4R56A

Crystal structure of sulfolobus cren7-dsdna(gtgatcac) complex
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
59
structure length
59
Chain Sequence
SSGKKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromatin protein Cren7
publication title Insights into the interaction between Cren7 and DNA: the role of loop beta 3-beta 4
pubmed doi rcsb
source organism Sulfolobus solfataricus p2
molecule tags Dna binding protein/dna
total genus 7
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11520 Cren7 Chromatin protein Cren7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.610 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4r56A00
4R56A 3LWIA 3KXTA 3LWHA 4R55A 2JTMA
chains in the Genus database with same CATH superfamily
4F16A 3JB9D 2DD5A 4JDSA 1X2KA 3QJ6A 4IKFA 4JJCA 4RG2A 1BBZA 1OV3A 3M59A 1OEBA 4KGVB 3CPFA 1VQOT 4N0AA 1YN8A 4J9CA 3L2QA 1R77A 4M78C 2JJ9A 2P0QA 3X24B 3HL8A 2V8JA 4ME7A 1H8KA 3J81E 4FM4B 3IQLA 4JJBA 3QYGB 2J6OA 1WI7A 4B9WA 2HBWA 5A2QE 3TSWA 1WA7A 2JTFA 3CCEA 1YJNT 2K9GA 2E6ZA 3HSBA 3C94A 3UA7A 2A36A 2QQAA 1VQ4A 3GLXA 4KULA 4DEYA 1I07A 3I5SA 4RTTA 2XDBA 3V8LA 3GIBA 4M77C 4OB1B 3X25B 3TSZA 5IXBA 5HK3A 3OSSC 2FZCB 2LMJA 2M51A 1KJWA 2GF7A 1YJWQ 2QEXA 1QCFA 1U5SA 1IREB 2R5MA 1WHMA 2V1RA 2DL8A 3PMIA 4KGZB 4KRTA 2F5KA 4KBMB 3M0RA 2XK0A 3BFMA 3M58A 1IXDA 1GRIA 2DNUA 2QA4A 5FU6C 1RAGB 5KCOA 2EGEA 1W2BS 4KH1B 4LNPA 1UUEA 2KVQG 3OB9A 4EDUA 4F7UG 2FEIA 3UT1A 2QG9B 3V8JA 2XHCA 4WCIA 4OB0B 2ZAEA 1UJ0A 2QQBA 3OQ5A 1VQ5Q 1G5VA 4KH0B 2RQTA 4RMOA 1TOVA 4BDZA 1VYTA 1ZSZB 2ROLA 2A7YA 2X4WA 4XTZA 1ZQ1A 2YDLA 1W4SA 2JOYA 3VYHB 4C5HA 5CKEA 1LJOA 3DKMA 2OAUA 4QQGA 3G1JA 2CDTA 4F7UB 1VIFA 4C0GA 5LJ3e 3L2VA 1MV0B 3CC4T 5GAOr 4WTOB 2CZ1B 1PKSA 4DBHA 5I22A 3OYAA 1M5Q1 4M7AG 2CUDA 3FIFA 3ULRB 1MMAA 1YIJT 1GBRA 5J26A 4J8OA 4Z89A 2GFUA 4M7DC 1KIKA 2QAZA 2ZCFB 1IHWA 3SB2A 2DMOA 3GOXA 1G3TA 2M1HA 3EG0A 4ELZC 1KQ2A 1Y7XA 2D9TA 2LJ3A 1D0ZA 2F2VA 2XKOC 2A0FB 4EMKA 3CCRA 2X4XA 5GJWB 2EPDA 4PFZA 4M7AB 1I5OB 3UPUA 5LJ3j 2FG0A 3S3MA 4QW2A 2P4RA 1R0CB 2HKNA 4ZNXA 5HKCA 1S72T 2VB6A 1HD3A 2K5FA 3SDZA 5KE2A 3AHUA 2P0PA 2BKDN 2CP7A 4MZMA 2EQUA 1MMGA 2O88A 2LJ1A 4KUIA 1VYUA 3EGUA 3CC2Q 1M2VA 1QVFP 4OP0A 5HCKA 4ATOA 2DYBA 2BE7D 3CMAT 3CCJQ 3CCSQ 4ZTFA 8ATCB 2JTEA 2YRVA 2I0NA 2JM8A 1QVPA 1UDLA 1Q81R 3VKIA 4IIOA 4GLKA 2NUTA 4C92C 4JRIA 3SWNC 5FWBA 3RDVA 3PIPA 1G3YA 3MCAB 2EYXA 2ABLA 4IUQA 4P5NA 4CI0C 1YI2Q 2PQWA 3NGPA 4Z02A 5GAOq 2MWPA 5GAN5 4AG1C 2AKKA 2YLCA 3LWIA 1WXUA 2KBTA 3JCMe 1PG5B 3OA6A 4M75E 3CMEQ 4M7DE 1KD1R 2LNHB 4GBQA 4PJOA 2P0KA 4E7LA 1YJ9T 2XG8D 3PVQA 3CCLA 1O9SA 2DXCA 1A0NB 1UG1A 1JEGA 4XTYA 2EJFA 1BI3A 3M4YA 4FSSA 2KYBA 3NTHA 2EJGA 1AWWA 4PK4A 3I56A 1YHQQ 4FU6A 1B7TA 3OYGA 5FU7B 1OZ3A 2XDDA 2X51A 3G4SA 1M1KR 2DVEA 1AWOA 2MCNA 3EFSA 4OVAA 1OQKA 2ZPEB 1NBEB 3QHSA 4RTUA 1AHJB 2CH4W 2DJZA 4C8QG 1QKXA 1UECA 1VQPT 1QKWA 2YRCA 1UGQB 3OS5A 3UATA 4DBQA 2FZGB 6AT1B 4IIMA 3JCMP 2CT3A 4XK8E 2HL3A 1K9MR 5GAOm 2F5TX 3THKA 2CZ7B 2IVWA 2LX7A 2MIOA 3PMTA 4C92E 2Y90A 3H0IA 2KY9A 4C8QB 1NG2A 3FB9A 3OYNA 2LP5A 3OBWA 2HD0A 2CP6A 3ZL7C 1YITA 5I2MA 2P84A 1AEYA 1GCQC 1XJWB 1VQOQ 5A0GA 4PJOD 2O31A 4J6WA 5L8RE 2ED1A 3EAEA 4B9XA 4M78F 2J05A 3HFNA 1K1ZA 3OYJA 1X75C 1PKTA 4OMFB 1V29B 1YJWA 3JCMd 1CKAA 3EG2A 2DD4A 1BU1A 1SHFA 2QTXA 2IIMA 1QVGS 1M2OA 2WSCE 4RCBA 3EG3A 3NTKA 3JCMg 2LCSA 4AG2C 4PLLA 3CCVA 1LPLA 1ZSZA 1YJNQ 3OYCA 2CUBA 4OMNA 2CSIA 4PFOA 4CC4B 3QUIA 1Q7YR 1KC8C 2PNIA 4F7UA 4ELYC 2SRCA 1JXMA 1AOJA 4M77F 2XDPA 3F70A 4GY5A 2D6FA 2LRQA 2Y4XA 3CXCS 1SG5A 1HK9A 1VQ5A 4FYXB 1X2QA 2EYWA 4RTZA 4JZ4A 3C12A 3R6OA 2ROTA 2HL5C 4RUGA 2RHXA 4CC7A 3A98A 1K0SA 2DIGA 3QJYA 3Q1JA 1K8AU 2DRMA 4XTWA 1VQMA 2LTOA 1JB0E 2QDLA 4J9IA 4FW1A 4A63B 3LGLA 2DFUA 1J3TA 2L3RA 1MGQA 1KFZA 3M57A 1Q95G 3QIIA 5I11A 3BW1A 2X35A 1PWTA 2DEQA 3VUZA 4M7AA 2HMAA 5CKHA 3OW2S 3ASKA 5EC7A 1WHKA 1BIBA 5LJ5f 3J80E 4OMMA 1WHJA 1NE8A 2J06A 2DM1A 1BKBA 1M9SA 4BI4A 1UGVA 4OGEA 2QQ9A 2X4JA 2JVVA 4YTLA 2GTJA 2RJCA 4ANJA 3CC4Q 2HNIA 3BDLA 4C0DB 2RQVA 5GAMf 2RQWA 1UGPB 2JXBA 3S3NA 1KHCA 2QASA 2Z0WA 5GAOn 2DYIA 3ZFJA 3E9FA 1YIJQ 1D1AA 2NUPB 3MHXA 2YXYA 2RNAA 4M77G 2EJ9A 4M7DF 5I21A 5LJ3f 2XD0A 3RNJA 4N0AC 1YI2T 1UEBA 3VS3A 1QQJA 2VVKA 3SHWA 1KHIA 2CP2A 3V7RA 1YNZA 1UHCA 2KQWA 1EFNA 4IUTA 3L2WA 3KUFA 3CC2A 1OYXA 3CCJA 3CCSA 2K79A 2FVUA 3QSUA 1RAAB 2E1HA 3JSCA 2K7AA 1OPKA 1RAIB 1VQ7A 1GBQA 4OMQA 3EFOB 1WYXA 3QDRB 5CR2A 4DA4A 4X9CA 3JB9I 2KYMA 3I55T 3LYIA 3FRNA 1Z9QA 2FYKA 3VUBA 1PC0A 1W2BA 1G83A 1YWPA 2DILA 5KYYB 4IUVA 5LJ5h 3OYFA 1H92A 2RJEA 2RHYA 2LQNA 3CMAQ 4R0KA 2L89A 4A4EA 3M0PA 4JZ3A 1BI0A 3HTRA 2GTOA 2E12A 2HSPA 3TCJA 1GXIE 2FL7A 4UC4A 3EHQA 4X34A 1M30A 4C92F 5CKDA 2CSQA 3S6WA 2JUFA 5GAOp 4J9HA 2E6NA 3CCUA 5GMKe 2D0NA 1HJDA 1S1NA 5GANe 4EMHA 4KUDK 1YHQA 5LJ3h 2DETA 3S3OA 4M75G 3QPHA 3R6NA 4M7DG 2CH4A 5A0LA 5KH6A 1VQ9T 4C8QA 4OMOA 2L2PA 1YJ9Q 3G6EA 4FT2A 1JXOA 4VUBA 1RL2A 2BE9B 1EIFA 4JPBW 2DTHA 4E7ZA 1T0JA 2YWWA 4A4FA 1Y71A 1TS9A 4DBRA 2ECZA 1WXTA 3NMZC 2DERA 4M75B 4M7DB 4V2SA 4JS4A 3TU4K 1VQNT 2DKGA 2LX9A 5C6SA 1QVGP 3OYLA 5GMKj 1C6VX 5L23A 2E3IA 5GANj 2LQ8A 3WXMB 1VQPQ 2K6DA 4E7KA 3VJPA 4X1VA 2L8DA 2K57A 2DE0X 1AWXA 1ZHIA 4N4IA 2KT8A 4JLGA 1TTHB 3KFVA 2DXBA 1VQOA 1SPKA 2ZPHB 2QXFA 1PSFA 4PKCC 4HVUA 4BUGA 2J6KA 1Q82R 2KRNA 3CXCP 5IT9E 4C92G 2CS7A 2XMFA 4F17A 1WXBA 3FDRA 5D6YA 1D09B 4C5GA 4MMKA 4MZPA 1M8VA 1JJ2A 3D7SB 2E64A 3L1AA 3GP8A 5KCHA 4EPCA 3UDCA 5GMKl 4C5EA 3M55A 1TUDA 3E19A 2VYTA 3MKDA 2FPFA 4C92B 1MV3A 2ZPIB 4C0FA 5GANd 5D7UA 2MI6A 3OW2P 3P8HA 2H8HA 3EH1A 1X6GA 3H41A 1MHNA 3VS1A 2ZPBB 3C4SA 5GANg 1D3BB 2F1LA 1QP3A 1BCMA 2D0QB 1X43A 1RI9A 1QMCA 4M78E 3HRUA 4A54A 2EQIA 3VRYA 3X26B 3CEYA 1MNDA 1SEMA 1SKUB 3EHRA 2QI2A 4XTUA 3JB9F 3A8OB 3LH5A 3PTAA 4QQDA 1HXDA 3EGXB 3I5RA 2IPOB 2O01E 1YCSB 1N27A 1EZZB 4J9EA 3UA6A 2DL5A 4LDVA 1NLPC 4FCYA 3H0FA 1UJYA 4PJOC 4DBFA 4J9GA 3OYHA 3CCMA 1WGSA 1MMNA 2HAXA 5CVIA 1B34B 2NUPA 4M77E 3JB9H 1ZSGA 2BIVA 2LQWA 2RHZA 1OI1A 1SSFA 4HCKA 1QP2A 1RI0A 2KT1A 1OU8A 2P4TA 2QYZA 4RTVA 1VQ6T 4BY6B 1SRLA 3CPWP 3CC4A 1W6XA 4ZN1A 2M0YA 2DA9A 3A1PA 3RIRA 1NJIU 4RTWA 4HA8A 2OTJT 4IURA 4A4HA 3L2ZA 1FXXA 3OS1A 3JCMJ 2K5IA 1KG1A 1WJQA 4BB7A 3EFOA 3UF4A 1JQQA 2G3RA 2EYQA 2KK4A 3JB9J 4E7SA 1M90U 1KD1C 1VIEA 3OYIA 3G71T 1Y0MA 4LDWA 2LVMA 2GBQA 2KDSA 1SHGA 5KYYA 3JCMQ 2RMOA 1KQSP 2CP5A 2COZA 1G3WA 3REAB 3JCMW 3H6ZA 4L6V5 3QXEB 8AT1B 1RLPC 2DEUA 2ZZDA 2DXTA 4R56A 1UFFA 1IGQA 3JB9G 1NJIC 2CYZB 2JS2A 1RADB 4JUVA 2J7IA 1QW1A 4J6YA 3PT9A 2CZ6B 1S72A 5CKFA 2EWNA 4HT8A 2XIDA 5GMKi 1U8RA 4AFZC 2KGTA 1M90C 2HEQA 1UGSB 2M9UA 3A8GB 4ZGDB 2KROA 1YWOA 3ZBDA 1JRIA 2D1XA 2CP0A 5GAMd 3CMAA 2M16A 3FEOA 2FRWA 1E6HA 1U1SA 2SEMA 2JS0A 1BIAA 1ZSZC 3CD6A 1KK7A 2PUKB 3DB4A 5CIUA 1VQKA 1X6BA 3I55Q 1WDXA 2LCLA 2DF6A 1I1JA 1I0CA 2DAQA 2OTLQ 4JRPA 1VQLT 4J7FA 2XI9A 2DBKA 4RTYA 3OMGA 4M75A 4BE2A 4M7DA 2LJ0A 1I81A 1W70A 2GQVA 1IO6A 1FMKA 4RKUE 1WHGA 2BZXA 2JZ2A 2CP3A 2JT4A 5AYFA 1NM7A 2DJQA 1OULA 1WHHA 1YJ9A 1G2BA 1Q7YU 1OX8A 2JNGA 4HCCA 2EBPA 2EQJA 3CC7Q 2OJ2A 2K3BA 1M8MA 3OSVA 1AD5A 1TXQA 4IUUA 1T3LA 1YITT 1D0YA 5FROA 3HHTB 2IG0A 2JW4A 2AIRB 4M7AC 2DL3A 1VQ9Q 3META 4XU0A 2EAYA 2LNVA 1PD1A 3EG9B 4IUPA 1Q7YC 2DZ9A 3NTIA 1B3QA 2YLBA 3JCMc 1TU0B 2K3XA 1AT1B 1E6GA 4PL6A 1KC8U 1LVKA 4HT9A 2FPDA 1NLOC 2B8AA 1QWEA 1FWZA 4HCZA 1SF9A 4HVVA 2X9HA 1ARKA 1VQNQ 4C92A 3TQ7P 2L3QA 2NWMA 4R55A 1C0MA 5J39A 1VQ4Q 2FPEA 2OX7A 1H641 2B86A 2RO0A 1M3CA 1AZEA 2X3WD 4EIKA 2E4HA 2OAWA 1D3BA 4M75D 3HRSA 4BE0A 3QWXX 1Q86U 1XNIA 2BUDA 2RF0A 1H3HA 3G7ZA 1ZBXA 2NUZA 2QTVA 2L0AA 2VGMA 2YHTA 3EGXA 1IGUA 4K11A 2LCCA 2FB7A 1CSKA 2D8JA 2EIFA 2COWA 1QVFA 1Y96B 1ACMB 3VS5A 3CCQT 3QG1A 2K4YA 1MNEA 5IHIA 1M1FA 1V76A 1B34A 3CBMA 4J6XA 2PVGB 5IAYA 1I8FA 1WNLA 1Q86C 4CC3A 1K73U 1HSQA 2EKOA 3RESA 5GMKh 2VGNA 3H0HA 2RQRA 3PE0A 1WHLA 1K4US 5FU7C 5HY6A 3OYDA 4L5GA 2FO0A 2L3SA 5LL6S 5GAN8 3QZ5B 3OMCA 1RAEB 4J9BA 2LZ6B 2D8HA 3C0CA 4M78G 1V1CA 4J9FA 1MMDA 4FSXA 2RQUA 3E1SA 2HDAA 5GAN2 1K73C 4BD3A 1PD0A 1D1CA 2AZVA 3OYBA 4J7IA 4JJDA 1QCNA 3CQTA 1CKBA 3VS6A 2Y4YA 4C8QC 1PRLC 5AT1B 1NZ9A 4M78B 1KQ1A 3PIOA 5FLXE 4PJOF 2LC4A 1IZ6A 3LX7A 3OYYA 3KBGA 5GAN7 4F14A 3M56A 4OMLA 3C95A 9ATCB 5ECAA 2K2VA 4XU2A 1I4K1 1VQ7T 1WJRA 3RBBB 2AT1B 3RKXA 3LH0A 2GGRA 1M3BA 3OYEA 4D8DA 4BACA 1N8RR 1VQ6Q 1VQ8T 4BI8B 1SSHA 2WSEE 2JMCA 1JO8A 3CPWS 2A28A 2OTJQ 2VUBA 4L59A 2VV5A 4M77B 1OX9A 2A37A 3A8MB 3LLRA 1QCOA 1BCOA 4F04B 2J6FA 4M7AD 3VU3C 1K8AR 1BK2A 5FRNA 1YI2A 2DTOA 2OTLT 2YUNA 4Y91A 3G71Q 4BI3A 1FMVA 5FU6B 4XTXA 1MUZA 3INZA 1TUCA 5M9OA 5DM7R 1WPYA 4NL2A 2F2WA 1M4ZA 2AK5A 1X69A 2DTIA 2MK5A 2MWOA 2W10A 3VS4A 3MEAA 1KQSS 3CMEA 4II1A 2E3HA 4LDUA 2RI3A 1XQHA 2KNBB 4OB3B 4QQ6A 1FMWA 3CC7T 1F1BB 3I55A 1K9AA 2JMAA 4PLIA 1P92A 2E10A 3V7CA 2C0TA 3G6ET 2PUOB 3VYGA 1RUWA 2JN0A 2EQKA 2DK3A 3ME9A 1UB4A 2CGHA 3E2UA 1D1BA 2BZ8A 1GFCA 2KE9A 4MDXA 2COYA 4TVRA 3JV3A 1X6OA 2O9VA 2KAFA 2ED0A 2QDYB 3HKSA 5FW9A 3I56Q 1HYOA 4Y92A 4AFSC 2ATCB 1QWFA 4NL3A 3EG9A 4AT1B 4MZTA 4HKEA 3JCMf 5KE3A 3SD4A 7AT1B 1TH7A 4B6MA 1VQLQ 4F7UF 3O8VA 3M5AA 1BB9A 3CCET 1RABB 4C0DC 4QT7A 3TVTA 1VQ4T 2ZGWA 4BDYA 5GAN4 4DQ2A 1VQ9A 1WLPB 5DY9A 2VC8A 2QGFB 2GNCA 3LWHA 2QEXT 1M3AA 4CC2A 3RKWA 4PJLA 3V7SA 3MPUB 5GAN6 1GCPA 2HQEA 2EFIA 2QA4T 2X4YA 2MOXA 4JJNK 1ABOA 2PVOB 4A4GA 4EMKC 4FYYB 1YITQ 2KRMA 1Y07A 1VQNA 3M9QA 1WZOA 1U3OA 5KYUB 4M7AF 1UTIA 2R5AA 1Y96A 1XTDA 3GPLA 3BE3A 2DLPA 1VA7A 2M0OA 5GAOl 1YJNA 1ABQA 1ZA2B 4EMGA 3QO3A 4C8QD 1RLQC 2KEAA 2RK1A 3VV0A 1UHFA 1RACB 3SWNB 3CCVQ 3JCMh 1IB8A 3HP9A 4OMPA 1GFDA 2PVDB 1EX4A 3JCMb 4PJMA 3X20B 5LJ5e 2XU8A 3SEMA 3VS0A 4NS5A 1ZUKA 2L3PA 3GNFB 1WQ7A 2BTTA 1NPPA 3A8LB 2C06A 1AZGB 2FZKB 3ER0A 4HVWA 1Q81U 3EH2A 3L2RA 5DLOA 2EGAA 1WX6A 4RTXA 2E5QA 3CCMT 4LDXA 5GAMe 3RUXA 4X9DA 2CZ0B 5DLQE 2M02A 3M0SA 2V8KA 2VXEA 2YRDA 2E70A 1VQMQ 2YUQA 2RPNA 3CCQQ 1RAHB 2OI3A 3CBPA 4M78A 2RB6A 3CCRT 1TSFA 1PRMC 2RJDA 1BI1A 3L2UA 2GQIA 1KD1U 2GCXA 5LJ5j 2PZ1A 2AZSA 3NPFA 2HQHA 1Q81C 2HKQB 4Z8AA 2QQSA 3JCMX 3M0UA 3M54A 3LGFA 4M75C 2AHJB 4M4ZA 2RI5A 5KYXB 3URGA 3VRZA 1WFWA 2EGCA 2DXUA 1Z9ZA 4ZN3A 5GAMj 2YUPA 3OS0A 1YIJA 2MAMA 3MJXA 1PCXA 4M77A 1LNXA 5GAN3 1M1KU 3EGDB 3TEEA 1O75A 3N5BB 3RMQA 1TUGB 3OYKA 3HRTA 4FT4A 4LDYA 3PNWC 5HK0A 3WVDB 3DB3A 3M0QA 2R57A 3QYHB 1VQ6A 4ZGEB 4MMLA 2DO3A 2YT6A 2ESWA 4CRIA 4PFPA 4AFUC 4C8QF 3P8BB 4LE9A 2OTJA 5D6WA 5LJ5d 1K9MU 1QVGA 2VASA 2O2OA 2VXFA 4E7HA 4XU3A 1M1KC 2I2LA 2CKKA 4FYWB 5LJ5g 1N9SA 3PVLA 1JJ2S 1VQ7Q 4E2FB 4PJOE 4M78D 5C0MA 3WVEB 3G71A 3CCLT 2A08A 3J7AF 4C0ZA 3CD6T 1VQ8Q 2GFAA 1T3SA 1OPLA 1VQKT 4JLIA 3H9NA 4C5IA 2MPXC 3T9NA 1UE9A 3VS7A 2E65A 2RH2A 2A3LA 3CXCA 3A8HB 3I56T 5GAMg 4J5YA 2FHDA 4LD9K 3VS2A 3G4ST 1K9MC 1FYNA 4J9DA 2EYZA 5LJ3d 2EYYA 1M1GA 2E41A 1T0HA 1JU5C 4JRKA 4QVZA 4E7IA 4PJJA 3M4GA 2AKLA 3REBB 5LJ3g 3JCMV 4N4HA 4AFQC 4M77D 2F69A 3LW5E 4JS5A 5IHKA 5CQXA 2H3EB 4BE1A 3PGGA 4DOWA 1FX7A 1NJIR 3CCUQ 3A5ZB 1PSEA 2LQKA 3MO8A 4ZTJA 3OW2A 2HSEB 3FC3A 4RCCA 5D6XA 2O4XB 1N5ZA 2G6FX 5KYWB 2DL7A 2CREA 2V26A 3GBQA 5CK9A 1TWBA 1M90R 5EG2A 3G6EQ 1IRXA 2W0ZA 1VQLA 4AMCA 3OY9A 3OYMA 4BY6C 3BDUA 3MP8A 3FJ5A 1ZA1B 1NYGA 1WQWA 1RAFB 5KYUA 5GMKm 1IHVA 4PJNA 1VQPA 2MYSA 5CQYA 3QZ9B 3U23A 1VOMA 1DJ7B 1G8XA 1YJWT 5GJVB 2DL4A 1X27A 5GANf 4E47A 4DOVA 4RG8A 2KXCA 3JAME 3GNGA 3I9QA 3CCVT 1W1FA 1W2BP 3HPWA 3CCEQ 3EG1A 1GL5A 4GLMA 3SWNA 1LCKA 1VYVA 4J83A 1UGRB 3OS2A 1YP5A 2LT4A 3CPWA 4OB2B 3TREA 4E6RA 1R8OB 2HZYA 1WIEA 4F7UE 2QEXQ 4M7DD 1ZBJA 2EKHA 4NOYA 1VUBA 2QK0A 2C0IA 4O6JA 1VQ5T 3V8KA 1ZX6A 2H3JA 2QA4Q 4ORZA 3OBYA 2C0OA 2KXDA 3MEVA 4QKUA 2RA2A 2HCKA 2PTKA 1NPRA 3NHNA 3RKYA 1E7OA 1VQMT 3E9GA 4OGCA 1KQSA 3CBOA 3QWYA 2DBMA 1G3SA 2EVRA 1N8RU 2KSSA 2K2MA 1AVZC 2EQMA 4DEXA 2XICA 4KGXB 4M7AE 3FLGA 2DVJA 2NLUA 2HQXA 4FYVB 3RERA 4PNOA 2KMTA 4FIBA 2BZYA 2DRKA 5GANh 3P8DA 2JM9A 2ENMA 4KT0E 4FW2A 3O5ZA 5A0DA 1TG0A 2RD1A 5KYXA 3RMSA 1M27C 4LD6A 2L5QA 4Q5WA 3CCQA 4XQ3A 4C92D 2RJFA 2HBPA 2V1QA 3MEWA 1XOVA 4FL6A 1N8RC 3I35A 2EW3A 3H8ZA 3QBYA 1U06A 1YBYA 3EGDA 1KC8R 4Z88A 2WSFE 3ZEHA 4HCBA 1JBMA 4XTVA 3CCMQ 3L42A 2JTMA 2R58A 5CKBA 2QGGA 1AWJA 3HFOA 2RHUA 3MEUA 3DLMA 2RI2A 1Y57A 2ZPFB 4D6WA 1GCQA 2V8IA 4ZGJB 1K8AC 5IXFA 1ZUUA 3CC2T 3CCRQ 1H3ZA 1K0XA 3CCJT 3CCST 1JJ2P 1U1TA 1Q86R 1X01A 2NYSA 2VWFA 4O5VA 1KSWA 1SRMA 2O9SA 2YSQA 4WF2A 4LN2A 5FWCA 2RM4A 4A53A 2ZPGB 3MP1A 2RN8A 4M75F 1LOJA 1YCYA 3KXTA 2DPPB 3RR6A 1R0BG 3PFSA 5IHNA 2YUOA 2K3YA 4EMKB 3QKJA 2RK2A 3JRZA 3X28B 5I2SA 3BY7A 4XAXB 5FRMA 3CMET 2DIQA 2KI7A 1K73R 1NEGA 4LXCA 1OOTA 4LUDA 1VQ8A 1WJSA 5KYNA 1S72Q 2KRSA 4N4GA 3EFRA 3GF5A 2DX1A 3AT1B 2F2XA 1PNJA 5CO7A 3CCUT 1M2VB 4D8KA 5CCAA 2FRYA 1YFNA 2DZCA 1YHQT 1PM3A 4OF1A 2VKNA 1OU9A 1Q82U 1OZ2A 4JRQA 4ESRA 3FJPA 1QVFS 2O4XA 1N6AA 1NYFA 2PU9B 2NUTB 5J3BA 5KYWA 5CAIA 3DLLA 2E5KA 4C8QE 4PJOG 4LUEA 2OTLA 2MF2A 3CCLQ 2LT1A 4HXJA 1QLYA 2X3XD 3CD6Q 4MDWA 5GAMh 2CT4A 1VQKQ 2LDMA 3M53A 1C1AA 1BYMA 1BI2A 1I5LA 4XU1A 2RHIA 3UWNA 1K76A 2QQRA 3NFCA 5IN1A 2MMPA 1NEBA 1B07A 3QDFA 1D0XA 2WACA 3SFMA 2K5LA 3G4SQ 4A4KA 4QVDA 4QVCA 2KR3A 4E7JA 1ZLMA 1Q82C 1ZUYA 1PHTA 3CC7A 5IH2A 3MP6A 1N9RA 4Y28E 4PJOB 3M0TA
chains in the Genus database with same CATH topology
2JNGA 3L2UA 3ASKA 4HCCA 3JB9D 1KD1U 2EQJA 1BIBA 2GCXA 5LJ5f 5LJ5j 2DD5A 4JDSA 3J80E 3OSVA 1NE8A 1Q81C 3QJ6A 4IKFA 2QQSA 1BKBA 1M9SA 4RG2A 3JCMX 4BI4A 3M54A 3LGFA 4OGEA 4M75C 3M59A 2AHJB 2QQ9A 4IUUA 2X4JA 2RI5A 1YJ9A 2JVVA 3CPFA 1VQOT 4N0AA 1YITT 4YTLA 3URGA 5FROA 3HHTB 3L2QA 2RJCA 2IG0A 4M78C 2HNIA 3BDLA 4C0DB 2DXUA 4M7AC 2P0QA 4ZN3A 5GAMf 5GAMj 3X24B 1UGPB 3HL8A 2V8JA 3S3NA 3OS0A 1KHCA 1YIJA 2MAMA 3META 4ME7A 3J81E 4FM4B 4XU0A 4M77A 2EAYA 1LNXA 5GAN3 2LNVA 5GAOn 3QYGB 1M1KU 3ZFJA 3E9FA 4IUPA 1Q7YC 3TEEA 1O75A 2DZ9A 3N5BB 3NTIA 3MHXA 3RMQA 3OYKA 2YLBA 3JCMc 4B9WA 2K3XA 4M77G 2EJ9A 4M7DF 5A2QE 5I21A 5LJ3f 2XD0A 4PL6A 1KC8U 4HT9A 3HRTA 4FT4A 2JTFA 3CCEA 4LDYA 3PNWC 4N0AC 1UEBA 5HK0A 2E6ZA 3WVDB 1YI2T 2B8AA 1YJNT 3HSBA 1FWZA 3DB3A 4HCZA 2R57A 3QYHB 3C94A 1VQ6A 4ZGEB 4MMLA 2DO3A 1KHIA 2QQAA 1VQ4A 3GLXA 3V7RA 4CRIA 4KULA 4C92A 2KQWA 4IUTA 3L2WA 3KUFA 3CC2A 2XDBA 4R55A 4C8QF 5J39A 3V8LA 1OYXA 3P8BB 4M77C 4OB1B 3GIBA 3X25B 5HK3A 3CCJA 3OSSC 2OTJA 1H641 5D6WA 5LJ5d 2GF7A 3CCSA 1K9MU 2QEXA 2RO0A 2FVUA 3QSUA 2E1HA 1QVGA 1IREB 3JSCA 2R5MA 3PMIA 1VQ7A 2VXFA 1D3BA 4E7HA 4XU3A 1M1KC 2F5KA 4KBMB 4M75D 2I2LA 2CKKA 2XK0A 3BFMA 1N9SA 3M58A 5LJ5g 3HRSA 4BE0A 1JJ2S 3QDRB 5CR2A 2QA4A 1XNIA 4DA4A 4X9CA 5FU6C 3JB9I 1Q86U 5KCOA 3I55T 3LYIA 4PJOE 3FRNA 4M78D 5C0MA 3WVEB 3G71A 2FYKA 3CCLT 3J7AF 4C0ZA 1W2BS 3CD6T 3VUBA 2GFAA 2BUDA 1W2BA 3G7ZA 1ZBXA 1VQKT 4JLIA 5LJ5h 2VGMA 2YHTA 4IUVA 4C5IA 3T9NA 2KVQG 3OYFA 2RJEA 2LCCA 2FB7A 2RHYA 3OB9A 2E65A 2EIFA 2RH2A 2A3LA 4EDUA 4F7UG 3CXCA 3A8HB 3I56T 2L89A 3UT1A 1Y96B 4A4EA 5GAMg 1QVFA 4J5YA 3V8JA 1BI0A 2XHCA 3CCQT 2FHDA 4LD9K 3G4ST 1K9MC 2E12A 4OB0B 3TCJA 3QG1A 5LJ3d 1GXIE 2K4YA 2QQBA 1M1GA 2E41A 3OQ5A 2FL7A 4JRKA 1G5VA 4QVZA 4UC4A 4E7IA 4X34A 4C92F 1M1FA 4RMOA 4BDZA 1B34A 5CKDA 3M4GA 3CBMA 2A7YA 2PVGB 2X4WA 4J6XA 3S6WA 4XTZA 5IAYA 2JUFA 1I8FA 1WNLA 1ZQ1A 3JCMV 5LJ3g 1Q86C 1K73U 4N4HA 1W4SA 2JOYA 3VYHB 5GAOp 2EKOA 4C5HA 5CKEA 1LJOA 4M77D 3RESA 3DKMA 2F69A 3LW5E 4JS5A 5GMKh 2OAUA 2VGNA 2E6NA 4QQGA 3CCUA 5CQXA 5GMKe 4BE1A 5FU7C 4F7UB 3PGGA 5GANe 4DOWA 1Q7YU 1VIFA 5HY6A 4C0GA 4L5GA 1FX7A 4EMHA 5LJ3h 3OYDA 1YHQA 4KUDK 5LL6S 5GAN8 3QZ5B 5LJ3e 3S3OA 3A5ZB 4M75G 1PSEA 3QPHA 3L2VA 4M7DG 3OMCA 3CC4T 2LQKA 3MO8A 5GAOr 4ZTJA 3OW2A 2CZ1B 3FC3A 5A0LA 4RCCA 5D6XA 5KH6A 4M78G 1VQ9T 4C8QA 3OYAA 1M5Q1 2O4XB 4M7AG 3G6EA 4FT2A 3FIFA 5CK9A 4VUBA 1RL2A 1YIJT 5J26A 4J8OA 4FSXA 5EG2A 1EIFA 2DTHA 2GFUA 4M7DC 3E1SA 1VQLA 2ZCFB 3OY9A 4A4FA 5GAN2 1K73C 3SB2A 4BD3A 3OYMA 1Y71A 3GOXA 1G3TA 4BY6C 3BDUA 2M1HA 3MP8A 3OYBA 4ELZC 1KQ2A 4J7IA 4M75B 4M7DB 1Y7XA 4V2SA 4JS4A 1WQWA 2D9TA 3TU4K 1VQNT 2Y4YA 2DKGA 5GMKm 4C8QC 2LX9A 2XKOC 4EMKA 3CCRA 1VQPA 1NZ9A 2X4XA 1KQ1A 3QZ9B 4M78B 5CQYA 4PJOF 5FLXE 5C6SA 3PIOA 3OYLA 4M7AB 5GMKj 2LC4A 1DJ7B 1IZ6A 1YJWT 3LX7A 5GANf 5GANj 2LQ8A 3WXMB 3OYYA 3KBGA 4E47A 5GAN7 4E7KA 3M56A 3VJPA 2L8DA 2K57A 3UPUA 5LJ3j 4DOVA 3C95A 4RG8A 1ZHIA 3JAME 3S3MA 3GNGA 4N4IA 2K2VA 4QW2A 4XU2A 1I4K1 4JLGA 3CCVT 5HKCA 1S72T 1VQ7T 1WJRA 3HPWA 2K5FA 3RKXA 3LH0A 3SDZA 5KE2A 3OYEA 3AHUA 4BACA 2DXBA 1VQOA 3SWNA 2P0PA 2ZPHB 1VQ8T 2BKDN 2QXFA 1PSFA 4J83A 4PKCC 4MZMA 4BI8B 4BUGA 1UGRB 2EQUA 2WSEE 4KUIA 5IT9E 4C92G 3OS2A 3CPWS 2LT4A 2CS7A 4OP0A 3CPWA 4ATOA 4OB2B 3TREA 1R8OB 3CMAT 4F7UE 2VUBA 3FDRA 5D6YA 4ZTFA 2YRVA 4C5GA 4L59A 2VV5A 4M77B 4MMKA 4M7DD 3A8MB 1QVPA 4MZPA 4PJOB 4NOYA 1M8VA 3LLRA 3VKIA 1JJ2A 1VUBA 2E64A 3L1AA 3GP8A 4GLKA 5KCHA 4O6JA 1VQ5T 4EPCA 3V8KA 3UDCA 4M7AD 5GMKl 3VU3C 4C92C 2H3JA 5FRNA 3OBYA 4JRIA 4C5EA 3M55A 3SWNC 2DTOA 1YI2A 3MEVA 2OTLT 3PIPA 1G3YA 3MCAB 4Y91A 4BI3A 3E19A 2RA2A 5FU6B 4IUQA 4XTXA 3INZA 1NPRA 4P5NA 4CI0C 5M9OA 2VYTA 1WPYA 2PQWA 4NL2A 5DM7R 1M4ZA 4Z02A 2DTIA 4C92B 3RKYA 5GAOq 2MWPA 2MWOA 1VQMT 3E9GA 5GAN5 2ZPIB 3MEAA 4C0FA 5GANd 1KQSS 2YLCA 3LWIA 4II1A 3CMEA 4OGCA 1KQSA 2MI6A 3CBOA 3JCMe 3P8HA 4LDUA 3OA6A 4M75E 1G3SA 2RI3A 4M7DE 1XQHA 1N8RU 4OB3B 2KSSA 1MHNA 2EQMA 2ZPBB 3C4SA 5GANg 4QQ6A 1D3BB 1QP3A 2D0QB 2XICA 4M78E 3CC7T 4PJOA 2P0KA 3HRUA 4A54A 4E7LA 1YJ9T 2XG8D 4M7AE 3FLGA 3X26B 2NLUA 3CEYA 3I55A 2HQXA 3CCLA 3RERA 1O9SA 4PNOA 4PLIA 1P92A 2E10A 2KMTA 3V7CA 4FIBA 2DXCA 5GANh 3G6ET 2QI2A 3P8DA 2PUOB 3VYGA 4XTUA 4XTYA 3A8OB 3JB9F 2JN0A 2EQKA 2EJFA 3PTAA 1BI3A 2DK3A 3ME9A 4QQDA 1HXDA 3M4YA 1UB4A 4KT0E 2O01E 5A0DA 2CGHA 3NTHA 1N27A 2RD1A 2EJGA 3RMSA 3I56A 5CKHA 4FU6A 4LD6A 4MDXA 2L5QA 4LDVA 4Q5WA 1OZ3A 5FU7B 2XDDA 3OYGA 3CCQA 3G4SA 4TVRA 4XQ3A 1X6OA 2DVEA 2KAFA 2QDYB 3HKSA 4C92D 2RJFA 2HBPA 3EFSA 4OVAA 4PJOC 2ZPEB 3MEWA 3QHSA 1XOVA 1AHJB 4FL6A 1N8RC 2DJZA 4NL3A 4C8QG 3H8ZA 3OYHA 1WGSA 3QBYA 3CCMA 1YBYA 2HAXA 5CVIA 1VQPT 4MZTA 1B34B 2WSFE 4HKEA 4M77E 3JCMf 3ZEHA 3JB9H 4HCBA 1JBMA 2BIVA 1UGQB 2RHZA 4XTVA 3L42A 3SD4A 1TH7A 2JTMA 5KE3A 3OS5A 2R58A 1OI1A 1SSFA 5CKBA 3HFOA 2RHUA 1QP2A 1RI0A 4F7UF 3O8VA 3M5AA 3MEUA 3CCET 2P4TA 3DLMA 3JCMP 2RI2A 4XK8E 4C0DC 2ZPFB 4D6WA 1VQ6T 5GAOm 2F5TX 4BY6B 1VQ4T 2V8IA 2ZGWA 3CC4A 4ZGJB 4ZN1A 2CZ7B 2IVWA 1K8AC 3PMTA 3CC2T 4C92E 2Y90A 4BDYA 1H3ZA 5GAN4 4DQ2A 3RIRA 1VQ9A 1NJIU 2KY9A 4HA8A 4C8QB 5DY9A 3CCJT 2VC8A 2OTJT 3CCST 1U1TA 3FB9A 3LWHA 4IURA 2QEXT 4A4HA 1X01A 3OYNA 4O5VA 3L2ZA 1FXXA 3OS1A 3JCMJ 2K5IA 3OBWA 3RKWA 1KG1A 1WJQA 2HD0A 4BB7A 3V7SA 4WF2A 5GAN6 2G3RA 1YITA 2EYQA 2RM4A 2KK4A 5I2MA 2HQEA 2EFIA 2QA4T 3JB9J 4A53A 2ZPGB 2X4YA 1M90U 4JJNK 4EMKC 2PVOB 1VIEA 3MP1A 4A4GA 4M75F 3OYIA 3G71T 1KD1C 4LDWA 1LOJA 2LVMA 1YCYA 5A0GA 3KXTA 2KDSA 4PJOD 2DPPB 4J6WA 5L8RE 1Y07A 1VQNA 3EAEA 3JCMQ 4B9XA 3M9QA 3PFSA 4M78F 2K3YA 4M7AF 1G3WA 3HFNA 3JCMW 3OYJA 1X75C 3H6ZA 4L6V5 2R5AA 3QKJA 2RK2A 3JRZA 3QXEB 4OMFB 4EMKB 1V29B 2ZZDA 1YJWA 1Y96A 3JCMd 1XTDA 2DXTA 3X28B 4R56A 3GPLA 5I2SA 3BY7A 3JB9G 4XAXB 2DD4A 1NJIC 2CYZB 4JUVA 3CMET 5FRMA 2QTXA 2DIQA 2M0OA 5GAOl 1YJNA 1QVGS 2WSCE 4RCBA 3NTKA 1QW1A 3JCMg 4EMGA 3QO3A 4C8QD 4J6YA 2RK1A 4PLLA 3CCVA 3PT9A 2CZ6B 3VV0A 5CKFA 2EWNA 1S72A 4HT8A 3OYCA 2XIDA 4Y28E 1VQ8A 3SWNB 1WJSA 5GMKi 1U8RA 1M90C 4N4GA 1UGSB 2M9UA 3EFRA 3JCMh 3A8GB 3GF5A 3HP9A 4ZGDB 2PVDB 3QUIA 5CO7A 1KC8C 3CCUT 3ZBDA 1JRIA 4F7UA 4ELYC 3JCMb 5GAMd 3CMAA 5CCAA 2M16A 2XDPA 3FEOA 3F70A 4M77F 4GY5A 2DZCA 3X20B 4OF1A 5LJ5e 1YHQT 2XU8A 2D6FA 1Q82U 1OZ2A 4JRQA 1U1SA 4NS5A 2LRQA 3GNFB 1WQ7A 2Y4XA 3CXCS 1HK9A 1NPPA 3FJPA 1QVFS 1BIAA 3A8LB 2C06A 1VQ5A 2O4XA 1N6AA 2PU9B 3CD6A 2PUKB 3DB4A 5CIUA 5J3BA 5CAIA 3C12A 3R6OA 3DLLA 4C8QE 4PJOG 1VQKA 3ER0A 2RHXA 2OTLA 2MF2A 1Q81U 2LCLA 2LT1A 3L2RA 4MDWA 5DLOA 5GAMh 2E5QA 2DAQA 2DIGA 3QJYA 3CCMT 2LDMA 3M53A 4LDXA 5GAMe 3RUXA 4X9DA 3Q1JA 4JRPA 2CZ0B 1K8AU 1VQLT 4J7FA 4XTWA 2XI9A 5DLQE 1BYMA 1BI2A 1VQMA 4XU1A 2RHIA 2V8KA 3UWNA 1I5LA 2LTOA 2QQRA 1JB0E 3OMGA 3NFCA 5IN1A 2MMPA 4M75A 2VXEA 4BE2A 2E70A 3LGLA 4M7DA 1I81A 2L3RA 2WACA 1MGQA 2GQVA 2K5LA 3SFMA 4A4KA 4QVDA 3M57A 3CBPA 4RKUE 4QVCA 3QIIA 4M78A 4E7JA 1Q82C 2RB6A 3CCRT 3BW1A 2JZ2A 2X35A 2DEQA 3VUZA 4M7AA 3CC7A 5AYFA 3MP6A 1N9RA 2RJDA 3OW2S 1BI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R56 A;  3LWI A;  3KXT A;  3LWH A;  4R55 A;  2JTM A; 
#chains in the Genus database with same CATH topology
 4F16 A;  3JB9 D;  2DD5 A;  4JDS A;  1X2K A;  3QJ6 A;  4IKF A;  4JJC A;  4RG2 A;  1BBZ A;  1OV3 A;  3M59 A;  1OEB A;  4KGV B;  3CPF A;  1VQO T;  4N0A A;  1YN8 A;  4J9C A;  3L2Q A;  1R77 A;  4M78 C;  2JJ9 A;  2P0Q A;  3X24 B;  3HL8 A;  2V8J A;  4ME7 A;  1H8K A;  3J81 E;  4FM4 B;  3IQL A;  4JJB A;  3QYG B;  2J6O A;  1WI7 A;  4B9W A;  2HBW A;  5A2Q E;  3TSW A;  1WA7 A;  2JTF A;  3CCE A;  1YJN T;  2K9G A;  2E6Z A;  3HSB A;  3C94 A;  3UA7 A;  2A36 A;  2QQA A;  1VQ4 A;  3GLX A;  4KUL A;  4DEY A;  1I07 A;  3I5S A;  4RTT A;  2XDB A;  3V8L A;  3GIB A;  4M77 C;  4OB1 B;  3X25 B;  3TSZ A;  5IXB A;  5HK3 A;  3OSS C;  2FZC B;  2LMJ A;  2M51 A;  1KJW A;  2GF7 A;  1YJW Q;  2QEX A;  1QCF A;  1U5S A;  1IRE B;  2R5M A;  1WHM A;  2V1R A;  2DL8 A;  3PMI A;  4KGZ B;  4KRT A;  2F5K A;  4KBM B;  3M0R A;  2XK0 A;  3BFM A;  3M58 A;  1IXD A;  1GRI A;  2DNU A;  2QA4 A;  5FU6 C;  1RAG B;  5KCO A;  2EGE A;  1W2B S;  4KH1 B;  4LNP A;  1UUE A;  2KVQ G;  3OB9 A;  4EDU A;  4F7U G;  2FEI A;  3UT1 A;  2QG9 B;  3V8J A;  2XHC A;  4WCI A;  4OB0 B;  2ZAE A;  1UJ0 A;  2QQB A;  3OQ5 A;  1VQ5 Q;  1G5V A;  4KH0 B;  2RQT A;  4RMO A;  1TOV A;  4BDZ A;  1VYT A;  1ZSZ B;  2ROL A;  2A7Y A;  2X4W A;  4XTZ A;  1ZQ1 A;  2YDL A;  1W4S A;  2JOY A;  3VYH B;  4C5H A;  5CKE A;  1LJO A;  3DKM A;  2OAU A;  4QQG A;  3G1J A;  2CDT A;  4F7U B;  1VIF A;  4C0G A;  5LJ3 e;  3L2V A;  1MV0 B;  3CC4 T;  5GAO r;  4WTO B;  2CZ1 B;  1PKS A;  4DBH A;  5I22 A;  3OYA A;  1M5Q 1;  4M7A G;  2CUD A;  3FIF A;  3ULR B;  1MMA A;  1YIJ T;  1GBR A;  5J26 A;  4J8O A;  4Z89 A;  2GFU A;  4M7D C;  1KIK A;  2QAZ A;  2ZCF B;  1IHW A;  3SB2 A;  2DMO A;  3GOX A;  1G3T A;  2M1H A;  3EG0 A;  4ELZ C;  1KQ2 A;  1Y7X A;  2D9T A;  2LJ3 A;  1D0Z A;  2F2V A;  2XKO C;  2A0F B;  4EMK A;  3CCR A;  2X4X A;  5GJW B;  2EPD A;  4PFZ A;  4M7A B;  1I5O B;  3UPU A;  5LJ3 j;  2FG0 A;  3S3M A;  4QW2 A;  2P4R A;  1R0C B;  2HKN A;  4ZNX A;  5HKC A;  1S72 T;  2VB6 A;  1HD3 A;  2K5F A;  3SDZ A;  5KE2 A;  3AHU A;  2P0P A;  2BKD N;  2CP7 A;  4MZM A;  2EQU A;  1MMG A;  2O88 A;  2LJ1 A;  4KUI A;  1VYU A;  3EGU A;  3CC2 Q;  1M2V A;  1QVF P;  4OP0 A;  5HCK A;  4ATO A;  2DYB A;  2BE7 D;  3CMA T;  3CCJ Q;  3CCS Q;  4ZTF A;  8ATC B;  2JTE A;  2YRV A;  2I0N A;  2JM8 A;  1QVP A;  1UDL A;  1Q81 R;  3VKI A;  4IIO A;  4GLK A;  2NUT A;  4C92 C;  4JRI A;  3SWN C;  5FWB A;  3RDV A;  3PIP A;  1G3Y A;  3MCA B;  2EYX A;  2ABL A;  4IUQ A;  4P5N A;  4CI0 C;  1YI2 Q;  2PQW A;  3NGP A;  4Z02 A;  5GAO q;  2MWP A;  5GAN 5;  4AG1 C;  2AKK A;  2YLC A;  3LWI A;  1WXU A;  2KBT A;  3JCM e;  1PG5 B;  3OA6 A;  4M75 E;  3CME Q;  4M7D E;  1KD1 R;  2LNH B;  4GBQ A;  4PJO A;  2P0K A;  4E7L A;  1YJ9 T;  2XG8 D;  3PVQ A;  3CCL A;  1O9S A;  2DXC A;  1A0N B;  1UG1 A;  1JEG A;  4XTY A;  2EJF A;  1BI3 A;  3M4Y A;  4FSS A;  2KYB A;  3NTH A;  2EJG A;  1AWW A;  4PK4 A;  3I56 A;  1YHQ Q;  4FU6 A;  1B7T A;  3OYG A;  5FU7 B;  1OZ3 A;  2XDD A;  2X51 A;  3G4S A;  1M1K R;  2DVE A;  1AWO A;  2MCN A;  3EFS A;  4OVA A;  1OQK A;  2ZPE B;  1NBE B;  3QHS A;  4RTU A;  1AHJ B;  2CH4 W;  2DJZ A;  4C8Q G;  1QKX A;  1UEC A;  1VQP T;  1QKW A;  2YRC A;  1UGQ B;  3OS5 A;  3UAT A;  4DBQ A;  2FZG B;  6AT1 B;  4IIM A;  3JCM P;  2CT3 A;  4XK8 E;  2HL3 A;  1K9M R;  5GAO m;  2F5T X;  3THK A;  2CZ7 B;  2IVW A;  2LX7 A;  2MIO A;  3PMT A;  4C92 E;  2Y90 A;  3H0I A;  2KY9 A;  4C8Q B;  1NG2 A;  3FB9 A;  3OYN A;  2LP5 A;  3OBW A;  2HD0 A;  2CP6 A;  3ZL7 C;  1YIT A;  5I2M A;  2P84 A;  1AEY A;  1GCQ C;  1XJW B;  1VQO Q;  5A0G A;  4PJO D;  2O31 A;  4J6W A;  5L8R E;  2ED1 A;  3EAE A;  4B9X A;  4M78 F;  2J05 A;  3HFN A;  1K1Z A;  3OYJ A;  1X75 C;  1PKT A;  4OMF B;  1V29 B;  1YJW A;  3JCM d;  1CKA A;  3EG2 A;  2DD4 A;  1BU1 A;  1SHF A;  2QTX A;  2IIM A;  1QVG S;  1M2O A;  2WSC E;  4RCB A;  3EG3 A;  3NTK A;  3JCM g;  2LCS A;  4AG2 C;  4PLL A;  3CCV A;  1LPL A;  1ZSZ A;  1YJN Q;  3OYC A;  2CUB A;  4OMN A;  2CSI A;  4PFO A;  4CC4 B;  3QUI A;  1Q7Y R;  1KC8 C;  2PNI A;  4F7U A;  4ELY C;  2SRC A;  1JXM A;  1AOJ A;  4M77 F;  2XDP A;  3F70 A;  4GY5 A;  2D6F A;  2LRQ A;  2Y4X A;  3CXC S;  1SG5 A;  1HK9 A;  1VQ5 A;  4FYX B;  1X2Q A;  2EYW A;  4RTZ A;  4JZ4 A;  3C12 A;  3R6O A;  2ROT A;  2HL5 C;  4RUG A;  2RHX A;  4CC7 A;  3A98 A;  1K0S A;  2DIG A;  3QJY A;  3Q1J A;  1K8A U;  2DRM A;  4XTW A;  1VQM A;  2LTO A;  1JB0 E;  2QDL A;  4J9I A;  4FW1 A;  4A63 B;  3LGL A;  2DFU A;  1J3T A;  2L3R A;  1MGQ A;  1KFZ A;  3M57 A;  1Q95 G;  3QII A;  5I11 A;  3BW1 A;  2X35 A;  1PWT A;  2DEQ A;  3VUZ A;  4M7A A;  2HMA A;  5CKH A;  3OW2 S;  3ASK A;  5EC7 A;  1WHK A;  1BIB A;  5LJ5 f;  3J80 E;  4OMM A;  1WHJ A;  1NE8 A;  2J06 A;  2DM1 A;  1BKB A;  1M9S A;  4BI4 A;  1UGV A;  4OGE A;  2QQ9 A;  2X4J A;  2JVV A;  4YTL A;  2GTJ A;  2RJC A;  4ANJ A;  3CC4 Q;  2HNI A;  3BDL A;  4C0D B;  2RQV A;  5GAM f;  2RQW A;  1UGP B;  2JXB A;  3S3N A;  1KHC A;  2QAS A;  2Z0W A;  5GAO n;  2DYI A;  3ZFJ A;  3E9F A;  1YIJ Q;  1D1A A;  2NUP B;  3MHX A;  2YXY A;  2RNA A;  4M77 G;  2EJ9 A;  4M7D F;  5I21 A;  5LJ3 f;  2XD0 A;  3RNJ A;  4N0A C;  1YI2 T;  1UEB A;  3VS3 A;  1QQJ A;  2VVK A;  3SHW A;  1KHI A;  2CP2 A;  3V7R A;  1YNZ A;  1UHC A;  2KQW A;  1EFN A;  4IUT A;  3L2W A;  3KUF A;  3CC2 A;  1OYX A;  3CCJ A;  3CCS A;  2K79 A;  2FVU A;  3QSU A;  1RAA B;  2E1H A;  3JSC A;  2K7A A;  1OPK A;  1RAI B;  1VQ7 A;  1GBQ A;  4OMQ A;  3EFO B;  1WYX A;  3QDR B;  5CR2 A;  4DA4 A;  4X9C A;  3JB9 I;  2KYM A;  3I55 T;  3LYI A;  3FRN A;  1Z9Q A;  2FYK A;  3VUB A;  1PC0 A;  1W2B A;  1G83 A;  1YWP A;  2DIL A;  5KYY B;  4IUV A;  5LJ5 h;  3OYF A;  1H92 A;  2RJE A;  2RHY A;  2LQN A;  3CMA Q;  4R0K A;  2L89 A;  4A4E A;  3M0P A;  4JZ3 A;  1BI0 A;  3HTR A;  2GTO A;  2E12 A;  2HSP A;  3TCJ A;  1GXI E;  2FL7 A;  4UC4 A;  3EHQ A;  4X34 A;  1M30 A;  4C92 F;  5CKD A;  2CSQ A;  3S6W A;  2JUF A;  5GAO p;  4J9H A;  2E6N A;  3CCU A;  5GMK e;  2D0N A;  1HJD A;  1S1N A;  5GAN e;  4EMH A;  4KUD K;  1YHQ A;  5LJ3 h;  2DET A;  3S3O A;  4M75 G;  3QPH A;  3R6N A;  4M7D G;  2CH4 A;  5A0L A;  5KH6 A;  1VQ9 T;  4C8Q A;  4OMO A;  2L2P A;  1YJ9 Q;  3G6E A;  4FT2 A;  1JXO A;  4VUB A;  1RL2 A;  2BE9 B;  1EIF A;  4JPB W;  2DTH A;  4E7Z A;  1T0J A;  2YWW A;  4A4F A;  1Y71 A;  1TS9 A;  4DBR A;  2ECZ A;  1WXT A;  3NMZ C;  2DER A;  4M75 B;  4M7D B;  4V2S A;  4JS4 A;  3TU4 K;  1VQN T;  2DKG A;  2LX9 A;  5C6S A;  1QVG P;  3OYL A;  5GMK j;  1C6V X;  5L23 A;  2E3I A;  5GAN j;  2LQ8 A;  3WXM B;  1VQP Q;  2K6D A;  4E7K A;  3VJP A;  4X1V A;  2L8D A;  2K57 A;  2DE0 X;  1AWX A;  1ZHI A;  4N4I A;  2KT8 A;  4JLG A;  1TTH B;  3KFV A;  2DXB A;  1VQO A;  1SPK A;  2ZPH B;  2QXF A;  1PSF A;  4PKC C;  4HVU A;  4BUG A;  2J6K A;  1Q82 R;  2KRN A;  3CXC P;  5IT9 E;  4C92 G;  2CS7 A;  2XMF A;  4F17 A;  1WXB A;  3FDR A;  5D6Y A;  1D09 B;  4C5G A;  4MMK A;  4MZP A;  1M8V A;  1JJ2 A;  3D7S B;  2E64 A;  3L1A A;  3GP8 A;  5KCH A;  4EPC A;  3UDC A;  5GMK l;  4C5E A;  3M55 A;  1TUD A;  3E19 A;  2VYT A;  3MKD A;  2FPF A;  4C92 B;  1MV3 A;  2ZPI B;  4C0F A;  5GAN d;  5D7U A;  2MI6 A;  3OW2 P;  3P8H A;  2H8H A;  3EH1 A;  1X6G A;  3H41 A;  1MHN A;  3VS1 A;  2ZPB B;  3C4S A;  5GAN g;  1D3B B;  2F1L A;  1QP3 A;  1BCM A;  2D0Q B;  1X43 A;  1RI9 A;  1QMC A;  4M78 E;  3HRU A;  4A54 A;  2EQI A;  3VRY A;  3X26 B;  3CEY A;  1MND A;  1SEM A;  1SKU B;  3EHR A;  2QI2 A;  4XTU A;  3JB9 F;  3A8O B;  3LH5 A;  3PTA A;  4QQD A;  1HXD A;  3EGX B;  3I5R A;  2IPO B;  2O01 E;  1YCS B;  1N27 A;  1EZZ B;  4J9E A;  3UA6 A;  2DL5 A;  4LDV A;  1NLP C;  4FCY A;  3H0F A;  1UJY A;  4PJO C;  4DBF A;  4J9G A;  3OYH A;  3CCM A;  1WGS A;  1MMN A;  2HAX A;  5CVI A;  1B34 B;  2NUP A;  4M77 E;  3JB9 H;  1ZSG A;  2BIV A;  2LQW A;  2RHZ A;  1OI1 A;  1SSF A;  4HCK A;  1QP2 A;  1RI0 A;  2KT1 A;  1OU8 A;  2P4T A;  2QYZ A;  4RTV A;  1VQ6 T;  4BY6 B;  1SRL A;  3CPW P;  3CC4 A;  1W6X A;  4ZN1 A;  2M0Y A;  2DA9 A;  3A1P A;  3RIR A;  1NJI U;  4RTW A;  4HA8 A;  2OTJ T;  4IUR A;  4A4H A;  3L2Z A;  1FXX A;  3OS1 A;  3JCM J;  2K5I A;  1KG1 A;  1WJQ A;  4BB7 A;  3EFO A;  3UF4 A;  1JQQ A;  2G3R A;  2EYQ A;  2KK4 A;  3JB9 J;  4E7S A;  1M90 U;  1KD1 C;  1VIE A;  3OYI A;  3G71 T;  1Y0M A;  4LDW A;  2LVM A;  2GBQ A;  2KDS A;  1SHG A;  5KYY A;  3JCM Q;  2RMO A;  1KQS P;  2CP5 A;  2COZ A;  1G3W A;  3REA B;  3JCM W;  3H6Z A;  4L6V 5;  3QXE B;  8AT1 B;  1RLP C;  2DEU A;  2ZZD A;  2DXT A;  4R56 A;  1UFF A;  1IGQ A;  3JB9 G;  1NJI C;  2CYZ B;  2JS2 A;  1RAD B;  4JUV A;  2J7I A;  1QW1 A;  4J6Y A;  3PT9 A;  2CZ6 B;  1S72 A;  5CKF A;  2EWN A;  4HT8 A;  2XID A;  5GMK i;  1U8R A;  4AFZ C;  2KGT A;  1M90 C;  2HEQ A;  1UGS B;  2M9U A;  3A8G B;  4ZGD B;  2KRO A;  1YWO A;  3ZBD A;  1JRI A;  2D1X A;  2CP0 A;  5GAM d;  3CMA A;  2M16 A;  3FEO A;  2FRW A;  1E6H A;  1U1S A;  2SEM A;  2JS0 A;  1BIA A;  1ZSZ C;  3CD6 A;  1KK7 A;  2PUK B;  3DB4 A;  5CIU A;  1VQK A;  1X6B A;  3I55 Q;  1WDX A;  2LCL A;  2DF6 A;  1I1J A;  1I0C A;  2DAQ A;  2OTL Q;  4JRP A;  1VQL T;  4J7F A;  2XI9 A;  2DBK A;  4RTY A;  3OMG A;  4M75 A;  4BE2 A;  4M7D A;  2LJ0 A;  1I81 A;  1W70 A;  2GQV A;  1IO6 A;  1FMK A;  4RKU E;  1WHG A;  2BZX A;  2JZ2 A;  2CP3 A;  2JT4 A;  5AYF A;  1NM7 A;  2DJQ A;  1OUL A;  1WHH A;  1YJ9 A;  1G2B A;  1Q7Y U;  1OX8 A;  2JNG A;  4HCC A;  2EBP A;  2EQJ A;  3CC7 Q;  2OJ2 A;  2K3B A;  1M8M A;  3OSV A;  1AD5 A;  1TXQ A;  4IUU A;  1T3L A;  1YIT T;  1D0Y A;  5FRO A;  3HHT B;  2IG0 A;  2JW4 A;  2AIR B;  4M7A C;  2DL3 A;  1VQ9 Q;  3MET A;  4XU0 A;  2EAY A;  2LNV A;  1PD1 A;  3EG9 B;  4IUP A;  1Q7Y C;  2DZ9 A;  3NTI A;  1B3Q A;  2YLB A;  3JCM c;  1TU0 B;  2K3X A;  1AT1 B;  1E6G A;  4PL6 A;  1KC8 U;  1LVK A;  4HT9 A;  2FPD A;  1NLO C;  2B8A A;  1QWE A;  1FWZ A;  4HCZ A;  1SF9 A;  4HVV A;  2X9H A;  1ARK A;  1VQN Q;  4C92 A;  3TQ7 P;  2L3Q A;  2NWM A;  4R55 A;  1C0M A;  5J39 A;  1VQ4 Q;  2FPE A;  2OX7 A;  1H64 1;  2B86 A;  2RO0 A;  1M3C A;  1AZE A;  2X3W D;  4EIK A;  2E4H A;  2OAW A;  1D3B A;  4M75 D;  3HRS A;  4BE0 A;  3QWX X;  1Q86 U;  1XNI A;  2BUD A;  2RF0 A;  1H3H A;  3G7Z A;  1ZBX A;  2NUZ A;  2QTV A;  2L0A A;  2VGM A;  2YHT A;  3EGX A;  1IGU A;  4K11 A;  2LCC A;  2FB7 A;  1CSK A;  2D8J A;  2EIF A;  2COW A;  1QVF A;  1Y96 B;  1ACM B;  3VS5 A;  3CCQ T;  3QG1 A;  2K4Y A;  1MNE A;  5IHI A;  1M1F A;  1V76 A;  1B34 A;  3CBM A;  4J6X A;  2PVG B;  5IAY A;  1I8F A;  1WNL A;  1Q86 C;  4CC3 A;  1K73 U;  1HSQ A;  2EKO A;  3RES A;  5GMK h;  2VGN A;  3H0H A;  2RQR A;  3PE0 A;  1WHL A;  1K4U S;  5FU7 C;  5HY6 A;  3OYD A;  4L5G A;  2FO0 A;  2L3S A;  5LL6 S;  5GAN 8;  3QZ5 B;  3OMC A;  1RAE B;  4J9B A;  2LZ6 B;  2D8H A;  3C0C A;  4M78 G;  1V1C A;  4J9F A;  1MMD A;  4FSX A;  2RQU A;  3E1S A;  2HDA A;  5GAN 2;  1K73 C;  4BD3 A;  1PD0 A;  1D1C A;  2AZV A;  3OYB A;  4J7I A;  4JJD A;  1QCN A;  3CQT A;  1CKB A;  3VS6 A;  2Y4Y A;  4C8Q C;  1PRL C;  5AT1 B;  1NZ9 A;  4M78 B;  1KQ1 A;  3PIO A;  5FLX E;  4PJO F;  2LC4 A;  1IZ6 A;  3LX7 A;  3OYY A;  3KBG A;  5GAN 7;  4F14 A;  3M56 A;  4OML A;  3C95 A;  9ATC B;  5ECA A;  2K2V A;  4XU2 A;  1I4K 1;  1VQ7 T;  1WJR A;  3RBB B;  2AT1 B;  3RKX A;  3LH0 A;  2GGR A;  1M3B A;  3OYE A;  4D8D A;  4BAC A;  1N8R R;  1VQ6 Q;  1VQ8 T;  4BI8 B;  1SSH A;  2WSE E;  2JMC A;  1JO8 A;  3CPW S;  2A28 A;  2OTJ Q;  2VUB A;  4L59 A;  2VV5 A;  4M77 B;  1OX9 A;  2A37 A;  3A8M B;  3LLR A;  1QCO A;  1BCO A;  4F04 B;  2J6F A;  4M7A D;  3VU3 C;  1K8A R;  1BK2 A;  5FRN A;  1YI2 A;  2DTO A;  2OTL T;  2YUN A;  4Y91 A;  3G71 Q;  4BI3 A;  1FMV A;  5FU6 B;  4XTX A;  1MUZ A;  3INZ A;  1TUC A;  5M9O A;  5DM7 R;  1WPY A;  4NL2 A;  2F2W A;  1M4Z A;  2AK5 A;  1X69 A;  2DTI A;  2MK5 A;  2MWO A;  2W10 A;  3VS4 A;  3MEA A;  1KQS S;  3CME A;  4II1 A;  2E3H A;  4LDU A;  2RI3 A;  1XQH A;  2KNB B;  4OB3 B;  4QQ6 A;  1FMW A;  3CC7 T;  1F1B B;  3I55 A;  1K9A A;  2JMA A;  4PLI A;  1P92 A;  2E10 A;  3V7C A;  2C0T A;  3G6E T;  2PUO B;  3VYG A;  1RUW A;  2JN0 A;  2EQK A;  2DK3 A;  3ME9 A;  1UB4 A;  2CGH A;  3E2U A;  1D1B A;  2BZ8 A;  1GFC A;  2KE9 A;  4MDX A;  2COY A;  4TVR A;  3JV3 A;  1X6O A;  2O9V A;  2KAF A;  2ED0 A;  2QDY B;  3HKS A;  5FW9 A;  3I56 Q;  1HYO A;  4Y92 A;  4AFS C;  2ATC B;  1QWF A;  4NL3 A;  3EG9 A;  4AT1 B;  4MZT A;  4HKE A;  3JCM f;  5KE3 A;  3SD4 A;  7AT1 B;  1TH7 A;  4B6M A;  1VQL Q;  4F7U F;  3O8V A;  3M5A A;  1BB9 A;  3CCE T;  1RAB B;  4C0D C;  4QT7 A;  3TVT A;  1VQ4 T;  2ZGW A;  4BDY A;  5GAN 4;  4DQ2 A;  1VQ9 A;  1WLP B;  5DY9 A;  2VC8 A;  2QGF B;  2GNC A;  3LWH A;  2QEX T;  1M3A A;  4CC2 A;  3RKW A;  4PJL A;  3V7S A;  3MPU B;  5GAN 6;  1GCP A;  2HQE A;  2EFI A;  2QA4 T;  2X4Y A;  2MOX A;  4JJN K;  1ABO A;  2PVO B;  4A4G A;  4EMK C;  4FYY B;  1YIT Q;  2KRM A;  1Y07 A;  1VQN A;  3M9Q A;  1WZO A;  1U3O A;  5KYU B;  4M7A F;  1UTI A;  2R5A A;  1Y96 A;  1XTD A;  3GPL A;  3BE3 A;  2DLP A;  1VA7 A;  2M0O A;  5GAO l;  1YJN A;  1ABQ A;  1ZA2 B;  4EMG A;  3QO3 A;  4C8Q D;  1RLQ C;  2KEA A;  2RK1 A;  3VV0 A;  1UHF A;  1RAC B;  3SWN B;  3CCV Q;  3JCM h;  1IB8 A;  3HP9 A;  4OMP A;  1GFD A;  2PVD B;  1EX4 A;  3JCM b;  4PJM A;  3X20 B;  5LJ5 e;  2XU8 A;  3SEM A;  3VS0 A;  4NS5 A;  1ZUK A;  2L3P A;  3GNF B;  1WQ7 A;  2BTT A;  1NPP A;  3A8L B;  2C06 A;  1AZG B;  2FZK B;  3ER0 A;  4HVW A;  1Q81 U;  3EH2 A;  3L2R A;  5DLO A;  2EGA A;  1WX6 A;  4RTX A;  2E5Q A;  3CCM T;  4LDX A;  5GAM e;  3RUX A;  4X9D A;  2CZ0 B;  5DLQ E;  2M02 A;  3M0S A;  2V8K A;  2VXE A;  2YRD A;  2E70 A;  1VQM Q;  2YUQ A;  2RPN A;  3CCQ Q;  1RAH B;  2OI3 A;  3CBP A;  4M78 A;  2RB6 A;  3CCR T;  1TSF A;  1PRM C;  2RJD A;  1BI1 A;  3L2U A;  2GQI A;  1KD1 U;  2GCX A;  5LJ5 j;  2PZ1 A;  2AZS A;  3NPF A;  2HQH A;  1Q81 C;  2HKQ B;  4Z8A A;  2QQS A;  3JCM X;  3M0U A;  3M54 A;  3LGF A;  4M75 C;  2AHJ B;  4M4Z A;  2RI5 A;  5KYX B;  3URG A;  3VRZ A;  1WFW A;  2EGC A;  2DXU A;  1Z9Z A;  4ZN3 A;  5GAM j;  2YUP A;  3OS0 A;  1YIJ A;  2MAM A;  3MJX A;  1PCX A;  4M77 A;  1LNX A;  5GAN 3;  1M1K U;  3EGD B;  3TEE A;  1O75 A;  3N5B B;  3RMQ A;  1TUG B;  3OYK A;  3HRT A;  4FT4 A;  4LDY A;  3PNW C;  5HK0 A;  3WVD B;  3DB3 A;  3M0Q A;  2R57 A;  3QYH B;  1VQ6 A;  4ZGE B;  4MML A;  2DO3 A;  2YT6 A;  2ESW A;  4CRI A;  4PFP A;  4AFU C;  4C8Q F;  3P8B B;  4LE9 A;  2OTJ A;  5D6W A;  5LJ5 d;  1K9M U;  1QVG A;  2VAS A;  2O2O A;  2VXF A;  4E7H A;  4XU3 A;  1M1K C;  2I2L A;  2CKK A;  4FYW B;  5LJ5 g;  1N9S A;  3PVL A;  1JJ2 S;  1VQ7 Q;  4E2F B;  4PJO E;  4M78 D;  5C0M A;  3WVE B;  3G71 A;  3CCL T;  2A08 A;  3J7A F;  4C0Z A;  3CD6 T;  1VQ8 Q;  2GFA A;  1T3S A;  1OPL A;  1VQK T;  4JLI A;  3H9N A;  4C5I A;  2MPX C;  3T9N A;  1UE9 A;  3VS7 A;  2E65 A;  2RH2 A;  2A3L A;  3CXC A;  3A8H B;  3I56 T;  5GAM g;  4J5Y A;  2FHD A;  4LD9 K;  3VS2 A;  3G4S T;  1K9M C;  1FYN A;  4J9D A;  2EYZ A;  5LJ3 d;  2EYY A;  1M1G A;  2E41 A;  1T0H A;  1JU5 C;  4JRK A;  4QVZ A;  4E7I A;  4PJJ A;  3M4G A;  2AKL A;  3REB B;  5LJ3 g;  3JCM V;  4N4H A;  4AFQ C;  4M77 D;  2F69 A;  3LW5 E;  4JS5 A;  5IHK A;  5CQX A;  2H3E B;  4BE1 A;  3PGG A;  4DOW A;  1FX7 A;  1NJI R;  3CCU Q;  3A5Z B;  1PSE A;  2LQK A;  3MO8 A;  4ZTJ A;  3OW2 A;  2HSE B;  3FC3 A;  4RCC A;  5D6X A;  2O4X B;  1N5Z A;  2G6F X;  5KYW B;  2DL7 A;  2CRE A;  2V26 A;  3GBQ A;  5CK9 A;  1TWB A;  1M90 R;  5EG2 A;  3G6E Q;  1IRX A;  2W0Z A;  1VQL A;  4AMC A;  3OY9 A;  3OYM A;  4BY6 C;  3BDU A;  3MP8 A;  3FJ5 A;  1ZA1 B;  1NYG A;  1WQW A;  1RAF B;  5KYU A;  5GMK m;  1IHV A;  4PJN A;  1VQP A;  2MYS A;  5CQY A;  3QZ9 B;  3U23 A;  1VOM A;  1DJ7 B;  1G8X A;  1YJW T;  5GJV B;  2DL4 A;  1X27 A;  5GAN f;  4E47 A;  4DOV A;  4RG8 A;  2KXC A;  3JAM E;  3GNG A;  3I9Q A;  3CCV T;  1W1F A;  1W2B P;  3HPW A;  3CCE Q;  3EG1 A;  1GL5 A;  4GLM A;  3SWN A;  1LCK A;  1VYV A;  4J83 A;  1UGR B;  3OS2 A;  1YP5 A;  2LT4 A;  3CPW A;  4OB2 B;  3TRE A;  4E6R A;  1R8O B;  2HZY A;  1WIE A;  4F7U E;  2QEX Q;  4M7D D;  1ZBJ A;  2EKH A;  4NOY A;  1VUB A;  2QK0 A;  2C0I A;  4O6J A;  1VQ5 T;  3V8K A;  1ZX6 A;  2H3J A;  2QA4 Q;  4ORZ A;  3OBY A;  2C0O A;  2KXD A;  3MEV A;  4QKU A;  2RA2 A;  2HCK A;  2PTK A;  1NPR A;  3NHN A;  3RKY A;  1E7O A;  1VQM T;  3E9G A;  4OGC A;  1KQS A;  3CBO A;  3QWY A;  2DBM A;  1G3S A;  2EVR A;  1N8R U;  2KSS A;  2K2M A;  1AVZ C;  2EQM A;  4DEX A;  2XIC A;  4KGX B;  4M7A E;  3FLG A;  2DVJ A;  2NLU A;  2HQX A;  4FYV B;  3RER A;  4PNO A;  2KMT A;  4FIB A;  2BZY A;  2DRK A;  5GAN h;  3P8D A;  2JM9 A;  2ENM A;  4KT0 E;  4FW2 A;  3O5Z A;  5A0D A;  1TG0 A;  2RD1 A;  5KYX A;  3RMS A;  1M27 C;  4LD6 A;  2L5Q A;  4Q5W A;  3CCQ A;  4XQ3 A;  4C92 D;  2RJF A;  2HBP A;  2V1Q A;  3MEW A;  1XOV A;  4FL6 A;  1N8R C;  3I35 A;  2EW3 A;  3H8Z A;  3QBY A;  1U06 A;  1YBY A;  3EGD A;  1KC8 R;  4Z88 A;  2WSF E;  3ZEH A;  4HCB A;  1JBM A;  4XTV A;  3CCM Q;  3L42 A;  2JTM A;  2R58 A;  5CKB A;  2QGG A;  1AWJ A;  3HFO A;  2RHU A;  3MEU A;  3DLM A;  2RI2 A;  1Y57 A;  2ZPF B;  4D6W A;  1GCQ A;  2V8I A;  4ZGJ B;  1K8A C;  5IXF A;  1ZUU A;  3CC2 T;  3CCR Q;  1H3Z A;  1K0X A;  3CCJ T;  3CCS T;  1JJ2 P;  1U1T A;  1Q86 R;  1X01 A;  2NYS A;  2VWF A;  4O5V A;  1KSW A;  1SRM A;  2O9S A;  2YSQ A;  4WF2 A;  4LN2 A;  5FWC A;  2RM4 A;  4A53 A;  2ZPG B;  3MP1 A;  2RN8 A;  4M75 F;  1LOJ A;  1YCY A;  3KXT A;  2DPP B;  3RR6 A;  1R0B G;  3PFS A;  5IHN A;  2YUO A;  2K3Y A;  4EMK B;  3QKJ A;  2RK2 A;  3JRZ A;  3X28 B;  5I2S A;  3BY7 A;  4XAX B;  5FRM A;  3CME T;  2DIQ A;  2KI7 A;  1K73 R;  1NEG A;  4LXC A;  1OOT A;  4LUD A;  1VQ8 A;  1WJS A;  5KYN A;  1S72 Q;  2KRS A;  4N4G A;  3EFR A;  3GF5 A;  2DX1 A;  3AT1 B;  2F2X A;  1PNJ A;  5CO7 A;  3CCU T;  1M2V B;  4D8K A;  5CCA A;  2FRY A;  1YFN A;  2DZC A;  1YHQ T;  1PM3 A;  4OF1 A;  2VKN A;  1OU9 A;  1Q82 U;  1OZ2 A;  4JRQ A;  4ESR A;  3FJP A;  1QVF S;  2O4X A;  1N6A A;  1NYF A;  2PU9 B;  2NUT B;  5J3B A;  5KYW A;  5CAI A;  3DLL A;  2E5K A;  4C8Q E;  4PJO G;  4LUE A;  2OTL A;  2MF2 A;  3CCL Q;  2LT1 A;  4HXJ A;  1QLY A;  2X3X D;  3CD6 Q;  4MDW A;  5GAM h;  2CT4 A;  1VQK Q;  2LDM A;  3M53 A;  1C1A A;  1BYM A;  1BI2 A;  1I5L A;  4XU1 A;  2RHI A;  3UWN A;  1K76 A;  2QQR A;  3NFC A;  5IN1 A;  2MMP A;  1NEB A;  1B07 A;  3QDF A;  1D0X A;  2WAC A;  3SFM A;  2K5L A;  3G4S Q;  4A4K A;  4QVD A;  4QVC A;  2KR3 A;  4E7J A;  1ZLM A;  1Q82 C;  1ZUY A;  1PHT A;  3CC7 A;  5IH2 A;  3MP6 A;  1N9R A;  4Y28 E;  4PJO B;  3M0T A; 
#chains in the Genus database with same CATH homology
 2JNG A;  3L2U A;  3ASK A;  4HCC A;  3JB9 D;  1KD1 U;  2EQJ A;  1BIB A;  2GCX A;  5LJ5 f;  5LJ5 j;  2DD5 A;  4JDS A;  3J80 E;  3OSV A;  1NE8 A;  1Q81 C;  3QJ6 A;  4IKF A;  2QQS A;  1BKB A;  1M9S A;  4RG2 A;  3JCM X;  4BI4 A;  3M54 A;  3LGF A;  4OGE A;  4M75 C;  3M59 A;  2AHJ B;  2QQ9 A;  4IUU A;  2X4J A;  2RI5 A;  1YJ9 A;  2JVV A;  3CPF A;  1VQO T;  4N0A A;  1YIT T;  4YTL A;  3URG A;  5FRO A;  3HHT B;  3L2Q A;  2RJC A;  2IG0 A;  4M78 C;  2HNI A;  3BDL A;  4C0D B;  2DXU A;  4M7A C;  2P0Q A;  4ZN3 A;  5GAM f;  5GAM j;  3X24 B;  1UGP B;  3HL8 A;  2V8J A;  3S3N A;  3OS0 A;  1KHC A;  1YIJ A;  2MAM A;  3MET A;  4ME7 A;  3J81 E;  4FM4 B;  4XU0 A;  4M77 A;  2EAY A;  1LNX A;  5GAN 3;  2LNV A;  5GAO n;  3QYG B;  1M1K U;  3ZFJ A;  3E9F A;  4IUP A;  1Q7Y C;  3TEE A;  1O75 A;  2DZ9 A;  3N5B B;  3NTI A;  3MHX A;  3RMQ A;  3OYK A;  2YLB A;  3JCM c;  4B9W A;  2K3X A;  4M77 G;  2EJ9 A;  4M7D F;  5A2Q E;  5I21 A;  5LJ3 f;  2XD0 A;  4PL6 A;  1KC8 U;  4HT9 A;  3HRT A;  4FT4 A;  2JTF A;  3CCE A;  4LDY A;  3PNW C;  4N0A C;  1UEB A;  5HK0 A;  2E6Z A;  3WVD B;  1YI2 T;  2B8A A;  1YJN T;  3HSB A;  1FWZ A;  3DB3 A;  4HCZ A;  2R57 A;  3QYH B;  3C94 A;  1VQ6 A;  4ZGE B;  4MML A;  2DO3 A;  1KHI A;  2QQA A;  1VQ4 A;  3GLX A;  3V7R A;  4CRI A;  4KUL A;  4C92 A;  2KQW A;  4IUT A;  3L2W A;  3KUF A;  3CC2 A;  2XDB A;  4R55 A;  4C8Q F;  5J39 A;  3V8L A;  1OYX A;  3P8B B;  4M77 C;  4OB1 B;  3GIB A;  3X25 B;  5HK3 A;  3CCJ A;  3OSS C;  2OTJ A;  1H64 1;  5D6W A;  5LJ5 d;  2GF7 A;  3CCS A;  1K9M U;  2QEX A;  2RO0 A;  2FVU A;  3QSU A;  2E1H A;  1QVG A;  1IRE B;  3JSC A;  2R5M A;  3PMI A;  1VQ7 A;  2VXF A;  1D3B A;  4E7H A;  4XU3 A;  1M1K C;  2F5K A;  4KBM B;  4M75 D;  2I2L A;  2CKK A;  2XK0 A;  3BFM A;  1N9S A;  3M58 A;  5LJ5 g;  3HRS A;  4BE0 A;  1JJ2 S;  3QDR B;  5CR2 A;  2QA4 A;  1XNI A;  4DA4 A;  4X9C A;  5FU6 C;  3JB9 I;  1Q86 U;  5KCO A;  3I55 T;  3LYI A;  4PJO E;  3FRN A;  4M78 D;  5C0M A;  3WVE B;  3G71 A;  2FYK A;  3CCL T;  3J7A F;  4C0Z A;  1W2B S;  3CD6 T;  3VUB A;  2GFA A;  2BUD A;  1W2B A;  3G7Z A;  1ZBX A;  1VQK T;  4JLI A;  5LJ5 h;  2VGM A;  2YHT A;  4IUV A;  4C5I A;  3T9N A;  2KVQ G;  3OYF A;  2RJE A;  2LCC A;  2FB7 A;  2RHY A;  3OB9 A;  2E65 A;  2EIF A;  2RH2 A;  2A3L A;  4EDU A;  4F7U G;  3CXC A;  3A8H B;  3I56 T;  2L89 A;  3UT1 A;  1Y96 B;  4A4E A;  5GAM g;  1QVF A;  4J5Y A;  3V8J A;  1BI0 A;  2XHC A;  3CCQ T;  2FHD A;  4LD9 K;  3G4S T;  1K9M C;  2E12 A;  4OB0 B;  3TCJ A;  3QG1 A;  5LJ3 d;  1GXI E;  2K4Y A;  2QQB A;  1M1G A;  2E41 A;  3OQ5 A;  2FL7 A;  4JRK A;  1G5V A;  4QVZ A;  4UC4 A;  4E7I A;  4X34 A;  4C92 F;  1M1F A;  4RMO A;  4BDZ A;  1B34 A;  5CKD A;  3M4G A;  3CBM A;  2A7Y A;  2PVG B;  2X4W A;  4J6X A;  3S6W A;  4XTZ A;  5IAY A;  2JUF A;  1I8F A;  1WNL A;  1ZQ1 A;  3JCM V;  5LJ3 g;  1Q86 C;  1K73 U;  4N4H A;  1W4S A;  2JOY A;  3VYH B;  5GAO p;  2EKO A;  4C5H A;  5CKE A;  1LJO A;  4M77 D;  3RES A;  3DKM A;  2F69 A;  3LW5 E;  4JS5 A;  5GMK h;  2OAU A;  2VGN A;  2E6N A;  4QQG A;  3CCU A;  5CQX A;  5GMK e;  4BE1 A;  5FU7 C;  4F7U B;  3PGG A;  5GAN e;  4DOW A;  1Q7Y U;  1VIF A;  5HY6 A;  4C0G A;  4L5G A;  1FX7 A;  4EMH A;  5LJ3 h;  3OYD A;  1YHQ A;  4KUD K;  5LL6 S;  5GAN 8;  3QZ5 B;  5LJ3 e;  3S3O A;  3A5Z B;  4M75 G;  1PSE A;  3QPH A;  3L2V A;  4M7D G;  3OMC A;  3CC4 T;  2LQK A;  3MO8 A;  5GAO r;  4ZTJ A;  3OW2 A;  2CZ1 B;  3FC3 A;  5A0L A;  4RCC A;  5D6X A;  5KH6 A;  4M78 G;  1VQ9 T;  4C8Q A;  3OYA A;  1M5Q 1;  2O4X B;  4M7A G;  3G6E A;  4FT2 A;  3FIF A;  5CK9 A;  4VUB A;  1RL2 A;  1YIJ T;  5J26 A;  4J8O A;  4FSX A;  5EG2 A;  1EIF A;  2DTH A;  2GFU A;  4M7D C;  3E1S A;  1VQL A;  2ZCF B;  3OY9 A;  4A4F A;  5GAN 2;  1K73 C;  3SB2 A;  4BD3 A;  3OYM A;  1Y71 A;  3GOX A;  1G3T A;  4BY6 C;  3BDU A;  2M1H A;  3MP8 A;  3OYB A;  4ELZ C;  1KQ2 A;  4J7I A;  4M75 B;  4M7D B;  1Y7X A;  4V2S A;  4JS4 A;  1WQW A;  2D9T A;  3TU4 K;  1VQN T;  2Y4Y A;  2DKG A;  5GMK m;  4C8Q C;  2LX9 A;  2XKO C;  4EMK A;  3CCR A;  1VQP A;  1NZ9 A;  2X4X A;  1KQ1 A;  3QZ9 B;  4M78 B;  5CQY A;  4PJO F;  5FLX E;  5C6S A;  3PIO A;  3OYL A;  4M7A B;  5GMK j;  2LC4 A;  1DJ7 B;  1IZ6 A;  1YJW T;  3LX7 A;  5GAN f;  5GAN j;  2LQ8 A;  3WXM B;  3OYY A;  3KBG A;  4E47 A;  5GAN 7;  4E7K A;  3M56 A;  3VJP A;  2L8D A;  2K57 A;  3UPU A;  5LJ3 j;  4DOV A;  3C95 A;  4RG8 A;  1ZHI A;  3JAM E;  3S3M A;  3GNG A;  4N4I A;  2K2V A;  4QW2 A;  4XU2 A;  1I4K 1;  4JLG A;  3CCV T;  5HKC A;  1S72 T;  1VQ7 T;  1WJR A;  3HPW A;  2K5F A;  3RKX A;  3LH0 A;  3SDZ A;  5KE2 A;  3OYE A;  3AHU A;  4BAC A;  2DXB A;  1VQO A;  3SWN A;  2P0P A;  2ZPH B;  1VQ8 T;  2BKD N;  2QXF A;  1PSF A;  4J83 A;  4PKC C;  4MZM A;  4BI8 B;  4BUG A;  1UGR B;  2EQU A;  2WSE E;  4KUI A;  5IT9 E;  4C92 G;  3OS2 A;  3CPW S;  2LT4 A;  2CS7 A;  4OP0 A;  3CPW A;  4ATO A;  4OB2 B;  3TRE A;  1R8O B;  3CMA T;  4F7U E;  2VUB A;  3FDR A;  5D6Y A;  4ZTF A;  2YRV A;  4C5G A;  4L59 A;  2VV5 A;  4M77 B;  4MMK A;  4M7D D;  3A8M B;  1QVP A;  4MZP A;  4PJO B;  4NOY A;  1M8V A;  3LLR A;  3VKI A;  1JJ2 A;  1VUB A;  2E64 A;  3L1A A;  3GP8 A;  4GLK A;  5KCH A;  4O6J A;  1VQ5 T;  4EPC A;  3V8K A;  3UDC A;  4M7A D;  5GMK l;  3VU3 C;  4C92 C;  2H3J A;  5FRN A;  3OBY A;  4JRI A;  4C5E A;  3M55 A;  3SWN C;  2DTO A;  1YI2 A;  3MEV A;  2OTL T;  3PIP A;  1G3Y A;  3MCA B;  4Y91 A;  4BI3 A;  3E19 A;  2RA2 A;  5FU6 B;  4IUQ A;  4XTX A;  3INZ A;  1NPR A;  4P5N A;  4CI0 C;  5M9O A;  2VYT A;  1WPY A;  2PQW A;  4NL2 A;  5DM7 R;  1M4Z A;  4Z02 A;  2DTI A;  4C92 B;  3RKY A;  5GAO q;  2MWP A;  2MWO A;  1VQM T;  3E9G A;  5GAN 5;  2ZPI B;  3MEA A;  4C0F A;  5GAN d;  1KQS S;  2YLC A;  3LWI A;  4II1 A;  3CME A;  4OGC A;  1KQS A;  2MI6 A;  3CBO A;  3JCM e;  3P8H A;  4LDU A;  3OA6 A;  4M75 E;  1G3S A;  2RI3 A;  4M7D E;  1XQH A;  1N8R U;  4OB3 B;  2KSS A;  1MHN A;  2EQM A;  2ZPB B;  3C4S A;  5GAN g;  4QQ6 A;  1D3B B;  1QP3 A;  2D0Q B;  2XIC A;  4M78 E;  3CC7 T;  4PJO A;  2P0K A;  3HRU A;  4A54 A;  4E7L A;  1YJ9 T;  2XG8 D;  4M7A E;  3FLG A;  3X26 B;  2NLU A;  3CEY A;  3I55 A;  2HQX A;  3CCL A;  3RER A;  1O9S A;  4PNO A;  4PLI A;  1P92 A;  2E10 A;  2KMT A;  3V7C A;  4FIB A;  2DXC A;  5GAN h;  3G6E T;  2QI2 A;  3P8D A;  2PUO B;  3VYG A;  4XTU A;  4XTY A;  3A8O B;  3JB9 F;  2JN0 A;  2EQK A;  2EJF A;  3PTA A;  1BI3 A;  2DK3 A;  3ME9 A;  4QQD A;  1HXD A;  3M4Y A;  1UB4 A;  4KT0 E;  2O01 E;  5A0D A;  2CGH A;  3NTH A;  1N27 A;  2RD1 A;  2EJG A;  3RMS A;  3I56 A;  5CKH A;  4FU6 A;  4LD6 A;  4MDX A;  2L5Q A;  4LDV A;  4Q5W A;  1OZ3 A;  5FU7 B;  2XDD A;  3OYG A;  3CCQ A;  3G4S A;  4TVR A;  4XQ3 A;  1X6O A;  2DVE A;  2KAF A;  2QDY B;  3HKS A;  4C92 D;  2RJF A;  2HBP A;  3EFS A;  4OVA A;  4PJO C;  2ZPE B;  3MEW A;  3QHS A;  1XOV A;  1AHJ B;  4FL6 A;  1N8R C;  2DJZ A;  4NL3 A;  4C8Q G;  3H8Z A;  3OYH A;  1WGS A;  3QBY A;  3CCM A;  1YBY A;  2HAX A;  5CVI A;  1VQP T;  4MZT A;  1B34 B;  2WSF E;  4HKE A;  4M77 E;  3JCM f;  3ZEH A;  3JB9 H;  4HCB A;  1JBM A;  2BIV A;  1UGQ B;  2RHZ A;  4XTV A;  3L42 A;  3SD4 A;  1TH7 A;  2JTM A;  5KE3 A;  3OS5 A;  2R58 A;  1OI1 A;  1SSF A;  5CKB A;  3HFO A;  2RHU A;  1QP2 A;  1RI0 A;  4F7U F;  3O8V A;  3M5A A;  3MEU A;  3CCE T;  2P4T A;  3DLM A;  3JCM P;  2RI2 A;  4XK8 E;  4C0D C;  2ZPF B;  4D6W A;  1VQ6 T;  5GAO m;  2F5T X;  4BY6 B;  1VQ4 T;  2V8I A;  2ZGW A;  3CC4 A;  4ZGJ B;  4ZN1 A;  2CZ7 B;  2IVW A;  1K8A C;  3PMT A;  3CC2 T;  4C92 E;  2Y90 A;  4BDY A;  1H3Z A;  5GAN 4;  4DQ2 A;  3RIR A;  1VQ9 A;  1NJI U;  2KY9 A;  4HA8 A;  4C8Q B;  5DY9 A;  3CCJ T;  2VC8 A;  2OTJ T;  3CCS T;  1U1T A;  3FB9 A;  3LWH A;  4IUR A;  2QEX T;  4A4H A;  1X01 A;  3OYN A;  4O5V A;  3L2Z A;  1FXX A;  3OS1 A;  3JCM J;  2K5I A;  3OBW A;  3RKW A;  1KG1 A;  1WJQ A;  2HD0 A;  4BB7 A;  3V7S A;  4WF2 A;  5GAN 6;  2G3R A;  1YIT A;  2EYQ A;  2RM4 A;  2KK4 A;  5I2M A;  2HQE A;  2EFI A;  2QA4 T;  3JB9 J;  4A53 A;  2ZPG B;  2X4Y A;  1M90 U;  4JJN K;  4EMK C;  2PVO B;  1VIE A;  3MP1 A;  4A4G A;  4M75 F;  3OYI A;  3G71 T;  1KD1 C;  4LDW A;  1LOJ A;  2LVM A;  1YCY A;  5A0G A;  3KXT A;  2KDS A;  4PJO D;  2DPP B;  4J6W A;  5L8R E;  1Y07 A;  1VQN A;  3EAE A;  3JCM Q;  4B9X A;  3M9Q A;  3PFS A;  4M78 F;  2K3Y A;  4M7A F;  1G3W A;  3HFN A;  3JCM W;  3OYJ A;  1X75 C;  3H6Z A;  4L6V 5;  2R5A A;  3QKJ A;  2RK2 A;  3JRZ A;  3QXE B;  4OMF B;  4EMK B;  1V29 B;  2ZZD A;  1YJW A;  1Y96 A;  3JCM d;  1XTD A;  2DXT A;  3X28 B;  4R56 A;  3GPL A;  5I2S A;  3BY7 A;  3JB9 G;  4XAX B;  2DD4 A;  1NJI C;  2CYZ B;  4JUV A;  3CME T;  5FRM A;  2QTX A;  2DIQ A;  2M0O A;  5GAO l;  1YJN A;  1QVG S;  2WSC E;  4RCB A;  3NTK A;  1QW1 A;  3JCM g;  4EMG A;  3QO3 A;  4C8Q D;  4J6Y A;  2RK1 A;  4PLL A;  3CCV A;  3PT9 A;  2CZ6 B;  3VV0 A;  5CKF A;  2EWN A;  1S72 A;  4HT8 A;  3OYC A;  2XID A;  4Y28 E;  1VQ8 A;  3SWN B;  1WJS A;  5GMK i;  1U8R A;  1M90 C;  4N4G A;  1UGS B;  2M9U A;  3EFR A;  3JCM h;  3A8G B;  3GF5 A;  3HP9 A;  4ZGD B;  2PVD B;  3QUI A;  5CO7 A;  1KC8 C;  3CCU T;  3ZBD A;  1JRI A;  4F7U A;  4ELY C;  3JCM b;  5GAM d;  3CMA A;  5CCA A;  2M16 A;  2XDP A;  3FEO A;  3F70 A;  4M77 F;  4GY5 A;  2DZC A;  3X20 B;  4OF1 A;  5LJ5 e;  1YHQ T;  2XU8 A;  2D6F A;  1Q82 U;  1OZ2 A;  4JRQ A;  1U1S A;  4NS5 A;  2LRQ A;  3GNF B;  1WQ7 A;  2Y4X A;  3CXC S;  1HK9 A;  1NPP A;  3FJP A;  1QVF S;  1BIA A;  3A8L B;  2C06 A;  1VQ5 A;  2O4X A;  1N6A A;  2PU9 B;  3CD6 A;  2PUK B;  3DB4 A;  5CIU A;  5J3B A;  5CAI A;  3C12 A;  3R6O A;  3DLL A;  4C8Q E;  4PJO G;  1VQK A;  3ER0 A;  2RHX A;  2OTL A;  2MF2 A;  1Q81 U;  2LCL A;  2LT1 A;  3L2R A;  4MDW A;  5DLO A;  5GAM h;  2E5Q A;  2DAQ A;  2DIG A;  3QJY A;  3CCM T;  2LDM A;  3M53 A;  4LDX A;  5GAM e;  3RUX A;  4X9D A;  3Q1J A;  4JRP A;  2CZ0 B;  1K8A U;  1VQL T;  4J7F A;  4XTW A;  2XI9 A;  5DLQ E;  1BYM A;  1BI2 A;  1VQM A;  4XU1 A;  2RHI A;  2V8K A;  3UWN A;  1I5L A;  2LTO A;  2QQR A;  1JB0 E;  3OMG A;  3NFC A;  5IN1 A;  2MMP A;  4M75 A;  2VXE A;  4BE2 A;  2E70 A;  3LGL A;  4M7D A;  1I81 A;  2L3R A;  2WAC A;  1MGQ A;  2GQV A;  2K5L A;  3SFM A;  4A4K A;  4QVD A;  3M57 A;  3CBP A;  4RKU E;  4QVC A;  3QII A;  4M78 A;  4E7J A;  1Q82 C;  2RB6 A;  3CCR T;  3BW1 A;  2JZ2 A;  2X35 A;  2DEQ A;  3VUZ A;  4M7A A;  3CC7 A;  5AYF A;  3MP6 A;  1N9R A;  2RJD A;  3OW2 S;  1BI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...