3PNWC

Crystal structure of the tudor domain of human tdrd3 in complex with an anti-tdrd3 fab
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
PMEYAKMWKPGDECFALYWEDNKFYRAEVEALHSSGMTAVVKFIDYGNYEEVLLSNIKPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB light chain
publication title CDR-H3 Diversity Is Not Required for Antigen Recognition by Synthetic Antibodies.
pubmed doi rcsb
source organism Homo sapiens, synthetic construct
molecule tags Protein binding/immune system
total genus 11
structure length 60
sequence length 60
chains with identical sequence F, I, L, O, R, U, X
ec nomenclature
pdb deposition date 2010-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00567 TUDOR Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3pnwC00
3PMTA 2RJFA 2LDMA 1N27A 3MP8A 2RHUA 3META 2NLUA 3UT1A 2WACA 2RHXA 3DLMA 3OYEA 3M9QA 4C5GA 2R58A 2X4YA 2BIVA 2RJCA 3OYCA 3UWNA 1KHCA 4RG2A 3LGFA 5D6WA 4E7IA 2XK0A 3OA6A 4GY5A 5J39A 5IN1A 2XDPA 3MEUA 3PFSA 3OYGA 3CEYA 2E5QA 4PLLA 4ZTJA 2MWPA 2X4XA 2BKDN 1MHNA 2GFUA 2G3RA 4QQGA 3L2WA 2P0KA 4LD6A 2D9TA 3OY9A 2RJDA 2LCCA 2M16A 5J26A 2RO0A 5KE2A 4UC4A 3MEWA 3PNWC 4BE1A 5KCOA 4B9XA 2E6NA 4IKFA 4PLIA 2L8DA 3OYNA 4E7HA 3OYMA 1WJSA 3S6WA 3O8VA 4IUVA 3OYLA 2L3RA 4IUUA 2RJEA 4NS5A 3QIIA 4IURA 3OYFA 4IUQA 3L2QA 3QKJA 4Z02A 5KH6A 4BD3A 3PMIA 5KCHA 4BDZA 3L42A 2EKOA 2L89A 2RHIA 3OYBA 3SD4A 4II1A 3Q1JA 3LGLA 3OYDA 5M9OA 2LVMA 3DB4A 4L59A 2JZ2A 4A4GA 2RI5A 2K3YA 3L2RA 4OVAA 3LH0A 3GOXA 3OS1A 2EQKA 4BE2A 3S3NA 5FRNA 2FHDA 4A4HA 5KE3A 4C5EA 2R5MA 1WJRA 3FEOA 4BACA 2RI3A 1G5VA 1XNIA 2QQRA 2LTOA 3NTHA 3E9GA 3OS0A 2MWOA 4N4GA 2O4XB 2X35A 4BE0A 2BUDA 3FLGA 3H8ZA 4IUPA 3P8HA 3OMGA 4Q5WA 3OYJA 2DIQA 2EQJA 4C5IA 2O4XA 5FRMA 3L2UA 3H6ZA 3OB9A 1WGSA 2M1HA 4QW2A 2K3XA 3OYKA 3MEVA 3OYIA 3ZEHA 2PQWA 4C5HA 4QQDA 1OI1A 2HQXA 4E7LA 4EDUA 4E7KA 4B9WA 5CIUA 1H3ZA 4FU6A 2F5KA 2R57A 3LYIA 3ASKA 4HCZA 4IUTA 4PL6A 1OYXA 5C6SA 3DB3A 3OS2A 3QBYA 4QQ6A 5C0MA 3EAEA 3S3MA 3MP1A 3C4SA 3NTKA 3BDLA 3L2VA 2YRVA 3MO8A 1RI0A 2DAQA 4A4EA 2QQSA 2R5AA 4X34A 5FROA 4A4FA 2M0OA 2GF7A 2RHZA 2JTFA 3OYAA 5IAYA 2DIGA 3P8DA 4ZTFA 3ME9A 5D6YA 3LX7A 3OMCA 2EFIA 2EQUA 5D6XA 3F70A 4CRIA 2LRQA 3E9FA 2IG0A 3MEAA 3FDRA 1OZ2A 4BDYA 3OYHA 1WJQA 4FL6A 3S3OA 2GFAA 2HQEA 2VYTA 3QJ6A 4N4IA 2RHYA 4E7JA 2B8AA 3MP6A 3OQ5A 4N4HA 3KUFA 2RI2A 3NTIA 1OZ3A 1SSFA 2EQMA 4QVZA 2CKKA 3FC3A 2X4WA 3LLRA
chains in the Genus database with same CATH superfamily
3RDVA 3J81E 2LCSA 1WPYA 2YRDA 3CC7T 3L1AA 1QVPA 2FRYA 2CSIA 4HT9A 1NEBA 1E6HA 1XTDA 2J6FA 4AFZC 2B86A 4R55A 4DOWA 4ATOA 3BY7A 3WVDB 1YHQT 2P0KA 1IHWA 2KSSA 5GMKi 1NYFA 1UFFA 3RNJA 3OYNA 4M7DC 4E7HA 1Q81R 3CC4T 1WJSA 2DEQA 4FW2A 3S6WA 2JTMA 5FU6B 1TUDA 1T3SA 1K73C 4M77F 1Y57A 4BDZA 4PJOD 3WVEB 1KSWA 5L23A 5GMKl 3DB4A 2DL4A 4EMHA 4KGXB 1G3SA 2V1QA 1IO6A 1OPLA 4BB7A 1XNIA 1RAGB 3NTHA 3OS0A 1HYOA 2KRNA 2MYSA 2DRKA 2X3WD 1OEBA 1UG1A 1UGSB 1N9RA 4F16A 1RL2A 1PRMC 1ZQ1A 2A7YA 4FCYA 4FW1A 4L6V5 5HY6A 1VQOA 3D7SB 3RUXA 1V29B 3M4YA 4F7UE 3VUBA 1K76A 5CR2A 1JJ2S 3G6EA 4ME7A 5FU7B 3CCEA 2LJ1A 1WLPB 1FXXA 2EFIA 3HRUA 1LJOA 2JM9A 2RB6A 4HXJA 4LUDA 1M2VA 1M90R 3OS5A 2L0AA 2DERA 3O5ZA 4C0GA 2B8AA 2DL7A 1WXTA 4KGZB 4XU0A 3CCRQ 1VYVA 2LNVA 2VWFA 2WACA 2AKKA 3I55T 3X24B 5I2SA 1QCOA 3H0FA 3IQLA 4F17A 3CPWS 2XDPA 2CYZB 3H0IA 5GANj 4M7DF 4OMPA 2YUOA 4LDVA 2XDBA 1VOMA 4OB0B 1D09B 2ENMA 1K9AA 2RJDA 2E70A 5J26A 4HCKA 4Y92A 1OU8A 5FWBA 4PK4A 2YUPA 3O8VA 5GAN4 4MMKA 1YIJA 4C0DB 1KFZA 2BE9B 2EAYA 2KRSA 2K6DA 3VS3A 2P0PA 2FHDA 3JCMg 5KE3A 3M4GA 1TXQA 1VUBA 1WZOA 1D1CA 2YUNA 2K3BA 1JRIA 5GAN3 4XU1A 3OYJA 1R77A 1VQ9A 2D8JA 5HK3A 5EG2A 3JCMe 3ULRB 3CC7Q 2NUTB 2GQIA 1MV3A 5LJ5g 5LJ3g 4PJOA 1QQJA 5C6SA 2EQIA 3OS2A 3R6OA 2H8HA 2KRMA 2KYBA 1VQ7A 2KXCA 4MZMA 4K11A 3BDLA 1VQKT 3THKA 5LJ3e 1VQPT 2ZPFB 1UGVA 3CC4Q 3ME9A 2LC4A 2KGTA 2NUPA 2RD1A 2GCXA 1M2VB 3PE0A 5D6XA 2O01E 2MF2A 1M8MA 1OZ2A 3DKMA 4PJOG 1GRIA 4C8QE 4J6YA 2LMJA 3NTIA 2P4RA 2ESWA 1WI7A 2EJGA 4LDWA 1KK7A 1D3BA 2OAUA 2ZPBB 4JRPA 3CQTA 3G4ST 5I2MA 3ZBDA 1VA7A 4RTTA 1GBRA 3VV0A 2MWPA 1RACB 3JCMf 1KIKA 2E3IA 1X75C 1XQHA 2RK2A 4DBFA 1AT1B 5CKHA 1G3YA 2CZ1B 4AT1B 1U5SA 4D8KA 4MDWA 4GBQA 4LD9K 4WCIA 5LJ5f 5LJ3f 2C0OA 3LWHA 2QYZA 3NHNA 5AYFA 1K9MR 3OS1A 3SB2A 1J3TA 4QVDA 2A0FB 4ZN3A 1E6GA 4L5GA 3BDUA 3SWNA 1WXBA 3C0CA 4QKUA 8ATCB 3QO3A 3I55Q 1P92A 2M1HA 3JB9F 4PJOB 4F14A 1JXMA 1U06A 4QQDA 4KT0E 2HBPA 5J3BA 4E7LA 1Q86R 1UB4A 3OW2S 1R0BG 1EFNA 3J7AF 4HCZA 1Q82R 4DA4A 1GBQA 4DEYA 3L2VA 2XDDA 4E7SA 3EG9A 1M3CA 1NLOC 2ZPIB 2CS7A 1TG0A 3G71T 2QK0A 2J7IA 2LCLA 1GFCA 1QVFP 2AT1B 4JZ4A 1G8XA 1RLQC 3S3OA 1VIEA 4M7AD 4C8QC 2FZKB 4EMKC 4JRIA 1N6AA 4M75A 4AMCA 1JJ2A 3JCMb 1D3BB 5KYNA 3A8GB 1FX7A 2HL5C 2AZSA 2HZYA 4EMGA 3M0TA 4LNPA 1PM3A 4RG2A 4IIMA 3NFCA 4MMLA 1QVGP 2EYXA 1MMAA 4KGVB 1TSFA 1T0JA 4HVVA 2VVKA 4UC4A 2RNAA 3VJPA 4DBHA 2F69A 1VQPQ 2JW4A 4KH0B 4AFUC 4PFOA 5FU6C 3FJ5A 4JJBA 3EFSA 3HL8A 1X6BA 1C6VX 1TS9A 1WDXA 4ESRA 3QYHB 5M9OA 3UATA 2JZ2A 1UTIA 2J6OA 2XU8A 4BE2A 1WHGA 1S72T 4HKEA 2EBPA 2YWWA 2JMAA 1OULA 4XTWA 4O6JA 2J6KA 5GAOp 1AVZC 2XICA 1WGSA 4QT7A 3NMZC 4N0AA 3G4SQ 3UPUA 3RKWA 2JOYA 1K0XA 2ZZDA 2K79A 5GAN5 3CCRA 4DOVA 3LYIA 1OYXA 1FMVA 3V7SA 1H8KA 3EG9B 2PVDB 1W1FA 1YWOA 4M78D 5FU7C 1AOJA 4X34A 2FO0A 2RHZA 4C8QF 3P8DA 1K73U 4OB3B 1PWTA 3F70A 2GBQA 3E9FA 1BIBA 2IG0A 2DXUA 4FL6A 2CREA 4C92A 2VYTA 1AHJB 1ZUYA 4N4IA 2DXBA 4M75B 3KUFA 1FWZA 4XK8E 2DETA 3KBGA 1X01A 3MP8A 2ABLA 3UT1A 5LL6S 3RKXA 1W6XA 1QLYA 1I4K1 1YFNA 2FZCB 2KAFA 1KHCA 2HEQA 1YI2A 4E7IA 2XK0A 3RKYA 5IN1A 4C92G 1IRXA 4CI0C 3NPFA 5FWCA 4QQGA 3CC7A 3JB9H 1O75A 5GAOm 3HFOA 1KC8R 3G71Q 1YHQA 1UJ0A 3AT1B 3LH0A 3PIOA 2RQTA 2V8IA 3OYYA 3CC4A 4M7AG 2QDLA 5KYUB 3M58A 3V8JA 2BUDA 3VYHB 1AZGB 3H8ZA 2NYSA 3OMGA 2DIQA 1I1JA 1V76A 1AD5A 4J9DA 1AWWA 4TVRA 3ZL7C 5KYWA 2DL8A 1C1AA 1AEYA 4C5HA 2RA2A 2EJ9A 3HTRA 5CKDA 5IH2A 1W2BP 2SEMA 4FU6A 2BE7D 3CD6T 4RCBA 5A0DA 2MPXC 2FG0A 1NJIU 2C0TA 2DTHA 3EG3A 1RAEB 1U8RA 2C06A 2FPDA 1R8OB 4JS5A 2BZXA 1ARKA 3G1JA 3RMSA 2VASA 4B6MA 4C92B 2QA4Q 1WJQA 1VQ8T 5EC7A 2D6FA 2DZCA 3CCST 4OMLA 2MAMA 2CKKA 1S72Q 1QWFA 1W70A 2D0QB 1ZHIA 2DL5A 1TOVA 4M78A 1QKWA 4C5GA 1WFWA 1BI3A 2RJCA 3CCMT 1UGQB 5A0GA 4ELZC 1JBMA 1GFDA 1HJDA 3OA6A 2EWNA 1M27C 1SSHA 3CMET 4Z88A 1QCFA 3I55A 1BB9A 2VKNA 5CKFA 1OOTA 3FB9A 3CXCS 1GCQC 3AHUA 3OYMA 4PJLA 4M78G 5CKEA 5KH6A 1ABQA 2RHIA 5GMKm 1IHVA 4Z89A 1B3QA 3HP9A 1K9MC 2EQKA 2M51A 2ED1A 4C5EA 4JPBW 4XU3A 2HKNA 1UE9A 2CUDA 4ZN1A 4BE0A 4IUPA 2JS0A 1KD1R 1HSQA 3EGDA 1RI9A 3HPWA 5KYWB 3JB9J 2DEUA 3M53A 5CKBA 4HVWA 4RTXA 4PJOC 4RKUE 4JRKA 4EDUA 3J80E 1KQSA 1IZ6A 4FSSA 3M0UA 1X6OA 3QZ5B 4RTWA 1RAFB 2P0QA 3QZ9B 3JCMP 2OI3A 2YRVA 1NE8A 5IT9E 3BW1A 3VS4A 1ZSZC 2DE0X 2OTLT 2LT4A 2EQUA 4NL3A 5CQXA 2RQRA 1WHKA 4XAXB 2BTTA 9ATCB 2EGAA 3N5BB 2ED0A 1G2BA 1NLPC 4PJJA 1M1KR 2ZPHB 1VQKA 4XTXA 4J5YA 1MV0B 1BKBA 1OZ3A 1SSFA 2H3JA 3FC3A 5GAMh 1VQ6T 1WIEA 2LDMA 4M78B 2FYKA 5CAIA 2RHXA 3TEEA 2KMTA 3OYCA 1VQ5A 3FIFA 3QXEB 2K9GA 1Q7YR 4LN2A 2EYZA 2J06A 2CT3A 2LQNA 2E5QA 3A8OB 1ZBXA 3CD6Q 4FM4B 2COWA 3M0RA 2DD5A 4BE1A 1I8FA 2DZ9A 4OP0A 4M77A 3G4SA 4CC2A 1G83A 5I21A 3CCLT 2JUFA 3H0HA 2DK3A 2PUOB 2HMAA 1ZA1B 2DFUA 1YNZA 4II1A 2LNHB 1V1CA 2K3YA 1BI2A 5ECAA 3L2RA 1VQ8Q 3PIPA 3X28B 1PG5B 4J9BA 3L2ZA 1TTHB 4M4ZA 4AG1C 4J7IA 1G5VA 3A5ZB 2K57A 3CCSQ 4PJOF 3CCJT 2FRWA 1Y7XA 3EGDB 1NJIC 3FLGA 1HXDA 1X27A 2COZA 3HRTA 3GF5A 1YJ9T 4C5IA 5FRMA 4RTUA 4XTVA 2LJ3A 3OB9A 2QQ9A 3MEVA 1HK9A 5FW9A 2JT4A 1ZUKA 3CCMQ 2HQXA 1Y96A 1KG1A 4B9WA 2EVRA 5GMKh 2F1LA 2RN8A 5CIUA 2CZ6B 3CMEQ 4CC3A 2CP3A 2DVEA 2V1RA 1BYMA 2M9UA 1BCOA 2M0YA 3VKIA 4FYVB 3RR6A 2DNUA 3WXMB 2DXTA 3EG1A 1XJWB 5KYXA 4EPCA 4A4FA 1Q81U 3A98A 2GF7A 1M9SA 3SDZA 1RADB 2CH4A 1KQ2A 2QXFA 1H92A 4LUEA 2A37A 1AWXA 2OX7A 3JCMW 2BZYA 1SKUB 2DXCA 2RHYA 3MP6A 4M75D 3I56T 1MMDA 1N9SA 3L2WA 2EW3A 3A8LB 2KVQG 3FRNA 3QYGB 5LJ5e 5LJ5j 1QMCA 5LJ3j 4O5VA 1NG2A 4M7DA 4JLGA 1X2KA 3CBPA 3GIBA 4X9DA 1UGRB 5GAN6 3M54A 2X9HA 2NUZA 3I5SA 2ZPGB 1SG5A 3MEUA 4M7AE 3M0PA 4OF1A 4M77B 3X26B 2KY9A 4KBMB 2MK5A 2E4HA 1YITA 3OBYA 4ZGDB 1AZEA 2E6NA 2DBMA 4QVCA 1HD3A 3M5AA 2YLCA 1N8RR 4RUGA 4IURA 2DYIA 1Q7YU 3PMIA 2OTLQ 2WSCE 1M90U 2LVMA 3EFOA 3SFMA 4OVAA 2DX1A 3S3NA 1WHJA 1YCYA 2QQAA 3KXTA 2IVWA 2GNCA 2WSFE 2LP5A 1VQ6Q 1YCSB 3QG1A 4DEXA 2DMOA 2CP2A 3CXCA 3MKDA 3TVTA 2HAXA 1Y96B 2K3XA 1TU0B 2A08A 3MJXA 2GTJA 5DY9A 3CPWP 1EIFA 1PNJA 3QWXX 4QQ6A 2DA9A 3CCVT 5KYXB 2CP7A 2E5KA 4RTYA 3HRSA 4RCCA 1DJ7B 2JTFA 1AWOA 2I0NA 1SHGA 3LX7A 3CCLQ 4C92C 5FLXE 2AHJB 4C92D 4OB2B 3FDRA 5CK9A 2JN0A 2HQEA 4P5NA 2LX9A 4OB1B 4E7JA 2A28A 4J6WA 5C0MA 3EH1A 4BI3A 3EG2A 3CCJQ 4PFZA 1FYNA 4YTLA 5GANh 2NUPB 3M9QA 3QUIA 1YJ9Q 2R58A 1NEGA 1VQ4T 2VXEA 2HBWA 2QEXT 2E65A 1A0NB 1CSKA 4M7AC 1OPKA 3PFSA 4RTVA 3V8LA 2LQWA 1GL5A 3MCAB 1UUEA 4JJCA 3H41A 2QI2A 2P84A 3RERA 2HDAA 2MOXA 2RO0A 5KCOA 3RIRA 2J05A 2H3EB 4B9XA 3JB9I 1VQ7T 4PKCC 4PLIA 4BY6B 3CMAT 1YJWT 3OYFA 1UEBA 2BZ8A 5KCHA 3EFOB 3OYBA 4L59A 1M1GA 3GOXA 2QGFB 3I5RA 2K7AA 3LH5A 2EYQA 3I56Q 2O88A 3VS2A 2X35A 1GXIE 4M75G 4F7UA 4PJMA 1KHIA 4OMMA 1OX8A 2EQJA 1KD1C 2COYA 3NGPA 1Q81C 2F2XA 1T3LA 3ZEHA 2KI7A 1KQSS 1ZX6A 2E12A 2QA4T 3CCUT 1Y71A 1WHMA 2MI6A 1RUWA 5GAN8 3X20B 3SWNB 4C92F 2CP5A 2LJ0A 4A4EA 4XTYA 4F7UG 1M5Q1 1Z9QA 2R5AA 2KT8A 1TH7A 2LZ6B 3CD6A 5D6YA 4FYWB 3UA6A 5AT1B 2QGGA 1CKBA 1K9MU 3QJ6A 1D0XA 2NWMA 1N5ZA 3PVLA 2AKLA 4NL2A 1WQ7A 2V26A 2ZCFB 4C0FA 1M4ZA 2RJFA 3PTAA 4M78C 5A2QE 2EIFA 3TQ7P 1IGQA 2ZPEB 4M7AF 2DTIA 3DLMA 1VQ8A 3RMQA 1LVKA 2BIVA 1Q7YC 2C0IA 1Q86U 2EPDA 3CCQT 3RBBB 4A54A 3OW2P 2QTVA 1M90C 2FVUA 4ZTJA 2DJQA 1Q82U 1S1NA 2BKDN 1RAIB 2D9TA 2LCCA 1LCKA 4FT2A 3CCVQ 5L8RE 1OU9A 3JCMJ 1ABOA 3HHTB 4IUUA 2RJEA 3CMEA 3L2QA 3UA7A 3CC2T 5IHNA 3MHXA 2HSPA 1QVFA 1OQKA 2Y4XA 2F2WA 2VB6A 3VRYA 4A4GA 5FRNA 3E2UA 4HCCA 1NM7A 2R5MA 2RI3A 1EX4A 4F7UB 3E9GA 5IXFA 3JCMQ 1VQ4Q 4C0DC 1BIAA 1BCMA 2QEXQ 2DD4A 2DVJA 1QVGA 2JTEA 2R57A 2DTOA 2RM4A 4HCBA 2DPPB 3M57A 3DB3A 1IGUA 3VS0A 3VYGA 1FMKA 4C8QA 1H3HA 4EMKA 3MO8A 1QP2A 2KK4A 2QQSA 5GANd 1M8VA 2HQHA 1VQ7Q 5IAYA 2DIGA 3CMAQ 2LQ8A 1WXUA 1RLPC 1YJWQ 4PJOE 1M3BA 2LRQA 1MMNA 3MEAA 1QKXA 4M78F 4AFSC 1K0SA 1VQLT 4J7FA 2XI9A 1TUCA 1X2QA 3JSCA 4JS4A 2ZAEA 1IREB 1G3TA 4JDSA 3REBB 2RHUA 3META 3GPLA 1MGQA 1MUZA 2KEAA 1B07A 1VQ6A 1K4US 2O31A 3FJPA 2DL3A 3CCUQ 2GFUA 2KXDA 4M77D 5KE2A 6AT1B 2YDLA 4A63B 4Z8AA 3EGXA 2PZ1A 3V7RA 2XIDA 3PT9A 4BD3A 1UDLA 3UF4A 2DM1A 2EKOA 2FPEA 5GAOq 3SD4A 2SRCA 1LNXA 4AG2C 3OBWA 2DKGA 3CCLA 4X1VA 3VS5A 1X43A 5GAN7 2IIMA 4XTUA 4QW2A 2EGCA 2XKOC 2K5LA 1LOJA 3A8MB 3OYIA 5CCAA 4KH1B 2YHTA 2YT6A 4XU2A 3CCJA 1H3ZA 4LXCA 2K4YA 4C8QB 4EMKB 3CCQQ 4BI4A 2ECZA 4PL6A 3VRZA 4J9FA 1YJ9A 1YI2T 2HD0A 2L5QA 3TCJA 3JCMX 3GNFB 2HKQB 1RI0A 2I2LA 2OTJT 2JM8A 4KUIA 2RQUA 1KC8U 1NPRA 3A1PA 3CC2Q 2CP0A 3EFRA 2E64A 1Q86C 2QASA 2RPNA 5CVIA 1AWJA 2L3QA 1Q82C 2EQMA 2K5FA 3LLRA 4ANJA 2HSEB 1JB0E 3X25B 4M7DD 1E7OA 3QPHA 2JJ9A 3EHQA 2K5IA 1XOVA 2X4YA 3G7ZA 4RTZA 1NPPA 3UWNA 3LGFA 3I56A 2A36A 2HCKA 1W2BA 4DBRA 3OYGA 2X4XA 4HA8A 2P4TA 1KJWA 1VQPA 1MHNA 4M75E 4MZPA 4RG8A 3QDFA 3TU4K 2M16A 3EGXB 1UHCA 2D1XA 1RAAB 4BI8B 4J6XA 4IKFA 2EKHA 4BY6C 4KUDK 2YXYA 2DLPA 2KT1A 1VQNT 2RQVA 4IUQA 1PD0A 4LE9A 1BI0A 2L3PA 2NUTA 1VYUA 3OYDA 2VGNA 1PSEA 4R0KA 4F04B 1VQMT 1PC0A 2MMPA 1VQLQ 1WJRA 2L3SA 3SHWA 5I11A 2XG8D 2M02A 4N4GA 2MWOA 1PKSA 2Y90A 3QHSA 1Q95G 4LDXA 2CSQA 3V8KA 2ROTA 3OYKA 4PJNA 4J8OA 4PFPA 2CUBA 2PQWA 3EHRA 1G3WA 2VUBA 2X51A 4KRTA 2JVVA 3TREA 5GJWB 1QP3A 2DYBA 2K2VA 3S3MA 3SWNC 3C4SA 3JCMc 5GANg 4M77G 1I81A 1OV3A 2D0NA 3CXCP 3GP8A 1YJNT 4CC7A 2EYYA 3VS7A 1K8AR 4EIKA 7AT1B 3CCVA 3GNGA 5GANe 1NYGA 2RQWA 3SEMA 2PVOB 2YUQA 2X4JA 4J9IA 4D8DA 1ZA2B 1WX6A 3E1SA 4ZGJB 1N27A 1KD1U 3CPFA 1PKTA 2LX7A 1GCQA 4Y28E 1WHHA 1ACMB 1CKAA 4R56A 4C92E 5J39A 2RMOA 3CEYA 4GLMA 2QTXA 3ZFJA 4M75C 2CH4W 4LD6A 3OY9A 1YI2Q 3G71A 1VQ4A 3MEWA 3V7CA 2VV5A 3QWYA 2QEXA 3OSVA 2O9SA 2PNIA 3OSSC 3HKSA 2OTJQ 2CGHA 3OYLA 3DLLA 1QVFS 1JXOA 4WTOB 3Q1JA 4FSXA 4J9HA 2DRMA 2CP6A 1M1KU 3H9NA 1SRLA 3CBOA 5HKCA 1IB8A 4FT4A 4A4HA 1NBEB 3JV3A 3CMAA 3E19A 2F2VA 3JB9D 1YHQQ 1YJWA 2KR3A 2XHCA 1T0HA 1MNDA 1JJ2P 5GANf 1VQOT 3CBMA 1B7TA 2CDTA 4V2SA 1U1SA 2PU9B 4M7DG 1ZSZA 2FZGB 3G6ET 1KC8C 2DILA 1OI1A 3CCET 4HVUA 1QVGS 1VQ5T 4E47A 2F5KA 2G6FX 2IPOB 1X69A 1FMWA 3BE3A 5D7UA 1SHFA 1TWBA 3BFMA 2E3HA 1D0YA 2K2MA 1BBZA 2DAQA 3ER0A 2L2PA 2QA4A 3CCUA 1RAHB 3VU3C 1NZ9A 4N0AC 1VQNQ 3JCMV 3UDCA 4OMNA 2DO3A 1S72A 4LDYA 5IXBA 4JLIA 1ZSGA 4E6RA 1VQMQ 4FYYB 3A8HB 1M3AA 2KNBB 3OQ5A 2RI2A 1MMGA 2PVGB 5GAMd 4FIBA 2X4WA 4JUVA 2O2OA 5CQYA 5DM7R 3OYEA 3I9QA 4M75F 1K8AU 3HFNA 2W0ZA 3LW5E 2VGMA 5GJVB 1PD1A 3GLXA 1I5OB 1YIJT 2Z0WA 4JJNK 1UECA 3C94A 4FYXB 4MZTA 1ZUUA 4M78E 4DQ2A 2L8DA 2XMFA 4XTZA 8AT1B 4M7DB 1BU1A 3CCQA 4ORZA 2L3RA 3VUZA 1K73R 1YJNQ 4Z02A 1EZZB 1JO8A 4F7UF 3L42A 2L89A 1VQ9T 3EH2A 2GQVA 4J9EA 1PSFA 4E2FB 2AIRB 2OJ2A 1D0ZA 2CT4A 2YSQA 4J9GA 3CC2A 4AFQC 1X6GA 3P8HA 4Q5WA 1ZSZB 5A0LA 1VYTA 1BI1A 2QAZA 3C95A 4E7KA 4OMQA 2F5TX 2YLBA 3T9NA 4C8QD 3ASKA 3PVQA 1I07A 3JRZA 3QBYA 2CZ0B 3MP1A 3JCMh 2GGRA 1Z9ZA 2V8KA 1SEMA 5FROA 4PNOA 2HL3A 2FL7A 1N8RU 1W4SA 1YITT 3OMCA 3RESA 2KQWA 1UJYA 3OYHA 1Y07A 2E10A 5LJ5h 5LJ3h 1I5LA 1PCXA 1QCNA 1YBYA 3PGGA 1MNEA 4NOYA 1WHLA 1B34A 1LPLA 2MCNA 2E6ZA 3JB9G 1VQKQ 1Y0MA 3VS1A 4JRQA 2D8HA 5HK0A 1VQOQ 4OGEA 2AK5A 2KDSA 5IHIA 1VQLA 5GAOn 1WA7A 5D6WA 3G6EQ 1W2BS 1IXDA 3CCEQ 3CPWA 2FB7A 4PLLA 4CC4B 2FEIA 5GAN2 1M1KC 1VQ5Q 2G3RA 2EGEA 2QQBA 4IIOA 1NJIR 3PNWC 2X3XD 5KYUA 2W10A 4ZNXA 3M55A 4NS5A 3QIIA 1D1AA 5HCKA 3M0QA 1M2OA 3CCSA 2RI5A 3KFVA 3M59A 1WQWA 2Y4YA 3M0SA 3FEOA 4E7ZA 1F1BB 2EJFA 4M77E 2QQRA 2JMCA 3M56A 1GCPA 3LWIA 3CCMA 1JQQA 3EGUA 3URGA 2JXBA 2O4XA 3H6ZA 2FPFA 1ZBJA 2DJZA 1R0CB 3QSUA 3REAB 2MIOA 2RK1A 4JJDA 1UHFA 1YIJQ 1D1BA 3R6NA 3NTKA 2A3LA 2LT1A 1C0MA 4GLKA 4ZTFA 5KYYA 4ELYC 4DBQA 3VS6A 4OGCA 1K8AC 4BDYA 3TSZA 1VQ9Q 2OTJA 4M7AA 1B34B 5GAOr 5GAMg 4KULA 4QVZA 1PHTA 1QW1A 3PMTA 4RMOA 1UGPB 1PRLC 4XQ3A 5IHKA 5DLOA 2NLUA 4VUBA 3HSBA 4C0ZA 3U23A 1O9SA 4HT8A 5GAMe 2CZ7B 5GAMj 1OX9A 1U3OA 2HNIA 3JAME 5CO7A 1ZLMA 1KQSP 3QJYA 1SPKA 4GY5A 1WNLA 2VC8A 1YWPA 2ROLA 3TSWA 2EYWA 5I22A 4OMOA 2VXFA 1SF9A 2V8JA 4OMFB 4C8QG 3MPUB 2OTLA 2OAWA 3EG0A 4D6WA 4M7DE 1VIFA 4Y91A 2O9VA 4IUVA 5GAOl 3GBQA 1YN8A 3QKJA 1M30A 1YITQ 3LGLA 1K1ZA 2RF0A 4LDUA 2RH2A 5DLQE 1BK2A 3INZA 3JCMd 4J83A 4BACA 2DF6A 4M77C 1VQNA 2LTOA 3C12A 3I35A 1JU5C 2ATCB 2DBKA 1RABB 2O4XB 3CCRT 2QDYB 3L2UA 2QG9B 1VQMA 2WSEE 4A53A 2PTKA 1N8RC 1JEGA 1YP5A 5LJ5d 1I0CA 5LJ3d 2E41A 3OW2A 4IUTA 4X9CA 4JZ3A 1H641 5GAMf 2ZGWA 3EAEA 2JS2A 1KQ1A 5GMKe 2E1HA 1SRMA 5GMKj 4ZGEB 2KBTA 5KYYB 1WYXA 2M0OA 2LQKA 3OYAA 1QWEA 2PUKB 2AZVA 4J9CA 2JNGA 2KE9A 2XD0A 4CRIA 3QDRB 2YRCA 3P8BB 1TUGB 1M1FA 4M7AB 4WF2A 2GFAA 2KROA 1U1TA 4BUGA 2GTOA 2KYMA 4N4HA 4A4KA 4MDXA 1YJNA
chains in the Genus database with same CATH topology
4BI3A 3J81E 3E1SA 4XK8E 4ZGJB 1N27A 3KBGA 1X01A 3MP8A 1KD1U 4YTLA 3UT1A 1WPYA 3CPFA 5GANh 5LL6S 3RKXA 3CC7T 3M9QA 3QUIA 2R58A 3L1AA 1QVPA 4Y28E 1I4K1 1VQ4T 2VXEA 2KAFA 1KHCA 4HT9A 4R56A 4C92E 2QEXT 1YI2A 4E7IA 2XK0A 2E65A 3RKYA 1XTDA 5IN1A 5J39A 4R55A 4C92G 3PFSA 4DOWA 4ATOA 4M7AC 3CEYA 2QTXA 3BY7A 3WVDB 3ZFJA 3V8LA 4CI0C 3MCAB 4QQGA 1YHQT 4M75C 2P0KA 2QI2A 4LD6A 3CC7A 3OY9A 3RERA 2RO0A 3G71A 1VQ4A 3MEWA 2KSSA 3RIRA 5KCOA 5GMKi 3V7CA 2VV5A 4B9XA 3JB9I 1VQ7T 4PKCC 4PLIA 3OSVA 1O75A 3OYNA 2QEXA 4E7HA 4BY6B 3CC4T 3CMAT 1WJSA 2DEQA 3S6WA 2JTMA 3HKSA 3OSSC 1YJWT 5FU6B 2CGHA 5GAOm 3HFOA 3OYLA 3OYFA 1UEBA 3DLLA 1K73C 1QVFS 5KCHA 4M77F 4BDZA 4PJOD 1YHQA 3WVEB 3OYBA 5GMKl 3Q1JA 4FSXA 3DB4A 4L59A 1M1KU 4EMHA 1G3SA 1M1GA 3CBOA 3LH0A 3PIOA 3GOXA 5HKCA 4FT4A 4A4HA 2V8IA 3OYYA 3CC4A 4BB7A 3CMAA 3E19A 3JB9D 4M7AG 1XNIA 2EYQA 1YJWA 2XHCA 4M7DC 3NTHA 3OS0A 3M58A 2X35A 3V8JA 2BUDA 4M75G 3H8ZA 3VYHB 5GANf 4F7UA 1GXIE 3OMGA 1VQOT 3CBMA 1KHIA 2DIQA 4V2SA 2EQJA 1U1SA 1KD1C 1Q81C 4TVRA 1UGSB 1N9RA 2PU9B 4M7DG 1RL2A 3ZEHA 3G6ET 1KC8C 4C5HA 1KQSS 1OI1A 3CCET 2E12A 2RA2A 2EJ9A 5CKDA 2QA4T 1ZQ1A 2A7YA 1QVGS 3CCUT 1Y71A 4FU6A 4L6V5 2MI6A 2F5KA 4E47A 4RCBA 1VQ5T 5HY6A 5GAN8 1VQOA 5A0DA 3RUXA 3X20B 1V29B 3SWNB 3M4YA 4F7UE 3VUBA 3BFMA 4C92F 5CR2A 1NJIU 1JJ2S 3G6EA 4ME7A 2DTHA 4A4EA 2DAQA 3ER0A 4XTYA 4F7UG 1M5Q1 5FU7B 2R5AA 3CCEA 2QA4A 1U8RA 2C06A 1R8OB 1TH7A 4JS5A 3CCUA 3RMSA 3CD6A 5D6YA 3VU3C 1FXXA 1NZ9A 4N0AC 2EFIA 3JCMV 3UDCA 4C92B 3HRUA 1LJOA 2RB6A 2DO3A 1S72A 4LDYA 1WJQA 1VQ8T 3OS5A 1K9MU 4JLIA 2D6FA 2DZCA 3QJ6A 4C0GA 2B8AA 3A8HB 3OQ5A 3CCST 2RI2A 2MAMA 2PVGB 4NL2A 5GAMd 1WQ7A 2CKKA 4FIBA 2X4WA 2ZCFB 4XU0A 4C0FA 1M4ZA 2D0QB 2RJFA 4JUVA 4M78C 5A2QE 2EIFA 1ZHIA 3PTAA 2LNVA 2ZPEB 4M7AF 5CQYA 5DM7R 2WACA 2DTIA 3DLMA 3OYEA 3I55T 4M78A 1VQ8A 4C5GA 3X24B 1BI3A 3RMQA 2BIVA 5I2SA 2RJCA 4M75F 1UGQB 3CCMT 5A0GA 1K8AU 3HFNA 4ELZC 1JBMA 1Q7YC 3LW5E 2VGMA 3OA6A 1Q86U 3GLXA 3CCQT 2EWNA 3CPWS 2XDPA 2CYZB 4A54A 5GANj 1M90C 4M7DF 3CMET 1YIJT 2FVUA 4ZTJA 4LDVA 1Q82U 4JJNK 2XDBA 2BKDN 4OB0B 3I55A 2D9TA 2LCCA 2RJDA 3C94A 2E70A 5J26A 4MZTA 4FT2A 5CKFA 4M78E 3FB9A 5L8RE 4DQ2A 2L8DA 3CXCS 4XTZA 3OYMA 3JCMJ 3AHUA 4M7DB 3CCQA 3O8VA 4M78G 5CKEA 4MMKA 5GAN4 2L3RA 3HHTB 2RJEA 4IUUA 3VUZA 3L2QA 3CMEA 1YIJA 4Z02A 3CC2T 5KH6A 3MHXA 4F7UF 3L42A 4C0DB 1QVFA 2RHIA 2L89A 2EAYA 5GMKm 1VQ9T 2Y4XA 2GQVA 3HP9A 4A4GA 1PSFA 1K9MC 2EQKA 5FRNA 2P0PA 2FHDA 3JCMg 5KE3A 4HCCA 3M4GA 1VUBA 4C5EA 2R5MA 2RI3A 4XU3A 4F7UB 3E9GA 4ZN1A 4BE0A 3CC2A 1JRIA 4IUPA 5GAN3 3P8HA 4XU1A 3OYJA 4Q5WA 1VQ9A 3HPWA 5HK3A 5EG2A 5A0LA 3JB9J 3M53A 1BI1A 3JCMe 5CKBA 3JCMQ 4PJOC 4C0DC 1BIAA 3C95A 4JRKA 4RKUE 4EDUA 5LJ5g 5LJ3g 3J80E 4E7KA 1KQSA 2F5TX 1IZ6A 4PJOA 2YLBA 2DD4A 3T9NA 1QVGA 2R57A 2DTOA 2RM4A 3ASKA 4C8QD 5C6SA 3OS2A 2DPPB 3M57A 3DB3A 1X6OA 3JRZA 3R6OA 3QBYA 1VQ7A 3QZ5B 3VYGA 4C8QA 2CZ0B 4EMKA 2P0QA 4MZMA 3MP1A 3QZ9B 3JCMh 3JCMP 3BDLA 2YRVA 1NE8A 2V8KA 5IT9E 1VQKT 3MO8A 1QP2A 5LJ3e 2KK4A 3BW1A 1VQPT 2QQSA 5GANd 5FROA 1M8VA 4PNOA 2FL7A 2ZPFB 1N8RU 1W4SA 2DIGA 5IAYA 2LQ8A 3ME9A 2LC4A 1YITT 2OTLT 2LT4A 2RD1A 2GCXA 2EQUA 3OMCA 5CQXA 5D6XA 2O01E 3RESA 4XAXB 4NL3A 4PJOE 2MF2A 2LRQA 3MEAA 3N5BB 2KQWA 1OZ2A 3OYHA 3DKMA 4M78F 1Y07A 2E10A 4PJOG 2ZPHB 1VQKA 5LJ5h 4XTXA 5LJ3h 4C8QE 1I5LA 4J5YA 1VQLT 4J6YA 4J7FA 1YBYA 3PGGA 2XI9A 1BKBA 3NTIA 4NOYA 1OZ3A 1SSFA 2H3JA 3JSCA 5GAMh 3FC3A 4JS4A 1VQ6T 1IREB 1B34A 1G3TA 4JDSA 2E6ZA 2LDMA 3JB9G 4M78B 2FYKA 5CAIA 2EJGA 2RHUA 3META 4JRQA 4LDWA 5HK0A 4OGEA 2RHXA 3GPLA 1MGQA 1D3BA 3TEEA 2KDSA 2OAUA 1VQLA 2KMTA 2ZPBB 3OYCA 5GAOn 3FIFA 4JRPA 3QXEB 3G4ST 1VQ5A 5I2MA 5D6WA 1VQ6A 3ZBDA 1W2BS 3VV0A 3CPWA 2FB7A 4PLLA 2E5QA 3A8OB 3FJPA 2MWPA 1M1KC 5GAN2 1ZBXA 3JCMf 2GFUA 4FM4B 1X75C 2G3RA 1XQHA 2QQBA 2RK2A 4M77D 5KE2A 2DD5A 4HCBA 4BE1A 1I8FA 2DZ9A 3PNWC 4OP0A 5CKHA 4M77A 3G4SA 1G3YA 2CZ1B 3M55A 3V7RA 2XIDA 3PT9A 4NS5A 3QIIA 2JUFA 5I21A 3CCLT 4MDWA 4BD3A 4LD9K 2DK3A 2PUOB 2EKOA 5GAOq 3CCSA 3SD4A 4II1A 5LJ5f 5LJ3f 3LWHA 5AYFA 2RI5A 2K3YA 1BI2A 3L2RA 3M59A 3PIPA 3X28B 3OS1A 1LNXA 1WQWA 3SB2A 2Y4YA 3L2ZA 3FEOA 4J7IA 4QVDA 1G5VA 2EJFA 4M77E 3A5ZB 2K57A 2QQRA 3OBWA 2DKGA 4PJOF 3CCJT 3CCLA 4ZN3A 1Y7XA 4L5GA 3M56A 3LWIA 3BDUA 3SWNA 3FLGA 3CCMA 1NJIC 1HXDA 5GAN7 3HRTA 3URGA 3GF5A 1YJ9T 4C5IA 2O4XA 5FRMA 4XTUA 4XTVA 3QO3A 3H6ZA 1P92A 3OB9A 2M1HA 2QQ9A 4QW2A 2XKOC 2K5LA 1LOJA 3A8MB 3MEVA 1HK9A 3OYIA 3JB9F 4PJOB 2DJZA 3JB9H 4QQDA 5CCAA 4KT0E 2HBPA 2HQXA 5J3BA 4E7LA 2YHTA 1Y96A 1KG1A 4B9WA 4XU2A 5GMKh 1UB4A 3CCJA 3QSUA 3OW2S 3CD6T 5CIUA 1H3ZA 3J7AF 4C8QB 2K4YA 4EMKB 2RK1A 4HCZA 4BI4A 4PL6A 2CZ6B 4DA4A 1YJ9A 1YI2T 2HD0A 2L5QA 3TCJA 2DVEA 1BYMA 2M9UA 3NTKA 3JCMX 3VKIA 3L2VA 2XDDA 3GNFB 3WXMB 1RI0A 2DXTA 2I2LA 2A3LA 2OTJT 2LT1A 4EPCA 4A4FA 1Q81U 2GF7A 1M9SA 2CS7A 2ZPIB 3SDZA 4KUIA 3G71T 4GLKA 4ZTFA 1KC8U 1KQ2A 2LCLA 2QXFA 4ELYC 1NPRA 4OGCA 1K8AC 4BDYA 3EFRA 3JCMW 2E64A 3S3OA 1VIEA 1Q86C 4M7AD 2DXCA 4C8QC 2RHYA 4EMKC 5CVIA 3MP6A 2OTJA 4M7AA 1B34B 5GAOr 5GAMg 4JRIA 4M75D 3I56T 1Q82C 1N6AA 2EQMA 1N9SA 2K5FA 4KULA 4QVZA 3LLRA 3L2WA 4M75A 1QW1A 2KVQG 3A8LB 3PMTA 4RMOA 1UGPB 1JB0E 3FRNA 3JCMb 1JJ2A 4XQ3A 3QYGB 3X25B 1D3BB 5LJ5j 5DLOA 5LJ3j 2NLUA 4VUBA 3A8GB 5LJ5e 3QPHA 4M7DD 3HSBA 4O5VA 4C0ZA 1FX7A 1O9SA 4M7DA 4HT8A 2K5IA 4JLGA 1XOVA 2X4YA 3CBPA 2CZ7B 4EMGA 3G7ZA 5GAMe 5GAMj 1NPPA 3UWNA 4X9DA 1UGRB 5GAN6 2HNIA 4RG2A 3M54A 3JAME 5CO7A 3LGFA 3I56A 4MMLA 3NFCA 3QJYA 4GY5A 1WNLA 2VC8A 1W2BA 2ZPGB 3MEUA 4M7AE 3OYGA 3GIBA 2X4XA 4HA8A 2P4TA 1VQPA 1MHNA 4OF1A 4M75E 4MZPA 4M77B 4RG8A 3X26B 2KY9A 2V8JA 2VXFA 3TU4K 4OMFB 4C8QG 2M16A 4KBMB 4UC4A 1YITA 2OTLA 3OBYA 3VJPA 2F69A 4BI8B 2E6NA 4ZGDB 4J6XA 4D6WA 4IKFA 1VIFA 4M7DE 4Y91A 4BY6C 4KUDK 4QVCA 3M5AA 5FU6C 2YLCA 4IUVA 1VQNT 5GAOl 4IURA 4IUQA 1Q7YU 3EFSA 3HL8A 3QKJA 1BI0A 3PMIA 2WSCE 3LGLA 2VGNA 3OYDA 3QYHB 5M9OA 1M90U 1PSEA 2LVMA 2JZ2A 1VQMT 3SFMA 4OVAA 2XU8A 4BE2A 3S3NA 4LDUA 2MMPA 2RH2A 5DLQE 1YCYA 1WJRA 2QQAA 2IVWA 3INZA 4HKEA 4J83A 3JCMd 3KXTA 4M77C 4BACA 1S72T 2LTOA 2XG8D 3C12A 1VQNA 2MWOA 2WSFE 4N4GA 2O4XB 3CCRT 3QG1A 2Y90A 3QHSA 4XTWA 4LDXA 2QDYB 4O6JA 5GAOp 3L2UA 3CXCA 1VQMA 2WSEE 3V8KA 2XICA 4A53A 1WGSA 2HAXA 1Y96B 2K3XA 3OYKA 1N8RC 4J8OA 2PQWA 4N0AA 3UPUA 3RKWA 1G3WA 2JOYA 2ZZDA 5GAN5 2VUBA 5LJ5d 5LJ3d 5DY9A 2E41A 3CCRA 4DOVA 1EIFA 4IUTA 2JVVA 3LYIA 3TREA 3OW2A 1OYXA 4X9CA 1QP3A 1H641 4QQ6A 5GAMf 2K2VA 2ZGWA 3EAEA 3S3MA 3CCVT 3SWNC 3C4SA 3V7SA 3JCMc 1KQ1A 2PVDB 5GMKe 2E1HA 5GMKj 4M78D 4ZGEB 3HRSA 5GANg 4M77G 1I81A 5FU7C 4X34A 4RCCA 2M0OA 3GP8A 1DJ7B 2JTFA 2LQKA 2RHZA 4C8QF 3OYAA 2PUKB 1YJNT 3P8DA 1K73U 4OB3B 2JNGA 3LX7A 2XD0A 4CRIA 3F70A 3QDRB 4C92C 5FLXE 2AHJB 3E9FA 1BIBA 2IG0A 3P8BB 4OB2B 3FDRA 4C92D 3CCVA 5CK9A 3GNGA 2DXUA 5GANe 1M1FA 4FL6A 4M7AB 2JN0A 4WF2A 2GFAA 4C92A 2PVOB 2HQEA 1U1TA 2VYTA 4P5NA 4BUGA 1AHJB 4N4IA 2LX9A 4OB1B 2DXBA 2X4JA 4E7JA 4N4HA 4M75B 4A4KA 3KUFA 4MDXA 4J6WA 1YJNA 1FWZA 5C0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PMT A;  2RJF A;  2LDM A;  1N27 A;  3MP8 A;  2RHU A;  3MET A;  2NLU A;  3UT1 A;  2WAC A;  2RHX A;  3DLM A;  3OYE A;  3M9Q A;  4C5G A;  2R58 A;  2X4Y A;  2BIV A;  2RJC A;  3OYC A;  3UWN A;  1KHC A;  4RG2 A;  3LGF A;  5D6W A;  4E7I A;  2XK0 A;  3OA6 A;  4GY5 A;  5J39 A;  5IN1 A;  2XDP A;  3MEU A;  3PFS A;  3OYG A;  3CEY A;  2E5Q A;  4PLL A;  4ZTJ A;  2MWP A;  2X4X A;  2BKD N;  1MHN A;  2GFU A;  2G3R A;  4QQG A;  3L2W A;  2P0K A;  4LD6 A;  2D9T A;  3OY9 A;  2RJD A;  2LCC A;  2M16 A;  5J26 A;  2RO0 A;  5KE2 A;  4UC4 A;  3MEW A;  3PNW C;  4BE1 A;  5KCO A;  4B9X A;  2E6N A;  4IKF A;  4PLI A;  2L8D A;  3OYN A;  4E7H A;  3OYM A;  1WJS A;  3S6W A;  3O8V A;  4IUV A;  3OYL A;  2L3R A;  4IUU A;  2RJE A;  4NS5 A;  3QII A;  4IUR A;  3OYF A;  4IUQ A;  3L2Q A;  3QKJ A;  4Z02 A;  5KH6 A;  4BD3 A;  3PMI A;  5KCH A;  4BDZ A;  3L42 A;  2EKO A;  2L89 A;  2RHI A;  3OYB A;  3SD4 A;  4II1 A;  3Q1J A;  3LGL A;  3OYD A;  5M9O A;  2LVM A;  3DB4 A;  4L59 A;  2JZ2 A;  4A4G A;  2RI5 A;  2K3Y A;  3L2R A;  4OVA A;  3LH0 A;  3GOX A;  3OS1 A;  2EQK A;  4BE2 A;  3S3N A;  5FRN A;  2FHD A;  4A4H A;  5KE3 A;  4C5E A;  2R5M A;  1WJR A;  3FEO A;  4BAC A;  2RI3 A;  1G5V A;  1XNI A;  2QQR A;  2LTO A;  3NTH A;  3E9G A;  3OS0 A;  2MWO A;  4N4G A;  2O4X B;  2X35 A;  4BE0 A;  2BUD A;  3FLG A;  3H8Z A;  4IUP A;  3P8H A;  3OMG A;  4Q5W A;  3OYJ A;  2DIQ A;  2EQJ A;  4C5I A;  2O4X A;  5FRM A;  3L2U A;  3H6Z A;  3OB9 A;  1WGS A;  2M1H A;  4QW2 A;  2K3X A;  3OYK A;  3MEV A;  3OYI A;  3ZEH A;  2PQW A;  4C5H A;  4QQD A;  1OI1 A;  2HQX A;  4E7L A;  4EDU A;  4E7K A;  4B9W A;  5CIU A;  1H3Z A;  4FU6 A;  2F5K A;  2R57 A;  3LYI A;  3ASK A;  4HCZ A;  4IUT A;  4PL6 A;  1OYX A;  5C6S A;  3DB3 A;  3OS2 A;  3QBY A;  4QQ6 A;  5C0M A;  3EAE A;  3S3M A;  3MP1 A;  3C4S A;  3NTK A;  3BDL A;  3L2V A;  2YRV A;  3MO8 A;  1RI0 A;  2DAQ A;  4A4E A;  2QQS A;  2R5A A;  4X34 A;  5FRO A;  4A4F A;  2M0O A;  2GF7 A;  2RHZ A;  2JTF A;  3OYA A;  5IAY A;  2DIG A;  3P8D A;  4ZTF A;  3ME9 A;  5D6Y A;  3LX7 A;  3OMC A;  2EFI A;  2EQU A;  5D6X A;  3F70 A;  4CRI A;  2LRQ A;  3E9F A;  2IG0 A;  3MEA A;  3FDR A;  1OZ2 A;  4BDY A;  3OYH A;  1WJQ A;  4FL6 A;  3S3O A;  2GFA A;  2HQE A;  2VYT A;  3QJ6 A;  4N4I A;  2RHY A;  4E7J A;  2B8A A;  3MP6 A;  3OQ5 A;  4N4H A;  3KUF A;  2RI2 A;  3NTI A;  1OZ3 A;  1SSF A;  2EQM A;  4QVZ A;  2CKK A;  3FC3 A;  2X4W A;  3LLR A; 
#chains in the Genus database with same CATH topology
 3RDV A;  3J81 E;  2LCS A;  1WPY A;  2YRD A;  3CC7 T;  3L1A A;  1QVP A;  2FRY A;  2CSI A;  4HT9 A;  1NEB A;  1E6H A;  1XTD A;  2J6F A;  4AFZ C;  2B86 A;  4R55 A;  4DOW A;  4ATO A;  3BY7 A;  3WVD B;  1YHQ T;  2P0K A;  1IHW A;  2KSS A;  5GMK i;  1NYF A;  1UFF A;  3RNJ A;  3OYN A;  4M7D C;  4E7H A;  1Q81 R;  3CC4 T;  1WJS A;  2DEQ A;  4FW2 A;  3S6W A;  2JTM A;  5FU6 B;  1TUD A;  1T3S A;  1K73 C;  4M77 F;  1Y57 A;  4BDZ A;  4PJO D;  3WVE B;  1KSW A;  5L23 A;  5GMK l;  3DB4 A;  2DL4 A;  4EMH A;  4KGX B;  1G3S A;  2V1Q A;  1IO6 A;  1OPL A;  4BB7 A;  1XNI A;  1RAG B;  3NTH A;  3OS0 A;  1HYO A;  2KRN A;  2MYS A;  2DRK A;  2X3W D;  1OEB A;  1UG1 A;  1UGS B;  1N9R A;  4F16 A;  1RL2 A;  1PRM C;  1ZQ1 A;  2A7Y A;  4FCY A;  4FW1 A;  4L6V 5;  5HY6 A;  1VQO A;  3D7S B;  3RUX A;  1V29 B;  3M4Y A;  4F7U E;  3VUB A;  1K76 A;  5CR2 A;  1JJ2 S;  3G6E A;  4ME7 A;  5FU7 B;  3CCE A;  2LJ1 A;  1WLP B;  1FXX A;  2EFI A;  3HRU A;  1LJO A;  2JM9 A;  2RB6 A;  4HXJ A;  4LUD A;  1M2V A;  1M90 R;  3OS5 A;  2L0A A;  2DER A;  3O5Z A;  4C0G A;  2B8A A;  2DL7 A;  1WXT A;  4KGZ B;  4XU0 A;  3CCR Q;  1VYV A;  2LNV A;  2VWF A;  2WAC A;  2AKK A;  3I55 T;  3X24 B;  5I2S A;  1QCO A;  3H0F A;  3IQL A;  4F17 A;  3CPW S;  2XDP A;  2CYZ B;  3H0I A;  5GAN j;  4M7D F;  4OMP A;  2YUO A;  4LDV A;  2XDB A;  1VOM A;  4OB0 B;  1D09 B;  2ENM A;  1K9A A;  2RJD A;  2E70 A;  5J26 A;  4HCK A;  4Y92 A;  1OU8 A;  5FWB A;  4PK4 A;  2YUP A;  3O8V A;  5GAN 4;  4MMK A;  1YIJ A;  4C0D B;  1KFZ A;  2BE9 B;  2EAY A;  2KRS A;  2K6D A;  3VS3 A;  2P0P A;  2FHD A;  3JCM g;  5KE3 A;  3M4G A;  1TXQ A;  1VUB A;  1WZO A;  1D1C A;  2YUN A;  2K3B A;  1JRI A;  5GAN 3;  4XU1 A;  3OYJ A;  1R77 A;  1VQ9 A;  2D8J A;  5HK3 A;  5EG2 A;  3JCM e;  3ULR B;  3CC7 Q;  2NUT B;  2GQI A;  1MV3 A;  5LJ5 g;  5LJ3 g;  4PJO A;  1QQJ A;  5C6S A;  2EQI A;  3OS2 A;  3R6O A;  2H8H A;  2KRM A;  2KYB A;  1VQ7 A;  2KXC A;  4MZM A;  4K11 A;  3BDL A;  1VQK T;  3THK A;  5LJ3 e;  1VQP T;  2ZPF B;  1UGV A;  3CC4 Q;  3ME9 A;  2LC4 A;  2KGT A;  2NUP A;  2RD1 A;  2GCX A;  1M2V B;  3PE0 A;  5D6X A;  2O01 E;  2MF2 A;  1M8M A;  1OZ2 A;  3DKM A;  4PJO G;  1GRI A;  4C8Q E;  4J6Y A;  2LMJ A;  3NTI A;  2P4R A;  2ESW A;  1WI7 A;  2EJG A;  4LDW A;  1KK7 A;  1D3B A;  2OAU A;  2ZPB B;  4JRP A;  3CQT A;  3G4S T;  5I2M A;  3ZBD A;  1VA7 A;  4RTT A;  1GBR A;  3VV0 A;  2MWP A;  1RAC B;  3JCM f;  1KIK A;  2E3I A;  1X75 C;  1XQH A;  2RK2 A;  4DBF A;  1AT1 B;  5CKH A;  1G3Y A;  2CZ1 B;  4AT1 B;  1U5S A;  4D8K A;  4MDW A;  4GBQ A;  4LD9 K;  4WCI A;  5LJ5 f;  5LJ3 f;  2C0O A;  3LWH A;  2QYZ A;  3NHN A;  5AYF A;  1K9M R;  3OS1 A;  3SB2 A;  1J3T A;  4QVD A;  2A0F B;  4ZN3 A;  1E6G A;  4L5G A;  3BDU A;  3SWN A;  1WXB A;  3C0C A;  4QKU A;  8ATC B;  3QO3 A;  3I55 Q;  1P92 A;  2M1H A;  3JB9 F;  4PJO B;  4F14 A;  1JXM A;  1U06 A;  4QQD A;  4KT0 E;  2HBP A;  5J3B A;  4E7L A;  1Q86 R;  1UB4 A;  3OW2 S;  1R0B G;  1EFN A;  3J7A F;  4HCZ A;  1Q82 R;  4DA4 A;  1GBQ A;  4DEY A;  3L2V A;  2XDD A;  4E7S A;  3EG9 A;  1M3C A;  1NLO C;  2ZPI B;  2CS7 A;  1TG0 A;  3G71 T;  2QK0 A;  2J7I A;  2LCL A;  1GFC A;  1QVF P;  2AT1 B;  4JZ4 A;  1G8X A;  1RLQ C;  3S3O A;  1VIE A;  4M7A D;  4C8Q C;  2FZK B;  4EMK C;  4JRI A;  1N6A A;  4M75 A;  4AMC A;  1JJ2 A;  3JCM b;  1D3B B;  5KYN A;  3A8G B;  1FX7 A;  2HL5 C;  2AZS A;  2HZY A;  4EMG A;  3M0T A;  4LNP A;  1PM3 A;  4RG2 A;  4IIM A;  3NFC A;  4MML A;  1QVG P;  2EYX A;  1MMA A;  4KGV B;  1TSF A;  1T0J A;  4HVV A;  2VVK A;  4UC4 A;  2RNA A;  3VJP A;  4DBH A;  2F69 A;  1VQP Q;  2JW4 A;  4KH0 B;  4AFU C;  4PFO A;  5FU6 C;  3FJ5 A;  4JJB A;  3EFS A;  3HL8 A;  1X6B A;  1C6V X;  1TS9 A;  1WDX A;  4ESR A;  3QYH B;  5M9O A;  3UAT A;  2JZ2 A;  1UTI A;  2J6O A;  2XU8 A;  4BE2 A;  1WHG A;  1S72 T;  4HKE A;  2EBP A;  2YWW A;  2JMA A;  1OUL A;  4XTW A;  4O6J A;  2J6K A;  5GAO p;  1AVZ C;  2XIC A;  1WGS A;  4QT7 A;  3NMZ C;  4N0A A;  3G4S Q;  3UPU A;  3RKW A;  2JOY A;  1K0X A;  2ZZD A;  2K79 A;  5GAN 5;  3CCR A;  4DOV A;  3LYI A;  1OYX A;  1FMV A;  3V7S A;  1H8K A;  3EG9 B;  2PVD B;  1W1F A;  1YWO A;  4M78 D;  5FU7 C;  1AOJ A;  4X34 A;  2FO0 A;  2RHZ A;  4C8Q F;  3P8D A;  1K73 U;  4OB3 B;  1PWT A;  3F70 A;  2GBQ A;  3E9F A;  1BIB A;  2IG0 A;  2DXU A;  4FL6 A;  2CRE A;  4C92 A;  2VYT A;  1AHJ B;  1ZUY A;  4N4I A;  2DXB A;  4M75 B;  3KUF A;  1FWZ A;  4XK8 E;  2DET A;  3KBG A;  1X01 A;  3MP8 A;  2ABL A;  3UT1 A;  5LL6 S;  3RKX A;  1W6X A;  1QLY A;  1I4K 1;  1YFN A;  2FZC B;  2KAF A;  1KHC A;  2HEQ A;  1YI2 A;  4E7I A;  2XK0 A;  3RKY A;  5IN1 A;  4C92 G;  1IRX A;  4CI0 C;  3NPF A;  5FWC A;  4QQG A;  3CC7 A;  3JB9 H;  1O75 A;  5GAO m;  3HFO A;  1KC8 R;  3G71 Q;  1YHQ A;  1UJ0 A;  3AT1 B;  3LH0 A;  3PIO A;  2RQT A;  2V8I A;  3OYY A;  3CC4 A;  4M7A G;  2QDL A;  5KYU B;  3M58 A;  3V8J A;  2BUD A;  3VYH B;  1AZG B;  3H8Z A;  2NYS A;  3OMG A;  2DIQ A;  1I1J A;  1V76 A;  1AD5 A;  4J9D A;  1AWW A;  4TVR A;  3ZL7 C;  5KYW A;  2DL8 A;  1C1A A;  1AEY A;  4C5H A;  2RA2 A;  2EJ9 A;  3HTR A;  5CKD A;  5IH2 A;  1W2B P;  2SEM A;  4FU6 A;  2BE7 D;  3CD6 T;  4RCB A;  5A0D A;  2MPX C;  2FG0 A;  1NJI U;  2C0T A;  2DTH A;  3EG3 A;  1RAE B;  1U8R A;  2C06 A;  2FPD A;  1R8O B;  4JS5 A;  2BZX A;  1ARK A;  3G1J A;  3RMS A;  2VAS A;  4B6M A;  4C92 B;  2QA4 Q;  1WJQ A;  1VQ8 T;  5EC7 A;  2D6F A;  2DZC A;  3CCS T;  4OML A;  2MAM A;  2CKK A;  1S72 Q;  1QWF A;  1W70 A;  2D0Q B;  1ZHI A;  2DL5 A;  1TOV A;  4M78 A;  1QKW A;  4C5G A;  1WFW A;  1BI3 A;  2RJC A;  3CCM T;  1UGQ B;  5A0G A;  4ELZ C;  1JBM A;  1GFD A;  1HJD A;  3OA6 A;  2EWN A;  1M27 C;  1SSH A;  3CME T;  4Z88 A;  1QCF A;  3I55 A;  1BB9 A;  2VKN A;  5CKF A;  1OOT A;  3FB9 A;  3CXC S;  1GCQ C;  3AHU A;  3OYM A;  4PJL A;  4M78 G;  5CKE A;  5KH6 A;  1ABQ A;  2RHI A;  5GMK m;  1IHV A;  4Z89 A;  1B3Q A;  3HP9 A;  1K9M C;  2EQK A;  2M51 A;  2ED1 A;  4C5E A;  4JPB W;  4XU3 A;  2HKN A;  1UE9 A;  2CUD A;  4ZN1 A;  4BE0 A;  4IUP A;  2JS0 A;  1KD1 R;  1HSQ A;  3EGD A;  1RI9 A;  3HPW A;  5KYW B;  3JB9 J;  2DEU A;  3M53 A;  5CKB A;  4HVW A;  4RTX A;  4PJO C;  4RKU E;  4JRK A;  4EDU A;  3J80 E;  1KQS A;  1IZ6 A;  4FSS A;  3M0U A;  1X6O A;  3QZ5 B;  4RTW A;  1RAF B;  2P0Q A;  3QZ9 B;  3JCM P;  2OI3 A;  2YRV A;  1NE8 A;  5IT9 E;  3BW1 A;  3VS4 A;  1ZSZ C;  2DE0 X;  2OTL T;  2LT4 A;  2EQU A;  4NL3 A;  5CQX A;  2RQR A;  1WHK A;  4XAX B;  2BTT A;  9ATC B;  2EGA A;  3N5B B;  2ED0 A;  1G2B A;  1NLP C;  4PJJ A;  1M1K R;  2ZPH B;  1VQK A;  4XTX A;  4J5Y A;  1MV0 B;  1BKB A;  1OZ3 A;  1SSF A;  2H3J A;  3FC3 A;  5GAM h;  1VQ6 T;  1WIE A;  2LDM A;  4M78 B;  2FYK A;  5CAI A;  2RHX A;  3TEE A;  2KMT A;  3OYC A;  1VQ5 A;  3FIF A;  3QXE B;  2K9G A;  1Q7Y R;  4LN2 A;  2EYZ A;  2J06 A;  2CT3 A;  2LQN A;  2E5Q A;  3A8O B;  1ZBX A;  3CD6 Q;  4FM4 B;  2COW A;  3M0R A;  2DD5 A;  4BE1 A;  1I8F A;  2DZ9 A;  4OP0 A;  4M77 A;  3G4S A;  4CC2 A;  1G83 A;  5I21 A;  3CCL T;  2JUF A;  3H0H A;  2DK3 A;  2PUO B;  2HMA A;  1ZA1 B;  2DFU A;  1YNZ A;  4II1 A;  2LNH B;  1V1C A;  2K3Y A;  1BI2 A;  5ECA A;  3L2R A;  1VQ8 Q;  3PIP A;  3X28 B;  1PG5 B;  4J9B A;  3L2Z A;  1TTH B;  4M4Z A;  4AG1 C;  4J7I A;  1G5V A;  3A5Z B;  2K57 A;  3CCS Q;  4PJO F;  3CCJ T;  2FRW A;  1Y7X A;  3EGD B;  1NJI C;  3FLG A;  1HXD A;  1X27 A;  2COZ A;  3HRT A;  3GF5 A;  1YJ9 T;  4C5I A;  5FRM A;  4RTU A;  4XTV A;  2LJ3 A;  3OB9 A;  2QQ9 A;  3MEV A;  1HK9 A;  5FW9 A;  2JT4 A;  1ZUK A;  3CCM Q;  2HQX A;  1Y96 A;  1KG1 A;  4B9W A;  2EVR A;  5GMK h;  2F1L A;  2RN8 A;  5CIU A;  2CZ6 B;  3CME Q;  4CC3 A;  2CP3 A;  2DVE A;  2V1R A;  1BYM A;  2M9U A;  1BCO A;  2M0Y A;  3VKI A;  4FYV B;  3RR6 A;  2DNU A;  3WXM B;  2DXT A;  3EG1 A;  1XJW B;  5KYX A;  4EPC A;  4A4F A;  1Q81 U;  3A98 A;  2GF7 A;  1M9S A;  3SDZ A;  1RAD B;  2CH4 A;  1KQ2 A;  2QXF A;  1H92 A;  4LUE A;  2A37 A;  1AWX A;  2OX7 A;  3JCM W;  2BZY A;  1SKU B;  2DXC A;  2RHY A;  3MP6 A;  4M75 D;  3I56 T;  1MMD A;  1N9S A;  3L2W A;  2EW3 A;  3A8L B;  2KVQ G;  3FRN A;  3QYG B;  5LJ5 e;  5LJ5 j;  1QMC A;  5LJ3 j;  4O5V A;  1NG2 A;  4M7D A;  4JLG A;  1X2K A;  3CBP A;  3GIB A;  4X9D A;  1UGR B;  5GAN 6;  3M54 A;  2X9H A;  2NUZ A;  3I5S A;  2ZPG B;  1SG5 A;  3MEU A;  4M7A E;  3M0P A;  4OF1 A;  4M77 B;  3X26 B;  2KY9 A;  4KBM B;  2MK5 A;  2E4H A;  1YIT A;  3OBY A;  4ZGD B;  1AZE A;  2E6N A;  2DBM A;  4QVC A;  1HD3 A;  3M5A A;  2YLC A;  1N8R R;  4RUG A;  4IUR A;  2DYI A;  1Q7Y U;  3PMI A;  2OTL Q;  2WSC E;  1M90 U;  2LVM A;  3EFO A;  3SFM A;  4OVA A;  2DX1 A;  3S3N A;  1WHJ A;  1YCY A;  2QQA A;  3KXT A;  2IVW A;  2GNC A;  2WSF E;  2LP5 A;  1VQ6 Q;  1YCS B;  3QG1 A;  4DEX A;  2DMO A;  2CP2 A;  3CXC A;  3MKD A;  3TVT A;  2HAX A;  1Y96 B;  2K3X A;  1TU0 B;  2A08 A;  3MJX A;  2GTJ A;  5DY9 A;  3CPW P;  1EIF A;  1PNJ A;  3QWX X;  4QQ6 A;  2DA9 A;  3CCV T;  5KYX B;  2CP7 A;  2E5K A;  4RTY A;  3HRS A;  4RCC A;  1DJ7 B;  2JTF A;  1AWO A;  2I0N A;  1SHG A;  3LX7 A;  3CCL Q;  4C92 C;  5FLX E;  2AHJ B;  4C92 D;  4OB2 B;  3FDR A;  5CK9 A;  2JN0 A;  2HQE A;  4P5N A;  2LX9 A;  4OB1 B;  4E7J A;  2A28 A;  4J6W A;  5C0M A;  3EH1 A;  4BI3 A;  3EG2 A;  3CCJ Q;  4PFZ A;  1FYN A;  4YTL A;  5GAN h;  2NUP B;  3M9Q A;  3QUI A;  1YJ9 Q;  2R58 A;  1NEG A;  1VQ4 T;  2VXE A;  2HBW A;  2QEX T;  2E65 A;  1A0N B;  1CSK A;  4M7A C;  1OPK A;  3PFS A;  4RTV A;  3V8L A;  2LQW A;  1GL5 A;  3MCA B;  1UUE A;  4JJC A;  3H41 A;  2QI2 A;  2P84 A;  3RER A;  2HDA A;  2MOX A;  2RO0 A;  5KCO A;  3RIR A;  2J05 A;  2H3E B;  4B9X A;  3JB9 I;  1VQ7 T;  4PKC C;  4PLI A;  4BY6 B;  3CMA T;  1YJW T;  3OYF A;  1UEB A;  2BZ8 A;  5KCH A;  3EFO B;  3OYB A;  4L59 A;  1M1G A;  3GOX A;  2QGF B;  3I5R A;  2K7A A;  3LH5 A;  2EYQ A;  3I56 Q;  2O88 A;  3VS2 A;  2X35 A;  1GXI E;  4M75 G;  4F7U A;  4PJM A;  1KHI A;  4OMM A;  1OX8 A;  2EQJ A;  1KD1 C;  2COY A;  3NGP A;  1Q81 C;  2F2X A;  1T3L A;  3ZEH A;  2KI7 A;  1KQS S;  1ZX6 A;  2E12 A;  2QA4 T;  3CCU T;  1Y71 A;  1WHM A;  2MI6 A;  1RUW A;  5GAN 8;  3X20 B;  3SWN B;  4C92 F;  2CP5 A;  2LJ0 A;  4A4E A;  4XTY A;  4F7U G;  1M5Q 1;  1Z9Q A;  2R5A A;  2KT8 A;  1TH7 A;  2LZ6 B;  3CD6 A;  5D6Y A;  4FYW B;  3UA6 A;  5AT1 B;  2QGG A;  1CKB A;  1K9M U;  3QJ6 A;  1D0X A;  2NWM A;  1N5Z A;  3PVL A;  2AKL A;  4NL2 A;  1WQ7 A;  2V26 A;  2ZCF B;  4C0F A;  1M4Z A;  2RJF A;  3PTA A;  4M78 C;  5A2Q E;  2EIF A;  3TQ7 P;  1IGQ A;  2ZPE B;  4M7A F;  2DTI A;  3DLM A;  1VQ8 A;  3RMQ A;  1LVK A;  2BIV A;  1Q7Y C;  2C0I A;  1Q86 U;  2EPD A;  3CCQ T;  3RBB B;  4A54 A;  3OW2 P;  2QTV A;  1M90 C;  2FVU A;  4ZTJ A;  2DJQ A;  1Q82 U;  1S1N A;  2BKD N;  1RAI B;  2D9T A;  2LCC A;  1LCK A;  4FT2 A;  3CCV Q;  5L8R E;  1OU9 A;  3JCM J;  1ABO A;  3HHT B;  4IUU A;  2RJE A;  3CME A;  3L2Q A;  3UA7 A;  3CC2 T;  5IHN A;  3MHX A;  2HSP A;  1QVF A;  1OQK A;  2Y4X A;  2F2W A;  2VB6 A;  3VRY A;  4A4G A;  5FRN A;  3E2U A;  4HCC A;  1NM7 A;  2R5M A;  2RI3 A;  1EX4 A;  4F7U B;  3E9G A;  5IXF A;  3JCM Q;  1VQ4 Q;  4C0D C;  1BIA A;  1BCM A;  2QEX Q;  2DD4 A;  2DVJ A;  1QVG A;  2JTE A;  2R57 A;  2DTO A;  2RM4 A;  4HCB A;  2DPP B;  3M57 A;  3DB3 A;  1IGU A;  3VS0 A;  3VYG A;  1FMK A;  4C8Q A;  1H3H A;  4EMK A;  3MO8 A;  1QP2 A;  2KK4 A;  2QQS A;  5GAN d;  1M8V A;  2HQH A;  1VQ7 Q;  5IAY A;  2DIG A;  3CMA Q;  2LQ8 A;  1WXU A;  1RLP C;  1YJW Q;  4PJO E;  1M3B A;  2LRQ A;  1MMN A;  3MEA A;  1QKX A;  4M78 F;  4AFS C;  1K0S A;  1VQL T;  4J7F A;  2XI9 A;  1TUC A;  1X2Q A;  3JSC A;  4JS4 A;  2ZAE A;  1IRE B;  1G3T A;  4JDS A;  3REB B;  2RHU A;  3MET A;  3GPL A;  1MGQ A;  1MUZ A;  2KEA A;  1B07 A;  1VQ6 A;  1K4U S;  2O31 A;  3FJP A;  2DL3 A;  3CCU Q;  2GFU A;  2KXD A;  4M77 D;  5KE2 A;  6AT1 B;  2YDL A;  4A63 B;  4Z8A A;  3EGX A;  2PZ1 A;  3V7R A;  2XID A;  3PT9 A;  4BD3 A;  1UDL A;  3UF4 A;  2DM1 A;  2EKO A;  2FPE A;  5GAO q;  3SD4 A;  2SRC A;  1LNX A;  4AG2 C;  3OBW A;  2DKG A;  3CCL A;  4X1V A;  3VS5 A;  1X43 A;  5GAN 7;  2IIM A;  4XTU A;  4QW2 A;  2EGC A;  2XKO C;  2K5L A;  1LOJ A;  3A8M B;  3OYI A;  5CCA A;  4KH1 B;  2YHT A;  2YT6 A;  4XU2 A;  3CCJ A;  1H3Z A;  4LXC A;  2K4Y A;  4C8Q B;  4EMK B;  3CCQ Q;  4BI4 A;  2ECZ A;  4PL6 A;  3VRZ A;  4J9F A;  1YJ9 A;  1YI2 T;  2HD0 A;  2L5Q A;  3TCJ A;  3JCM X;  3GNF B;  2HKQ B;  1RI0 A;  2I2L A;  2OTJ T;  2JM8 A;  4KUI A;  2RQU A;  1KC8 U;  1NPR A;  3A1P A;  3CC2 Q;  2CP0 A;  3EFR A;  2E64 A;  1Q86 C;  2QAS A;  2RPN A;  5CVI A;  1AWJ A;  2L3Q A;  1Q82 C;  2EQM A;  2K5F A;  3LLR A;  4ANJ A;  2HSE B;  1JB0 E;  3X25 B;  4M7D D;  1E7O A;  3QPH A;  2JJ9 A;  3EHQ A;  2K5I A;  1XOV A;  2X4Y A;  3G7Z A;  4RTZ A;  1NPP A;  3UWN A;  3LGF A;  3I56 A;  2A36 A;  2HCK A;  1W2B A;  4DBR A;  3OYG A;  2X4X A;  4HA8 A;  2P4T A;  1KJW A;  1VQP A;  1MHN A;  4M75 E;  4MZP A;  4RG8 A;  3QDF A;  3TU4 K;  2M16 A;  3EGX B;  1UHC A;  2D1X A;  1RAA B;  4BI8 B;  4J6X A;  4IKF A;  2EKH A;  4BY6 C;  4KUD K;  2YXY A;  2DLP A;  2KT1 A;  1VQN T;  2RQV A;  4IUQ A;  1PD0 A;  4LE9 A;  1BI0 A;  2L3P A;  2NUT A;  1VYU A;  3OYD A;  2VGN A;  1PSE A;  4R0K A;  4F04 B;  1VQM T;  1PC0 A;  2MMP A;  1VQL Q;  1WJR A;  2L3S A;  3SHW A;  5I11 A;  2XG8 D;  2M02 A;  4N4G A;  2MWO A;  1PKS A;  2Y90 A;  3QHS A;  1Q95 G;  4LDX A;  2CSQ A;  3V8K A;  2ROT A;  3OYK A;  4PJN A;  4J8O A;  4PFP A;  2CUB A;  2PQW A;  3EHR A;  1G3W A;  2VUB A;  2X51 A;  4KRT A;  2JVV A;  3TRE A;  5GJW B;  1QP3 A;  2DYB A;  2K2V A;  3S3M A;  3SWN C;  3C4S A;  3JCM c;  5GAN g;  4M77 G;  1I81 A;  1OV3 A;  2D0N A;  3CXC P;  3GP8 A;  1YJN T;  4CC7 A;  2EYY A;  3VS7 A;  1K8A R;  4EIK A;  7AT1 B;  3CCV A;  3GNG A;  5GAN e;  1NYG A;  2RQW A;  3SEM A;  2PVO B;  2YUQ A;  2X4J A;  4J9I A;  4D8D A;  1ZA2 B;  1WX6 A;  3E1S A;  4ZGJ B;  1N27 A;  1KD1 U;  3CPF A;  1PKT A;  2LX7 A;  1GCQ A;  4Y28 E;  1WHH A;  1ACM B;  1CKA A;  4R56 A;  4C92 E;  5J39 A;  2RMO A;  3CEY A;  4GLM A;  2QTX A;  3ZFJ A;  4M75 C;  2CH4 W;  4LD6 A;  3OY9 A;  1YI2 Q;  3G71 A;  1VQ4 A;  3MEW A;  3V7C A;  2VV5 A;  3QWY A;  2QEX A;  3OSV A;  2O9S A;  2PNI A;  3OSS C;  3HKS A;  2OTJ Q;  2CGH A;  3OYL A;  3DLL A;  1QVF S;  1JXO A;  4WTO B;  3Q1J A;  4FSX A;  4J9H A;  2DRM A;  2CP6 A;  1M1K U;  3H9N A;  1SRL A;  3CBO A;  5HKC A;  1IB8 A;  4FT4 A;  4A4H A;  1NBE B;  3JV3 A;  3CMA A;  3E19 A;  2F2V A;  3JB9 D;  1YHQ Q;  1YJW A;  2KR3 A;  2XHC A;  1T0H A;  1MND A;  1JJ2 P;  5GAN f;  1VQO T;  3CBM A;  1B7T A;  2CDT A;  4V2S A;  1U1S A;  2PU9 B;  4M7D G;  1ZSZ A;  2FZG B;  3G6E T;  1KC8 C;  2DIL A;  1OI1 A;  3CCE T;  4HVU A;  1QVG S;  1VQ5 T;  4E47 A;  2F5K A;  2G6F X;  2IPO B;  1X69 A;  1FMW A;  3BE3 A;  5D7U A;  1SHF A;  1TWB A;  3BFM A;  2E3H A;  1D0Y A;  2K2M A;  1BBZ A;  2DAQ A;  3ER0 A;  2L2P A;  2QA4 A;  3CCU A;  1RAH B;  3VU3 C;  1NZ9 A;  4N0A C;  1VQN Q;  3JCM V;  3UDC A;  4OMN A;  2DO3 A;  1S72 A;  4LDY A;  5IXB A;  4JLI A;  1ZSG A;  4E6R A;  1VQM Q;  4FYY B;  3A8H B;  1M3A A;  2KNB B;  3OQ5 A;  2RI2 A;  1MMG A;  2PVG B;  5GAM d;  4FIB A;  2X4W A;  4JUV A;  2O2O A;  5CQY A;  5DM7 R;  3OYE A;  3I9Q A;  4M75 F;  1K8A U;  3HFN A;  2W0Z A;  3LW5 E;  2VGM A;  5GJV B;  1PD1 A;  3GLX A;  1I5O B;  1YIJ T;  2Z0W A;  4JJN K;  1UEC A;  3C94 A;  4FYX B;  4MZT A;  1ZUU A;  4M78 E;  4DQ2 A;  2L8D A;  2XMF A;  4XTZ A;  8AT1 B;  4M7D B;  1BU1 A;  3CCQ A;  4ORZ A;  2L3R A;  3VUZ A;  1K73 R;  1YJN Q;  4Z02 A;  1EZZ B;  1JO8 A;  4F7U F;  3L42 A;  2L89 A;  1VQ9 T;  3EH2 A;  2GQV A;  4J9E A;  1PSF A;  4E2F B;  2AIR B;  2OJ2 A;  1D0Z A;  2CT4 A;  2YSQ A;  4J9G A;  3CC2 A;  4AFQ C;  1X6G A;  3P8H A;  4Q5W A;  1ZSZ B;  5A0L A;  1VYT A;  1BI1 A;  2QAZ A;  3C95 A;  4E7K A;  4OMQ A;  2F5T X;  2YLB A;  3T9N A;  4C8Q D;  3ASK A;  3PVQ A;  1I07 A;  3JRZ A;  3QBY A;  2CZ0 B;  3MP1 A;  3JCM h;  2GGR A;  1Z9Z A;  2V8K A;  1SEM A;  5FRO A;  4PNO A;  2HL3 A;  2FL7 A;  1N8R U;  1W4S A;  1YIT T;  3OMC A;  3RES A;  2KQW A;  1UJY A;  3OYH A;  1Y07 A;  2E10 A;  5LJ5 h;  5LJ3 h;  1I5L A;  1PCX A;  1QCN A;  1YBY A;  3PGG A;  1MNE A;  4NOY A;  1WHL A;  1B34 A;  1LPL A;  2MCN A;  2E6Z A;  3JB9 G;  1VQK Q;  1Y0M A;  3VS1 A;  4JRQ A;  2D8H A;  5HK0 A;  1VQO Q;  4OGE A;  2AK5 A;  2KDS A;  5IHI A;  1VQL A;  5GAO n;  1WA7 A;  5D6W A;  3G6E Q;  1W2B S;  1IXD A;  3CCE Q;  3CPW A;  2FB7 A;  4PLL A;  4CC4 B;  2FEI A;  5GAN 2;  1M1K C;  1VQ5 Q;  2G3R A;  2EGE A;  2QQB A;  4IIO A;  1NJI R;  3PNW C;  2X3X D;  5KYU A;  2W10 A;  4ZNX A;  3M55 A;  4NS5 A;  3QII A;  1D1A A;  5HCK A;  3M0Q A;  1M2O A;  3CCS A;  2RI5 A;  3KFV A;  3M59 A;  1WQW A;  2Y4Y A;  3M0S A;  3FEO A;  4E7Z A;  1F1B B;  2EJF A;  4M77 E;  2QQR A;  2JMC A;  3M56 A;  1GCP A;  3LWI A;  3CCM A;  1JQQ A;  3EGU A;  3URG A;  2JXB A;  2O4X A;  3H6Z A;  2FPF A;  1ZBJ A;  2DJZ A;  1R0C B;  3QSU A;  3REA B;  2MIO A;  2RK1 A;  4JJD A;  1UHF A;  1YIJ Q;  1D1B A;  3R6N A;  3NTK A;  2A3L A;  2LT1 A;  1C0M A;  4GLK A;  4ZTF A;  5KYY A;  4ELY C;  4DBQ A;  3VS6 A;  4OGC A;  1K8A C;  4BDY A;  3TSZ A;  1VQ9 Q;  2OTJ A;  4M7A A;  1B34 B;  5GAO r;  5GAM g;  4KUL A;  4QVZ A;  1PHT A;  1QW1 A;  3PMT A;  4RMO A;  1UGP B;  1PRL C;  4XQ3 A;  5IHK A;  5DLO A;  2NLU A;  4VUB A;  3HSB A;  4C0Z A;  3U23 A;  1O9S A;  4HT8 A;  5GAM e;  2CZ7 B;  5GAM j;  1OX9 A;  1U3O A;  2HNI A;  3JAM E;  5CO7 A;  1ZLM A;  1KQS P;  3QJY A;  1SPK A;  4GY5 A;  1WNL A;  2VC8 A;  1YWP A;  2ROL A;  3TSW A;  2EYW A;  5I22 A;  4OMO A;  2VXF A;  1SF9 A;  2V8J A;  4OMF B;  4C8Q G;  3MPU B;  2OTL A;  2OAW A;  3EG0 A;  4D6W A;  4M7D E;  1VIF A;  4Y91 A;  2O9V A;  4IUV A;  5GAO l;  3GBQ A;  1YN8 A;  3QKJ A;  1M30 A;  1YIT Q;  3LGL A;  1K1Z A;  2RF0 A;  4LDU A;  2RH2 A;  5DLQ E;  1BK2 A;  3INZ A;  3JCM d;  4J83 A;  4BAC A;  2DF6 A;  4M77 C;  1VQN A;  2LTO A;  3C12 A;  3I35 A;  1JU5 C;  2ATC B;  2DBK A;  1RAB B;  2O4X B;  3CCR T;  2QDY B;  3L2U A;  2QG9 B;  1VQM A;  2WSE E;  4A53 A;  2PTK A;  1N8R C;  1JEG A;  1YP5 A;  5LJ5 d;  1I0C A;  5LJ3 d;  2E41 A;  3OW2 A;  4IUT A;  4X9C A;  4JZ3 A;  1H64 1;  5GAM f;  2ZGW A;  3EAE A;  2JS2 A;  1KQ1 A;  5GMK e;  2E1H A;  1SRM A;  5GMK j;  4ZGE B;  2KBT A;  5KYY B;  1WYX A;  2M0O A;  2LQK A;  3OYA A;  1QWE A;  2PUK B;  2AZV A;  4J9C A;  2JNG A;  2KE9 A;  2XD0 A;  4CRI A;  3QDR B;  2YRC A;  3P8B B;  1TUG B;  1M1F A;  4M7A B;  4WF2 A;  2GFA A;  2KRO A;  1U1T A;  4BUG A;  2GTO A;  2KYM A;  4N4H A;  4A4K A;  4MDX A;  1YJN A; 
#chains in the Genus database with same CATH homology
 4BI3 A;  3J81 E;  3E1S A;  4XK8 E;  4ZGJ B;  1N27 A;  3KBG A;  1X01 A;  3MP8 A;  1KD1 U;  4YTL A;  3UT1 A;  1WPY A;  3CPF A;  5GAN h;  5LL6 S;  3RKX A;  3CC7 T;  3M9Q A;  3QUI A;  2R58 A;  3L1A A;  1QVP A;  4Y28 E;  1I4K 1;  1VQ4 T;  2VXE A;  2KAF A;  1KHC A;  4HT9 A;  4R56 A;  4C92 E;  2QEX T;  1YI2 A;  4E7I A;  2XK0 A;  2E65 A;  3RKY A;  1XTD A;  5IN1 A;  5J39 A;  4R55 A;  4C92 G;  3PFS A;  4DOW A;  4ATO A;  4M7A C;  3CEY A;  2QTX A;  3BY7 A;  3WVD B;  3ZFJ A;  3V8L A;  4CI0 C;  3MCA B;  4QQG A;  1YHQ T;  4M75 C;  2P0K A;  2QI2 A;  4LD6 A;  3CC7 A;  3OY9 A;  3RER A;  2RO0 A;  3G71 A;  1VQ4 A;  3MEW A;  2KSS A;  3RIR A;  5KCO A;  5GMK i;  3V7C A;  2VV5 A;  4B9X A;  3JB9 I;  1VQ7 T;  4PKC C;  4PLI A;  3OSV A;  1O75 A;  3OYN A;  2QEX A;  4E7H A;  4BY6 B;  3CC4 T;  3CMA T;  1WJS A;  2DEQ A;  3S6W A;  2JTM A;  3HKS A;  3OSS C;  1YJW T;  5FU6 B;  2CGH A;  5GAO m;  3HFO A;  3OYL A;  3OYF A;  1UEB A;  3DLL A;  1K73 C;  1QVF S;  5KCH A;  4M77 F;  4BDZ A;  4PJO D;  1YHQ A;  3WVE B;  3OYB A;  5GMK l;  3Q1J A;  4FSX A;  3DB4 A;  4L59 A;  1M1K U;  4EMH A;  1G3S A;  1M1G A;  3CBO A;  3LH0 A;  3PIO A;  3GOX A;  5HKC A;  4FT4 A;  4A4H A;  2V8I A;  3OYY A;  3CC4 A;  4BB7 A;  3CMA A;  3E19 A;  3JB9 D;  4M7A G;  1XNI A;  2EYQ A;  1YJW A;  2XHC A;  4M7D C;  3NTH A;  3OS0 A;  3M58 A;  2X35 A;  3V8J A;  2BUD A;  4M75 G;  3H8Z A;  3VYH B;  5GAN f;  4F7U A;  1GXI E;  3OMG A;  1VQO T;  3CBM A;  1KHI A;  2DIQ A;  4V2S A;  2EQJ A;  1U1S A;  1KD1 C;  1Q81 C;  4TVR A;  1UGS B;  1N9R A;  2PU9 B;  4M7D G;  1RL2 A;  3ZEH A;  3G6E T;  1KC8 C;  4C5H A;  1KQS S;  1OI1 A;  3CCE T;  2E12 A;  2RA2 A;  2EJ9 A;  5CKD A;  2QA4 T;  1ZQ1 A;  2A7Y A;  1QVG S;  3CCU T;  1Y71 A;  4FU6 A;  4L6V 5;  2MI6 A;  2F5K A;  4E47 A;  4RCB A;  1VQ5 T;  5HY6 A;  5GAN 8;  1VQO A;  5A0D A;  3RUX A;  3X20 B;  1V29 B;  3SWN B;  3M4Y A;  4F7U E;  3VUB A;  3BFM A;  4C92 F;  5CR2 A;  1NJI U;  1JJ2 S;  3G6E A;  4ME7 A;  2DTH A;  4A4E A;  2DAQ A;  3ER0 A;  4XTY A;  4F7U G;  1M5Q 1;  5FU7 B;  2R5A A;  3CCE A;  2QA4 A;  1U8R A;  2C06 A;  1R8O B;  1TH7 A;  4JS5 A;  3CCU A;  3RMS A;  3CD6 A;  5D6Y A;  3VU3 C;  1FXX A;  1NZ9 A;  4N0A C;  2EFI A;  3JCM V;  3UDC A;  4C92 B;  3HRU A;  1LJO A;  2RB6 A;  2DO3 A;  1S72 A;  4LDY A;  1WJQ A;  1VQ8 T;  3OS5 A;  1K9M U;  4JLI A;  2D6F A;  2DZC A;  3QJ6 A;  4C0G A;  2B8A A;  3A8H B;  3OQ5 A;  3CCS T;  2RI2 A;  2MAM A;  2PVG B;  4NL2 A;  5GAM d;  1WQ7 A;  2CKK A;  4FIB A;  2X4W A;  2ZCF B;  4XU0 A;  4C0F A;  1M4Z A;  2D0Q B;  2RJF A;  4JUV A;  4M78 C;  5A2Q E;  2EIF A;  1ZHI A;  3PTA A;  2LNV A;  2ZPE B;  4M7A F;  5CQY A;  5DM7 R;  2WAC A;  2DTI A;  3DLM A;  3OYE A;  3I55 T;  4M78 A;  1VQ8 A;  4C5G A;  3X24 B;  1BI3 A;  3RMQ A;  2BIV A;  5I2S A;  2RJC A;  4M75 F;  1UGQ B;  3CCM T;  5A0G A;  1K8A U;  3HFN A;  4ELZ C;  1JBM A;  1Q7Y C;  3LW5 E;  2VGM A;  3OA6 A;  1Q86 U;  3GLX A;  3CCQ T;  2EWN A;  3CPW S;  2XDP A;  2CYZ B;  4A54 A;  5GAN j;  1M90 C;  4M7D F;  3CME T;  1YIJ T;  2FVU A;  4ZTJ A;  4LDV A;  1Q82 U;  4JJN K;  2XDB A;  2BKD N;  4OB0 B;  3I55 A;  2D9T A;  2LCC A;  2RJD A;  3C94 A;  2E70 A;  5J26 A;  4MZT A;  4FT2 A;  5CKF A;  4M78 E;  3FB9 A;  5L8R E;  4DQ2 A;  2L8D A;  3CXC S;  4XTZ A;  3OYM A;  3JCM J;  3AHU A;  4M7D B;  3CCQ A;  3O8V A;  4M78 G;  5CKE A;  4MMK A;  5GAN 4;  2L3R A;  3HHT B;  2RJE A;  4IUU A;  3VUZ A;  3L2Q A;  3CME A;  1YIJ A;  4Z02 A;  3CC2 T;  5KH6 A;  3MHX A;  4F7U F;  3L42 A;  4C0D B;  1QVF A;  2RHI A;  2L89 A;  2EAY A;  5GMK m;  1VQ9 T;  2Y4X A;  2GQV A;  3HP9 A;  4A4G A;  1PSF A;  1K9M C;  2EQK A;  5FRN A;  2P0P A;  2FHD A;  3JCM g;  5KE3 A;  4HCC A;  3M4G A;  1VUB A;  4C5E A;  2R5M A;  2RI3 A;  4XU3 A;  4F7U B;  3E9G A;  4ZN1 A;  4BE0 A;  3CC2 A;  1JRI A;  4IUP A;  5GAN 3;  3P8H A;  4XU1 A;  3OYJ A;  4Q5W A;  1VQ9 A;  3HPW A;  5HK3 A;  5EG2 A;  5A0L A;  3JB9 J;  3M53 A;  1BI1 A;  3JCM e;  5CKB A;  3JCM Q;  4PJO C;  4C0D C;  1BIA A;  3C95 A;  4JRK A;  4RKU E;  4EDU A;  5LJ5 g;  5LJ3 g;  3J80 E;  4E7K A;  1KQS A;  2F5T X;  1IZ6 A;  4PJO A;  2YLB A;  2DD4 A;  3T9N A;  1QVG A;  2R57 A;  2DTO A;  2RM4 A;  3ASK A;  4C8Q D;  5C6S A;  3OS2 A;  2DPP B;  3M57 A;  3DB3 A;  1X6O A;  3JRZ A;  3R6O A;  3QBY A;  1VQ7 A;  3QZ5 B;  3VYG A;  4C8Q A;  2CZ0 B;  4EMK A;  2P0Q A;  4MZM A;  3MP1 A;  3QZ9 B;  3JCM h;  3JCM P;  3BDL A;  2YRV A;  1NE8 A;  2V8K A;  5IT9 E;  1VQK T;  3MO8 A;  1QP2 A;  5LJ3 e;  2KK4 A;  3BW1 A;  1VQP T;  2QQS A;  5GAN d;  5FRO A;  1M8V A;  4PNO A;  2FL7 A;  2ZPF B;  1N8R U;  1W4S A;  2DIG A;  5IAY A;  2LQ8 A;  3ME9 A;  2LC4 A;  1YIT T;  2OTL T;  2LT4 A;  2RD1 A;  2GCX A;  2EQU A;  3OMC A;  5CQX A;  5D6X A;  2O01 E;  3RES A;  4XAX B;  4NL3 A;  4PJO E;  2MF2 A;  2LRQ A;  3MEA A;  3N5B B;  2KQW A;  1OZ2 A;  3OYH A;  3DKM A;  4M78 F;  1Y07 A;  2E10 A;  4PJO G;  2ZPH B;  1VQK A;  5LJ5 h;  4XTX A;  5LJ3 h;  4C8Q E;  1I5L A;  4J5Y A;  1VQL T;  4J6Y A;  4J7F A;  1YBY A;  3PGG A;  2XI9 A;  1BKB A;  3NTI A;  4NOY A;  1OZ3 A;  1SSF A;  2H3J A;  3JSC A;  5GAM h;  3FC3 A;  4JS4 A;  1VQ6 T;  1IRE B;  1B34 A;  1G3T A;  4JDS A;  2E6Z A;  2LDM A;  3JB9 G;  4M78 B;  2FYK A;  5CAI A;  2EJG A;  2RHU A;  3MET A;  4JRQ A;  4LDW A;  5HK0 A;  4OGE A;  2RHX A;  3GPL A;  1MGQ A;  1D3B A;  3TEE A;  2KDS A;  2OAU A;  1VQL A;  2KMT A;  2ZPB B;  3OYC A;  5GAO n;  3FIF A;  4JRP A;  3QXE B;  3G4S T;  1VQ5 A;  5I2M A;  5D6W A;  1VQ6 A;  3ZBD A;  1W2B S;  3VV0 A;  3CPW A;  2FB7 A;  4PLL A;  2E5Q A;  3A8O B;  3FJP A;  2MWP A;  1M1K C;  5GAN 2;  1ZBX A;  3JCM f;  2GFU A;  4FM4 B;  1X75 C;  2G3R A;  1XQH A;  2QQB A;  2RK2 A;  4M77 D;  5KE2 A;  2DD5 A;  4HCB A;  4BE1 A;  1I8F A;  2DZ9 A;  3PNW C;  4OP0 A;  5CKH A;  4M77 A;  3G4S A;  1G3Y A;  2CZ1 B;  3M55 A;  3V7R A;  2XID A;  3PT9 A;  4NS5 A;  3QII A;  2JUF A;  5I21 A;  3CCL T;  4MDW A;  4BD3 A;  4LD9 K;  2DK3 A;  2PUO B;  2EKO A;  5GAO q;  3CCS A;  3SD4 A;  4II1 A;  5LJ5 f;  5LJ3 f;  3LWH A;  5AYF A;  2RI5 A;  2K3Y A;  1BI2 A;  3L2R A;  3M59 A;  3PIP A;  3X28 B;  3OS1 A;  1LNX A;  1WQW A;  3SB2 A;  2Y4Y A;  3L2Z A;  3FEO A;  4J7I A;  4QVD A;  1G5V A;  2EJF A;  4M77 E;  3A5Z B;  2K57 A;  2QQR A;  3OBW A;  2DKG A;  4PJO F;  3CCJ T;  3CCL A;  4ZN3 A;  1Y7X A;  4L5G A;  3M56 A;  3LWI A;  3BDU A;  3SWN A;  3FLG A;  3CCM A;  1NJI C;  1HXD A;  5GAN 7;  3HRT A;  3URG A;  3GF5 A;  1YJ9 T;  4C5I A;  2O4X A;  5FRM A;  4XTU A;  4XTV A;  3QO3 A;  3H6Z A;  1P92 A;  3OB9 A;  2M1H A;  2QQ9 A;  4QW2 A;  2XKO C;  2K5L A;  1LOJ A;  3A8M B;  3MEV A;  1HK9 A;  3OYI A;  3JB9 F;  4PJO B;  2DJZ A;  3JB9 H;  4QQD A;  5CCA A;  4KT0 E;  2HBP A;  2HQX A;  5J3B A;  4E7L A;  2YHT A;  1Y96 A;  1KG1 A;  4B9W A;  4XU2 A;  5GMK h;  1UB4 A;  3CCJ A;  3QSU A;  3OW2 S;  3CD6 T;  5CIU A;  1H3Z A;  3J7A F;  4C8Q B;  2K4Y A;  4EMK B;  2RK1 A;  4HCZ A;  4BI4 A;  4PL6 A;  2CZ6 B;  4DA4 A;  1YJ9 A;  1YI2 T;  2HD0 A;  2L5Q A;  3TCJ A;  2DVE A;  1BYM A;  2M9U A;  3NTK A;  3JCM X;  3VKI A;  3L2V A;  2XDD A;  3GNF B;  3WXM B;  1RI0 A;  2DXT A;  2I2L A;  2A3L A;  2OTJ T;  2LT1 A;  4EPC A;  4A4F A;  1Q81 U;  2GF7 A;  1M9S A;  2CS7 A;  2ZPI B;  3SDZ A;  4KUI A;  3G71 T;  4GLK A;  4ZTF A;  1KC8 U;  1KQ2 A;  2LCL A;  2QXF A;  4ELY C;  1NPR A;  4OGC A;  1K8A C;  4BDY A;  3EFR A;  3JCM W;  2E64 A;  3S3O A;  1VIE A;  1Q86 C;  4M7A D;  2DXC A;  4C8Q C;  2RHY A;  4EMK C;  5CVI A;  3MP6 A;  2OTJ A;  4M7A A;  1B34 B;  5GAO r;  5GAM g;  4JRI A;  4M75 D;  3I56 T;  1Q82 C;  1N6A A;  2EQM A;  1N9S A;  2K5F A;  4KUL A;  4QVZ A;  3LLR A;  3L2W A;  4M75 A;  1QW1 A;  2KVQ G;  3A8L B;  3PMT A;  4RMO A;  1UGP B;  1JB0 E;  3FRN A;  3JCM b;  1JJ2 A;  4XQ3 A;  3QYG B;  3X25 B;  1D3B B;  5LJ5 j;  5DLO A;  5LJ3 j;  2NLU A;  4VUB A;  3A8G B;  5LJ5 e;  3QPH A;  4M7D D;  3HSB A;  4O5V A;  4C0Z A;  1FX7 A;  1O9S A;  4M7D A;  4HT8 A;  2K5I A;  4JLG A;  1XOV A;  2X4Y A;  3CBP A;  2CZ7 B;  4EMG A;  3G7Z A;  5GAM e;  5GAM j;  1NPP A;  3UWN A;  4X9D A;  1UGR B;  5GAN 6;  2HNI A;  4RG2 A;  3M54 A;  3JAM E;  5CO7 A;  3LGF A;  3I56 A;  4MML A;  3NFC A;  3QJY A;  4GY5 A;  1WNL A;  2VC8 A;  1W2B A;  2ZPG B;  3MEU A;  4M7A E;  3OYG A;  3GIB A;  2X4X A;  4HA8 A;  2P4T A;  1VQP A;  1MHN A;  4OF1 A;  4M75 E;  4MZP A;  4M77 B;  4RG8 A;  3X26 B;  2KY9 A;  2V8J A;  2VXF A;  3TU4 K;  4OMF B;  4C8Q G;  2M16 A;  4KBM B;  4UC4 A;  1YIT A;  2OTL A;  3OBY A;  3VJP A;  2F69 A;  4BI8 B;  2E6N A;  4ZGD B;  4J6X A;  4D6W A;  4IKF A;  1VIF A;  4M7D E;  4Y91 A;  4BY6 C;  4KUD K;  4QVC A;  3M5A A;  5FU6 C;  2YLC A;  4IUV A;  1VQN T;  5GAO l;  4IUR A;  4IUQ A;  1Q7Y U;  3EFS A;  3HL8 A;  3QKJ A;  1BI0 A;  3PMI A;  2WSC E;  3LGL A;  2VGN A;  3OYD A;  3QYH B;  5M9O A;  1M90 U;  1PSE A;  2LVM A;  2JZ2 A;  1VQM T;  3SFM A;  4OVA A;  2XU8 A;  4BE2 A;  3S3N A;  4LDU A;  2MMP A;  2RH2 A;  5DLQ E;  1YCY A;  1WJR A;  2QQA A;  2IVW A;  3INZ A;  4HKE A;  4J83 A;  3JCM d;  3KXT A;  4M77 C;  4BAC A;  1S72 T;  2LTO A;  2XG8 D;  3C12 A;  1VQN A;  2MWO A;  2WSF E;  4N4G A;  2O4X B;  3CCR T;  3QG1 A;  2Y90 A;  3QHS A;  4XTW A;  4LDX A;  2QDY B;  4O6J A;  5GAO p;  3L2U A;  3CXC A;  1VQM A;  2WSE E;  3V8K A;  2XIC A;  4A53 A;  1WGS A;  2HAX A;  1Y96 B;  2K3X A;  3OYK A;  1N8R C;  4J8O A;  2PQW A;  4N0A A;  3UPU A;  3RKW A;  1G3W A;  2JOY A;  2ZZD A;  5GAN 5;  2VUB A;  5LJ5 d;  5LJ3 d;  5DY9 A;  2E41 A;  3CCR A;  4DOV A;  1EIF A;  4IUT A;  2JVV A;  3LYI A;  3TRE A;  3OW2 A;  1OYX A;  4X9C A;  1QP3 A;  1H64 1;  4QQ6 A;  5GAM f;  2K2V A;  2ZGW A;  3EAE A;  3S3M A;  3CCV T;  3SWN C;  3C4S A;  3V7S A;  3JCM c;  1KQ1 A;  2PVD B;  5GMK e;  2E1H A;  5GMK j;  4M78 D;  4ZGE B;  3HRS A;  5GAN g;  4M77 G;  1I81 A;  5FU7 C;  4X34 A;  4RCC A;  2M0O A;  3GP8 A;  1DJ7 B;  2JTF A;  2LQK A;  2RHZ A;  4C8Q F;  3OYA A;  2PUK B;  1YJN T;  3P8D A;  1K73 U;  4OB3 B;  2JNG A;  3LX7 A;  2XD0 A;  4CRI A;  3F70 A;  3QDR B;  4C92 C;  5FLX E;  2AHJ B;  3E9F A;  1BIB A;  2IG0 A;  3P8B B;  4OB2 B;  3FDR A;  4C92 D;  3CCV A;  5CK9 A;  3GNG A;  2DXU A;  5GAN e;  1M1F A;  4FL6 A;  4M7A B;  2JN0 A;  4WF2 A;  2GFA A;  4C92 A;  2PVO B;  2HQE A;  1U1T A;  2VYT A;  4P5N A;  4BUG A;  1AHJ B;  4N4I A;  2LX9 A;  4OB1 B;  2DXB A;  2X4J A;  4E7J A;  4N4H A;  4M75 B;  4A4K A;  3KUF A;  4MDX A;  4J6W A;  1YJN A;  1FWZ A;  5C0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...