1V76A

Crystal structure of archaeal ribonuclease p protein ph1771p from pyrococcus horikoshii ot3
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
GRVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGDRIWKVPKDVSIFEFEADDGTKIKIPGERLVGRPEMRLKKRWKKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of archaeal ribonuclease P protein Ph1771p from Pyrococcus horikoshii OT3: an archaeal homolog of eukaryotic ribonuclease P protein Rpp29
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Rna binding protein
molecule keywords RNase P protein Ph1771p
total genus 21
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2003-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01868 UPF0086 Domain of unknown function UPF0086
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.210 Mainly Beta Roll SH3 type barrels. Ribonuclease P/MRP, subunit p29 1v76A00
2KI7A 1OQKA 2ZAEA 1V76A 1PC0A 1TS9A 1TSFA
chains in the Genus database with same CATH superfamily
2CDTA 5CQYA 3QIIA 1KQ1A 2E65A 1K9AA 3NTHA 3EGUA 1VA7A 5GAOn 3QO3A 1D0XA 2EW3A 2L3QA 2LQKA 2VXFA 2LQNA 4LDWA 1UGQB 1J3TA 2QAZA 3JCMd 3JCMc 2H3EB 5I2MA 3S3NA 3I56T 4CC2A 2DO3A 3S3OA 3RERA 2JTFA 2J6KA 1FMKA 3OS1A 1RUWA 1AHJB 4DOVA 1VQNT 1VQLQ 1U06A 1AD5A 2KEAA 3A8LB 2DL7A 3EG2A 2K3BA 4M7DC 2EYYA 2ZPEB 3CXCS 3Q1JA 2JN0A 4PKCC 2KMTA 1YIJT 3CCET 4EMGA 3SWNC 1OV3A 4C0DC 1T3SA 1KQSS 3MEVA 5LJ3d 1RL2A 4J9EA 2CP3A 4A53A 2CYZB 4GBQA 3G6ET 1ABQA 2WSFE 2E3IA 4J9DA 5GAMh 3CCVT 4JPBW 4ESRA 2LCLA 1R8OB 2KBTA 2C06A 5I11A 1Q86C 1QP3A 1U3OA 1UHFA 2GTJA 3SB2A 1WPYA 2RF0A 5GANf 4IURA 2KNBB 5LJ5j 2BIVA 3P8HA 4WTOB 2LDMA 3SWNA 4F7UA 3V7SA 3J7AF 3HPWA 4RUGA 2KYMA 1YIJA 4LDYA 2KVQG 3JB9I 3JCMX 3VUBA 2NUTA 3CCVQ 2D1XA 4C92E 1PSFA 1VQNA 1KG1A 5DLQE 4RCBA 3CMEQ 4FU6A 6AT1B 2EQJA 3R6NA 1R0CB 4RTZA 1YITT 1M2VB 3EFOB 2GBQA 4BDYA 1UFFA 3M9QA 1XJWB 4FCYA 4Y91A 1QP2A 3E1SA 1K4US 1WJQA 2HSPA 4PJOF 1QVFA 4DA4A 5KYXB 1GRIA 1E6HA 4LDVA 1I5OB 4N0AC 5LJ5f 1NEBA 1JB0E 5IHKA 3BW1A 3RIRA 5CR2A 5KYNA 3RMSA 4RMOA 1I07A 1VQMA 4C8QF 4LD9K 4XU3A 4Z88A 1EX4A 5KH6A 3RMQA 5HKCA 8ATCB 2ATCB 4Z02A 4R56A 4PJLA 1VQPA 3CCSQ 1VQ9T 1N5ZA 2RK2A 5D6XA 2DTHA 1X75C 4A4FA 1O9SA 2EAYA 5GAN3 2AHJB 2VGMA 2EYQA 1VQMQ 3OB9A 3JSCA 1D3BA 4HVWA 5KYYA 2F69A 2KAFA 2VUBA 4IKFA 5LJ5h 1WYXA 3TREA 1WNLA 3JCMJ 2O31A 4XTXA 3OW2A 2BE7D 1VQ9Q 4M78G 2LT4A 4OF1A 3INZA 3LH0A 3MP6A 5CO7A 1ABOA 3THKA 3QPHA 3QDFA 3WXMB 1Y7XA 3CCJA 5KE2A 2RA2A 3M0RA 1G2BA 1PM3A 4A4KA 1DJ7B 4X9DA 3RUXA 2R5MA 3X24B 3L2WA 1K9MU 4C5EA 4C8QE 2DTIA 1W2BA 1Q7YR 3G71Q 3OYDA 1BI3A 5AYFA 1HXDA 1HSQA 1VYTA 4FSSA 1WJSA 2D8HA 2DXBA 1NBEB 4XTVA 1CKAA 4EMHA 1Z9QA 3CCMQ 4B6MA 2J7IA 3CCSA 2AT1B 5FWBA 4JLIA 1OQKA 2HNIA 3I55Q 2HQHA 1KK7A 4XU2A 3BDUA 2HKNA 4AMCA 1MNEA 3M53A 4N0AA 3OY9A 3OYEA 2RI5A 2LJ3A 1O75A 3M54A 4XTWA 1JO8A 1GCQC 3PVLA 4LN2A 2MI6A 1VUBA 4CC7A 1FWZA 2G6FX 2PUOB 1QW1A 3OMGA 3RKWA 1WA7A 2QQRA 1WQWA 2K2VA 2K6DA 3QWYA 5D6WA 2HL5C 2R57A 3CMAT 1U8RA 3SD4A 2CP2A 3F70A 2FZKB 3CCUA 4R55A 2DRMA 5IAYA 3AT1B 2KROA 2QEXQ 5FU6C 3CC7Q 1BYMA 4MZMA 4QVDA 3G4SQ 2PUKB 4CI0C 1G83A 2CP0A 4A54A 1XOVA 4RTUA 1WHJA 2CT4A 2KQWA 2GGRA 3SHWA 5IN1A 2ZGWA 4PL6A 2E3HA 3REAB 1D09B 1SSHA 4JJNK 3DB3A 1B3QA 2EBPA 2RI2A 1YJWQ 3ME9A 1QCFA 1TTHB 4ZTFA 2OTLA 2YUOA 2OTLT 2RD1A 1M5Q1 5GAMd 5GAOl 2FEIA 3TSZA 1JJ2A 4GY5A 1H3HA 3CCRA 4F16A 1F1BB 1KD1R 4PJOD 2F1LA 3META 2E6NA 4OB2B 2QXFA 2ESWA 4HVVA 4EMKA 3WVDB 5CIUA 1MMNA 4JZ3A 2E10A 1MV0B 4CRIA 1MHNA 1MMAA 5KCHA 1PKTA 1YJ9A 1E6GA 1NG2A 3QHSA 1AWWA 4C92C 4E7IA 2H8HA 1KQSP 3QXEB 2JTEA 1M27C 3OQ5A 3V7RA 4M77B 1RAAB 2JT4A 2BZYA 4C5GA 2E1HA 2RHYA 1M1KC 4PFZA 1QKWA 4Z89A 3OYIA 3TSWA 3HP9A 1YHQT 1GCQA 4PJOA 4F04B 3MP8A 1UGRB 1VQ8Q 2H3JA 4MZPA 4RTVA 3KFVA 2MPXC 2MWPA 3G1JA 2DBMA 3EFRA 2RM4A 3EG1A 1K8AR 2O4XA 1OX8A 4M75G 3CPFA 1TUDA 1UUEA 5D7UA 1FMWA 2IPOB 5LJ3f 4J7IA 5GJWB 1NM7A 3CD6T 1RI0A 5GAMe 4EIKA 3ZEHA 4RTWA 1M90U 3S6WA 4JRPA 4E7HA 3OBYA 3QBYA 3CPWP 1YI2Q 4JZ4A 2GFUA 4AT1B 2LMJA 4QVCA 3M0QA 1ZA2B 4A4HA 4AFUC 5J26A 2M0OA 3BE3A 2V1QA 3GLXA 1UJ0A 3CCMT 2YRCA 2VWFA 4XQ3A 3VUZA 2DILA 1M3BA 3RBBB 4M75F 2K7AA 1G5VA 3EG3A 2AZSA 3M0UA 4C92D 3HRUA 2RNAA 4ZN1A 2XMFA 5GAN4 3SEMA 1H92A 3CC7A 1VIEA 2V8IA 2J06A 3VKIA 2BZ8A 4FL6A 1YBYA 4JLGA 2OTLQ 2RMOA 1HK9A 1LPLA 3DKMA 3PNWC 1OZ2A 1ZX6A 1RAFB 2YLCA 2CSQA 1CSKA 4GLKA 4C0FA 1K76A 1UTIA 1S72T 3PE0A 1PRMC 2CGHA 3JCMP 5IHIA 3CMAA 1D3BB 2P0KA 2VXEA 1X2KA 2FPFA 1LCKA 4C8QG 2OAUA 3OYMA 2JUFA 4OB0B 2EFIA 3HL8A 4OVAA 2V8JA 3OYJA 2EKHA 2XU8A 4J9FA 4PLLA 1K73U 4M75B 2DX1A 3CD6Q 4K11A 1RAIB 2IG0A 3A8GB 1YP5A 4A4EA 4M7DB 3MKDA 3SFMA 3FC3A 2DEQA 4XAXB 4OGEA 1WHLA 3CCLQ 1QCNA 5IT9E 1AWJA 2W0ZA 4M7AF 1VQ6Q 1KC8U 1W1FA 4FYVB 1N9RA 2YDLA 1C6VX 3H0HA 3CCUT 3OMCA 1ZQ1A 4MZTA 1YITA 5CQXA 3NTIA 2KY9A 4J5YA 2DL8A 1M2VA 4OMLA 1PWTA 3RESA 2CKKA 3G6EQ 2NUZA 4E7ZA 5GAN8 3CCUQ 3EHQA 4ZGDB 1UEBA 4NL3A 2HAXA 2D6FA 4ATOA 1YJWT 1YJWA 4ZN3A 1PRLC 5CCAA 5HK3A 3BFMA 2HQXA 5CVIA 4JDSA 1AWOA 1VQ8A 5DLOA 3FB9A 2ZAEA 4C92B 1FYNA 3VRYA 4O6JA 2RHIA 3SWNB 3OYBA 4BY6B 4CC4B 2P0PA 2L3RA 1M8MA 5GAMj 4A63B 3I35A 3CCJQ 3PIPA 2RJFA 3M4GA 2K5IA 2NLUA 5GAMg 4JJBA 2DPPB 5I2SA 4PLIA 3JB9F 2LCCA 4J9HA 1VQPT 1MNDA 2EJGA 4M78F 1YHQA 2D8JA 4ZGEB 2JJ9A 3J81E 3OW2S 1AZGB 2RK1A 3VRZA 3CC4A 2YXYA 5IXBA 5IH2A 1SPKA 1Y96B 1VQOA 1WX6A 4X34A 1Q95G 2D9TA 2A36A 3ZBDA 1GL5A 3M58A 1OOTA 2V8KA 3DB4A 4II1A 5IHNA 3H6ZA 2J6FA 4M7DA 2GTOA 2AZVA 1U1TA 2QDLA 4LUEA 3X28B 5GAN2 1UB4A 5A0DA 3HTRA 1H3ZA 3E2UA 2DVEA 2YSQA 2IVWA 1ARKA 4DBQA 2L2PA 2YRVA 2A08A 1M2OA 3V8LA 1BI0A 4ORZA 1Q82U 8AT1B 1I5LA 4M77D 2JOYA 5FU7B 1G3YA 1OX9A 3NTKA 1ZSZB 1SRMA 1K8AU 2E12A 4CC3A 2EGAA 2K4YA 3J80E 3OSVA 1WGSA 4ZGJB 4JJDA 4KH1B 3G71A 4OMQA 3CC4Q 1N9SA 3I56Q 1TXQA 1KFZA 2BE9B 2DZ9A 3TU4K 2BKDN 2RHXA 1W70A 4BD3A 3JB9G 1UG1A 2JS2A 4OMOA 1VQNQ 4P5NA 2AK5A 1T0JA 5DM7R 3CBPA 3CQTA 3CMEA 1HYOA 4N4GA 1VQKA 2KRSA 1S1NA 2KXDA 1VQ4Q 1TS9A 2L89A 1SSFA 1OPKA 5J3BA 5GMKh 1VQLT 4AFQC 4XTUA 2FZCB 5GAOq 1EIFA 1V29B 5GMKi 4KUIA 4J9GA 4L5GA 1ZSZC 5HCKA 1QCOA 3JRZA 2NWMA 4IUQA 4QT7A 2DLPA 2KGTA 5FU7C 1LNXA 3QKJA 3EFSA 1YHQQ 3GPLA 2K2MA 2MYSA 3A8OB 2O4XB 4BE0A 2JS0A 3REBB 3I9QA 1BB9A 4C5HA 2M9UA 3LWIA 5FLXE 1WZOA 1ZA1B 5LL6S 4Y92A 3BY7A 3CCQQ 3PFSA 4OMMA 2GF7A 4BI3A 1GFCA 1KHIA 1YCSB 4RTYA 1Q7YU 2XI9A 5CK9A 4FYXB 4KGXB 4F14A 2GQIA 5FWCA 1X6OA 4PJOE 4Q5WA 2YUNA 3X25B 3RDVA 1K0SA 4AFSC 2DRKA 3HRSA 2X4XA 3I5RA 1SHFA 2CH4W 4J6YA 1CKBA 2HEQA 2DL5A 1I81A 3MPUB 5C0MA 1M3AA 2QG9B 2PNIA 2CUDA 1VQ4T 2ROTA 2DE0X 1UJYA 2DL4A 3O5ZA 3U23A 2AKLA 2WSEE 4RTTA 1BIAA 5IXFA 4C0ZA 1PHTA 1W4SA 3KXTA 2QQBA 5FROA 4D6WA 2LZ6B 3MEUA 3E9FA 1M90R 4M7DE 3CCRQ 4E47A 4PJNA 4M7AE 4M75E 2EQMA 3CCEA 4J9IA 2F5TX 4EMKB 1BU1A 3JV3A 2EQIA 1H8KA 2F5KA 2MAMA 2DF6A 5CKEA 2AIRB 1JU5C 2EQUA 2BTTA 3H0IA 3A5ZB 5EG2A 4J9CA 5KYUB 1ZUKA 3LYIA 3G4ST 3QG1A 3HHTB 1B7TA 4BY6C 5L23A 1W2BP 3CBMA 2GQVA 1JEGA 4JRKA 2XG8D 3PMIA 1IGUA 2HQEA 3C4SA 5L8RE 2JMAA 3TEEA 2X9HA 3H9NA 2LCSA 1LVKA 3L2UA 4L59A 1WLPB 3OS5A 2L0AA 3FJ5A 2LNVA 1JJ2S 2QA4Q 1ZSZA 2E41A 2KT8A 3HFNA 2X4YA 3I5SA 1NZ9A 2A0FB 2DZCA 2X4JA 4V2SA 1XQHA 4EPCA 1AZEA 2DERA 1BK2A 2JZ2A 4NL2A 4M7DG 2RHZA 3PTAA 3BDLA 2M51A 2A3LA 1Q7YC 3CCEQ 1KD1C 2JM8A 2XICA 3CC4T 4HXJA 3RR6A 4RG2A 3MEAA 1FXXA 1K73R 2DNUA 3SDZA 1YJNQ 3H41A 1M1GA 4KT0E 4QQGA 4M4ZA 3HFOA 2NUPB 1VYVA 2P4TA 3EHRA 1K1ZA 4RKUE 3MEWA 4PJOG 2QQ9A 4AG1C 3EH2A 4EDUA 2CT3A 1JJ2P 5GANe 1G3TA 1BCMA 2PVOB 4J9BA 1KC8R 1BI1A 4C92A 4HT9A 1S72A 2DETA 1TUGB 4C8QD 2PVGB 2W10A 3M59A 3FEOA 4KH0B 1TSFA 2DA9A 1ZUUA 4QVZA 1NJIR 3NHNA 5FRMA 1WFWA 2YLBA 3VS4A 1KHCA 2LP5A 3CC7T 1SEMA 5LJ5d 2RQRA 5HY6A 3JB9J 4E7KA 3RNJA 1OI1A 4PJMA 1N8RC 1KQSA 1Y07A 4IIOA 1OEBA 1YJ9Q 3KUFA 4M77E 1QVGA 2DTOA 7AT1B 2EGEA 1S72Q 4TVRA 4NOYA 4RTXA 5HK0A 3CCJT 2G3RA 2XIDA 1N8RR 4OGCA 1U1SA 3G6EA 2FRWA 4DBHA 2CSIA 3VS2A 2M1HA 1YJ9T 2GFAA 1YJNA 2K57A 2XD0A 1IRXA 2KSSA 1LOJA 2V26A 1XNIA 1Q81C 5CKFA 2X35A 1VQ7A 1EFNA 1TWBA 1K9MC 1M3CA 2J6OA 3UWNA 3CC2A 1K9MR 1TG0A 4FW2A 1RAEB 1WHMA 1VQPQ 3OW2P 1X27A 1KD1U 3LLRA 4QW2A 1MV3A 1VQKQ 2M0YA 4L6V5 2LX9A 3VS5A 3I55T 2KR3A 2FPDA 3CCLT 2YUPA 4ELZC 2O9VA 3GNGA 2RH2A 2O01E 4C8QC 5I21A 4M75A 1NPPA 2QDYB 2OI3A 1YIJQ 1M30A 1D1BA 1IO6A 2SRCA 2CUBA 4JRQA 4J6WA 4HCZA 4M77C 1BI2A 2FVUA 4M78C 4AFZC 3EGDB 5GANh 4GLMA 2QI2A 4C0GA 2QYZA 2JW4A 9ATCB 1IHWA 1QVFS 4PJJA 2X3WD 1YNZA 1N8RU 1BBZA 1BCOA 5GANg 1Y0MA 2QTXA 4JUVA 2DL3A 4VUBA 1NPRA 1VQ7Q 1B34A 1AEYA 4DEYA 1UGPB 3L1AA 3UT1A 3DLMA 3ZL7C 1YWOA 2HBWA 1N27A 2MCNA 2J05A 2EJFA 4NS5A 4OB1B 2QQSA 2DFUA 1RADB 1GXIE 1ZUYA 3LW5E 3MP1A 3G7ZA 3OBWA 1X43A 5KYWB 1FX7A 1JXOA 3OSSC 5CKHA 1Q81U 2DIQA 5LJ3h 4FYWB 5CKDA 1AT1B 1K0XA 1ZBJA 3LGFA 2VV5A 4IUUA 3ULRB 1SKUB 2MK5A 2L3PA 2OTJA 1PSEA 1H641 3JCMW 2HD0A 3L42A 2KXCA 4OMNA 3JCMe 3FLGA 1YJNT 2L3SA 4ZNXA 2KYBA 1R0BG 4E7JA 1ZSGA 1TUCA 4WF2A 4OMFB 3TCJA 2PZ1A 4IIMA 2QTVA 3LWHA 2QA4T 2A28A 1VOMA 3VYGA 2QA4A 2E5KA 4FT2A 2P4RA 3JB9D 3E19A 3TVTA 4XK8E 2K5LA 2ZCFB 1GCPA 2PVDB 3JCMg 1VQ5A 3EH1A 2OTJT 5A2QE 4DBRA 3GIBA 2EWNA 4E7SA 4J8OA 1FMVA 2XK0A 2MMPA 2EGCA 1OZ3A 1YITQ 4R0KA 5AT1B 3QWXX 3JCMV 4QQDA 2Y4XA 1QWFA 2DKGA 2DEUA 1Q86R 2VGNA 1NE8A 1M1KU 2LTOA 2RJDA 4M77A 2V1RA 1YI2A 3QZ9B 2OX7A 4MMKA 1SRLA 3GNFB 3QSUA 2CP6A 3CCST 4IUPA 2YRDA 4JS4A 3I56A 2DD4A 3GF5A 3QYGB 5D6YA 4X9CA 3DLLA 4XTYA 4BI8B 3CPWS 2Y4YA 4MDWA 3V8JA 4OB3B 2ENMA 5C6SA 1IZ6A 3FIFA 1JRIA 4XU1A 1MMGA 2LRQA 4LE9A 3L2VA 1VQMT 1VQKT 3VS1A 1IREB 3CEYA 2RB6A 1WJRA 4JS5A 1IHVA 4M75D 2XDBA 2EIFA 2RO0A 3QUIA 2HCKA 3VS6A 5FW9A 2HSEB 1I4K1 5KYUA 1JQQA 3G71T 3FDRA 3NMZC 4KUDK 3EAEA 1QVGS 2RPNA 1VQ4A 3C95A 1WXUA 1TOVA 3OYHA 1NYFA 3IQLA 4D8KA 4KGZB 3JCMh 3CCLA 4DBFA 2VASA 3WVEB 3OA6A 2HBPA 4M77G 2VB6A 2C0OA 1WI7A 4N4HA 3OYGA 2C0IA 1QWEA 1Q81R 2A37A 3QJYA 3TQ7P 3HSBA 1XTDA 2HKQB 4Z8AA 2KK4A 1GBQA 4M7DF 3A98A 2DAQA 2EYZA 4IUVA 2XHCA 4RCCA 1YI2T 4LNPA 3JCMb 1PCXA 1Y71A 1RAHB 2CZ6B 3G4SA 2FYKA 1X69A 4E6RA 3CCQT 1QVGP 1EZZB 3OYAA 3CD6A 2NYSA 3N5BB 2FL7A 3EG0A 3URGA 2L5QA 2ZPHB 1X6BA 5GAN7 3FRNA 4A4GA 4C8QB 4E2FB 2RQTA 2KT1A 4KULA 2MOXA 3S3MA 2P84A 2QEXT 2QQAA 5GMKj 3M55A 2EJ9A 3PIOA 5GAOr 5M9OA 1PNJA 3PMTA 2DD5A 4FW1A 5DY9A 3KBGA 1K73C 4BUGA 2KI7A 2COWA 2E64A 2SEMA 1YWPA 2DIGA 1X6GA 2QGGA 1M1FA 4LUDA 4LXCA 2HZYA 3RKXA 2L8DA 3CBOA 2Z0WA 1QVPA 1WIEA 1Z9ZA 3FJPA 2KDSA 2RI3A 5GAOp 1R77A 2R5AA 1PD1A 4Y28E 2QEXA 1G3SA 3QJ6A 1W2BS 1WHKA 3C12A 1M9SA 2X51A 1SG5A 3HKSA 1OPLA 2FB7A 4HKEA 1WDXA 4B9XA 2CZ1B 1U5SA 4OP0A 4X1VA 2ECZA 1OU9A 1UGVA 2LQ8A 2ZPGB 1RLQC 2EPDA 2GCXA 4HT8A 5I22A 2B8AA 3O8VA 3EGDA 3JCMf 1NJIC 1B34B 3LX7A 3UF4A 1C0MA 3ER0A 5LJ5e 1HJDA 2BZXA 1AVZC 1PC0A 1YFNA 3UDCA 1RI9A 2CZ7B 2DJZA 5GAN6 3JCMQ 1WXBA 2ZPBB 5KYYB 1UGSB 1Q82R 3CMET 1VIFA 3OYFA 4FSXA 4DOWA 1ACMB 1KSWA 3R6OA 3X20B 1YCYA 2CP7A 4HA8A 3P8BB 4KGVB 1M8VA 1RAGB 4M77F 4QKUA 1T3LA 4C5IA 2YHTA 1AOJA 5CAIA 5GMKl 3M57A 2MIOA 1SHGA 2OAWA 1A0NB 3A8MB 3PGGA 2FZGB 2PQWA 3H0FA 2HDAA 3EG9A 1OU8A 2CP5A 2KRMA 2M02A 2ZPIB 2LX7A 3GOXA 2OTJQ 3EFOA 3M4YA 2PTKA 3VU3C 4FYYB 2ZPFB 3VYHB 3I55A 4HVUA 2ABLA 3PVQA 5A0LA 4BDZA 1PKSA 2MF2A 3RKYA 4BE2A 3UATA 5LJ5g 2DM1A 2JTMA 1Y96A 2R58A 2VC8A 1KJWA 1M90C 2EYXA 5KYXA 1G3WA 2PU9B 4DEXA 1VQ5Q 4JRIA 3PT9A 3CC2T 1QQJA 3HRTA 2O88A 2RJCA 2EQKA 1VQ8T 2F2XA 2NUTB 1B07A 2QK0A 2DXTA 4M7AG 1GFDA 1QVFP 3CXCP 4KRTA 4UC4A 2WACA 3MCAB 2QGFB 4FM4B 3CPWA 1VYUA 1V1CA 3CMAQ 4OMPA 3JB9H 3M56A 3T9NA 3L2ZA 2ROLA 1VQOT 2RN8A 2YUQA 1VQ5T 5GJVB 4M7AD 2KE9A 1QLYA 2ED1A 4JJCA 4LDXA 1NLOC 2A7YA 1NJIU 1HD3A 3M0TA 3QYHB 2HL3A 5FU6B 4D8DA 5KE3A 2EYWA 2VVKA 1VQLA 1SF9A 1RLPC 1LJOA 2CH4A 2DJQA 2FPEA 3ASKA 1RACB 4F7UB 1QKXA 4C0DB 2IIMA 4B9WA 4F7UF 2OJ2A 1T0HA 2YT6A 4M78D 1TU0B 2M16A 4PNOA 2K79A 2LJ0A 5GAN5 2E5QA 4ELYC 4BE1A 4J7FA 3OS2A 3AHUA 4M78E 3ZFJA 5GMKm 2COYA 3A8HB 3M0SA 1JBMA 2XKOC 3JAME 3LH5A 3C94A 3VS0A 3CXCA 2XDPA 2LC4A 2RJEA 1IB8A 2ED0A 4J83A 5GMKe 1NYGA 2JNGA 1D0YA 2O9SA 3E9GA 3CCQA 1NEGA 5LJ3g 5GAOm 4O5VA 3V8KA 1E7OA 2LT1A 1I0CA 2NUPA 1NLPC 3OS0A 4PFOA 5LJ3j 3L2QA 2RHUA 3X26B 1D0ZA 5A0GA 1WXTA 2EKOA 2FG0A 3EG9B 1JXMA 1OYXA 1WQ7A 4PFPA 3VJPA 4E7LA 2AKKA 1MGQA 2YWWA 2K3YA 2RQUA 5KCOA 2I2LA 3MO8A 1KC8C 4IUTA 2VYTA 4N4IA 4ANJA 2HMAA 4BACA 4PJOC 2P0QA 2LQWA 1UDLA 1VQ7T 5J39A 2XDDA 1ZLMA 2E4HA 1D1AA 4HCBA 1VQOQ 1I1JA 1MUZA 2K9GA 1QMCA 4BB7A 4ZTJA 3MJXA 4ME7A 5EC7A 4EMKC 4HCKA 2F2VA 5FRNA 3C0CA 2ZZDA 1IGQA 1ZHIA 5ECAA 3LGLA 4C92F 3VS7A 1VQ6A 4J6XA 4XU0A 4M75C 3GBQA 3A1PA 2LNHB 1VQ9A 3EGXA 1RABB 3OYLA 3M5AA 3UPUA 2I0NA 1V76A 4FT4A 2EVRA 2GNCA 4F7UG 3M0PA 4AG2C 1W6XA 2RQWA 2DYBA 2DXUA 2FO0A 4M78B 3MHXA 1KQ2A 5GANj 2E70A 4BI4A 1BKBA 1OULA 4XTZA 3OYKA 3UA6A 4RG8A 4F7UE 2Y90A 4M7AB 4WCIA 2DVJA 1M4ZA 2DBKA 4HCCA 3D7SB 4DQ2A 2DYIA 3NGPA 3OYYA 3VS3A 3CCMA 4M7AC 1WHGA 3H8ZA 3GP8A 1PD0A 2B86A 2O2OA 2FHDA 3P8DA 2K5FA 1GBRA 1I8FA 1Y57A 2JXBA 2X3XD 4YTLA 1C1AA 4FIBA 2CS7A 1UE9A 2DK3A 1WHHA 1D1CA 1TH7A 2QASA 4MDXA 2WSCE 4C8QA 3NPFA 1N6AA 4C92G 3NFCA 2C0TA 4PJOB 1Q82C 5LJ3e 2D0QB 3OYNA 2DMOA 3VV0A 2FRYA 5GAMf 4MMLA 2F2WA 4LDUA 2JM9A 2DXCA 2X4WA 4PK4A 2LVMA 2CZ0B 5GANd 1K8AC 2KRNA 4M78A 2CREA 5KYWA 4M7DD 1X2QA 1P92A 1X01A 5CKBA 3CC2Q 4LD6A 3CCRT 3UA7A 4M7AA 3QZ5B 2D0NA 1BIBA 4KBMB 3EGXB 1UHCA 4QQ6A 1ZBXA 2JMCA 3CCVA 3QDRB 1M1KR 2E6ZA 2K3XA 3L2RA 1G8XA 1YN8A 3V7CA 1KIKA 2VKNA 2COZA 3OYCA 1PG5B 1VQ6T 1MMDA 4F17A 1Q86U 1IXDA 2LJ1A 1AWXA 2BUDA 2JVVA 2RQVA 1UECA 2MWOA
chains in the Genus database with same CATH topology
2KI7A 1OQKA 2ZAEA 1V76A 1PC0A 1TS9A 1TSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KI7 A;  1OQK A;  2ZAE A;  1V76 A;  1PC0 A;  1TS9 A;  1TSF A; 
#chains in the Genus database with same CATH topology
 2CDT A;  5CQY A;  3QII A;  1KQ1 A;  2E65 A;  1K9A A;  3NTH A;  3EGU A;  1VA7 A;  5GAO n;  3QO3 A;  1D0X A;  2EW3 A;  2L3Q A;  2LQK A;  2VXF A;  2LQN A;  4LDW A;  1UGQ B;  1J3T A;  2QAZ A;  3JCM d;  3JCM c;  2H3E B;  5I2M A;  3S3N A;  3I56 T;  4CC2 A;  2DO3 A;  3S3O A;  3RER A;  2JTF A;  2J6K A;  1FMK A;  3OS1 A;  1RUW A;  1AHJ B;  4DOV A;  1VQN T;  1VQL Q;  1U06 A;  1AD5 A;  2KEA A;  3A8L B;  2DL7 A;  3EG2 A;  2K3B A;  4M7D C;  2EYY A;  2ZPE B;  3CXC S;  3Q1J A;  2JN0 A;  4PKC C;  2KMT A;  1YIJ T;  3CCE T;  4EMG A;  3SWN C;  1OV3 A;  4C0D C;  1T3S A;  1KQS S;  3MEV A;  5LJ3 d;  1RL2 A;  4J9E A;  2CP3 A;  4A53 A;  2CYZ B;  4GBQ A;  3G6E T;  1ABQ A;  2WSF E;  2E3I A;  4J9D A;  5GAM h;  3CCV T;  4JPB W;  4ESR A;  2LCL A;  1R8O B;  2KBT A;  2C06 A;  5I11 A;  1Q86 C;  1QP3 A;  1U3O A;  1UHF A;  2GTJ A;  3SB2 A;  1WPY A;  2RF0 A;  5GAN f;  4IUR A;  2KNB B;  5LJ5 j;  2BIV A;  3P8H A;  4WTO B;  2LDM A;  3SWN A;  4F7U A;  3V7S A;  3J7A F;  3HPW A;  4RUG A;  2KYM A;  1YIJ A;  4LDY A;  2KVQ G;  3JB9 I;  3JCM X;  3VUB A;  2NUT A;  3CCV Q;  2D1X A;  4C92 E;  1PSF A;  1VQN A;  1KG1 A;  5DLQ E;  4RCB A;  3CME Q;  4FU6 A;  6AT1 B;  2EQJ A;  3R6N A;  1R0C B;  4RTZ A;  1YIT T;  1M2V B;  3EFO B;  2GBQ A;  4BDY A;  1UFF A;  3M9Q A;  1XJW B;  4FCY A;  4Y91 A;  1QP2 A;  3E1S A;  1K4U S;  1WJQ A;  2HSP A;  4PJO F;  1QVF A;  4DA4 A;  5KYX B;  1GRI A;  1E6H A;  4LDV A;  1I5O B;  4N0A C;  5LJ5 f;  1NEB A;  1JB0 E;  5IHK A;  3BW1 A;  3RIR A;  5CR2 A;  5KYN A;  3RMS A;  4RMO A;  1I07 A;  1VQM A;  4C8Q F;  4LD9 K;  4XU3 A;  4Z88 A;  1EX4 A;  5KH6 A;  3RMQ A;  5HKC A;  8ATC B;  2ATC B;  4Z02 A;  4R56 A;  4PJL A;  1VQP A;  3CCS Q;  1VQ9 T;  1N5Z A;  2RK2 A;  5D6X A;  2DTH A;  1X75 C;  4A4F A;  1O9S A;  2EAY A;  5GAN 3;  2AHJ B;  2VGM A;  2EYQ A;  1VQM Q;  3OB9 A;  3JSC A;  1D3B A;  4HVW A;  5KYY A;  2F69 A;  2KAF A;  2VUB A;  4IKF A;  5LJ5 h;  1WYX A;  3TRE A;  1WNL A;  3JCM J;  2O31 A;  4XTX A;  3OW2 A;  2BE7 D;  1VQ9 Q;  4M78 G;  2LT4 A;  4OF1 A;  3INZ A;  3LH0 A;  3MP6 A;  5CO7 A;  1ABO A;  3THK A;  3QPH A;  3QDF A;  3WXM B;  1Y7X A;  3CCJ A;  5KE2 A;  2RA2 A;  3M0R A;  1G2B A;  1PM3 A;  4A4K A;  1DJ7 B;  4X9D A;  3RUX A;  2R5M A;  3X24 B;  3L2W A;  1K9M U;  4C5E A;  4C8Q E;  2DTI A;  1W2B A;  1Q7Y R;  3G71 Q;  3OYD A;  1BI3 A;  5AYF A;  1HXD A;  1HSQ A;  1VYT A;  4FSS A;  1WJS A;  2D8H A;  2DXB A;  1NBE B;  4XTV A;  1CKA A;  4EMH A;  1Z9Q A;  3CCM Q;  4B6M A;  2J7I A;  3CCS A;  2AT1 B;  5FWB A;  4JLI A;  1OQK A;  2HNI A;  3I55 Q;  2HQH A;  1KK7 A;  4XU2 A;  3BDU A;  2HKN A;  4AMC A;  1MNE A;  3M53 A;  4N0A A;  3OY9 A;  3OYE A;  2RI5 A;  2LJ3 A;  1O75 A;  3M54 A;  4XTW A;  1JO8 A;  1GCQ C;  3PVL A;  4LN2 A;  2MI6 A;  1VUB A;  4CC7 A;  1FWZ A;  2G6F X;  2PUO B;  1QW1 A;  3OMG A;  3RKW A;  1WA7 A;  2QQR A;  1WQW A;  2K2V A;  2K6D A;  3QWY A;  5D6W A;  2HL5 C;  2R57 A;  3CMA T;  1U8R A;  3SD4 A;  2CP2 A;  3F70 A;  2FZK B;  3CCU A;  4R55 A;  2DRM A;  5IAY A;  3AT1 B;  2KRO A;  2QEX Q;  5FU6 C;  3CC7 Q;  1BYM A;  4MZM A;  4QVD A;  3G4S Q;  2PUK B;  4CI0 C;  1G83 A;  2CP0 A;  4A54 A;  1XOV A;  4RTU A;  1WHJ A;  2CT4 A;  2KQW A;  2GGR A;  3SHW A;  5IN1 A;  2ZGW A;  4PL6 A;  2E3H A;  3REA B;  1D09 B;  1SSH A;  4JJN K;  3DB3 A;  1B3Q A;  2EBP A;  2RI2 A;  1YJW Q;  3ME9 A;  1QCF A;  1TTH B;  4ZTF A;  2OTL A;  2YUO A;  2OTL T;  2RD1 A;  1M5Q 1;  5GAM d;  5GAO l;  2FEI A;  3TSZ A;  1JJ2 A;  4GY5 A;  1H3H A;  3CCR A;  4F16 A;  1F1B B;  1KD1 R;  4PJO D;  2F1L A;  3MET A;  2E6N A;  4OB2 B;  2QXF A;  2ESW A;  4HVV A;  4EMK A;  3WVD B;  5CIU A;  1MMN A;  4JZ3 A;  2E10 A;  1MV0 B;  4CRI A;  1MHN A;  1MMA A;  5KCH A;  1PKT A;  1YJ9 A;  1E6G A;  1NG2 A;  3QHS A;  1AWW A;  4C92 C;  4E7I A;  2H8H A;  1KQS P;  3QXE B;  2JTE A;  1M27 C;  3OQ5 A;  3V7R A;  4M77 B;  1RAA B;  2JT4 A;  2BZY A;  4C5G A;  2E1H A;  2RHY A;  1M1K C;  4PFZ A;  1QKW A;  4Z89 A;  3OYI A;  3TSW A;  3HP9 A;  1YHQ T;  1GCQ A;  4PJO A;  4F04 B;  3MP8 A;  1UGR B;  1VQ8 Q;  2H3J A;  4MZP A;  4RTV A;  3KFV A;  2MPX C;  2MWP A;  3G1J A;  2DBM A;  3EFR A;  2RM4 A;  3EG1 A;  1K8A R;  2O4X A;  1OX8 A;  4M75 G;  3CPF A;  1TUD A;  1UUE A;  5D7U A;  1FMW A;  2IPO B;  5LJ3 f;  4J7I A;  5GJW B;  1NM7 A;  3CD6 T;  1RI0 A;  5GAM e;  4EIK A;  3ZEH A;  4RTW A;  1M90 U;  3S6W A;  4JRP A;  4E7H A;  3OBY A;  3QBY A;  3CPW P;  1YI2 Q;  4JZ4 A;  2GFU A;  4AT1 B;  2LMJ A;  4QVC A;  3M0Q A;  1ZA2 B;  4A4H A;  4AFU C;  5J26 A;  2M0O A;  3BE3 A;  2V1Q A;  3GLX A;  1UJ0 A;  3CCM T;  2YRC A;  2VWF A;  4XQ3 A;  3VUZ A;  2DIL A;  1M3B A;  3RBB B;  4M75 F;  2K7A A;  1G5V A;  3EG3 A;  2AZS A;  3M0U A;  4C92 D;  3HRU A;  2RNA A;  4ZN1 A;  2XMF A;  5GAN 4;  3SEM A;  1H92 A;  3CC7 A;  1VIE A;  2V8I A;  2J06 A;  3VKI A;  2BZ8 A;  4FL6 A;  1YBY A;  4JLG A;  2OTL Q;  2RMO A;  1HK9 A;  1LPL A;  3DKM A;  3PNW C;  1OZ2 A;  1ZX6 A;  1RAF B;  2YLC A;  2CSQ A;  1CSK A;  4GLK A;  4C0F A;  1K76 A;  1UTI A;  1S72 T;  3PE0 A;  1PRM C;  2CGH A;  3JCM P;  5IHI A;  3CMA A;  1D3B B;  2P0K A;  2VXE A;  1X2K A;  2FPF A;  1LCK A;  4C8Q G;  2OAU A;  3OYM A;  2JUF A;  4OB0 B;  2EFI A;  3HL8 A;  4OVA A;  2V8J A;  3OYJ A;  2EKH A;  2XU8 A;  4J9F A;  4PLL A;  1K73 U;  4M75 B;  2DX1 A;  3CD6 Q;  4K11 A;  1RAI B;  2IG0 A;  3A8G B;  1YP5 A;  4A4E A;  4M7D B;  3MKD A;  3SFM A;  3FC3 A;  2DEQ A;  4XAX B;  4OGE A;  1WHL A;  3CCL Q;  1QCN A;  5IT9 E;  1AWJ A;  2W0Z A;  4M7A F;  1VQ6 Q;  1KC8 U;  1W1F A;  4FYV B;  1N9R A;  2YDL A;  1C6V X;  3H0H A;  3CCU T;  3OMC A;  1ZQ1 A;  4MZT A;  1YIT A;  5CQX A;  3NTI A;  2KY9 A;  4J5Y A;  2DL8 A;  1M2V A;  4OML A;  1PWT A;  3RES A;  2CKK A;  3G6E Q;  2NUZ A;  4E7Z A;  5GAN 8;  3CCU Q;  3EHQ A;  4ZGD B;  1UEB A;  4NL3 A;  2HAX A;  2D6F A;  4ATO A;  1YJW T;  1YJW A;  4ZN3 A;  1PRL C;  5CCA A;  5HK3 A;  3BFM A;  2HQX A;  5CVI A;  4JDS A;  1AWO A;  1VQ8 A;  5DLO A;  3FB9 A;  2ZAE A;  4C92 B;  1FYN A;  3VRY A;  4O6J A;  2RHI A;  3SWN B;  3OYB A;  4BY6 B;  4CC4 B;  2P0P A;  2L3R A;  1M8M A;  5GAM j;  4A63 B;  3I35 A;  3CCJ Q;  3PIP A;  2RJF A;  3M4G A;  2K5I A;  2NLU A;  5GAM g;  4JJB A;  2DPP B;  5I2S A;  4PLI A;  3JB9 F;  2LCC A;  4J9H A;  1VQP T;  1MND A;  2EJG A;  4M78 F;  1YHQ A;  2D8J A;  4ZGE B;  2JJ9 A;  3J81 E;  3OW2 S;  1AZG B;  2RK1 A;  3VRZ A;  3CC4 A;  2YXY A;  5IXB A;  5IH2 A;  1SPK A;  1Y96 B;  1VQO A;  1WX6 A;  4X34 A;  1Q95 G;  2D9T A;  2A36 A;  3ZBD A;  1GL5 A;  3M58 A;  1OOT A;  2V8K A;  3DB4 A;  4II1 A;  5IHN A;  3H6Z A;  2J6F A;  4M7D A;  2GTO A;  2AZV A;  1U1T A;  2QDL A;  4LUE A;  3X28 B;  5GAN 2;  1UB4 A;  5A0D A;  3HTR A;  1H3Z A;  3E2U A;  2DVE A;  2YSQ A;  2IVW A;  1ARK A;  4DBQ A;  2L2P A;  2YRV A;  2A08 A;  1M2O A;  3V8L A;  1BI0 A;  4ORZ A;  1Q82 U;  8AT1 B;  1I5L A;  4M77 D;  2JOY A;  5FU7 B;  1G3Y A;  1OX9 A;  3NTK A;  1ZSZ B;  1SRM A;  1K8A U;  2E12 A;  4CC3 A;  2EGA A;  2K4Y A;  3J80 E;  3OSV A;  1WGS A;  4ZGJ B;  4JJD A;  4KH1 B;  3G71 A;  4OMQ A;  3CC4 Q;  1N9S A;  3I56 Q;  1TXQ A;  1KFZ A;  2BE9 B;  2DZ9 A;  3TU4 K;  2BKD N;  2RHX A;  1W70 A;  4BD3 A;  3JB9 G;  1UG1 A;  2JS2 A;  4OMO A;  1VQN Q;  4P5N A;  2AK5 A;  1T0J A;  5DM7 R;  3CBP A;  3CQT A;  3CME A;  1HYO A;  4N4G A;  1VQK A;  2KRS A;  1S1N A;  2KXD A;  1VQ4 Q;  1TS9 A;  2L89 A;  1SSF A;  1OPK A;  5J3B A;  5GMK h;  1VQL T;  4AFQ C;  4XTU A;  2FZC B;  5GAO q;  1EIF A;  1V29 B;  5GMK i;  4KUI A;  4J9G A;  4L5G A;  1ZSZ C;  5HCK A;  1QCO A;  3JRZ A;  2NWM A;  4IUQ A;  4QT7 A;  2DLP A;  2KGT A;  5FU7 C;  1LNX A;  3QKJ A;  3EFS A;  1YHQ Q;  3GPL A;  2K2M A;  2MYS A;  3A8O B;  2O4X B;  4BE0 A;  2JS0 A;  3REB B;  3I9Q A;  1BB9 A;  4C5H A;  2M9U A;  3LWI A;  5FLX E;  1WZO A;  1ZA1 B;  5LL6 S;  4Y92 A;  3BY7 A;  3CCQ Q;  3PFS A;  4OMM A;  2GF7 A;  4BI3 A;  1GFC A;  1KHI A;  1YCS B;  4RTY A;  1Q7Y U;  2XI9 A;  5CK9 A;  4FYX B;  4KGX B;  4F14 A;  2GQI A;  5FWC A;  1X6O A;  4PJO E;  4Q5W A;  2YUN A;  3X25 B;  3RDV A;  1K0S A;  4AFS C;  2DRK A;  3HRS A;  2X4X A;  3I5R A;  1SHF A;  2CH4 W;  4J6Y A;  1CKB A;  2HEQ A;  2DL5 A;  1I81 A;  3MPU B;  5C0M A;  1M3A A;  2QG9 B;  2PNI A;  2CUD A;  1VQ4 T;  2ROT A;  2DE0 X;  1UJY A;  2DL4 A;  3O5Z A;  3U23 A;  2AKL A;  2WSE E;  4RTT A;  1BIA A;  5IXF A;  4C0Z A;  1PHT A;  1W4S A;  3KXT A;  2QQB A;  5FRO A;  4D6W A;  2LZ6 B;  3MEU A;  3E9F A;  1M90 R;  4M7D E;  3CCR Q;  4E47 A;  4PJN A;  4M7A E;  4M75 E;  2EQM A;  3CCE A;  4J9I A;  2F5T X;  4EMK B;  1BU1 A;  3JV3 A;  2EQI A;  1H8K A;  2F5K A;  2MAM A;  2DF6 A;  5CKE A;  2AIR B;  1JU5 C;  2EQU A;  2BTT A;  3H0I A;  3A5Z B;  5EG2 A;  4J9C A;  5KYU B;  1ZUK A;  3LYI A;  3G4S T;  3QG1 A;  3HHT B;  1B7T A;  4BY6 C;  5L23 A;  1W2B P;  3CBM A;  2GQV A;  1JEG A;  4JRK A;  2XG8 D;  3PMI A;  1IGU A;  2HQE A;  3C4S A;  5L8R E;  2JMA A;  3TEE A;  2X9H A;  3H9N A;  2LCS A;  1LVK A;  3L2U A;  4L59 A;  1WLP B;  3OS5 A;  2L0A A;  3FJ5 A;  2LNV A;  1JJ2 S;  2QA4 Q;  1ZSZ A;  2E41 A;  2KT8 A;  3HFN A;  2X4Y A;  3I5S A;  1NZ9 A;  2A0F B;  2DZC A;  2X4J A;  4V2S A;  1XQH A;  4EPC A;  1AZE A;  2DER A;  1BK2 A;  2JZ2 A;  4NL2 A;  4M7D G;  2RHZ A;  3PTA A;  3BDL A;  2M51 A;  2A3L A;  1Q7Y C;  3CCE Q;  1KD1 C;  2JM8 A;  2XIC A;  3CC4 T;  4HXJ A;  3RR6 A;  4RG2 A;  3MEA A;  1FXX A;  1K73 R;  2DNU A;  3SDZ A;  1YJN Q;  3H41 A;  1M1G A;  4KT0 E;  4QQG A;  4M4Z A;  3HFO A;  2NUP B;  1VYV A;  2P4T A;  3EHR A;  1K1Z A;  4RKU E;  3MEW A;  4PJO G;  2QQ9 A;  4AG1 C;  3EH2 A;  4EDU A;  2CT3 A;  1JJ2 P;  5GAN e;  1G3T A;  1BCM A;  2PVO B;  4J9B A;  1KC8 R;  1BI1 A;  4C92 A;  4HT9 A;  1S72 A;  2DET A;  1TUG B;  4C8Q D;  2PVG B;  2W10 A;  3M59 A;  3FEO A;  4KH0 B;  1TSF A;  2DA9 A;  1ZUU A;  4QVZ A;  1NJI R;  3NHN A;  5FRM A;  1WFW A;  2YLB A;  3VS4 A;  1KHC A;  2LP5 A;  3CC7 T;  1SEM A;  5LJ5 d;  2RQR A;  5HY6 A;  3JB9 J;  4E7K A;  3RNJ A;  1OI1 A;  4PJM A;  1N8R C;  1KQS A;  1Y07 A;  4IIO A;  1OEB A;  1YJ9 Q;  3KUF A;  4M77 E;  1QVG A;  2DTO A;  7AT1 B;  2EGE A;  1S72 Q;  4TVR A;  4NOY A;  4RTX A;  5HK0 A;  3CCJ T;  2G3R A;  2XID A;  1N8R R;  4OGC A;  1U1S A;  3G6E A;  2FRW A;  4DBH A;  2CSI A;  3VS2 A;  2M1H A;  1YJ9 T;  2GFA A;  1YJN A;  2K57 A;  2XD0 A;  1IRX A;  2KSS A;  1LOJ A;  2V26 A;  1XNI A;  1Q81 C;  5CKF A;  2X35 A;  1VQ7 A;  1EFN A;  1TWB A;  1K9M C;  1M3C A;  2J6O A;  3UWN A;  3CC2 A;  1K9M R;  1TG0 A;  4FW2 A;  1RAE B;  1WHM A;  1VQP Q;  3OW2 P;  1X27 A;  1KD1 U;  3LLR A;  4QW2 A;  1MV3 A;  1VQK Q;  2M0Y A;  4L6V 5;  2LX9 A;  3VS5 A;  3I55 T;  2KR3 A;  2FPD A;  3CCL T;  2YUP A;  4ELZ C;  2O9V A;  3GNG A;  2RH2 A;  2O01 E;  4C8Q C;  5I21 A;  4M75 A;  1NPP A;  2QDY B;  2OI3 A;  1YIJ Q;  1M30 A;  1D1B A;  1IO6 A;  2SRC A;  2CUB A;  4JRQ A;  4J6W A;  4HCZ A;  4M77 C;  1BI2 A;  2FVU A;  4M78 C;  4AFZ C;  3EGD B;  5GAN h;  4GLM A;  2QI2 A;  4C0G A;  2QYZ A;  2JW4 A;  9ATC B;  1IHW A;  1QVF S;  4PJJ A;  2X3W D;  1YNZ A;  1N8R U;  1BBZ A;  1BCO A;  5GAN g;  1Y0M A;  2QTX A;  4JUV A;  2DL3 A;  4VUB A;  1NPR A;  1VQ7 Q;  1B34 A;  1AEY A;  4DEY A;  1UGP B;  3L1A A;  3UT1 A;  3DLM A;  3ZL7 C;  1YWO A;  2HBW A;  1N27 A;  2MCN A;  2J05 A;  2EJF A;  4NS5 A;  4OB1 B;  2QQS A;  2DFU A;  1RAD B;  1GXI E;  1ZUY A;  3LW5 E;  3MP1 A;  3G7Z A;  3OBW A;  1X43 A;  5KYW B;  1FX7 A;  1JXO A;  3OSS C;  5CKH A;  1Q81 U;  2DIQ A;  5LJ3 h;  4FYW B;  5CKD A;  1AT1 B;  1K0X A;  1ZBJ A;  3LGF A;  2VV5 A;  4IUU A;  3ULR B;  1SKU B;  2MK5 A;  2L3P A;  2OTJ A;  1PSE A;  1H64 1;  3JCM W;  2HD0 A;  3L42 A;  2KXC A;  4OMN A;  3JCM e;  3FLG A;  1YJN T;  2L3S A;  4ZNX A;  2KYB A;  1R0B G;  4E7J A;  1ZSG A;  1TUC A;  4WF2 A;  4OMF B;  3TCJ A;  2PZ1 A;  4IIM A;  2QTV A;  3LWH A;  2QA4 T;  2A28 A;  1VOM A;  3VYG A;  2QA4 A;  2E5K A;  4FT2 A;  2P4R A;  3JB9 D;  3E19 A;  3TVT A;  4XK8 E;  2K5L A;  2ZCF B;  1GCP A;  2PVD B;  3JCM g;  1VQ5 A;  3EH1 A;  2OTJ T;  5A2Q E;  4DBR A;  3GIB A;  2EWN A;  4E7S A;  4J8O A;  1FMV A;  2XK0 A;  2MMP A;  2EGC A;  1OZ3 A;  1YIT Q;  4R0K A;  5AT1 B;  3QWX X;  3JCM V;  4QQD A;  2Y4X A;  1QWF A;  2DKG A;  2DEU A;  1Q86 R;  2VGN A;  1NE8 A;  1M1K U;  2LTO A;  2RJD A;  4M77 A;  2V1R A;  1YI2 A;  3QZ9 B;  2OX7 A;  4MMK A;  1SRL A;  3GNF B;  3QSU A;  2CP6 A;  3CCS T;  4IUP A;  2YRD A;  4JS4 A;  3I56 A;  2DD4 A;  3GF5 A;  3QYG B;  5D6Y A;  4X9C A;  3DLL A;  4XTY A;  4BI8 B;  3CPW S;  2Y4Y A;  4MDW A;  3V8J A;  4OB3 B;  2ENM A;  5C6S A;  1IZ6 A;  3FIF A;  1JRI A;  4XU1 A;  1MMG A;  2LRQ A;  4LE9 A;  3L2V A;  1VQM T;  1VQK T;  3VS1 A;  1IRE B;  3CEY A;  2RB6 A;  1WJR A;  4JS5 A;  1IHV A;  4M75 D;  2XDB A;  2EIF A;  2RO0 A;  3QUI A;  2HCK A;  3VS6 A;  5FW9 A;  2HSE B;  1I4K 1;  5KYU A;  1JQQ A;  3G71 T;  3FDR A;  3NMZ C;  4KUD K;  3EAE A;  1QVG S;  2RPN A;  1VQ4 A;  3C95 A;  1WXU A;  1TOV A;  3OYH A;  1NYF A;  3IQL A;  4D8K A;  4KGZ B;  3JCM h;  3CCL A;  4DBF A;  2VAS A;  3WVE B;  3OA6 A;  2HBP A;  4M77 G;  2VB6 A;  2C0O A;  1WI7 A;  4N4H A;  3OYG A;  2C0I A;  1QWE A;  1Q81 R;  2A37 A;  3QJY A;  3TQ7 P;  3HSB A;  1XTD A;  2HKQ B;  4Z8A A;  2KK4 A;  1GBQ A;  4M7D F;  3A98 A;  2DAQ A;  2EYZ A;  4IUV A;  2XHC A;  4RCC A;  1YI2 T;  4LNP A;  3JCM b;  1PCX A;  1Y71 A;  1RAH B;  2CZ6 B;  3G4S A;  2FYK A;  1X69 A;  4E6R A;  3CCQ T;  1QVG P;  1EZZ B;  3OYA A;  3CD6 A;  2NYS A;  3N5B B;  2FL7 A;  3EG0 A;  3URG A;  2L5Q A;  2ZPH B;  1X6B A;  5GAN 7;  3FRN A;  4A4G A;  4C8Q B;  4E2F B;  2RQT A;  2KT1 A;  4KUL A;  2MOX A;  3S3M A;  2P84 A;  2QEX T;  2QQA A;  5GMK j;  3M55 A;  2EJ9 A;  3PIO A;  5GAO r;  5M9O A;  1PNJ A;  3PMT A;  2DD5 A;  4FW1 A;  5DY9 A;  3KBG A;  1K73 C;  4BUG A;  2KI7 A;  2COW A;  2E64 A;  2SEM A;  1YWP A;  2DIG A;  1X6G A;  2QGG A;  1M1F A;  4LUD A;  4LXC A;  2HZY A;  3RKX A;  2L8D A;  3CBO A;  2Z0W A;  1QVP A;  1WIE A;  1Z9Z A;  3FJP A;  2KDS A;  2RI3 A;  5GAO p;  1R77 A;  2R5A A;  1PD1 A;  4Y28 E;  2QEX A;  1G3S A;  3QJ6 A;  1W2B S;  1WHK A;  3C12 A;  1M9S A;  2X51 A;  1SG5 A;  3HKS A;  1OPL A;  2FB7 A;  4HKE A;  1WDX A;  4B9X A;  2CZ1 B;  1U5S A;  4OP0 A;  4X1V A;  2ECZ A;  1OU9 A;  1UGV A;  2LQ8 A;  2ZPG B;  1RLQ C;  2EPD A;  2GCX A;  4HT8 A;  5I22 A;  2B8A A;  3O8V A;  3EGD A;  3JCM f;  1NJI C;  1B34 B;  3LX7 A;  3UF4 A;  1C0M A;  3ER0 A;  5LJ5 e;  1HJD A;  2BZX A;  1AVZ C;  1PC0 A;  1YFN A;  3UDC A;  1RI9 A;  2CZ7 B;  2DJZ A;  5GAN 6;  3JCM Q;  1WXB A;  2ZPB B;  5KYY B;  1UGS B;  1Q82 R;  3CME T;  1VIF A;  3OYF A;  4FSX A;  4DOW A;  1ACM B;  1KSW A;  3R6O A;  3X20 B;  1YCY A;  2CP7 A;  4HA8 A;  3P8B B;  4KGV B;  1M8V A;  1RAG B;  4M77 F;  4QKU A;  1T3L A;  4C5I A;  2YHT A;  1AOJ A;  5CAI A;  5GMK l;  3M57 A;  2MIO A;  1SHG A;  2OAW A;  1A0N B;  3A8M B;  3PGG A;  2FZG B;  2PQW A;  3H0F A;  2HDA A;  3EG9 A;  1OU8 A;  2CP5 A;  2KRM A;  2M02 A;  2ZPI B;  2LX7 A;  3GOX A;  2OTJ Q;  3EFO A;  3M4Y A;  2PTK A;  3VU3 C;  4FYY B;  2ZPF B;  3VYH B;  3I55 A;  4HVU A;  2ABL A;  3PVQ A;  5A0L A;  4BDZ A;  1PKS A;  2MF2 A;  3RKY A;  4BE2 A;  3UAT A;  5LJ5 g;  2DM1 A;  2JTM A;  1Y96 A;  2R58 A;  2VC8 A;  1KJW A;  1M90 C;  2EYX A;  5KYX A;  1G3W A;  2PU9 B;  4DEX A;  1VQ5 Q;  4JRI A;  3PT9 A;  3CC2 T;  1QQJ A;  3HRT A;  2O88 A;  2RJC A;  2EQK A;  1VQ8 T;  2F2X A;  2NUT B;  1B07 A;  2QK0 A;  2DXT A;  4M7A G;  1GFD A;  1QVF P;  3CXC P;  4KRT A;  4UC4 A;  2WAC A;  3MCA B;  2QGF B;  4FM4 B;  3CPW A;  1VYU A;  1V1C A;  3CMA Q;  4OMP A;  3JB9 H;  3M56 A;  3T9N A;  3L2Z A;  2ROL A;  1VQO T;  2RN8 A;  2YUQ A;  1VQ5 T;  5GJV B;  4M7A D;  2KE9 A;  1QLY A;  2ED1 A;  4JJC A;  4LDX A;  1NLO C;  2A7Y A;  1NJI U;  1HD3 A;  3M0T A;  3QYH B;  2HL3 A;  5FU6 B;  4D8D A;  5KE3 A;  2EYW A;  2VVK A;  1VQL A;  1SF9 A;  1RLP C;  1LJO A;  2CH4 A;  2DJQ A;  2FPE A;  3ASK A;  1RAC B;  4F7U B;  1QKX A;  4C0D B;  2IIM A;  4B9W A;  4F7U F;  2OJ2 A;  1T0H A;  2YT6 A;  4M78 D;  1TU0 B;  2M16 A;  4PNO A;  2K79 A;  2LJ0 A;  5GAN 5;  2E5Q A;  4ELY C;  4BE1 A;  4J7F A;  3OS2 A;  3AHU A;  4M78 E;  3ZFJ A;  5GMK m;  2COY A;  3A8H B;  3M0S A;  1JBM A;  2XKO C;  3JAM E;  3LH5 A;  3C94 A;  3VS0 A;  3CXC A;  2XDP A;  2LC4 A;  2RJE A;  1IB8 A;  2ED0 A;  4J83 A;  5GMK e;  1NYG A;  2JNG A;  1D0Y A;  2O9S A;  3E9G A;  3CCQ A;  1NEG A;  5LJ3 g;  5GAO m;  4O5V A;  3V8K A;  1E7O A;  2LT1 A;  1I0C A;  2NUP A;  1NLP C;  3OS0 A;  4PFO A;  5LJ3 j;  3L2Q A;  2RHU A;  3X26 B;  1D0Z A;  5A0G A;  1WXT A;  2EKO A;  2FG0 A;  3EG9 B;  1JXM A;  1OYX A;  1WQ7 A;  4PFP A;  3VJP A;  4E7L A;  2AKK A;  1MGQ A;  2YWW A;  2K3Y A;  2RQU A;  5KCO A;  2I2L A;  3MO8 A;  1KC8 C;  4IUT A;  2VYT A;  4N4I A;  4ANJ A;  2HMA A;  4BAC A;  4PJO C;  2P0Q A;  2LQW A;  1UDL A;  1VQ7 T;  5J39 A;  2XDD A;  1ZLM A;  2E4H A;  1D1A A;  4HCB A;  1VQO Q;  1I1J A;  1MUZ A;  2K9G A;  1QMC A;  4BB7 A;  4ZTJ A;  3MJX A;  4ME7 A;  5EC7 A;  4EMK C;  4HCK A;  2F2V A;  5FRN A;  3C0C A;  2ZZD A;  1IGQ A;  1ZHI A;  5ECA A;  3LGL A;  4C92 F;  3VS7 A;  1VQ6 A;  4J6X A;  4XU0 A;  4M75 C;  3GBQ A;  3A1P A;  2LNH B;  1VQ9 A;  3EGX A;  1RAB B;  3OYL A;  3M5A A;  3UPU A;  2I0N A;  1V76 A;  4FT4 A;  2EVR A;  2GNC A;  4F7U G;  3M0P A;  4AG2 C;  1W6X A;  2RQW A;  2DYB A;  2DXU A;  2FO0 A;  4M78 B;  3MHX A;  1KQ2 A;  5GAN j;  2E70 A;  4BI4 A;  1BKB A;  1OUL A;  4XTZ A;  3OYK A;  3UA6 A;  4RG8 A;  4F7U E;  2Y90 A;  4M7A B;  4WCI A;  2DVJ A;  1M4Z A;  2DBK A;  4HCC A;  3D7S B;  4DQ2 A;  2DYI A;  3NGP A;  3OYY A;  3VS3 A;  3CCM A;  4M7A C;  1WHG A;  3H8Z A;  3GP8 A;  1PD0 A;  2B86 A;  2O2O A;  2FHD A;  3P8D A;  2K5F A;  1GBR A;  1I8F A;  1Y57 A;  2JXB A;  2X3X D;  4YTL A;  1C1A A;  4FIB A;  2CS7 A;  1UE9 A;  2DK3 A;  1WHH A;  1D1C A;  1TH7 A;  2QAS A;  4MDX A;  2WSC E;  4C8Q A;  3NPF A;  1N6A A;  4C92 G;  3NFC A;  2C0T A;  4PJO B;  1Q82 C;  5LJ3 e;  2D0Q B;  3OYN A;  2DMO A;  3VV0 A;  2FRY A;  5GAM f;  4MML A;  2F2W A;  4LDU A;  2JM9 A;  2DXC A;  2X4W A;  4PK4 A;  2LVM A;  2CZ0 B;  5GAN d;  1K8A C;  2KRN A;  4M78 A;  2CRE A;  5KYW A;  4M7D D;  1X2Q A;  1P92 A;  1X01 A;  5CKB A;  3CC2 Q;  4LD6 A;  3CCR T;  3UA7 A;  4M7A A;  3QZ5 B;  2D0N A;  1BIB A;  4KBM B;  3EGX B;  1UHC A;  4QQ6 A;  1ZBX A;  2JMC A;  3CCV A;  3QDR B;  1M1K R;  2E6Z A;  2K3X A;  3L2R A;  1G8X A;  1YN8 A;  3V7C A;  1KIK A;  2VKN A;  2COZ A;  3OYC A;  1PG5 B;  1VQ6 T;  1MMD A;  4F17 A;  1Q86 U;  1IXD A;  2LJ1 A;  1AWX A;  2BUD A;  2JVV A;  2RQV A;  1UEC A;  2MWO A; 
#chains in the Genus database with same CATH homology
 2KI7 A;  1OQK A;  2ZAE A;  1V76 A;  1PC0 A;  1TS9 A;  1TSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...