4LD9K

Crystal structure of the n-terminally acetylated bah domain of sir3 bound to the nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
214
structure length
210
Chain Sequence
AKTLKDLDGWQVIITDDQGRVIDDNNRRRRGGENVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIKIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title The N-terminal acetylation of Sir3 stabilizes its binding to the nucleosome core particle.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Nuclear protein/transcription/dna
total genus 32
structure length 210
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ld9K00
3PT9A 1ZHIA 4FSXA 4JJNK 4LD9K 2FVUA 4KULA 4BB7A 3PTAA 4DOVA 4FT2A 1W4SA 3TU4K 1ZBXA 4KUIA 2FL7A 4DA4A 4DOWA 1M4ZA 4KUDK 4FT4A
chains in the Genus database with same CATH superfamily
2HSPA 3RNJA 1IHWA 1UG1A 1Y07A 5LJ3d 4HT8A 4CC4B 7AT1B 1LNXA 3JCMc 3VS5A 5IXBA 1BKBA 4ZN3A 4M77D 4X9DA 1TWBA 2A37A 2DL4A 1I81A 2DZ9A 2E6ZA 2M9UA 3G1JA 1RI9A 1FWZA 2FZKB 1AOJA 5GMKj 3I5SA 3I56Q 1T3LA 3ZBDA 5GAN2 2QYZA 2Y4XA 3OYLA 2CP2A 3BW1A 2V1RA 2D1XA 4IIMA 2FG0A 1KQSP 2RHYA 3H0IA 2X4XA 3DLLA 4C5EA 5ECAA 2J6OA 1QCNA 1KD1R 2QA4A 3A8OB 2BIVA 1EFNA 2PTKA 3EH1A 2LT1A 2AHJB 2RMOA 2KEAA 1K73C 2VGMA 4M77F 2JW4A 4K11A 2JXBA 1M2OA 4RTZA 3TREA 1VQ8T 1GCQC 5CAIA 2KT8A 3G6ET 3JCMW 4F7UA 4EMHA 3KXTA 4HT9A 5FU7C 3TSWA 3RMSA 4C0GA 4M75A 2PVOB 5IXFA 2KYBA 2OTLT 4KT0E 1U1TA 2D6FA 3VKIA 1TXQA 5GAN5 1BCMA 1CKBA 2KI7A 1X2KA 1OYXA 2E65A 3CCVA 1JJ2P 4M7DE 1X6GA 2KXCA 1ZSZC 2F2XA 4PJJA 2CZ7B 3CCET 2XD0A 3J7AF 4ZGEB 2L8DA 2GCXA 3LH5A 4ZNXA 1MUZA 1KC8C 2DL5A 2DD4A 2DYBA 3M54A 5D6WA 2BZXA 3P8DA 2L3RA 1M1KC 3FLGA 1KQSA 3CXCS 1G5VA 1I1JA 1VQ8Q 4PLLA 3G4ST 3G6EQ 1ABQA 4MMKA 4JJNK 2RHUA 1AZGB 2OTLQ 5M9OA 2YHTA 1GRIA 2CP5A 1WPYA 4JJDA 2K5FA 2QQBA 4NOYA 3KFVA 1K73U 1YI2A 3QO3A 1YNZA 1YJWA 3CCEQ 4HA8A 1BB9A 4LDXA 1LPLA 5CQXA 5GMKe 3M53A 4II1A 4E7SA 2COWA 4MZPA 4J7IA 1YFNA 2X4WA 3GNFB 1JJ2A 2X4JA 5CIUA 4ELYC 1UGRB 3G4SQ 1AEYA 1AT1B 3HRTA 4M7AB 2EVRA 4RG8A 1OPKA 3EG0A 2AZSA 3M0TA 3THKA 1U3OA 4LXCA 1JEGA 3EHRA 5LJ5f 4E7KA 2BZ8A 3DB3A 1YITT 3H0FA 4C92F 1NE8A 5FU6B 1RADB 3OA6A 3EG9B 1UEBA 5GANg 4XU2A 5LJ3f 5LL6S 1NJIU 4GBQA 1M1GA 2VV5A 4HCBA 4M77A 1PRMC 3QWYA 3JCMb 4M75E 2XG8D 3WVDB 3QBYA 1O75A 4OF1A 2J6FA 4HVUA 3MEUA 1EZZB 1NJIR 2K6DA 2VVKA 2DBMA 1TUDA 5GAMe 2A36A 3CPWP 1V29B 1GBQA 2DAQA 2DL7A 3UF4A 3RKXA 5FRNA 4QT7A 3OYIA 2EQKA 3CEYA 1YITQ 1QLYA 2OTJA 2HBWA 5J26A 1VA7A 4PJOF 3SD4A 1HJDA 1SEMA 2LQ8A 1S72T 2HBPA 3CCUT 1UB4A 4QKUA 4F17A 2H3EB 1BIBA 5IHNA 3SWNB 4M78G 1TG0A 3VRZA 5KYUB 2QQ9A 1WLPB 3FB9A 4J7FA 4F7UG 3JB9J 2XDBA 1WNLA 2YDLA 4QQ6A 4DEXA 2CP6A 1WQ7A 4ZGJB 2JS2A 1IO6A 1XNIA 2XI9A 3JV3A 2AT1B 1KQ1A 1OEBA 1M2VB 1Q7YU 1NG2A 1D1CA 3N5BB 1XTDA 3CPWA 1S72Q 1SRMA 1MNDA 1TS9A 5KYXB 3QYHB 1N8RC 3CMAA 2EYQA 5FLXE 1MMDA 1Q7YR 5EC7A 1ZLMA 4FT4A 2RNAA 2EIFA 2LRQA 3HP9A 1VQNA 2HZYA 1VQ4T 3NPFA 5CK9A 2QQRA 4V2SA 4C0DB 4OGCA 5HCKA 4IUQA 2DEUA 2EJ9A 3OYKA 4XTZA 2L3QA 2GFUA 1PD0A 2JOYA 4IUUA 1WJRA 2DA9A 4M7AC 3L2VA 4M7AE 3QXEB 1TUGB 2ED1A 5GAN4 2ZPHB 4BDZA 4M7DD 1AWXA 4BE0A 2LCCA 1UTIA 3OS5A 3RKWA 3X26B 4ANJA 4EDUA 2EQIA 2RQWA 4PL6A 1VYUA 5D6XA 3NTIA 1JB0E 2E1HA 2PVGB 3QZ5B 2XK0A 5FU6C 3OW2S 3CD6A 1VQ4Q 3E2UA 1WFWA 2JMCA 3M56A 2QA4T 1RAFB 2QK0A 3JCMQ 5GAOn 5DM7R 2FVUA 4OMNA 2A7YA 2K5LA 3NMZC 2ZPBB 1K76A 2DXCA 5GAOq 3PTAA 1WXBA 1C6VX 1W4SA 2DXTA 4M7DF 2E5KA 2OX7A 5GAOl 1YCYA 1V1CA 2L2PA 2OAUA 3OYYA 4Y92A 2DFUA 1W2BS 2NYSA 5J3BA 4HVVA 2P4RA 2MYSA 3FEOA 2NLUA 1U1SA 2DXUA 3CCVT 3VS4A 2WSCE 4YTLA 2E5QA 4DOVA 3MJXA 1WHHA 2QA4Q 2BTTA 2RH2A 5CO7A 2GGRA 4D8KA 5IT9E 3BY7A 3OYJA 2LNHB 3OYCA 2P0QA 1B34A 2JS0A 1UJYA 1NM7A 3SWNC 2KGTA 3GBQA 1Q81R 2KT1A 2LQNA 1WHMA 1BI2A 1T0JA 3I55A 2V8IA 1K9MC 4FT2A 4A53A 1HXDA 1SG5A 1FX7A 3GPLA 2RHZA 4D6WA 2RJCA 5GMKi 2HL3A 3PMIA 1FMVA 4C8QB 3M4GA 1VYTA 4A4GA 1VQ6A 4NL2A 5GMKm 2LDMA 1KIKA 1I5OB 4RTVA 3CCVQ 2ZAEA 4IIOA 1UHCA 4BD3A 3C12A 2EW3A 1QVFS 1YJWT 1RUWA 3CC7A 2X9HA 2Y90A 4M75D 3X25B 2K3BA 2FPDA 4L6V5 1Q86U 4VUBA 2DERA 3HFOA 1VYVA 2ATCB 3EG2A 1YJ9A 1YP5A 4C0FA 3FRNA 2CH4W 4C92E 2DO3A 1HSQA 4Y91A 2X3XD 2DD5A 4JJCA 4C0DC 2KDSA 3PIOA 5KYYB 2RB6A 1BI1A 3X24B 4E47A 2DIQA 2KBTA 1YI2Q 4JLIA 1KJWA 5CKDA 1YJWQ 6AT1B 1K1ZA 2EYYA 3L42A 3ER0A 2FO0A 4C5HA 5GAMg 3QIIA 1I8FA 1K9MU 1VIEA 4JRQA 2E41A 4AG1C 5KYWB 3H41A 2O4XB 1X43A 2KROA 2O88A 4N0AA 2QTVA 2R58A 3S6WA 3F70A 4PJOE 3V8KA 5LJ3h 2DBKA 5GAN3 5GAMd 3S3OA 3VU3C 2C06A 4M7DA 1KD1C 1RAIB 4L59A 2ESWA 4ZGDB 1YBYA 4FW1A 2J7IA 1BK2A 1D0XA 4XU0A 1M27C 2ROLA 3NFCA 4PJLA 2G3RA 2X51A 1VQMA 3C94A 4D8DA 5LJ5g 2O9SA 1RLPC 1T3SA 1Y96A 4RTWA 3ZL7C 4QQGA 2MMPA 2YUOA 3RESA 2O9VA 1M9SA 4KH0B 5FRMA 5LJ3g 2D8HA 2VUBA 4HVWA 1LOJA 3A8HB 1R77A 3VS6A 5EG2A 3T9NA 2F5KA 4EPCA 5FWBA 4BI8B 4JDSA 2CT3A 4M7AD 1TSFA 1Y57A 2E3IA 3JCMV 3OYMA 1B3QA 4Z02A 2A08A 2X3WD 3SHWA 4LD9K 4CC2A 2FYKA 2P84A 1VQ7A 3HHTB 3L2WA 1UGQB 1M30A 3L1AA 1KSWA 2NUTA 1IXDA 2OTJQ 1D1AA 2CZ0B 5FW9A 4MDXA 2ZGWA 1G3WA 4GLMA 3GF5A 4C8QC 1J3TA 1AWWA 1IZ6A 2PUKB 2CDTA 1NPPA 1KD1U 3EFRA 1PC0A 2AK5A 3CMAT 3MEWA 3VYHB 4A63B 2V26A 1AHJB 1W70A 3V7SA 2LP5A 1VQNT 3RERA 2RO0A 2DJZA 2D8JA 1E6GA 2JJ9A 2HSEB 4JZ4A 4M7AF 3C4SA 2EKOA 2W0ZA 2OAWA 1X6BA 4M78B 1ZBJA 3VS1A 4F7UB 1I0CA 4C8QG 4JS5A 2M51A 3URGA 2KR3A 4OMLA 3QDFA 2LNVA 1Q95G 1R0CB 2YUPA 3RIRA 3J80E 3EAEA 3WXMB 3CMAQ 4E6RA 3L2QA 4XTVA 1U5SA 3GLXA 4J9CA 4XK8E 4BDYA 1VQNQ 4JUVA 1MMGA 3CD6T 1OX9A 1ZX6A 3CCJA 4R0KA 1O9SA 2D0QB 2RK2A 2K79A 4C5GA 2NWMA 4ZN1A 2SRCA 2MK5A 5HK3A 2WACA 1ARKA 5I11A 1OI1A 2HQHA 3R6OA 5A0GA 4DEYA 4J83A 5GAOr 1VQKA 2EGAA 3AHUA 2RHXA 1NJIC 2F2VA 2A0FB 4RMOA 1QQJA 2XDPA 1ZSGA 4BE2A 1WA7A 1WXUA 2KYMA 3CD6Q 1XOVA 1BI3A 3I9QA 3A5ZB 3C95A 5IH2A 3H9NA 1YIJA 4XTYA 4C92D 5GAMf 4N4GA 2YUNA 3HL8A 2YRCA 2VB6A 4A54A 3VJPA 1BI0A 2DE0X 4J6XA 1X01A 3VS3A 1JBMA 4B6MA 4QVDA 1SSFA 1M8MA 4NL3A 3ME9A 1WX6A 4DBRA 3CCRA 1IGQA 5GANh 4ORZA 2ECZA 5KE2A 3HKSA 1UFFA 1G3YA 2X4YA 1AZEA 3OYAA 3I55T 3L2ZA 5KH6A 1UGPB 4NS5A 3UPUA 2YSQA 3CXCP 5LJ3j 4CC3A 2JNGA 4LD6A 1VQ6T 2DKGA 4J9HA 3CQTA 1OZ2A 2CUBA 3CPWS 1MNEA 2MPXC 1I07A 1NYGA 1VQPA 1MHNA 2RF0A 3CC7T 3PNWC 1PM3A 1D09B 3OYNA 5CQYA 5J39A 2EJFA 4PJOD 2JT4A 4M7AA 1Z9ZA 3LWIA 1P92A 2GTJA 4X1VA 2YWWA 3MO8A 4L5GA 3NTKA 1WJSA 2PQWA 1YJ9T 1UGVA 1W6XA 2NUPB 1Q7YC 1RAGB 2XDDA 2KNBB 3J81E 1VQOA 3SFMA 1LVKA 3I55Q 3M55A 4KUIA 3CCLA 2KMTA 5DY9A 4M78C 4M78E 3TSZA 1M1KR 1VQ6Q 2QTXA 3EG9A 2OI3A 4OVAA 1VQ9A 3SB2A 3JB9G 3UT1A 3FDRA 4O6JA 1H92A 3CC7Q 3PVQA 2DETA 3M0QA 1MMNA 4XTUA 1OQKA 3CXCA 4A4EA 2IVWA 1NLOC 1DJ7B 4CI0C 4JRPA 4PFPA 2RQTA 1YJ9Q 4KGVB 3M0UA 2K2VA 5I2SA 4QW2A 5FROA 3E9GA 1JXMA 3LWHA 3L2UA 5AT1B 4M75G 4BI3A 3VUZA 2ZPEB 2YLBA 1XQHA 2NUZA 5C6SA 2CZ6B 4PJMA 2CP7A 1W1FA 4ZTFA 1IB8A 2YUQA 3V7RA 3UWNA 2FRYA 5HK0A 3JSCA 4FYVB 2QI2A 4JS4A 3LGFA 1VQMT 4FCYA 5C0MA 2HNIA 2VKNA 3WVEB 1KHCA 3EFOA 3M0PA 4XTXA 2B8AA 4RTXA 1AWJA 3JCMe 2CGHA 2DRKA 1CKAA 2MI6A 2EKHA 2QEXA 2ED0A 2LTOA 5GJWB 1K8AU 2M0YA 3CCQA 3MEAA 4KBMB 1M2VA 3A1PA 2DZCA 2CP0A 1VQ5A 3UA6A 1X2QA 3UA7A 2C0IA 2C0TA 2DXBA 1K8AR 1VQ7T 2BZYA 3BDLA 4KGXB 1M4ZA 2QQSA 5KYXA 2P4TA 3LH0A 2LZ6B 1VQMQ 3X20B 3SDZA 2FZCB 3A8MB 3I35A 4C92A 2JMAA 2PVDB 3OB9A 2DIGA 1ZUUA 1RLQC 3EGXB 4LDWA 1WYXA 4WF2A 4EIKA 4F14A 2XICA 3GIBA 3LW5E 4X9CA 3V8JA 2YT6A 3H8ZA 3EG3A 4JZ3A 2LJ3A 3GOXA 3HSBA 2XIDA 2PNIA 5L23A 2DL3A 2DILA 2FZGB 1KQ2A 2EBPA 3JRZA 4HKEA 3U23A 2YLCA 4DBFA 5I21A 1M3CA 4JLGA 3CC4A 1VQ7Q 1TH7A 1FXXA 1VIFA 3QZ9B 3QHSA 1RAEB 3RMQA 2CP3A 1Q86C 4DBQA 5GANj 3M59A 3NHNA 2D9TA 2RPNA 1M90R 3MEVA 1YCSB 2FEIA 4PJOA 1NEGA 3GNGA 1D3BA 3Q1JA 2DTIA 4M77G 3L2RA 3SEMA 2K7AA 2FPEA 4WTOB 1TUCA 4J5YA 2OJ2A 3CCJT 2RHIA 1Q81U 3G71A 2V8KA 4HCZA 1PCXA 4JJBA 4J6WA 1QW1A 1Q82R 3OW2P 2LCLA 2DNUA 3DB4A 3CBOA 5KE3A 2DYIA 4FL6A 4BE1A 5IHKA 3EFSA 1QVGS 2E6NA 2K3YA 1VQKT 1WGSA 2SEMA 1TOVA 3ZEHA 1WHJA 2K4YA 4Z88A 1YWOA 1WQWA 3E9FA 3X28B 5CR2A 4PNOA 1ZHIA 1PWTA 2DVJA 2M0OA 2XHCA 3OYGA 1YI2T 4PJNA 2CSQA 3CCJQ 1T0HA 1YIJT 2O2OA 2I2LA 4XU1A 4EMKB 3EH2A 4GY5A 2DLPA 1A0NB 4PFOA 3HRUA 3CCMA 5GAMh 2I0NA 3RBBB 4M4ZA 1WHKA 3CCRT 1X75C 4F16A 5HY6A 1QCFA 4R55A 1NBEB 2P0PA 1VQKQ 2HAXA 4OMMA 5IAYA 1UUEA 2E4HA 1MGQA 3OYBA 4WCIA 5GAN7 2MWPA 1QCOA 2KRSA 1WDXA 4QVZA 4UC4A 5A0LA 3CBMA 1UDLA 3FJ5A 1N9RA 1VQPT 2DTHA 4XTWA 1YIJQ 2KQWA 2LC4A 4J9EA 3ASKA 9ATCB 1GCQA 3CBPA 5LJ5h 5GAOp 4HCKA 4PKCC 5KYYA 1KG1A 2DL8A 1G83A 1BCOA 3QUIA 4M78F 1OV3A 3CCRQ 4M7DB 4F7UF 5IHIA 1VQOT 3EGDA 4C92G 4J8OA 3CCLT 1OOTA 1ZSZA 4PLIA 3JCMP 1VQLA 3CCUA 2RQVA 3CMEA 2AZVA 3TCJA 2LX9A 2CSIA 1Y96B 1VQ9T 1K4US 1ABOA 1VQPQ 3CCSA 2J06A 5KYWA 4LDUA 1OPLA 2KSSA 2O4XA 3BFMA 3QDRB 2OTJT 2DM1A 2KRMA 1YJNA 1PHTA 2CZ1B 2EJGA 3HRSA 3VRYA 1Y0MA 2E10A 2GFAA 3AT1B 4BI4A 1VQOQ 1N27A 3OBWA 3QYGB 1KK7A 3GP8A 3INZA 2JTMA 3CCLQ 2JN0A 3EG1A 2IG0A 4PJOG 1E6HA 1KQSS 2F2WA 3H0HA 4RKUE 3QG1A 4RCCA 3EGUA 1IREB 2RJFA 4OGEA 1VQ9Q 1ZUKA 2CS7A 3R6NA 1H8KA 2QG9B 2XU8A 2EQMA 2V8JA 2HKNA 2BKDN 2LMJA 4OB3B 4C8QE 1JXOA 3JCMd 1Y71A 1D0YA 2ZCFB 2H8HA 4LUEA 4FYYB 2DRMA 1SPKA 2JM8A 3LYIA 5DLQE 5KYNA 2QEXT 1M8VA 1XJWB 2K9GA 5CVIA 1RI0A 1R8OB 1YHQQ 4E7JA 3CCQT 1JJ2S 2RI2A 4EMKC 3OY9A 3H6ZA 5CKFA 3OYFA 1VQ5T 3UATA 4P5NA 3ULRB 2LVMA 3M5AA 1PD1A 2QDYB 2VC8A 3JB9I 4M75B 1GFCA 5CKHA 2HQXA 3P8HA 3QJ6A 2QXFA 3QKJA 2VWFA 3S3MA 2RI3A 2JTFA 3CPFA 3OSVA 3E1SA 2CREA 1ZA1B 2A3LA 3PIPA 4DA4A 3HPWA 2FRWA 2CKKA 3FC3A 4ZTJA 3VS2A 3O8VA 4M78A 4IUTA 4OMOA 2QEXQ 3I5RA 1NEBA 2FB7A 2RI5A 4RTUA 2F5TX 3CCQQ 2ABLA 4BY6B 8ATCB 4N0AC 1VQ5Q 3V7CA 3VS0A 3RKYA 2HQEA 2YRDA 2G6FX 1FMWA 4LDYA 2EFIA 1SKUB 4BACA 1GL5A 2KXDA 3CC4T 4M7DC 1N9SA 1K0SA 3HFNA 2LX7A 2KAFA 4MZTA 2LQKA 5GAMj 2RJEA 3RUXA 1UHFA 5D7UA 3OMCA 2C0OA 1ACMB 1FMKA 4N4IA 1B07A 2WSEE 4FU6A 1JRIA 1PNJA 1H3ZA 4OMPA 4A4FA 4IUPA 4Y28E 5A0DA 3A98A 1QWFA 4ESRA 1NZ9A 1WHGA 1WZOA 1AD5A 1ZQ1A 1QP3A 2M16A 1HK9A 2FPFA 3OBYA 1X6OA 2QGFB 4OP0A 4M7DG 2E70A 3G71T 1SHFA 2HCKA 3C0CA 1HYOA 2W10A 4HXJA 4GLKA 1YWPA 2PUOB 4RTYA 2HL5C 1UE9A 3CC4Q 2KY9A 4BB7A 2BUDA 2YXYA 1C0MA 1B7TA 2MOXA 2KRNA 2MF2A 5LJ5j 4QVCA 2DF6A 2JTEA 3MHXA 2QASA 1D1BA 1HD3A 2R57A 3PGGA 2R5AA 1MV3A 3PT9A 4FYWB 4C0ZA 2B86A 4RCBA 5KCHA 4C5IA 1VUBA 1K73R 2P0KA 3OS2A 1IRXA 3RR6A 1NYFA 2H3JA 1MV0B 4B9WA 2CT4A 2M1HA 4CC7A 2DEQA 3MPUB 3ZFJA 3G71Q 1WHLA 1OU8A 4RG2A 2KK4A 1AWOA 1N5ZA 2O01E 3NTHA 4M77B 1YN8A 1UECA 1KC8U 2RA2A 2DK3A 3OYEA 2COYA 2EGCA 2ZZDA 4QQDA 1D0ZA 3CCMT 2A28A 2VYTA 2RQUA 1WIEA 1M1KU 2EYZA 4EMGA 2RK1A 3A8LB 4JRIA 5L8RE 2VXFA 2QDLA 1EX4A 1KC8R 2LJ0A 3UDCA 3M58A 2AIRB 1TTHB 3CC2A 1K9AA 4OMQA 2HD0A 3MP1A 3JB9H 3JCMf 4IKFA 4F7UE 1QP2A 4M75C 2YRVA 1K8AC 3QSUA 4IURA 1U8RA 2L0AA 1RAHB 1BYMA 2NUPA 2ZPFB 3VYGA 2JVVA 5GANd 2R5MA 2KE9A 2DX1A 2RM4A 3OYDA 1QWEA 1ZUYA 3JCMJ 3CCMQ 3S3NA 2PU9B 4LE9A 2X35A 8AT1B 3MKDA 4XQ3A 2IIMA 4MMLA 4FW2A 4E2FB 1GFDA 2EPDA 5D6YA 1BIAA 1V76A 5HKCA 1I5LA 4AG2C 4BY6C 1LJOA 2L3SA 1OX8A 1YHQA 3I56A 4A4KA 3V8LA 5I22A 2D0NA 1BBZA 4ATOA 1VQLT 3PMTA 1GBRA 2LJ1A 2K5IA 3CMET 4AMCA 1H3HA 2DJQA 3OQ5A 3M9QA 4C8QD 1BU1A 2AKLA 3CCST 3EFOB 3SWNA 5LJ5e 3JCMX 1S1NA 1IHVA 5GAN6 5KYUA 1NLPC 1M90C 1QVPA 4E7ZA 3QJYA 1YJNT 1G3TA 4JPBW 2DMOA 2RJDA 2XMFA 5LJ3e 2O31A 3LLRA 1QKWA 3P8BB 2GBQA 1SSHA 2XKOC 4J9DA 1M3BA 3NGPA 5IN1A 4Z89A 3OYHA 3G7ZA 4RUGA 4KH1B 3KBGA 1VQLQ 3CCUQ 4AT1B 4TVRA 1G3SA 1PSFA 3CMEQ 2EQJA 4PFZA 1Q82C 2M02A 2VGNA 1SHGA 4C8QF 1IGUA 4Q5WA 1AVZC 4C92B 3CCSQ 1Q81C 3PVLA 3MP8A 1Y7XA 4FIBA 1RL2A 1YJNQ 4O5VA 2MCNA 2K3XA 1UGSB 2DVEA 4AFQC 3BDUA 1I4K1 2GNCA 5CKBA 4DQ2A 4FM4B 1VQ8A 1PSEA 3G6EA 2ZPGB 3IQLA 2RD1A 4M77C 4E7LA 4J9FA 2OTLA 5GAOm 4M77E 2RN8A 1NPRA 3TQ7P 1M3AA 1M90U 2E12A 5DLOA 1WXTA 1GCPA 4CRIA 3EGXA 4PJOB 1ZBXA 3CCEA 4ELZC 2E64A 2WSFE 1PKSA 1D3BB 2DPPB 4M7AG 5CKEA 2QGGA 1VOMA 4LNPA 1SRLA 4XAXB 1LCKA 5CCAA 2RQRA 2MAMA 5GMKh 3LX7A 3RDVA 2JZ2A 1N8RU 2GQIA 1Q82U 3FJPA 5I2MA 1F1BB 3G4SA 1M1FA 5KCOA 1WJQA 3REAB 3M0RA 4DBHA 1B34B 3VUBA 4J9GA 3OMGA 4MDWA 3TVTA 1KFZA 3M57A 2MWOA 1N8RR 4KRTA 2LT4A 1WI7A 2COZA 2Z0WA 3OSSC 1PRLC 4OB2B 3DLMA 3VS7A 4OMFB 2Y4YA 4MZMA 2MIOA 4RTTA 1MMAA 2CH4A 4E7IA 1QKXA 5GANf 1Z9QA 2FL7A 3PFSA 3O5ZA 4KUDK 3TEEA 2HKQB 2EYXA 2EQUA 3E19A 3MP6A 2HDAA 3EHQA 2F69A 4LDVA 3JB9D 1OULA 1W2BP 4FSSA 4LN2A 3REBB 3TU4K 1JU5C 1PG5B 1ZA2B 4JRKA 4KGZB 1G8XA 4E7HA 4J9IA 5GJVB 2ROTA 4M78D 2CYZB 4C8QA 1YITA 1RAAB 1K0XA 1QMCA 1C1AA 2FHDA 4N4HA 4XU3A 1UJ0A 5GMKl 2EWNA 4FYXB 3M0SA 3OW2A 3A8GB 1U06A 2LQWA 4F04B 1QVGP 3OS0A 4OB1B 2CUDA 1PKTA 4C92C 3JB9F 2L5QA 2PZ1A 4EMKA 3META 4LUDA 4X34A 3DKMA 1JQQA 2QAZA 4HCCA 1Q86R 4J9BA 3LGLA 5FU7B 2E3HA 2K57A 2K2MA 1QVFP 2JM9A 4B9XA 5GANe 4A4HA 4AFUC 1R0BG 3EGDB 1M5Q1 1OU9A 1W2BA 2ZPIB 3JAME 1FYNA 4M75F 2J05A 1ZSZB 5FWCA 2KVQG 3OS1A 5A2QE 4J6YA 4OB0B 3CC2T 1RABB 4R56A 1S72A 1EIFA 2QQAA 1RACB 5GAN8 2EYWA 2V1QA 4PJOC 1SF9A 3QPHA 2GTOA 1TU0B 3JCMh 3KUFA 1K9MR 2L3PA 1JO8A 5AYFA 2AKKA 2HEQA 3PE0A 3M4YA 1N6AA 2F1LA 4BUGA 2VXEA 2L89A 4PK4A 4Z8AA 4AFSC 3FIFA 1QVGA 1E7OA 1H641 1CSKA 2GQVA 2BE9B 3QWXX 2VASA 4DOWA 2BE7D 1G2BA 4AFZC 1YHQT 3I56T 2ENMA 3MCAB 2GF7A 3CC2Q 2EAYA 3D7SB 1QVFA 3VV0A 4FSXA 4ME7A 2IPOB 3JCMg 4KULA 2NUTB 4IUVA 2DTOA 3HTRA 2LCSA 1OZ3A 3BE3A 2J6KA 5LJ5d 2JUFA 2EGEA 1VQ4A 1KHIA 1X27A 2HMAA 1GXIE 1X69A
chains in the Genus database with same CATH topology
4NL2A 2R57A 2LDMA 3PGGA 2R5AA 5GMKm 2QEXA 3PT9A 4C0ZA 1Y07A 2LTOA 5LJ3d 4HT8A 4RCBA 5KCHA 4BD3A 1K8AU 4C5IA 1LNXA 3C12A 3JCMc 1QVFS 1VUBA 2P0KA 3MEAA 3OS2A 3CCQA 1YJWT 1BKBA 4KBMB 4ZN3A 4M77D 4X9DA 3CC7A 2H3JA 2Y90A 1I81A 2DZ9A 2E6ZA 2M9UA 4B9WA 2DZCA 1FWZA 4M75D 1VQ5A 3X25B 2M1HA 5GMKj 4L6V5 1Q86U 2DXBA 2DEQA 4VUBA 3ZBDA 3HFOA 1VQ7T 3ZFJA 3BDLA 1M4ZA 2QQSA 2P4TA 5GAN2 3LH0A 1YJ9A 2Y4XA 4C0FA 3OYLA 4RG2A 3FRNA 3BW1A 3X20B 3SDZA 4C92E 2DO3A 2KK4A 2O01E 3A8MB 3NTHA 4M77B 4C92A 1KC8U 2RA2A 2DK3A 3OYEA 4Y91A 2PVDB 2DD5A 2RHYA 2ZZDA 4QQDA 2X4XA 3CCMT 3OB9A 4C0DC 2KDSA 4C5EA 3PIOA 2DIGA 2VYTA 3DLLA 1M1KU 4LDWA 4EMGA 2RB6A 1BI1A 2RK1A 4WF2A 3X24B 2QA4A 2XICA 3A8OB 2BIVA 3A8LB 3GIBA 4JRIA 3LW5E 4E47A 2DIQA 2LT1A 2VXFA 4X9CA 5L8RE 3V8JA 2AHJB 3H8ZA 1K73C 3UDCA 4JLIA 3M58A 5CKDA 2VGMA 3GOXA 2XIDA 3CC2A 3HSBA 4M77F 2HD0A 3MP1A 3JB9H 1KQ2A 3JCMf 3JRZA 4HKEA 2YLCA 3L42A 4IKFA 3ER0A 5I21A 4M7AE 4F7UE 1QP2A 4JLGA 3TREA 1VQ8T 4M75C 4C5HA 5GAMg 2YRVA 5CAIA 1K8AC 3QIIA 3G6ET 3JCMW 4F7UA 4EMHA 3KXTA 3CC4A 4IURA 3QSUA 4HT9A 5FU7C 1U8RA 1I8FA 3RMSA 1VIEA 4M75A 1TH7A 2PVOB 4C0GA 4JRQA 1FXXA 1K9MU 1VIFA 3QZ9B 1BYMA 2E41A 3QHSA 2OTLT 2ZPFB 3VYGA 4KT0E 2JVVA 1U1TA 2O4XB 2D6FA 5GANd 3RMQA 3VKIA 2R5MA 4N0AA 5GAN5 1Q86C 2R58A 3S6WA 5GANj 3M59A 3F70A 2D9TA 4PJOE 3V8KA 1OYXA 2RM4A 2E65A 3OYDA 3CCVA 3MEVA 5LJ3h 4M7DE 3JCMJ 5GAN3 3S3OA 5GAMd 3S3NA 2PU9B 4PJOA 2X35A 3VU3C 2C06A 4M7DA 4XQ3A 4MMLA 1KD1C 2CZ7B 3CCET 2XD0A 4L59A 4ZGEB 3J7AF 3GNGA 1D3BA 5D6YA 2L8DA 2GCXA 4ZGDB 1BIAA 1YBYA 2DTIA 3Q1JA 4M77G 4XU0A 3L2RA 5HKCA 1KC8C 1I5LA 2DD4A 4BY6C 1LJOA 3M54A 3NFCA 5D6WA 1YHQA 4J5YA 4A4KA 3P8DA 3I56A 2G3RA 2L3RA 3V8LA 1M1KC 3CCJT 2RHIA 3FLGA 3G71A 1Q81U 4ATOA 1VQMA 1VQLT 2V8KA 3C94A 4HCZA 3PMTA 5LJ5g 1KQSA 3CXCS 3CMET 2K5IA 1G5VA 1Y96A 4J6WA 4PLLA 3G4ST 4QQGA 1QW1A 3OQ5A 2MMPA 3M9QA 4C8QD 2LCLA 4MMKA 4JJNK 3CCST 3DB4A 3RESA 2RHUA 3CBOA 5KE3A 5M9OA 2YHTA 1M9SA 3SWNA 5LJ3g 5LJ5e 4A4GA 5FRMA 3JCMX 2VUBA 4FL6A 4BE1A 3EFSA 1WPYA 5GAN6 2K5FA 1LOJA 3A8HB 2QQBA 1QVGS 2E6NA 2K3YA 1M90C 4NOYA 1WGSA 1QVPA 1VQKT 3QJYA 1K73U 1YJNT 1G3TA 1YI2A 3QO3A 3ZEHA 1YJWA 5EG2A 3T9NA 2F5KA 2K4YA 2RJDA 3E9FA 1WQWA 5LJ3e 4EPCA 3LLRA 4BI8B 3X28B 4HA8A 4JDSA 4M7AD 4LDXA 5CR2A 5CQXA 4PNOA 3P8BB 3JCMV 3OYMA 1ZHIA 4Z02A 2M0OA 2XHCA 5GMKe 3OYGA 1YI2T 2XKOC 3M53A 4LD9K 4II1A 2FYKA 5IN1A 1VQ7A 3OYHA 4MZPA 4J7IA 3G7ZA 3HHTB 2X4WA 3GNFB 3KBGA 3L2WA 1YIJT 1UGQB 3L1AA 1JJ2A 2X4JA 4TVRA 1G3SA 1PSFA 5CIUA 2I2LA 4ELYC 2EQJA 1UGRB 2CZ0B 1Q82C 4MDXA 2VGNA 4XU1A 4C8QF 4Q5WA 4EMKB 4GY5A 3HRTA 4M7AB 2ZGWA 1G3WA 3GF5A 4C92B 3HRUA 4C8QC 3CCMA 1Q81C 5GAMh 1IZ6A 2PUKB 3MP8A 4RG8A 1KD1U 1NPPA 3CCRT 3EFRA 1X75C 3CMAT 5HY6A 3MEWA 1Y7XA 3VYHB 4R55A 4FIBA 1AHJB 2P0PA 1RL2A 3V7SA 2HAXA 4O5VA 1VQNT 3RERA 5IAYA 2RO0A 2K3XA 1MGQA 2DJZA 1UGSB 3OYBA 2DVEA 3BDUA 5GAN7 5LJ5f 2MWPA 4E7KA 1I4K1 3C4SA 3DB3A 1YITT 4M7AF 4C92F 1NE8A 2EKOA 5FU6B 3OA6A 5CKBA 4DQ2A 4FM4B 1VQ8A 4QVZA 4UC4A 5A0LA 1PSEA 3G6EA 4M78B 3CBMA 1UEBA 5GANg 2ZPGB 4XU2A 1N9RA 2RD1A 4F7UB 1VQPT 5LJ3f 2DTHA 4M77C 4XTWA 5LL6S 4C8QG 4JS5A 4E7LA 1NJIU 5GAOm 4M77E 2OTLA 2KQWA 2LC4A 1M1GA 2VV5A 4HCBA 4M77A 1NPRA 3ASKA 3URGA 4M75E 3JCMb 2XG8D 1M90U 2E12A 3QBYA 3WVDB 2LNVA 3CBPA 5LJ5h 5DLOA 5GAOp 4PKCC 4CRIA 1O75A 4OF1A 1KG1A 3RIRA 3MEUA 3J80E 4M78F 3QUIA 3EAEA 3WXMB 4PJOB 1ZBXA 3CCEA 5GAMe 4M7DB 4ELZC 3L2QA 2E64A 1V29B 4XTVA 4F7UF 2DAQA 3GLXA 2WSFE 1VQOT 4XK8E 1D3BB 2DPPB 4BDYA 4M7AG 5CKEA 4C92G 4JUVA 4XAXB 3RKXA 5FRNA 4J8OA 5CCAA 3CCLT 3CD6T 2MAMA 3OYIA 3CCJA 2EQKA 3CEYA 1O9SA 3LX7A 4PLIA 2D0QB 5GMKh 3CCUA 2RK2A 3JCMP 1VQLA 2JZ2A 1N8RU 3CMEA 2OTJA 3TCJA 4C5GA 2LX9A 3FJPA 5I2MA 5J26A 3G4SA 4ZN1A 1Q82U 4PJOF 1M1FA 3SD4A 1Y96B 5KCOA 5HK3A 1VQ9T 1WJQA 2WACA 1OI1A 2LQ8A 3R6OA 5A0GA 3CCSA 1B34B 3VUBA 1S72T 4LDUA 2KSSA 2HBPA 2O4XA 3CCUT 3OMGA 4MDWA 3BFMA 1UB4A 3QDRB 2OTJT 3M57A 1BIBA 2MWOA 3SWNB 2LT4A 4J83A 4M78G 5GAOr 3OSSC 1VQKA 4OB2B 2QQ9A 3FB9A 1YJNA 3AHUA 3DLMA 4J7FA 4F7UG 2CZ1B 2RHXA 3JB9J 1NJIC 2EJGA 3HRSA 4OMFB 2Y4YA 2XDBA 4MZMA 1WNLA 2E10A 4QQ6A 4RMOA 2GFAA 2XDPA 4BE2A 4BI4A 1N27A 3OBWA 1WQ7A 3QYGB 4ZGJB 5GANf 4E7IA 3PFSA 2FL7A 3GP8A 4KUDK 3INZA 3TEEA 2JTMA 1XNIA 1XOVA 2JN0A 1BI3A 2XI9A 2IG0A 4PJOG 3A5ZB 1KQSS 3C95A 1YIJA 2EQUA 3E19A 4XTYA 4C92D 4RKUE 5GAMf 4N4GA 3QG1A 1KQ1A 3HL8A 3MP6A 4RCCA 1Q7YU 2F69A 1IREB 4LDVA 2RJFA 3VJPA 1BI0A 3N5BB 4A54A 4J6XA 1X01A 3JB9D 1JBMA 1VQ6A 4QVDA 4OGEA 1SSFA 2CS7A 1XTDA 4NL3A 3CPWA 3ME9A 2XU8A 3QYHB 2EQMA 3CCRA 1N8RC 5GANh 2V8JA 3TU4K 3CMAA 2EYQA 5KE2A 4JRKA 3HKSA 5FLXE 1G3YA 2X4YA 4E7HA 4FT4A 2BKDN 2EIFA 3OYAA 2LRQA 3HP9A 3L2ZA 3I55T 1VQNA 4OB3B 4C8QE 5KH6A 3JCMd 1UGPB 1Y71A 4NS5A 3UPUA 2ZCFB 4M78D 1VQ4T 2CYZB 4C8QA 5LJ3j 5CK9A 1YITA 2JNGA 4LD6A 3LYIA 5DLQE 1VQ6T 2DKGA 2QQRA 4V2SA 4C0DB 1OZ2A 2FHDA 4IUQA 4N4HA 4OGCA 2QEXT 1M8VA 2EJ9A 5CVIA 3OYKA 4XU3A 1RI0A 1R8OB 4XTZA 3CPWS 5GMKl 2EWNA 4E7JA 3CCQT 2GFUA 1VQPA 1MHNA 3OW2A 2JOYA 3A8GB 4IUUA 1JJ2S 1WJRA 3CC7T 3PNWC 2RI2A 4EMKC 3OY9A 3OYNA 4M7AC 3OS0A 3H6ZA 3L2VA 4OB1B 5CKFA 3OYFA 4C92C 1VQ5T 3JB9F 3QXEB 2L5QA 4P5NA 5CQYA 2EJFA 2LVMA 4EMKA 5J39A 3META 4PJOD 5GAN4 2ZPHB 3M5AA 3DKMA 1P92A 4X34A 3LWIA 4BDZA 2QDYB 4M7AA 4BE0A 4M7DD 2LCCA 4HCCA 2VC8A 3OS5A 3MO8A 4L5GA 3RKWA 3NTKA 3JB9I 3X26B 4EDUA 1WJSA 4M75B 2PQWA 1YJ9T 5CKHA 3LGLA 2HQXA 3P8HA 4PL6A 5FU7B 1Q7YC 3QJ6A 2K57A 2QXFA 3QKJA 5D6XA 4B9XA 2XDDA 3S3MA 5GANe 3J81E 2RI3A 2JTFA 3NTIA 1JB0E 2E1HA 3SFMA 1VQOA 3CPFA 2PVGB 3OSVA 3QZ5B 3E1SA 2XK0A 4A4HA 3M55A 5FU6C 4KUIA 3CCLA 2A3LA 3PIPA 3OW2S 1M5Q1 3HPWA 4DA4A 3CD6A 2KMTA 1W2BA 5DY9A 2ZPIB 2CKKA 4M78C 3FC3A 3M56A 4ZTJA 4M78E 3JAME 2QA4T 2QTXA 4M75F 3O8VA 2KVQG 4IUTA 4M78A 3JCMQ 5GAOn 4OVAA 3OS1A 5DM7R 5A2QE 4J6YA 1VQ9A 4OB0B 2FVUA 3SB2A 2FB7A 2RI5A 3JB9G 2F5TX 3CC2T 3UT1A 3FDRA 4O6JA 4R56A 1S72A 1EIFA 2A7YA 2K5LA 4BY6B 2QQAA 2ZPBB 5GAN8 2DXCA 4N0AC 4XTUA 5GAOq 3PTAA 3V7CA 2DXTA 1W4SA 3RKYA 2HQEA 4M7DF 3CXCA 4LDYA 2EFIA 4A4EA 4BACA 5GAOl 4PJOC 2IVWA 3CC4T 1YCYA 3QPHA 4M7DC 1DJ7B 2OAUA 3OYYA 1N9SA 4CI0C 4JRPA 3JCMh 3KUFA 1W2BS 3HFNA 5AYFA 2KAFA 4MZTA 2K2VA 2LQKA 4QW2A 5J3BA 5I2SA 5GAMj 3M4YA 2RJEA 3FEOA 3RUXA 5FROA 3E9GA 1N6AA 4BUGA 2VXEA 2L89A 2NLUA 3OMCA 1U1SA 3LWHA 2DXUA 3FIFA 3L2UA 3CCVT 1QVGA 4N4IA 2WSCE 2WSEE 4FU6A 4M75G 4BI3A 1H641 4YTLA 1JRIA 3VUZA 2E5QA 2ZPEB 2YLBA 1XQHA 1H3ZA 4DOVA 4A4FA 4IUPA 2GQVA 4Y28E 5A0DA 5C6SA 2RH2A 1NZ9A 2CZ6B 5CO7A 5IT9E 1ZQ1A 3BY7A 4DOWA 4ZTFA 3OYJA 1QP3A 2M16A 1HK9A 3OYCA 2P0QA 3V7RA 3UWNA 1YHQT 5HK0A 3I56T 3OBYA 1B34A 2GF7A 3MCAB 1X6OA 2EAYA 4OP0A 1QVFA 3JSCA 3SWNC 4M7DG 2E70A 3VV0A 3G71T 2QI2A 4FSXA 3LGFA 4ME7A 4JS4A 1VQMT 5C0MA 3JCMg 4KULA 2HNIA 3WVEB 4IUVA 2DTOA 4GLKA 2PUOB 1BI2A 1KHCA 1OZ3A 2KY9A 4BB7A 2BUDA 4XTXA 3I55A 2V8IA 5LJ5d 2JUFA 2B8AA 1K9MC 4FT2A 4A53A 1HXDA 1VQ4A 1FX7A 2MF2A 5LJ5j 1KHIA 3GPLA 2RHZA 4D6WA 2RJCA 3JCMe 2CGHA 4QVCA 5GMKi 1GXIE 3PMIA 4C8QB 2MI6A 3M4GA 3MHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PT9 A;  1ZHI A;  4FSX A;  4JJN K;  4LD9 K;  2FVU A;  4KUL A;  4BB7 A;  3PTA A;  4DOV A;  4FT2 A;  1W4S A;  3TU4 K;  1ZBX A;  4KUI A;  2FL7 A;  4DA4 A;  4DOW A;  1M4Z A;  4KUD K;  4FT4 A; 
#chains in the Genus database with same CATH topology
 2HSP A;  3RNJ A;  1IHW A;  1UG1 A;  1Y07 A;  5LJ3 d;  4HT8 A;  4CC4 B;  7AT1 B;  1LNX A;  3JCM c;  3VS5 A;  5IXB A;  1BKB A;  4ZN3 A;  4M77 D;  4X9D A;  1TWB A;  2A37 A;  2DL4 A;  1I81 A;  2DZ9 A;  2E6Z A;  2M9U A;  3G1J A;  1RI9 A;  1FWZ A;  2FZK B;  1AOJ A;  5GMK j;  3I5S A;  3I56 Q;  1T3L A;  3ZBD A;  5GAN 2;  2QYZ A;  2Y4X A;  3OYL A;  2CP2 A;  3BW1 A;  2V1R A;  2D1X A;  4IIM A;  2FG0 A;  1KQS P;  2RHY A;  3H0I A;  2X4X A;  3DLL A;  4C5E A;  5ECA A;  2J6O A;  1QCN A;  1KD1 R;  2QA4 A;  3A8O B;  2BIV A;  1EFN A;  2PTK A;  3EH1 A;  2LT1 A;  2AHJ B;  2RMO A;  2KEA A;  1K73 C;  2VGM A;  4M77 F;  2JW4 A;  4K11 A;  2JXB A;  1M2O A;  4RTZ A;  3TRE A;  1VQ8 T;  1GCQ C;  5CAI A;  2KT8 A;  3G6E T;  3JCM W;  4F7U A;  4EMH A;  3KXT A;  4HT9 A;  5FU7 C;  3TSW A;  3RMS A;  4C0G A;  4M75 A;  2PVO B;  5IXF A;  2KYB A;  2OTL T;  4KT0 E;  1U1T A;  2D6F A;  3VKI A;  1TXQ A;  5GAN 5;  1BCM A;  1CKB A;  2KI7 A;  1X2K A;  1OYX A;  2E65 A;  3CCV A;  1JJ2 P;  4M7D E;  1X6G A;  2KXC A;  1ZSZ C;  2F2X A;  4PJJ A;  2CZ7 B;  3CCE T;  2XD0 A;  3J7A F;  4ZGE B;  2L8D A;  2GCX A;  3LH5 A;  4ZNX A;  1MUZ A;  1KC8 C;  2DL5 A;  2DD4 A;  2DYB A;  3M54 A;  5D6W A;  2BZX A;  3P8D A;  2L3R A;  1M1K C;  3FLG A;  1KQS A;  3CXC S;  1G5V A;  1I1J A;  1VQ8 Q;  4PLL A;  3G4S T;  3G6E Q;  1ABQ A;  4MMK A;  4JJN K;  2RHU A;  1AZG B;  2OTL Q;  5M9O A;  2YHT A;  1GRI A;  2CP5 A;  1WPY A;  4JJD A;  2K5F A;  2QQB A;  4NOY A;  3KFV A;  1K73 U;  1YI2 A;  3QO3 A;  1YNZ A;  1YJW A;  3CCE Q;  4HA8 A;  1BB9 A;  4LDX A;  1LPL A;  5CQX A;  5GMK e;  3M53 A;  4II1 A;  4E7S A;  2COW A;  4MZP A;  4J7I A;  1YFN A;  2X4W A;  3GNF B;  1JJ2 A;  2X4J A;  5CIU A;  4ELY C;  1UGR B;  3G4S Q;  1AEY A;  1AT1 B;  3HRT A;  4M7A B;  2EVR A;  4RG8 A;  1OPK A;  3EG0 A;  2AZS A;  3M0T A;  3THK A;  1U3O A;  4LXC A;  1JEG A;  3EHR A;  5LJ5 f;  4E7K A;  2BZ8 A;  3DB3 A;  1YIT T;  3H0F A;  4C92 F;  1NE8 A;  5FU6 B;  1RAD B;  3OA6 A;  3EG9 B;  1UEB A;  5GAN g;  4XU2 A;  5LJ3 f;  5LL6 S;  1NJI U;  4GBQ A;  1M1G A;  2VV5 A;  4HCB A;  4M77 A;  1PRM C;  3QWY A;  3JCM b;  4M75 E;  2XG8 D;  3WVD B;  3QBY A;  1O75 A;  4OF1 A;  2J6F A;  4HVU A;  3MEU A;  1EZZ B;  1NJI R;  2K6D A;  2VVK A;  2DBM A;  1TUD A;  5GAM e;  2A36 A;  3CPW P;  1V29 B;  1GBQ A;  2DAQ A;  2DL7 A;  3UF4 A;  3RKX A;  5FRN A;  4QT7 A;  3OYI A;  2EQK A;  3CEY A;  1YIT Q;  1QLY A;  2OTJ A;  2HBW A;  5J26 A;  1VA7 A;  4PJO F;  3SD4 A;  1HJD A;  1SEM A;  2LQ8 A;  1S72 T;  2HBP A;  3CCU T;  1UB4 A;  4QKU A;  4F17 A;  2H3E B;  1BIB A;  5IHN A;  3SWN B;  4M78 G;  1TG0 A;  3VRZ A;  5KYU B;  2QQ9 A;  1WLP B;  3FB9 A;  4J7F A;  4F7U G;  3JB9 J;  2XDB A;  1WNL A;  2YDL A;  4QQ6 A;  4DEX A;  2CP6 A;  1WQ7 A;  4ZGJ B;  2JS2 A;  1IO6 A;  1XNI A;  2XI9 A;  3JV3 A;  2AT1 B;  1KQ1 A;  1OEB A;  1M2V B;  1Q7Y U;  1NG2 A;  1D1C A;  3N5B B;  1XTD A;  3CPW A;  1S72 Q;  1SRM A;  1MND A;  1TS9 A;  5KYX B;  3QYH B;  1N8R C;  3CMA A;  2EYQ A;  5FLX E;  1MMD A;  1Q7Y R;  5EC7 A;  1ZLM A;  4FT4 A;  2RNA A;  2EIF A;  2LRQ A;  3HP9 A;  1VQN A;  2HZY A;  1VQ4 T;  3NPF A;  5CK9 A;  2QQR A;  4V2S A;  4C0D B;  4OGC A;  5HCK A;  4IUQ A;  2DEU A;  2EJ9 A;  3OYK A;  4XTZ A;  2L3Q A;  2GFU A;  1PD0 A;  2JOY A;  4IUU A;  1WJR A;  2DA9 A;  4M7A C;  3L2V A;  4M7A E;  3QXE B;  1TUG B;  2ED1 A;  5GAN 4;  2ZPH B;  4BDZ A;  4M7D D;  1AWX A;  4BE0 A;  2LCC A;  1UTI A;  3OS5 A;  3RKW A;  3X26 B;  4ANJ A;  4EDU A;  2EQI A;  2RQW A;  4PL6 A;  1VYU A;  5D6X A;  3NTI A;  1JB0 E;  2E1H A;  2PVG B;  3QZ5 B;  2XK0 A;  5FU6 C;  3OW2 S;  3CD6 A;  1VQ4 Q;  3E2U A;  1WFW A;  2JMC A;  3M56 A;  2QA4 T;  1RAF B;  2QK0 A;  3JCM Q;  5GAO n;  5DM7 R;  2FVU A;  4OMN A;  2A7Y A;  2K5L A;  3NMZ C;  2ZPB B;  1K76 A;  2DXC A;  5GAO q;  3PTA A;  1WXB A;  1C6V X;  1W4S A;  2DXT A;  4M7D F;  2E5K A;  2OX7 A;  5GAO l;  1YCY A;  1V1C A;  2L2P A;  2OAU A;  3OYY A;  4Y92 A;  2DFU A;  1W2B S;  2NYS A;  5J3B A;  4HVV A;  2P4R A;  2MYS A;  3FEO A;  2NLU A;  1U1S A;  2DXU A;  3CCV T;  3VS4 A;  2WSC E;  4YTL A;  2E5Q A;  4DOV A;  3MJX A;  1WHH A;  2QA4 Q;  2BTT A;  2RH2 A;  5CO7 A;  2GGR A;  4D8K A;  5IT9 E;  3BY7 A;  3OYJ A;  2LNH B;  3OYC A;  2P0Q A;  1B34 A;  2JS0 A;  1UJY A;  1NM7 A;  3SWN C;  2KGT A;  3GBQ A;  1Q81 R;  2KT1 A;  2LQN A;  1WHM A;  1BI2 A;  1T0J A;  3I55 A;  2V8I A;  1K9M C;  4FT2 A;  4A53 A;  1HXD A;  1SG5 A;  1FX7 A;  3GPL A;  2RHZ A;  4D6W A;  2RJC A;  5GMK i;  2HL3 A;  3PMI A;  1FMV A;  4C8Q B;  3M4G A;  1VYT A;  4A4G A;  1VQ6 A;  4NL2 A;  5GMK m;  2LDM A;  1KIK A;  1I5O B;  4RTV A;  3CCV Q;  2ZAE A;  4IIO A;  1UHC A;  4BD3 A;  3C12 A;  2EW3 A;  1QVF S;  1YJW T;  1RUW A;  3CC7 A;  2X9H A;  2Y90 A;  4M75 D;  3X25 B;  2K3B A;  2FPD A;  4L6V 5;  1Q86 U;  4VUB A;  2DER A;  3HFO A;  1VYV A;  2ATC B;  3EG2 A;  1YJ9 A;  1YP5 A;  4C0F A;  3FRN A;  2CH4 W;  4C92 E;  2DO3 A;  1HSQ A;  4Y91 A;  2X3X D;  2DD5 A;  4JJC A;  4C0D C;  2KDS A;  3PIO A;  5KYY B;  2RB6 A;  1BI1 A;  3X24 B;  4E47 A;  2DIQ A;  2KBT A;  1YI2 Q;  4JLI A;  1KJW A;  5CKD A;  1YJW Q;  6AT1 B;  1K1Z A;  2EYY A;  3L42 A;  3ER0 A;  2FO0 A;  4C5H A;  5GAM g;  3QII A;  1I8F A;  1K9M U;  1VIE A;  4JRQ A;  2E41 A;  4AG1 C;  5KYW B;  3H41 A;  2O4X B;  1X43 A;  2KRO A;  2O88 A;  4N0A A;  2QTV A;  2R58 A;  3S6W A;  3F70 A;  4PJO E;  3V8K A;  5LJ3 h;  2DBK A;  5GAN 3;  5GAM d;  3S3O A;  3VU3 C;  2C06 A;  4M7D A;  1KD1 C;  1RAI B;  4L59 A;  2ESW A;  4ZGD B;  1YBY A;  4FW1 A;  2J7I A;  1BK2 A;  1D0X A;  4XU0 A;  1M27 C;  2ROL A;  3NFC A;  4PJL A;  2G3R A;  2X51 A;  1VQM A;  3C94 A;  4D8D A;  5LJ5 g;  2O9S A;  1RLP C;  1T3S A;  1Y96 A;  4RTW A;  3ZL7 C;  4QQG A;  2MMP A;  2YUO A;  3RES A;  2O9V A;  1M9S A;  4KH0 B;  5FRM A;  5LJ3 g;  2D8H A;  2VUB A;  4HVW A;  1LOJ A;  3A8H B;  1R77 A;  3VS6 A;  5EG2 A;  3T9N A;  2F5K A;  4EPC A;  5FWB A;  4BI8 B;  4JDS A;  2CT3 A;  4M7A D;  1TSF A;  1Y57 A;  2E3I A;  3JCM V;  3OYM A;  1B3Q A;  4Z02 A;  2A08 A;  2X3W D;  3SHW A;  4LD9 K;  4CC2 A;  2FYK A;  2P84 A;  1VQ7 A;  3HHT B;  3L2W A;  1UGQ B;  1M30 A;  3L1A A;  1KSW A;  2NUT A;  1IXD A;  2OTJ Q;  1D1A A;  2CZ0 B;  5FW9 A;  4MDX A;  2ZGW A;  1G3W A;  4GLM A;  3GF5 A;  4C8Q C;  1J3T A;  1AWW A;  1IZ6 A;  2PUK B;  2CDT A;  1NPP A;  1KD1 U;  3EFR A;  1PC0 A;  2AK5 A;  3CMA T;  3MEW A;  3VYH B;  4A63 B;  2V26 A;  1AHJ B;  1W70 A;  3V7S A;  2LP5 A;  1VQN T;  3RER A;  2RO0 A;  2DJZ A;  2D8J A;  1E6G A;  2JJ9 A;  2HSE B;  4JZ4 A;  4M7A F;  3C4S A;  2EKO A;  2W0Z A;  2OAW A;  1X6B A;  4M78 B;  1ZBJ A;  3VS1 A;  4F7U B;  1I0C A;  4C8Q G;  4JS5 A;  2M51 A;  3URG A;  2KR3 A;  4OML A;  3QDF A;  2LNV A;  1Q95 G;  1R0C B;  2YUP A;  3RIR A;  3J80 E;  3EAE A;  3WXM B;  3CMA Q;  4E6R A;  3L2Q A;  4XTV A;  1U5S A;  3GLX A;  4J9C A;  4XK8 E;  4BDY A;  1VQN Q;  4JUV A;  1MMG A;  3CD6 T;  1OX9 A;  1ZX6 A;  3CCJ A;  4R0K A;  1O9S A;  2D0Q B;  2RK2 A;  2K79 A;  4C5G A;  2NWM A;  4ZN1 A;  2SRC A;  2MK5 A;  5HK3 A;  2WAC A;  1ARK A;  5I11 A;  1OI1 A;  2HQH A;  3R6O A;  5A0G A;  4DEY A;  4J83 A;  5GAO r;  1VQK A;  2EGA A;  3AHU A;  2RHX A;  1NJI C;  2F2V A;  2A0F B;  4RMO A;  1QQJ A;  2XDP A;  1ZSG A;  4BE2 A;  1WA7 A;  1WXU A;  2KYM A;  3CD6 Q;  1XOV A;  1BI3 A;  3I9Q A;  3A5Z B;  3C95 A;  5IH2 A;  3H9N A;  1YIJ A;  4XTY A;  4C92 D;  5GAM f;  4N4G A;  2YUN A;  3HL8 A;  2YRC A;  2VB6 A;  4A54 A;  3VJP A;  1BI0 A;  2DE0 X;  4J6X A;  1X01 A;  3VS3 A;  1JBM A;  4B6M A;  4QVD A;  1SSF A;  1M8M A;  4NL3 A;  3ME9 A;  1WX6 A;  4DBR A;  3CCR A;  1IGQ A;  5GAN h;  4ORZ A;  2ECZ A;  5KE2 A;  3HKS A;  1UFF A;  1G3Y A;  2X4Y A;  1AZE A;  3OYA A;  3I55 T;  3L2Z A;  5KH6 A;  1UGP B;  4NS5 A;  3UPU A;  2YSQ A;  3CXC P;  5LJ3 j;  4CC3 A;  2JNG A;  4LD6 A;  1VQ6 T;  2DKG A;  4J9H A;  3CQT A;  1OZ2 A;  2CUB A;  3CPW S;  1MNE A;  2MPX C;  1I07 A;  1NYG A;  1VQP A;  1MHN A;  2RF0 A;  3CC7 T;  3PNW C;  1PM3 A;  1D09 B;  3OYN A;  5CQY A;  5J39 A;  2EJF A;  4PJO D;  2JT4 A;  4M7A A;  1Z9Z A;  3LWI A;  1P92 A;  2GTJ A;  4X1V A;  2YWW A;  3MO8 A;  4L5G A;  3NTK A;  1WJS A;  2PQW A;  1YJ9 T;  1UGV A;  1W6X A;  2NUP B;  1Q7Y C;  1RAG B;  2XDD A;  2KNB B;  3J81 E;  1VQO A;  3SFM A;  1LVK A;  3I55 Q;  3M55 A;  4KUI A;  3CCL A;  2KMT A;  5DY9 A;  4M78 C;  4M78 E;  3TSZ A;  1M1K R;  1VQ6 Q;  2QTX A;  3EG9 A;  2OI3 A;  4OVA A;  1VQ9 A;  3SB2 A;  3JB9 G;  3UT1 A;  3FDR A;  4O6J A;  1H92 A;  3CC7 Q;  3PVQ A;  2DET A;  3M0Q A;  1MMN A;  4XTU A;  1OQK A;  3CXC A;  4A4E A;  2IVW A;  1NLO C;  1DJ7 B;  4CI0 C;  4JRP A;  4PFP A;  2RQT A;  1YJ9 Q;  4KGV B;  3M0U A;  2K2V A;  5I2S A;  4QW2 A;  5FRO A;  3E9G A;  1JXM A;  3LWH A;  3L2U A;  5AT1 B;  4M75 G;  4BI3 A;  3VUZ A;  2ZPE B;  2YLB A;  1XQH A;  2NUZ A;  5C6S A;  2CZ6 B;  4PJM A;  2CP7 A;  1W1F A;  4ZTF A;  1IB8 A;  2YUQ A;  3V7R A;  3UWN A;  2FRY A;  5HK0 A;  3JSC A;  4FYV B;  2QI2 A;  4JS4 A;  3LGF A;  1VQM T;  4FCY A;  5C0M A;  2HNI A;  2VKN A;  3WVE B;  1KHC A;  3EFO A;  3M0P A;  4XTX A;  2B8A A;  4RTX A;  1AWJ A;  3JCM e;  2CGH A;  2DRK A;  1CKA A;  2MI6 A;  2EKH A;  2QEX A;  2ED0 A;  2LTO A;  5GJW B;  1K8A U;  2M0Y A;  3CCQ A;  3MEA A;  4KBM B;  1M2V A;  3A1P A;  2DZC A;  2CP0 A;  1VQ5 A;  3UA6 A;  1X2Q A;  3UA7 A;  2C0I A;  2C0T A;  2DXB A;  1K8A R;  1VQ7 T;  2BZY A;  3BDL A;  4KGX B;  1M4Z A;  2QQS A;  5KYX A;  2P4T A;  3LH0 A;  2LZ6 B;  1VQM Q;  3X20 B;  3SDZ A;  2FZC B;  3A8M B;  3I35 A;  4C92 A;  2JMA A;  2PVD B;  3OB9 A;  2DIG A;  1ZUU A;  1RLQ C;  3EGX B;  4LDW A;  1WYX A;  4WF2 A;  4EIK A;  4F14 A;  2XIC A;  3GIB A;  3LW5 E;  4X9C A;  3V8J A;  2YT6 A;  3H8Z A;  3EG3 A;  4JZ3 A;  2LJ3 A;  3GOX A;  3HSB A;  2XID A;  2PNI A;  5L23 A;  2DL3 A;  2DIL A;  2FZG B;  1KQ2 A;  2EBP A;  3JRZ A;  4HKE A;  3U23 A;  2YLC A;  4DBF A;  5I21 A;  1M3C A;  4JLG A;  3CC4 A;  1VQ7 Q;  1TH7 A;  1FXX A;  1VIF A;  3QZ9 B;  3QHS A;  1RAE B;  3RMQ A;  2CP3 A;  1Q86 C;  4DBQ A;  5GAN j;  3M59 A;  3NHN A;  2D9T A;  2RPN A;  1M90 R;  3MEV A;  1YCS B;  2FEI A;  4PJO A;  1NEG A;  3GNG A;  1D3B A;  3Q1J A;  2DTI A;  4M77 G;  3L2R A;  3SEM A;  2K7A A;  2FPE A;  4WTO B;  1TUC A;  4J5Y A;  2OJ2 A;  3CCJ T;  2RHI A;  1Q81 U;  3G71 A;  2V8K A;  4HCZ A;  1PCX A;  4JJB A;  4J6W A;  1QW1 A;  1Q82 R;  3OW2 P;  2LCL A;  2DNU A;  3DB4 A;  3CBO A;  5KE3 A;  2DYI A;  4FL6 A;  4BE1 A;  5IHK A;  3EFS A;  1QVG S;  2E6N A;  2K3Y A;  1VQK T;  1WGS A;  2SEM A;  1TOV A;  3ZEH A;  1WHJ A;  2K4Y A;  4Z88 A;  1YWO A;  1WQW A;  3E9F A;  3X28 B;  5CR2 A;  4PNO A;  1ZHI A;  1PWT A;  2DVJ A;  2M0O A;  2XHC A;  3OYG A;  1YI2 T;  4PJN A;  2CSQ A;  3CCJ Q;  1T0H A;  1YIJ T;  2O2O A;  2I2L A;  4XU1 A;  4EMK B;  3EH2 A;  4GY5 A;  2DLP A;  1A0N B;  4PFO A;  3HRU A;  3CCM A;  5GAM h;  2I0N A;  3RBB B;  4M4Z A;  1WHK A;  3CCR T;  1X75 C;  4F16 A;  5HY6 A;  1QCF A;  4R55 A;  1NBE B;  2P0P A;  1VQK Q;  2HAX A;  4OMM A;  5IAY A;  1UUE A;  2E4H A;  1MGQ A;  3OYB A;  4WCI A;  5GAN 7;  2MWP A;  1QCO A;  2KRS A;  1WDX A;  4QVZ A;  4UC4 A;  5A0L A;  3CBM A;  1UDL A;  3FJ5 A;  1N9R A;  1VQP T;  2DTH A;  4XTW A;  1YIJ Q;  2KQW A;  2LC4 A;  4J9E A;  3ASK A;  9ATC B;  1GCQ A;  3CBP A;  5LJ5 h;  5GAO p;  4HCK A;  4PKC C;  5KYY A;  1KG1 A;  2DL8 A;  1G83 A;  1BCO A;  3QUI A;  4M78 F;  1OV3 A;  3CCR Q;  4M7D B;  4F7U F;  5IHI A;  1VQO T;  3EGD A;  4C92 G;  4J8O A;  3CCL T;  1OOT A;  1ZSZ A;  4PLI A;  3JCM P;  1VQL A;  3CCU A;  2RQV A;  3CME A;  2AZV A;  3TCJ A;  2LX9 A;  2CSI A;  1Y96 B;  1VQ9 T;  1K4U S;  1ABO A;  1VQP Q;  3CCS A;  2J06 A;  5KYW A;  4LDU A;  1OPL A;  2KSS A;  2O4X A;  3BFM A;  3QDR B;  2OTJ T;  2DM1 A;  2KRM A;  1YJN A;  1PHT A;  2CZ1 B;  2EJG A;  3HRS A;  3VRY A;  1Y0M A;  2E10 A;  2GFA A;  3AT1 B;  4BI4 A;  1VQO Q;  1N27 A;  3OBW A;  3QYG B;  1KK7 A;  3GP8 A;  3INZ A;  2JTM A;  3CCL Q;  2JN0 A;  3EG1 A;  2IG0 A;  4PJO G;  1E6H A;  1KQS S;  2F2W A;  3H0H A;  4RKU E;  3QG1 A;  4RCC A;  3EGU A;  1IRE B;  2RJF A;  4OGE A;  1VQ9 Q;  1ZUK A;  2CS7 A;  3R6N A;  1H8K A;  2QG9 B;  2XU8 A;  2EQM A;  2V8J A;  2HKN A;  2BKD N;  2LMJ A;  4OB3 B;  4C8Q E;  1JXO A;  3JCM d;  1Y71 A;  1D0Y A;  2ZCF B;  2H8H A;  4LUE A;  4FYY B;  2DRM A;  1SPK A;  2JM8 A;  3LYI A;  5DLQ E;  5KYN A;  2QEX T;  1M8V A;  1XJW B;  2K9G A;  5CVI A;  1RI0 A;  1R8O B;  1YHQ Q;  4E7J A;  3CCQ T;  1JJ2 S;  2RI2 A;  4EMK C;  3OY9 A;  3H6Z A;  5CKF A;  3OYF A;  1VQ5 T;  3UAT A;  4P5N A;  3ULR B;  2LVM A;  3M5A A;  1PD1 A;  2QDY B;  2VC8 A;  3JB9 I;  4M75 B;  1GFC A;  5CKH A;  2HQX A;  3P8H A;  3QJ6 A;  2QXF A;  3QKJ A;  2VWF A;  3S3M A;  2RI3 A;  2JTF A;  3CPF A;  3OSV A;  3E1S A;  2CRE A;  1ZA1 B;  2A3L A;  3PIP A;  4DA4 A;  3HPW A;  2FRW A;  2CKK A;  3FC3 A;  4ZTJ A;  3VS2 A;  3O8V A;  4M78 A;  4IUT A;  4OMO A;  2QEX Q;  3I5R A;  1NEB A;  2FB7 A;  2RI5 A;  4RTU A;  2F5T X;  3CCQ Q;  2ABL A;  4BY6 B;  8ATC B;  4N0A C;  1VQ5 Q;  3V7C A;  3VS0 A;  3RKY A;  2HQE A;  2YRD A;  2G6F X;  1FMW A;  4LDY A;  2EFI A;  1SKU B;  4BAC A;  1GL5 A;  2KXD A;  3CC4 T;  4M7D C;  1N9S A;  1K0S A;  3HFN A;  2LX7 A;  2KAF A;  4MZT A;  2LQK A;  5GAM j;  2RJE A;  3RUX A;  1UHF A;  5D7U A;  3OMC A;  2C0O A;  1ACM B;  1FMK A;  4N4I A;  1B07 A;  2WSE E;  4FU6 A;  1JRI A;  1PNJ A;  1H3Z A;  4OMP A;  4A4F A;  4IUP A;  4Y28 E;  5A0D A;  3A98 A;  1QWF A;  4ESR A;  1NZ9 A;  1WHG A;  1WZO A;  1AD5 A;  1ZQ1 A;  1QP3 A;  2M16 A;  1HK9 A;  2FPF A;  3OBY A;  1X6O A;  2QGF B;  4OP0 A;  4M7D G;  2E70 A;  3G71 T;  1SHF A;  2HCK A;  3C0C A;  1HYO A;  2W10 A;  4HXJ A;  4GLK A;  1YWP A;  2PUO B;  4RTY A;  2HL5 C;  1UE9 A;  3CC4 Q;  2KY9 A;  4BB7 A;  2BUD A;  2YXY A;  1C0M A;  1B7T A;  2MOX A;  2KRN A;  2MF2 A;  5LJ5 j;  4QVC A;  2DF6 A;  2JTE A;  3MHX A;  2QAS A;  1D1B A;  1HD3 A;  2R57 A;  3PGG A;  2R5A A;  1MV3 A;  3PT9 A;  4FYW B;  4C0Z A;  2B86 A;  4RCB A;  5KCH A;  4C5I A;  1VUB A;  1K73 R;  2P0K A;  3OS2 A;  1IRX A;  3RR6 A;  1NYF A;  2H3J A;  1MV0 B;  4B9W A;  2CT4 A;  2M1H A;  4CC7 A;  2DEQ A;  3MPU B;  3ZFJ A;  3G71 Q;  1WHL A;  1OU8 A;  4RG2 A;  2KK4 A;  1AWO A;  1N5Z A;  2O01 E;  3NTH A;  4M77 B;  1YN8 A;  1UEC A;  1KC8 U;  2RA2 A;  2DK3 A;  3OYE A;  2COY A;  2EGC A;  2ZZD A;  4QQD A;  1D0Z A;  3CCM T;  2A28 A;  2VYT A;  2RQU A;  1WIE A;  1M1K U;  2EYZ A;  4EMG A;  2RK1 A;  3A8L B;  4JRI A;  5L8R E;  2VXF A;  2QDL A;  1EX4 A;  1KC8 R;  2LJ0 A;  3UDC A;  3M58 A;  2AIR B;  1TTH B;  3CC2 A;  1K9A A;  4OMQ A;  2HD0 A;  3MP1 A;  3JB9 H;  3JCM f;  4IKF A;  4F7U E;  1QP2 A;  4M75 C;  2YRV A;  1K8A C;  3QSU A;  4IUR A;  1U8R A;  2L0A A;  1RAH B;  1BYM A;  2NUP A;  2ZPF B;  3VYG A;  2JVV A;  5GAN d;  2R5M A;  2KE9 A;  2DX1 A;  2RM4 A;  3OYD A;  1QWE A;  1ZUY A;  3JCM J;  3CCM Q;  3S3N A;  2PU9 B;  4LE9 A;  2X35 A;  8AT1 B;  3MKD A;  4XQ3 A;  2IIM A;  4MML A;  4FW2 A;  4E2F B;  1GFD A;  2EPD A;  5D6Y A;  1BIA A;  1V76 A;  5HKC A;  1I5L A;  4AG2 C;  4BY6 C;  1LJO A;  2L3S A;  1OX8 A;  1YHQ A;  3I56 A;  4A4K A;  3V8L A;  5I22 A;  2D0N A;  1BBZ A;  4ATO A;  1VQL T;  3PMT A;  1GBR A;  2LJ1 A;  2K5I A;  3CME T;  4AMC A;  1H3H A;  2DJQ A;  3OQ5 A;  3M9Q A;  4C8Q D;  1BU1 A;  2AKL A;  3CCS T;  3EFO B;  3SWN A;  5LJ5 e;  3JCM X;  1S1N A;  1IHV A;  5GAN 6;  5KYU A;  1NLP C;  1M90 C;  1QVP A;  4E7Z A;  3QJY A;  1YJN T;  1G3T A;  4JPB W;  2DMO A;  2RJD A;  2XMF A;  5LJ3 e;  2O31 A;  3LLR A;  1QKW A;  3P8B B;  2GBQ A;  1SSH A;  2XKO C;  4J9D A;  1M3B A;  3NGP A;  5IN1 A;  4Z89 A;  3OYH A;  3G7Z A;  4RUG A;  4KH1 B;  3KBG A;  1VQL Q;  3CCU Q;  4AT1 B;  4TVR A;  1G3S A;  1PSF A;  3CME Q;  2EQJ A;  4PFZ A;  1Q82 C;  2M02 A;  2VGN A;  1SHG A;  4C8Q F;  1IGU A;  4Q5W A;  1AVZ C;  4C92 B;  3CCS Q;  1Q81 C;  3PVL A;  3MP8 A;  1Y7X A;  4FIB A;  1RL2 A;  1YJN Q;  4O5V A;  2MCN A;  2K3X A;  1UGS B;  2DVE A;  4AFQ C;  3BDU A;  1I4K 1;  2GNC A;  5CKB A;  4DQ2 A;  4FM4 B;  1VQ8 A;  1PSE A;  3G6E A;  2ZPG B;  3IQL A;  2RD1 A;  4M77 C;  4E7L A;  4J9F A;  2OTL A;  5GAO m;  4M77 E;  2RN8 A;  1NPR A;  3TQ7 P;  1M3A A;  1M90 U;  2E12 A;  5DLO A;  1WXT A;  1GCP A;  4CRI A;  3EGX A;  4PJO B;  1ZBX A;  3CCE A;  4ELZ C;  2E64 A;  2WSF E;  1PKS A;  1D3B B;  2DPP B;  4M7A G;  5CKE A;  2QGG A;  1VOM A;  4LNP A;  1SRL A;  4XAX B;  1LCK A;  5CCA A;  2RQR A;  2MAM A;  5GMK h;  3LX7 A;  3RDV A;  2JZ2 A;  1N8R U;  2GQI A;  1Q82 U;  3FJP A;  5I2M A;  1F1B B;  3G4S A;  1M1F A;  5KCO A;  1WJQ A;  3REA B;  3M0R A;  4DBH A;  1B34 B;  3VUB A;  4J9G A;  3OMG A;  4MDW A;  3TVT A;  1KFZ A;  3M57 A;  2MWO A;  1N8R R;  4KRT A;  2LT4 A;  1WI7 A;  2COZ A;  2Z0W A;  3OSS C;  1PRL C;  4OB2 B;  3DLM A;  3VS7 A;  4OMF B;  2Y4Y A;  4MZM A;  2MIO A;  4RTT A;  1MMA A;  2CH4 A;  4E7I A;  1QKX A;  5GAN f;  1Z9Q A;  2FL7 A;  3PFS A;  3O5Z A;  4KUD K;  3TEE A;  2HKQ B;  2EYX A;  2EQU A;  3E19 A;  3MP6 A;  2HDA A;  3EHQ A;  2F69 A;  4LDV A;  3JB9 D;  1OUL A;  1W2B P;  4FSS A;  4LN2 A;  3REB B;  3TU4 K;  1JU5 C;  1PG5 B;  1ZA2 B;  4JRK A;  4KGZ B;  1G8X A;  4E7H A;  4J9I A;  5GJV B;  2ROT A;  4M78 D;  2CYZ B;  4C8Q A;  1YIT A;  1RAA B;  1K0X A;  1QMC A;  1C1A A;  2FHD A;  4N4H A;  4XU3 A;  1UJ0 A;  5GMK l;  2EWN A;  4FYX B;  3M0S A;  3OW2 A;  3A8G B;  1U06 A;  2LQW A;  4F04 B;  1QVG P;  3OS0 A;  4OB1 B;  2CUD A;  1PKT A;  4C92 C;  3JB9 F;  2L5Q A;  2PZ1 A;  4EMK A;  3MET A;  4LUD A;  4X34 A;  3DKM A;  1JQQ A;  2QAZ A;  4HCC A;  1Q86 R;  4J9B A;  3LGL A;  5FU7 B;  2E3H A;  2K57 A;  2K2M A;  1QVF P;  2JM9 A;  4B9X A;  5GAN e;  4A4H A;  4AFU C;  1R0B G;  3EGD B;  1M5Q 1;  1OU9 A;  1W2B A;  2ZPI B;  3JAM E;  1FYN A;  4M75 F;  2J05 A;  1ZSZ B;  5FWC A;  2KVQ G;  3OS1 A;  5A2Q E;  4J6Y A;  4OB0 B;  3CC2 T;  1RAB B;  4R56 A;  1S72 A;  1EIF A;  2QQA A;  1RAC B;  5GAN 8;  2EYW A;  2V1Q A;  4PJO C;  1SF9 A;  3QPH A;  2GTO A;  1TU0 B;  3JCM h;  3KUF A;  1K9M R;  2L3P A;  1JO8 A;  5AYF A;  2AKK A;  2HEQ A;  3PE0 A;  3M4Y A;  1N6A A;  2F1L A;  4BUG A;  2VXE A;  2L89 A;  4PK4 A;  4Z8A A;  4AFS C;  3FIF A;  1QVG A;  1E7O A;  1H64 1;  1CSK A;  2GQV A;  2BE9 B;  3QWX X;  2VAS A;  4DOW A;  2BE7 D;  1G2B A;  4AFZ C;  1YHQ T;  3I56 T;  2ENM A;  3MCA B;  2GF7 A;  3CC2 Q;  2EAY A;  3D7S B;  1QVF A;  3VV0 A;  4FSX A;  4ME7 A;  2IPO B;  3JCM g;  4KUL A;  2NUT B;  4IUV A;  2DTO A;  3HTR A;  2LCS A;  1OZ3 A;  3BE3 A;  2J6K A;  5LJ5 d;  2JUF A;  2EGE A;  1VQ4 A;  1KHI A;  1X27 A;  2HMA A;  1GXI E;  1X69 A; 
#chains in the Genus database with same CATH homology
 4NL2 A;  2R57 A;  2LDM A;  3PGG A;  2R5A A;  5GMK m;  2QEX A;  3PT9 A;  4C0Z A;  1Y07 A;  2LTO A;  5LJ3 d;  4HT8 A;  4RCB A;  5KCH A;  4BD3 A;  1K8A U;  4C5I A;  1LNX A;  3C12 A;  3JCM c;  1QVF S;  1VUB A;  2P0K A;  3MEA A;  3OS2 A;  3CCQ A;  1YJW T;  1BKB A;  4KBM B;  4ZN3 A;  4M77 D;  4X9D A;  3CC7 A;  2H3J A;  2Y90 A;  1I81 A;  2DZ9 A;  2E6Z A;  2M9U A;  4B9W A;  2DZC A;  1FWZ A;  4M75 D;  1VQ5 A;  3X25 B;  2M1H A;  5GMK j;  4L6V 5;  1Q86 U;  2DXB A;  2DEQ A;  4VUB A;  3ZBD A;  3HFO A;  1VQ7 T;  3ZFJ A;  3BDL A;  1M4Z A;  2QQS A;  2P4T A;  5GAN 2;  3LH0 A;  1YJ9 A;  2Y4X A;  4C0F A;  3OYL A;  4RG2 A;  3FRN A;  3BW1 A;  3X20 B;  3SDZ A;  4C92 E;  2DO3 A;  2KK4 A;  2O01 E;  3A8M B;  3NTH A;  4M77 B;  4C92 A;  1KC8 U;  2RA2 A;  2DK3 A;  3OYE A;  4Y91 A;  2PVD B;  2DD5 A;  2RHY A;  2ZZD A;  4QQD A;  2X4X A;  3CCM T;  3OB9 A;  4C0D C;  2KDS A;  4C5E A;  3PIO A;  2DIG A;  2VYT A;  3DLL A;  1M1K U;  4LDW A;  4EMG A;  2RB6 A;  1BI1 A;  2RK1 A;  4WF2 A;  3X24 B;  2QA4 A;  2XIC A;  3A8O B;  2BIV A;  3A8L B;  3GIB A;  4JRI A;  3LW5 E;  4E47 A;  2DIQ A;  2LT1 A;  2VXF A;  4X9C A;  5L8R E;  3V8J A;  2AHJ B;  3H8Z A;  1K73 C;  3UDC A;  4JLI A;  3M58 A;  5CKD A;  2VGM A;  3GOX A;  2XID A;  3CC2 A;  3HSB A;  4M77 F;  2HD0 A;  3MP1 A;  3JB9 H;  1KQ2 A;  3JCM f;  3JRZ A;  4HKE A;  2YLC A;  3L42 A;  4IKF A;  3ER0 A;  5I21 A;  4M7A E;  4F7U E;  1QP2 A;  4JLG A;  3TRE A;  1VQ8 T;  4M75 C;  4C5H A;  5GAM g;  2YRV A;  5CAI A;  1K8A C;  3QII A;  3G6E T;  3JCM W;  4F7U A;  4EMH A;  3KXT A;  3CC4 A;  4IUR A;  3QSU A;  4HT9 A;  5FU7 C;  1U8R A;  1I8F A;  3RMS A;  1VIE A;  4M75 A;  1TH7 A;  2PVO B;  4C0G A;  4JRQ A;  1FXX A;  1K9M U;  1VIF A;  3QZ9 B;  1BYM A;  2E41 A;  3QHS A;  2OTL T;  2ZPF B;  3VYG A;  4KT0 E;  2JVV A;  1U1T A;  2O4X B;  2D6F A;  5GAN d;  3RMQ A;  3VKI A;  2R5M A;  4N0A A;  5GAN 5;  1Q86 C;  2R58 A;  3S6W A;  5GAN j;  3M59 A;  3F70 A;  2D9T A;  4PJO E;  3V8K A;  1OYX A;  2RM4 A;  2E65 A;  3OYD A;  3CCV A;  3MEV A;  5LJ3 h;  4M7D E;  3JCM J;  5GAN 3;  3S3O A;  5GAM d;  3S3N A;  2PU9 B;  4PJO A;  2X35 A;  3VU3 C;  2C06 A;  4M7D A;  4XQ3 A;  4MML A;  1KD1 C;  2CZ7 B;  3CCE T;  2XD0 A;  4L59 A;  4ZGE B;  3J7A F;  3GNG A;  1D3B A;  5D6Y A;  2L8D A;  2GCX A;  4ZGD B;  1BIA A;  1YBY A;  2DTI A;  3Q1J A;  4M77 G;  4XU0 A;  3L2R A;  5HKC A;  1KC8 C;  1I5L A;  2DD4 A;  4BY6 C;  1LJO A;  3M54 A;  3NFC A;  5D6W A;  1YHQ A;  4J5Y A;  4A4K A;  3P8D A;  3I56 A;  2G3R A;  2L3R A;  3V8L A;  1M1K C;  3CCJ T;  2RHI A;  3FLG A;  3G71 A;  1Q81 U;  4ATO A;  1VQM A;  1VQL T;  2V8K A;  3C94 A;  4HCZ A;  3PMT A;  5LJ5 g;  1KQS A;  3CXC S;  3CME T;  2K5I A;  1G5V A;  1Y96 A;  4J6W A;  4PLL A;  3G4S T;  4QQG A;  1QW1 A;  3OQ5 A;  2MMP A;  3M9Q A;  4C8Q D;  2LCL A;  4MMK A;  4JJN K;  3CCS T;  3DB4 A;  3RES A;  2RHU A;  3CBO A;  5KE3 A;  5M9O A;  2YHT A;  1M9S A;  3SWN A;  5LJ3 g;  5LJ5 e;  4A4G A;  5FRM A;  3JCM X;  2VUB A;  4FL6 A;  4BE1 A;  3EFS A;  1WPY A;  5GAN 6;  2K5F A;  1LOJ A;  3A8H B;  2QQB A;  1QVG S;  2E6N A;  2K3Y A;  1M90 C;  4NOY A;  1WGS A;  1QVP A;  1VQK T;  3QJY A;  1K73 U;  1YJN T;  1G3T A;  1YI2 A;  3QO3 A;  3ZEH A;  1YJW A;  5EG2 A;  3T9N A;  2F5K A;  2K4Y A;  2RJD A;  3E9F A;  1WQW A;  5LJ3 e;  4EPC A;  3LLR A;  4BI8 B;  3X28 B;  4HA8 A;  4JDS A;  4M7A D;  4LDX A;  5CR2 A;  5CQX A;  4PNO A;  3P8B B;  3JCM V;  3OYM A;  1ZHI A;  4Z02 A;  2M0O A;  2XHC A;  5GMK e;  3OYG A;  1YI2 T;  2XKO C;  3M53 A;  4LD9 K;  4II1 A;  2FYK A;  5IN1 A;  1VQ7 A;  3OYH A;  4MZP A;  4J7I A;  3G7Z A;  3HHT B;  2X4W A;  3GNF B;  3KBG A;  3L2W A;  1YIJ T;  1UGQ B;  3L1A A;  1JJ2 A;  2X4J A;  4TVR A;  1G3S A;  1PSF A;  5CIU A;  2I2L A;  4ELY C;  2EQJ A;  1UGR B;  2CZ0 B;  1Q82 C;  4MDX A;  2VGN A;  4XU1 A;  4C8Q F;  4Q5W A;  4EMK B;  4GY5 A;  3HRT A;  4M7A B;  2ZGW A;  1G3W A;  3GF5 A;  4C92 B;  3HRU A;  4C8Q C;  3CCM A;  1Q81 C;  5GAM h;  1IZ6 A;  2PUK B;  3MP8 A;  4RG8 A;  1KD1 U;  1NPP A;  3CCR T;  3EFR A;  1X75 C;  3CMA T;  5HY6 A;  3MEW A;  1Y7X A;  3VYH B;  4R55 A;  4FIB A;  1AHJ B;  2P0P A;  1RL2 A;  3V7S A;  2HAX A;  4O5V A;  1VQN T;  3RER A;  5IAY A;  2RO0 A;  2K3X A;  1MGQ A;  2DJZ A;  1UGS B;  3OYB A;  2DVE A;  3BDU A;  5GAN 7;  5LJ5 f;  2MWP A;  4E7K A;  1I4K 1;  3C4S A;  3DB3 A;  1YIT T;  4M7A F;  4C92 F;  1NE8 A;  2EKO A;  5FU6 B;  3OA6 A;  5CKB A;  4DQ2 A;  4FM4 B;  1VQ8 A;  4QVZ A;  4UC4 A;  5A0L A;  1PSE A;  3G6E A;  4M78 B;  3CBM A;  1UEB A;  5GAN g;  2ZPG B;  4XU2 A;  1N9R A;  2RD1 A;  4F7U B;  1VQP T;  5LJ3 f;  2DTH A;  4M77 C;  4XTW A;  5LL6 S;  4C8Q G;  4JS5 A;  4E7L A;  1NJI U;  5GAO m;  4M77 E;  2OTL A;  2KQW A;  2LC4 A;  1M1G A;  2VV5 A;  4HCB A;  4M77 A;  1NPR A;  3ASK A;  3URG A;  4M75 E;  3JCM b;  2XG8 D;  1M90 U;  2E12 A;  3QBY A;  3WVD B;  2LNV A;  3CBP A;  5LJ5 h;  5DLO A;  5GAO p;  4PKC C;  4CRI A;  1O75 A;  4OF1 A;  1KG1 A;  3RIR A;  3MEU A;  3J80 E;  4M78 F;  3QUI A;  3EAE A;  3WXM B;  4PJO B;  1ZBX A;  3CCE A;  5GAM e;  4M7D B;  4ELZ C;  3L2Q A;  2E64 A;  1V29 B;  4XTV A;  4F7U F;  2DAQ A;  3GLX A;  2WSF E;  1VQO T;  4XK8 E;  1D3B B;  2DPP B;  4BDY A;  4M7A G;  5CKE A;  4C92 G;  4JUV A;  4XAX B;  3RKX A;  5FRN A;  4J8O A;  5CCA A;  3CCL T;  3CD6 T;  2MAM A;  3OYI A;  3CCJ A;  2EQK A;  3CEY A;  1O9S A;  3LX7 A;  4PLI A;  2D0Q B;  5GMK h;  3CCU A;  2RK2 A;  3JCM P;  1VQL A;  2JZ2 A;  1N8R U;  3CME A;  2OTJ A;  3TCJ A;  4C5G A;  2LX9 A;  3FJP A;  5I2M A;  5J26 A;  3G4S A;  4ZN1 A;  1Q82 U;  4PJO F;  1M1F A;  3SD4 A;  1Y96 B;  5KCO A;  5HK3 A;  1VQ9 T;  1WJQ A;  2WAC A;  1OI1 A;  2LQ8 A;  3R6O A;  5A0G A;  3CCS A;  1B34 B;  3VUB A;  1S72 T;  4LDU A;  2KSS A;  2HBP A;  2O4X A;  3CCU T;  3OMG A;  4MDW A;  3BFM A;  1UB4 A;  3QDR B;  2OTJ T;  3M57 A;  1BIB A;  2MWO A;  3SWN B;  2LT4 A;  4J83 A;  4M78 G;  5GAO r;  3OSS C;  1VQK A;  4OB2 B;  2QQ9 A;  3FB9 A;  1YJN A;  3AHU A;  3DLM A;  4J7F A;  4F7U G;  2CZ1 B;  2RHX A;  3JB9 J;  1NJI C;  2EJG A;  3HRS A;  4OMF B;  2Y4Y A;  2XDB A;  4MZM A;  1WNL A;  2E10 A;  4QQ6 A;  4RMO A;  2GFA A;  2XDP A;  4BE2 A;  4BI4 A;  1N27 A;  3OBW A;  1WQ7 A;  3QYG B;  4ZGJ B;  5GAN f;  4E7I A;  3PFS A;  2FL7 A;  3GP8 A;  4KUD K;  3INZ A;  3TEE A;  2JTM A;  1XNI A;  1XOV A;  2JN0 A;  1BI3 A;  2XI9 A;  2IG0 A;  4PJO G;  3A5Z B;  1KQS S;  3C95 A;  1YIJ A;  2EQU A;  3E19 A;  4XTY A;  4C92 D;  4RKU E;  5GAM f;  4N4G A;  3QG1 A;  1KQ1 A;  3HL8 A;  3MP6 A;  4RCC A;  1Q7Y U;  2F69 A;  1IRE B;  4LDV A;  2RJF A;  3VJP A;  1BI0 A;  3N5B B;  4A54 A;  4J6X A;  1X01 A;  3JB9 D;  1JBM A;  1VQ6 A;  4QVD A;  4OGE A;  1SSF A;  2CS7 A;  1XTD A;  4NL3 A;  3CPW A;  3ME9 A;  2XU8 A;  3QYH B;  2EQM A;  3CCR A;  1N8R C;  5GAN h;  2V8J A;  3TU4 K;  3CMA A;  2EYQ A;  5KE2 A;  4JRK A;  3HKS A;  5FLX E;  1G3Y A;  2X4Y A;  4E7H A;  4FT4 A;  2BKD N;  2EIF A;  3OYA A;  2LRQ A;  3HP9 A;  3L2Z A;  3I55 T;  1VQN A;  4OB3 B;  4C8Q E;  5KH6 A;  3JCM d;  1UGP B;  1Y71 A;  4NS5 A;  3UPU A;  2ZCF B;  4M78 D;  1VQ4 T;  2CYZ B;  4C8Q A;  5LJ3 j;  5CK9 A;  1YIT A;  2JNG A;  4LD6 A;  3LYI A;  5DLQ E;  1VQ6 T;  2DKG A;  2QQR A;  4V2S A;  4C0D B;  1OZ2 A;  2FHD A;  4IUQ A;  4N4H A;  4OGC A;  2QEX T;  1M8V A;  2EJ9 A;  5CVI A;  3OYK A;  4XU3 A;  1RI0 A;  1R8O B;  4XTZ A;  3CPW S;  5GMK l;  2EWN A;  4E7J A;  3CCQ T;  2GFU A;  1VQP A;  1MHN A;  3OW2 A;  2JOY A;  3A8G B;  4IUU A;  1JJ2 S;  1WJR A;  3CC7 T;  3PNW C;  2RI2 A;  4EMK C;  3OY9 A;  3OYN A;  4M7A C;  3OS0 A;  3H6Z A;  3L2V A;  4OB1 B;  5CKF A;  3OYF A;  4C92 C;  1VQ5 T;  3JB9 F;  3QXE B;  2L5Q A;  4P5N A;  5CQY A;  2EJF A;  2LVM A;  4EMK A;  5J39 A;  3MET A;  4PJO D;  5GAN 4;  2ZPH B;  3M5A A;  3DKM A;  1P92 A;  4X34 A;  3LWI A;  4BDZ A;  2QDY B;  4M7A A;  4BE0 A;  4M7D D;  2LCC A;  4HCC A;  2VC8 A;  3OS5 A;  3MO8 A;  4L5G A;  3RKW A;  3NTK A;  3JB9 I;  3X26 B;  4EDU A;  1WJS A;  4M75 B;  2PQW A;  1YJ9 T;  5CKH A;  3LGL A;  2HQX A;  3P8H A;  4PL6 A;  5FU7 B;  1Q7Y C;  3QJ6 A;  2K57 A;  2QXF A;  3QKJ A;  5D6X A;  4B9X A;  2XDD A;  3S3M A;  5GAN e;  3J81 E;  2RI3 A;  2JTF A;  3NTI A;  1JB0 E;  2E1H A;  3SFM A;  1VQO A;  3CPF A;  2PVG B;  3OSV A;  3QZ5 B;  3E1S A;  2XK0 A;  4A4H A;  3M55 A;  5FU6 C;  4KUI A;  3CCL A;  2A3L A;  3PIP A;  3OW2 S;  1M5Q 1;  3HPW A;  4DA4 A;  3CD6 A;  2KMT A;  1W2B A;  5DY9 A;  2ZPI B;  2CKK A;  4M78 C;  3FC3 A;  3M56 A;  4ZTJ A;  4M78 E;  3JAM E;  2QA4 T;  2QTX A;  4M75 F;  3O8V A;  2KVQ G;  4IUT A;  4M78 A;  3JCM Q;  5GAO n;  4OVA A;  3OS1 A;  5DM7 R;  5A2Q E;  4J6Y A;  1VQ9 A;  4OB0 B;  2FVU A;  3SB2 A;  2FB7 A;  2RI5 A;  3JB9 G;  2F5T X;  3CC2 T;  3UT1 A;  3FDR A;  4O6J A;  4R56 A;  1S72 A;  1EIF A;  2A7Y A;  2K5L A;  4BY6 B;  2QQA A;  2ZPB B;  5GAN 8;  2DXC A;  4N0A C;  4XTU A;  5GAO q;  3PTA A;  3V7C A;  2DXT A;  1W4S A;  3RKY A;  2HQE A;  4M7D F;  3CXC A;  4LDY A;  2EFI A;  4A4E A;  4BAC A;  5GAO l;  4PJO C;  2IVW A;  3CC4 T;  1YCY A;  3QPH A;  4M7D C;  1DJ7 B;  2OAU A;  3OYY A;  1N9S A;  4CI0 C;  4JRP A;  3JCM h;  3KUF A;  1W2B S;  3HFN A;  5AYF A;  2KAF A;  4MZT A;  2K2V A;  2LQK A;  4QW2 A;  5J3B A;  5I2S A;  5GAM j;  3M4Y A;  2RJE A;  3FEO A;  3RUX A;  5FRO A;  3E9G A;  1N6A A;  4BUG A;  2VXE A;  2L89 A;  2NLU A;  3OMC A;  1U1S A;  3LWH A;  2DXU A;  3FIF A;  3L2U A;  3CCV T;  1QVG A;  4N4I A;  2WSC E;  2WSE E;  4FU6 A;  4M75 G;  4BI3 A;  1H64 1;  4YTL A;  1JRI A;  3VUZ A;  2E5Q A;  2ZPE B;  2YLB A;  1XQH A;  1H3Z A;  4DOV A;  4A4F A;  4IUP A;  2GQV A;  4Y28 E;  5A0D A;  5C6S A;  2RH2 A;  1NZ9 A;  2CZ6 B;  5CO7 A;  5IT9 E;  1ZQ1 A;  3BY7 A;  4DOW A;  4ZTF A;  3OYJ A;  1QP3 A;  2M16 A;  1HK9 A;  3OYC A;  2P0Q A;  3V7R A;  3UWN A;  1YHQ T;  5HK0 A;  3I56 T;  3OBY A;  1B34 A;  2GF7 A;  3MCA B;  1X6O A;  2EAY A;  4OP0 A;  1QVF A;  3JSC A;  3SWN C;  4M7D G;  2E70 A;  3VV0 A;  3G71 T;  2QI2 A;  4FSX A;  3LGF A;  4ME7 A;  4JS4 A;  1VQM T;  5C0M A;  3JCM g;  4KUL A;  2HNI A;  3WVE B;  4IUV A;  2DTO A;  4GLK A;  2PUO B;  1BI2 A;  1KHC A;  1OZ3 A;  2KY9 A;  4BB7 A;  2BUD A;  4XTX A;  3I55 A;  2V8I A;  5LJ5 d;  2JUF A;  2B8A A;  1K9M C;  4FT2 A;  4A53 A;  1HXD A;  1VQ4 A;  1FX7 A;  2MF2 A;  5LJ5 j;  1KHI A;  3GPL A;  2RHZ A;  4D6W A;  2RJC A;  3JCM e;  2CGH A;  4QVC A;  5GMK i;  1GXI E;  3PMI A;  4C8Q B;  2MI6 A;  3M4G A;  3MHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...