2OJ2A

Nmr structure analysis of the hematopoetic cell kinase sh3 domain complexed with an artificial high affinity ligand (pd1)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
86
structure length
86
Chain Sequence
GPLGSPGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein,transferase/inhibitor
molecule keywords Hematopoetic Cell Kinase, SH3 domain
publication title Solution Structure of a Hck SH3 Domain Ligand Complex Reveals Novel Interaction Modes
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 86
sequence length 86
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2oj2A01
2K6DA 5IHKA 4LNPA 2C0OA 3EG0A 2LJ3A 4HXJA 3JV3A 2LJ0A 1H92A 1WFWA 4GBQA 2ROLA 1I1JA 1QWFA 1ZX6A 3UA7A 3I35A 2EGEA 1HD3A 1W70A 3H41A 2V1QA 3PE0A 5IHNA 1M27C 3TSWA 2M51A 1M3BA 2LP5A 5I11A 1JO8A 1GCPA 2DRMA 4RTZA 2SEMA 4D8DA 3U23A 3O5ZA 1BBZA 2IIMA 1YN8A 2CDTA 4CC7A 5HCKA 1WXBA 2RMOA 1BU1A 4LUEA 1T0HA 2DX1A 2KEAA 4DEXA 3M0TA 2EVRA 1XOVA 1UUEA 4OMLA 5GJWB 2EYXA 1GRIA 2ESWA 2EKHA 1UGVA 1B07A 4EIKA 1RLPC 2F2XA 1K0SA 3H0IA 3LH5A 1WXTA 1MUZA 3EG1A 2HCKA 4OMOA 3UF4A 2XMFA 1SEMA 3QWXX 2EW3A 3QWYA 4OMQA 1TUCA 1KFZA 4WCIA 2CT4A 2J6FA 2MIOA 2KNBB 2LMJA 2YUPA 2W10A 4KRTA 1Y0MA 2RQTA 2ROTA 1M3AA 2FO0A 2KGTA 2KRMA 4RTVA 4RTWA 2GBQA 2YDLA 1PWTA 2GNCA 1GFDA 3EHQA 1WA7A 1UG1A 2P4RA 3VS6A 2GGRA 1ZBJA 2CH4A 2FRYA 2I0NA 2K3BA 2DVJA 4Z89A 1K76A 2BZYA 2K2MA 2KYBA 2RN8A 2CUDA 2NUZA 2J05A 1KSWA 4QT7A 4HVUA 2ED1A 2FRWA 2J06A 2CSQA 1U06A 1I07A 2KR3A 2VKNA 2DMOA 1YWOA 2KBTA 3M0SA 1M30A 1AEYA 3I5RA 4FSSA 2EYYA 1NYFA 1ZUUA 4RUGA 4RTXA 1E7OA 3VRZA 2ED0A 2K7AA 3EG2A 3NHNA 1T0JA 5FWBA 2A08A 3SHWA 1UJ0A 2H8HA 1WXUA 2DL8A 2AZSA 1UECA 2YUNA 2F2WA 2BZ8A 1K0XA 1X6GA 3VS5A 1UJYA 2HBWA 2JM9A 1MV0B 4Z8AA 4A63B 1WX6A 2C0IA 2MOXA 1NM7A 1SHGA 2DF6A 1JXOA 4AG1C 4J9HA 4HVVA 1BK2A 4E6RA 2JTEA 4JPBW 1RUWA 2LNHB 1S1NA 2YUOA 1VA7A 2D0NA 2GTOA 2GQIA 1KIKA 3EGUA 2EGCA 1WDXA 4J9CA 4M4ZA 1ZLMA 1ZSGA 4LN2A 4JJDA 1QCFA 1CKBA 2DBKA 4RTTA 1A0NB 3ULRB 2JS0A 3EG3A 4D8KA 2D8JA 2YUQA 1UE9A 2K9GA 2DL4A 1SRMA 1TG0A 1U5SA 1QLYA 2OI3A 2A37A 2DJQA 2DL3A 2RQVA 4AG2C 1LCKA 2QDLA 2CUBA 5IXBA 2L0AA 1CSKA 1WLPB 1WIEA 4ESRA 1H3HA 2LX7A 1NLOC 1YP5A 2DLPA 2RNAA 1AOJA 4J9FA 2DRKA 3VS1A 4LE9A 3UATA 2VVKA 1YNZA 1WYXA 1BB9A 1TUDA 2C0TA 3M0RA 2KRNA 1H8KA 1QKWA 1ZUKA 1PRMC 1AWJA 3THKA 2PNIA 4CC4B 1W1FA 2DA9A 2KRSA 4J9IA 2SRCA 2KROA 2KXCA 1AWXA 2LQWA 2JXBA 1AD5A 2AKLA 1QWEA 2ABLA 4J9GA 1N5ZA 1YCSB 2J6KA 2MCNA 4CC2A 2CT3A 1UTIA 2KE9A 4CC3A 4Z88A 3REAB 2JMAA 3VS4A 1ABOA 1GFCA 2RQWA 1SSHA 4IIMA 2DE0X 3NPFA 3PVLA 3VRYA 3EHRA 1M3CA 1NLPC 3FJ5A 2AKKA 2O31A 2RQRA 2FG0A 4JJCA 1OPLA 1VYTA 1OV3A 2A28A 1NEBA 4F17A 4AFSC 4AFUC 2KT1A 2AZVA 4K11A 1Z9ZA 2W0ZA 2LCSA 5IH2A 1VYUA 3A98A 2O88A 1NG2A 4AFQC 1FYNA 1RLQC 4OMMA 4R0KA 2FPDA 4X1VA 2AK5A 2O9SA 2RPNA 3UA6A 1K4US 1WI7A 1NYGA 5EC7A 3RNJA 1JEGA 5L23A 2L3SA 1KJWA 2L3PA 4F16A 2DYBA 1FMKA 2JMCA 3SEMA 1OEBA 1X6BA 2EPDA 2ENMA 2FPFA 2JM8A 3H0HA 4JZ3A 5IXFA 2JS2A 2FEIA 2LQNA 1JXMA 2HEQA 1UDLA 2D1XA 3TSZA 1GBRA 2PZ1A 3CQTA 1V1CA 1ABQA 2HDAA 2DILA 1UFFA 2EYWA 1X43A 1IO6A 1X2KA 1I0CA 1GCQA 3TVTA 1GL5A 2KYMA 2OJ2A 3ZL7C 1PKSA 3PVQA 1RI9A 1EFNA 3VS7A 3C0CA 1SPKA 2LJ1A 4DEYA 3I9QA 4ORZA 1X2QA 1J3TA 2FPEA 1M8MA 2BZXA 1E6HA 2OAWA 1ARKA 5FW9A 2D8HA 3R6NA 1AZEA 2RF0A 2DBMA 1JQQA 1ZUYA 4IIOA 3NMZC 4ZNXA 1UHCA 1UHFA 3IQLA 2YT6A 3M0QA 4OMPA 2JW4A 2LZ6B 2X3WD 1SHFA 2KXDA 3M0UA 1QKXA 1T3LA 1MV3A 1NEGA 1E6GA 3VS3A 2L3QA 1K9AA 1Y57A 2DNUA 2J6OA 2B86A 2DL7A 2L2PA 1GBQA 2VWFA 2RQUA 4J9DA 2CREA 3VS2A 4AFZC 1YWPA 5IHIA 1B3QA 3KFVA 2BTTA 4JJBA 4J9BA 4LUDA 3GBQA 2E5KA 1Z9QA 3RBBB 1T3SA 2ECZA 2K79A 4OMNA 1OOTA 1U3OA 2CH4W 1AZGB 1SRLA 2DL5A 1OPKA 2O2OA 1X69A 4HCKA 2F2VA 2EBPA 2HSPA 2V1RA 3REBB 5ECAA 2O9VA 1GCQC 4JZ4A 4F14A 1W6XA 2KT8A 2CSIA 3M0PA 2PTKA 4RTYA 2M0YA 1HJDA 1AVZC 4Y92A 3NGPA 1CKAA 4J9EA 1K1ZA 4GLMA 1JU5C 2X3XD 2YSQA 2NWMA 1X27A 1PHTA 4HVWA 5FWCA 1VYVA 2EGAA 2GTJA 3H0FA 4RTUA 3I5SA 2DM1A 1PKTA 1G83A 3VS0A 2JT4A 1G2BA 1HSQA 1PNJA 2A36A 5I22A 1AWOA 2G6FX 1AWWA 1PRLC 2J7IA 2EYZA 5GJVB 2EQIA
chains in the Genus database with same CATH superfamily
2Y90A 2K6DA 1BYMA 4LNPA 2JTFA 4UC4A 2E3IA 2JJ9A 2LJ0A 1UEBA 4XU1A 4M78E 4M77D 1VQ6T 4GLKA 3OA6A 5EG2A 4GBQA 1M90C 4FIBA 4BY6B 4C8QG 2M9UA 3UA7A 1MMNA 5I2SA 1HD3A 1M9SA 1K9MR 4ME7A 4XTXA 1K8AC 3VV0A 4A4HA 1M3BA 1ZA1B 1RADB 1YCYA 4RG8A 4F7UE 2V26A 2SEMA 2XKOC 3U23A 2CDTA 3EH1A 1IXDA 1M8VA 5GAN5 2DX1A 2XI9A 3GP8A 3VJPA 1PD1A 2E3HA 3HFNA 2ESWA 4M7AE 1YJWA 1XJWB 4JLIA 2DETA 1OX8A 1WXTA 1Q95G 3TQ7P 3JCMg 5GAMj 5LJ3j 3QWXX 4NS5A 2EW3A 3QWYA 1TUCA 2QA4Q 4WCIA 2DD4A 3A8OB 1VUBA 2YUPA 2W10A 5KYWA 3SWNC 4C92A 4KRTA 1Y0MA 4L59A 1M3AA 3CC2T 4RTVA 1YJ9Q 3X24B 1FWZA 4M77B 5HY6A 2V8KA 1WA7A 2DTOA 1UG1A 2P4RA 3VS6A 3SFMA 2GGRA 1G5VA 1BCOA 2CH4A 4LDXA 2DVJA 4DBRA 3LGFA 3G6EA 4E7HA 2CP6A 1TU0B 5LJ5h 2KYBA 4C5HA 1Q81C 5GMKh 2CUDA 2NUZA 4OF1A 5J39A 3CCMA 4HVUA 2FHDA 4PK4A 4D6WA 4E47A 3EFOB 3A5ZB 2BKDN 2KR3A 5C0MA 2KBTA 1M30A 4FSSA 4E7LA 1MHNA 3CC7A 3F70A 4RTXA 1D09B 2ZPBB 3WVEB 2I2LA 3M5AA 2MPXC 4N0AA 4OB2B 2DKGA 3JCMQ 2A08A 3EG9B 2KMTA 1PSEA 1EIFA 3VYGA 1QVGP 2YXYA 1LVKA 2RHYA 1Q82R 3PGGA 2JN0A 1UECA 2YUNA 2F2WA 2BZ8A 8AT1B 4XTZA 3PIOA 1UJYA 2HBWA 1G8XA 5D7UA 1KQ1A 3CCUT 2C0IA 1SHGA 1WHMA 2MI6A 3E9GA 3GNGA 4M75D 1BK2A 4E6RA 2FZCB 2CP3A 2E4HA 2D0NA 3OYJA 3P8HA 1ZSGA 1BI1A 4BB7A 1CKBA 5GAN7 4EDUA 4C92F 1A0NB 3OMGA 3ULRB 3CMAA 3CCRA 3EGXA 2JS0A 3V8JA 1H3ZA 5A0DA 2ZGWA 2A37A 4AG2C 1OZ2A 2YHTA 1LCKA 2QDLA 2CUBA 3G7ZA 1WLPB 5LJ3h 1SF9A 1MNEA 4LDUA 4DBQA 4ESRA 1NLOC 1Q7YC 4XTUA 1QVGA 3UT1A 2EQKA 3JCMf 4KULA 2VXEA 1VQMA 2FZGB 1NE8A 1Y71A 3URGA 1PRMC 4CC4B 2PNIA 2K4YA 4EMKB 1W1FA 5DM7R 2KROA 1VQ6A 4B9WA 1VQ9Q 4M77C 3CXCA 2RK1A 2DZCA 5GAMd 2AKLA 4OB3B 5KYUB 2ABLA 4OMFB 1N5ZA 3H9NA 5AT1B 2MCNA 2GQVA 2R5AA 5A0GA 4BE2A 1IRXA 2WSEE 3GIBA 2DXTA 3REAB 2JMAA 3VS4A 1GFCA 1VOMA 2HD0A 1M3CA 1NLPC 2H3EB 3FJ5A 2BUDA 1WPYA 1EZZB 2F69A 1OPLA 3RMSA 2CP2A 2A28A 1RAFB 4AFSC 3JB9G 3OYAA 2Y4YA 2XDDA 1XNIA 1WQ7A 3A98A 2RI3A 1YIJT 3GF5A 1RLQC 3CEYA 4ZGJB 2K57A 3CCVT 2LRQA 3EAEA 1K4US 2QYZA 4ELZC 1K73C 3CCUQ 2JOYA 1W2BA 1D1CA 4M77A 1KJWA 2L3PA 4J8OA 2DYBA 4F16A 2VC8A 2CZ0B 5GAOq 1I4K1 3CC2A 1IGQA 4JZ3A 2FEIA 2LQNA 1QP2A 1D0ZA 1QVFS 4XU3A 1RL2A 3GOXA 3CD6Q 1ZBXA 1M5Q1 4C5GA 2NUPB 3FJPA 3G4SA 3C95A 3QPHA 1M1KU 3EFOA 2HBPA 2HDAA 1PM3A 2NUTB 3QHSA 2EYWA 4PJNA 1O75A 2E5QA 5DLOA 1GL5A 4J6YA 2MYSA 1S72T 2DTHA 2RD1A 1PKSA 4M7DG 1VQOT 1SPKA 2LJ1A 4ORZA 3A8MB 1HK9A 4M7AB 5M9OA 3I56Q 3OSVA 2DBMA 4PFOA 1JQQA 1ZUYA 2E65A 2RB6A 3C4SA 1YJNQ 5GAN4 2A3LA 4KUIA 2KXDA 1QKXA 4PL6A 1MV3A 1NEGA 2L3QA 1WJQA 3CCST 2XHCA 4M78G 1RAEB 3TCJA 1GBQA 2VWFA 3QKJA 2CREA 2QXFA 4DOVA 5GANj 3JCMW 5IHIA 3RKXA 4M75C 1B3QA 5HKCA 1Q86R 2EJFA 4JJBA 2KK4A 3GBQA 4LUDA 2E5KA 2RJEA 2ECZA 2K79A 4M77F 1AZGB 1VIFA 1VQ8T 1OPKA 4F7UG 2DAQA 1YIJQ 3A1PA 1VIEA 4KBMB 3G71A 3JCMJ 3M9QA 2P0PA 3L2UA 2RJFA 3CPWS 2VYTA 2QGGA 1WNLA 2M0YA 2MWOA 1HJDA 2EQUA 1AVZC 2X3XD 1PHTA 4FYVB 4QKUA 2ZPHB 2QTXA 4M7AG 1KD1C 1YJWT 5GAOn 2KAFA 2DIQA 1RAHB 1PKTA 5KYUA 1G83A 2RM4A 3VS0A 3M56A 2JT4A 1HSQA 3NTKA 1AWOA 4C8QD 2QQRA 2K5FA 2EYZA 4R55A 1VQ5A 1K9MU 2JTMA 5IHKA 2IG0A 3M4YA 4HCBA 1OU9A 2XU8A 1YITT 5HK3A 3I35A 4GY5A 1W70A 3H41A 2XICA 2X9HA 2V1QA 1N8RU 2PUKB 2QQBA 4BI3A 3G6ET 2O4XA 5I11A 1JO8A 3HL8A 1M1KR 4RTZA 1RAIB 2EJGA 4L5GA 1WHLA 1BBZA 3O5ZA 1YN8A 3J80E 4C0ZA 1BU1A 2LDMA 3M4GA 2EWNA 3CCVA 2ZPGB 1G3TA 3CC7T 5GJWB 2KDSA 1GRIA 2EKHA 1UGVA 3VKIA 5I2MA 4E7KA 3ER0A 1JJ2P 5CCAA 2JZ2A 3M59A 4L6V5 1SEMA 1KFZA 2J6FA 4C8QB 5D6XA 3ZEHA 3CBOA 2NUTA 2EFIA 4ZGDB 3V7RA 5CAIA 2MK5A 1IZ6A 1Y96B 4ZN1A 4C5EA 3X26B 5GANd 3QYGB 3LWIA 3DKMA 5FU7C 2K3BA 4M7AA 4X9DA 1K76A 2BZYA 1UGQB 4PFZA 1S72A 1OULA 4M75F 3OS0A 2BE7D 3WVDB 1VQOA 2K2VA 1YJWQ 4PJOE 2ED1A 5GMKj 3CBPA 3DLLA 4II1A 3T9NA 2VKNA 2NLUA 3M0SA 4A53A 3S3NA 1AEYA 1MNDA 1ZUUA 1Q82U 3L2ZA 2L8DA 2ED0A 3EG2A 1HXDA 1NPRA 5FWBA 5FRNA 1G3SA 2GFAA 2Z0WA 3CCSA 2H8HA 2DL8A 3VYHB 3MEVA 3MEAA 4PJLA 2LX9A 1X6GA 2P0QA 1IHVA 4C92C 3G6EQ 1R77A 2MOXA 2DF6A 2XK0A 2LQ8A 4AG1C 4DBHA 3CCMQ 3LWHA 5KE3A 4JPBW 2YUOA 1VQ8A 3OBWA 2OX7A 3QSUA 1VQ7A 3EGUA 2EGCA 3MP8A 1WDXA 2XD0A 4J9CA 5A0LA 4Y91A 4M4ZA 4E7IA 2DVEA 3CC7Q 5GAMf 1BI2A 3BFMA 4RTTA 1N8RR 4C0DB 3EG3A 1UB4A 3NTIA 3X20B 3JRZA 3LLRA 1TG0A 4AT1B 1U5SA 1TXQA 4FT4A 2RQVA 4IUUA 3PTAA 3HP9A 5IXBA 2L0AA 1B7TA 2LT4A 1KQSS 2R57A 1AOJA 5DLQE 2DRKA 3UATA 4N0AC 1X75C 2COZA 2GFUA 3E1SA 1WYXA 1BB9A 5AYFA 3HRTA 4B6MA 4BD3A 3MEWA 2KRNA 5KYYB 4PLIA 1AWJA 1O9SA 3OSSC 3G1JA 1ZSZC 1NJIC 4P5NA 1KHCA 2DXUA 2DA9A 4J9IA 3QUIA 2DXCA 1AD5A 3E2UA 1FMWA 1YITA 4RG2A 1YCSB 4CC2A 4FCYA 2YRDA 3CMAQ 4KGXB 3G4ST 3CCRQ 4CC3A 4MDWA 1M90R 4Z88A 4JRPA 1ABOA 3JB9D 1SSHA 3NPFA 3RUXA 3VRYA 5KH6A 4C0FA 4C5IA 2O31A 2RQRA 3CMET 3JCMe 3MP1A 1OV3A 4X34A 3E9FA 2KT1A 3A8HB 4K11A 4EPCA 1VQMQ 1VYUA 3OW2P 1TOVA 1FYNA 1ZA2B 4OMMA 2FPDA 5LJ5d 4C8QA 4KUDK 4QW2A 3S6WA 2AK5A 2LNVA 1VQ6Q 2O9SA 1SKUB 3LGLA 4FYXB 2R5MA 3N5BB 1NYGA 1ZSZA 5L23A 1D3BB 2YLCA 1VQLA 1TS9A 4BY6C 2ZZDA 1TUGB 3C12A 2QTVA 2JM8A 2KY9A 3CXCP 5IXFA 3EFSA 1JXMA 1FX7A 1UDLA 2D1XA 4MZTA 4KH1B 3OYCA 4N4GA 4IUVA 3BE3A 2X4YA 1V1CA 2V8JA 5GMKi 4LD9K 4M7DD 2DZ9A 1ABQA 2K5IA 3BDLA 2DILA 1BI0A 1X43A 2L5QA 1X2KA 3J81E 3SD4A 3G71T 3TVTA 2M0OA 3KUFA 2KYMA 1VQNT 1QVGS 3TEEA 2M02A 1M2VB 4J6XA 4C92E 1EFNA 2L89A 3C0CA 3OW2A 1Q81R 2FZKB 4DEYA 3I9QA 1X2QA 3VUBA 2FPEA 3RR6A 2E12A 1E6HA 3S3OA 2D8HA 3R6NA 1AZEA 2RF0A 3CC2Q 3QJ6A 5GAOl 3CC4T 3MKDA 3NMZC 1UHCA 4QQDA 4ZNXA 3IQLA 3JCMX 2YT6A 4M78D 1W2BP 3OS2A 3QBYA 2JW4A 2LZ6B 3M0UA 3LX7A 1T3LA 5IN1A 1VQ5T 1IREB 3G4SQ 1Q86U 1MMGA 2DNUA 3OQ5A 1M4ZA 3QG1A 5LJ3d 2YWWA 3HSBA 1JRIA 3LYIA 3UDCA 4J9DA 3MHXA 3VS2A 2VV5A 4MMKA 4AFZC 1YWPA 4C8QF 3UWNA 3KFVA 4FSXA 1XQHA 2R58A 2HKQB 1NZ9A 4JS5A 2OTJT 4OMNA 4B9XA 3OYNA 2CH4W 2M1HA 8ATCB 1WJRA 2RI2A 4M7DB 1OU8A 2F1LA 4PJOB 2HQHA 2EBPA 2HSPA 3REBB 3OYMA 2K3XA 3META 1VQ4T 1VQKA 1AT1B 4M7AD 1TWBA 2P4TA 2O9VA 3A8GB 2VUBA 4RTYA 1JB0E 4FW2A 2F5KA 2F5TX 1OYXA 5KYYA 4MDXA 2VASA 2QDYB 1C0MA 2MWPA 1LPLA 2DEQA 4HVWA 4J83A 1VYVA 3H0FA 4EMHA 4RTUA 3M55A 5GAN6 1YBYA 1G2BA 1LNXA 1PNJA 4M78B 2A36A 5I22A 1Q7YR 4CRIA 1R0CB 4PKCC 3FC3A 3PFSA 2CS7A 2J7IA 1OZ3A 5GJVB 3OYFA 2B8AA 3FRNA 3FIFA 1YHQT 3H6ZA 1AHJB 3M58A 1B34B 2RK2A 5FU6B 5D6YA 3L2WA 2ROLA 1I1JA 3G71Q 1QWFA 1ZX6A 4F7UB 5CKDA 4IUTA 4HT8A 3PE0A 1M27C 4DOWA 3OYLA 4YTLA 3CMEA 1GCPA 2KQWA 2DRMA 4PJOG 3EG9A 1RI0A 1I5OB 1U1SA 2IIMA 2DTIA 1WXBA 5HCKA 2RMOA 4M75G 1D3BA 4LUEA 1T0HA 2EJ9A 1KG1A 3P8BB 4DEXA 5GANf 5GAOp 3HPWA 1XOVA 4OMLA 1VQ5Q 4EMKC 4EIKA 3QDRB 3LH5A 1QW1A 4RCBA 3OS1A 3UF4A 2XMFA 4OMQA 2XG8D 2MIOA 2KNBB 2QEXT 2ZPIB 2LMJA 4Y28E 2ROTA 4BE1A 2FO0A 2KGTA 5LJ5g 2E1HA 3BW1A 4FYWB 2GNCA 1GFDA 3EHQA 3JCMh 1M2VA 1VQ7T 1Y07A 2K5LA 2FRYA 4DQ2A 4Z89A 2DYIA 2M16A 5FROA 1VQPT 3CCVQ 4M77E 2K2MA 2QGFB 1VQNA 4CI0C 1M1KC 2RN8A 4A4GA 2CP0A 1ZHIA 2OTLA 3CCQA 2X4XA 1DJ7B 4EMKA 1YFNA 2J06A 4FM4B 1PC0A 4BI4A 2JNGA 3CC4A 2EYYA 4LDYA 1NYFA 1KC8U 4RUGA 3VRZA 4M78C 4PLLA 1OX9A 2VXFA 3NHNA 3ASKA 5KYXB 3SHWA 3CCET 1N9RA 3WXMB 1UJ0A 3L42A 1OI1A 3NFCA 3HHTB 3L1AA 5IT9E 3VS5A 4M7DA 1ZQ1A 2DD5A 1WX6A 2HKNA 3QJYA 4A63B 4QVZA 1NM7A 1S72Q 1XTDA 2P0KA 2VGMA 2OTJA 1VQOQ 4HVVA 3GLXA 3CCJT 1RUWA 3RDVA 3X28B 1VA7A 2JUFA 3ME9A 2GTOA 2GQIA 1KIKA 1VQ4A 2HQEA 1R0BG 2QQAA 2E6NA 4M7AC 5GAMg 2QAZA 2X51A 5LJ3g 4ELYC 2DBKA 3UPUA 3JB9F 2ZAEA 2YUQA 1UE9A 2DL4A 1SRMA 2COYA 4XAXB 4M78A 1QLYA 2DJQA 3CCSQ 1D1AA 2HL5C 4AMCA 4BUGA 4HT9A 1CSKA 1WIEA 2NUPA 2LX7A 2HQXA 4ANJA 1B34A 1VQLT 3DB3A 2QI2A 2VVKA 2DK3A 3GPLA 2C0TA 4F7UA 2QQSA 3EFRA 3THKA 3TU4K 5CQYA 3OB9A 1M90U 3V8LA 1VQ8Q 2SRCA 5LJ5f 1VQ7Q 1YHQA 2KXCA 3RESA 2LQWA 5GAMe 2XDBA 3PMTA 4C0GA 4J9GA 1K9MC 2AIRB 2CT3A 1K8AU 2WACA 3OYYA 2RH2A 3TREA 2KE9A 5GMKl 4QVDA 4A4FA 3SWNB 3OS5A 2RQWA 2DE0X 2EQMA 4XTVA 2QA4T 3PVLA 3M57A 3EHRA 2G3RA 2RHXA 1IHWA 5FLXE 2A0FB 2FG0A 3RKYA 4JJCA 3KXTA 1N8RC 1JJ2S 4C92G 4M7DF 2CZ1B 4M75E 4F17A 4V2SA 1FXXA 5CKBA 3HTRA 1Z9ZA 3OYEA 2LCSA 3V7CA 5GAN3 1NG2A 4AFQC 1WHJA 4ZTJA 3H8ZA 4OB0B 1YI2A 1V76A 3UA6A 4XU2A 1WI7A 3BY7A 5KCOA 2ZCFB 5L8RE 1YITQ 1KC8R 2L3SA 4OP0A 2O01E 4QQGA 2QEXA 1M1FA 2E41A 1X6BA 3FLGA 1WZOA 2EPDA 1KK7A 1RAGB 3I55A 2PVOB 3M54A 1MGQA 3H0HA 4M78F 3BDUA 2ZPFB 2HEQA 2CKKA 5FRMA 3TSZA 2OAUA 2HMAA 2LT1A 2PZ1A 3MP6A 4KGVB 2DFUA 4RKUE 2COWA 4BE0A 1P92A 1D0XA 1V29B 3CBMA 1KQSP 1VQPA 3PT9A 1Q81U 5LJ3f 4F7UF 1IO6A 1WHKA 5D6WA 4LXCA 1VQKT 1GCQA 5C6SA 2DERA 2OJ2A 3FEOA 1QQJA 1I81A 2GCXA 5KYXA 1VQLQ 3JCMc 1UGPB 4E2FB 2BZXA 4HCZA 2OAWA 2LQKA 4BACA 1ARKA 5FW9A 4M7AF 3J7AF 4IIOA 4C8QC 1UHFA 5J3BA 4O5VA 5KYNA 3CCEA 1W4SA 3M0QA 1WHHA 4OMPA 2HSEB 3QDFA 1Q82C 2X3WD 4E7JA 1WJSA 5IAYA 1TSFA 1E6GA 2RJCA 3VS3A 3HRUA 1Y57A 2J6OA 2B86A 2ZPEB 2RJDA 2L2PA 4FYYB 4IUQA 3CCLA 4DA4A 4QVCA 2CP5A 1D1BA 4XU0A 1WGSA 4BI8B 3D7SB 2YRCA 3CCJA 2CZ7B 2D6FA 1KQSA 5CQXA 2BTTA 3MO8A 4J9BA 1Z9QA 2WSFE 4IKFA 3RBBB 1T3SA 1K8AR 1U3OA 3HRSA 3SB2A 4LD6A 2DL5A 2HNIA 5GAOm 2JVVA 1VQ9T 3EH2A 2DEUA 2V1RA 2RO0A 4JZ4A 2V8IA 1W6XA 4PFPA 2K3YA 2CSIA 2E70A 2PTKA 4DBFA 1ACMB 3MEUA 1CKAA 4EMGA 4JJNK 4J9EA 4GLMA 1JU5C 1Q7YU 2NWMA 3JCMV 4J7IA 5DY9A 5FWCA 2EGAA 4Q5WA 1Y96A 2DM1A 3OYIA 2FYKA 3RIRA 2G6FX 3S3MA 4PNOA 3SWNA 4NL3A 2QQ9A 2C0OA 3EG0A 2LJ3A 3KBGA 4FL6A 4HXJA 3QYHB 3JV3A 5CVIA 2XIDA 4F04B 4NOYA 3OBYA 1H92A 1NJIR 1WFWA 1VQKQ 3L2QA 1QP3A 3QXEB 3JCMP 2YLBA 2BIVA 2VGNA 1PG5B 4PJOD 2EGEA 3OW2S 2DIGA 4C0DC 1TTHB 3ZBDA 2QA4A 4HCCA 1BI3A 3Q1JA 3RKWA 2LCCA 2DJZA 5IHNA 4M77G 3TSWA 4BDZA 2M51A 2LP5A 1YJ9A 2RHUA 4E7ZA 1D0YA 1BIBA 3SDZA 4D8DA 4KT0E 1NBEB 2OTLT 3L2RA 3CCQT 3CD6T 3NTHA 2WSCE 4JRIA 4CC7A 4ZN3A 1IB8A 2KSSA 4LDVA 2KEAA 2AHJB 2CYZB 5GANg 2HZYA 1LOJA 4IUPA 3CXCS 3M0TA 2EVRA 1K73U 1UUEA 1X6OA 2EYXA 1B07A 1NPPA 1JBMA 1RLPC 4MZPA 2P84A 5GAMh 2F2XA 1K0SA 1HYOA 3H0IA 2QK0A 1MUZA 3EG1A 2E6ZA 2HCKA 4OMOA 2CT4A 3FDRA 5J26A 3I56T 2RQTA 2NYSA 3A8LB 1R8OB 2KRMA 1KQ2A 3CMEQ 4RTWA 3DLMA 2LC4A 2GBQA 1YJNT 2YDLA 2MAMA 3JCMb 1MMAA 3OYGA 5CKEA 1PWTA 3QZ9B 4KGZB 4C8QE 2L3RA 3MJXA 3E19A 5GANe 3RERA 1ZBJA 5GAN2 2H3JA 2I0NA 1FMVA 2KVQG 4M75B 4N4IA 3X25B 2VB6A 1W2BS 3PIPA 2J05A 1KSWA 4QT7A 1QVFP 2LVMA 4JS4A 2FRWA 2CSQA 1U06A 2GF7A 1I07A 2DMOA 1YWOA 5CKHA 2DPPB 5CIUA 1I5LA 2C06A 3I5RA 4J7FA 4ZTFA 1E7OA 2YRVA 2O4XB 4E7SA 2K7AA 4XQ3A 5CR2A 1T0JA 4OGEA 3OMCA 2MMPA 9ATCB 5I21A 4JRQA 1BIAA 1WXUA 3VUZA 2AZSA 3OYKA 1K0XA 5HK0A 2JM9A 1MV0B 4Z8AA 1H641 1Q86C 1JXOA 1VQNQ 3EGDB 1RAAB 5CO7A 4J9HA 1UGSB 4MZMA 3CCQQ 2CZ6B 2OTLQ 2JTEA 5GAN8 4VUBA 2LNHB 1S1NA 1G3YA 4RMOA 5A2QE 4OVAA 1VQ9A 2HAXA 1EX4A 3DB4A 3AHUA 1QVFA 1ZLMA 3CC4Q 4JDSA 2D9TA 4FW1A 4LN2A 4JJDA 1QCFA 2ATCB 2FB7A 1N9SA 3ZFJA 4J5YA 4OB1B 4D8KA 2D8JA 2K9GA 1GXIE 4XTWA 1KD1U 2OI3A 2DL3A 4HKEA 2D0QB 3QIIA 3PNWC 4J6WA 1N6AA 1YI2T 2AT1B 1SG5A 1H3HA 2DLPA 1YP5A 2RNAA 4J9FA 5LL6S 3VS1A 4LE9A 1K73R 1X01A 1YNZA 4A4KA 1QCOA 1TUDA 2PUOB 2OTJQ 3M0RA 3CPWP 1H8KA 4FT2A 1QKWA 1ZUKA 3FB9A 5CKFA 3I55T 1G3WA 3HFOA 2KRSA 2EIFA 3LH0A 1AWXA 4O6JA 1VQ4Q 2CGHA 2JXBA 1QWEA 3CCUA 4M7DC 2J6KA 1I8FA 1UTIA 2A7YA 4PJOC 2PU9B 4RCCA 3RMQA 4C92D 4A4EA 6AT1B 2DXBA 2XDPA 4IIMA 5CK9A 3OYHA 1N27A 2AKKA 3CD6A 2IPOB 4A54A 2PVGB 1VYTA 2MF2A 3JCMd 1NEBA 2EKOA 4AFUC 2HL3A 2AZVA 3OYBA 1RABB 5FU7B 2W0ZA 2FL7A 3O8VA 2QASA 5IH2A 2O88A 1F1BB 5KCHA 4QQ6A 2QG9B 2RA2A 5LJ5e 4X1VA 4R0KA 3QO3A 3AT1B 5GMKe 3JAME 1PSFA 1BKBA 1YHQQ 3PMIA 3C94A 2RPNA 1M2OA 2RI5A 1Y7XA 3P8DA 1JEGA 5EC7A 3RNJA 3CPWA 5GMKm 3OY9A 5FU6C 4KH0B 4X9CA 1FMKA 2JMCA 1KHIA 3SEMA 1OEBA 3I56A 1WQWA 2ENMA 2FPFA 4PJOA 3VU3C 3CCLT 2JS2A 2E10A 1YJNA 4M75A 1OQKA 4PJJA 1GBRA 1IGUA 3CQTA 4WTOB 2LCLA 2E64A 2EYQA 2PVDB 4MMLA 5KYWB 2RHIA 4C92B 1UFFA 1I0CA 1YI2Q 3ZL7C 3PVQA 1RI9A 3VS7A 3CCMT 1J3TA 2X4JA 3MPUB 1M1GA 1M8MA 1RACB 1LJOA 4PJMA 2QEXQ 1PCXA 2BE9B 1YIJA 3I55Q 4OGCA 2IVWA 4HA8A 1KD1R 4XTYA 3CPFA 3EGDA 5KE2A 1SSFA 1KC8C 3JSCA 1SHFA 1TH7A 2EAYA 4Z02A 3GNFB 1K9AA 5LJ3e 4JUVA 1VQPQ 2DL7A 4IURA 5GANh 3OYDA 3R6OA 2FVUA 2RQUA 2CP7A 4N4HA 1QCNA 1PD0A 4JRKA 1C1AA 4JLGA 3MCAB 4TVRA 4R56A 1ZSZB 1WHGA 1U1TA 4LDWA 1OOTA 3LW5E 1SRLA 4ZGEB 1QMCA 1YJ9T 2X35A 3QZ5B 2O2OA 4WF2A 1X69A 4HCKA 2EQJA 2F2VA 4ATOA 2Y4XA 3JB9J 1BCMA 1C6VX 4PJOF 5ECAA 4F14A 1GCQC 2KT8A 3CCEQ 3M0PA 4M7DE 3CMAT 3CCRT 4Y92A 3NGPA 5GAOr 4FU6A 5LJ5j 3JB9H 3INZA 3V7SA 1K1ZA 1MMDA 1U8RA 2KI7A 2YSQA 1X27A 2RHZA 4BDYA 3L2VA 2GTJA 3CCLQ 4XK8E 3HKSA 3I5SA 2DO3A 3EGXB 7AT1B 1QVPA 1NJIU 3V8KA 3CCJQ 1UGRB 4NL2A 2PQWA 1JJ2A 2X4WA 2LTOA 1VQMT 1PRLC 1AWWA 3JB9I 3M53A 2EQIA
chains in the Genus database with same CATH topology
2K6DA 5IHKA 4LNPA 2C0OA 3EG0A 2LJ3A 4HXJA 3JV3A 2LJ0A 1H92A 1WFWA 4GBQA 2ROLA 1I1JA 1QWFA 1ZX6A 3UA7A 3I35A 2EGEA 1HD3A 1W70A 3H41A 2V1QA 3PE0A 5IHNA 1M27C 3TSWA 2M51A 1M3BA 2LP5A 5I11A 1JO8A 1GCPA 2DRMA 4RTZA 2SEMA 4D8DA 3U23A 3O5ZA 1BBZA 2IIMA 1YN8A 2CDTA 4CC7A 5HCKA 1WXBA 2RMOA 1BU1A 4LUEA 1T0HA 2DX1A 2KEAA 4DEXA 3M0TA 2EVRA 1XOVA 1UUEA 4OMLA 5GJWB 2EYXA 1GRIA 2ESWA 2EKHA 1UGVA 1B07A 4EIKA 1RLPC 2F2XA 1K0SA 3H0IA 3LH5A 1WXTA 1MUZA 3EG1A 2HCKA 4OMOA 3UF4A 2XMFA 1SEMA 3QWXX 2EW3A 3QWYA 4OMQA 1TUCA 1KFZA 4WCIA 2CT4A 2J6FA 2MIOA 2KNBB 2LMJA 2YUPA 2W10A 4KRTA 1Y0MA 2RQTA 2ROTA 1M3AA 2FO0A 2KGTA 2KRMA 4RTVA 4RTWA 2GBQA 2YDLA 1PWTA 2GNCA 1GFDA 3EHQA 1WA7A 1UG1A 2P4RA 3VS6A 2GGRA 1ZBJA 2CH4A 2FRYA 2I0NA 2K3BA 2DVJA 4Z89A 1K76A 2BZYA 2K2MA 2KYBA 2RN8A 2CUDA 2NUZA 2J05A 1KSWA 4QT7A 4HVUA 2ED1A 2FRWA 2J06A 2CSQA 1U06A 1I07A 2KR3A 2VKNA 2DMOA 1YWOA 2KBTA 3M0SA 1M30A 1AEYA 3I5RA 4FSSA 2EYYA 1NYFA 1ZUUA 4RUGA 4RTXA 1E7OA 3VRZA 2ED0A 2K7AA 3EG2A 3NHNA 1T0JA 5FWBA 2A08A 3SHWA 1UJ0A 2H8HA 1WXUA 2DL8A 2AZSA 1UECA 2YUNA 2F2WA 2BZ8A 1K0XA 1X6GA 3VS5A 1UJYA 2HBWA 2JM9A 1MV0B 4Z8AA 4A63B 1WX6A 2C0IA 2MOXA 1NM7A 1SHGA 2DF6A 1JXOA 4AG1C 4J9HA 4HVVA 1BK2A 4E6RA 2JTEA 4JPBW 1RUWA 2LNHB 1S1NA 2YUOA 1VA7A 2D0NA 2GTOA 2GQIA 1KIKA 3EGUA 2EGCA 1WDXA 4J9CA 4M4ZA 1ZLMA 1ZSGA 4LN2A 4JJDA 1QCFA 1CKBA 2DBKA 4RTTA 1A0NB 3ULRB 2JS0A 3EG3A 4D8KA 2D8JA 2YUQA 1UE9A 2K9GA 2DL4A 1SRMA 1TG0A 1U5SA 1QLYA 2OI3A 2A37A 2DJQA 2DL3A 2RQVA 4AG2C 1LCKA 2QDLA 2CUBA 5IXBA 2L0AA 1CSKA 1WLPB 1WIEA 4ESRA 1H3HA 2LX7A 1NLOC 1YP5A 2DLPA 2RNAA 1AOJA 4J9FA 2DRKA 3VS1A 4LE9A 3UATA 2VVKA 1YNZA 1WYXA 1BB9A 1TUDA 2C0TA 3M0RA 2KRNA 1H8KA 1QKWA 1ZUKA 1PRMC 1AWJA 3THKA 2PNIA 4CC4B 1W1FA 2DA9A 2KRSA 4J9IA 2SRCA 2KROA 2KXCA 1AWXA 2LQWA 2JXBA 1AD5A 2AKLA 1QWEA 2ABLA 4J9GA 1N5ZA 1YCSB 2J6KA 2MCNA 4CC2A 2CT3A 1UTIA 2KE9A 4CC3A 4Z88A 3REAB 2JMAA 3VS4A 1ABOA 1GFCA 2RQWA 1SSHA 4IIMA 2DE0X 3NPFA 3PVLA 3VRYA 3EHRA 1M3CA 1NLPC 3FJ5A 2AKKA 2O31A 2RQRA 2FG0A 4JJCA 1OPLA 1VYTA 1OV3A 2A28A 1NEBA 4F17A 4AFSC 4AFUC 2KT1A 2AZVA 4K11A 1Z9ZA 2W0ZA 2LCSA 5IH2A 1VYUA 3A98A 2O88A 1NG2A 4AFQC 1FYNA 1RLQC 4OMMA 4R0KA 2FPDA 4X1VA 2AK5A 2O9SA 2RPNA 3UA6A 1K4US 1WI7A 1NYGA 5EC7A 3RNJA 1JEGA 5L23A 2L3SA 1KJWA 2L3PA 4F16A 2DYBA 1FMKA 2JMCA 3SEMA 1OEBA 1X6BA 2EPDA 2ENMA 2FPFA 2JM8A 3H0HA 4JZ3A 5IXFA 2JS2A 2FEIA 2LQNA 1JXMA 2HEQA 1UDLA 2D1XA 3TSZA 1GBRA 2PZ1A 3CQTA 1V1CA 1ABQA 2HDAA 2DILA 1UFFA 2EYWA 1X43A 1IO6A 1X2KA 1I0CA 1GCQA 3TVTA 1GL5A 2KYMA 2OJ2A 3ZL7C 1PKSA 3PVQA 1RI9A 1EFNA 3VS7A 3C0CA 1SPKA 2LJ1A 4DEYA 3I9QA 4ORZA 1X2QA 1J3TA 2FPEA 1M8MA 2BZXA 1E6HA 2OAWA 1ARKA 5FW9A 2D8HA 3R6NA 1AZEA 2RF0A 2DBMA 1JQQA 1ZUYA 4IIOA 3NMZC 4ZNXA 1UHCA 1UHFA 3IQLA 2YT6A 3M0QA 4OMPA 2JW4A 2LZ6B 2X3WD 1SHFA 2KXDA 3M0UA 1QKXA 1T3LA 1MV3A 1NEGA 1E6GA 3VS3A 2L3QA 1K9AA 1Y57A 2DNUA 2J6OA 2B86A 2DL7A 2L2PA 1GBQA 2VWFA 2RQUA 4J9DA 2CREA 3VS2A 4AFZC 1YWPA 5IHIA 1B3QA 3KFVA 2BTTA 4JJBA 4J9BA 4LUDA 3GBQA 2E5KA 1Z9QA 3RBBB 1T3SA 2ECZA 2K79A 4OMNA 1OOTA 1U3OA 2CH4W 1AZGB 1SRLA 2DL5A 1OPKA 2O2OA 1X69A 4HCKA 2F2VA 2EBPA 2HSPA 2V1RA 3REBB 5ECAA 2O9VA 1GCQC 4JZ4A 4F14A 1W6XA 2KT8A 2CSIA 3M0PA 2PTKA 4RTYA 2M0YA 1HJDA 1AVZC 4Y92A 3NGPA 1CKAA 4J9EA 1K1ZA 4GLMA 1JU5C 2X3XD 2YSQA 2NWMA 1X27A 1PHTA 4HVWA 5FWCA 1VYVA 2EGAA 2GTJA 3H0FA 4RTUA 3I5SA 2DM1A 1PKTA 1G83A 3VS0A 2JT4A 1G2BA 1HSQA 1PNJA 2A36A 5I22A 1AWOA 2G6FX 1AWWA 1PRLC 2J7IA 2EYZA 5GJVB 2EQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K6D A;  5IHK A;  4LNP A;  2C0O A;  3EG0 A;  2LJ3 A;  4HXJ A;  3JV3 A;  2LJ0 A;  1H92 A;  1WFW A;  4GBQ A;  2ROL A;  1I1J A;  1QWF A;  1ZX6 A;  3UA7 A;  3I35 A;  2EGE A;  1HD3 A;  1W70 A;  3H41 A;  2V1Q A;  3PE0 A;  5IHN A;  1M27 C;  3TSW A;  2M51 A;  1M3B A;  2LP5 A;  5I11 A;  1JO8 A;  1GCP A;  2DRM A;  4RTZ A;  2SEM A;  4D8D A;  3U23 A;  3O5Z A;  1BBZ A;  2IIM A;  1YN8 A;  2CDT A;  4CC7 A;  5HCK A;  1WXB A;  2RMO A;  1BU1 A;  4LUE A;  1T0H A;  2DX1 A;  2KEA A;  4DEX A;  3M0T A;  2EVR A;  1XOV A;  1UUE A;  4OML A;  5GJW B;  2EYX A;  1GRI A;  2ESW A;  2EKH A;  1UGV A;  1B07 A;  4EIK A;  1RLP C;  2F2X A;  1K0S A;  3H0I A;  3LH5 A;  1WXT A;  1MUZ A;  3EG1 A;  2HCK A;  4OMO A;  3UF4 A;  2XMF A;  1SEM A;  3QWX X;  2EW3 A;  3QWY A;  4OMQ A;  1TUC A;  1KFZ A;  4WCI A;  2CT4 A;  2J6F A;  2MIO A;  2KNB B;  2LMJ A;  2YUP A;  2W10 A;  4KRT A;  1Y0M A;  2RQT A;  2ROT A;  1M3A A;  2FO0 A;  2KGT A;  2KRM A;  4RTV A;  4RTW A;  2GBQ A;  2YDL A;  1PWT A;  2GNC A;  1GFD A;  3EHQ A;  1WA7 A;  1UG1 A;  2P4R A;  3VS6 A;  2GGR A;  1ZBJ A;  2CH4 A;  2FRY A;  2I0N A;  2K3B A;  2DVJ A;  4Z89 A;  1K76 A;  2BZY A;  2K2M A;  2KYB A;  2RN8 A;  2CUD A;  2NUZ A;  2J05 A;  1KSW A;  4QT7 A;  4HVU A;  2ED1 A;  2FRW A;  2J06 A;  2CSQ A;  1U06 A;  1I07 A;  2KR3 A;  2VKN A;  2DMO A;  1YWO A;  2KBT A;  3M0S A;  1M30 A;  1AEY A;  3I5R A;  4FSS A;  2EYY A;  1NYF A;  1ZUU A;  4RUG A;  4RTX A;  1E7O A;  3VRZ A;  2ED0 A;  2K7A A;  3EG2 A;  3NHN A;  1T0J A;  5FWB A;  2A08 A;  3SHW A;  1UJ0 A;  2H8H A;  1WXU A;  2DL8 A;  2AZS A;  1UEC A;  2YUN A;  2F2W A;  2BZ8 A;  1K0X A;  1X6G A;  3VS5 A;  1UJY A;  2HBW A;  2JM9 A;  1MV0 B;  4Z8A A;  4A63 B;  1WX6 A;  2C0I A;  2MOX A;  1NM7 A;  1SHG A;  2DF6 A;  1JXO A;  4AG1 C;  4J9H A;  4HVV A;  1BK2 A;  4E6R A;  2JTE A;  4JPB W;  1RUW A;  2LNH B;  1S1N A;  2YUO A;  1VA7 A;  2D0N A;  2GTO A;  2GQI A;  1KIK A;  3EGU A;  2EGC A;  1WDX A;  4J9C A;  4M4Z A;  1ZLM A;  1ZSG A;  4LN2 A;  4JJD A;  1QCF A;  1CKB A;  2DBK A;  4RTT A;  1A0N B;  3ULR B;  2JS0 A;  3EG3 A;  4D8K A;  2D8J A;  2YUQ A;  1UE9 A;  2K9G A;  2DL4 A;  1SRM A;  1TG0 A;  1U5S A;  1QLY A;  2OI3 A;  2A37 A;  2DJQ A;  2DL3 A;  2RQV A;  4AG2 C;  1LCK A;  2QDL A;  2CUB A;  5IXB A;  2L0A A;  1CSK A;  1WLP B;  1WIE A;  4ESR A;  1H3H A;  2LX7 A;  1NLO C;  1YP5 A;  2DLP A;  2RNA A;  1AOJ A;  4J9F A;  2DRK A;  3VS1 A;  4LE9 A;  3UAT A;  2VVK A;  1YNZ A;  1WYX A;  1BB9 A;  1TUD A;  2C0T A;  3M0R A;  2KRN A;  1H8K A;  1QKW A;  1ZUK A;  1PRM C;  1AWJ A;  3THK A;  2PNI A;  4CC4 B;  1W1F A;  2DA9 A;  2KRS A;  4J9I A;  2SRC A;  2KRO A;  2KXC A;  1AWX A;  2LQW A;  2JXB A;  1AD5 A;  2AKL A;  1QWE A;  2ABL A;  4J9G A;  1N5Z A;  1YCS B;  2J6K A;  2MCN A;  4CC2 A;  2CT3 A;  1UTI A;  2KE9 A;  4CC3 A;  4Z88 A;  3REA B;  2JMA A;  3VS4 A;  1ABO A;  1GFC A;  2RQW A;  1SSH A;  4IIM A;  2DE0 X;  3NPF A;  3PVL A;  3VRY A;  3EHR A;  1M3C A;  1NLP C;  3FJ5 A;  2AKK A;  2O31 A;  2RQR A;  2FG0 A;  4JJC A;  1OPL A;  1VYT A;  1OV3 A;  2A28 A;  1NEB A;  4F17 A;  4AFS C;  4AFU C;  2KT1 A;  2AZV A;  4K11 A;  1Z9Z A;  2W0Z A;  2LCS A;  5IH2 A;  1VYU A;  3A98 A;  2O88 A;  1NG2 A;  4AFQ C;  1FYN A;  1RLQ C;  4OMM A;  4R0K A;  2FPD A;  4X1V A;  2AK5 A;  2O9S A;  2RPN A;  3UA6 A;  1K4U S;  1WI7 A;  1NYG A;  5EC7 A;  3RNJ A;  1JEG A;  5L23 A;  2L3S A;  1KJW A;  2L3P A;  4F16 A;  2DYB A;  1FMK A;  2JMC A;  3SEM A;  1OEB A;  1X6B A;  2EPD A;  2ENM A;  2FPF A;  2JM8 A;  3H0H A;  4JZ3 A;  5IXF A;  2JS2 A;  2FEI A;  2LQN A;  1JXM A;  2HEQ A;  1UDL A;  2D1X A;  3TSZ A;  1GBR A;  2PZ1 A;  3CQT A;  1V1C A;  1ABQ A;  2HDA A;  2DIL A;  1UFF A;  2EYW A;  1X43 A;  1IO6 A;  1X2K A;  1I0C A;  1GCQ A;  3TVT A;  1GL5 A;  2KYM A;  2OJ2 A;  3ZL7 C;  1PKS A;  3PVQ A;  1RI9 A;  1EFN A;  3VS7 A;  3C0C A;  1SPK A;  2LJ1 A;  4DEY A;  3I9Q A;  4ORZ A;  1X2Q A;  1J3T A;  2FPE A;  1M8M A;  2BZX A;  1E6H A;  2OAW A;  1ARK A;  5FW9 A;  2D8H A;  3R6N A;  1AZE A;  2RF0 A;  2DBM A;  1JQQ A;  1ZUY A;  4IIO A;  3NMZ C;  4ZNX A;  1UHC A;  1UHF A;  3IQL A;  2YT6 A;  3M0Q A;  4OMP A;  2JW4 A;  2LZ6 B;  2X3W D;  1SHF A;  2KXD A;  3M0U A;  1QKX A;  1T3L A;  1MV3 A;  1NEG A;  1E6G A;  3VS3 A;  2L3Q A;  1K9A A;  1Y57 A;  2DNU A;  2J6O A;  2B86 A;  2DL7 A;  2L2P A;  1GBQ A;  2VWF A;  2RQU A;  4J9D A;  2CRE A;  3VS2 A;  4AFZ C;  1YWP A;  5IHI A;  1B3Q A;  3KFV A;  2BTT A;  4JJB A;  4J9B A;  4LUD A;  3GBQ A;  2E5K A;  1Z9Q A;  3RBB B;  1T3S A;  2ECZ A;  2K79 A;  4OMN A;  1OOT A;  1U3O A;  2CH4 W;  1AZG B;  1SRL A;  2DL5 A;  1OPK A;  2O2O A;  1X69 A;  4HCK A;  2F2V A;  2EBP A;  2HSP A;  2V1R A;  3REB B;  5ECA A;  2O9V A;  1GCQ C;  4JZ4 A;  4F14 A;  1W6X A;  2KT8 A;  2CSI A;  3M0P A;  2PTK A;  4RTY A;  2M0Y A;  1HJD A;  1AVZ C;  4Y92 A;  3NGP A;  1CKA A;  4J9E A;  1K1Z A;  4GLM A;  1JU5 C;  2X3X D;  2YSQ A;  2NWM A;  1X27 A;  1PHT A;  4HVW A;  5FWC A;  1VYV A;  2EGA A;  2GTJ A;  3H0F A;  4RTU A;  3I5S A;  2DM1 A;  1PKT A;  1G83 A;  3VS0 A;  2JT4 A;  1G2B A;  1HSQ A;  1PNJ A;  2A36 A;  5I22 A;  1AWO A;  2G6F X;  1AWW A;  1PRL C;  2J7I A;  2EYZ A;  5GJV B;  2EQI A; 
#chains in the Genus database with same CATH topology
 2Y90 A;  2K6D A;  1BYM A;  4LNP A;  2JTF A;  4UC4 A;  2E3I A;  2JJ9 A;  2LJ0 A;  1UEB A;  4XU1 A;  4M78 E;  4M77 D;  1VQ6 T;  4GLK A;  3OA6 A;  5EG2 A;  4GBQ A;  1M90 C;  4FIB A;  4BY6 B;  4C8Q G;  2M9U A;  3UA7 A;  1MMN A;  5I2S A;  1HD3 A;  1M9S A;  1K9M R;  4ME7 A;  4XTX A;  1K8A C;  3VV0 A;  4A4H A;  1M3B A;  1ZA1 B;  1RAD B;  1YCY A;  4RG8 A;  4F7U E;  2V26 A;  2SEM A;  2XKO C;  3U23 A;  2CDT A;  3EH1 A;  1IXD A;  1M8V A;  5GAN 5;  2DX1 A;  2XI9 A;  3GP8 A;  3VJP A;  1PD1 A;  2E3H A;  3HFN A;  2ESW A;  4M7A E;  1YJW A;  1XJW B;  4JLI A;  2DET A;  1OX8 A;  1WXT A;  1Q95 G;  3TQ7 P;  3JCM g;  5GAM j;  5LJ3 j;  3QWX X;  4NS5 A;  2EW3 A;  3QWY A;  1TUC A;  2QA4 Q;  4WCI A;  2DD4 A;  3A8O B;  1VUB A;  2YUP A;  2W10 A;  5KYW A;  3SWN C;  4C92 A;  4KRT A;  1Y0M A;  4L59 A;  1M3A A;  3CC2 T;  4RTV A;  1YJ9 Q;  3X24 B;  1FWZ A;  4M77 B;  5HY6 A;  2V8K A;  1WA7 A;  2DTO A;  1UG1 A;  2P4R A;  3VS6 A;  3SFM A;  2GGR A;  1G5V A;  1BCO A;  2CH4 A;  4LDX A;  2DVJ A;  4DBR A;  3LGF A;  3G6E A;  4E7H A;  2CP6 A;  1TU0 B;  5LJ5 h;  2KYB A;  4C5H A;  1Q81 C;  5GMK h;  2CUD A;  2NUZ A;  4OF1 A;  5J39 A;  3CCM A;  4HVU A;  2FHD A;  4PK4 A;  4D6W A;  4E47 A;  3EFO B;  3A5Z B;  2BKD N;  2KR3 A;  5C0M A;  2KBT A;  1M30 A;  4FSS A;  4E7L A;  1MHN A;  3CC7 A;  3F70 A;  4RTX A;  1D09 B;  2ZPB B;  3WVE B;  2I2L A;  3M5A A;  2MPX C;  4N0A A;  4OB2 B;  2DKG A;  3JCM Q;  2A08 A;  3EG9 B;  2KMT A;  1PSE A;  1EIF A;  3VYG A;  1QVG P;  2YXY A;  1LVK A;  2RHY A;  1Q82 R;  3PGG A;  2JN0 A;  1UEC A;  2YUN A;  2F2W A;  2BZ8 A;  8AT1 B;  4XTZ A;  3PIO A;  1UJY A;  2HBW A;  1G8X A;  5D7U A;  1KQ1 A;  3CCU T;  2C0I A;  1SHG A;  1WHM A;  2MI6 A;  3E9G A;  3GNG A;  4M75 D;  1BK2 A;  4E6R A;  2FZC B;  2CP3 A;  2E4H A;  2D0N A;  3OYJ A;  3P8H A;  1ZSG A;  1BI1 A;  4BB7 A;  1CKB A;  5GAN 7;  4EDU A;  4C92 F;  1A0N B;  3OMG A;  3ULR B;  3CMA A;  3CCR A;  3EGX A;  2JS0 A;  3V8J A;  1H3Z A;  5A0D A;  2ZGW A;  2A37 A;  4AG2 C;  1OZ2 A;  2YHT A;  1LCK A;  2QDL A;  2CUB A;  3G7Z A;  1WLP B;  5LJ3 h;  1SF9 A;  1MNE A;  4LDU A;  4DBQ A;  4ESR A;  1NLO C;  1Q7Y C;  4XTU A;  1QVG A;  3UT1 A;  2EQK A;  3JCM f;  4KUL A;  2VXE A;  1VQM A;  2FZG B;  1NE8 A;  1Y71 A;  3URG A;  1PRM C;  4CC4 B;  2PNI A;  2K4Y A;  4EMK B;  1W1F A;  5DM7 R;  2KRO A;  1VQ6 A;  4B9W A;  1VQ9 Q;  4M77 C;  3CXC A;  2RK1 A;  2DZC A;  5GAM d;  2AKL A;  4OB3 B;  5KYU B;  2ABL A;  4OMF B;  1N5Z A;  3H9N A;  5AT1 B;  2MCN A;  2GQV A;  2R5A A;  5A0G A;  4BE2 A;  1IRX A;  2WSE E;  3GIB A;  2DXT A;  3REA B;  2JMA A;  3VS4 A;  1GFC A;  1VOM A;  2HD0 A;  1M3C A;  1NLP C;  2H3E B;  3FJ5 A;  2BUD A;  1WPY A;  1EZZ B;  2F69 A;  1OPL A;  3RMS A;  2CP2 A;  2A28 A;  1RAF B;  4AFS C;  3JB9 G;  3OYA A;  2Y4Y A;  2XDD A;  1XNI A;  1WQ7 A;  3A98 A;  2RI3 A;  1YIJ T;  3GF5 A;  1RLQ C;  3CEY A;  4ZGJ B;  2K57 A;  3CCV T;  2LRQ A;  3EAE A;  1K4U S;  2QYZ A;  4ELZ C;  1K73 C;  3CCU Q;  2JOY A;  1W2B A;  1D1C A;  4M77 A;  1KJW A;  2L3P A;  4J8O A;  2DYB A;  4F16 A;  2VC8 A;  2CZ0 B;  5GAO q;  1I4K 1;  3CC2 A;  1IGQ A;  4JZ3 A;  2FEI A;  2LQN A;  1QP2 A;  1D0Z A;  1QVF S;  4XU3 A;  1RL2 A;  3GOX A;  3CD6 Q;  1ZBX A;  1M5Q 1;  4C5G A;  2NUP B;  3FJP A;  3G4S A;  3C95 A;  3QPH A;  1M1K U;  3EFO A;  2HBP A;  2HDA A;  1PM3 A;  2NUT B;  3QHS A;  2EYW A;  4PJN A;  1O75 A;  2E5Q A;  5DLO A;  1GL5 A;  4J6Y A;  2MYS A;  1S72 T;  2DTH A;  2RD1 A;  1PKS A;  4M7D G;  1VQO T;  1SPK A;  2LJ1 A;  4ORZ A;  3A8M B;  1HK9 A;  4M7A B;  5M9O A;  3I56 Q;  3OSV A;  2DBM A;  4PFO A;  1JQQ A;  1ZUY A;  2E65 A;  2RB6 A;  3C4S A;  1YJN Q;  5GAN 4;  2A3L A;  4KUI A;  2KXD A;  1QKX A;  4PL6 A;  1MV3 A;  1NEG A;  2L3Q A;  1WJQ A;  3CCS T;  2XHC A;  4M78 G;  1RAE B;  3TCJ A;  1GBQ A;  2VWF A;  3QKJ A;  2CRE A;  2QXF A;  4DOV A;  5GAN j;  3JCM W;  5IHI A;  3RKX A;  4M75 C;  1B3Q A;  5HKC A;  1Q86 R;  2EJF A;  4JJB A;  2KK4 A;  3GBQ A;  4LUD A;  2E5K A;  2RJE A;  2ECZ A;  2K79 A;  4M77 F;  1AZG B;  1VIF A;  1VQ8 T;  1OPK A;  4F7U G;  2DAQ A;  1YIJ Q;  3A1P A;  1VIE A;  4KBM B;  3G71 A;  3JCM J;  3M9Q A;  2P0P A;  3L2U A;  2RJF A;  3CPW S;  2VYT A;  2QGG A;  1WNL A;  2M0Y A;  2MWO A;  1HJD A;  2EQU A;  1AVZ C;  2X3X D;  1PHT A;  4FYV B;  4QKU A;  2ZPH B;  2QTX A;  4M7A G;  1KD1 C;  1YJW T;  5GAO n;  2KAF A;  2DIQ A;  1RAH B;  1PKT A;  5KYU A;  1G83 A;  2RM4 A;  3VS0 A;  3M56 A;  2JT4 A;  1HSQ A;  3NTK A;  1AWO A;  4C8Q D;  2QQR A;  2K5F A;  2EYZ A;  4R55 A;  1VQ5 A;  1K9M U;  2JTM A;  5IHK A;  2IG0 A;  3M4Y A;  4HCB A;  1OU9 A;  2XU8 A;  1YIT T;  5HK3 A;  3I35 A;  4GY5 A;  1W70 A;  3H41 A;  2XIC A;  2X9H A;  2V1Q A;  1N8R U;  2PUK B;  2QQB A;  4BI3 A;  3G6E T;  2O4X A;  5I11 A;  1JO8 A;  3HL8 A;  1M1K R;  4RTZ A;  1RAI B;  2EJG A;  4L5G A;  1WHL A;  1BBZ A;  3O5Z A;  1YN8 A;  3J80 E;  4C0Z A;  1BU1 A;  2LDM A;  3M4G A;  2EWN A;  3CCV A;  2ZPG B;  1G3T A;  3CC7 T;  5GJW B;  2KDS A;  1GRI A;  2EKH A;  1UGV A;  3VKI A;  5I2M A;  4E7K A;  3ER0 A;  1JJ2 P;  5CCA A;  2JZ2 A;  3M59 A;  4L6V 5;  1SEM A;  1KFZ A;  2J6F A;  4C8Q B;  5D6X A;  3ZEH A;  3CBO A;  2NUT A;  2EFI A;  4ZGD B;  3V7R A;  5CAI A;  2MK5 A;  1IZ6 A;  1Y96 B;  4ZN1 A;  4C5E A;  3X26 B;  5GAN d;  3QYG B;  3LWI A;  3DKM A;  5FU7 C;  2K3B A;  4M7A A;  4X9D A;  1K76 A;  2BZY A;  1UGQ B;  4PFZ A;  1S72 A;  1OUL A;  4M75 F;  3OS0 A;  2BE7 D;  3WVD B;  1VQO A;  2K2V A;  1YJW Q;  4PJO E;  2ED1 A;  5GMK j;  3CBP A;  3DLL A;  4II1 A;  3T9N A;  2VKN A;  2NLU A;  3M0S A;  4A53 A;  3S3N A;  1AEY A;  1MND A;  1ZUU A;  1Q82 U;  3L2Z A;  2L8D A;  2ED0 A;  3EG2 A;  1HXD A;  1NPR A;  5FWB A;  5FRN A;  1G3S A;  2GFA A;  2Z0W A;  3CCS A;  2H8H A;  2DL8 A;  3VYH B;  3MEV A;  3MEA A;  4PJL A;  2LX9 A;  1X6G A;  2P0Q A;  1IHV A;  4C92 C;  3G6E Q;  1R77 A;  2MOX A;  2DF6 A;  2XK0 A;  2LQ8 A;  4AG1 C;  4DBH A;  3CCM Q;  3LWH A;  5KE3 A;  4JPB W;  2YUO A;  1VQ8 A;  3OBW A;  2OX7 A;  3QSU A;  1VQ7 A;  3EGU A;  2EGC A;  3MP8 A;  1WDX A;  2XD0 A;  4J9C A;  5A0L A;  4Y91 A;  4M4Z A;  4E7I A;  2DVE A;  3CC7 Q;  5GAM f;  1BI2 A;  3BFM A;  4RTT A;  1N8R R;  4C0D B;  3EG3 A;  1UB4 A;  3NTI A;  3X20 B;  3JRZ A;  3LLR A;  1TG0 A;  4AT1 B;  1U5S A;  1TXQ A;  4FT4 A;  2RQV A;  4IUU A;  3PTA A;  3HP9 A;  5IXB A;  2L0A A;  1B7T A;  2LT4 A;  1KQS S;  2R57 A;  1AOJ A;  5DLQ E;  2DRK A;  3UAT A;  4N0A C;  1X75 C;  2COZ A;  2GFU A;  3E1S A;  1WYX A;  1BB9 A;  5AYF A;  3HRT A;  4B6M A;  4BD3 A;  3MEW A;  2KRN A;  5KYY B;  4PLI A;  1AWJ A;  1O9S A;  3OSS C;  3G1J A;  1ZSZ C;  1NJI C;  4P5N A;  1KHC A;  2DXU A;  2DA9 A;  4J9I A;  3QUI A;  2DXC A;  1AD5 A;  3E2U A;  1FMW A;  1YIT A;  4RG2 A;  1YCS B;  4CC2 A;  4FCY A;  2YRD A;  3CMA Q;  4KGX B;  3G4S T;  3CCR Q;  4CC3 A;  4MDW A;  1M90 R;  4Z88 A;  4JRP A;  1ABO A;  3JB9 D;  1SSH A;  3NPF A;  3RUX A;  3VRY A;  5KH6 A;  4C0F A;  4C5I A;  2O31 A;  2RQR A;  3CME T;  3JCM e;  3MP1 A;  1OV3 A;  4X34 A;  3E9F A;  2KT1 A;  3A8H B;  4K11 A;  4EPC A;  1VQM Q;  1VYU A;  3OW2 P;  1TOV A;  1FYN A;  1ZA2 B;  4OMM A;  2FPD A;  5LJ5 d;  4C8Q A;  4KUD K;  4QW2 A;  3S6W A;  2AK5 A;  2LNV A;  1VQ6 Q;  2O9S A;  1SKU B;  3LGL A;  4FYX B;  2R5M A;  3N5B B;  1NYG A;  1ZSZ A;  5L23 A;  1D3B B;  2YLC A;  1VQL A;  1TS9 A;  4BY6 C;  2ZZD A;  1TUG B;  3C12 A;  2QTV A;  2JM8 A;  2KY9 A;  3CXC P;  5IXF A;  3EFS A;  1JXM A;  1FX7 A;  1UDL A;  2D1X A;  4MZT A;  4KH1 B;  3OYC A;  4N4G A;  4IUV A;  3BE3 A;  2X4Y A;  1V1C A;  2V8J A;  5GMK i;  4LD9 K;  4M7D D;  2DZ9 A;  1ABQ A;  2K5I A;  3BDL A;  2DIL A;  1BI0 A;  1X43 A;  2L5Q A;  1X2K A;  3J81 E;  3SD4 A;  3G71 T;  3TVT A;  2M0O A;  3KUF A;  2KYM A;  1VQN T;  1QVG S;  3TEE A;  2M02 A;  1M2V B;  4J6X A;  4C92 E;  1EFN A;  2L89 A;  3C0C A;  3OW2 A;  1Q81 R;  2FZK B;  4DEY A;  3I9Q A;  1X2Q A;  3VUB A;  2FPE A;  3RR6 A;  2E12 A;  1E6H A;  3S3O A;  2D8H A;  3R6N A;  1AZE A;  2RF0 A;  3CC2 Q;  3QJ6 A;  5GAO l;  3CC4 T;  3MKD A;  3NMZ C;  1UHC A;  4QQD A;  4ZNX A;  3IQL A;  3JCM X;  2YT6 A;  4M78 D;  1W2B P;  3OS2 A;  3QBY A;  2JW4 A;  2LZ6 B;  3M0U A;  3LX7 A;  1T3L A;  5IN1 A;  1VQ5 T;  1IRE B;  3G4S Q;  1Q86 U;  1MMG A;  2DNU A;  3OQ5 A;  1M4Z A;  3QG1 A;  5LJ3 d;  2YWW A;  3HSB A;  1JRI A;  3LYI A;  3UDC A;  4J9D A;  3MHX A;  3VS2 A;  2VV5 A;  4MMK A;  4AFZ C;  1YWP A;  4C8Q F;  3UWN A;  3KFV A;  4FSX A;  1XQH A;  2R58 A;  2HKQ B;  1NZ9 A;  4JS5 A;  2OTJ T;  4OMN A;  4B9X A;  3OYN A;  2CH4 W;  2M1H A;  8ATC B;  1WJR A;  2RI2 A;  4M7D B;  1OU8 A;  2F1L A;  4PJO B;  2HQH A;  2EBP A;  2HSP A;  3REB B;  3OYM A;  2K3X A;  3MET A;  1VQ4 T;  1VQK A;  1AT1 B;  4M7A D;  1TWB A;  2P4T A;  2O9V A;  3A8G B;  2VUB A;  4RTY A;  1JB0 E;  4FW2 A;  2F5K A;  2F5T X;  1OYX A;  5KYY A;  4MDX A;  2VAS A;  2QDY B;  1C0M A;  2MWP A;  1LPL A;  2DEQ A;  4HVW A;  4J83 A;  1VYV A;  3H0F A;  4EMH A;  4RTU A;  3M55 A;  5GAN 6;  1YBY A;  1G2B A;  1LNX A;  1PNJ A;  4M78 B;  2A36 A;  5I22 A;  1Q7Y R;  4CRI A;  1R0C B;  4PKC C;  3FC3 A;  3PFS A;  2CS7 A;  2J7I A;  1OZ3 A;  5GJV B;  3OYF A;  2B8A A;  3FRN A;  3FIF A;  1YHQ T;  3H6Z A;  1AHJ B;  3M58 A;  1B34 B;  2RK2 A;  5FU6 B;  5D6Y A;  3L2W A;  2ROL A;  1I1J A;  3G71 Q;  1QWF A;  1ZX6 A;  4F7U B;  5CKD A;  4IUT A;  4HT8 A;  3PE0 A;  1M27 C;  4DOW A;  3OYL A;  4YTL A;  3CME A;  1GCP A;  2KQW A;  2DRM A;  4PJO G;  3EG9 A;  1RI0 A;  1I5O B;  1U1S A;  2IIM A;  2DTI A;  1WXB A;  5HCK A;  2RMO A;  4M75 G;  1D3B A;  4LUE A;  1T0H A;  2EJ9 A;  1KG1 A;  3P8B B;  4DEX A;  5GAN f;  5GAO p;  3HPW A;  1XOV A;  4OML A;  1VQ5 Q;  4EMK C;  4EIK A;  3QDR B;  3LH5 A;  1QW1 A;  4RCB A;  3OS1 A;  3UF4 A;  2XMF A;  4OMQ A;  2XG8 D;  2MIO A;  2KNB B;  2QEX T;  2ZPI B;  2LMJ A;  4Y28 E;  2ROT A;  4BE1 A;  2FO0 A;  2KGT A;  5LJ5 g;  2E1H A;  3BW1 A;  4FYW B;  2GNC A;  1GFD A;  3EHQ A;  3JCM h;  1M2V A;  1VQ7 T;  1Y07 A;  2K5L A;  2FRY A;  4DQ2 A;  4Z89 A;  2DYI A;  2M16 A;  5FRO A;  1VQP T;  3CCV Q;  4M77 E;  2K2M A;  2QGF B;  1VQN A;  4CI0 C;  1M1K C;  2RN8 A;  4A4G A;  2CP0 A;  1ZHI A;  2OTL A;  3CCQ A;  2X4X A;  1DJ7 B;  4EMK A;  1YFN A;  2J06 A;  4FM4 B;  1PC0 A;  4BI4 A;  2JNG A;  3CC4 A;  2EYY A;  4LDY A;  1NYF A;  1KC8 U;  4RUG A;  3VRZ A;  4M78 C;  4PLL A;  1OX9 A;  2VXF A;  3NHN A;  3ASK A;  5KYX B;  3SHW A;  3CCE T;  1N9R A;  3WXM B;  1UJ0 A;  3L42 A;  1OI1 A;  3NFC A;  3HHT B;  3L1A A;  5IT9 E;  3VS5 A;  4M7D A;  1ZQ1 A;  2DD5 A;  1WX6 A;  2HKN A;  3QJY A;  4A63 B;  4QVZ A;  1NM7 A;  1S72 Q;  1XTD A;  2P0K A;  2VGM A;  2OTJ A;  1VQO Q;  4HVV A;  3GLX A;  3CCJ T;  1RUW A;  3RDV A;  3X28 B;  1VA7 A;  2JUF A;  3ME9 A;  2GTO A;  2GQI A;  1KIK A;  1VQ4 A;  2HQE A;  1R0B G;  2QQA A;  2E6N A;  4M7A C;  5GAM g;  2QAZ A;  2X51 A;  5LJ3 g;  4ELY C;  2DBK A;  3UPU A;  3JB9 F;  2ZAE A;  2YUQ A;  1UE9 A;  2DL4 A;  1SRM A;  2COY A;  4XAX B;  4M78 A;  1QLY A;  2DJQ A;  3CCS Q;  1D1A A;  2HL5 C;  4AMC A;  4BUG A;  4HT9 A;  1CSK A;  1WIE A;  2NUP A;  2LX7 A;  2HQX A;  4ANJ A;  1B34 A;  1VQL T;  3DB3 A;  2QI2 A;  2VVK A;  2DK3 A;  3GPL A;  2C0T A;  4F7U A;  2QQS A;  3EFR A;  3THK A;  3TU4 K;  5CQY A;  3OB9 A;  1M90 U;  3V8L A;  1VQ8 Q;  2SRC A;  5LJ5 f;  1VQ7 Q;  1YHQ A;  2KXC A;  3RES A;  2LQW A;  5GAM e;  2XDB A;  3PMT A;  4C0G A;  4J9G A;  1K9M C;  2AIR B;  2CT3 A;  1K8A U;  2WAC A;  3OYY A;  2RH2 A;  3TRE A;  2KE9 A;  5GMK l;  4QVD A;  4A4F A;  3SWN B;  3OS5 A;  2RQW A;  2DE0 X;  2EQM A;  4XTV A;  2QA4 T;  3PVL A;  3M57 A;  3EHR A;  2G3R A;  2RHX A;  1IHW A;  5FLX E;  2A0F B;  2FG0 A;  3RKY A;  4JJC A;  3KXT A;  1N8R C;  1JJ2 S;  4C92 G;  4M7D F;  2CZ1 B;  4M75 E;  4F17 A;  4V2S A;  1FXX A;  5CKB A;  3HTR A;  1Z9Z A;  3OYE A;  2LCS A;  3V7C A;  5GAN 3;  1NG2 A;  4AFQ C;  1WHJ A;  4ZTJ A;  3H8Z A;  4OB0 B;  1YI2 A;  1V76 A;  3UA6 A;  4XU2 A;  1WI7 A;  3BY7 A;  5KCO A;  2ZCF B;  5L8R E;  1YIT Q;  1KC8 R;  2L3S A;  4OP0 A;  2O01 E;  4QQG A;  2QEX A;  1M1F A;  2E41 A;  1X6B A;  3FLG A;  1WZO A;  2EPD A;  1KK7 A;  1RAG B;  3I55 A;  2PVO B;  3M54 A;  1MGQ A;  3H0H A;  4M78 F;  3BDU A;  2ZPF B;  2HEQ A;  2CKK A;  5FRM A;  3TSZ A;  2OAU A;  2HMA A;  2LT1 A;  2PZ1 A;  3MP6 A;  4KGV B;  2DFU A;  4RKU E;  2COW A;  4BE0 A;  1P92 A;  1D0X A;  1V29 B;  3CBM A;  1KQS P;  1VQP A;  3PT9 A;  1Q81 U;  5LJ3 f;  4F7U F;  1IO6 A;  1WHK A;  5D6W A;  4LXC A;  1VQK T;  1GCQ A;  5C6S A;  2DER A;  2OJ2 A;  3FEO A;  1QQJ A;  1I81 A;  2GCX A;  5KYX A;  1VQL Q;  3JCM c;  1UGP B;  4E2F B;  2BZX A;  4HCZ A;  2OAW A;  2LQK A;  4BAC A;  1ARK A;  5FW9 A;  4M7A F;  3J7A F;  4IIO A;  4C8Q C;  1UHF A;  5J3B A;  4O5V A;  5KYN A;  3CCE A;  1W4S A;  3M0Q A;  1WHH A;  4OMP A;  2HSE B;  3QDF A;  1Q82 C;  2X3W D;  4E7J A;  1WJS A;  5IAY A;  1TSF A;  1E6G A;  2RJC A;  3VS3 A;  3HRU A;  1Y57 A;  2J6O A;  2B86 A;  2ZPE B;  2RJD A;  2L2P A;  4FYY B;  4IUQ A;  3CCL A;  4DA4 A;  4QVC A;  2CP5 A;  1D1B A;  4XU0 A;  1WGS A;  4BI8 B;  3D7S B;  2YRC A;  3CCJ A;  2CZ7 B;  2D6F A;  1KQS A;  5CQX A;  2BTT A;  3MO8 A;  4J9B A;  1Z9Q A;  2WSF E;  4IKF A;  3RBB B;  1T3S A;  1K8A R;  1U3O A;  3HRS A;  3SB2 A;  4LD6 A;  2DL5 A;  2HNI A;  5GAO m;  2JVV A;  1VQ9 T;  3EH2 A;  2DEU A;  2V1R A;  2RO0 A;  4JZ4 A;  2V8I A;  1W6X A;  4PFP A;  2K3Y A;  2CSI A;  2E70 A;  2PTK A;  4DBF A;  1ACM B;  3MEU A;  1CKA A;  4EMG A;  4JJN K;  4J9E A;  4GLM A;  1JU5 C;  1Q7Y U;  2NWM A;  3JCM V;  4J7I A;  5DY9 A;  5FWC A;  2EGA A;  4Q5W A;  1Y96 A;  2DM1 A;  3OYI A;  2FYK A;  3RIR A;  2G6F X;  3S3M A;  4PNO A;  3SWN A;  4NL3 A;  2QQ9 A;  2C0O A;  3EG0 A;  2LJ3 A;  3KBG A;  4FL6 A;  4HXJ A;  3QYH B;  3JV3 A;  5CVI A;  2XID A;  4F04 B;  4NOY A;  3OBY A;  1H92 A;  1NJI R;  1WFW A;  1VQK Q;  3L2Q A;  1QP3 A;  3QXE B;  3JCM P;  2YLB A;  2BIV A;  2VGN A;  1PG5 B;  4PJO D;  2EGE A;  3OW2 S;  2DIG A;  4C0D C;  1TTH B;  3ZBD A;  2QA4 A;  4HCC A;  1BI3 A;  3Q1J A;  3RKW A;  2LCC A;  2DJZ A;  5IHN A;  4M77 G;  3TSW A;  4BDZ A;  2M51 A;  2LP5 A;  1YJ9 A;  2RHU A;  4E7Z A;  1D0Y A;  1BIB A;  3SDZ A;  4D8D A;  4KT0 E;  1NBE B;  2OTL T;  3L2R A;  3CCQ T;  3CD6 T;  3NTH A;  2WSC E;  4JRI A;  4CC7 A;  4ZN3 A;  1IB8 A;  2KSS A;  4LDV A;  2KEA A;  2AHJ B;  2CYZ B;  5GAN g;  2HZY A;  1LOJ A;  4IUP A;  3CXC S;  3M0T A;  2EVR A;  1K73 U;  1UUE A;  1X6O A;  2EYX A;  1B07 A;  1NPP A;  1JBM A;  1RLP C;  4MZP A;  2P84 A;  5GAM h;  2F2X A;  1K0S A;  1HYO A;  3H0I A;  2QK0 A;  1MUZ A;  3EG1 A;  2E6Z A;  2HCK A;  4OMO A;  2CT4 A;  3FDR A;  5J26 A;  3I56 T;  2RQT A;  2NYS A;  3A8L B;  1R8O B;  2KRM A;  1KQ2 A;  3CME Q;  4RTW A;  3DLM A;  2LC4 A;  2GBQ A;  1YJN T;  2YDL A;  2MAM A;  3JCM b;  1MMA A;  3OYG A;  5CKE A;  1PWT A;  3QZ9 B;  4KGZ B;  4C8Q E;  2L3R A;  3MJX A;  3E19 A;  5GAN e;  3RER A;  1ZBJ A;  5GAN 2;  2H3J A;  2I0N A;  1FMV A;  2KVQ G;  4M75 B;  4N4I A;  3X25 B;  2VB6 A;  1W2B S;  3PIP A;  2J05 A;  1KSW A;  4QT7 A;  1QVF P;  2LVM A;  4JS4 A;  2FRW A;  2CSQ A;  1U06 A;  2GF7 A;  1I07 A;  2DMO A;  1YWO A;  5CKH A;  2DPP B;  5CIU A;  1I5L A;  2C06 A;  3I5R A;  4J7F A;  4ZTF A;  1E7O A;  2YRV A;  2O4X B;  4E7S A;  2K7A A;  4XQ3 A;  5CR2 A;  1T0J A;  4OGE A;  3OMC A;  2MMP A;  9ATC B;  5I21 A;  4JRQ A;  1BIA A;  1WXU A;  3VUZ A;  2AZS A;  3OYK A;  1K0X A;  5HK0 A;  2JM9 A;  1MV0 B;  4Z8A A;  1H64 1;  1Q86 C;  1JXO A;  1VQN Q;  3EGD B;  1RAA B;  5CO7 A;  4J9H A;  1UGS B;  4MZM A;  3CCQ Q;  2CZ6 B;  2OTL Q;  2JTE A;  5GAN 8;  4VUB A;  2LNH B;  1S1N A;  1G3Y A;  4RMO A;  5A2Q E;  4OVA A;  1VQ9 A;  2HAX A;  1EX4 A;  3DB4 A;  3AHU A;  1QVF A;  1ZLM A;  3CC4 Q;  4JDS A;  2D9T A;  4FW1 A;  4LN2 A;  4JJD A;  1QCF A;  2ATC B;  2FB7 A;  1N9S A;  3ZFJ A;  4J5Y A;  4OB1 B;  4D8K A;  2D8J A;  2K9G A;  1GXI E;  4XTW A;  1KD1 U;  2OI3 A;  2DL3 A;  4HKE A;  2D0Q B;  3QII A;  3PNW C;  4J6W A;  1N6A A;  1YI2 T;  2AT1 B;  1SG5 A;  1H3H A;  2DLP A;  1YP5 A;  2RNA A;  4J9F A;  5LL6 S;  3VS1 A;  4LE9 A;  1K73 R;  1X01 A;  1YNZ A;  4A4K A;  1QCO A;  1TUD A;  2PUO B;  2OTJ Q;  3M0R A;  3CPW P;  1H8K A;  4FT2 A;  1QKW A;  1ZUK A;  3FB9 A;  5CKF A;  3I55 T;  1G3W A;  3HFO A;  2KRS A;  2EIF A;  3LH0 A;  1AWX A;  4O6J A;  1VQ4 Q;  2CGH A;  2JXB A;  1QWE A;  3CCU A;  4M7D C;  2J6K A;  1I8F A;  1UTI A;  2A7Y A;  4PJO C;  2PU9 B;  4RCC A;  3RMQ A;  4C92 D;  4A4E A;  6AT1 B;  2DXB A;  2XDP A;  4IIM A;  5CK9 A;  3OYH A;  1N27 A;  2AKK A;  3CD6 A;  2IPO B;  4A54 A;  2PVG B;  1VYT A;  2MF2 A;  3JCM d;  1NEB A;  2EKO A;  4AFU C;  2HL3 A;  2AZV A;  3OYB A;  1RAB B;  5FU7 B;  2W0Z A;  2FL7 A;  3O8V A;  2QAS A;  5IH2 A;  2O88 A;  1F1B B;  5KCH A;  4QQ6 A;  2QG9 B;  2RA2 A;  5LJ5 e;  4X1V A;  4R0K A;  3QO3 A;  3AT1 B;  5GMK e;  3JAM E;  1PSF A;  1BKB A;  1YHQ Q;  3PMI A;  3C94 A;  2RPN A;  1M2O A;  2RI5 A;  1Y7X A;  3P8D A;  1JEG A;  5EC7 A;  3RNJ A;  3CPW A;  5GMK m;  3OY9 A;  5FU6 C;  4KH0 B;  4X9C A;  1FMK A;  2JMC A;  1KHI A;  3SEM A;  1OEB A;  3I56 A;  1WQW A;  2ENM A;  2FPF A;  4PJO A;  3VU3 C;  3CCL T;  2JS2 A;  2E10 A;  1YJN A;  4M75 A;  1OQK A;  4PJJ A;  1GBR A;  1IGU A;  3CQT A;  4WTO B;  2LCL A;  2E64 A;  2EYQ A;  2PVD B;  4MML A;  5KYW B;  2RHI A;  4C92 B;  1UFF A;  1I0C A;  1YI2 Q;  3ZL7 C;  3PVQ A;  1RI9 A;  3VS7 A;  3CCM T;  1J3T A;  2X4J A;  3MPU B;  1M1G A;  1M8M A;  1RAC B;  1LJO A;  4PJM A;  2QEX Q;  1PCX A;  2BE9 B;  1YIJ A;  3I55 Q;  4OGC A;  2IVW A;  4HA8 A;  1KD1 R;  4XTY A;  3CPF A;  3EGD A;  5KE2 A;  1SSF A;  1KC8 C;  3JSC A;  1SHF A;  1TH7 A;  2EAY A;  4Z02 A;  3GNF B;  1K9A A;  5LJ3 e;  4JUV A;  1VQP Q;  2DL7 A;  4IUR A;  5GAN h;  3OYD A;  3R6O A;  2FVU A;  2RQU A;  2CP7 A;  4N4H A;  1QCN A;  1PD0 A;  4JRK A;  1C1A A;  4JLG A;  3MCA B;  4TVR A;  4R56 A;  1ZSZ B;  1WHG A;  1U1T A;  4LDW A;  1OOT A;  3LW5 E;  1SRL A;  4ZGE B;  1QMC A;  1YJ9 T;  2X35 A;  3QZ5 B;  2O2O A;  4WF2 A;  1X69 A;  4HCK A;  2EQJ A;  2F2V A;  4ATO A;  2Y4X A;  3JB9 J;  1BCM A;  1C6V X;  4PJO F;  5ECA A;  4F14 A;  1GCQ C;  2KT8 A;  3CCE Q;  3M0P A;  4M7D E;  3CMA T;  3CCR T;  4Y92 A;  3NGP A;  5GAO r;  4FU6 A;  5LJ5 j;  3JB9 H;  3INZ A;  3V7S A;  1K1Z A;  1MMD A;  1U8R A;  2KI7 A;  2YSQ A;  1X27 A;  2RHZ A;  4BDY A;  3L2V A;  2GTJ A;  3CCL Q;  4XK8 E;  3HKS A;  3I5S A;  2DO3 A;  3EGX B;  7AT1 B;  1QVP A;  1NJI U;  3V8K A;  3CCJ Q;  1UGR B;  4NL2 A;  2PQW A;  1JJ2 A;  2X4W A;  2LTO A;  1VQM T;  1PRL C;  1AWW A;  3JB9 I;  3M53 A;  2EQI A; 
#chains in the Genus database with same CATH homology
 2K6D A;  5IHK A;  4LNP A;  2C0O A;  3EG0 A;  2LJ3 A;  4HXJ A;  3JV3 A;  2LJ0 A;  1H92 A;  1WFW A;  4GBQ A;  2ROL A;  1I1J A;  1QWF A;  1ZX6 A;  3UA7 A;  3I35 A;  2EGE A;  1HD3 A;  1W70 A;  3H41 A;  2V1Q A;  3PE0 A;  5IHN A;  1M27 C;  3TSW A;  2M51 A;  1M3B A;  2LP5 A;  5I11 A;  1JO8 A;  1GCP A;  2DRM A;  4RTZ A;  2SEM A;  4D8D A;  3U23 A;  3O5Z A;  1BBZ A;  2IIM A;  1YN8 A;  2CDT A;  4CC7 A;  5HCK A;  1WXB A;  2RMO A;  1BU1 A;  4LUE A;  1T0H A;  2DX1 A;  2KEA A;  4DEX A;  3M0T A;  2EVR A;  1XOV A;  1UUE A;  4OML A;  5GJW B;  2EYX A;  1GRI A;  2ESW A;  2EKH A;  1UGV A;  1B07 A;  4EIK A;  1RLP C;  2F2X A;  1K0S A;  3H0I A;  3LH5 A;  1WXT A;  1MUZ A;  3EG1 A;  2HCK A;  4OMO A;  3UF4 A;  2XMF A;  1SEM A;  3QWX X;  2EW3 A;  3QWY A;  4OMQ A;  1TUC A;  1KFZ A;  4WCI A;  2CT4 A;  2J6F A;  2MIO A;  2KNB B;  2LMJ A;  2YUP A;  2W10 A;  4KRT A;  1Y0M A;  2RQT A;  2ROT A;  1M3A A;  2FO0 A;  2KGT A;  2KRM A;  4RTV A;  4RTW A;  2GBQ A;  2YDL A;  1PWT A;  2GNC A;  1GFD A;  3EHQ A;  1WA7 A;  1UG1 A;  2P4R A;  3VS6 A;  2GGR A;  1ZBJ A;  2CH4 A;  2FRY A;  2I0N A;  2K3B A;  2DVJ A;  4Z89 A;  1K76 A;  2BZY A;  2K2M A;  2KYB A;  2RN8 A;  2CUD A;  2NUZ A;  2J05 A;  1KSW A;  4QT7 A;  4HVU A;  2ED1 A;  2FRW A;  2J06 A;  2CSQ A;  1U06 A;  1I07 A;  2KR3 A;  2VKN A;  2DMO A;  1YWO A;  2KBT A;  3M0S A;  1M30 A;  1AEY A;  3I5R A;  4FSS A;  2EYY A;  1NYF A;  1ZUU A;  4RUG A;  4RTX A;  1E7O A;  3VRZ A;  2ED0 A;  2K7A A;  3EG2 A;  3NHN A;  1T0J A;  5FWB A;  2A08 A;  3SHW A;  1UJ0 A;  2H8H A;  1WXU A;  2DL8 A;  2AZS A;  1UEC A;  2YUN A;  2F2W A;  2BZ8 A;  1K0X A;  1X6G A;  3VS5 A;  1UJY A;  2HBW A;  2JM9 A;  1MV0 B;  4Z8A A;  4A63 B;  1WX6 A;  2C0I A;  2MOX A;  1NM7 A;  1SHG A;  2DF6 A;  1JXO A;  4AG1 C;  4J9H A;  4HVV A;  1BK2 A;  4E6R A;  2JTE A;  4JPB W;  1RUW A;  2LNH B;  1S1N A;  2YUO A;  1VA7 A;  2D0N A;  2GTO A;  2GQI A;  1KIK A;  3EGU A;  2EGC A;  1WDX A;  4J9C A;  4M4Z A;  1ZLM A;  1ZSG A;  4LN2 A;  4JJD A;  1QCF A;  1CKB A;  2DBK A;  4RTT A;  1A0N B;  3ULR B;  2JS0 A;  3EG3 A;  4D8K A;  2D8J A;  2YUQ A;  1UE9 A;  2K9G A;  2DL4 A;  1SRM A;  1TG0 A;  1U5S A;  1QLY A;  2OI3 A;  2A37 A;  2DJQ A;  2DL3 A;  2RQV A;  4AG2 C;  1LCK A;  2QDL A;  2CUB A;  5IXB A;  2L0A A;  1CSK A;  1WLP B;  1WIE A;  4ESR A;  1H3H A;  2LX7 A;  1NLO C;  1YP5 A;  2DLP A;  2RNA A;  1AOJ A;  4J9F A;  2DRK A;  3VS1 A;  4LE9 A;  3UAT A;  2VVK A;  1YNZ A;  1WYX A;  1BB9 A;  1TUD A;  2C0T A;  3M0R A;  2KRN A;  1H8K A;  1QKW A;  1ZUK A;  1PRM C;  1AWJ A;  3THK A;  2PNI A;  4CC4 B;  1W1F A;  2DA9 A;  2KRS A;  4J9I A;  2SRC A;  2KRO A;  2KXC A;  1AWX A;  2LQW A;  2JXB A;  1AD5 A;  2AKL A;  1QWE A;  2ABL A;  4J9G A;  1N5Z A;  1YCS B;  2J6K A;  2MCN A;  4CC2 A;  2CT3 A;  1UTI A;  2KE9 A;  4CC3 A;  4Z88 A;  3REA B;  2JMA A;  3VS4 A;  1ABO A;  1GFC A;  2RQW A;  1SSH A;  4IIM A;  2DE0 X;  3NPF A;  3PVL A;  3VRY A;  3EHR A;  1M3C A;  1NLP C;  3FJ5 A;  2AKK A;  2O31 A;  2RQR A;  2FG0 A;  4JJC A;  1OPL A;  1VYT A;  1OV3 A;  2A28 A;  1NEB A;  4F17 A;  4AFS C;  4AFU C;  2KT1 A;  2AZV A;  4K11 A;  1Z9Z A;  2W0Z A;  2LCS A;  5IH2 A;  1VYU A;  3A98 A;  2O88 A;  1NG2 A;  4AFQ C;  1FYN A;  1RLQ C;  4OMM A;  4R0K A;  2FPD A;  4X1V A;  2AK5 A;  2O9S A;  2RPN A;  3UA6 A;  1K4U S;  1WI7 A;  1NYG A;  5EC7 A;  3RNJ A;  1JEG A;  5L23 A;  2L3S A;  1KJW A;  2L3P A;  4F16 A;  2DYB A;  1FMK A;  2JMC A;  3SEM A;  1OEB A;  1X6B A;  2EPD A;  2ENM A;  2FPF A;  2JM8 A;  3H0H A;  4JZ3 A;  5IXF A;  2JS2 A;  2FEI A;  2LQN A;  1JXM A;  2HEQ A;  1UDL A;  2D1X A;  3TSZ A;  1GBR A;  2PZ1 A;  3CQT A;  1V1C A;  1ABQ A;  2HDA A;  2DIL A;  1UFF A;  2EYW A;  1X43 A;  1IO6 A;  1X2K A;  1I0C A;  1GCQ A;  3TVT A;  1GL5 A;  2KYM A;  2OJ2 A;  3ZL7 C;  1PKS A;  3PVQ A;  1RI9 A;  1EFN A;  3VS7 A;  3C0C A;  1SPK A;  2LJ1 A;  4DEY A;  3I9Q A;  4ORZ A;  1X2Q A;  1J3T A;  2FPE A;  1M8M A;  2BZX A;  1E6H A;  2OAW A;  1ARK A;  5FW9 A;  2D8H A;  3R6N A;  1AZE A;  2RF0 A;  2DBM A;  1JQQ A;  1ZUY A;  4IIO A;  3NMZ C;  4ZNX A;  1UHC A;  1UHF A;  3IQL A;  2YT6 A;  3M0Q A;  4OMP A;  2JW4 A;  2LZ6 B;  2X3W D;  1SHF A;  2KXD A;  3M0U A;  1QKX A;  1T3L A;  1MV3 A;  1NEG A;  1E6G A;  3VS3 A;  2L3Q A;  1K9A A;  1Y57 A;  2DNU A;  2J6O A;  2B86 A;  2DL7 A;  2L2P A;  1GBQ A;  2VWF A;  2RQU A;  4J9D A;  2CRE A;  3VS2 A;  4AFZ C;  1YWP A;  5IHI A;  1B3Q A;  3KFV A;  2BTT A;  4JJB A;  4J9B A;  4LUD A;  3GBQ A;  2E5K A;  1Z9Q A;  3RBB B;  1T3S A;  2ECZ A;  2K79 A;  4OMN A;  1OOT A;  1U3O A;  2CH4 W;  1AZG B;  1SRL A;  2DL5 A;  1OPK A;  2O2O A;  1X69 A;  4HCK A;  2F2V A;  2EBP A;  2HSP A;  2V1R A;  3REB B;  5ECA A;  2O9V A;  1GCQ C;  4JZ4 A;  4F14 A;  1W6X A;  2KT8 A;  2CSI A;  3M0P A;  2PTK A;  4RTY A;  2M0Y A;  1HJD A;  1AVZ C;  4Y92 A;  3NGP A;  1CKA A;  4J9E A;  1K1Z A;  4GLM A;  1JU5 C;  2X3X D;  2YSQ A;  2NWM A;  1X27 A;  1PHT A;  4HVW A;  5FWC A;  1VYV A;  2EGA A;  2GTJ A;  3H0F A;  4RTU A;  3I5S A;  2DM1 A;  1PKT A;  1G83 A;  3VS0 A;  2JT4 A;  1G2B A;  1HSQ A;  1PNJ A;  2A36 A;  5I22 A;  1AWO A;  2G6F X;  1AWW A;  1PRL C;  2J7I A;  2EYZ A;  5GJV B;  2EQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...