1LJOA

Crystal structure of an sm-like protein (af-sm2) from archaeoglobus fulgidus at 1.95a resolution
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
75
structure length
75
Chain Sequence
GAMVLPNQMVKSMVGKIIRVEMKGEENQLVGKLEGVDDYMNLYLTNAMECKGEEKVRSLGEIVLRGNNVVLIQPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Archaeal Sm-like protein AF-Sm2
publication title Archaeal Sm proteins form heptameric and hexameric complexes: crystal structures of the Sm1 and Sm2 proteins from the hyperthermophile Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 15
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2002-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ljoA00
4N0AC 2DEQA 5GAOq 5GAN2 1D3BB 1B34B 4M78G 3GIBA 4PJOB 4RCBA 3BW1A 2VC8A 3PGGA 1I4K1 4WF2A 4MMKA 4EMGA 1HK9A 1LNXA 3JCMd 1JRIA 3JCMJ 3V7CA 1M8VA 3L2ZA 4M77C 2DTOA 3SB2A 5GAMe 4M77D 3JCMc 4OP0A 5DY9A 5GMKe 5GANd 5GANj 1LJOA 4M75A 4M75C 5GAMg 4M75D 3VU3C 2E41A 4XU0A 4M7DE 3SWNC 5LJ5f 4JUVA 1D3BA 4M7AC 4PNOA 1B34A 4PJOA 3BFMA 3L1AA 5GAN3 2I2LA 2QTXA 4C8QG 4C92G 4M7AF 4PJOC 4M78E 2EAYA 4PJOD 4JLIA 4QVCA 4HA8A 3EFSA 4F7UF 2DTHA 5GAN7 3RIRA 3QUIA 3INZA 2RD1A 3RUXA 3V8KA 1MGQA 5GAMf 4XTUA 2DZ9A 4HT8A 2JN0A 3RKWA 3JCMg 4XTXA 4JRIA 4XTYA 5LJ3d 4M77G 4NL3A 5LJ3j 4M7AE 4C8QE 4C92E 3JCMh 3JB9H 4M7DB 1JBMA 3V7RA 2RM4A 2DZCA 4M77F 2DKGA 2EWNA 3RKXA 5GANh 3HSBA 4M7AG 4M75F 4QVDA 4M78B 4PJOG 1X01A 2DXTA 2RA2A 1WQWA 3V7SA 3JCMW 1Y96B 3JCMV 4F7UG 2ZGWA 4PJOF 5GMKi 3JCMf 3RERA 4HT9A 2E64A 3JCMQ 4M7DA 4M7DC 4MMLA 5LJ5d 3RESA 2K57A 4J5YA 5LJ5j 4M7DD 4J6XA 4A54A 2EJFA 1KQ1A 2YLBA 4M78A 3JCMe 4M78C 1N9SA 2EJ9A 4C8QB 2HNIA 1M5Q1 2DTIA 2VXFA 4M78D 4XU2A 4C92B 4JRKA 5GAOl 5GANe 1Y96A 2DXUA 4X9DA 3JB9D 3RKYA 1H641 3AHUA 1I5LA 5LJ3h 2RB6A 4EMKB 5GANg 4XQ3A 1TH7A 4XTVA 4F7UE 3JB9J 4M75G 5CAIA 5GMKl 4X9CA 4NOYA 5GAMd 3FJPA 2CGHA 5GAMj 5GMKj 5GAN5 4Y91A 2DJZA 4C8QA 3JCMX 1WQ7A 3BY7A 4C92C 4C92A 4EMHA 4C8QD 5LJ5g 4C92D 3EFRA 2EJGA 4NL2A 3FIFA 4EMKA 2VXEA 4N0AA 2DVEA 4M77E 1WPYA 3V8LA 3BDUA 3SWNB 5GAOp 3JB9I 5GANf 3FB9A 3HFOA 4M7AB 5LJ5h 5GAOn 4M75E 4A53A 3QHSA 4J6YA 4M7DF 5LJ3e 5GAN4 2E65A 5GAN6 3JB9G 4V2SA 1BIAA 1HXDA 2YHTA 4F7UB 5LJ3g 4M77A 4M78F 3JCMb 4XU1A 5GAOm 1KQ2A 3QSUA 2Y90A 4PJOE 5I21A 2FB7A 3QO3A 3JB9F 2FYKA 2YLCA 3HFNA 1BIBA 3SWNA 1I8FA 2E1HA 5GMKm 1YCYA 4M7AA 5GAMh 5GAN8 4XTZA 1WNLA 1U1SA 3V8JA 3M4GA 5GMKh 5GAOr 4M7AD 4XU3A 2E10A 4DQ2A 3JCMP 4F7UA 1N9RA 4M77B 4C8QC 1U1TA 4J6WA 4XTWA 4RCCA 5LJ3f 4C92F 4C8QF 5LJ5e 1LOJA 4M75B 4M7DG 4EMKC 1I81A
chains in the Genus database with same CATH superfamily
3MEUA 1XOVA 2AZVA 2JM9A 3PGGA 2LQWA 2KYBA 4KGXB 2DYBA 3OB9A 2EYWA 3CC2T 2RF0A 1M1KU 2MYSA 2X4WA 2JXBA 3E9FA 3FDRA 2XI9A 2A36A 5J39A 3L2VA 1QW1A 1M30A 1VQLT 3OMGA 2CZ0B 4QVCA 4A4GA 2EQKA 3CBOA 1VQOA 1WYXA 1AWJA 4O5VA 3RKWA 2MWPA 2IVWA 5LJ3j 3MP1A 2RM4A 2DZCA 4M77F 4CI0C 1OEBA 4RTUA 4M78B 2RA2A 1G3YA 4J9IA 3CCUA 2QXFA 4F7UG 2YRVA 2OTLA 2GBQA 1VA7A 4A4KA 1GFDA 2K79A 3OYMA 3VS3A 5GAOl 2PVDB 2LCCA 4JJDA 3RKYA 3M59A 5GAN5 2PVGB 2J6KA 3G6EA 1OPKA 4F04B 4CRIA 3N5BB 4X1VA 2QASA 3LGFA 3EGXA 2L8DA 2ZAEA 4FW2A 3F70A 1A0NB 4ORZA 5HK0A 3CCMQ 4M7DF 1YI2T 4PJJA 2MI6A 2Z0WA 1ARKA 4M77A 2LX9A 1TG0A 2KT1A 3SWNA 1Q95G 4XTZA 1KD1U 3QWYA 5D6WA 5CQYA 2XK0A 3EG0A 1M4ZA 2HSEB 2K4YA 2KROA 3KBGA 1YJNA 1YJWQ 4NS5A 1SRMA 3JV3A 4M4ZA 3V7CA 2LC4A 2ZPBB 5GANd 1Q81U 1OX9A 3QDFA 4M75A 2BZXA 5LJ5f 4JUVA 1D3BA 2EYZA 2KR3A 3CCVQ 4C92G 1QVGP 4M78E 2BE9B 3CC7A 3AT1B 1SSFA 5C6SA 1ZSZC 5IT9E 1D1AA 3CCJQ 1SEMA 1K8AU 2X35A 2KK4A 4A4EA 5IXBA 2P4TA 4LE9A 2CP7A 4F14A 1KC8C 4R56A 3G4SA 4BD3A 5GANh 2F5KA 1VQ6A 3QDRB 2CP3A 3VV0A 4KUDK 3EG2A 1ABOA 2O4XB 3MKDA 4DBQA 3ME9A 1BK2A 2LJ1A 3NHNA 4GLMA 4JRPA 1WIEA 5I22A 1UGRB 2CS7A 2ZCFB 5HKCA 3LGLA 3VYHB 1Y96A 4X9DA 1X6OA 5IHIA 1IREB 4FCYA 2QQAA 1WHGA 1FMVA 1NEGA 5GMKl 4X9CA 2EYQA 2CGHA 2CDTA 1GCQC 2KRMA 3JCMX 1WQ7A 3BY7A 4E7KA 3QWXX 3PIPA 3UF4A 1AZGB 5FU7C 1VQ5T 2X3XD 1ZUUA 4D6WA 1WPYA 1T0HA 2QGGA 3BDUA 1VYVA 3JB9I 1CKAA 4M7AB 1KJWA 1V29B 2RHXA 3CCQT 3H0FA 3QJYA 4JZ3A 2R57A 4CC3A 1QVFP 4E6RA 2FRWA 1PHTA 2F2XA 2EGEA 4XU3A 1RLPC 3L2WA 4CC4B 4IUVA 1JB0E 1YFNA 2RQTA 4EMKC 3HPWA 4BDZA 3S3MA 2CZ1B 2DVJA 2XU8A 2J05A 1VQ9A 3QG1A 2GTJA 1WFWA 2JTMA 1VQOT 3OBYA 4HCCA 2ZPFB 2KVQG 3I55A 3QXEB 1XJWB 4PNOA 5GAN3 2DJQA 4PJOD 2EAYA 2PNIA 1VQPQ 2A0FB 1JJ2S 2HDAA 2WSEE 4PFOA 1VQ8Q 2C0TA 2CSIA 2DK3A 3RUXA 2KMTA 1LVKA 1S72Q 3CCUT 1WI7A 1M3BA 3M0UA 3OMCA 5IXFA 2OTLT 1UEBA 1QWFA 1AWXA 2JMCA 4AG1C 3CXCP 1K9MR 2NUTB 1GBQA 2KSSA 3ZBDA 3MEAA 1SRLA 1GBRA 2Y4XA 2MOXA 4Z89A 3G6ET 2L3SA 4BY6B 5CKEA 1JU5C 4F16A 2CSQA 1M9SA 4M7AE 2VXFA 1OULA 2HKNA 3I5RA 4JDSA 5GANe 4LD9K 1EFNA 4LDYA 1UE9A 2FL7A 2YDLA 1CSKA 3OYKA 2A7YA 2DD4A 4C92D 2GTOA 2YRDA 7AT1B 1M2OA 4BDYA 2DO3A 2VGMA 3EHQA 4RTTA 5KYUA 1I5OB 2IPOB 4M78F 2FG0A 1YJNT 1KQSP 3M53A 1QVPA 2YLCA 3S3NA 1VQKQ 4FYYB 1ZLMA 2O31A 1K9MC 4DQ2A 2K9GA 3JCMP 4XTWA 4RCCA 1SHFA 1PSFA 1LOJA 1F1BB 4M7DG 3SFMA 2L0AA 1YIJQ 2J6FA 2DYIA 1N8RU 1N6AA 3CC7T 3X24B 1M8VA 3C12A 1NLPC 3SB2A 2GQVA 1RAIB 1LJOA 2EQUA 3R6OA 4JJBA 5GAMg 3VU3C 2FPFA 3G4ST 3HTRA 3U23A 1TUDA 1UB4A 2O01E 4HA8A 1VQ6T 2L5QA 3QUIA 4FT4A 4CC2A 5KYWB 3EG9A 3RBBB 3JCMg 4XTXA 2PQWA 3CCMA 2M1HA 1RAHB 1GFCA 4DBRA 3CCEQ 3TREA 1NPRA 4QVDA 2LQNA 3V7SA 2MK5A 2HD0A 4ZN3A 3MP6A 4EDUA 3M56A 3KXTA 1RI0A 3THKA 3VJPA 3WXMB 3I35A 4MMLA 1VQMQ 4J5YA 5LJ5j 3O8VA 1UGQB 1HSQA 1N9SA 4XAXB 5GJWB 1YJWA 3REBB 4BI4A 5D6YA 4MZTA 5FU7B 1TH7A 1AHJB 2AKLA 2H8HA 3SD4A 4OB2B 4Y92A 2NUPB 4OMNA 3X20B 2DJZA 3VS4A 1UGSB 1QP2A 3HP9A 3CCVA 2QQBA 4KH0B 3HFOA 3GNGA 3JSCA 2G6FX 3CCJA 5LJ3g 4ME7A 2M16A 4BB7A 3L42A 1WXBA 3QO3A 4WCIA 5IHKA 1M1FA 1G83A 4HVVA 3MHXA 4A63B 1VQ9T 1EZZB 2D8HA 3VS6A 4FU6A 3D7SB 4F7UA 1U1TA 2FVUA 2KEAA 4J9BA 2DL8A 2P84A 3I55T 1S1NA 2RPNA 4X34A 2ED1A 2XG8D 1E7OA 2VGNA 1WX6A 5I2SA 3OS1A 5KE3A 2KGTA 1HD3A 4M77D 3NPFA 4DOWA 1AVZC 3GF5A 5KYXB 3C95A 1RAAB 3TSWA 4A4FA 4PJOA 4M7AF 1WHMA 2DAQA 1OV3A 3OSSC 1GRIA 4OB3B 5D7UA 4FYWB 2PVOB 3LH5A 4JPBW 3V7RA 4Z8AA 2DPPB 3PE0A 1FX7A 3PMIA 3BE3A 4B6MA 2M0OA 3DB3A 5GMKi 3ER0A 3KUFA 1PWTA 4M7DD 2RJEA 3UA7A 2EW3A 3RDVA 1Y7XA 1IRXA 3CCRQ 1AEYA 1TWBA 1G3SA 2HKQB 2X9HA 3TU4K 1W4SA 1D0YA 1QKXA 2HBPA 2L89A 4C92A 2YSQA 2VKNA 2AK5A 1UGVA 1MUZA 1VQPA 5KCOA 3P8BB 2J6OA 3OS0A 2OI3A 1VQ8A 4RG8A 3JCMb 4C0GA 4AFQC 3VS7A 1S72A 4C0ZA 4LDWA 1NJIR 2E1HA 1RABB 1RAEB 2JNGA 2XD0A 4JJCA 2QGFB 4PL6A 3VS2A 3OW2A 3P8DA 5M9OA 3QPHA 3HL8A 3HRSA 5J26A 2RK1A 1LCKA 4C5EA 4M78G 1PD0A 3E2UA 2YUPA 1OU8A 2RMOA 5DY9A 1KHIA 1NZ9A 3OW2P 3T9NA 4M7AC 3WVEB 1B34A 3E1SA 3CCMT 4KRTA 2C06A 1K9AA 2ZZDA 4FL6A 2XHCA 1IHWA 2YT6A 3JRZA 5KYYA 2CUBA 5AYFA 5GAN7 2DM1A 2C0OA 2ROLA 2NUTA 4IIMA 3VS1A 3LWHA 4PFPA 3JB9H 2XIDA 1NJIC 5CVIA 5KCHA 1YJWT 4FSSA 1K4US 2L3RA 1VQKA 2DLPA 4OMOA 1UGPB 2V1QA 4DEYA 3JCMQ 3VS0A 2PUKB 1P92A 3PNWC 4LUDA 1YWOA 1MNEA 2FRYA 2DIGA 3CCVT 3CPWS 1YIJA 4IUUA 5CKDA 3EH1A 5FWBA 3GPLA 2DBMA 2V8KA 2F2VA 2E12A 3CCJT 2LMJA 1ZSGA 3S6WA 3L2QA 2RJDA 3M57A 2E65A 3CQTA 2X51A 1C0MA 4D8KA 2O9SA 3LH0A 2CT3A 1Y0MA 3GBQA 1YWPA 4ELYC 2LX7A 1BIBA 2RQUA 1KK7A 1QLYA 2QQSA 3CCEA 1QCOA 4BY6C 1WHKA 1RL2A 1WA7A 1ZSZA 2F1LA 3JCMc 4OMMA 1ZBJA 2D0QB 2K5LA 2CP2A 1VQ4Q 2FZKB 2COWA 4ELZC 1VQMA 1I4K1 3UA6A 3HKSA 1KC8R 3VKIA 3M55A 3PVQA 1GXIE 3CD6Q 3TEEA 1Q7YR 4FYVB 1D1BA 1I0CA 2QK0A 4LUEA 3QKJA 1PM3A 2AT1B 2H3JA 6AT1B 2EQJA 1Q82R 2DTHA 3RIRA 2KT8A 2BZYA 5A0DA 1QVGA 2RI2A 1AWWA 1BYMA 1G3TA 4TVRA 1JBMA 1VYUA 2EFIA 2YRCA 4JS4A 4M7AG 1ZUYA 1G2BA 2FZCB 4QKUA 5EG2A 3L2RA 2H3EB 4J8OA 4M7DA 5CK9A 3CCSQ 2DX1A 1AZEA 5KYNA 2W10A 2YLBA 4M78D 4AFUC 4DA4A 1OU9A 2DXUA 1YN8A 2DL3A 1R77A 2E70A 1VQPT 2JJ9A 1K9MU 4Q5WA 1SHGA 4B9XA 4CC7A 1Q7YC 5GAMd 4E7LA 2WSFE 5GMKj 1VQ8T 1M27C 1S72T 3A1PA 1OZ2A 1BBZA 4EMKA 1Q82C 1UG1A 1WXUA 1G5VA 4A53A 4E7SA 3OA6A 2RQRA 5GAN4 2YWWA 3FEOA 3H0IA 2Y90A 5I21A 2HQEA 1JJ2P 3CCLQ 2BE7D 4HVWA 2V26A 3QIIA 3GNFB 2HCKA 3M0QA 5GAMh 2ZPGB 3EGDA 1QVFA 4OGCA 2COZA 4J6WA 2K2VA 5CO7A 4NOYA 5LJ5g 2K5FA 4BE2A 3QYHB 1MMAA 4FSXA 2RJCA 2F69A 1IGQA 2G3RA 4M75C 1BB9A 1JXOA 3VRZA 3MEWA 2LJ3A 1FMWA 2FEIA 1UECA 3CCRA 2DXCA 2LVMA 3CPFA 4AG2C 1QCNA 2E6ZA 1M1KC 1PC0A 2R5MA 2SRCA 2RJFA 2RD1A 1MGQA 4O6JA 1VQKT 1M90U 1RLQC 3EFOB 5LJ3d 2KY9A 1I1JA 2VUBA 2OAUA 3PTAA 1VQNQ 1YIJT 3JCMW 1UJYA 4OVAA 3JCMV 3OY9A 5CKFA 1X2KA 1X75C 4BI8B 4JZ4A 3RESA 1R0BG 5C0MA 3CXCA 1JEGA 1UDLA 3G71Q 5LL6S 4C8QB 2HNIA 4KH1B 2HQXA 2AHJB 5IHNA 5LJ3h 3MO8A 3JB9J 2W0ZA 4MZPA 1Q81R 3FJ5A 3TQ7P 3CMAQ 4PJMA 2XDBA 1WGSA 4OMFB 2JOYA 5GANf 1E6GA 3CCET 3I56Q 4B9WA 2A3LA 3JB9G 1Q86R 4DOVA 4UC4A 2FB7A 3DKMA 1VQMT 4M7AD 1B7TA 1KQSA 2E10A 1PSEA 2LT4A 1WXTA 2SEMA 1VYTA 1TSFA 2VVKA 3A8MB 1YJ9Q 4N0AC 2RNAA 2RN8A 3E19A 2HEQA 1U5SA 1ZQ1A 4LDUA 4FW1A 1ABQA 2KXDA 3BW1A 4KGVB 2K3XA 2EIFA 1AD5A 1JRIA 2DTOA 5GAMe 4OP0A 4Y28E 3A8HB 1BI1A 1SF9A 1Q81C 1WJSA 3QBYA 4YTLA 3OS5A 3J80E 2M02A 2AZSA 2EPDA 2KE9A 4C5HA 2M51A 1Q86C 1FYNA 2VV5A 4C8QE 1K8AC 2PZ1A 2IIMA 2MMPA 2DKGA 2ATCB 3HSBA 4A4HA 2QTVA 5J3BA 1X01A 3HRTA 5FW9A 3OYNA 3MCAB 4IUQA 2ZGWA 3OBWA 2FPDA 2DD5A 3QZ9B 1Z9QA 1K73U 2HL5C 4N4GA 4M78A 2EJ9A 1GL5A 1VQ4A 2OTJQ 4J7IA 2JS2A 3EGXB 1U3OA 2ED0A 3NTIA 3OYYA 3CD6A 4HKEA 4ZGEB 3OYJA 1KSWA 2DA9A 3VRYA 2EJGA 2QQ9A 4OMQA 1QP3A 2RQVA 4IKFA 3SWNB 1ZBXA 2ABLA 3NTHA 5LJ3e 2KNBB 4RMOA 2OX7A 1NPPA 2DL4A 1X2QA 2FYKA 1VIEA 2LTOA 1VOMA 2K7AA 4ZGDB 3OYIA 4J9DA 2NLUA 2PTKA 2QEXQ 4M75B 4ANJA 1RI9A 2RHZA 1JXMA 3CCRT 4JRQA 4BACA 1D3BB 1CKBA 1K1ZA 8AT1B 2KXCA 2LCLA 4L5GA 3CCSA 1KHCA 4WF2A 2EQIA 2VC8A 2P0KA 1HK9A 3A8OB 3J7AF 4FT2A 4OB1B 5HCKA 4IUTA 1ZA2B 4OMLA 2E41A 5L8RE 2FHDA 1ZHIA 2LQKA 2V1RA 2DNUA 2R58A 2RO0A 1YHQQ 2EGAA 1HYOA 2NWMA 5L23A 1H92A 4NL3A 1M2VB 3EG1A 1MHNA 1N5ZA 3CCLA 3MJXA 1WQWA 4MDWA 3M9QA 5I11A 1Y96B 2K6DA 2D1XA 2EKHA 2RK2A 3M0SA 4LNPA 3OYAA 1KG1A 3OYBA 4HT9A 2HAXA 2K57A 1TOVA 2YXYA 1K76A 4FYXB 4FIBA 1SPKA 2DL5A 4DBFA 1WJRA 5CKHA 4HCZA 2O4XA 3L2UA 2LDMA 1I5LA 3EGUA 1TUCA 3CEYA 3LW5E 2RQWA 2QA4Q 5FWCA 2X4JA 3C4SA 3H41A 3M58A 4C0FA 4EMHA 4QVZA 3I5SA 2V8IA 3VUBA 1YITQ 5GJVB 2CUDA 4LDVA 3FB9A 1K0XA 1X69A 5GAOn 4M75E 1WLPB 3QHSA 3CC4Q 3LX7A 2DRKA 1KQ2A 3OYEA 2DMOA 3QSUA 2JT4A 3C0CA 1AT1B 3NGPA 4PLLA 1I8FA 1ACMB 4M7AA 3OQ5A 3OSVA 1U1SA 2ZPHB 3V8JA 4RTXA 1WHHA 2EYXA 1N9RA 1BI3A 1VQNA 4C8QF 4QQ6A 2JZ2A 2BTTA 4PJNA 5GAOp 4ZTFA 5FRNA 5GAN2 3A98A 4EMGA 4LXCA 3G71A 2X4YA 3RMQA 2DXBA 5GANj 3OYFA 4XK8E 1E6HA 2QQRA 2R5AA 2ECZA 4J9HA 4PJOC 1RUWA 2J7IA 4HCBA 3CPWP 4RTYA 1IZ6A 3EFSA 3CMAA 1KC8U 4OGEA 3V8KA 4LD6A 1V1CA 1SKUB 1GCPA 3E9GA 3I56A 3CMEQ 3VS5A 1Q82U 4IUPA 4ATOA 1VQ4T 1W2BS 3UPUA 3DLLA 3RERA 2LNVA 3WVDB 4QT7A 4J83A 5LJ5d 3CD6T 2E5KA 5FRMA 3EH2A 2EKOA 1KQ1A 1JQQA 2GFUA 2JTFA 1K0SA 1YJ9A 1MMGA 1M5Q1 1X6BA 4MDXA 1C6VX 1XQHA 3GOXA 2F2WA 5DLOA 5KYUB 4C92C 1IGUA 3H6ZA 4DBHA 4MZMA 5DLQE 5LJ5h 4J6YA 1QQJA 2HBWA 4ESRA 1HXDA 1RADB 4ZTJA 4XU1A 1OOTA 5DM7R 3JB9F 5KH6A 2DIQA 2K3BA 2QDLA 5D6XA 2L3QA 3LLRA 3CCST 4RTZA 4KT0E 3G7ZA 3M4GA 1NLOC 4HXJA 2DERA 3SEMA 4C8QC 1BU1A 2K3YA 1W1FA 2YUQA 3BDLA 1YNZA 1YP5A 4RCBA 2D8JA 4RTWA 3GLXA 2EQMA 1OPLA 2E5QA 2OTJA 2KI7A 5IN1A 4XU0A 2JW4A 5ECAA 5FLXE 3EG9B 2EYYA 5FU6C 1NE8A 1PRMC 3OW2S 1M8MA 1TU0B 2LT1A 3CCLT 2RI3A 3INZA 2LCSA 5AT1B 4HT8A 2CH4A 4KULA 1C1AA 2CP6A 1NG2A 2JTEA 3TSZA 3SDZA 5KYWA 4M75F 4PJOG 3OYHA 2DBKA 4JS5A 2HZYA 5IAYA 1PNJA 2DFUA 4C5IA 2CP5A 3UT1A 1NEBA 2HMAA 4K11A 4AMCA 3P8HA 2E64A 4J9CA 4II1A 3X25B 2QEXA 4A54A 2V8JA 5CKBA 5I2MA 4PLIA 2L2PA 3M54A 4KBMB 2RB6A 2ZPIB 3OYGA 5CAIA 3FLGA 1QKWA 1VQ7A 2JMAA 3SHWA 1GCQA 4Y91A 3NMZC 3OYCA 2CZ6B 3EFRA 1PCXA 3FIFA 2A28A 3CC2Q 1UUEA 2A08A 5KE2A 2NUPA 1X27A 3ASKA 1VQLQ 1VQNT 4F7UB 4QQDA 1YHQA 3ZFJA 4HCKA 1BCMA 3FC3A 3HFNA 5A2QE 2EGCA 1OYXA 1UHFA 3G71T 1JJ2A 5LJ5e 1I07A 1RACB 1M1KR 1Q86U 1W70A 1I81A 2GFAA 1X6GA 2DEQA 2MWOA 2MCNA 5A0GA 4PJLA 5CIUA 2KRSA 3IQLA 3GIBA 4PJOB 1BI2A 3JCMd 4M77C 3CMAT 2E3IA 1UJ0A 4N4IA 1D09B 2JM8A 2LNHB 4OMPA 5HK3A 3SWNC 1TTHB 2DILA 1IO6A 2RI5A 3I56T 2QA4A 2I2LA 4C8QG 3M0TA 2M9UA 1WHJA 3ZL7C 1M2VA 1G8XA 5KYXA 4BE0A 2DF6A 1YITA 1BKBA 2XICA 3MP8A 2BUDA 4BUGA 1MV3A 3J81E 3CC4A 2E6NA 3JCMh 2P4RA 2OJ2A 1YI2Q 1AOJA 1W6XA 1YJ9T 2B8AA 3H9NA 1T0JA 3JAME 2WSCE 4QW2A 2XMFA 2ZPEB 2KQWA 4M7DC 5HY6A 2ESWA 2F5TX 2EJFA 2KYMA 2MIOA 1NBEB 2RHIA 2DTIA 4C92B 1QVGS 4LDXA 4XU2A 3AHUA 2AKKA 4P5NA 4F7UE 1H8KA 2HL3A 2JVVA 3NTKA 1T3SA 4Z02A 3RR6A 2LZ6B 1WDXA 1XNIA 3NFCA 2LQ8A 2VXEA 3PVLA 4RKUE 4N0AA 1KD1R 4ZN1A 3V8LA 3M5AA 2BIVA 5GAN6 5GAOm 3G1JA 4RUGA 5FROA 4PJOE 2O2OA 2FO0A 4RTVA 2IG0A 2XKOC 4IURA 4EPCA 3CMEA 1Z9ZA 4R0KA 2CREA 1PG5B 2DRMA 2K5IA 4Z88A 2KRNA 1RAFB 2DL7A 4KUIA 2D6FA 2OTJT 1N27A 2CT4A 1B34B 2FZGB 5FU6B 3REAB 1EIFA 1NM7A 4FM4B 3L2ZA 4N4HA 1K8AR 1B07A 5KYYB 2GGRA 9ATCB 2WACA 4OB0B 1D0ZA 3L1AA 2KBTA 2QTXA 4J9EA 1QVFS 4JLIA 4BI3A 1R8OB 1KD1C 2QI2A 1IHVA 1O9SA 1AWOA 1MNDA 5GAMf 2JN0A 4JRIA 1XTDA 4M77G 2RH2A 1VQ5Q 4C92E 2QEXT 1U8RA 2A37A 3TVTA 2CP0A 4RG2A 4PK4A 4QQGA 2DXTA 3CCQQ 3A5ZB 2LP5A 3JCMf 1VQ7T 4C5GA 2YUNA 3I9QA 5CQXA 4JJNK 5A0LA 3DLMA 8ATCB 1M3AA 4OF1A 3JCMe 4J7FA 3PMTA 4C0DC 3UATA 4ZNXA 2AIRB 5GANg 3OS2A 4M75G 3FJPA 1YHQT 2FPEA 4C8QD 1VQOQ 3PIOA 3CBPA 4NL2A 3LWIA 1V76A 4AFSC 1FMKA 1BI0A 2EBPA 2K2MA 3CXCS 4V2SA 1BIAA 4AT1B 3CBMA 1TUGB 1ZSZB 1M90R 3M0PA 1YCSB 2PU9B 3CCUQ 3H0HA 5GMKm 1WNLA 3DB4A 2QDYB 2P0QA 5GMKh 3UDCA 5GAOr 4KGZB 3EG3A 2OTLQ 3EHRA 4M77B 1M3CA 5LJ3f 2L3PA 1VUBA 2M0YA 4J9FA 5GAOq 2QYZA 1Y07A 1DJ7B 2D9TA 2RHUA 3MPUB 2QA4T 1OZ3A 2XDDA 1D1CA 1PKTA 3TCJA 1BCOA 3EAEA 1TXQA 4WTOB 1KIKA 3G6EQ 3HRUA 1YITT 4HVUA 4E7HA 1IB8A 5IH2A 3BFMA 3CC4T 2E4HA 1KQSS 2ROTA 1YBYA 1T3LA 3MEVA 4F7UF 2D0NA 1WJQA 2BKDN 2DZ9A 3CC2A 1NJIU 4XTYA 1VQ7Q 3A8GB 4M7DB 2JUFA 1VQLA 2MAMA 1M90C 3RKXA 2HQHA 2OAWA 4LN2A 3M0RA 2O9VA 3QJ6A 1YJNQ 3LYIA 3M4YA 4PJOF 4EIKA 1EX4A 3R6NA 2RHYA 2PUOB 3META 4J6XA 4AFZC 1NYFA 2X4XA 3QYGB 4M78C 4E2FB 4JRKA 3JB9D 2VWFA 4EMKB 4XTVA 2CZ7B 2KDSA 3CC7Q 2MPXC 4J9GA 1OX8A 3Q1JA 4E7ZA 1HJDA 2JS0A 3CMET 2DVEA 4M77E 2HSPA 2DE0X 3G4SQ 1IXDA 3EGDB 4DEXA 1VQ6Q 2EVRA 4PFZA 4ZGJB 4PKCC 2GQIA 1QWEA 1W2BA 2C0IA 1N8RR 1MV0B 1WHLA 2VB6A 1YI2A 1JO8A 2DEUA 3GP8A 4C92F 1QCFA 4D8DA 4GY5A 3VUZA 4JLGA 1W2BP 3X26B 1UHCA 3O5ZA 5EC7A 4MMKA 1K73R 1LNXA 1TS9A 3H8ZA 2GCXA 3JCMJ 1FWZA 2VASA 5GMKe 2P0PA 2ENMA 2I0NA 4M75D 2XDPA 4M7DE 1MMNA 4E47A 1NYGA 1Y71A 2BZ8A 3S3OA 1OI1A 3PT9A 1WZOA 3ZEHA 1QMCA 2O88A 2CKKA 3ULRB 2VYTA 4XTUA 4R55A 2X3WD 3CPWA 1D0XA 3QZ5B 1ZX6A 1J3TA 1G3WA 2MF2A 3X28B 3RMSA 4E7IA 2J06A 2EWNA 2NUZA 1UTIA 5CCAA 1N8RC 1ZA1B 4C0DB 1ZUKA 3FRNA 1SSHA 2CYZB 2LJ0A 3EFOA 2KAFA 2GF7A 1H3ZA 3A8LB 1B3QA 4VUBA 1VQ9Q 1RAGB 1Y57A 4GLKA 1SG5A 3OYDA 1Q7YU 2NYSA 1K73C 1H641 3I55Q 2QAZA 2QG9B 4XQ3A 1OQKA 2DETA 4L6V5 1M1GA 1X43A 1FXXA 5GAMj 2COYA 4E7JA 2LRQA 1MMDA 4C8QA 5GAN8 1PKSA 1LPLA 2YUOA 3KFVA 4BE1A 1R0CB 1PD1A 2B86A 3PFSA 3URGA 1O75A 2GNCA 2YHTA 1VIFA 3C94A 2E3HA 3RNJA 3VYGA 1U06A 3HHTB 1VQ5A 3UWNA 1YCYA 1PRLC 4IIOA 3OYLA 4F17A 5CR2A 1KFZA 2CH4W 4L59A 1UFFA 3CCQA 4GBQA 1H3HA 2Y4YA
chains in the Genus database with same CATH topology
4X34A 4N0AC 2DEQA 2MWOA 3MEUA 5GAOr 5A0GA 1XOVA 3E19A 5CIUA 1ZQ1A 4LDUA 2XG8D 3GIBA 4PJOB 1BI2A 2VGNA 5I2SA 3OS1A 3BW1A 3PGGA 2K3XA 2EIFA 3JCMd 5KE3A 1JRIA 4M77C 2DTOA 3CMAT 5GAMe 4M77D 4OP0A 4N4IA 4Y28E 4DOWA 3GF5A 3A8HB 3OB9A 1BI1A 5HK3A 3CC2T 3C95A 3SWNC 1M1KU 4A4FA 2RI5A 2X4WA 3E9FA 3I56T 3FDRA 4PJOA 2XI9A 1Q81C 2QA4A 2I2LA 4C8QG 5J39A 4M7AF 3L2VA 1QW1A 1WJSA 2M9UA 3QBYA 1VQLT 3OMGA 2CZ0B 4YTLA 4QVCA 3OS5A 4A4GA 2EQKA 2DAQA 3CBOA 3J80E 1VQOA 4BE0A 4C5HA 1YITA 1BKBA 2XICA 3MP8A 3OSSC 4O5VA 2BUDA 4OB3B 3RKWA 4BUGA 2MWPA 1Q86C 2IVWA 3J81E 5LJ3j 2VV5A 3MP1A 2PVOB 3CC4A 2E6NA 4C8QE 1K8AC 3JCMh 3V7RA 2RM4A 2DPPB 2DZCA 4M77F 2MMPA 2DKGA 4CI0C 1FX7A 3PMIA 4A4HA 2B8AA 1YJ9T 3HSBA 4M78B 5J3BA 2M0OA 1X01A 3HRTA 2RA2A 1G3YA 3JAME 3OYNA 3MCAB 3CCUA 2QXFA 2WSCE 3DB3A 4IUQA 4QW2A 2ZGWA 4F7UG 5GMKi 3OBWA 2YRVA 2ZPEB 2KQWA 3ER0A 2DD5A 3KUFA 3QZ9B 2OTLA 4M7DC 5HY6A 4A4KA 4M7DD 1K73U 2RJEA 2F5TX 2EJFA 4N4GA 3OYMA 4M78A 2EJ9A 5GAOl 2RHIA 2DTIA 4C92B 1QVGS 2PVDB 4XU2A 1VQ4A 4LDXA 2LCCA 1Y7XA 3RKYA 3AHUA 4J7IA 4P5NA 4F7UE 3M59A 2JVVA 1G3SA 3NTIA 3OYYA 3TU4K 5GAN5 3NTKA 3CD6A 1W4SA 2PVGB 4Z02A 3G6EA 4HKEA 4ZGEB 3OYJA 2HBPA 2L89A 4C92A 4CRIA 3N5BB 2EJGA 1XNIA 3LGFA 2LQ8A 2QQ9A 2VXEA 1QP3A 2L8DA 3NFCA 4N0AA 4RKUE 4ZN1A 3V8LA 3SWNB 3M5AA 1VQPA 1ZBXA 4IKFA 3F70A 2BIVA 5KCOA 3P8BB 5HK0A 4M7DF 3NTHA 3OS0A 1YI2T 5LJ3e 5GAN6 2MI6A 1VQ8A 4RG8A 5GAOm 4M77A 3JCMb 5FROA 4RMOA 4PJOE 4C0GA 1NPPA 1S72A 2LX9A 4C0ZA 2IG0A 4LDWA 2XKOC 2FYKA 1VIEA 4IURA 3SWNA 2LTOA 4EPCA 2E1HA 3CMEA 4ZGDB 3OYIA 4XTZA 2JNGA 1KD1U 2XD0A 2K5IA 4PL6A 2NLUA 5CQYA 5D6WA 2XK0A 3OW2A 3P8DA 5M9OA 3QPHA 1M4ZA 4KUIA 2K4YA 3KBGA 2D6FA 2OTJT 1N27A 3HL8A 4M75B 1YJNA 3HRSA 2RHZA 5J26A 3CCRT 2RK1A 4JRQA 4BACA 4NS5A 1D3BB 4C5EA 1B34B 2LCLA 4L5GA 4M78G 3CCSA 1KHCA 4WF2A 2VC8A 1EIFA 5FU6B 2P0KA 1HK9A 3A8OB 4FM4B 3J7AF 4FT2A 3V7CA 3L2ZA 4N4HA 4OB1B 2LC4A 4IUTA 5DY9A 1KHIA 2ZPBB 5GANd 1Q81U 2WACA 4M75A 1NZ9A 3T9NA 2E41A 5L8RE 5LJ5f 4JUVA 1D3BA 4M7AC 3WVEB 1B34A 3E1SA 4OB0B 2FHDA 3CCMT 3L1AA 1ZHIA 2QTXA 4C92G 2C06A 4M78E 2LQKA 2ZZDA 1QVFS 4JLIA 3CC7A 4FL6A 2XHCA 4BI3A 1R8OB 3JRZA 1SSFA 2R58A 5AYFA 5C6SA 5GAN7 5IT9E 1KD1C 2QI2A 1O9SA 2RO0A 1K8AU 2X35A 2KK4A 5GAMf 4A4EA 2JN0A 2P4TA 3LWHA 4JRIA 1XTDA 4M77G 4R56A 4NL3A 2RH2A 3G4SA 1KC8C 4BD3A 4C92E 3JB9H 2XIDA 2QEXT 1NJIC 1U8RA 5CVIA 5GANh 2F5KA 1VQ6A 5KCHA 1YJWT 1MHNA 4RG2A 3CCLA 3QDRB 4QQGA 2DXTA 3VV0A 4KUDK 1WQWA 4MDWA 3A5ZB 5GMKh 2L3RA 3M9QA 1VQKA 2O4XB 1Y96B 3OYAA 2RK2A 3ME9A 3JCMf 1KG1A 3OYBA 1VQ7T 4HT9A 4C5GA 1UGPB 3JCMQ 2Y4YA 2HAXA 2PUKB 2K57A 1P92A 3PNWC 4JRPA 4FIBA 5CQXA 4JJNK 5A0LA 3DLMA 1WJRA 4OF1A 5CKHA 1UGRB 2CS7A 2ZCFB 4HCZA 4J7FA 5HKCA 2DIGA 3LGLA 3PMTA 3JCMe 4C0DC 3CCVT 3VYHB 3CPWS 2O4XA 1Y96A 4IUUA 1X6OA 2LDMA 1IREB 4X9DA 5CKDA 3L2UA 1YIJA 1I5LA 2QQAA 5GANg 3CEYA 3GPLA 3LW5E 3OS2A 4M75G 5GMKl 4X9CA 2V8KA 2X4JA 3C4SA 2EYQA 2CGHA 3FJPA 2E12A 3CCJT 1YHQT 3M58A 1WQ7A 3BY7A 4C0FA 4EMHA 3JCMX 4QVZA 4C8QD 4E7KA 3S6WA 3PIOA 3L2QA 3CBPA 4NL2A 3PIPA 3LWIA 2V8IA 5FU7C 3VUBA 1VQ5T 2RJDA 4D6WA 1WPYA 3BDUA 3M57A 3JB9I 4LDVA 3FB9A 4M7AB 1BI0A 5GAOn 4M75E 3QHSA 3CXCS 2E65A 3LX7A 1V29B 1BIAA 1KQ2A 2RHXA 3CCQT 4V2SA 3QJYA 3OYEA 3CBMA 3LH0A 3QSUA 2R57A 4PLLA 4ELYC 2PU9B 1BIBA 1I8FA 5GMKm 4M7AA 2QQSA 3OQ5A 1WNLA 1U1SA 2QDYB 2P0QA 2ZPHB 3DB4A 3OSVA 3UDCA 4XU3A 3V8JA 4BY6C 3CCEA 3L2WA 1RL2A 1N9RA 1JB0E 4IUVA 4M77B 1BI3A 1VQNA 4C8QF 4QQ6A 5LJ3f 2JZ2A 1VUBA 3JCMc 5FRNA 5GAOp 4ZTFA 4EMKC 3HPWA 2D0QB 4BDZA 3S3MA 2K5LA 5GAOq 5GAN2 2CZ1B 1Y07A 1DJ7B 2D9TA 2RHUA 2XU8A 2QA4T 1OZ3A 4ELZC 2XDDA 1VQMA 4EMGA 1I4K1 1VQ9A 3HKSA 3VKIA 3TCJA 3QG1A 3G71A 2X4YA 2JTMA 3M55A 3EAEA 1GXIE 1VQOT 3RMQA 3TEEA 2DXBA 5GANj 3OBYA 3OYFA 3HRUA 4HCCA 1YITT 2ZPFB 2KVQG 3I55A 3QXEB 4XK8E 4E7HA 2R5AA 2QQRA 4PNOA 3QKJA 3BFMA 5GAN3 3CC4T 4PJOC 4PJOD 2H3JA 4HCBA 2EAYA 2EQJA 1KQSS 1JJ2S 1YBYA 2WSEE 1IZ6A 3EFSA 3MEVA 2DTHA 4F7UF 3RIRA 3CMAA 1KC8U 4OGEA 1WJQA 5A0DA 2DK3A 3RUXA 4LD6A 2KMTA 3V8KA 2BKDN 1QVGA 2DZ9A 2RI2A 3CCUT 3CC2A 1NJIU 3E9GA 1BYMA 3OMCA 4XTYA 3I56A 1G3TA 2OTLT 1UEBA 3A8GB 4TVRA 4M7DB 1JBMA 2JUFA 1VQLA 2MAMA 1M90C 2EFIA 3RKXA 4JS4A 1Q82U 4IUPA 4ATOA 4M7AG 1VQ4T 1W2BS 3QJ6A 3L2RA 5EG2A 3UPUA 2KSSA 3LYIA 3M4YA 4J8OA 3MEAA 3ZBDA 4PJOF 3DLLA 3RERA 2LNVA 3WVDB 4M7DA 5CK9A 2RHYA 4J83A 2Y4XA 5LJ5d 2PUOB 3CD6T 5FRMA 3META 4J6XA 3G6ET 2EKOA 2X4XA 1KQ1A 2YLBA 4BY6B 3QYGB 2JTFA 2GFUA 4M78C 5CKEA 1M9SA 4M78D 1M5Q1 2VXFA 1YJ9A 4M7AE 4JRKA 4DA4A 4JDSA 5GANe 2DXUA 4LD9K 3JB9D 4MDXA 1XQHA 2E70A 4EMKB 4LDYA 1VQPT 1K9MU 4Q5WA 4XTVA 3GOXA 2CZ7B 2FL7A 4B9XA 2KDSA 1Q7YC 5GAMd 4E7LA 3OYKA 2WSFE 5GMKj 5DLOA 1VQ8T 2A7YA 2DD4A 1S72T 4C92C 3H6ZA 4C92D 1OZ2A 3Q1JA 4EMKA 1Q82C 3CMET 2DVEA 4MZMA 4M77E 4BDYA 5DLQE 2DO3A 2VGMA 1G5VA 5LJ5h 4A53A 4J6YA 3OA6A 5GAN4 3FEOA 1HXDA 4M78F 4ZTJA 4XU1A 1YJNT 2Y90A 5DM7R 5I21A 2HQEA 3M53A 4ZGJB 4PKCC 2DIQA 5KH6A 3JB9F 1QVPA 5D6XA 2YLCA 3S3NA 1W2BA 3LLRA 3QIIA 3CCST 3GNFB 4KT0E 5GAMh 2ZPGB 3G7ZA 3M4GA 1QVFA 1YI2A 1K9MC 4OGCA 4DQ2A 3JCMP 4C8QC 4J6WA 4XTWA 4RCCA 4C92F 2K3YA 3GP8A 1PSFA 2K2VA 5CO7A 1LOJA 4NOYA 4M7DG 3SFMA 5LJ5g 4GY5A 2K5FA 4BE2A 3BDLA 3QYHB 3VUZA 4FSXA 4JLGA 4RCBA 3X26B 1N8RU 1N6AA 2RJCA 3CC7T 2F69A 3X24B 4MMKA 3GLXA 2EQMA 1LNXA 3H8ZA 3C12A 2GCXA 2G3RA 3JCMJ 1M8VA 3SB2A 1FWZA 2GQVA 2P0PA 5GMKe 1LJOA 2EQUA 3R6OA 4M75C 5GAMg 2E5QA 2OTJA 4M75D 2XDPA 5IN1A 3MEWA 4XU0A 3VU3C 5FLXE 4M7DE 4E47A 3CCRA 2DXCA 2LVMA 3CPFA 3G4ST 1Y71A 3S3OA 5FU6C 1UB4A 1OI1A 2O01E 3PT9A 1NE8A 3ZEHA 2E6ZA 1M1KC 2R5MA 4HA8A 3OW2S 1VQ6T 2L5QA 2LT1A 2CKKA 2RJFA 3QUIA 2RI3A 4FT4A 3CCLT 3INZA 2RD1A 1MGQA 2VYTA 4O6JA 4XTUA 4R55A 4KULA 1VQKT 3CPWA 1M90U 4HT8A 3JCMg 4XTXA 2PQWA 3QZ5B 5LJ3d 3CCMA 1G3WA 2M1HA 2MF2A 3X28B 3RMSA 4E7IA 3SDZA 2KY9A 3TREA 1NPRA 2EWNA 2VUBA 5CCAA 1N8RC 4M75F 4QVDA 2OAUA 4PJOG 3OYHA 3PTAA 1YIJT 4JS5A 3V7SA 4C0DB 5IAYA 3JCMW 3FRNA 2HD0A 4ZN3A 3MP6A 4C5IA 2CYZB 4EDUA 3M56A 4OVAA 2KAFA 5CKFA 1RI0A 1X75C 3JCMV 2GF7A 3UT1A 3OY9A 3KXTA 3A8LB 1H3ZA 3P8HA 3VJPA 2E64A 4VUBA 4II1A 4MMLA 3WXMB 3RESA 4BI8B 4J5YA 3X25B 5LJ5j 2QEXA 5C0MA 3O8VA 4A54A 3CXCA 1UGQB 2V8JA 4GLKA 5CKBA 5I2MA 4PLIA 1N9SA 5LL6S 4XAXB 4C8QB 2HNIA 3M54A 3OYDA 1YJWA 1Q7YU 4BI4A 4KBMB 5D6YA 2HQXA 2AHJB 1H641 1K73C 4MZTA 2RB6A 5FU7B 2ZPIB 5LJ3h 4XQ3A 1TH7A 3MO8A 3JB9J 1AHJB 3OYGA 4L6V5 5CAIA 3FLGA 1M1GA 4OB2B 3SD4A 1VQ7A 1FXXA 5GAMj 4MZPA 3X20B 4E7JA 4Y91A 2DJZA 2LRQA 3OYCA 4C8QA 5GAN8 2CZ6B 1UGSB 1QP2A 2XDBA 1WGSA 3EFRA 3HP9A 3CCVA 3FIFA 2QQBA 4BE1A 4OMFB 2JOYA 5GANf 3HFOA 3GNGA 3CCET 3PFSA 3URGA 3JSCA 1O75A 5KE2A 4B9WA 2A3LA 3JB9G 3CCJA 3ASKA 1VQNT 2YHTA 5LJ3g 4ME7A 4QQDA 1VIFA 4DOVA 4F7UB 1YHQA 3ZFJA 2M16A 3C94A 4UC4A 3L42A 4BB7A 2FB7A 3DKMA 3QO3A 3VYGA 3FC3A 3HFNA 1M1FA 3HHTB 5A2QE 3UWNA 1VQ5A 1YCYA 3MHXA 1VQMT 4M7AD 1VQ9T 3OYLA 1OYXA 5CR2A 1KQSA 4FU6A 3G71T 2E10A 1JJ2A 1PSEA 2LT4A 4F7UA 4L59A 1U1TA 5LJ5e 2FVUA 3CCQA 1Q86U 3I55T 1I81A 3A8MB 2GFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N0A C;  2DEQ A;  5GAO q;  5GAN 2;  1D3B B;  1B34 B;  4M78 G;  3GIB A;  4PJO B;  4RCB A;  3BW1 A;  2VC8 A;  3PGG A;  1I4K 1;  4WF2 A;  4MMK A;  4EMG A;  1HK9 A;  1LNX A;  3JCM d;  1JRI A;  3JCM J;  3V7C A;  1M8V A;  3L2Z A;  4M77 C;  2DTO A;  3SB2 A;  5GAM e;  4M77 D;  3JCM c;  4OP0 A;  5DY9 A;  5GMK e;  5GAN d;  5GAN j;  1LJO A;  4M75 A;  4M75 C;  5GAM g;  4M75 D;  3VU3 C;  2E41 A;  4XU0 A;  4M7D E;  3SWN C;  5LJ5 f;  4JUV A;  1D3B A;  4M7A C;  4PNO A;  1B34 A;  4PJO A;  3BFM A;  3L1A A;  5GAN 3;  2I2L A;  2QTX A;  4C8Q G;  4C92 G;  4M7A F;  4PJO C;  4M78 E;  2EAY A;  4PJO D;  4JLI A;  4QVC A;  4HA8 A;  3EFS A;  4F7U F;  2DTH A;  5GAN 7;  3RIR A;  3QUI A;  3INZ A;  2RD1 A;  3RUX A;  3V8K A;  1MGQ A;  5GAM f;  4XTU A;  2DZ9 A;  4HT8 A;  2JN0 A;  3RKW A;  3JCM g;  4XTX A;  4JRI A;  4XTY A;  5LJ3 d;  4M77 G;  4NL3 A;  5LJ3 j;  4M7A E;  4C8Q E;  4C92 E;  3JCM h;  3JB9 H;  4M7D B;  1JBM A;  3V7R A;  2RM4 A;  2DZC A;  4M77 F;  2DKG A;  2EWN A;  3RKX A;  5GAN h;  3HSB A;  4M7A G;  4M75 F;  4QVD A;  4M78 B;  4PJO G;  1X01 A;  2DXT A;  2RA2 A;  1WQW A;  3V7S A;  3JCM W;  1Y96 B;  3JCM V;  4F7U G;  2ZGW A;  4PJO F;  5GMK i;  3JCM f;  3RER A;  4HT9 A;  2E64 A;  3JCM Q;  4M7D A;  4M7D C;  4MML A;  5LJ5 d;  3RES A;  2K57 A;  4J5Y A;  5LJ5 j;  4M7D D;  4J6X A;  4A54 A;  2EJF A;  1KQ1 A;  2YLB A;  4M78 A;  3JCM e;  4M78 C;  1N9S A;  2EJ9 A;  4C8Q B;  2HNI A;  1M5Q 1;  2DTI A;  2VXF A;  4M78 D;  4XU2 A;  4C92 B;  4JRK A;  5GAO l;  5GAN e;  1Y96 A;  2DXU A;  4X9D A;  3JB9 D;  3RKY A;  1H64 1;  3AHU A;  1I5L A;  5LJ3 h;  2RB6 A;  4EMK B;  5GAN g;  4XQ3 A;  1TH7 A;  4XTV A;  4F7U E;  3JB9 J;  4M75 G;  5CAI A;  5GMK l;  4X9C A;  4NOY A;  5GAM d;  3FJP A;  2CGH A;  5GAM j;  5GMK j;  5GAN 5;  4Y91 A;  2DJZ A;  4C8Q A;  3JCM X;  1WQ7 A;  3BY7 A;  4C92 C;  4C92 A;  4EMH A;  4C8Q D;  5LJ5 g;  4C92 D;  3EFR A;  2EJG A;  4NL2 A;  3FIF A;  4EMK A;  2VXE A;  4N0A A;  2DVE A;  4M77 E;  1WPY A;  3V8L A;  3BDU A;  3SWN B;  5GAO p;  3JB9 I;  5GAN f;  3FB9 A;  3HFO A;  4M7A B;  5LJ5 h;  5GAO n;  4M75 E;  4A53 A;  3QHS A;  4J6Y A;  4M7D F;  5LJ3 e;  5GAN 4;  2E65 A;  5GAN 6;  3JB9 G;  4V2S A;  1BIA A;  1HXD A;  2YHT A;  4F7U B;  5LJ3 g;  4M77 A;  4M78 F;  3JCM b;  4XU1 A;  5GAO m;  1KQ2 A;  3QSU A;  2Y90 A;  4PJO E;  5I21 A;  2FB7 A;  3QO3 A;  3JB9 F;  2FYK A;  2YLC A;  3HFN A;  1BIB A;  3SWN A;  1I8F A;  2E1H A;  5GMK m;  1YCY A;  4M7A A;  5GAM h;  5GAN 8;  4XTZ A;  1WNL A;  1U1S A;  3V8J A;  3M4G A;  5GMK h;  5GAO r;  4M7A D;  4XU3 A;  2E10 A;  4DQ2 A;  3JCM P;  4F7U A;  1N9R A;  4M77 B;  4C8Q C;  1U1T A;  4J6W A;  4XTW A;  4RCC A;  5LJ3 f;  4C92 F;  4C8Q F;  5LJ5 e;  1LOJ A;  4M75 B;  4M7D G;  4EMK C;  1I81 A; 
#chains in the Genus database with same CATH topology
 3MEU A;  1XOV A;  2AZV A;  2JM9 A;  3PGG A;  2LQW A;  2KYB A;  4KGX B;  2DYB A;  3OB9 A;  2EYW A;  3CC2 T;  2RF0 A;  1M1K U;  2MYS A;  2X4W A;  2JXB A;  3E9F A;  3FDR A;  2XI9 A;  2A36 A;  5J39 A;  3L2V A;  1QW1 A;  1M30 A;  1VQL T;  3OMG A;  2CZ0 B;  4QVC A;  4A4G A;  2EQK A;  3CBO A;  1VQO A;  1WYX A;  1AWJ A;  4O5V A;  3RKW A;  2MWP A;  2IVW A;  5LJ3 j;  3MP1 A;  2RM4 A;  2DZC A;  4M77 F;  4CI0 C;  1OEB A;  4RTU A;  4M78 B;  2RA2 A;  1G3Y A;  4J9I A;  3CCU A;  2QXF A;  4F7U G;  2YRV A;  2OTL A;  2GBQ A;  1VA7 A;  4A4K A;  1GFD A;  2K79 A;  3OYM A;  3VS3 A;  5GAO l;  2PVD B;  2LCC A;  4JJD A;  3RKY A;  3M59 A;  5GAN 5;  2PVG B;  2J6K A;  3G6E A;  1OPK A;  4F04 B;  4CRI A;  3N5B B;  4X1V A;  2QAS A;  3LGF A;  3EGX A;  2L8D A;  2ZAE A;  4FW2 A;  3F70 A;  1A0N B;  4ORZ A;  5HK0 A;  3CCM Q;  4M7D F;  1YI2 T;  4PJJ A;  2MI6 A;  2Z0W A;  1ARK A;  4M77 A;  2LX9 A;  1TG0 A;  2KT1 A;  3SWN A;  1Q95 G;  4XTZ A;  1KD1 U;  3QWY A;  5D6W A;  5CQY A;  2XK0 A;  3EG0 A;  1M4Z A;  2HSE B;  2K4Y A;  2KRO A;  3KBG A;  1YJN A;  1YJW Q;  4NS5 A;  1SRM A;  3JV3 A;  4M4Z A;  3V7C A;  2LC4 A;  2ZPB B;  5GAN d;  1Q81 U;  1OX9 A;  3QDF A;  4M75 A;  2BZX A;  5LJ5 f;  4JUV A;  1D3B A;  2EYZ A;  2KR3 A;  3CCV Q;  4C92 G;  1QVG P;  4M78 E;  2BE9 B;  3CC7 A;  3AT1 B;  1SSF A;  5C6S A;  1ZSZ C;  5IT9 E;  1D1A A;  3CCJ Q;  1SEM A;  1K8A U;  2X35 A;  2KK4 A;  4A4E A;  5IXB A;  2P4T A;  4LE9 A;  2CP7 A;  4F14 A;  1KC8 C;  4R56 A;  3G4S A;  4BD3 A;  5GAN h;  2F5K A;  1VQ6 A;  3QDR B;  2CP3 A;  3VV0 A;  4KUD K;  3EG2 A;  1ABO A;  2O4X B;  3MKD A;  4DBQ A;  3ME9 A;  1BK2 A;  2LJ1 A;  3NHN A;  4GLM A;  4JRP A;  1WIE A;  5I22 A;  1UGR B;  2CS7 A;  2ZCF B;  5HKC A;  3LGL A;  3VYH B;  1Y96 A;  4X9D A;  1X6O A;  5IHI A;  1IRE B;  4FCY A;  2QQA A;  1WHG A;  1FMV A;  1NEG A;  5GMK l;  4X9C A;  2EYQ A;  2CGH A;  2CDT A;  1GCQ C;  2KRM A;  3JCM X;  1WQ7 A;  3BY7 A;  4E7K A;  3QWX X;  3PIP A;  3UF4 A;  1AZG B;  5FU7 C;  1VQ5 T;  2X3X D;  1ZUU A;  4D6W A;  1WPY A;  1T0H A;  2QGG A;  3BDU A;  1VYV A;  3JB9 I;  1CKA A;  4M7A B;  1KJW A;  1V29 B;  2RHX A;  3CCQ T;  3H0F A;  3QJY A;  4JZ3 A;  2R57 A;  4CC3 A;  1QVF P;  4E6R A;  2FRW A;  1PHT A;  2F2X A;  2EGE A;  4XU3 A;  1RLP C;  3L2W A;  4CC4 B;  4IUV A;  1JB0 E;  1YFN A;  2RQT A;  4EMK C;  3HPW A;  4BDZ A;  3S3M A;  2CZ1 B;  2DVJ A;  2XU8 A;  2J05 A;  1VQ9 A;  3QG1 A;  2GTJ A;  1WFW A;  2JTM A;  1VQO T;  3OBY A;  4HCC A;  2ZPF B;  2KVQ G;  3I55 A;  3QXE B;  1XJW B;  4PNO A;  5GAN 3;  2DJQ A;  4PJO D;  2EAY A;  2PNI A;  1VQP Q;  2A0F B;  1JJ2 S;  2HDA A;  2WSE E;  4PFO A;  1VQ8 Q;  2C0T A;  2CSI A;  2DK3 A;  3RUX A;  2KMT A;  1LVK A;  1S72 Q;  3CCU T;  1WI7 A;  1M3B A;  3M0U A;  3OMC A;  5IXF A;  2OTL T;  1UEB A;  1QWF A;  1AWX A;  2JMC A;  4AG1 C;  3CXC P;  1K9M R;  2NUT B;  1GBQ A;  2KSS A;  3ZBD A;  3MEA A;  1SRL A;  1GBR A;  2Y4X A;  2MOX A;  4Z89 A;  3G6E T;  2L3S A;  4BY6 B;  5CKE A;  1JU5 C;  4F16 A;  2CSQ A;  1M9S A;  4M7A E;  2VXF A;  1OUL A;  2HKN A;  3I5R A;  4JDS A;  5GAN e;  4LD9 K;  1EFN A;  4LDY A;  1UE9 A;  2FL7 A;  2YDL A;  1CSK A;  3OYK A;  2A7Y A;  2DD4 A;  4C92 D;  2GTO A;  2YRD A;  7AT1 B;  1M2O A;  4BDY A;  2DO3 A;  2VGM A;  3EHQ A;  4RTT A;  5KYU A;  1I5O B;  2IPO B;  4M78 F;  2FG0 A;  1YJN T;  1KQS P;  3M53 A;  1QVP A;  2YLC A;  3S3N A;  1VQK Q;  4FYY B;  1ZLM A;  2O31 A;  1K9M C;  4DQ2 A;  2K9G A;  3JCM P;  4XTW A;  4RCC A;  1SHF A;  1PSF A;  1LOJ A;  1F1B B;  4M7D G;  3SFM A;  2L0A A;  1YIJ Q;  2J6F A;  2DYI A;  1N8R U;  1N6A A;  3CC7 T;  3X24 B;  1M8V A;  3C12 A;  1NLP C;  3SB2 A;  2GQV A;  1RAI B;  1LJO A;  2EQU A;  3R6O A;  4JJB A;  5GAM g;  3VU3 C;  2FPF A;  3G4S T;  3HTR A;  3U23 A;  1TUD A;  1UB4 A;  2O01 E;  4HA8 A;  1VQ6 T;  2L5Q A;  3QUI A;  4FT4 A;  4CC2 A;  5KYW B;  3EG9 A;  3RBB B;  3JCM g;  4XTX A;  2PQW A;  3CCM A;  2M1H A;  1RAH B;  1GFC A;  4DBR A;  3CCE Q;  3TRE A;  1NPR A;  4QVD A;  2LQN A;  3V7S A;  2MK5 A;  2HD0 A;  4ZN3 A;  3MP6 A;  4EDU A;  3M56 A;  3KXT A;  1RI0 A;  3THK A;  3VJP A;  3WXM B;  3I35 A;  4MML A;  1VQM Q;  4J5Y A;  5LJ5 j;  3O8V A;  1UGQ B;  1HSQ A;  1N9S A;  4XAX B;  5GJW B;  1YJW A;  3REB B;  4BI4 A;  5D6Y A;  4MZT A;  5FU7 B;  1TH7 A;  1AHJ B;  2AKL A;  2H8H A;  3SD4 A;  4OB2 B;  4Y92 A;  2NUP B;  4OMN A;  3X20 B;  2DJZ A;  3VS4 A;  1UGS B;  1QP2 A;  3HP9 A;  3CCV A;  2QQB A;  4KH0 B;  3HFO A;  3GNG A;  3JSC A;  2G6F X;  3CCJ A;  5LJ3 g;  4ME7 A;  2M16 A;  4BB7 A;  3L42 A;  1WXB A;  3QO3 A;  4WCI A;  5IHK A;  1M1F A;  1G83 A;  4HVV A;  3MHX A;  4A63 B;  1VQ9 T;  1EZZ B;  2D8H A;  3VS6 A;  4FU6 A;  3D7S B;  4F7U A;  1U1T A;  2FVU A;  2KEA A;  4J9B A;  2DL8 A;  2P84 A;  3I55 T;  1S1N A;  2RPN A;  4X34 A;  2ED1 A;  2XG8 D;  1E7O A;  2VGN A;  1WX6 A;  5I2S A;  3OS1 A;  5KE3 A;  2KGT A;  1HD3 A;  4M77 D;  3NPF A;  4DOW A;  1AVZ C;  3GF5 A;  5KYX B;  3C95 A;  1RAA B;  3TSW A;  4A4F A;  4PJO A;  4M7A F;  1WHM A;  2DAQ A;  1OV3 A;  3OSS C;  1GRI A;  4OB3 B;  5D7U A;  4FYW B;  2PVO B;  3LH5 A;  4JPB W;  3V7R A;  4Z8A A;  2DPP B;  3PE0 A;  1FX7 A;  3PMI A;  3BE3 A;  4B6M A;  2M0O A;  3DB3 A;  5GMK i;  3ER0 A;  3KUF A;  1PWT A;  4M7D D;  2RJE A;  3UA7 A;  2EW3 A;  3RDV A;  1Y7X A;  1IRX A;  3CCR Q;  1AEY A;  1TWB A;  1G3S A;  2HKQ B;  2X9H A;  3TU4 K;  1W4S A;  1D0Y A;  1QKX A;  2HBP A;  2L89 A;  4C92 A;  2YSQ A;  2VKN A;  2AK5 A;  1UGV A;  1MUZ A;  1VQP A;  5KCO A;  3P8B B;  2J6O A;  3OS0 A;  2OI3 A;  1VQ8 A;  4RG8 A;  3JCM b;  4C0G A;  4AFQ C;  3VS7 A;  1S72 A;  4C0Z A;  4LDW A;  1NJI R;  2E1H A;  1RAB B;  1RAE B;  2JNG A;  2XD0 A;  4JJC A;  2QGF B;  4PL6 A;  3VS2 A;  3OW2 A;  3P8D A;  5M9O A;  3QPH A;  3HL8 A;  3HRS A;  5J26 A;  2RK1 A;  1LCK A;  4C5E A;  4M78 G;  1PD0 A;  3E2U A;  2YUP A;  1OU8 A;  2RMO A;  5DY9 A;  1KHI A;  1NZ9 A;  3OW2 P;  3T9N A;  4M7A C;  3WVE B;  1B34 A;  3E1S A;  3CCM T;  4KRT A;  2C06 A;  1K9A A;  2ZZD A;  4FL6 A;  2XHC A;  1IHW A;  2YT6 A;  3JRZ A;  5KYY A;  2CUB A;  5AYF A;  5GAN 7;  2DM1 A;  2C0O A;  2ROL A;  2NUT A;  4IIM A;  3VS1 A;  3LWH A;  4PFP A;  3JB9 H;  2XID A;  1NJI C;  5CVI A;  5KCH A;  1YJW T;  4FSS A;  1K4U S;  2L3R A;  1VQK A;  2DLP A;  4OMO A;  1UGP B;  2V1Q A;  4DEY A;  3JCM Q;  3VS0 A;  2PUK B;  1P92 A;  3PNW C;  4LUD A;  1YWO A;  1MNE A;  2FRY A;  2DIG A;  3CCV T;  3CPW S;  1YIJ A;  4IUU A;  5CKD A;  3EH1 A;  5FWB A;  3GPL A;  2DBM A;  2V8K A;  2F2V A;  2E12 A;  3CCJ T;  2LMJ A;  1ZSG A;  3S6W A;  3L2Q A;  2RJD A;  3M57 A;  2E65 A;  3CQT A;  2X51 A;  1C0M A;  4D8K A;  2O9S A;  3LH0 A;  2CT3 A;  1Y0M A;  3GBQ A;  1YWP A;  4ELY C;  2LX7 A;  1BIB A;  2RQU A;  1KK7 A;  1QLY A;  2QQS A;  3CCE A;  1QCO A;  4BY6 C;  1WHK A;  1RL2 A;  1WA7 A;  1ZSZ A;  2F1L A;  3JCM c;  4OMM A;  1ZBJ A;  2D0Q B;  2K5L A;  2CP2 A;  1VQ4 Q;  2FZK B;  2COW A;  4ELZ C;  1VQM A;  1I4K 1;  3UA6 A;  3HKS A;  1KC8 R;  3VKI A;  3M55 A;  3PVQ A;  1GXI E;  3CD6 Q;  3TEE A;  1Q7Y R;  4FYV B;  1D1B A;  1I0C A;  2QK0 A;  4LUE A;  3QKJ A;  1PM3 A;  2AT1 B;  2H3J A;  6AT1 B;  2EQJ A;  1Q82 R;  2DTH A;  3RIR A;  2KT8 A;  2BZY A;  5A0D A;  1QVG A;  2RI2 A;  1AWW A;  1BYM A;  1G3T A;  4TVR A;  1JBM A;  1VYU A;  2EFI A;  2YRC A;  4JS4 A;  4M7A G;  1ZUY A;  1G2B A;  2FZC B;  4QKU A;  5EG2 A;  3L2R A;  2H3E B;  4J8O A;  4M7D A;  5CK9 A;  3CCS Q;  2DX1 A;  1AZE A;  5KYN A;  2W10 A;  2YLB A;  4M78 D;  4AFU C;  4DA4 A;  1OU9 A;  2DXU A;  1YN8 A;  2DL3 A;  1R77 A;  2E70 A;  1VQP T;  2JJ9 A;  1K9M U;  4Q5W A;  1SHG A;  4B9X A;  4CC7 A;  1Q7Y C;  5GAM d;  4E7L A;  2WSF E;  5GMK j;  1VQ8 T;  1M27 C;  1S72 T;  3A1P A;  1OZ2 A;  1BBZ A;  4EMK A;  1Q82 C;  1UG1 A;  1WXU A;  1G5V A;  4A53 A;  4E7S A;  3OA6 A;  2RQR A;  5GAN 4;  2YWW A;  3FEO A;  3H0I A;  2Y90 A;  5I21 A;  2HQE A;  1JJ2 P;  3CCL Q;  2BE7 D;  4HVW A;  2V26 A;  3QII A;  3GNF B;  2HCK A;  3M0Q A;  5GAM h;  2ZPG B;  3EGD A;  1QVF A;  4OGC A;  2COZ A;  4J6W A;  2K2V A;  5CO7 A;  4NOY A;  5LJ5 g;  2K5F A;  4BE2 A;  3QYH B;  1MMA A;  4FSX A;  2RJC A;  2F69 A;  1IGQ A;  2G3R A;  4M75 C;  1BB9 A;  1JXO A;  3VRZ A;  3MEW A;  2LJ3 A;  1FMW A;  2FEI A;  1UEC A;  3CCR A;  2DXC A;  2LVM A;  3CPF A;  4AG2 C;  1QCN A;  2E6Z A;  1M1K C;  1PC0 A;  2R5M A;  2SRC A;  2RJF A;  2RD1 A;  1MGQ A;  4O6J A;  1VQK T;  1M90 U;  1RLQ C;  3EFO B;  5LJ3 d;  2KY9 A;  1I1J A;  2VUB A;  2OAU A;  3PTA A;  1VQN Q;  1YIJ T;  3JCM W;  1UJY A;  4OVA A;  3JCM V;  3OY9 A;  5CKF A;  1X2K A;  1X75 C;  4BI8 B;  4JZ4 A;  3RES A;  1R0B G;  5C0M A;  3CXC A;  1JEG A;  1UDL A;  3G71 Q;  5LL6 S;  4C8Q B;  2HNI A;  4KH1 B;  2HQX A;  2AHJ B;  5IHN A;  5LJ3 h;  3MO8 A;  3JB9 J;  2W0Z A;  4MZP A;  1Q81 R;  3FJ5 A;  3TQ7 P;  3CMA Q;  4PJM A;  2XDB A;  1WGS A;  4OMF B;  2JOY A;  5GAN f;  1E6G A;  3CCE T;  3I56 Q;  4B9W A;  2A3L A;  3JB9 G;  1Q86 R;  4DOV A;  4UC4 A;  2FB7 A;  3DKM A;  1VQM T;  4M7A D;  1B7T A;  1KQS A;  2E10 A;  1PSE A;  2LT4 A;  1WXT A;  2SEM A;  1VYT A;  1TSF A;  2VVK A;  3A8M B;  1YJ9 Q;  4N0A C;  2RNA A;  2RN8 A;  3E19 A;  2HEQ A;  1U5S A;  1ZQ1 A;  4LDU A;  4FW1 A;  1ABQ A;  2KXD A;  3BW1 A;  4KGV B;  2K3X A;  2EIF A;  1AD5 A;  1JRI A;  2DTO A;  5GAM e;  4OP0 A;  4Y28 E;  3A8H B;  1BI1 A;  1SF9 A;  1Q81 C;  1WJS A;  3QBY A;  4YTL A;  3OS5 A;  3J80 E;  2M02 A;  2AZS A;  2EPD A;  2KE9 A;  4C5H A;  2M51 A;  1Q86 C;  1FYN A;  2VV5 A;  4C8Q E;  1K8A C;  2PZ1 A;  2IIM A;  2MMP A;  2DKG A;  2ATC B;  3HSB A;  4A4H A;  2QTV A;  5J3B A;  1X01 A;  3HRT A;  5FW9 A;  3OYN A;  3MCA B;  4IUQ A;  2ZGW A;  3OBW A;  2FPD A;  2DD5 A;  3QZ9 B;  1Z9Q A;  1K73 U;  2HL5 C;  4N4G A;  4M78 A;  2EJ9 A;  1GL5 A;  1VQ4 A;  2OTJ Q;  4J7I A;  2JS2 A;  3EGX B;  1U3O A;  2ED0 A;  3NTI A;  3OYY A;  3CD6 A;  4HKE A;  4ZGE B;  3OYJ A;  1KSW A;  2DA9 A;  3VRY A;  2EJG A;  2QQ9 A;  4OMQ A;  1QP3 A;  2RQV A;  4IKF A;  3SWN B;  1ZBX A;  2ABL A;  3NTH A;  5LJ3 e;  2KNB B;  4RMO A;  2OX7 A;  1NPP A;  2DL4 A;  1X2Q A;  2FYK A;  1VIE A;  2LTO A;  1VOM A;  2K7A A;  4ZGD B;  3OYI A;  4J9D A;  2NLU A;  2PTK A;  2QEX Q;  4M75 B;  4ANJ A;  1RI9 A;  2RHZ A;  1JXM A;  3CCR T;  4JRQ A;  4BAC A;  1D3B B;  1CKB A;  1K1Z A;  8AT1 B;  2KXC A;  2LCL A;  4L5G A;  3CCS A;  1KHC A;  4WF2 A;  2EQI A;  2VC8 A;  2P0K A;  1HK9 A;  3A8O B;  3J7A F;  4FT2 A;  4OB1 B;  5HCK A;  4IUT A;  1ZA2 B;  4OML A;  2E41 A;  5L8R E;  2FHD A;  1ZHI A;  2LQK A;  2V1R A;  2DNU A;  2R58 A;  2RO0 A;  1YHQ Q;  2EGA A;  1HYO A;  2NWM A;  5L23 A;  1H92 A;  4NL3 A;  1M2V B;  3EG1 A;  1MHN A;  1N5Z A;  3CCL A;  3MJX A;  1WQW A;  4MDW A;  3M9Q A;  5I11 A;  1Y96 B;  2K6D A;  2D1X A;  2EKH A;  2RK2 A;  3M0S A;  4LNP A;  3OYA A;  1KG1 A;  3OYB A;  4HT9 A;  2HAX A;  2K57 A;  1TOV A;  2YXY A;  1K76 A;  4FYX B;  4FIB A;  1SPK A;  2DL5 A;  4DBF A;  1WJR A;  5CKH A;  4HCZ A;  2O4X A;  3L2U A;  2LDM A;  1I5L A;  3EGU A;  1TUC A;  3CEY A;  3LW5 E;  2RQW A;  2QA4 Q;  5FWC A;  2X4J A;  3C4S A;  3H41 A;  3M58 A;  4C0F A;  4EMH A;  4QVZ A;  3I5S A;  2V8I A;  3VUB A;  1YIT Q;  5GJV B;  2CUD A;  4LDV A;  3FB9 A;  1K0X A;  1X69 A;  5GAO n;  4M75 E;  1WLP B;  3QHS A;  3CC4 Q;  3LX7 A;  2DRK A;  1KQ2 A;  3OYE A;  2DMO A;  3QSU A;  2JT4 A;  3C0C A;  1AT1 B;  3NGP A;  4PLL A;  1I8F A;  1ACM B;  4M7A A;  3OQ5 A;  3OSV A;  1U1S A;  2ZPH B;  3V8J A;  4RTX A;  1WHH A;  2EYX A;  1N9R A;  1BI3 A;  1VQN A;  4C8Q F;  4QQ6 A;  2JZ2 A;  2BTT A;  4PJN A;  5GAO p;  4ZTF A;  5FRN A;  5GAN 2;  3A98 A;  4EMG A;  4LXC A;  3G71 A;  2X4Y A;  3RMQ A;  2DXB A;  5GAN j;  3OYF A;  4XK8 E;  1E6H A;  2QQR A;  2R5A A;  2ECZ A;  4J9H A;  4PJO C;  1RUW A;  2J7I A;  4HCB A;  3CPW P;  4RTY A;  1IZ6 A;  3EFS A;  3CMA A;  1KC8 U;  4OGE A;  3V8K A;  4LD6 A;  1V1C A;  1SKU B;  1GCP A;  3E9G A;  3I56 A;  3CME Q;  3VS5 A;  1Q82 U;  4IUP A;  4ATO A;  1VQ4 T;  1W2B S;  3UPU A;  3DLL A;  3RER A;  2LNV A;  3WVD B;  4QT7 A;  4J83 A;  5LJ5 d;  3CD6 T;  2E5K A;  5FRM A;  3EH2 A;  2EKO A;  1KQ1 A;  1JQQ A;  2GFU A;  2JTF A;  1K0S A;  1YJ9 A;  1MMG A;  1M5Q 1;  1X6B A;  4MDX A;  1C6V X;  1XQH A;  3GOX A;  2F2W A;  5DLO A;  5KYU B;  4C92 C;  1IGU A;  3H6Z A;  4DBH A;  4MZM A;  5DLQ E;  5LJ5 h;  4J6Y A;  1QQJ A;  2HBW A;  4ESR A;  1HXD A;  1RAD B;  4ZTJ A;  4XU1 A;  1OOT A;  5DM7 R;  3JB9 F;  5KH6 A;  2DIQ A;  2K3B A;  2QDL A;  5D6X A;  2L3Q A;  3LLR A;  3CCS T;  4RTZ A;  4KT0 E;  3G7Z A;  3M4G A;  1NLO C;  4HXJ A;  2DER A;  3SEM A;  4C8Q C;  1BU1 A;  2K3Y A;  1W1F A;  2YUQ A;  3BDL A;  1YNZ A;  1YP5 A;  4RCB A;  2D8J A;  4RTW A;  3GLX A;  2EQM A;  1OPL A;  2E5Q A;  2OTJ A;  2KI7 A;  5IN1 A;  4XU0 A;  2JW4 A;  5ECA A;  5FLX E;  3EG9 B;  2EYY A;  5FU6 C;  1NE8 A;  1PRM C;  3OW2 S;  1M8M A;  1TU0 B;  2LT1 A;  3CCL T;  2RI3 A;  3INZ A;  2LCS A;  5AT1 B;  4HT8 A;  2CH4 A;  4KUL A;  1C1A A;  2CP6 A;  1NG2 A;  2JTE A;  3TSZ A;  3SDZ A;  5KYW A;  4M75 F;  4PJO G;  3OYH A;  2DBK A;  4JS5 A;  2HZY A;  5IAY A;  1PNJ A;  2DFU A;  4C5I A;  2CP5 A;  3UT1 A;  1NEB A;  2HMA A;  4K11 A;  4AMC A;  3P8H A;  2E64 A;  4J9C A;  4II1 A;  3X25 B;  2QEX A;  4A54 A;  2V8J A;  5CKB A;  5I2M A;  4PLI A;  2L2P A;  3M54 A;  4KBM B;  2RB6 A;  2ZPI B;  3OYG A;  5CAI A;  3FLG A;  1QKW A;  1VQ7 A;  2JMA A;  3SHW A;  1GCQ A;  4Y91 A;  3NMZ C;  3OYC A;  2CZ6 B;  3EFR A;  1PCX A;  3FIF A;  2A28 A;  3CC2 Q;  1UUE A;  2A08 A;  5KE2 A;  2NUP A;  1X27 A;  3ASK A;  1VQL Q;  1VQN T;  4F7U B;  4QQD A;  1YHQ A;  3ZFJ A;  4HCK A;  1BCM A;  3FC3 A;  3HFN A;  5A2Q E;  2EGC A;  1OYX A;  1UHF A;  3G71 T;  1JJ2 A;  5LJ5 e;  1I07 A;  1RAC B;  1M1K R;  1Q86 U;  1W70 A;  1I81 A;  2GFA A;  1X6G A;  2DEQ A;  2MWO A;  2MCN A;  5A0G A;  4PJL A;  5CIU A;  2KRS A;  3IQL A;  3GIB A;  4PJO B;  1BI2 A;  3JCM d;  4M77 C;  3CMA T;  2E3I A;  1UJ0 A;  4N4I A;  1D09 B;  2JM8 A;  2LNH B;  4OMP A;  5HK3 A;  3SWN C;  1TTH B;  2DIL A;  1IO6 A;  2RI5 A;  3I56 T;  2QA4 A;  2I2L A;  4C8Q G;  3M0T A;  2M9U A;  1WHJ A;  3ZL7 C;  1M2V A;  1G8X A;  5KYX A;  4BE0 A;  2DF6 A;  1YIT A;  1BKB A;  2XIC A;  3MP8 A;  2BUD A;  4BUG A;  1MV3 A;  3J81 E;  3CC4 A;  2E6N A;  3JCM h;  2P4R A;  2OJ2 A;  1YI2 Q;  1AOJ A;  1W6X A;  1YJ9 T;  2B8A A;  3H9N A;  1T0J A;  3JAM E;  2WSC E;  4QW2 A;  2XMF A;  2ZPE B;  2KQW A;  4M7D C;  5HY6 A;  2ESW A;  2F5T X;  2EJF A;  2KYM A;  2MIO A;  1NBE B;  2RHI A;  2DTI A;  4C92 B;  1QVG S;  4LDX A;  4XU2 A;  3AHU A;  2AKK A;  4P5N A;  4F7U E;  1H8K A;  2HL3 A;  2JVV A;  3NTK A;  1T3S A;  4Z02 A;  3RR6 A;  2LZ6 B;  1WDX A;  1XNI A;  3NFC A;  2LQ8 A;  2VXE A;  3PVL A;  4RKU E;  4N0A A;  1KD1 R;  4ZN1 A;  3V8L A;  3M5A A;  2BIV A;  5GAN 6;  5GAO m;  3G1J A;  4RUG A;  5FRO A;  4PJO E;  2O2O A;  2FO0 A;  4RTV A;  2IG0 A;  2XKO C;  4IUR A;  4EPC A;  3CME A;  1Z9Z A;  4R0K A;  2CRE A;  1PG5 B;  2DRM A;  2K5I A;  4Z88 A;  2KRN A;  1RAF B;  2DL7 A;  4KUI A;  2D6F A;  2OTJ T;  1N27 A;  2CT4 A;  1B34 B;  2FZG B;  5FU6 B;  3REA B;  1EIF A;  1NM7 A;  4FM4 B;  3L2Z A;  4N4H A;  1K8A R;  1B07 A;  5KYY B;  2GGR A;  9ATC B;  2WAC A;  4OB0 B;  1D0Z A;  3L1A A;  2KBT A;  2QTX A;  4J9E A;  1QVF S;  4JLI A;  4BI3 A;  1R8O B;  1KD1 C;  2QI2 A;  1IHV A;  1O9S A;  1AWO A;  1MND A;  5GAM f;  2JN0 A;  4JRI A;  1XTD A;  4M77 G;  2RH2 A;  1VQ5 Q;  4C92 E;  2QEX T;  1U8R A;  2A37 A;  3TVT A;  2CP0 A;  4RG2 A;  4PK4 A;  4QQG A;  2DXT A;  3CCQ Q;  3A5Z B;  2LP5 A;  3JCM f;  1VQ7 T;  4C5G A;  2YUN A;  3I9Q A;  5CQX A;  4JJN K;  5A0L A;  3DLM A;  8ATC B;  1M3A A;  4OF1 A;  3JCM e;  4J7F A;  3PMT A;  4C0D C;  3UAT A;  4ZNX A;  2AIR B;  5GAN g;  3OS2 A;  4M75 G;  3FJP A;  1YHQ T;  2FPE A;  4C8Q D;  1VQO Q;  3PIO A;  3CBP A;  4NL2 A;  3LWI A;  1V76 A;  4AFS C;  1FMK A;  1BI0 A;  2EBP A;  2K2M A;  3CXC S;  4V2S A;  1BIA A;  4AT1 B;  3CBM A;  1TUG B;  1ZSZ B;  1M90 R;  3M0P A;  1YCS B;  2PU9 B;  3CCU Q;  3H0H A;  5GMK m;  1WNL A;  3DB4 A;  2QDY B;  2P0Q A;  5GMK h;  3UDC A;  5GAO r;  4KGZ B;  3EG3 A;  2OTL Q;  3EHR A;  4M77 B;  1M3C A;  5LJ3 f;  2L3P A;  1VUB A;  2M0Y A;  4J9F A;  5GAO q;  2QYZ A;  1Y07 A;  1DJ7 B;  2D9T A;  2RHU A;  3MPU B;  2QA4 T;  1OZ3 A;  2XDD A;  1D1C A;  1PKT A;  3TCJ A;  1BCO A;  3EAE A;  1TXQ A;  4WTO B;  1KIK A;  3G6E Q;  3HRU A;  1YIT T;  4HVU A;  4E7H A;  1IB8 A;  5IH2 A;  3BFM A;  3CC4 T;  2E4H A;  1KQS S;  2ROT A;  1YBY A;  1T3L A;  3MEV A;  4F7U F;  2D0N A;  1WJQ A;  2BKD N;  2DZ9 A;  3CC2 A;  1NJI U;  4XTY A;  1VQ7 Q;  3A8G B;  4M7D B;  2JUF A;  1VQL A;  2MAM A;  1M90 C;  3RKX A;  2HQH A;  2OAW A;  4LN2 A;  3M0R A;  2O9V A;  3QJ6 A;  1YJN Q;  3LYI A;  3M4Y A;  4PJO F;  4EIK A;  1EX4 A;  3R6N A;  2RHY A;  2PUO B;  3MET A;  4J6X A;  4AFZ C;  1NYF A;  2X4X A;  3QYG B;  4M78 C;  4E2F B;  4JRK A;  3JB9 D;  2VWF A;  4EMK B;  4XTV A;  2CZ7 B;  2KDS A;  3CC7 Q;  2MPX C;  4J9G A;  1OX8 A;  3Q1J A;  4E7Z A;  1HJD A;  2JS0 A;  3CME T;  2DVE A;  4M77 E;  2HSP A;  2DE0 X;  3G4S Q;  1IXD A;  3EGD B;  4DEX A;  1VQ6 Q;  2EVR A;  4PFZ A;  4ZGJ B;  4PKC C;  2GQI A;  1QWE A;  1W2B A;  2C0I A;  1N8R R;  1MV0 B;  1WHL A;  2VB6 A;  1YI2 A;  1JO8 A;  2DEU A;  3GP8 A;  4C92 F;  1QCF A;  4D8D A;  4GY5 A;  3VUZ A;  4JLG A;  1W2B P;  3X26 B;  1UHC A;  3O5Z A;  5EC7 A;  4MMK A;  1K73 R;  1LNX A;  1TS9 A;  3H8Z A;  2GCX A;  3JCM J;  1FWZ A;  2VAS A;  5GMK e;  2P0P A;  2ENM A;  2I0N A;  4M75 D;  2XDP A;  4M7D E;  1MMN A;  4E47 A;  1NYG A;  1Y71 A;  2BZ8 A;  3S3O A;  1OI1 A;  3PT9 A;  1WZO A;  3ZEH A;  1QMC A;  2O88 A;  2CKK A;  3ULR B;  2VYT A;  4XTU A;  4R55 A;  2X3W D;  3CPW A;  1D0X A;  3QZ5 B;  1ZX6 A;  1J3T A;  1G3W A;  2MF2 A;  3X28 B;  3RMS A;  4E7I A;  2J06 A;  2EWN A;  2NUZ A;  1UTI A;  5CCA A;  1N8R C;  1ZA1 B;  4C0D B;  1ZUK A;  3FRN A;  1SSH A;  2CYZ B;  2LJ0 A;  3EFO A;  2KAF A;  2GF7 A;  1H3Z A;  3A8L B;  1B3Q A;  4VUB A;  1VQ9 Q;  1RAG B;  1Y57 A;  4GLK A;  1SG5 A;  3OYD A;  1Q7Y U;  2NYS A;  1K73 C;  1H64 1;  3I55 Q;  2QAZ A;  2QG9 B;  4XQ3 A;  1OQK A;  2DET A;  4L6V 5;  1M1G A;  1X43 A;  1FXX A;  5GAM j;  2COY A;  4E7J A;  2LRQ A;  1MMD A;  4C8Q A;  5GAN 8;  1PKS A;  1LPL A;  2YUO A;  3KFV A;  4BE1 A;  1R0C B;  1PD1 A;  2B86 A;  3PFS A;  3URG A;  1O75 A;  2GNC A;  2YHT A;  1VIF A;  3C94 A;  2E3H A;  3RNJ A;  3VYG A;  1U06 A;  3HHT B;  1VQ5 A;  3UWN A;  1YCY A;  1PRL C;  4IIO A;  3OYL A;  4F17 A;  5CR2 A;  1KFZ A;  2CH4 W;  4L59 A;  1UFF A;  3CCQ A;  4GBQ A;  1H3H A;  2Y4Y A; 
#chains in the Genus database with same CATH homology
 4X34 A;  4N0A C;  2DEQ A;  2MWO A;  3MEU A;  5GAO r;  5A0G A;  1XOV A;  3E19 A;  5CIU A;  1ZQ1 A;  4LDU A;  2XG8 D;  3GIB A;  4PJO B;  1BI2 A;  2VGN A;  5I2S A;  3OS1 A;  3BW1 A;  3PGG A;  2K3X A;  2EIF A;  3JCM d;  5KE3 A;  1JRI A;  4M77 C;  2DTO A;  3CMA T;  5GAM e;  4M77 D;  4OP0 A;  4N4I A;  4Y28 E;  4DOW A;  3GF5 A;  3A8H B;  3OB9 A;  1BI1 A;  5HK3 A;  3CC2 T;  3C95 A;  3SWN C;  1M1K U;  4A4F A;  2RI5 A;  2X4W A;  3E9F A;  3I56 T;  3FDR A;  4PJO A;  2XI9 A;  1Q81 C;  2QA4 A;  2I2L A;  4C8Q G;  5J39 A;  4M7A F;  3L2V A;  1QW1 A;  1WJS A;  2M9U A;  3QBY A;  1VQL T;  3OMG A;  2CZ0 B;  4YTL A;  4QVC A;  3OS5 A;  4A4G A;  2EQK A;  2DAQ A;  3CBO A;  3J80 E;  1VQO A;  4BE0 A;  4C5H A;  1YIT A;  1BKB A;  2XIC A;  3MP8 A;  3OSS C;  4O5V A;  2BUD A;  4OB3 B;  3RKW A;  4BUG A;  2MWP A;  1Q86 C;  2IVW A;  3J81 E;  5LJ3 j;  2VV5 A;  3MP1 A;  2PVO B;  3CC4 A;  2E6N A;  4C8Q E;  1K8A C;  3JCM h;  3V7R A;  2RM4 A;  2DPP B;  2DZC A;  4M77 F;  2MMP A;  2DKG A;  4CI0 C;  1FX7 A;  3PMI A;  4A4H A;  2B8A A;  1YJ9 T;  3HSB A;  4M78 B;  5J3B A;  2M0O A;  1X01 A;  3HRT A;  2RA2 A;  1G3Y A;  3JAM E;  3OYN A;  3MCA B;  3CCU A;  2QXF A;  2WSC E;  3DB3 A;  4IUQ A;  4QW2 A;  2ZGW A;  4F7U G;  5GMK i;  3OBW A;  2YRV A;  2ZPE B;  2KQW A;  3ER0 A;  2DD5 A;  3KUF A;  3QZ9 B;  2OTL A;  4M7D C;  5HY6 A;  4A4K A;  4M7D D;  1K73 U;  2RJE A;  2F5T X;  2EJF A;  4N4G A;  3OYM A;  4M78 A;  2EJ9 A;  5GAO l;  2RHI A;  2DTI A;  4C92 B;  1QVG S;  2PVD B;  4XU2 A;  1VQ4 A;  4LDX A;  2LCC A;  1Y7X A;  3RKY A;  3AHU A;  4J7I A;  4P5N A;  4F7U E;  3M59 A;  2JVV A;  1G3S A;  3NTI A;  3OYY A;  3TU4 K;  5GAN 5;  3NTK A;  3CD6 A;  1W4S A;  2PVG B;  4Z02 A;  3G6E A;  4HKE A;  4ZGE B;  3OYJ A;  2HBP A;  2L89 A;  4C92 A;  4CRI A;  3N5B B;  2EJG A;  1XNI A;  3LGF A;  2LQ8 A;  2QQ9 A;  2VXE A;  1QP3 A;  2L8D A;  3NFC A;  4N0A A;  4RKU E;  4ZN1 A;  3V8L A;  3SWN B;  3M5A A;  1VQP A;  1ZBX A;  4IKF A;  3F70 A;  2BIV A;  5KCO A;  3P8B B;  5HK0 A;  4M7D F;  3NTH A;  3OS0 A;  1YI2 T;  5LJ3 e;  5GAN 6;  2MI6 A;  1VQ8 A;  4RG8 A;  5GAO m;  4M77 A;  3JCM b;  5FRO A;  4RMO A;  4PJO E;  4C0G A;  1NPP A;  1S72 A;  2LX9 A;  4C0Z A;  2IG0 A;  4LDW A;  2XKO C;  2FYK A;  1VIE A;  4IUR A;  3SWN A;  2LTO A;  4EPC A;  2E1H A;  3CME A;  4ZGD B;  3OYI A;  4XTZ A;  2JNG A;  1KD1 U;  2XD0 A;  2K5I A;  4PL6 A;  2NLU A;  5CQY A;  5D6W A;  2XK0 A;  3OW2 A;  3P8D A;  5M9O A;  3QPH A;  1M4Z A;  4KUI A;  2K4Y A;  3KBG A;  2D6F A;  2OTJ T;  1N27 A;  3HL8 A;  4M75 B;  1YJN A;  3HRS A;  2RHZ A;  5J26 A;  3CCR T;  2RK1 A;  4JRQ A;  4BAC A;  4NS5 A;  1D3B B;  4C5E A;  1B34 B;  2LCL A;  4L5G A;  4M78 G;  3CCS A;  1KHC A;  4WF2 A;  2VC8 A;  1EIF A;  5FU6 B;  2P0K A;  1HK9 A;  3A8O B;  4FM4 B;  3J7A F;  4FT2 A;  3V7C A;  3L2Z A;  4N4H A;  4OB1 B;  2LC4 A;  4IUT A;  5DY9 A;  1KHI A;  2ZPB B;  5GAN d;  1Q81 U;  2WAC A;  4M75 A;  1NZ9 A;  3T9N A;  2E41 A;  5L8R E;  5LJ5 f;  4JUV A;  1D3B A;  4M7A C;  3WVE B;  1B34 A;  3E1S A;  4OB0 B;  2FHD A;  3CCM T;  3L1A A;  1ZHI A;  2QTX A;  4C92 G;  2C06 A;  4M78 E;  2LQK A;  2ZZD A;  1QVF S;  4JLI A;  3CC7 A;  4FL6 A;  2XHC A;  4BI3 A;  1R8O B;  3JRZ A;  1SSF A;  2R58 A;  5AYF A;  5C6S A;  5GAN 7;  5IT9 E;  1KD1 C;  2QI2 A;  1O9S A;  2RO0 A;  1K8A U;  2X35 A;  2KK4 A;  5GAM f;  4A4E A;  2JN0 A;  2P4T A;  3LWH A;  4JRI A;  1XTD A;  4M77 G;  4R56 A;  4NL3 A;  2RH2 A;  3G4S A;  1KC8 C;  4BD3 A;  4C92 E;  3JB9 H;  2XID A;  2QEX T;  1NJI C;  1U8R A;  5CVI A;  5GAN h;  2F5K A;  1VQ6 A;  5KCH A;  1YJW T;  1MHN A;  4RG2 A;  3CCL A;  3QDR B;  4QQG A;  2DXT A;  3VV0 A;  4KUD K;  1WQW A;  4MDW A;  3A5Z B;  5GMK h;  2L3R A;  3M9Q A;  1VQK A;  2O4X B;  1Y96 B;  3OYA A;  2RK2 A;  3ME9 A;  3JCM f;  1KG1 A;  3OYB A;  1VQ7 T;  4HT9 A;  4C5G A;  1UGP B;  3JCM Q;  2Y4Y A;  2HAX A;  2PUK B;  2K57 A;  1P92 A;  3PNW C;  4JRP A;  4FIB A;  5CQX A;  4JJN K;  5A0L A;  3DLM A;  1WJR A;  4OF1 A;  5CKH A;  1UGR B;  2CS7 A;  2ZCF B;  4HCZ A;  4J7F A;  5HKC A;  2DIG A;  3LGL A;  3PMT A;  3JCM e;  4C0D C;  3CCV T;  3VYH B;  3CPW S;  2O4X A;  1Y96 A;  4IUU A;  1X6O A;  2LDM A;  1IRE B;  4X9D A;  5CKD A;  3L2U A;  1YIJ A;  1I5L A;  2QQA A;  5GAN g;  3CEY A;  3GPL A;  3LW5 E;  3OS2 A;  4M75 G;  5GMK l;  4X9C A;  2V8K A;  2X4J A;  3C4S A;  2EYQ A;  2CGH A;  3FJP A;  2E12 A;  3CCJ T;  1YHQ T;  3M58 A;  1WQ7 A;  3BY7 A;  4C0F A;  4EMH A;  3JCM X;  4QVZ A;  4C8Q D;  4E7K A;  3S6W A;  3PIO A;  3L2Q A;  3CBP A;  4NL2 A;  3PIP A;  3LWI A;  2V8I A;  5FU7 C;  3VUB A;  1VQ5 T;  2RJD A;  4D6W A;  1WPY A;  3BDU A;  3M57 A;  3JB9 I;  4LDV A;  3FB9 A;  4M7A B;  1BI0 A;  5GAO n;  4M75 E;  3QHS A;  3CXC S;  2E65 A;  3LX7 A;  1V29 B;  1BIA A;  1KQ2 A;  2RHX A;  3CCQ T;  4V2S A;  3QJY A;  3OYE A;  3CBM A;  3LH0 A;  3QSU A;  2R57 A;  4PLL A;  4ELY C;  2PU9 B;  1BIB A;  1I8F A;  5GMK m;  4M7A A;  2QQS A;  3OQ5 A;  1WNL A;  1U1S A;  2QDY B;  2P0Q A;  2ZPH B;  3DB4 A;  3OSV A;  3UDC A;  4XU3 A;  3V8J A;  4BY6 C;  3CCE A;  3L2W A;  1RL2 A;  1N9R A;  1JB0 E;  4IUV A;  4M77 B;  1BI3 A;  1VQN A;  4C8Q F;  4QQ6 A;  5LJ3 f;  2JZ2 A;  1VUB A;  3JCM c;  5FRN A;  5GAO p;  4ZTF A;  4EMK C;  3HPW A;  2D0Q B;  4BDZ A;  3S3M A;  2K5L A;  5GAO q;  5GAN 2;  2CZ1 B;  1Y07 A;  1DJ7 B;  2D9T A;  2RHU A;  2XU8 A;  2QA4 T;  1OZ3 A;  4ELZ C;  2XDD A;  1VQM A;  4EMG A;  1I4K 1;  1VQ9 A;  3HKS A;  3VKI A;  3TCJ A;  3QG1 A;  3G71 A;  2X4Y A;  2JTM A;  3M55 A;  3EAE A;  1GXI E;  1VQO T;  3RMQ A;  3TEE A;  2DXB A;  5GAN j;  3OBY A;  3OYF A;  3HRU A;  4HCC A;  1YIT T;  2ZPF B;  2KVQ G;  3I55 A;  3QXE B;  4XK8 E;  4E7H A;  2R5A A;  2QQR A;  4PNO A;  3QKJ A;  3BFM A;  5GAN 3;  3CC4 T;  4PJO C;  4PJO D;  2H3J A;  4HCB A;  2EAY A;  2EQJ A;  1KQS S;  1JJ2 S;  1YBY A;  2WSE E;  1IZ6 A;  3EFS A;  3MEV A;  2DTH A;  4F7U F;  3RIR A;  3CMA A;  1KC8 U;  4OGE A;  1WJQ A;  5A0D A;  2DK3 A;  3RUX A;  4LD6 A;  2KMT A;  3V8K A;  2BKD N;  1QVG A;  2DZ9 A;  2RI2 A;  3CCU T;  3CC2 A;  1NJI U;  3E9G A;  1BYM A;  3OMC A;  4XTY A;  3I56 A;  1G3T A;  2OTL T;  1UEB A;  3A8G B;  4TVR A;  4M7D B;  1JBM A;  2JUF A;  1VQL A;  2MAM A;  1M90 C;  2EFI A;  3RKX A;  4JS4 A;  1Q82 U;  4IUP A;  4ATO A;  4M7A G;  1VQ4 T;  1W2B S;  3QJ6 A;  3L2R A;  5EG2 A;  3UPU A;  2KSS A;  3LYI A;  3M4Y A;  4J8O A;  3MEA A;  3ZBD A;  4PJO F;  3DLL A;  3RER A;  2LNV A;  3WVD B;  4M7D A;  5CK9 A;  2RHY A;  4J83 A;  2Y4X A;  5LJ5 d;  2PUO B;  3CD6 T;  5FRM A;  3MET A;  4J6X A;  3G6E T;  2EKO A;  2X4X A;  1KQ1 A;  2YLB A;  4BY6 B;  3QYG B;  2JTF A;  2GFU A;  4M78 C;  5CKE A;  1M9S A;  4M78 D;  1M5Q 1;  2VXF A;  1YJ9 A;  4M7A E;  4JRK A;  4DA4 A;  4JDS A;  5GAN e;  2DXU A;  4LD9 K;  3JB9 D;  4MDX A;  1XQH A;  2E70 A;  4EMK B;  4LDY A;  1VQP T;  1K9M U;  4Q5W A;  4XTV A;  3GOX A;  2CZ7 B;  2FL7 A;  4B9X A;  2KDS A;  1Q7Y C;  5GAM d;  4E7L A;  3OYK A;  2WSF E;  5GMK j;  5DLO A;  1VQ8 T;  2A7Y A;  2DD4 A;  1S72 T;  4C92 C;  3H6Z A;  4C92 D;  1OZ2 A;  3Q1J A;  4EMK A;  1Q82 C;  3CME T;  2DVE A;  4MZM A;  4M77 E;  4BDY A;  5DLQ E;  2DO3 A;  2VGM A;  1G5V A;  5LJ5 h;  4A53 A;  4J6Y A;  3OA6 A;  5GAN 4;  3FEO A;  1HXD A;  4M78 F;  4ZTJ A;  4XU1 A;  1YJN T;  2Y90 A;  5DM7 R;  5I21 A;  2HQE A;  3M53 A;  4ZGJ B;  4PKC C;  2DIQ A;  5KH6 A;  3JB9 F;  1QVP A;  5D6X A;  2YLC A;  3S3N A;  1W2B A;  3LLR A;  3QII A;  3CCS T;  3GNF B;  4KT0 E;  5GAM h;  2ZPG B;  3G7Z A;  3M4G A;  1QVF A;  1YI2 A;  1K9M C;  4OGC A;  4DQ2 A;  3JCM P;  4C8Q C;  4J6W A;  4XTW A;  4RCC A;  4C92 F;  2K3Y A;  3GP8 A;  1PSF A;  2K2V A;  5CO7 A;  1LOJ A;  4NOY A;  4M7D G;  3SFM A;  5LJ5 g;  4GY5 A;  2K5F A;  4BE2 A;  3BDL A;  3QYH B;  3VUZ A;  4FSX A;  4JLG A;  4RCB A;  3X26 B;  1N8R U;  1N6A A;  2RJC A;  3CC7 T;  2F69 A;  3X24 B;  4MMK A;  3GLX A;  2EQM A;  1LNX A;  3H8Z A;  3C12 A;  2GCX A;  2G3R A;  3JCM J;  1M8V A;  3SB2 A;  1FWZ A;  2GQV A;  2P0P A;  5GMK e;  1LJO A;  2EQU A;  3R6O A;  4M75 C;  5GAM g;  2E5Q A;  2OTJ A;  4M75 D;  2XDP A;  5IN1 A;  3MEW A;  4XU0 A;  3VU3 C;  5FLX E;  4M7D E;  4E47 A;  3CCR A;  2DXC A;  2LVM A;  3CPF A;  3G4S T;  1Y71 A;  3S3O A;  5FU6 C;  1UB4 A;  1OI1 A;  2O01 E;  3PT9 A;  1NE8 A;  3ZEH A;  2E6Z A;  1M1K C;  2R5M A;  4HA8 A;  3OW2 S;  1VQ6 T;  2L5Q A;  2LT1 A;  2CKK A;  2RJF A;  3QUI A;  2RI3 A;  4FT4 A;  3CCL T;  3INZ A;  2RD1 A;  1MGQ A;  2VYT A;  4O6J A;  4XTU A;  4R55 A;  4KUL A;  1VQK T;  3CPW A;  1M90 U;  4HT8 A;  3JCM g;  4XTX A;  2PQW A;  3QZ5 B;  5LJ3 d;  3CCM A;  1G3W A;  2M1H A;  2MF2 A;  3X28 B;  3RMS A;  4E7I A;  3SDZ A;  2KY9 A;  3TRE A;  1NPR A;  2EWN A;  2VUB A;  5CCA A;  1N8R C;  4M75 F;  4QVD A;  2OAU A;  4PJO G;  3OYH A;  3PTA A;  1YIJ T;  4JS5 A;  3V7S A;  4C0D B;  5IAY A;  3JCM W;  3FRN A;  2HD0 A;  4ZN3 A;  3MP6 A;  4C5I A;  2CYZ B;  4EDU A;  3M56 A;  4OVA A;  2KAF A;  5CKF A;  1RI0 A;  1X75 C;  3JCM V;  2GF7 A;  3UT1 A;  3OY9 A;  3KXT A;  3A8L B;  1H3Z A;  3P8H A;  3VJP A;  2E64 A;  4VUB A;  4II1 A;  4MML A;  3WXM B;  3RES A;  4BI8 B;  4J5Y A;  3X25 B;  5LJ5 j;  2QEX A;  5C0M A;  3O8V A;  4A54 A;  3CXC A;  1UGQ B;  2V8J A;  4GLK A;  5CKB A;  5I2M A;  4PLI A;  1N9S A;  5LL6 S;  4XAX B;  4C8Q B;  2HNI A;  3M54 A;  3OYD A;  1YJW A;  1Q7Y U;  4BI4 A;  4KBM B;  5D6Y A;  2HQX A;  2AHJ B;  1H64 1;  1K73 C;  4MZT A;  2RB6 A;  5FU7 B;  2ZPI B;  5LJ3 h;  4XQ3 A;  1TH7 A;  3MO8 A;  3JB9 J;  1AHJ B;  3OYG A;  4L6V 5;  5CAI A;  3FLG A;  1M1G A;  4OB2 B;  3SD4 A;  1VQ7 A;  1FXX A;  5GAM j;  4MZP A;  3X20 B;  4E7J A;  4Y91 A;  2DJZ A;  2LRQ A;  3OYC A;  4C8Q A;  5GAN 8;  2CZ6 B;  1UGS B;  1QP2 A;  2XDB A;  1WGS A;  3EFR A;  3HP9 A;  3CCV A;  3FIF A;  2QQB A;  4BE1 A;  4OMF B;  2JOY A;  5GAN f;  3HFO A;  3GNG A;  3CCE T;  3PFS A;  3URG A;  3JSC A;  1O75 A;  5KE2 A;  4B9W A;  2A3L A;  3JB9 G;  3CCJ A;  3ASK A;  1VQN T;  2YHT A;  5LJ3 g;  4ME7 A;  4QQD A;  1VIF A;  4DOV A;  4F7U B;  1YHQ A;  3ZFJ A;  2M16 A;  3C94 A;  4UC4 A;  3L42 A;  4BB7 A;  2FB7 A;  3DKM A;  3QO3 A;  3VYG A;  3FC3 A;  3HFN A;  1M1F A;  3HHT B;  5A2Q E;  3UWN A;  1VQ5 A;  1YCY A;  3MHX A;  1VQM T;  4M7A D;  1VQ9 T;  3OYL A;  1OYX A;  5CR2 A;  1KQS A;  4FU6 A;  3G71 T;  2E10 A;  1JJ2 A;  1PSE A;  2LT4 A;  4F7U A;  4L59 A;  1U1T A;  5LJ5 e;  2FVU A;  3CCQ A;  1Q86 U;  3I55 T;  1I81 A;  3A8M B;  2GFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...