4MMLA

D40a hfq from pseudomonas aeruginosa
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
GHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFAQFVILLKNTVSQMVYKHAISTVVPSRPVRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein hfq
publication title Effect of conserved intersubunit amino Acid substitutions on hfq protein structure and stability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Rna binding protein
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4mmlA00
4M75E 3BDUA 4M75C 3BY7A 4J6XA 4XTXA 5LJ3d 4EMKC 4F7UF 4QVDA 3RESA 4F7UE 3SB2A 1LJOA 1Y96A 5GAMg 2FB7A 4XTUA 5GAMe 4JRIA 1WNLA 3QHSA 5LJ5f 3JB9F 1JRIA 5GANf 3L1AA 2RA2A 2DVEA 5GAOm 4M78A 2QTXA 1LNXA 1WPYA 5GMKi 3JCMb 2DZ9A 5GAN2 1I81A 2DTHA 4NL3A 3JCMf 2RM4A 4M7AF 4A53A 4MMLA 1Y96B 4M7AE 1N9SA 2DTIA 2E41A 2VC8A 3RKXA 5GAMh 2YLBA 4Y91A 3V8KA 3QSUA 4M7AC 2DXUA 1LOJA 2YLCA 3INZA 3JB9I 1YCYA 4NL2A 4HT8A 4M78B 5I21A 3EFRA 2EWNA 4DQ2A 1MGQA 4RCBA 2E1HA 4X9CA 5GAN7 4XQ3A 3HSBA 2YHTA 4M77D 3FB9A 5LJ3f 4HA8A 3JCMW 1TH7A 2DJZA 4C8QD 5CAIA 2EJ9A 4M77A 4OP0A 4XTWA 3JB9J 2DXTA 2I2LA 3RKYA 4M77E 4M7DB 4C8QA 2EAYA 1BIAA 4X9DA 2E64A 4M78D 3JB9H 5GANe 4M7AG 4WF2A 5GAN6 4V2SA 5GMKe 5GAOq 4M77B 3HFNA 1I8FA 4XU1A 2JN0A 1KQ1A 3V8JA 3GIBA 4C92D 4JUVA 5GMKl 2EJGA 3JCMe 4N0AA 4XTZA 4M78F 4C8QB 3HFOA 4M78E 1U1TA 3JCMQ 3VU3C 4M78C 2RD1A 3JB9G 4C92A 5GAMj 4M7DD 1D3BB 1JBMA 1HK9A 2DZCA 1U1SA 2EJFA 4C92E 3SWNA 3AHUA 5LJ3g 1N9RA 3JCMJ 3JCMP 4M7DA 4M77G 5LJ3e 4M7DF 2DTOA 4M7DE 3RERA 2K57A 2DEQA 3FJPA 4C8QG 4C92B 5GAN3 3RUXA 2VXFA 4JLIA 3SWNB 1WQWA 4M77F 4PNOA 4EMKB 4M77C 5LJ5g 4C8QF 5GAMf 4M78G 5GANg 4C8QE 5GAOl 5LJ5e 4PJOD 4C8QC 4J6YA 2Y90A 3V7RA 3JCMX 1D3BA 3V7SA 3JCMg 2ZGWA 4C92G 3BW1A 1I4K1 1X01A 4QVCA 4PJOA 5GAMd 1WQ7A 1BIBA 4HT9A 3QO3A 4J5YA 5LJ5h 5LJ5j 4M7DG 3PGGA 4N0AC 4A54A 2FYKA 5GANh 5GANj 5GMKh 4C92F 2E65A 4M75D 4XU0A 5GMKj 4MMKA 3RKWA 3JCMc 4C92C 3JCMh 4J6WA 4PJOB 4EMHA 2E10A 4M75A 3SWNC 4EMKA 1KQ2A 2RB6A 1B34B 3V8LA 4M7DC 3JB9D 5GAOp 4F7UA 3BFMA 1I5LA 1H641 1M5Q1 3FIFA 4NOYA 3M4GA 4M7AD 5LJ3h 5LJ3j 4M75B 4RCCA 3RIRA 4PJOG 2DKGA 5DY9A 4XU2A 3V7CA 4JRKA 4F7UB 4M7AA 5GAN5 4XTYA 5LJ5d 2CGHA 5GAOn 5GMKm 3EFSA 3JCMV 5GANd 4PJOF 4PJOE 4XTVA 4EMGA 2HNIA 3QUIA 4PJOC 2VXEA 3JCMd 1B34A 4M75G 4M7AB 1M8VA 3L2ZA 4F7UG 1HXDA 4XU3A 5GAN4 5GAOr 5GAN8 4M75F
chains in the Genus database with same CATH superfamily
1W4SA 4XTXA 4E2FB 3SHWA 4JRIA 2K5FA 5LJ5f 2HDAA 2F5TX 2OTLT 1QVGS 2PUOB 2EYYA 5GAN2 2JZ2A 4NL3A 1X2QA 2RPNA 3AT1B 2E5KA 2OTJQ 2EFIA 2KT8A 1E6HA 2VYTA 5AYFA 3CD6T 3CXCP 2FZGB 2EYZA 1EZZB 2K5LA 2GBQA 2I0NA 4M78F 2L3SA 3HFOA 2CP6A 4OGEA 3L2UA 2M1HA 1NZ9A 1VQ4Q 2EJFA 5KYWB 1U1SA 2XK0A 2ZPEB 3JCMJ 4M7DA 3A8OB 4GLKA 4C8QG 2QQRA 4KUDK 5CQYA 2QQBA 3M58A 5IHKA 4EMKB 3QXEB 4OGCA 2J6FA 3EHRA 1LPLA 4RTZA 2X4YA 2QDLA 1KIKA 1X01A 3I35A 1NPRA 2QA4T 3QYGB 1WXTA 1K9MR 4JDSA 2OTLA 3PGGA 3PVLA 4DA4A 5HK3A 4V2SA 2QK0A 1M1KR 3J7AF 1X6BA 2C0TA 1VQOT 2DRKA 2M9UA 3V8LA 2PU9B 1WI7A 2KYBA 3CPWP 2MF2A 2WSEE 4RTXA 4FW2A 2VUBA 1Y7XA 5GAN5 5GAOn 5I2MA 3IQLA 1WX6A 2M02A 2EW3A 1KHCA 1IREB 4J83A 1QVFS 3SDZA 5CVIA 2EIFA 1PWTA 1VQPT 1G2BA 1I0CA 1OZ2A 3I5SA 1OZ3A 4GY5A 3NMZC 2FB7A 3NHNA 2JM8A 1Q86C 1YBYA 4R0KA 4JJCA 2J6KA 2KEAA 3JCMf 2HZYA 4XK8E 3S3OA 2L0AA 2O2OA 1M90U 1VQMQ 2R57A 2QA4A 3CCMT 1JQQA 1K4US 1VQNT 2LT4A 4N4IA 4J9BA 2QDYB 4X9DA 3DKMA 4PK4A 4WF2A 1AZGB 3QZ9B 4N4HA 2C0OA 2L2PA 2JN0A 1ZA2B 5GMKl 2EJGA 2HAXA 3GNFB 3CCVA 1VUBA 1A0NB 2JJ9A 4C5EA 1B7TA 2DZCA 3ER0A 4YTLA 1YJNT 1KG1A 1YITT 1QKXA 4JLIA 4CC3A 3M55A 3FC3A 2VV5A 4EPCA 3QDFA 4Z02A 1VQ7Q 1VQPA 2DMOA 1ZSZB 2J6OA 1BIBA 3E9GA 4BY6B 4M7DG 3DLLA 1MMDA 2CZ6B 2L3PA 1VQ9T 2EGCA 3A1PA 5KYNA 1OV3A 4OB2B 4FYWB 3MJXA 3KXTA 4KULA 1K9MU 1RADB 1M1KU 1KC8R 3CCMA 2GFUA 1LVKA 2L8DA 3RIRA 1QWEA 1X75C 1YI2A 5DY9A 1VQNA 1PM3A 1R0CB 4JRKA 4XAXB 2AK5A 5CO7A 2RI5A 3KBGA 5GANd 2BZYA 3PIOA 3EG2A 3KFVA 2H3JA 3JSCA 2P4TA 3UA7A 3CC4Q 2LZ6B 2ABLA 5HCKA 4LUEA 4M75F 2EQJA 1Y07A 3JAME 1YJNA 1OU8A 1M3AA 1TUGB 4F7UE 1YITA 4PJJA 2MMPA 2HSPA 2AIRB 2RA2A 1K8AC 4M78A 3VRZA 1VQ6Q 1RUWA 2LJ0A 3G7ZA 3EFRA 4IUTA 3CCLA 2QEXQ 2FO0A 3JV3A 3REAB 2C06A 2DYIA 2EAYA 1VQ9A 2DA9A 2E64A 4ZNXA 5GANe 4DEXA 1OI1A 3ZEHA 1KQ1A 3MP6A 1OQKA 1TXQA 4N0AA 4BE2A 2VVKA 4KH0B 2FPEA 2PQWA 2X9HA 3UT1A 2FRWA 3L2VA 4PFPA 2KT1A 3G4ST 4B6MA 1SG5A 4ANJA 3OYJA 3T9NA 2CREA 5LJ5g 4C8QE 1GFDA 3M56A 1TG0A 3KUFA 4BI4A 4M75D 4J6WA 3CMEQ 1VIFA 1YIJT 2IPOB 2O88A 3A8LB 1QP2A 2VWFA 5L8RE 1YWPA 1SSFA 3J80E 3OYGA 1WXBA 4BY6C 2NYSA 1KC8U 4C0DB 4QQDA 4DOWA 2JW4A 3NTKA 3QJ6A 4OB0B 3I56T 2OI3A 3HKSA 2D0QB 1YN8A 3QIIA 3VUBA 2DEUA 4OMNA 2CYZB 2AKLA 3CBPA 4XTUA 2A37A 2GNCA 2K3BA 3H41A 2CSQA 3VJPA 2RJCA 2MWPA 4F16A 4R56A 5GMKi 2H8HA 3ZBDA 4DBFA 2RM4A 4M7AF 1PRLC 3OYLA 3EG9A 4BACA 2YLCA 4NL2A 2V8IA 1YHQT 1M90C 3RNJA 2LX9A 3G6EQ 1WLPB 2M0OA 1W6XA 5KYUA 2CZ0B 1VQ8T 4M7DB 2BZ8A 5CKFA 3CPWA 1YIJA 2RQUA 1QCFA 4XU1A 3GIBA 5FU7B 3M0QA 4RUGA 3LH0A 1B3QA 2RI2A 3FRNA 5A0GA 2CUDA 4CC2A 1W2BP 2XIDA 3AHUA 3LH5A 3UATA 4DBHA 1D0YA 2Y4YA 3P8BB 3S3MA 2KXCA 4RTTA 1BK2A 2Y4XA 2Y90A 1D0XA 2RHIA 2O9VA 3JCMg 3OW2S 3CC7T 2KRMA 3CCSQ 3M53A 1WJQA 5GMKh 5GMKj 4XU0A 1PCXA 2IG0A 3X25B 1K73R 1GBRA 4M75A 1MNEA 4PFOA 3OYYA 1YHQA 1M5Q1 2HSEB 1GCPA 1PSEA 1BBZA 5IN1A 3L2QA 4M7AD 1AHJB 4LUDA 5J3BA 4HCBA 4XU2A 4VUBA 4CI0C 1VQ8A 2XICA 4XTYA 2EQIA 4TVRA 2LRQA 2FPDA 3TSZA 2KY9A 4LDYA 2K2VA 2FZKB 1M1GA 4JRQA 2K3XA 2NUZA 3QG1A 4ATOA 2P0PA 4ZTJA 8ATCB 2AZVA 3CCUQ 4FT4A 4KRTA 3L1AA 4C0ZA 5GAOm 5FWBA 4C0DC 3LGFA 4IUPA 4AT1B 1T3LA 1UJYA 2ATCB 2CZ7B 1VQ5Q 1RAIB 4AFZC 1VQ4T 2KE9A 1LOJA 2ED1A 4XQ3A 1YJWQ 1K0SA 2JS2A 2F1LA 2BUDA 2X4WA 4IURA 5GAN6 3ME9A 5GAOq 1E7OA 2FEIA 2BE7D 2B8AA 1IXDA 3HPWA 4X1VA 3JCMQ 2YRDA 3CBOA 3CCRQ 3S3NA 5LJ3g 1UGPB 4F17A 4C92B 4O5VA 1VYUA 3GP8A 3OYHA 1P92A 2DILA 4J9CA 5FRMA 2OTJA 2X35A 1UJ0A 2MI6A 1FYNA 2MK5A 4KUIA 3UPUA 1Q82U 3JCMX 4X34A 1I4K1 4JZ4A 1XQHA 2ZCFB 2MWOA 1BCOA 3QO3A 3M0UA 1HSQA 1I07A 3MPUB 3EAEA 4C5GA 1M3CA 1XTDA 3G71Q 1VQ4A 1BI2A 2K79A 1D0ZA 2F2WA 5LJ3h 5LJ3j 3SD4A 1K73U 4L5GA 4M7AA 3UF4A 2X3WD 4PJOF 4XTVA 3QUIA 5A0LA 4M75G 3EFOA 6AT1B 1TSFA 5GJWB 1SHGA 2A3LA 4WTOB 4J6XA 3CMAT 1MMGA 2V1QA 2QGGA 2D8JA 2BE9B 1WNLA 4RTUA 1JRIA 2FL7A 1Y96B 1S72T 2VB6A 2DXUA 1UGQB 2KRNA 5FROA 2AT1B 2YWWA 3U23A 1EFNA 1QVPA 1TH7A 3H0IA 2DPPB 1U8RA 4IKFA 4XTWA 3CCEQ 2RHXA 2DK3A 2GTOA 1BIAA 2RHZA 1KD1C 4FT2A 1IHWA 1Q81R 3HFNA 1O75A 4M78E 1UGSB 4EDUA 2ROTA 1TS9A 5IH2A 3QKJA 2V1RA 2RMOA 4FW1A 3QWXX 2EKOA 2DEQA 3FJPA 3M5AA 4BE0A 5IAYA 3SWNB 3WXMB 5GAOl 1JO8A 4FM4B 2K7AA 4PJOD 2LCCA 2LCSA 1D3BA 1NYGA 2DBKA 3BW1A 3CMAA 5GAMd 4A4EA 2CP2A 1NJIC 2GTJA 3ZL7C 5FWCA 3HHTB 2JUFA 2QXFA 4C92C 4AFUC 1S72A 2CP3A 2EBPA 1SEMA 2E70A 1MMNA 2BTTA 2LTOA 5IT9E 1M2VA 4OMLA 4J7IA 2KR3A 5KYYA 5D6XA 1ZQ1A 5LJ5d 2CGHA 2DIGA 2EYWA 3H6ZA 4E47A 1UG1A 2QASA 1VQ7A 1ZBJA 4JS4A 1Y71A 4RG2A 3VKIA 2CDTA 4BDZA 1W2BA 4BI3A 2J7IA 1WHMA 2NUPB 3A8GB 5CKEA 1JB0E 2A0FB 2DO3A 5I11A 4C0FA 1G3TA 3CC2Q 3CCVT 5GAMe 5KYUB 3WVDB 3OMGA 2LX7A 2ED0A 4BUGA 5CR2A 1OPKA 1BCMA 4JLGA 1D09B 2HBPA 2DTIA 2YLBA 4JZ3A 4LDXA 2CH4W 2DFUA 4RCBA 4D6WA 2YHTA 4F14A 1AVZC 3TCJA 1KQSA 2DXTA 2D8HA 3TSWA 3CC4A 4M78D 2A28A 2GCXA 4M4ZA 4M77B 1OU9A 3MO8A 2ROLA 4PFZA 4XTZA 1NYFA 1OEBA 1Q81U 1WJSA 4Q5WA 1QVGA 3CCJT 3GF5A 4DEYA 2HBWA 5FU6B 3RERA 1FWZA 1VQ6A 1YI2T 2JT4A 4OMQA 1ZSGA 3OS5A 1AOJA 3DLMA 1UHFA 1Q7YR 1QCNA 2YUNA 1Q82C 3E9FA 4PJOA 4KT0E 1WQ7A 2NUTB 1D1BA 1VYTA 1U06A 1WDXA 2HQXA 4ELYC 1RI9A 2KAFA 5LL6S 2P4RA 1U5SA 3SWNC 2DX1A 2RHYA 2RB6A 1W1FA 1NPPA 3EH2A 4WCIA 2PVOB 1M27C 4KGZB 2ZZDA 3QJYA 4F7UB 2KGTA 1JXMA 2GF7A 2RH2A 5KE3A 3CCLT 3RR6A 2DERA 4EMGA 3JCMd 2HKNA 1IRXA 1MNDA 2EQUA 1R0BG 4M75E 4EMKC 4FIBA 2X3XD 2OTLQ 3CMEA 3CCJA 3GNGA 1IHVA 2QTXA 2RN8A 3FEOA 3CQTA 1JEGA 2V8KA 4MZMA 1QCOA 3VS5A 4J9GA 1WHHA 3CXCS 2KXDA 3EGDB 2JM9A 1MGQA 5GAN7 4BI8B 4A4KA 5LJ3f 1O9SA 1HYOA 1RAGB 3CD6Q 2EQMA 2RQTA 3RKYA 2ZPBB 3QPHA 2E6NA 3OSVA 1PNJA 4JPBW 4MZPA 1G3YA 4E7IA 2CP5A 2LC4A 2VKNA 3JCMe 1SRMA 4C8QB 4FYXB 1VQKQ 4HVVA 3VU3C 2HL5C 5KYXB 2LT1A 3FLGA 1IZ6A 2O4XB 4C0GA 2R5MA 4OMOA 1N8RR 1ARKA 1VQLT 2C0IA 5D6YA 3VS3A 2LP5A 2KROA 3OYDA 3VS6A 1FMWA 3P8HA 1MV0B 4M77C 4PJLA 4L59A 3VS1A 1GL5A 3NGPA 2JXBA 3V7RA 2ZGWA 2E12A 2P0KA 3CPWS 3C94A 1FMVA 1V76A 3NPFA 1PC0A 1VQOQ 2PTKA 1Q7YU 4MMKA 3H9NA 3MEUA 2K5IA 3RMSA 1KQ2A 5KH6A 3EFOB 2KSSA 1I5OB 1T3SA 2ZPHB 1RABB 1UEBA 3CCUT 4PJNA 4PJOG 1G3WA 1K76A 1UGVA 3PNWC 4CC7A 2HNIA 2GGRA 4RTVA 4K11A 1B34A 3L2ZA 3EGXA 4IUUA 1H8KA 4FL6A 4MDXA 2RQWA 1HXDA 5IHIA 1PD1A 1VQPQ 1QP3A 1SKUB 7AT1B 1PG5B 2XG8D 1LJOA 1VQLA 2CT4A 1ZSZC 2SEMA 3R6NA 2P0QA 2DL8A 2DTHA 4M7AE 3QSUA 5GAMh 2COYA 1TTHB 4JJNK 1RLQC 2X51A 1AWXA 3CCMQ 4JRPA 1VQNQ 3FB9A 3MP1A 1AEYA 2DJZA 2OJ2A 2W10A 1SF9A 1SSHA 2AZSA 5EG2A 4AMCA 2HQHA 2JTFA 2YXYA 5KYWA 4DBQA 4J9IA 2LNVA 1U1TA 2YRCA 5CQXA 2GQVA 2EYQA 1BI0A 3CCUA 1D3BB 1HK9A 1MMAA 4N4GA 4ZGEB 3LYIA 2DTOA 1M2OA 5GAN3 2J06A 4CRIA 2EPDA 2RO0A 1YJWA 1N8RU 4M78G 5D6WA 2K4YA 4C8QC 2MCNA 2DD4A 3M57A 4Y92A 2GQIA 4LDWA 2XU8A 3MCAB 2DAQA 2RK2A 2M51A 1PKTA 2M16A 1Q86R 4IIMA 1VQ9Q 1ZLMA 3LWHA 3HRTA 3GOXA 3CCQT 2X4XA 3CCRA 3FJ5A 1I5LA 1ABOA 1C0MA 2G3RA 1EX4A 1F1BB 1YJ9T 1AWJA 1G8XA 2LQWA 5L23A 3OS2A 3BE3A 2LQKA 4P5NA 2IVWA 2RJDA 1CKAA 1GCQC 2EKHA 2KQWA 2RQVA 3F70A 4ZGDB 1DJ7B 3C4SA 4J8OA 1TUCA 4B9XA 4XU3A 1KQSP 4KBMB 3CBMA 2V26A 3CCET 2BZXA 1HJDA 3UA6A 1JJ2P 1K9MC 5GJVB 2QQ9A 2PVGB 4AFSC 1M1KC 4F04B 1X2KA 3R6OA 2QYZA 2MIOA 4ZTFA 2K6DA 2VC8A 8AT1B 4J9EA 3E19A 3HSBA 1QVGP 4AG2C 2MOXA 2OTJT 3JCMW 1TOVA 4OP0A 3TQ7P 9ATCB 2E6ZA 3QZ5B 1OOTA 3CCQA 3LGLA 3P8DA 2K2MA 2MYSA 1TU0B 1NM7A 2RJEA 1Z9QA 4ZN1A 1YJ9A 2HQEA 4Z89A 3X26B 1KFZA 1PHTA 4BB7A 1H3ZA 3M0TA 1ZA1B 4M7DF 3GBQA 3G4SQ 3LWIA 4A4HA 1XJWB 1IB8A 4Z88A 1Q95G 1UGRB 2DBMA 3N5BB 4J9HA 3CCEA 1GBQA 1BI3A 4LD6A 2ZPFB 3DB4A 4J7FA 4FCYA 2CP0A 5EC7A 5GANh 5GANj 3QBYA 2E65A 4FSSA 1K8AR 3OSSC 4BDYA 2EQKA 2BKDN 4M7DC 4GLMA 1WIEA 2QAZA 1UE9A 1Q86U 1SPKA 5FU7C 2ZPGB 2O31A 5FRNA 1KK7A 4PJOE 3QWYA 2KI7A 3Q1JA 2CT3A 2H3EB 4RG8A 3I56Q 2X4JA 3VS4A 4ELZC 5GAN8 3GPLA 3I9QA 4IIOA 3RESA 3SB2A 3DB3A 2DYBA 3JB9F 1ZBXA 1X6OA 3JCMb 1LNXA 3LLRA 4OMFB 3GLXA 3M54A 4Y91A 3MEWA 1KC8C 4M78B 1VQMT 2XHCA 2B86A 1M3BA 4RTYA 1HD3A 1VQ8Q 1V1CA 1JU5C 3HTRA 1ACMB 4HCZA 3LX7A 3A98A 1W2BS 3L2RA 2PZ1A 1M1FA 3EG0A 1MV3A 1IO6A 2MPXC 1R8OB 2DM1A 4C92E 2ZPIB 1ZX6A 2XI9A 1Z9ZA 3O5ZA 3OB9A 3M0RA 3MKDA 1WQWA 4FSXA 1NLOC 5C0MA 1W70A 4PNOA 4FYYB 3HL8A 5GAMf 2ZAEA 3OY9A 3MP8A 3CC7Q 1VQ7T 1NG2A 2DL5A 5KCHA 2R5AA 1BU1A 1WHLA 4LXCA 2FYKA 4C92F 1VYVA 3A5ZB 3D7SB 3JCMc 3QDRB 1KJWA 4HVUA 2E10A 2NLUA 1B34B 2DF6A 2RK1A 3JB9D 2QQAA 3EGXB 4II1A 1VQMA 4NOYA 1M90R 1K8AU 1U3OA 2VGMA 4RKUE 1G83A 1VA7A 3EFSA 2CSIA 3OYFA 2ENMA 2COWA 2VXEA 3M9QA 1M8VA 2CH4A 4A4GA 2QG9B 2DL4A 1KHIA 1SRLA 3CC4T 3CPFA 1Y0MA 2D9TA 2E3IA 5IHNA 1WGSA 3SFMA 1GXIE 5A0DA 1H3HA 3QHSA 1GRIA 2DVEA 2DZ9A 5CKBA 1I81A 5KCOA 2MAMA 2E3HA 1VQKT 1AT1B 2SRCA 2ESWA 2YUOA 1AWWA 3JB9I 1VQ6T 1YCYA 5D7UA 1ZHIA 2YUPA 3I55Q 2JTEA 1QLYA 2KK4A 1TWBA 2CZ1B 3EG9B 2DETA 3VS7A 2QEXT 1M30A 2EVRA 2KNBB 2WSCE 4M7AG 1ZUUA 4ZN3A 4QQ6A 4C92D 4JUVA 2CKKA 3SEMA 4M78C 2LMJA 3L2WA 3JCMP 5IXFA 2KVQG 1JXOA 4HXJA 1MHNA 2VXFA 3QYHB 2FRYA 2PNIA 4KGVB 1RI0A 5CKHA 4D8DA 3OBWA 5FW9A 5LJ5e 4KGXB 1JJ2A 3CD6A 2CP7A 5AT1B 3EG3A 3L42A 3V7SA 2DL3A 2BIVA 2PUKB 1N6AA 2XDPA 2DXCA 4N0AC 4A54A 3X28B 4EMHA 2M0YA 3OYEA 1VQKA 2KRSA 2KBTA 4R55A 3JRZA 3UWNA 4QT7A 2CUBA 4IUVA 3CMET 1WYXA 1R77A 1NEBA 1N27A 1Y57A 2LDMA 4LDVA 1YCSB 3M4GA 1E6GA 4M75B 1LCKA 3A8MB 2QEXA 4CC4B 2JOYA 4OVAA 3H0FA 3X24B 2E4HA 1NE8A 5GAN4 3RBBB 2RJFA 1K9AA 4AG1C 3CMAQ 2D6FA 1WHKA 2WSFE 1VQOA 1UUEA 1FX7A 5GANf 1KSWA 5A2QE 2LVMA 5KE2A 1K73C 1S72Q 2L89A 4PKCC 3E1SA 1AWOA 1PD0A 3ULRB 1NLPC 3G6ET 4O6JA 3EG1A 5DLOA 1YNZA 4M77E 2DRMA 5CIUA 5GMKe 3TU4K 1K1ZA 3V8JA 1QW1A 3VV0A 2EGAA 1AD5A 4C92A 2COZA 2AKKA 2LCLA 3OBYA 5HY6A 2D0NA 2DIQA 2HCKA 1EIFA 5HKCA 2OAWA 4A63B 1QWFA 4M77F 1AZEA 1OYXA 2RQRA 1YFNA 3OS1A 3H8ZA 2XKOC 1UECA 5CCAA 2YRVA 1QVFA 1RLPC 2DNUA 3CCST 4UC4A 4LE9A 2J05A 3HRSA 3HRUA 1UTIA 1N5ZA 2DJQA 3OW2P 2FVUA 4PLLA 1IGUA 3PT9A 4PL6A 1NEGA 3M0SA 1TUDA 2W0ZA 4OMMA 3G6EA 1RACB 4C5IA 3HP9A 4OB3B 2JMAA 4J9FA 2QA4Q 2IIMA 3PVQA 1RL2A 3JCMV 1WFWA 3THKA 3PTAA 1KD1R 4M7AB 4EIKA 2YUQA 1WHJA 5FU6C 1M8MA 1M9SA 5GAOr 3C0CA 3C12A 3JB9G 4PJMA 2XDBA 5M9OA 2WACA 3BDUA 4BD3A 4M75C 3BY7A 5LJ3d 4MDWA 4F7UF 3CCVQ 1V29B 3PE0A 5GAMg 1Y96A 5HK0A 1S1NA 2XD0A 1WPYA 1D1AA 4IUQA 2E41A 1VQ5T 4JJBA 3NFCA 3BDLA 2HMAA 1FXXA 1B07A 4JJDA 4M77D 2LQ8A 1YJWT 1UDLA 2A7YA 3CCSA 1NJIR 1K0XA 3M0PA 1X69A 1I8FA 2L3QA 1UHCA 2DVJA 2FHDA 1VOMA 5GAMj 2CS7A 3CCRT 2E5QA 2F69A 3SWNA 1C1AA 2YT6A 3CCJQ 5LJ3e 4DOVA 1YI2Q 1YWOA 3RMQA 1T0HA 3CXCA 2HEQA 1X27A 4C8QF 4E7LA 2PVDB 1PRMC 2LJ3A 4L6V5 4C92G 1X6GA 2KYMA 2VGNA 4B9WA 4QVCA 2RI3A 4HT9A 4J5YA 5LJ5h 5LJ5j 1YJNQ 4QKUA 1YITQ 3OYKA 4EMKA 1Q81C 1VQ5A 3RDVA 3G71T 3VYHB 1NBEB 3URGA 2DKGA 2QI2A 3PMIA 3G4SA 3OA6A 2L5QA 5J26A 1WXUA 5DLQE 2XMFA 3CCLQ 4HKEA 2JNGA 1M2VB 1ZUKA 2O01E 2NUPA 5KYYB 3J81E 2GFAA 3M4YA 4ORZA 3MEAA 3OYBA 1KD1U 3VYGA 2P84A 4QVDA 3PMTA 2OAUA 1WZOA 2ECZA 2Z0WA 2DD5A 3EGUA 3OMCA 1MUZA 3NTHA 3MHXA 3REBB 1T0JA 1I1JA 1N9SA 3RKXA 1BYMA 4M7AC 3V8KA 4FYVB 4HT8A 5I21A 4E6RA 2E1HA 5CKDA 1UB4A 1WA7A 3PFSA 1Q82R 4OF1A 4C8QD 3OQ5A 2D1XA 4LNPA 4ZGJB 4M77A 2DL7A 5FLXE 2DLPA 3JB9J 4KH1B 3I56A 3VRYA 4Y28E 2HL3A 4E7KA 1XOVA 3G71A 4DBRA 1NJIU 2RD1A 2LNHB 1PSFA 2RNAA 1JBMA 3ASKA 4QW2A 4HCKA 4E7JA 3CEYA 3LW5E 1N9RA 4ME7A 1VQLQ 3VUZA 5C6SA 1BB9A 4M7DE 4MZTA 1OULA 1WJRA 2RHUA 2NUTA 5GANg 1FMKA 2FPFA 3E2UA 4J6YA 2JTMA 2A08A 1OPLA 3EHQA 1BI1A 1RAEB 1QMCA 2L3RA 3WVEB 4NS5A 3RKWA 2K9GA 2EYXA 2HKQB 3JCMh 4PJOB 2G6FX 5GAOp 4F7UA 3O8VA 1H641 4HVWA 1ZSZA 3FIFA 2JVVA 2FZCB 1D1CA 4RCCA 3UDCA 1ABQA 1QQJA 4PLIA 3V7CA 2R58A 2LQNA 3OYMA 2JMCA 4QVZA 5I2SA 3ZFJA 5CK9A 1BKBA 3CC7A 3I55T 4LDUA 2K3YA 4BE1A 4QQGA 1J3TA 1Q7YC 1YIJQ 1H92A 4GBQA 2OX7A 2FG0A 1RAFB 4LN2A 2QGFB 2LJ1A 3CC2T 2KMTA 1QKWA 3EGDA 2EGEA 3OYIA 1ZUYA 1G5VA 1OX9A 4A53A 4MMLA 3C95A 2XDDA 2DXBA 2AHJB 3INZA 5DM7R 1WHGA 4LD9K 3G1JA 2KDSA 4ESRA 1XNIA 2EWNA 4DQ2A 4X9CA 3MEVA 4HA8A 5CAIA 1PKSA 2YDLA 3TREA 2EJ9A 3PIPA 3OW2A 2O9SA 2I2LA 1RAHB 4J9DA 4C8QA 2F5KA 2JS0A 3JB9H 5KYXA 3OYNA 2O4XA 3VS2A 3TEEA 4A4FA 3NTIA 1QVFP 4FU6A 4D8KA 5J39A 2NWMA 3H0HA 4M7DD 2YSQA 1YHQQ 4Z8AA 1OX8A 2HD0A 4M77G 4RTWA 2K57A 3RUXA 5ECAA 1CSKA 4JS5A 5I22A 1UFFA 3A8HB 3I55A 2VASA 4AFQC 2DE0X 2QQSA 1GCQA 4E7SA 4HCCA 2F2VA 1C6VX 3CC2A 1G3SA 3FDRA 4RMOA 3I5RA 1CKBA 3VS0A 3CCQQ 1SHFA 1IGQA 1YP5A 2V8JA 3BFMA 4OB1B 2RF0A 1GFCA 2A36A 2F2XA 1YJ9Q 3M59A 2QTVA 1N8RC 1KQSS 1RAAB 4E7ZA 3X20B 1X43A 5GMKm 1VIEA 3OYAA 4OMPA 4PJOC 3S6WA 4C5HA 1JJ2S 3OYCA 1M4ZA 3EH1A 4F7UG 5IXBA 4E7HA 3OS0A 3META 3TVTA
chains in the Genus database with same CATH topology
1QP3A 2K3XA 2D6FA 2WSFE 1W4SA 3QG1A 4XTXA 1VQOA 2P0PA 4ZTJA 4ATOA 2XG8D 1LJOA 1VQLA 1FX7A 4JRIA 2K5FA 4FT4A 5LJ5f 2F5TX 2OTLT 1QVGS 5GANf 2PUOB 3L1AA 4C0ZA 5GAOm 2P0QA 3LGFA 4IUPA 4C0DC 2JZ2A 2DTHA 2LVMA 5KE2A 5GAN2 2CZ7B 5A2QE 4NL3A 1K73C 4M7AE 3QSUA 2L89A 4PKCC 5GAMh 1VQ4T 1LOJA 3E1SA 4JJNK 4XQ3A 4JRPA 2EFIA 3G6ET 3FB9A 4O6JA 3MP1A 2DJZA 2VYTA 5DLOA 5AYFA 3CD6T 2BUDA 2X4WA 4M77E 5CIUA 5EG2A 2K5LA 2JTFA 4IURA 5GAN6 3ME9A 5GMKe 3TU4K 5GAOq 3CCET 3V8JA 1QW1A 3VV0A 2B8AA 3HPWA 2LNVA 4M78F 3HFOA 1U1TA 4OGEA 5CQXA 2M1HA 3JCMQ 3L2UA 1NZ9A 2GQVA 2EYQA 3CBOA 1BI0A 4C92A 3CCUA 1D3BB 1HK9A 2EJFA 2LCLA 1U1SA 3OBYA 5HY6A 2XK0A 2ZPEB 2DIQA 5LJ3g 3S3NA 4N4GA 4ZGEB 1UGPB 3JCMJ 4M7DA 3LYIA 3A8OB 1EIFA 2DTOA 4GLKA 5HKCA 4C8QG 4O5VA 4C92B 5GAN3 2QQRA 3GP8A 3OYHA 4KUDK 1P92A 4CRIA 5CQYA 2QQBA 3M58A 4M77F 1OYXA 5FRMA 2RO0A 4EMKB 1YJWA 3QXEB 4OGCA 3OS1A 1N8RU 2X35A 2OTJA 4M78G 5D6WA 2MI6A 2K4YA 3H8ZA 4KUIA 2XKOC 4C8QC 3UPUA 1Q82U 3JCMX 4X34A 2DD4A 3M57A 2X4YA 4LDWA 5CCAA 2XU8A 1I4K1 1X01A 3MCAB 1NPRA 2YRVA 2QA4T 3QYGB 1QVFA 1XQHA 2DAQA 2RK2A 2MWOA 2ZCFB 3CCST 3QO3A 4UC4A 4JDSA 2OTLA 3PGGA 4V2SA 4DA4A 5HK3A 3EAEA 3J7AF 2M16A 4C5GA 3HRSA 3HRUA 3LWHA 1VQOT 3HRTA 3GOXA 3CCQT 1XTDA 2X4XA 2M9UA 1VQ4A 3CCRA 3V8LA 1BI2A 2FVUA 4PLLA 2PU9B 1I5LA 3PT9A 4PL6A 2G3RA 5LJ3h 2MF2A 5LJ3j 3G6EA 3SD4A 1YJ9T 1K73U 2WSEE 4C5IA 4L5GA 4M7AA 2VUBA 3OS2A 3HP9A 4OB3B 1Y7XA 5GAN5 2LQKA 2IVWA 4P5NA 2RJDA 1RL2A 5GAOn 3JCMV 2KQWA 5I2MA 4PJOF 4XTVA 3F70A 3PTAA 3QUIA 4ZGDB 1DJ7B 5A0LA 4M75G 3C4SA 4M7AB 1KHCA 1IREB 4J8OA 5FU6C 4B9XA 4J83A 4XU3A 4KBMB 1M9SA 3CBMA 3C12A 5CVIA 2EIFA 3SDZA 5GAOr 1QVFS 3JB9G 1K8AC 2XDBA 1VQPT 1OZ2A 5M9OA 2A3LA 2WACA 3BDUA 4M75C 3BY7A 4J6XA 1OZ3A 4MDWA 5LJ3d 4BD3A 4F7UF 3CMAT 1V29B 5GAMg 4GY5A 1K9MC 1Y96A 2QQ9A 2FB7A 2PVGB 5HK0A 1WNLA 1M1KC 1Q86C 1JRIA 1YBYA 3R6OA 2FL7A 2XD0A 1WPYA 4ZTFA 3JCMf 4IUQA 1Y96B 4XK8E 3S3OA 2E41A 2VC8A 1S72T 1VQ5T 1VQNA 2DXUA 3NFCA 1M90U 1UGQB 3BDLA 1FXXA 3E19A 3HSBA 5FROA 2R57A 4M77D 2LQ8A 2QA4A 3CCMT 1QVPA 1YJWT 3JCMW 2OTJT 1TH7A 1VQNT 2A7YA 2DPPB 3CCSA 2LT4A 1U8RA 4IKFA 4OP0A 4XTWA 4N4IA 2RHXA 2DK3A 1BIAA 2QDYB 2RHZA 2E6ZA 3DKMA 3QZ5B 4X9DA 4FT2A 1KD1C 3CCQA 3LGLA 3P8DA 4WF2A 3QZ9B 4N4HA 3HFNA 1I8FA 1O75A 2JN0A 2RJEA 5GMKl 2EJGA 2FHDA 2HAXA 3GNFB 4M78E 3CCVA 1UGSB 1VUBA 4ZN1A 4EDUA 1YJ9A 4C5EA 5GAMj 2HQEA 2CS7A 3X26B 2DZCA 3OYIA 3ER0A 3QKJA 4BB7A 3CCRT 2E5QA 2F69A 4YTLA 3SWNA 1YJNT 1H3ZA 1KG1A 5LJ3e 4DOVA 1YITT 4M7DF 2EKOA 2DEQA 3FJPA 3M5AA 4BE0A 5IAYA 3LWIA 4A4HA 4JLIA 3SWNB 3M55A 3RMQA 3WXMB 3CXCA 3FC3A 2VV5A 4EPCA 4C8QF 4E7LA 1UGRB 3N5BB 2PVDB 5GAOl 4FM4B 4Z02A 4PJOD 2LCCA 1D3BA 1VQPA 4L6V5 3CCEA 4C92G 1BI3A 3BW1A 4LD6A 3CMAA 2VGNA 2ZPFB 4B9WA 3DB4A 4QVCA 5GAMd 4J7FA 4A4EA 2RI3A 1BIBA 4HT9A 1NJIC 3E9GA 4J5YA 5LJ5h 4BY6B 5LJ5j 4M7DG 5GANh 5GANj 3HHTB 2E65A 2JUFA 3QBYA 3DLLA 2QXFA 4C92C 2CZ6B 1VQ9T 3OSSC 4BDYA 3OYKA 4EMKA 1S72A 2EQKA 1Q81C 1VQ5A 2BKDN 4OB2B 3KXTA 4KULA 3G71T 1K9MU 4M7DC 2E70A 1M1KU 3VYHB 1Q86U 3URGA 3CCMA 2LTOA 2GFUA 3RIRA 2L8DA 5IT9E 1YI2A 1X75C 2DKGA 5DY9A 2QI2A 3PMIA 3G4SA 4J7IA 5FU7C 4JRKA 3OA6A 4XAXB 2L5QA 5D6XA 5J26A 5DLQE 1ZQ1A 5LJ5d 2CGHA 2DIGA 2RI5A 2ZPGB 3KBGA 5CO7A 5GANd 4HKEA 5FRNA 2JNGA 3H6ZA 4E47A 3PIOA 4PJOE 2H3JA 3JSCA 3Q1JA 2O01E 1VQ7A 4JS4A 3J81E 1Y71A 2P4TA 2GFAA 4RG8A 3M4YA 4RG2A 3VKIA 2X4JA 4BDZA 1W2BA 4ELZC 3MEAA 5GAN8 4BI3A 4M75F 3GPLA 2EQJA 1Y07A 3JAME 3OYBA 3A8GB 5CKEA 1JB0E 3VYGA 1YJNA 1KD1U 2DO3A 4QVDA 3PMTA 3RESA 4C0FA 3SB2A 4F7UE 1G3TA 2OAUA 1YITA 3CCVT 3DB3A 5GAMe 3WVDB 2MMPA 3JB9F 2DD5A 3OMGA 1ZBXA 2RA2A 1X6OA 3OMCA 4M78A 4BUGA 1LNXA 3LLRA 4OMFB 5CR2A 4JLGA 3JCMb 3NTHA 3MHXA 2HBPA 3GLXA 1N9SA 2DTIA 3M54A 3RKXA 4M7AC 1BYMA 2YLBA 4Y91A 3MEWA 3V8KA 4LDXA 3G7ZA 1KC8C 4HT8A 4M78B 5I21A 3EFRA 4RCBA 2E1HA 4D6WA 5CKDA 1VQMT 4IUTA 2YHTA 3CCLA 1UB4A 3PFSA 2XHCA 4OF1A 4C8QD 3OQ5A 3TCJA 4ZGJB 1KQSA 4M77A 5FLXE 3JB9J 2DXTA 2C06A 2EAYA 3CC4A 1VQ9A 4HCZA 3I56A 2E64A 3LX7A 4M78D 4Y28E 5GANe 1W2BS 2GCXA 3L2RA 4E7KA 4M77B 1M1FA 1OI1A 1XOVA 3ZEHA 3G71A 1KQ1A 3MO8A 3MP6A 1NJIU 4N0AA 4XTZA 4BE2A 1R8OB 2PQWA 2RD1A 3UT1A 1PSFA 1JBMA 3ASKA 4QW2A 4C92E 2ZPIB 4E7JA 3L2VA 3CEYA 3LW5E 1N9RA 2XI9A 4ME7A 3VUZA 1Q81U 1WJSA 5C6SA 4Q5WA 1QVGA 3CCJT 3GF5A 4M7DE 3RERA 5FU6B 1FWZA 3OB9A 4MZTA 1YI2T 1VQ6A 3G4ST 1WQWA 4FSXA 3OYJA 3T9NA 5C0MA 3OS5A 4PNOA 3HL8A 5LJ5g 1WJRA 2RHUA 5GAMf 3DLMA 5GANg 4C8QE 3OY9A 3MP8A 4J6YA 2JTMA 1VQ7T 1Q82C 3E9FA 3M56A 4PJOA 3KUFA 4KT0E 1WQ7A 5KCHA 1BI1A 2R5AA 2HQXA 2L3RA 4ELYC 2FYKA 3WVEB 4BI4A 4C92F 4M75D 4NS5A 3A5ZB 3RKWA 3JCMc 2KAFA 3QDRB 3JCMh 4J6WA 4PJOB 5LL6S 2E10A 3SWNC 1VIFA 1YIJT 2RHYA 2NLUA 2RB6A 1B34B 2RK1A 3JB9D 2QQAA 4F7UA 3A8LB 3O8VA 1NPPA 5GAOp 1H641 4II1A 3FIFA 1VQMA 1QP2A 2JVVA 4NOYA 5L8RE 2PVOB 1K8AU 2ZZDA 3QJYA 1SSFA 4RCCA 3UDCA 2VGMA 4PLIA 3V7CA 4RKUE 4F7UB 2R58A 3J80E 3OYGA 2GF7A 2RH2A 4BY6C 5KE3A 3CCLT 3EFSA 3OYMA 4C0DB 1KC8U 3OYFA 4QVZA 4EMGA 5I2SA 3ZFJA 5CK9A 2VXEA 1BKBA 4QQDA 3M9QA 3JCMd 3CC7A 4DOWA 1M8VA 3I55T 4A4GA 3NTKA 4LDUA 2K3YA 4BE1A 3QJ6A 1KHIA 3CC4T 4OB0B 4QQGA 3CPFA 1Q7YC 2D9TA 3I56T 3HKSA 2D0QB 3QIIA 3VUBA 2EQUA 1WGSA 4M75E 3SFMA 4EMKC 4FIBA 1GXIE 2CYZB 3CBPA 5A0DA 4XTUA 3CMEA 4R56A 3CCJA 3CC2T 3QHSA 2KMTA 2DVEA 2RJCA 2MWPA 2QTXA 3GNGA 3VJPA 3FEOA 3ZBDA 2DZ9A 5CKBA 1I81A 2V8KA 5KCOA 4MZMA 5GMKi 1G5VA 2MAMA 2RM4A 4A53A 4M7AF 4MMLA 3C95A 2XDDA 1VQKT 3OYLA 3CXCS 2DXBA 2AHJB 4BACA 3INZA 2YLCA 3JB9I 1VQ6T 1YCYA 5DM7R 4NL2A 4LD9K 1ZHIA 2KDSA 2V8IA 1XNIA 2EWNA 4DQ2A 1MGQA 4X9CA 5GAN7 1YHQT 1M90C 2LX9A 3MEVA 4BI8B 2KK4A 2M0OA 5LJ3f 2CZ1B 4HA8A 4A4KA 1O9SA 5CAIA 3TREA 2EQMA 2EJ9A 3PIPA 2QEXT 3OW2A 2I2LA 3RKYA 2CZ0B 1VQ8T 4M7DB 2ZPBB 4C8QA 2F5KA 3QPHA 2WSCE 5CKFA 2E6NA 3OSVA 3CPWA 4MZPA 3JB9H 3OYNA 4M7AG 1YIJA 1G3YA 4E7IA 2O4XA 3TEEA 4A4FA 4ZN3A 4XU1A 3GIBA 4QQ6A 2LC4A 3NTIA 4C92D 4JUVA 3JCMe 5FU7B 4C8QB 2CKKA 3LH0A 4FU6A 5J39A 2RI2A 3FRNA 5A0GA 3VU3C 4M78C 2LT1A 4M7DD 3FLGA 2O4XB 1IZ6A 4C0GA 2XIDA 3L2WA 3AHUA 2R5MA 3JCMP 2HD0A 4M77G 1VQLT 5D6YA 2KVQG 2K57A 1MHNA 3RUXA 2VXFA 3QYHB 3OYDA 4JS5A 3A8HB 2Y4YA 3P8BB 3I55A 1RI0A 5CKHA 3P8HA 3S3MA 4M77C 4L59A 3OBWA 5LJ5e 2QQSA 1JJ2A 3CD6A 2Y4XA 2Y90A 3V7RA 3L42A 3V7SA 2RHIA 3JCMg 2ZGWA 3OW2S 3CC7T 2E12A 4HCCA 2BIVA 3M53A 2P0KA 2PUKB 1N6AA 2XDPA 2DXCA 1WJQA 4N0AC 4A54A 3C94A 3CPWS 3CC2A 1G3SA 5GMKh 5GMKj 3FDRA 4XU0A 4RMOA 1Q7YU 4MMKA 3X28B 2IG0A 3X25B 3MEUA 4EMHA 2K5IA 3OYEA 1VQKA 3RMSA 4M75A 3JRZA 3UWNA 4R55A 4IUVA 3CMET 1KQ2A 2V8JA 5KH6A 2KSSA 1N27A 3BFMA 3OYYA 4OB1B 1YHQA 2LDMA 1M5Q1 2ZPHB 4LDVA 3M4GA 1PSEA 3M59A 5IN1A 3L2QA 4M75B 1AHJB 5J3BA 4M7AD 1UEBA 3CCUT 4PJOG 4HCBA 4XU2A 1G3WA 4VUBA 3A8MB 2QEXA 1N8RC 4CI0C 1KQSS 1VQ8A 2XICA 4XTYA 3X20B 5GMKm 3PNWC 4TVRA 1VIEA 2JOYA 4OVAA 3OYAA 2LRQA 2HNIA 4PJOC 3S6WA 4C5HA 1B34A 3X24B 3OYCA 1JJ2S 1NE8A 3L2ZA 1M4ZA 2KY9A 4IUUA 4FL6A 2K2VA 4LDYA 1HXDA 4F7UG 3META 5GAN4 3OS0A 4E7HA 2RJFA 4MDXA 1M1GA 4JRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M75 E;  3BDU A;  4M75 C;  3BY7 A;  4J6X A;  4XTX A;  5LJ3 d;  4EMK C;  4F7U F;  4QVD A;  3RES A;  4F7U E;  3SB2 A;  1LJO A;  1Y96 A;  5GAM g;  2FB7 A;  4XTU A;  5GAM e;  4JRI A;  1WNL A;  3QHS A;  5LJ5 f;  3JB9 F;  1JRI A;  5GAN f;  3L1A A;  2RA2 A;  2DVE A;  5GAO m;  4M78 A;  2QTX A;  1LNX A;  1WPY A;  5GMK i;  3JCM b;  2DZ9 A;  5GAN 2;  1I81 A;  2DTH A;  4NL3 A;  3JCM f;  2RM4 A;  4M7A F;  4A53 A;  4MML A;  1Y96 B;  4M7A E;  1N9S A;  2DTI A;  2E41 A;  2VC8 A;  3RKX A;  5GAM h;  2YLB A;  4Y91 A;  3V8K A;  3QSU A;  4M7A C;  2DXU A;  1LOJ A;  2YLC A;  3INZ A;  3JB9 I;  1YCY A;  4NL2 A;  4HT8 A;  4M78 B;  5I21 A;  3EFR A;  2EWN A;  4DQ2 A;  1MGQ A;  4RCB A;  2E1H A;  4X9C A;  5GAN 7;  4XQ3 A;  3HSB A;  2YHT A;  4M77 D;  3FB9 A;  5LJ3 f;  4HA8 A;  3JCM W;  1TH7 A;  2DJZ A;  4C8Q D;  5CAI A;  2EJ9 A;  4M77 A;  4OP0 A;  4XTW A;  3JB9 J;  2DXT A;  2I2L A;  3RKY A;  4M77 E;  4M7D B;  4C8Q A;  2EAY A;  1BIA A;  4X9D A;  2E64 A;  4M78 D;  3JB9 H;  5GAN e;  4M7A G;  4WF2 A;  5GAN 6;  4V2S A;  5GMK e;  5GAO q;  4M77 B;  3HFN A;  1I8F A;  4XU1 A;  2JN0 A;  1KQ1 A;  3V8J A;  3GIB A;  4C92 D;  4JUV A;  5GMK l;  2EJG A;  3JCM e;  4N0A A;  4XTZ A;  4M78 F;  4C8Q B;  3HFO A;  4M78 E;  1U1T A;  3JCM Q;  3VU3 C;  4M78 C;  2RD1 A;  3JB9 G;  4C92 A;  5GAM j;  4M7D D;  1D3B B;  1JBM A;  1HK9 A;  2DZC A;  1U1S A;  2EJF A;  4C92 E;  3SWN A;  3AHU A;  5LJ3 g;  1N9R A;  3JCM J;  3JCM P;  4M7D A;  4M77 G;  5LJ3 e;  4M7D F;  2DTO A;  4M7D E;  3RER A;  2K57 A;  2DEQ A;  3FJP A;  4C8Q G;  4C92 B;  5GAN 3;  3RUX A;  2VXF A;  4JLI A;  3SWN B;  1WQW A;  4M77 F;  4PNO A;  4EMK B;  4M77 C;  5LJ5 g;  4C8Q F;  5GAM f;  4M78 G;  5GAN g;  4C8Q E;  5GAO l;  5LJ5 e;  4PJO D;  4C8Q C;  4J6Y A;  2Y90 A;  3V7R A;  3JCM X;  1D3B A;  3V7S A;  3JCM g;  2ZGW A;  4C92 G;  3BW1 A;  1I4K 1;  1X01 A;  4QVC A;  4PJO A;  5GAM d;  1WQ7 A;  1BIB A;  4HT9 A;  3QO3 A;  4J5Y A;  5LJ5 h;  5LJ5 j;  4M7D G;  3PGG A;  4N0A C;  4A54 A;  2FYK A;  5GAN h;  5GAN j;  5GMK h;  4C92 F;  2E65 A;  4M75 D;  4XU0 A;  5GMK j;  4MMK A;  3RKW A;  3JCM c;  4C92 C;  3JCM h;  4J6W A;  4PJO B;  4EMH A;  2E10 A;  4M75 A;  3SWN C;  4EMK A;  1KQ2 A;  2RB6 A;  1B34 B;  3V8L A;  4M7D C;  3JB9 D;  5GAO p;  4F7U A;  3BFM A;  1I5L A;  1H64 1;  1M5Q 1;  3FIF A;  4NOY A;  3M4G A;  4M7A D;  5LJ3 h;  5LJ3 j;  4M75 B;  4RCC A;  3RIR A;  4PJO G;  2DKG A;  5DY9 A;  4XU2 A;  3V7C A;  4JRK A;  4F7U B;  4M7A A;  5GAN 5;  4XTY A;  5LJ5 d;  2CGH A;  5GAO n;  5GMK m;  3EFS A;  3JCM V;  5GAN d;  4PJO F;  4PJO E;  4XTV A;  4EMG A;  2HNI A;  3QUI A;  4PJO C;  2VXE A;  3JCM d;  1B34 A;  4M75 G;  4M7A B;  1M8V A;  3L2Z A;  4F7U G;  1HXD A;  4XU3 A;  5GAN 4;  5GAO r;  5GAN 8;  4M75 F; 
#chains in the Genus database with same CATH topology
 1W4S A;  4XTX A;  4E2F B;  3SHW A;  4JRI A;  2K5F A;  5LJ5 f;  2HDA A;  2F5T X;  2OTL T;  1QVG S;  2PUO B;  2EYY A;  5GAN 2;  2JZ2 A;  4NL3 A;  1X2Q A;  2RPN A;  3AT1 B;  2E5K A;  2OTJ Q;  2EFI A;  2KT8 A;  1E6H A;  2VYT A;  5AYF A;  3CD6 T;  3CXC P;  2FZG B;  2EYZ A;  1EZZ B;  2K5L A;  2GBQ A;  2I0N A;  4M78 F;  2L3S A;  3HFO A;  2CP6 A;  4OGE A;  3L2U A;  2M1H A;  1NZ9 A;  1VQ4 Q;  2EJF A;  5KYW B;  1U1S A;  2XK0 A;  2ZPE B;  3JCM J;  4M7D A;  3A8O B;  4GLK A;  4C8Q G;  2QQR A;  4KUD K;  5CQY A;  2QQB A;  3M58 A;  5IHK A;  4EMK B;  3QXE B;  4OGC A;  2J6F A;  3EHR A;  1LPL A;  4RTZ A;  2X4Y A;  2QDL A;  1KIK A;  1X01 A;  3I35 A;  1NPR A;  2QA4 T;  3QYG B;  1WXT A;  1K9M R;  4JDS A;  2OTL A;  3PGG A;  3PVL A;  4DA4 A;  5HK3 A;  4V2S A;  2QK0 A;  1M1K R;  3J7A F;  1X6B A;  2C0T A;  1VQO T;  2DRK A;  2M9U A;  3V8L A;  2PU9 B;  1WI7 A;  2KYB A;  3CPW P;  2MF2 A;  2WSE E;  4RTX A;  4FW2 A;  2VUB A;  1Y7X A;  5GAN 5;  5GAO n;  5I2M A;  3IQL A;  1WX6 A;  2M02 A;  2EW3 A;  1KHC A;  1IRE B;  4J83 A;  1QVF S;  3SDZ A;  5CVI A;  2EIF A;  1PWT A;  1VQP T;  1G2B A;  1I0C A;  1OZ2 A;  3I5S A;  1OZ3 A;  4GY5 A;  3NMZ C;  2FB7 A;  3NHN A;  2JM8 A;  1Q86 C;  1YBY A;  4R0K A;  4JJC A;  2J6K A;  2KEA A;  3JCM f;  2HZY A;  4XK8 E;  3S3O A;  2L0A A;  2O2O A;  1M90 U;  1VQM Q;  2R57 A;  2QA4 A;  3CCM T;  1JQQ A;  1K4U S;  1VQN T;  2LT4 A;  4N4I A;  4J9B A;  2QDY B;  4X9D A;  3DKM A;  4PK4 A;  4WF2 A;  1AZG B;  3QZ9 B;  4N4H A;  2C0O A;  2L2P A;  2JN0 A;  1ZA2 B;  5GMK l;  2EJG A;  2HAX A;  3GNF B;  3CCV A;  1VUB A;  1A0N B;  2JJ9 A;  4C5E A;  1B7T A;  2DZC A;  3ER0 A;  4YTL A;  1YJN T;  1KG1 A;  1YIT T;  1QKX A;  4JLI A;  4CC3 A;  3M55 A;  3FC3 A;  2VV5 A;  4EPC A;  3QDF A;  4Z02 A;  1VQ7 Q;  1VQP A;  2DMO A;  1ZSZ B;  2J6O A;  1BIB A;  3E9G A;  4BY6 B;  4M7D G;  3DLL A;  1MMD A;  2CZ6 B;  2L3P A;  1VQ9 T;  2EGC A;  3A1P A;  5KYN A;  1OV3 A;  4OB2 B;  4FYW B;  3MJX A;  3KXT A;  4KUL A;  1K9M U;  1RAD B;  1M1K U;  1KC8 R;  3CCM A;  2GFU A;  1LVK A;  2L8D A;  3RIR A;  1QWE A;  1X75 C;  1YI2 A;  5DY9 A;  1VQN A;  1PM3 A;  1R0C B;  4JRK A;  4XAX B;  2AK5 A;  5CO7 A;  2RI5 A;  3KBG A;  5GAN d;  2BZY A;  3PIO A;  3EG2 A;  3KFV A;  2H3J A;  3JSC A;  2P4T A;  3UA7 A;  3CC4 Q;  2LZ6 B;  2ABL A;  5HCK A;  4LUE A;  4M75 F;  2EQJ A;  1Y07 A;  3JAM E;  1YJN A;  1OU8 A;  1M3A A;  1TUG B;  4F7U E;  1YIT A;  4PJJ A;  2MMP A;  2HSP A;  2AIR B;  2RA2 A;  1K8A C;  4M78 A;  3VRZ A;  1VQ6 Q;  1RUW A;  2LJ0 A;  3G7Z A;  3EFR A;  4IUT A;  3CCL A;  2QEX Q;  2FO0 A;  3JV3 A;  3REA B;  2C06 A;  2DYI A;  2EAY A;  1VQ9 A;  2DA9 A;  2E64 A;  4ZNX A;  5GAN e;  4DEX A;  1OI1 A;  3ZEH A;  1KQ1 A;  3MP6 A;  1OQK A;  1TXQ A;  4N0A A;  4BE2 A;  2VVK A;  4KH0 B;  2FPE A;  2PQW A;  2X9H A;  3UT1 A;  2FRW A;  3L2V A;  4PFP A;  2KT1 A;  3G4S T;  4B6M A;  1SG5 A;  4ANJ A;  3OYJ A;  3T9N A;  2CRE A;  5LJ5 g;  4C8Q E;  1GFD A;  3M56 A;  1TG0 A;  3KUF A;  4BI4 A;  4M75 D;  4J6W A;  3CME Q;  1VIF A;  1YIJ T;  2IPO B;  2O88 A;  3A8L B;  1QP2 A;  2VWF A;  5L8R E;  1YWP A;  1SSF A;  3J80 E;  3OYG A;  1WXB A;  4BY6 C;  2NYS A;  1KC8 U;  4C0D B;  4QQD A;  4DOW A;  2JW4 A;  3NTK A;  3QJ6 A;  4OB0 B;  3I56 T;  2OI3 A;  3HKS A;  2D0Q B;  1YN8 A;  3QII A;  3VUB A;  2DEU A;  4OMN A;  2CYZ B;  2AKL A;  3CBP A;  4XTU A;  2A37 A;  2GNC A;  2K3B A;  3H41 A;  2CSQ A;  3VJP A;  2RJC A;  2MWP A;  4F16 A;  4R56 A;  5GMK i;  2H8H A;  3ZBD A;  4DBF A;  2RM4 A;  4M7A F;  1PRL C;  3OYL A;  3EG9 A;  4BAC A;  2YLC A;  4NL2 A;  2V8I A;  1YHQ T;  1M90 C;  3RNJ A;  2LX9 A;  3G6E Q;  1WLP B;  2M0O A;  1W6X A;  5KYU A;  2CZ0 B;  1VQ8 T;  4M7D B;  2BZ8 A;  5CKF A;  3CPW A;  1YIJ A;  2RQU A;  1QCF A;  4XU1 A;  3GIB A;  5FU7 B;  3M0Q A;  4RUG A;  3LH0 A;  1B3Q A;  2RI2 A;  3FRN A;  5A0G A;  2CUD A;  4CC2 A;  1W2B P;  2XID A;  3AHU A;  3LH5 A;  3UAT A;  4DBH A;  1D0Y A;  2Y4Y A;  3P8B B;  3S3M A;  2KXC A;  4RTT A;  1BK2 A;  2Y4X A;  2Y90 A;  1D0X A;  2RHI A;  2O9V A;  3JCM g;  3OW2 S;  3CC7 T;  2KRM A;  3CCS Q;  3M53 A;  1WJQ A;  5GMK h;  5GMK j;  4XU0 A;  1PCX A;  2IG0 A;  3X25 B;  1K73 R;  1GBR A;  4M75 A;  1MNE A;  4PFO A;  3OYY A;  1YHQ A;  1M5Q 1;  2HSE B;  1GCP A;  1PSE A;  1BBZ A;  5IN1 A;  3L2Q A;  4M7A D;  1AHJ B;  4LUD A;  5J3B A;  4HCB A;  4XU2 A;  4VUB A;  4CI0 C;  1VQ8 A;  2XIC A;  4XTY A;  2EQI A;  4TVR A;  2LRQ A;  2FPD A;  3TSZ A;  2KY9 A;  4LDY A;  2K2V A;  2FZK B;  1M1G A;  4JRQ A;  2K3X A;  2NUZ A;  3QG1 A;  4ATO A;  2P0P A;  4ZTJ A;  8ATC B;  2AZV A;  3CCU Q;  4FT4 A;  4KRT A;  3L1A A;  4C0Z A;  5GAO m;  5FWB A;  4C0D C;  3LGF A;  4IUP A;  4AT1 B;  1T3L A;  1UJY A;  2ATC B;  2CZ7 B;  1VQ5 Q;  1RAI B;  4AFZ C;  1VQ4 T;  2KE9 A;  1LOJ A;  2ED1 A;  4XQ3 A;  1YJW Q;  1K0S A;  2JS2 A;  2F1L A;  2BUD A;  2X4W A;  4IUR A;  5GAN 6;  3ME9 A;  5GAO q;  1E7O A;  2FEI A;  2BE7 D;  2B8A A;  1IXD A;  3HPW A;  4X1V A;  3JCM Q;  2YRD A;  3CBO A;  3CCR Q;  3S3N A;  5LJ3 g;  1UGP B;  4F17 A;  4C92 B;  4O5V A;  1VYU A;  3GP8 A;  3OYH A;  1P92 A;  2DIL A;  4J9C A;  5FRM A;  2OTJ A;  2X35 A;  1UJ0 A;  2MI6 A;  1FYN A;  2MK5 A;  4KUI A;  3UPU A;  1Q82 U;  3JCM X;  4X34 A;  1I4K 1;  4JZ4 A;  1XQH A;  2ZCF B;  2MWO A;  1BCO A;  3QO3 A;  3M0U A;  1HSQ A;  1I07 A;  3MPU B;  3EAE A;  4C5G A;  1M3C A;  1XTD A;  3G71 Q;  1VQ4 A;  1BI2 A;  2K79 A;  1D0Z A;  2F2W A;  5LJ3 h;  5LJ3 j;  3SD4 A;  1K73 U;  4L5G A;  4M7A A;  3UF4 A;  2X3W D;  4PJO F;  4XTV A;  3QUI A;  5A0L A;  4M75 G;  3EFO A;  6AT1 B;  1TSF A;  5GJW B;  1SHG A;  2A3L A;  4WTO B;  4J6X A;  3CMA T;  1MMG A;  2V1Q A;  2QGG A;  2D8J A;  2BE9 B;  1WNL A;  4RTU A;  1JRI A;  2FL7 A;  1Y96 B;  1S72 T;  2VB6 A;  2DXU A;  1UGQ B;  2KRN A;  5FRO A;  2AT1 B;  2YWW A;  3U23 A;  1EFN A;  1QVP A;  1TH7 A;  3H0I A;  2DPP B;  1U8R A;  4IKF A;  4XTW A;  3CCE Q;  2RHX A;  2DK3 A;  2GTO A;  1BIA A;  2RHZ A;  1KD1 C;  4FT2 A;  1IHW A;  1Q81 R;  3HFN A;  1O75 A;  4M78 E;  1UGS B;  4EDU A;  2ROT A;  1TS9 A;  5IH2 A;  3QKJ A;  2V1R A;  2RMO A;  4FW1 A;  3QWX X;  2EKO A;  2DEQ A;  3FJP A;  3M5A A;  4BE0 A;  5IAY A;  3SWN B;  3WXM B;  5GAO l;  1JO8 A;  4FM4 B;  2K7A A;  4PJO D;  2LCC A;  2LCS A;  1D3B A;  1NYG A;  2DBK A;  3BW1 A;  3CMA A;  5GAM d;  4A4E A;  2CP2 A;  1NJI C;  2GTJ A;  3ZL7 C;  5FWC A;  3HHT B;  2JUF A;  2QXF A;  4C92 C;  4AFU C;  1S72 A;  2CP3 A;  2EBP A;  1SEM A;  2E70 A;  1MMN A;  2BTT A;  2LTO A;  5IT9 E;  1M2V A;  4OML A;  4J7I A;  2KR3 A;  5KYY A;  5D6X A;  1ZQ1 A;  5LJ5 d;  2CGH A;  2DIG A;  2EYW A;  3H6Z A;  4E47 A;  1UG1 A;  2QAS A;  1VQ7 A;  1ZBJ A;  4JS4 A;  1Y71 A;  4RG2 A;  3VKI A;  2CDT A;  4BDZ A;  1W2B A;  4BI3 A;  2J7I A;  1WHM A;  2NUP B;  3A8G B;  5CKE A;  1JB0 E;  2A0F B;  2DO3 A;  5I11 A;  4C0F A;  1G3T A;  3CC2 Q;  3CCV T;  5GAM e;  5KYU B;  3WVD B;  3OMG A;  2LX7 A;  2ED0 A;  4BUG A;  5CR2 A;  1OPK A;  1BCM A;  4JLG A;  1D09 B;  2HBP A;  2DTI A;  2YLB A;  4JZ3 A;  4LDX A;  2CH4 W;  2DFU A;  4RCB A;  4D6W A;  2YHT A;  4F14 A;  1AVZ C;  3TCJ A;  1KQS A;  2DXT A;  2D8H A;  3TSW A;  3CC4 A;  4M78 D;  2A28 A;  2GCX A;  4M4Z A;  4M77 B;  1OU9 A;  3MO8 A;  2ROL A;  4PFZ A;  4XTZ A;  1NYF A;  1OEB A;  1Q81 U;  1WJS A;  4Q5W A;  1QVG A;  3CCJ T;  3GF5 A;  4DEY A;  2HBW A;  5FU6 B;  3RER A;  1FWZ A;  1VQ6 A;  1YI2 T;  2JT4 A;  4OMQ A;  1ZSG A;  3OS5 A;  1AOJ A;  3DLM A;  1UHF A;  1Q7Y R;  1QCN A;  2YUN A;  1Q82 C;  3E9F A;  4PJO A;  4KT0 E;  1WQ7 A;  2NUT B;  1D1B A;  1VYT A;  1U06 A;  1WDX A;  2HQX A;  4ELY C;  1RI9 A;  2KAF A;  5LL6 S;  2P4R A;  1U5S A;  3SWN C;  2DX1 A;  2RHY A;  2RB6 A;  1W1F A;  1NPP A;  3EH2 A;  4WCI A;  2PVO B;  1M27 C;  4KGZ B;  2ZZD A;  3QJY A;  4F7U B;  2KGT A;  1JXM A;  2GF7 A;  2RH2 A;  5KE3 A;  3CCL T;  3RR6 A;  2DER A;  4EMG A;  3JCM d;  2HKN A;  1IRX A;  1MND A;  2EQU A;  1R0B G;  4M75 E;  4EMK C;  4FIB A;  2X3X D;  2OTL Q;  3CME A;  3CCJ A;  3GNG A;  1IHV A;  2QTX A;  2RN8 A;  3FEO A;  3CQT A;  1JEG A;  2V8K A;  4MZM A;  1QCO A;  3VS5 A;  4J9G A;  1WHH A;  3CXC S;  2KXD A;  3EGD B;  2JM9 A;  1MGQ A;  5GAN 7;  4BI8 B;  4A4K A;  5LJ3 f;  1O9S A;  1HYO A;  1RAG B;  3CD6 Q;  2EQM A;  2RQT A;  3RKY A;  2ZPB B;  3QPH A;  2E6N A;  3OSV A;  1PNJ A;  4JPB W;  4MZP A;  1G3Y A;  4E7I A;  2CP5 A;  2LC4 A;  2VKN A;  3JCM e;  1SRM A;  4C8Q B;  4FYX B;  1VQK Q;  4HVV A;  3VU3 C;  2HL5 C;  5KYX B;  2LT1 A;  3FLG A;  1IZ6 A;  2O4X B;  4C0G A;  2R5M A;  4OMO A;  1N8R R;  1ARK A;  1VQL T;  2C0I A;  5D6Y A;  3VS3 A;  2LP5 A;  2KRO A;  3OYD A;  3VS6 A;  1FMW A;  3P8H A;  1MV0 B;  4M77 C;  4PJL A;  4L59 A;  3VS1 A;  1GL5 A;  3NGP A;  2JXB A;  3V7R A;  2ZGW A;  2E12 A;  2P0K A;  3CPW S;  3C94 A;  1FMV A;  1V76 A;  3NPF A;  1PC0 A;  1VQO Q;  2PTK A;  1Q7Y U;  4MMK A;  3H9N A;  3MEU A;  2K5I A;  3RMS A;  1KQ2 A;  5KH6 A;  3EFO B;  2KSS A;  1I5O B;  1T3S A;  2ZPH B;  1RAB B;  1UEB A;  3CCU T;  4PJN A;  4PJO G;  1G3W A;  1K76 A;  1UGV A;  3PNW C;  4CC7 A;  2HNI A;  2GGR A;  4RTV A;  4K11 A;  1B34 A;  3L2Z A;  3EGX A;  4IUU A;  1H8K A;  4FL6 A;  4MDX A;  2RQW A;  1HXD A;  5IHI A;  1PD1 A;  1VQP Q;  1QP3 A;  1SKU B;  7AT1 B;  1PG5 B;  2XG8 D;  1LJO A;  1VQL A;  2CT4 A;  1ZSZ C;  2SEM A;  3R6N A;  2P0Q A;  2DL8 A;  2DTH A;  4M7A E;  3QSU A;  5GAM h;  2COY A;  1TTH B;  4JJN K;  1RLQ C;  2X51 A;  1AWX A;  3CCM Q;  4JRP A;  1VQN Q;  3FB9 A;  3MP1 A;  1AEY A;  2DJZ A;  2OJ2 A;  2W10 A;  1SF9 A;  1SSH A;  2AZS A;  5EG2 A;  4AMC A;  2HQH A;  2JTF A;  2YXY A;  5KYW A;  4DBQ A;  4J9I A;  2LNV A;  1U1T A;  2YRC A;  5CQX A;  2GQV A;  2EYQ A;  1BI0 A;  3CCU A;  1D3B B;  1HK9 A;  1MMA A;  4N4G A;  4ZGE B;  3LYI A;  2DTO A;  1M2O A;  5GAN 3;  2J06 A;  4CRI A;  2EPD A;  2RO0 A;  1YJW A;  1N8R U;  4M78 G;  5D6W A;  2K4Y A;  4C8Q C;  2MCN A;  2DD4 A;  3M57 A;  4Y92 A;  2GQI A;  4LDW A;  2XU8 A;  3MCA B;  2DAQ A;  2RK2 A;  2M51 A;  1PKT A;  2M16 A;  1Q86 R;  4IIM A;  1VQ9 Q;  1ZLM A;  3LWH A;  3HRT A;  3GOX A;  3CCQ T;  2X4X A;  3CCR A;  3FJ5 A;  1I5L A;  1ABO A;  1C0M A;  2G3R A;  1EX4 A;  1F1B B;  1YJ9 T;  1AWJ A;  1G8X A;  2LQW A;  5L23 A;  3OS2 A;  3BE3 A;  2LQK A;  4P5N A;  2IVW A;  2RJD A;  1CKA A;  1GCQ C;  2EKH A;  2KQW A;  2RQV A;  3F70 A;  4ZGD B;  1DJ7 B;  3C4S A;  4J8O A;  1TUC A;  4B9X A;  4XU3 A;  1KQS P;  4KBM B;  3CBM A;  2V26 A;  3CCE T;  2BZX A;  1HJD A;  3UA6 A;  1JJ2 P;  1K9M C;  5GJV B;  2QQ9 A;  2PVG B;  4AFS C;  1M1K C;  4F04 B;  1X2K A;  3R6O A;  2QYZ A;  2MIO A;  4ZTF A;  2K6D A;  2VC8 A;  8AT1 B;  4J9E A;  3E19 A;  3HSB A;  1QVG P;  4AG2 C;  2MOX A;  2OTJ T;  3JCM W;  1TOV A;  4OP0 A;  3TQ7 P;  9ATC B;  2E6Z A;  3QZ5 B;  1OOT A;  3CCQ A;  3LGL A;  3P8D A;  2K2M A;  2MYS A;  1TU0 B;  1NM7 A;  2RJE A;  1Z9Q A;  4ZN1 A;  1YJ9 A;  2HQE A;  4Z89 A;  3X26 B;  1KFZ A;  1PHT A;  4BB7 A;  1H3Z A;  3M0T A;  1ZA1 B;  4M7D F;  3GBQ A;  3G4S Q;  3LWI A;  4A4H A;  1XJW B;  1IB8 A;  4Z88 A;  1Q95 G;  1UGR B;  2DBM A;  3N5B B;  4J9H A;  3CCE A;  1GBQ A;  1BI3 A;  4LD6 A;  2ZPF B;  3DB4 A;  4J7F A;  4FCY A;  2CP0 A;  5EC7 A;  5GAN h;  5GAN j;  3QBY A;  2E65 A;  4FSS A;  1K8A R;  3OSS C;  4BDY A;  2EQK A;  2BKD N;  4M7D C;  4GLM A;  1WIE A;  2QAZ A;  1UE9 A;  1Q86 U;  1SPK A;  5FU7 C;  2ZPG B;  2O31 A;  5FRN A;  1KK7 A;  4PJO E;  3QWY A;  2KI7 A;  3Q1J A;  2CT3 A;  2H3E B;  4RG8 A;  3I56 Q;  2X4J A;  3VS4 A;  4ELZ C;  5GAN 8;  3GPL A;  3I9Q A;  4IIO A;  3RES A;  3SB2 A;  3DB3 A;  2DYB A;  3JB9 F;  1ZBX A;  1X6O A;  3JCM b;  1LNX A;  3LLR A;  4OMF B;  3GLX A;  3M54 A;  4Y91 A;  3MEW A;  1KC8 C;  4M78 B;  1VQM T;  2XHC A;  2B86 A;  1M3B A;  4RTY A;  1HD3 A;  1VQ8 Q;  1V1C A;  1JU5 C;  3HTR A;  1ACM B;  4HCZ A;  3LX7 A;  3A98 A;  1W2B S;  3L2R A;  2PZ1 A;  1M1F A;  3EG0 A;  1MV3 A;  1IO6 A;  2MPX C;  1R8O B;  2DM1 A;  4C92 E;  2ZPI B;  1ZX6 A;  2XI9 A;  1Z9Z A;  3O5Z A;  3OB9 A;  3M0R A;  3MKD A;  1WQW A;  4FSX A;  1NLO C;  5C0M A;  1W70 A;  4PNO A;  4FYY B;  3HL8 A;  5GAM f;  2ZAE A;  3OY9 A;  3MP8 A;  3CC7 Q;  1VQ7 T;  1NG2 A;  2DL5 A;  5KCH A;  2R5A A;  1BU1 A;  1WHL A;  4LXC A;  2FYK A;  4C92 F;  1VYV A;  3A5Z B;  3D7S B;  3JCM c;  3QDR B;  1KJW A;  4HVU A;  2E10 A;  2NLU A;  1B34 B;  2DF6 A;  2RK1 A;  3JB9 D;  2QQA A;  3EGX B;  4II1 A;  1VQM A;  4NOY A;  1M90 R;  1K8A U;  1U3O A;  2VGM A;  4RKU E;  1G83 A;  1VA7 A;  3EFS A;  2CSI A;  3OYF A;  2ENM A;  2COW A;  2VXE A;  3M9Q A;  1M8V A;  2CH4 A;  4A4G A;  2QG9 B;  2DL4 A;  1KHI A;  1SRL A;  3CC4 T;  3CPF A;  1Y0M A;  2D9T A;  2E3I A;  5IHN A;  1WGS A;  3SFM A;  1GXI E;  5A0D A;  1H3H A;  3QHS A;  1GRI A;  2DVE A;  2DZ9 A;  5CKB A;  1I81 A;  5KCO A;  2MAM A;  2E3H A;  1VQK T;  1AT1 B;  2SRC A;  2ESW A;  2YUO A;  1AWW A;  3JB9 I;  1VQ6 T;  1YCY A;  5D7U A;  1ZHI A;  2YUP A;  3I55 Q;  2JTE A;  1QLY A;  2KK4 A;  1TWB A;  2CZ1 B;  3EG9 B;  2DET A;  3VS7 A;  2QEX T;  1M30 A;  2EVR A;  2KNB B;  2WSC E;  4M7A G;  1ZUU A;  4ZN3 A;  4QQ6 A;  4C92 D;  4JUV A;  2CKK A;  3SEM A;  4M78 C;  2LMJ A;  3L2W A;  3JCM P;  5IXF A;  2KVQ G;  1JXO A;  4HXJ A;  1MHN A;  2VXF A;  3QYH B;  2FRY A;  2PNI A;  4KGV B;  1RI0 A;  5CKH A;  4D8D A;  3OBW A;  5FW9 A;  5LJ5 e;  4KGX B;  1JJ2 A;  3CD6 A;  2CP7 A;  5AT1 B;  3EG3 A;  3L42 A;  3V7S A;  2DL3 A;  2BIV A;  2PUK B;  1N6A A;  2XDP A;  2DXC A;  4N0A C;  4A54 A;  3X28 B;  4EMH A;  2M0Y A;  3OYE A;  1VQK A;  2KRS A;  2KBT A;  4R55 A;  3JRZ A;  3UWN A;  4QT7 A;  2CUB A;  4IUV A;  3CME T;  1WYX A;  1R77 A;  1NEB A;  1N27 A;  1Y57 A;  2LDM A;  4LDV A;  1YCS B;  3M4G A;  1E6G A;  4M75 B;  1LCK A;  3A8M B;  2QEX A;  4CC4 B;  2JOY A;  4OVA A;  3H0F A;  3X24 B;  2E4H A;  1NE8 A;  5GAN 4;  3RBB B;  2RJF A;  1K9A A;  4AG1 C;  3CMA Q;  2D6F A;  1WHK A;  2WSF E;  1VQO A;  1UUE A;  1FX7 A;  5GAN f;  1KSW A;  5A2Q E;  2LVM A;  5KE2 A;  1K73 C;  1S72 Q;  2L89 A;  4PKC C;  3E1S A;  1AWO A;  1PD0 A;  3ULR B;  1NLP C;  3G6E T;  4O6J A;  3EG1 A;  5DLO A;  1YNZ A;  4M77 E;  2DRM A;  5CIU A;  5GMK e;  3TU4 K;  1K1Z A;  3V8J A;  1QW1 A;  3VV0 A;  2EGA A;  1AD5 A;  4C92 A;  2COZ A;  2AKK A;  2LCL A;  3OBY A;  5HY6 A;  2D0N A;  2DIQ A;  2HCK A;  1EIF A;  5HKC A;  2OAW A;  4A63 B;  1QWF A;  4M77 F;  1AZE A;  1OYX A;  2RQR A;  1YFN A;  3OS1 A;  3H8Z A;  2XKO C;  1UEC A;  5CCA A;  2YRV A;  1QVF A;  1RLP C;  2DNU A;  3CCS T;  4UC4 A;  4LE9 A;  2J05 A;  3HRS A;  3HRU A;  1UTI A;  1N5Z A;  2DJQ A;  3OW2 P;  2FVU A;  4PLL A;  1IGU A;  3PT9 A;  4PL6 A;  1NEG A;  3M0S A;  1TUD A;  2W0Z A;  4OMM A;  3G6E A;  1RAC B;  4C5I A;  3HP9 A;  4OB3 B;  2JMA A;  4J9F A;  2QA4 Q;  2IIM A;  3PVQ A;  1RL2 A;  3JCM V;  1WFW A;  3THK A;  3PTA A;  1KD1 R;  4M7A B;  4EIK A;  2YUQ A;  1WHJ A;  5FU6 C;  1M8M A;  1M9S A;  5GAO r;  3C0C A;  3C12 A;  3JB9 G;  4PJM A;  2XDB A;  5M9O A;  2WAC A;  3BDU A;  4BD3 A;  4M75 C;  3BY7 A;  5LJ3 d;  4MDW A;  4F7U F;  3CCV Q;  1V29 B;  3PE0 A;  5GAM g;  1Y96 A;  5HK0 A;  1S1N A;  2XD0 A;  1WPY A;  1D1A A;  4IUQ A;  2E41 A;  1VQ5 T;  4JJB A;  3NFC A;  3BDL A;  2HMA A;  1FXX A;  1B07 A;  4JJD A;  4M77 D;  2LQ8 A;  1YJW T;  1UDL A;  2A7Y A;  3CCS A;  1NJI R;  1K0X A;  3M0P A;  1X69 A;  1I8F A;  2L3Q A;  1UHC A;  2DVJ A;  2FHD A;  1VOM A;  5GAM j;  2CS7 A;  3CCR T;  2E5Q A;  2F69 A;  3SWN A;  1C1A A;  2YT6 A;  3CCJ Q;  5LJ3 e;  4DOV A;  1YI2 Q;  1YWO A;  3RMQ A;  1T0H A;  3CXC A;  2HEQ A;  1X27 A;  4C8Q F;  4E7L A;  2PVD B;  1PRM C;  2LJ3 A;  4L6V 5;  4C92 G;  1X6G A;  2KYM A;  2VGN A;  4B9W A;  4QVC A;  2RI3 A;  4HT9 A;  4J5Y A;  5LJ5 h;  5LJ5 j;  1YJN Q;  4QKU A;  1YIT Q;  3OYK A;  4EMK A;  1Q81 C;  1VQ5 A;  3RDV A;  3G71 T;  3VYH B;  1NBE B;  3URG A;  2DKG A;  2QI2 A;  3PMI A;  3G4S A;  3OA6 A;  2L5Q A;  5J26 A;  1WXU A;  5DLQ E;  2XMF A;  3CCL Q;  4HKE A;  2JNG A;  1M2V B;  1ZUK A;  2O01 E;  2NUP A;  5KYY B;  3J81 E;  2GFA A;  3M4Y A;  4ORZ A;  3MEA A;  3OYB A;  1KD1 U;  3VYG A;  2P84 A;  4QVD A;  3PMT A;  2OAU A;  1WZO A;  2ECZ A;  2Z0W A;  2DD5 A;  3EGU A;  3OMC A;  1MUZ A;  3NTH A;  3MHX A;  3REB B;  1T0J A;  1I1J A;  1N9S A;  3RKX A;  1BYM A;  4M7A C;  3V8K A;  4FYV B;  4HT8 A;  5I21 A;  4E6R A;  2E1H A;  5CKD A;  1UB4 A;  1WA7 A;  3PFS A;  1Q82 R;  4OF1 A;  4C8Q D;  3OQ5 A;  2D1X A;  4LNP A;  4ZGJ B;  4M77 A;  2DL7 A;  5FLX E;  2DLP A;  3JB9 J;  4KH1 B;  3I56 A;  3VRY A;  4Y28 E;  2HL3 A;  4E7K A;  1XOV A;  3G71 A;  4DBR A;  1NJI U;  2RD1 A;  2LNH B;  1PSF A;  2RNA A;  1JBM A;  3ASK A;  4QW2 A;  4HCK A;  4E7J A;  3CEY A;  3LW5 E;  1N9R A;  4ME7 A;  1VQL Q;  3VUZ A;  5C6S A;  1BB9 A;  4M7D E;  4MZT A;  1OUL A;  1WJR A;  2RHU A;  2NUT A;  5GAN g;  1FMK A;  2FPF A;  3E2U A;  4J6Y A;  2JTM A;  2A08 A;  1OPL A;  3EHQ A;  1BI1 A;  1RAE B;  1QMC A;  2L3R A;  3WVE B;  4NS5 A;  3RKW A;  2K9G A;  2EYX A;  2HKQ B;  3JCM h;  4PJO B;  2G6F X;  5GAO p;  4F7U A;  3O8V A;  1H64 1;  4HVW A;  1ZSZ A;  3FIF A;  2JVV A;  2FZC B;  1D1C A;  4RCC A;  3UDC A;  1ABQ A;  1QQJ A;  4PLI A;  3V7C A;  2R58 A;  2LQN A;  3OYM A;  2JMC A;  4QVZ A;  5I2S A;  3ZFJ A;  5CK9 A;  1BKB A;  3CC7 A;  3I55 T;  4LDU A;  2K3Y A;  4BE1 A;  4QQG A;  1J3T A;  1Q7Y C;  1YIJ Q;  1H92 A;  4GBQ A;  2OX7 A;  2FG0 A;  1RAF B;  4LN2 A;  2QGF B;  2LJ1 A;  3CC2 T;  2KMT A;  1QKW A;  3EGD A;  2EGE A;  3OYI A;  1ZUY A;  1G5V A;  1OX9 A;  4A53 A;  4MML A;  3C95 A;  2XDD A;  2DXB A;  2AHJ B;  3INZ A;  5DM7 R;  1WHG A;  4LD9 K;  3G1J A;  2KDS A;  4ESR A;  1XNI A;  2EWN A;  4DQ2 A;  4X9C A;  3MEV A;  4HA8 A;  5CAI A;  1PKS A;  2YDL A;  3TRE A;  2EJ9 A;  3PIP A;  3OW2 A;  2O9S A;  2I2L A;  1RAH B;  4J9D A;  4C8Q A;  2F5K A;  2JS0 A;  3JB9 H;  5KYX A;  3OYN A;  2O4X A;  3VS2 A;  3TEE A;  4A4F A;  3NTI A;  1QVF P;  4FU6 A;  4D8K A;  5J39 A;  2NWM A;  3H0H A;  4M7D D;  2YSQ A;  1YHQ Q;  4Z8A A;  1OX8 A;  2HD0 A;  4M77 G;  4RTW A;  2K57 A;  3RUX A;  5ECA A;  1CSK A;  4JS5 A;  5I22 A;  1UFF A;  3A8H B;  3I55 A;  2VAS A;  4AFQ C;  2DE0 X;  2QQS A;  1GCQ A;  4E7S A;  4HCC A;  2F2V A;  1C6V X;  3CC2 A;  1G3S A;  3FDR A;  4RMO A;  3I5R A;  1CKB A;  3VS0 A;  3CCQ Q;  1SHF A;  1IGQ A;  1YP5 A;  2V8J A;  3BFM A;  4OB1 B;  2RF0 A;  1GFC A;  2A36 A;  2F2X A;  1YJ9 Q;  3M59 A;  2QTV A;  1N8R C;  1KQS S;  1RAA B;  4E7Z A;  3X20 B;  1X43 A;  5GMK m;  1VIE A;  3OYA A;  4OMP A;  4PJO C;  3S6W A;  4C5H A;  1JJ2 S;  3OYC A;  1M4Z A;  3EH1 A;  4F7U G;  5IXB A;  4E7H A;  3OS0 A;  3MET A;  3TVT A; 
#chains in the Genus database with same CATH homology
 1QP3 A;  2K3X A;  2D6F A;  2WSF E;  1W4S A;  3QG1 A;  4XTX A;  1VQO A;  2P0P A;  4ZTJ A;  4ATO A;  2XG8 D;  1LJO A;  1VQL A;  1FX7 A;  4JRI A;  2K5F A;  4FT4 A;  5LJ5 f;  2F5T X;  2OTL T;  1QVG S;  5GAN f;  2PUO B;  3L1A A;  4C0Z A;  5GAO m;  2P0Q A;  3LGF A;  4IUP A;  4C0D C;  2JZ2 A;  2DTH A;  2LVM A;  5KE2 A;  5GAN 2;  2CZ7 B;  5A2Q E;  4NL3 A;  1K73 C;  4M7A E;  3QSU A;  2L89 A;  4PKC C;  5GAM h;  1VQ4 T;  1LOJ A;  3E1S A;  4JJN K;  4XQ3 A;  4JRP A;  2EFI A;  3G6E T;  3FB9 A;  4O6J A;  3MP1 A;  2DJZ A;  2VYT A;  5DLO A;  5AYF A;  3CD6 T;  2BUD A;  2X4W A;  4M77 E;  5CIU A;  5EG2 A;  2K5L A;  2JTF A;  4IUR A;  5GAN 6;  3ME9 A;  5GMK e;  3TU4 K;  5GAO q;  3CCE T;  3V8J A;  1QW1 A;  3VV0 A;  2B8A A;  3HPW A;  2LNV A;  4M78 F;  3HFO A;  1U1T A;  4OGE A;  5CQX A;  2M1H A;  3JCM Q;  3L2U A;  1NZ9 A;  2GQV A;  2EYQ A;  3CBO A;  1BI0 A;  4C92 A;  3CCU A;  1D3B B;  1HK9 A;  2EJF A;  2LCL A;  1U1S A;  3OBY A;  5HY6 A;  2XK0 A;  2ZPE B;  2DIQ A;  5LJ3 g;  3S3N A;  4N4G A;  4ZGE B;  1UGP B;  3JCM J;  4M7D A;  3LYI A;  3A8O B;  1EIF A;  2DTO A;  4GLK A;  5HKC A;  4C8Q G;  4O5V A;  4C92 B;  5GAN 3;  2QQR A;  3GP8 A;  3OYH A;  4KUD K;  1P92 A;  4CRI A;  5CQY A;  2QQB A;  3M58 A;  4M77 F;  1OYX A;  5FRM A;  2RO0 A;  4EMK B;  1YJW A;  3QXE B;  4OGC A;  3OS1 A;  1N8R U;  2X35 A;  2OTJ A;  4M78 G;  5D6W A;  2MI6 A;  2K4Y A;  3H8Z A;  4KUI A;  2XKO C;  4C8Q C;  3UPU A;  1Q82 U;  3JCM X;  4X34 A;  2DD4 A;  3M57 A;  2X4Y A;  4LDW A;  5CCA A;  2XU8 A;  1I4K 1;  1X01 A;  3MCA B;  1NPR A;  2YRV A;  2QA4 T;  3QYG B;  1QVF A;  1XQH A;  2DAQ A;  2RK2 A;  2MWO A;  2ZCF B;  3CCS T;  3QO3 A;  4UC4 A;  4JDS A;  2OTL A;  3PGG A;  4V2S A;  4DA4 A;  5HK3 A;  3EAE A;  3J7A F;  2M16 A;  4C5G A;  3HRS A;  3HRU A;  3LWH A;  1VQO T;  3HRT A;  3GOX A;  3CCQ T;  1XTD A;  2X4X A;  2M9U A;  1VQ4 A;  3CCR A;  3V8L A;  1BI2 A;  2FVU A;  4PLL A;  2PU9 B;  1I5L A;  3PT9 A;  4PL6 A;  2G3R A;  5LJ3 h;  2MF2 A;  5LJ3 j;  3G6E A;  3SD4 A;  1YJ9 T;  1K73 U;  2WSE E;  4C5I A;  4L5G A;  4M7A A;  2VUB A;  3OS2 A;  3HP9 A;  4OB3 B;  1Y7X A;  5GAN 5;  2LQK A;  2IVW A;  4P5N A;  2RJD A;  1RL2 A;  5GAO n;  3JCM V;  2KQW A;  5I2M A;  4PJO F;  4XTV A;  3F70 A;  3PTA A;  3QUI A;  4ZGD B;  1DJ7 B;  5A0L A;  4M75 G;  3C4S A;  4M7A B;  1KHC A;  1IRE B;  4J8O A;  5FU6 C;  4B9X A;  4J83 A;  4XU3 A;  4KBM B;  1M9S A;  3CBM A;  3C12 A;  5CVI A;  2EIF A;  3SDZ A;  5GAO r;  1QVF S;  3JB9 G;  1K8A C;  2XDB A;  1VQP T;  1OZ2 A;  5M9O A;  2A3L A;  2WAC A;  3BDU A;  4M75 C;  3BY7 A;  4J6X A;  1OZ3 A;  4MDW A;  5LJ3 d;  4BD3 A;  4F7U F;  3CMA T;  1V29 B;  5GAM g;  4GY5 A;  1K9M C;  1Y96 A;  2QQ9 A;  2FB7 A;  2PVG B;  5HK0 A;  1WNL A;  1M1K C;  1Q86 C;  1JRI A;  1YBY A;  3R6O A;  2FL7 A;  2XD0 A;  1WPY A;  4ZTF A;  3JCM f;  4IUQ A;  1Y96 B;  4XK8 E;  3S3O A;  2E41 A;  2VC8 A;  1S72 T;  1VQ5 T;  1VQN A;  2DXU A;  3NFC A;  1M90 U;  1UGQ B;  3BDL A;  1FXX A;  3E19 A;  3HSB A;  5FRO A;  2R57 A;  4M77 D;  2LQ8 A;  2QA4 A;  3CCM T;  1QVP A;  1YJW T;  3JCM W;  2OTJ T;  1TH7 A;  1VQN T;  2A7Y A;  2DPP B;  3CCS A;  2LT4 A;  1U8R A;  4IKF A;  4OP0 A;  4XTW A;  4N4I A;  2RHX A;  2DK3 A;  1BIA A;  2QDY B;  2RHZ A;  2E6Z A;  3DKM A;  3QZ5 B;  4X9D A;  4FT2 A;  1KD1 C;  3CCQ A;  3LGL A;  3P8D A;  4WF2 A;  3QZ9 B;  4N4H A;  3HFN A;  1I8F A;  1O75 A;  2JN0 A;  2RJE A;  5GMK l;  2EJG A;  2FHD A;  2HAX A;  3GNF B;  4M78 E;  3CCV A;  1UGS B;  1VUB A;  4ZN1 A;  4EDU A;  1YJ9 A;  4C5E A;  5GAM j;  2HQE A;  2CS7 A;  3X26 B;  2DZC A;  3OYI A;  3ER0 A;  3QKJ A;  4BB7 A;  3CCR T;  2E5Q A;  2F69 A;  4YTL A;  3SWN A;  1YJN T;  1H3Z A;  1KG1 A;  5LJ3 e;  4DOV A;  1YIT T;  4M7D F;  2EKO A;  2DEQ A;  3FJP A;  3M5A A;  4BE0 A;  5IAY A;  3LWI A;  4A4H A;  4JLI A;  3SWN B;  3M55 A;  3RMQ A;  3WXM B;  3CXC A;  3FC3 A;  2VV5 A;  4EPC A;  4C8Q F;  4E7L A;  1UGR B;  3N5B B;  2PVD B;  5GAO l;  4FM4 B;  4Z02 A;  4PJO D;  2LCC A;  1D3B A;  1VQP A;  4L6V 5;  3CCE A;  4C92 G;  1BI3 A;  3BW1 A;  4LD6 A;  3CMA A;  2VGN A;  2ZPF B;  4B9W A;  3DB4 A;  4QVC A;  5GAM d;  4J7F A;  4A4E A;  2RI3 A;  1BIB A;  4HT9 A;  1NJI C;  3E9G A;  4J5Y A;  5LJ5 h;  4BY6 B;  5LJ5 j;  4M7D G;  5GAN h;  5GAN j;  3HHT B;  2E65 A;  2JUF A;  3QBY A;  3DLL A;  2QXF A;  4C92 C;  2CZ6 B;  1VQ9 T;  3OSS C;  4BDY A;  3OYK A;  4EMK A;  1S72 A;  2EQK A;  1Q81 C;  1VQ5 A;  2BKD N;  4OB2 B;  3KXT A;  4KUL A;  3G71 T;  1K9M U;  4M7D C;  2E70 A;  1M1K U;  3VYH B;  1Q86 U;  3URG A;  3CCM A;  2LTO A;  2GFU A;  3RIR A;  2L8D A;  5IT9 E;  1YI2 A;  1X75 C;  2DKG A;  5DY9 A;  2QI2 A;  3PMI A;  3G4S A;  4J7I A;  5FU7 C;  4JRK A;  3OA6 A;  4XAX B;  2L5Q A;  5D6X A;  5J26 A;  5DLQ E;  1ZQ1 A;  5LJ5 d;  2CGH A;  2DIG A;  2RI5 A;  2ZPG B;  3KBG A;  5CO7 A;  5GAN d;  4HKE A;  5FRN A;  2JNG A;  3H6Z A;  4E47 A;  3PIO A;  4PJO E;  2H3J A;  3JSC A;  3Q1J A;  2O01 E;  1VQ7 A;  4JS4 A;  3J81 E;  1Y71 A;  2P4T A;  2GFA A;  4RG8 A;  3M4Y A;  4RG2 A;  3VKI A;  2X4J A;  4BDZ A;  1W2B A;  4ELZ C;  3MEA A;  5GAN 8;  4BI3 A;  4M75 F;  3GPL A;  2EQJ A;  1Y07 A;  3JAM E;  3OYB A;  3A8G B;  5CKE A;  1JB0 E;  3VYG A;  1YJN A;  1KD1 U;  2DO3 A;  4QVD A;  3PMT A;  3RES A;  4C0F A;  3SB2 A;  4F7U E;  1G3T A;  2OAU A;  1YIT A;  3CCV T;  3DB3 A;  5GAM e;  3WVD B;  2MMP A;  3JB9 F;  2DD5 A;  3OMG A;  1ZBX A;  2RA2 A;  1X6O A;  3OMC A;  4M78 A;  4BUG A;  1LNX A;  3LLR A;  4OMF B;  5CR2 A;  4JLG A;  3JCM b;  3NTH A;  3MHX A;  2HBP A;  3GLX A;  1N9S A;  2DTI A;  3M54 A;  3RKX A;  4M7A C;  1BYM A;  2YLB A;  4Y91 A;  3MEW A;  3V8K A;  4LDX A;  3G7Z A;  1KC8 C;  4HT8 A;  4M78 B;  5I21 A;  3EFR A;  4RCB A;  2E1H A;  4D6W A;  5CKD A;  1VQM T;  4IUT A;  2YHT A;  3CCL A;  1UB4 A;  3PFS A;  2XHC A;  4OF1 A;  4C8Q D;  3OQ5 A;  3TCJ A;  4ZGJ B;  1KQS A;  4M77 A;  5FLX E;  3JB9 J;  2DXT A;  2C06 A;  2EAY A;  3CC4 A;  1VQ9 A;  4HCZ A;  3I56 A;  2E64 A;  3LX7 A;  4M78 D;  4Y28 E;  5GAN e;  1W2B S;  2GCX A;  3L2R A;  4E7K A;  4M77 B;  1M1F A;  1OI1 A;  1XOV A;  3ZEH A;  3G71 A;  1KQ1 A;  3MO8 A;  3MP6 A;  1NJI U;  4N0A A;  4XTZ A;  4BE2 A;  1R8O B;  2PQW A;  2RD1 A;  3UT1 A;  1PSF A;  1JBM A;  3ASK A;  4QW2 A;  4C92 E;  2ZPI B;  4E7J A;  3L2V A;  3CEY A;  3LW5 E;  1N9R A;  2XI9 A;  4ME7 A;  3VUZ A;  1Q81 U;  1WJS A;  5C6S A;  4Q5W A;  1QVG A;  3CCJ T;  3GF5 A;  4M7D E;  3RER A;  5FU6 B;  1FWZ A;  3OB9 A;  4MZT A;  1YI2 T;  1VQ6 A;  3G4S T;  1WQW A;  4FSX A;  3OYJ A;  3T9N A;  5C0M A;  3OS5 A;  4PNO A;  3HL8 A;  5LJ5 g;  1WJR A;  2RHU A;  5GAM f;  3DLM A;  5GAN g;  4C8Q E;  3OY9 A;  3MP8 A;  4J6Y A;  2JTM A;  1VQ7 T;  1Q82 C;  3E9F A;  3M56 A;  4PJO A;  3KUF A;  4KT0 E;  1WQ7 A;  5KCH A;  1BI1 A;  2R5A A;  2HQX A;  2L3R A;  4ELY C;  2FYK A;  3WVE B;  4BI4 A;  4C92 F;  4M75 D;  4NS5 A;  3A5Z B;  3RKW A;  3JCM c;  2KAF A;  3QDR B;  3JCM h;  4J6W A;  4PJO B;  5LL6 S;  2E10 A;  3SWN C;  1VIF A;  1YIJ T;  2RHY A;  2NLU A;  2RB6 A;  1B34 B;  2RK1 A;  3JB9 D;  2QQA A;  4F7U A;  3A8L B;  3O8V A;  1NPP A;  5GAO p;  1H64 1;  4II1 A;  3FIF A;  1VQM A;  1QP2 A;  2JVV A;  4NOY A;  5L8R E;  2PVO B;  1K8A U;  2ZZD A;  3QJY A;  1SSF A;  4RCC A;  3UDC A;  2VGM A;  4PLI A;  3V7C A;  4RKU E;  4F7U B;  2R58 A;  3J80 E;  3OYG A;  2GF7 A;  2RH2 A;  4BY6 C;  5KE3 A;  3CCL T;  3EFS A;  3OYM A;  4C0D B;  1KC8 U;  3OYF A;  4QVZ A;  4EMG A;  5I2S A;  3ZFJ A;  5CK9 A;  2VXE A;  1BKB A;  4QQD A;  3M9Q A;  3JCM d;  3CC7 A;  4DOW A;  1M8V A;  3I55 T;  4A4G A;  3NTK A;  4LDU A;  2K3Y A;  4BE1 A;  3QJ6 A;  1KHI A;  3CC4 T;  4OB0 B;  4QQG A;  3CPF A;  1Q7Y C;  2D9T A;  3I56 T;  3HKS A;  2D0Q B;  3QII A;  3VUB A;  2EQU A;  1WGS A;  4M75 E;  3SFM A;  4EMK C;  4FIB A;  1GXI E;  2CYZ B;  3CBP A;  5A0D A;  4XTU A;  3CME A;  4R56 A;  3CCJ A;  3CC2 T;  3QHS A;  2KMT A;  2DVE A;  2RJC A;  2MWP A;  2QTX A;  3GNG A;  3VJP A;  3FEO A;  3ZBD A;  2DZ9 A;  5CKB A;  1I81 A;  2V8K A;  5KCO A;  4MZM A;  5GMK i;  1G5V A;  2MAM A;  2RM4 A;  4A53 A;  4M7A F;  4MML A;  3C95 A;  2XDD A;  1VQK T;  3OYL A;  3CXC S;  2DXB A;  2AHJ B;  4BAC A;  3INZ A;  2YLC A;  3JB9 I;  1VQ6 T;  1YCY A;  5DM7 R;  4NL2 A;  4LD9 K;  1ZHI A;  2KDS A;  2V8I A;  1XNI A;  2EWN A;  4DQ2 A;  1MGQ A;  4X9C A;  5GAN 7;  1YHQ T;  1M90 C;  2LX9 A;  3MEV A;  4BI8 B;  2KK4 A;  2M0O A;  5LJ3 f;  2CZ1 B;  4HA8 A;  4A4K A;  1O9S A;  5CAI A;  3TRE A;  2EQM A;  2EJ9 A;  3PIP A;  2QEX T;  3OW2 A;  2I2L A;  3RKY A;  2CZ0 B;  1VQ8 T;  4M7D B;  2ZPB B;  4C8Q A;  2F5K A;  3QPH A;  2WSC E;  5CKF A;  2E6N A;  3OSV A;  3CPW A;  4MZP A;  3JB9 H;  3OYN A;  4M7A G;  1YIJ A;  1G3Y A;  4E7I A;  2O4X A;  3TEE A;  4A4F A;  4ZN3 A;  4XU1 A;  3GIB A;  4QQ6 A;  2LC4 A;  3NTI A;  4C92 D;  4JUV A;  3JCM e;  5FU7 B;  4C8Q B;  2CKK A;  3LH0 A;  4FU6 A;  5J39 A;  2RI2 A;  3FRN A;  5A0G A;  3VU3 C;  4M78 C;  2LT1 A;  4M7D D;  3FLG A;  2O4X B;  1IZ6 A;  4C0G A;  2XID A;  3L2W A;  3AHU A;  2R5M A;  3JCM P;  2HD0 A;  4M77 G;  1VQL T;  5D6Y A;  2KVQ G;  2K57 A;  1MHN A;  3RUX A;  2VXF A;  3QYH B;  3OYD A;  4JS5 A;  3A8H B;  2Y4Y A;  3P8B B;  3I55 A;  1RI0 A;  5CKH A;  3P8H A;  3S3M A;  4M77 C;  4L59 A;  3OBW A;  5LJ5 e;  2QQS A;  1JJ2 A;  3CD6 A;  2Y4X A;  2Y90 A;  3V7R A;  3L42 A;  3V7S A;  2RHI A;  3JCM g;  2ZGW A;  3OW2 S;  3CC7 T;  2E12 A;  4HCC A;  2BIV A;  3M53 A;  2P0K A;  2PUK B;  1N6A A;  2XDP A;  2DXC A;  1WJQ A;  4N0A C;  4A54 A;  3C94 A;  3CPW S;  3CC2 A;  1G3S A;  5GMK h;  5GMK j;  3FDR A;  4XU0 A;  4RMO A;  1Q7Y U;  4MMK A;  3X28 B;  2IG0 A;  3X25 B;  3MEU A;  4EMH A;  2K5I A;  3OYE A;  1VQK A;  3RMS A;  4M75 A;  3JRZ A;  3UWN A;  4R55 A;  4IUV A;  3CME T;  1KQ2 A;  2V8J A;  5KH6 A;  2KSS A;  1N27 A;  3BFM A;  3OYY A;  4OB1 B;  1YHQ A;  2LDM A;  1M5Q 1;  2ZPH B;  4LDV A;  3M4G A;  1PSE A;  3M59 A;  5IN1 A;  3L2Q A;  4M75 B;  1AHJ B;  5J3B A;  4M7A D;  1UEB A;  3CCU T;  4PJO G;  4HCB A;  4XU2 A;  1G3W A;  4VUB A;  3A8M B;  2QEX A;  1N8R C;  4CI0 C;  1KQS S;  1VQ8 A;  2XIC A;  4XTY A;  3X20 B;  5GMK m;  3PNW C;  4TVR A;  1VIE A;  2JOY A;  4OVA A;  3OYA A;  2LRQ A;  2HNI A;  4PJO C;  3S6W A;  4C5H A;  1B34 A;  3X24 B;  3OYC A;  1JJ2 S;  1NE8 A;  3L2Z A;  1M4Z A;  2KY9 A;  4IUU A;  4FL6 A;  2K2V A;  4LDY A;  1HXD A;  4F7U G;  3MET A;  5GAN 4;  3OS0 A;  4E7H A;  2RJF A;  4MDX A;  1M1G A;  4JRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...