4OMFB

The f420-reducing [nife]-hydrogenase complex from methanothermobacter marburgensis, the first x-ray structure of a group 3 family member
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
280
structure length
280
Chain Sequence
VLGTYKEIVSARSTDREIQKLAQDGGIVTGLLAYALDEGIIEGAVVAGPGEEFWKPQPMVAMSSDELKAAAGTKYTFSPNVMMLKKAVRQYGIEKLGTVAIPCQTMGIRKMQTYPFGVRFLADKIKLLVGIYCMENFPYTSLQTFICEKLGVSMELVEKMDIGKGKFWVYTQDDVLTLPLKETHGYEQAGCKICKDYVAELADVSTGSVGSPDGWSTVITRTDAGDSIFKQAVEAGLFETKPIEEVKPGLGLLEKLAAQKKEKAEKNIAARKEMGLPTPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F420-reducing hydrogenase, subunit gamma
publication title The F420-Reducing [NiFe]-Hydrogenase Complex from Methanothermobacter marburgensis, the First X-ray Structure of a Group 3 Family Member.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 96
structure length 280
sequence length 280
ec nomenclature ec 1.12.98.1: Coenzyme F420 hydrogenase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04422 FrhB_FdhB_N Coenzyme F420 hydrogenase/dehydrogenase, beta subunit N-term
B PF04432 FrhB_FdhB_C Coenzyme F420 hydrogenase/dehydrogenase, beta subunit C terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1030 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4omfB02
4OMFB 4CI0C
chains in the Genus database with same CATH superfamily
2YWWA 1I07A 4JS5A 2HAXA 4XAXB 4ZTFA 4X34A 1BIAA 2PTKA 3HRTA 1AOJA 3C94A 3UATA 1MMNA 2JTMA 1VQKA 2RHUA 1MMGA 4DBFA 2K4YA 3N5BB 1D1AA 3CC2A 4FSSA 1K1ZA 1YBYA 4PJOF 3BFMA 2R5MA 4KRTA 5FROA 1K9MR 2HDAA 1RL2A 1A0NB 3PMIA 4HXJA 2JS2A 4A4EA 1Q82C 1P92A 2DRKA 3LWHA 3QDRB 3PVLA 5GMKj 2RN8A 2LDMA 1UDLA 2M02A 3LYIA 3G1JA 4RG2A 1LPLA 5GMKe 2ECZA 1Q81C 2EKHA 4M75E 1UGVA 1W2BS 4C8QA 2RJEA 3CBPA 1VQPT 4CRIA 1WQWA 3NTHA 1NEGA 3FLGA 2DETA 1ZA1B 1VA7A 4KT0E 1RAIB 3EGDA 4EMKC 3E9FA 1QVPA 2HZYA 3I55A 1ZUKA 2DA9A 2D0NA 2LQWA 5HY6A 8ATCB 1BCOA 1QVFS 1JB0E 3RKYA 1VIFA 4M7DA 1X27A 4XTVA 1M9SA 5KYWB 1ACMB 3SWNB 2LJ3A 3G4ST 2E3IA 2DD5A 2RK1A 2ED0A 3S3NA 2H3EB 1VQ9T 1TG0A 4HCZA 3QJYA 4M7AB 4M78E 1I1JA 2DL5A 1ZSZA 1PD0A 5GAN2 2AZSA 2XDDA 4R0KA 2F2XA 1VQ7Q 2CDTA 2B86A 2KYMA 4FT2A 5KYXA 1RADB 3LH0A 1WZOA 2LT4A 1KK7A 3OYYA 2ZZDA 2EQJA 2EIFA 1QWFA 3I5RA 3VS6A 1QCFA 2CSIA 3CCSQ 4KGXB 1M2VA 1VQLA 2EYZA 2BE9B 3GLXA 2QTVA 3OW2A 2K57A 2RK2A 2DJZA 5KYUB 2I0NA 4E7ZA 3L2RA 3UA6A 2DD4A 3QWYA 4ESRA 2YUOA 3CMAA 3CCQA 3EGUA 1SPKA 2D1XA 7AT1B 1Z9QA 4M75G 1E6HA 1KD1R 4DBQA 3CCVT 1OU9A 4OB1B 2YT6A 2J6KA 4FT4A 2QGFB 1WHJA 3PTAA 2G3RA 1X01A 4NL2A 4OMLA 1VQ5A 1S72A 4ZNXA 3QIIA 2CS7A 5CO7A 1EX4A 2SRCA 3C0CA 1DJ7B 3CCUA 1G83A 3VRZA 4IUQA 3QKJA 2RO0A 1KHCA 2VKNA 2EYQA 2JUFA 3TSWA 2KR3A 1GRIA 2LT1A 1MGQA 4JS4A 2ENMA 2CKKA 1VQKQ 2BZYA 4WCIA 3CCEA 1VQOA 3CC2Q 1N6AA 3VV0A 1YITA 2O2OA 1H641 1Y0MA 4JJDA 4C8QB 4M78G 1M1KC 2FZCB 5GAMd 1W70A 2VGNA 4F16A 1VQNT 2COWA 2DE0X 2Y4YA 3EGDB 1JXOA 1Q86R 2MIOA 1MMAA 2BUDA 1OPKA 2I2LA 3FEOA 4M77E 1LCKA 2HL3A 3M5AA 5FU6B 4EIKA 5GAN3 4BB7A 1XOVA 2BE7D 3FIFA 1IREB 5FRNA 4PNOA 2CUDA 2L8DA 3A5ZB 3OYNA 4M7DB 1NM7A 4C0DC 2P0PA 4J6YA 1Q7YC 4KGZB 4AG1C 2FRWA 2JM9A 2L3QA 1TOVA 3AT1B 5CKBA 4FU6A 2D0QB 1YHQT 4QQ6A 3I55Q 5GAN5 2EBPA 3P8HA 2M9UA 4FM4B 1NYGA 1ZSZB 4RTVA 1U8RA 3CCJA 1K0XA 2GNCA 2ZGWA 2NLUA 1RUWA 1T3SA 4Z89A 1KIKA 4MDXA 5KYXB 3M9QA 3PGGA 1CKBA 1X6BA 2GQIA 2QA4T 1YJNT 3A98A 1XQHA 2AK5A 4M4ZA 3O8VA 3JCMf 3LW5E 1ZUUA 3M0RA 3G71T 1H92A 3OW2S 4XU0A 2MAMA 1M90R 5KE3A 1T0JA 4JLGA 2B8AA 3X25B 3FB9A 1I5OB 4ZN3A 2ROLA 4HT9A 1I4K1 2F5TX 2LQKA 2RJCA 1OU8A 1HJDA 3OA6A 3CCLA 3SB2A 2DZCA 4J9CA 2EVRA 5FW9A 3OYFA 1VIEA 4OGCA 1VQLQ 4HCCA 3V8JA 2XI9A 2K79A 4B9WA 3E19A 4M75D 5FWBA 2PVOB 2LNVA 3SHWA 5A0GA 1EFNA 3OSSC 2E41A 2FB7A 3RDVA 2X51A 1VQ8T 4M77G 1WHHA 3PIOA 4BY6B 4OP0A 3CMAQ 1BKBA 2NUZA 3TCJA 3CCQQ 1LVKA 3MCAB 4WTOB 4IUUA 3TSZA 5LJ3j 1HD3A 3QBYA 4NS5A 1UJYA 1D0XA 1EIFA 4PJOE 4ZGJB 5LJ3e 4OMMA 3QHSA 2PQWA 4RTTA 1JQQA 4GLKA 4X1VA 1WHGA 1VQ5Q 1VYUA 2V1RA 3OQ5A 4PJNA 4QQGA 1S72Q 3ULRB 1JEGA 4RTYA 1NJIR 2JMAA 3M0TA 3P8DA 3S3MA 3CCUQ 5CK9A 3OS2A 2PVGB 2RPNA 4M78D 4LN2A 2DL7A 5I22A 1M4ZA 4LDUA 5LJ5g 1Q82U 1ZX6A 2MOXA 2IVWA 1X2QA 1QLYA 3KUFA 4M75A 3CC7A 3OS5A 1D1BA 2KMTA 1H8KA 3CCEQ 1VQOQ 1YITQ 1I81A 1Q81U 2P84A 4B9XA 4C5EA 4OMNA 2JNGA 4MDWA 1SF9A 4BACA 3LWIA 1U5SA 3LGLA 1OEBA 2CP2A 3MKDA 3M56A 2PUKB 3Q1JA 4BD3A 1Y7XA 2R58A 3VS2A 2JVVA 5HK0A 2X9HA 1FWZA 1VOMA 2RD1A 2OJ2A 2ZPBB 3MJXA 4IUVA 5LJ5h 4FYWB 3D7SB 1KQSA 1M27C 2RJFA 1IZ6A 1VYVA 4C0FA 2RJDA 2X4WA 1UTIA 4M78A 2DXTA 3GF5A 3HPWA 2C0TA 1KJWA 2GGRA 2YLCA 1JJ2A 4P5NA 1TSFA 4L6V5 3GBQA 3QZ5B 4FYYB 3HFOA 2LQ8A 2DL8A 1YP5A 3ZBDA 3CCJQ 1OULA 1WI7A 2HNIA 2EJ9A 4CC3A 4IURA 3RKXA 3VS0A 3X28B 5FRMA 2CZ0B 4Z02A 1UECA 3LH5A 2E5KA 1D0ZA 1VQ4A 4E7SA 1U06A 2LC4A 4PFZA 3EG9A 2K5FA 4C92C 4QKUA 2AKLA 3CCMT 4EMHA 2LQNA 2SEMA 3CCRT 4C0ZA 4LD9K 2DZ9A 4N0AA 2DFUA 2DL4A 4J9HA 3AHUA 2DEUA 3CCLQ 3CMEA 2CREA 3L2QA 2E5QA 2JTEA 4A4KA 1B34B 2JZ2A 4M77D 1QQJA 4XTYA 2XIDA 1T3LA 2BIVA 4C8QF 1VQPA 4EMKA 3UF4A 2NUPA 4A4HA 2E6ZA 3MP8A 1PKSA 4JJNK 5KYNA 2A3LA 1K8AC 2PU9B 3QXEB 2EWNA 2DNUA 1AWJA 2DMOA 4M7DF 1SKUB 1YN8A 2YXYA 2P0KA 2FG0A 2OAWA 4DEXA 1N8RR 1Y07A 2L89A 2YLBA 1YJ9Q 1HXDA 1MMDA 2QQRA 5D7UA 2DL3A 5GAMf 3KFVA 1M1KU 1YWOA 1AT1B 2LCSA 1S1NA 1WIEA 1IGUA 1VQMT 4M77A 1OOTA 3CPWP 4BE0A 5DLOA 4K11A 4XU2A 2O01E 4A53A 3TU4K 4JZ4A 2P4RA 4PJLA 3OYGA 1KQSS 3CC7Q 3UDCA 1XNIA 3JCMP 4DOWA 2MK5A 2E65A 2QASA 3EG1A 5IHNA 1QVGS 4PJMA 3INZA 5FU7C 4J83A 1WHMA 3URGA 3VS7A 2EJGA 3GNGA 1U1SA 4C92E 1JJ2S 1Q7YU 1SSFA 3HHTB 1ZLMA 1M90C 1VQ7T 5KCHA 4M78B 5GMKh 3FC3A 1YI2A 2HSEB 3L42A 4N0AC 4A4FA 2L5QA 2ZAEA 3CPWA 4B6MA 4IKFA 2KSSA 2KY9A 3FJ5A 4A4GA 1QKXA 2DIGA 5GAOn 3OYKA 1AWWA 2AT1B 2RMOA 1GL5A 2EPDA 1EZZB 4F7UE 2JTFA 2RHYA 2QQ9A 2C0OA 3EG2A 5GJWB 3CCST 2KRNA 1YJWT 3A1PA 3CCVA 1IHWA 2CH4W 2GF7A 1ABOA 4RTXA 4BI3A 3JCMJ 3V8KA 2EQIA 4HT8A 4J6XA 2DTOA 4CC7A 3EG9B 3NTKA 1C1AA 4PJOD 2FPDA 2DYBA 1KC8C 3OS1A 5CQXA 3QPHA 1BI0A 2ZPFB 1RAGB 1UUEA 1BI2A 4D6WA 1JO8A 2C0IA 2PNIA 3V7CA 4CI0C 3ZL7C 2E70A 1SRMA 1JXMA 3QYHB 2KI7A 1VQ4Q 3M0SA 3UA7A 2D8JA 1X6OA 5GAOl 5EC7A 2JMCA 2QG9B 1UGRB 1Y57A 1NJIC 4IIMA 5LJ5d 4M77C 2WSFE 2DXBA 4OF1A 2VVKA 5KH6A 4VUBA 4EMKB 3EGXB 1MUZA 1VQNA 2HQHA 1QWEA 1V76A 4FYXB 4XTZA 2WSEE 2NUPB 3DB3A 1LJOA 2LNHB 2RI5A 5CVIA 4RTUA 1VQKT 2V26A 3A8HB 3CMEQ 1D3BB 4JPBW 1QW1A 2FZGB 2KDSA 3EHRA 1U1TA 4ZGEB 2DXCA 1KHIA 2F1LA 3CC2T 3CD6T 1M8VA 1UGQB 1UEBA 3FJPA 3CXCP 1VQPQ 2MYSA 5IXBA 4C92G 1WPYA 1F1BB 1Y71A 1K0SA 4JRQA 2DERA 3TREA 2DAQA 2W10A 2L0AA 4JLIA 1Y96A 4GLMA 3DLLA 1M3CA 2RHXA 2GFUA 4HVUA 5CKHA 3RMSA 4F7UG 2ZPGB 5LL6S 5I11A 1QP3A 2QEXA 1BU1A 4M7AE 1PRLC 2DBMA 3G4SQ 2VC8A 1YJNA 1WXBA 3I55T 3VUBA 4AMCA 1WJQA 9ATCB 2E64A 1K73C 5GAOq 5IT9E 3I56T 5HKCA 1WHLA 2DTHA 3J7AF 2RQTA 1AVZC 3BDUA 2J6FA 2X3WD 4EDUA 2F5KA 3FRNA 1YWPA 1ZBJA 3VRYA 2K5IA 1TUCA 1HK9A 2OTJT 2ZPEB 2YRCA 3JB9I 3JCMb 1FXXA 1PNJA 2HCKA 3M0PA 2KEAA 5GANj 3A8GB 1YI2Q 1WHKA 1MNDA 4HCBA 1NE8A 3CPFA 4AFZC 5GANe 2DX1A 1FMWA 4LXCA 2FEIA 2FHDA 2DILA 2XDBA 1GCQC 3I9QA 4N4GA 5GMKm 4PJOC 3JCMQ 2CT4A 2DF6A 4RCBA 3BW1A 1RAAB 2RNAA 4UC4A 1WX6A 3VUZA 1GFCA 2DLPA 2D6FA 1VQLT 3CCVQ 2DM1A 2FPFA 3HRUA 3VU3C 2P0QA 1N9SA 1ZBXA 1JBMA 3H8ZA 5C6SA 2CYZB 3S3OA 2DIQA 4BE1A 2RF0A 1PSFA 4LNPA 3CMAT 3OYJA 2VXFA 2MCNA 3OYBA 4O6JA 2NYSA 1QKWA 3JCMe 1R0CB 2HKQB 2FZKB 4J9BA 1OZ2A 2RA2A 2KRSA 2EFIA 3RNJA 1N8RC 2P4TA 2JXBA 4C8QE 4M7AG 1NPPA 3WVEB 4OMOA 4M75F 1M2VB 5D6WA 1VQ5T 2GTOA 4OB0B 5ECAA 2M0YA 3NGPA 4ME7A 1BK2A 3CC4A 2DKGA 3EHQA 2GCXA 1VQ6T 1SEMA 1WLPB 3JAME 2X3XD 1VQNQ 2X35A 2V8IA 5LJ3g 2QQBA 3OYDA 1YIJT 2C06A 2EGCA 3QDFA 1QCNA 4C5IA 4C92D 4XU3A 2XG8D 3E1SA 5KYYA 1Q82R 4L5GA 1NPRA 2DTIA 3HP9A 5A0DA 3RMQA 2DPPB 2HEQA 3BE3A 4J9GA 4M7DE 5KE2A 1K8AU 2QK0A 1VQOT 4HCKA 2XDPA 4CC2A 1YITT 2JJ9A 1Q81R 4PKCC 1K9MC 2QTXA 1RI9A 4XTXA 2VWFA 2LCLA 2COYA 4XQ3A 2AZVA 3BY7A 4M78F 2ABLA 3H0HA 4E7LA 1AWXA 3NPFA 1X6GA 4LDYA 1TH7A 2CT3A 5LJ3h 2L3RA 1UGSB 2JW4A 3G6EA 2XHCA 3OY9A 4DBHA 4DBRA 2PVDB 1MV0B 1LNXA 2LP5A 2Y90A 3I35A 1IGQA 2NUTA 3ER0A 3BDLA 4MMLA 3MEAA 1E7OA 1YJ9A 3LX7A 3CBOA 2QEXQ 3EH1A 4HA8A 5CR2A 4BDYA 1WNLA 3M54A 3R6OA 1N9RA 2DVEA 2A08A 1YJNQ 1WJSA 3F70A 4C92A 1UE9A 2X4JA 4YTLA 2DVJA 5GMKi 2KT1A 3M0UA 1ZHIA 2KXDA 4PLIA 1IXDA 1W1FA 4PFPA 3O5ZA 2EYXA 3VS5A 1UHFA 2JT4A 5LJ3f 5L8RE 2QDYB 3OYMA 1K9AA 3CCMA 4XK8E 1YFNA 3M0QA 4J9DA 1M90U 1NBEB 1GFDA 2RQRA 5EG2A 5HK3A 3JB9G 4N4IA 3CCRA 5I2SA 4F7UA 1FMKA 4QVCA 1O75A 2CZ1B 2K2VA 4FYVB 3U23A 4E7HA 1YCYA 4E47A 4DQ2A 1WXTA 1J3TA 3QWXX 2OTLA 1PKTA 1MNEA 3VS4A 2AHJB 2H8HA 1MV3A 1SRLA 4JUVA 1R0BG 4HKEA 1BI1A 2E6NA 4R56A 3L2ZA 1KC8U 3PNWC 1TTHB 3CCLT 5M9OA 2CUBA 5KCOA 3WXMB 2RHIA 4KH1B 5GJVB 2EGEA 4JJCA 4XU1A 3A8OB 4X9DA 3QYGB 2K6DA 1W2BP 1G2BA 5GAOr 3UT1A 4DEYA 3QJ6A 4ZTJA 4LUEA 1ZQ1A 4C5GA 5LJ5f 2QGGA 1PHTA 1OI1A 5DLQE 1NJIU 4M7AD 4IUPA 1KD1C 2QQAA 2HBPA 2CP3A 2XMFA 4ELYC 1VQMA 4JZ3A 4PJOG 5A2QE 4M77F 4RTWA 2Z0WA 1QVFP 4C0GA 5IXFA 2RM4A 3CEYA 4IUTA 2QQSA 2ZPHB 3OB9A 3TEEA 4KUDK 4AG2C 1UB4A 4MMKA 4D8DA 1SHFA 2E1HA 1BI3A 1M1KR 2XK0A 3V7RA 3CC4Q 2KROA 2E4HA 2LX9A 1YNZA 1ZSGA 2QYZA 3ME9A 5IN1A 2K9GA 3M4GA 3PT9A 1IB8A 3OBWA 2GTJA 5KYWA 1TU0B 3CC7T 3SWNA 2RI3A 3M55A 2BZXA 3J80E 1ZUYA 1D1CA 5J39A 1AWOA 1Q86C 2PUOB 1R8OB 3H9NA 1XTDA 1M3BA 3LGFA 1YJWA 1Q7YR 4MZTA 1SHGA 1OYXA 1M30A 3OYIA 2FO0A 3RR6A 2CP7A 4EMGA 1X75C 3T9NA 1D0YA 2LMJA 1BYMA 5IAYA 2O4XA 3G6EQ 3I5SA 1UFFA 2L3SA 5AT1B 2X4XA 5GAMj 1K73U 4GBQA 3PE0A 4L59A 4M75B 2M51A 4RTZA 1G3WA 1OX9A 3KBGA 2K7AA 3G4SA 8AT1B 3A8MB 5GAMe 3M4YA 4FL6A 1VQ9A 3TQ7P 1IHVA 1RABB 2KE9A 4A54A 3JB9D 3UWNA 2CZ6B 3HSBA 3MEWA 3SEMA 2VUBA 2XD0A 1HYOA 3V7SA 4LUDA 1GCPA 3RESA 4BDZA 5KYUA 3PVQA 3VKIA 1UGPB 2J06A 3CCMQ 4PFOA 4LDXA 3PMTA 2HQXA 1PD1A 4AFSC 3CCRQ 2VGMA 2V8KA 4E6RA 2DJQA 2KAFA 4J6WA 2MMPA 2PZ1A 2YRDA 1M1FA 1X69A 1VQ4T 2QDLA 4RUGA 2CP5A 1WDXA 2L3PA 2DO3A 2G6FX 2JOYA 2VASA 5LJ3d 3CD6A 2OTLQ 1QP2A 1HSQA 4M7DD 4E7IA 1VUBA 2DBKA 2HBWA 3VJPA 1C0MA 2Y4XA 5GAN6 2ZCFB 3GP8A 2KYBA 1M3AA 2A36A 5CCAA 3SWNC 1WGSA 1W4SA 1OX8A 3CMET 3OYAA 1TWBA 3IQLA 3PFSA 2VB6A 4M7AC 2LVMA 3G7ZA 3QZ9B 3OBYA 3RIRA 3HRSA 1H3ZA 4HVWA 5GAN7 2F2VA 2FVUA 3JB9J 4AFQC 2L2PA 3E9GA 2ESWA 5FU7B 1N8RU 1KFZA 3JCMX 2DK3A 2A37A 4JJBA 2KNBB 2K2MA 2LX7A 2D8HA 5D6YA 4E2FB 3NHNA 1TXQA 3EG0A 2DXUA 2RH2A 1N27A 3GNFB 3FDRA 1VQMQ 3HKSA 1Z9ZA 2EYWA 1T0HA 2HSPA 3I56A 2EGAA 1LOJA 3M57A 4BE2A 1UG1A 2JN0A 4JDSA 4DA4A 4OMQA 2A0FB 4E7JA 3H6ZA 3QG1A 2RI2A 1K9MU 2OTJA 1E6GA 3NMZC 1V29B 1K4US 2K3BA 1X2KA 1G3SA 1G5VA 3OW2P 4ELZC 3L2UA 1B07A 3X26B 2HQEA 3REAB 1IO6A 1GCQA 5FWCA 2RB6A 1FMVA 4PJOA 1NG2A 2O4XB 2F2WA 5GAOp 5CKFA 3MHXA 4TVRA 4ZGDB 1K76A 3MEUA 1B3QA 4J5YA 4J9IA 3RBBB 3C95A 4IIOA 4II1A 2D9TA 3OYHA 4XTUA 1YJWQ 1YHQA 1GBRA 2KVQG 4OGEA 1YI2T 4FIBA 1JU5C 3QSUA 1NYFA 1NZ9A 2FL7A 4M77B 1CSKA 4FW2A 1AHJB 1AEYA 3CBMA 3EFOA 3CXCA 4Y91A 2H3JA 4C8QC 2F69A 4HVVA 5I2MA 2QA4A 2YSQA 4CC4B 2K3XA 2XU8A 5IHKA 1NLOC 1RI0A 4N4HA 3KXTA 3EFRA 1VQ9Q 1M1GA 5IH2A 5GANg 2HMAA 1I5LA 1RAHB 4ATOA 1RAEB 3CPWS 2BTTA 1UHCA 1H3HA 3G71A 3QUIA 3MP1A 2YRVA 2YUQA 2EAYA 4BI4A 2WSCE 2DYIA 2E10A 2KQWA 1TUGB 3A8LB 3MEVA 5FU6C 4MZMA 2KXCA 2LZ6B 2FPEA 1VQ6A 4M7DC 5I21A 3E2UA 3VYHB 1BCMA 1PG5B 4MZPA 1UJ0A 1YIJA 3DB4A 3JCMW 4J7IA 2MI6A 1O9SA 4F14A 2EKOA 3RKWA 4Z8AA 4OMFB 2JS0A 2YHTA 1CKAA 4RKUE 5GAN8 3GIBA 5GANh 3R6NA 1ZSZC 3CD6Q 4QW2A 5FLXE 1WQ7A 1OZ3A 3UPUA 4R55A 4Q5WA 3JCMg 3NFCA 1WJRA 1VQ8A 1PSEA 3VS3A 4EPCA 2R57A 2X4YA 1TUDA 4RMOA 2KBTA 4KGVB 1KD1U 5CKDA 1AZEA 3GPLA 1WXUA 5CIUA 5C0MA 1K8AR 2EW3A 3THKA 2LJ1A 3CQTA 2ATCB 3DKMA 1GXIE 5GANf 1MHNA 2LRQA 1OQKA 2A28A 2IG0A 5L23A 4PLLA 2RQVA 1KG1A 1W6XA 2MWOA 4WF2A 1ABQA 2HD0A 3CCQT 2GBQA 3JCMh 4C92F 2LJ0A 4FW1A 1D09B 4OB2B 4LD6A 2FYKA 4PJJA 4Y28E 1QCOA 4A63B 3SFMA 4ANJA 1SG5A 3TVTA 2J05A 2KT8A 3X20B 3I56Q 2R5AA 4J7FA 2O9SA 2QEXT 4C0DB 4PJOB 1S72T 4F7UF 2MWPA 3EG3A 3VS1A 1NEBA 2K5LA 3CCUT 4F17A 4QVZA 1RACB 2RQWA 4BY6C 2OTJQ 1AD5A 1Q86U 1NLPC 1Y96B 2QI2A 2IIMA 3PIPA 2CZ7B 2YUNA 3HFNA 4BUGA 1SSHA 3CCET 4KULA 3CXCS 1PWTA 2KRMA 4PL6A 4FCYA 2EYYA 4BI8B 2DEQA 1X43A 3EFOB 3ZFJA 4E7KA 4JRKA 1PM3A 1BIBA 2IPOB 1R77A 3NTIA 2O9VA 1PC0A 2YDLA 5DM7R 1YHQQ 1G3TA 4X9CA 2M1HA 2O31A 1C6VX 2RQUA 3SDZA 4ORZA 1VYTA 4F04B 1G3YA 4KUIA 1AZGB 3M53A 5GAOm 2MPXC 1KC8R 4J9EA 3RUXA 3OSVA 1I8FA 1B34A 2QA4Q 1FX7A 4LE9A 2LCCA 2M0OA 4LDWA 3QO3A 3H0FA 5HCKA 1M2OA 2EQMA 1B7TA 2AKKA 2ZPIB 3ZEHA 3G71Q 1M8MA 3CCJT 1U3OA 2OAUA 2BKDN 3WVDB 3JCMc 3M59A 3X24B 5AYFA 3DLMA 4FSXA 4OB3B 1VQ6Q 2EQUA 4LDVA 4AFUC 2EQKA 1OPLA 3META 3REBB 4C8QG 1YIJQ 4V2SA 2CP6A 3JV3A 2M16A 5J26A 2FRYA 5IHIA 4AT1B 2CP0A 2KK4A 1V1CA 2WACA 3GOXA 2CSQA 1BB9A 4RCCA 2W0ZA 1KQSP 2ROTA 4RG8A 3CC4T 4M7AF 1QVGP 4O5VA 3VYGA 4J9FA 3OS0A 1VQ8Q 2OI3A 1PRMC 1JJ2P 3JSCA 4M7DG 1I0CA 1KSWA 5CQYA 4OMPA 2VXEA 3OMGA 5GAN4 1OV3A 4XTWA 5D6XA 5LJ5j 3J81E 3OYCA 4Y92A 5LJ5e 1KQ1A 3JRZA 2CGHA 1QVGA 1RLPC 1TS9A 2YUPA 2BZ8A 3L2VA 1WFWA 5CAIA 2V8JA 1N5ZA 1Q95G 3HTRA 3G6ET 3OMCA 4ZN1A 4NL3A 2LTOA 5GANd 1RAFB 3MPUB 1IRXA 5KYYB 2AIRB 3MP6A 1K73R 2GQVA 1W2BA 1ZA2B 5DY9A 4QVDA 1YJ9T 3EH2A 3JB9H 2QXFA 2VYTA 2CH4A 2HL5C 3MO8A 2EJFA 4Z88A 3L2WA 3C4SA 3H41A 4QQDA 3OYEA 4GY5A 1XJWB 1VQ7A 1M5Q1 1WYXA 4KH0B 5GAMg 2COZA 2ED1A 1QVFA 3EAEA 4C5HA 4PK4A 2VV5A 3ASKA 2OX7A 4NOYA 2QAZA 1YCSB 2NWMA 4J8OA 2J6OA 4M75C 3RERA 2JM8A 1RLQC 3LLRA 2NUTB 3M58A 4M7AA 3JB9F 3V8LA 3CCSA 3S6WA 3JCMd 1G8XA 1BBZA 2RHZA 2OTLT 2E12A 1PCXA 2DRMA 1FYNA 4C92B 3C12A 2HKNA 2J7IA 2MF2A 4JRIA 3EGXA 2E3HA 3OYLA 5GAMh 3P8BB 2A7YA 5A0LA 3SD4A 1D3BA 4F7UB 2O88A 1QMCA 2GFAA 6AT1B 3HL8A 2K3YA 5J3BA 3JCMV 4KBMB 3EFSA 4D8KA 3H0IA 1ARKA 2V1QA 4QT7A 4M78C 5GMKl 1JRIA 1WA7A 5CKEA 1KQ2A 4JRPA 1GBQA 4C8QD 2KGTA 4DOVA 2XICA 4OVAA 2XKOC 3L1AA
chains in the Genus database with same CATH topology
1N8RC 1YHQA 2P4TA 4C8QE 4M7AG 2KVQG 1NPPA 4OGEA 3WVEB 4JS5A 4M75F 2HAXA 1YI2T 1KQSA 4FIBA 4XAXB 5D6WA 4ZTFA 1VQ5T 2RJFA 3QSUA 1IZ6A 1BIAA 4X34A 3HRTA 1NZ9A 3C94A 4OB0B 4C0FA 2FL7A 2JTMA 4M77B 1VQKA 2RHUA 2RJDA 2X4WA 2K4YA 4ME7A 3CC4A 4M78A 2DXTA 3N5BB 2DKGA 2GCXA 1VQ6T 3JAME 3GF5A 3CC2A 1AHJB 3HPWA 2X35A 2YLCA 2V8IA 3CBMA 4P5NA 3CXCA 1YBYA 2H3JA 2QQBA 4PJOF 4Y91A 5LJ3g 3OYDA 1YIJT 4C8QC 2C06A 2F69A 4L6V5 5I2MA 3QZ5B 3BFMA 3KXTA 2R5MA 4C5IA 4C92D 3HFOA 2K3XA 2LQ8A 2XG8D 2XU8A 3E1SA 4XU3A 4L5GA 1NPRA 1RI0A 2DTIA 3EFRA 3HP9A 4N4HA 3RMQA 5FROA 2DPPB 2HNIA 1M1GA 2EJ9A 5GANg 1RL2A 3PMIA 5KE2A 4M7DE 1K8AU 1I5LA 4IURA 4A4EA 1VQOT 3RKXA 4ATOA 1Q82C 3X28B 3CPWS 2XDPA 1P92A 1YITT 2CZ0B 3LWHA 3QDRB 4Z02A 3G71A 5FRMA 3QUIA 3MP1A 2YRVA 1K9MC 4PKCC 4BI4A 2EAYA 5GMKj 2WSCE 2LDMA 2E10A 2KQWA 2QTXA 3A8LB 3LYIA 3MEVA 4XTXA 5FU6C 4RG2A 2LCLA 4MZMA 1VQ4A 5GMKe 1Q81C 4XQ3A 2LC4A 4M75E 1W2BS 4C8QA 2RJEA 3BY7A 2K5FA 3CBPA 4M78F 4CRIA 1VQPT 5I21A 4E7LA 1VQ6A 4M7DC 1WQWA 3VYHB 4C92C 3NTHA 4MZPA 4LDYA 3FLGA 1YIJA 3DB4A 3CCMT 3JCMW 1TH7A 4KT0E 5LJ3h 4J7IA 4EMHA 2L3RA 1UGSB 3G6EA 2MI6A 4EMKC 3E9FA 1O9SA 2XHCA 3OY9A 1QVPA 3CCRT 2EKOA 3RKWA 2PVDB 2Y90A 1LNXA 4OMFB 2YHTA 4C0ZA 4RKUE 3I55A 4LD9K 2DZ9A 5GAN8 3ER0A 4N0AA 3GIBA 5GANh 3BDLA 4MMLA 5HY6A 3MEAA 1YJ9A 4QW2A 5FLXE 1WQ7A 3CBOA 3LX7A 1QVFS 1OZ3A 3AHUA 4HA8A 5CR2A 3CMEA 1JB0E 4BDYA 3UPUA 3RKYA 1WNLA 1VIFA 2E5QA 3M54A 4R55A 4Q5WA 3L2QA 3R6OA 1N9RA 3JCMg 4A4KA 4M7DA 2DVEA 3NFCA 1WJSA 1B34B 1WJRA 2JZ2A 3F70A 4M77D 1PSEA 4XTYA 4C92A 1VQ8A 4XTVA 2X4JA 4EPCA 1M9SA 2XIDA 2R57A 4YTLA 2X4YA 5GMKi 1ZHIA 4PLIA 2BIVA 3SWNB 4C8QF 1VQPA 4RMOA 4EMKA 3G4ST 2DD5A 2RK1A 5LJ3f 3S3NA 5L8RE 2QDYB 1VQ9T 3OYMA 3CCMA 4XK8E 1KD1U 1M90U 5CKDA 4HCZA 3GPLA 3QJYA 4M7AB 4M78E 4A4HA 5CIUA 5C0MA 5EG2A 5HK3A 3JB9G 4N4IA 2E6ZA 3CCRA 3ZBDA 3DKMA 5I2SA 5GANf 1GXIE 5GAN2 1MHNA 3MP8A 4F7UA 4QVCA 2XDDA 1O75A 4JJNK 2LRQA 2A3LA 2CZ1B 2IG0A 2K2VA 2PU9B 4PLLA 1K8AC 3QXEB 1KG1A 2EWNA 4FT2A 4E7HA 1YCYA 4E47A 4DQ2A 2MWOA 3LH0A 4WF2A 2HD0A 3CCQT 2LT4A 2OTLA 4M7DF 3JCMh 3OYYA 2ZZDA 4C92F 2EQJA 2EIFA 4OB2B 2P0KA 4LD6A 1Y07A 2FYKA 2L89A 2YLBA 2AHJB 4Y28E 1HXDA 2QQRA 3SFMA 5GAMf 4JUVA 3X20B 1M1KU 1VQLA 3GLXA 4HKEA 2R5AA 1BI1A 4J7FA 2E6NA 4R56A 3L2ZA 1KC8U 2QEXT 1VQMT 4C0DB 4PJOB 3PNWC 4M77A 3CCLT 2K57A 5M9OA 2RK2A 3OW2A 1S72T 4F7UF 2DJZA 5KCOA 2MWPA 4BE0A 5DLOA 3WXMB 2K5LA 4XU2A 3L2RA 2O01E 3CCUT 2DD4A 4A53A 3TU4K 2RHIA 4XU1A 4QVZA 3A8OB 4BY6C 3OYGA 1KQSS 3CMAA 4X9DA 3UDCA 1XNIA 3CCQA 1Q86U 3QYGB 3JCMP 4DOWA 2E65A 5GAOr 1QVGS 3INZA 1Y96B 5FU7C 4M75G 4J83A 3UT1A 2QI2A 3QJ6A 3PIPA 4ZTJA 3CCVT 2CZ7B 1ZQ1A 3HFNA 4C5GA 4BUGA 4OB1B 5LJ5f 3URGA 3CCET 4KULA 2EJGA 3GNGA 4FT4A 1U1SA 4C92E 3CXCS 1Q7YU 1OI1A 5DLQE 1JJ2S 1SSFA 1NJIU 3HHTB 3PTAA 5A0DA 4IUPA 1KD1C 1M90C 4M7AD 4PL6A 2G3RA 5KCHA 1X01A 1VQ7T 2QQAA 4M78B 4NL2A 5GMKh 2HBPA 3FC3A 1YI2A 3L42A 4BI8B 4N0AC 4A4FA 2L5QA 3CPWA 4ELYC 1VQMA 1VQ5A 1G5VA 2DEQA 4PJOG 5A2QE 3ZFJA 1S72A 4M77F 4E7KA 3QIIA 2CS7A 5CO7A 4IKFA 4JRKA 1BIBA 2KSSA 1DJ7B 2KY9A 4A4GA 4C0GA 2DIGA 5GAOn 3NTIA 3OYKA 3CCUA 4IUQA 3QKJA 2RO0A 5DM7R 1KHCA 4F7UE 2RM4A 3CEYA 4IUTA 1G3TA 2EYQA 2JUFA 2QQSA 2RHYA 2JTFA 2QQ9A 2ZPHB 3OB9A 2M1HA 4X9CA 3TEEA 4KUDK 1UB4A 2LT1A 4MMKA 3CCST 1MGQA 4JS4A 3SDZA 1YJWT 2CKKA 2E1HA 3CCVA 1BI3A 2XK0A 3V7RA 2GF7A 1G3YA 4KUIA 4BI3A 3CCEA 3JCMJ 1VQOA 3M53A 5GAOm 3V8KA 1N6AA 3VV0A 1YITA 4HT8A 2LX9A 4J6XA 3RUXA 2DTOA 1H641 4C8QB 3ME9A 1M1KC 4M78G 3NTKA 3OSVA 5IN1A 1I8FA 5GAMd 3M4GA 1B34A 3PT9A 4PJOD 1KC8C 1FX7A 2VGNA 3OBWA 2LCCA 5CQXA 3OS1A 1VQNT 2M0OA 3CC7T 4LDWA 3QO3A 3SWNA 2Y4YA 3QPHA 2RI3A 3M55A 1BI0A 3J80E 2ZPFB 2BUDA 2EQMA 1BI2A 2I2LA 2ZPIB 3ZEHA 4D6WA 3FEOA 4M77E 5J39A 3CCJT 3V7CA 4CI0C 2OAUA 2E70A 1Q86C 2BKDN 2PUOB 3M5AA 1R8OB 5FU6B 5GAN3 1XTDA 3WVDB 3JCMc 4BB7A 1XOVA 3QYHB 3M59A 3LGFA 1YJWA 3X24B 4MZTA 5AYFA 3FIFA 1OYXA 3DLMA 1IREB 5FRNA 4PNOA 1X6OA 3OYIA 2L8DA 3A5ZB 4FSXA 3OYNA 4OB3B 4M7DB 4EMGA 5GAOl 1X75C 3T9NA 2EQUA 4LDVA 1UGRB 2P0PA 4J6YA 4C0DC 1Q7YC 1NJIC 5LJ5d 2EQKA 3META 4C8QG 4M77C 5IAYA 2O4XA 4V2SA 2WSFE 1BYMA 2DXBA 4OF1A 5KH6A 2M16A 5J26A 4VUBA 4EMKB 5CKBA 1VQNA 4FU6A 2D0QB 1YHQT 2X4XA 4QQ6A 4XTZA 5GAMj 2WSEE 2KK4A 1K73U 3DB3A 4L59A 1LJOA 4M75B 5GAN5 1G3WA 3P8HA 2M9UA 2WACA 4FM4B 3KBGA 2RI5A 3GOXA 3G4SA 5CVIA 4RCCA 3A8MB 5GAMe 1U8RA 3M4YA 3CCJA 4FL6A 4RG8A 1VQ9A 3A8HB 1VQKT 1D3BB 2ZGWA 3CC4T 1QW1A 2NLUA 2KDSA 4M7AF 1U1TA 4O5VA 2DXCA 4A54A 4ZGEB 3JB9D 1KHIA 3CC2T 3UWNA 5LJ5h 3VYGA 2CZ6B 3CD6T 3MEWA 3OS0A 2VUBA 2XD0A 3HSBA 1M8VA 3V7SA 1UGQB 4MDXA 3M9QA 3PGGA 3RESA 1UEBA 3FJPA 4BDZA 3JSCA 4M7DG 2QA4T 4C92G 3VKIA 1YJNT 1WPYA 5CQYA 1UGPB 1XQHA 2VXEA 4LDXA 3PMTA 1Y71A 3O8VA 3OMGA 5GAN4 4JRQA 2HQXA 4XTWA 2DAQA 3LW5E 3JCMf 3TREA 4JLIA 5D6XA 5LJ5j 3J81E 3G71T 3OYCA 3OW2S 1Y96A 2VGMA 4XU0A 2MAMA 2V8KA 2KAFA 3DLLA 4J6WA 2RHXA 5LJ5e 2MMPA 5KE3A 2GFUA 1KQ1A 1M1FA 3JRZA 1VQ4T 2CGHA 4JLGA 2B8AA 5CKHA 3RMSA 3X25B 4F7UG 1QVGA 3FB9A 4ZN3A 2DO3A 2JOYA 4HT9A 1I4K1 2F5TX 2LQKA 2ZPGB 2RJCA 3L2VA 5LJ3d 3CD6A 5CAIA 5LL6S 1QP3A 2V8JA 2QEXA 3OA6A 1QP2A 3CCLA 3SB2A 2DZCA 4M7DD 4E7IA 4M7AE 1VUBA 3G6ET 3OMCA 4ZN1A 3OYFA 3VJPA 2VC8A 4NL3A 2LTOA 1YJNA 5GANd 2Y4XA 1VIEA 5GAN6 2ZCFB 3MP6A 4OGCA 3I55T 2QA4A 3GP8A 3VUBA 2GQVA 5CCAA 4HCCA 3SWNC 3V8JA 1W2BA 1WGSA 5DY9A 4QVDA 1YJ9T 1W4SA 1WJQA 2XI9A 3JB9H 2E64A 2QXFA 3E19A 2VYTA 4M75D 2PVOB 4B9WA 3OYAA 3CMET 2LNVA 5GAOq 1K73C 3MO8A 2EJFA 5IT9E 3I56T 3PFSA 3L2WA 4M7AC 5A0GA 2LVMA 3OSSC 2E41A 2FB7A 3G7ZA 5HKCA 1VQ8T 2DTHA 3QZ9B 3OBYA 3C4SA 4M77G 3RIRA 3J7AF 4QQDA 3PIOA 3BDUA 3HRSA 4BY6B 1H3ZA 3OYEA 5GAN7 4GY5A 4OP0A 4EDUA 2FVUA 1BKBA 3JB9J 1M5Q1 3TCJA 1VQ7A 3MCAB 2F5KA 3E9GA 3FRNA 5FU7B 5GAMg 2K5IA 1N8RU 4IUUA 3JCMX 2DK3A 1QVFA 5LJ3j 1HK9A 3EAEA 4C5HA 2OTJT 2VV5A 3ASKA 2ZPEB 4NOYA 3QBYA 4NS5A 3JB9I 3JCMb 1EIFA 4J8OA 5D6YA 4PJOE 1FXXA 4ZGJB 5LJ3e 3QHSA 2DXUA 4M75C 2PQWA 5GANj 4GLKA 3RERA 2RH2A 3A8GB 3LLRA 3M58A 4M7AA 1N27A 3GNFB 4HCBA 1NE8A 3FDRA 3JB9F 3V8LA 3CPFA 3HKSA 3CCSA 3OQ5A 4QQGA 3S6WA 5GANe 3JCMd 2FHDA 3I56A 2XDBA 2RHZA 2OTLT 1JJ2A 3P8DA 4N4GA 3S3MA 2E12A 5GMKm 5CK9A 1LOJA 3M57A 4C92B 3OS2A 2PVGB 3JCMQ 4PJOC 4BE2A 2JN0A 4M78D 3C12A 2MF2A 1M4ZA 4JRIA 4JDSA 4LDUA 5LJ5g 4RCBA 4DA4A 1Q82U 3BW1A 4UC4A 3OYLA 4E7JA 2IVWA 3H6ZA 3QG1A 2RI2A 3VUZA 1K9MU 3KUFA 2D6FA 4M75A 2OTJA 1VQLT 3CC7A 3OS5A 5GAMh 3P8BB 2A7YA 2KMTA 1V29B 3HRUA 5A0LA 3SD4A 3VU3C 1Q81U 1I81A 2P0QA 1D3BA 1N9SA 4F7UB 4B9XA 2GFAA 1G3SA 1ZBXA 1JBMA 4C5EA 4ELZC 3H8ZA 3HL8A 3X26B 2CYZB 2HQEA 2JNGA 4MDWA 5C6SA 3L2UA 3S3OA 2DIQA 2K3YA 4BE1A 5J3BA 3JCMV 4BACA 3LWIA 2RB6A 1PSFA 4KBMB 3EFSA 4PJOA 3LGLA 3CMAT 2O4XB 3M56A 2PUKB 3Q1JA 4M78C 5GAOp 4BD3A 3OYJA 5CKFA 3MHXA 4TVRA 1JRIA 4ZGDB 5GMKl 3MEUA 1KQ2A 5CKEA 2VXFA 4J5YA 3OYBA 1Y7XA 2R58A 4JRPA 2JVVA 3C95A 4O6JA 4C8QD 5HK0A 3JCMe 1FWZA 4II1A 2RD1A 4DOVA 2D9TA 3OYHA 2ZPBB 1OZ2A 4XTUA 4IUVA 2XICA 2RA2A 2XKOC 4OVAA 2EFIA 3L1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OMF B;  4CI0 C; 
#chains in the Genus database with same CATH topology
 2YWW A;  1I07 A;  4JS5 A;  2HAX A;  4XAX B;  4ZTF A;  4X34 A;  1BIA A;  2PTK A;  3HRT A;  1AOJ A;  3C94 A;  3UAT A;  1MMN A;  2JTM A;  1VQK A;  2RHU A;  1MMG A;  4DBF A;  2K4Y A;  3N5B B;  1D1A A;  3CC2 A;  4FSS A;  1K1Z A;  1YBY A;  4PJO F;  3BFM A;  2R5M A;  4KRT A;  5FRO A;  1K9M R;  2HDA A;  1RL2 A;  1A0N B;  3PMI A;  4HXJ A;  2JS2 A;  4A4E A;  1Q82 C;  1P92 A;  2DRK A;  3LWH A;  3QDR B;  3PVL A;  5GMK j;  2RN8 A;  2LDM A;  1UDL A;  2M02 A;  3LYI A;  3G1J A;  4RG2 A;  1LPL A;  5GMK e;  2ECZ A;  1Q81 C;  2EKH A;  4M75 E;  1UGV A;  1W2B S;  4C8Q A;  2RJE A;  3CBP A;  1VQP T;  4CRI A;  1WQW A;  3NTH A;  1NEG A;  3FLG A;  2DET A;  1ZA1 B;  1VA7 A;  4KT0 E;  1RAI B;  3EGD A;  4EMK C;  3E9F A;  1QVP A;  2HZY A;  3I55 A;  1ZUK A;  2DA9 A;  2D0N A;  2LQW A;  5HY6 A;  8ATC B;  1BCO A;  1QVF S;  1JB0 E;  3RKY A;  1VIF A;  4M7D A;  1X27 A;  4XTV A;  1M9S A;  5KYW B;  1ACM B;  3SWN B;  2LJ3 A;  3G4S T;  2E3I A;  2DD5 A;  2RK1 A;  2ED0 A;  3S3N A;  2H3E B;  1VQ9 T;  1TG0 A;  4HCZ A;  3QJY A;  4M7A B;  4M78 E;  1I1J A;  2DL5 A;  1ZSZ A;  1PD0 A;  5GAN 2;  2AZS A;  2XDD A;  4R0K A;  2F2X A;  1VQ7 Q;  2CDT A;  2B86 A;  2KYM A;  4FT2 A;  5KYX A;  1RAD B;  3LH0 A;  1WZO A;  2LT4 A;  1KK7 A;  3OYY A;  2ZZD A;  2EQJ A;  2EIF A;  1QWF A;  3I5R A;  3VS6 A;  1QCF A;  2CSI A;  3CCS Q;  4KGX B;  1M2V A;  1VQL A;  2EYZ A;  2BE9 B;  3GLX A;  2QTV A;  3OW2 A;  2K57 A;  2RK2 A;  2DJZ A;  5KYU B;  2I0N A;  4E7Z A;  3L2R A;  3UA6 A;  2DD4 A;  3QWY A;  4ESR A;  2YUO A;  3CMA A;  3CCQ A;  3EGU A;  1SPK A;  2D1X A;  7AT1 B;  1Z9Q A;  4M75 G;  1E6H A;  1KD1 R;  4DBQ A;  3CCV T;  1OU9 A;  4OB1 B;  2YT6 A;  2J6K A;  4FT4 A;  2QGF B;  1WHJ A;  3PTA A;  2G3R A;  1X01 A;  4NL2 A;  4OML A;  1VQ5 A;  1S72 A;  4ZNX A;  3QII A;  2CS7 A;  5CO7 A;  1EX4 A;  2SRC A;  3C0C A;  1DJ7 B;  3CCU A;  1G83 A;  3VRZ A;  4IUQ A;  3QKJ A;  2RO0 A;  1KHC A;  2VKN A;  2EYQ A;  2JUF A;  3TSW A;  2KR3 A;  1GRI A;  2LT1 A;  1MGQ A;  4JS4 A;  2ENM A;  2CKK A;  1VQK Q;  2BZY A;  4WCI A;  3CCE A;  1VQO A;  3CC2 Q;  1N6A A;  3VV0 A;  1YIT A;  2O2O A;  1H64 1;  1Y0M A;  4JJD A;  4C8Q B;  4M78 G;  1M1K C;  2FZC B;  5GAM d;  1W70 A;  2VGN A;  4F16 A;  1VQN T;  2COW A;  2DE0 X;  2Y4Y A;  3EGD B;  1JXO A;  1Q86 R;  2MIO A;  1MMA A;  2BUD A;  1OPK A;  2I2L A;  3FEO A;  4M77 E;  1LCK A;  2HL3 A;  3M5A A;  5FU6 B;  4EIK A;  5GAN 3;  4BB7 A;  1XOV A;  2BE7 D;  3FIF A;  1IRE B;  5FRN A;  4PNO A;  2CUD A;  2L8D A;  3A5Z B;  3OYN A;  4M7D B;  1NM7 A;  4C0D C;  2P0P A;  4J6Y A;  1Q7Y C;  4KGZ B;  4AG1 C;  2FRW A;  2JM9 A;  2L3Q A;  1TOV A;  3AT1 B;  5CKB A;  4FU6 A;  2D0Q B;  1YHQ T;  4QQ6 A;  3I55 Q;  5GAN 5;  2EBP A;  3P8H A;  2M9U A;  4FM4 B;  1NYG A;  1ZSZ B;  4RTV A;  1U8R A;  3CCJ A;  1K0X A;  2GNC A;  2ZGW A;  2NLU A;  1RUW A;  1T3S A;  4Z89 A;  1KIK A;  4MDX A;  5KYX B;  3M9Q A;  3PGG A;  1CKB A;  1X6B A;  2GQI A;  2QA4 T;  1YJN T;  3A98 A;  1XQH A;  2AK5 A;  4M4Z A;  3O8V A;  3JCM f;  3LW5 E;  1ZUU A;  3M0R A;  3G71 T;  1H92 A;  3OW2 S;  4XU0 A;  2MAM A;  1M90 R;  5KE3 A;  1T0J A;  4JLG A;  2B8A A;  3X25 B;  3FB9 A;  1I5O B;  4ZN3 A;  2ROL A;  4HT9 A;  1I4K 1;  2F5T X;  2LQK A;  2RJC A;  1OU8 A;  1HJD A;  3OA6 A;  3CCL A;  3SB2 A;  2DZC A;  4J9C A;  2EVR A;  5FW9 A;  3OYF A;  1VIE A;  4OGC A;  1VQL Q;  4HCC A;  3V8J A;  2XI9 A;  2K79 A;  4B9W A;  3E19 A;  4M75 D;  5FWB A;  2PVO B;  2LNV A;  3SHW A;  5A0G A;  1EFN A;  3OSS C;  2E41 A;  2FB7 A;  3RDV A;  2X51 A;  1VQ8 T;  4M77 G;  1WHH A;  3PIO A;  4BY6 B;  4OP0 A;  3CMA Q;  1BKB A;  2NUZ A;  3TCJ A;  3CCQ Q;  1LVK A;  3MCA B;  4WTO B;  4IUU A;  3TSZ A;  5LJ3 j;  1HD3 A;  3QBY A;  4NS5 A;  1UJY A;  1D0X A;  1EIF A;  4PJO E;  4ZGJ B;  5LJ3 e;  4OMM A;  3QHS A;  2PQW A;  4RTT A;  1JQQ A;  4GLK A;  4X1V A;  1WHG A;  1VQ5 Q;  1VYU A;  2V1R A;  3OQ5 A;  4PJN A;  4QQG A;  1S72 Q;  3ULR B;  1JEG A;  4RTY A;  1NJI R;  2JMA A;  3M0T A;  3P8D A;  3S3M A;  3CCU Q;  5CK9 A;  3OS2 A;  2PVG B;  2RPN A;  4M78 D;  4LN2 A;  2DL7 A;  5I22 A;  1M4Z A;  4LDU A;  5LJ5 g;  1Q82 U;  1ZX6 A;  2MOX A;  2IVW A;  1X2Q A;  1QLY A;  3KUF A;  4M75 A;  3CC7 A;  3OS5 A;  1D1B A;  2KMT A;  1H8K A;  3CCE Q;  1VQO Q;  1YIT Q;  1I81 A;  1Q81 U;  2P84 A;  4B9X A;  4C5E A;  4OMN A;  2JNG A;  4MDW A;  1SF9 A;  4BAC A;  3LWI A;  1U5S A;  3LGL A;  1OEB A;  2CP2 A;  3MKD A;  3M56 A;  2PUK B;  3Q1J A;  4BD3 A;  1Y7X A;  2R58 A;  3VS2 A;  2JVV A;  5HK0 A;  2X9H A;  1FWZ A;  1VOM A;  2RD1 A;  2OJ2 A;  2ZPB B;  3MJX A;  4IUV A;  5LJ5 h;  4FYW B;  3D7S B;  1KQS A;  1M27 C;  2RJF A;  1IZ6 A;  1VYV A;  4C0F A;  2RJD A;  2X4W A;  1UTI A;  4M78 A;  2DXT A;  3GF5 A;  3HPW A;  2C0T A;  1KJW A;  2GGR A;  2YLC A;  1JJ2 A;  4P5N A;  1TSF A;  4L6V 5;  3GBQ A;  3QZ5 B;  4FYY B;  3HFO A;  2LQ8 A;  2DL8 A;  1YP5 A;  3ZBD A;  3CCJ Q;  1OUL A;  1WI7 A;  2HNI A;  2EJ9 A;  4CC3 A;  4IUR A;  3RKX A;  3VS0 A;  3X28 B;  5FRM A;  2CZ0 B;  4Z02 A;  1UEC A;  3LH5 A;  2E5K A;  1D0Z A;  1VQ4 A;  4E7S A;  1U06 A;  2LC4 A;  4PFZ A;  3EG9 A;  2K5F A;  4C92 C;  4QKU A;  2AKL A;  3CCM T;  4EMH A;  2LQN A;  2SEM A;  3CCR T;  4C0Z A;  4LD9 K;  2DZ9 A;  4N0A A;  2DFU A;  2DL4 A;  4J9H A;  3AHU A;  2DEU A;  3CCL Q;  3CME A;  2CRE A;  3L2Q A;  2E5Q A;  2JTE A;  4A4K A;  1B34 B;  2JZ2 A;  4M77 D;  1QQJ A;  4XTY A;  2XID A;  1T3L A;  2BIV A;  4C8Q F;  1VQP A;  4EMK A;  3UF4 A;  2NUP A;  4A4H A;  2E6Z A;  3MP8 A;  1PKS A;  4JJN K;  5KYN A;  2A3L A;  1K8A C;  2PU9 B;  3QXE B;  2EWN A;  2DNU A;  1AWJ A;  2DMO A;  4M7D F;  1SKU B;  1YN8 A;  2YXY A;  2P0K A;  2FG0 A;  2OAW A;  4DEX A;  1N8R R;  1Y07 A;  2L89 A;  2YLB A;  1YJ9 Q;  1HXD A;  1MMD A;  2QQR A;  5D7U A;  2DL3 A;  5GAM f;  3KFV A;  1M1K U;  1YWO A;  1AT1 B;  2LCS A;  1S1N A;  1WIE A;  1IGU A;  1VQM T;  4M77 A;  1OOT A;  3CPW P;  4BE0 A;  5DLO A;  4K11 A;  4XU2 A;  2O01 E;  4A53 A;  3TU4 K;  4JZ4 A;  2P4R A;  4PJL A;  3OYG A;  1KQS S;  3CC7 Q;  3UDC A;  1XNI A;  3JCM P;  4DOW A;  2MK5 A;  2E65 A;  2QAS A;  3EG1 A;  5IHN A;  1QVG S;  4PJM A;  3INZ A;  5FU7 C;  4J83 A;  1WHM A;  3URG A;  3VS7 A;  2EJG A;  3GNG A;  1U1S A;  4C92 E;  1JJ2 S;  1Q7Y U;  1SSF A;  3HHT B;  1ZLM A;  1M90 C;  1VQ7 T;  5KCH A;  4M78 B;  5GMK h;  3FC3 A;  1YI2 A;  2HSE B;  3L42 A;  4N0A C;  4A4F A;  2L5Q A;  2ZAE A;  3CPW A;  4B6M A;  4IKF A;  2KSS A;  2KY9 A;  3FJ5 A;  4A4G A;  1QKX A;  2DIG A;  5GAO n;  3OYK A;  1AWW A;  2AT1 B;  2RMO A;  1GL5 A;  2EPD A;  1EZZ B;  4F7U E;  2JTF A;  2RHY A;  2QQ9 A;  2C0O A;  3EG2 A;  5GJW B;  3CCS T;  2KRN A;  1YJW T;  3A1P A;  3CCV A;  1IHW A;  2CH4 W;  2GF7 A;  1ABO A;  4RTX A;  4BI3 A;  3JCM J;  3V8K A;  2EQI A;  4HT8 A;  4J6X A;  2DTO A;  4CC7 A;  3EG9 B;  3NTK A;  1C1A A;  4PJO D;  2FPD A;  2DYB A;  1KC8 C;  3OS1 A;  5CQX A;  3QPH A;  1BI0 A;  2ZPF B;  1RAG B;  1UUE A;  1BI2 A;  4D6W A;  1JO8 A;  2C0I A;  2PNI A;  3V7C A;  4CI0 C;  3ZL7 C;  2E70 A;  1SRM A;  1JXM A;  3QYH B;  2KI7 A;  1VQ4 Q;  3M0S A;  3UA7 A;  2D8J A;  1X6O A;  5GAO l;  5EC7 A;  2JMC A;  2QG9 B;  1UGR B;  1Y57 A;  1NJI C;  4IIM A;  5LJ5 d;  4M77 C;  2WSF E;  2DXB A;  4OF1 A;  2VVK A;  5KH6 A;  4VUB A;  4EMK B;  3EGX B;  1MUZ A;  1VQN A;  2HQH A;  1QWE A;  1V76 A;  4FYX B;  4XTZ A;  2WSE E;  2NUP B;  3DB3 A;  1LJO A;  2LNH B;  2RI5 A;  5CVI A;  4RTU A;  1VQK T;  2V26 A;  3A8H B;  3CME Q;  1D3B B;  4JPB W;  1QW1 A;  2FZG B;  2KDS A;  3EHR A;  1U1T A;  4ZGE B;  2DXC A;  1KHI A;  2F1L A;  3CC2 T;  3CD6 T;  1M8V A;  1UGQ B;  1UEB A;  3FJP A;  3CXC P;  1VQP Q;  2MYS A;  5IXB A;  4C92 G;  1WPY A;  1F1B B;  1Y71 A;  1K0S A;  4JRQ A;  2DER A;  3TRE A;  2DAQ A;  2W10 A;  2L0A A;  4JLI A;  1Y96 A;  4GLM A;  3DLL A;  1M3C A;  2RHX A;  2GFU A;  4HVU A;  5CKH A;  3RMS A;  4F7U G;  2ZPG B;  5LL6 S;  5I11 A;  1QP3 A;  2QEX A;  1BU1 A;  4M7A E;  1PRL C;  2DBM A;  3G4S Q;  2VC8 A;  1YJN A;  1WXB A;  3I55 T;  3VUB A;  4AMC A;  1WJQ A;  9ATC B;  2E64 A;  1K73 C;  5GAO q;  5IT9 E;  3I56 T;  5HKC A;  1WHL A;  2DTH A;  3J7A F;  2RQT A;  1AVZ C;  3BDU A;  2J6F A;  2X3W D;  4EDU A;  2F5K A;  3FRN A;  1YWP A;  1ZBJ A;  3VRY A;  2K5I A;  1TUC A;  1HK9 A;  2OTJ T;  2ZPE B;  2YRC A;  3JB9 I;  3JCM b;  1FXX A;  1PNJ A;  2HCK A;  3M0P A;  2KEA A;  5GAN j;  3A8G B;  1YI2 Q;  1WHK A;  1MND A;  4HCB A;  1NE8 A;  3CPF A;  4AFZ C;  5GAN e;  2DX1 A;  1FMW A;  4LXC A;  2FEI A;  2FHD A;  2DIL A;  2XDB A;  1GCQ C;  3I9Q A;  4N4G A;  5GMK m;  4PJO C;  3JCM Q;  2CT4 A;  2DF6 A;  4RCB A;  3BW1 A;  1RAA B;  2RNA A;  4UC4 A;  1WX6 A;  3VUZ A;  1GFC A;  2DLP A;  2D6F A;  1VQL T;  3CCV Q;  2DM1 A;  2FPF A;  3HRU A;  3VU3 C;  2P0Q A;  1N9S A;  1ZBX A;  1JBM A;  3H8Z A;  5C6S A;  2CYZ B;  3S3O A;  2DIQ A;  4BE1 A;  2RF0 A;  1PSF A;  4LNP A;  3CMA T;  3OYJ A;  2VXF A;  2MCN A;  3OYB A;  4O6J A;  2NYS A;  1QKW A;  3JCM e;  1R0C B;  2HKQ B;  2FZK B;  4J9B A;  1OZ2 A;  2RA2 A;  2KRS A;  2EFI A;  3RNJ A;  1N8R C;  2P4T A;  2JXB A;  4C8Q E;  4M7A G;  1NPP A;  3WVE B;  4OMO A;  4M75 F;  1M2V B;  5D6W A;  1VQ5 T;  2GTO A;  4OB0 B;  5ECA A;  2M0Y A;  3NGP A;  4ME7 A;  1BK2 A;  3CC4 A;  2DKG A;  3EHQ A;  2GCX A;  1VQ6 T;  1SEM A;  1WLP B;  3JAM E;  2X3X D;  1VQN Q;  2X35 A;  2V8I A;  5LJ3 g;  2QQB A;  3OYD A;  1YIJ T;  2C06 A;  2EGC A;  3QDF A;  1QCN A;  4C5I A;  4C92 D;  4XU3 A;  2XG8 D;  3E1S A;  5KYY A;  1Q82 R;  4L5G A;  1NPR A;  2DTI A;  3HP9 A;  5A0D A;  3RMQ A;  2DPP B;  2HEQ A;  3BE3 A;  4J9G A;  4M7D E;  5KE2 A;  1K8A U;  2QK0 A;  1VQO T;  4HCK A;  2XDP A;  4CC2 A;  1YIT T;  2JJ9 A;  1Q81 R;  4PKC C;  1K9M C;  2QTX A;  1RI9 A;  4XTX A;  2VWF A;  2LCL A;  2COY A;  4XQ3 A;  2AZV A;  3BY7 A;  4M78 F;  2ABL A;  3H0H A;  4E7L A;  1AWX A;  3NPF A;  1X6G A;  4LDY A;  1TH7 A;  2CT3 A;  5LJ3 h;  2L3R A;  1UGS B;  2JW4 A;  3G6E A;  2XHC A;  3OY9 A;  4DBH A;  4DBR A;  2PVD B;  1MV0 B;  1LNX A;  2LP5 A;  2Y90 A;  3I35 A;  1IGQ A;  2NUT A;  3ER0 A;  3BDL A;  4MML A;  3MEA A;  1E7O A;  1YJ9 A;  3LX7 A;  3CBO A;  2QEX Q;  3EH1 A;  4HA8 A;  5CR2 A;  4BDY A;  1WNL A;  3M54 A;  3R6O A;  1N9R A;  2DVE A;  2A08 A;  1YJN Q;  1WJS A;  3F70 A;  4C92 A;  1UE9 A;  2X4J A;  4YTL A;  2DVJ A;  5GMK i;  2KT1 A;  3M0U A;  1ZHI A;  2KXD A;  4PLI A;  1IXD A;  1W1F A;  4PFP A;  3O5Z A;  2EYX A;  3VS5 A;  1UHF A;  2JT4 A;  5LJ3 f;  5L8R E;  2QDY B;  3OYM A;  1K9A A;  3CCM A;  4XK8 E;  1YFN A;  3M0Q A;  4J9D A;  1M90 U;  1NBE B;  1GFD A;  2RQR A;  5EG2 A;  5HK3 A;  3JB9 G;  4N4I A;  3CCR A;  5I2S A;  4F7U A;  1FMK A;  4QVC A;  1O75 A;  2CZ1 B;  2K2V A;  4FYV B;  3U23 A;  4E7H A;  1YCY A;  4E47 A;  4DQ2 A;  1WXT A;  1J3T A;  3QWX X;  2OTL A;  1PKT A;  1MNE A;  3VS4 A;  2AHJ B;  2H8H A;  1MV3 A;  1SRL A;  4JUV A;  1R0B G;  4HKE A;  1BI1 A;  2E6N A;  4R56 A;  3L2Z A;  1KC8 U;  3PNW C;  1TTH B;  3CCL T;  5M9O A;  2CUB A;  5KCO A;  3WXM B;  2RHI A;  4KH1 B;  5GJV B;  2EGE A;  4JJC A;  4XU1 A;  3A8O B;  4X9D A;  3QYG B;  2K6D A;  1W2B P;  1G2B A;  5GAO r;  3UT1 A;  4DEY A;  3QJ6 A;  4ZTJ A;  4LUE A;  1ZQ1 A;  4C5G A;  5LJ5 f;  2QGG A;  1PHT A;  1OI1 A;  5DLQ E;  1NJI U;  4M7A D;  4IUP A;  1KD1 C;  2QQA A;  2HBP A;  2CP3 A;  2XMF A;  4ELY C;  1VQM A;  4JZ3 A;  4PJO G;  5A2Q E;  4M77 F;  4RTW A;  2Z0W A;  1QVF P;  4C0G A;  5IXF A;  2RM4 A;  3CEY A;  4IUT A;  2QQS A;  2ZPH B;  3OB9 A;  3TEE A;  4KUD K;  4AG2 C;  1UB4 A;  4MMK A;  4D8D A;  1SHF A;  2E1H A;  1BI3 A;  1M1K R;  2XK0 A;  3V7R A;  3CC4 Q;  2KRO A;  2E4H A;  2LX9 A;  1YNZ A;  1ZSG A;  2QYZ A;  3ME9 A;  5IN1 A;  2K9G A;  3M4G A;  3PT9 A;  1IB8 A;  3OBW A;  2GTJ A;  5KYW A;  1TU0 B;  3CC7 T;  3SWN A;  2RI3 A;  3M55 A;  2BZX A;  3J80 E;  1ZUY A;  1D1C A;  5J39 A;  1AWO A;  1Q86 C;  2PUO B;  1R8O B;  3H9N A;  1XTD A;  1M3B A;  3LGF A;  1YJW A;  1Q7Y R;  4MZT A;  1SHG A;  1OYX A;  1M30 A;  3OYI A;  2FO0 A;  3RR6 A;  2CP7 A;  4EMG A;  1X75 C;  3T9N A;  1D0Y A;  2LMJ A;  1BYM A;  5IAY A;  2O4X A;  3G6E Q;  3I5S A;  1UFF A;  2L3S A;  5AT1 B;  2X4X A;  5GAM j;  1K73 U;  4GBQ A;  3PE0 A;  4L59 A;  4M75 B;  2M51 A;  4RTZ A;  1G3W A;  1OX9 A;  3KBG A;  2K7A A;  3G4S A;  8AT1 B;  3A8M B;  5GAM e;  3M4Y A;  4FL6 A;  1VQ9 A;  3TQ7 P;  1IHV A;  1RAB B;  2KE9 A;  4A54 A;  3JB9 D;  3UWN A;  2CZ6 B;  3HSB A;  3MEW A;  3SEM A;  2VUB A;  2XD0 A;  1HYO A;  3V7S A;  4LUD A;  1GCP A;  3RES A;  4BDZ A;  5KYU A;  3PVQ A;  3VKI A;  1UGP B;  2J06 A;  3CCM Q;  4PFO A;  4LDX A;  3PMT A;  2HQX A;  1PD1 A;  4AFS C;  3CCR Q;  2VGM A;  2V8K A;  4E6R A;  2DJQ A;  2KAF A;  4J6W A;  2MMP A;  2PZ1 A;  2YRD A;  1M1F A;  1X69 A;  1VQ4 T;  2QDL A;  4RUG A;  2CP5 A;  1WDX A;  2L3P A;  2DO3 A;  2G6F X;  2JOY A;  2VAS A;  5LJ3 d;  3CD6 A;  2OTL Q;  1QP2 A;  1HSQ A;  4M7D D;  4E7I A;  1VUB A;  2DBK A;  2HBW A;  3VJP A;  1C0M A;  2Y4X A;  5GAN 6;  2ZCF B;  3GP8 A;  2KYB A;  1M3A A;  2A36 A;  5CCA A;  3SWN C;  1WGS A;  1W4S A;  1OX8 A;  3CME T;  3OYA A;  1TWB A;  3IQL A;  3PFS A;  2VB6 A;  4M7A C;  2LVM A;  3G7Z A;  3QZ9 B;  3OBY A;  3RIR A;  3HRS A;  1H3Z A;  4HVW A;  5GAN 7;  2F2V A;  2FVU A;  3JB9 J;  4AFQ C;  2L2P A;  3E9G A;  2ESW A;  5FU7 B;  1N8R U;  1KFZ A;  3JCM X;  2DK3 A;  2A37 A;  4JJB A;  2KNB B;  2K2M A;  2LX7 A;  2D8H A;  5D6Y A;  4E2F B;  3NHN A;  1TXQ A;  3EG0 A;  2DXU A;  2RH2 A;  1N27 A;  3GNF B;  3FDR A;  1VQM Q;  3HKS A;  1Z9Z A;  2EYW A;  1T0H A;  2HSP A;  3I56 A;  2EGA A;  1LOJ A;  3M57 A;  4BE2 A;  1UG1 A;  2JN0 A;  4JDS A;  4DA4 A;  4OMQ A;  2A0F B;  4E7J A;  3H6Z A;  3QG1 A;  2RI2 A;  1K9M U;  2OTJ A;  1E6G A;  3NMZ C;  1V29 B;  1K4U S;  2K3B A;  1X2K A;  1G3S A;  1G5V A;  3OW2 P;  4ELZ C;  3L2U A;  1B07 A;  3X26 B;  2HQE A;  3REA B;  1IO6 A;  1GCQ A;  5FWC A;  2RB6 A;  1FMV A;  4PJO A;  1NG2 A;  2O4X B;  2F2W A;  5GAO p;  5CKF A;  3MHX A;  4TVR A;  4ZGD B;  1K76 A;  3MEU A;  1B3Q A;  4J5Y A;  4J9I A;  3RBB B;  3C95 A;  4IIO A;  4II1 A;  2D9T A;  3OYH A;  4XTU A;  1YJW Q;  1YHQ A;  1GBR A;  2KVQ G;  4OGE A;  1YI2 T;  4FIB A;  1JU5 C;  3QSU A;  1NYF A;  1NZ9 A;  2FL7 A;  4M77 B;  1CSK A;  4FW2 A;  1AHJ B;  1AEY A;  3CBM A;  3EFO A;  3CXC A;  4Y91 A;  2H3J A;  4C8Q C;  2F69 A;  4HVV A;  5I2M A;  2QA4 A;  2YSQ A;  4CC4 B;  2K3X A;  2XU8 A;  5IHK A;  1NLO C;  1RI0 A;  4N4H A;  3KXT A;  3EFR A;  1VQ9 Q;  1M1G A;  5IH2 A;  5GAN g;  2HMA A;  1I5L A;  1RAH B;  4ATO A;  1RAE B;  3CPW S;  2BTT A;  1UHC A;  1H3H A;  3G71 A;  3QUI A;  3MP1 A;  2YRV A;  2YUQ A;  2EAY A;  4BI4 A;  2WSC E;  2DYI A;  2E10 A;  2KQW A;  1TUG B;  3A8L B;  3MEV A;  5FU6 C;  4MZM A;  2KXC A;  2LZ6 B;  2FPE A;  1VQ6 A;  4M7D C;  5I21 A;  3E2U A;  3VYH B;  1BCM A;  1PG5 B;  4MZP A;  1UJ0 A;  1YIJ A;  3DB4 A;  3JCM W;  4J7I A;  2MI6 A;  1O9S A;  4F14 A;  2EKO A;  3RKW A;  4Z8A A;  4OMF B;  2JS0 A;  2YHT A;  1CKA A;  4RKU E;  5GAN 8;  3GIB A;  5GAN h;  3R6N A;  1ZSZ C;  3CD6 Q;  4QW2 A;  5FLX E;  1WQ7 A;  1OZ3 A;  3UPU A;  4R55 A;  4Q5W A;  3JCM g;  3NFC A;  1WJR A;  1VQ8 A;  1PSE A;  3VS3 A;  4EPC A;  2R57 A;  2X4Y A;  1TUD A;  4RMO A;  2KBT A;  4KGV B;  1KD1 U;  5CKD A;  1AZE A;  3GPL A;  1WXU A;  5CIU A;  5C0M A;  1K8A R;  2EW3 A;  3THK A;  2LJ1 A;  3CQT A;  2ATC B;  3DKM A;  1GXI E;  5GAN f;  1MHN A;  2LRQ A;  1OQK A;  2A28 A;  2IG0 A;  5L23 A;  4PLL A;  2RQV A;  1KG1 A;  1W6X A;  2MWO A;  4WF2 A;  1ABQ A;  2HD0 A;  3CCQ T;  2GBQ A;  3JCM h;  4C92 F;  2LJ0 A;  4FW1 A;  1D09 B;  4OB2 B;  4LD6 A;  2FYK A;  4PJJ A;  4Y28 E;  1QCO A;  4A63 B;  3SFM A;  4ANJ A;  1SG5 A;  3TVT A;  2J05 A;  2KT8 A;  3X20 B;  3I56 Q;  2R5A A;  4J7F A;  2O9S A;  2QEX T;  4C0D B;  4PJO B;  1S72 T;  4F7U F;  2MWP A;  3EG3 A;  3VS1 A;  1NEB A;  2K5L A;  3CCU T;  4F17 A;  4QVZ A;  1RAC B;  2RQW A;  4BY6 C;  2OTJ Q;  1AD5 A;  1Q86 U;  1NLP C;  1Y96 B;  2QI2 A;  2IIM A;  3PIP A;  2CZ7 B;  2YUN A;  3HFN A;  4BUG A;  1SSH A;  3CCE T;  4KUL A;  3CXC S;  1PWT A;  2KRM A;  4PL6 A;  4FCY A;  2EYY A;  4BI8 B;  2DEQ A;  1X43 A;  3EFO B;  3ZFJ A;  4E7K A;  4JRK A;  1PM3 A;  1BIB A;  2IPO B;  1R77 A;  3NTI A;  2O9V A;  1PC0 A;  2YDL A;  5DM7 R;  1YHQ Q;  1G3T A;  4X9C A;  2M1H A;  2O31 A;  1C6V X;  2RQU A;  3SDZ A;  4ORZ A;  1VYT A;  4F04 B;  1G3Y A;  4KUI A;  1AZG B;  3M53 A;  5GAO m;  2MPX C;  1KC8 R;  4J9E A;  3RUX A;  3OSV A;  1I8F A;  1B34 A;  2QA4 Q;  1FX7 A;  4LE9 A;  2LCC A;  2M0O A;  4LDW A;  3QO3 A;  3H0F A;  5HCK A;  1M2O A;  2EQM A;  1B7T A;  2AKK A;  2ZPI B;  3ZEH A;  3G71 Q;  1M8M A;  3CCJ T;  1U3O A;  2OAU A;  2BKD N;  3WVD B;  3JCM c;  3M59 A;  3X24 B;  5AYF A;  3DLM A;  4FSX A;  4OB3 B;  1VQ6 Q;  2EQU A;  4LDV A;  4AFU C;  2EQK A;  1OPL A;  3MET A;  3REB B;  4C8Q G;  1YIJ Q;  4V2S A;  2CP6 A;  3JV3 A;  2M16 A;  5J26 A;  2FRY A;  5IHI A;  4AT1 B;  2CP0 A;  2KK4 A;  1V1C A;  2WAC A;  3GOX A;  2CSQ A;  1BB9 A;  4RCC A;  2W0Z A;  1KQS P;  2ROT A;  4RG8 A;  3CC4 T;  4M7A F;  1QVG P;  4O5V A;  3VYG A;  4J9F A;  3OS0 A;  1VQ8 Q;  2OI3 A;  1PRM C;  1JJ2 P;  3JSC A;  4M7D G;  1I0C A;  1KSW A;  5CQY A;  4OMP A;  2VXE A;  3OMG A;  5GAN 4;  1OV3 A;  4XTW A;  5D6X A;  5LJ5 j;  3J81 E;  3OYC A;  4Y92 A;  5LJ5 e;  1KQ1 A;  3JRZ A;  2CGH A;  1QVG A;  1RLP C;  1TS9 A;  2YUP A;  2BZ8 A;  3L2V A;  1WFW A;  5CAI A;  2V8J A;  1N5Z A;  1Q95 G;  3HTR A;  3G6E T;  3OMC A;  4ZN1 A;  4NL3 A;  2LTO A;  5GAN d;  1RAF B;  3MPU B;  1IRX A;  5KYY B;  2AIR B;  3MP6 A;  1K73 R;  2GQV A;  1W2B A;  1ZA2 B;  5DY9 A;  4QVD A;  1YJ9 T;  3EH2 A;  3JB9 H;  2QXF A;  2VYT A;  2CH4 A;  2HL5 C;  3MO8 A;  2EJF A;  4Z88 A;  3L2W A;  3C4S A;  3H41 A;  4QQD A;  3OYE A;  4GY5 A;  1XJW B;  1VQ7 A;  1M5Q 1;  1WYX A;  4KH0 B;  5GAM g;  2COZ A;  2ED1 A;  1QVF A;  3EAE A;  4C5H A;  4PK4 A;  2VV5 A;  3ASK A;  2OX7 A;  4NOY A;  2QAZ A;  1YCS B;  2NWM A;  4J8O A;  2J6O A;  4M75 C;  3RER A;  2JM8 A;  1RLQ C;  3LLR A;  2NUT B;  3M58 A;  4M7A A;  3JB9 F;  3V8L A;  3CCS A;  3S6W A;  3JCM d;  1G8X A;  1BBZ A;  2RHZ A;  2OTL T;  2E12 A;  1PCX A;  2DRM A;  1FYN A;  4C92 B;  3C12 A;  2HKN A;  2J7I A;  2MF2 A;  4JRI A;  3EGX A;  2E3H A;  3OYL A;  5GAM h;  3P8B B;  2A7Y A;  5A0L A;  3SD4 A;  1D3B A;  4F7U B;  2O88 A;  1QMC A;  2GFA A;  6AT1 B;  3HL8 A;  2K3Y A;  5J3B A;  3JCM V;  4KBM B;  3EFS A;  4D8K A;  3H0I A;  1ARK A;  2V1Q A;  4QT7 A;  4M78 C;  5GMK l;  1JRI A;  1WA7 A;  5CKE A;  1KQ2 A;  4JRP A;  1GBQ A;  4C8Q D;  2KGT A;  4DOV A;  2XIC A;  4OVA A;  2XKO C;  3L1A A; 
#chains in the Genus database with same CATH homology
 1N8R C;  1YHQ A;  2P4T A;  4C8Q E;  4M7A G;  2KVQ G;  1NPP A;  4OGE A;  3WVE B;  4JS5 A;  4M75 F;  2HAX A;  1YI2 T;  1KQS A;  4FIB A;  4XAX B;  5D6W A;  4ZTF A;  1VQ5 T;  2RJF A;  3QSU A;  1IZ6 A;  1BIA A;  4X34 A;  3HRT A;  1NZ9 A;  3C94 A;  4OB0 B;  4C0F A;  2FL7 A;  2JTM A;  4M77 B;  1VQK A;  2RHU A;  2RJD A;  2X4W A;  2K4Y A;  4ME7 A;  3CC4 A;  4M78 A;  2DXT A;  3N5B B;  2DKG A;  2GCX A;  1VQ6 T;  3JAM E;  3GF5 A;  3CC2 A;  1AHJ B;  3HPW A;  2X35 A;  2YLC A;  2V8I A;  3CBM A;  4P5N A;  3CXC A;  1YBY A;  2H3J A;  2QQB A;  4PJO F;  4Y91 A;  5LJ3 g;  3OYD A;  1YIJ T;  4C8Q C;  2C06 A;  2F69 A;  4L6V 5;  5I2M A;  3QZ5 B;  3BFM A;  3KXT A;  2R5M A;  4C5I A;  4C92 D;  3HFO A;  2K3X A;  2LQ8 A;  2XG8 D;  2XU8 A;  3E1S A;  4XU3 A;  4L5G A;  1NPR A;  1RI0 A;  2DTI A;  3EFR A;  3HP9 A;  4N4H A;  3RMQ A;  5FRO A;  2DPP B;  2HNI A;  1M1G A;  2EJ9 A;  5GAN g;  1RL2 A;  3PMI A;  5KE2 A;  4M7D E;  1K8A U;  1I5L A;  4IUR A;  4A4E A;  1VQO T;  3RKX A;  4ATO A;  1Q82 C;  3X28 B;  3CPW S;  2XDP A;  1P92 A;  1YIT T;  2CZ0 B;  3LWH A;  3QDR B;  4Z02 A;  3G71 A;  5FRM A;  3QUI A;  3MP1 A;  2YRV A;  1K9M C;  4PKC C;  4BI4 A;  2EAY A;  5GMK j;  2WSC E;  2LDM A;  2E10 A;  2KQW A;  2QTX A;  3A8L B;  3LYI A;  3MEV A;  4XTX A;  5FU6 C;  4RG2 A;  2LCL A;  4MZM A;  1VQ4 A;  5GMK e;  1Q81 C;  4XQ3 A;  2LC4 A;  4M75 E;  1W2B S;  4C8Q A;  2RJE A;  3BY7 A;  2K5F A;  3CBP A;  4M78 F;  4CRI A;  1VQP T;  5I21 A;  4E7L A;  1VQ6 A;  4M7D C;  1WQW A;  3VYH B;  4C92 C;  3NTH A;  4MZP A;  4LDY A;  3FLG A;  1YIJ A;  3DB4 A;  3CCM T;  3JCM W;  1TH7 A;  4KT0 E;  5LJ3 h;  4J7I A;  4EMH A;  2L3R A;  1UGS B;  3G6E A;  2MI6 A;  4EMK C;  3E9F A;  1O9S A;  2XHC A;  3OY9 A;  1QVP A;  3CCR T;  2EKO A;  3RKW A;  2PVD B;  2Y90 A;  1LNX A;  4OMF B;  2YHT A;  4C0Z A;  4RKU E;  3I55 A;  4LD9 K;  2DZ9 A;  5GAN 8;  3ER0 A;  4N0A A;  3GIB A;  5GAN h;  3BDL A;  4MML A;  5HY6 A;  3MEA A;  1YJ9 A;  4QW2 A;  5FLX E;  1WQ7 A;  3CBO A;  3LX7 A;  1QVF S;  1OZ3 A;  3AHU A;  4HA8 A;  5CR2 A;  3CME A;  1JB0 E;  4BDY A;  3UPU A;  3RKY A;  1WNL A;  1VIF A;  2E5Q A;  3M54 A;  4R55 A;  4Q5W A;  3L2Q A;  3R6O A;  1N9R A;  3JCM g;  4A4K A;  4M7D A;  2DVE A;  3NFC A;  1WJS A;  1B34 B;  1WJR A;  2JZ2 A;  3F70 A;  4M77 D;  1PSE A;  4XTY A;  4C92 A;  1VQ8 A;  4XTV A;  2X4J A;  4EPC A;  1M9S A;  2XID A;  2R57 A;  4YTL A;  2X4Y A;  5GMK i;  1ZHI A;  4PLI A;  2BIV A;  3SWN B;  4C8Q F;  1VQP A;  4RMO A;  4EMK A;  3G4S T;  2DD5 A;  2RK1 A;  5LJ3 f;  3S3N A;  5L8R E;  2QDY B;  1VQ9 T;  3OYM A;  3CCM A;  4XK8 E;  1KD1 U;  1M90 U;  5CKD A;  4HCZ A;  3GPL A;  3QJY A;  4M7A B;  4M78 E;  4A4H A;  5CIU A;  5C0M A;  5EG2 A;  5HK3 A;  3JB9 G;  4N4I A;  2E6Z A;  3CCR A;  3ZBD A;  3DKM A;  5I2S A;  5GAN f;  1GXI E;  5GAN 2;  1MHN A;  3MP8 A;  4F7U A;  4QVC A;  2XDD A;  1O75 A;  4JJN K;  2LRQ A;  2A3L A;  2CZ1 B;  2IG0 A;  2K2V A;  2PU9 B;  4PLL A;  1K8A C;  3QXE B;  1KG1 A;  2EWN A;  4FT2 A;  4E7H A;  1YCY A;  4E47 A;  4DQ2 A;  2MWO A;  3LH0 A;  4WF2 A;  2HD0 A;  3CCQ T;  2LT4 A;  2OTL A;  4M7D F;  3JCM h;  3OYY A;  2ZZD A;  4C92 F;  2EQJ A;  2EIF A;  4OB2 B;  2P0K A;  4LD6 A;  1Y07 A;  2FYK A;  2L89 A;  2YLB A;  2AHJ B;  4Y28 E;  1HXD A;  2QQR A;  3SFM A;  5GAM f;  4JUV A;  3X20 B;  1M1K U;  1VQL A;  3GLX A;  4HKE A;  2R5A A;  1BI1 A;  4J7F A;  2E6N A;  4R56 A;  3L2Z A;  1KC8 U;  2QEX T;  1VQM T;  4C0D B;  4PJO B;  3PNW C;  4M77 A;  3CCL T;  2K57 A;  5M9O A;  2RK2 A;  3OW2 A;  1S72 T;  4F7U F;  2DJZ A;  5KCO A;  2MWP A;  4BE0 A;  5DLO A;  3WXM B;  2K5L A;  4XU2 A;  3L2R A;  2O01 E;  3CCU T;  2DD4 A;  4A53 A;  3TU4 K;  2RHI A;  4XU1 A;  4QVZ A;  3A8O B;  4BY6 C;  3OYG A;  1KQS S;  3CMA A;  4X9D A;  3UDC A;  1XNI A;  3CCQ A;  1Q86 U;  3QYG B;  3JCM P;  4DOW A;  2E65 A;  5GAO r;  1QVG S;  3INZ A;  1Y96 B;  5FU7 C;  4M75 G;  4J83 A;  3UT1 A;  2QI2 A;  3QJ6 A;  3PIP A;  4ZTJ A;  3CCV T;  2CZ7 B;  1ZQ1 A;  3HFN A;  4C5G A;  4BUG A;  4OB1 B;  5LJ5 f;  3URG A;  3CCE T;  4KUL A;  2EJG A;  3GNG A;  4FT4 A;  1U1S A;  4C92 E;  3CXC S;  1Q7Y U;  1OI1 A;  5DLQ E;  1JJ2 S;  1SSF A;  1NJI U;  3HHT B;  3PTA A;  5A0D A;  4IUP A;  1KD1 C;  1M90 C;  4M7A D;  4PL6 A;  2G3R A;  5KCH A;  1X01 A;  1VQ7 T;  2QQA A;  4M78 B;  4NL2 A;  5GMK h;  2HBP A;  3FC3 A;  1YI2 A;  3L42 A;  4BI8 B;  4N0A C;  4A4F A;  2L5Q A;  3CPW A;  4ELY C;  1VQM A;  1VQ5 A;  1G5V A;  2DEQ A;  4PJO G;  5A2Q E;  3ZFJ A;  1S72 A;  4M77 F;  4E7K A;  3QII A;  2CS7 A;  5CO7 A;  4IKF A;  4JRK A;  1BIB A;  2KSS A;  1DJ7 B;  2KY9 A;  4A4G A;  4C0G A;  2DIG A;  5GAO n;  3NTI A;  3OYK A;  3CCU A;  4IUQ A;  3QKJ A;  2RO0 A;  5DM7 R;  1KHC A;  4F7U E;  2RM4 A;  3CEY A;  4IUT A;  1G3T A;  2EYQ A;  2JUF A;  2QQS A;  2RHY A;  2JTF A;  2QQ9 A;  2ZPH B;  3OB9 A;  2M1H A;  4X9C A;  3TEE A;  4KUD K;  1UB4 A;  2LT1 A;  4MMK A;  3CCS T;  1MGQ A;  4JS4 A;  3SDZ A;  1YJW T;  2CKK A;  2E1H A;  3CCV A;  1BI3 A;  2XK0 A;  3V7R A;  2GF7 A;  1G3Y A;  4KUI A;  4BI3 A;  3CCE A;  3JCM J;  1VQO A;  3M53 A;  5GAO m;  3V8K A;  1N6A A;  3VV0 A;  1YIT A;  4HT8 A;  2LX9 A;  4J6X A;  3RUX A;  2DTO A;  1H64 1;  4C8Q B;  3ME9 A;  1M1K C;  4M78 G;  3NTK A;  3OSV A;  5IN1 A;  1I8F A;  5GAM d;  3M4G A;  1B34 A;  3PT9 A;  4PJO D;  1KC8 C;  1FX7 A;  2VGN A;  3OBW A;  2LCC A;  5CQX A;  3OS1 A;  1VQN T;  2M0O A;  3CC7 T;  4LDW A;  3QO3 A;  3SWN A;  2Y4Y A;  3QPH A;  2RI3 A;  3M55 A;  1BI0 A;  3J80 E;  2ZPF B;  2BUD A;  2EQM A;  1BI2 A;  2I2L A;  2ZPI B;  3ZEH A;  4D6W A;  3FEO A;  4M77 E;  5J39 A;  3CCJ T;  3V7C A;  4CI0 C;  2OAU A;  2E70 A;  1Q86 C;  2BKD N;  2PUO B;  3M5A A;  1R8O B;  5FU6 B;  5GAN 3;  1XTD A;  3WVD B;  3JCM c;  4BB7 A;  1XOV A;  3QYH B;  3M59 A;  3LGF A;  1YJW A;  3X24 B;  4MZT A;  5AYF A;  3FIF A;  1OYX A;  3DLM A;  1IRE B;  5FRN A;  4PNO A;  1X6O A;  3OYI A;  2L8D A;  3A5Z B;  4FSX A;  3OYN A;  4OB3 B;  4M7D B;  4EMG A;  5GAO l;  1X75 C;  3T9N A;  2EQU A;  4LDV A;  1UGR B;  2P0P A;  4J6Y A;  4C0D C;  1Q7Y C;  1NJI C;  5LJ5 d;  2EQK A;  3MET A;  4C8Q G;  4M77 C;  5IAY A;  2O4X A;  4V2S A;  2WSF E;  1BYM A;  2DXB A;  4OF1 A;  5KH6 A;  2M16 A;  5J26 A;  4VUB A;  4EMK B;  5CKB A;  1VQN A;  4FU6 A;  2D0Q B;  1YHQ T;  2X4X A;  4QQ6 A;  4XTZ A;  5GAM j;  2WSE E;  2KK4 A;  1K73 U;  3DB3 A;  4L59 A;  1LJO A;  4M75 B;  5GAN 5;  1G3W A;  3P8H A;  2M9U A;  2WAC A;  4FM4 B;  3KBG A;  2RI5 A;  3GOX A;  3G4S A;  5CVI A;  4RCC A;  3A8M B;  5GAM e;  1U8R A;  3M4Y A;  3CCJ A;  4FL6 A;  4RG8 A;  1VQ9 A;  3A8H B;  1VQK T;  1D3B B;  2ZGW A;  3CC4 T;  1QW1 A;  2NLU A;  2KDS A;  4M7A F;  1U1T A;  4O5V A;  2DXC A;  4A54 A;  4ZGE B;  3JB9 D;  1KHI A;  3CC2 T;  3UWN A;  5LJ5 h;  3VYG A;  2CZ6 B;  3CD6 T;  3MEW A;  3OS0 A;  2VUB A;  2XD0 A;  3HSB A;  1M8V A;  3V7S A;  1UGQ B;  4MDX A;  3M9Q A;  3PGG A;  3RES A;  1UEB A;  3FJP A;  4BDZ A;  3JSC A;  4M7D G;  2QA4 T;  4C92 G;  3VKI A;  1YJN T;  1WPY A;  5CQY A;  1UGP B;  1XQH A;  2VXE A;  4LDX A;  3PMT A;  1Y71 A;  3O8V A;  3OMG A;  5GAN 4;  4JRQ A;  2HQX A;  4XTW A;  2DAQ A;  3LW5 E;  3JCM f;  3TRE A;  4JLI A;  5D6X A;  5LJ5 j;  3J81 E;  3G71 T;  3OYC A;  3OW2 S;  1Y96 A;  2VGM A;  4XU0 A;  2MAM A;  2V8K A;  2KAF A;  3DLL A;  4J6W A;  2RHX A;  5LJ5 e;  2MMP A;  5KE3 A;  2GFU A;  1KQ1 A;  1M1F A;  3JRZ A;  1VQ4 T;  2CGH A;  4JLG A;  2B8A A;  5CKH A;  3RMS A;  3X25 B;  4F7U G;  1QVG A;  3FB9 A;  4ZN3 A;  2DO3 A;  2JOY A;  4HT9 A;  1I4K 1;  2F5T X;  2LQK A;  2ZPG B;  2RJC A;  3L2V A;  5LJ3 d;  3CD6 A;  5CAI A;  5LL6 S;  1QP3 A;  2V8J A;  2QEX A;  3OA6 A;  1QP2 A;  3CCL A;  3SB2 A;  2DZC A;  4M7D D;  4E7I A;  4M7A E;  1VUB A;  3G6E T;  3OMC A;  4ZN1 A;  3OYF A;  3VJP A;  2VC8 A;  4NL3 A;  2LTO A;  1YJN A;  5GAN d;  2Y4X A;  1VIE A;  5GAN 6;  2ZCF B;  3MP6 A;  4OGC A;  3I55 T;  2QA4 A;  3GP8 A;  3VUB A;  2GQV A;  5CCA A;  4HCC A;  3SWN C;  3V8J A;  1W2B A;  1WGS A;  5DY9 A;  4QVD A;  1YJ9 T;  1W4S A;  1WJQ A;  2XI9 A;  3JB9 H;  2E64 A;  2QXF A;  3E19 A;  2VYT A;  4M75 D;  2PVO B;  4B9W A;  3OYA A;  3CME T;  2LNV A;  5GAO q;  1K73 C;  3MO8 A;  2EJF A;  5IT9 E;  3I56 T;  3PFS A;  3L2W A;  4M7A C;  5A0G A;  2LVM A;  3OSS C;  2E41 A;  2FB7 A;  3G7Z A;  5HKC A;  1VQ8 T;  2DTH A;  3QZ9 B;  3OBY A;  3C4S A;  4M77 G;  3RIR A;  3J7A F;  4QQD A;  3PIO A;  3BDU A;  3HRS A;  4BY6 B;  1H3Z A;  3OYE A;  5GAN 7;  4GY5 A;  4OP0 A;  4EDU A;  2FVU A;  1BKB A;  3JB9 J;  1M5Q 1;  3TCJ A;  1VQ7 A;  3MCA B;  2F5K A;  3E9G A;  3FRN A;  5FU7 B;  5GAM g;  2K5I A;  1N8R U;  4IUU A;  3JCM X;  2DK3 A;  1QVF A;  5LJ3 j;  1HK9 A;  3EAE A;  4C5H A;  2OTJ T;  2VV5 A;  3ASK A;  2ZPE B;  4NOY A;  3QBY A;  4NS5 A;  3JB9 I;  3JCM b;  1EIF A;  4J8O A;  5D6Y A;  4PJO E;  1FXX A;  4ZGJ B;  5LJ3 e;  3QHS A;  2DXU A;  4M75 C;  2PQW A;  5GAN j;  4GLK A;  3RER A;  2RH2 A;  3A8G B;  3LLR A;  3M58 A;  4M7A A;  1N27 A;  3GNF B;  4HCB A;  1NE8 A;  3FDR A;  3JB9 F;  3V8L A;  3CPF A;  3HKS A;  3CCS A;  3OQ5 A;  4QQG A;  3S6W A;  5GAN e;  3JCM d;  2FHD A;  3I56 A;  2XDB A;  2RHZ A;  2OTL T;  1JJ2 A;  3P8D A;  4N4G A;  3S3M A;  2E12 A;  5GMK m;  5CK9 A;  1LOJ A;  3M57 A;  4C92 B;  3OS2 A;  2PVG B;  3JCM Q;  4PJO C;  4BE2 A;  2JN0 A;  4M78 D;  3C12 A;  2MF2 A;  1M4Z A;  4JRI A;  4JDS A;  4LDU A;  5LJ5 g;  4RCB A;  4DA4 A;  1Q82 U;  3BW1 A;  4UC4 A;  3OYL A;  4E7J A;  2IVW A;  3H6Z A;  3QG1 A;  2RI2 A;  3VUZ A;  1K9M U;  3KUF A;  2D6F A;  4M75 A;  2OTJ A;  1VQL T;  3CC7 A;  3OS5 A;  5GAM h;  3P8B B;  2A7Y A;  2KMT A;  1V29 B;  3HRU A;  5A0L A;  3SD4 A;  3VU3 C;  1Q81 U;  1I81 A;  2P0Q A;  1D3B A;  1N9S A;  4F7U B;  4B9X A;  2GFA A;  1G3S A;  1ZBX A;  1JBM A;  4C5E A;  4ELZ C;  3H8Z A;  3HL8 A;  3X26 B;  2CYZ B;  2HQE A;  2JNG A;  4MDW A;  5C6S A;  3L2U A;  3S3O A;  2DIQ A;  2K3Y A;  4BE1 A;  5J3B A;  3JCM V;  4BAC A;  3LWI A;  2RB6 A;  1PSF A;  4KBM B;  3EFS A;  4PJO A;  3LGL A;  3CMA T;  2O4X B;  3M56 A;  2PUK B;  3Q1J A;  4M78 C;  5GAO p;  4BD3 A;  3OYJ A;  5CKF A;  3MHX A;  4TVR A;  1JRI A;  4ZGD B;  5GMK l;  3MEU A;  1KQ2 A;  5CKE A;  2VXF A;  4J5Y A;  3OYB A;  1Y7X A;  2R58 A;  4JRP A;  2JVV A;  3C95 A;  4O6J A;  4C8Q D;  5HK0 A;  3JCM e;  1FWZ A;  4II1 A;  2RD1 A;  4DOV A;  2D9T A;  3OYH A;  2ZPB B;  1OZ2 A;  4XTU A;  4IUV A;  2XIC A;  2RA2 A;  2XKO C;  4OVA A;  2EFI A;  3L1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...