2DL7A

Solution structure of the second sh3 domain of human kiaa0769 protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
73
structure length
73
Chain Sequence
GSSGSSGVCFVKALYDYEGQTDDELSFPEGAIIRILNKENQDDDGFWEGEFNGRIGVFPSVLVEELSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the second SH3 domain of human KIAA0769 protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords KIAA0769 protein
total genus 5
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2006-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dl7A00
2JS2A 2DRKA 2DM1A 5GJVB 1JU5C 4R0KA 3EG2A 1GRIA 1SRMA 1UTIA 4IIOA 1UG1A 4IIMA 3PVQA 1WXBA 4Y92A 3I35A 4J9CA 2PZ1A 1NYGA 2LCSA 4J9IA 2LQNA 2LP5A 2YUNA 1HSQA 4GLMA 2F2WA 2KBTA 4LUDA 1AWJA 3REAB 2IIMA 2C0TA 1E6HA 3R6NA 2DNUA 3UA6A 2H8HA 4CC4B 3NPFA 4DEXA 4M4ZA 1RUWA 4RTWA 1J3TA 3A98A 2CSQA 2FG0A 2KXDA 2DL4A 1K1ZA 2K6DA 1GCQA 3M0UA 1M27C 1X6BA 2RN8A 5IH2A 3VS1A 3GBQA 1KSWA 2HDAA 2FRYA 2J7IA 3ULRB 1PKTA 3H0FA 3H41A 1FMKA 3THKA 1PNJA 2AZSA 4RTXA 1UDLA 2JMAA 3I5RA 1Z9QA 1GBQA 2ECZA 1UFFA 2K9GA 2CT4A 4Z8AA 2KT1A 1UJYA 2FRWA 2AKKA 1K76A 2DBMA 2FO0A 2DMOA 1GFDA 5I22A 1T0JA 1YNZA 2DRMA 4RTVA 2KNBB 5IHNA 2J6FA 2C0OA 4OMLA 2L3SA 1WLPB 1WXTA 1CKAA 3SEMA 2DVJA 2EYWA 4AG2C 2EYZA 2DL5A 4F14A 2BZYA 4EIKA 3NGPA 1S1NA 1K0SA 1VYVA 4D8KA 1ZUUA 4HVWA 2D8JA 1X69A 1AWXA 2BTTA 2D0NA 2YSQA 2A28A 1G2BA 2JM8A 1MUZA 2I0NA 1QLYA 2AKLA 3O5ZA 1AZGB 4F16A 2KXCA 1GCQC 2ABLA 2KRNA 2GQIA 1OV3A 2O31A 5L23A 4CC2A 1BK2A 1X2KA 1QWEA 4F17A 2M0YA 2JXBA 2LJ1A 3VS6A 2JTEA 4JPBW 4KRTA 2F2XA 1T0HA 4J9BA 2QDLA 3M0QA 3RBBB 4RTTA 1K9AA 1WX6A 1NEBA 2YDLA 2RMOA 4D8DA 3ZL7C 1BBZA 4JJDA 1VA7A 4FSSA 2OAWA 1KJWA 3VS2A 2KRSA 2AK5A 3M0SA 1QKXA 2CSIA 2EGAA 3U23A 4J9EA 2GGRA 2LJ0A 4LNPA 2CH4A 3C0CA 2CT3A 5I11A 2ROTA 1H3HA 4ESRA 2K7AA 4AFSC 1FYNA 1BB9A 1TUDA 2EQIA 1H8KA 2HCKA 4LUEA 2J6OA 1AWOA 2DL8A 1G83A 1X27A 1NM7A 2DE0X 1NLPC 2YT6A 1PHTA 3QWXX 3NMZC 1K0XA 1SSHA 2C0IA 2RPNA 2CH4W 2JW4A 1A0NB 1UECA 5GJWB 1AWWA 1X43A 4AFQC 2PTKA 1ABQA 3VRYA 2LZ6B 2YUQA 1M8MA 4RTUA 2RQWA 1T3SA 1SRLA 1B3QA 3EGUA 4AFUC 1Y0MA 2MIOA 1AVZC 2PNIA 3M0PA 2DF6A 3QWYA 3SHWA 2EBPA 2O9VA 1T3LA 3PE0A 1YCSB 4CC3A 4J9FA 1XOVA 2A08A 1ZBJA 4AG1C 2BZ8A 1GCPA 2O9SA 4WCIA 1JEGA 1OEBA 1WI7A 3KFVA 2XMFA 1K4US 1UE9A 1X2QA 1JXMA 3REBB 2KEAA 1PRLC 3IQLA 1IO6A 3VS3A 1JO8A 5FWBA 5IHKA 2HEQA 1GL5A 3EG3A 1YN8A 1VYUA 1Y57A 1M3AA 4Z88A 5EC7A 1KFZA 2K79A 4K11A 2AZVA 2RF0A 2KGTA 1SEMA 5HCKA 2GTOA 2A36A 3I9QA 1MV0B 1B07A 4Z89A 2GBQA 1NYFA 4OMMA 2DLPA 1QKWA 2ESWA 1U3OA 1WDXA 2W0ZA 2CDTA 4ORZA 1U5SA 2DX1A 2DL7A 2OJ2A 2KROA 3NHNA 4OMOA 1UHCA 1ZSGA 4JJCA 1NLOC 4HVVA 1KIKA 2LX7A 1BU1A 3EG0A 2FPEA 1RLPC 2W10A 1QWFA 2GNCA 1ARKA 2LQWA 4A63B 1YP5A 1H92A 1UHFA 3LH5A 1ZX6A 2EW3A 1MV3A 2L0AA 2O88A 1UUEA 2V1RA 2CUBA 1Z9ZA 2RQUA 2RQTA 1NEGA 5IXBA 3UATA 2NWMA 1M3BA 2MOXA 2L3QA 1W6XA 1M3CA 1RI9A 1I07A 2DYBA 1W1FA 1YWOA 2V1QA 2GTJA 1PWTA 2D1XA 2EYXA 1NG2A 2LNHB 2VVKA 2EGCA 2SEMA 3VS7A 2CREA 1AOJA 1WFWA 1ABOA 2RQVA 2M51A 1YWPA 2P4RA 4GBQA 1E7OA 2VWFA 2FPFA 4QT7A 2EPDA 1TG0A 3VS4A 2K3BA 3VRZA 2F2VA 2FEIA 1U06A 2KRMA 3TSWA 2HBWA 5IXFA 2J05A 1RLQC 5IHIA 2LMJA 1AEYA 4E6RA 4RTYA 2MCNA 3EHQA 4X1VA 4RUGA 1SPKA 3TSZA 2ROLA 2K2MA 2RQRA 2JM9A 2O2OA 3VS5A 2G6FX 4OMQA 1V1CA 2L2PA 1AZEA 1VYTA 2BZXA 2A37A 2KYBA 2VKNA 3TVTA 3VS0A 2ED0A 3I5SA 4RTZA 2EKHA 1HD3A 5FW9A 2RNAA 1X6GA 1OOTA 2EYYA 3CQTA 1WIEA 4HCKA 2SRCA 1AD5A 1GBRA 3JV3A 2X3XD 4J9DA 3M0TA 2DJQA 1GFCA 2ED1A 1OPKA 2OI3A 2D8HA 2J6KA 3UA7A 2YUOA 2DBKA 1QCFA 2EGEA 2YUPA 1PKSA 1M30A 3FJ5A 1ZUKA 2L3PA 3UF4A 4DEYA 1CSKA 2KE9A 4LE9A 1SHFA 4JJBA 4AFZC 4JZ3A 2CUDA 2ENMA 1WYXA 1LCKA 3H0IA 1OPLA 1W70A 2B86A 4J9HA 2FPDA 3M0RA 4HXJA 1I0CA 3EHRA 1WXUA 5FWCA 5ECAA 3PVLA 2EVRA 4JZ4A 2KYMA 2X3WD 1HJDA 4HVUA 2KR3A 4OMNA 1UGVA 2JMCA 1I1JA 1TUCA 1WA7A 2JS0A 1E6GA 3EG1A 4OMPA 2DL3A 1SHGA 1PRMC 2HSPA 1ZUYA 2J06A 4CC7A 2LJ3A 2E5KA 2DILA 1JXOA 3RNJA 4ZNXA 1UJ0A 2KT8A 2DA9A 2JT4A 4J9GA 1CKBA 4LN2A 3H0HA 1N5ZA 1EFNA 1ZLMA 1JQQA 2NUZA
chains in the Genus database with same CATH superfamily
4EMKA 2JS2A 3T9NA 2DRKA 3M55A 1NJIC 3OBWA 3DB3A 3OW2P 4R0KA 1RABB 2X4XA 1KHCA 3BFMA 1UTIA 4IIOA 1Q82R 4MZTA 1WXBA 1N8RU 4J9CA 3OSVA 3M57A 1QCOA 1ZA1B 1VIFA 1HK9A 5GAN7 1P92A 3OQ5A 2F2WA 4QW2A 2IPOB 4BE0A 4B6MA 1UGSB 4EPCA 4C8QG 2C0TA 3JCMP 3PFSA 2WSCE 2KMTA 3C4SA 2CSQA 2KXDA 3EGDB 4XU0A 1I4K1 3QYHB 1M27C 3VS1A 5LJ5e 1IREB 3CCLQ 2ZPIB 1MGQA 4YTLA 1AHJB 4C92E 3AT1B 5CAIA 1FMKA 2CZ6B 3THKA 2DO3A 2AZSA 2WSFE 4EMKB 2E5QA 1Z9QA 2VASA 2DTHA 5CR2A 1ZQ1A 2K9GA 1VQMA 2CT4A 1VQOT 1ZSZC 4LDYA 2KT1A 1M1KC 2FRWA 3HKSA 3KUFA 2OTLQ 1MMDA 1W2BS 3CBOA 4RTVA 2XICA 3DLMA 2RHIA 2EYWA 1QP3A 1YJWQ 4XTZA 3BDLA 2EYZA 4PJOD 4M7DG 3QZ5B 2BZYA 1KC8C 4EIKA 4J5YA 4IUTA 5CQYA 1UEBA 1PG5B 3M9QA 2JTMA 2D0NA 3OYNA 1G2BA 5GMKh 4KULA 4M75C 4C8QD 1K8AR 3H8ZA 4JLIA 1VQNQ 5A0LA 5I2SA 4F16A 4RKUE 3L2VA 4KGXB 3M4GA 2KRNA 1RAFB 4M7DA 2RI3A 2E65A 4ANJA 2RHXA 4CC2A 1X2KA 4F17A 2JXBA 1MMGA 2HBPA 4OB0B 2JTEA 3OB9A 1Q82U 2DIGA 4KRTA 3E1SA 4J9BA 5D6WA 2PUOB 3M0QA 3RBBB 5GANh 2MF2A 1M2VA 5L8RE 2DTOA 1BBZA 3MEVA 2E41A 5HKCA 4J8OA 1OX9A 2CGHA 1G3WA 1QMCA 2OAWA 4FSSA 4F7UG 4M7DC 2KRSA 2AK5A 4PJOB 1QKXA 3LWIA 1KQ1A 1PD0A 5KYWA 4QQ6A 1QVGP 1QP2A 2CT3A 3CCMQ 4E7KA 4M7AB 1YIJT 2ZGWA 4N4IA 4X9CA 5KYWB 1OX8A 1H3HA 2RD1A 1BB9A 1TUDA 3SWNC 4ZGDB 2HCKA 1WJRA 2J6OA 4LUEA 1AWOA 1Q7YR 1G83A 5GAMd 4DOWA 3NMZC 1SSHA 2C0IA 2RPNA 2CH4W 1M2OA 5FU6B 2KQWA 1UECA 4AFQC 2PTKA 1C6VX 4Y28E 4KBMB 5GAOm 1M8MA 4IUQA 4RTUA 2RQWA 2YLBA 4MZMA 1VQ5Q 4A4EA 1SRLA 4BE1A 1M1GA 2MI6A 2F5KA 3G7ZA 4EMHA 2DF6A 3SHWA 2EBPA 2VGNA 1ZSZA 1YCSB 4J9FA 4AG1C 2BZ8A 2O9SA 3KFVA 1G3TA 2HSEB 4F7UA 4PJMA 1JXMA 2XK0A 2HL3A 4KH0B 1GL5A 1VYUA 1VQ4T 1MNDA 1VQ7T 3CCUT 3DB4A 4FIBA 2AZVA 4OMFB 2BKDN 3G71T 1VQPQ 2RM4A 1K8AU 2DZCA 4C92F 2KGTA 2A36A 1MV0B 1AT1B 1FWZA 2NLUA 2A0FB 3MPUB 3KBGA 4ZN1A 1YJNT 2DXBA 4ORZA 1NJIR 4R55A 2R5MA 3M59A 5FU6C 4Q5WA 1G5VA 1NLOC 3L2ZA 4HVVA 4RCBA 1IHWA 2QG9B 3NTIA 2FPEA 3JB9J 4A54A 1BCOA 4A63B 1H92A 3PT9A 3L2WA 4OGEA 4JJNK 5FRNA 2CS7A 2O88A 4C92G 3CMAQ 5GMKi 5GANg 3C95A 1NEGA 2NWMA 3OA6A 5DLOA 4PJOE 2L3QA 2XHCA 2DYBA 2D0QB 5IN1A 1W1FA 5KYNA 1VUBA 1M9SA 1PWTA 2EYXA 1VQKT 3CXCS 3VS7A 1WFWA 2MYSA 2K3YA 4C8QE 4XAXB 1WJSA 1VQ7Q 3RR6A 2M51A 1BYMA 1JRIA 1VQ8Q 3L2QA 4JS5A 4LD6A 4M75G 3CCQQ 2DKGA 5GAOq 5IXFA 1QQJA 1RLQC 5IHIA 5CKFA 4E6RA 4DBRA 5LL6S 5LJ3g 3EHQA 9ATCB 3LW5E 4PJOA 4X1VA 4M78G 2RK2A 1SPKA 5KYXA 2ROLA 2RQRA 2O2OA 5CO7A 5DY9A 3CMEA 2L2PA 4QKUA 1VYTA 3VS0A 3MP6A 2ED0A 4RTZA 2CP6A 4N0AA 5FW9A 2RNAA 2WSEE 5CKBA 1AD5A 3JV3A 2KVQG 5CIUA 4LDVA 3QUIA 2FB7A 5LJ3h 1RL2A 2VC8A 3UA7A 1H641 2DBKA 1QCFA 3VJPA 1YJWT 1PKSA 1MMNA 1ZUKA 2LDMA 2L3PA 1RACB 3HHTB 4KGVB 3OBYA 3M53A 2OTLA 1NPPA 2X35A 2QQRA 3H0IA 5LJ3d 4HXJA 3MEWA 2KY9A 1BI3A 1WXUA 3DKMA 2JZ2A 5FWCA 4JRIA 3CCJT 3S3NA 2HKNA 5I2MA 3KXTA 3TU4K 2KYMA 3V7RA 5KE3A 4OMNA 1UGVA 3JCMf 1SSFA 2F5TX 1E6GA 4N4GA 4OMPA 1X75C 1JJ2A 3A8HB 2LJ3A 1YHQQ 3TREA 3FDRA 2QASA 3RNJA 4AT1B 1VQLT 1WNLA 3E19A 2EJFA 4IUVA 2CP2A 2XIDA 4OB2B 4E7SA 4F7UF 1G3SA 2COYA 2JT4A 1BIAA 5GANe 2QQSA 5AT1B 4XTWA 3H0HA 3OMCA 1N5ZA 1ZLMA 1JQQA 1Y71A 4M77A 5GJVB 3O8VA 3EG2A 1ZA2B 2DXTA 1UG1A 2VUBA 4KGZB 3RESA 4V2SA 1W2BP 2PZ1A 2LCSA 1GXIE 4J9IA 2LQNA 2F69A 2BUDA 1PSEA 4NOYA 1VQ9A 2KBTA 3REAB 1YHQA 2IIMA 1VQPT 4E2FB 3I56T 2XU8A 3R6NA 3UA6A 2DFUA 3QPHA 4DEXA 4M4ZA 3GOXA 2DK3A 5GAMj 3A98A 1X6BA 5IH2A 5HK3A 3GBQA 3HL8A 2HDAA 2FRYA 3NTKA 2MWOA 2J7IA 1TOVA 1PKTA 3H0FA 3ULRB 3TCJA 4FYXB 1RAGB 3OS5A 1MHNA 5KCOA 4HA8A 1LNXA 1FX7A 3OMGA 2E1HA 2JMAA 3I5RA 3CCVQ 3EGXA 3CMET 3N5BB 4C92B 4Z8AA 2ZZDA 1UJYA 3CCQA 2P0QA 5GAN2 2DBMA 4JRPA 2FO0A 8ATCB 1GFDA 5I22A 3OYEA 3CC7Q 1YNZA 4C8QF 3C12A 2YRVA 2DRMA 1R77A 2QA4T 2DXUA 5IHNA 1C0MA 2EQMA 2J6FA 1U8RA 1OU8A 1WLPB 3HFNA 2QEXT 1WXTA 3JCMX 3SEMA 3CCSA 2DVJA 4XTXA 3GIBA 4AG2C 3HTRA 2O01E 4F14A 1QVGS 4PJOF 3NGPA 2P4TA 1UGQB 4D8KA 1ZUUA 2LNVA 1KQSP 3CCEQ 2D8JA 2QQAA 3CEYA 3JB9F 2O4XA 4EMGA 2F1LA 2CZ7B 1TS9A 1JJ2P 1GCQC 1TH7A 4ELYC 2ABLA 3MO8A 1N8RC 3MEAA 1N9RA 1OV3A 4HCBA 2O31A 3QG1A 3CC4T 1BK2A 1QWEA 5CVIA 4M77D 3QSUA 5C6SA 2LJ1A 4ZN3A 4JPBW 1V29B 4CRIA 2F2XA 3CCSQ 2KI7A 5LJ3j 2FL7A 1D3BA 4RTTA 1WX6A 3MEUA 1VQOQ 2XDPA 2YDLA 4C0FA 2RMOA 4D8DA 3RERA 2JJ9A 1I5OB 4OP0A 1LPLA 3MCAB 4NL2A 1M1KR 3ZEHA 1U1SA 4A4HA 4Z02A 4KH1B 4EMKC 4DA4A 3H6ZA 4KT0E 3BY7A 2QK0A 2CSIA 2EGAA 1IXDA 5KE2A 4LNPA 3RKWA 4MDWA 2I2LA 2CH4A 3ZFJA 2PVDB 1YIJA 3JCMW 3SB2A 2JOYA 2K7AA 1M1FA 4M7AF 4AFSC 3S3MA 1IZ6A 4E7HA 4HCZA 3CCET 3CCJA 1TWBA 2DL8A 1X27A 2OX7A 1I5LA 3L2UA 4RMOA 2DXCA 4WTOB 4E7JA 2V26A 4QQDA 5FROA 2FZCB 2JW4A 1D09B 1A0NB 1YJNQ 5GJWB 4ATOA 1K9MR 4N0AC 4P5NA 3VYHB 2KAFA 3A8LB 1ACMB 3S3OA 3VRYA 2LZ6B 4DBHA 3GP8A 2Y4XA 2EFIA 3A5ZB 3S6WA 1B3QA 3EGUA 4AFUC 4M78F 3GLXA 1PCXA 2V8KA 3QWYA 1T3LA 3PE0A 1K73R 1SF9A 1XOVA 3OSSC 1GCPA 1U1TA 1WI7A 5GAN3 2RJFA 1KD1R 1S72T 1NZ9A 2VXFA 1UE9A 4M78E 3CCLA 4PNOA 1IO6A 3VS3A 4OB3B 1JO8A 2HEQA 2EYQA 4Z88A 3L42A 4M7DE 1M90C 1KFZA 3MKDA 2K79A 1Q86R 4K11A 3BW1A 4X9DA 2FZKB 5CCAA 3I56Q 1IRXA 4FT2A 4BDZA 2RI2A 4FYVB 1NYFA 3CPWP 1RAIB 3JCMV 2ESWA 5LJ5h 1WDXA 5DM7R 1VQ6T 2DX1A 2DL7A 5D7UA 4D6WA 4E7IA 2WACA 4J83A 1MMAA 2XG8D 4HT9A 2RHUA 2W10A 1QWFA 3EG9B 2GNCA 4M78C 1YP5A 1UHFA 2QXFA 5A2QE 4BACA 2L0AA 3LX7A 3M54A 3OYIA 1UUEA 2LTOA 2V8IA 2RQTA 1R0BG 3FRNA 4C0GA 2XI9A 1M3CA 2MAMA 1W2BA 3TQ7P 1YWOA 2DIQA 5LJ5g 1NG2A 2V8JA 2EGCA 2SEMA 3VUBA 1ZHIA 2QDYB 5FU7C 2PU9B 2P0KA 2C06A 3GNGA 3OYLA 4LDWA 4GBQA 1E7OA 2CP7A 2DEUA 2EPDA 1TG0A 4NL3A 2JVVA 4M75D 2EJGA 2KRMA 3SFMA 1YJNA 2K4YA 3JCMb 2LMJA 2Z0WA 2Y4YA 4C0ZA 2RH2A 4PJNA 1VQNT 4BD3A 1LJOA 4OGCA 3TSZA 2XKOC 3VV0A 3VS5A 2QEXQ 3M5AA 1V1CA 3OS0A 2BZXA 3CD6T 2KYBA 2VKNA 3I5SA 4M77B 3FIFA 5GAN5 2GFAA 2HZYA 1HD3A 2LQKA 1OOTA 3OW2A 1KK7A 1WIEA 1VQ4A 1M90R 1WPYA 4PFOA 2DJQA 3JAME 4JDSA 1GFCA 3G6ET 2ED1A 2DVEA 4KUDK 4XTUA 3CCST 2LCCA 4C92C 3OYJA 2HD0A 2EGEA 1RAEB 3LYIA 1M30A 2M02A 1VQNA 5KYYB 4QVDA 1MNEA 1EIFA 3RMQA 1SHFA 2X9HA 4JJBA 5LJ5j 4JZ3A 2HL5C 2YHTA 1XJWB 1OPLA 1EX4A 3CMAA 1WHLA 2DERA 1VQ5T 3M0RA 4C5HA 4FYWB 1I0CA 2P84A 2RB6A 3WXMB 2X3WD 4C92D 1HJDA 3I55T 2YLCA 1TUCA 2HQEA 3CC4A 1OULA 3EG1A 2DD4A 1PRMC 1PM3A 3E9GA 1UB4A 1JXOA 2EAYA 4ZNXA 4J6YA 2XD0A 3OY9A 2KT8A 3J81E 4J9GA 1VQPA 3DLLA 2ZCFB 1HYOA 1YHQT 3A8MB 1GRIA 3CMEQ 1SRMA 2B8AA 3PVQA 4Y92A 5AYFA 2QA4A 1XQHA 1NYGA 2ZPBB 2LP5A 1HSQA 4GLMA 3G71Q 1YI2A 1E6HA 2DNUA 5J26A 5EG2A 3CXCA 2GF7A 2FG0A 2DL4A 3CC2T 2K6DA 4TVRA 1Q81U 3M0UA 2RN8A 4C8QC 3QIIA 3FJPA 1KSWA 4FM4B 1TXQA 4ME7A 4E7LA 1YITQ 3JB9G 5GAOn 1WGSA 3JB9D 1Q7YU 2P0PA 3X20B 2EQUA 2DTIA 1UDLA 1B7TA 2E4HA 4BE2A 2ECZA 1UFFA 4FL6A 5GMKe 2AKKA 3X25B 3LGFA 3PMTA 1D0ZA 2BIVA 3CCRA 2DMOA 3RDVA 3NFCA 1T0JA 5KCHA 4VUBA 1YJ9T 2KNBB 2C0OA 5GAMf 2CP0A 4M78A 1CKAA 4PJOG 1W4SA 2X4JA 1K9MU 3QDRB 2DL5A 2CP3A 1S1NA 3J7AF 1VYVA 5GMKl 3CC4Q 2VXEA 4IURA 1AWXA 2BTTA 4GY5A 4M75A 1M2VB 4XTVA 2A28A 2AKLA 4C0DC 4M77E 4XQ3A 1AZGB 3OYAA 2COZA 2GQIA 5GAN4 4DOVA 5GAOl 3V8JA 3PTAA 2AHJB 4PL6A 3QZ9B 3UWNA 3VS6A 3JCMJ 2RJCA 2QGGA 2E6NA 3GF5A 2HAXA 2AIRB 3CC7T 1M8VA 3QJ6A 1N27A 2DETA 2QA4Q 1K9AA 5GAMh 1NEBA 1YI2T 1YBYA 2M16A 3ZL7C 4JJDA 4PLIA 2QYZA 1JBMA 4FSXA 5KH6A 1TU0B 1RAAB 3U23A 2QTXA 2LJ0A 3MHXA 1C1AA 4R56A 1KC8U 3C0CA 5CKHA 3JB9I 2E70A 3OYHA 5KYYA 2CKKA 2EQIA 4PFZA 3HFOA 1H8KA 2AT1B 3V7SA 3HRUA 2DE0X 2A7YA 3CBMA 3QWXX 4J6WA 2K2VA 1AWWA 1EZZB 2NUTB 5M9OA 1PSFA 1R0CB 4CI0C 2YUQA 1TUGB 1T3SA 3QXEB 4F04B 1VOMA 4FCYA 2DPPB 2ZPFB 1VQ8A 3MJXA 3SWNA 3CMAT 4M7AA 1YJWA 1AVZC 2JTFA 2O9VA 1NPRA 1LOJA 2A08A 4C0DB 3MP8A 3WVDB 3G4SA 1JEGA 1OEBA 3EFRA 1WHMA 3OYGA 2BE9B 2GFUA 3REBB 4C8QB 2YXYA 5FWBA 2ZPEB 5DLQE 3EG3A 1YN8A 1Y57A 3CD6Q 1M3AA 3UDCA 5EC7A 3VUZA 2IG0A 4J7IA 3EG9A 4DBFA 1OZ3A 3G4SQ 1VQMT 7AT1B 1Y96B 2MMPA 3PNWC 5HCKA 5HK0A 4QQGA 3OYYA 1B07A 1ZSZB 1VQKA 4M7AE 2E3HA 2GBQA 2YRCA 4L59A 1UGRB 2R5AA 4M7DB 1YITA 2DLPA 1D0YA 4KUIA 1S72A 1D1AA 1QKWA 1U3OA 1X6OA 3JRZA 4II1A 3VKIA 4ZTJA 1XNIA 3J80E 1QCNA 3NHNA 2EQJA 1OQKA 1UHCA 1ZSGA 1F1BB 4X34A 4QVCA 2H3EB 1KIKA 2LX7A 3EG0A 1RLPC 2DJZA 3ME9A 1ARKA 2LQWA 2DAQA 2Y90A 3LH5A 2EW3A 5LJ3f 1YIJQ 1Z9ZA 2FZGB 4B9XA 2ZPHB 4RG2A 3UATA 1M3BA 2MOXA 5A0GA 3G6EQ 2R57A 3PIOA 1VQ6A 2E12A 4M7AD 1WZOA 3CCJQ 1I07A 1G8XA 1BI2A 2D9TA 2GTJA 2QQ9A 3ZBDA 4JLGA 1Y96A 2VVKA 3JCMc 2CREA 1AOJA 3NTHA 2X4WA 2ZPGB 1I81A 3E9FA 3V8LA 1K73U 1D3BB 2VWFA 1HXDA 3EGDA 1VQ5A 4EDUA 2K3BA 3VRZA 2JUFA 2LT1A 3TSWA 2E6ZA 4M75F 2J05A 2DZ9A 3MP1A 2GQVA 4M78B 1G3YA 2QGFB 4RTYA 3I55Q 1BKBA 2IVWA 4PJOC 3CC2Q 4AMCA 3G1JA 1WHJA 2NUPB 1KQSA 5I21A 4C5EA 1BI1A 4XK8E 4M7DD 3EH2A 2K57A 3X26B 3CCMA 2EKHA 4FT4A 5GANd 2EYYA 2SRCA 3CCRT 1QVFS 1GBRA 1IGUA 1JJ2S 1RAHB 4RG8A 4J9DA 2OTLT 1D1CA 1TSFA 8AT1B 1FMVA 5GAN6 4PKCC 2D8HA 2YUOA 1M90U 2VV5A 1WJQA 1VQ8T 5HY6A 2E64A 3A8GB 1VQKQ 1BI0A 2LC4A 3CCQT 5GAMe 3CXCP 4MZPA 4M75B 3CCUQ 1OZ2A 2QEXA 2KE9A 1JB0E 4N4HA 1Q81R 5GAMg 2ENMA 1LCKA 2B86A 4J9HA 2VGMA 4C8QA 2ZAEA 3D7SB 4JRKA 3G4ST 1VQMQ 4Y91A 1QVGA 1K73C 2OTJA 3VU3C 3X24B 2M9UA 2EVRA 4JZ4A 3E2UA 5CKEA 5J39A 3CCUA 2RA2A 4GLKA 5C0MA 4HVUA 4DQ2A 2JMCA 3LGLA 5FU7B 1O9SA 4ZTFA 3TEEA 3A8OB 3EFOA 5D6XA 2DL3A 1SHGA 1B34B 3I56A 2A3LA 2X4YA 4RCCA 2HSPA 1ZUYA 2J06A 4CC7A 4OF1A 5A0DA 1UJ0A 2DYIA 1R8OB 3GPLA 2DA9A 3X28B 2LX9A 1YCYA 3P8HA 3SWNB 3OYCA 1EFNA 3I55A 1N8RR 4FW1A 1FXXA 2DD5A 2DM1A 1JU5C 4A53A 3PMIA 3META 1WHHA 1S72Q 2PUKB 4IIMA 3I35A 3H9NA 2G3RA 3QJYA 3RMSA 3JCMQ 2H3JA 1VQ4Q 5J3BA 2YUNA 1NJIU 2EIFA 1SKUB 4LUDA 1AWJA 4HCCA 1KQ2A 2L3RA 2XDBA 4MDXA 2RK1A 1WHGA 4PLLA 1M1KU 1X01A 2H8HA 4CC4B 3NPFA 4BY6B 5KYXB 3OYFA 1RUWA 4RTWA 1J3TA 2R58A 4M7AC 2RJEA 3FC3A 1K1ZA 1RI0A 1GCQA 1Y7XA 3G6EA 1VQ6Q 2FYKA 4L6V5 4M77G 5GAOr 3CPWA 3VYGA 5CK9A 1QVFP 4QVZA 2EQKA 3A1PA 5GAOp 3H41A 5CKDA 1PNJA 3JSCA 1D0XA 4IKFA 4BUGA 2DEQA 2OTJT 1IHVA 4RTXA 3QHSA 1GBQA 3ER0A 4M75E 2QQBA 3OS2A 3HSBA 5KYUB 3G71A 1YI2Q 1K9MC 1KD1C 4OVAA 1K76A 2YWWA 2RJDA 2VYTA 2QTVA 4M7AG 1IB8A 3LLRA 2JN0A 2VB6A 4OMLA 2L3SA 3CC2A 4XU2A 3QO3A 2NUTA 4LXCA 3GNFB 3BDUA 5GANj 1Q81C 4M7DF 1KD1U 4F7UB 1KG1A 1D1BA 1WQ7A 1Q7YC 1K0SA 1ZBXA 1OI1A 2LCLA 4HVWA 2RO0A 4FYYB 5CQXA 2CZ0B 1X69A 1Q95G 2YSQA 2LQ8A 3OS1A 2JM8A 1MUZA 2I0NA 2KSSA 1QLYA 2HNIA 4C5GA 3URGA 3R6OA 4PFPA 4UC4A 3O5ZA 2KXCA 3JCMe 5IT9E 1NE8A 4BI4A 4MMLA 5L23A 5KYUA 2M0YA 4BI3A 3F70A 4ZGEB 3JCMg 2K5IA 4M77F 5LJ5f 3FEOA 1T0HA 2QDLA 3EFOB 2O4XB 2PQWA 1VQLQ 1FMWA 2M1HA 4FU6A 2X51A 2M0OA 4DBQA 3CCVA 2YRDA 4XU3A 1VA7A 1OU9A 3JCMh 1KJWA 3VS2A 3V7CA 3M0SA 2NYSA 3OYKA 4J9EA 2GGRA 3RIRA 1KQSS 2NUPA 5I11A 3M4YA 3L2RA 1VQLA 2ROTA 3P8DA 2FHDA 2K3XA 4ESRA 1FYNA 4BDYA 4HKEA 1KC8R 4IUUA 2MK5A 4J6XA 4NS5A 4MMKA 2KDSA 2RHYA 1NM7A 1NLPC 2YT6A 1PHTA 3M56A 3UT1A 1QVFA 1K0XA 1X43A 2L8DA 4LDUA 4PJJA 1ABQA 3OW2S 3V8KA 1VQ7A 2E10A 3BE3A 3QBYA 1Q82C 3HPWA 1M5Q1 2EKOA 5FRMA 1Y0MA 3RKXA 1PD1A 2MIOA 2PNIA 3M0PA 2XDDA 3P8BB 4C92A 2MPXC 1YITT 4CC3A 1ZBJA 4JS4A 4WCIA 2FVUA 2XMFA 3INZA 1K4US 1X2QA 3FB9A 4BB7A 2KEAA 1PRLC 3IQLA 3CCMT 5IHKA 5LJ5d 5GAN8 2LRQA 1VQOA 2EJ9A 2RF0A 1V76A 5LJ3e 1SEMA 2GTOA 3I9QA 2JNGA 4Z89A 3AHUA 3Q1JA 4OMMA 1KHIA 1RADB 5D6YA 3OYBA 1B34A 2RI5A 3CD6A 3RUXA 1SG5A 2W0ZA 4O5VA 2CDTA 1U5SA 2PVOB 3HRSA 2OJ2A 1WHKA 2KROA 4OMOA 4L5GA 1YFNA 5GANf 3HRTA 2L89A 1IGQA 4JJCA 1BU1A 3M58A 1TTHB 1VQ9Q 3EH1A 2HQHA 4PK4A 4OB1B 2OTJQ 1ZX6A 1Y07A 1MV3A 1M4ZA 1H3ZA 1WQWA 3CCLT 2V1RA 3EAEA 1QVPA 2CUBA 3CPFA 2RQUA 2E3IA 5IXBA 4WF2A 4F7UE 4FW2A 1LVKA 4BI8B 3CBPA 3CPWS 1W6XA 3PGGA 1RI9A 2BE7D 4PJLA 2V1QA 2D1XA 2LNHB 3LWHA 4A4FA 1K8AC 1ABOA 2RQVA 2D6FA 1YWPA 2P4RA 2LVMA 3LH0A 2FPFA 1BIBA 4QT7A 3VS4A 4E47A 2F2VA 2FEIA 1U06A 2QI2A 1DJ7B 2COWA 2HBWA 1YJ9A 3PIPA 4E7ZA 1AEYA 1N6AA 2MCNA 4JRQA 4XTYA 4RUGA 3HP9A 3JCMd 2K2MA 2JM9A 2G6FX 4OMQA 3EGXB 3WVEB 1AZEA 2A37A 3TVTA 1NBEB 2KK4A 3FLGA 4LDXA 3UPUA 2HMAA 1X6GA 3OYMA 3CQTA 4HCKA 1UGPB 3SDZA 4O6JA 2X3XD 1VIEA 4ZGJB 3M0TA 1Q86U 2GCXA 2ATCB 2MWPA 5IAYA 3JB9H 1OPKA 2OI3A 1YJ9Q 2J6KA 1PC0A 1XTDA 6AT1B 4M78D 2YUPA 3FJ5A 4B9WA 3UF4A 4DEYA 1CSKA 4J7FA 2HKQB 4A4GA 1Q86C 2K5LA 4LE9A 4AFZC 2RHZA 2CUDA 3RKYA 1WYXA 3ASKA 3QYGB 1W70A 2FPDA 3L1AA 3SD4A 2LT4A 4LD9K 3EHRA 1I8FA 4XU1A 1BCMA 5ECAA 3PVLA 3QKJA 2QAZA 2CYZB 4IUPA 2K5FA 4BY6C 2EWNA 4JUVA 2KR3A 1I1JA 4ELZC 3C94A 1WA7A 2JS0A 1N9SA 5GMKj 2HQXA 5FLXE 2OAUA 2PVGB 2E5KA 2DILA 5GMKm 2CP5A 1VQ9T 3CCVT 3CCRQ 4C5IA 3CC7A 3EFSA 3CCEA 4A4KA 1CKBA 1O75A 2CZ1B 4M77C 4LN2A 1QW1A 2L5QA 1OYXA 4HT8A 2NUZA 3OYDA 3QDFA
chains in the Genus database with same CATH topology
2JS2A 2DRKA 2DM1A 5GJVB 1JU5C 4R0KA 3EG2A 1GRIA 1SRMA 1UTIA 4IIOA 1UG1A 4IIMA 3PVQA 1WXBA 4Y92A 3I35A 4J9CA 2PZ1A 1NYGA 2LCSA 4J9IA 2LQNA 2LP5A 2YUNA 1HSQA 4GLMA 2F2WA 2KBTA 4LUDA 1AWJA 3REAB 2IIMA 2C0TA 1E6HA 3R6NA 2DNUA 3UA6A 2H8HA 4CC4B 3NPFA 4DEXA 4M4ZA 1RUWA 4RTWA 1J3TA 3A98A 2CSQA 2FG0A 2KXDA 2DL4A 1K1ZA 2K6DA 1GCQA 3M0UA 1M27C 1X6BA 2RN8A 5IH2A 3VS1A 3GBQA 1KSWA 2HDAA 2FRYA 2J7IA 3ULRB 1PKTA 3H0FA 3H41A 1FMKA 3THKA 1PNJA 2AZSA 4RTXA 1UDLA 2JMAA 3I5RA 1Z9QA 1GBQA 2ECZA 1UFFA 2K9GA 2CT4A 4Z8AA 2KT1A 1UJYA 2FRWA 2AKKA 1K76A 2DBMA 2FO0A 2DMOA 1GFDA 5I22A 1T0JA 1YNZA 2DRMA 4RTVA 2KNBB 5IHNA 2J6FA 2C0OA 4OMLA 2L3SA 1WLPB 1WXTA 1CKAA 3SEMA 2DVJA 2EYWA 4AG2C 2EYZA 2DL5A 4F14A 2BZYA 4EIKA 3NGPA 1S1NA 1K0SA 1VYVA 4D8KA 1ZUUA 4HVWA 2D8JA 1X69A 1AWXA 2BTTA 2D0NA 2YSQA 2A28A 1G2BA 2JM8A 1MUZA 2I0NA 1QLYA 2AKLA 3O5ZA 1AZGB 4F16A 2KXCA 1GCQC 2ABLA 2KRNA 2GQIA 1OV3A 2O31A 5L23A 4CC2A 1BK2A 1X2KA 1QWEA 4F17A 2M0YA 2JXBA 2LJ1A 3VS6A 2JTEA 4JPBW 4KRTA 2F2XA 1T0HA 4J9BA 2QDLA 3M0QA 3RBBB 4RTTA 1K9AA 1WX6A 1NEBA 2YDLA 2RMOA 4D8DA 3ZL7C 1BBZA 4JJDA 1VA7A 4FSSA 2OAWA 1KJWA 3VS2A 2KRSA 2AK5A 3M0SA 1QKXA 2CSIA 2EGAA 3U23A 4J9EA 2GGRA 2LJ0A 4LNPA 2CH4A 3C0CA 2CT3A 5I11A 2ROTA 1H3HA 4ESRA 2K7AA 4AFSC 1FYNA 1BB9A 1TUDA 2EQIA 1H8KA 2HCKA 4LUEA 2J6OA 1AWOA 2DL8A 1G83A 1X27A 1NM7A 2DE0X 1NLPC 2YT6A 1PHTA 3QWXX 3NMZC 1K0XA 1SSHA 2C0IA 2RPNA 2CH4W 2JW4A 1A0NB 1UECA 5GJWB 1AWWA 1X43A 4AFQC 2PTKA 1ABQA 3VRYA 2LZ6B 2YUQA 1M8MA 4RTUA 2RQWA 1T3SA 1SRLA 1B3QA 3EGUA 4AFUC 1Y0MA 2MIOA 1AVZC 2PNIA 3M0PA 2DF6A 3QWYA 3SHWA 2EBPA 2O9VA 1T3LA 3PE0A 1YCSB 4CC3A 4J9FA 1XOVA 2A08A 1ZBJA 4AG1C 2BZ8A 1GCPA 2O9SA 4WCIA 1JEGA 1OEBA 1WI7A 3KFVA 2XMFA 1K4US 1UE9A 1X2QA 1JXMA 3REBB 2KEAA 1PRLC 3IQLA 1IO6A 3VS3A 1JO8A 5FWBA 5IHKA 2HEQA 1GL5A 3EG3A 1YN8A 1VYUA 1Y57A 1M3AA 4Z88A 5EC7A 1KFZA 2K79A 4K11A 2AZVA 2RF0A 2KGTA 1SEMA 5HCKA 2GTOA 2A36A 3I9QA 1MV0B 1B07A 4Z89A 2GBQA 1NYFA 4OMMA 2DLPA 1QKWA 2ESWA 1U3OA 1WDXA 2W0ZA 2CDTA 4ORZA 1U5SA 2DX1A 2DL7A 2OJ2A 2KROA 3NHNA 4OMOA 1UHCA 1ZSGA 4JJCA 1NLOC 4HVVA 1KIKA 2LX7A 1BU1A 3EG0A 2FPEA 1RLPC 2W10A 1QWFA 2GNCA 1ARKA 2LQWA 4A63B 1YP5A 1H92A 1UHFA 3LH5A 1ZX6A 2EW3A 1MV3A 2L0AA 2O88A 1UUEA 2V1RA 2CUBA 1Z9ZA 2RQUA 2RQTA 1NEGA 5IXBA 3UATA 2NWMA 1M3BA 2MOXA 2L3QA 1W6XA 1M3CA 1RI9A 1I07A 2DYBA 1W1FA 1YWOA 2V1QA 2GTJA 1PWTA 2D1XA 2EYXA 1NG2A 2LNHB 2VVKA 2EGCA 2SEMA 3VS7A 2CREA 1AOJA 1WFWA 1ABOA 2RQVA 2M51A 1YWPA 2P4RA 4GBQA 1E7OA 2VWFA 2FPFA 4QT7A 2EPDA 1TG0A 3VS4A 2K3BA 3VRZA 2F2VA 2FEIA 1U06A 2KRMA 3TSWA 2HBWA 5IXFA 2J05A 1RLQC 5IHIA 2LMJA 1AEYA 4E6RA 4RTYA 2MCNA 3EHQA 4X1VA 4RUGA 1SPKA 3TSZA 2ROLA 2K2MA 2RQRA 2JM9A 2O2OA 3VS5A 2G6FX 4OMQA 1V1CA 2L2PA 1AZEA 1VYTA 2BZXA 2A37A 2KYBA 2VKNA 3TVTA 3VS0A 2ED0A 3I5SA 4RTZA 2EKHA 1HD3A 5FW9A 2RNAA 1X6GA 1OOTA 2EYYA 3CQTA 1WIEA 4HCKA 2SRCA 1AD5A 1GBRA 3JV3A 2X3XD 4J9DA 3M0TA 2DJQA 1GFCA 2ED1A 1OPKA 2OI3A 2D8HA 2J6KA 3UA7A 2YUOA 2DBKA 1QCFA 2EGEA 2YUPA 1PKSA 1M30A 3FJ5A 1ZUKA 2L3PA 3UF4A 4DEYA 1CSKA 2KE9A 4LE9A 1SHFA 4JJBA 4AFZC 4JZ3A 2CUDA 2ENMA 1WYXA 1LCKA 3H0IA 1OPLA 1W70A 2B86A 4J9HA 2FPDA 3M0RA 4HXJA 1I0CA 3EHRA 1WXUA 5FWCA 5ECAA 3PVLA 2EVRA 4JZ4A 2KYMA 2X3WD 1HJDA 4HVUA 2KR3A 4OMNA 1UGVA 2JMCA 1I1JA 1TUCA 1WA7A 2JS0A 1E6GA 3EG1A 4OMPA 2DL3A 1SHGA 1PRMC 2HSPA 1ZUYA 2J06A 4CC7A 2LJ3A 2E5KA 2DILA 1JXOA 3RNJA 4ZNXA 1UJ0A 2KT8A 2DA9A 2JT4A 4J9GA 1CKBA 4LN2A 3H0HA 1N5ZA 1EFNA 1ZLMA 1JQQA 2NUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JS2 A;  2DRK A;  2DM1 A;  5GJV B;  1JU5 C;  4R0K A;  3EG2 A;  1GRI A;  1SRM A;  1UTI A;  4IIO A;  1UG1 A;  4IIM A;  3PVQ A;  1WXB A;  4Y92 A;  3I35 A;  4J9C A;  2PZ1 A;  1NYG A;  2LCS A;  4J9I A;  2LQN A;  2LP5 A;  2YUN A;  1HSQ A;  4GLM A;  2F2W A;  2KBT A;  4LUD A;  1AWJ A;  3REA B;  2IIM A;  2C0T A;  1E6H A;  3R6N A;  2DNU A;  3UA6 A;  2H8H A;  4CC4 B;  3NPF A;  4DEX A;  4M4Z A;  1RUW A;  4RTW A;  1J3T A;  3A98 A;  2CSQ A;  2FG0 A;  2KXD A;  2DL4 A;  1K1Z A;  2K6D A;  1GCQ A;  3M0U A;  1M27 C;  1X6B A;  2RN8 A;  5IH2 A;  3VS1 A;  3GBQ A;  1KSW A;  2HDA A;  2FRY A;  2J7I A;  3ULR B;  1PKT A;  3H0F A;  3H41 A;  1FMK A;  3THK A;  1PNJ A;  2AZS A;  4RTX A;  1UDL A;  2JMA A;  3I5R A;  1Z9Q A;  1GBQ A;  2ECZ A;  1UFF A;  2K9G A;  2CT4 A;  4Z8A A;  2KT1 A;  1UJY A;  2FRW A;  2AKK A;  1K76 A;  2DBM A;  2FO0 A;  2DMO A;  1GFD A;  5I22 A;  1T0J A;  1YNZ A;  2DRM A;  4RTV A;  2KNB B;  5IHN A;  2J6F A;  2C0O A;  4OML A;  2L3S A;  1WLP B;  1WXT A;  1CKA A;  3SEM A;  2DVJ A;  2EYW A;  4AG2 C;  2EYZ A;  2DL5 A;  4F14 A;  2BZY A;  4EIK A;  3NGP A;  1S1N A;  1K0S A;  1VYV A;  4D8K A;  1ZUU A;  4HVW A;  2D8J A;  1X69 A;  1AWX A;  2BTT A;  2D0N A;  2YSQ A;  2A28 A;  1G2B A;  2JM8 A;  1MUZ A;  2I0N A;  1QLY A;  2AKL A;  3O5Z A;  1AZG B;  4F16 A;  2KXC A;  1GCQ C;  2ABL A;  2KRN A;  2GQI A;  1OV3 A;  2O31 A;  5L23 A;  4CC2 A;  1BK2 A;  1X2K A;  1QWE A;  4F17 A;  2M0Y A;  2JXB A;  2LJ1 A;  3VS6 A;  2JTE A;  4JPB W;  4KRT A;  2F2X A;  1T0H A;  4J9B A;  2QDL A;  3M0Q A;  3RBB B;  4RTT A;  1K9A A;  1WX6 A;  1NEB A;  2YDL A;  2RMO A;  4D8D A;  3ZL7 C;  1BBZ A;  4JJD A;  1VA7 A;  4FSS A;  2OAW A;  1KJW A;  3VS2 A;  2KRS A;  2AK5 A;  3M0S A;  1QKX A;  2CSI A;  2EGA A;  3U23 A;  4J9E A;  2GGR A;  2LJ0 A;  4LNP A;  2CH4 A;  3C0C A;  2CT3 A;  5I11 A;  2ROT A;  1H3H A;  4ESR A;  2K7A A;  4AFS C;  1FYN A;  1BB9 A;  1TUD A;  2EQI A;  1H8K A;  2HCK A;  4LUE A;  2J6O A;  1AWO A;  2DL8 A;  1G83 A;  1X27 A;  1NM7 A;  2DE0 X;  1NLP C;  2YT6 A;  1PHT A;  3QWX X;  3NMZ C;  1K0X A;  1SSH A;  2C0I A;  2RPN A;  2CH4 W;  2JW4 A;  1A0N B;  1UEC A;  5GJW B;  1AWW A;  1X43 A;  4AFQ C;  2PTK A;  1ABQ A;  3VRY A;  2LZ6 B;  2YUQ A;  1M8M A;  4RTU A;  2RQW A;  1T3S A;  1SRL A;  1B3Q A;  3EGU A;  4AFU C;  1Y0M A;  2MIO A;  1AVZ C;  2PNI A;  3M0P A;  2DF6 A;  3QWY A;  3SHW A;  2EBP A;  2O9V A;  1T3L A;  3PE0 A;  1YCS B;  4CC3 A;  4J9F A;  1XOV A;  2A08 A;  1ZBJ A;  4AG1 C;  2BZ8 A;  1GCP A;  2O9S A;  4WCI A;  1JEG A;  1OEB A;  1WI7 A;  3KFV A;  2XMF A;  1K4U S;  1UE9 A;  1X2Q A;  1JXM A;  3REB B;  2KEA A;  1PRL C;  3IQL A;  1IO6 A;  3VS3 A;  1JO8 A;  5FWB A;  5IHK A;  2HEQ A;  1GL5 A;  3EG3 A;  1YN8 A;  1VYU A;  1Y57 A;  1M3A A;  4Z88 A;  5EC7 A;  1KFZ A;  2K79 A;  4K11 A;  2AZV A;  2RF0 A;  2KGT A;  1SEM A;  5HCK A;  2GTO A;  2A36 A;  3I9Q A;  1MV0 B;  1B07 A;  4Z89 A;  2GBQ A;  1NYF A;  4OMM A;  2DLP A;  1QKW A;  2ESW A;  1U3O A;  1WDX A;  2W0Z A;  2CDT A;  4ORZ A;  1U5S A;  2DX1 A;  2DL7 A;  2OJ2 A;  2KRO A;  3NHN A;  4OMO A;  1UHC A;  1ZSG A;  4JJC A;  1NLO C;  4HVV A;  1KIK A;  2LX7 A;  1BU1 A;  3EG0 A;  2FPE A;  1RLP C;  2W10 A;  1QWF A;  2GNC A;  1ARK A;  2LQW A;  4A63 B;  1YP5 A;  1H92 A;  1UHF A;  3LH5 A;  1ZX6 A;  2EW3 A;  1MV3 A;  2L0A A;  2O88 A;  1UUE A;  2V1R A;  2CUB A;  1Z9Z A;  2RQU A;  2RQT A;  1NEG A;  5IXB A;  3UAT A;  2NWM A;  1M3B A;  2MOX A;  2L3Q A;  1W6X A;  1M3C A;  1RI9 A;  1I07 A;  2DYB A;  1W1F A;  1YWO A;  2V1Q A;  2GTJ A;  1PWT A;  2D1X A;  2EYX A;  1NG2 A;  2LNH B;  2VVK A;  2EGC A;  2SEM A;  3VS7 A;  2CRE A;  1AOJ A;  1WFW A;  1ABO A;  2RQV A;  2M51 A;  1YWP A;  2P4R A;  4GBQ A;  1E7O A;  2VWF A;  2FPF A;  4QT7 A;  2EPD A;  1TG0 A;  3VS4 A;  2K3B A;  3VRZ A;  2F2V A;  2FEI A;  1U06 A;  2KRM A;  3TSW A;  2HBW A;  5IXF A;  2J05 A;  1RLQ C;  5IHI A;  2LMJ A;  1AEY A;  4E6R A;  4RTY A;  2MCN A;  3EHQ A;  4X1V A;  4RUG A;  1SPK A;  3TSZ A;  2ROL A;  2K2M A;  2RQR A;  2JM9 A;  2O2O A;  3VS5 A;  2G6F X;  4OMQ A;  1V1C A;  2L2P A;  1AZE A;  1VYT A;  2BZX A;  2A37 A;  2KYB A;  2VKN A;  3TVT A;  3VS0 A;  2ED0 A;  3I5S A;  4RTZ A;  2EKH A;  1HD3 A;  5FW9 A;  2RNA A;  1X6G A;  1OOT A;  2EYY A;  3CQT A;  1WIE A;  4HCK A;  2SRC A;  1AD5 A;  1GBR A;  3JV3 A;  2X3X D;  4J9D A;  3M0T A;  2DJQ A;  1GFC A;  2ED1 A;  1OPK A;  2OI3 A;  2D8H A;  2J6K A;  3UA7 A;  2YUO A;  2DBK A;  1QCF A;  2EGE A;  2YUP A;  1PKS A;  1M30 A;  3FJ5 A;  1ZUK A;  2L3P A;  3UF4 A;  4DEY A;  1CSK A;  2KE9 A;  4LE9 A;  1SHF A;  4JJB A;  4AFZ C;  4JZ3 A;  2CUD A;  2ENM A;  1WYX A;  1LCK A;  3H0I A;  1OPL A;  1W70 A;  2B86 A;  4J9H A;  2FPD A;  3M0R A;  4HXJ A;  1I0C A;  3EHR A;  1WXU A;  5FWC A;  5ECA A;  3PVL A;  2EVR A;  4JZ4 A;  2KYM A;  2X3W D;  1HJD A;  4HVU A;  2KR3 A;  4OMN A;  1UGV A;  2JMC A;  1I1J A;  1TUC A;  1WA7 A;  2JS0 A;  1E6G A;  3EG1 A;  4OMP A;  2DL3 A;  1SHG A;  1PRM C;  2HSP A;  1ZUY A;  2J06 A;  4CC7 A;  2LJ3 A;  2E5K A;  2DIL A;  1JXO A;  3RNJ A;  4ZNX A;  1UJ0 A;  2KT8 A;  2DA9 A;  2JT4 A;  4J9G A;  1CKB A;  4LN2 A;  3H0H A;  1N5Z A;  1EFN A;  1ZLM A;  1JQQ A;  2NUZ A; 
#chains in the Genus database with same CATH topology
 4EMK A;  2JS2 A;  3T9N A;  2DRK A;  3M55 A;  1NJI C;  3OBW A;  3DB3 A;  3OW2 P;  4R0K A;  1RAB B;  2X4X A;  1KHC A;  3BFM A;  1UTI A;  4IIO A;  1Q82 R;  4MZT A;  1WXB A;  1N8R U;  4J9C A;  3OSV A;  3M57 A;  1QCO A;  1ZA1 B;  1VIF A;  1HK9 A;  5GAN 7;  1P92 A;  3OQ5 A;  2F2W A;  4QW2 A;  2IPO B;  4BE0 A;  4B6M A;  1UGS B;  4EPC A;  4C8Q G;  2C0T A;  3JCM P;  3PFS A;  2WSC E;  2KMT A;  3C4S A;  2CSQ A;  2KXD A;  3EGD B;  4XU0 A;  1I4K 1;  3QYH B;  1M27 C;  3VS1 A;  5LJ5 e;  1IRE B;  3CCL Q;  2ZPI B;  1MGQ A;  4YTL A;  1AHJ B;  4C92 E;  3AT1 B;  5CAI A;  1FMK A;  2CZ6 B;  3THK A;  2DO3 A;  2AZS A;  2WSF E;  4EMK B;  2E5Q A;  1Z9Q A;  2VAS A;  2DTH A;  5CR2 A;  1ZQ1 A;  2K9G A;  1VQM A;  2CT4 A;  1VQO T;  1ZSZ C;  4LDY A;  2KT1 A;  1M1K C;  2FRW A;  3HKS A;  3KUF A;  2OTL Q;  1MMD A;  1W2B S;  3CBO A;  4RTV A;  2XIC A;  3DLM A;  2RHI A;  2EYW A;  1QP3 A;  1YJW Q;  4XTZ A;  3BDL A;  2EYZ A;  4PJO D;  4M7D G;  3QZ5 B;  2BZY A;  1KC8 C;  4EIK A;  4J5Y A;  4IUT A;  5CQY A;  1UEB A;  1PG5 B;  3M9Q A;  2JTM A;  2D0N A;  3OYN A;  1G2B A;  5GMK h;  4KUL A;  4M75 C;  4C8Q D;  1K8A R;  3H8Z A;  4JLI A;  1VQN Q;  5A0L A;  5I2S A;  4F16 A;  4RKU E;  3L2V A;  4KGX B;  3M4G A;  2KRN A;  1RAF B;  4M7D A;  2RI3 A;  2E65 A;  4ANJ A;  2RHX A;  4CC2 A;  1X2K A;  4F17 A;  2JXB A;  1MMG A;  2HBP A;  4OB0 B;  2JTE A;  3OB9 A;  1Q82 U;  2DIG A;  4KRT A;  3E1S A;  4J9B A;  5D6W A;  2PUO B;  3M0Q A;  3RBB B;  5GAN h;  2MF2 A;  1M2V A;  5L8R E;  2DTO A;  1BBZ A;  3MEV A;  2E41 A;  5HKC A;  4J8O A;  1OX9 A;  2CGH A;  1G3W A;  1QMC A;  2OAW A;  4FSS A;  4F7U G;  4M7D C;  2KRS A;  2AK5 A;  4PJO B;  1QKX A;  3LWI A;  1KQ1 A;  1PD0 A;  5KYW A;  4QQ6 A;  1QVG P;  1QP2 A;  2CT3 A;  3CCM Q;  4E7K A;  4M7A B;  1YIJ T;  2ZGW A;  4N4I A;  4X9C A;  5KYW B;  1OX8 A;  1H3H A;  2RD1 A;  1BB9 A;  1TUD A;  3SWN C;  4ZGD B;  2HCK A;  1WJR A;  2J6O A;  4LUE A;  1AWO A;  1Q7Y R;  1G83 A;  5GAM d;  4DOW A;  3NMZ C;  1SSH A;  2C0I A;  2RPN A;  2CH4 W;  1M2O A;  5FU6 B;  2KQW A;  1UEC A;  4AFQ C;  2PTK A;  1C6V X;  4Y28 E;  4KBM B;  5GAO m;  1M8M A;  4IUQ A;  4RTU A;  2RQW A;  2YLB A;  4MZM A;  1VQ5 Q;  4A4E A;  1SRL A;  4BE1 A;  1M1G A;  2MI6 A;  2F5K A;  3G7Z A;  4EMH A;  2DF6 A;  3SHW A;  2EBP A;  2VGN A;  1ZSZ A;  1YCS B;  4J9F A;  4AG1 C;  2BZ8 A;  2O9S A;  3KFV A;  1G3T A;  2HSE B;  4F7U A;  4PJM A;  1JXM A;  2XK0 A;  2HL3 A;  4KH0 B;  1GL5 A;  1VYU A;  1VQ4 T;  1MND A;  1VQ7 T;  3CCU T;  3DB4 A;  4FIB A;  2AZV A;  4OMF B;  2BKD N;  3G71 T;  1VQP Q;  2RM4 A;  1K8A U;  2DZC A;  4C92 F;  2KGT A;  2A36 A;  1MV0 B;  1AT1 B;  1FWZ A;  2NLU A;  2A0F B;  3MPU B;  3KBG A;  4ZN1 A;  1YJN T;  2DXB A;  4ORZ A;  1NJI R;  4R55 A;  2R5M A;  3M59 A;  5FU6 C;  4Q5W A;  1G5V A;  1NLO C;  3L2Z A;  4HVV A;  4RCB A;  1IHW A;  2QG9 B;  3NTI A;  2FPE A;  3JB9 J;  4A54 A;  1BCO A;  4A63 B;  1H92 A;  3PT9 A;  3L2W A;  4OGE A;  4JJN K;  5FRN A;  2CS7 A;  2O88 A;  4C92 G;  3CMA Q;  5GMK i;  5GAN g;  3C95 A;  1NEG A;  2NWM A;  3OA6 A;  5DLO A;  4PJO E;  2L3Q A;  2XHC A;  2DYB A;  2D0Q B;  5IN1 A;  1W1F A;  5KYN A;  1VUB A;  1M9S A;  1PWT A;  2EYX A;  1VQK T;  3CXC S;  3VS7 A;  1WFW A;  2MYS A;  2K3Y A;  4C8Q E;  4XAX B;  1WJS A;  1VQ7 Q;  3RR6 A;  2M51 A;  1BYM A;  1JRI A;  1VQ8 Q;  3L2Q A;  4JS5 A;  4LD6 A;  4M75 G;  3CCQ Q;  2DKG A;  5GAO q;  5IXF A;  1QQJ A;  1RLQ C;  5IHI A;  5CKF A;  4E6R A;  4DBR A;  5LL6 S;  5LJ3 g;  3EHQ A;  9ATC B;  3LW5 E;  4PJO A;  4X1V A;  4M78 G;  2RK2 A;  1SPK A;  5KYX A;  2ROL A;  2RQR A;  2O2O A;  5CO7 A;  5DY9 A;  3CME A;  2L2P A;  4QKU A;  1VYT A;  3VS0 A;  3MP6 A;  2ED0 A;  4RTZ A;  2CP6 A;  4N0A A;  5FW9 A;  2RNA A;  2WSE E;  5CKB A;  1AD5 A;  3JV3 A;  2KVQ G;  5CIU A;  4LDV A;  3QUI A;  2FB7 A;  5LJ3 h;  1RL2 A;  2VC8 A;  3UA7 A;  1H64 1;  2DBK A;  1QCF A;  3VJP A;  1YJW T;  1PKS A;  1MMN A;  1ZUK A;  2LDM A;  2L3P A;  1RAC B;  3HHT B;  4KGV B;  3OBY A;  3M53 A;  2OTL A;  1NPP A;  2X35 A;  2QQR A;  3H0I A;  5LJ3 d;  4HXJ A;  3MEW A;  2KY9 A;  1BI3 A;  1WXU A;  3DKM A;  2JZ2 A;  5FWC A;  4JRI A;  3CCJ T;  3S3N A;  2HKN A;  5I2M A;  3KXT A;  3TU4 K;  2KYM A;  3V7R A;  5KE3 A;  4OMN A;  1UGV A;  3JCM f;  1SSF A;  2F5T X;  1E6G A;  4N4G A;  4OMP A;  1X75 C;  1JJ2 A;  3A8H B;  2LJ3 A;  1YHQ Q;  3TRE A;  3FDR A;  2QAS A;  3RNJ A;  4AT1 B;  1VQL T;  1WNL A;  3E19 A;  2EJF A;  4IUV A;  2CP2 A;  2XID A;  4OB2 B;  4E7S A;  4F7U F;  1G3S A;  2COY A;  2JT4 A;  1BIA A;  5GAN e;  2QQS A;  5AT1 B;  4XTW A;  3H0H A;  3OMC A;  1N5Z A;  1ZLM A;  1JQQ A;  1Y71 A;  4M77 A;  5GJV B;  3O8V A;  3EG2 A;  1ZA2 B;  2DXT A;  1UG1 A;  2VUB A;  4KGZ B;  3RES A;  4V2S A;  1W2B P;  2PZ1 A;  2LCS A;  1GXI E;  4J9I A;  2LQN A;  2F69 A;  2BUD A;  1PSE A;  4NOY A;  1VQ9 A;  2KBT A;  3REA B;  1YHQ A;  2IIM A;  1VQP T;  4E2F B;  3I56 T;  2XU8 A;  3R6N A;  3UA6 A;  2DFU A;  3QPH A;  4DEX A;  4M4Z A;  3GOX A;  2DK3 A;  5GAM j;  3A98 A;  1X6B A;  5IH2 A;  5HK3 A;  3GBQ A;  3HL8 A;  2HDA A;  2FRY A;  3NTK A;  2MWO A;  2J7I A;  1TOV A;  1PKT A;  3H0F A;  3ULR B;  3TCJ A;  4FYX B;  1RAG B;  3OS5 A;  1MHN A;  5KCO A;  4HA8 A;  1LNX A;  1FX7 A;  3OMG A;  2E1H A;  2JMA A;  3I5R A;  3CCV Q;  3EGX A;  3CME T;  3N5B B;  4C92 B;  4Z8A A;  2ZZD A;  1UJY A;  3CCQ A;  2P0Q A;  5GAN 2;  2DBM A;  4JRP A;  2FO0 A;  8ATC B;  1GFD A;  5I22 A;  3OYE A;  3CC7 Q;  1YNZ A;  4C8Q F;  3C12 A;  2YRV A;  2DRM A;  1R77 A;  2QA4 T;  2DXU A;  5IHN A;  1C0M A;  2EQM A;  2J6F A;  1U8R A;  1OU8 A;  1WLP B;  3HFN A;  2QEX T;  1WXT A;  3JCM X;  3SEM A;  3CCS A;  2DVJ A;  4XTX A;  3GIB A;  4AG2 C;  3HTR A;  2O01 E;  4F14 A;  1QVG S;  4PJO F;  3NGP A;  2P4T A;  1UGQ B;  4D8K A;  1ZUU A;  2LNV A;  1KQS P;  3CCE Q;  2D8J A;  2QQA A;  3CEY A;  3JB9 F;  2O4X A;  4EMG A;  2F1L A;  2CZ7 B;  1TS9 A;  1JJ2 P;  1GCQ C;  1TH7 A;  4ELY C;  2ABL A;  3MO8 A;  1N8R C;  3MEA A;  1N9R A;  1OV3 A;  4HCB A;  2O31 A;  3QG1 A;  3CC4 T;  1BK2 A;  1QWE A;  5CVI A;  4M77 D;  3QSU A;  5C6S A;  2LJ1 A;  4ZN3 A;  4JPB W;  1V29 B;  4CRI A;  2F2X A;  3CCS Q;  2KI7 A;  5LJ3 j;  2FL7 A;  1D3B A;  4RTT A;  1WX6 A;  3MEU A;  1VQO Q;  2XDP A;  2YDL A;  4C0F A;  2RMO A;  4D8D A;  3RER A;  2JJ9 A;  1I5O B;  4OP0 A;  1LPL A;  3MCA B;  4NL2 A;  1M1K R;  3ZEH A;  1U1S A;  4A4H A;  4Z02 A;  4KH1 B;  4EMK C;  4DA4 A;  3H6Z A;  4KT0 E;  3BY7 A;  2QK0 A;  2CSI A;  2EGA A;  1IXD A;  5KE2 A;  4LNP A;  3RKW A;  4MDW A;  2I2L A;  2CH4 A;  3ZFJ A;  2PVD B;  1YIJ A;  3JCM W;  3SB2 A;  2JOY A;  2K7A A;  1M1F A;  4M7A F;  4AFS C;  3S3M A;  1IZ6 A;  4E7H A;  4HCZ A;  3CCE T;  3CCJ A;  1TWB A;  2DL8 A;  1X27 A;  2OX7 A;  1I5L A;  3L2U A;  4RMO A;  2DXC A;  4WTO B;  4E7J A;  2V26 A;  4QQD A;  5FRO A;  2FZC B;  2JW4 A;  1D09 B;  1A0N B;  1YJN Q;  5GJW B;  4ATO A;  1K9M R;  4N0A C;  4P5N A;  3VYH B;  2KAF A;  3A8L B;  1ACM B;  3S3O A;  3VRY A;  2LZ6 B;  4DBH A;  3GP8 A;  2Y4X A;  2EFI A;  3A5Z B;  3S6W A;  1B3Q A;  3EGU A;  4AFU C;  4M78 F;  3GLX A;  1PCX A;  2V8K A;  3QWY A;  1T3L A;  3PE0 A;  1K73 R;  1SF9 A;  1XOV A;  3OSS C;  1GCP A;  1U1T A;  1WI7 A;  5GAN 3;  2RJF A;  1KD1 R;  1S72 T;  1NZ9 A;  2VXF A;  1UE9 A;  4M78 E;  3CCL A;  4PNO A;  1IO6 A;  3VS3 A;  4OB3 B;  1JO8 A;  2HEQ A;  2EYQ A;  4Z88 A;  3L42 A;  4M7D E;  1M90 C;  1KFZ A;  3MKD A;  2K79 A;  1Q86 R;  4K11 A;  3BW1 A;  4X9D A;  2FZK B;  5CCA A;  3I56 Q;  1IRX A;  4FT2 A;  4BDZ A;  2RI2 A;  4FYV B;  1NYF A;  3CPW P;  1RAI B;  3JCM V;  2ESW A;  5LJ5 h;  1WDX A;  5DM7 R;  1VQ6 T;  2DX1 A;  2DL7 A;  5D7U A;  4D6W A;  4E7I A;  2WAC A;  4J83 A;  1MMA A;  2XG8 D;  4HT9 A;  2RHU A;  2W10 A;  1QWF A;  3EG9 B;  2GNC A;  4M78 C;  1YP5 A;  1UHF A;  2QXF A;  5A2Q E;  4BAC A;  2L0A A;  3LX7 A;  3M54 A;  3OYI A;  1UUE A;  2LTO A;  2V8I A;  2RQT A;  1R0B G;  3FRN A;  4C0G A;  2XI9 A;  1M3C A;  2MAM A;  1W2B A;  3TQ7 P;  1YWO A;  2DIQ A;  5LJ5 g;  1NG2 A;  2V8J A;  2EGC A;  2SEM A;  3VUB A;  1ZHI A;  2QDY B;  5FU7 C;  2PU9 B;  2P0K A;  2C06 A;  3GNG A;  3OYL A;  4LDW A;  4GBQ A;  1E7O A;  2CP7 A;  2DEU A;  2EPD A;  1TG0 A;  4NL3 A;  2JVV A;  4M75 D;  2EJG A;  2KRM A;  3SFM A;  1YJN A;  2K4Y A;  3JCM b;  2LMJ A;  2Z0W A;  2Y4Y A;  4C0Z A;  2RH2 A;  4PJN A;  1VQN T;  4BD3 A;  1LJO A;  4OGC A;  3TSZ A;  2XKO C;  3VV0 A;  3VS5 A;  2QEX Q;  3M5A A;  1V1C A;  3OS0 A;  2BZX A;  3CD6 T;  2KYB A;  2VKN A;  3I5S A;  4M77 B;  3FIF A;  5GAN 5;  2GFA A;  2HZY A;  1HD3 A;  2LQK A;  1OOT A;  3OW2 A;  1KK7 A;  1WIE A;  1VQ4 A;  1M90 R;  1WPY A;  4PFO A;  2DJQ A;  3JAM E;  4JDS A;  1GFC A;  3G6E T;  2ED1 A;  2DVE A;  4KUD K;  4XTU A;  3CCS T;  2LCC A;  4C92 C;  3OYJ A;  2HD0 A;  2EGE A;  1RAE B;  3LYI A;  1M30 A;  2M02 A;  1VQN A;  5KYY B;  4QVD A;  1MNE A;  1EIF A;  3RMQ A;  1SHF A;  2X9H A;  4JJB A;  5LJ5 j;  4JZ3 A;  2HL5 C;  2YHT A;  1XJW B;  1OPL A;  1EX4 A;  3CMA A;  1WHL A;  2DER A;  1VQ5 T;  3M0R A;  4C5H A;  4FYW B;  1I0C A;  2P84 A;  2RB6 A;  3WXM B;  2X3W D;  4C92 D;  1HJD A;  3I55 T;  2YLC A;  1TUC A;  2HQE A;  3CC4 A;  1OUL A;  3EG1 A;  2DD4 A;  1PRM C;  1PM3 A;  3E9G A;  1UB4 A;  1JXO A;  2EAY A;  4ZNX A;  4J6Y A;  2XD0 A;  3OY9 A;  2KT8 A;  3J81 E;  4J9G A;  1VQP A;  3DLL A;  2ZCF B;  1HYO A;  1YHQ T;  3A8M B;  1GRI A;  3CME Q;  1SRM A;  2B8A A;  3PVQ A;  4Y92 A;  5AYF A;  2QA4 A;  1XQH A;  1NYG A;  2ZPB B;  2LP5 A;  1HSQ A;  4GLM A;  3G71 Q;  1YI2 A;  1E6H A;  2DNU A;  5J26 A;  5EG2 A;  3CXC A;  2GF7 A;  2FG0 A;  2DL4 A;  3CC2 T;  2K6D A;  4TVR A;  1Q81 U;  3M0U A;  2RN8 A;  4C8Q C;  3QII A;  3FJP A;  1KSW A;  4FM4 B;  1TXQ A;  4ME7 A;  4E7L A;  1YIT Q;  3JB9 G;  5GAO n;  1WGS A;  3JB9 D;  1Q7Y U;  2P0P A;  3X20 B;  2EQU A;  2DTI A;  1UDL A;  1B7T A;  2E4H A;  4BE2 A;  2ECZ A;  1UFF A;  4FL6 A;  5GMK e;  2AKK A;  3X25 B;  3LGF A;  3PMT A;  1D0Z A;  2BIV A;  3CCR A;  2DMO A;  3RDV A;  3NFC A;  1T0J A;  5KCH A;  4VUB A;  1YJ9 T;  2KNB B;  2C0O A;  5GAM f;  2CP0 A;  4M78 A;  1CKA A;  4PJO G;  1W4S A;  2X4J A;  1K9M U;  3QDR B;  2DL5 A;  2CP3 A;  1S1N A;  3J7A F;  1VYV A;  5GMK l;  3CC4 Q;  2VXE A;  4IUR A;  1AWX A;  2BTT A;  4GY5 A;  4M75 A;  1M2V B;  4XTV A;  2A28 A;  2AKL A;  4C0D C;  4M77 E;  4XQ3 A;  1AZG B;  3OYA A;  2COZ A;  2GQI A;  5GAN 4;  4DOV A;  5GAO l;  3V8J A;  3PTA A;  2AHJ B;  4PL6 A;  3QZ9 B;  3UWN A;  3VS6 A;  3JCM J;  2RJC A;  2QGG A;  2E6N A;  3GF5 A;  2HAX A;  2AIR B;  3CC7 T;  1M8V A;  3QJ6 A;  1N27 A;  2DET A;  2QA4 Q;  1K9A A;  5GAM h;  1NEB A;  1YI2 T;  1YBY A;  2M16 A;  3ZL7 C;  4JJD A;  4PLI A;  2QYZ A;  1JBM A;  4FSX A;  5KH6 A;  1TU0 B;  1RAA B;  3U23 A;  2QTX A;  2LJ0 A;  3MHX A;  1C1A A;  4R56 A;  1KC8 U;  3C0C A;  5CKH A;  3JB9 I;  2E70 A;  3OYH A;  5KYY A;  2CKK A;  2EQI A;  4PFZ A;  3HFO A;  1H8K A;  2AT1 B;  3V7S A;  3HRU A;  2DE0 X;  2A7Y A;  3CBM A;  3QWX X;  4J6W A;  2K2V A;  1AWW A;  1EZZ B;  2NUT B;  5M9O A;  1PSF A;  1R0C B;  4CI0 C;  2YUQ A;  1TUG B;  1T3S A;  3QXE B;  4F04 B;  1VOM A;  4FCY A;  2DPP B;  2ZPF B;  1VQ8 A;  3MJX A;  3SWN A;  3CMA T;  4M7A A;  1YJW A;  1AVZ C;  2JTF A;  2O9V A;  1NPR A;  1LOJ A;  2A08 A;  4C0D B;  3MP8 A;  3WVD B;  3G4S A;  1JEG A;  1OEB A;  3EFR A;  1WHM A;  3OYG A;  2BE9 B;  2GFU A;  3REB B;  4C8Q B;  2YXY A;  5FWB A;  2ZPE B;  5DLQ E;  3EG3 A;  1YN8 A;  1Y57 A;  3CD6 Q;  1M3A A;  3UDC A;  5EC7 A;  3VUZ A;  2IG0 A;  4J7I A;  3EG9 A;  4DBF A;  1OZ3 A;  3G4S Q;  1VQM T;  7AT1 B;  1Y96 B;  2MMP A;  3PNW C;  5HCK A;  5HK0 A;  4QQG A;  3OYY A;  1B07 A;  1ZSZ B;  1VQK A;  4M7A E;  2E3H A;  2GBQ A;  2YRC A;  4L59 A;  1UGR B;  2R5A A;  4M7D B;  1YIT A;  2DLP A;  1D0Y A;  4KUI A;  1S72 A;  1D1A A;  1QKW A;  1U3O A;  1X6O A;  3JRZ A;  4II1 A;  3VKI A;  4ZTJ A;  1XNI A;  3J80 E;  1QCN A;  3NHN A;  2EQJ A;  1OQK A;  1UHC A;  1ZSG A;  1F1B B;  4X34 A;  4QVC A;  2H3E B;  1KIK A;  2LX7 A;  3EG0 A;  1RLP C;  2DJZ A;  3ME9 A;  1ARK A;  2LQW A;  2DAQ A;  2Y90 A;  3LH5 A;  2EW3 A;  5LJ3 f;  1YIJ Q;  1Z9Z A;  2FZG B;  4B9X A;  2ZPH B;  4RG2 A;  3UAT A;  1M3B A;  2MOX A;  5A0G A;  3G6E Q;  2R57 A;  3PIO A;  1VQ6 A;  2E12 A;  4M7A D;  1WZO A;  3CCJ Q;  1I07 A;  1G8X A;  1BI2 A;  2D9T A;  2GTJ A;  2QQ9 A;  3ZBD A;  4JLG A;  1Y96 A;  2VVK A;  3JCM c;  2CRE A;  1AOJ A;  3NTH A;  2X4W A;  2ZPG B;  1I81 A;  3E9F A;  3V8L A;  1K73 U;  1D3B B;  2VWF A;  1HXD A;  3EGD A;  1VQ5 A;  4EDU A;  2K3B A;  3VRZ A;  2JUF A;  2LT1 A;  3TSW A;  2E6Z A;  4M75 F;  2J05 A;  2DZ9 A;  3MP1 A;  2GQV A;  4M78 B;  1G3Y A;  2QGF B;  4RTY A;  3I55 Q;  1BKB A;  2IVW A;  4PJO C;  3CC2 Q;  4AMC A;  3G1J A;  1WHJ A;  2NUP B;  1KQS A;  5I21 A;  4C5E A;  1BI1 A;  4XK8 E;  4M7D D;  3EH2 A;  2K57 A;  3X26 B;  3CCM A;  2EKH A;  4FT4 A;  5GAN d;  2EYY A;  2SRC A;  3CCR T;  1QVF S;  1GBR A;  1IGU A;  1JJ2 S;  1RAH B;  4RG8 A;  4J9D A;  2OTL T;  1D1C A;  1TSF A;  8AT1 B;  1FMV A;  5GAN 6;  4PKC C;  2D8H A;  2YUO A;  1M90 U;  2VV5 A;  1WJQ A;  1VQ8 T;  5HY6 A;  2E64 A;  3A8G B;  1VQK Q;  1BI0 A;  2LC4 A;  3CCQ T;  5GAM e;  3CXC P;  4MZP A;  4M75 B;  3CCU Q;  1OZ2 A;  2QEX A;  2KE9 A;  1JB0 E;  4N4H A;  1Q81 R;  5GAM g;  2ENM A;  1LCK A;  2B86 A;  4J9H A;  2VGM A;  4C8Q A;  2ZAE A;  3D7S B;  4JRK A;  3G4S T;  1VQM Q;  4Y91 A;  1QVG A;  1K73 C;  2OTJ A;  3VU3 C;  3X24 B;  2M9U A;  2EVR A;  4JZ4 A;  3E2U A;  5CKE A;  5J39 A;  3CCU A;  2RA2 A;  4GLK A;  5C0M A;  4HVU A;  4DQ2 A;  2JMC A;  3LGL A;  5FU7 B;  1O9S A;  4ZTF A;  3TEE A;  3A8O B;  3EFO A;  5D6X A;  2DL3 A;  1SHG A;  1B34 B;  3I56 A;  2A3L A;  2X4Y A;  4RCC A;  2HSP A;  1ZUY A;  2J06 A;  4CC7 A;  4OF1 A;  5A0D A;  1UJ0 A;  2DYI A;  1R8O B;  3GPL A;  2DA9 A;  3X28 B;  2LX9 A;  1YCY A;  3P8H A;  3SWN B;  3OYC A;  1EFN A;  3I55 A;  1N8R R;  4FW1 A;  1FXX A;  2DD5 A;  2DM1 A;  1JU5 C;  4A53 A;  3PMI A;  3MET A;  1WHH A;  1S72 Q;  2PUK B;  4IIM A;  3I35 A;  3H9N A;  2G3R A;  3QJY A;  3RMS A;  3JCM Q;  2H3J A;  1VQ4 Q;  5J3B A;  2YUN A;  1NJI U;  2EIF A;  1SKU B;  4LUD A;  1AWJ A;  4HCC A;  1KQ2 A;  2L3R A;  2XDB A;  4MDX A;  2RK1 A;  1WHG A;  4PLL A;  1M1K U;  1X01 A;  2H8H A;  4CC4 B;  3NPF A;  4BY6 B;  5KYX B;  3OYF A;  1RUW A;  4RTW A;  1J3T A;  2R58 A;  4M7A C;  2RJE A;  3FC3 A;  1K1Z A;  1RI0 A;  1GCQ A;  1Y7X A;  3G6E A;  1VQ6 Q;  2FYK A;  4L6V 5;  4M77 G;  5GAO r;  3CPW A;  3VYG A;  5CK9 A;  1QVF P;  4QVZ A;  2EQK A;  3A1P A;  5GAO p;  3H41 A;  5CKD A;  1PNJ A;  3JSC A;  1D0X A;  4IKF A;  4BUG A;  2DEQ A;  2OTJ T;  1IHV A;  4RTX A;  3QHS A;  1GBQ A;  3ER0 A;  4M75 E;  2QQB A;  3OS2 A;  3HSB A;  5KYU B;  3G71 A;  1YI2 Q;  1K9M C;  1KD1 C;  4OVA A;  1K76 A;  2YWW A;  2RJD A;  2VYT A;  2QTV A;  4M7A G;  1IB8 A;  3LLR A;  2JN0 A;  2VB6 A;  4OML A;  2L3S A;  3CC2 A;  4XU2 A;  3QO3 A;  2NUT A;  4LXC A;  3GNF B;  3BDU A;  5GAN j;  1Q81 C;  4M7D F;  1KD1 U;  4F7U B;  1KG1 A;  1D1B A;  1WQ7 A;  1Q7Y C;  1K0S A;  1ZBX A;  1OI1 A;  2LCL A;  4HVW A;  2RO0 A;  4FYY B;  5CQX A;  2CZ0 B;  1X69 A;  1Q95 G;  2YSQ A;  2LQ8 A;  3OS1 A;  2JM8 A;  1MUZ A;  2I0N A;  2KSS A;  1QLY A;  2HNI A;  4C5G A;  3URG A;  3R6O A;  4PFP A;  4UC4 A;  3O5Z A;  2KXC A;  3JCM e;  5IT9 E;  1NE8 A;  4BI4 A;  4MML A;  5L23 A;  5KYU A;  2M0Y A;  4BI3 A;  3F70 A;  4ZGE B;  3JCM g;  2K5I A;  4M77 F;  5LJ5 f;  3FEO A;  1T0H A;  2QDL A;  3EFO B;  2O4X B;  2PQW A;  1VQL Q;  1FMW A;  2M1H A;  4FU6 A;  2X51 A;  2M0O A;  4DBQ A;  3CCV A;  2YRD A;  4XU3 A;  1VA7 A;  1OU9 A;  3JCM h;  1KJW A;  3VS2 A;  3V7C A;  3M0S A;  2NYS A;  3OYK A;  4J9E A;  2GGR A;  3RIR A;  1KQS S;  2NUP A;  5I11 A;  3M4Y A;  3L2R A;  1VQL A;  2ROT A;  3P8D A;  2FHD A;  2K3X A;  4ESR A;  1FYN A;  4BDY A;  4HKE A;  1KC8 R;  4IUU A;  2MK5 A;  4J6X A;  4NS5 A;  4MMK A;  2KDS A;  2RHY A;  1NM7 A;  1NLP C;  2YT6 A;  1PHT A;  3M56 A;  3UT1 A;  1QVF A;  1K0X A;  1X43 A;  2L8D A;  4LDU A;  4PJJ A;  1ABQ A;  3OW2 S;  3V8K A;  1VQ7 A;  2E10 A;  3BE3 A;  3QBY A;  1Q82 C;  3HPW A;  1M5Q 1;  2EKO A;  5FRM A;  1Y0M A;  3RKX A;  1PD1 A;  2MIO A;  2PNI A;  3M0P A;  2XDD A;  3P8B B;  4C92 A;  2MPX C;  1YIT T;  4CC3 A;  1ZBJ A;  4JS4 A;  4WCI A;  2FVU A;  2XMF A;  3INZ A;  1K4U S;  1X2Q A;  3FB9 A;  4BB7 A;  2KEA A;  1PRL C;  3IQL A;  3CCM T;  5IHK A;  5LJ5 d;  5GAN 8;  2LRQ A;  1VQO A;  2EJ9 A;  2RF0 A;  1V76 A;  5LJ3 e;  1SEM A;  2GTO A;  3I9Q A;  2JNG A;  4Z89 A;  3AHU A;  3Q1J A;  4OMM A;  1KHI A;  1RAD B;  5D6Y A;  3OYB A;  1B34 A;  2RI5 A;  3CD6 A;  3RUX A;  1SG5 A;  2W0Z A;  4O5V A;  2CDT A;  1U5S A;  2PVO B;  3HRS A;  2OJ2 A;  1WHK A;  2KRO A;  4OMO A;  4L5G A;  1YFN A;  5GAN f;  3HRT A;  2L89 A;  1IGQ A;  4JJC A;  1BU1 A;  3M58 A;  1TTH B;  1VQ9 Q;  3EH1 A;  2HQH A;  4PK4 A;  4OB1 B;  2OTJ Q;  1ZX6 A;  1Y07 A;  1MV3 A;  1M4Z A;  1H3Z A;  1WQW A;  3CCL T;  2V1R A;  3EAE A;  1QVP A;  2CUB A;  3CPF A;  2RQU A;  2E3I A;  5IXB A;  4WF2 A;  4F7U E;  4FW2 A;  1LVK A;  4BI8 B;  3CBP A;  3CPW S;  1W6X A;  3PGG A;  1RI9 A;  2BE7 D;  4PJL A;  2V1Q A;  2D1X A;  2LNH B;  3LWH A;  4A4F A;  1K8A C;  1ABO A;  2RQV A;  2D6F A;  1YWP A;  2P4R A;  2LVM A;  3LH0 A;  2FPF A;  1BIB A;  4QT7 A;  3VS4 A;  4E47 A;  2F2V A;  2FEI A;  1U06 A;  2QI2 A;  1DJ7 B;  2COW A;  2HBW A;  1YJ9 A;  3PIP A;  4E7Z A;  1AEY A;  1N6A A;  2MCN A;  4JRQ A;  4XTY A;  4RUG A;  3HP9 A;  3JCM d;  2K2M A;  2JM9 A;  2G6F X;  4OMQ A;  3EGX B;  3WVE B;  1AZE A;  2A37 A;  3TVT A;  1NBE B;  2KK4 A;  3FLG A;  4LDX A;  3UPU A;  2HMA A;  1X6G A;  3OYM A;  3CQT A;  4HCK A;  1UGP B;  3SDZ A;  4O6J A;  2X3X D;  1VIE A;  4ZGJ B;  3M0T A;  1Q86 U;  2GCX A;  2ATC B;  2MWP A;  5IAY A;  3JB9 H;  1OPK A;  2OI3 A;  1YJ9 Q;  2J6K A;  1PC0 A;  1XTD A;  6AT1 B;  4M78 D;  2YUP A;  3FJ5 A;  4B9W A;  3UF4 A;  4DEY A;  1CSK A;  4J7F A;  2HKQ B;  4A4G A;  1Q86 C;  2K5L A;  4LE9 A;  4AFZ C;  2RHZ A;  2CUD A;  3RKY A;  1WYX A;  3ASK A;  3QYG B;  1W70 A;  2FPD A;  3L1A A;  3SD4 A;  2LT4 A;  4LD9 K;  3EHR A;  1I8F A;  4XU1 A;  1BCM A;  5ECA A;  3PVL A;  3QKJ A;  2QAZ A;  2CYZ B;  4IUP A;  2K5F A;  4BY6 C;  2EWN A;  4JUV A;  2KR3 A;  1I1J A;  4ELZ C;  3C94 A;  1WA7 A;  2JS0 A;  1N9S A;  5GMK j;  2HQX A;  5FLX E;  2OAU A;  2PVG B;  2E5K A;  2DIL A;  5GMK m;  2CP5 A;  1VQ9 T;  3CCV T;  3CCR Q;  4C5I A;  3CC7 A;  3EFS A;  3CCE A;  4A4K A;  1CKB A;  1O75 A;  2CZ1 B;  4M77 C;  4LN2 A;  1QW1 A;  2L5Q A;  1OYX A;  4HT8 A;  2NUZ A;  3OYD A;  3QDF A; 
#chains in the Genus database with same CATH homology
 2JS2 A;  2DRK A;  2DM1 A;  5GJV B;  1JU5 C;  4R0K A;  3EG2 A;  1GRI A;  1SRM A;  1UTI A;  4IIO A;  1UG1 A;  4IIM A;  3PVQ A;  1WXB A;  4Y92 A;  3I35 A;  4J9C A;  2PZ1 A;  1NYG A;  2LCS A;  4J9I A;  2LQN A;  2LP5 A;  2YUN A;  1HSQ A;  4GLM A;  2F2W A;  2KBT A;  4LUD A;  1AWJ A;  3REA B;  2IIM A;  2C0T A;  1E6H A;  3R6N A;  2DNU A;  3UA6 A;  2H8H A;  4CC4 B;  3NPF A;  4DEX A;  4M4Z A;  1RUW A;  4RTW A;  1J3T A;  3A98 A;  2CSQ A;  2FG0 A;  2KXD A;  2DL4 A;  1K1Z A;  2K6D A;  1GCQ A;  3M0U A;  1M27 C;  1X6B A;  2RN8 A;  5IH2 A;  3VS1 A;  3GBQ A;  1KSW A;  2HDA A;  2FRY A;  2J7I A;  3ULR B;  1PKT A;  3H0F A;  3H41 A;  1FMK A;  3THK A;  1PNJ A;  2AZS A;  4RTX A;  1UDL A;  2JMA A;  3I5R A;  1Z9Q A;  1GBQ A;  2ECZ A;  1UFF A;  2K9G A;  2CT4 A;  4Z8A A;  2KT1 A;  1UJY A;  2FRW A;  2AKK A;  1K76 A;  2DBM A;  2FO0 A;  2DMO A;  1GFD A;  5I22 A;  1T0J A;  1YNZ A;  2DRM A;  4RTV A;  2KNB B;  5IHN A;  2J6F A;  2C0O A;  4OML A;  2L3S A;  1WLP B;  1WXT A;  1CKA A;  3SEM A;  2DVJ A;  2EYW A;  4AG2 C;  2EYZ A;  2DL5 A;  4F14 A;  2BZY A;  4EIK A;  3NGP A;  1S1N A;  1K0S A;  1VYV A;  4D8K A;  1ZUU A;  4HVW A;  2D8J A;  1X69 A;  1AWX A;  2BTT A;  2D0N A;  2YSQ A;  2A28 A;  1G2B A;  2JM8 A;  1MUZ A;  2I0N A;  1QLY A;  2AKL A;  3O5Z A;  1AZG B;  4F16 A;  2KXC A;  1GCQ C;  2ABL A;  2KRN A;  2GQI A;  1OV3 A;  2O31 A;  5L23 A;  4CC2 A;  1BK2 A;  1X2K A;  1QWE A;  4F17 A;  2M0Y A;  2JXB A;  2LJ1 A;  3VS6 A;  2JTE A;  4JPB W;  4KRT A;  2F2X A;  1T0H A;  4J9B A;  2QDL A;  3M0Q A;  3RBB B;  4RTT A;  1K9A A;  1WX6 A;  1NEB A;  2YDL A;  2RMO A;  4D8D A;  3ZL7 C;  1BBZ A;  4JJD A;  1VA7 A;  4FSS A;  2OAW A;  1KJW A;  3VS2 A;  2KRS A;  2AK5 A;  3M0S A;  1QKX A;  2CSI A;  2EGA A;  3U23 A;  4J9E A;  2GGR A;  2LJ0 A;  4LNP A;  2CH4 A;  3C0C A;  2CT3 A;  5I11 A;  2ROT A;  1H3H A;  4ESR A;  2K7A A;  4AFS C;  1FYN A;  1BB9 A;  1TUD A;  2EQI A;  1H8K A;  2HCK A;  4LUE A;  2J6O A;  1AWO A;  2DL8 A;  1G83 A;  1X27 A;  1NM7 A;  2DE0 X;  1NLP C;  2YT6 A;  1PHT A;  3QWX X;  3NMZ C;  1K0X A;  1SSH A;  2C0I A;  2RPN A;  2CH4 W;  2JW4 A;  1A0N B;  1UEC A;  5GJW B;  1AWW A;  1X43 A;  4AFQ C;  2PTK A;  1ABQ A;  3VRY A;  2LZ6 B;  2YUQ A;  1M8M A;  4RTU A;  2RQW A;  1T3S A;  1SRL A;  1B3Q A;  3EGU A;  4AFU C;  1Y0M A;  2MIO A;  1AVZ C;  2PNI A;  3M0P A;  2DF6 A;  3QWY A;  3SHW A;  2EBP A;  2O9V A;  1T3L A;  3PE0 A;  1YCS B;  4CC3 A;  4J9F A;  1XOV A;  2A08 A;  1ZBJ A;  4AG1 C;  2BZ8 A;  1GCP A;  2O9S A;  4WCI A;  1JEG A;  1OEB A;  1WI7 A;  3KFV A;  2XMF A;  1K4U S;  1UE9 A;  1X2Q A;  1JXM A;  3REB B;  2KEA A;  1PRL C;  3IQL A;  1IO6 A;  3VS3 A;  1JO8 A;  5FWB A;  5IHK A;  2HEQ A;  1GL5 A;  3EG3 A;  1YN8 A;  1VYU A;  1Y57 A;  1M3A A;  4Z88 A;  5EC7 A;  1KFZ A;  2K79 A;  4K11 A;  2AZV A;  2RF0 A;  2KGT A;  1SEM A;  5HCK A;  2GTO A;  2A36 A;  3I9Q A;  1MV0 B;  1B07 A;  4Z89 A;  2GBQ A;  1NYF A;  4OMM A;  2DLP A;  1QKW A;  2ESW A;  1U3O A;  1WDX A;  2W0Z A;  2CDT A;  4ORZ A;  1U5S A;  2DX1 A;  2DL7 A;  2OJ2 A;  2KRO A;  3NHN A;  4OMO A;  1UHC A;  1ZSG A;  4JJC A;  1NLO C;  4HVV A;  1KIK A;  2LX7 A;  1BU1 A;  3EG0 A;  2FPE A;  1RLP C;  2W10 A;  1QWF A;  2GNC A;  1ARK A;  2LQW A;  4A63 B;  1YP5 A;  1H92 A;  1UHF A;  3LH5 A;  1ZX6 A;  2EW3 A;  1MV3 A;  2L0A A;  2O88 A;  1UUE A;  2V1R A;  2CUB A;  1Z9Z A;  2RQU A;  2RQT A;  1NEG A;  5IXB A;  3UAT A;  2NWM A;  1M3B A;  2MOX A;  2L3Q A;  1W6X A;  1M3C A;  1RI9 A;  1I07 A;  2DYB A;  1W1F A;  1YWO A;  2V1Q A;  2GTJ A;  1PWT A;  2D1X A;  2EYX A;  1NG2 A;  2LNH B;  2VVK A;  2EGC A;  2SEM A;  3VS7 A;  2CRE A;  1AOJ A;  1WFW A;  1ABO A;  2RQV A;  2M51 A;  1YWP A;  2P4R A;  4GBQ A;  1E7O A;  2VWF A;  2FPF A;  4QT7 A;  2EPD A;  1TG0 A;  3VS4 A;  2K3B A;  3VRZ A;  2F2V A;  2FEI A;  1U06 A;  2KRM A;  3TSW A;  2HBW A;  5IXF A;  2J05 A;  1RLQ C;  5IHI A;  2LMJ A;  1AEY A;  4E6R A;  4RTY A;  2MCN A;  3EHQ A;  4X1V A;  4RUG A;  1SPK A;  3TSZ A;  2ROL A;  2K2M A;  2RQR A;  2JM9 A;  2O2O A;  3VS5 A;  2G6F X;  4OMQ A;  1V1C A;  2L2P A;  1AZE A;  1VYT A;  2BZX A;  2A37 A;  2KYB A;  2VKN A;  3TVT A;  3VS0 A;  2ED0 A;  3I5S A;  4RTZ A;  2EKH A;  1HD3 A;  5FW9 A;  2RNA A;  1X6G A;  1OOT A;  2EYY A;  3CQT A;  1WIE A;  4HCK A;  2SRC A;  1AD5 A;  1GBR A;  3JV3 A;  2X3X D;  4J9D A;  3M0T A;  2DJQ A;  1GFC A;  2ED1 A;  1OPK A;  2OI3 A;  2D8H A;  2J6K A;  3UA7 A;  2YUO A;  2DBK A;  1QCF A;  2EGE A;  2YUP A;  1PKS A;  1M30 A;  3FJ5 A;  1ZUK A;  2L3P A;  3UF4 A;  4DEY A;  1CSK A;  2KE9 A;  4LE9 A;  1SHF A;  4JJB A;  4AFZ C;  4JZ3 A;  2CUD A;  2ENM A;  1WYX A;  1LCK A;  3H0I A;  1OPL A;  1W70 A;  2B86 A;  4J9H A;  2FPD A;  3M0R A;  4HXJ A;  1I0C A;  3EHR A;  1WXU A;  5FWC A;  5ECA A;  3PVL A;  2EVR A;  4JZ4 A;  2KYM A;  2X3W D;  1HJD A;  4HVU A;  2KR3 A;  4OMN A;  1UGV A;  2JMC A;  1I1J A;  1TUC A;  1WA7 A;  2JS0 A;  1E6G A;  3EG1 A;  4OMP A;  2DL3 A;  1SHG A;  1PRM C;  2HSP A;  1ZUY A;  2J06 A;  4CC7 A;  2LJ3 A;  2E5K A;  2DIL A;  1JXO A;  3RNJ A;  4ZNX A;  1UJ0 A;  2KT8 A;  2DA9 A;  2JT4 A;  4J9G A;  1CKB A;  4LN2 A;  3H0H A;  1N5Z A;  1EFN A;  1ZLM A;  1JQQ A;  2NUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...