2KMTA

Nmr solution structure of vibrio fischeri ccdb
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
105
structure length
105
Chain Sequence
b'MSQFTLYKNKDKSSAKTYPYFVDVQSDLLDNLNTRLVIPLTPIELLDKKAPSHLCPTIHIDEGDFIMLTQQMTSVPVKILSEPVNELSTFRNEIIAAIDFLITGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CcdB
molecule tags Toxin
source organism Vibrio fischeri
publication title Structural and Thermodynamic Characterization of Vibrio fischeri CcdB.
pubmed doi rcsb
total genus 16
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2kmtA00
5HK0A 5CKDA 3G7ZA 5CKHA 4VUBA 1M1FA 1NE8A 4MDXA 3HPWA 4MZMA 5CQXA 2MF2A 5DLOA 4MZTA 3JSCA 4ME7A 5CR2A 3NFCA 4HKEA 3VUBA 1UB4A 3TCJA 5HKCA 5HK3A 5CQYA 4ELYC 1X75C 3JRZA 5CKEA 5CKFA 5CK9A 4OF1A 5CKBA 5CO7A 4ELZC 5CCAA 2C06A 4MZPA 2VUBA 2KMTA 1VUBA
chains in the Genus database with same CATH superfamily
4IUPA 4C92C 2J6FA 1K9MR 2HEQA 1Z9QA 2E64A 3G6ET 5GAOr 3G71T 1Q95G 3OS0A 1KG1A 1VQ8Q 2LJ1A 5CIUA 3X25B 1AT1B 2DZ9A 2RJFA 1BI3A 3EGDB 2RF0A 2NLUA 1G2BA 2EGAA 5IHKA 1UGRB 1K9MC 4ZTJA 3ULRB 2O31A 3QDRB 2EW3A 2FZGB 2OTJT 2EYQA 2H3JA 2EWNA 4XK8E 4Z89A 4AG1C 1VQLT 3VS5A 3C12A 1UE9A 2RI5A 3OQ5A 2YSQA 2DLPA 2KRNA 4X1VA 2KYBA 3G1JA 2SEMA 4M7DC 3HPWA 3RERA 3LH5A 4JJNK 2XK0A 4C92A 3CCUA 4E7ZA 1K9AA 3OB9A 3G6EA 3EFRA 3I56A 1OX8A 2A7YA 4M7DG 2OTJQ 3WVEB 4X34A 1N6AA 5IN1A 3JAME 1YJWT 4XTVA 4QVDA 3DLLA 1GBRA 3OYGA 2KQWA 4EDUA 4PFOA 3RKXA 4E7IA 3VKIA 3H6ZA 4M7AA 2EQMA 4EPCA 2CT3A 1WHLA 2AT1B 1C0MA 2LCSA 1D1AA 3M53A 3CCLT 5CAIA 3SWNA 1OPKA 1KQSP 1ARKA 4F7UG 1H8KA 2RK1A 2PVOB 3S3NA 2DPPB 2ZAEA 3CMET 1PHTA 3JB9D 5FLXE 4PJOE 1M8MA 2O9VA 4J6XA 1Q81C 3VYHB 4FL6A 3URGA 4UC4A 4XTZA 3L2ZA 3JCMW 4HCBA 2A0FB 4J7IA 2C0IA 3SFMA 5KE3A 3JCMP 5KH6A 1EIFA 4OB1B 1VIEA 2J6OA 3X26B 2WSFE 2EIFA 3X24B 1VQ5T 1E6GA 2YUQA 2RJDA 4BDZA 1D0YA 4FIBA 5GAN7 1FMKA 2K5FA 1G3SA 2ECZA 3GIBA 3I55Q 2KRSA 3NTHA 4CC4B 4E7JA 3CCSQ 2AHJB 2K2VA 2R57A 1ZBXA 2DK3A 1SHFA 2HNIA 1M27C 4P5NA 1CKBA 4M7DB 4CC3A 3OYFA 1KK7A 4FM4B 2GF7A 2NWMA 1PSFA 5I2SA 1N8RC 3UT1A 1R8OB 3EFSA 4QW2A 4VUBA 2RQVA 2SRCA 4JDSA 3M54A 1YCSB 4O6JA 4II1A 3KFVA 2D1XA 4ORZA 1JBMA 4B9WA 1NEBA 2RHXA 3O8VA 3HHTB 1OULA 3A98A 4J6WA 4PKCC 4F7UF 3OS5A 5CKFA 5CCAA 1PM3A 5GAMh 1KHIA 2DYBA 5KE2A 5J3BA 1M90C 5LJ3f 1U5SA 2PVGB 3VRZA 4ZTFA 4A4GA 1KD1U 1WNLA 2XICA 4J9IA 4M7AC 3VUZA 2QEXQ 2LX9A 4J9EA 2C0OA 1TSFA 1QWEA 2CP5A 4M78E 1WYXA 1TS9A 3FJ5A 4KGXB 1O9SA 2DL3A 3RMSA 1E7OA 2RH2A 1RACB 5GMKm 2OI3A 2VWFA 5GAMd 3UPUA 1ZA2B 2P4TA 4M75D 4A53A 4OP0A 5GAOm 4HXJA 2QQ9A 3BW1A 4AG2C 3KUFA 2VGMA 5CVIA 1RABB 3H41A 3SEMA 2ZPIB 1GFCA 1S1NA 4J9HA 1N5ZA 3RKYA 3E2UA 1UTIA 3M9QA 4DOWA 2HL3A 2DTIA 4M78C 1ZSGA 1MMGA 4MDWA 4Q5WA 1VQ5Q 2E5KA 4GLMA 2BUDA 1PRMC 1B07A 1D1BA 1VQMA 2VVKA 4N4IA 5KYXA 1ZQ1A 1TWBA 1SPKA 4MZTA 2J05A 2RA2A 1KQ2A 1SF9A 4MMKA 4RG8A 3TU4K 2ABLA 1Q82C 4J8OA 2DMOA 4PJOD 1PG5B 1FYNA 2HQXA 2DXUA 4EMGA 1S72Q 2FVUA 2Y4YA 1GCQC 4MZMA 2OAUA 3PT9A 5LJ5d 3HL8A 1GL5A 2C0TA 2F2XA 2RHUA 4F04B 2EJFA 3CCQT 1WDXA 2HL5C 3LWHA 1AWOA 1M1GA 4ZN3A 3TQ7P 2FO0A 5KYYA 2QYZA 4E7SA 5CKDA 3FLGA 4M4ZA 2CS7A 5I22A 1Y0MA 3NPFA 1MMNA 1N8RU 1Z9ZA 2O2OA 1WXBA 3D7SB 1K73C 3PMTA 5KYUA 3E9GA 2E41A 5CKEA 5FU6C 1NYGA 4RCBA 4YTLA 4RG2A 1ZBJA 3OS1A 4R0KA 2QTXA 2FG0A 4Y91A 2YUNA 2DRMA 3A1PA 1K0SA 2COZA 2DERA 5CR2A 2O9SA 2W10A 2JT4A 2D8HA 3CCMT 2RI2A 2KXCA 2YUOA 1AOJA 1QW1A 1VQ8A 3CCSA 4M75C 5KCOA 1RI0A 1YJ9T 2CZ0B 3CC2A 3UA6A 2KY9A 2LVMA 1Y57A 2EKHA 3C4SA 3FB9A 2JVVA 1WHGA 2O01E 1M30A 3HRTA 2ENMA 1QMCA 1QVPA 3ER0A 5LJ5e 4JRKA 1ABQA 4GBQA 5KCHA 2DXBA 3N5BB 3CCMQ 4CC7A 2X4XA 4M78D 1XTDA 3S3MA 2KROA 3H0IA 1K1ZA 3IQLA 3A8HB 4FCYA 2JUFA 1LJOA 4ZGDB 2RO0A 2L5QA 4DEXA 1M8VA 2QASA 2Y4XA 1YI2Q 4PJOF 1OYXA 3CXCS 4M75G 1YHQA 1YIJQ 4XQ3A 1C6VX 3GP8A 2P0KA 3R6OA 4QKUA 5DY9A 2EGCA 5GANe 2E65A 1IB8A 2E1HA 3GOXA 1B34A 3OMGA 2HSPA 4E7LA 4C0ZA 2RK2A 5FU7C 4EMKC 2YLBA 2FB7A 2XI9A 1OZ2A 1FXXA 1OQKA 1B3QA 1X2KA 3NTKA 4IIMA 1VYVA 2RB6A 3V7RA 3JCMh 1X6OA 3V7SA 2X3WD 3LX7A 4J83A 4LDYA 3OYJA 4XTWA 3CXCA 2KT1A 3MPUB 3S3OA 1YFNA 1I5OB 4C92B 4K11A 2YRDA 3CCEA 2JOYA 3CQTA 1JB0E 4OF1A 2LRQA 4MZPA 2GFAA 4JPBW 1VQ5A 2E70A 2KGTA 1M3BA 2KDSA 1EFNA 4FYWB 4KH0B 1TU0B 5GANg 2MOXA 3BDLA 1AEYA 4C5IA 1VQ4A 3CD6T 1YCYA 1M3AA 2O4XB 2QXFA 3QO3A 1D0ZA 4RCCA 2XU8A 4BE0A 2HQEA 4JS5A 1YJ9A 3QPHA 1Q81U 2RQWA 2OTLA 2FL7A 1WQ7A 2X4JA 1I0CA 2A28A 2DO3A 2EYYA 3CCST 2GQVA 2DZCA 3SD4A 3EG9B 2L0AA 2KRMA 3CMEA 3VS2A 2LT4A 1GCQA 3CD6Q 4OMOA 1Q7YU 2X4YA 4LUEA 2BE9B 4C8QG 1PC0A 4GLKA 1YJNT 3FIFA 3UDCA 2EJGA 1X75C 1KD1C 1M2OA 1MV0B 3G71Q 4M75E 3CBMA 3LYIA 3P8BB 4A63B 1TUGB 4C0FA 4HKEA 4XU1A 3FEOA 2K2MA 1BB9A 1KQ1A 1YJNQ 2QQSA 1RAGB 3LH0A 4QQ6A 3JCMc 4M7AF 2F2WA 1FMVA 1TTHB 1W2BA 4FSSA 2JS2A 3JB9F 4DBHA 2NUPB 1IO6A 1VQPA 3ZBDA 1LVKA 2ED1A 4KBMB 3DB4A 1WJRA 3MEAA 4C92F 1DJ7B 2KI7A 2ED0A 3PE0A 4OMFB 3WVDB 4JZ4A 1K4US 3I56T 2XIDA 4FYYB 1YITA 2EYXA 2DVJA 3QZ5B 2QA4Q 3PFSA 2HBPA 2DD5A 3CXCP 5GMKe 2PNIA 1NEGA 3JB9H 4ME7A 3LW5E 4FT4A 3VUBA 3J81E 1OZ3A 3QWXX 4IURA 1VQ6T 3L2WA 1YHQT 2KEAA 4BI3A 5A2QE 4JLGA 2AIRB 2DRKA 1UJ0A 4M7AB 1IZ6A 1R77A 4HVVA 3V8LA 3P8HA 1VQMQ 2JTMA 1RAHB 5LJ3e 2EKOA 5GMKl 1FX7A 3CCLA 2BTTA 3HFNA 4X9DA 5GAN8 2ZGWA 2JNGA 2W0ZA 1SSFA 3CC7A 4EMKB 3RDVA 2F5KA 3JB9G 4Z02A 7AT1B 3OS2A 1I07A 3C95A 1VQ9Q 4PJLA 1RLPC 2JMCA 2YRCA 2MYSA 4M77D 9ATCB 3CMAT 2KMTA 1H641 4DA4A 1X43A 1QLYA 5KYYB 3A8GB 4BE2A 3L2UA 3AT1B 1CKAA 3CC7Q 3I35A 4JRIA 4M7AE 5M9OA 3A8OB 3CMAA 2K3BA 2DJZA 1N27A 1WX6A 3UF4A 2HZYA 1XJWB 2KYMA 2RI3A 4LD9K 1K73U 1JQQA 4XU2A 4Y92A 1J3TA 4OB0B 2EQJA 1LCKA 5IHIA 2MPXC 5GAN6 3CC4T 1UFFA 2LJ3A 2X51A 4IUQA 1ZSZA 2GGRA 1SKUB 2HD0A 4ZN1A 1HK9A 4QQGA 3VV0A 3G71A 1TXQA 2V8JA 2RM4A 1QCNA 3JCMf 4Y28E 1YJWA 1NJIC 2BIVA 4M77G 3MO8A 1Y96A 3CCVT 2D6FA 3OSVA 3DB3A 5FROA 4C8QE 4RTYA 2VASA 3GF5A 3EG9A 2FRYA 2LC4A 3NHNA 2QQAA 2V8IA 2DNUA 2MI6A 3CEYA 3E9FA 2E10A 3OMCA 1IHVA 1M9SA 4HT8A 3MP1A 1OU9A 1PD1A 3CCQA 3QZ9B 3JB9J 2QEXT 1WHMA 2RNAA 1TOVA 1Y7XA 2ZPEB 1HD3A 4J9CA 4XAXB 1UGQB 1M3CA 3MEVA 3SB2A 2DE0X 5FU6B 5GAN2 4WF2A 2JM8A 2QDYB 4QVCA 1GFDA 3JCMd 1I1JA 1WHJA 4RTWA 5GAMj 4BUGA 1BIBA 1BCMA 1T0JA 5GAMg 1VQPQ 1WA7A 2K57A 1NE8A 2XMFA 3UWNA 2CP6A 4OMNA 3H0HA 3BY7A 3EFOB 1AWXA 2EQIA 3CCUQ 2DM1A 1SG5A 3A8MB 3RR6A 2EQUA 4F14A 1OPLA 3HRUA 4M77C 4LXCA 1BCOA 2P0QA 1R0BG 5D6YA 3CPWA 1NLOC 3G7ZA 3U23A 4EIKA 3OYBA 2DXTA 4OGCA 3CC7T 1WFWA 2COWA 4E2FB 4KUDK 4J9BA 1PKTA 1UGPB 1K73R 2QDLA 2ROLA 4LD6A 1AD5A 2EBPA 5I21A 1VIFA 3H8ZA 2MAMA 2MCNA 2DX1A 5A0GA 3PVQA 2DTHA 4J9GA 3M5AA 1AZGB 5GAOp 4B6MA 1VQNT 5AYFA 4E7KA 1X6GA 4J7FA 1AHJB 2CREA 3Q1JA 3VS0A 2QA4A 4LE9A 4AT1B 3CC4Q 2J7IA 2KXDA 3FJPA 5GANd 1RADB 1G83A 4FT2A 2GTOA 1ABOA 2OTLQ 1BBZA 2PTKA 3L2QA 4EMKA 2EPDA 4NL2A 2CT4A 1O75A 3DKMA 3J80E 1TUDA 2EYZA 1XQHA 3PGGA 4QT7A 4OMPA 3CC4A 2CH4A 4GY5A 1QP3A 1OX9A 4RUGA 2A3LA 2CZ6B 5LJ5j 4RTUA 1WPYA 2YLCA 1UB4A 1PWTA 3MP6A 2WSEE 3TEEA 5LJ3g 1HSQA 3PNWC 1WHHA 8ATCB 2VXFA 1V76A 5IHNA 1VQLQ 4A4KA 1FWZA 2DTOA 1ZSZC 3UATA 5GANh 1W2BP 3INZA 5CKHA 1WQWA 3FDRA 4MDXA 2CDTA 2RQTA 3C0CA 4AMCA 1X27A 5D6WA 2Z0WA 1W4SA 4JUVA 4BE1A 5DLQE 2VC8A 1BI1A 5A0LA 4A54A 1QKWA 3EHRA 4PLIA 1IGUA 4M78A 4LDXA 5LL6S 4ELYC 4PJOG 3EG3A 4ELZC 5IT9E 4AFSC 1UHFA 5ECAA 1UECA 2IG0A 2E5QA 4PJMA 2DBKA 1AWJA 1RAIB 3RUXA 2KT8A 2AKKA 2CP3A 2LQ8A 1GXIE 2KVQG 2K9GA 2CZ1B 2LX7A 2H8HA 2FRWA 5HK3A 5CQYA 4FYVB 4QVZA 4IIOA 2BKDN 4ATOA 3GNGA 4RTXA 3CCJA 3ASKA 5D7UA 4M75A 2R58A 4PLLA 2GTJA 2CYZB 2L89A 2QGFB 4OVAA 4QQDA 1VQKQ 1QCOA 3QDFA 4KRTA 3TSWA 3VU3C 1AWWA 1NG2A 1XOVA 5CO7A 4KT0E 2VUBA 1FMWA 4BI4A 1WXTA 1K0XA 2LMJA 5EC7A 5J39A 4D6WA 3I55T 2AZVA 3I56Q 1VQKT 2OTJA 5I11A 1VQOT 4OMQA 1D0XA 3FRNA 3CCVQ 4DBFA 4E6RA 1EZZB 2CP7A 2JTFA 2FPFA 2RJEA 1UEBA 3SWNB 4NOYA 1YHQQ 2RMOA 1QP2A 2DL7A 2KNBB 1YIJA 4F7UA 3L2VA 1IREB 2X35A 3JSCA 2DEUA 4C8QD 3ME9A 1WIEA 3I5SA 6AT1B 3EGXB 4ZNXA 3M0SA 5L8RE 1OU8A 4M77A 1E6HA 2KAFA 4C5EA 4JS4A 1WJSA 2R5MA 2RPNA 3OYLA 8AT1B 2XDBA 1ZUKA 1TH7A 2MWPA 4LDWA 1WJQA 4C0GA 5A0DA 3M0UA 3CCLQ 3JCMQ 1OV3A 3OYIA 4IUVA 3CMAQ 3E1SA 2HDAA 3RKWA 2FPDA 1I4K1 4FSXA 3CC2Q 1GRIA 3QJ6A 3HRSA 5GJWB 2LQWA 3MEUA 1QVGA 2YT6A 4IUTA 4JRQA 1YNZA 1PD0A 1YWOA 3JCMJ 5LJ3h 3AHUA 3I9QA 2B86A 1T3LA 4A4EA 5LJ5f 4RTVA 2QQBA 3R6NA 1SRMA 2GQIA 4BY6B 3LGFA 2AKLA 2Y90A 3CCET 2JXBA 4PFZA 1VYTA 3PVLA 5HCKA 4A4HA 2L8DA 4XTYA 1W2BS 4M78F 2R5AA 1MHNA 1KD1R 4M78G 2NYSA 2PU9B 3GNFB 2LCLA 4XU3A 2QK0A 1R0CB 2D0QB 3OW2P 1W70A 2P84A 4J5YA 3H9NA 3L2RA 2LQKA 3OYHA 2RHIA 2YWWA 3NTIA 2CP2A 2LTOA 3NGPA 1VA7A 2FYKA 1C1AA 3MKDA 2NUTA 3M4GA 2E3HA 4M77F 1G3TA 1UG1A 1K8AU 2DL5A 2ESWA 5D6XA 3CBOA 2DFUA 2L3QA 4ANJA 1JJ2S 4C92D 2XG8D 3VS1A 1X69A 1PRLC 2FZCB 2NUPA 1YP5A 4PJNA 1YWPA 4HCCA 5GAMe 2GNCA 2KK4A 4C92G 2M1HA 2VYTA 1B34B 4M7DE 3EGUA 2ZPHB 3OA6A 1VQKA 3OSSC 4FW2A 4D8DA 4C8QC 1VOMA 4N4HA 1QVFP 3OYEA 2H3EB 2GBQA 3M56A 1VQPT 1D3BA 4N0AC 2DILA 3VS6A 2V1RA 5LJ3j 2P4RA 3JV3A 2E12A 1QVFS 1ACMB 2QAZA 5GMKj 1KC8U 1NZ9A 2F69A 1I8FA 1WLPB 1D3BB 4OMMA 1QKXA 2RD1A 1JXOA 4KGVB 1WI7A 1Y07A 4FYXB 2DBMA 1VQNA 3CCVA 2L2PA 1H92A 2DL4A 5KYWA 1JJ2P 1D1CA 4DBQA 3OBYA 2DKGA 1VQ9A 2EAYA 1WHKA 4M78B 5KYXB 2M0YA 3JB9I 2XHCA 1LPLA 4C8QB 2O4XA 4M75F 2M0OA 5IH2A 1NM7A 2E4HA 5C6SA 2JN0A 3VYGA 3QJYA 2MF2A 4PJOA 1XNIA 2DD4A 2LQNA 3BE3A 2A37A 4V2SA 4KULA 5FW9A 1YJ9Q 1NPPA 2CUBA 3CCEQ 2HBWA 1KQSA 1ZX6A 3X20B 2RJCA 3EGXA 2KBTA 3EG1A 1KFZA 3A8LB 5FRMA 4J9DA 1G5VA 5IXBA 2OTLT 4LUDA 2QI2A 2K7AA 5LJ5h 3CCRQ 1NYFA 1B7TA 4N4GA 2VGNA 1W1FA 3OYYA 4TVRA 4ZGEB 1VQ6A 1VQ4T 1K9MU 3CD6A 4C0DC 2A36A 3T9NA 3CCJT 1WGSA 1M4ZA 1G3WA 2J06A 2C06A 3F70A 2EQKA 2EYWA 1KIKA 1N9SA 2KE9A 2LJ0A 1BIAA 3VJPA 1I5LA 5GAOl 3BDUA 2L3PA 2G3RA 4O5VA 1KJWA 1VQ7T 3HFOA 5KYUB 2MK5A 3I55A 1M2VA 3C94A 4LDVA 2HSEB 1SRLA 5GAOq 3JCMV 2CKKA 3TSZA 2QGGA 3OY9A 2PQWA 1OOTA 1VUBA 5GMKi 1YIJT 3J7AF 2ROTA 1K76A 1A0NB 5EG2A 4M75B 2QTVA 1W6XA 3RNJA 2OX7A 1YN8A 1M1KR 4ESRA 4M7DF 3VS7A 4RMOA 2KSSA 2V26A 1RAFB 3PIPA 1K8AC 4FU6A 1X01A 1RAAB 4L6V5 2A08A 2GCXA 3CC2T 2WACA 4C5GA 1NBEB 1SEMA 3HKSA 2ZCFB 2AZSA 3JCMe 2LZ6B 3OYAA 3CCMA 1ZLMA 2X9HA 5HY6A 2M02A 4BI8B 2E3IA 2LNHB 4R56A 1PCXA 4PL6A 5GAOn 2FEIA 4OGEA 1UHCA 3ZFJA 1RLQC 1BI2A 4J6YA 1OI1A 1K8AR 2K5IA 5GANj 3HTRA 3THKA 4PFPA 2M9UA 4M7AD 3EH2A 1JU5C 3TVTA 4LDUA 1PNJA 5CQXA 2RN8A 1T0HA 3QBYA 1JO8A 2IVWA 5HKCA 1BKBA 1HYOA 2L3SA 3REBB 2K3YA 2E6NA 2O88A 2D0NA 4RTZA 1TG0A 1GCPA 4A4FA 4HVWA 1JEGA 4NL3A 3EHQA 5HK0A 5LJ3d 1VQOQ 2LDMA 1QVGP 4L5GA 4JZ3A 4HT9A 2LCCA 3JCMb 1VQ8T 3V8JA 1Q86R 1KC8R 1VQ4Q 1F1BB 2ZPBB 3M58A 1VQNQ 1ZHIA 2DEQA 2QQRA 3HSBA 2QG9B 1NJIR 1LNXA 3RIRA 4F17A 1SSHA 1PSEA 1UDLA 4OB3B 5KYWB 2PUOB 1Q82U 5GAMf 3L42A 3CPWS 1RUWA 1UJYA 3OYKA 4WCIA 2K4YA 3GLXA 1VQ7Q 1BYMA 2COYA 2OAWA 3HP9A 3NFCA 1LOJA 3CPFA 3TCJA 4BY6C 1BU1A 2EJ9A 2I0NA 3QWYA 1Q81R 2JMAA 4PK4A 2DAQA 3OW2A 1VQLA 1X6BA 2B8AA 4C8QF 2K79A 1YJWQ 3VS3A 2CP0A 1VQ7A 1WZOA 3WXMB 1IRXA 2X4WA 2RHZA 4RTTA 2QEXA 1M1KC 4DQ2A 4XTUA 2LT1A 1V1CA 4XU0A 3CBPA 4Z88A 3QSUA 4JJBA 1KSWA 3EG0A 3MJXA 2YHTA 5IXFA 3PTAA 1AVZC 1ZA1B 2QA4T 4HCZA 4AFZC 2G6FX 5FRNA 2CH4W 2RQUA 1VQ6Q 5AT1B 3CPWP 2M16A 4E47A 1U3OA 3JRZA 3G4SA 1MMDA 2RQRA 3JCMg 2VKNA 5FU7B 5GANf 1OEBA 2E6ZA 4HA8A 3OYDA 3EFOA 3RBBB 1IXDA 4CRIA 4F7UE 1SHGA 4M7AG 3P8DA 3GBQA 4OMLA 1Y71A 4CI0C 2OJ2A 4M77B 3PMIA 1N9RA 3KBGA 1D09B 1MNDA 1M1KU 2HKQB 4PJOC 4BACA 5C0MA 2EVRA 2F5TX 3CCJQ 1RAEB 3MHXA 4HVUA 3PIOA 4PNOA 3MP8A 2FPEA 3QYGB 4L59A 3MCAB 1QWFA 2K3XA 4IKFA 1UGVA 4M77E 3ZEHA 3EGDA 5LJ5g 3O5ZA 3V8KA 1HXDA 1X2QA 2ZZDA 3JCMX 2I2LA 3VS4A 5GAN4 1M1FA 3GPLA 4C8QA 3MEWA 4R55A 2VB6A 2V8KA 4MMLA 2K5LA 3M0QA 1PKSA 2X3XD 2LNVA 2NUTB 4IUUA 2DETA 2ZPGB 4AFQC 3S6WA 4ZGJB 4LN2A 2K6DA 4JJDA 1KHCA 1HJDA 4JJCA 2IPOB 2LP5A 1AZEA 4C5HA 4FW1A 3LGLA 2M51A 3X28B 5I2MA 1M90U 1JJ2A 1Q86U 5GMKh 1N8RR 4Z8AA 5KYNA 2BZXA 3M55A 3L1AA 4WTOB 3LLRA 2DXCA 3M4YA 3SHWA 2HMAA 3A5ZB 1NJIU 3M0PA 1EX4A 4JLIA 3REAB 3LWIA 5DM7R 1VQMT 3DLMA 2DF6A 1JXMA 2XDDA 1Q82R 4PJJA 2F2VA 4B9XA 5DLOA 4X9CA 1Y96B 2EGEA 2P0PA 4EMHA 3QXEB 3M57A 2L3RA 2YDLA 5GAN3 2PZ1A 3QUIA 4E7HA 2J6KA 5GJVB 2XD0A 1G3YA 3EH1A 2JS0A 1RL2A 3CMEQ 2BZYA 2DIQA 4N0AA 1UGSB 1T3SA 1U8RA 3META 1MGQA 1MMAA 3CCUT 1H3HA 3G4SQ 2HQHA 2JW4A 1Q7YC 1U1SA 3QG1A 2JTEA 5CKBA 1P92A 2DVEA 4BB7A 1TUCA 4KGZB 3I5RA 2DJQA 3V7CA 4XTXA 4DBRA 2YXYA 2PVDB 4KUIA 1IGQA 4LNPA 1QVGS 1CSKA 2XKOC 2AK5A 3RESA 2F1LA 1V29B 3QIIA 2DL8A 3G6EQ 3QKJA 1S72T 2JZ2A 3G4ST 4M7DA 3CCRT 2JJ9A 1VQ9T 1ZSZB 3TREA 1YITQ 1Q86C 2YRVA 3CCQQ 4OB2B 1YI2T 1IHWA 3NMZC 4J9FA 4PJOB 1MUZA 1U1TA 3OBWA 4KH1B 2KR3A 1YI2A 2FHDA 4NS5A 2ZPFB 1I81A 1M2VB 2CSQA 2DYIA 2FZKB 3SWNC 2DIGA 1VQOA 2D8JA 1YJNA 1YITT 1BI0A 1H3ZA 1S72A 4F7UB 4AFUC 4CC2A 2YUPA 2HCKA 1QVFA 2DA9A 3QHSA 4M7DD 3M59A 4D8KA 1QCFA 2MIOA 2MMPA 1JRIA 2EFIA 5FWCA 1U06A 5L23A 4C92E 2GFUA 4DOVA 5J26A 1UUEA 3EAEA 2ATCB 2HKNA 4JRPA 2PUKB 1BK2A 2CSIA 3OW2S 2D9TA 2JM9A 2MWOA 1G8XA 4C0DB 3FC3A 2BE7D 3M0TA 1KQSS 3KXTA 2IIMA 1NPRA 3BFMA 1MV3A 3SDZA 3M0RA 2BZ8A 3ZL7C 3EG2A 1ZUUA 3H0FA 4BD3A 2HAXA 3OYCA 4F16A 2CZ7B 2NUZA 4RKUE 1ZUYA 1KC8C 2CGHA 1RI9A 1YBYA 3CCRA 4BDYA 1MNEA 3OYNA 2RHYA 3VRYA 5IAYA 5GAN5 1QQJA 2WSCE 3UA7A 1Q7YR 3QYHB 1M5Q1 1M90R 4HCKA 3E19A 1NLPC 4DEYA 2XDPA 2VV5A 2CUDA 5CK9A 1GBQA 5FWBA 3RMQA 1VYUA 3OYMA 2V1QA 1WXUA 2VXEA
chains in the Genus database with same CATH topology
2DTOA 5GANh 4XQ3A 2M9UA 3INZA 5CKHA 4M7AD 1WQWA 3FDRA 2P0KA 4IUPA 3R6OA 3GP8A 4MDXA 4C92C 4LDUA 5DY9A 5CQXA 3G6EA 5D6WA 5GANe 1W4SA 2E65A 4JUVA 5DLQE 4BE1A 2VC8A 1BI1A 2E1HA 2E64A 1B34A 3OMGA 3QBYA 2IVWA 4A54A 1BKBA 4PLIA 5A0LA 5HKCA 3G6ET 3G71T 2K3YA 2E6NA 3OS0A 4M78A 4LDXA 4E7LA 5LL6S 4C0ZA 4ELYC 2RK2A 1KG1A 4A4FA 5FU7C 4PJOG 4EMKC 2YLBA 5CIUA 3X25B 4ELZC 5IT9E 2FB7A 2XI9A 1OZ2A 1FXXA 2DZ9A 4NL3A 2RJFA 1BI3A 3NTKA 3GOXA 5HK0A 2IG0A 5LJ3d 2LDMA 4L5GA 2E5QA 4HT9A 2LCCA 3JCMb 2RB6A 3V7RA 3JCMh 1VQ8T 1X6OA 2NLUA 3V7SA 3LX7A 3V8JA 3RUXA 4J83A 4LDYA 1UGRB 1K9MC 3OYJA 4XTWA 4ZTJA 3CXCA 3QDRB 2LQ8A 1GXIE 3S3OA 2KVQG 2ZPBB 3M58A 2OTJT 1ZHIA 2CZ1B 2DEQA 2EYQA 2QQRA 4C92B 3HSBA 2H3JA 2EWNA 3RERA 5HK3A 1LNXA 3RIRA 4XK8E 5CQYA 3CCEA 4QVZA 1PSEA 2JOYA 1JB0E 4OF1A 2LRQA 2BKDN 1VQLT 4OB3B 4ATOA 4MZPA 2PUOB 2GFAA 3GNGA 3C12A 1VQ5A 3CCJA 1Q82U 2RI5A 2E70A 3OQ5A 5GAMf 3ASKA 3L42A 3CPWS 4M75A 2KDSA 2R58A 4PLLA 3OYKA 4M7DC 5GANg 3HPWA 3BDLA 2CYZB 2L89A 2K4YA 3GLXA 4C5IA 2XK0A 4JJNK 1VQ4A 4C92A 4OVAA 4QQDA 3CCUA 3CD6T 1YCYA 2O4XB 2QXFA 3OB9A 3HP9A 3EFRA 3NFCA 1LOJA 3CPFA 3QO3A 2A7YA 2XU8A 4RCCA 3TCJA 4BY6C 3I56A 3VU3C 4M7DG 2EJ9A 3WVEB 4BE0A 2HQEA 4JS5A 4X34A 1N6AA 1XOVA 3QPHA 5IN1A 3JAME 1YJ9A 1YJWT 1Q81U 2OTLA 4XTVA 2FL7A 1WQ7A 5CO7A 2DAQA 4QVDA 3DLLA 2X4JA 4KT0E 2DO3A 3OYGA 2KQWA 4EDUA 3OW2A 2VUBA 1VQLA 3CCST 3RKXA 2GQVA 4E7IA 2DZCA 3VKIA 2B8AA 4BI4A 4C8QF 3H6ZA 4M7AA 2EQMA 3SD4A 5J39A 3CMEA 4EPCA 4D6WA 2LT4A 3I55T 1VQ7A 3WXMB 3M53A 3CCLT 2X4WA 5CAIA 3SWNA 2RHZA 1Q7YU 4F7UG 1VQKT 2OTJA 2X4YA 2QEXA 2RK1A 1M1KC 4C8QG 4DQ2A 2PVOB 4XTUA 1VQOT 3S3NA 2DPPB 3CMET 3FRNA 3JB9D 2LT1A 4GLKA 5FLXE 3FIFA 1YJNT 3UDCA 2EJGA 1X75C 1KD1C 4PJOE 4J6XA 1Q81C 4XU0A 3CBPA 3VYHB 3QSUA 4FL6A 3URGA 2JTFA 2RJEA 3SWNB 1UEBA 2YHTA 4M75E 3PTAA 4NOYA 3CBMA 3LYIA 2QA4T 3P8BB 4HCZA 4UC4A 4XTZA 1QP2A 3L2ZA 3JCMW 4F7UA 3L2VA 1YIJA 4HCBA 5FRNA 1IREB 2X35A 4C0FA 3JSCA 4J7IA 4HKEA 4C8QD 3SFMA 3ME9A 4XU1A 5KE3A 3JCMP 3FEOA 5KH6A 1EIFA 2M16A 4OB1B 4E47A 1VIEA 1KQ1A 5L8RE 3X26B 2WSFE 2QQSA 3JRZA 2EIFA 3X24B 3G4SA 3LH0A 4M77A 4QQ6A 3JCMc 1VQ5T 2KAFA 4C5EA 3JCMg 2RJDA 4JS4A 1WJSA 4BDZA 4M7AF 2R5MA 4FIBA 5FU7B 2E6ZA 5GANf 5GAN7 3OYLA 1W2BA 2XDBA 2K5FA 4HA8A 3JB9F 1G3SA 3GIBA 1VQPA 1TH7A 2MWPA 4LDWA 1WJQA 3ZBDA 4C0GA 5A0DA 3OYDA 3NTHA 3JCMQ 3OYIA 4IUVA 4CRIA 4F7UE 4KBMB 3E1SA 4M7AG 3P8DA 3DB4A 4E7JA 3RKWA 1WJRA 1Y71A 4CI0C 1I4K1 2AHJB 3MEAA 4FSXA 4M77B 1DJ7B 2K2VA 4C92F 3PMIA 1N9RA 3KBGA 2R57A 3QJ6A 4OMFB 1ZBXA 2DK3A 3HRSA 3WVDB 2HNIA 1M1KU 4PJOC 3I56T 4P5NA 4BACA 2XIDA 4M7DB 3MEUA 5C0MA 3OYFA 1QVGA 4FM4B 2GF7A 1YITA 3QZ5B 2F5TX 4IUTA 1PSFA 3PFSA 5I2SA 2HBPA 1R8OB 2DD5A 3EFSA 3UT1A 4QW2A 4VUBA 4JRQA 1N8RC 4JDSA 3MHXA 5GMKe 3M54A 3PIOA 4PNOA 3MP8A 3JCMJ 4O6JA 4II1A 5LJ3h 3AHUA 4ME7A 3QYGB 3JB9H 3LW5E 4FT4A 4L59A 3MCAB 3VUBA 3J81E 1OZ3A 1JBMA 4IURA 4A4EA 2RHXA 3O8VA 4B9WA 5LJ5f 1VQ6T 2K3XA 2QQBA 3L2WA 1YHQT 4IKFA 3HHTB 4J6WA 4PKCC 4M77E 3ZEHA 4BI3A 3OS5A 4F7UF 5A2QE 4JLGA 5CKFA 4BY6B 5CCAA 3LGFA 5LJ5g 3V8KA 4M7AB 1IZ6A 2Y90A 3V8LA 5GAMh 1HXDA 3P8HA 3CCET 1KHIA 2JTMA 2ZZDA 5LJ3e 3JCMX 2EKOA 2I2LA 1FX7A 4A4HA 5GMKl 3CCLA 5GAN4 5KE2A 5J3BA 1M1FA 2L8DA 3HFNA 1M90C 5LJ3f 4X9DA 4XTYA 5GAN8 1W2BS 2PVGB 4M78F 2ZGWA 3GPLA 2R5AA 4ZTFA 4C8QA 2JNGA 3MEWA 1MHNA 3CC7A 1SSFA 4M78G 2PU9B 3GNFB 4A4GA 4EMKB 1WNLA 1KD1U 2XICA 4R55A 2LCLA 2V8KA 4MMLA 2F5KA 4XU3A 3VUZA 3JB9G 2K5LA 4Z02A 4M7AC 2LNVA 2LX9A 4IUUA 3OS2A 2ZPGB 3C95A 3S6WA 4ZGJB 2D0QB 1KHCA 4M77D 3CMAT 2KMTA 1H641 4M78E 4DA4A 4J5YA 4C5HA 3L2RA 2LQKA 3OYHA 3LGLA 2RHIA 3A8GB 1O9SA 3RMSA 3NTIA 3X28B 4BE2A 2LTOA 2RH2A 5GMKm 3L2UA 5I2MA 2FYKA 1M90U 4JRIA 1Q86U 1JJ2A 4M7AE 5M9OA 5GMKh 3A8OB 3CMAA 3M55A 3M4GA 3L1AA 2DJZA 3LLRA 2DXCA 1N27A 3M4YA 4M77F 5GAMd 1G3TA 3UPUA 2P4TA 4M75D 4A53A 1K8AU 4OP0A 2RI3A 3A5ZB 1NJIU 4LD9K 5D6XA 1K73U 3CBOA 5GAOm 4JLIA 3LWIA 1JJ2S 2QQ9A 4C92D 2XG8D 3BW1A 5DM7R 4XU2A 1VQMT 3KUFA 2VGMA 3DLMA 5CVIA 4HCCA 5GAMe 4OB0B 2KK4A 2EQJA 2ZPIB 2XDDA 4C92G 2M1HA 2VYTA 4B9XA 1B34B 4M7DE 3RKYA 2ZPHB 5GAN6 5DLOA 3OA6A 3CC4T 1VQKA 3OSSC 4IUQA 4X9CA 4C8QC 1Y96B 4N4HA 2P0PA 3OYEA 3M9QA 4EMHA 4DOWA 3M56A 3QXEB 1VQPT 3M57A 1D3BA 2HD0A 2DTIA 1HK9A 4N0AC 4M78C 4QQGA 4ZN1A 2L3RA 3VV0A 5LJ3j 4MDWA 4Q5WA 5GAN3 3G71A 3QUIA 4E7HA 2BUDA 2V8JA 2RM4A 3JCMf 1G3YA 2E12A 1VQMA 1QVFS 2XD0A 4Y28E 1RL2A 1YJWA 1NJIC 5GMKj 2BIVA 2DIQA 3MO8A 4M77G 1KC8U 1Y96A 3CCVT 2D6FA 1NZ9A 4N0AA 2F69A 3OSVA 4N4IA 1ZQ1A 3DB3A 1I8FA 5FROA 4C8QE 1UGSB 1D3BB 4MZTA 3GF5A 2LC4A 1U8RA 2RA2A 2QQAA 2RD1A 1KQ2A 3META 1MGQA 2V8IA 1Y07A 3CCUT 1VQNA 4MMKA 4RG8A 3CCVA 3TU4K 1Q82C 3OBYA 4J8OA 1Q7YC 1U1SA 3QG1A 2MI6A 3CEYA 2DKGA 3E9FA 5CKBA 1P92A 2DVEA 4BB7A 2E10A 1VQ9A 3OMCA 4PJOD 2EAYA 1M9SA 4M78B 4HT8A 3MP1A 3V7CA 3JB9I 2HQXA 2DXUA 4XTXA 2PVDB 4KUIA 2XHCA 3CCQA 4EMGA 3QZ9B 3JB9J 2QEXT 2FVUA 4C8QB 1Y7XA 2O4XA 4M75F 1QVGS 2M0OA 2ZPEB 1BYMA 2XKOC 2Y4YA 5C6SA 2JN0A 3VYGA 4MZMA 3QJYA 2OAUA 3PT9A 1V29B 2MF2A 3QIIA 1UGQB 4XAXB 3HL8A 3RESA 5LJ5d 4PJOA 1XNIA 3MEVA 2DD4A 2RHUA 3SB2A 5FU6B 2EJFA 5GAN2 3CCQT 3QKJA 4WF2A 1S72T 2JZ2A 3G4ST 4V2SA 3LWHA 4M7DA 1M1GA 2QDYB 4KULA 3CCRT 4ZN3A 4QVCA 1VQ9T 1NPPA 3JCMd 3TREA 1KQSA 3X20B 2RJCA 5GAMj 4BUGA 1Q86C 2YRVA 3A8LB 5FRMA 1BIBA 5CKDA 2OTLT 1G5VA 4OB2B 1YI2T 5GAMg 2QI2A 3FLGA 2K57A 5LJ5h 2CS7A 4PJOB 1NE8A 1U1TA 3OBWA 4N4GA 2VGNA 3OYYA 4TVRA 3UWNA 4ZGEB 1N8RU 1VQ6A 1VQ4T 1K9MU 3CD6A 1YI2A 2FHDA 3BY7A 4C0DC 4NS5A 1K73C 2ZPFB 1I81A 3PMTA 3T9NA 3CCJT 3E9GA 2E41A 1WGSA 3A8MB 5CKEA 5FU6C 3SWNC 1M4ZA 2EQUA 4RCBA 5GAOr 1G3WA 3HRUA 2DIGA 1VQOA 4M77C 2C06A 4YTLA 1YJNA 1YITT 1BI0A 3F70A 1H3ZA 4RG2A 1S72A 2EQKA 1N9SA 2P0QA 5D6YA 3OS1A 4F7UB 1BIAA 3CPWA 2QTXA 3VJPA 3G7ZA 5GAOl 1I5LA 3BDUA 3OYBA 4Y91A 1QVFA 2G3RA 2DXTA 3QHSA 4O5VA 4M7DD 4OGCA 3M59A 3CC7T 1VQ7T 3HFOA 3I55A 5CR2A 2MMPA 1JRIA 3C94A 2EFIA 4LDVA 3CCMT 2RI2A 4KUDK 1UGPB 1QW1A 5GAOq 1VQ8A 3CCSA 4LD6A 4M75C 2CKKA 3JCMV 5I21A 5KCOA 1RI0A 4C92E 1YJ9T 1VIFA 2CZ0B 2GFUA 3H8ZA 3OY9A 2MAMA 3CC2A 2PQWA 4DOVA 5J26A 5A0GA 3EAEA 2DTHA 3M5AA 5GAOp 1VUBA 5GMKi 2KY9A 2LVMA 3C4SA 1VQNT 3FB9A 2JVVA 4JRPA 2PUKB 5AYFA 4E7KA 1YIJT 4J7FA 1AHJB 3OW2S 2D9TA 2O01E 3J7AF 2MWOA 3FC3A 4C0DB 3HRTA 3Q1JA 5EG2A 2QA4A 1QVPA 3ER0A 5LJ5e 3FJPA 4JRKA 4M75B 5GANd 1KQSS 5KCHA 3KXTA 2DXBA 4FT2A 3N5BB 1NPRA 3BFMA 3SDZA 2X4XA 4M78D 1XTDA 3L2QA 4EMKA 4M7DF 3S3MA 4BD3A 2HAXA 3OYCA 4NL2A 4RMOA 2KSSA 1O75A 3PIPA 1K8AC 2CZ7B 4FU6A 3DKMA 3A8HB 4RKUE 3J80E 1KC8C 2CGHA 1X01A 2JUFA 1LJOA 1XQHA 3PGGA 4L6V5 1YBYA 2GCXA 3CC2T 4ZGDB 2WACA 2RO0A 4C5GA 3CC4A 3CCRA 4BDYA 3HKSA 1QP3A 2ZCFB 4GY5A 3OYNA 2L5QA 2RHYA 2K5IA 3JCMe 1M8VA 5IAYA 5GAN5 2WSCE 2A3LA 2CZ6B 5LJ5j 3OYAA 3CCMA 1WPYA 2YLCA 3QYHB 5HY6A 1M5Q1 1UB4A 4BI8B 2Y4XA 3MP6A 2WSEE 4PJOF 3E19A 3TEEA 4R56A 5LJ3g 2XDPA 4PL6A 5GAOn 3PNWC 4OGEA 1OYXA 2VV5A 3ZFJA 5CK9A 2VXFA 1BI2A 4J6YA 3CXCS 4M75G 3RMQA 1OI1A 4A4KA 3OYMA 1FWZA 1YHQA 2VXEA 5GANj
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HK0 A;  5CKD A;  3G7Z A;  5CKH A;  4VUB A;  1M1F A;  1NE8 A;  4MDX A;  3HPW A;  4MZM A;  5CQX A;  2MF2 A;  5DLO A;  4MZT A;  3JSC A;  4ME7 A;  5CR2 A;  3NFC A;  4HKE A;  3VUB A;  1UB4 A;  3TCJ A;  5HKC A;  5HK3 A;  5CQY A;  4ELY C;  1X75 C;  3JRZ A;  5CKE A;  5CKF A;  5CK9 A;  4OF1 A;  5CKB A;  5CO7 A;  4ELZ C;  5CCA A;  2C06 A;  4MZP A;  2VUB A;  2KMT A;  1VUB A; 
#chains in the Genus database with same CATH topology
 4IUP A;  4C92 C;  2J6F A;  1K9M R;  2HEQ A;  1Z9Q A;  2E64 A;  3G6E T;  5GAO r;  3G71 T;  1Q95 G;  3OS0 A;  1KG1 A;  1VQ8 Q;  2LJ1 A;  5CIU A;  3X25 B;  1AT1 B;  2DZ9 A;  2RJF A;  1BI3 A;  3EGD B;  2RF0 A;  2NLU A;  1G2B A;  2EGA A;  5IHK A;  1UGR B;  1K9M C;  4ZTJ A;  3ULR B;  2O31 A;  3QDR B;  2EW3 A;  2FZG B;  2OTJ T;  2EYQ A;  2H3J A;  2EWN A;  4XK8 E;  4Z89 A;  4AG1 C;  1VQL T;  3VS5 A;  3C12 A;  1UE9 A;  2RI5 A;  3OQ5 A;  2YSQ A;  2DLP A;  2KRN A;  4X1V A;  2KYB A;  3G1J A;  2SEM A;  4M7D C;  3HPW A;  3RER A;  3LH5 A;  4JJN K;  2XK0 A;  4C92 A;  3CCU A;  4E7Z A;  1K9A A;  3OB9 A;  3G6E A;  3EFR A;  3I56 A;  1OX8 A;  2A7Y A;  4M7D G;  2OTJ Q;  3WVE B;  4X34 A;  1N6A A;  5IN1 A;  3JAM E;  1YJW T;  4XTV A;  4QVD A;  3DLL A;  1GBR A;  3OYG A;  2KQW A;  4EDU A;  4PFO A;  3RKX A;  4E7I A;  3VKI A;  3H6Z A;  4M7A A;  2EQM A;  4EPC A;  2CT3 A;  1WHL A;  2AT1 B;  1C0M A;  2LCS A;  1D1A A;  3M53 A;  3CCL T;  5CAI A;  3SWN A;  1OPK A;  1KQS P;  1ARK A;  4F7U G;  1H8K A;  2RK1 A;  2PVO B;  3S3N A;  2DPP B;  2ZAE A;  3CME T;  1PHT A;  3JB9 D;  5FLX E;  4PJO E;  1M8M A;  2O9V A;  4J6X A;  1Q81 C;  3VYH B;  4FL6 A;  3URG A;  4UC4 A;  4XTZ A;  3L2Z A;  3JCM W;  4HCB A;  2A0F B;  4J7I A;  2C0I A;  3SFM A;  5KE3 A;  3JCM P;  5KH6 A;  1EIF A;  4OB1 B;  1VIE A;  2J6O A;  3X26 B;  2WSF E;  2EIF A;  3X24 B;  1VQ5 T;  1E6G A;  2YUQ A;  2RJD A;  4BDZ A;  1D0Y A;  4FIB A;  5GAN 7;  1FMK A;  2K5F A;  1G3S A;  2ECZ A;  3GIB A;  3I55 Q;  2KRS A;  3NTH A;  4CC4 B;  4E7J A;  3CCS Q;  2AHJ B;  2K2V A;  2R57 A;  1ZBX A;  2DK3 A;  1SHF A;  2HNI A;  1M27 C;  4P5N A;  1CKB A;  4M7D B;  4CC3 A;  3OYF A;  1KK7 A;  4FM4 B;  2GF7 A;  2NWM A;  1PSF A;  5I2S A;  1N8R C;  3UT1 A;  1R8O B;  3EFS A;  4QW2 A;  4VUB A;  2RQV A;  2SRC A;  4JDS A;  3M54 A;  1YCS B;  4O6J A;  4II1 A;  3KFV A;  2D1X A;  4ORZ A;  1JBM A;  4B9W A;  1NEB A;  2RHX A;  3O8V A;  3HHT B;  1OUL A;  3A98 A;  4J6W A;  4PKC C;  4F7U F;  3OS5 A;  5CKF A;  5CCA A;  1PM3 A;  5GAM h;  1KHI A;  2DYB A;  5KE2 A;  5J3B A;  1M90 C;  5LJ3 f;  1U5S A;  2PVG B;  3VRZ A;  4ZTF A;  4A4G A;  1KD1 U;  1WNL A;  2XIC A;  4J9I A;  4M7A C;  3VUZ A;  2QEX Q;  2LX9 A;  4J9E A;  2C0O A;  1TSF A;  1QWE A;  2CP5 A;  4M78 E;  1WYX A;  1TS9 A;  3FJ5 A;  4KGX B;  1O9S A;  2DL3 A;  3RMS A;  1E7O A;  2RH2 A;  1RAC B;  5GMK m;  2OI3 A;  2VWF A;  5GAM d;  3UPU A;  1ZA2 B;  2P4T A;  4M75 D;  4A53 A;  4OP0 A;  5GAO m;  4HXJ A;  2QQ9 A;  3BW1 A;  4AG2 C;  3KUF A;  2VGM A;  5CVI A;  1RAB B;  3H41 A;  3SEM A;  2ZPI B;  1GFC A;  1S1N A;  4J9H A;  1N5Z A;  3RKY A;  3E2U A;  1UTI A;  3M9Q A;  4DOW A;  2HL3 A;  2DTI A;  4M78 C;  1ZSG A;  1MMG A;  4MDW A;  4Q5W A;  1VQ5 Q;  2E5K A;  4GLM A;  2BUD A;  1PRM C;  1B07 A;  1D1B A;  1VQM A;  2VVK A;  4N4I A;  5KYX A;  1ZQ1 A;  1TWB A;  1SPK A;  4MZT A;  2J05 A;  2RA2 A;  1KQ2 A;  1SF9 A;  4MMK A;  4RG8 A;  3TU4 K;  2ABL A;  1Q82 C;  4J8O A;  2DMO A;  4PJO D;  1PG5 B;  1FYN A;  2HQX A;  2DXU A;  4EMG A;  1S72 Q;  2FVU A;  2Y4Y A;  1GCQ C;  4MZM A;  2OAU A;  3PT9 A;  5LJ5 d;  3HL8 A;  1GL5 A;  2C0T A;  2F2X A;  2RHU A;  4F04 B;  2EJF A;  3CCQ T;  1WDX A;  2HL5 C;  3LWH A;  1AWO A;  1M1G A;  4ZN3 A;  3TQ7 P;  2FO0 A;  5KYY A;  2QYZ A;  4E7S A;  5CKD A;  3FLG A;  4M4Z A;  2CS7 A;  5I22 A;  1Y0M A;  3NPF A;  1MMN A;  1N8R U;  1Z9Z A;  2O2O A;  1WXB A;  3D7S B;  1K73 C;  3PMT A;  5KYU A;  3E9G A;  2E41 A;  5CKE A;  5FU6 C;  1NYG A;  4RCB A;  4YTL A;  4RG2 A;  1ZBJ A;  3OS1 A;  4R0K A;  2QTX A;  2FG0 A;  4Y91 A;  2YUN A;  2DRM A;  3A1P A;  1K0S A;  2COZ A;  2DER A;  5CR2 A;  2O9S A;  2W10 A;  2JT4 A;  2D8H A;  3CCM T;  2RI2 A;  2KXC A;  2YUO A;  1AOJ A;  1QW1 A;  1VQ8 A;  3CCS A;  4M75 C;  5KCO A;  1RI0 A;  1YJ9 T;  2CZ0 B;  3CC2 A;  3UA6 A;  2KY9 A;  2LVM A;  1Y57 A;  2EKH A;  3C4S A;  3FB9 A;  2JVV A;  1WHG A;  2O01 E;  1M30 A;  3HRT A;  2ENM A;  1QMC A;  1QVP A;  3ER0 A;  5LJ5 e;  4JRK A;  1ABQ A;  4GBQ A;  5KCH A;  2DXB A;  3N5B B;  3CCM Q;  4CC7 A;  2X4X A;  4M78 D;  1XTD A;  3S3M A;  2KRO A;  3H0I A;  1K1Z A;  3IQL A;  3A8H B;  4FCY A;  2JUF A;  1LJO A;  4ZGD B;  2RO0 A;  2L5Q A;  4DEX A;  1M8V A;  2QAS A;  2Y4X A;  1YI2 Q;  4PJO F;  1OYX A;  3CXC S;  4M75 G;  1YHQ A;  1YIJ Q;  4XQ3 A;  1C6V X;  3GP8 A;  2P0K A;  3R6O A;  4QKU A;  5DY9 A;  2EGC A;  5GAN e;  2E65 A;  1IB8 A;  2E1H A;  3GOX A;  1B34 A;  3OMG A;  2HSP A;  4E7L A;  4C0Z A;  2RK2 A;  5FU7 C;  4EMK C;  2YLB A;  2FB7 A;  2XI9 A;  1OZ2 A;  1FXX A;  1OQK A;  1B3Q A;  1X2K A;  3NTK A;  4IIM A;  1VYV A;  2RB6 A;  3V7R A;  3JCM h;  1X6O A;  3V7S A;  2X3W D;  3LX7 A;  4J83 A;  4LDY A;  3OYJ A;  4XTW A;  3CXC A;  2KT1 A;  3MPU B;  3S3O A;  1YFN A;  1I5O B;  4C92 B;  4K11 A;  2YRD A;  3CCE A;  2JOY A;  3CQT A;  1JB0 E;  4OF1 A;  2LRQ A;  4MZP A;  2GFA A;  4JPB W;  1VQ5 A;  2E70 A;  2KGT A;  1M3B A;  2KDS A;  1EFN A;  4FYW B;  4KH0 B;  1TU0 B;  5GAN g;  2MOX A;  3BDL A;  1AEY A;  4C5I A;  1VQ4 A;  3CD6 T;  1YCY A;  1M3A A;  2O4X B;  2QXF A;  3QO3 A;  1D0Z A;  4RCC A;  2XU8 A;  4BE0 A;  2HQE A;  4JS5 A;  1YJ9 A;  3QPH A;  1Q81 U;  2RQW A;  2OTL A;  2FL7 A;  1WQ7 A;  2X4J A;  1I0C A;  2A28 A;  2DO3 A;  2EYY A;  3CCS T;  2GQV A;  2DZC A;  3SD4 A;  3EG9 B;  2L0A A;  2KRM A;  3CME A;  3VS2 A;  2LT4 A;  1GCQ A;  3CD6 Q;  4OMO A;  1Q7Y U;  2X4Y A;  4LUE A;  2BE9 B;  4C8Q G;  1PC0 A;  4GLK A;  1YJN T;  3FIF A;  3UDC A;  2EJG A;  1X75 C;  1KD1 C;  1M2O A;  1MV0 B;  3G71 Q;  4M75 E;  3CBM A;  3LYI A;  3P8B B;  4A63 B;  1TUG B;  4C0F A;  4HKE A;  4XU1 A;  3FEO A;  2K2M A;  1BB9 A;  1KQ1 A;  1YJN Q;  2QQS A;  1RAG B;  3LH0 A;  4QQ6 A;  3JCM c;  4M7A F;  2F2W A;  1FMV A;  1TTH B;  1W2B A;  4FSS A;  2JS2 A;  3JB9 F;  4DBH A;  2NUP B;  1IO6 A;  1VQP A;  3ZBD A;  1LVK A;  2ED1 A;  4KBM B;  3DB4 A;  1WJR A;  3MEA A;  4C92 F;  1DJ7 B;  2KI7 A;  2ED0 A;  3PE0 A;  4OMF B;  3WVD B;  4JZ4 A;  1K4U S;  3I56 T;  2XID A;  4FYY B;  1YIT A;  2EYX A;  2DVJ A;  3QZ5 B;  2QA4 Q;  3PFS A;  2HBP A;  2DD5 A;  3CXC P;  5GMK e;  2PNI A;  1NEG A;  3JB9 H;  4ME7 A;  3LW5 E;  4FT4 A;  3VUB A;  3J81 E;  1OZ3 A;  3QWX X;  4IUR A;  1VQ6 T;  3L2W A;  1YHQ T;  2KEA A;  4BI3 A;  5A2Q E;  4JLG A;  2AIR B;  2DRK A;  1UJ0 A;  4M7A B;  1IZ6 A;  1R77 A;  4HVV A;  3V8L A;  3P8H A;  1VQM Q;  2JTM A;  1RAH B;  5LJ3 e;  2EKO A;  5GMK l;  1FX7 A;  3CCL A;  2BTT A;  3HFN A;  4X9D A;  5GAN 8;  2ZGW A;  2JNG A;  2W0Z A;  1SSF A;  3CC7 A;  4EMK B;  3RDV A;  2F5K A;  3JB9 G;  4Z02 A;  7AT1 B;  3OS2 A;  1I07 A;  3C95 A;  1VQ9 Q;  4PJL A;  1RLP C;  2JMC A;  2YRC A;  2MYS A;  4M77 D;  9ATC B;  3CMA T;  2KMT A;  1H64 1;  4DA4 A;  1X43 A;  1QLY A;  5KYY B;  3A8G B;  4BE2 A;  3L2U A;  3AT1 B;  1CKA A;  3CC7 Q;  3I35 A;  4JRI A;  4M7A E;  5M9O A;  3A8O B;  3CMA A;  2K3B A;  2DJZ A;  1N27 A;  1WX6 A;  3UF4 A;  2HZY A;  1XJW B;  2KYM A;  2RI3 A;  4LD9 K;  1K73 U;  1JQQ A;  4XU2 A;  4Y92 A;  1J3T A;  4OB0 B;  2EQJ A;  1LCK A;  5IHI A;  2MPX C;  5GAN 6;  3CC4 T;  1UFF A;  2LJ3 A;  2X51 A;  4IUQ A;  1ZSZ A;  2GGR A;  1SKU B;  2HD0 A;  4ZN1 A;  1HK9 A;  4QQG A;  3VV0 A;  3G71 A;  1TXQ A;  2V8J A;  2RM4 A;  1QCN A;  3JCM f;  4Y28 E;  1YJW A;  1NJI C;  2BIV A;  4M77 G;  3MO8 A;  1Y96 A;  3CCV T;  2D6F A;  3OSV A;  3DB3 A;  5FRO A;  4C8Q E;  4RTY A;  2VAS A;  3GF5 A;  3EG9 A;  2FRY A;  2LC4 A;  3NHN A;  2QQA A;  2V8I A;  2DNU A;  2MI6 A;  3CEY A;  3E9F A;  2E10 A;  3OMC A;  1IHV A;  1M9S A;  4HT8 A;  3MP1 A;  1OU9 A;  1PD1 A;  3CCQ A;  3QZ9 B;  3JB9 J;  2QEX T;  1WHM A;  2RNA A;  1TOV A;  1Y7X A;  2ZPE B;  1HD3 A;  4J9C A;  4XAX B;  1UGQ B;  1M3C A;  3MEV A;  3SB2 A;  2DE0 X;  5FU6 B;  5GAN 2;  4WF2 A;  2JM8 A;  2QDY B;  4QVC A;  1GFD A;  3JCM d;  1I1J A;  1WHJ A;  4RTW A;  5GAM j;  4BUG A;  1BIB A;  1BCM A;  1T0J A;  5GAM g;  1VQP Q;  1WA7 A;  2K57 A;  1NE8 A;  2XMF A;  3UWN A;  2CP6 A;  4OMN A;  3H0H A;  3BY7 A;  3EFO B;  1AWX A;  2EQI A;  3CCU Q;  2DM1 A;  1SG5 A;  3A8M B;  3RR6 A;  2EQU A;  4F14 A;  1OPL A;  3HRU A;  4M77 C;  4LXC A;  1BCO A;  2P0Q A;  1R0B G;  5D6Y A;  3CPW A;  1NLO C;  3G7Z A;  3U23 A;  4EIK A;  3OYB A;  2DXT A;  4OGC A;  3CC7 T;  1WFW A;  2COW A;  4E2F B;  4KUD K;  4J9B A;  1PKT A;  1UGP B;  1K73 R;  2QDL A;  2ROL A;  4LD6 A;  1AD5 A;  2EBP A;  5I21 A;  1VIF A;  3H8Z A;  2MAM A;  2MCN A;  2DX1 A;  5A0G A;  3PVQ A;  2DTH A;  4J9G A;  3M5A A;  1AZG B;  5GAO p;  4B6M A;  1VQN T;  5AYF A;  4E7K A;  1X6G A;  4J7F A;  1AHJ B;  2CRE A;  3Q1J A;  3VS0 A;  2QA4 A;  4LE9 A;  4AT1 B;  3CC4 Q;  2J7I A;  2KXD A;  3FJP A;  5GAN d;  1RAD B;  1G83 A;  4FT2 A;  2GTO A;  1ABO A;  2OTL Q;  1BBZ A;  2PTK A;  3L2Q A;  4EMK A;  2EPD A;  4NL2 A;  2CT4 A;  1O75 A;  3DKM A;  3J80 E;  1TUD A;  2EYZ A;  1XQH A;  3PGG A;  4QT7 A;  4OMP A;  3CC4 A;  2CH4 A;  4GY5 A;  1QP3 A;  1OX9 A;  4RUG A;  2A3L A;  2CZ6 B;  5LJ5 j;  4RTU A;  1WPY A;  2YLC A;  1UB4 A;  1PWT A;  3MP6 A;  2WSE E;  3TEE A;  5LJ3 g;  1HSQ A;  3PNW C;  1WHH A;  8ATC B;  2VXF A;  1V76 A;  5IHN A;  1VQL Q;  4A4K A;  1FWZ A;  2DTO A;  1ZSZ C;  3UAT A;  5GAN h;  1W2B P;  3INZ A;  5CKH A;  1WQW A;  3FDR A;  4MDX A;  2CDT A;  2RQT A;  3C0C A;  4AMC A;  1X27 A;  5D6W A;  2Z0W A;  1W4S A;  4JUV A;  4BE1 A;  5DLQ E;  2VC8 A;  1BI1 A;  5A0L A;  4A54 A;  1QKW A;  3EHR A;  4PLI A;  1IGU A;  4M78 A;  4LDX A;  5LL6 S;  4ELY C;  4PJO G;  3EG3 A;  4ELZ C;  5IT9 E;  4AFS C;  1UHF A;  5ECA A;  1UEC A;  2IG0 A;  2E5Q A;  4PJM A;  2DBK A;  1AWJ A;  1RAI B;  3RUX A;  2KT8 A;  2AKK A;  2CP3 A;  2LQ8 A;  1GXI E;  2KVQ G;  2K9G A;  2CZ1 B;  2LX7 A;  2H8H A;  2FRW A;  5HK3 A;  5CQY A;  4FYV B;  4QVZ A;  4IIO A;  2BKD N;  4ATO A;  3GNG A;  4RTX A;  3CCJ A;  3ASK A;  5D7U A;  4M75 A;  2R58 A;  4PLL A;  2GTJ A;  2CYZ B;  2L89 A;  2QGF B;  4OVA A;  4QQD A;  1VQK Q;  1QCO A;  3QDF A;  4KRT A;  3TSW A;  3VU3 C;  1AWW A;  1NG2 A;  1XOV A;  5CO7 A;  4KT0 E;  2VUB A;  1FMW A;  4BI4 A;  1WXT A;  1K0X A;  2LMJ A;  5EC7 A;  5J39 A;  4D6W A;  3I55 T;  2AZV A;  3I56 Q;  1VQK T;  2OTJ A;  5I11 A;  1VQO T;  4OMQ A;  1D0X A;  3FRN A;  3CCV Q;  4DBF A;  4E6R A;  1EZZ B;  2CP7 A;  2JTF A;  2FPF A;  2RJE A;  1UEB A;  3SWN B;  4NOY A;  1YHQ Q;  2RMO A;  1QP2 A;  2DL7 A;  2KNB B;  1YIJ A;  4F7U A;  3L2V A;  1IRE B;  2X35 A;  3JSC A;  2DEU A;  4C8Q D;  3ME9 A;  1WIE A;  3I5S A;  6AT1 B;  3EGX B;  4ZNX A;  3M0S A;  5L8R E;  1OU8 A;  4M77 A;  1E6H A;  2KAF A;  4C5E A;  4JS4 A;  1WJS A;  2R5M A;  2RPN A;  3OYL A;  8AT1 B;  2XDB A;  1ZUK A;  1TH7 A;  2MWP A;  4LDW A;  1WJQ A;  4C0G A;  5A0D A;  3M0U A;  3CCL Q;  3JCM Q;  1OV3 A;  3OYI A;  4IUV A;  3CMA Q;  3E1S A;  2HDA A;  3RKW A;  2FPD A;  1I4K 1;  4FSX A;  3CC2 Q;  1GRI A;  3QJ6 A;  3HRS A;  5GJW B;  2LQW A;  3MEU A;  1QVG A;  2YT6 A;  4IUT A;  4JRQ A;  1YNZ A;  1PD0 A;  1YWO A;  3JCM J;  5LJ3 h;  3AHU A;  3I9Q A;  2B86 A;  1T3L A;  4A4E A;  5LJ5 f;  4RTV A;  2QQB A;  3R6N A;  1SRM A;  2GQI A;  4BY6 B;  3LGF A;  2AKL A;  2Y90 A;  3CCE T;  2JXB A;  4PFZ A;  1VYT A;  3PVL A;  5HCK A;  4A4H A;  2L8D A;  4XTY A;  1W2B S;  4M78 F;  2R5A A;  1MHN A;  1KD1 R;  4M78 G;  2NYS A;  2PU9 B;  3GNF B;  2LCL A;  4XU3 A;  2QK0 A;  1R0C B;  2D0Q B;  3OW2 P;  1W70 A;  2P84 A;  4J5Y A;  3H9N A;  3L2R A;  2LQK A;  3OYH A;  2RHI A;  2YWW A;  3NTI A;  2CP2 A;  2LTO A;  3NGP A;  1VA7 A;  2FYK A;  1C1A A;  3MKD A;  2NUT A;  3M4G A;  2E3H A;  4M77 F;  1G3T A;  1UG1 A;  1K8A U;  2DL5 A;  2ESW A;  5D6X A;  3CBO A;  2DFU A;  2L3Q A;  4ANJ A;  1JJ2 S;  4C92 D;  2XG8 D;  3VS1 A;  1X69 A;  1PRL C;  2FZC B;  2NUP A;  1YP5 A;  4PJN A;  1YWP A;  4HCC A;  5GAM e;  2GNC A;  2KK4 A;  4C92 G;  2M1H A;  2VYT A;  1B34 B;  4M7D E;  3EGU A;  2ZPH B;  3OA6 A;  1VQK A;  3OSS C;  4FW2 A;  4D8D A;  4C8Q C;  1VOM A;  4N4H A;  1QVF P;  3OYE A;  2H3E B;  2GBQ A;  3M56 A;  1VQP T;  1D3B A;  4N0A C;  2DIL A;  3VS6 A;  2V1R A;  5LJ3 j;  2P4R A;  3JV3 A;  2E12 A;  1QVF S;  1ACM B;  2QAZ A;  5GMK j;  1KC8 U;  1NZ9 A;  2F69 A;  1I8F A;  1WLP B;  1D3B B;  4OMM A;  1QKX A;  2RD1 A;  1JXO A;  4KGV B;  1WI7 A;  1Y07 A;  4FYX B;  2DBM A;  1VQN A;  3CCV A;  2L2P A;  1H92 A;  2DL4 A;  5KYW A;  1JJ2 P;  1D1C A;  4DBQ A;  3OBY A;  2DKG A;  1VQ9 A;  2EAY A;  1WHK A;  4M78 B;  5KYX B;  2M0Y A;  3JB9 I;  2XHC A;  1LPL A;  4C8Q B;  2O4X A;  4M75 F;  2M0O A;  5IH2 A;  1NM7 A;  2E4H A;  5C6S A;  2JN0 A;  3VYG A;  3QJY A;  2MF2 A;  4PJO A;  1XNI A;  2DD4 A;  2LQN A;  3BE3 A;  2A37 A;  4V2S A;  4KUL A;  5FW9 A;  1YJ9 Q;  1NPP A;  2CUB A;  3CCE Q;  2HBW A;  1KQS A;  1ZX6 A;  3X20 B;  2RJC A;  3EGX A;  2KBT A;  3EG1 A;  1KFZ A;  3A8L B;  5FRM A;  4J9D A;  1G5V A;  5IXB A;  2OTL T;  4LUD A;  2QI2 A;  2K7A A;  5LJ5 h;  3CCR Q;  1NYF A;  1B7T A;  4N4G A;  2VGN A;  1W1F A;  3OYY A;  4TVR A;  4ZGE B;  1VQ6 A;  1VQ4 T;  1K9M U;  3CD6 A;  4C0D C;  2A36 A;  3T9N A;  3CCJ T;  1WGS A;  1M4Z A;  1G3W A;  2J06 A;  2C06 A;  3F70 A;  2EQK A;  2EYW A;  1KIK A;  1N9S A;  2KE9 A;  2LJ0 A;  1BIA A;  3VJP A;  1I5L A;  5GAO l;  3BDU A;  2L3P A;  2G3R A;  4O5V A;  1KJW A;  1VQ7 T;  3HFO A;  5KYU B;  2MK5 A;  3I55 A;  1M2V A;  3C94 A;  4LDV A;  2HSE B;  1SRL A;  5GAO q;  3JCM V;  2CKK A;  3TSZ A;  2QGG A;  3OY9 A;  2PQW A;  1OOT A;  1VUB A;  5GMK i;  1YIJ T;  3J7A F;  2ROT A;  1K76 A;  1A0N B;  5EG2 A;  4M75 B;  2QTV A;  1W6X A;  3RNJ A;  2OX7 A;  1YN8 A;  1M1K R;  4ESR A;  4M7D F;  3VS7 A;  4RMO A;  2KSS A;  2V26 A;  1RAF B;  3PIP A;  1K8A C;  4FU6 A;  1X01 A;  1RAA B;  4L6V 5;  2A08 A;  2GCX A;  3CC2 T;  2WAC A;  4C5G A;  1NBE B;  1SEM A;  3HKS A;  2ZCF B;  2AZS A;  3JCM e;  2LZ6 B;  3OYA A;  3CCM A;  1ZLM A;  2X9H A;  5HY6 A;  2M02 A;  4BI8 B;  2E3I A;  2LNH B;  4R56 A;  1PCX A;  4PL6 A;  5GAO n;  2FEI A;  4OGE A;  1UHC A;  3ZFJ A;  1RLQ C;  1BI2 A;  4J6Y A;  1OI1 A;  1K8A R;  2K5I A;  5GAN j;  3HTR A;  3THK A;  4PFP A;  2M9U A;  4M7A D;  3EH2 A;  1JU5 C;  3TVT A;  4LDU A;  1PNJ A;  5CQX A;  2RN8 A;  1T0H A;  3QBY A;  1JO8 A;  2IVW A;  5HKC A;  1BKB A;  1HYO A;  2L3S A;  3REB B;  2K3Y A;  2E6N A;  2O88 A;  2D0N A;  4RTZ A;  1TG0 A;  1GCP A;  4A4F A;  4HVW A;  1JEG A;  4NL3 A;  3EHQ A;  5HK0 A;  5LJ3 d;  1VQO Q;  2LDM A;  1QVG P;  4L5G A;  4JZ3 A;  4HT9 A;  2LCC A;  3JCM b;  1VQ8 T;  3V8J A;  1Q86 R;  1KC8 R;  1VQ4 Q;  1F1B B;  2ZPB B;  3M58 A;  1VQN Q;  1ZHI A;  2DEQ A;  2QQR A;  3HSB A;  2QG9 B;  1NJI R;  1LNX A;  3RIR A;  4F17 A;  1SSH A;  1PSE A;  1UDL A;  4OB3 B;  5KYW B;  2PUO B;  1Q82 U;  5GAM f;  3L42 A;  3CPW S;  1RUW A;  1UJY A;  3OYK A;  4WCI A;  2K4Y A;  3GLX A;  1VQ7 Q;  1BYM A;  2COY A;  2OAW A;  3HP9 A;  3NFC A;  1LOJ A;  3CPF A;  3TCJ A;  4BY6 C;  1BU1 A;  2EJ9 A;  2I0N A;  3QWY A;  1Q81 R;  2JMA A;  4PK4 A;  2DAQ A;  3OW2 A;  1VQL A;  1X6B A;  2B8A A;  4C8Q F;  2K79 A;  1YJW Q;  3VS3 A;  2CP0 A;  1VQ7 A;  1WZO A;  3WXM B;  1IRX A;  2X4W A;  2RHZ A;  4RTT A;  2QEX A;  1M1K C;  4DQ2 A;  4XTU A;  2LT1 A;  1V1C A;  4XU0 A;  3CBP A;  4Z88 A;  3QSU A;  4JJB A;  1KSW A;  3EG0 A;  3MJX A;  2YHT A;  5IXF A;  3PTA A;  1AVZ C;  1ZA1 B;  2QA4 T;  4HCZ A;  4AFZ C;  2G6F X;  5FRN A;  2CH4 W;  2RQU A;  1VQ6 Q;  5AT1 B;  3CPW P;  2M16 A;  4E47 A;  1U3O A;  3JRZ A;  3G4S A;  1MMD A;  2RQR A;  3JCM g;  2VKN A;  5FU7 B;  5GAN f;  1OEB A;  2E6Z A;  4HA8 A;  3OYD A;  3EFO A;  3RBB B;  1IXD A;  4CRI A;  4F7U E;  1SHG A;  4M7A G;  3P8D A;  3GBQ A;  4OML A;  1Y71 A;  4CI0 C;  2OJ2 A;  4M77 B;  3PMI A;  1N9R A;  3KBG A;  1D09 B;  1MND A;  1M1K U;  2HKQ B;  4PJO C;  4BAC A;  5C0M A;  2EVR A;  2F5T X;  3CCJ Q;  1RAE B;  3MHX A;  4HVU A;  3PIO A;  4PNO A;  3MP8 A;  2FPE A;  3QYG B;  4L59 A;  3MCA B;  1QWF A;  2K3X A;  4IKF A;  1UGV A;  4M77 E;  3ZEH A;  3EGD A;  5LJ5 g;  3O5Z A;  3V8K A;  1HXD A;  1X2Q A;  2ZZD A;  3JCM X;  2I2L A;  3VS4 A;  5GAN 4;  1M1F A;  3GPL A;  4C8Q A;  3MEW A;  4R55 A;  2VB6 A;  2V8K A;  4MML A;  2K5L A;  3M0Q A;  1PKS A;  2X3X D;  2LNV A;  2NUT B;  4IUU A;  2DET A;  2ZPG B;  4AFQ C;  3S6W A;  4ZGJ B;  4LN2 A;  2K6D A;  4JJD A;  1KHC A;  1HJD A;  4JJC A;  2IPO B;  2LP5 A;  1AZE A;  4C5H A;  4FW1 A;  3LGL A;  2M51 A;  3X28 B;  5I2M A;  1M90 U;  1JJ2 A;  1Q86 U;  5GMK h;  1N8R R;  4Z8A A;  5KYN A;  2BZX A;  3M55 A;  3L1A A;  4WTO B;  3LLR A;  2DXC A;  3M4Y A;  3SHW A;  2HMA A;  3A5Z B;  1NJI U;  3M0P A;  1EX4 A;  4JLI A;  3REA B;  3LWI A;  5DM7 R;  1VQM T;  3DLM A;  2DF6 A;  1JXM A;  2XDD A;  1Q82 R;  4PJJ A;  2F2V A;  4B9X A;  5DLO A;  4X9C A;  1Y96 B;  2EGE A;  2P0P A;  4EMH A;  3QXE B;  3M57 A;  2L3R A;  2YDL A;  5GAN 3;  2PZ1 A;  3QUI A;  4E7H A;  2J6K A;  5GJV B;  2XD0 A;  1G3Y A;  3EH1 A;  2JS0 A;  1RL2 A;  3CME Q;  2BZY A;  2DIQ A;  4N0A A;  1UGS B;  1T3S A;  1U8R A;  3MET A;  1MGQ A;  1MMA A;  3CCU T;  1H3H A;  3G4S Q;  2HQH A;  2JW4 A;  1Q7Y C;  1U1S A;  3QG1 A;  2JTE A;  5CKB A;  1P92 A;  2DVE A;  4BB7 A;  1TUC A;  4KGZ B;  3I5R A;  2DJQ A;  3V7C A;  4XTX A;  4DBR A;  2YXY A;  2PVD B;  4KUI A;  1IGQ A;  4LNP A;  1QVG S;  1CSK A;  2XKO C;  2AK5 A;  3RES A;  2F1L A;  1V29 B;  3QII A;  2DL8 A;  3G6E Q;  3QKJ A;  1S72 T;  2JZ2 A;  3G4S T;  4M7D A;  3CCR T;  2JJ9 A;  1VQ9 T;  1ZSZ B;  3TRE A;  1YIT Q;  1Q86 C;  2YRV A;  3CCQ Q;  4OB2 B;  1YI2 T;  1IHW A;  3NMZ C;  4J9F A;  4PJO B;  1MUZ A;  1U1T A;  3OBW A;  4KH1 B;  2KR3 A;  1YI2 A;  2FHD A;  4NS5 A;  2ZPF B;  1I81 A;  1M2V B;  2CSQ A;  2DYI A;  2FZK B;  3SWN C;  2DIG A;  1VQO A;  2D8J A;  1YJN A;  1YIT T;  1BI0 A;  1H3Z A;  1S72 A;  4F7U B;  4AFU C;  4CC2 A;  2YUP A;  2HCK A;  1QVF A;  2DA9 A;  3QHS A;  4M7D D;  3M59 A;  4D8K A;  1QCF A;  2MIO A;  2MMP A;  1JRI A;  2EFI A;  5FWC A;  1U06 A;  5L23 A;  4C92 E;  2GFU A;  4DOV A;  5J26 A;  1UUE A;  3EAE A;  2ATC B;  2HKN A;  4JRP A;  2PUK B;  1BK2 A;  2CSI A;  3OW2 S;  2D9T A;  2JM9 A;  2MWO A;  1G8X A;  4C0D B;  3FC3 A;  2BE7 D;  3M0T A;  1KQS S;  3KXT A;  2IIM A;  1NPR A;  3BFM A;  1MV3 A;  3SDZ A;  3M0R A;  2BZ8 A;  3ZL7 C;  3EG2 A;  1ZUU A;  3H0F A;  4BD3 A;  2HAX A;  3OYC A;  4F16 A;  2CZ7 B;  2NUZ A;  4RKU E;  1ZUY A;  1KC8 C;  2CGH A;  1RI9 A;  1YBY A;  3CCR A;  4BDY A;  1MNE A;  3OYN A;  2RHY A;  3VRY A;  5IAY A;  5GAN 5;  1QQJ A;  2WSC E;  3UA7 A;  1Q7Y R;  3QYH B;  1M5Q 1;  1M90 R;  4HCK A;  3E19 A;  1NLP C;  4DEY A;  2XDP A;  2VV5 A;  2CUD A;  5CK9 A;  1GBQ A;  5FWB A;  3RMQ A;  1VYU A;  3OYM A;  2V1Q A;  1WXU A;  2VXE A; 
#chains in the Genus database with same CATH homology
 2DTO A;  5GAN h;  4XQ3 A;  2M9U A;  3INZ A;  5CKH A;  4M7A D;  1WQW A;  3FDR A;  2P0K A;  4IUP A;  3R6O A;  3GP8 A;  4MDX A;  4C92 C;  4LDU A;  5DY9 A;  5CQX A;  3G6E A;  5D6W A;  5GAN e;  1W4S A;  2E65 A;  4JUV A;  5DLQ E;  4BE1 A;  2VC8 A;  1BI1 A;  2E1H A;  2E64 A;  1B34 A;  3OMG A;  3QBY A;  2IVW A;  4A54 A;  1BKB A;  4PLI A;  5A0L A;  5HKC A;  3G6E T;  3G71 T;  2K3Y A;  2E6N A;  3OS0 A;  4M78 A;  4LDX A;  4E7L A;  5LL6 S;  4C0Z A;  4ELY C;  2RK2 A;  1KG1 A;  4A4F A;  5FU7 C;  4PJO G;  4EMK C;  2YLB A;  5CIU A;  3X25 B;  4ELZ C;  5IT9 E;  2FB7 A;  2XI9 A;  1OZ2 A;  1FXX A;  2DZ9 A;  4NL3 A;  2RJF A;  1BI3 A;  3NTK A;  3GOX A;  5HK0 A;  2IG0 A;  5LJ3 d;  2LDM A;  4L5G A;  2E5Q A;  4HT9 A;  2LCC A;  3JCM b;  2RB6 A;  3V7R A;  3JCM h;  1VQ8 T;  1X6O A;  2NLU A;  3V7S A;  3LX7 A;  3V8J A;  3RUX A;  4J83 A;  4LDY A;  1UGR B;  1K9M C;  3OYJ A;  4XTW A;  4ZTJ A;  3CXC A;  3QDR B;  2LQ8 A;  1GXI E;  3S3O A;  2KVQ G;  2ZPB B;  3M58 A;  2OTJ T;  1ZHI A;  2CZ1 B;  2DEQ A;  2EYQ A;  2QQR A;  4C92 B;  3HSB A;  2H3J A;  2EWN A;  3RER A;  5HK3 A;  1LNX A;  3RIR A;  4XK8 E;  5CQY A;  3CCE A;  4QVZ A;  1PSE A;  2JOY A;  1JB0 E;  4OF1 A;  2LRQ A;  2BKD N;  1VQL T;  4OB3 B;  4ATO A;  4MZP A;  2PUO B;  2GFA A;  3GNG A;  3C12 A;  1VQ5 A;  3CCJ A;  1Q82 U;  2RI5 A;  2E70 A;  3OQ5 A;  5GAM f;  3ASK A;  3L42 A;  3CPW S;  4M75 A;  2KDS A;  2R58 A;  4PLL A;  3OYK A;  4M7D C;  5GAN g;  3HPW A;  3BDL A;  2CYZ B;  2L89 A;  2K4Y A;  3GLX A;  4C5I A;  2XK0 A;  4JJN K;  1VQ4 A;  4C92 A;  4OVA A;  4QQD A;  3CCU A;  3CD6 T;  1YCY A;  2O4X B;  2QXF A;  3OB9 A;  3HP9 A;  3EFR A;  3NFC A;  1LOJ A;  3CPF A;  3QO3 A;  2A7Y A;  2XU8 A;  4RCC A;  3TCJ A;  4BY6 C;  3I56 A;  3VU3 C;  4M7D G;  2EJ9 A;  3WVE B;  4BE0 A;  2HQE A;  4JS5 A;  4X34 A;  1N6A A;  1XOV A;  3QPH A;  5IN1 A;  3JAM E;  1YJ9 A;  1YJW T;  1Q81 U;  2OTL A;  4XTV A;  2FL7 A;  1WQ7 A;  5CO7 A;  2DAQ A;  4QVD A;  3DLL A;  2X4J A;  4KT0 E;  2DO3 A;  3OYG A;  2KQW A;  4EDU A;  3OW2 A;  2VUB A;  1VQL A;  3CCS T;  3RKX A;  2GQV A;  4E7I A;  2DZC A;  3VKI A;  2B8A A;  4BI4 A;  4C8Q F;  3H6Z A;  4M7A A;  2EQM A;  3SD4 A;  5J39 A;  3CME A;  4EPC A;  4D6W A;  2LT4 A;  3I55 T;  1VQ7 A;  3WXM B;  3M53 A;  3CCL T;  2X4W A;  5CAI A;  3SWN A;  2RHZ A;  1Q7Y U;  4F7U G;  1VQK T;  2OTJ A;  2X4Y A;  2QEX A;  2RK1 A;  1M1K C;  4C8Q G;  4DQ2 A;  2PVO B;  4XTU A;  1VQO T;  3S3N A;  2DPP B;  3CME T;  3FRN A;  3JB9 D;  2LT1 A;  4GLK A;  5FLX E;  3FIF A;  1YJN T;  3UDC A;  2EJG A;  1X75 C;  1KD1 C;  4PJO E;  4J6X A;  1Q81 C;  4XU0 A;  3CBP A;  3VYH B;  3QSU A;  4FL6 A;  3URG A;  2JTF A;  2RJE A;  3SWN B;  1UEB A;  2YHT A;  4M75 E;  3PTA A;  4NOY A;  3CBM A;  3LYI A;  2QA4 T;  3P8B B;  4HCZ A;  4UC4 A;  4XTZ A;  1QP2 A;  3L2Z A;  3JCM W;  4F7U A;  3L2V A;  1YIJ A;  4HCB A;  5FRN A;  1IRE B;  2X35 A;  4C0F A;  3JSC A;  4J7I A;  4HKE A;  4C8Q D;  3SFM A;  3ME9 A;  4XU1 A;  5KE3 A;  3JCM P;  3FEO A;  5KH6 A;  1EIF A;  2M16 A;  4OB1 B;  4E47 A;  1VIE A;  1KQ1 A;  5L8R E;  3X26 B;  2WSF E;  2QQS A;  3JRZ A;  2EIF A;  3X24 B;  3G4S A;  3LH0 A;  4M77 A;  4QQ6 A;  3JCM c;  1VQ5 T;  2KAF A;  4C5E A;  3JCM g;  2RJD A;  4JS4 A;  1WJS A;  4BDZ A;  4M7A F;  2R5M A;  4FIB A;  5FU7 B;  2E6Z A;  5GAN f;  5GAN 7;  3OYL A;  1W2B A;  2XDB A;  2K5F A;  4HA8 A;  3JB9 F;  1G3S A;  3GIB A;  1VQP A;  1TH7 A;  2MWP A;  4LDW A;  1WJQ A;  3ZBD A;  4C0G A;  5A0D A;  3OYD A;  3NTH A;  3JCM Q;  3OYI A;  4IUV A;  4CRI A;  4F7U E;  4KBM B;  3E1S A;  4M7A G;  3P8D A;  3DB4 A;  4E7J A;  3RKW A;  1WJR A;  1Y71 A;  4CI0 C;  1I4K 1;  2AHJ B;  3MEA A;  4FSX A;  4M77 B;  1DJ7 B;  2K2V A;  4C92 F;  3PMI A;  1N9R A;  3KBG A;  2R57 A;  3QJ6 A;  4OMF B;  1ZBX A;  2DK3 A;  3HRS A;  3WVD B;  2HNI A;  1M1K U;  4PJO C;  3I56 T;  4P5N A;  4BAC A;  2XID A;  4M7D B;  3MEU A;  5C0M A;  3OYF A;  1QVG A;  4FM4 B;  2GF7 A;  1YIT A;  3QZ5 B;  2F5T X;  4IUT A;  1PSF A;  3PFS A;  5I2S A;  2HBP A;  1R8O B;  2DD5 A;  3EFS A;  3UT1 A;  4QW2 A;  4VUB A;  4JRQ A;  1N8R C;  4JDS A;  3MHX A;  5GMK e;  3M54 A;  3PIO A;  4PNO A;  3MP8 A;  3JCM J;  4O6J A;  4II1 A;  5LJ3 h;  3AHU A;  4ME7 A;  3QYG B;  3JB9 H;  3LW5 E;  4FT4 A;  4L59 A;  3MCA B;  3VUB A;  3J81 E;  1OZ3 A;  1JBM A;  4IUR A;  4A4E A;  2RHX A;  3O8V A;  4B9W A;  5LJ5 f;  1VQ6 T;  2K3X A;  2QQB A;  3L2W A;  1YHQ T;  4IKF A;  3HHT B;  4J6W A;  4PKC C;  4M77 E;  3ZEH A;  4BI3 A;  3OS5 A;  4F7U F;  5A2Q E;  4JLG A;  5CKF A;  4BY6 B;  5CCA A;  3LGF A;  5LJ5 g;  3V8K A;  4M7A B;  1IZ6 A;  2Y90 A;  3V8L A;  5GAM h;  1HXD A;  3P8H A;  3CCE T;  1KHI A;  2JTM A;  2ZZD A;  5LJ3 e;  3JCM X;  2EKO A;  2I2L A;  1FX7 A;  4A4H A;  5GMK l;  3CCL A;  5GAN 4;  5KE2 A;  5J3B A;  1M1F A;  2L8D A;  3HFN A;  1M90 C;  5LJ3 f;  4X9D A;  4XTY A;  5GAN 8;  1W2B S;  2PVG B;  4M78 F;  2ZGW A;  3GPL A;  2R5A A;  4ZTF A;  4C8Q A;  2JNG A;  3MEW A;  1MHN A;  3CC7 A;  1SSF A;  4M78 G;  2PU9 B;  3GNF B;  4A4G A;  4EMK B;  1WNL A;  1KD1 U;  2XIC A;  4R55 A;  2LCL A;  2V8K A;  4MML A;  2F5K A;  4XU3 A;  3VUZ A;  3JB9 G;  2K5L A;  4Z02 A;  4M7A C;  2LNV A;  2LX9 A;  4IUU A;  3OS2 A;  2ZPG B;  3C95 A;  3S6W A;  4ZGJ B;  2D0Q B;  1KHC A;  4M77 D;  3CMA T;  2KMT A;  1H64 1;  4M78 E;  4DA4 A;  4J5Y A;  4C5H A;  3L2R A;  2LQK A;  3OYH A;  3LGL A;  2RHI A;  3A8G B;  1O9S A;  3RMS A;  3NTI A;  3X28 B;  4BE2 A;  2LTO A;  2RH2 A;  5GMK m;  3L2U A;  5I2M A;  2FYK A;  1M90 U;  4JRI A;  1Q86 U;  1JJ2 A;  4M7A E;  5M9O A;  5GMK h;  3A8O B;  3CMA A;  3M55 A;  3M4G A;  3L1A A;  2DJZ A;  3LLR A;  2DXC A;  1N27 A;  3M4Y A;  4M77 F;  5GAM d;  1G3T A;  3UPU A;  2P4T A;  4M75 D;  4A53 A;  1K8A U;  4OP0 A;  2RI3 A;  3A5Z B;  1NJI U;  4LD9 K;  5D6X A;  1K73 U;  3CBO A;  5GAO m;  4JLI A;  3LWI A;  1JJ2 S;  2QQ9 A;  4C92 D;  2XG8 D;  3BW1 A;  5DM7 R;  4XU2 A;  1VQM T;  3KUF A;  2VGM A;  3DLM A;  5CVI A;  4HCC A;  5GAM e;  4OB0 B;  2KK4 A;  2EQJ A;  2ZPI B;  2XDD A;  4C92 G;  2M1H A;  2VYT A;  4B9X A;  1B34 B;  4M7D E;  3RKY A;  2ZPH B;  5GAN 6;  5DLO A;  3OA6 A;  3CC4 T;  1VQK A;  3OSS C;  4IUQ A;  4X9C A;  4C8Q C;  1Y96 B;  4N4H A;  2P0P A;  3OYE A;  3M9Q A;  4EMH A;  4DOW A;  3M56 A;  3QXE B;  1VQP T;  3M57 A;  1D3B A;  2HD0 A;  2DTI A;  1HK9 A;  4N0A C;  4M78 C;  4QQG A;  4ZN1 A;  2L3R A;  3VV0 A;  5LJ3 j;  4MDW A;  4Q5W A;  5GAN 3;  3G71 A;  3QUI A;  4E7H A;  2BUD A;  2V8J A;  2RM4 A;  3JCM f;  1G3Y A;  2E12 A;  1VQM A;  1QVF S;  2XD0 A;  4Y28 E;  1RL2 A;  1YJW A;  1NJI C;  5GMK j;  2BIV A;  2DIQ A;  3MO8 A;  4M77 G;  1KC8 U;  1Y96 A;  3CCV T;  2D6F A;  1NZ9 A;  4N0A A;  2F69 A;  3OSV A;  4N4I A;  1ZQ1 A;  3DB3 A;  1I8F A;  5FRO A;  4C8Q E;  1UGS B;  1D3B B;  4MZT A;  3GF5 A;  2LC4 A;  1U8R A;  2RA2 A;  2QQA A;  2RD1 A;  1KQ2 A;  3MET A;  1MGQ A;  2V8I A;  1Y07 A;  3CCU T;  1VQN A;  4MMK A;  4RG8 A;  3CCV A;  3TU4 K;  1Q82 C;  3OBY A;  4J8O A;  1Q7Y C;  1U1S A;  3QG1 A;  2MI6 A;  3CEY A;  2DKG A;  3E9F A;  5CKB A;  1P92 A;  2DVE A;  4BB7 A;  2E10 A;  1VQ9 A;  3OMC A;  4PJO D;  2EAY A;  1M9S A;  4M78 B;  4HT8 A;  3MP1 A;  3V7C A;  3JB9 I;  2HQX A;  2DXU A;  4XTX A;  2PVD B;  4KUI A;  2XHC A;  3CCQ A;  4EMG A;  3QZ9 B;  3JB9 J;  2QEX T;  2FVU A;  4C8Q B;  1Y7X A;  2O4X A;  4M75 F;  1QVG S;  2M0O A;  2ZPE B;  1BYM A;  2XKO C;  2Y4Y A;  5C6S A;  2JN0 A;  3VYG A;  4MZM A;  3QJY A;  2OAU A;  3PT9 A;  1V29 B;  2MF2 A;  3QII A;  1UGQ B;  4XAX B;  3HL8 A;  3RES A;  5LJ5 d;  4PJO A;  1XNI A;  3MEV A;  2DD4 A;  2RHU A;  3SB2 A;  5FU6 B;  2EJF A;  5GAN 2;  3CCQ T;  3QKJ A;  4WF2 A;  1S72 T;  2JZ2 A;  3G4S T;  4V2S A;  3LWH A;  4M7D A;  1M1G A;  2QDY B;  4KUL A;  3CCR T;  4ZN3 A;  4QVC A;  1VQ9 T;  1NPP A;  3JCM d;  3TRE A;  1KQS A;  3X20 B;  2RJC A;  5GAM j;  4BUG A;  1Q86 C;  2YRV A;  3A8L B;  5FRM A;  1BIB A;  5CKD A;  2OTL T;  1G5V A;  4OB2 B;  1YI2 T;  5GAM g;  2QI2 A;  3FLG A;  2K57 A;  5LJ5 h;  2CS7 A;  4PJO B;  1NE8 A;  1U1T A;  3OBW A;  4N4G A;  2VGN A;  3OYY A;  4TVR A;  3UWN A;  4ZGE B;  1N8R U;  1VQ6 A;  1VQ4 T;  1K9M U;  3CD6 A;  1YI2 A;  2FHD A;  3BY7 A;  4C0D C;  4NS5 A;  1K73 C;  2ZPF B;  1I81 A;  3PMT A;  3T9N A;  3CCJ T;  3E9G A;  2E41 A;  1WGS A;  3A8M B;  5CKE A;  5FU6 C;  3SWN C;  1M4Z A;  2EQU A;  4RCB A;  5GAO r;  1G3W A;  3HRU A;  2DIG A;  1VQO A;  4M77 C;  2C06 A;  4YTL A;  1YJN A;  1YIT T;  1BI0 A;  3F70 A;  1H3Z A;  4RG2 A;  1S72 A;  2EQK A;  1N9S A;  2P0Q A;  5D6Y A;  3OS1 A;  4F7U B;  1BIA A;  3CPW A;  2QTX A;  3VJP A;  3G7Z A;  5GAO l;  1I5L A;  3BDU A;  3OYB A;  4Y91 A;  1QVF A;  2G3R A;  2DXT A;  3QHS A;  4O5V A;  4M7D D;  4OGC A;  3M59 A;  3CC7 T;  1VQ7 T;  3HFO A;  3I55 A;  5CR2 A;  2MMP A;  1JRI A;  3C94 A;  2EFI A;  4LDV A;  3CCM T;  2RI2 A;  4KUD K;  1UGP B;  1QW1 A;  5GAO q;  1VQ8 A;  3CCS A;  4LD6 A;  4M75 C;  2CKK A;  3JCM V;  5I21 A;  5KCO A;  1RI0 A;  4C92 E;  1YJ9 T;  1VIF A;  2CZ0 B;  2GFU A;  3H8Z A;  3OY9 A;  2MAM A;  3CC2 A;  2PQW A;  4DOV A;  5J26 A;  5A0G A;  3EAE A;  2DTH A;  3M5A A;  5GAO p;  1VUB A;  5GMK i;  2KY9 A;  2LVM A;  3C4S A;  1VQN T;  3FB9 A;  2JVV A;  4JRP A;  2PUK B;  5AYF A;  4E7K A;  1YIJ T;  4J7F A;  1AHJ B;  3OW2 S;  2D9T A;  2O01 E;  3J7A F;  2MWO A;  3FC3 A;  4C0D B;  3HRT A;  3Q1J A;  5EG2 A;  2QA4 A;  1QVP A;  3ER0 A;  5LJ5 e;  3FJP A;  4JRK A;  4M75 B;  5GAN d;  1KQS S;  5KCH A;  3KXT A;  2DXB A;  4FT2 A;  3N5B B;  1NPR A;  3BFM A;  3SDZ A;  2X4X A;  4M78 D;  1XTD A;  3L2Q A;  4EMK A;  4M7D F;  3S3M A;  4BD3 A;  2HAX A;  3OYC A;  4NL2 A;  4RMO A;  2KSS A;  1O75 A;  3PIP A;  1K8A C;  2CZ7 B;  4FU6 A;  3DKM A;  3A8H B;  4RKU E;  3J80 E;  1KC8 C;  2CGH A;  1X01 A;  2JUF A;  1LJO A;  1XQH A;  3PGG A;  4L6V 5;  1YBY A;  2GCX A;  3CC2 T;  4ZGD B;  2WAC A;  2RO0 A;  4C5G A;  3CC4 A;  3CCR A;  4BDY A;  3HKS A;  1QP3 A;  2ZCF B;  4GY5 A;  3OYN A;  2L5Q A;  2RHY A;  2K5I A;  3JCM e;  1M8V A;  5IAY A;  5GAN 5;  2WSC E;  2A3L A;  2CZ6 B;  5LJ5 j;  3OYA A;  3CCM A;  1WPY A;  2YLC A;  3QYH B;  5HY6 A;  1M5Q 1;  1UB4 A;  4BI8 B;  2Y4X A;  3MP6 A;  2WSE E;  4PJO F;  3E19 A;  3TEE A;  4R56 A;  5LJ3 g;  2XDP A;  4PL6 A;  5GAO n;  3PNW C;  4OGE A;  1OYX A;  2VV5 A;  3ZFJ A;  5CK9 A;  2VXF A;  1BI2 A;  4J6Y A;  3CXC S;  4M75 G;  3RMQ A;  1OI1 A;  4A4K A;  3OYM A;  1FWZ A;  1YHQ A;  2VXE A;  5GAN j; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...