2DL7A

Solution structure of the second sh3 domain of human kiaa0769 protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
73
structure length
73
Chain Sequence
GSSGSSGVCFVKALYDYEGQTDDELSFPEGAIIRILNKENQDDDGFWEGEFNGRIGVFPSVLVEELSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0769 protein
publication title Solution structure of the second SH3 domain of human KIAA0769 protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 5
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2006-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dl7A00
1WXTA 2EGAA 4ESRA 2GQIA 1ABQA 2M0YA 5L23A 1B3QA 1M8MA 1AWWA 2FRWA 2V1QA 1G83A 3UATA 2JXBA 4FSSA 1ZUYA 3RNJA 2BZXA 2BZ8A 2CH4W 2FG0A 2LQWA 4K11A 4ORZA 2LQNA 4R0KA 3PE0A 2JM9A 2QDLA 1ZUKA 2RMOA 2A36A 2G6FX 2SEMA 2CT4A 3R6NA 1Y57A 2RQTA 4AG2C 2D8HA 2YUNA 1YP5A 2BTTA 4CC7A 2FPDA 2J6OA 2L3PA 2DJQA 1GFDA 2AK5A 1A0NB 1X6BA 3REAB 2CSQA 1M3CA 1UECA 1PRLC 2P4RA 4HVUA 3M0TA 5EC7A 1Z9ZA 2RN8A 1GCQA 2DBKA 3VS4A 3LH5A 2KXCA 1G2BA 4OMPA 4Z88A 3ULRB 5FWBA 3M0UA 3TVTA 2LMJA 4RTZA 1SRLA 4JJBA 5ECAA 2D1XA 1U3OA 2KBTA 2FRYA 2CDTA 1M3BA 4DEYA 1ZUUA 2JW4A 4AFSC 1YNZA 2CUDA 4OMNA 1T3LA 2ABLA 1UUEA 1RLPC 4RTTA 3M0RA 1BU1A 1KFZA 3C0CA 1EFNA 1UJYA 1ARKA 1UG1A 4HVWA 1JO8A 1PKTA 1K1ZA 4D8DA 1GRIA 1QKWA 3UA7A 1AZEA 3H0HA 2K7AA 5FW9A 1ZX6A 1X27A 1PRMC 1AWJA 2F2WA 2DF6A 1RI9A 1U06A 4F16A 1OPLA 3UA6A 2VWFA 2YUOA 1BBZA 1H3HA 2O9SA 2ECZA 3EG0A 1UHFA 2L3SA 1WLPB 4Z8AA 2DRMA 4J9BA 1JU5C 1OOTA 1WIEA 1FYNA 1W6XA 1QLYA 4AFZC 1WX6A 2DL8A 4D8KA 2K6DA 2YT6A 3M0QA 3EHQA 4GBQA 4ZNXA 2BZYA 1YCSB 2KROA 2GNCA 1WFWA 3QWYA 2HCKA 4JJDA 2YSQA 1M30A 1SEMA 1S1NA 3GBQA 2J6FA 1PWTA 2FEIA 1ABOA 1GL5A 2KXDA 1T0JA 1PHTA 1SPKA 4CC3A 4KRTA 1TUDA 1MUZA 2J6KA 5GJWB 1I07A 2JMCA 2A08A 1KIKA 2EGEA 3A98A 1GCPA 2LZ6B 1UE9A 2AZVA 1M3AA 4F17A 2DX1A 1NEBA 1YN8A 2KRNA 1IO6A 4DEXA 1X2QA 1VYUA 2ENMA 2W0ZA 4HVVA 2KYBA 1RUWA 3EG3A 3VS6A 3KFVA 2DL5A 5GJVB 2EKHA 4J9CA 1GFCA 1W1FA 2AKKA 1AWXA 1UHCA 1XOVA 4RTYA 1T0HA 2RNAA 4EIKA 4AFUC 1J3TA 3NGPA 4OMOA 2CREA 3VRYA 1TUCA 5IH2A 1AVZC 3M0PA 2LJ1A 3JV3A 2DL4A 1H92A 2EYWA 2YUPA 5HCKA 2LCSA 1K9AA 1KJWA 1AOJA 2C0TA 4J9EA 2J7IA 3H0FA 4Y92A 2VKNA 3TSZA 1CKAA 1SHGA 3SHWA 1AEYA 2HEQA 1E6HA 2HBWA 5IHNA 1PKSA 2NWMA 2O88A 2O2OA 2KT1A 1K4US 4IIOA 3NMZC 1SHFA 1WDXA 2KRMA 4IIMA 4Z89A 2OJ2A 4WCIA 1JXOA 2HDAA 4HCKA 2EYYA 3VS0A 2JTEA 2EPDA 2DA9A 2K2MA 1UJ0A 4E6RA 3EGUA 1HJDA 1CKBA 2PNIA 2JS2A 2K3BA 2C0IA 3EG2A 3RBBB 2PTKA 2JM8A 1YWPA 2I0NA 2E5KA 2F2VA 2ROLA 1HD3A 4OMMA 5FWCA 2L3QA 1MV3A 1BB9A 2X3WD 2LJ0A 4J9FA 1ZBJA 1WXBA 2SRCA 4CC2A 1NLPC 2DM1A 1M27C 1KSWA 4J9IA 3H0IA 3TSWA 1GBRA 4RTWA 5IXBA 2JMAA 1WXUA 2CUBA 2EW3A 1ZSGA 2DNUA 1OEBA 2DLPA 4J9HA 2ED0A 2GBQA 2EBPA 2L2PA 1GCQC 2MIOA 2HSPA 2PZ1A 4HXJA 1MV0B 2DRKA 2DILA 3I5RA 2KT8A 2GTOA 4M4ZA 3NPFA 3PVLA 2EQIA 2J06A 1BK2A 2OI3A 4CC4B 2D0NA 4J9GA 1HSQA 4RUGA 4LUEA 4OMQA 1JEGA 1K0XA 1X43A 1VYVA 2RQVA 2IIMA 2EVRA 3SEMA 1AWOA 1YWOA 1K0SA 1X69A 3VS5A 4LN2A 2ROTA 2XMFA 4JZ3A 1N5ZA 1NLOC 2DE0X 2K79A 1WI7A 1CSKA 1ZLMA 2JT4A 2GTJA 4AFQC 2O31A 1UFFA 4OMLA 1V1CA 3I9QA 5I22A 1H8KA 2W10A 1FMKA 1B07A 1NG2A 2YUQA 2AKLA 2CSIA 2H8HA 3QWXX 5IHKA 1NM7A 1UDLA 2RQUA 2V1RA 2CH4A 2DL7A 2KRSA 3EG1A 2FPEA 3CQTA 1NEGA 2KNBB 2KYMA 2CT3A 3VS3A 2A28A 2DVJA 4A63B 3NHNA 5IXFA 1TG0A 1JXMA 2DBMA 1UGVA 4F14A 1E6GA 1QKXA 1NYFA 2OAWA 1U5SA 1WA7A 1VYTA 2LP5A 1K76A 2RQWA 4RTXA 2AZSA 1QWEA 2LJ3A 2KEAA 2ED1A 1LCKA 2DL3A 1WYXA 3ZL7C 2B86A 4QT7A 1QWFA 2M51A 2RPNA 4AG1C 2O9VA 2MCNA 1RLQC 2LNHB 1SSHA 3IQLA 3FJ5A 1W70A 3O5ZA 2C0OA 1I1JA 2DYBA 1I0CA 1OPKA 1T3SA 2J05A 2NUZA 2KGTA 2JS0A 4J9DA 1AZGB 4JJCA 2FPFA 1SRMA 3U23A 2FO0A 2EGCA 2LX7A 4RTVA 1Z9QA 3REBB 1NYGA 3VS2A 2MOXA 1AD5A 1OV3A 3EHRA 4GLMA 2DMOA 2L0AA 4LUDA 2A37A 2ESWA 3I35A 1VA7A 1GBQA 3H41A 3I5SA 1JQQA 3VS7A 1UTIA 2RQRA 4X1VA 1Y0MA 3PVQA 2VVKA 4LE9A 2KR3A 5IHIA 1X2KA 3UF4A 2EYZA 2YDLA 1E7OA 2GGRA 2K9GA 3M0SA 4RTUA 3THKA 5I11A 2EYXA 2F2XA 4LNPA 3VRZA 4JPBW 1PNJA 2D8JA 4JZ4A 3VS1A 2RF0A 1QCFA 2KE9A 2X3XD 1X6GA
chains in the Genus database with same CATH superfamily
2EGAA 1G3WA 2VGNA 4RCBA 1TWBA 2K2VA 1KD1U 5GMKj 3J81E 4JLGA 3HP9A 2FRWA 2LQKA 3QG1A 3JB9G 2JN0A 2B8AA 3OYHA 3RNJA 2BZXA 2MYSA 2YHTA 5GMKm 2LQWA 2V8IA 1C0MA 2DXCA 1VQOT 2JZ2A 3MP6A 4DOVA 3A8HB 2G6FX 2OTJT 2SEMA 3CPWP 2CT4A 1Y57A 4M77C 2D8HA 3HSBA 4CC7A 1PG5B 2J6OA 3QJYA 1QVFA 1X6BA 3A1PA 2LCLA 4QQGA 3OYGA 1Y07A 4C92G 1PRLC 1VIFA 3M0TA 2R57A 2WSFE 1AHJB 3X26B 3JCMV 1RI0A 3VS4A 3LH5A 1BI3A 4Z88A 5FWBA 3TVTA 1YHQA 1BYMA 1EIFA 2O01E 1WJRA 2LMJA 4OMFB 4RTZA 2YXYA 2D1XA 4FYXB 4F7UG 4IKFA 2L89A 1M3BA 1D0XA 3SD4A 3GPLA 2MWPA 3OY9A 2PVOB 1YNZA 2CUDA 4XK8E 3DB3A 1RAEB 3OYLA 3L1AA 1BU1A 4LXCA 4MMKA 1UJYA 3P8HA 1UG1A 1NE8A 4EMKB 4HVWA 4C92F 5KE2A 3CCMA 4C92D 3FLGA 1IGQA 1O9SA 2QTVA 5CKFA 1K1ZA 2DFUA 2RHYA 3I55A 2LNVA 1UB4A 4E7ZA 3MP8A 3S3NA 4BUGA 2DF6A 1B34A 2RD1A 2VYTA 3EFOB 2VWFA 2K5LA 4IUUA 2KK4A 3JCMg 3EG0A 3QXEB 2GFUA 3RMQA 2L3SA 2DIQA 1JU5C 2MF2A 1M90C 2FL7A 3VKIA 4C8QF 4IUVA 4C8QD 4EMHA 4DBHA 1YCSB 2KROA 5GAOn 1WFWA 1M1KR 5A2QE 3VUZA 3G6EA 4JJDA 3CC7A 4ELYC 3M55A 2J6FA 5CKEA 1PWTA 2DXBA 3M53A 3GP8A 1IHVA 3OS1A 2KXDA 4X34A 3SDZA 5GAOm 5DM7R 1TUDA 2DAQA 2YRVA 2XHCA 1MUZA 1PD1A 1I07A 5LJ3f 3ASKA 1OI1A 1NJIR 3H6ZA 4FYWB 4HKEA 1UGRB 4DBRA 2QQSA 4F17A 4XQ3A 1WHJA 1YN8A 4PJOB 1DJ7B 2R5MA 5FU6C 3TQ7P 1VQOQ 4N4IA 2IG0A 3BDLA 3JCMd 5KYWA 2OTJQ 1BIAA 3RKYA 2HQEA 1BIBA 4J9CA 3UDCA 2H3EB 1JJ2A 5KE3A 2GF7A 2E6ZA 1XOVA 2K3YA 2M02A 1X75C 4M7AB 3L2WA 1T0HA 1ZSZA 2DO3A 1GXIE 2DTIA 2ZCFB 2E5QA 3N5BB 5IH2A 5GMKl 4B9XA 3I56A 3OQ5A 5D6XA 3AT1B 2LCSA 3CCUT 2OX7A 4J9EA 4OGCA 3HRSA 1AEYA 1VQ6Q 2RJDA 2DIGA 1WHGA 2FYKA 1PKSA 5C0MA 4BE0A 2O2OA 3PFSA 1K4US 4J6XA 2QEXQ 5GAMj 1BCMA 4PFOA 4IUTA 1KD1R 3OYNA 2KAFA 1WDXA 1YHQT 2KRMA 3ZBDA 3BFMA 1IREB 1PC0A 4BY6B 3OYDA 1H3ZA 2DZ9A 4E6RA 1HJDA 4BI4A 3OYFA 2K3BA 5C6SA 2E4HA 2JM8A 5AT1B 5HKCA 2I0NA 2E5KA 2ROLA 1HD3A 4OMMA 4JRQA 1SG5A 1BB9A 5CAIA 2O4XA 1D1AA 1ZBJA 2SRCA 4CC2A 1NLPC 1M27C 4E7LA 4OF1A 2DETA 3H0IA 3TSWA 4FSXA 2CUBA 4C92B 3I55T 1MGQA 1Y7XA 3OW2P 1K73U 1OEBA 3CCLA 4XAXB 5KYNA 1C6VX 1G3SA 2GBQA 2E1HA 2L2PA 1AT1B 3FC3A 4AT1B 4E2FB 3QJ6A 3CEYA 1C1AA 1YI2T 5I2MA 1MV0B 4F7UB 2DTHA 1M1KC 1VOMA 2ZPIB 3I5RA 4BDYA 3OYCA 3DLLA 3WVDB 3ZEHA 1N8RU 2EQIA 2LCCA 3OYKA 4X9CA 2R58A 2X4XA 3HFNA 2EJGA 1OX8A 3CCRA 2YRDA 4OMQA 3G6ET 1K0XA 1QVGA 5GANg 1VYVA 3CC7T 3M4YA 4XTZA 1NJIC 2EVRA 2PUKB 1AWOA 3X24B 5CVIA 3CCEA 3VYGA 1K9MR 1VQNA 2XDBA 2CP5A 1N9SA 2XMFA 2PUOB 1VQPT 2DE0X 2K79A 1WI7A 3OBYA 1ZLMA 4J7FA 5LJ5j 4NL3A 3VYHB 3I9QA 2YUQA 3QWXX 3QBYA 5FU7C 1NM7A 2BUDA 1RADB 3CCQA 2KRSA 2RB6A 2XI9A 2EQUA 2YRCA 1VUBA 1WJQA 1WJSA 1OX9A 4JS5A 1WQ7A 3OMGA 2F5KA 1KQSP 2DBMA 3CCUQ 4KH0B 1QKXA 5GAN3 1WA7A 4HT9A 1QVFS 4CRIA 3JCMX 1LCKA 5KYUB 4C0DC 2DL3A 3M54A 2LVMA 5GAOp 2ZPEB 2B86A 4QT7A 3ZL7C 5D7UA 1KD1C 2M51A 5GAN2 2RA2A 4QVZA 1MMAA 3M58A 3JCMh 1SSHA 5FLXE 3FJ5A 3O8VA 1WHKA 4LDXA 3DLMA 3L42A 1I1JA 2OTLQ 2DYBA 1OYXA 4J9DA 2JS0A 1AZGB 3OSVA 1D3BB 1SRMA 4J7IA 1LPLA 3REBB 4B6MA 4DQ2A 1VQKA 1D0ZA 1NYGA 3NTKA 4B9WA 1AD5A 4C92E 1OV3A 1UGQB 2HNIA 2ESWA 1JQQA 1ACMB 1UTIA 1WZOA 4KBMB 1X01A 2DZCA 2HL5C 1WPYA 3DB4A 2VVKA 2KR3A 2LX9A 2QQBA 4JRKA 2ZPGB 5IHIA 3CCVQ 1Q81R 3CPFA 4RTUA 1YI2Q 2EYXA 1VQ4Q 3VRZA 4YTLA 2RF0A 4L6V5 2CP7A 2QAZA 4C8QE 4R55A 4C8QC 4HCBA 3RUXA 3OYMA 3CCLT 1I5OB 2ATCB 4EMKA 2GQIA 1MNEA 3A8GB 3ME9A 1AWWA 1QP3A 4VUBA 1G83A 2JXBA 2VC8A 3CC7Q 2HAXA 2CH4W 3G4SQ 1U1SA 2RK2A 2IVWA 3EFOA 4KGVB 5LJ3g 5GAMf 4R0KA 3PE0A 4LDWA 2RMOA 2WACA 4HCCA 4HCZA 1VQPQ 5A0LA 1K9MC 3X25B 3CCRT 4A4EA 2E3HA 2RQTA 2M9UA 2YUNA 4BACA 1YP5A 2BTTA 3CC4A 2DJQA 4N4GA 3CCET 2V26A 1IB8A 1Q95G 4IUQA 3REAB 1VQNT 3JCMc 2EYQA 2P4RA 1K73R 2QYZA 3FEOA 5EC7A 2RN8A 4MZTA 2AT1B 5GAN7 1M5Q1 2VB6A 2KXCA 4OMPA 3ULRB 4OVAA 4JLIA 4J6WA 1FMVA 2YWWA 5CKBA 1JJ2S 4O5VA 4LDUA 2M0OA 2WSCE 4FW2A 1U3OA 3CCQT 4ATOA 2KBTA 3E9FA 3LH0A 4DEYA 3EAEA 4HA8A 4AFSC 4PJOA 2F5TX 4OMNA 4DBFA 5I2SA 2ABLA 4PL6A 5LJ3d 1RLPC 4RTTA 3M0RA 1EFNA 3PMIA 1ARKA 4Y28E 4OP0A 1P92A 2CP0A 1VQLA 5LJ5h 1QKWA 3UA7A 3DKMA 1TH7A 3RKXA 3H0HA 3OYAA 4ZN1A 4E7IA 3HPWA 1M90R 5KYXB 4FW1A 2HSEB 2YLCA 1ZSZC 4Y91A 4Z8AA 2DRMA 1OOTA 1FYNA 2RI2A 5CIUA 4XU0A 2KQWA 1QMCA 4AFZC 1WX6A 3CCJQ 3CC2Q 3LGLA 3M0QA 3JAME 1YJNA 2QK0A 1VQKT 4M7DG 2XDPA 4J83A 4ZNXA 2Y90A 4PJOF 3CD6A 2PU9B 2BZYA 4PJOD 1Q81C 4O6JA 5GANh 1WQWA 3E19A 4R56A 3GBQA 4QQ6A 2BE9B 3HKSA 3MJXA 1PD0A 4ZGEB 1T0JA 1SPKA 4RG8A 4RG2A 1VQ9Q 4M78G 3QIIA 4M7AF 3M57A 5GJWB 4M7AD 1WHMA 2JOYA 3A98A 3CPWA 2CP2A 4QW2A 3RMSA 4J5YA 4M75G 3ZFJA 2KRNA 2CZ1B 1VYUA 1D0YA 2KYBA 3HFOA 1RUWA 4A4KA 4M7DF 3OS5A 4M7DD 2E12A 2EQKA 4C92A 1K8AU 2DL5A 3HL8A 5GJVB 2DK3A 2AKKA 1VQMA 2Y4YA 1AWXA 1QVGS 3J80E 3CCEQ 3VV0A 3M4GA 4AFUC 1VQNQ 4E7SA 4OMOA 3JB9F 3JCMb 3JB9D 3UT1A 3VRYA 2QTXA 3JV3A 4A4HA 2XICA 1S72A 1K73C 5KCHA 3FB9A 3E9GA 3MCAB 1K9AA 1AOJA 2C0TA 5GMKe 3H0FA 4M75F 4Y92A 2VKNA 2VV5A 4KULA 1CKAA 4C8QA 4M75D 3SHWA 4E7JA 3TREA 3RESA 2HKQB 3JB9H 2KI7A 2VXFA 4CI0C 1FXXA 1BCOA 1JBMA 3CMAQ 3NMZC 1SHFA 1VQ8T 3Q1JA 4Z89A 4DA4A 1Q7YU 4WCIA 3FRNA 2EFIA 1JXOA 3VS0A 2EYYA 4MMLA 1YJ9Q 2EPDA 2K2MA 1UJ0A 1CKBA 2PNIA 2JS2A 3P8BB 1Q86U 1FWZA 1H641 1PSEA 2F2VA 2L3QA 4F7UF 1MV3A 2A3LA 2LJ0A 2HD0A 1RACB 3M9QA 2DM1A 4J9IA 3PNWC 3JCMQ 1WGSA 1YITA 3RR6A 4A53A 1VQLT 1WXUA 5GMKi 3G7ZA 1R8OB 3EGXB 2DLPA 3OMCA 2E6NA 4II1A 4C0GA 3MEUA 2MIOA 4XU1A 2HSPA 3EG9B 1OZ2A 2DILA 3LYIA 1WNLA 4Z02A 2ZPBB 4GLKA 1BK2A 1YJNT 2QGGA 3PTAA 1IGUA 1YJWA 3CD6T 1HSQA 3GIBA 1O75A 4NS5A 1D3BA 1YWOA 3EH1A 1VQ5A 1M8VA 3EFSA 1X6OA 4KGZB 4ZTJA 1N5ZA 2KVQG 2C06A 4BE1A 1YIJA 2GTJA 2O31A 4FU6A 1FMKA 1NG2A 3CXCP 5IHKA 1PCXA 4BB7A 2CH4A 4OB3B 2FPEA 1NEGA 2P0KA 2ZAEA 4KUIA 1QP2A 4MZPA 2KYMA 2E64A 3VS3A 4M7DB 3V8JA 2A28A 3SFMA 5IXFA 1TG0A 4PLLA 1KC8U 1VQMT 1D1CA 1NYFA 2QQAA 4EMKC 2FB7A 4WTOB 4KGXB 4M78B 1S72T 1VQ8Q 3F70A 1TTHB 2M1HA 2DTOA 3EGDB 3OB9A 1RLQC 3IQLA 4M75B 3CBPA 4PJLA 1I0CA 1OPKA 1W4SA 3OW2A 1W2BP 3L2VA 3U23A 2MK5A 1M4ZA 4MDWA 2DXUA 3CCMT 3VS2A 2MOXA 3EHRA 2L0AA 4ZTFA 2A37A 2DKGA 1Q82U 1GBQA 3H41A 2CKKA 4ANJA 3I5SA 3VS7A 1OQKA 2RQRA 2NUPB 3PVQA 4OB0B 2D9TA 4M77G 1VQ7A 1UEBA 1X2KA 3CCSA 1ZBXA 4EMGA 3UF4A 2EYZA 1Y96A 1E7OA 2GGRA 2K9GA 5GAMe 5HK3A 3MO8A 4JPBW 1YITT 1PNJA 1YBYA 4JZ4A 2E70A 4GY5A 4E7KA 2KE9A 2X3XD 3JRZA 1M2VB 1WXTA 6AT1B 1I4K1 4PJOE 3P8DA 4PJOC 4ESRA 1EX4A 3CBMA 3CMEA 1ABQA 2M0YA 3BDUA 3S6WA 2KDSA 2JJ9A 2MWOA 3L2QA 1Q7YR 2BZ8A 1TU0B 1D09B 1ZA2B 2FG0A 4K11A 2Z0WA 2K4YA 3OSSC 2LQNA 5KYXA 4M7AE 2QDLA 4OGEA 4M7AC 1NPRA 1ZUKA 1Q86R 2A36A 4N4HA 1YJWT 3R6NA 4AG2C 4LDYA 2GFAA 1ZHIA 3CPWS 2FPDA 2QGFB 2L3PA 1GFDA 2AK5A 1A0NB 1KQSA 1VQ5T 1SSFA 4FIBA 2LRQA 2CZ7B 1M3CA 4J6YA 4PFPA 4M7DE 4HVUA 3OYJA 2EAYA 1SKUB 1Z9ZA 2DBKA 5GAN4 1YIJT 3RDVA 4LDVA 1G2BA 3V8KA 1I5LA 5GAOr 3LLRA 1SRLA 2X9HA 4JJBA 2LQ8A 4KT0E 2DXTA 3JCMJ 5GANj 4BY6C 3I56T 5CQXA 1ZUUA 4F04B 1LJOA 1YHQQ 3LGFA 4ZGJB 2E65A 2M16A 4M75E 4ME7A 4D6WA 4XTYA 1KFZA 2RHIA 1HK9A 3C0CA 2OAUA 1IHWA 5LJ5e 2XK0A 5KYYB 3SWNB 1JO8A 1RAAB 3META 1PKTA 2A7YA 1AZEA 5A0GA 2AIRB 2RM4A 5FW9A 1RAFB 1X27A 4C92C 2WSEE 1AWJA 1HYOA 2F2WA 4PJNA 3T9NA 1U06A 3JCMf 4JUVA 3CCMQ 2ZPFB 2XG8D 5A0DA 1H3HA 3I55Q 4WF2A 1UHFA 3MEAA 4X9DA 2F1LA 2PVGB 4F7UE 1QLYA 5KYWB 2VASA 2P84A 3QSUA 4GBQA 4NOYA 2JNGA 2HMAA 3QWYA 2HCKA 2F69A 1SEMA 2X4WA 2FHDA 1BI2A 2FEIA 2CGHA 2RO0A 1VQ7T 4KRTA 2EQMA 5IN1A 3CCST 3G6EQ 2J6KA 3GNGA 2VUBA 3PT9A 3KBGA 2EGEA 2GQVA 1GCPA 2LZ6B 5CCAA 3A5ZB 2RHXA 3A8OB 1UE9A 1M3AA 1Q7YC 2DX1A 1NEBA 5FRMA 3JB9I 1IO6A 2ENMA 2W0ZA 4HVVA 2NLUA 2PQWA 3CMET 4QVCA 3KFVA 2JVVA 2K5FA 1Q86C 3S3OA 3EGXA 1W1FA 2EQJA 1UHCA 5GAOq 1MNDA 2FZGB 1Q82R 3INZA 4RTYA 2CP6A 4EIKA 2QA4A 2COWA 3MP1A 1G3TA 2CREA 4M77B 8AT1B 1V29B 1TUCA 3EG9A 3M5AA 1VQ6A 2O4XB 2DL4A 2EYWA 4ZN3A 5HCKA 2QEXA 4XU2A 2PVDB 1N8RR 4FT4A 1QCNA 2CP3A 3M59A 3I56Q 4E7HA 1E6HA 1M1KU 5LJ3j 2NWMA 2O88A 2KT1A 1M1GA 4IIOA 2D0QB 1VIEA 1F1BB 2E10A 2OJ2A 2QQRA 3QKJA 1NJIU 2KY9A 4ELZC 4M7AA 2JTEA 2DA9A 3MEVA 2CS7A 3NTHA 7AT1B 3RBBB 2PTKA 3L2UA 1TOVA 1YWPA 5FWCA 4E47A 1IRXA 4QQDA 2X3WD 4FYYB 3MHXA 1TSFA 5IT9E 1WXBA 3E2UA 1QCOA 3C12A 3VU3C 4C5EA 4JJNK 2COYA 2JTMA 5LJ5f 1GBRA 4M7DA 4RTWA 3JB9J 5IXBA 2JMAA 5J39A 2EW3A 1ZSGA 4C0ZA 3QUIA 4L5GA 2ED0A 3OW2S 1LOJA 4JRPA 2RJEA 2KMTA 1GCQC 4XTWA 1G3YA 2HL3A 2A0FB 2PZ1A 4HXJA 3CCLQ 3JSCA 3PMTA 2KT8A 4M4ZA 3A8LB 3NFCA 4EPCA 3EGDA 3NPFA 3WXMB 2L5QA 4M75A 5M9OA 2DERA 4OB1B 4CC4B 5GANf 2D0NA 1B7TA 2P0PA 4RUGA 4LUEA 1ZA1B 1X43A 2RQVA 4FYVB 3SEMA 4L59A 1K0SA 1EZZB 1X69A 3MEWA 5HY6A 5AYFA 1LNXA 3VS5A 4LN2A 3URGA 2ROTA 3OS2A 3PIPA 3CCRQ 4BE2A 4JZ3A 3PGGA 4AMCA 4PLIA 3VJPA 3CMEQ 3J7AF 3CBOA 1CSKA 2MPXC 4IURA 1N6AA 1RABB 1V1CA 2NUPA 4OMLA 4JS4A 1H8KA 2W10A 1B07A 1N27A 2CSIA 5FU6B 4M77E 4M78F 3QDRB 1Y71A 4M78D 4F7UA 2BKDN 3QZ9B 3EG1A 1Q82C 5GAN8 3CCUA 2VGMA 4C5IA 3CQTA 2KNBB 3CC4T 2HZYA 3TEEA 4FM4B 4A54A 2CT3A 1V76A 2DVJA 4A63B 4N0AC 1M2VA 2EIFA 3CCQQ 1JXMA 3EFRA 3QHSA 5FRNA 2BIVA 1QVFP 1UGVA 2OAWA 4BD3A 1U5SA 1KQSS 1VYTA 3WVEB 2QA4T 4OB2B 1RL2A 3JCMW 1K76A 2RQWA 4RTXA 2AZSA 4C0FA 1N8RC 2KEAA 2ED1A 1VQ6T 1WYXA 1XTDA 3SB2A 2OTLA 2ZPHB 1QWFA 1HXDA 2RPNA 2QEXT 2QASA 3BE3A 3FJPA 5KCOA 4AG1C 4C8QG 4LD9K 3V7RA 4XTXA 5CKDA 2H3JA 5CO7A 1NBEB 3LW5E 2C0OA 4FCYA 1T3SA 4RCCA 1NPPA 5L8RE 4JJCA 2FPFA 1K9MU 2RJFA 1PM3A 2LX7A 4PNOA 1FX7A 3OS0A 2NUTB 1M9SA 4GLMA 4LUDA 3CCVA 3I35A 1TS9A 1YI2A 1VQ4A 4X1VA 1VQKQ 3RERA 4DBQA 4J8OA 5KYUA 3MKDA 4IUPA 3M0SA 5I11A 1LVKA 5LJ3h 3BY7A 3H8ZA 2D8JA 1TUGB 2CZ0B 2JTFA 5LL6S 3GLXA 3G71A 4MDXA 3C95A 1XNIA 2CZ6B 3G4SA 5KYYA 2MAMA 3M56A 3SWNA 5GAN6 3QZ5B 2LTOA 1B3QA 2P4TA 5L23A 1M8MA 2XU8A 2L3RA 1BI0A 2V1QA 3UATA 4FSSA 1VQPA 1ZUYA 5CK9A 2MMPA 1KHCA 4ORZA 3V8LA 4C5HA 3CXCA 3KXTA 2JM9A 2VXEA 2KSSA 2ZZDA 3E1SA 5GAMg 3LWIA 1WHHA 1I81A 3GF5A 4PKCC 1WHLA 4FL6A 2JUFA 1D1BA 2E41A 2CSQA 4JRIA 3QDFA 3QO3A 5FROA 1UECA 5CR2A 5IAYA 2LC4A 3GOXA 1G8XA 5CQYA 3CC4Q 1GCQA 3V7SA 3HTRA 1JJ2P 3FDRA 1M2OA 4LD6A 5FU7B 3M0UA 5I21A 1PSFA 2K57A 4V2SA 5ECAA 1Q81U 2LT1A 1R0CB 2QA4Q 2K3XA 2FRYA 2CDTA 1R0BG 3JCMe 2JW4A 1NZ9A 1UGSB 3PIOA 3D7SB 1BI1A 5GMKh 1T3LA 1W2BA 1UUEA 3TU4K 5GAMd 1MMGA 2NYSA 3UPUA 4D8DA 4C0DB 1K8AR 1GRIA 1U1TA 2XKOC 2K7AA 3X20B 1ZX6A 1PRMC 2X4YA 1RI9A 2OTLT 4F16A 1OPLA 3UA6A 2QQ9A 4M77A 3CCJA 1VQLQ 2YUOA 1BBZA 3CC2A 2O9SA 5DY9A 2ECZA 1OZ3A 1WLPB 4J9BA 1OULA 1WIEA 1W6XA 2RHUA 2DL8A 4D8KA 2K6DA 4TVRA 2YT6A 4N0AA 5LJ5g 3EHQA 5EG2A 4QKUA 2GNCA 3KUFA 3LWHA 1VQ9A 1YCYA 3CCVT 2YSQA 1M30A 1S1NA 2DD5A 3LX7A 2XD0A 1VQ4T 1YJNQ 1ABOA 4PK4A 4PJJA 1GL5A 3RKWA 2COZA 3QYHB 3CD6Q 4UC4A 1PHTA 4CC3A 4KH1B 2FVUA 2G3RA 3OYEA 2JMCA 2A08A 4A4GA 5D6YA 1KIKA 4C8QB 4M77F 2AZVA 1IZ6A 4M77D 2XIDA 3X28B 2IPOB 3G71T 3V7CA 4DEXA 4EDUA 1X2QA 2XDDA 1KK7A 4PJMA 5HK0A 3G4ST 4BI8B 3EG3A 3VS6A 3H9NA 1XJWB 1QVGP 2EKHA 3HRUA 1GFCA 4XTUA 4M7DC 2RJCA 1KQ2A 2LT4A 5LJ5d 1OU8A 2V8KA 2RNAA 2FZKB 1M90U 4RKUE 5GAOl 1J3TA 4MZMA 1ZQ1A 1B34B 2EJ9A 3NGPA 1QW1A 3FIFA 5DLOA 2V8JA 1VQMQ 2DJZA 1AVZC 3M0PA 2LJ1A 2QDYB 1H92A 4M78E 4M78C 1QQJA 2YUPA 1KJWA 2J7IA 3OBWA 3CMAA 3TSZA 1SHGA 4XU3A 3QPHA 2X51A 2HEQA 2L8DA 2HBWA 5IHNA 3VUBA 1S72Q 2DD4A 4DOWA 4M75C 3AHUA 3OYYA 3S3MA 1YJ9A 2E3IA 4PFZA 5GANd 4IIMA 3RIRA 5CKHA 1N9RA 3GNFB 5J26A 1JRIA 1MMDA 2HDAA 4HCKA 1UGPB 1MMNA 3TCJA 3EGUA 2QG9B 3HRTA 2X4JA 2C0IA 3EG2A 2HQHA 1K8AC 4HT8A 1BKBA 2QI2A 4J9FA 3JCMP 1KSWA 5D6WA 3A8MB 4BDZA 2EJFA 2RH2A 2DYIA 2EWNA 4KUDK 5GANe 2FZCB 2GCXA 2DPPB 2DNUA 3OA6A 1KC8R 2K5IA 4J9HA 1MHNA 3C94A 3MPUB 4Q5WA 2EBPA 4JDSA 1RAGB 1FMWA 1YITQ 3BW1A 1ZSZB 3CCJT 3CC2T 3R6OA 1OU9A 2HBPA 8ATCB 2DEUA 4ZGDB 2RK1A 2DRKA 2Y4XA 1IXDA 2GTOA 3EH2A 1VQOA 2I2LA 3PVLA 2J06A 1YFNA 5GAMh 5J3BA 2OI3A 2OTJA 3QYGB 4J9GA 1VQ9T 1JEGA 2IIMA 3G71Q 1YJWQ 2NUTA 1U8RA 1NLOC 2JT4A 4C5GA 4AFQC 1VQ5Q 1UFFA 5I22A 3HHTB 1R77A 2AKLA 2H8HA 4XTVA 1UDLA 2RQUA 2V1RA 3CXCS 2DL7A 1YIJQ 2ZGWA 1RAIB 3NHNA 2EKOA 3L2RA 4F14A 1E6GA 2DEQA 2LP5A 1VQ8A 3C4SA 2LDMA 1QWEA 3SWNC 2LJ3A 1XQHA 5KH6A 3NTIA 4BI3A 2RI5A 1Y96B 1KQ1A 3CMAT 2YLBA 2AHJB 2O9VA 1G5VA 2MCNA 2LNHB 3G1JA 4PJOG 1SF9A 1RAHB 1W70A 9ATCB 2HQXA 3O5ZA 4QVDA 2P0QA 2J05A 2NUZA 1YJ9T 2KGTA 4A4FA 2FO0A 2EGCA 4RTVA 1Z9QA 2HKNA 1W2BS 2D6FA 1JB0E 1KHIA 2MI6A 2QXFA 2DMOA 2RHZA 5DLQE 1VA7A 4M7AG 2BE7D 4P5NA 4FT2A 2CYZB 1KG1A 1QVPA 1I8FA 1TXQA 1Y0MA 4RMOA 3OYBA 5GAN5 4LE9A 2R5AA 3UWNA 3L2ZA 4M78A 5LJ3e 4NL2A 1KC8C 2X35A 2YDLA 3THKA 2F2XA 4LNPA 3OYIA 3ER0A 3VS1A 1VQ7Q 2RI3A 1QCFA 3CCSQ 1M1FA 2DVEA 1X6GA
chains in the Genus database with same CATH topology
1WXTA 2EGAA 4ESRA 2GQIA 1ABQA 2M0YA 5L23A 1B3QA 1M8MA 1AWWA 2FRWA 2V1QA 1G83A 3UATA 2JXBA 4FSSA 1ZUYA 3RNJA 2BZXA 2BZ8A 2CH4W 2FG0A 2LQWA 4K11A 4ORZA 2LQNA 4R0KA 3PE0A 2JM9A 2QDLA 1ZUKA 2RMOA 2A36A 2G6FX 2SEMA 2CT4A 3R6NA 1Y57A 2RQTA 4AG2C 2D8HA 2YUNA 1YP5A 2BTTA 4CC7A 2FPDA 2J6OA 2L3PA 2DJQA 1GFDA 2AK5A 1A0NB 1X6BA 3REAB 2CSQA 1M3CA 1UECA 1PRLC 2P4RA 4HVUA 3M0TA 5EC7A 1Z9ZA 2RN8A 1GCQA 2DBKA 3VS4A 3LH5A 2KXCA 1G2BA 4OMPA 4Z88A 3ULRB 5FWBA 3M0UA 3TVTA 2LMJA 4RTZA 1SRLA 4JJBA 5ECAA 2D1XA 1U3OA 2KBTA 2FRYA 2CDTA 1M3BA 4DEYA 1ZUUA 2JW4A 4AFSC 1YNZA 2CUDA 4OMNA 1T3LA 2ABLA 1UUEA 1RLPC 4RTTA 3M0RA 1BU1A 1KFZA 3C0CA 1EFNA 1UJYA 1ARKA 1UG1A 4HVWA 1JO8A 1PKTA 1K1ZA 4D8DA 1GRIA 1QKWA 3UA7A 1AZEA 3H0HA 2K7AA 5FW9A 1ZX6A 1X27A 1PRMC 1AWJA 2F2WA 2DF6A 1RI9A 1U06A 4F16A 1OPLA 3UA6A 2VWFA 2YUOA 1BBZA 1H3HA 2O9SA 2ECZA 3EG0A 1UHFA 2L3SA 1WLPB 4Z8AA 2DRMA 4J9BA 1JU5C 1OOTA 1WIEA 1FYNA 1W6XA 1QLYA 4AFZC 1WX6A 2DL8A 4D8KA 2K6DA 2YT6A 3M0QA 3EHQA 4GBQA 4ZNXA 2BZYA 1YCSB 2KROA 2GNCA 1WFWA 3QWYA 2HCKA 4JJDA 2YSQA 1M30A 1SEMA 1S1NA 3GBQA 2J6FA 1PWTA 2FEIA 1ABOA 1GL5A 2KXDA 1T0JA 1PHTA 1SPKA 4CC3A 4KRTA 1TUDA 1MUZA 2J6KA 5GJWB 1I07A 2JMCA 2A08A 1KIKA 2EGEA 3A98A 1GCPA 2LZ6B 1UE9A 2AZVA 1M3AA 4F17A 2DX1A 1NEBA 1YN8A 2KRNA 1IO6A 4DEXA 1X2QA 1VYUA 2ENMA 2W0ZA 4HVVA 2KYBA 1RUWA 3EG3A 3VS6A 3KFVA 2DL5A 5GJVB 2EKHA 4J9CA 1GFCA 1W1FA 2AKKA 1AWXA 1UHCA 1XOVA 4RTYA 1T0HA 2RNAA 4EIKA 4AFUC 1J3TA 3NGPA 4OMOA 2CREA 3VRYA 1TUCA 5IH2A 1AVZC 3M0PA 2LJ1A 3JV3A 2DL4A 1H92A 2EYWA 2YUPA 5HCKA 2LCSA 1K9AA 1KJWA 1AOJA 2C0TA 4J9EA 2J7IA 3H0FA 4Y92A 2VKNA 3TSZA 1CKAA 1SHGA 3SHWA 1AEYA 2HEQA 1E6HA 2HBWA 5IHNA 1PKSA 2NWMA 2O88A 2O2OA 2KT1A 1K4US 4IIOA 3NMZC 1SHFA 1WDXA 2KRMA 4IIMA 4Z89A 2OJ2A 4WCIA 1JXOA 2HDAA 4HCKA 2EYYA 3VS0A 2JTEA 2EPDA 2DA9A 2K2MA 1UJ0A 4E6RA 3EGUA 1HJDA 1CKBA 2PNIA 2JS2A 2K3BA 2C0IA 3EG2A 3RBBB 2PTKA 2JM8A 1YWPA 2I0NA 2E5KA 2F2VA 2ROLA 1HD3A 4OMMA 5FWCA 2L3QA 1MV3A 1BB9A 2X3WD 2LJ0A 4J9FA 1ZBJA 1WXBA 2SRCA 4CC2A 1NLPC 2DM1A 1M27C 1KSWA 4J9IA 3H0IA 3TSWA 1GBRA 4RTWA 5IXBA 2JMAA 1WXUA 2CUBA 2EW3A 1ZSGA 2DNUA 1OEBA 2DLPA 4J9HA 2ED0A 2GBQA 2EBPA 2L2PA 1GCQC 2MIOA 2HSPA 2PZ1A 4HXJA 1MV0B 2DRKA 2DILA 3I5RA 2KT8A 2GTOA 4M4ZA 3NPFA 3PVLA 2EQIA 2J06A 1BK2A 2OI3A 4CC4B 2D0NA 4J9GA 1HSQA 4RUGA 4LUEA 4OMQA 1JEGA 1K0XA 1X43A 1VYVA 2RQVA 2IIMA 2EVRA 3SEMA 1AWOA 1YWOA 1K0SA 1X69A 3VS5A 4LN2A 2ROTA 2XMFA 4JZ3A 1N5ZA 1NLOC 2DE0X 2K79A 1WI7A 1CSKA 1ZLMA 2JT4A 2GTJA 4AFQC 2O31A 1UFFA 4OMLA 1V1CA 3I9QA 5I22A 1H8KA 2W10A 1FMKA 1B07A 1NG2A 2YUQA 2AKLA 2CSIA 2H8HA 3QWXX 5IHKA 1NM7A 1UDLA 2RQUA 2V1RA 2CH4A 2DL7A 2KRSA 3EG1A 2FPEA 3CQTA 1NEGA 2KNBB 2KYMA 2CT3A 3VS3A 2A28A 2DVJA 4A63B 3NHNA 5IXFA 1TG0A 1JXMA 2DBMA 1UGVA 4F14A 1E6GA 1QKXA 1NYFA 2OAWA 1U5SA 1WA7A 1VYTA 2LP5A 1K76A 2RQWA 4RTXA 2AZSA 1QWEA 2LJ3A 2KEAA 2ED1A 1LCKA 2DL3A 1WYXA 3ZL7C 2B86A 4QT7A 1QWFA 2M51A 2RPNA 4AG1C 2O9VA 2MCNA 1RLQC 2LNHB 1SSHA 3IQLA 3FJ5A 1W70A 3O5ZA 2C0OA 1I1JA 2DYBA 1I0CA 1OPKA 1T3SA 2J05A 2NUZA 2KGTA 2JS0A 4J9DA 1AZGB 4JJCA 2FPFA 1SRMA 3U23A 2FO0A 2EGCA 2LX7A 4RTVA 1Z9QA 3REBB 1NYGA 3VS2A 2MOXA 1AD5A 1OV3A 3EHRA 4GLMA 2DMOA 2L0AA 4LUDA 2A37A 2ESWA 3I35A 1VA7A 1GBQA 3H41A 3I5SA 1JQQA 3VS7A 1UTIA 2RQRA 4X1VA 1Y0MA 3PVQA 2VVKA 4LE9A 2KR3A 5IHIA 1X2KA 3UF4A 2EYZA 2YDLA 1E7OA 2GGRA 2K9GA 3M0SA 4RTUA 3THKA 5I11A 2EYXA 2F2XA 4LNPA 3VRZA 4JPBW 1PNJA 2D8JA 4JZ4A 3VS1A 2RF0A 1QCFA 2KE9A 2X3XD 1X6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WXT A;  2EGA A;  4ESR A;  2GQI A;  1ABQ A;  2M0Y A;  5L23 A;  1B3Q A;  1M8M A;  1AWW A;  2FRW A;  2V1Q A;  1G83 A;  3UAT A;  2JXB A;  4FSS A;  1ZUY A;  3RNJ A;  2BZX A;  2BZ8 A;  2CH4 W;  2FG0 A;  2LQW A;  4K11 A;  4ORZ A;  2LQN A;  4R0K A;  3PE0 A;  2JM9 A;  2QDL A;  1ZUK A;  2RMO A;  2A36 A;  2G6F X;  2SEM A;  2CT4 A;  3R6N A;  1Y57 A;  2RQT A;  4AG2 C;  2D8H A;  2YUN A;  1YP5 A;  2BTT A;  4CC7 A;  2FPD A;  2J6O A;  2L3P A;  2DJQ A;  1GFD A;  2AK5 A;  1A0N B;  1X6B A;  3REA B;  2CSQ A;  1M3C A;  1UEC A;  1PRL C;  2P4R A;  4HVU A;  3M0T A;  5EC7 A;  1Z9Z A;  2RN8 A;  1GCQ A;  2DBK A;  3VS4 A;  3LH5 A;  2KXC A;  1G2B A;  4OMP A;  4Z88 A;  3ULR B;  5FWB A;  3M0U A;  3TVT A;  2LMJ A;  4RTZ A;  1SRL A;  4JJB A;  5ECA A;  2D1X A;  1U3O A;  2KBT A;  2FRY A;  2CDT A;  1M3B A;  4DEY A;  1ZUU A;  2JW4 A;  4AFS C;  1YNZ A;  2CUD A;  4OMN A;  1T3L A;  2ABL A;  1UUE A;  1RLP C;  4RTT A;  3M0R A;  1BU1 A;  1KFZ A;  3C0C A;  1EFN A;  1UJY A;  1ARK A;  1UG1 A;  4HVW A;  1JO8 A;  1PKT A;  1K1Z A;  4D8D A;  1GRI A;  1QKW A;  3UA7 A;  1AZE A;  3H0H A;  2K7A A;  5FW9 A;  1ZX6 A;  1X27 A;  1PRM C;  1AWJ A;  2F2W A;  2DF6 A;  1RI9 A;  1U06 A;  4F16 A;  1OPL A;  3UA6 A;  2VWF A;  2YUO A;  1BBZ A;  1H3H A;  2O9S A;  2ECZ A;  3EG0 A;  1UHF A;  2L3S A;  1WLP B;  4Z8A A;  2DRM A;  4J9B A;  1JU5 C;  1OOT A;  1WIE A;  1FYN A;  1W6X A;  1QLY A;  4AFZ C;  1WX6 A;  2DL8 A;  4D8K A;  2K6D A;  2YT6 A;  3M0Q A;  3EHQ A;  4GBQ A;  4ZNX A;  2BZY A;  1YCS B;  2KRO A;  2GNC A;  1WFW A;  3QWY A;  2HCK A;  4JJD A;  2YSQ A;  1M30 A;  1SEM A;  1S1N A;  3GBQ A;  2J6F A;  1PWT A;  2FEI A;  1ABO A;  1GL5 A;  2KXD A;  1T0J A;  1PHT A;  1SPK A;  4CC3 A;  4KRT A;  1TUD A;  1MUZ A;  2J6K A;  5GJW B;  1I07 A;  2JMC A;  2A08 A;  1KIK A;  2EGE A;  3A98 A;  1GCP A;  2LZ6 B;  1UE9 A;  2AZV A;  1M3A A;  4F17 A;  2DX1 A;  1NEB A;  1YN8 A;  2KRN A;  1IO6 A;  4DEX A;  1X2Q A;  1VYU A;  2ENM A;  2W0Z A;  4HVV A;  2KYB A;  1RUW A;  3EG3 A;  3VS6 A;  3KFV A;  2DL5 A;  5GJV B;  2EKH A;  4J9C A;  1GFC A;  1W1F A;  2AKK A;  1AWX A;  1UHC A;  1XOV A;  4RTY A;  1T0H A;  2RNA A;  4EIK A;  4AFU C;  1J3T A;  3NGP A;  4OMO A;  2CRE A;  3VRY A;  1TUC A;  5IH2 A;  1AVZ C;  3M0P A;  2LJ1 A;  3JV3 A;  2DL4 A;  1H92 A;  2EYW A;  2YUP A;  5HCK A;  2LCS A;  1K9A A;  1KJW A;  1AOJ A;  2C0T A;  4J9E A;  2J7I A;  3H0F A;  4Y92 A;  2VKN A;  3TSZ A;  1CKA A;  1SHG A;  3SHW A;  1AEY A;  2HEQ A;  1E6H A;  2HBW A;  5IHN A;  1PKS A;  2NWM A;  2O88 A;  2O2O A;  2KT1 A;  1K4U S;  4IIO A;  3NMZ C;  1SHF A;  1WDX A;  2KRM A;  4IIM A;  4Z89 A;  2OJ2 A;  4WCI A;  1JXO A;  2HDA A;  4HCK A;  2EYY A;  3VS0 A;  2JTE A;  2EPD A;  2DA9 A;  2K2M A;  1UJ0 A;  4E6R A;  3EGU A;  1HJD A;  1CKB A;  2PNI A;  2JS2 A;  2K3B A;  2C0I A;  3EG2 A;  3RBB B;  2PTK A;  2JM8 A;  1YWP A;  2I0N A;  2E5K A;  2F2V A;  2ROL A;  1HD3 A;  4OMM A;  5FWC A;  2L3Q A;  1MV3 A;  1BB9 A;  2X3W D;  2LJ0 A;  4J9F A;  1ZBJ A;  1WXB A;  2SRC A;  4CC2 A;  1NLP C;  2DM1 A;  1M27 C;  1KSW A;  4J9I A;  3H0I A;  3TSW A;  1GBR A;  4RTW A;  5IXB A;  2JMA A;  1WXU A;  2CUB A;  2EW3 A;  1ZSG A;  2DNU A;  1OEB A;  2DLP A;  4J9H A;  2ED0 A;  2GBQ A;  2EBP A;  2L2P A;  1GCQ C;  2MIO A;  2HSP A;  2PZ1 A;  4HXJ A;  1MV0 B;  2DRK A;  2DIL A;  3I5R A;  2KT8 A;  2GTO A;  4M4Z A;  3NPF A;  3PVL A;  2EQI A;  2J06 A;  1BK2 A;  2OI3 A;  4CC4 B;  2D0N A;  4J9G A;  1HSQ A;  4RUG A;  4LUE A;  4OMQ A;  1JEG A;  1K0X A;  1X43 A;  1VYV A;  2RQV A;  2IIM A;  2EVR A;  3SEM A;  1AWO A;  1YWO A;  1K0S A;  1X69 A;  3VS5 A;  4LN2 A;  2ROT A;  2XMF A;  4JZ3 A;  1N5Z A;  1NLO C;  2DE0 X;  2K79 A;  1WI7 A;  1CSK A;  1ZLM A;  2JT4 A;  2GTJ A;  4AFQ C;  2O31 A;  1UFF A;  4OML A;  1V1C A;  3I9Q A;  5I22 A;  1H8K A;  2W10 A;  1FMK A;  1B07 A;  1NG2 A;  2YUQ A;  2AKL A;  2CSI A;  2H8H A;  3QWX X;  5IHK A;  1NM7 A;  1UDL A;  2RQU A;  2V1R A;  2CH4 A;  2DL7 A;  2KRS A;  3EG1 A;  2FPE A;  3CQT A;  1NEG A;  2KNB B;  2KYM A;  2CT3 A;  3VS3 A;  2A28 A;  2DVJ A;  4A63 B;  3NHN A;  5IXF A;  1TG0 A;  1JXM A;  2DBM A;  1UGV A;  4F14 A;  1E6G A;  1QKX A;  1NYF A;  2OAW A;  1U5S A;  1WA7 A;  1VYT A;  2LP5 A;  1K76 A;  2RQW A;  4RTX A;  2AZS A;  1QWE A;  2LJ3 A;  2KEA A;  2ED1 A;  1LCK A;  2DL3 A;  1WYX A;  3ZL7 C;  2B86 A;  4QT7 A;  1QWF A;  2M51 A;  2RPN A;  4AG1 C;  2O9V A;  2MCN A;  1RLQ C;  2LNH B;  1SSH A;  3IQL A;  3FJ5 A;  1W70 A;  3O5Z A;  2C0O A;  1I1J A;  2DYB A;  1I0C A;  1OPK A;  1T3S A;  2J05 A;  2NUZ A;  2KGT A;  2JS0 A;  4J9D A;  1AZG B;  4JJC A;  2FPF A;  1SRM A;  3U23 A;  2FO0 A;  2EGC A;  2LX7 A;  4RTV A;  1Z9Q A;  3REB B;  1NYG A;  3VS2 A;  2MOX A;  1AD5 A;  1OV3 A;  3EHR A;  4GLM A;  2DMO A;  2L0A A;  4LUD A;  2A37 A;  2ESW A;  3I35 A;  1VA7 A;  1GBQ A;  3H41 A;  3I5S A;  1JQQ A;  3VS7 A;  1UTI A;  2RQR A;  4X1V A;  1Y0M A;  3PVQ A;  2VVK A;  4LE9 A;  2KR3 A;  5IHI A;  1X2K A;  3UF4 A;  2EYZ A;  2YDL A;  1E7O A;  2GGR A;  2K9G A;  3M0S A;  4RTU A;  3THK A;  5I11 A;  2EYX A;  2F2X A;  4LNP A;  3VRZ A;  4JPB W;  1PNJ A;  2D8J A;  4JZ4 A;  3VS1 A;  2RF0 A;  1QCF A;  2KE9 A;  2X3X D;  1X6G A; 
#chains in the Genus database with same CATH topology
 2EGA A;  1G3W A;  2VGN A;  4RCB A;  1TWB A;  2K2V A;  1KD1 U;  5GMK j;  3J81 E;  4JLG A;  3HP9 A;  2FRW A;  2LQK A;  3QG1 A;  3JB9 G;  2JN0 A;  2B8A A;  3OYH A;  3RNJ A;  2BZX A;  2MYS A;  2YHT A;  5GMK m;  2LQW A;  2V8I A;  1C0M A;  2DXC A;  1VQO T;  2JZ2 A;  3MP6 A;  4DOV A;  3A8H B;  2G6F X;  2OTJ T;  2SEM A;  3CPW P;  2CT4 A;  1Y57 A;  4M77 C;  2D8H A;  3HSB A;  4CC7 A;  1PG5 B;  2J6O A;  3QJY A;  1QVF A;  1X6B A;  3A1P A;  2LCL A;  4QQG A;  3OYG A;  1Y07 A;  4C92 G;  1PRL C;  1VIF A;  3M0T A;  2R57 A;  2WSF E;  1AHJ B;  3X26 B;  3JCM V;  1RI0 A;  3VS4 A;  3LH5 A;  1BI3 A;  4Z88 A;  5FWB A;  3TVT A;  1YHQ A;  1BYM A;  1EIF A;  2O01 E;  1WJR A;  2LMJ A;  4OMF B;  4RTZ A;  2YXY A;  2D1X A;  4FYX B;  4F7U G;  4IKF A;  2L89 A;  1M3B A;  1D0X A;  3SD4 A;  3GPL A;  2MWP A;  3OY9 A;  2PVO B;  1YNZ A;  2CUD A;  4XK8 E;  3DB3 A;  1RAE B;  3OYL A;  3L1A A;  1BU1 A;  4LXC A;  4MMK A;  1UJY A;  3P8H A;  1UG1 A;  1NE8 A;  4EMK B;  4HVW A;  4C92 F;  5KE2 A;  3CCM A;  4C92 D;  3FLG A;  1IGQ A;  1O9S A;  2QTV A;  5CKF A;  1K1Z A;  2DFU A;  2RHY A;  3I55 A;  2LNV A;  1UB4 A;  4E7Z A;  3MP8 A;  3S3N A;  4BUG A;  2DF6 A;  1B34 A;  2RD1 A;  2VYT A;  3EFO B;  2VWF A;  2K5L A;  4IUU A;  2KK4 A;  3JCM g;  3EG0 A;  3QXE B;  2GFU A;  3RMQ A;  2L3S A;  2DIQ A;  1JU5 C;  2MF2 A;  1M90 C;  2FL7 A;  3VKI A;  4C8Q F;  4IUV A;  4C8Q D;  4EMH A;  4DBH A;  1YCS B;  2KRO A;  5GAO n;  1WFW A;  1M1K R;  5A2Q E;  3VUZ A;  3G6E A;  4JJD A;  3CC7 A;  4ELY C;  3M55 A;  2J6F A;  5CKE A;  1PWT A;  2DXB A;  3M53 A;  3GP8 A;  1IHV A;  3OS1 A;  2KXD A;  4X34 A;  3SDZ A;  5GAO m;  5DM7 R;  1TUD A;  2DAQ A;  2YRV A;  2XHC A;  1MUZ A;  1PD1 A;  1I07 A;  5LJ3 f;  3ASK A;  1OI1 A;  1NJI R;  3H6Z A;  4FYW B;  4HKE A;  1UGR B;  4DBR A;  2QQS A;  4F17 A;  4XQ3 A;  1WHJ A;  1YN8 A;  4PJO B;  1DJ7 B;  2R5M A;  5FU6 C;  3TQ7 P;  1VQO Q;  4N4I A;  2IG0 A;  3BDL A;  3JCM d;  5KYW A;  2OTJ Q;  1BIA A;  3RKY A;  2HQE A;  1BIB A;  4J9C A;  3UDC A;  2H3E B;  1JJ2 A;  5KE3 A;  2GF7 A;  2E6Z A;  1XOV A;  2K3Y A;  2M02 A;  1X75 C;  4M7A B;  3L2W A;  1T0H A;  1ZSZ A;  2DO3 A;  1GXI E;  2DTI A;  2ZCF B;  2E5Q A;  3N5B B;  5IH2 A;  5GMK l;  4B9X A;  3I56 A;  3OQ5 A;  5D6X A;  3AT1 B;  2LCS A;  3CCU T;  2OX7 A;  4J9E A;  4OGC A;  3HRS A;  1AEY A;  1VQ6 Q;  2RJD A;  2DIG A;  1WHG A;  2FYK A;  1PKS A;  5C0M A;  4BE0 A;  2O2O A;  3PFS A;  1K4U S;  4J6X A;  2QEX Q;  5GAM j;  1BCM A;  4PFO A;  4IUT A;  1KD1 R;  3OYN A;  2KAF A;  1WDX A;  1YHQ T;  2KRM A;  3ZBD A;  3BFM A;  1IRE B;  1PC0 A;  4BY6 B;  3OYD A;  1H3Z A;  2DZ9 A;  4E6R A;  1HJD A;  4BI4 A;  3OYF A;  2K3B A;  5C6S A;  2E4H A;  2JM8 A;  5AT1 B;  5HKC A;  2I0N A;  2E5K A;  2ROL A;  1HD3 A;  4OMM A;  4JRQ A;  1SG5 A;  1BB9 A;  5CAI A;  2O4X A;  1D1A A;  1ZBJ A;  2SRC A;  4CC2 A;  1NLP C;  1M27 C;  4E7L A;  4OF1 A;  2DET A;  3H0I A;  3TSW A;  4FSX A;  2CUB A;  4C92 B;  3I55 T;  1MGQ A;  1Y7X A;  3OW2 P;  1K73 U;  1OEB A;  3CCL A;  4XAX B;  5KYN A;  1C6V X;  1G3S A;  2GBQ A;  2E1H A;  2L2P A;  1AT1 B;  3FC3 A;  4AT1 B;  4E2F B;  3QJ6 A;  3CEY A;  1C1A A;  1YI2 T;  5I2M A;  1MV0 B;  4F7U B;  2DTH A;  1M1K C;  1VOM A;  2ZPI B;  3I5R A;  4BDY A;  3OYC A;  3DLL A;  3WVD B;  3ZEH A;  1N8R U;  2EQI A;  2LCC A;  3OYK A;  4X9C A;  2R58 A;  2X4X A;  3HFN A;  2EJG A;  1OX8 A;  3CCR A;  2YRD A;  4OMQ A;  3G6E T;  1K0X A;  1QVG A;  5GAN g;  1VYV A;  3CC7 T;  3M4Y A;  4XTZ A;  1NJI C;  2EVR A;  2PUK B;  1AWO A;  3X24 B;  5CVI A;  3CCE A;  3VYG A;  1K9M R;  1VQN A;  2XDB A;  2CP5 A;  1N9S A;  2XMF A;  2PUO B;  1VQP T;  2DE0 X;  2K79 A;  1WI7 A;  3OBY A;  1ZLM A;  4J7F A;  5LJ5 j;  4NL3 A;  3VYH B;  3I9Q A;  2YUQ A;  3QWX X;  3QBY A;  5FU7 C;  1NM7 A;  2BUD A;  1RAD B;  3CCQ A;  2KRS A;  2RB6 A;  2XI9 A;  2EQU A;  2YRC A;  1VUB A;  1WJQ A;  1WJS A;  1OX9 A;  4JS5 A;  1WQ7 A;  3OMG A;  2F5K A;  1KQS P;  2DBM A;  3CCU Q;  4KH0 B;  1QKX A;  5GAN 3;  1WA7 A;  4HT9 A;  1QVF S;  4CRI A;  3JCM X;  1LCK A;  5KYU B;  4C0D C;  2DL3 A;  3M54 A;  2LVM A;  5GAO p;  2ZPE B;  2B86 A;  4QT7 A;  3ZL7 C;  5D7U A;  1KD1 C;  2M51 A;  5GAN 2;  2RA2 A;  4QVZ A;  1MMA A;  3M58 A;  3JCM h;  1SSH A;  5FLX E;  3FJ5 A;  3O8V A;  1WHK A;  4LDX A;  3DLM A;  3L42 A;  1I1J A;  2OTL Q;  2DYB A;  1OYX A;  4J9D A;  2JS0 A;  1AZG B;  3OSV A;  1D3B B;  1SRM A;  4J7I A;  1LPL A;  3REB B;  4B6M A;  4DQ2 A;  1VQK A;  1D0Z A;  1NYG A;  3NTK A;  4B9W A;  1AD5 A;  4C92 E;  1OV3 A;  1UGQ B;  2HNI A;  2ESW A;  1JQQ A;  1ACM B;  1UTI A;  1WZO A;  4KBM B;  1X01 A;  2DZC A;  2HL5 C;  1WPY A;  3DB4 A;  2VVK A;  2KR3 A;  2LX9 A;  2QQB A;  4JRK A;  2ZPG B;  5IHI A;  3CCV Q;  1Q81 R;  3CPF A;  4RTU A;  1YI2 Q;  2EYX A;  1VQ4 Q;  3VRZ A;  4YTL A;  2RF0 A;  4L6V 5;  2CP7 A;  2QAZ A;  4C8Q E;  4R55 A;  4C8Q C;  4HCB A;  3RUX A;  3OYM A;  3CCL T;  1I5O B;  2ATC B;  4EMK A;  2GQI A;  1MNE A;  3A8G B;  3ME9 A;  1AWW A;  1QP3 A;  4VUB A;  1G83 A;  2JXB A;  2VC8 A;  3CC7 Q;  2HAX A;  2CH4 W;  3G4S Q;  1U1S A;  2RK2 A;  2IVW A;  3EFO A;  4KGV B;  5LJ3 g;  5GAM f;  4R0K A;  3PE0 A;  4LDW A;  2RMO A;  2WAC A;  4HCC A;  4HCZ A;  1VQP Q;  5A0L A;  1K9M C;  3X25 B;  3CCR T;  4A4E A;  2E3H A;  2RQT A;  2M9U A;  2YUN A;  4BAC A;  1YP5 A;  2BTT A;  3CC4 A;  2DJQ A;  4N4G A;  3CCE T;  2V26 A;  1IB8 A;  1Q95 G;  4IUQ A;  3REA B;  1VQN T;  3JCM c;  2EYQ A;  2P4R A;  1K73 R;  2QYZ A;  3FEO A;  5EC7 A;  2RN8 A;  4MZT A;  2AT1 B;  5GAN 7;  1M5Q 1;  2VB6 A;  2KXC A;  4OMP A;  3ULR B;  4OVA A;  4JLI A;  4J6W A;  1FMV A;  2YWW A;  5CKB A;  1JJ2 S;  4O5V A;  4LDU A;  2M0O A;  2WSC E;  4FW2 A;  1U3O A;  3CCQ T;  4ATO A;  2KBT A;  3E9F A;  3LH0 A;  4DEY A;  3EAE A;  4HA8 A;  4AFS C;  4PJO A;  2F5T X;  4OMN A;  4DBF A;  5I2S A;  2ABL A;  4PL6 A;  5LJ3 d;  1RLP C;  4RTT A;  3M0R A;  1EFN A;  3PMI A;  1ARK A;  4Y28 E;  4OP0 A;  1P92 A;  2CP0 A;  1VQL A;  5LJ5 h;  1QKW A;  3UA7 A;  3DKM A;  1TH7 A;  3RKX A;  3H0H A;  3OYA A;  4ZN1 A;  4E7I A;  3HPW A;  1M90 R;  5KYX B;  4FW1 A;  2HSE B;  2YLC A;  1ZSZ C;  4Y91 A;  4Z8A A;  2DRM A;  1OOT A;  1FYN A;  2RI2 A;  5CIU A;  4XU0 A;  2KQW A;  1QMC A;  4AFZ C;  1WX6 A;  3CCJ Q;  3CC2 Q;  3LGL A;  3M0Q A;  3JAM E;  1YJN A;  2QK0 A;  1VQK T;  4M7D G;  2XDP A;  4J83 A;  4ZNX A;  2Y90 A;  4PJO F;  3CD6 A;  2PU9 B;  2BZY A;  4PJO D;  1Q81 C;  4O6J A;  5GAN h;  1WQW A;  3E19 A;  4R56 A;  3GBQ A;  4QQ6 A;  2BE9 B;  3HKS A;  3MJX A;  1PD0 A;  4ZGE B;  1T0J A;  1SPK A;  4RG8 A;  4RG2 A;  1VQ9 Q;  4M78 G;  3QII A;  4M7A F;  3M57 A;  5GJW B;  4M7A D;  1WHM A;  2JOY A;  3A98 A;  3CPW A;  2CP2 A;  4QW2 A;  3RMS A;  4J5Y A;  4M75 G;  3ZFJ A;  2KRN A;  2CZ1 B;  1VYU A;  1D0Y A;  2KYB A;  3HFO A;  1RUW A;  4A4K A;  4M7D F;  3OS5 A;  4M7D D;  2E12 A;  2EQK A;  4C92 A;  1K8A U;  2DL5 A;  3HL8 A;  5GJV B;  2DK3 A;  2AKK A;  1VQM A;  2Y4Y A;  1AWX A;  1QVG S;  3J80 E;  3CCE Q;  3VV0 A;  3M4G A;  4AFU C;  1VQN Q;  4E7S A;  4OMO A;  3JB9 F;  3JCM b;  3JB9 D;  3UT1 A;  3VRY A;  2QTX A;  3JV3 A;  4A4H A;  2XIC A;  1S72 A;  1K73 C;  5KCH A;  3FB9 A;  3E9G A;  3MCA B;  1K9A A;  1AOJ A;  2C0T A;  5GMK e;  3H0F A;  4M75 F;  4Y92 A;  2VKN A;  2VV5 A;  4KUL A;  1CKA A;  4C8Q A;  4M75 D;  3SHW A;  4E7J A;  3TRE A;  3RES A;  2HKQ B;  3JB9 H;  2KI7 A;  2VXF A;  4CI0 C;  1FXX A;  1BCO A;  1JBM A;  3CMA Q;  3NMZ C;  1SHF A;  1VQ8 T;  3Q1J A;  4Z89 A;  4DA4 A;  1Q7Y U;  4WCI A;  3FRN A;  2EFI A;  1JXO A;  3VS0 A;  2EYY A;  4MML A;  1YJ9 Q;  2EPD A;  2K2M A;  1UJ0 A;  1CKB A;  2PNI A;  2JS2 A;  3P8B B;  1Q86 U;  1FWZ A;  1H64 1;  1PSE A;  2F2V A;  2L3Q A;  4F7U F;  1MV3 A;  2A3L A;  2LJ0 A;  2HD0 A;  1RAC B;  3M9Q A;  2DM1 A;  4J9I A;  3PNW C;  3JCM Q;  1WGS A;  1YIT A;  3RR6 A;  4A53 A;  1VQL T;  1WXU A;  5GMK i;  3G7Z A;  1R8O B;  3EGX B;  2DLP A;  3OMC A;  2E6N A;  4II1 A;  4C0G A;  3MEU A;  2MIO A;  4XU1 A;  2HSP A;  3EG9 B;  1OZ2 A;  2DIL A;  3LYI A;  1WNL A;  4Z02 A;  2ZPB B;  4GLK A;  1BK2 A;  1YJN T;  2QGG A;  3PTA A;  1IGU A;  1YJW A;  3CD6 T;  1HSQ A;  3GIB A;  1O75 A;  4NS5 A;  1D3B A;  1YWO A;  3EH1 A;  1VQ5 A;  1M8V A;  3EFS A;  1X6O A;  4KGZ B;  4ZTJ A;  1N5Z A;  2KVQ G;  2C06 A;  4BE1 A;  1YIJ A;  2GTJ A;  2O31 A;  4FU6 A;  1FMK A;  1NG2 A;  3CXC P;  5IHK A;  1PCX A;  4BB7 A;  2CH4 A;  4OB3 B;  2FPE A;  1NEG A;  2P0K A;  2ZAE A;  4KUI A;  1QP2 A;  4MZP A;  2KYM A;  2E64 A;  3VS3 A;  4M7D B;  3V8J A;  2A28 A;  3SFM A;  5IXF A;  1TG0 A;  4PLL A;  1KC8 U;  1VQM T;  1D1C A;  1NYF A;  2QQA A;  4EMK C;  2FB7 A;  4WTO B;  4KGX B;  4M78 B;  1S72 T;  1VQ8 Q;  3F70 A;  1TTH B;  2M1H A;  2DTO A;  3EGD B;  3OB9 A;  1RLQ C;  3IQL A;  4M75 B;  3CBP A;  4PJL A;  1I0C A;  1OPK A;  1W4S A;  3OW2 A;  1W2B P;  3L2V A;  3U23 A;  2MK5 A;  1M4Z A;  4MDW A;  2DXU A;  3CCM T;  3VS2 A;  2MOX A;  3EHR A;  2L0A A;  4ZTF A;  2A37 A;  2DKG A;  1Q82 U;  1GBQ A;  3H41 A;  2CKK A;  4ANJ A;  3I5S A;  3VS7 A;  1OQK A;  2RQR A;  2NUP B;  3PVQ A;  4OB0 B;  2D9T A;  4M77 G;  1VQ7 A;  1UEB A;  1X2K A;  3CCS A;  1ZBX A;  4EMG A;  3UF4 A;  2EYZ A;  1Y96 A;  1E7O A;  2GGR A;  2K9G A;  5GAM e;  5HK3 A;  3MO8 A;  4JPB W;  1YIT T;  1PNJ A;  1YBY A;  4JZ4 A;  2E70 A;  4GY5 A;  4E7K A;  2KE9 A;  2X3X D;  3JRZ A;  1M2V B;  1WXT A;  6AT1 B;  1I4K 1;  4PJO E;  3P8D A;  4PJO C;  4ESR A;  1EX4 A;  3CBM A;  3CME A;  1ABQ A;  2M0Y A;  3BDU A;  3S6W A;  2KDS A;  2JJ9 A;  2MWO A;  3L2Q A;  1Q7Y R;  2BZ8 A;  1TU0 B;  1D09 B;  1ZA2 B;  2FG0 A;  4K11 A;  2Z0W A;  2K4Y A;  3OSS C;  2LQN A;  5KYX A;  4M7A E;  2QDL A;  4OGE A;  4M7A C;  1NPR A;  1ZUK A;  1Q86 R;  2A36 A;  4N4H A;  1YJW T;  3R6N A;  4AG2 C;  4LDY A;  2GFA A;  1ZHI A;  3CPW S;  2FPD A;  2QGF B;  2L3P A;  1GFD A;  2AK5 A;  1A0N B;  1KQS A;  1VQ5 T;  1SSF A;  4FIB A;  2LRQ A;  2CZ7 B;  1M3C A;  4J6Y A;  4PFP A;  4M7D E;  4HVU A;  3OYJ A;  2EAY A;  1SKU B;  1Z9Z A;  2DBK A;  5GAN 4;  1YIJ T;  3RDV A;  4LDV A;  1G2B A;  3V8K A;  1I5L A;  5GAO r;  3LLR A;  1SRL A;  2X9H A;  4JJB A;  2LQ8 A;  4KT0 E;  2DXT A;  3JCM J;  5GAN j;  4BY6 C;  3I56 T;  5CQX A;  1ZUU A;  4F04 B;  1LJO A;  1YHQ Q;  3LGF A;  4ZGJ B;  2E65 A;  2M16 A;  4M75 E;  4ME7 A;  4D6W A;  4XTY A;  1KFZ A;  2RHI A;  1HK9 A;  3C0C A;  2OAU A;  1IHW A;  5LJ5 e;  2XK0 A;  5KYY B;  3SWN B;  1JO8 A;  1RAA B;  3MET A;  1PKT A;  2A7Y A;  1AZE A;  5A0G A;  2AIR B;  2RM4 A;  5FW9 A;  1RAF B;  1X27 A;  4C92 C;  2WSE E;  1AWJ A;  1HYO A;  2F2W A;  4PJN A;  3T9N A;  1U06 A;  3JCM f;  4JUV A;  3CCM Q;  2ZPF B;  2XG8 D;  5A0D A;  1H3H A;  3I55 Q;  4WF2 A;  1UHF A;  3MEA A;  4X9D A;  2F1L A;  2PVG B;  4F7U E;  1QLY A;  5KYW B;  2VAS A;  2P84 A;  3QSU A;  4GBQ A;  4NOY A;  2JNG A;  2HMA A;  3QWY A;  2HCK A;  2F69 A;  1SEM A;  2X4W A;  2FHD A;  1BI2 A;  2FEI A;  2CGH A;  2RO0 A;  1VQ7 T;  4KRT A;  2EQM A;  5IN1 A;  3CCS T;  3G6E Q;  2J6K A;  3GNG A;  2VUB A;  3PT9 A;  3KBG A;  2EGE A;  2GQV A;  1GCP A;  2LZ6 B;  5CCA A;  3A5Z B;  2RHX A;  3A8O B;  1UE9 A;  1M3A A;  1Q7Y C;  2DX1 A;  1NEB A;  5FRM A;  3JB9 I;  1IO6 A;  2ENM A;  2W0Z A;  4HVV A;  2NLU A;  2PQW A;  3CME T;  4QVC A;  3KFV A;  2JVV A;  2K5F A;  1Q86 C;  3S3O A;  3EGX A;  1W1F A;  2EQJ A;  1UHC A;  5GAO q;  1MND A;  2FZG B;  1Q82 R;  3INZ A;  4RTY A;  2CP6 A;  4EIK A;  2QA4 A;  2COW A;  3MP1 A;  1G3T A;  2CRE A;  4M77 B;  8AT1 B;  1V29 B;  1TUC A;  3EG9 A;  3M5A A;  1VQ6 A;  2O4X B;  2DL4 A;  2EYW A;  4ZN3 A;  5HCK A;  2QEX A;  4XU2 A;  2PVD B;  1N8R R;  4FT4 A;  1QCN A;  2CP3 A;  3M59 A;  3I56 Q;  4E7H A;  1E6H A;  1M1K U;  5LJ3 j;  2NWM A;  2O88 A;  2KT1 A;  1M1G A;  4IIO A;  2D0Q B;  1VIE A;  1F1B B;  2E10 A;  2OJ2 A;  2QQR A;  3QKJ A;  1NJI U;  2KY9 A;  4ELZ C;  4M7A A;  2JTE A;  2DA9 A;  3MEV A;  2CS7 A;  3NTH A;  7AT1 B;  3RBB B;  2PTK A;  3L2U A;  1TOV A;  1YWP A;  5FWC A;  4E47 A;  1IRX A;  4QQD A;  2X3W D;  4FYY B;  3MHX A;  1TSF A;  5IT9 E;  1WXB A;  3E2U A;  1QCO A;  3C12 A;  3VU3 C;  4C5E A;  4JJN K;  2COY A;  2JTM A;  5LJ5 f;  1GBR A;  4M7D A;  4RTW A;  3JB9 J;  5IXB A;  2JMA A;  5J39 A;  2EW3 A;  1ZSG A;  4C0Z A;  3QUI A;  4L5G A;  2ED0 A;  3OW2 S;  1LOJ A;  4JRP A;  2RJE A;  2KMT A;  1GCQ C;  4XTW A;  1G3Y A;  2HL3 A;  2A0F B;  2PZ1 A;  4HXJ A;  3CCL Q;  3JSC A;  3PMT A;  2KT8 A;  4M4Z A;  3A8L B;  3NFC A;  4EPC A;  3EGD A;  3NPF A;  3WXM B;  2L5Q A;  4M75 A;  5M9O A;  2DER A;  4OB1 B;  4CC4 B;  5GAN f;  2D0N A;  1B7T A;  2P0P A;  4RUG A;  4LUE A;  1ZA1 B;  1X43 A;  2RQV A;  4FYV B;  3SEM A;  4L59 A;  1K0S A;  1EZZ B;  1X69 A;  3MEW A;  5HY6 A;  5AYF A;  1LNX A;  3VS5 A;  4LN2 A;  3URG A;  2ROT A;  3OS2 A;  3PIP A;  3CCR Q;  4BE2 A;  4JZ3 A;  3PGG A;  4AMC A;  4PLI A;  3VJP A;  3CME Q;  3J7A F;  3CBO A;  1CSK A;  2MPX C;  4IUR A;  1N6A A;  1RAB B;  1V1C A;  2NUP A;  4OML A;  4JS4 A;  1H8K A;  2W10 A;  1B07 A;  1N27 A;  2CSI A;  5FU6 B;  4M77 E;  4M78 F;  3QDR B;  1Y71 A;  4M78 D;  4F7U A;  2BKD N;  3QZ9 B;  3EG1 A;  1Q82 C;  5GAN 8;  3CCU A;  2VGM A;  4C5I A;  3CQT A;  2KNB B;  3CC4 T;  2HZY A;  3TEE A;  4FM4 B;  4A54 A;  2CT3 A;  1V76 A;  2DVJ A;  4A63 B;  4N0A C;  1M2V A;  2EIF A;  3CCQ Q;  1JXM A;  3EFR A;  3QHS A;  5FRN A;  2BIV A;  1QVF P;  1UGV A;  2OAW A;  4BD3 A;  1U5S A;  1KQS S;  1VYT A;  3WVE B;  2QA4 T;  4OB2 B;  1RL2 A;  3JCM W;  1K76 A;  2RQW A;  4RTX A;  2AZS A;  4C0F A;  1N8R C;  2KEA A;  2ED1 A;  1VQ6 T;  1WYX A;  1XTD A;  3SB2 A;  2OTL A;  2ZPH B;  1QWF A;  1HXD A;  2RPN A;  2QEX T;  2QAS A;  3BE3 A;  3FJP A;  5KCO A;  4AG1 C;  4C8Q G;  4LD9 K;  3V7R A;  4XTX A;  5CKD A;  2H3J A;  5CO7 A;  1NBE B;  3LW5 E;  2C0O A;  4FCY A;  1T3S A;  4RCC A;  1NPP A;  5L8R E;  4JJC A;  2FPF A;  1K9M U;  2RJF A;  1PM3 A;  2LX7 A;  4PNO A;  1FX7 A;  3OS0 A;  2NUT B;  1M9S A;  4GLM A;  4LUD A;  3CCV A;  3I35 A;  1TS9 A;  1YI2 A;  1VQ4 A;  4X1V A;  1VQK Q;  3RER A;  4DBQ A;  4J8O A;  5KYU A;  3MKD A;  4IUP A;  3M0S A;  5I11 A;  1LVK A;  5LJ3 h;  3BY7 A;  3H8Z A;  2D8J A;  1TUG B;  2CZ0 B;  2JTF A;  5LL6 S;  3GLX A;  3G71 A;  4MDX A;  3C95 A;  1XNI A;  2CZ6 B;  3G4S A;  5KYY A;  2MAM A;  3M56 A;  3SWN A;  5GAN 6;  3QZ5 B;  2LTO A;  1B3Q A;  2P4T A;  5L23 A;  1M8M A;  2XU8 A;  2L3R A;  1BI0 A;  2V1Q A;  3UAT A;  4FSS A;  1VQP A;  1ZUY A;  5CK9 A;  2MMP A;  1KHC A;  4ORZ A;  3V8L A;  4C5H A;  3CXC A;  3KXT A;  2JM9 A;  2VXE A;  2KSS A;  2ZZD A;  3E1S A;  5GAM g;  3LWI A;  1WHH A;  1I81 A;  3GF5 A;  4PKC C;  1WHL A;  4FL6 A;  2JUF A;  1D1B A;  2E41 A;  2CSQ A;  4JRI A;  3QDF A;  3QO3 A;  5FRO A;  1UEC A;  5CR2 A;  5IAY A;  2LC4 A;  3GOX A;  1G8X A;  5CQY A;  3CC4 Q;  1GCQ A;  3V7S A;  3HTR A;  1JJ2 P;  3FDR A;  1M2O A;  4LD6 A;  5FU7 B;  3M0U A;  5I21 A;  1PSF A;  2K57 A;  4V2S A;  5ECA A;  1Q81 U;  2LT1 A;  1R0C B;  2QA4 Q;  2K3X A;  2FRY A;  2CDT A;  1R0B G;  3JCM e;  2JW4 A;  1NZ9 A;  1UGS B;  3PIO A;  3D7S B;  1BI1 A;  5GMK h;  1T3L A;  1W2B A;  1UUE A;  3TU4 K;  5GAM d;  1MMG A;  2NYS A;  3UPU A;  4D8D A;  4C0D B;  1K8A R;  1GRI A;  1U1T A;  2XKO C;  2K7A A;  3X20 B;  1ZX6 A;  1PRM C;  2X4Y A;  1RI9 A;  2OTL T;  4F16 A;  1OPL A;  3UA6 A;  2QQ9 A;  4M77 A;  3CCJ A;  1VQL Q;  2YUO A;  1BBZ A;  3CC2 A;  2O9S A;  5DY9 A;  2ECZ A;  1OZ3 A;  1WLP B;  4J9B A;  1OUL A;  1WIE A;  1W6X A;  2RHU A;  2DL8 A;  4D8K A;  2K6D A;  4TVR A;  2YT6 A;  4N0A A;  5LJ5 g;  3EHQ A;  5EG2 A;  4QKU A;  2GNC A;  3KUF A;  3LWH A;  1VQ9 A;  1YCY A;  3CCV T;  2YSQ A;  1M30 A;  1S1N A;  2DD5 A;  3LX7 A;  2XD0 A;  1VQ4 T;  1YJN Q;  1ABO A;  4PK4 A;  4PJJ A;  1GL5 A;  3RKW A;  2COZ A;  3QYH B;  3CD6 Q;  4UC4 A;  1PHT A;  4CC3 A;  4KH1 B;  2FVU A;  2G3R A;  3OYE A;  2JMC A;  2A08 A;  4A4G A;  5D6Y A;  1KIK A;  4C8Q B;  4M77 F;  2AZV A;  1IZ6 A;  4M77 D;  2XID A;  3X28 B;  2IPO B;  3G71 T;  3V7C A;  4DEX A;  4EDU A;  1X2Q A;  2XDD A;  1KK7 A;  4PJM A;  5HK0 A;  3G4S T;  4BI8 B;  3EG3 A;  3VS6 A;  3H9N A;  1XJW B;  1QVG P;  2EKH A;  3HRU A;  1GFC A;  4XTU A;  4M7D C;  2RJC A;  1KQ2 A;  2LT4 A;  5LJ5 d;  1OU8 A;  2V8K A;  2RNA A;  2FZK B;  1M90 U;  4RKU E;  5GAO l;  1J3T A;  4MZM A;  1ZQ1 A;  1B34 B;  2EJ9 A;  3NGP A;  1QW1 A;  3FIF A;  5DLO A;  2V8J A;  1VQM Q;  2DJZ A;  1AVZ C;  3M0P A;  2LJ1 A;  2QDY B;  1H92 A;  4M78 E;  4M78 C;  1QQJ A;  2YUP A;  1KJW A;  2J7I A;  3OBW A;  3CMA A;  3TSZ A;  1SHG A;  4XU3 A;  3QPH A;  2X51 A;  2HEQ A;  2L8D A;  2HBW A;  5IHN A;  3VUB A;  1S72 Q;  2DD4 A;  4DOW A;  4M75 C;  3AHU A;  3OYY A;  3S3M A;  1YJ9 A;  2E3I A;  4PFZ A;  5GAN d;  4IIM A;  3RIR A;  5CKH A;  1N9R A;  3GNF B;  5J26 A;  1JRI A;  1MMD A;  2HDA A;  4HCK A;  1UGP B;  1MMN A;  3TCJ A;  3EGU A;  2QG9 B;  3HRT A;  2X4J A;  2C0I A;  3EG2 A;  2HQH A;  1K8A C;  4HT8 A;  1BKB A;  2QI2 A;  4J9F A;  3JCM P;  1KSW A;  5D6W A;  3A8M B;  4BDZ A;  2EJF A;  2RH2 A;  2DYI A;  2EWN A;  4KUD K;  5GAN e;  2FZC B;  2GCX A;  2DPP B;  2DNU A;  3OA6 A;  1KC8 R;  2K5I A;  4J9H A;  1MHN A;  3C94 A;  3MPU B;  4Q5W A;  2EBP A;  4JDS A;  1RAG B;  1FMW A;  1YIT Q;  3BW1 A;  1ZSZ B;  3CCJ T;  3CC2 T;  3R6O A;  1OU9 A;  2HBP A;  8ATC B;  2DEU A;  4ZGD B;  2RK1 A;  2DRK A;  2Y4X A;  1IXD A;  2GTO A;  3EH2 A;  1VQO A;  2I2L A;  3PVL A;  2J06 A;  1YFN A;  5GAM h;  5J3B A;  2OI3 A;  2OTJ A;  3QYG B;  4J9G A;  1VQ9 T;  1JEG A;  2IIM A;  3G71 Q;  1YJW Q;  2NUT A;  1U8R A;  1NLO C;  2JT4 A;  4C5G A;  4AFQ C;  1VQ5 Q;  1UFF A;  5I22 A;  3HHT B;  1R77 A;  2AKL A;  2H8H A;  4XTV A;  1UDL A;  2RQU A;  2V1R A;  3CXC S;  2DL7 A;  1YIJ Q;  2ZGW A;  1RAI B;  3NHN A;  2EKO A;  3L2R A;  4F14 A;  1E6G A;  2DEQ A;  2LP5 A;  1VQ8 A;  3C4S A;  2LDM A;  1QWE A;  3SWN C;  2LJ3 A;  1XQH A;  5KH6 A;  3NTI A;  4BI3 A;  2RI5 A;  1Y96 B;  1KQ1 A;  3CMA T;  2YLB A;  2AHJ B;  2O9V A;  1G5V A;  2MCN A;  2LNH B;  3G1J A;  4PJO G;  1SF9 A;  1RAH B;  1W70 A;  9ATC B;  2HQX A;  3O5Z A;  4QVD A;  2P0Q A;  2J05 A;  2NUZ A;  1YJ9 T;  2KGT A;  4A4F A;  2FO0 A;  2EGC A;  4RTV A;  1Z9Q A;  2HKN A;  1W2B S;  2D6F A;  1JB0 E;  1KHI A;  2MI6 A;  2QXF A;  2DMO A;  2RHZ A;  5DLQ E;  1VA7 A;  4M7A G;  2BE7 D;  4P5N A;  4FT2 A;  2CYZ B;  1KG1 A;  1QVP A;  1I8F A;  1TXQ A;  1Y0M A;  4RMO A;  3OYB A;  5GAN 5;  4LE9 A;  2R5A A;  3UWN A;  3L2Z A;  4M78 A;  5LJ3 e;  4NL2 A;  1KC8 C;  2X35 A;  2YDL A;  3THK A;  2F2X A;  4LNP A;  3OYI A;  3ER0 A;  3VS1 A;  1VQ7 Q;  2RI3 A;  1QCF A;  3CCS Q;  1M1F A;  2DVE A;  1X6G A; 
#chains in the Genus database with same CATH homology
 1WXT A;  2EGA A;  4ESR A;  2GQI A;  1ABQ A;  2M0Y A;  5L23 A;  1B3Q A;  1M8M A;  1AWW A;  2FRW A;  2V1Q A;  1G83 A;  3UAT A;  2JXB A;  4FSS A;  1ZUY A;  3RNJ A;  2BZX A;  2BZ8 A;  2CH4 W;  2FG0 A;  2LQW A;  4K11 A;  4ORZ A;  2LQN A;  4R0K A;  3PE0 A;  2JM9 A;  2QDL A;  1ZUK A;  2RMO A;  2A36 A;  2G6F X;  2SEM A;  2CT4 A;  3R6N A;  1Y57 A;  2RQT A;  4AG2 C;  2D8H A;  2YUN A;  1YP5 A;  2BTT A;  4CC7 A;  2FPD A;  2J6O A;  2L3P A;  2DJQ A;  1GFD A;  2AK5 A;  1A0N B;  1X6B A;  3REA B;  2CSQ A;  1M3C A;  1UEC A;  1PRL C;  2P4R A;  4HVU A;  3M0T A;  5EC7 A;  1Z9Z A;  2RN8 A;  1GCQ A;  2DBK A;  3VS4 A;  3LH5 A;  2KXC A;  1G2B A;  4OMP A;  4Z88 A;  3ULR B;  5FWB A;  3M0U A;  3TVT A;  2LMJ A;  4RTZ A;  1SRL A;  4JJB A;  5ECA A;  2D1X A;  1U3O A;  2KBT A;  2FRY A;  2CDT A;  1M3B A;  4DEY A;  1ZUU A;  2JW4 A;  4AFS C;  1YNZ A;  2CUD A;  4OMN A;  1T3L A;  2ABL A;  1UUE A;  1RLP C;  4RTT A;  3M0R A;  1BU1 A;  1KFZ A;  3C0C A;  1EFN A;  1UJY A;  1ARK A;  1UG1 A;  4HVW A;  1JO8 A;  1PKT A;  1K1Z A;  4D8D A;  1GRI A;  1QKW A;  3UA7 A;  1AZE A;  3H0H A;  2K7A A;  5FW9 A;  1ZX6 A;  1X27 A;  1PRM C;  1AWJ A;  2F2W A;  2DF6 A;  1RI9 A;  1U06 A;  4F16 A;  1OPL A;  3UA6 A;  2VWF A;  2YUO A;  1BBZ A;  1H3H A;  2O9S A;  2ECZ A;  3EG0 A;  1UHF A;  2L3S A;  1WLP B;  4Z8A A;  2DRM A;  4J9B A;  1JU5 C;  1OOT A;  1WIE A;  1FYN A;  1W6X A;  1QLY A;  4AFZ C;  1WX6 A;  2DL8 A;  4D8K A;  2K6D A;  2YT6 A;  3M0Q A;  3EHQ A;  4GBQ A;  4ZNX A;  2BZY A;  1YCS B;  2KRO A;  2GNC A;  1WFW A;  3QWY A;  2HCK A;  4JJD A;  2YSQ A;  1M30 A;  1SEM A;  1S1N A;  3GBQ A;  2J6F A;  1PWT A;  2FEI A;  1ABO A;  1GL5 A;  2KXD A;  1T0J A;  1PHT A;  1SPK A;  4CC3 A;  4KRT A;  1TUD A;  1MUZ A;  2J6K A;  5GJW B;  1I07 A;  2JMC A;  2A08 A;  1KIK A;  2EGE A;  3A98 A;  1GCP A;  2LZ6 B;  1UE9 A;  2AZV A;  1M3A A;  4F17 A;  2DX1 A;  1NEB A;  1YN8 A;  2KRN A;  1IO6 A;  4DEX A;  1X2Q A;  1VYU A;  2ENM A;  2W0Z A;  4HVV A;  2KYB A;  1RUW A;  3EG3 A;  3VS6 A;  3KFV A;  2DL5 A;  5GJV B;  2EKH A;  4J9C A;  1GFC A;  1W1F A;  2AKK A;  1AWX A;  1UHC A;  1XOV A;  4RTY A;  1T0H A;  2RNA A;  4EIK A;  4AFU C;  1J3T A;  3NGP A;  4OMO A;  2CRE A;  3VRY A;  1TUC A;  5IH2 A;  1AVZ C;  3M0P A;  2LJ1 A;  3JV3 A;  2DL4 A;  1H92 A;  2EYW A;  2YUP A;  5HCK A;  2LCS A;  1K9A A;  1KJW A;  1AOJ A;  2C0T A;  4J9E A;  2J7I A;  3H0F A;  4Y92 A;  2VKN A;  3TSZ A;  1CKA A;  1SHG A;  3SHW A;  1AEY A;  2HEQ A;  1E6H A;  2HBW A;  5IHN A;  1PKS A;  2NWM A;  2O88 A;  2O2O A;  2KT1 A;  1K4U S;  4IIO A;  3NMZ C;  1SHF A;  1WDX A;  2KRM A;  4IIM A;  4Z89 A;  2OJ2 A;  4WCI A;  1JXO A;  2HDA A;  4HCK A;  2EYY A;  3VS0 A;  2JTE A;  2EPD A;  2DA9 A;  2K2M A;  1UJ0 A;  4E6R A;  3EGU A;  1HJD A;  1CKB A;  2PNI A;  2JS2 A;  2K3B A;  2C0I A;  3EG2 A;  3RBB B;  2PTK A;  2JM8 A;  1YWP A;  2I0N A;  2E5K A;  2F2V A;  2ROL A;  1HD3 A;  4OMM A;  5FWC A;  2L3Q A;  1MV3 A;  1BB9 A;  2X3W D;  2LJ0 A;  4J9F A;  1ZBJ A;  1WXB A;  2SRC A;  4CC2 A;  1NLP C;  2DM1 A;  1M27 C;  1KSW A;  4J9I A;  3H0I A;  3TSW A;  1GBR A;  4RTW A;  5IXB A;  2JMA A;  1WXU A;  2CUB A;  2EW3 A;  1ZSG A;  2DNU A;  1OEB A;  2DLP A;  4J9H A;  2ED0 A;  2GBQ A;  2EBP A;  2L2P A;  1GCQ C;  2MIO A;  2HSP A;  2PZ1 A;  4HXJ A;  1MV0 B;  2DRK A;  2DIL A;  3I5R A;  2KT8 A;  2GTO A;  4M4Z A;  3NPF A;  3PVL A;  2EQI A;  2J06 A;  1BK2 A;  2OI3 A;  4CC4 B;  2D0N A;  4J9G A;  1HSQ A;  4RUG A;  4LUE A;  4OMQ A;  1JEG A;  1K0X A;  1X43 A;  1VYV A;  2RQV A;  2IIM A;  2EVR A;  3SEM A;  1AWO A;  1YWO A;  1K0S A;  1X69 A;  3VS5 A;  4LN2 A;  2ROT A;  2XMF A;  4JZ3 A;  1N5Z A;  1NLO C;  2DE0 X;  2K79 A;  1WI7 A;  1CSK A;  1ZLM A;  2JT4 A;  2GTJ A;  4AFQ C;  2O31 A;  1UFF A;  4OML A;  1V1C A;  3I9Q A;  5I22 A;  1H8K A;  2W10 A;  1FMK A;  1B07 A;  1NG2 A;  2YUQ A;  2AKL A;  2CSI A;  2H8H A;  3QWX X;  5IHK A;  1NM7 A;  1UDL A;  2RQU A;  2V1R A;  2CH4 A;  2DL7 A;  2KRS A;  3EG1 A;  2FPE A;  3CQT A;  1NEG A;  2KNB B;  2KYM A;  2CT3 A;  3VS3 A;  2A28 A;  2DVJ A;  4A63 B;  3NHN A;  5IXF A;  1TG0 A;  1JXM A;  2DBM A;  1UGV A;  4F14 A;  1E6G A;  1QKX A;  1NYF A;  2OAW A;  1U5S A;  1WA7 A;  1VYT A;  2LP5 A;  1K76 A;  2RQW A;  4RTX A;  2AZS A;  1QWE A;  2LJ3 A;  2KEA A;  2ED1 A;  1LCK A;  2DL3 A;  1WYX A;  3ZL7 C;  2B86 A;  4QT7 A;  1QWF A;  2M51 A;  2RPN A;  4AG1 C;  2O9V A;  2MCN A;  1RLQ C;  2LNH B;  1SSH A;  3IQL A;  3FJ5 A;  1W70 A;  3O5Z A;  2C0O A;  1I1J A;  2DYB A;  1I0C A;  1OPK A;  1T3S A;  2J05 A;  2NUZ A;  2KGT A;  2JS0 A;  4J9D A;  1AZG B;  4JJC A;  2FPF A;  1SRM A;  3U23 A;  2FO0 A;  2EGC A;  2LX7 A;  4RTV A;  1Z9Q A;  3REB B;  1NYG A;  3VS2 A;  2MOX A;  1AD5 A;  1OV3 A;  3EHR A;  4GLM A;  2DMO A;  2L0A A;  4LUD A;  2A37 A;  2ESW A;  3I35 A;  1VA7 A;  1GBQ A;  3H41 A;  3I5S A;  1JQQ A;  3VS7 A;  1UTI A;  2RQR A;  4X1V A;  1Y0M A;  3PVQ A;  2VVK A;  4LE9 A;  2KR3 A;  5IHI A;  1X2K A;  3UF4 A;  2EYZ A;  2YDL A;  1E7O A;  2GGR A;  2K9G A;  3M0S A;  4RTU A;  3THK A;  5I11 A;  2EYX A;  2F2X A;  4LNP A;  3VRZ A;  4JPB W;  1PNJ A;  2D8J A;  4JZ4 A;  3VS1 A;  2RF0 A;  1QCF A;  2KE9 A;  2X3X D;  1X6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...