1V76A

Crystal structure of archaeal ribonuclease p protein ph1771p from pyrococcus horikoshii ot3
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
GRVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGDRIWKVPKDVSIFEFEADDGTKIKIPGERLVGRPEMRLKKRWKKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNase P protein Ph1771p
publication title Crystal structure of archaeal ribonuclease P protein Ph1771p from Pyrococcus horikoshii OT3: an archaeal homolog of eukaryotic ribonuclease P protein Rpp29
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Rna binding protein
total genus 21
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2003-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01868 UPF0086 Domain of unknown function UPF0086
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.210 Mainly Beta Roll SH3 type barrels. Ribonuclease P/MRP, subunit p29 1v76A00
1TS9A 2KI7A 1V76A 2ZAEA 1OQKA 1PC0A 1TSFA
chains in the Genus database with same CATH superfamily
1C0MA 4C5EA 5LJ5d 1NJIU 4QQDA 4M7AA 1VQOT 2NUTA 2W10A 4DBHA 2BE7D 4FW2A 1QKWA 1PKTA 1RLQC 4X34A 4ZGJB 2FB7A 3H0HA 2PTKA 5CCAA 1U1TA 1YP5A 1YWOA 4L5GA 1WHHA 4PJOF 3DB4A 3VS4A 5LJ5g 3RMSA 3SFMA 2OTJT 1HYOA 5GMKm 4OVAA 1EX4A 2K5LA 1WXBA 2B86A 4Y28E 1OZ2A 5KCOA 1BI2A 3TEEA 5LL6S 1WHMA 2J6OA 1AEYA 1VQ9A 2EW3A 1Y71A 3RMQA 3C12A 1QP2A 2F69A 1TUDA 1ZBJA 2KT1A 1GFDA 2JM8A 2E6ZA 1K9AA 3CCRA 4F7UA 3VRYA 2KR3A 1XOVA 4M77F 3D7SB 1JO8A 1IREB 3EH1A 4FSXA 2X51A 4PNOA 1BI0A 2BZ8A 4LDWA 1Q81C 4FYWB 4BY6B 2YLBA 3MKDA 2HSPA 2FYKA 2DEQA 4ZTJA 1ARKA 2KRMA 1WHLA 3ZL7C 1WPYA 4PL6A 5CR2A 1X6GA 3SWNB 2YRCA 2COZA 1RADB 2F5TX 4FYVB 3EG0A 3UA6A 5ECAA 1U5SA 3CCUA 2DL3A 4GY5A 2E64A 3VS6A 1M2OA 2RD1A 5GJVB 1RI9A 2MK5A 4J9IA 3OYJA 2D9TA 4ZGEB 3ER0A 3TU4K 5D6XA 3DLMA 3P8BB 5C0MA 2C0OA 5LJ5h 2ED0A 1NJIC 3VUZA 2HBPA 1ZX6A 3FC3A 1I1JA 1PHTA 3I56T 4LN2A 2DVEA 5FU7C 3E9FA 4OMOA 1M2VB 2GGRA 1VQMT 3QHSA 2XICA 4E7ZA 1VQ9Q 1VQ7T 2R5MA 4M78F 2P0KA 3QUIA 5CKDA 3CCSQ 1V76A 4LUDA 2DD4A 2DXCA 4XTZA 2CH4W 3OYYA 1I0CA 5DM7R 3A8HB 2DX1A 1NG2A 2LQNA 1BI3A 4JPBW 4KGVB 3V7CA 5GMKl 3EG2A 4RG2A 4M7AB 3VS1A 3OW2P 2LTOA 2NUTB 1GCQA 2KXCA 3CCET 2BZYA 3L2QA 1PC0A 3QDFA 1TOVA 5GANj 4DBQA 3OYGA 4J6WA 3CMAT 4C92D 1MGQA 3M59A 4IUQA 2LT4A 2AKKA 1M1FA 4M7DD 5CQXA 1TTHB 3CC4Q 2P4RA 2M16A 2FZCB 2EWNA 3M56A 4PLIA 1G83A 3VKIA 1YHQA 2DBKA 4M75D 3CCQA 1X6OA 3MP6A 5EC7A 2EYZA 2EYYA 4ZTFA 2ZPBB 4OB0B 1Q7YR 1VQ4A 1WI7A 2RQWA 1W1FA 1X2KA 1ABOA 3EH2A 3REBB 5DLOA 1UE9A 1W2BS 4D6WA 4F7UB 2VGNA 2XMFA 2E3IA 3META 1M27C 2QA4A 1K8AU 2EJ9A 2VC8A 4C92E 3GNFB 2X4XA 3JSCA 3JB9F 1UEBA 4FW1A 2O9SA 4M7DE 2CKKA 3RKWA 2PVDB 2K5IA 8ATCB 1NYGA 3KUFA 3WVEB 1SSHA 3KFVA 2XU8A 1VQKA 3CD6Q 3RESA 4CI0C 2RJFA 2XIDA 2ZAEA 1HXDA 3A8LB 3N5BB 2AK5A 3L2WA 3C95A 1VQPQ 1J3TA 1MMGA 1K76A 4JDSA 3SDZA 1XQHA 1U06A 2RJDA 4IUTA 4PFPA 2MF2A 1YJWQ 3DKMA 1YITA 2VB6A 2DZ9A 1QVGS 1S72A 3OYDA 4QT7A 3S3OA 3NPFA 5GANe 4PJMA 4IIMA 2VUBA 1YJNA 2MAMA 1V29B 5GMKj 1JBMA 5CIUA 2JN0A 4ANJA 1M90R 1ZUYA 1X69A 2O88A 2CP0A 2YUNA 2K5FA 1IRXA 3CCQQ 1KD1U 2M0OA 1TWBA 2FVUA 4BI8B 3HSBA 2BIVA 1W6XA 1VQ4Q 5AYFA 5GANd 2EKOA 4J6XA 2VV5A 3H6ZA 5IXFA 3JB9I 2FO0A 2DF6A 3ZFJA 3EFSA 1MNEA 2QEXA 2J06A 2JXBA 4CC4B 2DILA 2RHYA 1K9MU 4M7DG 2QDYB 2QA4Q 4HKEA 2LVMA 4MDXA 3UDCA 1CSKA 1KQ1A 3OA6A 2HSEB 4A4FA 2JS2A 2PUOB 1VUBA 1Q82C 2HQHA 2O4XA 2IVWA 2YUQA 3VUBA 2E6NA 1K8AC 4J8OA 1X2QA 4O6JA 1VQ5Q 1SRLA 2JNGA 4Y91A 4FU6A 2DXUA 3CC7A 1VQKQ 2DTIA 3CMEQ 4LE9A 4FSSA 2EGCA 3HFNA 3I5SA 3KBGA 2D0QB 3OMGA 2RPNA 3L2UA 4XTVA 2GNCA 4E7HA 3E1SA 3MP8A 1Q86R 5FU6B 2KDSA 2V1RA 1PRLC 1NEBA 2EYXA 4J9CA 3V7RA 1N8RR 2ZCFB 3ZEHA 2PQWA 1QVFS 1IHWA 1TG0A 2A37A 4RCBA 1S72Q 4C92F 1FXXA 3THKA 5GAN3 1UUEA 1VQNA 4FM4B 1UTIA 2E5QA 2QI2A 5GMKe 1JJ2S 5IHNA 4M75F 4AFQC 2DRKA 4BE0A 2EQIA 3PMTA 2K3BA 1OEBA 3M5AA 4C0DC 5CVIA 2NUPA 4OMLA 5M9OA 2JJ9A 1B34A 2J6KA 4EMKA 5KE3A 4JJNK 2DEUA 1KD1C 2EQMA 1VQ9T 3OS2A 4J9HA 2GTJA 2AZSA 2KE9A 2DRMA 4FL6A 4LNPA 1C1AA 4BE1A 2Y90A 3CCST 2PVOB 2DJQA 4ZN3A 1GL5A 2O31A 1ZA1B 3URGA 1PM3A 4AG1C 2YT6A 4TVRA 3AT1B 3CCMA 2M02A 2H3JA 3I5RA 1AVZC 4AMCA 4MMKA 1OULA 4QVCA 1M1KR 4M7DC 1ZUUA 3FIFA 1VYUA 4AFZC 3CBOA 1ZSZA 1SHGA 1W2BP 2G3RA 2R58A 4XU2A 1S1NA 1GCPA 1AWWA 2HL3A 4PJOE 2EJFA 3WVDB 5GAN2 1T0HA 1UDLA 2DPPB 3LW5E 3LGFA 3CC4T 4HT9A 3M4GA 1PWTA 4BACA 2X3WD 4LD6A 2D1XA 2YLCA 4C8QA 2COYA 2A3LA 2GF7A 1H3HA 3CXCA 1YBYA 4PJLA 2BUDA 2NUZA 2QYZA 4MMLA 1WJRA 2E41A 5KYUA 4JS4A 3RBBB 3LX7A 1WJSA 4JLIA 2RA2A 1MV0B 2OX7A 4AFUC 4C0FA 2RF0A 5J3BA 1OV3A 2JT4A 2WSCE 1R77A 4PFZA 2D8HA 1WFWA 1M30A 1M3CA 2VASA 3OB9A 4PKCC 1OYXA 2HKNA 2CH4A 2O4XB 4OB3B 3CC2Q 4C5HA 4OB2B 4R55A 5HK0A 1LVKA 1WQ7A 1UGVA 2FEIA 2JUFA 1QVGP 2CDTA 1E7OA 3QZ5B 3E19A 3OW2S 3H9NA 1KQSP 3X24B 1X27A 5GAN4 2KYMA 2HNIA 2QTXA 2KXDA 2L2PA 4M78D 4RTXA 3EAEA 3NFCA 3RIRA 2E10A 4E7JA 1NLOC 1VQPT 1K73R 1YFNA 2LDMA 2XG8D 1AHJB 4RTUA 2L8DA 1MV3A 2JVVA 5GAOr 1VQ6A 3PVLA 3REAB 4PJOG 4II1A 2P0QA 5GANf 1EFNA 3M0TA 2M0YA 3VRZA 4HXJA 4WTOB 1NPPA 2JOYA 5CQYA 4C5GA 3LH5A 2NUPB 3A8GB 1B34B 3LLRA 3PMIA 1QW1A 4EMKB 3CCQT 1V1CA 2M9UA 4M78E 1VQLA 2CGHA 2WSFE 2YDLA 1VQ4T 4M77G 4PK4A 3TREA 2NYSA 2DM1A 3M0UA 2M1HA 1NE8A 1OPLA 1RAFB 4J9BA 4BDZA 2DERA 2J05A 3CCJA 2BTTA 4RKUE 4M77A 4JRIA 2DFUA 2CZ1B 2QA4T 5GJWB 1UECA 2LQ8A 4OB1B 4LDYA 2JM9A 1ZSZB 1T0JA 3CPWP 1OU8A 2H8HA 1Q7YU 1BBZA 2KQWA 3JB9D 5A0LA 1QVFP 1VQ5T 3UA7A 2PU9B 4DOVA 2LCLA 1VQKT 3CMET 4XTYA 3J80E 1IGQA 4CC7A 3EGDA 4C8QB 3FJ5A 1KHIA 1UG1A 1VIFA 2P0PA 4LD9K 4LDUA 1M3BA 1NLPC 1JJ2P 2L89A 5KYUB 3E9GA 4E6RA 2Y4XA 5FROA 5GAMf 3OMCA 1AOJA 1U1SA 3G6EA 1KIKA 2XK0A 1FMWA 1S72T 1I5OB 2OI3A 2EQJA 1GXIE 4E7LA 5GAOq 5IT9E 4RMOA 1YIJQ 4IUVA 3PVQA 1YJNT 3E2UA 5CKFA 3OYCA 3S3NA 1K1ZA 4M7AF 4JZ3A 4LXCA 4PJOC 3SEMA 4M78G 1MMDA 4OMNA 3QO3A 5I22A 1B7TA 3TSWA 2HEQA 3G71A 1FMKA 4MZMA 3RDVA 3VS3A 3HP9A 1OX9A 3I9QA 3A8MB 4QQ6A 2SRCA 4OF1A 2QK0A 2SEMA 5GAN5 3H8ZA 2L3PA 2O9VA 4A63B 3G1JA 1KFZA 2F2WA 4PJJA 4A53A 3EFOA 4OGEA 1A0NB 1Y0MA 4M77C 2QEXT 2DVJA 3CCVA 1M90U 1D0YA 5HK3A 4RTTA 4X9DA 1GBQA 3OYAA 1NPRA 1I07A 1XTDA 2PVGB 3M0RA 2OTLA 1UB4A 2W0ZA 1N9SA 3C4SA 3KXTA 4F7UF 3MCAB 4OP0A 3JCMe 1H92A 4QW2A 3O8VA 1D0XA 4ME7A 1XJWB 1G2BA 1Q95G 2LRQA 3EG9A 1TU0B 2E1HA 1BB9A 1UGRB 1DJ7B 1M3AA 2GQVA 4JJBA 3JCMc 3JB9H 2D6FA 1PD1A 4FYYB 2EYWA 3CBPA 1M4ZA 5IHKA 3LWIA 3JCMd 3PFSA 1YJ9A 2AKLA 3CCRQ 1G3SA 3GOXA 2X3XD 1HJDA 1Q81R 1D1AA 4AG2C 4RTVA 3OYLA 3JB9G 2JW4A 1BIBA 2JZ2A 1KK7A 4CC3A 2ZPIB 1AZEA 2RN8A 4R0KA 4HA8A 1TUGB 2MCNA 1Q86U 5KCHA 3SB2A 1BKBA 4JRQA 3CC2T 3C0CA 2QDLA 2KI7A 5FU7B 2I0NA 1WNLA 1WZOA 2DKGA 2RM4A 2MIOA 4R56A 1N8RU 1X6BA 4E7SA 3I55A 4PLLA 3BE3A 3JCMX 5GAN8 4M78C 3EGDB 1BCOA 2B8AA 3CCUQ 1LPLA 1LOJA 3M54A 2JTMA 5FW9A 2HQEA 1RAHB 4D8KA 1MHNA 2C0TA 4J6YA 3CCMT 1VIEA 5DLQE 3V8LA 2LMJA 2OTLQ 5GAN7 1WGSA 2EIFA 5FRMA 4L6V5 1FMVA 2GBQA 3MP1A 3G4SA 3L2ZA 3JCMP 1QQJA 3FJPA 3OBYA 3QPHA 3EG1A 4JRKA 3A98A 1G8XA 1KQ2A 4N4GA 2L5QA 1VQOA 2F2XA 4M75E 3O5ZA 2KK4A 1OX8A 4QVDA 4F16A 2HD0A 5KYYA 3JV3A 3BY7A 3QJ6A 4XK8E 1M1KU 4KBMB 2DTHA 2PUKB 1JU5C 1QCFA 2RK2A 2OTJA 1IHVA 3EFOB 3L1AA 4BI3A 3JCMQ 5GAMj 2HMAA 1QWEA 1RABB 1WX6A 2O01E 1OI1A 3I35A 3INZA 1QWFA 1ZHIA 4DOWA 1JB0E 1YCSB 3CEYA 1KQSS 4FT4A 1BI1A 2R57A 4A4GA 2ZPFB 1AT1B 1PG5B 3WXMB 4IUPA 2F1LA 2LNHB 1YHQQ 2RMOA 2EAYA 3EG9B 4BE2A 4JJCA 3UWNA 4BD3A 3M53A 3EFRA 2GTOA 3CXCS 1N8RC 4J9EA 1M8MA 3QXEB 5CKEA 3JB9J 3BDLA 1WLPB 2LJ3A 2LT1A 4C92G 5AT1B 4CC2A 1UFFA 3VS7A 3GP8A 2VGMA 1RAIB 3CCLA 2CP3A 3A1PA 5GAOp 3MO8A 1TUCA 4QQGA 1UGSB 4M75G 1PSEA 4B9XA 5GANg 1F1BB 2JS0A 3OYBA 4M7DA 2XDPA 3ME9A 1OU9A 2MYSA 1YIJT 1X43A 4XAXB 5KYNA 1H641 4OMMA 1WHGA 5FRNA 1I5LA 1K73U 3I56A 4NOYA 1SG5A 3A5ZB 3GBQA 2CT4A 2DO3A 4ZGDB 1Y96A 1VQLT 2LJ0A 2F2VA 5D6YA 4LUEA 4XTXA 3T9NA 3OS0A 3BFMA 1W4SA 1VQMA 1PNJA 2COWA 3CPWS 4E2FB 3P8DA 4BUGA 2FPDA 1NEGA 3M0PA 5GAMe 1YITQ 1VQ7A 1C6VX 4ZN1A 4N4IA 2BKDN 3CCJT 2V8IA 3ZBDA 1JEGA 1UGPB 1ACMB 1PRMC 1YJNQ 1YN8A 1JXMA 1O9SA 2OJ2A 2HZYA 5J26A 3JCMf 1VQ8A 5GAMd 2RK1A 1W2BA 2K2VA 3OYFA 2CSQA 4MDWA 3J81E 2DJZA 4XU1A 2DAQA 3C94A 5KYYB 5A0DA 5CO7A 1XNIA 2LX7A 3VS2A 1PSFA 1U3OA 2MPXC 3V8KA 3R6NA 4E7KA 4GLMA 5DY9A 5GANh 2QEXQ 1Q82R 1QP3A 5GAMg 3CCRT 3CCLQ 3PT9A 1TXQA 4RTZA 1T3LA 3JCMW 1WA7A 1HD3A 4C92C 4ELZC 1WJQA 1K9MC 4DEYA 4BI4A 2RQVA 5KE2A 4XU0A 3CC7Q 1KC8R 2X4JA 1X75C 2ED1A 3HFOA 4M75C 1RI0A 1AD5A 4M7AD 1CKAA 1FX7A 1PKSA 7AT1B 4C0DB 2K9GA 1K73C 4Z02A 4NL3A 3QIIA 2CS7A 1NM7A 1AWJA 3CCUT 2XI9A 2R5AA 4EMGA 2EFIA 3QKJA 2KSSA 2KNBB 4KRTA 1AWOA 1LCKA 2RO0A 3DLLA 2GQIA 2XDDA 4RTYA 2DD5A 2CP2A 4Z88A 1JXOA 3UT1A 1VQNQ 4DBRA 4HVVA 2OTLT 4M7DB 2DK3A 2QXFA 1N9RA 2JTFA 1VQ8Q 3PGGA 4FT2A 2VYTA 4M7AE 1AZGB 2CSIA 2NLUA 5HCKA 4C5IA 4EDUA 3J7AF 4IUUA 3OBWA 1VYVA 4KH0B 1QMCA 1UHFA 5KH6A 2KAFA 2VXFA 1AWXA 1FWZA 4KUDK 2OAWA 3PE0A 2QASA 2CP5A 3V7SA 2CYZB 3DB3A 3CCMQ 2KYBA 4FYXB 2JMAA 2AIRB 5GMKh 5A2QE 3CXCP 3SWNA 4C8QF 1IXDA 2QQBA 3HRSA 1IO6A 4X1VA 2X35A 4OGCA 1WHKA 1K4US 3IQLA 2ROLA 2EJGA 4F7UE 5HKCA 3OYMA 2E65A 3NMZC 2LC4A 3BDUA 4M4ZA 4PJOA 1KJWA 1RLPC 1Q81U 2K6DA 4Y92A 1YHQT 1SHFA 2X9HA 3LH0A 2JMCA 2E4HA 1N27A 3JAME 2V8KA 2Z0WA 2PNIA 4PFOA 2KRNA 3VV0A 4A54A 2FPFA 3S6WA 1WQWA 1M2VA 1EIFA 5HY6A 3JCMb 3HL8A 4PJNA 2H3EB 3L2VA 1ZQ1A 2C06A 2DIQA 3SD4A 2HL5C 2CZ6B 2CT3A 3H41A 3PTAA 1Y7XA 2MI6A 1KSWA 2AZVA 4M7AG 2L3QA 2CREA 1RAGB 3G4ST 1T3SA 1N6AA 3FDRA 4ESRA 4JS5A 4KGXB 4QVZA 5KYXA 2DXTA 4MZPA 5I2SA 5LJ3f 3RUXA 4NL2A 2L3SA 3GPLA 3OYIA 3OY9A 1WYXA 1KG1A 4BY6C 2XD0A 3ASKA 1YI2A 3ULRB 2QG9B 2FG0A 1QKXA 4XQ3A 3TQ7P 4D8DA 5D7UA 2FZKB 1WXTA 2RQUA 2CZ7B 2RHUA 2WACA 3SWNC 5CKBA 3TCJA 1YITT 4F7UG 1VQ6Q 3GLXA 2CP6A 4ATOA 1BU1A 3VU3C 2HKQB 3HRTA 1WHJA 5CAIA 4J5YA 1HK9A 2EGEA 3EG3A 4LDVA 3CCSA 2DIGA 4HVUA 3M55A 2KY9A 4N0AA 3TSZA 1I8FA 3UPUA 1NBEB 2ZPGB 2A0FB 2DTOA 1G3TA 2V8JA 2RQTA 1VQLQ 1QVPA 4OMPA 5CK9A 4M78A 1G3WA 1R0CB 1OPKA 2VVKA 3AHUA 2E70A 2EQKA 2RJEA 2OAUA 4GLKA 3CC4A 3H0FA 3CCJQ 2LNVA 1SF9A 1D1CA 2KVQG 4WCIA 2CP7A 2DYBA 1GFCA 1ZA2B 1MUZA 1UHCA 1YNZA 1P92A 3PIPA 3CCLT 1N5ZA 4KGZB 2K3XA 1OOTA 3OW2A 4A4KA 1NZ9A 1M5Q1 2RHZA 2XHCA 2P4TA 1E6GA 3OYHA 5EG2A 1QCOA 4M7AC 2MWPA 4IKFA 3HPWA 3CC7T 4B6MA 2YUPA 1Q7YC 4PJOB 3MEWA 2DA9A 1HSQA 1YI2Q 4FCYA 1WXUA 3MHXA 3OS1A 1BIAA 2YSQA 4HCZA 4HVWA 4KT0E 4JRPA 2MMPA 1E6HA 3HKSA 4HT8A 3Q1JA 2YUOA 3M0SA 3OSVA 2P84A 5GAN6 3M4YA 3G6EQ 3CD6A 5KYWA 5GAOm 2A36A 1ZLMA 2A7YA 2ZPHB 3OSSC 9ATCB 4M77B 2IIMA 2DL5A 2Y4YA 2QAZA 5A0GA 1SKUB 3V8JA 4RCCA 1RAAB 1R8OB 2HDAA 2LCSA 4N0AC 3M0QA 4BB7A 3VYGA 3JCMg 1VQPA 2QQRA 1VQNT 2DMOA 4JJDA 3TVTA 3F70A 5KYXB 1VQ8T 3G71Q 3UF4A 5GAOn 1YJWA 5L23A 1D3BA 2E3HA 3QYHB 1KHCA 1YWPA 2LP5A 2DBMA 2K4YA 4RG8A 1NJIR 3X28B 1UGQB 2RI2A 4EMHA 1K0SA 1W70A 2ZPEB 1BCMA 5I2MA 3RKYA 1OQKA 3GIBA 1GRIA 3CCVQ 3S3MA 2HAXA 1IB8A 4J83A 1OZ3A 3NHNA 4V2SA 1ABQA 1BYMA 1VA7A 1M90C 3VS5A 4DEXA 2CUBA 2VWFA 3QBYA 4XTUA 4AFSC 3LWHA 2EQUA 4LDXA 1MMAA 1MMNA 4F14A 5LJ3j 1MNDA 3VYHB 5IXBA 1Q82U 2L0AA 2NWMA 1LJOA 2AT1B 4KH1B 4HCKA 1LNXA 2KT8A 4E47A 4A4EA 2K2MA 2ESWA 1PD0A 4M78B 2DETA 2GFAA 2A08A 1YJ9Q 1VQ5A 1ZUKA 3QYGB 2DNUA 2DL7A 5LJ5f 3CMEA 1TS9A 2DZCA 1KC8U 4J9DA 2DXBA 3JCMh 2KMTA 1IGUA 1RL2A 2GCXA 2DL8A 3EHQA 3FB9A 2QTVA 3QWYA 4CRIA 4O5VA 5I21A 4F04B 1G5VA 3JCMV 3M9QA 4JZ4A 2LCCA 3OS5A 1X01A 2RI5A 1R0BG 2DLPA 4GBQA 4WF2A 2EPDA 3RR6A 2EBPA 1Q86C 1GCQC 3I55Q 2LZ6B 3FEOA 2YWWA 4Q5WA 5GAOl 4QKUA 2YRDA 2K79A 3QSUA 2J6FA 2YHTA 5FWCA 5IH2A 4ELYC 2ZZDA 3NTHA 2I2LA 1PCXA 3MEVA 2MWOA 3U23A 2BE9B 3JCMJ 3MEUA 3QDRB 4HCBA 5KYWB 1RUWA 4C0ZA 1U8RA 5FU6C 3MEAA 2E12A 2FZGB 2LJ1A 1YCYA 4C92A 3G4SQ 4C8QD 1VQ6T 2FRWA 1CKBA 2M51A 3QJYA 5L8RE 2VKNA 1VQOQ 1RACB 3QWXX 2G6FX 2RQRA 2CZ0B 1TSFA 3NGPA 5LJ3e 4M75A 1Y57A 2K57A 2PZ1A 5D6WA 4Z89A 4N4HA 1D3BB 3EGUA 2ABLA 4XTWA 3RKXA 2YXYA 4FIBA 2QQSA 2CUDA 2OTJQ 2E5KA 2DE0X 2O2OA 1M1KC 1BK2A 5LJ3d 3X25B 4F17A 2RHIA 4A4HA 1SEMA 1KC8C 3CQTA 4C8QE 2XDBA 2RHXA 1QCNA 2RB6A 3L2RA 4YTLA 1WIEA 2ATCB 2FPEA 3RNJA 4K11A 3FRNA 3QZ9B 1K0XA 5LJ3g 2C0IA 2QGFB 2KBTA 3CCEA 4L59A 1JQQA 3PIOA 4M7DF 3CMAA 2KGTA 1YI2T 3EGXA 3VS0A 1I81A 3CC2A 3HHTB 4XU3A 2DYIA 2FL7A 3LYIA 4DA4A 1Z9QA 2F5KA 1K8AR 4PJOD 2ROTA 2FRYA 3G6ET 2ZGWA 4KUIA 3VJPA 1NYFA 3FLGA 4EPCA 3A8OB 1H3ZA 1UJ0A 5IN1A 2IPOB 1SRMA 3EHRA 1H8KA 3JRZA 1ZBXA 2GFUA 1EZZB 3NTKA 1D09B 3I56Q 2QQ9A 1O75A 3QG1A 3SHWA 4UC4A 3G71T 4OMQA 4M77D 2KEAA 4DQ2A 5J39A 1QVGA 1GBRA 1RAEB 2ECZA 3MPUB 4AT1B 4J7FA 8AT1B 4EIKA 2JTEA 3MJXA 1KQSA 1VQMQ 3CBMA 4C8QG 5IHIA 5LJ5j 1SPKA 2RH2A 4RUGA 3OQ5A 5FLXE 1VQ7Q 3UATA 3CPFA 5GMKi 3OYKA 2K7AA 2L3RA 1I4K1 3CCVT 4BDYA 5LJ3h 6AT1B 3NTIA 2HBWA 1JRIA 2MOXA 4C92B 2EYQA 3BW1A 1M8VA 1VYTA 3R6OA 2D8JA 2WSEE 2RNAA 3L42A 3LGLA 2HQXA 1KD1R 3H0IA 4IIOA 3CCEQ 5FWBA 2LQKA 4M75B 2A28A 4M77E 4OMFB 2X4WA 4J9GA 5IAYA 2YRVA 4HCCA 2EVRA 2DL4A 5GAMh 3CMAQ 2RI3A 3X26B 1G3YA 2VXEA 2V1QA 3X20B 2XKOC 2ENMA 1Y96B 1ZSGA 1SSFA 5I11A 2FHDA 4J9FA 1K9MR 3M58A 4DBFA 4B9WA 1YJ9T 2QGGA 2X4YA 4JLGA 4EMKC 4ORZA 3CD6T 2K3YA 2KROA 3OYEA 4NS5A 1FYNA 4RTWA 1WDXA 3GF5A 2BZXA 1M9SA 4J7IA 1Z9ZA 4VUBA 3HRUA 1B3QA 4ZNXA 2EGAA 2D0NA 3CPWA 2LQWA 1QVFA 3M57A 1YJWT 1UJYA 1D0ZA 2HCKA 2LX9A 3I55T 1ZSZC 2J7IA 4X9CA 3EGXB 3OYNA 2KRSA 3P8HA 1YIJA 3GNGA 1IZ6A 4E7IA 2IG0A 4IURA 5LJ5e 3G7ZA 1QLYA 2QQAA 1B07A 2RJCA 3RERA 1JJ2A 1D1BA 4C0GA 3PNWC 4Z8AA 4JUVA 2V26A 4C8QC 2AHJB 3HTRA 5CKHA 4MZTA 1M1GA 1TH7A 5C6SA 2EKHA 4KULA 4P5NA 1VOMA 1Y07A
chains in the Genus database with same CATH topology
1TS9A 2KI7A 1V76A 2ZAEA 1OQKA 1PC0A 1TSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TS9 A;  2KI7 A;  1V76 A;  2ZAE A;  1OQK A;  1PC0 A;  1TSF A; 
#chains in the Genus database with same CATH topology
 1C0M A;  4C5E A;  5LJ5 d;  1NJI U;  4QQD A;  4M7A A;  1VQO T;  2NUT A;  2W10 A;  4DBH A;  2BE7 D;  4FW2 A;  1QKW A;  1PKT A;  1RLQ C;  4X34 A;  4ZGJ B;  2FB7 A;  3H0H A;  2PTK A;  5CCA A;  1U1T A;  1YP5 A;  1YWO A;  4L5G A;  1WHH A;  4PJO F;  3DB4 A;  3VS4 A;  5LJ5 g;  3RMS A;  3SFM A;  2OTJ T;  1HYO A;  5GMK m;  4OVA A;  1EX4 A;  2K5L A;  1WXB A;  2B86 A;  4Y28 E;  1OZ2 A;  5KCO A;  1BI2 A;  3TEE A;  5LL6 S;  1WHM A;  2J6O A;  1AEY A;  1VQ9 A;  2EW3 A;  1Y71 A;  3RMQ A;  3C12 A;  1QP2 A;  2F69 A;  1TUD A;  1ZBJ A;  2KT1 A;  1GFD A;  2JM8 A;  2E6Z A;  1K9A A;  3CCR A;  4F7U A;  3VRY A;  2KR3 A;  1XOV A;  4M77 F;  3D7S B;  1JO8 A;  1IRE B;  3EH1 A;  4FSX A;  2X51 A;  4PNO A;  1BI0 A;  2BZ8 A;  4LDW A;  1Q81 C;  4FYW B;  4BY6 B;  2YLB A;  3MKD A;  2HSP A;  2FYK A;  2DEQ A;  4ZTJ A;  1ARK A;  2KRM A;  1WHL A;  3ZL7 C;  1WPY A;  4PL6 A;  5CR2 A;  1X6G A;  3SWN B;  2YRC A;  2COZ A;  1RAD B;  2F5T X;  4FYV B;  3EG0 A;  3UA6 A;  5ECA A;  1U5S A;  3CCU A;  2DL3 A;  4GY5 A;  2E64 A;  3VS6 A;  1M2O A;  2RD1 A;  5GJV B;  1RI9 A;  2MK5 A;  4J9I A;  3OYJ A;  2D9T A;  4ZGE B;  3ER0 A;  3TU4 K;  5D6X A;  3DLM A;  3P8B B;  5C0M A;  2C0O A;  5LJ5 h;  2ED0 A;  1NJI C;  3VUZ A;  2HBP A;  1ZX6 A;  3FC3 A;  1I1J A;  1PHT A;  3I56 T;  4LN2 A;  2DVE A;  5FU7 C;  3E9F A;  4OMO A;  1M2V B;  2GGR A;  1VQM T;  3QHS A;  2XIC A;  4E7Z A;  1VQ9 Q;  1VQ7 T;  2R5M A;  4M78 F;  2P0K A;  3QUI A;  5CKD A;  3CCS Q;  1V76 A;  4LUD A;  2DD4 A;  2DXC A;  4XTZ A;  2CH4 W;  3OYY A;  1I0C A;  5DM7 R;  3A8H B;  2DX1 A;  1NG2 A;  2LQN A;  1BI3 A;  4JPB W;  4KGV B;  3V7C A;  5GMK l;  3EG2 A;  4RG2 A;  4M7A B;  3VS1 A;  3OW2 P;  2LTO A;  2NUT B;  1GCQ A;  2KXC A;  3CCE T;  2BZY A;  3L2Q A;  1PC0 A;  3QDF A;  1TOV A;  5GAN j;  4DBQ A;  3OYG A;  4J6W A;  3CMA T;  4C92 D;  1MGQ A;  3M59 A;  4IUQ A;  2LT4 A;  2AKK A;  1M1F A;  4M7D D;  5CQX A;  1TTH B;  3CC4 Q;  2P4R A;  2M16 A;  2FZC B;  2EWN A;  3M56 A;  4PLI A;  1G83 A;  3VKI A;  1YHQ A;  2DBK A;  4M75 D;  3CCQ A;  1X6O A;  3MP6 A;  5EC7 A;  2EYZ A;  2EYY A;  4ZTF A;  2ZPB B;  4OB0 B;  1Q7Y R;  1VQ4 A;  1WI7 A;  2RQW A;  1W1F A;  1X2K A;  1ABO A;  3EH2 A;  3REB B;  5DLO A;  1UE9 A;  1W2B S;  4D6W A;  4F7U B;  2VGN A;  2XMF A;  2E3I A;  3MET A;  1M27 C;  2QA4 A;  1K8A U;  2EJ9 A;  2VC8 A;  4C92 E;  3GNF B;  2X4X A;  3JSC A;  3JB9 F;  1UEB A;  4FW1 A;  2O9S A;  4M7D E;  2CKK A;  3RKW A;  2PVD B;  2K5I A;  8ATC B;  1NYG A;  3KUF A;  3WVE B;  1SSH A;  3KFV A;  2XU8 A;  1VQK A;  3CD6 Q;  3RES A;  4CI0 C;  2RJF A;  2XID A;  2ZAE A;  1HXD A;  3A8L B;  3N5B B;  2AK5 A;  3L2W A;  3C95 A;  1VQP Q;  1J3T A;  1MMG A;  1K76 A;  4JDS A;  3SDZ A;  1XQH A;  1U06 A;  2RJD A;  4IUT A;  4PFP A;  2MF2 A;  1YJW Q;  3DKM A;  1YIT A;  2VB6 A;  2DZ9 A;  1QVG S;  1S72 A;  3OYD A;  4QT7 A;  3S3O A;  3NPF A;  5GAN e;  4PJM A;  4IIM A;  2VUB A;  1YJN A;  2MAM A;  1V29 B;  5GMK j;  1JBM A;  5CIU A;  2JN0 A;  4ANJ A;  1M90 R;  1ZUY A;  1X69 A;  2O88 A;  2CP0 A;  2YUN A;  2K5F A;  1IRX A;  3CCQ Q;  1KD1 U;  2M0O A;  1TWB A;  2FVU A;  4BI8 B;  3HSB A;  2BIV A;  1W6X A;  1VQ4 Q;  5AYF A;  5GAN d;  2EKO A;  4J6X A;  2VV5 A;  3H6Z A;  5IXF A;  3JB9 I;  2FO0 A;  2DF6 A;  3ZFJ A;  3EFS A;  1MNE A;  2QEX A;  2J06 A;  2JXB A;  4CC4 B;  2DIL A;  2RHY A;  1K9M U;  4M7D G;  2QDY B;  2QA4 Q;  4HKE A;  2LVM A;  4MDX A;  3UDC A;  1CSK A;  1KQ1 A;  3OA6 A;  2HSE B;  4A4F A;  2JS2 A;  2PUO B;  1VUB A;  1Q82 C;  2HQH A;  2O4X A;  2IVW A;  2YUQ A;  3VUB A;  2E6N A;  1K8A C;  4J8O A;  1X2Q A;  4O6J A;  1VQ5 Q;  1SRL A;  2JNG A;  4Y91 A;  4FU6 A;  2DXU A;  3CC7 A;  1VQK Q;  2DTI A;  3CME Q;  4LE9 A;  4FSS A;  2EGC A;  3HFN A;  3I5S A;  3KBG A;  2D0Q B;  3OMG A;  2RPN A;  3L2U A;  4XTV A;  2GNC A;  4E7H A;  3E1S A;  3MP8 A;  1Q86 R;  5FU6 B;  2KDS A;  2V1R A;  1PRL C;  1NEB A;  2EYX A;  4J9C A;  3V7R A;  1N8R R;  2ZCF B;  3ZEH A;  2PQW A;  1QVF S;  1IHW A;  1TG0 A;  2A37 A;  4RCB A;  1S72 Q;  4C92 F;  1FXX A;  3THK A;  5GAN 3;  1UUE A;  1VQN A;  4FM4 B;  1UTI A;  2E5Q A;  2QI2 A;  5GMK e;  1JJ2 S;  5IHN A;  4M75 F;  4AFQ C;  2DRK A;  4BE0 A;  2EQI A;  3PMT A;  2K3B A;  1OEB A;  3M5A A;  4C0D C;  5CVI A;  2NUP A;  4OML A;  5M9O A;  2JJ9 A;  1B34 A;  2J6K A;  4EMK A;  5KE3 A;  4JJN K;  2DEU A;  1KD1 C;  2EQM A;  1VQ9 T;  3OS2 A;  4J9H A;  2GTJ A;  2AZS A;  2KE9 A;  2DRM A;  4FL6 A;  4LNP A;  1C1A A;  4BE1 A;  2Y90 A;  3CCS T;  2PVO B;  2DJQ A;  4ZN3 A;  1GL5 A;  2O31 A;  1ZA1 B;  3URG A;  1PM3 A;  4AG1 C;  2YT6 A;  4TVR A;  3AT1 B;  3CCM A;  2M02 A;  2H3J A;  3I5R A;  1AVZ C;  4AMC A;  4MMK A;  1OUL A;  4QVC A;  1M1K R;  4M7D C;  1ZUU A;  3FIF A;  1VYU A;  4AFZ C;  3CBO A;  1ZSZ A;  1SHG A;  1W2B P;  2G3R A;  2R58 A;  4XU2 A;  1S1N A;  1GCP A;  1AWW A;  2HL3 A;  4PJO E;  2EJF A;  3WVD B;  5GAN 2;  1T0H A;  1UDL A;  2DPP B;  3LW5 E;  3LGF A;  3CC4 T;  4HT9 A;  3M4G A;  1PWT A;  4BAC A;  2X3W D;  4LD6 A;  2D1X A;  2YLC A;  4C8Q A;  2COY A;  2A3L A;  2GF7 A;  1H3H A;  3CXC A;  1YBY A;  4PJL A;  2BUD A;  2NUZ A;  2QYZ A;  4MML A;  1WJR A;  2E41 A;  5KYU A;  4JS4 A;  3RBB B;  3LX7 A;  1WJS A;  4JLI A;  2RA2 A;  1MV0 B;  2OX7 A;  4AFU C;  4C0F A;  2RF0 A;  5J3B A;  1OV3 A;  2JT4 A;  2WSC E;  1R77 A;  4PFZ A;  2D8H A;  1WFW A;  1M30 A;  1M3C A;  2VAS A;  3OB9 A;  4PKC C;  1OYX A;  2HKN A;  2CH4 A;  2O4X B;  4OB3 B;  3CC2 Q;  4C5H A;  4OB2 B;  4R55 A;  5HK0 A;  1LVK A;  1WQ7 A;  1UGV A;  2FEI A;  2JUF A;  1QVG P;  2CDT A;  1E7O A;  3QZ5 B;  3E19 A;  3OW2 S;  3H9N A;  1KQS P;  3X24 B;  1X27 A;  5GAN 4;  2KYM A;  2HNI A;  2QTX A;  2KXD A;  2L2P A;  4M78 D;  4RTX A;  3EAE A;  3NFC A;  3RIR A;  2E10 A;  4E7J A;  1NLO C;  1VQP T;  1K73 R;  1YFN A;  2LDM A;  2XG8 D;  1AHJ B;  4RTU A;  2L8D A;  1MV3 A;  2JVV A;  5GAO r;  1VQ6 A;  3PVL A;  3REA B;  4PJO G;  4II1 A;  2P0Q A;  5GAN f;  1EFN A;  3M0T A;  2M0Y A;  3VRZ A;  4HXJ A;  4WTO B;  1NPP A;  2JOY A;  5CQY A;  4C5G A;  3LH5 A;  2NUP B;  3A8G B;  1B34 B;  3LLR A;  3PMI A;  1QW1 A;  4EMK B;  3CCQ T;  1V1C A;  2M9U A;  4M78 E;  1VQL A;  2CGH A;  2WSF E;  2YDL A;  1VQ4 T;  4M77 G;  4PK4 A;  3TRE A;  2NYS A;  2DM1 A;  3M0U A;  2M1H A;  1NE8 A;  1OPL A;  1RAF B;  4J9B A;  4BDZ A;  2DER A;  2J05 A;  3CCJ A;  2BTT A;  4RKU E;  4M77 A;  4JRI A;  2DFU A;  2CZ1 B;  2QA4 T;  5GJW B;  1UEC A;  2LQ8 A;  4OB1 B;  4LDY A;  2JM9 A;  1ZSZ B;  1T0J A;  3CPW P;  1OU8 A;  2H8H A;  1Q7Y U;  1BBZ A;  2KQW A;  3JB9 D;  5A0L A;  1QVF P;  1VQ5 T;  3UA7 A;  2PU9 B;  4DOV A;  2LCL A;  1VQK T;  3CME T;  4XTY A;  3J80 E;  1IGQ A;  4CC7 A;  3EGD A;  4C8Q B;  3FJ5 A;  1KHI A;  1UG1 A;  1VIF A;  2P0P A;  4LD9 K;  4LDU A;  1M3B A;  1NLP C;  1JJ2 P;  2L89 A;  5KYU B;  3E9G A;  4E6R A;  2Y4X A;  5FRO A;  5GAM f;  3OMC A;  1AOJ A;  1U1S A;  3G6E A;  1KIK A;  2XK0 A;  1FMW A;  1S72 T;  1I5O B;  2OI3 A;  2EQJ A;  1GXI E;  4E7L A;  5GAO q;  5IT9 E;  4RMO A;  1YIJ Q;  4IUV A;  3PVQ A;  1YJN T;  3E2U A;  5CKF A;  3OYC A;  3S3N A;  1K1Z A;  4M7A F;  4JZ3 A;  4LXC A;  4PJO C;  3SEM A;  4M78 G;  1MMD A;  4OMN A;  3QO3 A;  5I22 A;  1B7T A;  3TSW A;  2HEQ A;  3G71 A;  1FMK A;  4MZM A;  3RDV A;  3VS3 A;  3HP9 A;  1OX9 A;  3I9Q A;  3A8M B;  4QQ6 A;  2SRC A;  4OF1 A;  2QK0 A;  2SEM A;  5GAN 5;  3H8Z A;  2L3P A;  2O9V A;  4A63 B;  3G1J A;  1KFZ A;  2F2W A;  4PJJ A;  4A53 A;  3EFO A;  4OGE A;  1A0N B;  1Y0M A;  4M77 C;  2QEX T;  2DVJ A;  3CCV A;  1M90 U;  1D0Y A;  5HK3 A;  4RTT A;  4X9D A;  1GBQ A;  3OYA A;  1NPR A;  1I07 A;  1XTD A;  2PVG B;  3M0R A;  2OTL A;  1UB4 A;  2W0Z A;  1N9S A;  3C4S A;  3KXT A;  4F7U F;  3MCA B;  4OP0 A;  3JCM e;  1H92 A;  4QW2 A;  3O8V A;  1D0X A;  4ME7 A;  1XJW B;  1G2B A;  1Q95 G;  2LRQ A;  3EG9 A;  1TU0 B;  2E1H A;  1BB9 A;  1UGR B;  1DJ7 B;  1M3A A;  2GQV A;  4JJB A;  3JCM c;  3JB9 H;  2D6F A;  1PD1 A;  4FYY B;  2EYW A;  3CBP A;  1M4Z A;  5IHK A;  3LWI A;  3JCM d;  3PFS A;  1YJ9 A;  2AKL A;  3CCR Q;  1G3S A;  3GOX A;  2X3X D;  1HJD A;  1Q81 R;  1D1A A;  4AG2 C;  4RTV A;  3OYL A;  3JB9 G;  2JW4 A;  1BIB A;  2JZ2 A;  1KK7 A;  4CC3 A;  2ZPI B;  1AZE A;  2RN8 A;  4R0K A;  4HA8 A;  1TUG B;  2MCN A;  1Q86 U;  5KCH A;  3SB2 A;  1BKB A;  4JRQ A;  3CC2 T;  3C0C A;  2QDL A;  2KI7 A;  5FU7 B;  2I0N A;  1WNL A;  1WZO A;  2DKG A;  2RM4 A;  2MIO A;  4R56 A;  1N8R U;  1X6B A;  4E7S A;  3I55 A;  4PLL A;  3BE3 A;  3JCM X;  5GAN 8;  4M78 C;  3EGD B;  1BCO A;  2B8A A;  3CCU Q;  1LPL A;  1LOJ A;  3M54 A;  2JTM A;  5FW9 A;  2HQE A;  1RAH B;  4D8K A;  1MHN A;  2C0T A;  4J6Y A;  3CCM T;  1VIE A;  5DLQ E;  3V8L A;  2LMJ A;  2OTL Q;  5GAN 7;  1WGS A;  2EIF A;  5FRM A;  4L6V 5;  1FMV A;  2GBQ A;  3MP1 A;  3G4S A;  3L2Z A;  3JCM P;  1QQJ A;  3FJP A;  3OBY A;  3QPH A;  3EG1 A;  4JRK A;  3A98 A;  1G8X A;  1KQ2 A;  4N4G A;  2L5Q A;  1VQO A;  2F2X A;  4M75 E;  3O5Z A;  2KK4 A;  1OX8 A;  4QVD A;  4F16 A;  2HD0 A;  5KYY A;  3JV3 A;  3BY7 A;  3QJ6 A;  4XK8 E;  1M1K U;  4KBM B;  2DTH A;  2PUK B;  1JU5 C;  1QCF A;  2RK2 A;  2OTJ A;  1IHV A;  3EFO B;  3L1A A;  4BI3 A;  3JCM Q;  5GAM j;  2HMA A;  1QWE A;  1RAB B;  1WX6 A;  2O01 E;  1OI1 A;  3I35 A;  3INZ A;  1QWF A;  1ZHI A;  4DOW A;  1JB0 E;  1YCS B;  3CEY A;  1KQS S;  4FT4 A;  1BI1 A;  2R57 A;  4A4G A;  2ZPF B;  1AT1 B;  1PG5 B;  3WXM B;  4IUP A;  2F1L A;  2LNH B;  1YHQ Q;  2RMO A;  2EAY A;  3EG9 B;  4BE2 A;  4JJC A;  3UWN A;  4BD3 A;  3M53 A;  3EFR A;  2GTO A;  3CXC S;  1N8R C;  4J9E A;  1M8M A;  3QXE B;  5CKE A;  3JB9 J;  3BDL A;  1WLP B;  2LJ3 A;  2LT1 A;  4C92 G;  5AT1 B;  4CC2 A;  1UFF A;  3VS7 A;  3GP8 A;  2VGM A;  1RAI B;  3CCL A;  2CP3 A;  3A1P A;  5GAO p;  3MO8 A;  1TUC A;  4QQG A;  1UGS B;  4M75 G;  1PSE A;  4B9X A;  5GAN g;  1F1B B;  2JS0 A;  3OYB A;  4M7D A;  2XDP A;  3ME9 A;  1OU9 A;  2MYS A;  1YIJ T;  1X43 A;  4XAX B;  5KYN A;  1H64 1;  4OMM A;  1WHG A;  5FRN A;  1I5L A;  1K73 U;  3I56 A;  4NOY A;  1SG5 A;  3A5Z B;  3GBQ A;  2CT4 A;  2DO3 A;  4ZGD B;  1Y96 A;  1VQL T;  2LJ0 A;  2F2V A;  5D6Y A;  4LUE A;  4XTX A;  3T9N A;  3OS0 A;  3BFM A;  1W4S A;  1VQM A;  1PNJ A;  2COW A;  3CPW S;  4E2F B;  3P8D A;  4BUG A;  2FPD A;  1NEG A;  3M0P A;  5GAM e;  1YIT Q;  1VQ7 A;  1C6V X;  4ZN1 A;  4N4I A;  2BKD N;  3CCJ T;  2V8I A;  3ZBD A;  1JEG A;  1UGP B;  1ACM B;  1PRM C;  1YJN Q;  1YN8 A;  1JXM A;  1O9S A;  2OJ2 A;  2HZY A;  5J26 A;  3JCM f;  1VQ8 A;  5GAM d;  2RK1 A;  1W2B A;  2K2V A;  3OYF A;  2CSQ A;  4MDW A;  3J81 E;  2DJZ A;  4XU1 A;  2DAQ A;  3C94 A;  5KYY B;  5A0D A;  5CO7 A;  1XNI A;  2LX7 A;  3VS2 A;  1PSF A;  1U3O A;  2MPX C;  3V8K A;  3R6N A;  4E7K A;  4GLM A;  5DY9 A;  5GAN h;  2QEX Q;  1Q82 R;  1QP3 A;  5GAM g;  3CCR T;  3CCL Q;  3PT9 A;  1TXQ A;  4RTZ A;  1T3L A;  3JCM W;  1WA7 A;  1HD3 A;  4C92 C;  4ELZ C;  1WJQ A;  1K9M C;  4DEY A;  4BI4 A;  2RQV A;  5KE2 A;  4XU0 A;  3CC7 Q;  1KC8 R;  2X4J A;  1X75 C;  2ED1 A;  3HFO A;  4M75 C;  1RI0 A;  1AD5 A;  4M7A D;  1CKA A;  1FX7 A;  1PKS A;  7AT1 B;  4C0D B;  2K9G A;  1K73 C;  4Z02 A;  4NL3 A;  3QII A;  2CS7 A;  1NM7 A;  1AWJ A;  3CCU T;  2XI9 A;  2R5A A;  4EMG A;  2EFI A;  3QKJ A;  2KSS A;  2KNB B;  4KRT A;  1AWO A;  1LCK A;  2RO0 A;  3DLL A;  2GQI A;  2XDD A;  4RTY A;  2DD5 A;  2CP2 A;  4Z88 A;  1JXO A;  3UT1 A;  1VQN Q;  4DBR A;  4HVV A;  2OTL T;  4M7D B;  2DK3 A;  2QXF A;  1N9R A;  2JTF A;  1VQ8 Q;  3PGG A;  4FT2 A;  2VYT A;  4M7A E;  1AZG B;  2CSI A;  2NLU A;  5HCK A;  4C5I A;  4EDU A;  3J7A F;  4IUU A;  3OBW A;  1VYV A;  4KH0 B;  1QMC A;  1UHF A;  5KH6 A;  2KAF A;  2VXF A;  1AWX A;  1FWZ A;  4KUD K;  2OAW A;  3PE0 A;  2QAS A;  2CP5 A;  3V7S A;  2CYZ B;  3DB3 A;  3CCM Q;  2KYB A;  4FYX B;  2JMA A;  2AIR B;  5GMK h;  5A2Q E;  3CXC P;  3SWN A;  4C8Q F;  1IXD A;  2QQB A;  3HRS A;  1IO6 A;  4X1V A;  2X35 A;  4OGC A;  1WHK A;  1K4U S;  3IQL A;  2ROL A;  2EJG A;  4F7U E;  5HKC A;  3OYM A;  2E65 A;  3NMZ C;  2LC4 A;  3BDU A;  4M4Z A;  4PJO A;  1KJW A;  1RLP C;  1Q81 U;  2K6D A;  4Y92 A;  1YHQ T;  1SHF A;  2X9H A;  3LH0 A;  2JMC A;  2E4H A;  1N27 A;  3JAM E;  2V8K A;  2Z0W A;  2PNI A;  4PFO A;  2KRN A;  3VV0 A;  4A54 A;  2FPF A;  3S6W A;  1WQW A;  1M2V A;  1EIF A;  5HY6 A;  3JCM b;  3HL8 A;  4PJN A;  2H3E B;  3L2V A;  1ZQ1 A;  2C06 A;  2DIQ A;  3SD4 A;  2HL5 C;  2CZ6 B;  2CT3 A;  3H41 A;  3PTA A;  1Y7X A;  2MI6 A;  1KSW A;  2AZV A;  4M7A G;  2L3Q A;  2CRE A;  1RAG B;  3G4S T;  1T3S A;  1N6A A;  3FDR A;  4ESR A;  4JS5 A;  4KGX B;  4QVZ A;  5KYX A;  2DXT A;  4MZP A;  5I2S A;  5LJ3 f;  3RUX A;  4NL2 A;  2L3S A;  3GPL A;  3OYI A;  3OY9 A;  1WYX A;  1KG1 A;  4BY6 C;  2XD0 A;  3ASK A;  1YI2 A;  3ULR B;  2QG9 B;  2FG0 A;  1QKX A;  4XQ3 A;  3TQ7 P;  4D8D A;  5D7U A;  2FZK B;  1WXT A;  2RQU A;  2CZ7 B;  2RHU A;  2WAC A;  3SWN C;  5CKB A;  3TCJ A;  1YIT T;  4F7U G;  1VQ6 Q;  3GLX A;  2CP6 A;  4ATO A;  1BU1 A;  3VU3 C;  2HKQ B;  3HRT A;  1WHJ A;  5CAI A;  4J5Y A;  1HK9 A;  2EGE A;  3EG3 A;  4LDV A;  3CCS A;  2DIG A;  4HVU A;  3M55 A;  2KY9 A;  4N0A A;  3TSZ A;  1I8F A;  3UPU A;  1NBE B;  2ZPG B;  2A0F B;  2DTO A;  1G3T A;  2V8J A;  2RQT A;  1VQL Q;  1QVP A;  4OMP A;  5CK9 A;  4M78 A;  1G3W A;  1R0C B;  1OPK A;  2VVK A;  3AHU A;  2E70 A;  2EQK A;  2RJE A;  2OAU A;  4GLK A;  3CC4 A;  3H0F A;  3CCJ Q;  2LNV A;  1SF9 A;  1D1C A;  2KVQ G;  4WCI A;  2CP7 A;  2DYB A;  1GFC A;  1ZA2 B;  1MUZ A;  1UHC A;  1YNZ A;  1P92 A;  3PIP A;  3CCL T;  1N5Z A;  4KGZ B;  2K3X A;  1OOT A;  3OW2 A;  4A4K A;  1NZ9 A;  1M5Q 1;  2RHZ A;  2XHC A;  2P4T A;  1E6G A;  3OYH A;  5EG2 A;  1QCO A;  4M7A C;  2MWP A;  4IKF A;  3HPW A;  3CC7 T;  4B6M A;  2YUP A;  1Q7Y C;  4PJO B;  3MEW A;  2DA9 A;  1HSQ A;  1YI2 Q;  4FCY A;  1WXU A;  3MHX A;  3OS1 A;  1BIA A;  2YSQ A;  4HCZ A;  4HVW A;  4KT0 E;  4JRP A;  2MMP A;  1E6H A;  3HKS A;  4HT8 A;  3Q1J A;  2YUO A;  3M0S A;  3OSV A;  2P84 A;  5GAN 6;  3M4Y A;  3G6E Q;  3CD6 A;  5KYW A;  5GAO m;  2A36 A;  1ZLM A;  2A7Y A;  2ZPH B;  3OSS C;  9ATC B;  4M77 B;  2IIM A;  2DL5 A;  2Y4Y A;  2QAZ A;  5A0G A;  1SKU B;  3V8J A;  4RCC A;  1RAA B;  1R8O B;  2HDA A;  2LCS A;  4N0A C;  3M0Q A;  4BB7 A;  3VYG A;  3JCM g;  1VQP A;  2QQR A;  1VQN T;  2DMO A;  4JJD A;  3TVT A;  3F70 A;  5KYX B;  1VQ8 T;  3G71 Q;  3UF4 A;  5GAO n;  1YJW A;  5L23 A;  1D3B A;  2E3H A;  3QYH B;  1KHC A;  1YWP A;  2LP5 A;  2DBM A;  2K4Y A;  4RG8 A;  1NJI R;  3X28 B;  1UGQ B;  2RI2 A;  4EMH A;  1K0S A;  1W70 A;  2ZPE B;  1BCM A;  5I2M A;  3RKY A;  1OQK A;  3GIB A;  1GRI A;  3CCV Q;  3S3M A;  2HAX A;  1IB8 A;  4J83 A;  1OZ3 A;  3NHN A;  4V2S A;  1ABQ A;  1BYM A;  1VA7 A;  1M90 C;  3VS5 A;  4DEX A;  2CUB A;  2VWF A;  3QBY A;  4XTU A;  4AFS C;  3LWH A;  2EQU A;  4LDX A;  1MMA A;  1MMN A;  4F14 A;  5LJ3 j;  1MND A;  3VYH B;  5IXB A;  1Q82 U;  2L0A A;  2NWM A;  1LJO A;  2AT1 B;  4KH1 B;  4HCK A;  1LNX A;  2KT8 A;  4E47 A;  4A4E A;  2K2M A;  2ESW A;  1PD0 A;  4M78 B;  2DET A;  2GFA A;  2A08 A;  1YJ9 Q;  1VQ5 A;  1ZUK A;  3QYG B;  2DNU A;  2DL7 A;  5LJ5 f;  3CME A;  1TS9 A;  2DZC A;  1KC8 U;  4J9D A;  2DXB A;  3JCM h;  2KMT A;  1IGU A;  1RL2 A;  2GCX A;  2DL8 A;  3EHQ A;  3FB9 A;  2QTV A;  3QWY A;  4CRI A;  4O5V A;  5I21 A;  4F04 B;  1G5V A;  3JCM V;  3M9Q A;  4JZ4 A;  2LCC A;  3OS5 A;  1X01 A;  2RI5 A;  1R0B G;  2DLP A;  4GBQ A;  4WF2 A;  2EPD A;  3RR6 A;  2EBP A;  1Q86 C;  1GCQ C;  3I55 Q;  2LZ6 B;  3FEO A;  2YWW A;  4Q5W A;  5GAO l;  4QKU A;  2YRD A;  2K79 A;  3QSU A;  2J6F A;  2YHT A;  5FWC A;  5IH2 A;  4ELY C;  2ZZD A;  3NTH A;  2I2L A;  1PCX A;  3MEV A;  2MWO A;  3U23 A;  2BE9 B;  3JCM J;  3MEU A;  3QDR B;  4HCB A;  5KYW B;  1RUW A;  4C0Z A;  1U8R A;  5FU6 C;  3MEA A;  2E12 A;  2FZG B;  2LJ1 A;  1YCY A;  4C92 A;  3G4S Q;  4C8Q D;  1VQ6 T;  2FRW A;  1CKB A;  2M51 A;  3QJY A;  5L8R E;  2VKN A;  1VQO Q;  1RAC B;  3QWX X;  2G6F X;  2RQR A;  2CZ0 B;  1TSF A;  3NGP A;  5LJ3 e;  4M75 A;  1Y57 A;  2K57 A;  2PZ1 A;  5D6W A;  4Z89 A;  4N4H A;  1D3B B;  3EGU A;  2ABL A;  4XTW A;  3RKX A;  2YXY A;  4FIB A;  2QQS A;  2CUD A;  2OTJ Q;  2E5K A;  2DE0 X;  2O2O A;  1M1K C;  1BK2 A;  5LJ3 d;  3X25 B;  4F17 A;  2RHI A;  4A4H A;  1SEM A;  1KC8 C;  3CQT A;  4C8Q E;  2XDB A;  2RHX A;  1QCN A;  2RB6 A;  3L2R A;  4YTL A;  1WIE A;  2ATC B;  2FPE A;  3RNJ A;  4K11 A;  3FRN A;  3QZ9 B;  1K0X A;  5LJ3 g;  2C0I A;  2QGF B;  2KBT A;  3CCE A;  4L59 A;  1JQQ A;  3PIO A;  4M7D F;  3CMA A;  2KGT A;  1YI2 T;  3EGX A;  3VS0 A;  1I81 A;  3CC2 A;  3HHT B;  4XU3 A;  2DYI A;  2FL7 A;  3LYI A;  4DA4 A;  1Z9Q A;  2F5K A;  1K8A R;  4PJO D;  2ROT A;  2FRY A;  3G6E T;  2ZGW A;  4KUI A;  3VJP A;  1NYF A;  3FLG A;  4EPC A;  3A8O B;  1H3Z A;  1UJ0 A;  5IN1 A;  2IPO B;  1SRM A;  3EHR A;  1H8K A;  3JRZ A;  1ZBX A;  2GFU A;  1EZZ B;  3NTK A;  1D09 B;  3I56 Q;  2QQ9 A;  1O75 A;  3QG1 A;  3SHW A;  4UC4 A;  3G71 T;  4OMQ A;  4M77 D;  2KEA A;  4DQ2 A;  5J39 A;  1QVG A;  1GBR A;  1RAE B;  2ECZ A;  3MPU B;  4AT1 B;  4J7F A;  8AT1 B;  4EIK A;  2JTE A;  3MJX A;  1KQS A;  1VQM Q;  3CBM A;  4C8Q G;  5IHI A;  5LJ5 j;  1SPK A;  2RH2 A;  4RUG A;  3OQ5 A;  5FLX E;  1VQ7 Q;  3UAT A;  3CPF A;  5GMK i;  3OYK A;  2K7A A;  2L3R A;  1I4K 1;  3CCV T;  4BDY A;  5LJ3 h;  6AT1 B;  3NTI A;  2HBW A;  1JRI A;  2MOX A;  4C92 B;  2EYQ A;  3BW1 A;  1M8V A;  1VYT A;  3R6O A;  2D8J A;  2WSE E;  2RNA A;  3L42 A;  3LGL A;  2HQX A;  1KD1 R;  3H0I A;  4IIO A;  3CCE Q;  5FWB A;  2LQK A;  4M75 B;  2A28 A;  4M77 E;  4OMF B;  2X4W A;  4J9G A;  5IAY A;  2YRV A;  4HCC A;  2EVR A;  2DL4 A;  5GAM h;  3CMA Q;  2RI3 A;  3X26 B;  1G3Y A;  2VXE A;  2V1Q A;  3X20 B;  2XKO C;  2ENM A;  1Y96 B;  1ZSG A;  1SSF A;  5I11 A;  2FHD A;  4J9F A;  1K9M R;  3M58 A;  4DBF A;  4B9W A;  1YJ9 T;  2QGG A;  2X4Y A;  4JLG A;  4EMK C;  4ORZ A;  3CD6 T;  2K3Y A;  2KRO A;  3OYE A;  4NS5 A;  1FYN A;  4RTW A;  1WDX A;  3GF5 A;  2BZX A;  1M9S A;  4J7I A;  1Z9Z A;  4VUB A;  3HRU A;  1B3Q A;  4ZNX A;  2EGA A;  2D0N A;  3CPW A;  2LQW A;  1QVF A;  3M57 A;  1YJW T;  1UJY A;  1D0Z A;  2HCK A;  2LX9 A;  3I55 T;  1ZSZ C;  2J7I A;  4X9C A;  3EGX B;  3OYN A;  2KRS A;  3P8H A;  1YIJ A;  3GNG A;  1IZ6 A;  4E7I A;  2IG0 A;  4IUR A;  5LJ5 e;  3G7Z A;  1QLY A;  2QQA A;  1B07 A;  2RJC A;  3RER A;  1JJ2 A;  1D1B A;  4C0G A;  3PNW C;  4Z8A A;  4JUV A;  2V26 A;  4C8Q C;  2AHJ B;  3HTR A;  5CKH A;  4MZT A;  1M1G A;  1TH7 A;  5C6S A;  2EKH A;  4KUL A;  4P5N A;  1VOM A;  1Y07 A; 
#chains in the Genus database with same CATH homology
 1TS9 A;  2KI7 A;  1V76 A;  2ZAE A;  1OQK A;  1PC0 A;  1TSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...