1V76A

Crystal structure of archaeal ribonuclease p protein ph1771p from pyrococcus horikoshii ot3
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
GRVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGDRIWKVPKDVSIFEFEADDGTKIKIPGERLVGRPEMRLKKRWKKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of archaeal ribonuclease P protein Ph1771p from Pyrococcus horikoshii OT3: an archaeal homolog of eukaryotic ribonuclease P protein Rpp29
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Rna binding protein
molecule keywords RNase P protein Ph1771p
total genus 21
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2003-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01868 UPF0086 Domain of unknown function UPF0086
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.210 Mainly Beta Roll SH3 type barrels. Ribonuclease P/MRP, subunit p29 1v76A00
1TSFA 1PC0A 1TS9A 2KI7A 1OQKA 1V76A 2ZAEA
chains in the Genus database with same CATH superfamily
4L59A 2P84A 3VJPA 5GAOn 3DLMA 1QKWA 4M77B 1YITA 1YCYA 2FO0A 2V1RA 1N6AA 1IZ6A 4XQ3A 3G71A 2OTLT 4C8QG 1WHGA 5LJ3j 1KQ2A 2PQWA 1PRLC 5GANe 3OS0A 1K73U 3NTIA 4FYXB 3OYEA 3L2WA 1PC0A 3JAME 1V1CA 2ZPHB 3JB9F 1WLPB 1NJIR 2KYBA 1Q7YU 2NLUA 1I5OB 4AG1C 3MEAA 3THKA 1YFNA 2E3HA 1UG1A 2HAXA 2E10A 3CC7T 4N0AA 4N4IA 4B6MA 2CKKA 1K4US 2YHTA 1ZHIA 1ZA1B 3EFRA 3VS0A 1X75C 5CO7A 3RIRA 5KE2A 2BZXA 2LZ6B 1YWPA 2DAQA 1KC8R 1R77A 3LW5E 1TUCA 1UTIA 1X27A 3CC2A 2DIQA 2YRVA 1BB9A 5IN1A 2HMAA 3M53A 2WSCE 3PMIA 1C0MA 2F2WA 2HCKA 3SB2A 4R55A 3C0CA 3CD6T 1Q95G 1ZQ1A 1WQWA 4XTYA 4E7LA 3FEOA 2NUZA 1IHWA 3HPWA 1OX9A 4QQ6A 5GMKm 1JQQA 1QVPA 2RM4A 4J9BA 1Y71A 2DEUA 4FM4B 3MP6A 2RK1A 2HZYA 4II1A 1AWXA 3CCUQ 2EYWA 1I0CA 4E7KA 1VQKA 4M7DG 1YCSB 4JJDA 2OTJT 2JXBA 5EG2A 1LOJA 1JBMA 1UGPB 1M90U 1Y0MA 3HRUA 4OVAA 2QGFB 2DTIA 3OYCA 2YSQA 3EH1A 2K3YA 4FU6A 2EQUA 2V26A 4OF1A 2K5LA 3HFNA 4HKEA 1VQPT 4M75B 3FC3A 4FYWB 1WHLA 2XG8D 1QVGS 2CREA 3I56Q 1OU9A 4Z89A 2K2VA 1VQ4T 1AVZC 5GAOq 2B86A 2JJ9A 2MPXC 2OAUA 3CC7Q 1MNDA 1VQOT 2ENMA 4OMPA 2F2VA 4M77E 4M7AC 3L2QA 4PJOA 3I9QA 3CCMQ 5L8RE 1PSEA 3CXCP 2LT4A 1QKXA 2CUBA 4LUDA 1Z9QA 4RTVA 4E7IA 3M59A 5IXFA 1LJOA 5GAMh 2DX1A 3HFOA 3I5RA 3RESA 1N9SA 3M56A 4C8QA 1OI1A 2CS7A 5IXBA 2M1HA 2YWWA 3WXMB 3V7CA 2EQIA 3NFCA 1T3LA 4IUQA 4A54A 2FEIA 2EQJA 4LDXA 4M75G 1K8AR 4LNPA 5KYUA 2P4TA 3QZ9B 5GAOr 2DXUA 1QVFA 3CCRA 2LRQA 4PJLA 1JB0E 2A28A 1B34B 1BK2A 1EFNA 3QG1A 2AT1B 4J9IA 3RR6A 1PM3A 1VQLQ 4J5YA 4JJNK 5CKFA 4PFZA 2NUPB 5FWBA 5J39A 2JT4A 2QQSA 1PKTA 1KHCA 1PG5B 3A1PA 5IAYA 2BZ8A 3CC4T 2VC8A 4EMHA 4JLIA 5KYUB 4HVVA 4ORZA 2O9VA 4D8DA 2CT4A 3M9QA 1WFWA 2I2LA 2QQRA 2QG9B 3QHSA 2DMOA 3UA6A 4OB3B 1VQ8A 3SDZA 3E2UA 1LCKA 3OY9A 4KUIA 1H3ZA 2RJCA 4M77G 3EGXA 2L89A 5LJ5e 4BY6C 4FYYB 3OW2A 2BZYA 1KSWA 2ED1A 3QSUA 1R0CB 1BIAA 2KE9A 3OBYA 3CCLT 2D9TA 3PNWC 1OQKA 2KSSA 1FWZA 1K8AU 2DL3A 5KE3A 4PLLA 1OV3A 3G6EQ 5GJVB 4FIBA 2XI9A 4J9DA 1GCQC 4F7UB 4M75A 1WXTA 2X3XD 2L2PA 2KI7A 4WCIA 4C5HA 3FJ5A 4F04B 2WSEE 1YIJT 1N8RU 1IRXA 3QWXX 4XU0A 2C06A 3KUFA 2LC4A 3X20B 2RH2A 2V8JA 4J9EA 4RTYA 1NM7A 2CH4A 2YRDA 1G2BA 1MHNA 4E2FB 1K9MR 1ARKA 4TVRA 4XTUA 2MAMA 5GANf 1M1KC 4YTLA 5ECAA 4KGXB 5GAN3 4A63B 4IUVA 5KYWA 3CPFA 2V8IA 3OB9A 1D09B 2QEXA 2QA4Q 2A36A 4IIOA 3HHTB 1IREB 5FU6C 2SRCA 3OYGA 4NS5A 4LN2A 1SHFA 5GAOp 2DPPB 1H92A 4E7JA 4OMQA 3M0QA 2V1QA 5CCAA 1EIFA 4E7SA 1UECA 4EIKA 3GF5A 1OZ3A 4OMLA 4C5GA 2FZCB 5M9OA 1W1FA 5GAMj 1GFDA 3V8JA 1ZBXA 2XKOC 2PTKA 1B3QA 1H641 1K9MC 1JXMA 1QVGA 3H0FA 4X9CA 2R5AA 1PD1A 2E5KA 4R56A 2ROTA 3VKIA 2F2XA 4F17A 3OSVA 2KNBB 2MCNA 1ZBJA 4M7DF 1C1AA 2DEQA 2H3JA 1ZSGA 1YN8A 3JCMb 3L2RA 1VQOQ 4BE1A 1UEBA 1M8VA 2ZPGB 3OYYA 1Y57A 4ZN1A 4CC7A 4DBFA 9ATCB 3ZEHA 2DTHA 2RNAA 2W10A 4RTUA 3M0UA 3RUXA 4EMKB 1YITT 1BI1A 1NLOC 2HD0A 2VB6A 3LYIA 2XD0A 1I5LA 3EGXB 3NMZC 1KK7A 2EJGA 2LNVA 4M7DD 1VQ6Q 4PNOA 1OOTA 3J81E 3M54A 2XU8A 4LD9K 3CBPA 1AWJA 5I2SA 2E65A 1X01A 5A0GA 3JB9I 1VQNT 3PE0A 4M7AD 2O9SA 5GAN4 2X9HA 4JRIA 3UDCA 1SRMA 2YLBA 4DEXA 3CCEQ 4RTTA 3JB9D 2HL3A 3CMAA 3CMEA 2DL8A 3VS6A 3PIPA 3FRNA 1UUEA 3I56A 5KYXB 4JS5A 3EG2A 3EG1A 1M3AA 1UGSB 2EAYA 2QASA 3HRSA 4PKCC 1Q82U 5GANd 2L3PA 4PJNA 2CP3A 2CZ0B 1GCPA 2R57A 3SFMA 3PFSA 5CKHA 3JRZA 2CP0A 1MNEA 1JO8A 2QQBA 3PVQA 3LH5A 2RJFA 1RAFB 1VQMT 2YUPA 2COWA 3A8LB 2FRYA 2D8HA 4IURA 2QTXA 5CKBA 3JCMf 3L42A 3CC4Q 2DIGA 2DERA 1TWBA 3P8BB 3QXEB 4J7IA 2O88A 5GAOl 2EPDA 2KBTA 1VUBA 1EZZB 3G71T 5HCKA 1OEBA 3CCVT 3PT9A 1TOVA 2E41A 2BUDA 3FIFA 2L3QA 2YLCA 1VA7A 1ZA2B 2AZVA 3A8GB 1GFCA 2CUDA 3V7SA 5KYYA 1M27C 1M90C 4DBRA 1SSFA 3E19A 2IIMA 4M75E 4C0ZA 2XMFA 3OYKA 2EYXA 2MYSA 5GANg 2GTJA 2ZPBB 4M7DE 4PJMA 2VASA 2IVWA 5GAMg 1TUDA 5IT9E 4D6WA 3NGPA 2I0NA 1HXDA 3NHNA 3V7RA 5DY9A 4C92G 4DQ2A 4J6XA 3O8VA 3CD6A 3A8OB 3R6NA 3LGLA 3VRYA 1U1SA 1QCNA 1NJIC 5L23A 3CCUA 4OB0B 3DKMA 2ED0A 5CR2A 3OYJA 2JOYA 1BI0A 4M78A 1UDLA 1WIEA 3BDUA 5FRNA 1WI7A 3X24B 2ESWA 3CCUT 2BTTA 1UGVA 1WHHA 1N9RA 3QPHA 2VVKA 3CCSA 3EHRA 4ZGDB 4JZ4A 2KY9A 2QQ9A 3HTRA 1ACMB 2LQWA 4M7AA 4MZMA 4XK8E 2VV5A 1WA7A 1WGSA 3KXTA 4HCBA 1NG2A 3HL8A 2QAZA 3CCST 1P92A 1G83A 4CRIA 3CCJA 1IXDA 3H8ZA 4M75F 2O31A 3EG3A 4Y92A 1YJNQ 3X28B 1OZ2A 3OYLA 1KQSA 3QJ6A 5GANh 2Y90A 1VQKT 3QUIA 3EGDA 3HKSA 1Q86R 2DK3A 3FJPA 5GMKe 5GAN2 1JJ2P 4JRPA 4E47A 2MOXA 4C0DC 4IUUA 1AHJB 2EYQA 2EGAA 1ZSZC 2RO0A 3QKJA 1BIBA 4Q5WA 4HVUA 1VQ4A 3P8HA 3C4SA 2LT1A 1YI2Q 4M7AE 4HT8A 1D3BB 1VQ8T 3L1AA 1QP2A 4BB7A 5LJ3d 5DLOA 1PRMC 4J9HA 3CC2Q 3JCMQ 1HD3A 3P8DA 2XDDA 3CEYA 2DXBA 1X2KA 2EVRA 2DLPA 4CC3A 1BCOA 4M77A 4M78E 2EQMA 3JCMW 3OYAA 2QI2A 2J05A 3LGFA 4ZGJB 3QBYA 1ABQA 2AKKA 2QA4A 3M0PA 5AYFA 3GIBA 5CIUA 1M2VB 1S72T 2KEAA 2K79A 4M77C 5A0DA 3VYHB 3CCRQ 1GXIE 1SHGA 4OMOA 4OB1B 2DXTA 4GLMA 4M7DA 3OYDA 1FMKA 2KROA 3OSSC 1Q81C 1YIJA 3LH0A 2NUPA 2EYYA 1AWOA 1NPRA 4A4KA 1E7OA 3H0IA 4EMKC 1SSHA 3MPUB 5GAMe 1OX8A 4KGZB 2HQXA 2YUOA 2EKOA 3EFOA 3OS1A 1ZLMA 2EIFA 4XTZA 2VGNA 3CCET 2GFUA 4XU3A 1M2VA 3NPFA 2CSIA 2X4XA 4M75D 4PJOF 3RDVA 3G4SA 4OB2B 4UC4A 2CGHA 4F7UF 4J8OA 1ZSZA 2KK4A 4M75C 2JVVA 3I5SA 4N4HA 1QCFA 5DLQE 1WYXA 2RHIA 4F7UG 2RQRA 3CCLA 3J7AF 4ZGEB 3E1SA 2CZ7B 4C0FA 4IKFA 1RAAB 3OW2P 2C0TA 3JSCA 2RK2A 1GRIA 2GTOA 2XDPA 3EFOB 1MV3A 4RTZA 5D6WA 2D6FA 2MK5A 3JB9H 1CKAA 2MF2A 3MKDA 1FX7A 4RUGA 1K0SA 4J6WA 2K4YA 3JCMe 2EJFA 4M7AG 4C92F 2FB7A 4PLIA 2D8JA 3NTHA 1VQ7T 2XICA 3A98A 3JCMX 3E9GA 1PNJA 3DB4A 3AHUA 2E6NA 2EW3A 2ZPEB 1NE8A 3QDRB 3UF4A 5FW9A 3GNGA 2DO3A 2PNIA 2NWMA 4OMMA 3VV0A 2DZ9A 2O4XA 2HNIA 3VS2A 2M51A 3F70A 4PFOA 1AZGB 4ATOA 4QVZA 4HVWA 3VS5A 2DYIA 2BKDN 2Y4XA 4KULA 1EX4A 3SHWA 5KYNA 2FL7A 1K1ZA 1VQ5T 3LX7A 1QCOA 1NYGA 1X2QA 4AT1B 5LJ5j 4BI4A 2JTEA 1D1BA 2AKLA 4RMOA 1QMCA 4JJBA 2AIRB 2M0OA 4M78B 1IGUA 1SEMA 2L8DA 2DJZA 3JCMd 3LWIA 2ROLA 1NEBA 4IIMA 3ZFJA 2HQHA 4Y28E 5IHIA 1K9MU 2DA9A 1VIEA 2LJ1A 5CQXA 3CC7A 5J3BA 1MMGA 4Z8AA 4C92E 1M3BA 4EDUA 5DM7R 5I22A 3L2UA 2ECZA 2K5IA 2HEQA 2GCXA 4MDWA 4JZ3A 1I1JA 4FL6A 2D1XA 1ZUKA 1VQ4Q 3CC2T 1J3TA 2QK0A 1Y96A 4XU2A 3SD4A 4OGCA 1RACB 1IHVA 4JRQA 2JW4A 2KXCA 1M1FA 4AMCA 2NYSA 4ANJA 2J6KA 1M4ZA 3VU3C 2J7IA 1I4K1 3OYMA 2K57A 1VQMA 1ZSZB 1CKBA 3VS3A 2JTMA 2KVQG 4LDWA 1RAGB 2V8KA 2HDAA 3UT1A 1Y96B 1WJSA 2F1LA 3M58A 3T9NA 1K73C 1ZUUA 2FPFA 4GLKA 4WF2A 2OTLQ 1PCXA 3X26B 2OTLA 1VQ5Q 4JPBW 4M4ZA 1TG0A 4C92C 3J80E 1VQLA 2E64A 3H9NA 5CKEA 1M90R 1QW1A 1N27A 2M16A 3OA6A 4ZN3A 2GGRA 5IHKA 2CH4W 5LJ3e 4F7UA 4RCBA 1Y7XA 4C8QC 1D0YA 4M7DB 4AFQC 4R0KA 2RQWA 2BIVA 3ZBDA 1VYVA 2LNHB 3QO3A 2C0IA 3M0TA 2KMTA 2DRKA 2PVOB 1WNLA 1RAIB 3S6WA 4HCZA 3RNJA 4KBMB 2R5MA 3CCQT 4ELZC 2E70A 1SRLA 4Y91A 2AK5A 3CMEQ 1NBEB 1GBRA 1BYMA 3NTKA 1AEYA 2LMJA 3CCQA 3PVLA 4BI8B 6AT1B 1VQOA 1M3CA 3MEWA 4RCCA 1IB8A 2E4HA 4BDZA 1T0HA 1V29B 2YDLA 2DVEA 2DTOA 4C8QE 3QYGB 4IUPA 2WACA 2G6FX 4HCKA 2RHXA 4OMFB 5GAN6 3CCLQ 2DYBA 3EFSA 2COYA 4BD3A 2OI3A 3ULRB 2DXCA 1K76A 1KQSS 3RKWA 3RMQA 3JCMP 5GMKl 2AZSA 4JUVA 1W2BS 3FLGA 4X1VA 4PJJA 3CXCA 3CCVQ 3GLXA 1GL5A 3GBQA 3PMTA 1D0ZA 5FRMA 2HSEB 4HXJA 1VQLT 2LX9A 4A4GA 2K9GA 4P5NA 1UB4A 5FU7C 1HYOA 2E5QA 2RHUA 3N5BB 3L2ZA 2KRNA 1S72Q 5FLXE 1KHIA 2PUKB 1RI9A 1KD1R 1E6HA 2HL5C 7AT1B 3META 2DL7A 2MI6A 5KYYB 3C12A 2FG0A 4BI3A 3OYIA 1OPKA 1XOVA 1R8OB 4C5EA 1TH7A 3TCJA 2RB6A 5GAMf 1K73R 1FXXA 1AWWA 3U23A 2K5FA 3CPWP 3RERA 1U06A 1MUZA 2RHYA 1QQJA 2J06A 4NOYA 5CVIA 4AFUC 1GCQA 1Z9ZA 1T3SA 4A4FA 2A37A 4D8KA 3S3OA 1U8RA 1UE9A 2A0FB 2JS2A 1M1GA 1OYXA 1PKSA 5A2QE 4RG2A 2EBPA 3GOXA 4PJOE 1BKBA 1JJ2A 1OULA 2RMOA 4XTXA 4LD6A 1UJ0A 1KFZA 1NPPA 2DBKA 2COZA 2H3EB 3WVEB 3D7SB 4MMLA 1G3TA 3TVTA 1I8FA 1Q81U 2YT6A 3ASKA 3OW2S 3QDFA 5KCHA 4AG2C 2LTOA 5IHNA 4QKUA 2VXFA 4M78C 3C94A 2PVDB 4B9WA 3CCSQ 2RPNA 4M78F 3OYHA 1VQPQ 4J6YA 4CI0C 4QQGA 3RKYA 1O9SA 1F1BB 2LDMA 2ZZDA 2DJQA 2IG0A 3UATA 4V2SA 2CDTA 3CCJQ 1QP3A 4PJOD 5D7UA 2QXFA 2KAFA 2HBPA 5GAMd 1LVKA 1QVGP 5HK0A 2DFUA 5CAIA 1W2BA 1Q86U 2DL4A 1QWEA 3QZ5B 4F16A 3FDRA 5I21A 1WJRA 1D1AA 2KXDA 1K9AA 2EQKA 2JZ2A 4FSSA 4CC4B 1UGRB 1WJQA 4EMKA 1LNXA 2L3RA 1YHQQ 3GPLA 2QA4T 5LJ3g 2OAWA 3I55T 2JS0A 1YI2A 4HT9A 2GBQA 2PUOB 1S72A 1N8RC 4QVCA 2FZKB 1JEGA 5GMKj 4KT0E 4QVDA 2RQTA 3MEVA 4J9GA 1S1NA 4MZPA 3EG9A 3M4GA 3TQ7P 4QQDA 3DLLA 3OYBA 4NL2A 4BDYA 3S3NA 4FT2A 2CSQA 1MV0B 4OMNA 5GAN5 3RMSA 1D1CA 2FVUA 1AD5A 3PTAA 4MMKA 1D3BA 4C8QD 1YJ9T 4DA4A 2HKNA 8ATCB 2X51A 1VQ7A 5FWCA 1TS9A 1PD0A 3OMCA 4PFPA 3OMGA 3H6ZA 2DM1A 4BY6B 2RN8A 1G8XA 2MWOA 2JTFA 3EG9B 1RAEB 4PL6A 2ZPFB 4XTVA 4FYVB 1G3SA 3V8LA 5CKDA 1Y07A 1VQ8Q 3CXCS 1U3OA 4HA8A 1MMAA 2HQEA 4X34A 1RADB 4RTXA 1E6GA 2RF0A 2F69A 4B9XA 4Z02A 4CC2A 5A0LA 3A8MB 1WHMA 3JV3A 4F14A 3CC4A 2JN0A 3X25B 1Q81R 4XTWA 2JNGA 1W4SA 1H3HA 3VUBA 3CMET 3G4ST 2Y4YA 2GQVA 2CYZB 1SKUB 2OTJQ 1YJNT 1T0JA 2CP6A 1BBZA 1PWTA 3V8KA 2RJEA 1OPLA 1TSFA 2IPOB 4BE2A 1YI2T 2DBMA 3M0SA 1XQHA 3VUZA 4ESRA 2Z0WA 2KRMA 4MDXA 3MP8A 1KIKA 3MHXA 2DRMA 4PJOC 1UJYA 3CPWA 4RTWA 4J7FA 2FYKA 2PU9B 1AZEA 3QJYA 4DOWA 2GFAA 2FPDA 5LJ5g 3TEEA 1Q82R 1MGQA 3CCMA 2P0KA 1VQ6T 3G6EA 4M7AB 1X6BA 4OP0A 1KG1A 3SEMA 5J26A 2LQ8A 3EHQA 1QVFP 2M02A 3M0RA 4K11A 1KQSP 2RHZA 2OX7A 1KC8U 1KC8C 3ZL7C 3VS4A 2AHJB 2KGTA 1I81A 1G3WA 4GBQA 4L6V5 3JCMc 3QWYA 1XJWB 4KRTA 3MO8A 4VUBA 1YHQA 1D0XA 3REAB 1QLYA 2QDYB 4C92D 5C6SA 3EH2A 1YNZA 1VQ9Q 2A3LA 2EYZA 2LVMA 2M0YA 5FROA 3TREA 2LJ0A 1RUWA 2VXEA 2LX7A 4NL3A 1JU5C 3I56T 2XIDA 5GJWB 2RI5A 1YJNA 5LJ3h 4M78D 4C5IA 4FW2A 2EGCA 3KFVA 4M77D 2LQKA 4M7DC 4JRKA 4KGVB 2X4JA 5IH2A 1B7TA 2VWFA 1AOJA 3JCMJ 2DL5A 5LJ5h 1MMDA 3JCMg 3BE3A 2MMPA 4QW2A 5KYXA 4C8QB 2FZGB 1YIJQ 4RKUE 4FT4A 4M77F 2H8HA 3RKXA 2E6ZA 1WXUA 3I55Q 1JXOA 1WHJA 3AT1B 4LXCA 2D0NA 2M9UA 5GMKi 5LJ5f 3OBWA 3I35A 3JCMh 3URGA 4O5VA 1ZX6A 1UHCA 4LUEA 2P0PA 1VQKQ 1G3YA 3M4YA 2YUNA 2EKHA 3EG0A 2ATCB 2QGGA 2RQUA 3PIOA 3SWNC 1VOMA 1VQNQ 1VQMQ 3CCJT 4EMGA 4HCCA 2QDLA 2WSFE 1Q82C 3WVDB 2ZPIB 3HRTA 4ME7A 2DKGA 4ZNXA 4XAXB 2JMAA 2KR3A 4M7AF 2FHDA 3CMAT 1RLQC 1LPLA 4XU1A 2LQNA 3MEUA 1G5VA 2YUQA 3ME9A 2KT1A 3UA7A 1SF9A 2CT3A 2O2OA 3CQTA 2VUBA 2GF7A 2YRCA 2QYZA 1RI0A 1RLPC 2DE0X 2L0AA 3JB9G 3BFMA 3O5ZA 1NLPC 3GNFB 5FU6B 1YJ9Q 2GQIA 1PSFA 1RABB 4J83A 4J9CA 4WTOB 1YITQ 1SPKA 4ZTFA 2X3WD 1WQ7A 1I07A 2DETA 2W0ZA 1YJWQ 3E9FA 1QWFA 3KBGA 1WHKA 4C8QF 2NUTA 5LL6S 1YP5A 2E12A 4PJOG 2O01E 1YBYA 1JRIA 5GANj 1M1KR 1ABOA 2YXYA 2EWNA 1BI2A 3PGGA 4LDYA 2F5KA 5KYWB 1UHFA 1NZ9A 4BE0A 2G3RA 4JLGA 3OS5A 4EPCA 3IQLA 3QYHB 3HSBA 2OTJA 2GNCA 2ZAEA 3DB3A 4JS4A 2LCSA 3H41A 4C92B 3CCRT 1KJWA 3JCMV 2CZ6B 1IGQA 1XTDA 2E1HA 1RAHB 3G1JA 2K3BA 1WXBA 2CP5A 5AT1B 1M9SA 1O75A 2VKNA 1Q7YR 2HKQB 5KCOA 2XK0A 3CCVA 3FB9A 3CBMA 4BUGA 1VIFA 4IUTA 1VQPA 1JJ2S 2EGEA 4A53A 2CZ1B 2JUFA 5HK3A 3GP8A 1C6VX 1XNIA 3UWNA 4AFSC 4JDSA 2E3IA 2CP2A 2J6OA 4O6JA 5CK9A 2RD1A 1FMVA 4KH1B 1U1TA 3OYNA 1U5SA 2D0QB 3TSWA 4QT7A 2KQWA 3BDLA 1UGQB 2MIOA 4RG8A 2KYMA 4L5GA 5D6YA 2LP5A 3CCQQ 4A4HA 3OYFA 1X69A 2SEMA 1N5ZA 3HP9A 2DD4A 5I2MA 1M1KU 3RBBB 1WPYA 4LDUA 2FPEA 2RI3A 8AT1B 2A7YA 3LWHA 1CSKA 3TSZA 1NJIU 3BY7A 1BI3A 3A8HB 1M5Q1 2VGMA 2OJ2A 2DD5A 2DVJA 4ZTJA 1VYTA 3CMAQ 2EFIA 2RJDA 2RQVA 1Q86C 1M30A 2L5QA 1VQ9A 4Z88A 2XDBA 1K8AC 4JJCA 2B8AA 2DILA 2X35A 3VRZA 4BACA 4KUDK 3M55A 1A0NB 2HBWA 3MJXA 1MMNA 2XHCA 1V76A 1PHTA 2K7AA 2HSPA 2LCCA 1HK9A 1M2OA 5FU7B 3MCAB 2A08A 1AT1B 4LDVA 2JM8A 4C0GA 4PK4A 3S3MA 2QEXQ 3H0HA 3CD6Q 3C95A 3SWNB 2RA2A 4LE9A 1WZOA 1B07A 4OGEA 1KD1U 2KDSA 3VS1A 4FSXA 1UFFA 3REBB 5I11A 3CCEA 4J9FA 2PZ1A 3JB9J 5EC7A 2L3SA 4ELYC 5HKCA 3G7ZA 4KH0B 4C0DB 4M78G 3SWNA 1NEGA 4MZTA 1KD1C 1BU1A 4AFZC 1YWOA 1RL2A 1KQ1A 3I55A 2PVGB 5C0MA 1FYNA 2K6DA 1HSQA 1W6XA 5GMKh 2O4XB 1TXQA 4DEYA 2QQAA 3R6OA 2CP7A 3INZA 1R0BG 2DNUA 3MP1A 2VYTA 5LJ3f 5GAN7 3CCMT 3EAEA 2F5TX 3BW1A 3G6ET 5D6XA 1W70A 1ZUYA 4E7HA 1IO6A 1VQ9T 3VS7A 3M5AA 3M57A 1YJ9A 5CQYA 1H8KA 2FRWA 2RI2A 5GAN8 1HJDA 3EGUA 1WX6A 4N0AC 3LLRA 4F7UE 2QTVA 2ZGWA 2LJ3A 2EJ9A 2KRSA 1X43A 3Q1JA 3G71Q 4PJOB 1YJWT 3ER0A 1VYUA 4N4GA 2BE9B 1Q7YC 3A5ZB 1VQ7Q 1VQ5A 3TU4K 1N8RR 3CPWS 4GY5A 1YJWA 1DJ7B 1OU8A 1NYFA 3L2VA 2DZCA 3OQ5A 2NUTB 2QEXT 1VQNA 2JM9A 2JMCA 2K3XA 4E6RA 1M8MA 2BE7D 3QIIA 1SG5A 1TU0B 2J6FA 5LJ5d 1K0XA 1BCMA 4DBHA 2MWPA 1TTHB 2P0QA 1WDXA 1B34A 5HY6A 4FW1A 2X4YA 1TUGB 1VQ6A 3EGDB 5KH6A 4FCYA 3OS2A 4C92A 4E7ZA 2KT8A 1W2BP 3UPUA 2R58A 2C0OA 3VYGA 2DF6A 3G4SQ 1X6GA 2LCLA 2ABLA 4A4EA 4X9DA 3CBOA 4DBQA 2K2MA 2X4WA 1GBQA 5GAOm 1X6OA 1QVFS 2ZCFB 1FMWA 2P4RA 4DOVA 1YHQT
chains in the Genus database with same CATH topology
1TSFA 1PC0A 1TS9A 2KI7A 1OQKA 1V76A 2ZAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TSF A;  1PC0 A;  1TS9 A;  2KI7 A;  1OQK A;  1V76 A;  2ZAE A; 
#chains in the Genus database with same CATH topology
 4L59 A;  2P84 A;  3VJP A;  5GAO n;  3DLM A;  1QKW A;  4M77 B;  1YIT A;  1YCY A;  2FO0 A;  2V1R A;  1N6A A;  1IZ6 A;  4XQ3 A;  3G71 A;  2OTL T;  4C8Q G;  1WHG A;  5LJ3 j;  1KQ2 A;  2PQW A;  1PRL C;  5GAN e;  3OS0 A;  1K73 U;  3NTI A;  4FYX B;  3OYE A;  3L2W A;  1PC0 A;  3JAM E;  1V1C A;  2ZPH B;  3JB9 F;  1WLP B;  1NJI R;  2KYB A;  1Q7Y U;  2NLU A;  1I5O B;  4AG1 C;  3MEA A;  3THK A;  1YFN A;  2E3H A;  1UG1 A;  2HAX A;  2E10 A;  3CC7 T;  4N0A A;  4N4I A;  4B6M A;  2CKK A;  1K4U S;  2YHT A;  1ZHI A;  1ZA1 B;  3EFR A;  3VS0 A;  1X75 C;  5CO7 A;  3RIR A;  5KE2 A;  2BZX A;  2LZ6 B;  1YWP A;  2DAQ A;  1KC8 R;  1R77 A;  3LW5 E;  1TUC A;  1UTI A;  1X27 A;  3CC2 A;  2DIQ A;  2YRV A;  1BB9 A;  5IN1 A;  2HMA A;  3M53 A;  2WSC E;  3PMI A;  1C0M A;  2F2W A;  2HCK A;  3SB2 A;  4R55 A;  3C0C A;  3CD6 T;  1Q95 G;  1ZQ1 A;  1WQW A;  4XTY A;  4E7L A;  3FEO A;  2NUZ A;  1IHW A;  3HPW A;  1OX9 A;  4QQ6 A;  5GMK m;  1JQQ A;  1QVP A;  2RM4 A;  4J9B A;  1Y71 A;  2DEU A;  4FM4 B;  3MP6 A;  2RK1 A;  2HZY A;  4II1 A;  1AWX A;  3CCU Q;  2EYW A;  1I0C A;  4E7K A;  1VQK A;  4M7D G;  1YCS B;  4JJD A;  2OTJ T;  2JXB A;  5EG2 A;  1LOJ A;  1JBM A;  1UGP B;  1M90 U;  1Y0M A;  3HRU A;  4OVA A;  2QGF B;  2DTI A;  3OYC A;  2YSQ A;  3EH1 A;  2K3Y A;  4FU6 A;  2EQU A;  2V26 A;  4OF1 A;  2K5L A;  3HFN A;  4HKE A;  1VQP T;  4M75 B;  3FC3 A;  4FYW B;  1WHL A;  2XG8 D;  1QVG S;  2CRE A;  3I56 Q;  1OU9 A;  4Z89 A;  2K2V A;  1VQ4 T;  1AVZ C;  5GAO q;  2B86 A;  2JJ9 A;  2MPX C;  2OAU A;  3CC7 Q;  1MND A;  1VQO T;  2ENM A;  4OMP A;  2F2V A;  4M77 E;  4M7A C;  3L2Q A;  4PJO A;  3I9Q A;  3CCM Q;  5L8R E;  1PSE A;  3CXC P;  2LT4 A;  1QKX A;  2CUB A;  4LUD A;  1Z9Q A;  4RTV A;  4E7I A;  3M59 A;  5IXF A;  1LJO A;  5GAM h;  2DX1 A;  3HFO A;  3I5R A;  3RES A;  1N9S A;  3M56 A;  4C8Q A;  1OI1 A;  2CS7 A;  5IXB A;  2M1H A;  2YWW A;  3WXM B;  3V7C A;  2EQI A;  3NFC A;  1T3L A;  4IUQ A;  4A54 A;  2FEI A;  2EQJ A;  4LDX A;  4M75 G;  1K8A R;  4LNP A;  5KYU A;  2P4T A;  3QZ9 B;  5GAO r;  2DXU A;  1QVF A;  3CCR A;  2LRQ A;  4PJL A;  1JB0 E;  2A28 A;  1B34 B;  1BK2 A;  1EFN A;  3QG1 A;  2AT1 B;  4J9I A;  3RR6 A;  1PM3 A;  1VQL Q;  4J5Y A;  4JJN K;  5CKF A;  4PFZ A;  2NUP B;  5FWB A;  5J39 A;  2JT4 A;  2QQS A;  1PKT A;  1KHC A;  1PG5 B;  3A1P A;  5IAY A;  2BZ8 A;  3CC4 T;  2VC8 A;  4EMH A;  4JLI A;  5KYU B;  4HVV A;  4ORZ A;  2O9V A;  4D8D A;  2CT4 A;  3M9Q A;  1WFW A;  2I2L A;  2QQR A;  2QG9 B;  3QHS A;  2DMO A;  3UA6 A;  4OB3 B;  1VQ8 A;  3SDZ A;  3E2U A;  1LCK A;  3OY9 A;  4KUI A;  1H3Z A;  2RJC A;  4M77 G;  3EGX A;  2L89 A;  5LJ5 e;  4BY6 C;  4FYY B;  3OW2 A;  2BZY A;  1KSW A;  2ED1 A;  3QSU A;  1R0C B;  1BIA A;  2KE9 A;  3OBY A;  3CCL T;  2D9T A;  3PNW C;  1OQK A;  2KSS A;  1FWZ A;  1K8A U;  2DL3 A;  5KE3 A;  4PLL A;  1OV3 A;  3G6E Q;  5GJV B;  4FIB A;  2XI9 A;  4J9D A;  1GCQ C;  4F7U B;  4M75 A;  1WXT A;  2X3X D;  2L2P A;  2KI7 A;  4WCI A;  4C5H A;  3FJ5 A;  4F04 B;  2WSE E;  1YIJ T;  1N8R U;  1IRX A;  3QWX X;  4XU0 A;  2C06 A;  3KUF A;  2LC4 A;  3X20 B;  2RH2 A;  2V8J A;  4J9E A;  4RTY A;  1NM7 A;  2CH4 A;  2YRD A;  1G2B A;  1MHN A;  4E2F B;  1K9M R;  1ARK A;  4TVR A;  4XTU A;  2MAM A;  5GAN f;  1M1K C;  4YTL A;  5ECA A;  4KGX B;  5GAN 3;  4A63 B;  4IUV A;  5KYW A;  3CPF A;  2V8I A;  3OB9 A;  1D09 B;  2QEX A;  2QA4 Q;  2A36 A;  4IIO A;  3HHT B;  1IRE B;  5FU6 C;  2SRC A;  3OYG A;  4NS5 A;  4LN2 A;  1SHF A;  5GAO p;  2DPP B;  1H92 A;  4E7J A;  4OMQ A;  3M0Q A;  2V1Q A;  5CCA A;  1EIF A;  4E7S A;  1UEC A;  4EIK A;  3GF5 A;  1OZ3 A;  4OML A;  4C5G A;  2FZC B;  5M9O A;  1W1F A;  5GAM j;  1GFD A;  3V8J A;  1ZBX A;  2XKO C;  2PTK A;  1B3Q A;  1H64 1;  1K9M C;  1JXM A;  1QVG A;  3H0F A;  4X9C A;  2R5A A;  1PD1 A;  2E5K A;  4R56 A;  2ROT A;  3VKI A;  2F2X A;  4F17 A;  3OSV A;  2KNB B;  2MCN A;  1ZBJ A;  4M7D F;  1C1A A;  2DEQ A;  2H3J A;  1ZSG A;  1YN8 A;  3JCM b;  3L2R A;  1VQO Q;  4BE1 A;  1UEB A;  1M8V A;  2ZPG B;  3OYY A;  1Y57 A;  4ZN1 A;  4CC7 A;  4DBF A;  9ATC B;  3ZEH A;  2DTH A;  2RNA A;  2W10 A;  4RTU A;  3M0U A;  3RUX A;  4EMK B;  1YIT T;  1BI1 A;  1NLO C;  2HD0 A;  2VB6 A;  3LYI A;  2XD0 A;  1I5L A;  3EGX B;  3NMZ C;  1KK7 A;  2EJG A;  2LNV A;  4M7D D;  1VQ6 Q;  4PNO A;  1OOT A;  3J81 E;  3M54 A;  2XU8 A;  4LD9 K;  3CBP A;  1AWJ A;  5I2S A;  2E65 A;  1X01 A;  5A0G A;  3JB9 I;  1VQN T;  3PE0 A;  4M7A D;  2O9S A;  5GAN 4;  2X9H A;  4JRI A;  3UDC A;  1SRM A;  2YLB A;  4DEX A;  3CCE Q;  4RTT A;  3JB9 D;  2HL3 A;  3CMA A;  3CME A;  2DL8 A;  3VS6 A;  3PIP A;  3FRN A;  1UUE A;  3I56 A;  5KYX B;  4JS5 A;  3EG2 A;  3EG1 A;  1M3A A;  1UGS B;  2EAY A;  2QAS A;  3HRS A;  4PKC C;  1Q82 U;  5GAN d;  2L3P A;  4PJN A;  2CP3 A;  2CZ0 B;  1GCP A;  2R57 A;  3SFM A;  3PFS A;  5CKH A;  3JRZ A;  2CP0 A;  1MNE A;  1JO8 A;  2QQB A;  3PVQ A;  3LH5 A;  2RJF A;  1RAF B;  1VQM T;  2YUP A;  2COW A;  3A8L B;  2FRY A;  2D8H A;  4IUR A;  2QTX A;  5CKB A;  3JCM f;  3L42 A;  3CC4 Q;  2DIG A;  2DER A;  1TWB A;  3P8B B;  3QXE B;  4J7I A;  2O88 A;  5GAO l;  2EPD A;  2KBT A;  1VUB A;  1EZZ B;  3G71 T;  5HCK A;  1OEB A;  3CCV T;  3PT9 A;  1TOV A;  2E41 A;  2BUD A;  3FIF A;  2L3Q A;  2YLC A;  1VA7 A;  1ZA2 B;  2AZV A;  3A8G B;  1GFC A;  2CUD A;  3V7S A;  5KYY A;  1M27 C;  1M90 C;  4DBR A;  1SSF A;  3E19 A;  2IIM A;  4M75 E;  4C0Z A;  2XMF A;  3OYK A;  2EYX A;  2MYS A;  5GAN g;  2GTJ A;  2ZPB B;  4M7D E;  4PJM A;  2VAS A;  2IVW A;  5GAM g;  1TUD A;  5IT9 E;  4D6W A;  3NGP A;  2I0N A;  1HXD A;  3NHN A;  3V7R A;  5DY9 A;  4C92 G;  4DQ2 A;  4J6X A;  3O8V A;  3CD6 A;  3A8O B;  3R6N A;  3LGL A;  3VRY A;  1U1S A;  1QCN A;  1NJI C;  5L23 A;  3CCU A;  4OB0 B;  3DKM A;  2ED0 A;  5CR2 A;  3OYJ A;  2JOY A;  1BI0 A;  4M78 A;  1UDL A;  1WIE A;  3BDU A;  5FRN A;  1WI7 A;  3X24 B;  2ESW A;  3CCU T;  2BTT A;  1UGV A;  1WHH A;  1N9R A;  3QPH A;  2VVK A;  3CCS A;  3EHR A;  4ZGD B;  4JZ4 A;  2KY9 A;  2QQ9 A;  3HTR A;  1ACM B;  2LQW A;  4M7A A;  4MZM A;  4XK8 E;  2VV5 A;  1WA7 A;  1WGS A;  3KXT A;  4HCB A;  1NG2 A;  3HL8 A;  2QAZ A;  3CCS T;  1P92 A;  1G83 A;  4CRI A;  3CCJ A;  1IXD A;  3H8Z A;  4M75 F;  2O31 A;  3EG3 A;  4Y92 A;  1YJN Q;  3X28 B;  1OZ2 A;  3OYL A;  1KQS A;  3QJ6 A;  5GAN h;  2Y90 A;  1VQK T;  3QUI A;  3EGD A;  3HKS A;  1Q86 R;  2DK3 A;  3FJP A;  5GMK e;  5GAN 2;  1JJ2 P;  4JRP A;  4E47 A;  2MOX A;  4C0D C;  4IUU A;  1AHJ B;  2EYQ A;  2EGA A;  1ZSZ C;  2RO0 A;  3QKJ A;  1BIB A;  4Q5W A;  4HVU A;  1VQ4 A;  3P8H A;  3C4S A;  2LT1 A;  1YI2 Q;  4M7A E;  4HT8 A;  1D3B B;  1VQ8 T;  3L1A A;  1QP2 A;  4BB7 A;  5LJ3 d;  5DLO A;  1PRM C;  4J9H A;  3CC2 Q;  3JCM Q;  1HD3 A;  3P8D A;  2XDD A;  3CEY A;  2DXB A;  1X2K A;  2EVR A;  2DLP A;  4CC3 A;  1BCO A;  4M77 A;  4M78 E;  2EQM A;  3JCM W;  3OYA A;  2QI2 A;  2J05 A;  3LGF A;  4ZGJ B;  3QBY A;  1ABQ A;  2AKK A;  2QA4 A;  3M0P A;  5AYF A;  3GIB A;  5CIU A;  1M2V B;  1S72 T;  2KEA A;  2K79 A;  4M77 C;  5A0D A;  3VYH B;  3CCR Q;  1GXI E;  1SHG A;  4OMO A;  4OB1 B;  2DXT A;  4GLM A;  4M7D A;  3OYD A;  1FMK A;  2KRO A;  3OSS C;  1Q81 C;  1YIJ A;  3LH0 A;  2NUP A;  2EYY A;  1AWO A;  1NPR A;  4A4K A;  1E7O A;  3H0I A;  4EMK C;  1SSH A;  3MPU B;  5GAM e;  1OX8 A;  4KGZ B;  2HQX A;  2YUO A;  2EKO A;  3EFO A;  3OS1 A;  1ZLM A;  2EIF A;  4XTZ A;  2VGN A;  3CCE T;  2GFU A;  4XU3 A;  1M2V A;  3NPF A;  2CSI A;  2X4X A;  4M75 D;  4PJO F;  3RDV A;  3G4S A;  4OB2 B;  4UC4 A;  2CGH A;  4F7U F;  4J8O A;  1ZSZ A;  2KK4 A;  4M75 C;  2JVV A;  3I5S A;  4N4H A;  1QCF A;  5DLQ E;  1WYX A;  2RHI A;  4F7U G;  2RQR A;  3CCL A;  3J7A F;  4ZGE B;  3E1S A;  2CZ7 B;  4C0F A;  4IKF A;  1RAA B;  3OW2 P;  2C0T A;  3JSC A;  2RK2 A;  1GRI A;  2GTO A;  2XDP A;  3EFO B;  1MV3 A;  4RTZ A;  5D6W A;  2D6F A;  2MK5 A;  3JB9 H;  1CKA A;  2MF2 A;  3MKD A;  1FX7 A;  4RUG A;  1K0S A;  4J6W A;  2K4Y A;  3JCM e;  2EJF A;  4M7A G;  4C92 F;  2FB7 A;  4PLI A;  2D8J A;  3NTH A;  1VQ7 T;  2XIC A;  3A98 A;  3JCM X;  3E9G A;  1PNJ A;  3DB4 A;  3AHU A;  2E6N A;  2EW3 A;  2ZPE B;  1NE8 A;  3QDR B;  3UF4 A;  5FW9 A;  3GNG A;  2DO3 A;  2PNI A;  2NWM A;  4OMM A;  3VV0 A;  2DZ9 A;  2O4X A;  2HNI A;  3VS2 A;  2M51 A;  3F70 A;  4PFO A;  1AZG B;  4ATO A;  4QVZ A;  4HVW A;  3VS5 A;  2DYI A;  2BKD N;  2Y4X A;  4KUL A;  1EX4 A;  3SHW A;  5KYN A;  2FL7 A;  1K1Z A;  1VQ5 T;  3LX7 A;  1QCO A;  1NYG A;  1X2Q A;  4AT1 B;  5LJ5 j;  4BI4 A;  2JTE A;  1D1B A;  2AKL A;  4RMO A;  1QMC A;  4JJB A;  2AIR B;  2M0O A;  4M78 B;  1IGU A;  1SEM A;  2L8D A;  2DJZ A;  3JCM d;  3LWI A;  2ROL A;  1NEB A;  4IIM A;  3ZFJ A;  2HQH A;  4Y28 E;  5IHI A;  1K9M U;  2DA9 A;  1VIE A;  2LJ1 A;  5CQX A;  3CC7 A;  5J3B A;  1MMG A;  4Z8A A;  4C92 E;  1M3B A;  4EDU A;  5DM7 R;  5I22 A;  3L2U A;  2ECZ A;  2K5I A;  2HEQ A;  2GCX A;  4MDW A;  4JZ3 A;  1I1J A;  4FL6 A;  2D1X A;  1ZUK A;  1VQ4 Q;  3CC2 T;  1J3T A;  2QK0 A;  1Y96 A;  4XU2 A;  3SD4 A;  4OGC A;  1RAC B;  1IHV A;  4JRQ A;  2JW4 A;  2KXC A;  1M1F A;  4AMC A;  2NYS A;  4ANJ A;  2J6K A;  1M4Z A;  3VU3 C;  2J7I A;  1I4K 1;  3OYM A;  2K57 A;  1VQM A;  1ZSZ B;  1CKB A;  3VS3 A;  2JTM A;  2KVQ G;  4LDW A;  1RAG B;  2V8K A;  2HDA A;  3UT1 A;  1Y96 B;  1WJS A;  2F1L A;  3M58 A;  3T9N A;  1K73 C;  1ZUU A;  2FPF A;  4GLK A;  4WF2 A;  2OTL Q;  1PCX A;  3X26 B;  2OTL A;  1VQ5 Q;  4JPB W;  4M4Z A;  1TG0 A;  4C92 C;  3J80 E;  1VQL A;  2E64 A;  3H9N A;  5CKE A;  1M90 R;  1QW1 A;  1N27 A;  2M16 A;  3OA6 A;  4ZN3 A;  2GGR A;  5IHK A;  2CH4 W;  5LJ3 e;  4F7U A;  4RCB A;  1Y7X A;  4C8Q C;  1D0Y A;  4M7D B;  4AFQ C;  4R0K A;  2RQW A;  2BIV A;  3ZBD A;  1VYV A;  2LNH B;  3QO3 A;  2C0I A;  3M0T A;  2KMT A;  2DRK A;  2PVO B;  1WNL A;  1RAI B;  3S6W A;  4HCZ A;  3RNJ A;  4KBM B;  2R5M A;  3CCQ T;  4ELZ C;  2E70 A;  1SRL A;  4Y91 A;  2AK5 A;  3CME Q;  1NBE B;  1GBR A;  1BYM A;  3NTK A;  1AEY A;  2LMJ A;  3CCQ A;  3PVL A;  4BI8 B;  6AT1 B;  1VQO A;  1M3C A;  3MEW A;  4RCC A;  1IB8 A;  2E4H A;  4BDZ A;  1T0H A;  1V29 B;  2YDL A;  2DVE A;  2DTO A;  4C8Q E;  3QYG B;  4IUP A;  2WAC A;  2G6F X;  4HCK A;  2RHX A;  4OMF B;  5GAN 6;  3CCL Q;  2DYB A;  3EFS A;  2COY A;  4BD3 A;  2OI3 A;  3ULR B;  2DXC A;  1K76 A;  1KQS S;  3RKW A;  3RMQ A;  3JCM P;  5GMK l;  2AZS A;  4JUV A;  1W2B S;  3FLG A;  4X1V A;  4PJJ A;  3CXC A;  3CCV Q;  3GLX A;  1GL5 A;  3GBQ A;  3PMT A;  1D0Z A;  5FRM A;  2HSE B;  4HXJ A;  1VQL T;  2LX9 A;  4A4G A;  2K9G A;  4P5N A;  1UB4 A;  5FU7 C;  1HYO A;  2E5Q A;  2RHU A;  3N5B B;  3L2Z A;  2KRN A;  1S72 Q;  5FLX E;  1KHI A;  2PUK B;  1RI9 A;  1KD1 R;  1E6H A;  2HL5 C;  7AT1 B;  3MET A;  2DL7 A;  2MI6 A;  5KYY B;  3C12 A;  2FG0 A;  4BI3 A;  3OYI A;  1OPK A;  1XOV A;  1R8O B;  4C5E A;  1TH7 A;  3TCJ A;  2RB6 A;  5GAM f;  1K73 R;  1FXX A;  1AWW A;  3U23 A;  2K5F A;  3CPW P;  3RER A;  1U06 A;  1MUZ A;  2RHY A;  1QQJ A;  2J06 A;  4NOY A;  5CVI A;  4AFU C;  1GCQ A;  1Z9Z A;  1T3S A;  4A4F A;  2A37 A;  4D8K A;  3S3O A;  1U8R A;  1UE9 A;  2A0F B;  2JS2 A;  1M1G A;  1OYX A;  1PKS A;  5A2Q E;  4RG2 A;  2EBP A;  3GOX A;  4PJO E;  1BKB A;  1JJ2 A;  1OUL A;  2RMO A;  4XTX A;  4LD6 A;  1UJ0 A;  1KFZ A;  1NPP A;  2DBK A;  2COZ A;  2H3E B;  3WVE B;  3D7S B;  4MML A;  1G3T A;  3TVT A;  1I8F A;  1Q81 U;  2YT6 A;  3ASK A;  3OW2 S;  3QDF A;  5KCH A;  4AG2 C;  2LTO A;  5IHN A;  4QKU A;  2VXF A;  4M78 C;  3C94 A;  2PVD B;  4B9W A;  3CCS Q;  2RPN A;  4M78 F;  3OYH A;  1VQP Q;  4J6Y A;  4CI0 C;  4QQG A;  3RKY A;  1O9S A;  1F1B B;  2LDM A;  2ZZD A;  2DJQ A;  2IG0 A;  3UAT A;  4V2S A;  2CDT A;  3CCJ Q;  1QP3 A;  4PJO D;  5D7U A;  2QXF A;  2KAF A;  2HBP A;  5GAM d;  1LVK A;  1QVG P;  5HK0 A;  2DFU A;  5CAI A;  1W2B A;  1Q86 U;  2DL4 A;  1QWE A;  3QZ5 B;  4F16 A;  3FDR A;  5I21 A;  1WJR A;  1D1A A;  2KXD A;  1K9A A;  2EQK A;  2JZ2 A;  4FSS A;  4CC4 B;  1UGR B;  1WJQ A;  4EMK A;  1LNX A;  2L3R A;  1YHQ Q;  3GPL A;  2QA4 T;  5LJ3 g;  2OAW A;  3I55 T;  2JS0 A;  1YI2 A;  4HT9 A;  2GBQ A;  2PUO B;  1S72 A;  1N8R C;  4QVC A;  2FZK B;  1JEG A;  5GMK j;  4KT0 E;  4QVD A;  2RQT A;  3MEV A;  4J9G A;  1S1N A;  4MZP A;  3EG9 A;  3M4G A;  3TQ7 P;  4QQD A;  3DLL A;  3OYB A;  4NL2 A;  4BDY A;  3S3N A;  4FT2 A;  2CSQ A;  1MV0 B;  4OMN A;  5GAN 5;  3RMS A;  1D1C A;  2FVU A;  1AD5 A;  3PTA A;  4MMK A;  1D3B A;  4C8Q D;  1YJ9 T;  4DA4 A;  2HKN A;  8ATC B;  2X51 A;  1VQ7 A;  5FWC A;  1TS9 A;  1PD0 A;  3OMC A;  4PFP A;  3OMG A;  3H6Z A;  2DM1 A;  4BY6 B;  2RN8 A;  1G8X A;  2MWO A;  2JTF A;  3EG9 B;  1RAE B;  4PL6 A;  2ZPF B;  4XTV A;  4FYV B;  1G3S A;  3V8L A;  5CKD A;  1Y07 A;  1VQ8 Q;  3CXC S;  1U3O A;  4HA8 A;  1MMA A;  2HQE A;  4X34 A;  1RAD B;  4RTX A;  1E6G A;  2RF0 A;  2F69 A;  4B9X A;  4Z02 A;  4CC2 A;  5A0L A;  3A8M B;  1WHM A;  3JV3 A;  4F14 A;  3CC4 A;  2JN0 A;  3X25 B;  1Q81 R;  4XTW A;  2JNG A;  1W4S A;  1H3H A;  3VUB A;  3CME T;  3G4S T;  2Y4Y A;  2GQV A;  2CYZ B;  1SKU B;  2OTJ Q;  1YJN T;  1T0J A;  2CP6 A;  1BBZ A;  1PWT A;  3V8K A;  2RJE A;  1OPL A;  1TSF A;  2IPO B;  4BE2 A;  1YI2 T;  2DBM A;  3M0S A;  1XQH A;  3VUZ A;  4ESR A;  2Z0W A;  2KRM A;  4MDX A;  3MP8 A;  1KIK A;  3MHX A;  2DRM A;  4PJO C;  1UJY A;  3CPW A;  4RTW A;  4J7F A;  2FYK A;  2PU9 B;  1AZE A;  3QJY A;  4DOW A;  2GFA A;  2FPD A;  5LJ5 g;  3TEE A;  1Q82 R;  1MGQ A;  3CCM A;  2P0K A;  1VQ6 T;  3G6E A;  4M7A B;  1X6B A;  4OP0 A;  1KG1 A;  3SEM A;  5J26 A;  2LQ8 A;  3EHQ A;  1QVF P;  2M02 A;  3M0R A;  4K11 A;  1KQS P;  2RHZ A;  2OX7 A;  1KC8 U;  1KC8 C;  3ZL7 C;  3VS4 A;  2AHJ B;  2KGT A;  1I81 A;  1G3W A;  4GBQ A;  4L6V 5;  3JCM c;  3QWY A;  1XJW B;  4KRT A;  3MO8 A;  4VUB A;  1YHQ A;  1D0X A;  3REA B;  1QLY A;  2QDY B;  4C92 D;  5C6S A;  3EH2 A;  1YNZ A;  1VQ9 Q;  2A3L A;  2EYZ A;  2LVM A;  2M0Y A;  5FRO A;  3TRE A;  2LJ0 A;  1RUW A;  2VXE A;  2LX7 A;  4NL3 A;  1JU5 C;  3I56 T;  2XID A;  5GJW B;  2RI5 A;  1YJN A;  5LJ3 h;  4M78 D;  4C5I A;  4FW2 A;  2EGC A;  3KFV A;  4M77 D;  2LQK A;  4M7D C;  4JRK A;  4KGV B;  2X4J A;  5IH2 A;  1B7T A;  2VWF A;  1AOJ A;  3JCM J;  2DL5 A;  5LJ5 h;  1MMD A;  3JCM g;  3BE3 A;  2MMP A;  4QW2 A;  5KYX A;  4C8Q B;  2FZG B;  1YIJ Q;  4RKU E;  4FT4 A;  4M77 F;  2H8H A;  3RKX A;  2E6Z A;  1WXU A;  3I55 Q;  1JXO A;  1WHJ A;  3AT1 B;  4LXC A;  2D0N A;  2M9U A;  5GMK i;  5LJ5 f;  3OBW A;  3I35 A;  3JCM h;  3URG A;  4O5V A;  1ZX6 A;  1UHC A;  4LUE A;  2P0P A;  1VQK Q;  1G3Y A;  3M4Y A;  2YUN A;  2EKH A;  3EG0 A;  2ATC B;  2QGG A;  2RQU A;  3PIO A;  3SWN C;  1VOM A;  1VQN Q;  1VQM Q;  3CCJ T;  4EMG A;  4HCC A;  2QDL A;  2WSF E;  1Q82 C;  3WVD B;  2ZPI B;  3HRT A;  4ME7 A;  2DKG A;  4ZNX A;  4XAX B;  2JMA A;  2KR3 A;  4M7A F;  2FHD A;  3CMA T;  1RLQ C;  1LPL A;  4XU1 A;  2LQN A;  3MEU A;  1G5V A;  2YUQ A;  3ME9 A;  2KT1 A;  3UA7 A;  1SF9 A;  2CT3 A;  2O2O A;  3CQT A;  2VUB A;  2GF7 A;  2YRC A;  2QYZ A;  1RI0 A;  1RLP C;  2DE0 X;  2L0A A;  3JB9 G;  3BFM A;  3O5Z A;  1NLP C;  3GNF B;  5FU6 B;  1YJ9 Q;  2GQI A;  1PSF A;  1RAB B;  4J83 A;  4J9C A;  4WTO B;  1YIT Q;  1SPK A;  4ZTF A;  2X3W D;  1WQ7 A;  1I07 A;  2DET A;  2W0Z A;  1YJW Q;  3E9F A;  1QWF A;  3KBG A;  1WHK A;  4C8Q F;  2NUT A;  5LL6 S;  1YP5 A;  2E12 A;  4PJO G;  2O01 E;  1YBY A;  1JRI A;  5GAN j;  1M1K R;  1ABO A;  2YXY A;  2EWN A;  1BI2 A;  3PGG A;  4LDY A;  2F5K A;  5KYW B;  1UHF A;  1NZ9 A;  4BE0 A;  2G3R A;  4JLG A;  3OS5 A;  4EPC A;  3IQL A;  3QYH B;  3HSB A;  2OTJ A;  2GNC A;  2ZAE A;  3DB3 A;  4JS4 A;  2LCS A;  3H41 A;  4C92 B;  3CCR T;  1KJW A;  3JCM V;  2CZ6 B;  1IGQ A;  1XTD A;  2E1H A;  1RAH B;  3G1J A;  2K3B A;  1WXB A;  2CP5 A;  5AT1 B;  1M9S A;  1O75 A;  2VKN A;  1Q7Y R;  2HKQ B;  5KCO A;  2XK0 A;  3CCV A;  3FB9 A;  3CBM A;  4BUG A;  1VIF A;  4IUT A;  1VQP A;  1JJ2 S;  2EGE A;  4A53 A;  2CZ1 B;  2JUF A;  5HK3 A;  3GP8 A;  1C6V X;  1XNI A;  3UWN A;  4AFS C;  4JDS A;  2E3I A;  2CP2 A;  2J6O A;  4O6J A;  5CK9 A;  2RD1 A;  1FMV A;  4KH1 B;  1U1T A;  3OYN A;  1U5S A;  2D0Q B;  3TSW A;  4QT7 A;  2KQW A;  3BDL A;  1UGQ B;  2MIO A;  4RG8 A;  2KYM A;  4L5G A;  5D6Y A;  2LP5 A;  3CCQ Q;  4A4H A;  3OYF A;  1X69 A;  2SEM A;  1N5Z A;  3HP9 A;  2DD4 A;  5I2M A;  1M1K U;  3RBB B;  1WPY A;  4LDU A;  2FPE A;  2RI3 A;  8AT1 B;  2A7Y A;  3LWH A;  1CSK A;  3TSZ A;  1NJI U;  3BY7 A;  1BI3 A;  3A8H B;  1M5Q 1;  2VGM A;  2OJ2 A;  2DD5 A;  2DVJ A;  4ZTJ A;  1VYT A;  3CMA Q;  2EFI A;  2RJD A;  2RQV A;  1Q86 C;  1M30 A;  2L5Q A;  1VQ9 A;  4Z88 A;  2XDB A;  1K8A C;  4JJC A;  2B8A A;  2DIL A;  2X35 A;  3VRZ A;  4BAC A;  4KUD K;  3M55 A;  1A0N B;  2HBW A;  3MJX A;  1MMN A;  2XHC A;  1V76 A;  1PHT A;  2K7A A;  2HSP A;  2LCC A;  1HK9 A;  1M2O A;  5FU7 B;  3MCA B;  2A08 A;  1AT1 B;  4LDV A;  2JM8 A;  4C0G A;  4PK4 A;  3S3M A;  2QEX Q;  3H0H A;  3CD6 Q;  3C95 A;  3SWN B;  2RA2 A;  4LE9 A;  1WZO A;  1B07 A;  4OGE A;  1KD1 U;  2KDS A;  3VS1 A;  4FSX A;  1UFF A;  3REB B;  5I11 A;  3CCE A;  4J9F A;  2PZ1 A;  3JB9 J;  5EC7 A;  2L3S A;  4ELY C;  5HKC A;  3G7Z A;  4KH0 B;  4C0D B;  4M78 G;  3SWN A;  1NEG A;  4MZT A;  1KD1 C;  1BU1 A;  4AFZ C;  1YWO A;  1RL2 A;  1KQ1 A;  3I55 A;  2PVG B;  5C0M A;  1FYN A;  2K6D A;  1HSQ A;  1W6X A;  5GMK h;  2O4X B;  1TXQ A;  4DEY A;  2QQA A;  3R6O A;  2CP7 A;  3INZ A;  1R0B G;  2DNU A;  3MP1 A;  2VYT A;  5LJ3 f;  5GAN 7;  3CCM T;  3EAE A;  2F5T X;  3BW1 A;  3G6E T;  5D6X A;  1W70 A;  1ZUY A;  4E7H A;  1IO6 A;  1VQ9 T;  3VS7 A;  3M5A A;  3M57 A;  1YJ9 A;  5CQY A;  1H8K A;  2FRW A;  2RI2 A;  5GAN 8;  1HJD A;  3EGU A;  1WX6 A;  4N0A C;  3LLR A;  4F7U E;  2QTV A;  2ZGW A;  2LJ3 A;  2EJ9 A;  2KRS A;  1X43 A;  3Q1J A;  3G71 Q;  4PJO B;  1YJW T;  3ER0 A;  1VYU A;  4N4G A;  2BE9 B;  1Q7Y C;  3A5Z B;  1VQ7 Q;  1VQ5 A;  3TU4 K;  1N8R R;  3CPW S;  4GY5 A;  1YJW A;  1DJ7 B;  1OU8 A;  1NYF A;  3L2V A;  2DZC A;  3OQ5 A;  2NUT B;  2QEX T;  1VQN A;  2JM9 A;  2JMC A;  2K3X A;  4E6R A;  1M8M A;  2BE7 D;  3QII A;  1SG5 A;  1TU0 B;  2J6F A;  5LJ5 d;  1K0X A;  1BCM A;  4DBH A;  2MWP A;  1TTH B;  2P0Q A;  1WDX A;  1B34 A;  5HY6 A;  4FW1 A;  2X4Y A;  1TUG B;  1VQ6 A;  3EGD B;  5KH6 A;  4FCY A;  3OS2 A;  4C92 A;  4E7Z A;  2KT8 A;  1W2B P;  3UPU A;  2R58 A;  2C0O A;  3VYG A;  2DF6 A;  3G4S Q;  1X6G A;  2LCL A;  2ABL A;  4A4E A;  4X9D A;  3CBO A;  4DBQ A;  2K2M A;  2X4W A;  1GBQ A;  5GAO m;  1X6O A;  1QVF S;  2ZCF B;  1FMW A;  2P4R A;  4DOV A;  1YHQ T; 
#chains in the Genus database with same CATH homology
 1TSF A;  1PC0 A;  1TS9 A;  2KI7 A;  1OQK A;  1V76 A;  2ZAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...