1V76A

Crystal structure of archaeal ribonuclease p protein ph1771p from pyrococcus horikoshii ot3
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
GRVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGDRIWKVPKDVSIFEFEADDGTKIKIPGERLVGRPEMRLKKRWKKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNase P protein Ph1771p
publication title Crystal structure of archaeal ribonuclease P protein Ph1771p from Pyrococcus horikoshii OT3: an archaeal homolog of eukaryotic ribonuclease P protein Rpp29
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Rna binding protein
total genus 21
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2003-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01868 UPF0086 Domain of unknown function UPF0086
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.210 Mainly Beta Roll SH3 type barrels. Ribonuclease P/MRP, subunit p29 1v76A00
1TSFA 1OQKA 2ZAEA 1TS9A 1V76A 1PC0A 2KI7A
chains in the Genus database with same CATH superfamily
2RQTA 2K2MA 3RMQA 1NEGA 2IPOB 1VQKT 2RO0A 3M0RA 4A53A 4LN2A 3OW2A 4UC4A 4MZTA 2DXTA 3DKMA 1X01A 4LDWA 5GAMj 3CCRQ 1ZUUA 2GTJA 1KFZA 3HFOA 3L42A 1X43A 2ZPGB 1Y57A 1RAEB 2IG0A 3QO3A 4Y28E 4K11A 5LJ3d 2P84A 1AT1B 1W2BS 4BDYA 5J26A 1TUGB 3I55A 3OA6A 4CI0C 4LE9A 1GBQA 5CQYA 2A28A 2XHCA 4C8QA 2FPDA 3KXTA 2VGMA 2XG8D 4OMPA 5DM7R 4X9CA 1W2BA 1D0YA 4JLGA 1WQWA 4RCCA 1KSWA 4M78E 1OU8A 3H6ZA 1K76A 2QYZA 2CZ7B 3CCQT 1D3BB 2SEMA 1VQ6A 3BW1A 4QT7A 4OMMA 2RHUA 2NUPB 8AT1B 2HEQA 1YIJA 2L0AA 1UGRB 3ZFJA 1OPKA 1PSFA 4AG2C 2GTOA 2XDPA 3ZL7C 2E10A 1WGSA 3LWHA 1SHFA 3G71A 3OYMA 3EFSA 1UFFA 4C5EA 3H8ZA 2O2OA 4DOWA 1YBYA 5GMKl 4LDXA 4FW1A 4M7AC 1FYNA 2DAQA 4PFZA 1BIBA 2QQBA 4F04B 2F69A 2VYTA 5LJ3f 2RHYA 1O9SA 4OMLA 4ZNXA 5GAMh 2VUBA 2ATCB 1WXBA 3H0HA 3NMZC 1RLQC 3TCJA 5CR2A 1N8RR 2OTJQ 2DVEA 2LJ1A 3CEYA 3M0SA 4X34A 1B07A 2CP0A 2QEXA 1SSFA 4C8QG 3CCVQ 5GAN8 4PLLA 1VQ8A 2D0NA 3CC2T 4IUUA 2J05A 1CKAA 2DILA 3JCMQ 1Y07A 5GAMe 1KQ2A 1YJNA 2COZA 2F5KA 1WHKA 2KK4A 1K0XA 3C95A 1N6AA 3G1JA 3CPWP 1M1KR 2QQAA 2HMAA 3L2UA 2LVMA 5C0MA 2EJ9A 2E41A 1WJRA 2C0TA 1VQMA 3EG1A 4J9FA 4BE1A 4FSSA 1RAAB 2EBPA 1KQSS 1I1JA 3CMET 2GF7A 3FJ5A 1YJWA 2RK1A 2I2LA 1VQNA 2AZSA 2HSPA 1YWPA 2MK5A 2YUNA 1VYTA 3LH0A 3ZBDA 1EFNA 1ZLMA 4LNPA 3CCJT 2K3YA 3P8HA 4OVAA 3CCSA 1X69A 1WHMA 1RL2A 5GMKe 3A8OB 2LTOA 4EMHA 2XU8A 1WIEA 2QI2A 4A4HA 1NEBA 1H3ZA 1KQSA 3BY7A 4M7AA 4EMKB 1Q82U 1J3TA 3JCMV 2ZPFB 4QVZA 3ER0A 2HDAA 2M16A 1BI1A 1UB4A 1IB8A 2K4YA 5KYUB 3VS5A 1NJIR 1LOJA 1M1KC 3X26B 2RHIA 3CCQA 4NL2A 3QWXX 3U23A 2L5QA 4R0KA 4AFSC 4PJLA 4CC2A 1RAHB 1XOVA 3EG0A 2I0NA 2VXEA 4RKUE 4C5IA 4IIMA 1UGQB 3HTRA 2V8KA 3KUFA 4LUEA 2RQRA 4PJJA 1WHJA 1VIEA 2ZZDA 3QZ9B 1YFNA 2FYKA 5KYNA 4M7DE 3QUIA 4KULA 2D8HA 2DYBA 2J6FA 2B8AA 3MEUA 3OYIA 4MZPA 4D8DA 3RUXA 1R77A 3OYLA 2XMFA 2FZKB 2E5QA 4F14A 2VV5A 1O75A 1PD1A 3QDFA 3QDRB 2HZYA 3VS0A 3UA6A 3QZ5B 2WSEE 2FVUA 1K1ZA 4ZN3A 2RF0A 1ZBJA 2RJFA 3VU3C 3EGXA 3RBBB 1NJIC 4NS5A 2CZ1B 5CKBA 3OYGA 2BE9B 4WTOB 4IUVA 2DD4A 3H0IA 1MMDA 3E9GA 2QA4A 3CC2A 2DL5A 4M75A 2A0FB 4C5GA 2CSIA 3MJXA 1E7OA 3OYBA 1BI2A 2VVKA 1AWJA 2DBKA 2CDTA 4QQ6A 3OSVA 5LJ5g 3LH5A 1KC8U 2CP2A 3V8KA 1TTHB 2YT6A 4ELZC 3MCAB 3G4SA 2DL3A 3EH1A 2LJ0A 3QWYA 2GFUA 4J8OA 1QVGS 4C8QB 3I56Q 2L3SA 1SEMA 3X28B 4A54A 3CMEA 4BE2A 2RI2A 1RUWA 1RAFB 1ZBXA 2ZCFB 4XU1A 1YI2Q 1QLYA 4F7UE 2E6ZA 3CCJA 1VQPA 1IXDA 5GJVB 1D1AA 1D3BA 1JQQA 1S72A 4LUDA 4IIOA 1OZ2A 2VXFA 4BI4A 5D6XA 2NUPA 2KE9A 3E1SA 3PGGA 4FYWB 1W6XA 2DIQA 1Z9ZA 2QXFA 3JCMd 2GBQA 3CXCS 4BDZA 2Y4XA 4IKFA 1XJWB 2F2VA 4A4KA 5CKHA 5LJ5j 2E6NA 1M1GA 3V8LA 4C0GA 3A8MB 3CCMT 2EJFA 2ZPIB 3RNJA 2BIVA 3ULRB 3OYCA 4XAXB 3CPFA 1G5VA 4M75G 1WX6A 2R58A 4PKCC 3JCMc 4EMKC 4XTUA 3C94A 1U06A 2EQJA 2KXDA 2L8DA 3MP1A 1FWZA 3LLRA 1G3YA 1WFWA 5HCKA 2LQWA 4JPBW 3M59A 5DY9A 3RIRA 1HD3A 4QVCA 3M4GA 2DJZA 4XU2A 1D1CA 5DLQE 2DETA 3OYJA 5HK0A 4RTVA 5L8RE 2V8JA 3CCLQ 2DERA 4JJCA 2O9VA 4Z02A 2JUFA 4OF1A 1RI0A 2E3IA 3QXEB 4AMCA 3OYHA 1N8RU 5D6WA 1EX4A 2J6OA 4Q5WA 1ABQA 1C1AA 8ATCB 5KYYB 3FEOA 3V8JA 2QQSA 1OYXA 1OI1A 3CCET 4JZ4A 2WSFE 2FPFA 1WLPB 2ZPBB 2LCSA 2BZ8A 5CK9A 1MMNA 5LJ3e 4E7ZA 1ZUYA 2XICA 2O9SA 3I56T 2ROTA 4KGXB 4FSXA 1I8FA 4PK4A 4ZTJA 4E7IA 3VKIA 3UWNA 4C0FA 1YI2T 1I5LA 4J83A 3I9QA 1G8XA 4CC3A 3PIPA 4E7SA 1KJWA 4CRIA 3EH2A 1QKWA 3L2QA 3R6OA 2FO0A 4JRPA 2KRNA 4FT2A 4DOVA 3OQ5A 3M53A 4B6MA 4PJOF 4C0ZA 1VQ4T 5I22A 4F16A 2E5KA 5LJ5h 2QK0A 3JCMX 2E3HA 5HK3A 4EMKA 4BE0A 1GL5A 3AT1B 3OW2P 3MKDA 1PSEA 2EPDA 5GAOm 2YSQA 5KYUA 2QQ9A 1WXUA 4C92F 4J9DA 2EQIA 1U5SA 4PFPA 2IVWA 1TOVA 1MV3A 5A0GA 1YITQ 4C8QC 4HVWA 3UT1A 2X4JA 2AKLA 4MZMA 2RB6A 4IURA 3EG3A 3PMTA 3QPHA 2L3PA 2M0YA 1WI7A 4PJOG 2FHDA 4F17A 4C5HA 3CCUT 4E7KA 2XIDA 1VQLQ 4JLIA 3A8LB 5A0DA 5IXBA 2CZ6B 2M0OA 1WZOA 2HNIA 4XTWA 4PLIA 3WVEB 1TUDA 3HFNA 1A0NB 2EQUA 1BCMA 3HPWA 2DA9A 1N9RA 1VQ5T 2EYXA 3M0PA 3Q1JA 3WVDB 1W2BP 3EFRA 3G6EQ 3CCMA 1Q81R 5HKCA 2RH2A 2M51A 1M8MA 5J39A 2JTMA 2DL8A 4C92G 3VS6A 4R56A 2RHZA 4M7AD 3DB3A 4LDUA 3QHSA 4MDWA 4DBRA 1PC0A 3E9FA 4M78F 4BY6B 4RTUA 1R0BG 3CC7T 4C92E 2EGCA 2JOYA 2P0QA 2L3RA 2A37A 1M1FA 4M75B 3CC4Q 1VYVA 2NUTB 4E2FB 2CH4W 3CCEA 1UECA 1UDLA 3EG9B 3JCMg 2DRMA 3WXMB 1AEYA 2P0PA 3H0FA 3CMAT 3LYIA 2DK3A 5DLOA 1Y71A 4FM4B 3PMIA 3MEWA 3TEEA 4M78G 5KCOA 1Q81C 2ABLA 2KBTA 3PVLA 2QA4Q 4B9XA 1UGSB 2E1HA 3RMSA 4BUGA 3O5ZA 3PE0A 3C4SA 3DLMA 3TU4K 1MHNA 2VGNA 1D0XA 2G3RA 2V1RA 2PNIA 4IUTA 2H8HA 3CD6A 3R6NA 2KAFA 5GANd 4OGCA 1YITT 2E4HA 5GMKj 1VQ4A 3SWNB 3NTIA 3S3MA 2YXYA 3MO8A 1JJ2S 4ANJA 3QIIA 1YP5A 4FCYA 2DBMA 2LCLA 3OS0A 3JRZA 3H41A 3JCMb 1UE9A 5M9OA 2L3QA 3JB9F 1UTIA 1RACB 4N4HA 1FX7A 3G6ET 2D1XA 1I5OB 1UGPB 2OX7A 4FW2A 2CUDA 2LX9A 1JJ2A 4EIKA 3JSCA 2P4RA 1GCQC 2EYZA 1YJ9T 3GP8A 1SF9A 3ASKA 3OS1A 1I4K1 4OP0A 3QJ6A 2V8IA 1IHVA 1EZZB 1GXIE 1OULA 1FMKA 1M2OA 4DBFA 1VQ9Q 1KQSP 2EGEA 3QBYA 3J81E 1VQOQ 1YHQQ 2D0QB 3REAB 3URGA 1Q7YU 3L2ZA 2B86A 3JB9G 3CCRT 4J9EA 3TQ7P 1KD1R 1T0JA 2JZ2A 1XTDA 4OB1B 5KYYA 1IRXA 4PJOB 2RA2A 1VIFA 5KH6A 3JB9I 3FRNA 1UGVA 2K3XA 3QYGB 2P0KA 4PNOA 1NYGA 4XTVA 4KBMB 1D0ZA 2LNVA 2HL3A 1X6OA 5GANf 1YWOA 3BDUA 3OBWA 5GAN7 4ZN1A 1BB9A 5GAN3 3DLLA 3LX7A 3RKYA 1VQKA 1NZ9A 3M0QA 2RJCA 2DXUA 1RLPC 1BCOA 1M3CA 4OMQA 2LQNA 1PM3A 5GMKh 4C92B 2CP3A 3LWIA 4Z8AA 2CP6A 4FT4A 2M9UA 3HP9A 4HVVA 4M77F 4A4GA 3BDLA 5IAYA 2H3JA 3TREA 3S3NA 2JJ9A 4AT1B 4BY6C 1VQ7Q 4M7DF 2FB7A 2RPNA 3DB4A 2LJ3A 2HCKA 2CZ0B 4RTWA 4R55A 5A0LA 3JCMh 2EWNA 1GCQA 1GRIA 1SHGA 3TSWA 1KD1C 4BB7A 1E6GA 2KMTA 3GBQA 2R57A 4JZ3A 2EYWA 4M75C 4N4IA 2DL7A 2OTLQ 1VOMA 1M90R 1HJDA 5CIUA 4FU6A 5FU7B 2LP5A 2AK5A 2EJGA 1FMWA 2KRSA 1Q86R 3JCMe 4RTYA 1K9MC 2RHXA 1U1SA 1QP2A 2YDLA 3SD4A 4JS5A 1M3BA 2YRVA 2H3EB 4M77G 4M78B 1IHWA 4J9BA 2A7YA 4M7DG 4WCIA 1M3AA 3I5RA 2MPXC 4GBQA 2LX7A 3BFMA 4M77E 1V76A 2OTJT 5LJ3g 4D6WA 2LNHB 2RM4A 3P8BB 2KT8A 2K57A 1PD0A 4HCBA 5IXFA 2M02A 3HRSA 3OYEA 3CCVT 2W0ZA 1GFCA 1LPLA 2MWPA 1QVFP 1K8AR 4FYXB 1UJ0A 1YJ9A 1K73R 3SWNC 3A1PA 2XDBA 2RJDA 3JB9J 2RMOA 2CP5A 2MAMA 1G3WA 2EYQA 2A36A 4BI8B 1H8KA 1QVGP 1M90C 3S3OA 1V29B 5IHKA 4F7UF 1HSQA 1Q86C 3M58A 3D7SB 3CCRA 2LQKA 4ME7A 2LT4A 3L1AA 3EFOB 2NUZA 2X4YA 2EQMA 1MV0B 2F2WA 3NTKA 2NUTA 1U3OA 2D6FA 3M0TA 5AYFA 4Y92A 5FLXE 1VQ7T 2FRYA 2RQWA 2QDLA 2AZVA 3A5ZB 1M30A 3EG9A 1QVFS 2YHTA 4Z89A 1TWBA 5LJ3j 4KUIA 2GQIA 2SRCA 3FLGA 3SFMA 2KT1A 3I5SA 3QG1A 4KGVB 2HSEB 5ECAA 2MWOA 3CXCP 4XTXA 1TS9A 2QDYB 1MUZA 1YN8A 1AOJA 1K8AC 1LJOA 1JXOA 1K73C 4X9DA 5CQXA 4DBHA 3HL8A 2K3BA 4F7UG 2QGGA 2RI3A 2CS7A 2JN0A 3NTHA 2YUOA 4TVRA 3X25B 4JRKA 4PJOC 1QVFA 4NL3A 1P92A 2LDMA 1JRIA 4XK8E 2PUKB 3MP6A 5GAOr 2EKHA 3GF5A 1GCPA 3OSSC 4FYYB 3FIFA 1QVGA 3I55Q 2KDSA 4J7IA 3SWNA 2E70A 3NHNA 3QSUA 1RAGB 4AFZC 2QG9B 2DE0X 4FL6A 4C92C 1KG1A 5A2QE 2ZAEA 2WSCE 2OJ2A 4QQDA 1PKSA 2COYA 5J3BA 1SPKA 4ZTFA 3CQTA 1UJYA 3CD6Q 3VYHB 2PUOB 2KY9A 2PTKA 3ME9A 2X3XD 2HQHA 5KYXB 5FRMA 1ZHIA 4IUPA 1VQ6Q 3V7SA 2RNAA 3THKA 7AT1B 1KK7A 4DEYA 1MGQA 4ZGDB 2KVQG 2Y4YA 2Z0WA 1JU5C 1YIJQ 4DA4A 4RCBA 3CXCA 3NGPA 1RAIB 4OGEA 2OTJA 4C8QD 2CH4A 3AHUA 1LNXA 4JRQA 5FU7C 5GAMf 3G71Q 2FZCB 2LRQA 1JB0E 3CCVA 4E6RA 2F1LA 2JS0A 2HBWA 4M77B 4XQ3A 2LT1A 2DXCA 5LJ3h 4IUQA 2KNBB 2LC4A 4M78C 4M7DB 1G3SA 2DPPB 1WHGA 1ZQ1A 4OMOA 3X24B 1Y7XA 4PJOA 3MEAA 4BI3A 4PJMA 3G7ZA 3RKXA 1RABB 1BYMA 2A3LA 4ATOA 2XKOC 3NFCA 2PVOB 5IH2A 2AIRB 2FL7A 2YRDA 3OBYA 4L59A 2ESWA 2G6FX 1ABOA 2JT4A 4BD3A 1M1KU 2JTFA 4WF2A 1AHJB 4XU3A 2QEXQ 3OS5A 4E7JA 1VA7A 1VQ8Q 1W4SA 3HHTB 1X2QA 4C92A 1B34B 1YJNQ 4N0AC 2R5AA 5IHNA 2J06A 3S6WA 3T9NA 2DZ9A 2A08A 3V7RA 4CC4B 2JW4A 1VQKQ 4JRIA 3EHRA 2GGRA 4FYVB 2E64A 1YCSB 1BK2A 1X2KA 1HK9A 3SDZA 5GANe 4HT9A 1TG0A 1VQMQ 4RTXA 2RN8A 5KCHA 4ORZA 5EC7A 2X3WD 4J7FA 1QP3A 2BKDN 2KEAA 1GBRA 2CREA 1YJWQ 3VS2A 3VJPA 1SRMA 1F1BB 3LW5E 1VQNQ 4JUVA 5FWCA 1VQ6T 2DO3A 1U8RA 2OAUA 1AVZC 1KHCA 3GPLA 5C6SA 2X4XA 3CCSQ 1NJIU 1YIJT 3JV3A 3CBPA 4C0DB 2GNCA 3UDCA 3UATA 2KGTA 4M78A 5FROA 4Z88A 1PG5B 4F7UB 2O4XA 4A4EA 2YLBA 3OYDA 5I21A 3G71T 1WPYA 1NG2A 2EIFA 1XQHA 2YLCA 3VS1A 3CCLT 5KYWB 1D09B 1G3TA 2ZGWA 1WA7A 2KSSA 4O5VA 3CCQQ 3EGUA 1OV3A 2VASA 3X20B 5CKFA 6AT1B 1M4ZA 1QQJA 2VWFA 1ZA2B 2OAWA 3N5BB 2JS2A 2MMPA 3E2UA 3M0UA 1I0CA 5KE2A 2Y90A 2K7AA 3TVTA 1JEGA 3A8GB 4J6XA 4N0AA 3VS3A 5GAN2 5FWBA 2X51A 4L5GA 5GAOq 3V7CA 2EW3A 4KH1B 4QVDA 2K5IA 1Q82C 2JXBA 2QEXT 2O88A 2P4TA 2L2PA 2PU9B 3M5AA 3GLXA 1VQ8T 1PCXA 2W10A 4CC7A 2K9GA 1M8VA 2RI5A 3EFOA 4LDVA 3J7AF 4KRTA 1OU9A 1C0MA 1ZSZA 2K2VA 1JBMA 1JJ2P 2RQVA 4OB3B 3HSBA 1Y0MA 3JCMW 2DXBA 3I56A 1VQMT 4GY5A 1IGQA 2KRMA 4XU0A 1W1FA 2D8JA 4M77C 1YNZA 1KC8R 1YJWT 4GLMA 3M9QA 3VS7A 1VQNT 1YI2A 4M7DC 3CC2Q 3GNFB 4OMFB 3A8HB 1BIAA 3VS4A 1NE8A 2NYSA 1UG1A 1NPRA 5FW9A 2M1HA 2X4WA 1NYFA 3CCST 1M5Q1 2JTEA 2KR3A 2E12A 2DL4A 2BZYA 2DKGA 3FC3A 5I11A 3G4SQ 2BTTA 1QMCA 1WXTA 3NPFA 2DF6A 2PVDB 1VQLT 3JCMJ 1LCKA 2NWMA 4B9WA 1SRLA 2VC8A 2KQWA 4J6WA 3CMEQ 2DIGA 1TXQA 2CGHA 2AKKA 3REBB 1QWFA 3EHQA 4ZGEB 4II1A 4M75D 4JJBA 3MHXA 3UA7A 1H92A 4P5NA 1BKBA 4EPCA 2EAYA 2CT4A 1QVPA 3CCJQ 1VQPQ 4OMNA 2DTHA 1M27C 2CUBA 3C0CA 5KYXA 4A63B 2YUQA 1KC8C 1S72Q 2GQVA 1BBZA 1X75C 4E7HA 1DJ7B 5LJ5d 4C8QF 3CCUA 5FU6B 3SB2A 3CCLA 4LDYA 2LMJA 3SHWA 2JMCA 2JM9A 3TSZA 5D6YA 2MI6A 2MF2A 2JVVA 2DEUA 2JNGA 1AZGB 1VQ5A 1UEBA 2CYZB 4PL6A 3CC4T 1WDXA 3QJYA 1QWEA 4XTYA 2KROA 3M57A 4M77A 3OYKA 1OQKA 4C0DC 1OEBA 2E65A 1GFDA 4M7DA 1I81A 5GAN6 5GAN5 1QCNA 2IIMA 3PT9A 1WJQA 1NLOC 1QW1A 2DVJA 3CC7A 2QTVA 4MMKA 2V26A 1K9MR 1Q95G 4MMLA 4J9IA 2ED0A 3MP8A 1V1CA 3VRZA 2QA4T 1Y96B 4KH0B 4ELYC 1OPLA 1OX8A 1YCYA 4QW2A 5HY6A 4C8QE 1ZA1B 1B3QA 1T3LA 3EGDA 3PVQA 1JXMA 3JB9H 2NLUA 1B34A 3JAME 2ZPEB 2LZ6B 3G4ST 5GMKm 1TU0B 2ENMA 5LL6S 4HCZA 3CMAA 1ZUKA 2HL5C 1RI9A 1TH7A 3EAEA 4N4GA 1TUCA 2PZ1A 4PFOA 1WYXA 4HXJA 1WJSA 1M2VB 1ZX6A 3CBMA 5LJ5f 5D7UA 4GLKA 3L2VA 1PHTA 1HXDA 1R0CB 1N8RC 2QAZA 1VQPT 1ARKA 2DJQA 4PJOD 2MYSA 3RDVA 2DNUA 3LGLA 1YITA 1CSKA 1S72T 2DEQA 2X35A 3CPWS 1KHIA 4KUDK 1U1TA 1UHCA 2O4XB 1VQLA 4YTLA 4ESRA 3VUZA 1MMAA 4F7UA 2K79A 2BE7D 2PQWA 3RKWA 4HA8A 1VQ9T 4OB0B 2HD0A 1VQOT 1YHQT 4EMGA 3PIOA 4JJDA 2HQXA 3G6EA 4C92D 5KYWA 1TSFA 1T0HA 1IO6A 4RG2A 3CPWA 4HCCA 3GNGA 3SEMA 5GMKi 2YWWA 4DBQA 2DTOA 3OS2A 3BE3A 4M4ZA 5GAOp 5GAOn 4A4FA 2QTXA 4Y91A 2K5FA 2MCNA 4RTTA 1Q81U 2DM1A 2EVRA 4KGZB 4JS4A 4M7AF 1FMVA 3HRUA 5FRNA 3O8VA 3MPUB 3RERA 5GANg 2L89A 1X27A 4LXCA 3CC4A 2K5LA 5IHIA 5I2MA 3QYHB 3IQLA 2DRKA 3CCMQ 4QQGA 1N5ZA 2AT1B 3HRTA 1ZSZB 2ROLA 4DQ2A 2J7IA 4M78D 2ECZA 4VUBA 2RJEA 5CCAA 1WHHA 2EQKA 1VUBA 2EKOA 3FDRA 2KI7A 5FU6C 4HT8A 2KYBA 1BI0A 1QCOA 4AFUC 3FB9A 5CVIA 5GAMd 4V2SA 1K0SA 4RUGA 4M7AG 4LD9K 4ZGJB 2JMAA 4J9CA 2OTLT 2KXCA 1W70A 5IT9E 4M7AE 4QKUA 2HBPA 3E19A 4D8KA 2C0OA 3CCEQ 1WHLA 3JCMP 3KFVA 3PNWC 2HAXA 2DMOA 2ZPHB 2XK0A 1NM7A 5GANj 1RADB 3M54A 2LCCA 1G83A 5L23A 3LGFA 2DYIA 4HKEA 3VRYA 1C6VX 1WQ7A 2HKQB 4AG1C 1SG5A 1BI3A 1KQ1A 4JDSA 1NBEB 2PVGB 2X9HA 3KBGA 4J6YA 4M75F 3INZA 2XI9A 2AHJB 1MMGA 1NLPC 3RR6A 4E7LA 1AD5A 3A98A 3RESA 2CKKA 1B7TA 5GAN4 1CKBA 1QKXA 1M9SA 1UHFA 2D9TA 1IGUA 1VQ4Q 3PFSA 1PRLC 1PRMC 3M56A 3JB9D 3GOXA 1FXXA 1PNJA 4J9GA 1EIFA 1VQ9A 1JO8A 5AT1B 3VUBA 1VQOA 1YHQA 4PJNA 2QASA 1MNDA 3VYGA 1ZSGA 2RK2A 2GCXA 2VB6A 4AFQC 2QQRA 3ZEHA 1D1BA 1HYOA 3FJPA 2EGAA 3META 2RD1A 2EYYA 2ED1A 2OI3A 1Z9QA 3J80E 3OYYA 1N9SA 4RMOA 1Q7YR 3GIBA 4M75E 1KD1U 3CCUQ 2YUPA 1SKUB 2FRWA 1X6GA 2CSQA 2O31A 2JM8A 2MIOA 4L6V5 2VKNA 5GAOl 1N27A 1VQ5Q 3L2RA 4J5YA 1K9MU 3VV0A 2BUDA 1I07A 2F5TX 5IN1A 5CAIA 2DZCA 1Y96A 2WACA 2K6DA 5GANh 2RQUA 3PTAA 3EGDB 3M55A 4RG8A 2R5MA 3H9NA 1K9AA 1VQ7A 2FG0A 1KIKA 2HQEA 4LD6A 2FPEA 3OY9A 3I55T 3QKJA 3CC7Q 4BACA 2O01E 1H641 3F70A 2YRCA 1OOTA 4HCKA 9ATCB 5GJWB 4EDUA 2OTLA 3JCMf 4E47A 5KE3A 4M77D 1ZSZC 1M2VA 4DEXA 1Q7YC 3CD6T 2GFAA 5I2SA 4M7DD 4OB2B 2DX1A 2C0IA 3EG2A 1Q82R 2DLPA 1M90U 2C06A 1K4US 4JJNK 3OYFA 4M7AB 3CMAQ 2J6KA 1VYUA 2EFIA 3M4YA 1Q86U 2KYMA 1G2BA 5CKEA 1BU1A 2MOXA 1IZ6A 4RTZA 1AWWA 2HKNA 5CO7A 2F2XA 2FEIA 4X1VA 1MNEA 4HVUA 5LJ5e 1X6BA 2LQ8A 1NPPA 2XDDA 1ACMB 2V1QA 1AZEA 5GAMg 3UF4A 4XTZA 3OMCA 3I35A 3UPUA 3C12A 2CP7A 1E6HA 1AWOA 3MEVA 3OYAA 1PKTA 4MDXA 1H3HA 1S1NA 3L2WA 1K8AU 1SSHA 1R8OB 1IREB 4KT0E 1K73U 3CBOA 2BZXA 4PJOE 1LVKA 4J9HA 1UUEA 1WNLA 1OX9A 4FIBA 5EG2A 2FZGB 3OYNA 2DFUA 1XNIA 5CKDA 1PWTA 2QGFB 1OZ3A 4O6JA 3OB9A 3OW2S 3HKSA 3OMGA 1AWXA 2CT3A 1YJ9Q 2DTIA 1T3SA 1YJNT 2XD0A 2DD5A 4NOYA 3P8DA 3EGXB 1QCFA 2COWA
chains in the Genus database with same CATH topology
1TSFA 1OQKA 2ZAEA 1TS9A 1V76A 1PC0A 2KI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TSF A;  1OQK A;  2ZAE A;  1TS9 A;  1V76 A;  1PC0 A;  2KI7 A; 
#chains in the Genus database with same CATH topology
 2RQT A;  2K2M A;  3RMQ A;  1NEG A;  2IPO B;  1VQK T;  2RO0 A;  3M0R A;  4A53 A;  4LN2 A;  3OW2 A;  4UC4 A;  4MZT A;  2DXT A;  3DKM A;  1X01 A;  4LDW A;  5GAM j;  3CCR Q;  1ZUU A;  2GTJ A;  1KFZ A;  3HFO A;  3L42 A;  1X43 A;  2ZPG B;  1Y57 A;  1RAE B;  2IG0 A;  3QO3 A;  4Y28 E;  4K11 A;  5LJ3 d;  2P84 A;  1AT1 B;  1W2B S;  4BDY A;  5J26 A;  1TUG B;  3I55 A;  3OA6 A;  4CI0 C;  4LE9 A;  1GBQ A;  5CQY A;  2A28 A;  2XHC A;  4C8Q A;  2FPD A;  3KXT A;  2VGM A;  2XG8 D;  4OMP A;  5DM7 R;  4X9C A;  1W2B A;  1D0Y A;  4JLG A;  1WQW A;  4RCC A;  1KSW A;  4M78 E;  1OU8 A;  3H6Z A;  1K76 A;  2QYZ A;  2CZ7 B;  3CCQ T;  1D3B B;  2SEM A;  1VQ6 A;  3BW1 A;  4QT7 A;  4OMM A;  2RHU A;  2NUP B;  8AT1 B;  2HEQ A;  1YIJ A;  2L0A A;  1UGR B;  3ZFJ A;  1OPK A;  1PSF A;  4AG2 C;  2GTO A;  2XDP A;  3ZL7 C;  2E10 A;  1WGS A;  3LWH A;  1SHF A;  3G71 A;  3OYM A;  3EFS A;  1UFF A;  4C5E A;  3H8Z A;  2O2O A;  4DOW A;  1YBY A;  5GMK l;  4LDX A;  4FW1 A;  4M7A C;  1FYN A;  2DAQ A;  4PFZ A;  1BIB A;  2QQB A;  4F04 B;  2F69 A;  2VYT A;  5LJ3 f;  2RHY A;  1O9S A;  4OML A;  4ZNX A;  5GAM h;  2VUB A;  2ATC B;  1WXB A;  3H0H A;  3NMZ C;  1RLQ C;  3TCJ A;  5CR2 A;  1N8R R;  2OTJ Q;  2DVE A;  2LJ1 A;  3CEY A;  3M0S A;  4X34 A;  1B07 A;  2CP0 A;  2QEX A;  1SSF A;  4C8Q G;  3CCV Q;  5GAN 8;  4PLL A;  1VQ8 A;  2D0N A;  3CC2 T;  4IUU A;  2J05 A;  1CKA A;  2DIL A;  3JCM Q;  1Y07 A;  5GAM e;  1KQ2 A;  1YJN A;  2COZ A;  2F5K A;  1WHK A;  2KK4 A;  1K0X A;  3C95 A;  1N6A A;  3G1J A;  3CPW P;  1M1K R;  2QQA A;  2HMA A;  3L2U A;  2LVM A;  5C0M A;  2EJ9 A;  2E41 A;  1WJR A;  2C0T A;  1VQM A;  3EG1 A;  4J9F A;  4BE1 A;  4FSS A;  1RAA B;  2EBP A;  1KQS S;  1I1J A;  3CME T;  2GF7 A;  3FJ5 A;  1YJW A;  2RK1 A;  2I2L A;  1VQN A;  2AZS A;  2HSP A;  1YWP A;  2MK5 A;  2YUN A;  1VYT A;  3LH0 A;  3ZBD A;  1EFN A;  1ZLM A;  4LNP A;  3CCJ T;  2K3Y A;  3P8H A;  4OVA A;  3CCS A;  1X69 A;  1WHM A;  1RL2 A;  5GMK e;  3A8O B;  2LTO A;  4EMH A;  2XU8 A;  1WIE A;  2QI2 A;  4A4H A;  1NEB A;  1H3Z A;  1KQS A;  3BY7 A;  4M7A A;  4EMK B;  1Q82 U;  1J3T A;  3JCM V;  2ZPF B;  4QVZ A;  3ER0 A;  2HDA A;  2M16 A;  1BI1 A;  1UB4 A;  1IB8 A;  2K4Y A;  5KYU B;  3VS5 A;  1NJI R;  1LOJ A;  1M1K C;  3X26 B;  2RHI A;  3CCQ A;  4NL2 A;  3QWX X;  3U23 A;  2L5Q A;  4R0K A;  4AFS C;  4PJL A;  4CC2 A;  1RAH B;  1XOV A;  3EG0 A;  2I0N A;  2VXE A;  4RKU E;  4C5I A;  4IIM A;  1UGQ B;  3HTR A;  2V8K A;  3KUF A;  4LUE A;  2RQR A;  4PJJ A;  1WHJ A;  1VIE A;  2ZZD A;  3QZ9 B;  1YFN A;  2FYK A;  5KYN A;  4M7D E;  3QUI A;  4KUL A;  2D8H A;  2DYB A;  2J6F A;  2B8A A;  3MEU A;  3OYI A;  4MZP A;  4D8D A;  3RUX A;  1R77 A;  3OYL A;  2XMF A;  2FZK B;  2E5Q A;  4F14 A;  2VV5 A;  1O75 A;  1PD1 A;  3QDF A;  3QDR B;  2HZY A;  3VS0 A;  3UA6 A;  3QZ5 B;  2WSE E;  2FVU A;  1K1Z A;  4ZN3 A;  2RF0 A;  1ZBJ A;  2RJF A;  3VU3 C;  3EGX A;  3RBB B;  1NJI C;  4NS5 A;  2CZ1 B;  5CKB A;  3OYG A;  2BE9 B;  4WTO B;  4IUV A;  2DD4 A;  3H0I A;  1MMD A;  3E9G A;  2QA4 A;  3CC2 A;  2DL5 A;  4M75 A;  2A0F B;  4C5G A;  2CSI A;  3MJX A;  1E7O A;  3OYB A;  1BI2 A;  2VVK A;  1AWJ A;  2DBK A;  2CDT A;  4QQ6 A;  3OSV A;  5LJ5 g;  3LH5 A;  1KC8 U;  2CP2 A;  3V8K A;  1TTH B;  2YT6 A;  4ELZ C;  3MCA B;  3G4S A;  2DL3 A;  3EH1 A;  2LJ0 A;  3QWY A;  2GFU A;  4J8O A;  1QVG S;  4C8Q B;  3I56 Q;  2L3S A;  1SEM A;  3X28 B;  4A54 A;  3CME A;  4BE2 A;  2RI2 A;  1RUW A;  1RAF B;  1ZBX A;  2ZCF B;  4XU1 A;  1YI2 Q;  1QLY A;  4F7U E;  2E6Z A;  3CCJ A;  1VQP A;  1IXD A;  5GJV B;  1D1A A;  1D3B A;  1JQQ A;  1S72 A;  4LUD A;  4IIO A;  1OZ2 A;  2VXF A;  4BI4 A;  5D6X A;  2NUP A;  2KE9 A;  3E1S A;  3PGG A;  4FYW B;  1W6X A;  2DIQ A;  1Z9Z A;  2QXF A;  3JCM d;  2GBQ A;  3CXC S;  4BDZ A;  2Y4X A;  4IKF A;  1XJW B;  2F2V A;  4A4K A;  5CKH A;  5LJ5 j;  2E6N A;  1M1G A;  3V8L A;  4C0G A;  3A8M B;  3CCM T;  2EJF A;  2ZPI B;  3RNJ A;  2BIV A;  3ULR B;  3OYC A;  4XAX B;  3CPF A;  1G5V A;  4M75 G;  1WX6 A;  2R58 A;  4PKC C;  3JCM c;  4EMK C;  4XTU A;  3C94 A;  1U06 A;  2EQJ A;  2KXD A;  2L8D A;  3MP1 A;  1FWZ A;  3LLR A;  1G3Y A;  1WFW A;  5HCK A;  2LQW A;  4JPB W;  3M59 A;  5DY9 A;  3RIR A;  1HD3 A;  4QVC A;  3M4G A;  2DJZ A;  4XU2 A;  1D1C A;  5DLQ E;  2DET A;  3OYJ A;  5HK0 A;  4RTV A;  5L8R E;  2V8J A;  3CCL Q;  2DER A;  4JJC A;  2O9V A;  4Z02 A;  2JUF A;  4OF1 A;  1RI0 A;  2E3I A;  3QXE B;  4AMC A;  3OYH A;  1N8R U;  5D6W A;  1EX4 A;  2J6O A;  4Q5W A;  1ABQ A;  1C1A A;  8ATC B;  5KYY B;  3FEO A;  3V8J A;  2QQS A;  1OYX A;  1OI1 A;  3CCE T;  4JZ4 A;  2WSF E;  2FPF A;  1WLP B;  2ZPB B;  2LCS A;  2BZ8 A;  5CK9 A;  1MMN A;  5LJ3 e;  4E7Z A;  1ZUY A;  2XIC A;  2O9S A;  3I56 T;  2ROT A;  4KGX B;  4FSX A;  1I8F A;  4PK4 A;  4ZTJ A;  4E7I A;  3VKI A;  3UWN A;  4C0F A;  1YI2 T;  1I5L A;  4J83 A;  3I9Q A;  1G8X A;  4CC3 A;  3PIP A;  4E7S A;  1KJW A;  4CRI A;  3EH2 A;  1QKW A;  3L2Q A;  3R6O A;  2FO0 A;  4JRP A;  2KRN A;  4FT2 A;  4DOV A;  3OQ5 A;  3M53 A;  4B6M A;  4PJO F;  4C0Z A;  1VQ4 T;  5I22 A;  4F16 A;  2E5K A;  5LJ5 h;  2QK0 A;  3JCM X;  2E3H A;  5HK3 A;  4EMK A;  4BE0 A;  1GL5 A;  3AT1 B;  3OW2 P;  3MKD A;  1PSE A;  2EPD A;  5GAO m;  2YSQ A;  5KYU A;  2QQ9 A;  1WXU A;  4C92 F;  4J9D A;  2EQI A;  1U5S A;  4PFP A;  2IVW A;  1TOV A;  1MV3 A;  5A0G A;  1YIT Q;  4C8Q C;  4HVW A;  3UT1 A;  2X4J A;  2AKL A;  4MZM A;  2RB6 A;  4IUR A;  3EG3 A;  3PMT A;  3QPH A;  2L3P A;  2M0Y A;  1WI7 A;  4PJO G;  2FHD A;  4F17 A;  4C5H A;  3CCU T;  4E7K A;  2XID A;  1VQL Q;  4JLI A;  3A8L B;  5A0D A;  5IXB A;  2CZ6 B;  2M0O A;  1WZO A;  2HNI A;  4XTW A;  4PLI A;  3WVE B;  1TUD A;  3HFN A;  1A0N B;  2EQU A;  1BCM A;  3HPW A;  2DA9 A;  1N9R A;  1VQ5 T;  2EYX A;  3M0P A;  3Q1J A;  3WVD B;  1W2B P;  3EFR A;  3G6E Q;  3CCM A;  1Q81 R;  5HKC A;  2RH2 A;  2M51 A;  1M8M A;  5J39 A;  2JTM A;  2DL8 A;  4C92 G;  3VS6 A;  4R56 A;  2RHZ A;  4M7A D;  3DB3 A;  4LDU A;  3QHS A;  4MDW A;  4DBR A;  1PC0 A;  3E9F A;  4M78 F;  4BY6 B;  4RTU A;  1R0B G;  3CC7 T;  4C92 E;  2EGC A;  2JOY A;  2P0Q A;  2L3R A;  2A37 A;  1M1F A;  4M75 B;  3CC4 Q;  1VYV A;  2NUT B;  4E2F B;  2CH4 W;  3CCE A;  1UEC A;  1UDL A;  3EG9 B;  3JCM g;  2DRM A;  3WXM B;  1AEY A;  2P0P A;  3H0F A;  3CMA T;  3LYI A;  2DK3 A;  5DLO A;  1Y71 A;  4FM4 B;  3PMI A;  3MEW A;  3TEE A;  4M78 G;  5KCO A;  1Q81 C;  2ABL A;  2KBT A;  3PVL A;  2QA4 Q;  4B9X A;  1UGS B;  2E1H A;  3RMS A;  4BUG A;  3O5Z A;  3PE0 A;  3C4S A;  3DLM A;  3TU4 K;  1MHN A;  2VGN A;  1D0X A;  2G3R A;  2V1R A;  2PNI A;  4IUT A;  2H8H A;  3CD6 A;  3R6N A;  2KAF A;  5GAN d;  4OGC A;  1YIT T;  2E4H A;  5GMK j;  1VQ4 A;  3SWN B;  3NTI A;  3S3M A;  2YXY A;  3MO8 A;  1JJ2 S;  4ANJ A;  3QII A;  1YP5 A;  4FCY A;  2DBM A;  2LCL A;  3OS0 A;  3JRZ A;  3H41 A;  3JCM b;  1UE9 A;  5M9O A;  2L3Q A;  3JB9 F;  1UTI A;  1RAC B;  4N4H A;  1FX7 A;  3G6E T;  2D1X A;  1I5O B;  1UGP B;  2OX7 A;  4FW2 A;  2CUD A;  2LX9 A;  1JJ2 A;  4EIK A;  3JSC A;  2P4R A;  1GCQ C;  2EYZ A;  1YJ9 T;  3GP8 A;  1SF9 A;  3ASK A;  3OS1 A;  1I4K 1;  4OP0 A;  3QJ6 A;  2V8I A;  1IHV A;  1EZZ B;  1GXI E;  1OUL A;  1FMK A;  1M2O A;  4DBF A;  1VQ9 Q;  1KQS P;  2EGE A;  3QBY A;  3J81 E;  1VQO Q;  1YHQ Q;  2D0Q B;  3REA B;  3URG A;  1Q7Y U;  3L2Z A;  2B86 A;  3JB9 G;  3CCR T;  4J9E A;  3TQ7 P;  1KD1 R;  1T0J A;  2JZ2 A;  1XTD A;  4OB1 B;  5KYY A;  1IRX A;  4PJO B;  2RA2 A;  1VIF A;  5KH6 A;  3JB9 I;  3FRN A;  1UGV A;  2K3X A;  3QYG B;  2P0K A;  4PNO A;  1NYG A;  4XTV A;  4KBM B;  1D0Z A;  2LNV A;  2HL3 A;  1X6O A;  5GAN f;  1YWO A;  3BDU A;  3OBW A;  5GAN 7;  4ZN1 A;  1BB9 A;  5GAN 3;  3DLL A;  3LX7 A;  3RKY A;  1VQK A;  1NZ9 A;  3M0Q A;  2RJC A;  2DXU A;  1RLP C;  1BCO A;  1M3C A;  4OMQ A;  2LQN A;  1PM3 A;  5GMK h;  4C92 B;  2CP3 A;  3LWI A;  4Z8A A;  2CP6 A;  4FT4 A;  2M9U A;  3HP9 A;  4HVV A;  4M77 F;  4A4G A;  3BDL A;  5IAY A;  2H3J A;  3TRE A;  3S3N A;  2JJ9 A;  4AT1 B;  4BY6 C;  1VQ7 Q;  4M7D F;  2FB7 A;  2RPN A;  3DB4 A;  2LJ3 A;  2HCK A;  2CZ0 B;  4RTW A;  4R55 A;  5A0L A;  3JCM h;  2EWN A;  1GCQ A;  1GRI A;  1SHG A;  3TSW A;  1KD1 C;  4BB7 A;  1E6G A;  2KMT A;  3GBQ A;  2R57 A;  4JZ3 A;  2EYW A;  4M75 C;  4N4I A;  2DL7 A;  2OTL Q;  1VOM A;  1M90 R;  1HJD A;  5CIU A;  4FU6 A;  5FU7 B;  2LP5 A;  2AK5 A;  2EJG A;  1FMW A;  2KRS A;  1Q86 R;  3JCM e;  4RTY A;  1K9M C;  2RHX A;  1U1S A;  1QP2 A;  2YDL A;  3SD4 A;  4JS5 A;  1M3B A;  2YRV A;  2H3E B;  4M77 G;  4M78 B;  1IHW A;  4J9B A;  2A7Y A;  4M7D G;  4WCI A;  1M3A A;  3I5R A;  2MPX C;  4GBQ A;  2LX7 A;  3BFM A;  4M77 E;  1V76 A;  2OTJ T;  5LJ3 g;  4D6W A;  2LNH B;  2RM4 A;  3P8B B;  2KT8 A;  2K57 A;  1PD0 A;  4HCB A;  5IXF A;  2M02 A;  3HRS A;  3OYE A;  3CCV T;  2W0Z A;  1GFC A;  1LPL A;  2MWP A;  1QVF P;  1K8A R;  4FYX B;  1UJ0 A;  1YJ9 A;  1K73 R;  3SWN C;  3A1P A;  2XDB A;  2RJD A;  3JB9 J;  2RMO A;  2CP5 A;  2MAM A;  1G3W A;  2EYQ A;  2A36 A;  4BI8 B;  1H8K A;  1QVG P;  1M90 C;  3S3O A;  1V29 B;  5IHK A;  4F7U F;  1HSQ A;  1Q86 C;  3M58 A;  3D7S B;  3CCR A;  2LQK A;  4ME7 A;  2LT4 A;  3L1A A;  3EFO B;  2NUZ A;  2X4Y A;  2EQM A;  1MV0 B;  2F2W A;  3NTK A;  2NUT A;  1U3O A;  2D6F A;  3M0T A;  5AYF A;  4Y92 A;  5FLX E;  1VQ7 T;  2FRY A;  2RQW A;  2QDL A;  2AZV A;  3A5Z B;  1M30 A;  3EG9 A;  1QVF S;  2YHT A;  4Z89 A;  1TWB A;  5LJ3 j;  4KUI A;  2GQI A;  2SRC A;  3FLG A;  3SFM A;  2KT1 A;  3I5S A;  3QG1 A;  4KGV B;  2HSE B;  5ECA A;  2MWO A;  3CXC P;  4XTX A;  1TS9 A;  2QDY B;  1MUZ A;  1YN8 A;  1AOJ A;  1K8A C;  1LJO A;  1JXO A;  1K73 C;  4X9D A;  5CQX A;  4DBH A;  3HL8 A;  2K3B A;  4F7U G;  2QGG A;  2RI3 A;  2CS7 A;  2JN0 A;  3NTH A;  2YUO A;  4TVR A;  3X25 B;  4JRK A;  4PJO C;  1QVF A;  4NL3 A;  1P92 A;  2LDM A;  1JRI A;  4XK8 E;  2PUK B;  3MP6 A;  5GAO r;  2EKH A;  3GF5 A;  1GCP A;  3OSS C;  4FYY B;  3FIF A;  1QVG A;  3I55 Q;  2KDS A;  4J7I A;  3SWN A;  2E70 A;  3NHN A;  3QSU A;  1RAG B;  4AFZ C;  2QG9 B;  2DE0 X;  4FL6 A;  4C92 C;  1KG1 A;  5A2Q E;  2ZAE A;  2WSC E;  2OJ2 A;  4QQD A;  1PKS A;  2COY A;  5J3B A;  1SPK A;  4ZTF A;  3CQT A;  1UJY A;  3CD6 Q;  3VYH B;  2PUO B;  2KY9 A;  2PTK A;  3ME9 A;  2X3X D;  2HQH A;  5KYX B;  5FRM A;  1ZHI A;  4IUP A;  1VQ6 Q;  3V7S A;  2RNA A;  3THK A;  7AT1 B;  1KK7 A;  4DEY A;  1MGQ A;  4ZGD B;  2KVQ G;  2Y4Y A;  2Z0W A;  1JU5 C;  1YIJ Q;  4DA4 A;  4RCB A;  3CXC A;  3NGP A;  1RAI B;  4OGE A;  2OTJ A;  4C8Q D;  2CH4 A;  3AHU A;  1LNX A;  4JRQ A;  5FU7 C;  5GAM f;  3G71 Q;  2FZC B;  2LRQ A;  1JB0 E;  3CCV A;  4E6R A;  2F1L A;  2JS0 A;  2HBW A;  4M77 B;  4XQ3 A;  2LT1 A;  2DXC A;  5LJ3 h;  4IUQ A;  2KNB B;  2LC4 A;  4M78 C;  4M7D B;  1G3S A;  2DPP B;  1WHG A;  1ZQ1 A;  4OMO A;  3X24 B;  1Y7X A;  4PJO A;  3MEA A;  4BI3 A;  4PJM A;  3G7Z A;  3RKX A;  1RAB B;  1BYM A;  2A3L A;  4ATO A;  2XKO C;  3NFC A;  2PVO B;  5IH2 A;  2AIR B;  2FL7 A;  2YRD A;  3OBY A;  4L59 A;  2ESW A;  2G6F X;  1ABO A;  2JT4 A;  4BD3 A;  1M1K U;  2JTF A;  4WF2 A;  1AHJ B;  4XU3 A;  2QEX Q;  3OS5 A;  4E7J A;  1VA7 A;  1VQ8 Q;  1W4S A;  3HHT B;  1X2Q A;  4C92 A;  1B34 B;  1YJN Q;  4N0A C;  2R5A A;  5IHN A;  2J06 A;  3S6W A;  3T9N A;  2DZ9 A;  2A08 A;  3V7R A;  4CC4 B;  2JW4 A;  1VQK Q;  4JRI A;  3EHR A;  2GGR A;  4FYV B;  2E64 A;  1YCS B;  1BK2 A;  1X2K A;  1HK9 A;  3SDZ A;  5GAN e;  4HT9 A;  1TG0 A;  1VQM Q;  4RTX A;  2RN8 A;  5KCH A;  4ORZ A;  5EC7 A;  2X3W D;  4J7F A;  1QP3 A;  2BKD N;  2KEA A;  1GBR A;  2CRE A;  1YJW Q;  3VS2 A;  3VJP A;  1SRM A;  1F1B B;  3LW5 E;  1VQN Q;  4JUV A;  5FWC A;  1VQ6 T;  2DO3 A;  1U8R A;  2OAU A;  1AVZ C;  1KHC A;  3GPL A;  5C6S A;  2X4X A;  3CCS Q;  1NJI U;  1YIJ T;  3JV3 A;  3CBP A;  4C0D B;  2GNC A;  3UDC A;  3UAT A;  2KGT A;  4M78 A;  5FRO A;  4Z88 A;  1PG5 B;  4F7U B;  2O4X A;  4A4E A;  2YLB A;  3OYD A;  5I21 A;  3G71 T;  1WPY A;  1NG2 A;  2EIF A;  1XQH A;  2YLC A;  3VS1 A;  3CCL T;  5KYW B;  1D09 B;  1G3T A;  2ZGW A;  1WA7 A;  2KSS A;  4O5V A;  3CCQ Q;  3EGU A;  1OV3 A;  2VAS A;  3X20 B;  5CKF A;  6AT1 B;  1M4Z A;  1QQJ A;  2VWF A;  1ZA2 B;  2OAW A;  3N5B B;  2JS2 A;  2MMP A;  3E2U A;  3M0U A;  1I0C A;  5KE2 A;  2Y90 A;  2K7A A;  3TVT A;  1JEG A;  3A8G B;  4J6X A;  4N0A A;  3VS3 A;  5GAN 2;  5FWB A;  2X51 A;  4L5G A;  5GAO q;  3V7C A;  2EW3 A;  4KH1 B;  4QVD A;  2K5I A;  1Q82 C;  2JXB A;  2QEX T;  2O88 A;  2P4T A;  2L2P A;  2PU9 B;  3M5A A;  3GLX A;  1VQ8 T;  1PCX A;  2W10 A;  4CC7 A;  2K9G A;  1M8V A;  2RI5 A;  3EFO A;  4LDV A;  3J7A F;  4KRT A;  1OU9 A;  1C0M A;  1ZSZ A;  2K2V A;  1JBM A;  1JJ2 P;  2RQV A;  4OB3 B;  3HSB A;  1Y0M A;  3JCM W;  2DXB A;  3I56 A;  1VQM T;  4GY5 A;  1IGQ A;  2KRM A;  4XU0 A;  1W1F A;  2D8J A;  4M77 C;  1YNZ A;  1KC8 R;  1YJW T;  4GLM A;  3M9Q A;  3VS7 A;  1VQN T;  1YI2 A;  4M7D C;  3CC2 Q;  3GNF B;  4OMF B;  3A8H B;  1BIA A;  3VS4 A;  1NE8 A;  2NYS A;  1UG1 A;  1NPR A;  5FW9 A;  2M1H A;  2X4W A;  1NYF A;  3CCS T;  1M5Q 1;  2JTE A;  2KR3 A;  2E12 A;  2DL4 A;  2BZY A;  2DKG A;  3FC3 A;  5I11 A;  3G4S Q;  2BTT A;  1QMC A;  1WXT A;  3NPF A;  2DF6 A;  2PVD B;  1VQL T;  3JCM J;  1LCK A;  2NWM A;  4B9W A;  1SRL A;  2VC8 A;  2KQW A;  4J6W A;  3CME Q;  2DIG A;  1TXQ A;  2CGH A;  2AKK A;  3REB B;  1QWF A;  3EHQ A;  4ZGE B;  4II1 A;  4M75 D;  4JJB A;  3MHX A;  3UA7 A;  1H92 A;  4P5N A;  1BKB A;  4EPC A;  2EAY A;  2CT4 A;  1QVP A;  3CCJ Q;  1VQP Q;  4OMN A;  2DTH A;  1M27 C;  2CUB A;  3C0C A;  5KYX A;  4A63 B;  2YUQ A;  1KC8 C;  1S72 Q;  2GQV A;  1BBZ A;  1X75 C;  4E7H A;  1DJ7 B;  5LJ5 d;  4C8Q F;  3CCU A;  5FU6 B;  3SB2 A;  3CCL A;  4LDY A;  2LMJ A;  3SHW A;  2JMC A;  2JM9 A;  3TSZ A;  5D6Y A;  2MI6 A;  2MF2 A;  2JVV A;  2DEU A;  2JNG A;  1AZG B;  1VQ5 A;  1UEB A;  2CYZ B;  4PL6 A;  3CC4 T;  1WDX A;  3QJY A;  1QWE A;  4XTY A;  2KRO A;  3M57 A;  4M77 A;  3OYK A;  1OQK A;  4C0D C;  1OEB A;  2E65 A;  1GFD A;  4M7D A;  1I81 A;  5GAN 6;  5GAN 5;  1QCN A;  2IIM A;  3PT9 A;  1WJQ A;  1NLO C;  1QW1 A;  2DVJ A;  3CC7 A;  2QTV A;  4MMK A;  2V26 A;  1K9M R;  1Q95 G;  4MML A;  4J9I A;  2ED0 A;  3MP8 A;  1V1C A;  3VRZ A;  2QA4 T;  1Y96 B;  4KH0 B;  4ELY C;  1OPL A;  1OX8 A;  1YCY A;  4QW2 A;  5HY6 A;  4C8Q E;  1ZA1 B;  1B3Q A;  1T3L A;  3EGD A;  3PVQ A;  1JXM A;  3JB9 H;  2NLU A;  1B34 A;  3JAM E;  2ZPE B;  2LZ6 B;  3G4S T;  5GMK m;  1TU0 B;  2ENM A;  5LL6 S;  4HCZ A;  3CMA A;  1ZUK A;  2HL5 C;  1RI9 A;  1TH7 A;  3EAE A;  4N4G A;  1TUC A;  2PZ1 A;  4PFO A;  1WYX A;  4HXJ A;  1WJS A;  1M2V B;  1ZX6 A;  3CBM A;  5LJ5 f;  5D7U A;  4GLK A;  3L2V A;  1PHT A;  1HXD A;  1R0C B;  1N8R C;  2QAZ A;  1VQP T;  1ARK A;  2DJQ A;  4PJO D;  2MYS A;  3RDV A;  2DNU A;  3LGL A;  1YIT A;  1CSK A;  1S72 T;  2DEQ A;  2X35 A;  3CPW S;  1KHI A;  4KUD K;  1U1T A;  1UHC A;  2O4X B;  1VQL A;  4YTL A;  4ESR A;  3VUZ A;  1MMA A;  4F7U A;  2K79 A;  2BE7 D;  2PQW A;  3RKW A;  4HA8 A;  1VQ9 T;  4OB0 B;  2HD0 A;  1VQO T;  1YHQ T;  4EMG A;  3PIO A;  4JJD A;  2HQX A;  3G6E A;  4C92 D;  5KYW A;  1TSF A;  1T0H A;  1IO6 A;  4RG2 A;  3CPW A;  4HCC A;  3GNG A;  3SEM A;  5GMK i;  2YWW A;  4DBQ A;  2DTO A;  3OS2 A;  3BE3 A;  4M4Z A;  5GAO p;  5GAO n;  4A4F A;  2QTX A;  4Y91 A;  2K5F A;  2MCN A;  4RTT A;  1Q81 U;  2DM1 A;  2EVR A;  4KGZ B;  4JS4 A;  4M7A F;  1FMV A;  3HRU A;  5FRN A;  3O8V A;  3MPU B;  3RER A;  5GAN g;  2L89 A;  1X27 A;  4LXC A;  3CC4 A;  2K5L A;  5IHI A;  5I2M A;  3QYH B;  3IQL A;  2DRK A;  3CCM Q;  4QQG A;  1N5Z A;  2AT1 B;  3HRT A;  1ZSZ B;  2ROL A;  4DQ2 A;  2J7I A;  4M78 D;  2ECZ A;  4VUB A;  2RJE A;  5CCA A;  1WHH A;  2EQK A;  1VUB A;  2EKO A;  3FDR A;  2KI7 A;  5FU6 C;  4HT8 A;  2KYB A;  1BI0 A;  1QCO A;  4AFU C;  3FB9 A;  5CVI A;  5GAM d;  4V2S A;  1K0S A;  4RUG A;  4M7A G;  4LD9 K;  4ZGJ B;  2JMA A;  4J9C A;  2OTL T;  2KXC A;  1W70 A;  5IT9 E;  4M7A E;  4QKU A;  2HBP A;  3E19 A;  4D8K A;  2C0O A;  3CCE Q;  1WHL A;  3JCM P;  3KFV A;  3PNW C;  2HAX A;  2DMO A;  2ZPH B;  2XK0 A;  1NM7 A;  5GAN j;  1RAD B;  3M54 A;  2LCC A;  1G83 A;  5L23 A;  3LGF A;  2DYI A;  4HKE A;  3VRY A;  1C6V X;  1WQ7 A;  2HKQ B;  4AG1 C;  1SG5 A;  1BI3 A;  1KQ1 A;  4JDS A;  1NBE B;  2PVG B;  2X9H A;  3KBG A;  4J6Y A;  4M75 F;  3INZ A;  2XI9 A;  2AHJ B;  1MMG A;  1NLP C;  3RR6 A;  4E7L A;  1AD5 A;  3A98 A;  3RES A;  2CKK A;  1B7T A;  5GAN 4;  1CKB A;  1QKX A;  1M9S A;  1UHF A;  2D9T A;  1IGU A;  1VQ4 Q;  3PFS A;  1PRL C;  1PRM C;  3M56 A;  3JB9 D;  3GOX A;  1FXX A;  1PNJ A;  4J9G A;  1EIF A;  1VQ9 A;  1JO8 A;  5AT1 B;  3VUB A;  1VQO A;  1YHQ A;  4PJN A;  2QAS A;  1MND A;  3VYG A;  1ZSG A;  2RK2 A;  2GCX A;  2VB6 A;  4AFQ C;  2QQR A;  3ZEH A;  1D1B A;  1HYO A;  3FJP A;  2EGA A;  3MET A;  2RD1 A;  2EYY A;  2ED1 A;  2OI3 A;  1Z9Q A;  3J80 E;  3OYY A;  1N9S A;  4RMO A;  1Q7Y R;  3GIB A;  4M75 E;  1KD1 U;  3CCU Q;  2YUP A;  1SKU B;  2FRW A;  1X6G A;  2CSQ A;  2O31 A;  2JM8 A;  2MIO A;  4L6V 5;  2VKN A;  5GAO l;  1N27 A;  1VQ5 Q;  3L2R A;  4J5Y A;  1K9M U;  3VV0 A;  2BUD A;  1I07 A;  2F5T X;  5IN1 A;  5CAI A;  2DZC A;  1Y96 A;  2WAC A;  2K6D A;  5GAN h;  2RQU A;  3PTA A;  3EGD B;  3M55 A;  4RG8 A;  2R5M A;  3H9N A;  1K9A A;  1VQ7 A;  2FG0 A;  1KIK A;  2HQE A;  4LD6 A;  2FPE A;  3OY9 A;  3I55 T;  3QKJ A;  3CC7 Q;  4BAC A;  2O01 E;  1H64 1;  3F70 A;  2YRC A;  1OOT A;  4HCK A;  9ATC B;  5GJW B;  4EDU A;  2OTL A;  3JCM f;  4E47 A;  5KE3 A;  4M77 D;  1ZSZ C;  1M2V A;  4DEX A;  1Q7Y C;  3CD6 T;  2GFA A;  5I2S A;  4M7D D;  4OB2 B;  2DX1 A;  2C0I A;  3EG2 A;  1Q82 R;  2DLP A;  1M90 U;  2C06 A;  1K4U S;  4JJN K;  3OYF A;  4M7A B;  3CMA Q;  2J6K A;  1VYU A;  2EFI A;  3M4Y A;  1Q86 U;  2KYM A;  1G2B A;  5CKE A;  1BU1 A;  2MOX A;  1IZ6 A;  4RTZ A;  1AWW A;  2HKN A;  5CO7 A;  2F2X A;  2FEI A;  4X1V A;  1MNE A;  4HVU A;  5LJ5 e;  1X6B A;  2LQ8 A;  1NPP A;  2XDD A;  1ACM B;  2V1Q A;  1AZE A;  5GAM g;  3UF4 A;  4XTZ A;  3OMC A;  3I35 A;  3UPU A;  3C12 A;  2CP7 A;  1E6H A;  1AWO A;  3MEV A;  3OYA A;  1PKT A;  4MDX A;  1H3H A;  1S1N A;  3L2W A;  1K8A U;  1SSH A;  1R8O B;  1IRE B;  4KT0 E;  1K73 U;  3CBO A;  2BZX A;  4PJO E;  1LVK A;  4J9H A;  1UUE A;  1WNL A;  1OX9 A;  4FIB A;  5EG2 A;  2FZG B;  3OYN A;  2DFU A;  1XNI A;  5CKD A;  1PWT A;  2QGF B;  1OZ3 A;  4O6J A;  3OB9 A;  3OW2 S;  3HKS A;  3OMG A;  1AWX A;  2CT3 A;  1YJ9 Q;  2DTI A;  1T3S A;  1YJN T;  2XD0 A;  2DD5 A;  4NOY A;  3P8D A;  3EGX B;  1QCF A;  2COW A; 
#chains in the Genus database with same CATH homology
 1TSF A;  1OQK A;  2ZAE A;  1TS9 A;  1V76 A;  1PC0 A;  2KI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...