4R56A

Crystal structure of sulfolobus cren7-dsdna(gtgatcac) complex
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
59
structure length
59
Chain Sequence
SSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Chromatin protein Cren7
publication title Insights into the interaction between Cren7 and DNA: the role of loop beta 3-beta 4
pubmed doi rcsb
source organism Sulfolobus solfataricus p2
total genus 7
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11520 Cren7 Chromatin protein Cren7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.610 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4r56A00
2JTMA 4R56A 3LWHA 4R55A 3KXTA 3LWIA
chains in the Genus database with same CATH superfamily
3CBMA 1KD1U 2QDYB 4II1A 5GAMj 2OI3A 1P92A 4HT9A 1QCNA 1KHIA 1QQJA 3OS1A 4J8OA 1RAAB 2COZA 2VWFA 5GAMh 1K8AC 1X6GA 2FHDA 3CXCS 4AG1C 2PU9B 3G6EA 4OMLA 1QVFA 1Z9ZA 3EFOB 4ZGJB 3HL8A 1SSFA 1GCQC 1PG5B 1VQ6A 3M4GA 2LQ8A 1ZSGA 4M7AE 5D6XA 2F69A 3QXEB 2O2OA 2FRWA 2OTLT 3M0TA 2E3IA 2KROA 5CIUA 1GCPA 3EH2A 1NE8A 2E5QA 4QQDA 3M0SA 1QVGS 1YJ9T 5GAMe 5KH6A 5GAOq 3CCJQ 1I4K1 2E10A 1BI1A 1TXQA 4M7AB 2RK2A 1WXUA 1IHWA 2DL4A 2K3BA 1EIFA 3HPWA 3OW2A 1GCQA 2EQKA 3CCQQ 1HD3A 4IUTA 3OSVA 1H3ZA 3PNWC 4E7KA 1Q86R 5KE3A 3C0CA 3PVLA 3CCLA 4OMMA 1UJYA 5D6YA 4F7UE 4M7DF 2DILA 3V7SA 1IZ6A 1S1NA 2LCSA 3QDRB 4Y28E 5CKHA 3NMZC 1UDLA 2RH2A 2YT6A 2CT3A 5HK3A 4Z02A 1UGRB 2KY9A 1E7OA 1RAGB 2BKDN 2LNHB 3QZ5B 5FW9A 4AG2C 2JM9A 5AT1B 4JLIA 5GAMf 4EDUA 2RJFA 1YJWA 3OYKA 1ZLMA 3L42A 3QWXX 2CP5A 1I5LA 2MPXC 4FU6A 4RTUA 1WX6A 2KRNA 2CP3A 4PFOA 4CRIA 3RKWA 2R57A 5GMKj 2KYMA 1WHMA 5LJ5j 1D1BA 2ED1A 5KYUB 2K4YA 1YHQT 3EG2A 4C92A 1RLQC 1M4ZA 2MWOA 3I56A 1X27A 5LJ5h 2KDSA 5HCKA 2OTJA 5L23A 3OY9A 4ZNXA 1AD5A 1MMNA 3H6ZA 2L3PA 1X2QA 3CCJA 3I55T 3VYGA 1Y96A 3G4SQ 3PTAA 1R8OB 4FW2A 1VQ4Q 1B3QA 4LUDA 1WDXA 5D6WA 1WJSA 3JCMh 2A37A 2D8HA 4M77E 3JB9D 1ZSZA 3GOXA 2LCCA 2EYXA 7AT1B 1PKSA 4N0AC 2NWMA 3V8JA 4HCZA 5GMKe 5GAN3 3EFSA 2G6FX 5LJ5e 4F16A 1G3SA 1GFCA 1YITA 3QBYA 1YN8A 2CSIA 1ZHIA 1KSWA 3G71Q 4C92G 1KC8R 4PJMA 4HCKA 2RNAA 1NJIR 2DD5A 3VS6A 4M78F 2KNBB 1PSEA 4M77D 4M75B 2M02A 4M77B 3SFMA 3JCMe 2FB7A 4OF1A 3UDCA 2YHTA 4MZPA 1G5VA 4PLLA 3X26B 2O4XA 2IG0A 1QKXA 4O5VA 1Y71A 4N0AA 1W70A 1KQ2A 1FMWA 3LX7A 4XU2A 4LXCA 2OJ2A 4WCIA 2YRDA 1G83A 2K5LA 2OTLQ 1VQ9T 3MKDA 2JOYA 1YJNT 5KYYB 1UGPB 5GANh 2HD0A 4A4HA 1K8AR 2RI2A 4CC2A 3OMCA 2LT4A 1YJ9Q 3NGPA 1TUCA 4E7LA 2KI7A 3UF4A 4KULA 2QQRA 3MEAA 3BY7A 3MP8A 2EVRA 4HA8A 3M0RA 3I9QA 3HSBA 1M2VA 2RM4A 3LH0A 2CUBA 2F5TX 1HSQA 3JCMX 1CKAA 2L3SA 1MMGA 5GAN6 2H8HA 4XAXB 3H0FA 2CP2A 2LX7A 4P5NA 3JCMf 5GANe 1BBZA 2MIOA 1M30A 1WLPB 3G4SA 4BDZA 1VQ4A 4BACA 2M0YA 2LNVA 2CUDA 2EIFA 1OOTA 3RMQA 1D0YA 4F14A 3O5ZA 5CVIA 1K9AA 2FEIA 2VXFA 3RIRA 2EGAA 3CPFA 4LNPA 1QVFS 1WA7A 2ZCFB 1UJ0A 3CCVA 4PJOC 3G71A 2M51A 4ZTJA 1R0BG 1A0NB 3VKIA 2CREA 4OMOA 1TH7A 3G1JA 2PVOB 3VV0A 2KR3A 2RO0A 1UGQB 5A0GA 4PL6A 2EYYA 3KUFA 3JCMQ 1NEGA 2QYZA 1IGQA 1IO6A 1GBQA 2MCNA 1C1AA 1M1GA 4M7DC 2KXDA 1OZ2A 5GANf 3JCMP 3QHSA 1I07A 3E19A 2GCXA 2Y4XA 1YHQQ 2CZ6B 4KT0E 3OW2S 4PJOA 4VUBA 2QI2A 1VQMT 2OTLA 1B07A 2LX9A 2DFUA 5KCHA 1OU9A 4E7ZA 1FMVA 5GAOm 2SEMA 4X9CA 1PC0A 5GAMg 3PVQA 1N8RU 2P4RA 3ASKA 4Y91A 5C6SA 5GANd 4ZTFA 5FLXE 1Q81C 1BKBA 1VQ8T 2PQWA 2DA9A 2J6OA 2K2MA 1YI2T 2V8IA 2HAXA 1O9SA 4M7DA 1M2OA 2D9TA 3V7RA 2ZPHB 4N4HA 3OYIA 2DJZA 3NTIA 3J7AF 1I81A 2DO3A 4M7AF 3TSZA 3CPWP 3LH5A 4OB3B 4PJOG 3SWNC 2DIQA 3L2WA 1WXTA 4J9CA 4A53A 4RCCA 2FZGB 2OAWA 2I2LA 2QEXT 3OYGA 2JVVA 3OYDA 2HSEB 2A08A 4A4KA 2MOXA 3NHNA 1D3BB 1VYVA 1W4SA 2RQTA 1C6VX 4M78E 3THKA 2XICA 4MMLA 2E3HA 3EFRA 1AEYA 1W2BP 3FEOA 4M7DG 3MP1A 2NUTB 2PUKB 2GQIA 1VQ9Q 3SWNA 1KD1C 2DPPB 4QQGA 1S72T 2Z0WA 2DL7A 2DXCA 4L59A 1FYNA 3ER0A 3CBOA 5CKFA 5FU7C 4M78D 3QUIA 4XTWA 1RI9A 5KE2A 3PMIA 4F7UF 2KRMA 2DEQA 3JV3A 2JXBA 1RL2A 2X4YA 1T0HA 5C0MA 4FYXB 1YHQA 2K5FA 5GAOl 4E2FB 4BE2A 2H3JA 3L2ZA 1NBEB 1OX8A 2NUPA 2ZGWA 2L5QA 1VQKT 4FT2A 4A4GA 3V8LA 3OYJA 1XQHA 4D8KA 2HDAA 4XTVA 2D6FA 3JB9H 1ABQA 3OBYA 3MEUA 3CMAQ 3I55A 3UA6A 3EAEA 2DD4A 1WNLA 2L89A 5GJVB 3EGXB 3H0IA 4L5GA 1I0CA 4BE0A 2QG9B 5CR2A 2GBQA 3SEMA 1AT1B 3VS1A 2O9VA 1UGSB 1Y7XA 2ZPGB 3HHTB 4LDYA 1TSFA 3QSUA 2XD0A 5IHNA 3CPWA 3L2VA 4MZTA 5IT9E 1NPPA 3CBPA 2YSQA 3OYHA 4BI8B 3CCMT 1WQ7A 4J9HA 5HY6A 4C8QE 1Y0MA 1JJ2P 2QXFA 1ZUUA 3JB9F 5I11A 4XQ3A 4X1VA 2BE9B 3LWIA 3JCMg 2E4HA 2AKKA 3GLXA 1ZQ1A 2E5KA 3FJPA 2HSPA 1V76A 2LVMA 3CC4T 1E6HA 5GMKm 3G7ZA 1K1ZA 2LT1A 1W2BA 3S3OA 2DNUA 3INZA 2VV5A 3E2UA 2WSEE 2K6DA 2HKQB 4M75F 3OA6A 4MDWA 4DEYA 2RD1A 4C8QD 2HMAA 2EBPA 4M77F 3DB4A 1IHVA 1YCSB 1BU1A 1VQ9A 1YJNA 4ELZC 2RB6A 4HVWA 5HKCA 5CQYA 3H41A 2D0NA 1RAEB 3VRZA 1RACB 2COYA 4F17A 2VUBA 2COWA 2DK3A 4J6WA 4Y92A 4E7HA 1RAHB 2BE7D 4OGCA 2D1XA 2DL8A 3L2QA 2QTVA 2XHCA 1Z9QA 1WI7A 4OVAA 1VQ8Q 4C0DC 5CO7A 1YI2Q 2RQVA 1F1BB 1X6BA 5KYNA 4Z89A 3OS5A 1BK2A 3FDRA 1LNXA 2RF0A 5GANg 9ATCB 1BI2A 1NG2A 2V1RA 2QTXA 4CI0C 2KAFA 4C5GA 1WZOA 1VOMA 1RAFB 3E9FA 3GNFB 4J83A 2DBMA 2I0NA 4EPCA 1VQNT 1UECA 4BUGA 2EWNA 3UA7A 1Q86U 2BZYA 1Q81R 1YIJT 5FU6C 4J9BA 2QEXQ 2ZAEA 2K57A 2RHXA 3KBGA 2LQKA 4BI4A 3FLGA 3S6WA 3OSSC 2JS2A 4GY5A 2EYQA 1PHTA 2ESWA 1ARKA 4HCBA 1C0MA 5KCOA 3OYBA 3HRUA 2MYSA 3FIFA 5GMKl 3C95A 3QJYA 3WVDB 3M58A 3VU3C 1BIBA 1LJOA 3C94A 5IHIA 2A36A 4M7AD 1M8VA 1XJWB 3LW5E 3H9NA 1S72Q 2DL5A 1OV3A 2GQVA 5IN1A 4M7AC 3CC7T 1B7TA 1OPLA 4MDXA 3A8OB 4FYWB 1WJRA 1Q95G 1M90U 4J7FA 5GAOr 3CMEQ 1NM7A 2VKNA 3QDFA 3PT9A 1RADB 3A1PA 4B9WA 1T3SA 4DBQA 1YWOA 3X24B 2BIVA 1VQMA 2DKGA 4QW2A 2GNCA 1VQPT 2FG0A 3A8MB 1KD1R 5DLQE 1I5OB 3CC2Q 1VQKQ 4PJLA 4QKUA 1B34A 2L8DA 1Q7YU 1NLOC 2CZ1B 3M5AA 1NYGA 4XTYA 1WHLA 3VJPA 4C92E 1GL5A 1I8FA 5CAIA 3JAME 2HZYA 1Q82U 2CS7A 2MF2A 4RTZA 1X75C 1VQ5A 2P0KA 1TUDA 5LL6S 1VUBA 3MEVA 2F2VA 2LCLA 2RQUA 4XU1A 2Y90A 2MK5A 3M53A 2A0FB 2E1HA 3BW1A 3MPUB 2W0ZA 4XU3A 1QLYA 3CCMQ 4C92B 2R5AA 3CCST 4AMCA 1YP5A 1IXDA 2JTMA 2QQ9A 2XDBA 4K11A 1WHJA 1X43A 2F2XA 2QEXA 3CCRT 1NJIU 1SEMA 4NL3A 1K73C 5LJ3d 3CC4Q 1X01A 1N6AA 2QAZA 2W10A 1Y96B 1MV3A 1TU0B 1YFNA 2A28A 3EGDA 1RABB 1NLPC 2EKOA 2QK0A 1ZSZB 4F7UA 3META 2DXTA 3ZEHA 2GGRA 2X51A 1WHHA 2RQRA 4JJCA 3GIBA 1NEBA 2VB6A 2MAMA 1S72A 2V8JA 2R58A 1K0XA 2FO0A 3VS4A 4M75E 1MUZA 3HP9A 4BY6B 2MMPA 2WSCE 3GBQA 3CCQA 2RHIA 2DTIA 1ZUYA 2AT1B 1WFWA 3REBB 1VIFA 2LTOA 5GAN5 2O4XB 2QQBA 3OYEA 2KMTA 2EW3A 4M75D 1ABOA 3CPWS 2CZ7B 4EMKC 5AYFA 2JT4A 3M55A 4B6MA 4F7UG 3VS3A 4M77C 5J3BA 1UHFA 2RJEA 1K9MU 1VQNQ 4OMNA 4J5YA 1QP2A 1R0CB 2X4JA 5IHKA 3OMGA 1TWBA 1YIJQ 3H0HA 3VUZA 1XTDA 3EHQA 5GANj 1NYFA 1O75A 2A7YA 2YUPA 3CXCP 5GAN7 4OMPA 1W2BS 2AKLA 2RMOA 2L2PA 4ELYC 2K5IA 2KYBA 1T0JA 3CCMA 1M2VB 5DM7R 4R0KA 2SRCA 4EMKA 2FVUA 4DA4A 2AHJB 2O9SA 1D0ZA 2VVKA 2ZPIB 2EKHA 4JS5A 3CC4A 4IUQA 5EG2A 2HKNA 3CC7Q 1WXBA 2KT8A 5KYXA 2PNIA 2EYZA 5IXBA 3DLLA 2LJ1A 1SSHA 1JRIA 2LMJA 2ECZA 3RBBB 4JZ3A 1UUEA 3M59A 2LJ3A 4R55A 5FWBA 1LOJA 3CMAT 3LYIA 2JS0A 1VQPQ 2VASA 2FZCB 2VXEA 1ACMB 4FT4A 5J26A 1ZX6A 2CYZB 1UGVA 4C8QF 2PVDB 3OS2A 4Z8AA 2DTHA 2DE0X 4RUGA 4DBFA 4DEXA 1HJDA 1YBYA 4AFQC 2E70A 4IIMA 2VYTA 3M0QA 4IIOA 1MHNA 1JEGA 2DZCA 1VYUA 1N9SA 3EHRA 1VQ7T 2R5MA 2GFUA 3MJXA 4PJOB 3CCSQ 4LUEA 4RTYA 3M4YA 1YIJA 3CCRQ 2K3XA 3M0PA 5IAYA 3BFMA 1MNDA 2EAYA 2OAUA 2CZ0B 4RTTA 1OQKA 5I2MA 3MCAB 3FB9A 5CKBA 3NPFA 2QASA 4WTOB 1TOVA 4M7DB 1YJ9A 2OX7A 2E12A 3EH1A 1K73R 3A8GB 1RI0A 2HBWA 2IPOB 2YUQA 3RNJA 1LPLA 5CKDA 1QKWA 2DL3A 1G3TA 3PGGA 4EMGA 2J06A 3TU4K 1WHKA 1JXOA 1PCXA 3ULRB 2JTFA 4RG8A 3S3NA 1TS9A 4BD3A 3MP6A 2JW4A 3TVTA 1XNIA 3REAB 2FPEA 1KHCA 1M1KC 1AWXA 2A3LA 1IRXA 3BDLA 4BB7A 4JLGA 2FPFA 4FW1A 3BE3A 3SWNB 1ZA1B 4D8DA 2AIRB 4JRIA 2P0QA 3PMTA 1VQOT 3CD6T 3I35A 4RCBA 2X3WD 2RHZA 2J05A 4J9EA 1PRMC 4ANJA 5GMKi 3OB9A 1I1JA 1PNJA 1KQ1A 2RI3A 1BCMA 1D09B 2BZXA 2ZPEB 1G2BA 1AHJB 2JZ2A 4EMHA 2C06A 2HQHA 2VC8A 5GAN4 2OTJT 3I5SA 3AHUA 2NUPB 8ATCB 2LRQA 3Q1JA 3CMET 4EIKA 2X9HA 3CCRA 4M78C 2O01E 4ZGDB 1ZUKA 4C92F 1EFNA 4E47A 4RTVA 1PWTA 1OU8A 4FYVB 4KH0B 4M4ZA 4OGEA 3QJ6A 3CC2T 3ZBDA 3A8LB 3DKMA 1H641 3NTHA 1FMKA 2JUFA 1E6GA 1FWZA 3QG1A 2JMAA 3HKSA 4YTLA 2EJFA 2F1LA 2CH4A 1YITT 1K4US 1G8XA 4DOWA 5A0DA 4FSSA 4RTWA 1SHGA 3EG0A 4M78A 4ZN1A 1M1FA 2YRVA 2KE9A 3SB2A 4TVRA 1JO8A 3HRSA 4HKEA 3L1AA 2QDLA 4KGVB 2ZPFB 2EJ9A 1M90C 1OEBA 4NS5A 2BTTA 4E7IA 2DYIA 1MNEA 4RMOA 1BCOA 2DM1A 2YRCA 1KQSP 3PFSA 4PJJA 1KIKA 4XTXA 2BZ8A 2ZZDA 1AWJA 2KQWA 3CCUT 3HFNA 1VQ7Q 1RAIB 3E1SA 2DVJA 3X28B 1PRLC 2JJ9A 2EPDA 2M0OA 2P4TA 3TQ7P 1WGSA 1U3OA 1Q7YC 1Y57A 3LLRA 2QQAA 2KSSA 4M78G 2D8JA 3QYHB 3VS7A 1Q82C 4FM4B 3NTKA 1YWPA 1D1CA 3UPUA 4C8QC 4OMQA 4JPBW 3WVEB 4Z88A 4LN2A 1WJQA 2X4XA 4A63B 3IQLA 3OYMA 1BI0A 4JZ4A 1T3LA 3OW2P 3GP8A 1QCFA 1H3HA 1VA7A 5GAOp 3I5RA 4J9IA 3HFOA 3SHWA 2JNGA 1N9RA 3R6OA 3CCLQ 1AVZC 2DYBA 2KVQG 4PLIA 4N4GA 1QW1A 1SRMA 2ED0A 5LJ3j 4ZN3A 3HTRA 1UHCA 5D7UA 4C8QA 3RMSA 1KG1A 1EZZB 2LQWA 1OYXA 4FYYB 1M3BA 4GBQA 5DY9A 1ZBJA 3CMAA 5LJ3h 4C0DB 1OZ3A 3M56A 2E6ZA 3L2UA 4HCCA 4DBHA 4QVDA 5IH2A 4LDXA 3E9GA 2E41A 3EG9A 4E7SA 2KK4A 1YJWQ 2LC4A 2QA4T 1U8RA 1NPRA 3C12A 3RUXA 1WPYA 1N27A 2V8KA 1H92A 5KYWA 2JMCA 1MGQA 1JJ2A 5IXFA 1KQSA 3OYLA 2HBPA 5FU6B 1VQOQ 1V29B 1PKTA 3CD6Q 4V2SA 3J80E 1HYOA 3UWNA 3RESA 2K79A 5ECAA 5LJ3e 4C5HA 3D7SB 1M1KR 4JUVA 4C8QG 4PFPA 1SHFA 4KRTA 1VQ7A 4PNOA 4L6V5 4QVZA 3I56Q 4QT7A 1M9SA 1WHGA 2OTJQ 1GRIA 2XMFA 3EFOA 3ZL7C 1K9MC 2FL7A 2DBKA 1B34B 3JCMJ 3DLMA 2EFIA 1JB0E 2HNIA 4PJOF 3JRZA 4BDYA 5CQXA 4J9FA 4OB2B 2H3EB 2HEQA 2C0OA 1PD0A 1UB4A 2LDMA 6AT1B 1ZBXA 1U1SA 2GTOA 4J6YA 3PIOA 4JJDA 3UT1A 2L3QA 1YITQ 1J3TA 4M7AA 1G3YA 4A54A 1VQ8A 1YI2A 1CSKA 2CP6A 1OULA 2ENMA 3H8ZA 5LJ3f 3GPLA 3OYNA 2KGTA 3R6NA 3N5BB 3VYHB 4LDUA 4C92D 3X20B 5GAOn 2PVGB 1YCYA 1MMDA 3EGUA 4C92C 4CC3A 3EGDB 3JCMV 1IGUA 4BI3A 1QWEA 4ME7A 1MV0B 1KC8U 4RKUE 1QWFA 4F7UB 3CCUQ 1BIAA 1SPKA 1U06A 4OB0B 1HXDA 3PIPA 4C5EA 3KXTA 2E6NA 1M90R 4M7AG 3VS2A 4D6WA 3CCET 2GFAA 3V7CA 4XTZA 1VQOA 3CD6A 2D0QB 3P8BB 1OI1A 2DJQA 5J39A 1ZSZC 1BYMA 2CP0A 3MHXA 3SD4A 3CEYA 2G3RA 5GAMd 2O88A 2CGHA 2HL3A 4GLKA 2DERA 1GBRA 5GMKh 4PJNA 1Q7YR 3A5ZB 2YDLA 3M0UA 1N5ZA 4BY6C 3CMEA 4CC4B 1K8AU 4MMKA 3X25B 2ZPBB 2AZVA 3JCMb 3O8VA 2NUZA 1Q82R 5KYUA 3MEWA 2JM8A 2K3YA 5GAN2 1FXXA 1RLPC 3FRNA 4O6JA 2EYWA 3VS5A 3CC2A 1VQKA 2DVEA 3KFVA 3TCJA 1KFZA 2NLUA 4M75C 4BE1A 5FRMA 2PTKA 2AZSA 1X69A 1XOVA 1M5Q1 2EGEA 5GJWB 3CCVQ 3RR6A 2EQJA 3T9NA 2QGGA 4QQ6A 1N8RC 4EMKB 1X2KA 1OPKA 1YNZA 4XTUA 1WQWA 1TTHB 2QA4Q 2IVWA 1UG1A 4PK4A 2RK1A 2C0IA 2NYSA 4KBMB 5KYXB 1GFDA 3GF5A 4M75A 2M9UA 1U5SA 4M77A 4FL6A 2C0TA 3CCUA 2X4WA 3FJ5A 4DBRA 2YLBA 1TG0A 2DRMA 2XKOC 4J6XA 4KUDK 2DLPA 2EJGA 1QVGP 4C0GA 4R56A 2ATCB 2LZ6B 2J6FA 2RI5A 1M8MA 2JN0A 3JB9G 5LJ5f 4ORZA 2HL5C 4C5IA 1X6OA 5KYYA 4E6RA 4ATOA 2CSQA 1VQLT 1JU5C 1JQQA 4E7JA 1AZEA 1VIEA 4KGXB 4LD6A 1VYTA 4MZMA 1CKBA 1K9MR 4M75G 2X35A 2DEUA 2XDPA 4M77G 4PJOE 1V1CA 4LDVA 4A4FA 1BI3A 2KRSA 2DX1A 5LJ5d 2M1HA 2EQMA 3EG3A 4OP0A 3G6ET 1K73U 1UTIA 5FROA 3S3MA 4UC4A 3AT1B 2HQEA 3GNGA 1VQ6T 2RN8A 4F04B 1JJ2S 4PKCC 2PUOB 1KQSS 4PJOD 2WSFE 4DQ2A 3JCMd 4NL2A 1VQNA 3L2RA 4M7DE 3OYAA 3VS0A 3CXCA 2O31A 2B86A 3P8DA 4LE9A 4JRQA 3TEEA 2QA4A 3LWHA 3P8HA 3V8KA 1JXMA 2XIDA 1SG5A 1D0XA 3CCEQ 2DXUA 1LCKA 2P84A 2QGFB 5LJ3g 4M7DD 2AK5A 2KEAA 4N4IA 5I21A 2FPDA 3RERA 2YUNA 1TUGB 5HK0A 1M3CA 4JJBA 4GLMA 1HK9A 1QVGA 3QWYA 1FX7A 2K2VA 3F70A 3CCLT 3CC7A 1Y07A 4C0ZA 2FYKA 2MWPA 5A0LA 2PZ1A 2DETA 4JDSA 3J81E 4JS4A 1AWWA 3A98A 4OMFB 2DTOA 1H8KA 1MMAA 3I55Q 2CP7A 4J9GA 3OQ5A 1JBMA 3QZ9B 3RKXA 1VQPA 4J9DA 3TSWA 3U23A 5M9OA 3CQTA 1VQ5T 2EGCA 4IUPA 3JCMc 3RDVA 3RKYA 2F5KA 2K9GA 2RQWA 1YJWT 4OB1B 4DOVA 5CK9A 3PE0A 3SDZA 4XU0A 3FC3A 2LJ0A 4KH1B 1QP3A 2LQNA 3URGA 3A8HB 5GAN8 1QMCA 4X34A 2RPNA 2YUOA 3JB9J 2XI9A 8AT1B 2BUDA 2RJCA 4IUUA 2RHUA 3WXMB 3JSCA 1UFFA 2ABLA 5I22A 2RHYA 3QIIA 2VGNA 2DAQA 4HVVA 4IURA 2RA2A 3CCSA 3I56T 4FSXA 3VUBA 2XK0A 1NZ9A 4AFSC 1IB8A 3JB9I 2KT1A 1N8RR 2DF6A 2E64A 3LGFA 2X3XD 5FWCA 2ROTA 3QO3A 3NFCA 3OYYA 1Q86C 1QCOA 2CKKA 3CCJT 1D3BA 2K7AA 4KGZB 1YJNQ 2DRKA 3QPHA 4AFUC 2EQIA 4XK8E 2DXBA 5FU7B 3CCEA 4JRKA 2YLCA 1M27C 4AFZC 1LVKA 1W1FA 3MO8A 2FZKB 1IREB 4M78B 3OYCA 3CCQT 2KXCA 2GF7A 4FIBA 5EC7A 2XG8D 1WYXA 2E65A 1EX4A 2XU8A 4RG2A 2NUTA 4HT8A 4JRPA 1D1AA 3DB3A 3BDUA 1AWOA 1VQLQ 3OS0A 2GTJA 5DLOA 5L8RE 3M9QA 1SF9A 4RTXA 4FCYA 2J6KA 1WIEA 1AOJA 3M57A 2L3RA 2JTEA 1ZA2B 1KJWA 1SRLA 1SKUB 4ESRA 4WF2A 4X9DA 4A4EA 4LD9K 3G6EQ 4IKFA 4QVCA 3LGLA 1R77A 2FRYA 2V26A 2WACA 4C0FA 1PSFA 1W6XA 2B8AA 1KK7A 3UATA 5I2SA 1VQ6Q 1RUWA 2MI6A 5LJ5g 2F2WA 1QVFP 1K76A 2EQUA 2DZ9A 2CDTA 3EGXA 2IIMA 3ME9A 3OBWA 1G3WA 1GXIE 4PFZA 2L0AA 5CCAA 3JCMW 2VGMA 1UE9A 2CT4A 1QVPA 2P0PA 3ZFJA 2J7IA 1UEBA 4J7IA 1AZGB 1U1TA 1Q81U 4LDWA 1PM3A 2KBTA 4B9XA 3VRYA 2LP5A 1BB9A 4HVUA 3OYFA 5CKEA 2YXYA 1OX9A 4ZGEB 1K0SA 4CC7A 4HXJA 2XDDA 3QKJA 4JJNK 2RJDA 3TREA 4Q5WA 4C8QB 2M16A 4NOYA 3M54A 2CH4W 1VQMQ 1M1KU 3G4ST 1KC8C 4KUIA 3HRTA 5FRNA 1PD1A 1NJIC 4AT1B 3QYGB 1VQ4T 3C4SA 2HCKA 4IUVA 2DIGA 1DJ7B 3EG9B 2QQSA 3EG1A 2Y4YA 5A2QE 5KYWB 1M3AA 2YWWA 2ROLA 3CCVT 2DMOA 2V1QA 1VQLA 1VQ5Q 3G71T 2HQXA
chains in the Genus database with same CATH topology
1YBYA 3CBMA 2DXCA 4L59A 3MHXA 1KD1U 3ER0A 2QDYB 3CBOA 4II1A 5CKFA 3CEYA 4M78D 2G3RA 5FU7C 3QUIA 3SD4A 5GAMj 1P92A 4XTWA 5GAMd 4HT9A 5KE2A 1KHIA 2E70A 3PMIA 4F7UF 2CGHA 2VYTA 4GLKA 3OS1A 4J8OA 2DEQA 1RL2A 5GMKh 1MHNA 2X4YA 3A5ZB 2DZCA 5C0MA 5GAMh 1N9SA 1K8AC 2FHDA 3CXCS 1YHQA 4BY6C 2PU9B 2K5FA 3G6EA 5GAOl 3CMEA 4BE2A 2H3JA 3L2ZA 4MMKA 2ZPBB 3X25B 2R5MA 1K8AU 1VQ7T 4ZGJB 1QVFA 3HL8A 1SSFA 2GFUA 3O8VA 3JCMb 4PJOB 3MEWA 1VQ6A 2ZGWA 2L5QA 2LQ8A 3M4GA 4FT2A 4A4GA 1VQKT 3M4YA 4M7AE 5D6XA 2F69A 3QXEB 1YIJA 2K3YA 3V8LA 5GAN2 3OYJA 1FXXA 1XQHA 4XTVA 2K3XA 3FRNA 4O6JA 2D6FA 3JB9H 3OBYA 3MEUA 2OTLT 3CC2A 1VQKA 2DVEA 5CIUA 3TCJA 3I55A 3EAEA 2DD4A 1WNLA 5IAYA 3BFMA 2NLUA 2L89A 2EAYA 4L5GA 4M75C 1NE8A 4BE1A 2E5QA 4QQDA 5FRMA 4BE0A 2OAUA 5CR2A 2CZ0B 1QVGS 5I2MA 1YJ9T 3MCAB 1XOVA 1UGSB 1M5Q1 1Y7XA 2ZPGB 3FB9A 5GAMe 1I4K1 3HHTB 5KH6A 5GAOq 4LDYA 2E10A 3QSUA 5CKBA 2XD0A 2EQJA 3CPWA 1BI1A 3T9NA 4M7DB 4M7AB 3L2VA 4QQ6A 2RK2A 4MZTA 1N8RC 5IT9E 1YJ9A 4EMKB 3HPWA 1NPPA 1EIFA 4XTUA 3OW2A 1WQWA 1S72T 3CBPA 3OYHA 2EQKA 4BI8B 2E12A 3CCMT 2IVWA 1WQ7A 3A8GB 1RI0A 4IUTA 3OSVA 5HY6A 1H3ZA 3PNWC 4C8QE 4E7KA 2QXFA 3JB9F 4XQ3A 2RK1A 5CKDA 3LWIA 3PGGA 1G3TA 3JCMg 4EMGA 3GLXA 4KBMB 1ZQ1A 3FJPA 5KE3A 3CCLA 2LVMA 3GF5A 3CC4T 4M75A 2M9UA 3TU4K 5GMKm 3G7ZA 5D6YA 4M77A 4FL6A 4F7UE 2LT1A 1W2BA 4M7DF 3S3OA 3INZA 2JTFA 4RG8A 3CCUA 3S3NA 2X4WA 2VV5A 3V7SA 2WSEE 2YLBA 1IZ6A 4BD3A 3MP6A 4M75F 3OA6A 4MDWA 2RD1A 4C8QD 3QDRB 4Y28E 5CKHA 4M77F 1XNIA 3DB4A 2XKOC 4J6XA 1KHCA 4KUDK 2EJGA 2RH2A 4C0GA 1M1KC 4R56A 2RI5A 5HK3A 2A3LA 2JN0A 4Z02A 1VQ9A 1YJNA 2KY9A 1UGRB 4ELZC 3BDLA 2RB6A 3JB9G 2BKDN 3QZ5B 4JLGA 4BB7A 5HKCA 5CQYA 5LJ5f 3SWNB 4JLIA 5GAMf 4JRIA 4EDUA 2RJFA 1YJWA 2P0QA 1X6OA 4C5IA 3OYKA 2VUBA 2DK3A 3PMTA 1VQOT 3CD6T 4J6WA 3L42A 4ATOA 1I5LA 1VQLT 4E7HA 4RCBA 4E7JA 2RHZA 4OGCA 1VIEA 4FU6A 3L2QA 4LD6A 2XHCA 4MZMA 5GMKi 3OB9A 4M75G 4OVAA 1KQ1A 4C0DC 2X35A 2RI3A 2XDPA 4M77G 5CO7A 4CRIA 4PJOE 2ZPEB 3RKWA 4LDVA 2R57A 1AHJB 4A4FA 2JZ2A 4EMHA 5GMKj 2C06A 1BI3A 3OS5A 5LJ5j 3FDRA 5GANg 1LNXA 2VC8A 5LJ5d 5GAN4 1BI2A 2OTJT 3AHUA 2QTXA 2M1HA 2K4YA 4CI0C 2KAFA 2EQMA 4OP0A 4C5GA 2LRQA 3Q1JA 3G6ET 1YHQT 1K73U 3CMET 3CCRA 4C92A 4M78C 1M4ZA 2MWOA 3E9FA 2O01E 3GNFB 4J83A 5FROA 4ZGDB 3I56A 4UC4A 3S3MA 2HQEA 4EPCA 5LJ5h 1VQNT 4BUGA 2EWNA 2KDSA 3GNGA 1VQ6T 2OTJA 1Q86U 4C92F 4E47A 3OY9A 1JJ2S 4PKCC 1YIJT 2PUOB 5FU6C 1KQSS 4PJOD 2WSFE 3H6ZA 4DQ2A 2K57A 3JCMd 4NL2A 1VQNA 3L2RA 2RHXA 4OGEA 3CCJA 3QJ6A 3CC2T 3ZBDA 3A8LB 3KBGA 2LQKA 1Y96A 3VYGA 3I55T 3DKMA 3PTAA 1H641 3NTHA 4M7DE 4BI4A 2JUFA 1R8OB 3FLGA 3OYAA 1FWZA 3S6WA 5D6WA 1WJSA 3CXCA 3JCMh 3OSSC 3P8DA 3QG1A 4GY5A 2EYQA 3HKSA 4M77E 4JRQA 4YTLA 3JB9D 3TEEA 2QA4A 2EJFA 1YITT 3GOXA 2LCCA 3LWHA 3P8HA 3V8KA 4N0AC 2XIDA 4DOWA 3V8JA 4HCZA 5A0DA 4HCBA 5GMKe 5GAN3 5KCOA 3EFSA 3HRUA 3OYBA 3FIFA 2DXUA 5LJ5e 5GMKl 1G3SA 3C95A 4M78A 4ZN1A 1YITA 3QJYA 3QBYA 3WVDB 1M1FA 2YRVA 3M58A 3SB2A 1BIBA 4TVRA 1LJOA 1ZHIA 3C94A 3VU3C 5LJ3g 4M7DD 4M7AD 1M8VA 3HRSA 4HKEA 4N4IA 3L1AA 4C92G 5I21A 3LW5E 3RERA 2GQVA 2DD5A 2ZPFB 5IN1A 4M78F 5HK0A 3CC7T 4M7AC 4MDXA 1PSEA 2EJ9A 1M90C 3A8OB 4M77D 4M75B 4NS5A 4E7IA 1HK9A 4M77B 1QVGA 1WJRA 1M90U 4J7FA 4RMOA 5GAOr 1FX7A 2K2VA 3SFMA 3F70A 3JCMe 3CCLT 2FB7A 3PT9A 3CC7A 4OF1A 1Y07A 3UDCA 2YHTA 4C0ZA 2FYKA 2MWPA 5A0LA 3PFSA 4MZPA 4B9WA 1G5VA 4PLLA 4XTXA 2ZZDA 3X26B 2KQWA 2O4XA 3CCUT 4JDSA 2IG0A 3HFNA 3X24B 3J81E 4JS4A 2BIVA 3E1SA 1VQMA 2DKGA 4QW2A 3X28B 4O5VA 2M0OA 1VQPT 2P4TA 1Y71A 3A8MB 4OMFB 2DTOA 4N0AA 5DLQE 1WGSA 1KQ2A 3LX7A 4XU2A 1Q7YC 3OQ5A 1B34A 1JBMA 2L8DA 3QZ9B 3RKXA 1Q7YU 1VQPA 3LLRA 2CZ1B 3M5AA 4XTYA 2K5LA 5M9OA 1VQ9T 2QQAA 2JOYA 2KSSA 1YJNT 1VQ5T 3VJPA 4M78G 3QYHB 4C92E 1UGPB 5GANh 1Q82C 4FM4B 1I8FA 3NTKA 4IUPA 2HD0A 3JCMc 5CAIA 3UPUA 4A4HA 3RKYA 4C8QC 3JAME 2RI2A 1Q82U 2F5KA 3WVEB 3OMCA 2CS7A 2LT4A 2MF2A 1YJWT 4OB1B 1X75C 4DOVA 1VQ5A 2P0KA 5CK9A 1WJQA 5LL6S 4E7LA 1VUBA 2X4XA 3SDZA 3MEVA 4XU0A 4KULA 2LCLA 3FC3A 3OYMA 2QQRA 1BI0A 3MEAA 4XU1A 2Y90A 1QP3A 3BY7A 3M53A 3MP8A 2E1HA 3BW1A 3URGA 3GP8A 4HA8A 3A8HB 5GAN8 3HSBA 5GAOp 4XU3A 2RM4A 3HFOA 2JNGA 3LH0A 4X34A 2F5TX 4C92B 2R5AA 3JCMX 3CCST 1N9RA 3R6OA 3JB9J 2XI9A 2JTMA 2QQ9A 2BUDA 2RJCA 4IUUA 2RHUA 3WXMB 5GAN6 3JSCA 2XDBA 4XAXB 2KVQG 4P5NA 2RHYA 3JCMf 3QIIA 5GANe 2VGNA 2DAQA 4PLIA 2QEXA 3CCRT 4IURA 2RA2A 1NJIU 4N4GA 1QW1A 3CCSA 3I56T 4FSXA 5LJ3j 3VUBA 2XK0A 4ZN3A 4NL3A 5LJ3d 3G4SA 1NZ9A 1X01A 1K73C 4C8QA 3RMSA 4BDZA 1N6AA 3JB9I 1KG1A 1VQ4A 1Y96B 2E64A 3LGFA 4BACA 1OYXA 2LNVA 5DY9A 3CMAA 3QO3A 3NFCA 2EIFA 3OYYA 5LJ3h 4C0DB 2CKKA 1OZ3A 3M56A 2E6ZA 3CCJT 1Q86C 1D3BA 3L2UA 4HCCA 2EKOA 3RMQA 5CVIA 3QPHA 4F7UA 4QVDA 2VXFA 3META 4XK8E 2DXBA 2DXTA 3E9GA 5FU7B 3CCEA 4LDXA 2E41A 2YLCA 3CPFA 4JRKA 3RIRA 2KK4A 3ZEHA 1QVFS 2ZCFB 2LC4A 3CCVA 2QA4T 3MO8A 1U8RA 4PJOC 4M78B 1IREB 3OYCA 1NPRA 3G71A 3CCQT 3C12A 2GF7A 3RUXA 4ZTJA 3GIBA 1WPYA 1N27A 2MAMA 2V8JA 2R58A 4FIBA 1S72A 2XG8D 4M75E 2V8KA 2E65A 2XU8A 1MGQA 3HP9A 4RG2A 3VKIA 4BY6B 4JRPA 1JJ2A 4HT8A 2MMPA 1TH7A 2WSCE 3OYLA 1KQSA 2HBPA 3CCQA 5FU6B 3DB3A 3BDUA 2PVOB 1V29B 2RHIA 4V2SA 3J80E 3VV0A 2RO0A 3OS0A 5DLOA 1UGQB 3UWNA 2DTIA 3RESA 5L8RE 3M9QA 5LJ3e 5A0GA 4C5HA 4PL6A 4JUVA 3KUFA 4C8QG 3JCMQ 1VIFA 2LTOA 1VQ7A 5GAN5 3M57A 2O4XB 2L3RA 2QQBA 2KMTA 3OYEA 1M1GA 4PNOA 4L6V5 4M75D 4QVZA 4M7DC 1OZ2A 5GANf 3CPWS 1M9SA 3QHSA 3JCMP 2CZ7B 4WF2A 3E19A 4X9DA 4A4EA 4EMKC 2GCXA 2Y4XA 5AYFA 4LD9K 2CZ6B 4KT0E 3OW2S 3M55A 1K9MC 4QVCA 2FL7A 4F7UG 4IKFA 3LGLA 4M77C 5J3BA 1B34B 2WACA 2QI2A 4VUBA 3JCMJ 1VQMT 4C0FA 1PSFA 2B8AA 2RJEA 1K9MU 2LX9A 2OTLA 5KCHA 3DLMA 5I2SA 2EFIA 4J5YA 2MI6A 1QP2A 2X4JA 5GAOm 5LJ5g 3OMGA 1JB0E 4X9CA 2HNIA 4PJOF 5GAMg 3JRZA 4BDYA 5CQXA 3VUZA 1XTDA 4OB2B 2EQUA 2DZ9A 1N8RU 1UB4A 2LDMA 3ME9A 3OBWA 3ASKA 4Y91A 5GANj 1G3WA 1O75A 5C6SA 5GANd 1ZBXA 2A7YA 4ZTFA 1GXIE 5CCAA 5GAN7 3JCMW 2VGMA 1U1SA 5FLXE 1W2BS 1QVPA 1Q81C 2P0PA 4J6YA 1BKBA 3ZFJA 4PJOA 1VQ8T 4ELYC 2PQWA 1UEBA 4J7IA 2K5IA 1YI2T 3PIOA 2V8IA 1U1TA 3UT1A 4LDWA 1O9SA 3CCMA 1Q81U 2HAXA 4M7DA 4M7AA 5DM7R 2D9TA 4B9XA 1G3YA 3V7RA 4EMKA 4A54A 2ZPHB 4N4HA 3OYIA 1VQ8A 2DJZA 2FVUA 4DA4A 3NTIA 2AHJB 3J7AF 1YI2A 3H8ZA 1I81A 2DO3A 3OYFA 4M7AF 5CKEA 4ZGEB 5LJ3f 2ZPIB 2XDDA 3GPLA 4JS5A 3OYNA 4OB3B 3QKJA 4IUQA 4PJOG 4JJNK 3CC4A 3SWNC 5EG2A 2DIQA 3N5BB 3L2WA 2RJDA 3TREA 4Q5WA 3VYHB 4LDUA 4C8QB 4A53A 4RCCA 4C92D 2M16A 3X20B 5GAOn 3DLLA 2I2LA 1JRIA 2QEXT 2PVGB 4NOYA 3OYGA 2JVVA 3M54A 3OYDA 1YCYA 4A4KA 1M1KU 4C92C 3G4ST 1KC8C 4KUIA 3HRTA 5FRNA 1NJIC 1D3BB 3JCMV 3M59A 3QYGB 4BI3A 1VQ4T 4ME7A 4R55A 1KC8U 4RKUE 3C4SA 1W4SA 4F7UB 4IUVA 2DIGA 1BIAA 1LOJA 3CMAT 4OB0B 3LYIA 4M78E 1HXDA 3PIPA 2XICA 1DJ7B 4C5EA 4MMLA 3KXTA 2VXEA 2QQSA 3EFRA 3FEOA 2E6NA 2Y4YA 4FT4A 5J26A 3MP1A 4M7DG 4M7AG 4D6WA 2CYZB 3CCET 5A2QE 4C8QF 2PVDB 2GFAA 2PUKB 4XTZA 3V7CA 3OS2A 1VQOA 3CD6A 3CCVT 2DTHA 1VQLA 2D0QB 3P8BB 3G71T 2HQXA 1OI1A 2DPPB 3SWNA 4QQGA 1KD1C 5J39A 1BYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JTM A;  4R56 A;  3LWH A;  4R55 A;  3KXT A;  3LWI A; 
#chains in the Genus database with same CATH topology
 3CBM A;  1KD1 U;  2QDY B;  4II1 A;  5GAM j;  2OI3 A;  1P92 A;  4HT9 A;  1QCN A;  1KHI A;  1QQJ A;  3OS1 A;  4J8O A;  1RAA B;  2COZ A;  2VWF A;  5GAM h;  1K8A C;  1X6G A;  2FHD A;  3CXC S;  4AG1 C;  2PU9 B;  3G6E A;  4OML A;  1QVF A;  1Z9Z A;  3EFO B;  4ZGJ B;  3HL8 A;  1SSF A;  1GCQ C;  1PG5 B;  1VQ6 A;  3M4G A;  2LQ8 A;  1ZSG A;  4M7A E;  5D6X A;  2F69 A;  3QXE B;  2O2O A;  2FRW A;  2OTL T;  3M0T A;  2E3I A;  2KRO A;  5CIU A;  1GCP A;  3EH2 A;  1NE8 A;  2E5Q A;  4QQD A;  3M0S A;  1QVG S;  1YJ9 T;  5GAM e;  5KH6 A;  5GAO q;  3CCJ Q;  1I4K 1;  2E10 A;  1BI1 A;  1TXQ A;  4M7A B;  2RK2 A;  1WXU A;  1IHW A;  2DL4 A;  2K3B A;  1EIF A;  3HPW A;  3OW2 A;  1GCQ A;  2EQK A;  3CCQ Q;  1HD3 A;  4IUT A;  3OSV A;  1H3Z A;  3PNW C;  4E7K A;  1Q86 R;  5KE3 A;  3C0C A;  3PVL A;  3CCL A;  4OMM A;  1UJY A;  5D6Y A;  4F7U E;  4M7D F;  2DIL A;  3V7S A;  1IZ6 A;  1S1N A;  2LCS A;  3QDR B;  4Y28 E;  5CKH A;  3NMZ C;  1UDL A;  2RH2 A;  2YT6 A;  2CT3 A;  5HK3 A;  4Z02 A;  1UGR B;  2KY9 A;  1E7O A;  1RAG B;  2BKD N;  2LNH B;  3QZ5 B;  5FW9 A;  4AG2 C;  2JM9 A;  5AT1 B;  4JLI A;  5GAM f;  4EDU A;  2RJF A;  1YJW A;  3OYK A;  1ZLM A;  3L42 A;  3QWX X;  2CP5 A;  1I5L A;  2MPX C;  4FU6 A;  4RTU A;  1WX6 A;  2KRN A;  2CP3 A;  4PFO A;  4CRI A;  3RKW A;  2R57 A;  5GMK j;  2KYM A;  1WHM A;  5LJ5 j;  1D1B A;  2ED1 A;  5KYU B;  2K4Y A;  1YHQ T;  3EG2 A;  4C92 A;  1RLQ C;  1M4Z A;  2MWO A;  3I56 A;  1X27 A;  5LJ5 h;  2KDS A;  5HCK A;  2OTJ A;  5L23 A;  3OY9 A;  4ZNX A;  1AD5 A;  1MMN A;  3H6Z A;  2L3P A;  1X2Q A;  3CCJ A;  3I55 T;  3VYG A;  1Y96 A;  3G4S Q;  3PTA A;  1R8O B;  4FW2 A;  1VQ4 Q;  1B3Q A;  4LUD A;  1WDX A;  5D6W A;  1WJS A;  3JCM h;  2A37 A;  2D8H A;  4M77 E;  3JB9 D;  1ZSZ A;  3GOX A;  2LCC A;  2EYX A;  7AT1 B;  1PKS A;  4N0A C;  2NWM A;  3V8J A;  4HCZ A;  5GMK e;  5GAN 3;  3EFS A;  2G6F X;  5LJ5 e;  4F16 A;  1G3S A;  1GFC A;  1YIT A;  3QBY A;  1YN8 A;  2CSI A;  1ZHI A;  1KSW A;  3G71 Q;  4C92 G;  1KC8 R;  4PJM A;  4HCK A;  2RNA A;  1NJI R;  2DD5 A;  3VS6 A;  4M78 F;  2KNB B;  1PSE A;  4M77 D;  4M75 B;  2M02 A;  4M77 B;  3SFM A;  3JCM e;  2FB7 A;  4OF1 A;  3UDC A;  2YHT A;  4MZP A;  1G5V A;  4PLL A;  3X26 B;  2O4X A;  2IG0 A;  1QKX A;  4O5V A;  1Y71 A;  4N0A A;  1W70 A;  1KQ2 A;  1FMW A;  3LX7 A;  4XU2 A;  4LXC A;  2OJ2 A;  4WCI A;  2YRD A;  1G83 A;  2K5L A;  2OTL Q;  1VQ9 T;  3MKD A;  2JOY A;  1YJN T;  5KYY B;  1UGP B;  5GAN h;  2HD0 A;  4A4H A;  1K8A R;  2RI2 A;  4CC2 A;  3OMC A;  2LT4 A;  1YJ9 Q;  3NGP A;  1TUC A;  4E7L A;  2KI7 A;  3UF4 A;  4KUL A;  2QQR A;  3MEA A;  3BY7 A;  3MP8 A;  2EVR A;  4HA8 A;  3M0R A;  3I9Q A;  3HSB A;  1M2V A;  2RM4 A;  3LH0 A;  2CUB A;  2F5T X;  1HSQ A;  3JCM X;  1CKA A;  2L3S A;  1MMG A;  5GAN 6;  2H8H A;  4XAX B;  3H0F A;  2CP2 A;  2LX7 A;  4P5N A;  3JCM f;  5GAN e;  1BBZ A;  2MIO A;  1M30 A;  1WLP B;  3G4S A;  4BDZ A;  1VQ4 A;  4BAC A;  2M0Y A;  2LNV A;  2CUD A;  2EIF A;  1OOT A;  3RMQ A;  1D0Y A;  4F14 A;  3O5Z A;  5CVI A;  1K9A A;  2FEI A;  2VXF A;  3RIR A;  2EGA A;  3CPF A;  4LNP A;  1QVF S;  1WA7 A;  2ZCF B;  1UJ0 A;  3CCV A;  4PJO C;  3G71 A;  2M51 A;  4ZTJ A;  1R0B G;  1A0N B;  3VKI A;  2CRE A;  4OMO A;  1TH7 A;  3G1J A;  2PVO B;  3VV0 A;  2KR3 A;  2RO0 A;  1UGQ B;  5A0G A;  4PL6 A;  2EYY A;  3KUF A;  3JCM Q;  1NEG A;  2QYZ A;  1IGQ A;  1IO6 A;  1GBQ A;  2MCN A;  1C1A A;  1M1G A;  4M7D C;  2KXD A;  1OZ2 A;  5GAN f;  3JCM P;  3QHS A;  1I07 A;  3E19 A;  2GCX A;  2Y4X A;  1YHQ Q;  2CZ6 B;  4KT0 E;  3OW2 S;  4PJO A;  4VUB A;  2QI2 A;  1VQM T;  2OTL A;  1B07 A;  2LX9 A;  2DFU A;  5KCH A;  1OU9 A;  4E7Z A;  1FMV A;  5GAO m;  2SEM A;  4X9C A;  1PC0 A;  5GAM g;  3PVQ A;  1N8R U;  2P4R A;  3ASK A;  4Y91 A;  5C6S A;  5GAN d;  4ZTF A;  5FLX E;  1Q81 C;  1BKB A;  1VQ8 T;  2PQW A;  2DA9 A;  2J6O A;  2K2M A;  1YI2 T;  2V8I A;  2HAX A;  1O9S A;  4M7D A;  1M2O A;  2D9T A;  3V7R A;  2ZPH B;  4N4H A;  3OYI A;  2DJZ A;  3NTI A;  3J7A F;  1I81 A;  2DO3 A;  4M7A F;  3TSZ A;  3CPW P;  3LH5 A;  4OB3 B;  4PJO G;  3SWN C;  2DIQ A;  3L2W A;  1WXT A;  4J9C A;  4A53 A;  4RCC A;  2FZG B;  2OAW A;  2I2L A;  2QEX T;  3OYG A;  2JVV A;  3OYD A;  2HSE B;  2A08 A;  4A4K A;  2MOX A;  3NHN A;  1D3B B;  1VYV A;  1W4S A;  2RQT A;  1C6V X;  4M78 E;  3THK A;  2XIC A;  4MML A;  2E3H A;  3EFR A;  1AEY A;  1W2B P;  3FEO A;  4M7D G;  3MP1 A;  2NUT B;  2PUK B;  2GQI A;  1VQ9 Q;  3SWN A;  1KD1 C;  2DPP B;  4QQG A;  1S72 T;  2Z0W A;  2DL7 A;  2DXC A;  4L59 A;  1FYN A;  3ER0 A;  3CBO A;  5CKF A;  5FU7 C;  4M78 D;  3QUI A;  4XTW A;  1RI9 A;  5KE2 A;  3PMI A;  4F7U F;  2KRM A;  2DEQ A;  3JV3 A;  2JXB A;  1RL2 A;  2X4Y A;  1T0H A;  5C0M A;  4FYX B;  1YHQ A;  2K5F A;  5GAO l;  4E2F B;  4BE2 A;  2H3J A;  3L2Z A;  1NBE B;  1OX8 A;  2NUP A;  2ZGW A;  2L5Q A;  1VQK T;  4FT2 A;  4A4G A;  3V8L A;  3OYJ A;  1XQH A;  4D8K A;  2HDA A;  4XTV A;  2D6F A;  3JB9 H;  1ABQ A;  3OBY A;  3MEU A;  3CMA Q;  3I55 A;  3UA6 A;  3EAE A;  2DD4 A;  1WNL A;  2L89 A;  5GJV B;  3EGX B;  3H0I A;  4L5G A;  1I0C A;  4BE0 A;  2QG9 B;  5CR2 A;  2GBQ A;  3SEM A;  1AT1 B;  3VS1 A;  2O9V A;  1UGS B;  1Y7X A;  2ZPG B;  3HHT B;  4LDY A;  1TSF A;  3QSU A;  2XD0 A;  5IHN A;  3CPW A;  3L2V A;  4MZT A;  5IT9 E;  1NPP A;  3CBP A;  2YSQ A;  3OYH A;  4BI8 B;  3CCM T;  1WQ7 A;  4J9H A;  5HY6 A;  4C8Q E;  1Y0M A;  1JJ2 P;  2QXF A;  1ZUU A;  3JB9 F;  5I11 A;  4XQ3 A;  4X1V A;  2BE9 B;  3LWI A;  3JCM g;  2E4H A;  2AKK A;  3GLX A;  1ZQ1 A;  2E5K A;  3FJP A;  2HSP A;  1V76 A;  2LVM A;  3CC4 T;  1E6H A;  5GMK m;  3G7Z A;  1K1Z A;  2LT1 A;  1W2B A;  3S3O A;  2DNU A;  3INZ A;  2VV5 A;  3E2U A;  2WSE E;  2K6D A;  2HKQ B;  4M75 F;  3OA6 A;  4MDW A;  4DEY A;  2RD1 A;  4C8Q D;  2HMA A;  2EBP A;  4M77 F;  3DB4 A;  1IHV A;  1YCS B;  1BU1 A;  1VQ9 A;  1YJN A;  4ELZ C;  2RB6 A;  4HVW A;  5HKC A;  5CQY A;  3H41 A;  2D0N A;  1RAE B;  3VRZ A;  1RAC B;  2COY A;  4F17 A;  2VUB A;  2COW A;  2DK3 A;  4J6W A;  4Y92 A;  4E7H A;  1RAH B;  2BE7 D;  4OGC A;  2D1X A;  2DL8 A;  3L2Q A;  2QTV A;  2XHC A;  1Z9Q A;  1WI7 A;  4OVA A;  1VQ8 Q;  4C0D C;  5CO7 A;  1YI2 Q;  2RQV A;  1F1B B;  1X6B A;  5KYN A;  4Z89 A;  3OS5 A;  1BK2 A;  3FDR A;  1LNX A;  2RF0 A;  5GAN g;  9ATC B;  1BI2 A;  1NG2 A;  2V1R A;  2QTX A;  4CI0 C;  2KAF A;  4C5G A;  1WZO A;  1VOM A;  1RAF B;  3E9F A;  3GNF B;  4J83 A;  2DBM A;  2I0N A;  4EPC A;  1VQN T;  1UEC A;  4BUG A;  2EWN A;  3UA7 A;  1Q86 U;  2BZY A;  1Q81 R;  1YIJ T;  5FU6 C;  4J9B A;  2QEX Q;  2ZAE A;  2K57 A;  2RHX A;  3KBG A;  2LQK A;  4BI4 A;  3FLG A;  3S6W A;  3OSS C;  2JS2 A;  4GY5 A;  2EYQ A;  1PHT A;  2ESW A;  1ARK A;  4HCB A;  1C0M A;  5KCO A;  3OYB A;  3HRU A;  2MYS A;  3FIF A;  5GMK l;  3C95 A;  3QJY A;  3WVD B;  3M58 A;  3VU3 C;  1BIB A;  1LJO A;  3C94 A;  5IHI A;  2A36 A;  4M7A D;  1M8V A;  1XJW B;  3LW5 E;  3H9N A;  1S72 Q;  2DL5 A;  1OV3 A;  2GQV A;  5IN1 A;  4M7A C;  3CC7 T;  1B7T A;  1OPL A;  4MDX A;  3A8O B;  4FYW B;  1WJR A;  1Q95 G;  1M90 U;  4J7F A;  5GAO r;  3CME Q;  1NM7 A;  2VKN A;  3QDF A;  3PT9 A;  1RAD B;  3A1P A;  4B9W A;  1T3S A;  4DBQ A;  1YWO A;  3X24 B;  2BIV A;  1VQM A;  2DKG A;  4QW2 A;  2GNC A;  1VQP T;  2FG0 A;  3A8M B;  1KD1 R;  5DLQ E;  1I5O B;  3CC2 Q;  1VQK Q;  4PJL A;  4QKU A;  1B34 A;  2L8D A;  1Q7Y U;  1NLO C;  2CZ1 B;  3M5A A;  1NYG A;  4XTY A;  1WHL A;  3VJP A;  4C92 E;  1GL5 A;  1I8F A;  5CAI A;  3JAM E;  2HZY A;  1Q82 U;  2CS7 A;  2MF2 A;  4RTZ A;  1X75 C;  1VQ5 A;  2P0K A;  1TUD A;  5LL6 S;  1VUB A;  3MEV A;  2F2V A;  2LCL A;  2RQU A;  4XU1 A;  2Y90 A;  2MK5 A;  3M53 A;  2A0F B;  2E1H A;  3BW1 A;  3MPU B;  2W0Z A;  4XU3 A;  1QLY A;  3CCM Q;  4C92 B;  2R5A A;  3CCS T;  4AMC A;  1YP5 A;  1IXD A;  2JTM A;  2QQ9 A;  2XDB A;  4K11 A;  1WHJ A;  1X43 A;  2F2X A;  2QEX A;  3CCR T;  1NJI U;  1SEM A;  4NL3 A;  1K73 C;  5LJ3 d;  3CC4 Q;  1X01 A;  1N6A A;  2QAZ A;  2W10 A;  1Y96 B;  1MV3 A;  1TU0 B;  1YFN A;  2A28 A;  3EGD A;  1RAB B;  1NLP C;  2EKO A;  2QK0 A;  1ZSZ B;  4F7U A;  3MET A;  2DXT A;  3ZEH A;  2GGR A;  2X51 A;  1WHH A;  2RQR A;  4JJC A;  3GIB A;  1NEB A;  2VB6 A;  2MAM A;  1S72 A;  2V8J A;  2R58 A;  1K0X A;  2FO0 A;  3VS4 A;  4M75 E;  1MUZ A;  3HP9 A;  4BY6 B;  2MMP A;  2WSC E;  3GBQ A;  3CCQ A;  2RHI A;  2DTI A;  1ZUY A;  2AT1 B;  1WFW A;  3REB B;  1VIF A;  2LTO A;  5GAN 5;  2O4X B;  2QQB A;  3OYE A;  2KMT A;  2EW3 A;  4M75 D;  1ABO A;  3CPW S;  2CZ7 B;  4EMK C;  5AYF A;  2JT4 A;  3M55 A;  4B6M A;  4F7U G;  3VS3 A;  4M77 C;  5J3B A;  1UHF A;  2RJE A;  1K9M U;  1VQN Q;  4OMN A;  4J5Y A;  1QP2 A;  1R0C B;  2X4J A;  5IHK A;  3OMG A;  1TWB A;  1YIJ Q;  3H0H A;  3VUZ A;  1XTD A;  3EHQ A;  5GAN j;  1NYF A;  1O75 A;  2A7Y A;  2YUP A;  3CXC P;  5GAN 7;  4OMP A;  1W2B S;  2AKL A;  2RMO A;  2L2P A;  4ELY C;  2K5I A;  2KYB A;  1T0J A;  3CCM A;  1M2V B;  5DM7 R;  4R0K A;  2SRC A;  4EMK A;  2FVU A;  4DA4 A;  2AHJ B;  2O9S A;  1D0Z A;  2VVK A;  2ZPI B;  2EKH A;  4JS5 A;  3CC4 A;  4IUQ A;  5EG2 A;  2HKN A;  3CC7 Q;  1WXB A;  2KT8 A;  5KYX A;  2PNI A;  2EYZ A;  5IXB A;  3DLL A;  2LJ1 A;  1SSH A;  1JRI A;  2LMJ A;  2ECZ A;  3RBB B;  4JZ3 A;  1UUE A;  3M59 A;  2LJ3 A;  4R55 A;  5FWB A;  1LOJ A;  3CMA T;  3LYI A;  2JS0 A;  1VQP Q;  2VAS A;  2FZC B;  2VXE A;  1ACM B;  4FT4 A;  5J26 A;  1ZX6 A;  2CYZ B;  1UGV A;  4C8Q F;  2PVD B;  3OS2 A;  4Z8A A;  2DTH A;  2DE0 X;  4RUG A;  4DBF A;  4DEX A;  1HJD A;  1YBY A;  4AFQ C;  2E70 A;  4IIM A;  2VYT A;  3M0Q A;  4IIO A;  1MHN A;  1JEG A;  2DZC A;  1VYU A;  1N9S A;  3EHR A;  1VQ7 T;  2R5M A;  2GFU A;  3MJX A;  4PJO B;  3CCS Q;  4LUE A;  4RTY A;  3M4Y A;  1YIJ A;  3CCR Q;  2K3X A;  3M0P A;  5IAY A;  3BFM A;  1MND A;  2EAY A;  2OAU A;  2CZ0 B;  4RTT A;  1OQK A;  5I2M A;  3MCA B;  3FB9 A;  5CKB A;  3NPF A;  2QAS A;  4WTO B;  1TOV A;  4M7D B;  1YJ9 A;  2OX7 A;  2E12 A;  3EH1 A;  1K73 R;  3A8G B;  1RI0 A;  2HBW A;  2IPO B;  2YUQ A;  3RNJ A;  1LPL A;  5CKD A;  1QKW A;  2DL3 A;  1G3T A;  3PGG A;  4EMG A;  2J06 A;  3TU4 K;  1WHK A;  1JXO A;  1PCX A;  3ULR B;  2JTF A;  4RG8 A;  3S3N A;  1TS9 A;  4BD3 A;  3MP6 A;  2JW4 A;  3TVT A;  1XNI A;  3REA B;  2FPE A;  1KHC A;  1M1K C;  1AWX A;  2A3L A;  1IRX A;  3BDL A;  4BB7 A;  4JLG A;  2FPF A;  4FW1 A;  3BE3 A;  3SWN B;  1ZA1 B;  4D8D A;  2AIR B;  4JRI A;  2P0Q A;  3PMT A;  1VQO T;  3CD6 T;  3I35 A;  4RCB A;  2X3W D;  2RHZ A;  2J05 A;  4J9E A;  1PRM C;  4ANJ A;  5GMK i;  3OB9 A;  1I1J A;  1PNJ A;  1KQ1 A;  2RI3 A;  1BCM A;  1D09 B;  2BZX A;  2ZPE B;  1G2B A;  1AHJ B;  2JZ2 A;  4EMH A;  2C06 A;  2HQH A;  2VC8 A;  5GAN 4;  2OTJ T;  3I5S A;  3AHU A;  2NUP B;  8ATC B;  2LRQ A;  3Q1J A;  3CME T;  4EIK A;  2X9H A;  3CCR A;  4M78 C;  2O01 E;  4ZGD B;  1ZUK A;  4C92 F;  1EFN A;  4E47 A;  4RTV A;  1PWT A;  1OU8 A;  4FYV B;  4KH0 B;  4M4Z A;  4OGE A;  3QJ6 A;  3CC2 T;  3ZBD A;  3A8L B;  3DKM A;  1H64 1;  3NTH A;  1FMK A;  2JUF A;  1E6G A;  1FWZ A;  3QG1 A;  2JMA A;  3HKS A;  4YTL A;  2EJF A;  2F1L A;  2CH4 A;  1YIT T;  1K4U S;  1G8X A;  4DOW A;  5A0D A;  4FSS A;  4RTW A;  1SHG A;  3EG0 A;  4M78 A;  4ZN1 A;  1M1F A;  2YRV A;  2KE9 A;  3SB2 A;  4TVR A;  1JO8 A;  3HRS A;  4HKE A;  3L1A A;  2QDL A;  4KGV B;  2ZPF B;  2EJ9 A;  1M90 C;  1OEB A;  4NS5 A;  2BTT A;  4E7I A;  2DYI A;  1MNE A;  4RMO A;  1BCO A;  2DM1 A;  2YRC A;  1KQS P;  3PFS A;  4PJJ A;  1KIK A;  4XTX A;  2BZ8 A;  2ZZD A;  1AWJ A;  2KQW A;  3CCU T;  3HFN A;  1VQ7 Q;  1RAI B;  3E1S A;  2DVJ A;  3X28 B;  1PRL C;  2JJ9 A;  2EPD A;  2M0O A;  2P4T A;  3TQ7 P;  1WGS A;  1U3O A;  1Q7Y C;  1Y57 A;  3LLR A;  2QQA A;  2KSS A;  4M78 G;  2D8J A;  3QYH B;  3VS7 A;  1Q82 C;  4FM4 B;  3NTK A;  1YWP A;  1D1C A;  3UPU A;  4C8Q C;  4OMQ A;  4JPB W;  3WVE B;  4Z88 A;  4LN2 A;  1WJQ A;  2X4X A;  4A63 B;  3IQL A;  3OYM A;  1BI0 A;  4JZ4 A;  1T3L A;  3OW2 P;  3GP8 A;  1QCF A;  1H3H A;  1VA7 A;  5GAO p;  3I5R A;  4J9I A;  3HFO A;  3SHW A;  2JNG A;  1N9R A;  3R6O A;  3CCL Q;  1AVZ C;  2DYB A;  2KVQ G;  4PLI A;  4N4G A;  1QW1 A;  1SRM A;  2ED0 A;  5LJ3 j;  4ZN3 A;  3HTR A;  1UHC A;  5D7U A;  4C8Q A;  3RMS A;  1KG1 A;  1EZZ B;  2LQW A;  1OYX A;  4FYY B;  1M3B A;  4GBQ A;  5DY9 A;  1ZBJ A;  3CMA A;  5LJ3 h;  4C0D B;  1OZ3 A;  3M56 A;  2E6Z A;  3L2U A;  4HCC A;  4DBH A;  4QVD A;  5IH2 A;  4LDX A;  3E9G A;  2E41 A;  3EG9 A;  4E7S A;  2KK4 A;  1YJW Q;  2LC4 A;  2QA4 T;  1U8R A;  1NPR A;  3C12 A;  3RUX A;  1WPY A;  1N27 A;  2V8K A;  1H92 A;  5KYW A;  2JMC A;  1MGQ A;  1JJ2 A;  5IXF A;  1KQS A;  3OYL A;  2HBP A;  5FU6 B;  1VQO Q;  1V29 B;  1PKT A;  3CD6 Q;  4V2S A;  3J80 E;  1HYO A;  3UWN A;  3RES A;  2K79 A;  5ECA A;  5LJ3 e;  4C5H A;  3D7S B;  1M1K R;  4JUV A;  4C8Q G;  4PFP A;  1SHF A;  4KRT A;  1VQ7 A;  4PNO A;  4L6V 5;  4QVZ A;  3I56 Q;  4QT7 A;  1M9S A;  1WHG A;  2OTJ Q;  1GRI A;  2XMF A;  3EFO A;  3ZL7 C;  1K9M C;  2FL7 A;  2DBK A;  1B34 B;  3JCM J;  3DLM A;  2EFI A;  1JB0 E;  2HNI A;  4PJO F;  3JRZ A;  4BDY A;  5CQX A;  4J9F A;  4OB2 B;  2H3E B;  2HEQ A;  2C0O A;  1PD0 A;  1UB4 A;  2LDM A;  6AT1 B;  1ZBX A;  1U1S A;  2GTO A;  4J6Y A;  3PIO A;  4JJD A;  3UT1 A;  2L3Q A;  1YIT Q;  1J3T A;  4M7A A;  1G3Y A;  4A54 A;  1VQ8 A;  1YI2 A;  1CSK A;  2CP6 A;  1OUL A;  2ENM A;  3H8Z A;  5LJ3 f;  3GPL A;  3OYN A;  2KGT A;  3R6N A;  3N5B B;  3VYH B;  4LDU A;  4C92 D;  3X20 B;  5GAO n;  2PVG B;  1YCY A;  1MMD A;  3EGU A;  4C92 C;  4CC3 A;  3EGD B;  3JCM V;  1IGU A;  4BI3 A;  1QWE A;  4ME7 A;  1MV0 B;  1KC8 U;  4RKU E;  1QWF A;  4F7U B;  3CCU Q;  1BIA A;  1SPK A;  1U06 A;  4OB0 B;  1HXD A;  3PIP A;  4C5E A;  3KXT A;  2E6N A;  1M90 R;  4M7A G;  3VS2 A;  4D6W A;  3CCE T;  2GFA A;  3V7C A;  4XTZ A;  1VQO A;  3CD6 A;  2D0Q B;  3P8B B;  1OI1 A;  2DJQ A;  5J39 A;  1ZSZ C;  1BYM A;  2CP0 A;  3MHX A;  3SD4 A;  3CEY A;  2G3R A;  5GAM d;  2O88 A;  2CGH A;  2HL3 A;  4GLK A;  2DER A;  1GBR A;  5GMK h;  4PJN A;  1Q7Y R;  3A5Z B;  2YDL A;  3M0U A;  1N5Z A;  4BY6 C;  3CME A;  4CC4 B;  1K8A U;  4MMK A;  3X25 B;  2ZPB B;  2AZV A;  3JCM b;  3O8V A;  2NUZ A;  1Q82 R;  5KYU A;  3MEW A;  2JM8 A;  2K3Y A;  5GAN 2;  1FXX A;  1RLP C;  3FRN A;  4O6J A;  2EYW A;  3VS5 A;  3CC2 A;  1VQK A;  2DVE A;  3KFV A;  3TCJ A;  1KFZ A;  2NLU A;  4M75 C;  4BE1 A;  5FRM A;  2PTK A;  2AZS A;  1X69 A;  1XOV A;  1M5Q 1;  2EGE A;  5GJW B;  3CCV Q;  3RR6 A;  2EQJ A;  3T9N A;  2QGG A;  4QQ6 A;  1N8R C;  4EMK B;  1X2K A;  1OPK A;  1YNZ A;  4XTU A;  1WQW A;  1TTH B;  2QA4 Q;  2IVW A;  1UG1 A;  4PK4 A;  2RK1 A;  2C0I A;  2NYS A;  4KBM B;  5KYX B;  1GFD A;  3GF5 A;  4M75 A;  2M9U A;  1U5S A;  4M77 A;  4FL6 A;  2C0T A;  3CCU A;  2X4W A;  3FJ5 A;  4DBR A;  2YLB A;  1TG0 A;  2DRM A;  2XKO C;  4J6X A;  4KUD K;  2DLP A;  2EJG A;  1QVG P;  4C0G A;  4R56 A;  2ATC B;  2LZ6 B;  2J6F A;  2RI5 A;  1M8M A;  2JN0 A;  3JB9 G;  5LJ5 f;  4ORZ A;  2HL5 C;  4C5I A;  1X6O A;  5KYY A;  4E6R A;  4ATO A;  2CSQ A;  1VQL T;  1JU5 C;  1JQQ A;  4E7J A;  1AZE A;  1VIE A;  4KGX B;  4LD6 A;  1VYT A;  4MZM A;  1CKB A;  1K9M R;  4M75 G;  2X35 A;  2DEU A;  2XDP A;  4M77 G;  4PJO E;  1V1C A;  4LDV A;  4A4F A;  1BI3 A;  2KRS A;  2DX1 A;  5LJ5 d;  2M1H A;  2EQM A;  3EG3 A;  4OP0 A;  3G6E T;  1K73 U;  1UTI A;  5FRO A;  3S3M A;  4UC4 A;  3AT1 B;  2HQE A;  3GNG A;  1VQ6 T;  2RN8 A;  4F04 B;  1JJ2 S;  4PKC C;  2PUO B;  1KQS S;  4PJO D;  2WSF E;  4DQ2 A;  3JCM d;  4NL2 A;  1VQN A;  3L2R A;  4M7D E;  3OYA A;  3VS0 A;  3CXC A;  2O31 A;  2B86 A;  3P8D A;  4LE9 A;  4JRQ A;  3TEE A;  2QA4 A;  3LWH A;  3P8H A;  3V8K A;  1JXM A;  2XID A;  1SG5 A;  1D0X A;  3CCE Q;  2DXU A;  1LCK A;  2P84 A;  2QGF B;  5LJ3 g;  4M7D D;  2AK5 A;  2KEA A;  4N4I A;  5I21 A;  2FPD A;  3RER A;  2YUN A;  1TUG B;  5HK0 A;  1M3C A;  4JJB A;  4GLM A;  1HK9 A;  1QVG A;  3QWY A;  1FX7 A;  2K2V A;  3F70 A;  3CCL T;  3CC7 A;  1Y07 A;  4C0Z A;  2FYK A;  2MWP A;  5A0L A;  2PZ1 A;  2DET A;  4JDS A;  3J81 E;  4JS4 A;  1AWW A;  3A98 A;  4OMF B;  2DTO A;  1H8K A;  1MMA A;  3I55 Q;  2CP7 A;  4J9G A;  3OQ5 A;  1JBM A;  3QZ9 B;  3RKX A;  1VQP A;  4J9D A;  3TSW A;  3U23 A;  5M9O A;  3CQT A;  1VQ5 T;  2EGC A;  4IUP A;  3JCM c;  3RDV A;  3RKY A;  2F5K A;  2K9G A;  2RQW A;  1YJW T;  4OB1 B;  4DOV A;  5CK9 A;  3PE0 A;  3SDZ A;  4XU0 A;  3FC3 A;  2LJ0 A;  4KH1 B;  1QP3 A;  2LQN A;  3URG A;  3A8H B;  5GAN 8;  1QMC A;  4X34 A;  2RPN A;  2YUO A;  3JB9 J;  2XI9 A;  8AT1 B;  2BUD A;  2RJC A;  4IUU A;  2RHU A;  3WXM B;  3JSC A;  1UFF A;  2ABL A;  5I22 A;  2RHY A;  3QII A;  2VGN A;  2DAQ A;  4HVV A;  4IUR A;  2RA2 A;  3CCS A;  3I56 T;  4FSX A;  3VUB A;  2XK0 A;  1NZ9 A;  4AFS C;  1IB8 A;  3JB9 I;  2KT1 A;  1N8R R;  2DF6 A;  2E64 A;  3LGF A;  2X3X D;  5FWC A;  2ROT A;  3QO3 A;  3NFC A;  3OYY A;  1Q86 C;  1QCO A;  2CKK A;  3CCJ T;  1D3B A;  2K7A A;  4KGZ B;  1YJN Q;  2DRK A;  3QPH A;  4AFU C;  2EQI A;  4XK8 E;  2DXB A;  5FU7 B;  3CCE A;  4JRK A;  2YLC A;  1M27 C;  4AFZ C;  1LVK A;  1W1F A;  3MO8 A;  2FZK B;  1IRE B;  4M78 B;  3OYC A;  3CCQ T;  2KXC A;  2GF7 A;  4FIB A;  5EC7 A;  2XG8 D;  1WYX A;  2E65 A;  1EX4 A;  2XU8 A;  4RG2 A;  2NUT A;  4HT8 A;  4JRP A;  1D1A A;  3DB3 A;  3BDU A;  1AWO A;  1VQL Q;  3OS0 A;  2GTJ A;  5DLO A;  5L8R E;  3M9Q A;  1SF9 A;  4RTX A;  4FCY A;  2J6K A;  1WIE A;  1AOJ A;  3M57 A;  2L3R A;  2JTE A;  1ZA2 B;  1KJW A;  1SRL A;  1SKU B;  4ESR A;  4WF2 A;  4X9D A;  4A4E A;  4LD9 K;  3G6E Q;  4IKF A;  4QVC A;  3LGL A;  1R77 A;  2FRY A;  2V26 A;  2WAC A;  4C0F A;  1PSF A;  1W6X A;  2B8A A;  1KK7 A;  3UAT A;  5I2S A;  1VQ6 Q;  1RUW A;  2MI6 A;  5LJ5 g;  2F2W A;  1QVF P;  1K76 A;  2EQU A;  2DZ9 A;  2CDT A;  3EGX A;  2IIM A;  3ME9 A;  3OBW A;  1G3W A;  1GXI E;  4PFZ A;  2L0A A;  5CCA A;  3JCM W;  2VGM A;  1UE9 A;  2CT4 A;  1QVP A;  2P0P A;  3ZFJ A;  2J7I A;  1UEB A;  4J7I A;  1AZG B;  1U1T A;  1Q81 U;  4LDW A;  1PM3 A;  2KBT A;  4B9X A;  3VRY A;  2LP5 A;  1BB9 A;  4HVU A;  3OYF A;  5CKE A;  2YXY A;  1OX9 A;  4ZGE B;  1K0S A;  4CC7 A;  4HXJ A;  2XDD A;  3QKJ A;  4JJN K;  2RJD A;  3TRE A;  4Q5W A;  4C8Q B;  2M16 A;  4NOY A;  3M54 A;  2CH4 W;  1VQM Q;  1M1K U;  3G4S T;  1KC8 C;  4KUI A;  3HRT A;  5FRN A;  1PD1 A;  1NJI C;  4AT1 B;  3QYG B;  1VQ4 T;  3C4S A;  2HCK A;  4IUV A;  2DIG A;  1DJ7 B;  3EG9 B;  2QQS A;  3EG1 A;  2Y4Y A;  5A2Q E;  5KYW B;  1M3A A;  2YWW A;  2ROL A;  3CCV T;  2DMO A;  2V1Q A;  1VQL A;  1VQ5 Q;  3G71 T;  2HQX A; 
#chains in the Genus database with same CATH homology
 1YBY A;  3CBM A;  2DXC A;  4L59 A;  3MHX A;  1KD1 U;  3ER0 A;  2QDY B;  3CBO A;  4II1 A;  5CKF A;  3CEY A;  4M78 D;  2G3R A;  5FU7 C;  3QUI A;  3SD4 A;  5GAM j;  1P92 A;  4XTW A;  5GAM d;  4HT9 A;  5KE2 A;  1KHI A;  2E70 A;  3PMI A;  4F7U F;  2CGH A;  2VYT A;  4GLK A;  3OS1 A;  4J8O A;  2DEQ A;  1RL2 A;  5GMK h;  1MHN A;  2X4Y A;  3A5Z B;  2DZC A;  5C0M A;  5GAM h;  1N9S A;  1K8A C;  2FHD A;  3CXC S;  1YHQ A;  4BY6 C;  2PU9 B;  2K5F A;  3G6E A;  5GAO l;  3CME A;  4BE2 A;  2H3J A;  3L2Z A;  4MMK A;  2ZPB B;  3X25 B;  2R5M A;  1K8A U;  1VQ7 T;  4ZGJ B;  1QVF A;  3HL8 A;  1SSF A;  2GFU A;  3O8V A;  3JCM b;  4PJO B;  3MEW A;  1VQ6 A;  2ZGW A;  2L5Q A;  2LQ8 A;  3M4G A;  4FT2 A;  4A4G A;  1VQK T;  3M4Y A;  4M7A E;  5D6X A;  2F69 A;  3QXE B;  1YIJ A;  2K3Y A;  3V8L A;  5GAN 2;  3OYJ A;  1FXX A;  1XQH A;  4XTV A;  2K3X A;  3FRN A;  4O6J A;  2D6F A;  3JB9 H;  3OBY A;  3MEU A;  2OTL T;  3CC2 A;  1VQK A;  2DVE A;  5CIU A;  3TCJ A;  3I55 A;  3EAE A;  2DD4 A;  1WNL A;  5IAY A;  3BFM A;  2NLU A;  2L89 A;  2EAY A;  4L5G A;  4M75 C;  1NE8 A;  4BE1 A;  2E5Q A;  4QQD A;  5FRM A;  4BE0 A;  2OAU A;  5CR2 A;  2CZ0 B;  1QVG S;  5I2M A;  1YJ9 T;  3MCA B;  1XOV A;  1UGS B;  1M5Q 1;  1Y7X A;  2ZPG B;  3FB9 A;  5GAM e;  1I4K 1;  3HHT B;  5KH6 A;  5GAO q;  4LDY A;  2E10 A;  3QSU A;  5CKB A;  2XD0 A;  2EQJ A;  3CPW A;  1BI1 A;  3T9N A;  4M7D B;  4M7A B;  3L2V A;  4QQ6 A;  2RK2 A;  4MZT A;  1N8R C;  5IT9 E;  1YJ9 A;  4EMK B;  3HPW A;  1NPP A;  1EIF A;  4XTU A;  3OW2 A;  1WQW A;  1S72 T;  3CBP A;  3OYH A;  2EQK A;  4BI8 B;  2E12 A;  3CCM T;  2IVW A;  1WQ7 A;  3A8G B;  1RI0 A;  4IUT A;  3OSV A;  5HY6 A;  1H3Z A;  3PNW C;  4C8Q E;  4E7K A;  2QXF A;  3JB9 F;  4XQ3 A;  2RK1 A;  5CKD A;  3LWI A;  3PGG A;  1G3T A;  3JCM g;  4EMG A;  3GLX A;  4KBM B;  1ZQ1 A;  3FJP A;  5KE3 A;  3CCL A;  2LVM A;  3GF5 A;  3CC4 T;  4M75 A;  2M9U A;  3TU4 K;  5GMK m;  3G7Z A;  5D6Y A;  4M77 A;  4FL6 A;  4F7U E;  2LT1 A;  1W2B A;  4M7D F;  3S3O A;  3INZ A;  2JTF A;  4RG8 A;  3CCU A;  3S3N A;  2X4W A;  2VV5 A;  3V7S A;  2WSE E;  2YLB A;  1IZ6 A;  4BD3 A;  3MP6 A;  4M75 F;  3OA6 A;  4MDW A;  2RD1 A;  4C8Q D;  3QDR B;  4Y28 E;  5CKH A;  4M77 F;  1XNI A;  3DB4 A;  2XKO C;  4J6X A;  1KHC A;  4KUD K;  2EJG A;  2RH2 A;  4C0G A;  1M1K C;  4R56 A;  2RI5 A;  5HK3 A;  2A3L A;  2JN0 A;  4Z02 A;  1VQ9 A;  1YJN A;  2KY9 A;  1UGR B;  4ELZ C;  3BDL A;  2RB6 A;  3JB9 G;  2BKD N;  3QZ5 B;  4JLG A;  4BB7 A;  5HKC A;  5CQY A;  5LJ5 f;  3SWN B;  4JLI A;  5GAM f;  4JRI A;  4EDU A;  2RJF A;  1YJW A;  2P0Q A;  1X6O A;  4C5I A;  3OYK A;  2VUB A;  2DK3 A;  3PMT A;  1VQO T;  3CD6 T;  4J6W A;  3L42 A;  4ATO A;  1I5L A;  1VQL T;  4E7H A;  4RCB A;  4E7J A;  2RHZ A;  4OGC A;  1VIE A;  4FU6 A;  3L2Q A;  4LD6 A;  2XHC A;  4MZM A;  5GMK i;  3OB9 A;  4M75 G;  4OVA A;  1KQ1 A;  4C0D C;  2X35 A;  2RI3 A;  2XDP A;  4M77 G;  5CO7 A;  4CRI A;  4PJO E;  2ZPE B;  3RKW A;  4LDV A;  2R57 A;  1AHJ B;  4A4F A;  2JZ2 A;  4EMH A;  5GMK j;  2C06 A;  1BI3 A;  3OS5 A;  5LJ5 j;  3FDR A;  5GAN g;  1LNX A;  2VC8 A;  5LJ5 d;  5GAN 4;  1BI2 A;  2OTJ T;  3AHU A;  2QTX A;  2M1H A;  2K4Y A;  4CI0 C;  2KAF A;  2EQM A;  4OP0 A;  4C5G A;  2LRQ A;  3Q1J A;  3G6E T;  1YHQ T;  1K73 U;  3CME T;  3CCR A;  4C92 A;  4M78 C;  1M4Z A;  2MWO A;  3E9F A;  2O01 E;  3GNF B;  4J83 A;  5FRO A;  4ZGD B;  3I56 A;  4UC4 A;  3S3M A;  2HQE A;  4EPC A;  5LJ5 h;  1VQN T;  4BUG A;  2EWN A;  2KDS A;  3GNG A;  1VQ6 T;  2OTJ A;  1Q86 U;  4C92 F;  4E47 A;  3OY9 A;  1JJ2 S;  4PKC C;  1YIJ T;  2PUO B;  5FU6 C;  1KQS S;  4PJO D;  2WSF E;  3H6Z A;  4DQ2 A;  2K57 A;  3JCM d;  4NL2 A;  1VQN A;  3L2R A;  2RHX A;  4OGE A;  3CCJ A;  3QJ6 A;  3CC2 T;  3ZBD A;  3A8L B;  3KBG A;  2LQK A;  1Y96 A;  3VYG A;  3I55 T;  3DKM A;  3PTA A;  1H64 1;  3NTH A;  4M7D E;  4BI4 A;  2JUF A;  1R8O B;  3FLG A;  3OYA A;  1FWZ A;  3S6W A;  5D6W A;  1WJS A;  3CXC A;  3JCM h;  3OSS C;  3P8D A;  3QG1 A;  4GY5 A;  2EYQ A;  3HKS A;  4M77 E;  4JRQ A;  4YTL A;  3JB9 D;  3TEE A;  2QA4 A;  2EJF A;  1YIT T;  3GOX A;  2LCC A;  3LWH A;  3P8H A;  3V8K A;  4N0A C;  2XID A;  4DOW A;  3V8J A;  4HCZ A;  5A0D A;  4HCB A;  5GMK e;  5GAN 3;  5KCO A;  3EFS A;  3HRU A;  3OYB A;  3FIF A;  2DXU A;  5LJ5 e;  5GMK l;  1G3S A;  3C95 A;  4M78 A;  4ZN1 A;  1YIT A;  3QJY A;  3QBY A;  3WVD B;  1M1F A;  2YRV A;  3M58 A;  3SB2 A;  1BIB A;  4TVR A;  1LJO A;  1ZHI A;  3C94 A;  3VU3 C;  5LJ3 g;  4M7D D;  4M7A D;  1M8V A;  3HRS A;  4HKE A;  4N4I A;  3L1A A;  4C92 G;  5I21 A;  3LW5 E;  3RER A;  2GQV A;  2DD5 A;  2ZPF B;  5IN1 A;  4M78 F;  5HK0 A;  3CC7 T;  4M7A C;  4MDX A;  1PSE A;  2EJ9 A;  1M90 C;  3A8O B;  4M77 D;  4M75 B;  4NS5 A;  4E7I A;  1HK9 A;  4M77 B;  1QVG A;  1WJR A;  1M90 U;  4J7F A;  4RMO A;  5GAO r;  1FX7 A;  2K2V A;  3SFM A;  3F70 A;  3JCM e;  3CCL T;  2FB7 A;  3PT9 A;  3CC7 A;  4OF1 A;  1Y07 A;  3UDC A;  2YHT A;  4C0Z A;  2FYK A;  2MWP A;  5A0L A;  3PFS A;  4MZP A;  4B9W A;  1G5V A;  4PLL A;  4XTX A;  2ZZD A;  3X26 B;  2KQW A;  2O4X A;  3CCU T;  4JDS A;  2IG0 A;  3HFN A;  3X24 B;  3J81 E;  4JS4 A;  2BIV A;  3E1S A;  1VQM A;  2DKG A;  4QW2 A;  3X28 B;  4O5V A;  2M0O A;  1VQP T;  2P4T A;  1Y71 A;  3A8M B;  4OMF B;  2DTO A;  4N0A A;  5DLQ E;  1WGS A;  1KQ2 A;  3LX7 A;  4XU2 A;  1Q7Y C;  3OQ5 A;  1B34 A;  1JBM A;  2L8D A;  3QZ9 B;  3RKX A;  1Q7Y U;  1VQP A;  3LLR A;  2CZ1 B;  3M5A A;  4XTY A;  2K5L A;  5M9O A;  1VQ9 T;  2QQA A;  2JOY A;  2KSS A;  1YJN T;  1VQ5 T;  3VJP A;  4M78 G;  3QYH B;  4C92 E;  1UGP B;  5GAN h;  1Q82 C;  4FM4 B;  1I8F A;  3NTK A;  4IUP A;  2HD0 A;  3JCM c;  5CAI A;  3UPU A;  4A4H A;  3RKY A;  4C8Q C;  3JAM E;  2RI2 A;  1Q82 U;  2F5K A;  3WVE B;  3OMC A;  2CS7 A;  2LT4 A;  2MF2 A;  1YJW T;  4OB1 B;  1X75 C;  4DOV A;  1VQ5 A;  2P0K A;  5CK9 A;  1WJQ A;  5LL6 S;  4E7L A;  1VUB A;  2X4X A;  3SDZ A;  3MEV A;  4XU0 A;  4KUL A;  2LCL A;  3FC3 A;  3OYM A;  2QQR A;  1BI0 A;  3MEA A;  4XU1 A;  2Y90 A;  1QP3 A;  3BY7 A;  3M53 A;  3MP8 A;  2E1H A;  3BW1 A;  3URG A;  3GP8 A;  4HA8 A;  3A8H B;  5GAN 8;  3HSB A;  5GAO p;  4XU3 A;  2RM4 A;  3HFO A;  2JNG A;  3LH0 A;  4X34 A;  2F5T X;  4C92 B;  2R5A A;  3JCM X;  3CCS T;  1N9R A;  3R6O A;  3JB9 J;  2XI9 A;  2JTM A;  2QQ9 A;  2BUD A;  2RJC A;  4IUU A;  2RHU A;  3WXM B;  5GAN 6;  3JSC A;  2XDB A;  4XAX B;  2KVQ G;  4P5N A;  2RHY A;  3JCM f;  3QII A;  5GAN e;  2VGN A;  2DAQ A;  4PLI A;  2QEX A;  3CCR T;  4IUR A;  2RA2 A;  1NJI U;  4N4G A;  1QW1 A;  3CCS A;  3I56 T;  4FSX A;  5LJ3 j;  3VUB A;  2XK0 A;  4ZN3 A;  4NL3 A;  5LJ3 d;  3G4S A;  1NZ9 A;  1X01 A;  1K73 C;  4C8Q A;  3RMS A;  4BDZ A;  1N6A A;  3JB9 I;  1KG1 A;  1VQ4 A;  1Y96 B;  2E64 A;  3LGF A;  4BAC A;  1OYX A;  2LNV A;  5DY9 A;  3CMA A;  3QO3 A;  3NFC A;  2EIF A;  3OYY A;  5LJ3 h;  4C0D B;  2CKK A;  1OZ3 A;  3M56 A;  2E6Z A;  3CCJ T;  1Q86 C;  1D3B A;  3L2U A;  4HCC A;  2EKO A;  3RMQ A;  5CVI A;  3QPH A;  4F7U A;  4QVD A;  2VXF A;  3MET A;  4XK8 E;  2DXB A;  2DXT A;  3E9G A;  5FU7 B;  3CCE A;  4LDX A;  2E41 A;  2YLC A;  3CPF A;  4JRK A;  3RIR A;  2KK4 A;  3ZEH A;  1QVF S;  2ZCF B;  2LC4 A;  3CCV A;  2QA4 T;  3MO8 A;  1U8R A;  4PJO C;  4M78 B;  1IRE B;  3OYC A;  1NPR A;  3G71 A;  3CCQ T;  3C12 A;  2GF7 A;  3RUX A;  4ZTJ A;  3GIB A;  1WPY A;  1N27 A;  2MAM A;  2V8J A;  2R58 A;  4FIB A;  1S72 A;  2XG8 D;  4M75 E;  2V8K A;  2E65 A;  2XU8 A;  1MGQ A;  3HP9 A;  4RG2 A;  3VKI A;  4BY6 B;  4JRP A;  1JJ2 A;  4HT8 A;  2MMP A;  1TH7 A;  2WSC E;  3OYL A;  1KQS A;  2HBP A;  3CCQ A;  5FU6 B;  3DB3 A;  3BDU A;  2PVO B;  1V29 B;  2RHI A;  4V2S A;  3J80 E;  3VV0 A;  2RO0 A;  3OS0 A;  5DLO A;  1UGQ B;  3UWN A;  2DTI A;  3RES A;  5L8R E;  3M9Q A;  5LJ3 e;  5A0G A;  4C5H A;  4PL6 A;  4JUV A;  3KUF A;  4C8Q G;  3JCM Q;  1VIF A;  2LTO A;  1VQ7 A;  5GAN 5;  3M57 A;  2O4X B;  2L3R A;  2QQB A;  2KMT A;  3OYE A;  1M1G A;  4PNO A;  4L6V 5;  4M75 D;  4QVZ A;  4M7D C;  1OZ2 A;  5GAN f;  3CPW S;  1M9S A;  3QHS A;  3JCM P;  2CZ7 B;  4WF2 A;  3E19 A;  4X9D A;  4A4E A;  4EMK C;  2GCX A;  2Y4X A;  5AYF A;  4LD9 K;  2CZ6 B;  4KT0 E;  3OW2 S;  3M55 A;  1K9M C;  4QVC A;  2FL7 A;  4F7U G;  4IKF A;  3LGL A;  4M77 C;  5J3B A;  1B34 B;  2WAC A;  2QI2 A;  4VUB A;  3JCM J;  1VQM T;  4C0F A;  1PSF A;  2B8A A;  2RJE A;  1K9M U;  2LX9 A;  2OTL A;  5KCH A;  3DLM A;  5I2S A;  2EFI A;  4J5Y A;  2MI6 A;  1QP2 A;  2X4J A;  5GAO m;  5LJ5 g;  3OMG A;  1JB0 E;  4X9C A;  2HNI A;  4PJO F;  5GAM g;  3JRZ A;  4BDY A;  5CQX A;  3VUZ A;  1XTD A;  4OB2 B;  2EQU A;  2DZ9 A;  1N8R U;  1UB4 A;  2LDM A;  3ME9 A;  3OBW A;  3ASK A;  4Y91 A;  5GAN j;  1G3W A;  1O75 A;  5C6S A;  5GAN d;  1ZBX A;  2A7Y A;  4ZTF A;  1GXI E;  5CCA A;  5GAN 7;  3JCM W;  2VGM A;  1U1S A;  5FLX E;  1W2B S;  1QVP A;  1Q81 C;  2P0P A;  4J6Y A;  1BKB A;  3ZFJ A;  4PJO A;  1VQ8 T;  4ELY C;  2PQW A;  1UEB A;  4J7I A;  2K5I A;  1YI2 T;  3PIO A;  2V8I A;  1U1T A;  3UT1 A;  4LDW A;  1O9S A;  3CCM A;  1Q81 U;  2HAX A;  4M7D A;  4M7A A;  5DM7 R;  2D9T A;  4B9X A;  1G3Y A;  3V7R A;  4EMK A;  4A54 A;  2ZPH B;  4N4H A;  3OYI A;  1VQ8 A;  2DJZ A;  2FVU A;  4DA4 A;  3NTI A;  2AHJ B;  3J7A F;  1YI2 A;  3H8Z A;  1I81 A;  2DO3 A;  3OYF A;  4M7A F;  5CKE A;  4ZGE B;  5LJ3 f;  2ZPI B;  2XDD A;  3GPL A;  4JS5 A;  3OYN A;  4OB3 B;  3QKJ A;  4IUQ A;  4PJO G;  4JJN K;  3CC4 A;  3SWN C;  5EG2 A;  2DIQ A;  3N5B B;  3L2W A;  2RJD A;  3TRE A;  4Q5W A;  3VYH B;  4LDU A;  4C8Q B;  4A53 A;  4RCC A;  4C92 D;  2M16 A;  3X20 B;  5GAO n;  3DLL A;  2I2L A;  1JRI A;  2QEX T;  2PVG B;  4NOY A;  3OYG A;  2JVV A;  3M54 A;  3OYD A;  1YCY A;  4A4K A;  1M1K U;  4C92 C;  3G4S T;  1KC8 C;  4KUI A;  3HRT A;  5FRN A;  1NJI C;  1D3B B;  3JCM V;  3M59 A;  3QYG B;  4BI3 A;  1VQ4 T;  4ME7 A;  4R55 A;  1KC8 U;  4RKU E;  3C4S A;  1W4S A;  4F7U B;  4IUV A;  2DIG A;  1BIA A;  1LOJ A;  3CMA T;  4OB0 B;  3LYI A;  4M78 E;  1HXD A;  3PIP A;  2XIC A;  1DJ7 B;  4C5E A;  4MML A;  3KXT A;  2VXE A;  2QQS A;  3EFR A;  3FEO A;  2E6N A;  2Y4Y A;  4FT4 A;  5J26 A;  3MP1 A;  4M7D G;  4M7A G;  4D6W A;  2CYZ B;  3CCE T;  5A2Q E;  4C8Q F;  2PVD B;  2GFA A;  2PUK B;  4XTZ A;  3V7C A;  3OS2 A;  1VQO A;  3CD6 A;  3CCV T;  2DTH A;  1VQL A;  2D0Q B;  3P8B B;  3G71 T;  2HQX A;  1OI1 A;  2DPP B;  3SWN A;  4QQG A;  1KD1 C;  5J39 A;  1BYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...