2OJ2A

Nmr structure analysis of the hematopoetic cell kinase sh3 domain complexed with an artificial high affinity ligand (pd1)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
86
structure length
86
Chain Sequence
b'GPLGSPGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hematopoetic Cell Kinase, SH3 domain
publication title Solution Structure of a Hck SH3 Domain Ligand Complex Reveals Novel Interaction Modes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein,transferase/inhibitor
total genus 10
structure length 86
sequence length 86
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2oj2A01
2GQIA 2YDLA 4OMQA 2J06A 4JPBW 4RTUA 4CC7A 2MCNA 3VS1A 1QCFA 1TUDA 1NM7A 1WLPB 2DYBA 1QKWA 4J9BA 2KROA 1WIEA 1WA7A 2ABLA 1Z9QA 3UF4A 2DVJA 1X2QA 2MIOA 1PHTA 2J6OA 2IIMA 2CREA 4AG2C 1SRMA 1VYTA 2C0TA 5I22A 1GCQC 1HD3A 4F17A 1W6XA 1JXMA 4Z89A 2L3QA 4HVUA 1SHGA 2DBKA 2GGRA 3REBB 1JEGA 2L3PA 2KT1A 4AFSC 4R0KA 3EHQA 1M3AA 1MUZA 2DILA 4OMMA 1PWTA 2OI3A 3SHWA 3VS3A 2RPNA 4GBQA 2CSQA 2EYWA 2OAWA 5I11A 1X6GA 2AKLA 2O31A 2KYMA 4HXJA 3VS6A 3KFVA 1WI7A 2M0YA 1K1ZA 3O5ZA 1JXOA 2DL3A 1UUEA 4JJDA 2K79A 1KSWA 1WXUA 2JS0A 3EG3A 4OMOA 2KXDA 1E6GA 1SEMA 1W70A 1PKTA 1VA7A 1Y0MA 1K0SA 2KGTA 1ZUYA 1I07A 1M3BA 1ABOA 1JQQA 2GNCA 4OMNA 2DX1A 1B3QA 3M0TA 1KJWA 1H3HA 4HVVA 3EHRA 2RF0A 1HJDA 2K9GA 2D8HA 2EQIA 3THKA 4J9GA 1RLQC 1FMKA 2DRKA 4JJCA 2KE9A 1X2KA 2HCKA 1GCPA 4CC3A 4OMLA 4D8DA 1K0XA 4LUEA 1RLPC 1CKAA 5HCKA 2KRNA 2KRSA 4RTZA 4J9EA 2KT8A 3LH5A 5FWBA 1HSQA 4RTYA 2A36A 1KFZA 4FSSA 2W0ZA 3NMZC 3C0CA 1NEBA 2JM8A 3I35A 2EYYA 3RBBB 2LP5A 1AVZC 3ULRB 1V1CA 2YUPA 1N5ZA 1X27A 2JW4A 1NG2A 1OPKA 2EGCA 5FW9A 2FPFA 2LQWA 1GFDA 4LNPA 1E6HA 3ZL7C 2FRYA 3PVLA 4OMPA 2RQWA 2EBPA 4EIKA 4J9IA 1M3CA 3I5RA 2O88A 1WFWA 2PNIA 2YT6A 2FEIA 2K7AA 2EYZA 3NHNA 4WCIA 2B86A 4AFZC 2D1XA 1UDLA 1ARKA 4M4ZA 1SSHA 2BZXA 1NYGA 3EG2A 1YN8A 2ED0A 4AFQC 4JZ3A 1X69A 1MV0B 2K3BA 4LN2A 4D8KA 1K76A 3M0PA 3UATA 2GTJA 4RTVA 2V1RA 2LMJA 1JO8A 1UTIA 1OPLA 2RQVA 1RUWA 4CC2A 2P4RA 1UECA 2RN8A 2A28A 1Y57A 2J6FA 4Z88A 2HDAA 1U3OA 2KNBB 4RTWA 3VS2A 1GFCA 3I5SA 2LNHB 2DL7A 1UFFA 4LE9A 1AWXA 1CSKA 1A0NB 4RTXA 1U5SA 4F14A 2FO0A 2V1QA 3NGPA 2KR3A 1UG1A 2K6DA 3GBQA 2DL8A 1AWOA 3VS0A 3EG0A 1PKSA 1WX6A 2JTEA 3VS4A 1X6BA 1K9AA 1ZX6A 2W10A 2JS2A 2RMOA 1KIKA 2L0AA 1IO6A 2DJQA 3NPFA 2EGAA 1TG0A 2NWMA 1VYVA 1X43A 4Z8AA 2C0IA 4J9FA 1AWJA 1UE9A 3TSWA 2BTTA 2JXBA 1QWFA 2RQUA 2CH4A 2EW3A 2AZSA 1S1NA 1YWOA 3PVQA 2CUBA 2O9VA 2VVKA 1E7OA 2VKNA 3M0QA 1CKBA 2CUDA 2YUOA 4KRTA 2EPDA 4HVWA 2EGEA 1NLOC 1GCQA 1YWPA 2LCSA 3U23A 2A08A 3TVTA 1M8MA 5ECAA 1B07A 1QKXA 1FYNA 2CDTA 1NYFA 2ECZA 1BB9A 2J6KA 1T0HA 2K2MA 1T3LA 2LJ1A 1UHFA 2OJ2A 2O9SA 1AWWA 2E5KA 4RUGA 3VS5A 2JMAA 2DBMA 1SHFA 2DL4A 4J9DA 1WXBA 1UJ0A 2CH4W 1W1FA 4LUDA 5IXBA 3SEMA 2D0NA 1YCSB 1PNJA 2EKHA 2MOXA 1Z9ZA 3JV3A 2PZ1A 3PE0A 1AEYA 1ABQA 2FRWA 5IXFA 2A37A 5GJWB 3VRZA 5EC7A 2LJ0A 2X3WD 3M0UA 2L3SA 4RTTA 2LQNA 2JMCA 2AK5A 2ESWA 1QLYA 1UGVA 1BK2A 4ORZA 2XMFA 1YNZA 1U06A 3RNJA 2LX7A 1XOVA 2LJ3A 2C0OA 4J9CA 1UJYA 1I1JA 2JT4A 2VWFA 4AG1C 2DE0X 1LCKA 1H92A 1WDXA 4QT7A 2RQTA 5IHNA 1AZGB 2H8HA 2DLPA 1G83A 3EG1A 2DMOA 2EVRA 2EYXA 1G2BA 2FPDA 4J9HA 2GTOA 1J3TA 5IH2A 4CC4B 1ZUUA 2L2PA 1ZLMA 3QWXX 2PTKA 2X3XD 3IQLA 5GJVB 3UA6A 1ZBJA 3R6NA 1WYXA 2ENMA 1T3SA 1M30A 4X1VA 2HEQA 2KXCA 3I9QA 1WXTA 1NLPC 2I0NA 2J7IA 5IHIA 3M0SA 1NEGA 2KBTA 2M51A 3A98A 2ROTA 1GBQA 3QWYA 2RNAA 1BU1A 2AZVA 3TSZA 1YP5A 4ESRA 4E6RA 1ZSGA 2GBQA 3H0FA 2CT4A 1QWEA 1MV3A 1AZEA 2DL5A 2FPEA 2YUQA 2KYBA 4HCKA 1I0CA 4A63B 5L23A 2DM1A 1GL5A 1H8KA 4ZNXA 3H41A 4DEXA 2KRMA 2FG0A 2DNUA 2QDLA 1SRLA 3FJ5A 1M27C 2G6FX 2JM9A 2YSQA 3H0IA 1K4US 1SPKA 1EFNA 2YUNA 2DF6A 4AFUC 2F2WA 1OOTA 1AOJA 1PRLC 2BZ8A 4K11A 1UHCA 2NUZA 3CQTA 4JJBA 2SEMA 3UA7A 2ROLA 2O2OA 1GRIA 2CSIA 1T0JA 2ED1A 1AD5A 1TUCA 2BZYA 2D8JA 1GBRA 2KEAA 1RI9A 3REAB 1OEBA 1VYUA 2F2XA 2F2VA 5IHKA 2DRMA 1JU5C 3EGUA 5FWCA 4IIMA 4Y92A 4JZ4A 4DEYA 3H0HA 3VS7A 2LZ6B 2RQRA 3VRYA 1ZUKA 2HBWA 2HSPA 4GLMA 2AKKA 3M0RA 4IIOA 1OV3A 4F16A 2J05A 2DA9A 2CT3A 2SRCA 1BBZA 1PRMC
chains in the Genus database with same CATH superfamily
1TXQA 4OMQA 4JRKA 3VS1A 4Z02A 1QCFA 2VV5A 2COZA 2LCLA 1NM7A 3EG9B 4NL3A 2DJZA 4N4GA 1M1KU 3FLGA 5DM7R 2RHZA 3QBYA 3V8LA 5A2QE 4C92D 2M16A 2HAXA 2C0TA 5I22A 4QW2A 4F17A 1W6XA 2X51A 4ANJA 3CCLQ 2GGRA 3X20B 1LVKA 2DD5A 1KD1U 3JCMe 1VQ4Q 2COWA 2KT1A 3QPHA 2OTLQ 4AFSC 2M02A 1M3AA 4OGCA 2OI3A 4FT2A 2DXTA 4ZN3A 3QIIA 2RPNA 4M75A 5GANe 1RACB 3JCMg 4ATOA 2WSFE 1JJ2A 4CRIA 3KFVA 4M75F 4EMHA 4ZGJB 1WI7A 3S6WA 1K1ZA 1BCMA 3A8OB 1QCOA 2QASA 4JJDA 3M58A 4OMOA 5GANg 3OYIA 1MMNA 4C8QG 2LRQA 4E7SA 3LX7A 4MMKA 4OF1A 1Y0MA 1ZA2B 1M3BA 3OMGA 1JQQA 2GNCA 3HRSA 2E10A 4OMNA 5KE3A 2RI3A 2DZCA 4HVVA 5CKDA 2RF0A 2QGGA 3OBYA 1UGRB 1K9MU 1RLQC 3MEVA 1FMKA 2DRKA 3CMET 3MEWA 2KE9A 3G4ST 4LUEA 3CC2T 4M7DD 3M55A 4F7UE 4B6MA 2BE9B 1NE8A 3QJYA 2A36A 1KFZA 4M7AF 4AMCA 2W0ZA 3PMTA 2K3XA 3TREA 4QQDA 3NMZC 3CCRA 1XNIA 3I35A 2MK5A 1VQPQ 2P0PA 1RADB 3VU3C 1HXDA 2LCCA 3MP6A 1Y71A 1VQ8Q 1YJWA 4LNPA 4C8QA 2FRYA 2E64A 3I55A 3PVLA 2EKOA 3CCEA 3QXEB 3FC3A 2EFIA 2EBPA 3FIFA 3L42A 1XQHA 1M3CA 1WFWA 3RUXA 3JB9I 3D7SB 1VUBA 4FU6A 5M9OA 3FB9A 3OA6A 4XTVA 1SSHA 2CKKA 1Q82U 1QP3A 3L1AA 1YN8A 2NUPA 5CK9A 3MHXA 3OB9A 4IUVA 1PSEA 4N4HA 4VUBA 1MV0B 2HL5C 3M0PA 1C0MA 3UATA 2CP5A 4YTLA 4R55A 4C5HA 2LMJA 1JO8A 1I5OB 1OPLA 2RQVA 4CC2A 2P4RA 3SD4A 1G3SA 1RAAB 1Y57A 2J6FA 1TWBA 2Y90A 2HDAA 2KNBB 3DKMA 4RTWA 4FSXA 4C92E 3SWNC 4J6XA 2DL7A 1UFFA 4LE9A 1Y7XA 5FU6C 4M75B 2GFUA 2EQKA 1CSKA 4M78G 1U1SA 2XG8D 4PJOD 1A0NB 4RTXA 3OYBA 1K8AC 2K6DA 4FCYA 1AWOA 1OI1A 4L5GA 2JVVA 3C95A 2NUTA 3VS4A 3PIPA 1LNXA 1VQMQ 1K9AA 1ZX6A 3CCLT 2L0AA 2ZPBB 4KGVB 2OTLT 2DJQA 1EZZB 3E19A 3VUBA 4A4KA 2K5LA 2XHCA 1TG0A 2EWNA 2MMPA 3UT1A 4QKUA 1X43A 2C0IA 2R58A 1NJIR 3TSWA 1KQ1A 2BTTA 5DLOA 2EJ9A 3WVEB 1YITT 4J7IA 2JXBA 2RQUA 2HKNA 2Y4YA 2CH4A 4XK8E 2AZSA 3TQ7P 4JLGA 3CCMA 3V7RA 3CMEA 1VQ7T 2YUOA 3CC2A 1GCQA 2XU8A 1GXIE 2C06A 5ECAA 1B07A 1ZHIA 5GMKj 2LQKA 2GCXA 1BB9A 2NYSA 4M75C 2PVDB 3CEYA 5I2SA 1JB0E 1KQSS 2OJ2A 4QVDA 5J3BA 2O9SA 3VS5A 3HKSA 1SHFA 1QVPA 4C8QB 5GAMe 3M54A 1YFNA 5KYWA 1W2BP 2MOXA 1Z9ZA 1KC8C 4X34A 3PE0A 5LJ3f 1AEYA 2CZ7B 4J8OA 4XTWA 3RKXA 3VRZA 5EC7A 1IHVA 1XJWB 2GF7A 5GAMg 1WQWA 2K5IA 5GMKe 5IT9E 2NUPB 2MWPA 1UGVA 1WHGA 1FMVA 2XMFA 2RB6A 1VQPT 1VQOA 1XOVA 2LJ3A 4XTXA 2GFAA 3LW5E 1VQ8T 5AYFA 2JT4A 1H92A 1WDXA 2LNVA 3LGLA 1QVGA 1G3TA 4M77D 1VQ6A 2E12A 3EG1A 3JCMV 2DMOA 2K4YA 2DZ9A 1G2BA 4J9HA 3KUFA 4J6YA 1J3TA 4CC4B 4EMGA 5LJ5d 3IQLA 2GQVA 2K57A 2RHIA 1T3SA 1M30A 4X1VA 7AT1B 4QVCA 1WXTA 2J7IA 2NUTB 5LJ5h 4BUGA 3MP8A 1VQLQ 3CCRQ 3A98A 1QP2A 1GBQA 2RNAA 5CO7A 1MMGA 4E6RA 1ZSGA 1BIAA 1QWEA 2QTXA 5C6SA 3VJPA 3RMSA 4M7AE 3CCUT 3I55Q 4KT0E 4TVRA 2DM1A 2QEXT 1H8KA 1X75C 2V8KA 4GLKA 3CCEQ 4DEXA 3LWIA 3GOXA 2FHDA 4ZTFA 1YITA 4FT4A 2ZPFB 3FJ5A 2G6FX 2JM9A 3H0IA 1ZQ1A 1SPKA 1EFNA 4BE2A 4M78D 1WNLA 4B9WA 4PNOA 2DK3A 1JJ2P 1QQJA 1R8OB 4A4GA 1RI0A 1G3YA 2SEMA 2EJFA 3DB3A 3CC7A 1GRIA 4M78B 2CSIA 3EGXB 3QYHB 1Q7YU 3BW1A 3X25B 4DBQA 4PFZA 5GAN5 4PLIA 4F7UA 2LQ8A 3CPWP 2DRMA 3V8KA 1N9RA 4IIMA 4JJNK 1PD1A 4JZ4A 2X9HA 3V7CA 1H641 3WVDB 3L2ZA 5HKCA 2EYQA 1R0CB 3E2UA 5KYWB 3VV0A 2EJGA 4F16A 2CS7A 3EH2A 2CT3A 1OQKA 1Q81C 2YDLA 3JB9J 3NTKA 4JPBW 1FX7A 4E7JA 3M57A 1YJNA 2YRVA 1TUDA 5LJ5f 3OYLA 1QKWA 4J9BA 2DVJA 4RMOA 4A54A 1PHTA 2J6OA 2IIMA 2CREA 4AG2C 2DVEA 5I2MA 1VYTA 2LDMA 1GCQC 2QI2A 5IN1A 4MZTA 1IZ6A 1JXMA 2L3QA 2NLUA 1SHGA 4HVUA 2VB6A 2L3PA 3CXCS 4R0KA 2DILA 5GANf 2KAFA 9ATCB 3HL8A 2MWOA 2K3YA 3CMEQ 3JB9H 1SG5A 4GBQA 2CZ1B 4FL6A 1NBEB 3CC2Q 2O31A 2E4HA 2KYMA 3LH0A 1NJIC 5KYUA 1K9MR 4C92F 2KQWA 1UUEA 3MJXA 3H6ZA 4ELYC 2H3EB 3R6OA 3AT1B 1SEMA 3GPLA 2FYKA 4HT9A 4WTOB 2OAUA 5GAN8 2HZYA 4BDZA 2X4WA 4BE0A 1ZUYA 1K8AR 4MMLA 2DX1A 1B3QA 3CCUA 2XKOC 3M0TA 5CR2A 3QJ6A 4MDWA 3EHRA 2A7YA 3MKDA 3BE3A 3THKA 4J9GA 1UGSB 1M90C 4V2SA 3CCSA 1I4K1 1X2KA 4J83A 4BDYA 1GCPA 1U1TA 4FYXB 4OMLA 1K0XA 1CKAA 3TEEA 5HCKA 2KRSA 4J9EA 1M1FA 3CCQA 2PVOB 1AT1B 4B9XA 1VQOQ 4FSSA 1OX9A 4JRIA 2PU9B 4F7UB 2JM8A 5FROA 3CPWS 2LP5A 4M75G 1YJWT 1V1CA 1N5ZA 3CCJA 1OPKA 3I55T 2KK4A 4LXCA 3CCET 2EGCA 3CD6A 3JSCA 1GFDA 3VKIA 1VQ6Q 3ZL7C 2DXBA 2QK0A 2RQWA 3HPWA 4EIKA 4J9IA 1HYOA 2VUBA 4Y91A 2FEIA 2K7AA 2RK2A 3VUZA 1UEBA 2CYZB 2ZGWA 4FW2A 4WCIA 1MMAA 2JZ2A 2D1XA 4M4ZA 5CVIA 3JB9D 2BZXA 1VQ5A 2ED0A 4AFQC 1VQKA 1YIJA 3INZA 3OYDA 1BKBA 2K3BA 3KBGA 1KC8R 5GAMd 3V8JA 2V1RA 1UTIA 1N6AA 2RN8A 2DXCA 4Z88A 2QYZA 4OGEA 1U3OA 1GFCA 2DTIA 1YITQ 2YRCA 3C94A 1VQ7Q 1AWXA 2RJFA 2AHJB 2IG0A 5KYUB 3NGPA 3OW2S 5GAOr 1I8FA 3CC7Q 3EG0A 3RKYA 3PMIA 1X6BA 3S3MA 2VXEA 3EFOA 4RG8A 1D09B 2EAYA 2V8JA 1JRIA 1YCYA 1RAHB 4HCCA 3A8MB 1VYVA 1QVGP 4GY5A 4J9FA 1AWJA 3BDUA 1UE9A 3CCMT 3OSVA 3OYFA 3P8BB 4PJOF 2EIFA 4EMKA 1M1KC 2VKNA 4M7AA 2CUDA 2JJ9A 4KRTA 4LD9K 3G7ZA 4HVWA 5C0MA 4KULA 1OZ2A 1YJNQ 1YWPA 1MGQA 3SWNB 4BY6C 3HP9A 1QKXA 1FYNA 2JTMA 1NYFA 3L2QA 5FU6B 1KD1C 3J80E 1DJ7B 3F70A 4L59A 2O01E 5CQXA 2BE7D 2K2MA 2LJ1A 4C92C 2KSSA 1BI1A 4RUGA 2JMAA 1M8VA 4ME7A 4JDSA 2D0QB 2PUOB 5GAMf 4ZN1A 1UJ0A 3META 1EIFA 4LUDA 3SEMA 2ZPHB 1RAGB 2HSEB 2EKHA 1TSFA 5HK0A 1WHJA 2G3RA 1IREB 2RHYA 3QYGB 5GMKl 2QQSA 2DIQA 1QVFP 2XIDA 5IXFA 5GJWB 2LJ0A 2X3WD 3M0UA 4RTTA 2YHTA 2LQNA 1VQOT 1RL2A 2ESWA 3MO8A 3URGA 5CAIA 4ORZA 1YNZA 3NFCA 2ZZDA 2LX7A 1Q81R 4E7HA 1UJYA 1I1JA 4M75D 2MAMA 2DE0X 1K73R 1VQ6T 4A4EA 1K9MC 4QT7A 5LJ3d 2K5FA 2COYA 5GMKi 1AZGB 3CBPA 1KHCA 3CCUQ 1G83A 2QEXQ 3O8VA 1R0BG 2FPDA 5LJ3h 5GAN2 1N9SA 3JCMW 2WSCE 3CC4A 3CCSQ 2XICA 1S72T 2BKDN 1V76A 3AHUA 2QDYB 3OYKA 2X3XD 4IURA 3UDCA 1WYXA 4PJJA 4O5VA 5IAYA 3CCQQ 4KUDK 1NLPC 3OYMA 2QQBA 1IXDA 3JCMc 2KBTA 3EFOB 4KH1B 2LVMA 5D6XA 2ROTA 3QWYA 2AZVA 3LYIA 4M77F 4C0FA 1YP5A 6AT1B 1AHJB 3CCJQ 3H0FA 4O6JA 1WJQA 4XU3A 1X01A 3HHTB 2RJEA 2VYTA 4A63B 1GL5A 3BY7A 2KRMA 4EMKB 2FG0A 1Q82C 2QDLA 3JAME 1M27C 4M7AB 2YSQA 2YUNA 2ZPIB 2K2VA 2DF6A 4OB2B 2F2WA 2ZCFB 2E70A 1OOTA 2DFUA 3CC7T 5KE2A 1VQ5Q 2CP0A 4JJBA 4C8QD 2YLCA 3UA7A 1B34A 1VQKQ 3X24B 2MF2A 2ROLA 1YIJQ 4M7DE 1T0JA 4LDUA 1TUCA 2D8JA 1KK7A 1RI9A 1M90R 2E3HA 2F2XA 5IHKA 4XAXB 2QA4A 2F69A 3T9NA 3EGUA 5CKFA 4C0ZA 4DEYA 4IUPA 3VS7A 3FRNA 2LZ6B 5GMKm 3PGGA 2DIGA 1ZUKA 2HBWA 4GLMA 2X4XA 2LT4A 3DB4A 1PRMC 2P0KA 4XTZA 1QVFS 2HKQB 2J06A 1YJNT 1IHWA 2DYIA 3MEUA 4RTUA 4CC7A 2MCNA 4X9DA 3HFOA 3QZ5B 2EQUA 3QHSA 1WLPB 2DKGA 2KROA 2QQ9A 4EMKC 1X2QA 1UGQB 2RHUA 3ZFJA 4ZGEB 4M7AC 2X4YA 2JTFA 3CMAT 1M5Q1 1HD3A 1YHQA 4XTUA 1HK9A 1JBMA 4Z89A 2DBKA 1YBYA 3GLXA 3JRZA 1JEGA 2QQAA 3EGDA 3OYGA 2D9TA 1Q86R 2HL3A 1PWTA 4OMMA 4UC4A 5EG2A 3SHWA 1PD0A 1C1AA 3VS3A 1ZA1B 3OS5A 4HCZA 4HKEA 4F7UG 2CSQA 1S72A 2DEQA 1MNDA 2EYWA 2OAWA 5I11A 3TU4K 8ATCB 3VS6A 3J7AF 3EAEA 2WSEE 3JCMd 3O5ZA 4PJOE 2DL3A 3CPFA 2E41A 4C5IA 2JS0A 1WXUA 2K79A 1ACMB 2DO3A 2LC4A 1E6GA 3P8HA 4J6WA 4FYWB 5GANd 1YJWQ 1PKTA 1VA7A 3CBMA 3OBWA 2KGTA 4XU2A 1D1BA 1N8RR 2KY9A 4JLIA 1KQSA 3FDRA 3L2WA 2RI5A 3C4SA 2FL7A 5GANh 3CCST 2K9GA 2D8HA 5CIUA 1OX8A 1ZSZA 4HT8A 4QQGA 4CC3A 1WZOA 3BDLA 4OMFB 3CCQT 1RLPC 3MPUB 3J81E 2H3JA 2QQRA 4D6WA 1B34B 2KT8A 4OB0B 3LH5A 3EFRA 4IUQA 1HSQA 5LJ3j 3QDRB 5KH6A 2F5TX 3CCJT 3PTAA 1M1KR 3RBBB 1AVZC 3CD6T 2HQEA 4C8QE 1NG2A 4BI8B 1VQNA 4C92G 2BUDA 1W2BS 5FW9A 1NJIU 2LQWA 4M77C 1E6HA 2MYSA 4KGXB 1TTHB 1KD1R 4OMPA 4DQ2A 1XTDA 2F5KA 1K73C 2X4JA 3I5RA 5A0DA 3CC4Q 4JS4A 3LLRA 2E5QA 3G6EA 1VQ5T 5A0GA 1UDLA 1VQKT 1YIJT 3H8ZA 3EG2A 2RH2A 2VXFA 4JZ3A 1OYXA 4DOVA 3L2VA 3X28B 1X69A 3JCMf 5HY6A 1K76A 2XI9A 1TU0B 3CMAA 2RA2A 4LDVA 1UECA 3I56T 1O9SA 3OYAA 3EGDB 3VS2A 2R57A 3CCMQ 4N4IA 2LNHB 4M77E 4C92A 3QO3A 2RK1A 3ASKA 3JB9F 2P0QA 2O4XA 4LDYA 2L8DA 4J7FA 3OYEA 1U5SA 4F14A 2V1QA 1F1BB 2KR3A 2LX9A 1EX4A 3GBQA 2PUKB 3QG1A 4E47A 1WX6A 1FMWA 1W4SA 2JTEA 4AT1B 3BFMA 4PK4A 2B8AA 2W10A 2RMOA 4E7IA 2QA4Q 1IO6A 2FVUA 1MNEA 2ZPGB 4RKUE 3M53A 3OS1A 4Z8AA 2ATCB 3QKJA 3GNFB 2CP6A 1IGQA 2EW3A 1S1NA 1YWOA 3PVQA 3UWNA 1JJ2S 2CUBA 4PL6A 1ZSZB 2RM4A 2VVKA 4BD3A 3M0QA 2DPPB 4C0GA 1CKBA 3M5AA 2EPDA 4DBFA 3MCAB 5FU7B 2EGEA 1TH7A 1NPRA 3PFSA 5HK3A 3CCVT 3U23A 2HBPA 4M78E 2ECZA 1Q82R 2J6KA 1OULA 1T0HA 4C5GA 3S3OA 1UHFA 2DTOA 5LJ5j 1V29B 2E5KA 1VQMA 4KBMB 4N0AC 4M7DA 2DBMA 2DL4A 1WXBA 1YJ9A 3GF5A 2DD4A 4P5NA 4M7DF 1VIEA 2D0NA 3CXCA 3E9GA 3JV3A 2PZ1A 3FEOA 2CP7A 2FZKB 3SDZA 1S72Q 4QVZA 2A37A 1Q86C 4II1A 4XU0A 3UPUA 2JMCA 5GANj 4PJOG 2AK5A 2OTJA 1QLYA 3ZBDA 4WF2A 3RNJA 4PFPA 2ZPEB 2QAZA 2WACA 1ZSZC 3A8GB 4J9CA 2FZCB 5LJ5e 2JNGA 4M7AG 5FU7C 4ZTJA 4BY6B 1MMDA 2HD0A 4ELZC 5IHNA 3I56A 3NTHA 5GAMh 4Q5WA 1WGSA 2QXFA 5D6YA 2DLPA 1NPPA 3CC4T 4JRPA 2FZGB 4C92B 5LJ5g 3NTIA 5IH2A 2O4XB 1N8RC 1ZUUA 3G71T 5GMKh 2L2PA 3H9NA 1WHKA 3QWXX 5D6WA 3ZEHA 2PTKA 5GJVB 5L8RE 4FYYB 2ENMA 3PNWC 3L2UA 2HEQA 3S3NA 2KXCA 2E65A 3RESA 1N27A 2I0NA 3OS2A 3M0SA 2M51A 3OYJA 3TSZA 4ESRA 1FXXA 3A1PA 2GBQA 4PJOA 1VQNQ 1MV3A 3CPWA 2DL5A 2FPEA 3LWHA 2YUQA 2BIVA 4Y28E 4HCKA 1SKUB 4ZNXA 3H41A 1SF9A 5I21A 2DNUA 2V8IA 2R5AA 3OYYA 1K4US 4E7ZA 4DBHA 1H3ZA 2LT1A 3RERA 4JUVA 3G6EQ 2HQHA 2XDPA 4F04B 4PJLA 2DTHA 2XDBA 4K11A 3DLMA 3CCVA 1RAFB 1G8XA 1KQ2A 2HNIA 4RCCA 1RABB 1PG5B 2P4TA 5KYYA 2ED1A 1AD5A 5FRMA 3MEAA 3OQ5A 5A0LA 2QA4T 1GBRA 2KEAA 1YI2T 1VYUA 3M59A 3CMAQ 4M7DB 1BI3A 2EQMA 1K8AU 1VQLA 3E1SA 4E7KA 3HRTA 1VQ9T 1KQSP 3A8HB 3M56A 1M1GA 2AKKA 2YLBA 3M0RA 4IIOA 1OV3A 4M77G 5KYXA 1PSFA 2DA9A 2SRCA 1BBZA 3OYNA 2GQIA 4FIBA 1WPYA 2M0OA 4C8QF 3VYGA 5J39A 2DXUA 2XK0A 1UGPB 2A3LA 1WJRA 2DYBA 4NOYA 1NZ9A 1WA7A 1WIEA 4EPCA 2ABLA 1Z9QA 3UF4A 1Y96A 2MIOA 1YHQT 3OW2A 1I5LA 1QCNA 1SRMA 3OY9A 5CKEA 2JUFA 1D3BA 2E1HA 1I81A 3REBB 3EHQA 1PCXA 1D0YA 1MUZA 1D0ZA 1QMCA 3MP1A 2HQXA 2RJDA 1BI2A 5DY9A 2ZAEA 4M7DC 3KXTA 2CZ0B 3G71A 2X35A 4E2FB 1X6GA 2AKLA 2KMTA 4HXJA 5KCOA 4PFOA 4M77A 2M0YA 1JXOA 1KC8U 4IUTA 1KSWA 4RCBA 3EG3A 4ZGDB 2KXDA 4IUUA 3HRUA 3A8LB 1W70A 4OB1B 2R5MA 4PJOB 2VASA 1Q7YR 1QVGS 3CD6Q 4M7AD 2Z0WA 2JOYA 1KG1A 1K0SA 1YJ9Q 1I07A 1ABOA 1VQ4T 1Y07A 1BCOA 1KJWA 1H3HA 1IB8A 3OYHA 1VIFA 1HJDA 4BI4A 4DOWA 2EQIA 2JN0A 2LTOA 3CBOA 4JJCA 2HCKA 5GAMj 2E6NA 4D8DA 3JCMQ 3TCJA 2KRNA 1WHLA 3OS0A 4RTZA 3G4SA 4BACA 3V7SA 2CGHA 2DETA 2OTJQ 1BYMA 5FWBA 5KYYB 4A4FA 4RTYA 2YWWA 3FJPA 1TUGB 1U8RA 1VQNT 3C0CA 1NEBA 5AT1B 4A53A 1YI2A 1KHIA 2EYYA 5CKHA 3ULRB 4M78A 2RI2A 2YUPA 2D6FA 1X27A 2JW4A 3EGXA 4BE1A 1X6OA 3I56Q 2OX7A 2RO0A 2FPFA 1LJOA 3OMCA 1VQ9A 4M78F 3RMQA 5KYXB 2CZ6B 3GNGA 3G6ET 2O88A 1BIBA 4RG2A 2PNIA 2YT6A 3GIBA 4PJOC 3N5BB 2FB7A 2EYZA 3NHNA 2P84A 4E7LA 2B86A 4AFZC 2QGFB 4OB3B 3VYHB 1ARKA 2PVGB 3QZ9B 2DAQA 4XQ3A 1NYGA 1OZ3A 1LPLA 4MZMA 2XDDA 1Y96B 3RKWA 4LN2A 4PJMA 4D8KA 1IRXA 2GTJA 4RTVA 3E9FA 1D3BB 2M9UA 4JS5A 1RUWA 2A0FB 3QSUA 4BI3A 2A28A 5GAOn 3OSSC 4M75E 5KYNA 3I5SA 4R56A 1M9SA 4C5EA 3HFNA 2E3IA 1M2VA 3CXCP 3RR6A 1SSFA 4LD6A 2VGNA 4N0AA 4M77B 3L2RA 2DERA 2FO0A 3CCVQ 3JCMP 1UG1A 4NS5A 2DL8A 4C8QC 1Q81U 3VS0A 1OU9A 1PKSA 4HCBA 1VOMA 3QUIA 3JCMh 1K73U 3EFSA 2JS2A 3OYCA 1FWZA 1KIKA 4C0DB 2RHXA 3PIOA 3NPFA 2EGAA 2L5QA 3CCLA 1RAIB 4MZPA 2NWMA 5FLXE 1VQ4A 4HA8A 4XU1A 2OTLA 4EDUA 4LDWA 3JCMb 3DLLA 1LOJA 3RIRA 2EQJA 5GAOl 3M4GA 1QWFA 5FRNA 4MDXA 3QDFA 1P92A 3P8DA 2RD1A 1PM3A 5CKBA 2O9VA 4KUIA 4KH0B 1E7OA 3SFMA 4OP0A 3HTRA 1QVFA 1NLOC 2I2LA 1VQ7A 2YXYA 2LCSA 3EH1A 3HSBA 2A08A 1TOVA 1M8MA 3TVTA 2CP2A 2CP3A 8AT1B 2CDTA 2L3RA 3JB9G 1VQMT 4BB7A 3G1JA 1T3LA 5GAN6 1YJ9T 4CI0C 5LL6S 3Q1JA 5CCAA 4X9CA 1AWWA 4J9DA 2AIRB 3ER0A 2QG9B 1WHMA 2CH4W 4DBRA 2KDSA 4NL2A 1W1FA 5IXBA 1ZBXA 4F7UF 1YCSB 1PNJA 1QW1A 4DA4A 4C0DC 4QQ6A 1R77A 1ABQA 2FRWA 1OU8A 3G71Q 2IVWA 4PLLA 2OTJT 5LJ3e 2L3SA 2YRDA 1M2OA 5GAN3 1BK2A 3X26B 3EG9A 1U06A 1M90U 1UB4A 2MPXC 2MI6A 4FW1A 2C0OA 2QTVA 5J26A 1WJSA 1D1CA 1PC0A 5LJ3g 2VWFA 4AG1C 3M4YA 4XTYA 1VQPA 1B7TA 1LCKA 2F1LA 1C6VX 2RQTA 2VGMA 3PT9A 1VQ8A 2H8HA 2EVRA 4PJNA 1M2VB 2EYXA 1Q7YC 1RAEB 3LGFA 2GTOA 1O75A 4KGZB 4M78C 2VC8A 1D1AA 5D7UA 2IPOB 1ZLMA 3UA6A 4M7DG 1ZBJA 3R6NA 1M4ZA 3G4SQ 2RJCA 4OVAA 2DEUA 3I9QA 5DLQE 5GAOp 1WHHA 2PQWA 2E6ZA 5IHIA 1NEGA 3SB2A 3OW2P 1YI2Q 3M9QA 1BU1A 5KCHA 1MHNA 3A5ZB 2CT4A 5GAOm 1G3WA 1AZEA 1Q86U 1VQ9Q 1Q95G 2KYBA 4A4HA 1I0CA 5L23A 1W2BA 2M1HA 2HMAA 5GAN4 3RDVA 2L89A 1SRLA 1BI0A 2QEXA 3ME9A 1G5VA 4AFUC 2V26A 2BZ8A 1AOJA 1PRLC 3GP8A 2XD0A 4PKCC 4J5YA 1UHCA 2NUZA 3CQTA 4LDXA 1TS9A 2O2OA 4FM4B 3C12A 1YHQQ 4JRQA 2BZYA 1VQLT 3SWNA 3CCRT 3JCMJ 2AT1B 1OEBA 3REAB 2Y4XA 1N8RU 1D0XA 4IKFA 2F2VA 2KVQG 1JU5C 5FWCA 4Y92A 1WQ7A 5GAN7 3H0HA 3WXMB 2RQRA 3VRYA 4FYVB 2KI7A 3JCMX 2HSPA 5CQYA 1IGUA 5GAOq 2J05A 4L6V5
chains in the Genus database with same CATH topology
2GQIA 2YDLA 4OMQA 2J06A 4JPBW 4RTUA 4CC7A 2MCNA 3VS1A 1QCFA 1TUDA 1NM7A 1WLPB 2DYBA 1QKWA 4J9BA 2KROA 1WIEA 1WA7A 2ABLA 1Z9QA 3UF4A 2DVJA 1X2QA 2MIOA 1PHTA 2J6OA 2IIMA 2CREA 4AG2C 1SRMA 1VYTA 2C0TA 5I22A 1GCQC 1HD3A 4F17A 1W6XA 1JXMA 4Z89A 2L3QA 4HVUA 1SHGA 2DBKA 2GGRA 3REBB 1JEGA 2L3PA 2KT1A 4AFSC 4R0KA 3EHQA 1M3AA 1MUZA 2DILA 4OMMA 1PWTA 2OI3A 3SHWA 3VS3A 2RPNA 4GBQA 2CSQA 2EYWA 2OAWA 5I11A 1X6GA 2AKLA 2O31A 2KYMA 4HXJA 3VS6A 3KFVA 1WI7A 2M0YA 1K1ZA 3O5ZA 1JXOA 2DL3A 1UUEA 4JJDA 2K79A 1KSWA 1WXUA 2JS0A 3EG3A 4OMOA 2KXDA 1E6GA 1SEMA 1W70A 1PKTA 1VA7A 1Y0MA 1K0SA 2KGTA 1ZUYA 1I07A 1M3BA 1ABOA 1JQQA 2GNCA 4OMNA 2DX1A 1B3QA 3M0TA 1KJWA 1H3HA 4HVVA 3EHRA 2RF0A 1HJDA 2K9GA 2D8HA 2EQIA 3THKA 4J9GA 1RLQC 1FMKA 2DRKA 4JJCA 2KE9A 1X2KA 2HCKA 1GCPA 4CC3A 4OMLA 4D8DA 1K0XA 4LUEA 1RLPC 1CKAA 5HCKA 2KRNA 2KRSA 4RTZA 4J9EA 2KT8A 3LH5A 5FWBA 1HSQA 4RTYA 2A36A 1KFZA 4FSSA 2W0ZA 3NMZC 3C0CA 1NEBA 2JM8A 3I35A 2EYYA 3RBBB 2LP5A 1AVZC 3ULRB 1V1CA 2YUPA 1N5ZA 1X27A 2JW4A 1NG2A 1OPKA 2EGCA 5FW9A 2FPFA 2LQWA 1GFDA 4LNPA 1E6HA 3ZL7C 2FRYA 3PVLA 4OMPA 2RQWA 2EBPA 4EIKA 4J9IA 1M3CA 3I5RA 2O88A 1WFWA 2PNIA 2YT6A 2FEIA 2K7AA 2EYZA 3NHNA 4WCIA 2B86A 4AFZC 2D1XA 1UDLA 1ARKA 4M4ZA 1SSHA 2BZXA 1NYGA 3EG2A 1YN8A 2ED0A 4AFQC 4JZ3A 1X69A 1MV0B 2K3BA 4LN2A 4D8KA 1K76A 3M0PA 3UATA 2GTJA 4RTVA 2V1RA 2LMJA 1JO8A 1UTIA 1OPLA 2RQVA 1RUWA 4CC2A 2P4RA 1UECA 2RN8A 2A28A 1Y57A 2J6FA 4Z88A 2HDAA 1U3OA 2KNBB 4RTWA 3VS2A 1GFCA 3I5SA 2LNHB 2DL7A 1UFFA 4LE9A 1AWXA 1CSKA 1A0NB 4RTXA 1U5SA 4F14A 2FO0A 2V1QA 3NGPA 2KR3A 1UG1A 2K6DA 3GBQA 2DL8A 1AWOA 3VS0A 3EG0A 1PKSA 1WX6A 2JTEA 3VS4A 1X6BA 1K9AA 1ZX6A 2W10A 2JS2A 2RMOA 1KIKA 2L0AA 1IO6A 2DJQA 3NPFA 2EGAA 1TG0A 2NWMA 1VYVA 1X43A 4Z8AA 2C0IA 4J9FA 1AWJA 1UE9A 3TSWA 2BTTA 2JXBA 1QWFA 2RQUA 2CH4A 2EW3A 2AZSA 1S1NA 1YWOA 3PVQA 2CUBA 2O9VA 2VVKA 1E7OA 2VKNA 3M0QA 1CKBA 2CUDA 2YUOA 4KRTA 2EPDA 4HVWA 2EGEA 1NLOC 1GCQA 1YWPA 2LCSA 3U23A 2A08A 3TVTA 1M8MA 5ECAA 1B07A 1QKXA 1FYNA 2CDTA 1NYFA 2ECZA 1BB9A 2J6KA 1T0HA 2K2MA 1T3LA 2LJ1A 1UHFA 2OJ2A 2O9SA 1AWWA 2E5KA 4RUGA 3VS5A 2JMAA 2DBMA 1SHFA 2DL4A 4J9DA 1WXBA 1UJ0A 2CH4W 1W1FA 4LUDA 5IXBA 3SEMA 2D0NA 1YCSB 1PNJA 2EKHA 2MOXA 1Z9ZA 3JV3A 2PZ1A 3PE0A 1AEYA 1ABQA 2FRWA 5IXFA 2A37A 5GJWB 3VRZA 5EC7A 2LJ0A 2X3WD 3M0UA 2L3SA 4RTTA 2LQNA 2JMCA 2AK5A 2ESWA 1QLYA 1UGVA 1BK2A 4ORZA 2XMFA 1YNZA 1U06A 3RNJA 2LX7A 1XOVA 2LJ3A 2C0OA 4J9CA 1UJYA 1I1JA 2JT4A 2VWFA 4AG1C 2DE0X 1LCKA 1H92A 1WDXA 4QT7A 2RQTA 5IHNA 1AZGB 2H8HA 2DLPA 1G83A 3EG1A 2DMOA 2EVRA 2EYXA 1G2BA 2FPDA 4J9HA 2GTOA 1J3TA 5IH2A 4CC4B 1ZUUA 2L2PA 1ZLMA 3QWXX 2PTKA 2X3XD 3IQLA 5GJVB 3UA6A 1ZBJA 3R6NA 1WYXA 2ENMA 1T3SA 1M30A 4X1VA 2HEQA 2KXCA 3I9QA 1WXTA 1NLPC 2I0NA 2J7IA 5IHIA 3M0SA 1NEGA 2KBTA 2M51A 3A98A 2ROTA 1GBQA 3QWYA 2RNAA 1BU1A 2AZVA 3TSZA 1YP5A 4ESRA 4E6RA 1ZSGA 2GBQA 3H0FA 2CT4A 1QWEA 1MV3A 1AZEA 2DL5A 2FPEA 2YUQA 2KYBA 4HCKA 1I0CA 4A63B 5L23A 2DM1A 1GL5A 1H8KA 4ZNXA 3H41A 4DEXA 2KRMA 2FG0A 2DNUA 2QDLA 1SRLA 3FJ5A 1M27C 2G6FX 2JM9A 2YSQA 3H0IA 1K4US 1SPKA 1EFNA 2YUNA 2DF6A 4AFUC 2F2WA 1OOTA 1AOJA 1PRLC 2BZ8A 4K11A 1UHCA 2NUZA 3CQTA 4JJBA 2SEMA 3UA7A 2ROLA 2O2OA 1GRIA 2CSIA 1T0JA 2ED1A 1AD5A 1TUCA 2BZYA 2D8JA 1GBRA 2KEAA 1RI9A 3REAB 1OEBA 1VYUA 2F2XA 2F2VA 5IHKA 2DRMA 1JU5C 3EGUA 5FWCA 4IIMA 4Y92A 4JZ4A 4DEYA 3H0HA 3VS7A 2LZ6B 2RQRA 3VRYA 1ZUKA 2HBWA 2HSPA 4GLMA 2AKKA 3M0RA 4IIOA 1OV3A 4F16A 2J05A 2DA9A 2CT3A 2SRCA 1BBZA 1PRMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GQI A;  2YDL A;  4OMQ A;  2J06 A;  4JPB W;  4RTU A;  4CC7 A;  2MCN A;  3VS1 A;  1QCF A;  1TUD A;  1NM7 A;  1WLP B;  2DYB A;  1QKW A;  4J9B A;  2KRO A;  1WIE A;  1WA7 A;  2ABL A;  1Z9Q A;  3UF4 A;  2DVJ A;  1X2Q A;  2MIO A;  1PHT A;  2J6O A;  2IIM A;  2CRE A;  4AG2 C;  1SRM A;  1VYT A;  2C0T A;  5I22 A;  1GCQ C;  1HD3 A;  4F17 A;  1W6X A;  1JXM A;  4Z89 A;  2L3Q A;  4HVU A;  1SHG A;  2DBK A;  2GGR A;  3REB B;  1JEG A;  2L3P A;  2KT1 A;  4AFS C;  4R0K A;  3EHQ A;  1M3A A;  1MUZ A;  2DIL A;  4OMM A;  1PWT A;  2OI3 A;  3SHW A;  3VS3 A;  2RPN A;  4GBQ A;  2CSQ A;  2EYW A;  2OAW A;  5I11 A;  1X6G A;  2AKL A;  2O31 A;  2KYM A;  4HXJ A;  3VS6 A;  3KFV A;  1WI7 A;  2M0Y A;  1K1Z A;  3O5Z A;  1JXO A;  2DL3 A;  1UUE A;  4JJD A;  2K79 A;  1KSW A;  1WXU A;  2JS0 A;  3EG3 A;  4OMO A;  2KXD A;  1E6G A;  1SEM A;  1W70 A;  1PKT A;  1VA7 A;  1Y0M A;  1K0S A;  2KGT A;  1ZUY A;  1I07 A;  1M3B A;  1ABO A;  1JQQ A;  2GNC A;  4OMN A;  2DX1 A;  1B3Q A;  3M0T A;  1KJW A;  1H3H A;  4HVV A;  3EHR A;  2RF0 A;  1HJD A;  2K9G A;  2D8H A;  2EQI A;  3THK A;  4J9G A;  1RLQ C;  1FMK A;  2DRK A;  4JJC A;  2KE9 A;  1X2K A;  2HCK A;  1GCP A;  4CC3 A;  4OML A;  4D8D A;  1K0X A;  4LUE A;  1RLP C;  1CKA A;  5HCK A;  2KRN A;  2KRS A;  4RTZ A;  4J9E A;  2KT8 A;  3LH5 A;  5FWB A;  1HSQ A;  4RTY A;  2A36 A;  1KFZ A;  4FSS A;  2W0Z A;  3NMZ C;  3C0C A;  1NEB A;  2JM8 A;  3I35 A;  2EYY A;  3RBB B;  2LP5 A;  1AVZ C;  3ULR B;  1V1C A;  2YUP A;  1N5Z A;  1X27 A;  2JW4 A;  1NG2 A;  1OPK A;  2EGC A;  5FW9 A;  2FPF A;  2LQW A;  1GFD A;  4LNP A;  1E6H A;  3ZL7 C;  2FRY A;  3PVL A;  4OMP A;  2RQW A;  2EBP A;  4EIK A;  4J9I A;  1M3C A;  3I5R A;  2O88 A;  1WFW A;  2PNI A;  2YT6 A;  2FEI A;  2K7A A;  2EYZ A;  3NHN A;  4WCI A;  2B86 A;  4AFZ C;  2D1X A;  1UDL A;  1ARK A;  4M4Z A;  1SSH A;  2BZX A;  1NYG A;  3EG2 A;  1YN8 A;  2ED0 A;  4AFQ C;  4JZ3 A;  1X69 A;  1MV0 B;  2K3B A;  4LN2 A;  4D8K A;  1K76 A;  3M0P A;  3UAT A;  2GTJ A;  4RTV A;  2V1R A;  2LMJ A;  1JO8 A;  1UTI A;  1OPL A;  2RQV A;  1RUW A;  4CC2 A;  2P4R A;  1UEC A;  2RN8 A;  2A28 A;  1Y57 A;  2J6F A;  4Z88 A;  2HDA A;  1U3O A;  2KNB B;  4RTW A;  3VS2 A;  1GFC A;  3I5S A;  2LNH B;  2DL7 A;  1UFF A;  4LE9 A;  1AWX A;  1CSK A;  1A0N B;  4RTX A;  1U5S A;  4F14 A;  2FO0 A;  2V1Q A;  3NGP A;  2KR3 A;  1UG1 A;  2K6D A;  3GBQ A;  2DL8 A;  1AWO A;  3VS0 A;  3EG0 A;  1PKS A;  1WX6 A;  2JTE A;  3VS4 A;  1X6B A;  1K9A A;  1ZX6 A;  2W10 A;  2JS2 A;  2RMO A;  1KIK A;  2L0A A;  1IO6 A;  2DJQ A;  3NPF A;  2EGA A;  1TG0 A;  2NWM A;  1VYV A;  1X43 A;  4Z8A A;  2C0I A;  4J9F A;  1AWJ A;  1UE9 A;  3TSW A;  2BTT A;  2JXB A;  1QWF A;  2RQU A;  2CH4 A;  2EW3 A;  2AZS A;  1S1N A;  1YWO A;  3PVQ A;  2CUB A;  2O9V A;  2VVK A;  1E7O A;  2VKN A;  3M0Q A;  1CKB A;  2CUD A;  2YUO A;  4KRT A;  2EPD A;  4HVW A;  2EGE A;  1NLO C;  1GCQ A;  1YWP A;  2LCS A;  3U23 A;  2A08 A;  3TVT A;  1M8M A;  5ECA A;  1B07 A;  1QKX A;  1FYN A;  2CDT A;  1NYF A;  2ECZ A;  1BB9 A;  2J6K A;  1T0H A;  2K2M A;  1T3L A;  2LJ1 A;  1UHF A;  2OJ2 A;  2O9S A;  1AWW A;  2E5K A;  4RUG A;  3VS5 A;  2JMA A;  2DBM A;  1SHF A;  2DL4 A;  4J9D A;  1WXB A;  1UJ0 A;  2CH4 W;  1W1F A;  4LUD A;  5IXB A;  3SEM A;  2D0N A;  1YCS B;  1PNJ A;  2EKH A;  2MOX A;  1Z9Z A;  3JV3 A;  2PZ1 A;  3PE0 A;  1AEY A;  1ABQ A;  2FRW A;  5IXF A;  2A37 A;  5GJW B;  3VRZ A;  5EC7 A;  2LJ0 A;  2X3W D;  3M0U A;  2L3S A;  4RTT A;  2LQN A;  2JMC A;  2AK5 A;  2ESW A;  1QLY A;  1UGV A;  1BK2 A;  4ORZ A;  2XMF A;  1YNZ A;  1U06 A;  3RNJ A;  2LX7 A;  1XOV A;  2LJ3 A;  2C0O A;  4J9C A;  1UJY A;  1I1J A;  2JT4 A;  2VWF A;  4AG1 C;  2DE0 X;  1LCK A;  1H92 A;  1WDX A;  4QT7 A;  2RQT A;  5IHN A;  1AZG B;  2H8H A;  2DLP A;  1G83 A;  3EG1 A;  2DMO A;  2EVR A;  2EYX A;  1G2B A;  2FPD A;  4J9H A;  2GTO A;  1J3T A;  5IH2 A;  4CC4 B;  1ZUU A;  2L2P A;  1ZLM A;  3QWX X;  2PTK A;  2X3X D;  3IQL A;  5GJV B;  3UA6 A;  1ZBJ A;  3R6N A;  1WYX A;  2ENM A;  1T3S A;  1M30 A;  4X1V A;  2HEQ A;  2KXC A;  3I9Q A;  1WXT A;  1NLP C;  2I0N A;  2J7I A;  5IHI A;  3M0S A;  1NEG A;  2KBT A;  2M51 A;  3A98 A;  2ROT A;  1GBQ A;  3QWY A;  2RNA A;  1BU1 A;  2AZV A;  3TSZ A;  1YP5 A;  4ESR A;  4E6R A;  1ZSG A;  2GBQ A;  3H0F A;  2CT4 A;  1QWE A;  1MV3 A;  1AZE A;  2DL5 A;  2FPE A;  2YUQ A;  2KYB A;  4HCK A;  1I0C A;  4A63 B;  5L23 A;  2DM1 A;  1GL5 A;  1H8K A;  4ZNX A;  3H41 A;  4DEX A;  2KRM A;  2FG0 A;  2DNU A;  2QDL A;  1SRL A;  3FJ5 A;  1M27 C;  2G6F X;  2JM9 A;  2YSQ A;  3H0I A;  1K4U S;  1SPK A;  1EFN A;  2YUN A;  2DF6 A;  4AFU C;  2F2W A;  1OOT A;  1AOJ A;  1PRL C;  2BZ8 A;  4K11 A;  1UHC A;  2NUZ A;  3CQT A;  4JJB A;  2SEM A;  3UA7 A;  2ROL A;  2O2O A;  1GRI A;  2CSI A;  1T0J A;  2ED1 A;  1AD5 A;  1TUC A;  2BZY A;  2D8J A;  1GBR A;  2KEA A;  1RI9 A;  3REA B;  1OEB A;  1VYU A;  2F2X A;  2F2V A;  5IHK A;  2DRM A;  1JU5 C;  3EGU A;  5FWC A;  4IIM A;  4Y92 A;  4JZ4 A;  4DEY A;  3H0H A;  3VS7 A;  2LZ6 B;  2RQR A;  3VRY A;  1ZUK A;  2HBW A;  2HSP A;  4GLM A;  2AKK A;  3M0R A;  4IIO A;  1OV3 A;  4F16 A;  2J05 A;  2DA9 A;  2CT3 A;  2SRC A;  1BBZ A;  1PRM C; 
#chains in the Genus database with same CATH topology
 1TXQ A;  4OMQ A;  4JRK A;  3VS1 A;  4Z02 A;  1QCF A;  2VV5 A;  2COZ A;  2LCL A;  1NM7 A;  3EG9 B;  4NL3 A;  2DJZ A;  4N4G A;  1M1K U;  3FLG A;  5DM7 R;  2RHZ A;  3QBY A;  3V8L A;  5A2Q E;  4C92 D;  2M16 A;  2HAX A;  2C0T A;  5I22 A;  4QW2 A;  4F17 A;  1W6X A;  2X51 A;  4ANJ A;  3CCL Q;  2GGR A;  3X20 B;  1LVK A;  2DD5 A;  1KD1 U;  3JCM e;  1VQ4 Q;  2COW A;  2KT1 A;  3QPH A;  2OTL Q;  4AFS C;  2M02 A;  1M3A A;  4OGC A;  2OI3 A;  4FT2 A;  2DXT A;  4ZN3 A;  3QII A;  2RPN A;  4M75 A;  5GAN e;  1RAC B;  3JCM g;  4ATO A;  2WSF E;  1JJ2 A;  4CRI A;  3KFV A;  4M75 F;  4EMH A;  4ZGJ B;  1WI7 A;  3S6W A;  1K1Z A;  1BCM A;  3A8O B;  1QCO A;  2QAS A;  4JJD A;  3M58 A;  4OMO A;  5GAN g;  3OYI A;  1MMN A;  4C8Q G;  2LRQ A;  4E7S A;  3LX7 A;  4MMK A;  4OF1 A;  1Y0M A;  1ZA2 B;  1M3B A;  3OMG A;  1JQQ A;  2GNC A;  3HRS A;  2E10 A;  4OMN A;  5KE3 A;  2RI3 A;  2DZC A;  4HVV A;  5CKD A;  2RF0 A;  2QGG A;  3OBY A;  1UGR B;  1K9M U;  1RLQ C;  3MEV A;  1FMK A;  2DRK A;  3CME T;  3MEW A;  2KE9 A;  3G4S T;  4LUE A;  3CC2 T;  4M7D D;  3M55 A;  4F7U E;  4B6M A;  2BE9 B;  1NE8 A;  3QJY A;  2A36 A;  1KFZ A;  4M7A F;  4AMC A;  2W0Z A;  3PMT A;  2K3X A;  3TRE A;  4QQD A;  3NMZ C;  3CCR A;  1XNI A;  3I35 A;  2MK5 A;  1VQP Q;  2P0P A;  1RAD B;  3VU3 C;  1HXD A;  2LCC A;  3MP6 A;  1Y71 A;  1VQ8 Q;  1YJW A;  4LNP A;  4C8Q A;  2FRY A;  2E64 A;  3I55 A;  3PVL A;  2EKO A;  3CCE A;  3QXE B;  3FC3 A;  2EFI A;  2EBP A;  3FIF A;  3L42 A;  1XQH A;  1M3C A;  1WFW A;  3RUX A;  3JB9 I;  3D7S B;  1VUB A;  4FU6 A;  5M9O A;  3FB9 A;  3OA6 A;  4XTV A;  1SSH A;  2CKK A;  1Q82 U;  1QP3 A;  3L1A A;  1YN8 A;  2NUP A;  5CK9 A;  3MHX A;  3OB9 A;  4IUV A;  1PSE A;  4N4H A;  4VUB A;  1MV0 B;  2HL5 C;  3M0P A;  1C0M A;  3UAT A;  2CP5 A;  4YTL A;  4R55 A;  4C5H A;  2LMJ A;  1JO8 A;  1I5O B;  1OPL A;  2RQV A;  4CC2 A;  2P4R A;  3SD4 A;  1G3S A;  1RAA B;  1Y57 A;  2J6F A;  1TWB A;  2Y90 A;  2HDA A;  2KNB B;  3DKM A;  4RTW A;  4FSX A;  4C92 E;  3SWN C;  4J6X A;  2DL7 A;  1UFF A;  4LE9 A;  1Y7X A;  5FU6 C;  4M75 B;  2GFU A;  2EQK A;  1CSK A;  4M78 G;  1U1S A;  2XG8 D;  4PJO D;  1A0N B;  4RTX A;  3OYB A;  1K8A C;  2K6D A;  4FCY A;  1AWO A;  1OI1 A;  4L5G A;  2JVV A;  3C95 A;  2NUT A;  3VS4 A;  3PIP A;  1LNX A;  1VQM Q;  1K9A A;  1ZX6 A;  3CCL T;  2L0A A;  2ZPB B;  4KGV B;  2OTL T;  2DJQ A;  1EZZ B;  3E19 A;  3VUB A;  4A4K A;  2K5L A;  2XHC A;  1TG0 A;  2EWN A;  2MMP A;  3UT1 A;  4QKU A;  1X43 A;  2C0I A;  2R58 A;  1NJI R;  3TSW A;  1KQ1 A;  2BTT A;  5DLO A;  2EJ9 A;  3WVE B;  1YIT T;  4J7I A;  2JXB A;  2RQU A;  2HKN A;  2Y4Y A;  2CH4 A;  4XK8 E;  2AZS A;  3TQ7 P;  4JLG A;  3CCM A;  3V7R A;  3CME A;  1VQ7 T;  2YUO A;  3CC2 A;  1GCQ A;  2XU8 A;  1GXI E;  2C06 A;  5ECA A;  1B07 A;  1ZHI A;  5GMK j;  2LQK A;  2GCX A;  1BB9 A;  2NYS A;  4M75 C;  2PVD B;  3CEY A;  5I2S A;  1JB0 E;  1KQS S;  2OJ2 A;  4QVD A;  5J3B A;  2O9S A;  3VS5 A;  3HKS A;  1SHF A;  1QVP A;  4C8Q B;  5GAM e;  3M54 A;  1YFN A;  5KYW A;  1W2B P;  2MOX A;  1Z9Z A;  1KC8 C;  4X34 A;  3PE0 A;  5LJ3 f;  1AEY A;  2CZ7 B;  4J8O A;  4XTW A;  3RKX A;  3VRZ A;  5EC7 A;  1IHV A;  1XJW B;  2GF7 A;  5GAM g;  1WQW A;  2K5I A;  5GMK e;  5IT9 E;  2NUP B;  2MWP A;  1UGV A;  1WHG A;  1FMV A;  2XMF A;  2RB6 A;  1VQP T;  1VQO A;  1XOV A;  2LJ3 A;  4XTX A;  2GFA A;  3LW5 E;  1VQ8 T;  5AYF A;  2JT4 A;  1H92 A;  1WDX A;  2LNV A;  3LGL A;  1QVG A;  1G3T A;  4M77 D;  1VQ6 A;  2E12 A;  3EG1 A;  3JCM V;  2DMO A;  2K4Y A;  2DZ9 A;  1G2B A;  4J9H A;  3KUF A;  4J6Y A;  1J3T A;  4CC4 B;  4EMG A;  5LJ5 d;  3IQL A;  2GQV A;  2K57 A;  2RHI A;  1T3S A;  1M30 A;  4X1V A;  7AT1 B;  4QVC A;  1WXT A;  2J7I A;  2NUT B;  5LJ5 h;  4BUG A;  3MP8 A;  1VQL Q;  3CCR Q;  3A98 A;  1QP2 A;  1GBQ A;  2RNA A;  5CO7 A;  1MMG A;  4E6R A;  1ZSG A;  1BIA A;  1QWE A;  2QTX A;  5C6S A;  3VJP A;  3RMS A;  4M7A E;  3CCU T;  3I55 Q;  4KT0 E;  4TVR A;  2DM1 A;  2QEX T;  1H8K A;  1X75 C;  2V8K A;  4GLK A;  3CCE Q;  4DEX A;  3LWI A;  3GOX A;  2FHD A;  4ZTF A;  1YIT A;  4FT4 A;  2ZPF B;  3FJ5 A;  2G6F X;  2JM9 A;  3H0I A;  1ZQ1 A;  1SPK A;  1EFN A;  4BE2 A;  4M78 D;  1WNL A;  4B9W A;  4PNO A;  2DK3 A;  1JJ2 P;  1QQJ A;  1R8O B;  4A4G A;  1RI0 A;  1G3Y A;  2SEM A;  2EJF A;  3DB3 A;  3CC7 A;  1GRI A;  4M78 B;  2CSI A;  3EGX B;  3QYH B;  1Q7Y U;  3BW1 A;  3X25 B;  4DBQ A;  4PFZ A;  5GAN 5;  4PLI A;  4F7U A;  2LQ8 A;  3CPW P;  2DRM A;  3V8K A;  1N9R A;  4IIM A;  4JJN K;  1PD1 A;  4JZ4 A;  2X9H A;  3V7C A;  1H64 1;  3WVD B;  3L2Z A;  5HKC A;  2EYQ A;  1R0C B;  3E2U A;  5KYW B;  3VV0 A;  2EJG A;  4F16 A;  2CS7 A;  3EH2 A;  2CT3 A;  1OQK A;  1Q81 C;  2YDL A;  3JB9 J;  3NTK A;  4JPB W;  1FX7 A;  4E7J A;  3M57 A;  1YJN A;  2YRV A;  1TUD A;  5LJ5 f;  3OYL A;  1QKW A;  4J9B A;  2DVJ A;  4RMO A;  4A54 A;  1PHT A;  2J6O A;  2IIM A;  2CRE A;  4AG2 C;  2DVE A;  5I2M A;  1VYT A;  2LDM A;  1GCQ C;  2QI2 A;  5IN1 A;  4MZT A;  1IZ6 A;  1JXM A;  2L3Q A;  2NLU A;  1SHG A;  4HVU A;  2VB6 A;  2L3P A;  3CXC S;  4R0K A;  2DIL A;  5GAN f;  2KAF A;  9ATC B;  3HL8 A;  2MWO A;  2K3Y A;  3CME Q;  3JB9 H;  1SG5 A;  4GBQ A;  2CZ1 B;  4FL6 A;  1NBE B;  3CC2 Q;  2O31 A;  2E4H A;  2KYM A;  3LH0 A;  1NJI C;  5KYU A;  1K9M R;  4C92 F;  2KQW A;  1UUE A;  3MJX A;  3H6Z A;  4ELY C;  2H3E B;  3R6O A;  3AT1 B;  1SEM A;  3GPL A;  2FYK A;  4HT9 A;  4WTO B;  2OAU A;  5GAN 8;  2HZY A;  4BDZ A;  2X4W A;  4BE0 A;  1ZUY A;  1K8A R;  4MML A;  2DX1 A;  1B3Q A;  3CCU A;  2XKO C;  3M0T A;  5CR2 A;  3QJ6 A;  4MDW A;  3EHR A;  2A7Y A;  3MKD A;  3BE3 A;  3THK A;  4J9G A;  1UGS B;  1M90 C;  4V2S A;  3CCS A;  1I4K 1;  1X2K A;  4J83 A;  4BDY A;  1GCP A;  1U1T A;  4FYX B;  4OML A;  1K0X A;  1CKA A;  3TEE A;  5HCK A;  2KRS A;  4J9E A;  1M1F A;  3CCQ A;  2PVO B;  1AT1 B;  4B9X A;  1VQO Q;  4FSS A;  1OX9 A;  4JRI A;  2PU9 B;  4F7U B;  2JM8 A;  5FRO A;  3CPW S;  2LP5 A;  4M75 G;  1YJW T;  1V1C A;  1N5Z A;  3CCJ A;  1OPK A;  3I55 T;  2KK4 A;  4LXC A;  3CCE T;  2EGC A;  3CD6 A;  3JSC A;  1GFD A;  3VKI A;  1VQ6 Q;  3ZL7 C;  2DXB A;  2QK0 A;  2RQW A;  3HPW A;  4EIK A;  4J9I A;  1HYO A;  2VUB A;  4Y91 A;  2FEI A;  2K7A A;  2RK2 A;  3VUZ A;  1UEB A;  2CYZ B;  2ZGW A;  4FW2 A;  4WCI A;  1MMA A;  2JZ2 A;  2D1X A;  4M4Z A;  5CVI A;  3JB9 D;  2BZX A;  1VQ5 A;  2ED0 A;  4AFQ C;  1VQK A;  1YIJ A;  3INZ A;  3OYD A;  1BKB A;  2K3B A;  3KBG A;  1KC8 R;  5GAM d;  3V8J A;  2V1R A;  1UTI A;  1N6A A;  2RN8 A;  2DXC A;  4Z88 A;  2QYZ A;  4OGE A;  1U3O A;  1GFC A;  2DTI A;  1YIT Q;  2YRC A;  3C94 A;  1VQ7 Q;  1AWX A;  2RJF A;  2AHJ B;  2IG0 A;  5KYU B;  3NGP A;  3OW2 S;  5GAO r;  1I8F A;  3CC7 Q;  3EG0 A;  3RKY A;  3PMI A;  1X6B A;  3S3M A;  2VXE A;  3EFO A;  4RG8 A;  1D09 B;  2EAY A;  2V8J A;  1JRI A;  1YCY A;  1RAH B;  4HCC A;  3A8M B;  1VYV A;  1QVG P;  4GY5 A;  4J9F A;  1AWJ A;  3BDU A;  1UE9 A;  3CCM T;  3OSV A;  3OYF A;  3P8B B;  4PJO F;  2EIF A;  4EMK A;  1M1K C;  2VKN A;  4M7A A;  2CUD A;  2JJ9 A;  4KRT A;  4LD9 K;  3G7Z A;  4HVW A;  5C0M A;  4KUL A;  1OZ2 A;  1YJN Q;  1YWP A;  1MGQ A;  3SWN B;  4BY6 C;  3HP9 A;  1QKX A;  1FYN A;  2JTM A;  1NYF A;  3L2Q A;  5FU6 B;  1KD1 C;  3J80 E;  1DJ7 B;  3F70 A;  4L59 A;  2O01 E;  5CQX A;  2BE7 D;  2K2M A;  2LJ1 A;  4C92 C;  2KSS A;  1BI1 A;  4RUG A;  2JMA A;  1M8V A;  4ME7 A;  4JDS A;  2D0Q B;  2PUO B;  5GAM f;  4ZN1 A;  1UJ0 A;  3MET A;  1EIF A;  4LUD A;  3SEM A;  2ZPH B;  1RAG B;  2HSE B;  2EKH A;  1TSF A;  5HK0 A;  1WHJ A;  2G3R A;  1IRE B;  2RHY A;  3QYG B;  5GMK l;  2QQS A;  2DIQ A;  1QVF P;  2XID A;  5IXF A;  5GJW B;  2LJ0 A;  2X3W D;  3M0U A;  4RTT A;  2YHT A;  2LQN A;  1VQO T;  1RL2 A;  2ESW A;  3MO8 A;  3URG A;  5CAI A;  4ORZ A;  1YNZ A;  3NFC A;  2ZZD A;  2LX7 A;  1Q81 R;  4E7H A;  1UJY A;  1I1J A;  4M75 D;  2MAM A;  2DE0 X;  1K73 R;  1VQ6 T;  4A4E A;  1K9M C;  4QT7 A;  5LJ3 d;  2K5F A;  2COY A;  5GMK i;  1AZG B;  3CBP A;  1KHC A;  3CCU Q;  1G83 A;  2QEX Q;  3O8V A;  1R0B G;  2FPD A;  5LJ3 h;  5GAN 2;  1N9S A;  3JCM W;  2WSC E;  3CC4 A;  3CCS Q;  2XIC A;  1S72 T;  2BKD N;  1V76 A;  3AHU A;  2QDY B;  3OYK A;  2X3X D;  4IUR A;  3UDC A;  1WYX A;  4PJJ A;  4O5V A;  5IAY A;  3CCQ Q;  4KUD K;  1NLP C;  3OYM A;  2QQB A;  1IXD A;  3JCM c;  2KBT A;  3EFO B;  4KH1 B;  2LVM A;  5D6X A;  2ROT A;  3QWY A;  2AZV A;  3LYI A;  4M77 F;  4C0F A;  1YP5 A;  6AT1 B;  1AHJ B;  3CCJ Q;  3H0F A;  4O6J A;  1WJQ A;  4XU3 A;  1X01 A;  3HHT B;  2RJE A;  2VYT A;  4A63 B;  1GL5 A;  3BY7 A;  2KRM A;  4EMK B;  2FG0 A;  1Q82 C;  2QDL A;  3JAM E;  1M27 C;  4M7A B;  2YSQ A;  2YUN A;  2ZPI B;  2K2V A;  2DF6 A;  4OB2 B;  2F2W A;  2ZCF B;  2E70 A;  1OOT A;  2DFU A;  3CC7 T;  5KE2 A;  1VQ5 Q;  2CP0 A;  4JJB A;  4C8Q D;  2YLC A;  3UA7 A;  1B34 A;  1VQK Q;  3X24 B;  2MF2 A;  2ROL A;  1YIJ Q;  4M7D E;  1T0J A;  4LDU A;  1TUC A;  2D8J A;  1KK7 A;  1RI9 A;  1M90 R;  2E3H A;  2F2X A;  5IHK A;  4XAX B;  2QA4 A;  2F69 A;  3T9N A;  3EGU A;  5CKF A;  4C0Z A;  4DEY A;  4IUP A;  3VS7 A;  3FRN A;  2LZ6 B;  5GMK m;  3PGG A;  2DIG A;  1ZUK A;  2HBW A;  4GLM A;  2X4X A;  2LT4 A;  3DB4 A;  1PRM C;  2P0K A;  4XTZ A;  1QVF S;  2HKQ B;  2J06 A;  1YJN T;  1IHW A;  2DYI A;  3MEU A;  4RTU A;  4CC7 A;  2MCN A;  4X9D A;  3HFO A;  3QZ5 B;  2EQU A;  3QHS A;  1WLP B;  2DKG A;  2KRO A;  2QQ9 A;  4EMK C;  1X2Q A;  1UGQ B;  2RHU A;  3ZFJ A;  4ZGE B;  4M7A C;  2X4Y A;  2JTF A;  3CMA T;  1M5Q 1;  1HD3 A;  1YHQ A;  4XTU A;  1HK9 A;  1JBM A;  4Z89 A;  2DBK A;  1YBY A;  3GLX A;  3JRZ A;  1JEG A;  2QQA A;  3EGD A;  3OYG A;  2D9T A;  1Q86 R;  2HL3 A;  1PWT A;  4OMM A;  4UC4 A;  5EG2 A;  3SHW A;  1PD0 A;  1C1A A;  3VS3 A;  1ZA1 B;  3OS5 A;  4HCZ A;  4HKE A;  4F7U G;  2CSQ A;  1S72 A;  2DEQ A;  1MND A;  2EYW A;  2OAW A;  5I11 A;  3TU4 K;  8ATC B;  3VS6 A;  3J7A F;  3EAE A;  2WSE E;  3JCM d;  3O5Z A;  4PJO E;  2DL3 A;  3CPF A;  2E41 A;  4C5I A;  2JS0 A;  1WXU A;  2K79 A;  1ACM B;  2DO3 A;  2LC4 A;  1E6G A;  3P8H A;  4J6W A;  4FYW B;  5GAN d;  1YJW Q;  1PKT A;  1VA7 A;  3CBM A;  3OBW A;  2KGT A;  4XU2 A;  1D1B A;  1N8R R;  2KY9 A;  4JLI A;  1KQS A;  3FDR A;  3L2W A;  2RI5 A;  3C4S A;  2FL7 A;  5GAN h;  3CCS T;  2K9G A;  2D8H A;  5CIU A;  1OX8 A;  1ZSZ A;  4HT8 A;  4QQG A;  4CC3 A;  1WZO A;  3BDL A;  4OMF B;  3CCQ T;  1RLP C;  3MPU B;  3J81 E;  2H3J A;  2QQR A;  4D6W A;  1B34 B;  2KT8 A;  4OB0 B;  3LH5 A;  3EFR A;  4IUQ A;  1HSQ A;  5LJ3 j;  3QDR B;  5KH6 A;  2F5T X;  3CCJ T;  3PTA A;  1M1K R;  3RBB B;  1AVZ C;  3CD6 T;  2HQE A;  4C8Q E;  1NG2 A;  4BI8 B;  1VQN A;  4C92 G;  2BUD A;  1W2B S;  5FW9 A;  1NJI U;  2LQW A;  4M77 C;  1E6H A;  2MYS A;  4KGX B;  1TTH B;  1KD1 R;  4OMP A;  4DQ2 A;  1XTD A;  2F5K A;  1K73 C;  2X4J A;  3I5R A;  5A0D A;  3CC4 Q;  4JS4 A;  3LLR A;  2E5Q A;  3G6E A;  1VQ5 T;  5A0G A;  1UDL A;  1VQK T;  1YIJ T;  3H8Z A;  3EG2 A;  2RH2 A;  2VXF A;  4JZ3 A;  1OYX A;  4DOV A;  3L2V A;  3X28 B;  1X69 A;  3JCM f;  5HY6 A;  1K76 A;  2XI9 A;  1TU0 B;  3CMA A;  2RA2 A;  4LDV A;  1UEC A;  3I56 T;  1O9S A;  3OYA A;  3EGD B;  3VS2 A;  2R57 A;  3CCM Q;  4N4I A;  2LNH B;  4M77 E;  4C92 A;  3QO3 A;  2RK1 A;  3ASK A;  3JB9 F;  2P0Q A;  2O4X A;  4LDY A;  2L8D A;  4J7F A;  3OYE A;  1U5S A;  4F14 A;  2V1Q A;  1F1B B;  2KR3 A;  2LX9 A;  1EX4 A;  3GBQ A;  2PUK B;  3QG1 A;  4E47 A;  1WX6 A;  1FMW A;  1W4S A;  2JTE A;  4AT1 B;  3BFM A;  4PK4 A;  2B8A A;  2W10 A;  2RMO A;  4E7I A;  2QA4 Q;  1IO6 A;  2FVU A;  1MNE A;  2ZPG B;  4RKU E;  3M53 A;  3OS1 A;  4Z8A A;  2ATC B;  3QKJ A;  3GNF B;  2CP6 A;  1IGQ A;  2EW3 A;  1S1N A;  1YWO A;  3PVQ A;  3UWN A;  1JJ2 S;  2CUB A;  4PL6 A;  1ZSZ B;  2RM4 A;  2VVK A;  4BD3 A;  3M0Q A;  2DPP B;  4C0G A;  1CKB A;  3M5A A;  2EPD A;  4DBF A;  3MCA B;  5FU7 B;  2EGE A;  1TH7 A;  1NPR A;  3PFS A;  5HK3 A;  3CCV T;  3U23 A;  2HBP A;  4M78 E;  2ECZ A;  1Q82 R;  2J6K A;  1OUL A;  1T0H A;  4C5G A;  3S3O A;  1UHF A;  2DTO A;  5LJ5 j;  1V29 B;  2E5K A;  1VQM A;  4KBM B;  4N0A C;  4M7D A;  2DBM A;  2DL4 A;  1WXB A;  1YJ9 A;  3GF5 A;  2DD4 A;  4P5N A;  4M7D F;  1VIE A;  2D0N A;  3CXC A;  3E9G A;  3JV3 A;  2PZ1 A;  3FEO A;  2CP7 A;  2FZK B;  3SDZ A;  1S72 Q;  4QVZ A;  2A37 A;  1Q86 C;  4II1 A;  4XU0 A;  3UPU A;  2JMC A;  5GAN j;  4PJO G;  2AK5 A;  2OTJ A;  1QLY A;  3ZBD A;  4WF2 A;  3RNJ A;  4PFP A;  2ZPE B;  2QAZ A;  2WAC A;  1ZSZ C;  3A8G B;  4J9C A;  2FZC B;  5LJ5 e;  2JNG A;  4M7A G;  5FU7 C;  4ZTJ A;  4BY6 B;  1MMD A;  2HD0 A;  4ELZ C;  5IHN A;  3I56 A;  3NTH A;  5GAM h;  4Q5W A;  1WGS A;  2QXF A;  5D6Y A;  2DLP A;  1NPP A;  3CC4 T;  4JRP A;  2FZG B;  4C92 B;  5LJ5 g;  3NTI A;  5IH2 A;  2O4X B;  1N8R C;  1ZUU A;  3G71 T;  5GMK h;  2L2P A;  3H9N A;  1WHK A;  3QWX X;  5D6W A;  3ZEH A;  2PTK A;  5GJV B;  5L8R E;  4FYY B;  2ENM A;  3PNW C;  3L2U A;  2HEQ A;  3S3N A;  2KXC A;  2E65 A;  3RES A;  1N27 A;  2I0N A;  3OS2 A;  3M0S A;  2M51 A;  3OYJ A;  3TSZ A;  4ESR A;  1FXX A;  3A1P A;  2GBQ A;  4PJO A;  1VQN Q;  1MV3 A;  3CPW A;  2DL5 A;  2FPE A;  3LWH A;  2YUQ A;  2BIV A;  4Y28 E;  4HCK A;  1SKU B;  4ZNX A;  3H41 A;  1SF9 A;  5I21 A;  2DNU A;  2V8I A;  2R5A A;  3OYY A;  1K4U S;  4E7Z A;  4DBH A;  1H3Z A;  2LT1 A;  3RER A;  4JUV A;  3G6E Q;  2HQH A;  2XDP A;  4F04 B;  4PJL A;  2DTH A;  2XDB A;  4K11 A;  3DLM A;  3CCV A;  1RAF B;  1G8X A;  1KQ2 A;  2HNI A;  4RCC A;  1RAB B;  1PG5 B;  2P4T A;  5KYY A;  2ED1 A;  1AD5 A;  5FRM A;  3MEA A;  3OQ5 A;  5A0L A;  2QA4 T;  1GBR A;  2KEA A;  1YI2 T;  1VYU A;  3M59 A;  3CMA Q;  4M7D B;  1BI3 A;  2EQM A;  1K8A U;  1VQL A;  3E1S A;  4E7K A;  3HRT A;  1VQ9 T;  1KQS P;  3A8H B;  3M56 A;  1M1G A;  2AKK A;  2YLB A;  3M0R A;  4IIO A;  1OV3 A;  4M77 G;  5KYX A;  1PSF A;  2DA9 A;  2SRC A;  1BBZ A;  3OYN A;  2GQI A;  4FIB A;  1WPY A;  2M0O A;  4C8Q F;  3VYG A;  5J39 A;  2DXU A;  2XK0 A;  1UGP B;  2A3L A;  1WJR A;  2DYB A;  4NOY A;  1NZ9 A;  1WA7 A;  1WIE A;  4EPC A;  2ABL A;  1Z9Q A;  3UF4 A;  1Y96 A;  2MIO A;  1YHQ T;  3OW2 A;  1I5L A;  1QCN A;  1SRM A;  3OY9 A;  5CKE A;  2JUF A;  1D3B A;  2E1H A;  1I81 A;  3REB B;  3EHQ A;  1PCX A;  1D0Y A;  1MUZ A;  1D0Z A;  1QMC A;  3MP1 A;  2HQX A;  2RJD A;  1BI2 A;  5DY9 A;  2ZAE A;  4M7D C;  3KXT A;  2CZ0 B;  3G71 A;  2X35 A;  4E2F B;  1X6G A;  2AKL A;  2KMT A;  4HXJ A;  5KCO A;  4PFO A;  4M77 A;  2M0Y A;  1JXO A;  1KC8 U;  4IUT A;  1KSW A;  4RCB A;  3EG3 A;  4ZGD B;  2KXD A;  4IUU A;  3HRU A;  3A8L B;  1W70 A;  4OB1 B;  2R5M A;  4PJO B;  2VAS A;  1Q7Y R;  1QVG S;  3CD6 Q;  4M7A D;  2Z0W A;  2JOY A;  1KG1 A;  1K0S A;  1YJ9 Q;  1I07 A;  1ABO A;  1VQ4 T;  1Y07 A;  1BCO A;  1KJW A;  1H3H A;  1IB8 A;  3OYH A;  1VIF A;  1HJD A;  4BI4 A;  4DOW A;  2EQI A;  2JN0 A;  2LTO A;  3CBO A;  4JJC A;  2HCK A;  5GAM j;  2E6N A;  4D8D A;  3JCM Q;  3TCJ A;  2KRN A;  1WHL A;  3OS0 A;  4RTZ A;  3G4S A;  4BAC A;  3V7S A;  2CGH A;  2DET A;  2OTJ Q;  1BYM A;  5FWB A;  5KYY B;  4A4F A;  4RTY A;  2YWW A;  3FJP A;  1TUG B;  1U8R A;  1VQN T;  3C0C A;  1NEB A;  5AT1 B;  4A53 A;  1YI2 A;  1KHI A;  2EYY A;  5CKH A;  3ULR B;  4M78 A;  2RI2 A;  2YUP A;  2D6F A;  1X27 A;  2JW4 A;  3EGX A;  4BE1 A;  1X6O A;  3I56 Q;  2OX7 A;  2RO0 A;  2FPF A;  1LJO A;  3OMC A;  1VQ9 A;  4M78 F;  3RMQ A;  5KYX B;  2CZ6 B;  3GNG A;  3G6E T;  2O88 A;  1BIB A;  4RG2 A;  2PNI A;  2YT6 A;  3GIB A;  4PJO C;  3N5B B;  2FB7 A;  2EYZ A;  3NHN A;  2P84 A;  4E7L A;  2B86 A;  4AFZ C;  2QGF B;  4OB3 B;  3VYH B;  1ARK A;  2PVG B;  3QZ9 B;  2DAQ A;  4XQ3 A;  1NYG A;  1OZ3 A;  1LPL A;  4MZM A;  2XDD A;  1Y96 B;  3RKW A;  4LN2 A;  4PJM A;  4D8K A;  1IRX A;  2GTJ A;  4RTV A;  3E9F A;  1D3B B;  2M9U A;  4JS5 A;  1RUW A;  2A0F B;  3QSU A;  4BI3 A;  2A28 A;  5GAO n;  3OSS C;  4M75 E;  5KYN A;  3I5S A;  4R56 A;  1M9S A;  4C5E A;  3HFN A;  2E3I A;  1M2V A;  3CXC P;  3RR6 A;  1SSF A;  4LD6 A;  2VGN A;  4N0A A;  4M77 B;  3L2R A;  2DER A;  2FO0 A;  3CCV Q;  3JCM P;  1UG1 A;  4NS5 A;  2DL8 A;  4C8Q C;  1Q81 U;  3VS0 A;  1OU9 A;  1PKS A;  4HCB A;  1VOM A;  3QUI A;  3JCM h;  1K73 U;  3EFS A;  2JS2 A;  3OYC A;  1FWZ A;  1KIK A;  4C0D B;  2RHX A;  3PIO A;  3NPF A;  2EGA A;  2L5Q A;  3CCL A;  1RAI B;  4MZP A;  2NWM A;  5FLX E;  1VQ4 A;  4HA8 A;  4XU1 A;  2OTL A;  4EDU A;  4LDW A;  3JCM b;  3DLL A;  1LOJ A;  3RIR A;  2EQJ A;  5GAO l;  3M4G A;  1QWF A;  5FRN A;  4MDX A;  3QDF A;  1P92 A;  3P8D A;  2RD1 A;  1PM3 A;  5CKB A;  2O9V A;  4KUI A;  4KH0 B;  1E7O A;  3SFM A;  4OP0 A;  3HTR A;  1QVF A;  1NLO C;  2I2L A;  1VQ7 A;  2YXY A;  2LCS A;  3EH1 A;  3HSB A;  2A08 A;  1TOV A;  1M8M A;  3TVT A;  2CP2 A;  2CP3 A;  8AT1 B;  2CDT A;  2L3R A;  3JB9 G;  1VQM T;  4BB7 A;  3G1J A;  1T3L A;  5GAN 6;  1YJ9 T;  4CI0 C;  5LL6 S;  3Q1J A;  5CCA A;  4X9C A;  1AWW A;  4J9D A;  2AIR B;  3ER0 A;  2QG9 B;  1WHM A;  2CH4 W;  4DBR A;  2KDS A;  4NL2 A;  1W1F A;  5IXB A;  1ZBX A;  4F7U F;  1YCS B;  1PNJ A;  1QW1 A;  4DA4 A;  4C0D C;  4QQ6 A;  1R77 A;  1ABQ A;  2FRW A;  1OU8 A;  3G71 Q;  2IVW A;  4PLL A;  2OTJ T;  5LJ3 e;  2L3S A;  2YRD A;  1M2O A;  5GAN 3;  1BK2 A;  3X26 B;  3EG9 A;  1U06 A;  1M90 U;  1UB4 A;  2MPX C;  2MI6 A;  4FW1 A;  2C0O A;  2QTV A;  5J26 A;  1WJS A;  1D1C A;  1PC0 A;  5LJ3 g;  2VWF A;  4AG1 C;  3M4Y A;  4XTY A;  1VQP A;  1B7T A;  1LCK A;  2F1L A;  1C6V X;  2RQT A;  2VGM A;  3PT9 A;  1VQ8 A;  2H8H A;  2EVR A;  4PJN A;  1M2V B;  2EYX A;  1Q7Y C;  1RAE B;  3LGF A;  2GTO A;  1O75 A;  4KGZ B;  4M78 C;  2VC8 A;  1D1A A;  5D7U A;  2IPO B;  1ZLM A;  3UA6 A;  4M7D G;  1ZBJ A;  3R6N A;  1M4Z A;  3G4S Q;  2RJC A;  4OVA A;  2DEU A;  3I9Q A;  5DLQ E;  5GAO p;  1WHH A;  2PQW A;  2E6Z A;  5IHI A;  1NEG A;  3SB2 A;  3OW2 P;  1YI2 Q;  3M9Q A;  1BU1 A;  5KCH A;  1MHN A;  3A5Z B;  2CT4 A;  5GAO m;  1G3W A;  1AZE A;  1Q86 U;  1VQ9 Q;  1Q95 G;  2KYB A;  4A4H A;  1I0C A;  5L23 A;  1W2B A;  2M1H A;  2HMA A;  5GAN 4;  3RDV A;  2L89 A;  1SRL A;  1BI0 A;  2QEX A;  3ME9 A;  1G5V A;  4AFU C;  2V26 A;  2BZ8 A;  1AOJ A;  1PRL C;  3GP8 A;  2XD0 A;  4PKC C;  4J5Y A;  1UHC A;  2NUZ A;  3CQT A;  4LDX A;  1TS9 A;  2O2O A;  4FM4 B;  3C12 A;  1YHQ Q;  4JRQ A;  2BZY A;  1VQL T;  3SWN A;  3CCR T;  3JCM J;  2AT1 B;  1OEB A;  3REA B;  2Y4X A;  1N8R U;  1D0X A;  4IKF A;  2F2V A;  2KVQ G;  1JU5 C;  5FWC A;  4Y92 A;  1WQ7 A;  5GAN 7;  3H0H A;  3WXM B;  2RQR A;  3VRY A;  4FYV B;  2KI7 A;  3JCM X;  2HSP A;  5CQY A;  1IGU A;  5GAO q;  2J05 A;  4L6V 5; 
#chains in the Genus database with same CATH homology
 2GQI A;  2YDL A;  4OMQ A;  2J06 A;  4JPB W;  4RTU A;  4CC7 A;  2MCN A;  3VS1 A;  1QCF A;  1TUD A;  1NM7 A;  1WLP B;  2DYB A;  1QKW A;  4J9B A;  2KRO A;  1WIE A;  1WA7 A;  2ABL A;  1Z9Q A;  3UF4 A;  2DVJ A;  1X2Q A;  2MIO A;  1PHT A;  2J6O A;  2IIM A;  2CRE A;  4AG2 C;  1SRM A;  1VYT A;  2C0T A;  5I22 A;  1GCQ C;  1HD3 A;  4F17 A;  1W6X A;  1JXM A;  4Z89 A;  2L3Q A;  4HVU A;  1SHG A;  2DBK A;  2GGR A;  3REB B;  1JEG A;  2L3P A;  2KT1 A;  4AFS C;  4R0K A;  3EHQ A;  1M3A A;  1MUZ A;  2DIL A;  4OMM A;  1PWT A;  2OI3 A;  3SHW A;  3VS3 A;  2RPN A;  4GBQ A;  2CSQ A;  2EYW A;  2OAW A;  5I11 A;  1X6G A;  2AKL A;  2O31 A;  2KYM A;  4HXJ A;  3VS6 A;  3KFV A;  1WI7 A;  2M0Y A;  1K1Z A;  3O5Z A;  1JXO A;  2DL3 A;  1UUE A;  4JJD A;  2K79 A;  1KSW A;  1WXU A;  2JS0 A;  3EG3 A;  4OMO A;  2KXD A;  1E6G A;  1SEM A;  1W70 A;  1PKT A;  1VA7 A;  1Y0M A;  1K0S A;  2KGT A;  1ZUY A;  1I07 A;  1M3B A;  1ABO A;  1JQQ A;  2GNC A;  4OMN A;  2DX1 A;  1B3Q A;  3M0T A;  1KJW A;  1H3H A;  4HVV A;  3EHR A;  2RF0 A;  1HJD A;  2K9G A;  2D8H A;  2EQI A;  3THK A;  4J9G A;  1RLQ C;  1FMK A;  2DRK A;  4JJC A;  2KE9 A;  1X2K A;  2HCK A;  1GCP A;  4CC3 A;  4OML A;  4D8D A;  1K0X A;  4LUE A;  1RLP C;  1CKA A;  5HCK A;  2KRN A;  2KRS A;  4RTZ A;  4J9E A;  2KT8 A;  3LH5 A;  5FWB A;  1HSQ A;  4RTY A;  2A36 A;  1KFZ A;  4FSS A;  2W0Z A;  3NMZ C;  3C0C A;  1NEB A;  2JM8 A;  3I35 A;  2EYY A;  3RBB B;  2LP5 A;  1AVZ C;  3ULR B;  1V1C A;  2YUP A;  1N5Z A;  1X27 A;  2JW4 A;  1NG2 A;  1OPK A;  2EGC A;  5FW9 A;  2FPF A;  2LQW A;  1GFD A;  4LNP A;  1E6H A;  3ZL7 C;  2FRY A;  3PVL A;  4OMP A;  2RQW A;  2EBP A;  4EIK A;  4J9I A;  1M3C A;  3I5R A;  2O88 A;  1WFW A;  2PNI A;  2YT6 A;  2FEI A;  2K7A A;  2EYZ A;  3NHN A;  4WCI A;  2B86 A;  4AFZ C;  2D1X A;  1UDL A;  1ARK A;  4M4Z A;  1SSH A;  2BZX A;  1NYG A;  3EG2 A;  1YN8 A;  2ED0 A;  4AFQ C;  4JZ3 A;  1X69 A;  1MV0 B;  2K3B A;  4LN2 A;  4D8K A;  1K76 A;  3M0P A;  3UAT A;  2GTJ A;  4RTV A;  2V1R A;  2LMJ A;  1JO8 A;  1UTI A;  1OPL A;  2RQV A;  1RUW A;  4CC2 A;  2P4R A;  1UEC A;  2RN8 A;  2A28 A;  1Y57 A;  2J6F A;  4Z88 A;  2HDA A;  1U3O A;  2KNB B;  4RTW A;  3VS2 A;  1GFC A;  3I5S A;  2LNH B;  2DL7 A;  1UFF A;  4LE9 A;  1AWX A;  1CSK A;  1A0N B;  4RTX A;  1U5S A;  4F14 A;  2FO0 A;  2V1Q A;  3NGP A;  2KR3 A;  1UG1 A;  2K6D A;  3GBQ A;  2DL8 A;  1AWO A;  3VS0 A;  3EG0 A;  1PKS A;  1WX6 A;  2JTE A;  3VS4 A;  1X6B A;  1K9A A;  1ZX6 A;  2W10 A;  2JS2 A;  2RMO A;  1KIK A;  2L0A A;  1IO6 A;  2DJQ A;  3NPF A;  2EGA A;  1TG0 A;  2NWM A;  1VYV A;  1X43 A;  4Z8A A;  2C0I A;  4J9F A;  1AWJ A;  1UE9 A;  3TSW A;  2BTT A;  2JXB A;  1QWF A;  2RQU A;  2CH4 A;  2EW3 A;  2AZS A;  1S1N A;  1YWO A;  3PVQ A;  2CUB A;  2O9V A;  2VVK A;  1E7O A;  2VKN A;  3M0Q A;  1CKB A;  2CUD A;  2YUO A;  4KRT A;  2EPD A;  4HVW A;  2EGE A;  1NLO C;  1GCQ A;  1YWP A;  2LCS A;  3U23 A;  2A08 A;  3TVT A;  1M8M A;  5ECA A;  1B07 A;  1QKX A;  1FYN A;  2CDT A;  1NYF A;  2ECZ A;  1BB9 A;  2J6K A;  1T0H A;  2K2M A;  1T3L A;  2LJ1 A;  1UHF A;  2OJ2 A;  2O9S A;  1AWW A;  2E5K A;  4RUG A;  3VS5 A;  2JMA A;  2DBM A;  1SHF A;  2DL4 A;  4J9D A;  1WXB A;  1UJ0 A;  2CH4 W;  1W1F A;  4LUD A;  5IXB A;  3SEM A;  2D0N A;  1YCS B;  1PNJ A;  2EKH A;  2MOX A;  1Z9Z A;  3JV3 A;  2PZ1 A;  3PE0 A;  1AEY A;  1ABQ A;  2FRW A;  5IXF A;  2A37 A;  5GJW B;  3VRZ A;  5EC7 A;  2LJ0 A;  2X3W D;  3M0U A;  2L3S A;  4RTT A;  2LQN A;  2JMC A;  2AK5 A;  2ESW A;  1QLY A;  1UGV A;  1BK2 A;  4ORZ A;  2XMF A;  1YNZ A;  1U06 A;  3RNJ A;  2LX7 A;  1XOV A;  2LJ3 A;  2C0O A;  4J9C A;  1UJY A;  1I1J A;  2JT4 A;  2VWF A;  4AG1 C;  2DE0 X;  1LCK A;  1H92 A;  1WDX A;  4QT7 A;  2RQT A;  5IHN A;  1AZG B;  2H8H A;  2DLP A;  1G83 A;  3EG1 A;  2DMO A;  2EVR A;  2EYX A;  1G2B A;  2FPD A;  4J9H A;  2GTO A;  1J3T A;  5IH2 A;  4CC4 B;  1ZUU A;  2L2P A;  1ZLM A;  3QWX X;  2PTK A;  2X3X D;  3IQL A;  5GJV B;  3UA6 A;  1ZBJ A;  3R6N A;  1WYX A;  2ENM A;  1T3S A;  1M30 A;  4X1V A;  2HEQ A;  2KXC A;  3I9Q A;  1WXT A;  1NLP C;  2I0N A;  2J7I A;  5IHI A;  3M0S A;  1NEG A;  2KBT A;  2M51 A;  3A98 A;  2ROT A;  1GBQ A;  3QWY A;  2RNA A;  1BU1 A;  2AZV A;  3TSZ A;  1YP5 A;  4ESR A;  4E6R A;  1ZSG A;  2GBQ A;  3H0F A;  2CT4 A;  1QWE A;  1MV3 A;  1AZE A;  2DL5 A;  2FPE A;  2YUQ A;  2KYB A;  4HCK A;  1I0C A;  4A63 B;  5L23 A;  2DM1 A;  1GL5 A;  1H8K A;  4ZNX A;  3H41 A;  4DEX A;  2KRM A;  2FG0 A;  2DNU A;  2QDL A;  1SRL A;  3FJ5 A;  1M27 C;  2G6F X;  2JM9 A;  2YSQ A;  3H0I A;  1K4U S;  1SPK A;  1EFN A;  2YUN A;  2DF6 A;  4AFU C;  2F2W A;  1OOT A;  1AOJ A;  1PRL C;  2BZ8 A;  4K11 A;  1UHC A;  2NUZ A;  3CQT A;  4JJB A;  2SEM A;  3UA7 A;  2ROL A;  2O2O A;  1GRI A;  2CSI A;  1T0J A;  2ED1 A;  1AD5 A;  1TUC A;  2BZY A;  2D8J A;  1GBR A;  2KEA A;  1RI9 A;  3REA B;  1OEB A;  1VYU A;  2F2X A;  2F2V A;  5IHK A;  2DRM A;  1JU5 C;  3EGU A;  5FWC A;  4IIM A;  4Y92 A;  4JZ4 A;  4DEY A;  3H0H A;  3VS7 A;  2LZ6 B;  2RQR A;  3VRY A;  1ZUK A;  2HBW A;  2HSP A;  4GLM A;  2AKK A;  3M0R A;  4IIO A;  1OV3 A;  4F16 A;  2J05 A;  2DA9 A;  2CT3 A;  2SRC A;  1BBZ A;  1PRM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...