3TVTA

Structural basis for discs large interaction with pins
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
282
structure length
255
Chain Sequence
SLYVRALFDYDPGLPFKHGDILHVTNASDDEWWQARRVLGIVPSKRRWERKMRAVLSYEAVQRLSINYTRPVIILGPLKDRINDDLISEYPDKFGSCVPHTTRPKREYEVDGRDYHFVSSREQMERDIQNHLFIEAGQYNDNLYGTSVASVREVAEKGKHCILDVSGNAIKRLQVAQLYPVAVFIKPKSVDSVMEMNRRMTEEQAKKTYERAIKMEQEFGEYFTGVVQGDTIEEIYSKVKSMIWSQSGPTIWVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large 1 tumor suppressor protein
publication title Structural basis for Discs Large interaction with Pins
rcsb
source organism Drosophila melanogaster
molecule tags Antitumor protein/protein binding
total genus 78
structure length 255
sequence length 282
ec nomenclature
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3tvtA01
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 3tvtA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3tvtA02
3I8XA 2JMCA 4K81B 4KO8A 3GJ5A 1F2UA 3ZZTA 1W7AA 1NVXQ 1IQPA 3QPWA 1HT2E 1JALA 1SVKA 2PZGA 2XZPA 4AFZC 4KV9A 4AKEA 3LLMA 3P26A 3CIOA 5FBQB 2V55B 3L0OA 2IWRA 2R8RA 3IHWA 1NYFA 1YP5A 1G21E 4TYNA 3IHLA 4LBVA 4P4SB 1D9XA 2SEMA 1V43A 1W5TA 5LB4A 4IVRA 4TLBA 4B2LA 1EWRA 1E6HA 1YQTA 4I81A 1TADA 1P2UA 3FKQA 3EZ7A 2CJWA 4XD7A 4RSGA 3AKDA 1MH1A 1RJ9B 1U8ZA 2HT1A 1QRAA 1NG2A 2CL7X 1E1RD 2J5XA 2PZEA 2ZE8A 3OF5A 2X3XD 3PITA 4M53A 5DGXA 4XWKA 3QEOA 4OI1A 2P5TB 1MV0B 3H1TA 2IC5A 2AFIE 2ZI6A 3QBVA 4BECA 3H41A 3PVQA 1QLYA 4WBSA 3RC3A 4AWXA 1HY3A 1FQKA 2B8WA 3M0PA 4R2IA 3I9QA 2EWWA 1MABA 2Z43A 3CH4B 2YVUA 4L16A 3GCGA 3JVUA 1F3OA 1RPZA 4B3GA 3BAFA 1FUKA 3ZS9A 3GLHE 1ZD8A 4JJBA 2JS0A 1T3HA 3F0TA 3FJ5A 3RWOA 3SJBA 4B6FA 3B1ZA 3AVUA 4RTZA 1P3JA 4L15A 4HB0A 4CEHA 2F9MA 4JLOA 4M9QA 4PC7A 5JFGA 4X8OA 2VHJA 3EZ2A 2VSXA 1Q3TA 3AP2A 3EC2A 3ND8A 4PHGA 2ENMA 1PRMC 3QPVA 3E1SA 5KPJA 3VR2A 2ZRHA 3OZXA 2QTVB 2GTOA 1XMJA 2BJWA 4B75A 1CKAA 2ERYA 2OFOA 4Z1MD 4AYXA 1OPKA 1Z3IX 1Y63A 1M30A 1KI3A 3X2SA 2DNUA 1WLPB 2IUTA 4M9SA 4IDQA 4X8MA 3QQ5A 4NYJR 3NC1C 3MWLA 4OQMA 2EVRA 3C0CA 4QL3A 2ZS7A 1NY6A 4QJ3A 5HCKA 2VEDA 4JZKA 5FTMA 2HF9A 5GJWB 1FFHA 4MYTA 1II8B 3X1ZA 3BD9A 2GK6A 1G3MA 3GEHA 3ICQB 4HI0E 1KYIA 5DN6A 2CK3D 1COWD 3OIYA 4JMPA 4M1MA 3X1XA 4PFSA 1UAAA 3I3SR 4KHZA 4MYUA 1KNQA 1VCNA 4CZ2A 4TZ0A 4Z89A 3DVLA 2JLZA 2HSPA 3AVVA 1T0JA 2XNDD 2R65A 2ERXA 3BH7A 1JQQA 2IUSA 2BHRA 5TY0A 1XTRA 4TLAA 2LX7A 5FOSA 3X1DA 2GF9A 2AKYA 1D2MA 4R0KA 2X77A 4QKQA 5KTYA 4GL2A 3W90A 1A7JA 2CJWB 3UK6A 3G82C 1OIXA 1X6VA 4C0KA 3GFPA 1ZCBA 3PENA 3THYA 1DAEA 3LDAA 2HJGA 4IXMA 1QHXA 4IDOA 3C41J 1KSWA 5JSZA 1CR1A 1BK2A 4J9FA 2NTYC 2W0SA 1LY1A 4PO9A 2QSZA 5AWFC 3RSOA 5EE3A 2DFLA 1ZP6A 4E5UA 2HT6A 2CE2X 1JNYA 1FTNA 2P6UA 1LW7A 1OLOA 5CIWA 4RTYA 4KVGA 3FKSA 2V8OA 1LVGA 1TQDA 1EFNA 2IYQA 1R8SA 1H65A 5DO9A 1IXSB 3REGA 4ESRA 3C5CA 4CEHB 3Q9LA 1WBDA 1XPRA 3NC0C 1NYGA 3SQWA 1H8HD 1OH8A 3Q8XB 1IN7A 4QBIA 2HEIA 1VG9B 5EE0A 4CEJA 1QHYA 2YZ2A 3MCAA 2WMOB 1OE0A 3G5UA 4PAOA 4CW7A 4O2RA 4UXJA 2XB2A 2WJHA 1N6IA 3RANA 1YR9A 2R6DA 4GOJA 8OHMA 4PXAA 2QRNA 3MWYW 2NPIA 2JLVA 1L2TA 5EXSA 1UGVA 2UZ3A 3SBDA 5I22A 2CEAA 3F3YA 2KWIA 1CP2A 3KKMA 1JJ7A 1I4DD 2P3SA 3C4JA 1WDXA 4LPKA 5CYOA 2V1RA 1QHHA 1GILA 3JZAA 2WJYA 4QM6A 1Z47A 2GGRA 4LI0A 3RRYA 4IOMA 2JTEA 1E0KA 3SOPA 5J4YA 1M7BA 3PEWA 3H0IA 2PNIA 3TSOA 1M3AA 2ZSAA 1ZSGA 3AF3A 5AJVB 3K9NA 4LYAA 4B76A 1SHGA 1JPJA 3THKA 1PUIA 1KTVA 4LJ4A 4V02A 1GFDA 4MGYR 4NDZA 1E99A 2IXFA 1NBME 2ZJOA 3CRMA 4LYHA 3KJEA 4LE9A 1BMFD 4GOXA 1GRNA 4F91B 2FEIA 1ZUYA 2GNCA 2JM8A 1XCMA 4TL6A 5FL7A 1E2NA 2KE5A 2XTZA 4IEEA 5KNCA 1RKBA 3L0PA 2GEDA 2NO6A 4IDPA 2WWWA 2DILA 3TSZA 5JI3E 1W1WA 3PUZA 5FTJA 1F2TA 2UKDA 5FUYA 3LBNA 3VAAA 4BQSA 3IQXA 1SKYB 4P3YA 1BIFA 3THYB 2D2EA 2ZRGA 3CR8A 4PZYA 1UEIA 4YQFA 1KI1A 5EXXA 5K8TA 4W9MC 2C5LA 5FL3A 1M34E 4AI6A 2ZJ2A 4MKIA 2XSZA 4FXPA 3ZYCA 3OEED 4JYCA 1H8EA 1QVRA 4AY2A 2F1IA 1SXJD 4FCTA 2J06A 4ZCIA 1R0YA 2ZYUX 1Z6TA 3CM0A 3QUSA 1T9HA 1G8HA 4RKEA 3EIEA 1CJVC 4ZIRA 1U90A 2CH4A 3E2IA 2FPFA 2C03A 2ZSBA 1NLPC 2GJSA 4LCBA 4CEJB 2H7VA 2J45A 4C4PA 4OI2A 4D80A 4EPRA 1ZNXA 4DDTA 3PUXA 3TLXA 4B33A 3DL0A 1DBSA 2ZUCA 3AKEA 4ZDIA 3RNLA 5FPYA 4TYWA 2HCJB 1GP2A 4XVRA 3H2YA 2KXCA 3VKHA 1ODFA 1NVWQ 2NOAA 1TEXA 3C5HA 4EIKA 3GLIE 1SHFA 2W0ZA 2V9PA 3PUVA 1YE8A 2ZE7A 2XAUA 3LNCA 2D7DA 4BGDA 2DJQA 4FD2A 4HZIA 2PX3A 1M1YE 2WOOA 1OF1A 3RLFA 1ZINA 4P4TA 1ZBDA 4FMDF 4CF7A 4MUBA 1PLKA 2V7QD 5LD2C 1VPLA 1ZM9A 2WVJA 1QKXA 2C77A 2A28A 3A8TA 4L9WA 1MO3A 3FHTA 3FHCB 4CEIA 4KYUA 4TLCA 3RAPR 3FHOA 4WZAE 1AZTA 3WP0A 5A0FA 1E4YA 1OKKA 5JBQA 2EQBA 3MFYA 1TF2A 4X8HA 4AG2C 2QI9C 1A82A 5CDFA 1PHTA 2G88A 2JIZD 2QRZA 1AS0A 4HUQA 3OFNA 4UXHA 1UHCA 1F2TB 1N0VC 4QJ4A 2GAAA 2IUUA 4OK3A 2OG2A 1X8KA 1CU1A 1BH2A 4KFSA 3VHLB 4JBXA 3S1AB 3B1XA 1E2KA 3M0UA 1K0SA 1FMJA 2FSHA 1ZUKA 2GVZC 3U6BA 3K70B 2HJVA 2V4ZA 1IONA 4JL5A 2GDJA 2ZU6A 2OCPA 1W2GA 2OO7A 4QOSA 1YCSB 4Q4HA 3VS7A 3FWYA 4PZZA 1UE9A 4IRUB 2GF0A 4BEJA 1IN8A 4ZIRB 1G3IA 3MUFA 1XD2A 2K7AA 2DBMA 1VECA 3DOEA 3RBBB 3VX3A 2OBLA 4ZDKA 3KQLA 5JWRA 2RKOA 3PEYA 2BV3A 1XCPA 2XOKD 1RZ3A 1JQJC 3L82B 3NPFA 2H17A 1FOEB 1E9BA 3ZS8A 3A36A 3EHRA 5C4MA 2JJ8A 2DVJA 1KJWA 1UJ0A 1G5PA 2GILA 4J9CA 2ZTSA 5JHHB 1XTKA 4XD7D 2YUPA 4DSOA 2RN8A 2QE7D 4OJQA 1EXMA 1NKSA 4C0HA 3EASA 3AVPA 3H0HA 2WZQA 3KXKA 3MRSA 1JR3D 1ZU4A 4EQ6A 1UDLA 3I5SA 2DL4A 1W46A 4TMZA 1YZGA 2JM9A 1X8LA 1QHSA 2IF2A 5IXFA 3CONA 1O87A 2QN6A 2JJ1A 2G9NA 2B7BA 1VCMA 1FUUA 1KDPA 2BM1A 3LBHA 2HDNB 3LY5A 3SHFA 4A2PA 4C2TA 1Z06A 3TGPA 1IXRC 4QM7A 4RZ2A 3D8BA 1W36B 2LJ0A 4JJDA 2RHMA 4HAXA 4CIDA 3EX7C 2ZVQX 3A1SA 1K4US 4C9BA 3A6PC 2VHTA 1E79D 2DF6A 3CR7A 5DH9A 2GKSA 4Q7LA 1II0A 1LS1A 4CEIB 1ZIPA 1R5NA 3DKPA 3RC8A 1WXQA 3I35A 1JR6A 2W6ID 5HZKA 1DG3A 2GTPA 2GWHA 5BN4A 4DLVA 2RGBA 4LN2A 1MUZA 2BOVA 2J6KA 4Z8XA 4JSTA 4A0GA 1G3RA 1NLOC 4HUQB 2BBWA 2ORWA 1CJTC 1TU3A 1J7KA 3FMPB 2LKCA 2GVDC 1XTJA 2J7PA 4B3BA 1TUCA 4ZDWA 4FCVA 1TUDA 2F6RA 2LP5A 3P4XA 3SN6A 2WJGA 1CJMA 3AUXA 2YV5A 1E1RA 3BK7A 2WBLC 1UDWA 3RWMB 1AWJA 1EFTA 2PCLA 4QFMA 2ZE6A 4DHEA 2A9KA 2H57A 1NG1A 3NVAA 2YSQA 2PMDA 2L0XA 3QJYA 4Q4HB 4FSSA 1OYYA 1QHGA 3K0FA 3EHQA 3QBTA 3TVDA 5JCZA 4J9HA 2FE4A 3VS0A 2QM8A 5K8UA 3VNVA 3W5JA 2LWIA 1GNQA 2VTKA 3I8SA 4NCIA 4M8NE 1NKTA 3QXJA 3W6NA 4M4ZA 2VRWA 2QQ0A 5JJLA 1A4RA 1KOFA 2ED0A 4Q66C 4HDCA 1W47A 2E9SA 2VP4A 3L43A 3GLFA 1UECA 4LBWA 3REBB 1T8UA 3ONWA 1G4AE 1D2EA 3QF4A 2LNHB 4Z1MA 3SFZA 1EFUA 2LQWA 3VNUA 2EGCA 5IHPA 2RGNC 1L7VC 4EQ6B 3LV8A 2FFHA 2Z0MA 1JAHA 3I92A 3L0SA 2KR3A 5B2ZA 3AB3A 1UBEA 2XTNA 4D4JA 3AVTA 4I1SA 4G5SA 4MRVA 1WE2A 2C78A 2C9CA 2AKAB 1X1RA 1P4SA 3TKLA 4URVR 2J0VA 1G8FA 2OXCA 4JVMA 2OAP1 2CK3A 1COWA 4H1VA 2CUBA 4MRRA 3UWOA 2ZI4A 4Q7JB 1YZQA 1OXUA 1WB9A 3KJHA 3F8TA 3K09A 4QNRA 5JWOA 4RFSA 1RVDA 2PJZA 4BRWA 1JU5C 1M3CA 3ASYA 1E7OA 4B3DA 2XNDA 5EQTA 1GL9B 1OFIA 5DYGA 1U9IA 2G1JA 1FP7A 2Z6VA 2ZJ8A 4A0RA 1RFLA 4I99A 1K0XA 1HURA 4M9ZA 1KO4A 1OT3A 4URWR 3HPRA 4D0LB 4R7ZA 3VS3A 2FRYA 2K79A 4JT2A 3TAHA 2F9LA 1Q1ZA 3WYFA 5IK2D 2R6AA 3GLGB 2DHRA 2RPNA 1II9A 4GI7A 4W5WA 5CJPA 2XMFA 5KNBA 3K0FB 2G83A 3SE0A 2X1VA 2OJ2A 5BN5A 1X8JA 5EP3A 1NMZA 1W36C 1DADA 2AL7A 2MMCA 4NL4H 5EUMA 2ABLA 3RS3A 3E70C 721PA 1G83A 1P2TA 4QJ5A 2IWHA 5EXTA 4IJMA 4E6RA 2FNAA 2AX4A 1AS3A 3T5DA 3L2OB 4RCZA 2A78A 3CNOA 5FL7D 2RGXA 1Z22A 1D9ZA 2LCSA 2VP2A 3DEFA 2ZRKA 5FPSA 3RS5A 5J4HA 2GXAA 1KK2A 4YONB 2WAXA 2FN4A 1HA3A 3CNNA 3GLFB 5FI1B 4TYPA 1Z07A 2E5KA 2I1VB 3MD0A 1D2NA 2MSDB 2X2FA 2CSIA 3QF4B 3BORA 1S1NA 1NSFA 3QPUA 2DL3A 2J05A 2RB4A 3UG7A 4MKGA 4J9DA 3NEYA 2D8HA 3B6EA 2H18A 4G1UC 2V3CC 3FPAA 5BW8A 1XD8A 1WP9A 2XSZD 1YKSA 1SGWA 2FPEA 2KXDA 2KI5A 2DBKA 2VLIA 2R6CA 2ZRNA 4HLQB 3D3QA 5HCIA 3WRYC 3IO3A 1UKEA 4PC1A 5J4VA 4I1OA 3K0SA 1G1MA 2WWFA 5CDFE 2A5JA 4FI3C 5GJWC 1NLZA 1IY0A 1KDOA 3VRZA 1PWTA 2ZAOA 1GAJA 4IKEA 4F16A 3PXGA 2B21A 3KFXA 1BMFA 4DDUA 4TL7A 2FG5A 1E9EA 4GZMA 1RC8A 2JXBA 1XEXB 1UTIA 1Z9ZA 1W44A 2DWOA 3DKVA 1MO4A 5A4JA 2WWYA 1OH7A 5FUXA 1S9DA 4D8DA 2PX0A 2PCJA 3K9LA 3JV3A 3QIAA 1SZPA 1SSHA 1P9WA 2JCSA 4OQLA 4FWTA 3U60B 4AFUC 3QXCA 3LLUA 3MG9A 4NZYA 2CXXA 4O0MA 4AC9A 1T4GA 2XNSA 1SXJA 3D6TB 4JKIA 4WW0A 4LZZA 2PTKA 2ZRDA 4CDGA 4J9IA 3EG5A 3TK1A 4DKXA 3NHBA 4XSGA 2D74A 2BEKA 4DZZA 3KX2A 2O8EA 2WJVA 1XD9A 5FTNA 2IL1A 2ZQ5A 4DCTA 4Z8YA 1YJ5A 4YMWA 2BMDA 2GCOA 3QNUA 3CB4A 2W0MA 5KNDA 1SKQA 5K8IA 3OFND 3ZVLA 1GL5A 4KFTA 4C0BA 1H8KA 1FL9A 1M7GA 1GKIA 4TMWA 4DLTA 3SC3A 2RF0A 1Z2CA 2RQWA 1DEKA 5F9FA 3A1WA 3HDTA 1WRBA 1ZUNB 2EFDB 3IBYA 5G40A 1HSQA 2JATA 2ZIAA 2AZVA 1AWXA 3OIWA 1TF5A 1Q44A 3NBFA 4K8OA 1NVUQ 3U2QA 4OMOA 1S96A 1QCFA 4X1VA 3QKUA 4XIGS 4OHWA 1ZD9A 2BCJQ 3CBQA 4WCIA 3LA6A 3M1IA 2GXQA 4XTRA 1IO6A 4L8GA 3VMFA 3WNCA 1T6NA 2XEXA 2E87A 1BOFA 2QUZA 2V7QA 2QP3A 4ZI3A 3RVBA 3CRVA 3MWKA 5JI2E 1QHNA 2WSSD 4LBYA 2NPFA 4MRSA 2OCAA 1TG0A 2IS6A 2PT5A 3UMFA 2PZ1A 2QMUA 2IS2A 5DNYB 2WSMA 2JIZA 1GCPA 5AUQA 3CZPA 5P21A 2O8DB 4A6XA 5KOYA 1N6RA 3WNDA 4Q1AA 2D1XA 2JLUA 4BPBA 3CX6A 3ZJYA 3B7GA 3NG1A 2G6FX 3GJ6A 2O8FB 1DAGA 2ZRLA 4D82A 2KT1A 2JLRA 1AEYA 1XTQA 1JB1A 2ZETA 1XXHA 3F5FA 3PEVA 1G18A 3U3MA 1KI7A 3PR1A 4F4CA 1SXJB 4ON9A 1EFHA 2DR3A 1U8YA 4NH0A 4X8LA 4I4LA 4D25A 3FE2A 4K11A 4LC0A 1L4YA 3GLFE 4RKFA 3I5YA 4TMXA 2O8EB 3AGQA 1LB1B 4KI0A 4FMCF 4I1UA 3WHKA 2XOKA 1IAQA 2GCOB 2QG6A 3ECCA 4L4UA 4EPVA 2AK3A 4GFDA 4DLZA 2MSCB 2EYQA 4IW3B 3BFXA 4OMQA 2BVNA 4IOKA 4HZUA 3KL4A 2J7PD 2XXAA 4EPWA 2PEYA 2QE7A 4D2IA 4Q1FA 3P1JA 1R10A 1DAIA 3RS4A 1E2FA 3CF0A 1MO6A 4M22A 3GJ4A 5FOUA 5BQ5A 3T15A 2O0JA 3VQTA 4MQBA 4Q4JA 2OE2A 1JR3A 2GXUA 3L8YA 5GVRA 1E96A 1KKLA 4QHSA 4BLRA 3AUYA 4IFEA 1HTWA 1ABOA 4FCWA 3T1VA 5JEEA 1N5KA 2DX1A 1DS6A 2G0NA 4HVUA 3RSLA 2QM7A 3UMRA 2P6RA 5FPTA 2EYZA 4PC3A 3IIJA 3GBQA 4DBLC 4J9BA 2D0NA 2OBNA 1V1CA 2ZROA 3H0KA 4GP7A 4UNRA 3TJZA 1N6OA 5E3HA 1J3TA 2BTTA 5JLJA 1NLFA 4IIMA 3EG2A 3EZFA 1E79A 3CWQA 3WXMA 1M6NA 2DYKA 1VHTA 5CB6A 1GCQA 2EQIA 3GD7A 3VU9A 2DYBA 1QWEA 3M0QA 2H8KA 3SYNA 3BIFA 2W6IA 4M1KA 4BRUA 4XTCS 4YMTA 1AKEA 1WA5A 1YR8A 2LJ3A 4BZQA 2D4HA 1IBRA 2W2TA 5G41A 1XOVA 2FV8A 4UNQA 2QEQA 1X6BA 1DE0A 4EAQA 5FPKA 1PNJA 2YUOA 1R0WA 4ZNXA 4Q9IA 1JEGA 1TTTA 1FW6A 1G5RA 5H1YA 2O8CA 4LGMA 2BMEA 1TNDA 4S35A 1GG2A 4OJKA 2WWIA 5CK5A 4PC2A 5TARA 5FWBA 4RTUA 2GAOA 1XXHB 1QBKC 1XWIA 3EWSA 3MGCA 4L9SA 4PAQA 3VS1A 3SYLA 4HXJA 3GLIB 221PA 3KKNA 3LWNA 1IY2A 1F2UB 3EG3A 3K70C 4PPFA 1C4OA 1Y0MA 2YHSA 4NKRA 5CYPA 3IEVA 1NEBA 2EW1A 1NF3A 3SEMA 3OESA 3MJRA 3EPLA 2GJKA 4MRPA 2KT8A 5FBWB 1KZ7B 2CNWD 2Q9BA 3AP3A 4TMVA 1N6LA 4HZUB 5BYKA 3U7EB 2XXAB 4TQAA 4ZDJA 3ZD7A 1KIKA 4URXR 5HZHA 2VA8A 5D3MA 1UFFA 4NCNA 4ZCLA 3THWA 2IYZA 1EG7A 4KBGA 4R71A 2QT0A 1AQUA 4EFMA 4A2QA 4Q4JB 3A37A 3I5RA 1C9KA 3A58B 4LK2A 1OB2A 2OUKA 1XMIA 5L3VA 2GZDA 4DUGD 1T91A 4A6PA 1MABB 2CLSA 2DA9A 3M0SA 1BO6A 1KSFX 3SNHA 1BYIA 1LF5A 4A92A 4OK5A 4AYTA 2OILA 3ADBA 5LB2A 2F55A 1GM5A 3WHLA 3KJGA 2FFQA 4TTPA 1N0UA 4UNPA 4XJXA 3TNFA 1UFQA 3BJIC 3MWJA 4LJ9A 4MH0R 3UMSA 1KI6A 4TQ9A 2L2PA 2JT4A 1JO8A 1SRLA 2OT3B 3VU9B 4Q5IA 3G0HA 4GBMA 1NY5A 2JAQA 4D81A 1YWPA 4DLUA 4TSFD 1HUQA 4G0NA 4ASUD 1WF3A 4GOKA 1YR6A 2G3YA 2YOHA 2ZSFA 4KFRA 4KAXA 1VIYA 2JW4A 4NYIR 1KMQA 1W4RA 1SXJE 3JZMA 2JGNA 2JASA 4RUGA 2FH5B 2TMKA 4HEJA 3SEAA 2O8CB 3R7WA 3K9HA 1N3BA 3M0TA 2J41A 1A2KC 4ESVA 4HCKA 2WWGA 3QXHA 4LDJA 1GFIA 5IK2A 4JZ3A 1AZGB 4H1UA 1ZCAA 4LC1A 1A1VA 2O52A 1E9FA 5DLQC 2GCPA 3KQNA 2CUDA 2RGAA 2ZVPX 5KSYA 4O3MA 4QT7A 2AXNA 2O5VA 1ESNA 2G6BA 2IYRA 3B9QA 1KO5A 2FPLA 4LOAA 2MMGA 4KSCA 3KTAA 1M74A 1KK0A 1J2JA 2C95A 1T0JB 3BRWD 4BLOA 5HCNA 5EE9A 1WI7A 4DCUA 2VSOA 2ODWA 4XWAA 2GETA 5L3SA 3R8CA 5FBRB 5J4KA 1OXXK 1IN6A 4POAA 2ONJA 4HUTA 2OESA 2H1LA 3DDCA 3W6PA 1AKYA 2FPKA 3AKCA 5D3MB 2NG1A 4A36A 3THWB 4URYR 3A98A 1W4CA 2GJ9A 2IYLD 2D06A 2FFBA 1NSTA 3B13B 3X1WA 1ZD1A 4IVPA 3SJZA 2K6DA 4N0DA 5JMTA 1UBFA 2OFXA 1HEIA 1WX6A 5JSZB 2F2VA 1A0NB 4ZV4A 2J59A 2VP9A 3OE7D 3CWZA 4C3ZA 4ESHA 1KK1A 2H8HA 2YOGA 1G8GA 1E6CA 2WOJA 4D26A 2JLWA 3GJ0A 2DWPA 2PLFA 2NZJA 5IHKA 4MRNA 2CL6X 1S4QA 5C46F 4RZUA 4FMDB 2PZFA 1O3YA 4TT3A 3ZVMA 5HKKD 1KI6B 1IHUA 2FSIA 1OPLA 1E0SA 2YWFA 2VF8A 4HAYA 2P65A 3VX4A 2EVWX 4S2EA 4UNSA 1NJGA 2CDNA 4B2IA 3OAAD 4A2WA 3AVWA 4JZ4A 1KZGB 1MR3F 4US0R 1OHHD 4A1FA 1QKWA 1H3HA 3K0EA 2F2XA 2A3RA 421PA 4NYJQ 4D4MA 1XXHE 3RS0A 2ORIA 2HCKA 2X2EA 3BERA 4PANA 1N5LA 3WYAA 4DWJA 4DDWA 4ZCMA 2ZRBA 3PV0A 3R7WB 1OW3B 3R9XA 1TF7A 2DY1A 5DHAA 1P73A 2AR7A 1QHHB 3O8RA 2M0YA 1CTQA 4HSEA 2VSFA 1NNEA 4BE7B 4Q7MB 3IDQA 5DI3A 3U6KA 2GZAA 5JJKA 1AZEA 2ZRCA 1HH4A 3H0FA 4QGFA 3LW7A 3W34A 2J7KA 1Y57A 2PLRA 3I62A 2C0IA 1HQCA 5KSOA 1W70A 1SVOA 4PQYA 3RABA 5FW9A 2CCJA 1S9HA 4JJCA 3PCRB 3UA6A 1MT0A 3MAAC 4QC2A 1G291 1K5DA 3EXAA 1R0XA 5JRZA 1ZX6A 2NZ8A 3TAUA 3B85A 1KFZA 1VCOA 1GKUB 3NHAA 1WA7A 1JR3E 1NL3A 1VHLA 2C99A 1GKYA 2LKDA 4ZKDA 3GEEA 1FZQA 2BZXA 1U99A 1ZU5A 2GK7A 4AFSC 1D5CA 4ITRC 2ZM5A 1RIFA 1CJUC 2F2WA 1E9DA 2LQNA 2IYUA 1EX6A 4AYWA 2DLPA 1M2OB 5FR2A 1CRPA 2DMOA 4C7OA 4P31A 4FW9A 5FI0B 2I0NA 1Z6XA 1EFRD 2CLDX 3VR1A 1ZNZA 1N6HA 2ZU0C 2WICA 3LBIA 4OMLA 2P4RA 2AK2A 2CBZA 2G77B 2CHQA 2ANBA 4JLKA 3GP8A 1GITA 1LTQA 3CPHA 2P6NA 4D6PA 4Q18A 3FMFA 1PLLA 3CLVA 4OK6A 2WSSA 4D0NA 1YN8A 4BFTA 2QENA 4V0NA 2J3EA 3TW8B 1AOJA 3TQFA 1AZSC 4OHXA 4NYIQ 3RRNA 4BFVA 1X69A 4OKSA 4OMMA 3J81k 3GPLA 3HYTA 4JLJA 3QEJA 1JBKA 1Q20A 4LJAA 4DXAA 4V0OA 1G16A 1ESMA 1M8MA 2ZUBA 3AF0A 1K8RA 2KJQA 5C4GB 1P72A 2N46A 4OL0A 1ZM7A 1U9IC 1SVMA 1FNNA 4QHTA 1OXVA 3FFBA 1IY1A 1T0HA 4TZ6A 1VTKA 2Q3MA 2C0TA 3SQXA 1OFTA 1UJYA 5DI3B 3LRPA 2BCGY 5AJYA 2FZLA 4NHOA 5SZHB 1QG4A 2V54A 4JLDA 5C18A 3L0IB 3VR4A 2BKUA 2HV8A 2DE0X 2FPDA 5FH9A 4MGIR 4MA4A 5G3ZA 3T1TA 2VHQA 1FYNA 4Q9KA 4HLUA 4WOPA 2EFGA 1YZTA 4BFUA 2MSEB 2O2OA 1PV4A 1XNJA 3LAWA 2O88A 4JS0A 1N25A 2HXYA 4JYBA 3NWJA 2QORA 4FN5A 4LY6A 4BFWA 4Q00A 4D4KA 5JECA 2W2VA 1WXBA 1GRQA 2WIAA 5E95A 4FWIB 5AR1A 3KQUA 2IYYA 4DLWA 1TUEA 2L3PA 3HP1A 2DBYA 1ZNWA 2ED1A 2Q0HA 5HE9A 3EG1A 3W9YA 4NU0A 1CR0A 3C8UA 3UPUA 2OLJA 2RGDA 4WIAA 1I2DA 2CCKA 1IJFA 1K5GA 3KKPA 2FEOA 1DO2A 5B30A 2KYBA 4F14A 5H8WA 1G7SA 5IT5A 1BS1A 4RTXA 3P4YA 5FBVB 2ANCA 4AG5A 3V4RA 5DIFA 4DB2A 1A5TA 1B3QA 3IQLA 1XD2B 3M4YA 4MUAA 2GA8A 2WIBA 3IKJA 3KJIA 4M1SA 121PA 1E1QD 5TMPA 3NIBA 1X3SA 4RD4A 4IIOA 4QGGA 5FR1A 1OH5A 4M1OA 3NHNA 3FMOB 4L5BA 5KDOA 2FF7A 2REBA 3EPKA 3ULRB 1MOZA 5EE5B 1AWOA 4M4SA 2FPMA 1UM8A 5EC7A 1UKVY 3MJHA 1Z6AA 4HAUA 4K46A 3EARA 1UEJA 1GL6A 1S8FA 3DMDA 1Z0KA 2W58A 3K9GA 2QA5A 3ZD6A 2R2AA 1E3MA 2P5SA 4LSGA 4F17A 4EFNA 2BZYA 1E0JA 1T5IA 1ZNYA 3K0CA 5BXQC 2BZ8A 2DFTA 1T0HB 1W0JD 3LO5A 3ND9A 3O47A 4OQXA 2EYUA 1WBBA 5CJ2A 1OFUX 2WTUA 1UBGA 2K3BA 3A4NA 3VS5A 3W3AA 1NI3A 1KGDA 1P5ZB 2OZEA 2V6IA 3EC1A 4JLPA 5TB5A 1NVVR 5FTLA 3CNLA 1G4UR 1Q21A 1PVOA 2RH5A 2IS4A 2ODNA 5IXBA 5UKDA 2CE7A 4Q1BA 1QVAA 4NCHA 3O8CA 3AP1A 3CUEF 3HR7A 5B57C 4BEBA 3VKWA 5GJBA 1Q57A 3E5HA 5IHIA 1SXJC 5DHFA 3UANA 1Z63A 1B0UA 2AZSA 4GLMA 2R6FA 3A1UA 4QBGB 1ZC4A 4J9EA 2FGKA 1XEFA 2AD5A 5IH2A 1R2QA 1D8TA 4AKGA 4OI0A 3QVVA 5I11A 1KDTA 3CKLA 2CNWA 1RRCA 2OAWA 2HBWA 1E69A 1DAFA 1VDZA 2CHGA 2WV9A 2ZEJA 3IO5A 1S0UA 1DOAA 1DELA 1G41A 2AD1A 5E7MA 3UXMA 3P32A 2O31A 1NN0A 3QKRA 2EW3A 4DSTA 4A15A 3HJNA 4J0QA 4EJSA 1ZMXA 3A4LA 3U3JA 1U81A 3TUIC 1U0JA 1NN5A 4B3FX 1XTSA 4KXFB 4NPHA 2JS2A 4B44A 4DUGA 2UZIR 3NEJA 4CYMA 1L8QA 3V9PA 2XX3A 4IDNA 3DMNA 4CT4B 2I4IA 1W0KD 2C2HA 1FX0A 1OJLA 3Q72A 1YNZA 4JJZA 3DOFA 4PO1A 4BLSA 1OH6A 3VS4A 1NIJA 1TX4B 3Q7QA 4ACBA 2P67A 4DCSA 2JJ2D 1N6KA 3RDPA 3VS6A 1U0LA 1HQYE 3TQCA 3UA7A 4R98A 3R6NA 1CXZA 1HE1C 4JSYA 5CIQA 1ZAKA 4TSFA 2PT7A 4ASUA 3KQKA 2R44A 4QBFA 2J0UA 3I73A 3GMTA 3KQHA 3FGNA 3KUDA 2VVKA 4AG1C 1FTSA 1KI4A 1QZXA 2ZJAA 2R62A 4TN1A 1ETUA 1Z08A 5DYIA 3KZ1E 4M21A 4V03A 4F93B 2Q9AA 4RTWA 2OBMA 4B47A 3KKOA 3R9WA 4TL9A 1NM7A 1R7RA 3U44A 3ZQJA 5D3QA 1X1SA 4IOJA 4U02A 5JZVA 3ZZ0A 3QWYA 2F1RA 5FOTA 1PRLC 3U23A 4F38A 2W6JD 2FGJA 3IEUA 2DL8A 4TTRA 4JVLA 1TPZA 2KBEA 2IHBA 1KSHA 3GJ3A 5BWMA 3A4MA 3EZ9A 2IYTA 1U0HC 3IPXA 3K1JA 4NCJA 4W5JA 2QL6A 3KKQA 4HB4A 4TT3D 2ZRPA 3UF4A 2QGZA 5L3RA 3R9IA 2CH4W 4RFSB 5EJEA 1Y3AA 2REOA 1US8A 5JRJA 2JLXA 4KSBA 1OV3A 1NJFA 4ZO4A 4HAZA 2IXGA 2IW3A 2KGTA 4G5QA 3PVSA 3TMKA 2RQTA 3AVOA 4V0MA 2RHDA 4C2UA 4DT1A 3HPQA 2IXEA 1R6BX 3NTUA 1E2GA 3FYHA 2RMKA 1ZRHA 1RI9A 3GJXC 4A4DA 2ZUDA 2QROA 4A0HA 2IS1A 1E2EA 1Z0JA 3QKRB 4FIDA 2C98A 3ZQ6A 2J6OA 4EJSB 1E2JA 1TQ4A 4O25A 4JT4A 1KSGA 1G5TA 2ROLA 2YDLA 3T5GA 4AIIA 5EUQB 3CF2A 3OE7A 1XP8A 4EIWA 4KFUA 2WWHA 3VFDA 4B6EA 2QAGA 1XBTA 4V0KA 5J47A 2ZJ5A 3T12A 3EA0A 2W10A 4B3XA 3ZH9B 5FWCA 1FX0B 1P60A 1G8YA 2ZRIA 4WA7A 3T06B 6Q21A 4BZPA 2ZXUA 3AVXA 4BASA 4LUDA 4PSKA 4PPQA 2QTFA 2YINC 5KU1A 1VYTA 1LCKA 2ZSDA 4E09A 1IXZA 2J46A 1TUIA 3UATA 5HKKA 5ANRB 4WVFA 2QPOA 3EIQA 2RGEA 4AD8A 1G20E 4HVVA 2FDCA 3DPUA 4DC9A 2ESWA 3ZZUA 3I5XA 3WY9A 3B1YA 3M0EA 3OAAA 3QXXA 2V1UA 2FO0A 1E6GA 1OHHA 3QG5A 3THXA 2B92A 1J90A 1GCQC 3NGPA 1CJKC 3R20A 4HDOB 5EZ5A 4BLQA 5KUTA 1E9RA 4E22A 4EPXA 2R6GA 4P32A 1LS6A 2FU5C 2QPAA 2A7QA 5AJXA 1NVVQ 2BBSA 2AXPA 1E0AA 1AVZC 2D62A 3U44B 2ZI3A 4US2R 1P62B 4LPSA 2GRJA 5FUVA 1ARKA 3RRZA 1F6BA 5JS8A 1R5BA 2J87A 1E2MA 2FRWA 5SZKB 2B86A 4II7A 4KVAA 4GSYA 1M8PA 2NO0A 4UXIA 4HAWA 5AUNB 2KYMA 5GVSA 1MV5A 1NP6A 2GBLA 4RD1A 4EFLA 1W49A 4OHVA 2QSYA 1DVRA 5JEDA 3U4QA 4DSNA 2KBTA 3NBXX 1WFWA 1E98A 2F1HA 2LCFA 3B5JA 1N2CE 2OCYC 2C96A 3OHMA 4AG6A 5F9HA 2CCGA 3SHWA 2AWOA 3OEHD 4Y0AA 3PQCA 2WMNB 3TE6A 1G7CA 4FMCB 4UNNA 821PA 1XMSA 3WBJA 1Q1QA 1XJQA 3CO5A 1I1JA 2AWNA 4LYFA 3ZIAA 1W2HA 4PR0A 4DT1B 5KPDA 4AFQC 2FZ4A 3REAB 1KO1A 2OSBA 1XF9A 2FSGA 3QKTA 1CKBA 1P7CA 1XCGB 3RHFA 2JLQA 3KXLA 5B58C 1XJ0A 4M9XA 1AK2A 2OHFA 3N70A 5FFMA 2PMKA 4WZBE 2IEYA 1ZM4A 1M7HA 2OLKA 1EFRA 4GZLA 1CR4A 1FMKA 2QAGB 2KRNA 3ZDQA 3AQ4A 1Z8FA 4MYCA 4PX9A 4XSHA 4Q1DA 2EU8A 2BKEA 1AQYA 2OFWA 3IILA 1W6XA 1AIPA 4MDFA 2QMOA 4BZXA 2XITA 2BM0A 1MV3A 2RCNA 5TXGA 1F60A 4HB2A 5DI9A 4XH9B 1JPNA 1G64A 1CIPA 1BBZA 3EGUA 5GJVB 5L23A 3NH9A 4HAVA 1GBRA 3UIEA 3WP1B 3SYKA 3C14C 1VMAA 3T34A 4OHYA 4Q9LA 1TL7C 2DL7A 2YWEA 3THXB 4ORZA 1KNXA 1U3OA 3N5CA 2RQUA 2AHOA 1ZUIA 1YR7A 1JJVA 2A2ZA 4KCGA 2W83A 4YDSA 2NGRA 4DJTA 621PA 1YRAA 2M51A 4D8KA 3H4MA 4A82A 1OPXA 4Z88A 2REXB 1TQ6A 4A8JA 4RD0A 1WXTA 2ZITA 2ZPTX 4HYYA 3PJRA 4JVNA 5KYKA 3QKSA 3BWDD 4YMUA 4NP6A 2QZ4A 1P6XA 2C04A 2JDID 1GRIA 1E32A 1PJRA 4KU4A 4LWZA 1R0ZA 2C8VA 2QPTA 2H5EA 1KHTA 4YMSA 1QF9A 4NYMR 2YKGA 3U4QB 5IHNA 3V00A 3ZLJA 4PSVA 1XB2A 1XX6A 5EP1A 4M0LA 2K9GA 1NMYA 4Q48A 4Z8AA 2DB3A 1IN4A 3HU1A 2ZAMA 4FMBB 1W5SA 4TMKA 1LF0A 1SVWA 2C9OA 3LD9A 3LH5A 1Z9QA 1KI9A 2YYZA 2PJRA 2DFKB 1ZLMA 1CF4A 1OSNA 4JVSB 1W4AA 1E4VA 3I4LA 2KBFA 1KSJA 4B74A 1TU4A 1E2HA 4RCYA 2EKHA 4AK9A 4DRZA 1G17A 4CC2A 1GBQA 1CEEA 3NBZC 1WCV1 2QAJA 2Z4SA 2JLYA 4W7SA 1EX7A 5CLQA 2XZLA 1T3SA 2QP9X 1HJDA 2WJIA 1DAMA 1MO5A 3AVQA 3VR3A 4LNPA 2V1XA 5FOXA 2CDTA 1K9AA 3SS8A 3U7FB 3VR6A 1NN1A 2IYXA 3P20A 2WJJA 3SJCA 2ATXA 4G01B 1JEDA 4LHWA 4LX0A 2LMJA 5TVKA 2QU8A 1P9RA 4LHYA 2EBPA 4XVUA 2FWRA 2R9VA 4HLCA 2XGJA 1E1QA 1U8AA 3R8FA 2ODEA 4BFXA 2JMAA 1X86B 2GTJA 5GADl 3LFUA 4A0FA 3VHXA 1XDBA 3BFKA 2ROTA 4NBSA 4G5OA 5JCPA 1NG9A 1EFCA 1NEGA 1GNRA 1V5WA 3EPJA 3T1QA 4TLEA 4BWYA 2GEUA 5JHGB 1Q12A 2L0AA 1KO8A 1HT1E 4IOLA 4LHXA 5F2EA 1ZM3A 1P2SA 5L8VA 1W1FA 4B2PA 1ZUUA 2EFCB 1E2PA 2NO7A 2XJ4A 2ZJBA 4RZ3A 4GP6A 4EPTA 4C0AC 3I32A 1N0WA 1DPFA 1W0JA 4MGKR 4Q9HA 3DM5A 2FFAA 3W8RA 4A8JB 4QGHA 4QHYA 2YUNA 2N1BA 2BBOA 1PZNA 1I0CA 2IT1A 3NBYC 3PVLA 3QKSB 5KSPA 4B35A 1RUWA 1RLPC 1IN5A 2CREA 1FP6A 4RVCA 2DRKA 1GNPA 1Z29A 2BC9A 3TIFA 1RYFA 3TR5A 3WMEA 4ABYA 3IBGA 2FJUA 4IVQA 2ZE5A 2A5YB 4V0ME 4TYQA 1KDRA 2ZREA 1G19A 1R8QA 1I07A 1BB9A 1DAKA 1AGRA 1A2BA 3ICEA 3QENA 3MMPA 4PPGA 4EDHA 2BMFA 4Q7KA 5GJCA 3FB4A 3K0AA 1KO7A 1QHIA 2A36A 4KBFA 2IX3A 4GT1A 1KMHA 3HU2A 3WBKA 3SR0A 2NIPA 1RYHA 4US1R 4DCVA 2Y8EA 1WYXA 1YRBA 4NMMA 5IF9A 3SI7A 4N3NA 4TLDA 4NTZA 4JKYA 3LQRA 4M1YA 5KSZA 1E2QA 4M1TA 2ZRAA 3CRRA 1G8PA 4N0EA 1JI0A 2X3WD 1KY3A 4TQUS 3DO6A 3RNJA 4JJKA 1R5OA 3SDZA 1UKZA 4IHQA 3AKYA 4CC3A 2J1LA 4J9GA 2JA1A 4KODA 1WIEA 2CVHA 5LPNA 1BU1A 2A30A 1W0KA 5ECAA 1UBCA 3QXSA 3W8NA 2DL5A 3UG6A 4JLVA 2ORVA 1J8YF 2JEOA 4C30A 3TH5A 2OV2A 2JJ2A 1ZVQA 4DLXA 2BDTA 5EE1A 3SBEA 2VPPA 2AKLA 4BFZA 3O5ZA 2ZR7A 3THOA 2A5DA 3EAQA 4Y0VA 3A1VA 1ZYUA 3B2EA 4BFYA 2GXSA 4A9AA 2NQ2C 3EW9A 1E9AA 2DWQA 2I3BA 3K53A 4NCKA 5DISB 5EP2A 2FA9A 3BOSA 4DLYA 2WPDD 4GMXA 3W5IA 2IIMA 4BLTA 3GEIA 2QY9A 3H84A 4C0SA 1U2RA 1YZUA 1N6PA 1CRQA 4BLPA 3PFIA 4KITB 3OIUA 4U7DA 1P9NA 3AF2A 5IDVA 3GQBA 2W6JA 5IRCD 2BWJA 2RQVA 3KDSE 1OIVA 1VYVA 2KEAA 4NYMQ 2Z83A 1Z6GA 1ABQA 3WMFA 3I1FA 2ZJYA 1ONBA 1Z2AA 2ODBA 4O2LA 4DIEA 1OYWA 1OXSC 2HDAA 4KJZA 1Z83A 3S1AA 4Q03A 4LV6A 1S1MA 4Q1EA 4YLGA 1X6GA 1UADA 5KDLA 2BMJA 1KI8A 1GWNA 2EGEA 3NMZC 3BH6A 3K0AB 3NH6A 1ANKA 4YMVA 1Q3HA 3BB1A 3Q7PA 2ZSEA 4GPTA 4RD3A 3UKDA 2PEZA 4HLUC 1KMHB 4LUCA 4B48A 4RTVA 3CRW1 4YXWD 4QNMA 4M2LA 5JWHA 4JLNA 2HCBA 5H68A 5KO2A 2ZI7A 3AVYA 1YVDA 1BYUA 1D6JA 3GFOA 3MLEA 2J0SA 1GDDA 5EXPA 3BH0A 4NE2A 4PQFA 3AF4A 1DG1G 4E03A 2A5FA 2GNOA 3FFAA 2RGCA 2ZRFA 3B1WA 1SHKA 2YC2C 3IPYA 1HD3A 4LHZA 4DLRA 3U5ZB 4MITA 3CX7A 3CQTA 1U98A 2HLDD 3IIKA 1J99A 2I1QA 1NBMD 4HB3A 3ZL7C 1LFDB 2VHUA 4E07A 3QSYA 1J8MF 2PBRA 2ZR9A 3KTAB 3NDPA 4OYHA 1RRGA 1S1CA 1ZC3A 1XJCA 4IEIA 2VIIA 4MDEA 1P75A 1W36D 2IBMA 1H92A 2GJAA 2IA5A 2YUQA 1GIAA 3LVQE 4GMDA 4P33A 5L3SB 1N5IA 4HDQB 1K76A 2F43A 1VKJA 3PUYA 3ZIAD 2KRMA 2BBTA 1TAGA 1GOTA 3U61B 1VCIA 3AM1A 1OIWA 3LXXA 2QP4A 2VYFA 2WKRA 2K2MA 1U94A 2NMVA 1SPKA 4DLSA 1XRJA 2V6JA 4ACAA 4LV8B 2F7SA 1BKDR 2VP0A 1XZPA 4YDHB 1MRNA 4KYIB 4ZPXA 3X1YA 2GBQA 2VP6A 2GESA 2ZR0A 5DSZA 3EA5A 1EK0A 2NWMA 4TMTA 2F3TA 1ZUHA 5CM9C 2WM9B 3QY0A 3K0CC 2EYYA 4MKFA 2G1KA 4C0LA 4JLMA 1T8TA 1KIMA 2V1QA 5CB8A 4PQRA 3IUYA 1M3BA 3QG1A 4EKDA 4JBYA 1XPUA 2BJVA 4PZLA 2ECZA 4R9UC 5EP4A 1KJYA 3B60A 1OFHA 3TVTA 2GHIA 2HYDA 3OEHA 3Q5DA 2AFHE 3K09C 5H70A 2OI3A 4DDVA 2F3RA 4I1VA 1SHZA 4JL8A 3PG5A 1G7TA 5HE8A 1ZJ6A 4CVNA 2HYIC 5E7IA 2XZOA 1ZM2A 3AF1A 2CMKA 2E1RA 2O0KA 4PO8A 2RMOA 1OEBA 1AN0A 1JECA 1KK3A 3B9PA 2NO1A 4QBHA 3WNBA 2IYSA 4R2HA 5ELXA 2HXSA 4RD2A 3BS4A 4EUNA 2OM2A 1AS2A 2X8AA 3NXSA 3WRXC 2A08A 1AD5A 2IYVA 3IGFA 4LBZA 1G6HA 4ARZA 4JIMA 1FMLA 3VKGA 4QGAA 2GQIA 4EJSC 1Q1EA 1LV7A 5EZ6B 2FOLA 5F98A 4KRTA 3CW2A 3EZ6A 5AUOB 3N2IA 3TSWA 4P4UA 1NN3A 1SEMA 3D31A 2EYWA 1SULA 4AKHA 4TL8A 4LJ8A 4LV5B 3B82A 1N5ZA 3ADCA 3I72A 4Q1CA 1ZIOA 5CLLA 4OHZA 2IEZA 4CC4B 1F5NA 2F43B 2L3SA 4JL6A 2EYXA 3DM9B 1KKMA 1XEWY 1GVNB 2VO1A 3C16C 521PA 3O8BA 3Q5EA 1PKTA 1CS4C 4Q4LA 1GZSA 4AKIA 1GSIA 4DEXA 2CSQA 3LX8A 2WKQA 4RTTA 4QXAA 5J4LA 4WXRA 4C7OB 1QDEA 1PUJA 3KFVA 5B64A 1SKYE 1Z5ZA 1EGAA 2W00A 4KLNA 5CK4A 2FMXA 3W6OA 4P0TA 2VQSA 4Q21A 5AJWA 2EFEB 3AEZA 4UKDA 1CR2A 3ZGXA 2JDIA 4B34A 4IXNA 5FPHA 1CSKA 1OOTA 2YNMA 4IDHA 1Z0DA 4WXPA 5LBIA 5HR5A 1ZW6A 3HWSA 5A5GA 2J9RA 2D7CA 4U00A 3FDIA 1OXTA 2Q3FA 3GLGA 2XB4A 2H92A 1SVLA 3CF6R 4D4LA 2KSQA 1UHFA 2KRSA 1WXUA 2CL0X 4CC7A 2OAQ1 2Q6TA 4ILEA 5FOVA 5TV2A 3RS2A 1F48A 3QVUA 4HLDA 1L4UA 2Z4RA 4V0LA 4DEYA 2DM1A 1KJZA 4KLZA 1I4LD 5DN6D 4QRHA 1UDXA 3C15C 1UPTA 3U7HB 2MOXA 3HR8A 5TDHA 4Y92A 1HYQA 4XOIA 3GLIA 1DAHA 1XPOA 1Q1BA 4QG7A 1Z0AA 3CPEA 1E2IA 1IJEA 2QGNA 4HATA 3VR5A 2VH5R 3TUZC 4XWOA 2J0QA 2YOFA 4ARZB 2PH1A 2Q21A 1G2BA 3LW8A 1NIPA 4DSUA 4LHVA 4OI4A 4LJ7A 2HUPA 2KNBB 4W5HA 1E94E 1RRPA 3B8HA 1T3LA 2D2FA 3NKVA 3WMGA 3RRMA 2QAGC 2QTHA 1XZQA 2ZRJA 2RNAA 1P2VA 4G5GA 2EFHB 2C9YA 3IQWA 3CH5A 3TR0A 2W2XA 2A37A 1G9XA 2QMEA 3DHWC 1WQ1R 3M0RA 3B1VA 4LJYA 3U3KA 2ZJZA 2XTMA 4JLAA 4C0JA 3FKSD 5GJVC 4ERNA 2B7CA 3OIVA 3W3ZB 2L3QA 3ADKA 4G3XA 2O8BA 2QDLA 1KAGA 4WAUA 1RE0A 1KAOA 4GRAA 1RRFA 4XVQA 2LJ1A 1TQ2A 3KB2A 4F92B 3C7KA 1XMVA 1HV8A 4F4JA 1KY2A 3PIRA 3FMIA 3GLHA 2ECKA 3PE0A 3BB4A 2ZI9A 3CPJB 4PSAA 5C2JB 1WMSA 3SZRA 1C1YA 4LRWA 3EG0A 3QWXX 1JAIA 3LQQA 1XEXA 2ZS8A 3L8ZA 1VA7A 1WDTA 1X27A 1AGPA 1CULC 1OV4A 1RW4A 4B73A 3ADDA 2FX3A 5SZIA 3VS2A 5AUPB 1IOZA 1R4AA 3I61A 5LD2B 2KE9A 1G6OA 1UKYA 4PHTA 4U5XA 1Z28A 3QF7A 4RY2A 4YC7A 2GBLC 4IFBA 4JLBA 1LNZA 3H86A 1E9SA 1XEWX 5E4FA 2AK5A 1E2LA 4Z54A 2D8JA 3T61A 4URUR 1U06A 2DPXA 1N5JA 2CT4A 4Z51A 2K5UA 3LVRE 2CLCX 1NMXA 1Q0UA 1XTIA 4JBWA 2AN9A 1PLJA 4PPNA 5FOWA 2GCNA 4CRWB 2QQEA 3B78A 2YJTD 3EWAA 2YWGA 2GJ8A 4PHHA 1ELOA 1J70A 4TTQA 4TWZA 5FBLB 4TYYA 1UUEA 1H8HA 1N6NA 2DRMA 2MCNA 4JPBW 3NDBB 4URZR 1DARA 1GFCA 1K1ZA 4Q9JA 3PEUA 2AKKA 1JXMA 3CRQA 5F3WB 3LXRA 3QOFA 5G3YA 2G0TA 2J6FA 1SRMA 1G3QA 2FEMA 2QBYA 3EPHA 4Q4AA 1I4TD 1S2MA 3QE0A 4PTLA 1SVIA 4LJ6A 5J40A 4B32A 2ONKA 2ZYWX 3KB1A 4DVGA 2D3WA 4DB4A 3K70D 3DZDA 1FQJA 1H8ED 3A1TA 3T1OA 2VBCA 1YU9A 4ZI2A 5LDDC 4HVWA 5K8LA 1CLUA 3SJAA 3BXZA 1I2MA 2CT3A 2O0HA 3AV0B 3TBKA 1X43A 1P61B 4LJ5A 2O8BB 1VG0B 2P2LA 1YWOA 1Q22A 2WPDA 2CHVA 2DCUA 3K8YA 4PC6A 5JJIA 2ZI5A 1E9CA 2P0EA 4Q02A 4RJLA 3BBPA 1QWFA 3RS7A 2B6HA 2OEPA 1KI2A 3TRFA 3BB3A 3N2EA 3GLHB 3GJ7A 4GBQA 2RGNA 2EGAA 2FSFA 5M04A 4CGZA 4PAMA 1AA9A 2UVQA 4MKHA 2RAPA 5AK0A 1SVSA 2Q3HA 3ETLA 2QT1A 3SFVA 4RD6A 4RZXA 3KUCA 4A8JC 2O8DA 2X19A 4G5RA 5L3QA 1UF9A 1GUAA 5KDDA 2BEJA 1G3UA 2VP5A 3BE4A 1W4BA 2B8TA 4UQOA 4GNKA 4D0GA 2QNRA 3LX5A 4Q47A 2Q9CA 3U3OA 1OB5A 2O8FA 2N42A 3CZQA 2HF8A 2PL3A 2ZRMA 2BIFA 2IYWA 2WHXA 2NO9A 2IHYA 2WKPA 4AURA 4GDFA 5J5CA 1G7RA 4UJ3A 2O9VA 4A63B 3OEEA 4B71A 4DIDA 2J0UB 4DCNA 3ASZA 1SQ5A 3BGWA 4YXWA 3REFA 4B43A 2KROA 1TMKA 1EWQA 3GJ8A 1YHNA 5FUWA 1GL7A 2WWXA 1XU4A 1Z0FA 4FINA 2ZS9A 4OBEA 4MYHA 4PHFA 2GEVA 1ZBJA 5E7JA 1UJ2A 4H9GA 2DFNA 2WAYA 1GTVA 5HPYB 1OKKD 4OQFA 2VF7A 1VYUA 1AWWA 2ZYVX 5AJZA 4P4SA 3U7GA 3RYTC 4LYJA 3GFTA 1CBUA 1XFAA 1U5SA 2NUZA 2VL7A 3BC1A 1S3GA 2O9SA 1X2KA 3Q3JB 3AGPA 2SRCA 1IM2A 1NRJB 1VG1A 3PUWA 1B23P 3VRYA 5DE3A 2YC4C 2J7IA 2HLDA 1RJ9A 1NBMA 1Z0IA 2FG0A 2VWFA 1JEEA 1MRSA 2KB0A 2QBYB 4Q19A 2RGGA 2SHKA 3FTQA 4Q4AB 2Z5FA 3TUJC 1MKYA 1US8B 1RLQC 2MIOA 2IF0A 3JVVA 4LUEA 5FTKA 3T35A 4OQNA 4OMNA 4RFVA 1GRRA 2ZANA 3HYRA 3AH8A 4B3CA 5SZJA 2EPDA 1VG8A 3WYGA 4C0QC 4BUJA 2ASEA 4ZKEA 1DTSA 4N1AA 2C0OA 3IIMA 1UG1A 3HU3A 1HE8B 2EWVA 2JLSA 1M27C 1CKEA 1T5LA 3FVQA 1PKSA 5BN3A 1W48A 4EPYA 1JQLB 1S3SA 1FNMA 2YWHA 1FPMA 3SU8A 3UWKA 3BFVA 5HTKA 4F4IA 3O8DA 1QG2A 2OXRA 2ZYTX 4NONA 1E2DA 2HEQA 3Q85A 1X2QA 2YT6A 4F7WA 2A5GA 5C1BA 4BFSA 1NLYA 4OMPA 4WZ6A 3MSXA 1AM4D 3VTKA 1YZKA 4MGZR 2VKNA 1EESA 2CVFA 2QMHA 4CT5A 5KHOC 3GLGE 2VHCA 2XJ9A 3CX8A 3QI2A 4Q01A 5JS7A 1AJEA 1YZNA 3P27A 1TEVA 1YZLA 5L3QB 1B07A 1JXOA 3TW4A 3ZVRA 5CITA 3M6AA 2LZ6B 4M1WA 5G53C 5BYJA 2JJ1D 1K6MA 1Z6YA 3D7MA 3DZ8A 2H16A 2IK8A 2GZHA 4UJ5A 1VIAA 2ATVA 3FOZA 3U3RA 1II8A 1DO0A 5CM8B 3V4FA 3EIHA 3KXIA 3ZVNA 2F1JA 2OCBA 2RQRA
chains in the Genus database with same CATH superfamily
4KX5A 4PX5A 2C61A 1SVKA 3CCMA 3CIOA 1WPQA 5C34B 2R8RA 1JQBA 3V32A 3FR8A 1G0NA 1E6HA 3FKQA 1GJRA 4RSGA 3TEJA 1ZOPA 2X3XD 2DG2A 4HP8A 2HHLA 2ZI6A 3PVQA 3PJEA 4INJA 2X8BA 3B1ZA 3TMYA 4Z3KA 2FLKA 3DB4A 4QUGA 3EXEB 4I9FA 3VUZA 1KQPA 2CZ6B 5G0WA 2B7LA 3TTWA 2WUDA 4TRJA 4ICIA 5TRTA 2I65A 2EF1A 4MYTA 1II8B 1T1JA 4YPOA 5FTWA 3CW9A 3OIYA 4QDXA 3U4IA 4CZ2A 3L8CA 3ICCA 1T0JA 2XNDD 3B36A 5TY0A 3I04A 1BS2A 1P44A 5BT8A 4UASA 2W70A 2LV8A 2X77A 3EAFA 2CVQA 2WE7A 4C0KA 3WVDB 4LZJA 4XSVA 4LF7B 1WKVA 4YV1A 1IBMB 1OAKA 3V2IA 1AQJA 3EGDA 5CIWA 2B0JA 2O3QA 1TQDA 3IP9A 4CEHB 1B15A 4JITA 4ENVA 5D01A 5CBPA 3MCAA 4PAOA 4BNGA 3MT0A 4CW7A 5K8JB 5FUBA 2X3YA 3ITDA 2NV6A 4LYEA 5I22A 4RHFA 1UMCA 1I4DD 3CZAA 2D5CA 3W5HA 2V1RA 3CCEQ 3H7IA 3QE9Y 1XMPA 3SOPA 4GOND 4M8LA 1SKUB 4IHJF 1KTVA 1V39A 4NDZA 3G9QA 1HDZA 2YRFA 3D6NB 2WWWA 1W1WA 3HDYA 1XN1A 2ZRGA 4M0MA 4R2XA 4MKIA 1UFVA 2IY8A 3ZYCA 2ZYUX 4ZIRA 3GRYA 3GH1A 3OMCA 3A8OB 2FPFA 1DINA 1V26A 4HVAA 3EXG2 4EO7A 4IV5A 1QH8B 3AKEA 3OSVA 4WDRA 1D1CA 1GP2A 3D43A 4P7FA 3KLBA 4RH0A 1EFPA 2P5UA 2ONCA 1C3OA 3I3OA 4CF7A 1QQ7A 4ETWA 2WVJA 1VQ6T 2OMEA 4BV9A 4DWVA 5IYZB 3M6VA 1UHCA 3BXXA 3TBHA 2RKBA 1IIRA 2G06A 3GUVA 3GWGA 3ETCA 3MAGA 4FYYA 1K0SA 3TB6A 4DZTA 3N8GA 1UWCA 4Q4HA 4LD9K 5E7QA 1Y9JA 1L5MA 2DBMA 2OTJQ 1H2WA 1ISRA 4O4IA 1BGVA 5C4MA 2VKQA 3NV7A 5FU6B 1EXMA 5GV7A 4DR5B 4C0HA 2EZUA 1KBQA 3FCCA 2A59A 4E2FB 4X1IA 4HKTA 4YV2A 1WLSA 5AI4A 5HF8A 4ZC8A 2J07A 3T99A 4HAXA 2RC6A 3A6PC 2BGLA 3RLIA 1ABFA 5AYFA 4IIYA 1RDFA 1SIWA 3R74A 1II0A 4CEIB 2CN1A 4GDMA 4LOIA 2NWQA 1R5NA 3L2QA 3X24B 3Q9SA 4DHWA 1G3RA 5D87A 2N1MA 2IVFA 1PJ4A 1TUCA 1VQLA 3TWOA 2QNIA 4JC4A 3RWMB 5JAOA 4NJOA 3Q8KA 2NV0A 5H7XA 2L69A 5DY9A 1YIDA 3L40A 3VNVA 5DM4A 3W5JA 2LWIA 4TWIA 3I8SA 4M8NE 4HCCA 5CVVA 3IDAA 4B3RB 1NRWA 3RKUA 4JUDX 3M81A 2CVPA 3RVPA 4Z1MA 4NJEB 3ZWWA 3JQFC 1J24A 4FW1A 3AB3A 4EHAA 1UBEA 4OATA 2X76A 3RQSA 2C78A 2F8LA 2O2EA 3TKLA 1G8FA 3GRVA 2CK3A 1M3CA 5EMMA 1UZMA 2GZ2A 5BN4B 3WZ2A 3SC2B 4DARA 2JFYA 3AR6A 3QELA 3CUWA 4FFOA 4S2UA 3DLHA 3BREA 2F9LA 3K2BA 2VJAA 3L0DA 3A8LB 1V37A 3QYGB 3LQ1A 2G7MC 3CPFA 4BNNA 1YNSA 2MWOA 3C39A 3PUIA 3MINA 4TYPA 3TW0A 1JE0A 4LJRA 4IJQA 1CZUA 4GI5A 1PO7A 1N0HA 5BURA 3AF6A 4Q4DA 1WP9A 1K98A 5AVXA 1L5VA 1B34B 2VLIA 5J4VA 1G5VA 2E12A 4UVEA 1WP4A 4WCFC 3VTZA 3A4VA 1PWTA 1RVV1 3RJMA 2ZYAA 4L95C 1N3LA 5LJ5f 2RHJA 3ZV4A 1F20A 4G8BA 3HDHA 2XMDA 3QIAA 1DTWB 2WLSA 4UDNA 1DHTA 3PZRA 3TCXB 2I78A 4YBZA 4MV0A 2IKQA 4GIBA 4J8PA 2D74A 2BEKA 1FFWA 1YR2A 3NV9A 2B4KA 1SIOA 1IU9A 1CVLA 3BDVA 3OFND 4C0BA 3FDXA 2WYWA 1UXKA 3IBYA 1PV2A 5IAJA 5K9ZA 3RE1A 1P0IA 3JYNA 1Y5RA 1KJ9A 4FHGA 2GM4A 5EESA 1YWGO 3IOYA 4HF7A 2DPPB 3CRVA 1AF4A 5INTA 2JARA 1YJQA 2CXHA 2ORED 1ZESA 5DNYB 2FK7A 2O2IA 4ZRMA 3SX0A 1CY7A 4FYXA 4A6XA 1U2DA 2Q1XA 4Q1AA 1DAGA 5DHQA 2J30A 2PV0A 5HJ2A 4Y6QA 2C59A 4D9GA 3ZHQA 3PEVA 4MKXA 1SXJB 1EINA 1P45A 1U8YA 3IMKA 3OM9A 4NDAA 1EIZA 5K09A 3RM3A 4CKEB 4BQIA 4GFDA 2WF7A 1IHYA 4JKOA 3E81A 2FL7A 2PEYA 3P1JA 1YDGA 3QWBA 4RGYA 2QNBA 3GBQA 1AUPA 5FDFA 3GGJA 4YT8A 3O7MA 2GD6A 1NLFA 1DKLA 3N8KA 4U63A 1YBFA 1FYWA 3QVKA 2LGJA 3TTVA 4HJRA 5BR8B 2A9PA 3GK3A 2FR1A 2R5NA 1ML4A 3L7IA 4UD2A 5CCBA 4NKRA 2Q99A 4C2AA 2DAPA 1NEBA 4UEKA 5FBWB 3E0QA 2Q9BA 3P2KA 3RVKA 4TQAA 4C4TA 3ZD7A 1KIKA 4AMYA 4RENA 1M2WA 1C7JA 2FLVA 3JWJA 4XCVA 5L3VA 5EIXA 3SXPA 4MW7A 2PZ8A 3RKXA 3ADBA 1F8UA 2W2PA 3T1NA 3MWJA 2WSYB 1C29B 5FB3A 3DSRA 4QJBA 4MLCA 1H1LB 1PZEA 1EGQA 9ABPA 2L8DA 2G3YA 4HNVA 4V2SA 5F51A 1LI7A 4E21A 4IDEA 3RCBA 4RUGA 2TMKA 5FWDA 3QXHA 4R41A 3MBIA 1PD0A 1CQJB 3AT1A 1WMDA 3CC2T 3N2KA 2CUDA 5KSYA 2JFNA 4O3MA 4RU1A 2NLOA 3E7PA 3O03A 3BDAA 4H31A 5REQA 3QZUA 3EE6A 4MW0A 4POAA 3W6PA 4F6RA 4URYR 1W4CA 5DW3A 1JLSA 4GSLA 2HREA 2CLHB 3CWZA 2CFSA 5LJ5j 2NZJA 5IHKA 1I80A 4ZYUA 2Z5VA 4G85A 3CC8A 4UBKA 5KE2A 3LWHA 4PANA 1N5LA 2VXOA 2AR7A 3D3EA 5IAGA 1CTQA 2HA3A 3U6KA 4BY9E 1HH4A 2C0IA 3P2JA 5A9SB 4PQYA 4IJVA 1TMGE 1WAMA 3PX3A 3GFGA 1VCOA 4GPZA 1Y7PA 3FSEA 4QEKA 4P86A 2FB9A 1J2TA 5DYTA 1XU9A 3KPJA 3L7LA 2WA2A 1TGYA 3ZCXA 1EFRD 5JQWA 5K3EA 1FP4B 2P4RA 1UDAA 2G77B 4WTOA 5LQDA 2PUCA 3CCUQ 5JADA 1C8VB 4YAIA 3TXXA 5F1OA 3VAZA 4BP3A 4NYIQ 3U19A 3BW1A 1XNRB 4TRMA 3FTDA 3ZHXA 3DR5A 1X7GA 3BBLA 3G3EA 1VTKA 2XMPA 1K9SA 1GCGA 2OAEA 4DL9A 1EHIA 4MGIR 1RYNA 1BWQA 5D1HA 1TXGA 1T3TA 2HXYA 2YDYA 3AK4A 4UE3S 3EIXA 3P2YA 4EELA 5C8VA 2PDAA 4KGXB 5JNWA 3I55Q 1MUUA 4E7PA 1ZNWA 3LA8A 3GA0A 4XIYA 3JZDA 1RAAB 3UPUA 3PNLA 4NEQA 2G3RA 4N3BA 5DKFA 4MB6A 4F14A 1Y07A 2IODA 3RASA 3FVRA 5DIFA 3PGGA 2Q5OA 4ISBA 3C3AA 2JFGA 2GA8A 2WIJA 1ZOSA 3TKYA 1OH5A 1AQIA 5IM4A 3WLSA 1UKVY 1Z6AA 1X7YB 4QW2A 1PJSA 4RPGA 4EFNA 3DT6A 3O47A 1ZZGA 1BX1A 1WBBA 2YS7A 1VSVA 1UBGA 3AZPA 1KGDA 4HZGA 1NVVR 3IBFA 3NTXA 2H3JA 2RH5A 4TKZA 2HSJA 3IYLW 1ZVVA 2NZUG 3CKYA 2ZXFA 2HCTA 4IWNA 2AOVA 3UC5A 1Y3FE 3SNKA 4YMGA 1EEXB 3CKLA 4EA9A 1PEYA 2WUWE 2P4UA 2LT4A 3ZNNA 4F5WA 3VYSB 1O57A 2B1IA 1UT5A 3O1JC 3A1FA 2MAMA 3RTAA 2JZNA 4ONEA 1OZ3A 4QX6A 1FX0A 1X2BA 3DOFA 4RA9A 4GO1A 1NJ5A 3NVMB 3ZK9A 4UD6A 3FGNA 4WK0B 4AG1C 1T9KA 2ZJAA 1JTVA 1E6EA 4PCVA 1QGUB 4F93B 1D1SA 4M77A 3IVXA 4U02A 1SD5A 2Z1DA 1PRLC 2FGJA 3IEUA 1HE2A 4JVLA 1TPZA 1GD1O 1IHOA 4IURA 3PX7A 5CXXA 4MV7A 1UODA 3QUCA 3ZCUA 4CCSA 2H1FA 5DGDA 3T5MA 1E58A 4MUGA 4RACA 3C6XA 2A94A 3UUEA 4B0PA 2P2YA 3OE7A 2V98A 3PKZA 1P60A 2ZRIA 3I1JA 4Y6RA 4GKVA 3BMCA 4OFZA 1RR6A 3M0EA 1ST3A 2I9KA 3UPDA 1QOZA 1GYRA 4E4TA 3NGPA 1OU8A 5KUTA 2R6GA 4P32A 2BEVA 3LSYA 1YF3A 2G28A 4DSAA 2D62A 3MJDA 3AHCA 4CLOB 4C5AA 3PPXA 3AESA 4ZHQB 1Y33E 1LUAA 2XUPA 1ODLA 1MV5A 4DSNA 5D5QA 2OCYC 3ROEA 4UNNA 3W4JA 3EMVA 1F1JA 3LOPA 3PPYA 1XF9A 4UTVA 4ZVVA 2VG8A 5FFMA 3SHQA 5GMOA 2FPSA 5DI9A 3AR9A 3M1AA 2R5MA 3NH9A 3UUWA 3MCUA 2O2ZA 4LRTB 4ZVRA 2J6BA 2DL7A 2RQUA 1YR7A 4KCGA 5LQAA 1TQ6A 5HIJA 4A8JA 4W82A 5JASA 5KYKA 4PNEA 2QZ4A 3GP5A 3GYGA 3GJQA 3MCZA 4JBLA 1GAEO 3OMXA 1H3NA 3KD2A 2P1DA 1MMDA 2OQIA 2IEGA 1LF0A 2O0MA 2YYZA 1E6UA 1E4VA 2JH3A 1Z73A 1TU4A 4CC2A 3M4ZA 4I19A 5IJWA 1D1PA 1POXA 4C4ZA 3E3LA 4O6VA 2MSNA 5FOXA 1XAJA 1BVUA 1VLQA 2ATXA 4G01B 2C5EA 4O4JA 2CUZA 1JUDA 3H9QA 5GADl 5EEGA 1LDGA 3R41A 4HGYA 3HNPA 4DAOA 1HT1E 5FWXB 1UAYA 2X5KO 4N5NA 1TJ3A 1W0JA 4Q9HA 1XAIA 4IIDA 4B35A 2DRKA 3FYSA 4LZWA 3PWZA 2KQWA 1HNWB 1BB9A 1FRNA 2WM8A 3WA6A 2PSJA 2E85A 4KQ6A 1QIJA 4UEQA 1CV2A 2JNGA 3GI1A 3RNJA 4JJKA 4V3CA 4GECA 3GGPA 3LPLA 1EPUA 1VQ7T 1UZLA 5CURA 1CWUA 2ORVA 4D4HA 3PFBA 1WJRA 1HL7A 5EHNA 1AGYA 3A1VA 3EW9A 4FM9A 1OY1A 2WDZA 1GTL1 3CMEA 2Y66A 3VJLA 4GMXA 2A1TR 3GEIA 4FZVA 3OOWA 5F3DA 5TQ2A 1WUJS 3ESYA 1P9NA 2P0AA 4FS3A 2X9VA 2NZYA 2R8ZA 1I7LA 4FNGA 5ILGA 1KRWA 1Z2AA 3CCMQ 2X7XA 4KJZA 2E4VA 2CZ0B 4ELYC 1FK8A 3LP6A 2QDYB 4F5YA 3L0YA 4YXWD 4QNMA 3TZ6A 1CUHA 1QVZA 1HDRA 3IMGA 3BFJA 4JI6B 1Y1PA 2Z8XA 3OZGA 1GZ3A 2YXDA 4GX0A 2WG2A 2OFFA 3VJPA 4KZPA 3K0HA 1RACA 1B2LA 4CTKA 2ZQYA 4W99A 1TOVA 3HL8A 4HNSA 1HDOA 2VF2A 4JROA 1Y7TA 4JDUA 3UAVA 4I3GA 3SF0A 4J6FA 3QHPA 2BBTA 4BI4A 1VCIA 3H19A 2QXYA 3TTUA 3C4QA 3NUQA 1XTDA 1R8XA 2NMVA 1RAGB 3RYCB 3UJ3X 2BE7A 4ZRNA 3B7PA 2V8JA 2F4VB 3M3PA 4TMTA 1ZA1A 1TW2A 2F3TA 5C5DA 1KRXA 2FPPB 4JLMA 1R00A 3L8MA 1FMVA 1WW8A 2ZLBA 4NXNB 3QE2A 4DYDA 4LMBA 2I67A 1NW6A 4C8QC 2A1UA 2CMKA 2BYTA 4H1TA 3NGLA 3E2PA 4YIHA 4IWYA 4ZO9A 3Q5GA 1DIGA 2O2HA 3CW2A 1IEQA 3ZE9A 1WUYA 2AUTA 5IC6A 2V5VA 4ZVSA 4Y91A 2AN5A 3R7AA 3RF7A 4QT0A 3U9SA 1HFKA 4E7HA 4BI3A 3WVNA 2OBFA 2CLMB 1KKMA 4Q4LA 1GZSA 5KTMA 3E3OA 2GN1A 5J4LA 5K3CA 3IP5A 4C7OB 3VYVA 2Y9MB 3A2NA 4L6CA 1JXAA 1QZZA 3P0JA 1UK8A 5AJWA 4Q21A 3H8ZA 3ZPXA 4HXEB 2J9RA 4J9UE 3GCXA 1Y1TA 4ILEA 3QVUA 3DBLB 2CMDA 1UANA 2C8JA 2B61A 1WB5A 1IJEA 1RPJA 3GB9A 4UW9A 3U0VA 3LW8A 2HUPA 1T3LA 3PQ6A 2QTHA 1GCUA 3CH5A 1X80A 2W2XA 3K0KA 3URKA 3GJSA 2XZDA 1NOKA 2XNHA 3W3ZB 3D1JA 3EXFA 1FUYB 1R8OB 3WGJA 3KKKA 4JT8A 4F86A 1L0BA 3PYMA 1NI5A 1PSZA 5LLTA 5IFLA 1PQUA 2LVMA 3DMFA 3N8DA 1X27A 3H2KA 4P34A 5CLHA 3ADOA 5FAXA 2AK5A 1RXCA 3SWNB 3UY4A 5DZSA 1SCQA 1P39A 5GWXA 2JLAA 3F73A 1QVGA 4K1LA 4TWZA 2HOQA 1RABB 3IDSA 2CXNA 2H1WA 1PU2A 3VMMA 5F1KA 1OGYA 2HA0A 2O2DA 5J40A 2ONKA 4DB4A 1TKRA 5GOTA 3V8LA 4UU1A 1FU4A 4OG2A 1XVIA 3UAZA 2X7JA 1XHFA 5C9ZA 1X43A 4ESOA 2OGZA 1VOTA 4Z7JA 3JQFA 3LX4A 1ND6A 5E6RA 1V95A 3FWPA 3SFVA 3NDIA 1AZWA 3BE4A 1YJBA 4Q47A 3U3OA 3GLVA 3FPEA 4AURA 2KROA 1VQLQ 5GAMg 1ACJA 4WKCA 4TS3A 2ZS9A 5GINE 5HPYB 2CXUA 1TIPA 4P4SA 3RYTC 2VL7A 3ID6C 5CXUA 4PGAA 1WUKS 2VTBA 3TZHA 1ID1A 2XHEA 2MIOA 1ZH0A 4BP8A 1GRRA 5E6SA 2X13A 4N1AA 1WKCA 3IIMA 1UXJA 4LRXA 4AKTA 1NLYA 3QJ6A 1UOPA 1HOTA 1OZHA 1Z35A 2IPXA 4YWHA 5A9RA 4ER3A 3CMMA 1TEVA 3KOWA 2JJ1D 3D7MA 2B35A 4WCFA 4RHCA 3C6KA 5CM8B 3KXIA 1I4K1 2J5RA 1ZIYA 4AKEA 2JGLA 4WVLA 4TYNA 3IHLA 4LBVA 1Q1NA 1FYEA 4MQMA 4XTXA 2WF8A 3KOMA 2EXXA 2FMTA 4BX0A 4S1NA 3H41A 3CZ9A 1QLYA 1GPUA 4AWXA 2ROQA 3LT0A 5CNMA 4L16A 3BMNB 4IJKA 3ZS9A 1P3JA 1SZDA 2VHJA 5IABA 1XZNA 3D3JA 4FYWB 1JWLA 1JVSA 1M66A 4M7WA 4AYXA 1KU6A 4X45A 2RGWA 4M9SA 3QHQA 3W6UA 2B3TA 1WUTA 2F1KA 5HCKA 4OGLA 4Y2PA 1CUAA 1COWD 2E48A 1WSDA 2TYSB 2Y27A 3HB7A 4DR4B 2ERXA 3DB3A 3H75A 5B6JA 4EATA 3W90A 2FMUA 1DAEA 2HJGA 1QVFP 3AUAA 3UENA 2ALJA 5G0TA 1L7DA 1BK2A 2NTYC 3F4KA 3IEMA 3TFQA 3DFKA 2GN2A 5KNBD 3C3XA 3L1AA 4LXCA 2GYUA 3NEAA 4JP3A 3I6IA 1P31A 1VG9B 2E4XA 4XM0A 4KGVA 3ZQ4A 2XVYA 1NXSA 1KD1C 4G0WA 4AN0A 2VASA 1GILA 4QECA 4QM6A 4JOQA 1QGOA 4EMKB 4K03A 4FFBB 4EWLA 3AF3A 4LYAA 7AT1A 1JPJA 2K2VA 1SUAA 1GRNA 1OI3A 2XTZA 2IZ7A 1I5EA 3UTCA 5FUYA 2I7TA 2WSFE 2HO5A 3F7TA 3X2EA 5EXXA 2Y9PB 5I8WA 2XSZA 4CCYA 3HO1A 1QVRA 2QQAA 3MSCA 3QUSA 1KOJA 2O2YA 3WLPA 1CJVC 4DDKA 1EZZA 4TRNA 1N36B 2A9RA 2DEQA 2C03A 2G09A 1Q0HA 2ID8A 1KJQA 3GH3A 1ZNXA 2AOWA 1EVQA 1DBSA 4KNWA 2ZQZA 4NX2A 1SHFA 3S3TA 2F62A 3MOSA 4ETNA 4NF2A 1M1YE 3A9VA 4ZVNA 1NQWA 3OF3A 4LXTA 1RZVA 3AILA 4JYAB 4L3OA 1MO3A 2HHCA 1YTUA 5JAIA 1D2GA 3OU2A 3DLLA 2YFYA 3CUTA 1TF2A 1GTZA 4H7KA 2ETVA 2OK7A 4HSGA 1KE2A 3OZTA 1CU1A 3WSWA 1JHQA 1Z68A 3KPWA 1W2GA 1XDUA 4V2UA 1UE9A 1RIIA 3LKZA 5HK3A 4X34A 5B1YA 1JQJC 2HFJA 3FUCA 1FOEB 4MIEA 4HNHA 1E5DA 4YJHB 1LK7A 5KTPA 4X95A 1PC0A 3CONA 1O87A 4TM7A 4XLLA 2B7BA 1VCMA 3LBHA 3X2FA 4WBNF 2HDNB 2R47A 1K27A 3OBBA 2VUIB 5FF9A 2YIVX 1JQDA 4YAWA 3WL5A 5DH9A 4CWAA 2IHTA 4RIFA 4Z8XA 4FYVB 5K4GA 1LVHA 3R5TA 1B2RA 1NONA 1AA6A 4FW2A 3P4XA 1E1RA 1UDWA 3KQTA 2IH5A 4CG2A 1O94D 4B40A 2L0XA 4DJAA 2KM1A 5DBHX 2QG9B 1EE2A 4UQPA 5JJLA 2ED0A 4YMLA 2E9SA 2HW8A 2VP4A 1EGVB 1TD9A 1HKHA 4WJZA 1Q95G 3HVRA 5G02A 2A14A 3FRHA 3I92A 4I1SA 3L7CA 2HL3A 2J33A 1QCDA 3RBXA 3CCRT 2OHIA 3G79A 2CUBA 3KR0A 1PJAA 4RFSA 4BRWA 4ZANA 1VA5A 4GPD1 3MC1A 2CBGA 2HXGA 3L7KA 1SHTX 4CI0B 4RA6A 2R6AA 1ZGZA 3DCYA 5CJPA 1MAWA 3S44A 4G07A 3F5QA 4PWYA 3RO7A 1C3XA 2PE5A 1MZPA 1KHCA 4BNLA 4HPWA 1J33A 2QAZA 2FNAA 3L2OB 4R16A 2V7VA 2LCSA 2GXAA 2J8ZA 3ZNPA 4KMOA 2E5KA 3PDHA 3R3SA 5CVCA 2CSIA 2RB4A 2D8HA 3R6TA 1OI7A 3ZW9A 1CQPA 1AURA 3PEEA 1YHYA 3FPSA 3IO3A 4GR5A 3K0SA 4BMNA 4YMIA 1W52X 4EM6A 1Q86C 3F7NA 4ZGJB 4B17A 2IOQA 3SP1A 1E9EA 1U5BB 1D4ZA 2RHGB 2I54A 3GRPA 1X7ZB 3SXUA 5JLAA 3AHFA 3PDJA 3CJTA 1MN6A 5GONB 5BN5B 3L7MA 4DKXA 3EG5A 3IEXA 3CTMA 1EHCA 2WJVA 4DCTA 1FCJA 1PVDA 4RMOA 1E66A 2FXIA 4YI3A 3H4TA 2EFDB 3FNEA 2GVNA 3MQ2A 4K8OA 1NVUQ 2BKVA 4OMOA 1DKPA 1XLTC 4OOEA 2IUFA 1SOWA 2RG1A 3MFQA 3COYA 3RVBA 1NWCA 2C8LA 4EW6A 3OYCA 2C2MA 1D2HA 4QQRA 2IVZA 3WK8A 2YJNA 4MLZA 2V8BA 1T9ZA 3G8AA 4Q93A 3S8MA 4AUKA 1R5JA 2G1UA 5G4LA 3DBIA 2XUHA 5IMSA 4F4CA 4L0DA 1P2FA 2WYHA 1WUHS 2XH8A 3OM1A 5M3BA 4GWKA 2ZOSA 1QIDA 1V96A 2UUBB 4L4UA 4OHFA 5LJIA 3E35A 1BMTA 4YJ3F 1NF2A 2RJNA 3CF0A 3EC7A 4GYYA 4IS2A 2KSSA 3FLAA 3G1TA 1CB0A 2AEEA 3HADA 3WAJA 3WFJA 4BNKA 1S7GA 1GAXA 4DBLC 2CV0A 3TJZA 3EUFA 2N0SA 3HGTA 3CBMA 3TIIA 2J4FA 2H8KA 2W2QA 1AKEA 4HT3B 2W2TA 1WABA 5JY6A 4DM7A 3N7AA 4EAQA 5PGMA 3LHKA 4CU2A 2O8CA 4IG9A 3OYKA 1GG2A 3Q98A 3R0QA 1W96A 1QRSA 3ZGVA 3GLIB 2QLBA 4BXOA 4H4CA 1T8WA 4MLPA 1H0RA 5CVDA 2NZVG 1WXFA 2EW1A 1PJQA 3U7EB 3RUAA 2IYZA 3T7EA 1WPRA 2JFXA 5KNDH 3URMA 1T1RA 1FSZA 3ZE0B 4EHIA 1T91A 1TTPB 3GUCA 2Y93A 2XDYA 1UFQA 2PKXA 5L4LA 1AMNA 4C5CA 4TSFD 4OY3A 2WWRA 3EOZA 1WULS 5T3UA 4XM1A 4DDMA 1W4RA 2JGNA 3F2VA 3FI0A 2ZIZA 3N2NA 1N2EA 5E3JA 3OS5A 3B9QA 3LFTA 4F3YA 1EFLA 5HCNA 3PGJA 2CJFA 4D1YA 3MJXA 1LW6E 5J4KA 2BGGA 4HUTA 2OESA 5G1OA 2B99A 3HY4A 4AZWA 1DWUA 2GJ9A 2WIDA 4EKYA 4ZV4A 3Q3EA 4KNVA 4CKBB 4B7UA 2Q5CA 2JRCA 3IX7A 2CL6X 2PVGB 5LJ3f 4YUXA 3SZ3A 2YWFA 1YR3A 4W8GA 4S2EA 2RC5A 4C4OA 2IOFK 4GOMD 2A3RA 3ETHA 4M75C 1G59A 3IQEA 1JHRA 2IDKA 3A25A 2ZRCA 3DYVA 4IMRA 2IE0A 3IA7A 5T6MA 2VVTA 1K5DA 2QMZA 2HNBA 4J91A 5IM5A 5GAN3 3VV2A 2EKZA 3EGIA 3FIJA 5A5VA 3EDRA 2DMOA 2W98A 5EZYA 3I56A 1KPGA 5A04A 3PXBA 3R9KA 1Y96B 4ZGGA 4MMLA 3OPMA 5DNVA 5IN4A 4YRMA 4J2HA 2UYOA 2H1HA 1Q7YC 2J3EA 3TW8B 3KJXA 2G5PA 4V0OA 1WD7A 2ZT8A 4FOSA 2PR7A 1ECCA 4KMSA 1MPTA 3AZOA 3HV0A 4JRKA 4RUKA 5KCMA 3RADC 4QTTB 5SZHB 4KDRA 3AY0A 4MA4A 1FYNA 1I4OA 3OQVA 3LAWA 2FOIA 4ZYVA 2F1LA 2RHBA 3VSAA 1Y1QA 1M75A 4FWIB 2DK3A 4JDSA 3OSSC 4AMVA 3EG1A 3JQEA 4I9UA 1UFRA 3UTDA 1OR8A 1D1TA 4GLJA 2GDZA 1GU0A 3GUUA 3A1PA 1XZGA 1YKGA 2ANCA 3FNRA 1QX4A 3I2YX 3OYJA 1SQSA 3M4JA 3CMEQ 1J5XA 2WIBA 3U81A 4XLTA 4L5BA 1AVTA 2WQ6A 1CHNA 1UM8A 3MJHA 4N5DA 2R3SA 2KY9A 3ZD6A 2WZCA 3GDGA 5IVDA 1G42A 4PINA 3KZOA 1JA1A 4D3YA 4RQTA 5TB5A 3GP3A 3CH6A 2IS4A 5IW8A 3L8DA 1SK9A 4OJMX 4C8QA 2ODPA 1Z6PA 4AQYB 4AKGA 2CNWA 3CHYA 5CX1B 4BAUA 3I58A 1DELA 2XTJA 1G41A 4TOIA 5IS2A 3QKRA 3M82A 2H4WA 4KO3S 3GA5A 4B3FX 1QQAA 4LF8B 4KXFB 1B3RA 4JJZA 1R8JA 1U02A 1OXKB 2HAXA 1J49A 1EYZA 4UUBA 3FCXA 1IWPB 2GPNA 3KZ1E 4M21A 3LI2A 2ZBDA 2AH5A 4TL9A 3U44A 2G08A 1W581 3NMUF 2CXSA 2H00A 2H07A 4Z4QA 3WLEA 1KSHA 3GJ3A 2WTBA 2QL6A 4YUAA 1PZGA 1YB6A 2IXGA 2VUBA 4G5QA 3VH2A 3OT1A 4A4DA 4K3UA 2C98A 5M9OA 4FFMA 4X7MA 3EEIA 2QK4A 3ZKAA 3AUKA 3RFTA 1F6WA 4PLLA 5KU1A 3FJYA 1TUIA 3O3CA 3AXSA 3EYWA 4ZPJA 1ZOOA 2FDCA 4KXLA 2R79A 2V1UA 4UCWA 5GIPE 3AR2A 1M2FA 2C20A 5BSHA 4EGCB 2AXPA 4BNIA 2ZUVA 1KAEA 4MO2A 2NN3C 5SZKB 2V4MA 1H2XA 1P7YA 2NX2A 2F1HA 2LCFA 3K4PA 4LYFA 1HNXB 1PJZA 1W19A 3A31A 1KO1A 2FSGA 1XJ0A 1XHEA 3FW1A 3JV7A 4UHCA 2Y4YA 2N9UA 5KYUB 3UMYA 4QUAA 2LQ8A 4HDAA 3FTPA 4NZPA 5F5XA 3IILA 4MDFA 1F60A 3HMKA 1GNLA 1O96B 1NXWA 5AHKA 4PW0A 3T1HB 1Z4QA 3R24A 3N5CA 3BSFA 2A2ZA 4YDSA 4BGIA 3ZE1B 4D8KA 5HIAA 2HJ9A 2NVWA 1OX8A 2REXB 1QH1A 4OLHA 4GWLA 3PNSA 5I48A 4NP6A 1HQKA 4GI1A 1AC5A 4MW2A 1WHSB 1RPAA 1GSHA 2Q8QA 2K9GA 4Q48A 3HU1A 4U9IS 1A98A 1CF4A 2NVUB 3C48A 4MVJF 1W4AA 3CZ4A 3QQPA 3OTHA 1FFXB 1TGVA 1CEEA 2JD1A 2YJ3A 5TVGA 1GGHA 3U1TA 3TR6A