2KMTA

Nmr solution structure of vibrio fischeri ccdb
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
105
structure length
105
Chain Sequence
MSQFTLYKNKDKSSAKTYPYFVDVQSDLLDNLNTRLVIPLTPIELLDKKAPSHLCPTIHIDEGDFIMLTQQMTSVPVKILSEPVNELSTFRNEIIAAIDFLITGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords CcdB
publication title Structural and Thermodynamic Characterization of Vibrio fischeri CcdB.
pubmed doi rcsb
source organism Vibrio fischeri
total genus 16
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2kmtA00
2MF2A 4ELYC 5CKFA 2C06A 3HPWA 5HKCA 3JSCA 1NE8A 4HKEA 1M1FA 5CK9A 3NFCA 5DLOA 4OF1A 5CR2A 4MZMA 3G7ZA 3JRZA 3VUBA 5CQYA 5CQXA 5HK0A 4ME7A 2VUBA 5CKDA 4MDXA 1UB4A 2KMTA 5CKEA 5HK3A 1X75C 4MZTA 4ELZC 5CKHA 3TCJA 1VUBA 4MZPA 5CKBA 5CCAA 5CO7A 4VUBA
chains in the Genus database with same CATH superfamily
4JJCA 4RKUE 1VQ6A 4JRPA 2O88A 4ATOA 3MP8A 3OA6A 2LQNA 4M75B 4M7DE 2QYZA 1WGSA 2KI7A 2DRMA 3V7CA 3H41A 5IHNA 3LWIA 4DBQA 1BB9A 2RHXA 2EQMA 2CZ7B 2L3RA 2VV5A 4BB7A 4NL2A 2QDLA 4J6YA 1Y96B 5A0DA 5GAOm 2MIOA 1IREB 1JXOA 4HCKA 1JEGA 4J9DA 4JRIA 1D0XA 2E5KA 3CCVA 3KFVA 3OMGA 4J9FA 5GAOr 2VYTA 1D1AA 3PVLA 2DZCA 3G4ST 1RI9A 4FU6A 2H3JA 1K9MU 2M9UA 5HCKA 3ZBDA 4M77B 3JCMc 3CCEQ 2YXYA 2VB6A 2BE9B 4J6XA 3G7ZA 2ROLA 4EPCA 4OMQA 3G71A 4E7LA 4D6WA 4BE2A 4BUGA 1UFFA 3OYIA 2PQWA 3BE3A 1YFNA 1Q95G 4M7DC 3GF5A 4CI0C 2ZAEA 3E9FA 5CIUA 5IT9E 1D0YA 1K9MR 2F2WA 4M7DF 4PJOA 3HSBA 1W2BP 1B7TA 3EGDA 1UB4A 2RHUA 4E6RA 4QQDA 1UGQB 3LW5E 5L23A 1Q7YC 8ATCB 3LGLA 1X2KA 1NLOC 3BW1A 4FW2A 4FSSA 2RQWA 2LQKA 1GBQA 1JBMA 1AHJB 4HVVA 2JW4A 3QSUA 4KT0E 2FVUA 4O6JA 3CCJA 3M54A 3OSSC 2E12A 2RH2A 3OYEA 4KBMB 2MK5A 1TUDA 1M5Q1 1PKTA 2GBQA 4ORZA 2KE9A 4PFPA 2D1XA 2MWPA 3OW2S 4LDYA 1F1BB 1QVGP 4C92E 5KYYB 3LGFA 1K8AC 1BI0A 4E7KA 3CPWP 3SB2A 2DMOA 2OTLA 9ATCB 2O9SA 2QDYB 2P4TA 2JS0A 4DBFA 3VV0A 5CO7A 2O4XB 3CXCP 3RBBB 4DQ2A 1JJ2P 2KRMA 3CCRQ 2OAWA 1M8MA 2RF0A 3MKDA 3TREA 5GAMg 3NGPA 2HNIA 3UT1A 2RB6A 2E5QA 4M77E 4JJNK 3MEUA 4KGXB 4E2FB 2SEMA 2K2VA 2EBPA 5I2MA 1VQNQ 3OYKA 4KUIA 4DBHA 1IGQA 2EJGA 3BY7A 1YITQ 4Y28E 2QQAA 1M1FA 1RABB 1K9AA 4EMHA 2X4JA 5CR2A 1UHFA 2ZPIB 3CC4T 1V29B 3OSVA 4OMMA 1QCOA 2FZGB 2CSIA 2E10A 4Z89A 4Y91A 2D0NA 2DJQA 1PCXA 2E4HA 1QVFA 1WNLA 1BU1A 2AZSA 4M75F 3EG2A 2EYQA 4C92C 2CP6A 3I35A 4XK8E 1KD1C 2QEXT 4J9CA 2EPDA 3L2RA 4XU0A 1EIFA 4X9DA 4F16A 2EQKA 4FIBA 4HCCA 1U1SA 3VUBA 3EH2A 1K73C 4BDYA 3CMAT 2GFUA 2XMFA 4OB0B 2K6DA 2DXTA 4EMKC 3OYGA 2RNAA 1W6XA 2DA9A 1VUBA 3CCLT 1Q86U 4OVAA 1DJ7B 2ZPEB 1UGPB 1Y0MA 3T9NA 1BIBA 1UTIA 1OULA 4ZGDB 2EW3A 1FMWA 3PT9A 4R0KA 2CT3A 4M77F 2RN8A 2PVDB 5HK3A 1AWWA 3QZ9B 1YI2Q 4ZGEB 2JTEA 3UPUA 5GAOp 3MPUB 2EYYA 1W70A 4Z88A 3DLLA 1VQPQ 5KE3A 1FMVA 4M78D 2R5MA 1VQOA 1MMDA 4N4HA 3OYLA 1Q86R 1N9RA 1Q82R 5LJ5f 3MEAA 4RG8A 3O5ZA 4OMPA 2AIRB 2EKOA 4DA4A 1KD1U 2QQ9A 3CMET 1YJ9Q 1R0CB 2YRVA 3QHSA 2MAMA 4WTOB 1VQKT 2LNHB 4KRTA 4D8DA 4PJOB 2BTTA 3NFCA 4JRQA 2M1HA 3EGDB 3M53A 3NTIA 3HRUA 1J3TA 4IUUA 3H0FA 1H92A 3V8LA 1NPPA 4MZTA 2V8JA 1TUGB 1YCSB 2HDAA 2W10A 2ZPBB 4XTYA 3RKXA 3CCVQ 2QTXA 3G4SA 2DVEA 4ZGJB 3GOXA 1WQWA 1OQKA 1N27A 3RNJA 3WVEB 1RAIB 3JRZA 5D6XA 2DX1A 2VGMA 1RAAB 2YUOA 1Q81C 2L89A 1NJIR 4B9WA 4E7JA 4PJNA 1YHQA 1IRXA 1VYUA 3OW2A 2JMAA 2RA2A 4TVRA 3G71Q 1ZHIA 4A54A 1QCFA 4M7DD 5HY6A 2OTJT 2DAQA 3L1AA 3I5SA 4ME7A 4BI3A 3NTHA 3BDLA 3N5BB 1HXDA 1BBZA 2KDSA 5GAN2 2P0QA 2JXBA 1S72T 4C92A 4IUVA 3NTKA 3JCMV 1LPLA 3SEMA 1V76A 2LCLA 4XTZA 8AT1B 4RTUA 1TWBA 1WJRA 4RTWA 4AMCA 1XQHA 1WFWA 2KXDA 2LTOA 5J26A 4OMFB 4EMKA 2B86A 4OMOA 2HSEB 1B34A 2CUDA 5CKFA 2KY9A 4NL3A 3CCJQ 3AHUA 2QK0A 2HQXA 1I81A 4F04B 1QWFA 3TSWA 2LDMA 5KH6A 3GIBA 2VVKA 2DNUA 1QVFS 5I11A 3PVQA 4WF2A 4IUPA 1M90R 3VS7A 2LJ3A 1ZSGA 1TXQA 5M9OA 1KHCA 5GAN4 3S3MA 1NPRA 2OTLQ 4PNOA 2HEQA 4A4EA 2SRCA 2COWA 2YSQA 1VQMT 5J39A 2DERA 4X1VA 2FHDA 4FYYB 2CP5A 4M7DB 2NUTA 3M5AA 3VU3C 3I55T 1GFCA 1QWEA 1N5ZA 4F7UG 1MNEA 4KULA 1TU0B 4M78G 3A1PA 3A8LB 1WA7A 1VQ4Q 3KBGA 4DEYA 2I0NA 4PJMA 5IHKA 2FZCB 3QPHA 4RTTA 4M75D 2JZ2A 3ASKA 3CC4A 3CC2T 2BKDN 4JDSA 1D3BA 2F2XA 3PE0A 1KC8R 4RCCA 2YUPA 2ATCB 3JSCA 3M56A 2HD0A 5GMKi 2HAXA 1ARKA 4PL6A 3KXTA 1NZ9A 4MZMA 1NYFA 3M0UA 1VQ8T 4GY5A 4LDVA 3QO3A 1M1KR 4KH1B 3R6NA 2QEXA 3C94A 2J6FA 2X4XA 3JCMP 2RHZA 3EFRA 3CMAA 1FYNA 3MP6A 3R6OA 2FRWA 1QVPA 4X34A 3RUXA 2DIQA 2Z0WA 2NUPA 3CCLA 1RAGB 1X27A 4M77D 4FT2A 2JTMA 2FEIA 3QJYA 2DK3A 1MUZA 4A53A 2DBKA 5I2SA 3GNFB 1BKBA 4PKCC 2OX7A 2DIGA 1PHTA 1CKAA 2L3PA 2D9TA 3VYHB 2YDLA 3VS3A 1K9MC 4QQGA 4J9IA 2A3LA 4MMLA 3CCMT 4IURA 5LL6S 4HT9A 4FSXA 4RCBA 4IUTA 4OF1A 3OYMA 2J05A 1D1CA 3JB9G 1BI1A 4QVZA 1YNZA 2FPFA 2VWFA 3MP1A 2EWNA 2NWMA 4LXCA 4C8QE 1C6VX 2CT4A 1BK2A 2CP0A 4E7SA 1VQOQ 2DL7A 4AFSC 4ELYC 4HA8A 1NE8A 1V1CA 1Y71A 1ZLMA 1QVGS 4HCZA 2E3HA 4J9GA 1WHMA 4JS5A 2RJDA 2DXCA 4D8KA 3CMEA 2NYSA 1GRIA 1YWOA 1H8KA 2QI2A 1VQKA 2XIDA 5DM7R 1X75C 3QBYA 1KQSP 7AT1B 4C92B 1X6GA 2J7IA 3OS2A 2DBMA 2XHCA 2K5FA 1K76A 1AWOA 1JJ2S 3URGA 1YIJT 5ECAA 2C0OA 1WQ7A 2EFIA 2CYZB 3M4GA 4J5YA 1IO6A 1SSFA 2CH4W 4EMKB 3JV3A 3G4SQ 1B34B 2DPPB 4M7AG 3JCMW 4DEXA 3OYBA 4C5GA 1MNDA 2J6KA 2RQVA 3E2UA 2GCXA 1ZX6A 2BUDA 4A4FA 3OYCA 4XQ3A 2PVOB 2FL7A 2XG8D 1QCNA 3H9NA 2K3YA 3M0PA 4A4HA 1YHQQ 1AZEA 4NOYA 4C8QC 5LJ5g 2LMJA 2X3WD 3VS6A 1WHJA 2LRQA 2P4RA 3CC7T 3HTRA 2K79A 4YTLA 1GBRA 4AG1C 2OTJA 2CZ0B 3HHTB 2EJ9A 5LJ3e 4C8QF 2AT1B 2HCKA 2JS2A 1IHVA 2K3BA 3QDRB 2L5QA 4JLIA 4HCBA 4J6WA 2AKLA 4AFZC 1TG0A 1G5VA 2NUTB 1WHKA 1S72A 4GLKA 3QZ5B 2LT1A 4QQ6A 4XTWA 4DBRA 2DYBA 2XKOC 3RR6A 4M75G 1AT1B 1KJWA 1WHLA 2FPDA 5FRNA 1RL2A 2A37A 5FLXE 2HBPA 3G1JA 1I07A 1ZBXA 3BFMA 3OQ5A 1U5SA 2XD0A 4CC4B 1D3BB 1WHHA 3BDUA 2LX9A 3G6EQ 2ZPGB 2AHJB 5GAN3 2QXFA 2DFUA 3KUFA 2E65A 2PVGB 1TSFA 2RQTA 2CSQA 2DTOA 2L3QA 1OV3A 2C0TA 3EGXA 4AT1B 1OZ2A 4L59A 2X35A 3A98A 1EX4A 4M77G 1VQ9T 1VYVA 2V1RA 2X4WA 5GMKj 2E41A 2RI2A 1K0SA 1CSKA 1VQ7T 1W1FA 5FWBA 1SPKA 4JUVA 2JJ9A 4E7IA 5AYFA 1X01A 2HZYA 4OMLA 5GANe 3QXEB 2HKQB 1VQMA 1Q86C 4E47A 4HVUA 1OU9A 3H8ZA 3M0QA 1PRMC 2MOXA 1Q82C 2KT8A 1W2BA 1U3OA 2XDPA 3I55A 2CP7A 4BE1A 3P8BB 2VC8A 3CCRT 2HSPA 3VJPA 3CBPA 1IGUA 2KYBA 2QA4T 1G3SA 1WXUA 3JCMh 3GP8A 3M55A 1X6BA 2KRNA 3CC2A 3E1SA 2WACA 3CC4Q 4OB2B 4IIMA 1WJSA 4GLMA 4PFOA 4XTVA 4PJOD 2DVJA 3JCMe 1VQ8A 1M3AA 5GJVB 4N4IA 3JAME 5GAN7 1YITT 2G6FX 2ENMA 1QVGA 1YJWA 3NMZC 3FDRA 1NJIC 2QEXQ 1G83A 4L6V5 1VQ5Q 4RUGA 3TVTA 1H641 2DRKA 2NUZA 3LWHA 3CMAQ 1NLPC 4C92F 4OB1B 2COZA 2CKKA 3M59A 4C8QA 3D7SB 2LC4A 5IXBA 5GAMj 3CXCA 1EZZB 1X43A 2MYSA 1G2BA 2BIVA 3CCLQ 1JJ2A 2M51A 4Y92A 1Q82U 3FIFA 1M9SA 1B07A 3TEEA 4LDXA 2GQVA 5KE2A 2CREA 2H8HA 4R56A 3P8HA 1BYMA 3CCMA 4ZNXA 3OYNA 3C95A 4P5NA 4MMKA 3CCQT 1K1ZA 3FLGA 5FWCA 2DKGA 1ZUUA 2M0OA 1ZUYA 4RTYA 2XDDA 4JZ4A 1RAFB 2DXBA 2PU9B 3RKYA 2DM1A 4HVWA 1KQ2A 5IN1A 3QWXX 3INZA 5CAIA 1AEYA 4FYXB 1WLPB 4JJBA 2LP5A 3OYDA 1VQ6Q 3H0HA 5CKBA 4UC4A 1ABQA 3UF4A 4VUBA 3A8HB 1AVZC 1NJIU 1VQLT 3CMEQ 2LQ8A 1WXTA 3JCMb 1VQKQ 1C1AA 3PIOA 2EGAA 2RPNA 4PJLA 3OYHA 3S6WA 2E64A 1OPKA 3MCAB 3GBQA 1YIJA 5CKEA 4J8OA 2DO3A 1BCMA 1YJ9T 3V8KA 3FJPA 4QT7A 2KSSA 3RKWA 2YRDA 2YLBA 1YP5A 3F70A 5GAN8 3SDZA 4A4KA 3HRSA 3TQ7P 1UG1A 4M7AA 1IB8A 1KSWA 5DY9A 2RHIA 2DL4A 2F5TX 2JNGA 4Z02A 3RMQA 3OBYA 4XTUA 1ZA1B 2RO0A 4DOVA 1WZOA 1WXBA 1MV3A 3OYAA 1TUCA 3PIPA 2A0FB 4C8QD 3LH5A 4DOWA 4LDUA 1Z9QA 5GMKh 3CCUT 3VRZA 1M30A 3UATA 3X26B 1RLPC 1GFDA 3EGXB 3MJXA 3CC7A 1RAEB 2H3EB 3V7RA 3CBOA 2ZZDA 3M57A 1AWXA 2RJCA 2QASA 5IXFA 1G3TA 1BI3A 3DB4A 1M8VA 3MHXA 2OTJQ 4FYVB 5GMKe 1N8RU 1KC8C 6AT1B 1K73R 1AOJA 5GANd 1G8XA 4LUDA 3OS5A 5FW9A 3A8MB 3VS2A 5KYXA 1RACB 2DL8A 3UA7A 2VXEA 3HRTA 2WSCE 1S72Q 1FXXA 3MEVA 1SKUB 1M90U 2IG0A 2X51A 1G3WA 4EDUA 3FRNA 1OOTA 1M3BA 4PJOG 2DL3A 2JN0A 4JPBW 1UGRB 3L2UA 2DE0X 1GCQA 2I2LA 4JS4A 1N8RR 1XJWB 3UDCA 2ECZA 3J81E 4BI8B 2DTIA 2EQJA 2YUQA 3JB9J 3Q1JA 3CCST 2M0YA 5C6SA 3JCMd 2BE7D 2QGFB 4J83A 1KG1A 1SRMA 1TH7A 1RUWA 1MGQA 2COYA 3CCJT 1HK9A 4ZN1A 1JQQA 2LJ0A 1VQ9A 3L2QA 3OYFA 2E6NA 5HKCA 5KYUA 2RI5A 5LJ3j 2FYKA 5GAMh 1Y57A 1VQ7A 5CK9A 4XTXA 1OEBA 2MI6A 2LX7A 3QYHB 1QKWA 4C8QB 3LLRA 1TS9A 1KC8U 2VUBA 2R58A 5L8RE 3L2ZA 1I5LA 1OZ3A 2M16A 1UDLA 2ROTA 1VQMQ 5GAMe 1XOVA 4PLLA 1KQSS 3OB9A 3HL8A 2OTLT 5AT1B 1M1KU 2DZ9A 1IXDA 2JM8A 1YJNT 1XNIA 2DLPA 2RQRA 2DEQA 3I55Q 2LVMA 2KXCA 2O2OA 3RESA 2XK0A 2MCNA 3OY9A 5GMKl 2WSFE 2CDTA 2QA4A 2LCCA 2A7YA 1VYTA 1UEBA 5KYWA 1I4K1 3PTAA 2X4YA 3CQTA 3UWNA 3CC2Q 4RTVA 2RJFA 1PG5B 2F5KA 3EG0A 4HKEA 1VIEA 4J9HA 1OPLA 2YT6A 3ER0A 4LUEA 1ZSZC 1VQ4T 4PFZA 4K11A 2XI9A 3GLXA 4XU1A 4C92D 2FRYA 2FPEA 4NS5A 3TSZA 4BDZA 1U8RA 1YJWQ 4BACA 2VXFA 2PUKB 4F7UE 1IZ6A 3M9QA 2ZPFB 1QP3A 4M78E 5GANj 3QYGB 4JLGA 2GGRA 1Z9ZA 1FX7A 5KYNA 1NYGA 3ME9A 4OGCA 5CQYA 2CUBA 1WIEA 4B9XA 1K0XA 5GAOn 3EHQA 1W2BS 1PM3A 3VUZA 2EQIA 1SF9A 2YWWA 1UGSB 1JB0E 1O9SA 2K9GA 2K5LA 5GAOq 1QLYA 1SHFA 5GAN6 3CEYA 3EG9A 1UJ0A 3CCQA 3CCMQ 2FZKB 4X9CA 1D09B 5DLQE 2JM9A 3V8JA 3VKIA 2GF7A 4QVDA 4J9BA 3I56T 4M7DG 1WYXA 2KYMA 3X28B 1N9SA 2LQWA 3OMCA 1HYOA 2IIMA 2P84A 2D6FA 4Q5WA 3P8DA 4BI4A 3PGGA 1X6OA 4A63B 4O5VA 1SHGA 3A8OB 1E7OA 3M4YA 3X20B 3H0IA 2O01E 4RTXA 4FW1A 2CH4A 3CPWS 2KGTA 3S3OA 1VQLA 2A36A 1PSEA 2KMTA 1Y07A 2JTFA 1JO8A 1LJOA 3HKSA 3CD6T 1WPYA 2JT4A 2EVRA 3LH0A 4M78C 3RDVA 2ZGWA 2A28A 2FO0A 3PMTA 3CXCS 2CGHA 4F7UF 1YJ9A 1KK7A 1YIJQ 1UHCA 3META 4M78F 1GXIE 3SWNA 4R55A 1M2VA 3DKMA 2YRCA 5LJ3f 4ZTFA 4BY6C 1ZBJA 3EFSA 2JOYA 2Y4YA 3JCMX 4RG2A 2L2PA 1LOJA 1P92A 5FU7B 2MMPA 5D7UA 2C0IA 4ESRA 2E1HA 3QKJA 2KEAA 4ZN3A 1T3LA 5IH2A 1JRIA 2IVWA 4QVCA 4OGEA 3FEOA 3CCUA 2EIFA 5LJ3h 1T0HA 2BZXA 3CPFA 5KYUB 3CCET 3CC7Q 1BCOA 1PWTA 3PFSA 2MF2A 1UUEA 4IUQA 4EIKA 4CC7A 2GFAA 4C5EA 1YHQT 2KRSA 2V26A 4M7AE 1WHGA 2XICA 5GAMd 3WVDB 1ZSZA 5FU6B 4RMOA 1KQSA 1MMNA 1I5OB 2D8JA 2LCSA 4BE0A 4KH0B 2RMOA 4OP0A 1Y7XA 3ZL7C 4C0DC 1X2QA 2K57A 2RQUA 2YLCA 1A0NB 1TTHB 2EYZA 2PZ1A 5HK0A 5KYWB 2DYIA 3VRYA 4C92G 5GANf 3JB9F 4AG2C 1MHNA 2HL3A 4FCYA 3QWYA 2JVVA 3CCSA 2KROA 1UE9A 2VKNA 1KFZA 4EMGA 2EKHA 5LJ5j 3HFNA 2EJFA 4AFQC 1RAHB 2HQHA 2K5IA 2AKKA 3ZEHA 4FM4B 5GANh 2CP3A 4M75E 1SEMA 2IPOB 3JB9I 3G6ET 1VQ9Q 1KHIA 1S1NA 4HT8A 1QVFP 2KT1A 1VQ7Q 3JCMJ 3A8GB 2NUPB 1OYXA 1QKXA 1RI0A 2E70A 1W4SA 3PNWC 4M7AC 3OYJA 4Z8AA 3OS0A 2Y90A 1WDXA 4IKFA 3JCMf 2DL5A 1U1TA 1ABOA 3LYIA 1YJNA 1NEGA 2LZ6B 3TU4K 4M7AF 2LT4A 4KGVB 3GPLA 3EG9B 4F7UA 1JU5C 3MEWA 4M78A 3QDFA 5C0MA 1LCKA 1HSQA 3A5ZB 5DLOA 2QA4Q 1NG2A 3EH1A 3IQLA 1AZGB 1TOVA 2ESWA 3OBWA 1Q7YU 1WJQA 5GMKm 3I5RA 1VQNT 3DB3A 1ACMB 2DJZA 1VQ4A 5A2QE 2HQEA 4C0GA 2QQSA 3HPWA 4C0FA 2RI3A 3VS0A 2A08A 5A0LA 4M75C 2V1QA 3CPWA 4M4ZA 5KCOA 3OS1A 2ZCFB 1I8FA 2K3XA 1G3YA 4BD3A 1HJDA 3L2VA 2FB7A 1YN8A 1R8OB 1OI1A 2RHYA 1GCQC 3ULRB 1K8AU 4CC3A 3SWNB 1VQ5T 4CRIA 1M2VB 1Q7YR 5FU7C 2GTOA 2Y4XA 4J7FA 4OMNA 2KBTA 3C0CA 2YUNA 3QJ6A 2KK4A 2MWOA 1MV0B 2KNBB 3C12A 1FMKA 4F14A 1LVKA 1E6HA 3CCQQ 4E7HA 3ZFJA 2X9HA 4LDWA 3I56A 4M77C 3J80E 4M7DA 2R57A 3DLMA 4ANJA 2EYWA 2O31A 1JXMA 4L5GA 3GNGA 4MDXA 1K8AR 2CZ6B 3CBMA 1YI2T 2HMAA 4E7ZA 2RK2A 3M0SA 1KIKA 1AD5A 2B8AA 5LJ3d 3MO8A 3VS4A 5FU6C 1N8RC 2J6OA 1WI7A 1VQPT 1D1BA 4AFUC 5I22A 4J9EA 3OW2P 3CD6A 1B3QA 1IHWA 1VQLQ 1ZSZB 4A4GA 3JCMQ 2E6ZA 2OI3A 2QAZA 3L42A 3WXMB 4RTZA 1VQ6T 5GAOl 2QTVA 1I0CA 2AK5A 1M90C 4N0AC 3REBB 4LD6A 1PRLC 2VGNA 3RERA 1YWPA 3M58A 1T3SA 4ZTJA 2KQWA 2PUOB 2EAYA 1OX8A 1K73U 2GQIA 3V7SA 3O8VA 2D0QB 5LJ5h 2KVQG 1UGVA 2AZVA 1BI2A 3EFOA 1M1GA 1H3HA 1RADB 2L3SA 4MDWA 3CCVT 2W0ZA 5IAYA 3EG3A 4PK4A 3NHNA 2K2MA 3EGUA 2C06A 5LJ5e 3CCUQ 2M02A 1M2OA 3REAB 3CCEA 3L2WA 1R77A 5EC7A 2PNIA 2O9VA 1KD1R 1MMGA 4FL6A 2FG0A 5GJWB 1D0ZA 3RIRA 1QP2A 2KAFA 5CKHA 2DETA 2EQUA 4KGZB 1SRLA 2ED0A 1VIFA 2HKNA 4II1A 1M3CA 3G71T 3SD4A 5A0GA 4GBQA 1N6AA 4N4GA 1M1KC 3VS1A 2V8KA 3M0RA 3JB9D 3PMIA 4QKUA 1UJYA 4F7UB 5LJ3g 2MPXC 4M75A 5CKDA 1QMCA 1E6GA 4M78B 2L8DA 3QIIA 1QQJA 2GTJA 1XTDA 1PD0A 4PJJA 1UECA 1Y96A 2PTKA 5D6YA 4OB3B 3X24B 2E3IA 2F1LA 1PSFA 5GAMf 2K7AA 2OAUA 2YHTA 2OJ2A 2RD1A 3VYGA 2F2VA 4B6MA 2DTHA 4BY6B 3CCSQ 3AT1B 2KR3A 2BZ8A 4JZ3A 2QQBA 2X3XD 4C5IA 3E9GA 3FB9A 4QW2A 3RMSA 5GAN5 1EFNA 4CC2A 3H6ZA 1T0JA 2BZYA 3G6EA 4LE9A 4M77A 4PLIA 4JJDA 1Q81U 3SWNC 3OYYA 4JRKA 3U23A 1ZQ1A 1BIAA 3FJ5A 4M7AD 1R0BG 4PJOE 1NBEB 1NEBA 4V2SA 4XU2A 1CKBA 4ELZC 3SFMA 2GNCA 3FC3A 2CZ1B 1M4ZA 4LNPA 4LN2A 2QGGA 1C0MA 1MMAA 2VASA 2ZPHB 1OU8A 2P0KA 1YJNQ 2DEUA 1FWZA 1U06A 3C4SA 3CCRA 5GANg 5J3BA 2EYXA 1VA7A 2P0PA 2XDBA 2XU8A 2NLUA 3E19A 3S3NA 4KUDK 4C5HA 4N0AA 1Q81R 3SHWA 2LJ1A 2RJEA 5FROA 2QQRA 5FRMA 1LNXA 4C0DB 2WSEE 3I9QA 5EG2A 1OX9A 3X25B 3EAEA 4HXJA 1KQ1A 1VQNA 2F69A 5CQXA 1YITA 2HL5C 3UA6A 2RM4A 3EG1A 4XU3A 3NPFA 3THKA 1VQ8Q 2ED1A 5CVIA 2CP2A 4IIOA 1RLQC 1PKSA 3QUIA 4FYWB 3J7AF 5KCHA 1YCYA 2D8HA 2RK1A 3JCMg 4C0ZA 4PJOC 2J06A 3JB9H 1AWJA 2EGCA 2HBWA 3M0TA 1PC0A 1VQ5A 5KYYA 1YJWT 4F17A 1GCPA 5CCAA 4PJOF 1GL5A 2DF6A 3QG1A 1ZA2B 2JUFA 2QG9B 3HFOA 1X69A 4M7AB 1H3ZA 2DD5A 4C8QG 3EHRA 2O4XA 2K4YA 2V8IA 2DILA 4WCIA 3EFOB 1K4US 1O75A 1M27C 2R5AA 1YBYA 2JMCA 2DXUA 3I56Q 4FT4A 1PNJA 3TCJA 2DD4A 1ZUKA 5LJ5d 1SG5A 2CS7A 2LNVA 1NM7A 3LX7A 1PD1A 1YI2A 4J7IA 3VS5A 2EGEA 1HD3A 5IHIA 1WX6A 1VQPA 5D6WA 2G3RA 1VOMA 5I21A 1I1JA 1SSHA 2ABLA 2L0AA 1QW1A 4MZPA 4LD9K 5KYXB 1VQOT 3CD6Q 4XAXB 3HP9A
chains in the Genus database with same CATH topology
1OYXA 4RKUE 1VQ6A 1RI0A 3A8HB 2E70A 4JRPA 4ATOA 1NJIU 1VQLT 5M9OA 1KHCA 1W4SA 3MP8A 3PNWC 5GAN4 3S3MA 2LQ8A 4M7AC 1NPRA 3OYJA 3OA6A 4M75B 3OS0A 4M7DE 1WGSA 3JCMb 2Y90A 4PNOA 4IKFA 3JCMf 1U1TA 3PIOA 4A4EA 3V7CA 3LYIA 3OYHA 3S6WA 2E64A 3LWIA 3MCAB 1YJNA 2RHXA 1VQMT 2EQMA 1YIJA 5J39A 3TU4K 2CZ7B 2L3RA 2VV5A 2DO3A 2LT4A 4J8OA 4NL2A 5CKEA 4BB7A 2FHDA 4M7AF 4J6YA 5A0DA 1Y96B 3V8KA 3FJPA 3RKWA 2KSSA 5GAOm 3GPLA 4F7UA 1YJ9T 4M7DB 2YLBA 1IREB 3MEWA 3M5AA 3F70A 4M78A 3VU3C 5GAN8 3SDZA 3I55T 4A4KA 5C0MA 3A5ZB 4JRIA 3HRSA 4F7UG 3CCVA 5DLOA 4M7AA 3OMGA 5GAOr 2VYTA 4KULA 5DY9A 4M78G 2RHIA 2F5TX 2DZCA 3G4ST 3A8LB 2JNGA 4Z02A 3KBGA 3OBWA 3OBYA 4XTUA 3RMQA 1Q7YU 4FU6A 2H3JA 1WJQA 2RO0A 4DOVA 1K9MU 2M9UA 3QPHA 5GMKm 4M75D 2JZ2A 3ASKA 3CC4A 1VQNT 3OYAA 3DB3A 2DJZA 3ZBDA 1VQ4A 3CC2T 2BKDN 3PIPA 4JDSA 1D3BA 4M77B 4C8QD 5A2QE 2HQEA 3JCMc 4DOWA 4LDUA 5GMKh 3CCUT 4C0GA 2QQSA 4RCCA 3HPWA 3X26B 2RI3A 4C0FA 3JSCA 3M56A 2HD0A 5GMKi 3CC7A 2HAXA 4PL6A 3KXTA 3V7RA 4J6XA 3CBOA 1NZ9A 2ZZDA 3M57A 3G7ZA 4MZMA 4M75C 5A0LA 2RJCA 3CPWA 4EPCA 4GY5A 1VQ8T 4LDVA 1G3TA 5KCOA 3OS1A 1BI3A 2ZCFB 3DB4A 3QO3A 1M8VA 3G71A 4E7LA 1I8FA 2K3XA 3MHXA 4D6WA 2QEXA 4BE2A 5GMKe 3C94A 1N8RU 1G3YA 4BUGA 1KC8C 4BD3A 2X4XA 5GANd 3OYIA 3JCMP 2PQWA 2RHZA 3OS5A 3L2VA 2FB7A 3EFRA 3CMAA 1R8OB 3A8MB 1OI1A 2RHYA 4M7DC 3MP6A 3GF5A 3R6OA 4CI0C 1QVPA 3E9FA 4X34A 3RUXA 2DIQA 1K8AU 3SWNB 1VQ5T 4CRIA 5CIUA 5FU7C 5IT9E 2VXEA 3HRTA 2Y4XA 2WSCE 4J7FA 3CCLA 1FXXA 3MEVA 1M90U 4M77D 3QJ6A 4FT2A 2IG0A 1G3WA 2JTMA 4M7DF 4PJOA 3HSBA 2KK4A 4EDUA 3FRNA 3QJYA 2DK3A 1UB4A 4A53A 2MWOA 5I2SA 2RHUA 3GNFB 1BKBA 4PKCC 3C12A 2DIGA 4QQDA 1UGQB 3LW5E 1Q7YC 4E7HA 2D9TA 3LGLA 4PJOG 3VYHB 3ZFJA 4LDWA 2JN0A 1K9MC 4QQGA 3I56A 2A3LA 4M77C 4MMLA 3CCMT 3J80E 1UGRB 4IURA 3BW1A 5LL6S 3L2UA 4M7DA 4HT9A 2R57A 3DLMA 2LQKA 4FSXA 2I2LA 4IUTA 4RCBA 4JS4A 1JBMA 1AHJB 3UDCA 3J81E 4OF1A 4BI8B 3QSUA 2DTIA 2EQJA 2FVUA 4KT0E 4O6JA 3OYMA 3CCJA 3M54A 4L5GA 3Q1JA 3CCST 3JB9J 3OSSC 5C6SA 3GNGA 2E12A 3JCMd 2RH2A 3OYEA 4MDXA 4KBMB 3JB9G 1BI1A 4J83A 2CZ6B 4QVZA 1KG1A 3CBMA 1YI2T 1M5Q1 2RK2A 1TH7A 2B8AA 3MP1A 2EWNA 5LJ3d 4C8QE 3MO8A 1MGQA 5FU6C 3CCJT 1N8RC 1HK9A 4ZN1A 1VQPT 1VQ9A 4ELYC 3L2QA 3OYFA 2E6NA 5HKCA 2MWPA 2RI5A 4HA8A 1NE8A 5LJ3j 2FYKA 1Y71A 5GAMh 4LDYA 3OW2S 1VQ7A 5CK9A 3CD6A 4XTXA 1QVGS 4A4GA 4HCZA 2MI6A 4C92E 3LGFA 1K8AC 3JCMQ 4JS5A 2RJDA 2E6ZA 2DXCA 3QYHB 1BI0A 4E7KA 3L42A 3CMEA 3SB2A 3WXMB 4C8QB 3LLRA 1KC8U 2OTLA 1VQ6T 2VUBA 2R58A 2QI2A 5L8RE 5GAOl 3L2ZA 1M90C 1VQKA 2QDYB 2XIDA 1OZ3A 2P4TA 4N0AC 2M16A 5DM7R 1X75C 1I5LA 3QBYA 4LD6A 5GAMe 3VV0A 2VGNA 1XOVA 4PLLA 5CO7A 4C92B 1KQSS 3RERA 2O4XB 3OB9A 3OS2A 3HL8A 2XHCA 2K5FA 2OTLT 4DQ2A 3M58A 1M1KU 2DZ9A 4ZTJA 2KQWA 2PUOB 1JJ2S 2EAYA 1YJNT 3URGA 1XNIA 1YIJT 1K73U 2DEQA 3TREA 5GAMg 1WQ7A 2LVMA 2EFIA 3UT1A 2HNIA 3V7SA 2RB6A 2E5QA 4M77E 3RESA 2CYZB 2XK0A 3MEUA 4JJNK 3M4GA 4J5YA 3O8VA 1SSFA 3OY9A 2D0QB 5LJ5h 5GMKl 2KVQG 2WSFE 4EMKB 2QA4A 2LCCA 2A7YA 1BI2A 1B34B 1M1GA 2DPPB 4M7AG 1UEBA 3JCMW 4MDWA 2K2VA 5I2MA 3OYBA 3CCVT 4C5GA 1I4K1 5IAYA 3PTAA 2X4YA 3UWNA 3OYKA 4KUIA 2C06A 2RJFA 2EJGA 5LJ5e 2F5KA 2GCXA 3BY7A 4Y28E 2BUDA 4HKEA 2QQAA 1M1FA 4A4FA 3OYCA 4XQ3A 2X4JA 1VIEA 4EMHA 3CCEA 2PVOB 5CR2A 3L2WA 2ZPIB 3CC4T 3ER0A 2FL7A 1V29B 2XG8D 1VQ4T 4XU1A 4C92D 2K3YA 2XI9A 3GLXA 4A4HA 3OSVA 4NOYA 4C8QC 4NS5A 2E10A 5LJ5g 4FL6A 4Y91A 2LRQA 3RIRA 4BDZA 1U8RA 1QP2A 2KAFA 5CKHA 1WNLA 3CC7T 2EQUA 1QVFA 4YTLA 4BACA 2VXFA 2OTJA 1VIFA 2PUKB 2CZ0B 4M75F 4F7UE 2EYQA 4C92C 1IZ6A 3M9QA 4II1A 3HHTB 2ZPFB 2EJ9A 1QP3A 4C8QF 4XK8E 4M78E 3SD4A 3QYGB 5A0GA 5LJ3e 3G71T 2QEXT 4JLGA 5GANj 1KD1C 3L2RA 4XU0A 1N6AA 3QDRB 1FX7A 2L5QA 1EIFA 4N4GA 4X9DA 1M1KC 4JLIA 4HCBA 2EQKA 3ME9A 4FIBA 4HCCA 2V8KA 1U1SA 4OGCA 3PMIA 4J6WA 5CQYA 3VUBA 4BDYA 3JB9D 1K73C 3CMAT 2GFUA 4B9XA 4F7UB 4OB0B 4M75A 5CKDA 5LJ3g 1G5VA 1S72A 5GAOn 2DXTA 3QZ5B 4GLKA 4EMKC 3OYGA 3VUZA 1W2BS 2LT1A 4M78B 4QQ6A 4XTWA 2L8DA 1VUBA 3QIIA 2XKOC 3CCLT 1UGSB 1Q86U 1JB0E 1O9SA 1XTDA 2K5LA 4M75G 4OVAA 5GAOq 1DJ7B 2ZPEB 1UGPB 5FRNA 5GAN6 3CEYA 1RL2A 1Y96A 3T9NA 1BIBA 3CCQA 5FLXE 2HBPA 5D6YA 4X9CA 4OB3B 3X24B 4ZGDB 5DLQE 1PSFA 5GAMf 3V8JA 3VKIA 2GF7A 2OAUA 3PT9A 1ZBXA 2YHTA 4QVDA 3BFMA 3OQ5A 3I56T 2RD1A 4M7DG 3VYGA 2XD0A 4BY6B 2DTHA 1D3BB 3X28B 4M77F 1N9SA 2PVDB 5HK3A 3OMCA 3BDUA 3QZ9B 2D6FA 2LX9A 4Q5WA 2QQBA 3P8DA 4ZGEB 4BI4A 3E9GA 3FB9A 4QW2A 3PGGA 1X6OA 3RMSA 4C5IA 5GAN5 2ZPGB 2AHJB 5GAOp 5GAN3 3UPUA 2QXFA 3H6ZA 3KUFA 3DLLA 5KE3A 2E65A 2PVGB 3G6EA 3A8OB 4M77A 4O5VA 3M4YA 4M78D 4PLIA 3X20B 1Q81U 3SWNC 2DTOA 2R5MA 1VQOA 2O01E 3OYYA 4JRKA 1ZQ1A 4N4HA 3OYLA 1BIAA 5GMKj 4M7AD 3CPWS 1OZ2A 4L59A 1VQLA 2X35A 3S3OA 4M77G 1N9RA 1PSEA 1VQ9T 4PJOE 4V2SA 2KMTA 1Y07A 2X4WA 2E41A 2RI2A 2JTFA 4XU2A 1LJOA 3HKSA 3MEAA 4ELZC 3CD6T 1WPYA 1VQ7T 4RG8A 4JUVA 3LH0A 4M78C 3SFMA 4E7IA 3FC3A 2ZGWA 2EKOA 5AYFA 4DA4A 2CZ1B 1KD1U 2QQ9A 3CMET 1X01A 1M4ZA 2YRVA 3QHSA 5GANe 3PMTA 3QXEB 2MAMA 2CGHA 4E47A 3CXCS 1VQMA 1Q86C 1VQKT 4PJOB 3H8ZA 4F7UF 2ZPHB 3NFCA 1YJ9A 4JRQA 2P0KA 2M1HA 1Q82C 3M53A 3META 1FWZA 3C4SA 3HRUA 3NTIA 4M78F 1GXIE 4IUUA 3SWNA 4R55A 1W2BA 3CCRA 5GANg 2XDPA 5J3BA 3I55A 3DKMA 5LJ3f 3V8LA 4ZTFA 4BY6C 1NPPA 2P0PA 3EFSA 2V8JA 2JOYA 2Y4YA 4MZTA 4BE1A 2XU8A 2XDBA 2NLUA 3E19A 3S3NA 4KUDK 4C5HA 4N0AA 3JCMX 3P8BB 4RG2A 2RJEA 2ZPBB 4XTYA 5FROA 5LJ5f 2VC8A 2QQRA 3RKXA 1LOJA 3CCRT 2QTXA 1P92A 3G4SA 5FRMA 3VJPA 2DVEA 5FU7B 1LNXA 4C0DB 2MMPA 2WSEE 3CBPA 4ZGJB 3GOXA 1WQWA 2E1HA 1N27A 2QA4T 1G3SA 5EG2A 3QKJA 3JCMh 3GP8A 3X25B 3WVEB 3M55A 3EAEA 1VQNA 1KQ1A 3CC2A 4ZN3A 2F69A 3JRZA 1JRIA 2IVWA 5D6XA 3E1SA 5CQXA 2VGMA 4QVCA 2WACA 4OGEA 3FEOA 3CCUA 2L89A 1YITA 1Q81C 2EIFA 2RM4A 5LJ3h 4OB2B 4XU3A 4B9WA 4E7JA 1WJSA 4XTVA 4PJOD 3CPFA 5CVIA 1YHQA 3JCMe 3CCET 1VQ8A 4N4IA 3JAME 5GAN7 1YITT 3PFSA 2MF2A 3QUIA 3OW2A 4IUQA 3J7AF 1QVGA 1YJWA 2RA2A 5KCHA 4TVRA 1YCYA 2GFAA 2RK1A 3FDRA 1ZHIA 3JCMg 4A54A 4C5EA 1YHQT 1NJIC 4L6V5 4C0ZA 4M7DD 4PJOC 5HY6A 4M7AE 3JB9H 1H641 2DAQA 2XICA 2OTJT 5GAMd 3L1AA 4ME7A 3WVDB 3LWHA 4BI3A 4C92F 1VQ5A 1YJWT 4OB1B 3NTHA 3BDLA 3N5BB 1HXDA 2CKKA 3M59A 5FU6B 4RMOA 4C8QA 1KQSA 2LC4A 5CCAA 5GAMj 4PJOF 2KDSA 5GAN2 3CXCA 3QG1A 2JUFA 2P0QA 2BIVA 1JJ2A 4BE0A 3HFOA 4M7AB 1H3ZA 2DD5A 4OP0A 4C8QG 1Y7XA 3FIFA 1S72T 4C0DC 1Q82U 1M9SA 3TEEA 4IUVA 3NTKA 4C92A 4LDXA 2O4XA 2GQVA 2K57A 2YLCA 3JCMV 2K4YA 2V8IA 5KE2A 4R56A 5HK0A 2LCLA 3P8HA 1O75A 3CCMA 1BYMA 4XTZA 3OYNA 2R5AA 5GANf 4C92G 3JB9F 3C95A 4P5NA 1YBYA 4MMKA 1MHNA 1WJRA 2DXUA 4FT4A 3CCQT 1XQHA 3FLGA 2DD4A 2LTOA 5J26A 3TCJA 2DKGA 2JVVA 5LJ5d 4OMFB 4EMKA 3CCSA 2M0OA 2CS7A 1B34A 2XDDA 2LNVA 5CKFA 2KY9A 4EMGA 4NL3A 3LX7A 3AHUA 2DXBA 5LJ5j 1YI2A 3HFNA 4J7IA 2PU9B 3RKYA 2EJFA 2HQXA 1I81A 1KQ2A 5IN1A 2K5IA 1VQPA 5D6WA 3ZEHA 2G3RA 3INZA 4FM4B 5GANh 5CAIA 5I21A 2LDMA 5KH6A 3GIBA 4M75E 3JB9I 1QVFS 3G6ET 3OYDA 1KHIA 1QW1A 4MZPA 4UC4A 4WF2A 5CKBA 4LD9K 4HT8A 4IUPA 1VQOT 4XAXB 3HP9A 3JCMJ 4VUBA 3A8GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MF2 A;  4ELY C;  5CKF A;  2C06 A;  3HPW A;  5HKC A;  3JSC A;  1NE8 A;  4HKE A;  1M1F A;  5CK9 A;  3NFC A;  5DLO A;  4OF1 A;  5CR2 A;  4MZM A;  3G7Z A;  3JRZ A;  3VUB A;  5CQY A;  5CQX A;  5HK0 A;  4ME7 A;  2VUB A;  5CKD A;  4MDX A;  1UB4 A;  2KMT A;  5CKE A;  5HK3 A;  1X75 C;  4MZT A;  4ELZ C;  5CKH A;  3TCJ A;  1VUB A;  4MZP A;  5CKB A;  5CCA A;  5CO7 A;  4VUB A; 
#chains in the Genus database with same CATH topology
 4JJC A;  4RKU E;  1VQ6 A;  4JRP A;  2O88 A;  4ATO A;  3MP8 A;  3OA6 A;  2LQN A;  4M75 B;  4M7D E;  2QYZ A;  1WGS A;  2KI7 A;  2DRM A;  3V7C A;  3H41 A;  5IHN A;  3LWI A;  4DBQ A;  1BB9 A;  2RHX A;  2EQM A;  2CZ7 B;  2L3R A;  2VV5 A;  4BB7 A;  4NL2 A;  2QDL A;  4J6Y A;  1Y96 B;  5A0D A;  5GAO m;  2MIO A;  1IRE B;  1JXO A;  4HCK A;  1JEG A;  4J9D A;  4JRI A;  1D0X A;  2E5K A;  3CCV A;  3KFV A;  3OMG A;  4J9F A;  5GAO r;  2VYT A;  1D1A A;  3PVL A;  2DZC A;  3G4S T;  1RI9 A;  4FU6 A;  2H3J A;  1K9M U;  2M9U A;  5HCK A;  3ZBD A;  4M77 B;  3JCM c;  3CCE Q;  2YXY A;  2VB6 A;  2BE9 B;  4J6X A;  3G7Z A;  2ROL A;  4EPC A;  4OMQ A;  3G71 A;  4E7L A;  4D6W A;  4BE2 A;  4BUG A;  1UFF A;  3OYI A;  2PQW A;  3BE3 A;  1YFN A;  1Q95 G;  4M7D C;  3GF5 A;  4CI0 C;  2ZAE A;  3E9F A;  5CIU A;  5IT9 E;  1D0Y A;  1K9M R;  2F2W A;  4M7D F;  4PJO A;  3HSB A;  1W2B P;  1B7T A;  3EGD A;  1UB4 A;  2RHU A;  4E6R A;  4QQD A;  1UGQ B;  3LW5 E;  5L23 A;  1Q7Y C;  8ATC B;  3LGL A;  1X2K A;  1NLO C;  3BW1 A;  4FW2 A;  4FSS A;  2RQW A;  2LQK A;  1GBQ A;  1JBM A;  1AHJ B;  4HVV A;  2JW4 A;  3QSU A;  4KT0 E;  2FVU A;  4O6J A;  3CCJ A;  3M54 A;  3OSS C;  2E12 A;  2RH2 A;  3OYE A;  4KBM B;  2MK5 A;  1TUD A;  1M5Q 1;  1PKT A;  2GBQ A;  4ORZ A;  2KE9 A;  4PFP A;  2D1X A;  2MWP A;  3OW2 S;  4LDY A;  1F1B B;  1QVG P;  4C92 E;  5KYY B;  3LGF A;  1K8A C;  1BI0 A;  4E7K A;  3CPW P;  3SB2 A;  2DMO A;  2OTL A;  9ATC B;  2O9S A;  2QDY B;  2P4T A;  2JS0 A;  4DBF A;  3VV0 A;  5CO7 A;  2O4X B;  3CXC P;  3RBB B;  4DQ2 A;  1JJ2 P;  2KRM A;  3CCR Q;  2OAW A;  1M8M A;  2RF0 A;  3MKD A;  3TRE A;  5GAM g;  3NGP A;  2HNI A;  3UT1 A;  2RB6 A;  2E5Q A;  4M77 E;  4JJN K;  3MEU A;  4KGX B;  4E2F B;  2SEM A;  2K2V A;  2EBP A;  5I2M A;  1VQN Q;  3OYK A;  4KUI A;  4DBH A;  1IGQ A;  2EJG A;  3BY7 A;  1YIT Q;  4Y28 E;  2QQA A;  1M1F A;  1RAB B;  1K9A A;  4EMH A;  2X4J A;  5CR2 A;  1UHF A;  2ZPI B;  3CC4 T;  1V29 B;  3OSV A;  4OMM A;  1QCO A;  2FZG B;  2CSI A;  2E10 A;  4Z89 A;  4Y91 A;  2D0N A;  2DJQ A;  1PCX A;  2E4H A;  1QVF A;  1WNL A;  1BU1 A;  2AZS A;  4M75 F;  3EG2 A;  2EYQ A;  4C92 C;  2CP6 A;  3I35 A;  4XK8 E;  1KD1 C;  2QEX T;  4J9C A;  2EPD A;  3L2R A;  4XU0 A;  1EIF A;  4X9D A;  4F16 A;  2EQK A;  4FIB A;  4HCC A;  1U1S A;  3VUB A;  3EH2 A;  1K73 C;  4BDY A;  3CMA T;  2GFU A;  2XMF A;  4OB0 B;  2K6D A;  2DXT A;  4EMK C;  3OYG A;  2RNA A;  1W6X A;  2DA9 A;  1VUB A;  3CCL T;  1Q86 U;  4OVA A;  1DJ7 B;  2ZPE B;  1UGP B;  1Y0M A;  3T9N A;  1BIB A;  1UTI A;  1OUL A;  4ZGD B;  2EW3 A;  1FMW A;  3PT9 A;  4R0K A;  2CT3 A;  4M77 F;  2RN8 A;  2PVD B;  5HK3 A;  1AWW A;  3QZ9 B;  1YI2 Q;  4ZGE B;  2JTE A;  3UPU A;  5GAO p;  3MPU B;  2EYY A;  1W70 A;  4Z88 A;  3DLL A;  1VQP Q;  5KE3 A;  1FMV A;  4M78 D;  2R5M A;  1VQO A;  1MMD A;  4N4H A;  3OYL A;  1Q86 R;  1N9R A;  1Q82 R;  5LJ5 f;  3MEA A;  4RG8 A;  3O5Z A;  4OMP A;  2AIR B;  2EKO A;  4DA4 A;  1KD1 U;  2QQ9 A;  3CME T;  1YJ9 Q;  1R0C B;  2YRV A;  3QHS A;  2MAM A;  4WTO B;  1VQK T;  2LNH B;  4KRT A;  4D8D A;  4PJO B;  2BTT A;  3NFC A;  4JRQ A;  2M1H A;  3EGD B;  3M53 A;  3NTI A;  3HRU A;  1J3T A;  4IUU A;  3H0F A;  1H92 A;  3V8L A;  1NPP A;  4MZT A;  2V8J A;  1TUG B;  1YCS B;  2HDA A;  2W10 A;  2ZPB B;  4XTY A;  3RKX A;  3CCV Q;  2QTX A;  3G4S A;  2DVE A;  4ZGJ B;  3GOX A;  1WQW A;  1OQK A;  1N27 A;  3RNJ A;  3WVE B;  1RAI B;  3JRZ A;  5D6X A;  2DX1 A;  2VGM A;  1RAA B;  2YUO A;  1Q81 C;  2L89 A;  1NJI R;  4B9W A;  4E7J A;  4PJN A;  1YHQ A;  1IRX A;  1VYU A;  3OW2 A;  2JMA A;  2RA2 A;  4TVR A;  3G71 Q;  1ZHI A;  4A54 A;  1QCF A;  4M7D D;  5HY6 A;  2OTJ T;  2DAQ A;  3L1A A;  3I5S A;  4ME7 A;  4BI3 A;  3NTH A;  3BDL A;  3N5B B;  1HXD A;  1BBZ A;  2KDS A;  5GAN 2;  2P0Q A;  2JXB A;  1S72 T;  4C92 A;  4IUV A;  3NTK A;  3JCM V;  1LPL A;  3SEM A;  1V76 A;  2LCL A;  4XTZ A;  8AT1 B;  4RTU A;  1TWB A;  1WJR A;  4RTW A;  4AMC A;  1XQH A;  1WFW A;  2KXD A;  2LTO A;  5J26 A;  4OMF B;  4EMK A;  2B86 A;  4OMO A;  2HSE B;  1B34 A;  2CUD A;  5CKF A;  2KY9 A;  4NL3 A;  3CCJ Q;  3AHU A;  2QK0 A;  2HQX A;  1I81 A;  4F04 B;  1QWF A;  3TSW A;  2LDM A;  5KH6 A;  3GIB A;  2VVK A;  2DNU A;  1QVF S;  5I11 A;  3PVQ A;  4WF2 A;  4IUP A;  1M90 R;  3VS7 A;  2LJ3 A;  1ZSG A;  1TXQ A;  5M9O A;  1KHC A;  5GAN 4;  3S3M A;  1NPR A;  2OTL Q;  4PNO A;  2HEQ A;  4A4E A;  2SRC A;  2COW A;  2YSQ A;  1VQM T;  5J39 A;  2DER A;  4X1V A;  2FHD A;  4FYY B;  2CP5 A;  4M7D B;  2NUT A;  3M5A A;  3VU3 C;  3I55 T;  1GFC A;  1QWE A;  1N5Z A;  4F7U G;  1MNE A;  4KUL A;  1TU0 B;  4M78 G;  3A1P A;  3A8L B;  1WA7 A;  1VQ4 Q;  3KBG A;  4DEY A;  2I0N A;  4PJM A;  5IHK A;  2FZC B;  3QPH A;  4RTT A;  4M75 D;  2JZ2 A;  3ASK A;  3CC4 A;  3CC2 T;  2BKD N;  4JDS A;  1D3B A;  2F2X A;  3PE0 A;  1KC8 R;  4RCC A;  2YUP A;  2ATC B;  3JSC A;  3M56 A;  2HD0 A;  5GMK i;  2HAX A;  1ARK A;  4PL6 A;  3KXT A;  1NZ9 A;  4MZM A;  1NYF A;  3M0U A;  1VQ8 T;  4GY5 A;  4LDV A;  3QO3 A;  1M1K R;  4KH1 B;  3R6N A;  2QEX A;  3C94 A;  2J6F A;  2X4X A;  3JCM P;  2RHZ A;  3EFR A;  3CMA A;  1FYN A;  3MP6 A;  3R6O A;  2FRW A;  1QVP A;  4X34 A;  3RUX A;  2DIQ A;  2Z0W A;  2NUP A;  3CCL A;  1RAG B;  1X27 A;  4M77 D;  4FT2 A;  2JTM A;  2FEI A;  3QJY A;  2DK3 A;  1MUZ A;  4A53 A;  2DBK A;  5I2S A;  3GNF B;  1BKB A;  4PKC C;  2OX7 A;  2DIG A;  1PHT A;  1CKA A;  2L3P A;  2D9T A;  3VYH B;  2YDL A;  3VS3 A;  1K9M C;  4QQG A;  4J9I A;  2A3L A;  4MML A;  3CCM T;  4IUR A;  5LL6 S;  4HT9 A;  4FSX A;  4RCB A;  4IUT A;  4OF1 A;  3OYM A;  2J05 A;  1D1C A;  3JB9 G;  1BI1 A;  4QVZ A;  1YNZ A;  2FPF A;  2VWF A;  3MP1 A;  2EWN A;  2NWM A;  4LXC A;  4C8Q E;  1C6V X;  2CT4 A;  1BK2 A;  2CP0 A;  4E7S A;  1VQO Q;  2DL7 A;  4AFS C;  4ELY C;  4HA8 A;  1NE8 A;  1V1C A;  1Y71 A;  1ZLM A;  1QVG S;  4HCZ A;  2E3H A;  4J9G A;  1WHM A;  4JS5 A;  2RJD A;  2DXC A;  4D8K A;  3CME A;  2NYS A;  1GRI A;  1YWO A;  1H8K A;  2QI2 A;  1VQK A;  2XID A;  5DM7 R;  1X75 C;  3QBY A;  1KQS P;  7AT1 B;  4C92 B;  1X6G A;  2J7I A;  3OS2 A;  2DBM A;  2XHC A;  2K5F A;  1K76 A;  1AWO A;  1JJ2 S;  3URG A;  1YIJ T;  5ECA A;  2C0O A;  1WQ7 A;  2EFI A;  2CYZ B;  3M4G A;  4J5Y A;  1IO6 A;  1SSF A;  2CH4 W;  4EMK B;  3JV3 A;  3G4S Q;  1B34 B;  2DPP B;  4M7A G;  3JCM W;  4DEX A;  3OYB A;  4C5G A;  1MND A;  2J6K A;  2RQV A;  3E2U A;  2GCX A;  1ZX6 A;  2BUD A;  4A4F A;  3OYC A;  4XQ3 A;  2PVO B;  2FL7 A;  2XG8 D;  1QCN A;  3H9N A;  2K3Y A;  3M0P A;  4A4H A;  1YHQ Q;  1AZE A;  4NOY A;  4C8Q C;  5LJ5 g;  2LMJ A;  2X3W D;  3VS6 A;  1WHJ A;  2LRQ A;  2P4R A;  3CC7 T;  3HTR A;  2K79 A;  4YTL A;  1GBR A;  4AG1 C;  2OTJ A;  2CZ0 B;  3HHT B;  2EJ9 A;  5LJ3 e;  4C8Q F;  2AT1 B;  2HCK A;  2JS2 A;  1IHV A;  2K3B A;  3QDR B;  2L5Q A;  4JLI A;  4HCB A;  4J6W A;  2AKL A;  4AFZ C;  1TG0 A;  1G5V A;  2NUT B;  1WHK A;  1S72 A;  4GLK A;  3QZ5 B;  2LT1 A;  4QQ6 A;  4XTW A;  4DBR A;  2DYB A;  2XKO C;  3RR6 A;  4M75 G;  1AT1 B;  1KJW A;  1WHL A;  2FPD A;  5FRN A;  1RL2 A;  2A37 A;  5FLX E;  2HBP A;  3G1J A;  1I07 A;  1ZBX A;  3BFM A;  3OQ5 A;  1U5S A;  2XD0 A;  4CC4 B;  1D3B B;  1WHH A;  3BDU A;  2LX9 A;  3G6E Q;  2ZPG B;  2AHJ B;  5GAN 3;  2QXF A;  2DFU A;  3KUF A;  2E65 A;  2PVG B;  1TSF A;  2RQT A;  2CSQ A;  2DTO A;  2L3Q A;  1OV3 A;  2C0T A;  3EGX A;  4AT1 B;  1OZ2 A;  4L59 A;  2X35 A;  3A98 A;  1EX4 A;  4M77 G;  1VQ9 T;  1VYV A;  2V1R A;  2X4W A;  5GMK j;  2E41 A;  2RI2 A;  1K0S A;  1CSK A;  1VQ7 T;  1W1F A;  5FWB A;  1SPK A;  4JUV A;  2JJ9 A;  4E7I A;  5AYF A;  1X01 A;  2HZY A;  4OML A;  5GAN e;  3QXE B;  2HKQ B;  1VQM A;  1Q86 C;  4E47 A;  4HVU A;  1OU9 A;  3H8Z A;  3M0Q A;  1PRM C;  2MOX A;  1Q82 C;  2KT8 A;  1W2B A;  1U3O A;  2XDP A;  3I55 A;  2CP7 A;  4BE1 A;  3P8B B;  2VC8 A;  3CCR T;  2HSP A;  3VJP A;  3CBP A;  1IGU A;  2KYB A;  2QA4 T;  1G3S A;  1WXU A;  3JCM h;  3GP8 A;  3M55 A;  1X6B A;  2KRN A;  3CC2 A;  3E1S A;  2WAC A;  3CC4 Q;  4OB2 B;  4IIM A;  1WJS A;  4GLM A;  4PFO A;  4XTV A;  4PJO D;  2DVJ A;  3JCM e;  1VQ8 A;  1M3A A;  5GJV B;  4N4I A;  3JAM E;  5GAN 7;  1YIT T;  2G6F X;  2ENM A;  1QVG A;  1YJW A;  3NMZ C;  3FDR A;  1NJI C;  2QEX Q;  1G83 A;  4L6V 5;  1VQ5 Q;  4RUG A;  3TVT A;  1H64 1;  2DRK A;  2NUZ A;  3LWH A;  3CMA Q;  1NLP C;  4C92 F;  4OB1 B;  2COZ A;  2CKK A;  3M59 A;  4C8Q A;  3D7S B;  2LC4 A;  5IXB A;  5GAM j;  3CXC A;  1EZZ B;  1X43 A;  2MYS A;  1G2B A;  2BIV A;  3CCL Q;  1JJ2 A;  2M51 A;  4Y92 A;  1Q82 U;  3FIF A;  1M9S A;  1B07 A;  3TEE A;  4LDX A;  2GQV A;  5KE2 A;  2CRE A;  2H8H A;  4R56 A;  3P8H A;  1BYM A;  3CCM A;  4ZNX A;  3OYN A;  3C95 A;  4P5N A;  4MMK A;  3CCQ T;  1K1Z A;  3FLG A;  5FWC A;  2DKG A;  1ZUU A;  2M0O A;  1ZUY A;  4RTY A;  2XDD A;  4JZ4 A;  1RAF B;  2DXB A;  2PU9 B;  3RKY A;  2DM1 A;  4HVW A;  1KQ2 A;  5IN1 A;  3QWX X;  3INZ A;  5CAI A;  1AEY A;  4FYX B;  1WLP B;  4JJB A;  2LP5 A;  3OYD A;  1VQ6 Q;  3H0H A;  5CKB A;  4UC4 A;  1ABQ A;  3UF4 A;  4VUB A;  3A8H B;  1AVZ C;  1NJI U;  1VQL T;  3CME Q;  2LQ8 A;  1WXT A;  3JCM b;  1VQK Q;  1C1A A;  3PIO A;  2EGA A;  2RPN A;  4PJL A;  3OYH A;  3S6W A;  2E64 A;  1OPK A;  3MCA B;  3GBQ A;  1YIJ A;  5CKE A;  4J8O A;  2DO3 A;  1BCM A;  1YJ9 T;  3V8K A;  3FJP A;  4QT7 A;  2KSS A;  3RKW A;  2YRD A;  2YLB A;  1YP5 A;  3F70 A;  5GAN 8;  3SDZ A;  4A4K A;  3HRS A;  3TQ7 P;  1UG1 A;  4M7A A;  1IB8 A;  1KSW A;  5DY9 A;  2RHI A;  2DL4 A;  2F5T X;  2JNG A;  4Z02 A;  3RMQ A;  3OBY A;  4XTU A;  1ZA1 B;  2RO0 A;  4DOV A;  1WZO A;  1WXB A;  1MV3 A;  3OYA A;  1TUC A;  3PIP A;  2A0F B;  4C8Q D;  3LH5 A;  4DOW A;  4LDU A;  1Z9Q A;  5GMK h;  3CCU T;  3VRZ A;  1M30 A;  3UAT A;  3X26 B;  1RLP C;  1GFD A;  3EGX B;  3MJX A;  3CC7 A;  1RAE B;  2H3E B;  3V7R A;  3CBO A;  2ZZD A;  3M57 A;  1AWX A;  2RJC A;  2QAS A;  5IXF A;  1G3T A;  1BI3 A;  3DB4 A;  1M8V A;  3MHX A;  2OTJ Q;  4FYV B;  5GMK e;  1N8R U;  1KC8 C;  6AT1 B;  1K73 R;  1AOJ A;  5GAN d;  1G8X A;  4LUD A;  3OS5 A;  5FW9 A;  3A8M B;  3VS2 A;  5KYX A;  1RAC B;  2DL8 A;  3UA7 A;  2VXE A;  3HRT A;  2WSC E;  1S72 Q;  1FXX A;  3MEV A;  1SKU B;  1M90 U;  2IG0 A;  2X51 A;  1G3W A;  4EDU A;  3FRN A;  1OOT A;  1M3B A;  4PJO G;  2DL3 A;  2JN0 A;  4JPB W;  1UGR B;  3L2U A;  2DE0 X;  1GCQ A;  2I2L A;  4JS4 A;  1N8R R;  1XJW B;  3UDC A;  2ECZ A;  3J81 E;  4BI8 B;  2DTI A;  2EQJ A;  2YUQ A;  3JB9 J;  3Q1J A;  3CCS T;  2M0Y A;  5C6S A;  3JCM d;  2BE7 D;  2QGF B;  4J83 A;  1KG1 A;  1SRM A;  1TH7 A;  1RUW A;  1MGQ A;  2COY A;  3CCJ T;  1HK9 A;  4ZN1 A;  1JQQ A;  2LJ0 A;  1VQ9 A;  3L2Q A;  3OYF A;  2E6N A;  5HKC A;  5KYU A;  2RI5 A;  5LJ3 j;  2FYK A;  5GAM h;  1Y57 A;  1VQ7 A;  5CK9 A;  4XTX A;  1OEB A;  2MI6 A;  2LX7 A;  3QYH B;  1QKW A;  4C8Q B;  3LLR A;  1TS9 A;  1KC8 U;  2VUB A;  2R58 A;  5L8R E;  3L2Z A;  1I5L A;  1OZ3 A;  2M16 A;  1UDL A;  2ROT A;  1VQM Q;  5GAM e;  1XOV A;  4PLL A;  1KQS S;  3OB9 A;  3HL8 A;  2OTL T;  5AT1 B;  1M1K U;  2DZ9 A;  1IXD A;  2JM8 A;  1YJN T;  1XNI A;  2DLP A;  2RQR A;  2DEQ A;  3I55 Q;  2LVM A;  2KXC A;  2O2O A;  3RES A;  2XK0 A;  2MCN A;  3OY9 A;  5GMK l;  2WSF E;  2CDT A;  2QA4 A;  2LCC A;  2A7Y A;  1VYT A;  1UEB A;  5KYW A;  1I4K 1;  3PTA A;  2X4Y A;  3CQT A;  3UWN A;  3CC2 Q;  4RTV A;  2RJF A;  1PG5 B;  2F5K A;  3EG0 A;  4HKE A;  1VIE A;  4J9H A;  1OPL A;  2YT6 A;  3ER0 A;  4LUE A;  1ZSZ C;  1VQ4 T;  4PFZ A;  4K11 A;  2XI9 A;  3GLX A;  4XU1 A;  4C92 D;  2FRY A;  2FPE A;  4NS5 A;  3TSZ A;  4BDZ A;  1U8R A;  1YJW Q;  4BAC A;  2VXF A;  2PUK B;  4F7U E;  1IZ6 A;  3M9Q A;  2ZPF B;  1QP3 A;  4M78 E;  5GAN j;  3QYG B;  4JLG A;  2GGR A;  1Z9Z A;  1FX7 A;  5KYN A;  1NYG A;  3ME9 A;  4OGC A;  5CQY A;  2CUB A;  1WIE A;  4B9X A;  1K0X A;  5GAO n;  3EHQ A;  1W2B S;  1PM3 A;  3VUZ A;  2EQI A;  1SF9 A;  2YWW A;  1UGS B;  1JB0 E;  1O9S A;  2K9G A;  2K5L A;  5GAO q;  1QLY A;  1SHF A;  5GAN 6;  3CEY A;  3EG9 A;  1UJ0 A;  3CCQ A;  3CCM Q;  2FZK B;  4X9C A;  1D09 B;  5DLQ E;  2JM9 A;  3V8J A;  3VKI A;  2GF7 A;  4QVD A;  4J9B A;  3I56 T;  4M7D G;  1WYX A;  2KYM A;  3X28 B;  1N9S A;  2LQW A;  3OMC A;  1HYO A;  2IIM A;  2P84 A;  2D6F A;  4Q5W A;  3P8D A;  4BI4 A;  3PGG A;  1X6O A;  4A63 B;  4O5V A;  1SHG A;  3A8O B;  1E7O A;  3M4Y A;  3X20 B;  3H0I A;  2O01 E;  4RTX A;  4FW1 A;  2CH4 A;  3CPW S;  2KGT A;  3S3O A;  1VQL A;  2A36 A;  1PSE A;  2KMT A;  1Y07 A;  2JTF A;  1JO8 A;  1LJO A;  3HKS A;  3CD6 T;  1WPY A;  2JT4 A;  2EVR A;  3LH0 A;  4M78 C;  3RDV A;  2ZGW A;  2A28 A;  2FO0 A;  3PMT A;  3CXC S;  2CGH A;  4F7U F;  1YJ9 A;  1KK7 A;  1YIJ Q;  1UHC A;  3MET A;  4M78 F;  1GXI E;  3SWN A;  4R55 A;  1M2V A;  3DKM A;  2YRC A;  5LJ3 f;  4ZTF A;  4BY6 C;  1ZBJ A;  3EFS A;  2JOY A;  2Y4Y A;  3JCM X;  4RG2 A;  2L2P A;  1LOJ A;  1P92 A;  5FU7 B;  2MMP A;  5D7U A;  2C0I A;  4ESR A;  2E1H A;  3QKJ A;  2KEA A;  4ZN3 A;  1T3L A;  5IH2 A;  1JRI A;  2IVW A;  4QVC A;  4OGE A;  3FEO A;  3CCU A;  2EIF A;  5LJ3 h;  1T0H A;  2BZX A;  3CPF A;  5KYU B;  3CCE T;  3CC7 Q;  1BCO A;  1PWT A;  3PFS A;  2MF2 A;  1UUE A;  4IUQ A;  4EIK A;  4CC7 A;  2GFA A;  4C5E A;  1YHQ T;  2KRS A;  2V26 A;  4M7A E;  1WHG A;  2XIC A;  5GAM d;  3WVD B;  1ZSZ A;  5FU6 B;  4RMO A;  1KQS A;  1MMN A;  1I5O B;  2D8J A;  2LCS A;  4BE0 A;  4KH0 B;  2RMO A;  4OP0 A;  1Y7X A;  3ZL7 C;  4C0D C;  1X2Q A;  2K57 A;  2RQU A;  2YLC A;  1A0N B;  1TTH B;  2EYZ A;  2PZ1 A;  5HK0 A;  5KYW B;  2DYI A;  3VRY A;  4C92 G;  5GAN f;  3JB9 F;  4AG2 C;  1MHN A;  2HL3 A;  4FCY A;  3QWY A;  2JVV A;  3CCS A;  2KRO A;  1UE9 A;  2VKN A;  1KFZ A;  4EMG A;  2EKH A;  5LJ5 j;  3HFN A;  2EJF A;  4AFQ C;  1RAH B;  2HQH A;  2K5I A;  2AKK A;  3ZEH A;  4FM4 B;  5GAN h;  2CP3 A;  4M75 E;  1SEM A;  2IPO B;  3JB9 I;  3G6E T;  1VQ9 Q;  1KHI A;  1S1N A;  4HT8 A;  1QVF P;  2KT1 A;  1VQ7 Q;  3JCM J;  3A8G B;  2NUP B;  1OYX A;  1QKX A;  1RI0 A;  2E70 A;  1W4S A;  3PNW C;  4M7A C;  3OYJ A;  4Z8A A;  3OS0 A;  2Y90 A;  1WDX A;  4IKF A;  3JCM f;  2DL5 A;  1U1T A;  1ABO A;  3LYI A;  1YJN A;  1NEG A;  2LZ6 B;  3TU4 K;  4M7A F;  2LT4 A;  4KGV B;  3GPL A;  3EG9 B;  4F7U A;  1JU5 C;  3MEW A;  4M78 A;  3QDF A;  5C0M A;  1LCK A;  1HSQ A;  3A5Z B;  5DLO A;  2QA4 Q;  1NG2 A;  3EH1 A;  3IQL A;  1AZG B;  1TOV A;  2ESW A;  3OBW A;  1Q7Y U;  1WJQ A;  5GMK m;  3I5R A;  1VQN T;  3DB3 A;  1ACM B;  2DJZ A;  1VQ4 A;  5A2Q E;  2HQE A;  4C0G A;  2QQS A;  3HPW A;  4C0F A;  2RI3 A;  3VS0 A;  2A08 A;  5A0L A;  4M75 C;  2V1Q A;  3CPW A;  4M4Z A;  5KCO A;  3OS1 A;  2ZCF B;  1I8F A;  2K3X A;  1G3Y A;  4BD3 A;  1HJD A;  3L2V A;  2FB7 A;  1YN8 A;  1R8O B;  1OI1 A;  2RHY A;  1GCQ C;  3ULR B;  1K8A U;  4CC3 A;  3SWN B;  1VQ5 T;  4CRI A;  1M2V B;  1Q7Y R;  5FU7 C;  2GTO A;  2Y4X A;  4J7F A;  4OMN A;  2KBT A;  3C0C A;  2YUN A;  3QJ6 A;  2KK4 A;  2MWO A;  1MV0 B;  2KNB B;  3C12 A;  1FMK A;  4F14 A;  1LVK A;  1E6H A;  3CCQ Q;  4E7H A;  3ZFJ A;  2X9H A;  4LDW A;  3I56 A;  4M77 C;  3J80 E;  4M7D A;  2R57 A;  3DLM A;  4ANJ A;  2EYW A;  2O31 A;  1JXM A;  4L5G A;  3GNG A;  4MDX A;  1K8A R;  2CZ6 B;  3CBM A;  1YI2 T;  2HMA A;  4E7Z A;  2RK2 A;  3M0S A;  1KIK A;  1AD5 A;  2B8A A;  5LJ3 d;  3MO8 A;  3VS4 A;  5FU6 C;  1N8R C;  2J6O A;  1WI7 A;  1VQP T;  1D1B A;  4AFU C;  5I22 A;  4J9E A;  3OW2 P;  3CD6 A;  1B3Q A;  1IHW A;  1VQL Q;  1ZSZ B;  4A4G A;  3JCM Q;  2E6Z A;  2OI3 A;  2QAZ A;  3L42 A;  3WXM B;  4RTZ A;  1VQ6 T;  5GAO l;  2QTV A;  1I0C A;  2AK5 A;  1M90 C;  4N0A C;  3REB B;  4LD6 A;  1PRL C;  2VGN A;  3RER A;  1YWP A;  3M58 A;  1T3S A;  4ZTJ A;  2KQW A;  2PUO B;  2EAY A;  1OX8 A;  1K73 U;  2GQI A;  3V7S A;  3O8V A;  2D0Q B;  5LJ5 h;  2KVQ G;  1UGV A;  2AZV A;  1BI2 A;  3EFO A;  1M1G A;  1H3H A;  1RAD B;  2L3S A;  4MDW A;  3CCV T;  2W0Z A;  5IAY A;  3EG3 A;  4PK4 A;  3NHN A;  2K2M A;  3EGU A;  2C06 A;  5LJ5 e;  3CCU Q;  2M02 A;  1M2O A;  3REA B;  3CCE A;  3L2W A;  1R77 A;  5EC7 A;  2PNI A;  2O9V A;  1KD1 R;  1MMG A;  4FL6 A;  2FG0 A;  5GJW B;  1D0Z A;  3RIR A;  1QP2 A;  2KAF A;  5CKH A;  2DET A;  2EQU A;  4KGZ B;  1SRL A;  2ED0 A;  1VIF A;  2HKN A;  4II1 A;  1M3C A;  3G71 T;  3SD4 A;  5A0G A;  4GBQ A;  1N6A A;  4N4G A;  1M1K C;  3VS1 A;  2V8K A;  3M0R A;  3JB9 D;  3PMI A;  4QKU A;  1UJY A;  4F7U B;  5LJ3 g;  2MPX C;  4M75 A;  5CKD A;  1QMC A;  1E6G A;  4M78 B;  2L8D A;  3QII A;  1QQJ A;  2GTJ A;  1XTD A;  1PD0 A;  4PJJ A;  1UEC A;  1Y96 A;  2PTK A;  5D6Y A;  4OB3 B;  3X24 B;  2E3I A;  2F1L A;  1PSF A;  5GAM f;  2K7A A;  2OAU A;  2YHT A;  2OJ2 A;  2RD1 A;  3VYG A;  2F2V A;  4B6M A;  2DTH A;  4BY6 B;  3CCS Q;  3AT1 B;  2KR3 A;  2BZ8 A;  4JZ3 A;  2QQB A;  2X3X D;  4C5I A;  3E9G A;  3FB9 A;  4QW2 A;  3RMS A;  5GAN 5;  1EFN A;  4CC2 A;  3H6Z A;  1T0J A;  2BZY A;  3G6E A;  4LE9 A;  4M77 A;  4PLI A;  4JJD A;  1Q81 U;  3SWN C;  3OYY A;  4JRK A;  3U23 A;  1ZQ1 A;  1BIA A;  3FJ5 A;  4M7A D;  1R0B G;  4PJO E;  1NBE B;  1NEB A;  4V2S A;  4XU2 A;  1CKB A;  4ELZ C;  3SFM A;  2GNC A;  3FC3 A;  2CZ1 B;  1M4Z A;  4LNP A;  4LN2 A;  2QGG A;  1C0M A;  1MMA A;  2VAS A;  2ZPH B;  1OU8 A;  2P0K A;  1YJN Q;  2DEU A;  1FWZ A;  1U06 A;  3C4S A;  3CCR A;  5GAN g;  5J3B A;  2EYX A;  1VA7 A;  2P0P A;  2XDB A;  2XU8 A;  2NLU A;  3E19 A;  3S3N A;  4KUD K;  4C5H A;  4N0A A;  1Q81 R;  3SHW A;  2LJ1 A;  2RJE A;  5FRO A;  2QQR A;  5FRM A;  1LNX A;  4C0D B;  2WSE E;  3I9Q A;  5EG2 A;  1OX9 A;  3X25 B;  3EAE A;  4HXJ A;  1KQ1 A;  1VQN A;  2F69 A;  5CQX A;  1YIT A;  2HL5 C;  3UA6 A;  2RM4 A;  3EG1 A;  4XU3 A;  3NPF A;  3THK A;  1VQ8 Q;  2ED1 A;  5CVI A;  2CP2 A;  4IIO A;  1RLQ C;  1PKS A;  3QUI A;  4FYW B;  3J7A F;  5KCH A;  1YCY A;  2D8H A;  2RK1 A;  3JCM g;  4C0Z A;  4PJO C;  2J06 A;  3JB9 H;  1AWJ A;  2EGC A;  2HBW A;  3M0T A;  1PC0 A;  1VQ5 A;  5KYY A;  1YJW T;  4F17 A;  1GCP A;  5CCA A;  4PJO F;  1GL5 A;  2DF6 A;  3QG1 A;  1ZA2 B;  2JUF A;  2QG9 B;  3HFO A;  1X69 A;  4M7A B;  1H3Z A;  2DD5 A;  4C8Q G;  3EHR A;  2O4X A;  2K4Y A;  2V8I A;  2DIL A;  4WCI A;  3EFO B;  1K4U S;  1O75 A;  1M27 C;  2R5A A;  1YBY A;  2JMC A;  2DXU A;  3I56 Q;  4FT4 A;  1PNJ A;  3TCJ A;  2DD4 A;  1ZUK A;  5LJ5 d;  1SG5 A;  2CS7 A;  2LNV A;  1NM7 A;  3LX7 A;  1PD1 A;  1YI2 A;  4J7I A;  3VS5 A;  2EGE A;  1HD3 A;  5IHI A;  1WX6 A;  1VQP A;  5D6W A;  2G3R A;  1VOM A;  5I21 A;  1I1J A;  1SSH A;  2ABL A;  2L0A A;  1QW1 A;  4MZP A;  4LD9 K;  5KYX B;  1VQO T;  3CD6 Q;  4XAX B;  3HP9 A; 
#chains in the Genus database with same CATH homology
 1OYX A;  4RKU E;  1VQ6 A;  1RI0 A;  3A8H B;  2E70 A;  4JRP A;  4ATO A;  1NJI U;  1VQL T;  5M9O A;  1KHC A;  1W4S A;  3MP8 A;  3PNW C;  5GAN 4;  3S3M A;  2LQ8 A;  4M7A C;  1NPR A;  3OYJ A;  3OA6 A;  4M75 B;  3OS0 A;  4M7D E;  1WGS A;  3JCM b;  2Y90 A;  4PNO A;  4IKF A;  3JCM f;  1U1T A;  3PIO A;  4A4E A;  3V7C A;  3LYI A;  3OYH A;  3S6W A;  2E64 A;  3LWI A;  3MCA B;  1YJN A;  2RHX A;  1VQM T;  2EQM A;  1YIJ A;  5J39 A;  3TU4 K;  2CZ7 B;  2L3R A;  2VV5 A;  2DO3 A;  2LT4 A;  4J8O A;  4NL2 A;  5CKE A;  4BB7 A;  2FHD A;  4M7A F;  4J6Y A;  5A0D A;  1Y96 B;  3V8K A;  3FJP A;  3RKW A;  2KSS A;  5GAO m;  3GPL A;  4F7U A;  1YJ9 T;  4M7D B;  2YLB A;  1IRE B;  3MEW A;  3M5A A;  3F70 A;  4M78 A;  3VU3 C;  5GAN 8;  3SDZ A;  3I55 T;  4A4K A;  5C0M A;  3A5Z B;  4JRI A;  3HRS A;  4F7U G;  3CCV A;  5DLO A;  4M7A A;  3OMG A;  5GAO r;  2VYT A;  4KUL A;  5DY9 A;  4M78 G;  2RHI A;  2F5T X;  2DZC A;  3G4S T;  3A8L B;  2JNG A;  4Z02 A;  3KBG A;  3OBW A;  3OBY A;  4XTU A;  3RMQ A;  1Q7Y U;  4FU6 A;  2H3J A;  1WJQ A;  2RO0 A;  4DOV A;  1K9M U;  2M9U A;  3QPH A;  5GMK m;  4M75 D;  2JZ2 A;  3ASK A;  3CC4 A;  1VQN T;  3OYA A;  3DB3 A;  2DJZ A;  3ZBD A;  1VQ4 A;  3CC2 T;  2BKD N;  3PIP A;  4JDS A;  1D3B A;  4M77 B;  4C8Q D;  5A2Q E;  2HQE A;  3JCM c;  4DOW A;  4LDU A;  5GMK h;  3CCU T;  4C0G A;  2QQS A;  4RCC A;  3HPW A;  3X26 B;  2RI3 A;  4C0F A;  3JSC A;  3M56 A;  2HD0 A;  5GMK i;  3CC7 A;  2HAX A;  4PL6 A;  3KXT A;  3V7R A;  4J6X A;  3CBO A;  1NZ9 A;  2ZZD A;  3M57 A;  3G7Z A;  4MZM A;  4M75 C;  5A0L A;  2RJC A;  3CPW A;  4EPC A;  4GY5 A;  1VQ8 T;  4LDV A;  1G3T A;  5KCO A;  3OS1 A;  1BI3 A;  2ZCF B;  3DB4 A;  3QO3 A;  1M8V A;  3G71 A;  4E7L A;  1I8F A;  2K3X A;  3MHX A;  4D6W A;  2QEX A;  4BE2 A;  5GMK e;  3C94 A;  1N8R U;  1G3Y A;  4BUG A;  1KC8 C;  4BD3 A;  2X4X A;  5GAN d;  3OYI A;  3JCM P;  2PQW A;  2RHZ A;  3OS5 A;  3L2V A;  2FB7 A;  3EFR A;  3CMA A;  1R8O B;  3A8M B;  1OI1 A;  2RHY A;  4M7D C;  3MP6 A;  3GF5 A;  3R6O A;  4CI0 C;  1QVP A;  3E9F A;  4X34 A;  3RUX A;  2DIQ A;  1K8A U;  3SWN B;  1VQ5 T;  4CRI A;  5CIU A;  5FU7 C;  5IT9 E;  2VXE A;  3HRT A;  2Y4X A;  2WSC E;  4J7F A;  3CCL A;  1FXX A;  3MEV A;  1M90 U;  4M77 D;  3QJ6 A;  4FT2 A;  2IG0 A;  1G3W A;  2JTM A;  4M7D F;  4PJO A;  3HSB A;  2KK4 A;  4EDU A;  3FRN A;  3QJY A;  2DK3 A;  1UB4 A;  4A53 A;  2MWO A;  5I2S A;  2RHU A;  3GNF B;  1BKB A;  4PKC C;  3C12 A;  2DIG A;  4QQD A;  1UGQ B;  3LW5 E;  1Q7Y C;  4E7H A;  2D9T A;  3LGL A;  4PJO G;  3VYH B;  3ZFJ A;  4LDW A;  2JN0 A;  1K9M C;  4QQG A;  3I56 A;  2A3L A;  4M77 C;  4MML A;  3CCM T;  3J80 E;  1UGR B;  4IUR A;  3BW1 A;  5LL6 S;  3L2U A;  4M7D A;  4HT9 A;  2R57 A;  3DLM A;  2LQK A;  4FSX A;  2I2L A;  4IUT A;  4RCB A;  4JS4 A;  1JBM A;  1AHJ B;  3UDC A;  3J81 E;  4OF1 A;  4BI8 B;  3QSU A;  2DTI A;  2EQJ A;  2FVU A;  4KT0 E;  4O6J A;  3OYM A;  3CCJ A;  3M54 A;  4L5G A;  3Q1J A;  3CCS T;  3JB9 J;  3OSS C;  5C6S A;  3GNG A;  2E12 A;  3JCM d;  2RH2 A;  3OYE A;  4MDX A;  4KBM B;  3JB9 G;  1BI1 A;  4J83 A;  2CZ6 B;  4QVZ A;  1KG1 A;  3CBM A;  1YI2 T;  1M5Q 1;  2RK2 A;  1TH7 A;  2B8A A;  3MP1 A;  2EWN A;  5LJ3 d;  4C8Q E;  3MO8 A;  1MGQ A;  5FU6 C;  3CCJ T;  1N8R C;  1HK9 A;  4ZN1 A;  1VQP T;  1VQ9 A;  4ELY C;  3L2Q A;  3OYF A;  2E6N A;  5HKC A;  2MWP A;  2RI5 A;  4HA8 A;  1NE8 A;  5LJ3 j;  2FYK A;  1Y71 A;  5GAM h;  4LDY A;  3OW2 S;  1VQ7 A;  5CK9 A;  3CD6 A;  4XTX A;  1QVG S;  4A4G A;  4HCZ A;  2MI6 A;  4C92 E;  3LGF A;  1K8A C;  3JCM Q;  4JS5 A;  2RJD A;  2E6Z A;  2DXC A;  3QYH B;  1BI0 A;  4E7K A;  3L42 A;  3CME A;  3SB2 A;  3WXM B;  4C8Q B;  3LLR A;  1KC8 U;  2OTL A;  1VQ6 T;  2VUB A;  2R58 A;  2QI2 A;  5L8R E;  5GAO l;  3L2Z A;  1M90 C;  1VQK A;  2QDY B;  2XID A;  1OZ3 A;  2P4T A;  4N0A C;  2M16 A;  5DM7 R;  1X75 C;  1I5L A;  3QBY A;  4LD6 A;  5GAM e;  3VV0 A;  2VGN A;  1XOV A;  4PLL A;  5CO7 A;  4C92 B;  1KQS S;  3RER A;  2O4X B;  3OB9 A;  3OS2 A;  3HL8 A;  2XHC A;  2K5F A;  2OTL T;  4DQ2 A;  3M58 A;  1M1K U;  2DZ9 A;  4ZTJ A;  2KQW A;  2PUO B;  1JJ2 S;  2EAY A;  1YJN T;  3URG A;  1XNI A;  1YIJ T;  1K73 U;  2DEQ A;  3TRE A;  5GAM g;  1WQ7 A;  2LVM A;  2EFI A;  3UT1 A;  2HNI A;  3V7S A;  2RB6 A;  2E5Q A;  4M77 E;  3RES A;  2CYZ B;  2XK0 A;  3MEU A;  4JJN K;  3M4G A;  4J5Y A;  3O8V A;  1SSF A;  3OY9 A;  2D0Q B;  5LJ5 h;  5GMK l;  2KVQ G;  2WSF E;  4EMK B;  2QA4 A;  2LCC A;  2A7Y A;  1BI2 A;  1B34 B;  1M1G A;  2DPP B;  4M7A G;  1UEB A;  3JCM W;  4MDW A;  2K2V A;  5I2M A;  3OYB A;  3CCV T;  4C5G A;  1I4K 1;  5IAY A;  3PTA A;  2X4Y A;  3UWN A;  3OYK A;  4KUI A;  2C06 A;  2RJF A;  2EJG A;  5LJ5 e;  2F5K A;  2GCX A;  3BY7 A;  4Y28 E;  2BUD A;  4HKE A;  2QQA A;  1M1F A;  4A4F A;  3OYC A;  4XQ3 A;  2X4J A;  1VIE A;  4EMH A;  3CCE A;  2PVO B;  5CR2 A;  3L2W A;  2ZPI B;  3CC4 T;  3ER0 A;  2FL7 A;  1V29 B;  2XG8 D;  1VQ4 T;  4XU1 A;  4C92 D;  2K3Y A;  2XI9 A;  3GLX A;  4A4H A;  3OSV A;  4NOY A;  4C8Q C;  4NS5 A;  2E10 A;  5LJ5 g;  4FL6 A;  4Y91 A;  2LRQ A;  3RIR A;  4BDZ A;  1U8R A;  1QP2 A;  2KAF A;  5CKH A;  1WNL A;  3CC7 T;  2EQU A;  1QVF A;  4YTL A;  4BAC A;  2VXF A;  2OTJ A;  1VIF A;  2PUK B;  2CZ0 B;  4M75 F;  4F7U E;  2EYQ A;  4C92 C;  1IZ6 A;  3M9Q A;  4II1 A;  3HHT B;  2ZPF B;  2EJ9 A;  1QP3 A;  4C8Q F;  4XK8 E;  4M78 E;  3SD4 A;  3QYG B;  5A0G A;  5LJ3 e;  3G71 T;  2QEX T;  4JLG A;  5GAN j;  1KD1 C;  3L2R A;  4XU0 A;  1N6A A;  3QDR B;  1FX7 A;  2L5Q A;  1EIF A;  4N4G A;  4X9D A;  1M1K C;  4JLI A;  4HCB A;  2EQK A;  3ME9 A;  4FIB A;  4HCC A;  2V8K A;  1U1S A;  4OGC A;  3PMI A;  4J6W A;  5CQY A;  3VUB A;  4BDY A;  3JB9 D;  1K73 C;  3CMA T;  2GFU A;  4B9X A;  4F7U B;  4OB0 B;  4M75 A;  5CKD A;  5LJ3 g;  1G5V A;  1S72 A;  5GAO n;  2DXT A;  3QZ5 B;  4GLK A;  4EMK C;  3OYG A;  3VUZ A;  1W2B S;  2LT1 A;  4M78 B;  4QQ6 A;  4XTW A;  2L8D A;  1VUB A;  3QII A;  2XKO C;  3CCL T;  1UGS B;  1Q86 U;  1JB0 E;  1O9S A;  1XTD A;  2K5L A;  4M75 G;  4OVA A;  5GAO q;  1DJ7 B;  2ZPE B;  1UGP B;  5FRN A;  5GAN 6;  3CEY A;  1RL2 A;  1Y96 A;  3T9N A;  1BIB A;  3CCQ A;  5FLX E;  2HBP A;  5D6Y A;  4X9C A;  4OB3 B;  3X24 B;  4ZGD B;  5DLQ E;  1PSF A;  5GAM f;  3V8J A;  3VKI A;  2GF7 A;  2OAU A;  3PT9 A;  1ZBX A;  2YHT A;  4QVD A;  3BFM A;  3OQ5 A;  3I56 T;  2RD1 A;  4M7D G;  3VYG A;  2XD0 A;  4BY6 B;  2DTH A;  1D3B B;  3X28 B;  4M77 F;  1N9S A;  2PVD B;  5HK3 A;  3OMC A;  3BDU A;  3QZ9 B;  2D6F A;  2LX9 A;  4Q5W A;  2QQB A;  3P8D A;  4ZGE B;  4BI4 A;  3E9G A;  3FB9 A;  4QW2 A;  3PGG A;  1X6O A;  3RMS A;  4C5I A;  5GAN 5;  2ZPG B;  2AHJ B;  5GAO p;  5GAN 3;  3UPU A;  2QXF A;  3H6Z A;  3KUF A;  3DLL A;  5KE3 A;  2E65 A;  2PVG B;  3G6E A;  3A8O B;  4M77 A;  4O5V A;  3M4Y A;  4M78 D;  4PLI A;  3X20 B;  1Q81 U;  3SWN C;  2DTO A;  2R5M A;  1VQO A;  2O01 E;  3OYY A;  4JRK A;  1ZQ1 A;  4N4H A;  3OYL A;  1BIA A;  5GMK j;  4M7A D;  3CPW S;  1OZ2 A;  4L59 A;  1VQL A;  2X35 A;  3S3O A;  4M77 G;  1N9R A;  1PSE A;  1VQ9 T;  4PJO E;  4V2S A;  2KMT A;  1Y07 A;  2X4W A;  2E41 A;  2RI2 A;  2JTF A;  4XU2 A;  1LJO A;  3HKS A;  3MEA A;  4ELZ C;  3CD6 T;  1WPY A;  1VQ7 T;  4RG8 A;  4JUV A;  3LH0 A;  4M78 C;  3SFM A;  4E7I A;  3FC3 A;  2ZGW A;  2EKO A;  5AYF A;  4DA4 A;  2CZ1 B;  1KD1 U;  2QQ9 A;  3CME T;  1X01 A;  1M4Z A;  2YRV A;  3QHS A;  5GAN e;  3PMT A;  3QXE B;  2MAM A;  2CGH A;  4E47 A;  3CXC S;  1VQM A;  1Q86 C;  1VQK T;  4PJO B;  3H8Z A;  4F7U F;  2ZPH B;  3NFC A;  1YJ9 A;  4JRQ A;  2P0K A;  2M1H A;  1Q82 C;  3M53 A;  3MET A;  1FWZ A;  3C4S A;  3HRU A;  3NTI A;  4M78 F;  1GXI E;  4IUU A;  3SWN A;  4R55 A;  1W2B A;  3CCR A;  5GAN g;  2XDP A;  5J3B A;  3I55 A;  3DKM A;  5LJ3 f;  3V8L A;  4ZTF A;  4BY6 C;  1NPP A;  2P0P A;  3EFS A;  2V8J A;  2JOY A;  2Y4Y A;  4MZT A;  4BE1 A;  2XU8 A;  2XDB A;  2NLU A;  3E19 A;  3S3N A;  4KUD K;  4C5H A;  4N0A A;  3JCM X;  3P8B B;  4RG2 A;  2RJE A;  2ZPB B;  4XTY A;  5FRO A;  5LJ5 f;  2VC8 A;  2QQR A;  3RKX A;  1LOJ A;  3CCR T;  2QTX A;  1P92 A;  3G4S A;  5FRM A;  3VJP A;  2DVE A;  5FU7 B;  1LNX A;  4C0D B;  2MMP A;  2WSE E;  3CBP A;  4ZGJ B;  3GOX A;  1WQW A;  2E1H A;  1N27 A;  2QA4 T;  1G3S A;  5EG2 A;  3QKJ A;  3JCM h;  3GP8 A;  3X25 B;  3WVE B;  3M55 A;  3EAE A;  1VQN A;  1KQ1 A;  3CC2 A;  4ZN3 A;  2F69 A;  3JRZ A;  1JRI A;  2IVW A;  5D6X A;  3E1S A;  5CQX A;  2VGM A;  4QVC A;  2WAC A;  4OGE A;  3FEO A;  3CCU A;  2L89 A;  1YIT A;  1Q81 C;  2EIF A;  2RM4 A;  5LJ3 h;  4OB2 B;  4XU3 A;  4B9W A;  4E7J A;  1WJS A;  4XTV A;  4PJO D;  3CPF A;  5CVI A;  1YHQ A;  3JCM e;  3CCE T;  1VQ8 A;  4N4I A;  3JAM E;  5GAN 7;  1YIT T;  3PFS A;  2MF2 A;  3QUI A;  3OW2 A;  4IUQ A;  3J7A F;  1QVG A;  1YJW A;  2RA2 A;  5KCH A;  4TVR A;  1YCY A;  2GFA A;  2RK1 A;  3FDR A;  1ZHI A;  3JCM g;  4A54 A;  4C5E A;  1YHQ T;  1NJI C;  4L6V 5;  4C0Z A;  4M7D D;  4PJO C;  5HY6 A;  4M7A E;  3JB9 H;  1H64 1;  2DAQ A;  2XIC A;  2OTJ T;  5GAM d;  3L1A A;  4ME7 A;  3WVD B;  3LWH A;  4BI3 A;  4C92 F;  1VQ5 A;  1YJW T;  4OB1 B;  3NTH A;  3BDL A;  3N5B B;  1HXD A;  2CKK A;  3M59 A;  5FU6 B;  4RMO A;  4C8Q A;  1KQS A;  2LC4 A;  5CCA A;  5GAM j;  4PJO F;  2KDS A;  5GAN 2;  3CXC A;  3QG1 A;  2JUF A;  2P0Q A;  2BIV A;  1JJ2 A;  4BE0 A;  3HFO A;  4M7A B;  1H3Z A;  2DD5 A;  4OP0 A;  4C8Q G;  1Y7X A;  3FIF A;  1S72 T;  4C0D C;  1Q82 U;  1M9S A;  3TEE A;  4IUV A;  3NTK A;  4C92 A;  4LDX A;  2O4X A;  2GQV A;  2K57 A;  2YLC A;  3JCM V;  2K4Y A;  2V8I A;  5KE2 A;  4R56 A;  5HK0 A;  2LCL A;  3P8H A;  1O75 A;  3CCM A;  1BYM A;  4XTZ A;  3OYN A;  2R5A A;  5GAN f;  4C92 G;  3JB9 F;  3C95 A;  4P5N A;  1YBY A;  4MMK A;  1MHN A;  1WJR A;  2DXU A;  4FT4 A;  3CCQ T;  1XQH A;  3FLG A;  2DD4 A;  2LTO A;  5J26 A;  3TCJ A;  2DKG A;  2JVV A;  5LJ5 d;  4OMF B;  4EMK A;  3CCS A;  2M0O A;  2CS7 A;  1B34 A;  2XDD A;  2LNV A;  5CKF A;  2KY9 A;  4EMG A;  4NL3 A;  3LX7 A;  3AHU A;  2DXB A;  5LJ5 j;  1YI2 A;  3HFN A;  4J7I A;  2PU9 B;  3RKY A;  2EJF A;  2HQX A;  1I81 A;  1KQ2 A;  5IN1 A;  2K5I A;  1VQP A;  5D6W A;  3ZEH A;  2G3R A;  3INZ A;  4FM4 B;  5GAN h;  5CAI A;  5I21 A;  2LDM A;  5KH6 A;  3GIB A;  4M75 E;  3JB9 I;  1QVF S;  3G6E T;  3OYD A;  1KHI A;  1QW1 A;  4MZP A;  4UC4 A;  4WF2 A;  5CKB A;  4LD9 K;  4HT8 A;  4IUP A;  1VQO T;  4XAX B;  3HP9 A;  3JCM J;  4VUB A;  3A8G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...