2KMTA

Nmr solution structure of vibrio fischeri ccdb
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
105
structure length
105
Chain Sequence
MSQFTLYKNKDKSSAKTYPYFVDVQSDLLDNLNTRLVIPLTPIELLDKKAPSHLCPTIHIDEGDFIMLTQQMTSVPVKILSEPVNELSTFRNEIIAAIDFLITGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Thermodynamic Characterization of Vibrio fischeri CcdB.
pubmed doi rcsb
source organism Vibrio fischeri
molecule tags Toxin
molecule keywords CcdB
total genus 16
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2kmtA00
4MZMA 5CKFA 5DLOA 5CCAA 2MF2A 1UB4A 5CQYA 5CQXA 3HPWA 5HK0A 5CKDA 1M1FA 4ELYC 4ELZC 2VUBA 4MZTA 2KMTA 4OF1A 3JRZA 5CK9A 3VUBA 4ME7A 5CKHA 5HKCA 1VUBA 3JSCA 1X75C 5CO7A 5CKEA 5CR2A 4MDXA 3TCJA 1NE8A 4HKEA 3NFCA 2C06A 5HK3A 5CKBA 4VUBA 3G7ZA 4MZPA
chains in the Genus database with same CATH superfamily
2KRMA 1UB4A 1X6OA 4UC4A 4F17A 2DRKA 2ZAEA 3MHXA 4A4GA 4D6WA 4J9CA 3Q1JA 2DTIA 2YUOA 3QIIA 2ECZA 1TWBA 1BBZA 3OYGA 2DXBA 4FIBA 1KD1C 5EG2A 1VQ5T 2DL8A 1ACMB 1K4US 2CP3A 5EC7A 2DEUA 4N4HA 3OS0A 2OTJQ 1M90C 5HK0A 3PNWC 2CUBA 1XNIA 1OU9A 4MZTA 1S1NA 2J7IA 4XTWA 1VQOA 4J9FA 2YSQA 4CC2A 1VQMT 2O9VA 3CQTA 3JB9J 2DETA 2GBQA 1VQMQ 2QQBA 3E9FA 5KE2A 3CD6A 4M7AE 2CP7A 3META 3JCMh 2YHTA 2QEXQ 3MEUA 2ZPGB 2HNIA 1RACB 2C0OA 1TUGB 2OX7A 1N9SA 2RJCA 5CKHA 1WYXA 4EMHA 1BK2A 2P4RA 1D0ZA 1WLPB 4FL6A 4P5NA 5AYFA 2MF2A 3FDRA 1NJIC 1M90R 2EQJA 5IT9E 2E6ZA 4OVAA 3QYGB 2RQUA 3OS5A 4JJCA 4BUGA 1Q86R 1HSQA 2DTHA 3S3NA 2OTLQ 4RTWA 1ZSGA 4C8QD 2PNIA 4PJJA 1XJWB 2QXFA 2YXYA 1ZBJA 3GNGA 5LJ5d 3MKDA 1QP3A 2VYTA 1I5LA 3I5SA 1LNXA 2DD4A 4IUPA 3EGXA 3QJYA 4C8QC 5A0GA 1M3CA 4M7AB 2YT6A 3GP8A 4M78C 4J6WA 1I4K1 4FYYB 1NEGA 2LNVA 1X69A 4C5EA 3L2UA 1K9MR 2E4HA 2H3EB 2CT4A 1QLYA 2FZCB 1NYFA 2KDSA 5KH6A 1WI7A 1SSHA 1WDXA 3H6ZA 3UA6A 4C92G 5GAOr 2F5KA 3MP8A 1G2BA 2YUPA 3FEOA 3JCMb 1WA7A 2FHDA 3JB9D 2HDAA 3CC2A 1K73U 2M0YA 2EYZA 1T0JA 1ZSZC 2DX1A 4HVUA 1RABB 3LGLA 5GANg 1BI3A 5FWBA 3FJPA 4KH1B 3I55Q 1U8RA 2JW4A 3H0FA 3VS2A 1AWXA 2BIVA 4HXJA 1B07A 3CCST 3CCLT 2O4XA 2NYSA 1GFCA 2GFAA 3GBQA 1YCYA 2FPFA 1S72T 1QWFA 1G3WA 3EGDA 1M1KC 3CCQQ 1SSFA 1KD1U 4AFSC 1GCPA 3OYYA 4OMLA 2A08A 2M0OA 3VJPA 4C5IA 4M7DE 1WIEA 2F2XA 2DXCA 4CI0C 1WHHA 2YRCA 8ATCB 1Q81U 1VQNQ 4CC4B 1I81A 1K0SA 1FXXA 3OYMA 2JMCA 2RJEA 3OS1A 2HCKA 1V29B 3L1AA 1PRLC 2M51A 5CKDA 2P0QA 1VQKT 1CKBA 2RI2A 3CC2Q 1RAIB 5IHNA 4XTZA 4BACA 5IH2A 1KHCA 1U1TA 2RO0A 5LJ5g 3WVEB 1M30A 4PJOC 3OBWA 4A54A 3I55A 4BY6C 4XU1A 2NLUA 4XTYA 3M4GA 3EHRA 1X6GA 2MIOA 1T3SA 5KYYB 1AWJA 2E10A 2RM4A 2VV5A 2XDPA 3R6NA 1ABQA 4JPBW 4LDWA 3OYCA 2LQNA 1MMAA 2PU9B 4N0AA 1YI2A 3EHQA 3C94A 1LVKA 1CSKA 4Y91A 4II1A 2QDLA 1TUCA 4DBFA 2JUFA 1VQ8Q 2RHYA 1BYMA 1UGVA 3M58A 4ANJA 2DMOA 1XTDA 2MMPA 3UPUA 4L59A 2KYBA 5GAMe 1AD5A 2JTEA 2EYQA 3SDZA 4C8QA 1VQLT 3MJXA 1P92A 3OYAA 2QQRA 4VUBA 2D0QB 2B8AA 1H3HA 2FPEA 2FG0A 3M4YA 3UA7A 1VQKQ 3LX7A 1K8AR 1YWPA 6AT1B 2DNUA 5IHKA 4M7AA 2DE0X 3QUIA 1M1GA 2PQWA 4F04B 2EIFA 3CCET 2CYZB 3CXCS 1X75C 2CS7A 4FCYA 3EFOB 1D0XA 4C0DC 3CCMT 4IIOA 3OYHA 2K5LA 2C06A 2DPPB 4J9EA 3EAEA 1E6HA 4M78G 1VQOT 1VIEA 3O5ZA 4HCKA 3NGPA 3OYLA 5CK9A 2HQHA 3OYEA 1Q81R 1TXQA 1AEYA 4M77G 2KT1A 1JJ2A 5LJ3h 3NFCA 4C0GA 3H0HA 1B34B 2BZYA 1E7OA 2EWNA 2V8KA 3VS5A 4BI3A 2V8IA 1IHWA 5IHIA 2JS0A 5LJ3j 2JZ2A 2DL4A 3URGA 2YUQA 2EPDA 4D8KA 2J6OA 1W2BS 3JV3A 3OYBA 1U1SA 1K73R 3OA6A 4ZN1A 3BE3A 1W2BA 3M5AA 2K5IA 5D7UA 4C8QB 2DXTA 2KGTA 2QAZA 2ZPHB 1OX9A 1B7TA 2QTXA 3EG3A 5GAMj 2VGMA 4TVRA 1OV3A 4EMKB 2DERA 3RR6A 3EGUA 3M59A 1A0NB 2MOXA 1BB9A 4AG2C 4HKEA 2A36A 4KGVB 4DA4A 4LUDA 5FW9A 1HYOA 4M7DF 3M0QA 4R55A 2ATCB 5DLOA 2YRVA 1AOJA 2XU8A 3O8VA 4LXCA 5GANj 4MMKA 3F70A 1X27A 2CKKA 2E41A 5GAMf 4C5HA 2FPDA 4A4FA 1YIJT 2DD5A 4M75C 2KQWA 4XU2A 3CMEA 2DL5A 2DVJA 4M7DG 2QQ9A 4Z02A 4WTOB 4O5VA 3JB9I 3P8HA 5CKFA 1FX7A 1GXIE 1NM7A 3S6WA 3OYJA 1KC8R 1BIBA 3FJ5A 2KNBB 4F14A 2NUZA 1YJWA 1VIFA 5KYXB 1WJSA 1YJNQ 2K9GA 1MGQA 3G71T 2GTOA 5CVIA 1K1ZA 2IG0A 2BE9B 3QPHA 2RMOA 2QGGA 1GCQC 1YWOA 3OB9A 5GAN7 3EH2A 1Q82C 1YHQA 4OP0A 2RK2A 3CC2T 2XDDA 3TQ7P 2I0NA 1VQ4Q 2DEQA 2RQTA 3MEWA 3OYFA 3OYIA 3CMET 2D0NA 1KSWA 3HHTB 2R5AA 2EKOA 2X4XA 4FW2A 3EFOA 2JVVA 3G7ZA 2KXDA 4OMFB 4FYWB 2DL3A 2KY9A 5GAOq 2DXUA 4E7JA 4JZ3A 3NPFA 1YJWQ 1VQ8T 2AKKA 3CMAT 1OZ2A 4R0KA 1PWTA 2HBPA 1D1BA 2NUTA 2L89A 2VGNA 2D8HA 3MO8A 3VS0A 1PD1A 2D9TA 2R58A 2QEXT 2KAFA 4LUEA 3JCMd 4QT7A 2IIMA 4J6YA 1PSFA 2JM8A 3JCMV 5GMKl 2RB6A 5GAN6 1TH7A 4PL6A 3OYDA 3VKIA 1X2KA 1N6AA 5D6YA 1JXMA 4Z89A 1G8XA 4FSXA 1LOJA 4E7ZA 1LCKA 4DEYA 3JCMe 3JB9G 1QKXA 4WF2A 2CP0A 1VYVA 2LQWA 3G4ST 1RLPC 5J26A 2NWMA 3G4SQ 1YI2Q 4BE2A 4M78F 4F16A 2CP6A 3E1SA 4A4EA 2JOYA 2HSPA 3WVDB 4QQ6A 1VYUA 5GAMg 1PCXA 1O9SA 2EJGA 1XQHA 3PMIA 4FT4A 4HA8A 2X9HA 5FWCA 3RIRA 1RL2A 2QGFB 2KXCA 3C0CA 1K8AU 2A7YA 2NUTB 3I5RA 3J7AF 4RCBA 2EQMA 1PKTA 5KYUB 2BUDA 1AVZC 1G3SA 4M4ZA 4AFQC 1MNEA 4HCBA 3QHSA 2JN0A 1QVGS 3M55A 1UE9A 2SEMA 1WXTA 1W2BP 3DLLA 3HTRA 5KCOA 3RUXA 3VRYA 3OY9A 4LDYA 2RQWA 4C92F 2DL7A 3CCJQ 5GAN5 2COWA 4YTLA 5CIUA 3SB2A 2AT1B 1SF9A 3QSUA 3L2WA 1Q81C 3J81E 1E6GA 1NYGA 1VQ4A 5FROA 2EGAA 4E47A 2LQ8A 4AFZC 1YBYA 2GTJA 2EGCA 5GANd 1IRXA 1Y96B 2EFIA 2P0PA 4LDVA 1UG1A 3LGFA 1M2OA 4QVZA 2QG9B 4MDWA 3JCMg 3BDUA 4M77B 5DLQE 1Y71A 4RG2A 2HSEB 4PNOA 2JJ9A 2QYZA 4OB0B 1Y0MA 2L8DA 1EZZB 4FW1A 1QCFA 5I11A 4J6XA 2LNHB 1FMVA 1TSFA 1ZBXA 5GMKj 1QMCA 1M9SA 3BFMA 3HRUA 4XTUA 5GAN3 2ROLA 1YP5A 3EGXB 2O9SA 1AWWA 1YJ9Q 3RKYA 2GQIA 1NEBA 3A8HB 5GAOm 3S3OA 5LJ5j 1KFZA 3KXTA 2DJZA 3LH5A 3OSVA 1VQPA 2MCNA 3REBB 1N8RR 2LCSA 1VQ6Q 1VYTA 3UT1A 4PJOA 4PLLA 3LWIA 2D1XA 1QVFA 4HVWA 2EYYA 2KYMA 3I56T 4OMMA 2F69A 3QWXX 5FRNA 2EW3A 1PD0A 3EG9A 1SKUB 2CZ1B 3OYKA 2JTFA 5FRMA 2EJ9A 1NJIU 1ZHIA 2ENMA 1BKBA 4J9IA 3GLXA 3ER0A 4M77D 4M75E 1YIJA 2GF7A 3JRZA 5GAN8 3JCMc 2K2VA 3DLMA 1VQ7A 2ZPBB 3L2RA 2DLPA 5AT1B 1Q7YC 3CCEA 3HL8A 2LJ1A 4ATOA 4NS5A 4JS4A 2YUNA 4C0FA 2RI3A 4LDXA 1GRIA 5C0MA 3CCMQ 2GGRA 1AWOA 2XICA 4JJBA 4J9HA 4E7SA 4C92C 5KYNA 1G83A 3JB9F 1OPKA 3REAB 1KIKA 3R6OA 1OX8A 3RKWA 1TTHB 4MMLA 1D3BB 2FZKB 2JTMA 3CCQA 3CCEQ 1OEBA 4CC3A 3P8DA 3LYIA 4CC7A 2P4TA 2FVUA 2DZCA 3RKXA 4JDSA 1WHGA 1Q86U 1M1KR 2PVOB 1KG1A 3QBYA 2KK4A 4M78B 2D8JA 4L5GA 2BE7D 4N0AC 5GAMd 3LLRA 2LTOA 3G6EQ 4FT2A 4XAXB 2GNCA 4RG8A 3GOXA 3I56Q 2PTKA 5GAN2 1R0CB 4ORZA 4D8DA 1D3BA 2PUKB 3PVQA 5FU6C 3JCMf 2HZYA 3T9NA 3KFVA 1VQNT 2DRMA 4GLMA 3CC4Q 2EQIA 1VOMA 3CBPA 3VV0A 2PVDB 3QDFA 2PUOB 3FC3A 1FMWA 1M1KU 4LE9A 3HPWA 3QYHB 2O2OA 4E6RA 1JO8A 2DZ9A 1QKWA 2MI6A 2W10A 1K9AA 2NUPA 1ZSZB 2KE9A 4C92E 2FRWA 5IXBA 4X9CA 4M7DD 4ME7A 3RNJA 1VQ6A 1K9MC 3KBGA 4R56A 3JB9H 4FU6A 5GAOn 4OB3B 1B3QA 3ZFJA 2G6FX 2K5FA 3QO3A 5HCKA 3CCUQ 1YITA 4HCCA 4MZMA 2LX9A 2K4YA 4AFUC 2MWOA 2C0TA 2DA9A 1TG0A 1V76A 2RQVA 1UGRB 4JRIA 3JAME 4M78E 2X3WD 1LJOA 3CCRT 2QA4T 3DKMA 1JB0E 3EG1A 1GCQA 3UWNA 2PVGB 5KE3A 1U5SA 1AZEA 4ZGJB 1M2VB 2QQSA 3I55T 2ED1A 1VQ6T 3L2VA 4M7AG 5CCAA 1NJIR 1RAAB 1G3YA 2Z0WA 2A28A 4HT8A 4PJOD 1S72Q 2LZ6B 2K3XA 2E3IA 3EFSA 1KHIA 4DBHA 1AZGB 2X4YA 2SRCA 4M78A 3A98A 3CD6Q 3FRNA 4BD3A 4BDZA 3CCLQ 1Q95G 1TUDA 3CD6T 1UTIA 2E3HA 1YHQT 4M77A 3P8BB 2DIQA 4BDYA 4ZN3A 2J06A 1W1FA 2LT1A 1H8KA 1JJ2P 3QKJA 3G71Q 4Z88A 2EBPA 3OW2A 3VUZA 1VQMA 3ME9A 3RMQA 2BKDN 1N27A 2LMJA 4AT1B 1SPKA 1U3OA 2ZZDA 1OZ3A 4J7IA 2R5MA 4JJDA 5A0LA 1ZLMA 3LW5E 4X1VA 2CDTA 3CCRQ 1YJWT 2EGEA 2F5TX 4XTXA 2OTJA 3X24B 3RBBB 1YN8A 1R0BG 3VS3A 1RAFB 1ZA2B 2AIRB 3PGGA 4DBRA 2HMAA 1SRLA 4M77F 4XQ3A 2O4XB 5ECAA 2JMAA 2W0ZA 1JQQA 4C0DB 2JT4A 2LVMA 1Z9ZA 4J8OA 3JCMP 4KUIA 4RMOA 2HL3A 2CH4A 1W70A 2WSFE 4J9DA 1YJNT 5J39A 1JRIA 2OTJT 5KYWA 4XK8E 5A2QE 1O75A 1Z9QA 2EJFA 2E5QA 1M2VA 3X28B 4J9BA 2LRQA 1KQ2A 3OYNA 1QWEA 4PK4A 4B6MA 3TCJA 3V7CA 1JBMA 4Y92A 1QVGP 1XOVA 2CZ7B 5GMKi 2RI5A 3L2ZA 2J05A 4OB2B 3PMTA 4AMCA 4LNPA 4KH0B 3H9NA 2V8JA 1M3BA 2FZGB 2MYSA 1W4SA 4KBMB 3I56A 3MPUB 3DB3A 3EGDB 3BW1A 3SWNC 1WNLA 3L2QA 4OGEA 1NG2A 3HSBA 4B9XA 3A8LB 3VS4A 3A8MB 4E7HA 3OSSC 4M7DC 2F2WA 2LDMA 1Q82R 2QEXA 3TSZA 2YDLA 3NTIA 1ZUKA 1JEGA 1JJ2S 1SHFA 1N9RA 1IGUA 4PFOA 2YRDA 4M77C 1D0YA 2RH2A 2XI9A 1KC8C 1UHCA 1QVPA 3DB4A 4PJNA 4E7LA 2LC4A 2X4WA 2MAMA 3INZA 5GAOl 2E64A 3CPWA 1PRMC 1BCOA 3EH1A 1D1CA 4J5YA 4M75B 8AT1B 1NLPC 2XHCA 1OQKA 2GFUA 1RI0A 3CMEQ 4FYVB 2J6KA 4ZGEB 3FB9A 4MZPA 5FU7C 1YITT 3CBOA 3PIOA 1K0XA 4C0ZA 4F7UG 2F2VA 1MV0B 1X6BA 1N8RU 2K3BA 2EYWA 2RPNA 3X20B 1AHJB 2VASA 2AZVA 2RD1A 1Q7YU 2VKNA 1WHKA 4QQDA 2QA4A 2A3LA 1HXDA 2HKNA 4L6V5 3ZEHA 1M1FA 1VQ8A 1YJ9A 4JRQA 1QW1A 3CC4A 1IGQA 4KGXB 2E6NA 2RHUA 5GMKh 1VQ5Q 4IUQA 4RTUA 2V26A 2HBWA 4LD6A 4JZ4A 5LJ5f 4BE1A 3TSWA 1H92A 1QVFS 5CQXA 2E70A 5CQYA 4A4HA 2BZXA 1U06A 3MEAA 2JNGA 1CKAA 3RERA 3CCRA 1UGQB 2MK5A 2L3SA 2DF6A 1V1CA 1FWZA 3JSCA 3L42A 3M0SA 3S3MA 5KCHA 2A37A 2ESWA 5KYXA 1RI9A 1FMKA 2K57A 1QQJA 4M75A 2DJQA 3SWNA 1PG5B 1RAGB 3JCMX 1MNDA 2KMTA 3C12A 3CCMA 2BZ8A 2P0KA 2OAWA 1M4ZA 4EPCA 4GBQA 4QQGA 4IURA 5GAMh 2RHIA 2YWWA 1YJ9T 2HL5C 1BI1A 1Y57A 3QWYA 3TU4K 4F7UF 3G6ET 3VS1A 3MEVA 1WHLA 2QASA 4M77E 1VQ9Q 4J9GA 1C0MA 5C6SA 4FM4B 1VQ9T 4RTZA 3I35A 2Y4XA 1UFFA 2KEAA 4BI4A 1H641 2L5QA 1FYNA 1HD3A 3HFOA 2RHXA 2HQEA 4LDUA 1VQPQ 3CEYA 1QCOA 1VQ4T 1R77A 5I2SA 1YI2T 1BI2A 3AT1B 2RN8A 3SD4A 3ZL7C 3CCQT 1M5Q1 5CAIA 1MMDA 1GBRA 4M7AD 2IPOB 1I5OB 1D09B 1QVGA 2OTLA 2R57A 1ZUYA 2FB7A 2RHZA 1EIFA 4PJOG 5CKBA 3V7RA 1NPRA 3VYGA 2RK1A 1N8RC 2KRNA 2CZ0B 2F1LA 2ABLA 4BB7A 3M54A 1IO6A 2C0IA 1NZ9A 2OAUA 1VQ9A 1OULA 4OMPA 3M0TA 3PIPA 2IVWA 2HKQB 1WX6A 2RJFA 1T0HA 1IREB 2CP5A 2DM1A 2XD0A 2ZPIB 2XMFA 3NTHA 3PE0A 5IN1A 2GCXA 1HJDA 3TVTA 3HKSA 3G6EA 4C8QE 1UEBA 5GMKm 3CCVA 1OYXA 3OW2S 2RF0A 3NTKA 2ROTA 2G3RA 2E65A 1H3ZA 2WSEE 4Y28E 2CP2A 1WQWA 2DYIA 1WZOA 1I8FA 4N4IA 2CGHA 2KRSA 1UJYA 1KQSA 2VXFA 3CCVQ 2CSQA 2RNAA 1B34A 1KQSP 2K79A 3EG2A 5DM7R 2KT8A 1N5ZA 3HP9A 4C92B 5A0DA 2VC8A 2VWFA 3MCAB 2HEQA 2O88A 1YHQQ 1ZA1B 3VYHB 1I0CA 1Y07A 2EYXA 4NOYA 2BTTA 3VUBA 4HT9A 1M8VA 1TU0B 2OI3A 3V8JA 4F7UE 1SHGA 3RMSA 3CC7Q 4RUGA 4KT0E 3CC7T 1VQ7Q 3A5ZB 4ZTJA 3LH0A 4LD9K 3I9QA 4M75D 1YCSB 3M56A 2V1RA 2VUBA 1BU1A 1RAEB 3ASKA 4DBQA 3CXCA 1JU5C 2HD0A 5L23A 2M16A 5HKCA 1SEMA 2RQRA 5CR2A 2CZ6B 4HCZA 3TREA 1RAHB 1I07A 2ZCFB 4IUTA 3G4SA 4IUUA 1WJRA 2L3PA 1PM3A 4M75F 1GBQA 3RESA 5GJVB 1PHTA 4PJLA 1WPYA 4B9WA 2QA4Q 2CSIA 2H8HA 5D6XA 4EDUA 5FLXE 1VUBA 3GNFB 1KD1R 3VS7A 1UUEA 2FYKA 4EMKA 4PFZA 5FU7B 1J3TA 5IAYA 3CPWP 3PTAA 1WHMA 2E1HA 1SRMA 5DY9A 4DOWA 2ZPFB 4C92A 2FRYA 3FIFA 1EX4A 2K7AA 2M1HA 2L3RA 2X4JA 2HQXA 1M8MA 3PVLA 1RADB 5GANh 1K76A 1QP2A 2HAXA 2CT3A 3H0IA 3CC7A 1TS9A 5LJ3f 1KQ1A 3UATA 4EIKA 5J3BA 1PNJA 1KJWA 4OMQA 4V2SA 1UDLA 2ZPEB 1K9MU 3SWNB 3QJ6A 2ED0A 2DK3A 4RTTA 1IXDA 4KRTA 3AHUA 3G71A 4M7DB 4M7AF 1HK9A 2WSCE 3CMAA 3OS2A 1OU8A 3OW2P 3CCSQ 2MPXC 1UHFA 4PJOF 1NBEB 3PFSA 1YFNA 2EQKA 1ABOA 4J83A 4QW2A 2AKLA 1OPLA 4JRKA 2KSSA 2RA2A 4RTYA 3CCJA 1KQSS 3KUFA 3C4SA 1M27C 1YIJQ 4JS5A 5LL6S 2O01E 4RTVA 1I1JA 2QQAA 3A8GB 5FU6B 5KYUA 2QK0A 3GIBA 1WXUA 1VQLQ 2DO3A 1RUWA 3A8OB 1KC8U 3CPWS 2YLCA 4BE0A 2AHJB 2LJ3A 2DYBA 2X35A 2EVRA 1NLOC 1MMGA 1UECA 2LP5A 5GANf 3M0RA 2DIGA 3EG0A 4RKUE 1GFDA 5CO7A 3N5BB 5I21A 1M3AA 4EMGA 2XDBA 2COYA 3FLGA 3CCUT 2XG8D 2QI2A 4QVCA 4X9DA 4GY5A 3V8LA 4OB1B 5GAN4 2VB6A 4BY6B 3SHWA 4ESRA 2LT4A 5LJ3d 3JCMJ 1UGPB 4WCIA 5HY6A 3UDCA 4X34A 3V8KA 5IXFA 2JS2A 4C8QG 3LWHA 1ZSZA 3H41A 4FSSA 3TEEA 2LJ0A 1KK7A 1VA7A 2Y90A 2I2LA 4C8QF 1UGSB 1X01A 2NUPB 3SFMA 5LJ5e 4OGCA 3E9GA 4GLKA 4IUVA 3CC4T 5D6WA 3CCVT 2XKOC 3M0UA 1BIAA 3VS6A 4KULA 1K8AC 1VQNA 1TOVA 1T3LA 4QVDA 2LQKA 2LCLA 2M9UA 5LJ3g 4C5GA 1DJ7B 3QG1A 2H3JA 2FEIA 3OQ5A 2EKHA 4C92D 3OMGA 1K73C 3QXEB 2DILA 4MDXA 5L8RE 5M9OA 3J80E 4RCCA 3QZ9B 1Q7YR 1IHVA 4QKUA 5KYYA 1PKSA 4E7IA 1WJQA 4M7AC 3NMZC 4PLIA 3GF5A 4XU0A 2L3QA 1OI1A 3X25B 1BI0A 1VQOQ 4E2FB 3HRSA 2FL7A 4PJMA 1IZ6A 4O6JA 5GMKe 3MP1A 3EG9B 9ATCB 4XTVA 2L2PA 4JJNK 1R8OB 3VRZA 3E19A 4NL2A 3OMCA 2XIDA 3OBYA 3V7SA 4PJOB 1W6XA 3EFRA 4KUDK 2V1QA 4Q5WA 1BCMA 3M9QA 2KVQG 2KR3A 1YJNA 4DOVA 4ELYC 2CUDA 4A63B 4EMKC 2MWPA 2FO0A 2AK5A 2VVKA 5CKEA 3M57A 4RTXA 2JM9A 4K11A 4NL3A 4E7KA 1WXBA 2RJDA 4ZTFA 1D1AA 2J6FA 3THKA 4F7UA 1G3TA 2EQUA 3VU3C 2L0AA 1WHJA 2KI7A 2YLBA 2XK0A 2JXBA 4Z8AA 4OF1A 2DAQA 1WQ7A 1Q82U 3IQLA 3X26B 4ZGDB 1X43A 4F7UB 4IIMA 5GANe 2DBMA 1MUZA 1UJ0A 1X2QA 2ZGWA 5LJ3e 2O31A 1VQPT 3QDRB 4DEXA 1RLQC 2DFUA 3CPFA 1AT1B 2DVEA 3QZ5B 3GPLA 1MV3A 4M7DA 5LJ5h 3ZBDA 1M90U 4AG1C 1IB8A 3U23A 3JCMW 2K2MA 1LPLA 3C95A 2DKGA 4JLGA 5I22A 2K6DA 3A1PA 1ZUUA 1VQLA 1ARKA 4XU3A 2CREA 2LCCA 4ZNXA 4OMOA 3ULRB 3BDLA 1Y96A 2QDYB 3CMAQ 2WACA 4IKFA 3CCJT 4A53A 2K3YA 3CCSA 2LX7A 4M75G 2P84A 1S72A 1SG5A 4HVVA 2OJ2A 1MMNA 3CCLA 1NPPA 2E12A 2B86A 3WXMB 2VXEA 1C6VX 3M0PA 4J7FA 2EAYA 1VQ5A 2M02A 3MP6A 2DBKA 5GJWB 2E5KA 1WGSA 4JRPA 3HRTA 4M78D 1EFNA 5KYWB 2X51A 1Q86C 3BY7A 4BI8B 1WFWA 1NE8A 2X3XD 2D6FA 2KBTA 2Y4YA 3UF4A 2OTLT 4JLIA 3M53A 3HFNA 1ZQ1A 4LN2A 4CRIA 1MHNA 1VQ7T 3G1JA 1ZX6A 3E2UA 3SEMA 4A4KA 4DQ2A 4OMNA 4N4GA 3CBMA 1OOTA 2COZA 5I2MA 2PZ1A 2CH4W 1G5VA 1Y7XA 4PJOE 3PT9A 1VQKA 1C1AA 1F1BB 2QTVA 3D7SB 1QCNA 2GQVA 3CCUA 1YITQ 2AZSA 1PSEA 4FYXB 1GL5A 4ELZC 3NHNA 3JCMQ 4PFPA 4KGZB 4JUVA 1YNZA 3H8ZA 7AT1B 4PKCC 1QVFP 3CXCP 3RDVA 2DTOA 2A0FB 5GAOp 1JXOA 5HK3A 1PC0A 2KROA
chains in the Genus database with same CATH topology
3OB9A 5GAN7 3G4SA 4IUUA 1WJRA 4J7IA 1UB4A 1OZ3A 1X6OA 2ZZDA 2R5MA 4M75F 4UC4A 3RESA 1Q82C 3MHXA 4A4GA 1YHQA 5A0LA 4OP0A 2RK2A 3LW5E 4D6WA 3Q1JA 3CC2T 2DTIA 3QIIA 1WPYA 4B9WA 2XDDA 2DEQA 1YJWT 5D6XA 4EDUA 2F5TX 5FLXE 3MEWA 4XTXA 2OTJA 3X24B 3OYFA 1VUBA 3GNFB 3OYGA 2DXBA 2FYKA 4FIBA 5EG2A 1KD1C 1VQ5T 4EMKA 3OYIA 3CMET 5FU7B 3HHTB 5IAYA 2R5AA 2EKOA 2X4XA 4N4HA 3OS0A 2JVVA 3G7ZA 4OMFB 3PGGA 3PTAA 2KY9A 5GAOq 1M90C 2E1HA 5HK0A 3PNWC 1XNIA 2DXUA 4E7JA 4M77F 4MZTA 4XQ3A 2O4XB 1VQOA 4XTWA 5DY9A 4DOWA 2ZPFB 1VQ8T 4C92A 3CMAT 1OZ2A 4C0DB 2LVMA 2HBPA 3FIFA 4J8OA 3JCMP 1VQMT 2M1HA 4KUIA 2L3RA 4RMOA 2L89A 2X4JA 2HQXA 3JB9J 2VGNA 5GANh 2WSFE 3MO8A 1YJNT 2D9TA 2QQBA 2R58A 5J39A 1QP2A 3E9FA 2HAXA 1JRIA 2QEXT 2KAFA 5KE2A 2OTJT 3CC7A 3CD6A 4M7AE 3JCMd 3META 4XK8E 5A2QE 3JCMh 4J6YA 1O75A 2YHTA 5LJ3f 1KQ1A 1PSFA 2EJFA 3JCMV 2E5QA 5J3BA 5GMKl 2RB6A 3MEUA 5GAN6 2ZPGB 2HNIA 1TH7A 4PL6A 3X28B 2ZPEB 3VKIA 3OYDA 1K9MU 4V2SA 1N6AA 3SWNB 1N9SA 2LRQA 2RJCA 5D6YA 3QJ6A 5CKHA 2DK3A 1KQ2A 4FSXA 3OYNA 1LOJA 3AHUA 3TCJA 3V7CA 4EMHA 1JBMA 3G71A 4M7DB 3JCMe 3JB9G 4M7AF 1HK9A 1XOVA 2WSCE 4WF2A 2CZ7B 5GMKi 3CMAA 2RI5A 3L2ZA 4FL6A 4P5NA 5AYFA 3OS2A 3G4ST 5J26A 2MF2A 3FDRA 4OB2B 1NJIC 2EQJA 5IT9E 3PMTA 4PJOF 3PFSA 4BE2A 2EQKA 4J83A 4M78F 2E6ZA 4OVAA 4QW2A 3QYGB 3E1SA 3OS5A 2KSSA 2JOYA 2RA2A 4JRKA 2V8JA 4A4EA 3CCJA 3KUFA 4KBMB 1KQSS 1W4SA 3I56A 4BUGA 3C4SA 3DB3A 3BW1A 3SWNC 3WVDB 4QQ6A 2DTHA 3S3NA 1WNLA 5GAMg 3L2QA 4OGEA 4C8QD 1O9SA 3HSBA 4B9XA 3A8LB 2EJGA 2QXFA 3A8MB 1XQHA 3PMIA 2O01E 5LL6S 4JS5A 3OSSC 4FT4A 4E7HA 2QQAA 5FU6B 3A8GB 3GNGA 4HA8A 5LJ5d 4M7DC 3GIBA 2DO3A 1QP3A 2VYTA 3RIRA 3A8OB 1LNXA 2DD4A 4IUPA 2LDMA 3CPWS 1KC8U 1I5LA 1RL2A 2YLCA 3QJYA 2QEXA 4BE0A 4C8QC 5A0GA 4M7AB 1K8AU 2AHJB 2A7YA 3NTIA 3GP8A 4M78C 4J6WA 1I4K1 3J7AF 2X35A 4RCBA 2EQMA 2BUDA 1G3SA 5GANf 1JJ2S 2DIGA 2LNVA 4RKUE 4C5EA 5CO7A 4HCBA 3L2UA 3N5BB 1N9RA 3QHSA 2KDSA 2JN0A 1QVGS 4M77C 3M55A 5KH6A 2RH2A 5I21A 2XI9A 3H6ZA 4EMGA 1KC8C 2XDBA 1QVPA 3DB4A 4C92G 3DLLA 4E7LA 5GAOr 2LC4A 2X4WA 3FLGA 5KCOA 2F5KA 3MP8A 3RUXA 3FEOA 3JCMb 2MAMA 2XG8D 3INZA 5GAOl 2QI2A 4QVCA 3CCUT 2E64A 3CPWA 2FHDA 3JB9D 4X9DA 4LDYA 3OY9A 3CC2A 4C92F 5GAN5 1K73U 4YTLA 4GY5A 4J5YA 3V8LA 4OB1B 4M75B 5CIUA 5GAN4 4BY6B 2XHCA 3SB2A 2LT4A 2GFUA 3LGLA 1RI0A 1BI3A 5GANg 3L2WA 3QSUA 3FJPA 5LJ3d 1Q81C 1U8RA 3J81E 1VQ4A 5FROA 1UGPB 3JCMJ 4ZGEB 3FB9A 2BIVA 4MZPA 4E47A 5FU7C 3CCST 2LQ8A 3CCLT 1YITT 2O4XA 1YBYA 5HY6A 3UDCA 3CBOA 2GFAA 4X34A 3V8KA 1YCYA 3PIOA 4C8QG 5GANd 3LWHA 1Y96B 2EFIA 1S72T 2P0PA 4LDVA 3TEEA 4C0ZA 1G3WA 4F7UG 1M1KC 3LGFA 1N8RU 2Y90A 2I2LA 1SSFA 4QVZA 4MDWA 1UGSB 4C8QF 1X01A 1KD1U 3JCMg 3OYYA 4C5IA 2M0OA 3VJPA 3X20B 1AHJB 4M7DE 3SFMA 2DXCA 4CI0C 4OGCA 5LJ5e 3E9GA 1Q81U 3BDUA 4M77B 2RD1A 4GLKA 4IUVA 5DLQE 1I81A 1Y71A 5D6WA 4RG2A 3CC4T 3CCVT 2XKOC 1Q7YU 4PNOA 1FXXA 3OYMA 2RJEA 4OB0B 1BIAA 4QQDA 3OS1A 2L8DA 2QA4A 2A3LA 1HXDA 4KULA 1V29B 3L1AA 1K8AC 4J6XA 1ZBXA 4L6V5 1VQNA 3ZEHA 5CKDA 1M1FA 2P0QA 4QVDA 5GMKj 1VQ8A 1M9SA 3BFMA 2LQKA 2LCLA 2M9UA 1YJ9A 5LJ3g 1VQKT 4C5GA 1DJ7B 4JRQA 2RI2A 3QG1A 2H3JA 3HRUA 1QW1A 4XTUA 3CC4A 5GAN3 4BACA 4XTZA 3OQ5A 4C92D 3OMGA 1KHCA 1U1TA 1K73C 3QXEB 4MDXA 5L8RE 2RO0A 5LJ5g 5M9OA 2E6NA 3WVEB 2RHUA 3J80E 4RCCA 3OBWA 3QZ9B 4A54A 5GMKh 4IUQA 3I55A 3RKYA 4BY6C 4XU1A 2NLUA 3A8HB 4LD6A 5LJ5j 5GAOm 4XTYA 3S3OA 3M4GA 5LJ5f 4BE1A 3KXTA 4E7IA 1WJQA 4M7AC 4PLIA 2DJZA 3GF5A 3OSVA 4XU0A 1VQPA 1QVFS 1OI1A 5CQXA 2E70A 5CQYA 3X25B 1BI0A 4A4HA 3MEAA 3UT1A 4PJOA 4PLLA 2JNGA 3HRSA 3LWIA 2E10A 2FL7A 2RM4A 2VV5A 1QVFA 3RERA 1IZ6A 3CCRA 4O6JA 1UGQB 5GMKe 3MP1A 2XDPA 1FWZA 4XTVA 3I56T 4LDWA 4JJNK 2F69A 1R8OB 3JSCA 3L42A 5FRNA 3OYCA 3E19A 4NL2A 2CZ1B 3OYKA 2PU9B 3S3MA 2JTFA 4N0AA 3OMCA 2XIDA 3OBYA 1YI2A 3V7SA 5FRMA 4PJOB 5KCHA 3C94A 2EJ9A 1NJIU 3EFRA 4Y91A 2K57A 1ZHIA 4KUDK 1BKBA 4Q5WA 3M9QA 4II1A 2KVQG 3GLXA 3ER0A 4M77D 4M75A 4DOVA 1YJNA 3SWNA 4ELYC 2JUFA 4M75E 2RHYA 1YIJA 4EMKC 2MWPA 3JCMX 1BYMA 2KMTA 2GF7A 3JRZA 3M58A 3C12A 5GAN8 3CCMA 3JCMc 2P0KA 1XTDA 2K2VA 2MMPA 3DLMA 2ZPBB 3L2RA 3UPUA 1VQ7A 1M4ZA 4L59A 1Q7YC 3CCEA 3HL8A 4EPCA 5GAMe 2EYQA 3M57A 5CKEA 4ATOA 4NS5A 4QQGA 4IURA 4JS4A 3SDZA 4NL3A 4E7KA 4C0FA 5GAMh 2RI3A 4C8QA 2RHIA 1VQLT 2RJDA 4LDXA 5C0MA 4ZTFA 1P92A 1YJ9T 4F7UA 2QQRA 2XICA 4VUBA 3OYAA 1G3TA 2D0QB 2B8AA 2EQUA 4C92C 3VU3C 3JB9F 2YLBA 3R6OA 3M4YA 2XK0A 3RKWA 4MMLA 1BI1A 3LX7A 3TU4K 4F7UF 3G6ET 4OF1A 1D3BB 2DAQA 1WQ7A 1Q82U 3MEVA 2JTMA 3X26B 3CCQA 4M7AA 4M77E 4ZGDB 4F7UB 3QUIA 1M1GA 2PQWA 3P8DA 5GANe 2EIFA 4PJOC 5C6SA 2CYZB 3CXCS 1X75C 3LYIA 3CCET 4FM4B 1VQ9T 2P4TA 2CS7A 2FVUA 4C0DC 2DZCA 3RKXA 3CCMT 2ZGWA 3OYHA 2K5LA 2Y4XA 2C06A 2DPPB 4JDSA 1Q86U 4BI4A 2PVOB 5LJ3e 1KG1A 1H641 2L5QA 1VQPT 3EAEA 3QDRB 3QBYA 2KK4A 3CPFA 4M78B 4M78G 1VQOT 1VIEA 2RHXA 3HFOA 2HQEA 4L5GA 4LDUA 4N0AC 5GAMd 2DVEA 2LTOA 3CEYA 3LLRA 3QZ5B 4FT2A 1VQ4T 3GPLA 3OYLA 4XAXB 4M7DA 5LJ5h 3ZBDA 5I2SA 1YI2T 1BI2A 1M90U 4RG8A 3SD4A 5CK9A 3OYEA 3GOXA 1M5Q1 5CAIA 3CCQT 5GAN2 1D3BA 2PUKB 4M77G 4M7AD 2OTLA 1QVGA 2R57A 5FU6C 3JCMf 3JCMW 1JJ2A 5LJ3h 3C95A 3T9NA 2FB7A 1VQNT 3NFCA 2DKGA 4C0GA 1B34B 2RHZA 3CBPA 4JLGA 3VV0A 1EIFA 4PJOG 5CKBA 2PVDB 3V7RA 1NPRA 2PUOB 2EWNA 2V8KA 1VQLA 3FC3A 4BI3A 3VYGA 2RK1A 4XU3A 1M1KU 2LCCA 1N8RC 3HPWA 2CZ0B 2V8IA 3QYHB 5LJ3j 2JZ2A 2DZ9A 3URGA 2MI6A 4BB7A 3M54A 3BDLA 1Y96A 2QDYB 2WACA 4C92E 1NZ9A 4IKFA 2OAUA 3CCJT 1VQ9A 1W2BS 4X9CA 4M7DD 4ME7A 4A53A 2K3YA 1VQ6A 1K9MC 3OYBA 3PIPA 3CCSA 3KBGA 4R56A 2IVWA 3JB9H 1U1SA 2RJFA 4FU6A 5GAOn 3OA6A 4M75G 4ZN1A 1IREB 1S72A 4OB3B 2ZPIB 1W2BA 2XD0A 3M5AA 3ZFJA 2K5FA 2K5IA 3QO3A 3NTHA 1YITA 1NPPA 3CCLA 2E12A 4MZMA 4HCCA 2LX9A 4C8QB 2DXTA 2ZPHB 2K4YA 2MWOA 3WXMB 5IN1A 2VXEA 2QTXA 2GCXA 3HKSA 4J7FA 1UGRB 4JRIA 5GAMj 3JAME 3G6EA 2EAYA 4C8QE 1VQ5A 1UEBA 5GMKm 4M78E 3MP6A 1OYXA 3CCVA 2VGMA 4TVRA 4EMKB 1LJOA 3OW2S 3CCRT 2QA4T 3DKMA 1JB0E 3NTKA 2G3RA 1WGSA 2E65A 4JRPA 1H3ZA 3M59A 3HRTA 2WSEE 4M78D 4Y28E 1WQWA 1Q86C 1I8FA 3BY7A 3UWNA 4BI8B 2PVGB 2CGHA 4N4IA 5KE3A 1NE8A 4HKEA 2VXFA 1KQSA 2D6FA 2Y4YA 4DA4A 4JLIA 3M53A 2OTLT 4ZGJB 3HFNA 2QQSA 3I55T 1ZQ1A 4CRIA 4M7DF 1VQ6T 3L2VA 1B34A 4M7AG 4R55A 1MHNA 5DM7R 5DLOA 5CCAA 2YRVA 1VQ7T 3HP9A 2XU8A 4C92B 3O8VA 4A4KA 4DQ2A 5A0DA 2VC8A 1G3YA 3MCAB 4N4GA 4MMKA 5GANj 3CBMA 3F70A 3VYHB 4HT8A 4PJOD 4NOYA 1Y07A 5I2MA 2CKKA 2E41A 2K3XA 5GAMf 3VUBA 3EFSA 4C5HA 4HT9A 1Y7XA 1M8VA 1G5VA 1KHIA 4PJOE 3PT9A 1VQKA 4A4FA 2X4YA 1YIJT 2DD5A 3V8JA 4F7UE 4M75C 4M78A 2KQWA 3RMSA 4XU2A 3FRNA 3CMEA 2GQVA 4BD3A 4BDZA 3CCUA 2QQ9A 4KT0E 4M7DG 1PSEA 4Z02A 3CC7T 3CD6T 4O5VA 3JB9I 3A5ZB 3P8HA 5CKFA 4ZTJA 3LH0A 4LD9K 1FX7A 1YHQT 4M75D 3P8BB 4M77A 3M56A 2DIQA 4ELZC 1GXIE 2VUBA 3S6WA 3JCMQ 3OYJA 1BIBA 3ASKA 4BDYA 3CXCA 4ZN3A 1YJWA 2HD0A 4JUVA 1VIFA 2LT1A 3H8ZA 4PKCC 2M16A 1WJSA 3QKJA 5HKCA 5CR2A 2CZ6B 2DTOA 4HCZA 1MGQA 3G71T 3OW2A 5CVIA 3VUZA 5GAOp 1VQMA 3ME9A 3RMQA 2IG0A 3QPHA 2BKDN 1N27A 3TREA 5HK3A 2ZCFB 4IUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MZM A;  5CKF A;  5DLO A;  5CCA A;  2MF2 A;  1UB4 A;  5CQY A;  5CQX A;  3HPW A;  5HK0 A;  5CKD A;  1M1F A;  4ELY C;  4ELZ C;  2VUB A;  4MZT A;  2KMT A;  4OF1 A;  3JRZ A;  5CK9 A;  3VUB A;  4ME7 A;  5CKH A;  5HKC A;  1VUB A;  3JSC A;  1X75 C;  5CO7 A;  5CKE A;  5CR2 A;  4MDX A;  3TCJ A;  1NE8 A;  4HKE A;  3NFC A;  2C06 A;  5HK3 A;  5CKB A;  4VUB A;  3G7Z A;  4MZP A; 
#chains in the Genus database with same CATH topology
 2KRM A;  1UB4 A;  1X6O A;  4UC4 A;  4F17 A;  2DRK A;  2ZAE A;  3MHX A;  4A4G A;  4D6W A;  4J9C A;  3Q1J A;  2DTI A;  2YUO A;  3QII A;  2ECZ A;  1TWB A;  1BBZ A;  3OYG A;  2DXB A;  4FIB A;  1KD1 C;  5EG2 A;  1VQ5 T;  2DL8 A;  1ACM B;  1K4U S;  2CP3 A;  5EC7 A;  2DEU A;  4N4H A;  3OS0 A;  2OTJ Q;  1M90 C;  5HK0 A;  3PNW C;  2CUB A;  1XNI A;  1OU9 A;  4MZT A;  1S1N A;  2J7I A;  4XTW A;  1VQO A;  4J9F A;  2YSQ A;  4CC2 A;  1VQM T;  2O9V A;  3CQT A;  3JB9 J;  2DET A;  2GBQ A;  1VQM Q;  2QQB A;  3E9F A;  5KE2 A;  3CD6 A;  4M7A E;  2CP7 A;  3MET A;  3JCM h;  2YHT A;  2QEX Q;  3MEU A;  2ZPG B;  2HNI A;  1RAC B;  2C0O A;  1TUG B;  2OX7 A;  1N9S A;  2RJC A;  5CKH A;  1WYX A;  4EMH A;  1BK2 A;  2P4R A;  1D0Z A;  1WLP B;  4FL6 A;  4P5N A;  5AYF A;  2MF2 A;  3FDR A;  1NJI C;  1M90 R;  2EQJ A;  5IT9 E;  2E6Z A;  4OVA A;  3QYG B;  2RQU A;  3OS5 A;  4JJC A;  4BUG A;  1Q86 R;  1HSQ A;  2DTH A;  3S3N A;  2OTL Q;  4RTW A;  1ZSG A;  4C8Q D;  2PNI A;  4PJJ A;  1XJW B;  2QXF A;  2YXY A;  1ZBJ A;  3GNG A;  5LJ5 d;  3MKD A;  1QP3 A;  2VYT A;  1I5L A;  3I5S A;  1LNX A;  2DD4 A;  4IUP A;  3EGX A;  3QJY A;  4C8Q C;  5A0G A;  1M3C A;  4M7A B;  2YT6 A;  3GP8 A;  4M78 C;  4J6W A;  1I4K 1;  4FYY B;  1NEG A;  2LNV A;  1X69 A;  4C5E A;  3L2U A;  1K9M R;  2E4H A;  2H3E B;  2CT4 A;  1QLY A;  2FZC B;  1NYF A;  2KDS A;  5KH6 A;  1WI7 A;  1SSH A;  1WDX A;  3H6Z A;  3UA6 A;  4C92 G;  5GAO r;  2F5K A;  3MP8 A;  1G2B A;  2YUP A;  3FEO A;  3JCM b;  1WA7 A;  2FHD A;  3JB9 D;  2HDA A;  3CC2 A;  1K73 U;  2M0Y A;  2EYZ A;  1T0J A;  1ZSZ C;  2DX1 A;  4HVU A;  1RAB B;  3LGL A;  5GAN g;  1BI3 A;  5FWB A;  3FJP A;  4KH1 B;  3I55 Q;  1U8R A;  2JW4 A;  3H0F A;  3VS2 A;  1AWX A;  2BIV A;  4HXJ A;  1B07 A;  3CCS T;  3CCL T;  2O4X A;  2NYS A;  1GFC A;  2GFA A;  3GBQ A;  1YCY A;  2FPF A;  1S72 T;  1QWF A;  1G3W A;  3EGD A;  1M1K C;  3CCQ Q;  1SSF A;  1KD1 U;  4AFS C;  1GCP A;  3OYY A;  4OML A;  2A08 A;  2M0O A;  3VJP A;  4C5I A;  4M7D E;  1WIE A;  2F2X A;  2DXC A;  4CI0 C;  1WHH A;  2YRC A;  8ATC B;  1Q81 U;  1VQN Q;  4CC4 B;  1I81 A;  1K0S A;  1FXX A;  3OYM A;  2JMC A;  2RJE A;  3OS1 A;  2HCK A;  1V29 B;  3L1A A;  1PRL C;  2M51 A;  5CKD A;  2P0Q A;  1VQK T;  1CKB A;  2RI2 A;  3CC2 Q;  1RAI B;  5IHN A;  4XTZ A;  4BAC A;  5IH2 A;  1KHC A;  1U1T A;  2RO0 A;  5LJ5 g;  3WVE B;  1M30 A;  4PJO C;  3OBW A;  4A54 A;  3I55 A;  4BY6 C;  4XU1 A;  2NLU A;  4XTY A;  3M4G A;  3EHR A;  1X6G A;  2MIO A;  1T3S A;  5KYY B;  1AWJ A;  2E10 A;  2RM4 A;  2VV5 A;  2XDP A;  3R6N A;  1ABQ A;  4JPB W;  4LDW A;  3OYC A;  2LQN A;  1MMA A;  2PU9 B;  4N0A A;  1YI2 A;  3EHQ A;  3C94 A;  1LVK A;  1CSK A;  4Y91 A;  4II1 A;  2QDL A;  1TUC A;  4DBF A;  2JUF A;  1VQ8 Q;  2RHY A;  1BYM A;  1UGV A;  3M58 A;  4ANJ A;  2DMO A;  1XTD A;  2MMP A;  3UPU A;  4L59 A;  2KYB A;  5GAM e;  1AD5 A;  2JTE A;  2EYQ A;  3SDZ A;  4C8Q A;  1VQL T;  3MJX A;  1P92 A;  3OYA A;  2QQR A;  4VUB A;  2D0Q B;  2B8A A;  1H3H A;  2FPE A;  2FG0 A;  3M4Y A;  3UA7 A;  1VQK Q;  3LX7 A;  1K8A R;  1YWP A;  6AT1 B;  2DNU A;  5IHK A;  4M7A A;  2DE0 X;  3QUI A;  1M1G A;  2PQW A;  4F04 B;  2EIF A;  3CCE T;  2CYZ B;  3CXC S;  1X75 C;  2CS7 A;  4FCY A;  3EFO B;  1D0X A;  4C0D C;  3CCM T;  4IIO A;  3OYH A;  2K5L A;  2C06 A;  2DPP B;  4J9E A;  3EAE A;  1E6H A;  4M78 G;  1VQO T;  1VIE A;  3O5Z A;  4HCK A;  3NGP A;  3OYL A;  5CK9 A;  2HQH A;  3OYE A;  1Q81 R;  1TXQ A;  1AEY A;  4M77 G;  2KT1 A;  1JJ2 A;  5LJ3 h;  3NFC A;  4C0G A;  3H0H A;  1B34 B;  2BZY A;  1E7O A;  2EWN A;  2V8K A;  3VS5 A;  4BI3 A;  2V8I A;  1IHW A;  5IHI A;  2JS0 A;  5LJ3 j;  2JZ2 A;  2DL4 A;  3URG A;  2YUQ A;  2EPD A;  4D8K A;  2J6O A;  1W2B S;  3JV3 A;  3OYB A;  1U1S A;  1K73 R;  3OA6 A;  4ZN1 A;  3BE3 A;  1W2B A;  3M5A A;  2K5I A;  5D7U A;  4C8Q B;  2DXT A;  2KGT A;  2QAZ A;  2ZPH B;  1OX9 A;  1B7T A;  2QTX A;  3EG3 A;  5GAM j;  2VGM A;  4TVR A;  1OV3 A;  4EMK B;  2DER A;  3RR6 A;  3EGU A;  3M59 A;  1A0N B;  2MOX A;  1BB9 A;  4AG2 C;  4HKE A;  2A36 A;  4KGV B;  4DA4 A;  4LUD A;  5FW9 A;  1HYO A;  4M7D F;  3M0Q A;  4R55 A;  2ATC B;  5DLO A;  2YRV A;  1AOJ A;  2XU8 A;  3O8V A;  4LXC A;  5GAN j;  4MMK A;  3F70 A;  1X27 A;  2CKK A;  2E41 A;  5GAM f;  4C5H A;  2FPD A;  4A4F A;  1YIJ T;  2DD5 A;  4M75 C;  2KQW A;  4XU2 A;  3CME A;  2DL5 A;  2DVJ A;  4M7D G;  2QQ9 A;  4Z02 A;  4WTO B;  4O5V A;  3JB9 I;  3P8H A;  5CKF A;  1FX7 A;  1GXI E;  1NM7 A;  3S6W A;  3OYJ A;  1KC8 R;  1BIB A;  3FJ5 A;  2KNB B;  4F14 A;  2NUZ A;  1YJW A;  1VIF A;  5KYX B;  1WJS A;  1YJN Q;  2K9G A;  1MGQ A;  3G71 T;  2GTO A;  5CVI A;  1K1Z A;  2IG0 A;  2BE9 B;  3QPH A;  2RMO A;  2QGG A;  1GCQ C;  1YWO A;  3OB9 A;  5GAN 7;  3EH2 A;  1Q82 C;  1YHQ A;  4OP0 A;  2RK2 A;  3CC2 T;  2XDD A;  3TQ7 P;  2I0N A;  1VQ4 Q;  2DEQ A;  2RQT A;  3MEW A;  3OYF A;  3OYI A;  3CME T;  2D0N A;  1KSW A;  3HHT B;  2R5A A;  2EKO A;  2X4X A;  4FW2 A;  3EFO A;  2JVV A;  3G7Z A;  2KXD A;  4OMF B;  4FYW B;  2DL3 A;  2KY9 A;  5GAO q;  2DXU A;  4E7J A;  4JZ3 A;  3NPF A;  1YJW Q;  1VQ8 T;  2AKK A;  3CMA T;  1OZ2 A;  4R0K A;  1PWT A;  2HBP A;  1D1B A;  2NUT A;  2L89 A;  2VGN A;  2D8H A;  3MO8 A;  3VS0 A;  1PD1 A;  2D9T A;  2R58 A;  2QEX T;  2KAF A;  4LUE A;  3JCM d;  4QT7 A;  2IIM A;  4J6Y A;  1PSF A;  2JM8 A;  3JCM V;  5GMK l;  2RB6 A;  5GAN 6;  1TH7 A;  4PL6 A;  3OYD A;  3VKI A;  1X2K A;  1N6A A;  5D6Y A;  1JXM A;  4Z89 A;  1G8X A;  4FSX A;  1LOJ A;  4E7Z A;  1LCK A;  4DEY A;  3JCM e;  3JB9 G;  1QKX A;  4WF2 A;  2CP0 A;  1VYV A;  2LQW A;  3G4S T;  1RLP C;  5J26 A;  2NWM A;  3G4S Q;  1YI2 Q;  4BE2 A;  4M78 F;  4F16 A;  2CP6 A;  3E1S A;  4A4E A;  2JOY A;  2HSP A;  3WVD B;  4QQ6 A;  1VYU A;  5GAM g;  1PCX A;  1O9S A;  2EJG A;  1XQH A;  3PMI A;  4FT4 A;  4HA8 A;  2X9H A;  5FWC A;  3RIR A;  1RL2 A;  2QGF B;  2KXC A;  3C0C A;  1K8A U;  2A7Y A;  2NUT B;  3I5R A;  3J7A F;  4RCB A;  2EQM A;  1PKT A;  5KYU B;  2BUD A;  1AVZ C;  1G3S A;  4M4Z A;  4AFQ C;  1MNE A;  4HCB A;  3QHS A;  2JN0 A;  1QVG S;  3M55 A;  1UE9 A;  2SEM A;  1WXT A;  1W2B P;  3DLL A;  3HTR A;  5KCO A;  3RUX A;  3VRY A;  3OY9 A;  4LDY A;  2RQW A;  4C92 F;  2DL7 A;  3CCJ Q;  5GAN 5;  2COW A;  4YTL A;  5CIU A;  3SB2 A;  2AT1 B;  1SF9 A;  3QSU A;  3L2W A;  1Q81 C;  3J81 E;  1E6G A;  1NYG A;  1VQ4 A;  5FRO A;  2EGA A;  4E47 A;  2LQ8 A;  4AFZ C;  1YBY A;  2GTJ A;  2EGC A;  5GAN d;  1IRX A;  1Y96 B;  2EFI A;  2P0P A;  4LDV A;  1UG1 A;  3LGF A;  1M2O A;  4QVZ A;  2QG9 B;  4MDW A;  3JCM g;  3BDU A;  4M77 B;  5DLQ E;  1Y71 A;  4RG2 A;  2HSE B;  4PNO A;  2JJ9 A;  2QYZ A;  4OB0 B;  1Y0M A;  2L8D A;  1EZZ B;  4FW1 A;  1QCF A;  5I11 A;  4J6X A;  2LNH B;  1FMV A;  1TSF A;  1ZBX A;  5GMK j;  1QMC A;  1M9S A;  3BFM A;  3HRU A;  4XTU A;  5GAN 3;  2ROL A;  1YP5 A;  3EGX B;  2O9S A;  1AWW A;  1YJ9 Q;  3RKY A;  2GQI A;  1NEB A;  3A8H B;  5GAO m;  3S3O A;  5LJ5 j;  1KFZ A;  3KXT A;  2DJZ A;  3LH5 A;  3OSV A;  1VQP A;  2MCN A;  3REB B;  1N8R R;  2LCS A;  1VQ6 Q;  1VYT A;  3UT1 A;  4PJO A;  4PLL A;  3LWI A;  2D1X A;  1QVF A;  4HVW A;  2EYY A;  2KYM A;  3I56 T;  4OMM A;  2F69 A;  3QWX X;  5FRN A;  2EW3 A;  1PD0 A;  3EG9 A;  1SKU B;  2CZ1 B;  3OYK A;  2JTF A;  5FRM A;  2EJ9 A;  1NJI U;  1ZHI A;  2ENM A;  1BKB A;  4J9I A;  3GLX A;  3ER0 A;  4M77 D;  4M75 E;  1YIJ A;  2GF7 A;  3JRZ A;  5GAN 8;  3JCM c;  2K2V A;  3DLM A;  1VQ7 A;  2ZPB B;  3L2R A;  2DLP A;  5AT1 B;  1Q7Y C;  3CCE A;  3HL8 A;  2LJ1 A;  4ATO A;  4NS5 A;  4JS4 A;  2YUN A;  4C0F A;  2RI3 A;  4LDX A;  1GRI A;  5C0M A;  3CCM Q;  2GGR A;  1AWO A;  2XIC A;  4JJB A;  4J9H A;  4E7S A;  4C92 C;  5KYN A;  1G83 A;  3JB9 F;  1OPK A;  3REA B;  1KIK A;  3R6O A;  1OX8 A;  3RKW A;  1TTH B;  4MML A;  1D3B B;  2FZK B;  2JTM A;  3CCQ A;  3CCE Q;  1OEB A;  4CC3 A;  3P8D A;  3LYI A;  4CC7 A;  2P4T A;  2FVU A;  2DZC A;  3RKX A;  4JDS A;  1WHG A;  1Q86 U;  1M1K R;  2PVO B;  1KG1 A;  3QBY A;  2KK4 A;  4M78 B;  2D8J A;  4L5G A;  2BE7 D;  4N0A C;  5GAM d;  3LLR A;  2LTO A;  3G6E Q;  4FT2 A;  4XAX B;  2GNC A;  4RG8 A;  3GOX A;  3I56 Q;  2PTK A;  5GAN 2;  1R0C B;  4ORZ A;  4D8D A;  1D3B A;  2PUK B;  3PVQ A;  5FU6 C;  3JCM f;  2HZY A;  3T9N A;  3KFV A;  1VQN T;  2DRM A;  4GLM A;  3CC4 Q;  2EQI A;  1VOM A;  3CBP A;  3VV0 A;  2PVD B;  3QDF A;  2PUO B;  3FC3 A;  1FMW A;  1M1K U;  4LE9 A;  3HPW A;  3QYH B;  2O2O A;  4E6R A;  1JO8 A;  2DZ9 A;  1QKW A;  2MI6 A;  2W10 A;  1K9A A;  2NUP A;  1ZSZ B;  2KE9 A;  4C92 E;  2FRW A;  5IXB A;  4X9C A;  4M7D D;  4ME7 A;  3RNJ A;  1VQ6 A;  1K9M C;  3KBG A;  4R56 A;  3JB9 H;  4FU6 A;  5GAO n;  4OB3 B;  1B3Q A;  3ZFJ A;  2G6F X;  2K5F A;  3QO3 A;  5HCK A;  3CCU Q;  1YIT A;  4HCC A;  4MZM A;  2LX9 A;  2K4Y A;  4AFU C;  2MWO A;  2C0T A;  2DA9 A;  1TG0 A;  1V76 A;  2RQV A;  1UGR B;  4JRI A;  3JAM E;  4M78 E;  2X3W D;  1LJO A;  3CCR T;  2QA4 T;  3DKM A;  1JB0 E;  3EG1 A;  1GCQ A;  3UWN A;  2PVG B;  5KE3 A;  1U5S A;  1AZE A;  4ZGJ B;  1M2V B;  2QQS A;  3I55 T;  2ED1 A;  1VQ6 T;  3L2V A;  4M7A G;  5CCA A;  1NJI R;  1RAA B;  1G3Y A;  2Z0W A;  2A28 A;  4HT8 A;  4PJO D;  1S72 Q;  2LZ6 B;  2K3X A;  2E3I A;  3EFS A;  1KHI A;  4DBH A;  1AZG B;  2X4Y A;  2SRC A;  4M78 A;  3A98 A;  3CD6 Q;  3FRN A;  4BD3 A;  4BDZ A;  3CCL Q;  1Q95 G;  1TUD A;  3CD6 T;  1UTI A;  2E3H A;  1YHQ T;  4M77 A;  3P8B B;  2DIQ A;  4BDY A;  4ZN3 A;  2J06 A;  1W1F A;  2LT1 A;  1H8K A;  1JJ2 P;  3QKJ A;  3G71 Q;  4Z88 A;  2EBP A;  3OW2 A;  3VUZ A;  1VQM A;  3ME9 A;  3RMQ A;  2BKD N;  1N27 A;  2LMJ A;  4AT1 B;  1SPK A;  1U3O A;  2ZZD A;  1OZ3 A;  4J7I A;  2R5M A;  4JJD A;  5A0L A;  1ZLM A;  3LW5 E;  4X1V A;  2CDT A;  3CCR Q;  1YJW T;  2EGE A;  2F5T X;  4XTX A;  2OTJ A;  3X24 B;  3RBB B;  1YN8 A;  1R0B G;  3VS3 A;  1RAF B;  1ZA2 B;  2AIR B;  3PGG A;  4DBR A;  2HMA A;  1SRL A;  4M77 F;  4XQ3 A;  2O4X B;  5ECA A;  2JMA A;  2W0Z A;  1JQQ A;  4C0D B;  2JT4 A;  2LVM A;  1Z9Z A;  4J8O A;  3JCM P;  4KUI A;  4RMO A;  2HL3 A;  2CH4 A;  1W70 A;  2WSF E;  4J9D A;  1YJN T;  5J39 A;  1JRI A;  2OTJ T;  5KYW A;  4XK8 E;  5A2Q E;  1O75 A;  1Z9Q A;  2EJF A;  2E5Q A;  1M2V A;  3X28 B;  4J9B A;  2LRQ A;  1KQ2 A;  3OYN A;  1QWE A;  4PK4 A;  4B6M A;  3TCJ A;  3V7C A;  1JBM A;  4Y92 A;  1QVG P;  1XOV A;  2CZ7 B;  5GMK i;  2RI5 A;  3L2Z A;  2J05 A;  4OB2 B;  3PMT A;  4AMC A;  4LNP A;  4KH0 B;  3H9N A;  2V8J A;  1M3B A;  2FZG B;  2MYS A;  1W4S A;  4KBM B;  3I56 A;  3MPU B;  3DB3 A;  3EGD B;  3BW1 A;  3SWN C;  1WNL A;  3L2Q A;  4OGE A;  1NG2 A;  3HSB A;  4B9X A;  3A8L B;  3VS4 A;  3A8M B;  4E7H A;  3OSS C;  4M7D C;  2F2W A;  2LDM A;  1Q82 R;  2QEX A;  3TSZ A;  2YDL A;  3NTI A;  1ZUK A;  1JEG A;  1JJ2 S;  1SHF A;  1N9R A;  1IGU A;  4PFO A;  2YRD A;  4M77 C;  1D0Y A;  2RH2 A;  2XI9 A;  1KC8 C;  1UHC A;  1QVP A;  3DB4 A;  4PJN A;  4E7L A;  2LC4 A;  2X4W A;  2MAM A;  3INZ A;  5GAO l;  2E64 A;  3CPW A;  1PRM C;  1BCO A;  3EH1 A;  1D1C A;  4J5Y A;  4M75 B;  8AT1 B;  1NLP C;  2XHC A;  1OQK A;  2GFU A;  1RI0 A;  3CME Q;  4FYV B;  2J6K A;  4ZGE B;  3FB9 A;  4MZP A;  5FU7 C;  1YIT T;  3CBO A;  3PIO A;  1K0X A;  4C0Z A;  4F7U G;  2F2V A;  1MV0 B;  1X6B A;  1N8R U;  2K3B A;  2EYW A;  2RPN A;  3X20 B;  1AHJ B;  2VAS A;  2AZV A;  2RD1 A;  1Q7Y U;  2VKN A;  1WHK A;  4QQD A;  2QA4 A;  2A3L A;  1HXD A;  2HKN A;  4L6V 5;  3ZEH A;  1M1F A;  1VQ8 A;  1YJ9 A;  4JRQ A;  1QW1 A;  3CC4 A;  1IGQ A;  4KGX B;  2E6N A;  2RHU A;  5GMK h;  1VQ5 Q;  4IUQ A;  4RTU A;  2V26 A;  2HBW A;  4LD6 A;  4JZ4 A;  5LJ5 f;  4BE1 A;  3TSW A;  1H92 A;  1QVF S;  5CQX A;  2E70 A;  5CQY A;  4A4H A;  2BZX A;  1U06 A;  3MEA A;  2JNG A;  1CKA A;  3RER A;  3CCR A;  1UGQ B;  2MK5 A;  2L3S A;  2DF6 A;  1V1C A;  1FWZ A;  3JSC A;  3L42 A;  3M0S A;  3S3M A;  5KCH A;  2A37 A;  2ESW A;  5KYX A;  1RI9 A;  1FMK A;  2K57 A;  1QQJ A;  4M75 A;  2DJQ A;  3SWN A;  1PG5 B;  1RAG B;  3JCM X;  1MND A;  2KMT A;  3C12 A;  3CCM A;  2BZ8 A;  2P0K A;  2OAW A;  1M4Z A;  4EPC A;  4GBQ A;  4QQG A;  4IUR A;  5GAM h;  2RHI A;  2YWW A;  1YJ9 T;  2HL5 C;  1BI1 A;  1Y57 A;  3QWY A;  3TU4 K;  4F7U F;  3G6E T;  3VS1 A;  3MEV A;  1WHL A;  2QAS A;  4M77 E;  1VQ9 Q;  4J9G A;  1C0M A;  5C6S A;  4FM4 B;  1VQ9 T;  4RTZ A;  3I35 A;  2Y4X A;  1UFF A;  2KEA A;  4BI4 A;  1H64 1;  2L5Q A;  1FYN A;  1HD3 A;  3HFO A;  2RHX A;  2HQE A;  4LDU A;  1VQP Q;  3CEY A;  1QCO A;  1VQ4 T;  1R77 A;  5I2S A;  1YI2 T;  1BI2 A;  3AT1 B;  2RN8 A;  3SD4 A;  3ZL7 C;  3CCQ T;  1M5Q 1;  5CAI A;  1MMD A;  1GBR A;  4M7A D;  2IPO B;  1I5O B;  1D09 B;  1QVG A;  2OTL A;  2R57 A;  1ZUY A;  2FB7 A;  2RHZ A;  1EIF A;  4PJO G;  5CKB A;  3V7R A;  1NPR A;  3VYG A;  2RK1 A;  1N8R C;  2KRN A;  2CZ0 B;  2F1L A;  2ABL A;  4BB7 A;  3M54 A;  1IO6 A;  2C0I A;  1NZ9 A;  2OAU A;  1VQ9 A;  1OUL A;  4OMP A;  3M0T A;  3PIP A;  2IVW A;  2HKQ B;  1WX6 A;  2RJF A;  1T0H A;  1IRE B;  2CP5 A;  2DM1 A;  2XD0 A;  2ZPI B;  2XMF A;  3NTH A;  3PE0 A;  5IN1 A;  2GCX A;  1HJD A;  3TVT A;  3HKS A;  3G6E A;  4C8Q E;  1UEB A;  5GMK m;  3CCV A;  1OYX A;  3OW2 S;  2RF0 A;  3NTK A;  2ROT A;  2G3R A;  2E65 A;  1H3Z A;  2WSE E;  4Y28 E;  2CP2 A;  1WQW A;  2DYI A;  1WZO A;  1I8F A;  4N4I A;  2CGH A;  2KRS A;  1UJY A;  1KQS A;  2VXF A;  3CCV Q;  2CSQ A;  2RNA A;  1B34 A;  1KQS P;  2K79 A;  3EG2 A;  5DM7 R;  2KT8 A;  1N5Z A;  3HP9 A;  4C92 B;  5A0D A;  2VC8 A;  2VWF A;  3MCA B;  2HEQ A;  2O88 A;  1YHQ Q;  1ZA1 B;  3VYH B;  1I0C A;  1Y07 A;  2EYX A;  4NOY A;  2BTT A;  3VUB A;  4HT9 A;  1M8V A;  1TU0 B;  2OI3 A;  3V8J A;  4F7U E;  1SHG A;  3RMS A;  3CC7 Q;  4RUG A;  4KT0 E;  3CC7 T;  1VQ7 Q;  3A5Z B;  4ZTJ A;  3LH0 A;  4LD9 K;  3I9Q A;  4M75 D;  1YCS B;  3M56 A;  2V1R A;  2VUB A;  1BU1 A;  1RAE B;  3ASK A;  4DBQ A;  3CXC A;  1JU5 C;  2HD0 A;  5L23 A;  2M16 A;  5HKC A;  1SEM A;  2RQR A;  5CR2 A;  2CZ6 B;  4HCZ A;  3TRE A;  1RAH B;  1I07 A;  2ZCF B;  4IUT A;  3G4S A;  4IUU A;  1WJR A;  2L3P A;  1PM3 A;  4M75 F;  1GBQ A;  3RES A;  5GJV B;  1PHT A;  4PJL A;  1WPY A;  4B9W A;  2QA4 Q;  2CSI A;  2H8H A;  5D6X A;  4EDU A;  5FLX E;  1VUB A;  3GNF B;  1KD1 R;  3VS7 A;  1UUE A;  2FYK A;  4EMK A;  4PFZ A;  5FU7 B;  1J3T A;  5IAY A;  3CPW P;  3PTA A;  1WHM A;  2E1H A;  1SRM A;  5DY9 A;  4DOW A;  2ZPF B;  4C92 A;  2FRY A;  3FIF A;  1EX4 A;  2K7A A;  2M1H A;  2L3R A;  2X4J A;  2HQX A;  1M8M A;  3PVL A;  1RAD B;  5GAN h;  1K76 A;  1QP2 A;  2HAX A;  2CT3 A;  3H0I A;  3CC7 A;  1TS9 A;  5LJ3 f;  1KQ1 A;  3UAT A;  4EIK A;  5J3B A;  1PNJ A;  1KJW A;  4OMQ A;  4V2S A;  1UDL A;  2ZPE B;  1K9M U;  3SWN B;  3QJ6 A;  2ED0 A;  2DK3 A;  4RTT A;  1IXD A;  4KRT A;  3AHU A;  3G71 A;  4M7D B;  4M7A F;  1HK9 A;  2WSC E;  3CMA A;  3OS2 A;  1OU8 A;  3OW2 P;  3CCS Q;  2MPX C;  1UHF A;  4PJO F;  1NBE B;  3PFS A;  1YFN A;  2EQK A;  1ABO A;  4J83 A;  4QW2 A;  2AKL A;  1OPL A;  4JRK A;  2KSS A;  2RA2 A;  4RTY A;  3CCJ A;  1KQS S;  3KUF A;  3C4S A;  1M27 C;  1YIJ Q;  4JS5 A;  5LL6 S;  2O01 E;  4RTV A;  1I1J A;  2QQA A;  3A8G B;  5FU6 B;  5KYU A;  2QK0 A;  3GIB A;  1WXU A;  1VQL Q;  2DO3 A;  1RUW A;  3A8O B;  1KC8 U;  3CPW S;  2YLC A;  4BE0 A;  2AHJ B;  2LJ3 A;  2DYB A;  2X35 A;  2EVR A;  1NLO C;  1MMG A;  1UEC A;  2LP5 A;  5GAN f;  3M0R A;  2DIG A;  3EG0 A;  4RKU E;  1GFD A;  5CO7 A;  3N5B B;  5I21 A;  1M3A A;  4EMG A;  2XDB A;  2COY A;  3FLG A;  3CCU T;  2XG8 D;  2QI2 A;  4QVC A;  4X9D A;  4GY5 A;  3V8L A;  4OB1 B;  5GAN 4;  2VB6 A;  4BY6 B;  3SHW A;  4ESR A;  2LT4 A;  5LJ3 d;  3JCM J;  1UGP B;  4WCI A;  5HY6 A;  3UDC A;  4X34 A;  3V8K A;  5IXF A;  2JS2 A;  4C8Q G;  3LWH A;  1ZSZ A;  3H41 A;  4FSS A;  3TEE A;  2LJ0 A;  1KK7 A;  1VA7 A;  2Y90 A;  2I2L A;  4C8Q F;  1UGS B;  1X01 A;  2NUP B;  3SFM A;  5LJ5 e;  4OGC A;  3E9G A;  4GLK A;  4IUV A;  3CC4 T;  5D6W A;  3CCV T;  2XKO C;  3M0U A;  1BIA A;  3VS6 A;  4KUL A;  1K8A C;  1VQN A;  1TOV A;  1T3L A;  4QVD A;  2LQK A;  2LCL A;  2M9U A;  5LJ3 g;  4C5G A;  1DJ7 B;  3QG1 A;  2H3J A;  2FEI A;  3OQ5 A;  2EKH A;  4C92 D;  3OMG A;  1K73 C;  3QXE B;  2DIL A;  4MDX A;  5L8R E;  5M9O A;  3J80 E;  4RCC A;  3QZ9 B;  1Q7Y R;  1IHV A;  4QKU A;  5KYY A;  1PKS A;  4E7I A;  1WJQ A;  4M7A C;  3NMZ C;  4PLI A;  3GF5 A;  4XU0 A;  2L3Q A;  1OI1 A;  3X25 B;  1BI0 A;  1VQO Q;  4E2F B;  3HRS A;  2FL7 A;  4PJM A;  1IZ6 A;  4O6J A;  5GMK e;  3MP1 A;  3EG9 B;  9ATC B;  4XTV A;  2L2P A;  4JJN K;  1R8O B;  3VRZ A;  3E19 A;  4NL2 A;  3OMC A;  2XID A;  3OBY A;  3V7S A;  4PJO B;  1W6X A;  3EFR A;  4KUD K;  2V1Q A;  4Q5W A;  1BCM A;  3M9Q A;  2KVQ G;  2KR3 A;  1YJN A;  4DOV A;  4ELY C;  2CUD A;  4A63 B;  4EMK C;  2MWP A;  2FO0 A;  2AK5 A;  2VVK A;  5CKE A;  3M57 A;  4RTX A;  2JM9 A;  4K11 A;  4NL3 A;  4E7K A;  1WXB A;  2RJD A;  4ZTF A;  1D1A A;  2J6F A;  3THK A;  4F7U A;  1G3T A;  2EQU A;  3VU3 C;  2L0A A;  1WHJ A;  2KI7 A;  2YLB A;  2XK0 A;  2JXB A;  4Z8A A;  4OF1 A;  2DAQ A;  1WQ7 A;  1Q82 U;  3IQL A;  3X26 B;  4ZGD B;  1X43 A;  4F7U B;  4IIM A;  5GAN e;  2DBM A;  1MUZ A;  1UJ0 A;  1X2Q A;  2ZGW A;  5LJ3 e;  2O31 A;  1VQP T;  3QDR B;  4DEX A;  1RLQ C;  2DFU A;  3CPF A;  1AT1 B;  2DVE A;  3QZ5 B;  3GPL A;  1MV3 A;  4M7D A;  5LJ5 h;  3ZBD A;  1M90 U;  4AG1 C;  1IB8 A;  3U23 A;  3JCM W;  2K2M A;  1LPL A;  3C95 A;  2DKG A;  4JLG A;  5I22 A;  2K6D A;  3A1P A;  1ZUU A;  1VQL A;  1ARK A;  4XU3 A;  2CRE A;  2LCC A;  4ZNX A;  4OMO A;  3ULR B;  3BDL A;  1Y96 A;  2QDY B;  3CMA Q;  2WAC A;  4IKF A;  3CCJ T;  4A53 A;  2K3Y A;  3CCS A;  2LX7 A;  4M75 G;  2P84 A;  1S72 A;  1SG5 A;  4HVV A;  2OJ2 A;  1MMN A;  3CCL A;  1NPP A;  2E12 A;  2B86 A;  3WXM B;  2VXE A;  1C6V X;  3M0P A;  4J7F A;  2EAY A;  1VQ5 A;  2M02 A;  3MP6 A;  2DBK A;  5GJW B;  2E5K A;  1WGS A;  4JRP A;  3HRT A;  4M78 D;  1EFN A;  5KYW B;  2X51 A;  1Q86 C;  3BY7 A;  4BI8 B;  1WFW A;  1NE8 A;  2X3X D;  2D6F A;  2KBT A;  2Y4Y A;  3UF4 A;  2OTL T;  4JLI A;  3M53 A;  3HFN A;  1ZQ1 A;  4LN2 A;  4CRI A;  1MHN A;  1VQ7 T;  3G1J A;  1ZX6 A;  3E2U A;  3SEM A;  4A4K A;  4DQ2 A;  4OMN A;  4N4G A;  3CBM A;  1OOT A;  2COZ A;  5I2M A;  2PZ1 A;  2CH4 W;  1G5V A;  1Y7X A;  4PJO E;  3PT9 A;  1VQK A;  1C1A A;  1F1B B;  2QTV A;  3D7S B;  1QCN A;  2GQV A;  3CCU A;  1YIT Q;  2AZS A;  1PSE A;  4FYX B;  1GL5 A;  4ELZ C;  3NHN A;  3JCM Q;  4PFP A;  4KGZ B;  4JUV A;  1YNZ A;  3H8Z A;  7AT1 B;  4PKC C;  1QVF P;  3CXC P;  3RDV A;  2DTO A;  2A0F B;  5GAO p;  1JXO A;  5HK3 A;  1PC0 A;  2KRO A; 
#chains in the Genus database with same CATH homology
 3OB9 A;  5GAN 7;  3G4S A;  4IUU A;  1WJR A;  4J7I A;  1UB4 A;  1OZ3 A;  1X6O A;  2ZZD A;  2R5M A;  4M75 F;  4UC4 A;  3RES A;  1Q82 C;  3MHX A;  4A4G A;  1YHQ A;  5A0L A;  4OP0 A;  2RK2 A;  3LW5 E;  4D6W A;  3Q1J A;  3CC2 T;  2DTI A;  3QII A;  1WPY A;  4B9W A;  2XDD A;  2DEQ A;  1YJW T;  5D6X A;  4EDU A;  2F5T X;  5FLX E;  3MEW A;  4XTX A;  2OTJ A;  3X24 B;  3OYF A;  1VUB A;  3GNF B;  3OYG A;  2DXB A;  2FYK A;  4FIB A;  5EG2 A;  1KD1 C;  1VQ5 T;  4EMK A;  3OYI A;  3CME T;  5FU7 B;  3HHT B;  5IAY A;  2R5A A;  2EKO A;  2X4X A;  4N4H A;  3OS0 A;  2JVV A;  3G7Z A;  4OMF B;  3PGG A;  3PTA A;  2KY9 A;  5GAO q;  1M90 C;  2E1H A;  5HK0 A;  3PNW C;  1XNI A;  2DXU A;  4E7J A;  4M77 F;  4MZT A;  4XQ3 A;  2O4X B;  1VQO A;  4XTW A;  5DY9 A;  4DOW A;  2ZPF B;  1VQ8 T;  4C92 A;  3CMA T;  1OZ2 A;  4C0D B;  2LVM A;  2HBP A;  3FIF A;  4J8O A;  3JCM P;  1VQM T;  2M1H A;  4KUI A;  2L3R A;  4RMO A;  2L89 A;  2X4J A;  2HQX A;  3JB9 J;  2VGN A;  5GAN h;  2WSF E;  3MO8 A;  1YJN T;  2D9T A;  2QQB A;  2R58 A;  5J39 A;  1QP2 A;  3E9F A;  2HAX A;  1JRI A;  2QEX T;  2KAF A;  5KE2 A;  2OTJ T;  3CC7 A;  3CD6 A;  4M7A E;  3JCM d;  3MET A;  4XK8 E;  5A2Q E;  3JCM h;  4J6Y A;  1O75 A;  2YHT A;  5LJ3 f;  1KQ1 A;  1PSF A;  2EJF A;  3JCM V;  2E5Q A;  5J3B A;  5GMK l;  2RB6 A;  3MEU A;  5GAN 6;  2ZPG B;  2HNI A;  1TH7 A;  4PL6 A;  3X28 B;  2ZPE B;  3VKI A;  3OYD A;  1K9M U;  4V2S A;  1N6A A;  3SWN B;  1N9S A;  2LRQ A;  2RJC A;  5D6Y A;  3QJ6 A;  5CKH A;  2DK3 A;  1KQ2 A;  4FSX A;  3OYN A;  1LOJ A;  3AHU A;  3TCJ A;  3V7C A;  4EMH A;  1JBM A;  3G71 A;  4M7D B;  3JCM e;  3JB9 G;  4M7A F;  1HK9 A;  1XOV A;  2WSC E;  4WF2 A;  2CZ7 B;  5GMK i;  3CMA A;  2RI5 A;  3L2Z A;  4FL6 A;  4P5N A;  5AYF A;  3OS2 A;  3G4S T;  5J26 A;  2MF2 A;  3FDR A;  4OB2 B;  1NJI C;  2EQJ A;  5IT9 E;  3PMT A;  4PJO F;  3PFS A;  4BE2 A;  2EQK A;  4J83 A;  4M78 F;  2E6Z A;  4OVA A;  4QW2 A;  3QYG B;  3E1S A;  3OS5 A;  2KSS A;  2JOY A;  2RA2 A;  4JRK A;  2V8J A;  4A4E A;  3CCJ A;  3KUF A;  4KBM B;  1KQS S;  1W4S A;  3I56 A;  4BUG A;  3C4S A;  3DB3 A;  3BW1 A;  3SWN C;  3WVD B;  4QQ6 A;  2DTH A;  3S3N A;  1WNL A;  5GAM g;  3L2Q A;  4OGE A;  4C8Q D;  1O9S A;  3HSB A;  4B9X A;  3A8L B;  2EJG A;  2QXF A;  3A8M B;  1XQH A;  3PMI A;  2O01 E;  5LL6 S;  4JS5 A;  3OSS C;  4FT4 A;  4E7H A;  2QQA A;  5FU6 B;  3A8G B;  3GNG A;  4HA8 A;  5LJ5 d;  4M7D C;  3GIB A;  2DO3 A;  1QP3 A;  2VYT A;  3RIR A;  3A8O B;  1LNX A;  2DD4 A;  4IUP A;  2LDM A;  3CPW S;  1KC8 U;  1I5L A;  1RL2 A;  2YLC A;  3QJY A;  2QEX A;  4BE0 A;  4C8Q C;  5A0G A;  4M7A B;  1K8A U;  2AHJ B;  2A7Y A;  3NTI A;  3GP8 A;  4M78 C;  4J6W A;  1I4K 1;  3J7A F;  2X35 A;  4RCB A;  2EQM A;  2BUD A;  1G3S A;  5GAN f;  1JJ2 S;  2DIG A;  2LNV A;  4RKU E;  4C5E A;  5CO7 A;  4HCB A;  3L2U A;  3N5B B;  1N9R A;  3QHS A;  2KDS A;  2JN0 A;  1QVG S;  4M77 C;  3M55 A;  5KH6 A;  2RH2 A;  5I21 A;  2XI9 A;  3H6Z A;  4EMG A;  1KC8 C;  2XDB A;  1QVP A;  3DB4 A;  4C92 G;  3DLL A;  4E7L A;  5GAO r;  2LC4 A;  2X4W A;  3FLG A;  5KCO A;  2F5K A;  3MP8 A;  3RUX A;  3FEO A;  3JCM b;  2MAM A;  2XG8 D;  3INZ A;  5GAO l;  2QI2 A;  4QVC A;  3CCU T;  2E64 A;  3CPW A;  2FHD A;  3JB9 D;  4X9D A;  4LDY A;  3OY9 A;  3CC2 A;  4C92 F;  5GAN 5;  1K73 U;  4YTL A;  4GY5 A;  4J5Y A;  3V8L A;  4OB1 B;  4M75 B;  5CIU A;  5GAN 4;  4BY6 B;  2XHC A;  3SB2 A;  2LT4 A;  2GFU A;  3LGL A;  1RI0 A;  1BI3 A;  5GAN g;  3L2W A;  3QSU A;  3FJP A;  5LJ3 d;  1Q81 C;  1U8R A;  3J81 E;  1VQ4 A;  5FRO A;  1UGP B;  3JCM J;  4ZGE B;  3FB9 A;  2BIV A;  4MZP A;  4E47 A;  5FU7 C;  3CCS T;  2LQ8 A;  3CCL T;  1YIT T;  2O4X A;  1YBY A;  5HY6 A;  3UDC A;  3CBO A;  2GFA A;  4X34 A;  3V8K A;  1YCY A;  3PIO A;  4C8Q G;  5GAN d;  3LWH A;  1Y96 B;  2EFI A;  1S72 T;  2P0P A;  4LDV A;  3TEE A;  4C0Z A;  1G3W A;  4F7U G;  1M1K C;  3LGF A;  1N8R U;  2Y90 A;  2I2L A;  1SSF A;  4QVZ A;  4MDW A;  1UGS B;  4C8Q F;  1X01 A;  1KD1 U;  3JCM g;  3OYY A;  4C5I A;  2M0O A;  3VJP A;  3X20 B;  1AHJ B;  4M7D E;  3SFM A;  2DXC A;  4CI0 C;  4OGC A;  5LJ5 e;  3E9G A;  1Q81 U;  3BDU A;  4M77 B;  2RD1 A;  4GLK A;  4IUV A;  5DLQ E;  1I81 A;  1Y71 A;  5D6W A;  4RG2 A;  3CC4 T;  3CCV T;  2XKO C;  1Q7Y U;  4PNO A;  1FXX A;  3OYM A;  2RJE A;  4OB0 B;  1BIA A;  4QQD A;  3OS1 A;  2L8D A;  2QA4 A;  2A3L A;  1HXD A;  4KUL A;  1V29 B;  3L1A A;  1K8A C;  4J6X A;  1ZBX A;  4L6V 5;  1VQN A;  3ZEH A;  5CKD A;  1M1F A;  2P0Q A;  4QVD A;  5GMK j;  1VQ8 A;  1M9S A;  3BFM A;  2LQK A;  2LCL A;  2M9U A;  1YJ9 A;  5LJ3 g;  1VQK T;  4C5G A;  1DJ7 B;  4JRQ A;  2RI2 A;  3QG1 A;  2H3J A;  3HRU A;  1QW1 A;  4XTU A;  3CC4 A;  5GAN 3;  4BAC A;  4XTZ A;  3OQ5 A;  4C92 D;  3OMG A;  1KHC A;  1U1T A;  1K73 C;  3QXE B;  4MDX A;  5L8R E;  2RO0 A;  5LJ5 g;  5M9O A;  2E6N A;  3WVE B;  2RHU A;  3J80 E;  4RCC A;  3OBW A;  3QZ9 B;  4A54 A;  5GMK h;  4IUQ A;  3I55 A;  3RKY A;  4BY6 C;  4XU1 A;  2NLU A;  3A8H B;  4LD6 A;  5LJ5 j;  5GAO m;  4XTY A;  3S3O A;  3M4G A;  5LJ5 f;  4BE1 A;  3KXT A;  4E7I A;  1WJQ A;  4M7A C;  4PLI A;  2DJZ A;  3GF5 A;  3OSV A;  4XU0 A;  1VQP A;  1QVF S;  1OI1 A;  5CQX A;  2E70 A;  5CQY A;  3X25 B;  1BI0 A;  4A4H A;  3MEA A;  3UT1 A;  4PJO A;  4PLL A;  2JNG A;  3HRS A;  3LWI A;  2E10 A;  2FL7 A;  2RM4 A;  2VV5 A;  1QVF A;  3RER A;  1IZ6 A;  3CCR A;  4O6J A;  1UGQ B;  5GMK e;  3MP1 A;  2XDP A;  1FWZ A;  4XTV A;  3I56 T;  4LDW A;  4JJN K;  2F69 A;  1R8O B;  3JSC A;  3L42 A;  5FRN A;  3OYC A;  3E19 A;  4NL2 A;  2CZ1 B;  3OYK A;  2PU9 B;  3S3M A;  2JTF A;  4N0A A;  3OMC A;  2XID A;  3OBY A;  1YI2 A;  3V7S A;  5FRM A;  4PJO B;  5KCH A;  3C94 A;  2EJ9 A;  1NJI U;  3EFR A;  4Y91 A;  2K57 A;  1ZHI A;  4KUD K;  1BKB A;  4Q5W A;  3M9Q A;  4II1 A;  2KVQ G;  3GLX A;  3ER0 A;  4M77 D;  4M75 A;  4DOV A;  1YJN A;  3SWN A;  4ELY C;  2JUF A;  4M75 E;  2RHY A;  1YIJ A;  4EMK C;  2MWP A;  3JCM X;  1BYM A;  2KMT A;  2GF7 A;  3JRZ A;  3M58 A;  3C12 A;  5GAN 8;  3CCM A;  3JCM c;  2P0K A;  1XTD A;  2K2V A;  2MMP A;  3DLM A;  2ZPB B;  3L2R A;  3UPU A;  1VQ7 A;  1M4Z A;  4L59 A;  1Q7Y C;  3CCE A;  3HL8 A;  4EPC A;  5GAM e;  2EYQ A;  3M57 A;  5CKE A;  4ATO A;  4NS5 A;  4QQG A;  4IUR A;  4JS4 A;  3SDZ A;  4NL3 A;  4E7K A;  4C0F A;  5GAM h;  2RI3 A;  4C8Q A;  2RHI A;  1VQL T;  2RJD A;  4LDX A;  5C0M A;  4ZTF A;  1P92 A;  1YJ9 T;  4F7U A;  2QQR A;  2XIC A;  4VUB A;  3OYA A;  1G3T A;  2D0Q B;  2B8A A;  2EQU A;  4C92 C;  3VU3 C;  3JB9 F;  2YLB A;  3R6O A;  3M4Y A;  2XK0 A;  3RKW A;  4MML A;  1BI1 A;  3LX7 A;  3TU4 K;  4F7U F;  3G6E T;  4OF1 A;  1D3B B;  2DAQ A;  1WQ7 A;  1Q82 U;  3MEV A;  2JTM A;  3X26 B;  3CCQ A;  4M7A A;  4M77 E;  4ZGD B;  4F7U B;  3QUI A;  1M1G A;  2PQW A;  3P8D A;  5GAN e;  2EIF A;  4PJO C;  5C6S A;  2CYZ B;  3CXC S;  1X75 C;  3LYI A;  3CCE T;  4FM4 B;  1VQ9 T;  2P4T A;  2CS7 A;  2FVU A;  4C0D C;  2DZC A;  3RKX A;  3CCM T;  2ZGW A;  3OYH A;  2K5L A;  2Y4X A;  2C06 A;  2DPP B;  4JDS A;  1Q86 U;  4BI4 A;  2PVO B;  5LJ3 e;  1KG1 A;  1H64 1;  2L5Q A;  1VQP T;  3EAE A;  3QDR B;  3QBY A;  2KK4 A;  3CPF A;  4M78 B;  4M78 G;  1VQO T;  1VIE A;  2RHX A;  3HFO A;  2HQE A;  4L5G A;  4LDU A;  4N0A C;  5GAM d;  2DVE A;  2LTO A;  3CEY A;  3LLR A;  3QZ5 B;  4FT2 A;  1VQ4 T;  3GPL A;  3OYL A;  4XAX B;  4M7D A;  5LJ5 h;  3ZBD A;  5I2S A;  1YI2 T;  1BI2 A;  1M90 U;  4RG8 A;  3SD4 A;  5CK9 A;  3OYE A;  3GOX A;  1M5Q 1;  5CAI A;  3CCQ T;  5GAN 2;  1D3B A;  2PUK B;  4M77 G;  4M7A D;  2OTL A;  1QVG A;  2R57 A;  5FU6 C;  3JCM f;  3JCM W;  1JJ2 A;  5LJ3 h;  3C95 A;  3T9N A;  2FB7 A;  1VQN T;  3NFC A;  2DKG A;  4C0G A;  1B34 B;  2RHZ A;  3CBP A;  4JLG A;  3VV0 A;  1EIF A;  4PJO G;  5CKB A;  2PVD B;  3V7R A;  1NPR A;  2PUO B;  2EWN A;  2V8K A;  1VQL A;  3FC3 A;  4BI3 A;  3VYG A;  2RK1 A;  4XU3 A;  1M1K U;  2LCC A;  1N8R C;  3HPW A;  2CZ0 B;  2V8I A;  3QYH B;  5LJ3 j;  2JZ2 A;  2DZ9 A;  3URG A;  2MI6 A;  4BB7 A;  3M54 A;  3BDL A;  1Y96 A;  2QDY B;  2WAC A;  4C92 E;  1NZ9 A;  4IKF A;  2OAU A;  3CCJ T;  1VQ9 A;  1W2B S;  4X9C A;  4M7D D;  4ME7 A;  4A53 A;  2K3Y A;  1VQ6 A;  1K9M C;  3OYB A;  3PIP A;  3CCS A;  3KBG A;  4R56 A;  2IVW A;  3JB9 H;  1U1S A;  2RJF A;  4FU6 A;  5GAO n;  3OA6 A;  4M75 G;  4ZN1 A;  1IRE B;  1S72 A;  4OB3 B;  2ZPI B;  1W2B A;  2XD0 A;  3M5A A;  3ZFJ A;  2K5F A;  2K5I A;  3QO3 A;  3NTH A;  1YIT A;  1NPP A;  3CCL A;  2E12 A;  4MZM A;  4HCC A;  2LX9 A;  4C8Q B;  2DXT A;  2ZPH B;  2K4Y A;  2MWO A;  3WXM B;  5IN1 A;  2VXE A;  2QTX A;  2GCX A;  3HKS A;  4J7F A;  1UGR B;  4JRI A;  5GAM j;  3JAM E;  3G6E A;  2EAY A;  4C8Q E;  1VQ5 A;  1UEB A;  5GMK m;  4M78 E;  3MP6 A;  1OYX A;  3CCV A;  2VGM A;  4TVR A;  4EMK B;  1LJO A;  3OW2 S;  3CCR T;  2QA4 T;  3DKM A;  1JB0 E;  3NTK A;  2G3R A;  1WGS A;  2E65 A;  4JRP A;  1H3Z A;  3M59 A;  3HRT A;  2WSE E;  4M78 D;  4Y28 E;  1WQW A;  1Q86 C;  1I8F A;  3BY7 A;  3UWN A;  4BI8 B;  2PVG B;  2CGH A;  4N4I A;  5KE3 A;  1NE8 A;  4HKE A;  2VXF A;  1KQS A;  2D6F A;  2Y4Y A;  4DA4 A;  4JLI A;  3M53 A;  2OTL T;  4ZGJ B;  3HFN A;  2QQS A;  3I55 T;  1ZQ1 A;  4CRI A;  4M7D F;  1VQ6 T;  3L2V A;  1B34 A;  4M7A G;  4R55 A;  1MHN A;  5DM7 R;  5DLO A;  5CCA A;  2YRV A;  1VQ7 T;  3HP9 A;  2XU8 A;  4C92 B;  3O8V A;  4A4K A;  4DQ2 A;  5A0D A;  2VC8 A;  1G3Y A;  3MCA B;  4N4G A;  4MMK A;  5GAN j;  3CBM A;  3F70 A;  3VYH B;  4HT8 A;  4PJO D;  4NOY A;  1Y07 A;  5I2M A;  2CKK A;  2E41 A;  2K3X A;  5GAM f;  3VUB A;  3EFS A;  4C5H A;  4HT9 A;  1Y7X A;  1M8V A;  1G5V A;  1KHI A;  4PJO E;  3PT9 A;  1VQK A;  4A4F A;  2X4Y A;  1YIJ T;  2DD5 A;  3V8J A;  4F7U E;  4M75 C;  4M78 A;  2KQW A;  3RMS A;  4XU2 A;  3FRN A;  3CME A;  2GQV A;  4BD3 A;  4BDZ A;  3CCU A;  2QQ9 A;  4KT0 E;  4M7D G;  1PSE A;  4Z02 A;  3CC7 T;  3CD6 T;  4O5V A;  3JB9 I;  3A5Z B;  3P8H A;  5CKF A;  4ZTJ A;  3LH0 A;  4LD9 K;  1FX7 A;  1YHQ T;  4M75 D;  3P8B B;  4M77 A;  3M56 A;  2DIQ A;  4ELZ C;  1GXI E;  2VUB A;  3S6W A;  3JCM Q;  3OYJ A;  1BIB A;  3ASK A;  4BDY A;  3CXC A;  4ZN3 A;  1YJW A;  2HD0 A;  4JUV A;  1VIF A;  2LT1 A;  3H8Z A;  4PKC C;  2M16 A;  1WJS A;  3QKJ A;  5HKC A;  5CR2 A;  2CZ6 B;  2DTO A;  4HCZ A;  1MGQ A;  3G71 T;  3OW2 A;  5CVI A;  3VUZ A;  5GAO p;  1VQM A;  3ME9 A;  3RMQ A;  2IG0 A;  3QPH A;  2BKD N;  1N27 A;  3TRE A;  5HK3 A;  2ZCF B;  4IUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...