4R56A

Crystal structure of sulfolobus cren7-dsdna(gtgatcac) complex
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
59
structure length
59
Chain Sequence
SSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the interaction between Cren7 and DNA: the role of loop beta 3-beta 4
pubmed doi rcsb
source organism Sulfolobus solfataricus p2
molecule tags Dna binding protein/dna
molecule keywords Chromatin protein Cren7
total genus 7
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11520 Cren7 Chromatin protein Cren7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.610 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4r56A00
2JTMA 3KXTA 3LWIA 4R56A 3LWHA 4R55A
chains in the Genus database with same CATH superfamily
4PFZA 4XU1A 3H0FA 4M7AA 1BI3A 3OS0A 2L3SA 3JCMP 2GCXA 5D7UA 1I4K1 2O2OA 4X1VA 9ATCB 3CC7Q 2RHUA 1RL2A 2OJ2A 1M2OA 4AFZC 3OMGA 3I56Q 2RQWA 1V76A 2RH2A 1B34A 2DLPA 1VQ5Q 4J6WA 4EMKB 4LUEA 2HL5C 2DILA 3TQ7P 1QWEA 4M77B 3SB2A 4RKUE 1QP2A 5GAN2 2HEQA 2M51A 3RDVA 1TUGB 3CCVA 4JRPA 1IGQA 4PJOA 4DOVA 2LX9A 5KCOA 1YJ9T 1NPPA 2NUPB 2Z0WA 1UECA 3ER0A 2K57A 2DTHA 1ZBXA 3QZ5B 2BUDA 4QKUA 3VS7A 2OTJT 1WQWA 1GBQA 2HKQB 4C0DC 2JS2A 2K9GA 1FX7A 2BE7D 4KH0B 4MZMA 5HK0A 1XTDA 2KXDA 5GANe 4J9IA 4C8QB 1FMWA 4BUGA 2YRCA 1YJWT 4LDVA 3EFOB 3FJ5A 2KRMA 3O5ZA 2DXUA 2HMAA 1YIJQ 2DXTA 4R56A 2RPNA 4J9BA 3C12A 5GAOq 3GNGA 2YLBA 5HKCA 5KE2A 2CS7A 3H0IA 2QASA 3VS4A 4XTVA 4PJOG 1RABB 4JRIA 3A5ZB 2LC4A 1M8VA 1UEBA 2DAQA 3MEWA 2R57A 3CPWP 4BI3A 3PVQA 2QA4A 1RAEB 1RADB 1BK2A 4AFQC 1YHQQ 2DIGA 3CC7T 2DZ9A 2QDYB 3OSSC 2RN8A 1RLPC 3FJPA 1I8FA 2KYMA 1U5SA 2ROLA 1Y96A 3CMET 2DFUA 2P4RA 2P0QA 2RM4A 2CP5A 4FW2A 4F16A 2GNCA 1I5LA 2DVJA 3OB9A 1TUDA 1W2BA 4BY6C 4QVZA 4Z89A 4JZ4A 4LNPA 3CCQQ 1QCOA 2BKDN 5LJ3j 4OGEA 2DETA 1G3TA 3OA6A 1MMDA 3QWXX 2CZ1B 5GAMd 1Y96B 1Q82R 2KDSA 2E6NA 2A36A 3META 1U3OA 2VB6A 3EH2A 4PJJA 2AZVA 1Q81U 2V1QA 2HQEA 1I07A 1YBYA 3X24B 1B3QA 4XTXA 4Z88A 1I0CA 3M53A 5IT9E 5J26A 3M58A 3OYGA 1M2VA 1YJNT 2KMTA 4CI0C 3QYGB 3NFCA 4PJOC 2YWWA 2RMOA 1Y7XA 4PKCC 5GAMf 1HXDA 2EPDA 1UDLA 1WI7A 2CT4A 1X69A 1XNIA 1QCNA 2EJGA 2DL8A 3ME9A 2EKHA 4C92G 4J7IA 1G83A 1D0ZA 3QYHB 2JXBA 4M75F 1TTHB 1VQ5T 3SDZA 3HFOA 5GANh 3WXMB 2GBQA 4MDXA 2K3YA 1YJWA 3EHQA 2FG0A 3OY9A 2A08A 1WX6A 1KHIA 2JUFA 2KRSA 1M8MA 4DBRA 1PCXA 4OMOA 3QKJA 2RI2A 1OPKA 1WDXA 3M59A 1RAGB 2X9HA 4A63B 5GANd 1IO6A 5L23A 3E2UA 4KULA 3CCSQ 2HD0A 2LT4A 1MV3A 3CEYA 4XU3A 2C0OA 2HCKA 1I5OB 2E41A 1VQ9A 4BACA 2DA9A 1N9RA 1Q7YC 2FPDA 1TXQA 1M3CA 3OYIA 1VQ4T 5GAN6 5GMKm 4JS5A 2ZPBB 1OI1A 2ZPHB 1K73U 5ECAA 2CDTA 2CUBA 3PE0A 4C5IA 3NHNA 3JB9D 3DLMA 5GAN7 1MNDA 4HT9A 3G6EA 4QQGA 4B6MA 2CH4A 5GJVB 1TU0B 1YP5A 4L5GA 7AT1B 1T0HA 5GMKj 2HBWA 2LP5A 2CP6A 2LMJA 2PVDB 2VGMA 2VXFA 3HSBA 3MPUB 1OZ2A 2ECZA 1NEBA 1SPKA 1ZX6A 3SWNC 2DE0X 4BI4A 4XAXB 1B07A 3JB9I 3VS0A 2RHIA 1N8RR 1JXOA 2YLCA 4M7AG 1AWXA 5D6XA 4KT0E 3CCUT 1UUEA 4M77E 1ZQ1A 3SEMA 2EWNA 1WXUA 3DB3A 2RQTA 2QA4Q 2QEXT 4BDYA 3OBWA 1H3ZA 2OAUA 2YUNA 1ZA2B 3L2VA 4UC4A 5KYYA 4II1A 4C92F 5GAMj 2ZZDA 2DL5A 3JCMX 1QVGP 5CKFA 1JBMA 2DJQA 3REAB 2XG8D 1XJWB 1Z9ZA 3CCJA 2WSEE 3UF4A 1K0XA 3WVEB 2GGRA 4RTZA 1RI0A 2L0AA 2MWOA 1U1TA 1VQOQ 2PVGB 2WSCE 2RK1A 1KFZA 1ABQA 1PSEA 4XTWA 5EC7A 4C8QD 3QBYA 2K5IA 1G8XA 1PC0A 2XU8A 4KUDK 4E6RA 2OTJA 4DEXA 2HSEB 4OP0A 4E7ZA 3LGLA 1QLYA 1VQOT 5D6YA 2VV5A 2MIOA 3L2RA 3CPFA 1VQ4Q 3HL8A 3I56T 4JJCA 5CO7A 3L2ZA 4IUUA 3ZEHA 1YI2A 3PMIA 3TEEA 3CCMQ 5LJ3f 4E7KA 3M0QA 3JCMd 5LJ3h 2VC8A 1W2BS 3A8MB 4BD3A 4JUVA 4MDWA 3VS1A 4C0FA 5LJ3e 1CSKA 3G71T 2DRMA 2CP3A 1VQ5A 1KD1R 3CD6Q 4OMQA 3M57A 1G3WA 1PG5B 4PK4A 4LUDA 1NJIC 2E4HA 4M78D 2PUOB 4OGCA 3I35A 4JJBA 1KHCA 3HTRA 3OMCA 3L1AA 2DNUA 1VQ4A 3CC4A 4MZPA 3URGA 1J3TA 1PNJA 2QK0A 3CQTA 5L8RE 5CQYA 1SHGA 1IHWA 2NYSA 3JV3A 2YXYA 2CSQA 5GAOn 2OTLA 5LJ3g 5I22A 3VS5A 2M02A 2FVUA 1D1CA 4N4GA 2A7YA 2F5KA 1YITA 2EQKA 2ZCFB 3FDRA 2GF7A 3LLRA 1QW1A 2CP7A 2KNBB 2EFIA 1E6HA 5GANf 4J5YA 3I9QA 5CAIA 1SRLA 1RUWA 4NS5A 4AT1B 4C8QG 4MMKA 2LJ1A 3KFVA 4M78B 3CCMT 3QJYA 1A0NB 2BZYA 4LN2A 3CXCA 1SSFA 2L89A 1QKXA 3IQLA 4DQ2A 2LJ3A 1PRMC 1VQMQ 1RAHB 3CCST 2COZA 1UGVA 3ZBDA 3OW2A 1VQ7A 3RBBB 1KQ1A 2X3WD 1BYMA 4CC2A 4HVUA 5KYXA 1NJIR 1M90U 5FRMA 2XD0A 2K3BA 2JN0A 3H0HA 2DKGA 1WHGA 1VQKT 4M7DG 3JCMe 3S6WA 1KD1C 2EJFA 1K76A 1P92A 2AK5A 1W4SA 3RUXA 1KK7A 2OI3A 2PU9B 5IHKA 2EVRA 1ZHIA 2XK0A 1E7OA 5FROA 2ED0A 4E7LA 1OULA 4FYYB 3QZ9B 1BU1A 1GCQC 3EGDB 4J83A 4PNOA 3NPFA 1W1FA 3EFSA 3JCMc 1ARKA 1PM3A 3SFMA 4D6WA 5C6SA 2QEXQ 3JCMb 2A3LA 2JVVA 2ENMA 3I5SA 6AT1B 4ZGEB 3VJPA 3MEAA 4A4HA 5IXFA 4BE2A 1M2VB 1QCFA 3M56A 4JPBW 1TSFA 3PIPA 4AFUC 1VQ8T 5KYXB 2MF2A 4XU0A 2C0IA 3QO3A 3FLGA 2V26A 3WVDB 5I2SA 2W10A 1VQPT 3DB4A 5GAOr 3PFSA 2DXBA 2V8KA 3GOXA 1TH7A 8AT1B 4WTOB 5I2MA 5IHIA 2QQRA 1VQ8A 1LCKA 2KY9A 4OMMA 2DL4A 5I21A 2KBTA 4C0ZA 2BTTA 3R6NA 4F7UE 3PTAA 4KBMB 3HHTB 1R8OB 3FRNA 1WQ7A 1YCYA 1VYVA 1WPYA 1KQSA 2O4XA 2DMOA 1R0CB 2E65A 3EG9B 4HCKA 3EAEA 5IHNA 4HCCA 2RQRA 2EBPA 1MV0B 3CXCP 2FB7A 5GAOl 1VQMT 3OS5A 3QJ6A 1UE9A 4C92C 3G7ZA 3ZL7C 2QEXA 1N8RC 4LXCA 4B9WA 2RHZA 4N4IA 2LVMA 2RF0A 4AMCA 2HQHA 5LJ5d 4PLLA 1M90C 4FU6A 3FIFA 3MO8A 2RJFA 1Y07A 1BIBA 2KK4A 2PVOB 1EX4A 2M0OA 3JCMW 3CCLT 1KD1U 4M7DF 3CPWS 1K1ZA 1T3SA 4EMKA 2RI5A 2A37A 4C0GA 3C0CA 3S3OA 1EFNA 1GXIE 2KXCA 4X9CA 1D3BB 3OYMA 1SG5A 4TVRA 1X6GA 5LJ3d 1FMKA 1OZ3A 2DIQA 3CMAT 4E7SA 1QP3A 3NMZC 5GJWB 4IKFA 2J05A 2DXCA 2X3XD 2JOYA 3RR6A 4PJOB 1M3BA 4E47A 1Q7YU 1CKAA 3NTIA 3OYYA 2KRNA 2ZAEA 2CKKA 4J9HA 2LCCA 3HPWA 3RIRA 2RQVA 2DVEA 3M0TA 1BCOA 1OEBA 4HA8A 2XMFA 1VQNT 2HDAA 2JS0A 4HKEA 3JCMV 3OYJA 4N0AA 4ANJA 2DYBA 3I56A 2KI7A 1YHQA 3CC7A 4R55A 2AT1B 2VASA 2MPXC 1EIFA 3VRZA 3P8HA 2YRVA 3CCQA 1OX9A 3EFOA 1W6XA 1BB9A 4DEYA 3OYNA 2L3PA 4JRKA 1VQPA 4OMFB 4Y28E 2ABLA 1X6OA 4RCCA 4PJOD 3FEOA 4WF2A 2F5TX 2FL7A 3G71A 2NUPA 1M3AA 3CC4T 1ABOA 4FIBA 4C5EA 2CP2A 1VIEA 5IAYA 3A8GB 3J81E 2DBMA 1PD0A 2EGCA 3RESA 1M90R 3VS2A 2P0KA 3P8BB 2V8JA 1WXTA 3CC4Q 3V8JA 3GP8A 4C92B 4OMLA 1VQNQ 1T3LA 1C0MA 1RLQC 1NYFA 1WIEA 3QG1A 4L59A 2HKNA 1QMCA 3OYEA 1RAFB 1G3YA 1X2KA 4PJNA 2O31A 1TUCA 3M54A 2EYYA 2MOXA 4JDSA 5LJ5e 5FWCA 2J6KA 3Q1JA 5DM7R 2ATCB 2O88A 4K11A 4M7AD 3OBYA 2CUDA 2LQKA 4A4KA 1RACB 1YI2T 3HRSA 1AOJA 2E64A 3MP1A 1UB4A 3EFRA 3L2QA 2OTLT 2PTKA 1Q82C 3EG0A 3H8ZA 5GAN4 4PJLA 4BE1A 1M1GA 3LX7A 4ELZC 1X2QA 1UGRB 1X6BA 2BZ8A 3ZFJA 1Q86U 1VQ6A 2QQBA 2H3JA 1SF9A 2HNIA 1LOJA 2DZCA 2KR3A 2RI3A 4EDUA 1YFNA 5FU6C 1ZSZB 3R6OA 5KYWB 1YJWQ 1K4US 1MHNA 3CCJT 4HCBA 4FCYA 2EIFA 4O6JA 3LGFA 2QQ9A 2XI9A 4HVWA 1TOVA 2D8HA 5CR2A 3CMAA 1CKBA 2RK2A 4L6V5 3U23A 2KSSA 3LWHA 2Y90A 2PNIA 4F17A 1JJ2P 1U06A 4AFSC 3JCMf 4ZGDB 2RD1A 2YUOA 1OU8A 2EGEA 2EYQA 1BI2A 2LQWA 1WJRA 1M1KU 1GCPA 1O75A 3H41A 4QQ6A 4F7UG 2K5LA 2LDMA 5KE3A 4RG8A 4A54A 1NM7A 4OF1A 3SWNB 4J6YA 3FB9A 3QXEB 2KEAA 2JW4A 3O8VA 4RTWA 1YITT 2YT6A 4M7AE 1YHQT 2XHCA 3AT1B 2JMCA 3M4YA 3I55A 2GQIA 3GBQA 2H8HA 2V1RA 3CCET 3SWNA 2IG0A 2D9TA 1ZSZA 1WJQA 3LH5A 2XIDA 3SD4A 2I0NA 2QYZA 1S72A 4F04B 1WXBA 3QDFA 4B9XA 1BBZA 1Y57A 2G6FX 3A8OB 1Y0MA 1FXXA 2VVKA 3OYAA 3V7CA 1N5ZA 3C4SA 1QQJA 5IXBA 4C92D 1QVPA 3GIBA 4N4HA 2KGTA 3S3MA 2DD4A 2NUZA 2XKOC 5GAN5 4X9DA 2PUKB 1YI2Q 2NLUA 2FPFA 3VYHB 1KSWA 2D0NA 2DEUA 1PSFA 1UJYA 5CK9A 1VQ9T 1V29B 3HRUA 8ATCB 1I1JA 3JAME 4M7DA 4QVCA 2K6DA 2JMAA 3OYFA 1VYTA 2JTMA 1WYXA 2RA2A 5A2QE 4J8OA 3OW2S 2EYXA 4IURA 1QVFA 1BKBA 1VQLA 3GF5A 4QW2A 2X4JA 2RO0A 3CCLQ 4ZNXA 1JO8A 3X25B 2FZGB 2DTIA 2WSFE 2IVWA 1M5Q1 5KH6A 2EGAA 2RQUA 2FEIA 3M55A 4M75B 4RTXA 4M7AF 3CMEA 3OYLA 3MP8A 4KGZB 5FLXE 5GANg 4Y92A 3VS3A 1NPRA 2LCSA 1NYGA 1TWBA 2EAYA 4QQDA 4J9EA 4XK8E 4YTLA 3REBB 1ZUUA 2ROTA 4M77C 5A0LA 1OOTA 3J7AF 4M78C 5EG2A 3M4GA 2LZ6B 4CRIA 4LDYA 2DM1A 1TS9A 1UHCA 4KUIA 4WCIA 4XU2A 1X01A 5FRNA 5GAN3 1M1KC 1IRXA 1ZSGA 1NLOC 4OB2B 2MYSA 1YJNQ 4DBFA 5HK3A 2JNGA 3EG9A 3G1JA 3GPLA 4JJNK 5D6WA 3CCSA 5KYUA 2KT8A 2LX7A 1KQ2A 1VQMA 2X4XA 4OB3B 4ZN3A 2K5FA 4C8QC 4M75A 2X4WA 1JJ2A 3JCMQ 3PT9A 1R0BG 1BI0A 1JEGA 3QWYA 4IUTA 4CC4B 4P5NA 1ZUYA 1AZEA 1KC8U 1Q82U 1MMGA 2JM8A 4C5GA 3OYCA 2SEMA 4DOWA 5CVIA 3I55T 4ZTJA 2XICA 1FYNA 5LJ5h 3CCVQ 1K73C 3VU3C 4XTYA 4KGVB 1WGSA 1AZGB 2LQ8A 3CD6T 4RTVA 1B34B 4M75G 1TG0A 1K0SA 3BE3A 4M78G 1AWJA 2ED1A 1IXDA 2GTOA 5KYUB 3ULRB 3G4SQ 4V2SA 5GAOp 3A1PA 2CREA 1AT1B 2V8IA 2LRQA 1VIFA 1OPLA 3NGPA 2DD5A 4HCZA 2R58A 1BIAA 4VUBA 1VQ7T 4RCBA 5A0DA 1W2BP 2D0QB 2EKOA 2VXEA 2DPPB 3UATA 3OYDA 5FU7B 1HK9A 2DJZA 1AWWA 3BDLA 1YIJT 4Q5WA 1OYXA 2JJ9A 3MJXA 1M9SA 3E19A 1G2BA 2E12A 4E7JA 2NWMA 1UGPB 3BY7A 2ESWA 3H6ZA 3OW2P 2GFUA 1UGQB 1XOVA 3UT1A 2XDPA 4HXJA 2AKKA 1VQKQ 2LQNA 3CCEA 1QKWA 3TVTA 4E2FB 2RJDA 2A0FB 2RHXA 1IB8A 3OYHA 2NUTA 3CC2T 1K8AU 2E3IA 2QG9B 2VWFA 1IREB 2C0TA 4LDUA 2CSIA 4M78A 3M0UA 3ASKA 2K2MA 3MCAB 5DY9A 4C92A 1JU5C 3H9NA 2L5QA 1HJDA 2EW3A 1V1CA 4F7UA 1M4ZA 1Q7YR 3CXCS 4NL3A 1GFCA 4BB7A 2E6ZA 1Y71A 3CC2A 4M7DD 2VUBA 4Y91A 4D8DA 2LNVA 4LDWA 2M0YA 4RUGA 1VQ6Q 3BDUA 4PJMA 3CCJQ 1YWOA 5GAMe 2F2XA 1AHJB 1VA7A 5GMKh 4C8QE 3LW5E 3EG1A 3MKDA 4A4FA 2YHTA 1MNEA 2DF6A 1Q95G 3QHSA 1QVGA 2RB6A 4AG1C 1PKTA 5LJ5j 3PVLA 4EMGA 3JB9G 2KROA 3X20B 3V8LA 2HBPA 2DTOA 3M0RA 4BY6B 1C6VX 2CH4W 2NUTB 1MGQA 3CCRT 4PJOF 2QGGA 4C0DB 3T9NA 5LJ5f 2CZ0B 4XQ3A 3HFNA 1NZ9A 5AYFA 3CCRQ 5KCHA 2QQAA 4J7FA 4DBQA 2K79A 1NG2A 3MEVA 1RI9A 4M7AC 3UDCA 3CD6A 4M77D 4PL6A 2CGHA 3G71Q 1T0JA 2YSQA 2CZ6B 1GBRA 1AEYA 4ESRA 1VQLQ 2IIMA 3QDRB 2D8JA 1H92A 4PLIA 3M9QA 4E7IA 3CCRA 1ZSZC 1ZBJA 3VKIA 1X43A 2P0PA 2R5MA 1YIJA 3CMAQ 3RKYA 4GLMA 3EGDA 3RKWA 1GCQA 1UTIA 2VKNA 1OV3A 2B86A 2L2PA 4MZTA 2M1HA 2AZSA 1XQHA 4FM4B 5A0GA 5GAN8 4FW1A 2E1HA 1BCMA 2F69A 1NJIU 1WA7A 3HP9A 3CMEQ 1K9MC 5FU7C 2JTFA 1HYOA 2O01E 2YDLA 3GLXA 5FW9A 2DL3A 2RHYA 3KUFA 1KQSS 2COWA 1PWTA 5C0MA 2HZYA 2LT1A 1JB0E 2HSPA 3EH1A 2EQIA 4NL2A 2JM9A 4ME7A 2FZCB 2VGNA 2AIRB 1PRLC 3A8HB 1N27A 3LH0A 3CBMA 1GRIA 1D09B 3CC2Q 3OSVA 3VUBA 3MEUA 2EQUA 3CBOA 2XDDA 1SSHA 1K8AC 4CC3A 2FHDA 2MMPA 2K7AA 2KQWA 2C06A 2KYBA 5HCKA 2ZPFB 3THKA 4JRQA 2QDLA 1U8RA 4M7DE 1JXMA 2E5KA 4PJOE 1D1BA 1M30A 3DKMA 4ZN1A 1QVGS 3QSUA 1Q86R 5I11A 4RTYA 1OQKA 2J7IA 1H3HA 2ZPEB 2EYWA 4FT2A 3FC3A 4HVVA 1VYUA 4M77G 2KAFA 2O9VA 4AG2C 1R77A 3M5AA 2KVQG 1IZ6A 2BE9B 2ZPIB 1VQOA 4M77A 4RG2A 3OQ5A 4QVDA 1LNXA 1ACMB 1B7TA 3TCJA 4FT4A 1D1AA 2K4YA 2Y4YA 1IHVA 3RMSA 1YJ9Q 1VOMA 1UG1A 3VRYA 4GBQA 2CT3A 4ORZA 1WHMA 4E7HA 4DBHA 1SKUB 1WHHA 3TSWA 3OS1A 1YCSB 2FYKA 1LVKA 5GMKl 1VQNA 3HKSA 2O9SA 1C1AA 4XTUA 4F14A 3C95A 3JCMh 1N6AA 1WNLA 2BIVA 3CCEQ 1AWOA 3LYIA 4OB0B 4O5VA 4C8QA 2ZPGB 2P84A 4CC7A 1QVFS 3RNJA 3GNFB 1YWPA 1YITQ 1H8KA 4IUPA 2MK5A 1W70A 4FSXA 4JJDA 3I55Q 1OX8A 5DLOA 1SRMA 1NLPC 2Y4XA 2QA4T 2QAZA 5J3BA 1LJOA 1NBEB 1M1FA 3RERA 1Q86C 1OU9A 3PMTA 4C92E 2DO3A 2FZKB 4BI8B 2FO0A 4ZTFA 1F1BB 3CCUQ 4J6XA 3KXTA 2K2VA 1AD5A 3INZA 2B8AA 3EG2A 5KYYB 2P4TA 1K8AR 2L3RA 4R0KA 4LD6A 2F2WA 2RJCA 3M0PA 4JLGA 4M7DC 5GANj 2MAMA 2YUQA 4J9DA 4KGXB 3LWIA 3V8KA 3V7RA 1MMAA 2DRKA 4KH1B 1HSQA 2H3EB 2J06A 2RJEA 3CBPA 3F70A 1BI1A 3UA7A 4EMHA 5CKEA 3VV0A 1K9MU 1G5VA 2YUPA 1WJSA 1KIKA 1D0XA 4LE9A 2DL7A 4RMOA 2ZGWA 1K9MR 3QIIA 3SHWA 2QTXA 1JRIA 2G3RA 5FU6B 1M27C 3I5RA 1VQ6T 2D6FA 1IGUA 1HD3A 2DYIA 3BFMA 1YJNA 4EPCA 3UPUA 4J9CA 2J6OA 3JB9H 5GMKe 2EYZA 2JZ2A 3JCMJ 2AKLA 4NOYA 5J39A 3JCMg 4OMNA 2PQWA 3V7SA 3J80E 3NTHA 2LTOA 5CIUA 5KYWA 3E1SA 1K9AA 3VUZA 5M9OA 1KG1A 4PFOA 4BDZA 2CZ7B 1UJ0A 3EGXA 3TREA 2QGFB 2R5AA 5DLQE 1YNZA 4IIMA 1UGSB 4MMLA 4FYXB 3RKXA 2LJ0A 4F7UB 2DERA 5LL6S 3OYKA 1Q81C 2YRDA 2J6FA 1I81A 3PGGA 2LCLA 1VQKA 4M75D 3A98A 2KT1A 2PZ1A 3EGXB 3HRTA 1VQLT 1MMNA 3P8DA 3C94A 1LPLA 2XDBA 1VQPQ 4ELYC 3AHUA 4N0AC 2VYTA 2F1LA 3M0SA 1KC8C 1G3SA 4J9FA 2LNHB 2X35A 2FRYA 2OAWA 3CCQT 1N9SA 3L2WA 4BE0A 2K3XA 1O9SA 2HL3A 1FWZA 3A8LB 4OMPA 1QVFP 3EHRA 3MP6A 1KQSP 4X34A 2FPEA 3G6ET 1N8RU 5IN1A 5GAOm 3OYBA 1WFWA 5CKDA 2E3HA 5GMKi 2DK3A 4M7DB 1VQ8Q 4M4ZA 3NTKA 5LJ5g 1NE8A 1H641 3D7SB 2EQJA 4HT8A 2GQVA 1SEMA 4Z8AA 3DLLA 2FRWA 2E5QA 1AVZC 3PNWC 1UFFA 2GTJA 4J9GA 1WHJA 1PHTA 1WHLA 1Z9QA 3KBGA 1SHFA 1FMVA 2OTLQ 4M75E 4EMKC 4Z02A 4DA4A 4JS4A 2OX7A 4IIOA 3CCUA 2QTVA 4IUVA 2MWPA 4GY5A 1GL5A 4D8KA 2W0ZA 1VUBA 5GAMh 2JTEA 5CKBA 1U1SA 2E10A 4FSSA 2M9UA 2QI2A 4ZGJB 3X28B 3JRZA 1KJWA 1X75C 1KC8R 2L3QA 3JSCA 1WZOA 3G4SA 4M77F 4M78E 3TU4K 1E6GA 4FL6A 1PKSA 4FYVB 1X27A 2HAXA 3L2UA 1GFDA 1RAIB 3MHXA 4QT7A 1Q81R 1ZLMA 2DEQA 1S72T 4RTUA 3G4ST 1PD1A 5AT1B 2I2LA 4JZ3A 3X26B 3EGUA 2IPOB 5CQXA 3UWNA 2HQXA 4ATOA 1WHKA 3E9GA 1JJ2S 1VQ7Q 3S3NA 2MCNA 3CCVT 2KE9A 3VS6A 3G6EQ 2EJ9A 1K73R 2BZXA 1S1NA 1ZUKA 4KRTA 2RNAA 2X51A 2OTJQ 4C8QF 2AHJB 1YJ9A 2QXFA 2CYZB 1WLPB 1MUZA 4A4EA 3UA6A 3RMQA 1DJ7B 3JB9F 4M75C 4FYWB 1RAAB 1UHFA 2DBKA 4EIKA 4GLKA 2GFAA 3CPWA 4XTZA 1VQ9Q 4RTTA 5CKHA 3L42A 2O4XB 3OS2A 1D0YA 4OVAA 3JB9J 4M7AB 2EQMA 2JT4A 4IUQA 5CCAA 2COYA 2M16A 2E70A 4A4GA 5KYNA 1QWFA 2MI6A 1ZA1B 5FWBA 4A53A 4PFPA 3PIOA 1M1KR 3EG3A 3QUIA 5GAMg 1NEGA 3E9FA 2A28A 3N5BB 1JQQA 3QPHA 2L8DA 4JLIA 3VYGA 3BW1A 1YN8A 1EZZB 2CP0A 2DX1A 5IH2A 2QQSA 4M78F 3TSZA 3CCLA 4LDXA 2SRCA 1D3BA 2F2VA 1S72Q 4LD9K 2D1XA 4C5HA 2X4YA 4OB1B 3CCMA 4F7UF 2WACA 5HY6A
chains in the Genus database with same CATH topology
4M78D 1S72A 4XU1A 2PUOB 2ZPEB 4FT2A 4OGCA 3FC3A 4M77G 4M7AA 1KHCA 2KAFA 3OMCA 3L1AA 4B9XA 1VQ4A 3CC4A 1BI3A 3OS0A 4MZPA 3M5AA 3URGA 3JCMP 2GCXA 2KVQG 1IZ6A 5L8RE 2ZPIB 1I4K1 4M77A 3A8OB 1VQOA 5CQYA 4RG2A 3OQ5A 1FXXA 2RHUA 1RL2A 4QVDA 3OYAA 1LNXA 3V7CA 3OMGA 3TCJA 4FT4A 3C4SA 2RH2A 2K4YA 5GAOn 2Y4YA 2OTLA 3RMSA 1B34A 5LJ3g 4J6WA 4C92D 4EMKB 1QVPA 3GIBA 4N4HA 2FVUA 4N4GA 3S3MA 2DD4A 2XKOC 5GAN5 2A7YA 2F5KA 1YITA 2EQKA 4E7HA 4X9DA 2ZCFB 2PUKB 4M77B 3SB2A 3FDRA 2NLUA 3OS1A 2FYKA 3VYHB 4RKUE 5GMKl 1VQNA 2GF7A 3HKSA 3LLRA 1QP2A 1QW1A 5GANf 5GAN2 2EFIA 4J5YA 1PSFA 5CK9A 5CAIA 4NS5A 4C8QG 4XTUA 1VQ9T 1V29B 4MMKA 3CCVA 3C95A 3JCMh 3HRUA 1N6AA 1WNLA 4M78B 3CCMT 4JRPA 3QJYA 4DOVA 3JAME 4M7DA 2BIVA 3CXCA 4QVCA 2LX9A 1SSFA 3LYIA 2L89A 4OB0B 5KCOA 4DQ2A 4O5VA 3OYFA 1YJ9T 4C8QA 1NPPA 2ZPGB 2JTMA 3ER0A 3CCST 2K57A 2RA2A 2DTHA 1ZBXA 3QZ5B 2BUDA 4J8OA 5A2QE 3ZBDA 3OW2S 1QVFS 4IURA 3GNFB 3OW2A 1BKBA 1VQ7A 1WQWA 1VQLA 1QVFA 2OTJT 3GF5A 4QW2A 2X4JA 2RO0A 4C0DC 1KQ1A 1BYMA 3X25B 2DTIA 2WSFE 4IUPA 2IVWA 1M5Q1 1FX7A 4MZMA 5HK0A 4FSXA 1XTDA 5KH6A 2XIDA 5GANe 1M90U 5DLOA 4C8QB 5FRMA 2XD0A 3M55A 4M75B 2JN0A 2Y4XA 4BUGA 3CMEA 2QA4T 4M7AF 2DKGA 5J3BA 1LJOA 3OYLA 1VQKT 3MP8A 4M7DG 3JCMe 1M1FA 1YJWT 4LDVA 5FLXE 1Q86C 5GANg 3RERA 3PMTA 3S6WA 4C92E 1KD1C 2DO3A 4BI8B 1NPRA 2EJFA 1P92A 4ZTFA 2DXUA 1W4SA 4J6XA 2EAYA 2DXTA 3RUXA 3KXTA 4R56A 2PU9B 2K2VA 4QQDA 3C12A 4XK8E 3INZA 5GAOq 4YTLA 1ZHIA 2B8AA 2P4TA 2XK0A 4M77C 5A0LA 3J7AF 2L3RA 3GNGA 4LD6A 5FROA 4M78C 2YLBA 3CCRA 5HKCA 4E7LA 2RJCA 5KE2A 2CS7A 5EG2A 4JLGA 3M4GA 4M7DC 5GANj 2MAMA 3LWIA 3QZ9B 4CRIA 4LDYA 3V8KA 3V7RA 4XTVA 4J83A 4PNOA 4PJOG 4KUIA 4XU2A 1X01A 5FRNA 3EFSA 5GAN3 1M1KC 3JCMc 4JRIA 2RJEA 3A5ZB 2LC4A 1M8VA 4OB2B 3SFMA 1UEBA 3CBPA 2DAQA 3F70A 4D6WA 5C6SA 5HK3A 2JNGA 1BI1A 2A3LA 3JCMb 3GPLA 2JVVA 3MEWA 2R57A 4JJNK 4BI3A 4EMHA 5CKEA 5D6WA 3CCSA 2QA4A 4ZGEB 3VJPA 3MEAA 4A4HA 4BE2A 3VV0A 1K9MU 3M56A 1KQ2A 1G5VA 2DIGA 3PIPA 3CC7T 2DZ9A 1WJSA 2QDYB 1VQMA 4PJOA 2X4XA 3OSSC 4OB3B 1VQ8T 4ZN3A 4RMOA 2MF2A 2ZGWA 4XU0A 3QO3A 3FLGA 3WVDB 5I2SA 2K5FA 3QIIA 4C8QC 3FJPA 2X4WA 2QTXA 1I8FA 4M75A 1JRIA 3JCMQ 2G3RA 5FU6B 1VQPT 3DB4A 1JJ2A 3PT9A 1Y96A 3CMET 5GAOr 3PFSA 1I5LA 2DXBA 2P0QA 2RM4A 1VQ6T 1BI0A 2D6FA 2V8KA 3GOXA 1TH7A 3OB9A 3BFMA 1W2BA 5I2MA 4BY6C 4IUTA 4QVZA 2QQRA 1VQ8A 1YJNA 4EPCA 3UPUA 4P5NA 2KY9A 2BKDN 5LJ3j 3JB9H 5GMKe 2JZ2A 3JCMJ 4NOYA 5J39A 1Q82U 1KC8U 3JCMg 4OGEA 5I21A 2PQWA 4C0ZA 1G3TA 4C5GA 3OYCA 3OA6A 4F7UE 2CZ1B 5GAMd 3PTAA 3V7SA 3J80E 1Y96B 4KBMB 3HHTB 3NTHA 4DOWA 1R8OB 5CVIA 3I55T 4ZTJA 3FRNA 2KDSA 2XICA 2LTOA 5CIUA 2E6NA 3E1SA 3META 3VUZA 5M9OA 5LJ5h 1WQ7A 1K73C 3VU3C 4XTYA 1YCYA 1KG1A 4BDZA 1Q81U 2CZ7B 1KD1U 1WGSA 1WPYA 2HQEA 1YBYA 1KQSA 3X24B 2LQ8A 2O4XA 3CD6T 4XTXA 1B34B 3TREA 2R5AA 5DLQE 4M75G 3M53A 2E65A 4M78G 3EAEA 5IT9E 4HCCA 5J26A 3M58A 1UGSB 4MMLA 3OYGA 3RKXA 2FB7A 5GAOl 1YJNT 5GAOp 4V2SA 2KMTA 1VQMT 4CI0C 3OS5A 3NFCA 3QJ6A 3QYGB 4F7UB 4PJOC 4C92C 2V8IA 5LL6S 1Y7XA 2LRQA 3G7ZA 4PKCC 3OYKA 5GAMf 1Q81C 1VIFA 1HXDA 2QEXA 1I81A 3PGGA 2DD5A 2LCLA 1XNIA 4HCZA 1N8RC 1VQKA 2R58A 4M75D 2RHZA 4N4IA 4B9WA 2LVMA 2EJGA 1BIAA 3HRTA 4VUBA 1VQ7T 1VQLT 4RCBA 5A0DA 3P8DA 3C94A 3ME9A 2D0QB 2EKOA 2XDBA 2VXEA 4C92G 4ELYC 3AHUA 5LJ5d 4J7IA 4PLLA 1M90C 2DPPB 3QYHB 4N0AC 3OYDA 2VYTA 5FU7B 1HK9A 4M75F 1KC8C 4FU6A 1VQ5T 2DJZA 1G3SA 3FIFA 2X35A 3MO8A 3BDLA 3SDZA 2RJFA 1Y07A 1BIBA 2KK4A 2PVOB 3HFOA 2M0OA 3JCMW 4Q5WA 3CCLT 1YIJT 5GANh 3CPWS 3WXMB 1OYXA 3CCQT 4MDXA 1N9SA 3L2WA 2K3YA 1M9SA 3E19A 4EMKA 4BE0A 2K3XA 1YJWA 2RI5A 1O9SA 2E12A 3OY9A 4E7JA 3BY7A 1FWZA 1UGPB 3A8LB 3H6ZA 4C0GA 2GFUA 1UGQB 1KHIA 1XOVA 3UT1A 2JUFA 2XDPA 3S3OA 4X9CA 1GXIE 3MP6A 1D3BB 4X34A 3OYMA 3G6ET 4TVRA 3CCEA 5LJ3d 3QKJA 2RI2A 1OZ3A 2DIQA 1N8RU 3CMAT 2RJDA 1QP3A 2RHXA 3M59A 5IN1A 5GAOm 3OYHA 4IKFA 3CC2T 3OYBA 1K8AU 5GANd 1IREB 2DXCA 4LDUA 5CKDA 5GMKi 2JOYA 4M78A 2DK3A 4KULA 4PJOB 4M7DB 3ASKA 2HD0A 4E47A 1Q7YU 2LT4A 3CEYA 3MCAB 5DY9A 4C92A 3NTIA 3NTKA 3OYYA 4XU3A 5LJ5g 1NE8A 1H641 2CKKA 2L5QA 2LCCA 3HPWA 2E41A 2EQJA 1VQ9A 4HT8A 4F7UA 4BACA 1M4ZA 2GQVA 3RIRA 2DVEA 1Q7YC 1N9RA 3DLLA 3CXCS 3OYIA 1VQ4T 2E5QA 5GAN6 5GMKm 4NL3A 2ZPBB 4HA8A 4JS5A 4BB7A 2E6ZA 1VQNT 4E7IA 1OI1A 1Y71A 4HKEA 3PNWC 3JCMV 4N0AA 3OYJA 3CC2A 4M7DD 2ZPHB 1K73U 2VUBA 3I56A 4Y91A 4C5IA 2LNVA 3KBGA 4LDWA 3CC7A 1YHQA 4R55A 3BDUA 3JB9D 3DLMA 1EIFA 5GAMe 5GAN7 3P8HA 1AHJB 4M75E 4Z02A 4EMKC 5GMKh 2YRVA 4C8QE 4JS4A 4DA4A 3CCQA 3LW5E 3CCUA 4A4FA 4HT9A 2YHTA 3OYNA 4IUVA 4JRKA 1VQPA 2MWPA 3G6EA 4OMFB 4Y28E 4QQGA 4GY5A 3QHSA 1QVGA 2RB6A 1X6OA 5LJ5j 4RCCA 4L5GA 1VUBA 5GAMh 5CKBA 4EMGA 3JB9G 5GMKj 1U1SA 4PJOD 3FEOA 2E10A 3X20B 2M9UA 2PVDB 2VGMA 2VXFA 2F5TX 2FL7A 2HBPA 2QI2A 4WF2A 3V8LA 4ZGJB 3G71A 3HSBA 3X28B 3JRZA 3CC4T 1OZ2A 1X75C 2DTOA 4FIBA 4C5EA 1VIEA 5IAYA 3JSCA 3A8GB 3J81E 4BY6B 3RESA 3G4SA 3CCRT 1MGQA 4M77F 4PJOF 3SWNC 4C0DB 2P0KA 3P8BB 4M78E 2V8JA 3T9NA 4BI4A 5LJ5f 2CZ0B 3TU4K 4XQ3A 3HFNA 4XAXB 3V8JA 4FL6A 1NZ9A 3JB9I 3GP8A 2RHIA 4C92B 2HAXA 3L2UA 5AYFA 2YLCA 3QG1A 3MHXA 5KCHA 4L59A 4M7AG 2QQAA 4KT0E 5D6XA 3CCUT 3OYEA 4J7FA 4M77E 1ZQ1A 1G3YA 2DEQA 1S72T 3G4ST 2EWNA 3DB3A 3MEVA 3M54A 4M7AC 4JDSA 3UDCA 2I2LA 3CD6A 3X26B 4M77D 4PL6A 5LJ5e 2CGHA 2QEXT 4BDYA 3OBWA 1H3ZA 3Q1JA 5DM7R 2CZ6B 5CQXA 2OAUA 2HQXA 3UWNA 4M7AD 4ATOA 1JJ2S 3E9GA 3OBYA 3L2VA 4UC4A 4M7DF 3S3NA 3CCVT 2LQKA 3QDRB 4II1A 4A4KA 1YI2T 3HRSA 4PLIA 2E64A 1UB4A 2EJ9A 2ZZDA 3EFRA 3M9QA 3MP1A 4C92F 3VKIA 5GAMj 3L2QA 2P0PA 2R5MA 3JCMX 1YIJA 4C8QF 2AHJB 5CKFA 3RKYA 1JBMA 1YJ9A 1Q82C 2QXFA 3H8ZA 2CYZB 5GAN4 2XG8D 3SD4A 4BE1A 1M1GA 3LX7A 3RKWA 4ELZC 3CCJA 2WSEE 1UGRB 3WVEB 3ZFJA 1Q86U 1VQ6A 1RI0A 2QQBA 2H3JA 2HNIA 1U1TA 2MWOA 4MZTA 4A4EA 3RMQA 2PVGB 2M1HA 1LOJA 2WSCE 2DZCA 2RK1A 1XQHA 1DJ7B 2RI3A 4FM4B 4M75C 3JB9F 4EDUA 5A0GA 2OTLT 5FU6C 1PSEA 3R6OA 4XTWA 5GAN8 4GLKA 1MHNA 3CCJT 4C8QD 2E1HA 2GFAA 3QBYA 4XTZA 3CPWA 4HCBA 2F69A 1NJIU 2EIFA 4O6JA 2K5IA 3HP9A 3LGFA 5CKHA 2QQ9A 2O4XB 2XI9A 3L42A 2JTFA 5FU7C 3OS2A 1K9MC 2XU8A 4KUDK 2O01E 5CR2A 3GLXA 4OVAA 3CMAA 2OTJA 3JB9J 4M7AB 2RK2A 2RHYA 4L6V5 3KUFA 1KQSS 4OP0A 2KSSA 3LGLA 1VQOT 2EQMA 3LWHA 2Y90A 5D6YA 1NJIC 2VV5A 3JCMf 5C0MA 4IUQA 4ZGDB 3L2RA 2RD1A 1M1KU 2EYQA 3CPFA 5CCAA 1BI2A 1WJRA 1O75A 2LT1A 1JB0E 3HL8A 3I56T 2M16A 2E70A 4QQ6A 5CO7A 3L2ZA 4A4GA 4F7UG 4IUUA 2MI6A 4A53A 4NL2A 3ZEHA 1YI2A 2K5LA 2LDMA 5KE3A 3PIOA 4RG8A 3PMIA 4ME7A 3TEEA 4A54A 3QUIA 4OF1A 3SWNB 5GAMg 2VGNA 4J6YA 3A8HB 3FB9A 3QXEB 1N27A 5LJ3f 3E9FA 4E7KA 3JCMd 3LH0A 3CBMA 3N5BB 3O8VA 3QPHA 2VC8A 3OSVA 5LJ3h 3VUBA 1YITT 1W2BS 3MEUA 2EQUA 4M7AE 1YHQT 3CBOA 2XHCA 2XDDA 1K8AC 2L8DA 3A8MB 4JLIA 4BD3A 2FHDA 2MMPA 3BW1A 2KQWA 3M4YA 4JUVA 4MDWA 3VYGA 3I55A 2C06A 4C0FA 5LJ3e 2ZPFB 3G71T 4JRQA 1U8RA 3CCET 4M7DE 3SWNA 4PJOE 2QQSA 2IG0A 2D9TA 3DKMA 4M78F 1VQ5A 4ZN1A 3CCLA 4LDXA 1QVGS 3QSUA 1D3BA 1WJQA 3M57A 4LD9K 4C5HA 1G3WA 2X4YA 4OB1B 3CCMA 4F7UF 2WACA 5HY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JTM A;  3KXT A;  3LWI A;  4R56 A;  3LWH A;  4R55 A; 
#chains in the Genus database with same CATH topology
 4PFZ A;  4XU1 A;  3H0F A;  4M7A A;  1BI3 A;  3OS0 A;  2L3S A;  3JCM P;  2GCX A;  5D7U A;  1I4K 1;  2O2O A;  4X1V A;  9ATC B;  3CC7 Q;  2RHU A;  1RL2 A;  2OJ2 A;  1M2O A;  4AFZ C;  3OMG A;  3I56 Q;  2RQW A;  1V76 A;  2RH2 A;  1B34 A;  2DLP A;  1VQ5 Q;  4J6W A;  4EMK B;  4LUE A;  2HL5 C;  2DIL A;  3TQ7 P;  1QWE A;  4M77 B;  3SB2 A;  4RKU E;  1QP2 A;  5GAN 2;  2HEQ A;  2M51 A;  3RDV A;  1TUG B;  3CCV A;  4JRP A;  1IGQ A;  4PJO A;  4DOV A;  2LX9 A;  5KCO A;  1YJ9 T;  1NPP A;  2NUP B;  2Z0W A;  1UEC A;  3ER0 A;  2K57 A;  2DTH A;  1ZBX A;  3QZ5 B;  2BUD A;  4QKU A;  3VS7 A;  2OTJ T;  1WQW A;  1GBQ A;  2HKQ B;  4C0D C;  2JS2 A;  2K9G A;  1FX7 A;  2BE7 D;  4KH0 B;  4MZM A;  5HK0 A;  1XTD A;  2KXD A;  5GAN e;  4J9I A;  4C8Q B;  1FMW A;  4BUG A;  2YRC A;  1YJW T;  4LDV A;  3EFO B;  3FJ5 A;  2KRM A;  3O5Z A;  2DXU A;  2HMA A;  1YIJ Q;  2DXT A;  4R56 A;  2RPN A;  4J9B A;  3C12 A;  5GAO q;  3GNG A;  2YLB A;  5HKC A;  5KE2 A;  2CS7 A;  3H0I A;  2QAS A;  3VS4 A;  4XTV A;  4PJO G;  1RAB B;  4JRI A;  3A5Z B;  2LC4 A;  1M8V A;  1UEB A;  2DAQ A;  3MEW A;  2R57 A;  3CPW P;  4BI3 A;  3PVQ A;  2QA4 A;  1RAE B;  1RAD B;  1BK2 A;  4AFQ C;  1YHQ Q;  2DIG A;  3CC7 T;  2DZ9 A;  2QDY B;  3OSS C;  2RN8 A;  1RLP C;  3FJP A;  1I8F A;  2KYM A;  1U5S A;  2ROL A;  1Y96 A;  3CME T;  2DFU A;  2P4R A;  2P0Q A;  2RM4 A;  2CP5 A;  4FW2 A;  4F16 A;  2GNC A;  1I5L A;  2DVJ A;  3OB9 A;  1TUD A;  1W2B A;  4BY6 C;  4QVZ A;  4Z89 A;  4JZ4 A;  4LNP A;  3CCQ Q;  1QCO A;  2BKD N;  5LJ3 j;  4OGE A;  2DET A;  1G3T A;  3OA6 A;  1MMD A;  3QWX X;  2CZ1 B;  5GAM d;  1Y96 B;  1Q82 R;  2KDS A;  2E6N A;  2A36 A;  3MET A;  1U3O A;  2VB6 A;  3EH2 A;  4PJJ A;  2AZV A;  1Q81 U;  2V1Q A;  2HQE A;  1I07 A;  1YBY A;  3X24 B;  1B3Q A;  4XTX A;  4Z88 A;  1I0C A;  3M53 A;  5IT9 E;  5J26 A;  3M58 A;  3OYG A;  1M2V A;  1YJN T;  2KMT A;  4CI0 C;  3QYG B;  3NFC A;  4PJO C;  2YWW A;  2RMO A;  1Y7X A;  4PKC C;  5GAM f;  1HXD A;  2EPD A;  1UDL A;  1WI7 A;  2CT4 A;  1X69 A;  1XNI A;  1QCN A;  2EJG A;  2DL8 A;  3ME9 A;  2EKH A;  4C92 G;  4J7I A;  1G83 A;  1D0Z A;  3QYH B;  2JXB A;  4M75 F;  1TTH B;  1VQ5 T;  3SDZ A;  3HFO A;  5GAN h;  3WXM B;  2GBQ A;  4MDX A;  2K3Y A;  1YJW A;  3EHQ A;  2FG0 A;  3OY9 A;  2A08 A;  1WX6 A;  1KHI A;  2JUF A;  2KRS A;  1M8M A;  4DBR A;  1PCX A;  4OMO A;  3QKJ A;  2RI2 A;  1OPK A;  1WDX A;  3M59 A;  1RAG B;  2X9H A;  4A63 B;  5GAN d;  1IO6 A;  5L23 A;  3E2U A;  4KUL A;  3CCS Q;  2HD0 A;  2LT4 A;  1MV3 A;  3CEY A;  4XU3 A;  2C0O A;  2HCK A;  1I5O B;  2E41 A;  1VQ9 A;  4BAC A;  2DA9 A;  1N9R A;  1Q7Y C;  2FPD A;  1TXQ A;  1M3C A;  3OYI A;  1VQ4 T;  5GAN 6;  5GMK m;  4JS5 A;  2ZPB B;  1OI1 A;  2ZPH B;  1K73 U;  5ECA A;  2CDT A;  2CUB A;  3PE0 A;  4C5I A;  3NHN A;  3JB9 D;  3DLM A;  5GAN 7;  1MND A;  4HT9 A;  3G6E A;  4QQG A;  4B6M A;  2CH4 A;  5GJV B;  1TU0 B;  1YP5 A;  4L5G A;  7AT1 B;  1T0H A;  5GMK j;  2HBW A;  2LP5 A;  2CP6 A;  2LMJ A;  2PVD B;  2VGM A;  2VXF A;  3HSB A;  3MPU B;  1OZ2 A;  2ECZ A;  1NEB A;  1SPK A;  1ZX6 A;  3SWN C;  2DE0 X;  4BI4 A;  4XAX B;  1B07 A;  3JB9 I;  3VS0 A;  2RHI A;  1N8R R;  1JXO A;  2YLC A;  4M7A G;  1AWX A;  5D6X A;  4KT0 E;  3CCU T;  1UUE A;  4M77 E;  1ZQ1 A;  3SEM A;  2EWN A;  1WXU A;  3DB3 A;  2RQT A;  2QA4 Q;  2QEX T;  4BDY A;  3OBW A;  1H3Z A;  2OAU A;  2YUN A;  1ZA2 B;  3L2V A;  4UC4 A;  5KYY A;  4II1 A;  4C92 F;  5GAM j;  2ZZD A;  2DL5 A;  3JCM X;  1QVG P;  5CKF A;  1JBM A;  2DJQ A;  3REA B;  2XG8 D;  1XJW B;  1Z9Z A;  3CCJ A;  2WSE E;  3UF4 A;  1K0X A;  3WVE B;  2GGR A;  4RTZ A;  1RI0 A;  2L0A A;  2MWO A;  1U1T A;  1VQO Q;  2PVG B;  2WSC E;  2RK1 A;  1KFZ A;  1ABQ A;  1PSE A;  4XTW A;  5EC7 A;  4C8Q D;  3QBY A;  2K5I A;  1G8X A;  1PC0 A;  2XU8 A;  4KUD K;  4E6R A;  2OTJ A;  4DEX A;  2HSE B;  4OP0 A;  4E7Z A;  3LGL A;  1QLY A;  1VQO T;  5D6Y A;  2VV5 A;  2MIO A;  3L2R A;  3CPF A;  1VQ4 Q;  3HL8 A;  3I56 T;  4JJC A;  5CO7 A;  3L2Z A;  4IUU A;  3ZEH A;  1YI2 A;  3PMI A;  3TEE A;  3CCM Q;  5LJ3 f;  4E7K A;  3M0Q A;  3JCM d;  5LJ3 h;  2VC8 A;  1W2B S;  3A8M B;  4BD3 A;  4JUV A;  4MDW A;  3VS1 A;  4C0F A;  5LJ3 e;  1CSK A;  3G71 T;  2DRM A;  2CP3 A;  1VQ5 A;  1KD1 R;  3CD6 Q;  4OMQ A;  3M57 A;  1G3W A;  1PG5 B;  4PK4 A;  4LUD A;  1NJI C;  2E4H A;  4M78 D;  2PUO B;  4OGC A;  3I35 A;  4JJB A;  1KHC A;  3HTR A;  3OMC A;  3L1A A;  2DNU A;  1VQ4 A;  3CC4 A;  4MZP A;  3URG A;  1J3T A;  1PNJ A;  2QK0 A;  3CQT A;  5L8R E;  5CQY A;  1SHG A;  1IHW A;  2NYS A;  3JV3 A;  2YXY A;  2CSQ A;  5GAO n;  2OTL A;  5LJ3 g;  5I22 A;  3VS5 A;  2M02 A;  2FVU A;  1D1C A;  4N4G A;  2A7Y A;  2F5K A;  1YIT A;  2EQK A;  2ZCF B;  3FDR A;  2GF7 A;  3LLR A;  1QW1 A;  2CP7 A;  2KNB B;  2EFI A;  1E6H A;  5GAN f;  4J5Y A;  3I9Q A;  5CAI A;  1SRL A;  1RUW A;  4NS5 A;  4AT1 B;  4C8Q G;  4MMK A;  2LJ1 A;  3KFV A;  4M78 B;  3CCM T;  3QJY A;  1A0N B;  2BZY A;  4LN2 A;  3CXC A;  1SSF A;  2L89 A;  1QKX A;  3IQL A;  4DQ2 A;  2LJ3 A;  1PRM C;  1VQM Q;  1RAH B;  3CCS T;  2COZ A;  1UGV A;  3ZBD A;  3OW2 A;  1VQ7 A;  3RBB B;  1KQ1 A;  2X3W D;  1BYM A;  4CC2 A;  4HVU A;  5KYX A;  1NJI R;  1M90 U;  5FRM A;  2XD0 A;  2K3B A;  2JN0 A;  3H0H A;  2DKG A;  1WHG A;  1VQK T;  4M7D G;  3JCM e;  3S6W A;  1KD1 C;  2EJF A;  1K76 A;  1P92 A;  2AK5 A;  1W4S A;  3RUX A;  1KK7 A;  2OI3 A;  2PU9 B;  5IHK A;  2EVR A;  1ZHI A;  2XK0 A;  1E7O A;  5FRO A;  2ED0 A;  4E7L A;  1OUL A;  4FYY B;  3QZ9 B;  1BU1 A;  1GCQ C;  3EGD B;  4J83 A;  4PNO A;  3NPF A;  1W1F A;  3EFS A;  3JCM c;  1ARK A;  1PM3 A;  3SFM A;  4D6W A;  5C6S A;  2QEX Q;  3JCM b;  2A3L A;  2JVV A;  2ENM A;  3I5S A;  6AT1 B;  4ZGE B;  3VJP A;  3MEA A;  4A4H A;  5IXF A;  4BE2 A;  1M2V B;  1QCF A;  3M56 A;  4JPB W;  1TSF A;  3PIP A;  4AFU C;  1VQ8 T;  5KYX B;  2MF2 A;  4XU0 A;  2C0I A;  3QO3 A;  3FLG A;  2V26 A;  3WVD B;  5I2S A;  2W10 A;  1VQP T;  3DB4 A;  5GAO r;  3PFS A;  2DXB A;  2V8K A;  3GOX A;  1TH7 A;  8AT1 B;  4WTO B;  5I2M A;  5IHI A;  2QQR A;  1VQ8 A;  1LCK A;  2KY9 A;  4OMM A;  2DL4 A;  5I21 A;  2KBT A;  4C0Z A;  2BTT A;  3R6N A;  4F7U E;  3PTA A;  4KBM B;  3HHT B;  1R8O B;  3FRN A;  1WQ7 A;  1YCY A;  1VYV A;  1WPY A;  1KQS A;  2O4X A;  2DMO A;  1R0C B;  2E65 A;  3EG9 B;  4HCK A;  3EAE A;  5IHN A;  4HCC A;  2RQR A;  2EBP A;  1MV0 B;  3CXC P;  2FB7 A;  5GAO l;  1VQM T;  3OS5 A;  3QJ6 A;  1UE9 A;  4C92 C;  3G7Z A;  3ZL7 C;  2QEX A;  1N8R C;  4LXC A;  4B9W A;  2RHZ A;  4N4I A;  2LVM A;  2RF0 A;  4AMC A;  2HQH A;  5LJ5 d;  4PLL A;  1M90 C;  4FU6 A;  3FIF A;  3MO8 A;  2RJF A;  1Y07 A;  1BIB A;  2KK4 A;  2PVO B;  1EX4 A;  2M0O A;  3JCM W;  3CCL T;  1KD1 U;  4M7D F;  3CPW S;  1K1Z A;  1T3S A;  4EMK A;  2RI5 A;  2A37 A;  4C0G A;  3C0C A;  3S3O A;  1EFN A;  1GXI E;  2KXC A;  4X9C A;  1D3B B;  3OYM A;  1SG5 A;  4TVR A;  1X6G A;  5LJ3 d;  1FMK A;  1OZ3 A;  2DIQ A;  3CMA T;  4E7S A;  1QP3 A;  3NMZ C;  5GJW B;  4IKF A;  2J05 A;  2DXC A;  2X3X D;  2JOY A;  3RR6 A;  4PJO B;  1M3B A;  4E47 A;  1Q7Y U;  1CKA A;  3NTI A;  3OYY A;  2KRN A;  2ZAE A;  2CKK A;  4J9H A;  2LCC A;  3HPW A;  3RIR A;  2RQV A;  2DVE A;  3M0T A;  1BCO A;  1OEB A;  4HA8 A;  2XMF A;  1VQN T;  2HDA A;  2JS0 A;  4HKE A;  3JCM V;  3OYJ A;  4N0A A;  4ANJ A;  2DYB A;  3I56 A;  2KI7 A;  1YHQ A;  3CC7 A;  4R55 A;  2AT1 B;  2VAS A;  2MPX C;  1EIF A;  3VRZ A;  3P8H A;  2YRV A;  3CCQ A;  1OX9 A;  3EFO A;  1W6X A;  1BB9 A;  4DEY A;  3OYN A;  2L3P A;  4JRK A;  1VQP A;  4OMF B;  4Y28 E;  2ABL A;  1X6O A;  4RCC A;  4PJO D;  3FEO A;  4WF2 A;  2F5T X;  2FL7 A;  3G71 A;  2NUP A;  1M3A A;  3CC4 T;  1ABO A;  4FIB A;  4C5E A;  2CP2 A;  1VIE A;  5IAY A;  3A8G B;  3J81 E;  2DBM A;  1PD0 A;  2EGC A;  3RES A;  1M90 R;  3VS2 A;  2P0K A;  3P8B B;  2V8J A;  1WXT A;  3CC4 Q;  3V8J A;  3GP8 A;  4C92 B;  4OML A;  1VQN Q;  1T3L A;  1C0M A;  1RLQ C;  1NYF A;  1WIE A;  3QG1 A;  4L59 A;  2HKN A;  1QMC A;  3OYE A;  1RAF B;  1G3Y A;  1X2K A;  4PJN A;  2O31 A;  1TUC A;  3M54 A;  2EYY A;  2MOX A;  4JDS A;  5LJ5 e;  5FWC A;  2J6K A;  3Q1J A;  5DM7 R;  2ATC B;  2O88 A;  4K11 A;  4M7A D;  3OBY A;  2CUD A;  2LQK A;  4A4K A;  1RAC B;  1YI2 T;  3HRS A;  1AOJ A;  2E64 A;  3MP1 A;  1UB4 A;  3EFR A;  3L2Q A;  2OTL T;  2PTK A;  1Q82 C;  3EG0 A;  3H8Z A;  5GAN 4;  4PJL A;  4BE1 A;  1M1G A;  3LX7 A;  4ELZ C;  1X2Q A;  1UGR B;  1X6B A;  2BZ8 A;  3ZFJ A;  1Q86 U;  1VQ6 A;  2QQB A;  2H3J A;  1SF9 A;  2HNI A;  1LOJ A;  2DZC A;  2KR3 A;  2RI3 A;  4EDU A;  1YFN A;  5FU6 C;  1ZSZ B;  3R6O A;  5KYW B;  1YJW Q;  1K4U S;  1MHN A;  3CCJ T;  4HCB A;  4FCY A;  2EIF A;  4O6J A;  3LGF A;  2QQ9 A;  2XI9 A;  4HVW A;  1TOV A;  2D8H A;  5CR2 A;  3CMA A;  1CKB A;  2RK2 A;  4L6V 5;  3U23 A;  2KSS A;  3LWH A;  2Y90 A;  2PNI A;  4F17 A;  1JJ2 P;  1U06 A;  4AFS C;  3JCM f;  4ZGD B;  2RD1 A;  2YUO A;  1OU8 A;  2EGE A;  2EYQ A;  1BI2 A;  2LQW A;  1WJR A;  1M1K U;  1GCP A;  1O75 A;  3H41 A;  4QQ6 A;  4F7U G;  2K5L A;  2LDM A;  5KE3 A;  4RG8 A;  4A54 A;  1NM7 A;  4OF1 A;  3SWN B;  4J6Y A;  3FB9 A;  3QXE B;  2KEA A;  2JW4 A;  3O8V A;  4RTW A;  1YIT T;  2YT6 A;  4M7A E;  1YHQ T;  2XHC A;  3AT1 B;  2JMC A;  3M4Y A;  3I55 A;  2GQI A;  3GBQ A;  2H8H A;  2V1R A;  3CCE T;  3SWN A;  2IG0 A;  2D9T A;  1ZSZ A;  1WJQ A;  3LH5 A;  2XID A;  3SD4 A;  2I0N A;  2QYZ A;  1S72 A;  4F04 B;  1WXB A;  3QDF A;  4B9X A;  1BBZ A;  1Y57 A;  2G6F X;  3A8O B;  1Y0M A;  1FXX A;  2VVK A;  3OYA A;  3V7C A;  1N5Z A;  3C4S A;  1QQJ A;  5IXB A;  4C92 D;  1QVP A;  3GIB A;  4N4H A;  2KGT A;  3S3M A;  2DD4 A;  2NUZ A;  2XKO C;  5GAN 5;  4X9D A;  2PUK B;  1YI2 Q;  2NLU A;  2FPF A;  3VYH B;  1KSW A;  2D0N A;  2DEU A;  1PSF A;  1UJY A;  5CK9 A;  1VQ9 T;  1V29 B;  3HRU A;  8ATC B;  1I1J A;  3JAM E;  4M7D A;  4QVC A;  2K6D A;  2JMA A;  3OYF A;  1VYT A;  2JTM A;  1WYX A;  2RA2 A;  5A2Q E;  4J8O A;  3OW2 S;  2EYX A;  4IUR A;  1QVF A;  1BKB A;  1VQL A;  3GF5 A;  4QW2 A;  2X4J A;  2RO0 A;  3CCL Q;  4ZNX A;  1JO8 A;  3X25 B;  2FZG B;  2DTI A;  2WSF E;  2IVW A;  1M5Q 1;  5KH6 A;  2EGA A;  2RQU A;  2FEI A;  3M55 A;  4M75 B;  4RTX A;  4M7A F;  3CME A;  3OYL A;  3MP8 A;  4KGZ B;  5FLX E;  5GAN g;  4Y92 A;  3VS3 A;  1NPR A;  2LCS A;  1NYG A;  1TWB A;  2EAY A;  4QQD A;  4J9E A;  4XK8 E;  4YTL A;  3REB B;  1ZUU A;  2ROT A;  4M77 C;  5A0L A;  1OOT A;  3J7A F;  4M78 C;  5EG2 A;  3M4G A;  2LZ6 B;  4CRI A;  4LDY A;  2DM1 A;  1TS9 A;  1UHC A;  4KUI A;  4WCI A;  4XU2 A;  1X01 A;  5FRN A;  5GAN 3;  1M1K C;  1IRX A;  1ZSG A;  1NLO C;  4OB2 B;  2MYS A;  1YJN Q;  4DBF A;  5HK3 A;  2JNG A;  3EG9 A;  3G1J A;  3GPL A;  4JJN K;  5D6W A;  3CCS A;  5KYU A;  2KT8 A;  2LX7 A;  1KQ2 A;  1VQM A;  2X4X A;  4OB3 B;  4ZN3 A;  2K5F A;  4C8Q C;  4M75 A;  2X4W A;  1JJ2 A;  3JCM Q;  3PT9 A;  1R0B G;  1BI0 A;  1JEG A;  3QWY A;  4IUT A;  4CC4 B;  4P5N A;  1ZUY A;  1AZE A;  1KC8 U;  1Q82 U;  1MMG A;  2JM8 A;  4C5G A;  3OYC A;  2SEM A;  4DOW A;  5CVI A;  3I55 T;  4ZTJ A;  2XIC A;  1FYN A;  5LJ5 h;  3CCV Q;  1K73 C;  3VU3 C;  4XTY A;  4KGV B;  1WGS A;  1AZG B;  2LQ8 A;  3CD6 T;  4RTV A;  1B34 B;  4M75 G;  1TG0 A;  1K0S A;  3BE3 A;  4M78 G;  1AWJ A;  2ED1 A;  1IXD A;  2GTO A;  5KYU B;  3ULR B;  3G4S Q;  4V2S A;  5GAO p;  3A1P A;  2CRE A;  1AT1 B;  2V8I A;  2LRQ A;  1VIF A;  1OPL A;  3NGP A;  2DD5 A;  4HCZ A;  2R58 A;  1BIA A;  4VUB A;  1VQ7 T;  4RCB A;  5A0D A;  1W2B P;  2D0Q B;  2EKO A;  2VXE A;  2DPP B;  3UAT A;  3OYD A;  5FU7 B;  1HK9 A;  2DJZ A;  1AWW A;  3BDL A;  1YIJ T;  4Q5W A;  1OYX A;  2JJ9 A;  3MJX A;  1M9S A;  3E19 A;  1G2B A;  2E12 A;  4E7J A;  2NWM A;  1UGP B;  3BY7 A;  2ESW A;  3H6Z A;  3OW2 P;  2GFU A;  1UGQ B;  1XOV A;  3UT1 A;  2XDP A;  4HXJ A;  2AKK A;  1VQK Q;  2LQN A;  3CCE A;  1QKW A;  3TVT A;  4E2F B;  2RJD A;  2A0F B;  2RHX A;  1IB8 A;  3OYH A;  2NUT A;  3CC2 T;  1K8A U;  2E3I A;  2QG9 B;  2VWF A;  1IRE B;  2C0T A;  4LDU A;  2CSI A;  4M78 A;  3M0U A;  3ASK A;  2K2M A;  3MCA B;  5DY9 A;  4C92 A;  1JU5 C;  3H9N A;  2L5Q A;  1HJD A;  2EW3 A;  1V1C A;  4F7U A;  1M4Z A;  1Q7Y R;  3CXC S;  4NL3 A;  1GFC A;  4BB7 A;  2E6Z A;  1Y71 A;  3CC2 A;  4M7D D;  2VUB A;  4Y91 A;  4D8D A;  2LNV A;  4LDW A;  2M0Y A;  4RUG A;  1VQ6 Q;  3BDU A;  4PJM A;  3CCJ Q;  1YWO A;  5GAM e;  2F2X A;  1AHJ B;  1VA7 A;  5GMK h;  4C8Q E;  3LW5 E;  3EG1 A;  3MKD A;  4A4F A;  2YHT A;  1MNE A;  2DF6 A;  1Q95 G;  3QHS A;  1QVG A;  2RB6 A;  4AG1 C;  1PKT A;  5LJ5 j;  3PVL A;  4EMG A;  3JB9 G;  2KRO A;  3X20 B;  3V8L A;  2HBP A;  2DTO A;  3M0R A;  4BY6 B;  1C6V X;  2CH4 W;  2NUT B;  1MGQ A;  3CCR T;  4PJO F;  2QGG A;  4C0D B;  3T9N A;  5LJ5 f;  2CZ0 B;  4XQ3 A;  3HFN A;  1NZ9 A;  5AYF A;  3CCR Q;  5KCH A;  2QQA A;  4J7F A;  4DBQ A;  2K79 A;  1NG2 A;  3MEV A;  1RI9 A;  4M7A C;  3UDC A;  3CD6 A;  4M77 D;  4PL6 A;  2CGH A;  3G71 Q;  1T0J A;  2YSQ A;  2CZ6 B;  1GBR A;  1AEY A;  4ESR A;  1VQL Q;  2IIM A;  3QDR B;  2D8J A;  1H92 A;  4PLI A;  3M9Q A;  4E7I A;  3CCR A;  1ZSZ C;  1ZBJ A;  3VKI A;  1X43 A;  2P0P A;  2R5M A;  1YIJ A;  3CMA Q;  3RKY A;  4GLM A;  3EGD A;  3RKW A;  1GCQ A;  1UTI A;  2VKN A;  1OV3 A;  2B86 A;  2L2P A;  4MZT A;  2M1H A;  2AZS A;  1XQH A;  4FM4 B;  5A0G A;  5GAN 8;  4FW1 A;  2E1H A;  1BCM A;  2F69 A;  1NJI U;  1WA7 A;  3HP9 A;  3CME Q;  1K9M C;  5FU7 C;  2JTF A;  1HYO A;  2O01 E;  2YDL A;  3GLX A;  5FW9 A;  2DL3 A;  2RHY A;  3KUF A;  1KQS S;  2COW A;  1PWT A;  5C0M A;  2HZY A;  2LT1 A;  1JB0 E;  2HSP A;  3EH1 A;  2EQI A;  4NL2 A;  2JM9 A;  4ME7 A;  2FZC B;  2VGN A;  2AIR B;  1PRL C;  3A8H B;  1N27 A;  3LH0 A;  3CBM A;  1GRI A;  1D09 B;  3CC2 Q;  3OSV A;  3VUB A;  3MEU A;  2EQU A;  3CBO A;  2XDD A;  1SSH A;  1K8A C;  4CC3 A;  2FHD A;  2MMP A;  2K7A A;  2KQW A;  2C06 A;  2KYB A;  5HCK A;  2ZPF B;  3THK A;  4JRQ A;  2QDL A;  1U8R A;  4M7D E;  1JXM A;  2E5K A;  4PJO E;  1D1B A;  1M30 A;  3DKM A;  4ZN1 A;  1QVG S;  3QSU A;  1Q86 R;  5I11 A;  4RTY A;  1OQK A;  2J7I A;  1H3H A;  2ZPE B;  2EYW A;  4FT2 A;  3FC3 A;  4HVV A;  1VYU A;  4M77 G;  2KAF A;  2O9V A;  4AG2 C;  1R77 A;  3M5A A;  2KVQ G;  1IZ6 A;  2BE9 B;  2ZPI B;  1VQO A;  4M77 A;  4RG2 A;  3OQ5 A;  4QVD A;  1LNX A;  1ACM B;  1B7T A;  3TCJ A;  4FT4 A;  1D1A A;  2K4Y A;  2Y4Y A;  1IHV A;  3RMS A;  1YJ9 Q;  1VOM A;  1UG1 A;  3VRY A;  4GBQ A;  2CT3 A;  4ORZ A;  1WHM A;  4E7H A;  4DBH A;  1SKU B;  1WHH A;  3TSW A;  3OS1 A;  1YCS B;  2FYK A;  1LVK A;  5GMK l;  1VQN A;  3HKS A;  2O9S A;  1C1A A;  4XTU A;  4F14 A;  3C95 A;  3JCM h;  1N6A A;  1WNL A;  2BIV A;  3CCE Q;  1AWO A;  3LYI A;  4OB0 B;  4O5V A;  4C8Q A;  2ZPG B;  2P84 A;  4CC7 A;  1QVF S;  3RNJ A;  3GNF B;  1YWP A;  1YIT Q;  1H8K A;  4IUP A;  2MK5 A;  1W70 A;  4FSX A;  4JJD A;  3I55 Q;  1OX8 A;  5DLO A;  1SRM A;  1NLP C;  2Y4X A;  2QA4 T;  2QAZ A;  5J3B A;  1LJO A;  1NBE B;  1M1F A;  3RER A;  1Q86 C;  1OU9 A;  3PMT A;  4C92 E;  2DO3 A;  2FZK B;  4BI8 B;  2FO0 A;  4ZTF A;  1F1B B;  3CCU Q;  4J6X A;  3KXT A;  2K2V A;  1AD5 A;  3INZ A;  2B8A A;  3EG2 A;  5KYY B;  2P4T A;  1K8A R;  2L3R A;  4R0K A;  4LD6 A;  2F2W A;  2RJC A;  3M0P A;  4JLG A;  4M7D C;  5GAN j;  2MAM A;  2YUQ A;  4J9D A;  4KGX B;  3LWI A;  3V8K A;  3V7R A;  1MMA A;  2DRK A;  4KH1 B;  1HSQ A;  2H3E B;  2J06 A;  2RJE A;  3CBP A;  3F70 A;  1BI1 A;  3UA7 A;  4EMH A;  5CKE A;  3VV0 A;  1K9M U;  1G5V A;  2YUP A;  1WJS A;  1KIK A;  1D0X A;  4LE9 A;  2DL7 A;  4RMO A;  2ZGW A;  1K9M R;  3QII A;  3SHW A;  2QTX A;  1JRI A;  2G3R A;  5FU6 B;  1M27 C;  3I5R A;  1VQ6 T;  2D6F A;  1IGU A;  1HD3 A;  2DYI A;  3BFM A;  1YJN A;  4EPC A;  3UPU A;  4J9C A;  2J6O A;  3JB9 H;  5GMK e;  2EYZ A;  2JZ2 A;  3JCM J;  2AKL A;  4NOY A;  5J39 A;  3JCM g;  4OMN A;  2PQW A;  3V7S A;  3J80 E;  3NTH A;  2LTO A;  5CIU A;  5KYW A;  3E1S A;  1K9A A;  3VUZ A;  5M9O A;  1KG1 A;  4PFO A;  4BDZ A;  2CZ7 B;  1UJ0 A;  3EGX A;  3TRE A;  2QGF B;  2R5A A;  5DLQ E;  1YNZ A;  4IIM A;  1UGS B;  4MML A;  4FYX B;  3RKX A;  2LJ0 A;  4F7U B;  2DER A;  5LL6 S;  3OYK A;  1Q81 C;  2YRD A;  2J6F A;  1I81 A;  3PGG A;  2LCL A;  1VQK A;  4M75 D;  3A98 A;  2KT1 A;  2PZ1 A;  3EGX B;  3HRT A;  1VQL T;  1MMN A;  3P8D A;  3C94 A;  1LPL A;  2XDB A;  1VQP Q;  4ELY C;  3AHU A;  4N0A C;  2VYT A;  2F1L A;  3M0S A;  1KC8 C;  1G3S A;  4J9F A;  2LNH B;  2X35 A;  2FRY A;  2OAW A;  3CCQ T;  1N9S A;  3L2W A;  4BE0 A;  2K3X A;  1O9S A;  2HL3 A;  1FWZ A;  3A8L B;  4OMP A;  1QVF P;  3EHR A;  3MP6 A;  1KQS P;  4X34 A;  2FPE A;  3G6E T;  1N8R U;  5IN1 A;  5GAO m;  3OYB A;  1WFW A;  5CKD A;  2E3H A;  5GMK i;  2DK3 A;  4M7D B;  1VQ8 Q;  4M4Z A;  3NTK A;  5LJ5 g;  1NE8 A;  1H64 1;  3D7S B;  2EQJ A;  4HT8 A;  2GQV A;  1SEM A;  4Z8A A;  3DLL A;  2FRW A;  2E5Q A;  1AVZ C;  3PNW C;  1UFF A;  2GTJ A;  4J9G A;  1WHJ A;  1PHT A;  1WHL A;  1Z9Q A;  3KBG A;  1SHF A;  1FMV A;  2OTL Q;  4M75 E;  4EMK C;  4Z02 A;  4DA4 A;  4JS4 A;  2OX7 A;  4IIO A;  3CCU A;  2QTV A;  4IUV A;  2MWP A;  4GY5 A;  1GL5 A;  4D8K A;  2W0Z A;  1VUB A;  5GAM h;  2JTE A;  5CKB A;  1U1S A;  2E10 A;  4FSS A;  2M9U A;  2QI2 A;  4ZGJ B;  3X28 B;  3JRZ A;  1KJW A;  1X75 C;  1KC8 R;  2L3Q A;  3JSC A;  1WZO A;  3G4S A;  4M77 F;  4M78 E;  3TU4 K;  1E6G A;  4FL6 A;  1PKS A;  4FYV B;  1X27 A;  2HAX A;  3L2U A;  1GFD A;  1RAI B;  3MHX A;  4QT7 A;  1Q81 R;  1ZLM A;  2DEQ A;  1S72 T;  4RTU A;  3G4S T;  1PD1 A;  5AT1 B;  2I2L A;  4JZ3 A;  3X26 B;  3EGU A;  2IPO B;  5CQX A;  3UWN A;  2HQX A;  4ATO A;  1WHK A;  3E9G A;  1JJ2 S;  1VQ7 Q;  3S3N A;  2MCN A;  3CCV T;  2KE9 A;  3VS6 A;  3G6E Q;  2EJ9 A;  1K73 R;  2BZX A;  1S1N A;  1ZUK A;  4KRT A;  2RNA A;  2X51 A;  2OTJ Q;  4C8Q F;  2AHJ B;  1YJ9 A;  2QXF A;  2CYZ B;  1WLP B;  1MUZ A;  4A4E A;  3UA6 A;  3RMQ A;  1DJ7 B;  3JB9 F;  4M75 C;  4FYW B;  1RAA B;  1UHF A;  2DBK A;  4EIK A;  4GLK A;  2GFA A;  3CPW A;  4XTZ A;  1VQ9 Q;  4RTT A;  5CKH A;  3L42 A;  2O4X B;  3OS2 A;  1D0Y A;  4OVA A;  3JB9 J;  4M7A B;  2EQM A;  2JT4 A;  4IUQ A;  5CCA A;  2COY A;  2M16 A;  2E70 A;  4A4G A;  5KYN A;  1QWF A;  2MI6 A;  1ZA1 B;  5FWB A;  4A53 A;  4PFP A;  3PIO A;  1M1K R;  3EG3 A;  3QUI A;  5GAM g;  1NEG A;  3E9F A;  2A28 A;  3N5B B;  1JQQ A;  3QPH A;  2L8D A;  4JLI A;  3VYG A;  3BW1 A;  1YN8 A;  1EZZ B;  2CP0 A;  2DX1 A;  5IH2 A;  2QQS A;  4M78 F;  3TSZ A;  3CCL A;  4LDX A;  2SRC A;  1D3B A;  2F2V A;  1S72 Q;  4LD9 K;  2D1X A;  4C5H A;  2X4Y A;  4OB1 B;  3CCM A;  4F7U F;  2WAC A;  5HY6 A; 
#chains in the Genus database with same CATH homology
 4M78 D;  1S72 A;  4XU1 A;  2PUO B;  2ZPE B;  4FT2 A;  4OGC A;  3FC3 A;  4M77 G;  4M7A A;  1KHC A;  2KAF A;  3OMC A;  3L1A A;  4B9X A;  1VQ4 A;  3CC4 A;  1BI3 A;  3OS0 A;  4MZP A;  3M5A A;  3URG A;  3JCM P;  2GCX A;  2KVQ G;  1IZ6 A;  5L8R E;  2ZPI B;  1I4K 1;  4M77 A;  3A8O B;  1VQO A;  5CQY A;  4RG2 A;  3OQ5 A;  1FXX A;  2RHU A;  1RL2 A;  4QVD A;  3OYA A;  1LNX A;  3V7C A;  3OMG A;  3TCJ A;  4FT4 A;  3C4S A;  2RH2 A;  2K4Y A;  5GAO n;  2Y4Y A;  2OTL A;  3RMS A;  1B34 A;  5LJ3 g;  4J6W A;  4C92 D;  4EMK B;  1QVP A;  3GIB A;  4N4H A;  2FVU A;  4N4G A;  3S3M A;  2DD4 A;  2XKO C;  5GAN 5;  2A7Y A;  2F5K A;  1YIT A;  2EQK A;  4E7H A;  4X9D A;  2ZCF B;  2PUK B;  4M77 B;  3SB2 A;  3FDR A;  2NLU A;  3OS1 A;  2FYK A;  3VYH B;  4RKU E;  5GMK l;  1VQN A;  2GF7 A;  3HKS A;  3LLR A;  1QP2 A;  1QW1 A;  5GAN f;  5GAN 2;  2EFI A;  4J5Y A;  1PSF A;  5CK9 A;  5CAI A;  4NS5 A;  4C8Q G;  4XTU A;  1VQ9 T;  1V29 B;  4MMK A;  3CCV A;  3C95 A;  3JCM h;  3HRU A;  1N6A A;  1WNL A;  4M78 B;  3CCM T;  4JRP A;  3QJY A;  4DOV A;  3JAM E;  4M7D A;  2BIV A;  3CXC A;  4QVC A;  2LX9 A;  1SSF A;  3LYI A;  2L89 A;  4OB0 B;  5KCO A;  4DQ2 A;  4O5V A;  3OYF A;  1YJ9 T;  4C8Q A;  1NPP A;  2ZPG B;  2JTM A;  3ER0 A;  3CCS T;  2K57 A;  2RA2 A;  2DTH A;  1ZBX A;  3QZ5 B;  2BUD A;  4J8O A;  5A2Q E;  3ZBD A;  3OW2 S;  1QVF S;  4IUR A;  3GNF B;  3OW2 A;  1BKB A;  1VQ7 A;  1WQW A;  1VQL A;  1QVF A;  2OTJ T;  3GF5 A;  4QW2 A;  2X4J A;  2RO0 A;  4C0D C;  1KQ1 A;  1BYM A;  3X25 B;  2DTI A;  2WSF E;  4IUP A;  2IVW A;  1M5Q 1;  1FX7 A;  4MZM A;  5HK0 A;  4FSX A;  1XTD A;  5KH6 A;  2XID A;  5GAN e;  1M90 U;  5DLO A;  4C8Q B;  5FRM A;  2XD0 A;  3M55 A;  4M75 B;  2JN0 A;  2Y4X A;  4BUG A;  3CME A;  2QA4 T;  4M7A F;  2DKG A;  5J3B A;  1LJO A;  3OYL A;  1VQK T;  3MP8 A;  4M7D G;  3JCM e;  1M1F A;  1YJW T;  4LDV A;  5FLX E;  1Q86 C;  5GAN g;  3RER A;  3PMT A;  3S6W A;  4C92 E;  1KD1 C;  2DO3 A;  4BI8 B;  1NPR A;  2EJF A;  1P92 A;  4ZTF A;  2DXU A;  1W4S A;  4J6X A;  2EAY A;  2DXT A;  3RUX A;  3KXT A;  4R56 A;  2PU9 B;  2K2V A;  4QQD A;  3C12 A;  4XK8 E;  3INZ A;  5GAO q;  4YTL A;  1ZHI A;  2B8A A;  2P4T A;  2XK0 A;  4M77 C;  5A0L A;  3J7A F;  2L3R A;  3GNG A;  4LD6 A;  5FRO A;  4M78 C;  2YLB A;  3CCR A;  5HKC A;  4E7L A;  2RJC A;  5KE2 A;  2CS7 A;  5EG2 A;  4JLG A;  3M4G A;  4M7D C;  5GAN j;  2MAM A;  3LWI A;  3QZ9 B;  4CRI A;  4LDY A;  3V8K A;  3V7R A;  4XTV A;  4J83 A;  4PNO A;  4PJO G;  4KUI A;  4XU2 A;  1X01 A;  5FRN A;  3EFS A;  5GAN 3;  1M1K C;  3JCM c;  4JRI A;  2RJE A;  3A5Z B;  2LC4 A;  1M8V A;  4OB2 B;  3SFM A;  1UEB A;  3CBP A;  2DAQ A;  3F70 A;  4D6W A;  5C6S A;  5HK3 A;  2JNG A;  1BI1 A;  2A3L A;  3JCM b;  3GPL A;  2JVV A;  3MEW A;  2R57 A;  4JJN K;  4BI3 A;  4EMH A;  5CKE A;  5D6W A;  3CCS A;  2QA4 A;  4ZGE B;  3VJP A;  3MEA A;  4A4H A;  4BE2 A;  3VV0 A;  1K9M U;  3M56 A;  1KQ2 A;  1G5V A;  2DIG A;  3PIP A;  3CC7 T;  2DZ9 A;  1WJS A;  2QDY B;  1VQM A;  4PJO A;  2X4X A;  3OSS C;  4OB3 B;  1VQ8 T;  4ZN3 A;  4RMO A;  2MF2 A;  2ZGW A;  4XU0 A;  3QO3 A;  3FLG A;  3WVD B;  5I2S A;  2K5F A;  3QII A;  4C8Q C;  3FJP A;  2X4W A;  2QTX A;  1I8F A;  4M75 A;  1JRI A;  3JCM Q;  2G3R A;  5FU6 B;  1VQP T;  3DB4 A;  1JJ2 A;  3PT9 A;  1Y96 A;  3CME T;  5GAO r;  3PFS A;  1I5L A;  2DXB A;  2P0Q A;  2RM4 A;  1VQ6 T;  1BI0 A;  2D6F A;  2V8K A;  3GOX A;  1TH7 A;  3OB9 A;  3BFM A;  1W2B A;  5I2M A;  4BY6 C;  4IUT A;  4QVZ A;  2QQR A;  1VQ8 A;  1YJN A;  4EPC A;  3UPU A;  4P5N A;  2KY9 A;  2BKD N;  5LJ3 j;  3JB9 H;  5GMK e;  2JZ2 A;  3JCM J;  4NOY A;  5J39 A;  1Q82 U;  1KC8 U;  3JCM g;  4OGE A;  5I21 A;  2PQW A;  4C0Z A;  1G3T A;  4C5G A;  3OYC A;  3OA6 A;  4F7U E;  2CZ1 B;  5GAM d;  3PTA A;  3V7S A;  3J80 E;  1Y96 B;  4KBM B;  3HHT B;  3NTH A;  4DOW A;  1R8O B;  5CVI A;  3I55 T;  4ZTJ A;  3FRN A;  2KDS A;  2XIC A;  2LTO A;  5CIU A;  2E6N A;  3E1S A;  3MET A;  3VUZ A;  5M9O A;  5LJ5 h;  1WQ7 A;  1K73 C;  3VU3 C;  4XTY A;  1YCY A;  1KG1 A;  4BDZ A;  1Q81 U;  2CZ7 B;  1KD1 U;  1WGS A;  1WPY A;  2HQE A;  1YBY A;  1KQS A;  3X24 B;  2LQ8 A;  2O4X A;  3CD6 T;  4XTX A;  1B34 B;  3TRE A;  2R5A A;  5DLQ E;  4M75 G;  3M53 A;  2E65 A;  4M78 G;  3EAE A;  5IT9 E;  4HCC A;  5J26 A;  3M58 A;  1UGS B;  4MML A;  3OYG A;  3RKX A;  2FB7 A;  5GAO l;  1YJN T;  5GAO p;  4V2S A;  2KMT A;  1VQM T;  4CI0 C;  3OS5 A;  3NFC A;  3QJ6 A;  3QYG B;  4F7U B;  4PJO C;  4C92 C;  2V8I A;  5LL6 S;  1Y7X A;  2LRQ A;  3G7Z A;  4PKC C;  3OYK A;  5GAM f;  1Q81 C;  1VIF A;  1HXD A;  2QEX A;  1I81 A;  3PGG A;  2DD5 A;  2LCL A;  1XNI A;  4HCZ A;  1N8R C;  1VQK A;  2R58 A;  4M75 D;  2RHZ A;  4N4I A;  4B9W A;  2LVM A;  2EJG A;  1BIA A;  3HRT A;  4VUB A;  1VQ7 T;  1VQL T;  4RCB A;  5A0D A;  3P8D A;  3C94 A;  3ME9 A;  2D0Q B;  2EKO A;  2XDB A;  2VXE A;  4C92 G;  4ELY C;  3AHU A;  5LJ5 d;  4J7I A;  4PLL A;  1M90 C;  2DPP B;  3QYH B;  4N0A C;  3OYD A;  2VYT A;  5FU7 B;  1HK9 A;  4M75 F;  1KC8 C;  4FU6 A;  1VQ5 T;  2DJZ A;  1G3S A;  3FIF A;  2X35 A;  3MO8 A;  3BDL A;  3SDZ A;  2RJF A;  1Y07 A;  1BIB A;  2KK4 A;  2PVO B;  3HFO A;  2M0O A;  3JCM W;  4Q5W A;  3CCL T;  1YIJ T;  5GAN h;  3CPW S;  3WXM B;  1OYX A;  3CCQ T;  4MDX A;  1N9S A;  3L2W A;  2K3Y A;  1M9S A;  3E19 A;  4EMK A;  4BE0 A;  2K3X A;  1YJW A;  2RI5 A;  1O9S A;  2E12 A;  3OY9 A;  4E7J A;  3BY7 A;  1FWZ A;  1UGP B;  3A8L B;  3H6Z A;  4C0G A;  2GFU A;  1UGQ B;  1KHI A;  1XOV A;  3UT1 A;  2JUF A;  2XDP A;  3S3O A;  4X9C A;  1GXI E;  3MP6 A;  1D3B B;  4X34 A;  3OYM A;  3G6E T;  4TVR A;  3CCE A;  5LJ3 d;  3QKJ A;  2RI2 A;  1OZ3 A;  2DIQ A;  1N8R U;  3CMA T;  2RJD A;  1QP3 A;  2RHX A;  3M59 A;  5IN1 A;  5GAO m;  3OYH A;  4IKF A;  3CC2 T;  3OYB A;  1K8A U;  5GAN d;  1IRE B;  2DXC A;  4LDU A;  5CKD A;  5GMK i;  2JOY A;  4M78 A;  2DK3 A;  4KUL A;  4PJO B;  4M7D B;  3ASK A;  2HD0 A;  4E47 A;  1Q7Y U;  2LT4 A;  3CEY A;  3MCA B;  5DY9 A;  4C92 A;  3NTI A;  3NTK A;  3OYY A;  4XU3 A;  5LJ5 g;  1NE8 A;  1H64 1;  2CKK A;  2L5Q A;  2LCC A;  3HPW A;  2E41 A;  2EQJ A;  1VQ9 A;  4HT8 A;  4F7U A;  4BAC A;  1M4Z A;  2GQV A;  3RIR A;  2DVE A;  1Q7Y C;  1N9R A;  3DLL A;  3CXC S;  3OYI A;  1VQ4 T;  2E5Q A;  5GAN 6;  5GMK m;  4NL3 A;  2ZPB B;  4HA8 A;  4JS5 A;  4BB7 A;  2E6Z A;  1VQN T;  4E7I A;  1OI1 A;  1Y71 A;  4HKE A;  3PNW C;  3JCM V;  4N0A A;  3OYJ A;  3CC2 A;  4M7D D;  2ZPH B;  1K73 U;  2VUB A;  3I56 A;  4Y91 A;  4C5I A;  2LNV A;  3KBG A;  4LDW A;  3CC7 A;  1YHQ A;  4R55 A;  3BDU A;  3JB9 D;  3DLM A;  1EIF A;  5GAM e;  5GAN 7;  3P8H A;  1AHJ B;  4M75 E;  4Z02 A;  4EMK C;  5GMK h;  2YRV A;  4C8Q E;  4JS4 A;  4DA4 A;  3CCQ A;  3LW5 E;  3CCU A;  4A4F A;  4HT9 A;  2YHT A;  3OYN A;  4IUV A;  4JRK A;  1VQP A;  2MWP A;  3G6E A;  4OMF B;  4Y28 E;  4QQG A;  4GY5 A;  3QHS A;  1QVG A;  2RB6 A;  1X6O A;  5LJ5 j;  4RCC A;  4L5G A;  1VUB A;  5GAM h;  5CKB A;  4EMG A;  3JB9 G;  5GMK j;  1U1S A;  4PJO D;  3FEO A;  2E10 A;  3X20 B;  2M9U A;  2PVD B;  2VGM A;  2VXF A;  2F5T X;  2FL7 A;  2HBP A;  2QI2 A;  4WF2 A;  3V8L A;  4ZGJ B;  3G71 A;  3HSB A;  3X28 B;  3JRZ A;  3CC4 T;  1OZ2 A;  1X75 C;  2DTO A;  4FIB A;  4C5E A;  1VIE A;  5IAY A;  3JSC A;  3A8G B;  3J81 E;  4BY6 B;  3RES A;  3G4S A;  3CCR T;  1MGQ A;  4M77 F;  4PJO F;  3SWN C;  4C0D B;  2P0K A;  3P8B B;  4M78 E;  2V8J A;  3T9N A;  4BI4 A;  5LJ5 f;  2CZ0 B;  3TU4 K;  4XQ3 A;  3HFN A;  4XAX B;  3V8J A;  4FL6 A;  1NZ9 A;  3JB9 I;  3GP8 A;  2RHI A;  4C92 B;  2HAX A;  3L2U A;  5AYF A;  2YLC A;  3QG1 A;  3MHX A;  5KCH A;  4L59 A;  4M7A G;  2QQA A;  4KT0 E;  5D6X A;  3CCU T;  3OYE A;  4J7F A;  4M77 E;  1ZQ1 A;  1G3Y A;  2DEQ A;  1S72 T;  3G4S T;  2EWN A;  3DB3 A;  3MEV A;  3M54 A;  4M7A C;  4JDS A;  3UDC A;  2I2L A;  3CD6 A;  3X26 B;  4M77 D;  4PL6 A;  5LJ5 e;  2CGH A;  2QEX T;  4BDY A;  3OBW A;  1H3Z A;  3Q1J A;  5DM7 R;  2CZ6 B;  5CQX A;  2OAU A;  2HQX A;  3UWN A;  4M7A D;  4ATO A;  1JJ2 S;  3E9G A;  3OBY A;  3L2V A;  4UC4 A;  4M7D F;  3S3N A;  3CCV T;  2LQK A;  3QDR B;  4II1 A;  4A4K A;  1YI2 T;  3HRS A;  4PLI A;  2E64 A;  1UB4 A;  2EJ9 A;  2ZZD A;  3EFR A;  3M9Q A;  3MP1 A;  4C92 F;  3VKI A;  5GAM j;  3L2Q A;  2P0P A;  2R5M A;  3JCM X;  1YIJ A;  4C8Q F;  2AHJ B;  5CKF A;  3RKY A;  1JBM A;  1YJ9 A;  1Q82 C;  2QXF A;  3H8Z A;  2CYZ B;  5GAN 4;  2XG8 D;  3SD4 A;  4BE1 A;  1M1G A;  3LX7 A;  3RKW A;  4ELZ C;  3CCJ A;  2WSE E;  1UGR B;  3WVE B;  3ZFJ A;  1Q86 U;  1VQ6 A;  1RI0 A;  2QQB A;  2H3J A;  2HNI A;  1U1T A;  2MWO A;  4MZT A;  4A4E A;  3RMQ A;  2PVG B;  2M1H A;  1LOJ A;  2WSC E;  2DZC A;  2RK1 A;  1XQH A;  1DJ7 B;  2RI3 A;  4FM4 B;  4M75 C;  3JB9 F;  4EDU A;  5A0G A;  2OTL T;  5FU6 C;  1PSE A;  3R6O A;  4XTW A;  5GAN 8;  4GLK A;  1MHN A;  3CCJ T;  4C8Q D;  2E1H A;  2GFA A;  3QBY A;  4XTZ A;  3CPW A;  4HCB A;  2F69 A;  1NJI U;  2EIF A;  4O6J A;  2K5I A;  3HP9 A;  3LGF A;  5CKH A;  2QQ9 A;  2O4X B;  2XI9 A;  3L42 A;  2JTF A;  5FU7 C;  3OS2 A;  1K9M C;  2XU8 A;  4KUD K;  2O01 E;  5CR2 A;  3GLX A;  4OVA A;  3CMA A;  2OTJ A;  3JB9 J;  4M7A B;  2RK2 A;  2RHY A;  4L6V 5;  3KUF A;  1KQS S;  4OP0 A;  2KSS A;  3LGL A;  1VQO T;  2EQM A;  3LWH A;  2Y90 A;  5D6Y A;  1NJI C;  2VV5 A;  3JCM f;  5C0M A;  4IUQ A;  4ZGD B;  3L2R A;  2RD1 A;  1M1K U;  2EYQ A;  3CPF A;  5CCA A;  1BI2 A;  1WJR A;  1O75 A;  2LT1 A;  1JB0 E;  3HL8 A;  3I56 T;  2M16 A;  2E70 A;  4QQ6 A;  5CO7 A;  3L2Z A;  4A4G A;  4F7U G;  4IUU A;  2MI6 A;  4A53 A;  4NL2 A;  3ZEH A;  1YI2 A;  2K5L A;  2LDM A;  5KE3 A;  3PIO A;  4RG8 A;  3PMI A;  4ME7 A;  3TEE A;  4A54 A;  3QUI A;  4OF1 A;  3SWN B;  5GAM g;  2VGN A;  4J6Y A;  3A8H B;  3FB9 A;  3QXE B;  1N27 A;  5LJ3 f;  3E9F A;  4E7K A;  3JCM d;  3LH0 A;  3CBM A;  3N5B B;  3O8V A;  3QPH A;  2VC8 A;  3OSV A;  5LJ3 h;  3VUB A;  1YIT T;  1W2B S;  3MEU A;  2EQU A;  4M7A E;  1YHQ T;  3CBO A;  2XHC A;  2XDD A;  1K8A C;  2L8D A;  3A8M B;  4JLI A;  4BD3 A;  2FHD A;  2MMP A;  3BW1 A;  2KQW A;  3M4Y A;  4JUV A;  4MDW A;  3VYG A;  3I55 A;  2C06 A;  4C0F A;  5LJ3 e;  2ZPF B;  3G71 T;  4JRQ A;  1U8R A;  3CCE T;  4M7D E;  3SWN A;  4PJO E;  2QQS A;  2IG0 A;  2D9T A;  3DKM A;  4M78 F;  1VQ5 A;  4ZN1 A;  3CCL A;  4LDX A;  1QVG S;  3QSU A;  1D3B A;  1WJQ A;  3M57 A;  4LD9 K;  4C5H A;  1G3W A;  2X4Y A;  4OB1 B;  3CCM A;  4F7U F;  2WAC A;  5HY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...