4OMFB

The f420-reducing [nife]-hydrogenase complex from methanothermobacter marburgensis, the first x-ray structure of a group 3 family member
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
280
structure length
280
Chain Sequence
VLGTYKEIVSARSTDREIQKLAQDGGIVTGLLAYALDEGIIEGAVVAGPGEEFWKPQPMVAMSSDELKAAAGTKYTFSPNVMMLKKAVRQYGIEKLGTVAIPCQTMGIRKMQTYPFGVRFLADKIKLLVGIYCMENFPYTSLQTFICEKLGVSMELVEKMDIGKGKFWVYTQDDVLTLPLKETHGYEQAGCKICKDYVAELADVSTGSVGSPDGWSTVITRTDAGDSIFKQAVEAGLFETKPIEEVKPGLGLLEKLAAQKKEKAEKNIAARKEMGLPTPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords F420-reducing hydrogenase, subunit gamma
publication title The F420-Reducing [NiFe]-Hydrogenase Complex from Methanothermobacter marburgensis, the First X-ray Structure of a Group 3 Family Member.
pubmed doi rcsb
total genus 96
structure length 280
sequence length 280
ec nomenclature ec 1.12.98.1: Coenzyme F420 hydrogenase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04422 FrhB_FdhB_N Coenzyme F420 hydrogenase/dehydrogenase, beta subunit N-term
B PF04432 FrhB_FdhB_C Coenzyme F420 hydrogenase/dehydrogenase, beta subunit C terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1030 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4omfB02
4CI0C 4OMFB
chains in the Genus database with same CATH superfamily
2DJQA 4M7AB 2EGCA 2RJEA 5IHIA 4F7UE 2L0AA 4JPBW 2RI5A 5IHNA 1JU5C 2IG0A 4C8QE 4FIBA 2DF6A 1DJ7B 2L89A 4QVDA 3EGDA 3HP9A 3DLMA 5GMKi 2YRVA 5IH2A 3GLXA 5GANd 1WGSA 4KT0E 5GJVB 3CCJQ 3CCEA 2LNHB 3P8HA 4ZGEB 3CMET 1M1FA 2KEAA 1U1SA 1YJWQ 5I21A 1AWWA 2HDAA 1ZUYA 5FU7C 4C0GA 2LQKA 2MWOA 4HA8A 3AT1B 2CYZB 1YITA 2ZPGB 4FW2A 5KYUA 3OS1A 2LP5A 1RACB 3G1JA 3NGPA 3X26B 1YI2A 3GPLA 4EIKA 1N6AA 4PLLA 5GJWB 3M0UA 2YSQA 4AMCA 3CCLA 3EGUA 3O5ZA 2KR3A 5A0DA 4BI4A 1QP3A 3H8ZA 4R56A 5DM7R 5FRNA 4EPCA 3M0SA 4LDUA 3FB9A 3JB9G 2DXTA 3CCRA 1K73C 1MMGA 3ZEHA 3FC3A 5L8RE 3LLRA 4CC3A 3G6ET 3GOXA 3OW2P 4BY6B 3PNWC 2LDMA 2X35A 3EH1A 5ECAA 2PZ1A 4E2FB 1SSHA 2D6FA 1OZ2A 3QYGB 2W10A 3H9NA 1QVPA 3OYFA 2C06A 3DLLA 2LQNA 3JB9F 2VXFA 2JUFA 1C0MA 1NLPC 2QA4T 3OYHA 1ACMB 1WX6A 5GANh 2HBWA 4LE9A 1ZSZA 1XJWB 1WJRA 1W4SA 2K4YA 2V8JA 1W70A 4FL6A 3R6OA 3SD4A 3EG0A 5J3BA 4E7IA 4M7DE 1KQSP 3CMAT 2DMOA 2HAXA 3KXTA 1NZ9A 2CZ6B 3V7RA 3V8JA 4JJDA 5CKHA 2EVRA 2E12A 1M90C 5GAOl 1N8RC 2HQHA 1H3ZA 1ZBJA 1YIJT 3KBGA 3OYGA 1PC0A 5CQYA 1UGRB 2AZSA 3N5BB 4M7AF 2JXBA 1VQKT 5GAOn 1UJ0A 2EJGA 4OMFB 4XTVA 2LX9A 3QZ9B 4DEXA 2DVEA 1VIFA 4R55A 1YJ9Q 3S3MA 4GY5A 3SDZA 2RPNA 2A28A 3EHRA 1U06A 5GMKh 3CCUT 4RG2A 3S3OA 3UDCA 3CXCA 1NM7A 2P0KA 4QW2A 2H8HA 1VYUA 2YRCA 4PJMA 4ATOA 2PNIA 5DLQE 5AYFA 5J26A 2H3EB 2ECZA 2OTLT 2X3WD 2VVKA 3JCMW 2NUTA 5GAOp 3MP6A 3EFOB 3JAME 1CKBA 1TG0A 1I0CA 2DBKA 8AT1B 1WDXA 1VQ7A 1JO8A 1PKTA 1JJ2S 3CCJA 2QI2A 4JRPA 1Q86C 1GRIA 1AHJB 2HEQA 2X4JA 3CQTA 2QYZA 1YJWA 2V8IA 3M57A 2RQRA 1N27A 5EC7A 4FSSA 2V8KA 1QWFA 1X2KA 2AIRB 2M1HA 4VUBA 4GLMA 1PG5B 4RCCA 3SWNC 4JUVA 2WACA 3JB9D 1X27A 4C0DB 4C92D 1YBYA 2HL3A 1Q82R 3PFSA 2VASA 3CCET 1RLQC 1CSKA 3VYHB 5A0GA 1BBZA 1N5ZA 4PJOC 4BI8B 1YITT 4F14A 2D9TA 4E7KA 3JCMJ 2HKQB 2QAZA 3G6EQ 4LDYA 2RHZA 1ABOA 2NUPA 1MNDA 2J7IA 4MZTA 2OTJQ 4M75E 2QQBA 4C0ZA 2DX1A 4N0AA 1YI2T 1TTHB 5HKCA 4CC7A 4N4GA 1Y71A 1LCKA 1UE9A 3CCLT 5D6YA 2FHDA 4Z02A 1M30A 5KYUB 3JCMX 4F16A 1T0JA 3C0CA 1M8MA 1YN8A 1RAAB 2LJ3A 1D3BA 4FCYA 1X6OA 3LWIA 4J7FA 3QIIA 1QVGS 3CCRT 2EIFA 2HSPA 3CD6Q 5KYNA 4M78E 1MGQA 1LPLA 2YLBA 2CT3A 4QKUA 2DZCA 1PD1A 1UGSB 2ZAEA 2E65A 5I22A 1VYVA 2A37A 1GBQA 1AD5A 2PU9B 2QK0A 4AFUC 4XAXB 2RNAA 3MEAA 5LJ5e 1M2VA 3BW1A 1IO6A 5HCKA 3LH0A 2GQIA 2RHXA 3CBPA 1IHWA 1OPKA 2FL7A 5J39A 3L1AA 2ZPEB 1YJ9A 4RMOA 2QTVA 2JS0A 2RH2A 4P5NA 3RR6A 3VU3C 4KUIA 1ZSZB 3L2UA 3CEYA 2DKGA 3J7AF 2F2VA 4JDSA 3FRNA 4M77C 1B07A 2E64A 1M2OA 4KGVB 2CP3A 2HBPA 3QPHA 1K8AU 4OB3B 1ZX6A 2XDPA 3C4SA 1OU8A 2ESWA 4J83A 3X28B 1G5VA 3VJPA 4E7HA 4ZNXA 1WHHA 2FG0A 1QVFA 2JVVA 2PTKA 4KRTA 4RTUA 4PJJA 4CC4B 4L5GA 3L2QA 2FPEA 1GFCA 3CCSQ 1GXIE 1RI0A 1X01A 1YNZA 3QJYA 3INZA 2LQWA 1X75C 2XI9A 3ZBDA 4JRQA 2JOYA 1YCSB 3M9QA 2LCLA 1IXDA 4AG1C 2KXDA 2F2WA 3OYLA 1V76A 2DD4A 1OQKA 3QWYA 3ER0A 5FU6B 4EMKA 2KGTA 1M1KU 3DKMA 1HJDA 5IAYA 3HSBA 3M55A 3CC4Q 1VQ7T 2VYTA 3E2UA 3CCJT 2NUTB 2F1LA 2QQSA 2ED1A 2A0FB 1K9MU 2DBMA 2HMAA 4N4HA 5HK0A 4X9CA 1YJWT 1H8KA 1KD1R 4IIOA 2LTOA 2DL3A 3EHQA 5GAMg 4X1VA 1VUBA 4C0FA 2HQEA 3I35A 4PKCC 1X6BA 2RI2A 3M0RA 2OTJA 5GAOq 5CK9A 4J9FA 2EYQA 1T0HA 5GANe 4C92C 2OJ2A 2KMTA 4AFQC 3C94A 2LCCA 1BCMA 4A4KA 4GLKA 4JZ3A 2GTJA 3UA6A 3V7CA 2FZKB 1KFZA 3QBYA 4MMKA 5HY6A 2K5IA 3CD6A 5GAOr 1X6GA 3RMQA 1BB9A 1M3AA 3EGXA 4A63B 4K11A 4II1A 1NPPA 2QQ9A 3NHNA 1W2BA 4ZGJB 3HFNA 1K0SA 3EAEA 2V1RA 2K5LA 3I5RA 1TUCA 2NUPB 4HCZA 2KAFA 1FMKA 1KJWA 1TH7A 2RHYA 5GAMj 3X24B 1YP5A 3X25B 1NEBA 2PVOB 1SHFA 3OQ5A 4JZ4A 5GMKe 4RTYA 3RIRA 2JTEA 1K73U 3L2WA 1TOVA 1D3BB 2JMCA 2YHTA 3UF4A 3UA7A 4LDVA 3SB2A 1SG5A 1KK7A 3RBBB 2J6FA 4MZMA 2GNCA 2XICA 1VQPQ 2LQ8A 1AWJA 3OS2A 1I07A 2EQJA 3EFOA 1VA7A 2DYBA 1G8XA 4DBFA 1KIKA 2SRCA 1HXDA 4C8QC 2J6KA 4M77G 2GFAA 4ANJA 3LYIA 1YJ9T 2MOXA 3CBOA 1D1AA 4M7AE 1M2VB 3VKIA 1R8OB 2MK5A 2QDLA 1ZUKA 4O6JA 1CKAA 1HYOA 1AZGB 3EG3A 3HRUA 2A3LA 1RUWA 4FYVB 2DXCA 4QVZA 2HL5C 8ATCB 3CCSA 1BCOA 1VQ8Q 1M90U 2EW3A 3H0HA 1FMWA 3OW2S 1B34A 4M77F 2A08A 3JCMb 3NFCA 3QG1A 4HT8A 3CCMQ 1GBRA 1QKXA 2K6DA 4LUDA 1KHCA 2FB7A 1UG1A 3HFOA 1VQ7Q 4A4HA 4XTZA 5GMKm 2CZ1B 1WI7A 3KUFA 3CC4A 2FZGB 1U5SA 2K7AA 5D7UA 5GAMf 2C0OA 2V1QA 4PJOD 1JXMA 4OB1B 2O9VA 2ROLA 4J8OA 5CR2A 3HPWA 4XK8E 1KQSS 4M78D 5KYWB 2L2PA 3A8HB 4OB0B 2ZCFB 4GBQA 2CH4A 2JTMA 2IIMA 5GAMd 5DY9A 3A5ZB 3G7ZA 1YCYA 2DXBA 2LT1A 2DIGA 2P0QA 3LH5A 3L2VA 5C6SA 1BYMA 2E70A 4EMKB 3OYIA 1Q86U 4Z88A 2PUKB 4J9EA 1U8RA 4RG8A 6AT1B 4LNPA 2LX7A 4RTZA 3H41A 1OX9A 4C92G 3PMTA 2K3YA 3SWNA 2D8HA 2L3SA 3L2RA 1UHFA 2DXUA 3RUXA 3A8MB 3EFSA 1MHNA 4F17A 1VQOA 5IHKA 2OX7A 4M7DC 3M54A 3CXCP 2OTJT 1WHKA 3QWXX 2YWWA 3G4SQ 3BDUA 1MNEA 2QTXA 2EJ9A 4IUPA 3NTHA 3M0QA 3H6ZA 1M9SA 2WSEE 4RTXA 3PTAA 2FZCB 1M27C 4PJOA 2DZ9A 2DL7A 3A8OB 4C92F 1KD1C 1WXBA 3QDRB 1PSFA 2YUQA 2X3XD 2O88A 1I1JA 2MAMA 4BD3A 4E47A 3CD6T 1Y96A 4B9WA 1KQ2A 3ZFJA 5FU7B 1IB8A 4AFSC 3ASKA 3EG9B 1OULA 3REAB 4MDWA 4OMLA 3MKDA 3GP8A 3OSVA 3EGXB 4M77D 1VQPA 2DETA 1PHTA 2ZZDA 1G3WA 3P8DA 3QJ6A 1RAHB 1MMAA 1SPKA 1RADB 3MP1A 1O9SA 3FLGA 3FIFA 1R77A 1T3SA 4DBHA 2RB6A 2VGMA 2BIVA 4XU2A 5C0MA 1UFFA 4PNOA 4C5HA 5KE2A 2DILA 3UPUA 2BZXA 4FW1A 1MMNA 4C8QG 4FYXB 1D09B 2VB6A 3MCAB 1AVZC 3CPWA 3O8VA 1VQ8A 3HL8A 4JS4A 4XU3A 2ZPBB 2OAWA 1G3TA 1ZLMA 2COYA 5GAN5 4JJCA 2RHIA 3CCMA 1KC8U 1ZQ1A 4C8QF 3EG1A 3QHSA 2FRWA 1NJIC 1VQ4Q 5FRMA 2DIQA 4M77A 2X51A 1TSFA 3CCST 2A7YA 3META 2VV5A 1Q81C 3A8LB 5GAN7 4BB7A 1JQQA 2W0ZA 3TCJA 2RMOA 1SEMA 4M75C 2YUPA 1UHCA 5DLOA 1I81A 4QQ6A 1B34B 2RK1A 4BI3A 3WXMB 1I4K1 3JV3A 4NL2A 4PL6A 5KYYB 3CC4T 2CSQA 3OYKA 1FWZA 3E19A 4FYYB 4HCKA 5KCHA 2VUBA 4HVUA 1VQ5A 4M78C 4HT9A 3SHWA 1UGQB 1MV0B 2GFUA 4OMNA 5GAN3 1QCNA 4DEYA 3G4SA 4D8KA 2QGFB 1K0XA 2O9SA 3OYDA 4IUTA 4BE0A 2GBQA 3TSZA 2Y90A 4M7DG 1UEBA 5GAN6 5FW9A 1AWOA 1SKUB 1BIAA 1Y0MA 1YWOA 2KDSA 4XU0A 1QVFP 4B9XA 2X4XA 1VQOT 4LDWA 4A4GA 1RAGB 4LD9K 1YFNA 4C92A 5LJ3g 2DM1A 2Z0WA 5CQXA 4M7DF 1D0XA 4D8DA 3VS7A 4C5EA 2DL4A 1RI9A 3SWNB 3MPUB 1D0YA 3QO3A 1NEGA 2YT6A 2EPDA 3JCMQ 3NMZC 3HKSA 2D1XA 2AKKA 3M53A 3OYJA 4C8QD 3OB9A 5FROA 3V7SA 3PVLA 3THKA 2A36A 2DPPB 4PJOB 3WVEB 3JCMg 1G3SA 5GAN2 3C95A 3VRZA 4DOVA 4BE2A 2RN8A 5CCAA 4M78B 2GF7A 2EYZA 1Y96B 4LN2A 3PMIA 1EZZB 3S6WA 2P4TA 1T3LA 1NLOC 2MYSA 3BDLA 1VQPT 2DE0X 1G2BA 1UDLA 2EQIA 1E7OA 2EGAA 5KH6A 4N4IA 1W6XA 2RHUA 3VS2A 2OI3A 5GAN8 3PT9A 2RO0A 1C1AA 1FMVA 3CC2Q 2RA2A 2F5KA 4XTWA 4QVCA 3NTIA 1QLYA 1OZ3A 3MEWA 5LJ3j 2LRQA 3JRZA 1YJNQ 2P84A 4EMHA 2DERA 2K2MA 1PKSA 3VS5A 1E6GA 4DBRA 5GAN4 1VQ4A 5KYWA 4NOYA 3OS0A 1JJ2A 2KROA 3QDFA 2JM9A 3UWNA 1VQ8T 3TEEA 4L59A 1BKBA 3Q1JA 1UJYA 3DB4A 4C8QA 1EIFA 1BI3A 2GGRA 1LJOA 2EKOA 1W2BP 1U1TA 2E3IA 3CCMT 4A4FA 4OB2B 5CKBA 3R6NA 4EDUA 4ZGDB 1WLPB 3CC7Q 2M0YA 4J5YA 2RM4A 2CZ7B 1VQLQ 2KY9A 5A2QE 4JLIA 3CCVQ 3AHUA 1TU0B 4OMPA 3JCMP 2CUDA 2DFUA 5A0LA 2BE9B 1JEGA 3VRYA 4ZTJA 5CAIA 4FU6A 2K3BA 1AEYA 4HKEA 4PK4A 4DA4A 4M77B 4D6WA 4HVWA 4KGXB 1OOTA 5FWBA 2DNUA 5IN1A 4M7DD 2XG8D 2YLCA 3F70A 4PJOG 1M5Q1 3MP8A 2JNGA 2WSCE 2DVJA 2VXEA 2BZ8A 2IVWA 4C5IA 4M78G 5D6XA 4AG2C 2AKLA 4E6RA 3VV0A 3EG9A 1MV3A 1VQ5T 2YUNA 1QVGA 2E10A 3VS1A 4O5VA 1EX4A 4UC4A 4PJOF 1VQOQ 4WF2A 5LJ3f 3PE0A 2K5FA 1LNXA 3RKXA 1VQMQ 2D8JA 4L6V5 1YHQQ 4M78F 2X9HA 3H0IA 1Q82C 3G4ST 1OU9A 1Q7YR 1S1NA 3I55Q 2XU8A 2Y4XA 2XDBA 2BKDN 2EYWA 1H92A 1M4ZA 2FEIA 3OS5A 4OP0A 1UECA 1JRIA 3RDVA 4KBMB 1J3TA 3LGLA 5LJ3d 2YRDA 2C0IA 3L2ZA 3I56Q 3TSWA 3JCMf 4IIMA 4M7DA 4M7AC 3RKYA 4F04B 4J7IA 4ESRA 3U23A 1I5LA 2JS2A 4RTVA 2VC8A 4E7ZA 4Z8AA 3IQLA 2D0NA 3TREA 1E6HA 3JCMd 3MEUA 3JSCA 4C92B 1GCQC 3VS6A 3VS0A 1QWEA 3H0FA 4V2SA 3JCMc 1HK9A 2KNBB 4ORZA 4ZN3A 1NYFA 1VQ9Q 2FVUA 4OVAA 1VQ6Q 5KE3A 5LL6S 3CC2A 3JCMV 3EH2A 3M59A 4RTTA 2F2XA 2M16A 2HNIA 4RUGA 1WJSA 2EGEA 1YJNA 2F69A 2LJ1A 4J6WA 1ARKA 2KI7A 3GBQA 1KSWA 4E7JA 2HD0A 2XHCA 2RJDA 3FDRA 2NYSA 3OBWA 1N8RU 2KBTA 1NYGA 2FYKA 4NL3A 3C12A 2CUBA 5KYYA 4QQGA 4WCIA 3CXCS 4M75D 2JTFA 1WQWA 4J9HA 1BI1A 5LJ3h 2R57A 2E3HA 2QXFA 1XTDA 1BI0A 3CC7A 4BY6C 2P0PA 4R0KA 1VQ4T 1VQLA 3GNGA 4DBQA 2F5TX 2I2LA 1ZSGA 3CCVA 1WZOA 2YUOA 1A0NB 2VKNA 2QEXQ 1RABB 2M9UA 3J80E 2CP6A 2E6NA 1PNJA 4DQ2A 2XK0A 2KYBA 2FPFA 2RJCA 4J9BA 2HSEB 3JCMh 2CP5A 4MMLA 2DTIA 1JXOA 2V26A 2R58A 4LUEA 1IREB 4PJNA 2MI6A 2RQUA 3WVDB 2ABLA 4F7UB 4C8QB 1WIEA 3RESA 2O01E 1OI1A 1NJIU 4OGCA 3PVQA 2EQMA 3RKWA 1QMCA 1VQ5Q 1PD0A 3JB9J 1Q81U 2L5QA 1UTIA 2LMJA 2PVGB 4M75A 4OF1A 2ENMA 3HRTA 4XTUA 2B86A 1D1BA 1QCFA 2KRNA 1VQMA 2ZPFB 1YHQA 1KG1A 1JB0E 3CPWP 4AT1B 1BIBA 1B3QA 4A53A 3I55A 2DRKA 2DTHA 3G71Q 2KT1A 2K3XA 1WPYA 5D6WA 1X69A 2Y4YA 1KC8R 3PGGA 2G3RA 2BZYA 3CPFA 4LD6A 1Q95G 4OMOA 2DJZA 4M78A 4BDZA 4B6MA 3I56A 3QYHB 1LOJA 4KH0B 2ZPIB 1WA7A 1B7TA 1TUDA 4J9CA 2DO3A 2BUDA 2CZ0B 4E7SA 3MHXA 2COZA 4Y28E 2YDLA 2KK4A 4QT7A 4M7AG 1QP2A 3HTRA 5GAMh 1VQNQ 2DAQA 1OPLA 2DL5A 2EYXA 2EFIA 1Z9ZA 2KSSA 4E7LA 2KE9A 1R0BG 1SF9A 1I5OB 2QQRA 3GNFB 4XU1A 4OMMA 2LVMA 1P92A 1VQ9A 1VQ6A 5I2SA 2M51A 3M58A 2CS7A 1XQHA 3RNJA 2M0OA 3NPFA 4Y92A 4JJNK 3CCQQ 1Q7YC 1RLPC 2WSFE 1OYXA 4F7UG 4KH1B 1SSFA 3M4YA 1BK2A 4M7DB 2C0TA 1C6VX 4C0DC 4MZPA 1AZEA 3URGA 1WJQA 3HRSA 1N9SA 1UGVA 1S72Q 1RAIB 1OX8A 3OW2A 2RQTA 3E9GA 4LDXA 4XTXA 3CC2T 1Y57A 2KYMA 1HSQA 4J9GA 1QW1A 4F7UF 2HCKA 1G83A 1WHLA 1XNIA 3J81E 1YJNT 1IZ6A 3RERA 2RJFA 2MF2A 1TXQA 2COWA 2K79A 2JM8A 2MMPA 3OMGA 2QEXA 1GFDA 1QVFS 1KHIA 2PQWA 1SRLA 2QASA 2LNVA 5KYXA 1PSEA 2MWPA 1KQSA 2EQUA 3CMEQ 1ZA1B 3VS3A 3A1PA 2X4YA 1TS9A 2EQKA 5CKFA 4BUGA 2ATCB 3MJXA 2LT4A 3CC7T 2MIOA 2EAYA 1VQLT 2JJ9A 3VUZA 4PFZA 1N9RA 1NE8A 3CCVT 1GCPA 3OSSC 1Z9QA 1WHMA 1Y07A 4Y91A 2CP0A 1K76A 2RQWA 1PCXA 1ZHIA 2E6ZA 4TVRA 4FT2A 1FXXA 1PWTA 2EJFA 3TVTA 3EGDB 3M56A 3S3NA 2AT1B 1O75A 2JT4A 2L3QA 2XMFA 4KULA 4BACA 1X43A 4MDXA 2XD0A 2M02A 1K8AR 2RI3A 3M4GA 5IT9E 2FO0A 3REBB 3ULRB 4ELZC 4XQ3A 4HCCA 1ZSZC 3G71A 1HD3A 1PRLC 3SEMA 1VOMA 2NWMA 5LJ5g 2EBPA 1H641 2ZGWA 3MEVA 2JW4A 2GTOA 4JRIA 2J06A 4M7AD 3SFMA 3LW5E 1VQMT 1K9AA 3A8GB 4OGEA 3V8LA 2QA4Q 1H3HA 5KCOA 1UUEA 1JJ2P 3QUIA 3LWHA 1YHQT 5GMKl 4PJOE 2B8AA 7AT1B 4J6XA 3MO8A 5L23A 4IURA 2QG9B 4M75B 4PJLA 2HZYA 2JN0A 4OMQA 3I55T 4J9IA 3GF5A 2NLUA 4KUDK 2QGGA 3CMAQ 4IUVA 1ZA2B 4ZTFA 2CP2A 1M1KR 1VQNA 5FWCA 1D1CA 4LXCA 2KRSA 2DL8A 1W2BS 1XOVA 2CH4W 5CO7A 1U3OA 3OYCA 1ZBXA 3M0PA 1VIEA 3I56T 2KXCA 4RKUE 2VGNA 2GQVA 1WHGA 4FT4A 2O4XA 4C5GA 1K9MR 1YIJQ 1UGPB 5FU6C 1AWXA 1VQKQ 1IHVA 1IRXA 2EKHA 3VUBA 3ZL7C 3CCQA 3D7SB 1Q82U 5CKEA 1OV3A 1V29B 3LGFA 2DA9A 2J6OA 4XTYA 1JBMA 1ABQA 1FYNA 1QQJA 5AT1B 2O2OA 1WYXA 3OYEA 1KC8C 3EG2A 5LJ5j 1QKWA 5LJ3e 3JB9H 3QXEB 4JRKA 1NG2A 3CCUQ 4KGZB 2AHJB 1R0CB 1S72A 1QCOA 3P8BB 1PM3A 2R5MA 2E4HA 2BE7D 4WTOB 1W1FA 4M7AA 2PVDB 1VQ9T 1VQ6T 4IKFA 4CI0C 5I11A 3UT1A 3V8KA 1F1BB 4FM4B 1VYTA 2SEMA 3OMCA 2CT4A 4IUUA 2KVQG 4FSXA 1SHGA 2OTLQ 2CDTA 4RTWA 4FYWB 4CRIA 3GIBA 1QVGP 3T9NA 4Z89A 1GCQA 3JCMe 2IPOB 5I2MA 2D0QB 1IGQA 4F7UA 2HKNA 5CIUA 1YWPA 5IXFA 1K1ZA 2OAUA 5EG2A 2LCSA 2RD1A 1M3CA 2CSIA 3CMEA 4BDYA 4M77E 3HHTB 2R5AA 1M1GA 1WXUA 2E5QA 1RAEB 3OYAA 2JMAA 3NTKA 1WXTA 1K73R 4M75G 5GANg 1BU1A 2NUZA 1MUZA 2DK3A 3L42A 2KT8A 2JZ2A 2DEQA 2QEXT 1KQ1A 3OYBA 4PLIA 4N0AC 2LJ0A 3OA6A 3CCEQ 2CKKA 1WFWA 3LX7A 2KQWA 3CBMA 9ATCB 2ED0A 3I5SA 1Y7XA 2MPXC 3EFRA 3PIPA 4HVVA 5GAOm 2EWNA 2AZVA 2DEUA 3BY7A 4CC2A 1PRMC 3OY9A 1YITQ 4M75F 2QDYB 2FRYA 4J9DA 3FJPA 5KYXB 2DLPA 3QKJA 2E5KA 5LJ5f 3QSUA 3G6EA 4ME7A 4QQDA 4X34A 2LC4A 5CVIA 2L8DA 1MMDA 1YI2Q 3OYYA 2YXYA 2I0NA 4IUQA 2XDDA 2QQAA 3CCLQ 2H3JA 4A54A 1LVKA 3KFVA 4PFPA 1SRMA 1M3BA 4PFOA 2CREA 2FPDA 1GL5A 1IGUA 1BI2A 5GAMe 5LJ5d 1M90R 4BE1A 1N8RR 2QA4A 3CCRQ 3A98A 2DD5A 2L3PA 1WHJA 5GANj 2K57A 3I9QA 2DRMA 2K9GA 3VYGA 4HCBA 1X2QA 1EFNA 2MCNA 1UB4A 3G71T 3RMSA 3CMAA 4JS5A 2LZ6B 2K2VA 4JLGA 3E9FA 1AT1B 2BTTA 4C92E 2PUOB 1NPRA 1NBEB 2KRMA 3DB3A 2HQXA 1RAFB 4J6YA 4YTLA 3TU4K 2G6FX 1YIJA 4Q5WA 2CP7A 1VQKA 1K8AC 3OBYA 4RCBA 1G3YA 1AOJA 2XIDA 3E1SA 4M4ZA 3OYNA 1VQNT 1V1CA 3M5AA 3TQ7P 1KD1U 4NS5A 2E41A 1K4US 1WQ7A 1RL2A 3CCUA 1I8FA 5GMKj 4ZN1A 1WNLA 1NJIR 4X9DA 3JB9I 5FLXE 1Q86R 3BFMA 5IXBA 2P4RA 2X4WA 2DTOA 2L3RA 2O31A 4A4EA 2AK5A 3CCQT 1Q81R 3FEOA 1ZUUA 1TUGB 2OTLA 2DYIA 4HXJA 3FJ5A 4ELYC 4JJBA 3OYMA 3BE3A 2GCXA 2O4XB 1OEBA 2VWFA 4AFZC 5LJ5h 2RK2A 3PIOA 1M1KC 2J05A 2ROTA 5M9OA 1TWBA 4EMKC 3UATA 3X20B 2EYYA 1S72T 4EMGA 2RF0A 3ME9A 1D0ZA 3QZ5B 5CKDA 2RQVA 3VS4A 2E1HA 1K9MC 5HK3A 3CPWS 2ZPHB 1FX7A 4DOWA 2CGHA 1M8VA 5GANf 3M0TA 1Q7YU 2XKOC
chains in the Genus database with same CATH topology
4LDWA 1Q7YC 4A4GA 4PKCC 4M7AB 2WSFE 2RJEA 2RI2A 4LD9K 4F7UE 1OYXA 4F7UG 4C92A 2RI5A 1SSFA 2IG0A 4C8QE 2OTJA 5LJ3g 3M4YA 4M7DB 5GAOq 4FIBA 5CQXA 5CK9A 4M7DF 1DJ7B 2L89A 4C5EA 4C0DC 4QVDA 3HP9A 2EYQA 3DLMA 4MZPA 5GANe 3SWNB 3URGA 4C92C 1WJQA 5GMKi 2YRVA 3QO3A 2KMTA 3HRSA 1N9SA 3GLXA 5GANd 1WGSA 4KT0E 3C94A 2LCCA 3CCEA 3OW2A 4A4KA 3JCMQ 4GLKA 3P8HA 4ZGEB 3CMET 3HKSA 1M1FA 3V7CA 1U1SA 3E9GA 4LDXA 4XTXA 3M53A 3CC2T 3OYJA 3QBYA 3OB9A 5FROA 3V7SA 4C8QD 4MMKA 5I21A 5FU7C 2DPPB 4C0GA 5HY6A 2LQKA 1QW1A 4F7UF 2K5IA 2MWOA 4HA8A 3CD6A 2CYZB 1YITA 4PJOB 5GAOr 3WVEB 3RMQA 1XNIA 2ZPGB 3J81E 1YJNT 1IZ6A 3JCMg 3OS1A 1G3SA 5GAN2 3C95A 3RERA 4DOVA 4BE2A 4II1A 1NPPA 2RJFA 3X26B 5CCAA 2MF2A 4M78B 2GF7A 2QQ9A 1Y96B 1W2BA 4ZGJB 3HFNA 3PMIA 3S6WA 2P4TA 3EAEA 1YI2A 1VQPT 2K5LA 3BDLA 3GPLA 1N6AA 4PLLA 2MMPA 3OMGA 5KH6A 4N4IA 2QEXA 2RHUA 4HCZA 3CCLA 1KHIA 2KAFA 1TH7A 2PQWA 1QVFS 5GAN8 3PT9A 2LNVA 5A0DA 1PSEA 4BI4A 2MWPA 2RHYA 2RO0A 3X24B 3X25B 5GAMj 1KQSA 2EQUA 1QP3A 3H8ZA 4R56A 5DM7R 2PVOB 3OQ5A 5FRNA 4EPCA 2RA2A 2F5KA 4XTWA 5GMKe 4QVCA 4LDUA 2X4YA 3RIRA 3NTIA 3FB9A 3JB9G 1K73U 5CKFA 2EQKA 2DXTA 4BUGA 3CCRA 1K73C 1OZ3A 3MEWA 3ZEHA 2LT4A 3CC7T 3FC3A 5L8RE 2LRQA 5LJ3j 3L2WA 3JRZA 2EAYA 3LLRA 1D3BB 3G6ET 2YHTA 3GOXA 1VQLT 3VUZA 4LDVA 3SB2A 4EMHA 1N9RA 1NE8A 4BY6B 3PNWC 3CCVT 5GAN4 1VQ4A 2LDMA 2X35A 4NOYA 3OSSC 3OS0A 1JJ2A 4MZMA 2XICA 1Y07A 2D6FA 4Y91A 2LQ8A 1OZ2A 3OS2A 2EQJA 1ZHIA 3UWNA 3QYGB 3OYFA 1VQ8T 1QVPA 3TEEA 4L59A 1BKBA 3Q1JA 2C06A 3DLLA 3DB4A 3JB9F 4C8QA 2E6ZA 2VXFA 4TVRA 1EIFA 1BI3A 2JUFA 4FT2A 1LJOA 2EKOA 2QA4T 3OYHA 1HXDA 1FXXA 2EJFA 1U1TA 5GANh 3S3NA 3M56A 1O75A 4C8QC 3CCMT 4A4FA 4OB2B 5CKBA 4M77G 2GFAA 4KULA 3LYIA 4EDUA 4ZGDB 1WJRA 4BACA 1W4SA 2K4YA 3CBOA 2V8JA 1YJ9T 4M7AE 2XD0A 4J5YA 4FL6A 2RI3A 3M4GA 3R6OA 3SD4A 2RM4A 2CZ7B 3VKIA 5IT9E 2KY9A 4ELZC 5J3BA 4E7IA 5A2QE 1R8OB 4M7DE 4JLIA 3CMAT 4XQ3A 4HCCA 4O6JA 4PJOE 3G71A 3AHUA 3JCMP 3KXTA 1NZ9A 2CZ6B 2A3LA 3HRUA 2HAXA 5LJ5g 3V7RA 5A0LA 3V8JA 2DXCA 4QVZA 3CCSA 5CKHA 4ZTJA 1H641 2ZGWA 1M90U 5CAIA 4FU6A 3MEVA 2E12A 1M90C 5GAOl 4JRIA 4M7AD 4HKEA 4DA4A 1N8RC 4M77B 3SFMA 1H3ZA 4D6WA 3OW2S 3LW5E 1B34A 3KBGA 4M77F 3OYGA 1YIJT 5CQYA 1UGRB 5IN1A 1VQMT 4OGEA 3A8GB 3N5BB 3V8LA 3NFCA 3JCMb 5GAOn 1VQKT 5KCOA 4M7DD 3QG1A 2EJGA 2XG8D 3QUIA 4OMFB 2YLCA 3LWHA 3F70A 1YHQT 4HT8A 4XTVA 5GMKl 4PJOG 2B8AA 2LX9A 3QZ9B 1M5Q1 3MO8A 3MP8A 4J6XA 2JNGA 2WSCE 4IURA 2DVEA 1VIFA 4M75B 4R55A 2JN0A 2VXEA 1KHCA 3I55T 2FB7A 3S3MA 3HFOA 2IVWA 3GF5A 4A4HA 2NLUA 4GY5A 4C5IA 3SDZA 4M78G 4KUDK 4XTZA 5GMKm 4IUVA 2CZ1B 5D6XA 5GMKh 4ZTFA 1VQNA 3KUFA 3CC4A 3CCUT 4RG2A 3S3OA 3UDCA 1W2BS 3VV0A 5GAMf 1XOVA 3CXCA 5CO7A 3OYCA 1ZBXA 3I56T 1VIEA 2P0KA 4PJOD 4RKUE 1VQ5T 1QVGA 2E10A 4QW2A 2VGNA 2GQVA 4FT4A 4OB1B 2O4XA 4O5VA 4UC4A 4ATOA 4C5GA 4PJOF 4J8OA 5DLQE 5CR2A 4WF2A 3HPWA 5AYFA 4XK8E 2K5FA 1UGPB 1LNXA 5J26A 5LJ3f 3RKXA 1KQSS 4M78D 5FU6C 4L6V5 2OTLT 3A8HB 3VUBA 4OB0B 3CCQA 2ZCFB 1Q82U 5CKEA 4M78F 3JCMW 1V29B 1Q82C 5GAOp 2JTMA 3LGFA 3MP6A 3G4ST 4XTYA 3JAME 5GAMd 5DY9A 1JBMA 3A5ZB 2XU8A 2Y4XA 3G7ZA 2XDBA 1YCYA 3OYEA 2BKDN 1KC8C 2DXBA 5LJ5j 2LT1A 5LJ3e 3JB9H 1M4ZA 2DIGA 3QXEB 4JRKA 2P0QA 3OS5A 4OP0A 1VQ7A 3L2VA 1JRIA 5C6SA 1BYMA 4KBMB 2E70A 3LGLA 2AHJB 5LJ3d 4EMKB 3OYIA 3CCJA 1S72A 1Q86U 3P8BB 2R5MA 1JJ2S 2QI2A 4M7AA 3L2ZA 4JRPA 2PVDB 1VQ9T 2PUKB 1Q86C 1VQ6T 1U8RA 4IKFA 1AHJB 4CI0C 4RG8A 3JCMf 2X4JA 3UT1A 3V8KA 4M7DA 1YJWA 2V8IA 3M57A 4C92G 1N27A 4FM4B 2V8KA 3OMCA 3PMTA 4M7AC 3RKYA 4IUUA 2KVQG 2K3YA 3SWNA 3L2RA 4FSXA 2DXUA 3RUXA 3A8MB 2M1HA 1MHNA 3EFSA 4J7IA 4VUBA 1VQOA 4M7DC 3M54A 2OTJT 4CRIA 1I5LA 3GIBA 3T9NA 3BDUA 2QTXA 2VC8A 2EJ9A 4IUPA 4RCCA 3SWNC 3JCMe 4JUVA 2WACA 3JB9D 3NTHA 5I2MA 3H6ZA 2D0QB 3TREA 4C0DB 4C92D 1YBYA 4F7UA 3JCMd 3PFSA 1M9SA 2WSEE 3MEUA 3CCET 3PTAA 3JSCA 4C92B 4PJOA 2DZ9A 3A8OB 4C92F 1KD1C 4V2SA 3JCMc 1HK9A 3VYHB 4ZN3A 5CIUA 5A0GA 3QDRB 2OAUA 1PSFA 2FVUA 4OVAA 5EG2A 2RD1A 5KE3A 3CMEA 5LL6S 4BDYA 2MAMA 4M77E 3HHTB 2R5AA 4BD3A 4BI8B 4E47A 3CD6T 1M1GA 1Y96A 3CC2A 3JCMV 1YITT 4B9WA 3M59A 1KQ2A 2D9TA 2E5QA 4E7KA 3JCMJ 2M16A 2HNIA 4LDYA 3ZFJA 3OYAA 5FU7B 3NTKA 2RHZA 1WJSA 1YJNA 4MZTA 4M75E 3ASKA 2QQBA 4M75G 4C0ZA 5GANg 4N0AA 2F69A 4J6WA 2DK3A 3L42A 4MDWA 1YI2T 5HKCA 4E7JA 2HD0A 2XHCA 2RJDA 2JZ2A 3FDRA 4N4GA 1Y71A 2DEQA 3GP8A 3OBWA 1KQ1A 3OYBA 2QEXT 3OSVA 3CCLT 4M77D 5D6YA 2FHDA 4PLIA 4N0AC 1VQPA 4Z02A 1N8RU 3JCMX 3OA6A 2FYKA 2ZZDA 4NL3A 1G3WA 2CKKA 3P8DA 3C12A 3QJ6A 3LX7A 2KQWA 3CBMA 4QQGA 1D3BA 1Y7XA 1X6OA 3CXCS 3LWIA 3EFRA 3MP1A 4M75D 1O9SA 3PIPA 4J7FA 3FLGA 2JTFA 3FIFA 5GAOm 1WQWA 2EWNA 3QIIA 1BI1A 1QVGS 3CCRT 3BY7A 2EIFA 5LJ3h 2R57A 3OY9A 4M75F 2RB6A 2QDYB 2VGMA 2BIVA 4XU2A 2QXFA 5C0MA 3FJPA 3QKJA 4M78E 1MGQA 1XTDA 4PNOA 1BI0A 3CC7A 2YLBA 4BY6C 2P0PA 4C5HA 5LJ5f 2DZCA 3QSUA 3G6EA 1VQ4T 4ME7A 4QQDA 1UGSB 3GNGA 4X34A 2E65A 2LC4A 5CVIA 5KE2A 2L8DA 3UPUA 1VQLA 2F5TX 3OYYA 2I2LA 4C8QG 3CCVA 2PU9B 4IUQA 2XDDA 2QQAA 2H3JA 3MCAB 2M9UA 4A54A 3J80E 4XAXB 2E6NA 3CPWA 3O8VA 4DQ2A 2XK0A 1VQ8A 3HL8A 3MEAA 5LJ5e 3BW1A 4JS4A 1BI2A 2RJCA 4XU3A 3JCMh 5GAMe 2ZPBB 5LJ5d 4MMLA 2DTIA 3LH0A 4BE1A 2RHXA 1G3TA 2QA4A 2R58A 2DD5A 1IREB 3CBPA 5GAN5 2MI6A 2RHIA 3WVDB 2FL7A 5GANj 4F7UB 5J39A 2K57A 3CCMA 1KC8U 4M7AF 3L1AA 4C8QB 1ZQ1A 4MDXA 3VYGA 2ZPEB 4C8QF 1YJ9A 4HCBA 3RESA 1UB4A 2O01E 1OI1A 1NJIU 4OGCA 3QHSA 1NJIC 3G71T 4RMOA 5FRMA 2EQMA 2DIQA 3RMSA 4M77A 3CMAA 2RH2A 4P5NA 2K2VA 3VU3C 4JS5A 4KUIA 4JLGA 3RKWA 3E9FA 3L2UA 3CEYA 3CCST 2A7YA 2DKGA 3JB9J 3J7AF 1Q81U 2L5QA 3META 2VV5A 4JDSA 4C92E 1Q81C 3A8LB 3FRNA 2PUOB 2PVGB 4M77C 5GAN7 2E64A 1NPRA 4BB7A 4M75A 4OF1A 3DB3A 3HRTA 4XTUA 2HQXA 4J6YA 4YTLA 3TU4K 2HBPA 1YIJA 3QPHA 4Q5WA 3TCJA 1K8AU 4OB3B 1VQMA 4M75C 2XDPA 3C4SA 1VQKA 1K8AC 3OBYA 2ZPFB 4J83A 4RCBA 3X28B 1YHQA 3VJPA 1G5VA 5DLOA 1JB0E 4E7HA 1G3YA 1KG1A 1I81A 1BIBA 4QQ6A 2XIDA 1B34B 2RK1A 4BI3A 3WXMB 1I4K1 4A53A 3E1SA 4NL2A 4PL6A 3OYNA 3M5AA 3I55A 3CC4T 1VQNT 1QVFA 1KD1U 2JVVA 2DTHA 4NS5A 3OYKA 4PJOC 2E41A 4L5GA 3L2QA 2K3XA 1WPYA 1WQ7A 5D6WA 1RL2A 2Y4YA 1FWZA 3PGGA 2G3RA 1I8FA 3CPFA 3E19A 3CCUA 4LD6A 5GMKj 1GXIE 4ZN1A 1RI0A 1WNLA 1X01A 2DJZA 3QJYA 4M78A 4X9DA 4BDZA 3INZA 3JB9I 5KCHA 2VUBA 1X75C 3I56A 2XI9A 5FLXE 1VQ5A 3ZBDA 3BFMA 4JRQA 3QYHB 2JOYA 1LOJA 2X4WA 2ZPIB 3M9QA 4M78C 2DTOA 2L3RA 2LCLA 4HT9A 4A4EA 3CCQT 3FEOA 3OYLA 1UGQB 2DD4A 2GFUA 5GAN3 2OTLA 3ER0A 5FU6B 2DO3A 2BUDA 2CZ0B 4ELYC 3MHXA 4EMKA 3OYMA 4Y28E 2GCXA 2O4XB 1M1KU 5LJ5h 2RK2A 3DKMA 3PIOA 3G4SA 1M1KC 2KK4A 5IAYA 3M55A 3HSBA 5M9OA 4M7AG 3OYDA 1QP2A 5GAMh 4IUTA 2DAQA 4BE0A 1VQ7T 4EMKC 2VYTA 3X20B 2Y90A 3CCJT 1S72T 4M7DG 1UEBA 2EFIA 5GAN6 4EMGA 3ME9A 2KSSA 2QQSA 3QZ5B 5CKDA 4E7LA 1K9MU 4N4HA 2E1HA 1BIAA 5HK0A 1K9MC 2QQRA 4X9CA 5HK3A 1YJWT 3GNFB 4XU1A 3CPWS 2LVMA 1P92A 2KDSA 1VQ9A 1VQ6A 2ZPHB 1FX7A 1Q7YU 4DOWA 5I2SA 2LTOA 2CGHA 5GAMg 1M8VA 3M58A 5GANf 4XU0A 1VUBA 4B9XA 2CS7A 1XQHA 2M0OA 2X4XA 2HQEA 4C0FA 1VQOT 4JJNK 2XKOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CI0 C;  4OMF B; 
#chains in the Genus database with same CATH topology
 2DJQ A;  4M7A B;  2EGC A;  2RJE A;  5IHI A;  4F7U E;  2L0A A;  4JPB W;  2RI5 A;  5IHN A;  1JU5 C;  2IG0 A;  4C8Q E;  4FIB A;  2DF6 A;  1DJ7 B;  2L89 A;  4QVD A;  3EGD A;  3HP9 A;  3DLM A;  5GMK i;  2YRV A;  5IH2 A;  3GLX A;  5GAN d;  1WGS A;  4KT0 E;  5GJV B;  3CCJ Q;  3CCE A;  2LNH B;  3P8H A;  4ZGE B;  3CME T;  1M1F A;  2KEA A;  1U1S A;  1YJW Q;  5I21 A;  1AWW A;  2HDA A;  1ZUY A;  5FU7 C;  4C0G A;  2LQK A;  2MWO A;  4HA8 A;  3AT1 B;  2CYZ B;  1YIT A;  2ZPG B;  4FW2 A;  5KYU A;  3OS1 A;  2LP5 A;  1RAC B;  3G1J A;  3NGP A;  3X26 B;  1YI2 A;  3GPL A;  4EIK A;  1N6A A;  4PLL A;  5GJW B;  3M0U A;  2YSQ A;  4AMC A;  3CCL A;  3EGU A;  3O5Z A;  2KR3 A;  5A0D A;  4BI4 A;  1QP3 A;  3H8Z A;  4R56 A;  5DM7 R;  5FRN A;  4EPC A;  3M0S A;  4LDU A;  3FB9 A;  3JB9 G;  2DXT A;  3CCR A;  1K73 C;  1MMG A;  3ZEH A;  3FC3 A;  5L8R E;  3LLR A;  4CC3 A;  3G6E T;  3GOX A;  3OW2 P;  4BY6 B;  3PNW C;  2LDM A;  2X35 A;  3EH1 A;  5ECA A;  2PZ1 A;  4E2F B;  1SSH A;  2D6F A;  1OZ2 A;  3QYG B;  2W10 A;  3H9N A;  1QVP A;  3OYF A;  2C06 A;  3DLL A;  2LQN A;  3JB9 F;  2VXF A;  2JUF A;  1C0M A;  1NLP C;  2QA4 T;  3OYH A;  1ACM B;  1WX6 A;  5GAN h;  2HBW A;  4LE9 A;  1ZSZ A;  1XJW B;  1WJR A;  1W4S A;  2K4Y A;  2V8J A;  1W70 A;  4FL6 A;  3R6O A;  3SD4 A;  3EG0 A;  5J3B A;  4E7I A;  4M7D E;  1KQS P;  3CMA T;  2DMO A;  2HAX A;  3KXT A;  1NZ9 A;  2CZ6 B;  3V7R A;  3V8J A;  4JJD A;  5CKH A;  2EVR A;  2E12 A;  1M90 C;  5GAO l;  1N8R C;  2HQH A;  1H3Z A;  1ZBJ A;  1YIJ T;  3KBG A;  3OYG A;  1PC0 A;  5CQY A;  1UGR B;  2AZS A;  3N5B B;  4M7A F;  2JXB A;  1VQK T;  5GAO n;  1UJ0 A;  2EJG A;  4OMF B;  4XTV A;  2LX9 A;  3QZ9 B;  4DEX A;  2DVE A;  1VIF A;  4R55 A;  1YJ9 Q;  3S3M A;  4GY5 A;  3SDZ A;  2RPN A;  2A28 A;  3EHR A;  1U06 A;  5GMK h;  3CCU T;  4RG2 A;  3S3O A;  3UDC A;  3CXC A;  1NM7 A;  2P0K A;  4QW2 A;  2H8H A;  1VYU A;  2YRC A;  4PJM A;  4ATO A;  2PNI A;  5DLQ E;  5AYF A;  5J26 A;  2H3E B;  2ECZ A;  2OTL T;  2X3W D;  2VVK A;  3JCM W;  2NUT A;  5GAO p;  3MP6 A;  3EFO B;  3JAM E;  1CKB A;  1TG0 A;  1I0C A;  2DBK A;  8AT1 B;  1WDX A;  1VQ7 A;  1JO8 A;  1PKT A;  1JJ2 S;  3CCJ A;  2QI2 A;  4JRP A;  1Q86 C;  1GRI A;  1AHJ B;  2HEQ A;  2X4J A;  3CQT A;  2QYZ A;  1YJW A;  2V8I A;  3M57 A;  2RQR A;  1N27 A;  5EC7 A;  4FSS A;  2V8K A;  1QWF A;  1X2K A;  2AIR B;  2M1H A;  4VUB A;  4GLM A;  1PG5 B;  4RCC A;  3SWN C;  4JUV A;  2WAC A;  3JB9 D;  1X27 A;  4C0D B;  4C92 D;  1YBY A;  2HL3 A;  1Q82 R;  3PFS A;  2VAS A;  3CCE T;  1RLQ C;  1CSK A;  3VYH B;  5A0G A;  1BBZ A;  1N5Z A;  4PJO C;  4BI8 B;  1YIT T;  4F14 A;  2D9T A;  4E7K A;  3JCM J;  2HKQ B;  2QAZ A;  3G6E Q;  4LDY A;  2RHZ A;  1ABO A;  2NUP A;  1MND A;  2J7I A;  4MZT A;  2OTJ Q;  4M75 E;  2QQB A;  4C0Z A;  2DX1 A;  4N0A A;  1YI2 T;  1TTH B;  5HKC A;  4CC7 A;  4N4G A;  1Y71 A;  1LCK A;  1UE9 A;  3CCL T;  5D6Y A;  2FHD A;  4Z02 A;  1M30 A;  5KYU B;  3JCM X;  4F16 A;  1T0J A;  3C0C A;  1M8M A;  1YN8 A;  1RAA B;  2LJ3 A;  1D3B A;  4FCY A;  1X6O A;  3LWI A;  4J7F A;  3QII A;  1QVG S;  3CCR T;  2EIF A;  2HSP A;  3CD6 Q;  5KYN A;  4M78 E;  1MGQ A;  1LPL A;  2YLB A;  2CT3 A;  4QKU A;  2DZC A;  1PD1 A;  1UGS B;  2ZAE A;  2E65 A;  5I22 A;  1VYV A;  2A37 A;  1GBQ A;  1AD5 A;  2PU9 B;  2QK0 A;  4AFU C;  4XAX B;  2RNA A;  3MEA A;  5LJ5 e;  1M2V A;  3BW1 A;  1IO6 A;  5HCK A;  3LH0 A;  2GQI A;  2RHX A;  3CBP A;  1IHW A;  1OPK A;  2FL7 A;  5J39 A;  3L1A A;  2ZPE B;  1YJ9 A;  4RMO A;  2QTV A;  2JS0 A;  2RH2 A;  4P5N A;  3RR6 A;  3VU3 C;  4KUI A;  1ZSZ B;  3L2U A;  3CEY A;  2DKG A;  3J7A F;  2F2V A;  4JDS A;  3FRN A;  4M77 C;  1B07 A;  2E64 A;  1M2O A;  4KGV B;  2CP3 A;  2HBP A;  3QPH A;  1K8A U;  4OB3 B;  1ZX6 A;  2XDP A;  3C4S A;  1OU8 A;  2ESW A;  4J83 A;  3X28 B;  1G5V A;  3VJP A;  4E7H A;  4ZNX A;  1WHH A;  2FG0 A;  1QVF A;  2JVV A;  2PTK A;  4KRT A;  4RTU A;  4PJJ A;  4CC4 B;  4L5G A;  3L2Q A;  2FPE A;  1GFC A;  3CCS Q;  1GXI E;  1RI0 A;  1X01 A;  1YNZ A;  3QJY A;  3INZ A;  2LQW A;  1X75 C;  2XI9 A;  3ZBD A;  4JRQ A;  2JOY A;  1YCS B;  3M9Q A;  2LCL A;  1IXD A;  4AG1 C;  2KXD A;  2F2W A;  3OYL A;  1V76 A;  2DD4 A;  1OQK A;  3QWY A;  3ER0 A;  5FU6 B;  4EMK A;  2KGT A;  1M1K U;  3DKM A;  1HJD A;  5IAY A;  3HSB A;  3M55 A;  3CC4 Q;  1VQ7 T;  2VYT A;  3E2U A;  3CCJ T;  2NUT B;  2F1L A;  2QQS A;  2ED1 A;  2A0F B;  1K9M U;  2DBM A;  2HMA A;  4N4H A;  5HK0 A;  4X9C A;  1YJW T;  1H8K A;  1KD1 R;  4IIO A;  2LTO A;  2DL3 A;  3EHQ A;  5GAM g;  4X1V A;  1VUB A;  4C0F A;  2HQE A;  3I35 A;  4PKC C;  1X6B A;  2RI2 A;  3M0R A;  2OTJ A;  5GAO q;  5CK9 A;  4J9F A;  2EYQ A;  1T0H A;  5GAN e;  4C92 C;  2OJ2 A;  2KMT A;  4AFQ C;  3C94 A;  2LCC A;  1BCM A;  4A4K A;  4GLK A;  4JZ3 A;  2GTJ A;  3UA6 A;  3V7C A;  2FZK B;  1KFZ A;  3QBY A;  4MMK A;  5HY6 A;  2K5I A;  3CD6 A;  5GAO r;  1X6G A;  3RMQ A;  1BB9 A;  1M3A A;  3EGX A;  4A63 B;  4K11 A;  4II1 A;  1NPP A;  2QQ9 A;  3NHN A;  1W2B A;  4ZGJ B;  3HFN A;  1K0S A;  3EAE A;  2V1R A;  2K5L A;  3I5R A;  1TUC A;  2NUP B;  4HCZ A;  2KAF A;  1FMK A;  1KJW A;  1TH7 A;  2RHY A;  5GAM j;  3X24 B;  1YP5 A;  3X25 B;  1NEB A;  2PVO B;  1SHF A;  3OQ5 A;  4JZ4 A;  5GMK e;  4RTY A;  3RIR A;  2JTE A;  1K73 U;  3L2W A;  1TOV A;  1D3B B;  2JMC A;  2YHT A;  3UF4 A;  3UA7 A;  4LDV A;  3SB2 A;  1SG5 A;  1KK7 A;  3RBB B;  2J6F A;  4MZM A;  2GNC A;  2XIC A;  1VQP Q;  2LQ8 A;  1AWJ A;  3OS2 A;  1I07 A;  2EQJ A;  3EFO A;  1VA7 A;  2DYB A;  1G8X A;  4DBF A;  1KIK A;  2SRC A;  1HXD A;  4C8Q C;  2J6K A;  4M77 G;  2GFA A;  4ANJ A;  3LYI A;  1YJ9 T;  2MOX A;  3CBO A;  1D1A A;  4M7A E;  1M2V B;  3VKI A;  1R8O B;  2MK5 A;  2QDL A;  1ZUK A;  4O6J A;  1CKA A;  1HYO A;  1AZG B;  3EG3 A;  3HRU A;  2A3L A;  1RUW A;  4FYV B;  2DXC A;  4QVZ A;  2HL5 C;  8ATC B;  3CCS A;  1BCO A;  1VQ8 Q;  1M90 U;  2EW3 A;  3H0H A;  1FMW A;  3OW2 S;  1B34 A;  4M77 F;  2A08 A;  3JCM b;  3NFC A;  3QG1 A;  4HT8 A;  3CCM Q;  1GBR A;  1QKX A;  2K6D A;  4LUD A;  1KHC A;  2FB7 A;  1UG1 A;  3HFO A;  1VQ7 Q;  4A4H A;  4XTZ A;  5GMK m;  2CZ1 B;  1WI7 A;  3KUF A;  3CC4 A;  2FZG B;  1U5S A;  2K7A A;  5D7U A;  5GAM f;  2C0O A;  2V1Q A;  4PJO D;  1JXM A;  4OB1 B;  2O9V A;  2ROL A;  4J8O A;  5CR2 A;  3HPW A;  4XK8 E;  1KQS S;  4M78 D;  5KYW B;  2L2P A;  3A8H B;  4OB0 B;  2ZCF B;  4GBQ A;  2CH4 A;  2JTM A;  2IIM A;  5GAM d;  5DY9 A;  3A5Z B;  3G7Z A;  1YCY A;  2DXB A;  2LT1 A;  2DIG A;  2P0Q A;  3LH5 A;  3L2V A;  5C6S A;  1BYM A;  2E70 A;  4EMK B;  3OYI A;  1Q86 U;  4Z88 A;  2PUK B;  4J9E A;  1U8R A;  4RG8 A;  6AT1 B;  4LNP A;  2LX7 A;  4RTZ A;  3H41 A;  1OX9 A;  4C92 G;  3PMT A;  2K3Y A;  3SWN A;  2D8H A;  2L3S A;  3L2R A;  1UHF A;  2DXU A;  3RUX A;  3A8M B;  3EFS A;  1MHN A;  4F17 A;  1VQO A;  5IHK A;  2OX7 A;  4M7D C;  3M54 A;  3CXC P;  2OTJ T;  1WHK A;  3QWX X;  2YWW A;  3G4S Q;  3BDU A;  1MNE A;  2QTX A;  2EJ9 A;  4IUP A;  3NTH A;  3M0Q A;  3H6Z A;  1M9S A;  2WSE E;  4RTX A;  3PTA A;  2FZC B;  1M27 C;  4PJO A;  2DZ9 A;  2DL7 A;  3A8O B;  4C92 F;  1KD1 C;  1WXB A;  3QDR B;  1PSF A;  2YUQ A;  2X3X D;  2O88 A;  1I1J A;  2MAM A;  4BD3 A;  4E47 A;  3CD6 T;  1Y96 A;  4B9W A;  1KQ2 A;  3ZFJ A;  5FU7 B;  1IB8 A;  4AFS C;  3ASK A;  3EG9 B;  1OUL A;  3REA B;  4MDW A;  4OML A;  3MKD A;  3GP8 A;  3OSV A;  3EGX B;  4M77 D;  1VQP A;  2DET A;  1PHT A;  2ZZD A;  1G3W A;  3P8D A;  3QJ6 A;  1RAH B;  1MMA A;  1SPK A;  1RAD B;  3MP1 A;  1O9S A;  3FLG A;  3FIF A;  1R77 A;  1T3S A;  4DBH A;  2RB6 A;  2VGM A;  2BIV A;  4XU2 A;  5C0M A;  1UFF A;  4PNO A;  4C5H A;  5KE2 A;  2DIL A;  3UPU A;  2BZX A;  4FW1 A;  1MMN A;  4C8Q G;  4FYX B;  1D09 B;  2VB6 A;  3MCA B;  1AVZ C;  3CPW A;  3O8V A;  1VQ8 A;  3HL8 A;  4JS4 A;  4XU3 A;  2ZPB B;  2OAW A;  1G3T A;  1ZLM A;  2COY A;  5GAN 5;  4JJC A;  2RHI A;  3CCM A;  1KC8 U;  1ZQ1 A;  4C8Q F;  3EG1 A;  3QHS A;  2FRW A;  1NJI C;  1VQ4 Q;  5FRM A;  2DIQ A;  4M77 A;  2X51 A;  1TSF A;  3CCS T;  2A7Y A;  3MET A;  2VV5 A;  1Q81 C;  3A8L B;  5GAN 7;  4BB7 A;  1JQQ A;  2W0Z A;  3TCJ A;  2RMO A;  1SEM A;  4M75 C;  2YUP A;  1UHC A;  5DLO A;  1I81 A;  4QQ6 A;  1B34 B;  2RK1 A;  4BI3 A;  3WXM B;  1I4K 1;  3JV3 A;  4NL2 A;  4PL6 A;  5KYY B;  3CC4 T;  2CSQ A;  3OYK A;  1FWZ A;  3E19 A;  4FYY B;  4HCK A;  5KCH A;  2VUB A;  4HVU A;  1VQ5 A;  4M78 C;  4HT9 A;  3SHW A;  1UGQ B;  1MV0 B;  2GFU A;  4OMN A;  5GAN 3;  1QCN A;  4DEY A;  3G4S A;  4D8K A;  2QGF B;  1K0X A;  2O9S A;  3OYD A;  4IUT A;  4BE0 A;  2GBQ A;  3TSZ A;  2Y90 A;  4M7D G;  1UEB A;  5GAN 6;  5FW9 A;  1AWO A;  1SKU B;  1BIA A;  1Y0M A;  1YWO A;  2KDS A;  4XU0 A;  1QVF P;  4B9X A;  2X4X A;  1VQO T;  4LDW A;  4A4G A;  1RAG B;  4LD9 K;  1YFN A;  4C92 A;  5LJ3 g;  2DM1 A;  2Z0W A;  5CQX A;  4M7D F;  1D0X A;  4D8D A;  3VS7 A;  4C5E A;  2DL4 A;  1RI9 A;  3SWN B;  3MPU B;  1D0Y A;  3QO3 A;  1NEG A;  2YT6 A;  2EPD A;  3JCM Q;  3NMZ C;  3HKS A;  2D1X A;  2AKK A;  3M53 A;  3OYJ A;  4C8Q D;  3OB9 A;  5FRO A;  3V7S A;  3PVL A;  3THK A;  2A36 A;  2DPP B;  4PJO B;  3WVE B;  3JCM g;  1G3S A;  5GAN 2;  3C95 A;  3VRZ A;  4DOV A;  4BE2 A;  2RN8 A;  5CCA A;  4M78 B;  2GF7 A;  2EYZ A;  1Y96 B;  4LN2 A;  3PMI A;  1EZZ B;  3S6W A;  2P4T A;  1T3L A;  1NLO C;  2MYS A;  3BDL A;  1VQP T;  2DE0 X;  1G2B A;  1UDL A;  2EQI A;  1E7O A;  2EGA A;  5KH6 A;  4N4I A;  1W6X A;  2RHU A;  3VS2 A;  2OI3 A;  5GAN 8;  3PT9 A;  2RO0 A;  1C1A A;  1FMV A;  3CC2 Q;  2RA2 A;  2F5K A;  4XTW A;  4QVC A;  3NTI A;  1QLY A;  1OZ3 A;  3MEW A;  5LJ3 j;  2LRQ A;  3JRZ A;  1YJN Q;  2P84 A;  4EMH A;  2DER A;  2K2M A;  1PKS A;  3VS5 A;  1E6G A;  4DBR A;  5GAN 4;  1VQ4 A;  5KYW A;  4NOY A;  3OS0 A;  1JJ2 A;  2KRO A;  3QDF A;  2JM9 A;  3UWN A;  1VQ8 T;  3TEE A;  4L59 A;  1BKB A;  3Q1J A;  1UJY A;  3DB4 A;  4C8Q A;  1EIF A;  1BI3 A;  2GGR A;  1LJO A;  2EKO A;  1W2B P;  1U1T A;  2E3I A;  3CCM T;  4A4F A;  4OB2 B;  5CKB A;  3R6N A;  4EDU A;  4ZGD B;  1WLP B;  3CC7 Q;  2M0Y A;  4J5Y A;  2RM4 A;  2CZ7 B;  1VQL Q;  2KY9 A;  5A2Q E;  4JLI A;  3CCV Q;  3AHU A;  1TU0 B;  4OMP A;  3JCM P;  2CUD A;  2DFU A;  5A0L A;  2BE9 B;  1JEG A;  3VRY A;  4ZTJ A;  5CAI A;  4FU6 A;  2K3B A;  1AEY A;  4HKE A;  4PK4 A;  4DA4 A;  4M77 B;  4D6W A;  4HVW A;  4KGX B;  1OOT A;  5FWB A;  2DNU A;  5IN1 A;  4M7D D;  2XG8 D;  2YLC A;  3F70 A;  4PJO G;  1M5Q 1;  3MP8 A;  2JNG A;  2WSC E;  2DVJ A;  2VXE A;  2BZ8 A;  2IVW A;  4C5I A;  4M78 G;  5D6X A;  4AG2 C;  2AKL A;  4E6R A;  3VV0 A;  3EG9 A;  1MV3 A;  1VQ5 T;  2YUN A;  1QVG A;  2E10 A;  3VS1 A;  4O5V A;  1EX4 A;  4UC4 A;  4PJO F;  1VQO Q;  4WF2 A;  5LJ3 f;  3PE0 A;  2K5F A;  1LNX A;  3RKX A;  1VQM Q;  2D8J A;  4L6V 5;  1YHQ Q;  4M78 F;  2X9H A;  3H0I A;  1Q82 C;  3G4S T;  1OU9 A;  1Q7Y R;  1S1N A;  3I55 Q;  2XU8 A;  2Y4X A;  2XDB A;  2BKD N;  2EYW A;  1H92 A;  1M4Z A;  2FEI A;  3OS5 A;  4OP0 A;  1UEC A;  1JRI A;  3RDV A;  4KBM B;  1J3T A;  3LGL A;  5LJ3 d;  2YRD A;  2C0I A;  3L2Z A;  3I56 Q;  3TSW A;  3JCM f;  4IIM A;  4M7D A;  4M7A C;  3RKY A;  4F04 B;  4J7I A;  4ESR A;  3U23 A;  1I5L A;  2JS2 A;  4RTV A;  2VC8 A;  4E7Z A;  4Z8A A;  3IQL A;  2D0N A;  3TRE A;  1E6H A;  3JCM d;  3MEU A;  3JSC A;  4C92 B;  1GCQ C;  3VS6 A;  3VS0 A;  1QWE A;  3H0F A;  4V2S A;  3JCM c;  1HK9 A;  2KNB B;  4ORZ A;  4ZN3 A;  1NYF A;  1VQ9 Q;  2FVU A;  4OVA A;  1VQ6 Q;  5KE3 A;  5LL6 S;  3CC2 A;  3JCM V;  3EH2 A;  3M59 A;  4RTT A;  2F2X A;  2M16 A;  2HNI A;  4RUG A;  1WJS A;  2EGE A;  1YJN A;  2F69 A;  2LJ1 A;  4J6W A;  1ARK A;  2KI7 A;  3GBQ A;  1KSW A;  4E7J A;  2HD0 A;  2XHC A;  2RJD A;  3FDR A;  2NYS A;  3OBW A;  1N8R U;  2KBT A;  1NYG A;  2FYK A;  4NL3 A;  3C12 A;  2CUB A;  5KYY A;  4QQG A;  4WCI A;  3CXC S;  4M75 D;  2JTF A;  1WQW A;  4J9H A;  1BI1 A;  5LJ3 h;  2R57 A;  2E3H A;  2QXF A;  1XTD A;  1BI0 A;  3CC7 A;  4BY6 C;  2P0P A;  4R0K A;  1VQ4 T;  1VQL A;  3GNG A;  4DBQ A;  2F5T X;  2I2L A;  1ZSG A;  3CCV A;  1WZO A;  2YUO A;  1A0N B;  2VKN A;  2QEX Q;  1RAB B;  2M9U A;  3J80 E;  2CP6 A;  2E6N A;  1PNJ A;  4DQ2 A;  2XK0 A;  2KYB A;  2FPF A;  2RJC A;  4J9B A;  2HSE B;  3JCM h;  2CP5 A;  4MML A;  2DTI A;  1JXO A;  2V26 A;  2R58 A;  4LUE A;  1IRE B;  4PJN A;  2MI6 A;  2RQU A;  3WVD B;  2ABL A;  4F7U B;  4C8Q B;  1WIE A;  3RES A;  2O01 E;  1OI1 A;  1NJI U;  4OGC A;  3PVQ A;  2EQM A;  3RKW A;  1QMC A;  1VQ5 Q;  1PD0 A;  3JB9 J;  1Q81 U;  2L5Q A;  1UTI A;  2LMJ A;  2PVG B;  4M75 A;  4OF1 A;  2ENM A;  3HRT A;  4XTU A;  2B86 A;  1D1B A;  1QCF A;  2KRN A;  1VQM A;  2ZPF B;  1YHQ A;  1KG1 A;  1JB0 E;  3CPW P;  4AT1 B;  1BIB A;  1B3Q A;  4A53 A;  3I55 A;  2DRK A;  2DTH A;  3G71 Q;  2KT1 A;  2K3X A;  1WPY A;  5D6W A;  1X69 A;  2Y4Y A;  1KC8 R;  3PGG A;  2G3R A;  2BZY A;  3CPF A;  4LD6 A;  1Q95 G;  4OMO A;  2DJZ A;  4M78 A;  4BDZ A;  4B6M A;  3I56 A;  3QYH B;  1LOJ A;  4KH0 B;  2ZPI B;  1WA7 A;  1B7T A;  1TUD A;  4J9C A;  2DO3 A;  2BUD A;  2CZ0 B;  4E7S A;  3MHX A;  2COZ A;  4Y28 E;  2YDL A;  2KK4 A;  4QT7 A;  4M7A G;  1QP2 A;  3HTR A;  5GAM h;  1VQN Q;  2DAQ A;  1OPL A;  2DL5 A;  2EYX A;  2EFI A;  1Z9Z A;  2KSS A;  4E7L A;  2KE9 A;  1R0B G;  1SF9 A;  1I5O B;  2QQR A;  3GNF B;  4XU1 A;  4OMM A;  2LVM A;  1P92 A;  1VQ9 A;  1VQ6 A;  5I2S A;  2M51 A;  3M58 A;  2CS7 A;  1XQH A;  3RNJ A;  2M0O A;  3NPF A;  4Y92 A;  4JJN K;  3CCQ Q;  1Q7Y C;  1RLP C;  2WSF E;  1OYX A;  4F7U G;  4KH1 B;  1SSF A;  3M4Y A;  1BK2 A;  4M7D B;  2C0T A;  1C6V X;  4C0D C;  4MZP A;  1AZE A;  3URG A;  1WJQ A;  3HRS A;  1N9S A;  1UGV A;  1S72 Q;  1RAI B;  1OX8 A;  3OW2 A;  2RQT A;  3E9G A;  4LDX A;  4XTX A;  3CC2 T;  1Y57 A;  2KYM A;  1HSQ A;  4J9G A;  1QW1 A;  4F7U F;  2HCK A;  1G83 A;  1WHL A;  1XNI A;  3J81 E;  1YJN T;  1IZ6 A;  3RER A;  2RJF A;  2MF2 A;  1TXQ A;  2COW A;  2K79 A;  2JM8 A;  2MMP A;  3OMG A;  2QEX A;  1GFD A;  1QVF S;  1KHI A;  2PQW A;  1SRL A;  2QAS A;  2LNV A;  5KYX A;  1PSE A;  2MWP A;  1KQS A;  2EQU A;  3CME Q;  1ZA1 B;  3VS3 A;  3A1P A;  2X4Y A;  1TS9 A;  2EQK A;  5CKF A;  4BUG A;  2ATC B;  3MJX A;  2LT4 A;  3CC7 T;  2MIO A;  2EAY A;  1VQL T;  2JJ9 A;  3VUZ A;  4PFZ A;  1N9R A;  1NE8 A;  3CCV T;  1GCP A;  3OSS C;  1Z9Q A;  1WHM A;  1Y07 A;  4Y91 A;  2CP0 A;  1K76 A;  2RQW A;  1PCX A;  1ZHI A;  2E6Z A;  4TVR A;  4FT2 A;  1FXX A;  1PWT A;  2EJF A;  3TVT A;  3EGD B;  3M56 A;  3S3N A;  2AT1 B;  1O75 A;  2JT4 A;  2L3Q A;  2XMF A;  4KUL A;  4BAC A;  1X43 A;  4MDX A;  2XD0 A;  2M02 A;  1K8A R;  2RI3 A;  3M4G A;  5IT9 E;  2FO0 A;  3REB B;  3ULR B;  4ELZ C;  4XQ3 A;  4HCC A;  1ZSZ C;  3G71 A;  1HD3 A;  1PRL C;  3SEM A;  1VOM A;  2NWM A;  5LJ5 g;  2EBP A;  1H64 1;  2ZGW A;  3MEV A;  2JW4 A;  2GTO A;  4JRI A;  2J06 A;  4M7A D;  3SFM A;  3LW5 E;  1VQM T;  1K9A A;  3A8G B;  4OGE A;  3V8L A;  2QA4 Q;  1H3H A;  5KCO A;  1UUE A;  1JJ2 P;  3QUI A;  3LWH A;  1YHQ T;  5GMK l;  4PJO E;  2B8A A;  7AT1 B;  4J6X A;  3MO8 A;  5L23 A;  4IUR A;  2QG9 B;  4M75 B;  4PJL A;  2HZY A;  2JN0 A;  4OMQ A;  3I55 T;  4J9I A;  3GF5 A;  2NLU A;  4KUD K;  2QGG A;  3CMA Q;  4IUV A;  1ZA2 B;  4ZTF A;  2CP2 A;  1M1K R;  1VQN A;  5FWC A;  1D1C A;  4LXC A;  2KRS A;  2DL8 A;  1W2B S;  1XOV A;  2CH4 W;  5CO7 A;  1U3O A;  3OYC A;  1ZBX A;  3M0P A;  1VIE A;  3I56 T;  2KXC A;  4RKU E;  2VGN A;  2GQV A;  1WHG A;  4FT4 A;  2O4X A;  4C5G A;  1K9M R;  1YIJ Q;  1UGP B;  5FU6 C;  1AWX A;  1VQK Q;  1IHV A;  1IRX A;  2EKH A;  3VUB A;  3ZL7 C;  3CCQ A;  3D7S B;  1Q82 U;  5CKE A;  1OV3 A;  1V29 B;  3LGF A;  2DA9 A;  2J6O A;  4XTY A;  1JBM A;  1ABQ A;  1FYN A;  1QQJ A;  5AT1 B;  2O2O A;  1WYX A;  3OYE A;  1KC8 C;  3EG2 A;  5LJ5 j;  1QKW A;  5LJ3 e;  3JB9 H;  3QXE B;  4JRK A;  1NG2 A;  3CCU Q;  4KGZ B;  2AHJ B;  1R0C B;  1S72 A;  1QCO A;  3P8B B;  1PM3 A;  2R5M A;  2E4H A;  2BE7 D;  4WTO B;  1W1F A;  4M7A A;  2PVD B;  1VQ9 T;  1VQ6 T;  4IKF A;  4CI0 C;  5I11 A;  3UT1 A;  3V8K A;  1F1B B;  4FM4 B;  1VYT A;  2SEM A;  3OMC A;  2CT4 A;  4IUU A;  2KVQ G;  4FSX A;  1SHG A;  2OTL Q;  2CDT A;  4RTW A;  4FYW B;  4CRI A;  3GIB A;  1QVG P;  3T9N A;  4Z89 A;  1GCQ A;  3JCM e;  2IPO B;  5I2M A;  2D0Q B;  1IGQ A;  4F7U A;  2HKN A;  5CIU A;  1YWP A;  5IXF A;  1K1Z A;  2OAU A;  5EG2 A;  2LCS A;  2RD1 A;  1M3C A;  2CSI A;  3CME A;  4BDY A;  4M77 E;  3HHT B;  2R5A A;  1M1G A;  1WXU A;  2E5Q A;  1RAE B;  3OYA A;  2JMA A;  3NTK A;  1WXT A;  1K73 R;  4M75 G;  5GAN g;  1BU1 A;  2NUZ A;  1MUZ A;  2DK3 A;  3L42 A;  2KT8 A;  2JZ2 A;  2DEQ A;  2QEX T;  1KQ1 A;  3OYB A;  4PLI A;  4N0A C;  2LJ0 A;  3OA6 A;  3CCE Q;  2CKK A;  1WFW A;  3LX7 A;  2KQW A;  3CBM A;  9ATC B;  2ED0 A;  3I5S A;  1Y7X A;  2MPX C;  3EFR A;  3PIP A;  4HVV A;  5GAO m;  2EWN A;  2AZV A;  2DEU A;  3BY7 A;  4CC2 A;  1PRM C;  3OY9 A;  1YIT Q;  4M75 F;  2QDY B;  2FRY A;  4J9D A;  3FJP A;  5KYX B;  2DLP A;  3QKJ A;  2E5K A;  5LJ5 f;  3QSU A;  3G6E A;  4ME7 A;  4QQD A;  4X34 A;  2LC4 A;  5CVI A;  2L8D A;  1MMD A;  1YI2 Q;  3OYY A;  2YXY A;  2I0N A;  4IUQ A;  2XDD A;  2QQA A;  3CCL Q;  2H3J A;  4A54 A;  1LVK A;  3KFV A;  4PFP A;  1SRM A;  1M3B A;  4PFO A;  2CRE A;  2FPD A;  1GL5 A;  1IGU A;  1BI2 A;  5GAM e;  5LJ5 d;  1M90 R;  4BE1 A;  1N8R R;  2QA4 A;  3CCR Q;  3A98 A;  2DD5 A;  2L3P A;  1WHJ A;  5GAN j;  2K57 A;  3I9Q A;  2DRM A;  2K9G A;  3VYG A;  4HCB A;  1X2Q A;  1EFN A;  2MCN A;  1UB4 A;  3G71 T;  3RMS A;  3CMA A;  4JS5 A;  2LZ6 B;  2K2V A;  4JLG A;  3E9F A;  1AT1 B;  2BTT A;  4C92 E;  2PUO B;  1NPR A;  1NBE B;  2KRM A;  3DB3 A;  2HQX A;  1RAF B;  4J6Y A;  4YTL A;  3TU4 K;  2G6F X;  1YIJ A;  4Q5W A;  2CP7 A;  1VQK A;  1K8A C;  3OBY A;  4RCB A;  1G3Y A;  1AOJ A;  2XID A;  3E1S A;  4M4Z A;  3OYN A;  1VQN T;  1V1C A;  3M5A A;  3TQ7 P;  1KD1 U;  4NS5 A;  2E41 A;  1K4U S;  1WQ7 A;  1RL2 A;  3CCU A;  1I8F A;  5GMK j;  4ZN1 A;  1WNL A;  1NJI R;  4X9D A;  3JB9 I;  5FLX E;  1Q86 R;  3BFM A;  5IXB A;  2P4R A;  2X4W A;  2DTO A;  2L3R A;  2O31 A;  4A4E A;  2AK5 A;  3CCQ T;  1Q81 R;  3FEO A;  1ZUU A;  1TUG B;  2OTL A;  2DYI A;  4HXJ A;  3FJ5 A;  4ELY C;  4JJB A;  3OYM A;  3BE3 A;  2GCX A;  2O4X B;  1OEB A;  2VWF A;  4AFZ C;  5LJ5 h;  2RK2 A;  3PIO A;  1M1K C;  2J05 A;  2ROT A;  5M9O A;  1TWB A;  4EMK C;  3UAT A;  3X20 B;  2EYY A;  1S72 T;  4EMG A;  2RF0 A;  3ME9 A;  1D0Z A;  3QZ5 B;  5CKD A;  2RQV A;  3VS4 A;  2E1H A;  1K9M C;  5HK3 A;  3CPW S;  2ZPH B;  1FX7 A;  4DOW A;  2CGH A;  1M8V A;  5GAN f;  3M0T A;  1Q7Y U;  2XKO C; 
#chains in the Genus database with same CATH homology
 4LDW A;  1Q7Y C;  4A4G A;  4PKC C;  4M7A B;  2WSF E;  2RJE A;  2RI2 A;  4LD9 K;  4F7U E;  1OYX A;  4F7U G;  4C92 A;  2RI5 A;  1SSF A;  2IG0 A;  4C8Q E;  2OTJ A;  5LJ3 g;  3M4Y A;  4M7D B;  5GAO q;  4FIB A;  5CQX A;  5CK9 A;  4M7D F;  1DJ7 B;  2L89 A;  4C5E A;  4C0D C;  4QVD A;  3HP9 A;  2EYQ A;  3DLM A;  4MZP A;  5GAN e;  3SWN B;  3URG A;  4C92 C;  1WJQ A;  5GMK i;  2YRV A;  3QO3 A;  2KMT A;  3HRS A;  1N9S A;  3GLX A;  5GAN d;  1WGS A;  4KT0 E;  3C94 A;  2LCC A;  3CCE A;  3OW2 A;  4A4K A;  3JCM Q;  4GLK A;  3P8H A;  4ZGE B;  3CME T;  3HKS A;  1M1F A;  3V7C A;  1U1S A;  3E9G A;  4LDX A;  4XTX A;  3M53 A;  3CC2 T;  3OYJ A;  3QBY A;  3OB9 A;  5FRO A;  3V7S A;  4C8Q D;  4MMK A;  5I21 A;  5FU7 C;  2DPP B;  4C0G A;  5HY6 A;  2LQK A;  1QW1 A;  4F7U F;  2K5I A;  2MWO A;  4HA8 A;  3CD6 A;  2CYZ B;  1YIT A;  4PJO B;  5GAO r;  3WVE B;  3RMQ A;  1XNI A;  2ZPG B;  3J81 E;  1YJN T;  1IZ6 A;  3JCM g;  3OS1 A;  1G3S A;  5GAN 2;  3C95 A;  3RER A;  4DOV A;  4BE2 A;  4II1 A;  1NPP A;  2RJF A;  3X26 B;  5CCA A;  2MF2 A;  4M78 B;  2GF7 A;  2QQ9 A;  1Y96 B;  1W2B A;  4ZGJ B;  3HFN A;  3PMI A;  3S6W A;  2P4T A;  3EAE A;  1YI2 A;  1VQP T;  2K5L A;  3BDL A;  3GPL A;  1N6A A;  4PLL A;  2MMP A;  3OMG A;  5KH6 A;  4N4I A;  2QEX A;  2RHU A;  4HCZ A;  3CCL A;  1KHI A;  2KAF A;  1TH7 A;  2PQW A;  1QVF S;  5GAN 8;  3PT9 A;  2LNV A;  5A0D A;  1PSE A;  4BI4 A;  2MWP A;  2RHY A;  2RO0 A;  3X24 B;  3X25 B;  5GAM j;  1KQS A;  2EQU A;  1QP3 A;  3H8Z A;  4R56 A;  5DM7 R;  2PVO B;  3OQ5 A;  5FRN A;  4EPC A;  2RA2 A;  2F5K A;  4XTW A;  5GMK e;  4QVC A;  4LDU A;  2X4Y A;  3RIR A;  3NTI A;  3FB9 A;  3JB9 G;  1K73 U;  5CKF A;  2EQK A;  2DXT A;  4BUG A;  3CCR A;  1K73 C;  1OZ3 A;  3MEW A;  3ZEH A;  2LT4 A;  3CC7 T;  3FC3 A;  5L8R E;  2LRQ A;  5LJ3 j;  3L2W A;  3JRZ A;  2EAY A;  3LLR A;  1D3B B;  3G6E T;  2YHT A;  3GOX A;  1VQL T;  3VUZ A;  4LDV A;  3SB2 A;  4EMH A;  1N9R A;  1NE8 A;  4BY6 B;  3PNW C;  3CCV T;  5GAN 4;  1VQ4 A;  2LDM A;  2X35 A;  4NOY A;  3OSS C;  3OS0 A;  1JJ2 A;  4MZM A;  2XIC A;  1Y07 A;  2D6F A;  4Y91 A;  2LQ8 A;  1OZ2 A;  3OS2 A;  2EQJ A;  1ZHI A;  3UWN A;  3QYG B;  3OYF A;  1VQ8 T;  1QVP A;  3TEE A;  4L59 A;  1BKB A;  3Q1J A;  2C06 A;  3DLL A;  3DB4 A;  3JB9 F;  4C8Q A;  2E6Z A;  2VXF A;  4TVR A;  1EIF A;  1BI3 A;  2JUF A;  4FT2 A;  1LJO A;  2EKO A;  2QA4 T;  3OYH A;  1HXD A;  1FXX A;  2EJF A;  1U1T A;  5GAN h;  3S3N A;  3M56 A;  1O75 A;  4C8Q C;  3CCM T;  4A4F A;  4OB2 B;  5CKB A;  4M77 G;  2GFA A;  4KUL A;  3LYI A;  4EDU A;  4ZGD B;  1WJR A;  4BAC A;  1W4S A;  2K4Y A;  3CBO A;  2V8J A;  1YJ9 T;  4M7A E;  2XD0 A;  4J5Y A;  4FL6 A;  2RI3 A;  3M4G A;  3R6O A;  3SD4 A;  2RM4 A;  2CZ7 B;  3VKI A;  5IT9 E;  2KY9 A;  4ELZ C;  5J3B A;  4E7I A;  5A2Q E;  1R8O B;  4M7D E;  4JLI A;  3CMA T;  4XQ3 A;  4HCC A;  4O6J A;  4PJO E;  3G71 A;  3AHU A;  3JCM P;  3KXT A;  1NZ9 A;  2CZ6 B;  2A3L A;  3HRU A;  2HAX A;  5LJ5 g;  3V7R A;  5A0L A;  3V8J A;  2DXC A;  4QVZ A;  3CCS A;  5CKH A;  4ZTJ A;  1H64 1;  2ZGW A;  1M90 U;  5CAI A;  4FU6 A;  3MEV A;  2E12 A;  1M90 C;  5GAO l;  4JRI A;  4M7A D;  4HKE A;  4DA4 A;  1N8R C;  4M77 B;  3SFM A;  1H3Z A;  4D6W A;  3OW2 S;  3LW5 E;  1B34 A;  3KBG A;  4M77 F;  3OYG A;  1YIJ T;  5CQY A;  1UGR B;  5IN1 A;  1VQM T;  4OGE A;  3A8G B;  3N5B B;  3V8L A;  3NFC A;  3JCM b;  5GAO n;  1VQK T;  5KCO A;  4M7D D;  3QG1 A;  2EJG A;  2XG8 D;  3QUI A;  4OMF B;  2YLC A;  3LWH A;  3F70 A;  1YHQ T;  4HT8 A;  4XTV A;  5GMK l;  4PJO G;  2B8A A;  2LX9 A;  3QZ9 B;  1M5Q 1;  3MO8 A;  3MP8 A;  4J6X A;  2JNG A;  2WSC E;  4IUR A;  2DVE A;  1VIF A;  4M75 B;  4R55 A;  2JN0 A;  2VXE A;  1KHC A;  3I55 T;  2FB7 A;  3S3M A;  3HFO A;  2IVW A;  3GF5 A;  4A4H A;  2NLU A;  4GY5 A;  4C5I A;  3SDZ A;  4M78 G;  4KUD K;  4XTZ A;  5GMK m;  4IUV A;  2CZ1 B;  5D6X A;  5GMK h;  4ZTF A;  1VQN A;  3KUF A;  3CC4 A;  3CCU T;  4RG2 A;  3S3O A;  3UDC A;  1W2B S;  3VV0 A;  5GAM f;  1XOV A;  3CXC A;  5CO7 A;  3OYC A;  1ZBX A;  3I56 T;  1VIE A;  2P0K A;  4PJO D;  4RKU E;  1VQ5 T;  1QVG A;  2E10 A;  4QW2 A;  2VGN A;  2GQV A;  4FT4 A;  4OB1 B;  2O4X A;  4O5V A;  4UC4 A;  4ATO A;  4C5G A;  4PJO F;  4J8O A;  5DLQ E;  5CR2 A;  4WF2 A;  3HPW A;  5AYF A;  4XK8 E;  2K5F A;  1UGP B;  1LNX A;  5J26 A;  5LJ3 f;  3RKX A;  1KQS S;  4M78 D;  5FU6 C;  4L6V 5;  2OTL T;  3A8H B;  3VUB A;  4OB0 B;  3CCQ A;  2ZCF B;  1Q82 U;  5CKE A;  4M78 F;  3JCM W;  1V29 B;  1Q82 C;  5GAO p;  2JTM A;  3LGF A;  3MP6 A;  3G4S T;  4XTY A;  3JAM E;  5GAM d;  5DY9 A;  1JBM A;  3A5Z B;  2XU8 A;  2Y4X A;  3G7Z A;  2XDB A;  1YCY A;  3OYE A;  2BKD N;  1KC8 C;  2DXB A;  5LJ5 j;  2LT1 A;  5LJ3 e;  3JB9 H;  1M4Z A;  2DIG A;  3QXE B;  4JRK A;  2P0Q A;  3OS5 A;  4OP0 A;  1VQ7 A;  3L2V A;  1JRI A;  5C6S A;  1BYM A;  4KBM B;  2E70 A;  3LGL A;  2AHJ B;  5LJ3 d;  4EMK B;  3OYI A;  3CCJ A;  1S72 A;  1Q86 U;  3P8B B;  2R5M A;  1JJ2 S;  2QI2 A;  4M7A A;  3L2Z A;  4JRP A;  2PVD B;  1VQ9 T;  2PUK B;  1Q86 C;  1VQ6 T;  1U8R A;  4IKF A;  1AHJ B;  4CI0 C;  4RG8 A;  3JCM f;  2X4J A;  3UT1 A;  3V8K A;  4M7D A;  1YJW A;  2V8I A;  3M57 A;  4C92 G;  1N27 A;  4FM4 B;  2V8K A;  3OMC A;  3PMT A;  4M7A C;  3RKY A;  4IUU A;  2KVQ G;  2K3Y A;  3SWN A;  3L2R A;  4FSX A;  2DXU A;  3RUX A;  3A8M B;  2M1H A;  1MHN A;  3EFS A;  4J7I A;  4VUB A;  1VQO A;  4M7D C;  3M54 A;  2OTJ T;  4CRI A;  1I5L A;  3GIB A;  3T9N A;  3BDU A;  2QTX A;  2VC8 A;  2EJ9 A;  4IUP A;  4RCC A;  3SWN C;  3JCM e;  4JUV A;  2WAC A;  3JB9 D;  3NTH A;  5I2M A;  3H6Z A;  2D0Q B;  3TRE A;  4C0D B;  4C92 D;  1YBY A;  4F7U A;  3JCM d;  3PFS A;  1M9S A;  2WSE E;  3MEU A;  3CCE T;  3PTA A;  3JSC A;  4C92 B;  4PJO A;  2DZ9 A;  3A8O B;  4C92 F;  1KD1 C;  4V2S A;  3JCM c;  1HK9 A;  3VYH B;  4ZN3 A;  5CIU A;  5A0G A;  3QDR B;  2OAU A;  1PSF A;  2FVU A;  4OVA A;  5EG2 A;  2RD1 A;  5KE3 A;  3CME A;  5LL6 S;  4BDY A;  2MAM A;  4M77 E;  3HHT B;  2R5A A;  4BD3 A;  4BI8 B;  4E47 A;  3CD6 T;  1M1G A;  1Y96 A;  3CC2 A;  3JCM V;  1YIT T;  4B9W A;  3M59 A;  1KQ2 A;  2D9T A;  2E5Q A;  4E7K A;  3JCM J;  2M16 A;  2HNI A;  4LDY A;  3ZFJ A;  3OYA A;  5FU7 B;  3NTK A;  2RHZ A;  1WJS A;  1YJN A;  4MZT A;  4M75 E;  3ASK A;  2QQB A;  4M75 G;  4C0Z A;  5GAN g;  4N0A A;  2F69 A;  4J6W A;  2DK3 A;  3L42 A;  4MDW A;  1YI2 T;  5HKC A;  4E7J A;  2HD0 A;  2XHC A;  2RJD A;  2JZ2 A;  3FDR A;  4N4G A;  1Y71 A;  2DEQ A;  3GP8 A;  3OBW A;  1KQ1 A;  3OYB A;  2QEX T;  3OSV A;  3CCL T;  4M77 D;  5D6Y A;  2FHD A;  4PLI A;  4N0A C;  1VQP A;  4Z02 A;  1N8R U;  3JCM X;  3OA6 A;  2FYK A;  2ZZD A;  4NL3 A;  1G3W A;  2CKK A;  3P8D A;  3C12 A;  3QJ6 A;  3LX7 A;  2KQW A;  3CBM A;  4QQG A;  1D3B A;  1Y7X A;  1X6O A;  3CXC S;  3LWI A;  3EFR A;  3MP1 A;  4M75 D;  1O9S A;  3PIP A;  4J7F A;  3FLG A;  2JTF A;  3FIF A;  5GAO m;  1WQW A;  2EWN A;  3QII A;  1BI1 A;  1QVG S;  3CCR T;  3BY7 A;  2EIF A;  5LJ3 h;  2R57 A;  3OY9 A;  4M75 F;  2RB6 A;  2QDY B;  2VGM A;  2BIV A;  4XU2 A;  2QXF A;  5C0M A;  3FJP A;  3QKJ A;  4M78 E;  1MGQ A;  1XTD A;  4PNO A;  1BI0 A;  3CC7 A;  2YLB A;  4BY6 C;  2P0P A;  4C5H A;  5LJ5 f;  2DZC A;  3QSU A;  3G6E A;  1VQ4 T;  4ME7 A;  4QQD A;  1UGS B;  3GNG A;  4X34 A;  2E65 A;  2LC4 A;  5CVI A;  5KE2 A;  2L8D A;  3UPU A;  1VQL A;  2F5T X;  3OYY A;  2I2L A;  4C8Q G;  3CCV A;  2PU9 B;  4IUQ A;  2XDD A;  2QQA A;  2H3J A;  3MCA B;  2M9U A;  4A54 A;  3J80 E;  4XAX B;  2E6N A;  3CPW A;  3O8V A;  4DQ2 A;  2XK0 A;  1VQ8 A;  3HL8 A;  3MEA A;  5LJ5 e;  3BW1 A;  4JS4 A;  1BI2 A;  2RJC A;  4XU3 A;  3JCM h;  5GAM e;  2ZPB B;  5LJ5 d;  4MML A;  2DTI A;  3LH0 A;  4BE1 A;  2RHX A;  1G3T A;  2QA4 A;  2R58 A;  2DD5 A;  1IRE B;  3CBP A;  5GAN 5;  2MI6 A;  2RHI A;  3WVD B;  2FL7 A;  5GAN j;  4F7U B;  5J39 A;  2K57 A;  3CCM A;  1KC8 U;  4M7A F;  3L1A A;  4C8Q B;  1ZQ1 A;  4MDX A;  3VYG A;  2ZPE B;  4C8Q F;  1YJ9 A;  4HCB A;  3RES A;  1UB4 A;  2O01 E;  1OI1 A;  1NJI U;  4OGC A;  3QHS A;  1NJI C;  3G71 T;  4RMO A;  5FRM A;  2EQM A;  2DIQ A;  3RMS A;  4M77 A;  3CMA A;  2RH2 A;  4P5N A;  2K2V A;  3VU3 C;  4JS5 A;  4KUI A;  4JLG A;  3RKW A;  3E9F A;  3L2U A;  3CEY A;  3CCS T;  2A7Y A;  2DKG A;  3JB9 J;  3J7A F;  1Q81 U;  2L5Q A;  3MET A;  2VV5 A;  4JDS A;  4C92 E;  1Q81 C;  3A8L B;  3FRN A;  2PUO B;  2PVG B;  4M77 C;  5GAN 7;  2E64 A;  1NPR A;  4BB7 A;  4M75 A;  4OF1 A;  3DB3 A;  3HRT A;  4XTU A;  2HQX A;  4J6Y A;  4YTL A;  3TU4 K;  2HBP A;  1YIJ A;  3QPH A;  4Q5W A;  3TCJ A;  1K8A U;  4OB3 B;  1VQM A;  4M75 C;  2XDP A;  3C4S A;  1VQK A;  1K8A C;  3OBY A;  2ZPF B;  4J83 A;  4RCB A;  3X28 B;  1YHQ A;  3VJP A;  1G5V A;  5DLO A;  1JB0 E;  4E7H A;  1G3Y A;  1KG1 A;  1I81 A;  1BIB A;  4QQ6 A;  2XID A;  1B34 B;  2RK1 A;  4BI3 A;  3WXM B;  1I4K 1;  4A53 A;  3E1S A;  4NL2 A;  4PL6 A;  3OYN A;  3M5A A;  3I55 A;  3CC4 T;  1VQN T;  1QVF A;  1KD1 U;  2JVV A;  2DTH A;  4NS5 A;  3OYK A;  4PJO C;  2E41 A;  4L5G A;  3L2Q A;  2K3X A;  1WPY A;  1WQ7 A;  5D6W A;  1RL2 A;  2Y4Y A;  1FWZ A;  3PGG A;  2G3R A;  1I8F A;  3CPF A;  3E19 A;  3CCU A;  4LD6 A;  5GMK j;  1GXI E;  4ZN1 A;  1RI0 A;  1WNL A;  1X01 A;  2DJZ A;  3QJY A;  4M78 A;  4X9D A;  4BDZ A;  3INZ A;  3JB9 I;  5KCH A;  2VUB A;  1X75 C;  3I56 A;  2XI9 A;  5FLX E;  1VQ5 A;  3ZBD A;  3BFM A;  4JRQ A;  3QYH B;  2JOY A;  1LOJ A;  2X4W A;  2ZPI B;  3M9Q A;  4M78 C;  2DTO A;  2L3R A;  2LCL A;  4HT9 A;  4A4E A;  3CCQ T;  3FEO A;  3OYL A;  1UGQ B;  2DD4 A;  2GFU A;  5GAN 3;  2OTL A;  3ER0 A;  5FU6 B;  2DO3 A;  2BUD A;  2CZ0 B;  4ELY C;  3MHX A;  4EMK A;  3OYM A;  4Y28 E;  2GCX A;  2O4X B;  1M1K U;  5LJ5 h;  2RK2 A;  3DKM A;  3PIO A;  3G4S A;  1M1K C;  2KK4 A;  5IAY A;  3M55 A;  3HSB A;  5M9O A;  4M7A G;  3OYD A;  1QP2 A;  5GAM h;  4IUT A;  2DAQ A;  4BE0 A;  1VQ7 T;  4EMK C;  2VYT A;  3X20 B;  2Y90 A;  3CCJ T;  1S72 T;  4M7D G;  1UEB A;  2EFI A;  5GAN 6;  4EMG A;  3ME9 A;  2KSS A;  2QQS A;  3QZ5 B;  5CKD A;  4E7L A;  1K9M U;  4N4H A;  2E1H A;  1BIA A;  5HK0 A;  1K9M C;  2QQR A;  4X9C A;  5HK3 A;  1YJW T;  3GNF B;  4XU1 A;  3CPW S;  2LVM A;  1P92 A;  2KDS A;  1VQ9 A;  1VQ6 A;  2ZPH B;  1FX7 A;  1Q7Y U;  4DOW A;  5I2S A;  2LTO A;  2CGH A;  5GAM g;  1M8V A;  3M58 A;  5GAN f;  4XU0 A;  1VUB A;  4B9X A;  2CS7 A;  1XQH A;  2M0O A;  2X4X A;  2HQE A;  4C0F A;  1VQO T;  4JJN K;  2XKO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...