3PNWC

Crystal structure of the tudor domain of human tdrd3 in complex with an anti-tdrd3 fab
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
PMEYAKMWKPGDECFALYWEDNKFYRAEVEALHSSGMTAVVKFIDYGNYEEVLLSNIKPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/immune system
molecule keywords FAB light chain
publication title CDR-H3 Diversity Is Not Required for Antigen Recognition by Synthetic Antibodies.
pubmed doi rcsb
source organism Homo sapiens, synthetic construct
total genus 11
structure length 60
sequence length 60
chains with identical sequence F, I, L, O, R, U, X
ec nomenclature
pdb deposition date 2010-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00567 TUDOR Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3pnwC00
2PQWA 5IN1A 3OS2A 3Q1JA 2DIQA 2M1HA 4QQDA 3OB9A 2RO0A 3LGLA 2EQUA 3C4SA 3QBYA 3UWNA 2RJDA 3OYLA 4E7JA 4C5HA 4IUTA 2LCCA 2LVMA 4IUPA 3OA6A 3P8DA 4C5EA 2HQEA 3SD4A 3OMCA 3OQ5A 2M16A 2RI5A 2X4XA 2K3YA 4QQGA 3E9GA 3FEOA 3OS1A 2G3RA 3LH0A 2R5MA 3OYEA 5C6SA 2DIGA 3OYMA 1OZ2A 3OYGA 4ZTJA 3LYIA 4OVAA 3H6ZA 4PL6A 1OZ3A 3MP8A 2BKDN 3E9FA 3O8VA 3OYJA 4BD3A 2MWOA 3OMGA 2QQRA 2R5AA 3LX7A 5J26A 4BDYA 2QQSA 1OI1A 3MEVA 3OS0A 4N4HA 4A4GA 5C0MA 5J39A 3LLRA 3OYAA 4LD6A 1KHCA 4NS5A 3L2VA 1MHNA 2JTFA 3META 4X34A 4BE1A 2VYTA 3FLGA 2DAQA 4ZTFA 1XNIA 4IUQA 4L59A 3QIIA 4A4HA 2GF7A 3L2RA 3L2UA 2F5KA 3DB4A 1H3ZA 4QW2A 3MEWA 4B9WA 3OY9A 4FU6A 5D6WA 2GFUA 3M9QA 5KH6A 5IAYA 2D9TA 3PMTA 1WGSA 3LGFA 4HCZA 4IUVA 5CIUA 5D6YA 4IUUA 1WJSA 4Z02A 4FL6A 4E7IA 4QQ6A 2X4WA 2RHYA 2MWPA 2RHUA 3EAEA 2RJCA 2BIVA 3OYIA 2L8DA 3DLMA 4N4IA 2YRVA 2EQMA 5KE2A 1N27A 3P8HA 3CEYA 4C5IA 2EQJA 3F70A 2EFIA 2RI3A 3MEUA 3MEAA 2P0KA 4BACA 3L42A 3OYBA 4E7HA 5M9OA 2E6NA 2RI2A 4UC4A 2X35A 2FHDA 3ASKA 1RI0A 3OYKA 4E7KA 4C5GA 2NLUA 2O4XB 3OYHA 2BUDA 2RHZA 4BE0A 4A4EA 1OYXA 2LRQA 3DB3A 5KCHA 4CRIA 2RJFA 2L3RA 2GFAA 4II1A 3ZEHA 3OYDA 4N4GA 2JZ2A 4Q5WA 4PLIA 3QKJA 3UT1A 2E5QA 4A4FA 4BDZA 3ME9A 4B9XA 4IKFA 2LTOA 1SSFA 2IG0A 3MO8A 3NTHA 3PMIA 3L2QA 3MP1A 2X4YA 3FDRA 3GOXA 3S6WA 3L2WA 2EQKA 3OYNA 2LDMA 2R58A 2CKKA 5KE3A 2XK0A 5FRMA 2HQXA 2XDPA 3QJ6A 3OYCA 2R57A 2B8AA 5KCOA 2M0OA 3OYFA 5D6XA 2RHIA 2L89A 3S3MA 3FC3A 3KUFA 4EDUA 2RJEA 3PFSA 4RG2A 3S3OA 3NTIA 4QVZA 2K3XA 3H8ZA 2RHXA 1WJRA 4IURA 4BE2A 4E7LA 3PNWC 2WACA 3BDLA 4PLLA 3S3NA 5FROA 1G5VA 4GY5A 2O4XA 1WJQA 5FRNA 3NTKA 2EKOA 3MP6A
chains in the Genus database with same CATH superfamily
2NUPA 4PJMA 1WHMA 3UWNA 1IZ6A 3N5BB 1M2VA 3P8DA 3MKDA 3E9GA 3M59A 3RIRA 1BU1A 4JZ4A 5C6SA 4M7AA 1LNXA 2EJFA 1Y0MA 3EFRA 3CXCA 4ELZC 1OX8A 3OMGA 2JN0A 4ZN3A 2HKNA 2EYQA 1K9AA 2HNIA 1PG5B 1EIFA 1VQOT 5GAMf 4LD6A 3CC4A 3CD6Q 4EPCA 3INZA 4M75G 3THKA 1V1CA 1AZGB 1ZX6A 3L2RA 3EGXB 2EWNA 3KBGA 5GAOr 2DILA 1YIJQ 1WXUA 5CIUA 5D6YA 4IUUA 3QYHB 1T3SA 1QW1A 2RHYA 4JS5A 3EAEA 2EAYA 1SHGA 2EFIA 4OB1B 2HQHA 4HVVA 1IRXA 4R56A 5DLQE 3VU3C 4Z8AA 1DJ7B 1NJIR 2CP2A 3JB9I 5ECAA 5I21A 1I81A 3NFCA 1N8RC 3TVTA 3ZEHA 1VQMQ 1A0NB 2E5QA 4B9XA 1VUBA 2DPPB 3MJXA 4A4KA 2EVRA 1IREB 1WQ7A 5KE3A 2DK3A 4C8QF 5FRMA 1M1FA 4AFSC 1G3YA 4ZNXA 3QO3A 4FIBA 1LCKA 4ANJA 1UJYA 2KXDA 5FROA 4RMOA 3L1AA 3PIOA 2O4XA 1WJQA 3M4GA 1NG2A 3HHTB 4C8QB 1QVGA 1QMCA 1K73R 3G6ET 5GANg 2QDLA 2E12A 3JCMe 2DL5A 1CKBA 2J05A 3JCMJ 2XMFA 2A08A 3SD4A 3VRZA 5IT9E 1PC0A 3OS5A 5I11A 1QKXA 2J06A 2ZPFB 4MMLA 1ZUUA 4OVAA 3LYIA 3H6ZA 1JXMA 3QG1A 2MWOA 4ZGDB 4KRTA 3CMEQ 2LQNA 1RAAB 5GAMd 3SWNC 2E41A 2DD5A 2P0PA 1PD0A 1Q81R 1VQLA 5CCAA 3OYAA 4M75A 2A28A 3JCMc 3CMAQ 4QKUA 3JCMV 2A7YA 2VYTA 4ZTFA 2DAQA 3QIIA 4EMGA 3L2UA 2E5KA 1YJ9T 2LP5A 2HL3A 4FT4A 2D0QB 3GF5A 3UF4A 2H3JA 2H8HA 3JCMg 3DLLA 1VQOA 4PFZA 3REAB 3OYIA 4ORZA 5KE2A 2QQAA 4K11A 3F70A 3MEAA 1NE8A 4J9HA 1Q7YR 1G3WA 1K9MU 1D0YA 3JCMP 5KYYB 2DTOA 3OW2P 4A4EA 1D1AA 5GAN3 1Q82R 4FT2A 2X3WD 2JUFA 2QA4T 1XOVA 1EX4A 2JZ2A 4PLIA 3X26B 1Y96B 4A4FA 1YI2Q 2D1XA 4J9BA 2OTLT 4AFQC 3I5SA 3QZ9B 2K9GA 2D6FA 1MMNA 3QJ6A 1W6XA 2V8IA 2MPXC 1FMWA 5LJ3f 3H8ZA 3M56A 2RH2A 1VQPQ 4LD9K 1FMKA 1NYGA 4HVWA 1BI0A 4GY5A 3H0HA 4EMKC 3RKYA 4OGCA 4DOVA 2PTKA 4M78G 5GAOn 4C5EA 5GAN5 3OW2S 3OQ5A 2LJ0A 2Z0WA 3CCUT 1U1SA 4PL6A 4RTWA 3E1SA 5IXFA 3JRZA 3OYJA 1PD1A 4AFUC 2R5AA 6AT1B 2GQVA 1G2BA 3G6EA 2CZ6B 4ZGEB 2DTIA 3VS0A 2CT4A 3EG1A 8ATCB 3CC4Q 4FSSA 4DEYA 1PNJA 4X34A 4M7AE 1I0CA 1QP2A 1UGSB 2KAFA 2F5KA 2GTOA 3RMSA 3CD6T 3VV0A 2LX9A 5HCKA 4FCYA 1M4ZA 1KC8R 2E3IA 3V7RA 1SSHA 1PRMC 2O2OA 2ZCFB 2RHUA 3R6OA 2E3HA 4M7DD 1PHTA 2PVGB 1ZBJA 1YBYA 3MEUA 2M0YA 4E7HA 2RD1A 2KE9A 2RI2A 1RI0A 2RK1A 2NLUA 3A8MB 1Q95G 1JU5C 1X6GA 1WHLA 4VUBA 3DB3A 1K76A 4Q5WA 1IGQA 4BDZA 4PJOF 1M3AA 3ZFJA 3CPWP 2D8JA 3CCJQ 3MO8A 5DY9A 2RNAA 1T0JA 2HAXA 3SWNA 3L2QA 2IPOB 1ARKA 3OYNA 2LDMA 4M77E 1H92A 4DBFA 7AT1B 3G71Q 3J7AF 4PJOB 5LJ3d 5GMKe 3OYFA 5FU6B 5FWBA 3TSZA 1ABQA 4IIMA 2QA4A 2NUTA 4E7LA 4IURA 4R0KA 5CO7A 1XQHA 1X69A 1AEYA 1SHFA 4Z88A 3MP6A 2KNBB 2PNIA 4M78A 2M1HA 3REBB 1I5LA 1RUWA 1UB4A 1NEGA 3H9NA 1WA7A 2M16A 4Y92A 2K3YA 3TREA 1YJWQ 2R5MA 3EGDA 2DIGA 4E2FB 1X2QA 2QI2A 3OW2A 3CPWS 1EZZB 2EGAA 2RQUA 1KD1C 2L3SA 2DVEA 1VQLQ 1Y57A 4JRKA 3V8JA 2BZYA 1MHNA 4JS4A 1D09B 4HCKA 3CCUA 3EG3A 4C8QG 1TUCA 5I22A 1GCQA 3CMAT 1RACB 2AIRB 4HCZA 1NM7A 2DBMA 3URGA 2JM8A 2ED0A 1UHFA 1N6AA 1H641 1M8VA 5GAMh 3BE3A 3KFVA 2GCXA 2KT8A 2V1QA 2P0KA 3OYBA 3OYKA 2F5TX 2O01E 1PKTA 1MGQA 1NPPA 4XK8E 2PVOB 1BCMA 3OYHA 3C12A 4M4ZA 3CCSQ 3I56T 1M1KC 2KRNA 4E7ZA 3EGXA 4FYXB 3I55T 2DXBA 1H3HA 2E70A 4C92D 4F04B 2CUDA 2F1LA 2HL5C 2J6KA 3M0QA 1OOTA 2JXBA 2NUZA 1BIAA 2MI6A 4LUEA 2DETA 5D7UA 2XDDA 1JO8A 3V7SA 4M7DE 3HFNA 5LJ5d 4DEXA 2K3BA 5FRNA 1IGUA 1VQPT 4PJNA 1AZEA 1WFWA 2DEQA 1WXTA 4LDYA 3OA6A 4Z89A 2JM9A 2HQEA 1VYTA 5GMKj 2C0OA 1AWJA 1K8AU 2Y90A 3EFOA 3SB2A 1YCYA 4LNPA 1CSKA 3H0FA 1X6BA 4J5YA 4CC2A 3VYGA 3HP9A 3LLRA 1CKAA 3CCVT 2RN8A 4C8QA 3QWYA 3VJPA 2K57A 3CCQA 3DB4A 2J6OA 2ROTA 3VS4A 2RQRA 5IH2A 4J9GA 5HK0A 5IAYA 1WGSA 2ROLA 1ZSZC 1N9SA 2EPDA 3FJPA 4E7SA 5L8RE 3JCMb 2VV5A 1Q86U 1UECA 2ZPHB 2LT1A 1K0XA 3VS3A 3CMAA 3SEMA 2DBKA 1U06A 5AYFA 1VQ6T 1MNEA 3LW5E 1FYNA 1GCPA 1TOVA 1UUEA 3DKMA 2VKNA 3SWNB 2OTJQ 1X2KA 3OYDA 2CSIA 3QKJA 1JJ2P 3CCEQ 1ZBXA 1SSFA 2F2WA 2AKKA 2M9UA 4L6V5 4O6JA 2KSSA 2YUQA 2LMJA 3S6WA 3CCLA 3CCJT 2YSQA 2XK0A 1ZLMA 3I56A 1O75A 4FW1A 1R0BG 5KCOA 2DEUA 2KRSA 5FLXE 3I55A 2CT3A 2CZ0B 1D0XA 4QVZA 2COZA 5GMKi 3G71T 2L3PA 4JJDA 2QQBA 2CP3A 3A5ZB 4UC4A 3LWHA 1KHIA 5IN1A 2VASA 1UDLA 5CKHA 4E7JA 4C5HA 3EGDB 2LCCA 1D3BB 1Y96A 2D8HA 2KYMA 1QVPA 5GANf 4OMPA 5HKCA 4XU1A 1VQ5A 3LH0A 5CKEA 3JCMQ 3OYGA 4KUDK 1KSWA 1JJ2S 4JLGA 1WZOA 1VQPA 1YJWT 4PJOG 2JTEA 1WHKA 2AKLA 1WX6A 2K7AA 2OAWA 3QPHA 2I2LA 3M55A 2RB6A 1KQ1A 2DXUA 4RTVA 3CCUQ 2FZGB 2J6FA 1VQLT 3CC2Q 5CKBA 4LDVA 3CBMA 2EJ9A 1LJOA 4RCCA 3VS7A 4EMKB 2DF6A 3LWIA 4QQ6A 3CCVA 3JCMf 1YCSB 2YRVA 2M51A 4BB7A 4XU2A 3L42A 2MCNA 2X35A 2O9SA 4C5GA 1X27A 3GIBA 2O88A 3A8OB 1WHHA 3JAME 2ABLA 1JRIA 4M7DC 4J9EA 2JOYA 4DA4A 3BW1A 5FWCA 3CCST 3PMIA 2BZXA 1AWXA 2DL7A 1VQ6A 2JS2A 4KGXB 3PIPA 2XDPA 1GXIE 4JRQA 2R57A 1IO6A 3L2ZA 1VA7A 2BTTA 2NWMA 2QAZA 1ABOA 1WJRA 2LQKA 2WACA 3M0PA 2QGFB 1ZSZA 3CCJA 2XG8D 4J6WA 1M90U 3JB9D 2O9VA 2CZ1B 2LQWA 3QXEB 1VQ9Q 3EFOB 4LDWA 2O31A 1UG1A 3PVQA 2FYKA 5GANd 1NJIC 1ZA1B 1NZ9A 5FU7C 1BI2A 3P8BB 5A0LA 3G71A 1X01A 3OYEA 3EG0A 4X1VA 4D8KA 2AK5A 4M7AD 3PE0A 4PJOA 1AHJB 5LJ5h 3RKWA 1QQJA 3HL8A 2CUBA 1B34B 4N0AC 1JJ2A 1SF9A 3D7SB 3M58A 4MZMA 3G1JA 3FLGA 3SDZA 1PSFA 3CCQQ 3PGGA 2KRMA 2LC4A 4QW2A 1JEGA 1YJWA 1JBMA 2EYWA 1JB0E 2G6FX 3JCMd 4Z02A 4FL6A 1M3BA 2P0QA 1K73C 4C0ZA 2CH4A 3HFOA 3X28B 2DTHA 2KXCA 1VYUA 1OULA 2WSCE 5M9OA 1IB8A 1M2OA 1K0SA 1OPLA 1UEBA 2XI9A 1FX7A 5GMKm 1I07A 2HSEB 5KCHA 4C0FA 4M77D 2HKQB 2GFAA 3H0IA 4II1A 1Q81C 4JRIA 2DKGA 2PUKB 3OBWA 4OMMA 2E6ZA 2OTJT 1QLYA 3CCET 4L5GA 3CCLQ 1XJWB 5IXBA 4Y28E 2X9HA 3MPUB 1OQKA 2HQXA 3I56Q 4LXCA 5KYWB 3S3MA 3M57A 3MCAB 4MDWA 4C92C 2FL7A 3I55Q 3PFSA 2CDTA 1YP5A 4YTLA 2RHXA 3CCSA 2VVKA 1D1CA 2DZCA 2YXYA 2K4YA 2YDLA 5FW9A 2YRDA 1X6OA 2K6DA 4QQDA 1W4SA 3QBYA 5LL6S 4IUTA 4E47A 2LVMA 1Q7YC 3ZL7C 2CP5A 2HEQA 2ZPGB 2QGGA 1RAHB 1Q82C 3TU4K 1VQ5Q 2X4JA 1PRLC 3NPFA 3OYMA 1OZ2A 1VQKQ 1HYOA 3MP8A 4J9CA 1YWOA 2QQRA 2KBTA 4HT8A 2RM4A 3MEVA 1N5ZA 4XTXA 2FVUA 1K8AR 2WSEE 3MHXA 2MMPA 4KGVB 4C0GA 2JTFA 4A54A 2A36A 4MZPA 2DJZA 4M75D 3UATA 4BE1A 2FRWA 4F7UE 3FIFA 3RERA 4AG2C 4FSXA 1VQ8Q 1YITQ 3HRSA 5CKDA 2AZVA 3NHNA 3CC2T 3M0TA 3CCVQ 2ZPIB 1UHCA 2FG0A 2KT1A 3M0UA 2I0NA 2ED1A 2ZPEB 1AOJA 2XIDA 3ASKA 4PFOA 1KK7A 1OX9A 3CC7Q 4JUVA 1YFNA 3G4SA 4JZ3A 1Q86R 2EGEA 2V8KA 2OJ2A 4DBHA 4Y91A 3GPLA 1LVKA 4KT0E 1U1TA 1RAFB 1FXXA 5GAMj 1VQ6Q 1I4K1 2KDSA 2X51A 1U8RA 2DL8A 1KC8C 2PZ1A 1ZSZB 1P92A 2PU9B 3I5RA 2KR3A 3S3NA 1TG0A 2OTJA 2QTXA 3CCEA 2OI3A 3U23A 3SFMA 3OB9A 2ZGWA 4PJJA 3QYGB 1N8RU 1VQ9T 3CPFA 2KVQG 4XAXB 2P84A 1NJIU 1BI3A 2AHJB 2KY9A 3A8GB 1OU9A 1SRLA 4J7FA 2P4TA 1FWZA 2DNUA 2CP7A 2QXFA 4EMHA 5GANh 4L59A 4A4HA 2F69A 1UFFA 2MOXA 1S72Q 4X9CA 1D3BA 3CCQT 4BI8B 2K2MA 4C92A 3C94A 1O9SA 4FYYB 2DXCA 2CYZB 1WHJA 3TCJA 1QVFS 4N4IA 4FYVB 2E6NA 4GBQA 3CCMQ 2LZ6B 3CC2A 1VQ4A 3JB9J 3C95A 1T3LA 1C0MA 4M75E 4HCCA 1UJ0A 4GLMA 2XD0A 2A3LA 3LH5A 4OMQA 5GAN4 1OPKA 1M9SA 2FO0A 2GQIA 3M53A 4D8DA 4EMKA 1YHQQ 4OP0A 1D0ZA 1M30A 3TEEA 1HJDA 1RAGB 3EG9B 4V2SA 3CCLT 2DVJA 1C1AA 2DL4A 3EGUA 3S3OA 3QUIA 4XU0A 2QYZA 5CK9A 2DXTA 2GTJA 2YWWA 2ZPBB 1I5OB 3O8VA 4CC3A 5CR2A 4M7DF 5A2QE 2DMOA 2RO0A 3LGLA 3CCRQ 4JRPA 2RJDA 1GFDA 4M78D 5KYUB 1YJNA 2A0FB 2X4XA 4QQGA 1WNLA 1YNZA 4M7DB 3QDRB 2QQ9A 1M90R 3E9FA 2W0ZA 4HA8A 1VQ5T 3QDFA 1VQKT 3RDVA 5C0MA 1Y7XA 3L2VA 1VQ9A 5LJ5e 3C0CA 4M7AC 2DA9A 4TVRA 4A63B 2FEIA 2AZSA 2GF7A 4NOYA 9ATCB 4FU6A 3V8KA 3UA6A 4E6RA 2JW4A 1GL5A 1VQ8T 1YITT 4OMNA 1VQNT 1N27A 3P8HA 3CPWA 4LUDA 4HT9A 2H3EB 3KXTA 4BACA 1B3QA 5FU7B 2KYBA 2RA2A 1B34A 3GNGA 2K5FA 1OYXA 2LRQA 3G4SQ 1UTIA 1LPLA 2VGMA 1MMGA 4J83A 1W70A 2RQTA 3OSVA 3CC7T 1GBQA 3ME9A 3M0RA 2LTOA 4IKFA 4LE9A 5EC7A 3FDRA 3CXCS 2R58A 1WDXA 3UA7A 1BK2A 4D6WA 4M77C 1MMAA 1RLQC 2JT4A 4J9IA 5D6XA 3VRYA 2IIMA 2JS0A 4FYWB 3PNWC 3G7ZA 3HTRA 4MMKA 4RTUA 3JV3A 1M27C 4MDXA 2L2PA 2EYYA 2NYSA 1K9MR 3VS2A 2DIQA 4O5VA 3QHSA 2Y4XA 2HZYA 4IUPA 4RCBA 5CKFA 3RMQA 2GNCA 1RAEB 2DZ9A 4JJCA 3X20B 3QSUA 5CVIA 1XTDA 3AT1B 4BUGA 4ZTJA 3ER0A 3BDUA 3WVEB 2JMAA 1TTHB 2HSPA 3GBQA 2ESWA 5KYWA 4C92F 3OS0A 3QWXX 1TSFA 1VIFA 3A8LB 2V8JA 1WIEA 4ESRA 1ZA2B 3META 1EFNA 2E10A 3GLXA 1R8OB 1TWBA 3OSSC 4C92B 3OYYA 4C8QD 4HVUA 3OY9A 2XHCA 1ACMB 1X75C 2DM1A 3J80E 2RMOA 3M9QA 2A37A 5LJ3h 2B86A 1VQKA 1AD5A 2K2VA 1S72T 4ZGJB 4M78E 3H41A 5CAIA 4M75C 1K4US 2EKHA 1VQ7T 1JQQA 3DLMA 2K79A 4QVCA 3QZ5B 3X24B 5LJ5j 4C5IA 5AT1B 1NPRA 2EQJA 1TUDA 1M1GA 1AWWA 4XQ3A 1TXQA 5J3BA 2VXEA 3A1PA 1KD1U 4EIKA 1VQ4Q 1QVGS 1VQ8A 1YITA 1BIBA 4XU3A 1QCOA 3CCMT 1VQNA 4LDUA 4BI4A 2L3RA 5GAOl 1D1BA 5IHKA 2SEMA 3BY7A 1ZUYA 1Y71A 1SEMA 4RUGA 3VS6A 2IG0A 3NTHA 2HD0A 3RESA 3GOXA 2COYA 4WF2A 5GAOq 2B8AA 4C0DC 1YHQT 1U5SA 4RTYA 1JXOA 4WTOB 1T0HA 3KUFA 3CC7A 3NTIA 1Z9ZA 4MZTA 1BKBA 1TS9A 2EYXA 4PNOA 2V1RA 3NTKA 3O5ZA 1QCNA 4KBMB 2PQWA 4WCIA 3OS2A 2QEXT 3VUZA 3Q1JA 3E2UA 2L0AA 3GNFB 2EQUA 1B07A 2YLBA 4CI0C 5GAN6 2CSQA 1UE9A 1YJNQ 1M1KU 5IHNA 5KYXA 2BE9B 2RI5A 5GJWB 3CCRT 2FPDA 2CP6A 1UGQB 2E1HA 1KFZA 1NEBA 1OZ3A 1U3OA 2BKDN 5A0GA 2IVWA 1VOMA 1N8RR 3EH1A 2VUBA 4A4GA 4NS5A 1KHCA 2EQIA 2JNGA 3RKXA 3WXMB 3CQTA 2FZKB 1XNIA 4M77A 4JDSA 3HPWA 5D6WA 1M3CA 1ZUKA 1RI9A 2D9TA 3OBYA 5GANe 4J7IA 1WJSA 3J81E 2BZ8A 4JLIA 2L8DA 4F17A 4M7DG 2EIFA 2DERA 2EQMA 2XKOC 2L5QA 3EHQA 3V7CA 2GGRA 4AT1B 4DQ2A 4E7KA 2MYSA 1MV3A 3JCMX 1J3TA 1S72A 4KUIA 4BE0A 3PVLA 2OX7A 1YWPA 1VQ7A 2RQVA 1RL2A 2JMCA 4N4GA 3G4ST 2KEAA 2LNHB 2MF2A 2CP0A 2DRMA 4C8QE 3MP1A 4PKCC 3VKIA 2EQKA 3L2WA 1G3TA 2DL3A 5GAMe 3OYCA 3CCMA 4OB2B 2RHIA 3RUXA 2ECZA 3CBPA 4BE2A 3BDLA 4PLLA 1G5VA 1BI1A 2ZZDA 1YN8A 2QTVA 4FM4B 2QG9B 3M5AA 1YHQA 2CGHA 3ZBDA 2YUOA 3OMCA 1HK9A 1M5Q1 3UDCA 1G83A 2G3RA 4PJLA 2CZ7B 4BI3A 1TU0B 2QEXA 4M78C 2LCSA 4BY6C 4BDYA 5GAMg 2QQSA 3EG9A 2YLCA 4QT7A 4XTVA 4PJOD 4XTWA 3M0SA 1AVZC 5KYNA 1WLPB 3CCRA 5DLOA 1RLPC 5GMKl 2YUPA 1E7OA 4ME7A 1SG5A 3MEWA 1KQSP 5KYUA 2M02A 4F7UF 1WPYA 2CREA 3FJ5A 1Z9QA 4M7DA 3PTAA 1PKSA 3JB9F 4FW2A 2HBWA 4F7UB 4AG1C 2RI3A 2VXFA 1GCQC 3EFSA 4J9FA 5GANj 5L23A 2BUDA 2NUPB 2P4RA 4M7AF 2JTMA 1VQNQ 1QP3A 3JSCA 4RTTA 1K8AC 1VQ4T 1M2VB 4C92G 3RR6A 2EYZA 4LDXA 4ELYC 1MNDA 2DYBA 2VC8A 3A8HB 2SRCA 4M7AB 1FMVA 1HSQA 2DD4A 1QWEA 2RQWA 1KQSS 3NMZC 3M54A 4P5NA 2L89A 3FC3A 2E64A 4PFPA 3I35A 4EDUA 2RJEA 3HSBA 4RG2A 2DYIA 2K3XA 3NGPA 1R77A 5GAN7 3WVDB 4RTXA 3EG2A 2EKOA 3BFMA 5EG2A 3T9NA 5KYXB 1QCFA 1UGRB 2W10A 1N9RA 1UGPB 4QVDA 4N0AA 4ZN1A 1KQ2A 2E4HA 4RTZA 2DFUA 2HDAA 1Q86C 3FEOA 4JJBA 2F2XA 1YJNT 2LX7A 5DM7R 2YUNA 3IQLA 4J9DA 4M77F 1B7TA 3SHWA 1YIJT 2YHTA 4OB3B 4OMFB 1ZQ1A 2KI7A 1YJ9A 4M77B 1QVFP 3HRUA 1K1ZA 4LN2A 8AT1B 2WSFE 1MMDA 1TH7A 1OEBA 2GFUA 2XU8A 4F14A 5GAN2 4IUVA 3ULRB 3VYHB 1RADB 4HKEA 4B6MA 4DBQA 3A98A 1AWOA 5LJ3e 2EBPA 2CH4W 4C8QC 1VQMT 1G3SA 2EW3A 2ATCB 2DLPA 2HMAA 2O4XB 4OMOA 5A0DA 4PJOE 3M4YA 1VQ7Q 2OAUA 2OTLA 1PM3A 3HRTA 5LJ5f 1WQWA 4XTYA 1F1BB 1KD1R 1I1JA 4M75F 2BE7D 2CKKA 3QJYA 5LJ3g 2D0NA 2CS7A 1MUZA 2JVVA 1K73U 2C0TA 1E6GA 1OV3A 3FB9A 1KQSA 2FPEA 4M75B 4OB0B 3RBBB 2Y4YA 5CQYA 2FRYA 1QKWA 4JJNK 1BYMA 3JCMh 1I8FA 3CMET 3C4SA 2RPNA 4GLKA 1W2BP 3FRNA 1V29B 4HCBA 2FZCB 3PT9A 1Q81U 2AT1B 3OS1A 1WXBA 2F2VA 2FB7A 4XTUA 2DE0X 2QEXQ 1VQOQ 2DJQA 2LNVA 3LX7A 5J26A 4X9DA 2E65A 1M1KR 3UPUA 1OI1A 1PWTA 4N4HA 1NLPC 5J39A 2K5LA 2KMTA 3CD6A 1G8XA 1VIEA 4OMLA 2COWA 4C0DB 4IUQA 1H3ZA 2LT4A 1YIJA 4B9WA 4OGEA 1BBZA 3GP8A 1Q7YU 2LJ3A 2MWPA 3EHRA 1WHGA 2BIVA 3RNJA 1W2BS 4KH0B 1Q82U 1RABB 3CEYA 1IHVA 4NL2A 4R55A 1Y07A 2X3XD 5HK3A 1YI2T 5I2MA 1GBRA 4DBRA 3X25B 2FHDA 3R6NA 4J6XA 1NLOC 3VS5A 1M90C 3CXCP 1C6VX 2RJFA 1BB9A 1HXDA 2KK4A 2GBQA 2QK0A 5LJ3j 2FPFA 1VQMA 4J6YA 1SPKA 3I9QA 1AT1B 1GFCA 2MAMA 3E19A 4J8OA 4ATOA 4IIOA 2X4YA 2C0IA 4CC7A 2L3QA 1V76A 2EJGA 1QVFA 1NYFA 4JPBW 4A53A 1UGVA 2VGNA 4F7UG 1IHWA 2MK5A 2PVDB 4AMCA 2PUOB 5LJ5g 1GRIA 2KQWA 2V26A 5HY6A 3G6EQ 5GJVB 1KG1A 4KULA 3JB9G 2ENMA 3OYLA 2QASA 4DOWA 3CC4T 3TQ7P 2EGCA 1M8MA 4M7AG 4PK4A 2DO3A 2YT6A 2C06A 4XTZA 4BD3A 3CMEA 2MIOA 2XDBA 2LJ1A 1YJ9Q 1KC8U 2RK2A 5IHIA 1NBEB 2VWFA 3V8LA 2KROA 1TUGB 2QDYB 4KH1B 3EH2A 4PJOC 5KH6A 2LCLA 2HBPA 3PMTA 1X43A 3LGFA 4AFZC 5FU6C 3JCMW 4RG8A 4E7IA 1QVGP 2X4WA 1K9MC 3VS1A 2RJCA 4M78F 1IXDA 5GAOp 3JB9H 1WI7A 2VB6A 2DX1A 5GAN8 2NUTB 1QWFA 1H8KA 1KJWA 1W2BA 1HD3A 3CBOA 1E6HA 2J7IA 2RHZA 1SRMA 2QA4Q 2DRKA 1RAIB 4M78B 1WYXA 2JJ9A 3HKSA 4M77G 1SKUB 1BCOA 4BY6B 4CRIA 2OTLQ 5KYYA 1OU8A 3UT1A 4F16A 2YRCA 5GAOm 4NL3A 1YI2A 1KIKA 1S1NA 3TSWA 1PCXA 4OF1A 5GMKh 4KGZB 2LQ8A 1MV0B 2HCKA 4HXJA 3AHUA 4RKUE 4CC4B 1VYVA 2ZAEA 2M0OA 4F7UA 5CQXA 4C92E 3VUBA 2XICA 1ZSGA 2KGTA 2RF0A 5I2SA 1LOJA 1PSEA 2K5IA 1ZHIA 1W1FA 1R0CB
chains in the Genus database with same CATH topology
3CCEA 1VQPT 3SFMA 4FM4B 3OB9A 3UWNA 2ZGWA 1IZ6A 3M5AA 1YHQA 2DEQA 4LDYA 3N5BB 2CGHA 3OA6A 3P8DA 3ZBDA 2HQEA 3QYGB 3OMCA 5GMKj 1N8RU 1HK9A 1M5Q1 1K8AU 3E9GA 3UDCA 2Y90A 3M59A 3RIRA 1VQ9T 3SB2A 3CPFA 2G3RA 1YCYA 5C6SA 4M7AA 1LNXA 2EJFA 3EFRA 2KVQG 3CXCA 2CZ7B 4XAXB 4ELZC 4BI3A 2QEXA 4M78C 4BY6C 3OMGA 4J5YA 4BDYA 2JN0A 1NJIU 5GAMg 4ZN3A 1BI3A 2QQSA 2EYQA 2AHJB 2YLCA 2KY9A 3VYGA 4XTVA 4PJOD 2HNIA 3A8GB 4J7FA 4XTWA 1EIFA 3HP9A 5GAMf 1VQOT 3LLRA 4LD6A 3CC4A 3CCRA 2P4TA 3INZA 1FWZA 4M75G 4EPCA 3CCVT 5DLOA 5GMKl 4C8QA 1H3ZA 2QXFA 4EMHA 5GANh 4L59A 4ME7A 2F69A 4A4HA 3VJPA 3L2RA 2K57A 2EWNA 3DB4A 3CCQA 3KBGA 5GAOr 3MEWA 4X9CA 5HK0A 4F7UF 5IAYA 1D3BA 1WPYA 1WGSA 5CIUA 5D6YA 3CCQT 4IUUA 4BI8B 4C92A 3C94A 3QYHB 1O9SA 1N9SA 3FJPA 1QW1A 2DXCA 2RHYA 4JS5A 5L8RE 2CYZB 3EAEA 3TCJA 1QVFS 4M7DA 3JCMb 3PTAA 3JB9F 4N4IA 2VV5A 1Q86U 2ZPHB 2LT1A 4F7UB 2EAYA 2EFIA 2RI3A 2VXFA 4OB1B 3CMAA 4R56A 2E6NA 5DLQE 3EFSA 3VU3C 5AYFA 1DJ7B 1VQ6T 3CC2A 5GANj 1VQ4A 3LW5E 2BUDA 3JB9I 3JB9J 3C95A 5I21A 1I81A 4M7AF 2JTMA 1QP3A 3NFCA 3DKMA 3JSCA 1N8RC 3SWNB 1K8AC 1VQ4T 3ZEHA 3OYDA 3QKJA 4M75E 2E5QA 4C92G 1ZBXA 4HCCA 4B9XA 2XD0A 4LDXA 2A3LA 1VUBA 1SSFA 2DPPB 4ELYC 5GAN4 2M9UA 2VC8A 3A8HB 4L6V5 4O6JA 1M9SA 3M53A 4A4KA 2KSSA 4EMKA 4M7AB 1IREB 3S6WA 3CCLA 4OP0A 3CCJT 1WQ7A 5KE3A 2DD4A 2DK3A 2XK0A 1KQSS 3TEEA 4C8QF 3I56A 1O75A 3M54A 1M1FA 4P5NA 5FRMA 5KCOA 2L89A 3FC3A 2E64A 1G3YA 5FLXE 3CCLT 4EDUA 3I55A 3HSBA 2CZ0B 2RJEA 4V2SA 3S3OA 4RG2A 4QVZA 3QO3A 2K3XA 3QUIA 4FIBA 5GMKi 3G71T 4XU0A 5GAN7 5CK9A 5FROA 4RMOA 3PIOA 3L1AA 3WVDB 2O4XA 1WJQA 2DXTA 2QQBA 2ZPBB 3HHTB 3M4GA 2EKOA 3O8VA 3A5ZB 3BFMA 4UC4A 4C8QB 3LWHA 5EG2A 1KHIA 1QVGA 5IN1A 5CR2A 3T9NA 4M7DF 1UGRB 5CKHA 5A2QE 2RO0A 1N9RA 3LGLA 3G6ET 4JRPA 2RJDA 4E7JA 5GANg 4C5HA 1UGPB 4M78D 4QVDA 2LCCA 2E12A 3JCMe 1D3BB 1YJNA 4N0AA 4ZN1A 3JCMJ 1Y96A 3SD4A 1KQ2A 5IT9E 2X4XA 1QVPA 3OS5A 5HKCA 4QQGA 4XU1A 5GANf 1Q86C 1WNLA 3FEOA 1VQ5A 3LH0A 5CKEA 2ZPFB 4M7DB 1YJNT 3JCMQ 4MMLA 5DM7R 3OYGA 3QDRB 2QQ9A 3LYIA 4M77F 4OVAA 3H6ZA 4KUDK 1JJ2S 3E9FA 4JLGA 3QG1A 1VQPA 2MWOA 4ZGDB 1YIJT 2YHTA 1YJWT 4HA8A 1VQ5T 4OB3B 4OMFB 4PJOG 5GAMd 3SWNC 2E41A 2DD5A 2P0PA 1VQKT 5C0MA 1VQLA 3QPHA 5CCAA 1ZQ1A 1Y7XA 2I2LA 4M75A 3JCMc 3OYAA 3M55A 3L2VA 1YJ9A 4M77B 1VQ9A 3JCMV 2RB6A 1KQ1A 3HRUA 5LJ5e 2DXUA 2A7YA 4M7AC 2VYTA 4TVRA 2DAQA 4ZTFA 1VQLT 3QIIA 2GF7A 4EMGA 4NOYA 3L2UA 1YJ9T 5CKBA 2WSFE 1TH7A 4LDVA 4FT4A 3CBMA 4FU6A 2GFUA 2EJ9A 2D0QB 3V8KA 1LJOA 2XU8A 2H3JA 3GF5A 4IUVA 4RCCA 5GAN2 3JCMg 3VYHB 4EMKB 4HKEA 3DLLA 3LWIA 1VQOA 4QQ6A 1VQ8T 1YITT 3CD6T 5LJ3e 3CCVA 3JCMf 1VQNT 3OYIA 2YRVA 4C8QC 5KE2A 1N27A 2QQAA 3P8HA 3CPWA 1VQMT 4BB7A 4HT9A 3F70A 1G3SA 3KXTA 4XU2A 3MEAA 4BACA 3L42A 5FU7B 1NE8A 2X35A 2RA2A 4C5GA 1B34A 1G3WA 1K9MU 2O4XB 3JCMP 3GIBA 3A8OB 2DTOA 3GNGA 2K5FA 5A0DA 4A4EA 3JAME 1OYXA 5GAN3 2LRQA 4PJOE 3M4YA 1JRIA 4M7DC 2OAUA 2OTLA 2VGMA 4FT2A 4J83A 2JOYA 3OSVA 4DA4A 2JUFA 2QA4T 1XOVA 2JZ2A 4PLIA 4A4FA 3X26B 1Y96B 3BW1A 3CC7T 3HRTA 3ME9A 5LJ5f 3CCST 1WQWA 4XTYA 2LTOA 4IKFA 3PMIA 2OTLT 3FDRA 4M75F 3QZ9B 1VQ6A 3CXCS 2R58A 2CKKA 4D6WA 4M77C 3PIPA 3QJYA 2XDPA 5LJ3g 3QJ6A 4JRQA 2R57A 2D6FA 3L2ZA 1GXIE 2CS7A 5D6XA 2JVVA 1K73U 2V8IA 5LJ3f 3FB9A 3H8ZA 1WJRA 3M56A 2RH2A 1KQSA 3PNWC 2LQKA 2WACA 4M75B 4OB0B 4LD9K 1BI0A 3G7ZA 4GY5A 2Y4YA 5CQYA 4MMKA 4JJNK 4EMKC 1BYMA 3RKYA 4MDXA 4OGCA 3JCMh 3CCJA 4DOVA 2XG8D 1I8FA 2DIQA 4J6WA 4M78G 3QHSA 4O5VA 3C4SA 3CMET 2CZ1B 3QXEB 2Y4XA 3JB9D 4GLKA 4LDWA 5GAOn 2FYKA 5GANd 4IUPA 4RCBA 5CKFA 4C5EA 5GAN5 1NJIC 3FRNA 3RMQA 1V29B 3OQ5A 3OW2S 1NZ9A 5FU7C 4HCBA 1BI2A 3PT9A 3P8BB 5A0LA 2DZ9A 3G71A 1Q81U 1X01A 3X20B 3OS1A 3OYEA 3QSUA 5CVIA 3CCUT 1U1SA 1XTDA 2FB7A 4BUGA 4ZTJA 3ER0A 4PL6A 3BDUA 3WVEB 3E1SA 4XTUA 3JRZA 3OYJA 4M7AD 2LNVA 2R5AA 3LX7A 5J26A 4X9DA 4PJOA 2E65A 1AHJB 2GQVA 2CZ6B 3G6EA 4ZGEB 1OI1A 3UPUA 2DTIA 4C92F 3OS0A 4N4HA 5LJ5h 3RKWA 3HL8A 1B34B 1VIFA 4N0AC 3A8LB 1JJ2A 2V8JA 5J39A 2K5LA 2KMTA 3CD6A 1VIEA 3M58A 4MZMA 3META 4X34A 4M7AE 3FLGA 4C0DB 1QP2A 1UGSB 2E10A 3GLXA 1R8OB 1PSFA 4IUQA 3SDZA 3OSSC 2KAFA 2F5KA 3PGGA 3RMSA 2LC4A 3OYYA 4QW2A 2LT4A 4C8QD 4C92B 4B9WA 3VV0A 2XHCA 4OGEA 1JBMA 1X75C 3OY9A 3GP8A 1YIJA 3J80E 1YJWA 3M9QA 2LX9A 5LJ3h 1M4ZA 1VQKA 1JB0E 2K2VA 3V7RA 3JCMd 4Z02A 4FL6A 4M78E 4ZGJB 1S72T 1Q7YU 5CAIA 4M75C 2P0QA 2MWPA 2ZCFB 1K73C 2RHUA 1VQ7T 4C0ZA 2BIVA 3HFOA 3R6OA 3DLMA 3X28B 1W2BS 4QVCA 2DTHA 3QZ5B 1Q82U 3X24B 5LJ5j 3CEYA 4C5IA 4R55A 1NPRA 2EQJA 4NL2A 4M7DD 2PVGB 1Y07A 1YBYA 3MEUA 5HK3A 1YI2T 5I2MA 4E7HA 2RD1A 2WSCE 5M9OA 1M1GA 2RI2A 4XQ3A 3X25B 5J3BA 2FHDA 2VXEA 1RI0A 2RK1A 1UEBA 2XI9A 2NLUA 4J6XA 1FX7A 3A8MB 1M90C 5GMKm 1KD1U 1QVGS 1VQ8A 1YITA 1BIBA 4XU3A 4VUBA 3DB3A 5KCHA 4C0FA 3CCMT 4LDUA 2RJFA 4BI4A 1HXDA 4M77D 1VQNA 2L3RA 5GAOl 2KK4A 2GFAA 5LJ3j 4II1A 1VQMA 4J6YA 4Q5WA 4JRIA 4BDZA 4PJOF 2DKGA 3BY7A 1Q81C 3ZFJA 2PUKB 1Y71A 3OBWA 3MO8A 2E6ZA 2IG0A 2MAMA 3NTHA 5DY9A 3E19A 4J8OA 4ATOA 2HAXA 3SWNA 3L2QA 2X4YA 2HD0A 3RESA 2OTJT 3GOXA 3OYNA 3CCET 2LDMA 4L5GA 2EJGA 4M77E 4Y28E 1QVFA 2HQXA 3J7AF 4WF2A 5GAOq 4PJOB 2B8AA 5LJ3d 4C0DC 5GMKe 3OYFA 1YHQT 4A53A 3S3MA 3M57A 3KUFA 3MCAB 4MDWA 5FU6B 4C92C 2FL7A 2QA4A 3PFSA 3CC7A 2VGNA 3NTIA 4F7UG 2PVDB 4YTLA 2PUOB 2RHXA 4IURA 3CCSA 4E7LA 2DZCA 5LJ5g 2K4YA 1BKBA 2KQWA 4MZTA 5CO7A 5HY6A 1XQHA 4PNOA 3NTKA 3MP6A 4KBMB 1KG1A 2PQWA 4KULA 3OS2A 4M78A 3JB9G 2QEXT 1X6OA 3VUZA 3Q1JA 2M1HA 4QQDA 3GNFB 4CI0C 2EQUA 1W4SA 2YLBA 3QBYA 3OYLA 1I5LA 5LL6S 4IUTA 4E47A 2LVMA 5GAN6 1Q7YC 4DOWA 1M1KU 1UB4A 2M16A 2RI5A 2ZPGB 2K3YA 3CC4T 3CCRT 3TREA 1Q82C 3TU4K 1UGQB 2E1HA 2R5MA 2X4JA 2DIGA 3OYMA 1OZ2A 4M7AG 2QI2A 3OW2A 1OZ3A 2DO3A 3MP8A 2BKDN 3CPWS 2C06A 5A0GA 4XTZA 4BD3A 2QQRA 2IVWA 3CMEA 4HT8A 2RM4A 3MEVA 1KD1C 4XTXA 2FVUA 2VUBA 2XDBA 2DVEA 4A4GA 2WSEE 3MHXA 2MMPA 4JRKA 3V8JA 4C0GA 4NS5A 1KHCA 1KC8U 2RK2A 1MHNA 2JTFA 4JS4A 4A54A 4MZPA 3V8LA 2JNGA 2DJZA 3RKXA 4M75D 3WXMB 4BE1A 3CCUA 4F7UE 3FIFA 1XNIA 4C8QG 1M90U 3RERA 3CMAT 4M77A 4FSXA 2QDYB 4JDSA 3HPWA 4PJOC 5D6WA 2LCLA 3HRSA 5KH6A 2HBPA 2D9TA 3OBYA 5GANe 3PMTA 4J7IA 5CKDA 3LGFA 4HCZA 5FU6C 3JCMW 4RG8A 3URGA 3CC2T 1WJSA 4E7IA 3J81E 2X4WA 1N6AA 1K9MC 4JLIA 1H641 2RJCA 2ZPIB 1M8VA 2L8DA 4M7DG 2EIFA 5GAMh 2EQMA 4M78F 2GCXA 5GAOp 2XKOC 2L5QA 3JB9H 3V7CA 2ZPEB 2P0KA 5GAN8 3OYBA 2XIDA 4DQ2A 3ASKA 3OYKA 4E7KA 2F5TX 2O01E 1W2BA 1MGQA 1NPPA 4XK8E 2PVOB 3JCMX 1S72A 3CBOA 4KUIA 3OYHA 2RHZA 4BE0A 4JUVA 3C12A 3G4SA 3HKSA 4M78B 4M77G 4BY6B 4CRIA 3I56T 2V8KA 1VQ7A 1M1KC 4Y91A 3GPLA 3I55T 2DXBA 4KT0E 1RL2A 4N4GA 3UT1A 5GAOm 4NL3A 3G4ST 1YI2A 2E70A 2MF2A 4C92D 1U1TA 4C8QE 3MP1A 4OF1A 1FXXA 4PKCC 5GMKh 3VKIA 2EQKA 5GAMj 2LQ8A 3L2WA 1G3TA 3AHUA 4RKUE 1I4K1 2KDSA 5GAMe 1U8RA 3OYCA 3CCMA 1BIAA 2M0OA 2MI6A 4OB2B 2RHIA 3RUXA 4F7UA 1KC8C 5CQXA 4C92E 2XDDA 3VUBA 2XICA 1P92A 2PU9B 3CBPA 4BE2A 3S3NA 3V7SA 3BDLA 4PLLA 3HFNA 4M7DE 1G5VA 1BI1A 5I2SA 5LJ5d 1LOJA 2OTJA 5FRNA 1PSEA 2QTXA 2ZZDA 2K5IA 1ZHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQW A;  5IN1 A;  3OS2 A;  3Q1J A;  2DIQ A;  2M1H A;  4QQD A;  3OB9 A;  2RO0 A;  3LGL A;  2EQU A;  3C4S A;  3QBY A;  3UWN A;  2RJD A;  3OYL A;  4E7J A;  4C5H A;  4IUT A;  2LCC A;  2LVM A;  4IUP A;  3OA6 A;  3P8D A;  4C5E A;  2HQE A;  3SD4 A;  3OMC A;  3OQ5 A;  2M16 A;  2RI5 A;  2X4X A;  2K3Y A;  4QQG A;  3E9G A;  3FEO A;  3OS1 A;  2G3R A;  3LH0 A;  2R5M A;  3OYE A;  5C6S A;  2DIG A;  3OYM A;  1OZ2 A;  3OYG A;  4ZTJ A;  3LYI A;  4OVA A;  3H6Z A;  4PL6 A;  1OZ3 A;  3MP8 A;  2BKD N;  3E9F A;  3O8V A;  3OYJ A;  4BD3 A;  2MWO A;  3OMG A;  2QQR A;  2R5A A;  3LX7 A;  5J26 A;  4BDY A;  2QQS A;  1OI1 A;  3MEV A;  3OS0 A;  4N4H A;  4A4G A;  5C0M A;  5J39 A;  3LLR A;  3OYA A;  4LD6 A;  1KHC A;  4NS5 A;  3L2V A;  1MHN A;  2JTF A;  3MET A;  4X34 A;  4BE1 A;  2VYT A;  3FLG A;  2DAQ A;  4ZTF A;  1XNI A;  4IUQ A;  4L59 A;  3QII A;  4A4H A;  2GF7 A;  3L2R A;  3L2U A;  2F5K A;  3DB4 A;  1H3Z A;  4QW2 A;  3MEW A;  4B9W A;  3OY9 A;  4FU6 A;  5D6W A;  2GFU A;  3M9Q A;  5KH6 A;  5IAY A;  2D9T A;  3PMT A;  1WGS A;  3LGF A;  4HCZ A;  4IUV A;  5CIU A;  5D6Y A;  4IUU A;  1WJS A;  4Z02 A;  4FL6 A;  4E7I A;  4QQ6 A;  2X4W A;  2RHY A;  2MWP A;  2RHU A;  3EAE A;  2RJC A;  2BIV A;  3OYI A;  2L8D A;  3DLM A;  4N4I A;  2YRV A;  2EQM A;  5KE2 A;  1N27 A;  3P8H A;  3CEY A;  4C5I A;  2EQJ A;  3F70 A;  2EFI A;  2RI3 A;  3MEU A;  3MEA A;  2P0K A;  4BAC A;  3L42 A;  3OYB A;  4E7H A;  5M9O A;  2E6N A;  2RI2 A;  4UC4 A;  2X35 A;  2FHD A;  3ASK A;  1RI0 A;  3OYK A;  4E7K A;  4C5G A;  2NLU A;  2O4X B;  3OYH A;  2BUD A;  2RHZ A;  4BE0 A;  4A4E A;  1OYX A;  2LRQ A;  3DB3 A;  5KCH A;  4CRI A;  2RJF A;  2L3R A;  2GFA A;  4II1 A;  3ZEH A;  3OYD A;  4N4G A;  2JZ2 A;  4Q5W A;  4PLI A;  3QKJ A;  3UT1 A;  2E5Q A;  4A4F A;  4BDZ A;  3ME9 A;  4B9X A;  4IKF A;  2LTO A;  1SSF A;  2IG0 A;  3MO8 A;  3NTH A;  3PMI A;  3L2Q A;  3MP1 A;  2X4Y A;  3FDR A;  3GOX A;  3S6W A;  3L2W A;  2EQK A;  3OYN A;  2LDM A;  2R58 A;  2CKK A;  5KE3 A;  2XK0 A;  5FRM A;  2HQX A;  2XDP A;  3QJ6 A;  3OYC A;  2R57 A;  2B8A A;  5KCO A;  2M0O A;  3OYF A;  5D6X A;  2RHI A;  2L89 A;  3S3M A;  3FC3 A;  3KUF A;  4EDU A;  2RJE A;  3PFS A;  4RG2 A;  3S3O A;  3NTI A;  4QVZ A;  2K3X A;  3H8Z A;  2RHX A;  1WJR A;  4IUR A;  4BE2 A;  4E7L A;  3PNW C;  2WAC A;  3BDL A;  4PLL A;  3S3N A;  5FRO A;  1G5V A;  4GY5 A;  2O4X A;  1WJQ A;  5FRN A;  3NTK A;  2EKO A;  3MP6 A; 
#chains in the Genus database with same CATH topology
 2NUP A;  4PJM A;  1WHM A;  3UWN A;  1IZ6 A;  3N5B B;  1M2V A;  3P8D A;  3MKD A;  3E9G A;  3M59 A;  3RIR A;  1BU1 A;  4JZ4 A;  5C6S A;  4M7A A;  1LNX A;  2EJF A;  1Y0M A;  3EFR A;  3CXC A;  4ELZ C;  1OX8 A;  3OMG A;  2JN0 A;  4ZN3 A;  2HKN A;  2EYQ A;  1K9A A;  2HNI A;  1PG5 B;  1EIF A;  1VQO T;  5GAM f;  4LD6 A;  3CC4 A;  3CD6 Q;  4EPC A;  3INZ A;  4M75 G;  3THK A;  1V1C A;  1AZG B;  1ZX6 A;  3L2R A;  3EGX B;  2EWN A;  3KBG A;  5GAO r;  2DIL A;  1YIJ Q;  1WXU A;  5CIU A;  5D6Y A;  4IUU A;  3QYH B;  1T3S A;  1QW1 A;  2RHY A;  4JS5 A;  3EAE A;  2EAY A;  1SHG A;  2EFI A;  4OB1 B;  2HQH A;  4HVV A;  1IRX A;  4R56 A;  5DLQ E;  3VU3 C;  4Z8A A;  1DJ7 B;  1NJI R;  2CP2 A;  3JB9 I;  5ECA A;  5I21 A;  1I81 A;  3NFC A;  1N8R C;  3TVT A;  3ZEH A;  1VQM Q;  1A0N B;  2E5Q A;  4B9X A;  1VUB A;  2DPP B;  3MJX A;  4A4K A;  2EVR A;  1IRE B;  1WQ7 A;  5KE3 A;  2DK3 A;  4C8Q F;  5FRM A;  1M1F A;  4AFS C;  1G3Y A;  4ZNX A;  3QO3 A;  4FIB A;  1LCK A;  4ANJ A;  1UJY A;  2KXD A;  5FRO A;  4RMO A;  3L1A A;  3PIO A;  2O4X A;  1WJQ A;  3M4G A;  1NG2 A;  3HHT B;  4C8Q B;  1QVG A;  1QMC A;  1K73 R;  3G6E T;  5GAN g;  2QDL A;  2E12 A;  3JCM e;  2DL5 A;  1CKB A;  2J05 A;  3JCM J;  2XMF A;  2A08 A;  3SD4 A;  3VRZ A;  5IT9 E;  1PC0 A;  3OS5 A;  5I11 A;  1QKX A;  2J06 A;  2ZPF B;  4MML A;  1ZUU A;  4OVA A;  3LYI A;  3H6Z A;  1JXM A;  3QG1 A;  2MWO A;  4ZGD B;  4KRT A;  3CME Q;  2LQN A;  1RAA B;  5GAM d;  3SWN C;  2E41 A;  2DD5 A;  2P0P A;  1PD0 A;  1Q81 R;  1VQL A;  5CCA A;  3OYA A;  4M75 A;  2A28 A;  3JCM c;  3CMA Q;  4QKU A;  3JCM V;  2A7Y A;  2VYT A;  4ZTF A;  2DAQ A;  3QII A;  4EMG A;  3L2U A;  2E5K A;  1YJ9 T;  2LP5 A;  2HL3 A;  4FT4 A;  2D0Q B;  3GF5 A;  3UF4 A;  2H3J A;  2H8H A;  3JCM g;  3DLL A;  1VQO A;  4PFZ A;  3REA B;  3OYI A;  4ORZ A;  5KE2 A;  2QQA A;  4K11 A;  3F70 A;  3MEA A;  1NE8 A;  4J9H A;  1Q7Y R;  1G3W A;  1K9M U;  1D0Y A;  3JCM P;  5KYY B;  2DTO A;  3OW2 P;  4A4E A;  1D1A A;  5GAN 3;  1Q82 R;  4FT2 A;  2X3W D;  2JUF A;  2QA4 T;  1XOV A;  1EX4 A;  2JZ2 A;  4PLI A;  3X26 B;  1Y96 B;  4A4F A;  1YI2 Q;  2D1X A;  4J9B A;  2OTL T;  4AFQ C;  3I5S A;  3QZ9 B;  2K9G A;  2D6F A;  1MMN A;  3QJ6 A;  1W6X A;  2V8I A;  2MPX C;  1FMW A;  5LJ3 f;  3H8Z A;  3M56 A;  2RH2 A;  1VQP Q;  4LD9 K;  1FMK A;  1NYG A;  4HVW A;  1BI0 A;  4GY5 A;  3H0H A;  4EMK C;  3RKY A;  4OGC A;  4DOV A;  2PTK A;  4M78 G;  5GAO n;  4C5E A;  5GAN 5;  3OW2 S;  3OQ5 A;  2LJ0 A;  2Z0W A;  3CCU T;  1U1S A;  4PL6 A;  4RTW A;  3E1S A;  5IXF A;  3JRZ A;  3OYJ A;  1PD1 A;  4AFU C;  2R5A A;  6AT1 B;  2GQV A;  1G2B A;  3G6E A;  2CZ6 B;  4ZGE B;  2DTI A;  3VS0 A;  2CT4 A;  3EG1 A;  8ATC B;  3CC4 Q;  4FSS A;  4DEY A;  1PNJ A;  4X34 A;  4M7A E;  1I0C A;  1QP2 A;  1UGS B;  2KAF A;  2F5K A;  2GTO A;  3RMS A;  3CD6 T;  3VV0 A;  2LX9 A;  5HCK A;  4FCY A;  1M4Z A;  1KC8 R;  2E3I A;  3V7R A;  1SSH A;  1PRM C;  2O2O A;  2ZCF B;  2RHU A;  3R6O A;  2E3H A;  4M7D D;  1PHT A;  2PVG B;  1ZBJ A;  1YBY A;  3MEU A;  2M0Y A;  4E7H A;  2RD1 A;  2KE9 A;  2RI2 A;  1RI0 A;  2RK1 A;  2NLU A;  3A8M B;  1Q95 G;  1JU5 C;  1X6G A;  1WHL A;  4VUB A;  3DB3 A;  1K76 A;  4Q5W A;  1IGQ A;  4BDZ A;  4PJO F;  1M3A A;  3ZFJ A;  3CPW P;  2D8J A;  3CCJ Q;  3MO8 A;  5DY9 A;  2RNA A;  1T0J A;  2HAX A;  3SWN A;  3L2Q A;  2IPO B;  1ARK A;  3OYN A;  2LDM A;  4M77 E;  1H92 A;  4DBF A;  7AT1 B;  3G71 Q;  3J7A F;  4PJO B;  5LJ3 d;  5GMK e;  3OYF A;  5FU6 B;  5FWB A;  3TSZ A;  1ABQ A;  4IIM A;  2QA4 A;  2NUT A;  4E7L A;  4IUR A;  4R0K A;  5CO7 A;  1XQH A;  1X69 A;  1AEY A;  1SHF A;  4Z88 A;  3MP6 A;  2KNB B;  2PNI A;  4M78 A;  2M1H A;  3REB B;  1I5L A;  1RUW A;  1UB4 A;  1NEG A;  3H9N A;  1WA7 A;  2M16 A;  4Y92 A;  2K3Y A;  3TRE A;  1YJW Q;  2R5M A;  3EGD A;  2DIG A;  4E2F B;  1X2Q A;  2QI2 A;  3OW2 A;  3CPW S;  1EZZ B;  2EGA A;  2RQU A;  1KD1 C;  2L3S A;  2DVE A;  1VQL Q;  1Y57 A;  4JRK A;  3V8J A;  2BZY A;  1MHN A;  4JS4 A;  1D09 B;  4HCK A;  3CCU A;  3EG3 A;  4C8Q G;  1TUC A;  5I22 A;  1GCQ A;  3CMA T;  1RAC B;  2AIR B;  4HCZ A;  1NM7 A;  2DBM A;  3URG A;  2JM8 A;  2ED0 A;  1UHF A;  1N6A A;  1H64 1;  1M8V A;  5GAM h;  3BE3 A;  3KFV A;  2GCX A;  2KT8 A;  2V1Q A;  2P0K A;  3OYB A;  3OYK A;  2F5T X;  2O01 E;  1PKT A;  1MGQ A;  1NPP A;  4XK8 E;  2PVO B;  1BCM A;  3OYH A;  3C12 A;  4M4Z A;  3CCS Q;  3I56 T;  1M1K C;  2KRN A;  4E7Z A;  3EGX A;  4FYX B;  3I55 T;  2DXB A;  1H3H A;  2E70 A;  4C92 D;  4F04 B;  2CUD A;  2F1L A;  2HL5 C;  2J6K A;  3M0Q A;  1OOT A;  2JXB A;  2NUZ A;  1BIA A;  2MI6 A;  4LUE A;  2DET A;  5D7U A;  2XDD A;  1JO8 A;  3V7S A;  4M7D E;  3HFN A;  5LJ5 d;  4DEX A;  2K3B A;  5FRN A;  1IGU A;  1VQP T;  4PJN A;  1AZE A;  1WFW A;  2DEQ A;  1WXT A;  4LDY A;  3OA6 A;  4Z89 A;  2JM9 A;  2HQE A;  1VYT A;  5GMK j;  2C0O A;  1AWJ A;  1K8A U;  2Y90 A;  3EFO A;  3SB2 A;  1YCY A;  4LNP A;  1CSK A;  3H0F A;  1X6B A;  4J5Y A;  4CC2 A;  3VYG A;  3HP9 A;  3LLR A;  1CKA A;  3CCV T;  2RN8 A;  4C8Q A;  3QWY A;  3VJP A;  2K57 A;  3CCQ A;  3DB4 A;  2J6O A;  2ROT A;  3VS4 A;  2RQR A;  5IH2 A;  4J9G A;  5HK0 A;  5IAY A;  1WGS A;  2ROL A;  1ZSZ C;  1N9S A;  2EPD A;  3FJP A;  4E7S A;  5L8R E;  3JCM b;  2VV5 A;  1Q86 U;  1UEC A;  2ZPH B;  2LT1 A;  1K0X A;  3VS3 A;  3CMA A;  3SEM A;  2DBK A;  1U06 A;  5AYF A;  1VQ6 T;  1MNE A;  3LW5 E;  1FYN A;  1GCP A;  1TOV A;  1UUE A;  3DKM A;  2VKN A;  3SWN B;  2OTJ Q;  1X2K A;  3OYD A;  2CSI A;  3QKJ A;  1JJ2 P;  3CCE Q;  1ZBX A;  1SSF A;  2F2W A;  2AKK A;  2M9U A;  4L6V 5;  4O6J A;  2KSS A;  2YUQ A;  2LMJ A;  3S6W A;  3CCL A;  3CCJ T;  2YSQ A;  2XK0 A;  1ZLM A;  3I56 A;  1O75 A;  4FW1 A;  1R0B G;  5KCO A;  2DEU A;  2KRS A;  5FLX E;  3I55 A;  2CT3 A;  2CZ0 B;  1D0X A;  4QVZ A;  2COZ A;  5GMK i;  3G71 T;  2L3P A;  4JJD A;  2QQB A;  2CP3 A;  3A5Z B;  4UC4 A;  3LWH A;  1KHI A;  5IN1 A;  2VAS A;  1UDL A;  5CKH A;  4E7J A;  4C5H A;  3EGD B;  2LCC A;  1D3B B;  1Y96 A;  2D8H A;  2KYM A;  1QVP A;  5GAN f;  4OMP A;  5HKC A;  4XU1 A;  1VQ5 A;  3LH0 A;  5CKE A;  3JCM Q;  3OYG A;  4KUD K;  1KSW A;  1JJ2 S;  4JLG A;  1WZO A;  1VQP A;  1YJW T;  4PJO G;  2JTE A;  1WHK A;  2AKL A;  1WX6 A;  2K7A A;  2OAW A;  3QPH A;  2I2L A;  3M55 A;  2RB6 A;  1KQ1 A;  2DXU A;  4RTV A;  3CCU Q;  2FZG B;  2J6F A;  1VQL T;  3CC2 Q;  5CKB A;  4LDV A;  3CBM A;  2EJ9 A;  1LJO A;  4RCC A;  3VS7 A;  4EMK B;  2DF6 A;  3LWI A;  4QQ6 A;  3CCV A;  3JCM f;  1YCS B;  2YRV A;  2M51 A;  4BB7 A;  4XU2 A;  3L42 A;  2MCN A;  2X35 A;  2O9S A;  4C5G A;  1X27 A;  3GIB A;  2O88 A;  3A8O B;  1WHH A;  3JAM E;  2ABL A;  1JRI A;  4M7D C;  4J9E A;  2JOY A;  4DA4 A;  3BW1 A;  5FWC A;  3CCS T;  3PMI A;  2BZX A;  1AWX A;  2DL7 A;  1VQ6 A;  2JS2 A;  4KGX B;  3PIP A;  2XDP A;  1GXI E;  4JRQ A;  2R57 A;  1IO6 A;  3L2Z A;  1VA7 A;  2BTT A;  2NWM A;  2QAZ A;  1ABO A;  1WJR A;  2LQK A;  2WAC A;  3M0P A;  2QGF B;  1ZSZ A;  3CCJ A;  2XG8 D;  4J6W A;  1M90 U;  3JB9 D;  2O9V A;  2CZ1 B;  2LQW A;  3QXE B;  1VQ9 Q;  3EFO B;  4LDW A;  2O31 A;  1UG1 A;  3PVQ A;  2FYK A;  5GAN d;  1NJI C;  1ZA1 B;  1NZ9 A;  5FU7 C;  1BI2 A;  3P8B B;  5A0L A;  3G71 A;  1X01 A;  3OYE A;  3EG0 A;  4X1V A;  4D8K A;  2AK5 A;  4M7A D;  3PE0 A;  4PJO A;  1AHJ B;  5LJ5 h;  3RKW A;  1QQJ A;  3HL8 A;  2CUB A;  1B34 B;  4N0A C;  1JJ2 A;  1SF9 A;  3D7S B;  3M58 A;  4MZM A;  3G1J A;  3FLG A;  3SDZ A;  1PSF A;  3CCQ Q;  3PGG A;  2KRM A;  2LC4 A;  4QW2 A;  1JEG A;  1YJW A;  1JBM A;  2EYW A;  1JB0 E;  2G6F X;  3JCM d;  4Z02 A;  4FL6 A;  1M3B A;  2P0Q A;  1K73 C;  4C0Z A;  2CH4 A;  3HFO A;  3X28 B;  2DTH A;  2KXC A;  1VYU A;  1OUL A;  2WSC E;  5M9O A;  1IB8 A;  1M2O A;  1K0S A;  1OPL A;  1UEB A;  2XI9 A;  1FX7 A;  5GMK m;  1I07 A;  2HSE B;  5KCH A;  4C0F A;  4M77 D;  2HKQ B;  2GFA A;  3H0I A;  4II1 A;  1Q81 C;  4JRI A;  2DKG A;  2PUK B;  3OBW A;  4OMM A;  2E6Z A;  2OTJ T;  1QLY A;  3CCE T;  4L5G A;  3CCL Q;  1XJW B;  5IXB A;  4Y28 E;  2X9H A;  3MPU B;  1OQK A;  2HQX A;  3I56 Q;  4LXC A;  5KYW B;  3S3M A;  3M57 A;  3MCA B;  4MDW A;  4C92 C;  2FL7 A;  3I55 Q;  3PFS A;  2CDT A;  1YP5 A;  4YTL A;  2RHX A;  3CCS A;  2VVK A;  1D1C A;  2DZC A;  2YXY A;  2K4Y A;  2YDL A;  5FW9 A;  2YRD A;  1X6O A;  2K6D A;  4QQD A;  1W4S A;  3QBY A;  5LL6 S;  4IUT A;  4E47 A;  2LVM A;  1Q7Y C;  3ZL7 C;  2CP5 A;  2HEQ A;  2ZPG B;  2QGG A;  1RAH B;  1Q82 C;  3TU4 K;  1VQ5 Q;  2X4J A;  1PRL C;  3NPF A;  3OYM A;  1OZ2 A;  1VQK Q;  1HYO A;  3MP8 A;  4J9C A;  1YWO A;  2QQR A;  2KBT A;  4HT8 A;  2RM4 A;  3MEV A;  1N5Z A;  4XTX A;  2FVU A;  1K8A R;  2WSE E;  3MHX A;  2MMP A;  4KGV B;  4C0G A;  2JTF A;  4A54 A;  2A36 A;  4MZP A;  2DJZ A;  4M75 D;  3UAT A;  4BE1 A;  2FRW A;  4F7U E;  3FIF A;  3RER A;  4AG2 C;  4FSX A;  1VQ8 Q;  1YIT Q;  3HRS A;  5CKD A;  2AZV A;  3NHN A;  3CC2 T;  3M0T A;  3CCV Q;  2ZPI B;  1UHC A;  2FG0 A;  2KT1 A;  3M0U A;  2I0N A;  2ED1 A;  2ZPE B;  1AOJ A;  2XID A;  3ASK A;  4PFO A;  1KK7 A;  1OX9 A;  3CC7 Q;  4JUV A;  1YFN A;  3G4S A;  4JZ3 A;  1Q86 R;  2EGE A;  2V8K A;  2OJ2 A;  4DBH A;  4Y91 A;  3GPL A;  1LVK A;  4KT0 E;  1U1T A;  1RAF B;  1FXX A;  5GAM j;  1VQ6 Q;  1I4K 1;  2KDS A;  2X51 A;  1U8R A;  2DL8 A;  1KC8 C;  2PZ1 A;  1ZSZ B;  1P92 A;  2PU9 B;  3I5R A;  2KR3 A;  3S3N A;  1TG0 A;  2OTJ A;  2QTX A;  3CCE A;  2OI3 A;  3U23 A;  3SFM A;  3OB9 A;  2ZGW A;  4PJJ A;  3QYG B;  1N8R U;  1VQ9 T;  3CPF A;  2KVQ G;  4XAX B;  2P84 A;  1NJI U;  1BI3 A;  2AHJ B;  2KY9 A;  3A8G B;  1OU9 A;  1SRL A;  4J7F A;  2P4T A;  1FWZ A;  2DNU A;  2CP7 A;  2QXF A;  4EMH A;  5GAN h;  4L59 A;  4A4H A;  2F69 A;  1UFF A;  2MOX A;  1S72 Q;  4X9C A;  1D3B A;  3CCQ T;  4BI8 B;  2K2M A;  4C92 A;  3C94 A;  1O9S A;  4FYY B;  2DXC A;  2CYZ B;  1WHJ A;  3TCJ A;  1QVF S;  4N4I A;  4FYV B;  2E6N A;  4GBQ A;  3CCM Q;  2LZ6 B;  3CC2 A;  1VQ4 A;  3JB9 J;  3C95 A;  1T3L A;  1C0M A;  4M75 E;  4HCC A;  1UJ0 A;  4GLM A;  2XD0 A;  2A3L A;  3LH5 A;  4OMQ A;  5GAN 4;  1OPK A;  1M9S A;  2FO0 A;  2GQI A;  3M53 A;  4D8D A;  4EMK A;  1YHQ Q;  4OP0 A;  1D0Z A;  1M30 A;  3TEE A;  1HJD A;  1RAG B;  3EG9 B;  4V2S A;  3CCL T;  2DVJ A;  1C1A A;  2DL4 A;  3EGU A;  3S3O A;  3QUI A;  4XU0 A;  2QYZ A;  5CK9 A;  2DXT A;  2GTJ A;  2YWW A;  2ZPB B;  1I5O B;  3O8V A;  4CC3 A;  5CR2 A;  4M7D F;  5A2Q E;  2DMO A;  2RO0 A;  3LGL A;  3CCR Q;  4JRP A;  2RJD A;  1GFD A;  4M78 D;  5KYU B;  1YJN A;  2A0F B;  2X4X A;  4QQG A;  1WNL A;  1YNZ A;  4M7D B;  3QDR B;  2QQ9 A;  1M90 R;  3E9F A;  2W0Z A;  4HA8 A;  1VQ5 T;  3QDF A;  1VQK T;  3RDV A;  5C0M A;  1Y7X A;  3L2V A;  1VQ9 A;  5LJ5 e;  3C0C A;  4M7A C;  2DA9 A;  4TVR A;  4A63 B;  2FEI A;  2AZS A;  2GF7 A;  4NOY A;  9ATC B;  4FU6 A;  3V8K A;  3UA6 A;  4E6R A;  2JW4 A;  1GL5 A;  1VQ8 T;  1YIT T;  4OMN A;  1VQN T;  1N27 A;  3P8H A;  3CPW A;  4LUD A;  4HT9 A;  2H3E B;  3KXT A;  4BAC A;  1B3Q A;  5FU7 B;  2KYB A;  2RA2 A;  1B34 A;  3GNG A;  2K5F A;  1OYX A;  2LRQ A;  3G4S Q;  1UTI A;  1LPL A;  2VGM A;  1MMG A;  4J83 A;  1W70 A;  2RQT A;  3OSV A;  3CC7 T;  1GBQ A;  3ME9 A;  3M0R A;  2LTO A;  4IKF A;  4LE9 A;  5EC7 A;  3FDR A;  3CXC S;  2R58 A;  1WDX A;  3UA7 A;  1BK2 A;  4D6W A;  4M77 C;  1MMA A;  1RLQ C;  2JT4 A;  4J9I A;  5D6X A;  3VRY A;  2IIM A;  2JS0 A;  4FYW B;  3PNW C;  3G7Z A;  3HTR A;  4MMK A;  4RTU A;  3JV3 A;  1M27 C;  4MDX A;  2L2P A;  2EYY A;  2NYS A;  1K9M R;  3VS2 A;  2DIQ A;  4O5V A;  3QHS A;  2Y4X A;  2HZY A;  4IUP A;  4RCB A;  5CKF A;  3RMQ A;  2GNC A;  1RAE B;  2DZ9 A;  4JJC A;  3X20 B;  3QSU A;  5CVI A;  1XTD A;  3AT1 B;  4BUG A;  4ZTJ A;  3ER0 A;  3BDU A;  3WVE B;  2JMA A;  1TTH B;  2HSP A;  3GBQ A;  2ESW A;  5KYW A;  4C92 F;  3OS0 A;  3QWX X;  1TSF A;  1VIF A;  3A8L B;  2V8J A;  1WIE A;  4ESR A;  1ZA2 B;  3MET A;  1EFN A;  2E10 A;  3GLX A;  1R8O B;  1TWB A;  3OSS C;  4C92 B;  3OYY A;  4C8Q D;  4HVU A;  3OY9 A;  2XHC A;  1ACM B;  1X75 C;  2DM1 A;  3J80 E;  2RMO A;  3M9Q A;  2A37 A;  5LJ3 h;  2B86 A;  1VQK A;  1AD5 A;  2K2V A;  1S72 T;  4ZGJ B;  4M78 E;  3H41 A;  5CAI A;  4M75 C;  1K4U S;  2EKH A;  1VQ7 T;  1JQQ A;  3DLM A;  2K79 A;  4QVC A;  3QZ5 B;  3X24 B;  5LJ5 j;  4C5I A;  5AT1 B;  1NPR A;  2EQJ A;  1TUD A;  1M1G A;  1AWW A;  4XQ3 A;  1TXQ A;  5J3B A;  2VXE A;  3A1P A;  1KD1 U;  4EIK A;  1VQ4 Q;  1QVG S;  1VQ8 A;  1YIT A;  1BIB A;  4XU3 A;  1QCO A;  3CCM T;  1VQN A;  4LDU A;  4BI4 A;  2L3R A;  5GAO l;  1D1B A;  5IHK A;  2SEM A;  3BY7 A;  1ZUY A;  1Y71 A;  1SEM A;  4RUG A;  3VS6 A;  2IG0 A;  3NTH A;  2HD0 A;  3RES A;  3GOX A;  2COY A;  4WF2 A;  5GAO q;  2B8A A;  4C0D C;  1YHQ T;  1U5S A;  4RTY A;  1JXO A;  4WTO B;  1T0H A;  3KUF A;  3CC7 A;  3NTI A;  1Z9Z A;  4MZT A;  1BKB A;  1TS9 A;  2EYX A;  4PNO A;  2V1R A;  3NTK A;  3O5Z A;  1QCN A;  4KBM B;  2PQW A;  4WCI A;  3OS2 A;  2QEX T;  3VUZ A;  3Q1J A;  3E2U A;  2L0A A;  3GNF B;  2EQU A;  1B07 A;  2YLB A;  4CI0 C;  5GAN 6;  2CSQ A;  1UE9 A;  1YJN Q;  1M1K U;  5IHN A;  5KYX A;  2BE9 B;  2RI5 A;  5GJW B;  3CCR T;  2FPD A;  2CP6 A;  1UGQ B;  2E1H A;  1KFZ A;  1NEB A;  1OZ3 A;  1U3O A;  2BKD N;  5A0G A;  2IVW A;  1VOM A;  1N8R R;  3EH1 A;  2VUB A;  4A4G A;  4NS5 A;  1KHC A;  2EQI A;  2JNG A;  3RKX A;  3WXM B;  3CQT A;  2FZK B;  1XNI A;  4M77 A;  4JDS A;  3HPW A;  5D6W A;  1M3C A;  1ZUK A;  1RI9 A;  2D9T A;  3OBY A;  5GAN e;  4J7I A;  1WJS A;  3J81 E;  2BZ8 A;  4JLI A;  2L8D A;  4F17 A;  4M7D G;  2EIF A;  2DER A;  2EQM A;  2XKO C;  2L5Q A;  3EHQ A;  3V7C A;  2GGR A;  4AT1 B;  4DQ2 A;  4E7K A;  2MYS A;  1MV3 A;  3JCM X;  1J3T A;  1S72 A;  4KUI A;  4BE0 A;  3PVL A;  2OX7 A;  1YWP A;  1VQ7 A;  2RQV A;  1RL2 A;  2JMC A;  4N4G A;  3G4S T;  2KEA A;  2LNH B;  2MF2 A;  2CP0 A;  2DRM A;  4C8Q E;  3MP1 A;  4PKC C;  3VKI A;  2EQK A;  3L2W A;  1G3T A;  2DL3 A;  5GAM e;  3OYC A;  3CCM A;  4OB2 B;  2RHI A;  3RUX A;  2ECZ A;  3CBP A;  4BE2 A;  3BDL A;  4PLL A;  1G5V A;  1BI1 A;  2ZZD A;  1YN8 A;  2QTV A;  4FM4 B;  2QG9 B;  3M5A A;  1YHQ A;  2CGH A;  3ZBD A;  2YUO A;  3OMC A;  1HK9 A;  1M5Q 1;  3UDC A;  1G83 A;  2G3R A;  4PJL A;  2CZ7 B;  4BI3 A;  1TU0 B;  2QEX A;  4M78 C;  2LCS A;  4BY6 C;  4BDY A;  5GAM g;  2QQS A;  3EG9 A;  2YLC A;  4QT7 A;  4XTV A;  4PJO D;  4XTW A;  3M0S A;  1AVZ C;  5KYN A;  1WLP B;  3CCR A;  5DLO A;  1RLP C;  5GMK l;  2YUP A;  1E7O A;  4ME7 A;  1SG5 A;  3MEW A;  1KQS P;  5KYU A;  2M02 A;  4F7U F;  1WPY A;  2CRE A;  3FJ5 A;  1Z9Q A;  4M7D A;  3PTA A;  1PKS A;  3JB9 F;  4FW2 A;  2HBW A;  4F7U B;  4AG1 C;  2RI3 A;  2VXF A;  1GCQ C;  3EFS A;  4J9F A;  5GAN j;  5L23 A;  2BUD A;  2NUP B;  2P4R A;  4M7A F;  2JTM A;  1VQN Q;  1QP3 A;  3JSC A;  4RTT A;  1K8A C;  1VQ4 T;  1M2V B;  4C92 G;  3RR6 A;  2EYZ A;  4LDX A;  4ELY C;  1MND A;  2DYB A;  2VC8 A;  3A8H B;  2SRC A;  4M7A B;  1FMV A;  1HSQ A;  2DD4 A;  1QWE A;  2RQW A;  1KQS S;  3NMZ C;  3M54 A;  4P5N A;  2L89 A;  3FC3 A;  2E64 A;  4PFP A;  3I35 A;  4EDU A;  2RJE A;  3HSB A;  4RG2 A;  2DYI A;  2K3X A;  3NGP A;  1R77 A;  5GAN 7;  3WVD B;  4RTX A;  3EG2 A;  2EKO A;  3BFM A;  5EG2 A;  3T9N A;  5KYX B;  1QCF A;  1UGR B;  2W10 A;  1N9R A;  1UGP B;  4QVD A;  4N0A A;  4ZN1 A;  1KQ2 A;  2E4H A;  4RTZ A;  2DFU A;  2HDA A;  1Q86 C;  3FEO A;  4JJB A;  2F2X A;  1YJN T;  2LX7 A;  5DM7 R;  2YUN A;  3IQL A;  4J9D A;  4M77 F;  1B7T A;  3SHW A;  1YIJ T;  2YHT A;  4OB3 B;  4OMF B;  1ZQ1 A;  2KI7 A;  1YJ9 A;  4M77 B;  1QVF P;  3HRU A;  1K1Z A;  4LN2 A;  8AT1 B;  2WSF E;  1MMD A;  1TH7 A;  1OEB A;  2GFU A;  2XU8 A;  4F14 A;  5GAN 2;  4IUV A;  3ULR B;  3VYH B;  1RAD B;  4HKE A;  4B6M A;  4DBQ A;  3A98 A;  1AWO A;  5LJ3 e;  2EBP A;  2CH4 W;  4C8Q C;  1VQM T;  1G3S A;  2EW3 A;  2ATC B;  2DLP A;  2HMA A;  2O4X B;  4OMO A;  5A0D A;  4PJO E;  3M4Y A;  1VQ7 Q;  2OAU A;  2OTL A;  1PM3 A;  3HRT A;  5LJ5 f;  1WQW A;  4XTY A;  1F1B B;  1KD1 R;  1I1J A;  4M75 F;  2BE7 D;  2CKK A;  3QJY A;  5LJ3 g;  2D0N A;  2CS7 A;  1MUZ A;  2JVV A;  1K73 U;  2C0T A;  1E6G A;  1OV3 A;  3FB9 A;  1KQS A;  2FPE A;  4M75 B;  4OB0 B;  3RBB B;  2Y4Y A;  5CQY A;  2FRY A;  1QKW A;  4JJN K;  1BYM A;  3JCM h;  1I8F A;  3CME T;  3C4S A;  2RPN A;  4GLK A;  1W2B P;  3FRN A;  1V29 B;  4HCB A;  2FZC B;  3PT9 A;  1Q81 U;  2AT1 B;  3OS1 A;  1WXB A;  2F2V A;  2FB7 A;  4XTU A;  2DE0 X;  2QEX Q;  1VQO Q;  2DJQ A;  2LNV A;  3LX7 A;  5J26 A;  4X9D A;  2E65 A;  1M1K R;  3UPU A;  1OI1 A;  1PWT A;  4N4H A;  1NLP C;  5J39 A;  2K5L A;  2KMT A;  3CD6 A;  1G8X A;  1VIE A;  4OML A;  2COW A;  4C0D B;  4IUQ A;  1H3Z A;  2LT4 A;  1YIJ A;  4B9W A;  4OGE A;  1BBZ A;  3GP8 A;  1Q7Y U;  2LJ3 A;  2MWP A;  3EHR A;  1WHG A;  2BIV A;  3RNJ A;  1W2B S;  4KH0 B;  1Q82 U;  1RAB B;  3CEY A;  1IHV A;  4NL2 A;  4R55 A;  1Y07 A;  2X3X D;  5HK3 A;  1YI2 T;  5I2M A;  1GBR A;  4DBR A;  3X25 B;  2FHD A;  3R6N A;  4J6X A;  1NLO C;  3VS5 A;  1M90 C;  3CXC P;  1C6V X;  2RJF A;  1BB9 A;  1HXD A;  2KK4 A;  2GBQ A;  2QK0 A;  5LJ3 j;  2FPF A;  1VQM A;  4J6Y A;  1SPK A;  3I9Q A;  1AT1 B;  1GFC A;  2MAM A;  3E19 A;  4J8O A;  4ATO A;  4IIO A;  2X4Y A;  2C0I A;  4CC7 A;  2L3Q A;  1V76 A;  2EJG A;  1QVF A;  1NYF A;  4JPB W;  4A53 A;  1UGV A;  2VGN A;  4F7U G;  1IHW A;  2MK5 A;  2PVD B;  4AMC A;  2PUO B;  5LJ5 g;  1GRI A;  2KQW A;  2V26 A;  5HY6 A;  3G6E Q;  5GJV B;  1KG1 A;  4KUL A;  3JB9 G;  2ENM A;  3OYL A;  2QAS A;  4DOW A;  3CC4 T;  3TQ7 P;  2EGC A;  1M8M A;  4M7A G;  4PK4 A;  2DO3 A;  2YT6 A;  2C06 A;  4XTZ A;  4BD3 A;  3CME A;  2MIO A;  2XDB A;  2LJ1 A;  1YJ9 Q;  1KC8 U;  2RK2 A;  5IHI A;  1NBE B;  2VWF A;  3V8L A;  2KRO A;  1TUG B;  2QDY B;  4KH1 B;  3EH2 A;  4PJO C;  5KH6 A;  2LCL A;  2HBP A;  3PMT A;  1X43 A;  3LGF A;  4AFZ C;  5FU6 C;  3JCM W;  4RG8 A;  4E7I A;  1QVG P;  2X4W A;  1K9M C;  3VS1 A;  2RJC A;  4M78 F;  1IXD A;  5GAO p;  3JB9 H;  1WI7 A;  2VB6 A;  2DX1 A;  5GAN 8;  2NUT B;  1QWF A;  1H8K A;  1KJW A;  1W2B A;  1HD3 A;  3CBO A;  1E6H A;  2J7I A;  2RHZ A;  1SRM A;  2QA4 Q;  2DRK A;  1RAI B;  4M78 B;  1WYX A;  2JJ9 A;  3HKS A;  4M77 G;  1SKU B;  1BCO A;  4BY6 B;  4CRI A;  2OTL Q;  5KYY A;  1OU8 A;  3UT1 A;  4F16 A;  2YRC A;  5GAO m;  4NL3 A;  1YI2 A;  1KIK A;  1S1N A;  3TSW A;  1PCX A;  4OF1 A;  5GMK h;  4KGZ B;  2LQ8 A;  1MV0 B;  2HCK A;  4HXJ A;  3AHU A;  4RKU E;  4CC4 B;  1VYV A;  2ZAE A;  2M0O A;  4F7U A;  5CQX A;  4C92 E;  3VUB A;  2XIC A;  1ZSG A;  2KGT A;  2RF0 A;  5I2S A;  1LOJ A;  1PSE A;  2K5I A;  1ZHI A;  1W1F A;  1R0C B; 
#chains in the Genus database with same CATH homology
 3CCE A;  1VQP T;  3SFM A;  4FM4 B;  3OB9 A;  3UWN A;  2ZGW A;  1IZ6 A;  3M5A A;  1YHQ A;  2DEQ A;  4LDY A;  3N5B B;  2CGH A;  3OA6 A;  3P8D A;  3ZBD A;  2HQE A;  3QYG B;  3OMC A;  5GMK j;  1N8R U;  1HK9 A;  1M5Q 1;  1K8A U;  3E9G A;  3UDC A;  2Y90 A;  3M59 A;  3RIR A;  1VQ9 T;  3SB2 A;  3CPF A;  2G3R A;  1YCY A;  5C6S A;  4M7A A;  1LNX A;  2EJF A;  3EFR A;  2KVQ G;  3CXC A;  2CZ7 B;  4XAX B;  4ELZ C;  4BI3 A;  2QEX A;  4M78 C;  4BY6 C;  3OMG A;  4J5Y A;  4BDY A;  2JN0 A;  1NJI U;  5GAM g;  4ZN3 A;  1BI3 A;  2QQS A;  2EYQ A;  2AHJ B;  2YLC A;  2KY9 A;  3VYG A;  4XTV A;  4PJO D;  2HNI A;  3A8G B;  4J7F A;  4XTW A;  1EIF A;  3HP9 A;  5GAM f;  1VQO T;  3LLR A;  4LD6 A;  3CC4 A;  3CCR A;  2P4T A;  3INZ A;  1FWZ A;  4M75 G;  4EPC A;  3CCV T;  5DLO A;  5GMK l;  4C8Q A;  1H3Z A;  2QXF A;  4EMH A;  5GAN h;  4L59 A;  4ME7 A;  2F69 A;  4A4H A;  3VJP A;  3L2R A;  2K57 A;  2EWN A;  3DB4 A;  3CCQ A;  3KBG A;  5GAO r;  3MEW A;  4X9C A;  5HK0 A;  4F7U F;  5IAY A;  1D3B A;  1WPY A;  1WGS A;  5CIU A;  5D6Y A;  3CCQ T;  4IUU A;  4BI8 B;  4C92 A;  3C94 A;  3QYH B;  1O9S A;  1N9S A;  3FJP A;  1QW1 A;  2DXC A;  2RHY A;  4JS5 A;  5L8R E;  2CYZ B;  3EAE A;  3TCJ A;  1QVF S;  4M7D A;  3JCM b;  3PTA A;  3JB9 F;  4N4I A;  2VV5 A;  1Q86 U;  2ZPH B;  2LT1 A;  4F7U B;  2EAY A;  2EFI A;  2RI3 A;  2VXF A;  4OB1 B;  3CMA A;  4R56 A;  2E6N A;  5DLQ E;  3EFS A;  3VU3 C;  5AYF A;  1DJ7 B;  1VQ6 T;  3CC2 A;  5GAN j;  1VQ4 A;  3LW5 E;  2BUD A;  3JB9 I;  3JB9 J;  3C95 A;  5I21 A;  1I81 A;  4M7A F;  2JTM A;  1QP3 A;  3NFC A;  3DKM A;  3JSC A;  1N8R C;  3SWN B;  1K8A C;  1VQ4 T;  3ZEH A;  3OYD A;  3QKJ A;  4M75 E;  2E5Q A;  4C92 G;  1ZBX A;  4HCC A;  4B9X A;  2XD0 A;  4LDX A;  2A3L A;  1VUB A;  1SSF A;  2DPP B;  4ELY C;  5GAN 4;  2M9U A;  2VC8 A;  3A8H B;  4L6V 5;  4O6J A;  1M9S A;  3M53 A;  4A4K A;  2KSS A;  4EMK A;  4M7A B;  1IRE B;  3S6W A;  3CCL A;  4OP0 A;  3CCJ T;  1WQ7 A;  5KE3 A;  2DD4 A;  2DK3 A;  2XK0 A;  1KQS S;  3TEE A;  4C8Q F;  3I56 A;  1O75 A;  3M54 A;  1M1F A;  4P5N A;  5FRM A;  5KCO A;  2L89 A;  3FC3 A;  2E64 A;  1G3Y A;  5FLX E;  3CCL T;  4EDU A;  3I55 A;  3HSB A;  2CZ0 B;  2RJE A;  4V2S A;  3S3O A;  4RG2 A;  4QVZ A;  3QO3 A;  2K3X A;  3QUI A;  4FIB A;  5GMK i;  3G71 T;  4XU0 A;  5GAN 7;  5CK9 A;  5FRO A;  4RMO A;  3PIO A;  3L1A A;  3WVD B;  2O4X A;  1WJQ A;  2DXT A;  2QQB A;  2ZPB B;  3HHT B;  3M4G A;  2EKO A;  3O8V A;  3A5Z B;  3BFM A;  4UC4 A;  4C8Q B;  3LWH A;  5EG2 A;  1KHI A;  1QVG A;  5IN1 A;  5CR2 A;  3T9N A;  4M7D F;  1UGR B;  5CKH A;  5A2Q E;  2RO0 A;  1N9R A;  3LGL A;  3G6E T;  4JRP A;  2RJD A;  4E7J A;  5GAN g;  4C5H A;  1UGP B;  4M78 D;  4QVD A;  2LCC A;  2E12 A;  3JCM e;  1D3B B;  1YJN A;  4N0A A;  4ZN1 A;  3JCM J;  1Y96 A;  3SD4 A;  1KQ2 A;  5IT9 E;  2X4X A;  1QVP A;  3OS5 A;  5HKC A;  4QQG A;  4XU1 A;  5GAN f;  1Q86 C;  1WNL A;  3FEO A;  1VQ5 A;  3LH0 A;  5CKE A;  2ZPF B;  4M7D B;  1YJN T;  3JCM Q;  4MML A;  5DM7 R;  3OYG A;  3QDR B;  2QQ9 A;  3LYI A;  4M77 F;  4OVA A;  3H6Z A;  4KUD K;  1JJ2 S;  3E9F A;  4JLG A;  3QG1 A;  1VQP A;  2MWO A;  4ZGD B;  1YIJ T;  2YHT A;  1YJW T;  4HA8 A;  1VQ5 T;  4OB3 B;  4OMF B;  4PJO G;  5GAM d;  3SWN C;  2E41 A;  2DD5 A;  2P0P A;  1VQK T;  5C0M A;  1VQL A;  3QPH A;  5CCA A;  1ZQ1 A;  1Y7X A;  2I2L A;  4M75 A;  3JCM c;  3OYA A;  3M55 A;  3L2V A;  1YJ9 A;  4M77 B;  1VQ9 A;  3JCM V;  2RB6 A;  1KQ1 A;  3HRU A;  5LJ5 e;  2DXU A;  2A7Y A;  4M7A C;  2VYT A;  4TVR A;  2DAQ A;  4ZTF A;  1VQL T;  3QII A;  2GF7 A;  4EMG A;  4NOY A;  3L2U A;  1YJ9 T;  5CKB A;  2WSF E;  1TH7 A;  4LDV A;  4FT4 A;  3CBM A;  4FU6 A;  2GFU A;  2EJ9 A;  2D0Q B;  3V8K A;  1LJO A;  2XU8 A;  2H3J A;  3GF5 A;  4IUV A;  4RCC A;  5GAN 2;  3JCM g;  3VYH B;  4EMK B;  4HKE A;  3DLL A;  3LWI A;  1VQO A;  4QQ6 A;  1VQ8 T;  1YIT T;  3CD6 T;  5LJ3 e;  3CCV A;  3JCM f;  1VQN T;  3OYI A;  2YRV A;  4C8Q C;  5KE2 A;  1N27 A;  2QQA A;  3P8H A;  3CPW A;  1VQM T;  4BB7 A;  4HT9 A;  3F70 A;  1G3S A;  3KXT A;  4XU2 A;  3MEA A;  4BAC A;  3L42 A;  5FU7 B;  1NE8 A;  2X35 A;  2RA2 A;  4C5G A;  1B34 A;  1G3W A;  1K9M U;  2O4X B;  3JCM P;  3GIB A;  3A8O B;  2DTO A;  3GNG A;  2K5F A;  5A0D A;  4A4E A;  3JAM E;  1OYX A;  5GAN 3;  2LRQ A;  4PJO E;  3M4Y A;  1JRI A;  4M7D C;  2OAU A;  2OTL A;  2VGM A;  4FT2 A;  4J83 A;  2JOY A;  3OSV A;  4DA4 A;  2JUF A;  2QA4 T;  1XOV A;  2JZ2 A;  4PLI A;  4A4F A;  3X26 B;  1Y96 B;  3BW1 A;  3CC7 T;  3HRT A;  3ME9 A;  5LJ5 f;  3CCS T;  1WQW A;  4XTY A;  2LTO A;  4IKF A;  3PMI A;  2OTL T;  3FDR A;  4M75 F;  3QZ9 B;  1VQ6 A;  3CXC S;  2R58 A;  2CKK A;  4D6W A;  4M77 C;  3PIP A;  3QJY A;  2XDP A;  5LJ3 g;  3QJ6 A;  4JRQ A;  2R57 A;  2D6F A;  3L2Z A;  1GXI E;  2CS7 A;  5D6X A;  2JVV A;  1K73 U;  2V8I A;  5LJ3 f;  3FB9 A;  3H8Z A;  1WJR A;  3M56 A;  2RH2 A;  1KQS A;  3PNW C;  2LQK A;  2WAC A;  4M75 B;  4OB0 B;  4LD9 K;  1BI0 A;  3G7Z A;  4GY5 A;  2Y4Y A;  5CQY A;  4MMK A;  4JJN K;  4EMK C;  1BYM A;  3RKY A;  4MDX A;  4OGC A;  3JCM h;  3CCJ A;  4DOV A;  2XG8 D;  1I8F A;  2DIQ A;  4J6W A;  4M78 G;  3QHS A;  4O5V A;  3C4S A;  3CME T;  2CZ1 B;  3QXE B;  2Y4X A;  3JB9 D;  4GLK A;  4LDW A;  5GAO n;  2FYK A;  5GAN d;  4IUP A;  4RCB A;  5CKF A;  4C5E A;  5GAN 5;  1NJI C;  3FRN A;  3RMQ A;  1V29 B;  3OQ5 A;  3OW2 S;  1NZ9 A;  5FU7 C;  4HCB A;  1BI2 A;  3PT9 A;  3P8B B;  5A0L A;  2DZ9 A;  3G71 A;  1Q81 U;  1X01 A;  3X20 B;  3OS1 A;  3OYE A;  3QSU A;  5CVI A;  3CCU T;  1U1S A;  1XTD A;  2FB7 A;  4BUG A;  4ZTJ A;  3ER0 A;  4PL6 A;  3BDU A;  3WVE B;  3E1S A;  4XTU A;  3JRZ A;  3OYJ A;  4M7A D;  2LNV A;  2R5A A;  3LX7 A;  5J26 A;  4X9D A;  4PJO A;  2E65 A;  1AHJ B;  2GQV A;  2CZ6 B;  3G6E A;  4ZGE B;  1OI1 A;  3UPU A;  2DTI A;  4C92 F;  3OS0 A;  4N4H A;  5LJ5 h;  3RKW A;  3HL8 A;  1B34 B;  1VIF A;  4N0A C;  3A8L B;  1JJ2 A;  2V8J A;  5J39 A;  2K5L A;  2KMT A;  3CD6 A;  1VIE A;  3M58 A;  4MZM A;  3MET A;  4X34 A;  4M7A E;  3FLG A;  4C0D B;  1QP2 A;  1UGS B;  2E10 A;  3GLX A;  1R8O B;  1PSF A;  4IUQ A;  3SDZ A;  3OSS C;  2KAF A;  2F5K A;  3PGG A;  3RMS A;  2LC4 A;  3OYY A;  4QW2 A;  2LT4 A;  4C8Q D;  4C92 B;  4B9W A;  3VV0 A;  2XHC A;  4OGE A;  1JBM A;  1X75 C;  3OY9 A;  3GP8 A;  1YIJ A;  3J80 E;  1YJW A;  3M9Q A;  2LX9 A;  5LJ3 h;  1M4Z A;  1VQK A;  1JB0 E;  2K2V A;  3V7R A;  3JCM d;  4Z02 A;  4FL6 A;  4M78 E;  4ZGJ B;  1S72 T;  1Q7Y U;  5CAI A;  4M75 C;  2P0Q A;  2MWP A;  2ZCF B;  1K73 C;  2RHU A;  1VQ7 T;  4C0Z A;  2BIV A;  3HFO A;  3R6O A;  3DLM A;  3X28 B;  1W2B S;  4QVC A;  2DTH A;  3QZ5 B;  1Q82 U;  3X24 B;  5LJ5 j;  3CEY A;  4C5I A;  4R55 A;  1NPR A;  2EQJ A;  4NL2 A;  4M7D D;  2PVG B;  1Y07 A;  1YBY A;  3MEU A;  5HK3 A;  1YI2 T;  5I2M A;  4E7H A;  2RD1 A;  2WSC E;  5M9O A;  1M1G A;  2RI2 A;  4XQ3 A;  3X25 B;  5J3B A;  2FHD A;  2VXE A;  1RI0 A;  2RK1 A;  1UEB A;  2XI9 A;  2NLU A;  4J6X A;  1FX7 A;  3A8M B;  1M90 C;  5GMK m;  1KD1 U;  1QVG S;  1VQ8 A;  1YIT A;  1BIB A;  4XU3 A;  4VUB A;  3DB3 A;  5KCH A;  4C0F A;  3CCM T;  4LDU A;  2RJF A;  4BI4 A;  1HXD A;  4M77 D;  1VQN A;  2L3R A;  5GAO l;  2KK4 A;  2GFA A;  5LJ3 j;  4II1 A;  1VQM A;  4J6Y A;  4Q5W A;  4JRI A;  4BDZ A;  4PJO F;  2DKG A;  3BY7 A;  1Q81 C;  3ZFJ A;  2PUK B;  1Y71 A;  3OBW A;  3MO8 A;  2E6Z A;  2IG0 A;  2MAM A;  3NTH A;  5DY9 A;  3E19 A;  4J8O A;  4ATO A;  2HAX A;  3SWN A;  3L2Q A;  2X4Y A;  2HD0 A;  3RES A;  2OTJ T;  3GOX A;  3OYN A;  3CCE T;  2LDM A;  4L5G A;  2EJG A;  4M77 E;  4Y28 E;  1QVF A;  2HQX A;  3J7A F;  4WF2 A;  5GAO q;  4PJO B;  2B8A A;  5LJ3 d;  4C0D C;  5GMK e;  3OYF A;  1YHQ T;  4A53 A;  3S3M A;  3M57 A;  3KUF A;  3MCA B;  4MDW A;  5FU6 B;  4C92 C;  2FL7 A;  2QA4 A;  3PFS A;  3CC7 A;  2VGN A;  3NTI A;  4F7U G;  2PVD B;  4YTL A;  2PUO B;  2RHX A;  4IUR A;  3CCS A;  4E7L A;  2DZC A;  5LJ5 g;  2K4Y A;  1BKB A;  2KQW A;  4MZT A;  5CO7 A;  5HY6 A;  1XQH A;  4PNO A;  3NTK A;  3MP6 A;  4KBM B;  1KG1 A;  2PQW A;  4KUL A;  3OS2 A;  4M78 A;  3JB9 G;  2QEX T;  1X6O A;  3VUZ A;  3Q1J A;  2M1H A;  4QQD A;  3GNF B;  4CI0 C;  2EQU A;  1W4S A;  2YLB A;  3QBY A;  3OYL A;  1I5L A;  5LL6 S;  4IUT A;  4E47 A;  2LVM A;  5GAN 6;  1Q7Y C;  4DOW A;  1M1K U;  1UB4 A;  2M16 A;  2RI5 A;  2ZPG B;  2K3Y A;  3CC4 T;  3CCR T;  3TRE A;  1Q82 C;  3TU4 K;  1UGQ B;  2E1H A;  2R5M A;  2X4J A;  2DIG A;  3OYM A;  1OZ2 A;  4M7A G;  2QI2 A;  3OW2 A;  1OZ3 A;  2DO3 A;  3MP8 A;  2BKD N;  3CPW S;  2C06 A;  5A0G A;  4XTZ A;  4BD3 A;  2QQR A;  2IVW A;  3CME A;  4HT8 A;  2RM4 A;  3MEV A;  1KD1 C;  4XTX A;  2FVU A;  2VUB A;  2XDB A;  2DVE A;  4A4G A;  2WSE E;  3MHX A;  2MMP A;  4JRK A;  3V8J A;  4C0G A;  4NS5 A;  1KHC A;  1KC8 U;  2RK2 A;  1MHN A;  2JTF A;  4JS4 A;  4A54 A;  4MZP A;  3V8L A;  2JNG A;  2DJZ A;  3RKX A;  4M75 D;  3WXM B;  4BE1 A;  3CCU A;  4F7U E;  3FIF A;  1XNI A;  4C8Q G;  1M90 U;  3RER A;  3CMA T;  4M77 A;  4FSX A;  2QDY B;  4JDS A;  3HPW A;  4PJO C;  5D6W A;  2LCL A;  3HRS A;  5KH6 A;  2HBP A;  2D9T A;  3OBY A;  5GAN e;  3PMT A;  4J7I A;  5CKD A;  3LGF A;  4HCZ A;  5FU6 C;  3JCM W;  4RG8 A;  3URG A;  3CC2 T;  1WJS A;  4E7I A;  3J81 E;  2X4W A;  1N6A A;  1K9M C;  4JLI A;  1H64 1;  2RJC A;  2ZPI B;  1M8V A;  2L8D A;  4M7D G;  2EIF A;  5GAM h;  2EQM A;  4M78 F;  2GCX A;  5GAO p;  2XKO C;  2L5Q A;  3JB9 H;  3V7C A;  2ZPE B;  2P0K A;  5GAN 8;  3OYB A;  2XID A;  4DQ2 A;  3ASK A;  3OYK A;  4E7K A;  2F5T X;  2O01 E;  1W2B A;  1MGQ A;  1NPP A;  4XK8 E;  2PVO B;  3JCM X;  1S72 A;  3CBO A;  4KUI A;  3OYH A;  2RHZ A;  4BE0 A;  4JUV A;  3C12 A;  3G4S A;  3HKS A;  4M78 B;  4M77 G;  4BY6 B;  4CRI A;  3I56 T;  2V8K A;  1VQ7 A;  1M1K C;  4Y91 A;  3GPL A;  3I55 T;  2DXB A;  4KT0 E;  1RL2 A;  4N4G A;  3UT1 A;  5GAO m;  4NL3 A;  3G4S T;  1YI2 A;  2E70 A;  2MF2 A;  4C92 D;  1U1T A;  4C8Q E;  3MP1 A;  4OF1 A;  1FXX A;  4PKC C;  5GMK h;  3VKI A;  2EQK A;  5GAM j;  2LQ8 A;  3L2W A;  1G3T A;  3AHU A;  4RKU E;  1I4K 1;  2KDS A;  5GAM e;  1U8R A;  3OYC A;  3CCM A;  1BIA A;  2M0O A;  2MI6 A;  4OB2 B;  2RHI A;  3RUX A;  4F7U A;  1KC8 C;  5CQX A;  4C92 E;  2XDD A;  3VUB A;  2XIC A;  1P92 A;  2PU9 B;  3CBP A;  4BE2 A;  3S3N A;  3V7S A;  3BDL A;  4PLL A;  3HFN A;  4M7D E;  1G5V A;  1BI1 A;  5I2S A;  5LJ5 d;  1LOJ A;  2OTJ A;  5FRN A;  1PSE A;  2QTX A;  2ZZD A;  2K5I A;  1ZHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...