Z02A 3L2VA 5M9OA 3OYJA 1VQ6T 5LJ5e 3SB2A 4XTVA 1UGSB 2DO3A 4F7UE 3FRNA 4Y91A 1QVGS 4JRQA 2H3JA 2XIDA 4QW2A 4XU1A 5GAOr 1QP2A 2RA2A 5J26A 3V8JA 4XTXA 2QA4A 1G5VA 1G3SA 3HRUA 3QPHA 5LL6S 4C92C 1XTDA 1JJ2A 4PJOE 5GAN8 4XU3A 1IZ6A 2YLCA 4P5NA 1HXDA 3QXEB 4OB0B 4IURA 4BI4A 3CMET 2KMTA 1Y96B 3VV0A 1I5LA 4HT8A 3L1AA 4X9DA 1PSFA 2XKOC 4LDYA 2K2VA 5CQYA 5C6SA 1KQ1A 3OBWA 2R5AA 2V8JA 2CYZB 2ZPEB 2AHJB 3G7ZA 4C92D 1M1GA 4C8QC 4CRIA 2DAQA 1D3BB 2LTOA 3CCEA 3CCUA 4C8QB 3UPUA 4KT0E 2A3LA 2QXFA 2L3RA 2RJFA 2RK2A 3QJ6A 3VJPA 4B9XA 4OB1B 1VQ4T 2L89A 4BB7A 5CIUA 3M53A 3JCMV 5FRMA 5FU7C 4JS4A 3M4YA 1UEBA 3CC2T 1EIFA 1FXXA 3J7AF 2M16A 3F70A 2XD0A 4PJOF 1YJNT 3VUBA 2RHXA 3JCMW 3QSUA 3OY9A 2K5LA 2CKKA 2LT1A 4M78D 2A7YA 2D9TA 1S72T 1SSFA 4C0DB 4GLKA 5LJ5g 2GCXA 4N4GA 3O8VA 4XTUA 4ZGEB 2XICA 4C0FA 5GAN5 2E6NA 2XI9A 1G3TA 3HRSA 3CCMA 2EQUA 4NL2A 1LJOA 4Y28E 4C5EA 2P0KA 4QVDA 5KE3A 4PKCC 5I2MA 4OP0A 1U1TA 1X6OA 2VXFA 4M7AC 3QDRB 1KHIA 3J81E 3CCLA 2B8AA 4M7AB 1N9SA 3RKYA 3HKSA 3OA6A 1X01A 1M9SA 4M78F 5J3BA 3RESA 1FX7A 1WQWA 2O01E 3GNGA 2RHZA 3QYGB 4L59A 5GAOn 4A4EA 3PNWC 1NZ9A 4EMGA 3UWNA 3T9NA 4DOVA 4EPCA 1YITT 1YIJA 4BE0A 4ZTJA 2LRQA 3CC4A 2RM4A 2EYQA 1M1FA 2KQWA 3HRTA 1BI1A 3JAME 1N8RC 2LCCA 4OB2B 1M90U 2OTLT 2DTIA 4KBMB 4F7UB 3X28B 4KULA 2RO0A 4EMKB 1N8RU 2WSCE 2ZPIB 5GANh 5KCHA 4C92E 1WJRA 2DXTA 2EJFA 4QQDA 3FB9A 5DY9A 4BD3A 3G71T 1KD1C 1VQ7A 2JNGA 4M7DC 3SFMA 3V8KA 1I4K1 1UGPB 4J6XA 3ZBDA 2PUKB 1QP3A 4J6YA 4RKUE 4A4KA 4C5HA 3JB9I 3OW2S 5D6YA 4M7AE 3VU3C 1O9SA 4M7DA 1U8RA 5FU6C 3JCMg 3OYHA 2O4XA 3M9QA 3RMQA 3PGGA 4BE1A 1K73U 4QQGA 3C4SA 3Q1JA 4RMOA 2PVOB 4A53A 5GAN4 1BIAA 2GF7A 1Q81U 5GMKj 2E5QA 1AHJB 2M1HA 4RG2A 1QVGA 5CQXA 3X26B 2KVQG 1K8AU 2L5QA 1JB0E 4PNOA 1VQ8T 2K3YA 5GAN2 2KY9A 3HFNA 3LX7A 5A2QE 3OS2A 3P8DA 3L2RA 2OTLA 1WJQA 3FIFA 3QKJA 4ELZC 5HKCA 4M78B 2DJZA 3KXTA 3G6ET 4C92B 5GANg 3JCMP 4M7AF 4C8QD 1B34A 3JCMe 3CCST 3M56A 2XDBA 5LJ3j 3HHTB 4QVCA 1OI1A 1Y07A 3EFRA 2RI5A 2MF2A 4FT2A 3OYEA 1YI2T 2FYKA 3DLLA 1NE8A 2VGMA 3X24B 4M75F 5GANe 3RERA 4PJOD 2K4YA 4RCBA 3RKWA 3MCAB 1JJ2S 3CCQA 5GANj 3HL8A 5GAMe 2E65A 4ZTFA 1DJ7B 4BI3A 1ZHIA 3CC7A 5GAN7 1BI3A 2M9UA 3H8ZA 4HCZA 3S3MA 3GF5A 3M5AA 3CCJA 1M8VA 4OF1A 4PJOG 2VC8A 3ZFJA 3KBGA 1YHQA 4M77A 3X25B 3DLMA 1Q86U 1UGQB 4JLIA 4C8QA 3CXCA 5CKFA 5GAMh 2RJEA 3JB9J 4F7UG 3CCRT 2KK4A 2RB6A 5KCOA 4C0DC 3DKMA 1RI0A 1N9RA 3M57A 1BIBA 2HD0A 2OTJA 3OYFA 4A4FA 3PIPA 1VQ4A 2F5KA 2MMPA 4HKEA 2VXEA 2K5FA 1VQMT 4OGEA 3OS1A 3L2WA 3PFSA 5HK3A 2QDYB 5CKHA 3INZA 3OS5A 2FL7A 2EAYA 1WPYA 4C92F 1YBYA 1KQSS 1VQ5A 2ZPHB 3RIRA 2XHCA 1YJWT 2V8IA 2EFIA 4M77G 2JVVA 1FWZA 3MEWA 4X34A 3A8LB 1LNXA 2HQEA 4XTYA 4EDUA 5GAOl 5FROA 3WVEB 4ZN1A 5D6XA 2WACA 3HPWA 3V8LA 2FVUA 4O5VA 2LVMA 5CK9A 5LJ5f 2GFUA 1Q82U 2C06A 3BFMA 3OBYA 3CBPA 1W2BA 2BKDN 5L8RE 4ELYC 3QYHB 1VQ6A 1ZBXA 3GP8A 4OGCA 2E64A 2R58A 3FDRA 3UT1A 1B34B 1YJ9T 2CZ1B 3CCRA 4CI0C 3CEYA 3GNFB 3OYLA 3QIIA 4M7DB 4LDWA 2D0QB 4IUTA 4JRIA 2CZ6B 2EJ9A 4IUPA 1VQNT 1IREB 3CPWA 3CCMT 4BDYA 3CD6T 3BW1A 4A4GA 1VQ8A 1I8FA 1QVFA 1HK9A 3SWNA 3OYCA 3HFOA 1K9MC 5CCAA 2DZ9A 5GMKe 1RL2A 1M5Q1 2LX9A 4F7UA 3NTKA 4J83A 2MWPA 2WSEE 4E47A 1Q7YU 3ASKA 2F5TX 1R8OB 3M4GA 3R6OA 3OYNA 4M7AD 3WVDB 3JB9H 2LT4A 3E9FA 2RHIA 3OYYA 2L8DA 1KD1U 1TH7A 4M75E 2YHTA 2FB7A 2QEXA 4WF2A 1Q7YC 1BI0A 2XDDA 3JB9D 1VIEA 2X4WA 3JRZA 2ZPFB 2EQKA 3MP1A 4M77E 3VYGA 2CZ7B 2GQVA 4ZN3A 3CMAA 4E7IA 3TU4K 1NJIC 5GAMg 3JCMb 3TCJA 1WJSA 3EAEA 3QJYA 4MZMA 1K73C 3JSCA 4PJOB 3P8BB 2QQ9A 4M78C 5CKEA 3CBOA 3VYHB 5CO7A 3ER0A 3V7CA 1NJIU 2JOYA 4N0AA 2RI2A 5LJ3h 4EMKA 5GAN3 1QW1A 2LDMA 2DXUA 2EJGA 3TEEA 4BI8B 3META 3ZEHA 3OYIA 4JS5A 2X4JA 5GAN6 3GOXA 4FL6A 2VYTA 3OS0A 3C94A 3VUZA 3UDCA 4E7JA 2LCLA 3EFSA 3LWHA 4C5IA 3OYGA 2R5MA 4UC4A 1QVPA 1N6AA 2QTXA 4FT4A 4C5GA 5DLOA 5LJ5d 3PIOA 1Q86C 3I55T 2JTMA 2DVEA 2HNIA 3LWIA 2G3RA 2DD4A 4JDSA 4BDZA 1WNLA 4JRPA 2WSFE 4LDXA 5FRNA 4M77C 2IVWA 4Q5WA 3JCMc 4XTWA 1MGQA 2HQXA 4XQ3A 4F7UF 3OQ5A 2XK0A 4E7HA 3S3NA 2RJCA 5GMKl 2ZPGB 3MP8A 4M78E 2K3XA 1VQLA 1D3BA 4FU6A 1NPPA 2QA4T 2CS7A 4MDXA 2RK1A 1YIJT 3A8MB 3QG1A 2KDSA 2Y4XA 5CKBA 3L42A 2Y90A 4ZGDB 1Y96A 1UGRB 3OYKA 2E10A 4BE2A 3I56A 2X4XA 3RMSA 5A0GA 2QI2A 4KUDK 2EKOA 2QQRA 5LJ5j 1KQ2A 4NS5A 2JTFA 3A8HB 3GLXA 1JBMA 4ME7A 1VQNA 3LGFA 1I81A 4RG8A 3URGA 2QQAA 1VQLT 1Q82C 5CKDA 2R57A 2DD5A 3M54A 3OMCA 4M75B 4D6WA 3E1SA 4FSXA 4JUVA 3JCMh 3CCUT 3CCET 2MI6A 2KAFA 1W2BS 1YJNA 1S72A 5GAOq 4J6WA 1X75C 2RH2A 4V2SA 2XG8D 2DPPB 3CCJT 2RD1A 3ME9A 2CGHA 3QZ5B 5GANf 3NFCA 2E70A 5IN1A 5GMKi 4PL6A 1LOJA 1G3WA 4EMHA 5CR2A 1K9MU 2P4TA 5GAMd 3JCMX 3VKIA 1VQPA 3CPFA 3DB3A 3M59A 4A4HA 1H641 2PQWA 1M1KC 3OSSC 4OVAA 2ZGWA 3A8OB 4FM4B 4MZPA 3MO8A 5FLXE 3QUIA 2QEXT 3S6WA 4XK8E 5EG2A 3SWNB 3JCMQ 2LNVA 2I2LA 3S3OA 3BY7A 3P8HA 1MHNA 2E41A 4BY6C 1VQ5T 1JRIA 1OZ2A 4MZTA 1YI2A 2DKGA 2LQ8A 2E1HA 5GAOp 2EQMA 3CXCS 4N4HA 3CC4T 4GY5A 1K8AC 2RHUA 4LDVA 3RKXA 4C0ZA 3BDLA 4LD9K 1WQ7A 4M7DD 2PU9B 3A8GB 4XU0A 5KE2A 2PVDB 2MWOA 2YRVA 3FEOA 3FLGA 5LJ5h 3CCSA 2OAUA 3CD6A 4TVRA 2KSSA 1Q81C 3I55A 4M7DE 3C95A 4HCCA 3CC2A 2DTOA 3A5ZB 1ZQ1A 1BKBA 3CCVT 2DEQA 4MDWA 3OSVA 1BI2A 2QQBA 5KH6A 5FU6B 1NPRA 2NLUA 4PLIA 1YHQT 3M58A 3QBYA 4OMFB 4X9CA 5LJ3d 4B9WA 5I2SA 2X35A 4E7KA 4M7AA 2EWNA 4RCCA 5AYFA 3G4ST 2VV5A 3PMTA 3GPLA 4NOYA 4C0GA 2K5IA 2CZ0B 3V7RA 2EIFA 2RI3A 2VUBA 1QVFS 2Y4YA 2XDPA 3H6ZA 1KG1A 3CMAT 3J80E 4E7LA 1W4SA 3CPWS 4DOWA 3MEUA 1WGSA 3AHUA 4J8OA 4L5GA 5LJ3e 2E6ZA 5GMKm 3CCVA 2RHYA 5HY6A 5GAMf 4M77B 5DM7R 3I56T 4XU2A 2RJDA 4LDUA 5CVIA 3JCMf 3OB9A 3JB9F 2JUFA 3L2UA 2P0QA 4NL3A 1OYXA 2P0PA 5D6WA 5GANd 4PLLA 3G4SA 4DA4A 4M7DF 1VQKA 3TREA 1BYMA 4BUGA 2JN0A 4M78G 1H3ZA 4J7IA 2M0OA 4KUIA 5FU7B 1O75A 4QVZA 1PSEA 4M75G 4VUBA 3JCMd 3PTAA 2DIQA 3CCLT 1G3YA 3CMEA 3LYIA 2JZ2A 2MAMA 3OMGA 4ZGJB 3JCMJ 3V7SA 4YTLA 5A0DA 2VGNA 1KQSA 1Y7XA 3HP9A 1KC8U 2XU8A 4JJNK 2FHDA 3OW2A 4IUUA 4IKFA 3HSBA 5IT9E 4FIBA 3BDUA 1YCYA 3NTIA 2LC4A 3OYAA 4IUQA 2F69A 2DZCA 3LH0A 3PMIA 3N5BB 3DB4A 4XTZA 2DXBA 5CAIA 1VUBA 2EQJA 1KC8C 2BIVA 3CC7T 2DTHA 4C92A 1UB4A 3MHXA 1GXIE 4EMKC 1OZ3A 4R56A 4HCBA 4N0AC 4R55A 1Y71A 2DK3A 2O4XB 3WXMB 3L2QA 1M1KU 3C12A 4M78A 3OYMA 1N27A 4C8QE 4II1A 4JLGA 3M55A 3CCQT 1VQ9A 4L6V5 3GIBA 1VQOA 2ZCFB 4BACA 1VQ7T 1P92A 1M4ZA 3OYDA 4IUVA 3QHSA 3JB9G 2HAXA 3LW5E 1XNIA 2DXCA 4LD6A 3SDZA 4C8QF 1XQHA 4MMLA 3E9GA 3FJPA 3MEVA 1VQMA 4OB3B 4M77F 3MEAA 5HK0A 4M75C 2PVGB 2PUOB 5LJ3f 4C92G 2V8KA 2YLBA 4HT9A 5LJ3g 1XOVA 2OTJT 1KHCA 4QQ6A 3QZ9B 3SWNC 3OYBA 3X20B 5GMKh 4DQ2A 2IG0A 5C0MA 3FC3A 1YJWA 4PJOA 2ZZDA 2LQKA 2QQSA 1YITA 4A54A 2K57A 4PJOC 4BY6B 4N4IA 4M7AG 2DIGA 3CBMA 2GFAA 4ATOA 3QO3A 2BUDA 1M90C 5IAYA 2X4YA 4M75D 4M75A 5J39A 3L2ZA 5A0LA 1VQOT 3NTHA 2ZPBB 3MP6A 1U1SA 4M77D 3RUXA 3G6EA 1VQ9T 5GAOm 2D6FA 1VQPT 2E12A 3LGLA 5I21A 3E19A 1V29B 4O6JA 3SD4A 5GAMj 5DLQE 4XAXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JRK A;  4MMK A;  4M7D G;  4HA8 A;  4M77 E;  4C8Q G;  4PNO A;  5GAN 2;  4M7D E;  3HFN A;  4J5Y A;  2DTO A;  5GAM g;  3JCM b;  5LJ5 e;  3SB2 A;  4XTV A;  4PJO B;  4F7U E;  2DEQ A;  4Y91 A;  3FIF A;  4M78 C;  5GAO r;  4XU1 A;  2RA2 A;  4M78 B;  3V7C A;  3V8J A;  4X9C A;  4XTX A;  2DJZ A;  4N0A A;  5LJ3 d;  4M7A A;  4C92 B;  5LJ3 h;  4EMK A;  5GAN g;  5GAN 3;  3JCM P;  2EWN A;  4RCC A;  4M7A F;  2DXU A;  2EJG A;  4C92 C;  4C8Q D;  4PJO E;  5GAN 8;  1B34 A;  4XU3 A;  3JCM e;  2YLC A;  5GAN 6;  4NOY A;  5LJ3 j;  3V7R A;  4QVC A;  3EFR A;  1HXD A;  3EFS A;  2FYK A;  1Y96 B;  1I5L A;  4PJO D;  4HT8 A;  2QTX A;  3L1A A;  4M75 F;  5GAN e;  3AHU A;  4X9D A;  5LJ3 e;  5LJ5 d;  3RER A;  5GMK m;  1KQ1 A;  4RCB A;  3RKW A;  2DVE A;  2HNI A;  4C92 D;  4C8Q C;  5GAM f;  1D3B B;  4M77 B;  1WNL A;  5GAN j;  4XU2 A;  4C8Q B;  5GAM e;  4M77 C;  2E65 A;  3JCM c;  4XTW A;  1MGQ A;  4XQ3 A;  5GAN 7;  3JCM f;  4F7U F;  3JB9 F;  1M8V A;  4PJO G;  4NL3 A;  2VC8 A;  5GMK l;  3JCM V;  5GAN d;  4M7D F;  4M78 E;  2JN0 A;  4M78 G;  1D3B A;  4M77 A;  3JCM d;  4M75 G;  4PJO F;  4JLI A;  4C8Q A;  5GAM h;  3JCM W;  4F7U G;  3JB9 J;  3QSU A;  2RB6 A;  2Y90 A;  4M78 D;  3V7S A;  3JCM J;  1Y96 A;  2E10 A;  1N9R A;  1BIB A;  3HSB A;  5LJ5 g;  4XTU A;  5LJ5 j;  1KQ2 A;  3BDU A;  1YCY A;  5GAN 5;  2VXE A;  1JBM A;  1I81 A;  4NL2 A;  1LJO A;  2DZC A;  4XTZ A;  4QVD A;  5CAI A;  2DTH A;  4C92 A;  4OP0 A;  1U1T A;  3INZ A;  4M75 B;  4EMK C;  2VXF A;  4JUV A;  4M7A C;  2EAY A;  1WPY A;  4N0A C;  3JCM h;  4C92 F;  4M7A B;  1N9S A;  3RIR A;  3RKY A;  1X01 A;  4M78 A;  4M77 G;  4C8Q E;  3GIB A;  4M78 F;  3RES A;  1LNX A;  1WQW A;  4J6W A;  4XTY A;  5GAO q;  4V2S A;  5GAO l;  5GAO n;  2RD1 A;  4EMG A;  3V8L A;  2CGH A;  3QHS A;  5GAN f;  3JB9 G;  5GMK i;  5LJ5 f;  1LOJ A;  3BFM A;  2RM4 A;  4EMH A;  4C8Q F;  2E64 A;  4MML A;  3FJP A;  5GAM d;  1B34 B;  3JCM X;  2DTI A;  4F7U B;  4M77 F;  1H64 1;  4M75 C;  4EMK B;  2ZGW A;  5LJ3 f;  4HT9 A;  4C92 G;  2YLB A;  5LJ3 g;  3QUI A;  4C92 E;  5GAN h;  4M7D B;  2DXT A;  2EJF A;  4JRI A;  3FB9 A;  5DY9 A;  4M7D C;  3SWN C;  4M7A E;  2EJ9 A;  5GMK h;  4DQ2 A;  4PJO A;  3SWN B;  1I4K 1;  3BW1 A;  4J6X A;  3V8K A;  3JCM Q;  4A54 A;  2K57 A;  1I8F A;  2I2L A;  3BY7 A;  2FB7 A;  4J6Y A;  3JB9 I;  1HK9 A;  3SWN A;  3VU3 C;  2E41 A;  4M7D A;  3HFO A;  4M7A G;  1JRI A;  3JCM g;  4PJO C;  2DKG A;  3QO3 A;  3PGG A;  2DZ9 A;  5GMK e;  2E1H A;  5GAO p;  4M75 D;  1M5Q 1;  4M75 A;  4F7U A;  3L2Z A;  3RKX A;  4A53 A;  5GAN 4;  3M4G A;  1U1S A;  4M77 D;  3RUX A;  4M7A D;  1BIA A;  1WQ7 A;  5GAO m;  3JB9 H;  4M7D D;  5GMK j;  5I21 A;  4XU0 A;  5LJ5 h;  1TH7 A;  4M75 E;  5GAM j;  2YHT A;  4WF2 A;  3JB9 D; 
#chains in the Genus database with same CATH topology
 3PT9 A;  4J7F A;  4MMK A;  4HA8 A;  1VIF A;  2HBP A;  4C8Q G;  1YJ9 A;  1ZX6 A;  3OYJ A;  4XTV A;  1QKW A;  2H3J A;  2QDL A;  3V8J A;  4PFP A;  4XTX A;  1UFF A;  2QA4 A;  1G5V A;  1G3S A;  2HBW A;  1VOM A;  1SF9 A;  5GAN 8;  4XU3 A;  1HXD A;  2K2M A;  3QXE B;  1KK7 A;  2AZV A;  1Y96 B;  1TXQ A;  2AKK A;  4OML A;  3L1A A;  1I5L A;  1BK2 A;  1PSF A;  2O31 A;  4C92 D;  1JXM A;  1M1G A;  1TTH B;  2DF6 A;  2LTO A;  2EYW A;  2QXF A;  2L3R A;  1VYU A;  3QJ6 A;  2V26 A;  3VJP A;  3NGP A;  4B9X A;  4FCY A;  3C0C A;  4AFZ C;  3I5S A;  1WX6 A;  5FRM A;  3J7A F;  4PJO F;  1K8A R;  2B86 A;  2EYY A;  4C0F A;  5GAN 5;  2E6N A;  2XI9 A;  2EQU A;  4NL2 A;  1WHH A;  1U1T A;  3CCL A;  2LP5 A;  3EG3 A;  1N9S A;  7AT1 B;  4M78 F;  1GL5 A;  1D09 B;  3QYG B;  3OW2 P;  2ATC B;  4EPC A;  1R77 A;  4BE0 A;  4HVU A;  2LRQ A;  1CKA A;  2EBP A;  2EYQ A;  1BI1 A;  4OB2 B;  3X28 B;  4KUL A;  4EMK B;  2A28 A;  2A08 A;  1N8R U;  2ZPI B;  2DXT A;  3G71 T;  1UGP B;  1D0Y A;  4RTU A;  4C5H A;  4J6Y A;  4RKU E;  4M7A E;  1O9S A;  2J6K A;  5FU6 C;  3JCM g;  3OYH A;  4FSS A;  3ZL7 C;  3C4S A;  3UF4 A;  2GF7 A;  1QVG A;  5CQX A;  2L5Q A;  3EGU A;  4PNO A;  5GAN 2;  3HFN A;  1KQS P;  2HKN A;  1YNZ A;  3L2R A;  3G1J A;  2QGG A;  3FIF A;  3TQ7 P;  5IXB A;  3M0T A;  4M78 B;  1K0S A;  1B34 A;  3JCM e;  1IGQ A;  1M3A A;  3HHT B;  4QVC A;  2BTT A;  3EFR A;  3M0U A;  2FYK A;  3DLL A;  2SEM A;  1BU1 A;  1WLP B;  5GAN j;  2RQV A;  1DJ7 B;  1ZHI A;  4PFZ A;  5GAN 7;  1BI3 A;  2M9U A;  3H8Z A;  3CC7 A;  3S3M A;  1M8V A;  1PNJ A;  3RBB B;  3VS4 A;  1YHQ A;  2CSI A;  1Q86 U;  4LUE A;  5GAM h;  2VAS A;  2RJE A;  3JB9 J;  4F7U G;  2KK4 A;  3M57 A;  1N9R A;  3H0I A;  1JQQ A;  2MMP A;  4HKE A;  2VXE A;  2DRK A;  3PFS A;  2OX7 A;  5CKH A;  3INZ A;  1PD0 A;  1KQS S;  2XHC A;  4F14 A;  2RMO A;  3MEW A;  5KYX B;  4X34 A;  2ROT A;  2DA9 A;  5GAO l;  3WVE B;  3V8L A;  1BCO A;  3HPW A;  2LVM A;  5CK9 A;  5LJ5 f;  3BFM A;  1MUZ A;  3CBP A;  1W2B A;  2QAZ A;  1VQ6 A;  1S1N A;  2E64 A;  3G71 Q;  2O88 A;  3CCR A;  4M7D B;  4JRI A;  1VQN T;  3CCM T;  3CD6 T;  1AWX A;  1QVF A;  3TSW A;  2EPD A;  2KRN A;  5GMK e;  2MOX A;  4J83 A;  2MWP A;  1Q7Y U;  3R6O A;  2F5T X;  3NPF A;  1YP5 A;  2RHI A;  2YHT A;  2YRD A;  2XDD A;  3J81 E;  3JRZ A;  4M77 E;  4ZN3 A;  2OAW A;  2M51 A;  4E7I A;  2IIM A;  1BCM A;  3LH5 A;  3EAE A;  1K73 C;  3PVL A;  5CKE A;  5CO7 A;  2RF0 A;  2JOY A;  5LJ3 h;  3I56 Q;  4FL6 A;  2VYT A;  4RTZ A;  2PNI A;  2LCL A;  1OU8 A;  2DL8 A;  2QTX A;  2EGC A;  1GFD A;  2CP6 A;  3LWI A;  4DBR A;  1ZSZ A;  5FRN A;  4M77 C;  4XTW A;  2HQX A;  2NWM A;  1TUG B;  3OQ5 A;  2QAS A;  1AOJ A;  3EG0 A;  2QA4 T;  1JO8 A;  3L42 A;  2GBQ A;  1QVF P;  1IXD A;  5A0G A;  1KC8 R;  2ED0 A;  2QQR A;  4NS5 A;  2JTF A;  3GLX A;  2P84 A;  3LGF A;  1M2V B;  4E7Z A;  1QKX A;  1SPK A;  4M75 B;  4D6W A;  3JCM h;  4AFQ C;  2CUD A;  4CC4 B;  4ZNX A;  2FRW A;  5GAO q;  4RUG A;  2MPX C;  3QZ5 B;  5GAN f;  3NFC A;  5IN1 A;  4PL6 A;  1Y0M A;  4OMN A;  1H3H A;  2P4T A;  1EFN A;  1WHJ A;  1VQP A;  2PQW A;  1NYG A;  1ZUK A;  1PHT A;  2ZGW A;  4MZP A;  5FLX E;  1X6B A;  2NUT B;  3KFV A;  2I2L A;  3P8H A;  2E41 A;  1YI2 A;  4MZT A;  4FYW B;  2YXY A;  1GBQ A;  2E1H A;  2LZ6 B;  2EQM A;  1T0H A;  4GY5 A;  2DL7 A;  4LDV A;  3RKX A;  1WQ7 A;  2DX1 A;  1D1B A;  4Z88 A;  4XU0 A;  4IIM A;  2OAU A;  3CD6 A;  4M7D E;  4HCC A;  3CC2 A;  4J9E A;  3A5Z B;  2DBK A;  1BI2 A;  4E7K A;  2X35 A;  3I35 A;  4RCC A;  5AYF A;  1ZUY A;  4NOY A;  2K5I A;  2BZY A;  4F16 A;  1QVF S;  1JXO A;  1G83 A;  4DBH A;  1YHQ Q;  3AHU A;  2CUB A;  1SSH A;  2F2X A;  2CDT A;  4QT7 A;  1KJW A;  5GAM f;  1Z9Z A;  2RJD A;  2OJ2 A;  1OYX A;  5KYW B;  2COY A;  5D6W A;  3G4S A;  4M7D F;  2LCS A;  1VQK A;  2JN0 A;  4J7I A;  4KUI A;  3JCM d;  4M75 G;  3CME A;  4JZ3 A;  4B6M A;  4ZGJ B;  1KQS A;  2RQU A;  4HXJ A;  1Y7X A;  2KBT A;  2XU8 A;  5FWB A;  5IT9 E;  1WI7 A;  1YCY A;  1UGV A;  2F69 A;  2DZC A;  2VKN A;  3CC4 Q;  3N5B B;  3DB4 A;  5CAI A;  3CC7 T;  2BIV A;  3MHX A;  4N0A C;  4R55 A;  2DK3 A;  3BE3 A;  2KRM A;  2EQI A;  4C8Q E;  3CCQ T;  4JLG A;  3M55 A;  3E2U A;  4BAC A;  1P92 A;  1M4Z A;  1LCK A;  2CT4 A;  1K76 A;  3JB9 G;  2DXC A;  1GCQ C;  3SDZ A;  3VS3 A;  4MML A;  1VQM A;  2L0A A;  4GLM A;  1VQ7 Q;  2PUO B;  2YLB A;  5LJ3 g;  1XOV A;  2OTJ T;  3GBQ A;  4QQ6 A;  3QZ9 B;  3SWN C;  3OYB A;  4DQ2 A;  2IG0 A;  3FC3 A;  2YDL A;  2YUO A;  2K57 A;  3PVQ A;  4BY6 B;  4PJO C;  3REA B;  4M7A G;  4ORZ A;  3CPW P;  5A0L A;  3MP6 A;  1U1S A;  1OUL A;  5GAO m;  2D6F A;  1VQP T;  4RTV A;  4O6J A;  5DLQ E;  4XAX B;  5CKD A;  4JRK A;  3LLR A;  2EYX A;  3G71 A;  3KUF A;  2AKL A;  3L2V A;  1VQK T;  5M9O A;  3SB2 A;  1QVG S;  2XID A;  5J26 A;  3HRU A;  2I0N A;  3QPH A;  5LL6 S;  2AT1 B;  4WCI A;  1JJ2 A;  4PJO E;  1IZ6 A;  3NHN A;  4OB0 B;  2K79 A;  1U3O A;  2DEU A;  4HT8 A;  1TSF A;  3JV3 A;  1Q82 R;  2XKO C;  2FRY A;  2RQW A;  2AHJ B;  2NUP B;  4C8Q C;  4CRI A;  1D3B B;  3CCU A;  4C8Q B;  2A3L A;  1CKB A;  4KGV B;  3JCM V;  1GBR A;  3CC2 T;  2XD0 A;  3QWY A;  1N5Z A;  3JCM W;  2K5L A;  2CKK A;  2A7Y A;  2D9T A;  1S72 T;  2MK5 A;  1C1A A;  5LJ5 g;  3CCE Q;  4ZGE B;  2XIC A;  1G3T A;  4QVD A;  4C5E A;  1R0C B;  4OP0 A;  3CC2 Q;  1X6O A;  2VXF A;  1KHI A;  1YJ9 Q;  2GNC A;  1HD3 A;  2DVJ A;  2GTO A;  3RKY A;  3HKS A;  2HCK A;  1FX7 A;  1WQW A;  2O01 E;  3GNG A;  4RTT A;  2KRS A;  4L59 A;  5GAO n;  4A4E A;  4EMG A;  2RN8 A;  4DOV A;  1YIT T;  4ZTJ A;  2IPO B;  2LNH B;  1M1F A;  4PFO A;  2LCC A;  2OTL T;  3EGD A;  4F7U B;  2KI7 A;  4FYV B;  2BE9 B;  1WJR A;  4QQD A;  3FB9 A;  4M7D C;  5HCK A;  2JNG A;  1AWW A;  4BE1 A;  3PGG A;  1K73 U;  1SHG A;  3EGX A;  3Q1J A;  4J9C A;  4RMO A;  2PVO B;  4A53 A;  1PRL C;  1BIA A;  1EX4 A;  3MPU B;  5GMK j;  4OMQ A;  2M1H A;  2FZC B;  3MKD A;  1FMK A;  1JB0 E;  3I9Q A;  2QA4 Q;  1ABQ A;  1ZA2 B;  2P4R A;  4AMC A;  3P8D A;  3OS2 A;  1RAD B;  3KXT A;  1V76 A;  2HQH A;  4M7A F;  5EC7 A;  3CCS T;  1IB8 A;  2HL5 C;  2KT1 A;  2YUN A;  2MF2 A;  4FT2 A;  3CD6 Q;  4PJO D;  1MV0 B;  1NE8 A;  3X24 B;  4M75 F;  3MCA B;  5KYX A;  2MIO A;  3IQL A;  2FPF A;  5GAM e;  4ZTF A;  2G6F X;  2O9V A;  4JJD A;  4OF1 A;  4PJO G;  2VC8 A;  3ZFJ A;  3KBG A;  4M77 A;  1NLP C;  1CSK A;  3M0P A;  2NUP A;  3CCR T;  4C0D C;  1RI0 A;  1BIB A;  2OTJ A;  4A4F A;  5IXF A;  3PIP A;  1VQ4 A;  2C0I A;  1U5S A;  2VB6 A;  2K5F A;  2DYB A;  1VQM T;  1RAH B;  2ENM A;  2QDY B;  2BE7 D;  3OS5 A;  2FL7 A;  2COZ A;  2ZPH B;  3RIR A;  2V8I A;  2EFI A;  4M77 G;  1LNX A;  2HQE A;  2JM9 A;  4ZN1 A;  3RR6 A;  1LVK A;  2FVU A;  3M0S A;  2GFU A;  2BKD N;  4ELY C;  3QYH B;  2GQI A;  3FDR A;  1B34 B;  2KNB B;  2CZ1 B;  3REB B;  2LX7 A;  3U23 A;  4LDW A;  4IUT A;  4IUP A;  2EJ9 A;  1IRE B;  4BDY A;  2J05 A;  3SWN A;  1K9M C;  5CCA A;  2M02 A;  4F7U A;  2WSE E;  4E47 A;  2A36 A;  3ASK A;  3OYN A;  2DFU A;  3E9F A;  3OYY A;  1TH7 A;  4M75 E;  1K1Z A;  1UG1 A;  3JB9 D;  2X4W A;  3MP1 A;  2CZ7 B;  3CMA A;  1V1C A;  1WJS A;  2DYI A;  3JSC A;  3P8B B;  3VYH B;  3V7C A;  3SEM A;  4N0A A;  5GAN 3;  2BZ8 A;  3TEE A;  1ARK A;  3VUZ A;  2KRO A;  1AWJ A;  4UC4 A;  1QVP A;  1N6A A;  1VYV A;  4FT4 A;  3O5Z A;  2RNA A;  4K11 A;  2DJQ A;  4FYY B;  4KH1 B;  2YRC A;  2DVE A;  3CCJ Q;  1WXU A;  1MGQ A;  4E7H A;  2XK0 A;  2RJC A;  2ZPG B;  1M2V A;  4PJM A;  1X2K A;  1VQL A;  2RK1 A;  1YIJ T;  5IHK A;  2FG0 A;  2MYS A;  2Y4X A;  1OEB A;  4BE2 A;  1K4U S;  2E10 A;  2M0Y A;  2E3H A;  2X4X A;  4DEX A;  5LJ5 j;  1KQ2 A;  2H8H A;  1JBM A;  4ME7 A;  3URG A;  2QQA A;  4ESR A;  1VQL T;  1M27 C;  2AZS A;  4JUV A;  3CCE T;  3SHW A;  2RQT A;  2X3X D;  2RH2 A;  4V2S A;  2XG8 D;  2DPP B;  1YWO A;  1MMA A;  2CGH A;  5GMK i;  2ROL A;  1Z9Q A;  5GAM d;  1IO6 A;  3M59 A;  9ATC B;  1M1K C;  1EZZ B;  1PCX A;  1W70 A;  1PM3 A;  3EG1 A;  3S6W A;  5EG2 A;  3A1P A;  3SWN B;  2LNV A;  3S3O A;  3BY7 A;  1MHN A;  2JS0 A;  4BY6 C;  1JRI A;  1OZ2 A;  5GAO p;  3CXC S;  4N4H A;  2EGE A;  1U06 A;  1K8A C;  4C0Z A;  2PU9 B;  5KYY B;  2D0N A;  2PVD B;  2MWO A;  3FLG A;  1WHL A;  1WDX A;  1SRL A;  3CCR Q;  1Q81 C;  1PG5 B;  1QVG P;  2A0F B;  5FU6 B;  4DBF A;  1YHQ T;  3QBY A;  3CCM Q;  4OMF B;  4X9C A;  1WIE A;  4B9W A;  4KRT A;  1TOV A;  2VWF A;  2VV5 A;  1MMD A;  3PMT A;  3GPL A;  4C0G A;  2CZ0 B;  3V7R A;  2EIF A;  2RI3 A;  1KG1 A;  3J80 E;  3CPW S;  4J8O A;  4L5G A;  1ZA1 B;  2FO0 A;  2E6Z A;  2JT4 A;  2YT6 A;  4XU2 A;  1M3B A;  5CVI A;  1QLY A;  3JCM f;  2K7A A;  1X69 A;  3L2U A;  1HSQ A;  4PLL A;  4DA4 A;  1BYM A;  1ABO A;  1RAB B;  1H3Z A;  2M0O A;  2FPE A;  1VQL Q;  3CCL T;  1T3S A;  2QGF B;  2JZ2 A;  2MAM A;  3OMG A;  3RNJ A;  5D7U A;  2VGN A;  1IRX A;  2J7I A;  1KC8 U;  3HP9 A;  3OW2 A;  2FHD A;  1G8X A;  5IH2 A;  1Q7Y R;  4DEY A;  3LH0 A;  4AG2 C;  2DXB A;  2DTH A;  3VS6 A;  1UB4 A;  1GXI E;  3EGX B;  4EMK C;  4R56 A;  1MMG A;  2O4X B;  3WXM B;  2AIR B;  1VQ9 A;  4II1 A;  1D1C A;  1K9A A;  3OYD A;  1AWO A;  1K0X A;  3E9G A;  1Y57 A;  5HK0 A;  2KR3 A;  4JJC A;  5LJ3 f;  2V8K A;  2QEX T;  3X20 B;  1UUE A;  5GMK h;  4A54 A;  2DIG A;  3AT1 B;  2JMC A;  4AFS C;  1YIJ Q;  5KYU B;  1VQO T;  3VS2 A;  4M77 D;  3RUX A;  1OX8 A;  1GCQ A;  3LGL A;  3NMZ C;  3E19 A;  1V29 B;  3H9N A;  4M7D G;  1YN8 A;  2JW4 A;  4J5Y A;  4Z02 A;  1VQ6 T;  1UGS B;  4F7U E;  3FRN A;  4Y91 A;  4JRQ A;  4XU1 A;  4QW2 A;  5GAO r;  1QP2 A;  2RA2 A;  1TUC A;  1TU0 B;  1X6G A;  2DER A;  1RAI B;  2A37 A;  2YLC A;  4P5N A;  4BI4 A;  3CME T;  2L3S A;  3EFO B;  1SRM A;  3VV0 A;  1R0B G;  4X9D A;  1RAC B;  5C6S A;  1KQ1 A;  2R5A A;  2V8J A;  1VYT A;  2V1R A;  3UPU A;  4D8D A;  4KT0 E;  2RJF A;  1NLO C;  2L89 A;  5CIU A;  3M53 A;  2CP5 A;  4JS4 A;  1ZSZ B;  2M16 A;  3EG9 A;  3F70 A;  3VUB A;  2RHX A;  4M78 D;  1OOT A;  1SSF A;  4C0D B;  1VQP Q;  4GLK A;  4N4G A;  3O8V A;  3CCM A;  1UJ0 A;  3HRS A;  4QKU A;  1LJO A;  2P0K A;  4J9B A;  1K73 R;  1VQ5 Q;  4PKC C;  3I55 Q;  1GFC A;  1SEM A;  3OA6 A;  1X01 A;  1M9S A;  5J3B A;  3RES A;  2RHZ A;  3PNW C;  3UWN A;  1NG2 A;  2JTE A;  2RM4 A;  3HRT A;  2KQW A;  3JAM E;  1N8R C;  1NEG A;  4CC7 A;  2DTI A;  1YIT Q;  2LMJ A;  1NM7 A;  2RO0 A;  2ABL A;  2DL4 A;  2WSC E;  5GAN h;  4LN2 A;  5DY9 A;  4BD3 A;  1VQ7 A;  3G6E Q;  3SFM A;  4RTX A;  2PUK B;  1QP3 A;  2PZ1 A;  4A4K A;  3OW2 S;  1IHW A;  5D6Y A;  1RI9 A;  3VU3 C;  1U8R A;  2KEA A;  2O4X A;  1KIK A;  3RMQ A;  2LQN A;  4PJN A;  2GTJ A;  1B3Q A;  1JU5 C;  1S72 Q;  3X26 B;  4EIK A;  1K8A U;  1VQ8 T;  2KY9 A;  3LX7 A;  5A2Q E;  1WJQ A;  3QKJ A;  4ELZ C;  3G6E T;  4C92 B;  5GAN g;  3JCM P;  2LQW A;  1UJY A;  4LUD A;  5LJ3 j;  3RDV A;  1MV3 A;  2CP0 A;  1YI2 T;  3EHR A;  4CC2 A;  2QEX Q;  2K4Y A;  4RCB A;  2FZK B;  2HL3 A;  3CCQ A;  4J9I A;  2W0Z A;  3H41 A;  1PKS A;  1YJW Q;  4HCZ A;  3GF5 A;  3M5A A;  3CCJ A;  3DLM A;  4Z8A A;  5KYN A;  1UGQ B;  1VQM Q;  4C8Q A;  4OMP A;  1UEC A;  3CXC A;  1XJW B;  1PRM C;  2PTK A;  2HD0 A;  1UE9 A;  2L3P A;  1VQO Q;  1IHV A;  3L2W A;  1X43 A;  4OMM A;  4DBQ A;  1KD1 R;  2EAY A;  4C92 F;  1YBY A;  1VQ5 A;  1YJW T;  2FEI A;  2QK0 A;  2JVV A;  3A8L B;  2KT8 A;  3VS0 A;  5D6X A;  2WAC A;  1UHF A;  4O5V A;  1Q82 U;  2C06 A;  5L8R E;  1ZBX A;  2E3I A;  3GP8 A;  1YJ9 T;  3CEY A;  3G4S Q;  4PJL A;  3QII A;  2D0Q B;  2ECZ A;  1AZE A;  2CZ6 B;  1M1K R;  3BW1 A;  1VQ8 A;  1I8F A;  1KFZ A;  1RLQ C;  1HK9 A;  2DZ9 A;  1RL2 A;  2LX9 A;  4HVW A;  2RQR A;  3NTK A;  4M7A D;  1R8O B;  3WVD B;  2LT4 A;  2L8D A;  1T3L A;  3M0R A;  2QEX A;  1BI0 A;  1VIE A;  2ZPF B;  4JJB A;  3TU4 K;  5IHI A;  3JCM b;  3TCJ A;  1H8K A;  1ZLM A;  4PJO B;  2QQ9 A;  3CBO A;  3PE0 A;  1NJI U;  1T0J A;  3CXC P;  2RI2 A;  1UHC A;  1QW1 A;  2DXU A;  2EJG A;  3MET A;  1YJN Q;  3ZEH A;  3OYI A;  2X4J A;  5GAN 6;  3GOX A;  3OS0 A;  4E7J A;  1M90 R;  1WFW A;  2R5M A;  1AT1 B;  5DLO A;  3PIO A;  1Q86 C;  3I55 T;  2G3R A;  4JDS A;  4BDZ A;  4JRP A;  2WSF E;  1A0N B;  2IVW A;  4XQ3 A;  4F7U F;  1W1F A;  1M8M A;  3S3N A;  5GMK l;  3CME Q;  3MP8 A;  2K3X A;  1D3B A;  4MDX A;  1ZSG A;  3A8M B;  3QG1 A;  3QDF A;  2Y90 A;  4ZGD B;  2BZX A;  1Y96 A;  1UGR B;  2NUZ A;  3I56 A;  1TG0 A;  2EKO A;  1VQN A;  2YUQ A;  4RG8 A;  4CC3 A;  2DIL A;  1Q86 R;  5AT1 B;  2R57 A;  2DD5 A;  3M54 A;  3OMC A;  3E1S A;  1PWT A;  1WXT A;  1TUD A;  1PC0 A;  4J6W A;  1X75 C;  2O2O A;  2LJ0 A;  1RAF B;  2CP3 A;  2KYM A;  2EGA A;  3R6N A;  3EFO A;  2E70 A;  2C0T A;  1LOJ A;  1SG5 A;  1G3W A;  4EMH A;  1B07 A;  1YWP A;  1VQ4 Q;  3DB3 A;  1H64 1;  3A8O B;  4FM4 B;  1ZUU A;  2K6D A;  3QUI A;  1WYX A;  5GJW B;  1VQ6 Q;  2J6O A;  2LQ8 A;  8AT1 B;  2RHU A;  3H0F A;  1NYF A;  2CRE A;  5KE2 A;  2YRV A;  4TVR A;  1AVZ C;  2JM8 A;  2KXC A;  3C95 A;  3CCV T;  4MDW A;  5KH6 A;  1PKT A;  2DE0 X;  4PLI A;  5LJ3 d;  1J3T A;  1JEG A;  2ZAE A;  1BB9 A;  4M7A A;  6AT1 B;  2EWN A;  4E7S A;  1NBE B;  1C6V X;  3EH2 A;  1SHF A;  2VUB A;  2Y4Y A;  2L3Q A;  3CMA T;  2V1Q A;  3MJX A;  2J6F A;  3MEU A;  1WGS A;  5LJ3 e;  3HTR A;  5GMK m;  4JPB W;  1WHK A;  2DNU A;  5DM7 R;  1QMC A;  4LDU A;  1ZBJ A;  2KE9 A;  2JUF A;  3TRE A;  4BUG A;  1GRI A;  1O75 A;  4QVZ A;  4VUB A;  3PTA A;  1ZSZ C;  4Y92 A;  2DIQ A;  5FW9 A;  1W6X A;  2XMF A;  4GBQ A;  3V7S A;  2DM1 A;  4IKF A;  4IUU A;  4FIB A;  3OYA A;  3PMI A;  1KC8 C;  1VUB A;  4J9F A;  4C92 A;  4R0K A;  4X1V A;  2NYS A;  1M1K U;  1W2B P;  3GIB A;  1TS9 A;  2K9G A;  3ULR B;  1VQO A;  2ZCF B;  4KGX B;  1QWE A;  2HAX A;  2EYZ A;  3QHS A;  2OTL Q;  4C8Q F;  1AEY A;  3FJP A;  5KYU A;  1E6G A;  3TVT A;  4M75 C;  4HT9 A;  2EW3 A;  4C92 G;  3EG2 A;  3CQT A;  2X51 A;  1RUW A;  1YJW A;  5C0M A;  2ZZD A;  2QQS A;  1YIT A;  1MMN A;  4ATO A;  3QO3 A;  1M90 C;  5IAY A;  4M75 D;  4E2F B;  5J39 A;  3L2Z A;  1LPL A;  3NTH A;  2ZPB B;  1VQ9 T;  1RLP C;  1X2Q A;  5I21 A;  2D8H A;  2LJ1 A;  1OU9 A;  1KSW A;  3CCL Q;  1VA7 A;  5LJ5 e;  3A98 A;  1WXB A;  2DO3 A;  2COW A;  3M0Q A;  4FW2 A;  2DL3 A;  4C92 C;  1XTD A;  2CP2 A;  2CP7 A;  2DMO A;  2H3E B;  4IUR A;  2OI3 A;  2JJ9 A;  2KMT A;  5CQY A;  4LDY A;  2K2V A;  3OBW A;  2ZPE B;  2CYZ B;  3G7Z A;  2DAQ A;  3CCE A;  3VRZ A;  5I11 A;  1VQ4 T;  2RK2 A;  3UAT A;  4OB1 B;  1TWB A;  4BB7 A;  5FU7 C;  3M4Y A;  1UEB A;  1EIF A;  1FXX A;  4FW1 A;  1OV3 A;  1YJN T;  4OMO A;  3QSU A;  3OY9 A;  2LT1 A;  4ANJ A;  4LNP A;  3CCU Q;  2GCX A;  4XTU A;  1ACM B;  1I07 A;  4Y28 E;  5KE3 A;  5I2M A;  4LXC A;  4M7A C;  3QDR B;  2B8A A;  4M7A B;  1OX9 A;  4J9D A;  2HSP A;  1NZ9 A;  3T9N A;  2X9H A;  1YIJ A;  1NEB A;  3CC4 A;  1JJ2 P;  5KYY A;  1M90 U;  4KBM B;  2VVK A;  1WHM A;  2F1L A;  5L23 A;  5KCH A;  4C92 E;  2EJF A;  1KD1 C;  3EH1 A;  1K9M R;  3V8K A;  1I4K 1;  3ZBD A;  4J6X A;  3JB9 I;  4M7D A;  4RTY A;  2DRM A;  3M9Q A;  1OQK A;  4QQG A;  1GCP A;  5GAN 4;  4E6R A;  1Q81 U;  2E5Q A;  3VS5 A;  1AHJ B;  4RG2 A;  5IHN A;  1VQ9 Q;  2KVQ G;  1MNE A;  1BBZ A;  2D8J A;  2K3Y A;  1N8R R;  2HKQ B;  1WZO A;  2OTL A;  4HVV A;  1Q95 G;  1HJD A;  2LJ3 A;  5HKC A;  1RAG B;  2DJZ A;  4JZ4 A;  1VQN Q;  2KYB A;  4C8Q D;  4IIO A;  3M56 A;  4LE9 A;  3TSZ A;  2XDB A;  1OI1 A;  1Y07 A;  2RI5 A;  1UTI A;  3OYE A;  1PD1 A;  2E4H A;  2VGM A;  5GAN e;  3RER A;  4F04 B;  3RKW A;  3H0H A;  1JJ2 S;  3HL8 A;  2E65 A;  4BI3 A;  1YI2 Q;  3X25 B;  4JLI A;  5CKF A;  2DET A;  2RB6 A;  5KCO A;  3DKM A;  1D0X A;  2K3B A;  3OYF A;  4PJJ A;  2F5K A;  2CH4 W;  3D7S B;  4OGE A;  1QCN A;  3OS1 A;  5HK3 A;  2KXD A;  4D8K A;  5ECA A;  1WPY A;  2C0O A;  1QCF A;  2CH4 A;  1FWZ A;  4XTY A;  4EDU A;  2QG9 B;  5FRO A;  3I5R A;  2F2V A;  3OBY A;  1M3C A;  2HMA A;  4OGC A;  2R58 A;  3UT1 A;  4CI0 C;  3GNF B;  1AD5 A;  3OYL A;  1FMW A;  4WTO B;  4PK4 A;  3CPW A;  4A4G A;  2O9S A;  1I5O B;  4J9G A;  3CCV Q;  3OYC A;  3HFO A;  2QYZ A;  1M5Q 1;  3M4G A;  3JB9 H;  1OPL A;  1YFN A;  1KD1 U;  2FB7 A;  4WF2 A;  1Q7Y C;  3VYG A;  2EQK A;  2FZG B;  2GQV A;  2JS2 A;  2HZY A;  1NJI C;  5GAM g;  4MZM A;  3QJY A;  1IGU A;  4M78 C;  3UA7 A;  1M30 A;  2D1X A;  3ER0 A;  4EMK A;  2LDM A;  2SRC A;  4BI8 B;  4JS5 A;  2YSQ A;  3C94 A;  2CT3 A;  4HCK A;  3UDC A;  3EFS A;  3LWH A;  1QCO A;  4C5I A;  3OYG A;  4C5G A;  4A63 B;  5LJ5 d;  2JTM A;  2HDA A;  4KH0 B;  2HNI A;  2DD4 A;  1WNL A;  1QWF A;  4LDX A;  1X27 A;  4Q5W A;  3JCM c;  2EKH A;  4AG1 C;  2RPN A;  1WHG A;  2MCN A;  1F1B B;  4M78 E;  4FU6 A;  1NPP A;  2CS7 A;  8ATC B;  2DL5 A;  2W10 A;  2KDS A;  5CKB A;  3OYK A;  1I1J A;  1I0C A;  3RMS A;  4KUD K;  2QI2 A;  1MND A;  4KGZ B;  3EG9 B;  3A8H B;  2J06 A;  1I81 A;  1Q82 C;  5KYW A;  4FSX A;  3CCU T;  2MI6 A;  2KAF A;  1W2B S;  2F2W A;  3FJ5 A;  1YJN A;  2E5K A;  1S72 A;  3CCJ T;  2RD1 A;  3ME9 A;  2JXB A;  3UA6 A;  4AT1 B;  5CR2 A;  1K9M U;  2DBM A;  2DLP A;  3JCM X;  3VKI A;  3CPF A;  4A4H A;  4F17 A;  2KGT A;  4OVA A;  3OSS C;  1VQK Q;  3CCS Q;  3MO8 A;  2ESW A;  1RAA B;  5I22 A;  1D0Z A;  4XK8 E;  3EHQ A;  2HSE B;  3JCM Q;  1VQ5 T;  5FWC A;  2NUT A;  2DKG A;  1HYO A;  3CC7 Q;  3CC4 T;  1VQ8 Q;  3BDL A;  3CCQ Q;  4LD9 K;  1M2O A;  4M7D D;  1H92 A;  3A8G B;  2YWW A;  1UDL A;  5LJ5 h;  3FEO A;  4Z89 A;  3CCS A;  2AK5 A;  2EVR A;  3QWX X;  2FPD A;  1FYN A;  2KSS A;  3I55 A;  2Z0W A;  3VS1 A;  2DTO A;  1ZQ1 A;  1BKB A;  2DEQ A;  3OSV A;  2QQB A;  1NPR A;  2NLU A;  4M4Z A;  3M58 A;  5I2S A;  1FMV A;  3CMA Q;  2OTJ Q;  3G4S T;  2XDP A;  3H6Z A;  4E7L A;  1W4S A;  1G2B A;  4DOW A;  1D1A A;  4RTW A;  5GJV B;  2ED1 A;  1OPK A;  1QQJ A;  3CCV A;  2RHY A;  5HY6 A;  4M77 B;  3I56 T;  2GGR A;  3JB9 F;  3OB9 A;  2P0Q A;  4NL3 A;  2P0P A;  5GAN d;  4M78 G;  4J9H A;  5FU7 B;  2YUP A;  1PSE A;  1G3Y A;  3LYI A;  3JCM J;  4YTL A;  5A0D A;  3HSB A;  4JJN K;  3BDU A;  3NTI A;  2LC4 A;  4IUQ A;  4XTZ A;  2X3W D;  3VS7 A;  2CSQ A;  2EQJ A;  1AZG B;  1WA7 A;  1OZ3 A;  4HCB A;  2QTV A;  1Y71 A;  2JMA A;  3L2Q A;  3C12 A;  4M78 A;  3OYM A;  1N27 A;  1B7T A;  4L6V 5;  2HEQ A;  4AFU C;  1VQ7 T;  4IUV A;  3LW5 E;  3VRY A;  1RAE B;  1XNI A;  3THK A;  4FYX B;  4LD6 A;  1NJI R;  1XQH A;  3MEV A;  4OB3 B;  4M77 F;  3MEA A;  1YCS B;  2PVG B;  1KHC A;  4PJO A;  2L2P A;  2LQK A;  4N4I A;  3CBM A;  1E7O A;  2GFA A;  1SKU B;  2BUD A;  2X4Y A;  4M75 A;  3EGD B;  1C0M A;  3G6E A;  2E12 A;  1Q81 R;  3SD4 A;  5GAM j;  1E6H A; 
#chains in the Genus database with same CATH homology
 3PT9 A;  4J7F A;  4JRK A;  4MMK A;  4HA8 A;  1VIF A;  2HBP A;  3LLR A;  4C8Q G;  1YJ9 A;  4M7D G;  3G71 A;  3KUF A;  4J5Y A;  1VQK T;  4Z02 A;  3L2V A;  5M9O A;  3OYJ A;  1VQ6 T;  5LJ5 e;  3SB2 A;  4XTV A;  1UGS B;  2DO3 A;  4F7U E;  3FRN A;  4Y91 A;  1QVG S;  4JRQ A;  2H3J A;  2XID A;  4QW2 A;  4XU1 A;  5GAO r;  1QP2 A;  2RA2 A;  5J26 A;  3V8J A;  4XTX A;  2QA4 A;  1G5V A;  1G3S A;  3HRU A;  3QPH A;  5LL6 S;  4C92 C;  1XTD A;  1JJ2 A;  4PJO E;  5GAN 8;  4XU3 A;  1IZ6 A;  2YLC A;  4P5N A;  1HXD A;  3QXE B;  4OB0 B;  4IUR A;  4BI4 A;  3CME T;  2KMT A;  1Y96 B;  3VV0 A;  1I5L A;  4HT8 A;  3L1A A;  4X9D A;  1PSF A;  2XKO C;  4LDY A;  2K2V A;  5CQY A;  5C6S A;  1KQ1 A;  3OBW A;  2R5A A;  2V8J A;  2CYZ B;  2ZPE B;  2AHJ B;  3G7Z A;  4C92 D;  1M1G A;  4C8Q C;  4CRI A;  2DAQ A;  1D3B B;  2LTO A;  3CCE A;  3CCU A;  4C8Q B;  3UPU A;  4KT0 E;  2A3L A;  2QXF A;  2L3R A;  2RJF A;  2RK2 A;  3QJ6 A;  3VJP A;  4B9X A;  4OB1 B;  1VQ4 T;  2L89 A;  4BB7 A;  5CIU A;  3M53 A;  3JCM V;  5FRM A;  5FU7 C;  4JS4 A;  3M4Y A;  1UEB A;  3CC2 T;  1EIF A;  1FXX A;  3J7A F;  2M16 A;  3F70 A;  2XD0 A;  4PJO F;  1YJN T;  3VUB A;  2RHX A;  3JCM W;  3QSU A;  3OY9 A;  2K5L A;  2CKK A;  2LT1 A;  4M78 D;  2A7Y A;  2D9T A;  1S72 T;  1SSF A;  4C0D B;  4GLK A;  5LJ5 g;  2GCX A;  4N4G A;  3O8V A;  4XTU A;  4ZGE B;  2XIC A;  4C0F A;  5GAN 5;  2E6N A;  2XI9 A;  1G3T A;  3HRS A;  3CCM A;  2EQU A;  4NL2 A;  1LJO A;  4Y28 E;  4C5E A;  2P0K A;  4QVD A;  5KE3 A;  4PKC C;  5I2M A;  4OP0 A;  1U1T A;  1X6O A;  2VXF A;  4M7A C;  3QDR B;  1KHI A;  3J81 E;  3CCL A;  2B8A A;  4M7A B;  1N9S A;  3RKY A;  3HKS A;  3OA6 A;  1X01 A;  1M9S A;  4M78 F;  5J3B A;  3RES A;  1FX7 A;  1WQW A;  2O01 E;  3GNG A;  2RHZ A;  3QYG B;  4L59 A;  5GAO n;  4A4E A;  3PNW C;  1NZ9 A;  4EMG A;  3UWN A;  3T9N A;  4DOV A;  4EPC A;  1YIT T;  1YIJ A;  4BE0 A;  4ZTJ A;  2LRQ A;  3CC4 A;  2RM4 A;  2EYQ A;  1M1F A;  2KQW A;  3HRT A;  1BI1 A;  3JAM E;  1N8R C;  2LCC A;  4OB2 B;  1M90 U;  2OTL T;  2DTI A;  4KBM B;  4F7U B;  3X28 B;  4KUL A;  2RO0 A;  4EMK B;  1N8R U;  2WSC E;  2ZPI B;  5GAN h;  5KCH A;  4C92 E;  1WJR A;  2DXT A;  2EJF A;  4QQD A;  3FB9 A;  5DY9 A;  4BD3 A;  3G71 T;  1KD1 C;  1VQ7 A;  2JNG A;  4M7D C;  3SFM A;  3V8K A;  1I4K 1;  1UGP B;  4J6X A;  3ZBD A;  2PUK B;  1QP3 A;  4J6Y A;  4RKU E;  4A4K A;  4C5H A;  3JB9 I;  3OW2 S;  5D6Y A;  4M7A E;  3VU3 C;  1O9S A;  4M7D A;  1U8R A;  5FU6 C;  3JCM g;  3OYH A;  2O4X A;  3M9Q A;  3RMQ A;  3PGG A;  4BE1 A;  1K73 U;  4QQG A;  3C4S A;  3Q1J A;  4RMO A;  2PVO B;  4A53 A;  5GAN 4;  1BIA A;  2GF7 A;  1Q81 U;  5GMK j;  2E5Q A;  1AHJ B;  2M1H A;  4RG2 A;  1QVG A;  5CQX A;  3X26 B;  2KVQ G;  1K8A U;  2L5Q A;  1JB0 E;  4PNO A;  1VQ8 T;  2K3Y A;  5GAN 2;  2KY9 A;  3HFN A;  3LX7 A;  5A2Q E;  3OS2 A;  3P8D A;  3L2R A;  2OTL A;  1WJQ A;  3FIF A;  3QKJ A;  4ELZ C;  5HKC A;  4M78 B;  2DJZ A;  3KXT A;  3G6E T;  4C92 B;  5GAN g;  3JCM P;  4M7A F;  4C8Q D;  1B34 A;  3JCM e;  3CCS T;  3M56 A;  2XDB A;  5LJ3 j;  3HHT B;  4QVC A;  1OI1 A;  1Y07 A;  3EFR A;  2RI5 A;  2MF2 A;  4FT2 A;  3OYE A;  1YI2 T;  2FYK A;  3DLL A;  1NE8 A;  2VGM A;  3X24 B;  4M75 F;  5GAN e;  3RER A;  4PJO D;  2K4Y A;  4RCB A;  3RKW A;  3MCA B;  1JJ2 S;  3CCQ A;  5GAN j;  3HL8 A;  5GAM e;  2E65 A;  4ZTF A;  1DJ7 B;  4BI3 A;  1ZHI A;  3CC7 A;  5GAN 7;  1BI3 A;  2M9U A;  3H8Z A;  4HCZ A;  3S3M A;  3GF5 A;  3M5A A;  3CCJ A;  1M8V A;  4OF1 A;  4PJO G;  2VC8 A;  3ZFJ A;  3KBG A;  1YHQ A;  4M77 A;  3X25 B;  3DLM A;  1Q86 U;  1UGQ B;  4JLI A;  4C8Q A;  3CXC A;  5CKF A;  5GAM h;  2RJE A;  3JB9 J;  4F7U G;  3CCR T;  2KK4 A;  2RB6 A;  5KCO A;  4C0D C;  3DKM A;  1RI0 A;  1N9R A;  3M57 A;  1BIB A;  2HD0 A;  2OTJ A;  3OYF A;  4A4F A;  3PIP A;  1VQ4 A;  2F5K A;  2MMP A;  4HKE A;  2VXE A;  2K5F A;  1VQM T;  4OGE A;  3OS1 A;  3L2W A;  3PFS A;  5HK3 A;  2QDY B;  5CKH A;  3INZ A;  3OS5 A;  2FL7 A;  2EAY A;  1WPY A;  4C92 F;  1YBY A;  1KQS S;  1VQ5 A;  2ZPH B;  3RIR A;  2XHC A;  1YJW T;  2V8I A;  2EFI A;  4M77 G;  2JVV A;  1FWZ A;  3MEW A;  4X34 A;  3A8L B;  1LNX A;  2HQE A;  4XTY A;  4EDU A;  5GAO l;  5FRO A;  3WVE B;  4ZN1 A;  5D6X A;  2WAC A;  3HPW A;  3V8L A;  2FVU A;  4O5V A;  2LVM A;  5CK9 A;  5LJ5 f;  2GFU A;  1Q82 U;  2C06 A;  3BFM A;  3OBY A;  3CBP A;  1W2B A;  2BKD N;  5L8R E;  4ELY C;  3QYH B;  1VQ6 A;  1ZBX A;  3GP8 A;  4OGC A;  2E64 A;  2R58 A;  3FDR A;  3UT1 A;  1B34 B;  1YJ9 T;  2CZ1 B;  3CCR A;  4CI0 C;  3CEY A;  3GNF B;  3OYL A;  3QII A;  4M7D B;  4LDW A;  2D0Q B;  4IUT A;  4JRI A;  2CZ6 B;  2EJ9 A;  4IUP A;  1VQN T;  1IRE B;  3CPW A;  3CCM T;  4BDY A;  3CD6 T;  3BW1 A;  4A4G A;  1VQ8 A;  1I8F A;  1QVF A;  1HK9 A;  3SWN A;  3OYC A;  3HFO A;  1K9M C;  5CCA A;  2DZ9 A;  5GMK e;  1RL2 A;  1M5Q 1;  2LX9 A;  4F7U A;  3NTK A;  4J83 A;  2MWP A;  2WSE E;  4E47 A;  1Q7Y U;  3ASK A;  2F5T X;  1R8O B;  3M4G A;  3R6O A;  3OYN A;  4M7A D;  3WVD B;  3JB9 H;  2LT4 A;  3E9F A;  2RHI A;  3OYY A;  2L8D A;  1KD1 U;  1TH7 A;  4M75 E;  2YHT A;  2FB7 A;  2QEX A;  4WF2 A;  1Q7Y C;  1BI0 A;  2XDD A;  3JB9 D;  1VIE A;  2X4W A;  3JRZ A;  2ZPF B;  2EQK A;  3MP1 A;  4M77 E;  3VYG A;  2CZ7 B;  2GQV A;  4ZN3 A;  3CMA A;  4E7I A;  3TU4 K;  1NJI C;  5GAM g;  3JCM b;  3TCJ A;  1WJS A;  3EAE A;  3QJY A;  4MZM A;  1K73 C;  3JSC A;  4PJO B;  3P8B B;  2QQ9 A;  4M78 C;  5CKE A;  3CBO A;  3VYH B;  5CO7 A;  3ER0 A;  3V7C A;  1NJI U;  2JOY A;  4N0A A;  2RI2 A;  5LJ3 h;  4EMK A;  5GAN 3;  1QW1 A;  2LDM A;  2DXU A;  2EJG A;  3TEE A;  4BI8 B;  3MET A;  3ZEH A;  3OYI A;  4JS5 A;  2X4J A;  5GAN 6;  3GOX A;  4FL6 A;  2VYT A;  3OS0 A;  3C94 A;  3VUZ A;  3UDC A;  4E7J A;  2LCL A;  3EFS A;  3LWH A;  4C5I A;  3OYG A;  2R5M A;  4UC4 A;  1QVP A;  1N6A A;  2QTX A;  4FT4 A;  4C5G A;  5DLO A;  5LJ5 d;  3PIO A;  1Q86 C;  3I55 T;  2JTM A;  2DVE A;  2HNI A;  3LWI A;  2G3R A;  2DD4 A;  4JDS A;  4BDZ A;  1WNL A;  4JRP A;  2WSF E;  4LDX A;  5FRN A;  4M77 C;  2IVW A;  4Q5W A;  3JCM c;  4XTW A;  1MGQ A;  2HQX A;  4XQ3 A;  4F7U F;  3OQ5 A;  2XK0 A;  4E7H A;  3S3N A;  2RJC A;  5GMK l;  2ZPG B;  3MP8 A;  4M78 E;  2K3X A;  1VQL A;  1D3B A;  4FU6 A;  1NPP A;  2QA4 T;  2CS7 A;  4MDX A;  2RK1 A;  1YIJ T;  3A8M B;  3QG1 A;  2KDS A;  2Y4X A;  5CKB A;  3L42 A;  2Y90 A;  4ZGD B;  1Y96 A;  1UGR B;  3OYK A;  2E10 A;  4BE2 A;  3I56 A;  2X4X A;  3RMS A;  5A0G A;  2QI2 A;  4KUD K;  2EKO A;  2QQR A;  5LJ5 j;  1KQ2 A;  4NS5 A;  2JTF A;  3A8H B;  3GLX A;  1JBM A;  4ME7 A;  1VQN A;  3LGF A;  1I81 A;  4RG8 A;  3URG A;  2QQA A;  1VQL T;  1Q82 C;  5CKD A;  2R57 A;  2DD5 A;  3M54 A;  3OMC A;  4M75 B;  4D6W A;  3E1S A;  4FSX A;  4JUV A;  3JCM h;  3CCU T;  3CCE T;  2MI6 A;  2KAF A;  1W2B S;  1YJN A;  1S72 A;  5GAO q;  4J6W A;  1X75 C;  2RH2 A;  4V2S A;  2XG8 D;  2DPP B;  3CCJ T;  2RD1 A;  3ME9 A;  2CGH A;  3QZ5 B;  5GAN f;  3NFC A;  2E70 A;  5IN1 A;  5GMK i;  4PL6 A;  1LOJ A;  1G3W A;  4EMH A;  5CR2 A;  1K9M U;  2P4T A;  5GAM d;  3JCM X;  3VKI A;  1VQP A;  3CPF A;  3DB3 A;  3M59 A;  4A4H A;  1H64 1;  2PQW A;  1M1K C;  3OSS C;  4OVA A;  2ZGW A;  3A8O B;  4FM4 B;  4MZP A;  3MO8 A;  5FLX E;  3QUI A;  2QEX T;  3S6W A;  4XK8 E;  5EG2 A;  3SWN B;  3JCM Q;  2LNV A;  2I2L A;  3S3O A;  3BY7 A;  3P8H A;  1MHN A;  2E41 A;  4BY6 C;  1VQ5 T;  1JRI A;  1OZ2 A;  4MZT A;  1YI2 A;  2DKG A;  2LQ8 A;  2E1H A;  5GAO p;  2EQM A;  3CXC S;  4N4H A;  3CC4 T;  4GY5 A;  1K8A C;  2RHU A;  4LDV A;  3RKX A;  4C0Z A;  3BDL A;  4LD9 K;  1WQ7 A;  4M7D D;  2PU9 B;  3A8G B;  4XU0 A;  5KE2 A;  2PVD B;  2MWO A;  2YRV A;  3FEO A;  3FLG A;  5LJ5 h;  3CCS A;  2OAU A;  3CD6 A;  4TVR A;  2KSS A;  1Q81 C;  3I55 A;  4M7D E;  3C95 A;  4HCC A;  3CC2 A;  2DTO A;  3A5Z B;  1ZQ1 A;  1BKB A;  3CCV T;  2DEQ A;  4MDW A;  3OSV A;  1BI2 A;  2QQB A;  5KH6 A;  5FU6 B;  1NPR A;  2NLU A;  4PLI A;  1YHQ T;  3M58 A;  3QBY A;  4OMF B;  4X9C A;  5LJ3 d;  4B9W A;  5I2S A;  2X35 A;  4E7K A;  4M7A A;  2EWN A;  4RCC A;  5AYF A;  3G4S T;  2VV5 A;  3PMT A;  3GPL A;  4NOY A;  4C0G A;  2K5I A;  2CZ0 B;  3V7R A;  2EIF A;  2RI3 A;  2VUB A;  1QVF S;  2Y4Y A;  2XDP A;  3H6Z A;  1KG1 A;  3CMA T;  3J80 E;  4E7L A;  1W4S A;  3CPW S;  4DOW A;  3MEU A;  1WGS A;  3AHU A;  4J8O A;  4L5G A;  5LJ3 e;  2E6Z A;  5GMK m;  3CCV A;  2RHY A;  5HY6 A;  5GAM f;  4M77 B;  5DM7 R;  3I56 T;  4XU2 A;  2RJD A;  4LDU A;  5CVI A;  3JCM f;  3OB9 A;  3JB9 F;  2JUF A;  3L2U A;  2P0Q A;  4NL3 A;  1OYX A;  2P0P A;  5D6W A;  5GAN d;  4PLL A;  3G4S A;  4DA4 A;  4M7D F;  1VQK A;  3TRE A;  1BYM A;  4BUG A;  2JN0 A;  4M78 G;  1H3Z A;  4J7I A;  2M0O A;  4KUI A;  5FU7 B;  1O75 A;  4QVZ A;  1PSE A;  4M75 G;  4VUB A;  3JCM d;  3PTA A;  2DIQ A;  3CCL T;  1G3Y A;  3CME A;  3LYI A;  2JZ2 A;  2MAM A;  3OMG A;  4ZGJ B;  3JCM J;  3V7S A;  4YTL A;  5A0D A;  2VGN A;  1KQS A;  1Y7X A;  3HP9 A;  1KC8 U;  2XU8 A;  4JJN K;  2FHD A;  3OW2 A;  4IUU A;  4IKF A;  3HSB A;  5IT9 E;  4FIB A;  3BDU A;  1YCY A;  3NTI A;  2LC4 A;  3OYA A;  4IUQ A;  2F69 A;  2DZC A;  3LH0 A;  3PMI A;  3N5B B;  3DB4 A;  4XTZ A;  2DXB A;  5CAI A;  1VUB A;  2EQJ A;  1KC8 C;  2BIV A;  3CC7 T;  2DTH A;  4C92 A;  1UB4 A;  3MHX A;  1GXI E;  4EMK C;  1OZ3 A;  4R56 A;  4HCB A;  4N0A C;  4R55 A;  1Y71 A;  2DK3 A;  2O4X B;  3WXM B;  3L2Q A;  1M1K U;  3C12 A;  4M78 A;  3OYM A;  1N27 A;  4C8Q E;  4II1 A;  4JLG A;  3M55 A;  3CCQ T;  1VQ9 A;  4L6V 5;  3GIB A;  1VQO A;  2ZCF B;  4BAC A;  1VQ7 T;  1P92 A;  1M4Z A;  3OYD A;  4IUV A;  3QHS A;  3JB9 G;  2HAX A;  3LW5 E;  1XNI A;  2DXC A;  4LD6 A;  3SDZ A;  4C8Q F;  1XQH A;  4MML A;  3E9G A;  3FJP A;  3MEV A;  1VQM A;  4OB3 B;  4M77 F;  3MEA A;  5HK0 A;  4M75 C;  2PVG B;  2PUO B;  5LJ3 f;  4C92 G;  2V8K A;  2YLB A;  4HT9 A;  5LJ3 g;  1XOV A;  2OTJ T;  1KHC A;  4QQ6 A;  3QZ9 B;  3SWN C;  3OYB A;  3X20 B;  5GMK h;  4DQ2 A;  2IG0 A;  5C0M A;  3FC3 A;  1YJW A;  4PJO A;  2ZZD A;  2LQK A;  2QQS A;  1YIT A;  4A54 A;  2K57 A;  4PJO C;  4BY6 B;  4N4I A;  4M7A G;  2DIG A;  3CBM A;  2GFA A;  4ATO A;  3QO3 A;  2BUD A;  1M90 C;  5IAY A;  2X4Y A;  4M75 D;  4M75 A;  5J39 A;  3L2Z A;  5A0L A;  1VQO T;  3NTH A;  2ZPB B;  3MP6 A;  1U1S A;  4M77 D;  3RUX A;  3G6E A;  1VQ9 T;  5GAO m;  2D6F A;  1VQP T;  2E12 A;  3LGL A;  5I21 A;  3E19 A;  1V29 B;  4O6J A;  3SD4 A;  5GAM j;  5DLQ E;  4XAX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...