4LD9K

Crystal structure of the n-terminally acetylated bah domain of sir3 bound to the nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
214
structure length
210
Chain Sequence
AKTLKDLDGWQVIITDDQGRVIDDNNRRRRGGENVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIKIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The N-terminal acetylation of Sir3 stabilizes its binding to the nucleosome core particle.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Nuclear protein/transcription/dna
molecule keywords Histone H3.2
total genus 32
structure length 210
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ld9K00
4LD9K 1ZBXA 4FT2A 4DOWA 4BB7A 2FVUA 4JJNK 3PT9A 1ZHIA 4FT4A 2FL7A 4KULA 4KUDK 3PTAA 4DA4A 1M4ZA 4FSXA 4DOVA 3TU4K 1W4SA 4KUIA
chains in the Genus database with same CATH superfamily
2D1XA 2ECZA 3IQLA 4XTWA 1VQLT 4BDYA 1SSHA 2OAUA 2XD0A 2JM8A 2FL7A 3QKJA 1SHGA 2JMCA 3QPHA 4TVRA 3U23A 1KHCA 3EG2A 1YHQT 1V29B 2DILA 5GAN3 5GAMj 4JJCA 3CCLT 4XQ3A 3DLLA 3N5BB 2AK5A 3VYGA 2QQAA 1YITQ 3G6ET 4ZGEB 3LGFA 4KH1B 2O9SA 4QVCA 1VQNT 1X6BA 4Y92A 3RMSA 3FDRA 4F7UA 1VOMA 5GMKl 3CCVQ 3CCLA 1CKAA 1BKBA 2LJ0A 2FPDA 3VS5A 3OBWA 5I22A 2YUNA 1FMVA 5J26A 2VKNA 4MMKA 4JDSA 1JXOA 2DO3A 2JN0A 1UHFA 5IHNA 5LJ5d 3OBYA 4C0ZA 1N9RA 4ZGDB 3NHNA 1C0MA 1NBEB 3L2UA 1VQ5T 2QEXA 4FM4B 1K9MC 4KBMB 3TSZA 3G6EA 4DEYA 4FYXB 4J5YA 4RMOA 2E64A 3G71T 4LUEA 4LNPA 3J7AF 4C5EA 3THKA 5GAOm 4A4KA 5IXBA 3CCRQ 4JS4A 1D1BA 1VQMQ 2EQKA 3H6ZA 2LP5A 4Z89A 3CCVA 1WNLA 3EFSA 2DL5A 1G8XA 1AT1B 1BI0A 5DM7R 5KYNA 3M54A 5IT9E 1CKBA 1BIAA 4X1VA 3ER0A 1S1NA 3JCMe 1NE8A 2EGEA 1U06A 2KQWA 1N8RR 4MDXA 3JCMW 4KGZB 3TSWA 1Y96B 2KI7A 1JO8A 2L3SA 2WSFE 2QK0A 1RADB 2PQWA 2V26A 5I21A 5KYXB 1VQ8Q 4HCCA 3HRSA 1M1FA 1PD0A 3JCMh 3KBGA 4VUBA 4C92C 3ZL7C 2VASA 1AD5A 3PNWC 4OMNA 4CC2A 5GAN6 2JS0A 3JB9F 1KJWA 3MEUA 4M75C 1GCQC 5GAMd 1AWXA 1T0JA 4M7DA 2LJ3A 3OW2P 2EYWA 4FSSA 1ABOA 1CSKA 3CMEQ 5CKFA 1PCXA 1Y57A 1MMGA 3CCSA 1YJNQ 2DXBA 4M77G 2CZ1B 5FU7B 1KHIA 4M7DE 2F2XA 4OGCA 3OYFA 2R57A 1M3AA 3OYIA 1QVFP 2KROA 2EQIA 3UWNA 4C8QF 2RA2A 3M4GA 2QTXA 3L2QA 2QDYB 1OI1A 4XTVA 1IREB 3CEYA 4PLLA 4DOVA 1M8VA 1QKXA 2WSEE 2R5AA 2K5LA 2LQ8A 2KYBA 2LCSA 5IAYA 2EYQA 2EQUA 1YI2A 3BDLA 3LH5A 3MHXA 3CCLQ 5CVIA 1YBYA 2DERA 2ZPEB 1R0BG 1MMDA 2CP7A 1KQ1A 4EPCA 2KT1A 4FL6A 3E2UA 3SHWA 2AIRB 2KAFA 2VC8A 1O75A 2JZ2A 4XK8E 3EAEA 1SHFA 1WDXA 4M75D 2OTJT 5FWBA 3QG1A 5KCOA 1GRIA 2HBWA 1GCPA 2K9GA 5CO7A 1S72Q 1YITT 3EFRA 2KYMA 1IHVA 1RABB 1YWPA 2W10A 2L3RA 1VYUA 3REBB 2JS2A 4LDUA 3NFCA 2GTOA 3M0RA 4ZGJB 4AFSC 2HQXA 2EGCA 2GBQA 1VQPT 1D3BA 2RO0A 1SEMA 3CXCP 2K3BA 2RQUA 2P0KA 4NOYA 4L5GA 3J81E 3JCMg 3V7RA 2DBKA 1VQ4A 4D8DA 4X9CA 1H92A 1OQKA 1T3SA 4F7UE 3OS2A 4M7AE 2X4WA 3I56A 3QDFA 1D1AA 4PJOE 1GBQA 2FZCB 3LGLA 2K3XA 2J05A 4M77F 2DRKA 4PNOA 4WCIA 1K8AU 5L23A 4N4HA 2CP6A 5IXFA 2ZPFB 2PUOB 3X24B 3MEVA 3VS2A 3CCRT 2DTHA 3E9FA 1FYNA 2C06A 1C1AA 1VQMT 4M7AA 3H41A 2AT1B 1TH7A 1QVPA 1PHTA 2PTKA 4DEXA 1JXMA 2NYSA 4M75B 3GOXA 3ZBDA 1M27C 1KD1R 3QWXX 2JUFA 2LVMA 3GLXA 4C92F 1ZUUA 1TOVA 1Q7YR 3JSCA 2HDAA 1BI1A 3GNFB 3UDCA 2PVOB 4ELZC 2DD5A 4C8QD 1R8OB 1UFFA 1BU1A 2MMPA 4JS5A 4C5GA 1YHQQ 2QQSA 1TTHB 3D7SB 3VU3C 4XU1A 3CCMA 1D3BB 4PFPA 5HCKA 1WZOA 4YTLA 4P5NA 2DF6A 4Q5WA 2KR3A 1K73R 2QYZA 2A08A 4XU3A 1VQNA 2CZ0B 2L8DA 3EG9A 3PMTA 2YHTA 2FYKA 2QEXT 4E7ZA 3RIRA 4X9DA 1D0YA 4FYWB 1SSFA 1G3TA 2ATCB 3G71A 3FC3A 3M9QA 4OMMA 2CZ7B 2KSSA 2DM1A 4DBHA 5GAN7 4C8QB 4OP0A 2E41A 2PZ1A 1WGSA 3VV0A 1VQ4T 1PWTA 5GMKj 1X27A 4QQDA 1BI3A 1RI0A 2PNIA 1AEYA 4C92E 3OS0A 1MUZA 1OYXA 2LCCA 1SRMA 2D8JA 4XTYA 5IH2A 3CXCA 4HCBA 2D0QB 4C8QG 1AVZC 4J6WA 2OTJQ 5D6YA 2C0OA 3G71Q 1WIEA 4F7UG 3P8BB 4M75F 2O4XA 5IN1A 1OEBA 2XDDA 1MV3A 4ANJA 2CYZB 4M7DC 2BIVA 3M55A 1N8RU 4J7IA 1IB8A 4IUPA 5GAOq 1JBMA 2Y4XA 4FYVB 3T9NA 2M0YA 4C92A 4EMKA 2QASA 4L59A 1KC8R 3CD6A 1R0CB 1W2BA 2ZPHB 1D0XA 2MPXC 4OF1A 4M78F 1MGQA 1F1BB 2LX9A 1Z9ZA 2LTOA 2RI3A 3JB9G 3OYLA 1U1TA 2A28A 2EIFA 3SWNB 3AT1B 4Y91A 2XICA 2CS7A 2DNUA 1EFNA 1K9AA 4PK4A 3M56A 2Y4YA 2DJQA 2GQIA 4ORZA 4V2SA 1TS9A 3UF4A 1K8AC 5KE3A 4RG2A 5D6WA 2HAXA 4AFQC 2GNCA 2KY9A 1VQ9T 3QYHB 3CC2A 3QZ9B 1UGQB 3E19A 2FRYA 4OVAA 2DA9A 1DJ7B 2EJ9A 3ME9A 3A8HB 3TCJA 2MK5A 2RM4A 3CD6T 1RUWA 2GTJA 5LJ5e 2DIGA 3VJPA 4M7DD 2CGHA 4C0DB 1YIJQ 3M53A 4R55A 2RNAA 2DXCA 5GMKe 3H0IA 3HFOA 1YWOA 1TUGB 3CCJQ 2KDSA 5LJ5h 3DLMA 3PFSA 3JCMb 4BDZA 4KULA 2RJCA 3F70A 1NLOC 3G6EQ 2BUDA 4CI0C 4QQ6A 2QXFA 3KUFA 2YRVA 3VS7A 4GY5A 2DK3A 4M7AC 1U1SA 2KE9A 3X28B 2BE7D 5KYYB 3I55Q 5ECAA 3MP6A 1W2BS 4PFZA 3AHUA 2QGFB 4E7JA 1IGQA 4J9GA 1Q95G 3M0TA 3OMGA 2MYSA 2OX7A 3A8MB 1VQOT 5FROA 1Y96A 2YUOA 1T0HA 1XNIA 2AZVA 2QAZA 1ZUKA 7AT1B 2VXEA 3MKDA 3QSUA 2VVKA 2CUBA 1W70A 3HHTB 2HD0A 3HL8A 3BW1A 1M1KR 1QVFA 2KXDA 1YJWQ 1UGRB 2XK0A 2KBTA 3OS1A 1BI2A 2D6FA 1S72A 4BE2A 5GANf 3I55A 4IKFA 1TWBA 3PTAA 2HKQB 1TG0A 3QBYA 2X4YA 4KH0B 2OJ2A 4K11A 2KEAA 4ESRA 1SKUB 1K76A 2CP3A 4KGXB 3G1JA 4J9BA 4RTUA 3QO3A 3CCQA 1OZ3A 1H3ZA 1YI2T 3CC4T 1NZ9A 3SEMA 3MEWA 3EG9B 2DZ9A 3L42A 2YLCA 1OOTA 1ZSZC 4CC3A 4D6WA 1NJIR 4FU6A 1VQ4Q 4M7AD 4EMGA 4MZMA 2LZ6B 3WVEB 1QVGS 4E7KA 4M4ZA 1MMAA 2JM9A 3OQ5A 1VQKQ 3JB9H 2DXUA 1IRXA 3J80E 1BCOA 5KE2A 1UDLA 2MI6A 4LDYA 2HSPA 1ABQA 3CCUA 1ZA2B 2F5TX 1W2BP 2E5QA 2EJFA 2KRMA 3H0FA 3QXEB 4OMOA 4CRIA 1V1CA 2HZYA 3M4YA 2RK1A 4RUGA 1E6HA 5LJ3g 3RESA 1UECA 3FEOA 5GMKi 1QLYA 2DRMA 2M51A 3CMET 4HVWA 1SPKA 3TQ7P 4Z88A 4BY6B 2PVGB 1V76A 3S3MA 4FCYA 2B8AA 1H8KA 2MWOA 1YJNT 2HQEA 4XTUA 2DETA 1XTDA 2EWNA 2RH2A 4LDVA 3JCMd 1GCQA 1ZHIA 4JPBW 2DE0X 3OSSC 4AG1C 3X25B 3RR6A 2K57A 4XU0A 1UHCA 3CC2Q 2LT4A 4CC4B 5IHIA 5KYWA 4HKEA 4A4FA 4ATOA 4RKUE 4B6MA 2F5KA 4MMLA 2Y90A 3TU4K 1W4SA 2RB6A 4HT9A 2RHUA 2F2WA 1TUDA 2MWPA 1KFZA 3CCJT 3SWNC 2P4TA 5CCAA 4PJOC 3EH2A 2M02A 2LDMA 3CCEA 3TREA 2DVJA 5FLXE 1QVGP 4M7AF 5KCHA 2R5MA 1Y07A 4O5VA 2JTEA 2OAWA 1M90C 4C92D 3JCMX 2HSEB 3VYHB 3I35A 3CBMA 1QMCA 5C0MA 4PKCC 2FPEA 1QCFA 4PJOG 2M0OA 2CZ6B 2M9UA 3EHQA 3HKSA 2QA4T 1IXDA 1MNEA 4PJMA 4EIKA 1HYOA 1I4K1 3G7ZA 3NGPA 2CP0A 2GFUA 3I9QA 3CMAQ 5GAOr 3CPWP 3GNGA 1VYVA 1K9MR 2E12A 2YDLA 3M57A 4PLIA 2DEUA 1B34A 4Y28E 1K73U 1Y7XA 1AZGB 1Q82U 4XTZA 1PNJA 3L2ZA 1HD3A 1U8RA 2F1LA 2AKLA 3R6OA 4BUGA 3CCVT 2JJ9A 1LNXA 1NG2A 2CP2A 1YJWT 2BKDN 2QGGA 4BI4A 1A0NB 1PRMC 2M16A 5GAN4 4HCKA 1W1FA 2GF7A 4M75E 3JB9I 3BE3A 1RAEB 3I5RA 1OULA 1VQ7Q 1AWWA 3X26B 2JNGA 1OPKA 4LE9A 2QI2A 3RKXA 2J6FA 2OTLA 2K79A 2V1QA 1WXTA 4OMQA 3OW2S 1VQ9Q 3OYDA 2XG8D 5I2SA 1YI2Q 1AZEA 1RL2A 2D9TA 2FZGB 2BZYA 3S3OA 1OV3A 3PVQA 4AT1B 5CQYA 2KGTA 5GAN2 4N0AA 5HK0A 5GAMg 4RTVA 3ZFJA 3UA7A 2O4XB 4LDXA 5CKDA 2EAYA 3CCUQ 3RERA 1M3CA 1M1KU 4EDUA 1Q7YU 3EGXB 1GBRA 3M0PA 1PRLC 2E1HA 3CC7Q 1KC8C 2V8IA 3A8GB 4QW2A 3CPWS 4HXJA 4FYYB 1KSWA 5GAOp 4EMKC 1I1JA 3C4SA 2VXFA 1GFCA 2NUPA 3MP8A 3CPWA 1YP5A 1KIKA 3FLGA 2H8HA 2QA4A 1VQ6A 4DBRA 3I55T 1K0XA 3FB9A 4JZ4A 1WPYA 1K4US 2BE9B 1WHGA 2LQKA 4M78A 2KVQG 5DLQE 4X34A 1PD1A 3RNJA 3NPFA 3NTHA 3LWIA 4ME7A 4HVVA 5GAMf 2IVWA 2QQBA 5HKCA 5KYUA 1QCNA 1IZ6A 1YJNA 1KC8U 2X3XD 3V8LA 5CAIA 1OX9A 2LT1A 2L3PA 2DL4A 3QDRB 3ZEHA 1M90U 5GAMe 2QDLA 2YWWA 4J8OA 1E6GA 4PJJA 2CUDA 4M75A 4QT7A 1NEBA 4MZPA 1Q82C 2JTFA 2VGNA 1BBZA 3OYGA 1ACMB 1N27A 1HK9A 3JCMP 5GAMh 2DJZA 1QP3A 1OU9A 2RHZA 2KMTA 1Q81C 3CXCS 2L5QA 2YRCA 2X3WD 3RKYA 4IUUA 2JT4A 1BYMA 4Z02A 2K7AA 1ZUYA 2E65A 5J39A 1XQHA 3EGXA 4AFUC 1MHNA 4PJLA 2QA4Q 4EMHA 1X43A 1RAGB 3OYYA 1LVKA 1VIEA 2KK4A 2J6OA 4II1A 1VQ5Q 2BTTA 2KRNA 2EQJA 1VQMA 3C0CA 2FHDA 2HEQA 3Q1JA 2XMFA 3EG0A 5KYYA 2ROTA 4JJNK 2LQWA 2LX7A 4KRTA 2YT6A 4M78B 3BDUA 2DKGA 2LCLA 4JJDA 4JRKA 1Q86C 3HSBA 5CQXA 3OW2A 5GANj 2VGMA 2CSIA 2EKHA 3HRUA 2B86A 1N5ZA 2X4JA 3MEAA 3O5ZA 1M9SA 4M7AG 1UGSB 4M78E 2LMJA 1VQ7T 1I07A 2L89A 2ZCFB 1EZZB 3CMEA 1G3WA 2GQVA 2K2MA 4GLKA 3EG1A 1UG1A 3FJ5A 1VQ6T 4E7LA 1H3HA 2I2LA 1VQPQ 4JZ3A 2YRDA 2DZCA 2DXTA 1Z9QA 1M3BA 2O2OA 3E9GA 1I5LA 1FX7A 3DB3A 2YSQA 2K5FA 2LQNA 3L2WA 1N9SA 3GP8A 4F7UF 1VQ8T 2DFUA 1B34B 3QHSA 2DD4A 5GAOn 4J9FA 1Q7YC 2LC4A 2KRSA 2VUBA 1UJ0A 2E4HA 1SRLA 5EG2A 4ZTJA 2HCKA 1WFWA 1Q81U 1P92A 2L2PA 3PGGA 2CH4A 1LJOA 4HVUA 1M30A 1BB9A 3SWNA 1H641 1QCOA 2OTLQ 3DB4A 2L0AA 4PL6A 3OA6A 3PE0A 2XHCA 5FWCA 1VQ6Q 2SRCA 1OU8A 4JRIA 4QKUA 1UB4A 4A63B 4BD3A 3HPWA 4E2FB 2BZXA 1KG1A 3C95A 1JQQA 1LOJA 1KQSP 4R56A 1RAHB 1PSEA 2O01E 1JJ2P 4E7HA 1QWFA 1NJIU 1FWZA 4MDWA 3HP9A 2EVRA 4MZTA 2PU9B 4LN2A 3CCMQ 1WJRA 5AYFA 4AG2C 3OB9A 2G3RA 1KD1U 2KNBB 2RK2A 5I11A 4AMCA 4E47A 5C6SA 2RI5A 3MPUB 1M2OA 2K3YA 5HK3A 3GF5A 4KT0E 4ZN3A 1WHMA 2VYTA 2ZPIB 2F69A 2C0IA 4PJOF 1FMKA 3L2VA 1KK7A 3JCMf 2CP5A 3EFOA 2Z0WA 1G3YA 3G4SQ 4C92G 3SDZA 2HMAA 2RHXA 1GFDA 2A0FB 1XOVA 2MOXA 3CMAT 2GFAA 3QJ6A 2NUTA 1YN8A 1JJ2A 3CCMT 2CSQA 2KT8A 2XDBA 3A5ZB 4F04B 1YJ9Q 1RAFB 3L2RA 1OPLA 2J6KA 4J9DA 4C0DC 4DOWA 3S3NA 5IHKA 2K6DA 4QVZA 2EYZA 4N0AC 4IUVA 1I0CA 2DLPA 3EGDB 4JLIA 1K0SA 3PMIA 4AFZC 4A4GA 4M77E 3RMQA 1JU5C 4JRQA 1X01A 2RQTA 2A7YA 2RD1A 1S72T 2PVDB 3CPFA 1M90R 3M0UA 1WXBA 4M78D 4L6V5 4M77B 1M8MA 4OB3B 1VQ9A 2AHJB 3JAME 3VRYA 4J9CA 3KFVA 1R77A 1G2BA 3VS6A 1WX6A 3C12A 2X51A 3FJPA 2C0TA 4BY6C 1QQJA 1NPRA 1Y0MA 1UJYA 4LD6A 1QW1A 4NL3A 1K9MU 1VYTA 2LJ1A 1JB0E 2ENMA 3GBQA 3VUZA 3VS3A 4DQ2A 1YJWA 1KD1C 4J83A 1YCSB 3H8ZA 3EFOB 4J6XA 4PJNA 1WHHA 1QVGA 2YLBA 1AWJA 5GANd 2QTVA 1LCKA 3CCJA 4IIMA 3M58A 3DKMA 2EQMA 3CQTA 4ZN1A 1X2QA 4BI8B 2A36A 2OI3A 4F14A 5LJ5j 2JMAA 3OYHA 2DL3A 4IUQA 3SFMA 2YUPA 3MJXA 5J3BA 2MCNA 3JB9D 2EGAA 1X6OA 4J9EA 4BE1A 5GANg 2X4XA 4BB7A 2EKOA 3PIOA 1ZA1B 3GPLA 4M77A 2PUKB 1UGVA 2LNVA 1Y71A 1RAAB 3NTKA 5KYUB 1I8FA 2EPDA 1RLQC 1WXUA 3WXMB 5GMKh 5FW9A 1YITA 1M1KC 4D8KA 4M78G 2M1HA 2V8JA 4C5HA 3L1AA 3CCQQ 1BK2A 4BI3A 3EG3A 1I81A 5CKHA 5A0GA 1FMWA 4OMLA 5KYWB 2DBMA 1G3SA 4KUDK 1WJSA 1QKWA 3P8DA 5FU6C 2E5KA 2X35A 3V7SA 3SB2A 2XI9A 1VQKA 4M75G 2EJGA 1B07A 2YUQA 1VQOQ 1X69A 1JJ2S 2E10A 3MP1A 8AT1B 1RACB 3MCAB 4M77D 4J9HA 2P84A 3CC7A 1YFNA 2RHIA 2GGRA 1TU0B 2ZZDA 3X20B 2DPPB 4Z8AA 4JUVA 4OGEA 2ZGWA 1QVFS 3LW5E 4RCBA 1VUBA 1TSFA 3EGUA 5FU6B 5CR2A 1VIFA 2RPNA 2A37A 2P4RA 1VA7A 3HTRA 4JLGA 3UT1A 5DLOA 4PJOB 1G5VA 2ZAEA 1HSQA 1IHWA 3OS5A 5LJ3d 2I0NA 4GLMA 1UTIA 1ARKA 2RN8A 2O9VA 3RDVA 3EH1A 1NPPA 2CKKA 2J06A 2NLUA 3CC7T 1YJ9A 2VV5A 5D6XA 4KGVB 2LRQA 3VRZA 2EBPA 2EFIA 4FW2A 5L8RE 3BFMA 1RI9A 2DIQA 2OTLT 4HA8A 4WTOB 4JJBA 4M77C 3UPUA 3CD6Q 4C8QC 3BY7A 4F17A 2RJFA 2V1RA 5LL6S 5AT1B 3NTIA 3M5AA 2WACA 1G83A 3G4SA 2QQ9A 3OSVA 3VKIA 2E3IA 1YIJT 3M0SA 1UGPB 4A54A 5GAN5 3QZ5B 1Q86R 5LJ5f 1UEBA 2DTOA 3QJYA 4OMFB 2XDPA 1K1ZA 4RCCA 3OYJA 5KH6A 6AT1B 1LPLA 2F2VA 2XKOC 2ZPGB 4RTYA 3V7CA 5GANe 2XIDA 4J6YA 4C92B 3URGA 4JRPA 4GBQA 2ED0A 1EX4A 2EYXA 3EHRA 4RG8A 1W6XA 1PC0A 4XTXA 2EYYA 3UA6A 5GANh 3RUXA 4PJOA 3LYIA 2W0ZA 2QEXQ 4R0KA 4C8QA 3C94A 2COZA 1GL5A 1NLPC 1O9SA 2FRWA 2K2VA 4DBFA 4QQGA 2R58A 3O8VA 3META 3CC2T 3QIIA 2GCXA 1PKTA 3VS1A 3G4ST 4FIBA 4E7SA 2ESWA 1YIJA 1T3LA 1VQLQ 1QWEA 2RJEA 3RBBB 2K4YA 3JCMQ 5GJWB 3CC4A 2JTMA 4NS5A 2NUPB 2QQRA 3HFNA 2VB6A 1B3QA 2CT4A 3H9NA 1KQSA 2SEMA 1K73C 3VUBA 2V8KA 2XU8A 4KUIA 1HJDA 5FU7C 3OYNA 2ZPBB 2JOYA 3PIPA 5A0DA 1ZBXA 2E6ZA 3I56Q 4BE0A 1NJIC 1WQWA 1OX8A 2MAMA 3CBOA 1WYXA 3A8OB 5LJ3j 3LH0A 2H3JA 3CCQT 2RF0A 4A4HA 2YXYA 3WVDB 3MO8A 1YJ9T 2FEIA 4FSXA 1VQ7A 3OYKA 4WF2A 1VQNQ 1AWOA 4E7IA 4OB0B 3CC4Q 1WHKA 1RLPC 1ZSGA 1N8RC 2JW4A 1OZ2A 1MMNA 1AHJB 2J7IA 1Q81R 2BZ8A 3LX7A 1VQKT 4E6RA 2O31A 1ZSZA 1X6GA 3OYEA 1B7TA 1PSFA 1WJQA 2RJDA 2COWA 1WLPB 2VWFA 1JEGA 4M7AB 2E70A 4B9XA 1NEGA 2HL3A 1ZBJA 3OMCA 4EMKB 5GJVB 1JRIA 1WHJA 2DEQA 5CIUA 5FRMA 4A53A 1UE9A 4CC7A 3CCEQ 2IG0A 1TXQA 4ELYC 1HXDA 2KXCA 1NM7A 4FT2A 2DX1A 4C0FA 3KXTA 3VS0A 5A0LA 2IIMA 1X2KA 2JVVA 2E3HA 3VS4A 4UC4A 3M59A 5D7UA 3PVLA 2MIOA 4FW1A 3P8HA 4OB1B 4C8QE 5GAN8 1ZLMA 5KYXA 1VQ5A 4BACA 1IGUA 1ZQ1A 1BCMA 3EGDA 4RTZA 9ATCB 2RQWA 2CDTA 4N4IA 5CK9A 1YNZA 1YHQA 2A3LA 1D0ZA 5I2MA 2ABLA 1VQ8A 3CCUT 4N4GA 4XAXB 4IIOA 3JCMJ 4M7DF 2P0QA 3OYBA 1SG5A 2HNIA 2D8HA 3TVTA 2FZKB 4OB2B 3E1SA 2D0NA 1NYGA 3CCRA 2K5IA 4J9IA 1ZSZB 2FPFA 1PM3A 4LDWA 4RTXA 2CH4W 1IO6A 3CMAA 2FO0A 2H3EB 4C5IA 2RQVA 4C0GA 4PFOA 2DL8A 2CT3A 2ROLA 3OYAA 1J3TA 1M5Q1 3JRZA 3JB9J 1Q86U 3R6NA 2RI2A 4M7DG 4M7DB 3GIBA 4RTWA 4ZNXA 1M2VA 3LWHA 1U5SA 3HRTA 5M9OA 1GXIE 2DTIA 1MV0B 1WHLA 3OYMA 1WA7A 1YCYA 5DY9A 5CKEA 2X9HA 5GMKm 5FRNA 2RQRA 4LXCA 1I5OB 4QVDA 3REAB 1FXXA 1NYFA 2RMOA 1D1CA 2ED1A 3PT9A 2HBPA 1PG5B 8ATCB 1RAIB 2COYA 1XJWB 1WI7A 4F7UB 3I5SA 3SD4A 2HQHA 3ULRB 4LUDA 1K8AR 4O6JA 3I56T 5LJ5g 1WQ7A 2DL7A 4ZTFA 5LJ3h 3M0QA 2JXBA 4A4EA 4B9WA 2G6FX 2HL5C 3H0HA 4FT4A 4RTTA 1U3OA 3FIFA 3JV3A 2NUTB 3QWYA 3S6WA 2DYIA 3CCST 5LJ3e 4HCZA 3RKWA 2DVEA 2RHYA 3LLRA 1PKSA 4XU2A 2AKKA 2IPOB 1KQSS 1X75C 1MNDA 2DMOA 2EW3A 3A1PA 1C6VX 3JCMc 5LJ3f 2FVUA 2L3QA 1VQLA 3FRNA 4IURA 1D09B 3CBPA 1ZX6A 4J7FA 2MF2A 1VQPA 1UUEA 2QG9B 3V8JA 3V8KA 3INZA 1M2VB 3ASKA 1M4ZA 3CCET 4OMPA 2O88A 3A98A 5CKBA 3JCMV 1KQ2A 1QP2A 3TEEA 3QUIA 1AOJA 1E7OA 2AZSA 2NWMA 2HKNA 1BIBA 4HT8A 1VQOA 4M78C 4LD9K 3QYGB 1M1GA 3A8LB 4IUTA 2P0PA 4NL2A 3OYCA 2DAQA 4F16A 2FB7A 2NUZA 3CCSQ 4PJOD 5HY6A 1SF9A 4DBQA 1TUCA 3NMZC 4DA4A 2LNHB 2WSCE 3OY9A 2OTJA 5A2QE 1EIFA 5GAOl 2CREA 1N6AA 2FG0A 2DYBA 2E6NA 1Q82R 3UATA 5EC7A
chains in the Genus database with same CATH topology
3I55T 3FB9A 3M55A 3UT1A 1N8RU 1WPYA 4J7IA 5DLOA 4XTWA 1VQLT 4IUPA 5GAOq 1JBMA 2LQKA 4M78A 4PJOB 1G5VA 2KVQG 2Y4XA 4BDYA 5DLQE 2OAUA 4X34A 3T9NA 2XD0A 2FL7A 3NTHA 4C92A 4EMKA 3LWIA 3QKJA 4L59A 4ME7A 3OS5A 5GAMf 2IVWA 2QQBA 5LJ3d 5HKCA 3CD6A 1W2BA 2ZPHB 3QPHA 1IZ6A 1YJNA 4OF1A 1KC8U 4M78F 1MGQA 4TVRA 3V8LA 2LX9A 5CAIA 2LTOA 2LT1A 2RI3A 1KHCA 3OYLA 1U1TA 3JB9G 2EIFA 3QDRB 3ZEHA 3SWNB 1NPPA 1YHQT 1M90U 1V29B 2CKKA 4Y91A 2XICA 5GAMe 2CS7A 5GAN3 2NLUA 4J8OA 3M56A 5GAMj 3CC7T 4M75A 2Y4YA 4MZPA 1Q82C 1YJ9A 2VV5A 4V2SA 2JTFA 5D6XA 3CCLT 4XQ3A 2VGNA 2LRQA 3DLLA 3N5BB 3VYGA 3OYGA 1N27A 2QQAA 1HK9A 3G6ET 1K8AC 5KE3A 4ZGEB 5GAMh 3JCMP 2EFIA 4RG2A 5D6WA 2DJZA 2HAXA 1QP3A 2RHZA 3LGFA 2KMTA 5L8RE 1Q81C 2KY9A 3CXCS 3BFMA 2L5QA 2DIQA 4QVCA 2OTLT 1VQNT 3RKYA 4HA8A 1VQ9T 4IUUA 3RMSA 4M77C 3UPUA 3FDRA 3QYHB 4C8QC 3CC2A 3QZ9B 3BY7A 2RJFA 4F7UA 1UGQB 5GMKl 3E19A 4Z02A 3CCLA 1BYMA 4OVAA 5LL6S 1BKBA 1DJ7B 1XQHA 2E65A 2EJ9A 5J39A 3ME9A 3NTIA 3M5AA 2WACA 3G4SA 1MHNA 2QQ9A 3OSVA 3VKIA 1YIJT 4A54A 1UGPB 3A8HB 3OBWA 3QZ5B 3TCJA 5GAN5 5LJ5f 1UEBA 2DTOA 2RM4A 3QJYA 4OMFB 4EMHA 3CD6T 5J26A 2XDPA 4RCCA 3OYJA 5KH6A 4JDSA 4MMKA 3OYYA 2DO3A 2JN0A 2XKOC 2ZPGB 1VIEA 3V7CA 5GANe 2KK4A 2XIDA 5LJ5e 2DIGA 4J6YA 3VJPA 2CGHA 4II1A 4C0DB 4M7DD 5LJ5d 3M53A 4R55A 4C92B 3OBYA 3URGA 2EQJA 1VQMA 4C0ZA 2FHDA 4JRPA 1N9RA 4ZGDB 2DXCA 3Q1JA 5GMKe 4RG8A 3L2UA 3HFOA 4XTXA 4JJNK 1VQ5T 2QEXA 5GANh 4FM4B 2KDSA 4M78B 3RUXA 3LYIA 3DLMA 5LJ5h 3PFSA 3JCMb 4BDZA 1K9MC 3BDUA 4KULA 4KBMB 2DKGA 2RJCA 3F70A 2LCLA 4C8QA 3C94A 3G6EA 4JRKA 1Q86C 3HSBA 5CQXA 3OW2A 2BUDA 5GANj 2VGMA 1O9SA 4J5YA 4CI0C 4QQ6A 2K2VA 2QXFA 3KUFA 4RMOA 2YRVA 4QQGA 4GY5A 2E64A 3HRUA 3G71T 2R58A 3O8VA 3META 2DK3A 2X4JA 3MEAA 3CC2T 3J7AF 1U1SA 3QIIA 4M7AC 1M9SA 4M7AG 1UGSB 3X28B 2GCXA 4C5EA 4M78E 1VQ7T 2L89A 2ZCFB 3MP6A 3CMEA 1W2BS 5GAOm 4A4KA 3G4ST 1G3WA 2GQVA 4FIBA 4GLKA 1YIJA 3AHUA 4E7JA 4JS4A 2EQKA 3H6ZA 2RJEA 1VQ6T 2K4YA 3OMGA 3JCMQ 3CCVA 4E7LA 3A8MB 1VQOT 2I2LA 3CC4A 2JTMA 1WNLA 2DZCA 4NS5A 1Y96A 2DXTA 3EFSA 5FROA 2QQRA 3E9GA 3HFNA 1XNIA 1BI0A 1KQSA 1I5LA 1FX7A 1K73C 5DM7R 3M54A 2VXEA 2V8KA 2XU8A 3VUBA 3QSUA 3DB3A 4KUIA 5IT9E 1BIAA 3HHTB 2HD0A 5FU7C 3OYNA 2K5FA 3L2WA 3HL8A 2ZPBB 1N9SA 3ER0A 2JOYA 4F7UF 3PIPA 3GP8A 3BW1A 5A0DA 1ZBXA 3JCMe 1VQ8T 1QVFA 1B34B 1NE8A 2E6ZA 3QHSA 4BE0A 2KQWA 1UGRB 2XK0A 3JCMW 2DD4A 4MDXA 5GAOn 1Y96B 3OS1A 1Q7YC 1NJIC 1WQWA 1BI2A 2LC4A 2WSFE 2VUBA 2D6FA 1S72A 4BE2A 5GANf 2PQWA 5EG2A 2MAMA 4ZTJA 5I21A 3I55A 3CBOA 3A8OB 4IKFA 4HCCA 5LJ3j 3PTAA 3LH0A 3HRSA 3QBYA 2X4YA 1M1FA 1P92A 2H3JA 3CCQT 4A4HA 1Q81U 3PGGA 3JCMh 3KBGA 4VUBA 3WVDB 3MO8A 1YJ9T 1LJOA 4FSXA 4C92C 3PNWC 1VQ7A 3OYKA 3SWNA 4WF2A 1H641 5GAN6 4E7IA 3JB9F 3DB4A 4OB0B 3MEUA 4PL6A 4M75C 3OA6A 2XHCA 5GAMd 4JRIA 4M7DA 3QO3A 1UB4A 3CCQA 1N8RC 4BD3A 3HPWA 1OZ3A 1OZ2A 1YI2T 1H3ZA 3C95A 1KG1A 1LOJA 3CC4T 1NZ9A 3MEWA 5CKFA 2DZ9A 3L42A 4R56A 1AHJB 1PSEA 2O01E 2YLCA 4D6WA 4E7HA 1NJIU 4FU6A 4M7AD 1FWZA 3LX7A 1VQKT 3CCSA 4MDWA 4EMGA 4MZMA 2DXBA 4M77G 3WVEB 2CZ1B 3HP9A 3OYEA 5FU7B 1KHIA 1PSFA 1WJQA 4MZTA 2RJDA 4M7DE 2PU9B 1QVGS 4OGCA 1WJRA 3OYFA 4E7KA 5AYFA 2R57A 3OYIA 4M7AB 3OQ5A 2E70A 3JB9H 2DXUA 4B9XA 3J80E 3OB9A 3UWNA 2G3RA 5KE2A 1KD1U 2RK2A 4C8QF 4JLGA 2RA2A 2MI6A 3M4GA 3OMCA 4LDYA 4E47A 5C6SA 2RI5A 2QTXA 4EMKB 3L2QA 2QDYB 3CCUA 1JRIA 2K3YA 5HK3A 3GF5A 4KT0E 2DEQA 2F5TX 5CIUA 1OI1A 4ZN3A 2E5QA 4XTVA 4A53A 5FRMA 2VYTA 2EJFA 1IREB 2F69A 2ZPIB 3CEYA 3QXEB 4PLLA 4CRIA 4DOVA 1M8VA 4PJOF 3M4YA 2WSEE 2R5AA 2K5LA 2IG0A 2LQ8A 2RK1A 5IAYA 3L2VA 4ELYC 5LJ3g 1HXDA 3RESA 3JCMf 2EYQA 2EQUA 4FT2A 1YI2A 3BDLA 4C0FA 3KXTA 3MHXA 1G3YA 5A0LA 5CVIA 1YBYA 2JVVA 3FEOA 4C92G 5GMKi 2ZPEB 4UC4A 3SDZA 2RHXA 1KQ1A 3M59A 4EPCA 4FL6A 3CMET 1XOVA 3P8HA 4OB1B 4C8QE 5GAN8 4BY6B 2PVGB 3S3MA 3CMAT 2GFAA 2KAFA 3QJ6A 2VC8A 2B8AA 1O75A 2JZ2A 1VQ5A 4BACA 4XK8E 2MWOA 1ZQ1A 3EAEA 3CCMT 1YJNT 1JJ2A 2HQEA 4M75D 2XDBA 3A5ZB 2OTJT 3QG1A 4XTUA 5CK9A 4N4IA 1VQ6A 3L2RA 5KCOA 1YHQA 1XTDA 4C0DC 2EWNA 2RH2A 4LDVA 4DOWA 3S3NA 5CO7A 3JCMd 1ZHIA 2A3LA 1YITT 3EFRA 3OSSC 5I2MA 4QVZA 3X25B 2K57A 4N0AC 4IUVA 4XU0A 2L3RA 4JLIA 1VQ8A 3CCUT 3PMIA 2LT4A 4M77E 4N4GA 4A4GA 4HKEA 3RMQA 4A4FA 4JRQA 1X01A 4RKUE 4XAXB 4ATOA 4LDUA 2A7YA 2RD1A 3NFCA 2F5KA 3JCMJ 1S72T 2P0QA 4M7DF 3OYBA 2PVDB 2HNIA 3CPFA 4MMLA 4M78D 4L6V5 4OB2B 4ZGJB 2Y90A 4M77B 3TU4K 1W4SA 2RB6A 4HT9A 4PJOA 4OB3B 2RHUA 3E1SA 1VQ9A 2HQXA 2AHJB 2MWPA 3JAME 3CCJT 1VQPT 3SWNC 2P4TA 2RO0A 1D3BA 2K5IA 5CCAA 3CCRA 4PJOC 2LDMA 3CCEA 3TREA 3C12A 4LDWA 3CMAA 2P0KA 4NOYA 3FJPA 4L5GA 3J81E 3JCMg 4C5IA 3V7RA 4BY6C 5FLXE 1VQ4A 4C0GA 1NPRA 4X9CA 4M7AF 4LD6A 5KCHA 1QW1A 2R5MA 4NL3A 1K9MU 3OYAA 1Y07A 1JB0E 1M5Q1 4O5VA 3VUZA 4F7UE 1M90C 3JRZA 3OS2A 3JB9J 1Q86U 4M7AE 2X4WA 4C92D 4DQ2A 3JCMX 2RI2A 3I56A 1YJWA 4J83A 3VYHB 1KD1C 3H8ZA 3GIBA 4M7DG 4M7DB 4PJOE 3CBMA 3LGLA 3LWHA 3HRTA 5M9OA 5C0MA 2K3XA 4M77F 4PKCC 2DTIA 1GXIE 4PNOA 3OYMA 4J6XA 4PJOG 2M0OA 1YCYA 2CZ6B 2M9UA 1K8AU 5DY9A 5CKEA 3HKSA 4N4HA 5GMKm 2QA4T 1QVGA 5FRNA 2YLBA 2ZPFB 2PUOB 3X24B 1I4K1 3G7ZA 5GANd 2GFUA 3MEVA 4QVDA 3CCJA 5GAOr 3CCRT 2DTHA 3E9FA 3M58A 1FXXA 3GNGA 2C06A 3DKMA 2E12A 1VQMT 3M57A 4M7AA 4PLIA 2EQMA 1TH7A 1B34A 1QVPA 3PT9A 4ZN1A 4Y28E 1K73U 1Y7XA 4M75B 1Q82U 2HBPA 4XTZA 4BI8B 3L2ZA 3GOXA 3ZBDA 1U8RA 2OTJA 2JUFA 2LVMA 3GLXA 4C92F 4F7UB 3R6OA 4BUGA 5LJ5j 3OYHA 3CCVT 3SD4A 3JSCA 4IUQA 3SFMA 1BI1A 3GNFB 3UDCA 2PVOB 5J3BA 4O6JA 2DD5A 4ELZC 1LNXA 4C8QD 1R8OB 3I56T 1YJWT 2BKDN 2MMPA 1WQ7A 4BI4A 4C5GA 5LJ5g 4JS5A 3JB9D 2M16A 2QQSA 5GAN4 4ZTFA 1X6OA 2GF7A 4M75E 5LJ3h 4BE1A 5GANg 2X4XA 4BB7A 4A4EA 2EKOA 3VU3C 4B9WA 3PIOA 4XU1A 3CCMA 3JB9I 3GPLA 1D3BB 4M77A 2PUKB 4FT4A 3X26B 2JNGA 4YTLA 2LNVA 4P5NA 3FIFA 1Y71A 4Q5WA 3NTKA 2QI2A 1I8FA 4XU3A 3RKXA 2OTLA 2CZ0B 2L8DA 1VQNA 3WXMB 5GMKh 3S6WA 3PMTA 3CCST 5LJ3e 2YHTA 1YITA 2FYKA 2QEXT 1M1KC 4HCZA 3RKWA 2DVEA 3OW2S 4M78G 2M1HA 2V8JA 4C5HA 2RHYA 3RIRA 3OYDA 3L1AA 2XG8D 4X9DA 3LLRA 4XU2A 5I2SA 4BI3A 1KQSS 1X75C 1I81A 1RL2A 1SSFA 5CKHA 1G3TA 2FVUA 5LJ3f 3JCMc 2D9TA 5A0GA 3S3OA 3G71A 1VQLA 3FRNA 4IURA 3CBPA 5CQYA 4J7FA 2MF2A 3FC3A 1VQPA 3M9QA 1G3SA 3V8JA 4KUDK 3V8KA 1WJSA 2CZ7B 3P8DA 3INZA 5FU6C 2KSSA 2X35A 5GAN2 4N0AA 3V7SA 3ASKA 5HK0A 1M4ZA 3CCET 5GAN7 5GAMg 5CKBA 3JCMV 3SB2A 2XI9A 1KQ2A 3ZFJA 1QP2A 4C8QB 1VQKA 2O4XB 4M75G 4OP0A 3TEEA 3QUIA 2E41A 2EJGA 4LDXA 5CKDA 1BIBA 2EAYA 1WGSA 3VV0A 1VQ4T 4HT8A 1VQOA 1JJ2S 3RERA 4M78C 4LD9K 3QYGB 1M1GA 1M1KU 4EDUA 3A8LB 2E10A 5GMKj 4IUTA 3MP1A 1Q7YU 2P0PA 4QQDA 4NL2A 1BI3A 1RI0A 2DAQA 2E1HA 3MCAB 4M77D 3OYCA 4C92E 2FB7A 3OS0A 1OYXA 2LCCA 3CC7A 2RHIA 1KC8C 2V8IA 4XTYA 4PJOD 2ZZDA 3A8GB 4QW2A 5HY6A 3X20B 2DPPB 3CPWS 4JUVA 4OGEA 3CXCA 2ZGWA 2D0QB 4C8QG 4HCBA 5GAOp 4J6WA 4EMKC 4DA4A 1QVFS 3C4SA 2VXFA 2WSCE 3LW5E 4RCBA 5D6YA 4F7UG 3OY9A 1VUBA 3P8BB 3MP8A 4M75F 5A2QE 1EIFA 2O4XA 3CPWA 5FU6B 5GAOl 5CR2A 1VIFA 5IN1A 2XDDA 1N6AA 3FLGA 2E6NA 4M7DC 2QA4A 2BIVA 2CYZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LD9 K;  1ZBX A;  4FT2 A;  4DOW A;  4BB7 A;  2FVU A;  4JJN K;  3PT9 A;  1ZHI A;  4FT4 A;  2FL7 A;  4KUL A;  4KUD K;  3PTA A;  4DA4 A;  1M4Z A;  4FSX A;  4DOV A;  3TU4 K;  1W4S A;  4KUI A; 
#chains in the Genus database with same CATH topology
 2D1X A;  2ECZ A;  3IQL A;  4XTW A;  1VQL T;  4BDY A;  1SSH A;  2OAU A;  2XD0 A;  2JM8 A;  2FL7 A;  3QKJ A;  1SHG A;  2JMC A;  3QPH A;  4TVR A;  3U23 A;  1KHC A;  3EG2 A;  1YHQ T;  1V29 B;  2DIL A;  5GAN 3;  5GAM j;  4JJC A;  3CCL T;  4XQ3 A;  3DLL A;  3N5B B;  2AK5 A;  3VYG A;  2QQA A;  1YIT Q;  3G6E T;  4ZGE B;  3LGF A;  4KH1 B;  2O9S A;  4QVC A;  1VQN T;  1X6B A;  4Y92 A;  3RMS A;  3FDR A;  4F7U A;  1VOM A;  5GMK l;  3CCV Q;  3CCL A;  1CKA A;  1BKB A;  2LJ0 A;  2FPD A;  3VS5 A;  3OBW A;  5I22 A;  2YUN A;  1FMV A;  5J26 A;  2VKN A;  4MMK A;  4JDS A;  1JXO A;  2DO3 A;  2JN0 A;  1UHF A;  5IHN A;  5LJ5 d;  3OBY A;  4C0Z A;  1N9R A;  4ZGD B;  3NHN A;  1C0M A;  1NBE B;  3L2U A;  1VQ5 T;  2QEX A;  4FM4 B;  1K9M C;  4KBM B;  3TSZ A;  3G6E A;  4DEY A;  4FYX B;  4J5Y A;  4RMO A;  2E64 A;  3G71 T;  4LUE A;  4LNP A;  3J7A F;  4C5E A;  3THK A;  5GAO m;  4A4K A;  5IXB A;  3CCR Q;  4JS4 A;  1D1B A;  1VQM Q;  2EQK A;  3H6Z A;  2LP5 A;  4Z89 A;  3CCV A;  1WNL A;  3EFS A;  2DL5 A;  1G8X A;  1AT1 B;  1BI0 A;  5DM7 R;  5KYN A;  3M54 A;  5IT9 E;  1CKB A;  1BIA A;  4X1V A;  3ER0 A;  1S1N A;  3JCM e;  1NE8 A;  2EGE A;  1U06 A;  2KQW A;  1N8R R;  4MDX A;  3JCM W;  4KGZ B;  3TSW A;  1Y96 B;  2KI7 A;  1JO8 A;  2L3S A;  2WSF E;  2QK0 A;  1RAD B;  2PQW A;  2V26 A;  5I21 A;  5KYX B;  1VQ8 Q;  4HCC A;  3HRS A;  1M1F A;  1PD0 A;  3JCM h;  3KBG A;  4VUB A;  4C92 C;  3ZL7 C;  2VAS A;  1AD5 A;  3PNW C;  4OMN A;  4CC2 A;  5GAN 6;  2JS0 A;  3JB9 F;  1KJW A;  3MEU A;  4M75 C;  1GCQ C;  5GAM d;  1AWX A;  1T0J A;  4M7D A;  2LJ3 A;  3OW2 P;  2EYW A;  4FSS A;  1ABO A;  1CSK A;  3CME Q;  5CKF A;  1PCX A;  1Y57 A;  1MMG A;  3CCS A;  1YJN Q;  2DXB A;  4M77 G;  2CZ1 B;  5FU7 B;  1KHI A;  4M7D E;  2F2X A;  4OGC A;  3OYF A;  2R57 A;  1M3A A;  3OYI A;  1QVF P;  2KRO A;  2EQI A;  3UWN A;  4C8Q F;  2RA2 A;  3M4G A;  2QTX A;  3L2Q A;  2QDY B;  1OI1 A;  4XTV A;  1IRE B;  3CEY A;  4PLL A;  4DOV A;  1M8V A;  1QKX A;  2WSE E;  2R5A A;  2K5L A;  2LQ8 A;  2KYB A;  2LCS A;  5IAY A;  2EYQ A;  2EQU A;  1YI2 A;  3BDL A;  3LH5 A;  3MHX A;  3CCL Q;  5CVI A;  1YBY A;  2DER A;  2ZPE B;  1R0B G;  1MMD A;  2CP7 A;  1KQ1 A;  4EPC A;  2KT1 A;  4FL6 A;  3E2U A;  3SHW A;  2AIR B;  2KAF A;  2VC8 A;  1O75 A;  2JZ2 A;  4XK8 E;  3EAE A;  1SHF A;  1WDX A;  4M75 D;  2OTJ T;  5FWB A;  3QG1 A;  5KCO A;  1GRI A;  2HBW A;  1GCP A;  2K9G A;  5CO7 A;  1S72 Q;  1YIT T;  3EFR A;  2KYM A;  1IHV A;  1RAB B;  1YWP A;  2W10 A;  2L3R A;  1VYU A;  3REB B;  2JS2 A;  4LDU A;  3NFC A;  2GTO A;  3M0R A;  4ZGJ B;  4AFS C;  2HQX A;  2EGC A;  2GBQ A;  1VQP T;  1D3B A;  2RO0 A;  1SEM A;  3CXC P;  2K3B A;  2RQU A;  2P0K A;  4NOY A;  4L5G A;  3J81 E;  3JCM g;  3V7R A;  2DBK A;  1VQ4 A;  4D8D A;  4X9C A;  1H92 A;  1OQK A;  1T3S A;  4F7U E;  3OS2 A;  4M7A E;  2X4W A;  3I56 A;  3QDF A;  1D1A A;  4PJO E;  1GBQ A;  2FZC B;  3LGL A;  2K3X A;  2J05 A;  4M77 F;  2DRK A;  4PNO A;  4WCI A;  1K8A U;  5L23 A;  4N4H A;  2CP6 A;  5IXF A;  2ZPF B;  2PUO B;  3X24 B;  3MEV A;  3VS2 A;  3CCR T;  2DTH A;  3E9F A;  1FYN A;  2C06 A;  1C1A A;  1VQM T;  4M7A A;  3H41 A;  2AT1 B;  1TH7 A;  1QVP A;  1PHT A;  2PTK A;  4DEX A;  1JXM A;  2NYS A;  4M75 B;  3GOX A;  3ZBD A;  1M27 C;  1KD1 R;  3QWX X;  2JUF A;  2LVM A;  3GLX A;  4C92 F;  1ZUU A;  1TOV A;  1Q7Y R;  3JSC A;  2HDA A;  1BI1 A;  3GNF B;  3UDC A;  2PVO B;  4ELZ C;  2DD5 A;  4C8Q D;  1R8O B;  1UFF A;  1BU1 A;  2MMP A;  4JS5 A;  4C5G A;  1YHQ Q;  2QQS A;  1TTH B;  3D7S B;  3VU3 C;  4XU1 A;  3CCM A;  1D3B B;  4PFP A;  5HCK A;  1WZO A;  4YTL A;  4P5N A;  2DF6 A;  4Q5W A;  2KR3 A;  1K73 R;  2QYZ A;  2A08 A;  4XU3 A;  1VQN A;  2CZ0 B;  2L8D A;  3EG9 A;  3PMT A;  2YHT A;  2FYK A;  2QEX T;  4E7Z A;  3RIR A;  4X9D A;  1D0Y A;  4FYW B;  1SSF A;  1G3T A;  2ATC B;  3G71 A;  3FC3 A;  3M9Q A;  4OMM A;  2CZ7 B;  2KSS A;  2DM1 A;  4DBH A;  5GAN 7;  4C8Q B;  4OP0 A;  2E41 A;  2PZ1 A;  1WGS A;  3VV0 A;  1VQ4 T;  1PWT A;  5GMK j;  1X27 A;  4QQD A;  1BI3 A;  1RI0 A;  2PNI A;  1AEY A;  4C92 E;  3OS0 A;  1MUZ A;  1OYX A;  2LCC A;  1SRM A;  2D8J A;  4XTY A;  5IH2 A;  3CXC A;  4HCB A;  2D0Q B;  4C8Q G;  1AVZ C;  4J6W A;  2OTJ Q;  5D6Y A;  2C0O A;  3G71 Q;  1WIE A;  4F7U G;  3P8B B;  4M75 F;  2O4X A;  5IN1 A;  1OEB A;  2XDD A;  1MV3 A;  4ANJ A;  2CYZ B;  4M7D C;  2BIV A;  3M55 A;  1N8R U;  4J7I A;  1IB8 A;  4IUP A;  5GAO q;  1JBM A;  2Y4X A;  4FYV B;  3T9N A;  2M0Y A;  4C92 A;  4EMK A;  2QAS A;  4L59 A;  1KC8 R;  3CD6 A;  1R0C B;  1W2B A;  2ZPH B;  1D0X A;  2MPX C;  4OF1 A;  4M78 F;  1MGQ A;  1F1B B;  2LX9 A;  1Z9Z A;  2LTO A;  2RI3 A;  3JB9 G;  3OYL A;  1U1T A;  2A28 A;  2EIF A;  3SWN B;  3AT1 B;  4Y91 A;  2XIC A;  2CS7 A;  2DNU A;  1EFN A;  1K9A A;  4PK4 A;  3M56 A;  2Y4Y A;  2DJQ A;  2GQI A;  4ORZ A;  4V2S A;  1TS9 A;  3UF4 A;  1K8A C;  5KE3 A;  4RG2 A;  5D6W A;  2HAX A;  4AFQ C;  2GNC A;  2KY9 A;  1VQ9 T;  3QYH B;  3CC2 A;  3QZ9 B;  1UGQ B;  3E19 A;  2FRY A;  4OVA A;  2DA9 A;  1DJ7 B;  2EJ9 A;  3ME9 A;  3A8H B;  3TCJ A;  2MK5 A;  2RM4 A;  3CD6 T;  1RUW A;  2GTJ A;  5LJ5 e;  2DIG A;  3VJP A;  4M7D D;  2CGH A;  4C0D B;  1YIJ Q;  3M53 A;  4R55 A;  2RNA A;  2DXC A;  5GMK e;  3H0I A;  3HFO A;  1YWO A;  1TUG B;  3CCJ Q;  2KDS A;  5LJ5 h;  3DLM A;  3PFS A;  3JCM b;  4BDZ A;  4KUL A;  2RJC A;  3F70 A;  1NLO C;  3G6E Q;  2BUD A;  4CI0 C;  4QQ6 A;  2QXF A;  3KUF A;  2YRV A;  3VS7 A;  4GY5 A;  2DK3 A;  4M7A C;  1U1S A;  2KE9 A;  3X28 B;  2BE7 D;  5KYY B;  3I55 Q;  5ECA A;  3MP6 A;  1W2B S;  4PFZ A;  3AHU A;  2QGF B;  4E7J A;  1IGQ A;  4J9G A;  1Q95 G;  3M0T A;  3OMG A;  2MYS A;  2OX7 A;  3A8M B;  1VQO T;  5FRO A;  1Y96 A;  2YUO A;  1T0H A;  1XNI A;  2AZV A;  2QAZ A;  1ZUK A;  7AT1 B;  2VXE A;  3MKD A;  3QSU A;  2VVK A;  2CUB A;  1W70 A;  3HHT B;  2HD0 A;  3HL8 A;  3BW1 A;  1M1K R;  1QVF A;  2KXD A;  1YJW Q;  1UGR B;  2XK0 A;  2KBT A;  3OS1 A;  1BI2 A;  2D6F A;  1S72 A;  4BE2 A;  5GAN f;  3I55 A;  4IKF A;  1TWB A;  3PTA A;  2HKQ B;  1TG0 A;  3QBY A;  2X4Y A;  4KH0 B;  2OJ2 A;  4K11 A;  2KEA A;  4ESR A;  1SKU B;  1K76 A;  2CP3 A;  4KGX B;  3G1J A;  4J9B A;  4RTU A;  3QO3 A;  3CCQ A;  1OZ3 A;  1H3Z A;  1YI2 T;  3CC4 T;  1NZ9 A;  3SEM A;  3MEW A;  3EG9 B;  2DZ9 A;  3L42 A;  2YLC A;  1OOT A;  1ZSZ C;  4CC3 A;  4D6W A;  1NJI R;  4FU6 A;  1VQ4 Q;  4M7A D;  4EMG A;  4MZM A;  2LZ6 B;  3WVE B;  1QVG S;  4E7K A;  4M4Z A;  1MMA A;  2JM9 A;  3OQ5 A;  1VQK Q;  3JB9 H;  2DXU A;  1IRX A;  3J80 E;  1BCO A;  5KE2 A;  1UDL A;  2MI6 A;  4LDY A;  2HSP A;  1ABQ A;  3CCU A;  1ZA2 B;  2F5T X;  1W2B P;  2E5Q A;  2EJF A;  2KRM A;  3H0F A;  3QXE B;  4OMO A;  4CRI A;  1V1C A;  2HZY A;  3M4Y A;  2RK1 A;  4RUG A;  1E6H A;  5LJ3 g;  3RES A;  1UEC A;  3FEO A;  5GMK i;  1QLY A;  2DRM A;  2M51 A;  3CME T;  4HVW A;  1SPK A;  3TQ7 P;  4Z88 A;  4BY6 B;  2PVG B;  1V76 A;  3S3M A;  4FCY A;  2B8A A;  1H8K A;  2MWO A;  1YJN T;  2HQE A;  4XTU A;  2DET A;  1XTD A;  2EWN A;  2RH2 A;  4LDV A;  3JCM d;  1GCQ A;  1ZHI A;  4JPB W;  2DE0 X;  3OSS C;  4AG1 C;  3X25 B;  3RR6 A;  2K57 A;  4XU0 A;  1UHC A;  3CC2 Q;  2LT4 A;  4CC4 B;  5IHI A;  5KYW A;  4HKE A;  4A4F A;  4ATO A;  4RKU E;  4B6M A;  2F5K A;  4MML A;  2Y90 A;  3TU4 K;  1W4S A;  2RB6 A;  4HT9 A;  2RHU A;  2F2W A;  1TUD A;  2MWP A;  1KFZ A;  3CCJ T;  3SWN C;  2P4T A;  5CCA A;  4PJO C;  3EH2 A;  2M02 A;  2LDM A;  3CCE A;  3TRE A;  2DVJ A;  5FLX E;  1QVG P;  4M7A F;  5KCH A;  2R5M A;  1Y07 A;  4O5V A;  2JTE A;  2OAW A;  1M90 C;  4C92 D;  3JCM X;  2HSE B;  3VYH B;  3I35 A;  3CBM A;  1QMC A;  5C0M A;  4PKC C;  2FPE A;  1QCF A;  4PJO G;  2M0O A;  2CZ6 B;  2M9U A;  3EHQ A;  3HKS A;  2QA4 T;  1IXD A;  1MNE A;  4PJM A;  4EIK A;  1HYO A;  1I4K 1;  3G7Z A;  3NGP A;  2CP0 A;  2GFU A;  3I9Q A;  3CMA Q;  5GAO r;  3CPW P;  3GNG A;  1VYV A;  1K9M R;  2E12 A;  2YDL A;  3M57 A;  4PLI A;  2DEU A;  1B34 A;  4Y28 E;  1K73 U;  1Y7X A;  1AZG B;  1Q82 U;  4XTZ A;  1PNJ A;  3L2Z A;  1HD3 A;  1U8R A;  2F1L A;  2AKL A;  3R6O A;  4BUG A;  3CCV T;  2JJ9 A;  1LNX A;  1NG2 A;  2CP2 A;  1YJW T;  2BKD N;  2QGG A;  4BI4 A;  1A0N B;  1PRM C;  2M16 A;  5GAN 4;  4HCK A;  1W1F A;  2GF7 A;  4M75 E;  3JB9 I;  3BE3 A;  1RAE B;  3I5R A;  1OUL A;  1VQ7 Q;  1AWW A;  3X26 B;  2JNG A;  1OPK A;  4LE9 A;  2QI2 A;  3RKX A;  2J6F A;  2OTL A;  2K79 A;  2V1Q A;  1WXT A;  4OMQ A;  3OW2 S;  1VQ9 Q;  3OYD A;  2XG8 D;  5I2S A;  1YI2 Q;  1AZE A;  1RL2 A;  2D9T A;  2FZG B;  2BZY A;  3S3O A;  1OV3 A;  3PVQ A;  4AT1 B;  5CQY A;  2KGT A;  5GAN 2;  4N0A A;  5HK0 A;  5GAM g;  4RTV A;  3ZFJ A;  3UA7 A;  2O4X B;  4LDX A;  5CKD A;  2EAY A;  3CCU Q;  3RER A;  1M3C A;  1M1K U;  4EDU A;  1Q7Y U;  3EGX B;  1GBR A;  3M0P A;  1PRL C;  2E1H A;  3CC7 Q;  1KC8 C;  2V8I A;  3A8G B;  4QW2 A;  3CPW S;  4HXJ A;  4FYY B;  1KSW A;  5GAO p;  4EMK C;  1I1J A;  3C4S A;  2VXF A;  1GFC A;  2NUP A;  3MP8 A;  3CPW A;  1YP5 A;  1KIK A;  3FLG A;  2H8H A;  2QA4 A;  1VQ6 A;  4DBR A;  3I55 T;  1K0X A;  3FB9 A;  4JZ4 A;  1WPY A;  1K4U S;  2BE9 B;  1WHG A;  2LQK A;  4M78 A;  2KVQ G;  5DLQ E;  4X34 A;  1PD1 A;  3RNJ A;  3NPF A;  3NTH A;  3LWI A;  4ME7 A;  4HVV A;  5GAM f;  2IVW A;  2QQB A;  5HKC A;  5KYU A;  1QCN A;  1IZ6 A;  1YJN A;  1KC8 U;  2X3X D;  3V8L A;  5CAI A;  1OX9 A;  2LT1 A;  2L3P A;  2DL4 A;  3QDR B;  3ZEH A;  1M90 U;  5GAM e;  2QDL A;  2YWW A;  4J8O A;  1E6G A;  4PJJ A;  2CUD A;  4M75 A;  4QT7 A;  1NEB A;  4MZP A;  1Q82 C;  2JTF A;  2VGN A;  1BBZ A;  3OYG A;  1ACM B;  1N27 A;  1HK9 A;  3JCM P;  5GAM h;  2DJZ A;  1QP3 A;  1OU9 A;  2RHZ A;  2KMT A;  1Q81 C;  3CXC S;  2L5Q A;  2YRC A;  2X3W D;  3RKY A;  4IUU A;  2JT4 A;  1BYM A;  4Z02 A;  2K7A A;  1ZUY A;  2E65 A;  5J39 A;  1XQH A;  3EGX A;  4AFU C;  1MHN A;  4PJL A;  2QA4 Q;  4EMH A;  1X43 A;  1RAG B;  3OYY A;  1LVK A;  1VIE A;  2KK4 A;  2J6O A;  4II1 A;  1VQ5 Q;  2BTT A;  2KRN A;  2EQJ A;  1VQM A;  3C0C A;  2FHD A;  2HEQ A;  3Q1J A;  2XMF A;  3EG0 A;  5KYY A;  2ROT A;  4JJN K;  2LQW A;  2LX7 A;  4KRT A;  2YT6 A;  4M78 B;  3BDU A;  2DKG A;  2LCL A;  4JJD A;  4JRK A;  1Q86 C;  3HSB A;  5CQX A;  3OW2 A;  5GAN j;  2VGM A;  2CSI A;  2EKH A;  3HRU A;  2B86 A;  1N5Z A;  2X4J A;  3MEA A;  3O5Z A;  1M9S A;  4M7A G;  1UGS B;  4M78 E;  2LMJ A;  1VQ7 T;  1I07 A;  2L89 A;  2ZCF B;  1EZZ B;  3CME A;  1G3W A;  2GQV A;  2K2M A;  4GLK A;  3EG1 A;  1UG1 A;  3FJ5 A;  1VQ6 T;  4E7L A;  1H3H A;  2I2L A;  1VQP Q;  4JZ3 A;  2YRD A;  2DZC A;  2DXT A;  1Z9Q A;  1M3B A;  2O2O A;  3E9G A;  1I5L A;  1FX7 A;  3DB3 A;  2YSQ A;  2K5F A;  2LQN A;  3L2W A;  1N9S A;  3GP8 A;  4F7U F;  1VQ8 T;  2DFU A;  1B34 B;  3QHS A;  2DD4 A;  5GAO n;  4J9F A;  1Q7Y C;  2LC4 A;  2KRS A;  2VUB A;  1UJ0 A;  2E4H A;  1SRL A;  5EG2 A;  4ZTJ A;  2HCK A;  1WFW A;  1Q81 U;  1P92 A;  2L2P A;  3PGG A;  2CH4 A;  1LJO A;  4HVU A;  1M30 A;  1BB9 A;  3SWN A;  1H64 1;  1QCO A;  2OTL Q;  3DB4 A;  2L0A A;  4PL6 A;  3OA6 A;  3PE0 A;  2XHC A;  5FWC A;  1VQ6 Q;  2SRC A;  1OU8 A;  4JRI A;  4QKU A;  1UB4 A;  4A63 B;  4BD3 A;  3HPW A;  4E2F B;  2BZX A;  1KG1 A;  3C95 A;  1JQQ A;  1LOJ A;  1KQS P;  4R56 A;  1RAH B;  1PSE A;  2O01 E;  1JJ2 P;  4E7H A;  1QWF A;  1NJI U;  1FWZ A;  4MDW A;  3HP9 A;  2EVR A;  4MZT A;  2PU9 B;  4LN2 A;  3CCM Q;  1WJR A;  5AYF A;  4AG2 C;  3OB9 A;  2G3R A;  1KD1 U;  2KNB B;  2RK2 A;  5I11 A;  4AMC A;  4E47 A;  5C6S A;  2RI5 A;  3MPU B;  1M2O A;  2K3Y A;  5HK3 A;  3GF5 A;  4KT0 E;  4ZN3 A;  1WHM A;  2VYT A;  2ZPI B;  2F69 A;  2C0I A;  4PJO F;  1FMK A;  3L2V A;  1KK7 A;  3JCM f;  2CP5 A;  3EFO A;  2Z0W A;  1G3Y A;  3G4S Q;  4C92 G;  3SDZ A;  2HMA A;  2RHX A;  1GFD A;  2A0F B;  1XOV A;  2MOX A;  3CMA T;  2GFA A;  3QJ6 A;  2NUT A;  1YN8 A;  1JJ2 A;  3CCM T;  2CSQ A;  2KT8 A;  2XDB A;  3A5Z B;  4F04 B;  1YJ9 Q;  1RAF B;  3L2R A;  1OPL A;  2J6K A;  4J9D A;  4C0D C;  4DOW A;  3S3N A;  5IHK A;  2K6D A;  4QVZ A;  2EYZ A;  4N0A C;  4IUV A;  1I0C A;  2DLP A;  3EGD B;  4JLI A;  1K0S A;  3PMI A;  4AFZ C;  4A4G A;  4M77 E;  3RMQ A;  1JU5 C;  4JRQ A;  1X01 A;  2RQT A;  2A7Y A;  2RD1 A;  1S72 T;  2PVD B;  3CPF A;  1M90 R;  3M0U A;  1WXB A;  4M78 D;  4L6V 5;  4M77 B;  1M8M A;  4OB3 B;  1VQ9 A;  2AHJ B;  3JAM E;  3VRY A;  4J9C A;  3KFV A;  1R77 A;  1G2B A;  3VS6 A;  1WX6 A;  3C12 A;  2X51 A;  3FJP A;  2C0T A;  4BY6 C;  1QQJ A;  1NPR A;  1Y0M A;  1UJY A;  4LD6 A;  1QW1 A;  4NL3 A;  1K9M U;  1VYT A;  2LJ1 A;  1JB0 E;  2ENM A;  3GBQ A;  3VUZ A;  3VS3 A;  4DQ2 A;  1YJW A;  1KD1 C;  4J83 A;  1YCS B;  3H8Z A;  3EFO B;  4J6X A;  4PJN A;  1WHH A;  1QVG A;  2YLB A;  1AWJ A;  5GAN d;  2QTV A;  1LCK A;  3CCJ A;  4IIM A;  3M58 A;  3DKM A;  2EQM A;  3CQT A;  4ZN1 A;  1X2Q A;  4BI8 B;  2A36 A;  2OI3 A;  4F14 A;  5LJ5 j;  2JMA A;  3OYH A;  2DL3 A;  4IUQ A;  3SFM A;  2YUP A;  3MJX A;  5J3B A;  2MCN A;  3JB9 D;  2EGA A;  1X6O A;  4J9E A;  4BE1 A;  5GAN g;  2X4X A;  4BB7 A;  2EKO A;  3PIO A;  1ZA1 B;  3GPL A;  4M77 A;  2PUK B;  1UGV A;  2LNV A;  1Y71 A;  1RAA B;  3NTK A;  5KYU B;  1I8F A;  2EPD A;  1RLQ C;  1WXU A;  3WXM B;  5GMK h;  5FW9 A;  1YIT A;  1M1K C;  4D8K A;  4M78 G;  2M1H A;  2V8J A;  4C5H A;  3L1A A;  3CCQ Q;  1BK2 A;  4BI3 A;  3EG3 A;  1I81 A;  5CKH A;  5A0G A;  1FMW A;  4OML A;  5KYW B;  2DBM A;  1G3S A;  4KUD K;  1WJS A;  1QKW A;  3P8D A;  5FU6 C;  2E5K A;  2X35 A;  3V7S A;  3SB2 A;  2XI9 A;  1VQK A;  4M75 G;  2EJG A;  1B07 A;  2YUQ A;  1VQO Q;  1X69 A;  1JJ2 S;  2E10 A;  3MP1 A;  8AT1 B;  1RAC B;  3MCA B;  4M77 D;  4J9H A;  2P84 A;  3CC7 A;  1YFN A;  2RHI A;  2GGR A;  1TU0 B;  2ZZD A;  3X20 B;  2DPP B;  4Z8A A;  4JUV A;  4OGE A;  2ZGW A;  1QVF S;  3LW5 E;  4RCB A;  1VUB A;  1TSF A;  3EGU A;  5FU6 B;  5CR2 A;  1VIF A;  2RPN A;  2A37 A;  2P4R A;  1VA7 A;  3HTR A;  4JLG A;  3UT1 A;  5DLO A;  4PJO B;  1G5V A;  2ZAE A;  1HSQ A;  1IHW A;  3OS5 A;  5LJ3 d;  2I0N A;  4GLM A;  1UTI A;  1ARK A;  2RN8 A;  2O9V A;  3RDV A;  3EH1 A;  1NPP A;  2CKK A;  2J06 A;  2NLU A;  3CC7 T;  1YJ9 A;  2VV5 A;  5D6X A;  4KGV B;  2LRQ A;  3VRZ A;  2EBP A;  2EFI A;  4FW2 A;  5L8R E;  3BFM A;  1RI9 A;  2DIQ A;  2OTL T;  4HA8 A;  4WTO B;  4JJB A;  4M77 C;  3UPU A;  3CD6 Q;  4C8Q C;  3BY7 A;  4F17 A;  2RJF A;  2V1R A;  5LL6 S;  5AT1 B;  3NTI A;  3M5A A;  2WAC A;  1G83 A;  3G4S A;  2QQ9 A;  3OSV A;  3VKI A;  2E3I A;  1YIJ T;  3M0S A;  1UGP B;  4A54 A;  5GAN 5;  3QZ5 B;  1Q86 R;  5LJ5 f;  1UEB A;  2DTO A;  3QJY A;  4OMF B;  2XDP A;  1K1Z A;  4RCC A;  3OYJ A;  5KH6 A;  6AT1 B;  1LPL A;  2F2V A;  2XKO C;  2ZPG B;  4RTY A;  3V7C A;  5GAN e;  2XID A;  4J6Y A;  4C92 B;  3URG A;  4JRP A;  4GBQ A;  2ED0 A;  1EX4 A;  2EYX A;  3EHR A;  4RG8 A;  1W6X A;  1PC0 A;  4XTX A;  2EYY A;  3UA6 A;  5GAN h;  3RUX A;  4PJO A;  3LYI A;  2W0Z A;  2QEX Q;  4R0K A;  4C8Q A;  3C94 A;  2COZ A;  1GL5 A;  1NLP C;  1O9S A;  2FRW A;  2K2V A;  4DBF A;  4QQG A;  2R58 A;  3O8V A;  3MET A;  3CC2 T;  3QII A;  2GCX A;  1PKT A;  3VS1 A;  3G4S T;  4FIB A;  4E7S A;  2ESW A;  1YIJ A;  1T3L A;  1VQL Q;  1QWE A;  2RJE A;  3RBB B;  2K4Y A;  3JCM Q;  5GJW B;  3CC4 A;  2JTM A;  4NS5 A;  2NUP B;  2QQR A;  3HFN A;  2VB6 A;  1B3Q A;  2CT4 A;  3H9N A;  1KQS A;  2SEM A;  1K73 C;  3VUB A;  2V8K A;  2XU8 A;  4KUI A;  1HJD A;  5FU7 C;  3OYN A;  2ZPB B;  2JOY A;  3PIP A;  5A0D A;  1ZBX A;  2E6Z A;  3I56 Q;  4BE0 A;  1NJI C;  1WQW A;  1OX8 A;  2MAM A;  3CBO A;  1WYX A;  3A8O B;  5LJ3 j;  3LH0 A;  2H3J A;  3CCQ T;  2RF0 A;  4A4H A;  2YXY A;  3WVD B;  3MO8 A;  1YJ9 T;  2FEI A;  4FSX A;  1VQ7 A;  3OYK A;  4WF2 A;  1VQN Q;  1AWO A;  4E7I A;  4OB0 B;  3CC4 Q;  1WHK A;  1RLP C;  1ZSG A;  1N8R C;  2JW4 A;  1OZ2 A;  1MMN A;  1AHJ B;  2J7I A;  1Q81 R;  2BZ8 A;  3LX7 A;  1VQK T;  4E6R A;  2O31 A;  1ZSZ A;  1X6G A;  3OYE A;  1B7T A;  1PSF A;  1WJQ A;  2RJD A;  2COW A;  1WLP B;  2VWF A;  1JEG A;  4M7A B;  2E70 A;  4B9X A;  1NEG A;  2HL3 A;  1ZBJ A;  3OMC A;  4EMK B;  5GJV B;  1JRI A;  1WHJ A;  2DEQ A;  5CIU A;  5FRM A;  4A53 A;  1UE9 A;  4CC7 A;  3CCE Q;  2IG0 A;  1TXQ A;  4ELY C;  1HXD A;  2KXC A;  1NM7 A;  4FT2 A;  2DX1 A;  4C0F A;  3KXT A;  3VS0 A;  5A0L A;  2IIM A;  1X2K A;  2JVV A;  2E3H A;  3VS4 A;  4UC4 A;  3M59 A;  5D7U A;  3PVL A;  2MIO A;  4FW1 A;  3P8H A;  4OB1 B;  4C8Q E;  5GAN 8;  1ZLM A;  5KYX A;  1VQ5 A;  4BAC A;  1IGU A;  1ZQ1 A;  1BCM A;  3EGD A;  4RTZ A;  9ATC B;  2RQW A;  2CDT A;  4N4I A;  5CK9 A;  1YNZ A;  1YHQ A;  2A3L A;  1D0Z A;  5I2M A;  2ABL A;  1VQ8 A;  3CCU T;  4N4G A;  4XAX B;  4IIO A;  3JCM J;  4M7D F;  2P0Q A;  3OYB A;  1SG5 A;  2HNI A;  2D8H A;  3TVT A;  2FZK B;  4OB2 B;  3E1S A;  2D0N A;  1NYG A;  3CCR A;  2K5I A;  4J9I A;  1ZSZ B;  2FPF A;  1PM3 A;  4LDW A;  4RTX A;  2CH4 W;  1IO6 A;  3CMA A;  2FO0 A;  2H3E B;  4C5I A;  2RQV A;  4C0G A;  4PFO A;  2DL8 A;  2CT3 A;  2ROL A;  3OYA A;  1J3T A;  1M5Q 1;  3JRZ A;  3JB9 J;  1Q86 U;  3R6N A;  2RI2 A;  4M7D G;  4M7D B;  3GIB A;  4RTW A;  4ZNX A;  1M2V A;  3LWH A;  1U5S A;  3HRT A;  5M9O A;  1GXI E;  2DTI A;  1MV0 B;  1WHL A;  3OYM A;  1WA7 A;  1YCY A;  5DY9 A;  5CKE A;  2X9H A;  5GMK m;  5FRN A;  2RQR A;  4LXC A;  1I5O B;  4QVD A;  3REA B;  1FXX A;  1NYF A;  2RMO A;  1D1C A;  2ED1 A;  3PT9 A;  2HBP A;  1PG5 B;  8ATC B;  1RAI B;  2COY A;  1XJW B;  1WI7 A;  4F7U B;  3I5S A;  3SD4 A;  2HQH A;  3ULR B;  4LUD A;  1K8A R;  4O6J A;  3I56 T;  5LJ5 g;  1WQ7 A;  2DL7 A;  4ZTF A;  5LJ3 h;  3M0Q A;  2JXB A;  4A4E A;  4B9W A;  2G6F X;  2HL5 C;  3H0H A;  4FT4 A;  4RTT A;  1U3O A;  3FIF A;  3JV3 A;  2NUT B;  3QWY A;  3S6W A;  2DYI A;  3CCS T;  5LJ3 e;  4HCZ A;  3RKW A;  2DVE A;  2RHY A;  3LLR A;  1PKS A;  4XU2 A;  2AKK A;  2IPO B;  1KQS S;  1X75 C;  1MND A;  2DMO A;  2EW3 A;  3A1P A;  1C6V X;  3JCM c;  5LJ3 f;  2FVU A;  2L3Q A;  1VQL A;  3FRN A;  4IUR A;  1D09 B;  3CBP A;  1ZX6 A;  4J7F A;  2MF2 A;  1VQP A;  1UUE A;  2QG9 B;  3V8J A;  3V8K A;  3INZ A;  1M2V B;  3ASK A;  1M4Z A;  3CCE T;  4OMP A;  2O88 A;  3A98 A;  5CKB A;  3JCM V;  1KQ2 A;  1QP2 A;  3TEE A;  3QUI A;  1AOJ A;  1E7O A;  2AZS A;  2NWM A;  2HKN A;  1BIB A;  4HT8 A;  1VQO A;  4M78 C;  4LD9 K;  3QYG B;  1M1G A;  3A8L B;  4IUT A;  2P0P A;  4NL2 A;  3OYC A;  2DAQ A;  4F16 A;  2FB7 A;  2NUZ A;  3CCS Q;  4PJO D;  5HY6 A;  1SF9 A;  4DBQ A;  1TUC A;  3NMZ C;  4DA4 A;  2LNH B;  2WSC E;  3OY9 A;  2OTJ A;  5A2Q E;  1EIF A;  5GAO l;  2CRE A;  1N6A A;  2FG0 A;  2DYB A;  2E6N A;  1Q82 R;  3UAT A;  5EC7 A; 
#chains in the Genus database with same CATH homology
 3I55 T;  3FB9 A;  3M55 A;  3UT1 A;  1N8R U;  1WPY A;  4J7I A;  5DLO A;  4XTW A;  1VQL T;  4IUP A;  5GAO q;  1JBM A;  2LQK A;  4M78 A;  4PJO B;  1G5V A;  2KVQ G;  2Y4X A;  4BDY A;  5DLQ E;  2OAU A;  4X34 A;  3T9N A;  2XD0 A;  2FL7 A;  3NTH A;  4C92 A;  4EMK A;  3LWI A;  3QKJ A;  4L59 A;  4ME7 A;  3OS5 A;  5GAM f;  2IVW A;  2QQB A;  5LJ3 d;  5HKC A;  3CD6 A;  1W2B A;  2ZPH B;  3QPH A;  1IZ6 A;  1YJN A;  4OF1 A;  1KC8 U;  4M78 F;  1MGQ A;  4TVR A;  3V8L A;  2LX9 A;  5CAI A;  2LTO A;  2LT1 A;  2RI3 A;  1KHC A;  3OYL A;  1U1T A;  3JB9 G;  2EIF A;  3QDR B;  3ZEH A;  3SWN B;  1NPP A;  1YHQ T;  1M90 U;  1V29 B;  2CKK A;  4Y91 A;  2XIC A;  5GAM e;  2CS7 A;  5GAN 3;  2NLU A;  4J8O A;  3M56 A;  5GAM j;  3CC7 T;  4M75 A;  2Y4Y A;  4MZP A;  1Q82 C;  1YJ9 A;  2VV5 A;  4V2S A;  2JTF A;  5D6X A;  3CCL T;  4XQ3 A;  2VGN A;  2LRQ A;  3DLL A;  3N5B B;  3VYG A;  3OYG A;  1N27 A;  2QQA A;  1HK9 A;  3G6E T;  1K8A C;  5KE3 A;  4ZGE B;  5GAM h;  3JCM P;  2EFI A;  4RG2 A;  5D6W A;  2DJZ A;  2HAX A;  1QP3 A;  2RHZ A;  3LGF A;  2KMT A;  5L8R E;  1Q81 C;  2KY9 A;  3CXC S;  3BFM A;  2L5Q A;  2DIQ A;  4QVC A;  2OTL T;  1VQN T;  3RKY A;  4HA8 A;  1VQ9 T;  4IUU A;  3RMS A;  4M77 C;  3UPU A;  3FDR A;  3QYH B;  4C8Q C;  3CC2 A;  3QZ9 B;  3BY7 A;  2RJF A;  4F7U A;  1UGQ B;  5GMK l;  3E19 A;  4Z02 A;  3CCL A;  1BYM A;  4OVA A;  5LL6 S;  1BKB A;  1DJ7 B;  1XQH A;  2E65 A;  2EJ9 A;  5J39 A;  3ME9 A;  3NTI A;  3M5A A;  2WAC A;  3G4S A;  1MHN A;  2QQ9 A;  3OSV A;  3VKI A;  1YIJ T;  4A54 A;  1UGP B;  3A8H B;  3OBW A;  3QZ5 B;  3TCJ A;  5GAN 5;  5LJ5 f;  1UEB A;  2DTO A;  2RM4 A;  3QJY A;  4OMF B;  4EMH A;  3CD6 T;  5J26 A;  2XDP A;  4RCC A;  3OYJ A;  5KH6 A;  4JDS A;  4MMK A;  3OYY A;  2DO3 A;  2JN0 A;  2XKO C;  2ZPG B;  1VIE A;  3V7C A;  5GAN e;  2KK4 A;  2XID A;  5LJ5 e;  2DIG A;  4J6Y A;  3VJP A;  2CGH A;  4II1 A;  4C0D B;  4M7D D;  5LJ5 d;  3M53 A;  4R55 A;  4C92 B;  3OBY A;  3URG A;  2EQJ A;  1VQM A;  4C0Z A;  2FHD A;  4JRP A;  1N9R A;  4ZGD B;  2DXC A;  3Q1J A;  5GMK e;  4RG8 A;  3L2U A;  3HFO A;  4XTX A;  4JJN K;  1VQ5 T;  2QEX A;  5GAN h;  4FM4 B;  2KDS A;  4M78 B;  3RUX A;  3LYI A;  3DLM A;  5LJ5 h;  3PFS A;  3JCM b;  4BDZ A;  1K9M C;  3BDU A;  4KUL A;  4KBM B;  2DKG A;  2RJC A;  3F70 A;  2LCL A;  4C8Q A;  3C94 A;  3G6E A;  4JRK A;  1Q86 C;  3HSB A;  5CQX A;  3OW2 A;  2BUD A;  5GAN j;  2VGM A;  1O9S A;  4J5Y A;  4CI0 C;  4QQ6 A;  2K2V A;  2QXF A;  3KUF A;  4RMO A;  2YRV A;  4QQG A;  4GY5 A;  2E64 A;  3HRU A;  3G71 T;  2R58 A;  3O8V A;  3MET A;  2DK3 A;  2X4J A;  3MEA A;  3CC2 T;  3J7A F;  1U1S A;  3QII A;  4M7A C;  1M9S A;  4M7A G;  1UGS B;  3X28 B;  2GCX A;  4C5E A;  4M78 E;  1VQ7 T;  2L89 A;  2ZCF B;  3MP6 A;  3CME A;  1W2B S;  5GAO m;  4A4K A;  3G4S T;  1G3W A;  2GQV A;  4FIB A;  4GLK A;  1YIJ A;  3AHU A;  4E7J A;  4JS4 A;  2EQK A;  3H6Z A;  2RJE A;  1VQ6 T;  2K4Y A;  3OMG A;  3JCM Q;  3CCV A;  4E7L A;  3A8M B;  1VQO T;  2I2L A;  3CC4 A;  2JTM A;  1WNL A;  2DZC A;  4NS5 A;  1Y96 A;  2DXT A;  3EFS A;  5FRO A;  2QQR A;  3E9G A;  3HFN A;  1XNI A;  1BI0 A;  1KQS A;  1I5L A;  1FX7 A;  1K73 C;  5DM7 R;  3M54 A;  2VXE A;  2V8K A;  2XU8 A;  3VUB A;  3QSU A;  3DB3 A;  4KUI A;  5IT9 E;  1BIA A;  3HHT B;  2HD0 A;  5FU7 C;  3OYN A;  2K5F A;  3L2W A;  3HL8 A;  2ZPB B;  1N9S A;  3ER0 A;  2JOY A;  4F7U F;  3PIP A;  3GP8 A;  3BW1 A;  5A0D A;  1ZBX A;  3JCM e;  1VQ8 T;  1QVF A;  1B34 B;  1NE8 A;  2E6Z A;  3QHS A;  4BE0 A;  2KQW A;  1UGR B;  2XK0 A;  3JCM W;  2DD4 A;  4MDX A;  5GAO n;  1Y96 B;  3OS1 A;  1Q7Y C;  1NJI C;  1WQW A;  1BI2 A;  2LC4 A;  2WSF E;  2VUB A;  2D6F A;  1S72 A;  4BE2 A;  5GAN f;  2PQW A;  5EG2 A;  2MAM A;  4ZTJ A;  5I21 A;  3I55 A;  3CBO A;  3A8O B;  4IKF A;  4HCC A;  5LJ3 j;  3PTA A;  3LH0 A;  3HRS A;  3QBY A;  2X4Y A;  1M1F A;  1P92 A;  2H3J A;  3CCQ T;  4A4H A;  1Q81 U;  3PGG A;  3JCM h;  3KBG A;  4VUB A;  3WVD B;  3MO8 A;  1YJ9 T;  1LJO A;  4FSX A;  4C92 C;  3PNW C;  1VQ7 A;  3OYK A;  3SWN A;  4WF2 A;  1H64 1;  5GAN 6;  4E7I A;  3JB9 F;  3DB4 A;  4OB0 B;  3MEU A;  4PL6 A;  4M75 C;  3OA6 A;  2XHC A;  5GAM d;  4JRI A;  4M7D A;  3QO3 A;  1UB4 A;  3CCQ A;  1N8R C;  4BD3 A;  3HPW A;  1OZ3 A;  1OZ2 A;  1YI2 T;  1H3Z A;  3C95 A;  1KG1 A;  1LOJ A;  3CC4 T;  1NZ9 A;  3MEW A;  5CKF A;  2DZ9 A;  3L42 A;  4R56 A;  1AHJ B;  1PSE A;  2O01 E;  2YLC A;  4D6W A;  4E7H A;  1NJI U;  4FU6 A;  4M7A D;  1FWZ A;  3LX7 A;  1VQK T;  3CCS A;  4MDW A;  4EMG A;  4MZM A;  2DXB A;  4M77 G;  3WVE B;  2CZ1 B;  3HP9 A;  3OYE A;  5FU7 B;  1KHI A;  1PSF A;  1WJQ A;  4MZT A;  2RJD A;  4M7D E;  2PU9 B;  1QVG S;  4OGC A;  1WJR A;  3OYF A;  4E7K A;  5AYF A;  2R57 A;  3OYI A;  4M7A B;  3OQ5 A;  2E70 A;  3JB9 H;  2DXU A;  4B9X A;  3J80 E;  3OB9 A;  3UWN A;  2G3R A;  5KE2 A;  1KD1 U;  2RK2 A;  4C8Q F;  4JLG A;  2RA2 A;  2MI6 A;  3M4G A;  3OMC A;  4LDY A;  4E47 A;  5C6S A;  2RI5 A;  2QTX A;  4EMK B;  3L2Q A;  2QDY B;  3CCU A;  1JRI A;  2K3Y A;  5HK3 A;  3GF5 A;  4KT0 E;  2DEQ A;  2F5T X;  5CIU A;  1OI1 A;  4ZN3 A;  2E5Q A;  4XTV A;  4A53 A;  5FRM A;  2VYT A;  2EJF A;  1IRE B;  2F69 A;  2ZPI B;  3CEY A;  3QXE B;  4PLL A;  4CRI A;  4DOV A;  1M8V A;  4PJO F;  3M4Y A;  2WSE E;  2R5A A;  2K5L A;  2IG0 A;  2LQ8 A;  2RK1 A;  5IAY A;  3L2V A;  4ELY C;  5LJ3 g;  1HXD A;  3RES A;  3JCM f;  2EYQ A;  2EQU A;  4FT2 A;  1YI2 A;  3BDL A;  4C0F A;  3KXT A;  3MHX A;  1G3Y A;  5A0L A;  5CVI A;  1YBY A;  2JVV A;  3FEO A;  4C92 G;  5GMK i;  2ZPE B;  4UC4 A;  3SDZ A;  2RHX A;  1KQ1 A;  3M59 A;  4EPC A;  4FL6 A;  3CME T;  1XOV A;  3P8H A;  4OB1 B;  4C8Q E;  5GAN 8;  4BY6 B;  2PVG B;  3S3M A;  3CMA T;  2GFA A;  2KAF A;  3QJ6 A;  2VC8 A;  2B8A A;  1O75 A;  2JZ2 A;  1VQ5 A;  4BAC A;  4XK8 E;  2MWO A;  1ZQ1 A;  3EAE A;  3CCM T;  1YJN T;  1JJ2 A;  2HQE A;  4M75 D;  2XDB A;  3A5Z B;  2OTJ T;  3QG1 A;  4XTU A;  5CK9 A;  4N4I A;  1VQ6 A;  3L2R A;  5KCO A;  1YHQ A;  1XTD A;  4C0D C;  2EWN A;  2RH2 A;  4LDV A;  4DOW A;  3S3N A;  5CO7 A;  3JCM d;  1ZHI A;  2A3L A;  1YIT T;  3EFR A;  3OSS C;  5I2M A;  4QVZ A;  3X25 B;  2K57 A;  4N0A C;  4IUV A;  4XU0 A;  2L3R A;  4JLI A;  1VQ8 A;  3CCU T;  3PMI A;  2LT4 A;  4M77 E;  4N4G A;  4A4G A;  4HKE A;  3RMQ A;  4A4F A;  4JRQ A;  1X01 A;  4RKU E;  4XAX B;  4ATO A;  4LDU A;  2A7Y A;  2RD1 A;  3NFC A;  2F5K A;  3JCM J;  1S72 T;  2P0Q A;  4M7D F;  3OYB A;  2PVD B;  2HNI A;  3CPF A;  4MML A;  4M78 D;  4L6V 5;  4OB2 B;  4ZGJ B;  2Y90 A;  4M77 B;  3TU4 K;  1W4S A;  2RB6 A;  4HT9 A;  4PJO A;  4OB3 B;  2RHU A;  3E1S A;  1VQ9 A;  2HQX A;  2AHJ B;  2MWP A;  3JAM E;  3CCJ T;  1VQP T;  3SWN C;  2P4T A;  2RO0 A;  1D3B A;  2K5I A;  5CCA A;  3CCR A;  4PJO C;  2LDM A;  3CCE A;  3TRE A;  3C12 A;  4LDW A;  3CMA A;  2P0K A;  4NOY A;  3FJP A;  4L5G A;  3J81 E;  3JCM g;  4C5I A;  3V7R A;  4BY6 C;  5FLX E;  1VQ4 A;  4C0G A;  1NPR A;  4X9C A;  4M7A F;  4LD6 A;  5KCH A;  1QW1 A;  2R5M A;  4NL3 A;  1K9M U;  3OYA A;  1Y07 A;  1JB0 E;  1M5Q 1;  4O5V A;  3VUZ A;  4F7U E;  1M90 C;  3JRZ A;  3OS2 A;  3JB9 J;  1Q86 U;  4M7A E;  2X4W A;  4C92 D;  4DQ2 A;  3JCM X;  2RI2 A;  3I56 A;  1YJW A;  4J83 A;  3VYH B;  1KD1 C;  3H8Z A;  3GIB A;  4M7D G;  4M7D B;  4PJO E;  3CBM A;  3LGL A;  3LWH A;  3HRT A;  5M9O A;  5C0M A;  2K3X A;  4M77 F;  4PKC C;  2DTI A;  1GXI E;  4PNO A;  3OYM A;  4J6X A;  4PJO G;  2M0O A;  1YCY A;  2CZ6 B;  2M9U A;  1K8A U;  5DY9 A;  5CKE A;  3HKS A;  4N4H A;  5GMK m;  2QA4 T;  1QVG A;  5FRN A;  2YLB A;  2ZPF B;  2PUO B;  3X24 B;  1I4K 1;  3G7Z A;  5GAN d;  2GFU A;  3MEV A;  4QVD A;  3CCJ A;  5GAO r;  3CCR T;  2DTH A;  3E9F A;  3M58 A;  1FXX A;  3GNG A;  2C06 A;  3DKM A;  2E12 A;  1VQM T;  3M57 A;  4M7A A;  4PLI A;  2EQM A;  1TH7 A;  1B34 A;  1QVP A;  3PT9 A;  4ZN1 A;  4Y28 E;  1K73 U;  1Y7X A;  4M75 B;  1Q82 U;  2HBP A;  4XTZ A;  4BI8 B;  3L2Z A;  3GOX A;  3ZBD A;  1U8R A;  2OTJ A;  2JUF A;  2LVM A;  3GLX A;  4C92 F;  4F7U B;  3R6O A;  4BUG A;  5LJ5 j;  3OYH A;  3CCV T;  3SD4 A;  3JSC A;  4IUQ A;  3SFM A;  1BI1 A;  3GNF B;  3UDC A;  2PVO B;  5J3B A;  4O6J A;  2DD5 A;  4ELZ C;  1LNX A;  4C8Q D;  1R8O B;  3I56 T;  1YJW T;  2BKD N;  2MMP A;  1WQ7 A;  4BI4 A;  4C5G A;  5LJ5 g;  4JS5 A;  3JB9 D;  2M16 A;  2QQS A;  5GAN 4;  4ZTF A;  1X6O A;  2GF7 A;  4M75 E;  5LJ3 h;  4BE1 A;  5GAN g;  2X4X A;  4BB7 A;  4A4E A;  2EKO A;  3VU3 C;  4B9W A;  3PIO A;  4XU1 A;  3CCM A;  3JB9 I;  3GPL A;  1D3B B;  4M77 A;  2PUK B;  4FT4 A;  3X26 B;  2JNG A;  4YTL A;  2LNV A;  4P5N A;  3FIF A;  1Y71 A;  4Q5W A;  3NTK A;  2QI2 A;  1I8F A;  4XU3 A;  3RKX A;  2OTL A;  2CZ0 B;  2L8D A;  1VQN A;  3WXM B;  5GMK h;  3S6W A;  3PMT A;  3CCS T;  5LJ3 e;  2YHT A;  1YIT A;  2FYK A;  2QEX T;  1M1K C;  4HCZ A;  3RKW A;  2DVE A;  3OW2 S;  4M78 G;  2M1H A;  2V8J A;  4C5H A;  2RHY A;  3RIR A;  3OYD A;  3L1A A;  2XG8 D;  4X9D A;  3LLR A;  4XU2 A;  5I2S A;  4BI3 A;  1KQS S;  1X75 C;  1I81 A;  1RL2 A;  1SSF A;  5CKH A;  1G3T A;  2FVU A;  5LJ3 f;  3JCM c;  2D9T A;  5A0G A;  3S3O A;  3G71 A;  1VQL A;  3FRN A;  4IUR A;  3CBP A;  5CQY A;  4J7F A;  2MF2 A;  3FC3 A;  1VQP A;  3M9Q A;  1G3S A;  3V8J A;  4KUD K;  3V8K A;  1WJS A;  2CZ7 B;  3P8D A;  3INZ A;  5FU6 C;  2KSS A;  2X35 A;  5GAN 2;  4N0A A;  3V7S A;  3ASK A;  5HK0 A;  1M4Z A;  3CCE T;  5GAN 7;  5GAM g;  5CKB A;  3JCM V;  3SB2 A;  2XI9 A;  1KQ2 A;  3ZFJ A;  1QP2 A;  4C8Q B;  1VQK A;  2O4X B;  4M75 G;  4OP0 A;  3TEE A;  3QUI A;  2E41 A;  2EJG A;  4LDX A;  5CKD A;  1BIB A;  2EAY A;  1WGS A;  3VV0 A;  1VQ4 T;  4HT8 A;  1VQO A;  1JJ2 S;  3RER A;  4M78 C;  4LD9 K;  3QYG B;  1M1G A;  1M1K U;  4EDU A;  3A8L B;  2E10 A;  5GMK j;  4IUT A;  3MP1 A;  1Q7Y U;  2P0P A;  4QQD A;  4NL2 A;  1BI3 A;  1RI0 A;  2DAQ A;  2E1H A;  3MCA B;  4M77 D;  3OYC A;  4C92 E;  2FB7 A;  3OS0 A;  1OYX A;  2LCC A;  3CC7 A;  2RHI A;  1KC8 C;  2V8I A;  4XTY A;  4PJO D;  2ZZD A;  3A8G B;  4QW2 A;  5HY6 A;  3X20 B;  2DPP B;  3CPW S;  4JUV A;  4OGE A;  3CXC A;  2ZGW A;  2D0Q B;  4C8Q G;  4HCB A;  5GAO p;  4J6W A;  4EMK C;  4DA4 A;  1QVF S;  3C4S A;  2VXF A;  2WSC E;  3LW5 E;  4RCB A;  5D6Y A;  4F7U G;  3OY9 A;  1VUB A;  3P8B B;  3MP8 A;  4M75 F;  5A2Q E;  1EIF A;  2O4X A;  3CPW A;  5FU6 B;  5GAO l;  5CR2 A;  1VIF A;  5IN1 A;  2XDD A;  1N6A A;  3FLG A;  2E6N A;  4M7D C;  2QA4 A;  2BIV A;  2CYZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...