2DL7A

Solution structure of the second sh3 domain of human kiaa0769 protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
73
structure length
73
Chain Sequence
GSSGSSGVCFVKALYDYEGQTDDELSFPEGAIIRILNKENQDDDGFWEGEFNGRIGVFPSVLVEELSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the second SH3 domain of human KIAA0769 protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords KIAA0769 protein
total genus 5
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2006-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dl7A00
2C0IA 1QKWA 4Z8AA 4J9EA 1BU1A 2J6OA 2MIOA 1SHGA 2P4RA 1K76A 2DNUA 1MV0B 2OJ2A 2SEMA 1GFCA 1FMKA 3R6NA 1JEGA 2GTJA 2GTOA 2M0YA 1AWWA 4CC7A 3NHNA 1T0HA 2DRMA 5I22A 1NG2A 1NEGA 2X3WD 1SSHA 4WCIA 1A0NB 1FYNA 4ORZA 3M0QA 4F17A 2DRKA 1YWOA 4K11A 2FG0A 1MUZA 3NPFA 2FEIA 2CUBA 2I0NA 2RQWA 5EC7A 2EW3A 1QWFA 2L3PA 4AG2C 2KYMA 2EKHA 2DE0X 2K9GA 4R0KA 2CSIA 1M3CA 2LX7A 1AWOA 4ZNXA 2L0AA 1T0JA 3VS3A 2IIMA 3JV3A 3VS1A 1LCKA 1UUEA 3PVQA 1W70A 2KYBA 4LUDA 3UF4A 1JXMA 2FPEA 2A28A 4JJCA 1H92A 4CC4B 1X43A 2J6KA 1K1ZA 2RQTA 3EG2A 2D1XA 1X69A 2CDTA 1SRLA 2DL5A 1KSWA 1NLPC 1PKSA 4M4ZA 3RBBB 4AG1C 3I35A 1QWEA 3IQLA 2LJ1A 2FRYA 2ENMA 2O31A 2GQIA 3C0CA 3REAB 2EBPA 2K6DA 4HVWA 1ZX6A 1NYGA 4J9DA 2KGTA 2JTEA 3VS7A 2CT3A 2RQRA 2KRNA 1RLPC 1OPKA 2YUQA 2C0TA 1QCFA 2L2PA 2AZSA 3PVLA 2FPDA 4GLMA 1GBRA 1IO6A 2EGEA 1SEMA 1Z9QA 1N5ZA 1G83A 4Z88A 1WDXA 2NWMA 4D8DA 1XOVA 2XMFA 3VS0A 4F16A 1TG0A 2DX1A 1JU5C 1YCSB 4GBQA 2K79A 2W10A 2J7IA 1ABOA 1UG1A 2DBMA 4CC2A 3REBB 1M30A 2JT4A 2JW4A 1ABQA 3UA6A 2V1RA 2EGCA 2E5KA 4RTXA 1JO8A 1ZSGA 2LZ6B 1YWPA 2KXDA 4EIKA 2D8HA 2LNHB 2EVRA 2DA9A 1X2QA 2ABLA 1ZLMA 1VA7A 1Z9ZA 4KRTA 3VRYA 2EYYA 1YNZA 2LQWA 1ZUYA 2F2XA 2RQVA 1UDLA 2K3BA 2HCKA 2B86A 5HCKA 1RI9A 2KRMA 1PWTA 2KXCA 2KROA 1VYVA 1GFDA 1CKBA 3LH5A 1U3OA 4D8KA 4LUEA 1G2BA 4JPBW 4J9CA 3EG0A 1T3SA 1GL5A 4JJBA 5GJVB 4ESRA 2VVKA 1SPKA 2DLPA 2DYBA 1H3HA 4J9GA 3H41A 1B3QA 1T3LA 3THKA 1WA7A 1SHFA 1OEBA 1BBZA 4RUGA 3KFVA 2RN8A 4RTYA 2FPFA 2FO0A 1PRMC 1U5SA 1Y57A 2CH4A 2L3QA 2RMOA 2EQIA 1SRMA 2QDLA 5GJWB 3U23A 1WXUA 3SHWA 2J06A 5IXBA 3VS2A 1YN8A 1K0SA 1K9AA 3A98A 1WXTA 1U06A 1GCQC 1ZUKA 2CH4W 2GBQA 4RTVA 3FJ5A 1WI7A 3CQTA 3VS5A 1WFWA 1K0XA 2DM1A 1KIKA 1GCQA 2A36A 1X2KA 1TUDA 2JS2A 4DEYA 4OMLA 4A63B 2YUPA 3I5RA 4J9FA 3TVTA 1M3AA 3H0FA 1UJYA 1J3TA 1PHTA 2O88A 1UJ0A 1W6XA 1NLOC 1OOTA 2DMOA 3I9QA 2BZ8A 1WXBA 4IIMA 2JS0A 1AWJA 2KT1A 2OI3A 4JZ3A 1AVZC 4E6RA 2YSQA 2DVJA 1V1CA 2DF6A 1AEYA 1JXOA 2HSPA 4Y92A 2DL3A 1AWXA 3M0SA 3M0TA 2BZYA 1M3BA 4JZ4A 2NUZA 1X6BA 5FWCA 2A08A 4LNPA 5L23A 1PKTA 2G6FX 1BB9A 3TSZA 3EG1A 2AK5A 4AFSC 2H8HA 1KFZA 2CREA 1PRLC 1B07A 1K4US 1QLYA 2HDAA 2LQNA 2KRSA 1HJDA 1JQQA 2W0ZA 1NEBA 1WLPB 2LJ0A 2JXBA 2KE9A 4RTZA 1UHFA 3NGPA 1WYXA 2RQUA 1UTIA 1YP5A 2KEAA 3VRZA 3EG3A 1ARKA 1NYFA 2DL8A 3VS4A 3I5SA 3RNJA 2JMCA 2BZXA 2PZ1A 1Y0MA 2MCNA 1I0CA 1GRIA 2GNCA 4CC3A 1AD5A 3H0IA 1GCPA 2FRWA 2EGAA 2LMJA 1M27C 4AFZC 3PE0A 4RTUA 2RNAA 1TUCA 2CT4A 2MOXA 2EYZA 2EPDA 1W1FA 4OMOA 2C0OA 2DL4A 2ROLA 2YDLA 2AKKA 3M0PA 1AZEA 1VYTA 4RTWA 4HCKA 2M51A 2SRCA 1RLQC 2GGRA 4HVVA 2K7AA 4RTTA 2BTTA 2V1QA 2EYWA 4JJDA 5IHIA 2ECZA 3QWXX 3ULRB 4IIOA 2D8JA 1KJWA 2KNBB 4HVUA 1VYUA 1H8KA 5I11A 3TSWA 2YUNA 1OPLA 5IHKA 5FWBA 1WIEA 2AZVA 2AKLA 4OMQA 2DJQA 1ZBJA 3VS6A 4LE9A 3O5ZA 2LCSA 4LN2A 2F2WA 3SEMA 1E6HA 1X27A 2O9SA 1X6GA 2DBKA 1WX6A 4AFUC 2ED1A 3EHRA 2KR3A 1HSQA 1UHCA 2A37A 4J9BA 4J9HA 3QWYA 1MV3A 4F14A 1AZGB 2JMAA 1UE9A 2LP5A 4QT7A 2F2VA 2ED0A 3ZL7C 2EYXA 2ROTA 1E6GA 2O2OA 2PNIA 5IHNA 1HD3A 1GBQA 2KBTA 2DILA 2ESWA 1S1NA 1CSKA 2JM8A 2HEQA 1QKXA 1ZUUA 5IH2A 1UFFA 4FSSA 1M8MA 1BK2A 3UA7A 1PNJA 2YUOA 2D0NA 2RF0A 3M0UA 1NM7A 3UATA 5ECAA 3NMZC 3EHQA 2J6FA 1E7OA 2LJ3A 2L3SA 2RPNA 1RUWA 3M0RA 1I07A 3H0HA 1CKAA 1UGVA 4OMNA 2K2MA 2VKNA 1EFNA 1I1JA 2J05A 4OMPA 2KT8A 3GBQA 2VWFA 4AFQC 5FW9A 1UECA 4OMMA 4J9IA 2DL7A 2HBWA 4DEXA 2O9VA 4X1VA 2X3XD 4HXJA 1AOJA 5IXFA 2OAWA 3EGUA 2PTKA 2CUDA 2JM9A 4Z89A 1OV3A 2YT6A 2CSQA
chains in the Genus database with same CATH superfamily
1D0ZA 3HP9A 3VJPA 2MIOA 2J6OA 2MWOA 4QVDA 4B9WA 1MV0B 2OJ2A 2HQHA 2XDPA 1GFCA 1FMKA 2GTOA 1TU0B 1AWWA 4NOYA 2A3LA 4CC7A 2DRMA 3V7SA 1NEGA 5KH6A 2P0PA 5CKEA 3G6ET 1NPRA 4EMKC 1YHQT 4J6WA 3CD6A 4LDUA 2MWPA 2P84A 4K11A 2I0NA 5EC7A 1VQKT 3A8MB 2DVEA 2WSFE 4DBHA 4AG2C 2EKHA 3GNFB 4M7DB 4N4HA 2CSIA 1Q86C 4YTLA 2Z0WA 4ZNXA 5LJ3d 5DLOA 2IIMA 1LCKA 1IRXA 2RJFA 3QDFA 2R58A 1VQ6T 1JXMA 2FPEA 1I5OB 3A1PA 4M78F 1VQMA 1H92A 4CC4B 1R8OB 2L89A 1BI0A 1K1ZA 2RQTA 5KE3A 2R5AA 5KCHA 2CKKA 1X69A 1TS9A 5KYUA 1SRLA 4AG1C 2EQMA 1QWEA 1WHKA 2FRYA 4L5GA 3REAB 4FT2A 1N8RR 1YITT 4HVWA 1PD0A 1WHHA 2OTJQ 1OU8A 2K5IA 2JTEA 3VS7A 1JJ2A 2KRNA 1LOJA 4LXCA 1RLPC 4C92F 3QZ9B 2C0TA 4PFPA 3OYGA 4KH1B 4GLMA 3UPUA 4II1A 1VQ7Q 5A2QE 4F7UG 5FU6C 2LDMA 2QTVA 1Q81C 1N8RC 5HK3A 2DK3A 1ZSZA 1M1FA 1XOVA 4AT1B 1YJNT 4MZTA 2J7IA 3LLRA 1FX7A 2DBMA 1M30A 1YITA 1HXDA 2EGCA 2PVGB 1ZSGA 2CP6A 1YWPA 4EIKA 5GAOq 2EVRA 1WNLA 3PMTA 4QQDA 1X2QA 3GLXA 1X6OA 4KRTA 1MMNA 1W2BS 3EGXA 1VQ4T 3ZBDA 3CCQA 3JCMc 4M7AB 2B86A 1VIFA 3F70A 1RI9A 5L8RE 3SFMA 3E1SA 2QA4T 3P8BB 8AT1B 5FROA 2X51A 4JPBW 5KYNA 4A4FA 4JJBA 1YJNA 1N27A 2K3YA 2VVKA 1M2OA 1KC8U 2DLPA 2DYBA 4C8QG 1H3HA 1B34B 1B3QA 1T3LA 1PSFA 2KSSA 5HY6A 4RCCA 5D7UA 4JDSA 4RG2A 3EFOA 1VQPT 1QVGS 3C95A 4E2FB 3PIPA 2MK5A 2FO0A 4M7AD 2QGFB 1Y57A 1NBEB 3OW2S 3U23A 4XTUA 1TUGB 5IXBA 3VS2A 1YN8A 1VQ4A 4WTOB 5KYWB 4EPCA 3OSSC 2QQBA 1LPLA 3CQTA 3VS5A 2DM1A 3SB2A 3OYLA 1QCOA 5GAN8 3CCEQ 1YIJA 3LWHA 1Y7XA 4E7JA 1ACMB 2YUPA 2X4JA 1ZBXA 1R0BG 3OYNA 2RH2A 2ZPEB 3H0FA 3AT1B 4CI0C 2DMOA 2BZ8A 2XG8D 3A8LB 4FYWB 2DTHA 2CP2A 4N4GA 1AVZC 4E6RA 1S72Q 1V1CA 2VASA 4OP0A 4XU0A 2DZ9A 2E12A 2M02A 1JXOA 4NL2A 3M0TA 1IREB 3RERA 2NUZA 3GF5A 3FIFA 1NJIU 2A08A 4LNPA 3CCST 1BB9A 1G3SA 1TWBA 3EG1A 3X26B 2RHYA 2AK5A 6AT1B 3AHUA 4J83A 1WPYA 2CREA 3FEOA 3MKDA 3HL8A 1H3ZA 4DA4A 5A0GA 2LJ0A 2BUDA 5CAIA 2JXBA 1W2BA 2NLUA 2WSEE 3QO3A 1YP5A 2YWWA 3VRZA 1V76A 3EG3A 1ARKA 2F5TX 4C8QD 1VQ8Q 5CQXA 1OI1A 4M75D 3I5SA 1VQ5A 2BZXA 4M77E 1I4K1 2MCNA 5GAOr 2GFAA 2D0QB 4CC3A 3M4GA 2DJZA 2EGAA 2CP5A 3FLGA 2EQJA 4LDVA 1N6AA 3PE0A 3CC4Q 4RG8A 2CP7A 2LT1A 3CCUA 2L8DA 3CXCP 3ZEHA 2C0OA 3P8HA 3JCMQ 4N0AC 2EQKA 2QQ9A 3FB9A 3QIIA 4M78D 1KQ1A 4HKEA 4RTWA 4HCKA 3KBGA 4IURA 4N4IA 4X9DA 3VKIA 4FW1A 2BTTA 2EYWA 1QCNA 1RAEB 1KQSP 4JLGA 2ECZA 3ULRB 1K8AR 2VYTA 1EIFA 2KNBB 3LGLA 3MEVA 1VQ7A 5IHKA 2NYSA 1WIEA 3CXCA 2ZZDA 4QVCA 2QEXQ 3VS6A 2RJEA 3SEMA 2O9SA 2GFUA 3JCMV 5GMKe 3CMAA 2RD1A 3EHRA 3OS1A 5CO7A 3CCMT 4J9HA 4GY5A 3M5AA 1MV3A 4F14A 2RHXA 3G6EQ 2X4YA 3HSBA 3L2WA 1ZSZB 3DB4A 2HKQB 2JNGA 2ROTA 3BDUA 2OTLA 4ZGJB 1BIAA 2HNIA 2ESWA 3JB9G 2AIRB 1S1NA 1QMCA 4BACA 2ZPHB 4FSSA 1BK2A 1PNJA 4P5NA 4R55A 1VQNQ 2LJ3A 2RPNA 3EGXB 3MPUB 1RUWA 4M7AA 1WQWA 1QVFP 3X24B 2GF7A 3NFCA 4OGCA 1UGVA 3MP1A 4TVRA 2VKNA 1WHJA 3WVDB 2M9UA 3EG9A 4Q5WA 1M9SA 2VWFA 1UECA 2M16A 5KYXB 3RMSA 3S6WA 2RM4A 4HXJA 2EJ9A 5C0MA 4X34A 4IUTA 5IT9E 1OZ3A 4Z89A 2LNVA 1SF9A 1ZA2B 4JS4A 2PUKB 1G3YA 4Z8AA 1BU1A 3MO8A 9ATCB 4C0GA 3CCEA 1K76A 2DNUA 2EIFA 5GAN2 1TH7A 1WZOA 5I2MA 1VQMQ 5FRMA 2V8JA 2M0YA 3FRNA 1X01A 4N0AA 2E70A 2V26A 3S3MA 1T0HA 4C5IA 4OVAA 2IPOB 5I22A 5LJ3g 1Y07A 2HBPA 2PVDB 5CK9A 4WCIA 4R56A 4M7DA 1FYNA 4ORZA 4F17A 1QVFS 2QASA 1F1BB 1G8XA 4PJOD 4XU3A 3HRTA 4RCBA 1LNXA 2PQWA 4NL3A 3CCSA 2E41A 3G6EA 2K9GA 1OQKA 4E7SA 3URGA 2DTOA 1IZ6A 1M3CA 1PG5B 2LX7A 5DLQE 1T0JA 3LX7A 2EJGA 1EX4A 3VS3A 5GAOn 1Q81U 5GMKh 1RI0A 5FU7B 3OYCA 5KE2A 2FZGB 4C5HA 3OS2A 2A28A 5GANd 1YI2A 3CPWA 4LD9K 2BIVA 2X35A 2LX9A 5GANh 4Y91A 2CDTA 4JS5A 2QA4Q 4KT0E 2RB6A 1PKSA 1NLPC 3RBBB 1Q82R 3OYAA 3RUXA 3E2UA 4FT4A 2XD0A 1FMWA 2CS7A 7AT1B 3JCMd 2X4XA 1OU9A 1RAGB 2EBPA 4PJOA 3JB9H 2K6DA 1YJWA 1M2VA 3FDRA 3CCLA 3NTHA 3M56A 2CT3A 4BD3A 4CRIA 2RQRA 4GLKA 4KUDK 1RADB 2EFIA 2L2PA 3OYYA 3PVLA 2YRVA 1GBRA 4E7ZA 4DOVA 3BE3A 1IO6A 1XQHA 4PJJA 1N5ZA 2NWMA 2XMFA 1SG5A 3VS0A 1OULA 2RJDA 1JU5C 3BW1A 1YCSB 5GANe 1MNDA 4O6JA 4PNOA 1ABOA 1UG1A 4KGXB 3QYHB 3VUBA 3HFOA 4M7DD 1U1SA 2MPXC 3REBB 2JT4A 2V1RA 1D1AA 1YJWT 1TSFA 3S3NA 2VXFA 2FHDA 1MMAA 2D8HA 4D6WA 4PJNA 1HYOA 1Z9ZA 4FSXA 1Q86R 2EYYA 2RQVA 2K3BA 3X28B 2DXUA 1SSFA 2KRMA 2WSCE 3EFSA 3QUIA 2YLCA 5I2SA 2L5QA 1Q7YU 1GFDA 4EMKA 1M4ZA 5GMKj 4D8KA 4XTVA 1WJRA 2RI2A 1GL5A 3CCQT 4ZN3A 4OB0B 4JRPA 3HFNA 5LJ3e 1WJSA 4J9GA 3JCMg 3GP8A 2EJFA 1K9MU 5M9OA 2QA4A 4E7LA 3O8VA 2E6ZA 5KYWA 3M54A 4DQ2A 1G5VA 4RUGA 2NUPA 4F7UB 4C92A 1Y71A 4BB7A 1PRMC 2CH4A 3OYJA 1D3BB 4HT8A 1VQ4Q 4M75A 1K0SA 1WXTA 4M77B 1U06A 1GCQC 1KQSA 1VQLT 2GBQA 1WI7A 1YHQQ 1GCQA 3QDRB 1X2KA 4A4KA 1TUDA 2JS2A 4DEYA 4OMLA 3J80E 3HTRA 2DO3A 1QVGP 3PFSA 1QP2A 4J9FA 3CMEQ 2EYQA 3G71A 4M7DF 1M3AA 1ZSZC 2KQWA 2QAZA 1UJYA 5FLXE 4QQ6A 1PHTA 1M90R 1UJ0A 3EGDB 4A4HA 1W6XA 4RMOA 4E7KA 1OOTA 4M78A 3I56T 4C5EA 1WXBA 1M1GA 2KT1A 4JZ3A 1VQKQ 4JUVA 3META 3R6OA 1R0CB 2CZ1B 2MI6A 4O5VA 3M0SA 1FWZA 1BIBA 4JZ4A 4Y28E 5I21A 4XTWA 4EMGA 3JCMh 4HCCA 3MEAA 1D0XA 1PKTA 2M0OA 3TSZA 5L23A 1WGSA 4M7AE 3QYGB 1XTDA 2H8HA 3V8JA 1KFZA 3G7ZA 4PLIA 3JCMW 1B07A 5LJ5e 2HZYA 1TOVA 1QLYA 4KGZB 4FYYB 2KRSA 1HJDA 4PJOF 2MYSA 2JOYA 4M77D 2W0ZA 4A4EA 1NEBA 3H9NA 4MZMA 3MJXA 4RTZA 3I56A 3NGPA 3VYGA 1IB8A 2XICA 1UTIA 1W4SA 5GANg 4Z02A 3FJPA 2BKDN 3RKYA 1VIEA 2LQKA 2LCCA 4ME7A 2A0FB 3CXCS 3CCVA 1IGUA 5A0DA 2R5MA 3VS4A 1VQ9T 3C12A 4JRQA 5EG2A 1R77A 2PZ1A 2LT4A 2GNCA 3OQ5A 1AD5A 3H0IA 4OGEA 1GCPA 1KQSS 3VYHB 1MNEA 2V8KA 5LL6S 4LD6A 2LMJA 1M27C 1VQ9Q 2RNAA 1TUCA 3CC4A 4C92G 2EPDA 1UEBA 4EMHA 1C1AA 4DOWA 2O4XB 5FU6B 5GAN5 1LJOA 2BE9B 2WACA 3L2QA 1AZEA 1JJ2S 1RLQC 1MMGA 2K7AA 4RTTA 2V1QA 2I2LA 2VGMA 2PUOB 5IHIA 1BCMA 3QWXX 3BFMA 2D8JA 1VQ9A 4HVUA 4BI4A 3JAME 4KUIA 1HK9A 1OPLA 2Y4YA 8ATCB 2AKLA 1BCOA 3HRUA 2LCSA 1WJQA 2F2WA 1E6HA 4FYVB 4J5YA 2X4WA 4OB3B 1X6GA 3CC4T 4AFUC 1HSQA 3QJYA 4E7IA 4J9BA 2RHUA 3QWYA 3PMIA 2BE7D 5C6SA 2LP5A 4XTXA 4QT7A 5GMKl 2ED0A 5GAN3 1VQPQ 2KBTA 3JCMX 3CCMA 2E10A 1CSKA 1NZ9A 2DAQA 2EWNA 5GAN4 2JM8A 4KH0B 2HEQA 1ZUUA 5IH2A 3CCLQ 1YJ9A 1YFNA 4ZTJA 2D0NA 2OTLT 1NM7A 5D6YA 4J6XA 5ECAA 3UATA 2L3RA 1JBMA 2YRDA 3G4SQ 4DBFA 3M0RA 3H0HA 3SD4A 4C8QE 5KYXA 3TREA 2LTOA 1I8FA 4DBQA 1KC8C 3PTAA 3EH2A 1VQLA 2J05A 2QXFA 1RAAB 4M75G 3GIBA 4OMPA 5KCOA 1FXXA 5DM7R 2RA2A 5FW9A 1VQ5Q 4J9IA 4A53A 2EAYA 3OYEA 4PJOG 2HL3A 1M90C 4KGVB 5D6WA 4UC4A 4M7AC 3ASKA 2PTKA 4V2SA 2CUDA 3PT9A 2LQ8A 4PL6A 2CSQA 3BDLA 3CPWP 1YJWQ 2C0IA 1QKWA 3PNWC 4J9EA 4C92B 2P4RA 2QYZA 1PD1A 1D3BA 2SEMA 3R6NA 4FM4B 5AT1B 1Q81R 2RK1A 1LVKA 3OYDA 4M78G 1RACB 3A8HB 1RAHB 2LVMA 4QQGA 4XAXB 1NG2A 2X3WD 1ZQ1A 3CCRT 5A0LA 1U1TA 2HSEB 2JJ9A 4LDWA 1KD1C 2GQVA 2QQRA 5FRNA 5CCAA 5IAYA 3OMGA 2E3HA 3NPFA 2CUBA 2CYZB 2EW3A 2L3PA 2KYMA 4PK4A 1WHLA 3CC2A 3L2UA 3MCAB 4R0KA 1TXQA 1AWOA 2L0AA 1G3TA 2KI7A 4M75E 1VQ8T 3JV3A 5DY9A 3VS1A 3MEWA 1UUEA 4KBMB 1MGQA 2AT1B 3UF4A 2FYKA 4PJOE 3MP8A 3QZ5B 1WQ7A 4JJCA 3EG2A 3LYIA 2EQUA 3CCRA 4MDXA 5FU7C 4M77F 3I35A 3INZA 3IQLA 2ENMA 2O31A 3C0CA 3JB9D 1WHGA 1X75C 4ATOA 1YI2T 4M78E 1NYGA 2E6NA 3RKXA 2YLBA 3E9GA 2KGTA 1QVPA 2XDBA 3HPWA 3OBWA 4J6YA 3V7CA 1VQ8A 1OPKA 2XU8A 2YUQA 1VQOA 4LDXA 4M7DE 1D09B 2AZSA 4XTZA 2FPDA 3JCMb 5LJ5d 1JJ2P 2KDSA 2F69A 2EGEA 3CCLT 1Z9QA 2XKOC 3LH0A 4HT9A 4D8DA 4A4GA 1VQ6Q 4F16A 1TG0A 2DX1A 2GCXA 2K79A 2JTFA 2W10A 3A5ZB 3L2ZA 4CC2A 2DPPB 1PCXA 4F04B 2E5KA 1DJ7B 3QHSA 3TQ7P 1JO8A 2LZ6B 2DXCA 2KXDA 3OYIA 2DA9A 2RHIA 3D7SB 5GANf 1VA7A 3QSUA 5HK0A 1VQ5T 1YNZA 5GAN7 2LQWA 2PU9B 4JRIA 1UDLA 2O01E 1K73R 2HCKA 4L59A 4QW2A 2MAMA 3QJ6A 5HKCA 1UGRB 3NTKA 2RHZA 2KROA 1VYVA 2ZCFB 3RR6A 4E47A 1PM3A 3C94A 3NTIA 3WXMB 1CKBA 2DXBA 4EDUA 3CC7Q 3V7RA 3CCUT 2AHJB 1PC0A 4J9CA 3H8ZA 1T3SA 3DB3A 2QQSA 1KC8R 4IUPA 4ESRA 3V8KA 1C6VX 2DFUA 1M90U 3ME9A 3H41A 5LJ3j 1YJ9T 3OMCA 3CCRQ 2KVQG 4M75B 1IHVA 1WA7A 4PJOC 1OEBA 4WF2A 1UGSB 4VUBA 3KFVA 2FPFA 2L3QA 3OS5A 4M78C 2QDLA 1WXUA 3SHWA 2J06A 3A98A 2XDDA 1ZUKA 4RTVA 3FJ5A 1WFWA 1GXIE 1ZA1B 2P0KA 1VQ6A 2A36A 3OW2P 4MZPA 3OB9A 1VQMT 2K4YA 5GAOp 3I5RA 4RKUE 2DZCA 1JRIA 1WHMA 1J3TA 1M1KC 2O88A 3CBOA 4M75C 3CD6Q 1BYMA 2R57A 1Y96A 3TCJA 1NLOC 3JCMe 4MDWA 3I9QA 4M77G 4XU2A 4C92C 4IIMA 2OI3A 5LJ5g 3G71T 2DVJA 5CR2A 2CP3A 2DF6A 1TTHB 1AEYA 4Y92A 1AWXA 2BZYA 1D0YA 1H641 4E7HA 1KK7A 3VU3C 4C5GA 1X6BA 4J8OA 2IVWA 3X20B 3KXTA 3CPFA 2OX7A 2YXYA 5KYYB 4C92D 2OTJA 3CC2T 4B9XA 3UT1A 4J7FA 4AFSC 4C8QA 1BI1A 2OTLQ 2HDAA 5AYFA 4FU6A 3JB9J 2QG9B 1WLPB 5GAMj 3G4ST 3I56Q 2KE9A 1UHFA 1WYXA 5GAMg 2RQUA 3CC2Q 1Q7YC 3VV0A 3SWNA 4PJLA 2KEAA 1C0MA 1QP3A 3QBYA 5GAN6 4FCYA 4PFOA 4J7IA 2RO0A 2ZPBB 3RMQA 4QVZA 3DLMA 1PSEA 2DL8A 4KULA 4ZTFA 2KAFA 3PIOA 3CCJQ 4BDZA 2A7YA 2JMCA 2DEQA 1XNIA 2K57A 2MMPA 3DLLA 1VOMA 3JRZA 3QXEB 2FRWA 5IN1A 1YBYA 3L2RA 3TEEA 3HKSA 4EMKB 4F7UE 4AFZC 3WVEB 2CT4A 4BI3A 4C0ZA 3MHXA 2EYZA 2E1HA 4OMOA 2DD5A 2ROLA 1VUBA 2YDLA 3RKWA 3FC3A 2ZPIB 1YITQ 2AKKA 3M0PA 3I55T 3G4SA 3JCMP 1W2BP 4HVVA 2DXTA 1YJ9Q 2NUPB 4F7UA 1VQPA 5GAMf 4IIOA 1K73C 5CKHA 3CCQQ 1QQJA 3M55A 5CIUA 1H8KA 1VQOQ 2FZKB 1KD1R 4M7AF 1S72A 1V29B 2DIQA 5FWBA 2ZPGB 3V8LA 3M58A 2DJQA 4LE9A 1IGQA 3O5ZA 4LN2A 2DKGA 1X27A 5KYUB 2HAXA 2ED1A 2KR3A 5GMKi 1I5LA 1VQLQ 2B8AA 2JMAA 4ZN1A 3I55A 1Q95G 3MP6A 3EGDA 1D1BA 2E4HA 4ANJA 2FZCB 5D6XA 2JTMA 2EYXA 1E6GA 1M1KU 2O2OA 2HQEA 2PNIA 5IHNA 1HD3A 5LJ5j 3M57A 1YJNQ 3QKJA 2DILA 3CMET 1P92A 5J39A 1UFFA 1K8AC 1RABB 3UWNA 1M8MA 4PJOB 4IKFA 3EHQA 1M2VB 2J6FA 4BUGA 3LGFA 2NUTB 1CKAA 2DTIA 1OYXA 4PKCC 2V8IA 2K2MA 1I1JA 2KT8A 3GBQA 2DETA 1AHJB 4OMMA 2DL7A 2HBWA 4DEXA 2XI9A 3P8DA 2O9VA 1M1KR 4C0DC 4X1VA 1Q82U 1RAIB 5IXFA 2RI3A 3EGUA 5LJ3f 3Q1JA 3CMEA 2JM9A 1QW1A 1N9SA 2YT6A 1K9MC 5LJ5h 1KQ2A 1JB0E 2IG0A 1SHGA 2FL7A 4ZGEB 4PJMA 4QKUA 1JEGA 2GTJA 4B6MA 1QVGA 3NHNA 1VQKA 2QDYB 3OBYA 4C8QF 4BE0A 2QK0A 3CC7A 1B34A 1SSHA 1A0NB 1K9MR 1N9RA 2JN0A 3M0QA 2DRKA 2DYIA 1YWOA 2FG0A 1MUZA 2CZ6B 2FEIA 2RQWA 3L1AA 1MMDA 2COWA 1QWFA 5GAOl 1KG1A 2OTJT 2DE0X 3I55Q 1BKBA 1Y96B 3LWIA 3E9FA 2E64A 2MF2A 3SWNC 3PVQA 1W70A 2KYBA 4LUDA 2KY9A 3OS0A 5GAMh 1K73U 2DIGA 1VQ7T 4F7UF 5GAMd 4M7AG 2P4TA 2ZGWA 4X9CA 4DBRA 2K2VA 1X43A 2CZ0B 2J6KA 2RK2A 2D1XA 2DL5A 1KSWA 3JSCA 4M4ZA 3GOXA 3CC7T 3CMAT 3OY9A 1YIJQ 2DD4A 2LJ1A 1B7TA 3JCMf 2GQIA 2CGHA 2CZ7B 3PGGA 1ZX6A 2HKNA 4M7DC 1FMVA 4J9DA 4BY6B 2ZAEA 1XJWB 3M59A 3EH1A 1QCFA 4XK8E 4M78B 5J3BA 3EG9B 2VB6A 4MMLA 3VUZA 1SEMA 4Z88A 1G83A 4ELZC 1WDXA 1EZZB 2LRQA 4OMFB 2OAUA 3N5BB 4IUQA 4GBQA 3QPHA 2FVUA 3T9NA 5CKDA 1AT1B 2XK0A 1NJIC 3CCVQ 2JW4A 1ABQA 3UA6A 2QEXA 1OX9A 4RTXA 4M75F 1M5Q1 1YCYA 2LNHB 4FYXB 2KMTA 2ABLA 1ZLMA 3VRYA 2K5LA 4JLIA 4L6V5 1ZUYA 3G1JA 2F2XA 3C4SA 2DERA 1RAFB 4OB2B 5HCKA 2RJCA 3HHTB 1PWTA 2KXCA 4OB1B 3CCET 3HRSA 1OZ2A 3LH5A 1U3OA 4LUEA 1G2BA 3EG0A 3JB9I 1K8AU 3CCMQ 5GJVB 4LDYA 5CKBA 1KHIA 1SPKA 2VUBA 3CBMA 2D6FA 5LJ5f 2KK4A 3THKA 3M9QA 2QEXT 3DKMA 2E65A 1SHFA 1UB4A 1BBZA 4RTYA 2LC4A 2RN8A 1U5SA 3X25B 2RMOA 2EKOA 2EQIA 1SRMA 3A8GB 5GJWB 2LCLA 1K9AA 3KUFA 2CH4W 2HD0A 3CEYA 4IUUA 1K0XA 2E5QA 1VQNT 1KIKA 4ELYC 4C0DB 3CCJT 4ZGDB 3ER0A 4BI8B 4A63B 3CCSQ 1NE8A 3OYFA 4JJNK 3TVTA 2HL5C 3OA6A 4C0FA 2VV5A 3OW2A 4AMCA 3CMAQ 2JS0A 1AWJA 2VC8A 4XTYA 2DEUA 3JB9F 2YSQA 4OF1A 3RIRA 3MEUA 2CP0A 2HSPA 2DL3A 2HQXA 1M3BA 2M1HA 2ATCB 4BE2A 2YHTA 3ZFJA 5FWCA 1NJIR 1ZHIA 4FL6A 1M8VA 2G6FX 2COZA 4PFZA 4HCBA 1PRLC 1K4US 3SWNB 2YRCA 2H3JA 2LQNA 2VXEA 1BI2A 2JZ2A 1JQQA 4FIBA 2K3XA 2G3RA 2Y4XA 4HA8A 1IXDA 1YI2Q 5CKFA 1KHCA 1NYFA 2F5KA 3RNJA 1Y0MA 1I0CA 1GRIA 1O9SA 2ZPFB 2JVVA 2Y90A 3JCMJ 4RTUA 3M4YA 2MOXA 2RI5A 4BY6C 2C06A 5J26A 1W1FA 1SKUB 2DL4A 1D1CA 3LW5E 1Q82C 4M77A 1VYTA 1G3WA 2M51A 2SRCA 2GGRA 1UGPB 3UDCA 5GAOm 4BDYA 5CQYA 3CPWS 1MHNA 4JJDA 3CCUQ 4MMKA 4M7DG 1KJWA 4A54A 2QQAA 1VYUA 5I11A 3TSWA 2X9HA 5GMKm 2YUNA 1OX8A 2E3IA 3GPLA 2AZVA 3CBPA 4OMQA 1ZBJA 1KD1U 3QG1A 5GAMe 3OYMA 3J81E 3J7AF 3OSVA 4IUVA 3TU4K 2DBKA 1WX6A 3EFOB 4BE1A 1UHCA 2A37A 1S72T 2P0QA 3SDZA 1QVFA 1AZGB 4C8QC 4FW2A 1UE9A 3EFRA 2D9TA 2F2VA 3ZL7C 3OYKA 1Q7YR 1RL2A 4C92E 3BY7A 4M77C 3H6ZA 1NPPA 2VGNA 1GBQA 3L42A 4HCZA 1BI3A 3OYBA 1VQOT 1Q86U 1I81A 1QKXA 3E19A 1U8RA 2NUTA 3GNGA 3UA7A 2F1LA 2QGGA 4NS5A 2YUOA 2RF0A 3M0UA 3NMZC 1E7OA 2FB7A 2L3SA 1O75A 2COYA 5KYYA 1I07A 3G71Q 2QTXA 2PVOB 3RDVA 4JRKA 4C8QB 4OMNA 2H3EB 1EFNA 1YHQA 3L2VA 2XHCA 5GANj 1N8RU 3CD6T 3A8OB 1VQNA 1YIJT 4AFQC 5LJ3h 3CCJA 4XQ3A 2K5FA 3M53A 3EAEA 2JUFA 1IHWA 4XU1A 2HMAA 2X3XD 1AOJA 2OAWA 3S3OA 4PLLA 1UGQB 2QI2A 3RESA 5CVIA 1OV3A 3OYHA 2XIDA 3CCVT 2O4XA
chains in the Genus database with same CATH topology
2C0IA 1QKWA 4Z8AA 4J9EA 1BU1A 2J6OA 2MIOA 1SHGA 2P4RA 1K76A 2DNUA 1MV0B 2OJ2A 2SEMA 1GFCA 1FMKA 3R6NA 1JEGA 2GTJA 2GTOA 2M0YA 1AWWA 4CC7A 3NHNA 1T0HA 2DRMA 5I22A 1NG2A 1NEGA 2X3WD 1SSHA 4WCIA 1A0NB 1FYNA 4ORZA 3M0QA 4F17A 2DRKA 1YWOA 4K11A 2FG0A 1MUZA 3NPFA 2FEIA 2CUBA 2I0NA 2RQWA 5EC7A 2EW3A 1QWFA 2L3PA 4AG2C 2KYMA 2EKHA 2DE0X 2K9GA 4R0KA 2CSIA 1M3CA 2LX7A 1AWOA 4ZNXA 2L0AA 1T0JA 3VS3A 2IIMA 3JV3A 3VS1A 1LCKA 1UUEA 3PVQA 1W70A 2KYBA 4LUDA 3UF4A 1JXMA 2FPEA 2A28A 4JJCA 1H92A 4CC4B 1X43A 2J6KA 1K1ZA 2RQTA 3EG2A 2D1XA 1X69A 2CDTA 1SRLA 2DL5A 1KSWA 1NLPC 1PKSA 4M4ZA 3RBBB 4AG1C 3I35A 1QWEA 3IQLA 2LJ1A 2FRYA 2ENMA 2O31A 2GQIA 3C0CA 3REAB 2EBPA 2K6DA 4HVWA 1ZX6A 1NYGA 4J9DA 2KGTA 2JTEA 3VS7A 2CT3A 2RQRA 2KRNA 1RLPC 1OPKA 2YUQA 2C0TA 1QCFA 2L2PA 2AZSA 3PVLA 2FPDA 4GLMA 1GBRA 1IO6A 2EGEA 1SEMA 1Z9QA 1N5ZA 1G83A 4Z88A 1WDXA 2NWMA 4D8DA 1XOVA 2XMFA 3VS0A 4F16A 1TG0A 2DX1A 1JU5C 1YCSB 4GBQA 2K79A 2W10A 2J7IA 1ABOA 1UG1A 2DBMA 4CC2A 3REBB 1M30A 2JT4A 2JW4A 1ABQA 3UA6A 2V1RA 2EGCA 2E5KA 4RTXA 1JO8A 1ZSGA 2LZ6B 1YWPA 2KXDA 4EIKA 2D8HA 2LNHB 2EVRA 2DA9A 1X2QA 2ABLA 1ZLMA 1VA7A 1Z9ZA 4KRTA 3VRYA 2EYYA 1YNZA 2LQWA 1ZUYA 2F2XA 2RQVA 1UDLA 2K3BA 2HCKA 2B86A 5HCKA 1RI9A 2KRMA 1PWTA 2KXCA 2KROA 1VYVA 1GFDA 1CKBA 3LH5A 1U3OA 4D8KA 4LUEA 1G2BA 4JPBW 4J9CA 3EG0A 1T3SA 1GL5A 4JJBA 5GJVB 4ESRA 2VVKA 1SPKA 2DLPA 2DYBA 1H3HA 4J9GA 3H41A 1B3QA 1T3LA 3THKA 1WA7A 1SHFA 1OEBA 1BBZA 4RUGA 3KFVA 2RN8A 4RTYA 2FPFA 2FO0A 1PRMC 1U5SA 1Y57A 2CH4A 2L3QA 2RMOA 2EQIA 1SRMA 2QDLA 5GJWB 3U23A 1WXUA 3SHWA 2J06A 5IXBA 3VS2A 1YN8A 1K0SA 1K9AA 3A98A 1WXTA 1U06A 1GCQC 1ZUKA 2CH4W 2GBQA 4RTVA 3FJ5A 1WI7A 3CQTA 3VS5A 1WFWA 1K0XA 2DM1A 1KIKA 1GCQA 2A36A 1X2KA 1TUDA 2JS2A 4DEYA 4OMLA 4A63B 2YUPA 3I5RA 4J9FA 3TVTA 1M3AA 3H0FA 1UJYA 1J3TA 1PHTA 2O88A 1UJ0A 1W6XA 1NLOC 1OOTA 2DMOA 3I9QA 2BZ8A 1WXBA 4IIMA 2JS0A 1AWJA 2KT1A 2OI3A 4JZ3A 1AVZC 4E6RA 2YSQA 2DVJA 1V1CA 2DF6A 1AEYA 1JXOA 2HSPA 4Y92A 2DL3A 1AWXA 3M0SA 3M0TA 2BZYA 1M3BA 4JZ4A 2NUZA 1X6BA 5FWCA 2A08A 4LNPA 5L23A 1PKTA 2G6FX 1BB9A 3TSZA 3EG1A 2AK5A 4AFSC 2H8HA 1KFZA 2CREA 1PRLC 1B07A 1K4US 1QLYA 2HDAA 2LQNA 2KRSA 1HJDA 1JQQA 2W0ZA 1NEBA 1WLPB 2LJ0A 2JXBA 2KE9A 4RTZA 1UHFA 3NGPA 1WYXA 2RQUA 1UTIA 1YP5A 2KEAA 3VRZA 3EG3A 1ARKA 1NYFA 2DL8A 3VS4A 3I5SA 3RNJA 2JMCA 2BZXA 2PZ1A 1Y0MA 2MCNA 1I0CA 1GRIA 2GNCA 4CC3A 1AD5A 3H0IA 1GCPA 2FRWA 2EGAA 2LMJA 1M27C 4AFZC 3PE0A 4RTUA 2RNAA 1TUCA 2CT4A 2MOXA 2EYZA 2EPDA 1W1FA 4OMOA 2C0OA 2DL4A 2ROLA 2YDLA 2AKKA 3M0PA 1AZEA 1VYTA 4RTWA 4HCKA 2M51A 2SRCA 1RLQC 2GGRA 4HVVA 2K7AA 4RTTA 2BTTA 2V1QA 2EYWA 4JJDA 5IHIA 2ECZA 3QWXX 3ULRB 4IIOA 2D8JA 1KJWA 2KNBB 4HVUA 1VYUA 1H8KA 5I11A 3TSWA 2YUNA 1OPLA 5IHKA 5FWBA 1WIEA 2AZVA 2AKLA 4OMQA 2DJQA 1ZBJA 3VS6A 4LE9A 3O5ZA 2LCSA 4LN2A 2F2WA 3SEMA 1E6HA 1X27A 2O9SA 1X6GA 2DBKA 1WX6A 4AFUC 2ED1A 3EHRA 2KR3A 1HSQA 1UHCA 2A37A 4J9BA 4J9HA 3QWYA 1MV3A 4F14A 1AZGB 2JMAA 1UE9A 2LP5A 4QT7A 2F2VA 2ED0A 3ZL7C 2EYXA 2ROTA 1E6GA 2O2OA 2PNIA 5IHNA 1HD3A 1GBQA 2KBTA 2DILA 2ESWA 1S1NA 1CSKA 2JM8A 2HEQA 1QKXA 1ZUUA 5IH2A 1UFFA 4FSSA 1M8MA 1BK2A 3UA7A 1PNJA 2YUOA 2D0NA 2RF0A 3M0UA 1NM7A 3UATA 5ECAA 3NMZC 3EHQA 2J6FA 1E7OA 2LJ3A 2L3SA 2RPNA 1RUWA 3M0RA 1I07A 3H0HA 1CKAA 1UGVA 4OMNA 2K2MA 2VKNA 1EFNA 1I1JA 2J05A 4OMPA 2KT8A 3GBQA 2VWFA 4AFQC 5FW9A 1UECA 4OMMA 4J9IA 2DL7A 2HBWA 4DEXA 2O9VA 4X1VA 2X3XD 4HXJA 1AOJA 5IXFA 2OAWA 3EGUA 2PTKA 2CUDA 2JM9A 4Z89A 1OV3A 2YT6A 2CSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0I A;  1QKW A;  4Z8A A;  4J9E A;  1BU1 A;  2J6O A;  2MIO A;  1SHG A;  2P4R A;  1K76 A;  2DNU A;  1MV0 B;  2OJ2 A;  2SEM A;  1GFC A;  1FMK A;  3R6N A;  1JEG A;  2GTJ A;  2GTO A;  2M0Y A;  1AWW A;  4CC7 A;  3NHN A;  1T0H A;  2DRM A;  5I22 A;  1NG2 A;  1NEG A;  2X3W D;  1SSH A;  4WCI A;  1A0N B;  1FYN A;  4ORZ A;  3M0Q A;  4F17 A;  2DRK A;  1YWO A;  4K11 A;  2FG0 A;  1MUZ A;  3NPF A;  2FEI A;  2CUB A;  2I0N A;  2RQW A;  5EC7 A;  2EW3 A;  1QWF A;  2L3P A;  4AG2 C;  2KYM A;  2EKH A;  2DE0 X;  2K9G A;  4R0K A;  2CSI A;  1M3C A;  2LX7 A;  1AWO A;  4ZNX A;  2L0A A;  1T0J A;  3VS3 A;  2IIM A;  3JV3 A;  3VS1 A;  1LCK A;  1UUE A;  3PVQ A;  1W70 A;  2KYB A;  4LUD A;  3UF4 A;  1JXM A;  2FPE A;  2A28 A;  4JJC A;  1H92 A;  4CC4 B;  1X43 A;  2J6K A;  1K1Z A;  2RQT A;  3EG2 A;  2D1X A;  1X69 A;  2CDT A;  1SRL A;  2DL5 A;  1KSW A;  1NLP C;  1PKS A;  4M4Z A;  3RBB B;  4AG1 C;  3I35 A;  1QWE A;  3IQL A;  2LJ1 A;  2FRY A;  2ENM A;  2O31 A;  2GQI A;  3C0C A;  3REA B;  2EBP A;  2K6D A;  4HVW A;  1ZX6 A;  1NYG A;  4J9D A;  2KGT A;  2JTE A;  3VS7 A;  2CT3 A;  2RQR A;  2KRN A;  1RLP C;  1OPK A;  2YUQ A;  2C0T A;  1QCF A;  2L2P A;  2AZS A;  3PVL A;  2FPD A;  4GLM A;  1GBR A;  1IO6 A;  2EGE A;  1SEM A;  1Z9Q A;  1N5Z A;  1G83 A;  4Z88 A;  1WDX A;  2NWM A;  4D8D A;  1XOV A;  2XMF A;  3VS0 A;  4F16 A;  1TG0 A;  2DX1 A;  1JU5 C;  1YCS B;  4GBQ A;  2K79 A;  2W10 A;  2J7I A;  1ABO A;  1UG1 A;  2DBM A;  4CC2 A;  3REB B;  1M30 A;  2JT4 A;  2JW4 A;  1ABQ A;  3UA6 A;  2V1R A;  2EGC A;  2E5K A;  4RTX A;  1JO8 A;  1ZSG A;  2LZ6 B;  1YWP A;  2KXD A;  4EIK A;  2D8H A;  2LNH B;  2EVR A;  2DA9 A;  1X2Q A;  2ABL A;  1ZLM A;  1VA7 A;  1Z9Z A;  4KRT A;  3VRY A;  2EYY A;  1YNZ A;  2LQW A;  1ZUY A;  2F2X A;  2RQV A;  1UDL A;  2K3B A;  2HCK A;  2B86 A;  5HCK A;  1RI9 A;  2KRM A;  1PWT A;  2KXC A;  2KRO A;  1VYV A;  1GFD A;  1CKB A;  3LH5 A;  1U3O A;  4D8K A;  4LUE A;  1G2B A;  4JPB W;  4J9C A;  3EG0 A;  1T3S A;  1GL5 A;  4JJB A;  5GJV B;  4ESR A;  2VVK A;  1SPK A;  2DLP A;  2DYB A;  1H3H A;  4J9G A;  3H41 A;  1B3Q A;  1T3L A;  3THK A;  1WA7 A;  1SHF A;  1OEB A;  1BBZ A;  4RUG A;  3KFV A;  2RN8 A;  4RTY A;  2FPF A;  2FO0 A;  1PRM C;  1U5S A;  1Y57 A;  2CH4 A;  2L3Q A;  2RMO A;  2EQI A;  1SRM A;  2QDL A;  5GJW B;  3U23 A;  1WXU A;  3SHW A;  2J06 A;  5IXB A;  3VS2 A;  1YN8 A;  1K0S A;  1K9A A;  3A98 A;  1WXT A;  1U06 A;  1GCQ C;  1ZUK A;  2CH4 W;  2GBQ A;  4RTV A;  3FJ5 A;  1WI7 A;  3CQT A;  3VS5 A;  1WFW A;  1K0X A;  2DM1 A;  1KIK A;  1GCQ A;  2A36 A;  1X2K A;  1TUD A;  2JS2 A;  4DEY A;  4OML A;  4A63 B;  2YUP A;  3I5R A;  4J9F A;  3TVT A;  1M3A A;  3H0F A;  1UJY A;  1J3T A;  1PHT A;  2O88 A;  1UJ0 A;  1W6X A;  1NLO C;  1OOT A;  2DMO A;  3I9Q A;  2BZ8 A;  1WXB A;  4IIM A;  2JS0 A;  1AWJ A;  2KT1 A;  2OI3 A;  4JZ3 A;  1AVZ C;  4E6R A;  2YSQ A;  2DVJ A;  1V1C A;  2DF6 A;  1AEY A;  1JXO A;  2HSP A;  4Y92 A;  2DL3 A;  1AWX A;  3M0S A;  3M0T A;  2BZY A;  1M3B A;  4JZ4 A;  2NUZ A;  1X6B A;  5FWC A;  2A08 A;  4LNP A;  5L23 A;  1PKT A;  2G6F X;  1BB9 A;  3TSZ A;  3EG1 A;  2AK5 A;  4AFS C;  2H8H A;  1KFZ A;  2CRE A;  1PRL C;  1B07 A;  1K4U S;  1QLY A;  2HDA A;  2LQN A;  2KRS A;  1HJD A;  1JQQ A;  2W0Z A;  1NEB A;  1WLP B;  2LJ0 A;  2JXB A;  2KE9 A;  4RTZ A;  1UHF A;  3NGP A;  1WYX A;  2RQU A;  1UTI A;  1YP5 A;  2KEA A;  3VRZ A;  3EG3 A;  1ARK A;  1NYF A;  2DL8 A;  3VS4 A;  3I5S A;  3RNJ A;  2JMC A;  2BZX A;  2PZ1 A;  1Y0M A;  2MCN A;  1I0C A;  1GRI A;  2GNC A;  4CC3 A;  1AD5 A;  3H0I A;  1GCP A;  2FRW A;  2EGA A;  2LMJ A;  1M27 C;  4AFZ C;  3PE0 A;  4RTU A;  2RNA A;  1TUC A;  2CT4 A;  2MOX A;  2EYZ A;  2EPD A;  1W1F A;  4OMO A;  2C0O A;  2DL4 A;  2ROL A;  2YDL A;  2AKK A;  3M0P A;  1AZE A;  1VYT A;  4RTW A;  4HCK A;  2M51 A;  2SRC A;  1RLQ C;  2GGR A;  4HVV A;  2K7A A;  4RTT A;  2BTT A;  2V1Q A;  2EYW A;  4JJD A;  5IHI A;  2ECZ A;  3QWX X;  3ULR B;  4IIO A;  2D8J A;  1KJW A;  2KNB B;  4HVU A;  1VYU A;  1H8K A;  5I11 A;  3TSW A;  2YUN A;  1OPL A;  5IHK A;  5FWB A;  1WIE A;  2AZV A;  2AKL A;  4OMQ A;  2DJQ A;  1ZBJ A;  3VS6 A;  4LE9 A;  3O5Z A;  2LCS A;  4LN2 A;  2F2W A;  3SEM A;  1E6H A;  1X27 A;  2O9S A;  1X6G A;  2DBK A;  1WX6 A;  4AFU C;  2ED1 A;  3EHR A;  2KR3 A;  1HSQ A;  1UHC A;  2A37 A;  4J9B A;  4J9H A;  3QWY A;  1MV3 A;  4F14 A;  1AZG B;  2JMA A;  1UE9 A;  2LP5 A;  4QT7 A;  2F2V A;  2ED0 A;  3ZL7 C;  2EYX A;  2ROT A;  1E6G A;  2O2O A;  2PNI A;  5IHN A;  1HD3 A;  1GBQ A;  2KBT A;  2DIL A;  2ESW A;  1S1N A;  1CSK A;  2JM8 A;  2HEQ A;  1QKX A;  1ZUU A;  5IH2 A;  1UFF A;  4FSS A;  1M8M A;  1BK2 A;  3UA7 A;  1PNJ A;  2YUO A;  2D0N A;  2RF0 A;  3M0U A;  1NM7 A;  3UAT A;  5ECA A;  3NMZ C;  3EHQ A;  2J6F A;  1E7O A;  2LJ3 A;  2L3S A;  2RPN A;  1RUW A;  3M0R A;  1I07 A;  3H0H A;  1CKA A;  1UGV A;  4OMN A;  2K2M A;  2VKN A;  1EFN A;  1I1J A;  2J05 A;  4OMP A;  2KT8 A;  3GBQ A;  2VWF A;  4AFQ C;  5FW9 A;  1UEC A;  4OMM A;  4J9I A;  2DL7 A;  2HBW A;  4DEX A;  2O9V A;  4X1V A;  2X3X D;  4HXJ A;  1AOJ A;  5IXF A;  2OAW A;  3EGU A;  2PTK A;  2CUD A;  2JM9 A;  4Z89 A;  1OV3 A;  2YT6 A;  2CSQ A; 
#chains in the Genus database with same CATH topology
 1D0Z A;  3HP9 A;  3VJP A;  2MIO A;  2J6O A;  2MWO A;  4QVD A;  4B9W A;  1MV0 B;  2OJ2 A;  2HQH A;  2XDP A;  1GFC A;  1FMK A;  2GTO A;  1TU0 B;  1AWW A;  4NOY A;  2A3L A;  4CC7 A;  2DRM A;  3V7S A;  1NEG A;  5KH6 A;  2P0P A;  5CKE A;  3G6E T;  1NPR A;  4EMK C;  1YHQ T;  4J6W A;  3CD6 A;  4LDU A;  2MWP A;  2P84 A;  4K11 A;  2I0N A;  5EC7 A;  1VQK T;  3A8M B;  2DVE A;  2WSF E;  4DBH A;  4AG2 C;  2EKH A;  3GNF B;  4M7D B;  4N4H A;  2CSI A;  1Q86 C;  4YTL A;  2Z0W A;  4ZNX A;  5LJ3 d;  5DLO A;  2IIM A;  1LCK A;  1IRX A;  2RJF A;  3QDF A;  2R58 A;  1VQ6 T;  1JXM A;  2FPE A;  1I5O B;  3A1P A;  4M78 F;  1VQM A;  1H92 A;  4CC4 B;  1R8O B;  2L89 A;  1BI0 A;  1K1Z A;  2RQT A;  5KE3 A;  2R5A A;  5KCH A;  2CKK A;  1X69 A;  1TS9 A;  5KYU A;  1SRL A;  4AG1 C;  2EQM A;  1QWE A;  1WHK A;  2FRY A;  4L5G A;  3REA B;  4FT2 A;  1N8R R;  1YIT T;  4HVW A;  1PD0 A;  1WHH A;  2OTJ Q;  1OU8 A;  2K5I A;  2JTE A;  3VS7 A;  1JJ2 A;  2KRN A;  1LOJ A;  4LXC A;  1RLP C;  4C92 F;  3QZ9 B;  2C0T A;  4PFP A;  3OYG A;  4KH1 B;  4GLM A;  3UPU A;  4II1 A;  1VQ7 Q;  5A2Q E;  4F7U G;  5FU6 C;  2LDM A;  2QTV A;  1Q81 C;  1N8R C;  5HK3 A;  2DK3 A;  1ZSZ A;  1M1F A;  1XOV A;  4AT1 B;  1YJN T;  4MZT A;  2J7I A;  3LLR A;  1FX7 A;  2DBM A;  1M30 A;  1YIT A;  1HXD A;  2EGC A;  2PVG B;  1ZSG A;  2CP6 A;  1YWP A;  4EIK A;  5GAO q;  2EVR A;  1WNL A;  3PMT A;  4QQD A;  1X2Q A;  3GLX A;  1X6O A;  4KRT A;  1MMN A;  1W2B S;  3EGX A;  1VQ4 T;  3ZBD A;  3CCQ A;  3JCM c;  4M7A B;  2B86 A;  1VIF A;  3F70 A;  1RI9 A;  5L8R E;  3SFM A;  3E1S A;  2QA4 T;  3P8B B;  8AT1 B;  5FRO A;  2X51 A;  4JPB W;  5KYN A;  4A4F A;  4JJB A;  1YJN A;  1N27 A;  2K3Y A;  2VVK A;  1M2O A;  1KC8 U;  2DLP A;  2DYB A;  4C8Q G;  1H3H A;  1B34 B;  1B3Q A;  1T3L A;  1PSF A;  2KSS A;  5HY6 A;  4RCC A;  5D7U A;  4JDS A;  4RG2 A;  3EFO A;  1VQP T;  1QVG S;  3C95 A;  4E2F B;  3PIP A;  2MK5 A;  2FO0 A;  4M7A D;  2QGF B;  1Y57 A;  1NBE B;  3OW2 S;  3U23 A;  4XTU A;  1TUG B;  5IXB A;  3VS2 A;  1YN8 A;  1VQ4 A;  4WTO B;  5KYW B;  4EPC A;  3OSS C;  2QQB A;  1LPL A;  3CQT A;  3VS5 A;  2DM1 A;  3SB2 A;  3OYL A;  1QCO A;  5GAN 8;  3CCE Q;  1YIJ A;  3LWH A;  1Y7X A;  4E7J A;  1ACM B;  2YUP A;  2X4J A;  1ZBX A;  1R0B G;  3OYN A;  2RH2 A;  2ZPE B;  3H0F A;  3AT1 B;  4CI0 C;  2DMO A;  2BZ8 A;  2XG8 D;  3A8L B;  4FYW B;  2DTH A;  2CP2 A;  4N4G A;  1AVZ C;  4E6R A;  1S72 Q;  1V1C A;  2VAS A;  4OP0 A;  4XU0 A;  2DZ9 A;  2E12 A;  2M02 A;  1JXO A;  4NL2 A;  3M0T A;  1IRE B;  3RER A;  2NUZ A;  3GF5 A;  3FIF A;  1NJI U;  2A08 A;  4LNP A;  3CCS T;  1BB9 A;  1G3S A;  1TWB A;  3EG1 A;  3X26 B;  2RHY A;  2AK5 A;  6AT1 B;  3AHU A;  4J83 A;  1WPY A;  2CRE A;  3FEO A;  3MKD A;  3HL8 A;  1H3Z A;  4DA4 A;  5A0G A;  2LJ0 A;  2BUD A;  5CAI A;  2JXB A;  1W2B A;  2NLU A;  2WSE E;  3QO3 A;  1YP5 A;  2YWW A;  3VRZ A;  1V76 A;  3EG3 A;  1ARK A;  2F5T X;  4C8Q D;  1VQ8 Q;  5CQX A;  1OI1 A;  4M75 D;  3I5S A;  1VQ5 A;  2BZX A;  4M77 E;  1I4K 1;  2MCN A;  5GAO r;  2GFA A;  2D0Q B;  4CC3 A;  3M4G A;  2DJZ A;  2EGA A;  2CP5 A;  3FLG A;  2EQJ A;  4LDV A;  1N6A A;  3PE0 A;  3CC4 Q;  4RG8 A;  2CP7 A;  2LT1 A;  3CCU A;  2L8D A;  3CXC P;  3ZEH A;  2C0O A;  3P8H A;  3JCM Q;  4N0A C;  2EQK A;  2QQ9 A;  3FB9 A;  3QII A;  4M78 D;  1KQ1 A;  4HKE A;  4RTW A;  4HCK A;  3KBG A;  4IUR A;  4N4I A;  4X9D A;  3VKI A;  4FW1 A;  2BTT A;  2EYW A;  1QCN A;  1RAE B;  1KQS P;  4JLG A;  2ECZ A;  3ULR B;  1K8A R;  2VYT A;  1EIF A;  2KNB B;  3LGL A;  3MEV A;  1VQ7 A;  5IHK A;  2NYS A;  1WIE A;  3CXC A;  2ZZD A;  4QVC A;  2QEX Q;  3VS6 A;  2RJE A;  3SEM A;  2O9S A;  2GFU A;  3JCM V;  5GMK e;  3CMA A;  2RD1 A;  3EHR A;  3OS1 A;  5CO7 A;  3CCM T;  4J9H A;  4GY5 A;  3M5A A;  1MV3 A;  4F14 A;  2RHX A;  3G6E Q;  2X4Y A;  3HSB A;  3L2W A;  1ZSZ B;  3DB4 A;  2HKQ B;  2JNG A;  2ROT A;  3BDU A;  2OTL A;  4ZGJ B;  1BIA A;  2HNI A;  2ESW A;  3JB9 G;  2AIR B;  1S1N A;  1QMC A;  4BAC A;  2ZPH B;  4FSS A;  1BK2 A;  1PNJ A;  4P5N A;  4R55 A;  1VQN Q;  2LJ3 A;  2RPN A;  3EGX B;  3MPU B;  1RUW A;  4M7A A;  1WQW A;  1QVF P;  3X24 B;  2GF7 A;  3NFC A;  4OGC A;  1UGV A;  3MP1 A;  4TVR A;  2VKN A;  1WHJ A;  3WVD B;  2M9U A;  3EG9 A;  4Q5W A;  1M9S A;  2VWF A;  1UEC A;  2M16 A;  5KYX B;  3RMS A;  3S6W A;  2RM4 A;  4HXJ A;  2EJ9 A;  5C0M A;  4X34 A;  4IUT A;  5IT9 E;  1OZ3 A;  4Z89 A;  2LNV A;  1SF9 A;  1ZA2 B;  4JS4 A;  2PUK B;  1G3Y A;  4Z8A A;  1BU1 A;  3MO8 A;  9ATC B;  4C0G A;  3CCE A;  1K76 A;  2DNU A;  2EIF A;  5GAN 2;  1TH7 A;  1WZO A;  5I2M A;  1VQM Q;  5FRM A;  2V8J A;  2M0Y A;  3FRN A;  1X01 A;  4N0A A;  2E70 A;  2V26 A;  3S3M A;  1T0H A;  4C5I A;  4OVA A;  2IPO B;  5I22 A;  5LJ3 g;  1Y07 A;  2HBP A;  2PVD B;  5CK9 A;  4WCI A;  4R56 A;  4M7D A;  1FYN A;  4ORZ A;  4F17 A;  1QVF S;  2QAS A;  1F1B B;  1G8X A;  4PJO D;  4XU3 A;  3HRT A;  4RCB A;  1LNX A;  2PQW A;  4NL3 A;  3CCS A;  2E41 A;  3G6E A;  2K9G A;  1OQK A;  4E7S A;  3URG A;  2DTO A;  1IZ6 A;  1M3C A;  1PG5 B;  2LX7 A;  5DLQ E;  1T0J A;  3LX7 A;  2EJG A;  1EX4 A;  3VS3 A;  5GAO n;  1Q81 U;  5GMK h;  1RI0 A;  5FU7 B;  3OYC A;  5KE2 A;  2FZG B;  4C5H A;  3OS2 A;  2A28 A;  5GAN d;  1YI2 A;  3CPW A;  4LD9 K;  2BIV A;  2X35 A;  2LX9 A;  5GAN h;  4Y91 A;  2CDT A;  4JS5 A;  2QA4 Q;  4KT0 E;  2RB6 A;  1PKS A;  1NLP C;  3RBB B;  1Q82 R;  3OYA A;  3RUX A;  3E2U A;  4FT4 A;  2XD0 A;  1FMW A;  2CS7 A;  7AT1 B;  3JCM d;  2X4X A;  1OU9 A;  1RAG B;  2EBP A;  4PJO A;  3JB9 H;  2K6D A;  1YJW A;  1M2V A;  3FDR A;  3CCL A;  3NTH A;  3M56 A;  2CT3 A;  4BD3 A;  4CRI A;  2RQR A;  4GLK A;  4KUD K;  1RAD B;  2EFI A;  2L2P A;  3OYY A;  3PVL A;  2YRV A;  1GBR A;  4E7Z A;  4DOV A;  3BE3 A;  1IO6 A;  1XQH A;  4PJJ A;  1N5Z A;  2NWM A;  2XMF A;  1SG5 A;  3VS0 A;  1OUL A;  2RJD A;  1JU5 C;  3BW1 A;  1YCS B;  5GAN e;  1MND A;  4O6J A;  4PNO A;  1ABO A;  1UG1 A;  4KGX B;  3QYH B;  3VUB A;  3HFO A;  4M7D D;  1U1S A;  2MPX C;  3REB B;  2JT4 A;  2V1R A;  1D1A A;  1YJW T;  1TSF A;  3S3N A;  2VXF A;  2FHD A;  1MMA A;  2D8H A;  4D6W A;  4PJN A;  1HYO A;  1Z9Z A;  4FSX A;  1Q86 R;  2EYY A;  2RQV A;  2K3B A;  3X28 B;  2DXU A;  1SSF A;  2KRM A;  2WSC E;  3EFS A;  3QUI A;  2YLC A;  5I2S A;  2L5Q A;  1Q7Y U;  1GFD A;  4EMK A;  1M4Z A;  5GMK j;  4D8K A;  4XTV A;  1WJR A;  2RI2 A;  1GL5 A;  3CCQ T;  4ZN3 A;  4OB0 B;  4JRP A;  3HFN A;  5LJ3 e;  1WJS A;  4J9G A;  3JCM g;  3GP8 A;  2EJF A;  1K9M U;  5M9O A;  2QA4 A;  4E7L A;  3O8V A;  2E6Z A;  5KYW A;  3M54 A;  4DQ2 A;  1G5V A;  4RUG A;  2NUP A;  4F7U B;  4C92 A;  1Y71 A;  4BB7 A;  1PRM C;  2CH4 A;  3OYJ A;  1D3B B;  4HT8 A;  1VQ4 Q;  4M75 A;  1K0S A;  1WXT A;  4M77 B;  1U06 A;  1GCQ C;  1KQS A;  1VQL T;  2GBQ A;  1WI7 A;  1YHQ Q;  1GCQ A;  3QDR B;  1X2K A;  4A4K A;  1TUD A;  2JS2 A;  4DEY A;  4OML A;  3J80 E;  3HTR A;  2DO3 A;  1QVG P;  3PFS A;  1QP2 A;  4J9F A;  3CME Q;  2EYQ A;  3G71 A;  4M7D F;  1M3A A;  1ZSZ C;  2KQW A;  2QAZ A;  1UJY A;  5FLX E;  4QQ6 A;  1PHT A;  1M90 R;  1UJ0 A;  3EGD B;  4A4H A;  1W6X A;  4RMO A;  4E7K A;  1OOT A;  4M78 A;  3I56 T;  4C5E A;  1WXB A;  1M1G A;  2KT1 A;  4JZ3 A;  1VQK Q;  4JUV A;  3MET A;  3R6O A;  1R0C B;  2CZ1 B;  2MI6 A;  4O5V A;  3M0S A;  1FWZ A;  1BIB A;  4JZ4 A;  4Y28 E;  5I21 A;  4XTW A;  4EMG A;  3JCM h;  4HCC A;  3MEA A;  1D0X A;  1PKT A;  2M0O A;  3TSZ A;  5L23 A;  1WGS A;  4M7A E;  3QYG B;  1XTD A;  2H8H A;  3V8J A;  1KFZ A;  3G7Z A;  4PLI A;  3JCM W;  1B07 A;  5LJ5 e;  2HZY A;  1TOV A;  1QLY A;  4KGZ B;  4FYY B;  2KRS A;  1HJD A;  4PJO F;  2MYS A;  2JOY A;  4M77 D;  2W0Z A;  4A4E A;  1NEB A;  3H9N A;  4MZM A;  3MJX A;  4RTZ A;  3I56 A;  3NGP A;  3VYG A;  1IB8 A;  2XIC A;  1UTI A;  1W4S A;  5GAN g;  4Z02 A;  3FJP A;  2BKD N;  3RKY A;  1VIE A;  2LQK A;  2LCC A;  4ME7 A;  2A0F B;  3CXC S;  3CCV A;  1IGU A;  5A0D A;  2R5M A;  3VS4 A;  1VQ9 T;  3C12 A;  4JRQ A;  5EG2 A;  1R77 A;  2PZ1 A;  2LT4 A;  2GNC A;  3OQ5 A;  1AD5 A;  3H0I A;  4OGE A;  1GCP A;  1KQS S;  3VYH B;  1MNE A;  2V8K A;  5LL6 S;  4LD6 A;  2LMJ A;  1M27 C;  1VQ9 Q;  2RNA A;  1TUC A;  3CC4 A;  4C92 G;  2EPD A;  1UEB A;  4EMH A;  1C1A A;  4DOW A;  2O4X B;  5FU6 B;  5GAN 5;  1LJO A;  2BE9 B;  2WAC A;  3L2Q A;  1AZE A;  1JJ2 S;  1RLQ C;  1MMG A;  2K7A A;  4RTT A;  2V1Q A;  2I2L A;  2VGM A;  2PUO B;  5IHI A;  1BCM A;  3QWX X;  3BFM A;  2D8J A;  1VQ9 A;  4HVU A;  4BI4 A;  3JAM E;  4KUI A;  1HK9 A;  1OPL A;  2Y4Y A;  8ATC B;  2AKL A;  1BCO A;  3HRU A;  2LCS A;  1WJQ A;  2F2W A;  1E6H A;  4FYV B;  4J5Y A;  2X4W A;  4OB3 B;  1X6G A;  3CC4 T;  4AFU C;  1HSQ A;  3QJY A;  4E7I A;  4J9B A;  2RHU A;  3QWY A;  3PMI A;  2BE7 D;  5C6S A;  2LP5 A;  4XTX A;  4QT7 A;  5GMK l;  2ED0 A;  5GAN 3;  1VQP Q;  2KBT A;  3JCM X;  3CCM A;  2E10 A;  1CSK A;  1NZ9 A;  2DAQ A;  2EWN A;  5GAN 4;  2JM8 A;  4KH0 B;  2HEQ A;  1ZUU A;  5IH2 A;  3CCL Q;  1YJ9 A;  1YFN A;  4ZTJ A;  2D0N A;  2OTL T;  1NM7 A;  5D6Y A;  4J6X A;  5ECA A;  3UAT A;  2L3R A;  1JBM A;  2YRD A;  3G4S Q;  4DBF A;  3M0R A;  3H0H A;  3SD4 A;  4C8Q E;  5KYX A;  3TRE A;  2LTO A;  1I8F A;  4DBQ A;  1KC8 C;  3PTA A;  3EH2 A;  1VQL A;  2J05 A;  2QXF A;  1RAA B;  4M75 G;  3GIB A;  4OMP A;  5KCO A;  1FXX A;  5DM7 R;  2RA2 A;  5FW9 A;  1VQ5 Q;  4J9I A;  4A53 A;  2EAY A;  3OYE A;  4PJO G;  2HL3 A;  1M90 C;  4KGV B;  5D6W A;  4UC4 A;  4M7A C;  3ASK A;  2PTK A;  4V2S A;  2CUD A;  3PT9 A;  2LQ8 A;  4PL6 A;  2CSQ A;  3BDL A;  3CPW P;  1YJW Q;  2C0I A;  1QKW A;  3PNW C;  4J9E A;  4C92 B;  2P4R A;  2QYZ A;  1PD1 A;  1D3B A;  2SEM A;  3R6N A;  4FM4 B;  5AT1 B;  1Q81 R;  2RK1 A;  1LVK A;  3OYD A;  4M78 G;  1RAC B;  3A8H B;  1RAH B;  2LVM A;  4QQG A;  4XAX B;  1NG2 A;  2X3W D;  1ZQ1 A;  3CCR T;  5A0L A;  1U1T A;  2HSE B;  2JJ9 A;  4LDW A;  1KD1 C;  2GQV A;  2QQR A;  5FRN A;  5CCA A;  5IAY A;  3OMG A;  2E3H A;  3NPF A;  2CUB A;  2CYZ B;  2EW3 A;  2L3P A;  2KYM A;  4PK4 A;  1WHL A;  3CC2 A;  3L2U A;  3MCA B;  4R0K A;  1TXQ A;  1AWO A;  2L0A A;  1G3T A;  2KI7 A;  4M75 E;  1VQ8 T;  3JV3 A;  5DY9 A;  3VS1 A;  3MEW A;  1UUE A;  4KBM B;  1MGQ A;  2AT1 B;  3UF4 A;  2FYK A;  4PJO E;  3MP8 A;  3QZ5 B;  1WQ7 A;  4JJC A;  3EG2 A;  3LYI A;  2EQU A;  3CCR A;  4MDX A;  5FU7 C;  4M77 F;  3I35 A;  3INZ A;  3IQL A;  2ENM A;  2O31 A;  3C0C A;  3JB9 D;  1WHG A;  1X75 C;  4ATO A;  1YI2 T;  4M78 E;  1NYG A;  2E6N A;  3RKX A;  2YLB A;  3E9G A;  2KGT A;  1QVP A;  2XDB A;  3HPW A;  3OBW A;  4J6Y A;  3V7C A;  1VQ8 A;  1OPK A;  2XU8 A;  2YUQ A;  1VQO A;  4LDX A;  4M7D E;  1D09 B;  2AZS A;  4XTZ A;  2FPD A;  3JCM b;  5LJ5 d;  1JJ2 P;  2KDS A;  2F69 A;  2EGE A;  3CCL T;  1Z9Q A;  2XKO C;  3LH0 A;  4HT9 A;  4D8D A;  4A4G A;  1VQ6 Q;  4F16 A;  1TG0 A;  2DX1 A;  2GCX A;  2K79 A;  2JTF A;  2W10 A;  3A5Z B;  3L2Z A;  4CC2 A;  2DPP B;  1PCX A;  4F04 B;  2E5K A;  1DJ7 B;  3QHS A;  3TQ7 P;  1JO8 A;  2LZ6 B;  2DXC A;  2KXD A;  3OYI A;  2DA9 A;  2RHI A;  3D7S B;  5GAN f;  1VA7 A;  3QSU A;  5HK0 A;  1VQ5 T;  1YNZ A;  5GAN 7;  2LQW A;  2PU9 B;  4JRI A;  1UDL A;  2O01 E;  1K73 R;  2HCK A;  4L59 A;  4QW2 A;  2MAM A;  3QJ6 A;  5HKC A;  1UGR B;  3NTK A;  2RHZ A;  2KRO A;  1VYV A;  2ZCF B;  3RR6 A;  4E47 A;  1PM3 A;  3C94 A;  3NTI A;  3WXM B;  1CKB A;  2DXB A;  4EDU A;  3CC7 Q;  3V7R A;  3CCU T;  2AHJ B;  1PC0 A;  4J9C A;  3H8Z A;  1T3S A;  3DB3 A;  2QQS A;  1KC8 R;  4IUP A;  4ESR A;  3V8K A;  1C6V X;  2DFU A;  1M90 U;  3ME9 A;  3H41 A;  5LJ3 j;  1YJ9 T;  3OMC A;  3CCR Q;  2KVQ G;  4M75 B;  1IHV A;  1WA7 A;  4PJO C;  1OEB A;  4WF2 A;  1UGS B;  4VUB A;  3KFV A;  2FPF A;  2L3Q A;  3OS5 A;  4M78 C;  2QDL A;  1WXU A;  3SHW A;  2J06 A;  3A98 A;  2XDD A;  1ZUK A;  4RTV A;  3FJ5 A;  1WFW A;  1GXI E;  1ZA1 B;  2P0K A;  1VQ6 A;  2A36 A;  3OW2 P;  4MZP A;  3OB9 A;  1VQM T;  2K4Y A;  5GAO p;  3I5R A;  4RKU E;  2DZC A;  1JRI A;  1WHM A;  1J3T A;  1M1K C;  2O88 A;  3CBO A;  4M75 C;  3CD6 Q;  1BYM A;  2R57 A;  1Y96 A;  3TCJ A;  1NLO C;  3JCM e;  4MDW A;  3I9Q A;  4M77 G;  4XU2 A;  4C92 C;  4IIM A;  2OI3 A;  5LJ5 g;  3G71 T;  2DVJ A;  5CR2 A;  2CP3 A;  2DF6 A;  1TTH B;  1AEY A;  4Y92 A;  1AWX A;  2BZY A;  1D0Y A;  1H64 1;  4E7H A;  1KK7 A;  3VU3 C;  4C5G A;  1X6B A;  4J8O A;  2IVW A;  3X20 B;  3KXT A;  3CPF A;  2OX7 A;  2YXY A;  5KYY B;  4C92 D;  2OTJ A;  3CC2 T;  4B9X A;  3UT1 A;  4J7F A;  4AFS C;  4C8Q A;  1BI1 A;  2OTL Q;  2HDA A;  5AYF A;  4FU6 A;  3JB9 J;  2QG9 B;  1WLP B;  5GAM j;  3G4S T;  3I56 Q;  2KE9 A;  1UHF A;  1WYX A;  5GAM g;  2RQU A;  3CC2 Q;  1Q7Y C;  3VV0 A;  3SWN A;  4PJL A;  2KEA A;  1C0M A;  1QP3 A;  3QBY A;  5GAN 6;  4FCY A;  4PFO A;  4J7I A;  2RO0 A;  2ZPB B;  3RMQ A;  4QVZ A;  3DLM A;  1PSE A;  2DL8 A;  4KUL A;  4ZTF A;  2KAF A;  3PIO A;  3CCJ Q;  4BDZ A;  2A7Y A;  2JMC A;  2DEQ A;  1XNI A;  2K57 A;  2MMP A;  3DLL A;  1VOM A;  3JRZ A;  3QXE B;  2FRW A;  5IN1 A;  1YBY A;  3L2R A;  3TEE A;  3HKS A;  4EMK B;  4F7U E;  4AFZ C;  3WVE B;  2CT4 A;  4BI3 A;  4C0Z A;  3MHX A;  2EYZ A;  2E1H A;  4OMO A;  2DD5 A;  2ROL A;  1VUB A;  2YDL A;  3RKW A;  3FC3 A;  2ZPI B;  1YIT Q;  2AKK A;  3M0P A;  3I55 T;  3G4S A;  3JCM P;  1W2B P;  4HVV A;  2DXT A;  1YJ9 Q;  2NUP B;  4F7U A;  1VQP A;  5GAM f;  4IIO A;  1K73 C;  5CKH A;  3CCQ Q;  1QQJ A;  3M55 A;  5CIU A;  1H8K A;  1VQO Q;  2FZK B;  1KD1 R;  4M7A F;  1S72 A;  1V29 B;  2DIQ A;  5FWB A;  2ZPG B;  3V8L A;  3M58 A;  2DJQ A;  4LE9 A;  1IGQ A;  3O5Z A;  4LN2 A;  2DKG A;  1X27 A;  5KYU B;  2HAX A;  2ED1 A;  2KR3 A;  5GMK i;  1I5L A;  1VQL Q;  2B8A A;  2JMA A;  4ZN1 A;  3I55 A;  1Q95 G;  3MP6 A;  3EGD A;  1D1B A;  2E4H A;  4ANJ A;  2FZC B;  5D6X A;  2JTM A;  2EYX A;  1E6G A;  1M1K U;  2O2O A;  2HQE A;  2PNI A;  5IHN A;  1HD3 A;  5LJ5 j;  3M57 A;  1YJN Q;  3QKJ A;  2DIL A;  3CME T;  1P92 A;  5J39 A;  1UFF A;  1K8A C;  1RAB B;  3UWN A;  1M8M A;  4PJO B;  4IKF A;  3EHQ A;  1M2V B;  2J6F A;  4BUG A;  3LGF A;  2NUT B;  1CKA A;  2DTI A;  1OYX A;  4PKC C;  2V8I A;  2K2M A;  1I1J A;  2KT8 A;  3GBQ A;  2DET A;  1AHJ B;  4OMM A;  2DL7 A;  2HBW A;  4DEX A;  2XI9 A;  3P8D A;  2O9V A;  1M1K R;  4C0D C;  4X1V A;  1Q82 U;  1RAI B;  5IXF A;  2RI3 A;  3EGU A;  5LJ3 f;  3Q1J A;  3CME A;  2JM9 A;  1QW1 A;  1N9S A;  2YT6 A;  1K9M C;  5LJ5 h;  1KQ2 A;  1JB0 E;  2IG0 A;  1SHG A;  2FL7 A;  4ZGE B;  4PJM A;  4QKU A;  1JEG A;  2GTJ A;  4B6M A;  1QVG A;  3NHN A;  1VQK A;  2QDY B;  3OBY A;  4C8Q F;  4BE0 A;  2QK0 A;  3CC7 A;  1B34 A;  1SSH A;  1A0N B;  1K9M R;  1N9R A;  2JN0 A;  3M0Q A;  2DRK A;  2DYI A;  1YWO A;  2FG0 A;  1MUZ A;  2CZ6 B;  2FEI A;  2RQW A;  3L1A A;  1MMD A;  2COW A;  1QWF A;  5GAO l;  1KG1 A;  2OTJ T;  2DE0 X;  3I55 Q;  1BKB A;  1Y96 B;  3LWI A;  3E9F A;  2E64 A;  2MF2 A;  3SWN C;  3PVQ A;  1W70 A;  2KYB A;  4LUD A;  2KY9 A;  3OS0 A;  5GAM h;  1K73 U;  2DIG A;  1VQ7 T;  4F7U F;  5GAM d;  4M7A G;  2P4T A;  2ZGW A;  4X9C A;  4DBR A;  2K2V A;  1X43 A;  2CZ0 B;  2J6K A;  2RK2 A;  2D1X A;  2DL5 A;  1KSW A;  3JSC A;  4M4Z A;  3GOX A;  3CC7 T;  3CMA T;  3OY9 A;  1YIJ Q;  2DD4 A;  2LJ1 A;  1B7T A;  3JCM f;  2GQI A;  2CGH A;  2CZ7 B;  3PGG A;  1ZX6 A;  2HKN A;  4M7D C;  1FMV A;  4J9D A;  4BY6 B;  2ZAE A;  1XJW B;  3M59 A;  3EH1 A;  1QCF A;  4XK8 E;  4M78 B;  5J3B A;  3EG9 B;  2VB6 A;  4MML A;  3VUZ A;  1SEM A;  4Z88 A;  1G83 A;  4ELZ C;  1WDX A;  1EZZ B;  2LRQ A;  4OMF B;  2OAU A;  3N5B B;  4IUQ A;  4GBQ A;  3QPH A;  2FVU A;  3T9N A;  5CKD A;  1AT1 B;  2XK0 A;  1NJI C;  3CCV Q;  2JW4 A;  1ABQ A;  3UA6 A;  2QEX A;  1OX9 A;  4RTX A;  4M75 F;  1M5Q 1;  1YCY A;  2LNH B;  4FYX B;  2KMT A;  2ABL A;  1ZLM A;  3VRY A;  2K5L A;  4JLI A;  4L6V 5;  1ZUY A;  3G1J A;  2F2X A;  3C4S A;  2DER A;  1RAF B;  4OB2 B;  5HCK A;  2RJC A;  3HHT B;  1PWT A;  2KXC A;  4OB1 B;  3CCE T;  3HRS A;  1OZ2 A;  3LH5 A;  1U3O A;  4LUE A;  1G2B A;  3EG0 A;  3JB9 I;  1K8A U;  3CCM Q;  5GJV B;  4LDY A;  5CKB A;  1KHI A;  1SPK A;  2VUB A;  3CBM A;  2D6F A;  5LJ5 f;  2KK4 A;  3THK A;  3M9Q A;  2QEX T;  3DKM A;  2E65 A;  1SHF A;  1UB4 A;  1BBZ A;  4RTY A;  2LC4 A;  2RN8 A;  1U5S A;  3X25 B;  2RMO A;  2EKO A;  2EQI A;  1SRM A;  3A8G B;  5GJW B;  2LCL A;  1K9A A;  3KUF A;  2CH4 W;  2HD0 A;  3CEY A;  4IUU A;  1K0X A;  2E5Q A;  1VQN T;  1KIK A;  4ELY C;  4C0D B;  3CCJ T;  4ZGD B;  3ER0 A;  4BI8 B;  4A63 B;  3CCS Q;  1NE8 A;  3OYF A;  4JJN K;  3TVT A;  2HL5 C;  3OA6 A;  4C0F A;  2VV5 A;  3OW2 A;  4AMC A;  3CMA Q;  2JS0 A;  1AWJ A;  2VC8 A;  4XTY A;  2DEU A;  3JB9 F;  2YSQ A;  4OF1 A;  3RIR A;  3MEU A;  2CP0 A;  2HSP A;  2DL3 A;  2HQX A;  1M3B A;  2M1H A;  2ATC B;  4BE2 A;  2YHT A;  3ZFJ A;  5FWC A;  1NJI R;  1ZHI A;  4FL6 A;  1M8V A;  2G6F X;  2COZ A;  4PFZ A;  4HCB A;  1PRL C;  1K4U S;  3SWN B;  2YRC A;  2H3J A;  2LQN A;  2VXE A;  1BI2 A;  2JZ2 A;  1JQQ A;  4FIB A;  2K3X A;  2G3R A;  2Y4X A;  4HA8 A;  1IXD A;  1YI2 Q;  5CKF A;  1KHC A;  1NYF A;  2F5K A;  3RNJ A;  1Y0M A;  1I0C A;  1GRI A;  1O9S A;  2ZPF B;  2JVV A;  2Y90 A;  3JCM J;  4RTU A;  3M4Y A;  2MOX A;  2RI5 A;  4BY6 C;  2C06 A;  5J26 A;  1W1F A;  1SKU B;  2DL4 A;  1D1C A;  3LW5 E;  1Q82 C;  4M77 A;  1VYT A;  1G3W A;  2M51 A;  2SRC A;  2GGR A;  1UGP B;  3UDC A;  5GAO m;  4BDY A;  5CQY A;  3CPW S;  1MHN A;  4JJD A;  3CCU Q;  4MMK A;  4M7D G;  1KJW A;  4A54 A;  2QQA A;  1VYU A;  5I11 A;  3TSW A;  2X9H A;  5GMK m;  2YUN A;  1OX8 A;  2E3I A;  3GPL A;  2AZV A;  3CBP A;  4OMQ A;  1ZBJ A;  1KD1 U;  3QG1 A;  5GAM e;  3OYM A;  3J81 E;  3J7A F;  3OSV A;  4IUV A;  3TU4 K;  2DBK A;  1WX6 A;  3EFO B;  4BE1 A;  1UHC A;  2A37 A;  1S72 T;  2P0Q A;  3SDZ A;  1QVF A;  1AZG B;  4C8Q C;  4FW2 A;  1UE9 A;  3EFR A;  2D9T A;  2F2V A;  3ZL7 C;  3OYK A;  1Q7Y R;  1RL2 A;  4C92 E;  3BY7 A;  4M77 C;  3H6Z A;  1NPP A;  2VGN A;  1GBQ A;  3L42 A;  4HCZ A;  1BI3 A;  3OYB A;  1VQO T;  1Q86 U;  1I81 A;  1QKX A;  3E19 A;  1U8R A;  2NUT A;  3GNG A;  3UA7 A;  2F1L A;  2QGG A;  4NS5 A;  2YUO A;  2RF0 A;  3M0U A;  3NMZ C;  1E7O A;  2FB7 A;  2L3S A;  1O75 A;  2COY A;  5KYY A;  1I07 A;  3G71 Q;  2QTX A;  2PVO B;  3RDV A;  4JRK A;  4C8Q B;  4OMN A;  2H3E B;  1EFN A;  1YHQ A;  3L2V A;  2XHC A;  5GAN j;  1N8R U;  3CD6 T;  3A8O B;  1VQN A;  1YIJ T;  4AFQ C;  5LJ3 h;  3CCJ A;  4XQ3 A;  2K5F A;  3M53 A;  3EAE A;  2JUF A;  1IHW A;  4XU1 A;  2HMA A;  2X3X D;  1AOJ A;  2OAW A;  3S3O A;  4PLL A;  1UGQ B;  2QI2 A;  3RES A;  5CVI A;  1OV3 A;  3OYH A;  2XID A;  3CCV T;  2O4X A; 
#chains in the Genus database with same CATH homology
 2C0I A;  1QKW A;  4Z8A A;  4J9E A;  1BU1 A;  2J6O A;  2MIO A;  1SHG A;  2P4R A;  1K76 A;  2DNU A;  1MV0 B;  2OJ2 A;  2SEM A;  1GFC A;  1FMK A;  3R6N A;  1JEG A;  2GTJ A;  2GTO A;  2M0Y A;  1AWW A;  4CC7 A;  3NHN A;  1T0H A;  2DRM A;  5I22 A;  1NG2 A;  1NEG A;  2X3W D;  1SSH A;  4WCI A;  1A0N B;  1FYN A;  4ORZ A;  3M0Q A;  4F17 A;  2DRK A;  1YWO A;  4K11 A;  2FG0 A;  1MUZ A;  3NPF A;  2FEI A;  2CUB A;  2I0N A;  2RQW A;  5EC7 A;  2EW3 A;  1QWF A;  2L3P A;  4AG2 C;  2KYM A;  2EKH A;  2DE0 X;  2K9G A;  4R0K A;  2CSI A;  1M3C A;  2LX7 A;  1AWO A;  4ZNX A;  2L0A A;  1T0J A;  3VS3 A;  2IIM A;  3JV3 A;  3VS1 A;  1LCK A;  1UUE A;  3PVQ A;  1W70 A;  2KYB A;  4LUD A;  3UF4 A;  1JXM A;  2FPE A;  2A28 A;  4JJC A;  1H92 A;  4CC4 B;  1X43 A;  2J6K A;  1K1Z A;  2RQT A;  3EG2 A;  2D1X A;  1X69 A;  2CDT A;  1SRL A;  2DL5 A;  1KSW A;  1NLP C;  1PKS A;  4M4Z A;  3RBB B;  4AG1 C;  3I35 A;  1QWE A;  3IQL A;  2LJ1 A;  2FRY A;  2ENM A;  2O31 A;  2GQI A;  3C0C A;  3REA B;  2EBP A;  2K6D A;  4HVW A;  1ZX6 A;  1NYG A;  4J9D A;  2KGT A;  2JTE A;  3VS7 A;  2CT3 A;  2RQR A;  2KRN A;  1RLP C;  1OPK A;  2YUQ A;  2C0T A;  1QCF A;  2L2P A;  2AZS A;  3PVL A;  2FPD A;  4GLM A;  1GBR A;  1IO6 A;  2EGE A;  1SEM A;  1Z9Q A;  1N5Z A;  1G83 A;  4Z88 A;  1WDX A;  2NWM A;  4D8D A;  1XOV A;  2XMF A;  3VS0 A;  4F16 A;  1TG0 A;  2DX1 A;  1JU5 C;  1YCS B;  4GBQ A;  2K79 A;  2W10 A;  2J7I A;  1ABO A;  1UG1 A;  2DBM A;  4CC2 A;  3REB B;  1M30 A;  2JT4 A;  2JW4 A;  1ABQ A;  3UA6 A;  2V1R A;  2EGC A;  2E5K A;  4RTX A;  1JO8 A;  1ZSG A;  2LZ6 B;  1YWP A;  2KXD A;  4EIK A;  2D8H A;  2LNH B;  2EVR A;  2DA9 A;  1X2Q A;  2ABL A;  1ZLM A;  1VA7 A;  1Z9Z A;  4KRT A;  3VRY A;  2EYY A;  1YNZ A;  2LQW A;  1ZUY A;  2F2X A;  2RQV A;  1UDL A;  2K3B A;  2HCK A;  2B86 A;  5HCK A;  1RI9 A;  2KRM A;  1PWT A;  2KXC A;  2KRO A;  1VYV A;  1GFD A;  1CKB A;  3LH5 A;  1U3O A;  4D8K A;  4LUE A;  1G2B A;  4JPB W;  4J9C A;  3EG0 A;  1T3S A;  1GL5 A;  4JJB A;  5GJV B;  4ESR A;  2VVK A;  1SPK A;  2DLP A;  2DYB A;  1H3H A;  4J9G A;  3H41 A;  1B3Q A;  1T3L A;  3THK A;  1WA7 A;  1SHF A;  1OEB A;  1BBZ A;  4RUG A;  3KFV A;  2RN8 A;  4RTY A;  2FPF A;  2FO0 A;  1PRM C;  1U5S A;  1Y57 A;  2CH4 A;  2L3Q A;  2RMO A;  2EQI A;  1SRM A;  2QDL A;  5GJW B;  3U23 A;  1WXU A;  3SHW A;  2J06 A;  5IXB A;  3VS2 A;  1YN8 A;  1K0S A;  1K9A A;  3A98 A;  1WXT A;  1U06 A;  1GCQ C;  1ZUK A;  2CH4 W;  2GBQ A;  4RTV A;  3FJ5 A;  1WI7 A;  3CQT A;  3VS5 A;  1WFW A;  1K0X A;  2DM1 A;  1KIK A;  1GCQ A;  2A36 A;  1X2K A;  1TUD A;  2JS2 A;  4DEY A;  4OML A;  4A63 B;  2YUP A;  3I5R A;  4J9F A;  3TVT A;  1M3A A;  3H0F A;  1UJY A;  1J3T A;  1PHT A;  2O88 A;  1UJ0 A;  1W6X A;  1NLO C;  1OOT A;  2DMO A;  3I9Q A;  2BZ8 A;  1WXB A;  4IIM A;  2JS0 A;  1AWJ A;  2KT1 A;  2OI3 A;  4JZ3 A;  1AVZ C;  4E6R A;  2YSQ A;  2DVJ A;  1V1C A;  2DF6 A;  1AEY A;  1JXO A;  2HSP A;  4Y92 A;  2DL3 A;  1AWX A;  3M0S A;  3M0T A;  2BZY A;  1M3B A;  4JZ4 A;  2NUZ A;  1X6B A;  5FWC A;  2A08 A;  4LNP A;  5L23 A;  1PKT A;  2G6F X;  1BB9 A;  3TSZ A;  3EG1 A;  2AK5 A;  4AFS C;  2H8H A;  1KFZ A;  2CRE A;  1PRL C;  1B07 A;  1K4U S;  1QLY A;  2HDA A;  2LQN A;  2KRS A;  1HJD A;  1JQQ A;  2W0Z A;  1NEB A;  1WLP B;  2LJ0 A;  2JXB A;  2KE9 A;  4RTZ A;  1UHF A;  3NGP A;  1WYX A;  2RQU A;  1UTI A;  1YP5 A;  2KEA A;  3VRZ A;  3EG3 A;  1ARK A;  1NYF A;  2DL8 A;  3VS4 A;  3I5S A;  3RNJ A;  2JMC A;  2BZX A;  2PZ1 A;  1Y0M A;  2MCN A;  1I0C A;  1GRI A;  2GNC A;  4CC3 A;  1AD5 A;  3H0I A;  1GCP A;  2FRW A;  2EGA A;  2LMJ A;  1M27 C;  4AFZ C;  3PE0 A;  4RTU A;  2RNA A;  1TUC A;  2CT4 A;  2MOX A;  2EYZ A;  2EPD A;  1W1F A;  4OMO A;  2C0O A;  2DL4 A;  2ROL A;  2YDL A;  2AKK A;  3M0P A;  1AZE A;  1VYT A;  4RTW A;  4HCK A;  2M51 A;  2SRC A;  1RLQ C;  2GGR A;  4HVV A;  2K7A A;  4RTT A;  2BTT A;  2V1Q A;  2EYW A;  4JJD A;  5IHI A;  2ECZ A;  3QWX X;  3ULR B;  4IIO A;  2D8J A;  1KJW A;  2KNB B;  4HVU A;  1VYU A;  1H8K A;  5I11 A;  3TSW A;  2YUN A;  1OPL A;  5IHK A;  5FWB A;  1WIE A;  2AZV A;  2AKL A;  4OMQ A;  2DJQ A;  1ZBJ A;  3VS6 A;  4LE9 A;  3O5Z A;  2LCS A;  4LN2 A;  2F2W A;  3SEM A;  1E6H A;  1X27 A;  2O9S A;  1X6G A;  2DBK A;  1WX6 A;  4AFU C;  2ED1 A;  3EHR A;  2KR3 A;  1HSQ A;  1UHC A;  2A37 A;  4J9B A;  4J9H A;  3QWY A;  1MV3 A;  4F14 A;  1AZG B;  2JMA A;  1UE9 A;  2LP5 A;  4QT7 A;  2F2V A;  2ED0 A;  3ZL7 C;  2EYX A;  2ROT A;  1E6G A;  2O2O A;  2PNI A;  5IHN A;  1HD3 A;  1GBQ A;  2KBT A;  2DIL A;  2ESW A;  1S1N A;  1CSK A;  2JM8 A;  2HEQ A;  1QKX A;  1ZUU A;  5IH2 A;  1UFF A;  4FSS A;  1M8M A;  1BK2 A;  3UA7 A;  1PNJ A;  2YUO A;  2D0N A;  2RF0 A;  3M0U A;  1NM7 A;  3UAT A;  5ECA A;  3NMZ C;  3EHQ A;  2J6F A;  1E7O A;  2LJ3 A;  2L3S A;  2RPN A;  1RUW A;  3M0R A;  1I07 A;  3H0H A;  1CKA A;  1UGV A;  4OMN A;  2K2M A;  2VKN A;  1EFN A;  1I1J A;  2J05 A;  4OMP A;  2KT8 A;  3GBQ A;  2VWF A;  4AFQ C;  5FW9 A;  1UEC A;  4OMM A;  4J9I A;  2DL7 A;  2HBW A;  4DEX A;  2O9V A;  4X1V A;  2X3X D;  4HXJ A;  1AOJ A;  5IXF A;  2OAW A;  3EGU A;  2PTK A;  2CUD A;  2JM9 A;  4Z89 A;  1OV3 A;  2YT6 A;  2CSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...