3TVTA

Structural basis for discs large interaction with pins
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
282
structure length
255
Chain Sequence
SLYVRALFDYDPGLPFKHGDILHVTNASDDEWWQARRVLGIVPSKRRWERKMRAVLSYEAVQRLSINYTRPVIILGPLKDRINDDLISEYPDKFGSCVPHTTRPKREYEVDGRDYHFVSSREQMERDIQNHLFIEAGQYNDNLYGTSVASVREVAEKGKHCILDVSGNAIKRLQVAQLYPVAVFIKPKSVDSVMEMNRRMTEEQAKKTYERAIKMEQEFGEYFTGVVQGDTIEEIYSKVKSMIWSQSGPTIWVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for Discs Large interaction with Pins
rcsb
source organism Drosophila melanogaster
molecule tags Antitumor protein/protein binding
molecule keywords Disks large 1 tumor suppressor protein
total genus 78
structure length 255
sequence length 282
ec nomenclature
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3tvtA01
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 3tvtA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3tvtA02
3UPUA 3FOZA 1PUJA 1C9KA 4Q00A 1ZUNB 2BIFA 3T61A 3THOA 1JR3D 5KHOC 2PTKA 4IOLA 2JJ1A 2ZYUX 3M0EA 4V0LA 1NNEA 3W8RA 1UBFA 3ZS8A 4TQ9A 4GDFA 4JLDA 1KKLA 3LBIA 3U61B 1ZUKA 3RRMA 3PV0A 5EP1A 1MRSA 2FPMA 1H65A 2R6GA 1EFTA 1TUDA 2O8CA 4HAYA 1OXUA 2WVJA 3K9GA 1CKAA 2LP5A 4P32A 3GLFE 4Q4LA 2A5DA 2N1BA 2ZRFA 1CKBA 2C04A 4QKQA 1H8EA 1EFRA 4PC1A 2WKPA 4B2LA 4HB2A 2ZE5A 1G5RA 4Z88A 2XITA 1V1CA 4LV6A 3M1IA 5C18A 2BBOA 4A4DA 1SQ5A 2QI9C 2RGEA 1OB5A 1E3MA 1ZMXA 1IO6A 1KO8A 4PC6A 1T0JA 5TDHA 3I61A 2FNAA 2QBYB 2LJ0A 4AKHA 2NO9A 2YINC 4R7ZA 4RFSB 2CUDA 2DLPA 3PEYA 1RYHA 2QU8A 3GMTA 1X27A 3L0OA 4EAQA 2VF8A 4HLDA 1GRNA 2DVJA 1KY2A 2UVQA 3Q7PA 5CIWA 1UM8A 3THXA 4WZAE 1HEIA 1H92A 1ZD9A 1H3HA 2GTPA 3ADKA 2MMGA 3TSOA 1CJTC 1PJRA 4G5SA 2OAQ1 4JJDA 4UNRA 4CF7A 2JLVA 1IXRC 4PZYA 1P5ZB 3VR1A 2VBCA 2ERXA 4D8KA 4DEXA 3K0FB 2O9VA 3R8CA 1RZ3A 4LZZA 3SYKA 1G1MA 2DFLA 4IOMA 1KDTA 4IFEA 1H8HA 3BB4A 5FUVA 3GJ7A 4TMZA 3A4LA 3AF4A 1YZNA 4C30A 4KLNA 1G291 5IDVA 3CWZA 2H5EA 3H84A 3UG6A 4LV8B 2RGXA 4OQLA 1VG9B 2YT6A 4MRPA 2DX1A 5GJCA 2BOVA 1W6XA 2JJ2A 1G17A 1Q1ZA 2FEIA 3VS6A 4MYTA 2ZETA 3SNHA 3ZZTA 1OPLA 4Q9LA 4D0LB 3THYA 1XDBA 1UF9A 4MKHA 4OI2A 4TSFA 4W5WA 5EE9A 5JSZB 2MSEB 2O8FB 2A7QA 2PNIA 3VHLB 1P6XA 2XB2A 2BC9A 2PCJA 3BB3A 1G5TA 2CCGA 5IK2A 1W48A 2GF0A 4GRAA 3GBQA 1VMAA 1CJVC 1Z0IA 1U99A 4LHXA 2GILA 2FOLA 1E79A 3ETLA 1F2TB 4IOKA 1TQ4A 4TMVA 3QF4B 3KQLA 3EPLA 2ODEA 1AM4D 3KQNA 2I4IA 4P33A 2FRWA 2M0YA 1F2TA 1NKTA 3AQ4A 3T35A 1OKKA 1W2HA 2YWFA 2XTZA 1ZNXA 5JI3E 1KO5A 4V0ME 2HUPA 2ZSDA 4WCIA 5JRZA 2XMFA 3W90A 3BS4A 1YZKA 1E1RA 4IVPA 1Z8FA 4M9XA 1CXZA 2CE2X 4MRVA 4YXWD 1UJ2A 2J6FA 1XP8A 5LPNA 3L2OB 4S35A 1SHKA 3QKTA 5EXSA 1TF2A 4FXPA 5L3VA 4YMTA 4BFXA 3I8SA 1E0AA 1ZM9A 5JEEA 2JGNA 5CYPA 3RHFA 2O9SA 2JW4A 4NYMR 4MA4A 2FPEA 2VP4A 1O3YA 2P5TB 5CM8B 4A9AA 4IVQA 3W5IA 5B57C 4PC7A 4BASA 1BYUA 3LV8A 4KLZA 3LX8A 2ROTA 4BFVA 5FBVB 2F55A 3LH5A 4DLUA 2V4ZA 1LCKA 2IS1A 4B6FA 2C0OA 1OPXA 1Z0JA 2EW1A 2RGDA 2D74A 5TMPA 2IYYA 3P4YA 1Z6GA 1OFTA 5DE3A 5DNYB 5J4KA 1S2MA 3H0HA 2EFEB 2H1LA 2IXFA 3FWYA 5KU1A 2RCNA 4UNQA 1SKYE 3ADDA 3OAAA 4DC9A 4AKEA 2REBA 3QKRA 3NG1A 2ZU0C 1WLPB 3R7WA 1GBQA 1W47A 421PA 2KXCA 3K8YA 2O8EB 3IILA 1GFIA 4OMPA 4MKFA 3AV0B 4AC9A 3TQCA 1NVWQ 1P2SA 4ASUA 1G6OA 1KJWA 2ZJOA 1R0WA 1XMJA 4IJMA 3WP0A 1TUEA 4US0R 2BZ8A 3I9QA 3KXKA 4WVFA 4LNPA 4GLMA 2PZGA 2DFNA 5KNCA 5BYKA 1KMHA 2H57A 4B47A 2QMOA 2KBEA 1JEEA 2R65A 3DO6A 3A1TA 1WFWA 4K8OA 4O2RA 3PEWA 2V54A 5IH2A 3ZL7C 3B2EA 2ZS7A 5DI3B 1Q1EA 4GZLA 2KYBA 2CNWD 1W4BA 2GDJA 2GK7A 3QOFA 2HT1A 2PX0A 2SHKA 4I4LA 3X1WA 2ZR9A 3GP8A 2GAAA 4KCGA 4PHFA 4HUTA 1OYWA 2OLJA 3CZPA 3PFIA 1W1WA 5AJVB 2HV8A 1OPKA 1ZIOA 1Q1QA 2H92A 4FCWA 1K0XA 4AY2A 4A92A 3I3SR 1EFHA 4IVRA 2D7CA 3UK6A 2J1LA 4A36A 4QNMA 5KSPA 5AWFC 3EHQA 5DYGA 1WCV1 1NJGA 5KTYA 4LYAA 3QENA 1OXTA 2ZU6A 4PPQA 1R2QA 2QZ4A 1HE8B 3GJ4A 1QHIA 5DN6A 2VSOA 2YOGA 4ZIRA 5FOWA 1CP2A 1DAHA 1E2GA 4EUNA 3UA6A 4NMMA 4EJSC 4F91B 4HYYA 5EXXA 1ODFA 4JT2A 4RSGA 3KKMA 1I4TD 4A6XA 121PA 4CEIA 3T5GA 2QM8A 1N0UA 3JV3A 3RAPR 1NN5A 4M9QA 4R2HA 2PLRA 2J6KA 3CRRA 3O5ZA 2FSIA 5FWCA 2AXNA 3B82A 4US1R 2R6DA 4JMPA 4ACBA 3BH0A 1LF0A 2IEYA 3AKCA 4JZKA 4ARZA 1N5LA 1AZEA 2CUBA 2OV2A 4PQFA 4DDWA 3O8RA 2P6NA 3BE4A 1P61B 3PR1A 4HUQB 1DAMA 1S1NA 2JCSA 2PJRA 4JLNA 1SKYB 3M0UA 2ZJ2A 5G3ZA 1XZQA 2CLCX 2IWHA 1Z6YA 1R10A 2XB4A 3ADBA 3DPUA 2IWRA 3A58B 2QAGB 5CM9C 4HAZA 3A36A 2X77A 1KSJA 4NBSA 3VS4A 1E9SA 2OILA 5DI3A 1JR3E 1E2NA 3KB1A 4HAWA 4NTZA 3KDSE 3VQTA 4B32A 1SVIA 3H0KA 2PH1A 4N0EA 4PHHA 4AFZC 3BK7A 1ZD8A 3SFVA 3ZD6A 2AFIE 2WWXA 2R44A 1Z0AA 1FOEB 2GNCA 2A5JA 2A37A 4RTXA 1EG7A 2IF2A 3TUIC 2RQVA 4ESRA 2GZDA 1RIFA 4YQFA 3R9WA 2VHJA 4G5RA 1NRJB 2QL6A 1R0ZA 4LY6A 2GCPA 3CM0A 4AG5A 1GG2A 2WJVA 5HCKA 1C4OA 1OIVA 5CB8A 4RY2A 4CEHA 4KO8A 2PZ1A 1P4SA 1NG9A 1E2FA 1XEWY 3KQHA 2J7PD 3EASA 5FI0B 2O8DB 1TUIA 4HLQB 1YE8A 5FPKA 4CT5A 2KE5A 3V00A 3WMFA 5FL3A 4JVLA 5JHGB 4DLYA 1UHCA 1UHFA 2YV5A 1P62B 4QJ5A 1N6OA 3F8TA 2DBKA 3C14C 3K0AA 1QZXA 4JLAA 3NHNA 2V1UA 1A82A 4Q9KA 2AFHE 5EJEA 1J99A 1KI6A 2X2EA 1NN3A 5L23A 1KAGA 3QKSB 1G4UR 3TKLA 4YMUA 2E9SA 2C5LA 5E7JA 2IXGA 4M1WA 3KXIA 5KDLA 1E1QD 4LUEA 3VX4A 2DL3A 3VR3A 4JL6A 4Q18A 3LW8A 1QHHA 1EK0A 2D3WA 3EGUA 3CIOA 4IXMA 5M04A 3BERA 4OYHA 4GBQA 3QXCA 4ON9A 3MAAC 4F4IA 4JSTA 1Z0DA 2FH5B 8OHMA 3GQBA 1J3TA 2VP0A 4O0MA 2GGRA 2HEIA 5FOVA 2W0ZA 1X8JA 3QG1A 3WBKA 2J7KA 2ZJBA 1AGRA 1NBME 4KVGA 1GITA 4TYWA 2MOXA 2WBLC 3K0CC 1UDLA 3N5CA 4D4MA 4JSYA 4TLCA 3PG5A 3B8HA 3ZVMA 2FG5A 2KI5A 1YZUA 2JIZA 4LUCA 5H8WA 2GCOB 2ZRHA 1P2VA 3KKPA 1Y3AA 3BAFA 1V43A 2LJ1A 5EE5B 2IW3A 5HZKA 1NN0A 5L3QB 2OUKA 1UBEA 1NY5A 2EWWA 4PHGA 4Q48A 3NVAA 3VS3A 1UG1A 3B1YA 4X8OA 3OIVA 1RPZA 1OSNA 2H16A 2OCBA 2QMUA 2K7AA 1F60A 3LDAA 3SS8A 5FOSA 4IRUB 4MKIA 2CSQA 3QQ5A 1IXSB 2ZAMA 4QFMA 3UXMA 1QHXA 5C46F 3UIEA 4J0QA 2G9NA 2GWHA 4GMXA 1IY0A 1QHSA 2IYZA 4ERNA 2JLXA 5GVRA 3NHBA 4UXJA 2X3XD 4OHWA 2O8DA 5EE1A 2HDAA 4UXIA 3U3KA 3OEEA 1IM2A 1GL7A 4L5BA 2BZXA 2QEQA 1SVOA 2O2OA 3EZ2A 1VCOA 3HPRA 3DDCA 1UKYA 2NQ2C 1KZ7B 3WHLA 1SHZA 4YC7A 2C8VA 3R9IA 5C4GB 4QGAA 2XSZA 3AUYA 4ABYA 2YYZA 4EKDA 4TYNA 4CEHB 1G8HA 1WBDA 5LDDC 1W5TA 2JJ2D 1J7KA 2Y8EA 2ZE8A 3EC1A 3A98A 2IC5A 5KNDA 2DPXA 3JZMA 4DLXA 4IDHA 3T1QA 4OK3A 1IJEA 3RS4A 2FPDA 4BLPA 4DT1A 5JJKA 1AWXA 1XZPA 3OESA 3W3ZB 4MQBA 1YCSB 4WZBE 2WWGA 5D3MA 1E2MA 1IHUA 3D6TB 4AD8A 3A1UA 5DIFA 1MOZA 3PENA 4FMCB 2FSGA 2KE9A 1UBCA 4KV9A 3ZQJA 1XPUA 2B8TA 3I5SA 1BOFA 3I5YA 4AYWA 4LE9A 3QI2A 1Q20A 1MT0A 2LWIA 1NVXQ 1GAJA 2MCNA 2HCJB 3DOEA 4QHTA 2QPOA 1RRCA 5AR1A 4D25A 4IEEA 3SI7A 1ARKA 3M0TA 3EA5A 1E9AA 3V9PA 1JB1A 1EFUA 3WNBA 4P4SA 3EXAA 4JVNA 1NEBA 2ORVA 2JDIA 4TSFD 1AJEA 1OKKD 3NBYC 3TGPA 2OCPA 5DSZA 1CJUC 1DEKA 4EJSB 1M34E 5A4JA 2RKOA 2NWMA 3TMKA 4B43A 5IK2D 4QBHA 1R5BA 3EZ7A 2CVFA 5TXGA 1SPKA 4YDSA 3U7GA 1ZD1A 3X2SA 5FTNA 3I4LA 3KJHA 2FEOA 3W34A 4YMWA 1F48A 1G7RA 1UFFA 5G41A 4RZ3A 4HVWA 2IT1A 3EG5A 1FMKA 1T5IA 1SEMA 2VL7A 4CW7A 4J9BA 1LW7A 1NG2A 5BXQC 4HB3A 1TTTA 2Q9AA 3NBXX 4MRRA 1DELA 3O47A 1P9RA 1M7HA 2CHGA 1U2RA 4M53A 3B85A 4PAMA 2Q9BA 4LWZA 4UQOA 4UKDA 2XXAB 3BH7A 2F9LA 2D1XA 4MRNA 4XWKA 2CL6X 3DZDA 6Q21A 1N6HA 4R0KA 2IYVA 2R6AA 2RGGA 4W7SA 2DMOA 1LTQA 1IY1A 3H2YA 4B3XA 4C0KA 1OFHA 2MSDB 3PXGA 4AG2C 1M7GA 3K9LA 2O8FA 2FDCA 1BB9A 2KSQA 1IONA 2K3BA 2FZ4A 5IHIA 4DCVA 2OESA 3KFVA 4TL6A 4CDGA 2J45A 1E94E 5J4HA 3KTAB 4BUJA 4QJ3A 2A28A 4LJ7A 2GJ9A 2LCSA 2KB0A 2QPTA 3EIQA 3U3MA 3EPJA 1VYTA 1K4US 3F3YA 1E69A 1X43A 2EVWX 2GXUA 1N5KA 5DYIA 1OFUX 3LNCA 3ASYA 3TRFA 3ZZ0A 4YMSA 4ACAA 2KJQA 2O88A 3V4FA 3MCAA 4DSNA 4BGDA 1AZTA 4QM7A 4C9BA 2GBLA 2AKKA 2EPDA 2WZQA 4CGZA 3AVPA 1VTKA 1N6KA 4JBWA 3L0SA 2JLYA 2IS4A 4TLDA 4U00A 3CH4B 1U8ZA 1NVUQ 1COWA 3DKVA 1SKQA 2DYBA 2GKSA 5AUQA 4M22A 5LB2A 2AZSA 4AFSC 2R6CA 4P31A 3WYAA 1NMZA 1L4YA 5F3WB 1RLPC 3WHKA 3BD9A 4R98A 4J9FA 1CKEA 3VFDA 4O3MA 1P2UA 3TBKA 1RJ9B 4B35A 1AZSC 2GVZC 3PIRA 2CT4A 2WJYA 3H0IA 1EESA 1Y63A 3T34A 3C7KA 1N6NA 2YUQA 3QKRB 4PR0A 1VIYA 4IXNA 4KJZA 1BIFA 4W5HA 3AVYA 1NVVR 2YC2C 1EX6A 3GEHA 4NHOA 1QHNA 1W0KA 5LD2B 4Q7KA 1T6NA 1W7AA 4JKYA 2ZPTX 1OJLA 3VNUA 2OHFA 4F93B 5AK0A 2GCOA 4JYBA 4NYJQ 1JQQA 1KDOA 1SXJE 3SBDA 1ZCAA 4B34A 3OF5A 2P6UA 3H0FA 4TLEA 5J40A 5CIQA 1Z29A 2ATXA 3MWJA 1D5CA 3T5DA 1NLZA 1W70A 1OH7A 2BJVA 3QPUA 3NC0C 4KI0A 5GJBA 2OJ2A 4Q7JB 1JBKA 5FL7D 1T3LA 4HLCA 1VCIA 1E98A 3M0RA 4NYJR 4WIAA 2CHQA 3SEAA 1PWTA 4FIDA 1T4GA 4KVAA 4RZ2A 1ZM2A 1E2IA 4EFNA 5JBQA 1GUAA 2KYMA 3AP2A 5G3YA 2ZRMA 2GTOA 2R6FA 1CS4C 3FYHA 3O8DA 3I8XA 4JVMA 4BPBA 4C7OB 1ESMA 1JU5C 4HAVA 2OM2A 4DJTA 1JQLB 4TT3A 3RSLA 4URYR 1ABOA 4J9HA 3MRSA 2MSCB 4LX0A 2O8CB 2QTHA 1QKXA 1A5TA 1KMQA 3I5XA 3UWOA 3BFKA 4RD1A 1XEFA 5K8TA 3VR4A 4C2UA 4LJ8A 1XF9A 4Q66C 3U44A 2QPAA 3GLHE 1FTSA 4WOPA 3W8NA 1E2KA 4B3FX 2V6JA 2X19A 2IX3A 1XXHE 3U7HB 4HATA 2ZROA 1E4YA 4Q7MB 1E6HA 4TTRA 5J4VA 5FPSA 2VHQA 4DCNA 1T0HB 4IDQA 4JZ4A 5GJWB 5FOUA 2G77B 1SGWA 1U90A 2RAPA 1SRLA 2KWIA 5FOXA 2AL7A 1NI3A 1QHGA 2O0JA 4Q1CA 3TUZC 4BFUA 4DSOA 2AD1A 3Q7QA 2DCUA 2ESWA 1EXMA 2NIPA 2WJIA 3QXXA 2Z4RA 2KRNA 2EGAA 3HPQA 1XXHA 1U8AA 2YNMA 1VPLA 2ZUDA 3MWKA 4EDHA 1T5LA 4CEIB 3NDBB 1M8MA 2LCFA 1GRRA 2VP9A 3RS3A 1YN8A 1II8A 2WIAA 5UKDA 1XEXB 2A78A 3CPJB 1YHNA 1IXZA 1XD2B 1G8FA 4JLJA 5A0FA 1NKSA 5DN6D 4AI6A 1CJKC 3A6PC 1PKTA 1OHHD 3FMPB 2ED0A 2JMCA 2ZS8A 2VP2A 1FTNA 1L2TA 4TWZA 1RC8A 3A4MA 5FPHA 1IOZA 2ZEJA 4J9GA 1ZCBA 2XNSA 3SC3A 4IIOA 2XNDD 1KI4A 3T06B 1XX6A 2PT5A 3CX6A 4EIWA 2OAWA 1Z83A 2PCLA 3KKOA 2CSIA 4BLOA 1L4UA 4QXAA 1G2BA 3Q5EA 3QVVA 4TMXA 1TF5A 4Q4JB 4JLMA 3GJ8A 2WPDD 1QG2A 2O0KA 2O5VA 1N3BA 4KFRA 4PAQA 4QOSA 2ZI6A 2HYDA 3ICQB 3RLFA 3ZVRA 5JWRA 1KI8A 2OBLA 2CVHA 1B3QA 4NDZA 2W0MA 3KJEA 1P9WA 3K09A 2AKLA 2P4RA 2RHMA 1J2JA 4CC4B 1AA9A 2KEAA 3QUSA 3B1XA 5HCNA 1COWD 4BRUA 4MGIR 4LYFA 1M3BA 3RNLA 5F98A 4WBSA 1IN5A 1FMJA 4RJLA 3K0CA 4BFYA 1MO5A 5JMTA 3BGWA 4MYHA 4QBFA 4HXJA 4MKGA 1LY1A 1M30A 5IHKA 2VWFA 1AS2A 1WQ1R 2C03A 3NH9A 4RFSA 2HF8A 2F7SA 2Q6TA 4EQ6B 5EXTA 2V1QA 2R62A 2J06A 2JS0A 1I2DA 2ZTSA 3ND8A 3VR2A 3PVSA 1I2MA 2GTJA 5FI1B 3SJZA 4DDVA 5CDFE 3G5UA 2JLSA 4M1SA 3QPVA 1ZM4A 3LA6A 3ZVLA 2L2PA 2GHIA 1GFDA 3T15A 1E2PA 1E1RD 3PUYA 3QBTA 3Q3JB 3LD9A 1TU3A 1TQ2A 2ZJ5A 3TSWA 3C8UA 2L3SA 4PSAA 4DT1B 5GJVB 3OFNA 4LHYA 3EX7C 2Q9CA 1J70A 2WWFA 3FKSA 4FCVA 3EIEA 2DR3A 2QM7A 3QEJA 2HT6A 3LVRE 2I3BA 4P4TA 1ZNYA 2G6FX 1X3SA 2VP5A 4G5OA 3KKQA 4S2EA 4WW0A 4L16A 4UNPA 4MITA 2J5XA 4C3ZA 3PEVA 4M21A 1DO0A 2FU5C 2WWHA 1AWWA 3B7GA 3AVUA 1G3UA 3CNOA 5JCZA 4WAUA 4D2IA 5CJ2A 3SJAA 2KGTA 3P26A 4TL8A 2BMEA 3HR7A 4TL9A 1E9CA 1GILA 1U0HC 1KNXA 2PL3A 1JJ7A 3QPWA 2JLWA 1P3JA 1YWOA 1S9DA 1EX7A 3AGPA 4GBMA 2DWPA 4YDHB 2VSFA 2DILA 1GCPA 1M7BA 4A8JB 3SYNA 3AVQA 4XD7A 4YLGA 5JFGA 4CRWB 5CK4A 1XTJA 2EWVA 3ZDQA 1N25A 4GI7A 1NVVQ 2AHOA 3SE0A 4CVNA 2HXSA 1QRAA 4ZCMA 4NCNA 3ZJYA 4DBLC 2D7DA 1XU4A 1CTQA 3PCRB 4HLUC 3ZGXA 4Q7LA 1PV4A 2C9YA 1N5ZA 2CH4A 1E0SA 4NPHA 4EIKA 2JIZD 4OQMA 4DXAA 1AN0A 1CF4A 3IBGA 1SULA 1YVDA 2VTKA 1BO6A 3CX7A 3X1YA 1ZU4A 1N0WA 2G83A 2OT3B 3LXXA 2ZYWX 4B75A 4DSUA 2LNHB 1S8FA 3FKQA 4I1VA 1P2TA 1T0JB 3IHLA 2VLIA 1M3AA 3RC8A 1DAKA 2QA5A 2RQUA 4U5XA 1TF7A 3MJRA 1PLJA 3RABA 2ZSEA 1M3CA 1G21E 2ORIA 3QWXX 2UKDA 4K81B 4NCIA 2L3PA 2ED1A 2C0TA 3CO5A 3GJXC 2CNWA 3B5JA 5EZ5A 1DOAA 1OOTA 1W36B 1WA7A 3SEMA 2WJJA 2WWIA 1GOTA 3M0QA 5KOYA 3A4NA 4KFUA 2O52A 4J9EA 4LPSA 5ANRB 2HLDD 2VVKA 1UDXA 4TMKA 3T1VA 2OBMA 4A63B 2VHUA 1VDZA 2GJSA 4CIDA 1X2QA 4DSTA 1IY2A 2XSZD 2YZ2A 4AG1C 3U3RA 3M4YA 5IT5A 3DMDA 2J0UB 1NLPC 1IN6A 3K0AB 4GT1A 4KYIB 4LBVA 4NH0A 4Y92A 1K5GA 3HP1A 1JJVA 1GNRA 4NE2A 3R7WB 2IK8A 1QF9A 3U6BA 4RTVA 3REGA 4ZPXA 4QT7A 1XEXA 1WRBA 3CPEA 2PBRA 2EFCB 3FJ5A 1HJDA 4DEYA 1OV4A 4RD6A 4MDFA 2ROLA 3I92A 4ESHA 2ZRKA 1SXJC 1R8SA 1PRMC 1JI0A 1ZAKA 2VIIA 2W6IA 2BKEA 2A5YB 3LAWA 4BFSA 4BFTA 4GOKA 1AWJA 2O0HA 1G6HA 4M1YA 5SZIA 4D80A 2RGNC 4IFBA 1KTVA 3TR0A 5KNBA 1UFQA 1KO1A 2GXAA 4HZUA 1M74A 2O8BA 2GNOA 4LJ9A 2FG0A 4I1OA 1G8GA 2EGEA 2ZS9A 3AKDA 4V0OA 1Z5ZA 3J81k 3VKHA 2GZAA 4OMLA 3VRZA 4URVR 4URUR 2PJZA 1ZUUA 3TE6A 1FX0B 4BZXA 4XVRA 3FFBA 4D0NA 4R2IA 5FTJA 4RCZA 4D8DA 1LF5A 3C16C 3AF2A 3A8TA 2DL7A 1GZSA 2FPLA 4I1UA 2XTNA 5HPYB 3OIWA 3ULRB 1P7CA 1I1JA 2WMNB 4JJCA 2RQRA 1XEWX 1F5NA 3BH6A 1TEVA 2J0UA 4RTWA 1N6LA 3O8CA 4Q01A 3QKSA 2P5SA 1OLOA 4PPGA 4DWJA 3R6NA 1SHGA 1GSIA 1KGDA 2CREA 2EKHA 2W6JD 1MV0B 4L4UA 4Q9JA 5KSZA 1G83A 2VF7A 4OHXA 5K8LA 2YUNA 4PPFA 1PRLC 1CBUA 4OK6A 3U60B 3PVLA 4OKSA 1ZM7A 4F92B 1UEIA 4GFDA 2OSBA 5L3RA 2FZLA 2G0NA 3SU8A 2DWOA 3OE7A 1D2NA 4AK9A 3H86A 1DAGA 3TNFA 4B3CA 3FKSD 5FPTA 1XTSA 2F9MA 3CRVA 4X8LA 2DJQA 1SSHA 4XD7D 4Z51A 3AM1A 4GP6A 4BWYA 3G82C 2JS2A 5FBLB 4TQAA 5AUPB 1E9RA 1SVWA 2JMAA 1VG1A 2EYXA 4MUAA 1SVLA 3CF2A 2A3RA 3DM5A 1G8YA 4GSYA 3QE0A 2QMHA 2W10A 2YWGA 4RTTA 2AXPA 5CDFA 1MUZA 1DS6A 3QXHA 1T3SA 1I4LD 2GESA 3PJRA 1R5OA 2QSZA 3RSOA 3U23A 1EWRA 4N0DA 1XTIA 3QKUA 4TZ0A 3CRW1 3VS0A 4PFSA 2AWNA 4TN1A 1LS1A 2A08A 2DF6A 1D8TA 2BBWA 1E1QA 2RGBA 4M1MA 4JKIA 5HR5A 2QP3A 2PMKA 1VCMA 1R5NA 4Q4JA 1OH6A 1XRJA 3T1TA 5CK5A 3GLGB 2ZUCA 3VR6A 3U5ZB 2F2WA 1HV8A 2LKCA 1DAFA 2YJTD 1G8PA 1B07A 1W44A 2IIMA 1Q3TA 2A5GA 2CK3D 2VQSA 4RZUA 3VU9A 2QDLA 2IYLD 2YVUA 1HYQA 3EHRA 3M0SA 2PZFA 4KRTA 1Z06A 4HUQA 1G7TA 1RE0A 3IQWA 1JO8A 2CJWA 1RKBA 2ASEA 5EE0A 4Q21A 4Z8AA 4AG6A 2BJWA 1Z07A 4BZPA 2XGJA 2IUTA 5KO2A 5P21A 4OMOA 3DM9B 4LSGA 3CRMA 2ZE6A 5KDDA 2DYKA 2QP4A 3MG9A 1EGAA 1PUIA 3TQFA 3KUDA 2NOAA 4JLPA 5F9HA 1U3OA 4AWXA 3BOSA 5DLQC 221PA 4HEJA 3OEHD 4OL0A 3BWDD 1KYIA 1WXQA 1NYFA 2FPKA 2EVRA 4HAXA 5BWMA 1A1VA 3CNLA 2FV8A 4UNSA 5FTMA 1ZBJA 1AKYA 3AF0A 3IO5A 1XJQA 1WIEA 1MABA 3H41A 3L8ZA 2AX4A 1UTIA 1GVNB 1NJFA 1T9HA 3UKDA 3R9XA 2GJAA 4PO9A 1WE2A 4JIMA 4ZKEA 2QTFA 3EG2A 1Z6AA 2QMEA 3TUJC 2KBFA 4F7WA 1N6RA 1ZP6A 3AB3A 4PSVA 1BH2A 1AOJA 2LKDA 5JWOA 1X6BA 2ZR7A 4L9SA 5KPDA 4CEJA 2QBYA 4PSKA 2WTUA 3RYTC 1M6NA 2XNDA 5AUOB 5J4LA 1E79D 3QVUA 1Z2CA 1P9NA 5EC7A 1KJYA 1KMHB 4GOXA 4H1UA 4RZXA 1NSTA 2ODNA 3RDPA 3QF7A 1YZLA 3WP1B 1ZM3A 4LJAA 1ELOA 1QWEA 1X1RA 4OJQA 5FBWB 3W5JA 3SZRA 4NKRA 2ATVA 4ZDKA 3M0PA 1KI9A 1FMLA 1YJ5A 3GCGA 4Z8XA 1YZTA 1JAHA 3SQXA 2E5KA 1D9XA 4JJKA 3QIAA 2AKAB 1JAIA 2NZ8A 3IGFA 3GEIA 1CLUA 1S4QA 5JCPA 5ELXA 5JHHB 1A7JA 1GFCA 3A1SA 4E22A 2C98A 2DHRA 2BMJA 3Q9LA 3L0IB 4LJYA 2CDTA 4HZUB 4XTCS 2J7IA 4KSBA 2YWHA 3REFA 1UAAA 1HE1C 2HBWA 4J9DA 2JM9A 3IIKA 3GLIE 2B7CA 3LRPA 2H18A 1AKEA 4FINA 4BEJA 3CUEF 4JL5A 2ZI5A 3IIMA 4E5UA 2BBTA 2Z43A 2HYIC 1I07A 3IUYA 4IOJA 2OO7A 2JLRA 1VG0B 2CHVA 4Y0AA 1PVOA 4C0LA 1MO6A 2BMDA 4RD2A 1ZBDA 1MO4A 2ZRLA 521PA 2BTTA 2ZANA 3TK1A 1SRMA 2QNRA 4R9UC 2P6RA 2I1QA 4OMNA 4EQ6A 1WBBA 3LLMA 4P4UA 3L82B 1NG1A 4IW3B 3PE0A 4MUBA 2ZAOA 3RVBA 2JLUA 4QRHA 1UBGA 1PLKA 1XD9A 2DBYA 5FR2A 3UMSA 4X1VA 4PTLA 5JEDA 5JWHA 2IS6A 1E2JA 4B74A 1XPOA 3OFND 3ZS9A 2ECKA 1DBSA 1S0UA 2WPDA 4IDOA 3QJYA 2JATA 2LQWA 2GETA 2FN4A 1XFAA 4H1VA 3CF6R 1TUCA 3QG5A 1GCQA 4PQRA 1ZW6A 5G53C 2HXYA 4HVUA 1KIMA 1E9BA 4HSEA 5TY0A 3C41J 2OBNA 1MABB 2BMFA 2ZREA 1DE0A 3SQWA 1II8B 2RN8A 4A82A 4PZLA 1W49A 2IYSA 1OIXA 3HDTA 1Z3IX 3EZFA 4BLQA 1W5SA 3AP1A 2IXEA 4ZCIA 3AEZA 4LI0A 3TAHA 2L0AA 2RH5A 1AQUA 1US8A 1EFCA 1KI6B 2K5UA 3AKYA 3AUXA 2AKYA 1MH1A 2C78A 2QSYA 4HDQB 1HTWA 5FTLA 3OIYA 2ZSBA 3KFXA 1QCFA 2FSHA 4HB0A 4LOAA 4TMWA 2FMXA 4A0HA 1GDDA 4DLTA 2A2ZA 4A0GA 3I32A 2DFKB 3K9HA 1OEBA 4V0MA 5FBQB 1CEEA 2XAUA 5L3QA 1ANKA 1H8ED 4L9WA 2NO1A 3VMFA 2YOHA 2RHDA 3NXSA 1KDPA 1VHLA 4KBGA 4O25A 3WNCA 4MGYR 3B78A 1VKJA 2DRKA 1UJ0A 3IEVA 4Q9HA 2YUPA 1ZNWA 1FL9A 3K70D 3DMNA 1E4VA 2D8HA 2GQIA 2GAOA 1LFDB 4LV5B 1OXSC 4LHWA 4NCHA 1KOFA 2MIOA 1VCNA 3S1AB 4LPKA 4QHYA 1K9AA 2LX7A 1HUQA 2FFHA 3EAQA 4AKGA 2O31A 3SFZA 1Q22A 4Y0VA 5BQ5A 1JPJA 3K09C 1XCPA 4KBFA 4KITB 3EPKA 4IDPA 2RB4A 5CB6A 4B44A 4ZDIA 3IO3A 1KI1A 4DLSA 2ZR0A 3B13B 1X69A 5GJVC 3NEJA 2A36A 2D62A 1H8KA 4R71A 4MGZR 2ZRPA 4LC1A 5CLLA 4A0FA 1Z63A 5CJPA 4RCYA 1U5SA 4FMBB 1IN4A 4AFQC 1SVMA 1T0HA 2N46A 3C4JA 1KO7A 3MLEA 4ZI3A 4US2R 3DVLA 5JI2E 2DRMA 1BYIA 1DVRA 1ZU5A 1ZX6A 4I81A 5SZKB 4DCUA 1CRPA 4JS0A 1NMYA 2W6ID 5JS7A 3RBBB 1KFZA 2F3RA 1MV3A 3EWSA 2F1HA 4PPNA 4QJ4A 5DGXA 3H4MA 1KNQA 1Q3HA 2BEJA 1YRBA 4ILEA 4PAOA 2C99A 1FX0A 4D6PA 1S3GA 1XB2A 4H9GA 1E96A 3ADCA 3W9YA 1E0JA 1UUEA 2ANCA 2KR3A 5IHNA 1PKSA 2OG2A 4QL3A 2F1JA 2X2FA 2XEXA 3TW8B 4E6RA 4UXHA 1U0JA 3AH8A 5FPYA 2NTYC 1QVRA 2OXRA 3UMRA 3WMEA 5F9FA 1UKZA 3WBJA 1K0SA 4Q4HB 1N6PA 1Q44A 2KBTA 4M1KA 1KI7A 2J0VA 2QT0A 4B6EA 2V1XA 4LCBA 2KT8A 1CIPA 4YMVA 1R6BX 1S3SA 4LJ5A 2C9OA 4TTQA 3X1XA 4QG7A 3X1ZA 1K76A 3JZAA 5EP3A 1HT2E 3NC1C 3KKNA 4G3XA 3A37A 2IBMA 2WJGA 5EP4A 2ZYVX 5J4YA 2CBZA 2J3EA 1FP7A 3ONWA 2W2TA 1XTRA 2DNUA 4DDUA 4EPYA 2QE7A 4A8JC 5L8VA 1YR8A 4BLSA 3PITA 2IEZA 3HJNA 3AVVA 3C5HA 3WRXC 1ZUYA 2XTMA 1KK3A 3CB4A 4V0NA 1VECA 1YRAA 1OXXK 1ESNA 1E2LA 1SHFA 4N1AA 4PX9A 4XVQA 3TVDA 4JT4A 2O8BB 3NHAA 1A0NB 1M8PA 2G6BA 2QAGA 3NWJA 1W46A 2ZITA 5HE9A 1RRFA 1YZGA 2DY1A 3AGQA 2EQIA 1BBZA 1U81A 2X1VA 1RRPA 2ZRAA 5EZ6B 1KIKA 3KTAA 5KPJA 2QG6A 4PANA 2FFBA 3GJ3A 2ZJ8A 2NGRA 2IF0A 5AJXA 2Q21A 1ZSGA 2C96A 4DIEA 1YWPA 2PT7A 2HCKA 5FR1A 5IXFA 5E7IA 3GJ5A 1Q21A 1KSGA 3HU3A 1K1ZA 1F2UB 2ZJYA 2NO7A 1VIAA 3ECCA 1G19A 1TAGA 3B1WA 2QY9A 1U8YA 1ZUIA 3WY9A 1KK1A 1XCGB 2V3CC 1ZNZA 3K0SA 4U7DA 1OXVA 3LW7A 2F6RA 1CULC 3IPXA 2G1JA 4PZZA 5HKKD 2J05A 1X6GA 2KT1A 2E1RA 3HYTA 5FH9A 2ZM5A 1XTKA 4TTPA 2F2XA 2Z83A 3NBZC 1Y57A 4MDEA 1GKYA 1Z28A 3FHCB 2ZI4A 1WA5A 2NO0A 5E3HA 3ND9A 3RWOA 1NP6A 5JECA 3EA0A 2W83A 1XJ0A 2R9VA 1QHYA 1UEJA 1WXBA 4HB4A 2UZ3A 1ZYUA 3K70B 3B6EA 2CLDX 2QP9X 5H1YA 3NPFA 1XTQA 1KSHA 3MUFA 4M0LA 2Z5FA 2J9RA 1UPTA 4II7A 4BECA 4ZNXA 2AN9A 4PQYA 4QBGB 1T8TA 1RI9A 1KO4A 2J6OA 1VA7A 1P60A 4ZV4A 2FFAA 2YWEA 3K0EA 3VS5A 1A2KC 2CK3A 2FRYA 2ONKA 1NBMD 4QGHA 1QG4A 1BS1A 5HCIA 3GFOA 4OJKA 1QLYA 5FBRB 2EQBA 4LBYA 4JZ3A 2XJ4A 2BHRA 1Z08A 4X8HA 5B64A 2Q3HA 1HA3A 5CITA 3TW4A 4A15A 2ZVQX 2ZIAA 1X1SA 1K6MA 4KAXA 1FZQA 4XH9B 2GEDA 1P73A 3CKLA 4KHZA 2FO0A 3VS2A 4D81A 1GKIA 5H70A 3UG7A 3AF1A 2B21A 3MSXA 3FTQA 4Q4HA 4TYQA 1JECA 4QGGA 4DVGA 4Q19A 2IS2A 1AS0A 2IYUA 3GD7A 1LV7A 4JLKA 5BYJA 5HZHA 3S1AA 4NYIQ 1RYFA 1Q0UA 1GWNA 4BE7B 1IN8A 2VRWA 1X2KA 1RRGA 2K79A 4B33A 2LJ3A 2IHBA 2ZUBA 3JVVA 4Q02A 5L3SB 1U06A 5LD2C 2ERYA 2YKGA 2K6DA 2G1KA 2NO6A 3U2QA 2D4HA 4K46A 3AP3A 3IQLA 2OCYC 4JPBW 2XOKA 2ZJAA 3LWNA 2RNAA 3CH5A 1W1FA 1KK2A 1GCQC 1JEDA 4XOIA 3VHXA 2WWYA 4MRSA 1E6GA 1W0JD 4JLVA 2VA8A 2WSSD 3B1ZA 3DL0A 3TJZA 4L15A 5J47A 2BKUA 5KDOA 1ZJ6A 4BZQA 4RFVA 4OHZA 3THWA 1GIAA 4HI0E 4ARZB 2WWWA 3I73A 3BFVA 3W6OA 1XJCA 3VKWA 1YU9A 4Q1BA 1OT3A 5LBIA 3K53A 4FWTA 2IHYA 3R20A 4LHZA 2AR7A 4EFLA 2F3TA 4HLUA 1XNJA 3MJHA 1YNZA 1A2BA 2F1RA 4FI3C 1JNYA 3EZ9A 3HR8A 2UZIR 5GVSA 1FYNA 1L7VC 3A1VA 4UNNA 1UGVA 1WMSA 1D2EA 3ZIAA 3NGPA 5H68A 3KJGA 1QWFA 3BORA 4P4SB 5C4MA 2P65A 4G5QA 1QBKC 4A2WA 1UDWA 1Z2AA 3WXMA 1US8B 2OCAA 4CZ2A 1OH8A 1CR2A 1J90A 3LLUA 4F17A 2ZRNA 2EBPA 1N2CE 3OZXA 3CBQA 3GLHA 1S96A 1GL6A 4OQXA 4NZYA 3KB2A 1CSKA 1DG1G 1NIPA 4BLTA 1W36D 1JR6A 2JASA 2WV9A 2BBSA 3DOFA 3IEUA 3FMOB 4PO8A 1G16A 2J7PA 4DLWA 2C0IA 2WAXA 3N2EA 1Z47A 3IDQA 2L3QA 1ZUHA 1XD8A 3ZZUA 2L0XA 1II9A 2VYFA 2JXBA 2DFTA 3B9PA 4CYMA 3LFUA 2YOFA 3SR0A 1BMFA 2KROA 3Q8XB 2R2AA 4LGMA 1V5WA 2GZHA 5E7MA 3EARA 3GJ0A 3IHWA 4JLOA 2EFHB 4CT4B 4FCTA 5B2ZA 2J59A 2D0NA 1ZLMA 3RNJA 4LYHA 4M9ZA 5B58C 1SXJB 4G1UC 1Q1BA 3SDZA 1MKYA 3U3JA 2VPPA 5CYOA 4TYYA 3IIJA 2BVNA 4AIIA 1GBRA 1QHHB 2ZE7A 3I72A 4EPTA 2XZLA 1ZIPA 1IAQA 2GJKA 2JA1A 4Z1MD 5TVKA 4PHTA 3P1JA 3IQXA 1XPRA 3VAAA 5DHAA 5FL7A 2A30A 4JYCA 5FWBA 4C0JA 1M2OB 4RTYA 4P3YA 4B3BA 2OXCA 2AD5A 4MH0R 4Q1AA 5GJWC 1R7RA 4Q4AA 2RGNA 5TB5A 4D26A 1NY6A 2FF7A 1GP2A 2Q0HA 5EE3A 3BRWD 4LK2A 1DPFA 4GOJA 4I99A 1G18A 5I11A 1JEGA 2VH5R 1NLFA 5DISB 3RS2A 1G5PA 3EZ6A 3VTKA 3W6NA 5IF9A 3CZQA 2NUZA 4OI1A 2F1IA 1LB1B 2QTVB 4ZO4A 5F2EA 4NYMQ 3MD0A 1AVZC 3EIHA 3R8FA 1T8UA 2W00A 2QT1A 2AZVA 3E5HA 4DUGA 2BV3A 3ZYCA 4ZDJA 1TADA 1II0A 3CNNA 3FMFA 2CT3A 4FMDF 3SOPA 2OZEA 4E09A 4MYCA 4URZR 3QWYA 4ORZA 3CLVA 4V02A 1AQYA 1PLLA 2DL8A 1DG3A 5JZVA 3AKEA 3QXSA 1WXTA 3OEED 2WSMA 3LQQA 2QENA 4DZZA 5KSYA 3GLFA 1D2MA 4GL2A 1KSFX 2AWOA 2K2MA 3TR5A 3VNVA 4LC0A 3TH5A 1AGPA 4TT3D 4DB4A 1Z22A 4BQSA 3GEEA 2J41A 1TMKA 2PX3A 1E0KA 1GL9B 3RRYA 1N5IA 3REBB 1HQCA 1QVAA 4FN5A 3SYLA 3EWAA 1HQYE 2JLQA 4B73A 4ESVA 3N2IA 4IKEA 2KRMA 1R4AA 2ZYTX 3EPHA 1SVSA 2ZI9A 4O2LA 3BJIC 4EPWA 1YR6A 1Z0FA 4V0KA 4K11A 2JDID 1U0LA 4Q1EA 3SN6A 3U7EB 1UECA 1NYGA 1E9DA 4WA7A 4BFZA 2RGCA 1HY3A 4POAA 2LZ6B 3D7MA 2Z4SA 1QKWA 1AK2A 5K8IA 3W6PA 3SHWA 2CJWB 4U02A 4C0AC 3D3QA 1EFNA 1IQPA 1E9FA 3VS7A 2CMKA 1B23P 1LNZA 721PA 2HJVA 3MMPA 1T91A 2DBMA 2C95A 2ZSFA 3PEUA 4LHVA 5FFMA 3VU9B 2ENMA 2XXAA 2YC4C 1S1CA 2JAQA 1YR7A 4IEIA 2AK2A 4MYUA 5DHFA 3PUZA 4Z89A 1OHHA 3T1OA 2YUOA 2F2VA 2FGJA 2IYTA 3F5FA 2HCBA 3LVQE 3PQCA 1YR9A 4KODA 1K5DA 3I35A 1JALA 3K0FA 4QBIA 2CLSA 3FB4A 2LMJA 4RD4A 4TL7A 4B3DA 4B76A 4DLZA 2V9PA 1BK2A 2N42A 3UA7A 1E2QA 5AUNB 1FUUA 1QDEA 3WYFA 1J8YF 4D4LA 2BWJA 5AJWA 4J9IA 4Q03A 2FSFA 3GLIB 2NMVA 3FGNA 1M1YE 3KQUA 2EYUA 2IYXA 1VHTA 1X8KA 2B86A 1BMFD 1MRNA 4D4JA 3TIFA 2QUZA 1XD2A 2V7QA 2QE7D 1DO2A 3U4QB 5FUXA 3P4XA 3U44B 1OB2A 1U94A 1G3MA 4JVSB 4EPVA 2H8HA 2QN6A 2F43B 2VO1A 3OEHA 3GLHB 4JBYA 4MGKR 4JBXA 2AK3A 3Q72A 2QGZA 1NIJA 1JPNA 2WKRA 4A2PA 1SXJD 2ZRIA 4CEJB 5LB4A 1UE9A 4A0RA 4Q1FA 2JTEA 4PC3A 3JVUA 1UKVY 1OE0A 2P0EA 1AWOA 2CH4W 4CC7A 2J0QA 1KHTA 1AEYA 2Q3MA 2GJ8A 3PUVA 4LBWA 4M4ZA 3Q5DA 4NYIR 1Z9ZA 3IBYA 4A1FA 3L43A 1I4DD 3ZLJA 2ZI3A 2VHCA 4XSHA 1RUWA 3OIUA 1G20E 2ZVPX 4B2PA 3U3OA 1TX4B 2ODWA 4E03A 4QNRA 1R8QA 2FJUA 2GA8A 2HJGA 1KKMA 1U9IA 4Q1DA 3VKGA 1F3OA 2AK5A 1E2EA 3AVTA 2FWRA 2GBLC 4JL8A 4OK5A 1U9IC 3FPAA 2NZJA 1N5JA 1GL5A 2NPIA 2J87A 4C0BA 3CR8A 3W3AA 2WJHA 1G7CA 3KUCA 1TQDA 5BN5A 3X1DA 1W0KD 4RD0A 2A5FA 3DKPA 4Z8YA 3G0HA 2JLZA 3NTUA 1IBRA 4DUGD 5C2JB 2B7BA 4BLRA 2CL0X 2JJ1D 2FGKA 1RVDA 1F2UA 5KUTA 3THWB 1F6BA 1ZVQA 2WOJA 3D31A 1NBMA 1WDTA 2RF0A 5FOTA 2ZXUA 1IN7A 1CU1A 4PC2A 3KX2A 3PUXA 3RANA 1X86B 5E4FA 3WYGA 4HVVA 3K9NA 5JJLA 1FQJA 1P72A 2YSQA 2EFDB 2P2LA 3DEFA 4PXAA 4DIDA 1CJMA 2CXXA 1Z0KA 2PEZA 4TYPA 1CR1A 3N70A 4FD2A 4JLBA 4TQUS 2EGCA 3CQTA 1AS3A 4HAUA 3CWQA 3ICEA 3KQKA 1XCMA 3P27A 2H8KA 2ZJZA 1JR3A 2RQTA 1YKSA 5BN3A 2QAJA 3HU1A 5SZJA 2WICA 2EFGA 3FMIA 1O87A 3EW9A 4RKEA 5FUWA 1G41A 4QGFA 4I1SA 1DTSA 4P0TA 4C0HA 5KSOA 2SEMA 5D3MB 4OMQA 3GLGE 4F16A 2OE2A 2ZSAA 4YONB 4IHQA 1OFIA 3T12A 1NMXA 3IPYA 2D2EA 3MWYW 4RTZA 1GTVA 4HDCA 3KJIA 4DKXA 3EC2A 3I1FA 2ANBA 5IRCD 2X8AA 3EG3A 5HTKA 2IYQA 3P20A 4W9MC 1L8QA 3AVWA 4TLBA 3BB1A 3E70C 2RMOA 4FW9A 2VHTA 3GPLA 2ZRBA 3LXRA 4GNKA 1WI7A 4QHSA 2D8JA 1JXOA 3NDPA 2FX3A 2V1RA 4YXWA 3THYB 1OW3B 2G88A 4C2TA 1NSFA 3B9QA 1YQTA 1TEXA 2QAGC 1N6IA 5EQTA 1LS6A 2FPFA 2KXDA 2EYWA 1LVGA 1H8HD 2X3WD 2IYWA 3OHMA 1WP9A 4KU4A 4UJ3A 4EPXA 2XOKD 3KZ1E 2I1VB 4NONA 2BCGY 3KL4A 1E9EA 3K1JA 1CRQA 1PNJA 1XMSA 3F0TA 4KYUA 1NM7A 3REAB 4A8JA 1G7SA 1OYYA 2QROA 1DARA 2ZRCA 1NL3A 3DZ8A 4G01B 2CCKA 2V7QD 4LJ4A 5DI9A 1WYXA 2WM9B 3FDIA 4IDNA 1J8MF 2QRNA 2ZRDA 1WX6A 4DCSA 1T3HA 1Z6XA 3UATA 1BKDR 4JJBA 1ZINA 3MGCA 4C7OA 3QF4A 4F14A 2ECZA 3EG1A 4L8GA 3AVOA 4KFTA 1WF3A 3RS7A 3I62A 4OHYA 1AZGB 1OV3A 1G4AE 2IYRA 2P3SA 1Q57A 5B30A 1VYUA 1HURA 1XOVA 1NF3A 1TNDA 4DCTA 3LQRA 3TVTA 4HDOB 3FFAA 4D0GA 2G3YA 4M9SA 3MFYA 2R8RA 1E32A 2YDLA 2OEPA 3RRNA 4EPRA 5A5GA 2DL5A 1VYVA 2W2XA 3QY0A 4D4KA 3NH6A 2QRZA 3THXB 3QSYA 3TAUA 3VR5A 1B0UA 2HDNB 2WHXA 4OQFA 1SXJA 2REOA 1TPZA 1KK0A 2DA9A 2RGAA 1E7OA 2GBQA 4RUGA 4M8NE 5CLQA 4BFWA 4WZ6A 2P67A 4OI0A 1M27C 2Z6VA 4PO1A 3QEOA 4ZDWA 2QORA 1G9XA 5TARA 5I22A 1OH5A 3FHTA 1GNPA 5FTKA 2A9KA 3RWMB 4ZI2A 3SHFA 3DHWC 1X6VA 3BBPA 2OLKA 2XZOA 5G40A 3L8YA 4M1OA 4EJSA 2W58A 1I0CA 3THKA 2V55B 2DM1A 5HE8A 2WSSA 4JJZA 4UJ5A 2QQ0A 2HF9A 2WOOA 3FHOA 4OBEA 5EUQB 5TV2A 4HCKA 2TMKA 4F4JA 3CONA 4OQNA 3D8BA 3LY5A 4RD3A 1FQKA 1ETUA 3SJCA 3PUWA 2ONJA 3BFXA 3TSZA 1WXUA 5ECAA 2OFWA 1Q12A 4CC3A 4LBZA 4C0QC 3TLXA 1ABQA 2IA5A 2XX3A 2YHSA 3GLFB 3AVXA 3GLGA 2KRSA 1CR0A 3GJ6A 5L3SA 4IIMA 2PZEA 4N3NA 5JS8A 4AURA 4AYXA 1XBTA 1XMVA 2ODBA 2W6JA 4FMCF 1CR4A 4FMDB 5EUMA 2W2VA 2FE4A 2PEYA 5IHPA 1W4RA 2EYZA 1G3RA 3VX3A 2PMDA 4LRWA 1JQJC 3ZIAD 3CR7A 1DADA 1E2DA 3FE2A 4D82A 1PZNA 3M6AA 4F38A 5JSZA 1TU4A 3PVQA 4FSSA 4G0NA 2DE0X 3NIBA 3OE7D 4E07A 2D06A 2WIBA 5D3QA 4ASUD 1X8LA 2G0TA 3ZVNA 3SJBA 2DB3A 4W5JA 1K8RA 1G3IA 2IUSA 1YP5A 1HT1E 2LQNA 2ZRGA 2BEKA 3B60A 3OAAD 2MMCA 1G64A 3GFTA 4ZKDA 5AJZA 3U7FB 1WB9A 1A4RA 4XWAA 3RRZA 2Q3FA 3ASZA 3CW2A 4KSCA 4RKFA 1RLQC 4XVUA 4LUDA 1UKEA 2VKNA 1AIPA 4GPTA 2GEVA 2J0SA 3P32A 4BRWA 1FP6A 3RS0A 4Q5IA 3CX8A 1DAEA 1XMIA 2JEOA 3UWKA 3CF0A 2GXSA 3C0CA 1JXMA 4XSGA 2ABLA 2RPNA 2GXQA 3C15C 2SRCA 4WXRA 1KJZA 1MR3F 1Z9QA 1U98A 5JLJA 4NU0A 3V4RA 4QC2A 3UF4A 2NPFA 3CRQA 4LYJA 4DLVA 1EFRD 1E6CA 5KYKA 4RTUA 4WXPA 2CE7A 2FEMA 1TG0A 2EYQA 5SZHB 3I5RA 1UADA 1S9HA 1GRQA 5E95A 4URWR 4ZIRB 2BDTA 3HWSA 4DB2A 1SVKA 1IJFA 3QBVA 5AJYA 1FNNA 3ZD7A 4V03A 1E99A 2GK6A 1N0VC 2K9GA 2QQEA 1YZQA 1KDRA 3O8BA 3B1VA 2ZI7A 3E1SA 4RVCA 4GZMA 2CCJA 4M2LA 4DHEA 4GMDA 4Z1MA 1SZPA 2BM0A 3ZQ6A 1HSQA 5HKKA 1Z6TA 1ZC4A 3LBNA 4XIGS 2DWQA 2REXB 5BW8A 4Q47A 2IUUA 1RW4A 5DO9A 1FW6A 4LN2A 4OMMA 4B3GA 4DRZA 1UJYA 4AYTA 1GKUB 3IKJA 1KI3A 2C9CA 1MV5A 2ZRJA 3Q85A 3WNDA 4AFUC 2B92A 1GRIA 2GF9A 3BC1A 1XXHB 1AD5A 1NN1A 1TQ6A 3EG0A 5C1BA 1EWQA 1W2GA 2HLDA 2Z0MA 1NLOC 2D2FA 3A1WA 4F4CA 2OAP1 2CEAA 2ORWA 4QM6A 3KXLA 2EYYA 2VEDA 4HZIA 5DH9A 4B48A 2XJ9A 1E2HA 1Y0MA 2H7VA 621PA 4GP7A 2FA9A 1OIWA 3LX5A 2EU8A 3UMFA 3NMZC 2I0NA 4TMTA 1OF1A 3E2IA 2V8OA 4C4PA 4NCJA 4A6PA 1ONBA 3NKVA 1VG8A 2BZYA 4EFMA 5BN4A 4J9CA 2KNBB 4OI4A 1NEGA 2GEUA 3UANA 3C5CA 3H1TA 3MWLA 4B2IA 3LBHA 5K8UA 2C77A 4OHVA 1KSWA 3CPHA 3LO5A 2PLFA 1KZGB 1NLYA 2HEQA 4G5GA 4ITRC 5J5CA 821PA 1KY3A 2BM1A 1W4CA 4AKIA 4Q4AB 3ZH9B 4TZ6A 3BIFA 2OFXA 3WRYC 1FPMA 3L0PA 3RC3A 1XWIA 3WMGA 3BXZA 2XZPA 2J46A 1C1YA 2H17A 2RMKA 4B71A 5EP2A 4DLRA 4ZCLA 3HU2A 1RFLA 2IL1A 3HYRA 5JRJA 3RS5A 2ZQ5A 3NBFA 2DL4A 1D6JA 4TLAA 1S1MA 1MO3A 1FUKA 3VRYA 3QXJA 4URXR 2WMOB 2JJ8A 5IXBA 1FNMA 3GLIA 3U4QA 1FFHA 1ZC3A 2QGNA 2WKQA 4C0SA 4M1TA 3K70C 5EXPA 3QNUA 2JM8A 3GFPA 4Q9IA 4X8MA 1GNQA 3VS1A 1D9ZA 2EW3A 4NCKA 1PHTA 1BU1A 2BCJQ 4FWIB 1R0XA 3NEYA 1KAOA 4KXFB 1ZRHA 5FUYA 2OI3A 2VSXA 2V6IA 2VP6A 2GRJA 3FVQA 4NL4H 1WDXA 2CDNA 2GVDC 4Z54A 1KI2A 4LDJA 2C2HA 1HD3A 1W0JA 5GADl 2WAYA 3AF3A 4LJ6A 5JJIA 4XTRA 2JT4A 4KFSA 2W0SA 4BEBA 3SBEA 1R0YA 4XJXA 4CC2A 2O8EA 4A2QA 1W4AA 4DDTA 2FFQA 2OFOA 2B8WA 4M4SA 4XWOA 2B6HA 1HH4A 5FW9A 2E87A 1RJ9A 1TL7C 1DAIA 2RQWA 1G3QA 3U6KA 4NP6A 1W36C 2CL7X 2HSPA 2F43A 2NG1A 1P75A 2M51A 1GM5A 2GCNA
chains in the Genus database with same CATH superfamily
2R66A 4ZODA 4KGVA 4UDYX 1OWMA 2BIFA 3C6MA 3Q8KA 3Q41A 4MB2A 4W9NC 3AX6A 3CC8A 3THOA 2UUBB 2PTKA 2JJ1A 2ZYUX 5KCHA 4OSOA 4DIFA 2NAPA 5HILA 2F62A 5KTSA 2YVKA 1PJQA 1NNEA 2OTLT 4LDPA 4RIIA 4CDMA 3LCMA 3PEEA 1HYOA 3RRMA 4X1IA 5EP1A 1B7GO 5CBKA 5I5EA 1H65A 1GU7A 2H65A 4LOKA 4B81A 4G8BA 3REQA 1FU4A 4XU3A 1U2ZA 1YHQT 2OD7A 4HAYA 4L0CA 4AN4A 4Z7NB 2ZZMA 5AI6A 3RYHA 1LRKA 3SHOA 1ZN9A 1GHTA 3P2MA 5ELMA 3VZCA 4V1CI 1MCZA 3ZBDA 2ZRFA 3KYBA 1Y37A 1H8EA 2NTEA 4LTDA 2ZCVA 1U7PA 2WKPA 4PC1A 3MB5A 1KF0A 1FJHA 2ERCA 2R86A 4B2LA 5JS2A 2IH4A 2QRHA 4ZVQA 2ZE5A 4LV6A 4Z88A 1BX1A 2XITA 1CVRA 4MWCA 4HXGA 2OBFA 1WCYA 1KG1A 3NBMA 2OV8A 4BU1A 1ZMXA 1IULA 4PC6A 3AINA 1ZXXA 4DW8A 1RKVA 3I61A 2LJ0A 1EA7A 1BIBA 1X80B 3IAUA 4DMHA 4RFSB 2CUDA 4BHTA 2DLPA 2C4WA 3J81A 1ML3A 1RYHA 2OWDA 8ABPA 3GMTA 3P9NA 3I1YA 1HEYA 2O5RA 2Z09A 2VF8A 2CZQA 5EKTA 1EX4A 4FBMA 2JIOA 4OB2B 1TD9A 3OLZA 4JBHA 5CIWA 4CKYA 2W98A 3R0IA 2JFZA 3AIMA 3BIJA 4WZAE 4JP5A 5EIAA 4UC4A 3OTHA 5FRNA 2XMGA 2QXYA 1JEAA 1M9NA 3M53A 2GM3A 3HP9A 1BWQA 3E7FA 4Q9NA 2G4VA 3SQNA 2F5TX 3R24A 3VR1A 2VBCA 3K2QA 4F3NA 2ERXA 4D8KA 1PG5B 1HMPA 3K0FB 4C20A 4E5SA 3KUUA 1X15A 3R8CA 1C14A 4O5OA 5CO7A 3DOCA 1G1MA 2A9RA 5DGHA 1HBJA 4E2FA 1VP3A 4EGJA 5CDHA 4IUUA 3C74A 3DULA 4OBWA 5JAMA 1YZNA 4X93A 4C30A 5JISA 3O74A 3SYMA 2H4JA 1SIUA 3IERA 3R5TA 4YRIA 1L5SA 1C5KA 4FFMA 2DPHA 2YT6A 2D5IA 2PN1A 1UOOA 4BZWA 5GJCA 1I3OA 4NMXB 1SAYA 2PGNA 3NANA 4E7LA 1HDZA 1O7JA 3LT4A 4H7KA 1Y6RA 3V1KA 1P7ZA 2K6GA 1F8UA 2DWUA 4ZRNA 1OPLA 1ZCZA 4D0LB 1UF9A 2IZ6A 5K4GA 1TZ2A 2CFRA 2LVBA 1VQ6T 2A7QA 4FT4A 1P6XA 1GXIE 2BFBA 4MWBA 2V03A 2O3RA 4CLEA 2GF0A 1O95C 3DTTA 4N18A 5IBRA 4KR9A 3REQB 4XRGA 5ENZA 3I9NA 3VPGA 4NI5A 5JROA 1IBKB 1WUKS 1TMYA 2I2AA 1BEEA 5DLPA 1FRZA 1UXJA 2GFIA 2GILA 2NLOA 1CV2A 1TQ4A 3KQLA 3TD2A 2UAGA 5KCZA 2QZ9A 4FW8A 2IODA 3H4TA 3KQNA 4ZREA 4GXTA 2J30A 2BE9A 2M0YA 1NKTA 2V9ZA 3CCMT 2E6NA 2Y1WA 3F6EX 4PG4A 1TYCA 3F46A 1ZNXA 3PT5A 4K6FA 3V7NA 1KO5A 1QKIA 1XF1A 4KX3A 2ZSDA 1UMCA 2XMFA 1XZKA 2CXUA 1DJMA 3HFJA 3R74A 1YZKA 1E1RA 2WQ7A 1JN0A 1Z8FA 4NBWA 1VYHA 2Y05A 2NYSA 4DC1A 1DUSA 1NJIC 1UJ2A 1UZAA 4U4AA 4C0GA 2FVYA 3AIIA 1H6AA 3L2OB 3QKTA 4OSPA 4YCAA 2RH2A 5CVDA 5D87A 5EXSA 2P2GA 5L3VA 1PU2A 2Y2UA 4YMTA 1FE8A 1T2DA 1J8FA 3A1CA 2OUIA 5HIJA 1XQWA 5T64A 1LBSA 4BFXA 1ZM9A 4YA6A 4QUGA 1EIWA 5ALMA 5CYPA 4ZV7A 1T8YA 3RHFA 2JW4A 1M54A 4Y6LA 1Y5LA 1W0CA 4QRDA 1A98A 5CYGA 1C1DB 1NGSA 4J3NA 2C57A 3H1AA 4IVQA 3COVA 4X1KB 3TB6A 3V55A 3WL3A 1IVSA 4CKZA 1C0LA 1BYUA 2YWRA 2CYCA 4BNDA 3IT0A 3LH5A 1UZUA 1AG9A 3IMGA 1R9MA 1YZVA 3GX1A 3Q3GE 4B6FA 1TO6A 2C0OA 3RERA 4U8HA 2QUAA 5M2QA 3G0BA 2DHQA 3BQMB 3NCHA 1NTOA 2CYAA 4ND1A 3ZDBA 3A3KA 4GVLA 2D59A 5DE3A 5I4KA 2XQKA 3ETEA 1S2MA 3FWYA 2H1LA 2IXFA 3BJMA 4U2GA 1ORRA 5E1BA 4UNQA 1SKYE 3GNSA 3ENWA 2BFMA 2Q1XA 3HP4A 3LFTA 1J0AA 4J7CA 1ZI6A 4RENA 5B7NA 3JQ9A 5CLIA 2QL7A 1NJ1A 4KXWA 3NG1A 1UAYA 2ZU0C 5E6SA 4KKXB 5LMZA 1VMEA 2KXCA 5IYZF 1RIIA 5FJJA 4LTMA 4MAAA 5BSWA 2C5AA 4MLDA 3TQCA 4CTNA 1Y3BE 4OXQA 5CA1A 3Q6MA 1C0EA 1R0WA 3OYBA 4IF4A 1XMJA 5EMNA 1DDIA 3AEKB 3TSAA 1S8AA 2AF3C 4G67A 4NULA 4US0R 3CUYA 4M0KA 4LNPA 4GLMA 3ILSA 3RGWS 4B47A 4E7OA 1T2NA 1JEEA 3DO6A 4OA8A 4AQDA 5EGSA 4K8OA 1T5TA 2V54A 3M56A 4J16A 1JDUA 5EKSA 4FDLA 5IH2A 5F3RA 2IY8A 3VDRA 3G7ZA 3I55T 4BVGA 4X60A 3U17A 4YUYA 4FONA 4C4AA 3AFHA 1ZRSA 1D1CA 2CP7A 3S5JA 2R8YA 3C8ZA 1JH8A 2GQ0A 1HDXA 1DLJA 3F8WA 3GCZA 3H9BA 4N03A 1E77A 1Q82R 1PVDA 1JQBA 2DTEA 4JGGA 4H18A 4RKUE 1ODKA 3GP8A 1WQWA 3LWHA 3W79A 3PGMA 5ITWA 2NTNA 2E49A 2EQ5A 1M9SA 4D3SA 1TT7A 1AD2A 2G1AA 1QIHA 3UHAA 2HV8A 3GFFA 1OPKA 3HI6A 1RACB 3R0QA 2H92A 4FCWA 3WQQA 3CEPB 1I7LA 3ZU6A 4AO7A 5A5VA 2IYPA 1K0XA 4W82A 1SU8A 4IVRA 2J1LA 2LDXA 5J26A 3ZWQA 4A36A 3IP9A 1JKMA 2QLFA 3LK7A 3FC3A 3R7FA 3UT0A 5F5LA 1F4LA 5KTYA 4LYAA 1DIHA 3QENA 1OXTA 3OJ0A 2PMFA 3QWFA 4TWRA 4J76A 3WL7A 3WYNA 1R2QA 4WACA 4YAFA 4PJOB 3CC4Q 1QHIA 5DN6A 3WTBA 4AS1A 4LNHA 1U8FO 5FOWA 1TUGB 1EHIA 1L6IA 3BGVA 4MLPA 2V0CA 1AO3A 3SZUA 2ECOA 4EJSC 1Y4AE 4ME7A 4CUJA 4BNHA 3EYAA 4HYYA 1Z4JA 2DQZA 3EMVA 1X70A 4QELA 1ODFA 4RX1A 3FROA 4RSGA 1G6Q1 1I4TD 3KKMA 4BAGA 4WN9B 2R8ZA 3T5BA 4CEIA 2Y68A 4Z6KA 3DKIA 1HR0B 5IC6A 3ZDRA 5GAMg 4GI5A 2EGGA 4IKOA 1DX6A 5GAOm 4BL5A 4MIYA 3CRRA 4BTEA 4RZSA 4ZXPA 4QOGA 3UFXA 3LT0A 5FWCA 1SQSA 2V8BA 3PX2A 3R0VA 2AXNA 3E61A 1T25A 5I8ZA 5FADA 4ARZA 1Y71A 3FGOA 3S3OA 4E2FB 2OHHA 1E64A 4FWBA 1IVNA 1CZLA 3HNPA 4PQFA 5JDCC 4DDWA 1YVEI 2P6NA 2PT6A 3O8RA 4B3RB 4D0SA 5L40A 2HCFA 1YAJA 3CJTA 2VN8A 5IJ9A 2OGWA 1DAMA 3A26A 2GM4A 5A02A 3IDZA 5G3ZA 3ZK9A 4DBZA 6AT1B 3G2JA 3LO8A 1UPCA 2CP3A 2CLCX 4S05A 2XB4A 3DOJA 3H5WA 4RDXA 2WFLB 3ZE2B 2DEQA 2IYAA 1C9NA 2W4QA 2QAGB 3ZH2A 5CM9C 2X77A 1RXCA 3PJGA 4NBSA 3STVA 3WWCA 3MP6A 2V45A 2BGMA 2P3LA 2XUFA 1E2NA 3KB1A 4NTZA 2X0FA 5HRAA 3DBHA 1EYZA 3E9MA 2CV2A 4AFZC 1NQAO 1MOQA 4OGCA 1YITT 1QGUA 2R44A 3CW8X 3MUNA 4IICA 5KOJB 3MZ0A 1CIJA 2XOXA 1EG7A 5I3ZA 3D3WA 4HWRA 1QIIA 5E8RA 3R9WA 4X66B 4A91A 1AXEA 4W7HA 1APBA 2PXXA 1M6VB 1NRJB 4EITA 2DH6A 4H60A 1XNRB 2WJVA 3N76A 2JKVA 1OIVA 3ILXA 3S8YA 4JJIA 2IZ0A 4KO8A 2BFDA 4OM7A 1NUHA 4AUKA 4ZP1A 5J47A 1NG9A 4NABA 4PZUA 3LU1A 3JASB 4U6SA 2R751 5AW6A 3KQHA 4C7JA 1NM5A 1SO8A 4TKVA 2GPBA 4DILA 3GT0A 2EQKA 1RC1A 3H13A 4X54A 3WJ2A 2BD0A 1G55A 2UZ4A 3DDHA 1ZONA 4TKLA 3CCSA 3RS9A 3C14C 3F71A 1ZJWA 2G9UA 4YAKA 1A82A 3JD3A 4Q9KA 5FD8A 1UWKA 2GAJA 4NS1A 5DT9A 4D4GA 1A9XA 4CLRB 4BGUA 1O94C 2AFIB 2ZKIA 4II2A 4LDNA 4YMUA 2K7FA 3M6WA 1TEZA 2HN9A 1N36B 3ZWPA 5GOZA 4WLVA 2W2OA 2L5QA 3EGIA 4M1WA 3VR3A 4LUEA 3L1AA 2DL3A 3VX4A 2H1WA 4QOIA 4A3SA 1WNFA 5FNVA 3PF9A 1OD6A 1GCOA 4PZ9A 1QPGA 3MAAC 8OHMA 1AK9A 1EFPB 3JQRA 3HB1A 5FHQA 5IXSA 3JCMW 1VGVA 5GIOE 1BKSB 5FOVA 2W0ZA 1WVGA 2W8BB 4X1YB 3NOXA 2ZJBA 1AGRA 3S40A 4WLFA 1RWOA 7ADHA 2DUJA 1CVLA 1TO2E 2QW0X 1PKEA 2QAIA 4WD3A 4DOMA 1HO3A 3B8HA 3PG5A 2FG5A 4GWGA 3UY4A 2C88A 4ZEMA 2EW2A 1RAGB 4WOJA 2JIZA 5H8WA 2WT4A 4X85A 2GCOB 4IUQA 1Y3AA 1JHPA 4MCIA 2CFCA 4TMYA 2TSYB 5DM70 3VOTA 1I5OA 3ZD6A 1Z5WA 3UJNA 1NN0A 1P92A 1X7WB 1L5QA 3DV0B 2FI1A 1UBEA 3JSXA 2QG4A 4M77E 3L7DA 4FDUA 4MQ4A 1YRLA 1XZJA 2QN2A 1NW9B 1FUEA 1J9ZA 3OE5A 3AY6A 3OIVA 3ZNNA 4BS9A 3P9RA 1XYGA 2H16A 2IOQA 3TRKA 2OCBA 1TGVA 1RYDA 1ORVA 2VAWA 3UXMA 1IXSB 4YJDA 4O4LB 1Q7YC 1QHXA 5A9TA 2AG5A 4J0QA 2I03A 2Z8XA 4OYLA 4JU8A 2G9NA 1G0NA 3O8NA 1S2IA 3RSZA 1GNSA 2A0XA 4PZPA 3PRKE 1XGKA 4QTUB 1ULUA 1C9DB 5KVCA 2O8DA 4UXIA 3LRXA 4BMXA 2VV5A 4L5BA 1SBYA 3HPRA 3OQVA 1SVOA 2O2OA 3PXBA 5EI5A 5F3DA 1ONPA 1IGQA 1SHZA 5C8YA 5A7GA 3ZHTA 1I2CA 4HQ0A 5AW9A 4ABYA 3FA2A 1EUQA 1WBDA 3BICA 4D42A 4HGOA 3N28A 5BP7A 4QYIA 4IDHA 4TSRA 1E18A 3KQVA 3MW8A 2FPDA 1CDZA 4MVJD 4QASA 3RS4A 4BLPA 5JJKA 4MQBA 2PO7A 4K8RB 1NPTO 2I3GA 4WZBE 1WPXA 5LU8A 4R9VA 1GR1A 3A1UA 2OCLA 3EXFB 1VQNQ 1MOZA 2RH4A 2RJOA 4DIKA 2P79A 1KEKA 4KXXA 2BLNA 3KJZA 5K45A 3U49A 4UOQA 3KTFA 1L5OA 1T4CA 1XXLA 1TA4A 4HFJA 1IQUA 1Q20A 4UCFA 3ZDEA 5LMNB 4KO1S 1NVXQ 1VQOQ 2JNGA 1QE5A 1WKVA 3DOEA 2I2BA 2FL7A 2QPOA 3II6X 1W29A 1FFAA 4WX2B 4Z2AA 3PC4A 1ZRMA 3M0TA 1PL6A 4JR2A 4M7AG 4P4SA 3WNBA 4L22A 2ORVA 1NI5A 1O97C 4MGEA 1AJEA 4EABA 1YJXA 2VK8A 4CXMA 5DSZA 1W1UA 2QUKA 3DWGA 4NFYA 4O3FA 4P4NA 3CLTD 2GAIA 4B43A 5IK2D 4K9SA 3AXTA 2E4YA 1I0LA 5KVAA 1KYXA 4ZJZA 3UCFA 1N2HA 4YDSA 4D46A 3CZAA 5JXGA 3JQPA 2FN9A 1SD1A 5FLXE 3HXOA 2C2ZA 4IIYA 4P5DA 1DQPA 1P74A 3F7OA 4FDAA 1G7RA 1PSDA 4ZYTA 5B2EA 3O75A 3PHHA 2B99A 3EG5A 3OVMA 1FMKA 4NMWA 3ZCVA 1RAGA 2BRUC 4X20A 2JAWA 1GPWB 3KTOA 4EVIA 1TTTA 3K71B 4KC0A 2Q9AA 3SLRA 1DELA 2F8MA 4U7HA 1M7HA 4R0NA 1QG0A 4PAMA 2WY2D 5LNK1 1Q14A 4LWZA 4ZD6A 2OWEA 3JAME 4BO7A 5HCUA 5CX4A 4MW4A 2D1XA 3CCLT 3AF5A 4C92D 2JVIA 2XZDA 1JIJA 1KMCA 2FUCA 2GA9A 3DZDA 4KE9A 4R0KA 4MQFB 2DMOA 4C06A 1IY1A 3H2YA 1NPRA 1JVSA 2W6PA 3CBPA 1M7GA 1WDWB 4O59O 2VQFB 1D4FA 3RFUA 1IONA 5J1TB 1BS9A 2FZ4A 4BZZA 4XM0A 4EY4A 4DR7B 4CR8A 5A0GA 1SUAA 1RQRA 3QVKA 1WXEA 5J4HA 1VI2A 4BUJA 2A28A 2E5WA 4LJ7A 5LUAA 3AT1B 3QLUA 2GLXA 2DQKA 4HWSA 4M1ZA 2KB0A 3BYZA 3EGEA 3QYHB 3I2HA 2E4UA 4Y91A 3ETNA 4KVZA 1I2ZA 1RM5A 1Z8NA 2EVWX 1N5KA 4DYVA 4R1QA 3LNCA 2YXDA 3ASYA 4YMSA 3GXOA 4CMIB 4CODB 4KUIA 1EX9A 1H22A 3V4FA 4FGLA 3O8VA 1ZG3A 4WZBB 1PR6A 1U2GA 2DSNA 5JARA 3T7RA 1JU9A 1KJ8A 1ZIXA 2ZT5A 3GJQA 4ZAZA 2XF2A 1JTEA 3AVPA 4ER3A 3L79A 4EG0A 1FMVA 1Q81R 3FMVA 3L0SA 3WJ1A 1O0SA 5IKPA 4MQEA 2NADA 4D9EA 1I3NA 4KL8S 2EAUA 2DXTA 5CKHA 1OGYA 2Z5LA 5EIOA 3WDSA 2XUIA 3CVOA 4M22A 3TQOA 4X41A 2AZSA 2HR1A 1K9MR 4A6DA 5KIAA 1L4YA 2XUHA 4MX8A 1HKUA 4U1RA 3VFDA 1P2UA 4P3KA 3TBKA 1IHOA 1EE1A 3PA8A 4QYMA 1X39A 1Y6QA 4O33A 2HNAA 3S1LA 3WJAA 2I2FA 4EI7A 3IAHA 4YDRA 5BMVB 1Y63A 2VWPA 1HWYA 1WXWA 3QKRB 5I4IA 3B51X 4II1A 1GPBA 4IXNA 4KJZA 3AESA 3T52A 3JQQA 4D3DA 3C98A 1J24A 4ND4A 3AVYA 5LBTA 2LCCA 2C9BA 1QM5A 2XXJA 1YQGA 2FR0A 2Q0SA 1HX7A 5DGTA 1V6AA 3PF8A 1CQIA 1W7AA 3VNUA 1K3TA 2Q6VA 4MI9A 3D43A 4PIMA 3HZOA 2RO0A 1SXJE 2ODPA 4RSMA 5MFZA 3H0FA 5CIQA 2PAAA 3RVLA 2EFIA 5ECGC 4PNOA 1YMQA 3QPUA 2Y1OA 4KI0A 5IT4A 3M54A 1ULBA 7AT1B 2QVGA 4GW3A 4HNUA 1MPXA 1T3LA 2WTMA 4Y28E 3G71Q 2OHIA 3UC5A 1A04A 1NUTA 3M0RA 2CLLB 3SEAA 3JQBC 4PJOF 3CC4A 3OS2A 3GC6A 5INTA 4H4CA 4FIDA 1T4GA 5JC1A 3CF4A 3IDAA 4RCBA 3EVEA 3DWEX 1D1TA 1E2IA 2HQSA 2XUZA 3L0ZA 2WJ3A 5JBQA 3N1UA 1M2NA 3Q7RA 1V1RB 3CVYA 2ZRMA 2GTOA 3OMXA 3UB2A 5LNK6 3MWFA 5KJ1A 1G8KA 2AXEA 1W34A 2DOKA 2JJMA 3ESBA 3DG9A 2YS6A 5C80A 1JQLB 2QE6A 3X20B 4URYR 1ZUD1 4LC9A 4Z3KA 5M7EA 3MRSA 1M5RA 2MSCB 1JWLA 2QTHA 1GUYA 3HJHA 1TXGA 4KZKA 3RSFA 1TM2A 1DWQA 3M1LA 4ZI5A 4LXXA 5K8TA 2X5KO 1AUXA 4UQPA 3U44A 5PGMA 3GLHE 3TQIA 2P40A 3W8NA 4CM1A 1WDLA 2NM0A 1RACA 3H1BA 1B15A 3KKKA 3LTEA 3SD7A 1WLYA 2X76A 5FPSA 4JC5A 3JATB 4DV0B 1FVXA 2V0NA 1T0HB 3ILYA 4MHSA 4YCCA 4ZT5A 16PKA 1PF7E 2G77B 1Z15A 3K5IA 1QCDA 3CD6T 1V3UA 3QVMA 1K6EA 3QOXA 5JPCA 1HXHA 2I4LA 3WGTA 5FUMA 1EZZA 1JSRA 4WFQA 4JJ4A 2KWIA 4WNIA 5FOXA 3PUKA 4IHJB 1XMPA 2C2GA 2L19A 3EDOA 3QPBA 4FGUA 4D5EA 1XU9A 5AXBA 4ZPJA 4X71A 5CH8A 3T7CA 1LC0A 2CMGA 2XBLA 2DBZA 2ZZKA 4Y3UA 4YUAA 4XQEA 4EG5A 3L92A 5CFPA 2FPRA 5C53B 1BHO1 1KJQA 3QXXA 1N3LA 5JCZA 2BN4A 2YNMA 5KE2A 1XVTA 3DMPA 3MWKA 4EDHA 5J3JA 4KB5A 3PE6A 1VIFA 2IYOA 4D9KA 1GRRA 1L7MA 1A9QA 2C2YA 1EM8B 1II8A 2NTJA 1I3CA 4CG3A 1UFVA 1XEXB 2A78A 4GC9A 1MEOA 4GRDA 3V32A 3ZDXB 4EZBA 1LSJA 1XI2A 4N01A 3DBVO 4X5OA 4N0PA 5IKOA 4AF7A 5DCYA 5A0FA 1NKSA 2CUNA 3ELBA 1TTHB 3ZW9A 4AI6A 4H7EA 2JMCA 2ZS8A 4DBRA 3V8PA 4P5PA 3FFXA 4LOLA 5E6UA 1PGPA 2CXHA 4DHWA 1J5EB 1GFWA 4J9GA 1V39A 3GDGA 4MVXA 4R5MA 4Q9DA 5EPOA 4IIOA 4WKNA 4OLAA 4XD2A 2PT5A 3C3MA 1A3CA 4BWGA 4CMGA 1Z83A 3C70A 3L9XA 2PCLA 4DVJA 3COWA 2CSIA 4LZOA 4KIGA 4MJXA 4BLOA 3HADA 4NBUA 2J85A 3QVVA 4Y2JA 4O8ZA 1A27A 3HSSA 1JZSA 2PS3A 2VDOB 3GJ8A 1REQB 2MYTA 1DBRA 1QG2A 2O5VA 3WLAA 2AC2A 2JI8A 4PQEA 4Z7OB 5KYTA 1RPAA 2HYDA 2I54A 3CUTA 2SECE 3PRJA 5JWRA 4DV1B 1RD4A 4R2LA 1ZPDA 4UEWA 4RHFA 5E0OA 3BXEA 2AKLA 3E9FA 1U8EA 3WKDA 3U61B 2RHMA 2G72A 1LD3A 4CC4B 5DVZA 1SVUA 4ZCTA 1D3BA 2IHKA 3B1XA 4PAWA 1COWD 4BB0A 5AM4A 5HS4A 1EGVB 4HS4A 3WHIA 1L5FA 1M3BA 2D3TA 2J3DA 1QP0A 4TM8A 3V1TC 3ELDA 5SICE 5BVHB 3N2GB 3WNZA 4L6V5 1WXDA 1XRNA 1I01A 1JDNA 2VDRB 2H48A 1KQSP 2Q3JA 4QBFA 1LY1A 1WQ1R 3H83A 4P34A 5IDXA 3VUFA 3UT5B 4MI1A 3MRTA 2WWVD 1Z13A 4EQ6B 1PFUA 2FRVA 4YRPA 2ZTSA 3D4OA 3FPJA 5BMVF 3ND8A 2ZIXA 5FI1B 3ONNA 1C3JA 3G5UA 5BR8B 3QPVA 4ZAGA 3SPXA 2IH2A 3ZVLA 2QD1A 3U4IA 4QRIA 2C1EA 3BQ9A 3TTUA 3QXEB 2GEKA 3QBTA 2QLMA 2FY8A 5IU6A 1DXOA 2RK1A 3PD1A 2ZIWB 3D6AA 2DFDA 3HWRA 4KN9S 4HA8A 1YAHA 3S2FA 1J09A 4X6YA 5EJ4A 2XRZA 5DLDA 1W4LA 2L3SA 1OX4A 4PSAA 2H2IA 2NX2A 4N9QA 3LPDA 5DXAA 1QMGA 5GJVB 3FZGA 3H11B 3OFNA 1NBHA 3K9FC 1VPDA 3AWDA 1LLCA 3EX7C 5B1SA 1CUWA 3P71T 3OKPA 4MV3A 3QEJA 4TTVA 5JALA 1WU7A 4H4EA 3CZ9A 3MGGA 2YDYA 2R1TB 3OZIA 4MITA 2J5XA 4TVKA 3VKVA 3SDSA 5HIKA 3L3BA 2HSDA 5CKBA 5FV4A 1AWWA 3AVUA 1G3UA 3L93A 3CNOA 1HOTA 2GBCA 1QS0B 3HKBA 4WAUA 5CJ2A 3WGKA 1XZEA 5ALSA 3VMMA 1GILA 1R37A 3UGKA 1CRZA 2GBIA 4G5YA 3QPWA 1P3JA 1UJMA 3K1AA 4TWBA 2BFCB 3W2FA 1E6WA 2DWPA 3A70A 3CCMA 5F73A 1CR6A 5LJ5d 1GCPA 1QIEA 5KNCH 4RIEA 4QO7A 5AVTA 1LDEA 3SYNA 4YLGA 1SBNE 3CXUA 1WCWA 2SKCA 4JXKA 5DNVA 2E6KA 4BYGA 1X7ZB 4CL8A 4F9TA 1XTJA 2J3HA 2HSJA 3PLNA 1RJGA 1NVVQ 3MWEB 5BORA 1E89A 4XGQA 2HXSA 2VJBA 3KQOA 5AW4A 2OYRA 3TAXA 2FF5A 3P9YA 3ZJYA 4DBLC 4EUFA 1CTQA 2P78A 3H65A 3ZCRA 1XDSA 4L8VA 4KULA 2MYSA 1N5ZA 2WFMA 2RKWA 4D6WA 4OQMA 2JIZD 4DXAA 1BHJA 1CF4A 4G26A 5AI0A 1NXPA 3G2MA 1YVDA 5BW4A 4KN5A 5ILOA 3PGVA 3ABQB 1BO6A 4P2GA 1ZW1A 3CLTC 1ZU4A 1YSCA 2G83A 4FFPA 3KT0A 1GG5A 5DTJA 5CLJA 4MRMA 8MHTA 1S8FA 3X1KA 4M75G 4I1VA 2Z9CA 1CZUA 5AOAA 3EDYA 1OBCA 2HHHB 2AFHB 2YIJA 4LZWA 5GAOn 3BWVA 4J07A 1PLJA 4EB6B 3TEEA 3UWPA 3BW1A 5KJ6A 2O7SA 4F5DA 3QXGA 4REQA 5IZ4A 1G21E 4HZGA 1LZLA 2RHOA 3EFHA 4ZMSA 8AT1A 3OIGA 5C31A 2C0TA 3KO8A 1FVOA 5I01A 3I6MA 3CEAA 3HJBA 2QL9A 1OOTA 2AI3A 1PW5A 2XMDA 2RD2A 2PJUA 2FRDA 5HK0A 2WJJA 1JT2A 2OZVA 5D5QA 1OZ2A 4J9EA 2O52A 3FAZA 2HLHA 3G1WA 1UDXA 3ONEA 3QW4B 2P9TA 3KLBA 3KSRA 3KYDB 4ZOCA 2OBMA 3O2QB 2PZLA 2RJDA 2J5BA 1KDVA 1VDZA 4BO4A 3HXKA 1X2QA 4M75D 4DAEA 4F4UA 1UUFA 3ZGOA 4MUXA 5A6SA 3Q5GA 1EDBA 1WVMA 2OQVA 1NW3A 2WSCE 2HSZA 3DMDA 4GT1A 4LBVA 4Y92A 1JJVA 2GN0A 3V7SA 2PBFA 3NEAA 3QUQA 2Z6QA 2WIDA 1VRWA 2IK8A 5EWMB 5HS6A 1QF9A 4JLWA 3HZHA 1QP4A 5E4JA 1ISMA 1M6YA 3SKYA 5CG1A 3EGXB 1XEXA 2Y1XA 2HWXA 3VTAA 2CDAA 3CPEA 1CUZA 2PBRA 1NKVA 3MTEA 2BONA 3QA9A 1B2LA 1Y8QB 3ORSA 1RQLA 1WHMA 2BP7B 3QUCA 4RD6A 3UAYA 2I33A 4JQSA 3M81A 4BQNA 4MDFA 1SXJC 3T3GA 2PXAA 3CXRA 4BFSA 4G85A 4GOKA 4BFTA 1AKMA 1Y7TA 4B2YA 1A9PA 2XB9A 3CGWA 2HU8A 1GSHA 1A95A 1YQDA 3D3WB 1JG4A 4Z9YA 4E1BA 1YQEA 4EZIA 4C7XA 4UU1A 1KO1A 2B1QA 5A5EA 1T1SA 4LJ9A 1GN8A 1F6DA 1CP3A 2ZJ1A 4GOLD 4MLZA 2JCXA 1T6BY 5IC4A 3VRZA 4I3HA 4URVR 2CMFA 3IUMA 4B87A 2X3FA 1FX0B 3C7CB 5KQLA 1F5SA 3FFBA 4D0NA 1QVFP 4R2IA 5FTJA 1SCBA 2Z0WA 4D8DA 2Q3CA 3G2KA 4C92F 1RVV1 3HRHA 4PLWA 2DL7A 1T15A 2FPLA 4U2CA 4E2WA 4FGZA 4IILA 3QTLA 1DT5A 5HPYB 1QVPA 1P7CA 4OXYA 3MMZA 4KQGA 1TLLA 3FSGA 2RQRA 5H4GA 5IWCA 3CVWA 1XEWX 4HGZA 2J0UA 4KX5A 1UXGA 1S72T 1NSYA 1SM4A 3B6IA 1WHJA 3K94A 1OLOA 4I1IA 4RKQA 3T5CA 1BDMA 1F0NA 1SC1A 3E58A 1EK5A 3OU6A 2W6JD 4NIMA 1MV0B 3OW2P 3IAM1 4M55A 1G83A 4RSHA 2Q8NA 4M60A 4OHXA 5SYAA 3JYPA 1MVNA 4E5YA 3U60B 2NQ8A 4ETMA 4F92B 3EQ7A 1UEIA 2Q8PA 2OSBA 3ABSB 1V4VA 1KXJA 4XX0A 5L3RA 3S2IA 3QE3A 4FHZA 3OE7A 1D2NA 3NWPA 2OO3A 3MTBA 4L0QA 4CLHA 4C78A 4B0PA 1DAGA 1O94D 2NNWB 2XAAA 1XTSA 4MPPA 4OJNA 3PGLA 5FPTA 1SSHA 3IP3A