1V76A

Crystal structure of archaeal ribonuclease p protein ph1771p from pyrococcus horikoshii ot3
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
GRVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGDRIWKVPKDVSIFEFEADDGTKIKIPGERLVGRPEMRLKKRWKKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords RNase P protein Ph1771p
publication title Crystal structure of archaeal ribonuclease P protein Ph1771p from Pyrococcus horikoshii OT3: an archaeal homolog of eukaryotic ribonuclease P protein Rpp29
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 21
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature ec 3.1.26.5: Ribonuclease P.
pdb deposition date 2003-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01868 UPF0086 Domain of unknown function UPF0086
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.210 Mainly Beta Roll SH3 type barrels. Ribonuclease P/MRP, subunit p29 1v76A00
1TS9A 1V76A 2ZAEA 1PC0A 2KI7A 1OQKA 1TSFA
chains in the Genus database with same CATH superfamily
5LJ5e 2L2PA 1PM3A 1YBYA 1VQ7Q 2EQMA 2WSEE 4BDYA 2X3WD 2DD4A 2M02A 2CT4A 5CK9A 1YITT 1D0YA 3L2VA 4KULA 5GAOr 2DJQA 1N9RA 4HVWA 1PKTA 3P8DA 3CCJA 2QG9B 5A0GA 3RKXA 2VKNA 2DETA 1VQ9Q 2PTKA 3ER0A 1KQSA 3UATA 3QJ6A 1K9MU 3E9FA 1K0XA 2H3JA 3SWNB 1KC8C 1K76A 1YP5A 4DEYA 3FRNA 1BI1A 2NUPB 1AEYA 1VQOQ 4PL6A 1NE8A 4CRIA 3SFMA 4Y92A 4HKEA 2ED0A 1BIBA 1WA7A 4IUUA 3RUXA 4KBMB 3NPFA 1YCSB 4E7SA 1RUWA 3ME9A 2DFUA 1H92A 2XMFA 3MKDA 4OMPA 1ZLMA 1NJIU 2KXCA 4UC4A 4EIKA 2D0NA 2DRMA 3QXEB 3BE3A 2LDMA 3OYDA 1JQQA 4A63B 1VIEA 2LZ6B 1M90U 1QW1A 3G6EQ 1VQMQ 1WYXA 1WXTA 3EGDB 4JDSA 4EMKB 2ZZDA 2X51A 4ANJA 3AT1B 1Z9QA 1KG1A 4FT4A 4RUGA 1PRMC 2G6FX 3CPWP 5GANg 3CCVA 3M56A 2OTJA 3VRYA 1N9SA 4N0AA 3REAB 3CMEA 1D0XA 1JXOA 1SPKA 2M9UA 5GAN3 3DLLA 3CCEA 1M9SA 1FMVA 4RTUA 2V1QA 4X9CA 3X24B 3EG0A 2JTEA 4PJOE 1MMDA 2ECZA 2BKDN 3I35A 1K9AA 3JB9I 2JTFA 1KSWA 3I56T 4J9EA 1S72T 3JAME 4N4HA 1N8RR 2DE0X 3CC7A 5GAN2 4V2SA 1HD3A 2QEXA 1G3YA 5HCKA 2KXDA 1EZZB 1MNDA 3VUBA 3VS1A 1XJWB 2DVEA 5GJWB 2EGEA 4Z02A 3GPLA 4XTUA 5GANe 4NL2A 4JS4A 2DIQA 2QQSA 2DXBA 2VWFA 1X27A 4J9FA 2YT6A 4WTOB 1OX8A 2RJFA 2RM4A 2B8AA 3UPUA 1VQ8T 3FDRA 2DERA 2HKQB 4A4FA 2OTLT 4MDWA 3S6WA 4BACA 2HDAA 1VQKA 3IQLA 2EYWA 3REBB 4Q5WA 2R57A 3DB4A 4KGXB 1YFNA 4FYYB 2O31A 4WF2A 2K2VA 3KFVA 5LJ3h 2C0OA 5GAMf 2R5MA 3OW2S 3KBGA 2OAWA 1B34B 3UF4A 1ZA1B 2XHCA 2CZ6B 2DVJA 3X28B 4PJNA 4OB1B 5FROA 1A0NB 1UGRB 1BBZA 1VA7A 2ABLA 1ZSGA 2EIFA 2QASA 2K4YA 3PT9A 5KE2A 2MIOA 3HKSA 2A36A 3RR6A 5LJ3j 4C0GA 2JMCA 3HRSA 5IHKA 5DY9A 3CCQQ 3FLGA 4TVRA 3H6ZA 1K9MR 2EYZA 3DKMA 3TSZA 2MWOA 2RJEA 5IHIA 3HHTB 1YHQT 4C92E 1Y96A 1AZGB 1G83A 3VS5A 3C95A 3CC2Q 3NTKA 3M55A 3QDFA 1M1KU 2QQBA 2J6OA 2M0YA 2E64A 1ACMB 2O88A 4FSXA 2PUOB 5LJ5d 5KCOA 3OA6A 2LC4A 2K5FA 5CO7A 3QSUA 1QVPA 4F14A 1NEGA 2D9TA 2O9SA 1UGVA 1M1FA 2FEIA 4IURA 1M3BA 4C8QE 1YN8A 4JRKA 2W10A 4LUEA 1WQ7A 1VUBA 1KC8U 2K7AA 4PJOB 1YIJA 3J80E 3PMIA 3MEUA 2LRQA 4OMFB 3BY7A 1BK2A 1QP2A 1G3TA 2XI9A 2NUTB 4LE9A 4XTZA 3CMAQ 4M75E 3GLXA 2E41A 5GMKj 1N8RC 3HL8A 2E6NA 1NPRA 1OOTA 3MCAB 3CCLQ 3M54A 2EVRA 4FL6A 4C5HA 1VQPT 1X43A 1FWZA 2P84A 2QA4T 1KHIA 2O4XB 2GQIA 4ELZC 1HJDA 1K0SA 1TG0A 3G1JA 4FU6A 4LDWA 2D8JA 1M8MA 4B6MA 4JRQA 4PJOC 3FJPA 5GAN5 1NYFA 5HKCA 1G3SA 2LNHB 2DTHA 5KYUB 2RQTA 3TU4K 1RLPC 1W4SA 3FEOA 2SEMA 3TSWA 1PSEA 4JLIA 1YITA 1YI2T 3PIPA 4PJOD 1GCQA 2RMOA 2OTJT 1R77A 3LW5E 3H9NA 2DL3A 4RG8A 3HFNA 1VQ5T 3CMET 1AZEA 2KGTA 1AWOA 4ZN3A 3QIIA 1TUCA 4QT7A 2ZPHB 3RDVA 3JCMV 4E7IA 1B07A 1Q81U 4E7HA 2FPFA 1SG5A 4L59A 3CCET 2EKHA 3SEMA 1MNEA 1IREB 3X25B 1OZ2A 1U06A 2RHZA 1WXBA 1W70A 2QDYB 3EG2A 4OB3B 3WVEB 1VQ6Q 1M3AA 2Z0WA 4MZMA 2ENMA 4J5YA 4DA4A 3CCST 2K3BA 4IUPA 5CKDA 3L2WA 1IGQA 2YUNA 2JT4A 4J9CA 1PRLC 2C06A 1K9MC 3FB9A 3OYBA 1SKUB 2QEXT 3O8VA 1QLYA 2E5KA 4GBQA 3HRUA 2RF0A 2J6KA 3NFCA 1IRXA 4DBFA 3M0TA 1FX7A 2XDDA 1OI1A 1WNLA 3OYHA 2FG0A 4RCBA 2QYZA 4BI8B 2X3XD 4Y91A 4F16A 4OGEA 4Z88A 2JNGA 5C0MA 3PGGA 3I55T 1OPKA 3MJXA 4C8QB 3G71T 1YJWQ 2P0PA 4DOWA 2BE7D 2IPOB 3MP1A 1K8AU 1M1KR 3JB9J 4OP0A 3JCMf 5KH6A 1VQKT 2HZYA 5HK0A 4X1VA 3TEEA 2ATCB 1R8OB 1QP3A 1XTDA 1UDLA 4BI3A 4OVAA 1BI3A 2P0QA 5J39A 3EHQA 1W2BP 1K4US 2ZPIB 2L3SA 3PVQA 4MMKA 1WHGA 3HSBA 3I56A 2VYTA 1S72A 4R0KA 1M30A 1QCOA 5FW9A 2CUDA 4LXCA 2CUBA 4C92D 1VQLA 4PJJA 2WSCE 4C8QC 3S3NA 1TH7A 1G5VA 1UGPB 8AT1B 1X2QA 2FZGB 1MMAA 2CSIA 1BI0A 2Y90A 3QZ5B 3M57A 4X9DA 3JCMP 3RNJA 5GAMh 2VGNA 1AT1B 3GNFB 2CT3A 4MZPA 1RADB 3MHXA 4M75A 2GQVA 3OB9A 4E7JA 1VQ8A 3UWNA 1I07A 4KGZB 3MEWA 3CD6Q 4C8QD 3QZ9B 1TUGB 3CBPA 4ZGDB 1OYXA 1Z9ZA 1W2BA 2DIGA 4RG2A 2ZPGB 5GAOp 4PJOG 4BUGA 5GAMj 2X4JA 3L2UA 4HT9A 2EQUA 3TQ7P 5FU6B 1Y07A 3V7CA 4PJOF 3H0FA 1JEGA 4JZ4A 2I2LA 4XTWA 1UJ0A 5IH2A 3G6EA 3WVDB 1VQMA 3R6NA 4M75D 5CQYA 5CVIA 4F7UA 5LJ5g 1ZUKA 2LJ3A 3I9QA 2HD0A 2FHDA 2V8JA 1YIJT 5KYYA 1VIFA 3RKWA 5KYWA 1KHCA 4B9WA 1RAIB 6AT1B 2CKKA 1NM7A 4CC4B 4ELYC 1OU8A 3OYAA 3R6OA 4ESRA 3EH1A 1QVFA 1M2VB 4M7DA 1Q81R 3H8ZA 4BD3A 1NYGA 4NOYA 3VKIA 4HVUA 2RK1A 1AVZC 5FU6C 2COYA 5LJ3e 2YRCA 4JUVA 1KQSP 1VQ4Q 1O9SA 1OV3A 4ZGEB 1YJNT 2FVUA 2QGGA 3M58A 3OYIA 3JCMJ 3EGUA 2F69A 3VYHB 3TREA 2GFUA 1AWXA 2KROA 4JJBA 3KUFA 2K3YA 2GNCA 2K3XA 1WHKA 1LJOA 4E7LA 2RD1A 3OYYA 1I81A 2E5QA 2HBPA 1GFDA 4M7AA 3HTRA 3NTIA 2W0ZA 2XG8D 2J06A 1NEBA 1M1KC 4JRPA 3RKYA 2QTXA 3M0SA 1NLPC 2JS0A 2VC8A 1QQJA 1C1AA 4DBQA 4HT8A 3JCMc 2CREA 3HPWA 3OYMA 2JMAA 2RK2A 2LT1A 2Y4YA 3OYFA 1BKBA 2VGMA 1KQ1A 4J7FA 1K8AR 2OI3A 2PNIA 1S1NA 4AFQC 4VUBA 3G4ST 2AT1B 4J7IA 1Y71A 1IB8A 2COWA 1MGQA 1OX9A 2LCLA 1VQPA 5IAYA 2ED1A 2DD5A 5CQXA 1V76A 2QA4A 3SD4A 3U23A 3QG1A 3CCMT 1RACB 2LJ0A 2CS7A 2K9GA 1PHTA 2DM1A 3VJPA 3EGXA 1WX6A 2ESWA 5DM7R 1BU1A 2LQ8A 3HFOA 1UJYA 3RMQA 4M77A 4C8QG 2RHUA 2BZ8A 1D09B 1ABOA 2DEUA 1Q82U 3VU3C 4LUDA 4C8QF 4KH1B 1TS9A 1OEBA 5I2MA 5CR2A 2EW3A 1RL2A 3SWNC 1YI2A 2XICA 4C0DB 4LNPA 3OYLA 1CSKA 3VYGA 1OPLA 4JS5A 3OYEA 1VQ5A 1D0ZA 2MWPA 3CC2A 1TOVA 2GF7A 2YWWA 4QW2A 2NUPA 2CP3A 2L3QA 5GMKm 3M59A 4PFOA 3AHUA 4RTVA 2XU8A 3M0UA 2RN8A 4CC7A 4FCYA 1UHCA 1SHFA 3C94A 3C4SA 4D8KA 4ORZA 3CCUQ 1VQ7T 4EMKC 3CCSA 7AT1B 4IUVA 1YJ9Q 1Q81C 1YWPA 2AHJB 4FYVB 4RKUE 2K5LA 4HCCA 1YHQQ 1GL5A 1X69A 3JCMh 2HQEA 1OQKA 1BIAA 3ULRB 1VQLT 5IN1A 4C0FA 1QVGS 2JS2A 2RHXA 1NBEB 2E10A 3UA6A 1Y57A 2E4HA 1VQ9T 2RPNA 4JJCA 2JM8A 5I22A 1SRLA 1QWEA 4Z8AA 1WDXA 3CMAA 1WHJA 3CC4Q 3CCLA 2KQWA 2A0FB 4RTWA 4ZGJB 1QMCA 2LX7A 1U8RA 2KT1A 3I55A 2D6FA 3QWXX 3DLMA 1TTHB 2FRYA 3G71A 4PNOA 2GTOA 1Q95G 1VQOT 2ZPFB 3EAEA 4QQGA 2DLPA 1M1GA 3C12A 1PG5B 4XU3A 2XD0A 4XTYA 1ZUYA 1EX4A 2L0AA 3UDCA 3L42A 3J7AF 2DBMA 3L2RA 3CCJQ 1MMGA 1X2KA 2QXFA 4J9BA 3G6ET 4KT0E 2RQRA 1VQMT 4PJMA 4J8OA 2EYXA 1K8AC 1KK7A 1WFWA 4OMMA 1TU0B 1Y96B 3EFOA 2CP5A 2DXTA 3V8JA 2KYMA 3MO8A 2E65A 3GIBA 2LNVA 1WI7A 3MEAA 3NHNA 2HBWA 5GAN7 4F17A 1BI2A 5KYXB 2MYSA 1VYUA 1QWFA 5LJ3d 3D7SB 1ZX6A 3LH5A 3OBWA 3KXTA 3EFRA 4LD6A 2H3EB 3LWIA 2A28A 5FU7B 4KGVB 4DOVA 4XTVA 2DRKA 2YLBA 3URGA 1U1SA 2FZCB 2HL3A 4ZN1A 2CZ7B 3RESA 1Q7YC 5I11A 4A4EA 2C0TA 1IXDA 4D8DA 1B34A 3CCVQ 2P0KA 4OMOA 4AG1C 1PWTA 3E19A 2QAZA 3ZL7C 3VS3A 3CXCA 1XQHA 4MDXA 3I5RA 5LJ5j 2DF6A 2QGFB 3FJ5A 3MP8A 1JB0E 5GMKh 1JJ2A 1Q82R 3EHRA 4LDYA 3ZEHA 2KDSA 5GAMe 5GAOm 3DB3A 2IG0A 4M78A 2RB6A 3EG9A 1V1CA 2DJZA 4JJNK 2VV5A 2E12A 5FU7C 1BCMA 1E6GA 1YJWA 4JRIA 2H8HA 4OMNA 5EC7A 8ATCB 3CC7Q 4BE2A 1HXDA 3JRZA 4FW2A 1KQSS 4BY6B 3LGLA 3F70A 4IKFA 2J7IA 2KBTA 5A0DA 3OSVA 4DEXA 5GAN4 4OB0B 2PVDB 1YNZA 3A8LB 1GRIA 4PKCC 2RHYA 3M0RA 5C6SA 2F2XA 3E1SA 1YJNA 1B3QA 4BDZA 4KRTA 5GMKl 4N4IA 3M0QA 1T3SA 2L89A 2SRCA 3PIOA 2JUFA 2DL7A 1RABB 2NUZA 1J3TA 4O6JA 4A4KA 4C5GA 3OYGA 2CP0A 4F7UE 3CCQT 1XOVA 3QO3A 1JXMA 3GP8A 2QI2A 4BY6C 3VS7A 2YUOA 2XIDA 4ATOA 4XU2A 3OYCA 2DNUA 1R0CB 4M7DE 1ZSZA 3CC2T 1GCQC 2O4XA 4HCZA 3J81E 3G4SA 1QCNA 5A0LA 4CC3A 1K73R 3CCRQ 1GFCA 1PD0A 4EPCA 1CKBA 1T0HA 3QYGB 3E9GA 2BIVA 3M53A 2OX7A 2XK0A 4RTYA 4E7ZA 1IO6A 1D3BA 3CCMA 2RQVA 4NS5A 2DTIA 3PNWC 2HEQA 2PVGB 1UFFA 1W1FA 3MPUB 1ZUUA 2FZKB 5CKFA 3OS0A 4IUTA 2RNAA 4RCCA 2KE9A 5KYUA 2DKGA 3QUIA 4M7AE 3CPFA 4C92B 1EIFA 2RA2A 1HK9A 2LX9A 1KD1R 1E7OA 3CPWS 2KY9A 2JOYA 5GANj 1F1BB 2CH4A 2KEAA 1SF9A 1ZQ1A 1VQNQ 3CMAT 3BDUA 4RTZA 4FSSA 1UHFA 3TVTA 2EAYA 2V8IA 3P8BB 3CCLT 1Q86R 2KNBB 4ZTFA 3O5ZA 2JXBA 2KI7A 3CBOA 1ARKA 3LWHA 4KUDK 2EGAA 2CH4W 3JB9D 3GF5A 1UECA 1TXQA 1I1JA 2ZCFB 4GLKA 4L6V5 2CP7A 2QQRA 1Q82C 2O2OA 4JZ3A 1UTIA 4C92C 2YUQA 1IGUA 2EWNA 4LDXA 3L2ZA 3OQ5A 1VQ7A 1LOJA 3JCMg 4M75B 5L8RE 3THKA 1MHNA 2VXFA 3PVLA 2DILA 2KSSA 1ABQA 1X6OA 5EG2A 3OBYA 3QHSA 4M77E 1KIKA 3V8KA 2QTVA 3V7SA 4AFSC 1BYMA 1QCFA 4IIOA 2MAMA 1Q7YU 1VQ9A 4RMOA 5FRNA 5GAOl 5D6XA 2YLCA 1QVGA 3OW2P 2EJ9A 3S3MA 5D6YA 2KK4A 5CIUA 1RLQC 3PTAA 3RBBB 4F7UB 1H3ZA 2HQXA 1QVFP 2V26A 1VQOA 4XAXB 4M75C 5KCHA 2D1XA 1I4K1 5KYWB 1YITQ 3RIRA 5LJ3g 5I21A 2D8HA 3JCMe 3PFSA 2MMPA 4M7DB 2VXEA 1FYNA 5GAMd 2YRDA 4OGCA 4J6WA 1PC0A 2FL7A 1GXIE 5LJ5f 1RAFB 1XNIA 2XDBA 2CZ0B 1K73C 2DMOA 1WJQA 2DEQA 3OW2A 4Y28E 1YWOA 2RH2A 1MMNA 5D6WA 2XDPA 4II1A 5CKBA 2MK5A 3GBQA 5IXFA 2ZGWA 4FM4B 1YJWT 4J9IA 2DBKA 1O75A 1GBRA 5GAOq 4A54A 5FWBA 2DA9A 4M7AB 3EFSA 2EPDA 2M1HA 1HSQA 3EG1A 2DX1A 4M7DC 2YRVA 3QYHB 2LMJA 3M0PA 3M5AA 1KD1C 2LCSA 1UG1A 5KE3A 5GMKi 1CKAA 2FRWA 3V7RA 3VRZA 1LPLA 3LH0A 4Z89A 3RERA 1UEBA 2ZPBB 5FRMA 2DTOA 1WIEA 4HXJA 1Q86C 2KRSA 4PFPA 1LCKA 4M7DD 2F2VA 1ZHIA 2AKLA 2EGCA 4MZTA 3JB9G 4EMHA 1PD1A 4AFZC 4IIMA 3JB9F 3NMZC 1MUZA 4PJLA 1G8XA 3PMTA 3EG3A 3EGXB 3ZFJA 3OMCA 2K2MA 1UGQB 2A08A 1UB4A 3CD6T 3I56Q 1S72Q 1MV0B 3JCMb 2HSPA 2LJ1A 2YSQA 2HCKA 2JN0A 4M77B 3MP6A 4M7AD 1T0JA 2CP6A 2K79A 1WJSA 3M4YA 4C92G 1M3CA 4WCIA 1VQLQ 2E6ZA 3BFMA 2EJGA 1NLOC 4A53A 4C92F 1Y0MA 2VASA 2X4YA 2RJDA 3CQTA 2AIRB 2JZ2A 5GMKe 2PVOB 4P5NA 2FYKA 1ZBXA 3VV0A 1RI0A 4PK4A 2IIMA 4C0ZA 5IHNA 1X6GA 2DZ9A 1VQ8Q 1H3HA 1M27C 1AHJB 4OMLA 2ROLA 1U1TA 2FPDA 2OTLQ 2GTJA 5IT9E 5I2SA 1C0MA 1P92A 4LDUA 1Q7YR 4M78E 5GJVB 3CCQA 1D1BA 1UGSB 2E3IA 4M77C 2NYSA 1M8VA 3LX7A 5CAIA 2KVQG 3QJYA 5GANf 1KQ2A 1HYOA 2L5QA 3OMGA 2MF2A 4XK8E 2V1RA 3N5BB 5GAN8 1LNXA 4RTTA 2L3RA 4DBRA 3HRTA 2KMTA 4ZTJA 3SWNA 1VQ4T 3SDZA 2MPXC 5ECAA 4M75G 3L1AA 4N0AC 1RAHB 4M77D 3WXMB 3JCMQ 2WACA 3P8HA 4M75F 3OY9A 2DXUA 2ROTA 4HCBA 1LVKA 2B86A 3A8OB 3LYIA 3QWYA 2BZXA 4BE0A 5FWCA 3FC3A 5J3BA 2FB7A 4C0DC 1RI9A 3EGDA 4EMKA 2ZAEA 4JPBW 1RAEB 4CI0C 3HP9A 4LDVA 1QKXA 4F7UG 2DZCA 2X35A 2KR3A 2RQWA 1WJRA 2C0IA 2EQKA 2QK0A 2LCCA 4J83A 2LTOA 4F7UF 3EH2A 4XU0A 4EMGA 2JJ9A 2LQKA 3CPWA 2X4XA 4M7DG 4AT1B 3BDLA 2GFAA 1K1ZA 3OYKA 3EFOB 1PSFA 4M7DF 3JCMd 4BB7A 2KT8A 4E6RA 4FYXB 2PU9B 2K6DA 1K73U 1GCPA 1W2BS 2BUDA 4KUIA 1H641 1R0BG 2DAQA 3META 5HY6A 1X6BA 2EFIA 1NPPA 2OAUA 3I5SA 1V29B 2RO0A 5FLXE 2GGRA 2YXYA 3H0IA 2J05A 4M7AG 1BCOA 1E6HA 3JV3A 4XU1A 3CXCP 1SEMA 4AMCA 1VQPQ 2A3LA 4L5GA 2QQAA 4M7AF 1JBMA 2QA4Q 1KD1U 1IHWA 5GAMg 1C6VX 4FIBA 2NLUA 1M5Q1 3M4GA 1JJ2P 2X9HA 4EDUA 2YUPA 3TCJA 3ZBDA 2HQHA 4OF1A 1D1CA 1QVFS 1Q86U 3CCRA 3PE0A 1TWBA 4ME7A 5LJ5h 2HKNA 4FW1A 1VQ6A 3H41A 4M78B 3CCUT 2M0OA 4OB2B 1WXUA 3ASKA 3EG9B 1D1AA 1JO8A 1G3WA 3S3OA 2KRMA 3OS1A 1YJ9T 1YI2Q 3OYNA 1T3LA 1RAGB 3C0CA 4E2FB 5L23A 5CKHA 2OTJQ 3FIFA 1N6AA 1VQ5Q 3CMEQ 2QQ9A 3CEYA 4HVVA 2F2WA 2JTMA 2VUBA 4FT2A 1JU5C 4M77G 3CCEQ 2Y4XA 1VQNA 4X34A 2MOXA 3CC4T 1H8KA 1NJIR 4XQ3A 4BI4A 2XKOC 5KYXA 4M77F 4M4ZA 1BB9A 1NG2A 2RI3A 3VS6A 1WPYA 5J26A 2D0QB 2E3HA 4M78C 1M90R 1AD5A 3CCSQ 2O01E 2F5TX 4E7KA 2QEXQ 2EQJA 5GAOn 2AZVA 4N4GA 3CCJT 2CYZB 3QKJA 4JJDA 2MCNA 2DO3A 1OU9A 1X75C 4M78D 3QDRB 2DYIA 1N5ZA 2P4TA 2EYYA 4D6WA 2RHIA 1I0CA 1X01A 4IUQA 5HK3A 2PZ1A 1U5SA 1DJ7B 1ZSZB 2G3RA 2EYQA 3T9NA 1QKWA 3I55Q 1OULA 3GNGA 2LP5A 3OS5A 3G71Q 4PJOA 2KYBA 4QQDA 3G7ZA 4J9HA 5LL6S 2EKOA 4DBHA 1VQKQ 1FXXA 4C5IA 1OZ3A 1D3BB 2DK3A 1YCYA 2NUTA 2GCXA 2AZSA 2IVWA 3UT1A 3A8HB 4AFUC 4BE1A 1IHVA 3CD6A 3L2QA 2PUKB 2JW4A 2F1LA 1AOJA 1SSHA 2F5KA 1ZSZC 3CCVT 4OMQA 1I5LA 4PLIA 2JVVA 4DQ2A 4PFZA 2CZ1B 2MI6A 3MEVA 5GANh 4JLGA 1N27A 2A7YA 4MMLA 1IZ6A 2DPPB 4AG2C 1KJWA 1SSFA 3SB2A 2VVKA 2I0NA 3CBMA 2VB6A 3VS4A 1ZBJA 5DLQE 5AT1B 4J6YA 2EJFA 2RQUA 1WHHA 1SHGA 5GAN6 3CC7T 2OJ2A 3LLRA 4LN2A 1ZA2B 3VS0A 5GANd 1WZOA 1FMKA 1RAAB 2FPEA 1PNJA 2CP2A 3A8GB 2DL8A 2M51A 2L3PA 4HA8A 3A8MB 1VQ4A 2EBPA 2QDLA 1U3OA 1QVGP 1EFNA 4FYWB 1FMWA 3INZA 1M2OA 4O5VA 2M16A 4LD9K 5M9OA 3UA7A 1WHMA 1YIJQ 4R55A 2EQIA 2R58A 2WSFE 2ZPEB 1NJIC 2L8DA 1AWWA 2DL5A 2HAXA 2O9VA 1GBQA 2HNIA 5DLOA 4C92A 1PKSA 1M90C 2CDTA 4B9XA 1G2BA 2AK5A 2LVMA 2DL4A 2CSQA 2J6FA 1WHLA 2DXCA 2P4RA 4YTLA 3OYJA 5KYNA 1W6XA 4QVDA 2YHTA 4QKUA 2BE9B 3OS2A 3A5ZB 4M78G 1YJNQ 2RI5A 4A4HA 3BW1A 2KRNA 4J6XA 2CGHA 4C8QA 4M78F 1WQWA 1PCXA 3JCMX 1KC8R 2BZYA 3RMSA 4RTXA 3CCRT 3H0HA 4QQ6A 3V8LA 1KFZA 3A98A 1I8FA 4F04B 1VQ6T 2E1HA 2AKKA 1Y7XA 2NWMA 9ATCB 2K57A 2E70A 4PLLA 5KYYB 1UUEA 1AWJA 5CCAA 3E2UA 5LJ3f 4XTXA 4ZNXA 5A2QE 1VOMA 4A4GA 3NGPA 5IXBA 2YDLA 1I5OB 3CXCS 2OTLA 1UE9A 2RI2A 2LQWA 3QBYA 3G4SQ 1TUDA 4CC2A 1VQNT 4E47A 2K5IA 1JJ2S 3JB9H 2FO0A 3SHWA 1WGSA 2RJCA 3CCMQ 2KAFA 3M9QA 3VS2A 2PQWA 1WLPB 1JRIA 1N8RU 4C5EA 1MV3A 4KH0B 3JSCA 3QPHA 4GY5A 4QVZA 2HL5C 1VYTA 2JM9A 2LQNA 2GBQA 4R56A 5AYFA 1M4ZA 3X26B 5CKEA 3LGFA 3CCUA 2LT4A 2HMAA 4J9DA 1TSFA 1SRMA 2COZA 2V8KA 4J9GA 4QVCA 4NL3A 1YJ9A 1B7TA 3JCMW 2BTTA 4K11A 3Q1JA 3OSSC 1YHQA 1VYVA 3X20B 3NTHA 4HCKA 3VUZA 1NZ9A 2R5AA 2X4WA 4M7AC 2DYBA 3GOXA 3A1PA 4GLMA 5D7UA 3CC4A 1M2VA 2HSEB 2A37A
chains in the Genus database with same CATH topology
1TS9A 1V76A 2ZAEA 1PC0A 2KI7A 1OQKA 1TSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TS9 A;  1V76 A;  2ZAE A;  1PC0 A;  2KI7 A;  1OQK A;  1TSF A; 
#chains in the Genus database with same CATH topology
 5LJ5 e;  2L2P A;  1PM3 A;  1YBY A;  1VQ7 Q;  2EQM A;  2WSE E;  4BDY A;  2X3W D;  2DD4 A;  2M02 A;  2CT4 A;  5CK9 A;  1YIT T;  1D0Y A;  3L2V A;  4KUL A;  5GAO r;  2DJQ A;  1N9R A;  4HVW A;  1PKT A;  3P8D A;  3CCJ A;  2QG9 B;  5A0G A;  3RKX A;  2VKN A;  2DET A;  1VQ9 Q;  2PTK A;  3ER0 A;  1KQS A;  3UAT A;  3QJ6 A;  1K9M U;  3E9F A;  1K0X A;  2H3J A;  3SWN B;  1KC8 C;  1K76 A;  1YP5 A;  4DEY A;  3FRN A;  1BI1 A;  2NUP B;  1AEY A;  1VQO Q;  4PL6 A;  1NE8 A;  4CRI A;  3SFM A;  4Y92 A;  4HKE A;  2ED0 A;  1BIB A;  1WA7 A;  4IUU A;  3RUX A;  4KBM B;  3NPF A;  1YCS B;  4E7S A;  1RUW A;  3ME9 A;  2DFU A;  1H92 A;  2XMF A;  3MKD A;  4OMP A;  1ZLM A;  1NJI U;  2KXC A;  4UC4 A;  4EIK A;  2D0N A;  2DRM A;  3QXE B;  3BE3 A;  2LDM A;  3OYD A;  1JQQ A;  4A63 B;  1VIE A;  2LZ6 B;  1M90 U;  1QW1 A;  3G6E Q;  1VQM Q;  1WYX A;  1WXT A;  3EGD B;  4JDS A;  4EMK B;  2ZZD A;  2X51 A;  4ANJ A;  3AT1 B;  1Z9Q A;  1KG1 A;  4FT4 A;  4RUG A;  1PRM C;  2G6F X;  3CPW P;  5GAN g;  3CCV A;  3M56 A;  2OTJ A;  3VRY A;  1N9S A;  4N0A A;  3REA B;  3CME A;  1D0X A;  1JXO A;  1SPK A;  2M9U A;  5GAN 3;  3DLL A;  3CCE A;  1M9S A;  1FMV A;  4RTU A;  2V1Q A;  4X9C A;  3X24 B;  3EG0 A;  2JTE A;  4PJO E;  1MMD A;  2ECZ A;  2BKD N;  3I35 A;  1K9A A;  3JB9 I;  2JTF A;  1KSW A;  3I56 T;  4J9E A;  1S72 T;  3JAM E;  4N4H A;  1N8R R;  2DE0 X;  3CC7 A;  5GAN 2;  4V2S A;  1HD3 A;  2QEX A;  1G3Y A;  5HCK A;  2KXD A;  1EZZ B;  1MND A;  3VUB A;  3VS1 A;  1XJW B;  2DVE A;  5GJW B;  2EGE A;  4Z02 A;  3GPL A;  4XTU A;  5GAN e;  4NL2 A;  4JS4 A;  2DIQ A;  2QQS A;  2DXB A;  2VWF A;  1X27 A;  4J9F A;  2YT6 A;  4WTO B;  1OX8 A;  2RJF A;  2RM4 A;  2B8A A;  3UPU A;  1VQ8 T;  3FDR A;  2DER A;  2HKQ B;  4A4F A;  2OTL T;  4MDW A;  3S6W A;  4BAC A;  2HDA A;  1VQK A;  3IQL A;  2EYW A;  3REB B;  4Q5W A;  2R57 A;  3DB4 A;  4KGX B;  1YFN A;  4FYY B;  2O31 A;  4WF2 A;  2K2V A;  3KFV A;  5LJ3 h;  2C0O A;  5GAM f;  2R5M A;  3OW2 S;  3KBG A;  2OAW A;  1B34 B;  3UF4 A;  1ZA1 B;  2XHC A;  2CZ6 B;  2DVJ A;  3X28 B;  4PJN A;  4OB1 B;  5FRO A;  1A0N B;  1UGR B;  1BBZ A;  1VA7 A;  2ABL A;  1ZSG A;  2EIF A;  2QAS A;  2K4Y A;  3PT9 A;  5KE2 A;  2MIO A;  3HKS A;  2A36 A;  3RR6 A;  5LJ3 j;  4C0G A;  2JMC A;  3HRS A;  5IHK A;  5DY9 A;  3CCQ Q;  3FLG A;  4TVR A;  3H6Z A;  1K9M R;  2EYZ A;  3DKM A;  3TSZ A;  2MWO A;  2RJE A;  5IHI A;  3HHT B;  1YHQ T;  4C92 E;  1Y96 A;  1AZG B;  1G83 A;  3VS5 A;  3C95 A;  3CC2 Q;  3NTK A;  3M55 A;  3QDF A;  1M1K U;  2QQB A;  2J6O A;  2M0Y A;  2E64 A;  1ACM B;  2O88 A;  4FSX A;  2PUO B;  5LJ5 d;  5KCO A;  3OA6 A;  2LC4 A;  2K5F A;  5CO7 A;  3QSU A;  1QVP A;  4F14 A;  1NEG A;  2D9T A;  2O9S A;  1UGV A;  1M1F A;  2FEI A;  4IUR A;  1M3B A;  4C8Q E;  1YN8 A;  4JRK A;  2W10 A;  4LUE A;  1WQ7 A;  1VUB A;  1KC8 U;  2K7A A;  4PJO B;  1YIJ A;  3J80 E;  3PMI A;  3MEU A;  2LRQ A;  4OMF B;  3BY7 A;  1BK2 A;  1QP2 A;  1G3T A;  2XI9 A;  2NUT B;  4LE9 A;  4XTZ A;  3CMA Q;  4M75 E;  3GLX A;  2E41 A;  5GMK j;  1N8R C;  3HL8 A;  2E6N A;  1NPR A;  1OOT A;  3MCA B;  3CCL Q;  3M54 A;  2EVR A;  4FL6 A;  4C5H A;  1VQP T;  1X43 A;  1FWZ A;  2P84 A;  2QA4 T;  1KHI A;  2O4X B;  2GQI A;  4ELZ C;  1HJD A;  1K0S A;  1TG0 A;  3G1J A;  4FU6 A;  4LDW A;  2D8J A;  1M8M A;  4B6M A;  4JRQ A;  4PJO C;  3FJP A;  5GAN 5;  1NYF A;  5HKC A;  1G3S A;  2LNH B;  2DTH A;  5KYU B;  2RQT A;  3TU4 K;  1RLP C;  1W4S A;  3FEO A;  2SEM A;  3TSW A;  1PSE A;  4JLI A;  1YIT A;  1YI2 T;  3PIP A;  4PJO D;  1GCQ A;  2RMO A;  2OTJ T;  1R77 A;  3LW5 E;  3H9N A;  2DL3 A;  4RG8 A;  3HFN A;  1VQ5 T;  3CME T;  1AZE A;  2KGT A;  1AWO A;  4ZN3 A;  3QII A;  1TUC A;  4QT7 A;  2ZPH B;  3RDV A;  3JCM V;  4E7I A;  1B07 A;  1Q81 U;  4E7H A;  2FPF A;  1SG5 A;  4L59 A;  3CCE T;  2EKH A;  3SEM A;  1MNE A;  1IRE B;  3X25 B;  1OZ2 A;  1U06 A;  2RHZ A;  1WXB A;  1W70 A;  2QDY B;  3EG2 A;  4OB3 B;  3WVE B;  1VQ6 Q;  1M3A A;  2Z0W A;  4MZM A;  2ENM A;  4J5Y A;  4DA4 A;  3CCS T;  2K3B A;  4IUP A;  5CKD A;  3L2W A;  1IGQ A;  2YUN A;  2JT4 A;  4J9C A;  1PRL C;  2C06 A;  1K9M C;  3FB9 A;  3OYB A;  1SKU B;  2QEX T;  3O8V A;  1QLY A;  2E5K A;  4GBQ A;  3HRU A;  2RF0 A;  2J6K A;  3NFC A;  1IRX A;  4DBF A;  3M0T A;  1FX7 A;  2XDD A;  1OI1 A;  1WNL A;  3OYH A;  2FG0 A;  4RCB A;  2QYZ A;  4BI8 B;  2X3X D;  4Y91 A;  4F16 A;  4OGE A;  4Z88 A;  2JNG A;  5C0M A;  3PGG A;  3I55 T;  1OPK A;  3MJX A;  4C8Q B;  3G71 T;  1YJW Q;  2P0P A;  4DOW A;  2BE7 D;  2IPO B;  3MP1 A;  1K8A U;  1M1K R;  3JB9 J;  4OP0 A;  3JCM f;  5KH6 A;  1VQK T;  2HZY A;  5HK0 A;  4X1V A;  3TEE A;  2ATC B;  1R8O B;  1QP3 A;  1XTD A;  1UDL A;  4BI3 A;  4OVA A;  1BI3 A;  2P0Q A;  5J39 A;  3EHQ A;  1W2B P;  1K4U S;  2ZPI B;  2L3S A;  3PVQ A;  4MMK A;  1WHG A;  3HSB A;  3I56 A;  2VYT A;  1S72 A;  4R0K A;  1M30 A;  1QCO A;  5FW9 A;  2CUD A;  4LXC A;  2CUB A;  4C92 D;  1VQL A;  4PJJ A;  2WSC E;  4C8Q C;  3S3N A;  1TH7 A;  1G5V A;  1UGP B;  8AT1 B;  1X2Q A;  2FZG B;  1MMA A;  2CSI A;  1BI0 A;  2Y90 A;  3QZ5 B;  3M57 A;  4X9D A;  3JCM P;  3RNJ A;  5GAM h;  2VGN A;  1AT1 B;  3GNF B;  2CT3 A;  4MZP A;  1RAD B;  3MHX A;  4M75 A;  2GQV A;  3OB9 A;  4E7J A;  1VQ8 A;  3UWN A;  1I07 A;  4KGZ B;  3MEW A;  3CD6 Q;  4C8Q D;  3QZ9 B;  1TUG B;  3CBP A;  4ZGD B;  1OYX A;  1Z9Z A;  1W2B A;  2DIG A;  4RG2 A;  2ZPG B;  5GAO p;  4PJO G;  4BUG A;  5GAM j;  2X4J A;  3L2U A;  4HT9 A;  2EQU A;  3TQ7 P;  5FU6 B;  1Y07 A;  3V7C A;  4PJO F;  3H0F A;  1JEG A;  4JZ4 A;  2I2L A;  4XTW A;  1UJ0 A;  5IH2 A;  3G6E A;  3WVD B;  1VQM A;  3R6N A;  4M75 D;  5CQY A;  5CVI A;  4F7U A;  5LJ5 g;  1ZUK A;  2LJ3 A;  3I9Q A;  2HD0 A;  2FHD A;  2V8J A;  1YIJ T;  5KYY A;  1VIF A;  3RKW A;  5KYW A;  1KHC A;  4B9W A;  1RAI B;  6AT1 B;  2CKK A;  1NM7 A;  4CC4 B;  4ELY C;  1OU8 A;  3OYA A;  3R6O A;  4ESR A;  3EH1 A;  1QVF A;  1M2V B;  4M7D A;  1Q81 R;  3H8Z A;  4BD3 A;  1NYG A;  4NOY A;  3VKI A;  4HVU A;  2RK1 A;  1AVZ C;  5FU6 C;  2COY A;  5LJ3 e;  2YRC A;  4JUV A;  1KQS P;  1VQ4 Q;  1O9S A;  1OV3 A;  4ZGE B;  1YJN T;  2FVU A;  2QGG A;  3M58 A;  3OYI A;  3JCM J;  3EGU A;  2F69 A;  3VYH B;  3TRE A;  2GFU A;  1AWX A;  2KRO A;  4JJB A;  3KUF A;  2K3Y A;  2GNC A;  2K3X A;  1WHK A;  1LJO A;  4E7L A;  2RD1 A;  3OYY A;  1I81 A;  2E5Q A;  2HBP A;  1GFD A;  4M7A A;  3HTR A;  3NTI A;  2W0Z A;  2XG8 D;  2J06 A;  1NEB A;  1M1K C;  4JRP A;  3RKY A;  2QTX A;  3M0S A;  1NLP C;  2JS0 A;  2VC8 A;  1QQJ A;  1C1A A;  4DBQ A;  4HT8 A;  3JCM c;  2CRE A;  3HPW A;  3OYM A;  2JMA A;  2RK2 A;  2LT1 A;  2Y4Y A;  3OYF A;  1BKB A;  2VGM A;  1KQ1 A;  4J7F A;  1K8A R;  2OI3 A;  2PNI A;  1S1N A;  4AFQ C;  4VUB A;  3G4S T;  2AT1 B;  4J7I A;  1Y71 A;  1IB8 A;  2COW A;  1MGQ A;  1OX9 A;  2LCL A;  1VQP A;  5IAY A;  2ED1 A;  2DD5 A;  5CQX A;  1V76 A;  2QA4 A;  3SD4 A;  3U23 A;  3QG1 A;  3CCM T;  1RAC B;  2LJ0 A;  2CS7 A;  2K9G A;  1PHT A;  2DM1 A;  3VJP A;  3EGX A;  1WX6 A;  2ESW A;  5DM7 R;  1BU1 A;  2LQ8 A;  3HFO A;  1UJY A;  3RMQ A;  4M77 A;  4C8Q G;  2RHU A;  2BZ8 A;  1D09 B;  1ABO A;  2DEU A;  1Q82 U;  3VU3 C;  4LUD A;  4C8Q F;  4KH1 B;  1TS9 A;  1OEB A;  5I2M A;  5CR2 A;  2EW3 A;  1RL2 A;  3SWN C;  1YI2 A;  2XIC A;  4C0D B;  4LNP A;  3OYL A;  1CSK A;  3VYG A;  1OPL A;  4JS5 A;  3OYE A;  1VQ5 A;  1D0Z A;  2MWP A;  3CC2 A;  1TOV A;  2GF7 A;  2YWW A;  4QW2 A;  2NUP A;  2CP3 A;  2L3Q A;  5GMK m;  3M59 A;  4PFO A;  3AHU A;  4RTV A;  2XU8 A;  3M0U A;  2RN8 A;  4CC7 A;  4FCY A;  1UHC A;  1SHF A;  3C94 A;  3C4S A;  4D8K A;  4ORZ A;  3CCU Q;  1VQ7 T;  4EMK C;  3CCS A;  7AT1 B;  4IUV A;  1YJ9 Q;  1Q81 C;  1YWP A;  2AHJ B;  4FYV B;  4RKU E;  2K5L A;  4HCC A;  1YHQ Q;  1GL5 A;  1X69 A;  3JCM h;  2HQE A;  1OQK A;  1BIA A;  3ULR B;  1VQL T;  5IN1 A;  4C0F A;  1QVG S;  2JS2 A;  2RHX A;  1NBE B;  2E10 A;  3UA6 A;  1Y57 A;  2E4H A;  1VQ9 T;  2RPN A;  4JJC A;  2JM8 A;  5I22 A;  1SRL A;  1QWE A;  4Z8A A;  1WDX A;  3CMA A;  1WHJ A;  3CC4 Q;  3CCL A;  2KQW A;  2A0F B;  4RTW A;  4ZGJ B;  1QMC A;  2LX7 A;  1U8R A;  2KT1 A;  3I55 A;  2D6F A;  3QWX X;  3DLM A;  1TTH B;  2FRY A;  3G71 A;  4PNO A;  2GTO A;  1Q95 G;  1VQO T;  2ZPF B;  3EAE A;  4QQG A;  2DLP A;  1M1G A;  3C12 A;  1PG5 B;  4XU3 A;  2XD0 A;  4XTY A;  1ZUY A;  1EX4 A;  2L0A A;  3UDC A;  3L42 A;  3J7A F;  2DBM A;  3L2R A;  3CCJ Q;  1MMG A;  1X2K A;  2QXF A;  4J9B A;  3G6E T;  4KT0 E;  2RQR A;  1VQM T;  4PJM A;  4J8O A;  2EYX A;  1K8A C;  1KK7 A;  1WFW A;  4OMM A;  1TU0 B;  1Y96 B;  3EFO A;  2CP5 A;  2DXT A;  3V8J A;  2KYM A;  3MO8 A;  2E65 A;  3GIB A;  2LNV A;  1WI7 A;  3MEA A;  3NHN A;  2HBW A;  5GAN 7;  4F17 A;  1BI2 A;  5KYX B;  2MYS A;  1VYU A;  1QWF A;  5LJ3 d;  3D7S B;  1ZX6 A;  3LH5 A;  3OBW A;  3KXT A;  3EFR A;  4LD6 A;  2H3E B;  3LWI A;  2A28 A;  5FU7 B;  4KGV B;  4DOV A;  4XTV A;  2DRK A;  2YLB A;  3URG A;  1U1S A;  2FZC B;  2HL3 A;  4ZN1 A;  2CZ7 B;  3RES A;  1Q7Y C;  5I11 A;  4A4E A;  2C0T A;  1IXD A;  4D8D A;  1B34 A;  3CCV Q;  2P0K A;  4OMO A;  4AG1 C;  1PWT A;  3E19 A;  2QAZ A;  3ZL7 C;  3VS3 A;  3CXC A;  1XQH A;  4MDX A;  3I5R A;  5LJ5 j;  2DF6 A;  2QGF B;  3FJ5 A;  3MP8 A;  1JB0 E;  5GMK h;  1JJ2 A;  1Q82 R;  3EHR A;  4LDY A;  3ZEH A;  2KDS A;  5GAM e;  5GAO m;  3DB3 A;  2IG0 A;  4M78 A;  2RB6 A;  3EG9 A;  1V1C A;  2DJZ A;  4JJN K;  2VV5 A;  2E12 A;  5FU7 C;  1BCM A;  1E6G A;  1YJW A;  4JRI A;  2H8H A;  4OMN A;  5EC7 A;  8ATC B;  3CC7 Q;  4BE2 A;  1HXD A;  3JRZ A;  4FW2 A;  1KQS S;  4BY6 B;  3LGL A;  3F70 A;  4IKF A;  2J7I A;  2KBT A;  5A0D A;  3OSV A;  4DEX A;  5GAN 4;  4OB0 B;  2PVD B;  1YNZ A;  3A8L B;  1GRI A;  4PKC C;  2RHY A;  3M0R A;  5C6S A;  2F2X A;  3E1S A;  1YJN A;  1B3Q A;  4BDZ A;  4KRT A;  5GMK l;  4N4I A;  3M0Q A;  1T3S A;  2L89 A;  2SRC A;  3PIO A;  2JUF A;  2DL7 A;  1RAB B;  2NUZ A;  1J3T A;  4O6J A;  4A4K A;  4C5G A;  3OYG A;  2CP0 A;  4F7U E;  3CCQ T;  1XOV A;  3QO3 A;  1JXM A;  3GP8 A;  2QI2 A;  4BY6 C;  3VS7 A;  2YUO A;  2XID A;  4ATO A;  4XU2 A;  3OYC A;  2DNU A;  1R0C B;  4M7D E;  1ZSZ A;  3CC2 T;  1GCQ C;  2O4X A;  4HCZ A;  3J81 E;  3G4S A;  1QCN A;  5A0L A;  4CC3 A;  1K73 R;  3CCR Q;  1GFC A;  1PD0 A;  4EPC A;  1CKB A;  1T0H A;  3QYG B;  3E9G A;  2BIV A;  3M53 A;  2OX7 A;  2XK0 A;  4RTY A;  4E7Z A;  1IO6 A;  1D3B A;  3CCM A;  2RQV A;  4NS5 A;  2DTI A;  3PNW C;  2HEQ A;  2PVG B;  1UFF A;  1W1F A;  3MPU B;  1ZUU A;  2FZK B;  5CKF A;  3OS0 A;  4IUT A;  2RNA A;  4RCC A;  2KE9 A;  5KYU A;  2DKG A;  3QUI A;  4M7A E;  3CPF A;  4C92 B;  1EIF A;  2RA2 A;  1HK9 A;  2LX9 A;  1KD1 R;  1E7O A;  3CPW S;  2KY9 A;  2JOY A;  5GAN j;  1F1B B;  2CH4 A;  2KEA A;  1SF9 A;  1ZQ1 A;  1VQN Q;  3CMA T;  3BDU A;  4RTZ A;  4FSS A;  1UHF A;  3TVT A;  2EAY A;  2V8I A;  3P8B B;  3CCL T;  1Q86 R;  2KNB B;  4ZTF A;  3O5Z A;  2JXB A;  2KI7 A;  3CBO A;  1ARK A;  3LWH A;  4KUD K;  2EGA A;  2CH4 W;  3JB9 D;  3GF5 A;  1UEC A;  1TXQ A;  1I1J A;  2ZCF B;  4GLK A;  4L6V 5;  2CP7 A;  2QQR A;  1Q82 C;  2O2O A;  4JZ3 A;  1UTI A;  4C92 C;  2YUQ A;  1IGU A;  2EWN A;  4LDX A;  3L2Z A;  3OQ5 A;  1VQ7 A;  1LOJ A;  3JCM g;  4M75 B;  5L8R E;  3THK A;  1MHN A;  2VXF A;  3PVL A;  2DIL A;  2KSS A;  1ABQ A;  1X6O A;  5EG2 A;  3OBY A;  3QHS A;  4M77 E;  1KIK A;  3V8K A;  2QTV A;  3V7S A;  4AFS C;  1BYM A;  1QCF A;  4IIO A;  2MAM A;  1Q7Y U;  1VQ9 A;  4RMO A;  5FRN A;  5GAO l;  5D6X A;  2YLC A;  1QVG A;  3OW2 P;  2EJ9 A;  3S3M A;  5D6Y A;  2KK4 A;  5CIU A;  1RLQ C;  3PTA A;  3RBB B;  4F7U B;  1H3Z A;  2HQX A;  1QVF P;  2V26 A;  1VQO A;  4XAX B;  4M75 C;  5KCH A;  2D1X A;  1I4K 1;  5KYW B;  1YIT Q;  3RIR A;  5LJ3 g;  5I21 A;  2D8H A;  3JCM e;  3PFS A;  2MMP A;  4M7D B;  2VXE A;  1FYN A;  5GAM d;  2YRD A;  4OGC A;  4J6W A;  1PC0 A;  2FL7 A;  1GXI E;  5LJ5 f;  1RAF B;  1XNI A;  2XDB A;  2CZ0 B;  1K73 C;  2DMO A;  1WJQ A;  2DEQ A;  3OW2 A;  4Y28 E;  1YWO A;  2RH2 A;  1MMN A;  5D6W A;  2XDP A;  4II1 A;  5CKB A;  2MK5 A;  3GBQ A;  5IXF A;  2ZGW A;  4FM4 B;  1YJW T;  4J9I A;  2DBK A;  1O75 A;  1GBR A;  5GAO q;  4A54 A;  5FWB A;  2DA9 A;  4M7A B;  3EFS A;  2EPD A;  2M1H A;  1HSQ A;  3EG1 A;  2DX1 A;  4M7D C;  2YRV A;  3QYH B;  2LMJ A;  3M0P A;  3M5A A;  1KD1 C;  2LCS A;  1UG1 A;  5KE3 A;  5GMK i;  1CKA A;  2FRW A;  3V7R A;  3VRZ A;  1LPL A;  3LH0 A;  4Z89 A;  3RER A;  1UEB A;  2ZPB B;  5FRM A;  2DTO A;  1WIE A;  4HXJ A;  1Q86 C;  2KRS A;  4PFP A;  1LCK A;  4M7D D;  2F2V A;  1ZHI A;  2AKL A;  2EGC A;  4MZT A;  3JB9 G;  4EMH A;  1PD1 A;  4AFZ C;  4IIM A;  3JB9 F;  3NMZ C;  1MUZ A;  4PJL A;  1G8X A;  3PMT A;  3EG3 A;  3EGX B;  3ZFJ A;  3OMC A;  2K2M A;  1UGQ B;  2A08 A;  1UB4 A;  3CD6 T;  3I56 Q;  1S72 Q;  1MV0 B;  3JCM b;  2HSP A;  2LJ1 A;  2YSQ A;  2HCK A;  2JN0 A;  4M77 B;  3MP6 A;  4M7A D;  1T0J A;  2CP6 A;  2K79 A;  1WJS A;  3M4Y A;  4C92 G;  1M3C A;  4WCI A;  1VQL Q;  2E6Z A;  3BFM A;  2EJG A;  1NLO C;  4A53 A;  4C92 F;  1Y0M A;  2VAS A;  2X4Y A;  2RJD A;  3CQT A;  2AIR B;  2JZ2 A;  5GMK e;  2PVO B;  4P5N A;  2FYK A;  1ZBX A;  3VV0 A;  1RI0 A;  4PK4 A;  2IIM A;  4C0Z A;  5IHN A;  1X6G A;  2DZ9 A;  1VQ8 Q;  1H3H A;  1M27 C;  1AHJ B;  4OML A;  2ROL A;  1U1T A;  2FPD A;  2OTL Q;  2GTJ A;  5IT9 E;  5I2S A;  1C0M A;  1P92 A;  4LDU A;  1Q7Y R;  4M78 E;  5GJV B;  3CCQ A;  1D1B A;  1UGS B;  2E3I A;  4M77 C;  2NYS A;  1M8V A;  3LX7 A;  5CAI A;  2KVQ G;  3QJY A;  5GAN f;  1KQ2 A;  1HYO A;  2L5Q A;  3OMG A;  2MF2 A;  4XK8 E;  2V1R A;  3N5B B;  5GAN 8;  1LNX A;  4RTT A;  2L3R A;  4DBR A;  3HRT A;  2KMT A;  4ZTJ A;  3SWN A;  1VQ4 T;  3SDZ A;  2MPX C;  5ECA A;  4M75 G;  3L1A A;  4N0A C;  1RAH B;  4M77 D;  3WXM B;  3JCM Q;  2WAC A;  3P8H A;  4M75 F;  3OY9 A;  2DXU A;  2ROT A;  4HCB A;  1LVK A;  2B86 A;  3A8O B;  3LYI A;  3QWY A;  2BZX A;  4BE0 A;  5FWC A;  3FC3 A;  5J3B A;  2FB7 A;  4C0D C;  1RI9 A;  3EGD A;  4EMK A;  2ZAE A;  4JPB W;  1RAE B;  4CI0 C;  3HP9 A;  4LDV A;  1QKX A;  4F7U G;  2DZC A;  2X35 A;  2KR3 A;  2RQW A;  1WJR A;  2C0I A;  2EQK A;  2QK0 A;  2LCC A;  4J83 A;  2LTO A;  4F7U F;  3EH2 A;  4XU0 A;  4EMG A;  2JJ9 A;  2LQK A;  3CPW A;  2X4X A;  4M7D G;  4AT1 B;  3BDL A;  2GFA A;  1K1Z A;  3OYK A;  3EFO B;  1PSF A;  4M7D F;  3JCM d;  4BB7 A;  2KT8 A;  4E6R A;  4FYX B;  2PU9 B;  2K6D A;  1K73 U;  1GCP A;  1W2B S;  2BUD A;  4KUI A;  1H64 1;  1R0B G;  2DAQ A;  3MET A;  5HY6 A;  1X6B A;  2EFI A;  1NPP A;  2OAU A;  3I5S A;  1V29 B;  2RO0 A;  5FLX E;  2GGR A;  2YXY A;  3H0I A;  2J05 A;  4M7A G;  1BCO A;  1E6H A;  3JV3 A;  4XU1 A;  3CXC P;  1SEM A;  4AMC A;  1VQP Q;  2A3L A;  4L5G A;  2QQA A;  4M7A F;  1JBM A;  2QA4 Q;  1KD1 U;  1IHW A;  5GAM g;  1C6V X;  4FIB A;  2NLU A;  1M5Q 1;  3M4G A;  1JJ2 P;  2X9H A;  4EDU A;  2YUP A;  3TCJ A;  3ZBD A;  2HQH A;  4OF1 A;  1D1C A;  1QVF S;  1Q86 U;  3CCR A;  3PE0 A;  1TWB A;  4ME7 A;  5LJ5 h;  2HKN A;  4FW1 A;  1VQ6 A;  3H41 A;  4M78 B;  3CCU T;  2M0O A;  4OB2 B;  1WXU A;  3ASK A;  3EG9 B;  1D1A A;  1JO8 A;  1G3W A;  3S3O A;  2KRM A;  3OS1 A;  1YJ9 T;  1YI2 Q;  3OYN A;  1T3L A;  1RAG B;  3C0C A;  4E2F B;  5L23 A;  5CKH A;  2OTJ Q;  3FIF A;  1N6A A;  1VQ5 Q;  3CME Q;  2QQ9 A;  3CEY A;  4HVV A;  2F2W A;  2JTM A;  2VUB A;  4FT2 A;  1JU5 C;  4M77 G;  3CCE Q;  2Y4X A;  1VQN A;  4X34 A;  2MOX A;  3CC4 T;  1H8K A;  1NJI R;  4XQ3 A;  4BI4 A;  2XKO C;  5KYX A;  4M77 F;  4M4Z A;  1BB9 A;  1NG2 A;  2RI3 A;  3VS6 A;  1WPY A;  5J26 A;  2D0Q B;  2E3H A;  4M78 C;  1M90 R;  1AD5 A;  3CCS Q;  2O01 E;  2F5T X;  4E7K A;  2QEX Q;  2EQJ A;  5GAO n;  2AZV A;  4N4G A;  3CCJ T;  2CYZ B;  3QKJ A;  4JJD A;  2MCN A;  2DO3 A;  1OU9 A;  1X75 C;  4M78 D;  3QDR B;  2DYI A;  1N5Z A;  2P4T A;  2EYY A;  4D6W A;  2RHI A;  1I0C A;  1X01 A;  4IUQ A;  5HK3 A;  2PZ1 A;  1U5S A;  1DJ7 B;  1ZSZ B;  2G3R A;  2EYQ A;  3T9N A;  1QKW A;  3I55 Q;  1OUL A;  3GNG A;  2LP5 A;  3OS5 A;  3G71 Q;  4PJO A;  2KYB A;  4QQD A;  3G7Z A;  4J9H A;  5LL6 S;  2EKO A;  4DBH A;  1VQK Q;  1FXX A;  4C5I A;  1OZ3 A;  1D3B B;  2DK3 A;  1YCY A;  2NUT A;  2GCX A;  2AZS A;  2IVW A;  3UT1 A;  3A8H B;  4AFU C;  4BE1 A;  1IHV A;  3CD6 A;  3L2Q A;  2PUK B;  2JW4 A;  2F1L A;  1AOJ A;  1SSH A;  2F5K A;  1ZSZ C;  3CCV T;  4OMQ A;  1I5L A;  4PLI A;  2JVV A;  4DQ2 A;  4PFZ A;  2CZ1 B;  2MI6 A;  3MEV A;  5GAN h;  4JLG A;  1N27 A;  2A7Y A;  4MML A;  1IZ6 A;  2DPP B;  4AG2 C;  1KJW A;  1SSF A;  3SB2 A;  2VVK A;  2I0N A;  3CBM A;  2VB6 A;  3VS4 A;  1ZBJ A;  5DLQ E;  5AT1 B;  4J6Y A;  2EJF A;  2RQU A;  1WHH A;  1SHG A;  5GAN 6;  3CC7 T;  2OJ2 A;  3LLR A;  4LN2 A;  1ZA2 B;  3VS0 A;  5GAN d;  1WZO A;  1FMK A;  1RAA B;  2FPE A;  1PNJ A;  2CP2 A;  3A8G B;  2DL8 A;  2M51 A;  2L3P A;  4HA8 A;  3A8M B;  1VQ4 A;  2EBP A;  2QDL A;  1U3O A;  1QVG P;  1EFN A;  4FYW B;  1FMW A;  3INZ A;  1M2O A;  4O5V A;  2M16 A;  4LD9 K;  5M9O A;  3UA7 A;  1WHM A;  1YIJ Q;  4R55 A;  2EQI A;  2R58 A;  2WSF E;  2ZPE B;  1NJI C;  2L8D A;  1AWW A;  2DL5 A;  2HAX A;  2O9V A;  1GBQ A;  2HNI A;  5DLO A;  4C92 A;  1PKS A;  1M90 C;  2CDT A;  4B9X A;  1G2B A;  2AK5 A;  2LVM A;  2DL4 A;  2CSQ A;  2J6F A;  1WHL A;  2DXC A;  2P4R A;  4YTL A;  3OYJ A;  5KYN A;  1W6X A;  4QVD A;  2YHT A;  4QKU A;  2BE9 B;  3OS2 A;  3A5Z B;  4M78 G;  1YJN Q;  2RI5 A;  4A4H A;  3BW1 A;  2KRN A;  4J6X A;  2CGH A;  4C8Q A;  4M78 F;  1WQW A;  1PCX A;  3JCM X;  1KC8 R;  2BZY A;  3RMS A;  4RTX A;  3CCR T;  3H0H A;  4QQ6 A;  3V8L A;  1KFZ A;  3A98 A;  1I8F A;  4F04 B;  1VQ6 T;  2E1H A;  2AKK A;  1Y7X A;  2NWM A;  9ATC B;  2K57 A;  2E70 A;  4PLL A;  5KYY B;  1UUE A;  1AWJ A;  5CCA A;  3E2U A;  5LJ3 f;  4XTX A;  4ZNX A;  5A2Q E;  1VOM A;  4A4G A;  3NGP A;  5IXB A;  2YDL A;  1I5O B;  3CXC S;  2OTL A;  1UE9 A;  2RI2 A;  2LQW A;  3QBY A;  3G4S Q;  1TUD A;  4CC2 A;  1VQN T;  4E47 A;  2K5I A;  1JJ2 S;  3JB9 H;  2FO0 A;  3SHW A;  1WGS A;  2RJC A;  3CCM Q;  2KAF A;  3M9Q A;  3VS2 A;  2PQW A;  1WLP B;  1JRI A;  1N8R U;  4C5E A;  1MV3 A;  4KH0 B;  3JSC A;  3QPH A;  4GY5 A;  4QVZ A;  2HL5 C;  1VYT A;  2JM9 A;  2LQN A;  2GBQ A;  4R56 A;  5AYF A;  1M4Z A;  3X26 B;  5CKE A;  3LGF A;  3CCU A;  2LT4 A;  2HMA A;  4J9D A;  1TSF A;  1SRM A;  2COZ A;  2V8K A;  4J9G A;  4QVC A;  4NL3 A;  1YJ9 A;  1B7T A;  3JCM W;  2BTT A;  4K11 A;  3Q1J A;  3OSS C;  1YHQ A;  1VYV A;  3X20 B;  3NTH A;  4HCK A;  3VUZ A;  1NZ9 A;  2R5A A;  2X4W A;  4M7A C;  2DYB A;  3GOX A;  3A1P A;  4GLM A;  5D7U A;  3CC4 A;  1M2V A;  2HSE B;  2A37 A; 
#chains in the Genus database with same CATH homology
 1TS9 A;  1V76 A;  2ZAE A;  1PC0 A;  2KI7 A;  1OQK A;  1TSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...