4LD9K

Crystal structure of the n-terminally acetylated bah domain of sir3 bound to the nucleosome core particle
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
214
structure length
210
Chain Sequence
b'AKTLKDLDGWQVIITDDQGRVIDDNNRRRRGGENVFLKRISDGLSFGKGESVIFNDNVTETYSVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIKIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title The N-terminal acetylation of Sir3 stabilizes its binding to the nucleosome core particle.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Nuclear protein/transcription/dna
total genus 32
structure length 210
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01426 BAH BAH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.490 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ld9K00
3PTAA 2FVUA 4FT2A 4DOWA 1W4SA 1ZHIA 4KUIA 4JJNK 4KUDK 4DOVA 4KULA 2FL7A 4FSXA 3TU4K 4DA4A 3PT9A 4LD9K 1M4ZA 1ZBXA 4BB7A 4FT4A
chains in the Genus database with same CATH superfamily
3PVLA 3U23A 3PTAA 2JZ2A 2EAYA 4Z89A 2HNIA 1GXIE 1RUWA 5GAMe 4QVCA 3RKXA 5LJ3d 1BI3A 2JMCA 4ZTFA 3FJ5A 4QQGA 1KQSS 1TWBA 2RF0A 5IHKA 4PJJA 2DRKA 3THKA 1SRMA 1VQNQ 1Y0MA 1TH7A 2CREA 2O9VA 1V76A 4E7KA 2XDPA 1QP3A 4OB2B 4OMNA 4ZGJB 2LJ3A 4PJOF 4RTZA 2ZAEA 3EHRA 5CR2A 3RNJA 2LT1A 3VUBA 4DQ2A 3JB9F 4N4HA 3V7RA 2DYBA 3NHNA 4QVDA 1SG5A 2JNGA 3C0CA 3SWNC 2EW3A 2QTXA 1MV3A 3DLMA 2ZGWA 2EQIA 2DL4A 2CSIA 4M4ZA 3VV0A 3QXEB 1VQ4T 1QVFP 4JUVA 5M9OA 1B34A 1GCQC 3QJ6A 2GFAA 2QQSA 1ZQ1A 2K2VA 2BKDN 1KJWA 2RQWA 1G3WA 5FU6B 2YWWA 5IN1A 3BDUA 2LZ6B 3JCMX 2OTJT 3M56A 2ROTA 4O6JA 3A8GB 2C06A 3KUFA 2DLPA 2XIDA 4MZTA 2QQAA 2MOXA 3X24B 1VYVA 2PUKB 3V7CA 3NGPA 2H3JA 1LJOA 1RI0A 2AKLA 4FW2A 2A28A 5LJ5j 3OYIA 2FPDA 2CT4A 2J06A 2GQIA 5IHNA 1JEGA 4RMOA 5KYYB 1TG0A 3BE3A 4A54A 1TSFA 4A4GA 1MMAA 3CBOA 5EC7A 4M7DC 3EG3A 2RPNA 1I4K1 4AFZC 3HHTB 1ZSZC 2KRSA 3M53A 1W6XA 1Y57A 5GAOn 5HK3A 3V8LA 1VQOA 4J9FA 5FW9A 4L5GA 3JCMc 2VWFA 5GANj 2VXEA 1KC8R 1GL5A 1K9MU 1WIEA 1K4US 3RESA 2X3XD 3FEOA 4C92F 2FB7A 4HCKA 1QVGS 1Q7YU 4E7IA 2I0NA 3RDVA 1VQOQ 3QWXX 1Q81C 1HK9A 2DL5A 5GMKe 2CGHA 2NWMA 3CCLT 1R0CB 1HJDA 2K5IA 1U8RA 4M77F 2GFUA 4X9CA 4PJLA 1WJRA 3MP6A 1VQMQ 1TTHB 4XU3A 3JB9J 3LH5A 2X9HA 1YI2Q 1ZUKA 1GBRA 1VQ8T 4HVVA 2E3IA 3I56A 4J7IA 3FIFA 4E2FB 3QJYA 1JQQA 1I5LA 3CCRT 1WHGA 3C94A 5FU7B 4KUDK 4FYYB 3UA6A 3I55T 3D7SB 3L2RA 3HRSA 2MK5A 1Q7YR 4J9CA 4FCYA 1KK7A 1RLQC 2M0OA 1WHLA 1BI0A 3I56Q 5CIUA 2O2OA 4DBRA 3OYKA 1X6OA 3META 3JB9D 4F7UB 5LJ3g 1K76A 2E5QA 1SPKA 4ZN3A 5GJWB 4BE0A 1FMVA 4J83A 4ME7A 5GAOl 3EHQA 2JTFA 3CC7Q 4J8OA 3G71A 4XK8E 2KBTA 4OB3B 1M1KR 3JB9G 2JTEA 2P0KA 1OI1A 2ZPEB 5FLXE 3CXCP 3M0PA 1ZA1B 4Q5WA 1HSQA 4E47A 1YIJT 3G71Q 1X75C 3FB9A 1MUZA 3X28B 3L2QA 3ME9A 1XNIA 3BFMA 2ESWA 1M5Q1 4C8QF 3OY9A 2VV5A 1IZ6A 2XG8D 4F7UE 4ATOA 3PNWC 3EFOA 1YITA 4PJNA 3GLXA 1QW1A 5KYWB 2O4XA 1VQLA 1BIAA 2CS7A 2QQBA 2W0ZA 3G6EA 1VIFA 1K0XA 1VQKT 5L8RE 2VUBA 3EGXB 3MO8A 2FO0A 4AFUC 3CCVQ 3OSVA 2J6FA 2JM8A 2Z0WA 1M90U 4ANJA 4OVAA 3CD6A 2WSEE 3SB2A 3M58A 4HVWA 1YITQ 1AZGB 1VQLQ 5A0LA 1CKAA 2DTOA 2AK5A 4C0DB 1RAHB 3SWNA 1UJYA 1M2VA 3CC2A 1LVKA 4XTZA 1D0ZA 4QT7A 2COYA 1AWXA 1QVFS 3J80E 2F2WA 3CD6Q 4M78B 1MGQA 2ECZA 3HFOA 4JS5A 1GCQA 4EMHA 1OX8A 2ED1A 1PM3A 1IHWA 3CC2Q 3CCSA 4N0AC 2RHIA 1I1JA 1KQSA 3FDRA 4JJBA 3VS7A 1KC8C 1S72T 2M0YA 3VS3A 5LL6S 5LJ5d 1I0CA 1YJWT 1WXBA 2M51A 3CCSQ 3H0IA 4LDYA 4JDSA 4J6WA 3FRNA 4M7DA 2O01E 4M78E 4M7DF 2ABLA 3L2ZA 4NS5A 1ZSZA 1SSFA 2R5AA 1T0HA 3CC4Q 3LGFA 4FL6A 4AG2C 2COZA 3ZFJA 1I5OB 2EYYA 5GANd 1SHFA 1VQ9T 3OA6A 2DTHA 1FXXA 3UATA 3M0QA 3M5AA 4LDWA 1LOJA 2LTOA 1WHJA 2X35A 5J3BA 2DL7A 1H92A 2QAZA 2DEUA 2L0AA 2E41A 2FZGB 3S3NA 2DMOA 1VQ4A 1Q7YC 2ENMA 5KE3A 1M3CA 2JW4A 4A53A 1K73R 3CQTA 4AT1B 3A1PA 5LJ3e 2KMTA 2V26A 1PCXA 1WDXA 4A4EA 2VC8A 1UGSB 3ZBDA 5FU7C 2OTJA 2DEQA 4ESRA 1PNJA 2MF2A 1QQJA 2GBQA 2JS0A 3EG9B 3CEYA 4XTXA 2D8HA 2QA4T 1AOJA 3JCMV 2HD0A 2DL8A 1VIEA 4IUTA 1NPRA 2FL7A 1M1KC 2LNVA 2XDDA 3X26B 3UT1A 3JCMW 2OTJQ 1KIKA 2RQVA 3VU3C 5GMKl 2RN8A 3JB9H 2JOYA 2QEXT 2LRQA 1OYXA 3O5ZA 1UGPB 2E64A 1WPYA 4HA8A 4PNOA 4OMOA 2LCSA 5KYXA 1Q81U 5D7UA 1RABB 2DA9A 4F04B 5A2QE 3PIPA 2CP6A 2KVQG 4X1VA 1X6BA 3OYBA 4LUDA 3ZEHA 2GTOA 4L6V5 1QVGA 2E10A 1YNZA 1MMDA 1JJ2P 1C1AA 4EMKC 2YUQA 2R57A 2DD5A 4QQ6A 3V7SA 4BI4A 4D8KA 2MCNA 2DYIA 4KGXB 2VGMA 1XOVA 4PLLA 3BW1A 2YXYA 3OYGA 5C0MA 1T0JA 2KGTA 2DIQA 2VKNA 3MEAA 3EFRA 3V8KA 3CCQT 5CKBA 4IIOA 3CXCS 5GAMj 2HEQA 1VQ6T 5KYNA 3CCLA 2QXFA 1WHMA 3RMSA 3OW2P 1RAEB 2KAFA 1OPKA 4PFOA 3AT1B 1XJWB 4MZPA 1W2BA 4JZ4A 4PFPA 2J6OA 4FSXA 1YFNA 1YBYA 5LJ3f 4A4HA 2EBPA 1G3SA 3MJXA 4BDZA 3EGDA 4MDXA 3CCLQ 2B86A 1VQ8A 1MNDA 2DO3A 1WX6A 2YRDA 5I21A 3LW5E 5KYUB 1Q82R 9ATCB 3NTHA 2PNIA 4XU1A 1UHFA 2ZPIB 2YUOA 1UECA 4ZGEB 4M78C 3CCRA 5L23A 1IGUA 4M7DD 2RMOA 1K9AA 3GBQA 2NUZA 3I55A 1EFNA 1KD1R 4J9HA 3HKSA 1OU9A 2EFIA 4J9BA 2MMPA 2OX7A 5LJ5g 4OB1B 2KE9A 1VQ8Q 1QVPA 2DXCA 2L89A 2RA2A 4WF2A 4J9EA 4D8DA 2K5LA 2DAQA 3CCRQ 2FZCB 4M7DG 1Z9ZA 3VRYA 3I55Q 1FYNA 1M3AA 4BUGA 3TEEA 2YDLA 3HSBA 2RQTA 4NL3A 2KI7A 4BE2A 4IUPA 1VYUA 5AT1B 1JU5C 5LJ5h 1WI7A 5KYYA 3JCMg 4N0AA 3VS5A 5IT9E 3GNFB 4D6WA 2FZKB 3H0FA 3SD4A 5GANg 2CYZB 5KCOA 1KQ2A 2E6NA 1K1ZA 5GAN2 2ED0A 2VVKA 4OMQA 1D1BA 1W4SA 3CPWP 1KFZA 4M7AG 2P0QA 2BIVA 2P4RA 1YIJA 2JVVA 3OYEA 2YT6A 4RTVA 2HQXA 5FRMA 3BDLA 2VXFA 2X4XA 2EQUA 3G7ZA 1Y71A 3DLLA 3OYFA 1K73C 3JCMh 3V8JA 3VRZA 2ZZDA 4X9DA 1IGQA 2GGRA 5GANh 1D3BB 3OYDA 2ZPBB 1YIJQ 1VQKA 1QMCA 2R58A 1JO8A 3NMZC 3MPUB 5I2SA 2EGAA 5DLQE 4ZNXA 1F1BB 1SEMA 4M75B 2EYZA 3JB9I 2C0IA 2IIMA 1QVFA 2DBMA 2RHZA 1X01A 3OBYA 3QUIA 1N5ZA 2F1LA 4N4GA 4KH1B 3L42A 1T3SA 2FPFA 4V2SA 2HL5C 1KC8U 2DX1A 1VQKQ 2GQVA 4NOYA 5GMKj 1M27C 3J81E 2PTKA 1KG1A 3CCMT 1AWOA 2K3YA 4HT9A 2H3EB 2CZ0B 2SEMA 5IXBA 3JCMP 2QGGA 1NJIR 1NM7A 1M9SA 3OYLA 1FWZA 2YSQA 3OS0A 2D9TA 2QDYB 2BE9B 3NTIA 2A37A 4UC4A 3L2VA 2D8JA 1ARKA 4M75E 4MZMA 1S72A 2EQMA 1H3ZA 1OU8A 2DM1A 1AD5A 4BDYA 5DLOA 1V1CA 3GF5A 5GAN4 3JCMb 1SHGA 4KBMB 1YJWA 2RJFA 1G2BA 1C0MA 4PJOB 3UWNA 2D1XA 1OOTA 3VS6A 1AWWA 3CBMA 5CVIA 2DIGA 4M7AC 3OB9A 1LNXA 1S72Q 1N9RA 1OULA 2C0OA 1WA7A 4OMMA 2DJZA 4E7HA 2RHUA 4FYXB 2B8AA 4WTOB 1YJWQ 5FRNA 3OS2A 1D09B 3EFSA 4N4IA 4C5EA 5EG2A 4EMKA 1B34B 1VQPT 4FYWB 1VQ9A 3OQ5A 2K57A 2PVDB 2L2PA 1G3TA 2EIFA 1I81A 1Q82C 1I07A 3L1AA 4LE9A 5CKEA 1M1KU 2DRMA 1OZ2A 4R0KA 4FM4B 1KD1C 3CCJT 4PJOE 1YHQT 1BKBA 1VQ9Q 7AT1B 1LCKA 5KYWA 4B9XA 2F2VA 1QWFA 2L3QA 4OB0B 5J26A 3KXTA 1OQKA 3NPFA 5CKHA 1WFWA 3OW2S 3MHXA 3OSSC 4Z8AA 3LWHA 2X4WA 2X3WD 2DETA 3VYGA 3TCJA 1BYMA 4XTVA 3C12A 3DKMA 3QYHB 2EKHA 3E19A 3QZ9B 5GAN5 1WXUA 1YWOA 2QA4A 2WACA 3HTRA 3QPHA 4IKFA 3M54A 2RI3A 3A8MB 2RHXA 2K5FA 1BI2A 1R77A 2BUDA 2JT4A 1X27A 3FJPA 2MWPA 4M78A 2ZPFB 1UB4A 2QEXA 2M16A 1B7TA 1VQNT 1D0YA 1PRLC 4JJCA 1M8VA 2DBKA 1P92A 4IUUA 2GNCA 4IURA 1NYFA 1UE9A 4C92B 1JB0E 2WSCE 1JXMA 4ORZA 3I9QA 1PSFA 4OP0A 2CKKA 3QKJA 2DPPB 1PG5B 3PE0A 1PRMC 3CXCA 2QEXQ 3SEMA 2ROLA 5GAOm 4LN2A 2CUBA 1PD0A 2RJCA 4M77B 2CZ6B 3TSZA 1N8RU 1OZ3A 5DM7R 1GFCA 4LUEA 4JLGA 3LLRA 1V29B 2XKOC 2CH4W 2BZ8A 3CCQA 3AHUA 2DNUA 2QGFB 2KSSA 2LJ0A 4CRIA 1X2KA 3VUZA 1VQ6A 2LX9A 3CCUT 1GRIA 3E1SA 1UFFA 1M3BA 3CPWS 2P0PA 5LJ5f 4C92E 4GY5A 5FU6C 2QQ9A 3G6EQ 2A08A 3ZL7C 3CCQQ 4JRPA 4E6RA 2K3BA 3TVTA 1NZ9A 2YLBA 1IRXA 3QDRB 1VQ6Q 1NJIC 1BBZA 2PQWA 4JJDA 1VYTA 1QLYA 4M77E 1EX4A 1NG2A 2FEIA 3CMET 1N8RR 3EH2A 1G83A 2KK4A 2KT8A 3JCMf 1AVZC 4DOVA 2M1HA 5GANf 1QWEA 4EPCA 4BACA 2E1HA 1PC0A 2HCKA 4J9DA 1R8OB 2EJFA 3LGLA 3RBBB 3EH1A 1A0NB 4OMPA 4KGZB 1VUBA 2XU8A 3EG9A 1B3QA 4EMGA 2CZ7B 3INZA 4IUVA 2PUOB 3BY7A 3E9GA 4XTUA 1U5SA 4HCCA 4HKEA 1K73U 3M9QA 4J7FA 2LT4A 2MAMA 1U06A 4C8QB 4PFZA 4PJOC 2HKNA 3OYNA 5GAOp 4OGEA 1Q95G 4PLIA 8ATCB 4RTXA 2DXTA 2HKQB 1MNEA 3OYHA 2X4JA 4HVUA 3JCMd 2CP0A 2AT1B 3RERA 2CUDA 2AHJB 1VQ5T 1HYOA 1D0XA 1Z9QA 2RQRA 1UDLA 1UUEA 2K79A 1E6GA 1YCSB 2AIRB 3QIIA 5GAMg 1NEBA 4VUBA 1HD3A 4Z02A 1VQMT 4M7AA 1RAGB 2Y90A 1YI2T 1EIFA 2YUNA 2QK0A 1XQHA 4M7AF 2YLCA 2EYXA 3H0HA 1Q86R 3H41A 1VQ7T 1ACMB 4J6XA 2RQUA 1ABQA 1BCOA 4RTUA 5DY9A 1AHJB 1M2VB 4M78D 1FMWA 2L5QA 2LQKA 4C8QE 1BI1A 5IH2A 1ZUYA 3WVEB 1WQWA 2F2XA 1FMKA 4C5GA 3CPFA 2FYKA 4PJMA 2LQNA 2V1RA 5GAMh 3E2UA 4K11A 3S3MA 1VQ4Q 3CCET 2EJ9A 4M78G 4LDUA 3OMCA 5KCHA 1PHTA 3OYCA 3OS5A 4ZN1A 2JJ9A 1NLPC 2EQKA 1WYXA 2LCCA 1K8AR 1ZUUA 1SF9A 2K6DA 3CCMA 3MEWA 3E9FA 2X4YA 1M2OA 3CC7T 3S3OA 1IREB 4ZGDB 1H8KA 2ZCFB 5KYUA 2DILA 1N27A 3NTKA 3CCMQ 2YRVA 1SKUB 3GPLA 3A5ZB 1WJQA 1S1NA 2V8JA 4C92C 2DK3A 2E12A 5CQXA 4R55A 2NUTB 5J39A 1ZSZB 5FROA 4A4FA 4CI0C 4MDWA 3T9NA 5GAN6 1WHKA 3VS4A 5GMKm 2KRMA 1Q82U 5CQYA 2VASA 4XAXB 2E70A 3R6OA 4DBQA 1NLOC 4GBQA 4M77C 1KD1U 1GFDA 2QQRA 2O9SA 4PL6A 2D6FA 1ZSGA 2J05A 4AG1C 3CCVT 1RAIB 3DB4A 2CZ1B 4RUGA 1IXDA 5GAOr 1PD1A 1WQ7A 2O31A 3M57A 3MCAB 4C0GA 2EYQA 1VQPA 1WJSA 4OF1A 2MPXC 5I22A 3JAME 4B6MA 3PIOA 1Y96B 3OW2A 2RB6A 2KRNA 2EKOA 2DXUA 2J7IA 1W2BP 5GAN8 1N8RC 1IO6A 4C0DC 3HP9A 5FWCA 3OMGA 2EQJA 1VQPQ 4KGVB 3CCJA 4BY6B 1YHQA 2J6KA 2KQWA 3QBYA 2X51A 2RK1A 1D3BA 2IVWA 1WGSA 4KH0B 5CKDA 2P4TA 1M1FA 3GIBA 1RLPC 2P84A 4AMCA 2AKKA 3ASKA 5CK9A 1NE8A 3P8BB 3CCJQ 4RTWA 1PKTA 1W70A 3OS1A 1YJ9T 3OYAA 1YHQQ 1ZA2B 2A7YA 2L8DA 3FC3A 1M8MA 1R0BG 3M0TA 1JBMA 5IAYA 4MMKA 2KDSA 5GMKh 2EGCA 4M7AD 2OAWA 2FG0A 3OYMA 1U3OA 2EJGA 3QHSA 2EGEA 2XMFA 4HT8A 4C0ZA 1VQNA 1Y7XA 5HCKA 4C8QC 2EWNA 4JPBW 2NYSA 4LNPA 2KT1A 3C4SA 4JRIA 3EG2A 3CC4T 2KYMA 3R6NA 5KH6A 2QI2A 1WZOA 2KXCA 3NFCA 1U1TA 3X25B 4F16A 2JUFA 1TOVA 4RCBA 2ATCB 4QVZA 4E7SA 1H641 1Q86C 2DZCA 3CPWA 1QKWA 2QDLA 1RAFB 3PFSA 1BCMA 1NJIU 4PJOA 4MMLA 2HMAA 3EAEA 2VYTA 3HRUA 3J7AF 1QCNA 1ABOA 4A63B 3QYGB 1DJ7B 3QWYA 4BD3A 3RIRA 2COWA 1TUDA 2E4HA 4YTLA 1RL2A 3EGDB 3CCUA 1RAAB 3A8HB 2C0TA 2K3XA 2O88A 2H8HA 4FYVB 3GNGA 2NUPB 3VS1A 2WSFE 1K8AC 1RACB 2ZPGB 4NL2A 1M1GA 1X2QA 1RI9A 3VS2A 4C0FA 3QDFA 3L2UA 1UGVA 2LP5A 2PZ1A 4XTYA 2L3SA 4Z88A 3CCUQ 3M0SA 2OI3A 1M30A 3PT9A 1MV0B 2DERA 4IIMA 2DJQA 4Y28E 1HXDA 4LXCA 3TQ7P 3QO3A 4E7JA 1IHVA 3CMEA 4E7LA 1Y07A 2E3HA 2CP5A 1GBQA 1YJNT 1BU1A 4C5IA 5A0DA 3M4GA 2OJ2A 3ULRB 3URGA 3CMAT 4OMFB 3M0RA 1FX7A 1H3HA 1E7OA 2DD4A 1RADB 4L59A 3RKYA 3CMEQ 4FIBA 2XDBA 1PKSA 2DFUA 2DE0X 4F7UA 3I35A 3G4ST 2MI6A 1X43A 2RJDA 2KXDA 5GAMf 3WXMB 4F7UF 1YWPA 5D6XA 3IQLA 3JCMQ 3QSUA 2OAUA 5GAN7 2RK2A 4J9GA 4RG2A 3HFNA 4JRKA 2HBWA 2KNBB 1OEBA 4RKUE 4ELYC 4PK4A 1PWTA 4EDUA 1JXOA 1D1CA 2RM4A 3PGGA 4RCCA 4DEXA 2RD1A 4C92A 4M75D 1JJ2S 1VQ5A 4R56A 2K2MA 4JJNK 4A4KA 4TVRA 2KYBA 3M0UA 3OYYA 2EVRA 2R5MA 4Y91A 2XK0A 4DBFA 3GP8A 2V8IA 3G1JA 5D6YA 1VQMA 2K9GA 2IG0A 2L3RA 2RNAA 2IPOB 4M77A 3TREA 1YI2A 5LJ5e 4M75G 5GAMd 1VQ5Q 1PSEA 5GMKi 1VQ7A 3C95A 4CC7A 3PMIA 2OTLT 3KFVA 4BY6C 1YN8A 2GTJA 3EGXA 5IHIA 1W1FA 3HPWA 3REBB 3P8HA 1EZZB 2DZ9A 3CCEA 1VQ7Q 1K9MR 5CO7A 2RH2A 3M4YA 4C5HA 2YRCA 1W2BS 2JTMA 3SDZA 3JCMe 2RJEA 4DBHA 1ZBJA 5GANe 4FW1A 6AT1B 2CP2A 5I2MA 1M4ZA 4XU0A 3WVDB 3CC7A 4PJOD 3HL8A 3CCEQ 1WNLA 3MP1A 4M78F 1TXQA 2BZYA 2QA4Q 4WCIA 2CP3A 1OPLA 2XD0A 4FT2A 5D6WA 3LX7A 1AT1B 1MMNA 1MHNA 2MWOA 3LWIA 4O5VA 2F5KA 2PVGB 4OMLA 1K0SA 4PJOG 4OGCA 2L3PA 2XI9A 1ZBXA 4AFSC 5HKCA 3JCMJ 2F69A 1OV3A 3ER0A 2D0QB 2LMJA 1ZX6A 4EMKB 4F17A 3OBWA 5LJ3h 3QZ5B 4HXJA 2DTIA 2CT3A 1G5VA 1T3LA 2E6ZA 4KULA 3DB3A 2FRWA 4RG8A 2E65A 3EG0A 4C8QA 2LX7A 1GCPA 3CBPA 2A0FB 2LDMA 1N6AA 3VKIA 3CCVA 4LDXA 2HDAA 2D0NA 4BB7A 1UEBA 4LDVA 2M9UA 3VYHB 5CKFA 2HAXA 2MIOA 4IUQA 3S6WA 4M75C 2DL3A 5KE2A 2DVJA 4FU6A 3JRZA 4J9IA 1UJ0A 2W10A 4J6YA 1UGQB 4GLMA 4P5NA 2G6FX 2LC4A 2LVMA 3H6ZA 4FT4A 2JS2A 3JSCA 4RTTA 3OYJA 4XTWA 4E7ZA 1AWJA 2RHYA 3Q1JA 1TS9A 3UDCA 1NBEB 2KROA 5HY6A 1ZHIA 3QG1A 1WLPB 2FPEA 2JMAA 4F7UG 2CDTA 2LNHB 3I5RA 1E6HA 2DKGA 4II1A 2KR3A 2QG9B 3LYIA 4C92D 1YJ9A 2RO0A 2BTTA 2V1QA 2CSQA 5CCAA 1CKBA 1KHCA 5LJ3j 1KQSP 2F5TX 2EPDA 3UA7A 3F70A 1Q86U 2XHCA 4ZTJA 1BK2A 1YCYA 1IB8A 2M02A 2MYSA 4CC2A 3MP8A 4M77D 4LD6A 1YJ9Q 4C92G 1QCFA 1M90R 1UTIA 1VQOT 1XTDA 2DF6A 4ELZC 1O75A 3GOXA 4FSSA 3CC4A 3EFOB 1SRLA 2O4XB 4CC4B 3HRTA 2EYWA 4M77G 1K8AU 2FRYA 3A98A 1QCOA 4LD9K 1CSKA 1D1AA 1JRIA 1KHIA 2QASA 2NUTA 3TSWA 4HCZA 3MEUA 2LJ1A 2NLUA 3RKWA 3I5SA 1QKXA 3M59A 2V8KA 2YUPA 4DEYA 2HSPA 4HCBA 1U1SA 1X6GA 2CP7A 1MMGA 5ECAA 3SWNB 3UPUA 3MEVA 4DA4A 2LCLA 5HK0A 1K9MC 3FLGA 4XQ3A 2ZPHB 4QW2A 2JN0A 3I56T 1G8XA 4J5YA 2FVUA 5A0GA 3RUXA 4JS4A 2RI2A 1TUGB 1Y96A 3EGUA 4KRTA 4EIKA 2HL3A 4BI3A 2BZXA 2HQEA 1NEGA 1UHCA 2A36A 4JZ3A 1C6VX 1WHHA 1VA7A 2QYZA 1X69A 2FHDA 5GAN3 3SHWA 4C8QD 3RR6A 1YJNA 4CC3A 2PVOB 1J3TA 1YP5A 3MKDA 1UG1A 2YHTA 4RTYA 2RI5A 3CMAA 4B9WA 3M55A 2VB6A 4M7DB 1TU0B 2AZSA 2E5KA 4XU2A 3G71T 5IXFA 1ZLMA 1QVGP 2HZYA 1KQ1A 3G4SA 4C8QG 1YJNQ 2LQWA 1JJ2A 1O9SA 2GF7A 3PVQA 4QKUA 4X34A 3SFMA 3CMAQ 4BI8B 4AFQC 1AEYA 1VOMA 3A8LB 3VJPA 3UF4A 2A3LA 5C6SA 2AZVA 3G4SQ 1B07A 4M7AB 3O8VA 5AYFA 2HQHA 1UGRB 2CH4A 5GJVB 4JRQA 1YITT 2KEAA 1VQLT 3PMTA 3G6ET 2LQ8A 3EG1A 2XICA 3LH0A 4JLIA 2HBPA 3TU4K 2GCXA 1BIBA 1G3YA 2I2LA 4PKCC 4M7DE 1AZEA 5GAOq 4BE1A 4GLKA 1OX9A 3CD6T 2DVEA 2HSEB 2JXBA 1N9SA 1Q81R 1SSHA 2KY9A 2DXBA 2Y4XA 1QP2A 3VS0A 2VGNA 4KUIA 2OTLA 3CC2T 3KBGA 3X20B 4QQDA 4M75A 2Y4YA 3JV3A 1I8FA 2QTVA 2K4YA 4M75F 4M7AE 4F14A 1BB9A 4Y92A 2NUPA 5I11A 1TUCA 2BE7D 1LPLA 2SRCA 3A8OB 1KSWA 3H8ZA 3N5BB 5KYXB 5FWBA 2OTLQ 4DOWA 3L2WA 3CCST 1M90C 3P8DA 2G3RA 5CAIA 1NYGA 2PU9B 3H9NA 4KT0E 8AT1B 1WXTA 2JM9A 3REAB 1NPPA 3RMQA 2K7AA
chains in the Genus database with same CATH topology
4EDUA 3PTAA 2MF2A 2P0PA 2JZ2A 2EAYA 2RM4A 3PGGA 4RCCA 5LJ5f 2RD1A 3CEYA 2HNIA 4XTXA 4GY5A 4C92E 4C92A 1GXIE 4M75D 5FU6C 1JJ2S 2QA4T 5GAMe 2QQ9A 3JCMV 1VQ5A 2HD0A 4QVCA 4R56A 3RKXA 5LJ3d 4JJNK 1VIEA 4JRPA 1BI3A 4IUTA 1NPRA 4TVRA 4A4KA 2FL7A 4ZTFA 1NZ9A 1M1KC 2YLBA 3QDRB 3OYYA 4QQGA 2R5MA 2LNVA 2XDDA 3X26B 1KQSS 1NJIC 3UT1A 3JCMW 4Y91A 2XK0A 3GP8A 3CPWS 2PQWA 3VU3C 2V8IA 5GMKl 5D6YA 1VQMA 3JB9H 1TH7A 2IG0A 2JOYA 2L3RA 4M77E 4M77A 3TREA 2QEXT 1YI2A 2LRQA 1OYXA 5LJ5e 4M75G 1UGPB 2E64A 2XDPA 5GAMd 4E7KA 3CMET 1WPYA 1PSEA 1QP3A 4HA8A 4OB2B 4PNOA 5GMKi 1Q81U 1VQ7A 5A2QE 2KK4A 3C95A 4ZGJB 3PIPA 2KVQG 3JCMf 3OYBA 4PJOF 3ZEHA 3PMIA 4DOVA 4L6V5 1QVGA 5CR2A 2M1HA 2OTLT 2LT1A 2E10A 3VUBA 4BY6C 4DQ2A 5GANf 3JB9F 4N4HA 3V7RA 4EPCA 4BACA 4EMKC 2E1HA 4QVDA 1R8OB 2JNGA 3HPWA 3SWNC 2R57A 2QTXA 3LGLA 2DD5A 3P8HA 3DLMA 4QQ6A 3V7SA 2DZ9A 4BI4A 3CCEA 2ZGWA 5CO7A 1VUBA 2XU8A 2RH2A 2VGMA 3M4YA 3VV0A 4C5HA 4EMGA 3QXEB 1VQ4T 1XOVA 4JUVA 2CZ7B 1B34A 3INZA 2PUOB 3BW1A 3BY7A 3E9GA 4IUVA 4PLLA 2JTMA 3SDZA 5C0MA 3JCMe 4XTUA 3OYGA 1W2BS 3QJ6A 4HCCA 2GFAA 2QQSA 2RJEA 4HKEA 1K73U 1ZQ1A 2K2VA 3M9QA 2DIQA 4J7FA 3MEAA 3EFRA 2LT4A 2MAMA 2BKDN 3V8KA 5GANe 3CCQT 4C8QB 5CKBA 1G3WA 4PJOC 5FU6B 5I2MA 3CXCS 1M4ZA 4XU0A 5GAMj 3OYNA 3WVDB 3CC7A 5IN1A 1VQ6T 4PJOD 5GAOp 3HL8A 1WNLA 3BDUA 3MP1A 3JCMX 4OGEA 3CCLA 2QXFA 4PLIA 3RMSA 3M56A 4M78F 2OTJT 4O6JA 2DXTA 2KAFA 3A8GB 3KUFA 2C06A 2XIDA 3OYHA 2X4JA 4MZTA 3JCMd 2XD0A 2QQAA 4FT2A 4MZPA 5D6WA 3RERA 3LX7A 3X24B 2AHJB 1W2BA 1VQ5T 1MHNA 2PUKB 3V7CA 2MWOA 3LWIA 4O5VA 4FSXA 2H3JA 1LJOA 1RI0A 3OYIA 2F5KA 1YBYA 2PVGB 5LJ5j 5LJ3f 4A4HA 4PJOG 1G3SA 2XI9A 4OGCA 4BDZA 4MDXA 1ZBXA 3QIIA 5GAMg 4RMOA 4VUBA 4Z02A 5HKCA 4A54A 1VQ8A 4A4GA 3JCMJ 1VQMT 4M7AA 2F69A 2DO3A 3ER0A 2Y90A 5I21A 1EIFA 3CBOA 3LW5E 1YI2T 1XQHA 2D0QB 3NTHA 4M7AF 2YLCA 4M7DC 4EMKB 4XU1A 1I4K1 3OBWA 2ZPIB 3HHTB 5LJ3h 3QZ5B 4M78C 4ZGEB 3CCRA 2DTIA 1VQ7T 4J6XA 4M7DD 5DY9A 1G5VA 1AHJB 4M78D 3I55A 2L5QA 3M53A 2E6ZA 4KULA 3HKSA 3DB3A 2LQKA 4RG8A 1BI1A 2EFIA 2E65A 4C8QA 4C8QE 2MMPA 5LJ5g 3CBPA 4OB1B 3WVEB 1WQWA 5GAOn 5HK3A 2LDMA 1N6AA 3VKIA 3V8LA 1VQOA 1QVPA 4C5GA 2DXCA 2L89A 2FYKA 2RA2A 3CPFA 4L5GA 3JCMc 3CCVA 4LDXA 4WF2A 4BB7A 1UEBA 4LDVA 2M9UA 3VYHB 5CKFA 5GAMh 2HAXA 2K5LA 3S3MA 2DAQA 5GANj 4IUQA 2VXEA 3CCET 3S6WA 4M75C 1K9MU 2EJ9A 4M7DG 5KE2A 3RESA 4FU6A 4LDUA 3OMCA 4M78G 5KCHA 3OYCA 3OS5A 4ZN1A 3JRZA 2EQKA 3FEOA 4C92F 2FB7A 4BUGA 2LCCA 1QVGS 3TEEA 1Q7YU 3HSBA 4NL3A 4BE2A 4E7IA 3CCMA 3MEWA 4J6YA 1UGQB 4IUPA 3E9FA 4P5NA 2X4YA 5LJ5h 1Q81C 1HK9A 2LC4A 5GMKe 3CC7T 3JCMg 2LVMA 4N0AA 3S3OA 2CGHA 3H6ZA 3GNFB 4FT4A 4D6WA 3JSCA 5IT9E 3OYJA 3SD4A 4XTWA 3CCLT 1IREB 4ZGDB 2ZCFB 2RHYA 3Q1JA 5GANg 2CYZB 2K5IA 1U8RA 4M77F 5KCOA 2GFUA 3UDCA 1KQ2A 2E6NA 5GAN2 4X9CA 1N27A 5HY6A 1W4SA 1ZHIA 3NTKA 4M7AG 3QG1A 2YRVA 3GPLA 2P0QA 2BIVA 1WJRA 1YIJA 3A5ZB 2JVVA 3MP6A 1WJQA 4F7UG 3OYEA 2V8JA 4C92C 2DK3A 2DKGA 2HQXA 2E12A 4II1A 5CQXA 4XU3A 5FRMA 4R55A 3JB9J 3LYIA 3BDLA 2VXFA 4C92D 2RO0A 5J39A 1YJ9A 5FROA 4A4FA 4CI0C 2X4XA 4MDWA 2EQUA 3T9NA 5GAN6 1VQ8T 3G7ZA 1Y71A 5CCAA 3OYFA 3I56A 3DLLA 1K73C 3JCMh 1KHCA 5LJ3j 2F5TX 3V8JA 5GMKm 4J7IA 2ZZDA 5CQYA 1Q82U 4X9DA 4XAXB 3FIFA 3QJYA 3F70A 5GANh 1Q86U 2XHCA 1I5LA 4ZTJA 1D3BB 1YCYA 2E70A 3R6OA 3OYDA 2ZPBB 3C94A 3CCRT 1VQKA 2R58A 5FU7B 4KUDK 4M77C 3I55T 5I2SA 1KD1U 3L2RA 3HRSA 5DLQE 3MP8A 2QQRA 4M75B 4M77D 3JB9I 4LD6A 4PL6A 4C92G 2D6FA 1QVFA 2RHZA 1X01A 3OBYA 2M0OA 3QUIA 1VQOT 1BI0A 1XTDA 5CIUA 3CCVT 3DB4A 4N4GA 2CZ1B 4ELZC 3OYKA 3L42A 1X6OA 5GAOr 1O75A 3META 3JB9D 1WQ7A 3M57A 3MCAB 4C0GA 4F7UB 3GOXA 2EYQA 5LJ3g 4V2SA 1VQPA 1KC8U 2E5QA 3CC4A 1WJSA 4ZN3A 4OF1A 2GQVA 4NOYA 2O4XB 5GMKj 3JAME 4BE0A 4J83A 3HRTA 4ME7A 3PIOA 4M77G 5GAOl 1K8AU 3J81E 1Y96B 3OW2A 2RB6A 1KG1A 2EKOA 2JTFA 2DXUA 3CCMT 4LD9K 1JRIA 1KHIA 4J8OA 2K3YA 5GAN8 3G71A 4HT9A 1N8RC 4XK8E 4OB3B 4HCZA 2CZ0B 4C0DC 3JB9G 3HP9A 3OMGA 2EQJA 3MEUA 3JCMP 3CCJA 2NLUA 3RKWA 4BY6B 1YHQA 2P0KA 2KQWA 1OI1A 2ZPEB 3M59A 3QBYA 2V8KA 1M9SA 5FLXE 2RK1A 4HCBA 1U1SA 3OYLA 1D3BA 1FWZA 3OS0A 2D9TA 2IVWA 1WGSA 2QDYB 3NTIA 5CKDA 3SWNB 3UPUA 4Q5WA 2P4TA 4UC4A 1M1FA 3L2VA 3GIBA 3MEVA 4M75E 4E47A 4MZMA 1YIJT 1X75C 4DA4A 3FB9A 2LCLA 3X28B 3ASKA 3ME9A 5CK9A 5HK0A 3L2QA 1S72A 1K9MC 2EQMA 1H3ZA 1XNIA 3BFMA 1NE8A 3FLGA 1M5Q1 4XQ3A 3P8BB 4C8QF 4BDYA 5DLOA 2ZPHB 3GF5A 5GAN4 3JCMb 3OS1A 3OY9A 4QW2A 3OYAA 2JN0A 1YJ9T 2A7YA 2VV5A 2L8DA 1IZ6A 2XG8D 4KBMB 4F7UE 1YJWA 4ATOA 2RJFA 3FC3A 3I56T 3PNWC 4J5YA 2FVUA 3UWNA 1YITA 5A0GA 4PJOB 3GLXA 1QW1A 3RUXA 4JS4A 2O4XA 1VQLA 1BIAA 2CS7A 2QQBA 1JBMA 5IAYA 4MMKA 2KDSA 3G6EA 1VIFA 2RI2A 3CBMA 5CVIA 1VQKT 2DIGA 4M7AC 3OB9A 1Y96A 1LNXA 5GMKh 1N9RA 5L8RE 2VUBA 3MO8A 4M7AD 3OYMA 2EJGA 3OSVA 3QHSA 4BI3A 2DJZA 2HQEA 4E7HA 1M90U 2RHUA 2B8AA 5FRNA 3OS2A 3EFSA 4OVAA 4HT8A 3CD6A 4C0ZA 1VQNA 1Y7XA 2WSEE 4N4IA 3SB2A 3M58A 4C8QC 2EWNA 2FHDA 5A0LA 4C5EA 5GAN3 5EG2A 2DTOA 4C8QD 1B34B 3C4SA 4JRIA 4EMKA 3CC4T 1VQPT 1YJNA 5KH6A 2PVOB 2QI2A 3OQ5A 4C0DB 2K57A 5M9OA 3SWNA 1VQ9A 3NFCA 3CC2A 1U1TA 2PVDB 3X25B 1G3TA 2EIFA 4XTZA 2YHTA 2JUFA 2RI5A 3CMAA 4B9WA 3M55A 4RCBA 4M7DB 4QVZA 1I81A 1QVFS 3J80E 1Q82C 4XU2A 4M78B 3L1AA 1MGQA 3HFOA 3G71T 4JS5A 1H641 5CKEA 4EMHA 2DZCA 1Q86C 1M1KU 3CPWA 1KQ1A 3PFSA 1OZ2A 3G4SA 4C8QG 1NJIU 4FM4B 1KD1C 3CCJT 4PJOE 1YHQT 1BKBA 4PJOA 4MMLA 3EAEA 2VYTA 3HRUA 1O9SA 1JJ2A 4B9XA 2GF7A 3J7AF 3QYGB 3CCSA 4OB0B 4X34A 1DJ7B 5J26A 4N0AC 4BD3A 3SFMA 3KXTA 2RHIA 5CKHA 4BI8B 3RIRA 3OW2S 3MHXA 3A8LB 3OSSC 4YTLA 3VJPA 1KQSA 3FDRA 3LWHA 2X4WA 1RL2A 3CCUA 1KC8C 2A3LA 1S72T 3VYGA 3TCJA 5C6SA 5LL6S 3A8HB 5LJ5d 1BYMA 2K3XA 4XTVA 3C12A 3DKMA 4M7AB 3GNGA 3QYHB 3E19A 2WSFE 3O8VA 3QZ9B 5AYFA 1YJWT 5GAN5 1K8AC 1UGRB 2QA4A 2WACA 3QPHA 4IKFA 2ZPGB 4NL2A 1M1GA 4JRQA 3M54A 1YITT 2RI3A 4LDYA 1VQLT 3A8MB 2RHXA 4C0FA 4JDSA 3PMTA 3G6ET 3L2UA 2K5FA 2LQ8A 4J6WA 4XTYA 2XICA 3LH0A 1BI2A 3FRNA 4JLIA 2HBPA 3TU4K 2GCXA 1BIBA 2BUDA 1G3YA 2I2LA 4PKCC 4M7DE 3FJPA 3PT9A 4M7DA 2O01E 2MWPA 5GAOq 4M78E 4GLKA 4BE1A 4M78A 2ZPFB 4M7DF 3L2ZA 4Y28E 4NS5A 1HXDA 1UB4A 2QEXA 1SSFA 2M16A 2R5AA 3QO3A 2DVEA 4E7JA 3CD6T 1VQNT 3CMEA 4E7LA 3LGFA 1N9SA 1Y07A 4FL6A 1M8VA 1P92A 2KY9A 3ZFJA 4IUUA 4C92B 4IURA 2DXBA 2Y4XA 1JB0E 2WSCE 1QP2A 1YJNT 5GANd 2VGNA 4KUIA 1VQ9T 4C5IA 2OTLA 1PSFA 3OA6A 2DTHA 4OP0A 1FXXA 5A0DA 3CC2T 3M4GA 2CKKA 3KBGA 3M5AA 2DPPB 3QKJA 3X20B 4LDWA 1LOJA 4QQDA 4M75A 3URGA 3CMAT 2LTOA 2Y4YA 4OMFB 1FX7A 2X35A 1I8FA 3CXCA 5J3BA 2K4YA 5GAOm 4M75F 2DD4A 4L59A 3RKYA 4M7AE 2XDBA 4FIBA 2E41A 2RJCA 4M77B 3S3NA 2CZ6B 4F7UA 3G4ST 1VQ4A 2MI6A 1OZ3A 3A8OB 3H8ZA 1Q7YC 3N5BB 2RJDA 5DM7R 1N8RU 5KE3A 5GAMf 4JLGA 3LLRA 3WXMB 4F7UF 4DOWA 4A53A 3L2WA 5D6XA 1V29B 2XKOC 3JCMQ 3CCST 1M90C 3P8DA 3QSUA 2G3RA 2OAUA 5CAIA 3CCQA 5LJ3e 3AHUA 2KMTA 2KSSA 2RK2A 5GAN7 4CRIA 2PU9B 4RG2A 4KT0E 4A4EA 2VC8A 3VUZA 1VQ6A 2LX9A 3HFNA 1UGSB 4JRKA 3CCUT 4RKUE 3ZBDA 4ELYC 3E1SA 5FU7C 2OTJA 2DEQA 1NPPA 3RMQA 2EJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PTA A;  2FVU A;  4FT2 A;  4DOW A;  1W4S A;  1ZHI A;  4KUI A;  4JJN K;  4KUD K;  4DOV A;  4KUL A;  2FL7 A;  4FSX A;  3TU4 K;  4DA4 A;  3PT9 A;  4LD9 K;  1M4Z A;  1ZBX A;  4BB7 A;  4FT4 A; 
#chains in the Genus database with same CATH topology
 3PVL A;  3U23 A;  3PTA A;  2JZ2 A;  2EAY A;  4Z89 A;  2HNI A;  1GXI E;  1RUW A;  5GAM e;  4QVC A;  3RKX A;  5LJ3 d;  1BI3 A;  2JMC A;  4ZTF A;  3FJ5 A;  4QQG A;  1KQS S;  1TWB A;  2RF0 A;  5IHK A;  4PJJ A;  2DRK A;  3THK A;  1SRM A;  1VQN Q;  1Y0M A;  1TH7 A;  2CRE A;  2O9V A;  1V76 A;  4E7K A;  2XDP A;  1QP3 A;  4OB2 B;  4OMN A;  4ZGJ B;  2LJ3 A;  4PJO F;  4RTZ A;  2ZAE A;  3EHR A;  5CR2 A;  3RNJ A;  2LT1 A;  3VUB A;  4DQ2 A;  3JB9 F;  4N4H A;  3V7R A;  2DYB A;  3NHN A;  4QVD A;  1SG5 A;  2JNG A;  3C0C A;  3SWN C;  2EW3 A;  2QTX A;  1MV3 A;  3DLM A;  2ZGW A;  2EQI A;  2DL4 A;  2CSI A;  4M4Z A;  3VV0 A;  3QXE B;  1VQ4 T;  1QVF P;  4JUV A;  5M9O A;  1B34 A;  1GCQ C;  3QJ6 A;  2GFA A;  2QQS A;  1ZQ1 A;  2K2V A;  2BKD N;  1KJW A;  2RQW A;  1G3W A;  5FU6 B;  2YWW A;  5IN1 A;  3BDU A;  2LZ6 B;  3JCM X;  2OTJ T;  3M56 A;  2ROT A;  4O6J A;  3A8G B;  2C06 A;  3KUF A;  2DLP A;  2XID A;  4MZT A;  2QQA A;  2MOX A;  3X24 B;  1VYV A;  2PUK B;  3V7C A;  3NGP A;  2H3J A;  1LJO A;  1RI0 A;  2AKL A;  4FW2 A;  2A28 A;  5LJ5 j;  3OYI A;  2FPD A;  2CT4 A;  2J06 A;  2GQI A;  5IHN A;  1JEG A;  4RMO A;  5KYY B;  1TG0 A;  3BE3 A;  4A54 A;  1TSF A;  4A4G A;  1MMA A;  3CBO A;  5EC7 A;  4M7D C;  3EG3 A;  2RPN A;  1I4K 1;  4AFZ C;  3HHT B;  1ZSZ C;  2KRS A;  3M53 A;  1W6X A;  1Y57 A;  5GAO n;  5HK3 A;  3V8L A;  1VQO A;  4J9F A;  5FW9 A;  4L5G A;  3JCM c;  2VWF A;  5GAN j;  2VXE A;  1KC8 R;  1GL5 A;  1K9M U;  1WIE A;  1K4U S;  3RES A;  2X3X D;  3FEO A;  4C92 F;  2FB7 A;  4HCK A;  1QVG S;  1Q7Y U;  4E7I A;  2I0N A;  3RDV A;  1VQO Q;  3QWX X;  1Q81 C;  1HK9 A;  2DL5 A;  5GMK e;  2CGH A;  2NWM A;  3CCL T;  1R0C B;  1HJD A;  2K5I A;  1U8R A;  4M77 F;  2GFU A;  4X9C A;  4PJL A;  1WJR A;  3MP6 A;  1VQM Q;  1TTH B;  4XU3 A;  3JB9 J;  3LH5 A;  2X9H A;  1YI2 Q;  1ZUK A;  1GBR A;  1VQ8 T;  4HVV A;  2E3I A;  3I56 A;  4J7I A;  3FIF A;  4E2F B;  3QJY A;  1JQQ A;  1I5L A;  3CCR T;  1WHG A;  3C94 A;  5FU7 B;  4KUD K;  4FYY B;  3UA6 A;  3I55 T;  3D7S B;  3L2R A;  3HRS A;  2MK5 A;  1Q7Y R;  4J9C A;  4FCY A;  1KK7 A;  1RLQ C;  2M0O A;  1WHL A;  1BI0 A;  3I56 Q;  5CIU A;  2O2O A;  4DBR A;  3OYK A;  1X6O A;  3MET A;  3JB9 D;  4F7U B;  5LJ3 g;  1K76 A;  2E5Q A;  1SPK A;  4ZN3 A;  5GJW B;  4BE0 A;  1FMV A;  4J83 A;  4ME7 A;  5GAO l;  3EHQ A;  2JTF A;  3CC7 Q;  4J8O A;  3G71 A;  4XK8 E;  2KBT A;  4OB3 B;  1M1K R;  3JB9 G;  2JTE A;  2P0K A;  1OI1 A;  2ZPE B;  5FLX E;  3CXC P;  3M0P A;  1ZA1 B;  4Q5W A;  1HSQ A;  4E47 A;  1YIJ T;  3G71 Q;  1X75 C;  3FB9 A;  1MUZ A;  3X28 B;  3L2Q A;  3ME9 A;  1XNI A;  3BFM A;  2ESW A;  1M5Q 1;  4C8Q F;  3OY9 A;  2VV5 A;  1IZ6 A;  2XG8 D;  4F7U E;  4ATO A;  3PNW C;  3EFO A;  1YIT A;  4PJN A;  3GLX A;  1QW1 A;  5KYW B;  2O4X A;  1VQL A;  1BIA A;  2CS7 A;  2QQB A;  2W0Z A;  3G6E A;  1VIF A;  1K0X A;  1VQK T;  5L8R E;  2VUB A;  3EGX B;  3MO8 A;  2FO0 A;  4AFU C;  3CCV Q;  3OSV A;  2J6F A;  2JM8 A;  2Z0W A;  1M90 U;  4ANJ A;  4OVA A;  3CD6 A;  2WSE E;  3SB2 A;  3M58 A;  4HVW A;  1YIT Q;  1AZG B;  1VQL Q;  5A0L A;  1CKA A;  2DTO A;  2AK5 A;  4C0D B;  1RAH B;  3SWN A;  1UJY A;  1M2V A;  3CC2 A;  1LVK A;  4XTZ A;  1D0Z A;  4QT7 A;  2COY A;  1AWX A;  1QVF S;  3J80 E;  2F2W A;  3CD6 Q;  4M78 B;  1MGQ A;  2ECZ A;  3HFO A;  4JS5 A;  1GCQ A;  4EMH A;  1OX8 A;  2ED1 A;  1PM3 A;  1IHW A;  3CC2 Q;  3CCS A;  4N0A C;  2RHI A;  1I1J A;  1KQS A;  3FDR A;  4JJB A;  3VS7 A;  1KC8 C;  1S72 T;  2M0Y A;  3VS3 A;  5LL6 S;  5LJ5 d;  1I0C A;  1YJW T;  1WXB A;  2M51 A;  3CCS Q;  3H0I A;  4LDY A;  4JDS A;  4J6W A;  3FRN A;  4M7D A;  2O01 E;  4M78 E;  4M7D F;  2ABL A;  3L2Z A;  4NS5 A;  1ZSZ A;  1SSF A;  2R5A A;  1T0H A;  3CC4 Q;  3LGF A;  4FL6 A;  4AG2 C;  2COZ A;  3ZFJ A;  1I5O B;  2EYY A;  5GAN d;  1SHF A;  1VQ9 T;  3OA6 A;  2DTH A;  1FXX A;  3UAT A;  3M0Q A;  3M5A A;  4LDW A;  1LOJ A;  2LTO A;  1WHJ A;  2X35 A;  5J3B A;  2DL7 A;  1H92 A;  2QAZ A;  2DEU A;  2L0A A;  2E41 A;  2FZG B;  3S3N A;  2DMO A;  1VQ4 A;  1Q7Y C;  2ENM A;  5KE3 A;  1M3C A;  2JW4 A;  4A53 A;  1K73 R;  3CQT A;  4AT1 B;  3A1P A;  5LJ3 e;  2KMT A;  2V26 A;  1PCX A;  1WDX A;  4A4E A;  2VC8 A;  1UGS B;  3ZBD A;  5FU7 C;  2OTJ A;  2DEQ A;  4ESR A;  1PNJ A;  2MF2 A;  1QQJ A;  2GBQ A;  2JS0 A;  3EG9 B;  3CEY A;  4XTX A;  2D8H A;  2QA4 T;  1AOJ A;  3JCM V;  2HD0 A;  2DL8 A;  1VIE A;  4IUT A;  1NPR A;  2FL7 A;  1M1K C;  2LNV A;  2XDD A;  3X26 B;  3UT1 A;  3JCM W;  2OTJ Q;  1KIK A;  2RQV A;  3VU3 C;  5GMK l;  2RN8 A;  3JB9 H;  2JOY A;  2QEX T;  2LRQ A;  1OYX A;  3O5Z A;  1UGP B;  2E64 A;  1WPY A;  4HA8 A;  4PNO A;  4OMO A;  2LCS A;  5KYX A;  1Q81 U;  5D7U A;  1RAB B;  2DA9 A;  4F04 B;  5A2Q E;  3PIP A;  2CP6 A;  2KVQ G;  4X1V A;  1X6B A;  3OYB A;  4LUD A;  3ZEH A;  2GTO A;  4L6V 5;  1QVG A;  2E10 A;  1YNZ A;  1MMD A;  1JJ2 P;  1C1A A;  4EMK C;  2YUQ A;  2R57 A;  2DD5 A;  4QQ6 A;  3V7S A;  4BI4 A;  4D8K A;  2MCN A;  2DYI A;  4KGX B;  2VGM A;  1XOV A;  4PLL A;  3BW1 A;  2YXY A;  3OYG A;  5C0M A;  1T0J A;  2KGT A;  2DIQ A;  2VKN A;  3MEA A;  3EFR A;  3V8K A;  3CCQ T;  5CKB A;  4IIO A;  3CXC S;  5GAM j;  2HEQ A;  1VQ6 T;  5KYN A;  3CCL A;  2QXF A;  1WHM A;  3RMS A;  3OW2 P;  1RAE B;  2KAF A;  1OPK A;  4PFO A;  3AT1 B;  1XJW B;  4MZP A;  1W2B A;  4JZ4 A;  4PFP A;  2J6O A;  4FSX A;  1YFN A;  1YBY A;  5LJ3 f;  4A4H A;  2EBP A;  1G3S A;  3MJX A;  4BDZ A;  3EGD A;  4MDX A;  3CCL Q;  2B86 A;  1VQ8 A;  1MND A;  2DO3 A;  1WX6 A;  2YRD A;  5I21 A;  3LW5 E;  5KYU B;  1Q82 R;  9ATC B;  3NTH A;  2PNI A;  4XU1 A;  1UHF A;  2ZPI B;  2YUO A;  1UEC A;  4ZGE B;  4M78 C;  3CCR A;  5L23 A;  1IGU A;  4M7D D;  2RMO A;  1K9A A;  3GBQ A;  2NUZ A;  3I55 A;  1EFN A;  1KD1 R;  4J9H A;  3HKS A;  1OU9 A;  2EFI A;  4J9B A;  2MMP A;  2OX7 A;  5LJ5 g;  4OB1 B;  2KE9 A;  1VQ8 Q;  1QVP A;  2DXC A;  2L89 A;  2RA2 A;  4WF2 A;  4J9E A;  4D8D A;  2K5L A;  2DAQ A;  3CCR Q;  2FZC B;  4M7D G;  1Z9Z A;  3VRY A;  3I55 Q;  1FYN A;  1M3A A;  4BUG A;  3TEE A;  2YDL A;  3HSB A;  2RQT A;  4NL3 A;  2KI7 A;  4BE2 A;  4IUP A;  1VYU A;  5AT1 B;  1JU5 C;  5LJ5 h;  1WI7 A;  5KYY A;  3JCM g;  4N0A A;  3VS5 A;  5IT9 E;  3GNF B;  4D6W A;  2FZK B;  3H0F A;  3SD4 A;  5GAN g;  2CYZ B;  5KCO A;  1KQ2 A;  2E6N A;  1K1Z A;  5GAN 2;  2ED0 A;  2VVK A;  4OMQ A;  1D1B A;  1W4S A;  3CPW P;  1KFZ A;  4M7A G;  2P0Q A;  2BIV A;  2P4R A;  1YIJ A;  2JVV A;  3OYE A;  2YT6 A;  4RTV A;  2HQX A;  5FRM A;  3BDL A;  2VXF A;  2X4X A;  2EQU A;  3G7Z A;  1Y71 A;  3DLL A;  3OYF A;  1K73 C;  3JCM h;  3V8J A;  3VRZ A;  2ZZD A;  4X9D A;  1IGQ A;  2GGR A;  5GAN h;  1D3B B;  3OYD A;  2ZPB B;  1YIJ Q;  1VQK A;  1QMC A;  2R58 A;  1JO8 A;  3NMZ C;  3MPU B;  5I2S A;  2EGA A;  5DLQ E;  4ZNX A;  1F1B B;  1SEM A;  4M75 B;  2EYZ A;  3JB9 I;  2C0I A;  2IIM A;  1QVF A;  2DBM A;  2RHZ A;  1X01 A;  3OBY A;  3QUI A;  1N5Z A;  2F1L A;  4N4G A;  4KH1 B;  3L42 A;  1T3S A;  2FPF A;  4V2S A;  2HL5 C;  1KC8 U;  2DX1 A;  1VQK Q;  2GQV A;  4NOY A;  5GMK j;  1M27 C;  3J81 E;  2PTK A;  1KG1 A;  3CCM T;  1AWO A;  2K3Y A;  4HT9 A;  2H3E B;  2CZ0 B;  2SEM A;  5IXB A;  3JCM P;  2QGG A;  1NJI R;  1NM7 A;  1M9S A;  3OYL A;  1FWZ A;  2YSQ A;  3OS0 A;  2D9T A;  2QDY B;  2BE9 B;  3NTI A;  2A37 A;  4UC4 A;  3L2V A;  2D8J A;  1ARK A;  4M75 E;  4MZM A;  1S72 A;  2EQM A;  1H3Z A;  1OU8 A;  2DM1 A;  1AD5 A;  4BDY A;  5DLO A;  1V1C A;  3GF5 A;  5GAN 4;  3JCM b;  1SHG A;  4KBM B;  1YJW A;  2RJF A;  1G2B A;  1C0M A;  4PJO B;  3UWN A;  2D1X A;  1OOT A;  3VS6 A;  1AWW A;  3CBM A;  5CVI A;  2DIG A;  4M7A C;  3OB9 A;  1LNX A;  1S72 Q;  1N9R A;  1OUL A;  2C0O A;  1WA7 A;  4OMM A;  2DJZ A;  4E7H A;  2RHU A;  4FYX B;  2B8A A;  4WTO B;  1YJW Q;  5FRN A;  3OS2 A;  1D09 B;  3EFS A;  4N4I A;  4C5E A;  5EG2 A;  4EMK A;  1B34 B;  1VQP T;  4FYW B;  1VQ9 A;  3OQ5 A;  2K57 A;  2PVD B;  2L2P A;  1G3T A;  2EIF A;  1I81 A;  1Q82 C;  1I07 A;  3L1A A;  4LE9 A;  5CKE A;  1M1K U;  2DRM A;  1OZ2 A;  4R0K A;  4FM4 B;  1KD1 C;  3CCJ T;  4PJO E;  1YHQ T;  1BKB A;  1VQ9 Q;  7AT1 B;  1LCK A;  5KYW A;  4B9X A;  2F2V A;  1QWF A;  2L3Q A;  4OB0 B;  5J26 A;  3KXT A;  1OQK A;  3NPF A;  5CKH A;  1WFW A;  3OW2 S;  3MHX A;  3OSS C;  4Z8A A;  3LWH A;  2X4W A;  2X3W D;  2DET A;  3VYG A;  3TCJ A;  1BYM A;  4XTV A;  3C12 A;  3DKM A;  3QYH B;  2EKH A;  3E19 A;  3QZ9 B;  5GAN 5;  1WXU A;  1YWO A;  2QA4 A;  2WAC A;  3HTR A;  3QPH A;  4IKF A;  3M54 A;  2RI3 A;  3A8M B;  2RHX A;  2K5F A;  1BI2 A;  1R77 A;  2BUD A;  2JT4 A;  1X27 A;  3FJP A;  2MWP A;  4M78 A;  2ZPF B;  1UB4 A;  2QEX A;  2M16 A;  1B7T A;  1VQN T;  1D0Y A;  1PRL C;  4JJC A;  1M8V A;  2DBK A;  1P92 A;  4IUU A;  2GNC A;  4IUR A;  1NYF A;  1UE9 A;  4C92 B;  1JB0 E;  2WSC E;  1JXM A;  4ORZ A;  3I9Q A;  1PSF A;  4OP0 A;  2CKK A;  3QKJ A;  2DPP B;  1PG5 B;  3PE0 A;  1PRM C;  3CXC A;  2QEX Q;  3SEM A;  2ROL A;  5GAO m;  4LN2 A;  2CUB A;  1PD0 A;  2RJC A;  4M77 B;  2CZ6 B;  3TSZ A;  1N8R U;  1OZ3 A;  5DM7 R;  1GFC A;  4LUE A;  4JLG A;  3LLR A;  1V29 B;  2XKO C;  2CH4 W;  2BZ8 A;  3CCQ A;  3AHU A;  2DNU A;  2QGF B;  2KSS A;  2LJ0 A;  4CRI A;  1X2K A;  3VUZ A;  1VQ6 A;  2LX9 A;  3CCU T;  1GRI A;  3E1S A;  1UFF A;  1M3B A;  3CPW S;  2P0P A;  5LJ5 f;  4C92 E;  4GY5 A;  5FU6 C;  2QQ9 A;  3G6E Q;  2A08 A;  3ZL7 C;  3CCQ Q;  4JRP A;  4E6R A;  2K3B A;  3TVT A;  1NZ9 A;  2YLB A;  1IRX A;  3QDR B;  1VQ6 Q;  1NJI C;  1BBZ A;  2PQW A;  4JJD A;  1VYT A;  1QLY A;  4M77 E;  1EX4 A;  1NG2 A;  2FEI A;  3CME T;  1N8R R;  3EH2 A;  1G83 A;  2KK4 A;  2KT8 A;  3JCM f;  1AVZ C;  4DOV A;  2M1H A;  5GAN f;  1QWE A;  4EPC A;  4BAC A;  2E1H A;  1PC0 A;  2HCK A;  4J9D A;  1R8O B;  2EJF A;  3LGL A;  3RBB B;  3EH1 A;  1A0N B;  4OMP A;  4KGZ B;  1VUB A;  2XU8 A;  3EG9 A;  1B3Q A;  4EMG A;  2CZ7 B;  3INZ A;  4IUV A;  2PUO B;  3BY7 A;  3E9G A;  4XTU A;  1U5S A;  4HCC A;  4HKE A;  1K73 U;  3M9Q A;  4J7F A;  2LT4 A;  2MAM A;  1U06 A;  4C8Q B;  4PFZ A;  4PJO C;  2HKN A;  3OYN A;  5GAO p;  4OGE A;  1Q95 G;  4PLI A;  8ATC B;  4RTX A;  2DXT A;  2HKQ B;  1MNE A;  3OYH A;  2X4J A;  4HVU A;  3JCM d;  2CP0 A;  2AT1 B;  3RER A;  2CUD A;  2AHJ B;  1VQ5 T;  1HYO A;  1D0X A;  1Z9Q A;  2RQR A;  1UDL A;  1UUE A;  2K79 A;  1E6G A;  1YCS B;  2AIR B;  3QII A;  5GAM g;  1NEB A;  4VUB A;  1HD3 A;  4Z02 A;  1VQM T;  4M7A A;  1RAG B;  2Y90 A;  1YI2 T;  1EIF A;  2YUN A;  2QK0 A;  1XQH A;  4M7A F;  2YLC A;  2EYX A;  3H0H A;  1Q86 R;  3H41 A;  1VQ7 T;  1ACM B;  4J6X A;  2RQU A;  1ABQ A;  1BCO A;  4RTU A;  5DY9 A;  1AHJ B;  1M2V B;  4M78 D;  1FMW A;  2L5Q A;  2LQK A;  4C8Q E;  1BI1 A;  5IH2 A;  1ZUY A;  3WVE B;  1WQW A;  2F2X A;  1FMK A;  4C5G A;  3CPF A;  2FYK A;  4PJM A;  2LQN A;  2V1R A;  5GAM h;  3E2U A;  4K11 A;  3S3M A;  1VQ4 Q;  3CCE T;  2EJ9 A;  4M78 G;  4LDU A;  3OMC A;  5KCH A;  1PHT A;  3OYC A;  3OS5 A;  4ZN1 A;  2JJ9 A;  1NLP C;  2EQK A;  1WYX A;  2LCC A;  1K8A R;  1ZUU A;  1SF9 A;  2K6D A;  3CCM A;  3MEW A;  3E9F A;  2X4Y A;  1M2O A;  3CC7 T;  3S3O A;  1IRE B;  4ZGD B;  1H8K A;  2ZCF B;  5KYU A;  2DIL A;  1N27 A;  3NTK A;  3CCM Q;  2YRV A;  1SKU B;  3GPL A;  3A5Z B;  1WJQ A;  1S1N A;  2V8J A;  4C92 C;  2DK3 A;  2E12 A;  5CQX A;  4R55 A;  2NUT B;  5J39 A;  1ZSZ B;  5FRO A;  4A4F A;  4CI0 C;  4MDW A;  3T9N A;  5GAN 6;  1WHK A;  3VS4 A;  5GMK m;  2KRM A;  1Q82 U;  5CQY A;  2VAS A;  4XAX B;  2E70 A;  3R6O A;  4DBQ A;  1NLO C;  4GBQ A;  4M77 C;  1KD1 U;  1GFD A;  2QQR A;  2O9S A;  4PL6 A;  2D6F A;  1ZSG A;  2J05 A;  4AG1 C;  3CCV T;  1RAI B;  3DB4 A;  2CZ1 B;  4RUG A;  1IXD A;  5GAO r;  1PD1 A;  1WQ7 A;  2O31 A;  3M57 A;  3MCA B;  4C0G A;  2EYQ A;  1VQP A;  1WJS A;  4OF1 A;  2MPX C;  5I22 A;  3JAM E;  4B6M A;  3PIO A;  1Y96 B;  3OW2 A;  2RB6 A;  2KRN A;  2EKO A;  2DXU A;  2J7I A;  1W2B P;  5GAN 8;  1N8R C;  1IO6 A;  4C0D C;  3HP9 A;  5FWC A;  3OMG A;  2EQJ A;  1VQP Q;  4KGV B;  3CCJ A;  4BY6 B;  1YHQ A;  2J6K A;  2KQW A;  3QBY A;  2X51 A;  2RK1 A;  1D3B A;  2IVW A;  1WGS A;  4KH0 B;  5CKD A;  2P4T A;  1M1F A;  3GIB A;  1RLP C;  2P84 A;  4AMC A;  2AKK A;  3ASK A;  5CK9 A;  1NE8 A;  3P8B B;  3CCJ Q;  4RTW A;  1PKT A;  1W70 A;  3OS1 A;  1YJ9 T;  3OYA A;  1YHQ Q;  1ZA2 B;  2A7Y A;  2L8D A;  3FC3 A;  1M8M A;  1R0B G;  3M0T A;  1JBM A;  5IAY A;  4MMK A;  2KDS A;  5GMK h;  2EGC A;  4M7A D;  2OAW A;  2FG0 A;  3OYM A;  1U3O A;  2EJG A;  3QHS A;  2EGE A;  2XMF A;  4HT8 A;  4C0Z A;  1VQN A;  1Y7X A;  5HCK A;  4C8Q C;  2EWN A;  4JPB W;  2NYS A;  4LNP A;  2KT1 A;  3C4S A;  4JRI A;  3EG2 A;  3CC4 T;  2KYM A;  3R6N A;  5KH6 A;  2QI2 A;  1WZO A;  2KXC A;  3NFC A;  1U1T A;  3X25 B;  4F16 A;  2JUF A;  1TOV A;  4RCB A;  2ATC B;  4QVZ A;  4E7S A;  1H64 1;  1Q86 C;  2DZC A;  3CPW A;  1QKW A;  2QDL A;  1RAF B;  3PFS A;  1BCM A;  1NJI U;  4PJO A;  4MML A;  2HMA A;  3EAE A;  2VYT A;  3HRU A;  3J7A F;  1QCN A;  1ABO A;  4A63 B;  3QYG B;  1DJ7 B;  3QWY A;  4BD3 A;  3RIR A;  2COW A;  1TUD A;  2E4H A;  4YTL A;  1RL2 A;  3EGD B;  3CCU A;  1RAA B;  3A8H B;  2C0T A;  2K3X A;  2O88 A;  2H8H A;  4FYV B;  3GNG A;  2NUP B;  3VS1 A;  2WSF E;  1K8A C;  1RAC B;  2ZPG B;  4NL2 A;  1M1G A;  1X2Q A;  1RI9 A;  3VS2 A;  4C0F A;  3QDF A;  3L2U A;  1UGV A;  2LP5 A;  2PZ1 A;  4XTY A;  2L3S A;  4Z88 A;  3CCU Q;  3M0S A;  2OI3 A;  1M30 A;  3PT9 A;  1MV0 B;  2DER A;  4IIM A;  2DJQ A;  4Y28 E;  1HXD A;  4LXC A;  3TQ7 P;  3QO3 A;  4E7J A;  1IHV A;  3CME A;  4E7L A;  1Y07 A;  2E3H A;  2CP5 A;  1GBQ A;  1YJN T;  1BU1 A;  4C5I A;  5A0D A;  3M4G A;  2OJ2 A;  3ULR B;  3URG A;  3CMA T;  4OMF B;  3M0R A;  1FX7 A;  1H3H A;  1E7O A;  2DD4 A;  1RAD B;  4L59 A;  3RKY A;  3CME Q;  4FIB A;  2XDB A;  1PKS A;  2DFU A;  2DE0 X;  4F7U A;  3I35 A;  3G4S T;  2MI6 A;  1X43 A;  2RJD A;  2KXD A;  5GAM f;  3WXM B;  4F7U F;  1YWP A;  5D6X A;  3IQL A;  3JCM Q;  3QSU A;  2OAU A;  5GAN 7;  2RK2 A;  4J9G A;  4RG2 A;  3HFN A;  4JRK A;  2HBW A;  2KNB B;  1OEB A;  4RKU E;  4ELY C;  4PK4 A;  1PWT A;  4EDU A;  1JXO A;  1D1C A;  2RM4 A;  3PGG A;  4RCC A;  4DEX A;  2RD1 A;  4C92 A;  4M75 D;  1JJ2 S;  1VQ5 A;  4R56 A;  2K2M A;  4JJN K;  4A4K A;  4TVR A;  2KYB A;  3M0U A;  3OYY A;  2EVR A;  2R5M A;  4Y91 A;  2XK0 A;  4DBF A;  3GP8 A;  2V8I A;  3G1J A;  5D6Y A;  1VQM A;  2K9G A;  2IG0 A;  2L3R A;  2RNA A;  2IPO B;  4M77 A;  3TRE A;  1YI2 A;  5LJ5 e;  4M75 G;  5GAM d;  1VQ5 Q;  1PSE A;  5GMK i;  1VQ7 A;  3C95 A;  4CC7 A;  3PMI A;  2OTL T;  3KFV A;  4BY6 C;  1YN8 A;  2GTJ A;  3EGX A;  5IHI A;  1W1F A;  3HPW A;  3REB B;  3P8H A;  1EZZ B;  2DZ9 A;  3CCE A;  1VQ7 Q;  1K9M R;  5CO7 A;  2RH2 A;  3M4Y A;  4C5H A;  2YRC A;  1W2B S;  2JTM A;  3SDZ A;  3JCM e;  2RJE A;  4DBH A;  1ZBJ A;  5GAN e;  4FW1 A;  6AT1 B;  2CP2 A;  5I2M A;  1M4Z A;  4XU0 A;  3WVD B;  3CC7 A;  4PJO D;  3HL8 A;  3CCE Q;  1WNL A;  3MP1 A;  4M78 F;  1TXQ A;  2BZY A;  2QA4 Q;  4WCI A;  2CP3 A;  1OPL A;  2XD0 A;  4FT2 A;  5D6W A;  3LX7 A;  1AT1 B;  1MMN A;  1MHN A;  2MWO A;  3LWI A;  4O5V A;  2F5K A;  2PVG B;  4OML A;  1K0S A;  4PJO G;  4OGC A;  2L3P A;  2XI9 A;  1ZBX A;  4AFS C;  5HKC A;  3JCM J;  2F69 A;  1OV3 A;  3ER0 A;  2D0Q B;  2LMJ A;  1ZX6 A;  4EMK B;  4F17 A;  3OBW A;  5LJ3 h;  3QZ5 B;  4HXJ A;  2DTI A;  2CT3 A;  1G5V A;  1T3L A;  2E6Z A;  4KUL A;  3DB3 A;  2FRW A;  4RG8 A;  2E65 A;  3EG0 A;  4C8Q A;  2LX7 A;  1GCP A;  3CBP A;  2A0F B;  2LDM A;  1N6A A;  3VKI A;  3CCV A;  4LDX A;  2HDA A;  2D0N A;  4BB7 A;  1UEB A;  4LDV A;  2M9U A;  3VYH B;  5CKF A;  2HAX A;  2MIO A;  4IUQ A;  3S6W A;  4M75 C;  2DL3 A;  5KE2 A;  2DVJ A;  4FU6 A;  3JRZ A;  4J9I A;  1UJ0 A;  2W10 A;  4J6Y A;  1UGQ B;  4GLM A;  4P5N A;  2G6F X;  2LC4 A;  2LVM A;  3H6Z A;  4FT4 A;  2JS2 A;  3JSC A;  4RTT A;  3OYJ A;  4XTW A;  4E7Z A;  1AWJ A;  2RHY A;  3Q1J A;  1TS9 A;  3UDC A;  1NBE B;  2KRO A;  5HY6 A;  1ZHI A;  3QG1 A;  1WLP B;  2FPE A;  2JMA A;  4F7U G;  2CDT A;  2LNH B;  3I5R A;  1E6H A;  2DKG A;  4II1 A;  2KR3 A;  2QG9 B;  3LYI A;  4C92 D;  1YJ9 A;  2RO0 A;  2BTT A;  2V1Q A;  2CSQ A;  5CCA A;  1CKB A;  1KHC A;  5LJ3 j;  1KQS P;  2F5T X;  2EPD A;  3UA7 A;  3F70 A;  1Q86 U;  2XHC A;  4ZTJ A;  1BK2 A;  1YCY A;  1IB8 A;  2M02 A;  2MYS A;  4CC2 A;  3MP8 A;  4M77 D;  4LD6 A;  1YJ9 Q;  4C92 G;  1QCF A;  1M90 R;  1UTI A;  1VQO T;  1XTD A;  2DF6 A;  4ELZ C;  1O75 A;  3GOX A;  4FSS A;  3CC4 A;  3EFO B;  1SRL A;  2O4X B;  4CC4 B;  3HRT A;  2EYW A;  4M77 G;  1K8A U;  2FRY A;  3A98 A;  1QCO A;  4LD9 K;  1CSK A;  1D1A A;  1JRI A;  1KHI A;  2QAS A;  2NUT A;  3TSW A;  4HCZ A;  3MEU A;  2LJ1 A;  2NLU A;  3RKW A;  3I5S A;  1QKX A;  3M59 A;  2V8K A;  2YUP A;  4DEY A;  2HSP A;  4HCB A;  1U1S A;  1X6G A;  2CP7 A;  1MMG A;  5ECA A;  3SWN B;  3UPU A;  3MEV A;  4DA4 A;  2LCL A;  5HK0 A;  1K9M C;  3FLG A;  4XQ3 A;  2ZPH B;  4QW2 A;  2JN0 A;  3I56 T;  1G8X A;  4J5Y A;  2FVU A;  5A0G A;  3RUX A;  4JS4 A;  2RI2 A;  1TUG B;  1Y96 A;  3EGU A;  4KRT A;  4EIK A;  2HL3 A;  4BI3 A;  2BZX A;  2HQE A;  1NEG A;  1UHC A;  2A36 A;  4JZ3 A;  1C6V X;  1WHH A;  1VA7 A;  2QYZ A;  1X69 A;  2FHD A;  5GAN 3;  3SHW A;  4C8Q D;  3RR6 A;  1YJN A;  4CC3 A;  2PVO B;  1J3T A;  1YP5 A;  3MKD A;  1UG1 A;  2YHT A;  4RTY A;  2RI5 A;  3CMA A;  4B9W A;  3M55 A;  2VB6 A;  4M7D B;  1TU0 B;  2AZS A;  2E5K A;  4XU2 A;  3G71 T;  5IXF A;  1ZLM A;  1QVG P;  2HZY A;  1KQ1 A;  3G4S A;  4C8Q G;  1YJN Q;  2LQW A;  1JJ2 A;  1O9S A;  2GF7 A;  3PVQ A;  4QKU A;  4X34 A;  3SFM A;  3CMA Q;  4BI8 B;  4AFQ C;  1AEY A;  1VOM A;  3A8L B;  3VJP A;  3UF4 A;  2A3L A;  5C6S A;  2AZV A;  3G4S Q;  1B07 A;  4M7A B;  3O8V A;  5AYF A;  2HQH A;  1UGR B;  2CH4 A;  5GJV B;  4JRQ A;  1YIT T;  2KEA A;  1VQL T;  3PMT A;  3G6E T;  2LQ8 A;  3EG1 A;  2XIC A;  3LH0 A;  4JLI A;  2HBP A;  3TU4 K;  2GCX A;  1BIB A;  1G3Y A;  2I2L A;  4PKC C;  4M7D E;  1AZE A;  5GAO q;  4BE1 A;  4GLK A;  1OX9 A;  3CD6 T;  2DVE A;  2HSE B;  2JXB A;  1N9S A;  1Q81 R;  1SSH A;  2KY9 A;  2DXB A;  2Y4X A;  1QP2 A;  3VS0 A;  2VGN A;  4KUI A;  2OTL A;  3CC2 T;  3KBG A;  3X20 B;  4QQD A;  4M75 A;  2Y4Y A;  3JV3 A;  1I8F A;  2QTV A;  2K4Y A;  4M75 F;  4M7A E;  4F14 A;  1BB9 A;  4Y92 A;  2NUP A;  5I11 A;  1TUC A;  2BE7 D;  1LPL A;  2SRC A;  3A8O B;  1KSW A;  3H8Z A;  3N5B B;  5KYX B;  5FWB A;  2OTL Q;  4DOW A;  3L2W A;  3CCS T;  1M90 C;  3P8D A;  2G3R A;  5CAI A;  1NYG A;  2PU9 B;  3H9N A;  4KT0 E;  8AT1 B;  1WXT A;  2JM9 A;  3REA B;  1NPP A;  3RMQ A;  2K7A A; 
#chains in the Genus database with same CATH homology
 4EDU A;  3PTA A;  2MF2 A;  2P0P A;  2JZ2 A;  2EAY A;  2RM4 A;  3PGG A;  4RCC A;  5LJ5 f;  2RD1 A;  3CEY A;  2HNI A;  4XTX A;  4GY5 A;  4C92 E;  4C92 A;  1GXI E;  4M75 D;  5FU6 C;  1JJ2 S;  2QA4 T;  5GAM e;  2QQ9 A;  3JCM V;  1VQ5 A;  2HD0 A;  4QVC A;  4R56 A;  3RKX A;  5LJ3 d;  4JJN K;  1VIE A;  4JRP A;  1BI3 A;  4IUT A;  1NPR A;  4TVR A;  4A4K A;  2FL7 A;  4ZTF A;  1NZ9 A;  1M1K C;  2YLB A;  3QDR B;  3OYY A;  4QQG A;  2R5M A;  2LNV A;  2XDD A;  3X26 B;  1KQS S;  1NJI C;  3UT1 A;  3JCM W;  4Y91 A;  2XK0 A;  3GP8 A;  3CPW S;  2PQW A;  3VU3 C;  2V8I A;  5GMK l;  5D6Y A;  1VQM A;  3JB9 H;  1TH7 A;  2IG0 A;  2JOY A;  2L3R A;  4M77 E;  4M77 A;  3TRE A;  2QEX T;  1YI2 A;  2LRQ A;  1OYX A;  5LJ5 e;  4M75 G;  1UGP B;  2E64 A;  2XDP A;  5GAM d;  4E7K A;  3CME T;  1WPY A;  1PSE A;  1QP3 A;  4HA8 A;  4OB2 B;  4PNO A;  5GMK i;  1Q81 U;  1VQ7 A;  5A2Q E;  2KK4 A;  3C95 A;  4ZGJ B;  3PIP A;  2KVQ G;  3JCM f;  3OYB A;  4PJO F;  3ZEH A;  3PMI A;  4DOV A;  4L6V 5;  1QVG A;  5CR2 A;  2M1H A;  2OTL T;  2LT1 A;  2E10 A;  3VUB A;  4BY6 C;  4DQ2 A;  5GAN f;  3JB9 F;  4N4H A;  3V7R A;  4EPC A;  4BAC A;  4EMK C;  2E1H A;  4QVD A;  1R8O B;  2JNG A;  3HPW A;  3SWN C;  2R57 A;  2QTX A;  3LGL A;  2DD5 A;  3P8H A;  3DLM A;  4QQ6 A;  3V7S A;  2DZ9 A;  4BI4 A;  3CCE A;  2ZGW A;  5CO7 A;  1VUB A;  2XU8 A;  2RH2 A;  2VGM A;  3M4Y A;  3VV0 A;  4C5H A;  4EMG A;  3QXE B;  1VQ4 T;  1XOV A;  4JUV A;  2CZ7 B;  1B34 A;  3INZ A;  2PUO B;  3BW1 A;  3BY7 A;  3E9G A;  4IUV A;  4PLL A;  2JTM A;  3SDZ A;  5C0M A;  3JCM e;  4XTU A;  3OYG A;  1W2B S;  3QJ6 A;  4HCC A;  2GFA A;  2QQS A;  2RJE A;  4HKE A;  1K73 U;  1ZQ1 A;  2K2V A;  3M9Q A;  2DIQ A;  4J7F A;  3MEA A;  3EFR A;  2LT4 A;  2MAM A;  2BKD N;  3V8K A;  5GAN e;  3CCQ T;  4C8Q B;  5CKB A;  1G3W A;  4PJO C;  5FU6 B;  5I2M A;  3CXC S;  1M4Z A;  4XU0 A;  5GAM j;  3OYN A;  3WVD B;  3CC7 A;  5IN1 A;  1VQ6 T;  4PJO D;  5GAO p;  3HL8 A;  1WNL A;  3BDU A;  3MP1 A;  3JCM X;  4OGE A;  3CCL A;  2QXF A;  4PLI A;  3RMS A;  3M56 A;  4M78 F;  2OTJ T;  4O6J A;  2DXT A;  2KAF A;  3A8G B;  3KUF A;  2C06 A;  2XID A;  3OYH A;  2X4J A;  4MZT A;  3JCM d;  2XD0 A;  2QQA A;  4FT2 A;  4MZP A;  5D6W A;  3RER A;  3LX7 A;  3X24 B;  2AHJ B;  1W2B A;  1VQ5 T;  1MHN A;  2PUK B;  3V7C A;  2MWO A;  3LWI A;  4O5V A;  4FSX A;  2H3J A;  1LJO A;  1RI0 A;  3OYI A;  2F5K A;  1YBY A;  2PVG B;  5LJ5 j;  5LJ3 f;  4A4H A;  4PJO G;  1G3S A;  2XI9 A;  4OGC A;  4BDZ A;  4MDX A;  1ZBX A;  3QII A;  5GAM g;  4RMO A;  4VUB A;  4Z02 A;  5HKC A;  4A54 A;  1VQ8 A;  4A4G A;  3JCM J;  1VQM T;  4M7A A;  2F69 A;  2DO3 A;  3ER0 A;  2Y90 A;  5I21 A;  1EIF A;  3CBO A;  3LW5 E;  1YI2 T;  1XQH A;  2D0Q B;  3NTH A;  4M7A F;  2YLC A;  4M7D C;  4EMK B;  4XU1 A;  1I4K 1;  3OBW A;  2ZPI B;  3HHT B;  5LJ3 h;  3QZ5 B;  4M78 C;  4ZGE B;  3CCR A;  2DTI A;  1VQ7 T;  4J6X A;  4M7D D;  5DY9 A;  1G5V A;  1AHJ B;  4M78 D;  3I55 A;  2L5Q A;  3M53 A;  2E6Z A;  4KUL A;  3HKS A;  3DB3 A;  2LQK A;  4RG8 A;  1BI1 A;  2EFI A;  2E65 A;  4C8Q A;  4C8Q E;  2MMP A;  5LJ5 g;  3CBP A;  4OB1 B;  3WVE B;  1WQW A;  5GAO n;  5HK3 A;  2LDM A;  1N6A A;  3VKI A;  3V8L A;  1VQO A;  1QVP A;  4C5G A;  2DXC A;  2L89 A;  2FYK A;  2RA2 A;  3CPF A;  4L5G A;  3JCM c;  3CCV A;  4LDX A;  4WF2 A;  4BB7 A;  1UEB A;  4LDV A;  2M9U A;  3VYH B;  5CKF A;  5GAM h;  2HAX A;  2K5L A;  3S3M A;  2DAQ A;  5GAN j;  4IUQ A;  2VXE A;  3CCE T;  3S6W A;  4M75 C;  1K9M U;  2EJ9 A;  4M7D G;  5KE2 A;  3RES A;  4FU6 A;  4LDU A;  3OMC A;  4M78 G;  5KCH A;  3OYC A;  3OS5 A;  4ZN1 A;  3JRZ A;  2EQK A;  3FEO A;  4C92 F;  2FB7 A;  4BUG A;  2LCC A;  1QVG S;  3TEE A;  1Q7Y U;  3HSB A;  4NL3 A;  4BE2 A;  4E7I A;  3CCM A;  3MEW A;  4J6Y A;  1UGQ B;  4IUP A;  3E9F A;  4P5N A;  2X4Y A;  5LJ5 h;  1Q81 C;  1HK9 A;  2LC4 A;  5GMK e;  3CC7 T;  3JCM g;  2LVM A;  4N0A A;  3S3O A;  2CGH A;  3H6Z A;  3GNF B;  4FT4 A;  4D6W A;  3JSC A;  5IT9 E;  3OYJ A;  3SD4 A;  4XTW A;  3CCL T;  1IRE B;  4ZGD B;  2ZCF B;  2RHY A;  3Q1J A;  5GAN g;  2CYZ B;  2K5I A;  1U8R A;  4M77 F;  5KCO A;  2GFU A;  3UDC A;  1KQ2 A;  2E6N A;  5GAN 2;  4X9C A;  1N27 A;  5HY6 A;  1W4S A;  1ZHI A;  3NTK A;  4M7A G;  3QG1 A;  2YRV A;  3GPL A;  2P0Q A;  2BIV A;  1WJR A;  1YIJ A;  3A5Z B;  2JVV A;  3MP6 A;  1WJQ A;  4F7U G;  3OYE A;  2V8J A;  4C92 C;  2DK3 A;  2DKG A;  2HQX A;  2E12 A;  4II1 A;  5CQX A;  4XU3 A;  5FRM A;  4R55 A;  3JB9 J;  3LYI A;  3BDL A;  2VXF A;  4C92 D;  2RO0 A;  5J39 A;  1YJ9 A;  5FRO A;  4A4F A;  4CI0 C;  2X4X A;  4MDW A;  2EQU A;  3T9N A;  5GAN 6;  1VQ8 T;  3G7Z A;  1Y71 A;  5CCA A;  3OYF A;  3I56 A;  3DLL A;  1K73 C;  3JCM h;  1KHC A;  5LJ3 j;  2F5T X;  3V8J A;  5GMK m;  4J7I A;  2ZZD A;  5CQY A;  1Q82 U;  4X9D A;  4XAX B;  3FIF A;  3QJY A;  3F70 A;  5GAN h;  1Q86 U;  2XHC A;  1I5L A;  4ZTJ A;  1D3B B;  1YCY A;  2E70 A;  3R6O A;  3OYD A;  2ZPB B;  3C94 A;  3CCR T;  1VQK A;  2R58 A;  5FU7 B;  4KUD K;  4M77 C;  3I55 T;  5I2S A;  1KD1 U;  3L2R A;  3HRS A;  5DLQ E;  3MP8 A;  2QQR A;  4M75 B;  4M77 D;  3JB9 I;  4LD6 A;  4PL6 A;  4C92 G;  2D6F A;  1QVF A;  2RHZ A;  1X01 A;  3OBY A;  2M0O A;  3QUI A;  1VQO T;  1BI0 A;  1XTD A;  5CIU A;  3CCV T;  3DB4 A;  4N4G A;  2CZ1 B;  4ELZ C;  3OYK A;  3L42 A;  1X6O A;  5GAO r;  1O75 A;  3MET A;  3JB9 D;  1WQ7 A;  3M57 A;  3MCA B;  4C0G A;  4F7U B;  3GOX A;  2EYQ A;  5LJ3 g;  4V2S A;  1VQP A;  1KC8 U;  2E5Q A;  3CC4 A;  1WJS A;  4ZN3 A;  4OF1 A;  2GQV A;  4NOY A;  2O4X B;  5GMK j;  3JAM E;  4BE0 A;  4J83 A;  3HRT A;  4ME7 A;  3PIO A;  4M77 G;  5GAO l;  1K8A U;  3J81 E;  1Y96 B;  3OW2 A;  2RB6 A;  1KG1 A;  2EKO A;  2JTF A;  2DXU A;  3CCM T;  4LD9 K;  1JRI A;  1KHI A;  4J8O A;  2K3Y A;  5GAN 8;  3G71 A;  4HT9 A;  1N8R C;  4XK8 E;  4OB3 B;  4HCZ A;  2CZ0 B;  4C0D C;  3JB9 G;  3HP9 A;  3OMG A;  2EQJ A;  3MEU A;  3JCM P;  3CCJ A;  2NLU A;  3RKW A;  4BY6 B;  1YHQ A;  2P0K A;  2KQW A;  1OI1 A;  2ZPE B;  3M59 A;  3QBY A;  2V8K A;  1M9S A;  5FLX E;  2RK1 A;  4HCB A;  1U1S A;  3OYL A;  1D3B A;  1FWZ A;  3OS0 A;  2D9T A;  2IVW A;  1WGS A;  2QDY B;  3NTI A;  5CKD A;  3SWN B;  3UPU A;  4Q5W A;  2P4T A;  4UC4 A;  1M1F A;  3L2V A;  3GIB A;  3MEV A;  4M75 E;  4E47 A;  4MZM A;  1YIJ T;  1X75 C;  4DA4 A;  3FB9 A;  2LCL A;  3X28 B;  3ASK A;  3ME9 A;  5CK9 A;  5HK0 A;  3L2Q A;  1S72 A;  1K9M C;  2EQM A;  1H3Z A;  1XNI A;  3BFM A;  1NE8 A;  3FLG A;  1M5Q 1;  4XQ3 A;  3P8B B;  4C8Q F;  4BDY A;  5DLO A;  2ZPH B;  3GF5 A;  5GAN 4;  3JCM b;  3OS1 A;  3OY9 A;  4QW2 A;  3OYA A;  2JN0 A;  1YJ9 T;  2A7Y A;  2VV5 A;  2L8D A;  1IZ6 A;  2XG8 D;  4KBM B;  4F7U E;  1YJW A;  4ATO A;  2RJF A;  3FC3 A;  3I56 T;  3PNW C;  4J5Y A;  2FVU A;  3UWN A;  1YIT A;  5A0G A;  4PJO B;  3GLX A;  1QW1 A;  3RUX A;  4JS4 A;  2O4X A;  1VQL A;  1BIA A;  2CS7 A;  2QQB A;  1JBM A;  5IAY A;  4MMK A;  2KDS A;  3G6E A;  1VIF A;  2RI2 A;  3CBM A;  5CVI A;  1VQK T;  2DIG A;  4M7A C;  3OB9 A;  1Y96 A;  1LNX A;  5GMK h;  1N9R A;  5L8R E;  2VUB A;  3MO8 A;  4M7A D;  3OYM A;  2EJG A;  3OSV A;  3QHS A;  4BI3 A;  2DJZ A;  2HQE A;  4E7H A;  1M90 U;  2RHU A;  2B8A A;  5FRN A;  3OS2 A;  3EFS A;  4OVA A;  4HT8 A;  3CD6 A;  4C0Z A;  1VQN A;  1Y7X A;  2WSE E;  4N4I A;  3SB2 A;  3M58 A;  4C8Q C;  2EWN A;  2FHD A;  5A0L A;  4C5E A;  5GAN 3;  5EG2 A;  2DTO A;  4C8Q D;  1B34 B;  3C4S A;  4JRI A;  4EMK A;  3CC4 T;  1VQP T;  1YJN A;  5KH6 A;  2PVO B;  2QI2 A;  3OQ5 A;  4C0D B;  2K57 A;  5M9O A;  3SWN A;  1VQ9 A;  3NFC A;  3CC2 A;  1U1T A;  2PVD B;  3X25 B;  1G3T A;  2EIF A;  4XTZ A;  2YHT A;  2JUF A;  2RI5 A;  3CMA A;  4B9W A;  3M55 A;  4RCB A;  4M7D B;  4QVZ A;  1I81 A;  1QVF S;  3J80 E;  1Q82 C;  4XU2 A;  4M78 B;  3L1A A;  1MGQ A;  3HFO A;  3G71 T;  4JS5 A;  1H64 1;  5CKE A;  4EMH A;  2DZC A;  1Q86 C;  1M1K U;  3CPW A;  1KQ1 A;  3PFS A;  1OZ2 A;  3G4S A;  4C8Q G;  1NJI U;  4FM4 B;  1KD1 C;  3CCJ T;  4PJO E;  1YHQ T;  1BKB A;  4PJO A;  4MML A;  3EAE A;  2VYT A;  3HRU A;  1O9S A;  1JJ2 A;  4B9X A;  2GF7 A;  3J7A F;  3QYG B;  3CCS A;  4OB0 B;  4X34 A;  1DJ7 B;  5J26 A;  4N0A C;  4BD3 A;  3SFM A;  3KXT A;  2RHI A;  5CKH A;  4BI8 B;  3RIR A;  3OW2 S;  3MHX A;  3A8L B;  3OSS C;  4YTL A;  3VJP A;  1KQS A;  3FDR A;  3LWH A;  2X4W A;  1RL2 A;  3CCU A;  1KC8 C;  2A3L A;  1S72 T;  3VYG A;  3TCJ A;  5C6S A;  5LL6 S;  3A8H B;  5LJ5 d;  1BYM A;  2K3X A;  4XTV A;  3C12 A;  3DKM A;  4M7A B;  3GNG A;  3QYH B;  3E19 A;  2WSF E;  3O8V A;  3QZ9 B;  5AYF A;  1YJW T;  5GAN 5;  1K8A C;  1UGR B;  2QA4 A;  2WAC A;  3QPH A;  4IKF A;  2ZPG B;  4NL2 A;  1M1G A;  4JRQ A;  3M54 A;  1YIT T;  2RI3 A;  4LDY A;  1VQL T;  3A8M B;  2RHX A;  4C0F A;  4JDS A;  3PMT A;  3G6E T;  3L2U A;  2K5F A;  2LQ8 A;  4J6W A;  4XTY A;  2XIC A;  3LH0 A;  1BI2 A;  3FRN A;  4JLI A;  2HBP A;  3TU4 K;  2GCX A;  1BIB A;  2BUD A;  1G3Y A;  2I2L A;  4PKC C;  4M7D E;  3FJP A;  3PT9 A;  4M7D A;  2O01 E;  2MWP A;  5GAO q;  4M78 E;  4GLK A;  4BE1 A;  4M78 A;  2ZPF B;  4M7D F;  3L2Z A;  4Y28 E;  4NS5 A;  1HXD A;  1UB4 A;  2QEX A;  1SSF A;  2M16 A;  2R5A A;  3QO3 A;  2DVE A;  4E7J A;  3CD6 T;  1VQN T;  3CME A;  4E7L A;  3LGF A;  1N9S A;  1Y07 A;  4FL6 A;  1M8V A;  1P92 A;  2KY9 A;  3ZFJ A;  4IUU A;  4C92 B;  4IUR A;  2DXB A;  2Y4X A;  1JB0 E;  2WSC E;  1QP2 A;  1YJN T;  5GAN d;  2VGN A;  4KUI A;  1VQ9 T;  4C5I A;  2OTL A;  1PSF A;  3OA6 A;  2DTH A;  4OP0 A;  1FXX A;  5A0D A;  3CC2 T;  3M4G A;  2CKK A;  3KBG A;  3M5A A;  2DPP B;  3QKJ A;  3X20 B;  4LDW A;  1LOJ A;  4QQD A;  4M75 A;  3URG A;  3CMA T;  2LTO A;  2Y4Y A;  4OMF B;  1FX7 A;  2X35 A;  1I8F A;  3CXC A;  5J3B A;  2K4Y A;  5GAO m;  4M75 F;  2DD4 A;  4L59 A;  3RKY A;  4M7A E;  2XDB A;  4FIB A;  2E41 A;  2RJC A;  4M77 B;  3S3N A;  2CZ6 B;  4F7U A;  3G4S T;  1VQ4 A;  2MI6 A;  1OZ3 A;  3A8O B;  3H8Z A;  1Q7Y C;  3N5B B;  2RJD A;  5DM7 R;  1N8R U;  5KE3 A;  5GAM f;  4JLG A;  3LLR A;  3WXM B;  4F7U F;  4DOW A;  4A53 A;  3L2W A;  5D6X A;  1V29 B;  2XKO C;  3JCM Q;  3CCS T;  1M90 C;  3P8D A;  3QSU A;  2G3R A;  2OAU A;  5CAI A;  3CCQ A;  5LJ3 e;  3AHU A;  2KMT A;  2KSS A;  2RK2 A;  5GAN 7;  4CRI A;  2PU9 B;  4RG2 A;  4KT0 E;  4A4E A;  2VC8 A;  3VUZ A;  1VQ6 A;  2LX9 A;  3HFN A;  1UGS B;  4JRK A;  3CCU T;  4RKU E;  3ZBD A;  4ELY C;  3E1S A;  5FU7 C;  2OTJ A;  2DEQ A;  1NPP A;  3RMQ A;  2EJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...