4LD9K

Crystal structure of the n-terminally acetylated bah domain of sir3 bound to the nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
214
structure length
210
Chain Sequence
AKTLKDLDGWQVIITDDQGRVIDDNNRRRRGGENVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIKIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein/transcription/dna
molecule keywords Histone H3.2
publication title The N-terminal acetylation of Sir3 stabilizes its binding to the nucleosome core particle.
pubmed doi rcsb
source organism Xenopus laevis
total genus 32
structure length 210
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ld9K00
4KUIA 4DA4A 4FT2A 4FSXA 2FL7A 4KUDK 4BB7A 3TU4K 3PT9A 1W4SA 1M4ZA 4DOWA 1ZBXA 4FT4A 4LD9K 4KULA 4JJNK 2FVUA 4DOVA 1ZHIA 3PTAA
chains in the Genus database with same CATH superfamily
1FWZA 2L3RA 1UJYA 3MPUB 4LN2A 4FM4B 2C0TA 1PD0A 3WXMB 1Q86C 3H41A 4A4HA 2EGEA 1JJ2A 9ATCB 3EFRA 2HBPA 2JZ2A 4HVUA 2DO3A 2LNVA 4M78F 2BKDN 3BDLA 2MF2A 1VQ8T 1LOJA 4C8QG 4XU2A 1VQOT 2ECZA 2EQUA 1YIJQ 4M78C 2FZKB 2H3EB 5LJ3g 1I81A 2PQWA 3URGA 1YJWT 2QEXA 1YJ9T 4PLIA 3BY7A 1M30A 4C8QE 1PG5B 4C5IA 4X34A 3RR6A 2XICA 1X43A 3M0TA 3NPFA 1FMKA 1KD1C 1NZ9A 3I56Q 3VYHB 5CKDA 2OI3A 4IUQA 3G4SA 3A5ZB 1QMCA 1UGSB 4JLGA 3HRSA 2LNHB 1V29B 4RCBA 3H0FA 2LC4A 2JMCA 1K8AR 1BKBA 4J7FA 2QA4Q 1WHHA 3CBMA 3QWYA 3LWIA 3MP1A 4C8QB 3CC4Q 1ARKA 4M7AC 1YP5A 3OYEA 4NOYA 8AT1B 1FX7A 1YITQ 4BI3A 1M90R 5I2MA 2LQWA 2PUKB 5D6WA 1RLQC 4N0AA 3TSZA 3QHSA 3OYFA 4AFUC 1G3WA 2MIOA 1R0BG 1OV3A 2O4XB 2LQ8A 1OPLA 1QW1A 5GANe 4F14A 3RNJA 1PRMC 4J6XA 2VB6A 2HZYA 4J8OA 3TEEA 2EGAA 2XK0A 4B9XA 1RACB 1P92A 1JBMA 3GF5A 4C0GA 1E6GA 4FYWB 3VS1A 3VS6A 4FT4A 1O9SA 1WPYA 1NEGA 3QO3A 2R5MA 4R56A 4J6YA 2HDAA 1RAGB 1BI0A 3NTIA 3OS5A 3EG3A 1YI2T 5IHNA 1VQ7A 1OZ3A 4XU3A 4OMMA 2J6FA 3E1SA 3M58A 2LX9A 2A7YA 3X24B 4C8QF 1KHIA 5LJ5e 1I8FA 1X01A 3L2ZA 1ZX6A 4IUTA 4UC4A 3HHTB 2EQIA 3PT9A 2CT3A 2ZPGB 4AT1B 1SPKA 3L42A 4C8QC 3G1JA 3H8ZA 4EMKB 2Z0WA 2KYMA 1Z9ZA 3FC3A 1JQQA 1ZA1B 2X35A 1NLOC 1VYUA 5IXFA 3DB4A 5KYNA 1ZUYA 5GMKj 2LCLA 4JRPA 3AT1B 4RTTA 4AFSC 4NL3A 1LPLA 1VQ6T 3J7AF 2EYWA 1G83A 1WHMA 1FMVA 2BIVA 5CR2A 4KRTA 2C06A 1WZOA 3EGDB 3HRUA 4M78D 4X9CA 4F17A 2RJCA 2GTJA 2DETA 1NJIU 1MV0B 1MGQA 3MEAA 5LJ5f 2KYBA 1VQ9Q 1VQLQ 3V7RA 2O9SA 1ZBXA 4PJOA 2RI2A 2QGFB 2GQVA 4XK8E 2VXFA 4HCKA 2GFAA 5DLOA 1OOTA 2X3WD 3X26B 2K3BA 2RI3A 5GAOn 2DM1A 2GFUA 2CUBA 4WCIA 3OYAA 2JTEA 1MNEA 2M1HA 2IIMA 5IN1A 4E47A 4M7AD 3OYIA 1M2VB 2K2VA 3SHWA 4EMKC 1K9MU 4PKCC 5LJ3h 2P0KA 1PKTA 2AKKA 4HT9A 3CCSQ 3ZL7C 1RI0A 3DB3A 2DTIA 3VKIA 1N8RU 4PJJA 1OX8A 2NYSA 4BI8B 1SG5A 1FYNA 2ED0A 3CCUA 3LGLA 1S72T 2SEMA 2AHJB 4FW2A 3A8HB 1Q82U 2VC8A 1YJNA 5KE2A 1KHCA 4CI0C 4LXCA 4XTWA 3A8LB 1KJWA 2L89A 4M7DG 2YDLA 1AEYA 4ZTJA 4D6WA 1I5LA 3G6ET 4M7DE 3EFOA 3CMEA 5CQYA 2IVWA 3OS2A 2EJGA 2GTOA 1QCNA 2YT6A 1N27A 3T9NA 2QTVA 1UDLA 3M0QA 2EJFA 1YJWQ 1YJ9Q 3MEVA 1Y7XA 1ZUKA 1MMGA 4C8QD 3QZ5B 4FSSA 2LJ0A 3CCVA 1U3OA 2CP6A 3CCET 1Y0MA 3S3NA 1WLPB 2CZ0B 1VQKT 4M7DB 3JSCA 4BD3A 1TUCA 1W70A 3CPWP 2A0FB 3A1PA 1VQ5T 3SDZA 2XIDA 1X2KA 1NPPA 3OYLA 4RTYA 4C5GA 1W1FA 3JCMQ 3GIBA 3WVDB 4Z8AA 2XKOC 2LQNA 3P8HA 2A3LA 4DBHA 4PL6A 2EYXA 2HNIA 2AT1B 2Y90A 4FCYA 3QSUA 2V1RA 3RKWA 3RERA 2C0OA 3CCUQ 1QP2A 4XTYA 3VUBA 3CBOA 2PU9B 2X51A 3QZ9B 4LUDA 4OB3B 1M1KC 1BI3A 2EYZA 1UGPB 5KYWA 1QVFP 2IG0A 1PHTA 4BACA 1A0NB 2KNBB 1K8AC 5LJ3j 1XTDA 3M56A 3QBYA 2HCKA 4M7DF 1IZ6A 3CCRA 1M90C 2EQKA 1UECA 4VUBA 1IB8A 2MK5A 2FL7A 4M7DC 3VU3C 3NTKA 2QA4T 1PSEA 4F7UA 2FG0A 2DA9A 1RABB 2DVEA 1M4ZA 1RAHB 1YITT 2J7IA 3OYNA 2KXCA 1KC8U 4XU0A 5KH6A 4C5HA 5ECAA 2CDTA 1JXMA 1WNLA 2V8JA 2XD0A 2M9UA 1TG0A 2DL3A 2K5LA 3I35A 3ER0A 1TWBA 4A54A 3F70A 3I55A 1H3ZA 4OF1A 2RQUA 1LJOA 4KBMB 1W4SA 3M57A 3OBWA 4C0DC 3UPUA 1KFZA 2V8IA 2VASA 3CCQQ 3FJ5A 2QQSA 5FU6B 1Y07A 1VQMA 5KE3A 2DJQA 4FYVB 3EG9A 4J9HA 2OX7A 1PD1A 1SHGA 3NMZC 5GAMe 4ZGEB 2CH4A 3GOXA 5HCKA 2COWA 1U1SA 2KR3A 2AKLA 4PJOE 2AZVA 2E64A 2L3SA 2QEXT 2CT4A 1I4K1 4QVZA 1M1GA 4QQGA 4DA4A 4E6RA 2D0QB 3JCMc 1D1BA 1WQWA 2OAWA 4C92A 1M8VA 1MNDA 3H9NA 3A8GB 2A37A 4PJOB 3A98A 2KQWA 1UGRB 3BFMA 3CPWS 2CZ7B 3V8LA 4J5YA 1VQ4A 1N6AA 2DYBA 3I5SA 4KGXB 1OEBA 5J39A 3QJ6A 1NJIR 1QWEA 2RD1A 4LDWA 4HT8A 4E7KA 3OYDA 3CBPA 5GAN7 4E7LA 2AIRB 2EIFA 4M75C 1Y57A 2DXUA 2KXDA 5DY9A 5FU6C 3JCMP 2ZGWA 3QKJA 4C0FA 1K0SA 1N9RA 5GAN8 2MPXC 1AWWA 1X6GA 4Z89A 2RK1A 3L2RA 3V7CA 4A4FA 1VQPQ 5FRMA 4LDUA 3CCJA 2XDPA 5KCHA 1CKBA 2DNUA 5L8RE 3M0UA 1YHQA 2XDBA 4F04B 3MO8A 2FEIA 4QQDA 4QT7A 3G6EQ 3MHXA 3NGPA 5GAOp 3O8VA 1Y71A 3INZA 2CGHA 4IIOA 4YTLA 2VYTA 2SRCA 4R55A 3UWNA 3CCST 2KT8A 2FYKA 3EFOB 4BUGA 2RHZA 3M9QA 5CKBA 3CCEQ 1JO8A 2HQHA 3OMCA 4FW1A 3MEWA 3FIFA 4HCBA 1C0MA 5KYXB 1G2BA 3CMAA 1K73C 2BUDA 2OTLQ 3TVTA 2QAZA 2HKNA 1VQ5Q 3CC7A 3VRZA 4Q5WA 1JEGA 4C0ZA 4PJNA 3TU4K 3JCMf 1BBZA 2VKNA 3EGUA 1WI7A 2LP5A 5FLXE 2DL7A 1U06A 2ENMA 1H92A 3UA7A 1UTIA 2ZPHB 2ZPIB 2K3XA 1Q7YU 2JS2A 3GNGA 2E6NA 5GAN6 4Y91A 4CC2A 2E10A 2VWFA 4QW2A 1G8XA 1KQSA 4PK4A 3SWNB 3E19A 1KD1U 3E9FA 1JU5C 3CCJQ 2KDSA 2M51A 2EKOA 3QJYA 3DKMA 3OBYA 3JCMd 3EAEA 3EG0A 2O2OA 2L3PA 4LDVA 5HKCA 1M1KR 5IHKA 4JRIA 4MZPA 4JJCA 1YWOA 4CC3A 5GAOr 3THKA 2DERA 5I21A 5IAYA 2D8HA 3QDFA 1ZHIA 4DBRA 2F2VA 3FDRA 5I2SA 1UG1A 1QCFA 4M75D 4M77G 1ZA2B 2LTOA 2J6KA 4B9WA 4CC7A 3HL8A 2X4YA 1Q81U 1QLYA 2R5AA 3CCUT 4WF2A 2O9VA 4IUUA 3CMAQ 4M77E 3OYYA 3CC7Q 4RTUA 4HCCA 1PSFA 1X6BA 1YJNT 1MMNA 2E12A 1C6VX 2LJ1A 4J9GA 3C94A 3M0RA 5A0DA 1QVFA 3UT1A 4RG8A 3VS7A 1QCOA 4XTUA 4LUEA 4ZN3A 4IIMA 3SWNC 4M77B 3NFCA 2EKHA 2RJEA 3CMET 1AHJB 1BK2A 2F69A 3BE3A 4OP0A 3MP6A 1TS9A 5FROA 1VUBA 2QEXQ 4MZMA 1UE9A 1WHGA 1WIEA 3QPHA 2MOXA 3CCVT 2HAXA 1MMDA 2CKKA 1J3TA 4E7HA 3CD6A 3QYGB 2O01E 2DKGA 3OSVA 4NS5A 2NWMA 3G4SQ 4EIKA 2QYZA 1NYGA 5GJVB 2DZ9A 2ROLA 1QQJA 1T3LA 4HKEA 3VUZA 5GANf 2DBMA 3OYCA 4JRKA 4PFOA 2E1HA 2QK0A 1GCQA 4EMHA 1GBRA 4HA8A 2KBTA 5LJ5g 2A28A 3CCQT 4MDWA 1KG1A 2QGGA 1GCPA 5EG2A 2A08A 1VQNA 3REAB 4ZGDB 4F16A 1D1AA 2E4HA 2JOYA 2BE9B 2E65A 4EDUA 4M77F 3JCMh 4K11A 2FPDA 4RTXA 3CC2A 5IH2A 5IT9E 1CKAA 4RUGA 5C0MA 1M5Q1 4BE1A 2HQEA 2CSQA 1RAIB 4J9FA 1AZEA 4RKUE 4Z02A 2JVVA 5I11A 4M77C 3M0PA 3MP8A 1WX6A 5GANd 2R58A 4J9IA 3OS0A 2GQIA 4JJDA 3OYBA 2R57A 2YLCA 4E7SA 2K5IA 1OU9A 2EWNA 1X6OA 2B86A 2FVUA 3X25B 5FRNA 1VQ8A 1HK9A 3X20B 3OQ5A 4OB0B 3CCRT 1VQOA 4IKFA 3SFMA 1NJIC 2LRQA 4XTVA 3JCMJ 2BTTA 1AWJA 3CQTA 1VQ7Q 1MUZA 1GL5A 4P5NA 2PVDB 2XMFA 2ZAEA 4HCZA 5LJ5d 4HVVA 4LNPA 3HFNA 1Q95G 2FHDA 2RNAA 3JB9G 3CD6Q 2OTJA 1D3BA 5KYYB 1SSFA 3C4SA 1JB0E 2E5QA 3O5ZA 4PFZA 1ZSZA 2PVGB 2O88A 2NUTA 3LLRA 2EGCA 1SRMA 1K9MC 5A0GA 4DEYA 2XG8D 4DBQA 3LWHA 1VQPT 1TTHB 2DZCA 4D8KA 1WFWA 2GF7A 1VQMT 3JCMW 4XQ3A 5M9OA 1K73R 3LYIA 5EC7A 1N8RC 2BZ8A 4BDZA 2MWOA 5HK3A 1IRXA 4X1VA 1HD3A 4M78A 1RLPC 3L2VA 5J26A 2YUQA 2M16A 2RB6A 1Q82C 3H0IA 2KMTA 2W0ZA 2MMPA 3LH0A 3HSBA 3PVQA 3CCMA 3E9GA 3ME9A 3OMGA 2DK3A 2QG9B 3JCMX 2K5FA 4DQ2A 1LNXA 3RESA 1NBEB 2VUBA 1TUGB 1YFNA 3IQLA 2X4WA 2CYZB 2XHCA 4ZTFA 2DXCA 1HYOA 2K79A 1YI2A 2OTLT 3S3MA 1BIAA 3E2UA 5GAOq 4M7AA 5I22A 2ZZDA 3M59A 5CO7A 4LDXA 1AWXA 1D0XA 4PLLA 3UF4A 3ULRB 3R6NA 2RQRA 1Q7YR 2DD5A 5GANh 1MV3A 1IXDA 1O75A 3HFOA 3Q1JA 2PZ1A 2XDDA 3MKDA 4QKUA 3JB9F 1U5SA 2D6FA 3J81E 1IGUA 1XOVA 2QTXA 1OX9A 1VYTA 5DM7R 2KVQG 1YCSB 2HBWA 4MMKA 1TXQA 1YJNQ 1VQ6A 4JRQA 3N5BB 2M0OA 3QYHB 2EPDA 2RHUA 1H3HA 2LCSA 1K4US 3CEYA 3CCJT 2JMAA 2ZPFB 2F1LA 2ESWA 2RM4A 2KRSA 1R77A 5LJ5h 1M90U 5GAN2 3M0SA 3PTAA 3NTHA 3U23A 1PRLC 4KGVB 2RHXA 2QQ9A 1YBYA 3CMEQ 3JV3A 3M55A 2RJFA 4AG2C 1M2OA 6AT1B 2LT4A 3FB9A 2PNIA 2NUPA 2BE7D 4Y28E 3OYMA 2WACA 2VGMA 2HL5C 5GMKe 1K9AA 4ORZA 4C8QA 1V1CA 3CCVQ 2GGRA 2I0NA 1D0YA 1MHNA 4GLMA 5GMKi 2RHYA 5C6SA 4OMNA 3CMAT 3OY9A 3CC7T 1BYMA 1OI1A 2KSSA 2O4XA 3EH1A 2DEQA 2IPOB 3V7SA 2YRVA 3RMQA 1WJQA 2KEAA 1KC8C 7AT1B 4OGCA 4N0AC 3J80E 1GBQA 1H641 1NE8A 4PJOG 3LX7A 2L2PA 4JZ4A 1VIEA 2LJ3A 4JPBW 1S72A 2E70A 2ROTA 2EJ9A 4AMCA 3FRNA 3KBGA 4MMLA 3OYJA 4QVDA 5HK0A 1GFDA 1KSWA 2HL3A 4OVAA 1WXUA 1ZUUA 1CSKA 1TH7A 2DD4A 2E6ZA 3OB9A 4EMGA 3QXEB 1I07A 3RUXA 3CCLA 2BZYA 3G4ST 2DL5A 5GANj 5CVIA 4A4KA 3CCRQ 3MEUA 2ABLA 3CXCP 5J3BA 2RA2A 2RQVA 3LGFA 3UATA 3UA6A 2FO0A 1SRLA 3ZBDA 4XTZA 2EBPA 2JJ9A 5FU7B 4RTZA 2DF6A 2ZCFB 2DAQA 1UHFA 2JM9A 1FMWA 2WSCE 2LX7A 2DIGA 3EH2A 1QKWA 2QQRA 2JS0A 3WVEB 1VQKA 2JNGA 1OU8A 2EAYA 1T0JA 4DOWA 1WXTA 1HSQA 5GAMf 2DRKA 3C95A 1RADB 5LJ5j 1I1JA 3OW2P 1M8MA 3I55Q 4IURA 4Z88A 2XI9A 2HMAA 1D3BB 2OAUA 2YUNA 1NG2A 2AZSA 4KH1B 3I9QA 3OS1A 1G3TA 4JS5A 1XJWB 2MAMA 4GLKA 1RUWA 1ZSZB 1VQMQ 1B34A 3JB9H 2MYSA 1ACMB 4M78E 2V26A 2PTKA 1U1TA 2J05A 1WA7A 2NUTB 4A53A 1JRIA 1WHLA 1Y96A 4DBFA 1K9MR 4M7DD 3CPFA 1YIJA 4BE2A 2RQWA 1VQ7T 1OPKA 4PJOF 5GAMd 1X69A 2MCNA 4TVRA 3VS2A 2Y4YA 3RBBB 1N8RR 1M2VA 3DLLA 4KUDK 3G71A 2CUDA 1SF9A 4M7AG 5AT1B 1JXOA 1QWFA 1RAAB 2JTMA 4M78B 1OULA 3HRTA 3I56A 3CD6T 4PJOC 5HY6A 3FJPA 5CKEA 5FU7C 2QQAA 2YUOA 1AVZC 1OQKA 3JCMg 1Q82R 2YUPA 5CKFA 3KXTA 4J83A 1G3YA 4M7AE 3ZFJA 4MZTA 4OMFB 2QA4A 1Q86U 2HKQB 3CC4A 1UGVA 2DMOA 3REBB 1M3AA 1S1NA 2K3YA 3MJXA 1VQ4Q 2FPEA 1YITA 1GRIA 4J9EA 1QVPA 1PM3A 1TU0B 2A36A 1QVGP 1ZLMA 1WJRA 3C0CA 1VQNT 2CREA 1B7TA 2JXBA 3HP9A 4JUVA 1MMAA 1M9SA 2CP0A 4M7AB 2P4RA 1KQ2A 3CC2T 2YHTA 2RO0A 2VVKA 4M4ZA 5LJ3e 4Y92A 4X9DA 1ZSZC 3EG2A 4IUVA 2C0IA 2CP7A 4XAXB 4FYYB 4ME7A 4E7JA 5CQXA 2V8KA 4F7UG 2ATCB 2DYIA 4MDXA 2OJ2A 1PCXA 1YHQQ 5GMKh 3A8MB 4FT2A 3GLXA 1H8KA 2AK5A 4GBQA 2RPNA 2CZ6B 1Q7YC 2KY9A 4M7DA 2FB7A 3PMIA 3S6WA 4RMOA 4F7UE 5KYWB 3VS3A 3CPWA 1K76A 2DRMA 4AFZC 3M54A 3G71Q 2O31A 3CXCS 1M1FA 1XQHA 5CCAA 1IHWA 1X75C 2OTJT 4FL6A 2F2WA 4E2FB 3TSWA 3JAME 4E7IA 2RMOA 5LJ3f 1QKXA 3V8JA 4M7AF 3VS0A 1V76A 2RQTA 2K7AA 1KK7A 2JT4A 1I0CA 4F7UB 2NUPB 1M3BA 4LD6A 1WJSA 2FPFA 4RTVA 4B6MA 1LVKA 3BW1A 1M3CA 4IUPA 3OW2S 3JCMb 5GAMh 4BI4A 1ABQA 3SEMA 2JTFA 2COYA 5GAN5 4A4GA 4OMQA 2DPPB 1DJ7B 1W2BP 4XTXA 1Z9QA 3P8DA 1Q81C 4FYXB 3QUIA 5GMKm 1ZBJA 5LJ3d 3RKYA 1VQ9A 1VQLA 4D8DA 2YWWA 1WDXA 1KC8R 4PJOD 3HPWA 2X9HA 2DTHA 4C92G 3CCMT 3EFSA 2CS7A 2G3RA 2DJZA 1GXIE 1PKSA 5GANg 2J6OA 3ASKA 3EG9B 5GJWB 1X27A 2CP3A 2FZGB 1IO6A 1WHKA 3OSSC 2QASA 4C92E 2QQBA 2L0AA 3GBQA 4PFPA 4F7UF 1HXDA 2DIQA 1RAFB 4FSXA 3EGXA 1SSHA 3H0HA 5GAOm 4DEXA 3LW5E 3CCSA 5LL6S 4N4IA 3TREA 3PMTA 2KAFA 4M75A 4C92B 5GAN4 3VYGA 3GPLA 1QVGS 2FRYA 2KT1A 2EFIA 2X4XA 2E3HA 2H8HA 4ESRA 2QI2A 3C12A 3QWXX 8ATCB 4BE0A 1ABOA 4J9CA 1BCMA 2VV5A 1TOVA 1AWOA 1EZZB 5KYUA 2E5KA 2L5QA 2I2LA 2DTOA 2LCCA 2CP2A 2KROA 2ZPBB 4JS4A 2LVMA 1G5VA 1NLPC 4KGZB 2DEUA 3PGGA 1WHJA 5D6XA 4BDYA 1T0HA 4XU1A 3FLGA 1HJDA 3CXCA 4BB7A 1VA7A 1B34B 2NLUA 3M5AA 4QVCA 5FW9A 1YJ9A 1VYVA 2EQMA 1YJWA 3META 2VXEA 1RI9A 2EVRA 2V1QA 4FIBA 2RI5A 3SB2A 1Y96B 3S3OA 3GP8A 4C5EA 2D0NA 1BIBA 2DE0X 4C92F 1K0XA 5GAMj 1TSFA 2F5TX 3PVLA 4OMLA 1YNZA 2DL8A 5AYFA 1OZ2A 4C92C 3I55T 2WSEE 3OW2A 4J9BA 3M4GA 3RIRA 1PWTA 2DILA 2DVJA 3FEOA 1RL2A 2K57A 2W10A 1C1AA 3RDVA 1VQNQ 4ATOA 2K4YA 2F5KA 4II1A 2B8AA 3PIPA 2LDMA 4AFQC 2CP5A 3CC2Q 5IXBA 1UEBA 1ZQ1A 1E6HA 1EFNA 3VS4A 1W2BS 4LD9K 1JJ2P 2G6FX 3EHRA 3AHUA 3HKSA 1G3SA 2DL4A 1OYXA 4KT0E 2KI7A 1F1BB 1N5ZA 4JLIA 1PC0A 4QQ6A 4BY6B 2MI6A 1D0ZA 4O5VA 1K1ZA 1Q86R 2YSQA 3H6ZA 2K9GA 3CCLT 1BCOA 1NYFA 2PUOB 1BB9A 3PNWC 1VQ8Q 2COZA 3RMSA 2DFUA 1LCKA 1VQOQ 3LH5A 4L6V5 1BU1A 1D09B 1KQSP 4DOVA 2MWPA 1NPRA 5KYXA 4O6JA 2JUFA 1NM7A 2QDYB 1UB4A 3L2UA 1VQ4T 3MCAB 5D7UA 3VJPA 1ZSGA 1AD5A 1QVGA 4L5GA 2OTJQ 4R0KA 4PJMA 3R6OA 2RK2A 2XU8A 4GY5A 4N4HA 4KULA 1B3QA 1AOJA 4JJNK 2WSFE 5CAIA 1FXXA 3I5RA 4M77D 3PE0A 1KD1R 2PVOB 4ZGJB 2FRWA 1M1KU 2KK4A 3L2QA 2H3JA 1UGQB 4LDYA 2DX1A 4L59A 3KFVA 3CCQA 4HXJA 3VV0A 2F2XA 2DBKA 4RG2A 1K8AU 3SWNA 3OYGA 4C0DB 1YHQT 1B07A 1EX4A 2GNCA 3VRYA 4BY6C 3G7ZA 3OYHA 2JN0A 3OA6A 1IREB 1YIJT 1EIFA 1YN8A 4J9DA 4OGEA 3BDUA 2YLBA 3M4YA 4OMPA 4V2SA 2GCXA 1W6XA 3G71T 3CCMQ 1UJ0A 4EPCA 1Q81R 1WYXA 2K6DA 2FZCB 3I56T 1UUEA 2LQKA 2LZ6B 1UHCA 2BZXA 5L23A 1NEBA 1T3SA 2L8DA 5GAN3 5CIUA 4C92D 1KIKA 4ZN1A 4NL2A 1BI2A 4E7ZA 2HEQA 4M75G 2K2MA 1YI2Q 3JRZA 2RHIA 3CC4T 1VOMA 1SKUB 1IHVA 3QG1A 4M75E 1YCYA 2QXFA 4JZ3A 1WGSA 5CKHA 4KH0B 2X4JA 3TQ7P 4A4EA 4ANJA 2ED1A 2YXYA 1M27C 1W2BA 3EGXB 5CK9A 4OB2B 2EYQA 4M77A 3L2WA 4M75B 1RAEB 1AT1B 1VQPA 1VQ6Q 1VIFA 2KGTA 1JJ2S 4KUIA 4PNOA 1U8RA 3PIOA 3V8KA 1KQ1A 2HQXA 2JM8A 1QP3A 3SD4A 2E41A 3ZEHA 2KRMA 2DXBA 3G6EA 3EG1A 5KYUB 4WTOB 1X2QA 2HD0A 2DLPA 2M0YA 1AZGB 4EMKA 2EYYA 3GNFB 3JB9I 3QDRB 5GAMg 1E7OA 2NUZA 1GFCA 3D7SB 4RCCA 1KQSS 2KE9A 2CH4W 4CRIA 2CZ1B 2D9TA 2D1XA 2LMJA 3CCEA 3TCJA 2RH2A 2OTLA 2KRNA 4JJBA 1VQ5A 1TUDA 1WXBA 1PNJA 5D6YA 4OB1B 2LT1A 3JB9D 3EGDA 3RKXA 5GMKl 3M53A 3UDCA 1SEMA 4M75F 4A63B 1I5OB 2HSPA 2GBQA 2RJDA 4M78G 1GCQC 3QIIA 4LE9A 4FU6A 1R8OB 4HVWA 3OYKA 3L1AA 3KUFA 1R0CB 5DLQE 4ZNXA 2L3QA 2YRDA 5A2QE 1S72Q 2HSEB 2RF0A 4J7IA 3EHQA 4J6WA 1VQ9T 1VQLT 4N4GA 2VGNA 2E3IA 2J06A 3DLMA 2QDLA 2P4TA 3HTRA 5KCOA 4OMOA 1UFFA 3JCMe 1YWPA 5GAOl 1QVFS 4RTWA 3VS5A 2RN8A 4ELYC 2D8JA 4JDSA 3CCLQ 1N9SA 2DXTA 1IGQA 4PJLA 2CSIA 1K73U 2EQJA 5KYYA 3JCMV 3PFSA 4CC4B 2P0QA 1WQ7A 5FWCA 3JB9J 2YRCA 5FWBA 3NHNA 2X3XD 1BI1A 2EW3A 1XNIA 1D1CA 4AG1C 5A0LA 3A8OB 1SHFA 4ELZC 2JW4A 2Y4XA 5IHIA 1VQKQ 2M02A 2P0PA 2P84A 3P8BB 2ZPEB 3X28B
chains in the Genus database with same CATH topology
1VQMA 5KE3A 1FWZA 3E9GA 3CCMA 2L3RA 3ME9A 3OMGA 2DIQA 2DK3A 4FM4B 4FSXA 3JCMX 3WXMB 2K5FA 5GAOm 4DQ2A 3LW5E 1Q86C 1LNXA 3RESA 3CCSA 2VUBA 5LL6S 4A4HA 4N4IA 3TREA 5GAMe 4ZGEB 1JJ2A 2X4WA 3GOXA 2CYZB 2XHCA 3PMTA 4ZTFA 2KAFA 1U1SA 4M75A 2DXCA 4C92B 5GAN4 3EFRA 2HBPA 3VYGA 2JZ2A 2E64A 1YI2A 4PJOE 2DO3A 2QEXT 3GPLA 1QVGS 2OTLT 2EFIA 3S3MA 2X4XA 1I4K1 1BIAA 2LNVA 4M78F 1M1GA 4QQGA 4QVZA 5GAOq 2QI2A 3C12A 4DA4A 4M7AA 2ZZDA 4BE0A 2BKDN 3M59A 3BDLA 5CO7A 4LDXA 2MF2A 2D0QB 3JCMc 1VQ8T 1LOJA 4PLLA 2VV5A 4C8QG 4XU2A 1VQOT 2EQUA 2DD5A 4M78C 5GANh 1WQWA 5LJ3g 1I81A 2PQWA 4C92A 1M8VA 1O75A 3HFOA 3URGA 3A8GB 2L5QA 3Q1JA 2I2LA 2QEXA 2XDDA 1YJ9T 1YJWT 4PJOB 2DTOA 2LCCA 4PLIA 2ZPBB 3BY7A 2KQWA 4C8QE 4JS4A 3JB9F 1UGRB 4C5IA 2LVMA 3BFMA 4X34A 2CZ7B 3J81E 3CPWS 1XOVA 2D6FA 2QTXA 1G5VA 5DM7R 3V8LA 2XICA 4J5YA 1VQ4A 3PGGA 1N6AA 1KD1C 1NZ9A 2KVQG 5D6XA 3VYHB 5CKDA 4MMKA 4IUQA 3G4SA 5J39A 3A5ZB 3QJ6A 1UGSB 4BDYA 4JLGA 1VQ6A 4XU1A 2RD1A 4JRQA 3N5BB 2M0OA 3FLGA 3QYHB 4LDWA 2RHUA 4E7KA 3HRSA 4RCBA 1V29B 3OYDA 3CBPA 3CEYA 5GAN7 4E7LA 3CXCA 4BB7A 2EIFA 4M75C 3CCJT 1B34B 2NLUA 2ZPFB 3M5AA 4QVCA 2DXUA 2EQMA 1YJ9A 2LC4A 1YJWA 2RM4A 3META 2VXEA 1BKBA 4J7FA 5DY9A 5FU6C 5LJ5h 3CBMA 3JCMP 4FIBA 3LWIA 2ZGWA 3MP1A 2RI5A 3QKJA 3SB2A 1Y96B 4C0FA 4C8QB 3S3OA 3GP8A 4C5EA 1M90U 4M7AC 5GAN2 3OYEA 1N9RA 4NOYA 1BIBA 4C92F 3PTAA 3NTHA 5GAMj 1FX7A 5GAN8 4BI3A 5I2MA 2RHXA 2RK1A 2QQ9A 1YBYA 2PUKB 5D6WA 2F5TX 3M55A 2RJFA 4N0AA 3L2RA 3V7CA 4A4FA 5FRMA 5AYFA 1OZ2A 2LT4A 3FB9A 3QHSA 4LDUA 3OYFA 3CCJA 2XDPA 4C92C 5KCHA 5L8RE 3I55T 1G3WA 2WSEE 4Y28E 3OW2A 3OYMA 2WACA 1YHQA 2VGMA 3M4GA 2XDBA 5GMKe 3RIRA 4C8QA 3MO8A 2O4XB 2LQ8A 1QW1A 3FEOA 4QQDA 1RL2A 2K57A 1MHNA 5GANe 5GMKi 2RHYA 4J6XA 3MHXA 5C6SA 4J8OA 3TEEA 2XK0A 4B9XA 5GAOp 3O8VA 1P92A 1Y71A 1JBMA 3JB9D 3GF5A 3INZA 2K4YA 3CMAT 2CGHA 4C0GA 4HT8A 2F5KA 4II1A 4ATOA 3OY9A 2B8AA 3CC7T 1BYMA 1OI1A 3PIPA 4YTLA 2VYTA 4R55A 2LDMA 2KSSA 3UWNA 3CCST 1UEBA 2FYKA 4FT4A 1ZQ1A 4LD9K 1W2BS 2O4XA 2RHZA 4BUGA 1O9SA 1WPYA 3AHUA 3QO3A 2R5MA 3HKSA 4R56A 3M9QA 4J6YA 1BI0A 3NTIA 1G3SA 2DEQA 3OS5A 1OYXA 4KT0E 5CKBA 3OMCA 3V7SA 1YI2T 2YRVA 3RMQA 1VQ7A 1OZ3A 3MEWA 4XU3A 3FIFA 4HCBA 1WJQA 4JLIA 1KC8C 4OGCA 3E1SA 3M58A 2LX9A 2A7YA 4QQ6A 2MI6A 3X24B 2BUDA 4N0AC 4BY6B 4C8QF 3CMAA 1K73C 3J80E 1H641 1KHIA 1NE8A 4O5VA 4PJOG 5LJ5e 3CC7A 3LX7A 1I8FA 4Q5WA 1VIEA 3H6ZA 1X01A 3L2ZA 3CCLT 2E70A 4C0ZA 1S72A 2EJ9A 2PUOB 3FRNA 4IUTA 3KBGA 3PNWC 4MMLA 3HHTB 4UC4A 4QVDA 3PT9A 3OYJA 3TU4K 5HK0A 2ZPGB 3RMSA 4C8QC 3L42A 3JCMf 3H8ZA 4EMKB 4L6V5 4OVAA 4DOVA 5FLXE 2MWPA 3FC3A 1TH7A 2DD4A 1NPRA 4O6JA 2JUFA 2E6ZA 2QDYB 2X35A 1UB4A 3DB4A 3OB9A 3L2UA 4EMGA 2LCLA 5GMKj 3QXEB 1VQ4T 3MCAB 3RUXA 3VJPA 2ZPHB 4JRPA 2ZPIB 2K3XA 1Q7YU 3CCLA 3G4ST 4NL3A 3GNGA 1QVGA 2E6NA 1VQ6T 4L5GA 5GANj 3J7AF 5CVIA 5GAN6 4Y91A 2E10A 4A4KA 3MEUA 4QW2A 3R6OA 2RK2A 2XU8A 1KQSA 2BIVA 4GY5A 5J3BA 4N4HA 4KULA 5CR2A 3SWNB 2RA2A 4JJNK 2C06A 3LGFA 3E19A 2WSFE 1KD1U 3E9FA 3HSBA 3ZBDA 4XTZA 5CAIA 1FXXA 5FU7B 3HRUA 2KDSA 4M78D 4M77D 2ZCFB 2DAQA 2EKOA 3DKMA 2PVOB 3QJYA 4X9CA 3OBYA 2RJCA 4ZGJB 3JCMd 3EAEA 2WSCE 1M1KU 1NJIU 2DIGA 2KK4A 4LDVA 2H3JA 5HKCA 1UGQB 4LDYA 3L2QA 1MGQA 2QQRA 4L59A 3MEAA 5LJ5f 3WVEB 1VQKA 3CCQA 2JNGA 3VV0A 3V7RA 2EAYA 4JRIA 4MZPA 4RG2A 4DOWA 1K8AU 1ZBXA 5GAOr 4PJOA 2RI2A 3C95A 3SWNA 5GAMf 3OYGA 5LJ5j 5I21A 4C0DB 5IAYA 1YHQT 2GQVA 4XK8E 2VXFA 2GFAA 4IURA 1ZHIA 3G7ZA 2JN0A 4BY6C 5DLOA 3OYHA 3OA6A 1IREB 3X26B 3FDRA 5I2SA 2XI9A 1YIJT 1EIFA 1D3BB 2OAUA 4M75D 4OGEA 4M77G 2RI3A 3BDUA 2YLBA 3M4YA 2LTOA 5GAOn 4B9WA 2GFUA 3OS1A 4V2SA 1G3TA 3HL8A 3OYAA 2X4YA 4JS5A 1Q81U 2M1HA 2MAMA 2GCXA 2R5AA 3CCUT 5IN1A 4E47A 4WF2A 4M7AD 4GLKA 3OYIA 4IUUA 2K2VA 1VQMT 3G71T 1B34A 4EMKC 4EPCA 3JB9H 4M78E 4M77E 1K9MU 4PKCC 1U1TA 3I56T 3OYYA 4A53A 4HCCA 1JRIA 2LQKA 5LJ3h 1PSFA 2P0KA 1Y96A 1YJNT 4HT9A 5KE2A 4M7DD 2E12A 3CPFA 1RI0A 2L8DA 3DB3A 5CIUA 4C92D 5GAN3 4BE2A 1YIJA 4ZN1A 2DTIA 4NL2A 1BI2A 1VQ7T 3C94A 3VKIA 4PJOF 3CCMT 5GAMd 4TVRA 4M75G 1N8RU 3JRZA 5A0DA 4BI8B 1QVFA 2RHIA 2Y4YA 3CCUA 3UT1A 4RG8A 3LGLA 3DLLA 3CC4T 4KUDK 3G71A 4XTUA 1S72T 4M7AG 4PJOC 4ZN3A 2JTMA 4M78B 3HRTA 4M77B 3SWNC 2AHJB 3NFCA 3I56A 3CD6T 3A8HB 3QG1A 1Q82U 2RJEA 4M75E 5HY6A 2VC8A 1YJNA 3FJPA 1YCYA 2QXFA 5CKEA 5FU7C 1KHCA 1WGSA 4CI0C 1AHJB 2QQAA 3CMET 3JCMg 4XTWA 3KXTA 3A8LB 5CKHA 5CKFA 4J83A 2F69A 2L89A 1G3YA 3MP6A 4OP0A 4M7DG 2X4JA 4A4EA 4M7AE 3ZFJA 5FROA 1VUBA 4MZTA 4MZMA 4OMFB 2QA4A 1Q86U 4ZTJA 3QPHA 1W2BA 3CC4A 5CK9A 3CCVT 2K3YA 4D6WA 1I5LA 2HAXA 4OB2B 2CKKA 2EYQA 4E7HA 4M77A 3CD6A 3QYGB 3L2WA 2O01E 3G6ET 1YITA 1QVPA 4M7DE 2DKGA 3OSVA 4NS5A 4M75B 3CMEA 5CQYA 2IVWA 3OS2A 2EJGA 1WJRA 1VQPA 1N27A 1VQNT 1VIFA 3T9NA 2DZ9A 1JJ2S 4HKEA 3HP9A 4JUVA 3VUZA 1M9SA 2EJFA 4KUIA 4PNOA 4M7AB 5GANf 1U8RA 1KQ2A 3MEVA 1Y7XA 4C8QD 3PIOA 2YHTA 3QZ5B 4JRKA 3OYCA 3CC2T 2RO0A 3V8KA 5LJ3e 1KQ1A 2E1HA 3CCVA 2HQXA 4X9DA 4EMHA 1QP3A 3SD4A 2E41A 3ZEHA 4IUVA 3CCET 2DXBA 4HA8A 3G6EA 2CZ0B 3S3NA 1VQKT 5LJ5g 3CCQT 4MDWA 2HD0A 4M7DB 1KG1A 3JSCA 4XAXB 4BD3A 4EMKA 5EG2A 3GNFB 3JB9I 1VQNA 3QDRB 4ZGDB 2JOYA 5GAMg 4ME7A 4E7JA 1VQ5T 3SDZA 2E65A 5CQXA 4EDUA 2V8KA 4M77F 2XIDA 3OYLA 1NPPA 4F7UG 4RCCA 1KQSS 3JCMh 4MDXA 3CC2A 5IT9E 4C5GA 4CRIA 3JCMQ 5C0MA 3GIBA 3WVDB 5GMKh 1M5Q1 3A8MB 2CZ1B 2D9TA 2XKOC 4FT2A 4BE1A 2HQEA 3GLXA 3P8HA 2A3LA 3CCEA 2CZ6B 4RKUE 4Z02A 2JVVA 4PL6A 4M77C 3TCJA 1Q7YC 2KY9A 4M7DA 2FB7A 3MP8A 2HNIA 2RH2A 3PMIA 3S6WA 4RMOA 4F7UE 5GANd 2Y90A 2R58A 3CPWA 3OS0A 2OTLA 3OYBA 2R57A 2YLCA 3QSUA 3RKWA 3RERA 1VQ5A 2K5IA 2EWNA 5D6YA 1X6OA 2FVUA 2LT1A 1QP2A 3M54A 4OB1B 3RKXA 5GMKl 3CXCS 1M1FA 1XQHA 3X25B 3M53A 3UDCA 5CCAA 4XTYA 5FRNA 1X75C 1VQ8A 4M75F 1HK9A 3X20B 3VUBA 2OTJT 3OQ5A 4OB0B 3CBOA 4FL6A 2RJDA 2PU9B 4M78G 3JAME 3QZ9B 4E7IA 3CCRT 3QIIA 1VQOA 4OB3B 4FU6A 4IKFA 3SFMA 1M1KC 1NJIC 1BI3A 1R8OB 2LRQA 4XTVA 5LJ3f 3JCMJ 1UGPB 3V8JA 3OYKA 4M7AF 3L1AA 3KUFA 2IG0A 4F7UB 5DLQE 4BACA 4P5NA 2PVDB 4LD6A 1K8AC 5LJ3j 1WJSA 1XTDA 4HCZA 5LJ5d 3M56A 5A2QE 3QBYA 3BW1A 4M7DF 4IUPA 3HFNA 4J7IA 2FHDA 1IZ6A 4J6WA 3OW2S 3JB9G 2OTJA 1VQ9T 1D3BA 3JCMb 5GAMh 1VQLT 4BI4A 3CCRA 1M90C 4N4GA 1SSFA 2EQKA 2VGNA 2JTFA 4VUBA 3C4SA 1JB0E 2E5QA 2FL7A 3DLMA 2P4TA 4M7DC 3VU3C 5GAN5 3NTKA 2QA4T 4A4GA 1PSEA 2DPPB 4F7UA 1DJ7B 5KCOA 2PVGB 4XTXA 3P8DA 2DVEA 3JCMe 1Q81C 3QUIA 1M4ZA 5GAOl 1QVFS 3JCMW 5GMKm 3LLRA 1YITT 4ELYC 4JDSA 1K9MC 1N9SA 5LJ3d 2DXTA 3RKYA 5A0GA 3OYNA 2XG8D 1KC8U 4XU0A 3LWHA 1VQ9A 5KH6A 1VQPT 1VQLA 4C5HA 1K73U 2DZCA 2EQJA 2GF7A 1WNLA 3JCMV 3PFSA 4PJOD 3HPWA 2DTHA 2P0QA 1WQ7A 2V8JA 3EFSA 2CS7A 4XQ3A 4C92G 2M9UA 2G3RA 2DJZA 2K5LA 3LYIA 5M9OA 3JB9J 2XD0A 1GXIE 5GANg 1N8RC 3ER0A 3ASKA 4A54A 4BDZA 2MWOA 3F70A 3I55A 5HK3A 4OF1A 1H3ZA 1LJOA 1BI1A 4M78A 4KBMB 1W4SA 3M57A 3OSSC 5J26A 3L2VA 1XNIA 3OBWA 4C0DC 4C92E 5A0LA 3UPUA 2M16A 2QQBA 2RB6A 3A8OB 4ELZC 2V8IA 2Y4XA 1Q82C 2KMTA 2P0PA 4F7UF 1HXDA 2MMPA 3LH0A 2QQSA 5FU6B 3P8BB 2ZPEB 3X28B 1Y07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KUI A;  4DA4 A;  4FT2 A;  4FSX A;  2FL7 A;  4KUD K;  4BB7 A;  3TU4 K;  3PT9 A;  1W4S A;  1M4Z A;  4DOW A;  1ZBX A;  4FT4 A;  4LD9 K;  4KUL A;  4JJN K;  2FVU A;  4DOV A;  1ZHI A;  3PTA A; 
#chains in the Genus database with same CATH topology
 1FWZ A;  2L3R A;  1UJY A;  3MPU B;  4LN2 A;  4FM4 B;  2C0T A;  1PD0 A;  3WXM B;  1Q86 C;  3H41 A;  4A4H A;  2EGE A;  1JJ2 A;  9ATC B;  3EFR A;  2HBP A;  2JZ2 A;  4HVU A;  2DO3 A;  2LNV A;  4M78 F;  2BKD N;  3BDL A;  2MF2 A;  1VQ8 T;  1LOJ A;  4C8Q G;  4XU2 A;  1VQO T;  2ECZ A;  2EQU A;  1YIJ Q;  4M78 C;  2FZK B;  2H3E B;  5LJ3 g;  1I81 A;  2PQW A;  3URG A;  1YJW T;  2QEX A;  1YJ9 T;  4PLI A;  3BY7 A;  1M30 A;  4C8Q E;  1PG5 B;  4C5I A;  4X34 A;  3RR6 A;  2XIC A;  1X43 A;  3M0T A;  3NPF A;  1FMK A;  1KD1 C;  1NZ9 A;  3I56 Q;  3VYH B;  5CKD A;  2OI3 A;  4IUQ A;  3G4S A;  3A5Z B;  1QMC A;  1UGS B;  4JLG A;  3HRS A;  2LNH B;  1V29 B;  4RCB A;  3H0F A;  2LC4 A;  2JMC A;  1K8A R;  1BKB A;  4J7F A;  2QA4 Q;  1WHH A;  3CBM A;  3QWY A;  3LWI A;  3MP1 A;  4C8Q B;  3CC4 Q;  1ARK A;  4M7A C;  1YP5 A;  3OYE A;  4NOY A;  8AT1 B;  1FX7 A;  1YIT Q;  4BI3 A;  1M90 R;  5I2M A;  2LQW A;  2PUK B;  5D6W A;  1RLQ C;  4N0A A;  3TSZ A;  3QHS A;  3OYF A;  4AFU C;  1G3W A;  2MIO A;  1R0B G;  1OV3 A;  2O4X B;  2LQ8 A;  1OPL A;  1QW1 A;  5GAN e;  4F14 A;  3RNJ A;  1PRM C;  4J6X A;  2VB6 A;  2HZY A;  4J8O A;  3TEE A;  2EGA A;  2XK0 A;  4B9X A;  1RAC B;  1P92 A;  1JBM A;  3GF5 A;  4C0G A;  1E6G A;  4FYW B;  3VS1 A;  3VS6 A;  4FT4 A;  1O9S A;  1WPY A;  1NEG A;  3QO3 A;  2R5M A;  4R56 A;  4J6Y A;  2HDA A;  1RAG B;  1BI0 A;  3NTI A;  3OS5 A;  3EG3 A;  1YI2 T;  5IHN A;  1VQ7 A;  1OZ3 A;  4XU3 A;  4OMM A;  2J6F A;  3E1S A;  3M58 A;  2LX9 A;  2A7Y A;  3X24 B;  4C8Q F;  1KHI A;  5LJ5 e;  1I8F A;  1X01 A;  3L2Z A;  1ZX6 A;  4IUT A;  4UC4 A;  3HHT B;  2EQI A;  3PT9 A;  2CT3 A;  2ZPG B;  4AT1 B;  1SPK A;  3L42 A;  4C8Q C;  3G1J A;  3H8Z A;  4EMK B;  2Z0W A;  2KYM A;  1Z9Z A;  3FC3 A;  1JQQ A;  1ZA1 B;  2X35 A;  1NLO C;  1VYU A;  5IXF A;  3DB4 A;  5KYN A;  1ZUY A;  5GMK j;  2LCL A;  4JRP A;  3AT1 B;  4RTT A;  4AFS C;  4NL3 A;  1LPL A;  1VQ6 T;  3J7A F;  2EYW A;  1G83 A;  1WHM A;  1FMV A;  2BIV A;  5CR2 A;  4KRT A;  2C06 A;  1WZO A;  3EGD B;  3HRU A;  4M78 D;  4X9C A;  4F17 A;  2RJC A;  2GTJ A;  2DET A;  1NJI U;  1MV0 B;  1MGQ A;  3MEA A;  5LJ5 f;  2KYB A;  1VQ9 Q;  1VQL Q;  3V7R A;  2O9S A;  1ZBX A;  4PJO A;  2RI2 A;  2QGF B;  2GQV A;  4XK8 E;  2VXF A;  4HCK A;  2GFA A;  5DLO A;  1OOT A;  2X3W D;  3X26 B;  2K3B A;  2RI3 A;  5GAO n;  2DM1 A;  2GFU A;  2CUB A;  4WCI A;  3OYA A;  2JTE A;  1MNE A;  2M1H A;  2IIM A;  5IN1 A;  4E47 A;  4M7A D;  3OYI A;  1M2V B;  2K2V A;  3SHW A;  4EMK C;  1K9M U;  4PKC C;  5LJ3 h;  2P0K A;  1PKT A;  2AKK A;  4HT9 A;  3CCS Q;  3ZL7 C;  1RI0 A;  3DB3 A;  2DTI A;  3VKI A;  1N8R U;  4PJJ A;  1OX8 A;  2NYS A;  4BI8 B;  1SG5 A;  1FYN A;  2ED0 A;  3CCU A;  3LGL A;  1S72 T;  2SEM A;  2AHJ B;  4FW2 A;  3A8H B;  1Q82 U;  2VC8 A;  1YJN A;  5KE2 A;  1KHC A;  4CI0 C;  4LXC A;  4XTW A;  3A8L B;  1KJW A;  2L89 A;  4M7D G;  2YDL A;  1AEY A;  4ZTJ A;  4D6W A;  1I5L A;  3G6E T;  4M7D E;  3EFO A;  3CME A;  5CQY A;  2IVW A;  3OS2 A;  2EJG A;  2GTO A;  1QCN A;  2YT6 A;  1N27 A;  3T9N A;  2QTV A;  1UDL A;  3M0Q A;  2EJF A;  1YJW Q;  1YJ9 Q;  3MEV A;  1Y7X A;  1ZUK A;  1MMG A;  4C8Q D;  3QZ5 B;  4FSS A;  2LJ0 A;  3CCV A;  1U3O A;  2CP6 A;  3CCE T;  1Y0M A;  3S3N A;  1WLP B;  2CZ0 B;  1VQK T;  4M7D B;  3JSC A;  4BD3 A;  1TUC A;  1W70 A;  3CPW P;  2A0F B;  3A1P A;  1VQ5 T;  3SDZ A;  2XID A;  1X2K A;  1NPP A;  3OYL A;  4RTY A;  4C5G A;  1W1F A;  3JCM Q;  3GIB A;  3WVD B;  4Z8A A;  2XKO C;  2LQN A;  3P8H A;  2A3L A;  4DBH A;  4PL6 A;  2EYX A;  2HNI A;  2AT1 B;  2Y90 A;  4FCY A;  3QSU A;  2V1R A;  3RKW A;  3RER A;  2C0O A;  3CCU Q;  1QP2 A;  4XTY A;  3VUB A;  3CBO A;  2PU9 B;  2X51 A;  3QZ9 B;  4LUD A;  4OB3 B;  1M1K C;  1BI3 A;  2EYZ A;  1UGP B;  5KYW A;  1QVF P;  2IG0 A;  1PHT A;  4BAC A;  1A0N B;  2KNB B;  1K8A C;  5LJ3 j;  1XTD A;  3M56 A;  3QBY A;  2HCK A;  4M7D F;  1IZ6 A;  3CCR A;  1M90 C;  2EQK A;  1UEC A;  4VUB A;  1IB8 A;  2MK5 A;  2FL7 A;  4M7D C;  3VU3 C;  3NTK A;  2QA4 T;  1PSE A;  4F7U A;  2FG0 A;  2DA9 A;  1RAB B;  2DVE A;  1M4Z A;  1RAH B;  1YIT T;  2J7I A;  3OYN A;  2KXC A;  1KC8 U;  4XU0 A;  5KH6 A;  4C5H A;  5ECA A;  2CDT A;  1JXM A;  1WNL A;  2V8J A;  2XD0 A;  2M9U A;  1TG0 A;  2DL3 A;  2K5L A;  3I35 A;  3ER0 A;  1TWB A;  4A54 A;  3F70 A;  3I55 A;  1H3Z A;  4OF1 A;  2RQU A;  1LJO A;  4KBM B;  1W4S A;  3M57 A;  3OBW A;  4C0D C;  3UPU A;  1KFZ A;  2V8I A;  2VAS A;  3CCQ Q;  3FJ5 A;  2QQS A;  5FU6 B;  1Y07 A;  1VQM A;  5KE3 A;  2DJQ A;  4FYV B;  3EG9 A;  4J9H A;  2OX7 A;  1PD1 A;  1SHG A;  3NMZ C;  5GAM e;  4ZGE B;  2CH4 A;  3GOX A;  5HCK A;  2COW A;  1U1S A;  2KR3 A;  2AKL A;  4PJO E;  2AZV A;  2E64 A;  2L3S A;  2QEX T;  2CT4 A;  1I4K 1;  4QVZ A;  1M1G A;  4QQG A;  4DA4 A;  4E6R A;  2D0Q B;  3JCM c;  1D1B A;  1WQW A;  2OAW A;  4C92 A;  1M8V A;  1MND A;  3H9N A;  3A8G B;  2A37 A;  4PJO B;  3A98 A;  2KQW A;  1UGR B;  3BFM A;  3CPW S;  2CZ7 B;  3V8L A;  4J5Y A;  1VQ4 A;  1N6A A;  2DYB A;  3I5S A;  4KGX B;  1OEB A;  5J39 A;  3QJ6 A;  1NJI R;  1QWE A;  2RD1 A;  4LDW A;  4HT8 A;  4E7K A;  3OYD A;  3CBP A;  5GAN 7;  4E7L A;  2AIR B;  2EIF A;  4M75 C;  1Y57 A;  2DXU A;  2KXD A;  5DY9 A;  5FU6 C;  3JCM P;  2ZGW A;  3QKJ A;  4C0F A;  1K0S A;  1N9R A;  5GAN 8;  2MPX C;  1AWW A;  1X6G A;  4Z89 A;  2RK1 A;  3L2R A;  3V7C A;  4A4F A;  1VQP Q;  5FRM A;  4LDU A;  3CCJ A;  2XDP A;  5KCH A;  1CKB A;  2DNU A;  5L8R E;  3M0U A;  1YHQ A;  2XDB A;  4F04 B;  3MO8 A;  2FEI A;  4QQD A;  4QT7 A;  3G6E Q;  3MHX A;  3NGP A;  5GAO p;  3O8V A;  1Y71 A;  3INZ A;  2CGH A;  4IIO A;  4YTL A;  2VYT A;  2SRC A;  4R55 A;  3UWN A;  3CCS T;  2KT8 A;  2FYK A;  3EFO B;  4BUG A;  2RHZ A;  3M9Q A;  5CKB A;  3CCE Q;  1JO8 A;  2HQH A;  3OMC A;  4FW1 A;  3MEW A;  3FIF A;  4HCB A;  1C0M A;  5KYX B;  1G2B A;  3CMA A;  1K73 C;  2BUD A;  2OTL Q;  3TVT A;  2QAZ A;  2HKN A;  1VQ5 Q;  3CC7 A;  3VRZ A;  4Q5W A;  1JEG A;  4C0Z A;  4PJN A;  3TU4 K;  3JCM f;  1BBZ A;  2VKN A;  3EGU A;  1WI7 A;  2LP5 A;  5FLX E;  2DL7 A;  1U06 A;  2ENM A;  1H92 A;  3UA7 A;  1UTI A;  2ZPH B;  2ZPI B;  2K3X A;  1Q7Y U;  2JS2 A;  3GNG A;  2E6N A;  5GAN 6;  4Y91 A;  4CC2 A;  2E10 A;  2VWF A;  4QW2 A;  1G8X A;  1KQS A;  4PK4 A;  3SWN B;  3E19 A;  1KD1 U;  3E9F A;  1JU5 C;  3CCJ Q;  2KDS A;  2M51 A;  2EKO A;  3QJY A;  3DKM A;  3OBY A;  3JCM d;  3EAE A;  3EG0 A;  2O2O A;  2L3P A;  4LDV A;  5HKC A;  1M1K R;  5IHK A;  4JRI A;  4MZP A;  4JJC A;  1YWO A;  4CC3 A;  5GAO r;  3THK A;  2DER A;  5I21 A;  5IAY A;  2D8H A;  3QDF A;  1ZHI A;  4DBR A;  2F2V A;  3FDR A;  5I2S A;  1UG1 A;  1QCF A;  4M75 D;  4M77 G;  1ZA2 B;  2LTO A;  2J6K A;  4B9W A;  4CC7 A;  3HL8 A;  2X4Y A;  1Q81 U;  1QLY A;  2R5A A;  3CCU T;  4WF2 A;  2O9V A;  4IUU A;  3CMA Q;  4M77 E;  3OYY A;  3CC7 Q;  4RTU A;  4HCC A;  1PSF A;  1X6B A;  1YJN T;  1MMN A;  2E12 A;  1C6V X;  2LJ1 A;  4J9G A;  3C94 A;  3M0R A;  5A0D A;  1QVF A;  3UT1 A;  4RG8 A;  3VS7 A;  1QCO A;  4XTU A;  4LUE A;  4ZN3 A;  4IIM A;  3SWN C;  4M77 B;  3NFC A;  2EKH A;  2RJE A;  3CME T;  1AHJ B;  1BK2 A;  2F69 A;  3BE3 A;  4OP0 A;  3MP6 A;  1TS9 A;  5FRO A;  1VUB A;  2QEX Q;  4MZM A;  1UE9 A;  1WHG A;  1WIE A;  3QPH A;  2MOX A;  3CCV T;  2HAX A;  1MMD A;  2CKK A;  1J3T A;  4E7H A;  3CD6 A;  3QYG B;  2O01 E;  2DKG A;  3OSV A;  4NS5 A;  2NWM A;  3G4S Q;  4EIK A;  2QYZ A;  1NYG A;  5GJV B;  2DZ9 A;  2ROL A;  1QQJ A;  1T3L A;  4HKE A;  3VUZ A;  5GAN f;  2DBM A;  3OYC A;  4JRK A;  4PFO A;  2E1H A;  2QK0 A;  1GCQ A;  4EMH A;  1GBR A;  4HA8 A;  2KBT A;  5LJ5 g;  2A28 A;  3CCQ T;  4MDW A;  1KG1 A;  2QGG A;  1GCP A;  5EG2 A;  2A08 A;  1VQN A;  3REA B;  4ZGD B;  4F16 A;  1D1A A;  2E4H A;  2JOY A;  2BE9 B;  2E65 A;  4EDU A;  4M77 F;  3JCM h;  4K11 A;  2FPD A;  4RTX A;  3CC2 A;  5IH2 A;  5IT9 E;  1CKA A;  4RUG A;  5C0M A;  1M5Q 1;  4BE1 A;  2HQE A;  2CSQ A;  1RAI B;  4J9F A;  1AZE A;  4RKU E;  4Z02 A;  2JVV A;  5I11 A;  4M77 C;  3M0P A;  3MP8 A;  1WX6 A;  5GAN d;  2R58 A;  4J9I A;  3OS0 A;  2GQI A;  4JJD A;  3OYB A;  2R57 A;  2YLC A;  4E7S A;  2K5I A;  1OU9 A;  2EWN A;  1X6O A;  2B86 A;  2FVU A;  3X25 B;  5FRN A;  1VQ8 A;  1HK9 A;  3X20 B;  3OQ5 A;  4OB0 B;  3CCR T;  1VQO A;  4IKF A;  3SFM A;  1NJI C;  2LRQ A;  4XTV A;  3JCM J;  2BTT A;  1AWJ A;  3CQT A;  1VQ7 Q;  1MUZ A;  1GL5 A;  4P5N A;  2PVD B;  2XMF A;  2ZAE A;  4HCZ A;  5LJ5 d;  4HVV A;  4LNP A;  3HFN A;  1Q95 G;  2FHD A;  2RNA A;  3JB9 G;  3CD6 Q;  2OTJ A;  1D3B A;  5KYY B;  1SSF A;  3C4S A;  1JB0 E;  2E5Q A;  3O5Z A;  4PFZ A;  1ZSZ A;  2PVG B;  2O88 A;  2NUT A;  3LLR A;  2EGC A;  1SRM A;  1K9M C;  5A0G A;  4DEY A;  2XG8 D;  4DBQ A;  3LWH A;  1VQP T;  1TTH B;  2DZC A;  4D8K A;  1WFW A;  2GF7 A;  1VQM T;  3JCM W;  4XQ3 A;  5M9O A;  1K73 R;  3LYI A;  5EC7 A;  1N8R C;  2BZ8 A;  4BDZ A;  2MWO A;  5HK3 A;  1IRX A;  4X1V A;  1HD3 A;  4M78 A;  1RLP C;  3L2V A;  5J26 A;  2YUQ A;  2M16 A;  2RB6 A;  1Q82 C;  3H0I A;  2KMT A;  2W0Z A;  2MMP A;  3LH0 A;  3HSB A;  3PVQ A;  3CCM A;  3E9G A;  3ME9 A;  3OMG A;  2DK3 A;  2QG9 B;  3JCM X;  2K5F A;  4DQ2 A;  1LNX A;  3RES A;  1NBE B;  2VUB A;  1TUG B;  1YFN A;  3IQL A;  2X4W A;  2CYZ B;  2XHC A;  4ZTF A;  2DXC A;  1HYO A;  2K79 A;  1YI2 A;  2OTL T;  3S3M A;  1BIA A;  3E2U A;  5GAO q;  4M7A A;  5I22 A;  2ZZD A;  3M59 A;  5CO7 A;  4LDX A;  1AWX A;  1D0X A;  4PLL A;  3UF4 A;  3ULR B;  3R6N A;  2RQR A;  1Q7Y R;  2DD5 A;  5GAN h;  1MV3 A;  1IXD A;  1O75 A;  3HFO A;  3Q1J A;  2PZ1 A;  2XDD A;  3MKD A;  4QKU A;  3JB9 F;  1U5S A;  2D6F A;  3J81 E;  1IGU A;  1XOV A;  2QTX A;  1OX9 A;  1VYT A;  5DM7 R;  2KVQ G;  1YCS B;  2HBW A;  4MMK A;  1TXQ A;  1YJN Q;  1VQ6 A;  4JRQ A;  3N5B B;  2M0O A;  3QYH B;  2EPD A;  2RHU A;  1H3H A;  2LCS A;  1K4U S;  3CEY A;  3CCJ T;  2JMA A;  2ZPF B;  2F1L A;  2ESW A;  2RM4 A;  2KRS A;  1R77 A;  5LJ5 h;  1M90 U;  5GAN 2;  3M0S A;  3PTA A;  3NTH A;  3U23 A;  1PRL C;  4KGV B;  2RHX A;  2QQ9 A;  1YBY A;  3CME Q;  3JV3 A;  3M55 A;  2RJF A;  4AG2 C;  1M2O A;  6AT1 B;  2LT4 A;  3FB9 A;  2PNI A;  2NUP A;  2BE7 D;  4Y28 E;  3OYM A;  2WAC A;  2VGM A;  2HL5 C;  5GMK e;  1K9A A;  4ORZ A;  4C8Q A;  1V1C A;  3CCV Q;  2GGR A;  2I0N A;  1D0Y A;  1MHN A;  4GLM A;  5GMK i;  2RHY A;  5C6S A;  4OMN A;  3CMA T;  3OY9 A;  3CC7 T;  1BYM A;  1OI1 A;  2KSS A;  2O4X A;  3EH1 A;  2DEQ A;  2IPO B;  3V7S A;  2YRV A;  3RMQ A;  1WJQ A;  2KEA A;  1KC8 C;  7AT1 B;  4OGC A;  4N0A C;  3J80 E;  1GBQ A;  1H64 1;  1NE8 A;  4PJO G;  3LX7 A;  2L2P A;  4JZ4 A;  1VIE A;  2LJ3 A;  4JPB W;  1S72 A;  2E70 A;  2ROT A;  2EJ9 A;  4AMC A;  3FRN A;  3KBG A;  4MML A;  3OYJ A;  4QVD A;  5HK0 A;  1GFD A;  1KSW A;  2HL3 A;  4OVA A;  1WXU A;  1ZUU A;  1CSK A;  1TH7 A;  2DD4 A;  2E6Z A;  3OB9 A;  4EMG A;  3QXE B;  1I07 A;  3RUX A;  3CCL A;  2BZY A;  3G4S T;  2DL5 A;  5GAN j;  5CVI A;  4A4K A;  3CCR Q;  3MEU A;  2ABL A;  3CXC P;  5J3B A;  2RA2 A;  2RQV A;  3LGF A;  3UAT A;  3UA6 A;  2FO0 A;  1SRL A;  3ZBD A;  4XTZ A;  2EBP A;  2JJ9 A;  5FU7 B;  4RTZ A;  2DF6 A;  2ZCF B;  2DAQ A;  1UHF A;  2JM9 A;  1FMW A;  2WSC E;  2LX7 A;  2DIG A;  3EH2 A;  1QKW A;  2QQR A;  2JS0 A;  3WVE B;  1VQK A;  2JNG A;  1OU8 A;  2EAY A;  1T0J A;  4DOW A;  1WXT A;  1HSQ A;  5GAM f;  2DRK A;  3C95 A;  1RAD B;  5LJ5 j;  1I1J A;  3OW2 P;  1M8M A;  3I55 Q;  4IUR A;  4Z88 A;  2XI9 A;  2HMA A;  1D3B B;  2OAU A;  2YUN A;  1NG2 A;  2AZS A;  4KH1 B;  3I9Q A;  3OS1 A;  1G3T A;  4JS5 A;  1XJW B;  2MAM A;  4GLK A;  1RUW A;  1ZSZ B;  1VQM Q;  1B34 A;  3JB9 H;  2MYS A;  1ACM B;  4M78 E;  2V26 A;  2PTK A;  1U1T A;  2J05 A;  1WA7 A;  2NUT B;  4A53 A;  1JRI A;  1WHL A;  1Y96 A;  4DBF A;  1K9M R;  4M7D D;  3CPF A;  1YIJ A;  4BE2 A;  2RQW A;  1VQ7 T;  1OPK A;  4PJO F;  5GAM d;  1X69 A;  2MCN A;  4TVR A;  3VS2 A;  2Y4Y A;  3RBB B;  1N8R R;  1M2V A;  3DLL A;  4KUD K;  3G71 A;  2CUD A;  1SF9 A;  4M7A G;  5AT1 B;  1JXO A;  1QWF A;  1RAA B;  2JTM A;  4M78 B;  1OUL A;  3HRT A;  3I56 A;  3CD6 T;  4PJO C;  5HY6 A;  3FJP A;  5CKE A;  5FU7 C;  2QQA A;  2YUO A;  1AVZ C;  1OQK A;  3JCM g;  1Q82 R;  2YUP A;  5CKF A;  3KXT A;  4J83 A;  1G3Y A;  4M7A E;  3ZFJ A;  4MZT A;  4OMF B;  2QA4 A;  1Q86 U;  2HKQ B;  3CC4 A;  1UGV A;  2DMO A;  3REB B;  1M3A A;  1S1N A;  2K3Y A;  3MJX A;  1VQ4 Q;  2FPE A;  1YIT A;  1GRI A;  4J9E A;  1QVP A;  1PM3 A;  1TU0 B;  2A36 A;  1QVG P;  1ZLM A;  1WJR A;  3C0C A;  1VQN T;  2CRE A;  1B7T A;  2JXB A;  3HP9 A;  4JUV A;  1MMA A;  1M9S A;  2CP0 A;  4M7A B;  2P4R A;  1KQ2 A;  3CC2 T;  2YHT A;  2RO0 A;  2VVK A;  4M4Z A;  5LJ3 e;  4Y92 A;  4X9D A;  1ZSZ C;  3EG2 A;  4IUV A;  2C0I A;  2CP7 A;  4XAX B;  4FYY B;  4ME7 A;  4E7J A;  5CQX A;  2V8K A;  4F7U G;  2ATC B;  2DYI A;  4MDX A;  2OJ2 A;  1PCX A;  1YHQ Q;  5GMK h;  3A8M B;  4FT2 A;  3GLX A;  1H8K A;  2AK5 A;  4GBQ A;  2RPN A;  2CZ6 B;  1Q7Y C;  2KY9 A;  4M7D A;  2FB7 A;  3PMI A;  3S6W A;  4RMO A;  4F7U E;  5KYW B;  3VS3 A;  3CPW A;  1K76 A;  2DRM A;  4AFZ C;  3M54 A;  3G71 Q;  2O31 A;  3CXC S;  1M1F A;  1XQH A;  5CCA A;  1IHW A;  1X75 C;  2OTJ T;  4FL6 A;  2F2W A;  4E2F B;  3TSW A;  3JAM E;  4E7I A;  2RMO A;  5LJ3 f;  1QKX A;  3V8J A;  4M7A F;  3VS0 A;  1V76 A;  2RQT A;  2K7A A;  1KK7 A;  2JT4 A;  1I0C A;  4F7U B;  2NUP B;  1M3B A;  4LD6 A;  1WJS A;  2FPF A;  4RTV A;  4B6M A;  1LVK A;  3BW1 A;  1M3C A;  4IUP A;  3OW2 S;  3JCM b;  5GAM h;  4BI4 A;  1ABQ A;  3SEM A;  2JTF A;  2COY A;  5GAN 5;  4A4G A;  4OMQ A;  2DPP B;  1DJ7 B;  1W2B P;  4XTX A;  1Z9Q A;  3P8D A;  1Q81 C;  4FYX B;  3QUI A;  5GMK m;  1ZBJ A;  5LJ3 d;  3RKY A;  1VQ9 A;  1VQL A;  4D8D A;  2YWW A;  1WDX A;  1KC8 R;  4PJO D;  3HPW A;  2X9H A;  2DTH A;  4C92 G;  3CCM T;  3EFS A;  2CS7 A;  2G3R A;  2DJZ A;  1GXI E;  1PKS A;  5GAN g;  2J6O A;  3ASK A;  3EG9 B;  5GJW B;  1X27 A;  2CP3 A;  2FZG B;  1IO6 A;  1WHK A;  3OSS C;  2QAS A;  4C92 E;  2QQB A;  2L0A A;  3GBQ A;  4PFP A;  4F7U F;  1HXD A;  2DIQ A;  1RAF B;  4FSX A;  3EGX A;  1SSH A;  3H0H A;  5GAO m;  4DEX A;  3LW5 E;  3CCS A;  5LL6 S;  4N4I A;  3TRE A;  3PMT A;  2KAF A;  4M75 A;  4C92 B;  5GAN 4;  3VYG A;  3GPL A;  1QVG S;  2FRY A;  2KT1 A;  2EFI A;  2X4X A;  2E3H A;  2H8H A;  4ESR A;  2QI2 A;  3C12 A;  3QWX X;  8ATC B;  4BE0 A;  1ABO A;  4J9C A;  1BCM A;  2VV5 A;  1TOV A;  1AWO A;  1EZZ B;  5KYU A;  2E5K A;  2L5Q A;  2I2L A;  2DTO A;  2LCC A;  2CP2 A;  2KRO A;  2ZPB B;  4JS4 A;  2LVM A;  1G5V A;  1NLP C;  4KGZ B;  2DEU A;  3PGG A;  1WHJ A;  5D6X A;  4BDY A;  1T0H A;  4XU1 A;  3FLG A;  1HJD A;  3CXC A;  4BB7 A;  1VA7 A;  1B34 B;  2NLU A;  3M5A A;  4QVC A;  5FW9 A;  1YJ9 A;  1VYV A;  2EQM A;  1YJW A;  3MET A;  2VXE A;  1RI9 A;  2EVR A;  2V1Q A;  4FIB A;  2RI5 A;  3SB2 A;  1Y96 B;  3S3O A;  3GP8 A;  4C5E A;  2D0N A;  1BIB A;  2DE0 X;  4C92 F;  1K0X A;  5GAM j;  1TSF A;  2F5T X;  3PVL A;  4OML A;  1YNZ A;  2DL8 A;  5AYF A;  1OZ2 A;  4C92 C;  3I55 T;  2WSE E;  3OW2 A;  4J9B A;  3M4G A;  3RIR A;  1PWT A;  2DIL A;  2DVJ A;  3FEO A;  1RL2 A;  2K57 A;  2W10 A;  1C1A A;  3RDV A;  1VQN Q;  4ATO A;  2K4Y A;  2F5K A;  4II1 A;  2B8A A;  3PIP A;  2LDM A;  4AFQ C;  2CP5 A;  3CC2 Q;  5IXB A;  1UEB A;  1ZQ1 A;  1E6H A;  1EFN A;  3VS4 A;  1W2B S;  4LD9 K;  1JJ2 P;  2G6F X;  3EHR A;  3AHU A;  3HKS A;  1G3S A;  2DL4 A;  1OYX A;  4KT0 E;  2KI7 A;  1F1B B;  1N5Z A;  4JLI A;  1PC0 A;  4QQ6 A;  4BY6 B;  2MI6 A;  1D0Z A;  4O5V A;  1K1Z A;  1Q86 R;  2YSQ A;  3H6Z A;  2K9G A;  3CCL T;  1BCO A;  1NYF A;  2PUO B;  1BB9 A;  3PNW C;  1VQ8 Q;  2COZ A;  3RMS A;  2DFU A;  1LCK A;  1VQO Q;  3LH5 A;  4L6V 5;  1BU1 A;  1D09 B;  1KQS P;  4DOV A;  2MWP A;  1NPR A;  5KYX A;  4O6J A;  2JUF A;  1NM7 A;  2QDY B;  1UB4 A;  3L2U A;  1VQ4 T;  3MCA B;  5D7U A;  3VJP A;  1ZSG A;  1AD5 A;  1QVG A;  4L5G A;  2OTJ Q;  4R0K A;  4PJM A;  3R6O A;  2RK2 A;  2XU8 A;  4GY5 A;  4N4H A;  4KUL A;  1B3Q A;  1AOJ A;  4JJN K;  2WSF E;  5CAI A;  1FXX A;  3I5R A;  4M77 D;  3PE0 A;  1KD1 R;  2PVO B;  4ZGJ B;  2FRW A;  1M1K U;  2KK4 A;  3L2Q A;  2H3J A;  1UGQ B;  4LDY A;  2DX1 A;  4L59 A;  3KFV A;  3CCQ A;  4HXJ A;  3VV0 A;  2F2X A;  2DBK A;  4RG2 A;  1K8A U;  3SWN A;  3OYG A;  4C0D B;  1YHQ T;  1B07 A;  1EX4 A;  2GNC A;  3VRY A;  4BY6 C;  3G7Z A;  3OYH A;  2JN0 A;  3OA6 A;  1IRE B;  1YIJ T;  1EIF A;  1YN8 A;  4J9D A;  4OGE A;  3BDU A;  2YLB A;  3M4Y A;  4OMP A;  4V2S A;  2GCX A;  1W6X A;  3G71 T;  3CCM Q;  1UJ0 A;  4EPC A;  1Q81 R;  1WYX A;  2K6D A;  2FZC B;  3I56 T;  1UUE A;  2LQK A;  2LZ6 B;  1UHC A;  2BZX A;  5L23 A;  1NEB A;  1T3S A;  2L8D A;  5GAN 3;  5CIU A;  4C92 D;  1KIK A;  4ZN1 A;  4NL2 A;  1BI2 A;  4E7Z A;  2HEQ A;  4M75 G;  2K2M A;  1YI2 Q;  3JRZ A;  2RHI A;  3CC4 T;  1VOM A;  1SKU B;  1IHV A;  3QG1 A;  4M75 E;  1YCY A;  2QXF A;  4JZ3 A;  1WGS A;  5CKH A;  4KH0 B;  2X4J A;  3TQ7 P;  4A4E A;  4ANJ A;  2ED1 A;  2YXY A;  1M27 C;  1W2B A;  3EGX B;  5CK9 A;  4OB2 B;  2EYQ A;  4M77 A;  3L2W A;  4M75 B;  1RAE B;  1AT1 B;  1VQP A;  1VQ6 Q;  1VIF A;  2KGT A;  1JJ2 S;  4KUI A;  4PNO A;  1U8R A;  3PIO A;  3V8K A;  1KQ1 A;  2HQX A;  2JM8 A;  1QP3 A;  3SD4 A;  2E41 A;  3ZEH A;  2KRM A;  2DXB A;  3G6E A;  3EG1 A;  5KYU B;  4WTO B;  1X2Q A;  2HD0 A;  2DLP A;  2M0Y A;  1AZG B;  4EMK A;  2EYY A;  3GNF B;  3JB9 I;  3QDR B;  5GAM g;  1E7O A;  2NUZ A;  1GFC A;  3D7S B;  4RCC A;  1KQS S;  2KE9 A;  2CH4 W;  4CRI A;  2CZ1 B;  2D9T A;  2D1X A;  2LMJ A;  3CCE A;  3TCJ A;  2RH2 A;  2OTL A;  2KRN A;  4JJB A;  1VQ5 A;  1TUD A;  1WXB A;  1PNJ A;  5D6Y A;  4OB1 B;  2LT1 A;  3JB9 D;  3EGD A;  3RKX A;  5GMK l;  3M53 A;  3UDC A;  1SEM A;  4M75 F;  4A63 B;  1I5O B;  2HSP A;  2GBQ A;  2RJD A;  4M78 G;  1GCQ C;  3QII A;  4LE9 A;  4FU6 A;  1R8O B;  4HVW A;  3OYK A;  3L1A A;  3KUF A;  1R0C B;  5DLQ E;  4ZNX A;  2L3Q A;  2YRD A;  5A2Q E;  1S72 Q;  2HSE B;  2RF0 A;  4J7I A;  3EHQ A;  4J6W A;  1VQ9 T;  1VQL T;  4N4G A;  2VGN A;  2E3I A;  2J06 A;  3DLM A;  2QDL A;  2P4T A;  3HTR A;  5KCO A;  4OMO A;  1UFF A;  3JCM e;  1YWP A;  5GAO l;  1QVF S;  4RTW A;  3VS5 A;  2RN8 A;  4ELY C;  2D8J A;  4JDS A;  3CCL Q;  1N9S A;  2DXT A;  1IGQ A;  4PJL A;  2CSI A;  1K73 U;  2EQJ A;  5KYY A;  3JCM V;  3PFS A;  4CC4 B;  2P0Q A;  1WQ7 A;  5FWC A;  3JB9 J;  2YRC A;  5FWB A;  3NHN A;  2X3X D;  1BI1 A;  2EW3 A;  1XNI A;  1D1C A;  4AG1 C;  5A0L A;  3A8O B;  1SHF A;  4ELZ C;  2JW4 A;  2Y4X A;  5IHI A;  1VQK Q;  2M02 A;  2P0P A;  2P84 A;  3P8B B;  2ZPE B;  3X28 B; 
#chains in the Genus database with same CATH homology
 1VQM A;  5KE3 A;  1FWZ A;  3E9G A;  3CCM A;  2L3R A;  3ME9 A;  3OMG A;  2DIQ A;  2DK3 A;  4FM4 B;  4FSX A;  3JCM X;  3WXM B;  2K5F A;  5GAO m;  4DQ2 A;  3LW5 E;  1Q86 C;  1LNX A;  3RES A;  3CCS A;  2VUB A;  5LL6 S;  4A4H A;  4N4I A;  3TRE A;  5GAM e;  4ZGE B;  1JJ2 A;  2X4W A;  3GOX A;  2CYZ B;  2XHC A;  3PMT A;  4ZTF A;  2KAF A;  1U1S A;  4M75 A;  2DXC A;  4C92 B;  5GAN 4;  3EFR A;  2HBP A;  3VYG A;  2JZ2 A;  2E64 A;  1YI2 A;  4PJO E;  2DO3 A;  2QEX T;  3GPL A;  1QVG S;  2OTL T;  2EFI A;  3S3M A;  2X4X A;  1I4K 1;  1BIA A;  2LNV A;  4M78 F;  1M1G A;  4QQG A;  4QVZ A;  5GAO q;  2QI2 A;  3C12 A;  4DA4 A;  4M7A A;  2ZZD A;  4BE0 A;  2BKD N;  3M59 A;  3BDL A;  5CO7 A;  4LDX A;  2MF2 A;  2D0Q B;  3JCM c;  1VQ8 T;  1LOJ A;  4PLL A;  2VV5 A;  4C8Q G;  4XU2 A;  1VQO T;  2EQU A;  2DD5 A;  4M78 C;  5GAN h;  1WQW A;  5LJ3 g;  1I81 A;  2PQW A;  4C92 A;  1M8V A;  1O75 A;  3HFO A;  3URG A;  3A8G B;  2L5Q A;  3Q1J A;  2I2L A;  2QEX A;  2XDD A;  1YJ9 T;  1YJW T;  4PJO B;  2DTO A;  2LCC A;  4PLI A;  2ZPB B;  3BY7 A;  2KQW A;  4C8Q E;  4JS4 A;  3JB9 F;  1UGR B;  4C5I A;  2LVM A;  3BFM A;  4X34 A;  2CZ7 B;  3J81 E;  3CPW S;  1XOV A;  2D6F A;  2QTX A;  1G5V A;  5DM7 R;  3V8L A;  2XIC A;  4J5Y A;  1VQ4 A;  3PGG A;  1N6A A;  1KD1 C;  1NZ9 A;  2KVQ G;  5D6X A;  3VYH B;  5CKD A;  4MMK A;  4IUQ A;  3G4S A;  5J39 A;  3A5Z B;  3QJ6 A;  1UGS B;  4BDY A;  4JLG A;  1VQ6 A;  4XU1 A;  2RD1 A;  4JRQ A;  3N5B B;  2M0O A;  3FLG A;  3QYH B;  4LDW A;  2RHU A;  4E7K A;  3HRS A;  4RCB A;  1V29 B;  3OYD A;  3CBP A;  3CEY A;  5GAN 7;  4E7L A;  3CXC A;  4BB7 A;  2EIF A;  4M75 C;  3CCJ T;  1B34 B;  2NLU A;  2ZPF B;  3M5A A;  4QVC A;  2DXU A;  2EQM A;  1YJ9 A;  2LC4 A;  1YJW A;  2RM4 A;  3MET A;  2VXE A;  1BKB A;  4J7F A;  5DY9 A;  5FU6 C;  5LJ5 h;  3CBM A;  3JCM P;  4FIB A;  3LWI A;  2ZGW A;  3MP1 A;  2RI5 A;  3QKJ A;  3SB2 A;  1Y96 B;  4C0F A;  4C8Q B;  3S3O A;  3GP8 A;  4C5E A;  1M90 U;  4M7A C;  5GAN 2;  3OYE A;  1N9R A;  4NOY A;  1BIB A;  4C92 F;  3PTA A;  3NTH A;  5GAM j;  1FX7 A;  5GAN 8;  4BI3 A;  5I2M A;  2RHX A;  2RK1 A;  2QQ9 A;  1YBY A;  2PUK B;  5D6W A;  2F5T X;  3M55 A;  2RJF A;  4N0A A;  3L2R A;  3V7C A;  4A4F A;  5FRM A;  5AYF A;  1OZ2 A;  2LT4 A;  3FB9 A;  3QHS A;  4LDU A;  3OYF A;  3CCJ A;  2XDP A;  4C92 C;  5KCH A;  5L8R E;  3I55 T;  1G3W A;  2WSE E;  4Y28 E;  3OW2 A;  3OYM A;  2WAC A;  1YHQ A;  2VGM A;  3M4G A;  2XDB A;  5GMK e;  3RIR A;  4C8Q A;  3MO8 A;  2O4X B;  2LQ8 A;  1QW1 A;  3FEO A;  4QQD A;  1RL2 A;  2K57 A;  1MHN A;  5GAN e;  5GMK i;  2RHY A;  4J6X A;  3MHX A;  5C6S A;  4J8O A;  3TEE A;  2XK0 A;  4B9X A;  5GAO p;  3O8V A;  1P92 A;  1Y71 A;  1JBM A;  3JB9 D;  3GF5 A;  3INZ A;  2K4Y A;  3CMA T;  2CGH A;  4C0G A;  4HT8 A;  2F5K A;  4II1 A;  4ATO A;  3OY9 A;  2B8A A;  3CC7 T;  1BYM A;  1OI1 A;  3PIP A;  4YTL A;  2VYT A;  4R55 A;  2LDM A;  2KSS A;  3UWN A;  3CCS T;  1UEB A;  2FYK A;  4FT4 A;  1ZQ1 A;  4LD9 K;  1W2B S;  2O4X A;  2RHZ A;  4BUG A;  1O9S A;  1WPY A;  3AHU A;  3QO3 A;  2R5M A;  3HKS A;  4R56 A;  3M9Q A;  4J6Y A;  1BI0 A;  3NTI A;  1G3S A;  2DEQ A;  3OS5 A;  1OYX A;  4KT0 E;  5CKB A;  3OMC A;  3V7S A;  1YI2 T;  2YRV A;  3RMQ A;  1VQ7 A;  1OZ3 A;  3MEW A;  4XU3 A;  3FIF A;  4HCB A;  1WJQ A;  4JLI A;  1KC8 C;  4OGC A;  3E1S A;  3M58 A;  2LX9 A;  2A7Y A;  4QQ6 A;  2MI6 A;  3X24 B;  2BUD A;  4N0A C;  4BY6 B;  4C8Q F;  3CMA A;  1K73 C;  3J80 E;  1H64 1;  1KHI A;  1NE8 A;  4O5V A;  4PJO G;  5LJ5 e;  3CC7 A;  3LX7 A;  1I8F A;  4Q5W A;  1VIE A;  3H6Z A;  1X01 A;  3L2Z A;  3CCL T;  2E70 A;  4C0Z A;  1S72 A;  2EJ9 A;  2PUO B;  3FRN A;  4IUT A;  3KBG A;  3PNW C;  4MML A;  3HHT B;  4UC4 A;  4QVD A;  3PT9 A;  3OYJ A;  3TU4 K;  5HK0 A;  2ZPG B;  3RMS A;  4C8Q C;  3L42 A;  3JCM f;  3H8Z A;  4EMK B;  4L6V 5;  4OVA A;  4DOV A;  5FLX E;  2MWP A;  3FC3 A;  1TH7 A;  2DD4 A;  1NPR A;  4O6J A;  2JUF A;  2E6Z A;  2QDY B;  2X35 A;  1UB4 A;  3DB4 A;  3OB9 A;  3L2U A;  4EMG A;  2LCL A;  5GMK j;  3QXE B;  1VQ4 T;  3MCA B;  3RUX A;  3VJP A;  2ZPH B;  4JRP A;  2ZPI B;  2K3X A;  1Q7Y U;  3CCL A;  3G4S T;  4NL3 A;  3GNG A;  1QVG A;  2E6N A;  1VQ6 T;  4L5G A;  5GAN j;  3J7A F;  5CVI A;  5GAN 6;  4Y91 A;  2E10 A;  4A4K A;  3MEU A;  4QW2 A;  3R6O A;  2RK2 A;  2XU8 A;  1KQS A;  2BIV A;  4GY5 A;  5J3B A;  4N4H A;  4KUL A;  5CR2 A;  3SWN B;  2RA2 A;  4JJN K;  2C06 A;  3LGF A;  3E19 A;  2WSF E;  1KD1 U;  3E9F A;  3HSB A;  3ZBD A;  4XTZ A;  5CAI A;  1FXX A;  5FU7 B;  3HRU A;  2KDS A;  4M78 D;  4M77 D;  2ZCF B;  2DAQ A;  2EKO A;  3DKM A;  2PVO B;  3QJY A;  4X9C A;  3OBY A;  2RJC A;  4ZGJ B;  3JCM d;  3EAE A;  2WSC E;  1M1K U;  1NJI U;  2DIG A;  2KK4 A;  4LDV A;  2H3J A;  5HKC A;  1UGQ B;  4LDY A;  3L2Q A;  1MGQ A;  2QQR A;  4L59 A;  3MEA A;  5LJ5 f;  3WVE B;  1VQK A;  3CCQ A;  2JNG A;  3VV0 A;  3V7R A;  2EAY A;  4JRI A;  4MZP A;  4RG2 A;  4DOW A;  1K8A U;  1ZBX A;  5GAO r;  4PJO A;  2RI2 A;  3C95 A;  3SWN A;  5GAM f;  3OYG A;  5LJ5 j;  5I21 A;  4C0D B;  5IAY A;  1YHQ T;  2GQV A;  4XK8 E;  2VXF A;  2GFA A;  4IUR A;  1ZHI A;  3G7Z A;  2JN0 A;  4BY6 C;  5DLO A;  3OYH A;  3OA6 A;  1IRE B;  3X26 B;  3FDR A;  5I2S A;  2XI9 A;  1YIJ T;  1EIF A;  1D3B B;  2OAU A;  4M75 D;  4OGE A;  4M77 G;  2RI3 A;  3BDU A;  2YLB A;  3M4Y A;  2LTO A;  5GAO n;  4B9W A;  2GFU A;  3OS1 A;  4V2S A;  1G3T A;  3HL8 A;  3OYA A;  2X4Y A;  4JS5 A;  1Q81 U;  2M1H A;  2MAM A;  2GCX A;  2R5A A;  3CCU T;  5IN1 A;  4E47 A;  4WF2 A;  4M7A D;  4GLK A;  3OYI A;  4IUU A;  2K2V A;  1VQM T;  3G71 T;  1B34 A;  4EMK C;  4EPC A;  3JB9 H;  4M78 E;  4M77 E;  1K9M U;  4PKC C;  1U1T A;  3I56 T;  3OYY A;  4A53 A;  4HCC A;  1JRI A;  2LQK A;  5LJ3 h;  1PSF A;  2P0K A;  1Y96 A;  1YJN T;  4HT9 A;  5KE2 A;  4M7D D;  2E12 A;  3CPF A;  1RI0 A;  2L8D A;  3DB3 A;  5CIU A;  4C92 D;  5GAN 3;  4BE2 A;  1YIJ A;  4ZN1 A;  2DTI A;  4NL2 A;  1BI2 A;  1VQ7 T;  3C94 A;  3VKI A;  4PJO F;  3CCM T;  5GAM d;  4TVR A;  4M75 G;  1N8R U;  3JRZ A;  5A0D A;  4BI8 B;  1QVF A;  2RHI A;  2Y4Y A;  3CCU A;  3UT1 A;  4RG8 A;  3LGL A;  3DLL A;  3CC4 T;  4KUD K;  3G71 A;  4XTU A;  1S72 T;  4M7A G;  4PJO C;  4ZN3 A;  2JTM A;  4M78 B;  3HRT A;  4M77 B;  3SWN C;  2AHJ B;  3NFC A;  3I56 A;  3CD6 T;  3A8H B;  3QG1 A;  1Q82 U;  2RJE A;  4M75 E;  5HY6 A;  2VC8 A;  1YJN A;  3FJP A;  1YCY A;  2QXF A;  5CKE A;  5FU7 C;  1KHC A;  1WGS A;  4CI0 C;  1AHJ B;  2QQA A;  3CME T;  3JCM g;  4XTW A;  3KXT A;  3A8L B;  5CKH A;  5CKF A;  4J83 A;  2F69 A;  2L89 A;  1G3Y A;  3MP6 A;  4OP0 A;  4M7D G;  2X4J A;  4A4E A;  4M7A E;  3ZFJ A;  5FRO A;  1VUB A;  4MZT A;  4MZM A;  4OMF B;  2QA4 A;  1Q86 U;  4ZTJ A;  3QPH A;  1W2B A;  3CC4 A;  5CK9 A;  3CCV T;  2K3Y A;  4D6W A;  1I5L A;  2HAX A;  4OB2 B;  2CKK A;  2EYQ A;  4E7H A;  4M77 A;  3CD6 A;  3QYG B;  3L2W A;  2O01 E;  3G6E T;  1YIT A;  1QVP A;  4M7D E;  2DKG A;  3OSV A;  4NS5 A;  4M75 B;  3CME A;  5CQY A;  2IVW A;  3OS2 A;  2EJG A;  1WJR A;  1VQP A;  1N27 A;  1VQN T;  1VIF A;  3T9N A;  2DZ9 A;  1JJ2 S;  4HKE A;  3HP9 A;  4JUV A;  3VUZ A;  1M9S A;  2EJF A;  4KUI A;  4PNO A;  4M7A B;  5GAN f;  1U8R A;  1KQ2 A;  3MEV A;  1Y7X A;  4C8Q D;  3PIO A;  2YHT A;  3QZ5 B;  4JRK A;  3OYC A;  3CC2 T;  2RO0 A;  3V8K A;  5LJ3 e;  1KQ1 A;  2E1H A;  3CCV A;  2HQX A;  4X9D A;  4EMH A;  1QP3 A;  3SD4 A;  2E41 A;  3ZEH A;  4IUV A;  3CCE T;  2DXB A;  4HA8 A;  3G6E A;  2CZ0 B;  3S3N A;  1VQK T;  5LJ5 g;  3CCQ T;  4MDW A;  2HD0 A;  4M7D B;  1KG1 A;  3JSC A;  4XAX B;  4BD3 A;  4EMK A;  5EG2 A;  3GNF B;  3JB9 I;  1VQN A;  3QDR B;  4ZGD B;  2JOY A;  5GAM g;  4ME7 A;  4E7J A;  1VQ5 T;  3SDZ A;  2E65 A;  5CQX A;  4EDU A;  2V8K A;  4M77 F;  2XID A;  3OYL A;  1NPP A;  4F7U G;  4RCC A;  1KQS S;  3JCM h;  4MDX A;  3CC2 A;  5IT9 E;  4C5G A;  4CRI A;  3JCM Q;  5C0M A;  3GIB A;  3WVD B;  5GMK h;  1M5Q 1;  3A8M B;  2CZ1 B;  2D9T A;  2XKO C;  4FT2 A;  4BE1 A;  2HQE A;  3GLX A;  3P8H A;  2A3L A;  3CCE A;  2CZ6 B;  4RKU E;  4Z02 A;  2JVV A;  4PL6 A;  4M77 C;  3TCJ A;  1Q7Y C;  2KY9 A;  4M7D A;  2FB7 A;  3MP8 A;  2HNI A;  2RH2 A;  3PMI A;  3S6W A;  4RMO A;  4F7U E;  5GAN d;  2Y90 A;  2R58 A;  3CPW A;  3OS0 A;  2OTL A;  3OYB A;  2R57 A;  2YLC A;  3QSU A;  3RKW A;  3RER A;  1VQ5 A;  2K5I A;  2EWN A;  5D6Y A;  1X6O A;  2FVU A;  2LT1 A;  1QP2 A;  3M54 A;  4OB1 B;  3RKX A;  5GMK l;  3CXC S;  1M1F A;  1XQH A;  3X25 B;  3M53 A;  3UDC A;  5CCA A;  4XTY A;  5FRN A;  1X75 C;  1VQ8 A;  4M75 F;  1HK9 A;  3X20 B;  3VUB A;  2OTJ T;  3OQ5 A;  4OB0 B;  3CBO A;  4FL6 A;  2RJD A;  2PU9 B;  4M78 G;  3JAM E;  3QZ9 B;  4E7I A;  3CCR T;  3QII A;  1VQO A;  4OB3 B;  4FU6 A;  4IKF A;  3SFM A;  1M1K C;  1NJI C;  1BI3 A;  1R8O B;  2LRQ A;  4XTV A;  5LJ3 f;  3JCM J;  1UGP B;  3V8J A;  3OYK A;  4M7A F;  3L1A A;  3KUF A;  2IG0 A;  4F7U B;  5DLQ E;  4BAC A;  4P5N A;  2PVD B;  4LD6 A;  1K8A C;  5LJ3 j;  1WJS A;  1XTD A;  4HCZ A;  5LJ5 d;  3M56 A;  5A2Q E;  3QBY A;  3BW1 A;  4M7D F;  4IUP A;  3HFN A;  4J7I A;  2FHD A;  1IZ6 A;  4J6W A;  3OW2 S;  3JB9 G;  2OTJ A;  1VQ9 T;  1D3B A;  3JCM b;  5GAM h;  1VQL T;  4BI4 A;  3CCR A;  1M90 C;  4N4G A;  1SSF A;  2EQK A;  2VGN A;  2JTF A;  4VUB A;  3C4S A;  1JB0 E;  2E5Q A;  2FL7 A;  3DLM A;  2P4T A;  4M7D C;  3VU3 C;  5GAN 5;  3NTK A;  2QA4 T;  4A4G A;  1PSE A;  2DPP B;  4F7U A;  1DJ7 B;  5KCO A;  2PVG B;  4XTX A;  3P8D A;  2DVE A;  3JCM e;  1Q81 C;  3QUI A;  1M4Z A;  5GAO l;  1QVF S;  3JCM W;  5GMK m;  3LLR A;  1YIT T;  4ELY C;  4JDS A;  1K9M C;  1N9S A;  5LJ3 d;  2DXT A;  3RKY A;  5A0G A;  3OYN A;  2XG8 D;  1KC8 U;  4XU0 A;  3LWH A;  1VQ9 A;  5KH6 A;  1VQP T;  1VQL A;  4C5H A;  1K73 U;  2DZC A;  2EQJ A;  2GF7 A;  1WNL A;  3JCM V;  3PFS A;  4PJO D;  3HPW A;  2DTH A;  2P0Q A;  1WQ7 A;  2V8J A;  3EFS A;  2CS7 A;  4XQ3 A;  4C92 G;  2M9U A;  2G3R A;  2DJZ A;  2K5L A;  3LYI A;  5M9O A;  3JB9 J;  2XD0 A;  1GXI E;  5GAN g;  1N8R C;  3ER0 A;  3ASK A;  4A54 A;  4BDZ A;  2MWO A;  3F70 A;  3I55 A;  5HK3 A;  4OF1 A;  1H3Z A;  1LJO A;  1BI1 A;  4M78 A;  4KBM B;  1W4S A;  3M57 A;  3OSS C;  5J26 A;  3L2V A;  1XNI A;  3OBW A;  4C0D C;  4C92 E;  5A0L A;  3UPU A;  2M16 A;  2QQB A;  2RB6 A;  3A8O B;  4ELZ C;  2V8I A;  2Y4X A;  1Q82 C;  2KMT A;  2P0P A;  4F7U F;  1HXD A;  2MMP A;  3LH0 A;  2QQS A;  5FU6 B;  3P8B B;  2ZPE B;  3X28 B;  1Y07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...