4MMLA

D40a hfq from pseudomonas aeruginosa
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
GHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFAQFVILLKNTVSQMVYKHAISTVVPSRPVRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Protein hfq
publication title Effect of conserved intersubunit amino Acid substitutions on hfq protein structure and stability.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17209 Hfq Hfq protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4mmlA00
3JCMh 4M77F 4M75C 4WF2A 5GMKi 4PJOD 1H641 4C8QD 3HSBA 1BIAA 4J6XA 4MMLA 4PJOB 4M77A 3SB2A 3JCMP 1N9RA 5CAIA 4M77C 2E1HA 4C92E 4EMKA 5LJ3j 4C92G 3QSUA 3FJPA 3RKXA 2E10A 4EMGA 4V2SA 1I4K1 3JCMJ 4XU1A 3RIRA 5GMKj 4J6YA 4PJOF 2QTXA 2VXEA 4A53A 2K57A 4C8QF 2DTOA 2DTIA 3BDUA 5LJ5f 4C92D 1B34B 5LJ5d 5GAN6 3HFOA 3JB9J 1KQ2A 4PJOA 3RKWA 4C8QA 2DKGA 5LJ3e 5GAOp 2YLCA 3JCMd 4JRKA 5GAN3 1X01A 5GAOn 2RD1A 1I8FA 5LJ3f 2CGHA 5DY9A 1WQWA 2VC8A 3SWNB 5GMKe 4M78E 4M7AC 5LJ5j 2EJGA 3JCMQ 2DXTA 4M7DE 1Y96A 5GAOm 3RERA 4M7DG 4M75B 4C92F 1BIBA 4X9CA 1KQ1A 1U1TA 4XTXA 3JCMc 4C92A 2YHTA 4X9DA 4EMKC 1JRIA 4C92C 1U1SA 2DZ9A 3JCMW 4DQ2A 3QUIA 3FB9A 5LJ5e 5GANd 3JB9G 4JUVA 4M78B 4M7DB 3JCMe 3HFNA 4RCCA 4HT9A 4M75E 5GAMh 5GANh 4M75G 4NL2A 4OP0A 1N9SA 3JCMf 3V7RA 4N0AA 1D3BB 3JB9D 5GAN8 4PJOC 2DXUA 4C8QC 5GAOl 2DZCA 3V8KA 4PNOA 2DTHA 3RKYA 3AHUA 1LNXA 5GMKl 4M7DF 2RM4A 4HA8A 4M75D 5LJ3g 5GAN5 3JB9H 4A54A 4F7UB 3RESA 2Y90A 3EFRA 3BFMA 4J6WA 4M78G 4M78A 4Y91A 4M7DA 3M4GA 3GIBA 4HT8A 4NOYA 1WQ7A 5GMKm 1B34A 5GAMe 5GANe 4QVCA 5GAN4 3V7CA 3JB9F 4EMHA 4M78D 3VU3C 2VXFA 4M77B 5GAMf 3JB9I 2RA2A 1WNLA 1LJOA 4XU2A 3JCMb 5GANf 4NL3A 5GAMd 4MMKA 4M7DD 4M75F 3SWNA 3INZA 4F7UE 2DJZA 3L2ZA 2FB7A 3JCMV 3L1AA 4F7UG 3V8JA 2JN0A 1YCYA 4M7AE 3QHSA 2EWNA 3QO3A 4M75A 5LJ5g 4M7AG 2EAYA 2EJ9A 4XQ3A 3EFSA 4J5YA 4JLIA 2FYKA 3V8LA 1MGQA 3BW1A 4N0AC 3JCMg 5GAMj 5GANj 1M8VA 4M77E 4M78F 3RUXA 5LJ3h 1HK9A 1I5LA 4M77G 1M5Q1 2HNIA 4XTWA 4XU0A 4C8QB 4JRIA 4M7AD 4XU3A 5GAOq 3FIFA 5GMKh 4XTYA 4M78C 4M7AB 5GAN2 4M7DC 5GAOr 2ZGWA 2E41A 4M77D 2EJFA 4XTZA 3PGGA 3BY7A 3JCMX 1Y96B 1D3BA 2DVEA 1LOJA 2I2LA 1JBMA 2RB6A 4RCBA 4F7UF 4PJOE 3V7SA 4C8QE 4QVDA 4PJOG 1WPYA 4EMKB 4C8QG 5GAMg 5GANg 4M7AF 2E65A 2E64A 4C92B 4F7UA 2DEQA 3SWNC 1HXDA 4XTVA 2YLBA 5LJ5h 5GAN7 5I21A 1I81A 1TH7A 4M7AA 5LJ3d 4XTUA
chains in the Genus database with same CATH superfamily
5DM7R 5A0DA 4FM4B 1IXDA 4AFQC 2NUZA 2KI7A 4C92G 4PK4A 1U3OA 3MEUA 3L2WA 2OAWA 1I4K1 1EX4A 3C94A 2W0ZA 2OX7A 2QQBA 1PD0A 1K9AA 1W2BS 3LH5A 2CH4W 4F04B 1K9MC 1I8FA 1UEBA 1M3BA 1ARKA 1ZA2B 2D9TA 1YJNT 3CC7Q 1S72T 2P0QA 2YWWA 1KQ1A 1HSQA 3JB9G 4JRPA 1FMKA 4X34A 4M75E 4E2FB 3I55A 4C0GA 3NGPA 3V8KA 2QG9B 2GFUA 1UFFA 2A08A 2HQHA 2VKNA 2X3WD 4PLIA 4AFZC 1PRLC 3EFRA 2ZPEB 1NLPC 5KYYB 2J6OA 2KDSA 2JW4A 3OW2S 4XAXB 1PCXA 1O9SA 2RA2A 1KQSA 2M51A 1BI0A 2Y4XA 5KCOA 2M0YA 3EAEA 3CCSA 1Z9ZA 1M1KU 1A0NB 4DOVA 1KHCA 5FWBA 1CSKA 2KY9A 4R56A 2PUOB 5HY6A 4C8QB 4XTWA 4PJJA 1WX6A 3GLXA 3OYAA 4A4KA 2XD0A 3E9FA 5GAOr 2NYSA 4M77D 3LW5E 1QWFA 2GQIA 2RB6A 3OW2A 1YI2A 3EHRA 4HCCA 3OYCA 2C0TA 1K4US 9ATCB 4MDXA 3OSVA 4FW2A 1H641 3M0QA 1TUDA 3X26B 4E7LA 3VV0A 1AWWA 4M77A 3LGLA 3LH0A 1Q86U 2XICA 3OSSC 1VQ4Q 3QSUA 1VQOA 1JJ2P 2VV5A 1X2KA 4V2SA 2XMFA 4J6YA 1XQHA 1B34B 1P92A 1ZQ1A 5LJ3e 3MEVA 3HRSA 1K9MR 5HCKA 3S3NA 2QDYB 4IIMA 2LX9A 1Q7YC 5CKHA 4Z88A 4OGCA 1RACB 2ENMA 3EG0A 4OGEA 5CIUA 4X9CA 2DD5A 3P8HA 1G3SA 3MP1A 1VOMA 4PLLA 2LC4A 3JV3A 2X4YA 2PVDB 2RHZA 3JCMf 2VVKA 2RJFA 3EG2A 5CQYA 4GLMA 1UGPB 1G2BA 4M78G 2F2VA 3EGDB 4Y91A 1N5ZA 3QYHB 3I55Q 5GAN4 3V7CA 4CI0C 1I1JA 1UJYA 2H8HA 3REAB 2AKLA 1PM3A 2DIQA 5L8RE 2LDMA 1W4SA 3S6WA 3PVLA 3QDRB 3VKIA 1R0BG 3T9NA 4RTYA 2PZ1A 1IRXA 3PGGA 3CMET 3CCSQ 1ZUYA 1LOJA 2AT1B 2LQNA 1WHKA 1YJ9A 4BE0A 1K1ZA 4OMQA 5M9OA 1HYOA 4C5EA 2V1RA 1YHQA 2E64A 3X25B 2LNVA 3WVEB 4XTVA 2JNGA 4FSSA 2QEXA 4M4ZA 1SPKA 3HTRA 2KGTA 5KE2A 3SB2A 1X6OA 1MV3A 4BACA 1T0HA 3JCMP 1UDLA 1SEMA 1K0SA 4GBQA 1D0XA 2OAUA 3M9QA 1YI2Q 2GFAA 2RJCA 1VQNT 4DOWA 3CCMT 1NEBA 1NJIC 4PJOF 3PIOA 2JJ9A 2DTOA 2DTIA 2CP5A 1WXBA 3RKWA 3LYIA 2V26A 5GAOp 1ZA1B 2K5FA 3RMQA 4O6JA 2A7YA 2MPXC 1VQOQ 4YTLA 2X3XD 3PMIA 1Q7YR 1KD1C 1Q81C 1UHFA 3QJ6A 1RAIB 3HHTB 5GJWB 1H3HA 3CCRA 2RI5A 1SG5A 2GQVA 3CPWP 4PFPA 1VQ7T 3QUIA 3E2UA 5KYWB 1OULA 1QKXA 2F69A 2YXYA 3G6EA 1PWTA 3X20B 2QAZA 3FC3A 1QP3A 4BD3A 4PKCC 3AHUA 1WHMA 2X4JA 1QVGP 4ZGJB 1YIJT 2OTJT 1VQ5T 3E9GA 4HVVA 4EIKA 1SRLA 4ESRA 4M75F 3I56A 1OV3A 4JS5A 4F7UG 4JLIA 1OX8A 2YRCA 4HCKA 1KFZA 2O9SA 4Z89A 3URGA 2D0QB 1M2OA 1PKSA 1UGVA 1ACMB 2KT1A 2NWMA 2RJDA 4E7JA 2MI6A 1V76A 2A0FB 3MP6A 5KYXB 1JB0E 2I2LA 3CCQA 2M0OA 2QQSA 4C5IA 3VS2A 1K73C 1M90U 2JT4A 2RQTA 3CCLT 1I81A 4J9FA 2BZXA 2LQ8A 4BDZA 2R58A 2C06A 3OS2A 2M02A 4AFUC 5CAIA 4M77C 2OJ2A 7AT1B 4C92E 1YJ9Q 5KE3A 1F1BB 1YHQQ 1UHCA 5IT9E 1GBRA 3EH2A 4JJCA 1M30A 3ASKA 4OMMA 2DILA 2J06A 2DK3A 1RLQC 2QEXQ 5FROA 3TSWA 5CKBA 4FCYA 2CUDA 3LX7A 3UT1A 3JB9J 2QA4A 3G4SA 4E7KA 2RQRA 2PVOB 4HVUA 1VQMT 3RNJA 1C1AA 4QT7A 1NYGA 1KD1R 3VJPA 3QJYA 1Q81R 1G3WA 2DLPA 2LX7A 2F2WA 4OMFB 4MZMA 3E1SA 4J83A 2O9VA 4RTWA 2RHIA 3CPFA 2EYWA 2EVRA 3RR6A 2DL8A 3PMTA 1N9SA 3QDFA 4C8QC 2H3EB 3CD6T 1PRMC 1G3YA 3CCRQ 4JDSA 2KNBB 1IO6A 2E5QA 4ELYC 2EYYA 3PIPA 3QG1A 2FPEA 4JJBA 3G6EQ 2YSQA 2EQIA 3I35A 2E70A 3C95A 3RMSA 4M7DD 3MO8A 1BCMA 1C0MA 1LPLA 3LGFA 2COWA 5DLQE 3JCMV 1GXIE 1G3TA 5DLOA 1X75C 2EWNA 2CP2A 1UB4A 3TEEA 3M53A 2YUNA 4DEYA 1YJWA 2DIGA 2C0OA 5CVIA 3WXMB 3I56Q 3BY7A 4OB0B 5CR2A 3JCMX 4QW2A 4KT0E 4KGXB 5HKCA 2GCXA 2JS0A 4C8QG 3TREA 1K73R 2YUOA 1GCQA 4XTUA 1O75A 2JZ2A 4B9WA 2RPNA 4KGZB 1BK2A 2CSIA 2FRYA 4MMLA 2M16A 3CCQQ 3CCEA 1RAFB 2EGEA 1VQKT 2QASA 3CXCP 2CP0A 2I0NA 3KUFA 1TXQA 4FYWB 3E19A 1QMCA 2KMTA 3CMAA 5FWCA 1T3SA 2EKHA 5GAOn 2M1HA 5LJ3f 1N8RR 3CCUA 1OU9A 1OOTA 3SWNB 1QVFS 3JCMQ 3UDCA 1G83A 3GBQA 3CCVA 3Q1JA 4ORZA 4RTUA 1YITT 2HAXA 2QDLA 1VQ6Q 2YRVA 2QA4Q 3G4SQ 3JCMW 3FB9A 2DFUA 4C0FA 2RQUA 3C4SA 2YUPA 4RG2A 2L3RA 3G71T 3OYBA 4DBHA 3KFVA 3NPFA 5EG2A 4J6WA 4M78A 1QVFA 3CCJA 1UECA 2CUBA 1YJNA 2ZPFB 1GFDA 1S72A 6AT1B 3JB9I 2QYZA 1GFCA 3M0PA 2EIFA 4PJMA 1Y0MA 1W2BP 3UF4A 2DBMA 3KBGA 1YP5A 3EFSA 1KG1A 2RI3A 4EPCA 8AT1B 2PUKB 1M5Q1 2HNIA 3A8LB 3QPHA 2YT6A 2HL5C 1M1FA 2RHXA 3A98A 2R5MA 2GTJA 2LNHB 3MP8A 1SSFA 1WLPB 1AT1B 1YJWQ 3OYLA 1TH7A 2FHDA 2PQWA 4PJOD 1BI1A 4LN2A 2E6ZA 3SEMA 3NTKA 4BB7A 3RKXA 3OW2P 2ESWA 1SSHA 2AHJB 3CC4A 2IIMA 4FSXA 2CT3A 5KYUA 1KHIA 2HQEA 2P0KA 4PJOA 2DYIA 2CREA 2K3YA 2RD1A 3QZ5B 5DY9A 3CCEQ 2BTTA 2RJEA 1ZX6A 2P0PA 2JTFA 3EGUA 4J9HA 1H3ZA 3RERA 1WGSA 4C92F 1I0CA 3CMAQ 2L3PA 1B7TA 4EMKC 2WSFE 4DQ2A 3DB4A 4KH1B 4L6V5 4RCCA 1TU0B 2DRKA 2FL7A 5CQXA 4ZN3A 2DF6A 3CCVQ 2LCLA 4N4IA 4OMPA 4A4FA 4M75D 2EKOA 2CDTA 3EGXA 5IHNA 5GAN5 3LWHA 4PJLA 1WXUA 1WXTA 1I5OB 2P4TA 1N27A 3JB9F 3EG9A 3HPWA 4M77B 2Y4YA 4F7UE 2MK5A 1IGQA 2HMAA 4M75A 1ZUUA 2ABLA 1W2BA 3CCJQ 4HKEA 3CC2T 2VUBA 3QZ9B 2MYSA 1YJNQ 2DRMA 3PNWC 1S72Q 2DM1A 4JLGA 1AZEA 2O88A 2WACA 2LZ6B 1X43A 3MJXA 3TU4K 1WZOA 4M7DC 2E41A 5GJVB 3VS4A 1D3BA 4J9BA 4RCBA 1KC8U 2KE9A 3C12A 1ZUKA 2KROA 5GAMg 2HSPA 3OYHA 2E65A 3OYYA 3OYMA 1SRMA 1ZBJA 1GCQC 5GMKi 3M56A 2K3XA 5FW9A 1H92A 4C5GA 4IUUA 2ED0A 4HCZA 2KXCA 4E47A 1VQPT 1VQ8T 2JOYA 2ZPGB 1M2VA 4XU1A 1R77A 2A3LA 4E7HA 5CKEA 4PL6A 4E6RA 2JMAA 5GAN3 1BBZA 4JZ3A 2DX1A 1WQWA 5IHKA 1M90C 4M7AC 5LJ5j 2EJGA 1AEYA 4M7DG 2MIOA 3CC4Q 3NMZC 1OU8A 2SEMA 1U1TA 4X9DA 3H8ZA 5GANd 1VQLT 4RUGA 1K76A 1BYMA 1M1GA 2LCCA 1RUWA 4ZGEB 2BE7D 1VQNA 3VYGA 1SF9A 2FO0A 3CCMA 2JMCA 2DXUA 2LTOA 2CP6A 1ZSGA 3WVDB 2D0NA 3EFOA 4QQDA 2K4YA 3QXEB 4GLKA 3M0SA 1X6GA 3MKDA 4EMHA 4IURA 2O31A 4O5VA 1VYUA 4M7AG 2LJ3A 1VQ7A 4LDWA 4TVRA 3NTIA 4J5YA 3V8LA 1IHVA 4P5NA 4M78F 2DNUA 1IGUA 4QQ6A 2O4XA 4XTYA 3A8MB 5KYNA 2DVEA 1YIJA 1MNDA 1PSFA 2ZPIB 3NHNA 4C8QE 1VQ5A 5GANg 1AD5A 3SWNC 5GAN7 5I21A 1PKTA 1GL5A 2HCKA 3I9QA 2CSQA 1XJWB 2LT1A 2YRDA 4BI3A 4AG1C 1Y07A 4ZTJA 1AVZC 2COYA 4J9EA 1UTIA 2QTXA 3VS5A 1WHJA 1X2QA 5J26A 2EGAA 2LP5A 2LJ0A 2B8AA 5FLXE 2V8IA 4K11A 5KCHA 3THKA 2XI9A 1M90R 1TSFA 2QGFB 1Y96A 1E6GA 3CCLA 5IHIA 2PNIA 1FX7A 1D1AA 3O8VA 4F16A 5J39A 4LE9A 4DBQA 3L2VA 4N0AA 2DPPB 4QQGA 1NZ9A 2KEAA 1LNXA 4ELZC 2XG8D 3JB9H 1WJSA 2GTOA 2DJQA 4ZN1A 1WQ7A 3HRTA 1VQMA 3RBBB 3UATA 1VQNQ 1LJOA 3CCMQ 1BI2A 1VQ9A 4ATOA 1VA7A 4IKFA 1TUCA 4ZNXA 3ZL7C 2JN0A 3EGDA 2FZKB 5D6YA 2LJ1A 1UGRB 2FYKA 3QBYA 3OYFA 1RAGB 2RNAA 4XU0A 1WHGA 4C5HA 2XKOC 2L0AA 3VS0A 1YFNA 3CD6A 2NLUA 2ZZDA 3U23A 2XDBA 1WA7A 1RL2A 1JBMA 2VASA 1T3LA 1VQ7Q 3ULRB 4F7UF 2VB6A 3A8GB 1TG0A 3M4YA 4R55A 1D0ZA 4EMKB 2V1QA 1NPPA 1PNJA 2QQ9A 5J3BA 5EC7A 2DBKA 3L1AA 3OYEA 3BE3A 2W10A 2ZCFB 1YIJQ 4Y28E 1IHWA 4J9GA 4J9CA 2NUPA 4N4HA 2MCNA 1OPKA 1MMGA 2NUTA 4LNPA 1VQ5Q 4EMGA 2GGRA 3RIRA 1RAHB 5GMKj 3BDUA 4C92D 5LJ5d 2DO3A 3H0HA 2VWFA 1FMWA 4LUDA 3ZFJA 2DVJA 2JXBA 2WSCE 1U5SA 5GAOm 4LUEA 1ABQA 2CT4A 3OYJA 3J81E 1MV0B 3REBB 4C92A 2KYMA 2JVVA 1NJIR 4M7DB 1Y7XA 3JB9D 3CCLQ 1S1NA 2QI2A 4WTOB 3RESA 2KBTA 5KYWA 3OYIA 1QKWA 3CBPA 5C0MA 2RH2A 1QWEA 1ZSZA 1BKBA 4IUQA 2ATCB 2O01E 3SD4A 3INZA 2FB7A 1M3CA 1Q7YU 2WSEE 5LJ5g 4E7IA 2XU8A 1MGQA 5GAMj 1YBYA 2MAMA 3SDZA 1QVFP 1VQMQ 3M57A 1I5LA 4M77G 2EGCA 3HP9A 2HEQA 1RLPC 3G71A 1OPLA 4UC4A 5ECAA 1VQ9Q 3G6ET 4M7AB 1N6AA 4L5GA 3OA6A 2PVGB 4BE1A 2X4XA 2DMOA 2BZ8A 2A37A 1R8OB 4CC4B 3DLLA 2DL3A 1OX9A 2HQXA 4LDVA 2FEIA 1PD1A 1IZ6A 2KRNA 2LT4A 3CD6Q 1BIAA 1BI3A 5KYXA 2O2OA 2XIDA 3VUZA 2RHYA 1PC0A 2K9GA 2KXDA 4LDUA 4RG8A 3SHWA 3FDRA 3L2RA 4C8QF 1OZ3A 4KGVB 4MDWA 3A8HB 3JCMd 2DETA 2FPFA 2K7AA 2E3IA 1JO8A 3GF5A 3QKJA 2PU9B 4J7IA 4VUBA 4M7DE 1QVPA 1M1KC 1WYXA 4IUTA 2J7IA 2V8JA 2ROTA 3N5BB 2DZ9A 2EQMA 5D6XA 2EYZA 3L2UA 1Y71A 1Q82U 1SKUB 2KAFA 3CEYA 4FYXB 2KR3A 2DERA 3RKYA 1D1CA 1VIEA 3BFMA 4JS4A 2HL3A 1UE9A 3X28B 2E4HA 4NOYA 3VRZA 4C0DC 2JM8A 2XDPA 1VQ6T 1NPRA 4M78D 3HRUA 3VU3C 5KH6A 2EPDA 1Q86C 1V1CA 2DJZA 1TS9A 3VS7A 4M7AE 2EAYA 1Q81U 3JCMg 5GANj 3S3MA 1U06A 2MF2A 2EYQA 3HL8A 2ZGWA 4PJNA 1IB8A 1VYTA 4D8DA 2E6NA 2K5IA 1K8AU 4CC3A 2YDLA 2CZ6B 3QYGB 2DEQA 5LJ5h 2FRWA 3G71Q 5C6SA 1EIFA 1NLOC 4BY6C 3DKMA 4DA4A 1FMVA 1JEGA 2GBQA 2OTLT 2E1HA 3CC2A 5LJ3j 1T0JA 3MPUB 3G1JA 1BB9A 4OMOA 5IN1A 4JJNK 2DXBA 3EGXB 2ZAEA 5GAN6 3HFOA 5CKFA 2DKGA 4E7ZA 4GY5A 1QW1A 1M3AA 4EDUA 1UGSB 3RDVA 4QVZA 3OQ5A 2CYZB 4RTTA 5FU6C 2L8DA 2LVMA 2QXFA 3JSCA 4M75B 3EG3A 4JRQA 1Q95G 1M1KR 1MUZA 1YWPA 3ZEHA 3VS6A 1AZGB 3JCMc 4C92C 2AK5A 4JUVA 4CC7A 1Y57A 4OB3B 1VQPA 1VQ8A 1U8RA 4FIBA 5D7UA 1D3BB 4BI8B 4ZTFA 3M0RA 2RQWA 2DTHA 2RM4A 2Y90A 2CZ1B 4J9DA 3GIBA 3X24B 2DAQA 3OYNA 4F17A 5GAMe 2F2XA 4FL6A 4PFZA 3R6NA 1Q86R 1N8RU 5GAMd 3MEWA 5I2SA 4KRTA 3L2ZA 3CCUQ 4Z02A 4RTXA 1YCYA 4DBFA 1M2VB 3MCAB 3QHSA 3CCVT 4RTVA 1VQLA 4II1A 4CC2A 3CC7T 3TCJA 1SHFA 3EH1A 1EFNA 2P84A 1MHNA 2CP3A 1UG1A 4R0KA 2LRQA 2GF7A 5FRNA 3AT1B 1JU5C 3M54A 1WDXA 2D1XA 3OYGA 1MMNA 4F7UA 3OMGA 2BKDN 3CCJT 2ZPBB 1ABOA 3R6OA 3JCMh 3NTHA 3HSBA 3C0CA 2AZVA 2DL5A 4KUIA 2A28A 2EQUA 3QIIA 3A1PA 4ME7A 2ED1A 2IVWA 1WI7A 2X9HA 4OVAA 2E10A 1KQSS 3EFOB 2QGGA 3FRNA 4A53A 5A0LA 5LJ5f 3VUBA 3F70A 2JS2A 1KQ2A 2XDDA 1I07A 2RN8A 3D7SB 1X01A 2HSEB 2FG0A 3CC2Q 3L42A 1BU1A 2HD0A 3P8DA 2P4RA 2EQJA 1AWOA 2L5QA 4FYVB 1M9SA 1M4ZA 1PHTA 4LDYA 4DEXA 3PT9A 3OYDA 2YHTA 2HBPA 4FW1A 1JRIA 4MZTA 2O4XB 2QK0A 1AHJB 2MMPA 3CMEA 5GAOl 1ZLMA 2DZCA 2DL4A 4M7DF 5AT1B 1TTHB 4A54A 3CC4T 3M5AA 4OB1B 2K5LA 4BUGA 1VQ4T 1VQPQ 1VQ8Q 5GANe 5IAYA 2HDAA 1D0YA 1K0XA 3FJ5A 1WNLA 1XTDA 4MMKA 1QCNA 4C0ZA 3I5RA 2K2VA 1OYXA 4Z8AA 3VS1A 2EJ9A 1W1FA 3BW1A 1M8VA 3UA6A 4M77E 1HK9A 2DD4A 3DB3A 4QKUA 5HK3A 2XHCA 3KXTA 2VGNA 3PVQA 5GMKh 2L89A 4M78C 1OI1A 5GAN2 2FZCB 2DE0X 2E12A 1Y96B 5LL6S 5FU7C 4OB2B 4B6MA 3OY9A 1VQLQ 3MEAA 1OQKA 4M7AF 5CK9A 1Z9QA 2DYBA 5LJ3d 5KYYA 1NE8A 4C8QD 2COZA 4E7SA 2CZ7B 1N9RA 1YNZA 2K2MA 4A63B 3PFSA 4A4EA 3I55T 1VYVA 1EZZB 3VYHB 1RAEB 4C0DB 2K57A 2OTJA 3BDLA 3OBYA 4C8QA 3GNFB 4JRKA 1CKBA 1M8MA 3H0FA 2IG0A 1ZHIA 4IIOA 2F1LA 3ME9A 4Q5WA 3UWNA 4BE2A 3CCST 4KULA 5I22A 1LCKA 2L3SA 3JRZA 1AWJA 4HT9A 1RI0A 5GAMh 2DA9A 4MZPA 1MNEA 4NL2A 2Z0WA 5AYFA 4AFSC 3J7AF 4PJOC 3EHQA 3M58A 1W6XA 4HA8A 5LJ3g 1RAAB 5CKDA 3OB9A 2AKKA 4BDYA 1QCOA 2KVQG 1OEBA 1YI2T 2A36A 4BY6B 5CCAA 1B34A 4OF1A 4RMOA 1JJ2S 1XOVA 2VXFA 4J9IA 3CMEQ 4OMNA 2NUPB 2NUTB 1TWBA 2KK4A 3H9NA 1X69A 3QO3A 1VUBA 2L3QA 4HCBA 2ROLA 2RI2A 3FEOA 3FLGA 1Q82C 1VQOT 3RUXA 4D8KA 1GCPA 3M0TA 4OMLA 1IREB 2RQVA 1E6HA 3MHXA 5FU6B 3M59A 1QP2A 2E3HA 2FZGB 2J05A 2KRMA 4KH0B 2RF0A 1X6BA 1KK7A 1MMDA 1JJ2A 1K9MU 4NS5A 5IXBA 4QVDA 4PJOG 2H3JA 2R5AA 4C92B 3G7ZA 3M0UA 1H8KA 1GRIA 2BE9B 5FRMA 4M75C 2D8HA 1JXOA 4J6XA 4J7FA 5IXFA 2KSSA 1TOVA 1ZBXA 1YN8A 3LLRA 2JTMA 3UA7A 1X27A 1K8AC 2CP7A 1ZSZB 2EQKA 3PTAA 2OI3A 1MMAA 1CKAA 3A5ZB 2DXTA 4LDXA 1G8XA 5L23A 2OTJQ 1UUEA 3S3OA 5LJ5e 4J8OA 2M9UA 4FYYB 3HFNA 5GANh 4M75G 4OP0A 3TQ7P 2MWPA 1WHLA 5GAN8 1G5VA 1W70A 3J80E 2X51A 5CO7A 5GMKl 2BUDA 4Y92A 3CBMA 1NYFA 1YJ9T 2QQRA 3L2QA 1YHQT 2X35A 3HKSA 1NM7A 1B3QA 5GAMf 3JCMJ 2KT8A 1BCOA 3OBWA 2QEXT 1QCFA 1VQKA 3VS3A 4XQ3A 4A4HA 2HZYA 1V29B 2R57A 2BIVA 2DXCA 1YCSB 1SHGA 1Q82R 5LJ3h 3I5SA 4JRIA 4A4GA 2J6KA 4WCIA 4DBRA 4FT2A 1R0CB 2V8KA 3IQLA 2CS7A 3CPWS 2E5KA 4X1VA 3V7SA 1NBEB 1WPYA 1YITA 1VQ6A 1E7OA 1B07A 3NFCA 1HXDA 2CZ0B 1N8RC 1WIEA 4M77F 1DJ7B 3CCRT 2RK2A 1QVGS 4RKUE 1VQ9T 2KRSA 1RABB 2CKKA 1KSWA 3OMCA 4EMKA 1XNIA 3FJPA 2K3BA 1QLYA 3CQTA 2SRCA 1HD3A 2VYTA 4JJDA 4AT1B 2LQKA 2DEUA 3CPWA 1K8AR 2YLCA 3UPUA 4PFOA 2D6FA 2CGHA 2VGMA 2VC8A 1JXMA 1HJDA 1QVGA 3I56T 1YWOA 1BIBA 4XTXA 4B9XA 8ATCB 3EG1A 2OTLA 2RK1A 2LMJA 4M78B 3TVTA 5HK0A 3JCMe 4ZGDB 2C0IA 2MOXA 1FXXA 1J3TA 5FU7B 3V7RA 1OZ2A 1KC8C 4LD6A 4FT4A 2G3RA 3QWXX 2ECZA 3CCQT 4M7DA 3M4GA 1FYNA 1FWZA 1UGQB 2EYXA 1TUGB 2D8JA 2EFIA 4RTZA 5GANf 3H41A 3JCMb 4BI4A 1AOJA 3GP8A 2LCSA 3H6ZA 4KBMB 1C6VX 3GOXA 3DLMA 2EW3A 5A2QE 2FVUA 1AWXA 4N0AC 1D09B 2ZPHB 4D6WA 3OYKA 4M7AD 2EBPA 4XU3A 3M55A 1NJIU 3FIFA 4HVWA 1D1BA 4XTZA 2QA4T 1RADB 2KQWA 3G4ST 1VQKQ 1WFWA 1KIKA 1LVKA 4L59A 2K6DA 4N4GA 2J6FA 2CH4A 2AZSA 2K79A 1PG5B 2DL7A 2YLBA 5I11A 1NEGA 1KD1U 4M7AA 2RHUA 4WF2A 5KYUB 4PJOB 4ANJA 5I2MA 3PE0A 3CC7A 1YITQ 4LXCA 2AIRB 2VXEA 5A0GA 2HKQB 2X4WA 4FU6A 4IUVA 3JAME 3ER0A 4CRIA 1JQQA 5GMKe 4M78E 2MWOA 2QTVA 4KUDK 2BZYA 3QWYA 3GPLA 4F14A 2HBWA 2PTKA 3META 1U1SA 2GNCA 1QQJA 3ZBDA 4XK8E 5IH2A 2IPOB 1YJWT 2JTEA 3EG9B 1RI9A 4JPBW 2JM9A 1KC8R 2G6FX 4PNOA 2RMOA 4LD9K 3OS0A 4HXJA 3GNGA 4F7UB 2OTLQ 3OS5A 2B86A 1M27C 1WJQA 4HT8A 5GMKm 2F5TX 2RO0A 1KQSP 4QVCA 3CXCS 1K73U 4NL3A 1WJRA 4XU2A 3VRYA 4AG2C 1GBQA 3SWNA 2L2PA 1VIFA 3H0IA 3V8JA 4IUPA 3CCET 3OS1A 2HKNA 2FPDA 1KJWA 5D6WA 2JUFA 1PSEA 3O5ZA 5GAOq 3CMAT 1NG2A 4JZ4A 2EJFA 2YUQA 1ZSZC 3CCUT 3P8BB 3CXCA 4PJOE 1VQ4A 2LQWA 3LWIA 4AMCA 3CBOA 3SFMA 3A8OB 1WHHA 2F5KA 2KYBA 2QQAA 2XK0A 3TSZA 1UJ0A
chains in the Genus database with same CATH topology
5DM7R 1O75A 2JZ2A 4B9WA 5A0DA 4FM4B 1NE8A 4C8QD 3OYEA 4MMLA 2CZ7B 2ZCFB 1N9RA 4Y28E 2M16A 3PFSA 3CCEA 4A4EA 4N4HA 4C92G 3I55T 3MEUA 4EMGA 1VQKT 3L2WA 3VYHB 1I4K1 3RIRA 3C94A 3KUFA 5GMKj 4C0DB 2K57A 2QQBA 3E19A 3BDUA 2OTJA 4C92D 2KMTA 3CMAA 5LJ5d 2DO3A 3BDLA 3OBYA 1W2BS 4C8QA 3GNFB 4JRKA 5GAOn 2M1HA 1K9MC 3ZFJA 1I8FA 1UEBA 5LJ3f 3CCUA 2D9TA 2IG0A 1YJNT 3SWNB 1ZHIA 2WSCE 1S72T 1QVFS 3JCMQ 3UDCA 2P0QA 5GAOm 3ME9A 3CCVA 4Q5WA 3Q1JA 3OYJA 3UWNA 5LJ3d 1YITT 3J81E 2HAXA 4M7DD 1KQ1A 4C92A 4BE2A 3CCST 4KULA 2YRVA 3JCMW 3FB9A 3JB9G 2JVVA 3JRZA 4JRPA 4M7DB 4C0FA 4X34A 4HT9A 4M75E 3I55A 1RI0A 5GAMh 1Y7XA 4MZPA 3C4SA 4NL2A 4RG2A 5AYFA 3J7AF 2L3RA 3JB9D 4PJOC 4C0GA 3G71T 3OYBA 3M58A 3V8KA 2GFUA 2QI2A 4PLIA 4HA8A 5LJ3g 5CKDA 5EG2A 3RESA 4J6WA 3EFRA 3OB9A 4M78A 2ZPEB 4BDYA 3OYIA 2KVQG 3CBPA 1QVFA 3CCJA 5C0MA 1YI2T 2RH2A 4BY6B 5CCAA 1YJNA 2ZPFB 1B34A 2KDSA 4OF1A 4RMOA 3OW2S 1BKBA 4XAXB 4IUQA 1S72A 1JJ2S 1XOVA 2VXFA 3JB9I 1O9SA 2RA2A 2O01E 3SD4A 1KQSA 1BI0A 2EIFA 3INZA 2Y4XA 2FB7A 5KCOA 3KBGA 2KK4A 1Q7YU 3EAEA 3CCSA 3QO3A 2WSEE 5LJ5g 4E7IA 1M1KU 1VUBA 2XU8A 4HCBA 4DOVA 3EFSA 1KG1A 2RI2A 2RI3A 1KHCA 4EPCA 1MGQA 3FEOA 5GAMj 1YBYA 2MAMA 3FLGA 2KY9A 1VQOT 1Q82C 3RUXA 3SDZA 4R56A 2PUOB 3M57A 2PUKB 1I5LA 4M77G 5HY6A 1M5Q1 2HNIA 3A8LB 3QPHA 4XTWA 4C8QB 3HP9A 3GLXA 3OYAA 1IREB 3G71A 4UC4A 4A4KA 1M1FA 3G6ET 3MHXA 5FU6B 4M7AB 1N6AA 2XD0A 3M59A 4L5GA 1QP2A 3E9FA 5GAOr 4M77D 3OA6A 3LW5E 2PVGB 2RHXA 2R5MA 4BE1A 2RB6A 3OW2A 1JJ2A 2X4XA 4NS5A 1K9MU 1YI2A 3MP8A 4QVDA 4PJOG 2H3JA 2R5AA 1R8OB 1SSFA 4HCCA 4C92B 3OYCA 3G7ZA 3DLLA 3OYLA 2HQXA 4LDVA 1IZ6A 1TH7A 5FRMA 4MDXA 2PQWA 2FHDA 2LT4A 3OSVA 4M75C 4PJOD 1BI1A 1H641 3X26B 1BIAA 1BI3A 4E7LA 3VV0A 2E6ZA 4J6XA 4M77A 2XIDA 3LGLA 3LH0A 4J7FA 3NTKA 1Q86U 2XICA 2KSSA 2RHYA 3VUZA 3OSSC 4BB7A 3QSUA 1ZBXA 3RKXA 1VQOA 2VV5A 4LDUA 4V2SA 2AHJB 4RG8A 4J6YA 1XQHA 2JTMA 3FDRA 3LLRA 4FSXA 4C8QF 3L2RA 3CC4A 1OZ3A 1KHIA 4MDWA 2HQEA 1K8AC 1B34B 2P0KA 4PJOA 2EQKA 1P92A 1ZQ1A 5LJ3e 3A8HB 3MEVA 3JCMd 3PTAA 2K3YA 2RD1A 3HRSA 3QZ5B 3S3NA 5DY9A 2RJEA 2QDYB 3A5ZB 3GF5A 3QKJA 2P0PA 2PU9B 4J7IA 4VUBA 2JTFA 2LX9A 1Q7YC 5CKHA 2DXTA 4LDXA 4M7DE 1QVPA 1H3ZA 3RERA 1M1KC 1WGSA 4C92F 4OGCA 4OGEA 4IUTA 5CIUA 4X9CA 2DD5A 2V8JA 3P8HA 3N5BB 4EMKC 1G3SA 3MP1A 2WSFE 2DZ9A 2EQMA 4DQ2A 5LJ5e 3S3OA 5D6XA 3DB4A 4PLLA 1Y71A 4J8OA 3L2UA 2M9UA 4L6V5 3HFNA 2LC4A 4RCCA 2X4YA 2FL7A 5GANh 2PVDB 1Q82U 4M75G 2RHZA 4OP0A 2MWPA 3JCMf 5CQXA 4ZN3A 2RJFA 2KAFA 3CEYA 5GAN8 3J80E 1G5VA 5CQYA 2LCLA 4N4IA 3RKYA 1VIEA 5CO7A 5GMKl 2BUDA 3CBMA 4A4FA 4M75D 2EKOA 1UGPB 5GAN5 3LWHA 3BFMA 4M78G 4JS4A 4Y91A 1YJ9T 2QQRA 3X28B 4NOYA 4C0DC 2XDPA 3L2QA 1YHQT 2X35A 3HKSA 1VQ6T 3QYHB 2P4TA 3V7CA 5GAN4 1N27A 3JB9F 4CI0C 3HPWA 1NPRA 4M78D 3HRUA 3VU3C 4M77B 2Y4YA 5GAMf 5KH6A 3JCMJ 1Q86C 3OBWA 2QEXT 4F7UE 2DJZA 4M7AE 1VQKA 4M75A 2EAYA 4XQ3A 4A4HA 1W2BA 1Q81U 4HKEA 3CC2T 2VUBA 1V29B 2R57A 2BIVA 2DXCA 3QZ9B 3JCMg 5GANj 3S3MA 3PNWC 5LJ3h 2DIQA 5L8RE 4JRIA 2MF2A 4JLGA 2LDMA 1W4SA 3S6WA 3QDRB 2EYQA 3VKIA 2WACA 4A4GA 3HL8A 3T9NA 3TU4K 4M7DC 2ZGWA 2E41A 4FT2A 1K8AU 2E6NA 2K5IA 3PGGA 3CMET 2V8KA 2CS7A 1D3BA 3CPWS 1LOJA 4RCBA 1YJ9A 4BE0A 1KC8U 3V7SA 3C12A 5M9OA 2CZ6B 1WPYA 5GAMg 4C5EA 3OYHA 1YITA 1YHQA 2E65A 2E64A 3X25B 1VQ6A 2LNVA 3NFCA 2DEQA 3OYYA 1HXDA 2CZ0B 2JNGA 3QYGB 4XTVA 3WVEB 5LJ5h 3OYMA 1N8RC 4M77F 5C6SA 5GMKi 2QEXA 1DJ7B 1EIFA 3M56A 4BY6C 2RK2A 2K3XA 3DKMA 3CCRT 4DA4A 1QVGS 2OTLT 4RKUE 5KE2A 3SB2A 1X6OA 4BACA 3JCMP 1VQ9T 2CKKA 4C5GA 4IUUA 3OMCA 4HCZA 2E1HA 4EMKA 4E47A 1XNIA 2OAUA 3M9QA 5LJ3j 1VQPT 1VQ8T 2JOYA 3CC2A 3FJPA 2GFAA 2ZPGB 5IN1A 4JJNK 2RJCA 2DXBA 1VQNT 4DOWA 4XU1A 2A3LA 3CCMT 2VYTA 4PJOF 3PIOA 1NJIC 2LQKA 2DTOA 2DTIA 3CPWA 4E7HA 5GAN6 3HFOA 5CKFA 5CKEA 4PL6A 3RKWA 3LYIA 2DKGA 5GAOp 2YLCA 4GY5A 1QW1A 5GAN3 4EDUA 1UGSB 2K5FA 3RMQA 4QVZA 2CGHA 3OQ5A 3UPUA 2D6FA 2VGMA 4O6JA 1WQWA 2VC8A 2A7YA 2CYZB 5FU6C 1M90C 2L8DA 5LJ5j 4M7AC 2EJGA 2LVMA 4YTLA 3PMIA 2QXFA 3JSCA 1KD1C 4M7DG 4M75B 4JRQA 1QVGA 1Q81C 3QJ6A 3ZEHA 3I56T 1BIBA 4XTXA 3HHTB 1U1TA 3JCMc 4B9XA 2RI5A 4X9DA 3CCRA 3H8ZA 2GQVA 4C92C 2RK1A 2OTLA 1VQ7T 3QUIA 5GANd 1VQLT 4JUVA 4M78B 5HK0A 3JCMe 2F69A 4OB3B 4ZGDB 1VQPA 1U8RA 1VQ8A 3G6EA 1BYMA 1M1GA 1FXXA 2LCCA 5FU7B 3V7RA 1OZ2A 4FIBA 4ZGEB 1VQNA 1D3BB 3VYGA 3X20B 4BI8B 3CCMA 2LTOA 1QP3A 2DXUA 4BD3A 3FC3A 4ZTFA 1KC8C 4PKCC 3AHUA 2DTHA 2X4JA 2RM4A 3WVDB 4ZGJB 4LD6A 4QQDA 2K4YA 4FT4A 2Y90A 2CZ1B 2G3RA 1YIJT 2OTJT 3QXEB 3CCQT 3M4GA 3GIBA 4M7DA 1FWZA 1UGQB 3X24B 2DAQA 4GLKA 1VQ5T 3OYNA 5GAMe 3E9GA 2EFIA 4EMHA 4FL6A 5GANf 3JCMb 4IURA 1N8RU 5GAMd 4O5VA 3MEWA 4BI4A 4M75F 3I56A 5I2SA 3L2ZA 3GP8A 4Z02A 4JS5A 4F7UG 3H6ZA 4KBMB 1YCYA 3GOXA 3MCAB 3DLMA 3QHSA 3CCVT 5A2QE 4M7AG 1VQ7A 2FVUA 4LDWA 4TVRA 3NTIA 4J5YA 4JLIA 4II1A 3V8LA 1VQLA 4N0AC 4P5NA 2ZPHB 3CC7T 3TCJA 4M78F 4D6WA 3OYKA 3URGA 2D0QB 4M7AD 4XU3A 3M55A 4QQ6A 2O4XA 2RJDA 1NJIU 3FIFA 4XTYA 1MHNA 4E7JA 2MI6A 3A8MB 4XTZA 2QA4T 3MP6A 2KQWA 3G4ST 2DVEA 1YIJA 1JB0E 2LRQA 2I2LA 2GF7A 1PSFA 5FRNA 3CCQA 4L59A 2ZPIB 3M54A 2M0OA 2QQSA 4C8QE 4N4GA 1VQ5A 4C5IA 5GANg 3OYGA 1K73C 4F7UA 1M90U 3SWNC 2YLBA 3OMGA 2BKDN 5GAN7 2ZPBB 5I21A 3CCJT 1I81A 3CCLT 3R6OA 1KD1U 4M7AA 2RHUA 3JCMh 4WF2A 3NTHA 2LQ8A 3HSBA 4BDZA 2R58A 2C06A 3OS2A 4PJOB 4KUIA 2EQUA 5CAIA 2LT1A 3QIIA 4M77C 4BI3A 5I2MA 4C92E 4ME7A 5KE3A 1Y07A 2IVWA 4ZTJA 3CC7A 4OVAA 2E10A 1KQSS 5IT9E 3ASKA 2QTXA 3FRNA 2VXEA 4A53A 5A0LA 2DK3A 5LJ5f 5A0GA 3VUBA 5J26A 3F70A 5FROA 2X4WA 5CKBA 3LX7A 3UT1A 3JB9J 1KQ2A 4FU6A 2XDDA 4IUVA 3JAME 2B8AA 5FLXE 2QA4A 1X01A 2V8IA 5KCHA 3G4SA 4E7KA 3ER0A 2PVOB 4CRIA 3L42A 5GMKe 2XI9A 1VQMT 2HD0A 3P8DA 4M78E 2MWOA 1Y96A 2EQJA 2L5QA 3VJPA 3CCLA 3QJYA 1M9SA 4KUDK 1G3WA 1M4ZA 4LDYA 3GPLA 4OMFB 3PT9A 3OYDA 1FX7A 2YHTA 2HBPA 3E1SA 3META 4MZTA 1JRIA 3O8VA 4MZMA 1U1SA 4J83A 3ZBDA 4XK8E 2O4XB 5J39A 2RHIA 3CPFA 1AHJB 2MMPA 1YJWT 3PMTA 1N9SA 3L2VA 4N0AA 2DPPB 4QQGA 3CMEA 4C8QC 5GAOl 1NZ9A 2DZCA 3CD6T 4PNOA 1LNXA 4M7DF 4ELZC 1G3YA 2XG8D 4JDSA 4LD9K 3JB9H 3OS0A 1WJSA 4A54A 3GNGA 4F7UB 3CC4T 3OS5A 2E5QA 3M5AA 4OB1B 4ELYC 2K5LA 4BUGA 1WJQA 4ZN1A 3QG1A 1WQ7A 5GMKm 2F5TX 3PIPA 1VQ4T 4HT8A 2RO0A 3HRTA 1VQMA 5GANe 4QVCA 5IAYA 3CXCS 2E70A 4NL3A 1K73U 1WJRA 1LJOA 1WNLA 1BI2A 1XTDA 3C95A 3MO8A 4MMKA 4XU2A 3RMSA 1VQ9A 4ATOA 3LGFA 3SWNA 4IKFA 5DLQE 3JCMV 1VIFA 4C0ZA 1GXIE 3V8JA 1G3TA 2JN0A 5DLOA 2K2VA 1OYXA 1X75C 2EWNA 5D6YA 2EJ9A 4IUPA 1UGRB 3CCET 2FYKA 1UB4A 3BW1A 3QBYA 3OS1A 1M8VA 3TEEA 4M77E 3OYFA 3M53A 1HK9A 1YJWA 2DD4A 4XU0A 2DIGA 3DB3A 5D6WA 4C5HA 2XKOC 5HK3A 2XHCA 3KXTA 2JUFA 1PSEA 2VGNA 5GAOq 5CVIA 5GMKh 3CMAT 2L89A 4M78C 3WXMB 3CD6A 1OI1A 2NLUA 5GAN2 2ZZDA 2EJFA 2XDBA 3BY7A 4OB0B 2E12A 5CR2A 1Y96B 5LL6S 3JCMX 5FU7C 1RL2A 4OB2B 1JBMA 3CCUT 4QW2A 3OY9A 4KT0E 3P8BB 4F7UF 3CXCA 4PJOE 3A8GB 3MEAA 5HKCA 2GCXA 1VQ4A 3M4YA 4R55A 3LWIA 4EMKB 1NPPA 4C8QG 3CBOA 2QQ9A 4M7AF 5J3BA 3SFMA 3TREA 3A8OB 2F5KA 5CK9A 3L1AA 2QQAA 2XK0A 4XTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM h;  4M77 F;  4M75 C;  4WF2 A;  5GMK i;  4PJO D;  1H64 1;  4C8Q D;  3HSB A;  1BIA A;  4J6X A;  4MML A;  4PJO B;  4M77 A;  3SB2 A;  3JCM P;  1N9R A;  5CAI A;  4M77 C;  2E1H A;  4C92 E;  4EMK A;  5LJ3 j;  4C92 G;  3QSU A;  3FJP A;  3RKX A;  2E10 A;  4EMG A;  4V2S A;  1I4K 1;  3JCM J;  4XU1 A;  3RIR A;  5GMK j;  4J6Y A;  4PJO F;  2QTX A;  2VXE A;  4A53 A;  2K57 A;  4C8Q F;  2DTO A;  2DTI A;  3BDU A;  5LJ5 f;  4C92 D;  1B34 B;  5LJ5 d;  5GAN 6;  3HFO A;  3JB9 J;  1KQ2 A;  4PJO A;  3RKW A;  4C8Q A;  2DKG A;  5LJ3 e;  5GAO p;  2YLC A;  3JCM d;  4JRK A;  5GAN 3;  1X01 A;  5GAO n;  2RD1 A;  1I8F A;  5LJ3 f;  2CGH A;  5DY9 A;  1WQW A;  2VC8 A;  3SWN B;  5GMK e;  4M78 E;  4M7A C;  5LJ5 j;  2EJG A;  3JCM Q;  2DXT A;  4M7D E;  1Y96 A;  5GAO m;  3RER A;  4M7D G;  4M75 B;  4C92 F;  1BIB A;  4X9C A;  1KQ1 A;  1U1T A;  4XTX A;  3JCM c;  4C92 A;  2YHT A;  4X9D A;  4EMK C;  1JRI A;  4C92 C;  1U1S A;  2DZ9 A;  3JCM W;  4DQ2 A;  3QUI A;  3FB9 A;  5LJ5 e;  5GAN d;  3JB9 G;  4JUV A;  4M78 B;  4M7D B;  3JCM e;  3HFN A;  4RCC A;  4HT9 A;  4M75 E;  5GAM h;  5GAN h;  4M75 G;  4NL2 A;  4OP0 A;  1N9S A;  3JCM f;  3V7R A;  4N0A A;  1D3B B;  3JB9 D;  5GAN 8;  4PJO C;  2DXU A;  4C8Q C;  5GAO l;  2DZC A;  3V8K A;  4PNO A;  2DTH A;  3RKY A;  3AHU A;  1LNX A;  5GMK l;  4M7D F;  2RM4 A;  4HA8 A;  4M75 D;  5LJ3 g;  5GAN 5;  3JB9 H;  4A54 A;  4F7U B;  3RES A;  2Y90 A;  3EFR A;  3BFM A;  4J6W A;  4M78 G;  4M78 A;  4Y91 A;  4M7D A;  3M4G A;  3GIB A;  4HT8 A;  4NOY A;  1WQ7 A;  5GMK m;  1B34 A;  5GAM e;  5GAN e;  4QVC A;  5GAN 4;  3V7C A;  3JB9 F;  4EMH A;  4M78 D;  3VU3 C;  2VXF A;  4M77 B;  5GAM f;  3JB9 I;  2RA2 A;  1WNL A;  1LJO A;  4XU2 A;  3JCM b;  5GAN f;  4NL3 A;  5GAM d;  4MMK A;  4M7D D;  4M75 F;  3SWN A;  3INZ A;  4F7U E;  2DJZ A;  3L2Z A;  2FB7 A;  3JCM V;  3L1A A;  4F7U G;  3V8J A;  2JN0 A;  1YCY A;  4M7A E;  3QHS A;  2EWN A;  3QO3 A;  4M75 A;  5LJ5 g;  4M7A G;  2EAY A;  2EJ9 A;  4XQ3 A;  3EFS A;  4J5Y A;  4JLI A;  2FYK A;  3V8L A;  1MGQ A;  3BW1 A;  4N0A C;  3JCM g;  5GAM j;  5GAN j;  1M8V A;  4M77 E;  4M78 F;  3RUX A;  5LJ3 h;  1HK9 A;  1I5L A;  4M77 G;  1M5Q 1;  2HNI A;  4XTW A;  4XU0 A;  4C8Q B;  4JRI A;  4M7A D;  4XU3 A;  5GAO q;  3FIF A;  5GMK h;  4XTY A;  4M78 C;  4M7A B;  5GAN 2;  4M7D C;  5GAO r;  2ZGW A;  2E41 A;  4M77 D;  2EJF A;  4XTZ A;  3PGG A;  3BY7 A;  3JCM X;  1Y96 B;  1D3B A;  2DVE A;  1LOJ A;  2I2L A;  1JBM A;  2RB6 A;  4RCB A;  4F7U F;  4PJO E;  3V7S A;  4C8Q E;  4QVD A;  4PJO G;  1WPY A;  4EMK B;  4C8Q G;  5GAM g;  5GAN g;  4M7A F;  2E65 A;  2E64 A;  4C92 B;  4F7U A;  2DEQ A;  3SWN C;  1HXD A;  4XTV A;  2YLB A;  5LJ5 h;  5GAN 7;  5I21 A;  1I81 A;  1TH7 A;  4M7A A;  5LJ3 d;  4XTU A; 
#chains in the Genus database with same CATH topology
 5DM7 R;  5A0D A;  4FM4 B;  1IXD A;  4AFQ C;  2NUZ A;  2KI7 A;  4C92 G;  4PK4 A;  1U3O A;  3MEU A;  3L2W A;  2OAW A;  1I4K 1;  1EX4 A;  3C94 A;  2W0Z A;  2OX7 A;  2QQB A;  1PD0 A;  1K9A A;  1W2B S;  3LH5 A;  2CH4 W;  4F04 B;  1K9M C;  1I8F A;  1UEB A;  1M3B A;  1ARK A;  1ZA2 B;  2D9T A;  1YJN T;  3CC7 Q;  1S72 T;  2P0Q A;  2YWW A;  1KQ1 A;  1HSQ A;  3JB9 G;  4JRP A;  1FMK A;  4X34 A;  4M75 E;  4E2F B;  3I55 A;  4C0G A;  3NGP A;  3V8K A;  2QG9 B;  2GFU A;  1UFF A;  2A08 A;  2HQH A;  2VKN A;  2X3W D;  4PLI A;  4AFZ C;  1PRL C;  3EFR A;  2ZPE B;  1NLP C;  5KYY B;  2J6O A;  2KDS A;  2JW4 A;  3OW2 S;  4XAX B;  1PCX A;  1O9S A;  2RA2 A;  1KQS A;  2M51 A;  1BI0 A;  2Y4X A;  5KCO A;  2M0Y A;  3EAE A;  3CCS A;  1Z9Z A;  1M1K U;  1A0N B;  4DOV A;  1KHC A;  5FWB A;  1CSK A;  2KY9 A;  4R56 A;  2PUO B;  5HY6 A;  4C8Q B;  4XTW A;  4PJJ A;  1WX6 A;  3GLX A;  3OYA A;  4A4K A;  2XD0 A;  3E9F A;  5GAO r;  2NYS A;  4M77 D;  3LW5 E;  1QWF A;  2GQI A;  2RB6 A;  3OW2 A;  1YI2 A;  3EHR A;  4HCC A;  3OYC A;  2C0T A;  1K4U S;  9ATC B;  4MDX A;  3OSV A;  4FW2 A;  1H64 1;  3M0Q A;  1TUD A;  3X26 B;  4E7L A;  3VV0 A;  1AWW A;  4M77 A;  3LGL A;  3LH0 A;  1Q86 U;  2XIC A;  3OSS C;  1VQ4 Q;  3QSU A;  1VQO A;  1JJ2 P;  2VV5 A;  1X2K A;  4V2S A;  2XMF A;  4J6Y A;  1XQH A;  1B34 B;  1P92 A;  1ZQ1 A;  5LJ3 e;  3MEV A;  3HRS A;  1K9M R;  5HCK A;  3S3N A;  2QDY B;  4IIM A;  2LX9 A;  1Q7Y C;  5CKH A;  4Z88 A;  4OGC A;  1RAC B;  2ENM A;  3EG0 A;  4OGE A;  5CIU A;  4X9C A;  2DD5 A;  3P8H A;  1G3S A;  3MP1 A;  1VOM A;  4PLL A;  2LC4 A;  3JV3 A;  2X4Y A;  2PVD B;  2RHZ A;  3JCM f;  2VVK A;  2RJF A;  3EG2 A;  5CQY A;  4GLM A;  1UGP B;  1G2B A;  4M78 G;  2F2V A;  3EGD B;  4Y91 A;  1N5Z A;  3QYH B;  3I55 Q;  5GAN 4;  3V7C A;  4CI0 C;  1I1J A;  1UJY A;  2H8H A;  3REA B;  2AKL A;  1PM3 A;  2DIQ A;  5L8R E;  2LDM A;  1W4S A;  3S6W A;  3PVL A;  3QDR B;  3VKI A;  1R0B G;  3T9N A;  4RTY A;  2PZ1 A;  1IRX A;  3PGG A;  3CME T;  3CCS Q;  1ZUY A;  1LOJ A;  2AT1 B;  2LQN A;  1WHK A;  1YJ9 A;  4BE0 A;  1K1Z A;  4OMQ A;  5M9O A;  1HYO A;  4C5E A;  2V1R A;  1YHQ A;  2E64 A;  3X25 B;  2LNV A;  3WVE B;  4XTV A;  2JNG A;  4FSS A;  2QEX A;  4M4Z A;  1SPK A;  3HTR A;  2KGT A;  5KE2 A;  3SB2 A;  1X6O A;  1MV3 A;  4BAC A;  1T0H A;  3JCM P;  1UDL A;  1SEM A;  1K0S A;  4GBQ A;  1D0X A;  2OAU A;  3M9Q A;  1YI2 Q;  2GFA A;  2RJC A;  1VQN T;  4DOW A;  3CCM T;  1NEB A;  1NJI C;  4PJO F;  3PIO A;  2JJ9 A;  2DTO A;  2DTI A;  2CP5 A;  1WXB A;  3RKW A;  3LYI A;  2V26 A;  5GAO p;  1ZA1 B;  2K5F A;  3RMQ A;  4O6J A;  2A7Y A;  2MPX C;  1VQO Q;  4YTL A;  2X3X D;  3PMI A;  1Q7Y R;  1KD1 C;  1Q81 C;  1UHF A;  3QJ6 A;  1RAI B;  3HHT B;  5GJW B;  1H3H A;  3CCR A;  2RI5 A;  1SG5 A;  2GQV A;  3CPW P;  4PFP A;  1VQ7 T;  3QUI A;  3E2U A;  5KYW B;  1OUL A;  1QKX A;  2F69 A;  2YXY A;  3G6E A;  1PWT A;  3X20 B;  2QAZ A;  3FC3 A;  1QP3 A;  4BD3 A;  4PKC C;  3AHU A;  1WHM A;  2X4J A;  1QVG P;  4ZGJ B;  1YIJ T;  2OTJ T;  1VQ5 T;  3E9G A;  4HVV A;  4EIK A;  1SRL A;  4ESR A;  4M75 F;  3I56 A;  1OV3 A;  4JS5 A;  4F7U G;  4JLI A;  1OX8 A;  2YRC A;  4HCK A;  1KFZ A;  2O9S A;  4Z89 A;  3URG A;  2D0Q B;  1M2O A;  1PKS A;  1UGV A;  1ACM B;  2KT1 A;  2NWM A;  2RJD A;  4E7J A;  2MI6 A;  1V76 A;  2A0F B;  3MP6 A;  5KYX B;  1JB0 E;  2I2L A;  3CCQ A;  2M0O A;  2QQS A;  4C5I A;  3VS2 A;  1K73 C;  1M90 U;  2JT4 A;  2RQT A;  3CCL T;  1I81 A;  4J9F A;  2BZX A;  2LQ8 A;  4BDZ A;  2R58 A;  2C06 A;  3OS2 A;  2M02 A;  4AFU C;  5CAI A;  4M77 C;  2OJ2 A;  7AT1 B;  4C92 E;  1YJ9 Q;  5KE3 A;  1F1B B;  1YHQ Q;  1UHC A;  5IT9 E;  1GBR A;  3EH2 A;  4JJC A;  1M30 A;  3ASK A;  4OMM A;  2DIL A;  2J06 A;  2DK3 A;  1RLQ C;  2QEX Q;  5FRO A;  3TSW A;  5CKB A;  4FCY A;  2CUD A;  3LX7 A;  3UT1 A;  3JB9 J;  2QA4 A;  3G4S A;  4E7K A;  2RQR A;  2PVO B;  4HVU A;  1VQM T;  3RNJ A;  1C1A A;  4QT7 A;  1NYG A;  1KD1 R;  3VJP A;  3QJY A;  1Q81 R;  1G3W A;  2DLP A;  2LX7 A;  2F2W A;  4OMF B;  4MZM A;  3E1S A;  4J83 A;  2O9V A;  4RTW A;  2RHI A;  3CPF A;  2EYW A;  2EVR A;  3RR6 A;  2DL8 A;  3PMT A;  1N9S A;  3QDF A;  4C8Q C;  2H3E B;  3CD6 T;  1PRM C;  1G3Y A;  3CCR Q;  4JDS A;  2KNB B;  1IO6 A;  2E5Q A;  4ELY C;  2EYY A;  3PIP A;  3QG1 A;  2FPE A;  4JJB A;  3G6E Q;  2YSQ A;  2EQI A;  3I35 A;  2E70 A;  3C95 A;  3RMS A;  4M7D D;  3MO8 A;  1BCM A;  1C0M A;  1LPL A;  3LGF A;  2COW A;  5DLQ E;  3JCM V;  1GXI E;  1G3T A;  5DLO A;  1X75 C;  2EWN A;  2CP2 A;  1UB4 A;  3TEE A;  3M53 A;  2YUN A;  4DEY A;  1YJW A;  2DIG A;  2C0O A;  5CVI A;  3WXM B;  3I56 Q;  3BY7 A;  4OB0 B;  5CR2 A;  3JCM X;  4QW2 A;  4KT0 E;  4KGX B;  5HKC A;  2GCX A;  2JS0 A;  4C8Q G;  3TRE A;  1K73 R;  2YUO A;  1GCQ A;  4XTU A;  1O75 A;  2JZ2 A;  4B9W A;  2RPN A;  4KGZ B;  1BK2 A;  2CSI A;  2FRY A;  4MML A;  2M16 A;  3CCQ Q;  3CCE A;  1RAF B;  2EGE A;  1VQK T;  2QAS A;  3CXC P;  2CP0 A;  2I0N A;  3KUF A;  1TXQ A;  4FYW B;  3E19 A;  1QMC A;  2KMT A;  3CMA A;  5FWC A;  1T3S A;  2EKH A;  5GAO n;  2M1H A;  5LJ3 f;  1N8R R;  3CCU A;  1OU9 A;  1OOT A;  3SWN B;  1QVF S;  3JCM Q;  3UDC A;  1G83 A;  3GBQ A;  3CCV A;  3Q1J A;  4ORZ A;  4RTU A;  1YIT T;  2HAX A;  2QDL A;  1VQ6 Q;  2YRV A;  2QA4 Q;  3G4S Q;  3JCM W;  3FB9 A;  2DFU A;  4C0F A;  2RQU A;  3C4S A;  2YUP A;  4RG2 A;  2L3R A;  3G71 T;  3OYB A;  4DBH A;  3KFV A;  3NPF A;  5EG2 A;  4J6W A;  4M78 A;  1QVF A;  3CCJ A;  1UEC A;  2CUB A;  1YJN A;  2ZPF B;  1GFD A;  1S72 A;  6AT1 B;  3JB9 I;  2QYZ A;  1GFC A;  3M0P A;  2EIF A;  4PJM A;  1Y0M A;  1W2B P;  3UF4 A;  2DBM A;  3KBG A;  1YP5 A;  3EFS A;  1KG1 A;  2RI3 A;  4EPC A;  8AT1 B;  2PUK B;  1M5Q 1;  2HNI A;  3A8L B;  3QPH A;  2YT6 A;  2HL5 C;  1M1F A;  2RHX A;  3A98 A;  2R5M A;  2GTJ A;  2LNH B;  3MP8 A;  1SSF A;  1WLP B;  1AT1 B;  1YJW Q;  3OYL A;  1TH7 A;  2FHD A;  2PQW A;  4PJO D;  1BI1 A;  4LN2 A;  2E6Z A;  3SEM A;  3NTK A;  4BB7 A;  3RKX A;  3OW2 P;  2ESW A;  1SSH A;  2AHJ B;  3CC4 A;  2IIM A;  4FSX A;  2CT3 A;  5KYU A;  1KHI A;  2HQE A;  2P0K A;  4PJO A;  2DYI A;  2CRE A;  2K3Y A;  2RD1 A;  3QZ5 B;  5DY9 A;  3CCE Q;  2BTT A;  2RJE A;  1ZX6 A;  2P0P A;  2JTF A;  3EGU A;  4J9H A;  1H3Z A;  3RER A;  1WGS A;  4C92 F;  1I0C A;  3CMA Q;  2L3P A;  1B7T A;  4EMK C;  2WSF E;  4DQ2 A;  3DB4 A;  4KH1 B;  4L6V 5;  4RCC A;  1TU0 B;  2DRK A;  2FL7 A;  5CQX A;  4ZN3 A;  2DF6 A;  3CCV Q;  2LCL A;  4N4I A;  4OMP A;  4A4F A;  4M75 D;  2EKO A;  2CDT A;  3EGX A;  5IHN A;  5GAN 5;  3LWH A;  4PJL A;  1WXU A;  1WXT A;  1I5O B;  2P4T A;  1N27 A;  3JB9 F;  3EG9 A;  3HPW A;  4M77 B;  2Y4Y A;  4F7U E;  2MK5 A;  1IGQ A;  2HMA A;  4M75 A;  1ZUU A;  2ABL A;  1W2B A;  3CCJ Q;  4HKE A;  3CC2 T;  2VUB A;  3QZ9 B;  2MYS A;  1YJN Q;  2DRM A;  3PNW C;  1S72 Q;  2DM1 A;  4JLG A;  1AZE A;  2O88 A;  2WAC A;  2LZ6 B;  1X43 A;  3MJX A;  3TU4 K;  1WZO A;  4M7D C;  2E41 A;  5GJV B;  3VS4 A;  1D3B A;  4J9B A;  4RCB A;  1KC8 U;  2KE9 A;  3C12 A;  1ZUK A;  2KRO A;  5GAM g;  2HSP A;  3OYH A;  2E65 A;  3OYY A;  3OYM A;  1SRM A;  1ZBJ A;  1GCQ C;  5GMK i;  3M56 A;  2K3X A;  5FW9 A;  1H92 A;  4C5G A;  4IUU A;  2ED0 A;  4HCZ A;  2KXC A;  4E47 A;  1VQP T;  1VQ8 T;  2JOY A;  2ZPG B;  1M2V A;  4XU1 A;  1R77 A;  2A3L A;  4E7H A;  5CKE A;  4PL6 A;  4E6R A;  2JMA A;  5GAN 3;  1BBZ A;  4JZ3 A;  2DX1 A;  1WQW A;  5IHK A;  1M90 C;  4M7A C;  5LJ5 j;  2EJG A;  1AEY A;  4M7D G;  2MIO A;  3CC4 Q;  3NMZ C;  1OU8 A;  2SEM A;  1U1T A;  4X9D A;  3H8Z A;  5GAN d;  1VQL T;  4RUG A;  1K76 A;  1BYM A;  1M1G A;  2LCC A;  1RUW A;  4ZGE B;  2BE7 D;  1VQN A;  3VYG A;  1SF9 A;  2FO0 A;  3CCM A;  2JMC A;  2DXU A;  2LTO A;  2CP6 A;  1ZSG A;  3WVD B;  2D0N A;  3EFO A;  4QQD A;  2K4Y A;  3QXE B;  4GLK A;  3M0S A;  1X6G A;  3MKD A;  4EMH A;  4IUR A;  2O31 A;  4O5V A;  1VYU A;  4M7A G;  2LJ3 A;  1VQ7 A;  4LDW A;  4TVR A;  3NTI A;  4J5Y A;  3V8L A;  1IHV A;  4P5N A;  4M78 F;  2DNU A;  1IGU A;  4QQ6 A;  2O4X A;  4XTY A;  3A8M B;  5KYN A;  2DVE A;  1YIJ A;  1MND A;  1PSF A;  2ZPI B;  3NHN A;  4C8Q E;  1VQ5 A;  5GAN g;  1AD5 A;  3SWN C;  5GAN 7;  5I21 A;  1PKT A;  1GL5 A;  2HCK A;  3I9Q A;  2CSQ A;  1XJW B;  2LT1 A;  2YRD A;  4BI3 A;  4AG1 C;  1Y07 A;  4ZTJ A;  1AVZ C;  2COY A;  4J9E A;  1UTI A;  2QTX A;  3VS5 A;  1WHJ A;  1X2Q A;  5J26 A;  2EGA A;  2LP5 A;  2LJ0 A;  2B8A A;  5FLX E;  2V8I A;  4K11 A;  5KCH A;  3THK A;  2XI9 A;  1M90 R;  1TSF A;  2QGF B;  1Y96 A;  1E6G A;  3CCL A;  5IHI A;  2PNI A;  1FX7 A;  1D1A A;  3O8V A;  4F16 A;  5J39 A;  4LE9 A;  4DBQ A;  3L2V A;  4N0A A;  2DPP B;  4QQG A;  1NZ9 A;  2KEA A;  1LNX A;  4ELZ C;  2XG8 D;  3JB9 H;  1WJS A;  2GTO A;  2DJQ A;  4ZN1 A;  1WQ7 A;  3HRT A;  1VQM A;  3RBB B;  3UAT A;  1VQN Q;  1LJO A;  3CCM Q;  1BI2 A;  1VQ9 A;  4ATO A;  1VA7 A;  4IKF A;  1TUC A;  4ZNX A;  3ZL7 C;  2JN0 A;  3EGD A;  2FZK B;  5D6Y A;  2LJ1 A;  1UGR B;  2FYK A;  3QBY A;  3OYF A;  1RAG B;  2RNA A;  4XU0 A;  1WHG A;  4C5H A;  2XKO C;  2L0A A;  3VS0 A;  1YFN A;  3CD6 A;  2NLU A;  2ZZD A;  3U23 A;  2XDB A;  1WA7 A;  1RL2 A;  1JBM A;  2VAS A;  1T3L A;  1VQ7 Q;  3ULR B;  4F7U F;  2VB6 A;  3A8G B;  1TG0 A;  3M4Y A;  4R55 A;  1D0Z A;  4EMK B;  2V1Q A;  1NPP A;  1PNJ A;  2QQ9 A;  5J3B A;  5EC7 A;  2DBK A;  3L1A A;  3OYE A;  3BE3 A;  2W10 A;  2ZCF B;  1YIJ Q;  4Y28 E;  1IHW A;  4J9G A;  4J9C A;  2NUP A;  4N4H A;  2MCN A;  1OPK A;  1MMG A;  2NUT A;  4LNP A;  1VQ5 Q;  4EMG A;  2GGR A;  3RIR A;  1RAH B;  5GMK j;  3BDU A;  4C92 D;  5LJ5 d;  2DO3 A;  3H0H A;  2VWF A;  1FMW A;  4LUD A;  3ZFJ A;  2DVJ A;  2JXB A;  2WSC E;  1U5S A;  5GAO m;  4LUE A;  1ABQ A;  2CT4 A;  3OYJ A;  3J81 E;  1MV0 B;  3REB B;  4C92 A;  2KYM A;  2JVV A;  1NJI R;  4M7D B;  1Y7X A;  3JB9 D;  3CCL Q;  1S1N A;  2QI2 A;  4WTO B;  3RES A;  2KBT A;  5KYW A;  3OYI A;  1QKW A;  3CBP A;  5C0M A;  2RH2 A;  1QWE A;  1ZSZ A;  1BKB A;  4IUQ A;  2ATC B;  2O01 E;  3SD4 A;  3INZ A;  2FB7 A;  1M3C A;  1Q7Y U;  2WSE E;  5LJ5 g;  4E7I A;  2XU8 A;  1MGQ A;  5GAM j;  1YBY A;  2MAM A;  3SDZ A;  1QVF P;  1VQM Q;  3M57 A;  1I5L A;  4M77 G;  2EGC A;  3HP9 A;  2HEQ A;  1RLP C;  3G71 A;  1OPL A;  4UC4 A;  5ECA A;  1VQ9 Q;  3G6E T;  4M7A B;  1N6A A;  4L5G A;  3OA6 A;  2PVG B;  4BE1 A;  2X4X A;  2DMO A;  2BZ8 A;  2A37 A;  1R8O B;  4CC4 B;  3DLL A;  2DL3 A;  1OX9 A;  2HQX A;  4LDV A;  2FEI A;  1PD1 A;  1IZ6 A;  2KRN A;  2LT4 A;  3CD6 Q;  1BIA A;  1BI3 A;  5KYX A;  2O2O A;  2XID A;  3VUZ A;  2RHY A;  1PC0 A;  2K9G A;  2KXD A;  4LDU A;  4RG8 A;  3SHW A;  3FDR A;  3L2R A;  4C8Q F;  1OZ3 A;  4KGV B;  4MDW A;  3A8H B;  3JCM d;  2DET A;  2FPF A;  2K7A A;  2E3I A;  1JO8 A;  3GF5 A;  3QKJ A;  2PU9 B;  4J7I A;  4VUB A;  4M7D E;  1QVP A;  1M1K C;  1WYX A;  4IUT A;  2J7I A;  2V8J A;  2ROT A;  3N5B B;  2DZ9 A;  2EQM A;  5D6X A;  2EYZ A;  3L2U A;  1Y71 A;  1Q82 U;  1SKU B;  2KAF A;  3CEY A;  4FYX B;  2KR3 A;  2DER A;  3RKY A;  1D1C A;  1VIE A;  3BFM A;  4JS4 A;  2HL3 A;  1UE9 A;  3X28 B;  2E4H A;  4NOY A;  3VRZ A;  4C0D C;  2JM8 A;  2XDP A;  1VQ6 T;  1NPR A;  4M78 D;  3HRU A;  3VU3 C;  5KH6 A;  2EPD A;  1Q86 C;  1V1C A;  2DJZ A;  1TS9 A;  3VS7 A;  4M7A E;  2EAY A;  1Q81 U;  3JCM g;  5GAN j;  3S3M A;  1U06 A;  2MF2 A;  2EYQ A;  3HL8 A;  2ZGW A;  4PJN A;  1IB8 A;  1VYT A;  4D8D A;  2E6N A;  2K5I A;  1K8A U;  4CC3 A;  2YDL A;  2CZ6 B;  3QYG B;  2DEQ A;  5LJ5 h;  2FRW A;  3G71 Q;  5C6S A;  1EIF A;  1NLO C;  4BY6 C;  3DKM A;  4DA4 A;  1FMV A;  1JEG A;  2GBQ A;  2OTL T;  2E1H A;  3CC2 A;  5LJ3 j;  1T0J A;  3MPU B;  3G1J A;  1BB9 A;  4OMO A;  5IN1 A;  4JJN K;  2DXB A;  3EGX B;  2ZAE A;  5GAN 6;  3HFO A;  5CKF A;  2DKG A;  4E7Z A;  4GY5 A;  1QW1 A;  1M3A A;  4EDU A;  1UGS B;  3RDV A;  4QVZ A;  3OQ5 A;  2CYZ B;  4RTT A;  5FU6 C;  2L8D A;  2LVM A;  2QXF A;  3JSC A;  4M75 B;  3EG3 A;  4JRQ A;  1Q95 G;  1M1K R;  1MUZ A;  1YWP A;  3ZEH A;  3VS6 A;  1AZG B;  3JCM c;  4C92 C;  2AK5 A;  4JUV A;  4CC7 A;  1Y57 A;  4OB3 B;  1VQP A;  1VQ8 A;  1U8R A;  4FIB A;  5D7U A;  1D3B B;  4BI8 B;  4ZTF A;  3M0R A;  2RQW A;  2DTH A;  2RM4 A;  2Y90 A;  2CZ1 B;  4J9D A;  3GIB A;  3X24 B;  2DAQ A;  3OYN A;  4F17 A;  5GAM e;  2F2X A;  4FL6 A;  4PFZ A;  3R6N A;  1Q86 R;  1N8R U;  5GAM d;  3MEW A;  5I2S A;  4KRT A;  3L2Z A;  3CCU Q;  4Z02 A;  4RTX A;  1YCY A;  4DBF A;  1M2V B;  3MCA B;  3QHS A;  3CCV T;  4RTV A;  1VQL A;  4II1 A;  4CC2 A;  3CC7 T;  3TCJ A;  1SHF A;  3EH1 A;  1EFN A;  2P84 A;  1MHN A;  2CP3 A;  1UG1 A;  4R0K A;  2LRQ A;  2GF7 A;  5FRN A;  3AT1 B;  1JU5 C;  3M54 A;  1WDX A;  2D1X A;  3OYG A;  1MMN A;  4F7U A;  3OMG A;  2BKD N;  3CCJ T;  2ZPB B;  1ABO A;  3R6O A;  3JCM h;  3NTH A;  3HSB A;  3C0C A;  2AZV A;  2DL5 A;  4KUI A;  2A28 A;  2EQU A;  3QII A;  3A1P A;  4ME7 A;  2ED1 A;  2IVW A;  1WI7 A;  2X9H A;  4OVA A;  2E10 A;  1KQS S;  3EFO B;  2QGG A;  3FRN A;  4A53 A;  5A0L A;  5LJ5 f;  3VUB A;  3F70 A;  2JS2 A;  1KQ2 A;  2XDD A;  1I07 A;  2RN8 A;  3D7S B;  1X01 A;  2HSE B;  2FG0 A;  3CC2 Q;  3L42 A;  1BU1 A;  2HD0 A;  3P8D A;  2P4R A;  2EQJ A;  1AWO A;  2L5Q A;  4FYV B;  1M9S A;  1M4Z A;  1PHT A;  4LDY A;  4DEX A;  3PT9 A;  3OYD A;  2YHT A;  2HBP A;  4FW1 A;  1JRI A;  4MZT A;  2O4X B;  2QK0 A;  1AHJ B;  2MMP A;  3CME A;  5GAO l;  1ZLM A;  2DZC A;  2DL4 A;  4M7D F;  5AT1 B;  1TTH B;  4A54 A;  3CC4 T;  3M5A A;  4OB1 B;  2K5L A;  4BUG A;  1VQ4 T;  1VQP Q;  1VQ8 Q;  5GAN e;  5IAY A;  2HDA A;  1D0Y A;  1K0X A;  3FJ5 A;  1WNL A;  1XTD A;  4MMK A;  1QCN A;  4C0Z A;  3I5R A;  2K2V A;  1OYX A;  4Z8A A;  3VS1 A;  2EJ9 A;  1W1F A;  3BW1 A;  1M8V A;  3UA6 A;  4M77 E;  1HK9 A;  2DD4 A;  3DB3 A;  4QKU A;  5HK3 A;  2XHC A;  3KXT A;  2VGN A;  3PVQ A;  5GMK h;  2L89 A;  4M78 C;  1OI1 A;  5GAN 2;  2FZC B;  2DE0 X;  2E12 A;  1Y96 B;  5LL6 S;  5FU7 C;  4OB2 B;  4B6M A;  3OY9 A;  1VQL Q;  3MEA A;  1OQK A;  4M7A F;  5CK9 A;  1Z9Q A;  2DYB A;  5LJ3 d;  5KYY A;  1NE8 A;  4C8Q D;  2COZ A;  4E7S A;  2CZ7 B;  1N9R A;  1YNZ A;  2K2M A;  4A63 B;  3PFS A;  4A4E A;  3I55 T;  1VYV A;  1EZZ B;  3VYH B;  1RAE B;  4C0D B;  2K57 A;  2OTJ A;  3BDL A;  3OBY A;  4C8Q A;  3GNF B;  4JRK A;  1CKB A;  1M8M A;  3H0F A;  2IG0 A;  1ZHI A;  4IIO A;  2F1L A;  3ME9 A;  4Q5W A;  3UWN A;  4BE2 A;  3CCS T;  4KUL A;  5I22 A;  1LCK A;  2L3S A;  3JRZ A;  1AWJ A;  4HT9 A;  1RI0 A;  5GAM h;  2DA9 A;  4MZP A;  1MNE A;  4NL2 A;  2Z0W A;  5AYF A;  4AFS C;  3J7A F;  4PJO C;  3EHQ A;  3M58 A;  1W6X A;  4HA8 A;  5LJ3 g;  1RAA B;  5CKD A;  3OB9 A;  2AKK A;  4BDY A;  1QCO A;  2KVQ G;  1OEB A;  1YI2 T;  2A36 A;  4BY6 B;  5CCA A;  1B34 A;  4OF1 A;  4RMO A;  1JJ2 S;  1XOV A;  2VXF A;  4J9I A;  3CME Q;  4OMN A;  2NUP B;  2NUT B;  1TWB A;  2KK4 A;  3H9N A;  1X69 A;  3QO3 A;  1VUB A;  2L3Q A;  4HCB A;  2ROL A;  2RI2 A;  3FEO A;  3FLG A;  1Q82 C;  1VQO T;  3RUX A;  4D8K A;  1GCP A;  3M0T A;  4OML A;  1IRE B;  2RQV A;  1E6H A;  3MHX A;  5FU6 B;  3M59 A;  1QP2 A;  2E3H A;  2FZG B;  2J05 A;  2KRM A;  4KH0 B;  2RF0 A;  1X6B A;  1KK7 A;  1MMD A;  1JJ2 A;  1K9M U;  4NS5 A;  5IXB A;  4QVD A;  4PJO G;  2H3J A;  2R5A A;  4C92 B;  3G7Z A;  3M0U A;  1H8K A;  1GRI A;  2BE9 B;  5FRM A;  4M75 C;  2D8H A;  1JXO A;  4J6X A;  4J7F A;  5IXF A;  2KSS A;  1TOV A;  1ZBX A;  1YN8 A;  3LLR A;  2JTM A;  3UA7 A;  1X27 A;  1K8A C;  2CP7 A;  1ZSZ B;  2EQK A;  3PTA A;  2OI3 A;  1MMA A;  1CKA A;  3A5Z B;  2DXT A;  4LDX A;  1G8X A;  5L23 A;  2OTJ Q;  1UUE A;  3S3O A;  5LJ5 e;  4J8O A;  2M9U A;  4FYY B;  3HFN A;  5GAN h;  4M75 G;  4OP0 A;  3TQ7 P;  2MWP A;  1WHL A;  5GAN 8;  1G5V A;  1W70 A;  3J80 E;  2X51 A;  5CO7 A;  5GMK l;  2BUD A;  4Y92 A;  3CBM A;  1NYF A;  1YJ9 T;  2QQR A;  3L2Q A;  1YHQ T;  2X35 A;  3HKS A;  1NM7 A;  1B3Q A;  5GAM f;  3JCM J;  2KT8 A;  1BCO A;  3OBW A;  2QEX T;  1QCF A;  1VQK A;  3VS3 A;  4XQ3 A;  4A4H A;  2HZY A;  1V29 B;  2R57 A;  2BIV A;  2DXC A;  1YCS B;  1SHG A;  1Q82 R;  5LJ3 h;  3I5S A;  4JRI A;  4A4G A;  2J6K A;  4WCI A;  4DBR A;  4FT2 A;  1R0C B;  2V8K A;  3IQL A;  2CS7 A;  3CPW S;  2E5K A;  4X1V A;  3V7S A;  1NBE B;  1WPY A;  1YIT A;  1VQ6 A;  1E7O A;  1B07 A;  3NFC A;  1HXD A;  2CZ0 B;  1N8R C;  1WIE A;  4M77 F;  1DJ7 B;  3CCR T;  2RK2 A;  1QVG S;  4RKU E;  1VQ9 T;  2KRS A;  1RAB B;  2CKK A;  1KSW A;  3OMC A;  4EMK A;  1XNI A;  3FJP A;  2K3B A;  1QLY A;  3CQT A;  2SRC A;  1HD3 A;  2VYT A;  4JJD A;  4AT1 B;  2LQK A;  2DEU A;  3CPW A;  1K8A R;  2YLC A;  3UPU A;  4PFO A;  2D6F A;  2CGH A;  2VGM A;  2VC8 A;  1JXM A;  1HJD A;  1QVG A;  3I56 T;  1YWO A;  1BIB A;  4XTX A;  4B9X A;  8ATC B;  3EG1 A;  2OTL A;  2RK1 A;  2LMJ A;  4M78 B;  3TVT A;  5HK0 A;  3JCM e;  4ZGD B;  2C0I A;  2MOX A;  1FXX A;  1J3T A;  5FU7 B;  3V7R A;  1OZ2 A;  1KC8 C;  4LD6 A;  4FT4 A;  2G3R A;  3QWX X;  2ECZ A;  3CCQ T;  4M7D A;  3M4G A;  1FYN A;  1FWZ A;  1UGQ B;  2EYX A;  1TUG B;  2D8J A;  2EFI A;  4RTZ A;  5GAN f;  3H41 A;  3JCM b;  4BI4 A;  1AOJ A;  3GP8 A;  2LCS A;  3H6Z A;  4KBM B;  1C6V X;  3GOX A;  3DLM A;  2EW3 A;  5A2Q E;  2FVU A;  1AWX A;  4N0A C;  1D09 B;  2ZPH B;  4D6W A;  3OYK A;  4M7A D;  2EBP A;  4XU3 A;  3M55 A;  1NJI U;  3FIF A;  4HVW A;  1D1B A;  4XTZ A;  2QA4 T;  1RAD B;  2KQW A;  3G4S T;  1VQK Q;  1WFW A;  1KIK A;  1LVK A;  4L59 A;  2K6D A;  4N4G A;  2J6F A;  2CH4 A;  2AZS A;  2K79 A;  1PG5 B;  2DL7 A;  2YLB A;  5I11 A;  1NEG A;  1KD1 U;  4M7A A;  2RHU A;  4WF2 A;  5KYU B;  4PJO B;  4ANJ A;  5I2M A;  3PE0 A;  3CC7 A;  1YIT Q;  4LXC A;  2AIR B;  2VXE A;  5A0G A;  2HKQ B;  2X4W A;  4FU6 A;  4IUV A;  3JAM E;  3ER0 A;  4CRI A;  1JQQ A;  5GMK e;  4M78 E;  2MWO A;  2QTV A;  4KUD K;  2BZY A;  3QWY A;  3GPL A;  4F14 A;  2HBW A;  2PTK A;  3MET A;  1U1S A;  2GNC A;  1QQJ A;  3ZBD A;  4XK8 E;  5IH2 A;  2IPO B;  1YJW T;  2JTE A;  3EG9 B;  1RI9 A;  4JPB W;  2JM9 A;  1KC8 R;  2G6F X;  4PNO A;  2RMO A;  4LD9 K;  3OS0 A;  4HXJ A;  3GNG A;  4F7U B;  2OTL Q;  3OS5 A;  2B86 A;  1M27 C;  1WJQ A;  4HT8 A;  5GMK m;  2F5T X;  2RO0 A;  1KQS P;  4QVC A;  3CXC S;  1K73 U;  4NL3 A;  1WJR A;  4XU2 A;  3VRY A;  4AG2 C;  1GBQ A;  3SWN A;  2L2P A;  1VIF A;  3H0I A;  3V8J A;  4IUP A;  3CCE T;  3OS1 A;  2HKN A;  2FPD A;  1KJW A;  5D6W A;  2JUF A;  1PSE A;  3O5Z A;  5GAO q;  3CMA T;  1NG2 A;  4JZ4 A;  2EJF A;  2YUQ A;  1ZSZ C;  3CCU T;  3P8B B;  3CXC A;  4PJO E;  1VQ4 A;  2LQW A;  3LWI A;  4AMC A;  3CBO A;  3SFM A;  3A8O B;  1WHH A;  2F5K A;  2KYB A;  2QQA A;  2XK0 A;  3TSZ A;  1UJ0 A; 
#chains in the Genus database with same CATH homology
 5DM7 R;  1O75 A;  2JZ2 A;  4B9W A;  5A0D A;  4FM4 B;  1NE8 A;  4C8Q D;  3OYE A;  4MML A;  2CZ7 B;  2ZCF B;  1N9R A;  4Y28 E;  2M16 A;  3PFS A;  3CCE A;  4A4E A;  4N4H A;  4C92 G;  3I55 T;  3MEU A;  4EMG A;  1VQK T;  3L2W A;  3VYH B;  1I4K 1;  3RIR A;  3C94 A;  3KUF A;  5GMK j;  4C0D B;  2K57 A;  2QQB A;  3E19 A;  3BDU A;  2OTJ A;  4C92 D;  2KMT A;  3CMA A;  5LJ5 d;  2DO3 A;  3BDL A;  3OBY A;  1W2B S;  4C8Q A;  3GNF B;  4JRK A;  5GAO n;  2M1H A;  1K9M C;  3ZFJ A;  1I8F A;  1UEB A;  5LJ3 f;  3CCU A;  2D9T A;  2IG0 A;  1YJN T;  3SWN B;  1ZHI A;  2WSC E;  1S72 T;  1QVF S;  3JCM Q;  3UDC A;  2P0Q A;  5GAO m;  3ME9 A;  3CCV A;  4Q5W A;  3Q1J A;  3OYJ A;  3UWN A;  5LJ3 d;  1YIT T;  3J81 E;  2HAX A;  4M7D D;  1KQ1 A;  4C92 A;  4BE2 A;  3CCS T;  4KUL A;  2YRV A;  3JCM W;  3FB9 A;  3JB9 G;  2JVV A;  3JRZ A;  4JRP A;  4M7D B;  4C0F A;  4X34 A;  4HT9 A;  4M75 E;  3I55 A;  1RI0 A;  5GAM h;  1Y7X A;  4MZP A;  3C4S A;  4NL2 A;  4RG2 A;  5AYF A;  3J7A F;  2L3R A;  3JB9 D;  4PJO C;  4C0G A;  3G71 T;  3OYB A;  3M58 A;  3V8K A;  2GFU A;  2QI2 A;  4PLI A;  4HA8 A;  5LJ3 g;  5CKD A;  5EG2 A;  3RES A;  4J6W A;  3EFR A;  3OB9 A;  4M78 A;  2ZPE B;  4BDY A;  3OYI A;  2KVQ G;  3CBP A;  1QVF A;  3CCJ A;  5C0M A;  1YI2 T;  2RH2 A;  4BY6 B;  5CCA A;  1YJN A;  2ZPF B;  1B34 A;  2KDS A;  4OF1 A;  4RMO A;  3OW2 S;  1BKB A;  4XAX B;  4IUQ A;  1S72 A;  1JJ2 S;  1XOV A;  2VXF A;  3JB9 I;  1O9S A;  2RA2 A;  2O01 E;  3SD4 A;  1KQS A;  1BI0 A;  2EIF A;  3INZ A;  2Y4X A;  2FB7 A;  5KCO A;  3KBG A;  2KK4 A;  1Q7Y U;  3EAE A;  3CCS A;  3QO3 A;  2WSE E;  5LJ5 g;  4E7I A;  1M1K U;  1VUB A;  2XU8 A;  4HCB A;  4DOV A;  3EFS A;  1KG1 A;  2RI2 A;  2RI3 A;  1KHC A;  4EPC A;  1MGQ A;  3FEO A;  5GAM j;  1YBY A;  2MAM A;  3FLG A;  2KY9 A;  1VQO T;  1Q82 C;  3RUX A;  3SDZ A;  4R56 A;  2PUO B;  3M57 A;  2PUK B;  1I5L A;  4M77 G;  5HY6 A;  1M5Q 1;  2HNI A;  3A8L B;  3QPH A;  4XTW A;  4C8Q B;  3HP9 A;  3GLX A;  3OYA A;  1IRE B;  3G71 A;  4UC4 A;  4A4K A;  1M1F A;  3G6E T;  3MHX A;  5FU6 B;  4M7A B;  1N6A A;  2XD0 A;  3M59 A;  4L5G A;  1QP2 A;  3E9F A;  5GAO r;  4M77 D;  3OA6 A;  3LW5 E;  2PVG B;  2RHX A;  2R5M A;  4BE1 A;  2RB6 A;  3OW2 A;  1JJ2 A;  2X4X A;  4NS5 A;  1K9M U;  1YI2 A;  3MP8 A;  4QVD A;  4PJO G;  2H3J A;  2R5A A;  1R8O B;  1SSF A;  4HCC A;  4C92 B;  3OYC A;  3G7Z A;  3DLL A;  3OYL A;  2HQX A;  4LDV A;  1IZ6 A;  1TH7 A;  5FRM A;  4MDX A;  2PQW A;  2FHD A;  2LT4 A;  3OSV A;  4M75 C;  4PJO D;  1BI1 A;  1H64 1;  3X26 B;  1BIA A;  1BI3 A;  4E7L A;  3VV0 A;  2E6Z A;  4J6X A;  4M77 A;  2XID A;  3LGL A;  3LH0 A;  4J7F A;  3NTK A;  1Q86 U;  2XIC A;  2KSS A;  2RHY A;  3VUZ A;  3OSS C;  4BB7 A;  3QSU A;  1ZBX A;  3RKX A;  1VQO A;  2VV5 A;  4LDU A;  4V2S A;  2AHJ B;  4RG8 A;  4J6Y A;  1XQH A;  2JTM A;  3FDR A;  3LLR A;  4FSX A;  4C8Q F;  3L2R A;  3CC4 A;  1OZ3 A;  1KHI A;  4MDW A;  2HQE A;  1K8A C;  1B34 B;  2P0K A;  4PJO A;  2EQK A;  1P92 A;  1ZQ1 A;  5LJ3 e;  3A8H B;  3MEV A;  3JCM d;  3PTA A;  2K3Y A;  2RD1 A;  3HRS A;  3QZ5 B;  3S3N A;  5DY9 A;  2RJE A;  2QDY B;  3A5Z B;  3GF5 A;  3QKJ A;  2P0P A;  2PU9 B;  4J7I A;  4VUB A;  2JTF A;  2LX9 A;  1Q7Y C;  5CKH A;  2DXT A;  4LDX A;  4M7D E;  1QVP A;  1H3Z A;  3RER A;  1M1K C;  1WGS A;  4C92 F;  4OGC A;  4OGE A;  4IUT A;  5CIU A;  4X9C A;  2DD5 A;  2V8J A;  3P8H A;  3N5B B;  4EMK C;  1G3S A;  3MP1 A;  2WSF E;  2DZ9 A;  2EQM A;  4DQ2 A;  5LJ5 e;  3S3O A;  5D6X A;  3DB4 A;  4PLL A;  1Y71 A;  4J8O A;  3L2U A;  2M9U A;  4L6V 5;  3HFN A;  2LC4 A;  4RCC A;  2X4Y A;  2FL7 A;  5GAN h;  2PVD B;  1Q82 U;  4M75 G;  2RHZ A;  4OP0 A;  2MWP A;  3JCM f;  5CQX A;  4ZN3 A;  2RJF A;  2KAF A;  3CEY A;  5GAN 8;  3J80 E;  1G5V A;  5CQY A;  2LCL A;  4N4I A;  3RKY A;  1VIE A;  5CO7 A;  5GMK l;  2BUD A;  3CBM A;  4A4F A;  4M75 D;  2EKO A;  1UGP B;  5GAN 5;  3LWH A;  3BFM A;  4M78 G;  4JS4 A;  4Y91 A;  1YJ9 T;  2QQR A;  3X28 B;  4NOY A;  4C0D C;  2XDP A;  3L2Q A;  1YHQ T;  2X35 A;  3HKS A;  1VQ6 T;  3QYH B;  2P4T A;  3V7C A;  5GAN 4;  1N27 A;  3JB9 F;  4CI0 C;  3HPW A;  1NPR A;  4M78 D;  3HRU A;  3VU3 C;  4M77 B;  2Y4Y A;  5GAM f;  5KH6 A;  3JCM J;  1Q86 C;  3OBW A;  2QEX T;  4F7U E;  2DJZ A;  4M7A E;  1VQK A;  4M75 A;  2EAY A;  4XQ3 A;  4A4H A;  1W2B A;  1Q81 U;  4HKE A;  3CC2 T;  2VUB A;  1V29 B;  2R57 A;  2BIV A;  2DXC A;  3QZ9 B;  3JCM g;  5GAN j;  3S3M A;  3PNW C;  5LJ3 h;  2DIQ A;  5L8R E;  4JRI A;  2MF2 A;  4JLG A;  2LDM A;  1W4S A;  3S6W A;  3QDR B;  2EYQ A;  3VKI A;  2WAC A;  4A4G A;  3HL8 A;  3T9N A;  3TU4 K;  4M7D C;  2ZGW A;  2E41 A;  4FT2 A;  1K8A U;  2E6N A;  2K5I A;  3PGG A;  3CME T;  2V8K A;  2CS7 A;  1D3B A;  3CPW S;  1LOJ A;  4RCB A;  1YJ9 A;  4BE0 A;  1KC8 U;  3V7S A;  3C12 A;  5M9O A;  2CZ6 B;  1WPY A;  5GAM g;  4C5E A;  3OYH A;  1YIT A;  1YHQ A;  2E65 A;  2E64 A;  3X25 B;  1VQ6 A;  2LNV A;  3NFC A;  2DEQ A;  3OYY A;  1HXD A;  2CZ0 B;  2JNG A;  3QYG B;  4XTV A;  3WVE B;  5LJ5 h;  3OYM A;  1N8R C;  4M77 F;  5C6S A;  5GMK i;  2QEX A;  1DJ7 B;  1EIF A;  3M56 A;  4BY6 C;  2RK2 A;  2K3X A;  3DKM A;  3CCR T;  4DA4 A;  1QVG S;  2OTL T;  4RKU E;  5KE2 A;  3SB2 A;  1X6O A;  4BAC A;  3JCM P;  1VQ9 T;  2CKK A;  4C5G A;  4IUU A;  3OMC A;  4HCZ A;  2E1H A;  4EMK A;  4E47 A;  1XNI A;  2OAU A;  3M9Q A;  5LJ3 j;  1VQP T;  1VQ8 T;  2JOY A;  3CC2 A;  3FJP A;  2GFA A;  2ZPG B;  5IN1 A;  4JJN K;  2RJC A;  2DXB A;  1VQN T;  4DOW A;  4XU1 A;  2A3L A;  3CCM T;  2VYT A;  4PJO F;  3PIO A;  1NJI C;  2LQK A;  2DTO A;  2DTI A;  3CPW A;  4E7H A;  5GAN 6;  3HFO A;  5CKF A;  5CKE A;  4PL6 A;  3RKW A;  3LYI A;  2DKG A;  5GAO p;  2YLC A;  4GY5 A;  1QW1 A;  5GAN 3;  4EDU A;  1UGS B;  2K5F A;  3RMQ A;  4QVZ A;  2CGH A;  3OQ5 A;  3UPU A;  2D6F A;  2VGM A;  4O6J A;  1WQW A;  2VC8 A;  2A7Y A;  2CYZ B;  5FU6 C;  1M90 C;  2L8D A;  5LJ5 j;  4M7A C;  2EJG A;  2LVM A;  4YTL A;  3PMI A;  2QXF A;  3JSC A;  1KD1 C;  4M7D G;  4M75 B;  4JRQ A;  1QVG A;  1Q81 C;  3QJ6 A;  3ZEH A;  3I56 T;  1BIB A;  4XTX A;  3HHT B;  1U1T A;  3JCM c;  4B9X A;  2RI5 A;  4X9D A;  3CCR A;  3H8Z A;  2GQV A;  4C92 C;  2RK1 A;  2OTL A;  1VQ7 T;  3QUI A;  5GAN d;  1VQL T;  4JUV A;  4M78 B;  5HK0 A;  3JCM e;  2F69 A;  4OB3 B;  4ZGD B;  1VQP A;  1U8R A;  1VQ8 A;  3G6E A;  1BYM A;  1M1G A;  1FXX A;  2LCC A;  5FU7 B;  3V7R A;  1OZ2 A;  4FIB A;  4ZGE B;  1VQN A;  1D3B B;  3VYG A;  3X20 B;  4BI8 B;  3CCM A;  2LTO A;  1QP3 A;  2DXU A;  4BD3 A;  3FC3 A;  4ZTF A;  1KC8 C;  4PKC C;  3AHU A;  2DTH A;  2X4J A;  2RM4 A;  3WVD B;  4ZGJ B;  4LD6 A;  4QQD A;  2K4Y A;  4FT4 A;  2Y90 A;  2CZ1 B;  2G3R A;  1YIJ T;  2OTJ T;  3QXE B;  3CCQ T;  3M4G A;  3GIB A;  4M7D A;  1FWZ A;  1UGQ B;  3X24 B;  2DAQ A;  4GLK A;  1VQ5 T;  3OYN A;  5GAM e;  3E9G A;  2EFI A;  4EMH A;  4FL6 A;  5GAN f;  3JCM b;  4IUR A;  1N8R U;  5GAM d;  4O5V A;  3MEW A;  4BI4 A;  4M75 F;  3I56 A;  5I2S A;  3L2Z A;  3GP8 A;  4Z02 A;  4JS5 A;  4F7U G;  3H6Z A;  4KBM B;  1YCY A;  3GOX A;  3MCA B;  3DLM A;  3QHS A;  3CCV T;  5A2Q E;  4M7A G;  1VQ7 A;  2FVU A;  4LDW A;  4TVR A;  3NTI A;  4J5Y A;  4JLI A;  4II1 A;  3V8L A;  1VQL A;  4N0A C;  4P5N A;  2ZPH B;  3CC7 T;  3TCJ A;  4M78 F;  4D6W A;  3OYK A;  3URG A;  2D0Q B;  4M7A D;  4XU3 A;  3M55 A;  4QQ6 A;  2O4X A;  2RJD A;  1NJI U;  3FIF A;  4XTY A;  1MHN A;  4E7J A;  2MI6 A;  3A8M B;  4XTZ A;  2QA4 T;  3MP6 A;  2KQW A;  3G4S T;  2DVE A;  1YIJ A;  1JB0 E;  2LRQ A;  2I2L A;  2GF7 A;  1PSF A;  5FRN A;  3CCQ A;  4L59 A;  2ZPI B;  3M54 A;  2M0O A;  2QQS A;  4C8Q E;  4N4G A;  1VQ5 A;  4C5I A;  5GAN g;  3OYG A;  1K73 C;  4F7U A;  1M90 U;  3SWN C;  2YLB A;  3OMG A;  2BKD N;  5GAN 7;  2ZPB B;  5I21 A;  3CCJ T;  1I81 A;  3CCL T;  3R6O A;  1KD1 U;  4M7A A;  2RHU A;  3JCM h;  4WF2 A;  3NTH A;  2LQ8 A;  3HSB A;  4BDZ A;  2R58 A;  2C06 A;  3OS2 A;  4PJO B;  4KUI A;  2EQU A;  5CAI A;  2LT1 A;  3QII A;  4M77 C;  4BI3 A;  5I2M A;  4C92 E;  4ME7 A;  5KE3 A;  1Y07 A;  2IVW A;  4ZTJ A;  3CC7 A;  4OVA A;  2E10 A;  1KQS S;  5IT9 E;  3ASK A;  2QTX A;  3FRN A;  2VXE A;  4A53 A;  5A0L A;  2DK3 A;  5LJ5 f;  5A0G A;  3VUB A;  5J26 A;  3F70 A;  5FRO A;  2X4W A;  5CKB A;  3LX7 A;  3UT1 A;  3JB9 J;  1KQ2 A;  4FU6 A;  2XDD A;  4IUV A;  3JAM E;  2B8A A;  5FLX E;  2QA4 A;  1X01 A;  2V8I A;  5KCH A;  3G4S A;  4E7K A;  3ER0 A;  2PVO B;  4CRI A;  3L42 A;  5GMK e;  2XI9 A;  1VQM T;  2HD0 A;  3P8D A;  4M78 E;  2MWO A;  1Y96 A;  2EQJ A;  2L5Q A;  3VJP A;  3CCL A;  3QJY A;  1M9S A;  4KUD K;  1G3W A;  1M4Z A;  4LDY A;  3GPL A;  4OMF B;  3PT9 A;  3OYD A;  1FX7 A;  2YHT A;  2HBP A;  3E1S A;  3MET A;  4MZT A;  1JRI A;  3O8V A;  4MZM A;  1U1S A;  4J83 A;  3ZBD A;  4XK8 E;  2O4X B;  5J39 A;  2RHI A;  3CPF A;  1AHJ B;  2MMP A;  1YJW T;  3PMT A;  1N9S A;  3L2V A;  4N0A A;  2DPP B;  4QQG A;  3CME A;  4C8Q C;  5GAO l;  1NZ9 A;  2DZC A;  3CD6 T;  4PNO A;  1LNX A;  4M7D F;  4ELZ C;  1G3Y A;  2XG8 D;  4JDS A;  4LD9 K;  3JB9 H;  3OS0 A;  1WJS A;  4A54 A;  3GNG A;  4F7U B;  3CC4 T;  3OS5 A;  2E5Q A;  3M5A A;  4OB1 B;  4ELY C;  2K5L A;  4BUG A;  1WJQ A;  4ZN1 A;  3QG1 A;  1WQ7 A;  5GMK m;  2F5T X;  3PIP A;  1VQ4 T;  4HT8 A;  2RO0 A;  3HRT A;  1VQM A;  5GAN e;  4QVC A;  5IAY A;  3CXC S;  2E70 A;  4NL3 A;  1K73 U;  1WJR A;  1LJO A;  1WNL A;  1BI2 A;  1XTD A;  3C95 A;  3MO8 A;  4MMK A;  4XU2 A;  3RMS A;  1VQ9 A;  4ATO A;  3LGF A;  3SWN A;  4IKF A;  5DLQ E;  3JCM V;  1VIF A;  4C0Z A;  1GXI E;  3V8J A;  1G3T A;  2JN0 A;  5DLO A;  2K2V A;  1OYX A;  1X75 C;  2EWN A;  5D6Y A;  2EJ9 A;  4IUP A;  1UGR B;  3CCE T;  2FYK A;  1UB4 A;  3BW1 A;  3QBY A;  3OS1 A;  1M8V A;  3TEE A;  4M77 E;  3OYF A;  3M53 A;  1HK9 A;  1YJW A;  2DD4 A;  4XU0 A;  2DIG A;  3DB3 A;  5D6W A;  4C5H A;  2XKO C;  5HK3 A;  2XHC A;  3KXT A;  2JUF A;  1PSE A;  2VGN A;  5GAO q;  5CVI A;  5GMK h;  3CMA T;  2L89 A;  4M78 C;  3WXM B;  3CD6 A;  1OI1 A;  2NLU A;  5GAN 2;  2ZZD A;  2EJF A;  2XDB A;  3BY7 A;  4OB0 B;  2E12 A;  5CR2 A;  1Y96 B;  5LL6 S;  3JCM X;  5FU7 C;  1RL2 A;  4OB2 B;  1JBM A;  3CCU T;  4QW2 A;  3OY9 A;  4KT0 E;  3P8B B;  4F7U F;  3CXC A;  4PJO E;  3A8G B;  3MEA A;  5HKC A;  2GCX A;  1VQ4 A;  3M4Y A;  4R55 A;  3LWI A;  4EMK B;  1NPP A;  4C8Q G;  3CBO A;  2QQ9 A;  4M7A F;  5J3B A;  3SFM A;  3TRE A;  3A8O B;  2F5K A;  5CK9 A;  3L1A A;  2QQA A;  2XK0 A;  4XTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...