4LD9K

Crystal structure of the n-terminally acetylated bah domain of sir3 bound to the nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
214
structure length
210
Chain Sequence
AKTLKDLDGWQVIITDDQGRVIDDNNRRRRGGENVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIKIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The N-terminal acetylation of Sir3 stabilizes its binding to the nucleosome core particle.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Nuclear protein/transcription/dna
molecule keywords Histone H3.2
total genus 32
structure length 210
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ld9K00
4KUDK 4FT2A 4KUIA 1ZBXA 4FT4A 4JJNK 2FVUA 4DOWA 4KULA 2FL7A 4BB7A 1ZHIA 4FSXA 1W4SA 3PT9A 4DOVA 1M4ZA 3PTAA 4DA4A 3TU4K 4LD9K
chains in the Genus database with same CATH superfamily
3QYGB 1QWEA 5FU6B 3EGXA 2XG8D 4QQ6A 5KH6A 3JCMJ 1JB0E 4LN2A 4HT9A 4ZTJA 3OA6A 2BKDN 2LTOA 3OYGA 2R5AA 2OTJT 2YUQA 1VQ8Q 1ABOA 4FYWB 3HFNA 2O4XB 1S72Q 3G71Q 1LJOA 1VQOA 2QI2A 3CCEA 3EG3A 4M78A 3TCJA 1UG1A 4C0ZA 2VV5A 2KYMA 1WXBA 2P0QA 3OS0A 2MIOA 1V29B 3QG1A 4X9DA 1M8VA 1XQHA 4C92D 1BCMA 2L3PA 4HCZA 2ESWA 5L8RE 1YJ9T 3PTAA 1YJNA 2QGFB 4M7AD 4C92E 3H9NA 1KQSP 5FU7C 1QKWA 4F7UB 1N9SA 4RTVA 3S3OA 2PTKA 2QA4Q 2MYSA 1WHHA 5CR2A 5HY6A 3CCRA 3OBWA 2HCKA 2DL5A 3JCMh 1D1BA 2ZPEB 2MAMA 2CDTA 1E6GA 4JJCA 1YP5A 1PNJA 1YN8A 1WHKA 4AFZC 2NUTB 1F1BB 4IURA 1YIJQ 1X01A 3EFRA 1WJRA 2FB7A 5A0LA 1IXDA 4J6WA 1NPRA 3LH5A 4EPCA 5FWCA 1MMAA 2YXYA 5DLQE 1M1KR 1X2QA 1MMNA 3I5RA 1AWJA 1KD1C 5CQYA 1VQNT 3M0TA 2CKKA 2EQUA 2OX7A 3CCJT 3R6NA 2AT1B 1NJIR 2FPDA 2HAXA 4HKEA 4EMHA 3GPLA 3VUZA 3M58A 1WXUA 2DILA 3C94A 1D3BA 4C92A 1QCNA 2W0ZA 2ZPBB 3G71T 1QVFS 2EJ9A 3BY7A 1WGSA 1O75A 1OOTA 1M3CA 3O8VA 2XICA 2DERA 4EMKC 1OI1A 3UA7A 1KK7A 3LH0A 1UJYA 3I56A 3ZEHA 2VGMA 1N8RU 1X69A 2L0AA 3HSBA 4GY5A 2SRCA 1T3LA 1VQPQ 1UHCA 1SKUB 1D0ZA 5D6WA 5J3BA 2RMOA 1LPLA 1X75C 4NOYA 4LE9A 5I11A 2J6FA 1K9MC 3G6EQ 1I8FA 3PGGA 4LUDA 3CCJA 2JNGA 2M1HA 1BKBA 4X34A 4BE2A 5KYXB 3QBYA 3E9FA 1IO6A 4M7DF 5GMKi 5IH2A 4CC3A 2D9TA 2X35A 2QEXQ 3QIIA 2MMPA 4XQ3A 3NTIA 1M3AA 4FYYB 3WXMB 5GMKj 3PIOA 3LW5E 1KD1R 1IREB 1TUDA 2CT4A 1OZ3A 1M1KC 1BI2A 2Y90A 5GAN5 2RB6A 2P0KA 4PJOD 1Y07A 1WDXA 1YITA 2EQJA 2HBWA 4FYXB 3UPUA 3RR6A 3MP8A 4M7DC 3AHUA 3RUXA 5IHKA 2DE0X 1I81A 2JM8A 2RJDA 4QW2A 2NUPA 3OYKA 2WSCE 4DBRA 4JPBW 3OYCA 1Z9QA 4K11A 4OMOA 2EJGA 3JCMV 1UGRB 4M77F 1M8MA 1B34B 3QWXX 4KUIA 1R0BG 5LJ5e 4EMGA 1EX4A 2HNIA 2ZPHB 4M78C 3H41A 2X3XD 3QO3A 4KT0E 4OB3B 1Y71A 1GXIE 3CBPA 2RA2A 1BIAA 1EIFA 2CUBA 4DBQA 3VS4A 2VXFA 3PE0A 2FG0A 4C8QB 2FHDA 4JJDA 4J9EA 1WJQA 2K79A 3CPFA 2Y4XA 4J9BA 1SHGA 2ED0A 3QZ5B 5CIUA 1KQSA 1KG1A 2X4YA 2ROTA 4XK8E 5IN1A 2EQMA 2OTLA 2VXEA 2QASA 3CC2Q 3EFOB 1VQLA 1M4ZA 2M0YA 1Q7YU 4E47A 1Q7YR 1X43A 5D7UA 4EDUA 2CSIA 1G2BA 3CCSQ 3CCVQ 2F1LA 2JUFA 4N4GA 3CPWS 3G4SQ 2JXBA 3EGXB 3M53A 2JZ2A 1OQKA 3X24B 5AT1B 5KYUB 2R58A 2F5TX 2QQRA 2E10A 2ZGWA 1C0MA 3HRUA 4E7SA 2QTXA 3IQLA 3JCMX 1NLOC 4RUGA 4CC4B 2AHJB 1SRLA 2L3QA 3NHNA 4HXJA 2LP5A 1W70A 3E9GA 1H3ZA 3CMET 1H92A 2KGTA 3DLMA 1K73R 2P4TA 2COZA 1BU1A 1Q81U 2CUDA 4RG2A 3SD4A 3CCQT 2CGHA 4FT4A 2LMJA 4JRQA 2CP2A 5HCKA 3X25B 4BDYA 5I2MA 4M7AF 3OS2A 2O9VA 4LDYA 2GCXA 1W4SA 1PHTA 1PSEA 1K8AU 2RN8A 2DEQA 5HK0A 4WF2A 1GFDA 2YWWA 2RHXA 4JLGA 2BUDA 3VJPA 1RAAB 2EPDA 2O31A 3VS6A 4KULA 1Q82U 4JRIA 3RERA 1GCPA 2GTOA 2V26A 2YT6A 5KCHA 3OQ5A 1YFNA 1YHQT 3H8ZA 3MO8A 3L2VA 1D1AA 5GAN4 3CD6A 1K0SA 2DO3A 3MHXA 5FRNA 4ANJA 4M7AA 5FW9A 1D0YA 4RCCA 5HKCA 3OYYA 4II1A 4PJOB 4IUPA 5CCAA 2M9UA 2V8IA 5HK3A 2RO0A 3N5BB 4JZ4A 2EQIA 2BZ8A 1Z9ZA 1YJWA 1M27C 1T3SA 1I5LA 5LJ3f 3CXCP 1CKAA 1AZEA 3MEAA 3OSVA 2RHYA 1FMKA 1VQKQ 3V7SA 5KCOA 2KAFA 2R57A 1VQMQ 5CO7A 5FU6C 1VQKA 4C0FA 2L3SA 2HQXA 3JCMc 1Q86U 4BI4A 3A5ZB 1ZX6A 2JMAA 1KC8C 3EG9A 3CMEQ 1PG5B 4M77B 2AZSA 1VQMA 2AKLA 4IKFA 1U06A 1FMVA 4J7FA 3L1AA 4GBQA 1FWZA 4PJOC 1IHVA 2E6ZA 3CC7Q 1NJIU 2LCCA 3O5ZA 1G3SA 3VS5A 1RAHB 1PSFA 2EYWA 4C8QG 3OYLA 5L23A 1W2BS 1SSFA 4JJNK 2K6DA 1BBZA 1DJ7B 2NWMA 1IGUA 3D7SB 3SDZA 3I56T 1W1FA 1MMDA 1VQ4A 3M5AA 2KXDA 5CKFA 1KQ2A 2RQRA 1VQ9Q 4C5EA 4QQDA 2PUOB 4HCCA 1UTIA 3CCMQ 1OX8A 2DJZA 1VQPA 2E65A 1I5OB 2HL3A 1QLYA 4BY6C 1QP2A 2FL7A 2FZKB 5IT9E 3META 2QGGA 3QJYA 1VOMA 2CS7A 3L2WA 2GF7A 1PRMC 1RI9A 4EMKA 1KSWA 1Q86C 2P0PA 1Q81R 3EGDB 5CKBA 2QEXA 4JS5A 3V8KA 3EGUA 4OMLA 3R6OA 2M02A 3L2ZA 3CCQQ 1N8RC 1QWFA 1VQ7Q 1UECA 3TREA 3CXCA 1MNDA 2JS2A 3V8LA 1M90C 1CSKA 4C5IA 1S72T 2HEQA 4J9DA 4ZN3A 4OMFB 2K3YA 2ZCFB 5J39A 2CZ0B 2RF0A 1MHNA 2C0IA 2F2WA 4LNPA 4C0DB 2KROA 3KBGA 4J9IA 4FW2A 2DMOA 3I55A 1YHQA 1S1NA 1N9RA 3PMTA 1YIJT 1RLQC 4A63B 3JB9H 3I55Q 2BZXA 2XHCA 2K2VA 4PNOA 5J26A 4AT1B 3J80E 2K3XA 5GAMe 1TU0B 3GLXA 2NUTA 4BY6B 4FIBA 2RK2A 3LGFA 1JU5C 3P8BB 3QSUA 3OW2P 4FSXA 2XDDA 4OMPA 1KD1U 1MV0B 1S72A 2J6KA 4FU6A 3OYIA 3LWIA 2JTFA 2K2MA 3JCMf 2RJEA 1VQ5Q 2QQ9A 3U23A 8AT1B 5GMKe 1AD5A 4E7IA 2VUBA 1VQ5A 2D6FA 2PQWA 4KGXB 2YRCA 2CT3A 1VQPT 2DD4A 3TEEA 3M9QA 1R0CB 4OGCA 1ZBXA 2FRWA 1WYXA 2IVWA 1TWBA 3REAB 3LX7A 3NMZC 1JEGA 2BTTA 3I35A 2FZGB 1M5Q1 2V8JA 2ZAEA 3PNWC 1M2VB 2RJCA 4BACA 1BI1A 4O6JA 3MKDA 1VQOT 1YIJA 2Z0WA 1NYFA 2IIMA 4JJBA 2OTLT 1FMWA 3GBQA 4PKCC 1PKSA 4BI8B 1FXXA 3H0HA 1ABQA 3GP8A 2MF2A 1ZUYA 2AIRB 2E3IA 3MEVA 1BB9A 3HTRA 4M4ZA 4A4HA 1TUGB 2LT1A 3TQ7P 4OMNA 2M0OA 5GAMh 1WNLA 5D6YA 1VA7A 1VQ8T 1PKTA 3M0RA 3SB2A 2QQAA 2OTJA 4ZGEB 3MP1A 2CYZB 2E12A 4Y91A 2LJ0A 1FX7A 3MEWA 3KXTA 5GMKm 4M7DE 3CC4T 3SFMA 2EGAA 4Z02A 2XMFA 3RNJA 1GCQC 2RPNA 3LLRA 3ULRB 2A08A 1K9AA 1RLPC 2HSEB 2DL4A 1YJNT 1VQ6T 1WQWA 1T0JA 1KIKA 3VU3C 1SEMA 1ZA1B 3DLLA 1WX6A 4ZNXA 4RCBA 2M51A 5IXFA 3G1JA 1UFFA 2ECZA 4NL2A 1NBEB 3BFMA 4PK4A 4Z89A 5GAN7 5I2SA 1U1SA 1VYVA 1QVGP 1WI7A 2L2PA 1U3OA 3CCVT 1YI2A 3JAME 3L2RA 1UB4A 1ZSZC 5GAOl 2DKGA 4J9FA 2EIFA 4FCYA 2I0NA 3VUBA 2QG9B 3M0UA 4YTLA 1SPKA 2QQBA 4DEYA 2D1XA 3EGDA 4XU1A 3C4SA 3L2UA 2LNHB 4ZGDB 2GGRA 2KK4A 2XKOC 5GANf 1N6AA 2F5KA 3CCLT 3RIRA 1UGPB 1K8AR 4M7DB 4M78G 4ESRA 4ELZC 2LZ6B 3CQTA 3OBYA 2YSQA 3UDCA 3INZA 1E7OA 1YJWQ 4RTXA 3REBB 1O9SA 3H0IA 4C8QC 1HD3A 1EFNA 3M4GA 5LJ5d 2P4RA 1X6OA 2QAZA 3I5SA 2ABLA 4E7JA 1YWPA 1QVGA 1UJ0A 3G71A 2DTOA 3S6WA 1U1TA 2DEUA 4Y28E 4FW1A 2EYXA 4FYVB 1K76A 2X9HA 2DL7A 1WHLA 4X9CA 4QQGA 2OI3A 1KQSS 2K57A 2RQVA 2JM9A 3AT1B 2HL5C 4VUBA 1BK2A 1JXMA 4FSSA 1VQNA 3RKWA 1YNZA 5LJ5g 4IIMA 1PD1A 1RAEB 2DPPB 5LL6S 3S3MA 3H0FA 3GNFB 3MEUA 3MJXA 2LVMA 1QVPA 3EG9B 4KH0B 2V1RA 1Q86R 4RTYA 2KRSA 2QDYB 2OTLQ 2EFIA 2KRNA 7AT1B 3SEMA 1I07A 3A8LB 4EMKB 1A0NB 2E5QA 3HHTB 1AVZC 2DYBA 3I56Q 4AG1C 2HZYA 1R8OB 3QYHB 2LQKA 2LT4A 1JO8A 1YJ9Q 1ZBJA 1B34A 4ELYC 1OYXA 4M78F 1JQQA 9ATCB 2E1HA 2YRVA 1IB8A 2VGNA 4XTZA 5GAMd 3JB9J 2COYA 1W2BP 1PM3A 5A0GA 1SHFA 4DQ2A 4MDWA 1M1FA 1RAIB 5KYNA 2ZPGB 4KRTA 3VRYA 4P5NA 5GAN3 1D0XA 5EG2A 2J6OA 3CCQA 3UWNA 3CMAQ 3MCAB 1HJDA 2MPXC 3JSCA 3SWNC 2YUPA 1M3BA 2X51A 4D8DA 4QVDA 1U8RA 4LDXA 2ROLA 4M7AC 3OYHA 2A36A 4AG2C 2LQWA 2HD0A 1ZSZA 4F7UA 4C92F 3OSSC 4OF1A 3CD6T 4X1VA 1IZ6A 4F14A 3F70A 2D0NA 1TH7A 2B8AA 4BE1A 1X6BA 5LJ3h 3OMCA 4RTUA 2KBTA 2CP3A 1TUCA 1NG2A 3C0CA 3VS2A 2JOYA 4PLLA 3S3NA 3QHSA 3UT1A 4QKUA 2QQSA 1ZUUA 3JCMQ 4XTYA 3OYNA 1GBQA 2LJ1A 3M0SA 2RNAA 4R56A 4OP0A 1NLPC 3VS1A 4XU0A 2D8HA 2HSPA 3CBMA 2FEIA 4J7IA 3FIFA 2XIDA 5IAYA 1AWOA 1M1GA 1ARKA 2L8DA 1YJWT 2LC4A 2K4YA 3E2UA 3BW1A 1Q82R 3CC7T 1N5ZA 4E7ZA 3WVEB 1Y57A 3GF5A 5LJ5j 2MK5A 2CH4A 4QT7A 1QCFA 1UGQB 4J9GA 2E41A 4F7UF 3EFOA 5DM7R 4F04B 4BUGA 1UUEA 1R77A 1BI0A 2VASA 1KC8U 5GAMj 3HRSA 3VS7A 3X20B 4E6RA 3JV3A 3CBOA 4PJOG 2VWFA 2DX1A 1VQ6Q 5IXBA 2DTIA 4E2FB 1KFZA 4PL6A 1RAFB 1TG0A 3CCSA 3CCRT 2KSSA 3E19A 1ZA2B 2PVOB 1PWTA 2O88A 2OAUA 3CCUQ 2FRYA 3CEYA 3HFOA 1QP3A 3L2QA 1TOVA 4O5VA 1N27A 2DIGA 5GAMg 4J9HA 2E5KA 2RQWA 3GIBA 2LQNA 3NTHA 2LCLA 3FRNA 1OV3A 2PVDB 3G7ZA 2QEXT 2K5FA 3CC7A 3G4ST 4PJOE 1H641 4NS5A 2AKKA 1OU8A 1WHMA 2J05A 3QWYA 4MZMA 3KUFA 5KYWB 2MI6A 1RI0A 1M90U 1H8KA 1SSHA 2C06A 2ENMA 2F69A 2XI9A 4PJMA 3CCMT 2YUOA 4PJOA 1M2VA 1C1AA 3M4YA 2CZ6B 2LX7A 2LNVA 2DRKA 2X3WD 3HRTA 2RD1A 5A0DA 4OVAA 3HKSA 1TTHB 1VQOQ 4JUVA 2E70A 3JCMP 3JB9G 1Q82C 2RQTA 2EKOA 2LCSA 2WSFE 1NM7A 4A4GA 2D0QB 2L89A 4C0DC 3A98A 3C12A 2RI5A 4A4FA 3PFSA 3T9NA 2MCNA 3J81E 4N4IA 2CP0A 1HXDA 5KE2A 4F16A 1K73U 2CP7A 2AZVA 1SRMA 2WACA 1W6XA 4BDZA 3GOXA 2YUNA 3A8HB 2F2XA 2LX9A 3TSWA 3EH2A 4DOWA 4MDXA 2KY9A 5LJ5f 1M30A 4J9CA 1K8AC 2KT8A 4J6XA 3EFSA 3P8DA 2JMCA 1MGQA 2EWNA 3VYGA 2JTMA 3PVQA 4C5HA 2HMAA 4XU2A 2XDBA 1LCKA 4A54A 2H8HA 2DXTA 3CCLQ 4F17A 1MV3A 4TVRA 4HCBA 2DETA 1BI3A 2FPFA 4M77A 4RKUE 1ZHIA 1VQ8A 2Y4YA 1YITQ 5LJ5h 2JJ9A 1UEBA 3V7CA 5LJ3g 3OYAA 4IUQA 2K9GA 1KC8R 2CZ7B 5IHIA 1HK9A 3OS1A 3BDUA 4C8QA 5GAN2 1NYGA 4GLMA 2G6FX 4D8KA 2DL3A 4HCKA 5C6SA 2J7IA 2L5QA 1Y96B 3JCMg 3G6ET 4C92C 1IGQA 3VV0A 3VYHB 3M56A 4FL6A 1AT1B 1K0XA 4C8QF 3RMSA 2GTJA 1PD0A 2EYZA 1Q95G 5KYWA 1I0CA 3OB9A 4KUDK 2DIQA 1VQNQ 2KI7A 1WQ7A 3FC3A 1VQLT 1RADB 4IUUA 2JT4A 4A4EA 3CD6Q 3EG2A 3PVLA 4M77G 2V8KA 4DBFA 3CCRQ 1VQ6A 5GANj 1VQ9T 4M78E 2KT1A 1JXOA 1AHJB 1IHWA 4ZN1A 1UDLA 3HL8A 3CPWP 1WPYA 1D09B 3X28B 3EHRA 4MZPA 1JJ2S 3OYMA 2K5IA 4OMMA 1QVFP 1ACMB 2NYSA 3JCMb 1AZGB 1WIEA 2DXBA 1K73C 4L5GA 3G4SA 2PVGB 3A1PA 3EH1A 3TU4K 4ORZA 1VQ7A 3L42A 1WXTA 1GFCA 1OZ2A 1H3HA 3UF4A 1Q7YC 2DVJA 4XTUA 1NJIC 4OGEA 4CI0C 3FEOA 4RTTA 1AWXA 2R5MA 2LJ3A 4PJOF 2G3RA 3CCUT 1RUWA 1BIBA 1Y0MA 2XU8A 2EAYA 2A7YA 2P84A 2GQVA 4M78B 1W2BA 5IHNA 2XK0A 4AFQC 2EKHA 4C0GA 2DL8A 1K4US 4PLIA 3THKA 4JRPA 3TVTA 3ER0A 4IUVA 1KQ1A 5GJWB 3VS0A 4N4HA 1AWWA 2FZCB 3VS3A 4M77D 1GL5A 2DFUA 2A3LA 2KXCA 2DK3A 1WZOA 3FLGA 4AMCA 4MZTA 3CC4A 1YWOA 1QMCA 5GAN8 1PRLC 3CC4Q 4XTWA 4LXCA 4F7UE 3M0PA 1NE8A 1VIFA 2W10A 5CAIA 2K5LA 1G5VA 2O9SA 1BCOA 2X4JA 3CCJQ 4E7LA 3SHWA 3CPWA 2KVQG 4L6V5 3FDRA 5CKDA 2K3BA 2DXUA 2RH2A 1M9SA 2OJ2A 1NEBA 3RKYA 4RTZA 4BI3A 2RHZA 1I1JA 2KNBB 4LUEA 5GAOm 5GANg 3M57A 4NL3A 2KE9A 4CC7A 3KFVA 2O4XA 2KEAA 2E6NA 2KRMA 4XTVA 1IRXA 4B6MA 2CSQA 1XTDA 1G8XA 4Y92A 3CCVA 5CQXA 1YI2T 2DNUA 3EG0A 2EW3A 2MWPA 4CRIA 3CCUA 2RM4A 5GAN6 1GBRA 1Q81C 3FJ5A 2ZPIB 5FLXE 4XU3A 3NTKA 1TSFA 4AFUC 4L59A 2I2LA 4C92B 1ZSGA 1QCOA 4OB2B 2WSEE 1E6HA 2DZ9A 5GANd 4E7KA 4M75D 4B9WA 3VRZA 4MMKA 3MP6A 3VKIA 1XNIA 2YRDA 2JS0A 3Q1JA 4JS4A 2LRQA 1B7TA 4QVZA 4A53A 4PFOA 3HP9A 3ZBDA 1M1KU 3WVDB 1WHGA 2JW4A 3V8JA 2YHTA 3NGPA 1B3QA 4BE0A 5C0MA 5M9OA 1VQ9A 2VB6A 2EVRA 3TSZA 3JB9D 2HKNA 1RL2A 2JVVA 4FM4B 1VQ4Q 1G3TA 5I21A 4M75B 2DA9A 1VQ4T 2QK0A 4JZ3A 1D3BB 3ZL7C 3J7AF 2PNIA 4M7AE 2DZCA 4KBMB 1JJ2A 2QA4T 3FJPA 1VUBA 1VIEA 1QVFA 1UE9A 4R55A 3SWNA 1GCQA 5GAMf 3OYFA 1K9MU 1LNXA 2HQEA 1K9MR 1Y7XA 1YCYA 1U5SA 2GBQA 2VC8A 1VQ7T 1G3WA 1UHFA 2RHUA 1LVKA 2GQIA 2GFUA 2PZ1A 3H6ZA 1WHJA 3BDLA 4JLIA 4KH1B 5GMKl 2PU9B 2V1QA 3JCMe 2CP5A 2YLBA 1NZ9A 2O2OA 3PT9A 1T0HA 1HSQA 2DYIA 3OY9A 4N0AA 1K1ZA 1WJSA 5LJ3j 2C0OA 4OB1B 4JDSA 1OULA 5KE3A 3ME9A 4C8QD 1UGSB 3OYEA 2EYYA 4N0AC 3UATA 1BYMA 2ZZDA 1FYNA 2RQUA 2LQ8A 4QVCA 4M75C 4BD3A 1X2KA 4M7AG 2J06A 2DRMA 2HQHA 2QDLA 5GMKh 1I4K1 3CMEA 4PFPA 5FRMA 2H3JA 5ECAA 2C0TA 3LGLA 3E1SA 2YDLA 3RMQA 2VVKA 4RG8A 2HKQB 4PJLA 2SEMA 3OYDA 2D8JA 1GRIA 2AK5A 3A8MB 5DY9A 1WA7A 3X26B 3BE3A 3RBBB 3HPWA 5KYUA 3DB4A 1MUZA 5AYFA 1YJNQ 2A37A 3EG1A 5GAOr 1QQJA 4M75E 2QA4A 4OB0B 1ZQ1A 2DBKA 1XJWB 4M78D 3JRZA 2QYZA 3URGA 4CC2A 4UC4A 2HDAA 2K7AA 4A4KA 3JCMd 3QZ9B 2PUKB 3OS5A 5CK9A 4RMOA 3CC2A 2M16A 2FYKA 2BE9B 4Z8AA 3M54A 4DEXA 1EZZB 2COWA 3ASKA 5CVIA 4DBHA 2E64A 1WLPB 1QVGS 4PJNA 2EGCA 2RK1A 1PCXA 5CKEA 4Q5WA 5D6XA 3QDFA 3C95A 3QKJA 1OU9A 3NFCA 2JTEA 4V2SA 1Y96A 2OTJQ 3UA6A 5FROA 1VYTA 1J3TA 1ZSZB 5GAOp 4E7HA 3DKMA 3CMAA 1XOVA 2BZYA 2EBPA 2X4WA 1N8RR 3OMGA 4J5YA 3QJ6A 3LYIA 2DM1A 2NUZA 2O01E 2B86A 2BE7D 3OYBA 3A8OB 4WTOB 3RESA 1M2OA 2EJFA 2KDSA 2FO0A 2KMTA 4OMQA 2DTHA 4DA4A 1RABB 2A28A 4LD9K 5EC7A 4IIOA 4JRKA 1AOJA 4J6YA 1CKBA 4HVUA 2DF6A 1ZUKA 4C5GA 4HA8A 4LD6A 2F2VA 8ATCB 1WFWA 3CMAT 5GANe 1HYOA 2MOXA 1RAGB 2VKNA 1KJWA 3I9QA 3M59A 4WCIA 2DAQA 4KGZB 4LDWA 4J83A 1KHCA 1JJ2P 6AT1B 1YI2Q 1G3YA 1P92A 3QXEB 3CCST 1TS9A 5KYYA 3OYJA 3CXCS 1V1CA 3DB3A 3QPHA 2KYBA 4M7DA 2DBMA 1X27A 2XD0A 3CC2T 5CKHA 3G6EA 5FWBA 1B07A 4EIKA 2H3EB 2EQKA 3RKXA 4C8QE 2GNCA 1NEGA 3M55A 4XTXA 4HT8A 3ZFJA 2RI3A 2CH4W 4F7UG 2DVEA 2RI2A 3OW2A 2E3HA 2NUPB 4GLKA 2RJFA 1C6VX 2EGEA 3CCET 1AEYA 1KHIA 1SG5A 4M77E 2QTVA 2CREA 5FU7B 4C92G 5GAOq 4DOVA 2MWOA 2KR3A 1JBMA 1YITT 4M7DD 3GNGA 1YHQQ 2DJQA 3QUIA 3CCLA 2CP6A 2E4HA 1LOJA 2L3RA 4RTWA 2KQWA 1JRIA 3LWHA 3NPFA 1QKXA 3A8GB 5LJ3d 4M7AB 3PMIA 1PC0A 2IG0A 5GJVB 3OW2S 3CCEQ 1D1CA 4M77C 4PFZA 1YCSB 2YLCA 2EYQA 2OAWA 2X4XA 1RACB 5GANh 4ZTFA 2HBPA 3RDVA 1NPPA 2GFAA 1OEBA 4M75F 4B9XA 2XDPA 4J8OA 3MPUB 1TXQA 2A0FB 2JN0A 4PJJA 1OPLA 1OPKA 3JCMW 2BIVA 1MNEA 3FB9A 3PIPA 5DLOA 4M7DG 2CZ1B 1MMGA 4ATOA 2DXCA 4XAXB 1VYUA 3EAEA 4LDUA 5LJ3e 2QXFA 1YBYA 5GAOn 4D6WA 4LDVA 1V76A 1YJ9A 4HVVA 3CCMA 3QDRB 1VQ5T 1SF9A 1VQLQ 3SWNB 3JB9F 4MMLA 4HVWA 4ME7A 4BB7A 2LDMA 1X6GA 3I55T 5A2QE 2NLUA 1M90R 2ATCB 5KYXA 2FPEA 4AFSC 1QW1A 1VQKT 2IPOB 3JB9I 4FT2A 3EHQA 4Z88A 4R0KA 1OX9A 2FVUA 3V7RA 1UGVA 2ED1A 2DLPA 3P8HA 5KYYB 5I22A 2RHIA 3M0QA 1G83A 2DD5A 4M75A 4M75G 4KGVB 2VYTA 4IUTA 1ZLMA 4ZGJB 2ZPFB 1VQMT
chains in the Genus database with same CATH topology
3V7SA 3QYGB 5KCOA 2KAFA 5FU6B 2R57A 2HD0A 2MWPA 5CO7A 4F7UA 5FU6C 4C92F 2XG8D 4CRIA 3CCUA 2RM4A 3OSSC 4OF1A 1VQKA 4C0FA 5GAN6 3CD6T 1IZ6A 4QQ6A 2HQXA 5KH6A 3JCMc 3F70A 1Q81C 1Q86U 1TH7A 2ZPIB 4BI4A 5FLXE 1JB0E 2B8AA 4XU3A 3A5ZB 4BE1A 3JCMJ 3NTKA 4L59A 4HT9A 2I2LA 5LJ3h 1KC8C 4C92B 3OMCA 4ZTJA 3OA6A 2BKDN 2LTOA 4M77B 3OYGA 1VQMA 2R5AA 2OTJT 4OB2B 4IKFA 2WSEE 2JOYA 4PLLA 2DZ9A 5GANd 4J7FA 3L1AA 3S3NA 1FWZA 3QHSA 3UT1A 4E7KA 4PJOC 2E6ZA 2QQSA 4M75D 3HFNA 2O4XB 4B9WA 1NJIU 2LCCA 4MMKA 3JCMQ 1G3SA 3MP6A 4XTYA 3OYNA 1LJOA 1PSFA 1XNIA 3VKIA 1VQOA 4C8QG 2QI2A 3Q1JA 3OYLA 2LRQA 3CCEA 4JS4A 1W2BS 1SSFA 4JJNK 4QVZA 4M78A 3TCJA 1DJ7B 4A53A 4C0ZA 2VV5A 3HP9A 3ZBDA 1M1KU 4R56A 2P0QA 3SDZA 3I56T 4OP0A 3OS0A 3WVDB 1V29B 5FRMA 3V8JA 2YHTA 4XU0A 3M5AA 1VQ4A 3QG1A 3CBMA 4X9DA 5CKFA 1KQ2A 1XQHA 4J7IA 1M8VA 4C92D 3FIFA 2XIDA 5IAYA 4HCZA 4BE0A 5L8RE 4C5EA 1M1GA 5C0MA 1YJ9T 5M9OA 2L8DA 3PTAA 1YJNA 2LC4A 2K4YA 4QQDA 1YJWT 3BW1A 4M7AD 2PUOB 4HCCA 1VQ9A 4C92E 3CC7T 5FU7C 3JB9D 1RL2A 2JVVA 2DJZA 1VQPA 4FM4B 3WVEB 1G3TA 2E65A 5I21A 4F7UB 3GF5A 5LJ5j 4M75B 4BY6C 1VQ4T 1N9SA 1D3BB 1QP2A 3S3OA 3J7AF 1UGQB 2FL7A 5IT9E 4M7AE 3META 2DZCA 3QJYA 4KBMB 1JJ2A 2CS7A 2E41A 2QA4T 4F7UF 3FJPA 2GF7A 3L2WA 5CR2A 1VUBA 1VIEA 5DM7R 1QVFA 4BUGA 4EMKA 5HY6A 3CCRA 3OBWA 1BI0A 1KC8U 4R55A 5GAMj 3SWNA 2P0PA 3HRSA 1Q86C 3X20B 5GAMf 3OYFA 3JCMh 1K9MU 1LNXA 2ZPEB 5CKBA 2HQEA 1Y7XA 1YCYA 2MAMA 3CBOA 4PJOG 2QEXA 3V8KA 4JS5A 2VC8A 1VQ7T 1G3WA 2RHUA 3R6OA 2DTIA 3L2ZA 1N8RC 4IURA 4PL6A 1X01A 2GFUA 3TREA 3EFRA 3H6ZA 3BDLA 4JLIA 5GMKl 3CXCA 3CCSA 3CCRT 2KSSA 2PU9B 1WJRA 3E19A 2PVOB 3JCMe 2FB7A 5A0LA 2YLBA 2OAUA 3V8LA 1M90C 4J6WA 1NZ9A 3PT9A 3CEYA 3HFOA 1NPRA 1QP3A 4C5IA 4EPCA 3L2QA 1S72T 4O5VA 5DLQE 1N27A 3OY9A 2DIGA 4N0AA 4OMFB 4ZN3A 5GAMg 2K3YA 2ZCFB 1WJSA 5J39A 2CZ0B 5LJ3j 4OB1B 1KD1C 1MHNA 4JDSA 3GIBA 5CQYA 3NTHA 5KE3A 2LCLA 1VQNT 3ME9A 4C0DB 3KBGA 4C8QD 3FRNA 2PVDB 3G7ZA 2QEXT 2CKKA 3I55A 2K5FA 3CC7A 1UGSB 3G4ST 3OYEA 2EQUA 1YHQA 4PJOE 1H641 1N9RA 4NS5A 3CCJT 4N0AC 3PMTA 1YIJT 3JB9H 1BYMA 2XHCA 2HAXA 2K2VA 2ZZDA 4PNOA 5J26A 4MZMA 4HKEA 3KUFA 3J80E 2K3XA 2LQ8A 2MI6A 1RI0A 4EMHA 5GAMe 1M90U 3GLXA 4QVCA 3GPLA 2C06A 4M75C 4FIBA 4BD3A 4BY6B 2RK2A 3LGFA 2F69A 2XI9A 3M58A 3VUZA 3P8BB 3CCMT 3QSUA 4M7AG 4FSXA 2XDDA 4PJOA 3C94A 5GMKh 1D3BA 4C92A 1KD1U 1I4K1 3CMEA 1S72A 3M4YA 2CZ6B 2ZPBB 3G71T 4FU6A 2EJ9A 2H3JA 2JTFA 2LNVA 3BY7A 3OYIA 3LWIA 3JCMf 1WGSA 2RJEA 1O75A 3LGLA 3E1SA 3HRTA 2RD1A 2QQ9A 5A0DA 4OVAA 5GMKe 4E7IA 2VUBA 3HKSA 3O8VA 1VQ5A 2D6FA 3RMQA 2XICA 4EMKC 4RG8A 2PQWA 4JUVA 1OI1A 2E70A 3OYDA 3JCMP 3JB9G 3LH0A 1Q82C 3I56A 3ZEHA 2VGMA 1N8RU 3A8MB 2DD4A 5DY9A 1VQPT 3X26B 3HSBA 3TEEA 4GY5A 2EKOA 3HPWA 3DB4A 3M9QA 5AYFA 1QVFS 2WSFE 5D6WA 4OGCA 5J3BA 1ZBXA 4NOYA 1X75C 5GAOr 4A4GA 2D0QB 2L89A 4C0DC 4M75E 2QA4A 2IVWA 4OB0B 1ZQ1A 3LX7A 3C12A 2RI5A 4A4FA 1K9MC 4M78D 3PFSA 3T9NA 3J81E 4N4IA 3JRZA 1I8FA 1M5Q1 2V8JA 3PGGA 3PNWC 3URGA 4UC4A 1HXDA 2RJCA 5KE2A 4BACA 1K73U 1BI1A 4O6JA 3CCJA 4A4KA 2JNGA 2M1HA 1BKBA 4X34A 3JCMd 3QZ9B 1VQOT 1YIJA 2PUKB 3OS5A 2WACA 4BE2A 5CK9A 4BDZA 4RMOA 3QBYA 2OTLT 3CC2A 3E9FA 2M16A 4PKCC 3GOXA 4M7DF 5GMKi 4BI8B 1FXXA 2FYKA 3A8HB 2LX9A 3M54A 3GP8A 2D9TA 2X35A 2MF2A 2MMPA 3QIIA 3ASKA 3NTIA 4XQ3A 5CVIA 4DOWA 2E64A 3WXMB 4MDXA 2KY9A 5LJ5f 1QVGS 5GMKj 3PIOA 2RK1A 3MEVA 3LW5E 5CKEA 4Q5WA 4A4HA 1K8AC 2LT1A 5D6XA 1IREB 3C95A 1OZ3A 3QKJA 3NFCA 2M0OA 1M1KC 1BI2A 5GAMh 2Y90A 1WNLA 2RB6A 5GAN5 4V2SA 1Y96A 2P0KA 4J6XA 5D6YA 3EFSA 3P8DA 5FROA 4PJOD 1MGQA 1Y07A 2EWNA 3VYGA 1VQ8T 2JTMA 5GAOp 4C5HA 3SB2A 2QQAA 2OTJA 4ZGEB 4XU2A 3DKMA 4E7HA 2XDBA 4A54A 1YITA 2EQJA 2DXTA 3MP1A 2CYZB 2E12A 1XOVA 4Y91A 3CMAA 2X4WA 1FX7A 3MEWA 3OMGA 3KXTA 5GMKm 3UPUA 4M7DE 4J5YA 3QJ6A 3CC4T 3LYIA 3SFMA 4TVRA 3MP8A 4HCBA 4M7DC 1BI3A 4M77A 3AHUA 3RUXA 4RKUE 1ZHIA 2O01E 4Z02A 3OYBA 1I81A 2RJDA 4QW2A 3A8OB 1VQ8A 2Y4YA 3RESA 5LJ5h 3LLRA 1UEBA 3V7CA 5LJ3g 3OYKA 2EJFA 4IUQA 3OYAA 2WSCE 2KDSA 2KMTA 2CZ7B 2DTHA 3OYCA 4DA4A 2EJGA 1HK9A 3JCMV 3OS1A 4LD9K 1UGRB 3BDUA 4M77F 1B34B 4JRKA 4J6YA 4KUIA 4C8QA 5LJ5e 5GAN2 1YJNT 4C5GA 4EMGA 2HNIA 2ZPHB 4HA8A 4LD6A 5C6SA 4M78C 1VQ6T 1WQWA 2L5QA 1Y96B 3JCMg 3G6ET 3VU3C 3CMAT 4C92C 5GANe 3DLLA 3VV0A 3QO3A 4KT0E 4OB3B 3VYHB 3M56A 1Y71A 4FL6A 4RCBA 1GXIE 3CBPA 2RA2A 4C8QF 1BIAA 1EIFA 4NL2A 3RMSA 3M59A 2DAQA 2VXFA 3BFMA 4LDWA 4J83A 1KHCA 3OB9A 5GAN7 5I2SA 1U1SA 4C8QB 4KUDK 2DIQA 2FHDA 1G3YA 1P92A 1WQ7A 3QXEB 3FC3A 3CCST 1VQLT 1WJQA 4IUUA 3OYJA 3CXCS 3CCVT 1YI2A 3CPFA 2Y4XA 4A4EA 3DB3A 3JAME 3L2RA 3QZ5B 1UB4A 5CIUA 1KQSA 1KG1A 2X4YA 3QPHA 5GAOl 4M7DA 2DKGA 4XK8E 4M77G 5IN1A 2V8KA 2EQMA 1VQ6A 5GANj 2OTLA 2XD0A 3CC2T 2VXEA 5CKHA 1VQ9T 3G6EA 4M78E 2EIFA 1VQLA 1M4ZA 2EQKA 1AHJB 3RKXA 3VUBA 4ZN1A 4C8QE 3HL8A 4YTLA 1WPYA 2QQBA 3M55A 4XTXA 1Q7YU 4E47A 4HT8A 3ZFJA 2RI3A 4XU1A 3C4SA 2DVEA 3X28B 4MZPA 4F7UG 4ZGDB 3OYMA 3L2UA 2K5IA 4EDUA 1JJ2S 3JCMb 2KK4A 2XKOC 5GANf 1N6AA 2F5KA 2RI2A 3CCLT 3RIRA 3OW2A 1UGPB 4M7DB 2JUFA 4M78G 4N4GA 3CPWS 4GLKA 4ELZC 2RJFA 3CCET 1KHIA 3M53A 2JZ2A 4M77E 5FU7B 4C92G 3OBYA 3X24B 2DXBA 1K73C 4L5GA 2R58A 3UDCA 5GAOq 3G4SA 4DOVA 2F5TX 2QQRA 3INZA 2MWOA 2PVGB 2ZGWA 2E10A 1JBMA 1YITT 4M7DD 3HRUA 3GNGA 1O9SA 2QTXA 3TU4K 1VQ7A 3QUIA 3L42A 3CCLA 4C8QC 3JCMX 1LOJA 1OZ2A 2L3RA 3M4GA 5LJ5d 1Q7YC 2KQWA 1JRIA 3LWHA 1X6OA 4XTUA 1NJIC 2AHJB 4OGEA 4CI0C 3FEOA 3A8GB 5LJ3d 4M7AB 1H3ZA 3E9GA 4E7JA 3CMET 3PMIA 2R5MA 4PJOF 3CCUT 2G3RA 1QVGA 2IG0A 3G71A 3OW2S 2DTOA 2XU8A 1BIBA 3S6WA 2EAYA 1U1TA 4M77C 2A7YA 3DLMA 4Y28E 2GQVA 2P4TA 4M78B 2YLCA 2EYQA 2X4XA 1W2BA 1Q81U 2XK0A 5GANh 4X9CA 4ZTFA 4QQGA 2HBPA 4RG2A 1NPPA 4C0GA 1KQSS 2GFAA 2K57A 4PLIA 4M75F 3SD4A 4JRPA 4B9XA 3CCQT 2CGHA 4FT4A 2XDPA 4J8OA 3ER0A 4IUVA 2JN0A 4VUBA 1KQ1A 4JRQA 3JCMW 3X25B 2BIVA 4BDYA 3FB9A 5I2MA 3PIPA 5DLOA 3RKWA 5LJ5g 1VQNA 4M7AF 4N4HA 3OS2A 4M7DG 2CZ1B 2DPPB 4LDYA 4M77D 5LL6S 4ATOA 2GCXA 3S3MA 1W4SA 3GNFB 3MEUA 1PSEA 2DXCA 4XAXB 2LVMA 1K8AU 2A3LA 1QVPA 2DEQA 3EAEA 4LDUA 5HK0A 2DK3A 5LJ3e 2QXFA 1YBYA 3FLGA 4WF2A 5GAOn 4D6WA 4MZTA 3CC4A 2QDYB 4LDVA 2EFIA 2RHXA 1YJ9A 3A8LB 4JLGA 5GAN8 2BUDA 3VJPA 4EMKB 3CCMA 3QDRB 1VQ5T 2E5QA 3HHTB 4XTWA 4F7UE 3SWNB 3JB9F 4MMLA 4KULA 1VIFA 1NE8A 1Q82U 4JRIA 4ME7A 5CAIA 3RERA 4BB7A 2K5LA 2LDMA 1G5VA 2X4JA 4E7LA 5KCHA 3OQ5A 1R8OB 3QYHB 2LQKA 2LT4A 3CPWA 3I55T 5A2QE 2KVQG 2NLUA 1YHQT 3H8ZA 1B34A 3MO8A 4L6V5 3FDRA 4ELYC 5CKDA 1OYXA 3L2VA 4M78F 1QW1A 2DXUA 2E1HA 2RH2A 5GAN4 1M9SA 1VQKT 2YRVA 3CD6A 2DO3A 3MHXA 3JB9I 2VGNA 5FRNA 3RKYA 4FT2A 4M7AA 4BI3A 2RHZA 4XTZA 4RCCA 5GAMd 5HKCA 3OYYA 3JB9J 4II1A 2FVUA 3V7RA 5A0GA 5GAOm 4PJOB 4IUPA 1M1FA 3P8HA 3M57A 4MDWA 4DQ2A 5CCAA 5GANg 2M9UA 2O4XA 2ZPGB 4NL3A 2RHIA 2V8IA 4P5NA 5HK3A 5EG2A 5GAN3 2RO0A 2E6NA 2DD5A 3N5BB 3UWNA 3CCQA 1YJWA 4M75A 4XTVA 3MCAB 4M75G 1I5LA 3JSCA 5LJ3f 3SWNC 2VYTA 3MEAA 1XTDA 4IUTA 4QVDA 3OSVA 2RHYA 1U8RA 4LDXA 4M7AC 3OYHA 4ZGJB 3CCVA 5CQXA 1YI2T 2ZPFB 1VQMT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KUD K;  4FT2 A;  4KUI A;  1ZBX A;  4FT4 A;  4JJN K;  2FVU A;  4DOW A;  4KUL A;  2FL7 A;  4BB7 A;  1ZHI A;  4FSX A;  1W4S A;  3PT9 A;  4DOV A;  1M4Z A;  3PTA A;  4DA4 A;  3TU4 K;  4LD9 K; 
#chains in the Genus database with same CATH topology
 3QYG B;  1QWE A;  5FU6 B;  3EGX A;  2XG8 D;  4QQ6 A;  5KH6 A;  3JCM J;  1JB0 E;  4LN2 A;  4HT9 A;  4ZTJ A;  3OA6 A;  2BKD N;  2LTO A;  3OYG A;  2R5A A;  2OTJ T;  2YUQ A;  1VQ8 Q;  1ABO A;  4FYW B;  3HFN A;  2O4X B;  1S72 Q;  3G71 Q;  1LJO A;  1VQO A;  2QI2 A;  3CCE A;  3EG3 A;  4M78 A;  3TCJ A;  1UG1 A;  4C0Z A;  2VV5 A;  2KYM A;  1WXB A;  2P0Q A;  3OS0 A;  2MIO A;  1V29 B;  3QG1 A;  4X9D A;  1M8V A;  1XQH A;  4C92 D;  1BCM A;  2L3P A;  4HCZ A;  2ESW A;  5L8R E;  1YJ9 T;  3PTA A;  1YJN A;  2QGF B;  4M7A D;  4C92 E;  3H9N A;  1KQS P;  5FU7 C;  1QKW A;  4F7U B;  1N9S A;  4RTV A;  3S3O A;  2PTK A;  2QA4 Q;  2MYS A;  1WHH A;  5CR2 A;  5HY6 A;  3CCR A;  3OBW A;  2HCK A;  2DL5 A;  3JCM h;  1D1B A;  2ZPE B;  2MAM A;  2CDT A;  1E6G A;  4JJC A;  1YP5 A;  1PNJ A;  1YN8 A;  1WHK A;  4AFZ C;  2NUT B;  1F1B B;  4IUR A;  1YIJ Q;  1X01 A;  3EFR A;  1WJR A;  2FB7 A;  5A0L A;  1IXD A;  4J6W A;  1NPR A;  3LH5 A;  4EPC A;  5FWC A;  1MMA A;  2YXY A;  5DLQ E;  1M1K R;  1X2Q A;  1MMN A;  3I5R A;  1AWJ A;  1KD1 C;  5CQY A;  1VQN T;  3M0T A;  2CKK A;  2EQU A;  2OX7 A;  3CCJ T;  3R6N A;  2AT1 B;  1NJI R;  2FPD A;  2HAX A;  4HKE A;  4EMH A;  3GPL A;  3VUZ A;  3M58 A;  1WXU A;  2DIL A;  3C94 A;  1D3B A;  4C92 A;  1QCN A;  2W0Z A;  2ZPB B;  3G71 T;  1QVF S;  2EJ9 A;  3BY7 A;  1WGS A;  1O75 A;  1OOT A;  1M3C A;  3O8V A;  2XIC A;  2DER A;  4EMK C;  1OI1 A;  3UA7 A;  1KK7 A;  3LH0 A;  1UJY A;  3I56 A;  3ZEH A;  2VGM A;  1N8R U;  1X69 A;  2L0A A;  3HSB A;  4GY5 A;  2SRC A;  1T3L A;  1VQP Q;  1UHC A;  1SKU B;  1D0Z A;  5D6W A;  5J3B A;  2RMO A;  1LPL A;  1X75 C;  4NOY A;  4LE9 A;  5I11 A;  2J6F A;  1K9M C;  3G6E Q;  1I8F A;  3PGG A;  4LUD A;  3CCJ A;  2JNG A;  2M1H A;  1BKB A;  4X34 A;  4BE2 A;  5KYX B;  3QBY A;  3E9F A;  1IO6 A;  4M7D F;  5GMK i;  5IH2 A;  4CC3 A;  2D9T A;  2X35 A;  2QEX Q;  3QII A;  2MMP A;  4XQ3 A;  3NTI A;  1M3A A;  4FYY B;  3WXM B;  5GMK j;  3PIO A;  3LW5 E;  1KD1 R;  1IRE B;  1TUD A;  2CT4 A;  1OZ3 A;  1M1K C;  1BI2 A;  2Y90 A;  5GAN 5;  2RB6 A;  2P0K A;  4PJO D;  1Y07 A;  1WDX A;  1YIT A;  2EQJ A;  2HBW A;  4FYX B;  3UPU A;  3RR6 A;  3MP8 A;  4M7D C;  3AHU A;  3RUX A;  5IHK A;  2DE0 X;  1I81 A;  2JM8 A;  2RJD A;  4QW2 A;  2NUP A;  3OYK A;  2WSC E;  4DBR A;  4JPB W;  3OYC A;  1Z9Q A;  4K11 A;  4OMO A;  2EJG A;  3JCM V;  1UGR B;  4M77 F;  1M8M A;  1B34 B;  3QWX X;  4KUI A;  1R0B G;  5LJ5 e;  4EMG A;  1EX4 A;  2HNI A;  2ZPH B;  4M78 C;  3H41 A;  2X3X D;  3QO3 A;  4KT0 E;  4OB3 B;  1Y71 A;  1GXI E;  3CBP A;  2RA2 A;  1BIA A;  1EIF A;  2CUB A;  4DBQ A;  3VS4 A;  2VXF A;  3PE0 A;  2FG0 A;  4C8Q B;  2FHD A;  4JJD A;  4J9E A;  1WJQ A;  2K79 A;  3CPF A;  2Y4X A;  4J9B A;  1SHG A;  2ED0 A;  3QZ5 B;  5CIU A;  1KQS A;  1KG1 A;  2X4Y A;  2ROT A;  4XK8 E;  5IN1 A;  2EQM A;  2OTL A;  2VXE A;  2QAS A;  3CC2 Q;  3EFO B;  1VQL A;  1M4Z A;  2M0Y A;  1Q7Y U;  4E47 A;  1Q7Y R;  1X43 A;  5D7U A;  4EDU A;  2CSI A;  1G2B A;  3CCS Q;  3CCV Q;  2F1L A;  2JUF A;  4N4G A;  3CPW S;  3G4S Q;  2JXB A;  3EGX B;  3M53 A;  2JZ2 A;  1OQK A;  3X24 B;  5AT1 B;  5KYU B;  2R58 A;  2F5T X;  2QQR A;  2E10 A;  2ZGW A;  1C0M A;  3HRU A;  4E7S A;  2QTX A;  3IQL A;  3JCM X;  1NLO C;  4RUG A;  4CC4 B;  2AHJ B;  1SRL A;  2L3Q A;  3NHN A;  4HXJ A;  2LP5 A;  1W70 A;  3E9G A;  1H3Z A;  3CME T;  1H92 A;  2KGT A;  3DLM A;  1K73 R;  2P4T A;  2COZ A;  1BU1 A;  1Q81 U;  2CUD A;  4RG2 A;  3SD4 A;  3CCQ T;  2CGH A;  4FT4 A;  2LMJ A;  4JRQ A;  2CP2 A;  5HCK A;  3X25 B;  4BDY A;  5I2M A;  4M7A F;  3OS2 A;  2O9V A;  4LDY A;  2GCX A;  1W4S A;  1PHT A;  1PSE A;  1K8A U;  2RN8 A;  2DEQ A;  5HK0 A;  4WF2 A;  1GFD A;  2YWW A;  2RHX A;  4JLG A;  2BUD A;  3VJP A;  1RAA B;  2EPD A;  2O31 A;  3VS6 A;  4KUL A;  1Q82 U;  4JRI A;  3RER A;  1GCP A;  2GTO A;  2V26 A;  2YT6 A;  5KCH A;  3OQ5 A;  1YFN A;  1YHQ T;  3H8Z A;  3MO8 A;  3L2V A;  1D1A A;  5GAN 4;  3CD6 A;  1K0S A;  2DO3 A;  3MHX A;  5FRN A;  4ANJ A;  4M7A A;  5FW9 A;  1D0Y A;  4RCC A;  5HKC A;  3OYY A;  4II1 A;  4PJO B;  4IUP A;  5CCA A;  2M9U A;  2V8I A;  5HK3 A;  2RO0 A;  3N5B B;  4JZ4 A;  2EQI A;  2BZ8 A;  1Z9Z A;  1YJW A;  1M27 C;  1T3S A;  1I5L A;  5LJ3 f;  3CXC P;  1CKA A;  1AZE A;  3MEA A;  3OSV A;  2RHY A;  1FMK A;  1VQK Q;  3V7S A;  5KCO A;  2KAF A;  2R57 A;  1VQM Q;  5CO7 A;  5FU6 C;  1VQK A;  4C0F A;  2L3S A;  2HQX A;  3JCM c;  1Q86 U;  4BI4 A;  3A5Z B;  1ZX6 A;  2JMA A;  1KC8 C;  3EG9 A;  3CME Q;  1PG5 B;  4M77 B;  2AZS A;  1VQM A;  2AKL A;  4IKF A;  1U06 A;  1FMV A;  4J7F A;  3L1A A;  4GBQ A;  1FWZ A;  4PJO C;  1IHV A;  2E6Z A;  3CC7 Q;  1NJI U;  2LCC A;  3O5Z A;  1G3S A;  3VS5 A;  1RAH B;  1PSF A;  2EYW A;  4C8Q G;  3OYL A;  5L23 A;  1W2B S;  1SSF A;  4JJN K;  2K6D A;  1BBZ A;  1DJ7 B;  2NWM A;  1IGU A;  3D7S B;  3SDZ A;  3I56 T;  1W1F A;  1MMD A;  1VQ4 A;  3M5A A;  2KXD A;  5CKF A;  1KQ2 A;  2RQR A;  1VQ9 Q;  4C5E A;  4QQD A;  2PUO B;  4HCC A;  1UTI A;  3CCM Q;  1OX8 A;  2DJZ A;  1VQP A;  2E65 A;  1I5O B;  2HL3 A;  1QLY A;  4BY6 C;  1QP2 A;  2FL7 A;  2FZK B;  5IT9 E;  3MET A;  2QGG A;  3QJY A;  1VOM A;  2CS7 A;  3L2W A;  2GF7 A;  1PRM C;  1RI9 A;  4EMK A;  1KSW A;  1Q86 C;  2P0P A;  1Q81 R;  3EGD B;  5CKB A;  2QEX A;  4JS5 A;  3V8K A;  3EGU A;  4OML A;  3R6O A;  2M02 A;  3L2Z A;  3CCQ Q;  1N8R C;  1QWF A;  1VQ7 Q;  1UEC A;  3TRE A;  3CXC A;  1MND A;  2JS2 A;  3V8L A;  1M90 C;  1CSK A;  4C5I A;  1S72 T;  2HEQ A;  4J9D A;  4ZN3 A;  4OMF B;  2K3Y A;  2ZCF B;  5J39 A;  2CZ0 B;  2RF0 A;  1MHN A;  2C0I A;  2F2W A;  4LNP A;  4C0D B;  2KRO A;  3KBG A;  4J9I A;  4FW2 A;  2DMO A;  3I55 A;  1YHQ A;  1S1N A;  1N9R A;  3PMT A;  1YIJ T;  1RLQ C;  4A63 B;  3JB9 H;  3I55 Q;  2BZX A;  2XHC A;  2K2V A;  4PNO A;  5J26 A;  4AT1 B;  3J80 E;  2K3X A;  5GAM e;  1TU0 B;  3GLX A;  2NUT A;  4BY6 B;  4FIB A;  2RK2 A;  3LGF A;  1JU5 C;  3P8B B;  3QSU A;  3OW2 P;  4FSX A;  2XDD A;  4OMP A;  1KD1 U;  1MV0 B;  1S72 A;  2J6K A;  4FU6 A;  3OYI A;  3LWI A;  2JTF A;  2K2M A;  3JCM f;  2RJE A;  1VQ5 Q;  2QQ9 A;  3U23 A;  8AT1 B;  5GMK e;  1AD5 A;  4E7I A;  2VUB A;  1VQ5 A;  2D6F A;  2PQW A;  4KGX B;  2YRC A;  2CT3 A;  1VQP T;  2DD4 A;  3TEE A;  3M9Q A;  1R0C B;  4OGC A;  1ZBX A;  2FRW A;  1WYX A;  2IVW A;  1TWB A;  3REA B;  3LX7 A;  3NMZ C;  1JEG A;  2BTT A;  3I35 A;  2FZG B;  1M5Q 1;  2V8J A;  2ZAE A;  3PNW C;  1M2V B;  2RJC A;  4BAC A;  1BI1 A;  4O6J A;  3MKD A;  1VQO T;  1YIJ A;  2Z0W A;  1NYF A;  2IIM A;  4JJB A;  2OTL T;  1FMW A;  3GBQ A;  4PKC C;  1PKS A;  4BI8 B;  1FXX A;  3H0H A;  1ABQ A;  3GP8 A;  2MF2 A;  1ZUY A;  2AIR B;  2E3I A;  3MEV A;  1BB9 A;  3HTR A;  4M4Z A;  4A4H A;  1TUG B;  2LT1 A;  3TQ7 P;  4OMN A;  2M0O A;  5GAM h;  1WNL A;  5D6Y A;  1VA7 A;  1VQ8 T;  1PKT A;  3M0R A;  3SB2 A;  2QQA A;  2OTJ A;  4ZGE B;  3MP1 A;  2CYZ B;  2E12 A;  4Y91 A;  2LJ0 A;  1FX7 A;  3MEW A;  3KXT A;  5GMK m;  4M7D E;  3CC4 T;  3SFM A;  2EGA A;  4Z02 A;  2XMF A;  3RNJ A;  1GCQ C;  2RPN A;  3LLR A;  3ULR B;  2A08 A;  1K9A A;  1RLP C;  2HSE B;  2DL4 A;  1YJN T;  1VQ6 T;  1WQW A;  1T0J A;  1KIK A;  3VU3 C;  1SEM A;  1ZA1 B;  3DLL A;  1WX6 A;  4ZNX A;  4RCB A;  2M51 A;  5IXF A;  3G1J A;  1UFF A;  2ECZ A;  4NL2 A;  1NBE B;  3BFM A;  4PK4 A;  4Z89 A;  5GAN 7;  5I2S A;  1U1S A;  1VYV A;  1QVG P;  1WI7 A;  2L2P A;  1U3O A;  3CCV T;  1YI2 A;  3JAM E;  3L2R A;  1UB4 A;  1ZSZ C;  5GAO l;  2DKG A;  4J9F A;  2EIF A;  4FCY A;  2I0N A;  3VUB A;  2QG9 B;  3M0U A;  4YTL A;  1SPK A;  2QQB A;  4DEY A;  2D1X A;  3EGD A;  4XU1 A;  3C4S A;  3L2U A;  2LNH B;  4ZGD B;  2GGR A;  2KK4 A;  2XKO C;  5GAN f;  1N6A A;  2F5K A;  3CCL T;  3RIR A;  1UGP B;  1K8A R;  4M7D B;  4M78 G;  4ESR A;  4ELZ C;  2LZ6 B;  3CQT A;  3OBY A;  2YSQ A;  3UDC A;  3INZ A;  1E7O A;  1YJW Q;  4RTX A;  3REB B;  1O9S A;  3H0I A;  4C8Q C;  1HD3 A;  1EFN A;  3M4G A;  5LJ5 d;  2P4R A;  1X6O A;  2QAZ A;  3I5S A;  2ABL A;  4E7J A;  1YWP A;  1QVG A;  1UJ0 A;  3G71 A;  2DTO A;  3S6W A;  1U1T A;  2DEU A;  4Y28 E;  4FW1 A;  2EYX A;  4FYV B;  1K76 A;  2X9H A;  2DL7 A;  1WHL A;  4X9C A;  4QQG A;  2OI3 A;  1KQS S;  2K57 A;  2RQV A;  2JM9 A;  3AT1 B;  2HL5 C;  4VUB A;  1BK2 A;  1JXM A;  4FSS A;  1VQN A;  3RKW A;  1YNZ A;  5LJ5 g;  4IIM A;  1PD1 A;  1RAE B;  2DPP B;  5LL6 S;  3S3M A;  3H0F A;  3GNF B;  3MEU A;  3MJX A;  2LVM A;  1QVP A;  3EG9 B;  4KH0 B;  2V1R A;  1Q86 R;  4RTY A;  2KRS A;  2QDY B;  2OTL Q;  2EFI A;  2KRN A;  7AT1 B;  3SEM A;  1I07 A;  3A8L B;  4EMK B;  1A0N B;  2E5Q A;  3HHT B;  1AVZ C;  2DYB A;  3I56 Q;  4AG1 C;  2HZY A;  1R8O B;  3QYH B;  2LQK A;  2LT4 A;  1JO8 A;  1YJ9 Q;  1ZBJ A;  1B34 A;  4ELY C;  1OYX A;  4M78 F;  1JQQ A;  9ATC B;  2E1H A;  2YRV A;  1IB8 A;  2VGN A;  4XTZ A;  5GAM d;  3JB9 J;  2COY A;  1W2B P;  1PM3 A;  5A0G A;  1SHF A;  4DQ2 A;  4MDW A;  1M1F A;  1RAI B;  5KYN A;  2ZPG B;  4KRT A;  3VRY A;  4P5N A;  5GAN 3;  1D0X A;  5EG2 A;  2J6O A;  3CCQ A;  3UWN A;  3CMA Q;  3MCA B;  1HJD A;  2MPX C;  3JSC A;  3SWN C;  2YUP A;  1M3B A;  2X51 A;  4D8D A;  4QVD A;  1U8R A;  4LDX A;  2ROL A;  4M7A C;  3OYH A;  2A36 A;  4AG2 C;  2LQW A;  2HD0 A;  1ZSZ A;  4F7U A;  4C92 F;  3OSS C;  4OF1 A;  3CD6 T;  4X1V A;  1IZ6 A;  4F14 A;  3F70 A;  2D0N A;  1TH7 A;  2B8A A;  4BE1 A;  1X6B A;  5LJ3 h;  3OMC A;  4RTU A;  2KBT A;  2CP3 A;  1TUC A;  1NG2 A;  3C0C A;  3VS2 A;  2JOY A;  4PLL A;  3S3N A;  3QHS A;  3UT1 A;  4QKU A;  2QQS A;  1ZUU A;  3JCM Q;  4XTY A;  3OYN A;  1GBQ A;  2LJ1 A;  3M0S A;  2RNA A;  4R56 A;  4OP0 A;  1NLP C;  3VS1 A;  4XU0 A;  2D8H A;  2HSP A;  3CBM A;  2FEI A;  4J7I A;  3FIF A;  2XID A;  5IAY A;  1AWO A;  1M1G A;  1ARK A;  2L8D A;  1YJW T;  2LC4 A;  2K4Y A;  3E2U A;  3BW1 A;  1Q82 R;  3CC7 T;  1N5Z A;  4E7Z A;  3WVE B;  1Y57 A;  3GF5 A;  5LJ5 j;  2MK5 A;  2CH4 A;  4QT7 A;  1QCF A;  1UGQ B;  4J9G A;  2E41 A;  4F7U F;  3EFO A;  5DM7 R;  4F04 B;  4BUG A;  1UUE A;  1R77 A;  1BI0 A;  2VAS A;  1KC8 U;  5GAM j;  3HRS A;  3VS7 A;  3X20 B;  4E6R A;  3JV3 A;  3CBO A;  4PJO G;  2VWF A;  2DX1 A;  1VQ6 Q;  5IXB A;  2DTI A;  4E2F B;  1KFZ A;  4PL6 A;  1RAF B;  1TG0 A;  3CCS A;  3CCR T;  2KSS A;  3E19 A;  1ZA2 B;  2PVO B;  1PWT A;  2O88 A;  2OAU A;  3CCU Q;  2FRY A;  3CEY A;  3HFO A;  1QP3 A;  3L2Q A;  1TOV A;  4O5V A;  1N27 A;  2DIG A;  5GAM g;  4J9H A;  2E5K A;  2RQW A;  3GIB A;  2LQN A;  3NTH A;  2LCL A;  3FRN A;  1OV3 A;  2PVD B;  3G7Z A;  2QEX T;  2K5F A;  3CC7 A;  3G4S T;  4PJO E;  1H64 1;  4NS5 A;  2AKK A;  1OU8 A;  1WHM A;  2J05 A;  3QWY A;  4MZM A;  3KUF A;  5KYW B;  2MI6 A;  1RI0 A;  1M90 U;  1H8K A;  1SSH A;  2C06 A;  2ENM A;  2F69 A;  2XI9 A;  4PJM A;  3CCM T;  2YUO A;  4PJO A;  1M2V A;  1C1A A;  3M4Y A;  2CZ6 B;  2LX7 A;  2LNV A;  2DRK A;  2X3W D;  3HRT A;  2RD1 A;  5A0D A;  4OVA A;  3HKS A;  1TTH B;  1VQO Q;  4JUV A;  2E70 A;  3JCM P;  3JB9 G;  1Q82 C;  2RQT A;  2EKO A;  2LCS A;  2WSF E;  1NM7 A;  4A4G A;  2D0Q B;  2L89 A;  4C0D C;  3A98 A;  3C12 A;  2RI5 A;  4A4F A;  3PFS A;  3T9N A;  2MCN A;  3J81 E;  4N4I A;  2CP0 A;  1HXD A;  5KE2 A;  4F16 A;  1K73 U;  2CP7 A;  2AZV A;  1SRM A;  2WAC A;  1W6X A;  4BDZ A;  3GOX A;  2YUN A;  3A8H B;  2F2X A;  2LX9 A;  3TSW A;  3EH2 A;  4DOW A;  4MDX A;  2KY9 A;  5LJ5 f;  1M30 A;  4J9C A;  1K8A C;  2KT8 A;  4J6X A;  3EFS A;  3P8D A;  2JMC A;  1MGQ A;  2EWN A;  3VYG A;  2JTM A;  3PVQ A;  4C5H A;  2HMA A;  4XU2 A;  2XDB A;  1LCK A;  4A54 A;  2H8H A;  2DXT A;  3CCL Q;  4F17 A;  1MV3 A;  4TVR A;  4HCB A;  2DET A;  1BI3 A;  2FPF A;  4M77 A;  4RKU E;  1ZHI A;  1VQ8 A;  2Y4Y A;  1YIT Q;  5LJ5 h;  2JJ9 A;  1UEB A;  3V7C A;  5LJ3 g;  3OYA A;  4IUQ A;  2K9G A;  1KC8 R;  2CZ7 B;  5IHI A;  1HK9 A;  3OS1 A;  3BDU A;  4C8Q A;  5GAN 2;  1NYG A;  4GLM A;  2G6F X;  4D8K A;  2DL3 A;  4HCK A;  5C6S A;  2J7I A;  2L5Q A;  1Y96 B;  3JCM g;  3G6E T;  4C92 C;  1IGQ A;  3VV0 A;  3VYH B;  3M56 A;  4FL6 A;  1AT1 B;  1K0X A;  4C8Q F;  3RMS A;  2GTJ A;  1PD0 A;  2EYZ A;  1Q95 G;  5KYW A;  1I0C A;  3OB9 A;  4KUD K;  2DIQ A;  1VQN Q;  2KI7 A;  1WQ7 A;  3FC3 A;  1VQL T;  1RAD B;  4IUU A;  2JT4 A;  4A4E A;  3CD6 Q;  3EG2 A;  3PVL A;  4M77 G;  2V8K A;  4DBF A;  3CCR Q;  1VQ6 A;  5GAN j;  1VQ9 T;  4M78 E;  2KT1 A;  1JXO A;  1AHJ B;  1IHW A;  4ZN1 A;  1UDL A;  3HL8 A;  3CPW P;  1WPY A;  1D09 B;  3X28 B;  3EHR A;  4MZP A;  1JJ2 S;  3OYM A;  2K5I A;  4OMM A;  1QVF P;  1ACM B;  2NYS A;  3JCM b;  1AZG B;  1WIE A;  2DXB A;  1K73 C;  4L5G A;  3G4S A;  2PVG B;  3A1P A;  3EH1 A;  3TU4 K;  4ORZ A;  1VQ7 A;  3L42 A;  1WXT A;  1GFC A;  1OZ2 A;  1H3H A;  3UF4 A;  1Q7Y C;  2DVJ A;  4XTU A;  1NJI C;  4OGE A;  4CI0 C;  3FEO A;  4RTT A;  1AWX A;  2R5M A;  2LJ3 A;  4PJO F;  2G3R A;  3CCU T;  1RUW A;  1BIB A;  1Y0M A;  2XU8 A;  2EAY A;  2A7Y A;  2P84 A;  2GQV A;  4M78 B;  1W2B A;  5IHN A;  2XK0 A;  4AFQ C;  2EKH A;  4C0G A;  2DL8 A;  1K4U S;  4PLI A;  3THK A;  4JRP A;  3TVT A;  3ER0 A;  4IUV A;  1KQ1 A;  5GJW B;  3VS0 A;  4N4H A;  1AWW A;  2FZC B;  3VS3 A;  4M77 D;  1GL5 A;  2DFU A;  2A3L A;  2KXC A;  2DK3 A;  1WZO A;  3FLG A;  4AMC A;  4MZT A;  3CC4 A;  1YWO A;  1QMC A;  5GAN 8;  1PRL C;  3CC4 Q;  4XTW A;  4LXC A;  4F7U E;  3M0P A;  1NE8 A;  1VIF A;  2W10 A;  5CAI A;  2K5L A;  1G5V A;  2O9S A;  1BCO A;  2X4J A;  3CCJ Q;  4E7L A;  3SHW A;  3CPW A;  2KVQ G;  4L6V 5;  3FDR A;  5CKD A;  2K3B A;  2DXU A;  2RH2 A;  1M9S A;  2OJ2 A;  1NEB A;  3RKY A;  4RTZ A;  4BI3 A;  2RHZ A;  1I1J A;  2KNB B;  4LUE A;  5GAO m;  5GAN g;  3M57 A;  4NL3 A;  2KE9 A;  4CC7 A;  3KFV A;  2O4X A;  2KEA A;  2E6N A;  2KRM A;  4XTV A;  1IRX A;  4B6M A;  2CSQ A;  1XTD A;  1G8X A;  4Y92 A;  3CCV A;  5CQX A;  1YI2 T;  2DNU A;  3EG0 A;  2EW3 A;  2MWP A;  4CRI A;  3CCU A;  2RM4 A;  5GAN 6;  1GBR A;  1Q81 C;  3FJ5 A;  2ZPI B;  5FLX E;  4XU3 A;  3NTK A;  1TSF A;  4AFU C;  4L59 A;  2I2L A;  4C92 B;  1ZSG A;  1QCO A;  4OB2 B;  2WSE E;  1E6H A;  2DZ9 A;  5GAN d;  4E7K A;  4M75 D;  4B9W A;  3VRZ A;  4MMK A;  3MP6 A;  3VKI A;  1XNI A;  2YRD A;  2JS0 A;  3Q1J A;  4JS4 A;  2LRQ A;  1B7T A;  4QVZ A;  4A53 A;  4PFO A;  3HP9 A;  3ZBD A;  1M1K U;  3WVD B;  1WHG A;  2JW4 A;  3V8J A;  2YHT A;  3NGP A;  1B3Q A;  4BE0 A;  5C0M A;  5M9O A;  1VQ9 A;  2VB6 A;  2EVR A;  3TSZ A;  3JB9 D;  2HKN A;  1RL2 A;  2JVV A;  4FM4 B;  1VQ4 Q;  1G3T A;  5I21 A;  4M75 B;  2DA9 A;  1VQ4 T;  2QK0 A;  4JZ3 A;  1D3B B;  3ZL7 C;  3J7A F;  2PNI A;  4M7A E;  2DZC A;  4KBM B;  1JJ2 A;  2QA4 T;  3FJP A;  1VUB A;  1VIE A;  1QVF A;  1UE9 A;  4R55 A;  3SWN A;  1GCQ A;  5GAM f;  3OYF A;  1K9M U;  1LNX A;  2HQE A;  1K9M R;  1Y7X A;  1YCY A;  1U5S A;  2GBQ A;  2VC8 A;  1VQ7 T;  1G3W A;  1UHF A;  2RHU A;  1LVK A;  2GQI A;  2GFU A;  2PZ1 A;  3H6Z A;  1WHJ A;  3BDL A;  4JLI A;  4KH1 B;  5GMK l;  2PU9 B;  2V1Q A;  3JCM e;  2CP5 A;  2YLB A;  1NZ9 A;  2O2O A;  3PT9 A;  1T0H A;  1HSQ A;  2DYI A;  3OY9 A;  4N0A A;  1K1Z A;  1WJS A;  5LJ3 j;  2C0O A;  4OB1 B;  4JDS A;  1OUL A;  5KE3 A;  3ME9 A;  4C8Q D;  1UGS B;  3OYE A;  2EYY A;  4N0A C;  3UAT A;  1BYM A;  2ZZD A;  1FYN A;  2RQU A;  2LQ8 A;  4QVC A;  4M75 C;  4BD3 A;  1X2K A;  4M7A G;  2J06 A;  2DRM A;  2HQH A;  2QDL A;  5GMK h;  1I4K 1;  3CME A;  4PFP A;  5FRM A;  2H3J A;  5ECA A;  2C0T A;  3LGL A;  3E1S A;  2YDL A;  3RMQ A;  2VVK A;  4RG8 A;  2HKQ B;  4PJL A;  2SEM A;  3OYD A;  2D8J A;  1GRI A;  2AK5 A;  3A8M B;  5DY9 A;  1WA7 A;  3X26 B;  3BE3 A;  3RBB B;  3HPW A;  5KYU A;  3DB4 A;  1MUZ A;  5AYF A;  1YJN Q;  2A37 A;  3EG1 A;  5GAO r;  1QQJ A;  4M75 E;  2QA4 A;  4OB0 B;  1ZQ1 A;  2DBK A;  1XJW B;  4M78 D;  3JRZ A;  2QYZ A;  3URG A;  4CC2 A;  4UC4 A;  2HDA A;  2K7A A;  4A4K A;  3JCM d;  3QZ9 B;  2PUK B;  3OS5 A;  5CK9 A;  4RMO A;  3CC2 A;  2M16 A;  2FYK A;  2BE9 B;  4Z8A A;  3M54 A;  4DEX A;  1EZZ B;  2COW A;  3ASK A;  5CVI A;  4DBH A;  2E64 A;  1WLP B;  1QVG S;  4PJN A;  2EGC A;  2RK1 A;  1PCX A;  5CKE A;  4Q5W A;  5D6X A;  3QDF A;  3C95 A;  3QKJ A;  1OU9 A;  3NFC A;  2JTE A;  4V2S A;  1Y96 A;  2OTJ Q;  3UA6 A;  5FRO A;  1VYT A;  1J3T A;  1ZSZ B;  5GAO p;  4E7H A;  3DKM A;  3CMA A;  1XOV A;  2BZY A;  2EBP A;  2X4W A;  1N8R R;  3OMG A;  4J5Y A;  3QJ6 A;  3LYI A;  2DM1 A;  2NUZ A;  2O01 E;  2B86 A;  2BE7 D;  3OYB A;  3A8O B;  4WTO B;  3RES A;  1M2O A;  2EJF A;  2KDS A;  2FO0 A;  2KMT A;  4OMQ A;  2DTH A;  4DA4 A;  1RAB B;  2A28 A;  4LD9 K;  5EC7 A;  4IIO A;  4JRK A;  1AOJ A;  4J6Y A;  1CKB A;  4HVU A;  2DF6 A;  1ZUK A;  4C5G A;  4HA8 A;  4LD6 A;  2F2V A;  8ATC B;  1WFW A;  3CMA T;  5GAN e;  1HYO A;  2MOX A;  1RAG B;  2VKN A;  1KJW A;  3I9Q A;  3M59 A;  4WCI A;  2DAQ A;  4KGZ B;  4LDW A;  4J83 A;  1KHC A;  1JJ2 P;  6AT1 B;  1YI2 Q;  1G3Y A;  1P92 A;  3QXE B;  3CCS T;  1TS9 A;  5KYY A;  3OYJ A;  3CXC S;  1V1C A;  3DB3 A;  3QPH A;  2KYB A;  4M7D A;  2DBM A;  1X27 A;  2XD0 A;  3CC2 T;  5CKH A;  3G6E A;  5FWB A;  1B07 A;  4EIK A;  2H3E B;  2EQK A;  3RKX A;  4C8Q E;  2GNC A;  1NEG A;  3M55 A;  4XTX A;  4HT8 A;  3ZFJ A;  2RI3 A;  2CH4 W;  4F7U G;  2DVE A;  2RI2 A;  3OW2 A;  2E3H A;  2NUP B;  4GLK A;  2RJF A;  1C6V X;  2EGE A;  3CCE T;  1AEY A;  1KHI A;  1SG5 A;  4M77 E;  2QTV A;  2CRE A;  5FU7 B;  4C92 G;  5GAO q;  4DOV A;  2MWO A;  2KR3 A;  1JBM A;  1YIT T;  4M7D D;  3GNG A;  1YHQ Q;  2DJQ A;  3QUI A;  3CCL A;  2CP6 A;  2E4H A;  1LOJ A;  2L3R A;  4RTW A;  2KQW A;  1JRI A;  3LWH A;  3NPF A;  1QKX A;  3A8G B;  5LJ3 d;  4M7A B;  3PMI A;  1PC0 A;  2IG0 A;  5GJV B;  3OW2 S;  3CCE Q;  1D1C A;  4M77 C;  4PFZ A;  1YCS B;  2YLC A;  2EYQ A;  2OAW A;  2X4X A;  1RAC B;  5GAN h;  4ZTF A;  2HBP A;  3RDV A;  1NPP A;  2GFA A;  1OEB A;  4M75 F;  4B9X A;  2XDP A;  4J8O A;  3MPU B;  1TXQ A;  2A0F B;  2JN0 A;  4PJJ A;  1OPL A;  1OPK A;  3JCM W;  2BIV A;  1MNE A;  3FB9 A;  3PIP A;  5DLO A;  4M7D G;  2CZ1 B;  1MMG A;  4ATO A;  2DXC A;  4XAX B;  1VYU A;  3EAE A;  4LDU A;  5LJ3 e;  2QXF A;  1YBY A;  5GAO n;  4D6W A;  4LDV A;  1V76 A;  1YJ9 A;  4HVV A;  3CCM A;  3QDR B;  1VQ5 T;  1SF9 A;  1VQL Q;  3SWN B;  3JB9 F;  4MML A;  4HVW A;  4ME7 A;  4BB7 A;  2LDM A;  1X6G A;  3I55 T;  5A2Q E;  2NLU A;  1M90 R;  2ATC B;  5KYX A;  2FPE A;  4AFS C;  1QW1 A;  1VQK T;  2IPO B;  3JB9 I;  4FT2 A;  3EHQ A;  4Z88 A;  4R0K A;  1OX9 A;  2FVU A;  3V7R A;  1UGV A;  2ED1 A;  2DLP A;  3P8H A;  5KYY B;  5I22 A;  2RHI A;  3M0Q A;  1G83 A;  2DD5 A;  4M75 A;  4M75 G;  4KGV B;  2VYT A;  4IUT A;  1ZLM A;  4ZGJ B;  2ZPF B;  1VQM T; 
#chains in the Genus database with same CATH homology
 3V7S A;  3QYG B;  5KCO A;  2KAF A;  5FU6 B;  2R57 A;  2HD0 A;  2MWP A;  5CO7 A;  4F7U A;  5FU6 C;  4C92 F;  2XG8 D;  4CRI A;  3CCU A;  2RM4 A;  3OSS C;  4OF1 A;  1VQK A;  4C0F A;  5GAN 6;  3CD6 T;  1IZ6 A;  4QQ6 A;  2HQX A;  5KH6 A;  3JCM c;  3F70 A;  1Q81 C;  1Q86 U;  1TH7 A;  2ZPI B;  4BI4 A;  5FLX E;  1JB0 E;  2B8A A;  4XU3 A;  3A5Z B;  4BE1 A;  3JCM J;  3NTK A;  4L59 A;  4HT9 A;  2I2L A;  5LJ3 h;  1KC8 C;  4C92 B;  3OMC A;  4ZTJ A;  3OA6 A;  2BKD N;  2LTO A;  4M77 B;  3OYG A;  1VQM A;  2R5A A;  2OTJ T;  4OB2 B;  4IKF A;  2WSE E;  2JOY A;  4PLL A;  2DZ9 A;  5GAN d;  4J7F A;  3L1A A;  3S3N A;  1FWZ A;  3QHS A;  3UT1 A;  4E7K A;  4PJO C;  2E6Z A;  2QQS A;  4M75 D;  3HFN A;  2O4X B;  4B9W A;  1NJI U;  2LCC A;  4MMK A;  3JCM Q;  1G3S A;  3MP6 A;  4XTY A;  3OYN A;  1LJO A;  1PSF A;  1XNI A;  3VKI A;  1VQO A;  4C8Q G;  2QI2 A;  3Q1J A;  3OYL A;  2LRQ A;  3CCE A;  4JS4 A;  1W2B S;  1SSF A;  4JJN K;  4QVZ A;  4M78 A;  3TCJ A;  1DJ7 B;  4A53 A;  4C0Z A;  2VV5 A;  3HP9 A;  3ZBD A;  1M1K U;  4R56 A;  2P0Q A;  3SDZ A;  3I56 T;  4OP0 A;  3OS0 A;  3WVD B;  1V29 B;  5FRM A;  3V8J A;  2YHT A;  4XU0 A;  3M5A A;  1VQ4 A;  3QG1 A;  3CBM A;  4X9D A;  5CKF A;  1KQ2 A;  1XQH A;  4J7I A;  1M8V A;  4C92 D;  3FIF A;  2XID A;  5IAY A;  4HCZ A;  4BE0 A;  5L8R E;  4C5E A;  1M1G A;  5C0M A;  1YJ9 T;  5M9O A;  2L8D A;  3PTA A;  1YJN A;  2LC4 A;  2K4Y A;  4QQD A;  1YJW T;  3BW1 A;  4M7A D;  2PUO B;  4HCC A;  1VQ9 A;  4C92 E;  3CC7 T;  5FU7 C;  3JB9 D;  1RL2 A;  2JVV A;  2DJZ A;  1VQP A;  4FM4 B;  3WVE B;  1G3T A;  2E65 A;  5I21 A;  4F7U B;  3GF5 A;  5LJ5 j;  4M75 B;  4BY6 C;  1VQ4 T;  1N9S A;  1D3B B;  1QP2 A;  3S3O A;  3J7A F;  1UGQ B;  2FL7 A;  5IT9 E;  4M7A E;  3MET A;  2DZC A;  3QJY A;  4KBM B;  1JJ2 A;  2CS7 A;  2E41 A;  2QA4 T;  4F7U F;  3FJP A;  2GF7 A;  3L2W A;  5CR2 A;  1VUB A;  1VIE A;  5DM7 R;  1QVF A;  4BUG A;  4EMK A;  5HY6 A;  3CCR A;  3OBW A;  1BI0 A;  1KC8 U;  4R55 A;  5GAM j;  3SWN A;  2P0P A;  3HRS A;  1Q86 C;  3X20 B;  5GAM f;  3OYF A;  3JCM h;  1K9M U;  1LNX A;  2ZPE B;  5CKB A;  2HQE A;  1Y7X A;  1YCY A;  2MAM A;  3CBO A;  4PJO G;  2QEX A;  3V8K A;  4JS5 A;  2VC8 A;  1VQ7 T;  1G3W A;  2RHU A;  3R6O A;  2DTI A;  3L2Z A;  1N8R C;  4IUR A;  4PL6 A;  1X01 A;  2GFU A;  3TRE A;  3EFR A;  3H6Z A;  3BDL A;  4JLI A;  5GMK l;  3CXC A;  3CCS A;  3CCR T;  2KSS A;  2PU9 B;  1WJR A;  3E19 A;  2PVO B;  3JCM e;  2FB7 A;  5A0L A;  2YLB A;  2OAU A;  3V8L A;  1M90 C;  4J6W A;  1NZ9 A;  3PT9 A;  3CEY A;  3HFO A;  1NPR A;  1QP3 A;  4C5I A;  4EPC A;  3L2Q A;  1S72 T;  4O5V A;  5DLQ E;  1N27 A;  3OY9 A;  2DIG A;  4N0A A;  4OMF B;  4ZN3 A;  5GAM g;  2K3Y A;  2ZCF B;  1WJS A;  5J39 A;  2CZ0 B;  5LJ3 j;  4OB1 B;  1KD1 C;  1MHN A;  4JDS A;  3GIB A;  5CQY A;  3NTH A;  5KE3 A;  2LCL A;  1VQN T;  3ME9 A;  4C0D B;  3KBG A;  4C8Q D;  3FRN A;  2PVD B;  3G7Z A;  2QEX T;  2CKK A;  3I55 A;  2K5F A;  3CC7 A;  1UGS B;  3G4S T;  3OYE A;  2EQU A;  1YHQ A;  4PJO E;  1H64 1;  1N9R A;  4NS5 A;  3CCJ T;  4N0A C;  3PMT A;  1YIJ T;  3JB9 H;  1BYM A;  2XHC A;  2HAX A;  2K2V A;  2ZZD A;  4PNO A;  5J26 A;  4MZM A;  4HKE A;  3KUF A;  3J80 E;  2K3X A;  2LQ8 A;  2MI6 A;  1RI0 A;  4EMH A;  5GAM e;  1M90 U;  3GLX A;  4QVC A;  3GPL A;  2C06 A;  4M75 C;  4FIB A;  4BD3 A;  4BY6 B;  2RK2 A;  3LGF A;  2F69 A;  2XI9 A;  3M58 A;  3VUZ A;  3P8B B;  3CCM T;  3QSU A;  4M7A G;  4FSX A;  2XDD A;  4PJO A;  3C94 A;  5GMK h;  1D3B A;  4C92 A;  1KD1 U;  1I4K 1;  3CME A;  1S72 A;  3M4Y A;  2CZ6 B;  2ZPB B;  3G71 T;  4FU6 A;  2EJ9 A;  2H3J A;  2JTF A;  2LNV A;  3BY7 A;  3OYI A;  3LWI A;  3JCM f;  1WGS A;  2RJE A;  1O75 A;  3LGL A;  3E1S A;  3HRT A;  2RD1 A;  2QQ9 A;  5A0D A;  4OVA A;  5GMK e;  4E7I A;  2VUB A;  3HKS A;  3O8V A;  1VQ5 A;  2D6F A;  3RMQ A;  2XIC A;  4EMK C;  4RG8 A;  2PQW A;  4JUV A;  1OI1 A;  2E70 A;  3OYD A;  3JCM P;  3JB9 G;  3LH0 A;  1Q82 C;  3I56 A;  3ZEH A;  2VGM A;  1N8R U;  3A8M B;  2DD4 A;  5DY9 A;  1VQP T;  3X26 B;  3HSB A;  3TEE A;  4GY5 A;  2EKO A;  3HPW A;  3DB4 A;  3M9Q A;  5AYF A;  1QVF S;  2WSF E;  5D6W A;  4OGC A;  5J3B A;  1ZBX A;  4NOY A;  1X75 C;  5GAO r;  4A4G A;  2D0Q B;  2L89 A;  4C0D C;  4M75 E;  2QA4 A;  2IVW A;  4OB0 B;  1ZQ1 A;  3LX7 A;  3C12 A;  2RI5 A;  4A4F A;  1K9M C;  4M78 D;  3PFS A;  3T9N A;  3J81 E;  4N4I A;  3JRZ A;  1I8F A;  1M5Q 1;  2V8J A;  3PGG A;  3PNW C;  3URG A;  4UC4 A;  1HXD A;  2RJC A;  5KE2 A;  4BAC A;  1K73 U;  1BI1 A;  4O6J A;  3CCJ A;  4A4K A;  2JNG A;  2M1H A;  1BKB A;  4X34 A;  3JCM d;  3QZ9 B;  1VQO T;  1YIJ A;  2PUK B;  3OS5 A;  2WAC A;  4BE2 A;  5CK9 A;  4BDZ A;  4RMO A;  3QBY A;  2OTL T;  3CC2 A;  3E9F A;  2M16 A;  4PKC C;  3GOX A;  4M7D F;  5GMK i;  4BI8 B;  1FXX A;  2FYK A;  3A8H B;  2LX9 A;  3M54 A;  3GP8 A;  2D9T A;  2X35 A;  2MF2 A;  2MMP A;  3QII A;  3ASK A;  3NTI A;  4XQ3 A;  5CVI A;  4DOW A;  2E64 A;  3WXM B;  4MDX A;  2KY9 A;  5LJ5 f;  1QVG S;  5GMK j;  3PIO A;  2RK1 A;  3MEV A;  3LW5 E;  5CKE A;  4Q5W A;  4A4H A;  1K8A C;  2LT1 A;  5D6X A;  1IRE B;  3C95 A;  1OZ3 A;  3QKJ A;  3NFC A;  2M0O A;  1M1K C;  1BI2 A;  5GAM h;  2Y90 A;  1WNL A;  2RB6 A;  5GAN 5;  4V2S A;  1Y96 A;  2P0K A;  4J6X A;  5D6Y A;  3EFS A;  3P8D A;  5FRO A;  4PJO D;  1MGQ A;  1Y07 A;  2EWN A;  3VYG A;  1VQ8 T;  2JTM A;  5GAO p;  4C5H A;  3SB2 A;  2QQA A;  2OTJ A;  4ZGE B;  4XU2 A;  3DKM A;  4E7H A;  2XDB A;  4A54 A;  1YIT A;  2EQJ A;  2DXT A;  3MP1 A;  2CYZ B;  2E12 A;  1XOV A;  4Y91 A;  3CMA A;  2X4W A;  1FX7 A;  3MEW A;  3OMG A;  3KXT A;  5GMK m;  3UPU A;  4M7D E;  4J5Y A;  3QJ6 A;  3CC4 T;  3LYI A;  3SFM A;  4TVR A;  3MP8 A;  4HCB A;  4M7D C;  1BI3 A;  4M77 A;  3AHU A;  3RUX A;  4RKU E;  1ZHI A;  2O01 E;  4Z02 A;  3OYB A;  1I81 A;  2RJD A;  4QW2 A;  3A8O B;  1VQ8 A;  2Y4Y A;  3RES A;  5LJ5 h;  3LLR A;  1UEB A;  3V7C A;  5LJ3 g;  3OYK A;  2EJF A;  4IUQ A;  3OYA A;  2WSC E;  2KDS A;  2KMT A;  2CZ7 B;  2DTH A;  3OYC A;  4DA4 A;  2EJG A;  1HK9 A;  3JCM V;  3OS1 A;  4LD9 K;  1UGR B;  3BDU A;  4M77 F;  1B34 B;  4JRK A;  4J6Y A;  4KUI A;  4C8Q A;  5LJ5 e;  5GAN 2;  1YJN T;  4C5G A;  4EMG A;  2HNI A;  2ZPH B;  4HA8 A;  4LD6 A;  5C6S A;  4M78 C;  1VQ6 T;  1WQW A;  2L5Q A;  1Y96 B;  3JCM g;  3G6E T;  3VU3 C;  3CMA T;  4C92 C;  5GAN e;  3DLL A;  3VV0 A;  3QO3 A;  4KT0 E;  4OB3 B;  3VYH B;  3M56 A;  1Y71 A;  4FL6 A;  4RCB A;  1GXI E;  3CBP A;  2RA2 A;  4C8Q F;  1BIA A;  1EIF A;  4NL2 A;  3RMS A;  3M59 A;  2DAQ A;  2VXF A;  3BFM A;  4LDW A;  4J83 A;  1KHC A;  3OB9 A;  5GAN 7;  5I2S A;  1U1S A;  4C8Q B;  4KUD K;  2DIQ A;  2FHD A;  1G3Y A;  1P92 A;  1WQ7 A;  3QXE B;  3FC3 A;  3CCS T;  1VQL T;  1WJQ A;  4IUU A;  3OYJ A;  3CXC S;  3CCV T;  1YI2 A;  3CPF A;  2Y4X A;  4A4E A;  3DB3 A;  3JAM E;  3L2R A;  3QZ5 B;  1UB4 A;  5CIU A;  1KQS A;  1KG1 A;  2X4Y A;  3QPH A;  5GAO l;  4M7D A;  2DKG A;  4XK8 E;  4M77 G;  5IN1 A;  2V8K A;  2EQM A;  1VQ6 A;  5GAN j;  2OTL A;  2XD0 A;  3CC2 T;  2VXE A;  5CKH A;  1VQ9 T;  3G6E A;  4M78 E;  2EIF A;  1VQL A;  1M4Z A;  2EQK A;  1AHJ B;  3RKX A;  3VUB A;  4ZN1 A;  4C8Q E;  3HL8 A;  4YTL A;  1WPY A;  2QQB A;  3M55 A;  4XTX A;  1Q7Y U;  4E47 A;  4HT8 A;  3ZFJ A;  2RI3 A;  4XU1 A;  3C4S A;  2DVE A;  3X28 B;  4MZP A;  4F7U G;  4ZGD B;  3OYM A;  3L2U A;  2K5I A;  4EDU A;  1JJ2 S;  3JCM b;  2KK4 A;  2XKO C;  5GAN f;  1N6A A;  2F5K A;  2RI2 A;  3CCL T;  3RIR A;  3OW2 A;  1UGP B;  4M7D B;  2JUF A;  4M78 G;  4N4G A;  3CPW S;  4GLK A;  4ELZ C;  2RJF A;  3CCE T;  1KHI A;  3M53 A;  2JZ2 A;  4M77 E;  5FU7 B;  4C92 G;  3OBY A;  3X24 B;  2DXB A;  1K73 C;  4L5G A;  2R58 A;  3UDC A;  5GAO q;  3G4S A;  4DOV A;  2F5T X;  2QQR A;  3INZ A;  2MWO A;  2PVG B;  2ZGW A;  2E10 A;  1JBM A;  1YIT T;  4M7D D;  3HRU A;  3GNG A;  1O9S A;  2QTX A;  3TU4 K;  1VQ7 A;  3QUI A;  3L42 A;  3CCL A;  4C8Q C;  3JCM X;  1LOJ A;  1OZ2 A;  2L3R A;  3M4G A;  5LJ5 d;  1Q7Y C;  2KQW A;  1JRI A;  3LWH A;  1X6O A;  4XTU A;  1NJI C;  2AHJ B;  4OGE A;  4CI0 C;  3FEO A;  3A8G B;  5LJ3 d;  4M7A B;  1H3Z A;  3E9G A;  4E7J A;  3CME T;  3PMI A;  2R5M A;  4PJO F;  3CCU T;  2G3R A;  1QVG A;  2IG0 A;  3G71 A;  3OW2 S;  2DTO A;  2XU8 A;  1BIB A;  3S6W A;  2EAY A;  1U1T A;  4M77 C;  2A7Y A;  3DLM A;  4Y28 E;  2GQV A;  2P4T A;  4M78 B;  2YLC A;  2EYQ A;  2X4X A;  1W2B A;  1Q81 U;  2XK0 A;  5GAN h;  4X9C A;  4ZTF A;  4QQG A;  2HBP A;  4RG2 A;  1NPP A;  4C0G A;  1KQS S;  2GFA A;  2K57 A;  4PLI A;  4M75 F;  3SD4 A;  4JRP A;  4B9X A;  3CCQ T;  2CGH A;  4FT4 A;  2XDP A;  4J8O A;  3ER0 A;  4IUV A;  2JN0 A;  4VUB A;  1KQ1 A;  4JRQ A;  3JCM W;  3X25 B;  2BIV A;  4BDY A;  3FB9 A;  5I2M A;  3PIP A;  5DLO A;  3RKW A;  5LJ5 g;  1VQN A;  4M7A F;  4N4H A;  3OS2 A;  4M7D G;  2CZ1 B;  2DPP B;  4LDY A;  4M77 D;  5LL6 S;  4ATO A;  2GCX A;  3S3M A;  1W4S A;  3GNF B;  3MEU A;  1PSE A;  2DXC A;  4XAX B;  2LVM A;  1K8A U;  2A3L A;  1QVP A;  2DEQ A;  3EAE A;  4LDU A;  5HK0 A;  2DK3 A;  5LJ3 e;  2QXF A;  1YBY A;  3FLG A;  4WF2 A;  5GAO n;  4D6W A;  4MZT A;  3CC4 A;  2QDY B;  4LDV A;  2EFI A;  2RHX A;  1YJ9 A;  3A8L B;  4JLG A;  5GAN 8;  2BUD A;  3VJP A;  4EMK B;  3CCM A;  3QDR B;  1VQ5 T;  2E5Q A;  3HHT B;  4XTW A;  4F7U E;  3SWN B;  3JB9 F;  4MML A;  4KUL A;  1VIF A;  1NE8 A;  1Q82 U;  4JRI A;  4ME7 A;  5CAI A;  3RER A;  4BB7 A;  2K5L A;  2LDM A;  1G5V A;  2X4J A;  4E7L A;  5KCH A;  3OQ5 A;  1R8O B;  3QYH B;  2LQK A;  2LT4 A;  3CPW A;  3I55 T;  5A2Q E;  2KVQ G;  2NLU A;  1YHQ T;  3H8Z A;  1B34 A;  3MO8 A;  4L6V 5;  3FDR A;  4ELY C;  5CKD A;  1OYX A;  3L2V A;  4M78 F;  1QW1 A;  2DXU A;  2E1H A;  2RH2 A;  5GAN 4;  1M9S A;  1VQK T;  2YRV A;  3CD6 A;  2DO3 A;  3MHX A;  3JB9 I;  2VGN A;  5FRN A;  3RKY A;  4FT2 A;  4M7A A;  4BI3 A;  2RHZ A;  4XTZ A;  4RCC A;  5GAM d;  5HKC A;  3OYY A;  3JB9 J;  4II1 A;  2FVU A;  3V7R A;  5A0G A;  5GAO m;  4PJO B;  4IUP A;  1M1F A;  3P8H A;  3M57 A;  4MDW A;  4DQ2 A;  5CCA A;  5GAN g;  2M9U A;  2O4X A;  2ZPG B;  4NL3 A;  2RHI A;  2V8I A;  4P5N A;  5HK3 A;  5EG2 A;  5GAN 3;  2RO0 A;  2E6N A;  2DD5 A;  3N5B B;  3UWN A;  3CCQ A;  1YJW A;  4M75 A;  4XTV A;  3MCA B;  4M75 G;  1I5L A;  3JSC A;  5LJ3 f;  3SWN C;  2VYT A;  3MEA A;  1XTD A;  4IUT A;  4QVD A;  3OSV A;  2RHY A;  1U8R A;  4LDX A;  4M7A C;  3OYH A;  4ZGJ B;  3CCV A;  5CQX A;  1YI2 T;  2ZPF B;  1VQM T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...