2DL7A

Solution structure of the second sh3 domain of human kiaa0769 protein
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
73
structure length
73
Chain Sequence
GSSGSSGVCFVKALYDYEGQTDDELSFPEGAIIRILNKENQDDDGFWEGEFNGRIGVFPSVLVEELSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0769 protein
publication title Solution structure of the second SH3 domain of human KIAA0769 protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 5
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2006-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dl7A00
2MIOA 2YUPA 1KFZA 1ZUKA 2C0OA 1TG0A 1Y0MA 1RI9A 1W1FA 2AZVA 1CSKA 2XMFA 1VYTA 4Z8AA 2GBQA 3H0IA 1NEBA 2EPDA 2V1RA 2LMJA 2M51A 2ENMA 3EHRA 3NMZC 3UF4A 3ULRB 2GNCA 2J06A 1B3QA 2RPNA 2V1QA 1AWWA 2RF0A 2CDTA 3M0PA 3SEMA 2O2OA 1YN8A 1GFDA 4F14A 3QWXX 4OMMA 3M0QA 3THKA 4QT7A 1FYNA 1X2KA 4HXJA 4AFZC 2K79A 2D8JA 2A37A 4M4ZA 2K9GA 2MCNA 1U5SA 3O5ZA 1UTIA 4JZ4A 2LCSA 1TUCA 2DL3A 1K1ZA 1GL5A 2DRMA 1T0HA 3JV3A 2CUDA 2KE9A 5FWCA 1U3OA 2IIMA 4AG2C 2O9SA 2YUOA 1WIEA 4OMPA 2LP5A 4LE9A 2GTJA 3A98A 2LX7A 3VS0A 1T0JA 2KEAA 1ARKA 1W6XA 1WDXA 2JS2A 3I35A 2FPFA 3TSWA 4KRTA 1M30A 4DEYA 1WI7A 4HVVA 2DL7A 4RTWA 2ED0A 2DBKA 1K0SA 2CUBA 1Z9QA 1YCSB 4WCIA 3ZL7C 2BZXA 1PKSA 1HSQA 1QKXA 4DEXA 4J9IA 2JM8A 4RTZA 1SRMA 2RN8A 2VKNA 2C0TA 1SSHA 3M0RA 1T3LA 4JJBA 2DJQA 4FSSA 1OEBA 2PTKA 1GCPA 4RTYA 1UECA 1LCKA 1N5ZA 4IIOA 2L2PA 1ABOA 4Y92A 4AFUC 2AKLA 2HEQA 4AFQC 1XOVA 2LNHB 2LJ0A 2KYMA 2CH4W 1QWFA 2FO0A 3I5SA 4JPBW 3VRZA 4CC4B 2FRYA 1NLOC 1SPKA 1ZSGA 1A0NB 2DE0X 1GRIA 2YDLA 2HDAA 2DNUA 4RTXA 3VRYA 4LNPA 2CREA 2A28A 2EGCA 2FRWA 3U23A 2L3QA 2NUZA 2W0ZA 3EGUA 1JEGA 1EFNA 2M0YA 2D8HA 4CC2A 2HBWA 2YUQA 4GLMA 1W70A 1PRMC 4RTTA 2OAWA 3PE0A 3VS2A 1ZX6A 1HJDA 4IIMA 1UG1A 3EHQA 1T3SA 2K3BA 2FG0A 2DL5A 1E6GA 2AKKA 1M3BA 3PVQA 1E7OA 2DF6A 2ED1A 4ESRA 3M0TA 1WXBA 2LQWA 4J9EA 2F2XA 2SRCA 2ABLA 3REAB 1G83A 4CC7A 1M8MA 2B86A 2KR3A 2RQVA 5IH2A 2K7AA 5IHNA 1PKTA 1WLPB 1FMKA 4J9DA 1AD5A 2KYBA 2DYBA 2KROA 1WA7A 1PHTA 2KRSA 3H0FA 1WYXA 2ECZA 1WFWA 2LZ6B 1KSWA 2D1XA 3VS3A 1HD3A 3M0UA 5I11A 1SRLA 5IHKA 2BTTA 2D0NA 1GBRA 1M27C 2DA9A 2AZSA 2CSQA 4AG1C 2EBPA 4JJCA 3RNJA 4F17A 5HCKA 3UATA 4J9BA 2O9VA 1CKAA 1V1CA 2KT8A 2EYXA 3CQTA 2CT3A 2DX1A 2ESWA 4HVUA 4LUEA 1MUZA 1UGVA 4JZ3A 4A63B 2I0NA 3EG3A 2YT6A 2J7IA 1JU5C 1VYUA 4E6RA 3VS5A 2J05A 2FPDA 2BZ8A 1ZBJA 4Z89A 4JJDA 1QCFA 1UHFA 1NEGA 2JTEA 2KXDA 4HVWA 4EIKA 1K76A 2AK5A 4HCKA 1H92A 4Z88A 2JT4A 5FW9A 1ZLMA 3VS1A 2HCKA 2EW3A 1WX6A 4ORZA 5GJWB 4GBQA 2JW4A 3SHWA 3UA6A 1NM7A 3R6NA 2VVKA 2OJ2A 1G2BA 3NHNA 3FJ5A 3TSZA 1Y57A 3C0CA 1UJYA 1NG2A 2KNBB 4LUDA 3NGPA 2RQTA 1H3HA 5IXBA 1UFFA 4J9FA 3H0HA 2RQWA 1YWOA 1U06A 2EYWA 1JXOA 1M3CA 1YNZA 2RNAA 2GQIA 2JMAA 1WXTA 2G6FX 2CT4A 1M3AA 2KRNA 2X3XD 2J6KA 2LQNA 1JXMA 1AWOA 2A08A 2DBMA 2F2WA 5EC7A 1YP5A 2EKHA 3RBBB 1YWPA 5FWBA 1I1JA 2L0AA 4K11A 1CKBA 4D8DA 1I07A 1GBQA 2VWFA 1X2QA 1ZUYA 1X27A 2RQRA 1NYGA 2F2VA 1AZEA 2DMOA 1AVZC 1MV3A 3I5RA 1AZGB 1AOJA 2C0IA 1RLPC 2L3PA 3VS4A 4D8KA 2MOXA 2K2MA 4X1VA 2DRKA 1I0CA 3PVLA 1GCQA 1OPKA 1SHFA 1UJ0A 2K6DA 2RMOA 1SHGA 1K4US 1AWJA 1X43A 1ABQA 4J9GA 2GTOA 4RTUA 1JQQA 4OMLA 1SEMA 1J3TA 1Z9ZA 3QWYA 1KJWA 3LH5A 2LJ3A 4F16A 2O88A 2YSQA 3GBQA 2LJ1A 2YUNA 1GFCA 2CSIA 2ROLA 1TUDA 5ECAA 3EG1A 2E5KA 1AEYA 2HSPA 5I22A 3IQLA 2EGEA 2EYYA 4J9CA 2RQUA 2J6FA 2JS0A 1JO8A 5GJVB 2GGRA 1GCQC 2X3WD 1PWTA 1UE9A 2ROTA 2BZYA 4ZNXA 1PRLC 1H8KA 4R0KA 3REBB 2KRMA 1BBZA 4J9HA 2DILA 2JMCA 1BB9A 3I9QA 1VA7A 1NLPC 1QKWA 1OOTA 2DVJA 4RTVA 3EG0A 2L3SA 2FPEA 2SEMA 1RLQC 1UHCA 1UDLA 1MV0B 4RUGA 1WXUA 2O31A 1K0XA 2A36A 1S1NA 4AFSC 2DL4A 2KXCA 3H41A 2EVRA 2NWMA 2KBTA 2OI3A 2P4RA 2JXBA 4OMOA 2PNIA 5L23A 4OMQA 4OMNA 2DL8A 2H8HA 4LN2A 1NYFA 1UUEA 2DM1A 1VYVA 1X6BA 3VS7A 4CC3A 3TVTA 1RUWA 1OV3A 2JM9A 2EQIA 2W10A 3VS6A 1E6HA 2CH4A 1OPLA 1ZUUA 3KFVA 3EG2A 1X6GA 2KGTA 3NPFA 3UA7A 1AWXA 1BU1A 1B07A 1IO6A 2PZ1A 1KIKA 5IHIA 2KT1A 2EYZA 2FEIA 2J6OA 2QDLA 1X69A 2DLPA 2EGAA 3M0SA 5IXFA 1K9AA 1QLYA 1QWEA 1PNJA 1BK2A
chains in the Genus database with same CATH superfamily
1ZSZA 2KY9A 2MIOA 1IREB 1LJOA 1RI9A 4PJOD 3C94A 3M56A 1Q82C 2OTLA 2ATCB 2JTMA 3L2VA 4PJOC 1M8VA 2D6FA 5DY9A 3L42A 2V1RA 4QW2A 4DOWA 4M7DD 5GAN4 3NMZC 2AIRB 2M0OA 1WZOA 3HHTB 4PFPA 2V1QA 1AWWA 2RF0A 2CDTA 3CCQT 3VUZA 2GQVA 1MMGA 1VIFA 1YN8A 4QQGA 3H6ZA 2K2VA 2LNVA 3G1JA 3I55T 2JVVA 4OMMA 4DBQA 4HXJA 4M7DB 5CK9A 4M78C 1TWBA 3MP1A 3FB9A 3BE3A 2Y4YA 5CQXA 4JZ4A 2DL3A 2M02A 3DB3A 2CP6A 4KUIA 1T0HA 3JV3A 3ASKA 5FWCA 1MMAA 4AG2C 3CPWS 4WTOB 2YUOA 4LE9A 5LJ5e 5D7UA 3SFMA 1ARKA 4C92B 4HT9A 3I35A 4QVZA 3TQ7P 4VUBA 3P8BB 2FPFA 4XU3A 3CCVA 4M78F 3CC7Q 1D1BA 3MP6A 1K8AR 3EFOB 4FYXB 1OI1A 2CUBA 4PJLA 1Z9QA 3FJPA 3CBOA 4WCIA 1Q7YR 1D1AA 2B8AA 5GAMh 3ZL7C 4J6YA 2BZXA 2DD4A 2JM8A 5KYWB 4FSXA 3CC4T 3GP8A 1SRMA 4FU6A 4M7DE 1HYOA 1BCMA 1KC8U 4FSSA 2XHCA 1QVFS 1GCPA 1N5ZA 4JS4A 1ABOA 2HEQA 3HP9A 1XOVA 3VUBA 5I2SA 1YHQT 5GANf 1NPRA 4MMLA 3VRZA 2PUOB 1SPKA 2KK4A 1ZSGA 2KMTA 4BUGA 2DJZA 3ZFJA 4M7DA 4C92E 1GRIA 3PNWC 3HRUA 4E7JA 3VRYA 3WXMB 4X9DA 3LGFA 2CREA 2A28A 2FRWA 3U23A 2JOYA 2NUZA 4FYWB 3EGUA 1JEGA 1NJIU 1EFNA 2CP2A 3JCMc 2M0YA 2QXFA 2HBWA 3CCMA 1M1KU 4N4IA 3G6EQ 1W70A 2YRDA 5GANd 4M75F 4C92A 1TOVA 3M9QA 5KYUB 2CZ6B 4F04B 1E6GA 1M3BA 2ED1A 2GFUA 2NLUA 3UDCA 3EFOA 3PIOA 3A8LB 2ABLA 1G83A 1M8MA 3ER0A 5KYWA 5GANh 2K7AA 1KQSA 5CAIA 3CXCP 1VQOT 2RB6A 4J9DA 2MAMA 1AD5A 2KYBA 2DYBA 2KROA 3OBYA 1WYXA 2ECZA 4L59A 1WFWA 1NZ9A 1NJIR 1VQKA 2XD0A 1HD3A 5IHKA 2O01E 2BTTA 4WF2A 2DA9A 4AG1C 4RCBA 4LXCA 3GLXA 2DAQA 2A7YA 3M54A 2DVEA 5C6SA 1Y96A 2ZPIB 3CBPA 2CP0A 1R8OB 2CZ7B 2CS7A 2X4XA 3L2RA 1MUZA 2I0NA 3EG3A 1FWZA 2WSCE 1M2OA 5LJ3h 2YRVA 3R6OA 1UHFA 1UGRB 3EH2A 1Q86U 2KXDA 1WNLA 3L2QA 2JT4A 2LVMA 1KD1C 1N8RC 3VS1A 2EW3A 5KYUA 2FL7A 2GFAA 1Q82R 2XK0A 3VKIA 3OYMA 1ZBXA 3CCEQ 3CCUT 2HSEB 2M9UA 3TSZA 1Y57A 3C0CA 4FW1A 3QJ6A 5AYFA 4LUDA 3NGPA 2RQTA 3BFMA 3PMIA 3JB9F 4J9FA 2E4HA 2RQWA 4C0ZA 1JXOA 1M3CA 2EQUA 3CCRT 1BI2A 2OTLQ 4V2SA 1V29B 1KQ1A 3RBBB 2CYZB 2QDYB 5FU6B 4OB1B 2RHUA 3OYLA 1YWPA 1YJ9A 1BIBA 1I1JA 1TSFA 5KYNA 1GBQA 5FLXE 3I56A 4FCYA 2RI2A 1NPPA 1ZA1B 1RI0A 3M53A 5KH6A 1WJRA 3I5RA 1RLPC 2V8KA 4X1VA 3OS1A 1I0CA 1O75A 5GAMj 4N0AA 1X43A 1ZHIA 1VQ8T 3NTHA 2LDMA 4LDUA 4RTUA 3META 1SEMA 2DYIA 1J3TA 1XTDA 1PC0A 1Z9ZA 3LH5A 4M77D 2O88A 4KT0E 2DZCA 5DLOA 1WQ7A 1UGSB 3X24B 2E5KA 5HKCA 4E7HA 1RABB 5I22A 1UGPB 2EYYA 2AT1B 2QAZA 2YLBA 2LQ8A 2C06A 1GCQC 3JB9I 4KH0B 1K9MC 1W2BA 2ROTA 2BZYA 3JCMe 3CMET 1M4ZA 3JCMW 3QO3A 3CCVQ 2JMCA 3SB2A 4M77B 3A1PA 1WJQA 2ZPEB 1QKWA 1OOTA 3CMAQ 4OF1A 2FPEA 4C5EA 3OW2A 3JCMP 1VQ7Q 4HT8A 9ATCB 4PJJA 1UHCA 1XJWB 5CVIA 4N4HA 2EYQA 5J3BA 4OB3B 2IG0A 1ACMB 2EVRA 4E7LA 1S72A 2KBTA 2OI3A 2P4RA 3M58A 2JNGA 4F7UB 2VUBA 3H9NA 1U1SA 1QMCA 3MEWA 4A4GA 4PK4A 2P0PA 2DL8A 2H8HA 2D0QB 3CC7A 1VYVA 2CGHA 4CC3A 2FZCB 2XDBA 5GANj 2ZPBB 6AT1B 2K3YA 4C8QD 1OPLA 2X35A 3EGDB 4J83A 1SG5A 2RJFA 5GMKi 3EG2A 1JB0E 3NPFA 4C8QC 5J26A 5I2MA 1FMVA 5IHIA 3CCMQ 4AT1B 2J6OA 3M0SA 4IUQA 1VQMT 4GY5A 2OTJT 1M1FA 1PNJA 2Y90A 3C12A 1QVGP 2EJFA 3QUIA 1ZUKA 1VUBA 1TH7A 2I2LA 5EG2A 1KD1U 1QVFP 4M77A 4F7UE 1FMWA 2QQ9A 3LW5E 2AZVA 2DK3A 2F5KA 1R0CB 2E3IA 1WJSA 5L8RE 1YJNA 5LJ3j 5FU7B 1WHGA 2D9TA 4PJMA 3H0IA 1HXDA 2EPDA 4A4KA 7AT1B 2JN0A 2JJ9A 4BD3A 2R57A 4BACA 2J06A 4O5VA 1ZSZC 4A4EA 4JLGA 1Q81U 4F7UG 1K73C 3J80E 1VQNQ 4F7UA 2O2OA 4KH1B 3GIBA 1RAEB 4F14A 4KGZB 3ZBDA 1QCNA 4MMKA 4QQ6A 1X2KA 4QT7A 1QQJA 2D8JA 3UWNA 4M4ZA 2MF2A 3O5ZA 3RERA 2LCSA 5KCOA 4IKFA 3EGDA 1KD1R 1N8RR 3G6ET 1KK7A 1VQLT 3E19A 4OMPA 1MNEA 2GTJA 3OYEA 1BI1A 1JBMA 2LX7A 1T0JA 3UPUA 4J6WA 3RMSA 1W6XA 2JS2A 4PLLA 1RADB 1M30A 2QGGA 1WI7A 2HQEA 2GCXA 3MJXA 1I4K1 1PD1A 2DL7A 2RJEA 1TU0B 1WGSA 4BE2A 3OYDA 3VYHB 1M9SA 2YXYA 1VOMA 2A0FB 1F1BB 1XNIA 2H3EB 4DEXA 4EMHA 1HSQA 2DEQA 4J9IA 2PUKB 3OYIA 3QZ5B 2RN8A 2VKNA 4OMFB 1SSHA 4M7AF 4PKCC 3M0RA 3OB9A 2ZPHB 2KQWA 2DTIA 1MMNA 1IGQA 3RDVA 1VQ4Q 1D09B 3M57A 5A0GA 3CC2A 3OYCA 3OS0A 3L2WA 4IURA 4X34A 2WSFE 3I56Q 1VQ9Q 4BE0A 2CH4W 2X9HA 3HTRA 2FO0A 3CCEA 4JPBW 4CC4B 1NLOC 3BDUA 3QDFA 2H3JA 5LJ5h 1A0NB 3G71Q 2DE0X 3P8HA 1RAHB 2HDAA 4RTXA 2MWOA 2W0ZA 1AHJB 1IXDA 2YUQA 4GLMA 1K9MR 1P92A 3VS2A 3EHQA 1M2VB 2Y4XA 3MEUA 4M7DC 2EFIA 2FG0A 4JRQA 4XK8E 2DL5A 2G3RA 4J7IA 3J7AF 3PVQA 5HY6A 1K8AU 1E7OA 2VGNA 5GAMf 2DF6A 4Q5WA 1WXBA 2F2XA 1Q7YU 2OTLT 2SRCA 5AT1B 1JJ2P 3QXEB 4IUPA 4L5GA 2B86A 1VQ5A 4XTUA 2KR3A 2RQVA 4C92D 5IH2A 4PJOF 1D0XA 1PKTA 3JCMQ 1WLPB 3NTIA 1OZ2A 5GANg 2VASA 4C92C 2NUPA 5DLQE 3A8GB 2IVWA 2RD1A 5D6XA 4M7DF 3OW2S 4HA8A 3M0UA 4ME7A 1RACB 4MZTA 5GAMd 1AT1B 3NFCA 4JJCA 3OYNA 1S72Q 3RNJA 3Q1JA 3SD4A 4QQDA 3JCMb 4J9BA 1OX8A 2O9VA 1CKAA 3M4YA 2DXCA 2KT8A 2EYXA 2CT3A 3OMCA 4BI3A 4MDXA 2J7IA 4Z02A 1JU5C 3CMAA 1BKBA 2V26A 2VB6A 4C92F 1R77A 2J05A 2FPDA 4B9WA 2BZ8A 4JJDA 1QCFA 2LT4A 2HD0A 1VQ7A 2JTEA 3JCMV 1W4SA 4EMGA 4ZGJB 3V8LA 1M2VA 1H92A 4Z88A 5FW9A 3LX7A 3CPFA 1ZLMA 4ORZA 4D6WA 4X9CA 3CCVT 1G2BA 4C5GA 5A0DA 4XTYA 3INZA 1UJYA 4RG2A 2KNBB 4E47A 1H3HA 3M5AA 2R5MA 3H0HA 4LDXA 1U06A 4J5YA 1YNZA 2JTFA 1I8FA 1K73R 1MNDA 4PJOG 1YJNQ 2QTVA 2X3XD 3QJYA 3S3MA 1AWOA 1YBYA 3VJPA 2DBMA 5EC7A 1YP5A 2CP5A 1WHMA 5FWBA 1X75C 4K11A 1CKBA 4M78E 2PU9B 2E1HA 1I07A 3OYKA 3CCSQ 2VWFA 4XQ3A 1X2QA 4PLIA 1X27A 1YIJQ 1LOJA 1TUGB 4BB7A 2L5QA 1Y7XA 1MV3A 3DB4A 1AZGB 3QG1A 1BI0A 4PFOA 1AOJA 2C0IA 2L3PA 4M75B 5KYYB 2MOXA 2K2MA 4Y91A 1G8XA 5LJ3f 3PVLA 4PL6A 3LWIA 3JSCA 3CEYA 4M78G 4J9GA 2GTOA 1JQQA 3CXCA 3JAME 3OY9A 2O4XB 3CCMT 3HL8A 1TXQA 5HK3A 1GXIE 4ZN3A 2ROLA 1TUDA 5ECAA 1AEYA 4JJNK 2E5QA 1Q82U 3BY7A 1VQNA 2RQUA 4N4GA 1KHCA 8AT1B 5GJVB 2DIQA 5LJ5j 4J8OA 5LJ3d 2RM4A 3JCMf 3REBB 1VQ6Q 4C0DB 2DILA 3G4SQ 3CCLQ 4EMKB 4RTVA 2DVJA 3EG0A 3MO8A 4FM4B 4M75E 3QYGB 2HBPA 1B34B 3GOXA 3JRZA 1RLQC 1VQKT 4IUTA 1VQPQ 2A36A 2DL4A 4NL3A 4DA4A 2QQSA 3OYYA 4KUDK 4FT4A 1G3TA 2JXBA 3JCMd 3CC2Q 2PNIA 1OZ3A 4XU2A 4RCCA 4M75G 4R56A 4OMNA 4M75A 5KYYA 3L2UA 4CRIA 1NYFA 1UUEA 1QP3A 2AHJB 3EH1A 3TVTA 1RUWA 3QHSA 3OSSC 1OV3A 2RK2A 4QVCA 2EQIA 2KDSA 1M5Q1 3VS6A 1E6HA 2O4XA 2P0QA 3JCMh 2DPPB 2EIFA 1X6GA 2L3RA 4KBMB 1B07A 2KT1A 1VQ4A 3BDLA 1YITA 2DLPA 4JRKA 5C0MA 3CCQQ 1H3ZA 2HQHA 1VQ9A 1G3WA 2DETA 3L2ZA 4ANJA 4ELZC 3A8MB 2YUPA 4LDVA 1KFZA 5LL6S 2C0OA 5GMKe 4KGXB 2K5IA 1TG0A 5GAOl 1Y0MA 3G71A 1W1FA 1HK9A 4EMKA 4E7IA 2XMFA 1EIFA 4Z8AA 1LNXA 1B34A 2GBQA 3L1AA 4BY6B 1VQ5Q 3EAEA 2ENMA 1YJ9T 4JRIA 3EHRA 3UF4A 3I56T 2GNCA 2RPNA 1B3QA 1QW1A 3G7ZA 5D6WA 3M0PA 5A2QE 3SEMA 1IRXA 4C5IA 1GFDA 4M77C 2P84A 3QWXX 1FX7A 4RMOA 1M90C 3THKA 1FYNA 4NS5A 2K79A 2EWNA 2A37A 5GAN6 2K9GA 1U5SA 2E10A 1TUCA 5IT9E 1YJWA 3JB9G 1K1ZA 1GL5A 2QA4A 4QVDA 3E9FA 4ZGEB 2CP3A 2MYSA 1WIEA 2ZZDA 2LP5A 3AT1B 3CCJA 2L8DA 2XICA 5CQYA 2HMAA 4M77F 3VS0A 2EQJA 2KEAA 3VU3C 1BYMA 4DBHA 1YCYA 3CD6A 4OB0B 3TSWA 3WVDB 4RTWA 3CPWP 1K0SA 2E65A 2FZGB 4LDWA 1Q95G 1YCSB 3RIRA 5GAOq 1SKUB 5CO7A 4DBRA 4RG8A 3PGGA 4RTZA 3PTAA 1N6AA 4HCZA 2C0TA 5GMKl 5CR2A 1OEBA 2KVQG 2XIDA 3SWNB 5FROA 2PTKA 1UECA 3X26B 1S72T 4Y92A 1VQMA 2AKLA 3S3NA 2BUDA 2NYSA 2EQMA 4FIBA 1D0ZA 3SDZA 2PVOB 2LTOA 1QVGA 5FU7C 3CC7T 1PCXA 3LH0A 2LCCA 1OX9A 1QVFA 3PMTA 3QYHB 2DNUA 4FW2A 3OS2A 4XU0A 5CKDA 3QPHA 3OYFA 3EG9B 3RR6A 1N8RU 3MCAB 2EGCA 3HSBA 1VQOQ 3P8DA 2D8HA 1N27A 1U8RA 2XU8A 4C8QF 2XKOC 1PRMC 2OAWA 3PE0A 1HJDA 1SSFA 5I21A 3CCSA 1YI2A 1YIJA 1T3SA 1KQSS 2QEXA 2F1LA 2AKKA 2EAYA 2QGFB 3JCMJ 4A54A 3FEOA 2LQWA 4J9EA 2KI7A 3HKSA 1YJNT 2MWPA 1YFNA 4CC7A 1MHNA 3JCMX 2BE7D 3AHUA 2RK1A 1VQLA 1FMKA 1RAGB 2QQBA 3A5ZB 3M59A 1Y07A 1WA7A 2E70A 3H0FA 3SWNA 2WACA 3QDRB 3MHXA 3GF5A 2R5AA 3LWHA 2X4WA 5I11A 1SRLA 5LJ5f 1IB8A 2D0NA 5DM7R 4B6MA 4NOYA 2AZSA 2EBPA 4HCBA 2DTOA 5HCKA 1KC8C 4J6XA 4HCCA 4O6JA 1ZA2B 1VQ6A 2BKDN 3V7SA 2YWWA 2Z0WA 3UT1A 2DKGA 1RAFB 2DX1A 2ESWA 3G4SA 3EG9A 4A63B 4JZ3A 3CCLA 1X6OA 2QK0A 3OQ5A 3V7CA 4E6RA 2K4YA 3VS5A 3CCRQ 4XTZA 4Z89A 1K9MU 3FRNA 1H641 2FZKB 4HVWA 5GAMg 5LJ5d 1VQPA 1K76A 2AK5A 1O9SA 4HCKA 2E64A 2PVDB 3EFSA 3JB9H 4M7AB 1YITQ 4GBQA 5GAOp 2K5LA 1NJIC 1I5OB 1NM7A 3RKWA 2YHTA 3MEVA 1M1KC 1NG2A 2LCLA 1C6VX 5IXBA 3PFSA 3RKXA 3TU4K 3S3OA 2RJCA 3KUFA 1YWOA 2RNAA 2GQIA 1VQ8Q 3FDRA 2VXFA 2G6FX 2CT4A 1M3AA 4KULA 2KRNA 4JDSA 2XG8D 1QVPA 2DIGA 2J6KA 1PSEA 2A08A 2COYA 2F2WA 5HK0A 2M1HA 3OA6A 2L0AA 1R0BG 4D8DA 3CC2T 2LT1A 2K57A 2DD5A 2F2VA 2KAFA 4MDWA 4OB2B 1AZEA 3CCQA 4JRPA 3TCJA 2X4YA 3CCET 1AVZC 1WHLA 2CP7A 1N9RA 1WHJA 3I55A 3VS4A 4L6V5 1TTHB 3CMEQ 4M7AE 1UJ0A 2RMOA 2HNIA 1AWJA 1JJ2A 1ABQA 1PSFA 1XQHA 1YJWQ 1G3SA 1W2BS 2QA4Q 1KJWA 3HRTA 3GBQA 4FYYB 2YUNA 1GFCA 4PJOB 2CSIA 3X28B 1BCOA 5GAOn 2HSPA 3OYBA 4M7AG 4M7AA 3IQLA 3CCJQ 4JS5A 4M78D 2KSSA 1PWTA 1PM3A 3CD6Q 1EZZB 1VIEA 4ZNXA 1PRLC 1Q86C 4R0KA 1DJ7B 2KRMA 3GNGA 4OVAA 3OBWA 5GAN3 4PFZA 2FHDA 2DXTA 4HKEA 1VQ5T 3I9QA 1VA7A 1RL2A 1NLPC 1IZ6A 1K73U 2YRCA 1KQ2A 2L3SA 3M55A 2OAUA 2SEMA 2X4JA 4BDZA 3CC4A 4M78B 4AMCA 3X20B 1MV0B 3OSVA 1K0XA 1S1NA 4AFSC 5CKHA 5LJ3g 2K3XA 4ZTFA 4MZMA 5CKBA 2RHXA 2DEUA 1VQMQ 2OTJQ 1YHQA 4ATOA 4PJOE 2X51A 2QG9B 4J7FA 2DM1A 5CIUA 2QASA 1X6BA 2JZ2A 3VS7A 2JM9A 4Y28E 2ZPFB 4XAXB 3CMAT 1QVGS 2W10A 4EDUA 2MMPA 4FT2A 1ZUUA 1VQ7T 3C95A 3QBYA 3KXTA 1ZQ1A 3KFVA 4CI0C 2FYKA 4DBFA 4M75D 2RHZA 1JRIA 2PZ1A 3JCMg 4PJOA 1KIKA 2FB7A 5KYXB 2EYZA 2FEIA 4M75C 2EKOA 1K9AA 1QWEA 1I5LA 4E7KA 2MPXC 1YI2Q 1FXXA 1BK2A 4M7DG 1Y96B 2QEXQ 1OU8A 3WVEB 1PD0A 3E2UA 4XTVA 3N5BB 3FLGA 1CSKA 3LLRA 1VYTA 5A0LA 1D1CA 3E1SA 2ZAEA 2JUFA 1NEBA 4M78A 2V8IA 1VQLQ 1SF9A 1VQOA 2LMJA 2M51A 3C4SA 2BIVA 2RA2A 2ZPGB 4C92G 2EJ9A 5FRMA 5D6YA 3ULRB 1KC8R 3DLMA 2P0KA 3V8KA 4C0DC 3FIFA 4LD6A 1OU9A 1N9SA 5GAMe 2OX7A 4EMKC 3M0QA 2F5TX 2M16A 1BI3A 4N0AC 4AFZC 4ZTJA 2E3HA 2QQAA 4R55A 3PT9A 2MCNA 2COWA 4A53A 1UTIA 1EX4A 2RI3A 1KQSP 2DRMA 2CUDA 3HFOA 2KE9A 1U3OA 2IIMA 1IHWA 3LGLA 5GMKh 3CBMA 2O9SA 4NL2A 4TVRA 5KYXA 1M1KR 4XTXA 3A98A 2CKKA 1VQNT 3GPLA 1OULA 1KG1A 3MP8A 1WDXA 3GNFB 3JB9D 1MMDA 4KRTA 1NE8A 3CCUA 4DEYA 4HVVA 1I81A 2QI2A 2ED0A 2DBKA 3RMQA 2RHIA 2DFUA 3H8ZA 1C0MA 3DLLA 1PKSA 1QKXA 4LD9K 2YLCA 1OQKA 3CCRA 2DXUA 5FU6C 3TREA 3S6WA 5IN1A 1MGQA 2VV5A 1T3LA 4JJBA 2DJQA 2COZA 4RTYA 2HL5C 1LCKA 2HL3A 4IIOA 2L2PA 3QZ9B 1WPYA 4AFUC 2E12A 4AFQC 3OYGA 2EJGA 2LNHB 5GAN5 2LJ0A 2KYMA 2BE9B 3E9GA 3MEAA 3VYGA 5GANe 2RJDA 1QWFA 5KE3A 2R58A 3I5SA 4EPCA 1D3BB 2FRYA 4II1A 1Y71A 4BY6C 3I55Q 1D0YA 2HZYA 2YDLA 2MK5A 4LNPA 1Q81C 5FRNA 4PJNA 1VQ8A 2L3QA 4OP0A 4UC4A 4DQ2A 1X01A 2RH2A 4OGEA 4CC2A 1G3YA 4GLKA 2MI6A 2EQKA 1VQ4T 1JJ2S 1YITT 4RTTA 1Q86R 1ZX6A 4JUVA 4IIMA 1UG1A 4BDYA 1VQ9T 4ZGDB 2GF7A 2K3BA 2VGMA 2VYTA 3EGXB 1LVKA 5LJ3e 2L89A 5GAN8 4ESRA 3M0TA 3G71T 4E7SA 3CMEA 4BI8B 1RAAB 3REAB 4IUUA 3KBGA 8ATCB 1TS9A 5IHNA 2QTXA 5KCHA 3V8JA 1QCOA 1PHTA 2KRSA 1WQWA 3CC4Q 2LZ6B 4FL6A 1KHIA 1KSWA 2LQKA 3MKDA 2D1XA 3VS3A 4BE1A 1GBRA 1M27C 2CSQA 5CCAA 1D3BA 1W2BP 4F17A 3UATA 1YHQQ 2CZ1B 1V1CA 5M9OA 3QIIA 3CPWA 3CQTA 2DERA 4HVUA 4LUEA 1NBEB 1UGVA 4MZPA 1YJWT 3SWNC 3D7SB 2RHYA 2YT6A 4ZN1A 2QA4T 1VYUA 3OW2P 4C0GA 1ZBJA 5GAN2 3OYAA 2DZ9A 5GAN7 1NEGA 3VV0A 4F7UF 5J39A 2RO0A 3CCJT 3QKJA 4KGVB 1G5VA 4EIKA 1PG5B 2XDDA 3CD6T 3ME9A 2HCKA 3ZEHA 1WX6A 4JLIA 5GJWB 3A8HB 1IGUA 2LC4A 2FVUA 1B7TA 2JW4A 2VXEA 3EGXA 3SHWA 3UA6A 2OTJA 3R6NA 2VVKA 2OJ2A 3NHNA 4YTLA 3FJ5A 2DXBA 4E7ZA 2HAXA 2RI5A 2NUTB 1UFFA 1RAIB 2VC8A 2EYWA 3OMGA 2DO3A 2JMAA 4M77E 1WXTA 5GMKj 5LJ5g 3V7RA 3HPWA 4QKUA 2WSEE 2DTHA 1K8AC 2LQNA 1JXMA 5CKEA 1IHVA 3HFNA 2EKHA 1Q7YC 3TEEA 2LX9A 3BW1A 4PNOA 4ELYC 2ZCFB 1ZUYA 2RQRA 3RKYA 1NYGA 3HRSA 4C8QB 2DMOA 3CXCS 5GAOm 4M77G 2QYZA 2LRQA 4FYVB 4D8KA 3F70A 3JB9J 2DRKA 4OGCA 4BI4A 1GCQA 1OPKA 1SHFA 2QQRA 2K6DA 1SHGA 3J81E 1K4US 3MPUB 3A8OB 3O8VA 2E41A 1U1TA 4OMLA 1LPLA 4XU1A 1BIAA 4A4FA 3QWYA 3G6EA 4F16A 2LJ3A 2YSQA 2LJ1A 2F69A 3RUXA 1VQKQ 3CCST 1C1AA 1YI2T 3EG1A 2HKNA 1YIJT 2QEXT 1QP2A 2EGEA 4J9CA 2J6FA 2JS0A 2HKQB 1JO8A 2GGRA 2X3WD 1UE9A 5CKFA 1ZSZB 4IUVA 1H8KA 2NUTA 5KE2A 1BBZA 4J9HA 3CCUQ 2CZ0B 4C8QE 3RESA 2K5FA 1BB9A 2E6NA 3DKMA 5GAOr 2XI9A 4M7AD 2P4TA 2PVGB 4M7AC 3X25B 1M90U 4A4HA 3OYJA 1UDLA 1WHHA 2E6ZA 4RUGA 1V76A 1WXUA 2O31A 3NTKA 1UB4A 2IPOB 2KXCA 3H41A 4LDYA 4C8QG 2NWMA 4C8QA 3QSUA 1Q81R 4OMOA 2PQWA 4DOVA 5L23A 3OYHA 4OMQA 1M1GA 5IAYA 3M4GA 1VQ6T 2V8JA 3FC3A 2A3LA 4LN2A 2XDPA 3G4ST 3T9NA 4C5HA 3CCLT 2ZGWA 2HQXA 4C0FA 1UGQB 4RKUE 5GMKm 2CH4A 3PIPA 1WHKA 3LYIA 1OYXA 3URGA 2NUPB 2KGTA 3UA7A 4XTWA 1YJ9Q 1VQPT 1AWXA 1BU1A 1IO6A 1UEBA 3EFRA 4E2FB 2QDLA 1X69A 2EGAA 5IXFA 1M90R 1QLYA 4P5NA 3OS5A 4B9XA
chains in the Genus database with same CATH topology
2MIOA 2YUPA 1KFZA 1ZUKA 2C0OA 1TG0A 1Y0MA 1RI9A 1W1FA 2AZVA 1CSKA 2XMFA 1VYTA 4Z8AA 2GBQA 3H0IA 1NEBA 2EPDA 2V1RA 2LMJA 2M51A 2ENMA 3EHRA 3NMZC 3UF4A 3ULRB 2GNCA 2J06A 1B3QA 2RPNA 2V1QA 1AWWA 2RF0A 2CDTA 3M0PA 3SEMA 2O2OA 1YN8A 1GFDA 4F14A 3QWXX 4OMMA 3M0QA 3THKA 4QT7A 1FYNA 1X2KA 4HXJA 4AFZC 2K79A 2D8JA 2A37A 4M4ZA 2K9GA 2MCNA 1U5SA 3O5ZA 1UTIA 4JZ4A 2LCSA 1TUCA 2DL3A 1K1ZA 1GL5A 2DRMA 1T0HA 3JV3A 2CUDA 2KE9A 5FWCA 1U3OA 2IIMA 4AG2C 2O9SA 2YUOA 1WIEA 4OMPA 2LP5A 4LE9A 2GTJA 3A98A 2LX7A 3VS0A 1T0JA 2KEAA 1ARKA 1W6XA 1WDXA 2JS2A 3I35A 2FPFA 3TSWA 4KRTA 1M30A 4DEYA 1WI7A 4HVVA 2DL7A 4RTWA 2ED0A 2DBKA 1K0SA 2CUBA 1Z9QA 1YCSB 4WCIA 3ZL7C 2BZXA 1PKSA 1HSQA 1QKXA 4DEXA 4J9IA 2JM8A 4RTZA 1SRMA 2RN8A 2VKNA 2C0TA 1SSHA 3M0RA 1T3LA 4JJBA 2DJQA 4FSSA 1OEBA 2PTKA 1GCPA 4RTYA 1UECA 1LCKA 1N5ZA 4IIOA 2L2PA 1ABOA 4Y92A 4AFUC 2AKLA 2HEQA 4AFQC 1XOVA 2LNHB 2LJ0A 2KYMA 2CH4W 1QWFA 2FO0A 3I5SA 4JPBW 3VRZA 4CC4B 2FRYA 1NLOC 1SPKA 1ZSGA 1A0NB 2DE0X 1GRIA 2YDLA 2HDAA 2DNUA 4RTXA 3VRYA 4LNPA 2CREA 2A28A 2EGCA 2FRWA 3U23A 2L3QA 2NUZA 2W0ZA 3EGUA 1JEGA 1EFNA 2M0YA 2D8HA 4CC2A 2HBWA 2YUQA 4GLMA 1W70A 1PRMC 4RTTA 2OAWA 3PE0A 3VS2A 1ZX6A 1HJDA 4IIMA 1UG1A 3EHQA 1T3SA 2K3BA 2FG0A 2DL5A 1E6GA 2AKKA 1M3BA 3PVQA 1E7OA 2DF6A 2ED1A 4ESRA 3M0TA 1WXBA 2LQWA 4J9EA 2F2XA 2SRCA 2ABLA 3REAB 1G83A 4CC7A 1M8MA 2B86A 2KR3A 2RQVA 5IH2A 2K7AA 5IHNA 1PKTA 1WLPB 1FMKA 4J9DA 1AD5A 2KYBA 2DYBA 2KROA 1WA7A 1PHTA 2KRSA 3H0FA 1WYXA 2ECZA 1WFWA 2LZ6B 1KSWA 2D1XA 3VS3A 1HD3A 3M0UA 5I11A 1SRLA 5IHKA 2BTTA 2D0NA 1GBRA 1M27C 2DA9A 2AZSA 2CSQA 4AG1C 2EBPA 4JJCA 3RNJA 4F17A 5HCKA 3UATA 4J9BA 2O9VA 1CKAA 1V1CA 2KT8A 2EYXA 3CQTA 2CT3A 2DX1A 2ESWA 4HVUA 4LUEA 1MUZA 1UGVA 4JZ3A 4A63B 2I0NA 3EG3A 2YT6A 2J7IA 1JU5C 1VYUA 4E6RA 3VS5A 2J05A 2FPDA 2BZ8A 1ZBJA 4Z89A 4JJDA 1QCFA 1UHFA 1NEGA 2JTEA 2KXDA 4HVWA 4EIKA 1K76A 2AK5A 4HCKA 1H92A 4Z88A 2JT4A 5FW9A 1ZLMA 3VS1A 2HCKA 2EW3A 1WX6A 4ORZA 5GJWB 4GBQA 2JW4A 3SHWA 3UA6A 1NM7A 3R6NA 2VVKA 2OJ2A 1G2BA 3NHNA 3FJ5A 3TSZA 1Y57A 3C0CA 1UJYA 1NG2A 2KNBB 4LUDA 3NGPA 2RQTA 1H3HA 5IXBA 1UFFA 4J9FA 3H0HA 2RQWA 1YWOA 1U06A 2EYWA 1JXOA 1M3CA 1YNZA 2RNAA 2GQIA 2JMAA 1WXTA 2G6FX 2CT4A 1M3AA 2KRNA 2X3XD 2J6KA 2LQNA 1JXMA 1AWOA 2A08A 2DBMA 2F2WA 5EC7A 1YP5A 2EKHA 3RBBB 1YWPA 5FWBA 1I1JA 2L0AA 4K11A 1CKBA 4D8DA 1I07A 1GBQA 2VWFA 1X2QA 1ZUYA 1X27A 2RQRA 1NYGA 2F2VA 1AZEA 2DMOA 1AVZC 1MV3A 3I5RA 1AZGB 1AOJA 2C0IA 1RLPC 2L3PA 3VS4A 4D8KA 2MOXA 2K2MA 4X1VA 2DRKA 1I0CA 3PVLA 1GCQA 1OPKA 1SHFA 1UJ0A 2K6DA 2RMOA 1SHGA 1K4US 1AWJA 1X43A 1ABQA 4J9GA 2GTOA 4RTUA 1JQQA 4OMLA 1SEMA 1J3TA 1Z9ZA 3QWYA 1KJWA 3LH5A 2LJ3A 4F16A 2O88A 2YSQA 3GBQA 2LJ1A 2YUNA 1GFCA 2CSIA 2ROLA 1TUDA 5ECAA 3EG1A 2E5KA 1AEYA 2HSPA 5I22A 3IQLA 2EGEA 2EYYA 4J9CA 2RQUA 2J6FA 2JS0A 1JO8A 5GJVB 2GGRA 1GCQC 2X3WD 1PWTA 1UE9A 2ROTA 2BZYA 4ZNXA 1PRLC 1H8KA 4R0KA 3REBB 2KRMA 1BBZA 4J9HA 2DILA 2JMCA 1BB9A 3I9QA 1VA7A 1NLPC 1QKWA 1OOTA 2DVJA 4RTVA 3EG0A 2L3SA 2FPEA 2SEMA 1RLQC 1UHCA 1UDLA 1MV0B 4RUGA 1WXUA 2O31A 1K0XA 2A36A 1S1NA 4AFSC 2DL4A 2KXCA 3H41A 2EVRA 2NWMA 2KBTA 2OI3A 2P4RA 2JXBA 4OMOA 2PNIA 5L23A 4OMQA 4OMNA 2DL8A 2H8HA 4LN2A 1NYFA 1UUEA 2DM1A 1VYVA 1X6BA 3VS7A 4CC3A 3TVTA 1RUWA 1OV3A 2JM9A 2EQIA 2W10A 3VS6A 1E6HA 2CH4A 1OPLA 1ZUUA 3KFVA 3EG2A 1X6GA 2KGTA 3NPFA 3UA7A 1AWXA 1BU1A 1B07A 1IO6A 2PZ1A 1KIKA 5IHIA 2KT1A 2EYZA 2FEIA 2J6OA 2QDLA 1X69A 2DLPA 2EGAA 3M0SA 5IXFA 1K9AA 1QLYA 1QWEA 1PNJA 1BK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MIO A;  2YUP A;  1KFZ A;  1ZUK A;  2C0O A;  1TG0 A;  1Y0M A;  1RI9 A;  1W1F A;  2AZV A;  1CSK A;  2XMF A;  1VYT A;  4Z8A A;  2GBQ A;  3H0I A;  1NEB A;  2EPD A;  2V1R A;  2LMJ A;  2M51 A;  2ENM A;  3EHR A;  3NMZ C;  3UF4 A;  3ULR B;  2GNC A;  2J06 A;  1B3Q A;  2RPN A;  2V1Q A;  1AWW A;  2RF0 A;  2CDT A;  3M0P A;  3SEM A;  2O2O A;  1YN8 A;  1GFD A;  4F14 A;  3QWX X;  4OMM A;  3M0Q A;  3THK A;  4QT7 A;  1FYN A;  1X2K A;  4HXJ A;  4AFZ C;  2K79 A;  2D8J A;  2A37 A;  4M4Z A;  2K9G A;  2MCN A;  1U5S A;  3O5Z A;  1UTI A;  4JZ4 A;  2LCS A;  1TUC A;  2DL3 A;  1K1Z A;  1GL5 A;  2DRM A;  1T0H A;  3JV3 A;  2CUD A;  2KE9 A;  5FWC A;  1U3O A;  2IIM A;  4AG2 C;  2O9S A;  2YUO A;  1WIE A;  4OMP A;  2LP5 A;  4LE9 A;  2GTJ A;  3A98 A;  2LX7 A;  3VS0 A;  1T0J A;  2KEA A;  1ARK A;  1W6X A;  1WDX A;  2JS2 A;  3I35 A;  2FPF A;  3TSW A;  4KRT A;  1M30 A;  4DEY A;  1WI7 A;  4HVV A;  2DL7 A;  4RTW A;  2ED0 A;  2DBK A;  1K0S A;  2CUB A;  1Z9Q A;  1YCS B;  4WCI A;  3ZL7 C;  2BZX A;  1PKS A;  1HSQ A;  1QKX A;  4DEX A;  4J9I A;  2JM8 A;  4RTZ A;  1SRM A;  2RN8 A;  2VKN A;  2C0T A;  1SSH A;  3M0R A;  1T3L A;  4JJB A;  2DJQ A;  4FSS A;  1OEB A;  2PTK A;  1GCP A;  4RTY A;  1UEC A;  1LCK A;  1N5Z A;  4IIO A;  2L2P A;  1ABO A;  4Y92 A;  4AFU C;  2AKL A;  2HEQ A;  4AFQ C;  1XOV A;  2LNH B;  2LJ0 A;  2KYM A;  2CH4 W;  1QWF A;  2FO0 A;  3I5S A;  4JPB W;  3VRZ A;  4CC4 B;  2FRY A;  1NLO C;  1SPK A;  1ZSG A;  1A0N B;  2DE0 X;  1GRI A;  2YDL A;  2HDA A;  2DNU A;  4RTX A;  3VRY A;  4LNP A;  2CRE A;  2A28 A;  2EGC A;  2FRW A;  3U23 A;  2L3Q A;  2NUZ A;  2W0Z A;  3EGU A;  1JEG A;  1EFN A;  2M0Y A;  2D8H A;  4CC2 A;  2HBW A;  2YUQ A;  4GLM A;  1W70 A;  1PRM C;  4RTT A;  2OAW A;  3PE0 A;  3VS2 A;  1ZX6 A;  1HJD A;  4IIM A;  1UG1 A;  3EHQ A;  1T3S A;  2K3B A;  2FG0 A;  2DL5 A;  1E6G A;  2AKK A;  1M3B A;  3PVQ A;  1E7O A;  2DF6 A;  2ED1 A;  4ESR A;  3M0T A;  1WXB A;  2LQW A;  4J9E A;  2F2X A;  2SRC A;  2ABL A;  3REA B;  1G83 A;  4CC7 A;  1M8M A;  2B86 A;  2KR3 A;  2RQV A;  5IH2 A;  2K7A A;  5IHN A;  1PKT A;  1WLP B;  1FMK A;  4J9D A;  1AD5 A;  2KYB A;  2DYB A;  2KRO A;  1WA7 A;  1PHT A;  2KRS A;  3H0F A;  1WYX A;  2ECZ A;  1WFW A;  2LZ6 B;  1KSW A;  2D1X A;  3VS3 A;  1HD3 A;  3M0U A;  5I11 A;  1SRL A;  5IHK A;  2BTT A;  2D0N A;  1GBR A;  1M27 C;  2DA9 A;  2AZS A;  2CSQ A;  4AG1 C;  2EBP A;  4JJC A;  3RNJ A;  4F17 A;  5HCK A;  3UAT A;  4J9B A;  2O9V A;  1CKA A;  1V1C A;  2KT8 A;  2EYX A;  3CQT A;  2CT3 A;  2DX1 A;  2ESW A;  4HVU A;  4LUE A;  1MUZ A;  1UGV A;  4JZ3 A;  4A63 B;  2I0N A;  3EG3 A;  2YT6 A;  2J7I A;  1JU5 C;  1VYU A;  4E6R A;  3VS5 A;  2J05 A;  2FPD A;  2BZ8 A;  1ZBJ A;  4Z89 A;  4JJD A;  1QCF A;  1UHF A;  1NEG A;  2JTE A;  2KXD A;  4HVW A;  4EIK A;  1K76 A;  2AK5 A;  4HCK A;  1H92 A;  4Z88 A;  2JT4 A;  5FW9 A;  1ZLM A;  3VS1 A;  2HCK A;  2EW3 A;  1WX6 A;  4ORZ A;  5GJW B;  4GBQ A;  2JW4 A;  3SHW A;  3UA6 A;  1NM7 A;  3R6N A;  2VVK A;  2OJ2 A;  1G2B A;  3NHN A;  3FJ5 A;  3TSZ A;  1Y57 A;  3C0C A;  1UJY A;  1NG2 A;  2KNB B;  4LUD A;  3NGP A;  2RQT A;  1H3H A;  5IXB A;  1UFF A;  4J9F A;  3H0H A;  2RQW A;  1YWO A;  1U06 A;  2EYW A;  1JXO A;  1M3C A;  1YNZ A;  2RNA A;  2GQI A;  2JMA A;  1WXT A;  2G6F X;  2CT4 A;  1M3A A;  2KRN A;  2X3X D;  2J6K A;  2LQN A;  1JXM A;  1AWO A;  2A08 A;  2DBM A;  2F2W A;  5EC7 A;  1YP5 A;  2EKH A;  3RBB B;  1YWP A;  5FWB A;  1I1J A;  2L0A A;  4K11 A;  1CKB A;  4D8D A;  1I07 A;  1GBQ A;  2VWF A;  1X2Q A;  1ZUY A;  1X27 A;  2RQR A;  1NYG A;  2F2V A;  1AZE A;  2DMO A;  1AVZ C;  1MV3 A;  3I5R A;  1AZG B;  1AOJ A;  2C0I A;  1RLP C;  2L3P A;  3VS4 A;  4D8K A;  2MOX A;  2K2M A;  4X1V A;  2DRK A;  1I0C A;  3PVL A;  1GCQ A;  1OPK A;  1SHF A;  1UJ0 A;  2K6D A;  2RMO A;  1SHG A;  1K4U S;  1AWJ A;  1X43 A;  1ABQ A;  4J9G A;  2GTO A;  4RTU A;  1JQQ A;  4OML A;  1SEM A;  1J3T A;  1Z9Z A;  3QWY A;  1KJW A;  3LH5 A;  2LJ3 A;  4F16 A;  2O88 A;  2YSQ A;  3GBQ A;  2LJ1 A;  2YUN A;  1GFC A;  2CSI A;  2ROL A;  1TUD A;  5ECA A;  3EG1 A;  2E5K A;  1AEY A;  2HSP A;  5I22 A;  3IQL A;  2EGE A;  2EYY A;  4J9C A;  2RQU A;  2J6F A;  2JS0 A;  1JO8 A;  5GJV B;  2GGR A;  1GCQ C;  2X3W D;  1PWT A;  1UE9 A;  2ROT A;  2BZY A;  4ZNX A;  1PRL C;  1H8K A;  4R0K A;  3REB B;  2KRM A;  1BBZ A;  4J9H A;  2DIL A;  2JMC A;  1BB9 A;  3I9Q A;  1VA7 A;  1NLP C;  1QKW A;  1OOT A;  2DVJ A;  4RTV A;  3EG0 A;  2L3S A;  2FPE A;  2SEM A;  1RLQ C;  1UHC A;  1UDL A;  1MV0 B;  4RUG A;  1WXU A;  2O31 A;  1K0X A;  2A36 A;  1S1N A;  4AFS C;  2DL4 A;  2KXC A;  3H41 A;  2EVR A;  2NWM A;  2KBT A;  2OI3 A;  2P4R A;  2JXB A;  4OMO A;  2PNI A;  5L23 A;  4OMQ A;  4OMN A;  2DL8 A;  2H8H A;  4LN2 A;  1NYF A;  1UUE A;  2DM1 A;  1VYV A;  1X6B A;  3VS7 A;  4CC3 A;  3TVT A;  1RUW A;  1OV3 A;  2JM9 A;  2EQI A;  2W10 A;  3VS6 A;  1E6H A;  2CH4 A;  1OPL A;  1ZUU A;  3KFV A;  3EG2 A;  1X6G A;  2KGT A;  3NPF A;  3UA7 A;  1AWX A;  1BU1 A;  1B07 A;  1IO6 A;  2PZ1 A;  1KIK A;  5IHI A;  2KT1 A;  2EYZ A;  2FEI A;  2J6O A;  2QDL A;  1X69 A;  2DLP A;  2EGA A;  3M0S A;  5IXF A;  1K9A A;  1QLY A;  1QWE A;  1PNJ A;  1BK2 A; 
#chains in the Genus database with same CATH topology
 1ZSZ A;  2KY9 A;  2MIO A;  1IRE B;  1LJO A;  1RI9 A;  4PJO D;  3C94 A;  3M56 A;  1Q82 C;  2OTL A;  2ATC B;  2JTM A;  3L2V A;  4PJO C;  1M8V A;  2D6F A;  5DY9 A;  3L42 A;  2V1R A;  4QW2 A;  4DOW A;  4M7D D;  5GAN 4;  3NMZ C;  2AIR B;  2M0O A;  1WZO A;  3HHT B;  4PFP A;  2V1Q A;  1AWW A;  2RF0 A;  2CDT A;  3CCQ T;  3VUZ A;  2GQV A;  1MMG A;  1VIF A;  1YN8 A;  4QQG A;  3H6Z A;  2K2V A;  2LNV A;  3G1J A;  3I55 T;  2JVV A;  4OMM A;  4DBQ A;  4HXJ A;  4M7D B;  5CK9 A;  4M78 C;  1TWB A;  3MP1 A;  3FB9 A;  3BE3 A;  2Y4Y A;  5CQX A;  4JZ4 A;  2DL3 A;  2M02 A;  3DB3 A;  2CP6 A;  4KUI A;  1T0H A;  3JV3 A;  3ASK A;  5FWC A;  1MMA A;  4AG2 C;  3CPW S;  4WTO B;  2YUO A;  4LE9 A;  5LJ5 e;  5D7U A;  3SFM A;  1ARK A;  4C92 B;  4HT9 A;  3I35 A;  4QVZ A;  3TQ7 P;  4VUB A;  3P8B B;  2FPF A;  4XU3 A;  3CCV A;  4M78 F;  3CC7 Q;  1D1B A;  3MP6 A;  1K8A R;  3EFO B;  4FYX B;  1OI1 A;  2CUB A;  4PJL A;  1Z9Q A;  3FJP A;  3CBO A;  4WCI A;  1Q7Y R;  1D1A A;  2B8A A;  5GAM h;  3ZL7 C;  4J6Y A;  2BZX A;  2DD4 A;  2JM8 A;  5KYW B;  4FSX A;  3CC4 T;  3GP8 A;  1SRM A;  4FU6 A;  4M7D E;  1HYO A;  1BCM A;  1KC8 U;  4FSS A;  2XHC A;  1QVF S;  1GCP A;  1N5Z A;  4JS4 A;  1ABO A;  2HEQ A;  3HP9 A;  1XOV A;  3VUB A;  5I2S A;  1YHQ T;  5GAN f;  1NPR A;  4MML A;  3VRZ A;  2PUO B;  1SPK A;  2KK4 A;  1ZSG A;  2KMT A;  4BUG A;  2DJZ A;  3ZFJ A;  4M7D A;  4C92 E;  1GRI A;  3PNW C;  3HRU A;  4E7J A;  3VRY A;  3WXM B;  4X9D A;  3LGF A;  2CRE A;  2A28 A;  2FRW A;  3U23 A;  2JOY A;  2NUZ A;  4FYW B;  3EGU A;  1JEG A;  1NJI U;  1EFN A;  2CP2 A;  3JCM c;  2M0Y A;  2QXF A;  2HBW A;  3CCM A;  1M1K U;  4N4I A;  3G6E Q;  1W70 A;  2YRD A;  5GAN d;  4M75 F;  4C92 A;  1TOV A;  3M9Q A;  5KYU B;  2CZ6 B;  4F04 B;  1E6G A;  1M3B A;  2ED1 A;  2GFU A;  2NLU A;  3UDC A;  3EFO A;  3PIO A;  3A8L B;  2ABL A;  1G83 A;  1M8M A;  3ER0 A;  5KYW A;  5GAN h;  2K7A A;  1KQS A;  5CAI A;  3CXC P;  1VQO T;  2RB6 A;  4J9D A;  2MAM A;  1AD5 A;  2KYB A;  2DYB A;  2KRO A;  3OBY A;  1WYX A;  2ECZ A;  4L59 A;  1WFW A;  1NZ9 A;  1NJI R;  1VQK A;  2XD0 A;  1HD3 A;  5IHK A;  2O01 E;  2BTT A;  4WF2 A;  2DA9 A;  4AG1 C;  4RCB A;  4LXC A;  3GLX A;  2DAQ A;  2A7Y A;  3M54 A;  2DVE A;  5C6S A;  1Y96 A;  2ZPI B;  3CBP A;  2CP0 A;  1R8O B;  2CZ7 B;  2CS7 A;  2X4X A;  3L2R A;  1MUZ A;  2I0N A;  3EG3 A;  1FWZ A;  2WSC E;  1M2O A;  5LJ3 h;  2YRV A;  3R6O A;  1UHF A;  1UGR B;  3EH2 A;  1Q86 U;  2KXD A;  1WNL A;  3L2Q A;  2JT4 A;  2LVM A;  1KD1 C;  1N8R C;  3VS1 A;  2EW3 A;  5KYU A;  2FL7 A;  2GFA A;  1Q82 R;  2XK0 A;  3VKI A;  3OYM A;  1ZBX A;  3CCE Q;  3CCU T;  2HSE B;  2M9U A;  3TSZ A;  1Y57 A;  3C0C A;  4FW1 A;  3QJ6 A;  5AYF A;  4LUD A;  3NGP A;  2RQT A;  3BFM A;  3PMI A;  3JB9 F;  4J9F A;  2E4H A;  2RQW A;  4C0Z A;  1JXO A;  1M3C A;  2EQU A;  3CCR T;  1BI2 A;  2OTL Q;  4V2S A;  1V29 B;  1KQ1 A;  3RBB B;  2CYZ B;  2QDY B;  5FU6 B;  4OB1 B;  2RHU A;  3OYL A;  1YWP A;  1YJ9 A;  1BIB A;  1I1J A;  1TSF A;  5KYN A;  1GBQ A;  5FLX E;  3I56 A;  4FCY A;  2RI2 A;  1NPP A;  1ZA1 B;  1RI0 A;  3M53 A;  5KH6 A;  1WJR A;  3I5R A;  1RLP C;  2V8K A;  4X1V A;  3OS1 A;  1I0C A;  1O75 A;  5GAM j;  4N0A A;  1X43 A;  1ZHI A;  1VQ8 T;  3NTH A;  2LDM A;  4LDU A;  4RTU A;  3MET A;  1SEM A;  2DYI A;  1J3T A;  1XTD A;  1PC0 A;  1Z9Z A;  3LH5 A;  4M77 D;  2O88 A;  4KT0 E;  2DZC A;  5DLO A;  1WQ7 A;  1UGS B;  3X24 B;  2E5K A;  5HKC A;  4E7H A;  1RAB B;  5I22 A;  1UGP B;  2EYY A;  2AT1 B;  2QAZ A;  2YLB A;  2LQ8 A;  2C06 A;  1GCQ C;  3JB9 I;  4KH0 B;  1K9M C;  1W2B A;  2ROT A;  2BZY A;  3JCM e;  3CME T;  1M4Z A;  3JCM W;  3QO3 A;  3CCV Q;  2JMC A;  3SB2 A;  4M77 B;  3A1P A;  1WJQ A;  2ZPE B;  1QKW A;  1OOT A;  3CMA Q;  4OF1 A;  2FPE A;  4C5E A;  3OW2 A;  3JCM P;  1VQ7 Q;  4HT8 A;  9ATC B;  4PJJ A;  1UHC A;  1XJW B;  5CVI A;  4N4H A;  2EYQ A;  5J3B A;  4OB3 B;  2IG0 A;  1ACM B;  2EVR A;  4E7L A;  1S72 A;  2KBT A;  2OI3 A;  2P4R A;  3M58 A;  2JNG A;  4F7U B;  2VUB A;  3H9N A;  1U1S A;  1QMC A;  3MEW A;  4A4G A;  4PK4 A;  2P0P A;  2DL8 A;  2H8H A;  2D0Q B;  3CC7 A;  1VYV A;  2CGH A;  4CC3 A;  2FZC B;  2XDB A;  5GAN j;  2ZPB B;  6AT1 B;  2K3Y A;  4C8Q D;  1OPL A;  2X35 A;  3EGD B;  4J83 A;  1SG5 A;  2RJF A;  5GMK i;  3EG2 A;  1JB0 E;  3NPF A;  4C8Q C;  5J26 A;  5I2M A;  1FMV A;  5IHI A;  3CCM Q;  4AT1 B;  2J6O A;  3M0S A;  4IUQ A;  1VQM T;  4GY5 A;  2OTJ T;  1M1F A;  1PNJ A;  2Y90 A;  3C12 A;  1QVG P;  2EJF A;  3QUI A;  1ZUK A;  1VUB A;  1TH7 A;  2I2L A;  5EG2 A;  1KD1 U;  1QVF P;  4M77 A;  4F7U E;  1FMW A;  2QQ9 A;  3LW5 E;  2AZV A;  2DK3 A;  2F5K A;  1R0C B;  2E3I A;  1WJS A;  5L8R E;  1YJN A;  5LJ3 j;  5FU7 B;  1WHG A;  2D9T A;  4PJM A;  3H0I A;  1HXD A;  2EPD A;  4A4K A;  7AT1 B;  2JN0 A;  2JJ9 A;  4BD3 A;  2R57 A;  4BAC A;  2J06 A;  4O5V A;  1ZSZ C;  4A4E A;  4JLG A;  1Q81 U;  4F7U G;  1K73 C;  3J80 E;  1VQN Q;  4F7U A;  2O2O A;  4KH1 B;  3GIB A;  1RAE B;  4F14 A;  4KGZ B;  3ZBD A;  1QCN A;  4MMK A;  4QQ6 A;  1X2K A;  4QT7 A;  1QQJ A;  2D8J A;  3UWN A;  4M4Z A;  2MF2 A;  3O5Z A;  3RER A;  2LCS A;  5KCO A;  4IKF A;  3EGD A;  1KD1 R;  1N8R R;  3G6E T;  1KK7 A;  1VQL T;  3E19 A;  4OMP A;  1MNE A;  2GTJ A;  3OYE A;  1BI1 A;  1JBM A;  2LX7 A;  1T0J A;  3UPU A;  4J6W A;  3RMS A;  1W6X A;  2JS2 A;  4PLL A;  1RAD B;  1M30 A;  2QGG A;  1WI7 A;  2HQE A;  2GCX A;  3MJX A;  1I4K 1;  1PD1 A;  2DL7 A;  2RJE A;  1TU0 B;  1WGS A;  4BE2 A;  3OYD A;  3VYH B;  1M9S A;  2YXY A;  1VOM A;  2A0F B;  1F1B B;  1XNI A;  2H3E B;  4DEX A;  4EMH A;  1HSQ A;  2DEQ A;  4J9I A;  2PUK B;  3OYI A;  3QZ5 B;  2RN8 A;  2VKN A;  4OMF B;  1SSH A;  4M7A F;  4PKC C;  3M0R A;  3OB9 A;  2ZPH B;  2KQW A;  2DTI A;  1MMN A;  1IGQ A;  3RDV A;  1VQ4 Q;  1D09 B;  3M57 A;  5A0G A;  3CC2 A;  3OYC A;  3OS0 A;  3L2W A;  4IUR A;  4X34 A;  2WSF E;  3I56 Q;  1VQ9 Q;  4BE0 A;  2CH4 W;  2X9H A;  3HTR A;  2FO0 A;  3CCE A;  4JPB W;  4CC4 B;  1NLO C;  3BDU A;  3QDF A;  2H3J A;  5LJ5 h;  1A0N B;  3G71 Q;  2DE0 X;  3P8H A;  1RAH B;  2HDA A;  4RTX A;  2MWO A;  2W0Z A;  1AHJ B;  1IXD A;  2YUQ A;  4GLM A;  1K9M R;  1P92 A;  3VS2 A;  3EHQ A;  1M2V B;  2Y4X A;  3MEU A;  4M7D C;  2EFI A;  2FG0 A;  4JRQ A;  4XK8 E;  2DL5 A;  2G3R A;  4J7I A;  3J7A F;  3PVQ A;  5HY6 A;  1K8A U;  1E7O A;  2VGN A;  5GAM f;  2DF6 A;  4Q5W A;  1WXB A;  2F2X A;  1Q7Y U;  2OTL T;  2SRC A;  5AT1 B;  1JJ2 P;  3QXE B;  4IUP A;  4L5G A;  2B86 A;  1VQ5 A;  4XTU A;  2KR3 A;  2RQV A;  4C92 D;  5IH2 A;  4PJO F;  1D0X A;  1PKT A;  3JCM Q;  1WLP B;  3NTI A;  1OZ2 A;  5GAN g;  2VAS A;  4C92 C;  2NUP A;  5DLQ E;  3A8G B;  2IVW A;  2RD1 A;  5D6X A;  4M7D F;  3OW2 S;  4HA8 A;  3M0U A;  4ME7 A;  1RAC B;  4MZT A;  5GAM d;  1AT1 B;  3NFC A;  4JJC A;  3OYN A;  1S72 Q;  3RNJ A;  3Q1J A;  3SD4 A;  4QQD A;  3JCM b;  4J9B A;  1OX8 A;  2O9V A;  1CKA A;  3M4Y A;  2DXC A;  2KT8 A;  2EYX A;  2CT3 A;  3OMC A;  4BI3 A;  4MDX A;  2J7I A;  4Z02 A;  1JU5 C;  3CMA A;  1BKB A;  2V26 A;  2VB6 A;  4C92 F;  1R77 A;  2J05 A;  2FPD A;  4B9W A;  2BZ8 A;  4JJD A;  1QCF A;  2LT4 A;  2HD0 A;  1VQ7 A;  2JTE A;  3JCM V;  1W4S A;  4EMG A;  4ZGJ B;  3V8L A;  1M2V A;  1H92 A;  4Z88 A;  5FW9 A;  3LX7 A;  3CPF A;  1ZLM A;  4ORZ A;  4D6W A;  4X9C A;  3CCV T;  1G2B A;  4C5G A;  5A0D A;  4XTY A;  3INZ A;  1UJY A;  4RG2 A;  2KNB B;  4E47 A;  1H3H A;  3M5A A;  2R5M A;  3H0H A;  4LDX A;  1U06 A;  4J5Y A;  1YNZ A;  2JTF A;  1I8F A;  1K73 R;  1MND A;  4PJO G;  1YJN Q;  2QTV A;  2X3X D;  3QJY A;  3S3M A;  1AWO A;  1YBY A;  3VJP A;  2DBM A;  5EC7 A;  1YP5 A;  2CP5 A;  1WHM A;  5FWB A;  1X75 C;  4K11 A;  1CKB A;  4M78 E;  2PU9 B;  2E1H A;  1I07 A;  3OYK A;  3CCS Q;  2VWF A;  4XQ3 A;  1X2Q A;  4PLI A;  1X27 A;  1YIJ Q;  1LOJ A;  1TUG B;  4BB7 A;  2L5Q A;  1Y7X A;  1MV3 A;  3DB4 A;  1AZG B;  3QG1 A;  1BI0 A;  4PFO A;  1AOJ A;  2C0I A;  2L3P A;  4M75 B;  5KYY B;  2MOX A;  2K2M A;  4Y91 A;  1G8X A;  5LJ3 f;  3PVL A;  4PL6 A;  3LWI A;  3JSC A;  3CEY A;  4M78 G;  4J9G A;  2GTO A;  1JQQ A;  3CXC A;  3JAM E;  3OY9 A;  2O4X B;  3CCM T;  3HL8 A;  1TXQ A;  5HK3 A;  1GXI E;  4ZN3 A;  2ROL A;  1TUD A;  5ECA A;  1AEY A;  4JJN K;  2E5Q A;  1Q82 U;  3BY7 A;  1VQN A;  2RQU A;  4N4G A;  1KHC A;  8AT1 B;  5GJV B;  2DIQ A;  5LJ5 j;  4J8O A;  5LJ3 d;  2RM4 A;  3JCM f;  3REB B;  1VQ6 Q;  4C0D B;  2DIL A;  3G4S Q;  3CCL Q;  4EMK B;  4RTV A;  2DVJ A;  3EG0 A;  3MO8 A;  4FM4 B;  4M75 E;  3QYG B;  2HBP A;  1B34 B;  3GOX A;  3JRZ A;  1RLQ C;  1VQK T;  4IUT A;  1VQP Q;  2A36 A;  2DL4 A;  4NL3 A;  4DA4 A;  2QQS A;  3OYY A;  4KUD K;  4FT4 A;  1G3T A;  2JXB A;  3JCM d;  3CC2 Q;  2PNI A;  1OZ3 A;  4XU2 A;  4RCC A;  4M75 G;  4R56 A;  4OMN A;  4M75 A;  5KYY A;  3L2U A;  4CRI A;  1NYF A;  1UUE A;  1QP3 A;  2AHJ B;  3EH1 A;  3TVT A;  1RUW A;  3QHS A;  3OSS C;  1OV3 A;  2RK2 A;  4QVC A;  2EQI A;  2KDS A;  1M5Q 1;  3VS6 A;  1E6H A;  2O4X A;  2P0Q A;  3JCM h;  2DPP B;  2EIF A;  1X6G A;  2L3R A;  4KBM B;  1B07 A;  2KT1 A;  1VQ4 A;  3BDL A;  1YIT A;  2DLP A;  4JRK A;  5C0M A;  3CCQ Q;  1H3Z A;  2HQH A;  1VQ9 A;  1G3W A;  2DET A;  3L2Z A;  4ANJ A;  4ELZ C;  3A8M B;  2YUP A;  4LDV A;  1KFZ A;  5LL6 S;  2C0O A;  5GMK e;  4KGX B;  2K5I A;  1TG0 A;  5GAO l;  1Y0M A;  3G71 A;  1W1F A;  1HK9 A;  4EMK A;  4E7I A;  2XMF A;  1EIF A;  4Z8A A;  1LNX A;  1B34 A;  2GBQ A;  3L1A A;  4BY6 B;  1VQ5 Q;  3EAE A;  2ENM A;  1YJ9 T;  4JRI A;  3EHR A;  3UF4 A;  3I56 T;  2GNC A;  2RPN A;  1B3Q A;  1QW1 A;  3G7Z A;  5D6W A;  3M0P A;  5A2Q E;  3SEM A;  1IRX A;  4C5I A;  1GFD A;  4M77 C;  2P84 A;  3QWX X;  1FX7 A;  4RMO A;  1M90 C;  3THK A;  1FYN A;  4NS5 A;  2K79 A;  2EWN A;  2A37 A;  5GAN 6;  2K9G A;  1U5S A;  2E10 A;  1TUC A;  5IT9 E;  1YJW A;  3JB9 G;  1K1Z A;  1GL5 A;  2QA4 A;  4QVD A;  3E9F A;  4ZGE B;  2CP3 A;  2MYS A;  1WIE A;  2ZZD A;  2LP5 A;  3AT1 B;  3CCJ A;  2L8D A;  2XIC A;  5CQY A;  2HMA A;  4M77 F;  3VS0 A;  2EQJ A;  2KEA A;  3VU3 C;  1BYM A;  4DBH A;  1YCY A;  3CD6 A;  4OB0 B;  3TSW A;  3WVD B;  4RTW A;  3CPW P;  1K0S A;  2E65 A;  2FZG B;  4LDW A;  1Q95 G;  1YCS B;  3RIR A;  5GAO q;  1SKU B;  5CO7 A;  4DBR A;  4RG8 A;  3PGG A;  4RTZ A;  3PTA A;  1N6A A;  4HCZ A;  2C0T A;  5GMK l;  5CR2 A;  1OEB A;  2KVQ G;  2XID A;  3SWN B;  5FRO A;  2PTK A;  1UEC A;  3X26 B;  1S72 T;  4Y92 A;  1VQM A;  2AKL A;  3S3N A;  2BUD A;  2NYS A;  2EQM A;  4FIB A;  1D0Z A;  3SDZ A;  2PVO B;  2LTO A;  1QVG A;  5FU7 C;  3CC7 T;  1PCX A;  3LH0 A;  2LCC A;  1OX9 A;  1QVF A;  3PMT A;  3QYH B;  2DNU A;  4FW2 A;  3OS2 A;  4XU0 A;  5CKD A;  3QPH A;  3OYF A;  3EG9 B;  3RR6 A;  1N8R U;  3MCA B;  2EGC A;  3HSB A;  1VQO Q;  3P8D A;  2D8H A;  1N27 A;  1U8R A;  2XU8 A;  4C8Q F;  2XKO C;  1PRM C;  2OAW A;  3PE0 A;  1HJD A;  1SSF A;  5I21 A;  3CCS A;  1YI2 A;  1YIJ A;  1T3S A;  1KQS S;  2QEX A;  2F1L A;  2AKK A;  2EAY A;  2QGF B;  3JCM J;  4A54 A;  3FEO A;  2LQW A;  4J9E A;  2KI7 A;  3HKS A;  1YJN T;  2MWP A;  1YFN A;  4CC7 A;  1MHN A;  3JCM X;  2BE7 D;  3AHU A;  2RK1 A;  1VQL A;  1FMK A;  1RAG B;  2QQB A;  3A5Z B;  3M59 A;  1Y07 A;  1WA7 A;  2E70 A;  3H0F A;  3SWN A;  2WAC A;  3QDR B;  3MHX A;  3GF5 A;  2R5A A;  3LWH A;  2X4W A;  5I11 A;  1SRL A;  5LJ5 f;  1IB8 A;  2D0N A;  5DM7 R;  4B6M A;  4NOY A;  2AZS A;  2EBP A;  4HCB A;  2DTO A;  5HCK A;  1KC8 C;  4J6X A;  4HCC A;  4O6J A;  1ZA2 B;  1VQ6 A;  2BKD N;  3V7S A;  2YWW A;  2Z0W A;  3UT1 A;  2DKG A;  1RAF B;  2DX1 A;  2ESW A;  3G4S A;  3EG9 A;  4A63 B;  4JZ3 A;  3CCL A;  1X6O A;  2QK0 A;  3OQ5 A;  3V7C A;  4E6R A;  2K4Y A;  3VS5 A;  3CCR Q;  4XTZ A;  4Z89 A;  1K9M U;  3FRN A;  1H64 1;  2FZK B;  4HVW A;  5GAM g;  5LJ5 d;  1VQP A;  1K76 A;  2AK5 A;  1O9S A;  4HCK A;  2E64 A;  2PVD B;  3EFS A;  3JB9 H;  4M7A B;  1YIT Q;  4GBQ A;  5GAO p;  2K5L A;  1NJI C;  1I5O B;  1NM7 A;  3RKW A;  2YHT A;  3MEV A;  1M1K C;  1NG2 A;  2LCL A;  1C6V X;  5IXB A;  3PFS A;  3RKX A;  3TU4 K;  3S3O A;  2RJC A;  3KUF A;  1YWO A;  2RNA A;  2GQI A;  1VQ8 Q;  3FDR A;  2VXF A;  2G6F X;  2CT4 A;  1M3A A;  4KUL A;  2KRN A;  4JDS A;  2XG8 D;  1QVP A;  2DIG A;  2J6K A;  1PSE A;  2A08 A;  2COY A;  2F2W A;  5HK0 A;  2M1H A;  3OA6 A;  2L0A A;  1R0B G;  4D8D A;  3CC2 T;  2LT1 A;  2K57 A;  2DD5 A;  2F2V A;  2KAF A;  4MDW A;  4OB2 B;  1AZE A;  3CCQ A;  4JRP A;  3TCJ A;  2X4Y A;  3CCE T;  1AVZ C;  1WHL A;  2CP7 A;  1N9R A;  1WHJ A;  3I55 A;  3VS4 A;  4L6V 5;  1TTH B;  3CME Q;  4M7A E;  1UJ0 A;  2RMO A;  2HNI A;  1AWJ A;  1JJ2 A;  1ABQ A;  1PSF A;  1XQH A;  1YJW Q;  1G3S A;  1W2B S;  2QA4 Q;  1KJW A;  3HRT A;  3GBQ A;  4FYY B;  2YUN A;  1GFC A;  4PJO B;  2CSI A;  3X28 B;  1BCO A;  5GAO n;  2HSP A;  3OYB A;  4M7A G;  4M7A A;  3IQL A;  3CCJ Q;  4JS5 A;  4M78 D;  2KSS A;  1PWT A;  1PM3 A;  3CD6 Q;  1EZZ B;  1VIE A;  4ZNX A;  1PRL C;  1Q86 C;  4R0K A;  1DJ7 B;  2KRM A;  3GNG A;  4OVA A;  3OBW A;  5GAN 3;  4PFZ A;  2FHD A;  2DXT A;  4HKE A;  1VQ5 T;  3I9Q A;  1VA7 A;  1RL2 A;  1NLP C;  1IZ6 A;  1K73 U;  2YRC A;  1KQ2 A;  2L3S A;  3M55 A;  2OAU A;  2SEM A;  2X4J A;  4BDZ A;  3CC4 A;  4M78 B;  4AMC A;  3X20 B;  1MV0 B;  3OSV A;  1K0X A;  1S1N A;  4AFS C;  5CKH A;  5LJ3 g;  2K3X A;  4ZTF A;  4MZM A;  5CKB A;  2RHX A;  2DEU A;  1VQM Q;  2OTJ Q;  1YHQ A;  4ATO A;  4PJO E;  2X51 A;  2QG9 B;  4J7F A;  2DM1 A;  5CIU A;  2QAS A;  1X6B A;  2JZ2 A;  3VS7 A;  2JM9 A;  4Y28 E;  2ZPF B;  4XAX B;  3CMA T;  1QVG S;  2W10 A;  4EDU A;  2MMP A;  4FT2 A;  1ZUU A;  1VQ7 T;  3C95 A;  3QBY A;  3KXT A;  1ZQ1 A;  3KFV A;  4CI0 C;  2FYK A;  4DBF A;  4M75 D;  2RHZ A;  1JRI A;  2PZ1 A;  3JCM g;  4PJO A;  1KIK A;  2FB7 A;  5KYX B;  2EYZ A;  2FEI A;  4M75 C;  2EKO A;  1K9A A;  1QWE A;  1I5L A;  4E7K A;  2MPX C;  1YI2 Q;  1FXX A;  1BK2 A;  4M7D G;  1Y96 B;  2QEX Q;  1OU8 A;  3WVE B;  1PD0 A;  3E2U A;  4XTV A;  3N5B B;  3FLG A;  1CSK A;  3LLR A;  1VYT A;  5A0L A;  1D1C A;  3E1S A;  2ZAE A;  2JUF A;  1NEB A;  4M78 A;  2V8I A;  1VQL Q;  1SF9 A;  1VQO A;  2LMJ A;  2M51 A;  3C4S A;  2BIV A;  2RA2 A;  2ZPG B;  4C92 G;  2EJ9 A;  5FRM A;  5D6Y A;  3ULR B;  1KC8 R;  3DLM A;  2P0K A;  3V8K A;  4C0D C;  3FIF A;  4LD6 A;  1OU9 A;  1N9S A;  5GAM e;  2OX7 A;  4EMK C;  3M0Q A;  2F5T X;  2M16 A;  1BI3 A;  4N0A C;  4AFZ C;  4ZTJ A;  2E3H A;  2QQA A;  4R55 A;  3PT9 A;  2MCN A;  2COW A;  4A53 A;  1UTI A;  1EX4 A;  2RI3 A;  1KQS P;  2DRM A;  2CUD A;  3HFO A;  2KE9 A;  1U3O A;  2IIM A;  1IHW A;  3LGL A;  5GMK h;  3CBM A;  2O9S A;  4NL2 A;  4TVR A;  5KYX A;  1M1K R;  4XTX A;  3A98 A;  2CKK A;  1VQN T;  3GPL A;  1OUL A;  1KG1 A;  3MP8 A;  1WDX A;  3GNF B;  3JB9 D;  1MMD A;  4KRT A;  1NE8 A;  3CCU A;  4DEY A;  4HVV A;  1I81 A;  2QI2 A;  2ED0 A;  2DBK A;  3RMQ A;  2RHI A;  2DFU A;  3H8Z A;  1C0M A;  3DLL A;  1PKS A;  1QKX A;  4LD9 K;  2YLC A;  1OQK A;  3CCR A;  2DXU A;  5FU6 C;  3TRE A;  3S6W A;  5IN1 A;  1MGQ A;  2VV5 A;  1T3L A;  4JJB A;  2DJQ A;  2COZ A;  4RTY A;  2HL5 C;  1LCK A;  2HL3 A;  4IIO A;  2L2P A;  3QZ9 B;  1WPY A;  4AFU C;  2E12 A;  4AFQ C;  3OYG A;  2EJG A;  2LNH B;  5GAN 5;  2LJ0 A;  2KYM A;  2BE9 B;  3E9G A;  3MEA A;  3VYG A;  5GAN e;  2RJD A;  1QWF A;  5KE3 A;  2R58 A;  3I5S A;  4EPC A;  1D3B B;  2FRY A;  4II1 A;  1Y71 A;  4BY6 C;  3I55 Q;  1D0Y A;  2HZY A;  2YDL A;  2MK5 A;  4LNP A;  1Q81 C;  5FRN A;  4PJN A;  1VQ8 A;  2L3Q A;  4OP0 A;  4UC4 A;  4DQ2 A;  1X01 A;  2RH2 A;  4OGE A;  4CC2 A;  1G3Y A;  4GLK A;  2MI6 A;  2EQK A;  1VQ4 T;  1JJ2 S;  1YIT T;  4RTT A;  1Q86 R;  1ZX6 A;  4JUV A;  4IIM A;  1UG1 A;  4BDY A;  1VQ9 T;  4ZGD B;  2GF7 A;  2K3B A;  2VGM A;  2VYT A;  3EGX B;  1LVK A;  5LJ3 e;  2L89 A;  5GAN 8;  4ESR A;  3M0T A;  3G71 T;  4E7S A;  3CME A;  4BI8 B;  1RAA B;  3REA B;  4IUU A;  3KBG A;  8ATC B;  1TS9 A;  5IHN A;  2QTX A;  5KCH A;  3V8J A;  1QCO A;  1PHT A;  2KRS A;  1WQW A;  3CC4 Q;  2LZ6 B;  4FL6 A;  1KHI A;  1KSW A;  2LQK A;  3MKD A;  2D1X A;  3VS3 A;  4BE1 A;  1GBR A;  1M27 C;  2CSQ A;  5CCA A;  1D3B A;  1W2B P;  4F17 A;  3UAT A;  1YHQ Q;  2CZ1 B;  1V1C A;  5M9O A;  3QII A;  3CPW A;  3CQT A;  2DER A;  4HVU A;  4LUE A;  1NBE B;  1UGV A;  4MZP A;  1YJW T;  3SWN C;  3D7S B;  2RHY A;  2YT6 A;  4ZN1 A;  2QA4 T;  1VYU A;  3OW2 P;  4C0G A;  1ZBJ A;  5GAN 2;  3OYA A;  2DZ9 A;  5GAN 7;  1NEG A;  3VV0 A;  4F7U F;  5J39 A;  2RO0 A;  3CCJ T;  3QKJ A;  4KGV B;  1G5V A;  4EIK A;  1PG5 B;  2XDD A;  3CD6 T;  3ME9 A;  2HCK A;  3ZEH A;  1WX6 A;  4JLI A;  5GJW B;  3A8H B;  1IGU A;  2LC4 A;  2FVU A;  1B7T A;  2JW4 A;  2VXE A;  3EGX A;  3SHW A;  3UA6 A;  2OTJ A;  3R6N A;  2VVK A;  2OJ2 A;  3NHN A;  4YTL A;  3FJ5 A;  2DXB A;  4E7Z A;  2HAX A;  2RI5 A;  2NUT B;  1UFF A;  1RAI B;  2VC8 A;  2EYW A;  3OMG A;  2DO3 A;  2JMA A;  4M77 E;  1WXT A;  5GMK j;  5LJ5 g;  3V7R A;  3HPW A;  4QKU A;  2WSE E;  2DTH A;  1K8A C;  2LQN A;  1JXM A;  5CKE A;  1IHV A;  3HFN A;  2EKH A;  1Q7Y C;  3TEE A;  2LX9 A;  3BW1 A;  4PNO A;  4ELY C;  2ZCF B;  1ZUY A;  2RQR A;  3RKY A;  1NYG A;  3HRS A;  4C8Q B;  2DMO A;  3CXC S;  5GAO m;  4M77 G;  2QYZ A;  2LRQ A;  4FYV B;  4D8K A;  3F70 A;  3JB9 J;  2DRK A;  4OGC A;  4BI4 A;  1GCQ A;  1OPK A;  1SHF A;  2QQR A;  2K6D A;  1SHG A;  3J81 E;  1K4U S;  3MPU B;  3A8O B;  3O8V A;  2E41 A;  1U1T A;  4OML A;  1LPL A;  4XU1 A;  1BIA A;  4A4F A;  3QWY A;  3G6E A;  4F16 A;  2LJ3 A;  2YSQ A;  2LJ1 A;  2F69 A;  3RUX A;  1VQK Q;  3CCS T;  1C1A A;  1YI2 T;  3EG1 A;  2HKN A;  1YIJ T;  2QEX T;  1QP2 A;  2EGE A;  4J9C A;  2J6F A;  2JS0 A;  2HKQ B;  1JO8 A;  2GGR A;  2X3W D;  1UE9 A;  5CKF A;  1ZSZ B;  4IUV A;  1H8K A;  2NUT A;  5KE2 A;  1BBZ A;  4J9H A;  3CCU Q;  2CZ0 B;  4C8Q E;  3RES A;  2K5F A;  1BB9 A;  2E6N A;  3DKM A;  5GAO r;  2XI9 A;  4M7A D;  2P4T A;  2PVG B;  4M7A C;  3X25 B;  1M90 U;  4A4H A;  3OYJ A;  1UDL A;  1WHH A;  2E6Z A;  4RUG A;  1V76 A;  1WXU A;  2O31 A;  3NTK A;  1UB4 A;  2IPO B;  2KXC A;  3H41 A;  4LDY A;  4C8Q G;  2NWM A;  4C8Q A;  3QSU A;  1Q81 R;  4OMO A;  2PQW A;  4DOV A;  5L23 A;  3OYH A;  4OMQ A;  1M1G A;  5IAY A;  3M4G A;  1VQ6 T;  2V8J A;  3FC3 A;  2A3L A;  4LN2 A;  2XDP A;  3G4S T;  3T9N A;  4C5H A;  3CCL T;  2ZGW A;  2HQX A;  4C0F A;  1UGQ B;  4RKU E;  5GMK m;  2CH4 A;  3PIP A;  1WHK A;  3LYI A;  1OYX A;  3URG A;  2NUP B;  2KGT A;  3UA7 A;  4XTW A;  1YJ9 Q;  1VQP T;  1AWX A;  1BU1 A;  1IO6 A;  1UEB A;  3EFR A;  4E2F B;  2QDL A;  1X69 A;  2EGA A;  5IXF A;  1M90 R;  1QLY A;  4P5N A;  3OS5 A;  4B9X A; 
#chains in the Genus database with same CATH homology
 2MIO A;  2YUP A;  1KFZ A;  1ZUK A;  2C0O A;  1TG0 A;  1Y0M A;  1RI9 A;  1W1F A;  2AZV A;  1CSK A;  2XMF A;  1VYT A;  4Z8A A;  2GBQ A;  3H0I A;  1NEB A;  2EPD A;  2V1R A;  2LMJ A;  2M51 A;  2ENM A;  3EHR A;  3NMZ C;  3UF4 A;  3ULR B;  2GNC A;  2J06 A;  1B3Q A;  2RPN A;  2V1Q A;  1AWW A;  2RF0 A;  2CDT A;  3M0P A;  3SEM A;  2O2O A;  1YN8 A;  1GFD A;  4F14 A;  3QWX X;  4OMM A;  3M0Q A;  3THK A;  4QT7 A;  1FYN A;  1X2K A;  4HXJ A;  4AFZ C;  2K79 A;  2D8J A;  2A37 A;  4M4Z A;  2K9G A;  2MCN A;  1U5S A;  3O5Z A;  1UTI A;  4JZ4 A;  2LCS A;  1TUC A;  2DL3 A;  1K1Z A;  1GL5 A;  2DRM A;  1T0H A;  3JV3 A;  2CUD A;  2KE9 A;  5FWC A;  1U3O A;  2IIM A;  4AG2 C;  2O9S A;  2YUO A;  1WIE A;  4OMP A;  2LP5 A;  4LE9 A;  2GTJ A;  3A98 A;  2LX7 A;  3VS0 A;  1T0J A;  2KEA A;  1ARK A;  1W6X A;  1WDX A;  2JS2 A;  3I35 A;  2FPF A;  3TSW A;  4KRT A;  1M30 A;  4DEY A;  1WI7 A;  4HVV A;  2DL7 A;  4RTW A;  2ED0 A;  2DBK A;  1K0S A;  2CUB A;  1Z9Q A;  1YCS B;  4WCI A;  3ZL7 C;  2BZX A;  1PKS A;  1HSQ A;  1QKX A;  4DEX A;  4J9I A;  2JM8 A;  4RTZ A;  1SRM A;  2RN8 A;  2VKN A;  2C0T A;  1SSH A;  3M0R A;  1T3L A;  4JJB A;  2DJQ A;  4FSS A;  1OEB A;  2PTK A;  1GCP A;  4RTY A;  1UEC A;  1LCK A;  1N5Z A;  4IIO A;  2L2P A;  1ABO A;  4Y92 A;  4AFU C;  2AKL A;  2HEQ A;  4AFQ C;  1XOV A;  2LNH B;  2LJ0 A;  2KYM A;  2CH4 W;  1QWF A;  2FO0 A;  3I5S A;  4JPB W;  3VRZ A;  4CC4 B;  2FRY A;  1NLO C;  1SPK A;  1ZSG A;  1A0N B;  2DE0 X;  1GRI A;  2YDL A;  2HDA A;  2DNU A;  4RTX A;  3VRY A;  4LNP A;  2CRE A;  2A28 A;  2EGC A;  2FRW A;  3U23 A;  2L3Q A;  2NUZ A;  2W0Z A;  3EGU A;  1JEG A;  1EFN A;  2M0Y A;  2D8H A;  4CC2 A;  2HBW A;  2YUQ A;  4GLM A;  1W70 A;  1PRM C;  4RTT A;  2OAW A;  3PE0 A;  3VS2 A;  1ZX6 A;  1HJD A;  4IIM A;  1UG1 A;  3EHQ A;  1T3S A;  2K3B A;  2FG0 A;  2DL5 A;  1E6G A;  2AKK A;  1M3B A;  3PVQ A;  1E7O A;  2DF6 A;  2ED1 A;  4ESR A;  3M0T A;  1WXB A;  2LQW A;  4J9E A;  2F2X A;  2SRC A;  2ABL A;  3REA B;  1G83 A;  4CC7 A;  1M8M A;  2B86 A;  2KR3 A;  2RQV A;  5IH2 A;  2K7A A;  5IHN A;  1PKT A;  1WLP B;  1FMK A;  4J9D A;  1AD5 A;  2KYB A;  2DYB A;  2KRO A;  1WA7 A;  1PHT A;  2KRS A;  3H0F A;  1WYX A;  2ECZ A;  1WFW A;  2LZ6 B;  1KSW A;  2D1X A;  3VS3 A;  1HD3 A;  3M0U A;  5I11 A;  1SRL A;  5IHK A;  2BTT A;  2D0N A;  1GBR A;  1M27 C;  2DA9 A;  2AZS A;  2CSQ A;  4AG1 C;  2EBP A;  4JJC A;  3RNJ A;  4F17 A;  5HCK A;  3UAT A;  4J9B A;  2O9V A;  1CKA A;  1V1C A;  2KT8 A;  2EYX A;  3CQT A;  2CT3 A;  2DX1 A;  2ESW A;  4HVU A;  4LUE A;  1MUZ A;  1UGV A;  4JZ3 A;  4A63 B;  2I0N A;  3EG3 A;  2YT6 A;  2J7I A;  1JU5 C;  1VYU A;  4E6R A;  3VS5 A;  2J05 A;  2FPD A;  2BZ8 A;  1ZBJ A;  4Z89 A;  4JJD A;  1QCF A;  1UHF A;  1NEG A;  2JTE A;  2KXD A;  4HVW A;  4EIK A;  1K76 A;  2AK5 A;  4HCK A;  1H92 A;  4Z88 A;  2JT4 A;  5FW9 A;  1ZLM A;  3VS1 A;  2HCK A;  2EW3 A;  1WX6 A;  4ORZ A;  5GJW B;  4GBQ A;  2JW4 A;  3SHW A;  3UA6 A;  1NM7 A;  3R6N A;  2VVK A;  2OJ2 A;  1G2B A;  3NHN A;  3FJ5 A;  3TSZ A;  1Y57 A;  3C0C A;  1UJY A;  1NG2 A;  2KNB B;  4LUD A;  3NGP A;  2RQT A;  1H3H A;  5IXB A;  1UFF A;  4J9F A;  3H0H A;  2RQW A;  1YWO A;  1U06 A;  2EYW A;  1JXO A;  1M3C A;  1YNZ A;  2RNA A;  2GQI A;  2JMA A;  1WXT A;  2G6F X;  2CT4 A;  1M3A A;  2KRN A;  2X3X D;  2J6K A;  2LQN A;  1JXM A;  1AWO A;  2A08 A;  2DBM A;  2F2W A;  5EC7 A;  1YP5 A;  2EKH A;  3RBB B;  1YWP A;  5FWB A;  1I1J A;  2L0A A;  4K11 A;  1CKB A;  4D8D A;  1I07 A;  1GBQ A;  2VWF A;  1X2Q A;  1ZUY A;  1X27 A;  2RQR A;  1NYG A;  2F2V A;  1AZE A;  2DMO A;  1AVZ C;  1MV3 A;  3I5R A;  1AZG B;  1AOJ A;  2C0I A;  1RLP C;  2L3P A;  3VS4 A;  4D8K A;  2MOX A;  2K2M A;  4X1V A;  2DRK A;  1I0C A;  3PVL A;  1GCQ A;  1OPK A;  1SHF A;  1UJ0 A;  2K6D A;  2RMO A;  1SHG A;  1K4U S;  1AWJ A;  1X43 A;  1ABQ A;  4J9G A;  2GTO A;  4RTU A;  1JQQ A;  4OML A;  1SEM A;  1J3T A;  1Z9Z A;  3QWY A;  1KJW A;  3LH5 A;  2LJ3 A;  4F16 A;  2O88 A;  2YSQ A;  3GBQ A;  2LJ1 A;  2YUN A;  1GFC A;  2CSI A;  2ROL A;  1TUD A;  5ECA A;  3EG1 A;  2E5K A;  1AEY A;  2HSP A;  5I22 A;  3IQL A;  2EGE A;  2EYY A;  4J9C A;  2RQU A;  2J6F A;  2JS0 A;  1JO8 A;  5GJV B;  2GGR A;  1GCQ C;  2X3W D;  1PWT A;  1UE9 A;  2ROT A;  2BZY A;  4ZNX A;  1PRL C;  1H8K A;  4R0K A;  3REB B;  2KRM A;  1BBZ A;  4J9H A;  2DIL A;  2JMC A;  1BB9 A;  3I9Q A;  1VA7 A;  1NLP C;  1QKW A;  1OOT A;  2DVJ A;  4RTV A;  3EG0 A;  2L3S A;  2FPE A;  2SEM A;  1RLQ C;  1UHC A;  1UDL A;  1MV0 B;  4RUG A;  1WXU A;  2O31 A;  1K0X A;  2A36 A;  1S1N A;  4AFS C;  2DL4 A;  2KXC A;  3H41 A;  2EVR A;  2NWM A;  2KBT A;  2OI3 A;  2P4R A;  2JXB A;  4OMO A;  2PNI A;  5L23 A;  4OMQ A;  4OMN A;  2DL8 A;  2H8H A;  4LN2 A;  1NYF A;  1UUE A;  2DM1 A;  1VYV A;  1X6B A;  3VS7 A;  4CC3 A;  3TVT A;  1RUW A;  1OV3 A;  2JM9 A;  2EQI A;  2W10 A;  3VS6 A;  1E6H A;  2CH4 A;  1OPL A;  1ZUU A;  3KFV A;  3EG2 A;  1X6G A;  2KGT A;  3NPF A;  3UA7 A;  1AWX A;  1BU1 A;  1B07 A;  1IO6 A;  2PZ1 A;  1KIK A;  5IHI A;  2KT1 A;  2EYZ A;  2FEI A;  2J6O A;  2QDL A;  1X69 A;  2DLP A;  2EGA A;  3M0S A;  5IXF A;  1K9A A;  1QLY A;  1QWE A;  1PNJ A;  1BK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...