4MMLA

D40a hfq from pseudomonas aeruginosa
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
GHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFAQFVILLKNTVSQMVYKHAISTVVPSRPVRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein hfq
publication title Effect of conserved intersubunit amino Acid substitutions on hfq protein structure and stability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Rna binding protein
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4mmlA00
1D3BB 4C8QC 5I21A 4XU2A 3V7SA 3V7CA 4J5YA 5GMKl 4M7AE 2DZCA 4J6WA 5GMKm 2DTHA 1X01A 1WQ7A 4C8QA 2RD1A 4PJOB 2VXEA 4F7UA 4EMHA 2RB6A 4M78B 2RM4A 2DEQA 3V8LA 4JRKA 4EMGA 4XU0A 4C8QG 3JB9I 1KQ1A 4J6XA 4C92C 4M75D 4F7UG 2EJ9A 4WF2A 4M7AB 3JCMh 3JCMQ 1BIBA 1HK9A 1I8FA 4XTZA 2E41A 4C92A 4QVCA 3JB9H 3JCMP 4M7DB 5LJ3g 2DXUA 5GAN3 3V7RA 4NOYA 3V8KA 3JCMb 4EMKC 5GAOr 4M77C 5LJ3f 4C92G 4C8QF 2YLCA 5LJ5g 1I4K1 5GAMf 5GAN2 5GAOp 1U1SA 2CGHA 1B34A 2VC8A 4F7UF 4EMKA 4M78D 4M77A 5GAN4 5GANf 2DTOA 2YLBA 3HSBA 5LJ5f 3EFRA 4X9DA 3JCMd 3INZA 4M77E 4C8QE 3V8JA 3GIBA 4NL3A 5LJ3e 3RKYA 4F7UE 1BIAA 2I2LA 1LJOA 4M77G 4XTYA 2HNIA 3QO3A 4X9CA 4C92F 2FB7A 2RA2A 1Y96A 3RUXA 3SB2A 2JN0A 4JUVA 3SWNA 5GMKi 4XTXA 4M75C 1WNLA 4M7DD 3FIFA 2DZ9A 5GAOl 3BY7A 2FYKA 4A53A 3QHSA 5GAOm 4QVDA 4RCBA 3JCMW 4MMKA 1WQWA 1TH7A 3JB9D 3EFSA 4M75A 4XU1A 3FB9A 3RIRA 4C8QB 4C92E 5GAMg 4XU3A 4JLIA 2QTXA 1WPYA 2YHTA 3AHUA 1M8VA 4F7UB 5GANg 3RESA 4M77F 1N9RA 3JB9J 4V2SA 5CAIA 4PJOD 3M4GA 4XQ3A 5LJ3j 1D3BA 2DKGA 4M75G 4A54A 4HT9A 4M7DG 2EAYA 4M78C 4OP0A 3JCMV 3RERA 3HFNA 4PJOA 2DJZA 5LJ3h 3HFOA 4XTUA 3JB9G 3SWNC 5GAMe 4M78A 4C92B 5GAOn 4M7AD 5GANh 2K57A 3VU3C 1M5Q1 5LJ5h 5GANe 1LNXA 2ZGWA 4JRIA 4M78E 2E65A 3QUIA 4PJOG 4HA8A 5GAN6 5LJ5e 4XTVA 4RCCA 5GAN7 1YCYA 4M75F 4C8QD 4M7DC 4M78G 4NL2A 1I81A 1KQ2A 2EJGA 3RKXA 2EWNA 5GAOq 4M7AA 2E10A 4J6YA 5GMKh 1B34B 3RKWA 4Y91A 4EMKB 3L1AA 5DY9A 4M77B 5GMKe 3QSUA 4M7DA 3JCMX 3JCMg 5GAN5 3JB9F 3JCMc 3L2ZA 4MMLA 4M75E 3JCMJ 4M7AG 4M7DE 2DXTA 2EJFA 5GAN8 4PJOC 1HXDA 2Y90A 3JCMf 4PJOF 5GAMj 2VXFA 3FJPA 4N0AC 1JBMA 3PGGA 4C92D 5GANj 4M78F 5LJ3d 5LJ5j 1Y96B 3SWNB 2E1HA 4DQ2A 5GAMd 2DTIA 5GAMh 4HT8A 4N0AA 3BFMA 2DVEA 4PJOE 5GANd 1MGQA 4XTWA 3JCMe 5LJ5d 4M7AC 4M75B 3BDUA 5GMKj 4M7AF 1JRIA 4PNOA 1N9SA 1H641 4M77D 1I5LA 3BW1A 1U1TA 1LOJA 4M7DF 2E64A
chains in the Genus database with same CATH superfamily
3QIIA 1G83A 5D6XA 3I56T 4A4GA 2VXEA 1VQ9Q 2C0TA 4QVZA 1GBQA 3PIOA 4C92C 4JZ4A 4M75D 5I11A 1QQJA 4B6MA 3OYAA 4B9XA 1W2BS 1IO6A 2HKQB 4UC4A 2JJ9A 4NOYA 2AKLA 4C8QF 5GAN2 5GAMf 2D9TA 4M78D 5GANf 2DTOA 2KSSA 2W10A 3WVEB 3X24B 4M4ZA 3GLXA 4QQ6A 2JMCA 1IGUA 4IIMA 1JJ2P 2GFUA 3QO3A 1KD1C 3RERA 4JLGA 2DL7A 2AKKA 4Q5WA 2FYKA 3CCRT 3C12A 3MHXA 3JB9J 2FZGB 1K9MR 2G3RA 1VQKT 1IXDA 4AMCA 2X9HA 3Q1JA 3CCVQ 4GBQA 5GAMe 3CC7A 2XICA 3H6ZA 1O75A 3L2WA 5GANe 4KUIA 1X6BA 2L2PA 2RI2A 5GAN7 2QA4T 1K4US 4M7AA 3P8HA 5GMKh 3RKWA 4EMKB 5KYXB 3QSUA 4M7DA 3UPUA 1RUWA 1Q81C 2EKOA 3JCMc 2K5LA 4M7AG 3OMGA 2HZYA 2A3LA 1YNZA 2YUPA 3FJPA 5CKBA 3OYDA 1PHTA 4Y28E 4JJDA 3JRZA 2RJCA 3VS3A 2E70A 4J7FA 1QWFA 1JB0E 2J6OA 2KXCA 1KG1A 3QHSA 2E64A 5IHIA 5J26A 4LDUA 4PJJA 3OW2P 2K79A 4M7AE 2X4YA 2HQHA 1Y57A 1VA7A 2Y4YA 2RD1A 2CP7A 3M5AA 1ZSZA 4AFZC 3KFVA 3U23A 3GP8A 2L3RA 4ZGEB 2JNGA 6AT1B 1S72Q 2WSEE 3V7RA 2OTLA 2EBPA 2CUBA 1OYXA 3S3OA 5LJ5g 2JZ2A 3QWXX 1UHCA 1VUBA 2HKNA 3OW2S 2JXBA 5LJ3e 4J9GA 5FU6B 4AFQC 4ZGJB 2DERA 2L3PA 3BE3A 3X25B 4A4FA 1QP2A 4M75A 2HEQA 2PUOB 3MEVA 2V26A 3RIRA 1VQLA 1N9RA 1Q82U 4XQ3A 1WIEA 1VQ9T 4M75G 2EYQA 1K8AU 4KH1B 3I9QA 3META 3HFOA 3EG0A 4M78A 4C92B 2HMAA 1M5Q1 4L59A 2X3WD 1G3YA 2EW3A 4X34A 2FEIA 3CMEQ 4N4GA 4M78G 5L8RE 4J6YA 3SFMA 1B34B 4Y91A 2QDLA 3HL8A 2OTJQ 5CO7A 1YJWA 2LMJA 1UE9A 3JB9F 2DNUA 4M75E 3CCEA 2EJFA 1MV3A 2KVQG 3PGGA 3P8DA 3MCAB 5LJ5j 1OX9A 1WJRA 5LJ5d 4LDYA 2X4JA 3CC4A 2RQUA 1VQ8A 3EG3A 1D3BB 1M3CA 2PU9B 4DEYA 5I2MA 1YJNT 2IG0A 2ATCB 2LT1A 1AT1B 4BB7A 2QI2A 1NEBA 1RAFB 4J9BA 1OI1A 4FM4B 5KE3A 4ZTFA 1BI1A 2RI3A 1VQNT 1EIFA 1YHQA 1PKTA 3J81E 2DF6A 1HYOA 3URGA 1K73C 1PD1A 2DBMA 1NE8A 3OYIA 2YT6A 3TCJA 2DRKA 2DO3A 3VYHB 3WVDB 3CMAT 5DM7R 3OYMA 2IIMA 2PNIA 5IHKA 3TSZA 4M77E 3L2UA 1TWBA 3GIBA 1JU5C 3ASKA 3OSSC 1LJOA 4II1A 5A0DA 3TQ7P 4X9CA 1E6HA 3SB2A 1I07A 1IHWA 4E7LA 4GY5A 5FWCA 1R8OB 1ZX6A 4MMKA 5FWBA 3TEEA 2J6FA 1AOJA 1Q82R 1VQPA 1M8VA 1WPYA 2DIQA 3M0UA 2XI9A 3ZFJA 1FMKA 1K8AR 4OB2B 1Y0MA 5FW9A 3H0IA 2A08A 4LD6A 4Z88A 1S72T 1OU9A 5DLQE 4MDXA 2BZXA 3M4YA 4EDUA 1M30A 2Y4XA 2K3XA 4C5IA 1N27A 1KC8C 3PMIA 2GF7A 1N8RR 2MIOA 3EHRA 2VXFA 2XU8A 3CCST 2DJQA 1Y96B 5GAMh 4ORZA 3BDLA 2AIRB 3H8ZA 1SHFA 4M7AF 5KCHA 1OOTA 2NUPB 2ABLA 4M7DF 4C8QC 2CZ6B 3NPFA 2RB6A 4F04B 2RM4A 4QT7A 4OMQA 4BI8B 3FC3A 1MHNA 3CMET 2DIGA 1QCOA 2EGCA 2O4XB 3UA7A 4FSXA 2OTJT 2CYZB 2HAXA 2DXUA 1F1BB 3EFOA 1U1SA 2DMOA 2AT1B 5IXFA 1XQHA 2O2OA 1YITQ 4RTVA 3QDRB 4JJCA 2OX7A 3I5RA 3S6WA 3L2QA 4JS4A 2C06A 2KROA 3QYGB 1PSEA 2ENMA 2DYBA 2J06A 3OYEA 1OU8A 3JB9D 1WQWA 3HP9A 5KH6A 1J3TA 2PZ1A 3CPWS 1WHGA 4XU3A 1SKUB 3OBYA 3MKDA 2E3IA 3M0SA 3HFNA 4HVVA 1OPLA 5LJ3h 1KFZA 3SWNC 2FPDA 1M1FA 2EQUA 2E65A 2BIVA 5I2SA 4L5GA 1KK7A 2EKHA 4M75F 3CC7Q 2E10A 5DY9A 2EGAA 5GMKe 1QVFS 1JXMA 4LXCA 4ZTJA 3G71A 2DK3A 2Y90A 2JOYA 1V76A 3FDRA 4M78F 3M54A 3PTAA 2RHIA 1U3OA 2FO0A 2RHXA 2LZ6B 3TU4K 2K7AA 2KY9A 1BCMA 1BI3A 1JRIA 1PKSA 1E6GA 4IKFA 1DJ7B 2QEXA 1E7OA 5GMKm 2DTHA 4P5NA 4J9EA 3PVQA 4QKUA 4Y92A 3RDVA 1AVZC 3PMTA 4J6XA 4TVRA 1KD1U 1G5VA 4FSSA 1BKBA 3OYJA 5GAN3 2HDAA 3OQ5A 2DPPB 3OYKA 1C1AA 2KYMA 2K3YA 1X2KA 2M16A 2OTLQ 2K3BA 3INZA 1T3LA 3QXEB 1SEMA 3VUBA 3I35A 1QP3A 3KUFA 4PLLA 2HSEB 2MWPA 2EIFA 3G6EA 1ACMB 3CCUA 3UWNA 3ZL7C 4A4KA 1N5ZA 4OB1B 4D8DA 2BZYA 4OMOA 1M2VA 4C8QB 2V8KA 3JAME 3EGDB 3CCQT 1RAEB 2ED1A 4BE0A 1UJYA 2NUTB 1TUCA 3NMZC 4M7AD 5DLOA 3VU3C 1RAHB 4E7KA 2P4RA 4PL6A 4IUQA 2KDSA 5A0GA 2EWNA 3REBB 4WTOB 2M02A 3UDCA 3CCLT 2AHJB 2IVWA 1R77A 5CKDA 5GAN5 3M55A 1YITT 5KE2A 1YIJA 3G4SA 2R58A 2COWA 2F1LA 4KULA 2KRSA 2LVMA 3NFCA 1YJWQ 1VOMA 2A37A 3GBQA 3PVLA 3CCEQ 2P4TA 3NHNA 1FWZA 2VGMA 2WACA 3CXCS 4GLKA 5A2QE 4FIBA 2B86A 5FU7C 3V7SA 1X75C 4AT1B 4J83A 3I55A 3REAB 3CC4Q 1X01A 2DLPA 1VQ8Q 2ZPGB 3CD6T 4QW2A 1KD1R 2WSFE 2HBWA 2QASA 1KQSA 3JB9I 4IUTA 4DA4A 1VIFA 2EJ9A 3NTIA 4B9WA 2CZ0B 5IHNA 1XTDA 4HVWA 4R55A 4KBMB 1SF9A 3V8KA 2LJ0A 3TSWA 1YHQQ 1SSHA 2YLCA 5GAOp 4KRTA 2FL7A 2RHUA 2YLBA 3EFRA 2D1XA 3RKYA 2XHCA 4BDZA 1PD0A 1IREB 3FLGA 1X2QA 5A0LA 2E4HA 1WNLA 4HCZA 3OS1A 1GFDA 1ZUKA 1Y7XA 3JCMW 2RQRA 3FB9A 2E6NA 2QTXA 5C0MA 3AHUA 1U8RA 3M9QA 1YFNA 3C94A 4JJBA 2LQNA 4LE9A 1NPRA 2QQSA 4DBHA 1GBRA 4PJOA 2YRDA 3CBOA 3H0HA 4BI3A 2P0KA 4XTUA 1MNEA 1YJ9T 2LX7A 2DL3A 3X28B 1R0CB 2M51A 2ZGWA 5KYYB 3EH2A 4PJOG 4HA8A 1YI2T 1AHJB 4XTVA 4R0KA 4M7DC 2F5TX 3RKXA 2OTLT 3JCMg 1NEGA 2FRYA 5FLXE 1VIEA 1RAGB 3QKJA 2KBTA 1EZZB 1FXXA 4N0AA 3G1JA 3EG9A 3F70A 1ZLMA 2DVJA 4PJOE 2NYSA 1MGQA 1RLPC 1GRIA 1K73U 2VWFA 1H641 4M77D 3VRYA 1U1TA 2PQWA 1JJ2S 1I1JA 4PKCC 2MPXC 2QGFB 1SG5A 2RHYA 3E9GA 3QJ6A 4OB3B 3M59A 1X6OA 4EMGA 2QAZA 1WHKA 2C0OA 3VRZA 2VVKA 2HBPA 3EHQA 2VV5A 4KGVB 3QJYA 3LGFA 5C6SA 3CC2Q 3I56A 4MZMA 3JCMb 1VQOT 1M90C 5LJ3f 4OGEA 1BI2A 2KYBA 5J39A 4OMNA 4LD9K 2YUOA 3CCET 1UGVA 1VQ4Q 1VQMQ 2DD4A 1VQ7T 1QKWA 2HL5C 3QBYA 2HNIA 2H3EB 1KSWA 2P0PA 1EX4A 3JCMd 1PNJA 4OMFB 2CP0A 4QQDA 4M75C 4HCCA 1CKBA 2DZ9A 2GCXA 2KGTA 3CC4T 1AWXA 4XU1A 3L2RA 5FU7B 1PM3A 3PNWC 4A4EA 2YSQA 1KC8U 4FT4A 2ZZDA 4MZTA 1T0JA 4E7SA 4M78C 1VQ5A 3VJPA 4IIOA 4JRPA 4E7JA 5LJ5h 1LNXA 4OF1A 1NJIC 2KE9A 2ZCFB 3CCRA 2MF2A 2F2VA 1YCYA 4F14A 4IURA 3CPFA 1VQKA 4HVUA 2X3XD 3JCMJ 1WJQA 1IGQA 2AZVA 2O9SA 1RAIB 3TREA 5CQYA 2FVUA 3G71Q 1K73R 2QA4A 2MK5A 4C5GA 3SEMA 4WCIA 2BUDA 2JTMA 2J7IA 1H92A 2KMTA 2KT8A 3O5ZA 5I21A 2QQAA 2DZCA 1JQQA 4F7UA 1OULA 1N8RU 4CRIA 2QEXQ 3A8OB 4N4HA 2JUFA 1D0YA 2RO0A 3R6OA 5KYUA 1NYFA 2QYZA 1KQ1A 3NGPA 4NS5A 4F7UG 1MMAA 4M7AB 2V8IA 3OYGA 1I8FA 2E41A 2GFAA 2KT1A 5D6YA 4M7DB 3LW5E 4K11A 2CP5A 2E6ZA 3MP6A 2EFIA 4XK8E 2DE0X 4LDWA 2LJ3A 2VC8A 2HSPA 4M77A 4X9DA 3CCVT 4PK4A 2EYWA 4F7UE 1BIAA 1QMCA 4M77G 1RLQC 1Q86C 2DL8A 3EGXA 3MEAA 2RA2A 2B8AA 4XTXA 3DB3A 1NLOC 1M27C 2LT4A 3EFSA 2KR3A 3HHTB 1KC8R 2CT3A 3G6EQ 2ROTA 1KQSP 1AWJA 2A7YA 3CCUQ 5D7UA 2P84A 4ATOA 4DEXA 5KYWB 2VB6A 3EG1A 1AWOA 1WFWA 3CC2T 4OVAA 2K57A 3ME9A 2L89A 1G3SA 1KQ2A 1OQKA 3JV3A 4HCKA 2FPEA 3ER0A 1RAAB 3JCMX 1VQ4T 1VQMT 5EG2A 3G7ZA 4PJOF 4PJLA 4R56A 4AG2C 2QQBA 2E5QA 2LDMA 3CCMQ 2ZPFB 1YIJQ 1M8MA 1PSFA 4BY6C 5CR2A 3G4SQ 1YWPA 2RN8A 4LN2A 3SDZA 1W6XA 4M75B 3OBWA 1FX7A 2FHDA 2RJFA 4ZNXA 2YRCA 1UUEA 3VS1A 3OYLA 4M78B 3CCJQ 1W4SA 4RTYA 5HY6A 1BIBA 1B7TA 3OYCA 2MCNA 3JCMP 1W2BA 1YJNA 1VQ6Q 5LL6S 2KNBB 1BBZA 1V29B 4J9HA 8AT1B 4CC3A 1WI7A 1D1BA 3G71T 3A98A 2DRMA 1VQNA 2EYZA 2RH2A 2X51A 1D0XA 2BZ8A 5GAOl 1AEYA 3QWYA 4QVDA 3J7AF 3CMAA 2BE9B 2OI3A 1PRMC 2ZAEA 3M57A 4JLIA 4DBQA 1EFNA 4BE2A 4V2SA 2QTVA 1BB9A 3JSCA 2LRQA 1M1KU 4EPCA 5CK9A 3VYGA 4FT2A 3E2UA 2AZSA 1GXIE 2RNAA 2A28A 2YWWA 2ECZA 4RG8A 2K4YA 1Z9ZA 5AYFA 2XIDA 1D1CA 4RUGA 4E6RA 3S3NA 2D8HA 2XDDA 3VS0A 3M53A 4FL6A 1T0HA 3L2ZA 4FYYB 3WXMB 5GAN8 5GAMj 2EGEA 1UECA 3O8VA 1S72A 5GANj 4ZN1A 2E1HA 5GAMd 4GLMA 3BFMA 2NUTA 5GANd 2CREA 3JCMe 1WHMA 1R0BG 2VASA 4CI0C 1G8XA 2LCCA 2XDPA 4J5YA 2RK1A 1SPKA 1WQ7A 2DA9A 3CCSA 5GJWB 2DXCA 4EMHA 1M3AA 3OYBA 2F2XA 2DEQA 4JRKA 3UA6A 2GGRA 2EQMA 5IXBA 2JM8A 3GOXA 1HK9A 2QQ9A 3OYFA 1BCOA 4LDVA 2LNVA 4DOWA 2E5KA 3OYNA 1GFCA 3IQLA 5HCKA 1QLYA 3MEUA 2LQWA 2LC4A 4F7UF 3I56Q 5GAN4 1TOVA 3CCMT 4BACA 2RQWA 5LJ5f 1G3TA 1FMVA 4YTLA 3CMEA 1C6VX 3MPUB 2KRNA 2JMAA 2I2LA 2JS2A 4BY6B 5CQXA 2OTJA 4DOVA 1KIKA 1V1CA 3SWNA 3M0RA 4JUVA 4LUDA 5KYNA 1ARKA 1QVPA 2ED0A 2O9VA 4HXJA 3HTRA 4M77F 4PJOD 1M1KR 5CAIA 3CCJT 1MNDA 5LJ3j 2DKGA 2EYYA 4C5HA 2EAYA 1PCXA 1OX8A 2I0NA 3JCMV 4J9IA 1BI0A 4A63B 1D09B 1M1GA 1VQ5Q 4JRIA 5LJ5e 2F69A 1VQ6T 1RABB 1CSKA 1I81A 3EFOB 3CBMA 4E7IA 3L1AA 2O31A 1Q81U 3UATA 3LGLA 4N4IA 4OMMA 3CQTA 4C92D 1VQLQ 3NTKA 4BI4A 2XK0A 2R57A 4O6JA 2LJ1A 3E19A 1HJDA 3LH5A 4IUUA 1I5LA 3BW1A 2QDYB 1LOJA 1M90U 2QA4Q 1NG2A 4FYXB 3V7CA 1UGPB 1PRLC 1YWOA 4J6WA 4C0ZA 2GNCA 1NBEB 4IUVA 1QVGP 1GCQA 3PE0A 2NLUA 2JT4A 1RACB 3NTHA 3QPHA 3X26B 2H8HA 1WJSA 2HCKA 4QVCA 4PFZA 1NYGA 4J9CA 1M3BA 2EPDA 1C0MA 4RTWA 2LQKA 1K9AA 4EMKA 5KYXA 3HSBA 3SD4A 3RR6A 3VS7A 3LWIA 1GL5A 2OAUA 1BYMA 2DM1A 2DD5A 1NJIU 3CC7T 2MMPA 2SEMA 3M0QA 5IT9E 1IHVA 5ECAA 2GQIA 3T9NA 3RESA 3M4GA 2VGNA 4ELYC 3THKA 1VYTA 4JDSA 4CC4B 4OP0A 1W2BP 2L3QA 4JRQA 4J9FA 3VS5A 2MOXA 3ULRB 1Q7YC 3P8BB 2RI5A 1Q81R 1M9SA 3CCQA 1AWWA 2IPOB 4RTUA 1HXDA 3A8HB 4JJNK 4N0AC 3E9FA 4FU6A 1VQPQ 4KGXB 2DTIA 4HT8A 3OB9A 4A4HA 4M7AC 1M4ZA 1M2VB 4C0FA 1M90R 1N9SA 3CCLA 1KHCA 1VYVA 7AT1B 2X4XA 1ZSGA 1X27A 2EQJA 1YITA 4FCYA 3N5BB 2PUKB 1UTIA 4EIKA 2D0QB 2F2WA 1IB8A 1T3SA 3A8LB 5CKHA 1VQ5T 2G6FX 4JZ3A 1ZUUA 1Q86U 4WF2A 3JCMh 1LCKA 3OS0A 4C92A 3JB9H 1TS9A 2EQKA 1NZ9A 4C92G 1MMNA 1D0ZA 1B34A 3CD6A 4OMPA 3OYYA 1VQLT 3MP1A 1YJNQ 2DXBA 1ZSZC 1ZBJA 4FYVB 1WHLA 2FPFA 3J80E 4E2FB 1NJIR 3A1PA 2JTEA 3CEYA 2C0IA 2GQVA 1VQNQ 3OA6A 4RCBA 1MMGA 2E12A 4RMOA 2OJ2A 4C92E 4ZN3A 3CPWA 3TVTA 2QQRA 5HK3A 4BE1A 1K1ZA 9ATCB 1D3BA 1YJWT 1TSFA 3H9NA 4A54A 4HT9A 3CMAQ 4M7DG 1M2OA 2DL4A 2KAFA 1TXQA 1U06A 4C0DC 3MP8A 5GAOn 1UGRB 4QQGA 1U5SA 2O01E 3QUIA 4J7IA 5GAN6 1ZBXA 3VKIA 4D8KA 3VUZA 4NL2A 1VYUA 4CC2A 3VS2A 2YUQA 1VQ8T 1QVFA 3QG1A 3R6NA 4M7DE 1AD5A 1YJ9A 1K9MC 1I5OB 1LVKA 1RADB 3VS4A 2V8JA 4DQ2A 5L23A 2JM9A 1NPPA 4AG1C 5M9OA 2JVVA 2RHZA 5KYWA 1YI2A 4HCBA 2L3SA 2WSCE 3M0PA 5GMKj 1JEGA 3A8GB 1YHQT 2BKDN 2EQIA 1LPLA 2CKKA 1WHJA 1CKAA 2DILA 2FZCB 1D1AA 4PJOB 3LH0A 1ZHIA 4BUGA 1Q86R 1MMDA 1QWEA 4XU0A 3A5ZB 2A0FB 4FW2A 2QGGA 4PJNA 3OY9A 2M1HA 5HK0A 3CCSQ 3FJ5A 5GJVB 1TUDA 1B07A 3QDFA 1WYXA 2SRCA 1OV3A 1HD3A 3OMCA 1UFFA 4M77C 2BTTA 1G3WA 5EC7A 3CBPA 1OZ2A 1VQPT 1B3QA 2HD0A 3EG9B 1YCSB 2KK4A 2VKNA 3OSVA 2PVOB 1MV0B 3QYHB 4RG2A 2FB7A 3PIPA 1Y96A 3RUXA 1RI9A 3H41A 4L6V5 4OB0B 3I5SA 1VQOA 3BY7A 2YRVA 2ZPIB 1TH7A 5CKFA 4Z02A 2NUPA 4E7HA 1BU1A 1MUZA 3EAEA 3M0TA 4RTTA 1NLPC 1VQ7A 2DYIA 3GNFB 1UG1A 1TG0A 2YDLA 2K2MA 2FZKB 4MDWA 3FRNA 4M78E 2COYA 4C8QD 4VUBA 2O4XA 2HL3A 1SHGA 4O5VA 4MMLA 3OYHA 4J9DA 1KJWA 1BK2A 1ZSZB 1I0CA 2EVRA 3HRSA 1YP5A 1JBMA 4PFOA 5FRNA 2R5AA 1OZ3A 1X43A 3MJXA 4PLIA 1YN8A 1QCFA 2DVEA 2VUBA 3DB4A 4FW1A 3CXCA 1QVGA 1WHHA 2DAQA 5GMKl 1VQ9A 2DL5A 8ATCB 2CDTA 3VV0A 1X69A 3M58A 2LQ8A 4F16A 1AZEA 4BDYA 4C0DB 4D6WA 2P0QA 1KQSS 1ZUYA 2LNHB 1XNIA 2KRMA 2DETA 2MWOA 2HQXA 1UEBA 2J6KA 1WLPB 2GTOA 2ZPEB 5GAOr 1UB4A 5D6WA 1UDLA 2PVGB 1S1NA 2RF0A 2QG9B 2ROLA 3UT1A 1YBYA 4X1VA 3V8JA 3VS6A 2GBQA 4CC7A 3I55Q 2NUZA 2LCLA 2XD0A 4C92F 5GMKi 3EGUA 2JN0A 4RKUE 5KCOA 2CH4W 1WA7A 4E7ZA 1SRLA 5HKCA 5GAMg 3KBGA 2JW4A 3FEOA 3MO8A 3UF4A 4F7UB 5GANg 2CSIA 4ZGDB 3CCVA 1H8KA 3LLRA 2COZA 1TTHB 2YUNA 5KYUB 2D6FA 4LDXA 4ESRA 2DJZA 2K6DA 3L2VA 4ME7A 1X6GA 4Z8AA 3LYIA 2LP5A 5GANh 4MZPA 2XMFA 2DEUA 4RCCA 4PJMA 4HKEA 4F17A 1GCPA 1ZA2B 2M0OA 2RPNA 1TU0B 1RI0A 4M77B 2E3HA 2V1RA 4DBRA 2K5IA 2CH4A 1Q82C 1NM7A 2DXTA 3DLMA 2QEXT 3JCMf 1ABOA 3DLLA 3EGXB 1PC0A 3HKSA 1FMWA 3CCQQ 1K8AC 3CC2A 1H3ZA 1O9SA 2ZPBB 3EH1A 3C4SA 2XKOC 3CPWP 1PWTA 1IZ6A 4XTWA 1SSFA 2RQTA 4JS5A 2GTJA 2DFUA 1VQ4A 1JJ2A 1VQMA 2QXFA 2MAMA 1G2BA 4C8QA 3CCLQ 3D7SB 1JO8A 1P92A 1WDXA 1KHIA 3PFSA 3V8LA 3EGDA 1N8RC 4C8QG 4E47A 4OGCA 2LCSA 1QVFP 3JCMQ 1WXTA 2RQVA 4LNPA 1PG5B 4XTZA 1HSQA 2CP2A 1IRXA 5LJ3g 3G6ET 2L8DA 3CCUT 1FYNA 4KH0B 3HPWA 2CGHA 4KGZB 2Z0WA 1UGQB 1XOVA 5IN1A 3ZEHA 4AFUC 4C8QE 5IAYA 2L0AA 3CD6Q 4XTYA 1K76A 1H3HA 2X4WA 2D8JA 1Q95G 1ZQ1A 1Q7YU 3RNJA 3OS2A 3LX7A 1W70A 3E1SA 2D0NA 1WX6A 4AFSC 2YHTA 2FRWA 2BE7D 4JPBW 2K5FA 3AT1B 1YIJT 3OW2A 2W0ZA 3G4ST 3RMSA 1UGSB 2LX9A 3EG2A 3GPLA 1WXBA 2PTKA 1XJWB 3H0FA 3SHWA 2EYXA 3S3MA 2O88A 1W1FA 5CVIA 4C5EA 1QCNA 1WGSA 5I22A 3I55T 1RL2A 2ESWA 2R5MA 2XG8D 3DKMA 4KUDK 1ZA1B 1OEBA 5LJ3d 3GNGA 2CP3A 2ZPHB 1YJ9Q 3OS5A 4Z89A 4XAXB 4C0GA 2KI7A 4PNOA 2KEAA 1YI2Q 1K0XA 4XU2A 1UHFA 1WZOA 3CCRQ 3C95A 2LTOA 4RTZA 1GCQC 2DBKA 5CCAA 1UJ0A 4LUEA 2MYSA 2CZ7B 2X35A 1VQKQ 1OPKA 2JS0A 2VYTA 2HQEA 5J3BA 1WXUA 3L42A 2DX1A 3HRUA 3PT9A 2KQWA 3LWHA 3ZBDA 4J8OA 1QKXA 5KYYA 2H3JA 4EMKC 5FROA 2CUDA 3RMQA 1I4K1 2CT4A 1Z9QA 3X20B 2MI6A 4IUPA 3CXCP 2NWMA 2QK0A 4NL3A 2YXYA 1JXOA 2FG0A 2CSQA 4PFPA 2V1QA 2XDBA 3A8MB 1Q7YR 5IH2A 4M7DD 1Y71A 2J05A 4RTXA 1QW1A 3FIFA 4A53A 1K0SA 4ELZC 5GAOm 2K9GA 2K2VA 3CCMA 1VQOQ 4OMLA 1ABQA 1A0NB 3QZ5B 2PVDB 1N6AA 1M1KC 1K9MU 1Y07A 2RK2A 2RJDA 4DBFA 4BD3A 3KXTA 2M9UA 3JB9G 2OAWA 1VQ7Q 2RMOA 2AK5A 2A36A 1QVGS 5AT1B 2CS7A 2EJGA 5GAOq 4ANJA 1AZGB 4KT0E 3CCJA 1TUGB 3HRTA 3C0CA 4PJOC 3M56A 1SRMA 2M0YA 3SWNB 5FU6C 3QZ9B 3MEWA 2L5QA 2F5KA 1VQ6A 2CP6A 5CIUA 2KXDA 2CZ1B 2RJEA 5CKEA 3RBBB 3BDUA 4FYWB 2JTFA 3GF5A 5FRMA
chains in the Genus database with same CATH topology
3QIIA 5D6XA 3I56T 4A4GA 2QEXA 5GMKm 2DTHA 4PJOB 4P5NA 3LH0A 2VXEA 3OYLA 1ZHIA 4M78B 4BUGA 4XU0A 3A5ZB 1W4SA 4QVZA 3PIOA 3OY9A 2M1HA 5HK0A 4C92C 3PMTA 4J6XA 4TVRA 1KD1U 4M75D 1G5VA 5HY6A 1BIBA 3OYCA 3OYAA 4B9XA 3JCMP 1BKBA 1W2BS 3OYJA 1W2BA 5GAN3 4UC4A 4NOYA 1YJNA 3OMCA 3OQ5A 4M77C 5LL6S 1G3WA 2DPPB 4C8QF 1V29B 5GAMf 5GAN2 3OYKA 2D9TA 3CBPA 1OZ2A 1VQPT 4M78D 2K3YA 2HD0A 2M16A 2DTOA 5GANf 2KSSA 3WVEB 3G71T 3X24B 3INZA 2KK4A 3GLXA 3QXEB 3VUBA 1VQNA 4QQ6A 3OSVA 2PVOB 2RH2A 3QYHB 4RG2A 1QP3A 2GFUA 3KUFA 4PLLA 3QO3A 1KD1C 2MWPA 2FB7A 3PIPA 1Y96A 3RUXA 3RERA 2EIFA 3G6EA 4L6V5 4JLGA 4OB0B 3CCUA 3UWNA 1VQOA 5GAOl 4Q5WA 3BY7A 2FYKA 4A4KA 4OB1B 2YRVA 3CCRT 4QVDA 3J7AF 2ZPIB 1TH7A 3C12A 5CKFA 4Z02A 3CMAA 4C8QB 4E7HA 2V8KA 3M57A 3MHXA 4JLIA 1VQ6A 3EAEA 4BE2A 3JB9J 4V2SA 1VQKT 2G3RA 3JSCA 3JAME 2LRQA 3CCQT 1M1KU 4EPCA 1VQ7A 5CK9A 3VYGA 3GNFB 4FT2A 4BE0A 2OTJT 3Q1JA 1GXIE 4RG8A 5GAMe 3CC7A 2K4YA 4M7AD 2XICA 5DLOA 3H6ZA 1O75A 3VU3C 3L2WA 5GANe 4KUIA 3FRNA 4M78E 4MDWA 5AYFA 4E7KA 2XIDA 2RI2A 5GAN7 4PL6A 4C8QD 4IUQA 2FHDA 2KDSA 2QA4T 5A0GA 3S3NA 4M7AA 2EWNA 3P8HA 4VUBA 5GMKh 2O4XA 3RKWA 2XDDA 4EMKB 3UDCA 3CCLT 2AHJB 2IVWA 3M53A 4O5VA 3UPUA 5CKDA 5GAN5 1Q81C 4FL6A 2EKOA 3JCMc 4M7DA 3L2ZA 4MMLA 3M55A 2K5LA 1YITT 4M7AG 3OYHA 5KE2A 1YIJA 3WXMB 3OMGA 5GAN8 5GAMj 2A3LA 3G4SA 2R58A 4KULA 3HRSA 3FJPA 2LVMA 3NFCA 1JBMA 5CKBA 3O8VA 3OYDA 1S72A 5GANj 4ZN1A 5FRNA 2R5AA 1OZ3A 4PLIA 2E1HA 4Y28E 5GAMd 3JRZA 2P4TA 3BFMA 2DVEA 2RJCA 1FWZA 2E70A 5GANd 2VGMA 2VUBA 3JCMe 4J7FA 1JB0E 3DB4A 2WACA 4CI0C 4GLKA 5A2QE 3CXCA 3CXCS 1KG1A 4FIBA 1QVGA 3QHSA 2LCCA 2E64A 5J26A 4LDUA 5FU7C 2XDPA 3V7SA 1X75C 2DAQA 4J5YA 2X4YA 4J83A 5GMKl 2RK1A 3I55A 1VQ9A 4M7AE 2Y4YA 1X01A 1WQ7A 2RD1A 3CCSA 2ZPGB 2DXCA 4EMHA 3CD6T 3VV0A 4QW2A 3OYBA 3M58A 2LQ8A 2DEQA 4JRKA 4BDYA 3M5AA 4C0DB 2EQMA 2P0QA 2WSFE 4D6WA 1KQSS 3JB9I 1KQSA 4IUTA 4DA4A 1VIFA 3GP8A 2EJ9A 3GOXA 1XNIA 2L3RA 2CZ0B 1HK9A 3NTIA 4B9WA 2QQ9A 4ZGEB 3OYFA 2JNGA 1XTDA 4R55A 4LDVA 2LNVA 2MWOA 2HQXA 4KBMB 4DOWA 2WSEE 3OYNA 1UEBA 3V7RA 2OTLA 3V8KA 2ZPEB 5GAOr 1OYXA 3S3OA 5LJ5g 2JZ2A 1UB4A 2YLCA 2FL7A 3MEUA 5D6WA 5GAOp 2RHUA 2LC4A 4F7UF 2PVGB 1VUBA 5GAN4 3CCMT 2YLBA 4BACA 5LJ5f 3EFRA 1G3TA 3UT1A 1YBYA 3OW2S 4YTLA 3V8JA 3CMEA 5LJ3e 3RKYA 2XHCA 4BDZA 5FU6B 2I2LA 1IREB 4BY6B 4ZGJB 2LCLA 5CQXA 2XD0A 2OTJA 3FLGA 4DOVA 4C92F 5GMKi 3SWNA 2JN0A 4JUVA 4RKUE 3X25B 5A0LA 1WNLA 4HCZA 5KCOA 4A4FA 1QVPA 3OS1A 1QP2A 1Y7XA 3JCMW 5HKCA 4M75A 5GAMg 2PUOB 3FB9A 3MEVA 3RIRA 3KBGA 2E6NA 2QTXA 1VQLA 3FEOA 5C0MA 3AHUA 3MO8A 4F7UB 5GANg 4M77F 1N9RA 4PJOD 1U8RA 3M9QA 5CAIA 3CCJT 1Q82U 4XQ3A 4ZGDB 5LJ3j 3CCVA 1VQ9T 2DKGA 3C94A 4M75G 2EYQA 3LLRA 4C5HA 2EAYA 1K8AU 2D6FA 4LDXA 1NPRA 3JCMV 2QQSA 4PJOA 2DJZA 3CBOA 4BI3A 3L2VA 3META 2P0KA 3HFOA 4ME7A 4XTUA 1YJ9T 4M78A 4C92B 1BI0A 3LYIA 3X28B 5GANh 4MZPA 1M5Q1 1M1GA 4L59A 2ZGWA 4JRIA 4PJOG 5LJ5e 2F69A 4HA8A 1YI2T 1VQ6T 1AHJB 4XTVA 1G3YA 4RCCA 4X34A 4N4GA 4M78G 4HKEA 1I81A 5L8RE 2F5TX 2M0OA 3RKXA 4M7DC 3CBMA 4J6YA 1B34B 3SFMA 4Y91A 4E7IA 1RI0A 3HL8A 3L1AA 4M77B 5CO7A 2OTLT 1YJWA 1Q81U 3JCMg 3JB9F 4M75E 5FLXE 2K5IA 3CCEA 3LGLA 2DXTA 3DLMA 4N4IA 2EJFA 1Q82C 1VIEA 2KVQG 2QEXT 3JCMf 3QKJA 3DLLA 3QSUA 3P8DA 3PGGA 3HKSA 3CC2A 3MCAB 1FXXA 4C92D 1K8AC 1H3ZA 1O9SA 2ZPBB 5LJ5j 3NTKA 4BI4A 3C4SA 2XK0A 2R57A 2XKOC 4N0AA 1WJRA 4O6JA 1IZ6A 3F70A 4PJOE 1MGQA 4XTWA 3E19A 5LJ5d 4LDYA 2X4JA 1K73U 3CC4A 1SSFA 4IUUA 1H641 4M77D 4JS5A 1I5LA 3BW1A 2QDYB 1U1TA 1LOJA 2PQWA 1M90U 1VQ4A 1VQ8A 1JJ2S 1JJ2A 1D3BB 1VQMA 4PKCC 2PU9B 3V7CA 5I2MA 1UGPB 1YJNT 2IG0A 2QXFA 2MAMA 4J6WA 4C0ZA 2RHYA 3E9GA 4C8QA 2LT1A 1P92A 4BB7A 3QJ6A 1KHIA 2QI2A 4OB3B 4IUVA 3PFSA 3V8LA 3M59A 1X6OA 1OI1A 4EMGA 1N8RC 2NLUA 4FM4B 4C8QG 5KE3A 3NTHA 4ZTFA 1BI1A 4E47A 3QPHA 4OGCA 3X26B 2RI3A 1VQNT 1EIFA 2HBPA 3JCMQ 1YHQA 3J81E 2VV5A 1WJSA 3QJYA 4XTZA 3LGFA 4QVCA 5C6SA 3URGA 5LJ3g 1K73C 3G6ET 3I56A 1NE8A 2L8DA 3OYIA 3CCUT 4MZMA 3JCMb 3TCJA 1VQOT 2DO3A 3VYHB 3WVDB 1M90C 5LJ3f 3HPWA 4OGEA 3CMAT 2CGHA 2LQKA 5DM7R 3OYMA 1BI2A 4EMKA 5J39A 4LD9K 3HSBA 1UGQB 1XOVA 3CCET 5IN1A 3ZEHA 4M77E 3SD4A 3L2UA 4C8QE 2DD4A 1VQ7T 3GIBA 3LWIA 5IAYA 2OAUA 3ASKA 3OSSC 1BYMA 1LJOA 3QBYA 4II1A 4XTYA 2HNIA 2DD5A 5A0DA 2P0PA 1NJIU 2X4WA 4X9CA 3SB2A 3JCMd 3CC7T 2MMPA 4OMFB 4QQDA 4M75C 4HCCA 1ZQ1A 4GY5A 2DZ9A 4E7LA 1Q7YU 1R8OB 5IT9E 2GCXA 3CC4T 4MMKA 3OS2A 3LX7A 4XU1A 3TEEA 3L2RA 3E1SA 5FU7B 3T9NA 1VQPA 2YHTA 1WPYA 3PNWC 2DIQA 4A4EA 1M8VA 3RESA 1KC8U 4FT4A 2ZZDA 3M4GA 4MZTA 2XI9A 3ZFJA 2VGNA 4ELYC 4OB2B 2K5FA 4JDSA 4M78C 1YIJT 4OP0A 1VQ5A 3OW2A 4LD6A 3G4ST 3RMSA 3VJPA 1UGSB 1S72T 2LX9A 4JRPA 4JRQA 4E7JA 5DLQE 5LJ5h 4MDXA 1LNXA 3M4YA 4OF1A 2ZCFB 4EDUA 3GPLA 2MF2A 3CCRA 1NJIC 1YCYA 1Q7YC 2Y4XA 3P8BB 4IURA 2RI5A 3S3MA 3CPFA 1VQKA 1M9SA 3CCQA 5CVIA 2K3XA 4C5EA 3JCMJ 4C5IA 1N27A 1KC8C 1WGSA 3I55T 1RL2A 3PMIA 1WJQA 2GF7A 1HXDA 2R5MA 3A8HB 2XG8D 2VXFA 4JJNK 4N0AC 2XU8A 3DKMA 3E9FA 4FU6A 3CCST 4KUDK 5LJ3d 3TREA 1Y96B 5CQYA 3GNGA 2DTIA 2FVUA 5GAMh 4HT8A 3OB9A 4A4HA 3BDLA 2ZPHB 3OS5A 2QA4A 3H8ZA 4M7AC 1M4ZA 4M7AF 5KCHA 4XAXB 4C5GA 4C0FA 4C0GA 2BUDA 2JTMA 4PNOA 1N9SA 3CCLA 1KHCA 2KMTA 4M7DF 2X4XA 4C8QC 2EQJA 5I21A 2QQAA 4XU2A 1YITA 2CZ6B 2DZCA 3N5BB 3C95A 2LTOA 2PUKB 5CCAA 2D0QB 4F7UA 2RB6A 2CZ7B 2RM4A 2X35A 1N8RU 3A8LB 4CRIA 3A8OB 5CKHA 4N4HA 2JUFA 4BI8B 1VQ5T 1Q86U 2RO0A 2VYTA 1MHNA 3R6OA 3FC3A 1KQ1A 3CMET 4NS5A 2DIGA 2HQEA 5J3BA 4F7UG 4WF2A 3L42A 4M7AB 3JCMh 2V8IA 3OYGA 3HRUA 3PT9A 3OS0A 1I8FA 2O4XB 2E41A 4FSXA 4C92A 2CYZB 2GFAA 2KQWA 3LWHA 2HAXA 3ZBDA 4J8OA 5D6YA 3JB9H 3LW5E 2DXUA 4M7DB 2EQKA 1NZ9A 2E6ZA 2H3JA 3MP6A 2EFIA 4EMKC 5FROA 4XK8E 3RMQA 4C92G 1I4K1 4LDWA 1U1SA 1B34A 3CD6A 2VC8A 3OYYA 1VQLT 4M77A 3MP1A 3X20B 1XQHA 2DXBA 2MI6A 4X9DA 3CCVT 4IUPA 4NL3A 3J80E 4F7UE 1BIAA 3QDRB 4M77G 3L2QA 3S6WA 4JS4A 3CEYA 1Q86C 2C06A 3QYGB 2XDBA 3A8MB 1PSEA 3MEAA 2RA2A 5FRMA 2GQVA 4M7DD 1Y71A 2B8AA 4XTXA 1QW1A 3DB3A 3FIFA 4A53A 4ELZC 5GAOm 3OYEA 4RCBA 3OA6A 3JB9D 1WQWA 2E12A 2LT4A 3HP9A 3EFSA 4RMOA 4C92E 5KH6A 4ZN3A 3HHTB 3CPWS 3CPWA 4XU3A 2A7YA 2K2VA 2QQRA 3OBYA 5HK3A 3CCMA 4BE1A 1D3BA 1YJWT 3QZ5B 4ATOA 2PVDB 1N6AA 1M1KC 4A54A 4HT9A 1K9MU 4M7DG 1Y07A 2RK2A 2KAFA 2RJDA 3HFNA 5LJ3h 4BD3A 4C0DC 3KXTA 3MP8A 2M9UA 3JB9G 3SWNC 5GAOn 3CC2T 1M1FA 4OVAA 2K57A 3ME9A 2L89A 1UGRB 4QQGA 2EQUA 2E65A 2BIVA 2O01E 3QUIA 4J7IA 4L5GA 5GAN6 5I2SA 1ZBXA 3VKIA 1QVGS 3VUZA 4M75F 1G3SA 2CS7A 4NL2A 1KQ2A 2EJGA 5GAOq 2E10A 4KT0E 3CCJA 5DY9A 5GMKe 3ER0A 3JCMX 1VQ8T 1QVFA 1QVFS 3QG1A 1VQ4T 3HRTA 1VQMT 5EG2A 3G7ZA 4M7DE 4ZTJA 3G71A 4PJOC 2DK3A 2Y90A 4PJOF 4R56A 3M56A 2JOYA 2QQBA 2E5QA 1YJ9A 1K9MC 3FDRA 2LDMA 4M78F 3M54A 3PTAA 2ZPFB 3SWNB 2V8JA 2RHIA 3QZ9B 5FU6C 4DQ2A 1NPPA 1PSFA 2JVVA 2L5QA 2F5KA 2RHZA 3MEWA 4BY6C 5M9OA 2RHXA 2WSCE 5CR2A 1YI2A 4HCBA 3SDZA 5CIUA 3TU4K 2CZ1B 2RJEA 5CKEA 2KY9A 4M75B 3BDUA 5GMKj 1BI3A 3OBWA 2JTFA 1JRIA 3A8GB 1YHQT 3GF5A 2BKDN 4IKFA 2CKKA 1FX7A 1DJ7B 2RJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D3B B;  4C8Q C;  5I21 A;  4XU2 A;  3V7S A;  3V7C A;  4J5Y A;  5GMK l;  4M7A E;  2DZC A;  4J6W A;  5GMK m;  2DTH A;  1X01 A;  1WQ7 A;  4C8Q A;  2RD1 A;  4PJO B;  2VXE A;  4F7U A;  4EMH A;  2RB6 A;  4M78 B;  2RM4 A;  2DEQ A;  3V8L A;  4JRK A;  4EMG A;  4XU0 A;  4C8Q G;  3JB9 I;  1KQ1 A;  4J6X A;  4C92 C;  4M75 D;  4F7U G;  2EJ9 A;  4WF2 A;  4M7A B;  3JCM h;  3JCM Q;  1BIB A;  1HK9 A;  1I8F A;  4XTZ A;  2E41 A;  4C92 A;  4QVC A;  3JB9 H;  3JCM P;  4M7D B;  5LJ3 g;  2DXU A;  5GAN 3;  3V7R A;  4NOY A;  3V8K A;  3JCM b;  4EMK C;  5GAO r;  4M77 C;  5LJ3 f;  4C92 G;  4C8Q F;  2YLC A;  5LJ5 g;  1I4K 1;  5GAM f;  5GAN 2;  5GAO p;  1U1S A;  2CGH A;  1B34 A;  2VC8 A;  4F7U F;  4EMK A;  4M78 D;  4M77 A;  5GAN 4;  5GAN f;  2DTO A;  2YLB A;  3HSB A;  5LJ5 f;  3EFR A;  4X9D A;  3JCM d;  3INZ A;  4M77 E;  4C8Q E;  3V8J A;  3GIB A;  4NL3 A;  5LJ3 e;  3RKY A;  4F7U E;  1BIA A;  2I2L A;  1LJO A;  4M77 G;  4XTY A;  2HNI A;  3QO3 A;  4X9C A;  4C92 F;  2FB7 A;  2RA2 A;  1Y96 A;  3RUX A;  3SB2 A;  2JN0 A;  4JUV A;  3SWN A;  5GMK i;  4XTX A;  4M75 C;  1WNL A;  4M7D D;  3FIF A;  2DZ9 A;  5GAO l;  3BY7 A;  2FYK A;  4A53 A;  3QHS A;  5GAO m;  4QVD A;  4RCB A;  3JCM W;  4MMK A;  1WQW A;  1TH7 A;  3JB9 D;  3EFS A;  4M75 A;  4XU1 A;  3FB9 A;  3RIR A;  4C8Q B;  4C92 E;  5GAM g;  4XU3 A;  4JLI A;  2QTX A;  1WPY A;  2YHT A;  3AHU A;  1M8V A;  4F7U B;  5GAN g;  3RES A;  4M77 F;  1N9R A;  3JB9 J;  4V2S A;  5CAI A;  4PJO D;  3M4G A;  4XQ3 A;  5LJ3 j;  1D3B A;  2DKG A;  4M75 G;  4A54 A;  4HT9 A;  4M7D G;  2EAY A;  4M78 C;  4OP0 A;  3JCM V;  3RER A;  3HFN A;  4PJO A;  2DJZ A;  5LJ3 h;  3HFO A;  4XTU A;  3JB9 G;  3SWN C;  5GAM e;  4M78 A;  4C92 B;  5GAO n;  4M7A D;  5GAN h;  2K57 A;  3VU3 C;  1M5Q 1;  5LJ5 h;  5GAN e;  1LNX A;  2ZGW A;  4JRI A;  4M78 E;  2E65 A;  3QUI A;  4PJO G;  4HA8 A;  5GAN 6;  5LJ5 e;  4XTV A;  4RCC A;  5GAN 7;  1YCY A;  4M75 F;  4C8Q D;  4M7D C;  4M78 G;  4NL2 A;  1I81 A;  1KQ2 A;  2EJG A;  3RKX A;  2EWN A;  5GAO q;  4M7A A;  2E10 A;  4J6Y A;  5GMK h;  1B34 B;  3RKW A;  4Y91 A;  4EMK B;  3L1A A;  5DY9 A;  4M77 B;  5GMK e;  3QSU A;  4M7D A;  3JCM X;  3JCM g;  5GAN 5;  3JB9 F;  3JCM c;  3L2Z A;  4MML A;  4M75 E;  3JCM J;  4M7A G;  4M7D E;  2DXT A;  2EJF A;  5GAN 8;  4PJO C;  1HXD A;  2Y90 A;  3JCM f;  4PJO F;  5GAM j;  2VXF A;  3FJP A;  4N0A C;  1JBM A;  3PGG A;  4C92 D;  5GAN j;  4M78 F;  5LJ3 d;  5LJ5 j;  1Y96 B;  3SWN B;  2E1H A;  4DQ2 A;  5GAM d;  2DTI A;  5GAM h;  4HT8 A;  4N0A A;  3BFM A;  2DVE A;  4PJO E;  5GAN d;  1MGQ A;  4XTW A;  3JCM e;  5LJ5 d;  4M7A C;  4M75 B;  3BDU A;  5GMK j;  4M7A F;  1JRI A;  4PNO A;  1N9S A;  1H64 1;  4M77 D;  1I5L A;  3BW1 A;  1U1T A;  1LOJ A;  4M7D F;  2E64 A; 
#chains in the Genus database with same CATH topology
 3QII A;  1G83 A;  5D6X A;  3I56 T;  4A4G A;  2VXE A;  1VQ9 Q;  2C0T A;  4QVZ A;  1GBQ A;  3PIO A;  4C92 C;  4JZ4 A;  4M75 D;  5I11 A;  1QQJ A;  4B6M A;  3OYA A;  4B9X A;  1W2B S;  1IO6 A;  2HKQ B;  4UC4 A;  2JJ9 A;  4NOY A;  2AKL A;  4C8Q F;  5GAN 2;  5GAM f;  2D9T A;  4M78 D;  5GAN f;  2DTO A;  2KSS A;  2W10 A;  3WVE B;  3X24 B;  4M4Z A;  3GLX A;  4QQ6 A;  2JMC A;  1IGU A;  4IIM A;  1JJ2 P;  2GFU A;  3QO3 A;  1KD1 C;  3RER A;  4JLG A;  2DL7 A;  2AKK A;  4Q5W A;  2FYK A;  3CCR T;  3C12 A;  3MHX A;  3JB9 J;  2FZG B;  1K9M R;  2G3R A;  1VQK T;  1IXD A;  4AMC A;  2X9H A;  3Q1J A;  3CCV Q;  4GBQ A;  5GAM e;  3CC7 A;  2XIC A;  3H6Z A;  1O75 A;  3L2W A;  5GAN e;  4KUI A;  1X6B A;  2L2P A;  2RI2 A;  5GAN 7;  2QA4 T;  1K4U S;  4M7A A;  3P8H A;  5GMK h;  3RKW A;  4EMK B;  5KYX B;  3QSU A;  4M7D A;  3UPU A;  1RUW A;  1Q81 C;  2EKO A;  3JCM c;  2K5L A;  4M7A G;  3OMG A;  2HZY A;  2A3L A;  1YNZ A;  2YUP A;  3FJP A;  5CKB A;  3OYD A;  1PHT A;  4Y28 E;  4JJD A;  3JRZ A;  2RJC A;  3VS3 A;  2E70 A;  4J7F A;  1QWF A;  1JB0 E;  2J6O A;  2KXC A;  1KG1 A;  3QHS A;  2E64 A;  5IHI A;  5J26 A;  4LDU A;  4PJJ A;  3OW2 P;  2K79 A;  4M7A E;  2X4Y A;  2HQH A;  1Y57 A;  1VA7 A;  2Y4Y A;  2RD1 A;  2CP7 A;  3M5A A;  1ZSZ A;  4AFZ C;  3KFV A;  3U23 A;  3GP8 A;  2L3R A;  4ZGE B;  2JNG A;  6AT1 B;  1S72 Q;  2WSE E;  3V7R A;  2OTL A;  2EBP A;  2CUB A;  1OYX A;  3S3O A;  5LJ5 g;  2JZ2 A;  3QWX X;  1UHC A;  1VUB A;  2HKN A;  3OW2 S;  2JXB A;  5LJ3 e;  4J9G A;  5FU6 B;  4AFQ C;  4ZGJ B;  2DER A;  2L3P A;  3BE3 A;  3X25 B;  4A4F A;  1QP2 A;  4M75 A;  2HEQ A;  2PUO B;  3MEV A;  2V26 A;  3RIR A;  1VQL A;  1N9R A;  1Q82 U;  4XQ3 A;  1WIE A;  1VQ9 T;  4M75 G;  2EYQ A;  1K8A U;  4KH1 B;  3I9Q A;  3MET A;  3HFO A;  3EG0 A;  4M78 A;  4C92 B;  2HMA A;  1M5Q 1;  4L59 A;  2X3W D;  1G3Y A;  2EW3 A;  4X34 A;  2FEI A;  3CME Q;  4N4G A;  4M78 G;  5L8R E;  4J6Y A;  3SFM A;  1B34 B;  4Y91 A;  2QDL A;  3HL8 A;  2OTJ Q;  5CO7 A;  1YJW A;  2LMJ A;  1UE9 A;  3JB9 F;  2DNU A;  4M75 E;  3CCE A;  2EJF A;  1MV3 A;  2KVQ G;  3PGG A;  3P8D A;  3MCA B;  5LJ5 j;  1OX9 A;  1WJR A;  5LJ5 d;  4LDY A;  2X4J A;  3CC4 A;  2RQU A;  1VQ8 A;  3EG3 A;  1D3B B;  1M3C A;  2PU9 B;  4DEY A;  5I2M A;  1YJN T;  2IG0 A;  2ATC B;  2LT1 A;  1AT1 B;  4BB7 A;  2QI2 A;  1NEB A;  1RAF B;  4J9B A;  1OI1 A;  4FM4 B;  5KE3 A;  4ZTF A;  1BI1 A;  2RI3 A;  1VQN T;  1EIF A;  1YHQ A;  1PKT A;  3J81 E;  2DF6 A;  1HYO A;  3URG A;  1K73 C;  1PD1 A;  2DBM A;  1NE8 A;  3OYI A;  2YT6 A;  3TCJ A;  2DRK A;  2DO3 A;  3VYH B;  3WVD B;  3CMA T;  5DM7 R;  3OYM A;  2IIM A;  2PNI A;  5IHK A;  3TSZ A;  4M77 E;  3L2U A;  1TWB A;  3GIB A;  1JU5 C;  3ASK A;  3OSS C;  1LJO A;  4II1 A;  5A0D A;  3TQ7 P;  4X9C A;  1E6H A;  3SB2 A;  1I07 A;  1IHW A;  4E7L A;  4GY5 A;  5FWC A;  1R8O B;  1ZX6 A;  4MMK A;  5FWB A;  3TEE A;  2J6F A;  1AOJ A;  1Q82 R;  1VQP A;  1M8V A;  1WPY A;  2DIQ A;  3M0U A;  2XI9 A;  3ZFJ A;  1FMK A;  1K8A R;  4OB2 B;  1Y0M A;  5FW9 A;  3H0I A;  2A08 A;  4LD6 A;  4Z88 A;  1S72 T;  1OU9 A;  5DLQ E;  4MDX A;  2BZX A;  3M4Y A;  4EDU A;  1M30 A;  2Y4X A;  2K3X A;  4C5I A;  1N27 A;  1KC8 C;  3PMI A;  2GF7 A;  1N8R R;  2MIO A;  3EHR A;  2VXF A;  2XU8 A;  3CCS T;  2DJQ A;  1Y96 B;  5GAM h;  4ORZ A;  3BDL A;  2AIR B;  3H8Z A;  1SHF A;  4M7A F;  5KCH A;  1OOT A;  2NUP B;  2ABL A;  4M7D F;  4C8Q C;  2CZ6 B;  3NPF A;  2RB6 A;  4F04 B;  2RM4 A;  4QT7 A;  4OMQ A;  4BI8 B;  3FC3 A;  1MHN A;  3CME T;  2DIG A;  1QCO A;  2EGC A;  2O4X B;  3UA7 A;  4FSX A;  2OTJ T;  2CYZ B;  2HAX A;  2DXU A;  1F1B B;  3EFO A;  1U1S A;  2DMO A;  2AT1 B;  5IXF A;  1XQH A;  2O2O A;  1YIT Q;  4RTV A;  3QDR B;  4JJC A;  2OX7 A;  3I5R A;  3S6W A;  3L2Q A;  4JS4 A;  2C06 A;  2KRO A;  3QYG B;  1PSE A;  2ENM A;  2DYB A;  2J06 A;  3OYE A;  1OU8 A;  3JB9 D;  1WQW A;  3HP9 A;  5KH6 A;  1J3T A;  2PZ1 A;  3CPW S;  1WHG A;  4XU3 A;  1SKU B;  3OBY A;  3MKD A;  2E3I A;  3M0S A;  3HFN A;  4HVV A;  1OPL A;  5LJ3 h;  1KFZ A;  3SWN C;  2FPD A;  1M1F A;  2EQU A;  2E65 A;  2BIV A;  5I2S A;  4L5G A;  1KK7 A;  2EKH A;  4M75 F;  3CC7 Q;  2E10 A;  5DY9 A;  2EGA A;  5GMK e;  1QVF S;  1JXM A;  4LXC A;  4ZTJ A;  3G71 A;  2DK3 A;  2Y90 A;  2JOY A;  1V76 A;  3FDR A;  4M78 F;  3M54 A;  3PTA A;  2RHI A;  1U3O A;  2FO0 A;  2RHX A;  2LZ6 B;  3TU4 K;  2K7A A;  2KY9 A;  1BCM A;  1BI3 A;  1JRI A;  1PKS A;  1E6G A;  4IKF A;  1DJ7 B;  2QEX A;  1E7O A;  5GMK m;  2DTH A;  4P5N A;  4J9E A;  3PVQ A;  4QKU A;  4Y92 A;  3RDV A;  1AVZ C;  3PMT A;  4J6X A;  4TVR A;  1KD1 U;  1G5V A;  4FSS A;  1BKB A;  3OYJ A;  5GAN 3;  2HDA A;  3OQ5 A;  2DPP B;  3OYK A;  1C1A A;  2KYM A;  2K3Y A;  1X2K A;  2M16 A;  2OTL Q;  2K3B A;  3INZ A;  1T3L A;  3QXE B;  1SEM A;  3VUB A;  3I35 A;  1QP3 A;  3KUF A;  4PLL A;  2HSE B;  2MWP A;  2EIF A;  3G6E A;  1ACM B;  3CCU A;  3UWN A;  3ZL7 C;  4A4K A;  1N5Z A;  4OB1 B;  4D8D A;  2BZY A;  4OMO A;  1M2V A;  4C8Q B;  2V8K A;  3JAM E;  3EGD B;  3CCQ T;  1RAE B;  2ED1 A;  4BE0 A;  1UJY A;  2NUT B;  1TUC A;  3NMZ C;  4M7A D;  5DLO A;  3VU3 C;  1RAH B;  4E7K A;  2P4R A;  4PL6 A;  4IUQ A;  2KDS A;  5A0G A;  2EWN A;  3REB B;  4WTO B;  2M02 A;  3UDC A;  3CCL T;  2AHJ B;  2IVW A;  1R77 A;  5CKD A;  5GAN 5;  3M55 A;  1YIT T;  5KE2 A;  1YIJ A;  3G4S A;  2R58 A;  2COW A;  2F1L A;  4KUL A;  2KRS A;  2LVM A;  3NFC A;  1YJW Q;  1VOM A;  2A37 A;  3GBQ A;  3PVL A;  3CCE Q;  2P4T A;  3NHN A;  1FWZ A;  2VGM A;  2WAC A;  3CXC S;  4GLK A;  5A2Q E;  4FIB A;  2B86 A;  5FU7 C;  3V7S A;  1X75 C;  4AT1 B;  4J83 A;  3I55 A;  3REA B;  3CC4 Q;  1X01 A;  2DLP A;  1VQ8 Q;  2ZPG B;  3CD6 T;  4QW2 A;  1KD1 R;  2WSF E;  2HBW A;  2QAS A;  1KQS A;  3JB9 I;  4IUT A;  4DA4 A;  1VIF A;  2EJ9 A;  3NTI A;  4B9W A;  2CZ0 B;  5IHN A;  1XTD A;  4HVW A;  4R55 A;  4KBM B;  1SF9 A;  3V8K A;  2LJ0 A;  3TSW A;  1YHQ Q;  1SSH A;  2YLC A;  5GAO p;  4KRT A;  2FL7 A;  2RHU A;  2YLB A;  3EFR A;  2D1X A;  3RKY A;  2XHC A;  4BDZ A;  1PD0 A;  1IRE B;  3FLG A;  1X2Q A;  5A0L A;  2E4H A;  1WNL A;  4HCZ A;  3OS1 A;  1GFD A;  1ZUK A;  1Y7X A;  3JCM W;  2RQR A;  3FB9 A;  2E6N A;  2QTX A;  5C0M A;  3AHU A;  1U8R A;  3M9Q A;  1YFN A;  3C94 A;  4JJB A;  2LQN A;  4LE9 A;  1NPR A;  2QQS A;  4DBH A;  1GBR A;  4PJO A;  2YRD A;  3CBO A;  3H0H A;  4BI3 A;  2P0K A;  4XTU A;  1MNE A;  1YJ9 T;  2LX7 A;  2DL3 A;  3X28 B;  1R0C B;  2M51 A;  2ZGW A;  5KYY B;  3EH2 A;  4PJO G;  4HA8 A;  1YI2 T;  1AHJ B;  4XTV A;  4R0K A;  4M7D C;  2F5T X;  3RKX A;  2OTL T;  3JCM g;  1NEG A;  2FRY A;  5FLX E;  1VIE A;  1RAG B;  3QKJ A;  2KBT A;  1EZZ B;  1FXX A;  4N0A A;  3G1J A;  3EG9 A;  3F70 A;  1ZLM A;  2DVJ A;  4PJO E;  2NYS A;  1MGQ A;  1RLP C;  1GRI A;  1K73 U;  2VWF A;  1H64 1;  4M77 D;  3VRY A;  1U1T A;  2PQW A;  1JJ2 S;  1I1J A;  4PKC C;  2MPX C;  2QGF B;  1SG5 A;  2RHY A;  3E9G A;  3QJ6 A;  4OB3 B;  3M59 A;  1X6O A;  4EMG A;  2QAZ A;  1WHK A;  2C0O A;  3VRZ A;  2VVK A;  2HBP A;  3EHQ A;  2VV5 A;  4KGV B;  3QJY A;  3LGF A;  5C6S A;  3CC2 Q;  3I56 A;  4MZM A;  3JCM b;  1VQO T;  1M90 C;  5LJ3 f;  4OGE A;  1BI2 A;  2KYB A;  5J39 A;  4OMN A;  4LD9 K;  2YUO A;  3CCE T;  1UGV A;  1VQ4 Q;  1VQM Q;  2DD4 A;  1VQ7 T;  1QKW A;  2HL5 C;  3QBY A;  2HNI A;  2H3E B;  1KSW A;  2P0P A;  1EX4 A;  3JCM d;  1PNJ A;  4OMF B;  2CP0 A;  4QQD A;  4M75 C;  4HCC A;  1CKB A;  2DZ9 A;  2GCX A;  2KGT A;  3CC4 T;  1AWX A;  4XU1 A;  3L2R A;  5FU7 B;  1PM3 A;  3PNW C;  4A4E A;  2YSQ A;  1KC8 U;  4FT4 A;  2ZZD A;  4MZT A;  1T0J A;  4E7S A;  4M78 C;  1VQ5 A;  3VJP A;  4IIO A;  4JRP A;  4E7J A;  5LJ5 h;  1LNX A;  4OF1 A;  1NJI C;  2KE9 A;  2ZCF B;  3CCR A;  2MF2 A;  2F2V A;  1YCY A;  4F14 A;  4IUR A;  3CPF A;  1VQK A;  4HVU A;  2X3X D;  3JCM J;  1WJQ A;  1IGQ A;  2AZV A;  2O9S A;  1RAI B;  3TRE A;  5CQY A;  2FVU A;  3G71 Q;  1K73 R;  2QA4 A;  2MK5 A;  4C5G A;  3SEM A;  4WCI A;  2BUD A;  2JTM A;  2J7I A;  1H92 A;  2KMT A;  2KT8 A;  3O5Z A;  5I21 A;  2QQA A;  2DZC A;  1JQQ A;  4F7U A;  1OUL A;  1N8R U;  4CRI A;  2QEX Q;  3A8O B;  4N4H A;  2JUF A;  1D0Y A;  2RO0 A;  3R6O A;  5KYU A;  1NYF A;  2QYZ A;  1KQ1 A;  3NGP A;  4NS5 A;  4F7U G;  1MMA A;  4M7A B;  2V8I A;  3OYG A;  1I8F A;  2E41 A;  2GFA A;  2KT1 A;  5D6Y A;  4M7D B;  3LW5 E;  4K11 A;  2CP5 A;  2E6Z A;  3MP6 A;  2EFI A;  4XK8 E;  2DE0 X;  4LDW A;  2LJ3 A;  2VC8 A;  2HSP A;  4M77 A;  4X9D A;  3CCV T;  4PK4 A;  2EYW A;  4F7U E;  1BIA A;  1QMC A;  4M77 G;  1RLQ C;  1Q86 C;  2DL8 A;  3EGX A;  3MEA A;  2RA2 A;  2B8A A;  4XTX A;  3DB3 A;  1NLO C;  1M27 C;  2LT4 A;  3EFS A;  2KR3 A;  3HHT B;  1KC8 R;  2CT3 A;  3G6E Q;  2ROT A;  1KQS P;  1AWJ A;  2A7Y A;  3CCU Q;  5D7U A;  2P84 A;  4ATO A;  4DEX A;  5KYW B;  2VB6 A;  3EG1 A;  1AWO A;  1WFW A;  3CC2 T;  4OVA A;  2K57 A;  3ME9 A;  2L89 A;  1G3S A;  1KQ2 A;  1OQK A;  3JV3 A;  4HCK A;  2FPE A;  3ER0 A;  1RAA B;  3JCM X;  1VQ4 T;  1VQM T;  5EG2 A;  3G7Z A;  4PJO F;  4PJL A;  4R56 A;  4AG2 C;  2QQB A;  2E5Q A;  2LDM A;  3CCM Q;  2ZPF B;  1YIJ Q;  1M8M A;  1PSF A;  4BY6 C;  5CR2 A;  3G4S Q;  1YWP A;  2RN8 A;  4LN2 A;  3SDZ A;  1W6X A;  4M75 B;  3OBW A;  1FX7 A;  2FHD A;  2RJF A;  4ZNX A;  2YRC A;  1UUE A;  3VS1 A;  3OYL A;  4M78 B;  3CCJ Q;  1W4S A;  4RTY A;  5HY6 A;  1BIB A;  1B7T A;  3OYC A;  2MCN A;  3JCM P;  1W2B A;  1YJN A;  1VQ6 Q;  5LL6 S;  2KNB B;  1BBZ A;  1V29 B;  4J9H A;  8AT1 B;  4CC3 A;  1WI7 A;  1D1B A;  3G71 T;  3A98 A;  2DRM A;  1VQN A;  2EYZ A;  2RH2 A;  2X51 A;  1D0X A;  2BZ8 A;  5GAO l;  1AEY A;  3QWY A;  4QVD A;  3J7A F;  3CMA A;  2BE9 B;  2OI3 A;  1PRM C;  2ZAE A;  3M57 A;  4JLI A;  4DBQ A;  1EFN A;  4BE2 A;  4V2S A;  2QTV A;  1BB9 A;  3JSC A;  2LRQ A;  1M1K U;  4EPC A;  5CK9 A;  3VYG A;  4FT2 A;  3E2U A;  2AZS A;  1GXI E;  2RNA A;  2A28 A;  2YWW A;  2ECZ A;  4RG8 A;  2K4Y A;  1Z9Z A;  5AYF A;  2XID A;  1D1C A;  4RUG A;  4E6R A;  3S3N A;  2D8H A;  2XDD A;  3VS0 A;  3M53 A;  4FL6 A;  1T0H A;  3L2Z A;  4FYY B;  3WXM B;  5GAN 8;  5GAM j;  2EGE A;  1UEC A;  3O8V A;  1S72 A;  5GAN j;  4ZN1 A;  2E1H A;  5GAM d;  4GLM A;  3BFM A;  2NUT A;  5GAN d;  2CRE A;  3JCM e;  1WHM A;  1R0B G;  2VAS A;  4CI0 C;  1G8X A;  2LCC A;  2XDP A;  4J5Y A;  2RK1 A;  1SPK A;  1WQ7 A;  2DA9 A;  3CCS A;  5GJW B;  2DXC A;  4EMH A;  1M3A A;  3OYB A;  2F2X A;  2DEQ A;  4JRK A;  3UA6 A;  2GGR A;  2EQM A;  5IXB A;  2JM8 A;  3GOX A;  1HK9 A;  2QQ9 A;  3OYF A;  1BCO A;  4LDV A;  2LNV A;  4DOW A;  2E5K A;  3OYN A;  1GFC A;  3IQL A;  5HCK A;  1QLY A;  3MEU A;  2LQW A;  2LC4 A;  4F7U F;  3I56 Q;  5GAN 4;  1TOV A;  3CCM T;  4BAC A;  2RQW A;  5LJ5 f;  1G3T A;  1FMV A;  4YTL A;  3CME A;  1C6V X;  3MPU B;  2KRN A;  2JMA A;  2I2L A;  2JS2 A;  4BY6 B;  5CQX A;  2OTJ A;  4DOV A;  1KIK A;  1V1C A;  3SWN A;  3M0R A;  4JUV A;  4LUD A;  5KYN A;  1ARK A;  1QVP A;  2ED0 A;  2O9V A;  4HXJ A;  3HTR A;  4M77 F;  4PJO D;  1M1K R;  5CAI A;  3CCJ T;  1MND A;  5LJ3 j;  2DKG A;  2EYY A;  4C5H A;  2EAY A;  1PCX A;  1OX8 A;  2I0N A;  3JCM V;  4J9I A;  1BI0 A;  4A63 B;  1D09 B;  1M1G A;  1VQ5 Q;  4JRI A;  5LJ5 e;  2F69 A;  1VQ6 T;  1RAB B;  1CSK A;  1I81 A;  3EFO B;  3CBM A;  4E7I A;  3L1A A;  2O31 A;  1Q81 U;  3UAT A;  3LGL A;  4N4I A;  4OMM A;  3CQT A;  4C92 D;  1VQL Q;  3NTK A;  4BI4 A;  2XK0 A;  2R57 A;  4O6J A;  2LJ1 A;  3E19 A;  1HJD A;  3LH5 A;  4IUU A;  1I5L A;  3BW1 A;  2QDY B;  1LOJ A;  1M90 U;  2QA4 Q;  1NG2 A;  4FYX B;  3V7C A;  1UGP B;  1PRL C;  1YWO A;  4J6W A;  4C0Z A;  2GNC A;  1NBE B;  4IUV A;  1QVG P;  1GCQ A;  3PE0 A;  2NLU A;  2JT4 A;  1RAC B;  3NTH A;  3QPH A;  3X26 B;  2H8H A;  1WJS A;  2HCK A;  4QVC A;  4PFZ A;  1NYG A;  4J9C A;  1M3B A;  2EPD A;  1C0M A;  4RTW A;  2LQK A;  1K9A A;  4EMK A;  5KYX A;  3HSB A;  3SD4 A;  3RR6 A;  3VS7 A;  3LWI A;  1GL5 A;  2OAU A;  1BYM A;  2DM1 A;  2DD5 A;  1NJI U;  3CC7 T;  2MMP A;  2SEM A;  3M0Q A;  5IT9 E;  1IHV A;  5ECA A;  2GQI A;  3T9N A;  3RES A;  3M4G A;  2VGN A;  4ELY C;  3THK A;  1VYT A;  4JDS A;  4CC4 B;  4OP0 A;  1W2B P;  2L3Q A;  4JRQ A;  4J9F A;  3VS5 A;  2MOX A;  3ULR B;  1Q7Y C;  3P8B B;  2RI5 A;  1Q81 R;  1M9S A;  3CCQ A;  1AWW A;  2IPO B;  4RTU A;  1HXD A;  3A8H B;  4JJN K;  4N0A C;  3E9F A;  4FU6 A;  1VQP Q;  4KGX B;  2DTI A;  4HT8 A;  3OB9 A;  4A4H A;  4M7A C;  1M4Z A;  1M2V B;  4C0F A;  1M90 R;  1N9S A;  3CCL A;  1KHC A;  1VYV A;  7AT1 B;  2X4X A;  1ZSG A;  1X27 A;  2EQJ A;  1YIT A;  4FCY A;  3N5B B;  2PUK B;  1UTI A;  4EIK A;  2D0Q B;  2F2W A;  1IB8 A;  1T3S A;  3A8L B;  5CKH A;  1VQ5 T;  2G6F X;  4JZ3 A;  1ZUU A;  1Q86 U;  4WF2 A;  3JCM h;  1LCK A;  3OS0 A;  4C92 A;  3JB9 H;  1TS9 A;  2EQK A;  1NZ9 A;  4C92 G;  1MMN A;  1D0Z A;  1B34 A;  3CD6 A;  4OMP A;  3OYY A;  1VQL T;  3MP1 A;  1YJN Q;  2DXB A;  1ZSZ C;  1ZBJ A;  4FYV B;  1WHL A;  2FPF A;  3J80 E;  4E2F B;  1NJI R;  3A1P A;  2JTE A;  3CEY A;  2C0I A;  2GQV A;  1VQN Q;  3OA6 A;  4RCB A;  1MMG A;  2E12 A;  4RMO A;  2OJ2 A;  4C92 E;  4ZN3 A;  3CPW A;  3TVT A;  2QQR A;  5HK3 A;  4BE1 A;  1K1Z A;  9ATC B;  1D3B A;  1YJW T;  1TSF A;  3H9N A;  4A54 A;  4HT9 A;  3CMA Q;  4M7D G;  1M2O A;  2DL4 A;  2KAF A;  1TXQ A;  1U06 A;  4C0D C;  3MP8 A;  5GAO n;  1UGR B;  4QQG A;  1U5S A;  2O01 E;  3QUI A;  4J7I A;  5GAN 6;  1ZBX A;  3VKI A;  4D8K A;  3VUZ A;  4NL2 A;  1VYU A;  4CC2 A;  3VS2 A;  2YUQ A;  1VQ8 T;  1QVF A;  3QG1 A;  3R6N A;  4M7D E;  1AD5 A;  1YJ9 A;  1K9M C;  1I5O B;  1LVK A;  1RAD B;  3VS4 A;  2V8J A;  4DQ2 A;  5L23 A;  2JM9 A;  1NPP A;  4AG1 C;  5M9O A;  2JVV A;  2RHZ A;  5KYW A;  1YI2 A;  4HCB A;  2L3S A;  2WSC E;  3M0P A;  5GMK j;  1JEG A;  3A8G B;  1YHQ T;  2BKD N;  2EQI A;  1LPL A;  2CKK A;  1WHJ A;  1CKA A;  2DIL A;  2FZC B;  1D1A A;  4PJO B;  3LH0 A;  1ZHI A;  4BUG A;  1Q86 R;  1MMD A;  1QWE A;  4XU0 A;  3A5Z B;  2A0F B;  4FW2 A;  2QGG A;  4PJN A;  3OY9 A;  2M1H A;  5HK0 A;  3CCS Q;  3FJ5 A;  5GJV B;  1TUD A;  1B07 A;  3QDF A;  1WYX A;  2SRC A;  1OV3 A;  1HD3 A;  3OMC A;  1UFF A;  4M77 C;  2BTT A;  1G3W A;  5EC7 A;  3CBP A;  1OZ2 A;  1VQP T;  1B3Q A;  2HD0 A;  3EG9 B;  1YCS B;  2KK4 A;  2VKN A;  3OSV A;  2PVO B;  1MV0 B;  3QYH B;  4RG2 A;  2FB7 A;  3PIP A;  1Y96 A;  3RUX A;  1RI9 A;  3H41 A;  4L6V 5;  4OB0 B;  3I5S A;  1VQO A;  3BY7 A;  2YRV A;  2ZPI B;  1TH7 A;  5CKF A;  4Z02 A;  2NUP A;  4E7H A;  1BU1 A;  1MUZ A;  3EAE A;  3M0T A;  4RTT A;  1NLP C;  1VQ7 A;  2DYI A;  3GNF B;  1UG1 A;  1TG0 A;  2YDL A;  2K2M A;  2FZK B;  4MDW A;  3FRN A;  4M78 E;  2COY A;  4C8Q D;  4VUB A;  2O4X A;  2HL3 A;  1SHG A;  4O5V A;  4MML A;  3OYH A;  4J9D A;  1KJW A;  1BK2 A;  1ZSZ B;  1I0C A;  2EVR A;  3HRS A;  1YP5 A;  1JBM A;  4PFO A;  5FRN A;  2R5A A;  1OZ3 A;  1X43 A;  3MJX A;  4PLI A;  1YN8 A;  1QCF A;  2DVE A;  2VUB A;  3DB4 A;  4FW1 A;  3CXC A;  1QVG A;  1WHH A;  2DAQ A;  5GMK l;  1VQ9 A;  2DL5 A;  8ATC B;  2CDT A;  3VV0 A;  1X69 A;  3M58 A;  2LQ8 A;  4F16 A;  1AZE A;  4BDY A;  4C0D B;  4D6W A;  2P0Q A;  1KQS S;  1ZUY A;  2LNH B;  1XNI A;  2KRM A;  2DET A;  2MWO A;  2HQX A;  1UEB A;  2J6K A;  1WLP B;  2GTO A;  2ZPE B;  5GAO r;  1UB4 A;  5D6W A;  1UDL A;  2PVG B;  1S1N A;  2RF0 A;  2QG9 B;  2ROL A;  3UT1 A;  1YBY A;  4X1V A;  3V8J A;  3VS6 A;  2GBQ A;  4CC7 A;  3I55 Q;  2NUZ A;  2LCL A;  2XD0 A;  4C92 F;  5GMK i;  3EGU A;  2JN0 A;  4RKU E;  5KCO A;  2CH4 W;  1WA7 A;  4E7Z A;  1SRL A;  5HKC A;  5GAM g;  3KBG A;  2JW4 A;  3FEO A;  3MO8 A;  3UF4 A;  4F7U B;  5GAN g;  2CSI A;  4ZGD B;  3CCV A;  1H8K A;  3LLR A;  2COZ A;  1TTH B;  2YUN A;  5KYU B;  2D6F A;  4LDX A;  4ESR A;  2DJZ A;  2K6D A;  3L2V A;  4ME7 A;  1X6G A;  4Z8A A;  3LYI A;  2LP5 A;  5GAN h;  4MZP A;  2XMF A;  2DEU A;  4RCC A;  4PJM A;  4HKE A;  4F17 A;  1GCP A;  1ZA2 B;  2M0O A;  2RPN A;  1TU0 B;  1RI0 A;  4M77 B;  2E3H A;  2V1R A;  4DBR A;  2K5I A;  2CH4 A;  1Q82 C;  1NM7 A;  2DXT A;  3DLM A;  2QEX T;  3JCM f;  1ABO A;  3DLL A;  3EGX B;  1PC0 A;  3HKS A;  1FMW A;  3CCQ Q;  1K8A C;  3CC2 A;  1H3Z A;  1O9S A;  2ZPB B;  3EH1 A;  3C4S A;  2XKO C;  3CPW P;  1PWT A;  1IZ6 A;  4XTW A;  1SSF A;  2RQT A;  4JS5 A;  2GTJ A;  2DFU A;  1VQ4 A;  1JJ2 A;  1VQM A;  2QXF A;  2MAM A;  1G2B A;  4C8Q A;  3CCL Q;  3D7S B;  1JO8 A;  1P92 A;  1WDX A;  1KHI A;  3PFS A;  3V8L A;  3EGD A;  1N8R C;  4C8Q G;  4E47 A;  4OGC A;  2LCS A;  1QVF P;  3JCM Q;  1WXT A;  2RQV A;  4LNP A;  1PG5 B;  4XTZ A;  1HSQ A;  2CP2 A;  1IRX A;  5LJ3 g;  3G6E T;  2L8D A;  3CCU T;  1FYN A;  4KH0 B;  3HPW A;  2CGH A;  4KGZ B;  2Z0W A;  1UGQ B;  1XOV A;  5IN1 A;  3ZEH A;  4AFU C;  4C8Q E;  5IAY A;  2L0A A;  3CD6 Q;  4XTY A;  1K76 A;  1H3H A;  2X4W A;  2D8J A;  1Q95 G;  1ZQ1 A;  1Q7Y U;  3RNJ A;  3OS2 A;  3LX7 A;  1W70 A;  3E1S A;  2D0N A;  1WX6 A;  4AFS C;  2YHT A;  2FRW A;  2BE7 D;  4JPB W;  2K5F A;  3AT1 B;  1YIJ T;  3OW2 A;  2W0Z A;  3G4S T;  3RMS A;  1UGS B;  2LX9 A;  3EG2 A;  3GPL A;  1WXB A;  2PTK A;  1XJW B;  3H0F A;  3SHW A;  2EYX A;  3S3M A;  2O88 A;  1W1F A;  5CVI A;  4C5E A;  1QCN A;  1WGS A;  5I22 A;  3I55 T;  1RL2 A;  2ESW A;  2R5M A;  2XG8 D;  3DKM A;  4KUD K;  1ZA1 B;  1OEB A;  5LJ3 d;  3GNG A;  2CP3 A;  2ZPH B;  1YJ9 Q;  3OS5 A;  4Z89 A;  4XAX B;  4C0G A;  2KI7 A;  4PNO A;  2KEA A;  1YI2 Q;  1K0X A;  4XU2 A;  1UHF A;  1WZO A;  3CCR Q;  3C95 A;  2LTO A;  4RTZ A;  1GCQ C;  2DBK A;  5CCA A;  1UJ0 A;  4LUE A;  2MYS A;  2CZ7 B;  2X35 A;  1VQK Q;  1OPK A;  2JS0 A;  2VYT A;  2HQE A;  5J3B A;  1WXU A;  3L42 A;  2DX1 A;  3HRU A;  3PT9 A;  2KQW A;  3LWH A;  3ZBD A;  4J8O A;  1QKX A;  5KYY A;  2H3J A;  4EMK C;  5FRO A;  2CUD A;  3RMQ A;  1I4K 1;  2CT4 A;  1Z9Q A;  3X20 B;  2MI6 A;  4IUP A;  3CXC P;  2NWM A;  2QK0 A;  4NL3 A;  2YXY A;  1JXO A;  2FG0 A;  2CSQ A;  4PFP A;  2V1Q A;  2XDB A;  3A8M B;  1Q7Y R;  5IH2 A;  4M7D D;  1Y71 A;  2J05 A;  4RTX A;  1QW1 A;  3FIF A;  4A53 A;  1K0S A;  4ELZ C;  5GAO m;  2K9G A;  2K2V A;  3CCM A;  1VQO Q;  4OML A;  1ABQ A;  1A0N B;  3QZ5 B;  2PVD B;  1N6A A;  1M1K C;  1K9M U;  1Y07 A;  2RK2 A;  2RJD A;  4DBF A;  4BD3 A;  3KXT A;  2M9U A;  3JB9 G;  2OAW A;  1VQ7 Q;  2RMO A;  2AK5 A;  2A36 A;  1QVG S;  5AT1 B;  2CS7 A;  2EJG A;  5GAO q;  4ANJ A;  1AZG B;  4KT0 E;  3CCJ A;  1TUG B;  3HRT A;  3C0C A;  4PJO C;  3M56 A;  1SRM A;  2M0Y A;  3SWN B;  5FU6 C;  3QZ9 B;  3MEW A;  2L5Q A;  2F5K A;  1VQ6 A;  2CP6 A;  5CIU A;  2KXD A;  2CZ1 B;  2RJE A;  5CKE A;  3RBB B;  3BDU A;  4FYW B;  2JTF A;  3GF5 A;  5FRM A; 
#chains in the Genus database with same CATH homology
 3QII A;  5D6X A;  3I56 T;  4A4G A;  2QEX A;  5GMK m;  2DTH A;  4PJO B;  4P5N A;  3LH0 A;  2VXE A;  3OYL A;  1ZHI A;  4M78 B;  4BUG A;  4XU0 A;  3A5Z B;  1W4S A;  4QVZ A;  3PIO A;  3OY9 A;  2M1H A;  5HK0 A;  4C92 C;  3PMT A;  4J6X A;  4TVR A;  1KD1 U;  4M75 D;  1G5V A;  5HY6 A;  1BIB A;  3OYC A;  3OYA A;  4B9X A;  3JCM P;  1BKB A;  1W2B S;  3OYJ A;  1W2B A;  5GAN 3;  4UC4 A;  4NOY A;  1YJN A;  3OMC A;  3OQ5 A;  4M77 C;  5LL6 S;  1G3W A;  2DPP B;  4C8Q F;  1V29 B;  5GAM f;  5GAN 2;  3OYK A;  2D9T A;  3CBP A;  1OZ2 A;  1VQP T;  4M78 D;  2K3Y A;  2HD0 A;  2M16 A;  2DTO A;  5GAN f;  2KSS A;  3WVE B;  3G71 T;  3X24 B;  3INZ A;  2KK4 A;  3GLX A;  3QXE B;  3VUB A;  1VQN A;  4QQ6 A;  3OSV A;  2PVO B;  2RH2 A;  3QYH B;  4RG2 A;  1QP3 A;  2GFU A;  3KUF A;  4PLL A;  3QO3 A;  1KD1 C;  2MWP A;  2FB7 A;  3PIP A;  1Y96 A;  3RUX A;  3RER A;  2EIF A;  3G6E A;  4L6V 5;  4JLG A;  4OB0 B;  3CCU A;  3UWN A;  1VQO A;  5GAO l;  4Q5W A;  3BY7 A;  2FYK A;  4A4K A;  4OB1 B;  2YRV A;  3CCR T;  4QVD A;  3J7A F;  2ZPI B;  1TH7 A;  3C12 A;  5CKF A;  4Z02 A;  3CMA A;  4C8Q B;  4E7H A;  2V8K A;  3M57 A;  3MHX A;  4JLI A;  1VQ6 A;  3EAE A;  4BE2 A;  3JB9 J;  4V2S A;  1VQK T;  2G3R A;  3JSC A;  3JAM E;  2LRQ A;  3CCQ T;  1M1K U;  4EPC A;  1VQ7 A;  5CK9 A;  3VYG A;  3GNF B;  4FT2 A;  4BE0 A;  2OTJ T;  3Q1J A;  1GXI E;  4RG8 A;  5GAM e;  3CC7 A;  2K4Y A;  4M7A D;  2XIC A;  5DLO A;  3H6Z A;  1O75 A;  3VU3 C;  3L2W A;  5GAN e;  4KUI A;  3FRN A;  4M78 E;  4MDW A;  5AYF A;  4E7K A;  2XID A;  2RI2 A;  5GAN 7;  4PL6 A;  4C8Q D;  4IUQ A;  2FHD A;  2KDS A;  2QA4 T;  5A0G A;  3S3N A;  4M7A A;  2EWN A;  3P8H A;  4VUB A;  5GMK h;  2O4X A;  3RKW A;  2XDD A;  4EMK B;  3UDC A;  3CCL T;  2AHJ B;  2IVW A;  3M53 A;  4O5V A;  3UPU A;  5CKD A;  5GAN 5;  1Q81 C;  4FL6 A;  2EKO A;  3JCM c;  4M7D A;  3L2Z A;  4MML A;  3M55 A;  2K5L A;  1YIT T;  4M7A G;  3OYH A;  5KE2 A;  1YIJ A;  3WXM B;  3OMG A;  5GAN 8;  5GAM j;  2A3L A;  3G4S A;  2R58 A;  4KUL A;  3HRS A;  3FJP A;  2LVM A;  3NFC A;  1JBM A;  5CKB A;  3O8V A;  3OYD A;  1S72 A;  5GAN j;  4ZN1 A;  5FRN A;  2R5A A;  1OZ3 A;  4PLI A;  2E1H A;  4Y28 E;  5GAM d;  3JRZ A;  2P4T A;  3BFM A;  2DVE A;  2RJC A;  1FWZ A;  2E70 A;  5GAN d;  2VGM A;  2VUB A;  3JCM e;  4J7F A;  1JB0 E;  3DB4 A;  2WAC A;  4CI0 C;  4GLK A;  5A2Q E;  3CXC A;  3CXC S;  1KG1 A;  4FIB A;  1QVG A;  3QHS A;  2LCC A;  2E64 A;  5J26 A;  4LDU A;  5FU7 C;  2XDP A;  3V7S A;  1X75 C;  2DAQ A;  4J5Y A;  2X4Y A;  4J83 A;  5GMK l;  2RK1 A;  3I55 A;  1VQ9 A;  4M7A E;  2Y4Y A;  1X01 A;  1WQ7 A;  2RD1 A;  3CCS A;  2ZPG B;  2DXC A;  4EMH A;  3CD6 T;  3VV0 A;  4QW2 A;  3OYB A;  3M58 A;  2LQ8 A;  2DEQ A;  4JRK A;  4BDY A;  3M5A A;  4C0D B;  2EQM A;  2P0Q A;  2WSF E;  4D6W A;  1KQS S;  3JB9 I;  1KQS A;  4IUT A;  4DA4 A;  1VIF A;  3GP8 A;  2EJ9 A;  3GOX A;  1XNI A;  2L3R A;  2CZ0 B;  1HK9 A;  3NTI A;  4B9W A;  2QQ9 A;  4ZGE B;  3OYF A;  2JNG A;  1XTD A;  4R55 A;  4LDV A;  2LNV A;  2MWO A;  2HQX A;  4KBM B;  4DOW A;  2WSE E;  3OYN A;  1UEB A;  3V7R A;  2OTL A;  3V8K A;  2ZPE B;  5GAO r;  1OYX A;  3S3O A;  5LJ5 g;  2JZ2 A;  1UB4 A;  2YLC A;  2FL7 A;  3MEU A;  5D6W A;  5GAO p;  2RHU A;  2LC4 A;  4F7U F;  2PVG B;  1VUB A;  5GAN 4;  3CCM T;  2YLB A;  4BAC A;  5LJ5 f;  3EFR A;  1G3T A;  3UT1 A;  1YBY A;  3OW2 S;  4YTL A;  3V8J A;  3CME A;  5LJ3 e;  3RKY A;  2XHC A;  4BDZ A;  5FU6 B;  2I2L A;  1IRE B;  4BY6 B;  4ZGJ B;  2LCL A;  5CQX A;  2XD0 A;  2OTJ A;  3FLG A;  4DOV A;  4C92 F;  5GMK i;  3SWN A;  2JN0 A;  4JUV A;  4RKU E;  3X25 B;  5A0L A;  1WNL A;  4HCZ A;  5KCO A;  4A4F A;  1QVP A;  3OS1 A;  1QP2 A;  1Y7X A;  3JCM W;  5HKC A;  4M75 A;  5GAM g;  2PUO B;  3FB9 A;  3MEV A;  3RIR A;  3KBG A;  2E6N A;  2QTX A;  1VQL A;  3FEO A;  5C0M A;  3AHU A;  3MO8 A;  4F7U B;  5GAN g;  4M77 F;  1N9R A;  4PJO D;  1U8R A;  3M9Q A;  5CAI A;  3CCJ T;  1Q82 U;  4XQ3 A;  4ZGD B;  5LJ3 j;  3CCV A;  1VQ9 T;  2DKG A;  3C94 A;  4M75 G;  2EYQ A;  3LLR A;  4C5H A;  2EAY A;  1K8A U;  2D6F A;  4LDX A;  1NPR A;  3JCM V;  2QQS A;  4PJO A;  2DJZ A;  3CBO A;  4BI3 A;  3L2V A;  3MET A;  2P0K A;  3HFO A;  4ME7 A;  4XTU A;  1YJ9 T;  4M78 A;  4C92 B;  1BI0 A;  3LYI A;  3X28 B;  5GAN h;  4MZP A;  1M5Q 1;  1M1G A;  4L59 A;  2ZGW A;  4JRI A;  4PJO G;  5LJ5 e;  2F69 A;  4HA8 A;  1YI2 T;  1VQ6 T;  1AHJ B;  4XTV A;  1G3Y A;  4RCC A;  4X34 A;  4N4G A;  4M78 G;  4HKE A;  1I81 A;  5L8R E;  2F5T X;  2M0O A;  3RKX A;  4M7D C;  3CBM A;  4J6Y A;  1B34 B;  3SFM A;  4Y91 A;  4E7I A;  1RI0 A;  3HL8 A;  3L1A A;  4M77 B;  5CO7 A;  2OTL T;  1YJW A;  1Q81 U;  3JCM g;  3JB9 F;  4M75 E;  5FLX E;  2K5I A;  3CCE A;  3LGL A;  2DXT A;  3DLM A;  4N4I A;  2EJF A;  1Q82 C;  1VIE A;  2KVQ G;  2QEX T;  3JCM f;  3QKJ A;  3DLL A;  3QSU A;  3P8D A;  3PGG A;  3HKS A;  3CC2 A;  3MCA B;  1FXX A;  4C92 D;  1K8A C;  1H3Z A;  1O9S A;  2ZPB B;  5LJ5 j;  3NTK A;  4BI4 A;  3C4S A;  2XK0 A;  2R57 A;  2XKO C;  4N0A A;  1WJR A;  4O6J A;  1IZ6 A;  3F70 A;  4PJO E;  1MGQ A;  4XTW A;  3E19 A;  5LJ5 d;  4LDY A;  2X4J A;  1K73 U;  3CC4 A;  1SSF A;  4IUU A;  1H64 1;  4M77 D;  4JS5 A;  1I5L A;  3BW1 A;  2QDY B;  1U1T A;  1LOJ A;  2PQW A;  1M90 U;  1VQ4 A;  1VQ8 A;  1JJ2 S;  1JJ2 A;  1D3B B;  1VQM A;  4PKC C;  2PU9 B;  3V7C A;  5I2M A;  1UGP B;  1YJN T;  2IG0 A;  2QXF A;  2MAM A;  4J6W A;  4C0Z A;  2RHY A;  3E9G A;  4C8Q A;  2LT1 A;  1P92 A;  4BB7 A;  3QJ6 A;  1KHI A;  2QI2 A;  4OB3 B;  4IUV A;  3PFS A;  3V8L A;  3M59 A;  1X6O A;  1OI1 A;  4EMG A;  1N8R C;  2NLU A;  4FM4 B;  4C8Q G;  5KE3 A;  3NTH A;  4ZTF A;  1BI1 A;  4E47 A;  3QPH A;  4OGC A;  3X26 B;  2RI3 A;  1VQN T;  1EIF A;  2HBP A;  3JCM Q;  1YHQ A;  3J81 E;  2VV5 A;  1WJS A;  3QJY A;  4XTZ A;  3LGF A;  4QVC A;  5C6S A;  3URG A;  5LJ3 g;  1K73 C;  3G6E T;  3I56 A;  1NE8 A;  2L8D A;  3OYI A;  3CCU T;  4MZM A;  3JCM b;  3TCJ A;  1VQO T;  2DO3 A;  3VYH B;  3WVD B;  1M90 C;  5LJ3 f;  3HPW A;  4OGE A;  3CMA T;  2CGH A;  2LQK A;  5DM7 R;  3OYM A;  1BI2 A;  4EMK A;  5J39 A;  4LD9 K;  3HSB A;  1UGQ B;  1XOV A;  3CCE T;  5IN1 A;  3ZEH A;  4M77 E;  3SD4 A;  3L2U A;  4C8Q E;  2DD4 A;  1VQ7 T;  3GIB A;  3LWI A;  5IAY A;  2OAU A;  3ASK A;  3OSS C;  1BYM A;  1LJO A;  3QBY A;  4II1 A;  4XTY A;  2HNI A;  2DD5 A;  5A0D A;  2P0P A;  1NJI U;  2X4W A;  4X9C A;  3SB2 A;  3JCM d;  3CC7 T;  2MMP A;  4OMF B;  4QQD A;  4M75 C;  4HCC A;  1ZQ1 A;  4GY5 A;  2DZ9 A;  4E7L A;  1Q7Y U;  1R8O B;  5IT9 E;  2GCX A;  3CC4 T;  4MMK A;  3OS2 A;  3LX7 A;  4XU1 A;  3TEE A;  3L2R A;  3E1S A;  5FU7 B;  3T9N A;  1VQP A;  2YHT A;  1WPY A;  3PNW C;  2DIQ A;  4A4E A;  1M8V A;  3RES A;  1KC8 U;  4FT4 A;  2ZZD A;  3M4G A;  4MZT A;  2XI9 A;  3ZFJ A;  2VGN A;  4ELY C;  4OB2 B;  2K5F A;  4JDS A;  4M78 C;  1YIJ T;  4OP0 A;  1VQ5 A;  3OW2 A;  4LD6 A;  3G4S T;  3RMS A;  3VJP A;  1UGS B;  1S72 T;  2LX9 A;  4JRP A;  4JRQ A;  4E7J A;  5DLQ E;  5LJ5 h;  4MDX A;  1LNX A;  3M4Y A;  4OF1 A;  2ZCF B;  4EDU A;  3GPL A;  2MF2 A;  3CCR A;  1NJI C;  1YCY A;  1Q7Y C;  2Y4X A;  3P8B B;  4IUR A;  2RI5 A;  3S3M A;  3CPF A;  1VQK A;  1M9S A;  3CCQ A;  5CVI A;  2K3X A;  4C5E A;  3JCM J;  4C5I A;  1N27 A;  1KC8 C;  1WGS A;  3I55 T;  1RL2 A;  3PMI A;  1WJQ A;  2GF7 A;  1HXD A;  2R5M A;  3A8H B;  2XG8 D;  2VXF A;  4JJN K;  4N0A C;  2XU8 A;  3DKM A;  3E9F A;  4FU6 A;  3CCS T;  4KUD K;  5LJ3 d;  3TRE A;  1Y96 B;  5CQY A;  3GNG A;  2DTI A;  2FVU A;  5GAM h;  4HT8 A;  3OB9 A;  4A4H A;  3BDL A;  2ZPH B;  3OS5 A;  2QA4 A;  3H8Z A;  4M7A C;  1M4Z A;  4M7A F;  5KCH A;  4XAX B;  4C5G A;  4C0F A;  4C0G A;  2BUD A;  2JTM A;  4PNO A;  1N9S A;  3CCL A;  1KHC A;  2KMT A;  4M7D F;  2X4X A;  4C8Q C;  2EQJ A;  5I21 A;  2QQA A;  4XU2 A;  1YIT A;  2CZ6 B;  2DZC A;  3N5B B;  3C95 A;  2LTO A;  2PUK B;  5CCA A;  2D0Q B;  4F7U A;  2RB6 A;  2CZ7 B;  2RM4 A;  2X35 A;  1N8R U;  3A8L B;  4CRI A;  3A8O B;  5CKH A;  4N4H A;  2JUF A;  4BI8 B;  1VQ5 T;  1Q86 U;  2RO0 A;  2VYT A;  1MHN A;  3R6O A;  3FC3 A;  1KQ1 A;  3CME T;  4NS5 A;  2DIG A;  2HQE A;  5J3B A;  4F7U G;  4WF2 A;  3L42 A;  4M7A B;  3JCM h;  2V8I A;  3OYG A;  3HRU A;  3PT9 A;  3OS0 A;  1I8F A;  2O4X B;  2E41 A;  4FSX A;  4C92 A;  2CYZ B;  2GFA A;  2KQW A;  3LWH A;  2HAX A;  3ZBD A;  4J8O A;  5D6Y A;  3JB9 H;  3LW5 E;  2DXU A;  4M7D B;  2EQK A;  1NZ9 A;  2E6Z A;  2H3J A;  3MP6 A;  2EFI A;  4EMK C;  5FRO A;  4XK8 E;  3RMQ A;  4C92 G;  1I4K 1;  4LDW A;  1U1S A;  1B34 A;  3CD6 A;  2VC8 A;  3OYY A;  1VQL T;  4M77 A;  3MP1 A;  3X20 B;  1XQH A;  2DXB A;  2MI6 A;  4X9D A;  3CCV T;  4IUP A;  4NL3 A;  3J80 E;  4F7U E;  1BIA A;  3QDR B;  4M77 G;  3L2Q A;  3S6W A;  4JS4 A;  3CEY A;  1Q86 C;  2C06 A;  3QYG B;  2XDB A;  3A8M B;  1PSE A;  3MEA A;  2RA2 A;  5FRM A;  2GQV A;  4M7D D;  1Y71 A;  2B8A A;  4XTX A;  1QW1 A;  3DB3 A;  3FIF A;  4A53 A;  4ELZ C;  5GAO m;  3OYE A;  4RCB A;  3OA6 A;  3JB9 D;  1WQW A;  2E12 A;  2LT4 A;  3HP9 A;  3EFS A;  4RMO A;  4C92 E;  5KH6 A;  4ZN3 A;  3HHT B;  3CPW S;  3CPW A;  4XU3 A;  2A7Y A;  2K2V A;  2QQR A;  3OBY A;  5HK3 A;  3CCM A;  4BE1 A;  1D3B A;  1YJW T;  3QZ5 B;  4ATO A;  2PVD B;  1N6A A;  1M1K C;  4A54 A;  4HT9 A;  1K9M U;  4M7D G;  1Y07 A;  2RK2 A;  2KAF A;  2RJD A;  3HFN A;  5LJ3 h;  4BD3 A;  4C0D C;  3KXT A;  3MP8 A;  2M9U A;  3JB9 G;  3SWN C;  5GAO n;  3CC2 T;  1M1F A;  4OVA A;  2K57 A;  3ME9 A;  2L89 A;  1UGR B;  4QQG A;  2EQU A;  2E65 A;  2BIV A;  2O01 E;  3QUI A;  4J7I A;  4L5G A;  5GAN 6;  5I2S A;  1ZBX A;  3VKI A;  1QVG S;  3VUZ A;  4M75 F;  1G3S A;  2CS7 A;  4NL2 A;  1KQ2 A;  2EJG A;  5GAO q;  2E10 A;  4KT0 E;  3CCJ A;  5DY9 A;  5GMK e;  3ER0 A;  3JCM X;  1VQ8 T;  1QVF A;  1QVF S;  3QG1 A;  1VQ4 T;  3HRT A;  1VQM T;  5EG2 A;  3G7Z A;  4M7D E;  4ZTJ A;  3G71 A;  4PJO C;  2DK3 A;  2Y90 A;  4PJO F;  4R56 A;  3M56 A;  2JOY A;  2QQB A;  2E5Q A;  1YJ9 A;  1K9M C;  3FDR A;  2LDM A;  4M78 F;  3M54 A;  3PTA A;  2ZPF B;  3SWN B;  2V8J A;  2RHI A;  3QZ9 B;  5FU6 C;  4DQ2 A;  1NPP A;  1PSF A;  2JVV A;  2L5Q A;  2F5K A;  2RHZ A;  3MEW A;  4BY6 C;  5M9O A;  2RHX A;  2WSC E;  5CR2 A;  1YI2 A;  4HCB A;  3SDZ A;  5CIU A;  3TU4 K;  2CZ1 B;  2RJE A;  5CKE A;  2KY9 A;  4M75 B;  3BDU A;  5GMK j;  1BI3 A;  3OBW A;  2JTF A;  1JRI A;  3A8G B;  1YHQ T;  3GF5 A;  2BKD N;  4IKF A;  2CKK A;  1FX7 A;  1DJ7 B;  2RJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...