2KMTA

Nmr solution structure of vibrio fischeri ccdb
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
105
structure length
105
Chain Sequence
MSQFTLYKNKDKSSAKTYPYFVDVQSDLLDNLNTRLVIPLTPIELLDKKAPSHLCPTIHIDEGDFIMLTQQMTSVPVKILSEPVNELSTFRNEIIAAIDFLITGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Thermodynamic Characterization of Vibrio fischeri CcdB.
pubmed doi rcsb
source organism Vibrio fischeri
molecule tags Toxin
molecule keywords CcdB
total genus 16
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2kmtA00
5DLOA 1M1FA 4HKEA 5CKFA 5CO7A 5HKCA 4MZTA 5CCAA 2VUBA 4VUBA 5HK0A 5CQXA 2KMTA 3NFCA 5CKDA 3JRZA 4OF1A 4ELZC 3VUBA 1NE8A 2C06A 5HK3A 5CQYA 3G7ZA 4MZMA 5CKHA 5CK9A 5CR2A 5CKBA 3JSCA 4MDXA 1X75C 2MF2A 3TCJA 4ELYC 5CKEA 3HPWA 4ME7A 4MZPA 1UB4A 1VUBA
chains in the Genus database with same CATH superfamily
2QQBA 4N4IA 4M78E 3EGUA 1T0HA 1QW1A 3A8HB 1WXBA 3OS5A 2YLCA 4JPBW 2A3LA 1UGRB 1BIAA 1UEBA 3M0SA 3EHQA 4J6WA 4A4FA 1GXIE 4M75A 4C0ZA 3OYNA 2KYMA 1YCYA 1GBRA 1TUDA 2V8KA 2JOYA 1YIJA 3P8BB 5CQXA 1G3WA 1KD1R 1YITA 4QVCA 3G71A 1YJNA 3NPFA 4EMGA 5GAN3 2G3RA 1IGQA 1KK7A 1RAIB 4OMOA 4R56A 3OYAA 4M7AC 4C92G 9ATCB 4BY6C 4BDZA 1OULA 2PQWA 3TCJA 3JCMe 1TS9A 1YJWT 4JRKA 1U06A 4EMKB 5FU6C 1R0CB 4KGXB 2WACA 2JW4A 3QZ5B 1Q82C 4O6JA 3EFOA 1G83A 1TOVA 2X4XA 3M0PA 3OYMA 1BI1A 3QZ9B 4J9EA 3VYHB 4PJOA 1YJWQ 4M75E 2ZPFB 2PVGB 1TH7A 2QK0A 1PRLC 1PSFA 5LJ3d 2JS0A 2ZPGB 5C0MA 4JJCA 1M8VA 1WPYA 5FWBA 1W2BS 1KJWA 1QKXA 3PVLA 1W2BA 1IXDA 4Z88A 2B86A 3HKSA 1IHWA 4PJOE 1PD1A 4QVDA 1RAGB 1KQSA 2CP5A 2LQKA 2QEXQ 3DLLA 1SKUB 1X6GA 1ZX6A 1HJDA 2KNBB 1FYNA 4PJMA 1X27A 4JRIA 4C8QD 1BKBA 2D0NA 2LX9A 1G3SA 1E7OA 2HQXA 3MPUB 3FEOA 4XTZA 1XOVA 3L2UA 1Q7YR 4E7HA 4C8QE 3VS3A 3UT1A 3FIFA 1KHIA 3QYHB 3OW2A 1JEGA 4F7UE 4XTVA 2LNVA 1QQJA 2K5FA 3M9QA 2NLUA 3QDFA 4LNPA 4A4GA 3GNFB 1YJ9T 1WXUA 3UA6A 5FROA 2DXCA 2WSEE 3JCMf 1YBYA 2F5KA 4XTYA 2KQWA 3CEYA 2EIFA 4F7UF 3M56A 2O9VA 4J9BA 5D6XA 3FJPA 3LWIA 3CCLA 1K9AA 4RTYA 3OS2A 2ATCB 2RJEA 3CQTA 4ZTJA 3CC7A 3CMAT 3GPLA 3QG1A 1ZBXA 4XK8E 2DL4A 4PJOG 1CSKA 2CZ6B 2RK1A 1ZUYA 3RMSA 3WVDB 3A8MB 2JJ9A 1M2VB 2HD0A 3P8HA 4M7DD 1VQ5Q 2EGAA 3HFOA 5EC7A 1W2BP 4IUVA 3RKXA 1KIKA 2BE9B 1K73U 3A8OB 2K57A 3C12A 5GAOr 4QQDA 2K4YA 4A53A 1JXOA 4CC7A 5GMKi 2DNUA 1RAFB 2QG9B 4N0AA 1I1JA 2W10A 3L1AA 3V7RA 5GAOn 2CKKA 3OW2P 2LQWA 4L59A 1X6OA 5L23A 3CPFA 2A28A 1VQ9T 2DMOA 5HCKA 1VQKA 3G6ET 2RM4A 2DXBA 1QVPA 2RNAA 2PUKB 1M3CA 2VUBA 4RTXA 1G8XA 2HEQA 4C0DC 2FB7A 2H8HA 3RKWA 5GAMj 1QLYA 2DKGA 2CT4A 2WSFE 1Y0MA 4DOVA 1H641 1QMCA 3P8DA 1IGUA 1M27C 2OJ2A 5KYUB 3M4YA 5FU7C 2QA4A 1M1GA 4M78C 1M30A 1O75A 2KBTA 1M3AA 3A8LB 1VQ8Q 1D0YA 1T3SA 1RI9A 2E1HA 3M0RA 2KY9A 2LVMA 2EYQA 2GBQA 5CR2A 1QVGS 1QWFA 1SPKA 3VS2A 2ZPHB 3M53A 1J3TA 5D7UA 4X9DA 2X4WA 3AHUA 4AFSC 1AZGB 2JTEA 2RHIA 1MMDA 3JCMh 1W6XA 1Y57A 4R55A 3MP8A 2FHDA 3GNGA 2M0YA 2VWFA 2DEQA 3MP6A 3Q1JA 1X2QA 5LJ5f 3CD6T 2AHJB 5IH2A 3QBYA 3EG9B 1ZSGA 1ZQ1A 3LGFA 5IAYA 4NL2A 4K11A 3M55A 1VQPQ 2VV5A 3UPUA 3CXCA 2LCLA 4L6V5 1VQMA 4EDUA 4FT4A 1RUWA 2RI5A 3SHWA 1K73R 4C8QC 1G2BA 2LRQA 3CCRQ 1UB4A 4JJBA 2ZZDA 5IHNA 1JU5C 2CSQA 5LJ5h 2NUTA 3PIPA 4R0KA 5LJ5j 1K9MU 2D8HA 5A0GA 4M7DF 2O31A 1WYXA 5GANg 2XD0A 3SWNB 1X75C 4J7FA 4C8QG 1IRXA 3BDUA 1PRMC 4LUEA 5AT1B 4C5HA 4HA8A 5GJVB 2RJCA 5GMKe 2YUPA 1JJ2S 1N8RC 4M7AE 2RPNA 4Z89A 2X9HA 3CPWS 4RTUA 4M77B 1K76A 1YJNQ 2MOXA 4OF1A 1Y7XA 2YDLA 3RBBB 4BDYA 3URGA 1QKWA 4C8QF 3CCSA 4AFQC 2LTOA 1ZSZC 8AT1B 4FL6A 4OP0A 2CZ7B 2SRCA 4HKEA 2LQNA 4Z8AA 3FRNA 2ESWA 1A0NB 5GAMe 1IHVA 1IZ6A 1IO6A 1K8AU 4OGCA 2QQRA 5FLXE 3SFMA 1VYVA 2GGRA 1CKAA 3QO3A 4EMKC 2M9UA 3QJYA 1M90U 3OW2S 4RG8A 1I8FA 3HRSA 4OMMA 4M7AB 3GOXA 1D3BB 2P0QA 3QIIA 4AG2C 1MGQA 2ZPBB 4KH0B 2KRNA 4LD6A 4F7UB 1VQMT 4PFZA 2ECZA 2HQEA 3I56Q 3PE0A 5I2MA 3EGXB 1PD0A 2EYWA 2P4RA 3JCMX 4J5YA 5GAOl 3QSUA 1NLOC 4OMQA 2JNGA 4M7DG 1VQ4A 3VS1A 1XJWB 1X69A 2KSSA 2MYSA 2VC8A 1WHLA 2DEUA 4PJOD 1QP2A 5GANe 1LNXA 2IIMA 8ATCB 2KXCA 2E3HA 1LPLA 1WGSA 2J7IA 4HVVA 5FRNA 1Q81C 4QQ6A 2DZCA 2P0KA 3L2RA 2LCCA 2Y4YA 4Z02A 1BYMA 2F1LA 3JB9J 1FXXA 1H3HA 5GMKm 2RA2A 2YUQA 2LX7A 2IVWA 2K9GA 2E6ZA 1MNDA 1VQ7Q 1GRIA 3JV3A 1TTHB 2A37A 1D0XA 5A2QE 1WI7A 5GAN8 3H0HA 3CCUA 1Q86U 2I0NA 1K9MC 5AYFA 3I5RA 4GLKA 2R5MA 3CCMA 4PNOA 2GTOA 2O4XA 2K79A 5GAN7 4ZNXA 2KT1A 5DM7R 2DD4A 3NTHA 5GANd 2DA9A 3F70A 3JB9G 1S1NA 1N9RA 4Y28E 5CKFA 2NUZA 1W1FA 2KRMA 4AMCA 2LC4A 1KD1C 1M1KR 1EZZB 4JRQA 4CC4B 1U8RA 4XQ3A 1AD5A 4C92C 4NL3A 2JVVA 3PNWC 4WF2A 2HBPA 3VKIA 4FW2A 3X28B 1KFZA 4A4EA 4J9DA 3BFMA 1B34B 1ZA2B 1I07A 3CC4A 1H8KA 2VKNA 1JJ2P 3I9QA 4QW2A 5KE2A 3CCJT 1KQSP 1I4K1 2H3EB 3G7ZA 4B9XA 4KULA 5LJ3h 3REAB 4P5NA 4RCBA 4HCKA 3JAME 3CCUQ 2CDTA 2K5LA 4WCIA 4AG1C 3CCST 1RACB 1LOJA 3EHRA 1PM3A 1EFNA 1GL5A 4E47A 3EFRA 2CSIA 1KC8C 1KQ2A 4JS4A 3THKA 1U1TA 3L2VA 3CCUT 3R6OA 3MEVA 2EJFA 1ABOA 3CCEA 2QTXA 1VQNT 3OS1A 1QVFA 2DTOA 2CP7A 4DEXA 3QXEB 1JBMA 1WQ7A 1KC8R 5IN1A 3OBWA 2RQWA 4J6YA 1WHJA 3NFCA 4PJOF 4RMOA 1Q82R 1VQLA 4E2FB 1MMGA 3E2UA 3TQ7P 4HCBA 3TREA 4DA4A 4IIOA 4AFUC 4LD9K 4CC2A 1QVGP 4FSXA 4RG2A 2RF0A 1JJ2A 2LDMA 1VOMA 3ZFJA 2PUOB 4C8QA 1UGVA 3I56A 5HKCA 1Y07A 3I35A 4M78F 3ASKA 1OPLA 2ED1A 1VQ9A 2HL3A 2EJGA 2CUBA 3KBGA 2CH4A 3RESA 2X4YA 2C0OA 3M59A 1M4ZA 2XICA 3JB9I 1YP5A 3RKYA 4J6XA 1TWBA 2JS2A 2BIVA 3JCMQ 5DLOA 5M9OA 1WFWA 3CD6A 4PJOC 3NHNA 4DBRA 4C0FA 2X4JA 3E19A 3CCQT 1VQLQ 2EGEA 3E9FA 2EYYA 2HMAA 5GAMd 3BE3A 4F16A 3I55Q 3RIRA 2L3RA 2L0AA 3QWXX 1K4US 1SSHA 1JB0E 3OYEA 2YRVA 2YUOA 2CP2A 2QQ9A 5L8RE 1FMWA 1B3QA 3C94A 1ZUUA 2AKLA 2KE9A 1WHGA 4IKFA 3PMIA 4BD3A 2E6NA 2BZYA 3LGLA 4M75B 2EW3A 4M78A 1NE8A 4Y91A 3LW5E 3JCMP 2GQIA 2JM9A 3S6WA 4MDXA 2KK4A 3HFNA 2DXUA 3V7SA 3A98A 4BACA 4QVZA 4Y92A 2M0OA 3MKDA 1VQ8T 2E70A 2FL7A 2XIDA 5A0LA 3U23A 1YN8A 5GAN5 3ZBDA 4QQGA 2QI2A 3MP1A 2DL8A 2DTIA 5KYWA 3G6EA 1I81A 2D0QB 4A4KA 2YT6A 3INZA 3VS0A 3CMAQ 1NLPC 3EG3A 2L2PA 2DXTA 1RADB 4M77C 1G3YA 3QYGB 3M5AA 2P84A 1MMNA 2BTTA 2YSQA 1AWWA 2OTJQ 4M78G 3OYFA 2EQIA 4N0AC 2F5TX 4C92D 1OPKA 2V1RA 1PHTA 3JCMg 2L3PA 3G4ST 2LT1A 5KE3A 2XDBA 3OBYA 4M77E 1S72T 5GAMg 4PJNA 5FU6B 3X20B 4BB7A 1ZLMA 1M90C 4M75D 1HYOA 1I5OB 1WA7A 3G4SQ 1TUGB 4B9WA 2OTLA 4JDSA 4FT2A 1S72Q 2CP0A 3UDCA 1OI1A 4M77F 5CVIA 2C06A 5LJ3j 1ZHIA 4MZMA 2QQAA 2XDPA 1YWPA 1NJIU 2K2MA 2ED0A 2MF2A 2HSEB 4RKUE 1M9SA 4XAXB 4ME7A 2O9SA 1YJ9A 1VQ7A 2EGCA 4JLGA 1VQOQ 3RMQA 2YRDA 2AK5A 7AT1B 1U5SA 3JCMJ 2L8DA 4OB0B 5KYNA 1GFCA 3CCET 3VYGA 2MIOA 1KQ1A 1WJQA 2OX7A 3BW1A 2FRYA 1WQWA 1Z9QA 1ZA1B 2A08A 2DJQA 3FLGA 3UA7A 3META 5I2SA 3HSBA 2KGTA 2DO3A 4FYXB 3TSZA 2J6FA 2ZPIB 1NG2A 4RTWA 2DYIA 1VQKQ 4LXCA 2FZGB 5CAIA 2L5QA 5KYWB 1Q81U 4J8OA 4LDUA 5D6YA 4C5GA 3EG1A 4IUTA 4OB1B 3H6ZA 5LJ3e 4IUQA 1NJIC 3EG9A 2KDSA 2HCKA 3VS5A 1VYUA 3C0CA 4OMNA 2FPDA 5C6SA 1VQPT 1QVFS 2AZSA 3PVQA 1WDXA 1R0BG 4UC4A 3PT9A 1LJOA 2EQJA 3SWNA 2LCSA 2XK0A 3EH2A 3HTRA 2YXYA 4TVRA 2DBMA 1NYGA 3CC7T 4MZPA 4E7LA 5I21A 4IUUA 2LNHB 4XU2A 3M0QA 2X35A 1M2OA 1Y96B 3I56T 3PMTA 4HXJA 4XTXA 4DQ2A 1WHMA 1RL2A 4M77A 4CI0C 3PFSA 3TSWA 3QKJA 1JQQA 4HCZA 3CC7Q 1YHQT 5GMKl 2CYZB 4A4HA 2J6OA 4J7IA 2MWPA 1WJSA 1UJYA 3S3OA 4KRTA 4MDWA 1PCXA 5J39A 3QPHA 2E65A 4II1A 3CBPA 4M7AD 2JMCA 1KD1U 1MUZA 3AT1B 3M0UA 4NOYA 2EPDA 3MEUA 1HD3A 3CCVQ 1UUEA 2CP6A 2F2XA 1TUCA 4FM4B 4BUGA 1JO8A 1OZ3A 4E7SA 2RJFA 2P0PA 2XI9A 5LJ3f 3VS4A 1FX7A 4ZGEB 3N5BB 4ATOA 3CCVT 3LH0A 4MMLA 1GBQA 4Q5WA 6AT1B 3A5ZB 4LUDA 2XG8D 4J9HA 2YUNA 2DERA 4ZN1A 4E7IA 1VQ5T 2LMJA 4OMFB 4M7AA 1O9SA 1RI0A 2KI7A 3CXCP 2K3YA 5A0DA 2QEXA 1N27A 2RI2A 5CIUA 2XDDA 2PTKA 1WLPB 5GAN4 4M7AG 1V1CA 2CH4W 4AFZC 3PGGA 1AOJA 2OAUA 2P4TA 1AHJB 1X2KA 1AEYA 1NPPA 2KAFA 3OMCA 2VXEA 4E7KA 4BE0A 1M5Q1 1Q81R 1BCMA 2D1XA 1E6GA 2A36A 3H9NA 2YLBA 1OX8A 3MCAB 4BI8B 2CUDA 3ZEHA 4BI3A 1D1BA 3EFOB 5I11A 4XU0A 1W70A 2X51A 1YJWA 5LL6S 2F2WA 4M7DA 5GANf 1NBEB 4HT9A 1HXDA 2DD5A 1VIEA 1VQ6A 3S3MA 1UJ0A 2COWA 1UHCA 2QYZA 2SEMA 1T0JA 2J06A 3CCJQ 4F7UG 1QCNA 2FPEA 2VB6A 5KYYA 4EMHA 2R58A 1K0SA 2VGMA 2DFUA 3RNJA 3G71Q 3CPWP 5KYXA 3JB9D 3TU4K 1M1KU 1YIJQ 1LCKA 1LVKA 4PJLA 4HT8A 1SSFA 2EQMA 3CBOA 2GQVA 1BU1A 2COYA 3FJ5A 1NJIR 4E7JA 3WVEB 1R8OB 3G71T 3S3NA 2DL5A 1K73C 1Q82U 1K0XA 1SRMA 3OYIA 2PVDB 1OX9A 3SD4A 1RABB 1BIBA 2ZCFB 2QASA 2O4XB 4M7DC 2X3XD 3CPWA 2E12A 3JCMc 1BI2A 3I5SA 2DE0X 3UWNA 1Q86R 1RAEB 2GNCA 5J3BA 2BKDN 4J83A 1XNIA 1NM7A 4LE9A 2JT4A 4JZ4A 4OMLA 1E6HA 2ROTA 4ESRA 5KH6A 1KSWA 1D1AA 2E5QA 3V8JA 4KT0E 1YI2A 1EX4A 1SHGA 2YHTA 4MZTA 5GMKh 1EIFA 2RJDA 1P92A 2DL7A 1UGQB 2PU9B 4PK4A 1MMAA 1TG0A 1N8RU 3CCRT 3UF4A 2DK3A 1NYFA 4BI4A 1VQ5A 2AKKA 4PLLA 3CCMT 4FYVB 1V76A 1PG5B 3OYHA 2QEXT 3CCLT 3RERA 3ZL7C 2O88A 1H3ZA 3QUIA 4X34A 1SRLA 2RHUA 3SDZA 1X01A 2K5IA 2FVUA 3EGDA 2QDYB 3M58A 3CCLQ 5GJWB 4X9CA 2NWMA 3O8VA 4RTZA 3IQLA 2LJ0A 2RHXA 3PTAA 1C0MA 2Z0WA 3EH1A 1FMKA 5IT9E 2PVOB 3X24B 5KCHA 2NYSA 3VJPA 2B8AA 1YNZA 1I5LA 1OU9A 1BBZA 2M16A 4LDXA 2FO0A 3RR6A 4C5IA 4CRIA 3WXMB 1VQ6T 3DLMA 3MEWA 4M78D 2HL5C 2EBPA 2M1HA 4E6RA 3M57A 3OYCA 1VQOA 3CCJA 2FRWA 2YWWA 1YJ9Q 1XQHA 1B07A 3CC2A 3CC4T 1M8MA 1BI3A 3GLXA 2OTLT 4JLIA 3OYBA 1VQ6Q 1ZSZB 5FRMA 2X3WD 2HBWA 2F69A 4V2SA 1YHQA 2C0IA 3L2QA 4DOWA 1S72A 4JUVA 1SHFA 2OTLQ 3H41A 2VVKA 3G4SA 2EYZA 3VRZA 2PNIA 4M4ZA 3LLRA 2V26A 2DIGA 2COZA 2A7YA 3M54A 5GANj 3OYDA 3SWNC 4KGZB 3G1JA 4IUPA 2AIRB 2QDLA 2XMFA 2CGHA 4B6MA 5IHKA 4DBFA 4KGVB 5DLQE 4PL6A 3HPWA 2QXFA 1R77A 5IHIA 4LN2A 3OQ5A 2KR3A 3SB2A 4DEYA 2DVJA 2RD1A 3GF5A 2EQKA 2DL3A 1FMVA 1BB9A 1PC0A 1D3BA 4J9FA 4VUBA 3VV0A 4EIKA 5CKDA 3OMGA 4N4HA 4JZ3A 2JTFA 3G6EQ 3OS0A 3OY9A 1KHCA 4KBMB 3OB9A 3CCQQ 1AZEA 3A1PA 3VS6A 1K9MR 1X6BA 4RTTA 2MCNA 2LZ6B 4GLMA 1QP3A 3I55T 2LT4A 2K6DA 4A63B 2QA4T 1U1SA 4O5VA 2QTVA 1G3TA 4ZGJB 2EQUA 3CCVA 1AWXA 4FIBA 3C95A 1RLPC 2DPPB 2CZ1B 2GTJA 1UECA 4PLIA 1YITQ 1K8AC 5LJ5e 2DLPA 2RH2A 2NUPA 2EYXA 5EG2A 1D0ZA 1JXMA 2AZVA 4J9GA 1C6VX 2RQVA 3X25B 2EKOA 3L2ZA 1B7TA 1YITT 4JS5A 2BUDA 2NUTB 2FG0A 3MO8A 1K8AR 2KVQG 1Q7YU 3VRYA 1KG1A 4ORZA 3HHTB 4F14A 4M7DB 4KUDK 2DBKA 2XHCA 3NTKA 2EFIA 1ZSZA 2PZ1A 5GMKj 4M75G 2HAXA 1ZUKA 1N5ZA 1ARKA 4RCCA 2HKQB 2D9TA 2HZYA 2K2VA 4ZTFA 3JB9F 2GFUA 1Y96A 3MHXA 2YRCA 2HSPA 3TVTA 1F1BB 1AVZC 2BZ8A 1M3BA 4XTWA 3DKMA 4ELZC 3M4GA 4XU1A 2JUFA 2J6KA 1WXTA 4XTUA 2RHYA 4M75F 2BZXA 1UHFA 2FYKA 2RMOA 2ABLA 3H0IA 1PWTA 3GP8A 3CMET 1Q7YC 5I22A 3DB3A 3EFSA 3DB4A 3OYGA 3E1SA 3JCMV 1RAAB 2L89A 3JB9H 1SEMA 2DVEA 4X1VA 2R5AA 3CMEQ 1QCFA 4IURA 3NTIA 3OSSC 4FCYA 4OVAA 4D8KA 2EVRA 2IPOB 1FWZA 2J05A 5LJ3g 3MJXA 1VQOT 1VQNQ 5HK3A 2EWNA 4PKCC 1OYXA 3EGXA 1YJNT 3LWHA 5CK9A 5GAOp 4HCCA 3V8LA 3JCMd 1IREB 3VUZA 2RQUA 1OU8A 2KYBA 3BDLA 2DX1A 2WSCE 1B34A 1W4SA 3CXCS 1N9SA 2RB6A 5HK0A 3EG0A 3HRUA 4EMKA 2OI3A 1WHKA 2ZGWA 2NUPB 1K1ZA 2RO0A 2DJZA 2CT3A 4FW1A 2FZKB 2HQHA 1ZBJA 3ER0A 4JRPA 2E10A 2RI3A 4C0GA 1D09B 1RLQC 2RQRA 1QVFP 5CO7A 3T9NA 2E64A 2FEIA 2DYBA 4F04B 2VYTA 2E41A 1XTDA 2DETA 2JN0A 1SF9A 1BK2A 3OYKA 4L5GA 2VGNA 2OTJA 1BCOA 1M90R 4J9CA 2JMAA 5ECAA 1BI0A 2MMPA 5KYYB 1GCQC 1NPRA 2W0ZA 1HSQA 3E9GA 3CMAA 1WJRA 4DBQA 5HY6A 2A0FB 3V7CA 4KH1B 1RAHB 2KT8A 3CBMA 4C5EA 3J7AF 5D6WA 2E3IA 2V8IA 2DF6A 2OAWA 2DRMA 1N8RR 4LDWA 4JJDA 1VQNA 3QHSA 1KQSS 3QWYA 2VASA 4E7ZA 1CKBA 3JRZA 1PKTA 4RTVA 2XU8A 3VS7A 4YTLA 1OQKA 2JXBA 1UTIA 5GAMf 1YFNA 2L3QA 4M7AF 1M1FA 2AT1B 1TSFA 3I55A 1YIJT 3GIBA 3X26B 2LJ3A 1AWOA 4ZN3A 3UATA 5IXBA 2DIQA 2K3XA 5CKHA 3CD6Q 1PNJA 5CKBA 3JSCA 2OTJT 1V29B 2QQSA 2QGFB 1ABQA 1DJ7B 3V8KA 5IXFA 4F7UA 2EJ9A 1TXQA 3L2WA 2HDAA 5GAMh 2DRKA 3OYLA 3ULRB 4C92A 4OB2B 1VQ9Q 4PJJA 1NEBA 2L3SA 3GBQA 1SG5A 3KUFA 3FB9A 3KXTA 2O2OA 5GAOm 1N6AA 1JRIA 1M2VA 1WX6A 2GF7A 2MAMA 4OGEA 1U3OA 5GAOq 2Y90A 3H0FA 4C0DB 1Z9ZA 1IB8A 4ZGDB 3SEMA 3A8GB 4OB3B 3EG2A 5KYXB 3M0TA 1VYTA 2CREA 4C92E 3JCMW 4NS5A 4WTOB 4FYWB 2HNIA 1Q86C 1G5VA 3QDRB 3OYYA 1M1KC 2K3BA 3J81E 3CCEQ 1PKSA 4C8QB 3CCSQ 2C0TA 2KEAA 5GANh 2DZ9A 4BE1A 5GAN6 4KUIA 2MI6A 4C92F 1OEBA 1Q95G 5FWCA 2XKOC 1NZ9A 4D8DA 3J80E 3H8ZA 3L42A 3R6NA 2DAQA 2E4HA 4FU6A 4J9IA 2V1QA 2FZCB 4FYYB 1WNLA 1QVGA 1UFFA 1Y71A 1HK9A 3CCQA 2ENMA 1MNEA 3VU3C 1QCOA 1VQKT 2LJ1A 1OV3A 3HRTA 3QJ6A 3CC4Q 1UDLA 2MPXC 4RUGA 1I0CA 2IG0A 3CCRA 2KRSA 2ZPEB 4XU3A 4M77D 3RDVA 1VQMQ 2JTMA 2D8JA 3OSVA 1AWJA 4GBQA 3MEAA 1OOTA 2Y4XA 4QT7A 2MWOA 4M75C 2RK2A 4CC3A 1VQPA 5LJ5g 2FPFA 3EGDB 3LH5A 4M78B 3HP9A 5FU7B 4F17A 3REBB 2DM1A 1VA7A 4N4GA 3CCMQ 2MK5A 1NEGA 4GY5A 3BY7A 1YHQQ 2LP5A 2DILA 1D1CA 1VQLT 5FW9A 4FSSA 2DTHA 1MV0B 2LQ8A 3C4SA 3EAEA 2V8JA 4PFOA 4PJOB 3HL8A 1UGSB 1WZOA 1KC8U 2E5KA 3CC2Q 4MMKA 2CZ0B 4BE2A 4C92B 3OA6A 3D7SB 2GCXA 4JJNK 3LYIA 5CCAA 2QAZA 1X43A 2KMTA 1YCSB 2EAYA 1QWEA 1VQ8A 2KROA 1VQ7T 3CC2T 3FDRA 2HKNA 5CQYA 4M77G 3TEEA 4LDVA 2QA4Q 3ME9A 4EPCA 2BE7D 4ANJA 4HVUA 4ELYC 5LJ5d 3CMEA 1VQ4T 2QGGA 4OMPA 1UGPB 2RHZA 4DBHA 2JM8A 2M02A 1H92A 2JZ2A 2RQTA 2CS7A 1MHNA 2I2LA 4IIMA 1WIEA 3O5ZA 2EKHA 3FC3A 1GCQA 1T3LA 3VUBA 4HVWA 1VQ4Q 1VIFA 3PIOA 1UG1A 2G6FX 3NGPA 4AT1B 1YWOA 5KCOA 5GAN2 4QKUA 1WHHA 2KXDA 2H3JA 1C1AA 2ROLA 5CKEA 4BY6B 1VUBA 1OZ2A 1YI2T 4M7DE 3KFVA 2RN8A 4A54A 4D6WA 2VXFA 3NMZC 1AT1B 4PFPA 1ACMB 1UE9A 3OYJA 1TU0B 5DY9A 3JCMb 2D6FA 1MV3A 3LX7A 2R57A 2O01E 2ZAEA 1GCPA 4LDYA 1GFDA 2K7AA 1YI2Q 3RUXA 5KYUA 1PSEA 5J26A 2GFAA 2M51A 2CP3A 2F2VA
chains in the Genus database with same CATH topology
2JNGA 4XU2A 2QQBA 4M7DG 4N4IA 2X35A 4M78E 1VQ4A 1Y96B 3I56T 3GP8A 3PMTA 3CMET 4XTXA 1Q7YC 4DQ2A 1RL2A 4M77A 4CI0C 3PFSA 1QW1A 3A8HB 3QKJA 2KSSA 3DB3A 3EFSA 3DB4A 3OS5A 2VC8A 4HCZA 2YLCA 4PJOD 1QP2A 2A3LA 5GANe 1LNXA 3E1SA 3OYGA 3JCMV 1UGRB 1BIAA 5GMKl 1YHQT 2CYZB 4A4HA 1UEBA 2L89A 3JB9H 1WGSA 4J7IA 2MWPA 2DVEA 1WJSA 2R5AA 4J6WA 5FRNA 4A4FA 3S3OA 1Q81C 1GXIE 4QQ6A 4IURA 4MDWA 2DZCA 3NTIA 3OSSC 4M75A 4C0ZA 2P0KA 3OYNA 2LCCA 2Y4YA 1YCYA 4Z02A 3L2RA 1BYMA 4OVAA 5J39A 1FWZA 3JB9J 2V8KA 3QPHA 1FXXA 5LJ3g 2JOYA 1YIJA 2E65A 3P8BB 4II1A 5CQXA 1G3WA 3CBPA 1YITA 4QVCA 3G71A 1VQOT 1KD1U 4M7AD 1YJNA 4EMGA 5GAN3 2G3RA 4NOYA 5GMKm 2RA2A 3MEUA 5HK3A 2EWNA 4PKCC 1OYXA 2IVWA 3LWHA 2E6ZA 4FM4B 4BUGA 5CK9A 5GAOp 4R56A 3OYAA 1YJNT 4C92G 4HCCA 4BY6C 4BDZA 3V8LA 3JCMd 4M7AC 2PQWA 1OZ3A 3TCJA 3JCMe 1YJWT 4JRKA 1IREB 2RJFA 2P0PA 2XI9A 5LJ3f 3VUZA 5FU6C 4EMKB 5A2QE 5GAN8 1FX7A 3CCUA 2WACA 4ZGEB 3N5BB 3BDLA 4ATOA 3QZ5B 2WSCE 1Q82C 1B34A 1W4SA 4O6JA 3LH0A 3CXCS 3CCVT 1N9SA 2RB6A 1Q86U 2X4XA 4MMLA 1K9MC 5HK0A 4Q5WA 3HRUA 5AYFA 3OYMA 1BI1A 3A5ZB 4EMKA 2XG8D 3QZ9B 3VYHB 4PJOA 4GLKA 2R5MA 4M75E 2ZPFB 2PVGB 2ZGWA 4ZN1A 1TH7A 3CCMA 4E7IA 1VQ5T 4PNOA 4OMFB 2O4XA 4M7AA 1PSFA 2RO0A 5GAN7 1O9SA 1RI0A 5DM7R 2DJZA 5LJ3d 2K3YA 3ER0A 4JRPA 2E10A 5A0DA 2DD4A 2ZPGB 3NTHA 5GANd 2QEXA 5C0MA 2RI3A 4C0GA 3F70A 1M8VA 3JB9G 1N27A 2RI2A 5CIUA 1N9RA 1WPYA 2XDDA 1W2BS 4Y28E 5CKFA 5CO7A 5GAN4 4M7AG 3T9NA 2E64A 1W2BA 2LC4A 1KD1C 2VYTA 3PGGA 2OAUA 2E41A 1XTDA 4JRQA 3HKSA 2P4TA 2JN0A 1U8RA 1AHJB 4XQ3A 3OYKA 1NPPA 2KAFA 4PJOE 3OMCA 4C92C 2VXEA 4QVDA 4E7KA 4L5GA 2VGNA 4BE0A 1KQSA 4NL3A 1M5Q1 2LQKA 2JVVA 2OTJA 3PNWC 3DLLA 4WF2A 2HBPA 3VKIA 1KC8U 3X28B 2YLBA 1BI0A 2MMPA 4BI8B 3MCAB 4A4EA 3ZEHA 4BI3A 3BFMA 4JRIA 1B34B 4C8QD 1BKBA 1NPRA 3CC4A 4XU0A 3E9GA 3CMAA 1WJRA 1YJWA 5HY6A 5LL6S 3V7CA 4QW2A 5KE2A 3CCJT 4M7DA 2LX9A 1G3SA 3CBMA 5GANf 2HQXA 4C5EA 3J7AF 3FEOA 5D6WA 1I4K1 4XTZA 1XOVA 3G7ZA 4B9XA 4KULA 5LJ3h 3L2UA 2V8IA 1HXDA 2DD5A 4P5NA 4RCBA 1VIEA 3JAME 4E7HA 4C8QE 3S3MA 1VQ6A 3UT1A 3FIFA 1KHIA 2K5LA 3QYHB 3OW2A 3CCST 1LOJA 4F7UE 4XTVA 4F7UG 4E47A 4LDWA 3EFRA 4EMHA 2R58A 2LNVA 1VQNA 2K5FA 3M9QA 2VGMA 3QHSA 1KC8C 1KQ2A 4JS4A 2NLUA 1KQSS 1U1TA 3L2VA 3CCUT 3R6OA 3JRZA 3GNFB 3MEVA 2EJFA 4A4GA 3TU4K 3JB9D 1YJ9T 1M1KU 4HT8A 2XU8A 1SSFA 2EQMA 3CBOA 4YTLA 5FROA 3CCEA 2DXCA 2WSEE 2QTXA 1YBYA 3JCMf 2F5KA 2GQVA 1VQNT 4XTYA 3OS1A 2KQWA 3CEYA 2EIFA 4F7UF 2DTOA 5GAMf 1QVFA 3M56A 3QXEB 1JBMA 4E7JA 1WQ7A 3WVEB 5D6XA 3FJPA 1R8OB 5IN1A 3LWIA 3G71T 1M1FA 3S3NA 3CCLA 4M7AF 1K73C 3I55A 3OBWA 2RJEA 3OS2A 4ZTJA 1YIJT 3CC7A 1Q82U 3CMAT 3GIBA 3GPLA 3X26B 4J6YA 4PJOF 3NFCA 3OYIA 2PVDB 3QG1A 1ZBXA 3SD4A 1BIBA 2ZCFB 4XK8E 4ZN3A 4PJOG 2O4XB 4RMOA 4M7DC 1VQLA 2DIQA 3CPWA 2E12A 3JCMc 1BI2A 2CZ6B 2K3XA 5CKHA 3TREA 2RK1A 3UWNA 4HCBA 3RMSA 5CKBA 3WVDB 3JSCA 3A8MB 4DA4A 2OTJT 1V29B 2QQSA 5J3BA 2BKDN 1DJ7B 4J83A 1XNIA 2HD0A 3V8KA 4LD9K 3P8HA 4M7DD 4F7UA 3HFOA 4FSXA 2EJ9A 4IUVA 4RG2A 3RKXA 5KH6A 2E5QA 1JJ2A 2LDMA 3V8JA 4KT0E 1YI2A 3L2WA 3A8OB 2PUOB 3ZFJA 5GAMh 4C8QA 2K57A 1K73U 2YHTA 3I56A 5HKCA 3C12A 4MZTA 1Y07A 5GMKh 3OYLA 1EIFA 4M78F 3ASKA 4C92A 4QQDA 2K4YA 2RJDA 4OB2B 5GAOr 4A53A 5GMKi 1P92A 1VQ9A 4N0AA 1UGQB 2PU9B 2EJGA 3L1AA 3V7RA 5GAOn 3KBGA 1N8RU 3CCRT 2CKKA 3KUFA 3FB9A 3RESA 2X4YA 3M59A 3KXTA 1M4ZA 2DK3A 4L59A 1X6OA 2XICA 4BI4A 5GAOm 1VQ5A 3JB9I 4PLLA 3CPFA 3CCMT 3RKYA 4J6XA 1VQ9T 1JRIA 1N6AA 2BIVA 3OYHA 3JCMQ 2GF7A 2MAMA 5DLOA 2QEXT 5M9OA 3CCLT 1VQKA 4OGEA 3G6ET 3CD6A 5GAOq 4PJOC 2Y90A 2RM4A 3RERA 2DXBA 1QVPA 2X4JA 3E19A 2PUKB 2VUBA 4C0DB 4C0FA 3E9FA 3CCQT 1H3ZA 4ZGDB 3QUIA 5GAMd 3A8GB 4OB3B 4C0DC 4X34A 2FB7A 3RKWA 2RHUA 3SDZA 5GAMj 1X01A 4C92E 3JCMW 2K5IA 2FVUA 2DKGA 4NS5A 3RIRA 2WSFE 2HNIA 2QDYB 1Q86C 3M58A 2L3RA 1G5VA 4X9CA 3O8VA 4DOVA 1JB0E 1H641 3P8DA 3QDRB 2RHXA 3OYYA 3OYEA 3PTAA 2YRVA 2QQ9A 5L8RE 1M1KC 5IT9E 3M4YA 2PVOB 3C94A 5FU7C 3J81E 2QA4A 1M1GA 3X24B 4M78C 4C8QB 4IKFA 1O75A 5KCHA 3VJPA 2B8AA 5GANh 1I5LA 3A8LB 2DZ9A 3PMIA 4BD3A 2E6NA 2M16A 4BE1A 4LDXA 5GAN6 4C5IA 3LGLA 4CRIA 4KUIA 2E1HA 4M75B 2KY9A 2MI6A 3WXMB 2LVMA 3DLMA 3MEWA 1VQ6T 4M78A 4M78D 1NE8A 4Y91A 3LW5E 4C92F 3JCMP 2EYQA 2M1HA 2XKOC 1NZ9A 3M57A 3J80E 3OYCA 3H8ZA 5CR2A 3S6WA 1VQOA 1QVGS 3CCJA 4MDXA 3L42A 2KK4A 3HFNA 1XQHA 2DXUA 2DAQA 3V7SA 2ZPHB 4BACA 4QVZA 2M0OA 3M53A 1BI3A 4FU6A 3CC4T 1VQ8T 3CC2A 3GLXA 2E70A 2FL7A 2OTLT 2XIDA 4JLIA 3OYBA 4X9DA 5A0LA 5GAN5 1WNLA 2X4WA 3ZBDA 1QVGA 5FRMA 3AHUA 1Y71A 1HK9A 4QQGA 2QI2A 3MP1A 3CCQA 2DTIA 3VU3C 2F69A 3G6EA 4V2SA 1I81A 1YHQA 2RHIA 1VQKT 2D0QB 4A4KA 3JCMh 3L2QA 3INZA 3HRTA 3QJ6A 4DOWA 2DXTA 4R55A 4JUVA 4M77C 1G3YA 1S72A 3MP8A 2FHDA 3GNGA 3QYGB 3M5AA 2DEQA 3MP6A 3G4SA 2IG0A 3Q1JA 5LJ5f 3CCRA 3CD6T 2ZPEB 4XU3A 2AHJB 3QBYA 4M77D 4M78G 1ZQ1A 3LLRA 3LGFA 2DIGA 5IAYA 3OYFA 2A7YA 3M54A 4NL2A 5GANj 2JTMA 4N0AC 3OYDA 2F5TX 3M55A 3SWNC 3OSVA 4C92D 3MEAA 3JCMg 2VV5A 2LT1A 2Y4XA 3G4ST 4IUPA 3UPUA 5KE3A 2XDBA 2MWOA 3OBYA 4M75C 2CGHA 2RK2A 4M77E 3CXCA 2LCLA 1VQPA 1S72T 5LJ5g 5GAMg 4L6V5 1VQMA 4EDUA 4FT4A 2RI5A 5FU6B 3X20B 4M78B 4BB7A 4C8QC 3HP9A 5FU7B 1M90C 4M75D 5DLQE 2LRQA 4PL6A 3HPWA 2QXFA 1UB4A 3SB2A 3OQ5A 4B9WA 2RD1A 3GF5A 2OTLA 2EQKA 2ZZDA 4FT2A 4JDSA 4N4GA 5LJ5h 3PIPA 1D3BA 4VUBA 5LJ5j 3VV0A 4GY5A 1K9MU 4HT9A 3UDCA 5A0GA 3BY7A 3OMGA 1OI1A 4N4HA 5CKDA 4M7DF 2JTFA 3OS0A 3OY9A 1KHCA 4M77F 4KBMB 3OB9A 5CVIA 2C06A 5LJ3j 1VQLT 1ZHIA 2DTHA 5GANg 2LQ8A 3C4SA 3EAEA 4MZMA 2XD0A 2QQAA 3SWNB 2XDPA 2V8JA 1NJIU 4PJOB 1X75C 2MF2A 4J7FA 3HL8A 1QP3A 1UGSB 4RKUE 1M9SA 4C8QG 2LT4A 3BDUA 2CZ0B 4MMKA 4XAXB 3I55T 4ME7A 4BE2A 4C5HA 4C92B 1YJ9A 3OA6A 4HA8A 1U1SA 2GCXA 2RJCA 4O5VA 5GMKe 2QA4T 4JLGA 1JJ2S 1N8RC 4JJNK 4M7AE 3RMQA 1G3TA 4ZGJB 2EQUA 3LYIA 5CCAA 3CPWS 3CCVA 3JCMJ 2L8DA 4OB0B 4FIBA 2KMTA 3C95A 4M77B 2DPPB 2EAYA 2CZ1B 3VYGA 3CCET 4PLIA 1VQ8A 1KQ1A 1WJQA 1Y7XA 4OF1A 1K8AC 1VQ7T 3CC2T 3BW1A 3FDRA 5CQYA 4M77G 3TEEA 1WQWA 5LJ5e 3URGA 4C8QF 3CCSA 4BDYA 2RH2A 2LTOA 4LDVA 3ME9A 4EPCA 5EG2A 4ELYC 3FLGA 4FL6A 5LJ5d 3CMEA 1VQ4T 3META 4OP0A 3X25B 5I2SA 1UGPB 2RHZA 2EKOA 3L2ZA 3HSBA 2CZ7B 1YITT 4JS5A 2BUDA 4HKEA 3MO8A 2JZ2A 3FRNA 2KVQG 2CS7A 1Q7YU 1MHNA 1KG1A 5GAMe 2I2LA 3HHTB 1IZ6A 4M7DB 3FC3A 2DO3A 1K8AU 4KUDK 3VUBA 2XHCA 4OGCA 2ZPIB 2QQRA 5FLXE 3NTKA 1VIFA 2EFIA 3SFMA 3PIOA 5GMKj 3QO3A 4M75G 2HAXA 5KCOA 5GAN2 4EMKC 2M9UA 4RCCA 3QJYA 2D9TA 1M90U 2K2VA 2L5QA 5CAIA 4RG8A 3OW2S 1I8FA 2H3JA 5CKEA 4BY6B 4ZTFA 3HRSA 4M7AB 1Q81U 3GOXA 1D3BB 3JB9F 2GFUA 1Y96A 1VUBA 2P0QA 3MHXA 3QIIA 1OZ2A 4J8OA 4LDUA 5D6YA 1YI2T 1MGQA 4C5GA 4M7DE 2ZPBB 4A54A 4IUTA 2VXFA 4OB1B 4D6WA 3H6ZA 5LJ3e 4IUQA 1NJIC 3OYJA 2KDSA 4LD6A 4XTWA 5DY9A 4F7UB 3JCMb 1VQMT 2D6FA 3DKMA 3LX7A 4ELZC 5C6SA 1VQPT 2R57A 2O01E 3M4GA 1QVFS 2HQEA 4XU1A 4LDYA 4UC4A 5I2MA 3PT9A 2JUFA 1LJOA 2EQJA 3SWNA 3RUXA 2XK0A 4XTUA 3JCMX 4TVRA 2RHYA 4J5YA 4M75F 5GAOl 3QSUA 1VQ7A 2FYKA 1PSEA 5J26A 3CC7T 4MZPA 4E7LA 2GFAA 5I21A 4IUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DLO A;  1M1F A;  4HKE A;  5CKF A;  5CO7 A;  5HKC A;  4MZT A;  5CCA A;  2VUB A;  4VUB A;  5HK0 A;  5CQX A;  2KMT A;  3NFC A;  5CKD A;  3JRZ A;  4OF1 A;  4ELZ C;  3VUB A;  1NE8 A;  2C06 A;  5HK3 A;  5CQY A;  3G7Z A;  4MZM A;  5CKH A;  5CK9 A;  5CR2 A;  5CKB A;  3JSC A;  4MDX A;  1X75 C;  2MF2 A;  3TCJ A;  4ELY C;  5CKE A;  3HPW A;  4ME7 A;  4MZP A;  1UB4 A;  1VUB A; 
#chains in the Genus database with same CATH topology
 2QQB A;  4N4I A;  4M78 E;  3EGU A;  1T0H A;  1QW1 A;  3A8H B;  1WXB A;  3OS5 A;  2YLC A;  4JPB W;  2A3L A;  1UGR B;  1BIA A;  1UEB A;  3M0S A;  3EHQ A;  4J6W A;  4A4F A;  1GXI E;  4M75 A;  4C0Z A;  3OYN A;  2KYM A;  1YCY A;  1GBR A;  1TUD A;  2V8K A;  2JOY A;  1YIJ A;  3P8B B;  5CQX A;  1G3W A;  1KD1 R;  1YIT A;  4QVC A;  3G71 A;  1YJN A;  3NPF A;  4EMG A;  5GAN 3;  2G3R A;  1IGQ A;  1KK7 A;  1RAI B;  4OMO A;  4R56 A;  3OYA A;  4M7A C;  4C92 G;  9ATC B;  4BY6 C;  4BDZ A;  1OUL A;  2PQW A;  3TCJ A;  3JCM e;  1TS9 A;  1YJW T;  4JRK A;  1U06 A;  4EMK B;  5FU6 C;  1R0C B;  4KGX B;  2WAC A;  2JW4 A;  3QZ5 B;  1Q82 C;  4O6J A;  3EFO A;  1G83 A;  1TOV A;  2X4X A;  3M0P A;  3OYM A;  1BI1 A;  3QZ9 B;  4J9E A;  3VYH B;  4PJO A;  1YJW Q;  4M75 E;  2ZPF B;  2PVG B;  1TH7 A;  2QK0 A;  1PRL C;  1PSF A;  5LJ3 d;  2JS0 A;  2ZPG B;  5C0M A;  4JJC A;  1M8V A;  1WPY A;  5FWB A;  1W2B S;  1KJW A;  1QKX A;  3PVL A;  1W2B A;  1IXD A;  4Z88 A;  2B86 A;  3HKS A;  1IHW A;  4PJO E;  1PD1 A;  4QVD A;  1RAG B;  1KQS A;  2CP5 A;  2LQK A;  2QEX Q;  3DLL A;  1SKU B;  1X6G A;  1ZX6 A;  1HJD A;  2KNB B;  1FYN A;  4PJM A;  1X27 A;  4JRI A;  4C8Q D;  1BKB A;  2D0N A;  2LX9 A;  1G3S A;  1E7O A;  2HQX A;  3MPU B;  3FEO A;  4XTZ A;  1XOV A;  3L2U A;  1Q7Y R;  4E7H A;  4C8Q E;  3VS3 A;  3UT1 A;  3FIF A;  1KHI A;  3QYH B;  3OW2 A;  1JEG A;  4F7U E;  4XTV A;  2LNV A;  1QQJ A;  2K5F A;  3M9Q A;  2NLU A;  3QDF A;  4LNP A;  4A4G A;  3GNF B;  1YJ9 T;  1WXU A;  3UA6 A;  5FRO A;  2DXC A;  2WSE E;  3JCM f;  1YBY A;  2F5K A;  4XTY A;  2KQW A;  3CEY A;  2EIF A;  4F7U F;  3M56 A;  2O9V A;  4J9B A;  5D6X A;  3FJP A;  3LWI A;  3CCL A;  1K9A A;  4RTY A;  3OS2 A;  2ATC B;  2RJE A;  3CQT A;  4ZTJ A;  3CC7 A;  3CMA T;  3GPL A;  3QG1 A;  1ZBX A;  4XK8 E;  2DL4 A;  4PJO G;  1CSK A;  2CZ6 B;  2RK1 A;  1ZUY A;  3RMS A;  3WVD B;  3A8M B;  2JJ9 A;  1M2V B;  2HD0 A;  3P8H A;  4M7D D;  1VQ5 Q;  2EGA A;  3HFO A;  5EC7 A;  1W2B P;  4IUV A;  3RKX A;  1KIK A;  2BE9 B;  1K73 U;  3A8O B;  2K57 A;  3C12 A;  5GAO r;  4QQD A;  2K4Y A;  4A53 A;  1JXO A;  4CC7 A;  5GMK i;  2DNU A;  1RAF B;  2QG9 B;  4N0A A;  1I1J A;  2W10 A;  3L1A A;  3V7R A;  5GAO n;  2CKK A;  3OW2 P;  2LQW A;  4L59 A;  1X6O A;  5L23 A;  3CPF A;  2A28 A;  1VQ9 T;  2DMO A;  5HCK A;  1VQK A;  3G6E T;  2RM4 A;  2DXB A;  1QVP A;  2RNA A;  2PUK B;  1M3C A;  2VUB A;  4RTX A;  1G8X A;  2HEQ A;  4C0D C;  2FB7 A;  2H8H A;  3RKW A;  5GAM j;  1QLY A;  2DKG A;  2CT4 A;  2WSF E;  1Y0M A;  4DOV A;  1H64 1;  1QMC A;  3P8D A;  1IGU A;  1M27 C;  2OJ2 A;  5KYU B;  3M4Y A;  5FU7 C;  2QA4 A;  1M1G A;  4M78 C;  1M30 A;  1O75 A;  2KBT A;  1M3A A;  3A8L B;  1VQ8 Q;  1D0Y A;  1T3S A;  1RI9 A;  2E1H A;  3M0R A;  2KY9 A;  2LVM A;  2EYQ A;  2GBQ A;  5CR2 A;  1QVG S;  1QWF A;  1SPK A;  3VS2 A;  2ZPH B;  3M53 A;  1J3T A;  5D7U A;  4X9D A;  2X4W A;  3AHU A;  4AFS C;  1AZG B;  2JTE A;  2RHI A;  1MMD A;  3JCM h;  1W6X A;  1Y57 A;  4R55 A;  3MP8 A;  2FHD A;  3GNG A;  2M0Y A;  2VWF A;  2DEQ A;  3MP6 A;  3Q1J A;  1X2Q A;  5LJ5 f;  3CD6 T;  2AHJ B;  5IH2 A;  3QBY A;  3EG9 B;  1ZSG A;  1ZQ1 A;  3LGF A;  5IAY A;  4NL2 A;  4K11 A;  3M55 A;  1VQP Q;  2VV5 A;  3UPU A;  3CXC A;  2LCL A;  4L6V 5;  1VQM A;  4EDU A;  4FT4 A;  1RUW A;  2RI5 A;  3SHW A;  1K73 R;  4C8Q C;  1G2B A;  2LRQ A;  3CCR Q;  1UB4 A;  4JJB A;  2ZZD A;  5IHN A;  1JU5 C;  2CSQ A;  5LJ5 h;  2NUT A;  3PIP A;  4R0K A;  5LJ5 j;  1K9M U;  2D8H A;  5A0G A;  4M7D F;  2O31 A;  1WYX A;  5GAN g;  2XD0 A;  3SWN B;  1X75 C;  4J7F A;  4C8Q G;  1IRX A;  3BDU A;  1PRM C;  4LUE A;  5AT1 B;  4C5H A;  4HA8 A;  5GJV B;  2RJC A;  5GMK e;  2YUP A;  1JJ2 S;  1N8R C;  4M7A E;  2RPN A;  4Z89 A;  2X9H A;  3CPW S;  4RTU A;  4M77 B;  1K76 A;  1YJN Q;  2MOX A;  4OF1 A;  1Y7X A;  2YDL A;  3RBB B;  4BDY A;  3URG A;  1QKW A;  4C8Q F;  3CCS A;  4AFQ C;  2LTO A;  1ZSZ C;  8AT1 B;  4FL6 A;  4OP0 A;  2CZ7 B;  2SRC A;  4HKE A;  2LQN A;  4Z8A A;  3FRN A;  2ESW A;  1A0N B;  5GAM e;  1IHV A;  1IZ6 A;  1IO6 A;  1K8A U;  4OGC A;  2QQR A;  5FLX E;  3SFM A;  1VYV A;  2GGR A;  1CKA A;  3QO3 A;  4EMK C;  2M9U A;  3QJY A;  1M90 U;  3OW2 S;  4RG8 A;  1I8F A;  3HRS A;  4OMM A;  4M7A B;  3GOX A;  1D3B B;  2P0Q A;  3QII A;  4AG2 C;  1MGQ A;  2ZPB B;  4KH0 B;  2KRN A;  4LD6 A;  4F7U B;  1VQM T;  4PFZ A;  2ECZ A;  2HQE A;  3I56 Q;  3PE0 A;  5I2M A;  3EGX B;  1PD0 A;  2EYW A;  2P4R A;  3JCM X;  4J5Y A;  5GAO l;  3QSU A;  1NLO C;  4OMQ A;  2JNG A;  4M7D G;  1VQ4 A;  3VS1 A;  1XJW B;  1X69 A;  2KSS A;  2MYS A;  2VC8 A;  1WHL A;  2DEU A;  4PJO D;  1QP2 A;  5GAN e;  1LNX A;  2IIM A;  8ATC B;  2KXC A;  2E3H A;  1LPL A;  1WGS A;  2J7I A;  4HVV A;  5FRN A;  1Q81 C;  4QQ6 A;  2DZC A;  2P0K A;  3L2R A;  2LCC A;  2Y4Y A;  4Z02 A;  1BYM A;  2F1L A;  3JB9 J;  1FXX A;  1H3H A;  5GMK m;  2RA2 A;  2YUQ A;  2LX7 A;  2IVW A;  2K9G A;  2E6Z A;  1MND A;  1VQ7 Q;  1GRI A;  3JV3 A;  1TTH B;  2A37 A;  1D0X A;  5A2Q E;  1WI7 A;  5GAN 8;  3H0H A;  3CCU A;  1Q86 U;  2I0N A;  1K9M C;  5AYF A;  3I5R A;  4GLK A;  2R5M A;  3CCM A;  4PNO A;  2GTO A;  2O4X A;  2K79 A;  5GAN 7;  4ZNX A;  2KT1 A;  5DM7 R;  2DD4 A;  3NTH A;  5GAN d;  2DA9 A;  3F70 A;  3JB9 G;  1S1N A;  1N9R A;  4Y28 E;  5CKF A;  2NUZ A;  1W1F A;  2KRM A;  4AMC A;  2LC4 A;  1KD1 C;  1M1K R;  1EZZ B;  4JRQ A;  4CC4 B;  1U8R A;  4XQ3 A;  1AD5 A;  4C92 C;  4NL3 A;  2JVV A;  3PNW C;  4WF2 A;  2HBP A;  3VKI A;  4FW2 A;  3X28 B;  1KFZ A;  4A4E A;  4J9D A;  3BFM A;  1B34 B;  1ZA2 B;  1I07 A;  3CC4 A;  1H8K A;  2VKN A;  1JJ2 P;  3I9Q A;  4QW2 A;  5KE2 A;  3CCJ T;  1KQS P;  1I4K 1;  2H3E B;  3G7Z A;  4B9X A;  4KUL A;  5LJ3 h;  3REA B;  4P5N A;  4RCB A;  4HCK A;  3JAM E;  3CCU Q;  2CDT A;  2K5L A;  4WCI A;  4AG1 C;  3CCS T;  1RAC B;  1LOJ A;  3EHR A;  1PM3 A;  1EFN A;  1GL5 A;  4E47 A;  3EFR A;  2CSI A;  1KC8 C;  1KQ2 A;  4JS4 A;  3THK A;  1U1T A;  3L2V A;  3CCU T;  3R6O A;  3MEV A;  2EJF A;  1ABO A;  3CCE A;  2QTX A;  1VQN T;  3OS1 A;  1QVF A;  2DTO A;  2CP7 A;  4DEX A;  3QXE B;  1JBM A;  1WQ7 A;  1KC8 R;  5IN1 A;  3OBW A;  2RQW A;  4J6Y A;  1WHJ A;  3NFC A;  4PJO F;  4RMO A;  1Q82 R;  1VQL A;  4E2F B;  1MMG A;  3E2U A;  3TQ7 P;  4HCB A;  3TRE A;  4DA4 A;  4IIO A;  4AFU C;  4LD9 K;  4CC2 A;  1QVG P;  4FSX A;  4RG2 A;  2RF0 A;  1JJ2 A;  2LDM A;  1VOM A;  3ZFJ A;  2PUO B;  4C8Q A;  1UGV A;  3I56 A;  5HKC A;  1Y07 A;  3I35 A;  4M78 F;  3ASK A;  1OPL A;  2ED1 A;  1VQ9 A;  2HL3 A;  2EJG A;  2CUB A;  3KBG A;  2CH4 A;  3RES A;  2X4Y A;  2C0O A;  3M59 A;  1M4Z A;  2XIC A;  3JB9 I;  1YP5 A;  3RKY A;  4J6X A;  1TWB A;  2JS2 A;  2BIV A;  3JCM Q;  5DLO A;  5M9O A;  1WFW A;  3CD6 A;  4PJO C;  3NHN A;  4DBR A;  4C0F A;  2X4J A;  3E19 A;  3CCQ T;  1VQL Q;  2EGE A;  3E9F A;  2EYY A;  2HMA A;  5GAM d;  3BE3 A;  4F16 A;  3I55 Q;  3RIR A;  2L3R A;  2L0A A;  3QWX X;  1K4U S;  1SSH A;  1JB0 E;  3OYE A;  2YRV A;  2YUO A;  2CP2 A;  2QQ9 A;  5L8R E;  1FMW A;  1B3Q A;  3C94 A;  1ZUU A;  2AKL A;  2KE9 A;  1WHG A;  4IKF A;  3PMI A;  4BD3 A;  2E6N A;  2BZY A;  3LGL A;  4M75 B;  2EW3 A;  4M78 A;  1NE8 A;  4Y91 A;  3LW5 E;  3JCM P;  2GQI A;  2JM9 A;  3S6W A;  4MDX A;  2KK4 A;  3HFN A;  2DXU A;  3V7S A;  3A98 A;  4BAC A;  4QVZ A;  4Y92 A;  2M0O A;  3MKD A;  1VQ8 T;  2E70 A;  2FL7 A;  2XID A;  5A0L A;  3U23 A;  1YN8 A;  5GAN 5;  3ZBD A;  4QQG A;  2QI2 A;  3MP1 A;  2DL8 A;  2DTI A;  5KYW A;  3G6E A;  1I81 A;  2D0Q B;  4A4K A;  2YT6 A;  3INZ A;  3VS0 A;  3CMA Q;  1NLP C;  3EG3 A;  2L2P A;  2DXT A;  1RAD B;  4M77 C;  1G3Y A;  3QYG B;  3M5A A;  2P84 A;  1MMN A;  2BTT A;  2YSQ A;  1AWW A;  2OTJ Q;  4M78 G;  3OYF A;  2EQI A;  4N0A C;  2F5T X;  4C92 D;  1OPK A;  2V1R A;  1PHT A;  3JCM g;  2L3P A;  3G4S T;  2LT1 A;  5KE3 A;  2XDB A;  3OBY A;  4M77 E;  1S72 T;  5GAM g;  4PJN A;  5FU6 B;  3X20 B;  4BB7 A;  1ZLM A;  1M90 C;  4M75 D;  1HYO A;  1I5O B;  1WA7 A;  3G4S Q;  1TUG B;  4B9W A;  2OTL A;  4JDS A;  4FT2 A;  1S72 Q;  2CP0 A;  3UDC A;  1OI1 A;  4M77 F;  5CVI A;  2C06 A;  5LJ3 j;  1ZHI A;  4MZM A;  2QQA A;  2XDP A;  1YWP A;  1NJI U;  2K2M A;  2ED0 A;  2MF2 A;  2HSE B;  4RKU E;  1M9S A;  4XAX B;  4ME7 A;  2O9S A;  1YJ9 A;  1VQ7 A;  2EGC A;  4JLG A;  1VQO Q;  3RMQ A;  2YRD A;  2AK5 A;  7AT1 B;  1U5S A;  3JCM J;  2L8D A;  4OB0 B;  5KYN A;  1GFC A;  3CCE T;  3VYG A;  2MIO A;  1KQ1 A;  1WJQ A;  2OX7 A;  3BW1 A;  2FRY A;  1WQW A;  1Z9Q A;  1ZA1 B;  2A08 A;  2DJQ A;  3FLG A;  3UA7 A;  3MET A;  5I2S A;  3HSB A;  2KGT A;  2DO3 A;  4FYX B;  3TSZ A;  2J6F A;  2ZPI B;  1NG2 A;  4RTW A;  2DYI A;  1VQK Q;  4LXC A;  2FZG B;  5CAI A;  2L5Q A;  5KYW B;  1Q81 U;  4J8O A;  4LDU A;  5D6Y A;  4C5G A;  3EG1 A;  4IUT A;  4OB1 B;  3H6Z A;  5LJ3 e;  4IUQ A;  1NJI C;  3EG9 A;  2KDS A;  2HCK A;  3VS5 A;  1VYU A;  3C0C A;  4OMN A;  2FPD A;  5C6S A;  1VQP T;  1QVF S;  2AZS A;  3PVQ A;  1WDX A;  1R0B G;  4UC4 A;  3PT9 A;  1LJO A;  2EQJ A;  3SWN A;  2LCS A;  2XK0 A;  3EH2 A;  3HTR A;  2YXY A;  4TVR A;  2DBM A;  1NYG A;  3CC7 T;  4MZP A;  4E7L A;  5I21 A;  4IUU A;  2LNH B;  4XU2 A;  3M0Q A;  2X35 A;  1M2O A;  1Y96 B;  3I56 T;  3PMT A;  4HXJ A;  4XTX A;  4DQ2 A;  1WHM A;  1RL2 A;  4M77 A;  4CI0 C;  3PFS A;  3TSW A;  3QKJ A;  1JQQ A;  4HCZ A;  3CC7 Q;  1YHQ T;  5GMK l;  2CYZ B;  4A4H A;  2J6O A;  4J7I A;  2MWP A;  1WJS A;  1UJY A;  3S3O A;  4KRT A;  4MDW A;  1PCX A;  5J39 A;  3QPH A;  2E65 A;  4II1 A;  3CBP A;  4M7A D;  2JMC A;  1KD1 U;  1MUZ A;  3AT1 B;  3M0U A;  4NOY A;  2EPD A;  3MEU A;  1HD3 A;  3CCV Q;  1UUE A;  2CP6 A;  2F2X A;  1TUC A;  4FM4 B;  4BUG A;  1JO8 A;  1OZ3 A;  4E7S A;  2RJF A;  2P0P A;  2XI9 A;  5LJ3 f;  3VS4 A;  1FX7 A;  4ZGE B;  3N5B B;  4ATO A;  3CCV T;  3LH0 A;  4MML A;  1GBQ A;  4Q5W A;  6AT1 B;  3A5Z B;  4LUD A;  2XG8 D;  4J9H A;  2YUN A;  2DER A;  4ZN1 A;  4E7I A;  1VQ5 T;  2LMJ A;  4OMF B;  4M7A A;  1O9S A;  1RI0 A;  2KI7 A;  3CXC P;  2K3Y A;  5A0D A;  2QEX A;  1N27 A;  2RI2 A;  5CIU A;  2XDD A;  2PTK A;  1WLP B;  5GAN 4;  4M7A G;  1V1C A;  2CH4 W;  4AFZ C;  3PGG A;  1AOJ A;  2OAU A;  2P4T A;  1AHJ B;  1X2K A;  1AEY A;  1NPP A;  2KAF A;  3OMC A;  2VXE A;  4E7K A;  4BE0 A;  1M5Q 1;  1Q81 R;  1BCM A;  2D1X A;  1E6G A;  2A36 A;  3H9N A;  2YLB A;  1OX8 A;  3MCA B;  4BI8 B;  2CUD A;  3ZEH A;  4BI3 A;  1D1B A;  3EFO B;  5I11 A;  4XU0 A;  1W70 A;  2X51 A;  1YJW A;  5LL6 S;  2F2W A;  4M7D A;  5GAN f;  1NBE B;  4HT9 A;  1HXD A;  2DD5 A;  1VIE A;  1VQ6 A;  3S3M A;  1UJ0 A;  2COW A;  1UHC A;  2QYZ A;  2SEM A;  1T0J A;  2J06 A;  3CCJ Q;  4F7U G;  1QCN A;  2FPE A;  2VB6 A;  5KYY A;  4EMH A;  2R58 A;  1K0S A;  2VGM A;  2DFU A;  3RNJ A;  3G71 Q;  3CPW P;  5KYX A;  3JB9 D;  3TU4 K;  1M1K U;  1YIJ Q;  1LCK A;  1LVK A;  4PJL A;  4HT8 A;  1SSF A;  2EQM A;  3CBO A;  2GQV A;  1BU1 A;  2COY A;  3FJ5 A;  1NJI R;  4E7J A;  3WVE B;  1R8O B;  3G71 T;  3S3N A;  2DL5 A;  1K73 C;  1Q82 U;  1K0X A;  1SRM A;  3OYI A;  2PVD B;  1OX9 A;  3SD4 A;  1RAB B;  1BIB A;  2ZCF B;  2QAS A;  2O4X B;  4M7D C;  2X3X D;  3CPW A;  2E12 A;  3JCM c;  1BI2 A;  3I5S A;  2DE0 X;  3UWN A;  1Q86 R;  1RAE B;  2GNC A;  5J3B A;  2BKD N;  4J83 A;  1XNI A;  1NM7 A;  4LE9 A;  2JT4 A;  4JZ4 A;  4OML A;  1E6H A;  2ROT A;  4ESR A;  5KH6 A;  1KSW A;  1D1A A;  2E5Q A;  3V8J A;  4KT0 E;  1YI2 A;  1EX4 A;  1SHG A;  2YHT A;  4MZT A;  5GMK h;  1EIF A;  2RJD A;  1P92 A;  2DL7 A;  1UGQ B;  2PU9 B;  4PK4 A;  1MMA A;  1TG0 A;  1N8R U;  3CCR T;  3UF4 A;  2DK3 A;  1NYF A;  4BI4 A;  1VQ5 A;  2AKK A;  4PLL A;  3CCM T;  4FYV B;  1V76 A;  1PG5 B;  3OYH A;  2QEX T;  3CCL T;  3RER A;  3ZL7 C;  2O88 A;  1H3Z A;  3QUI A;  4X34 A;  1SRL A;  2RHU A;  3SDZ A;  1X01 A;  2K5I A;  2FVU A;  3EGD A;  2QDY B;  3M58 A;  3CCL Q;  5GJW B;  4X9C A;  2NWM A;  3O8V A;  4RTZ A;  3IQL A;  2LJ0 A;  2RHX A;  3PTA A;  1C0M A;  2Z0W A;  3EH1 A;  1FMK A;  5IT9 E;  2PVO B;  3X24 B;  5KCH A;  2NYS A;  3VJP A;  2B8A A;  1YNZ A;  1I5L A;  1OU9 A;  1BBZ A;  2M16 A;  4LDX A;  2FO0 A;  3RR6 A;  4C5I A;  4CRI A;  3WXM B;  1VQ6 T;  3DLM A;  3MEW A;  4M78 D;  2HL5 C;  2EBP A;  2M1H A;  4E6R A;  3M57 A;  3OYC A;  1VQO A;  3CCJ A;  2FRW A;  2YWW A;  1YJ9 Q;  1XQH A;  1B07 A;  3CC2 A;  3CC4 T;  1M8M A;  1BI3 A;  3GLX A;  2OTL T;  4JLI A;  3OYB A;  1VQ6 Q;  1ZSZ B;  5FRM A;  2X3W D;  2HBW A;  2F69 A;  4V2S A;  1YHQ A;  2C0I A;  3L2Q A;  4DOW A;  1S72 A;  4JUV A;  1SHF A;  2OTL Q;  3H41 A;  2VVK A;  3G4S A;  2EYZ A;  3VRZ A;  2PNI A;  4M4Z A;  3LLR A;  2V26 A;  2DIG A;  2COZ A;  2A7Y A;  3M54 A;  5GAN j;  3OYD A;  3SWN C;  4KGZ B;  3G1J A;  4IUP A;  2AIR B;  2QDL A;  2XMF A;  2CGH A;  4B6M A;  5IHK A;  4DBF A;  4KGV B;  5DLQ E;  4PL6 A;  3HPW A;  2QXF A;  1R77 A;  5IHI A;  4LN2 A;  3OQ5 A;  2KR3 A;  3SB2 A;  4DEY A;  2DVJ A;  2RD1 A;  3GF5 A;  2EQK A;  2DL3 A;  1FMV A;  1BB9 A;  1PC0 A;  1D3B A;  4J9F A;  4VUB A;  3VV0 A;  4EIK A;  5CKD A;  3OMG A;  4N4H A;  4JZ3 A;  2JTF A;  3G6E Q;  3OS0 A;  3OY9 A;  1KHC A;  4KBM B;  3OB9 A;  3CCQ Q;  1AZE A;  3A1P A;  3VS6 A;  1K9M R;  1X6B A;  4RTT A;  2MCN A;  2LZ6 B;  4GLM A;  1QP3 A;  3I55 T;  2LT4 A;  2K6D A;  4A63 B;  2QA4 T;  1U1S A;  4O5V A;  2QTV A;  1G3T A;  4ZGJ B;  2EQU A;  3CCV A;  1AWX A;  4FIB A;  3C95 A;  1RLP C;  2DPP B;  2CZ1 B;  2GTJ A;  1UEC A;  4PLI A;  1YIT Q;  1K8A C;  5LJ5 e;  2DLP A;  2RH2 A;  2NUP A;  2EYX A;  5EG2 A;  1D0Z A;  1JXM A;  2AZV A;  4J9G A;  1C6V X;  2RQV A;  3X25 B;  2EKO A;  3L2Z A;  1B7T A;  1YIT T;  4JS5 A;  2BUD A;  2NUT B;  2FG0 A;  3MO8 A;  1K8A R;  2KVQ G;  1Q7Y U;  3VRY A;  1KG1 A;  4ORZ A;  3HHT B;  4F14 A;  4M7D B;  4KUD K;  2DBK A;  2XHC A;  3NTK A;  2EFI A;  1ZSZ A;  2PZ1 A;  5GMK j;  4M75 G;  2HAX A;  1ZUK A;  1N5Z A;  1ARK A;  4RCC A;  2HKQ B;  2D9T A;  2HZY A;  2K2V A;  4ZTF A;  3JB9 F;  2GFU A;  1Y96 A;  3MHX A;  2YRC A;  2HSP A;  3TVT A;  1F1B B;  1AVZ C;  2BZ8 A;  1M3B A;  4XTW A;  3DKM A;  4ELZ C;  3M4G A;  4XU1 A;  2JUF A;  2J6K A;  1WXT A;  4XTU A;  2RHY A;  4M75 F;  2BZX A;  1UHF A;  2FYK A;  2RMO A;  2ABL A;  3H0I A;  1PWT A;  3GP8 A;  3CME T;  1Q7Y C;  5I22 A;  3DB3 A;  3EFS A;  3DB4 A;  3OYG A;  3E1S A;  3JCM V;  1RAA B;  2L89 A;  3JB9 H;  1SEM A;  2DVE A;  4X1V A;  2R5A A;  3CME Q;  1QCF A;  4IUR A;  3NTI A;  3OSS C;  4FCY A;  4OVA A;  4D8K A;  2EVR A;  2IPO B;  1FWZ A;  2J05 A;  5LJ3 g;  3MJX A;  1VQO T;  1VQN Q;  5HK3 A;  2EWN A;  4PKC C;  1OYX A;  3EGX A;  1YJN T;  3LWH A;  5CK9 A;  5GAO p;  4HCC A;  3V8L A;  3JCM d;  1IRE B;  3VUZ A;  2RQU A;  1OU8 A;  2KYB A;  3BDL A;  2DX1 A;  2WSC E;  1B34 A;  1W4S A;  3CXC S;  1N9S A;  2RB6 A;  5HK0 A;  3EG0 A;  3HRU A;  4EMK A;  2OI3 A;  1WHK A;  2ZGW A;  2NUP B;  1K1Z A;  2RO0 A;  2DJZ A;  2CT3 A;  4FW1 A;  2FZK B;  2HQH A;  1ZBJ A;  3ER0 A;  4JRP A;  2E10 A;  2RI3 A;  4C0G A;  1D09 B;  1RLQ C;  2RQR A;  1QVF P;  5CO7 A;  3T9N A;  2E64 A;  2FEI A;  2DYB A;  4F04 B;  2VYT A;  2E41 A;  1XTD A;  2DET A;  2JN0 A;  1SF9 A;  1BK2 A;  3OYK A;  4L5G A;  2VGN A;  2OTJ A;  1BCO A;  1M90 R;  4J9C A;  2JMA A;  5ECA A;  1BI0 A;  2MMP A;  5KYY B;  1GCQ C;  1NPR A;  2W0Z A;  1HSQ A;  3E9G A;  3CMA A;  1WJR A;  4DBQ A;  5HY6 A;  2A0F B;  3V7C A;  4KH1 B;  1RAH B;  2KT8 A;  3CBM A;  4C5E A;  3J7A F;  5D6W A;  2E3I A;  2V8I A;  2DF6 A;  2OAW A;  2DRM A;  1N8R R;  4LDW A;  4JJD A;  1VQN A;  3QHS A;  1KQS S;  3QWY A;  2VAS A;  4E7Z A;  1CKB A;  3JRZ A;  1PKT A;  4RTV A;  2XU8 A;  3VS7 A;  4YTL A;  1OQK A;  2JXB A;  1UTI A;  5GAM f;  1YFN A;  2L3Q A;  4M7A F;  1M1F A;  2AT1 B;  1TSF A;  3I55 A;  1YIJ T;  3GIB A;  3X26 B;  2LJ3 A;  1AWO A;  4ZN3 A;  3UAT A;  5IXB A;  2DIQ A;  2K3X A;  5CKH A;  3CD6 Q;  1PNJ A;  5CKB A;  3JSC A;  2OTJ T;  1V29 B;  2QQS A;  2QGF B;  1ABQ A;  1DJ7 B;  3V8K A;  5IXF A;  4F7U A;  2EJ9 A;  1TXQ A;  3L2W A;  2HDA A;  5GAM h;  2DRK A;  3OYL A;  3ULR B;  4C92 A;  4OB2 B;  1VQ9 Q;  4PJJ A;  1NEB A;  2L3S A;  3GBQ A;  1SG5 A;  3KUF A;  3FB9 A;  3KXT A;  2O2O A;  5GAO m;  1N6A A;  1JRI A;  1M2V A;  1WX6 A;  2GF7 A;  2MAM A;  4OGE A;  1U3O A;  5GAO q;  2Y90 A;  3H0F A;  4C0D B;  1Z9Z A;  1IB8 A;  4ZGD B;  3SEM A;  3A8G B;  4OB3 B;  3EG2 A;  5KYX B;  3M0T A;  1VYT A;  2CRE A;  4C92 E;  3JCM W;  4NS5 A;  4WTO B;  4FYW B;  2HNI A;  1Q86 C;  1G5V A;  3QDR B;  3OYY A;  1M1K C;  2K3B A;  3J81 E;  3CCE Q;  1PKS A;  4C8Q B;  3CCS Q;  2C0T A;  2KEA A;  5GAN h;  2DZ9 A;  4BE1 A;  5GAN 6;  4KUI A;  2MI6 A;  4C92 F;  1OEB A;  1Q95 G;  5FWC A;  2XKO C;  1NZ9 A;  4D8D A;  3J80 E;  3H8Z A;  3L42 A;  3R6N A;  2DAQ A;  2E4H A;  4FU6 A;  4J9I A;  2V1Q A;  2FZC B;  4FYY B;  1WNL A;  1QVG A;  1UFF A;  1Y71 A;  1HK9 A;  3CCQ A;  2ENM A;  1MNE A;  3VU3 C;  1QCO A;  1VQK T;  2LJ1 A;  1OV3 A;  3HRT A;  3QJ6 A;  3CC4 Q;  1UDL A;  2MPX C;  4RUG A;  1I0C A;  2IG0 A;  3CCR A;  2KRS A;  2ZPE B;  4XU3 A;  4M77 D;  3RDV A;  1VQM Q;  2JTM A;  2D8J A;  3OSV A;  1AWJ A;  4GBQ A;  3MEA A;  1OOT A;  2Y4X A;  4QT7 A;  2MWO A;  4M75 C;  2RK2 A;  4CC3 A;  1VQP A;  5LJ5 g;  2FPF A;  3EGD B;  3LH5 A;  4M78 B;  3HP9 A;  5FU7 B;  4F17 A;  3REB B;  2DM1 A;  1VA7 A;  4N4G A;  3CCM Q;  2MK5 A;  1NEG A;  4GY5 A;  3BY7 A;  1YHQ Q;  2LP5 A;  2DIL A;  1D1C A;  1VQL T;  5FW9 A;  4FSS A;  2DTH A;  1MV0 B;  2LQ8 A;  3C4S A;  3EAE A;  2V8J A;  4PFO A;  4PJO B;  3HL8 A;  1UGS B;  1WZO A;  1KC8 U;  2E5K A;  3CC2 Q;  4MMK A;  2CZ0 B;  4BE2 A;  4C92 B;  3OA6 A;  3D7S B;  2GCX A;  4JJN K;  3LYI A;  5CCA A;  2QAZ A;  1X43 A;  2KMT A;  1YCS B;  2EAY A;  1QWE A;  1VQ8 A;  2KRO A;  1VQ7 T;  3CC2 T;  3FDR A;  2HKN A;  5CQY A;  4M77 G;  3TEE A;  4LDV A;  2QA4 Q;  3ME9 A;  4EPC A;  2BE7 D;  4ANJ A;  4HVU A;  4ELY C;  5LJ5 d;  3CME A;  1VQ4 T;  2QGG A;  4OMP A;  1UGP B;  2RHZ A;  4DBH A;  2JM8 A;  2M02 A;  1H92 A;  2JZ2 A;  2RQT A;  2CS7 A;  1MHN A;  2I2L A;  4IIM A;  1WIE A;  3O5Z A;  2EKH A;  3FC3 A;  1GCQ A;  1T3L A;  3VUB A;  4HVW A;  1VQ4 Q;  1VIF A;  3PIO A;  1UG1 A;  2G6F X;  3NGP A;  4AT1 B;  1YWO A;  5KCO A;  5GAN 2;  4QKU A;  1WHH A;  2KXD A;  2H3J A;  1C1A A;  2ROL A;  5CKE A;  4BY6 B;  1VUB A;  1OZ2 A;  1YI2 T;  4M7D E;  3KFV A;  2RN8 A;  4A54 A;  4D6W A;  2VXF A;  3NMZ C;  1AT1 B;  4PFP A;  1ACM B;  1UE9 A;  3OYJ A;  1TU0 B;  5DY9 A;  3JCM b;  2D6F A;  1MV3 A;  3LX7 A;  2R57 A;  2O01 E;  2ZAE A;  1GCP A;  4LDY A;  1GFD A;  2K7A A;  1YI2 Q;  3RUX A;  5KYU A;  1PSE A;  5J26 A;  2GFA A;  2M51 A;  2CP3 A;  2F2V A; 
#chains in the Genus database with same CATH homology
 2JNG A;  4XU2 A;  2QQB A;  4M7D G;  4N4I A;  2X35 A;  4M78 E;  1VQ4 A;  1Y96 B;  3I56 T;  3GP8 A;  3PMT A;  3CME T;  4XTX A;  1Q7Y C;  4DQ2 A;  1RL2 A;  4M77 A;  4CI0 C;  3PFS A;  1QW1 A;  3A8H B;  3QKJ A;  2KSS A;  3DB3 A;  3EFS A;  3DB4 A;  3OS5 A;  2VC8 A;  4HCZ A;  2YLC A;  4PJO D;  1QP2 A;  2A3L A;  5GAN e;  1LNX A;  3E1S A;  3OYG A;  3JCM V;  1UGR B;  1BIA A;  5GMK l;  1YHQ T;  2CYZ B;  4A4H A;  1UEB A;  2L89 A;  3JB9 H;  1WGS A;  4J7I A;  2MWP A;  2DVE A;  1WJS A;  2R5A A;  4J6W A;  5FRN A;  4A4F A;  3S3O A;  1Q81 C;  1GXI E;  4QQ6 A;  4IUR A;  4MDW A;  2DZC A;  3NTI A;  3OSS C;  4M75 A;  4C0Z A;  2P0K A;  3OYN A;  2LCC A;  2Y4Y A;  1YCY A;  4Z02 A;  3L2R A;  1BYM A;  4OVA A;  5J39 A;  1FWZ A;  3JB9 J;  2V8K A;  3QPH A;  1FXX A;  5LJ3 g;  2JOY A;  1YIJ A;  2E65 A;  3P8B B;  4II1 A;  5CQX A;  1G3W A;  3CBP A;  1YIT A;  4QVC A;  3G71 A;  1VQO T;  1KD1 U;  4M7A D;  1YJN A;  4EMG A;  5GAN 3;  2G3R A;  4NOY A;  5GMK m;  2RA2 A;  3MEU A;  5HK3 A;  2EWN A;  4PKC C;  1OYX A;  2IVW A;  3LWH A;  2E6Z A;  4FM4 B;  4BUG A;  5CK9 A;  5GAO p;  4R56 A;  3OYA A;  1YJN T;  4C92 G;  4HCC A;  4BY6 C;  4BDZ A;  3V8L A;  3JCM d;  4M7A C;  2PQW A;  1OZ3 A;  3TCJ A;  3JCM e;  1YJW T;  4JRK A;  1IRE B;  2RJF A;  2P0P A;  2XI9 A;  5LJ3 f;  3VUZ A;  5FU6 C;  4EMK B;  5A2Q E;  5GAN 8;  1FX7 A;  3CCU A;  2WAC A;  4ZGE B;  3N5B B;  3BDL A;  4ATO A;  3QZ5 B;  2WSC E;  1Q82 C;  1B34 A;  1W4S A;  4O6J A;  3LH0 A;  3CXC S;  3CCV T;  1N9S A;  2RB6 A;  1Q86 U;  2X4X A;  4MML A;  1K9M C;  5HK0 A;  4Q5W A;  3HRU A;  5AYF A;  3OYM A;  1BI1 A;  3A5Z B;  4EMK A;  2XG8 D;  3QZ9 B;  3VYH B;  4PJO A;  4GLK A;  2R5M A;  4M75 E;  2ZPF B;  2PVG B;  2ZGW A;  4ZN1 A;  1TH7 A;  3CCM A;  4E7I A;  1VQ5 T;  4PNO A;  4OMF B;  2O4X A;  4M7A A;  1PSF A;  2RO0 A;  5GAN 7;  1O9S A;  1RI0 A;  5DM7 R;  2DJZ A;  5LJ3 d;  2K3Y A;  3ER0 A;  4JRP A;  2E10 A;  5A0D A;  2DD4 A;  2ZPG B;  3NTH A;  5GAN d;  2QEX A;  5C0M A;  2RI3 A;  4C0G A;  3F70 A;  1M8V A;  3JB9 G;  1N27 A;  2RI2 A;  5CIU A;  1N9R A;  1WPY A;  2XDD A;  1W2B S;  4Y28 E;  5CKF A;  5CO7 A;  5GAN 4;  4M7A G;  3T9N A;  2E64 A;  1W2B A;  2LC4 A;  1KD1 C;  2VYT A;  3PGG A;  2OAU A;  2E41 A;  1XTD A;  4JRQ A;  3HKS A;  2P4T A;  2JN0 A;  1U8R A;  1AHJ B;  4XQ3 A;  3OYK A;  1NPP A;  2KAF A;  4PJO E;  3OMC A;  4C92 C;  2VXE A;  4QVD A;  4E7K A;  4L5G A;  2VGN A;  4BE0 A;  1KQS A;  4NL3 A;  1M5Q 1;  2LQK A;  2JVV A;  2OTJ A;  3PNW C;  3DLL A;  4WF2 A;  2HBP A;  3VKI A;  1KC8 U;  3X28 B;  2YLB A;  1BI0 A;  2MMP A;  4BI8 B;  3MCA B;  4A4E A;  3ZEH A;  4BI3 A;  3BFM A;  4JRI A;  1B34 B;  4C8Q D;  1BKB A;  1NPR A;  3CC4 A;  4XU0 A;  3E9G A;  3CMA A;  1WJR A;  1YJW A;  5HY6 A;  5LL6 S;  3V7C A;  4QW2 A;  5KE2 A;  3CCJ T;  4M7D A;  2LX9 A;  1G3S A;  3CBM A;  5GAN f;  2HQX A;  4C5E A;  3J7A F;  3FEO A;  5D6W A;  1I4K 1;  4XTZ A;  1XOV A;  3G7Z A;  4B9X A;  4KUL A;  5LJ3 h;  3L2U A;  2V8I A;  1HXD A;  2DD5 A;  4P5N A;  4RCB A;  1VIE A;  3JAM E;  4E7H A;  4C8Q E;  3S3M A;  1VQ6 A;  3UT1 A;  3FIF A;  1KHI A;  2K5L A;  3QYH B;  3OW2 A;  3CCS T;  1LOJ A;  4F7U E;  4XTV A;  4F7U G;  4E47 A;  4LDW A;  3EFR A;  4EMH A;  2R58 A;  2LNV A;  1VQN A;  2K5F A;  3M9Q A;  2VGM A;  3QHS A;  1KC8 C;  1KQ2 A;  4JS4 A;  2NLU A;  1KQS S;  1U1T A;  3L2V A;  3CCU T;  3R6O A;  3JRZ A;  3GNF B;  3MEV A;  2EJF A;  4A4G A;  3TU4 K;  3JB9 D;  1YJ9 T;  1M1K U;  4HT8 A;  2XU8 A;  1SSF A;  2EQM A;  3CBO A;  4YTL A;  5FRO A;  3CCE A;  2DXC A;  2WSE E;  2QTX A;  1YBY A;  3JCM f;  2F5K A;  2GQV A;  1VQN T;  4XTY A;  3OS1 A;  2KQW A;  3CEY A;  2EIF A;  4F7U F;  2DTO A;  5GAM f;  1QVF A;  3M56 A;  3QXE B;  1JBM A;  4E7J A;  1WQ7 A;  3WVE B;  5D6X A;  3FJP A;  1R8O B;  5IN1 A;  3LWI A;  3G71 T;  1M1F A;  3S3N A;  3CCL A;  4M7A F;  1K73 C;  3I55 A;  3OBW A;  2RJE A;  3OS2 A;  4ZTJ A;  1YIJ T;  3CC7 A;  1Q82 U;  3CMA T;  3GIB A;  3GPL A;  3X26 B;  4J6Y A;  4PJO F;  3NFC A;  3OYI A;  2PVD B;  3QG1 A;  1ZBX A;  3SD4 A;  1BIB A;  2ZCF B;  4XK8 E;  4ZN3 A;  4PJO G;  2O4X B;  4RMO A;  4M7D C;  1VQL A;  2DIQ A;  3CPW A;  2E12 A;  3JCM c;  1BI2 A;  2CZ6 B;  2K3X A;  5CKH A;  3TRE A;  2RK1 A;  3UWN A;  4HCB A;  3RMS A;  5CKB A;  3WVD B;  3JSC A;  3A8M B;  4DA4 A;  2OTJ T;  1V29 B;  2QQS A;  5J3B A;  2BKD N;  1DJ7 B;  4J83 A;  1XNI A;  2HD0 A;  3V8K A;  4LD9 K;  3P8H A;  4M7D D;  4F7U A;  3HFO A;  4FSX A;  2EJ9 A;  4IUV A;  4RG2 A;  3RKX A;  5KH6 A;  2E5Q A;  1JJ2 A;  2LDM A;  3V8J A;  4KT0 E;  1YI2 A;  3L2W A;  3A8O B;  2PUO B;  3ZFJ A;  5GAM h;  4C8Q A;  2K57 A;  1K73 U;  2YHT A;  3I56 A;  5HKC A;  3C12 A;  4MZT A;  1Y07 A;  5GMK h;  3OYL A;  1EIF A;  4M78 F;  3ASK A;  4C92 A;  4QQD A;  2K4Y A;  2RJD A;  4OB2 B;  5GAO r;  4A53 A;  5GMK i;  1P92 A;  1VQ9 A;  4N0A A;  1UGQ B;  2PU9 B;  2EJG A;  3L1A A;  3V7R A;  5GAO n;  3KBG A;  1N8R U;  3CCR T;  2CKK A;  3KUF A;  3FB9 A;  3RES A;  2X4Y A;  3M59 A;  3KXT A;  1M4Z A;  2DK3 A;  4L59 A;  1X6O A;  2XIC A;  4BI4 A;  5GAO m;  1VQ5 A;  3JB9 I;  4PLL A;  3CPF A;  3CCM T;  3RKY A;  4J6X A;  1VQ9 T;  1JRI A;  1N6A A;  2BIV A;  3OYH A;  3JCM Q;  2GF7 A;  2MAM A;  5DLO A;  2QEX T;  5M9O A;  3CCL T;  1VQK A;  4OGE A;  3G6E T;  3CD6 A;  5GAO q;  4PJO C;  2Y90 A;  2RM4 A;  3RER A;  2DXB A;  1QVP A;  2X4J A;  3E19 A;  2PUK B;  2VUB A;  4C0D B;  4C0F A;  3E9F A;  3CCQ T;  1H3Z A;  4ZGD B;  3QUI A;  5GAM d;  3A8G B;  4OB3 B;  4C0D C;  4X34 A;  2FB7 A;  3RKW A;  2RHU A;  3SDZ A;  5GAM j;  1X01 A;  4C92 E;  3JCM W;  2K5I A;  2FVU A;  2DKG A;  4NS5 A;  3RIR A;  2WSF E;  2HNI A;  2QDY B;  1Q86 C;  3M58 A;  2L3R A;  1G5V A;  4X9C A;  3O8V A;  4DOV A;  1JB0 E;  1H64 1;  3P8D A;  3QDR B;  2RHX A;  3OYY A;  3OYE A;  3PTA A;  2YRV A;  2QQ9 A;  5L8R E;  1M1K C;  5IT9 E;  3M4Y A;  2PVO B;  3C94 A;  5FU7 C;  3J81 E;  2QA4 A;  1M1G A;  3X24 B;  4M78 C;  4C8Q B;  4IKF A;  1O75 A;  5KCH A;  3VJP A;  2B8A A;  5GAN h;  1I5L A;  3A8L B;  2DZ9 A;  3PMI A;  4BD3 A;  2E6N A;  2M16 A;  4BE1 A;  4LDX A;  5GAN 6;  4C5I A;  3LGL A;  4CRI A;  4KUI A;  2E1H A;  4M75 B;  2KY9 A;  2MI6 A;  3WXM B;  2LVM A;  3DLM A;  3MEW A;  1VQ6 T;  4M78 A;  4M78 D;  1NE8 A;  4Y91 A;  3LW5 E;  4C92 F;  3JCM P;  2EYQ A;  2M1H A;  2XKO C;  1NZ9 A;  3M57 A;  3J80 E;  3OYC A;  3H8Z A;  5CR2 A;  3S6W A;  1VQO A;  1QVG S;  3CCJ A;  4MDX A;  3L42 A;  2KK4 A;  3HFN A;  1XQH A;  2DXU A;  2DAQ A;  3V7S A;  2ZPH B;  4BAC A;  4QVZ A;  2M0O A;  3M53 A;  1BI3 A;  4FU6 A;  3CC4 T;  1VQ8 T;  3CC2 A;  3GLX A;  2E70 A;  2FL7 A;  2OTL T;  2XID A;  4JLI A;  3OYB A;  4X9D A;  5A0L A;  5GAN 5;  1WNL A;  2X4W A;  3ZBD A;  1QVG A;  5FRM A;  3AHU A;  1Y71 A;  1HK9 A;  4QQG A;  2QI2 A;  3MP1 A;  3CCQ A;  2DTI A;  3VU3 C;  2F69 A;  3G6E A;  4V2S A;  1I81 A;  1YHQ A;  2RHI A;  1VQK T;  2D0Q B;  4A4K A;  3JCM h;  3L2Q A;  3INZ A;  3HRT A;  3QJ6 A;  4DOW A;  2DXT A;  4R55 A;  4JUV A;  4M77 C;  1G3Y A;  1S72 A;  3MP8 A;  2FHD A;  3GNG A;  3QYG B;  3M5A A;  2DEQ A;  3MP6 A;  3G4S A;  2IG0 A;  3Q1J A;  5LJ5 f;  3CCR A;  3CD6 T;  2ZPE B;  4XU3 A;  2AHJ B;  3QBY A;  4M77 D;  4M78 G;  1ZQ1 A;  3LLR A;  3LGF A;  2DIG A;  5IAY A;  3OYF A;  2A7Y A;  3M54 A;  4NL2 A;  5GAN j;  2JTM A;  4N0A C;  3OYD A;  2F5T X;  3M55 A;  3SWN C;  3OSV A;  4C92 D;  3MEA A;  3JCM g;  2VV5 A;  2LT1 A;  2Y4X A;  3G4S T;  4IUP A;  3UPU A;  5KE3 A;  2XDB A;  2MWO A;  3OBY A;  4M75 C;  2CGH A;  2RK2 A;  4M77 E;  3CXC A;  2LCL A;  1VQP A;  1S72 T;  5LJ5 g;  5GAM g;  4L6V 5;  1VQM A;  4EDU A;  4FT4 A;  2RI5 A;  5FU6 B;  3X20 B;  4M78 B;  4BB7 A;  4C8Q C;  3HP9 A;  5FU7 B;  1M90 C;  4M75 D;  5DLQ E;  2LRQ A;  4PL6 A;  3HPW A;  2QXF A;  1UB4 A;  3SB2 A;  3OQ5 A;  4B9W A;  2RD1 A;  3GF5 A;  2OTL A;  2EQK A;  2ZZD A;  4FT2 A;  4JDS A;  4N4G A;  5LJ5 h;  3PIP A;  1D3B A;  4VUB A;  5LJ5 j;  3VV0 A;  4GY5 A;  1K9M U;  4HT9 A;  3UDC A;  5A0G A;  3BY7 A;  3OMG A;  1OI1 A;  4N4H A;  5CKD A;  4M7D F;  2JTF A;  3OS0 A;  3OY9 A;  1KHC A;  4M77 F;  4KBM B;  3OB9 A;  5CVI A;  2C06 A;  5LJ3 j;  1VQL T;  1ZHI A;  2DTH A;  5GAN g;  2LQ8 A;  3C4S A;  3EAE A;  4MZM A;  2XD0 A;  2QQA A;  3SWN B;  2XDP A;  2V8J A;  1NJI U;  4PJO B;  1X75 C;  2MF2 A;  4J7F A;  3HL8 A;  1QP3 A;  1UGS B;  4RKU E;  1M9S A;  4C8Q G;  2LT4 A;  3BDU A;  2CZ0 B;  4MMK A;  4XAX B;  3I55 T;  4ME7 A;  4BE2 A;  4C5H A;  4C92 B;  1YJ9 A;  3OA6 A;  4HA8 A;  1U1S A;  2GCX A;  2RJC A;  4O5V A;  5GMK e;  2QA4 T;  4JLG A;  1JJ2 S;  1N8R C;  4JJN K;  4M7A E;  3RMQ A;  1G3T A;  4ZGJ B;  2EQU A;  3LYI A;  5CCA A;  3CPW S;  3CCV A;  3JCM J;  2L8D A;  4OB0 B;  4FIB A;  2KMT A;  3C95 A;  4M77 B;  2DPP B;  2EAY A;  2CZ1 B;  3VYG A;  3CCE T;  4PLI A;  1VQ8 A;  1KQ1 A;  1WJQ A;  1Y7X A;  4OF1 A;  1K8A C;  1VQ7 T;  3CC2 T;  3BW1 A;  3FDR A;  5CQY A;  4M77 G;  3TEE A;  1WQW A;  5LJ5 e;  3URG A;  4C8Q F;  3CCS A;  4BDY A;  2RH2 A;  2LTO A;  4LDV A;  3ME9 A;  4EPC A;  5EG2 A;  4ELY C;  3FLG A;  4FL6 A;  5LJ5 d;  3CME A;  1VQ4 T;  3MET A;  4OP0 A;  3X25 B;  5I2S A;  1UGP B;  2RHZ A;  2EKO A;  3L2Z A;  3HSB A;  2CZ7 B;  1YIT T;  4JS5 A;  2BUD A;  4HKE A;  3MO8 A;  2JZ2 A;  3FRN A;  2KVQ G;  2CS7 A;  1Q7Y U;  1MHN A;  1KG1 A;  5GAM e;  2I2L A;  3HHT B;  1IZ6 A;  4M7D B;  3FC3 A;  2DO3 A;  1K8A U;  4KUD K;  3VUB A;  2XHC A;  4OGC A;  2ZPI B;  2QQR A;  5FLX E;  3NTK A;  1VIF A;  2EFI A;  3SFM A;  3PIO A;  5GMK j;  3QO3 A;  4M75 G;  2HAX A;  5KCO A;  5GAN 2;  4EMK C;  2M9U A;  4RCC A;  3QJY A;  2D9T A;  1M90 U;  2K2V A;  2L5Q A;  5CAI A;  4RG8 A;  3OW2 S;  1I8F A;  2H3J A;  5CKE A;  4BY6 B;  4ZTF A;  3HRS A;  4M7A B;  1Q81 U;  3GOX A;  1D3B B;  3JB9 F;  2GFU A;  1Y96 A;  1VUB A;  2P0Q A;  3MHX A;  3QII A;  1OZ2 A;  4J8O A;  4LDU A;  5D6Y A;  1YI2 T;  1MGQ A;  4C5G A;  4M7D E;  2ZPB B;  4A54 A;  4IUT A;  2VXF A;  4OB1 B;  4D6W A;  3H6Z A;  5LJ3 e;  4IUQ A;  1NJI C;  3OYJ A;  2KDS A;  4LD6 A;  4XTW A;  5DY9 A;  4F7U B;  3JCM b;  1VQM T;  2D6F A;  3DKM A;  3LX7 A;  4ELZ C;  5C6S A;  1VQP T;  2R57 A;  2O01 E;  3M4G A;  1QVF S;  2HQE A;  4XU1 A;  4LDY A;  4UC4 A;  5I2M A;  3PT9 A;  2JUF A;  1LJO A;  2EQJ A;  3SWN A;  3RUX A;  2XK0 A;  4XTU A;  3JCM X;  4TVR A;  2RHY A;  4J5Y A;  4M75 F;  5GAO l;  3QSU A;  1VQ7 A;  2FYK A;  1PSE A;  5J26 A;  3CC7 T;  4MZP A;  4E7L A;  2GFA A;  5I21 A;  4IUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...