3PNWC

Crystal structure of the tudor domain of human tdrd3 in complex with an anti-tdrd3 fab
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
b'PMEYAKMWKPGDECFALYWEDNKFYRAEVEALHSSGMTAVVKFIDYGNYEEVLLSNIKPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB light chain
publication title CDR-H3 Diversity Is Not Required for Antigen Recognition by Synthetic Antibodies.
pubmed doi rcsb
source organism Homo sapiens, synthetic construct
molecule tags Protein binding/immune system
total genus 11
structure length 60
sequence length 60
chains with identical sequence F, I, L, O, R, U, X
ec nomenclature
pdb deposition date 2010-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00567 TUDOR Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3pnwC00
2RHIA 3M9QA 4E7LA 2RJCA 2P0KA 3OY9A 2BUDA 1XNIA 4QW2A 4E7HA 2R57A 3DLMA 4QQGA 4Z02A 3OYJA 3LGLA 1KHCA 2LVMA 3NTIA 2X35A 4EDUA 2XDPA 1N27A 3S3OA 1G5VA 3OYHA 2M0OA 3QKJA 4B9WA 3OS1A 4BD3A 2EKOA 3OS0A 2R58A 2VYTA 4BACA 3L2RA 3KUFA 5KCOA 5M9OA 1OZ3A 2R5MA 3PMTA 2WACA 3OYDA 3L2QA 2QQSA 4GY5A 2RHZA 3E9GA 3NTKA 3P8DA 3SD4A 2MWPA 2X4XA 3ASKA 4IUVA 3OYGA 2GF7A 4CRIA 2EQJA 4BE2A 2K3YA 2RI5A 3OYFA 3MP8A 5D6WA 2HQXA 5KH6A 4A4FA 3LX7A 4UC4A 3FLGA 4C5IA 5D6XA 2LDMA 2EQUA 4QVZA 4Q5WA 3OYCA 3MEVA 4IUUA 2HQEA 1WJSA 3O8VA 3QBYA 5C0MA 3OA6A 3QJ6A 3OYBA 2EFIA 3GOXA 5IAYA 5FRMA 2CKKA 2RJEA 4BE1A 2YRVA 5C6SA 2M16A 4A4EA 3LYIA 3P8HA 1RI0A 3MP1A 3PMIA 3FDRA 2LTOA 2O4XB 3PNWC 1MHNA 4HCZA 4IUQA 2D9TA 4IURA 2X4WA 3OYMA 3OYAA 3L2UA 5IN1A 2L89A 2L8DA 5J26A 2GFAA 3ZEHA 3DB4A 4A4HA 3C4SA 3L2VA 4IUTA 2RI3A 3MEAA 2FHDA 3CEYA 3OB9A 2RO0A 2F5KA 2NLUA 4IUPA 4QQDA 2R5AA 2QQRA 4ZTFA 1OI1A 5KCHA 1OZ2A 4BE0A 4FL6A 3OS2A 4NS5A 2B8AA 2LRQA 2EQMA 5J39A 4PLIA 4E7KA 2G3RA 2RHXA 4C5EA 4OVAA 4RG2A 3QIIA 4BDYA 2L3RA 3LLRA 3OYEA 3H8ZA 2EQKA 2M1HA 2X4YA 3ME9A 2DIQA 3Q1JA 4II1A 4X34A 4A4GA 2PQWA 3OYNA 3EAEA 4QQ6A 3DB3A 3OYLA 4N4IA 1WGSA 3S3NA 1WJQA 2JTFA 2RJFA 3META 5CIUA 3UWNA 3OYIA 2O4XA 2E6NA 3E9FA 4N4HA 1OYXA 3S6WA 3LGFA 3MEWA 3UT1A 3NTHA 4IKFA 4C5HA 2E5QA 4LD6A 2XK0A 5FROA 4BDZA 4ZTJA 1H3ZA 5KE2A 3MO8A 2RHYA 5KE3A 3MEUA 5FRNA 5D6YA 1WJRA 2BIVA 3H6ZA 2RJDA 4FU6A 2RI2A 3FC3A 2BKDN 2LCCA 4C5GA 4E7JA 2GFUA 4N4GA 3BDLA 3LH0A 4PLLA 4E7IA 3F70A 2RHUA 3MP6A 3OMCA 3L2WA 2JZ2A 2MWOA 4L59A 3OQ5A 3PFSA 3S3MA 3OYKA 3L42A 2DIGA 4PL6A 3FEOA 2IG0A 3OMGA 2K3XA 4B9XA 1SSFA 2DAQA
chains in the Genus database with same CATH superfamily
3RUXA 2OI3A 2IVWA 1YNZA 2V8IA 4JJDA 2JS2A 2RM4A 3HP9A 2R57A 4Z02A 2LVMA 1RAGB 3OYHA 2EAYA 3QKJA 4M7DC 2CP0A 2MPXC 1M3CA 2L3SA 2PUOB 2R58A 1H3HA 2VYTA 3HFNA 1WHHA 2OTLA 1M2OA 2QQSA 4BY6C 3NTKA 3JSCA 4IUVA 3CC2Q 2RI5A 5LJ3h 3I56Q 2DL4A 2PVOB 2E5KA 1VQKT 2EGEA 1YJNQ 2MMPA 1R0CB 3G7ZA 3RIRA 4VUBA 5GAMf 3CPWS 3LYIA 3P8HA 5A0GA 3PMIA 2O4XB 4KUIA 3OYAA 3OYMA 2YUPA 3OYYA 2ESWA 3C4SA 1O9SA 1NZ9A 3NHNA 3PIPA 4RKUE 1BI0A 4NS5A 1VQ6T 1M8VA 1VQKQ 1VQ4Q 1X6OA 2JM9A 2DNUA 3A1PA 1Q86U 2LQ8A 2CZ6B 1TUCA 2M1HA 5LJ3d 2O88A 1D1BA 1WJQA 1PG5B 3LW5E 2VGMA 1IB8A 1WQ7A 2DZCA 1S72T 2QGGA 2RQTA 2EJGA 1S1NA 2RI2A 4DBRA 4FT4A 2D8JA 1NLPC 4MZPA 1YJ9Q 1BB9A 2MI6A 1K8AR 4E2FB 1N9SA 1KC8R 3OQ5A 1EFNA 4CC2A 2CGHA 1Q82R 2KRMA 2DIGA 2MIOA 2ED0A 2QAZA 2XIDA 3PT9A 3MKDA 5ECAA 4KRTA 1QVFA 3OY9A 3OYJA 4EDUA 4M77C 1JXOA 1VUBA 3HTRA 4ZGDB 1MMDA 5GAN5 3VKIA 4AMCA 1LVKA 5KYWB 2KMTA 3KUFA 3L2RA 2JUFA 1Q86C 3C0CA 3FIFA 1BI2A 3HHTB 2HL3A 1WHLA 2ZPHB 3OYGA 2GF7A 4OMNA 2F2WA 1VYUA 1NJIR 5GAOn 1GBQA 5D6XA 1C6VX 1T3SA 4HCBA 3FJ5A 3SWNC 1PKSA 2RJEA 4HVVA 4OF1A 5IXBA 1J3TA 1YWPA 4CC4B 2J7IA 2YUOA 2GBQA 2KQWA 1U06A 1FXXA 1Q81R 3CCLA 3AT1B 5KYYB 5GAOm 4PJOA 1VQPQ 4LDYA 4GLKA 4J83A 1LPLA 2QTVA 3ZL7C 2E6ZA 2VASA 3RKWA 4JPBW 1WHMA 2E3HA 1W2BP 5GAMj 2RMOA 2EJ9A 2DXUA 1PRLC 2O01E 1QVGA 4IKFA 5FWBA 1YJWQ 5FROA 3C12A 1X27A 1YBYA 4FW1A 1WJRA 4PJOD 2V1QA 3JV3A 3LH0A 3ER0A 2GTJA 5LJ3g 3CCJT 2YUQA 3REBB 3CXCA 1KQ2A 1ZBJA 5AT1B 1KIKA 1QVPA 2K7AA 1KHIA 4M7DG 1SHGA 4A4KA 2RJCA 2C0IA 4MZMA 1SSHA 2KYBA 3TEEA 2RQWA 4L5GA 3G6EA 4M7AE 4LE9A 2CT4A 3RBBB 1LJOA 3G71Q 2ROTA 3OS1A 4X9CA 1BU1A 3M55A 1K8AC 4J9CA 2IPOB 2DILA 1KC8C 4ELZC 3JCMQ 2YLBA 1Q82C 1NBEB 5D6WA 2HQXA 1P92A 3GP8A 2PZ1A 2RB6A 1FMWA 1VQNA 2COWA 5IT9E 3RKXA 2DXCA 2DO3A 2EYWA 4QVZA 3C94A 2A08A 3GOXA 3JCMX 1NYGA 2YRVA 3CC4A 4KBMB 4QQGA 3HRUA 3M58A 2W0ZA 3UATA 1D1AA 1T0HA 1HXDA 3CBOA 2F5KA 2NLUA 2QQRA 5KCHA 5DY9A 3FJPA 1NJIC 1RL2A 2DJQA 2A0FB 2LT4A 1X6GA 2OX7A 3JB9H 1QQJA 2SRCA 1K73U 1LNXA 3ME9A 4M7DD 4QQ6A 3WXMB 4LUDA 3EFOA 5GMKj 2X3XD 2QYZA 3OSSC 3META 3CXCS 3CCST 1Q81C 2E6NA 1ZSZA 2DERA 4C5HA 4C8QC 1QVFP 5CCAA 4BDZA 3G4ST 1BI1A 2KY9A 1AVZC 1TUDA 3H6ZA 3CMAT 5GAOr 6AT1B 5HY6A 3TSZA 2LCCA 4C5GA 1UJYA 1UE9A 2DTIA 3TREA 2MWOA 4C92C 4M7AC 1YIJA 1VQ6A 5D7UA 4M77G 1PSEA 3NMZC 1M1KU 1BIBA 2PVGB 3PVQA 2ZZDA 1Z9QA 3NTIA 2QEXQ 3G4SQ 2XDPA 3H0FA 4KULA 1I0CA 4A53A 5LJ5e 2VXEA 1B34A 3CMAQ 8AT1B 1V1CA 2DVJA 3OS0A 3I55A 5KCOA 2DRKA 1AWOA 1OOTA 4PJOB 4WF2A 2KNBB 4M75A 3URGA 3ASKA 1CSKA 1M2VA 1VQMA 5FU6B 3U23A 2FRYA 3H0IA 4JRIA 2VC8A 1X75C 5L8RE 3V7CA 5GJWB 4HA8A 1T0JA 4R55A 3NGPA 2JMAA 5C6SA 2H8HA 2QDYB 4E7KA 3DKMA 1MHNA 2X4WA 2ECZA 1X01A 1QKXA 2DMOA 2L2PA 1M30A 2KE9A 2NUPA 3CCUA 1ABQA 1QVGP 2AKLA 2JTEA 4M75D 2ZGWA 1VQLQ 1U5SA 1FX7A 3JCMe 2LCSA 1R77A 3CCRA 5A2QE 2HNIA 1G2BA 4RTTA 1MGQA 3EGXB 1QWFA 2DIQA 3CXCP 3M53A 1YHQT 3A8LB 3OYNA 2M02A 2FPEA 3CCEA 3CQTA 1X2KA 3LWHA 5DM7R 1X6BA 3EG3A 3QXEB 2CUDA 4IIMA 5GAOl 1NM7A 2LZ6B 3V7SA 3I5SA 2DYIA 1Y7XA 1D0XA 1ZX6A 1MNEA 4XU2A 4XTYA 4PJOE 2ZPIB 2E3IA 2EGAA 4X9DA 1Z9ZA 4FSSA 1YHQQ 3CCMA 3UA7A 2QI2A 2D1XA 4M7DB 4RUGA 3VS3A 2FRWA 2F5TX 5LJ3f 1M3BA 4FSXA 4ATOA 1KD1R 4OGEA 4OMPA 1RLPC 2Y90A 2DLPA 5IXFA 4BY6B 2KXCA 1VQ7T 4HXJA 1BYMA 4L6V5 2DXTA 2JS0A 1JJ2P 5FU7B 3RNJA 3CCJA 1M5Q1 4C0GA 3GF5A 3FLGA 2KAFA 1NLOC 1W6XA 1JO8A 3QJ6A 2Z0WA 4OP0A 3L2ZA 4BE1A 3EFOB 4JUVA 2E12A 2XHCA 5IN1A 3TQ7P 2M0YA 4Y28E 1HJDA 2RI3A 2E1HA 1Y96A 3MEAA 1PRMC 4J7FA 2FEIA 3KXTA 1TG0A 2DL8A 3FRNA 3VS0A 1AWJA 2ZCFB 4PJOF 1FWZA 4ZGJB 2KI7A 2P4TA 3VV0A 5HKCA 2HSPA 3JB9I 2HKNA 4DEYA 4HT8A 4C8QG 4X34A 4KGZB 1AZEA 3UWNA 4PJJA 4RMOA 1H92A 2DK3A 4JS5A 1KD1U 1QWEA 3CPWA 5KE2A 2YHTA 3EG9A 4FU6A 4C92G 3CCLQ 1YP5A 2KR3A 2L0AA 3OW2S 1ZUYA 4M75B 4HT9A 1M2VB 3H9NA 3CC7T 3JB9G 3QPHA 4QVCA 1QCNA 1U3OA 1BCOA 2JTMA 4PL6A 4RG8A 2K4YA 4OB2B 3BDUA 4OMOA 1RACB 5I22A 2O9SA 3CBMA 1OPLA 4EMHA 3JCMc 2X3WD 4XU3A 2HEQA 3CCSA 3OS5A 5KYYA 2NUPB 3M5AA 1M1FA 3PMTA 4DBFA 3E9GA 3CC2T 5CR2A 3I56T 5EG2A 2FZKB 1TSFA 4BUGA 3RDVA 2HKQB 1M27C 5GAN7 4M78A 2LMJA 3CMEA 1YJNT 3QBYA 1GBRA 1KD1C 2HZYA 2DPPB 4RTUA 5FRMA 2L5QA 2K3BA 5LJ3j 4M7DF 3E19A 3FDRA 3CCVA 1YI2A 4MZTA 1NEGA 2L8DA 2GFAA 3DB4A 1B7TA 4J9DA 2LX9A 2MAMA 1XQHA 1UGQB 4DOWA 1WA7A 1VQ5T 4M75E 2XD0A 1AOJA 3JB9D 2E65A 1I5LA 4M78D 5L23A 2DL3A 4PLIA 1U1TA 1VQ4T 3THKA 4RG2A 2EW3A 1IRXA 3VUZA 4CI0C 2K57A 1VQNQ 4P5NA 4QT7A 1VA7A 2K2VA 4J9IA 2YLCA 2CP5A 3P8BB 1SRLA 3CC4Q 3EGUA 4RCCA 3NTHA 1PNJA 5HCKA 2DJZA 5D6YA 1VQ5Q 2DL5A 2JXBA 2KEAA 4Z89A 4N4GA 1YJ9T 3CCQT 2F1LA 1TOVA 2QQBA 1IHVA 1SPKA 2QK0A 1ABOA 1D0YA 5IHNA 4DA4A 3L42A 3QJYA 4KH0B 2JN0A 3RKYA 1W70A 1K1ZA 2RH2A 2RHIA 2WSFE 5GAMe 2BUDA 3EGDA 4M4ZA 4E7HA 1UB4A 2GQIA 4J8OA 3HL8A 1M1GA 2EPDA 3LGLA 1PKTA 3UDCA 2M0OA 4BD3A 2LJ1A 1Y96B 4BACA 2AT1B 3CCQQ 4XTUA 2BZ8A 4WCIA 4OMQA 2WSEE 4MMLA 2A36A 1VOMA 3SD4A 2QASA 4M75F 1GFCA 2EQJA 4XU0A 1M90U 1NG2A 2LJ0A 1NEBA 1IHWA 3INZA 4RTYA 4UC4A 4C5IA 2LDMA 4BI3A 3QSUA 4BI4A 2OTJA 1QLYA 1WIEA 2CP2A 4B6MA 2PUKB 4OMFB 3OYDA 3GIBA 1RUWA 2K5LA 2O31A 2A7YA 2DEQA 3BE3A 3EG9B 2JM8A 5GANg 2QA4A 4ZTFA 1VQPT 4OGCA 4EIKA 3CPWP 3X26B 2YRDA 1IGUA 3TU4K 1OU9A 2L3RA 1AWWA 1K0XA 2KRSA 3Q1JA 3M57A 1UGPB 1VQ9Q 3DB3A 4J9GA 3BY7A 1NYFA 1BI3A 4CC3A 3S6WA 1YJWT 2FB7A 1R0BG 1WXBA 2EYYA 4Z8AA 1PSFA 1M90C 5DLOA 3CCUQ 2M9UA 1IGQA 4PLLA 3JCMW 1VQOT 3L2WA 1ZUUA 3TVTA 1UHFA 4LDXA 4M78B 1HK9A 3FEOA 1OEBA 2LJ3A 3V7RA 2VB6A 3A8MB 2DX1A 5CK9A 4J7IA 5GMKe 3CCEQ 1VYTA 1KQSS 3VRYA 1UUEA 3G71T 4B9WA 1JB0E 1ZUKA 4N0AA 4XTXA 4EMKA 3QDFA 3FB9A 1NE8A 1VQOQ 1K73R 3J7AF 1RLQC 2GGRA 4YTLA 3VS6A 3HFOA 4KT0E 3EGXA 4BE2A 3HRSA 2XDDA 2QQAA 3AHUA 1WNLA 1H8KA 3X25B 3E2UA 3CCMQ 1PM3A 3CD6A 1N9RA 2YRCA 1RI0A 1GCQC 1JQQA 2HBWA 3JRZA 1C0MA 4E7SA 4IUTA 3V8KA 1UGVA 2RO0A 2LCLA 3M0UA 4WTOB 1UEBA 1YCSB 2EYQA 1M1KR 1OULA 4RTXA 3T9NA 1YITT 2EVRA 3MJXA 4OVAA 4M78E 4M7DA 3N5BB 3EGDB 4F7UG 2JOYA 5A0DA 2DEUA 1M3AA 5CAIA 3LGFA 3MEWA 1G3YA 3ULRB 2XK0A 2FL7A 4ZN1A 1VQ8Q 2K79A 1TWBA 2BIVA 1Y71A 2CH4A 3PIOA 1YITQ 3A8OB 4E7IA 3F70A 2HAXA 1M8MA 1WX6A 5CKHA 4LNPA 2CYZB 4JLIA 2OJ2A 3S3MA 1QP2A 3QYGB 1VQKA 4XAXB 3EG1A 2RN8A 1KFZA 2CZ1B 2HQHA 1SEMA 2RQVA 3X24B 2QEXT 2XICA 2CT3A 2JW4A 3M0SA 3PTAA 1GRIA 3RR6A 2FZGB 4FCYA 4HVUA 1OZ3A 2VKNA 1OQKA 4AFUC 2RHZA 4FIBA 1UJ0A 1CKBA 2DZ9A 2XKOC 2K3YA 2GTOA 2BZXA 1I4K1 5IHKA 1WQWA 3JB9F 4M78F 4RTWA 1TTHB 1QP3A 5CKBA 4X1VA 4IUUA 3OA6A 2NUZA 1N5ZA 2QG9B 1MNDA 1D3BB 1S72A 3EFRA 1K73C 2P84A 1AD5A 4LDWA 5GMKm 1WFWA 1VQLT 1UDLA 2R5AA 2V1RA 4XQ3A 2OTLT 1N6AA 4AG2C 1MV0B 2ATCB 4JZ3A 4M77A 4J6YA 3I35A 4C0DC 1AWXA 2FO0A 1UG1A 4ZNXA 2YWWA 1EZZB 2DKGA 1UGSB 4D8KA 4II1A 3CMEQ 3OYLA 2QTXA 2ED1A 1VIEA 2JT4A 3OYIA 1RAEB 3E9FA 1OYXA 3IQLA 3M0QA 1FMKA 2X4JA 4DBQA 3ZBDA 5HK0A 4EMKB 2OTLQ 1C1AA 3MEUA 1M1KC 2VVKA 2VUBA 3M0TA 1VIFA 3FC3A 2D6FA 1G3WA 3G1JA 3SWNA 1K9AA 4M77D 2LC4A 1BBZA 4JJNK 3OSVA 4KUDK 1XOVA 2J6OA 1ZBXA 2F2VA 1TXQA 1A0NB 4B9XA 2DAQA 4A63B 2E10A 3EHRA 2XDBA 3QO3A 2K5FA 1UTIA 4PFPA 3SDZA 2MF2A 4D8DA 3M4GA 3MPUB 3S3OA 1V76A 3JB9J 1ZA1B 5IH2A 4LDVA 3GNFB 1F1BB 2M51A 1OX9A 2YSQA 3QG1A 1Y0MA 4LN2A 4J9EA 2K6DA 4PFZA 2GQVA 2A37A 1G3SA 2MWPA 1HYOA 2JMCA 9ATCB 5GAN8 2COYA 2E70A 2X51A 2C06A 1ARKA 1JEGA 3DLLA 4F16A 3OW2A 1X2QA 1YCYA 2EYZA 4OB3B 4JJCA 2A28A 3MEVA 3OYBA 2E64A 4PFOA 2CKKA 1SHFA 2ZPBB 1BK2A 5A0LA 2KGTA 2KDSA 5GAN6 5J26A 5KYUA 4Z88A 2C0TA 2LQWA 3L2VA 1Q7YR 1ZA2B 3A98A 3EH2A 1IXDA 2FZCB 5CKDA 2KXDA 1OX8A 2KROA 5J39A 2CZ7B 5LJ5h 2X4YA 4HCKA 1PC0A 1D0ZA 2DF6A 3C95A 2JTFA 5CIUA 5LJ3e 4F7UB 2J6KA 5GAOp 3UT1A 2E5QA 3CBPA 4J6XA 1JU5C 2H3JA 4MDWA 3CCLT 3JCMV 3I9QA 2P0QA 2BZYA 2F69A 2GFUA 3BDLA 1Q95G 4AFZC 3MP6A 1H641 1LCKA 4JLGA 1GL5A 2EWNA 1QCFA 1K9MU 2J05A 4M7DE 2VWFA 1SSFA 3VYGA 5GANj 4PJOC 2JVVA 3JAME 5LJ5d 5GMKi 1JBMA 1K0SA 5FU6C 3JCMh 5I2MA 1ZQ1A 2EBPA 1WHJA 2ROLA 4M7AG 1WHKA 5GANh 4QVDA 2R5MA 3JCMb 1Q7YU 4Y92A 1W4SA 2DTOA 4XK8E 4CRIA 2LT1A 4LD9K 1Y07A 4M77B 2LQKA 4C8QA 2CP7A 4RTVA 3LWIA 2MYSA 2DTHA 3EFSA 4OMLA 1WLPB 2MK5A 4V2SA 2V8JA 4AG1C 2M16A 8ATCB 2D9TA 1QKWA 2CH4W 3M59A 2D8HA 3G4SA 1EIFA 3G6ET 4C92A 3CMAA 2DM1A 3JCMd 4M7AA 3OB9A 1SF9A 1TUGB 2KT1A 5GANd 2OAWA 3SWNB 3RESA 4ME7A 4C8QD 1X43A 2EYXA 2CZ0B 3RMQA 1VQNT 2CS7A 1W2BA 2PQWA 3RERA 5FWCA 3VS5A 3G6EQ 3GLXA 1I1JA 4FW2A 1Q7YC 3CC4T 1WI7A 4N4HA 2DXBA 5GMKl 4C92D 4M7AD 4FYXB 1M90R 4EMGA 3MO8A 2PTKA 4JRKA 1MV3A 2B86A 3HRTA 2CP6A 3A8GB 4E6RA 5CO7A 1VQLA 1AT1B 2DVEA 1KK7A 4J9HA 4M77E 3OYKA 2E4HA 2LX7A 1ZLMA 3UF4A 3NFCA 5GAN3 1KG1A 3OW2P 5FU7C 1KHCA 1UHCA 2EGCA 1YFNA 5KYXA 2KRNA 4F7UF 3RMSA 5KYUB 4ORZA 2XMFA 2HSEB 4LXCA 3I5RA 3SB2A 2WACA 3M56A 1ZSZC 4JRQA 2DA9A 1V29B 3QZ9B 1WHGA 1WXUA 4FYVB 5LJ5g 3MP8A 4A4FA 1MUZA 2RQUA 1YIJT 2NWMA 2LNVA 1YHQA 2EQUA 3JCMP 3OYCA 3VS1A 4FT2A 5IAYA 2EKHA 4F14A 2HL5C 2P4RA 1GXIE 3PNWC 4O5VA 1WZOA 3L2UA 3BFMA 2I0NA 4AFSC 1W2BS 3J81E 1BKBA 3I55T 1KSWA 5GAN2 2JNGA 1KQSA 4DQ2A 1OZ2A 4FL6A 1ZSGA 2KYMA 3A5ZB 2B8AA 2E41A 1WDXA 4D6WA 3EG2A 4C0ZA 4J9BA 1YIJQ 1VQMT 1VQ6Q 3GBQA 5GAN4 2RHXA 4M77F 2D0NA 3QIIA 3VS2A 3VU3C 3ZFJA 3H8ZA 4FYYB 1N8RR 4K11A 1VQ9T 4M75C 3EAEA 3EHQA 3JCMg 4PJMA 1WGSA 2DYBA 2Y4XA 4OB1B 2RJFA 4MMKA 2VGNA 3I55Q 1R8OB 1S72Q 1H3ZA 5CKFA 4ZTJA 5KE3A 3CCUT 1VQ7A 3M0RA 3E1SA 2KBTA 2RJDA 3H0HA 1TU0B 4JZ4A 1VQMQ 1RAFB 2D0QB 1JRIA 4AFQC 4IIOA 4ANJA 3REAB 4PJOG 3CCRT 4EPCA 2V26A 4C8QB 3QHSA 2XI9A 1D3BA 2ABLA 2HDAA 3M9QA 4E7LA 2P0KA 3CCET 1SRMA 2X35A 4PKCC 1RI9A 2LP5A 4C92B 3CPFA 4M7AB 1KJWA 3M54A 4KH1B 1UFFA 2O2OA 3L2QA 5FW9A 3CCRQ 4ELYC 3UA6A 2AZVA 4RCBA 5I11A 2PNIA 1NPRA 2LQNA 4QKUA 2BTTA 3L1AA 3CCMT 3O8VA 1K4US 1K8AU 2EFIA 3NPFA 1KC8U 1N8RU 3HSBA 4J5YA 1Q82U 4IUQA 2YUNA 4IURA 2RQRA 3ZEHA 4PJNA 4MDXA 1G83A 2RK1A 3CEYA 1IREB 2DFUA 4BB7A 4QQDA 2HD0A 2RF0A 3M0PA 1IZ6A 2QDLA 1IO6A 4BI8B 2FPDA 1M9SA 4C0DB 5GAMh 3CC7A 2OAUA 1QVFS 4R56A 3WVEB 3R6NA 2G3RA 1QW1A 4C5EA 2AIRB 2QXFA 1I8FA 1NPPA 2VXFA 4C8QE 3OYEA 3SHWA 4HCCA 5I21A 2MOXA 1E6HA 1NJIU 3VJPA 3BW1A 1E6GA 3SEMA 4JDSA 5KYXB 2RA2A 3VS7A 4XTZA 1VQ8T 2QQ9A 1YWOA 2XG8D 4C92E 2RHYA 5FRNA 1SKUB 1RADB 2K5IA 3CC2A 3I56A 3CCJQ 3J80E 2CREA 1X69A 4AT1B 1Q81U 1RAAB 2CSIA 1N8RC 1ACMB 5HK3A 1D1CA 1CKAA 3PGGA 5GAMd 1YJNA 1QCOA 3LH5A 5EC7A 3OBWA 1XNIA 4QW2A 3X28B 3R6OA 1N27A 4ESRA 4JRPA 3VYHB 4XTVA 5CQYA 2AK5A 4GLMA 1HSQA 5CQXA 2PVDB 1VQ5A 3P8DA 1VQ4A 1JJ2A 1UECA 3OYFA 2H3EB 3QZ5B 1GFDA 5KH6A 1KQSP 3LX7A 1QVGS 2G6FX 4C8QF 2A3LA 4OB0B 2C0OA 2HQEA 2I2LA 1XJWB 1PD0A 4F7UA 2KK4A 1W1FA 2EQIA 4A4EA 1ZHIA 3JCMJ 5LJ5f 5IHIA 1B3QA 4A4HA 1PD1A 3KBGA 2FHDA 4C92F 4M7AF 1MMNA 1YJ9A 1OI1A 1AHJB 1K76A 3CCQA 2VV5A 4TVRA 5GAOq 3OS2A 2L3QA 2LRQA 2YT6A 2QGFB 7AT1B 2EQMA 5GMKh 2RD1A 4J6WA 4M75G 3KFVA 2ZPGB 2DETA 1G3TA 2CDTA 1T3LA 3HPWA 2PU9B 3D7SB 3CMET 2J06A 4A4GA 2X9HA 2ZAEA 4LUEA 1EX4A 2Y4YA 4GBQA 3VUBA 4FYWB 4M78C 3CCSQ 1YI2T 3CCVT 4OMMA 2CUBA 1I5OB 2DRMA 3JCMf 1M4ZA 4JJBA 2K2MA 3UPUA 1OU8A 2EJFA 5GANf 2NUTA 1SG5A 1RAHB 4A54A 2AKKA 3OMGA 2DBKA 2P0PA 4NOYA 4HVWA 1YI2Q 3CCVQ 2FYKA 3QUIA 1JJ2S 1VQ9A 3MCAB 2EIFA 2KVQG 4ZN3A 3A8HB 2HCKA 2O9VA 2CP3A 4J9FA 2JJ9A 1B07A 1O75A 5M9OA 1VQPA 5GAMg 2X4XA 2HMAA 3OBYA 3H41A 3EG0A 3QDRB 1BCMA 2V8KA 2K9GA 2FPFA 5GANe 2BE9B 4DBHA 3QWYA 4Y91A 3TSWA 3MP1A 2LTOA 1YJWA 1TS9A 2L89A 5DLQE 2BE7D 2IIMA 1D09B 4NL2A 3HKSA 4IUPA 1BIAA 1K9MR 4F17A 1VQOA 1U1SA 4JS4A 3GNGA 2AZSA 1G8XA 1KQ1A 2KSSA 4O6JA 3GPLA 1UGRB 3PE0A 2GNCA 4BDYA 3EH1A 1FYNA 3LLRA 2EQKA 5CKEA 5KYNA 4N4IA 2YXYA 4ZGEB 1U8RA 1FMVA 2OTJT 3VS4A 3G71A 2O4XA 5LJ5j 3TCJA 5LL6S 2ZPFB 2DL7A 4LD6A 1AEYA 3SFMA 2CSQA 4HKEA 2BKDN 4E7JA 2QA4T 3X20B 4CC7A 2RHUA 3QWXX 4L59A 2FG0A 4E47A 4PJLA 1GCQA 5AYFA 4E7ZA 3M4YA 1QMCA 1PWTA 2IG0A 2DD5A 2L3PA 1AZGB 1RAIB 2OTJQ 4KGVB 1WPYA 2YDLA 1GCPA 4LDUA 1PHTA 3DLMA 4XU1A 1G5VA 2J6FA 2XU8A 2EKOA 1LOJA 2DE0X 2QA4Q 1ZSZB 5FLXE 1XTDA 1VQ8A 2HBPA 1VQ7Q 4PNOA 4GY5A 3V8LA 1YITA 1RABB 2DD4A 3QYHB 1E7OA 3V8JA 2ENMA 3MHXA 5I2SA 1MMGA 2NYSA 4Q5WA 1VYVA 1WJSA 5C0MA 5GJVB 3WVDB 4HCZA 1MMAA 2GCXA 5J3BA 1I07A 2ZPEB 4RTZA 2KT8A 2COZA 5KYWA 3VRZA 1B34B 2RK2A 1YN8A 4BE0A 4R0KA 1DJ7B 4DOVA 2NUTB 4N0AC 4EMKC 4XTWA 1Y57A 4F04B 4NL3A 4M78G 1OPKA 1OV3A 1WYXA 1PCXA 1WXTA 4F7UE 3CD6T 2QEXA 3S3NA 2RPNA 2WSCE 4DEXA 2F2XA 1K9MC 3O5ZA 5CVIA 1TH7A 2RNAA 2LNHB 2DBMA 2W10A 3PVLA 4PK4A 3OMCA 2AHJB 2JZ2A 1Q86R 3CC7Q 2FVUA 4C0FA 2SEMA 3PFSA 1I81A 1JXMA 3CD6Q 4KGXB 1HD3A 2K3XA 2MCNA 4FM4B
chains in the Genus database with same CATH topology
3RUXA 2QI2A 2CZ1B 1D3BA 2IVWA 3M9QA 2V8IA 4E7LA 4M7DB 2P0KA 2F5TX 2RM4A 3HP9A 5LJ3f 2R57A 3X24B 2QEXT 4Z02A 3CCET 2LVMA 2XICA 2X35A 4FSXA 4ATOA 4OGEA 3OYHA 2EAYA 3QKJA 4PKCC 4M7DC 3PTAA 2Y90A 2PUOB 4C92B 3CPFA 2R58A 4M7AB 2VYTA 3HFNA 4BY6B 3M54A 1OZ3A 2OTLA 1VQ7T 3L2QA 2QQSA 4BY6C 2RHZA 4FIBA 3NTKA 4ELYC 2DZ9A 3JSCA 4IUVA 2XKOC 1BYMA 4L6V5 2K3YA 2DXTA 2RI5A 4RCBA 5LJ3h 5FU7B 3CCJA 1NPRA 1I4K1 1M5Q1 4C0GA 3GF5A 3FLGA 1WQWA 2PVOB 3JB9F 4M78F 1QP3A 2KAFA 3L1AA 5CKBA 3CCMT 1VQKT 4IUUA 3OA6A 3O8VA 3QJ6A 2MMPA 2EFIA 3G7ZA 3RIRA 4OP0A 4VUBA 3L2ZA 5GAMf 3CPWS 4BE1A 1KC8U 4JUVA 1N8RU 3LYIA 3P8HA 5A0GA 4J5YA 2E12A 3PMIA 1Q82U 2O4XB 2XHCA 4KUIA 3HSBA 1D3BB 4IUQA 4IURA 3OYMA 3OYAA 1S72A 3EFRA 5IN1A 3OYYA 3ZEHA 1K73C 4Y28E 3C4SA 4MDXA 1O9SA 1NZ9A 2E1HA 1Y96A 2RI3A 3MEAA 2RK1A 3CEYA 1IREB 4LDWA 4BB7A 4QQDA 2HD0A 5GMKm 1VQLT 1IZ6A 2R5AA 3PIPA 4J7FA 4XQ3A 2OTLT 4BI8B 3KXTA 1N6AA 3FRNA 1M9SA 4C0DB 5GAMh 3CC7A 2ZCFB 4PJOF 4RKUE 1BI0A 4NS5A 3JCMh 1FWZA 4ZGJB 2P4TA 2OAUA 3VV0A 5HKCA 1VQ6T 1QVFS 4R56A 3WVEB 1M8VA 2G3RA 3JB9I 1QW1A 4M77A 1X6OA 4J6YA 4C5EA 2QXFA 4C0DC 1I8FA 1NPPA 1Q86U 2LQ8A 2VXFA 4C8QE 2CZ6B 2DKGA 3OYEA 4HT8A 1UGSB 2M1HA 5LJ3d 4HCCA 4II1A 4C8QG 4X34A 5I21A 3OYLA 2QTXA 1WJQA 1VIEA 1NJIU 3UWNA 3OYIA 3VJPA 3BW1A 4RMOA 3E9FA 2VGMA 3LW5E 4JDSA 1OYXA 2RA2A 1WQ7A 2DK3A 2X4JA 2DZCA 4JS5A 1S72T 4XTZA 3ZBDA 5HK0A 2QQ9A 4EMKB 1KD1U 1VQ8T 3CPWA 2XG8D 4C92E 5KE2A 2EJGA 2RHYA 2YHTA 3MEUA 5FRNA 1M1KC 4FU6A 2VUBA 2RI2A 1VIFA 4C92G 2K5IA 3FC3A 2D6FA 3OW2S 4FT4A 4MZPA 3CC2A 4M75B 4HT9A 1G3WA 3SWNA 3I56A 2MI6A 3J80E 4M77D 2LC4A 4JJNK 3JB9G 3QPHA 4QVCA 3CC7T 1N9SA 1Q81U 3OSVA 4KUDK 3OQ5A 1N8RC 1XOVA 2CGHA 1ZBXA 2JTMA 4PL6A 2DIGA 3PGGA 4RG8A 2K4YA 5HK3A 5GAMd 1YJNA 4OB2B 4B9XA 2DAQA 3BDUA 2XIDA 2E10A 3PT9A 2XDBA 3QO3A 1QVFA 2K5FA 3OY9A 3OBWA 1XNIA 3CBMA 4QW2A 3SDZA 2MF2A 3OYJA 4EMHA 3JCMc 3X28B 3M4GA 4EDUA 4M77C 4XU3A 3R6OA 1N27A 3S3OA 1VUBA 4ZGDB 3JB9J 5GAN5 3VKIA 3CCSA 3OS5A 3M5AA 1M1FA 4LDVA 4JRPA 3VYHB 2KMTA 3KUFA 4XTVA 3L2RA 5CQYA 2JUFA 3GNFB 3PMTA 3QG1A 5CQXA 1Q86C 3FIFA 2PVDB 1VQ5A 1BI2A 3HHTB 2GQVA 3E9GA 3P8DA 1G3SA 2MWPA 2ZPHB 3OYGA 2GF7A 1VQ4A 1JJ2A 5CR2A 3CC2T 3I56T 5EG2A 3OYFA 3QZ5B 5GAN8 4BUGA 2E70A 5KH6A 5GAN7 5GAOn 2C06A 3LX7A 4M78A 1QVGS 3DLLA 3OW2A 5D6XA 3CMEA 1YCYA 4C8QF 4OB3B 1YJNT 2A3LA 3MEVA 4OB0B 2HQEA 2I2LA 3QBYA 4HCBA 1KD1C 4F7UA 2KK4A 2E64A 2DPPB 3SWNC 3OYBA 5FRMA 2CKKA 2RJEA 4OF1A 2L5QA 2ZPBB 5LJ3j 4M7DF 4A4EA 1ZHIA 3JCMJ 3E19A 5A0LA 3FDRA 3CCVA 1YI2A 5LJ5f 4MZTA 2KDSA 2L8DA 5J26A 2GFAA 5GAN6 2KQWA 3DB4A 4A4HA 1FXXA 3L2VA 3KBGA 3CCLA 2LX9A 2FHDA 2MAMA 4C92F 4M7AF 1XQHA 1UGQB 1YJ9A 1OI1A 1AHJB 5CKDA 3CCQA 2VV5A 5GAOm 4TVRA 5GAOq 4PJOA 4LDYA 4DOWA 4GLKA 4J83A 4M75E 3OS2A 1VQ5T 2LRQA 2XD0A 1I5LA 5GMKh 2E65A 2EQMA 4M78D 2RD1A 4J6WA 4M75G 5J39A 3JB9D 4PLIA 1U1TA 2E6ZA 1VQ4T 2ZPGB 2CZ7B 5LJ5h 1G3TA 4RG2A 3RKWA 3VUZA 3HPWA 4CI0C 2K57A 2PU9B 4P5NA 3CMET 2X4YA 4A4GA 5GAMj 2EJ9A 1JJ2S 2K2VA 2DXUA 2YLCA 2O01E 2Y4YA 3C95A 1QVGA 2JTFA 5CIUA 5LJ3e 3P8BB 3VUBA 4F7UB 4M78C 4IKFA 1YI2T 4RCCA 3UT1A 3NTHA 5GAOp 3CCVT 2DJZA 2E5QA 3CBPA 5FROA 3C12A 4J6XA 2H3JA 4MDWA 1YBYA 5D6YA 3CCLT 1WJRA 3JCMV 4PJOD 2P0QA 2F69A 3JCMf 2GFUA 4N4GA 3BDLA 1YJ9T 1M4ZA 3CCQT 3LH0A 3ER0A 5LJ3g 3CCJT 3UPUA 2QQBA 3MP6A 1H641 3CXCA 2EJFA 1KQ2A 5GANf 4JLGA 2EWNA 4DA4A 3L42A 4A54A 3QJYA 3OMGA 1K9MU 1QVPA 2P0PA 4M7DE 1SSFA 3VYGA 2JN0A 3RKYA 5GANj 1KHIA 4M7DG 4PJOC 2JVVA 3JAME 2RH2A 2RHIA 2WSFE 4NOYA 4A4KA 5LJ5d 2RJCA 5GMKi 5GAMe 2BUDA 4E7HA 1JBMA 5FU6C 1UB4A 2FYKA 3QUIA 3HL8A 3MCAB 1M1GA 3LGLA 4J8OA 4MZMA 5I2MA 3TEEA 1ZQ1A 4L5GA 3UDCA 3G6EA 4M7AE 2M0OA 2EIFA 2KVQG 4M7AG 1LJOA 3A8HB 4ZN3A 3OS1A 4BD3A 5GANh 1Y96B 4X9CA 4BACA 4QVDA 3M55A 4XTUA 1K8AC 1O75A 5M9OA 2R5MA 1VQPA 3JCMb 1Q7YU 1KC8C 4ELZC 1W4SA 2DTOA 5GAMg 3JCMQ 2WSEE 4MMLA 1VQ9A 3SD4A 2YLBA 1Q82C 2X4XA 4XK8E 4M75F 4CRIA 2EQJA 2LT1A 3OBYA 4XU0A 4LD9K 1M90U 1Y07A 5D6WA 2HQXA 1P92A 4M77B 3QDRB 3GP8A 2V8KA 2RB6A 3INZA 4UC4A 1VQNA 2LQKA 4C5IA 2LDMA 4C8QA 5IT9E 3RKXA 2DXCA 4BI3A 2DO3A 4QVZA 3LWIA 3QSUA 4BI4A 3C94A 2DTHA 5GANe 3GOXA 3EFSA 4Y91A 2OTJA 3JCMX 4V2SA 2V8JA 2YRVA 2M16A 3CC4A 2PUKB 3MP1A 4KBMB 4OMFB 2LTOA 3HRUA 4QQGA 3OYDA 3M58A 1YJWA 2D9TA 3GIBA 2K5LA 3M59A 2L89A 2A7YA 1EIFA 5DLQE 3G4SA 3G6ET 2DEQA 4C92A 3CMAA 4NL2A 3JCMd 4M7AA 1HXDA 3CBOA 3HKSA 3OB9A 2F5KA 5GANg 2NLUA 4IUPA 1BIAA 2QA4A 2QQRA 4ZTFA 5KCHA 5DY9A 3FJPA 1VQPT 1VQOA 1NJIC 5GANd 1U1SA 3SWNB 4OGCA 3RESA 4JS4A 3GNGA 1RL2A 1KQ1A 2LT4A 4ME7A 3X26B 3JB9H 2KSSA 4O6JA 4C8QD 3GPLA 1UGRB 3TU4K 1K73U 2CZ0B 3RMQA 4BDYA 1LNXA 2L3RA 1VQNT 3LLRA 2CS7A 1W2BA 2EQKA 3ME9A 4M7DD 3Q1JA 3M57A 5CKEA 2PQWA 3RERA 1UGPB 4QQ6A 3DB3A 4N4IA 3WXMB 4ZGEB 5GMKj 1U8RA 3GLXA 2OTJT 3OSSC 3BY7A 1Q7YC 1Q81C 3META 3CXCS 3CC4T 3G71A 1BI3A 2E6NA 2O4XA 3TCJA 4N4HA 5LL6S 5LJ5j 3S6WA 2DXBA 5GMKl 4C92D 1YJWT 4C5HA 4C8QC 4M7AD 2FB7A 2ZPFB 5CCAA 4LD6A 3G4ST 4BDZA 1PSFA 1M90C 1BI1A 4EMGA 3MO8A 2KY9A 4JRKA 3SFMA 3CMAT 3H6ZA 5DLOA 5GAOr 3HRTA 5HY6A 4HKEA 2BKDN 2LCCA 4C5GA 4E7JA 2QA4T 2M9UA 3A8GB 1VQLA 4PLLA 5CO7A 3JCMW 1VQOT 3X20B 2DTIA 2DVEA 3TREA 2RHUA 3L2WA 2MWOA 4L59A 4C92C 4E47A 4M7AC 4LDXA 4M78B 4M77E 3OYKA 1YIJA 5AYFA 1HK9A 1VQ6A 3M4YA 3FEOA 2IG0A 2DD5A 1PSEA 4M77G 3NFCA 3V7RA 5GAN3 1M1KU 1WPYA 3A8MB 1BIBA 5CK9A 2PVGB 4LDUA 1KG1A 3DLMA 2ZZDA 4J7IA 5GMKe 5FU7C 1KHCA 3NTIA 1KQSS 2XDPA 4XU1A 1G5VA 4KULA 4A53A 5LJ5e 3G71T 2VXEA 1B34A 3RMSA 4B9WA 4F7UF 1JB0E 2XU8A 2EKOA 4N0AA 4XTXA 3OS0A 4EMKA 1LOJA 3FB9A 3I55A 3SB2A 5FLXE 5KCOA 1NE8A 1XTDA 1VQ8A 2WACA 3J7AF 2HBPA 3M56A 4PNOA 4PJOB 4WF2A 4YTLA 3HFOA 4GY5A 4KT0E 4M75A 3V8LA 1YITA 3URGA 2DD4A 3ASKA 3QYHB 3CCST 4JRQA 1V29B 1VQMA 4BE2A 3QZ9B 3HRSA 5FU6B 3V8JA 5LJ5g 3MP8A 3MHXA 2XDDA 5I2SA 4A4FA 2QQAA 3AHUA 4JRIA 2VC8A 1WNLA 3X25B 1X75C 1YIJT 2LNVA 5L8RE 1YHQA 2EQUA 3V7CA 4Q5WA 3OYCA 4HA8A 3JCMP 1WJSA 5C0MA 3CD6A 4R55A 4FT2A 5IAYA 1N9RA 3WVDB 5C6SA 2QDYB 1GXIE 1RI0A 4HCZA 3PNWC 4E7KA 3DKMA 1MHNA 2GCXA 4O5VA 5J3BA 2X4WA 3L2UA 1X01A 3JRZA 2ZPEB 3BFMA 4IUTA 3V8KA 3CCUA 2RO0A 1W2BS 3J81E 1BKBA 2LCLA 3I55T 1B34B 5GAN2 2JNGA 2ZGWA 4M75D 1KQSA 2RK2A 4DQ2A 1FX7A 1OZ2A 1UEBA 3JCMe 4BE0A 4FL6A 3A5ZB 2EYQA 2B8AA 1DJ7B 3T9NA 2E41A 4D6WA 3CCRA 1YITT 4C0ZA 5A2QE 2HNIA 4DOVA 4N0AC 1VQMT 4EMKC 5GAN4 1K8AU 2RHXA 4XTWA 4OVAA 4M77F 4M78E 3QIIA 4M7DA 3VU3C 1MGQA 3ZFJA 4NL3A 4M78G 3H8ZA 3N5BB 2DIQA 3M53A 1VQ9T 1YHQT 3A8LB 4M75C 3OYNA 3EAEA 3JCMg 4F7UE 3CCEA 3CD6T 3LWHA 1WGSA 2QEXA 3S3NA 5DM7R 2Y4XA 2JOYA 4F7UG 4OB1B 2RJFA 5A0DA 3QXEB 2WSCE 4MMKA 5CAIA 3LGFA 3MEWA 2VGNA 1R8OB 1G3YA 1K9MC 5GAOl 2XK0A 1H3ZA 5CKFA 2FL7A 4ZN1A 4ZTJA 5KE3A 3V7SA 5CVIA 1TH7A 2BIVA 3CCUT 3E1SA 2RJDA 1Y71A 1VQ7A 3PIOA 1Y7XA 3A8OB 2D0QB 4XU2A 4XTYA 4PJOE 4E7IA 1JRIA 3F70A 2HAXA 2ZPIB 3OMCA 4PJOG 2AHJB 2JZ2A 4X9DA 5CKHA 3CCRT 2FVUA 4C0FA 3PFSA 2CYZB 4JLIA 4EPCA 3S3MA 1I81A 1QP2A 3QYGB 3CCMA 4C8QB 1VQKA 3QHSA 4XAXB 2K3XA 2XI9A 4FM4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RHI A;  3M9Q A;  4E7L A;  2RJC A;  2P0K A;  3OY9 A;  2BUD A;  1XNI A;  4QW2 A;  4E7H A;  2R57 A;  3DLM A;  4QQG A;  4Z02 A;  3OYJ A;  3LGL A;  1KHC A;  2LVM A;  3NTI A;  2X35 A;  4EDU A;  2XDP A;  1N27 A;  3S3O A;  1G5V A;  3OYH A;  2M0O A;  3QKJ A;  4B9W A;  3OS1 A;  4BD3 A;  2EKO A;  3OS0 A;  2R58 A;  2VYT A;  4BAC A;  3L2R A;  3KUF A;  5KCO A;  5M9O A;  1OZ3 A;  2R5M A;  3PMT A;  2WAC A;  3OYD A;  3L2Q A;  2QQS A;  4GY5 A;  2RHZ A;  3E9G A;  3NTK A;  3P8D A;  3SD4 A;  2MWP A;  2X4X A;  3ASK A;  4IUV A;  3OYG A;  2GF7 A;  4CRI A;  2EQJ A;  4BE2 A;  2K3Y A;  2RI5 A;  3OYF A;  3MP8 A;  5D6W A;  2HQX A;  5KH6 A;  4A4F A;  3LX7 A;  4UC4 A;  3FLG A;  4C5I A;  5D6X A;  2LDM A;  2EQU A;  4QVZ A;  4Q5W A;  3OYC A;  3MEV A;  4IUU A;  2HQE A;  1WJS A;  3O8V A;  3QBY A;  5C0M A;  3OA6 A;  3QJ6 A;  3OYB A;  2EFI A;  3GOX A;  5IAY A;  5FRM A;  2CKK A;  2RJE A;  4BE1 A;  2YRV A;  5C6S A;  2M16 A;  4A4E A;  3LYI A;  3P8H A;  1RI0 A;  3MP1 A;  3PMI A;  3FDR A;  2LTO A;  2O4X B;  3PNW C;  1MHN A;  4HCZ A;  4IUQ A;  2D9T A;  4IUR A;  2X4W A;  3OYM A;  3OYA A;  3L2U A;  5IN1 A;  2L89 A;  2L8D A;  5J26 A;  2GFA A;  3ZEH A;  3DB4 A;  4A4H A;  3C4S A;  3L2V A;  4IUT A;  2RI3 A;  3MEA A;  2FHD A;  3CEY A;  3OB9 A;  2RO0 A;  2F5K A;  2NLU A;  4IUP A;  4QQD A;  2R5A A;  2QQR A;  4ZTF A;  1OI1 A;  5KCH A;  1OZ2 A;  4BE0 A;  4FL6 A;  3OS2 A;  4NS5 A;  2B8A A;  2LRQ A;  2EQM A;  5J39 A;  4PLI A;  4E7K A;  2G3R A;  2RHX A;  4C5E A;  4OVA A;  4RG2 A;  3QII A;  4BDY A;  2L3R A;  3LLR A;  3OYE A;  3H8Z A;  2EQK A;  2M1H A;  2X4Y A;  3ME9 A;  2DIQ A;  3Q1J A;  4II1 A;  4X34 A;  4A4G A;  2PQW A;  3OYN A;  3EAE A;  4QQ6 A;  3DB3 A;  3OYL A;  4N4I A;  1WGS A;  3S3N A;  1WJQ A;  2JTF A;  2RJF A;  3MET A;  5CIU A;  3UWN A;  3OYI A;  2O4X A;  2E6N A;  3E9F A;  4N4H A;  1OYX A;  3S6W A;  3LGF A;  3MEW A;  3UT1 A;  3NTH A;  4IKF A;  4C5H A;  2E5Q A;  4LD6 A;  2XK0 A;  5FRO A;  4BDZ A;  4ZTJ A;  1H3Z A;  5KE2 A;  3MO8 A;  2RHY A;  5KE3 A;  3MEU A;  5FRN A;  5D6Y A;  1WJR A;  2BIV A;  3H6Z A;  2RJD A;  4FU6 A;  2RI2 A;  3FC3 A;  2BKD N;  2LCC A;  4C5G A;  4E7J A;  2GFU A;  4N4G A;  3BDL A;  3LH0 A;  4PLL A;  4E7I A;  3F70 A;  2RHU A;  3MP6 A;  3OMC A;  3L2W A;  2JZ2 A;  2MWO A;  4L59 A;  3OQ5 A;  3PFS A;  3S3M A;  3OYK A;  3L42 A;  2DIG A;  4PL6 A;  3FEO A;  2IG0 A;  3OMG A;  2K3X A;  4B9X A;  1SSF A;  2DAQ A; 
#chains in the Genus database with same CATH topology
 3RUX A;  2OI3 A;  2IVW A;  1YNZ A;  2V8I A;  4JJD A;  2JS2 A;  2RM4 A;  3HP9 A;  2R57 A;  4Z02 A;  2LVM A;  1RAG B;  3OYH A;  2EAY A;  3QKJ A;  4M7D C;  2CP0 A;  2MPX C;  1M3C A;  2L3S A;  2PUO B;  2R58 A;  1H3H A;  2VYT A;  3HFN A;  1WHH A;  2OTL A;  1M2O A;  2QQS A;  4BY6 C;  3NTK A;  3JSC A;  4IUV A;  3CC2 Q;  2RI5 A;  5LJ3 h;  3I56 Q;  2DL4 A;  2PVO B;  2E5K A;  1VQK T;  2EGE A;  1YJN Q;  2MMP A;  1R0C B;  3G7Z A;  3RIR A;  4VUB A;  5GAM f;  3CPW S;  3LYI A;  3P8H A;  5A0G A;  3PMI A;  2O4X B;  4KUI A;  3OYA A;  3OYM A;  2YUP A;  3OYY A;  2ESW A;  3C4S A;  1O9S A;  1NZ9 A;  3NHN A;  3PIP A;  4RKU E;  1BI0 A;  4NS5 A;  1VQ6 T;  1M8V A;  1VQK Q;  1VQ4 Q;  1X6O A;  2JM9 A;  2DNU A;  3A1P A;  1Q86 U;  2LQ8 A;  2CZ6 B;  1TUC A;  2M1H A;  5LJ3 d;  2O88 A;  1D1B A;  1WJQ A;  1PG5 B;  3LW5 E;  2VGM A;  1IB8 A;  1WQ7 A;  2DZC A;  1S72 T;  2QGG A;  2RQT A;  2EJG A;  1S1N A;  2RI2 A;  4DBR A;  4FT4 A;  2D8J A;  1NLP C;  4MZP A;  1YJ9 Q;  1BB9 A;  2MI6 A;  1K8A R;  4E2F B;  1N9S A;  1KC8 R;  3OQ5 A;  1EFN A;  4CC2 A;  2CGH A;  1Q82 R;  2KRM A;  2DIG A;  2MIO A;  2ED0 A;  2QAZ A;  2XID A;  3PT9 A;  3MKD A;  5ECA A;  4KRT A;  1QVF A;  3OY9 A;  3OYJ A;  4EDU A;  4M77 C;  1JXO A;  1VUB A;  3HTR A;  4ZGD B;  1MMD A;  5GAN 5;  3VKI A;  4AMC A;  1LVK A;  5KYW B;  2KMT A;  3KUF A;  3L2R A;  2JUF A;  1Q86 C;  3C0C A;  3FIF A;  1BI2 A;  3HHT B;  2HL3 A;  1WHL A;  2ZPH B;  3OYG A;  2GF7 A;  4OMN A;  2F2W A;  1VYU A;  1NJI R;  5GAO n;  1GBQ A;  5D6X A;  1C6V X;  1T3S A;  4HCB A;  3FJ5 A;  3SWN C;  1PKS A;  2RJE A;  4HVV A;  4OF1 A;  5IXB A;  1J3T A;  1YWP A;  4CC4 B;  2J7I A;  2YUO A;  2GBQ A;  2KQW A;  1U06 A;  1FXX A;  1Q81 R;  3CCL A;  3AT1 B;  5KYY B;  5GAO m;  4PJO A;  1VQP Q;  4LDY A;  4GLK A;  4J83 A;  1LPL A;  2QTV A;  3ZL7 C;  2E6Z A;  2VAS A;  3RKW A;  4JPB W;  1WHM A;  2E3H A;  1W2B P;  5GAM j;  2RMO A;  2EJ9 A;  2DXU A;  1PRL C;  2O01 E;  1QVG A;  4IKF A;  5FWB A;  1YJW Q;  5FRO A;  3C12 A;  1X27 A;  1YBY A;  4FW1 A;  1WJR A;  4PJO D;  2V1Q A;  3JV3 A;  3LH0 A;  3ER0 A;  2GTJ A;  5LJ3 g;  3CCJ T;  2YUQ A;  3REB B;  3CXC A;  1KQ2 A;  1ZBJ A;  5AT1 B;  1KIK A;  1QVP A;  2K7A A;  1KHI A;  4M7D G;  1SHG A;  4A4K A;  2RJC A;  2C0I A;  4MZM A;  1SSH A;  2KYB A;  3TEE A;  2RQW A;  4L5G A;  3G6E A;  4M7A E;  4LE9 A;  2CT4 A;  3RBB B;  1LJO A;  3G71 Q;  2ROT A;  3OS1 A;  4X9C A;  1BU1 A;  3M55 A;  1K8A C;  4J9C A;  2IPO B;  2DIL A;  1KC8 C;  4ELZ C;  3JCM Q;  2YLB A;  1Q82 C;  1NBE B;  5D6W A;  2HQX A;  1P92 A;  3GP8 A;  2PZ1 A;  2RB6 A;  1FMW A;  1VQN A;  2COW A;  5IT9 E;  3RKX A;  2DXC A;  2DO3 A;  2EYW A;  4QVZ A;  3C94 A;  2A08 A;  3GOX A;  3JCM X;  1NYG A;  2YRV A;  3CC4 A;  4KBM B;  4QQG A;  3HRU A;  3M58 A;  2W0Z A;  3UAT A;  1D1A A;  1T0H A;  1HXD A;  3CBO A;  2F5K A;  2NLU A;  2QQR A;  5KCH A;  5DY9 A;  3FJP A;  1NJI C;  1RL2 A;  2DJQ A;  2A0F B;  2LT4 A;  1X6G A;  2OX7 A;  3JB9 H;  1QQJ A;  2SRC A;  1K73 U;  1LNX A;  3ME9 A;  4M7D D;  4QQ6 A;  3WXM B;  4LUD A;  3EFO A;  5GMK j;  2X3X D;  2QYZ A;  3OSS C;  3MET A;  3CXC S;  3CCS T;  1Q81 C;  2E6N A;  1ZSZ A;  2DER A;  4C5H A;  4C8Q C;  1QVF P;  5CCA A;  4BDZ A;  3G4S T;  1BI1 A;  2KY9 A;  1AVZ C;  1TUD A;  3H6Z A;  3CMA T;  5GAO r;  6AT1 B;  5HY6 A;  3TSZ A;  2LCC A;  4C5G A;  1UJY A;  1UE9 A;  2DTI A;  3TRE A;  2MWO A;  4C92 C;  4M7A C;  1YIJ A;  1VQ6 A;  5D7U A;  4M77 G;  1PSE A;  3NMZ C;  1M1K U;  1BIB A;  2PVG B;  3PVQ A;  2ZZD A;  1Z9Q A;  3NTI A;  2QEX Q;  3G4S Q;  2XDP A;  3H0F A;  4KUL A;  1I0C A;  4A53 A;  5LJ5 e;  2VXE A;  1B34 A;  3CMA Q;  8AT1 B;  1V1C A;  2DVJ A;  3OS0 A;  3I55 A;  5KCO A;  2DRK A;  1AWO A;  1OOT A;  4PJO B;  4WF2 A;  2KNB B;  4M75 A;  3URG A;  3ASK A;  1CSK A;  1M2V A;  1VQM A;  5FU6 B;  3U23 A;  2FRY A;  3H0I A;  4JRI A;  2VC8 A;  1X75 C;  5L8R E;  3V7C A;  5GJW B;  4HA8 A;  1T0J A;  4R55 A;  3NGP A;  2JMA A;  5C6S A;  2H8H A;  2QDY B;  4E7K A;  3DKM A;  1MHN A;  2X4W A;  2ECZ A;  1X01 A;  1QKX A;  2DMO A;  2L2P A;  1M30 A;  2KE9 A;  2NUP A;  3CCU A;  1ABQ A;  1QVG P;  2AKL A;  2JTE A;  4M75 D;  2ZGW A;  1VQL Q;  1U5S A;  1FX7 A;  3JCM e;  2LCS A;  1R77 A;  3CCR A;  5A2Q E;  2HNI A;  1G2B A;  4RTT A;  1MGQ A;  3EGX B;  1QWF A;  2DIQ A;  3CXC P;  3M53 A;  1YHQ T;  3A8L B;  3OYN A;  2M02 A;  2FPE A;  3CCE A;  3CQT A;  1X2K A;  3LWH A;  5DM7 R;  1X6B A;  3EG3 A;  3QXE B;  2CUD A;  4IIM A;  5GAO l;  1NM7 A;  2LZ6 B;  3V7S A;  3I5S A;  2DYI A;  1Y7X A;  1D0X A;  1ZX6 A;  1MNE A;  4XU2 A;  4XTY A;  4PJO E;  2ZPI B;  2E3I A;  2EGA A;  4X9D A;  1Z9Z A;  4FSS A;  1YHQ Q;  3CCM A;  3UA7 A;  2QI2 A;  2D1X A;  4M7D B;  4RUG A;  3VS3 A;  2FRW A;  2F5T X;  5LJ3 f;  1M3B A;  4FSX A;  4ATO A;  1KD1 R;  4OGE A;  4OMP A;  1RLP C;  2Y90 A;  2DLP A;  5IXF A;  4BY6 B;  2KXC A;  1VQ7 T;  4HXJ A;  1BYM A;  4L6V 5;  2DXT A;  2JS0 A;  1JJ2 P;  5FU7 B;  3RNJ A;  3CCJ A;  1M5Q 1;  4C0G A;  3GF5 A;  3FLG A;  2KAF A;  1NLO C;  1W6X A;  1JO8 A;  3QJ6 A;  2Z0W A;  4OP0 A;  3L2Z A;  4BE1 A;  3EFO B;  4JUV A;  2E12 A;  2XHC A;  5IN1 A;  3TQ7 P;  2M0Y A;  4Y28 E;  1HJD A;  2RI3 A;  2E1H A;  1Y96 A;  3MEA A;  1PRM C;  4J7F A;  2FEI A;  3KXT A;  1TG0 A;  2DL8 A;  3FRN A;  3VS0 A;  1AWJ A;  2ZCF B;  4PJO F;  1FWZ A;  4ZGJ B;  2KI7 A;  2P4T A;  3VV0 A;  5HKC A;  2HSP A;  3JB9 I;  2HKN A;  4DEY A;  4HT8 A;  4C8Q G;  4X34 A;  4KGZ B;  1AZE A;  3UWN A;  4PJJ A;  4RMO A;  1H92 A;  2DK3 A;  4JS5 A;  1KD1 U;  1QWE A;  3CPW A;  5KE2 A;  2YHT A;  3EG9 A;  4FU6 A;  4C92 G;  3CCL Q;  1YP5 A;  2KR3 A;  2L0A A;  3OW2 S;  1ZUY A;  4M75 B;  4HT9 A;  1M2V B;  3H9N A;  3CC7 T;  3JB9 G;  3QPH A;  4QVC A;  1QCN A;  1U3O A;  1BCO A;  2JTM A;  4PL6 A;  4RG8 A;  2K4Y A;  4OB2 B;  3BDU A;  4OMO A;  1RAC B;  5I22 A;  2O9S A;  3CBM A;  1OPL A;  4EMH A;  3JCM c;  2X3W D;  4XU3 A;  2HEQ A;  3CCS A;  3OS5 A;  5KYY A;  2NUP B;  3M5A A;  1M1F A;  3PMT A;  4DBF A;  3E9G A;  3CC2 T;  5CR2 A;  3I56 T;  5EG2 A;  2FZK B;  1TSF A;  4BUG A;  3RDV A;  2HKQ B;  1M27 C;  5GAN 7;  4M78 A;  2LMJ A;  3CME A;  1YJN T;  3QBY A;  1GBR A;  1KD1 C;  2HZY A;  2DPP B;  4RTU A;  5FRM A;  2L5Q A;  2K3B A;  5LJ3 j;  4M7D F;  3E19 A;  3FDR A;  3CCV A;  1YI2 A;  4MZT A;  1NEG A;  2L8D A;  2GFA A;  3DB4 A;  1B7T A;  4J9D A;  2LX9 A;  2MAM A;  1XQH A;  1UGQ B;  4DOW A;  1WA7 A;  1VQ5 T;  4M75 E;  2XD0 A;  1AOJ A;  3JB9 D;  2E65 A;  1I5L A;  4M78 D;  5L23 A;  2DL3 A;  4PLI A;  1U1T A;  1VQ4 T;  3THK A;  4RG2 A;  2EW3 A;  1IRX A;  3VUZ A;  4CI0 C;  2K57 A;  1VQN Q;  4P5N A;  4QT7 A;  1VA7 A;  2K2V A;  4J9I A;  2YLC A;  2CP5 A;  3P8B B;  1SRL A;  3CC4 Q;  3EGU A;  4RCC A;  3NTH A;  1PNJ A;  5HCK A;  2DJZ A;  5D6Y A;  1VQ5 Q;  2DL5 A;  2JXB A;  2KEA A;  4Z89 A;  4N4G A;  1YJ9 T;  3CCQ T;  2F1L A;  1TOV A;  2QQB A;  1IHV A;  1SPK A;  2QK0 A;  1ABO A;  1D0Y A;  5IHN A;  4DA4 A;  3L42 A;  3QJY A;  4KH0 B;  2JN0 A;  3RKY A;  1W70 A;  1K1Z A;  2RH2 A;  2RHI A;  2WSF E;  5GAM e;  2BUD A;  3EGD A;  4M4Z A;  4E7H A;  1UB4 A;  2GQI A;  4J8O A;  3HL8 A;  1M1G A;  2EPD A;  3LGL A;  1PKT A;  3UDC A;  2M0O A;  4BD3 A;  2LJ1 A;  1Y96 B;  4BAC A;  2AT1 B;  3CCQ Q;  4XTU A;  2BZ8 A;  4WCI A;  4OMQ A;  2WSE E;  4MML A;  2A36 A;  1VOM A;  3SD4 A;  2QAS A;  4M75 F;  1GFC A;  2EQJ A;  4XU0 A;  1M90 U;  1NG2 A;  2LJ0 A;  1NEB A;  1IHW A;  3INZ A;  4RTY A;  4UC4 A;  4C5I A;  2LDM A;  4BI3 A;  3QSU A;  4BI4 A;  2OTJ A;  1QLY A;  1WIE A;  2CP2 A;  4B6M A;  2PUK B;  4OMF B;  3OYD A;  3GIB A;  1RUW A;  2K5L A;  2O31 A;  2A7Y A;  2DEQ A;  3BE3 A;  3EG9 B;  2JM8 A;  5GAN g;  2QA4 A;  4ZTF A;  1VQP T;  4OGC A;  4EIK A;  3CPW P;  3X26 B;  2YRD A;  1IGU A;  3TU4 K;  1OU9 A;  2L3R A;  1AWW A;  1K0X A;  2KRS A;  3Q1J A;  3M57 A;  1UGP B;  1VQ9 Q;  3DB3 A;  4J9G A;  3BY7 A;  1NYF A;  1BI3 A;  4CC3 A;  3S6W A;  1YJW T;  2FB7 A;  1R0B G;  1WXB A;  2EYY A;  4Z8A A;  1PSF A;  1M90 C;  5DLO A;  3CCU Q;  2M9U A;  1IGQ A;  4PLL A;  3JCM W;  1VQO T;  3L2W A;  1ZUU A;  3TVT A;  1UHF A;  4LDX A;  4M78 B;  1HK9 A;  3FEO A;  1OEB A;  2LJ3 A;  3V7R A;  2VB6 A;  3A8M B;  2DX1 A;  5CK9 A;  4J7I A;  5GMK e;  3CCE Q;  1VYT A;  1KQS S;  3VRY A;  1UUE A;  3G71 T;  4B9W A;  1JB0 E;  1ZUK A;  4N0A A;  4XTX A;  4EMK A;  3QDF A;  3FB9 A;  1NE8 A;  1VQO Q;  1K73 R;  3J7A F;  1RLQ C;  2GGR A;  4YTL A;  3VS6 A;  3HFO A;  4KT0 E;  3EGX A;  4BE2 A;  3HRS A;  2XDD A;  2QQA A;  3AHU A;  1WNL A;  1H8K A;  3X25 B;  3E2U A;  3CCM Q;  1PM3 A;  3CD6 A;  1N9R A;  2YRC A;  1RI0 A;  1GCQ C;  1JQQ A;  2HBW A;  3JRZ A;  1C0M A;  4E7S A;  4IUT A;  3V8K A;  1UGV A;  2RO0 A;  2LCL A;  3M0U A;  4WTO B;  1UEB A;  1YCS B;  2EYQ A;  1M1K R;  1OUL A;  4RTX A;  3T9N A;  1YIT T;  2EVR A;  3MJX A;  4OVA A;  4M78 E;  4M7D A;  3N5B B;  3EGD B;  4F7U G;  2JOY A;  5A0D A;  2DEU A;  1M3A A;  5CAI A;  3LGF A;  3MEW A;  1G3Y A;  3ULR B;  2XK0 A;  2FL7 A;  4ZN1 A;  1VQ8 Q;  2K79 A;  1TWB A;  2BIV A;  1Y71 A;  2CH4 A;  3PIO A;  1YIT Q;  3A8O B;  4E7I A;  3F70 A;  2HAX A;  1M8M A;  1WX6 A;  5CKH A;  4LNP A;  2CYZ B;  4JLI A;  2OJ2 A;  3S3M A;  1QP2 A;  3QYG B;  1VQK A;  4XAX B;  3EG1 A;  2RN8 A;  1KFZ A;  2CZ1 B;  2HQH A;  1SEM A;  2RQV A;  3X24 B;  2QEX T;  2XIC A;  2CT3 A;  2JW4 A;  3M0S A;  3PTA A;  1GRI A;  3RR6 A;  2FZG B;  4FCY A;  4HVU A;  1OZ3 A;  2VKN A;  1OQK A;  4AFU C;  2RHZ A;  4FIB A;  1UJ0 A;  1CKB A;  2DZ9 A;  2XKO C;  2K3Y A;  2GTO A;  2BZX A;  1I4K 1;  5IHK A;  1WQW A;  3JB9 F;  4M78 F;  4RTW A;  1TTH B;  1QP3 A;  5CKB A;  4X1V A;  4IUU A;  3OA6 A;  2NUZ A;  1N5Z A;  2QG9 B;  1MND A;  1D3B B;  1S72 A;  3EFR A;  1K73 C;  2P84 A;  1AD5 A;  4LDW A;  5GMK m;  1WFW A;  1VQL T;  1UDL A;  2R5A A;  2V1R A;  4XQ3 A;  2OTL T;  1N6A A;  4AG2 C;  1MV0 B;  2ATC B;  4JZ3 A;  4M77 A;  4J6Y A;  3I35 A;  4C0D C;  1AWX A;  2FO0 A;  1UG1 A;  4ZNX A;  2YWW A;  1EZZ B;  2DKG A;  1UGS B;  4D8K A;  4II1 A;  3CME Q;  3OYL A;  2QTX A;  2ED1 A;  1VIE A;  2JT4 A;  3OYI A;  1RAE B;  3E9F A;  1OYX A;  3IQL A;  3M0Q A;  1FMK A;  2X4J A;  4DBQ A;  3ZBD A;  5HK0 A;  4EMK B;  2OTL Q;  1C1A A;  3MEU A;  1M1K C;  2VVK A;  2VUB A;  3M0T A;  1VIF A;  3FC3 A;  2D6F A;  1G3W A;  3G1J A;  3SWN A;  1K9A A;  4M77 D;  2LC4 A;  1BBZ A;  4JJN K;  3OSV A;  4KUD K;  1XOV A;  2J6O A;  1ZBX A;  2F2V A;  1TXQ A;  1A0N B;  4B9X A;  2DAQ A;  4A63 B;  2E10 A;  3EHR A;  2XDB A;  3QO3 A;  2K5F A;  1UTI A;  4PFP A;  3SDZ A;  2MF2 A;  4D8D A;  3M4G A;  3MPU B;  3S3O A;  1V76 A;  3JB9 J;  1ZA1 B;  5IH2 A;  4LDV A;  3GNF B;  1F1B B;  2M51 A;  1OX9 A;  2YSQ A;  3QG1 A;  1Y0M A;  4LN2 A;  4J9E A;  2K6D A;  4PFZ A;  2GQV A;  2A37 A;  1G3S A;  2MWP A;  1HYO A;  2JMC A;  9ATC B;  5GAN 8;  2COY A;  2E70 A;  2X51 A;  2C06 A;  1ARK A;  1JEG A;  3DLL A;  4F16 A;  3OW2 A;  1X2Q A;  1YCY A;  2EYZ A;  4OB3 B;  4JJC A;  2A28 A;  3MEV A;  3OYB A;  2E64 A;  4PFO A;  2CKK A;  1SHF A;  2ZPB B;  1BK2 A;  5A0L A;  2KGT A;  2KDS A;  5GAN 6;  5J26 A;  5KYU A;  4Z88 A;  2C0T A;  2LQW A;  3L2V A;  1Q7Y R;  1ZA2 B;  3A98 A;  3EH2 A;  1IXD A;  2FZC B;  5CKD A;  2KXD A;  1OX8 A;  2KRO A;  5J39 A;  2CZ7 B;  5LJ5 h;  2X4Y A;  4HCK A;  1PC0 A;  1D0Z A;  2DF6 A;  3C95 A;  2JTF A;  5CIU A;  5LJ3 e;  4F7U B;  2J6K A;  5GAO p;  3UT1 A;  2E5Q A;  3CBP A;  4J6X A;  1JU5 C;  2H3J A;  4MDW A;  3CCL T;  3JCM V;  3I9Q A;  2P0Q A;  2BZY A;  2F69 A;  2GFU A;  3BDL A;  1Q95 G;  4AFZ C;  3MP6 A;  1H64 1;  1LCK A;  4JLG A;  1GL5 A;  2EWN A;  1QCF A;  1K9M U;  2J05 A;  4M7D E;  2VWF A;  1SSF A;  3VYG A;  5GAN j;  4PJO C;  2JVV A;  3JAM E;  5LJ5 d;  5GMK i;  1JBM A;  1K0S A;  5FU6 C;  3JCM h;  5I2M A;  1ZQ1 A;  2EBP A;  1WHJ A;  2ROL A;  4M7A G;  1WHK A;  5GAN h;  4QVD A;  2R5M A;  3JCM b;  1Q7Y U;  4Y92 A;  1W4S A;  2DTO A;  4XK8 E;  4CRI A;  2LT1 A;  4LD9 K;  1Y07 A;  4M77 B;  2LQK A;  4C8Q A;  2CP7 A;  4RTV A;  3LWI A;  2MYS A;  2DTH A;  3EFS A;  4OML A;  1WLP B;  2MK5 A;  4V2S A;  2V8J A;  4AG1 C;  2M16 A;  8ATC B;  2D9T A;  1QKW A;  2CH4 W;  3M59 A;  2D8H A;  3G4S A;  1EIF A;  3G6E T;  4C92 A;  3CMA A;  2DM1 A;  3JCM d;  4M7A A;  3OB9 A;  1SF9 A;  1TUG B;  2KT1 A;  5GAN d;  2OAW A;  3SWN B;  3RES A;  4ME7 A;  4C8Q D;  1X43 A;  2EYX A;  2CZ0 B;  3RMQ A;  1VQN T;  2CS7 A;  1W2B A;  2PQW A;  3RER A;  5FWC A;  3VS5 A;  3G6E Q;  3GLX A;  1I1J A;  4FW2 A;  1Q7Y C;  3CC4 T;  1WI7 A;  4N4H A;  2DXB A;  5GMK l;  4C92 D;  4M7A D;  4FYX B;  1M90 R;  4EMG A;  3MO8 A;  2PTK A;  4JRK A;  1MV3 A;  2B86 A;  3HRT A;  2CP6 A;  3A8G B;  4E6R A;  5CO7 A;  1VQL A;  1AT1 B;  2DVE A;  1KK7 A;  4J9H A;  4M77 E;  3OYK A;  2E4H A;  2LX7 A;  1ZLM A;  3UF4 A;  3NFC A;  5GAN 3;  1KG1 A;  3OW2 P;  5FU7 C;  1KHC A;  1UHC A;  2EGC A;  1YFN A;  5KYX A;  2KRN A;  4F7U F;  3RMS A;  5KYU B;  4ORZ A;  2XMF A;  2HSE B;  4LXC A;  3I5R A;  3SB2 A;  2WAC A;  3M56 A;  1ZSZ C;  4JRQ A;  2DA9 A;  1V29 B;  3QZ9 B;  1WHG A;  1WXU A;  4FYV B;  5LJ5 g;  3MP8 A;  4A4F A;  1MUZ A;  2RQU A;  1YIJ T;  2NWM A;  2LNV A;  1YHQ A;  2EQU A;  3JCM P;  3OYC A;  3VS1 A;  4FT2 A;  5IAY A;  2EKH A;  4F14 A;  2HL5 C;  2P4R A;  1GXI E;  3PNW C;  4O5V A;  1WZO A;  3L2U A;  3BFM A;  2I0N A;  4AFS C;  1W2B S;  3J81 E;  1BKB A;  3I55 T;  1KSW A;  5GAN 2;  2JNG A;  1KQS A;  4DQ2 A;  1OZ2 A;  4FL6 A;  1ZSG A;  2KYM A;  3A5Z B;  2B8A A;  2E41 A;  1WDX A;  4D6W A;  3EG2 A;  4C0Z A;  4J9B A;  1YIJ Q;  1VQM T;  1VQ6 Q;  3GBQ A;  5GAN 4;  2RHX A;  4M77 F;  2D0N A;  3QII A;  3VS2 A;  3VU3 C;  3ZFJ A;  3H8Z A;  4FYY B;  1N8R R;  4K11 A;  1VQ9 T;  4M75 C;  3EAE A;  3EHQ A;  3JCM g;  4PJM A;  1WGS A;  2DYB A;  2Y4X A;  4OB1 B;  2RJF A;  4MMK A;  2VGN A;  3I55 Q;  1R8O B;  1S72 Q;  1H3Z A;  5CKF A;  4ZTJ A;  5KE3 A;  3CCU T;  1VQ7 A;  3M0R A;  3E1S A;  2KBT A;  2RJD A;  3H0H A;  1TU0 B;  4JZ4 A;  1VQM Q;  1RAF B;  2D0Q B;  1JRI A;  4AFQ C;  4IIO A;  4ANJ A;  3REA B;  4PJO G;  3CCR T;  4EPC A;  2V26 A;  4C8Q B;  3QHS A;  2XI9 A;  1D3B A;  2ABL A;  2HDA A;  3M9Q A;  4E7L A;  2P0K A;  3CCE T;  1SRM A;  2X35 A;  4PKC C;  1RI9 A;  2LP5 A;  4C92 B;  3CPF A;  4M7A B;  1KJW A;  3M54 A;  4KH1 B;  1UFF A;  2O2O A;  3L2Q A;  5FW9 A;  3CCR Q;  4ELY C;  3UA6 A;  2AZV A;  4RCB A;  5I11 A;  2PNI A;  1NPR A;  2LQN A;  4QKU A;  2BTT A;  3L1A A;  3CCM T;  3O8V A;  1K4U S;  1K8A U;  2EFI A;  3NPF A;  1KC8 U;  1N8R U;  3HSB A;  4J5Y A;  1Q82 U;  4IUQ A;  2YUN A;  4IUR A;  2RQR A;  3ZEH A;  4PJN A;  4MDX A;  1G83 A;  2RK1 A;  3CEY A;  1IRE B;  2DFU A;  4BB7 A;  4QQD A;  2HD0 A;  2RF0 A;  3M0P A;  1IZ6 A;  2QDL A;  1IO6 A;  4BI8 B;  2FPD A;  1M9S A;  4C0D B;  5GAM h;  3CC7 A;  2OAU A;  1QVF S;  4R56 A;  3WVE B;  3R6N A;  2G3R A;  1QW1 A;  4C5E A;  2AIR B;  2QXF A;  1I8F A;  1NPP A;  2VXF A;  4C8Q E;  3OYE A;  3SHW A;  4HCC A;  5I21 A;  2MOX A;  1E6H A;  1NJI U;  3VJP A;  3BW1 A;  1E6G A;  3SEM A;  4JDS A;  5KYX B;  2RA2 A;  3VS7 A;  4XTZ A;  1VQ8 T;  2QQ9 A;  1YWO A;  2XG8 D;  4C92 E;  2RHY A;  5FRN A;  1SKU B;  1RAD B;  2K5I A;  3CC2 A;  3I56 A;  3CCJ Q;  3J80 E;  2CRE A;  1X69 A;  4AT1 B;  1Q81 U;  1RAA B;  2CSI A;  1N8R C;  1ACM B;  5HK3 A;  1D1C A;  1CKA A;  3PGG A;  5GAM d;  1YJN A;  1QCO A;  3LH5 A;  5EC7 A;  3OBW A;  1XNI A;  4QW2 A;  3X28 B;  3R6O A;  1N27 A;  4ESR A;  4JRP A;  3VYH B;  4XTV A;  5CQY A;  2AK5 A;  4GLM A;  1HSQ A;  5CQX A;  2PVD B;  1VQ5 A;  3P8D A;  1VQ4 A;  1JJ2 A;  1UEC A;  3OYF A;  2H3E B;  3QZ5 B;  1GFD A;  5KH6 A;  1KQS P;  3LX7 A;  1QVG S;  2G6F X;  4C8Q F;  2A3L A;  4OB0 B;  2C0O A;  2HQE A;  2I2L A;  1XJW B;  1PD0 A;  4F7U A;  2KK4 A;  1W1F A;  2EQI A;  4A4E A;  1ZHI A;  3JCM J;  5LJ5 f;  5IHI A;  1B3Q A;  4A4H A;  1PD1 A;  3KBG A;  2FHD A;  4C92 F;  4M7A F;  1MMN A;  1YJ9 A;  1OI1 A;  1AHJ B;  1K76 A;  3CCQ A;  2VV5 A;  4TVR A;  5GAO q;  3OS2 A;  2L3Q A;  2LRQ A;  2YT6 A;  2QGF B;  7AT1 B;  2EQM A;  5GMK h;  2RD1 A;  4J6W A;  4M75 G;  3KFV A;  2ZPG B;  2DET A;  1G3T A;  2CDT A;  1T3L A;  3HPW A;  2PU9 B;  3D7S B;  3CME T;  2J06 A;  4A4G A;  2X9H A;  2ZAE A;  4LUE A;  1EX4 A;  2Y4Y A;  4GBQ A;  3VUB A;  4FYW B;  4M78 C;  3CCS Q;  1YI2 T;  3CCV T;  4OMM A;  2CUB A;  1I5O B;  2DRM A;  3JCM f;  1M4Z A;  4JJB A;  2K2M A;  3UPU A;  1OU8 A;  2EJF A;  5GAN f;  2NUT A;  1SG5 A;  1RAH B;  4A54 A;  2AKK A;  3OMG A;  2DBK A;  2P0P A;  4NOY A;  4HVW A;  1YI2 Q;  3CCV Q;  2FYK A;  3QUI A;  1JJ2 S;  1VQ9 A;  3MCA B;  2EIF A;  2KVQ G;  4ZN3 A;  3A8H B;  2HCK A;  2O9V A;  2CP3 A;  4J9F A;  2JJ9 A;  1B07 A;  1O75 A;  5M9O A;  1VQP A;  5GAM g;  2X4X A;  2HMA A;  3OBY A;  3H41 A;  3EG0 A;  3QDR B;  1BCM A;  2V8K A;  2K9G A;  2FPF A;  5GAN e;  2BE9 B;  4DBH A;  3QWY A;  4Y91 A;  3TSW A;  3MP1 A;  2LTO A;  1YJW A;  1TS9 A;  2L89 A;  5DLQ E;  2BE7 D;  2IIM A;  1D09 B;  4NL2 A;  3HKS A;  4IUP A;  1BIA A;  1K9M R;  4F17 A;  1VQO A;  1U1S A;  4JS4 A;  3GNG A;  2AZS A;  1G8X A;  1KQ1 A;  2KSS A;  4O6J A;  3GPL A;  1UGR B;  3PE0 A;  2GNC A;  4BDY A;  3EH1 A;  1FYN A;  3LLR A;  2EQK A;  5CKE A;  5KYN A;  4N4I A;  2YXY A;  4ZGE B;  1U8R A;  1FMV A;  2OTJ T;  3VS4 A;  3G71 A;  2O4X A;  5LJ5 j;  3TCJ A;  5LL6 S;  2ZPF B;  2DL7 A;  4LD6 A;  1AEY A;  3SFM A;  2CSQ A;  4HKE A;  2BKD N;  4E7J A;  2QA4 T;  3X20 B;  4CC7 A;  2RHU A;  3QWX X;  4L59 A;  2FG0 A;  4E47 A;  4PJL A;  1GCQ A;  5AYF A;  4E7Z A;  3M4Y A;  1QMC A;  1PWT A;  2IG0 A;  2DD5 A;  2L3P A;  1AZG B;  1RAI B;  2OTJ Q;  4KGV B;  1WPY A;  2YDL A;  1GCP A;  4LDU A;  1PHT A;  3DLM A;  4XU1 A;  1G5V A;  2J6F A;  2XU8 A;  2EKO A;  1LOJ A;  2DE0 X;  2QA4 Q;  1ZSZ B;  5FLX E;  1XTD A;  1VQ8 A;  2HBP A;  1VQ7 Q;  4PNO A;  4GY5 A;  3V8L A;  1YIT A;  1RAB B;  2DD4 A;  3QYH B;  1E7O A;  3V8J A;  2ENM A;  3MHX A;  5I2S A;  1MMG A;  2NYS A;  4Q5W A;  1VYV A;  1WJS A;  5C0M A;  5GJV B;  3WVD B;  4HCZ A;  1MMA A;  2GCX A;  5J3B A;  1I07 A;  2ZPE B;  4RTZ A;  2KT8 A;  2COZ A;  5KYW A;  3VRZ A;  1B34 B;  2RK2 A;  1YN8 A;  4BE0 A;  4R0K A;  1DJ7 B;  4DOV A;  2NUT B;  4N0A C;  4EMK C;  4XTW A;  1Y57 A;  4F04 B;  4NL3 A;  4M78 G;  1OPK A;  1OV3 A;  1WYX A;  1PCX A;  1WXT A;  4F7U E;  3CD6 T;  2QEX A;  3S3N A;  2RPN A;  2WSC E;  4DEX A;  2F2X A;  1K9M C;  3O5Z A;  5CVI A;  1TH7 A;  2RNA A;  2LNH B;  2DBM A;  2W10 A;  3PVL A;  4PK4 A;  3OMC A;  2AHJ B;  2JZ2 A;  1Q86 R;  3CC7 Q;  2FVU A;  4C0F A;  2SEM A;  3PFS A;  1I81 A;  1JXM A;  3CD6 Q;  4KGX B;  1HD3 A;  2K3X A;  2MCN A;  4FM4 B; 
#chains in the Genus database with same CATH homology
 3RUX A;  2QI2 A;  2CZ1 B;  1D3B A;  2IVW A;  3M9Q A;  2V8I A;  4E7L A;  4M7D B;  2P0K A;  2F5T X;  2RM4 A;  3HP9 A;  5LJ3 f;  2R57 A;  3X24 B;  2QEX T;  4Z02 A;  3CCE T;  2LVM A;  2XIC A;  2X35 A;  4FSX A;  4ATO A;  4OGE A;  3OYH A;  2EAY A;  3QKJ A;  4PKC C;  4M7D C;  3PTA A;  2Y90 A;  2PUO B;  4C92 B;  3CPF A;  2R58 A;  4M7A B;  2VYT A;  3HFN A;  4BY6 B;  3M54 A;  1OZ3 A;  2OTL A;  1VQ7 T;  3L2Q A;  2QQS A;  4BY6 C;  2RHZ A;  4FIB A;  3NTK A;  4ELY C;  2DZ9 A;  3JSC A;  4IUV A;  2XKO C;  1BYM A;  4L6V 5;  2K3Y A;  2DXT A;  2RI5 A;  4RCB A;  5LJ3 h;  5FU7 B;  3CCJ A;  1NPR A;  1I4K 1;  1M5Q 1;  4C0G A;  3GF5 A;  3FLG A;  1WQW A;  2PVO B;  3JB9 F;  4M78 F;  1QP3 A;  2KAF A;  3L1A A;  5CKB A;  3CCM T;  1VQK T;  4IUU A;  3OA6 A;  3O8V A;  3QJ6 A;  2MMP A;  2EFI A;  3G7Z A;  3RIR A;  4OP0 A;  4VUB A;  3L2Z A;  5GAM f;  3CPW S;  4BE1 A;  1KC8 U;  4JUV A;  1N8R U;  3LYI A;  3P8H A;  5A0G A;  4J5Y A;  2E12 A;  3PMI A;  1Q82 U;  2O4X B;  2XHC A;  4KUI A;  3HSB A;  1D3B B;  4IUQ A;  4IUR A;  3OYM A;  3OYA A;  1S72 A;  3EFR A;  5IN1 A;  3OYY A;  3ZEH A;  1K73 C;  4Y28 E;  3C4S A;  4MDX A;  1O9S A;  1NZ9 A;  2E1H A;  1Y96 A;  2RI3 A;  3MEA A;  2RK1 A;  3CEY A;  1IRE B;  4LDW A;  4BB7 A;  4QQD A;  2HD0 A;  5GMK m;  1VQL T;  1IZ6 A;  2R5A A;  3PIP A;  4J7F A;  4XQ3 A;  2OTL T;  4BI8 B;  3KXT A;  1N6A A;  3FRN A;  1M9S A;  4C0D B;  5GAM h;  3CC7 A;  2ZCF B;  4PJO F;  4RKU E;  1BI0 A;  4NS5 A;  3JCM h;  1FWZ A;  4ZGJ B;  2P4T A;  2OAU A;  3VV0 A;  5HKC A;  1VQ6 T;  1QVF S;  4R56 A;  3WVE B;  1M8V A;  2G3R A;  3JB9 I;  1QW1 A;  4M77 A;  1X6O A;  4J6Y A;  4C5E A;  2QXF A;  4C0D C;  1I8F A;  1NPP A;  1Q86 U;  2LQ8 A;  2VXF A;  4C8Q E;  2CZ6 B;  2DKG A;  3OYE A;  4HT8 A;  1UGS B;  2M1H A;  5LJ3 d;  4HCC A;  4II1 A;  4C8Q G;  4X34 A;  5I21 A;  3OYL A;  2QTX A;  1WJQ A;  1VIE A;  1NJI U;  3UWN A;  3OYI A;  3VJP A;  3BW1 A;  4RMO A;  3E9F A;  2VGM A;  3LW5 E;  4JDS A;  1OYX A;  2RA2 A;  1WQ7 A;  2DK3 A;  2X4J A;  2DZC A;  4JS5 A;  1S72 T;  4XTZ A;  3ZBD A;  5HK0 A;  2QQ9 A;  4EMK B;  1KD1 U;  1VQ8 T;  3CPW A;  2XG8 D;  4C92 E;  5KE2 A;  2EJG A;  2RHY A;  2YHT A;  3MEU A;  5FRN A;  1M1K C;  4FU6 A;  2VUB A;  2RI2 A;  1VIF A;  4C92 G;  2K5I A;  3FC3 A;  2D6F A;  3OW2 S;  4FT4 A;  4MZP A;  3CC2 A;  4M75 B;  4HT9 A;  1G3W A;  3SWN A;  3I56 A;  2MI6 A;  3J80 E;  4M77 D;  2LC4 A;  4JJN K;  3JB9 G;  3QPH A;  4QVC A;  3CC7 T;  1N9S A;  1Q81 U;  3OSV A;  4KUD K;  3OQ5 A;  1N8R C;  1XOV A;  2CGH A;  1ZBX A;  2JTM A;  4PL6 A;  2DIG A;  3PGG A;  4RG8 A;  2K4Y A;  5HK3 A;  5GAM d;  1YJN A;  4OB2 B;  4B9X A;  2DAQ A;  3BDU A;  2XID A;  2E10 A;  3PT9 A;  2XDB A;  3QO3 A;  1QVF A;  2K5F A;  3OY9 A;  3OBW A;  1XNI A;  3CBM A;  4QW2 A;  3SDZ A;  2MF2 A;  3OYJ A;  4EMH A;  3JCM c;  3X28 B;  3M4G A;  4EDU A;  4M77 C;  4XU3 A;  3R6O A;  1N27 A;  3S3O A;  1VUB A;  4ZGD B;  3JB9 J;  5GAN 5;  3VKI A;  3CCS A;  3OS5 A;  3M5A A;  1M1F A;  4LDV A;  4JRP A;  3VYH B;  2KMT A;  3KUF A;  4XTV A;  3L2R A;  5CQY A;  2JUF A;  3GNF B;  3PMT A;  3QG1 A;  5CQX A;  1Q86 C;  3FIF A;  2PVD B;  1VQ5 A;  1BI2 A;  3HHT B;  2GQV A;  3E9G A;  3P8D A;  1G3S A;  2MWP A;  2ZPH B;  3OYG A;  2GF7 A;  1VQ4 A;  1JJ2 A;  5CR2 A;  3CC2 T;  3I56 T;  5EG2 A;  3OYF A;  3QZ5 B;  5GAN 8;  4BUG A;  2E70 A;  5KH6 A;  5GAN 7;  5GAO n;  2C06 A;  3LX7 A;  4M78 A;  1QVG S;  3DLL A;  3OW2 A;  5D6X A;  3CME A;  1YCY A;  4C8Q F;  4OB3 B;  1YJN T;  2A3L A;  3MEV A;  4OB0 B;  2HQE A;  2I2L A;  3QBY A;  4HCB A;  1KD1 C;  4F7U A;  2KK4 A;  2E64 A;  2DPP B;  3SWN C;  3OYB A;  5FRM A;  2CKK A;  2RJE A;  4OF1 A;  2L5Q A;  2ZPB B;  5LJ3 j;  4M7D F;  4A4E A;  1ZHI A;  3JCM J;  3E19 A;  5A0L A;  3FDR A;  3CCV A;  1YI2 A;  5LJ5 f;  4MZT A;  2KDS A;  2L8D A;  5J26 A;  2GFA A;  5GAN 6;  2KQW A;  3DB4 A;  4A4H A;  1FXX A;  3L2V A;  3KBG A;  3CCL A;  2LX9 A;  2FHD A;  2MAM A;  4C92 F;  4M7A F;  1XQH A;  1UGQ B;  1YJ9 A;  1OI1 A;  1AHJ B;  5CKD A;  3CCQ A;  2VV5 A;  5GAO m;  4TVR A;  5GAO q;  4PJO A;  4LDY A;  4DOW A;  4GLK A;  4J83 A;  4M75 E;  3OS2 A;  1VQ5 T;  2LRQ A;  2XD0 A;  1I5L A;  5GMK h;  2E65 A;  2EQM A;  4M78 D;  2RD1 A;  4J6W A;  4M75 G;  5J39 A;  3JB9 D;  4PLI A;  1U1T A;  2E6Z A;  1VQ4 T;  2ZPG B;  2CZ7 B;  5LJ5 h;  1G3T A;  4RG2 A;  3RKW A;  3VUZ A;  3HPW A;  4CI0 C;  2K57 A;  2PU9 B;  4P5N A;  3CME T;  2X4Y A;  4A4G A;  5GAM j;  2EJ9 A;  1JJ2 S;  2K2V A;  2DXU A;  2YLC A;  2O01 E;  2Y4Y A;  3C95 A;  1QVG A;  2JTF A;  5CIU A;  5LJ3 e;  3P8B B;  3VUB A;  4F7U B;  4M78 C;  4IKF A;  1YI2 T;  4RCC A;  3UT1 A;  3NTH A;  5GAO p;  3CCV T;  2DJZ A;  2E5Q A;  3CBP A;  5FRO A;  3C12 A;  4J6X A;  2H3J A;  4MDW A;  1YBY A;  5D6Y A;  3CCL T;  1WJR A;  3JCM V;  4PJO D;  2P0Q A;  2F69 A;  3JCM f;  2GFU A;  4N4G A;  3BDL A;  1YJ9 T;  1M4Z A;  3CCQ T;  3LH0 A;  3ER0 A;  5LJ3 g;  3CCJ T;  3UPU A;  2QQB A;  3MP6 A;  1H64 1;  3CXC A;  2EJF A;  1KQ2 A;  5GAN f;  4JLG A;  2EWN A;  4DA4 A;  3L42 A;  4A54 A;  3QJY A;  3OMG A;  1K9M U;  1QVP A;  2P0P A;  4M7D E;  1SSF A;  3VYG A;  2JN0 A;  3RKY A;  5GAN j;  1KHI A;  4M7D G;  4PJO C;  2JVV A;  3JAM E;  2RH2 A;  2RHI A;  2WSF E;  4NOY A;  4A4K A;  5LJ5 d;  2RJC A;  5GMK i;  5GAM e;  2BUD A;  4E7H A;  1JBM A;  5FU6 C;  1UB4 A;  2FYK A;  3QUI A;  3HL8 A;  3MCA B;  1M1G A;  3LGL A;  4J8O A;  4MZM A;  5I2M A;  3TEE A;  1ZQ1 A;  4L5G A;  3UDC A;  3G6E A;  4M7A E;  2M0O A;  2EIF A;  2KVQ G;  4M7A G;  1LJO A;  3A8H B;  4ZN3 A;  3OS1 A;  4BD3 A;  5GAN h;  1Y96 B;  4X9C A;  4BAC A;  4QVD A;  3M55 A;  4XTU A;  1K8A C;  1O75 A;  5M9O A;  2R5M A;  1VQP A;  3JCM b;  1Q7Y U;  1KC8 C;  4ELZ C;  1W4S A;  2DTO A;  5GAM g;  3JCM Q;  2WSE E;  4MML A;  1VQ9 A;  3SD4 A;  2YLB A;  1Q82 C;  2X4X A;  4XK8 E;  4M75 F;  4CRI A;  2EQJ A;  2LT1 A;  3OBY A;  4XU0 A;  4LD9 K;  1M90 U;  1Y07 A;  5D6W A;  2HQX A;  1P92 A;  4M77 B;  3QDR B;  3GP8 A;  2V8K A;  2RB6 A;  3INZ A;  4UC4 A;  1VQN A;  2LQK A;  4C5I A;  2LDM A;  4C8Q A;  5IT9 E;  3RKX A;  2DXC A;  4BI3 A;  2DO3 A;  4QVZ A;  3LWI A;  3QSU A;  4BI4 A;  3C94 A;  2DTH A;  5GAN e;  3GOX A;  3EFS A;  4Y91 A;  2OTJ A;  3JCM X;  4V2S A;  2V8J A;  2YRV A;  2M16 A;  3CC4 A;  2PUK B;  3MP1 A;  4KBM B;  4OMF B;  2LTO A;  3HRU A;  4QQG A;  3OYD A;  3M58 A;  1YJW A;  2D9T A;  3GIB A;  2K5L A;  3M59 A;  2L89 A;  2A7Y A;  1EIF A;  5DLQ E;  3G4S A;  3G6E T;  2DEQ A;  4C92 A;  3CMA A;  4NL2 A;  3JCM d;  4M7A A;  1HXD A;  3CBO A;  3HKS A;  3OB9 A;  2F5K A;  5GAN g;  2NLU A;  4IUP A;  1BIA A;  2QA4 A;  2QQR A;  4ZTF A;  5KCH A;  5DY9 A;  3FJP A;  1VQP T;  1VQO A;  1NJI C;  5GAN d;  1U1S A;  3SWN B;  4OGC A;  3RES A;  4JS4 A;  3GNG A;  1RL2 A;  1KQ1 A;  2LT4 A;  4ME7 A;  3X26 B;  3JB9 H;  2KSS A;  4O6J A;  4C8Q D;  3GPL A;  1UGR B;  3TU4 K;  1K73 U;  2CZ0 B;  3RMQ A;  4BDY A;  1LNX A;  2L3R A;  1VQN T;  3LLR A;  2CS7 A;  1W2B A;  2EQK A;  3ME9 A;  4M7D D;  3Q1J A;  3M57 A;  5CKE A;  2PQW A;  3RER A;  1UGP B;  4QQ6 A;  3DB3 A;  4N4I A;  3WXM B;  4ZGE B;  5GMK j;  1U8R A;  3GLX A;  2OTJ T;  3OSS C;  3BY7 A;  1Q7Y C;  1Q81 C;  3MET A;  3CXC S;  3CC4 T;  3G71 A;  1BI3 A;  2E6N A;  2O4X A;  3TCJ A;  4N4H A;  5LL6 S;  5LJ5 j;  3S6W A;  2DXB A;  5GMK l;  4C92 D;  1YJW T;  4C5H A;  4C8Q C;  4M7A D;  2FB7 A;  2ZPF B;  5CCA A;  4LD6 A;  3G4S T;  4BDZ A;  1PSF A;  1M90 C;  1BI1 A;  4EMG A;  3MO8 A;  2KY9 A;  4JRK A;  3SFM A;  3CMA T;  3H6Z A;  5DLO A;  5GAO r;  3HRT A;  5HY6 A;  4HKE A;  2BKD N;  2LCC A;  4C5G A;  4E7J A;  2QA4 T;  2M9U A;  3A8G B;  1VQL A;  4PLL A;  5CO7 A;  3JCM W;  1VQO T;  3X20 B;  2DTI A;  2DVE A;  3TRE A;  2RHU A;  3L2W A;  2MWO A;  4L59 A;  4C92 C;  4E47 A;  4M7A C;  4LDX A;  4M78 B;  4M77 E;  3OYK A;  1YIJ A;  5AYF A;  1HK9 A;  1VQ6 A;  3M4Y A;  3FEO A;  2IG0 A;  2DD5 A;  1PSE A;  4M77 G;  3NFC A;  3V7R A;  5GAN 3;  1M1K U;  1WPY A;  3A8M B;  1BIB A;  5CK9 A;  2PVG B;  4LDU A;  1KG1 A;  3DLM A;  2ZZD A;  4J7I A;  5GMK e;  5FU7 C;  1KHC A;  3NTI A;  1KQS S;  2XDP A;  4XU1 A;  1G5V A;  4KUL A;  4A53 A;  5LJ5 e;  3G71 T;  2VXE A;  1B34 A;  3RMS A;  4B9W A;  4F7U F;  1JB0 E;  2XU8 A;  2EKO A;  4N0A A;  4XTX A;  3OS0 A;  4EMK A;  1LOJ A;  3FB9 A;  3I55 A;  3SB2 A;  5FLX E;  5KCO A;  1NE8 A;  1XTD A;  1VQ8 A;  2WAC A;  3J7A F;  2HBP A;  3M56 A;  4PNO A;  4PJO B;  4WF2 A;  4YTL A;  3HFO A;  4GY5 A;  4KT0 E;  4M75 A;  3V8L A;  1YIT A;  3URG A;  2DD4 A;  3ASK A;  3QYH B;  3CCS T;  4JRQ A;  1V29 B;  1VQM A;  4BE2 A;  3QZ9 B;  3HRS A;  5FU6 B;  3V8J A;  5LJ5 g;  3MP8 A;  3MHX A;  2XDD A;  5I2S A;  4A4F A;  2QQA A;  3AHU A;  4JRI A;  2VC8 A;  1WNL A;  3X25 B;  1X75 C;  1YIJ T;  2LNV A;  5L8R E;  1YHQ A;  2EQU A;  3V7C A;  4Q5W A;  3OYC A;  4HA8 A;  3JCM P;  1WJS A;  5C0M A;  3CD6 A;  4R55 A;  4FT2 A;  5IAY A;  1N9R A;  3WVD B;  5C6S A;  2QDY B;  1GXI E;  1RI0 A;  4HCZ A;  3PNW C;  4E7K A;  3DKM A;  1MHN A;  2GCX A;  4O5V A;  5J3B A;  2X4W A;  3L2U A;  1X01 A;  3JRZ A;  2ZPE B;  3BFM A;  4IUT A;  3V8K A;  3CCU A;  2RO0 A;  1W2B S;  3J81 E;  1BKB A;  2LCL A;  3I55 T;  1B34 B;  5GAN 2;  2JNG A;  2ZGW A;  4M75 D;  1KQS A;  2RK2 A;  4DQ2 A;  1FX7 A;  1OZ2 A;  1UEB A;  3JCM e;  4BE0 A;  4FL6 A;  3A5Z B;  2EYQ A;  2B8A A;  1DJ7 B;  3T9N A;  2E41 A;  4D6W A;  3CCR A;  1YIT T;  4C0Z A;  5A2Q E;  2HNI A;  4DOV A;  4N0A C;  1VQM T;  4EMK C;  5GAN 4;  1K8A U;  2RHX A;  4XTW A;  4OVA A;  4M77 F;  4M78 E;  3QII A;  4M7D A;  3VU3 C;  1MGQ A;  3ZFJ A;  4NL3 A;  4M78 G;  3H8Z A;  3N5B B;  2DIQ A;  3M53 A;  1VQ9 T;  1YHQ T;  3A8L B;  4M75 C;  3OYN A;  3EAE A;  3JCM g;  4F7U E;  3CCE A;  3CD6 T;  3LWH A;  1WGS A;  2QEX A;  3S3N A;  5DM7 R;  2Y4X A;  2JOY A;  4F7U G;  4OB1 B;  2RJF A;  5A0D A;  3QXE B;  2WSC E;  4MMK A;  5CAI A;  3LGF A;  3MEW A;  2VGN A;  1R8O B;  1G3Y A;  1K9M C;  5GAO l;  2XK0 A;  1H3Z A;  5CKF A;  2FL7 A;  4ZN1 A;  4ZTJ A;  5KE3 A;  3V7S A;  5CVI A;  1TH7 A;  2BIV A;  3CCU T;  3E1S A;  2RJD A;  1Y71 A;  1VQ7 A;  3PIO A;  1Y7X A;  3A8O B;  2D0Q B;  4XU2 A;  4XTY A;  4PJO E;  4E7I A;  1JRI A;  3F70 A;  2HAX A;  2ZPI B;  3OMC A;  4PJO G;  2AHJ B;  2JZ2 A;  4X9D A;  5CKH A;  3CCR T;  2FVU A;  4C0F A;  3PFS A;  2CYZ B;  4JLI A;  4EPC A;  3S3M A;  1I81 A;  1QP2 A;  3QYG B;  3CCM A;  4C8Q B;  1VQK A;  3QHS A;  4XAX B;  2K3X A;  2XI9 A;  4FM4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...