2DL7A

Solution structure of the second sh3 domain of human kiaa0769 protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
73
structure length
73
Chain Sequence
b'GSSGSSGVCFVKALYDYEGQTDDELSFPEGAIIRILNKENQDDDGFWEGEFNGRIGVFPSVLVEELSSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0769 protein
publication title Solution structure of the second SH3 domain of human KIAA0769 protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 5
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2006-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dl7A00
2DA9A 1Z9ZA 1RI9A 2M0YA 5HCKA 1ZLMA 2AKKA 2VVKA 3UATA 1ABQA 1NYFA 3I5RA 4RTVA 1WDXA 2RQRA 1ZUUA 2D8JA 2LNHB 5GJWB 2LX7A 2F2WA 2MCNA 1WXUA 5FWBA 4K11A 5FWCA 1WX6A 1NYGA 1UDLA 4Z88A 1PRMC 2ESWA 2DX1A 2EGEA 1J3TA 2EKHA 2A28A 2HCKA 2JM8A 1I07A 1B07A 1UE9A 5IHNA 2KYMA 1RLQC 4J9HA 1ZX6A 2A08A 2FPEA 3UF4A 1AEYA 1ZUYA 1VA7A 4RTXA 2HDAA 1AWXA 1A0NB 4ZNXA 2KRNA 1HSQA 2DMOA 2RQTA 2RN8A 1N5ZA 1Z9QA 2SEMA 1U5SA 1UFFA 2CT3A 1Y57A 4OMMA 3QWYA 1UGVA 2LJ0A 5IHKA 1Y0MA 3IQLA 1UHFA 1JO8A 2KXDA 2YDLA 2AK5A 2LQNA 4JPBW 2OI3A 2K79A 1WYXA 2K3BA 2DE0X 2EQIA 4CC4B 1CKAA 2P4RA 3VRZA 2C0IA 3THKA 1YP5A 2I0NA 2BZ8A 2JMAA 3VS1A 1RUWA 2KRSA 1WIEA 4J9DA 2J05A 3I35A 2EYWA 1QKWA 2DL4A 4LE9A 4JJCA 2RQWA 1IO6A 2LMJA 2EYXA 4JZ3A 3H0HA 2DILA 2ECZA 2CDTA 1BB9A 3VS2A 1VYUA 2C0TA 1GRIA 1U06A 4QT7A 2O2OA 4J9BA 2DL8A 2KT1A 1FYNA 1XOVA 1MUZA 2RMOA 5FW9A 1MV0B 3NHNA 2KROA 2FO0A 4ESRA 2G6FX 1I1JA 4FSSA 2BZXA 3VS4A 1TUDA 2OJ2A 2K9GA 1NLPC 1E6GA 1PWTA 4RTTA 3EG0A 1JQQA 2D0NA 3H0FA 5L23A 2BTTA 1M8MA 1RLPC 2EYZA 1WXTA 2J6OA 1VYVA 1KFZA 4F17A 2L0AA 1AWJA 2DL3A 2PZ1A 2J06A 1ZSGA 5EC7A 1E7OA 2CH4W 2O88A 1JEGA 1X2KA 1K1ZA 2EGAA 2GGRA 2KT8A 1YNZA 1GFDA 4LUEA 1QWEA 2EBPA 4CC2A 1HJDA 2YUPA 4LN2A 1PHTA 1PRLC 2JM9A 3EHRA 4IIMA 2DVJA 2D8HA 1QCFA 1OV3A 2K2MA 1TG0A 1NG2A 3M0UA 1YN8A 1WFWA 2EYYA 1SHGA 2RNAA 2YSQA 1KIKA 2X3XD 1YWOA 2DF6A 1T3SA 2L3SA 1BU1A 4Z8AA 2AZVA 2MOXA 3PVLA 4DEXA 2CSQA 1ZBJA 5ECAA 1GCQA 3REBB 4AFQC 2DJQA 1I0CA 1UJ0A 1QWFA 3EG2A 3TSWA 4OMPA 4OMLA 2ED0A 3R6NA 3KFVA 2CSIA 1MV3A 3LH5A 2O31A 2EW3A 1CKBA 4EIKA 1T0HA 2L2PA 2K7AA 3VS6A 2ROTA 2J6FA 4J9FA 5IXBA 2HBWA 4Y92A 1NEGA 3C0CA 1X43A 3VRYA 2DL5A 1AZGB 2MIOA 3H41A 3I5SA 2DRKA 2DYBA 4RTZA 3I9QA 1UUEA 1WA7A 2JTEA 1OPLA 2V1QA 2OAWA 4IIOA 2GTOA 3EHQA 4X1VA 3REAB 1SEMA 3PVQA 3M0RA 4M4ZA 3M0TA 4RUGA 2DLPA 2JXBA 3EG3A 4HVWA 1AVZC 2XMFA 2KYBA 3M0PA 2CT4A 2FRWA 4J9IA 1X69A 2L3PA 3ZL7C 3TVTA 5I22A 1X6BA 4J9GA 2GBQA 1GCPA 1GBRA 3M0SA 1WI7A 2CUDA 2LQWA 1SSHA 1H92A 1SRLA 2DBKA 4KRTA 2HEQA 4HXJA 4E6RA 2LJ3A 1M3BA 2KR3A 4AFUC 1W1FA 1AWWA 1GCQC 1KJWA 1PKTA 2GQIA 3VS5A 1GBQA 2LZ6B 1T0JA 1WLPB 1OEBA 2X3WD 2PTKA 2H8HA 1EFNA 1OPKA 2QDLA 5GJVB 1NM7A 4GBQA 4AFZC 2ABLA 4HVUA 3U23A 1T3LA 3RBBB 2NUZA 5IH2A 2BZYA 4D8KA 2B86A 1W6XA 4JJDA 1YCSB 1BK2A 2PNIA 1G83A 4F14A 2CUBA 1KSWA 3UA7A 1X2QA 1QLYA 3RNJA 1V1CA 2K6DA 4OMNA 1CSKA 1JXOA 2O9VA 1UJYA 2GNCA 4J9EA 4DEYA 2JS2A 2KXCA 5IHIA 2ED1A 1JU5C 1PKSA 1WXBA 1UTIA 1K4US 4RTWA 1W70A 1UECA 1YWPA 2RF0A 1PNJA 2GTJA 2FRYA 2FEIA 3EG1A 1VYTA 3GBQA 3JV3A 2F2VA 1X27A 1LCKA 4LUDA 2YUOA 4RTYA 1E6HA 2YT6A 2M51A 2EVRA 2V1RA 4R0KA 2J7IA 1M3AA 3QWXX 2LCSA 3ULRB 2W10A 2FG0A 1AD5A 1H8KA 2KRMA 2RQUA 4A63B 3VS7A 2VKNA 3NGPA 4F16A 5IXFA 3A98A 1G2BA 5I11A 1UHCA 2O9SA 3H0IA 1TUCA 1FMKA 1GFCA 2YUQA 4HCKA 2KGTA 4D8DA 2ROLA 1K0SA 2EGCA 4AFSC 3UA6A 1SPKA 1SRMA 2RQVA 2LJ1A 2FPFA 2A37A 3FJ5A 2DBMA 3VS0A 2CREA 1U3OA 3TSZA 2E5KA 2EPDA 1QKXA 1X6GA 2FPDA 3VS3A 1ARKA 2SRCA 2JW4A 1GL5A 1H3HA 2LP5A 1M3CA 4GLMA 4JZ4A 3EGUA 1NLOC 2HSPA 4LNPA 2KBTA 2KNBB 2J6KA 3CQTA 1K0XA 1AWOA 2D1XA 2JT4A 4J9CA 2DNUA 2DM1A 3O5ZA 3SEMA 1M30A 4OMQA 1K76A 2AZSA 2IIMA 2C0OA 1B3QA 1S1NA 2ENMA 3NPFA 2DRMA 4AG1C 4OMOA 1OOTA 4JJBA 4Z89A 2W0ZA 3M0QA 3NMZC 1UG1A 1AZEA 1NEBA 4HVVA 1ABOA 1ZUKA 1JXMA 4RTUA 1SHFA 2JMCA 1AOJA 2CH4A 2JS0A 1M27C 4CC7A 1K9AA 2KEAA 2L3QA 2RPNA 2AKLA 2F2XA 3PE0A 2A36A 2VWFA 3SHWA 1HD3A 2DL7A 2KE9A 4AG2C 4CC3A 2YUNA 2NWMA 4WCIA 1BBZA 4ORZA
chains in the Genus database with same CATH superfamily
2M1HA 3BFMA 4MZTA 3MO8A 3ZBDA 2AKKA 2D6FA 1ABQA 1R77A 2D8JA 3RMSA 2F2WA 4PJOB 2MCNA 3HTRA 2OTLQ 1YIJT 4C92F 3RIRA 3OYIA 1J3TA 2QA4Q 2A28A 1B07A 1KQ1A 1UE9A 4C5IA 2EKOA 1ZX6A 1YJNQ 1WQWA 2FPEA 1QVGS 2DYIA 1I81A 2NUPA 2HZYA 3E9FA 1S72Q 4M7AE 1G3YA 3CCQT 2SEMA 4JJNK 3CCVT 4OB2B 1QVFP 2E5QA 3V7RA 5FROA 3CEYA 2DERA 2AK5A 2CS7A 4GY5A 5IAYA 2K79A 3FRNA 2WSFE 1BCOA 5FLXE 3MEVA 3QJYA 2P4RA 1YP5A 2I0NA 2FZGB 4J9DA 2ZAEA 2EJ9A 3DLLA 2BKDN 2EYWA 4LE9A 4JJCA 3OYNA 4HT9A 5GAN8 1IO6A 2DTOA 1Q81R 5GAOr 5FU6C 3JAME 1M1KU 3S3MA 3VS2A 1VYUA 2COYA 1U06A 2O2OA 5L8RE 1YITA 5FU7B 2DJZA 3VKIA 4DA4A 2FO0A 4ESRA 2G6FX 1I1JA 2QDYB 3A8OB 4A53A 1LOJA 2K9GA 2OJ2A 4IURA 1PWTA 3ZEHA 1IHWA 4A4GA 1OX8A 2JZ2A 4L59A 3VYHB 1YI2A 3M53A 2RHXA 2L0AA 2LNVA 5DLOA 1AWJA 1OU9A 3MCAB 4HCBA 2EQMA 2CH4W 1EIFA 1X2KA 1K1ZA 2EGAA 2KT8A 1WHJA 1YJ9T 1YNZA 4LUEA 1QWEA 2NYSA 2P0KA 2JUFA 4M78E 2GFUA 1D0XA 2AIRB 1YJWA 3PMTA 1NG2A 5KCHA 1NJIC 1VQNA 3M0UA 2FHDA 3FEOA 2QQSA 1KIKA 4FL6A 2VGNA 3PGGA 2PQWA 4J7IA 2X4YA 3PVLA 3J7AF 1ZBJA 5CIUA 2Y90A 1GCQA 3REBB 4XK8E 4XTWA 5GANj 2DJQA 5LJ5h 1QWFA 3JCMg 3CPWS 3VU3C 3R6NA 1KQSP 1KC8R 1MV3A 2O31A 4C8QE 5KCOA 2HKNA 5I2SA 2DZCA 3JCMf 4QVCA 2HQXA 4PJOF 2QQAA 4BY6B 2K7AA 3I55T 1M90R 1VQOQ 1WGSA 1H641 4M75E 4ELYC 2DL5A 2MIOA 3I9QA 1WA7A 2OTLA 2JTEA 1OPLA 4F7UA 1W2BP 4IIOA 4O6JA 1NPRA 1QCNA 2QQ9A 1G8XA 4M7DE 1RADB 4M7AB 2RJFA 1YJNA 5A0GA 3CCET 4PLLA 2DTHA 3G4SQ 1GBRA 5CVIA 2KAFA 1Q82U 2ZPBB 1IHVA 3G6ET 2HSEB 5FRMA 5KYYA 1KD1R 1VQPQ 2V26A 3L2RA 1S72A 1OI1A 2LT1A 2LQWA 3L2UA 2HEQA 2QG9B 2E41A 5CQXA 4MMKA 3Q1JA 3A5ZB 1M3BA 2JTFA 1WJSA 4N4GA 3JCMb 1Q7YC 1AWWA 2OAUA 1GCQC 2GQIA 3VS5A 1GBQA 2LZ6B 1Q86U 3FDRA 1EFNA 1OPKA 1EX4A 1NM7A 1NPPA 2ABLA 1X01A 4R56A 1D1BA 5LJ3g 3CCST 2MK5A 4D8KA 5CR2A 1WNLA 2JNGA 1ZA1B 4JJDA 4Y28E 5GAMf 2HBPA 5LJ3f 1YCSB 4ZGJB 1BK2A 1QVFA 2LC4A 3RESA 4E47A 2I2LA 2JTMA 1TWBA 2DO3A 4XU3A 3ASKA 4OMFB 4BDZA 1X2QA 3RNJA 3M58A 1CSKA 1JXOA 1UJYA 3LW5E 4DEYA 1AT1B 2EJFA 4PJMA 4M7DD 3JCMP 4N4IA 4BI3A 5IHIA 2HL5C 3C94A 3DB4A 3CC4T 1WXBA 1UTIA 4M78B 4E7ZA 4M77G 2P84A 1V76A 3QYHB 1PNJA 2GTJA 5KYNA 4ELZC 4N0AA 2KSSA 2HKQB 1LCKA 2YUOA 2LX9A 4RTYA 2M02A 1Y71A 2M51A 1U8RA 4R0KA 3OYGA 1M3AA 4Y91A 1QMCA 3QWXX 2KVQG 8ATCB 2OX7A 2ZPHB 2FG0A 3HFNA 4OF1A 2RQUA 4A63B 4ME7A 5KE3A 5GMKl 2VKNA 2VV5A 4XU2A 3JB9I 5A0LA 4IUQA 2MYSA 1XNIA 1UHCA 2O9SA 1Y07A 3E19A 1TUCA 5IN1A 4CRIA 3TCJA 1FMKA 1QP3A 3CCUQ 1K9MC 1SRMA 2FPFA 4C8QB 2A37A 3FJ5A 4KT0E 2COWA 2E5KA 2EPDA 4QQ6A 5GANh 1X6GA 3OQ5A 1M1KC 1SF9A 4LDVA 1M3CA 4JZ4A 4C92A 2RHZA 1K73R 2F5KA 3CMAQ 4M75B 3SWNB 1K0XA 2EQKA 2D1XA 2JT4A 1K8AR 2DNUA 2CZ1B 1N8RR 3S3NA 3SEMA 3QBYA 2C0OA 4XTYA 1S1NA 1UGPB 2E6NA 4AG1C 2KDSA 5D6YA 3T9NA 1VQOA 4M77D 3G7ZA 2XU8A 4ZN3A 2Z0WA 1N27A 3M0QA 3L2VA 1AZEA 2E10A 1NEBA 2XI9A 3CBOA 4M7AF 3SFMA 4N0AC 4E7HA 2JMCA 1RAAB 2CH4A 2JS0A 4B9XA 3G1JA 1KQSA 1VQKQ 2X9HA 1QQJA 2AKLA 3PE0A 5GAOp 2B8AA 2P0QA 2DL7A 3G4SA 2X51A 2YUNA 2NWMA 2NUZA 1BBZA 2DA9A 1VQPA 4B6MA 1NE8A 1JJ2A 1B7TA 3BDUA 3OYAA 4XAXB 3EFOA 3FJPA 2VVKA 3UATA 1MHNA 4PJOG 3LLRA 2E1HA 5CKDA 2RA2A 4QW2A 2RQRA 3RKYA 3QDFA 2RHIA 3CMEA 4FM4B 2ZPIB 3V7CA 3CCJA 1NYGA 4C92C 2DX1A 5C0MA 1TUGB 1WPYA 4FU6A 3WVEB 4KUIA 1I07A 2KYMA 3JB9G 2MMPA 2ZCFB 3A1PA 3AT1B 4BE0A 1AEYA 1ZUYA 3E2UA 2EYQA 3N5BB 1OZ3A 3JCMJ 3EGXB 1A0NB 3OBYA 3A8HB 2DMOA 2RQTA 1Z9QA 4MDXA 1MGQA 1VQ6A 2LJ0A 4M78F 3URGA 3IQLA 1UHFA 1JO8A 2YDLA 4RG2A 4JPBW 2Y4YA 5GANg 1WYXA 3NTIA 3L2QA 2EQIA 4J7FA 1YJWT 4LDWA 4J6WA 2XKOC 5IT9E 1RUWA 2V8JA 3PMIA 4JUVA 3JB9J 1QKWA 3QG1A 2DL4A 5KE2A 4JRPA 2A0FB 4WF2A 2RQWA 4RCCA 2K57A 2LMJA 2RJEA 5CKHA 2ECZA 5GAMj 4J5YA 2HD0A 2WSEE 4QT7A 2LVMA 3V8LA 2RMOA 1XOVA 1MUZA 4X34A 3F70A 1MNDA 1MV0B 3QIIA 3OY9A 1ZA2B 5LJ5d 1PSEA 2COZA 2VB6A 2DVEA 3EG0A 3JB9D 4PJOA 3CCUA 1VQ5T 4AT1B 1IRXA 2R5AA 5KYXB 2EYZA 1WXTA 2J6OA 1VYVA 2VYTA 2DTIA 2PZ1A 3CCLQ 1JEGA 2CGHA 4C0FA 3CBPA 1KHCA 1GFDA 3CMAA 4CC2A 1HJDA 2L8DA 1ZHIA 1PRLC 4V2SA 1NZ9A 1O9SA 5GAOm 4JDSA 2OTLT 4IIMA 5LJ5e 5CKFA 3HRUA 5EG2A 2YRVA 1IGUA 2QA4T 4QVDA 4B9WA 1M1FA 4E7JA 1YJNT 1SHGA 2HQEA 2XICA 3VUZA 2YSQA 4C0DB 2X3XD 5CO7A 1YWOA 2DF6A 5HY6A 1T3SA 3OYMA 2LT4A 4J83A 2L3SA 1OQKA 1BU1A 3O8VA 4Z8AA 5GAN5 2DXCA 2P4TA 1S72T 2CSQA 4XU0A 1VQKA 1I0CA 1UJ0A 4A54A 1XTDA 2K5FA 4OMLA 3RERA 2E64A 4PK4A 3JCMh 3SD4A 2EW3A 1IGQA 3TQ7P 1W2BS 1CKBA 3HSBA 4HA8A 1IXDA 1JBMA 2EJGA 3HL8A 4PJOC 3OBWA 2E65A 5D7UA 1F1BB 2J6FA 2HBWA 3HRSA 5M9OA 1PD1A 2NUTA 1AZGB 3H41A 3I5SA 3V7SA 4RTZA 3CPFA 3HHTB 2V1QA 2OAWA 1K9MU 2GTOA 2LCCA 3EHQA 4X1VA 2ZZDA 3PVQA 3M0RA 2E70A 4RUGA 3C95A 2DD4A 4OGCA 3CXCA 4HVWA 2JN0A 2KYBA 3M0PA 2CT4A 4FYWB 1LPLA 2FRWA 4J9IA 4J9GA 2GBQA 3OW2P 3UPUA 4OGEA 3M0SA 4F7UE 4XQ3A 4EMKB 1WI7A 2CUDA 4E7LA 4F7UG 1TSFA 4E6RA 3EAEA 3X28B 5C6SA 2QTXA 4RKUE 1TTHB 1W4SA 2M0OA 2HL3A 4MZMA 1PKTA 1KJWA 1VQ8A 1U1TA 3GPLA 4F04B 3QYGB 2H8HA 2IPOB 1N6AA 1P92A 4BI4A 4E7SA 2DIQA 2K2VA 5FU7C 3EGDB 4NOYA 2JOYA 5GAMh 3MP6A 5LJ3h 9ATCB 2HNIA 2Y4XA 1HK9A 1BYMA 2CZ6B 3A8LB 2H3EB 4PFZA 1G83A 2KMTA 1G5VA 2EFIA 4OMNA 3A8GB 2GNCA 2YHTA 3R6OA 1NJIR 3GNFB 4O5VA 1VOMA 3CC2A 2XHCA 3KBGA 1BIAA 4GLKA 4BB7A 1W70A 5GMKe 3CCLA 2FRYA 2PUKB 4OP0A 4LXCA 1VYTA 3GBQA 3JCMX 2RJDA 3G71T 4M7AA 4QVZA 3DKMA 4AMCA 2F2VA 3LGFA 4OB3B 2YXYA 2YT6A 1KC8C 4PLIA 1M2VB 3UDCA 5GANe 3I56Q 8AT1B 2M9UA 3JCMV 2DAQA 5GMKi 2O01E 2W10A 3H6ZA 4C5HA 4FT2A 2XDDA 1SG5A 3EFRA 4X9CA 1JJ2P 2CP7A 4YTLA 3D7SB 3G4ST 1GFCA 2YUQA 2KGTA 6AT1B 1BCMA 2EGCA 5HK3A 4DBFA 1SPKA 1KHIA 4C0ZA 1VQPT 3C4SA 5CK9A 3VS0A 2V8IA 1VQMT 2DKGA 2QI2A 1QKXA 1H3HA 1U1SA 2SRCA 2JW4A 2LP5A 3EGUA 4KULA 1NLOC 1OZ2A 4BY6C 1D3BB 4N4HA 2J6KA 1N9RA 2X4WA 3MHXA 2DM1A 3O5ZA 2GF7A 4OMQA 2IIMA 1B3QA 2QGFB 3CC7Q 2ENMA 3NPFA 1YIJA 3MEUA 4LDYA 5A0DA 4ZGEB 3CMEQ 3M56A 4FYYB 1PG5B 4Z89A 4IUTA 2W0ZA 3CCJQ 4C92E 3M59A 2O4XA 1UG1A 1N9SA 4HVVA 4M7AC 2YRDA 5I21A 1ZUKA 1PC0A 4C92G 3CCEQ 1JXMA 2CP3A 4OVAA 4M78A 2VXEA 5GAMg 1M27C 1Q7YR 4CC7A 3G6EQ 3GP8A 2L3QA 4KGXB 2RPNA 2EAYA 1OX9A 3CCQA 2KI7A 2KE9A 3EG9B 3QZ9B 5KYWB 1FMWA 4WCIA 4ORZA 2DEUA 3H8ZA 3BY7A 2DEQA 1VQ6Q 1D1CA 4PL6A 1NYFA 4M77E 4RTVA 1WDXA 3WXMB 1M4ZA 3VV0A 3JRZA 5KYUB 1WXUA 1R8OB 5FWBA 3LWHA 4Z88A 4BE2A 2ESWA 4C8QA 4JRQA 5CKEA 2F69A 2EGEA 5DM7R 2K5LA 3OW2A 2HCKA 2JM8A 1VQ7Q 5FRNA 4J9HA 2A08A 2CP5A 4IUUA 3MEWA 3CCRQ 4KH0B 4M75A 3SWNA 1O75A 3CCUT 1VA7A 4RTXA 1WHLA 2ZGWA 3UWNA 4FW2A 1AWXA 3WVDB 1PSFA 1VIEA 4IKFA 3M57A 4TVRA 2RN8A 4C92D 1N5ZA 3P8DA 1U5SA 2CT3A 1Y57A 2XK0A 4OMMA 4QKUA 2VC8A 3QWYA 4MMLA 1RAHB 1TH7A 1H3ZA 5IHKA 2R57A 4M78C 2DXBA 2KXDA 1I5OB 3CMAT 2RB6A 2RJCA 4BI8B 2E12A 2K3BA 2DE0X 1YJ9A 4CC4B 3MEAA 3QXEB 1M2OA 2BZ8A 2JMAA 3SDZA 2KRSA 2QASA 1WIEA 2D9TA 3I35A 1KK7A 4II1A 1I4K1 4RG8A 5HK0A 2A7YA 1Q81U 2EYXA 5LL6S 3I56A 3H0HA 2OTJQ 2CDTA 1TS9A 1BB9A 3VYGA 1M1KR 4J9BA 4M7DB 1Y96B 1ZSZB 1FYNA 3S3OA 3LGLA 2F5TX 1M8VA 5FW9A 1VQKT 1V29B 3E9GA 3MPUB 2BZXA 2VGMA 4FSSA 4X9DA 3VS4A 1YHQQ 1JB0E 2BE9B 1NLPC 3NTHA 1SSFA 3MKDA 1E6GA 4C8QC 4RTTA 4ATOA 1JQQA 3JCMd 1OU8A 2D0NA 2QEXQ 2LQ8A 3H0FA 4NL2A 2VXFA 3PTAA 2DETA 1G3TA 5D6WA 1RLPC 1C0MA 1KFZA 4F17A 4M75C 3SWNC 1VQ4Q 2J06A 1BI0A 5EC7A 1E7OA 3CXCP 2JJ9A 2RHUA 2O88A 1VQLQ 1TOVA 1RABB 3CCMQ 2H3JA 2YUPA 4LN2A 2JM9A 3OYJA 4PJOE 4JLGA 2GCXA 2D8HA 2XG8D 1OV3A 3EGXA 5DLQE 1LVKA 3CC7A 1ZQ1A 1R0CB 1TG0A 3JCMe 4BD3A 1QVGA 1WFWA 2EYYA 4XTZA 2FYKA 3OMGA 2RI5A 1QW1A 1YITT 3CCEA 2PUOB 2AZVA 2L5QA 2MOXA 2VASA 4FYVB 1IB8A 3G6EA 1QVFS 5ECAA 2MF2A 4IUPA 4JRIA 4AFQC 5GAN6 4A4FA 5DY9A 2P0PA 1KC8U 4M77B 1YI2T 1VIFA 3KFVA 2CSIA 2E4HA 3LH5A 3M4YA 3PIOA 1WHKA 1RAFB 3FLGA 3L1AA 1M90U 1T0HA 2L2PA 3VS6A 3EH1A 3X26B 4J9FA 1EZZB 4Y92A 1NEGA 3EFOB 1VQ8Q 3C0CA 1X43A 4P5NA 1Y7XA 2AHJB 3VRYA 5LJ3d 3CD6Q 2DRKA 1GXIE 1UUEA 2D0QB 3REAB 1VQNT 4LD6A 5KYXA 2EWNA 4M4ZA 3M0TA 2DLPA 2YWWA 1VQ9Q 4BE1A 4HT8A 1FX7A 1VQ7A 4PJOD 3M54A 2XMFA 4E7KA 1HXDA 2PVOB 5CQYA 3CCRA 3ZL7C 3TVTA 1GCPA 1KD1U 1WHHA 1BKBA 2E6ZA 4EPCA 1Q82R 4WTOB 5GAMe 5LJ3e 1H92A 2DBKA 4C8QF 3CCLT 3OS5A 4KGZB 3JCMc 2IG0A 2LJ3A 3OMCA 3CC2Q 2CP2A 3OYKA 2YLBA 1W1FA 4MDWA 2HAXA 4M75F 3M55A 2V8KA 1WLPB 3BW1A 2X3WD 4OB0B 1Q86R 3TU4K 2QDLA 5GJVB 4E2FB 4GBQA 1QVPA 4HVUA 1T3LA 4M7DF 2BZYA 5J3BA 4ZTFA 2B86A 3QDRB 4KGVB 2OTJA 1W6XA 5GAN2 2RH2A 1RL2A 3L2WA 2EQUA 1RAGB 2MAMA 4PKCC 5GAN3 3MP1A 1VQ5Q 4F14A 2XDPA 3LYIA 1YCYA 3CPWA 3UA7A 1YHQA 1QLYA 1V1CA 1KQSS 5KH6A 4J8OA 4Z02A 2O9VA 3RKWA 1B34B 2JS2A 2QEXA 2KXCA 3RR6A 2ED1A 1BIBA 1JU5C 1PKSA 3GF5A 2WACA 3HRTA 1TXQA 3OYYA 4RTWA 1M1GA 1UECA 1YWPA 1VQ4A 2FEIA 3EG1A 3JV3A 1JJ2S 2X35A 1VQLA 3PNWC 1X27A 4LUDA 1E6HA 1YBYA 3CCMA 2EVRA 1I8FA 2V1RA 4DOWA 3M9QA 4A4EA 2XD0A 1YIJQ 2DIGA 3ULRB 4EMKA 1G3SA 1AD5A 4BDYA 4C0DC 4FYXB 3J80E 2AT1B 3NGPA 4F16A 4CI0C 5FU6B 3A98A 4R55A 1G2BA 5I11A 5A2QE 5GAN4 3H0IA 4XTXA 2QYZA 4JS4A 3DB3A 4ANJA 2RHYA 4D8DA 4M7AG 1D1AA 4PNOA 2ATCB 2RQVA 5D6XA 4QQDA 2DBMA 4HCZA 2CREA 1U3OA 4M77F 1Q81C 1RAEB 3CCQQ 4KUDK 3CCVQ 1GL5A 3VS3A 1ARKA 1K73U 4RCBA 1OYXA 3GOXA 2HSPA 3EGDA 2KNBB 3META 3GIBA 1K8AU 3QJ6A 1AHJB 2NUPB 2FZCB 1N8RU 1AWOA 2LTOA 4J9CA 4LD9K 3QO3A 1M30A 4JRKA 2AZSA 3EFSA 4FW1A 4RMOA 3RKXA 4JJBA 3JSCA 3LH0A 4LDUA 4DBQA 1XJWB 4HKEA 1WHMA 3HP9A 3CD6A 1ABOA 3RDVA 2DXUA 3QSUA 2IVWA 2NUTB 1SHFA 3OYFA 1HYOA 2ZPFB 3OYHA 4IUVA 1VQ9A 4JS5A 5HKCA 3PIPA 3AHUA 1WQ7A 4MZPA 2A36A 4EMKC 1M9SA 2WSCE 1HD3A 4LDXA 3JB9H 3FC3A 1M2VA 2BUDA 3OSVA 3OA6A 5J39A 5GAOl 5GANd 4NL3A 1Z9ZA 4M7AD 1RI9A 4PFPA 3HFOA 5I2MA 2M0YA 5HCKA 3V8KA 1ZLMA 2DFUA 4J6XA 4PFOA 3V8JA 3OYDA 4M78G 3I5RA 1YJ9Q 3OS1A 2EQJA 1ZUUA 2LNHB 5GJWB 2LX7A 2FB7A 3MP8A 3I56T 4K11A 1MMAA 5FWCA 1WX6A 1UDLA 2E3IA 1PRMC 1UGQB 3A8MB 2RO0A 1VQOT 2QXFA 1ACMB 2LQKA 5GMKj 1X75C 2EKHA 5IHNA 1RLQC 4PJLA 3UF4A 3E1SA 2L3RA 2FVUA 3OSSC 1TU0B 3CBMA 2DPPB 1D3BA 3SB2A 2HDAA 1MMNA 3QPHA 1M90C 2K5IA 4ZNXA 2KRNA 1HSQA 1VQ5A 5GMKm 1LNXA 4BACA 4FSXA 1UFFA 1UGVA 3QKJA 2BIVA 1QVGP 1Y0MA 4C8QG 3P8BB 3G71Q 2LQNA 2OI3A 2XDBA 1UGRB 1CKAA 3VRZA 1PM3A 2FZKB 2C0IA 3THKA 4M75G 3CC7T 2NLUA 3VS1A 3I55Q 2J05A 3CMET 1D0YA 3KXTA 1WJQA 3X20B 4DBRA 3JB9F 1KD1C 4ZGDB 2QA4A 3CCJT 2ZPGB 4JZ3A 2GQVA 2HMAA 4M78D 1PCXA 2DILA 3EG9A 4M7DG 5KYWA 2EIFA 3H9NA 2C0TA 1GRIA 2DL8A 2KT1A 1BI3A 4DBHA 1XQHA 3NFCA 1X6OA 2KROA 3NHNA 1TUDA 2HQHA 5CKBA 1VQMQ 3CXCS 2X4XA 5KYUA 3ZFJA 3M4GA 4F7UB 2RI2A 5L23A 3JCMW 2BTTA 1M8MA 3LX7A 1VQ6T 2KQWA 2DL3A 1BI2A 1ZSGA 4DQ2A 3CCVA 2MWPA 2G3RA 4C5EA 2GGRA 1OULA 1C1AA 2EBPA 4C8QD 1PHTA 3EHRA 2QGGA 3S6WA 2DVJA 2FL7A 5KYYB 1QCFA 3L42A 2CZ0B 2K2MA 2L89A 3MJXA 4J6YA 2M16A 3OS0A 1YN8A 4M75D 1VQ7T 2QQRA 2QTVA 3CCSQ 4L5GA 2RNAA 3CCRT 1VUBA 2DZ9A 2DXTA 2QQBA 2KK4A 5CAIA 2O4XB 1IZ6A 2QAZA 1M5Q1 4DEXA 1PD0A 2RM4A 5LJ5g 3LWIA 4EMHA 2K4YA 1D09B 7AT1B 3ER0A 3EG2A 3TSWA 4OMPA 1FXXA 2ED0A 3BE3A 5LJ5f 1LJOA 4QQGA 1RACB 4C0GA 2R58A 2YLCA 1IREB 3CC4Q 2C06A 4M7DA 1Y96A 3OB9A 1ZSZA 4EIKA 2CKKA 3RUXA 4JLIA 2ROTA 1I5LA 5IXBA 1RAIB 3CPWP 1WZOA 1FWZA 4ZTJA 4PJNA 1YFNA 2RD1A 3JCMQ 2ZPEB 2DYBA 4E7IA 2OTJT 1KQ2A 1K9MR 1SEMA 1K73C 5J26A 2CP6A 2LCLA 2YRCA 5GMKh 2LDMA 2JXBA 3EG3A 2RK2A 4NS5A 1AVZC 1FMVA 1YHQT 1K8AC 2PVGB 1N8RC 1X69A 1MMGA 2L3PA 5I22A 1X6BA 2QEXT 4A4KA 2XIDA 3X25B 3GNGA 2CZ7B 4C5GA 4FCYA 1SSHA 1SRLA 1R0BG 4KRTA 1VQ4T 4HXJA 3QHSA 4EMGA 1VQLT 2KR3A 3UT1A 3G71A 1ZBXA 4AFUC 3CCMT 1G3WA 1Q95G 1UEBA 1T0JA 1OEBA 4Q5WA 4FT4A 2PTKA 2CYZB 3OS2A 1WHGA 1MNEA 4AFZC 3I55A 3U23A 2F1LA 3RBBB 3OYBA 1JRIA 5IH2A 2K3XA 4BUGA 4C92B 4M7DC 1ZSZC 1WJRA 5GAOq 4HCCA 4M77A 5AYFA 4KH1B 2PNIA 4PJJA 2A3LA 4XU1A 4VUBA 2CUBA 4F7UF 1KSWA 2PU9B 3OYEA 1MMDA 1VQMA 2K6DA 2KY9A 3ME9A 1NJIU 4J9EA 3INZA 1W2BA 2DK3A 2CP0A 2BE7D 3QZ5B 3BDLA 2JVVA 3P8HA 1K4US 1D0ZA 2LRQA 1SKUB 3OYLA 2RF0A 4L6V5 3TREA 2PVDB 1UB4A 5CCAA 1VQ8T 3C12A 2R5MA 4ZN1A 4EDUA 4XTUA 3CD6T 2J7IA 1QP2A 3PT9A 2LCSA 5GAOn 1H8KA 2KRMA 3HPWA 1YITQ 3VS7A 3FIFA 5GAMd 1VQ9T 5IXFA 3TEEA 3RMQA 3QUIA 2E3HA 3CCSA 5AT1B 2MI6A 3OW2S 4UC4A 4D6WA 3J81E 3FB9A 4HCKA 3PFSA 2ROLA 1K0SA 4AFSC 3UA6A 1YI2Q 2LJ1A 3EH2A 4M77C 3TSZA 4XTVA 3HKSA 3OYCA 2FPDA 3CC2T 4GLMA 1UGSB 5GANf 3DLMA 2X4JA 1NBEB 4LNPA 2KBTA 1RI0A 1Q82C 3CQTA 3CC4A 3VJPA 2MPXC 1YJWQ 1K76A 1C6VX 2QK0A 1DJ7B 3M5AA 5LJ3j 2DRMA 1VQNQ 4OMOA 3L2ZA 5GAN7 2RK1A 1OOTA 4A4HA 3NTKA 3KUFA 2GFAA 2MWOA 2VUBA 3NMZC 4OB1B 1B34A 1QCOA 1Q86C 2K3YA 4RTUA 1AOJA 1Q7YU 4KBMB 2RI3A 3GLXA 1K9AA 2KEAA 3X24B 2DD5A 4FIBA 2F2XA 2VWFA 3VUBA 3SHWA 5LJ5j 1BI1A 4AG2C 1KG1A 4CC3A 4DOVA
chains in the Genus database with same CATH topology
2DA9A 1Z9ZA 1RI9A 2M0YA 5HCKA 1ZLMA 2AKKA 2VVKA 3UATA 1ABQA 1NYFA 3I5RA 4RTVA 1WDXA 2RQRA 1ZUUA 2D8JA 2LNHB 5GJWB 2LX7A 2F2WA 2MCNA 1WXUA 5FWBA 4K11A 5FWCA 1WX6A 1NYGA 1UDLA 4Z88A 1PRMC 2ESWA 2DX1A 2EGEA 1J3TA 2EKHA 2A28A 2HCKA 2JM8A 1I07A 1B07A 1UE9A 5IHNA 2KYMA 1RLQC 4J9HA 1ZX6A 2A08A 2FPEA 3UF4A 1AEYA 1ZUYA 1VA7A 4RTXA 2HDAA 1AWXA 1A0NB 4ZNXA 2KRNA 1HSQA 2DMOA 2RQTA 2RN8A 1N5ZA 1Z9QA 2SEMA 1U5SA 1UFFA 2CT3A 1Y57A 4OMMA 3QWYA 1UGVA 2LJ0A 5IHKA 1Y0MA 3IQLA 1UHFA 1JO8A 2KXDA 2YDLA 2AK5A 2LQNA 4JPBW 2OI3A 2K79A 1WYXA 2K3BA 2DE0X 2EQIA 4CC4B 1CKAA 2P4RA 3VRZA 2C0IA 3THKA 1YP5A 2I0NA 2BZ8A 2JMAA 3VS1A 1RUWA 2KRSA 1WIEA 4J9DA 2J05A 3I35A 2EYWA 1QKWA 2DL4A 4LE9A 4JJCA 2RQWA 1IO6A 2LMJA 2EYXA 4JZ3A 3H0HA 2DILA 2ECZA 2CDTA 1BB9A 3VS2A 1VYUA 2C0TA 1GRIA 1U06A 4QT7A 2O2OA 4J9BA 2DL8A 2KT1A 1FYNA 1XOVA 1MUZA 2RMOA 5FW9A 1MV0B 3NHNA 2KROA 2FO0A 4ESRA 2G6FX 1I1JA 4FSSA 2BZXA 3VS4A 1TUDA 2OJ2A 2K9GA 1NLPC 1E6GA 1PWTA 4RTTA 3EG0A 1JQQA 2D0NA 3H0FA 5L23A 2BTTA 1M8MA 1RLPC 2EYZA 1WXTA 2J6OA 1VYVA 1KFZA 4F17A 2L0AA 1AWJA 2DL3A 2PZ1A 2J06A 1ZSGA 5EC7A 1E7OA 2CH4W 2O88A 1JEGA 1X2KA 1K1ZA 2EGAA 2GGRA 2KT8A 1YNZA 1GFDA 4LUEA 1QWEA 2EBPA 4CC2A 1HJDA 2YUPA 4LN2A 1PHTA 1PRLC 2JM9A 3EHRA 4IIMA 2DVJA 2D8HA 1QCFA 1OV3A 2K2MA 1TG0A 1NG2A 3M0UA 1YN8A 1WFWA 2EYYA 1SHGA 2RNAA 2YSQA 1KIKA 2X3XD 1YWOA 2DF6A 1T3SA 2L3SA 1BU1A 4Z8AA 2AZVA 2MOXA 3PVLA 4DEXA 2CSQA 1ZBJA 5ECAA 1GCQA 3REBB 4AFQC 2DJQA 1I0CA 1UJ0A 1QWFA 3EG2A 3TSWA 4OMPA 4OMLA 2ED0A 3R6NA 3KFVA 2CSIA 1MV3A 3LH5A 2O31A 2EW3A 1CKBA 4EIKA 1T0HA 2L2PA 2K7AA 3VS6A 2ROTA 2J6FA 4J9FA 5IXBA 2HBWA 4Y92A 1NEGA 3C0CA 1X43A 3VRYA 2DL5A 1AZGB 2MIOA 3H41A 3I5SA 2DRKA 2DYBA 4RTZA 3I9QA 1UUEA 1WA7A 2JTEA 1OPLA 2V1QA 2OAWA 4IIOA 2GTOA 3EHQA 4X1VA 3REAB 1SEMA 3PVQA 3M0RA 4M4ZA 3M0TA 4RUGA 2DLPA 2JXBA 3EG3A 4HVWA 1AVZC 2XMFA 2KYBA 3M0PA 2CT4A 2FRWA 4J9IA 1X69A 2L3PA 3ZL7C 3TVTA 5I22A 1X6BA 4J9GA 2GBQA 1GCPA 1GBRA 3M0SA 1WI7A 2CUDA 2LQWA 1SSHA 1H92A 1SRLA 2DBKA 4KRTA 2HEQA 4HXJA 4E6RA 2LJ3A 1M3BA 2KR3A 4AFUC 1W1FA 1AWWA 1GCQC 1KJWA 1PKTA 2GQIA 3VS5A 1GBQA 2LZ6B 1T0JA 1WLPB 1OEBA 2X3WD 2PTKA 2H8HA 1EFNA 1OPKA 2QDLA 5GJVB 1NM7A 4GBQA 4AFZC 2ABLA 4HVUA 3U23A 1T3LA 3RBBB 2NUZA 5IH2A 2BZYA 4D8KA 2B86A 1W6XA 4JJDA 1YCSB 1BK2A 2PNIA 1G83A 4F14A 2CUBA 1KSWA 3UA7A 1X2QA 1QLYA 3RNJA 1V1CA 2K6DA 4OMNA 1CSKA 1JXOA 2O9VA 1UJYA 2GNCA 4J9EA 4DEYA 2JS2A 2KXCA 5IHIA 2ED1A 1JU5C 1PKSA 1WXBA 1UTIA 1K4US 4RTWA 1W70A 1UECA 1YWPA 2RF0A 1PNJA 2GTJA 2FRYA 2FEIA 3EG1A 1VYTA 3GBQA 3JV3A 2F2VA 1X27A 1LCKA 4LUDA 2YUOA 4RTYA 1E6HA 2YT6A 2M51A 2EVRA 2V1RA 4R0KA 2J7IA 1M3AA 3QWXX 2LCSA 3ULRB 2W10A 2FG0A 1AD5A 1H8KA 2KRMA 2RQUA 4A63B 3VS7A 2VKNA 3NGPA 4F16A 5IXFA 3A98A 1G2BA 5I11A 1UHCA 2O9SA 3H0IA 1TUCA 1FMKA 1GFCA 2YUQA 4HCKA 2KGTA 4D8DA 2ROLA 1K0SA 2EGCA 4AFSC 3UA6A 1SPKA 1SRMA 2RQVA 2LJ1A 2FPFA 2A37A 3FJ5A 2DBMA 3VS0A 2CREA 1U3OA 3TSZA 2E5KA 2EPDA 1QKXA 1X6GA 2FPDA 3VS3A 1ARKA 2SRCA 2JW4A 1GL5A 1H3HA 2LP5A 1M3CA 4GLMA 4JZ4A 3EGUA 1NLOC 2HSPA 4LNPA 2KBTA 2KNBB 2J6KA 3CQTA 1K0XA 1AWOA 2D1XA 2JT4A 4J9CA 2DNUA 2DM1A 3O5ZA 3SEMA 1M30A 4OMQA 1K76A 2AZSA 2IIMA 2C0OA 1B3QA 1S1NA 2ENMA 3NPFA 2DRMA 4AG1C 4OMOA 1OOTA 4JJBA 4Z89A 2W0ZA 3M0QA 3NMZC 1UG1A 1AZEA 1NEBA 4HVVA 1ABOA 1ZUKA 1JXMA 4RTUA 1SHFA 2JMCA 1AOJA 2CH4A 2JS0A 1M27C 4CC7A 1K9AA 2KEAA 2L3QA 2RPNA 2AKLA 2F2XA 3PE0A 2A36A 2VWFA 3SHWA 1HD3A 2DL7A 2KE9A 4AG2C 4CC3A 2YUNA 2NWMA 4WCIA 1BBZA 4ORZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DA9 A;  1Z9Z A;  1RI9 A;  2M0Y A;  5HCK A;  1ZLM A;  2AKK A;  2VVK A;  3UAT A;  1ABQ A;  1NYF A;  3I5R A;  4RTV A;  1WDX A;  2RQR A;  1ZUU A;  2D8J A;  2LNH B;  5GJW B;  2LX7 A;  2F2W A;  2MCN A;  1WXU A;  5FWB A;  4K11 A;  5FWC A;  1WX6 A;  1NYG A;  1UDL A;  4Z88 A;  1PRM C;  2ESW A;  2DX1 A;  2EGE A;  1J3T A;  2EKH A;  2A28 A;  2HCK A;  2JM8 A;  1I07 A;  1B07 A;  1UE9 A;  5IHN A;  2KYM A;  1RLQ C;  4J9H A;  1ZX6 A;  2A08 A;  2FPE A;  3UF4 A;  1AEY A;  1ZUY A;  1VA7 A;  4RTX A;  2HDA A;  1AWX A;  1A0N B;  4ZNX A;  2KRN A;  1HSQ A;  2DMO A;  2RQT A;  2RN8 A;  1N5Z A;  1Z9Q A;  2SEM A;  1U5S A;  1UFF A;  2CT3 A;  1Y57 A;  4OMM A;  3QWY A;  1UGV A;  2LJ0 A;  5IHK A;  1Y0M A;  3IQL A;  1UHF A;  1JO8 A;  2KXD A;  2YDL A;  2AK5 A;  2LQN A;  4JPB W;  2OI3 A;  2K79 A;  1WYX A;  2K3B A;  2DE0 X;  2EQI A;  4CC4 B;  1CKA A;  2P4R A;  3VRZ A;  2C0I A;  3THK A;  1YP5 A;  2I0N A;  2BZ8 A;  2JMA A;  3VS1 A;  1RUW A;  2KRS A;  1WIE A;  4J9D A;  2J05 A;  3I35 A;  2EYW A;  1QKW A;  2DL4 A;  4LE9 A;  4JJC A;  2RQW A;  1IO6 A;  2LMJ A;  2EYX A;  4JZ3 A;  3H0H A;  2DIL A;  2ECZ A;  2CDT A;  1BB9 A;  3VS2 A;  1VYU A;  2C0T A;  1GRI A;  1U06 A;  4QT7 A;  2O2O A;  4J9B A;  2DL8 A;  2KT1 A;  1FYN A;  1XOV A;  1MUZ A;  2RMO A;  5FW9 A;  1MV0 B;  3NHN A;  2KRO A;  2FO0 A;  4ESR A;  2G6F X;  1I1J A;  4FSS A;  2BZX A;  3VS4 A;  1TUD A;  2OJ2 A;  2K9G A;  1NLP C;  1E6G A;  1PWT A;  4RTT A;  3EG0 A;  1JQQ A;  2D0N A;  3H0F A;  5L23 A;  2BTT A;  1M8M A;  1RLP C;  2EYZ A;  1WXT A;  2J6O A;  1VYV A;  1KFZ A;  4F17 A;  2L0A A;  1AWJ A;  2DL3 A;  2PZ1 A;  2J06 A;  1ZSG A;  5EC7 A;  1E7O A;  2CH4 W;  2O88 A;  1JEG A;  1X2K A;  1K1Z A;  2EGA A;  2GGR A;  2KT8 A;  1YNZ A;  1GFD A;  4LUE A;  1QWE A;  2EBP A;  4CC2 A;  1HJD A;  2YUP A;  4LN2 A;  1PHT A;  1PRL C;  2JM9 A;  3EHR A;  4IIM A;  2DVJ A;  2D8H A;  1QCF A;  1OV3 A;  2K2M A;  1TG0 A;  1NG2 A;  3M0U A;  1YN8 A;  1WFW A;  2EYY A;  1SHG A;  2RNA A;  2YSQ A;  1KIK A;  2X3X D;  1YWO A;  2DF6 A;  1T3S A;  2L3S A;  1BU1 A;  4Z8A A;  2AZV A;  2MOX A;  3PVL A;  4DEX A;  2CSQ A;  1ZBJ A;  5ECA A;  1GCQ A;  3REB B;  4AFQ C;  2DJQ A;  1I0C A;  1UJ0 A;  1QWF A;  3EG2 A;  3TSW A;  4OMP A;  4OML A;  2ED0 A;  3R6N A;  3KFV A;  2CSI A;  1MV3 A;  3LH5 A;  2O31 A;  2EW3 A;  1CKB A;  4EIK A;  1T0H A;  2L2P A;  2K7A A;  3VS6 A;  2ROT A;  2J6F A;  4J9F A;  5IXB A;  2HBW A;  4Y92 A;  1NEG A;  3C0C A;  1X43 A;  3VRY A;  2DL5 A;  1AZG B;  2MIO A;  3H41 A;  3I5S A;  2DRK A;  2DYB A;  4RTZ A;  3I9Q A;  1UUE A;  1WA7 A;  2JTE A;  1OPL A;  2V1Q A;  2OAW A;  4IIO A;  2GTO A;  3EHQ A;  4X1V A;  3REA B;  1SEM A;  3PVQ A;  3M0R A;  4M4Z A;  3M0T A;  4RUG A;  2DLP A;  2JXB A;  3EG3 A;  4HVW A;  1AVZ C;  2XMF A;  2KYB A;  3M0P A;  2CT4 A;  2FRW A;  4J9I A;  1X69 A;  2L3P A;  3ZL7 C;  3TVT A;  5I22 A;  1X6B A;  4J9G A;  2GBQ A;  1GCP A;  1GBR A;  3M0S A;  1WI7 A;  2CUD A;  2LQW A;  1SSH A;  1H92 A;  1SRL A;  2DBK A;  4KRT A;  2HEQ A;  4HXJ A;  4E6R A;  2LJ3 A;  1M3B A;  2KR3 A;  4AFU C;  1W1F A;  1AWW A;  1GCQ C;  1KJW A;  1PKT A;  2GQI A;  3VS5 A;  1GBQ A;  2LZ6 B;  1T0J A;  1WLP B;  1OEB A;  2X3W D;  2PTK A;  2H8H A;  1EFN A;  1OPK A;  2QDL A;  5GJV B;  1NM7 A;  4GBQ A;  4AFZ C;  2ABL A;  4HVU A;  3U23 A;  1T3L A;  3RBB B;  2NUZ A;  5IH2 A;  2BZY A;  4D8K A;  2B86 A;  1W6X A;  4JJD A;  1YCS B;  1BK2 A;  2PNI A;  1G83 A;  4F14 A;  2CUB A;  1KSW A;  3UA7 A;  1X2Q A;  1QLY A;  3RNJ A;  1V1C A;  2K6D A;  4OMN A;  1CSK A;  1JXO A;  2O9V A;  1UJY A;  2GNC A;  4J9E A;  4DEY A;  2JS2 A;  2KXC A;  5IHI A;  2ED1 A;  1JU5 C;  1PKS A;  1WXB A;  1UTI A;  1K4U S;  4RTW A;  1W70 A;  1UEC A;  1YWP A;  2RF0 A;  1PNJ A;  2GTJ A;  2FRY A;  2FEI A;  3EG1 A;  1VYT A;  3GBQ A;  3JV3 A;  2F2V A;  1X27 A;  1LCK A;  4LUD A;  2YUO A;  4RTY A;  1E6H A;  2YT6 A;  2M51 A;  2EVR A;  2V1R A;  4R0K A;  2J7I A;  1M3A A;  3QWX X;  2LCS A;  3ULR B;  2W10 A;  2FG0 A;  1AD5 A;  1H8K A;  2KRM A;  2RQU A;  4A63 B;  3VS7 A;  2VKN A;  3NGP A;  4F16 A;  5IXF A;  3A98 A;  1G2B A;  5I11 A;  1UHC A;  2O9S A;  3H0I A;  1TUC A;  1FMK A;  1GFC A;  2YUQ A;  4HCK A;  2KGT A;  4D8D A;  2ROL A;  1K0S A;  2EGC A;  4AFS C;  3UA6 A;  1SPK A;  1SRM A;  2RQV A;  2LJ1 A;  2FPF A;  2A37 A;  3FJ5 A;  2DBM A;  3VS0 A;  2CRE A;  1U3O A;  3TSZ A;  2E5K A;  2EPD A;  1QKX A;  1X6G A;  2FPD A;  3VS3 A;  1ARK A;  2SRC A;  2JW4 A;  1GL5 A;  1H3H A;  2LP5 A;  1M3C A;  4GLM A;  4JZ4 A;  3EGU A;  1NLO C;  2HSP A;  4LNP A;  2KBT A;  2KNB B;  2J6K A;  3CQT A;  1K0X A;  1AWO A;  2D1X A;  2JT4 A;  4J9C A;  2DNU A;  2DM1 A;  3O5Z A;  3SEM A;  1M30 A;  4OMQ A;  1K76 A;  2AZS A;  2IIM A;  2C0O A;  1B3Q A;  1S1N A;  2ENM A;  3NPF A;  2DRM A;  4AG1 C;  4OMO A;  1OOT A;  4JJB A;  4Z89 A;  2W0Z A;  3M0Q A;  3NMZ C;  1UG1 A;  1AZE A;  1NEB A;  4HVV A;  1ABO A;  1ZUK A;  1JXM A;  4RTU A;  1SHF A;  2JMC A;  1AOJ A;  2CH4 A;  2JS0 A;  1M27 C;  4CC7 A;  1K9A A;  2KEA A;  2L3Q A;  2RPN A;  2AKL A;  2F2X A;  3PE0 A;  2A36 A;  2VWF A;  3SHW A;  1HD3 A;  2DL7 A;  2KE9 A;  4AG2 C;  4CC3 A;  2YUN A;  2NWM A;  4WCI A;  1BBZ A;  4ORZ A; 
#chains in the Genus database with same CATH topology
 2M1H A;  3BFM A;  4MZT A;  3MO8 A;  3ZBD A;  2AKK A;  2D6F A;  1ABQ A;  1R77 A;  2D8J A;  3RMS A;  2F2W A;  4PJO B;  2MCN A;  3HTR A;  2OTL Q;  1YIJ T;  4C92 F;  3RIR A;  3OYI A;  1J3T A;  2QA4 Q;  2A28 A;  1B07 A;  1KQ1 A;  1UE9 A;  4C5I A;  2EKO A;  1ZX6 A;  1YJN Q;  1WQW A;  2FPE A;  1QVG S;  2DYI A;  1I81 A;  2NUP A;  2HZY A;  3E9F A;  1S72 Q;  4M7A E;  1G3Y A;  3CCQ T;  2SEM A;  4JJN K;  3CCV T;  4OB2 B;  1QVF P;  2E5Q A;  3V7R A;  5FRO A;  3CEY A;  2DER A;  2AK5 A;  2CS7 A;  4GY5 A;  5IAY A;  2K79 A;  3FRN A;  2WSF E;  1BCO A;  5FLX E;  3MEV A;  3QJY A;  2P4R A;  1YP5 A;  2I0N A;  2FZG B;  4J9D A;  2ZAE A;  2EJ9 A;  3DLL A;  2BKD N;  2EYW A;  4LE9 A;  4JJC A;  3OYN A;  4HT9 A;  5GAN 8;  1IO6 A;  2DTO A;  1Q81 R;  5GAO r;  5FU6 C;  3JAM E;  1M1K U;  3S3M A;  3VS2 A;  1VYU A;  2COY A;  1U06 A;  2O2O A;  5L8R E;  1YIT A;  5FU7 B;  2DJZ A;  3VKI A;  4DA4 A;  2FO0 A;  4ESR A;  2G6F X;  1I1J A;  2QDY B;  3A8O B;  4A53 A;  1LOJ A;  2K9G A;  2OJ2 A;  4IUR A;  1PWT A;  3ZEH A;  1IHW A;  4A4G A;  1OX8 A;  2JZ2 A;  4L59 A;  3VYH B;  1YI2 A;  3M53 A;  2RHX A;  2L0A A;  2LNV A;  5DLO A;  1AWJ A;  1OU9 A;  3MCA B;  4HCB A;  2EQM A;  2CH4 W;  1EIF A;  1X2K A;  1K1Z A;  2EGA A;  2KT8 A;  1WHJ A;  1YJ9 T;  1YNZ A;  4LUE A;  1QWE A;  2NYS A;  2P0K A;  2JUF A;  4M78 E;  2GFU A;  1D0X A;  2AIR B;  1YJW A;  3PMT A;  1NG2 A;  5KCH A;  1NJI C;  1VQN A;  3M0U A;  2FHD A;  3FEO A;  2QQS A;  1KIK A;  4FL6 A;  2VGN A;  3PGG A;  2PQW A;  4J7I A;  2X4Y A;  3PVL A;  3J7A F;  1ZBJ A;  5CIU A;  2Y90 A;  1GCQ A;  3REB B;  4XK8 E;  4XTW A;  5GAN j;  2DJQ A;  5LJ5 h;  1QWF A;  3JCM g;  3CPW S;  3VU3 C;  3R6N A;  1KQS P;  1KC8 R;  1MV3 A;  2O31 A;  4C8Q E;  5KCO A;  2HKN A;  5I2S A;  2DZC A;  3JCM f;  4QVC A;  2HQX A;  4PJO F;  2QQA A;  4BY6 B;  2K7A A;  3I55 T;  1M90 R;  1VQO Q;  1WGS A;  1H64 1;  4M75 E;  4ELY C;  2DL5 A;  2MIO A;  3I9Q A;  1WA7 A;  2OTL A;  2JTE A;  1OPL A;  4F7U A;  1W2B P;  4IIO A;  4O6J A;  1NPR A;  1QCN A;  2QQ9 A;  1G8X A;  4M7D E;  1RAD B;  4M7A B;  2RJF A;  1YJN A;  5A0G A;  3CCE T;  4PLL A;  2DTH A;  3G4S Q;  1GBR A;  5CVI A;  2KAF A;  1Q82 U;  2ZPB B;  1IHV A;  3G6E T;  2HSE B;  5FRM A;  5KYY A;  1KD1 R;  1VQP Q;  2V26 A;  3L2R A;  1S72 A;  1OI1 A;  2LT1 A;  2LQW A;  3L2U A;  2HEQ A;  2QG9 B;  2E41 A;  5CQX A;  4MMK A;  3Q1J A;  3A5Z B;  1M3B A;  2JTF A;  1WJS A;  4N4G A;  3JCM b;  1Q7Y C;  1AWW A;  2OAU A;  1GCQ C;  2GQI A;  3VS5 A;  1GBQ A;  2LZ6 B;  1Q86 U;  3FDR A;  1EFN A;  1OPK A;  1EX4 A;  1NM7 A;  1NPP A;  2ABL A;  1X01 A;  4R56 A;  1D1B A;  5LJ3 g;  3CCS T;  2MK5 A;  4D8K A;  5CR2 A;  1WNL A;  2JNG A;  1ZA1 B;  4JJD A;  4Y28 E;  5GAM f;  2HBP A;  5LJ3 f;  1YCS B;  4ZGJ B;  1BK2 A;  1QVF A;  2LC4 A;  3RES A;  4E47 A;  2I2L A;  2JTM A;  1TWB A;  2DO3 A;  4XU3 A;  3ASK A;  4OMF B;  4BDZ A;  1X2Q A;  3RNJ A;  3M58 A;  1CSK A;  1JXO A;  1UJY A;  3LW5 E;  4DEY A;  1AT1 B;  2EJF A;  4PJM A;  4M7D D;  3JCM P;  4N4I A;  4BI3 A;  5IHI A;  2HL5 C;  3C94 A;  3DB4 A;  3CC4 T;  1WXB A;  1UTI A;  4M78 B;  4E7Z A;  4M77 G;  2P84 A;  1V76 A;  3QYH B;  1PNJ A;  2GTJ A;  5KYN A;  4ELZ C;  4N0A A;  2KSS A;  2HKQ B;  1LCK A;  2YUO A;  2LX9 A;  4RTY A;  2M02 A;  1Y71 A;  2M51 A;  1U8R A;  4R0K A;  3OYG A;  1M3A A;  4Y91 A;  1QMC A;  3QWX X;  2KVQ G;  8ATC B;  2OX7 A;  2ZPH B;  2FG0 A;  3HFN A;  4OF1 A;  2RQU A;  4A63 B;  4ME7 A;  5KE3 A;  5GMK l;  2VKN A;  2VV5 A;  4XU2 A;  3JB9 I;  5A0L A;  4IUQ A;  2MYS A;  1XNI A;  1UHC A;  2O9S A;  1Y07 A;  3E19 A;  1TUC A;  5IN1 A;  4CRI A;  3TCJ A;  1FMK A;  1QP3 A;  3CCU Q;  1K9M C;  1SRM A;  2FPF A;  4C8Q B;  2A37 A;  3FJ5 A;  4KT0 E;  2COW A;  2E5K A;  2EPD A;  4QQ6 A;  5GAN h;  1X6G A;  3OQ5 A;  1M1K C;  1SF9 A;  4LDV A;  1M3C A;  4JZ4 A;  4C92 A;  2RHZ A;  1K73 R;  2F5K A;  3CMA Q;  4M75 B;  3SWN B;  1K0X A;  2EQK A;  2D1X A;  2JT4 A;  1K8A R;  2DNU A;  2CZ1 B;  1N8R R;  3S3N A;  3SEM A;  3QBY A;  2C0O A;  4XTY A;  1S1N A;  1UGP B;  2E6N A;  4AG1 C;  2KDS A;  5D6Y A;  3T9N A;  1VQO A;  4M77 D;  3G7Z A;  2XU8 A;  4ZN3 A;  2Z0W A;  1N27 A;  3M0Q A;  3L2V A;  1AZE A;  2E10 A;  1NEB A;  2XI9 A;  3CBO A;  4M7A F;  3SFM A;  4N0A C;  4E7H A;  2JMC A;  1RAA B;  2CH4 A;  2JS0 A;  4B9X A;  3G1J A;  1KQS A;  1VQK Q;  2X9H A;  1QQJ A;  2AKL A;  3PE0 A;  5GAO p;  2B8A A;  2P0Q A;  2DL7 A;  3G4S A;  2X51 A;  2YUN A;  2NWM A;  2NUZ A;  1BBZ A;  2DA9 A;  1VQP A;  4B6M A;  1NE8 A;  1JJ2 A;  1B7T A;  3BDU A;  3OYA A;  4XAX B;  3EFO A;  3FJP A;  2VVK A;  3UAT A;  1MHN A;  4PJO G;  3LLR A;  2E1H A;  5CKD A;  2RA2 A;  4QW2 A;  2RQR A;  3RKY A;  3QDF A;  2RHI A;  3CME A;  4FM4 B;  2ZPI B;  3V7C A;  3CCJ A;  1NYG A;  4C92 C;  2DX1 A;  5C0M A;  1TUG B;  1WPY A;  4FU6 A;  3WVE B;  4KUI A;  1I07 A;  2KYM A;  3JB9 G;  2MMP A;  2ZCF B;  3A1P A;  3AT1 B;  4BE0 A;  1AEY A;  1ZUY A;  3E2U A;  2EYQ A;  3N5B B;  1OZ3 A;  3JCM J;  3EGX B;  1A0N B;  3OBY A;  3A8H B;  2DMO A;  2RQT A;  1Z9Q A;  4MDX A;  1MGQ A;  1VQ6 A;  2LJ0 A;  4M78 F;  3URG A;  3IQL A;  1UHF A;  1JO8 A;  2YDL A;  4RG2 A;  4JPB W;  2Y4Y A;  5GAN g;  1WYX A;  3NTI A;  3L2Q A;  2EQI A;  4J7F A;  1YJW T;  4LDW A;  4J6W A;  2XKO C;  5IT9 E;  1RUW A;  2V8J A;  3PMI A;  4JUV A;  3JB9 J;  1QKW A;  3QG1 A;  2DL4 A;  5KE2 A;  4JRP A;  2A0F B;  4WF2 A;  2RQW A;  4RCC A;  2K57 A;  2LMJ A;  2RJE A;  5CKH A;  2ECZ A;  5GAM j;  4J5Y A;  2HD0 A;  2WSE E;  4QT7 A;  2LVM A;  3V8L A;  2RMO A;  1XOV A;  1MUZ A;  4X34 A;  3F70 A;  1MND A;  1MV0 B;  3QII A;  3OY9 A;  1ZA2 B;  5LJ5 d;  1PSE A;  2COZ A;  2VB6 A;  2DVE A;  3EG0 A;  3JB9 D;  4PJO A;  3CCU A;  1VQ5 T;  4AT1 B;  1IRX A;  2R5A A;  5KYX B;  2EYZ A;  1WXT A;  2J6O A;  1VYV A;  2VYT A;  2DTI A;  2PZ1 A;  3CCL Q;  1JEG A;  2CGH A;  4C0F A;  3CBP A;  1KHC A;  1GFD A;  3CMA A;  4CC2 A;  1HJD A;  2L8D A;  1ZHI A;  1PRL C;  4V2S A;  1NZ9 A;  1O9S A;  5GAO m;  4JDS A;  2OTL T;  4IIM A;  5LJ5 e;  5CKF A;  3HRU A;  5EG2 A;  2YRV A;  1IGU A;  2QA4 T;  4QVD A;  4B9W A;  1M1F A;  4E7J A;  1YJN T;  1SHG A;  2HQE A;  2XIC A;  3VUZ A;  2YSQ A;  4C0D B;  2X3X D;  5CO7 A;  1YWO A;  2DF6 A;  5HY6 A;  1T3S A;  3OYM A;  2LT4 A;  4J83 A;  2L3S A;  1OQK A;  1BU1 A;  3O8V A;  4Z8A A;  5GAN 5;  2DXC A;  2P4T A;  1S72 T;  2CSQ A;  4XU0 A;  1VQK A;  1I0C A;  1UJ0 A;  4A54 A;  1XTD A;  2K5F A;  4OML A;  3RER A;  2E64 A;  4PK4 A;  3JCM h;  3SD4 A;  2EW3 A;  1IGQ A;  3TQ7 P;  1W2B S;  1CKB A;  3HSB A;  4HA8 A;  1IXD A;  1JBM A;  2EJG A;  3HL8 A;  4PJO C;  3OBW A;  2E65 A;  5D7U A;  1F1B B;  2J6F A;  2HBW A;  3HRS A;  5M9O A;  1PD1 A;  2NUT A;  1AZG B;  3H41 A;  3I5S A;  3V7S A;  4RTZ A;  3CPF A;  3HHT B;  2V1Q A;  2OAW A;  1K9M U;  2GTO A;  2LCC A;  3EHQ A;  4X1V A;  2ZZD A;  3PVQ A;  3M0R A;  2E70 A;  4RUG A;  3C95 A;  2DD4 A;  4OGC A;  3CXC A;  4HVW A;  2JN0 A;  2KYB A;  3M0P A;  2CT4 A;  4FYW B;  1LPL A;  2FRW A;  4J9I A;  4J9G A;  2GBQ A;  3OW2 P;  3UPU A;  4OGE A;  3M0S A;  4F7U E;  4XQ3 A;  4EMK B;  1WI7 A;  2CUD A;  4E7L A;  4F7U G;  1TSF A;  4E6R A;  3EAE A;  3X28 B;  5C6S A;  2QTX A;  4RKU E;  1TTH B;  1W4S A;  2M0O A;  2HL3 A;  4MZM A;  1PKT A;  1KJW A;  1VQ8 A;  1U1T A;  3GPL A;  4F04 B;  3QYG B;  2H8H A;  2IPO B;  1N6A A;  1P92 A;  4BI4 A;  4E7S A;  2DIQ A;  2K2V A;  5FU7 C;  3EGD B;  4NOY A;  2JOY A;  5GAM h;  3MP6 A;  5LJ3 h;  9ATC B;  2HNI A;  2Y4X A;  1HK9 A;  1BYM A;  2CZ6 B;  3A8L B;  2H3E B;  4PFZ A;  1G83 A;  2KMT A;  1G5V A;  2EFI A;  4OMN A;  3A8G B;  2GNC A;  2YHT A;  3R6O A;  1NJI R;  3GNF B;  4O5V A;  1VOM A;  3CC2 A;  2XHC A;  3KBG A;  1BIA A;  4GLK A;  4BB7 A;  1W70 A;  5GMK e;  3CCL A;  2FRY A;  2PUK B;  4OP0 A;  4LXC A;  1VYT A;  3GBQ A;  3JCM X;  2RJD A;  3G71 T;  4M7A A;  4QVZ A;  3DKM A;  4AMC A;  2F2V A;  3LGF A;  4OB3 B;  2YXY A;  2YT6 A;  1KC8 C;  4PLI A;  1M2V B;  3UDC A;  5GAN e;  3I56 Q;  8AT1 B;  2M9U A;  3JCM V;  2DAQ A;  5GMK i;  2O01 E;  2W10 A;  3H6Z A;  4C5H A;  4FT2 A;  2XDD A;  1SG5 A;  3EFR A;  4X9C A;  1JJ2 P;  2CP7 A;  4YTL A;  3D7S B;  3G4S T;  1GFC A;  2YUQ A;  2KGT A;  6AT1 B;  1BCM A;  2EGC A;  5HK3 A;  4DBF A;  1SPK A;  1KHI A;  4C0Z A;  1VQP T;  3C4S A;  5CK9 A;  3VS0 A;  2V8I A;  1VQM T;  2DKG A;  2QI2 A;  1QKX A;  1H3H A;  1U1S A;  2SRC A;  2JW4 A;  2LP5 A;  3EGU A;  4KUL A;  1NLO C;  1OZ2 A;  4BY6 C;  1D3B B;  4N4H A;  2J6K A;  1N9R A;  2X4W A;  3MHX A;  2DM1 A;  3O5Z A;  2GF7 A;  4OMQ A;  2IIM A;  1B3Q A;  2QGF B;  3CC7 Q;  2ENM A;  3NPF A;  1YIJ A;  3MEU A;  4LDY A;  5A0D A;  4ZGE B;  3CME Q;  3M56 A;  4FYY B;  1PG5 B;  4Z89 A;  4IUT A;  2W0Z A;  3CCJ Q;  4C92 E;  3M59 A;  2O4X A;  1UG1 A;  1N9S A;  4HVV A;  4M7A C;  2YRD A;  5I21 A;  1ZUK A;  1PC0 A;  4C92 G;  3CCE Q;  1JXM A;  2CP3 A;  4OVA A;  4M78 A;  2VXE A;  5GAM g;  1M27 C;  1Q7Y R;  4CC7 A;  3G6E Q;  3GP8 A;  2L3Q A;  4KGX B;  2RPN A;  2EAY A;  1OX9 A;  3CCQ A;  2KI7 A;  2KE9 A;  3EG9 B;  3QZ9 B;  5KYW B;  1FMW A;  4WCI A;  4ORZ A;  2DEU A;  3H8Z A;  3BY7 A;  2DEQ A;  1VQ6 Q;  1D1C A;  4PL6 A;  1NYF A;  4M77 E;  4RTV A;  1WDX A;  3WXM B;  1M4Z A;  3VV0 A;  3JRZ A;  5KYU B;  1WXU A;  1R8O B;  5FWB A;  3LWH A;  4Z88 A;  4BE2 A;  2ESW A;  4C8Q A;  4JRQ A;  5CKE A;  2F69 A;  2EGE A;  5DM7 R;  2K5L A;  3OW2 A;  2HCK A;  2JM8 A;  1VQ7 Q;  5FRN A;  4J9H A;  2A08 A;  2CP5 A;  4IUU A;  3MEW A;  3CCR Q;  4KH0 B;  4M75 A;  3SWN A;  1O75 A;  3CCU T;  1VA7 A;  4RTX A;  1WHL A;  2ZGW A;  3UWN A;  4FW2 A;  1AWX A;  3WVD B;  1PSF A;  1VIE A;  4IKF A;  3M57 A;  4TVR A;  2RN8 A;  4C92 D;  1N5Z A;  3P8D A;  1U5S A;  2CT3 A;  1Y57 A;  2XK0 A;  4OMM A;  4QKU A;  2VC8 A;  3QWY A;  4MML A;  1RAH B;  1TH7 A;  1H3Z A;  5IHK A;  2R57 A;  4M78 C;  2DXB A;  2KXD A;  1I5O B;  3CMA T;  2RB6 A;  2RJC A;  4BI8 B;  2E12 A;  2K3B A;  2DE0 X;  1YJ9 A;  4CC4 B;  3MEA A;  3QXE B;  1M2O A;  2BZ8 A;  2JMA A;  3SDZ A;  2KRS A;  2QAS A;  1WIE A;  2D9T A;  3I35 A;  1KK7 A;  4II1 A;  1I4K 1;  4RG8 A;  5HK0 A;  2A7Y A;  1Q81 U;  2EYX A;  5LL6 S;  3I56 A;  3H0H A;  2OTJ Q;  2CDT A;  1TS9 A;  1BB9 A;  3VYG A;  1M1K R;  4J9B A;  4M7D B;  1Y96 B;  1ZSZ B;  1FYN A;  3S3O A;  3LGL A;  2F5T X;  1M8V A;  5FW9 A;  1VQK T;  1V29 B;  3E9G A;  3MPU B;  2BZX A;  2VGM A;  4FSS A;  4X9D A;  3VS4 A;  1YHQ Q;  1JB0 E;  2BE9 B;  1NLP C;  3NTH A;  1SSF A;  3MKD A;  1E6G A;  4C8Q C;  4RTT A;  4ATO A;  1JQQ A;  3JCM d;  1OU8 A;  2D0N A;  2QEX Q;  2LQ8 A;  3H0F A;  4NL2 A;  2VXF A;  3PTA A;  2DET A;  1G3T A;  5D6W A;  1RLP C;  1C0M A;  1KFZ A;  4F17 A;  4M75 C;  3SWN C;  1VQ4 Q;  2J06 A;  1BI0 A;  5EC7 A;  1E7O A;  3CXC P;  2JJ9 A;  2RHU A;  2O88 A;  1VQL Q;  1TOV A;  1RAB B;  3CCM Q;  2H3J A;  2YUP A;  4LN2 A;  2JM9 A;  3OYJ A;  4PJO E;  4JLG A;  2GCX A;  2D8H A;  2XG8 D;  1OV3 A;  3EGX A;  5DLQ E;  1LVK A;  3CC7 A;  1ZQ1 A;  1R0C B;  1TG0 A;  3JCM e;  4BD3 A;  1QVG A;  1WFW A;  2EYY A;  4XTZ A;  2FYK A;  3OMG A;  2RI5 A;  1QW1 A;  1YIT T;  3CCE A;  2PUO B;  2AZV A;  2L5Q A;  2MOX A;  2VAS A;  4FYV B;  1IB8 A;  3G6E A;  1QVF S;  5ECA A;  2MF2 A;  4IUP A;  4JRI A;  4AFQ C;  5GAN 6;  4A4F A;  5DY9 A;  2P0P A;  1KC8 U;  4M77 B;  1YI2 T;  1VIF A;  3KFV A;  2CSI A;  2E4H A;  3LH5 A;  3M4Y A;  3PIO A;  1WHK A;  1RAF B;  3FLG A;  3L1A A;  1M90 U;  1T0H A;  2L2P A;  3VS6 A;  3EH1 A;  3X26 B;  4J9F A;  1EZZ B;  4Y92 A;  1NEG A;  3EFO B;  1VQ8 Q;  3C0C A;  1X43 A;  4P5N A;  1Y7X A;  2AHJ B;  3VRY A;  5LJ3 d;  3CD6 Q;  2DRK A;  1GXI E;  1UUE A;  2D0Q B;  3REA B;  1VQN T;  4LD6 A;  5KYX A;  2EWN A;  4M4Z A;  3M0T A;  2DLP A;  2YWW A;  1VQ9 Q;  4BE1 A;  4HT8 A;  1FX7 A;  1VQ7 A;  4PJO D;  3M54 A;  2XMF A;  4E7K A;  1HXD A;  2PVO B;  5CQY A;  3CCR A;  3ZL7 C;  3TVT A;  1GCP A;  1KD1 U;  1WHH A;  1BKB A;  2E6Z A;  4EPC A;  1Q82 R;  4WTO B;  5GAM e;  5LJ3 e;  1H92 A;  2DBK A;  4C8Q F;  3CCL T;  3OS5 A;  4KGZ B;  3JCM c;  2IG0 A;  2LJ3 A;  3OMC A;  3CC2 Q;  2CP2 A;  3OYK A;  2YLB A;  1W1F A;  4MDW A;  2HAX A;  4M75 F;  3M55 A;  2V8K A;  1WLP B;  3BW1 A;  2X3W D;  4OB0 B;  1Q86 R;  3TU4 K;  2QDL A;  5GJV B;  4E2F B;  4GBQ A;  1QVP A;  4HVU A;  1T3L A;  4M7D F;  2BZY A;  5J3B A;  4ZTF A;  2B86 A;  3QDR B;  4KGV B;  2OTJ A;  1W6X A;  5GAN 2;  2RH2 A;  1RL2 A;  3L2W A;  2EQU A;  1RAG B;  2MAM A;  4PKC C;  5GAN 3;  3MP1 A;  1VQ5 Q;  4F14 A;  2XDP A;  3LYI A;  1YCY A;  3CPW A;  3UA7 A;  1YHQ A;  1QLY A;  1V1C A;  1KQS S;  5KH6 A;  4J8O A;  4Z02 A;  2O9V A;  3RKW A;  1B34 B;  2JS2 A;  2QEX A;  2KXC A;  3RR6 A;  2ED1 A;  1BIB A;  1JU5 C;  1PKS A;  3GF5 A;  2WAC A;  3HRT A;  1TXQ A;  3OYY A;  4RTW A;  1M1G A;  1UEC A;  1YWP A;  1VQ4 A;  2FEI A;  3EG1 A;  3JV3 A;  1JJ2 S;  2X35 A;  1VQL A;  3PNW C;  1X27 A;  4LUD A;  1E6H A;  1YBY A;  3CCM A;  2EVR A;  1I8F A;  2V1R A;  4DOW A;  3M9Q A;  4A4E A;  2XD0 A;  1YIJ Q;  2DIG A;  3ULR B;  4EMK A;  1G3S A;  1AD5 A;  4BDY A;  4C0D C;  4FYX B;  3J80 E;  2AT1 B;  3NGP A;  4F16 A;  4CI0 C;  5FU6 B;  3A98 A;  4R55 A;  1G2B A;  5I11 A;  5A2Q E;  5GAN 4;  3H0I A;  4XTX A;  2QYZ A;  4JS4 A;  3DB3 A;  4ANJ A;  2RHY A;  4D8D A;  4M7A G;  1D1A A;  4PNO A;  2ATC B;  2RQV A;  5D6X A;  4QQD A;  2DBM A;  4HCZ A;  2CRE A;  1U3O A;  4M77 F;  1Q81 C;  1RAE B;  3CCQ Q;  4KUD K;  3CCV Q;  1GL5 A;  3VS3 A;  1ARK A;  1K73 U;  4RCB A;  1OYX A;  3GOX A;  2HSP A;  3EGD A;  2KNB B;  3MET A;  3GIB A;  1K8A U;  3QJ6 A;  1AHJ B;  2NUP B;  2FZC B;  1N8R U;  1AWO A;  2LTO A;  4J9C A;  4LD9 K;  3QO3 A;  1M30 A;  4JRK A;  2AZS A;  3EFS A;  4FW1 A;  4RMO A;  3RKX A;  4JJB A;  3JSC A;  3LH0 A;  4LDU A;  4DBQ A;  1XJW B;  4HKE A;  1WHM A;  3HP9 A;  3CD6 A;  1ABO A;  3RDV A;  2DXU A;  3QSU A;  2IVW A;  2NUT B;  1SHF A;  3OYF A;  1HYO A;  2ZPF B;  3OYH A;  4IUV A;  1VQ9 A;  4JS5 A;  5HKC A;  3PIP A;  3AHU A;  1WQ7 A;  4MZP A;  2A36 A;  4EMK C;  1M9S A;  2WSC E;  1HD3 A;  4LDX A;  3JB9 H;  3FC3 A;  1M2V A;  2BUD A;  3OSV A;  3OA6 A;  5J39 A;  5GAO l;  5GAN d;  4NL3 A;  1Z9Z A;  4M7A D;  1RI9 A;  4PFP A;  3HFO A;  5I2M A;  2M0Y A;  5HCK A;  3V8K A;  1ZLM A;  2DFU A;  4J6X A;  4PFO A;  3V8J A;  3OYD A;  4M78 G;  3I5R A;  1YJ9 Q;  3OS1 A;  2EQJ A;  1ZUU A;  2LNH B;  5GJW B;  2LX7 A;  2FB7 A;  3MP8 A;  3I56 T;  4K11 A;  1MMA A;  5FWC A;  1WX6 A;  1UDL A;  2E3I A;  1PRM C;  1UGQ B;  3A8M B;  2RO0 A;  1VQO T;  2QXF A;  1ACM B;  2LQK A;  5GMK j;  1X75 C;  2EKH A;  5IHN A;  1RLQ C;  4PJL A;  3UF4 A;  3E1S A;  2L3R A;  2FVU A;  3OSS C;  1TU0 B;  3CBM A;  2DPP B;  1D3B A;  3SB2 A;  2HDA A;  1MMN A;  3QPH A;  1M90 C;  2K5I A;  4ZNX A;  2KRN A;  1HSQ A;  1VQ5 A;  5GMK m;  1LNX A;  4BAC A;  4FSX A;  1UFF A;  1UGV A;  3QKJ A;  2BIV A;  1QVG P;  1Y0M A;  4C8Q G;  3P8B B;  3G71 Q;  2LQN A;  2OI3 A;  2XDB A;  1UGR B;  1CKA A;  3VRZ A;  1PM3 A;  2FZK B;  2C0I A;  3THK A;  4M75 G;  3CC7 T;  2NLU A;  3VS1 A;  3I55 Q;  2J05 A;  3CME T;  1D0Y A;  3KXT A;  1WJQ A;  3X20 B;  4DBR A;  3JB9 F;  1KD1 C;  4ZGD B;  2QA4 A;  3CCJ T;  2ZPG B;  4JZ3 A;  2GQV A;  2HMA A;  4M78 D;  1PCX A;  2DIL A;  3EG9 A;  4M7D G;  5KYW A;  2EIF A;  3H9N A;  2C0T A;  1GRI A;  2DL8 A;  2KT1 A;  1BI3 A;  4DBH A;  1XQH A;  3NFC A;  1X6O A;  2KRO A;  3NHN A;  1TUD A;  2HQH A;  5CKB A;  1VQM Q;  3CXC S;  2X4X A;  5KYU A;  3ZFJ A;  3M4G A;  4F7U B;  2RI2 A;  5L23 A;  3JCM W;  2BTT A;  1M8M A;  3LX7 A;  1VQ6 T;  2KQW A;  2DL3 A;  1BI2 A;  1ZSG A;  4DQ2 A;  3CCV A;  2MWP A;  2G3R A;  4C5E A;  2GGR A;  1OUL A;  1C1A A;  2EBP A;  4C8Q D;  1PHT A;  3EHR A;  2QGG A;  3S6W A;  2DVJ A;  2FL7 A;  5KYY B;  1QCF A;  3L42 A;  2CZ0 B;  2K2M A;  2L89 A;  3MJX A;  4J6Y A;  2M16 A;  3OS0 A;  1YN8 A;  4M75 D;  1VQ7 T;  2QQR A;  2QTV A;  3CCS Q;  4L5G A;  2RNA A;  3CCR T;  1VUB A;  2DZ9 A;  2DXT A;  2QQB A;  2KK4 A;  5CAI A;  2O4X B;  1IZ6 A;  2QAZ A;  1M5Q 1;  4DEX A;  1PD0 A;  2RM4 A;  5LJ5 g;  3LWI A;  4EMH A;  2K4Y A;  1D09 B;  7AT1 B;  3ER0 A;  3EG2 A;  3TSW A;  4OMP A;  1FXX A;  2ED0 A;  3BE3 A;  5LJ5 f;  1LJO A;  4QQG A;  1RAC B;  4C0G A;  2R58 A;  2YLC A;  1IRE B;  3CC4 Q;  2C06 A;  4M7D A;  1Y96 A;  3OB9 A;  1ZSZ A;  4EIK A;  2CKK A;  3RUX A;  4JLI A;  2ROT A;  1I5L A;  5IXB A;  1RAI B;  3CPW P;  1WZO A;  1FWZ A;  4ZTJ A;  4PJN A;  1YFN A;  2RD1 A;  3JCM Q;  2ZPE B;  2DYB A;  4E7I A;  2OTJ T;  1KQ2 A;  1K9M R;  1SEM A;  1K73 C;  5J26 A;  2CP6 A;  2LCL A;  2YRC A;  5GMK h;  2LDM A;  2JXB A;  3EG3 A;  2RK2 A;  4NS5 A;  1AVZ C;  1FMV A;  1YHQ T;  1K8A C;  2PVG B;  1N8R C;  1X69 A;  1MMG A;  2L3P A;  5I22 A;  1X6B A;  2QEX T;  4A4K A;  2XID A;  3X25 B;  3GNG A;  2CZ7 B;  4C5G A;  4FCY A;  1SSH A;  1SRL A;  1R0B G;  4KRT A;  1VQ4 T;  4HXJ A;  3QHS A;  4EMG A;  1VQL T;  2KR3 A;  3UT1 A;  3G71 A;  1ZBX A;  4AFU C;  3CCM T;  1G3W A;  1Q95 G;  1UEB A;  1T0J A;  1OEB A;  4Q5W A;  4FT4 A;  2PTK A;  2CYZ B;  3OS2 A;  1WHG A;  1MNE A;  4AFZ C;  3I55 A;  3U23 A;  2F1L A;  3RBB B;  3OYB A;  1JRI A;  5IH2 A;  2K3X A;  4BUG A;  4C92 B;  4M7D C;  1ZSZ C;  1WJR A;  5GAO q;  4HCC A;  4M77 A;  5AYF A;  4KH1 B;  2PNI A;  4PJJ A;  2A3L A;  4XU1 A;  4VUB A;  2CUB A;  4F7U F;  1KSW A;  2PU9 B;  3OYE A;  1MMD A;  1VQM A;  2K6D A;  2KY9 A;  3ME9 A;  1NJI U;  4J9E A;  3INZ A;  1W2B A;  2DK3 A;  2CP0 A;  2BE7 D;  3QZ5 B;  3BDL A;  2JVV A;  3P8H A;  1K4U S;  1D0Z A;  2LRQ A;  1SKU B;  3OYL A;  2RF0 A;  4L6V 5;  3TRE A;  2PVD B;  1UB4 A;  5CCA A;  1VQ8 T;  3C12 A;  2R5M A;  4ZN1 A;  4EDU A;  4XTU A;  3CD6 T;  2J7I A;  1QP2 A;  3PT9 A;  2LCS A;  5GAO n;  1H8K A;  2KRM A;  3HPW A;  1YIT Q;  3VS7 A;  3FIF A;  5GAM d;  1VQ9 T;  5IXF A;  3TEE A;  3RMQ A;  3QUI A;  2E3H A;  3CCS A;  5AT1 B;  2MI6 A;  3OW2 S;  4UC4 A;  4D6W A;  3J81 E;  3FB9 A;  4HCK A;  3PFS A;  2ROL A;  1K0S A;  4AFS C;  3UA6 A;  1YI2 Q;  2LJ1 A;  3EH2 A;  4M77 C;  3TSZ A;  4XTV A;  3HKS A;  3OYC A;  2FPD A;  3CC2 T;  4GLM A;  1UGS B;  5GAN f;  3DLM A;  2X4J A;  1NBE B;  4LNP A;  2KBT A;  1RI0 A;  1Q82 C;  3CQT A;  3CC4 A;  3VJP A;  2MPX C;  1YJW Q;  1K76 A;  1C6V X;  2QK0 A;  1DJ7 B;  3M5A A;  5LJ3 j;  2DRM A;  1VQN Q;  4OMO A;  3L2Z A;  5GAN 7;  2RK1 A;  1OOT A;  4A4H A;  3NTK A;  3KUF A;  2GFA A;  2MWO A;  2VUB A;  3NMZ C;  4OB1 B;  1B34 A;  1QCO A;  1Q86 C;  2K3Y A;  4RTU A;  1AOJ A;  1Q7Y U;  4KBM B;  2RI3 A;  3GLX A;  1K9A A;  2KEA A;  3X24 B;  2DD5 A;  4FIB A;  2F2X A;  2VWF A;  3VUB A;  3SHW A;  5LJ5 j;  1BI1 A;  4AG2 C;  1KG1 A;  4CC3 A;  4DOV A; 
#chains in the Genus database with same CATH homology
 2DA9 A;  1Z9Z A;  1RI9 A;  2M0Y A;  5HCK A;  1ZLM A;  2AKK A;  2VVK A;  3UAT A;  1ABQ A;  1NYF A;  3I5R A;  4RTV A;  1WDX A;  2RQR A;  1ZUU A;  2D8J A;  2LNH B;  5GJW B;  2LX7 A;  2F2W A;  2MCN A;  1WXU A;  5FWB A;  4K11 A;  5FWC A;  1WX6 A;  1NYG A;  1UDL A;  4Z88 A;  1PRM C;  2ESW A;  2DX1 A;  2EGE A;  1J3T A;  2EKH A;  2A28 A;  2HCK A;  2JM8 A;  1I07 A;  1B07 A;  1UE9 A;  5IHN A;  2KYM A;  1RLQ C;  4J9H A;  1ZX6 A;  2A08 A;  2FPE A;  3UF4 A;  1AEY A;  1ZUY A;  1VA7 A;  4RTX A;  2HDA A;  1AWX A;  1A0N B;  4ZNX A;  2KRN A;  1HSQ A;  2DMO A;  2RQT A;  2RN8 A;  1N5Z A;  1Z9Q A;  2SEM A;  1U5S A;  1UFF A;  2CT3 A;  1Y57 A;  4OMM A;  3QWY A;  1UGV A;  2LJ0 A;  5IHK A;  1Y0M A;  3IQL A;  1UHF A;  1JO8 A;  2KXD A;  2YDL A;  2AK5 A;  2LQN A;  4JPB W;  2OI3 A;  2K79 A;  1WYX A;  2K3B A;  2DE0 X;  2EQI A;  4CC4 B;  1CKA A;  2P4R A;  3VRZ A;  2C0I A;  3THK A;  1YP5 A;  2I0N A;  2BZ8 A;  2JMA A;  3VS1 A;  1RUW A;  2KRS A;  1WIE A;  4J9D A;  2J05 A;  3I35 A;  2EYW A;  1QKW A;  2DL4 A;  4LE9 A;  4JJC A;  2RQW A;  1IO6 A;  2LMJ A;  2EYX A;  4JZ3 A;  3H0H A;  2DIL A;  2ECZ A;  2CDT A;  1BB9 A;  3VS2 A;  1VYU A;  2C0T A;  1GRI A;  1U06 A;  4QT7 A;  2O2O A;  4J9B A;  2DL8 A;  2KT1 A;  1FYN A;  1XOV A;  1MUZ A;  2RMO A;  5FW9 A;  1MV0 B;  3NHN A;  2KRO A;  2FO0 A;  4ESR A;  2G6F X;  1I1J A;  4FSS A;  2BZX A;  3VS4 A;  1TUD A;  2OJ2 A;  2K9G A;  1NLP C;  1E6G A;  1PWT A;  4RTT A;  3EG0 A;  1JQQ A;  2D0N A;  3H0F A;  5L23 A;  2BTT A;  1M8M A;  1RLP C;  2EYZ A;  1WXT A;  2J6O A;  1VYV A;  1KFZ A;  4F17 A;  2L0A A;  1AWJ A;  2DL3 A;  2PZ1 A;  2J06 A;  1ZSG A;  5EC7 A;  1E7O A;  2CH4 W;  2O88 A;  1JEG A;  1X2K A;  1K1Z A;  2EGA A;  2GGR A;  2KT8 A;  1YNZ A;  1GFD A;  4LUE A;  1QWE A;  2EBP A;  4CC2 A;  1HJD A;  2YUP A;  4LN2 A;  1PHT A;  1PRL C;  2JM9 A;  3EHR A;  4IIM A;  2DVJ A;  2D8H A;  1QCF A;  1OV3 A;  2K2M A;  1TG0 A;  1NG2 A;  3M0U A;  1YN8 A;  1WFW A;  2EYY A;  1SHG A;  2RNA A;  2YSQ A;  1KIK A;  2X3X D;  1YWO A;  2DF6 A;  1T3S A;  2L3S A;  1BU1 A;  4Z8A A;  2AZV A;  2MOX A;  3PVL A;  4DEX A;  2CSQ A;  1ZBJ A;  5ECA A;  1GCQ A;  3REB B;  4AFQ C;  2DJQ A;  1I0C A;  1UJ0 A;  1QWF A;  3EG2 A;  3TSW A;  4OMP A;  4OML A;  2ED0 A;  3R6N A;  3KFV A;  2CSI A;  1MV3 A;  3LH5 A;  2O31 A;  2EW3 A;  1CKB A;  4EIK A;  1T0H A;  2L2P A;  2K7A A;  3VS6 A;  2ROT A;  2J6F A;  4J9F A;  5IXB A;  2HBW A;  4Y92 A;  1NEG A;  3C0C A;  1X43 A;  3VRY A;  2DL5 A;  1AZG B;  2MIO A;  3H41 A;  3I5S A;  2DRK A;  2DYB A;  4RTZ A;  3I9Q A;  1UUE A;  1WA7 A;  2JTE A;  1OPL A;  2V1Q A;  2OAW A;  4IIO A;  2GTO A;  3EHQ A;  4X1V A;  3REA B;  1SEM A;  3PVQ A;  3M0R A;  4M4Z A;  3M0T A;  4RUG A;  2DLP A;  2JXB A;  3EG3 A;  4HVW A;  1AVZ C;  2XMF A;  2KYB A;  3M0P A;  2CT4 A;  2FRW A;  4J9I A;  1X69 A;  2L3P A;  3ZL7 C;  3TVT A;  5I22 A;  1X6B A;  4J9G A;  2GBQ A;  1GCP A;  1GBR A;  3M0S A;  1WI7 A;  2CUD A;  2LQW A;  1SSH A;  1H92 A;  1SRL A;  2DBK A;  4KRT A;  2HEQ A;  4HXJ A;  4E6R A;  2LJ3 A;  1M3B A;  2KR3 A;  4AFU C;  1W1F A;  1AWW A;  1GCQ C;  1KJW A;  1PKT A;  2GQI A;  3VS5 A;  1GBQ A;  2LZ6 B;  1T0J A;  1WLP B;  1OEB A;  2X3W D;  2PTK A;  2H8H A;  1EFN A;  1OPK A;  2QDL A;  5GJV B;  1NM7 A;  4GBQ A;  4AFZ C;  2ABL A;  4HVU A;  3U23 A;  1T3L A;  3RBB B;  2NUZ A;  5IH2 A;  2BZY A;  4D8K A;  2B86 A;  1W6X A;  4JJD A;  1YCS B;  1BK2 A;  2PNI A;  1G83 A;  4F14 A;  2CUB A;  1KSW A;  3UA7 A;  1X2Q A;  1QLY A;  3RNJ A;  1V1C A;  2K6D A;  4OMN A;  1CSK A;  1JXO A;  2O9V A;  1UJY A;  2GNC A;  4J9E A;  4DEY A;  2JS2 A;  2KXC A;  5IHI A;  2ED1 A;  1JU5 C;  1PKS A;  1WXB A;  1UTI A;  1K4U S;  4RTW A;  1W70 A;  1UEC A;  1YWP A;  2RF0 A;  1PNJ A;  2GTJ A;  2FRY A;  2FEI A;  3EG1 A;  1VYT A;  3GBQ A;  3JV3 A;  2F2V A;  1X27 A;  1LCK A;  4LUD A;  2YUO A;  4RTY A;  1E6H A;  2YT6 A;  2M51 A;  2EVR A;  2V1R A;  4R0K A;  2J7I A;  1M3A A;  3QWX X;  2LCS A;  3ULR B;  2W10 A;  2FG0 A;  1AD5 A;  1H8K A;  2KRM A;  2RQU A;  4A63 B;  3VS7 A;  2VKN A;  3NGP A;  4F16 A;  5IXF A;  3A98 A;  1G2B A;  5I11 A;  1UHC A;  2O9S A;  3H0I A;  1TUC A;  1FMK A;  1GFC A;  2YUQ A;  4HCK A;  2KGT A;  4D8D A;  2ROL A;  1K0S A;  2EGC A;  4AFS C;  3UA6 A;  1SPK A;  1SRM A;  2RQV A;  2LJ1 A;  2FPF A;  2A37 A;  3FJ5 A;  2DBM A;  3VS0 A;  2CRE A;  1U3O A;  3TSZ A;  2E5K A;  2EPD A;  1QKX A;  1X6G A;  2FPD A;  3VS3 A;  1ARK A;  2SRC A;  2JW4 A;  1GL5 A;  1H3H A;  2LP5 A;  1M3C A;  4GLM A;  4JZ4 A;  3EGU A;  1NLO C;  2HSP A;  4LNP A;  2KBT A;  2KNB B;  2J6K A;  3CQT A;  1K0X A;  1AWO A;  2D1X A;  2JT4 A;  4J9C A;  2DNU A;  2DM1 A;  3O5Z A;  3SEM A;  1M30 A;  4OMQ A;  1K76 A;  2AZS A;  2IIM A;  2C0O A;  1B3Q A;  1S1N A;  2ENM A;  3NPF A;  2DRM A;  4AG1 C;  4OMO A;  1OOT A;  4JJB A;  4Z89 A;  2W0Z A;  3M0Q A;  3NMZ C;  1UG1 A;  1AZE A;  1NEB A;  4HVV A;  1ABO A;  1ZUK A;  1JXM A;  4RTU A;  1SHF A;  2JMC A;  1AOJ A;  2CH4 A;  2JS0 A;  1M27 C;  4CC7 A;  1K9A A;  2KEA A;  2L3Q A;  2RPN A;  2AKL A;  2F2X A;  3PE0 A;  2A36 A;  2VWF A;  3SHW A;  1HD3 A;  2DL7 A;  2KE9 A;  4AG2 C;  4CC3 A;  2YUN A;  2NWM A;  4WCI A;  1BBZ A;  4ORZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...