2DL7A

Solution structure of the second sh3 domain of human kiaa0769 protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
73
structure length
73
Chain Sequence
GSSGSSGVCFVKALYDYEGQTDDELSFPEGAIIRILNKENQDDDGFWEGEFNGRIGVFPSVLVEELSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords KIAA0769 protein
publication title Solution structure of the second SH3 domain of human KIAA0769 protein
rcsb
source organism Homo sapiens
total genus 5
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2006-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dl7A00
5IHNA 5IXFA 1I07A 2DA9A 1GFDA 2RN8A 2KROA 4E6RA 1UHCA 2AKKA 2ROLA 2DX1A 2W10A 1UTIA 2I0NA 1K0XA 1GCQA 2DE0X 2B86A 2DMOA 4EIKA 1PKSA 2RQUA 4ESRA 1YCSB 4IIMA 3M0SA 3VS3A 2DILA 3IQLA 4ORZA 1AWOA 1W1FA 1K0SA 4F16A 1I1JA 2LCSA 5I22A 2OI3A 2LNHB 4JJDA 3I9QA 2EYWA 1S1NA 3EGUA 1QKXA 1X69A 1ZUYA 2PZ1A 2X3XD 1E6GA 4Z88A 1WDXA 1UECA 2PTKA 1QLYA 2F2WA 3EG3A 4HXJA 3THKA 4F17A 2C0OA 2FG0A 4OMQA 2OAWA 1M8MA 1H8KA 2XMFA 1AWJA 2ED1A 4CC4B 1WI7A 2YUQA 2O31A 1ABQA 4RTUA 1U5SA 5IXBA 1B07A 1ABOA 2K79A 2MIOA 1GRIA 4GLMA 1SSHA 3REAB 1ZUKA 2DL8A 2MCNA 1X6GA 1PKTA 3QWXX 3NMZC 1U3OA 4J9HA 2LX7A 2RQVA 4J9CA 2HBWA 2RQRA 4HVUA 2EGEA 1WXBA 2KEAA 3VS2A 2KRNA 1UFFA 3C0CA 1U06A 1YP5A 2IIMA 1W70A 4AFZC 1BK2A 2KT1A 2EYZA 4RTXA 2H8HA 2L3QA 2JMAA 3EG1A 1K4US 2F2XA 1OEBA 1Y57A 2ABLA 2KBTA 1RLPC 1UHFA 2J6KA 1AZEA 3U23A 3CQTA 3I5SA 2BTTA 1BBZA 3EHQA 1T0HA 2GNCA 1BU1A 2EW3A 2RMOA 1GBRA 1K76A 2AK5A 1AEYA 1PNJA 1QWEA 1J3TA 1TUCA 2DYBA 2V1QA 3NPFA 1PRMC 4J9BA 1EFNA 4K11A 4Z89A 2DL4A 5FWBA 1UUEA 2C0TA 2NWMA 1JXMA 2OJ2A 1HSQA 1KIKA 2G6FX 1V1CA 1SRMA 2EVRA 1TG0A 2BZXA 3M0UA 3RBBB 5I11A 1WYXA 4AFUC 5GJWB 2FPFA 2DLPA 3R6NA 4RTVA 2RPNA 5IHIA 2L2PA 3VS6A 1E6HA 3JV3A 1YWPA 4OMNA 1JO8A 1HD3A 3RNJA 1OPKA 1CKBA 1GCQC 3EG2A 4J9EA 2DL3A 1SHFA 1WA7A 1NM7A 2O2OA 1GCPA 4D8KA 4RTWA 3M0QA 2FRWA 4RUGA 2RQWA 2LMJA 1H92A 2KR3A 2JMCA 4AFQC 1QKWA 4LN2A 3VS7A 4RTTA 1N5ZA 1W6XA 1AZGB 4LNPA 1T3LA 3TVTA 1SPKA 3VRZA 1WXUA 2HSPA 1PRLC 3TSZA 1KJWA 2K2MA 1ZX6A 2BZ8A 2ESWA 4OMOA 3NGPA 2EGAA 3O5ZA 4GBQA 5EC7A 1WLPB 2J7IA 1PWTA 2ENMA 2J06A 2LJ3A 3M0RA 1H3HA 3I35A 3H41A 2LJ1A 2JM8A 2AZSA 1X6BA 1UE9A 4FSSA 2A36A 3EG0A 5FW9A 3QWYA 3VS0A 1XOVA 2L0AA 3H0HA 2CH4A 2D1XA 1M3BA 2ROTA 2BZYA 1JQQA 3FJ5A 3KFVA 2YUPA 1Z9QA 1NG2A 3H0IA 3VRYA 1PHTA 2K7AA 2NUZA 4JZ3A 2DF6A 2YUOA 4ZNXA 2AZVA 3VS1A 1M3AA 1E7OA 2L3PA 3M0PA 1ARKA 3PVQA 5HCKA 1VA7A 1M30A 2EYYA 2CT4A 2JM9A 2KNBB 1OV3A 2LJ0A 2W0ZA 2CSIA 2YSQA 1AVZC 2DJQA 2CSQA 4Z8AA 1A0NB 1T3SA 1VYUA 1AOJA 1KSWA 1K9AA 1IO6A 4HVWA 2KYMA 3PVLA 2KYBA 2CUBA 2EYXA 2O9VA 3REBB 1M27C 1NYFA 2AKLA 2FPEA 4D8DA 3VS5A 3PE0A 1FYNA 2HDAA 4HCKA 1X2QA 2JS2A 4Y92A 2HEQA 2YT6A 2J05A 1VYVA 5ECAA 3GBQA 1ZLMA 4WCIA 4AG2C 2D0NA 1NEGA 2GQIA 2J6FA 2MOXA 5IHKA 2GGRA 2C0IA 4RTYA 2DNUA 2RNAA 2GBQA 4LUEA 1MUZA 1AD5A 1RUWA 1SEMA 2SEMA 1CKAA 1LCKA 4J9FA 2CDTA 2CH4W 1ZSGA 2QDLA 2VVKA 2F2VA 2DM1A 1UGVA 1UJYA 1YWOA 2GTOA 4AG1C 2P4RA 1RLQC 2J6OA 5L23A 1B3QA 1WIEA 1X43A 2KXCA 4DEYA 2LQWA 1GL5A 3TSWA 4CC7A 2VWFA 1QCFA 3SEMA 1HJDA 3UA7A 2DBMA 1JXOA 4J9GA 1JU5C 2DRKA 4RTZA 4F14A 2EBPA 1QWFA 1CSKA 2DVJA 1Y0MA 2LQNA 2X3WD 2A28A 1MV3A 3SHWA 1VYTA 2KE9A 4KRTA 1BB9A 2LZ6B 2K3BA 1AWXA 2KRMA 4OMLA 2DBKA 5IH2A 3ULRB 2KGTA 2L3SA 3ZL7C 1ZUUA 2EPDA 2FRYA 2DL5A 4X1VA 2M0YA 2A08A 2JXBA 1WFWA 4AFSC 1NEBA 4JPBW 3I5RA 1AWWA 1FMKA 4QT7A 1Z9ZA 1OPLA 4LE9A 2ED0A 1I0CA 4LUDA 2EGCA 1K1ZA 2PNIA 2RF0A 5GJVB 1KFZA 1G83A 4CC2A 1X27A 2CREA 1JEGA 2K6DA 1NLOC 1MV0B 4IIOA 3LH5A 1TUDA 1RI9A 4JJCA 2KRSA 1M3CA 2YDLA 2O88A 2V1RA 4DEXA 2D8HA 3H0FA 3EHRA 4HVVA 2D8JA 2K9GA 3A98A 3VS4A 4R0KA 1SRLA 1YNZA 2ECZA 1T0JA 4M4ZA 2VKNA 1YN8A 2E5KA 2EKHA 1SHGA 3M0TA 1WX6A 2HCKA 2CT3A 2DL7A 2M51A 2O9SA 2FPDA 4OMMA 3UATA 2A37A 1OOTA 2JW4A 1X2KA 2YUNA 4OMPA 5FWCA 1UG1A 2SRCA 2GTJA 4JZ4A 1UJ0A 4J9DA 1NLPC 1UDLA 2KT8A 2EQIA 2JT4A 2KXDA 1ZBJA 4CC3A 2JS0A 2JTEA 3NHNA 2DRMA 1NYGA 1GFCA 1G2BA 3UA6A 3UF4A 1GBQA 4J9IA 2LP5A 2FO0A 2FEIA 4JJBA 1WXTA 2RQTA 4A63B 2CUDA
chains in the Genus database with same CATH superfamily
5IHNA 2XI9A 2AKKA 3CCVA 1NBEB 5GAOl 2DX1A 2I0NA 5HY6A 4A4KA 3L2UA 5GAOn 2B86A 5FU7C 4JJNK 2HKNA 3DB3A 1QVPA 3J80E 4ESRA 1YCSB 3FC3A 1TU0B 4LDXA 1OZ2A 2CZ7B 3M0SA 3VS3A 3CC2T 1VQ4Q 7AT1B 1K73C 4RKUE 1Q7YC 5CK9A 1NJIC 4ORZA 1W1FA 3C94A 3JCMh 2QTVA 5I22A 3I56T 4JJDA 1C6VX 3EGUA 4M7DG 1X69A 1ZUYA 3HL8A 2PZ1A 5GANe 2X3XD 2DD5A 3AHUA 4XU0A 1Q81R 2PTKA 1UECA 3GIBA 2F5TX 4QVDA 4HXJA 3EGXA 3HRTA 4C5HA 4FM4B 4QW2A 4R55A 3OA6A 3CCEQ 1OULA 4M7AE 4MMKA 1M8MA 4M75G 1JBMA 2HNIA 2XMFA 3HPWA 3JCMe 4ME7A 2GFAA 2ED1A 1WI7A 2H3EB 3TU4K 3F70A 5IXBA 1B07A 2MIOA 4GY5A 3QO3A 1SSHA 2MK5A 2QASA 3H9NA 4VUBA 2MCNA 1YCYA 3QWXX 1U3OA 2EAYA 2HQEA 2LX7A 4M7DA 4DBFA 2R5AA 3H8ZA 1WXBA 2KEAA 1BI3A 4GLKA 1VQOA 3C0CA 2IIMA 4PFPA 4E7KA 1BK2A 4N0AA 2CP7A 5A0LA 4Y91A 3X28B 1RABB 4RTXA 2DZCA 4HKEA 2F2XA 2COYA 3MEUA 4M75A 2QAZA 3MKDA 1IHVA 4XU3A 1UHFA 4E7HA 3I5SA 4KGZB 3EHQA 1OX9A 3BFMA 1T0HA 2GNCA 1LJOA 3NTHA 3CCVQ 1Y96A 1BU1A 1M90C 1IRXA 1VOMA 4M77B 1Q86C 2B8AA 2V1QA 3NPFA 3META 4B9XA 1PRMC 5GAN2 4J9BA 3GOXA 1WGSA 1Y71A 4K11A 4Z89A 2QGFB 2DL4A 3EFOA 1UUEA 1VQ5T 2LDMA 1W4SA 1LPLA 4JUVA 4OB1B 1I81A 1NE8A 1KIKA 5LJ3f 4XK8E 2JVVA 2EVRA 1TG0A 2BZXA 3TEEA 4OB2B 3V8LA 5I21A 4PJLA 4RTVA 2E41A 5IHIA 5D6XA 4DQ2A 3QDRB 3JV3A 1KD1C 3OQ5A 4L5GA 4J6WA 4M7DB 1OPKA 1YJ9A 3EG2A 5A2QE 2O2OA 4FW1A 3OBYA 2RQWA 2VXEA 2LMJA 1RAGB 1FXXA 2CP5A 5CKBA 1QKWA 5EG2A 4C8QG 1N5ZA 2RI5A 1AZGB 1KQSP 3TVTA 1SPKA 3EAEA 4MZMA 2QG9B 1WXUA 1X75C 2ZGWA 1WHGA 3VJPA 1KJWA 1WZOA 4PL6A 5KE3A 4DBRA 5FROA 4HCCA 3MEWA 3O5ZA 2CP6A 3MEVA 2OTJT 3QZ9B 3QYGB 1X6OA 1VQOQ 2JTFA 2LQ8A 2AZSA 2E3IA 1X6BA 4OMFB 5GAOr 2QEXT 2XICA 4BUGA 2EWNA 5GMKi 2L0AA 4X34A 2QI2A 2D1XA 1M3BA 3N5BB 2NUTB 4C8QA 4C5IA 1VQ9T 1JQQA 2E6NA 5LL6S 3HKSA 1Z9QA 1VQKA 2V26A 3VRYA 2K7AA 1N9SA 4JZ3A 3GLXA 2QDYB 3VS1A 3DB4A 4FL6A 1E7OA 4AMCA 2L3PA 1PM3A 4IUPA 3PVQA 5GMKe 3QBYA 1M30A 2KQWA 2EYYA 1D3BA 5KYWB 4HA8A 2PU9B 2JM9A 5AYFA 8AT1B 2LJ0A 1I8FA 4N0AC 3A8HB 1R77A 2L5QA 2WACA 4M75C 3OYFA 1QVFP 3CCJT 3OYDA 3PVLA 1JRIA 3REBB 1M27C 1NYFA 2L8DA 2KMTA 2AKLA 4E7LA 1YI2T 4M75F 2VGMA 1YJ9Q 2X51A 3C4SA 4Y92A 3CPWP 2YT6A 2J05A 1S72A 1D1BA 1TS9A 1VQMA 2EIFA 2XD0A 3MJXA 1NEGA 4XTVA 5IHKA 2GF7A 2GBQA 2F69A 5CO7A 1WNLA 4LDUA 1SEMA 4J9FA 2CDTA 1ZSGA 1M2VA 3CD6T 1X43A 3AT1B 1JJ2P 2LQWA 4FU6A 3C95A 1G3SA 3UA7A 3OSVA 5GMKl 3R6OA 4HT8A 2ATCB 3I55T 2DRKA 3PGGA 3FRNA 1B34A 2X3WD 4C5EA 2KE9A 4KRTA 2LZ6B 2KRMA 3ASKA 2DJZA 3CC2A 2M0OA 4PJMA 1VQKQ 1M90U 1WQ7A 2FRYA 4X9CA 1Q86U 3JCMb 2A08A 2JXBA 1WHMA 4M77D 3UDCA 2ZPFB 4JPBW 3I56A 1AWWA 1BKBA 3LGLA 1XQHA 4ZGJB 4BE1A 2MPXC 4LDWA 3V8JA 2E3HA 4Y28E 2PNIA 2RF0A 4EPCA 1YJNQ 4PJOG 3FLGA 4V2SA 4LD6A 2ZAEA 4ELYC 4JJCA 3M4YA 4DEXA 2QGGA 3H0FA 5GANf 1K9MR 4C8QC 1VQLA 5D7UA 5LJ5h 2RD1A 1G5VA 2I2LA 4MZPA 2E5KA 2PUKB 1M2VB 2DIQA 2JNGA 4C8QF 3M0TA 1WX6A 1K8AC 2HCKA 4M7DD 2EKOA 2DTOA 2DL7A 1PSFA 3FIFA 4LXCA 1S72Q 4OMMA 1OOTA 3JCMf 2YWWA 2YUNA 1VQMQ 4OMPA 3S3NA 1KC8C 4M75E 3QDFA 1NLPC 1UDLA 2KT8A 1BYMA 4A4GA 4PJOA 1QW1A 4M75D 3EH2A 1RAEB 3NHNA 3G71Q 2RI2A 3GNGA 3LYIA 1N9RA 2HL5C 2DXUA 4JJBA 1WXTA 2RQTA 3JB9G 2K5LA 1GFDA 2DA9A 4IUTA 2RN8A 4A53A 5LJ3g 4E6RA 1KHCA 1M1KR 3OS0A 1UTIA 5A0GA 1K0XA 3X25B 1VQ5A 3BY7A 1SF9A 2RQUA 3CC2Q 1BI2A 4PLIA 1MMAA 2CP2A 2NYSA 2YLCA 3HRSA 4M78B 5CKEA 4JRIA 3M53A 3I56Q 1QVFA 1M1KU 3OYMA 1K0SA 4F16A 1YJWA 4XTXA 2LCSA 4B6MA 2D0QB 2OI3A 2LNHB 5KYYB 2K3XA 5FU6B 1MNDA 3BDUA 1C0MA 4MDWA 1E6GA 2RJDA 3CPWA 2F2WA 2ZPGB 4MZTA 2MWPA 2BE9B 3MHXA 4F17A 5IAYA 5LJ5d 2C0OA 4PJOB 2FG0A 4OMQA 1VQLQ 2V8IA 3JCMc 4R56A 3CPFA 1VQ7T 1AT1B 1SG5A 2EQMA 3OYLA 2QQSA 2Z0WA 4RTUA 2LCCA 2RJEA 2OTJA 2DL8A 3CMET 1X6GA 3CC4T 3NMZC 4C8QE 2L89A 4CRIA 2X4WA 2QEXA 3QHSA 1U06A 2XHCA 4C8QD 4PLLA 1YITT 1WJQA 2PVGB 1RAAB 4BB7A 4BY6B 2P84A 3EG1A 1VQ9A 4RG8A 2CYZB 4C0DB 3SWNA 1Y57A 2J6KA 2LNVA 2MWOA 3HFNA 1AZEA 4A4HA 4JLGA 1BBZA 3L2RA 3WXMB 3L2ZA 1VQ5Q 2YRVA 3DLMA 4KUDK 2WSCE 4M77G 1JXMA 2KY9A 1VQ8T 3CXCS 3M0UA 3RBBB 3LX7A 1YJWQ 3E19A 2NLUA 1N8RC 2RK1A 1P92A 3FEOA 3R6NA 4BACA 3GPLA 2RPNA 2CP0A 4QKUA 1YI2A 5CKHA 4J8OA 3P8DA 1NPPA 2CKKA 1YWPA 4OMNA 1ACMB 1HD3A 1CKBA 4J9EA 5CQYA 2DL3A 1M4ZA 1GCPA 4O5VA 2DIGA 3CC7T 1BI0A 2RO0A 4RUGA 2HL3A 1BIBA 5HK3A 4IUQA 5CCAA 1H92A 2KR3A 2JMCA 3OS1A 1QVGS 3RR6A 4FCYA 5KYNA 4M77A 2PVOB 4E7SA 1EZZB 1T3LA 5CKFA 3VRZA 3SWNB 3CCUT 2BKDN 2E10A 2NUPA 2OTJQ 3CD6A 5KYXA 2YXYA 2BZ8A 1KC8U 1WHKA 3NGPA 4KGVB 2EGAA 4GBQA 1B7TA 1YHQT 4F7UF 5EC7A 2LC4A 1X01A 1WLPB 3QJ6A 4KBMB 1H641 2ENMA 2J06A 1H3HA 2QEXQ 1VQPT 4FSSA 1G3WA 1M8VA 3JB9F 2CZ6B 2XKOC 2DPPB 3QWYA 1IB8A 1VQ9Q 2MF2A 2V8KA 2CH4A 3RDVA 1ZHIA 3E9GA 2ROTA 3FJ5A 2BIVA 3KFVA 5LJ5j 1NG2A 1RAIB 1KQ1A 3OMCA 3L2VA 2DF6A 5GAMj 2DAQA 5D6WA 2YUOA 4ZNXA 2AZVA 5GANg 1G3TA 2DKGA 1VA7A 3RKWA 3GF5A 3QSUA 2CT4A 3LWHA 1YBYA 2FVUA 3M58A 4XTWA 4C0FA 2YSQA 2DJQA 4KH0B 2DEUA 2CSQA 4ZGDB 2OAUA 2PVDB 2CP3A 3JCMg 3SWNC 3PFSA 1YI2Q 4NL3A 3CMAT 2NUPB 3PMTA 2JJ9A 5C6SA 5KYXB 4FT4A 5CIUA 3MCAB 1D0XA 1VQNA 4D8DA 5GMKm 5IN1A 2JN0A 1X2QA 3P8BB 2NUTA 2Y4YA 4PJOD 3GBQA 1UGRB 1W2BS 4LD9K 2E12A 3A5ZB 2D0NA 1BIAA 1BI1A 5DLOA 4ZTFA 4KUIA 1Q82C 1M1GA 2RHZA 2CS7A 3VUBA 1AD5A 3FJPA 1PSEA 3QJYA 1QCNA 3MO8A 3CD6Q 2CH4W 5KYWA 4C92G 2ZPEB 1YWOA 2EQKA 4AG1C 4ANJA 1RLQC 2J6OA 5L23A 3OB9A 5LJ5f 4DEYA 1GL5A 4CC7A 2VWFA 3I55Q 1HJDA 1R0BG 3RESA 2DBMA 1WHLA 2H3JA 1JU5C 1QCOA 2AIRB 4RTZA 1TUGB 2E65A 3RERA 1QWFA 3CCST 1Y0MA 4ZTJA 2A28A 4F7UE 2M9UA 4MMLA 3RMSA 3UWNA 4M77C 2JUFA 4OMLA 3CCRT 4HCBA 4KT0E 3ULRB 2KGTA 2L3SA 3D7SB 4E47A 4ATOA 3UPUA 3JCMQ 3OYAA 1HYOA 4M77F 2YLBA 4QVCA 2G3RA 3OYBA 4JRQA 3JB9D 4C92A 4JS5A 1FMKA 3SD4A 1Z9ZA 3URGA 3E9FA 1OPLA 2ED0A 4LUDA 1K1ZA 1KFZA 1G83A 4P5NA 1X27A 2DXCA 5GAN6 1K73R 2RB6A 1JEGA 1NLOC 1Q7YR 1NJIR 4CI0C 3LWIA 1N8RU 5FRMA 2A0FB 1VIEA 2O88A 1VQ7A 2BUDA 4M7DC 3A98A 1YNZA 5GAN5 2ZZDA 1K73U 1VQNQ 1YN8A 1Q7YU 4M7DF 1YJNA 1SHGA 1NJIU 5CKDA 2CT3A 3CMEA 2A3LA 3CC4A 3UATA 1PCXA 1X2KA 5KCHA 3E1SA 3EGDB 5FWCA 1YIJA 1UG1A 2SRCA 3CCQT 1UJ0A 2DFUA 3OYNA 1OYXA 3CCMT 1YITA 2JT4A 1ZBJA 4CC3A 2JS0A 4OGCA 1MMGA 2C06A 2COWA 5IT9E 3QXEB 3A8OB 3LH0A 1RI0A 2FZCB 4C92B 4A63B 2LX9A 2E4HA 1QQJA 1F1BB 1UHCA 3ZFJA 3G71A 1M1FA 2LT1A 2W10A 4EMKA 1IREB 4YTLA 4M7AG 2DE0X 2DMOA 3QZ5B 2WSEE 3J7AF 1PKSA 4QQDA 5GAN4 1VQ8A 3OYHA 3P8HA 1M90R 1UEBA 4HCZA 4IIMA 4XU2A 1Q86R 3M57A 2KI7A 2VXFA 5CVIA 3TQ7P 4A4EA 1AWOA 3E2UA 4M78G 3I9QA 2EYWA 5KYUA 1S1NA 1XTDA 2ZPBB 4QVZA 1KQSS 1NZ9A 4M77E 3RMQA 2DO3A 4Z88A 1QLYA 4JRPA 3EG3A 3CC7A 3THKA 2IG0A 4L59A 4M7AA 1VQ7Q 1RACB 2OAWA 1N27A 1QMCA 2LT4A 1KD1R 1D0ZA 5AT1B 2F1LA 1H8KA 4J5YA 2QQAA 1ZSZB 3CCUA 3X24B 3A8GB 2YUQA 1ABQA 1M9SA 2K57A 4QQGA 3CMEQ 4C92C 1KQ2A 1VQOT 3CC4Q 1FMWA 4NL2A 2EJ9A 4XAXB 2K79A 1YHQA 1GRIA 3L42A 4GLMA 3VKIA 4M78A 3DLLA 1YIJQ 4J9CA 1KD1U 1Q82U 2RQRA 3G4ST 4EMKB 4M7DE 2EGEA 1YITQ 3OW2S 5GAMh 1W70A 3GNFB 3EG9B 4AFZC 5FLXE 3MEAA 5KYYA 2KT1A 6AT1B 5GAOm 2EYZA 5HK0A 2H8HA 4J6XA 2L3QA 1K4US 1OEBA 3MP1A 2P0PA 4KH1B 2KBTA 3G6ET 2E64A 1KK7A 4XTYA 1IZ6A 1OX8A 1XJWB 3CQTA 3HSBA 2DTHA 2BTTA 1D09B 5LJ5e 2EQUA 2EW3A 2RMOA 4N4GA 5KYUB 1GBRA 1K76A 2AK5A 1PNJA 1QWEA 1TUCA 2DYBA 1EFNA 2LQKA 3S6WA 1TOVA 3ZBDA 1VQ8Q 1QP3A 4M7AB 2NWMA 3OYEA 2K2VA 1Q95G 2RM4A 2OJ2A 4XU1A 2G6FX 3Q1JA 4BI4A 1V1CA 2RK2A 2R58A 1SRMA 1Q81C 5I11A 4AFUC 3CXCP 3CMAA 1IXDA 3RKYA 2FPFA 4RCBA 1SSFA 3VS6A 1DJ7B 3HP9A 2K5FA 1E6HA 2HQXA 3CC7Q 4EMKC 2YRDA 4DOVA 3JCMP 1SHFA 4D8KA 3WVEB 1O75A 1WJSA 2FRWA 4NS5A 1I5LA 1WPYA 1JJ2S 5LJ3d 2DERA 3CCUQ 4RTTA 1W6XA 3LW5E 4Q5WA 1MGQA 1OU9A 2E6ZA 4JDSA 3MP6A 1R8OB 1O9SA 2HSPA 3TSZA 1YHQQ 2K2MA 4FYYB 5KCOA 2FZGB 2ESWA 1KHIA 4A54A 5GAMd 4C5GA 3MP8A 3ER0A 1M5Q1 3H41A 3OS5A 5GAOp 1WJRA 2LJ1A 4N4IA 2JM8A 2VGNA 1UE9A 3CCSA 4M7AC 4D6WA 3EG0A 1OI1A 2LVMA 2EJGA 2DZ9A 3KUFA 3CCRA 2DXTA 5GAOq 3V7CA 3RUXA 2BZYA 3ME9A 5CR2A 4C92D 1LOJA 2IPOB 3H0IA 1HXDA 2GFUA 2KDSA 5FU7B 2NUZA 3M5AA 2YRCA 8ATCB 1M3AA 4M78C 3HTRA 3GP8A 3M0PA 2PUOB 4RG2A 4BDYA 5GAN3 1ARKA 2RI3A 4FYVB 4BI3A 1TXQA 4M78F 2CSIA 3HHTB 3L2QA 3FDRA 5FU6C 3CBMA 3L1AA 1A0NB 2X4JA 3CMAQ 1T3SA 3VU3C 3PNWC 1AOJA 1IO6A 2KYMA 3QG1A 3EFSA 4B9WA 1AHJB 1ZQ1A 2WSFE 2KYBA 1WQWA 3CBOA 3INZA 2O9VA 2HD0A 4PJOC 2QA4T 3VS5A 3S3MA 1FYNA 2HDAA 3RIRA 5D6YA 4HCKA 2FHDA 4MDXA 3CCJA 2HEQA 4PJOF 3V7SA 1VYVA 2HAXA 3CCQA 5I2SA 2XDPA 4WCIA 1W2BP 4AG2C 3CCMA 2HBPA 4ZGEB 2M16A 2MOXA 1U1SA 2J6FA 1MMDA 2GGRA 2C0IA 1K8AR 4RTYA 2GQVA 2DNUA 2RNAA 1VIFA 1JB0E 1MUZA 3OMGA 2FYKA 1VQ6T 3BW1A 1I4K1 2SEMA 1CKAA 1EIFA 1LCKA 4BD3A 5CAIA 2M1HA 2QDLA 1KC8R 1M2OA 2DM1A 2HZYA 3VUZA 1UJYA 1WHJA 5GANh 4AT1B 2GTOA 2RA2A 2P4RA 2VB6A 1B3QA 2KSSA 3L2WA 4BY6C 2EQJA 1QCFA 1K8AU 3SEMA 3HFOA 4JLIA 3CCSQ 4J9GA 4C0DC 2ZCFB 5C0MA 1XNIA 2GCXA 2XU8A 3CCRQ 2XDBA 1UGQB 3SHWA 1HK9A 4XQ3A 1BB9A 1TTHB 2K3BA 2QXFA 2LCLA 2DBKA 3ZL7C 3CCLT 3I55A 4OF1A 4XTUA 1ZUUA 2DL5A 4PJJA 2KAFA 4X1VA 4EMHA 4AFSC 3CXCA 1NEBA 5LJ3j 3O8VA 4QT7A 3LLRA 4LE9A 2DXBA 1GXIE 3M9QA 4J6YA 5GAN7 5GJVB 3PIOA 4M7AD 3NTKA 1VQLT 2K6DA 2MAMA 4OB3B 3OYYA 3LH5A 3A8LB 1Q81U 5J26A 2DYIA 5KH6A 2KRSA 1M3CA 2YDLA 1SKUB 4E7IA 2V1RA 3OY9A 4OVAA 4PFZA 3EHRA 4HVVA 1R0CB 2K9GA 3VS4A 1QVGA 1IHWA 4M78E 3SDZA 1SRLA 2A7YA 3PIPA 3CEYA 4M78D 2VUBA 3OYJA 3CCJQ 2M51A 4LDVA 2DEQA 3OBWA 3CCQQ 3G4SA 2JW4A 3G1JA 3M54A 5FRNA 3KBGA 3CCMQ 4E2FB 3TCJA 4JZ4A 1KG1A 2XK0A 4TVRA 2EQIA 5GAN8 4BDZA 4PJOE 2JTEA 5GANd 3H6ZA 2DRMA 1NYGA 4NOYA 4E7ZA 1GFCA 4C0GA 3UA6A 4J7IA 2OTLT 2LTOA 3G6EA 2LP5A 2FO0A 4ZN3A 2FEIA 3EGXB 1H3ZA 2HSEB 4BE0A 5IXFA 1I07A 2KROA 3JCMd 2ROLA 2QQ9A 1MMNA 4FYWB 3JB9J 1GCQA 3TREA 4EIKA 1MHNA 1OZ3A 3X26B 2HMAA 1YJWT 3G7ZA 3JCMW 3SFMA 3DKMA 3JSCA 5GAMf 4OGEA 4FIBA 2DILA 3IQLA 1TH7A 3EGDA 5J39A 4PNOA 1VQ4T 1I1JA 2ZPHB 1ZBXA 3NFCA 2E1HA 1QKXA 1K9MC 2MI6A 5I2MA 1WDXA 4M75B 1N8RR 2E70A 2RHXA 1FMVA 3V8KA 3M59A 1W2BA 4O6JA 3A1PA 1Y96B 2EYQA 3ZEHA 1BCOA 4KGXB 3CCET 4EMGA 1AWJA 4WTOB 4CC4B 2FB7A 3EFOB 2O31A 1U5SA 5GMKh 1OU8A 3VYHB 1EX4A 1ABOA 3CBPA 3G4SQ 2D6FA 3REAB 2XDDA 1ZUKA 1N6AA 1PKTA 2P0KA 4WF2A 4J9HA 2RQVA 2HBWA 4HVUA 2R5MA 5L8RE 4Z02A 3VS2A 4EDUA 4FSXA 3JAME 2KRNA 5HKCA 1UFFA 2AT1B 1YP5A 3OW2P 3MPUB 2MMPA 2BE7D 4BE2A 3JB9H 3G6EQ 2JMAA 2DD4A 1M1KC 2DETA 2ABLA 1RLPC 3PMIA 2FZKB 1FWZA 3U23A 3PT9A 2K3YA 3S3OA 2D9TA 1RADB 1AEYA 1J3TA 2EJFA 3OYIA 1ZSZA 4DBQA 3CCVT 2YHTA 2O4XA 1V29B 5FWBA 3OYKA 2C0TA 5J3BA 1D1AA 1HSQA 3OYCA 4JS4A 4BI8B 4C0ZA 3BE3A 2O01E 1WYXA 2L3RA 4PJNA 5GJWB 1G3YA 2DLPA 1ZA2B 2L2PA 3EG9A 5GANj 2QA4A 1PD0A 1JO8A 2CZ0B 2KVQG 2XG8D 2IVWA 4C8QB 3RNJA 1GCQC 1WA7A 1NM7A 4RTWA 3M0QA 2DK3A 2JZ2A 3EFRA 4AFQC 4LN2A 3VS7A 2EFIA 2F5KA 3SB2A 1PD1A 1VQ6A 4LNPA 2RH2A 2RHIA 1D3BB 1PRLC 9ATCB 4IKFA 1ZX6A 4PFOA 4OMOA 4PKCC 2MYSA 1BCMA 3QKJA 3JCMJ 1Q82R 3M56A 4J83A 3FB9A 4DOWA 4JRKA 2J7IA 1PWTA 2LJ3A 3M0RA 3X20B 3I35A 2QK0A 2O4XB 5LJ3h 1RL2A 2A36A 4L6V5 3A8MB 5FW9A 3VS0A 1XOVA 2JOYA 2VV5A 3H0HA 3BDLA 3CCLA 2CGHA 1C1AA 4C92F 1VQPA 4UC4A 4II1A 4IURA 2YUPA 2E5QA 4OP0A 1PHTA 2XIDA 1D0YA 3M55A 1MNEA 1IGQA 2ZPIB 3PTAA 5LJ3e 4E7JA 5HCKA 4J7FA 1KQSA 4DBHA 2KNBB 3WVDB 2K5IA 1OV3A 2W0ZA 3JRZA 1AVZC 1UB4A 4Z8AA 2FL7A 1VQNT 2RHUA 1QVFS 1VYUA 5GAMe 1KSWA 5CQXA 1K9AA 1RAHB 1G8XA 4HVWA 1I5OB 1K9MU 1Y07A 3J81E 2CUBA 2QA4Q 2EYXA 2RHYA 1U8RA 4IUUA 2Y4XA 1B34B 2FPEA 3KXTA 2PQWA 3PE0A 1OQKA 2M02A 3CPWS 1ZSZC 2QQRA 2P0QA 2JS2A 2DTIA 5ECAA 4F7UG 2QYZA 5DLQE 1YJ9T 2QQBA 1ZLMA 1D1CA 1TWBA 2GQIA 3V7RA 1VQ6Q 1PC0A 1LVKA 3OW2A 2K4YA 4LUEA 1RUWA 2OTLA 2X35A 2V8JA 2VVKA 2F2VA 2VASA 1UGVA 2HKQB 3M4GA 1NPRA 1UGPB 1WIEA 5LJ5g 2KXCA 1QVGP 2X4YA 3TSWA 3UT1A 3VYGA 1JXOA 4FW2A 5GAMg 2R57A 4KULA 3LGFA 2HQHA 4F14A 2EBPA 1IGUA 2DVJA 1CSKA 4N4HA 2LQNA 4F7UA 2RJCA 2KK4A 3T9NA 1MV3A 4F04B 1VYTA 3CCLQ 1AWXA 2RJFA 3JB9I 1VQPQ 4ZN1A 5IH2A 3EH1A 4QQ6A 3C12A 2LRQA 1ZA1B 4IUVA 2EPDA 4HT9A 4XTZA 2M0YA 5KE2A 2AHJB 1VQ4A 4DA4A 1QP2A 1WFWA 4RCCA 1VQKT 3I5RA 2X4XA 2VC8A 1PG5B 2OX7A 3RKXA 5GMKj 3OS2A 1WHHA 4PK4A 4C92E 3OSSC 1I0CA 2EGCA 4M7AF 4CC2A 4FYXB 2CREA 2JTMA 1MV0B 4IIOA 1VUBA 2Y90A 1TUDA 3JCMV 1RI9A 1TSFA 1YJNT 2D8HA 3NTIA 1FX7A 3CCEA 2D8JA 2QTXA 5M9OA 3OYGA 1JJ2A 4R0KA 2ECZA 1T0JA 4M4ZA 3QPHA 2VKNA 1YIJT 3QUIA 4RMOA 2EKHA 2VYTA 1YFNA 3HRUA 2O9SA 2FPDA 2DVEA 5DM7R 1U1TA 1Y7XA 2A37A 1S72T 2GTJA 4F7UB 4J9DA 3QIIA 4OB0B 2P4TA 1VQMT 2X9HA 1V76A 2KXDA 1LNXA 2OTLQ 2COZA 1UGSB 4LDYA 4X9DA 4A4FA 3JCMX 1G2BA 1RAFB 3UF4A 1GBQA 5DY9A 5A0DA 4J9IA 3G71T 4FT2A 3QYHB 4ELZC 2CZ1B 3VV0A 2CUDA
chains in the Genus database with same CATH topology
5IHNA 5IXFA 1I07A 2DA9A 1GFDA 2RN8A 2KROA 4E6RA 1UHCA 2AKKA 2ROLA 2DX1A 2W10A 1UTIA 2I0NA 1K0XA 1GCQA 2DE0X 2B86A 2DMOA 4EIKA 1PKSA 2RQUA 4ESRA 1YCSB 4IIMA 3M0SA 3VS3A 2DILA 3IQLA 4ORZA 1AWOA 1W1FA 1K0SA 4F16A 1I1JA 2LCSA 5I22A 2OI3A 2LNHB 4JJDA 3I9QA 2EYWA 1S1NA 3EGUA 1QKXA 1X69A 1ZUYA 2PZ1A 2X3XD 1E6GA 4Z88A 1WDXA 1UECA 2PTKA 1QLYA 2F2WA 3EG3A 4HXJA 3THKA 4F17A 2C0OA 2FG0A 4OMQA 2OAWA 1M8MA 1H8KA 2XMFA 1AWJA 2ED1A 4CC4B 1WI7A 2YUQA 2O31A 1ABQA 4RTUA 1U5SA 5IXBA 1B07A 1ABOA 2K79A 2MIOA 1GRIA 4GLMA 1SSHA 3REAB 1ZUKA 2DL8A 2MCNA 1X6GA 1PKTA 3QWXX 3NMZC 1U3OA 4J9HA 2LX7A 2RQVA 4J9CA 2HBWA 2RQRA 4HVUA 2EGEA 1WXBA 2KEAA 3VS2A 2KRNA 1UFFA 3C0CA 1U06A 1YP5A 2IIMA 1W70A 4AFZC 1BK2A 2KT1A 2EYZA 4RTXA 2H8HA 2L3QA 2JMAA 3EG1A 1K4US 2F2XA 1OEBA 1Y57A 2ABLA 2KBTA 1RLPC 1UHFA 2J6KA 1AZEA 3U23A 3CQTA 3I5SA 2BTTA 1BBZA 3EHQA 1T0HA 2GNCA 1BU1A 2EW3A 2RMOA 1GBRA 1K76A 2AK5A 1AEYA 1PNJA 1QWEA 1J3TA 1TUCA 2DYBA 2V1QA 3NPFA 1PRMC 4J9BA 1EFNA 4K11A 4Z89A 2DL4A 5FWBA 1UUEA 2C0TA 2NWMA 1JXMA 2OJ2A 1HSQA 1KIKA 2G6FX 1V1CA 1SRMA 2EVRA 1TG0A 2BZXA 3M0UA 3RBBB 5I11A 1WYXA 4AFUC 5GJWB 2FPFA 2DLPA 3R6NA 4RTVA 2RPNA 5IHIA 2L2PA 3VS6A 1E6HA 3JV3A 1YWPA 4OMNA 1JO8A 1HD3A 3RNJA 1OPKA 1CKBA 1GCQC 3EG2A 4J9EA 2DL3A 1SHFA 1WA7A 1NM7A 2O2OA 1GCPA 4D8KA 4RTWA 3M0QA 2FRWA 4RUGA 2RQWA 2LMJA 1H92A 2KR3A 2JMCA 4AFQC 1QKWA 4LN2A 3VS7A 4RTTA 1N5ZA 1W6XA 1AZGB 4LNPA 1T3LA 3TVTA 1SPKA 3VRZA 1WXUA 2HSPA 1PRLC 3TSZA 1KJWA 2K2MA 1ZX6A 2BZ8A 2ESWA 4OMOA 3NGPA 2EGAA 3O5ZA 4GBQA 5EC7A 1WLPB 2J7IA 1PWTA 2ENMA 2J06A 2LJ3A 3M0RA 1H3HA 3I35A 3H41A 2LJ1A 2JM8A 2AZSA 1X6BA 1UE9A 4FSSA 2A36A 3EG0A 5FW9A 3QWYA 3VS0A 1XOVA 2L0AA 3H0HA 2CH4A 2D1XA 1M3BA 2ROTA 2BZYA 1JQQA 3FJ5A 3KFVA 2YUPA 1Z9QA 1NG2A 3H0IA 3VRYA 1PHTA 2K7AA 2NUZA 4JZ3A 2DF6A 2YUOA 4ZNXA 2AZVA 3VS1A 1M3AA 1E7OA 2L3PA 3M0PA 1ARKA 3PVQA 5HCKA 1VA7A 1M30A 2EYYA 2CT4A 2JM9A 2KNBB 1OV3A 2LJ0A 2W0ZA 2CSIA 2YSQA 1AVZC 2DJQA 2CSQA 4Z8AA 1A0NB 1T3SA 1VYUA 1AOJA 1KSWA 1K9AA 1IO6A 4HVWA 2KYMA 3PVLA 2KYBA 2CUBA 2EYXA 2O9VA 3REBB 1M27C 1NYFA 2AKLA 2FPEA 4D8DA 3VS5A 3PE0A 1FYNA 2HDAA 4HCKA 1X2QA 2JS2A 4Y92A 2HEQA 2YT6A 2J05A 1VYVA 5ECAA 3GBQA 1ZLMA 4WCIA 4AG2C 2D0NA 1NEGA 2GQIA 2J6FA 2MOXA 5IHKA 2GGRA 2C0IA 4RTYA 2DNUA 2RNAA 2GBQA 4LUEA 1MUZA 1AD5A 1RUWA 1SEMA 2SEMA 1CKAA 1LCKA 4J9FA 2CDTA 2CH4W 1ZSGA 2QDLA 2VVKA 2F2VA 2DM1A 1UGVA 1UJYA 1YWOA 2GTOA 4AG1C 2P4RA 1RLQC 2J6OA 5L23A 1B3QA 1WIEA 1X43A 2KXCA 4DEYA 2LQWA 1GL5A 3TSWA 4CC7A 2VWFA 1QCFA 3SEMA 1HJDA 3UA7A 2DBMA 1JXOA 4J9GA 1JU5C 2DRKA 4RTZA 4F14A 2EBPA 1QWFA 1CSKA 2DVJA 1Y0MA 2LQNA 2X3WD 2A28A 1MV3A 3SHWA 1VYTA 2KE9A 4KRTA 1BB9A 2LZ6B 2K3BA 1AWXA 2KRMA 4OMLA 2DBKA 5IH2A 3ULRB 2KGTA 2L3SA 3ZL7C 1ZUUA 2EPDA 2FRYA 2DL5A 4X1VA 2M0YA 2A08A 2JXBA 1WFWA 4AFSC 1NEBA 4JPBW 3I5RA 1AWWA 1FMKA 4QT7A 1Z9ZA 1OPLA 4LE9A 2ED0A 1I0CA 4LUDA 2EGCA 1K1ZA 2PNIA 2RF0A 5GJVB 1KFZA 1G83A 4CC2A 1X27A 2CREA 1JEGA 2K6DA 1NLOC 1MV0B 4IIOA 3LH5A 1TUDA 1RI9A 4JJCA 2KRSA 1M3CA 2YDLA 2O88A 2V1RA 4DEXA 2D8HA 3H0FA 3EHRA 4HVVA 2D8JA 2K9GA 3A98A 3VS4A 4R0KA 1SRLA 1YNZA 2ECZA 1T0JA 4M4ZA 2VKNA 1YN8A 2E5KA 2EKHA 1SHGA 3M0TA 1WX6A 2HCKA 2CT3A 2DL7A 2M51A 2O9SA 2FPDA 4OMMA 3UATA 2A37A 1OOTA 2JW4A 1X2KA 2YUNA 4OMPA 5FWCA 1UG1A 2SRCA 2GTJA 4JZ4A 1UJ0A 4J9DA 1NLPC 1UDLA 2KT8A 2EQIA 2JT4A 2KXDA 1ZBJA 4CC3A 2JS0A 2JTEA 3NHNA 2DRMA 1NYGA 1GFCA 1G2BA 3UA6A 3UF4A 1GBQA 4J9IA 2LP5A 2FO0A 2FEIA 4JJBA 1WXTA 2RQTA 4A63B 2CUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IHN A;  5IXF A;  1I07 A;  2DA9 A;  1GFD A;  2RN8 A;  2KRO A;  4E6R A;  1UHC A;  2AKK A;  2ROL A;  2DX1 A;  2W10 A;  1UTI A;  2I0N A;  1K0X A;  1GCQ A;  2DE0 X;  2B86 A;  2DMO A;  4EIK A;  1PKS A;  2RQU A;  4ESR A;  1YCS B;  4IIM A;  3M0S A;  3VS3 A;  2DIL A;  3IQL A;  4ORZ A;  1AWO A;  1W1F A;  1K0S A;  4F16 A;  1I1J A;  2LCS A;  5I22 A;  2OI3 A;  2LNH B;  4JJD A;  3I9Q A;  2EYW A;  1S1N A;  3EGU A;  1QKX A;  1X69 A;  1ZUY A;  2PZ1 A;  2X3X D;  1E6G A;  4Z88 A;  1WDX A;  1UEC A;  2PTK A;  1QLY A;  2F2W A;  3EG3 A;  4HXJ A;  3THK A;  4F17 A;  2C0O A;  2FG0 A;  4OMQ A;  2OAW A;  1M8M A;  1H8K A;  2XMF A;  1AWJ A;  2ED1 A;  4CC4 B;  1WI7 A;  2YUQ A;  2O31 A;  1ABQ A;  4RTU A;  1U5S A;  5IXB A;  1B07 A;  1ABO A;  2K79 A;  2MIO A;  1GRI A;  4GLM A;  1SSH A;  3REA B;  1ZUK A;  2DL8 A;  2MCN A;  1X6G A;  1PKT A;  3QWX X;  3NMZ C;  1U3O A;  4J9H A;  2LX7 A;  2RQV A;  4J9C A;  2HBW A;  2RQR A;  4HVU A;  2EGE A;  1WXB A;  2KEA A;  3VS2 A;  2KRN A;  1UFF A;  3C0C A;  1U06 A;  1YP5 A;  2IIM A;  1W70 A;  4AFZ C;  1BK2 A;  2KT1 A;  2EYZ A;  4RTX A;  2H8H A;  2L3Q A;  2JMA A;  3EG1 A;  1K4U S;  2F2X A;  1OEB A;  1Y57 A;  2ABL A;  2KBT A;  1RLP C;  1UHF A;  2J6K A;  1AZE A;  3U23 A;  3CQT A;  3I5S A;  2BTT A;  1BBZ A;  3EHQ A;  1T0H A;  2GNC A;  1BU1 A;  2EW3 A;  2RMO A;  1GBR A;  1K76 A;  2AK5 A;  1AEY A;  1PNJ A;  1QWE A;  1J3T A;  1TUC A;  2DYB A;  2V1Q A;  3NPF A;  1PRM C;  4J9B A;  1EFN A;  4K11 A;  4Z89 A;  2DL4 A;  5FWB A;  1UUE A;  2C0T A;  2NWM A;  1JXM A;  2OJ2 A;  1HSQ A;  1KIK A;  2G6F X;  1V1C A;  1SRM A;  2EVR A;  1TG0 A;  2BZX A;  3M0U A;  3RBB B;  5I11 A;  1WYX A;  4AFU C;  5GJW B;  2FPF A;  2DLP A;  3R6N A;  4RTV A;  2RPN A;  5IHI A;  2L2P A;  3VS6 A;  1E6H A;  3JV3 A;  1YWP A;  4OMN A;  1JO8 A;  1HD3 A;  3RNJ A;  1OPK A;  1CKB A;  1GCQ C;  3EG2 A;  4J9E A;  2DL3 A;  1SHF A;  1WA7 A;  1NM7 A;  2O2O A;  1GCP A;  4D8K A;  4RTW A;  3M0Q A;  2FRW A;  4RUG A;  2RQW A;  2LMJ A;  1H92 A;  2KR3 A;  2JMC A;  4AFQ C;  1QKW A;  4LN2 A;  3VS7 A;  4RTT A;  1N5Z A;  1W6X A;  1AZG B;  4LNP A;  1T3L A;  3TVT A;  1SPK A;  3VRZ A;  1WXU A;  2HSP A;  1PRL C;  3TSZ A;  1KJW A;  2K2M A;  1ZX6 A;  2BZ8 A;  2ESW A;  4OMO A;  3NGP A;  2EGA A;  3O5Z A;  4GBQ A;  5EC7 A;  1WLP B;  2J7I A;  1PWT A;  2ENM A;  2J06 A;  2LJ3 A;  3M0R A;  1H3H A;  3I35 A;  3H41 A;  2LJ1 A;  2JM8 A;  2AZS A;  1X6B A;  1UE9 A;  4FSS A;  2A36 A;  3EG0 A;  5FW9 A;  3QWY A;  3VS0 A;  1XOV A;  2L0A A;  3H0H A;  2CH4 A;  2D1X A;  1M3B A;  2ROT A;  2BZY A;  1JQQ A;  3FJ5 A;  3KFV A;  2YUP A;  1Z9Q A;  1NG2 A;  3H0I A;  3VRY A;  1PHT A;  2K7A A;  2NUZ A;  4JZ3 A;  2DF6 A;  2YUO A;  4ZNX A;  2AZV A;  3VS1 A;  1M3A A;  1E7O A;  2L3P A;  3M0P A;  1ARK A;  3PVQ A;  5HCK A;  1VA7 A;  1M30 A;  2EYY A;  2CT4 A;  2JM9 A;  2KNB B;  1OV3 A;  2LJ0 A;  2W0Z A;  2CSI A;  2YSQ A;  1AVZ C;  2DJQ A;  2CSQ A;  4Z8A A;  1A0N B;  1T3S A;  1VYU A;  1AOJ A;  1KSW A;  1K9A A;  1IO6 A;  4HVW A;  2KYM A;  3PVL A;  2KYB A;  2CUB A;  2EYX A;  2O9V A;  3REB B;  1M27 C;  1NYF A;  2AKL A;  2FPE A;  4D8D A;  3VS5 A;  3PE0 A;  1FYN A;  2HDA A;  4HCK A;  1X2Q A;  2JS2 A;  4Y92 A;  2HEQ A;  2YT6 A;  2J05 A;  1VYV A;  5ECA A;  3GBQ A;  1ZLM A;  4WCI A;  4AG2 C;  2D0N A;  1NEG A;  2GQI A;  2J6F A;  2MOX A;  5IHK A;  2GGR A;  2C0I A;  4RTY A;  2DNU A;  2RNA A;  2GBQ A;  4LUE A;  1MUZ A;  1AD5 A;  1RUW A;  1SEM A;  2SEM A;  1CKA A;  1LCK A;  4J9F A;  2CDT A;  2CH4 W;  1ZSG A;  2QDL A;  2VVK A;  2F2V A;  2DM1 A;  1UGV A;  1UJY A;  1YWO A;  2GTO A;  4AG1 C;  2P4R A;  1RLQ C;  2J6O A;  5L23 A;  1B3Q A;  1WIE A;  1X43 A;  2KXC A;  4DEY A;  2LQW A;  1GL5 A;  3TSW A;  4CC7 A;  2VWF A;  1QCF A;  3SEM A;  1HJD A;  3UA7 A;  2DBM A;  1JXO A;  4J9G A;  1JU5 C;  2DRK A;  4RTZ A;  4F14 A;  2EBP A;  1QWF A;  1CSK A;  2DVJ A;  1Y0M A;  2LQN A;  2X3W D;  2A28 A;  1MV3 A;  3SHW A;  1VYT A;  2KE9 A;  4KRT A;  1BB9 A;  2LZ6 B;  2K3B A;  1AWX A;  2KRM A;  4OML A;  2DBK A;  5IH2 A;  3ULR B;  2KGT A;  2L3S A;  3ZL7 C;  1ZUU A;  2EPD A;  2FRY A;  2DL5 A;  4X1V A;  2M0Y A;  2A08 A;  2JXB A;  1WFW A;  4AFS C;  1NEB A;  4JPB W;  3I5R A;  1AWW A;  1FMK A;  4QT7 A;  1Z9Z A;  1OPL A;  4LE9 A;  2ED0 A;  1I0C A;  4LUD A;  2EGC A;  1K1Z A;  2PNI A;  2RF0 A;  5GJV B;  1KFZ A;  1G83 A;  4CC2 A;  1X27 A;  2CRE A;  1JEG A;  2K6D A;  1NLO C;  1MV0 B;  4IIO A;  3LH5 A;  1TUD A;  1RI9 A;  4JJC A;  2KRS A;  1M3C A;  2YDL A;  2O88 A;  2V1R A;  4DEX A;  2D8H A;  3H0F A;  3EHR A;  4HVV A;  2D8J A;  2K9G A;  3A98 A;  3VS4 A;  4R0K A;  1SRL A;  1YNZ A;  2ECZ A;  1T0J A;  4M4Z A;  2VKN A;  1YN8 A;  2E5K A;  2EKH A;  1SHG A;  3M0T A;  1WX6 A;  2HCK A;  2CT3 A;  2DL7 A;  2M51 A;  2O9S A;  2FPD A;  4OMM A;  3UAT A;  2A37 A;  1OOT A;  2JW4 A;  1X2K A;  2YUN A;  4OMP A;  5FWC A;  1UG1 A;  2SRC A;  2GTJ A;  4JZ4 A;  1UJ0 A;  4J9D A;  1NLP C;  1UDL A;  2KT8 A;  2EQI A;  2JT4 A;  2KXD A;  1ZBJ A;  4CC3 A;  2JS0 A;  2JTE A;  3NHN A;  2DRM A;  1NYG A;  1GFC A;  1G2B A;  3UA6 A;  3UF4 A;  1GBQ A;  4J9I A;  2LP5 A;  2FO0 A;  2FEI A;  4JJB A;  1WXT A;  2RQT A;  4A63 B;  2CUD A; 
#chains in the Genus database with same CATH topology
 5IHN A;  2XI9 A;  2AKK A;  3CCV A;  1NBE B;  5GAO l;  2DX1 A;  2I0N A;  5HY6 A;  4A4K A;  3L2U A;  5GAO n;  2B86 A;  5FU7 C;  4JJN K;  2HKN A;  3DB3 A;  1QVP A;  3J80 E;  4ESR A;  1YCS B;  3FC3 A;  1TU0 B;  4LDX A;  1OZ2 A;  2CZ7 B;  3M0S A;  3VS3 A;  3CC2 T;  1VQ4 Q;  7AT1 B;  1K73 C;  4RKU E;  1Q7Y C;  5CK9 A;  1NJI C;  4ORZ A;  1W1F A;  3C94 A;  3JCM h;  2QTV A;  5I22 A;  3I56 T;  4JJD A;  1C6V X;  3EGU A;  4M7D G;  1X69 A;  1ZUY A;  3HL8 A;  2PZ1 A;  5GAN e;  2X3X D;  2DD5 A;  3AHU A;  4XU0 A;  1Q81 R;  2PTK A;  1UEC A;  3GIB A;  2F5T X;  4QVD A;  4HXJ A;  3EGX A;  3HRT A;  4C5H A;  4FM4 B;  4QW2 A;  4R55 A;  3OA6 A;  3CCE Q;  1OUL A;  4M7A E;  4MMK A;  1M8M A;  4M75 G;  1JBM A;  2HNI A;  2XMF A;  3HPW A;  3JCM e;  4ME7 A;  2GFA A;  2ED1 A;  1WI7 A;  2H3E B;  3TU4 K;  3F70 A;  5IXB A;  1B07 A;  2MIO A;  4GY5 A;  3QO3 A;  1SSH A;  2MK5 A;  2QAS A;  3H9N A;  4VUB A;  2MCN A;  1YCY A;  3QWX X;  1U3O A;  2EAY A;  2HQE A;  2LX7 A;  4M7D A;  4DBF A;  2R5A A;  3H8Z A;  1WXB A;  2KEA A;  1BI3 A;  4GLK A;  1VQO A;  3C0C A;  2IIM A;  4PFP A;  4E7K A;  1BK2 A;  4N0A A;  2CP7 A;  5A0L A;  4Y91 A;  3X28 B;  1RAB B;  4RTX A;  2DZC A;  4HKE A;  2F2X A;  2COY A;  3MEU A;  4M75 A;  2QAZ A;  3MKD A;  1IHV A;  4XU3 A;  1UHF A;  4E7H A;  3I5S A;  4KGZ B;  3EHQ A;  1OX9 A;  3BFM A;  1T0H A;  2GNC A;  1LJO A;  3NTH A;  3CCV Q;  1Y96 A;  1BU1 A;  1M90 C;  1IRX A;  1VOM A;  4M77 B;  1Q86 C;  2B8A A;  2V1Q A;  3NPF A;  3MET A;  4B9X A;  1PRM C;  5GAN 2;  4J9B A;  3GOX A;  1WGS A;  1Y71 A;  4K11 A;  4Z89 A;  2QGF B;  2DL4 A;  3EFO A;  1UUE A;  1VQ5 T;  2LDM A;  1W4S A;  1LPL A;  4JUV A;  4OB1 B;  1I81 A;  1NE8 A;  1KIK A;  5LJ3 f;  4XK8 E;  2JVV A;  2EVR A;  1TG0 A;  2BZX A;  3TEE A;  4OB2 B;  3V8L A;  5I21 A;  4PJL A;  4RTV A;  2E41 A;  5IHI A;  5D6X A;  4DQ2 A;  3QDR B;  3JV3 A;  1KD1 C;  3OQ5 A;  4L5G A;  4J6W A;  4M7D B;  1OPK A;  1YJ9 A;  3EG2 A;  5A2Q E;  2O2O A;  4FW1 A;  3OBY A;  2RQW A;  2VXE A;  2LMJ A;  1RAG B;  1FXX A;  2CP5 A;  5CKB A;  1QKW A;  5EG2 A;  4C8Q G;  1N5Z A;  2RI5 A;  1AZG B;  1KQS P;  3TVT A;  1SPK A;  3EAE A;  4MZM A;  2QG9 B;  1WXU A;  1X75 C;  2ZGW A;  1WHG A;  3VJP A;  1KJW A;  1WZO A;  4PL6 A;  5KE3 A;  4DBR A;  5FRO A;  4HCC A;  3MEW A;  3O5Z A;  2CP6 A;  3MEV A;  2OTJ T;  3QZ9 B;  3QYG B;  1X6O A;  1VQO Q;  2JTF A;  2LQ8 A;  2AZS A;  2E3I A;  1X6B A;  4OMF B;  5GAO r;  2QEX T;  2XIC A;  4BUG A;  2EWN A;  5GMK i;  2L0A A;  4X34 A;  2QI2 A;  2D1X A;  1M3B A;  3N5B B;  2NUT B;  4C8Q A;  4C5I A;  1VQ9 T;  1JQQ A;  2E6N A;  5LL6 S;  3HKS A;  1Z9Q A;  1VQK A;  2V26 A;  3VRY A;  2K7A A;  1N9S A;  4JZ3 A;  3GLX A;  2QDY B;  3VS1 A;  3DB4 A;  4FL6 A;  1E7O A;  4AMC A;  2L3P A;  1PM3 A;  4IUP A;  3PVQ A;  5GMK e;  3QBY A;  1M30 A;  2KQW A;  2EYY A;  1D3B A;  5KYW B;  4HA8 A;  2PU9 B;  2JM9 A;  5AYF A;  8AT1 B;  2LJ0 A;  1I8F A;  4N0A C;  3A8H B;  1R77 A;  2L5Q A;  2WAC A;  4M75 C;  3OYF A;  1QVF P;  3CCJ T;  3OYD A;  3PVL A;  1JRI A;  3REB B;  1M27 C;  1NYF A;  2L8D A;  2KMT A;  2AKL A;  4E7L A;  1YI2 T;  4M75 F;  2VGM A;  1YJ9 Q;  2X51 A;  3C4S A;  4Y92 A;  3CPW P;  2YT6 A;  2J05 A;  1S72 A;  1D1B A;  1TS9 A;  1VQM A;  2EIF A;  2XD0 A;  3MJX A;  1NEG A;  4XTV A;  5IHK A;  2GF7 A;  2GBQ A;  2F69 A;  5CO7 A;  1WNL A;  4LDU A;  1SEM A;  4J9F A;  2CDT A;  1ZSG A;  1M2V A;  3CD6 T;  1X43 A;  3AT1 B;  1JJ2 P;  2LQW A;  4FU6 A;  3C95 A;  1G3S A;  3UA7 A;  3OSV A;  5GMK l;  3R6O A;  4HT8 A;  2ATC B;  3I55 T;  2DRK A;  3PGG A;  3FRN A;  1B34 A;  2X3W D;  4C5E A;  2KE9 A;  4KRT A;  2LZ6 B;  2KRM A;  3ASK A;  2DJZ A;  3CC2 A;  2M0O A;  4PJM A;  1VQK Q;  1M90 U;  1WQ7 A;  2FRY A;  4X9C A;  1Q86 U;  3JCM b;  2A08 A;  2JXB A;  1WHM A;  4M77 D;  3UDC A;  2ZPF B;  4JPB W;  3I56 A;  1AWW A;  1BKB A;  3LGL A;  1XQH A;  4ZGJ B;  4BE1 A;  2MPX C;  4LDW A;  3V8J A;  2E3H A;  4Y28 E;  2PNI A;  2RF0 A;  4EPC A;  1YJN Q;  4PJO G;  3FLG A;  4V2S A;  4LD6 A;  2ZAE A;  4ELY C;  4JJC A;  3M4Y A;  4DEX A;  2QGG A;  3H0F A;  5GAN f;  1K9M R;  4C8Q C;  1VQL A;  5D7U A;  5LJ5 h;  2RD1 A;  1G5V A;  2I2L A;  4MZP A;  2E5K A;  2PUK B;  1M2V B;  2DIQ A;  2JNG A;  4C8Q F;  3M0T A;  1WX6 A;  1K8A C;  2HCK A;  4M7D D;  2EKO A;  2DTO A;  2DL7 A;  1PSF A;  3FIF A;  4LXC A;  1S72 Q;  4OMM A;  1OOT A;  3JCM f;  2YWW A;  2YUN A;  1VQM Q;  4OMP A;  3S3N A;  1KC8 C;  4M75 E;  3QDF A;  1NLP C;  1UDL A;  2KT8 A;  1BYM A;  4A4G A;  4PJO A;  1QW1 A;  4M75 D;  3EH2 A;  1RAE B;  3NHN A;  3G71 Q;  2RI2 A;  3GNG A;  3LYI A;  1N9R A;  2HL5 C;  2DXU A;  4JJB A;  1WXT A;  2RQT A;  3JB9 G;  2K5L A;  1GFD A;  2DA9 A;  4IUT A;  2RN8 A;  4A53 A;  5LJ3 g;  4E6R A;  1KHC A;  1M1K R;  3OS0 A;  1UTI A;  5A0G A;  1K0X A;  3X25 B;  1VQ5 A;  3BY7 A;  1SF9 A;  2RQU A;  3CC2 Q;  1BI2 A;  4PLI A;  1MMA A;  2CP2 A;  2NYS A;  2YLC A;  3HRS A;  4M78 B;  5CKE A;  4JRI A;  3M53 A;  3I56 Q;  1QVF A;  1M1K U;  3OYM A;  1K0S A;  4F16 A;  1YJW A;  4XTX A;  2LCS A;  4B6M A;  2D0Q B;  2OI3 A;  2LNH B;  5KYY B;  2K3X A;  5FU6 B;  1MND A;  3BDU A;  1C0M A;  4MDW A;  1E6G A;  2RJD A;  3CPW A;  2F2W A;  2ZPG B;  4MZT A;  2MWP A;  2BE9 B;  3MHX A;  4F17 A;  5IAY A;  5LJ5 d;  2C0O A;  4PJO B;  2FG0 A;  4OMQ A;  1VQL Q;  2V8I A;  3JCM c;  4R56 A;  3CPF A;  1VQ7 T;  1AT1 B;  1SG5 A;  2EQM A;  3OYL A;  2QQS A;  2Z0W A;  4RTU A;  2LCC A;  2RJE A;  2OTJ A;  2DL8 A;  3CME T;  1X6G A;  3CC4 T;  3NMZ C;  4C8Q E;  2L89 A;  4CRI A;  2X4W A;  2QEX A;  3QHS A;  1U06 A;  2XHC A;  4C8Q D;  4PLL A;  1YIT T;  1WJQ A;  2PVG B;  1RAA B;  4BB7 A;  4BY6 B;  2P84 A;  3EG1 A;  1VQ9 A;  4RG8 A;  2CYZ B;  4C0D B;  3SWN A;  1Y57 A;  2J6K A;  2LNV A;  2MWO A;  3HFN A;  1AZE A;  4A4H A;  4JLG A;  1BBZ A;  3L2R A;  3WXM B;  3L2Z A;  1VQ5 Q;  2YRV A;  3DLM A;  4KUD K;  2WSC E;  4M77 G;  1JXM A;  2KY9 A;  1VQ8 T;  3CXC S;  3M0U A;  3RBB B;  3LX7 A;  1YJW Q;  3E19 A;  2NLU A;  1N8R C;  2RK1 A;  1P92 A;  3FEO A;  3R6N A;  4BAC A;  3GPL A;  2RPN A;  2CP0 A;  4QKU A;  1YI2 A;  5CKH A;  4J8O A;  3P8D A;  1NPP A;  2CKK A;  1YWP A;  4OMN A;  1ACM B;  1HD3 A;  1CKB A;  4J9E A;  5CQY A;  2DL3 A;  1M4Z A;  1GCP A;  4O5V A;  2DIG A;  3CC7 T;  1BI0 A;  2RO0 A;  4RUG A;  2HL3 A;  1BIB A;  5HK3 A;  4IUQ A;  5CCA A;  1H92 A;  2KR3 A;  2JMC A;  3OS1 A;  1QVG S;  3RR6 A;  4FCY A;  5KYN A;  4M77 A;  2PVO B;  4E7S A;  1EZZ B;  1T3L A;  5CKF A;  3VRZ A;  3SWN B;  3CCU T;  2BKD N;  2E10 A;  2NUP A;  2OTJ Q;  3CD6 A;  5KYX A;  2YXY A;  2BZ8 A;  1KC8 U;  1WHK A;  3NGP A;  4KGV B;  2EGA A;  4GBQ A;  1B7T A;  1YHQ T;  4F7U F;  5EC7 A;  2LC4 A;  1X01 A;  1WLP B;  3QJ6 A;  4KBM B;  1H64 1;  2ENM A;  2J06 A;  1H3H A;  2QEX Q;  1VQP T;  4FSS A;  1G3W A;  1M8V A;  3JB9 F;  2CZ6 B;  2XKO C;  2DPP B;  3QWY A;  1IB8 A;  1VQ9 Q;  2MF2 A;  2V8K A;  2CH4 A;  3RDV A;  1ZHI A;  3E9G A;  2ROT A;  3FJ5 A;  2BIV A;  3KFV A;  5LJ5 j;  1NG2 A;  1RAI B;  1KQ1 A;  3OMC A;  3L2V A;  2DF6 A;  5GAM j;  2DAQ A;  5D6W A;  2YUO A;  4ZNX A;  2AZV A;  5GAN g;  1G3T A;  2DKG A;  1VA7 A;  3RKW A;  3GF5 A;  3QSU A;  2CT4 A;  3LWH A;  1YBY A;  2FVU A;  3M58 A;  4XTW A;  4C0F A;  2YSQ A;  2DJQ A;  4KH0 B;  2DEU A;  2CSQ A;  4ZGD B;  2OAU A;  2PVD B;  2CP3 A;  3JCM g;  3SWN C;  3PFS A;  1YI2 Q;  4NL3 A;  3CMA T;  2NUP B;  3PMT A;  2JJ9 A;  5C6S A;  5KYX B;  4FT4 A;  5CIU A;  3MCA B;  1D0X A;  1VQN A;  4D8D A;  5GMK m;  5IN1 A;  2JN0 A;  1X2Q A;  3P8B B;  2NUT A;  2Y4Y A;  4PJO D;  3GBQ A;  1UGR B;  1W2B S;  4LD9 K;  2E12 A;  3A5Z B;  2D0N A;  1BIA A;  1BI1 A;  5DLO A;  4ZTF A;  4KUI A;  1Q82 C;  1M1G A;  2RHZ A;  2CS7 A;  3VUB A;  1AD5 A;  3FJP A;  1PSE A;  3QJY A;  1QCN A;  3MO8 A;  3CD6 Q;  2CH4 W;  5KYW A;  4C92 G;  2ZPE B;  1YWO A;  2EQK A;  4AG1 C;  4ANJ A;  1RLQ C;  2J6O A;  5L23 A;  3OB9 A;  5LJ5 f;  4DEY A;  1GL5 A;  4CC7 A;  2VWF A;  3I55 Q;  1HJD A;  1R0B G;  3RES A;  2DBM A;  1WHL A;  2H3J A;  1JU5 C;  1QCO A;  2AIR B;  4RTZ A;  1TUG B;  2E65 A;  3RER A;  1QWF A;  3CCS T;  1Y0M A;  4ZTJ A;  2A28 A;  4F7U E;  2M9U A;  4MML A;  3RMS A;  3UWN A;  4M77 C;  2JUF A;  4OML A;  3CCR T;  4HCB A;  4KT0 E;  3ULR B;  2KGT A;  2L3S A;  3D7S B;  4E47 A;  4ATO A;  3UPU A;  3JCM Q;  3OYA A;  1HYO A;  4M77 F;  2YLB A;  4QVC A;  2G3R A;  3OYB A;  4JRQ A;  3JB9 D;  4C92 A;  4JS5 A;  1FMK A;  3SD4 A;  1Z9Z A;  3URG A;  3E9F A;  1OPL A;  2ED0 A;  4LUD A;  1K1Z A;  1KFZ A;  1G83 A;  4P5N A;  1X27 A;  2DXC A;  5GAN 6;  1K73 R;  2RB6 A;  1JEG A;  1NLO C;  1Q7Y R;  1NJI R;  4CI0 C;  3LWI A;  1N8R U;  5FRM A;  2A0F B;  1VIE A;  2O88 A;  1VQ7 A;  2BUD A;  4M7D C;  3A98 A;  1YNZ A;  5GAN 5;  2ZZD A;  1K73 U;  1VQN Q;  1YN8 A;  1Q7Y U;  4M7D F;  1YJN A;  1SHG A;  1NJI U;  5CKD A;  2CT3 A;  3CME A;  2A3L A;  3CC4 A;  3UAT A;  1PCX A;  1X2K A;  5KCH A;  3E1S A;  3EGD B;  5FWC A;  1YIJ A;  1UG1 A;  2SRC A;  3CCQ T;  1UJ0 A;  2DFU A;  3OYN A;  1OYX A;  3CCM T;  1YIT A;  2JT4 A;  1ZBJ A;  4CC3 A;  2JS0 A;  4OGC A;  1MMG A;  2C06 A;  2COW A;  5IT9 E;  3QXE B;  3A8O B;  3LH0 A;  1RI0 A;  2FZC B;  4C92 B;  4A63 B;  2LX9 A;  2E4H A;  1QQJ A;  1F1B B;  1UHC A;  3ZFJ A;  3G71 A;  1M1F A;  2LT1 A;  2W10 A;  4EMK A;  1IRE B;  4YTL A;  4M7A G;  2DE0 X;  2DMO A;  3QZ5 B;  2WSE E;  3J7A F;  1PKS A;  4QQD A;  5GAN 4;  1VQ8 A;  3OYH A;  3P8H A;  1M90 R;  1UEB A;  4HCZ A;  4IIM A;  4XU2 A;  1Q86 R;  3M57 A;  2KI7 A;  2VXF A;  5CVI A;  3TQ7 P;  4A4E A;  1AWO A;  3E2U A;  4M78 G;  3I9Q A;  2EYW A;  5KYU A;  1S1N A;  1XTD A;  2ZPB B;  4QVZ A;  1KQS S;  1NZ9 A;  4M77 E;  3RMQ A;  2DO3 A;  4Z88 A;  1QLY A;  4JRP A;  3EG3 A;  3CC7 A;  3THK A;  2IG0 A;  4L59 A;  4M7A A;  1VQ7 Q;  1RAC B;  2OAW A;  1N27 A;  1QMC A;  2LT4 A;  1KD1 R;  1D0Z A;  5AT1 B;  2F1L A;  1H8K A;  4J5Y A;  2QQA A;  1ZSZ B;  3CCU A;  3X24 B;  3A8G B;  2YUQ A;  1ABQ A;  1M9S A;  2K57 A;  4QQG A;  3CME Q;  4C92 C;  1KQ2 A;  1VQO T;  3CC4 Q;  1FMW A;  4NL2 A;  2EJ9 A;  4XAX B;  2K79 A;  1YHQ A;  1GRI A;  3L42 A;  4GLM A;  3VKI A;  4M78 A;  3DLL A;  1YIJ Q;  4J9C A;  1KD1 U;  1Q82 U;  2RQR A;  3G4S T;  4EMK B;  4M7D E;  2EGE A;  1YIT Q;  3OW2 S;  5GAM h;  1W70 A;  3GNF B;  3EG9 B;  4AFZ C;  5FLX E;  3MEA A;  5KYY A;  2KT1 A;  6AT1 B;  5GAO m;  2EYZ A;  5HK0 A;  2H8H A;  4J6X A;  2L3Q A;  1K4U S;  1OEB A;  3MP1 A;  2P0P A;  4KH1 B;  2KBT A;  3G6E T;  2E64 A;  1KK7 A;  4XTY A;  1IZ6 A;  1OX8 A;  1XJW B;  3CQT A;  3HSB A;  2DTH A;  2BTT A;  1D09 B;  5LJ5 e;  2EQU A;  2EW3 A;  2RMO A;  4N4G A;  5KYU B;  1GBR A;  1K76 A;  2AK5 A;  1PNJ A;  1QWE A;  1TUC A;  2DYB A;  1EFN A;  2LQK A;  3S6W A;  1TOV A;  3ZBD A;  1VQ8 Q;  1QP3 A;  4M7A B;  2NWM A;  3OYE A;  2K2V A;  1Q95 G;  2RM4 A;  2OJ2 A;  4XU1 A;  2G6F X;  3Q1J A;  4BI4 A;  1V1C A;  2RK2 A;  2R58 A;  1SRM A;  1Q81 C;  5I11 A;  4AFU C;  3CXC P;  3CMA A;  1IXD A;  3RKY A;  2FPF A;  4RCB A;  1SSF A;  3VS6 A;  1DJ7 B;  3HP9 A;  2K5F A;  1E6H A;  2HQX A;  3CC7 Q;  4EMK C;  2YRD A;  4DOV A;  3JCM P;  1SHF A;  4D8K A;  3WVE B;  1O75 A;  1WJS A;  2FRW A;  4NS5 A;  1I5L A;  1WPY A;  1JJ2 S;  5LJ3 d;  2DER A;  3CCU Q;  4RTT A;  1W6X A;  3LW5 E;  4Q5W A;  1MGQ A;  1OU9 A;  2E6Z A;  4JDS A;  3MP6 A;  1R8O B;  1O9S A;  2HSP A;  3TSZ A;  1YHQ Q;  2K2M A;  4FYY B;  5KCO A;  2FZG B;  2ESW A;  1KHI A;  4A54 A;  5GAM d;  4C5G A;  3MP8 A;  3ER0 A;  1M5Q 1;  3H41 A;  3OS5 A;  5GAO p;  1WJR A;  2LJ1 A;  4N4I A;  2JM8 A;  2VGN A;  1UE9 A;  3CCS A;  4M7A C;  4D6W A;  3EG0 A;  1OI1 A;  2LVM A;  2EJG A;  2DZ9 A;  3KUF A;  3CCR A;  2DXT A;  5GAO q;  3V7C A;  3RUX A;  2BZY A;  3ME9 A;  5CR2 A;  4C92 D;  1LOJ A;  2IPO B;  3H0I A;  1HXD A;  2GFU A;  2KDS A;  5FU7 B;  2NUZ A;  3M5A A;  2YRC A;  8ATC B;  1M3A A;  4M78 C;  3HTR A;  3GP8 A;  3M0P A;  2PUO B;  4RG2 A;  4BDY A;  5GAN 3;  1ARK A;  2RI3 A;  4FYV B;  4BI3 A;  1TXQ A;  4M78 F;  2CSI A;  3HHT B;  3L2Q A;  3FDR A;  5FU6 C;  3CBM A;  3L1A A;  1A0N B;  2X4J A;  3CMA Q;  1T3S A;  3VU3 C;  3PNW C;  1AOJ A;  1IO6 A;  2KYM A;  3QG1 A;  3EFS A;  4B9W A;  1AHJ B;  1ZQ1 A;  2WSF E;  2KYB A;  1WQW A;  3CBO A;  3INZ A;  2O9V A;  2HD0 A;  4PJO C;  2QA4 T;  3VS5 A;  3S3M A;  1FYN A;  2HDA A;  3RIR A;  5D6Y A;  4HCK A;  2FHD A;  4MDX A;  3CCJ A;  2HEQ A;  4PJO F;  3V7S A;  1VYV A;  2HAX A;  3CCQ A;  5I2S A;  2XDP A;  4WCI A;  1W2B P;  4AG2 C;  3CCM A;  2HBP A;  4ZGE B;  2M16 A;  2MOX A;  1U1S A;  2J6F A;  1MMD A;  2GGR A;  2C0I A;  1K8A R;  4RTY A;  2GQV A;  2DNU A;  2RNA A;  1VIF A;  1JB0 E;  1MUZ A;  3OMG A;  2FYK A;  1VQ6 T;  3BW1 A;  1I4K 1;  2SEM A;  1CKA A;  1EIF A;  1LCK A;  4BD3 A;  5CAI A;  2M1H A;  2QDL A;  1KC8 R;  1M2O A;  2DM1 A;  2HZY A;  3VUZ A;  1UJY A;  1WHJ A;  5GAN h;  4AT1 B;  2GTO A;  2RA2 A;  2P4R A;  2VB6 A;  1B3Q A;  2KSS A;  3L2W A;  4BY6 C;  2EQJ A;  1QCF A;  1K8A U;  3SEM A;  3HFO A;  4JLI A;  3CCS Q;  4J9G A;  4C0D C;  2ZCF B;  5C0M A;  1XNI A;  2GCX A;  2XU8 A;  3CCR Q;  2XDB A;  1UGQ B;  3SHW A;  1HK9 A;  4XQ3 A;  1BB9 A;  1TTH B;  2K3B A;  2QXF A;  2LCL A;  2DBK A;  3ZL7 C;  3CCL T;  3I55 A;  4OF1 A;  4XTU A;  1ZUU A;  2DL5 A;  4PJJ A;  2KAF A;  4X1V A;  4EMH A;  4AFS C;  3CXC A;  1NEB A;  5LJ3 j;  3O8V A;  4QT7 A;  3LLR A;  4LE9 A;  2DXB A;  1GXI E;  3M9Q A;  4J6Y A;  5GAN 7;  5GJV B;  3PIO A;  4M7A D;  3NTK A;  1VQL T;  2K6D A;  2MAM A;  4OB3 B;  3OYY A;  3LH5 A;  3A8L B;  1Q81 U;  5J26 A;  2DYI A;  5KH6 A;  2KRS A;  1M3C A;  2YDL A;  1SKU B;  4E7I A;  2V1R A;  3OY9 A;  4OVA A;  4PFZ A;  3EHR A;  4HVV A;  1R0C B;  2K9G A;  3VS4 A;  1QVG A;  1IHW A;  4M78 E;  3SDZ A;  1SRL A;  2A7Y A;  3PIP A;  3CEY A;  4M78 D;  2VUB A;  3OYJ A;  3CCJ Q;  2M51 A;  4LDV A;  2DEQ A;  3OBW A;  3CCQ Q;  3G4S A;  2JW4 A;  3G1J A;  3M54 A;  5FRN A;  3KBG A;  3CCM Q;  4E2F B;  3TCJ A;  4JZ4 A;  1KG1 A;  2XK0 A;  4TVR A;  2EQI A;  5GAN 8;  4BDZ A;  4PJO E;  2JTE A;  5GAN d;  3H6Z A;  2DRM A;  1NYG A;  4NOY A;  4E7Z A;  1GFC A;  4C0G A;  3UA6 A;  4J7I A;  2OTL T;  2LTO A;  3G6E A;  2LP5 A;  2FO0 A;  4ZN3 A;  2FEI A;  3EGX B;  1H3Z A;  2HSE B;  4BE0 A;  5IXF A;  1I07 A;  2KRO A;  3JCM d;  2ROL A;  2QQ9 A;  1MMN A;  4FYW B;  3JB9 J;  1GCQ A;  3TRE A;  4EIK A;  1MHN A;  1OZ3 A;  3X26 B;  2HMA A;  1YJW T;  3G7Z A;  3JCM W;  3SFM A;  3DKM A;  3JSC A;  5GAM f;  4OGE A;  4FIB A;  2DIL A;  3IQL A;  1TH7 A;  3EGD A;  5J39 A;  4PNO A;  1VQ4 T;  1I1J A;  2ZPH B;  1ZBX A;  3NFC A;  2E1H A;  1QKX A;  1K9M C;  2MI6 A;  5I2M A;  1WDX A;  4M75 B;  1N8R R;  2E70 A;  2RHX A;  1FMV A;  3V8K A;  3M59 A;  1W2B A;  4O6J A;  3A1P A;  1Y96 B;  2EYQ A;  3ZEH A;  1BCO A;  4KGX B;  3CCE T;  4EMG A;  1AWJ A;  4WTO B;  4CC4 B;  2FB7 A;  3EFO B;  2O31 A;  1U5S A;  5GMK h;  1OU8 A;  3VYH B;  1EX4 A;  1ABO A;  3CBP A;  3G4S Q;  2D6F A;  3REA B;  2XDD A;  1ZUK A;  1N6A A;  1PKT A;  2P0K A;  4WF2 A;  4J9H A;  2RQV A;  2HBW A;  4HVU A;  2R5M A;  5L8R E;  4Z02 A;  3VS2 A;  4EDU A;  4FSX A;  3JAM E;  2KRN A;  5HKC A;  1UFF A;  2AT1 B;  1YP5 A;  3OW2 P;  3MPU B;  2MMP A;  2BE7 D;  4BE2 A;  3JB9 H;  3G6E Q;  2JMA A;  2DD4 A;  1M1K C;  2DET A;  2ABL A;  1RLP C;  3PMI A;  2FZK B;  1FWZ A;  3U23 A;  3PT9 A;  2K3Y A;  3S3O A;  2D9T A;  1RAD B;  1AEY A;  1J3T A;  2EJF A;  3OYI A;  1ZSZ A;  4DBQ A;  3CCV T;  2YHT A;  2O4X A;  1V29 B;  5FWB A;  3OYK A;  2C0T A;  5J3B A;  1D1A A;  1HSQ A;  3OYC A;  4JS4 A;  4BI8 B;  4C0Z A;  3BE3 A;  2O01 E;  1WYX A;  2L3R A;  4PJN A;  5GJW B;  1G3Y A;  2DLP A;  1ZA2 B;  2L2P A;  3EG9 A;  5GAN j;  2QA4 A;  1PD0 A;  1JO8 A;  2CZ0 B;  2KVQ G;  2XG8 D;  2IVW A;  4C8Q B;  3RNJ A;  1GCQ C;  1WA7 A;  1NM7 A;  4RTW A;  3M0Q A;  2DK3 A;  2JZ2 A;  3EFR A;  4AFQ C;  4LN2 A;  3VS7 A;  2EFI A;  2F5K A;  3SB2 A;  1PD1 A;  1VQ6 A;  4LNP A;  2RH2 A;  2RHI A;  1D3B B;  1PRL C;  9ATC B;  4IKF A;  1ZX6 A;  4PFO A;  4OMO A;  4PKC C;  2MYS A;  1BCM A;  3QKJ A;  3JCM J;  1Q82 R;  3M56 A;  4J83 A;  3FB9 A;  4DOW A;  4JRK A;  2J7I A;  1PWT A;  2LJ3 A;  3M0R A;  3X20 B;  3I35 A;  2QK0 A;  2O4X B;  5LJ3 h;  1RL2 A;  2A36 A;  4L6V 5;  3A8M B;  5FW9 A;  3VS0 A;  1XOV A;  2JOY A;  2VV5 A;  3H0H A;  3BDL A;  3CCL A;  2CGH A;  1C1A A;  4C92 F;  1VQP A;  4UC4 A;  4II1 A;  4IUR A;  2YUP A;  2E5Q A;  4OP0 A;  1PHT A;  2XID A;  1D0Y A;  3M55 A;  1MNE A;  1IGQ A;  2ZPI B;  3PTA A;  5LJ3 e;  4E7J A;  5HCK A;  4J7F A;  1KQS A;  4DBH A;  2KNB B;  3WVD B;  2K5I A;  1OV3 A;  2W0Z A;  3JRZ A;  1AVZ C;  1UB4 A;  4Z8A A;  2FL7 A;  1VQN T;  2RHU A;  1QVF S;  1VYU A;  5GAM e;  1KSW A;  5CQX A;  1K9A A;  1RAH B;  1G8X A;  4HVW A;  1I5O B;  1K9M U;  1Y07 A;  3J81 E;  2CUB A;  2QA4 Q;  2EYX A;  2RHY A;  1U8R A;  4IUU A;  2Y4X A;  1B34 B;  2FPE A;  3KXT A;  2PQW A;  3PE0 A;  1OQK A;  2M02 A;  3CPW S;  1ZSZ C;  2QQR A;  2P0Q A;  2JS2 A;  2DTI A;  5ECA A;  4F7U G;  2QYZ A;  5DLQ E;  1YJ9 T;  2QQB A;  1ZLM A;  1D1C A;  1TWB A;  2GQI A;  3V7R A;  1VQ6 Q;  1PC0 A;  1LVK A;  3OW2 A;  2K4Y A;  4LUE A;  1RUW A;  2OTL A;  2X35 A;  2V8J A;  2VVK A;  2F2V A;  2VAS A;  1UGV A;  2HKQ B;  3M4G A;  1NPR A;  1UGP B;  1WIE A;  5LJ5 g;  2KXC A;  1QVG P;  2X4Y A;  3TSW A;  3UT1 A;  3VYG A;  1JXO A;  4FW2 A;  5GAM g;  2R57 A;  4KUL A;  3LGF A;  2HQH A;  4F14 A;  2EBP A;  1IGU A;  2DVJ A;  1CSK A;  4N4H A;  2LQN A;  4F7U A;  2RJC A;  2KK4 A;  3T9N A;  1MV3 A;  4F04 B;  1VYT A;  3CCL Q;  1AWX A;  2RJF A;  3JB9 I;  1VQP Q;  4ZN1 A;  5IH2 A;  3EH1 A;  4QQ6 A;  3C12 A;  2LRQ A;  1ZA1 B;  4IUV A;  2EPD A;  4HT9 A;  4XTZ A;  2M0Y A;  5KE2 A;  2AHJ B;  1VQ4 A;  4DA4 A;  1QP2 A;  1WFW A;  4RCC A;  1VQK T;  3I5R A;  2X4X A;  2VC8 A;  1PG5 B;  2OX7 A;  3RKX A;  5GMK j;  3OS2 A;  1WHH A;  4PK4 A;  4C92 E;  3OSS C;  1I0C A;  2EGC A;  4M7A F;  4CC2 A;  4FYX B;  2CRE A;  2JTM A;  1MV0 B;  4IIO A;  1VUB A;  2Y90 A;  1TUD A;  3JCM V;  1RI9 A;  1TSF A;  1YJN T;  2D8H A;  3NTI A;  1FX7 A;  3CCE A;  2D8J A;  2QTX A;  5M9O A;  3OYG A;  1JJ2 A;  4R0K A;  2ECZ A;  1T0J A;  4M4Z A;  3QPH A;  2VKN A;  1YIJ T;  3QUI A;  4RMO A;  2EKH A;  2VYT A;  1YFN A;  3HRU A;  2O9S A;  2FPD A;  2DVE A;  5DM7 R;  1U1T A;  1Y7X A;  2A37 A;  1S72 T;  2GTJ A;  4F7U B;  4J9D A;  3QII A;  4OB0 B;  2P4T A;  1VQM T;  2X9H A;  1V76 A;  2KXD A;  1LNX A;  2OTL Q;  2COZ A;  1UGS B;  4LDY A;  4X9D A;  4A4F A;  3JCM X;  1G2B A;  1RAF B;  3UF4 A;  1GBQ A;  5DY9 A;  5A0D A;  4J9I A;  3G71 T;  4FT2 A;  3QYH B;  4ELZ C;  2CZ1 B;  3VV0 A;  2CUD A; 
#chains in the Genus database with same CATH homology
 5IHN A;  5IXF A;  1I07 A;  2DA9 A;  1GFD A;  2RN8 A;  2KRO A;  4E6R A;  1UHC A;  2AKK A;  2ROL A;  2DX1 A;  2W10 A;  1UTI A;  2I0N A;  1K0X A;  1GCQ A;  2DE0 X;  2B86 A;  2DMO A;  4EIK A;  1PKS A;  2RQU A;  4ESR A;  1YCS B;  4IIM A;  3M0S A;  3VS3 A;  2DIL A;  3IQL A;  4ORZ A;  1AWO A;  1W1F A;  1K0S A;  4F16 A;  1I1J A;  2LCS A;  5I22 A;  2OI3 A;  2LNH B;  4JJD A;  3I9Q A;  2EYW A;  1S1N A;  3EGU A;  1QKX A;  1X69 A;  1ZUY A;  2PZ1 A;  2X3X D;  1E6G A;  4Z88 A;  1WDX A;  1UEC A;  2PTK A;  1QLY A;  2F2W A;  3EG3 A;  4HXJ A;  3THK A;  4F17 A;  2C0O A;  2FG0 A;  4OMQ A;  2OAW A;  1M8M A;  1H8K A;  2XMF A;  1AWJ A;  2ED1 A;  4CC4 B;  1WI7 A;  2YUQ A;  2O31 A;  1ABQ A;  4RTU A;  1U5S A;  5IXB A;  1B07 A;  1ABO A;  2K79 A;  2MIO A;  1GRI A;  4GLM A;  1SSH A;  3REA B;  1ZUK A;  2DL8 A;  2MCN A;  1X6G A;  1PKT A;  3QWX X;  3NMZ C;  1U3O A;  4J9H A;  2LX7 A;  2RQV A;  4J9C A;  2HBW A;  2RQR A;  4HVU A;  2EGE A;  1WXB A;  2KEA A;  3VS2 A;  2KRN A;  1UFF A;  3C0C A;  1U06 A;  1YP5 A;  2IIM A;  1W70 A;  4AFZ C;  1BK2 A;  2KT1 A;  2EYZ A;  4RTX A;  2H8H A;  2L3Q A;  2JMA A;  3EG1 A;  1K4U S;  2F2X A;  1OEB A;  1Y57 A;  2ABL A;  2KBT A;  1RLP C;  1UHF A;  2J6K A;  1AZE A;  3U23 A;  3CQT A;  3I5S A;  2BTT A;  1BBZ A;  3EHQ A;  1T0H A;  2GNC A;  1BU1 A;  2EW3 A;  2RMO A;  1GBR A;  1K76 A;  2AK5 A;  1AEY A;  1PNJ A;  1QWE A;  1J3T A;  1TUC A;  2DYB A;  2V1Q A;  3NPF A;  1PRM C;  4J9B A;  1EFN A;  4K11 A;  4Z89 A;  2DL4 A;  5FWB A;  1UUE A;  2C0T A;  2NWM A;  1JXM A;  2OJ2 A;  1HSQ A;  1KIK A;  2G6F X;  1V1C A;  1SRM A;  2EVR A;  1TG0 A;  2BZX A;  3M0U A;  3RBB B;  5I11 A;  1WYX A;  4AFU C;  5GJW B;  2FPF A;  2DLP A;  3R6N A;  4RTV A;  2RPN A;  5IHI A;  2L2P A;  3VS6 A;  1E6H A;  3JV3 A;  1YWP A;  4OMN A;  1JO8 A;  1HD3 A;  3RNJ A;  1OPK A;  1CKB A;  1GCQ C;  3EG2 A;  4J9E A;  2DL3 A;  1SHF A;  1WA7 A;  1NM7 A;  2O2O A;  1GCP A;  4D8K A;  4RTW A;  3M0Q A;  2FRW A;  4RUG A;  2RQW A;  2LMJ A;  1H92 A;  2KR3 A;  2JMC A;  4AFQ C;  1QKW A;  4LN2 A;  3VS7 A;  4RTT A;  1N5Z A;  1W6X A;  1AZG B;  4LNP A;  1T3L A;  3TVT A;  1SPK A;  3VRZ A;  1WXU A;  2HSP A;  1PRL C;  3TSZ A;  1KJW A;  2K2M A;  1ZX6 A;  2BZ8 A;  2ESW A;  4OMO A;  3NGP A;  2EGA A;  3O5Z A;  4GBQ A;  5EC7 A;  1WLP B;  2J7I A;  1PWT A;  2ENM A;  2J06 A;  2LJ3 A;  3M0R A;  1H3H A;  3I35 A;  3H41 A;  2LJ1 A;  2JM8 A;  2AZS A;  1X6B A;  1UE9 A;  4FSS A;  2A36 A;  3EG0 A;  5FW9 A;  3QWY A;  3VS0 A;  1XOV A;  2L0A A;  3H0H A;  2CH4 A;  2D1X A;  1M3B A;  2ROT A;  2BZY A;  1JQQ A;  3FJ5 A;  3KFV A;  2YUP A;  1Z9Q A;  1NG2 A;  3H0I A;  3VRY A;  1PHT A;  2K7A A;  2NUZ A;  4JZ3 A;  2DF6 A;  2YUO A;  4ZNX A;  2AZV A;  3VS1 A;  1M3A A;  1E7O A;  2L3P A;  3M0P A;  1ARK A;  3PVQ A;  5HCK A;  1VA7 A;  1M30 A;  2EYY A;  2CT4 A;  2JM9 A;  2KNB B;  1OV3 A;  2LJ0 A;  2W0Z A;  2CSI A;  2YSQ A;  1AVZ C;  2DJQ A;  2CSQ A;  4Z8A A;  1A0N B;  1T3S A;  1VYU A;  1AOJ A;  1KSW A;  1K9A A;  1IO6 A;  4HVW A;  2KYM A;  3PVL A;  2KYB A;  2CUB A;  2EYX A;  2O9V A;  3REB B;  1M27 C;  1NYF A;  2AKL A;  2FPE A;  4D8D A;  3VS5 A;  3PE0 A;  1FYN A;  2HDA A;  4HCK A;  1X2Q A;  2JS2 A;  4Y92 A;  2HEQ A;  2YT6 A;  2J05 A;  1VYV A;  5ECA A;  3GBQ A;  1ZLM A;  4WCI A;  4AG2 C;  2D0N A;  1NEG A;  2GQI A;  2J6F A;  2MOX A;  5IHK A;  2GGR A;  2C0I A;  4RTY A;  2DNU A;  2RNA A;  2GBQ A;  4LUE A;  1MUZ A;  1AD5 A;  1RUW A;  1SEM A;  2SEM A;  1CKA A;  1LCK A;  4J9F A;  2CDT A;  2CH4 W;  1ZSG A;  2QDL A;  2VVK A;  2F2V A;  2DM1 A;  1UGV A;  1UJY A;  1YWO A;  2GTO A;  4AG1 C;  2P4R A;  1RLQ C;  2J6O A;  5L23 A;  1B3Q A;  1WIE A;  1X43 A;  2KXC A;  4DEY A;  2LQW A;  1GL5 A;  3TSW A;  4CC7 A;  2VWF A;  1QCF A;  3SEM A;  1HJD A;  3UA7 A;  2DBM A;  1JXO A;  4J9G A;  1JU5 C;  2DRK A;  4RTZ A;  4F14 A;  2EBP A;  1QWF A;  1CSK A;  2DVJ A;  1Y0M A;  2LQN A;  2X3W D;  2A28 A;  1MV3 A;  3SHW A;  1VYT A;  2KE9 A;  4KRT A;  1BB9 A;  2LZ6 B;  2K3B A;  1AWX A;  2KRM A;  4OML A;  2DBK A;  5IH2 A;  3ULR B;  2KGT A;  2L3S A;  3ZL7 C;  1ZUU A;  2EPD A;  2FRY A;  2DL5 A;  4X1V A;  2M0Y A;  2A08 A;  2JXB A;  1WFW A;  4AFS C;  1NEB A;  4JPB W;  3I5R A;  1AWW A;  1FMK A;  4QT7 A;  1Z9Z A;  1OPL A;  4LE9 A;  2ED0 A;  1I0C A;  4LUD A;  2EGC A;  1K1Z A;  2PNI A;  2RF0 A;  5GJV B;  1KFZ A;  1G83 A;  4CC2 A;  1X27 A;  2CRE A;  1JEG A;  2K6D A;  1NLO C;  1MV0 B;  4IIO A;  3LH5 A;  1TUD A;  1RI9 A;  4JJC A;  2KRS A;  1M3C A;  2YDL A;  2O88 A;  2V1R A;  4DEX A;  2D8H A;  3H0F A;  3EHR A;  4HVV A;  2D8J A;  2K9G A;  3A98 A;  3VS4 A;  4R0K A;  1SRL A;  1YNZ A;  2ECZ A;  1T0J A;  4M4Z A;  2VKN A;  1YN8 A;  2E5K A;  2EKH A;  1SHG A;  3M0T A;  1WX6 A;  2HCK A;  2CT3 A;  2DL7 A;  2M51 A;  2O9S A;  2FPD A;  4OMM A;  3UAT A;  2A37 A;  1OOT A;  2JW4 A;  1X2K A;  2YUN A;  4OMP A;  5FWC A;  1UG1 A;  2SRC A;  2GTJ A;  4JZ4 A;  1UJ0 A;  4J9D A;  1NLP C;  1UDL A;  2KT8 A;  2EQI A;  2JT4 A;  2KXD A;  1ZBJ A;  4CC3 A;  2JS0 A;  2JTE A;  3NHN A;  2DRM A;  1NYG A;  1GFC A;  1G2B A;  3UA6 A;  3UF4 A;  1GBQ A;  4J9I A;  2LP5 A;  2FO0 A;  2FEI A;  4JJB A;  1WXT A;  2RQT A;  4A63 B;  2CUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...