1LJOA

Crystal structure of an sm-like protein (af-sm2) from archaeoglobus fulgidus at 1.95a resolution
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
75
structure length
75
Chain Sequence
GAMVLPNQMVKSMVGKIIRVEMKGEENQLVGKLEGVDDYMNLYLTNAMECKGEEKVRSLGEIVLRGNNVVLIQPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Archaeal Sm proteins form heptameric and hexameric complexes: crystal structures of the Sm1 and Sm2 proteins from the hyperthermophile Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Unknown function
molecule keywords Archaeal Sm-like protein AF-Sm2
total genus 15
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2002-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ljoA00
2FB7A 2RD1A 4C92C 3QHSA 1H641 4M78B 2RA2A 1I4K1 3BFMA 4XU3A 2DJZA 4C8QB 3HFNA 3SWNA 5GAMh 3JB9J 4M7AE 5GAOm 3HSBA 4XTVA 5GANg 4PJOB 3RERA 4WF2A 2DKGA 5CAIA 3JCMd 4M7DA 4M7DE 2EAYA 3SWNB 2DZCA 3JCMc 4F7UA 1U1SA 5LJ3e 5LJ5j 4A53A 2DTOA 4XTUA 5GAOn 1Y96A 4C8QC 4M7DB 1YCYA 5GAMf 5GANe 4NL3A 2E41A 4M7AF 2DEQA 4MMKA 2DTIA 5GAMg 3JCMb 1M5Q1 5GMKh 1B34A 2DVEA 4XTXA 3V7RA 4EMHA 1N9SA 5GAOq 5GMKe 1D3BA 4RCBA 1LJOA 5GAOr 3FIFA 2ZGWA 4C8QG 5DY9A 3V8JA 4RCCA 4J6YA 4M75D 4C92D 5GMKm 5GANd 1WNLA 1LOJA 4M75G 4XU0A 3V7CA 3V8LA 4QVDA 4OP0A 4F7UE 5GAN4 5GANj 3GIBA 4MMLA 4V2SA 4PNOA 4M77C 1X01A 3EFRA 1BIBA 1N9RA 2I2LA 4F7UB 4C8QF 1KQ1A 2DXUA 4JLIA 2EWNA 3JCMV 3L2ZA 3JB9G 4M7AA 3FB9A 4M78C 2EJ9A 5GAN3 4M75F 5LJ5f 1TH7A 4M78D 3RUXA 2DZ9A 4M78G 4N0AC 4C8QD 2RM4A 3JCMh 4M77B 4M78E 2YLCA 4C92G 5GMKi 2CGHA 3SWNC 4HA8A 2EJFA 3V7SA 4JUVA 4A54A 4HT9A 2FYKA 5GAN6 4M77E 5GAN8 4XTYA 5GAOp 2DTHA 4M7DC 2VXFA 2Y90A 4JRKA 4J6XA 5LJ3d 1MGQA 5LJ5h 1JRIA 5LJ3f 3JCMQ 1M8VA 4EMKA 1I5LA 4X9DA 1HK9A 1U1TA 2YHTA 5GAN2 1I81A 4C8QA 3JCMf 4M7DG 4PJOA 5GANh 4F7UG 3M4GA 3V8KA 3RESA 4M75A 4M75E 3RIRA 4C92E 4XTZA 5GAN5 3L1AA 4C92A 4M7AB 4Y91A 3JCMe 5LJ5g 4C8QE 2QTXA 3JB9H 5I21A 1I8FA 4NOYA 2EJGA 1WQWA 3JCMJ 1WPYA 3BDUA 4C92B 2HNIA 5LJ3g 3RKWA 4PJOD 5GAMj 2JN0A 5GMKj 5GAOl 1JBMA 4HT8A 5GMKl 4XU2A 5LJ3j 2YLBA 5LJ5e 3QUIA 4JRIA 3AHUA 3JB9F 4M77F 3HFOA 4NL2A 4PJOF 4XTWA 3VU3C 3INZA 4XU1A 4M7DD 1WQ7A 2RB6A 4M78F 3EFSA 3FJPA 2VXEA 2E65A 2E64A 2DXTA 3JCMg 4C92F 3JCMP 4M7AG 3QSUA 4M77D 1BIAA 4N0AA 4X9CA 1Y96B 4EMKB 4M77G 5GAMe 4PJOG 1HXDA 5GAMd 4PJOE 3JB9I 2E10A 4QVCA 3BY7A 4M75B 3PGGA 4M7DF 3RKYA 1B34B 2K57A 4DQ2A 1D3BB 4F7UF 4XQ3A 4M77A 2VC8A 3QO3A 4EMKC 3JCMX 5GANf 3BW1A 3RKXA 3SB2A 5LJ3h 2E1HA 5LJ5d 1KQ2A 4M7AC 4PJOC 4J6WA 4J5YA 3JB9D 4M78A 5GAN7 3JCMW 4M75C 4M7AD 1LNXA 4EMGA
chains in the Genus database with same CATH superfamily
3I5SA 3IQLA 4M78B 3RBBB 1ZX6A 4Z88A 6AT1B 4LUDA 1ARKA 1TTHB 1NE8A 2DKGA 3UA7A 1KK7A 2YDLA 3I56Q 1D0XA 3GBQA 2DIGA 5KYXA 1H3ZA 2SRCA 1M1GA 4MMKA 3SDZA 2DL3A 2DXBA 3REBB 1EIFA 5GAOr 4RCCA 2CS7A 4FCYA 1M90C 1BI1A 2AKLA 1VOMA 4M77C 2WACA 3SD4A 1NLOC 1RI9A 2K3XA 3VYHB 4M4ZA 3VRZA 4M78E 3UF4A 3R6NA 2FYKA 4CC4B 1M8MA 3GF5A 1WYXA 2QXFA 1YFNA 3A5ZB 4PJLA 4CC7A 3MPUB 4C0DB 2MAMA 4C8QA 2K6DA 3V8KA 3RIRA 2COWA 4M75E 2RK1A 4GBQA 2L8DA 2GFAA 1R8OB 1PRLC 3JB9H 2R57A 2EJGA 3CCRQ 3QDRB 5CVIA 4LXCA 4EDUA 3HFOA 3OBYA 1VQLQ 3OMCA 1VQ5T 1YITT 1LPLA 2HZYA 3CCMA 2E70A 1QVGS 3CD6A 1M3BA 2DPPB 2JZ2A 4M77G 1FMKA 2PUOB 2EYYA 1I5OB 1N8RC 2QI2A 3PGGA 4DBFA 1IHWA 1B34B 1OX8A 1D3BB 3CMEA 2VWFA 2KYMA 4IIMA 3CCUA 3JCMW 2B8AA 4M7AD 1QWFA 2V26A 4AFSC 1MNDA 3QHSA 1NYGA 3NTHA 3CC4T 1G3SA 3BFMA 3C4SA 2DJZA 2CYZB 2ZCFB 3HFNA 4JPBW 3CCSA 1UGPB 3E9GA 1K73R 1D1CA 4E7IA 2MCNA 2PU9B 2XK0A 1AWWA 1VQKQ 2K7AA 3I55T 2O88A 2X4YA 3FRNA 3V7RA 3OS0A 1N6AA 2V8JA 4J9EA 2VB6A 4J6YA 1BYMA 1S72A 1G83A 3V8LA 5GAN4 3QBYA 1ZQ1A 2QQBA 2G3RA 1IO6A 3NTIA 3PE0A 4JS5A 2ZPGB 3M9QA 4F7UB 2KRMA 3L2ZA 5IXBA 2BZXA 4FYVB 3EH2A 3WXMB 3LYIA 2IG0A 1XQHA 2RHUA 3PVLA 1D1AA 2QQ9A 5I11A 3RR6A 4JRKA 1YIJA 1JJ2S 2YHTA 5GAN2 2EQKA 5GANh 3H0IA 4M75A 4LD6A 2CP0A 2K4YA 1QKWA 2KEAA 4C0DC 2Z0WA 1VQ6T 2RI5A 5L23A 5CIUA 2KK4A 1JBMA 1GFCA 3QZ9B 1DJ7B 2G6FX 2K5IA 1WQ7A 2RB6A 3OYAA 3JCMg 1SSHA 1WIEA 3OYGA 3CXCP 4E6RA 4CC3A 2V8IA 2Y4XA 3G1JA 5FU7C 2BZYA 2X35A 3BY7A 2RK2A 1U5SA 5LJ5d 3WVEB 1NEBA 4M78A 5KYWA 1PD1A 1VQLT 3QJYA 3X20B 4M7AE 5FRNA 4PJNA 4JDSA 4IURA 1W6XA 4WF2A 1MMAA 1U1SA 2DLPA 4TVRA 2GQVA 1JQQA 1K76A 1ACMB 4OMMA 5GAMg 5C6SA 2D6FA 3A1PA 4EPCA 2QDLA 4ZGDB 2M0YA 2O2OA 3ASKA 2MWPA 2X51A 3I55A 3M58A 2NUPB 2V1RA 3HRTA 2HBPA 1YJWA 1NG2A 1X2QA 3MEUA 1PM3A 1KQ1A 1YWPA 5LJ5f 2YRVA 3CC4A 1VQ4Q 4IUQA 3I55Q 1VQOQ 1UHFA 3DLLA 1Y07A 5GAN6 4M77E 3UDCA 1VQ9Q 5GAOp 2AK5A 2DTHA 2VXFA 1NYFA 3ZEHA 3VUBA 3CMET 1YI2T 5CR2A 2HAXA 1T0HA 4AT1B 5KYYA 5GAN5 1B3QA 4C92E 5LJ5g 2K9GA 5GJWB 2CSIA 1N8RU 2F69A 2KQWA 4RTUA 1P92A 5LJ3g 1Q81C 3G4SQ 2P0PA 3NTKA 2LCLA 1UGQB 2A37A 2QGGA 4OMOA 2E65A 3CPFA 2DL5A 3LGFA 2GCXA 2ZPFB 1Y96B 3BE3A 1RAFB 1HXDA 4LDWA 5GAMd 1Q86C 1QVFP 4QVCA 2LRQA 4X34A 1UJ0A 1SHFA 4LNPA 3EAEA 4KRTA 4J6WA 2BIVA 3EHRA 2XMFA 3VS7A 1YHQQ 4XU3A 5I2SA 1JO8A 4J83A 4XTVA 1VQMA 5EG2A 3NGPA 5CAIA 1T3SA 5I2MA 4OB2B 4M7DE 2EYWA 4E2FB 5LJ3e 5LJ5j 3NHNA 3TQ7P 1AZEA 4NL3A 2KR3A 4F04B 1EFNA 4E47A 1JJ2A 2XU8A 3OS5A 5FU7B 1AWJA 2DXCA 3EFOB 1KIKA 3VS5A 4M75G 4XU0A 2CP5A 3OW2A 4FT2A 1B7TA 2LZ6B 3EG2A 1Y71A 2NUTA 1KD1C 3EFRA 4OF1A 3G6EQ 2EYXA 2QASA 4MZPA 1YJNT 2FZKB 1H3HA 1PCXA 2CREA 4KGXB 1RABB 2COZA 2FPFA 3EG0A 2YRDA 4FIBA 3CCRT 2PZ1A 2OI3A 3QJ6A 2KE9A 1JJ2P 2AT1B 3A98A 4L59A 2RQWA 2MWOA 4DA4A 5LJ5h 1MGQA 1ZSZB 4X9DA 5CQYA 1QVGA 2BZ8A 1WHKA 2EIFA 3E19A 1KD1R 3L2VA 3CBMA 2QEXA 2GTOA 3L2QA 2D8HA 2ROLA 1BI3A 2D8JA 5GMKl 2DILA 2LNVA 3QXEB 4NL2A 4PJOF 2RPNA 2DBMA 2E12A 3A8GB 1YI2Q 2VUBA 1RAIB 4DOWA 3QSUA 2WSCE 2ECZA 4PJOE 4ME7A 3JB9I 3C0CA 5DLQE 2AZVA 2JJ9A 3E1SA 4N4HA 2RI2A 3JCMX 1WGSA 3G4ST 3SB2A 3MEVA 4XAXB 5HK3A 2L0AA 2JT4A 3EG9A 3CCUQ 1IXDA 5CO7A 1X6GA 3MKDA 2OAUA 2HDAA 3G7ZA 4PJOB 1M2VA 3QYGB 2DJQA 3EGDB 1R77A 2V1QA 4M7DA 1TXQA 2DEUA 2LQ8A 2H8HA 2L3SA 4XTUA 5D7UA 3VYGA 4A53A 4ESRA 2C06A 1Y96A 2CZ6B 1YCYA 4Z89A 3M0UA 2GNCA 2RN8A 4IKFA 2CUDA 4KH1B 1VQLA 1Q7YU 1VQ9A 4RCBA 2KMTA 2D0QB 4QQGA 4QVDA 5GANj 2WSFE 4PFPA 1M2VB 3EG3A 1K9AA 3NFCA 3OY9A 4PNOA 1N9RA 1QKXA 4M78C 1Q7YC 1QCOA 1K8AU 1KHCA 1G3TA 1AHJB 4HVUA 2LCCA 3UPUA 4HA8A 4JUVA 2XKOC 2XHCA 2F5KA 3OYHA 3EH1A 4EMKA 3U23A 3PT9A 4M7DG 2CH4A 4ANJA 4L6V5 4BUGA 2XIDA 2ENMA 2XDBA 1UG1A 2L3PA 4CRIA 3JCMJ 2RH2A 1MV3A 3S6WA 2BUDA 1QQJA 4C92B 3CCMT 4AFUC 1GCQC 5GAMj 3KUFA 2X3WD 1NPPA 2K2VA 5LJ3j 5LJ5e 1U3OA 1W4SA 4Q5WA 3S3NA 2L3QA 1PKTA 1SHGA 3FJPA 4E7JA 3PMIA 1E6HA 2D0NA 2KVQG 4B6MA 1BIAA 4QQDA 4OGEA 1T3LA 3CCJQ 2EGCA 3ER0A 1ABQA 2CT4A 4F17A 4O5VA 5CKEA 3RKYA 1OX9A 1SG5A 3CC2A 4XK8E 5LJ3h 2WSEE 1MUZA 2RD1A 1OU8A 2RI3A 1VA7A 1H8KA 2J05A 2RA2A 4D8DA 1O9SA 3RERA 2JW4A 1VUBA 2PUKB 4D6WA 4F7UA 1QCFA 5GAOn 3EGUA 3DB3A 3CEYA 5A2QE 1VQ4T 1M27C 3GLXA 2BTTA 1V29B 2X4WA 1IHVA 2DVEA 1OYXA 2QQRA 2KXDA 3QKJA 3FEOA 3CCUT 5DY9A 5IH2A 4Y92A 2IVWA 2XICA 1JB0E 3G71Q 2XG8D 5IHNA 2I2LA 1YCSB 3PIOA 1K4US 3JB9G 2CP6A 2RHXA 1D1BA 1S72T 2DZ9A 1ZSZC 4N0AC 2RM4A 1AD5A 2EJFA 3QIIA 1FMVA 3ULRB 3C95A 4DBHA 1JRIA 3P8HA 3DLMA 4BDZA 3QG1A 4RMOA 3VS3A 4F7UG 1JXOA 3MJXA 8AT1B 3CCLA 4BD3A 1I8FA 4BY6B 1PWTA 2L3RA 4PJMA 2JN0A 5GMKj 4RTYA 3CCRA 2JXBA 1V76A 4JJNK 1MV0B 5J39A 1YHQT 3TEEA 1PKSA 4N4GA 3RDVA 3G71A 3OMGA 2GF7A 3UT1A 2HQHA 1W1FA 2M16A 2VC8A 2K79A 3PFSA 4ZGEB 3JB9D 2VV5A 4B9XA 4KGZB 2EGEA 2AIRB 1M1KC 2FRYA 4GLKA 4IUUA 4J9GA 1NLPC 2NUTB 2MF2A 3HSBA 2FO0A 2JM9A 3S3MA 4MZMA 2OTLA 5ECAA 2EAYA 3MP6A 2EKOA 1RUWA 3J81E 1YJ9T 4OMQA 2CZ1B 4M7DB 1UGVA 3M0PA 1K8AC 4EMHA 5GMKe 3AT1B 2M0OA 3OYEA 1ZBJA 1B07A 2FPDA 3UWNA 1KQSS 2CP7A 3KFVA 1OU9A 2F2VA 1UUEA 4J8OA 5FROA 3QWXX 3J80E 2YXYA 3CXCA 1JU5C 1K0SA 1GXIE 4E7SA 4FYXB 1RI0A 3GNGA 2VVKA 1M3AA 3AHUA 4MDXA 1M8VA 4LUEA 5FU6C 4A4EA 3I9QA 3CXCS 3M4GA 2GBQA 4E7HA 2K5LA 1NM7A 1KSWA 4C92A 4M7AB 1PRMC 4NOYA 5KCHA 1HYOA 1WQWA 4LD9K 4UC4A 2DD4A 1S72Q 2IIMA 1VQ8A 2QA4T 5FW9A 3VS4A 2QG9B 1QVPA 3PNWC 3D7SB 3EFOA 1UHCA 1AZGB 1GRIA 1Q81R 4R55A 1AWXA 1WDXA 4OVAA 1SF9A 3CCST 4RG8A 3O5ZA 3I56T 4BI8B 4QT7A 2MMPA 4JJDA 1X6BA 1BCMA 3LGLA 3VS6A 1IGUA 3RKXA 4JJBA 4PJOC 4X1VA 2JNGA 4E7LA 3OA6A 4J7IA 4BY6C 4DBRA 3CQTA 1XOVA 5FRMA 2ABLA 1TUCA 4IUPA 1N5ZA 3JRZA 5GAOm 2DYBA 3H0FA 3LX7A 2ZPEB 2JTEA 4GY5A 4JLGA 1UGSB 1K9MU 4L5GA 2DTOA 4QKUA 1VQ5A 5CK9A 3OQ5A 2LX7A 2QAZA 3REAB 3TSZA 2DA9A 4MMLA 1TUDA 2LTOA 1G8XA 1SPKA 1BI2A 1UJYA 1BIBA 2EWNA 3OYNA 1ZHIA 2BE7D 2KBTA 2YRCA 4AMCA 3O8VA 3HRSA 2F2WA 1RACB 1YNZA 1M4ZA 3M0TA 1PC0A 4RUGA 4PFZA 2DYIA 3EG9B 1BBZA 1VQ4A 2HKNA 1YITQ 2M51A 4BE0A 4II1A 1I81A 3CMAQ 2JVVA 4J9BA 4QQ6A 4F16A 4XTZA 3HP9A 1SRLA 3FLGA 5I21A 2KI7A 2A08A 3S3OA 1Q82R 1IZ6A 1OEBA 3A8HB 4WTOB 4HT8A 1TSFA 2CZ7B 1BI0A 1TG0A 2DE0X 3WVDB 3N5BB 3OYYA 1OZ3A 2VGNA 3VS1A 1UECA 2VXEA 3GNFB 2O9VA 1VQ7T 3G6EA 3LH0A 1E6GA 1W2BP 1OV3A 2JMCA 3TSWA 4PLLA 2D9TA 5FU6B 3CCJA 2EQJA 1YIJQ 3QWYA 4KULA 5CKHA 2DRKA 2E3IA 5FWBA 1O75A 5HY6A 1CKAA 1BU1A 4LE9A 2RJCA 1QVFA 4Y28E 3JB9J 2K5FA 4C8QB 3J7AF 3KXTA 1MHNA 2RHIA 2MI6A 5IHIA 3A8LB 2CH4W 3M57A 2DK3A 2DL7A 4PKCC 5D6XA 4HKEA 1FYNA 1WLPB 2E41A 2DEQA 4MZTA 4OB1B 2W10A 1VIEA 4BE1A 2E5KA 2ZZDA 3CCVQ 4B9WA 2ZGWA 4C8QG 4C5HA 2PVDB 1WNLA 2CUBA 5J26A 2MIOA 4V2SA 2KROA 2FRWA 4WCIA 4J9IA 3FB9A 4JRQA 3A8OB 1VQ6Q 2EYZA 2CP2A 5FWCA 2O01E 4LDYA 3M4YA 2OTJQ 4A54A 2QA4A 4AFQC 3MP1A 3VUZA 4J7FA 3JCMQ 5KYYB 5LJ3f 1Z9ZA 4FYYB 4C5IA 1W2BS 2V8KA 3OBWA 4HCKA 3RESA 3JCMe 1M1KU 1QVFS 1YJNQ 4C8QE 4FW2A 4HVVA 3QDFA 1BK2A 1GBRA 3LWIA 1KFZA 2HQEA 3M0SA 2P84A 1PSEA 4R56A 1I07A 1LVKA 1IREB 4FSXA 3OYIA 2QQAA 3MO8A 4BB7A 4FSSA 1KD1U 3E2UA 5I22A 2FL7A 3OYDA 1ABOA 5KYUB 2DVJA 2J06A 2ROTA 5A0DA 3QO3A 1OZ2A 2X4XA 2HKQB 3GOXA 1I0CA 1U06A 2AKKA 2QDYB 4M75C 2F5TX 2RHZA 4PJJA 4C92C 1H641 1YJ9A 1VQ7Q 2JTFA 5GANg 1MMDA 3CCLQ 4EIKA 5CKBA 3L2RA 1UDLA 2GTJA 3TREA 4A4KA 4C8QC 3CC7T 4FT4A 1ZLMA 1M90R 1M5Q1 3ZBDA 3LH5A 1FWZA 3HL8A 2ATCB 2DL8A 4JJCA 1VQ9T 3OYMA 2X3XD 1WJSA 2J6KA 3CMEQ 4OP0A 4ZTFA 1IB8A 3GP8A 2KXCA 1WHHA 2P0QA 4OGCA 2FZGB 2JTMA 5IT9E 1CSKA 3PIPA 2DO3A 1SSFA 1TH7A 3FDRA 3RUXA 2M02A 3EHQA 4FM4B 3JV3A 4XTYA 5AT1B 1VYTA 4RTTA 3VJPA 1VQNQ 1VQPT 4YTLA 4C0GA 1NJIU 3DKMA 3PTAA 1YHQA 2QYZA 4AFZC 4LDXA 2R5MA 4P5NA 1I1JA 3QUIA 1HD3A 4M77F 2BKDN 1X2KA 4M7DD 3C12A 4FYWB 2DF6A 2JMAA 5M9OA 1M9SA 3QYHB 1X43A 1YJWT 1CKBA 1C1AA 2DL4A 2DNUA 4DQ2A 5HKCA 2LNHB 1KQ2A 2RNAA 3BW1A 1UB4A 1VIFA 2FHDA 2HBWA 2SEMA 4C0ZA 2LC4A 2HCKA 4K11A 3CPWS 1UFFA 5DM7R 1N27A 3OYBA 5GAMh 1UGRB 1TWBA 4OMLA 3GPLA 5J3BA 3JCMd 2DX1A 3M55A 3CD6Q 5GANe 4M7AF 2DTIA 3VRYA 1PHTA 3JCMb 4RTZA 3HRUA 1B34A 4XTXA 9ATCB 1U8RA 1KG1A 4Z02A 1EX4A 4KBMB 2DAQA 1AVZC 4HXJA 1WX6A 4KGVB 3V8JA 4C92D 5GMKm 2EW3A 2KT1A 5KE2A 1KQSA 4F7UE 1ZA1B 3CMAT 3GIBA 2LT1A 1WHLA 2VKNA 4JLIA 4C0FA 1Y7XA 2FPEA 4M75F 1PNJA 3OSSC 2DM1A 4C8QD 1NZ9A 4M77B 2YLCA 4CC2A 3L2UA 2LX9A 1D09B 5IXFA 2GQIA 2CP3A 5CQXA 3LW5E 1WXTA 2NUZA 1WHMA 2Y90A 1VQOA 1K9MR 2KYBA 2K2MA 5A0LA 1I5LA 2PVOB 4ZNXA 4O6JA 2MPXC 4MDWA 3H8ZA 2KAFA 3A8MB 4C5EA 4J9HA 4KUIA 1BKBA 1X6OA 2QTXA 3CPWA 3M56A 1M2OA 3P8DA 2LP5A 3QZ5B 2YWWA 2LJ0A 1QVGP 1OPKA 4ELZC 3H9NA 2KRNA 2QK0A 1RLQC 1SKUB 1WHJA 2MOXA 3EFSA 2CDTA 5CCAA 2DD5A 1VQKA 2K3BA 4Z8AA 1QCNA 2E6ZA 4J9CA 1Q81U 2GGRA 2IPOB 4M75B 4RTXA 3DB4A 5A0GA 2K57A 4BI4A 4J5YA 2CT3A 2LQKA 3CCVT 1LNXA 3OYJA 4A4GA 3I56A 1ZA2B 1M1KR 3SWNB 3JCMc 2RQVA 1QP3A 2VASA 1ZUKA 2DRMA 1WJRA 5GAMf 1AT1B 2X9HA 2Y4YA 1BCOA 5GMKh 1D0YA 2OTJT 5GAOq 1JEGA 3CCEA 2E4HA 3ZL7C 1M3CA 4FW1A 4ZTJA 1F1BB 2ED0A 1LOJA 1K0XA 2XD0A 2AHJB 1WI7A 3UA6A 2EQIA 3JCMV 4DOVA 1OPLA 3CD6T 3CCMQ 4IUTA 3Q1JA 4PK4A 5DLOA 3V7SA 2CZ0B 3TU4K 3UATA 2OTJA 5KCOA 1S1NA 5CKFA 2JM8A 2OX7A 4RG2A 1W70A 2L5QA 1KQSP 3CBPA 2XDPA 1TUGB 1RADB 2EQMA 2NUPA 2YUOA 3CCJT 2DERA 4Y91A 2YUNA 3X24B 3NMZC 3TCJA 3EG1A 4E7KA 2L2PA 5IHKA 1Q95G 1VQOT 3CCVA 1JXMA 4KT0E 4XU2A 1EZZB 4D8KA 4E7ZA 1UTIA 4A63B 3RMQA 7AT1B 1Y57A 2MK5A 1C6VX 2QEXT 1YJNA 3OS2A 3CC4Q 3I5RA 2E64A 2J6OA 5GAMe 1RL2A 3META 2C0OA 3VS2A 1RAEB 2E3HA 3PMTA 1VQPA 2JS2A 3PVQA 1VQKT 2EYQA 4FL6A 2QA4Q 4EMKC 4AG2C 2C0IA 3SFMA 2RQRA 4EMGA 1QW1A 4JRPA 2RHYA 3M54A 1Q82U 1W2BA 2M9UA 2O4XA 5EC7A 2DIQA 5FLXE 4J9DA 3G71T 1AWOA 1ZUUA 3F70A 1T0JA 4AG1C 2OTLQ 2A7YA 3OW2P 2JOYA 2LQNA 4DBQA 2RQTA 3MHXA 1LJOA 3OS1A 1G5VA 2H3JA 2EVRA 2R58A 1WXUA 1VQNT 4QW2A 2O4XB 1VQPQ 3X28B 2J7IA 4C8QF 2PNIA 3MEWA 2EJ9A 1WA7A 5GAN3 2LJ3A 1K1ZA 1SRMA 4M78D 1OULA 4M78G 2FG0A 3HHTB 5L8RE 4C92G 4HT9A 3SWNC 3H0HA 1G3YA 5GAN8 2YUPA 2O31A 5LJ3d 5HK0A 2VYTA 2CKKA 2QGFB 1NEGA 1UE9A 1FXXA 3I35A 4A4FA 1WHGA 2NLUA 1SEMA 2RJFA 2JS0A 3VV0A 1WJQA 3FJ5A 5KYNA 5KYXB 2KNBB 3BDUA 1A0NB 2CSQA 2X4JA 3CCEQ 1HSQA 4VUBA 3RKWA 4ZN1A 3EGXA 2YSQA 3HPWA 5HCKA 1Y0MA 2NYSA 4KUDK 3ZFJA 2DFUA 3CC7A 4XTWA 3VU3C 1K73C 1QMCA 2P0KA 1MMNA 2F1LA 3P8BB 2EQUA 2LT4A 1XNIA 1ZSZA 4M77D 4X9CA 2J6FA 4DEXA 4HCBA 2HD0A 2LVMA 1VQMT 3SEMA 3OSVA 2I0NA 2RO0A 4QVZA 2EGAA 4N4IA 1YWOA 3E9FA 1KC8C 2QTVA 1ZSGA 2RJDA 4F14A 5IN1A 2E5QA 2QEXQ 1TS9A 3MP8A 3SWNA 2COYA 3TVTA 4ZN3A 3HKSA 3KBGA 3THKA 3L2WA 1YIJT 3SHWA 2LCSA 1XTDA 3LLRA 1AOJA 4OMNA 1PG5B 3X25B 4IUVA 3FIFA 2LMJA 2EPDA 3BDLA 3CC2Q 3ME9A 2A36A 2MYSA 1X69A 1H92A 1X01A 1XJWB 3NPFA 1RAHB 2K3YA 2OTLT 3MCAB 1D0ZA 3R6OA 2YUQA 3JCMh 2CGHA 3OB9A 2KY9A 3H41A 2HSEB 2A3LA 1GFDA 2HSPA 1VYUA 1FX7A 3CMAA 3CCSQ 4OMPA 5KH6A 1VYVA 2XI9A 2YT6A 2P4TA 3JAME 1WPYA 1YP5A 2OAWA 4ZGJB 1BB9A 2D1XA 3OW2S 5GAOl 2YLBA 3H6ZA 3JB9F 1IRXA 1HJDA 2HEQA 2LDMA 2LJ1A 1VQ6A 4M78F 2GFUA 5IAYA 3OYCA 4C92F 1X75C 2KRSA 1J3TA 1R0CB 4EMKB 1FMWA 1UEBA 4PJOG 1M1FA 2KGTA 4JZ4A 2DBKA 4A4HA 1YBYA 4BI3A 3X26B 3LWHA 1OOTA 2QQSA 4F7UF 3CCET 2ED1A 2RQUA 4M77A 4PL6A 2A28A 1K73U 2ESWA 4GLMA 2HL5C 3M53A 4PFOA 1I4K1 1KC8R 4JZ3A 4RTWA 3G6ET 2RMOA 1VQ7A 2HL3A 1MMGA 1OI1A 4ELYC 2RJEA 4C5GA 3URGA 1NJIR 2ZAEA 4DEYA 4BACA 2RF0A 1D3BA 3C94A 5KYWB 1Q86R 2O9SA 2XDDA 2FVUA 1VQ8Q 3M59A 3CCQT 1KHIA 4ORZA 2DXUA 4M7AA 5KE3A 5LL6S 1RAGB 3M0QA 1X27A 2EKHA 2JUFA 1KC8U 4OB3B 4PJOD 1E7OA 4KH0B 2EFIA 5AYFA 2KDSA 4M7DC 4J6XA 2A0FB 1G2BA 2PQWA 4RKUE 1HK9A 1U1TA 3VS0A 3CC2T 3JCMf 2P4RA 4OMFB 3QPHA 3L1AA 3OYKA 5C0MA 4NS5A 4OB0B 4CI0C 2OJ2A 1TU0B 3EGXB 3OYLA 1TOVA 2C0TA 2LQWA 2B86A 5CKDA 3FC3A 8ATCB 3INZA 4XU1A 1QP2A 3T9NA 3EGDA 3JCMP 2DXTA 1M30A 4M7AG 2BE9B 1K9MC 2ZPBB 3OYFA 2PTKA 3HTRA 2DMOA 1WZOA 4JS4A 4XQ3A 5GANf 2E1HA 1YN8A 5KYUA 4M7AC 1N8RR 2FB7A 4PLIA 2W0ZA 2ZPHB 4HCCA 2KT8A 1GCQA 1ZUYA 2DZCA 4BE2A 1WXBA 5D6WA 3CCQA 1NPRA 1YJWQ 1YITA 1AEYA 1IGQA 1RAAB 1N9SA 3RMSA 4HVWA 4RTVA 1QWEA 2AZSA 4M75D 5GANd 1Q86U 1K8AR 4HCZA 3V7CA 1WFWA 1LCKA 2M1HA 4BDYA 1Q82C 4FU6A 1YI2A 1C0MA 2ZPIB 1YJ9Q 3RNJA 1GL5A 3CBOA 2HQXA 5D6YA 2F2XA 5GMKi 2FZCB 4LN2A 1QLYA 1MNEA 1Q7YR 3L42A 1VQ5Q 2NWMA 1RLPC 2DETA 3G4SA 1VQ8T 4PJOA 1GCPA 1NJIC 1PD0A 3CCQQ 1G3WA 2VGMA 1VQMQ 2PVGB 2R5AA 4R0KA 1V1CA 3JSCA 4J9FA 2HMAA 1GBQA 1ZBXA 2HNIA 2H3EB 2FEIA 1M90U 2EBPA 4LDVA 1NBEB 3M0RA 4JRIA 1R0BG 5GJVB 3VKIA 4LDUA 2L89A 4IIOA 4ATOA 3M5AA 2E6NA 3CCLT 4N0AA 2KSSA 1OQKA 3CPWP 2E10A 3MEAA 4M7DF 1VQNA 3CC7Q 1PSFA 1KJWA 5GAN7 1Z9QA
chains in the Genus database with same CATH topology
1QW1A 4JRPA 2RJCA 5CO7A 1QVFA 2OAUA 4Y28E 4M78B 2RHYA 3JB9J 2K5FA 3M54A 4C8QB 3G7ZA 3J7AF 1Q82U 3KXTA 4PJOB 1W2BA 2M9UA 2O4XA 1MHNA 2DIQA 5FLXE 1NE8A 2RHIA 2DKGA 2MI6A 3QYGB 3G71T 4M7DA 3A8LB 3M57A 2DK3A 3F70A 2LQ8A 2DIGA 4PKCC 3VYGA 4XTUA 4A53A 2A7YA 5D6XA 2C06A 1H3ZA 1Y96A 4HKEA 2CZ6B 1YCYA 1M1GA 2E41A 2DEQA 4MMKA 3SDZA 4MZTA 2JOYA 4OB1B 2DXBA 4IKFA 1VIEA 4BE1A 1Q7YU 1VQLA 1EIFA 3MHXA 1VQ9A 4RCBA 2ZZDA 1LJOA 2KMTA 4B9WA 3OS1A 5GAOr 2ZGWA 4C8QG 1G5VA 4C5HA 2PVDB 4RCCA 2H3JA 2D0QB 2CS7A 1M90C 4QQGA 1BI1A 1WNLA 4QVDA 2R58A 5GANj 2WSFE 4QW2A 2O4XB 5J26A 1VQNT 3NFCA 3OY9A 4PNOA 3X28B 4V2SA 4M77C 2WACA 1N9RA 4C8QF 3SD4A 3FB9A 3MEWA 4M78C 2EJ9A 5GAN3 4JRQA 1Q7YC 3A8OB 2K3XA 3VYHB 4M78D 1K8AU 1KHCA 4M78G 3HHTB 1G3TA 5L8RE 1AHJB 2O01E 4LDYA 4M78E 4C92G 2LCCA 3M4YA 4HA8A 3SWNC 3UPUA 4JUVA 2XKOC 4A54A 2QA4A 1G3YA 2FYKA 2XHCA 2F5KA 3MP1A 3GF5A 5GAN8 2QXFA 3VUZA 5LJ3d 3A5ZB 2VYTA 4J7FA 2CKKA 5HK0A 5LJ3f 3JCMQ 3OYHA 4EMKA 4C0DB 2MAMA 3PT9A 4M7DG 1FXXA 4C8QA 4C5IA 1W2BS 4A4FA 2V8KA 3V8KA 3OBWA 3RESA 3RIRA 4M75E 2RK1A 4L6V5 2NLUA 4BUGA 2L8DA 2GFAA 2RJFA 2XIDA 1R8OB 3JCMe 4C8QE 1M1KU 1QVFS 3VV0A 2XDBA 1WJQA 2R57A 3JB9H 2EJGA 3JCMJ 4CRIA 2RH2A 3S6WA 3BDUA 2BUDA 4C92B 3CCMT 2X4JA 3QDRB 3LWIA 4VUBA 3RKWA 2HQEA 5GAMj 1PSEA 4R56A 3KUFA 4ZN1A 1NPPA 2K2VA 3HPWA 5CVIA 5LJ3j 5LJ5e 1IREB 4KUDK 1W4SA 4Q5WA 4EDUA 3ZFJA 3S3NA 3HFOA 3OBYA 4FSXA 3OYIA 3CC7A 4XTWA 3OMCA 3VU3C 1VQ5T 1K73C 1YITT 2QQAA 3CCMA 2E70A 3MO8A 4BB7A 3FJPA 4E7JA 2P0KA 3PMIA 1QVGS 3P8BB 2KVQG 3CD6A 2DPPB 2EQUA 2LT4A 1KD1U 2JZ2A 1XNIA 4M77D 1BIAA 4QQDA 4OGEA 4X9CA 4M77G 4HCBA 2FL7A 2HD0A 2LVMA 1VQMT 3ER0A 2PUOB 3OSVA 3OYDA 1N8RC 2QI2A 3PGGA 4O5VA 5CKEA 3RKYA 1B34B 2RO0A 1D3BB 3CMEA 4QVZA 4N4IA 3CC2A 4XK8E 3QO3A 5A0DA 1OZ2A 3E9FA 2X4XA 2WSEE 5LJ3h 3GOXA 1KC8C 3CCUA 2QDYB 3JCMW 2RJDA 2B8AA 2F5TX 4M75C 4M7AD 2RHZA 2RD1A 2RI3A 3QHSA 5IN1A 4C92C 1H641 2E5QA 1YJ9A 3MP8A 3NTHA 3CC4T 1G3SA 2RA2A 3BFMA 3C4SA 2DJZA 2CYZB 2ZCFB 3HFNA 2JTFA 3SWNA 3CCSA 5GANg 1UGPB 1O9SA 4ZN3A 3RERA 3E9GA 1VUBA 3HKSA 5CKBA 2PUKB 3KBGA 3L2RA 3L2WA 3TREA 4D6WA 4F7UA 4E7IA 2PU9B 2XK0A 1YIJT 5GAOn 4A4KA 3CC2T 4C8QC 3DB3A 3CC7T 3CEYA 4FT4A 5A2QE 1VQ4T 1XTDA 3I55T 3LLRA 3GLXA 1V29B 1M5Q1 2X4WA 2X4YA 2DVEA 2QQRA 1OYXA 3FRNA 1FWZA 3HL8A 3V7RA 3ZBDA 3OS0A 3QKJA 1VQ9T 3FEOA 3CCUT 3X25B 4IUVA 1N6AA 2V8JA 3FIFA 3OYMA 5DY9A 4J6YA 1WJSA 1BYMA 1S72A 3BDLA 3ME9A 3V8LA 2IVWA 4OP0A 5GAN4 4ZTFA 3QBYA 2XICA 1ZQ1A 3GP8A 2QQBA 2G3RA 1JB0E 2P0QA 3NTIA 4OGCA 1X01A 4JS5A 2XG8D 2ZPGB 3M9QA 2I2LA 4F7UB 2JTMA 3PIOA 2K3YA 5IT9E 2OTLT 3L2ZA 3JB9G 2RHXA 3MCAB 3PIPA 2DO3A 1SSFA 1TH7A 1S72T 3FDRA 3RUXA 2DZ9A 3R6OA 3WXMB 4N0AC 4FM4B 2RM4A 3JCMh 3LYIA 2CGHA 2IG0A 2EJFA 3QIIA 1XQHA 2RHUA 3OB9A 2KY9A 4XTYA 2QQ9A 3C95A 1I5LA 4JRKA 1JRIA 2A3LA 3P8HA 3DLMA 1YIJA 1JJ2S 2YHTA 3VJPA 3QG1A 5GAN2 2EQKA 4RMOA 4BDZA 5GANh 4F7UG 1VQPT 1FX7A 4M75A 3CMAA 4LD6A 4YTLA 2K4YA 3CCLA 5KH6A 4BD3A 1I8FA 4C0GA 2XI9A 3JAME 2P4TA 4C0DC 1NJIU 1WPYA 4BY6B 3DKMA 3PTAA 1VQ6T 2RI5A 4ZGJB 2L3RA 1YHQA 5CIUA 2JN0A 2KK4A 5GMKj 3OW2S 5GAOl 1JBMA 3QZ9B 4LDXA 2R5MA 4P5NA 2YLBA 3H6ZA 3QUIA 3JB9F 1DJ7B 3CCRA 4M77F 4JJNK 2BKDN 4M7DD 5J39A 2K5IA 1WQ7A 2LDMA 2RB6A 3TEEA 4M78F 2GFUA 5IAYA 3C12A 4N4GA 3OYAA 3OYCA 1VQ6A 4C92F 1X75C 3JCMg 3G71A 3OYGA 4EMKB 2V8IA 2Y4XA 1UEBA 4PJOG 1M1FA 3OMGA 5M9OA 5FU7C 2GF7A 1M9SA 2X35A 3BY7A 3QYHB 2RK2A 4A4HA 3UT1A 1YBYA 1YJWT 4BI3A 3X26B 3LWHA 2QQSA 4DQ2A 4F7UF 3CCET 5HKCA 2M16A 4M77A 2VC8A 1KQ2A 3BW1A 4PL6A 1UB4A 5LJ5d 3WVEB 1VIFA 3PFSA 4M78A 4ZGEB 2FHDA 3JB9D 2VV5A 4C0ZA 4B9XA 2LC4A 1M1KC 1K73U 1VQLT 4GLKA 4IUUA 3CPWS 3QJYA 3M53A 5DM7R 1I4K1 1N27A 3X20B 3OYBA 5GAMh 1UGRB 4M7AE 3GPLA 2MF2A 5FRNA 3HSBA 4JDSA 5J3BA 3S3MA 4IURA 4WF2A 4MZMA 3JCMd 2OTLA 2EAYA 3G6ET 3MP6A 2EKOA 1U1SA 3J81E 1VQ7A 3M55A 1YJ9T 4HT9A 4TVRA 2GQVA 2CZ1B 4M7DB 5GANe 4M7AF 1OI1A 4ELYC 1K8AC 2DTIA 2RJEA 4C5GA 3URGA 5GAMg 3JCMb 5C6SA 2D6FA 3HRUA 1B34A 4XTXA 4EPCA 4EMHA 4BACA 4Z02A 1U8RA 5GMKe 1KG1A 1D3BA 3C94A 4ZGDB 4KBMB 2M0OA 2DAQA 2MWPA 3ASKA 2XDDA 3OYEA 2FVUA 3V8JA 4C92D 5GMKm 3M58A 5KE2A 3I55A 3UWNA 3HRTA 1KQSA 4F7UE 2HBPA 3M59A 1YJWA 2LT1A 3CMAT 3GIBA 1KQSS 3CCQT 3MEUA 1KHIA 1KQ1A 2DXUA 4JLIA 4M7AA 4J8OA 5FROA 4C0FA 5KE3A 5LL6S 1Y7XA 3J80E 4M75F 5LJ5f 3OSSC 2JUFA 2YRVA 1KC8U 4OB3B 4C8QD 3CXCA 3CC4A 4IUQA 1NZ9A 4M77B 2YLCA 4PJOD 1GXIE 3L2UA 3DLLA 1RI0A 2LX9A 1Y07A 5GAN6 2EFIA 4M77E 3UDCA 3GNGA 5GAOp 5CQXA 3LW5E 2DTHA 2KDSA 5AYFA 2VXFA 2Y90A 3AHUA 4J6XA 4M7DC 4MDXA 1M8VA 5FU6C 1VQOA 2PQWA 4RKUE 5A0LA 3ZEHA 1HK9A 1U1TA 2PVOB 3VUBA 4A4EA 5CR2A 3CMET 3JCMf 1YI2T 2HAXA 4O6JA 4MDWA 3CXCS 3M4GA 4OMFB 3H8ZA 5GAN5 2KAFA 3QPHA 4C92E 2K5LA 4E7HA 3L1AA 3A8MB 3OYKA 4C92A 4M7AB 4C5EA 5C0MA 4KUIA 1BKBA 1X6OA 2QTXA 4NS5A 5LJ5g 3CPWA 4NOYA 3M56A 3P8DA 1WQWA 4OB0B 4CI0C 5KCHA 4LD9K 4UC4A 1N8RU 2DD4A 2F69A 2KQWA 3OYLA 1P92A 1VQ8A 3QZ5B 5LJ3g 2QA4T 1Q81C 1VQPA 2P0PA 1QVPA 3NTKA 2LCLA 3PNWC 4ELZC 1UGQB 5CKDA 3FC3A 3INZA 4XU1A 1QP2A 3T9NA 3EFSA 5CCAA 2E65A 2DD5A 2DXTA 3JCMP 1VQKA 3CPFA 4R55A 3LGFA 4M7AG 2GCXA 2ZPFB 4OVAA 2E6ZA 1Y96B 3CCST 4RG8A 1Q81U 1HXDA 4LDWA 5GAMd 3I56T 1Q86C 2ZPBB 4BI8B 3OYFA 1K9MC 4QVCA 4M75B 3DB4A 2LRQA 5A0GA 2MMPA 4X34A 2K57A 4JS4A 4XQ3A 4BI4A 3EAEA 3LGLA 5GANf 3RKXA 2E1HA 4M7AC 4PJOC 4J6WA 2BIVA 4J5YA 2JNGA 2LQKA 4E7LA 3OA6A 3CCVT 4J7IA 1LNXA 4BY6C 3OYJA 2FB7A 4A4GA 4PLIA 1XOVA 5FRMA 4XU3A 5I2SA 3I56A 4IUPA 2ZPHB 3JRZA 5GAOm 4J83A 4XTVA 1VQMA 4HCCA 3LX7A 2ZPEB 4GY5A 5EG2A 5CAIA 5I2MA 4OB2B 4M7DE 4JLGA 1UGSB 3SWNB 2DZCA 3JCMc 4BE2A 5LJ3e 5LJ5j 5D6WA 4L5GA 2DTOA 3CCQA 1NPRA 1K9MU 1QP3A 1VQ5A 5CK9A 1YITA 1WJRA 5GAMf 4NL3A 3OQ5A 2Y4YA 4E47A 1JJ2A 2XU8A 5GMKh 3OS5A 5GAOq 2OTJT 5FU7B 1N9SA 3RMSA 3CCEA 2DXCA 4ZTJA 4M75D 5GANd 1Q86U 4M75G 1LOJA 4XU0A 4HCZA 3V7CA 3OW2A 2M1HA 4FT2A 4MMLA 4BDYA 1Q82C 2LTOA 1KD1C 1Y71A 2XD0A 2AHJB 4FU6A 1BI2A 3EFRA 1BIBA 1YI2A 4OF1A 4MZPA 3JCMV 2EWNA 3OYNA 1YJNT 2ZPIB 4DOVA 1ZHIA 4FIBA 3CBOA 3CD6T 3CCRT 2HQXA 4IUTA 3O8VA 3HRSA 3QJ6A 5D6YA 1M4ZA 3Q1JA 5GMKi 5DLOA 3V7SA 2CZ0B 4L59A 3TU4K 2OTJA 5KCOA 2MWOA 5CKFA 4DA4A 3L42A 1VQ4A 5LJ5h 1MGQA 3G4SA 1YHQT 4BE0A 4RG2A 4II1A 4X9DA 1I81A 1VQ8T 4PJOA 2L5QA 5CQYA 3CBPA 1QVGA 2XDPA 1NJIC 2JVVA 4QQ6A 2EQMA 4XTZA 2EIFA 1G3WA 2VGMA 3HP9A 3CCJT 2PVGB 2R5AA 4Y91A 3FLGA 3E19A 3X24B 5I21A 3TCJA 3JSCA 3S3OA 3L2VA 3CBMA 4E7KA 1IZ6A 2QEXA 1ZBXA 2HNIA 3L2QA 3A8HB 1BI3A 1VQOT 3CCVA 4HT8A 1M90U 5GMKl 4KT0E 4XU2A 4LDVA 4JRIA 2LNVA 3QXEB 2CZ7B 4NL2A 3VKIA 4PJOF 1BI0A 4LDUA 3RMQA 2L89A 3WVDB 4ATOA 2QEXT 2E12A 3N5BB 3OYYA 1YJNA 1OZ3A 2VGNA 3A8GB 3OS2A 2VXEA 3GNFB 2E64A 3M5AA 1VQ7T 2VUBA 3G6EA 2E6NA 3LH0A 4DOWA 3CCLT 3QSUA 4N0AA 2WSCE 5GAMe 1RL2A 3META 4PLLA 3PMTA 2KSSA 2D9TA 4ME7A 2E10A 3MEAA 5FU6B 3JB9I 2EQJA 5DLQE 3CCJA 3E1SA 4KULA 1VQKT 4N4HA 4M7DF 1VQNA 2RI2A 2EYQA 5CKHA 4FL6A 1PSFA 4PJOE 1O75A 3JCMX 4EMKC 1WGSA 3G4ST 3SB2A 3MEVA 5HY6A 4XAXB 3SFMA 5GAN7 5HK3A 4EMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FB7 A;  2RD1 A;  4C92 C;  3QHS A;  1H64 1;  4M78 B;  2RA2 A;  1I4K 1;  3BFM A;  4XU3 A;  2DJZ A;  4C8Q B;  3HFN A;  3SWN A;  5GAM h;  3JB9 J;  4M7A E;  5GAO m;  3HSB A;  4XTV A;  5GAN g;  4PJO B;  3RER A;  4WF2 A;  2DKG A;  5CAI A;  3JCM d;  4M7D A;  4M7D E;  2EAY A;  3SWN B;  2DZC A;  3JCM c;  4F7U A;  1U1S A;  5LJ3 e;  5LJ5 j;  4A53 A;  2DTO A;  4XTU A;  5GAO n;  1Y96 A;  4C8Q C;  4M7D B;  1YCY A;  5GAM f;  5GAN e;  4NL3 A;  2E41 A;  4M7A F;  2DEQ A;  4MMK A;  2DTI A;  5GAM g;  3JCM b;  1M5Q 1;  5GMK h;  1B34 A;  2DVE A;  4XTX A;  3V7R A;  4EMH A;  1N9S A;  5GAO q;  5GMK e;  1D3B A;  4RCB A;  1LJO A;  5GAO r;  3FIF A;  2ZGW A;  4C8Q G;  5DY9 A;  3V8J A;  4RCC A;  4J6Y A;  4M75 D;  4C92 D;  5GMK m;  5GAN d;  1WNL A;  1LOJ A;  4M75 G;  4XU0 A;  3V7C A;  3V8L A;  4QVD A;  4OP0 A;  4F7U E;  5GAN 4;  5GAN j;  3GIB A;  4MML A;  4V2S A;  4PNO A;  4M77 C;  1X01 A;  3EFR A;  1BIB A;  1N9R A;  2I2L A;  4F7U B;  4C8Q F;  1KQ1 A;  2DXU A;  4JLI A;  2EWN A;  3JCM V;  3L2Z A;  3JB9 G;  4M7A A;  3FB9 A;  4M78 C;  2EJ9 A;  5GAN 3;  4M75 F;  5LJ5 f;  1TH7 A;  4M78 D;  3RUX A;  2DZ9 A;  4M78 G;  4N0A C;  4C8Q D;  2RM4 A;  3JCM h;  4M77 B;  4M78 E;  2YLC A;  4C92 G;  5GMK i;  2CGH A;  3SWN C;  4HA8 A;  2EJF A;  3V7S A;  4JUV A;  4A54 A;  4HT9 A;  2FYK A;  5GAN 6;  4M77 E;  5GAN 8;  4XTY A;  5GAO p;  2DTH A;  4M7D C;  2VXF A;  2Y90 A;  4JRK A;  4J6X A;  5LJ3 d;  1MGQ A;  5LJ5 h;  1JRI A;  5LJ3 f;  3JCM Q;  1M8V A;  4EMK A;  1I5L A;  4X9D A;  1HK9 A;  1U1T A;  2YHT A;  5GAN 2;  1I81 A;  4C8Q A;  3JCM f;  4M7D G;  4PJO A;  5GAN h;  4F7U G;  3M4G A;  3V8K A;  3RES A;  4M75 A;  4M75 E;  3RIR A;  4C92 E;  4XTZ A;  5GAN 5;  3L1A A;  4C92 A;  4M7A B;  4Y91 A;  3JCM e;  5LJ5 g;  4C8Q E;  2QTX A;  3JB9 H;  5I21 A;  1I8F A;  4NOY A;  2EJG A;  1WQW A;  3JCM J;  1WPY A;  3BDU A;  4C92 B;  2HNI A;  5LJ3 g;  3RKW A;  4PJO D;  5GAM j;  2JN0 A;  5GMK j;  5GAO l;  1JBM A;  4HT8 A;  5GMK l;  4XU2 A;  5LJ3 j;  2YLB A;  5LJ5 e;  3QUI A;  4JRI A;  3AHU A;  3JB9 F;  4M77 F;  3HFO A;  4NL2 A;  4PJO F;  4XTW A;  3VU3 C;  3INZ A;  4XU1 A;  4M7D D;  1WQ7 A;  2RB6 A;  4M78 F;  3EFS A;  3FJP A;  2VXE A;  2E65 A;  2E64 A;  2DXT A;  3JCM g;  4C92 F;  3JCM P;  4M7A G;  3QSU A;  4M77 D;  1BIA A;  4N0A A;  4X9C A;  1Y96 B;  4EMK B;  4M77 G;  5GAM e;  4PJO G;  1HXD A;  5GAM d;  4PJO E;  3JB9 I;  2E10 A;  4QVC A;  3BY7 A;  4M75 B;  3PGG A;  4M7D F;  3RKY A;  1B34 B;  2K57 A;  4DQ2 A;  1D3B B;  4F7U F;  4XQ3 A;  4M77 A;  2VC8 A;  3QO3 A;  4EMK C;  3JCM X;  5GAN f;  3BW1 A;  3RKX A;  3SB2 A;  5LJ3 h;  2E1H A;  5LJ5 d;  1KQ2 A;  4M7A C;  4PJO C;  4J6W A;  4J5Y A;  3JB9 D;  4M78 A;  5GAN 7;  3JCM W;  4M75 C;  4M7A D;  1LNX A;  4EMG A; 
#chains in the Genus database with same CATH topology
 3I5S A;  3IQL A;  4M78 B;  3RBB B;  1ZX6 A;  4Z88 A;  6AT1 B;  4LUD A;  1ARK A;  1TTH B;  1NE8 A;  2DKG A;  3UA7 A;  1KK7 A;  2YDL A;  3I56 Q;  1D0X A;  3GBQ A;  2DIG A;  5KYX A;  1H3Z A;  2SRC A;  1M1G A;  4MMK A;  3SDZ A;  2DL3 A;  2DXB A;  3REB B;  1EIF A;  5GAO r;  4RCC A;  2CS7 A;  4FCY A;  1M90 C;  1BI1 A;  2AKL A;  1VOM A;  4M77 C;  2WAC A;  3SD4 A;  1NLO C;  1RI9 A;  2K3X A;  3VYH B;  4M4Z A;  3VRZ A;  4M78 E;  3UF4 A;  3R6N A;  2FYK A;  4CC4 B;  1M8M A;  3GF5 A;  1WYX A;  2QXF A;  1YFN A;  3A5Z B;  4PJL A;  4CC7 A;  3MPU B;  4C0D B;  2MAM A;  4C8Q A;  2K6D A;  3V8K A;  3RIR A;  2COW A;  4M75 E;  2RK1 A;  4GBQ A;  2L8D A;  2GFA A;  1R8O B;  1PRL C;  3JB9 H;  2R57 A;  2EJG A;  3CCR Q;  3QDR B;  5CVI A;  4LXC A;  4EDU A;  3HFO A;  3OBY A;  1VQL Q;  3OMC A;  1VQ5 T;  1YIT T;  1LPL A;  2HZY A;  3CCM A;  2E70 A;  1QVG S;  3CD6 A;  1M3B A;  2DPP B;  2JZ2 A;  4M77 G;  1FMK A;  2PUO B;  2EYY A;  1I5O B;  1N8R C;  2QI2 A;  3PGG A;  4DBF A;  1IHW A;  1B34 B;  1OX8 A;  1D3B B;  3CME A;  2VWF A;  2KYM A;  4IIM A;  3CCU A;  3JCM W;  2B8A A;  4M7A D;  1QWF A;  2V26 A;  4AFS C;  1MND A;  3QHS A;  1NYG A;  3NTH A;  3CC4 T;  1G3S A;  3BFM A;  3C4S A;  2DJZ A;  2CYZ B;  2ZCF B;  3HFN A;  4JPB W;  3CCS A;  1UGP B;  3E9G A;  1K73 R;  1D1C A;  4E7I A;  2MCN A;  2PU9 B;  2XK0 A;  1AWW A;  1VQK Q;  2K7A A;  3I55 T;  2O88 A;  2X4Y A;  3FRN A;  3V7R A;  3OS0 A;  1N6A A;  2V8J A;  4J9E A;  2VB6 A;  4J6Y A;  1BYM A;  1S72 A;  1G83 A;  3V8L A;  5GAN 4;  3QBY A;  1ZQ1 A;  2QQB A;  2G3R A;  1IO6 A;  3NTI A;  3PE0 A;  4JS5 A;  2ZPG B;  3M9Q A;  4F7U B;  2KRM A;  3L2Z A;  5IXB A;  2BZX A;  4FYV B;  3EH2 A;  3WXM B;  3LYI A;  2IG0 A;  1XQH A;  2RHU A;  3PVL A;  1D1A A;  2QQ9 A;  5I11 A;  3RR6 A;  4JRK A;  1YIJ A;  1JJ2 S;  2YHT A;  5GAN 2;  2EQK A;  5GAN h;  3H0I A;  4M75 A;  4LD6 A;  2CP0 A;  2K4Y A;  1QKW A;  2KEA A;  4C0D C;  2Z0W A;  1VQ6 T;  2RI5 A;  5L23 A;  5CIU A;  2KK4 A;  1JBM A;  1GFC A;  3QZ9 B;  1DJ7 B;  2G6F X;  2K5I A;  1WQ7 A;  2RB6 A;  3OYA A;  3JCM g;  1SSH A;  1WIE A;  3OYG A;  3CXC P;  4E6R A;  4CC3 A;  2V8I A;  2Y4X A;  3G1J A;  5FU7 C;  2BZY A;  2X35 A;  3BY7 A;  2RK2 A;  1U5S A;  5LJ5 d;  3WVE B;  1NEB A;  4M78 A;  5KYW A;  1PD1 A;  1VQL T;  3QJY A;  3X20 B;  4M7A E;  5FRN A;  4PJN A;  4JDS A;  4IUR A;  1W6X A;  4WF2 A;  1MMA A;  1U1S A;  2DLP A;  4TVR A;  2GQV A;  1JQQ A;  1K76 A;  1ACM B;  4OMM A;  5GAM g;  5C6S A;  2D6F A;  3A1P A;  4EPC A;  2QDL A;  4ZGD B;  2M0Y A;  2O2O A;  3ASK A;  2MWP A;  2X51 A;  3I55 A;  3M58 A;  2NUP B;  2V1R A;  3HRT A;  2HBP A;  1YJW A;  1NG2 A;  1X2Q A;  3MEU A;  1PM3 A;  1KQ1 A;  1YWP A;  5LJ5 f;  2YRV A;  3CC4 A;  1VQ4 Q;  4IUQ A;  3I55 Q;  1VQO Q;  1UHF A;  3DLL A;  1Y07 A;  5GAN 6;  4M77 E;  3UDC A;  1VQ9 Q;  5GAO p;  2AK5 A;  2DTH A;  2VXF A;  1NYF A;  3ZEH A;  3VUB A;  3CME T;  1YI2 T;  5CR2 A;  2HAX A;  1T0H A;  4AT1 B;  5KYY A;  5GAN 5;  1B3Q A;  4C92 E;  5LJ5 g;  2K9G A;  5GJW B;  2CSI A;  1N8R U;  2F69 A;  2KQW A;  4RTU A;  1P92 A;  5LJ3 g;  1Q81 C;  3G4S Q;  2P0P A;  3NTK A;  2LCL A;  1UGQ B;  2A37 A;  2QGG A;  4OMO A;  2E65 A;  3CPF A;  2DL5 A;  3LGF A;  2GCX A;  2ZPF B;  1Y96 B;  3BE3 A;  1RAF B;  1HXD A;  4LDW A;  5GAM d;  1Q86 C;  1QVF P;  4QVC A;  2LRQ A;  4X34 A;  1UJ0 A;  1SHF A;  4LNP A;  3EAE A;  4KRT A;  4J6W A;  2BIV A;  3EHR A;  2XMF A;  3VS7 A;  1YHQ Q;  4XU3 A;  5I2S A;  1JO8 A;  4J83 A;  4XTV A;  1VQM A;  5EG2 A;  3NGP A;  5CAI A;  1T3S A;  5I2M A;  4OB2 B;  4M7D E;  2EYW A;  4E2F B;  5LJ3 e;  5LJ5 j;  3NHN A;  3TQ7 P;  1AZE A;  4NL3 A;  2KR3 A;  4F04 B;  1EFN A;  4E47 A;  1JJ2 A;  2XU8 A;  3OS5 A;  5FU7 B;  1AWJ A;  2DXC A;  3EFO B;  1KIK A;  3VS5 A;  4M75 G;  4XU0 A;  2CP5 A;  3OW2 A;  4FT2 A;  1B7T A;  2LZ6 B;  3EG2 A;  1Y71 A;  2NUT A;  1KD1 C;  3EFR A;  4OF1 A;  3G6E Q;  2EYX A;  2QAS A;  4MZP A;  1YJN T;  2FZK B;  1H3H A;  1PCX A;  2CRE A;  4KGX B;  1RAB B;  2COZ A;  2FPF A;  3EG0 A;  2YRD A;  4FIB A;  3CCR T;  2PZ1 A;  2OI3 A;  3QJ6 A;  2KE9 A;  1JJ2 P;  2AT1 B;  3A98 A;  4L59 A;  2RQW A;  2MWO A;  4DA4 A;  5LJ5 h;  1MGQ A;  1ZSZ B;  4X9D A;  5CQY A;  1QVG A;  2BZ8 A;  1WHK A;  2EIF A;  3E19 A;  1KD1 R;  3L2V A;  3CBM A;  2QEX A;  2GTO A;  3L2Q A;  2D8H A;  2ROL A;  1BI3 A;  2D8J A;  5GMK l;  2DIL A;  2LNV A;  3QXE B;  4NL2 A;  4PJO F;  2RPN A;  2DBM A;  2E12 A;  3A8G B;  1YI2 Q;  2VUB A;  1RAI B;  4DOW A;  3QSU A;  2WSC E;  2ECZ A;  4PJO E;  4ME7 A;  3JB9 I;  3C0C A;  5DLQ E;  2AZV A;  2JJ9 A;  3E1S A;  4N4H A;  2RI2 A;  3JCM X;  1WGS A;  3G4S T;  3SB2 A;  3MEV A;  4XAX B;  5HK3 A;  2L0A A;  2JT4 A;  3EG9 A;  3CCU Q;  1IXD A;  5CO7 A;  1X6G A;  3MKD A;  2OAU A;  2HDA A;  3G7Z A;  4PJO B;  1M2V A;  3QYG B;  2DJQ A;  3EGD B;  1R77 A;  2V1Q A;  4M7D A;  1TXQ A;  2DEU A;  2LQ8 A;  2H8H A;  2L3S A;  4XTU A;  5D7U A;  3VYG A;  4A53 A;  4ESR A;  2C06 A;  1Y96 A;  2CZ6 B;  1YCY A;  4Z89 A;  3M0U A;  2GNC A;  2RN8 A;  4IKF A;  2CUD A;  4KH1 B;  1VQL A;  1Q7Y U;  1VQ9 A;  4RCB A;  2KMT A;  2D0Q B;  4QQG A;  4QVD A;  5GAN j;  2WSF E;  4PFP A;  1M2V B;  3EG3 A;  1K9A A;  3NFC A;  3OY9 A;  4PNO A;  1N9R A;  1QKX A;  4M78 C;  1Q7Y C;  1QCO A;  1K8A U;  1KHC A;  1G3T A;  1AHJ B;  4HVU A;  2LCC A;  3UPU A;  4HA8 A;  4JUV A;  2XKO C;  2XHC A;  2F5K A;  3OYH A;  3EH1 A;  4EMK A;  3U23 A;  3PT9 A;  4M7D G;  2CH4 A;  4ANJ A;  4L6V 5;  4BUG A;  2XID A;  2ENM A;  2XDB A;  1UG1 A;  2L3P A;  4CRI A;  3JCM J;  2RH2 A;  1MV3 A;  3S6W A;  2BUD A;  1QQJ A;  4C92 B;  3CCM T;  4AFU C;  1GCQ C;  5GAM j;  3KUF A;  2X3W D;  1NPP A;  2K2V A;  5LJ3 j;  5LJ5 e;  1U3O A;  1W4S A;  4Q5W A;  3S3N A;  2L3Q A;  1PKT A;  1SHG A;  3FJP A;  4E7J A;  3PMI A;  1E6H A;  2D0N A;  2KVQ G;  4B6M A;  1BIA A;  4QQD A;  4OGE A;  1T3L A;  3CCJ Q;  2EGC A;  3ER0 A;  1ABQ A;  2CT4 A;  4F17 A;  4O5V A;  5CKE A;  3RKY A;  1OX9 A;  1SG5 A;  3CC2 A;  4XK8 E;  5LJ3 h;  2WSE E;  1MUZ A;  2RD1 A;  1OU8 A;  2RI3 A;  1VA7 A;  1H8K A;  2J05 A;  2RA2 A;  4D8D A;  1O9S A;  3RER A;  2JW4 A;  1VUB A;  2PUK B;  4D6W A;  4F7U A;  1QCF A;  5GAO n;  3EGU A;  3DB3 A;  3CEY A;  5A2Q E;  1VQ4 T;  1M27 C;  3GLX A;  2BTT A;  1V29 B;  2X4W A;  1IHV A;  2DVE A;  1OYX A;  2QQR A;  2KXD A;  3QKJ A;  3FEO A;  3CCU T;  5DY9 A;  5IH2 A;  4Y92 A;  2IVW A;  2XIC A;  1JB0 E;  3G71 Q;  2XG8 D;  5IHN A;  2I2L A;  1YCS B;  3PIO A;  1K4U S;  3JB9 G;  2CP6 A;  2RHX A;  1D1B A;  1S72 T;  2DZ9 A;  1ZSZ C;  4N0A C;  2RM4 A;  1AD5 A;  2EJF A;  3QII A;  1FMV A;  3ULR B;  3C95 A;  4DBH A;  1JRI A;  3P8H A;  3DLM A;  4BDZ A;  3QG1 A;  4RMO A;  3VS3 A;  4F7U G;  1JXO A;  3MJX A;  8AT1 B;  3CCL A;  4BD3 A;  1I8F A;  4BY6 B;  1PWT A;  2L3R A;  4PJM A;  2JN0 A;  5GMK j;  4RTY A;  3CCR A;  2JXB A;  1V76 A;  4JJN K;  1MV0 B;  5J39 A;  1YHQ T;  3TEE A;  1PKS A;  4N4G A;  3RDV A;  3G71 A;  3OMG A;  2GF7 A;  3UT1 A;  2HQH A;  1W1F A;  2M16 A;  2VC8 A;  2K79 A;  3PFS A;  4ZGE B;  3JB9 D;  2VV5 A;  4B9X A;  4KGZ B;  2EGE A;  2AIR B;  1M1K C;  2FRY A;  4GLK A;  4IUU A;  4J9G A;  1NLP C;  2NUT B;  2MF2 A;  3HSB A;  2FO0 A;  2JM9 A;  3S3M A;  4MZM A;  2OTL A;  5ECA A;  2EAY A;  3MP6 A;  2EKO A;  1RUW A;  3J81 E;  1YJ9 T;  4OMQ A;  2CZ1 B;  4M7D B;  1UGV A;  3M0P A;  1K8A C;  4EMH A;  5GMK e;  3AT1 B;  2M0O A;  3OYE A;  1ZBJ A;  1B07 A;  2FPD A;  3UWN A;  1KQS S;  2CP7 A;  3KFV A;  1OU9 A;  2F2V A;  1UUE A;  4J8O A;  5FRO A;  3QWX X;  3J80 E;  2YXY A;  3CXC A;  1JU5 C;  1K0S A;  1GXI E;  4E7S A;  4FYX B;  1RI0 A;  3GNG A;  2VVK A;  1M3A A;  3AHU A;  4MDX A;  1M8V A;  4LUE A;  5FU6 C;  4A4E A;  3I9Q A;  3CXC S;  3M4G A;  2GBQ A;  4E7H A;  2K5L A;  1NM7 A;  1KSW A;  4C92 A;  4M7A B;  1PRM C;  4NOY A;  5KCH A;  1HYO A;  1WQW A;  4LD9 K;  4UC4 A;  2DD4 A;  1S72 Q;  2IIM A;  1VQ8 A;  2QA4 T;  5FW9 A;  3VS4 A;  2QG9 B;  1QVP A;  3PNW C;  3D7S B;  3EFO A;  1UHC A;  1AZG B;  1GRI A;  1Q81 R;  4R55 A;  1AWX A;  1WDX A;  4OVA A;  1SF9 A;  3CCS T;  4RG8 A;  3O5Z A;  3I56 T;  4BI8 B;  4QT7 A;  2MMP A;  4JJD A;  1X6B A;  1BCM A;  3LGL A;  3VS6 A;  1IGU A;  3RKX A;  4JJB A;  4PJO C;  4X1V A;  2JNG A;  4E7L A;  3OA6 A;  4J7I A;  4BY6 C;  4DBR A;  3CQT A;  1XOV A;  5FRM A;  2ABL A;  1TUC A;  4IUP A;  1N5Z A;  3JRZ A;  5GAO m;  2DYB A;  3H0F A;  3LX7 A;  2ZPE B;  2JTE A;  4GY5 A;  4JLG A;  1UGS B;  1K9M U;  4L5G A;  2DTO A;  4QKU A;  1VQ5 A;  5CK9 A;  3OQ5 A;  2LX7 A;  2QAZ A;  3REA B;  3TSZ A;  2DA9 A;  4MML A;  1TUD A;  2LTO A;  1G8X A;  1SPK A;  1BI2 A;  1UJY A;  1BIB A;  2EWN A;  3OYN A;  1ZHI A;  2BE7 D;  2KBT A;  2YRC A;  4AMC A;  3O8V A;  3HRS A;  2F2W A;  1RAC B;  1YNZ A;  1M4Z A;  3M0T A;  1PC0 A;  4RUG A;  4PFZ A;  2DYI A;  3EG9 B;  1BBZ A;  1VQ4 A;  2HKN A;  1YIT Q;  2M51 A;  4BE0 A;  4II1 A;  1I81 A;  3CMA Q;  2JVV A;  4J9B A;  4QQ6 A;  4F16 A;  4XTZ A;  3HP9 A;  1SRL A;  3FLG A;  5I21 A;  2KI7 A;  2A08 A;  3S3O A;  1Q82 R;  1IZ6 A;  1OEB A;  3A8H B;  4WTO B;  4HT8 A;  1TSF A;  2CZ7 B;  1BI0 A;  1TG0 A;  2DE0 X;  3WVD B;  3N5B B;  3OYY A;  1OZ3 A;  2VGN A;  3VS1 A;  1UEC A;  2VXE A;  3GNF B;  2O9V A;  1VQ7 T;  3G6E A;  3LH0 A;  1E6G A;  1W2B P;  1OV3 A;  2JMC A;  3TSW A;  4PLL A;  2D9T A;  5FU6 B;  3CCJ A;  2EQJ A;  1YIJ Q;  3QWY A;  4KUL A;  5CKH A;  2DRK A;  2E3I A;  5FWB A;  1O75 A;  5HY6 A;  1CKA A;  1BU1 A;  4LE9 A;  2RJC A;  1QVF A;  4Y28 E;  3JB9 J;  2K5F A;  4C8Q B;  3J7A F;  3KXT A;  1MHN A;  2RHI A;  2MI6 A;  5IHI A;  3A8L B;  2CH4 W;  3M57 A;  2DK3 A;  2DL7 A;  4PKC C;  5D6X A;  4HKE A;  1FYN A;  1WLP B;  2E41 A;  2DEQ A;  4MZT A;  4OB1 B;  2W10 A;  1VIE A;  4BE1 A;  2E5K A;  2ZZD A;  3CCV Q;  4B9W A;  2ZGW A;  4C8Q G;  4C5H A;  2PVD B;  1WNL A;  2CUB A;  5J26 A;  2MIO A;  4V2S A;  2KRO A;  2FRW A;  4WCI A;  4J9I A;  3FB9 A;  4JRQ A;  3A8O B;  1VQ6 Q;  2EYZ A;  2CP2 A;  5FWC A;  2O01 E;  4LDY A;  3M4Y A;  2OTJ Q;  4A54 A;  2QA4 A;  4AFQ C;  3MP1 A;  3VUZ A;  4J7F A;  3JCM Q;  5KYY B;  5LJ3 f;  1Z9Z A;  4FYY B;  4C5I A;  1W2B S;  2V8K A;  3OBW A;  4HCK A;  3RES A;  3JCM e;  1M1K U;  1QVF S;  1YJN Q;  4C8Q E;  4FW2 A;  4HVV A;  3QDF A;  1BK2 A;  1GBR A;  3LWI A;  1KFZ A;  2HQE A;  3M0S A;  2P84 A;  1PSE A;  4R56 A;  1I07 A;  1LVK A;  1IRE B;  4FSX A;  3OYI A;  2QQA A;  3MO8 A;  4BB7 A;  4FSS A;  1KD1 U;  3E2U A;  5I22 A;  2FL7 A;  3OYD A;  1ABO A;  5KYU B;  2DVJ A;  2J06 A;  2ROT A;  5A0D A;  3QO3 A;  1OZ2 A;  2X4X A;  2HKQ B;  3GOX A;  1I0C A;  1U06 A;  2AKK A;  2QDY B;  4M75 C;  2F5T X;  2RHZ A;  4PJJ A;  4C92 C;  1H64 1;  1YJ9 A;  1VQ7 Q;  2JTF A;  5GAN g;  1MMD A;  3CCL Q;  4EIK A;  5CKB A;  3L2R A;  1UDL A;  2GTJ A;  3TRE A;  4A4K A;  4C8Q C;  3CC7 T;  4FT4 A;  1ZLM A;  1M90 R;  1M5Q 1;  3ZBD A;  3LH5 A;  1FWZ A;  3HL8 A;  2ATC B;  2DL8 A;  4JJC A;  1VQ9 T;  3OYM A;  2X3X D;  1WJS A;  2J6K A;  3CME Q;  4OP0 A;  4ZTF A;  1IB8 A;  3GP8 A;  2KXC A;  1WHH A;  2P0Q A;  4OGC A;  2FZG B;  2JTM A;  5IT9 E;  1CSK A;  3PIP A;  2DO3 A;  1SSF A;  1TH7 A;  3FDR A;  3RUX A;  2M02 A;  3EHQ A;  4FM4 B;  3JV3 A;  4XTY A;  5AT1 B;  1VYT A;  4RTT A;  3VJP A;  1VQN Q;  1VQP T;  4YTL A;  4C0G A;  1NJI U;  3DKM A;  3PTA A;  1YHQ A;  2QYZ A;  4AFZ C;  4LDX A;  2R5M A;  4P5N A;  1I1J A;  3QUI A;  1HD3 A;  4M77 F;  2BKD N;  1X2K A;  4M7D D;  3C12 A;  4FYW B;  2DF6 A;  2JMA A;  5M9O A;  1M9S A;  3QYH B;  1X43 A;  1YJW T;  1CKB A;  1C1A A;  2DL4 A;  2DNU A;  4DQ2 A;  5HKC A;  2LNH B;  1KQ2 A;  2RNA A;  3BW1 A;  1UB4 A;  1VIF A;  2FHD A;  2HBW A;  2SEM A;  4C0Z A;  2LC4 A;  2HCK A;  4K11 A;  3CPW S;  1UFF A;  5DM7 R;  1N27 A;  3OYB A;  5GAM h;  1UGR B;  1TWB A;  4OML A;  3GPL A;  5J3B A;  3JCM d;  2DX1 A;  3M55 A;  3CD6 Q;  5GAN e;  4M7A F;  2DTI A;  3VRY A;  1PHT A;  3JCM b;  4RTZ A;  3HRU A;  1B34 A;  4XTX A;  9ATC B;  1U8R A;  1KG1 A;  4Z02 A;  1EX4 A;  4KBM B;  2DAQ A;  1AVZ C;  4HXJ A;  1WX6 A;  4KGV B;  3V8J A;  4C92 D;  5GMK m;  2EW3 A;  2KT1 A;  5KE2 A;  1KQS A;  4F7U E;  1ZA1 B;  3CMA T;  3GIB A;  2LT1 A;  1WHL A;  2VKN A;  4JLI A;  4C0F A;  1Y7X A;  2FPE A;  4M75 F;  1PNJ A;  3OSS C;  2DM1 A;  4C8Q D;  1NZ9 A;  4M77 B;  2YLC A;  4CC2 A;  3L2U A;  2LX9 A;  1D09 B;  5IXF A;  2GQI A;  2CP3 A;  5CQX A;  3LW5 E;  1WXT A;  2NUZ A;  1WHM A;  2Y90 A;  1VQO A;  1K9M R;  2KYB A;  2K2M A;  5A0L A;  1I5L A;  2PVO B;  4ZNX A;  4O6J A;  2MPX C;  4MDW A;  3H8Z A;  2KAF A;  3A8M B;  4C5E A;  4J9H A;  4KUI A;  1BKB A;  1X6O A;  2QTX A;  3CPW A;  3M56 A;  1M2O A;  3P8D A;  2LP5 A;  3QZ5 B;  2YWW A;  2LJ0 A;  1QVG P;  1OPK A;  4ELZ C;  3H9N A;  2KRN A;  2QK0 A;  1RLQ C;  1SKU B;  1WHJ A;  2MOX A;  3EFS A;  2CDT A;  5CCA A;  2DD5 A;  1VQK A;  2K3B A;  4Z8A A;  1QCN A;  2E6Z A;  4J9C A;  1Q81 U;  2GGR A;  2IPO B;  4M75 B;  4RTX A;  3DB4 A;  5A0G A;  2K57 A;  4BI4 A;  4J5Y A;  2CT3 A;  2LQK A;  3CCV T;  1LNX A;  3OYJ A;  4A4G A;  3I56 A;  1ZA2 B;  1M1K R;  3SWN B;  3JCM c;  2RQV A;  1QP3 A;  2VAS A;  1ZUK A;  2DRM A;  1WJR A;  5GAM f;  1AT1 B;  2X9H A;  2Y4Y A;  1BCO A;  5GMK h;  1D0Y A;  2OTJ T;  5GAO q;  1JEG A;  3CCE A;  2E4H A;  3ZL7 C;  1M3C A;  4FW1 A;  4ZTJ A;  1F1B B;  2ED0 A;  1LOJ A;  1K0X A;  2XD0 A;  2AHJ B;  1WI7 A;  3UA6 A;  2EQI A;  3JCM V;  4DOV A;  1OPL A;  3CD6 T;  3CCM Q;  4IUT A;  3Q1J A;  4PK4 A;  5DLO A;  3V7S A;  2CZ0 B;  3TU4 K;  3UAT A;  2OTJ A;  5KCO A;  1S1N A;  5CKF A;  2JM8 A;  2OX7 A;  4RG2 A;  1W70 A;  2L5Q A;  1KQS P;  3CBP A;  2XDP A;  1TUG B;  1RAD B;  2EQM A;  2NUP A;  2YUO A;  3CCJ T;  2DER A;  4Y91 A;  2YUN A;  3X24 B;  3NMZ C;  3TCJ A;  3EG1 A;  4E7K A;  2L2P A;  5IHK A;  1Q95 G;  1VQO T;  3CCV A;  1JXM A;  4KT0 E;  4XU2 A;  1EZZ B;  4D8K A;  4E7Z A;  1UTI A;  4A63 B;  3RMQ A;  7AT1 B;  1Y57 A;  2MK5 A;  1C6V X;  2QEX T;  1YJN A;  3OS2 A;  3CC4 Q;  3I5R A;  2E64 A;  2J6O A;  5GAM e;  1RL2 A;  3MET A;  2C0O A;  3VS2 A;  1RAE B;  2E3H A;  3PMT A;  1VQP A;  2JS2 A;  3PVQ A;  1VQK T;  2EYQ A;  4FL6 A;  2QA4 Q;  4EMK C;  4AG2 C;  2C0I A;  3SFM A;  2RQR A;  4EMG A;  1QW1 A;  4JRP A;  2RHY A;  3M54 A;  1Q82 U;  1W2B A;  2M9U A;  2O4X A;  5EC7 A;  2DIQ A;  5FLX E;  4J9D A;  3G71 T;  1AWO A;  1ZUU A;  3F70 A;  1T0J A;  4AG1 C;  2OTL Q;  2A7Y A;  3OW2 P;  2JOY A;  2LQN A;  4DBQ A;  2RQT A;  3MHX A;  1LJO A;  3OS1 A;  1G5V A;  2H3J A;  2EVR A;  2R58 A;  1WXU A;  1VQN T;  4QW2 A;  2O4X B;  1VQP Q;  3X28 B;  2J7I A;  4C8Q F;  2PNI A;  3MEW A;  2EJ9 A;  1WA7 A;  5GAN 3;  2LJ3 A;  1K1Z A;  1SRM A;  4M78 D;  1OUL A;  4M78 G;  2FG0 A;  3HHT B;  5L8R E;  4C92 G;  4HT9 A;  3SWN C;  3H0H A;  1G3Y A;  5GAN 8;  2YUP A;  2O31 A;  5LJ3 d;  5HK0 A;  2VYT A;  2CKK A;  2QGF B;  1NEG A;  1UE9 A;  1FXX A;  3I35 A;  4A4F A;  1WHG A;  2NLU A;  1SEM A;  2RJF A;  2JS0 A;  3VV0 A;  1WJQ A;  3FJ5 A;  5KYN A;  5KYX B;  2KNB B;  3BDU A;  1A0N B;  2CSQ A;  2X4J A;  3CCE Q;  1HSQ A;  4VUB A;  3RKW A;  4ZN1 A;  3EGX A;  2YSQ A;  3HPW A;  5HCK A;  1Y0M A;  2NYS A;  4KUD K;  3ZFJ A;  2DFU A;  3CC7 A;  4XTW A;  3VU3 C;  1K73 C;  1QMC A;  2P0K A;  1MMN A;  2F1L A;  3P8B B;  2EQU A;  2LT4 A;  1XNI A;  1ZSZ A;  4M77 D;  4X9C A;  2J6F A;  4DEX A;  4HCB A;  2HD0 A;  2LVM A;  1VQM T;  3SEM A;  3OSV A;  2I0N A;  2RO0 A;  4QVZ A;  2EGA A;  4N4I A;  1YWO A;  3E9F A;  1KC8 C;  2QTV A;  1ZSG A;  2RJD A;  4F14 A;  5IN1 A;  2E5Q A;  2QEX Q;  1TS9 A;  3MP8 A;  3SWN A;  2COY A;  3TVT A;  4ZN3 A;  3HKS A;  3KBG A;  3THK A;  3L2W A;  1YIJ T;  3SHW A;  2LCS A;  1XTD A;  3LLR A;  1AOJ A;  4OMN A;  1PG5 B;  3X25 B;  4IUV A;  3FIF A;  2LMJ A;  2EPD A;  3BDL A;  3CC2 Q;  3ME9 A;  2A36 A;  2MYS A;  1X69 A;  1H92 A;  1X01 A;  1XJW B;  3NPF A;  1RAH B;  2K3Y A;  2OTL T;  3MCA B;  1D0Z A;  3R6O A;  2YUQ A;  3JCM h;  2CGH A;  3OB9 A;  2KY9 A;  3H41 A;  2HSE B;  2A3L A;  1GFD A;  2HSP A;  1VYU A;  1FX7 A;  3CMA A;  3CCS Q;  4OMP A;  5KH6 A;  1VYV A;  2XI9 A;  2YT6 A;  2P4T A;  3JAM E;  1WPY A;  1YP5 A;  2OAW A;  4ZGJ B;  1BB9 A;  2D1X A;  3OW2 S;  5GAO l;  2YLB A;  3H6Z A;  3JB9 F;  1IRX A;  1HJD A;  2HEQ A;  2LDM A;  2LJ1 A;  1VQ6 A;  4M78 F;  2GFU A;  5IAY A;  3OYC A;  4C92 F;  1X75 C;  2KRS A;  1J3T A;  1R0C B;  4EMK B;  1FMW A;  1UEB A;  4PJO G;  1M1F A;  2KGT A;  4JZ4 A;  2DBK A;  4A4H A;  1YBY A;  4BI3 A;  3X26 B;  3LWH A;  1OOT A;  2QQS A;  4F7U F;  3CCE T;  2ED1 A;  2RQU A;  4M77 A;  4PL6 A;  2A28 A;  1K73 U;  2ESW A;  4GLM A;  2HL5 C;  3M53 A;  4PFO A;  1I4K 1;  1KC8 R;  4JZ3 A;  4RTW A;  3G6E T;  2RMO A;  1VQ7 A;  2HL3 A;  1MMG A;  1OI1 A;  4ELY C;  2RJE A;  4C5G A;  3URG A;  1NJI R;  2ZAE A;  4DEY A;  4BAC A;  2RF0 A;  1D3B A;  3C94 A;  5KYW B;  1Q86 R;  2O9S A;  2XDD A;  2FVU A;  1VQ8 Q;  3M59 A;  3CCQ T;  1KHI A;  4ORZ A;  2DXU A;  4M7A A;  5KE3 A;  5LL6 S;  1RAG B;  3M0Q A;  1X27 A;  2EKH A;  2JUF A;  1KC8 U;  4OB3 B;  4PJO D;  1E7O A;  4KH0 B;  2EFI A;  5AYF A;  2KDS A;  4M7D C;  4J6X A;  2A0F B;  1G2B A;  2PQW A;  4RKU E;  1HK9 A;  1U1T A;  3VS0 A;  3CC2 T;  3JCM f;  2P4R A;  4OMF B;  3QPH A;  3L1A A;  3OYK A;  5C0M A;  4NS5 A;  4OB0 B;  4CI0 C;  2OJ2 A;  1TU0 B;  3EGX B;  3OYL A;  1TOV A;  2C0T A;  2LQW A;  2B86 A;  5CKD A;  3FC3 A;  8ATC B;  3INZ A;  4XU1 A;  1QP2 A;  3T9N A;  3EGD A;  3JCM P;  2DXT A;  1M30 A;  4M7A G;  2BE9 B;  1K9M C;  2ZPB B;  3OYF A;  2PTK A;  3HTR A;  2DMO A;  1WZO A;  4JS4 A;  4XQ3 A;  5GAN f;  2E1H A;  1YN8 A;  5KYU A;  4M7A C;  1N8R R;  2FB7 A;  4PLI A;  2W0Z A;  2ZPH B;  4HCC A;  2KT8 A;  1GCQ A;  1ZUY A;  2DZC A;  4BE2 A;  1WXB A;  5D6W A;  3CCQ A;  1NPR A;  1YJW Q;  1YIT A;  1AEY A;  1IGQ A;  1RAA B;  1N9S A;  3RMS A;  4HVW A;  4RTV A;  1QWE A;  2AZS A;  4M75 D;  5GAN d;  1Q86 U;  1K8A R;  4HCZ A;  3V7C A;  1WFW A;  1LCK A;  2M1H A;  4BDY A;  1Q82 C;  4FU6 A;  1YI2 A;  1C0M A;  2ZPI B;  1YJ9 Q;  3RNJ A;  1GL5 A;  3CBO A;  2HQX A;  5D6Y A;  2F2X A;  5GMK i;  2FZC B;  4LN2 A;  1QLY A;  1MNE A;  1Q7Y R;  3L42 A;  1VQ5 Q;  2NWM A;  1RLP C;  2DET A;  3G4S A;  1VQ8 T;  4PJO A;  1GCP A;  1NJI C;  1PD0 A;  3CCQ Q;  1G3W A;  2VGM A;  1VQM Q;  2PVG B;  2R5A A;  4R0K A;  1V1C A;  3JSC A;  4J9F A;  2HMA A;  1GBQ A;  1ZBX A;  2HNI A;  2H3E B;  2FEI A;  1M90 U;  2EBP A;  4LDV A;  1NBE B;  3M0R A;  4JRI A;  1R0B G;  5GJV B;  3VKI A;  4LDU A;  2L89 A;  4IIO A;  4ATO A;  3M5A A;  2E6N A;  3CCL T;  4N0A A;  2KSS A;  1OQK A;  3CPW P;  2E10 A;  3MEA A;  4M7D F;  1VQN A;  3CC7 Q;  1PSF A;  1KJW A;  5GAN 7;  1Z9Q A; 
#chains in the Genus database with same CATH homology
 1QW1 A;  4JRP A;  2RJC A;  5CO7 A;  1QVF A;  2OAU A;  4Y28 E;  4M78 B;  2RHY A;  3JB9 J;  2K5F A;  3M54 A;  4C8Q B;  3G7Z A;  3J7A F;  1Q82 U;  3KXT A;  4PJO B;  1W2B A;  2M9U A;  2O4X A;  1MHN A;  2DIQ A;  5FLX E;  1NE8 A;  2RHI A;  2DKG A;  2MI6 A;  3QYG B;  3G71 T;  4M7D A;  3A8L B;  3M57 A;  2DK3 A;  3F70 A;  2LQ8 A;  2DIG A;  4PKC C;  3VYG A;  4XTU A;  4A53 A;  2A7Y A;  5D6X A;  2C06 A;  1H3Z A;  1Y96 A;  4HKE A;  2CZ6 B;  1YCY A;  1M1G A;  2E41 A;  2DEQ A;  4MMK A;  3SDZ A;  4MZT A;  2JOY A;  4OB1 B;  2DXB A;  4IKF A;  1VIE A;  4BE1 A;  1Q7Y U;  1VQL A;  1EIF A;  3MHX A;  1VQ9 A;  4RCB A;  2ZZD A;  1LJO A;  2KMT A;  4B9W A;  3OS1 A;  5GAO r;  2ZGW A;  4C8Q G;  1G5V A;  4C5H A;  2PVD B;  4RCC A;  2H3J A;  2D0Q B;  2CS7 A;  1M90 C;  4QQG A;  1BI1 A;  1WNL A;  4QVD A;  2R58 A;  5GAN j;  2WSF E;  4QW2 A;  2O4X B;  5J26 A;  1VQN T;  3NFC A;  3OY9 A;  4PNO A;  3X28 B;  4V2S A;  4M77 C;  2WAC A;  1N9R A;  4C8Q F;  3SD4 A;  3FB9 A;  3MEW A;  4M78 C;  2EJ9 A;  5GAN 3;  4JRQ A;  1Q7Y C;  3A8O B;  2K3X A;  3VYH B;  4M78 D;  1K8A U;  1KHC A;  4M78 G;  3HHT B;  1G3T A;  5L8R E;  1AHJ B;  2O01 E;  4LDY A;  4M78 E;  4C92 G;  2LCC A;  3M4Y A;  4HA8 A;  3SWN C;  3UPU A;  4JUV A;  2XKO C;  4A54 A;  2QA4 A;  1G3Y A;  2FYK A;  2XHC A;  2F5K A;  3MP1 A;  3GF5 A;  5GAN 8;  2QXF A;  3VUZ A;  5LJ3 d;  3A5Z B;  2VYT A;  4J7F A;  2CKK A;  5HK0 A;  5LJ3 f;  3JCM Q;  3OYH A;  4EMK A;  4C0D B;  2MAM A;  3PT9 A;  4M7D G;  1FXX A;  4C8Q A;  4C5I A;  1W2B S;  4A4F A;  2V8K A;  3V8K A;  3OBW A;  3RES A;  3RIR A;  4M75 E;  2RK1 A;  4L6V 5;  2NLU A;  4BUG A;  2L8D A;  2GFA A;  2RJF A;  2XID A;  1R8O B;  3JCM e;  4C8Q E;  1M1K U;  1QVF S;  3VV0 A;  2XDB A;  1WJQ A;  2R57 A;  3JB9 H;  2EJG A;  3JCM J;  4CRI A;  2RH2 A;  3S6W A;  3BDU A;  2BUD A;  4C92 B;  3CCM T;  2X4J A;  3QDR B;  3LWI A;  4VUB A;  3RKW A;  2HQE A;  5GAM j;  1PSE A;  4R56 A;  3KUF A;  4ZN1 A;  1NPP A;  2K2V A;  3HPW A;  5CVI A;  5LJ3 j;  5LJ5 e;  1IRE B;  4KUD K;  1W4S A;  4Q5W A;  4EDU A;  3ZFJ A;  3S3N A;  3HFO A;  3OBY A;  4FSX A;  3OYI A;  3CC7 A;  4XTW A;  3OMC A;  3VU3 C;  1VQ5 T;  1K73 C;  1YIT T;  2QQA A;  3CCM A;  2E70 A;  3MO8 A;  4BB7 A;  3FJP A;  4E7J A;  2P0K A;  3PMI A;  1QVG S;  3P8B B;  2KVQ G;  3CD6 A;  2DPP B;  2EQU A;  2LT4 A;  1KD1 U;  2JZ2 A;  1XNI A;  4M77 D;  1BIA A;  4QQD A;  4OGE A;  4X9C A;  4M77 G;  4HCB A;  2FL7 A;  2HD0 A;  2LVM A;  1VQM T;  3ER0 A;  2PUO B;  3OSV A;  3OYD A;  1N8R C;  2QI2 A;  3PGG A;  4O5V A;  5CKE A;  3RKY A;  1B34 B;  2RO0 A;  1D3B B;  3CME A;  4QVZ A;  4N4I A;  3CC2 A;  4XK8 E;  3QO3 A;  5A0D A;  1OZ2 A;  3E9F A;  2X4X A;  2WSE E;  5LJ3 h;  3GOX A;  1KC8 C;  3CCU A;  2QDY B;  3JCM W;  2RJD A;  2B8A A;  2F5T X;  4M75 C;  4M7A D;  2RHZ A;  2RD1 A;  2RI3 A;  3QHS A;  5IN1 A;  4C92 C;  1H64 1;  2E5Q A;  1YJ9 A;  3MP8 A;  3NTH A;  3CC4 T;  1G3S A;  2RA2 A;  3BFM A;  3C4S A;  2DJZ A;  2CYZ B;  2ZCF B;  3HFN A;  2JTF A;  3SWN A;  3CCS A;  5GAN g;  1UGP B;  1O9S A;  4ZN3 A;  3RER A;  3E9G A;  1VUB A;  3HKS A;  5CKB A;  2PUK B;  3KBG A;  3L2R A;  3L2W A;  3TRE A;  4D6W A;  4F7U A;  4E7I A;  2PU9 B;  2XK0 A;  1YIJ T;  5GAO n;  4A4K A;  3CC2 T;  4C8Q C;  3DB3 A;  3CC7 T;  3CEY A;  4FT4 A;  5A2Q E;  1VQ4 T;  1XTD A;  3I55 T;  3LLR A;  3GLX A;  1V29 B;  1M5Q 1;  2X4W A;  2X4Y A;  2DVE A;  2QQR A;  1OYX A;  3FRN A;  1FWZ A;  3HL8 A;  3V7R A;  3ZBD A;  3OS0 A;  3QKJ A;  1VQ9 T;  3FEO A;  3CCU T;  3X25 B;  4IUV A;  1N6A A;  2V8J A;  3FIF A;  3OYM A;  5DY9 A;  4J6Y A;  1WJS A;  1BYM A;  1S72 A;  3BDL A;  3ME9 A;  3V8L A;  2IVW A;  4OP0 A;  5GAN 4;  4ZTF A;  3QBY A;  2XIC A;  1ZQ1 A;  3GP8 A;  2QQB A;  2G3R A;  1JB0 E;  2P0Q A;  3NTI A;  4OGC A;  1X01 A;  4JS5 A;  2XG8 D;  2ZPG B;  3M9Q A;  2I2L A;  4F7U B;  2JTM A;  3PIO A;  2K3Y A;  5IT9 E;  2OTL T;  3L2Z A;  3JB9 G;  2RHX A;  3MCA B;  3PIP A;  2DO3 A;  1SSF A;  1TH7 A;  1S72 T;  3FDR A;  3RUX A;  2DZ9 A;  3R6O A;  3WXM B;  4N0A C;  4FM4 B;  2RM4 A;  3JCM h;  3LYI A;  2CGH A;  2IG0 A;  2EJF A;  3QII A;  1XQH A;  2RHU A;  3OB9 A;  2KY9 A;  4XTY A;  2QQ9 A;  3C95 A;  1I5L A;  4JRK A;  1JRI A;  2A3L A;  3P8H A;  3DLM A;  1YIJ A;  1JJ2 S;  2YHT A;  3VJP A;  3QG1 A;  5GAN 2;  2EQK A;  4RMO A;  4BDZ A;  5GAN h;  4F7U G;  1VQP T;  1FX7 A;  4M75 A;  3CMA A;  4LD6 A;  4YTL A;  2K4Y A;  3CCL A;  5KH6 A;  4BD3 A;  1I8F A;  4C0G A;  2XI9 A;  3JAM E;  2P4T A;  4C0D C;  1NJI U;  1WPY A;  4BY6 B;  3DKM A;  3PTA A;  1VQ6 T;  2RI5 A;  4ZGJ B;  2L3R A;  1YHQ A;  5CIU A;  2JN0 A;  2KK4 A;  5GMK j;  3OW2 S;  5GAO l;  1JBM A;  3QZ9 B;  4LDX A;  2R5M A;  4P5N A;  2YLB A;  3H6Z A;  3QUI A;  3JB9 F;  1DJ7 B;  3CCR A;  4M77 F;  4JJN K;  2BKD N;  4M7D D;  5J39 A;  2K5I A;  1WQ7 A;  2LDM A;  2RB6 A;  3TEE A;  4M78 F;  2GFU A;  5IAY A;  3C12 A;  4N4G A;  3OYA A;  3OYC A;  1VQ6 A;  4C92 F;  1X75 C;  3JCM g;  3G71 A;  3OYG A;  4EMK B;  2V8I A;  2Y4X A;  1UEB A;  4PJO G;  1M1F A;  3OMG A;  5M9O A;  5FU7 C;  2GF7 A;  1M9S A;  2X35 A;  3BY7 A;  3QYH B;  2RK2 A;  4A4H A;  3UT1 A;  1YBY A;  1YJW T;  4BI3 A;  3X26 B;  3LWH A;  2QQS A;  4DQ2 A;  4F7U F;  3CCE T;  5HKC A;  2M16 A;  4M77 A;  2VC8 A;  1KQ2 A;  3BW1 A;  4PL6 A;  1UB4 A;  5LJ5 d;  3WVE B;  1VIF A;  3PFS A;  4M78 A;  4ZGE B;  2FHD A;  3JB9 D;  2VV5 A;  4C0Z A;  4B9X A;  2LC4 A;  1M1K C;  1K73 U;  1VQL T;  4GLK A;  4IUU A;  3CPW S;  3QJY A;  3M53 A;  5DM7 R;  1I4K 1;  1N27 A;  3X20 B;  3OYB A;  5GAM h;  1UGR B;  4M7A E;  3GPL A;  2MF2 A;  5FRN A;  3HSB A;  4JDS A;  5J3B A;  3S3M A;  4IUR A;  4WF2 A;  4MZM A;  3JCM d;  2OTL A;  2EAY A;  3G6E T;  3MP6 A;  2EKO A;  1U1S A;  3J81 E;  1VQ7 A;  3M55 A;  1YJ9 T;  4HT9 A;  4TVR A;  2GQV A;  2CZ1 B;  4M7D B;  5GAN e;  4M7A F;  1OI1 A;  4ELY C;  1K8A C;  2DTI A;  2RJE A;  4C5G A;  3URG A;  5GAM g;  3JCM b;  5C6S A;  2D6F A;  3HRU A;  1B34 A;  4XTX A;  4EPC A;  4EMH A;  4BAC A;  4Z02 A;  1U8R A;  5GMK e;  1KG1 A;  1D3B A;  3C94 A;  4ZGD B;  4KBM B;  2M0O A;  2DAQ A;  2MWP A;  3ASK A;  2XDD A;  3OYE A;  2FVU A;  3V8J A;  4C92 D;  5GMK m;  3M58 A;  5KE2 A;  3I55 A;  3UWN A;  3HRT A;  1KQS A;  4F7U E;  2HBP A;  3M59 A;  1YJW A;  2LT1 A;  3CMA T;  3GIB A;  1KQS S;  3CCQ T;  3MEU A;  1KHI A;  1KQ1 A;  2DXU A;  4JLI A;  4M7A A;  4J8O A;  5FRO A;  4C0F A;  5KE3 A;  5LL6 S;  1Y7X A;  3J80 E;  4M75 F;  5LJ5 f;  3OSS C;  2JUF A;  2YRV A;  1KC8 U;  4OB3 B;  4C8Q D;  3CXC A;  3CC4 A;  4IUQ A;  1NZ9 A;  4M77 B;  2YLC A;  4PJO D;  1GXI E;  3L2U A;  3DLL A;  1RI0 A;  2LX9 A;  1Y07 A;  5GAN 6;  2EFI A;  4M77 E;  3UDC A;  3GNG A;  5GAO p;  5CQX A;  3LW5 E;  2DTH A;  2KDS A;  5AYF A;  2VXF A;  2Y90 A;  3AHU A;  4J6X A;  4M7D C;  4MDX A;  1M8V A;  5FU6 C;  1VQO A;  2PQW A;  4RKU E;  5A0L A;  3ZEH A;  1HK9 A;  1U1T A;  2PVO B;  3VUB A;  4A4E A;  5CR2 A;  3CME T;  3JCM f;  1YI2 T;  2HAX A;  4O6J A;  4MDW A;  3CXC S;  3M4G A;  4OMF B;  3H8Z A;  5GAN 5;  2KAF A;  3QPH A;  4C92 E;  2K5L A;  4E7H A;  3L1A A;  3A8M B;  3OYK A;  4C92 A;  4M7A B;  4C5E A;  5C0M A;  4KUI A;  1BKB A;  1X6O A;  2QTX A;  4NS5 A;  5LJ5 g;  3CPW A;  4NOY A;  3M56 A;  3P8D A;  1WQW A;  4OB0 B;  4CI0 C;  5KCH A;  4LD9 K;  4UC4 A;  1N8R U;  2DD4 A;  2F69 A;  2KQW A;  3OYL A;  1P92 A;  1VQ8 A;  3QZ5 B;  5LJ3 g;  2QA4 T;  1Q81 C;  1VQP A;  2P0P A;  1QVP A;  3NTK A;  2LCL A;  3PNW C;  4ELZ C;  1UGQ B;  5CKD A;  3FC3 A;  3INZ A;  4XU1 A;  1QP2 A;  3T9N A;  3EFS A;  5CCA A;  2E65 A;  2DD5 A;  2DXT A;  3JCM P;  1VQK A;  3CPF A;  4R55 A;  3LGF A;  4M7A G;  2GCX A;  2ZPF B;  4OVA A;  2E6Z A;  1Y96 B;  3CCS T;  4RG8 A;  1Q81 U;  1HXD A;  4LDW A;  5GAM d;  3I56 T;  1Q86 C;  2ZPB B;  4BI8 B;  3OYF A;  1K9M C;  4QVC A;  4M75 B;  3DB4 A;  2LRQ A;  5A0G A;  2MMP A;  4X34 A;  2K57 A;  4JS4 A;  4XQ3 A;  4BI4 A;  3EAE A;  3LGL A;  5GAN f;  3RKX A;  2E1H A;  4M7A C;  4PJO C;  4J6W A;  2BIV A;  4J5Y A;  2JNG A;  2LQK A;  4E7L A;  3OA6 A;  3CCV T;  4J7I A;  1LNX A;  4BY6 C;  3OYJ A;  2FB7 A;  4A4G A;  4PLI A;  1XOV A;  5FRM A;  4XU3 A;  5I2S A;  3I56 A;  4IUP A;  2ZPH B;  3JRZ A;  5GAO m;  4J83 A;  4XTV A;  1VQM A;  4HCC A;  3LX7 A;  2ZPE B;  4GY5 A;  5EG2 A;  5CAI A;  5I2M A;  4OB2 B;  4M7D E;  4JLG A;  1UGS B;  3SWN B;  2DZC A;  3JCM c;  4BE2 A;  5LJ3 e;  5LJ5 j;  5D6W A;  4L5G A;  2DTO A;  3CCQ A;  1NPR A;  1K9M U;  1QP3 A;  1VQ5 A;  5CK9 A;  1YIT A;  1WJR A;  5GAM f;  4NL3 A;  3OQ5 A;  2Y4Y A;  4E47 A;  1JJ2 A;  2XU8 A;  5GMK h;  3OS5 A;  5GAO q;  2OTJ T;  5FU7 B;  1N9S A;  3RMS A;  3CCE A;  2DXC A;  4ZTJ A;  4M75 D;  5GAN d;  1Q86 U;  4M75 G;  1LOJ A;  4XU0 A;  4HCZ A;  3V7C A;  3OW2 A;  2M1H A;  4FT2 A;  4MML A;  4BDY A;  1Q82 C;  2LTO A;  1KD1 C;  1Y71 A;  2XD0 A;  2AHJ B;  4FU6 A;  1BI2 A;  3EFR A;  1BIB A;  1YI2 A;  4OF1 A;  4MZP A;  3JCM V;  2EWN A;  3OYN A;  1YJN T;  2ZPI B;  4DOV A;  1ZHI A;  4FIB A;  3CBO A;  3CD6 T;  3CCR T;  2HQX A;  4IUT A;  3O8V A;  3HRS A;  3QJ6 A;  5D6Y A;  1M4Z A;  3Q1J A;  5GMK i;  5DLO A;  3V7S A;  2CZ0 B;  4L59 A;  3TU4 K;  2OTJ A;  5KCO A;  2MWO A;  5CKF A;  4DA4 A;  3L42 A;  1VQ4 A;  5LJ5 h;  1MGQ A;  3G4S A;  1YHQ T;  4BE0 A;  4RG2 A;  4II1 A;  4X9D A;  1I81 A;  1VQ8 T;  4PJO A;  2L5Q A;  5CQY A;  3CBP A;  1QVG A;  2XDP A;  1NJI C;  2JVV A;  4QQ6 A;  2EQM A;  4XTZ A;  2EIF A;  1G3W A;  2VGM A;  3HP9 A;  3CCJ T;  2PVG B;  2R5A A;  4Y91 A;  3FLG A;  3E19 A;  3X24 B;  5I21 A;  3TCJ A;  3JSC A;  3S3O A;  3L2V A;  3CBM A;  4E7K A;  1IZ6 A;  2QEX A;  1ZBX A;  2HNI A;  3L2Q A;  3A8H B;  1BI3 A;  1VQO T;  3CCV A;  4HT8 A;  1M90 U;  5GMK l;  4KT0 E;  4XU2 A;  4LDV A;  4JRI A;  2LNV A;  3QXE B;  2CZ7 B;  4NL2 A;  3VKI A;  4PJO F;  1BI0 A;  4LDU A;  3RMQ A;  2L89 A;  3WVD B;  4ATO A;  2QEX T;  2E12 A;  3N5B B;  3OYY A;  1YJN A;  1OZ3 A;  2VGN A;  3A8G B;  3OS2 A;  2VXE A;  3GNF B;  2E64 A;  3M5A A;  1VQ7 T;  2VUB A;  3G6E A;  2E6N A;  3LH0 A;  4DOW A;  3CCL T;  3QSU A;  4N0A A;  2WSC E;  5GAM e;  1RL2 A;  3MET A;  4PLL A;  3PMT A;  2KSS A;  2D9T A;  4ME7 A;  2E10 A;  3MEA A;  5FU6 B;  3JB9 I;  2EQJ A;  5DLQ E;  3CCJ A;  3E1S A;  4KUL A;  1VQK T;  4N4H A;  4M7D F;  1VQN A;  2RI2 A;  2EYQ A;  5CKH A;  4FL6 A;  1PSF A;  4PJO E;  1O75 A;  3JCM X;  4EMK C;  1WGS A;  3G4S T;  3SB2 A;  3MEV A;  5HY6 A;  4XAX B;  3SFM A;  5GAN 7;  5HK3 A;  4EMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...