3TVTA

Structural basis for discs large interaction with pins
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
282
structure length
255
Chain Sequence
SLYVRALFDYDPGLPFKHGDILHVTNASDDEWWQARRVLGIVPSKRRWERKMRAVLSYEAVQRLSINYTRPVIILGPLKDRINDDLISEYPDKFGSCVPHTTRPKREYEVDGRDYHFVSSREQMERDIQNHLFIEAGQYNDNLYGTSVASVREVAEKGKHCILDVSGNAIKRLQVAQLYPVAVFIKPKSVDSVMEMNRRMTEEQAKKTYERAIKMEQEFGEYFTGVVQGDTIEEIYSKVKSMIWSQSGPTIWVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large 1 tumor suppressor protein
publication title Structural basis for Discs Large interaction with Pins
rcsb
source organism Drosophila melanogaster
molecule tags Antitumor protein/protein binding
total genus 78
structure length 255
sequence length 282
ec nomenclature
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3tvtA01
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 3tvtA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3tvtA02
1XXHB 3KQHA 1WXUA 2M0YA 4PHFA 1SXJB 1LFDB 1KSFX 1QHGA 2MSDB 4TQ9A 4DLXA 4OI0A 4HAVA 5IHIA 4EUNA 2HXYA 2ZR7A 3WRXC 5KO2A 1WA5A 2WV9A 3E2IA 4MUAA 3GJ0A 4PPNA 1I2MA 1W0JD 1G7TA 3QBTA 1HA3A 1S0UA 1EK0A 1F2TA 1X86B 4OYHA 4RY2A 2BDTA 2JIZD 2XTNA 1P3JA 1I4TD 3D8BA 2OHFA 4C2UA 1NLOC 4A0RA 1AS3A 3GD7A 4DLTA 2DB3A 2F2WA 1KMHB 2A7QA 2NPIA 3KQLA 4HSEA 4OI4A 5JI2E 4PC7A 4D82A 3QSYA 4Z89A 2J7KA 3IKJA 4DUGD 2ZU6A 2IYUA 1GILA 1CEEA 3QWXX 1YQTA 2QAGA 1ZUYA 2QAGC 3BAFA 4JPBW 4TL8A 2GTPA 1QKWA 4G3XA 2HF9A 4ACBA 1K4US 1A4RA 4YDSA 4UXIA 4PAOA 3DPUA 1HV8A 2JMAA 3L0SA 2FEOA 2PX3A 2YINC 1VIYA 4ON9A 1G16A 3DM5A 1OYWA 3QJYA 1NIJA 3BBPA 1U8AA 2O8FB 1IJFA 3V9PA 1AZGB 4F93B 2LQWA 4PC3A 2PZEA 4OMOA 1EFUA 1M1YE 3I32A 1D2MA 2D74A 2FRYA 5H1YA 4D80A 1N6HA 2V1RA 4WOPA 3B13B 3EIEA 2FPDA 2GETA 2C98A 2QGNA 2YWGA 3TSZA 2Q3MA 2FO0A 4JVNA 5EP3A 5KOYA 1YVDA 3W6NA 3ZVNA 3KKMA 2DVJA 2D7DA 5K8UA 1QG4A 2IXEA 1CKBA 1E79A 2KBTA 1VG1A 1DBSA 4IKEA 3AVYA 2GBQA 1Q44A 1EFRD 2A5GA 3HPQA 1ZUIA 1SVLA 4XJXA 1G9XA 3UA6A 5A4JA 2EVWX 5EUQB 3R20A 1QHSA 1OB2A 1Z83A 4KFTA 4KFUA 1GKYA 2AWNA 2P65A 1UJ0A 1Z9QA 5FR2A 1KSGA 2IW3A 2WJYA 1NKTA 3PITA 2OCBA 4QFMA 2X19A 2LWIA 3EC1A 1E9BA 1FNNA 2WJGA 3KUCA 3EA5A 4NONA 3FGNA 4CZ2A 2WPDA 2HUPA 4HUTA 3U7HB 3MFYA 3CQTA 1OFIA 4NYMQ 4X8OA 1D8TA 2F1HA 3BOSA 4LV6A 5FL3A 1ZAKA 2X3WD 4GRAA 3PUWA 2NWMA 1G8YA 2OZEA 1TU3A 4N0DA 2O2OA 2O8CA 4WZBE 2G0TA 3I4LA 3T1OA 3Q7QA 2LKCA 4UQOA 4BGDA 2ZREA 1G6OA 4JSYA 2J5XA 4FIDA 1E2LA 2QT1A 1GCPA 5JHGB 4NCHA 1G291 1WRBA 1GL5A 121PA 2VWFA 4PAQA 1KI7A 1A1VA 1G21E 2W10A 1TF5A 3CRVA 4II7A 4BLQA 2CHQA 3LV8A 3MMPA 4F92B 3MWYW 3LD9A 2C0OA 2CCJA 3BRWD 1E0AA 1M3CA 1T3LA 3ECCA 4I1UA 5E7JA 4OI1A 2LJ3A 4JT4A 1GNPA 2WWHA 4D81A 2JTEA 1TUCA 4LHXA 5B2ZA 3REGA 1V1CA 1CULC 3AF2A 3LWNA 2FPEA 2QG6A 4CDGA 2RGDA 3AKDA 4QBIA 1ZNYA 4HAZA 4GP7A 1TX4B 4Q4AA 1AJEA 2EBPA 1UADA 2B7BA 3N70A 3R7WB 4B34A 1QCFA 1YNZA 4KYIB 1GL6A 4QRHA 1DOAA 2ZI3A 4KSBA 3SJZA 1XCGB 2ZEJA 1SVKA 3M0RA 4LN2A 2HLDD 2QEQA 4W5HA 2XXAA 1S1NA 3VS3A 1K0SA 2DPXA 2CL6X 1XD2B 3I62A 4QJ3A 2JW4A 2AWOA 2AD5A 5BYKA 1F2UB 1UKEA 1YR6A 3FFAA 3FMPB 4QGGA 3GJ6A 1IN8A 3BH0A 1UAAA 2YSQA 1GRRA 1GRIA 5KSYA 1OYYA 3C0CA 3KQKA 1KO5A 2P2LA 3VMFA 2EYQA 2AD1A 4XOIA 4ESRA 4EPXA 2NG1A 2ZJBA 1BYIA 3IBYA 2IX3A 1ZW6A 2IYZA 5FUWA 5L3QA 4M53A 2O88A 1ZC4A 3MRSA 5DN6A 2JJ2A 1X2KA 2CCKA 3MGCA 4D2IA 5JSZA 3AVUA 4YMVA 2IYVA 3H0HA 4DJTA 4RJLA 4B3GA 5LD2C 3H0IA 2OLKA 5HKKA 5AJYA 4JLVA 1TF7A 2W2VA 3FHCB 3MUFA 3M4YA 4GLMA 3P26A 2YUQA 2FPLA 4JLKA 4DDVA 1GKIA 1FPMA 2DWQA 3A4MA 1HTWA 2HBWA 2HCBA 1WMSA 5I22A 1OLOA 3CB4A 3J81k 5JEDA 2QRNA 5J5CA 4AKEA 2GTJA 1HUQA 1XNJA 2NOAA 2XTZA 3LFUA 3OFND 4LSGA 2JLUA 1WIEA 4KODA 1XTJA 1XZPA 4S2EA 2XOKA 4PO1A 5A0FA 2P6UA 2NQ2C 4Y0AA 1P72A 1J8MF 2HF8A 4FW9A 1KDTA 4LJ4A 2KB0A 2E87A 2A36A 4F38A 3LNCA 2V6JA 4M4SA 1NG1A 4PZLA 3RLFA 2VHQA 3VR4A 1TTTA 4TMVA 1OXXK 4OJKA 3SOPA 2KT8A 3IEUA 3H4MA 4JLPA 1KI9A 2NUZA 4OBEA 4Q02A 3KFXA 1EGAA 4O2RA 3W3ZB 4DCTA 5SZHB 3QF7A 4MRSA 4KBGA 4LPSA 2VHTA 4M1SA 3FMOB 4ERNA 2R2AA 3I8SA 1OW3B 5BYJA 4DIEA 1E2GA 2ODWA 2ZRIA 4P4SB 3PJRA 1AD5A 3BS4A 4D25A 3HYRA 3K53A 1IXSB 4RFSA 3UXMA 3R8FA 2PJZA 1LF0A 1XMVA 3PR1A 2A5YB 4JIMA 3VKGA 3VRYA 3K0CA 3K0CC 2D06A 4HLQB 2WAYA 3LW7A 4XD7D 4QKQA 2CNWD 1T4GA 1OFTA 2ZITA 3NH9A 2OCYC 1JB1A 2ERXA 5EE5B 5JJIA 5DI3A 1PKTA 4J9DA 1R7RA 1NI3A 1FTSA 3KXIA 1R6BX 4LRWA 5KPDA 1YZUA 3K1JA 1CJTC 4HI0E 1R0YA 1Z0AA 1PLLA 4QNMA 2BM0A 3QPWA 1I07A 4CEJA 2FEMA 4B2PA 5JJKA 1RE0A 1S9HA 1G4AE 2WAXA 1BMFA 1ETUA 2LP5A 1ZU5A 2CBZA 3AF3A 3I72A 3LVRE 2QY9A 1K1ZA 4A6XA 1H92A 1RVDA 4JT2A 5FPKA 2BZYA 5EQTA 4R7ZA 4JLOA 3W8NA 3KFVA 3CPHA 2WWIA 2GNCA 2PH1A 3AEZA 1TMKA 3MCAA 4GI7A 1M8PA 1Z6XA 2G0NA 1SVWA 4ZCIA 1J7KA 4RTUA 2HCKA 4X8LA 1SVOA 2IS1A 4KFRA 4HAYA 5AJZA 2OUKA 3SDZA 2VP0A 3RABA 1W1FA 3Q8XB 1H65A 2V7QD 3U4QA 4RUGA 4AG1C 2C0IA 4KXFB 2J7PD 3D31A 2YDLA 2IT1A 3PUYA 1X43A 3AF4A 4DWJA 3OIWA 3UKDA 2CH4A 2RQVA 4EPWA 1NF3A 1CSKA 5ECAA 4OK5A 4G5GA 3C8UA 1NEBA 2L0XA 3I5YA 1G3IA 1ZBJA 2Z83A 3IEVA 4MRRA 3P27A 4NKRA 2ED0A 4HVWA 3DMDA 5D3MA 1ZUHA 2RMKA 1VECA 2ORWA 3LXRA 2IWHA 1XPOA 1RRFA 4JKIA 2Z4RA 2AX4A 1XTRA 1ARKA 4MGIR 1YRAA 2J06A 4JL6A 4AYTA 2OE2A 5TB5A 4BFYA 1E2MA 2JCSA 2O31A 4PFSA 2AR7A 2A08A 1XTSA 4WBSA 1KI6B 2MCNA 5C1BA 1Z5ZA 2EU8A 4G1UC 3NKVA 3L0PA 1VDZA 2VSFA 4C3ZA 5GVSA 1ZIOA 3ZZUA 4ZV4A 5BN3A 4AFSC 3SJCA 3L8YA 1FMJA 2J6KA 2KRMA 1D2NA 1R4AA 2CJWB 2YJTD 4XSGA 5BN5A 2KYBA 1NM7A 2C9CA 4URUR 5IDVA 4Z8AA 2FZ4A 4LJ7A 4AWXA 1WBDA 3IQLA 4DCSA 3GJ8A 4KLZA 4RD6A 4L15A 3TSWA 2BC9A 3SN6A 4LHWA 4ZI3A 2AZSA 3JVVA 4WXRA 4B3XA 1P75A 4NMMA 2WMNB 3SJBA 5JEEA 4FCWA 3U7FB 1CRPA 1HEIA 3WRYC 4XWAA 4DSTA 5KYKA 3TLXA 3GLHA 1C1YA 1IY0A 2CLSA 2D1XA 3CNLA 4BZXA 4DDTA 2QMOA 5CDFE 1RPZA 4NCIA 2ZAMA 3LBIA 4HUQB 1ZIPA 3EG1A 2GXUA 2VHUA 2KE9A 1YR9A 1WB9A 3A1SA 2DL5A 4XSHA 3L0OA 1WDXA 4Q18A 2D4HA 4AC9A 1S1CA 3GLGA 3WYAA 2GDJA 5J4HA 2JLZA 1YZGA 3LBNA 1P2UA 2QT0A 3UG6A 5H8WA 5DHAA 2FGJA 2QUZA 1CU1A 4RD4A 4CVNA 1Z07A 3T1TA 4OHXA 3Q9LA 1SZPA 3B9QA 1DPFA 1A2KC 3DZDA 1GFCA 4YC7A 2GF0A 2RHDA 3ZS8A 2K3BA 1M3BA 4YLGA 1JNYA 4PHGA 3I92A 3FKQA 2RGAA 4TZ0A 1WX6A 2C5LA 3VS1A 1CLUA 2ZE6A 2Q0HA 2FPFA 2OILA 2ODEA 4PSVA 1E2IA 1GAJA 1LNZA 4ARZA 5EZ6B 1Y0MA 4KRTA 3GFTA 1Q1ZA 3EWSA 1VHTA 2QSYA 3THWB 2Q9BA 5TXGA 5CYOA 1ESMA 5J4LA 4YONB 5IHNA 2GWHA 4B71A 5JCZA 2QP9X 2IS4A 4YMUA 3WP0A 1P9RA 3DDCA 2R62A 2JEOA 4L9SA 1BB9A 3TQFA 4AK9A 3OEEA 1BU1A 4IOLA 4TT3D 4UXJA 5AUQA 4A8JA 1UBCA 4A8JC 5FTLA 4D0LB 4EJSB 1XXHA 2JS0A 3RRMA 1SHGA 1W2GA 4GZLA 3RS5A 1SXJA 4IIMA 1SXJC 4LV8B 5LBIA 4TL6A 3NPFA 3IHLA 2E9SA 3FTQA 5FWBA 3NDBB 4BEBA 4WA7A 3EIQA 3B8HA 2XNDA 1XPRA 1DELA 1KJZA 2QZ4A 2DBKA 4D8KA 1M7HA 4GBQA 3G5UA 4I4LA 3SFVA 2JA1A 4PR0A 1G6HA 3RANA 1KMHA 5KDOA 1VHLA 2VA8A 2WKQA 5KDDA 4RVCA 4FD2A 2XTMA 3DMNA 4OI2A 4L8GA 4KAXA 2FSHA 4WIAA 2RQWA 1G41A 4Q1FA 4XH9B 1UGVA 1S2MA 4PHTA 2YC4C 5FPYA 3FHTA 2EQIA 2VP2A 1Z6GA 2VL7A 4J9HA 4Z1MA 3RSOA 1FNMA 3BB4A 4DSNA 3WP1B 3AVWA 1OEBA 1N3BA 2JT4A 3B9PA 4LYFA 3WBJA 4MUBA 2EYXA 1OH8A 3E5HA 3NWJA 1QVRA 3QI2A 1II0A 2WVJA 1BKDR 1XBTA 2VSXA 3M0EA 4PPQA 3F8TA 1PWTA 3EPLA 1AWJA 1N2CE 3NIBA 1XTIA 3SE0A 1CR4A 5GJBA 1KO4A 2YV5A 1HSQA 5HZKA 3AF0A 1UG1A 3BGWA 1MUZA 3TSOA 4C7OB 4XWKA 2B6HA 1SULA 1E32A 3LW8A 3QKRA 3QF4B 4FXPA 4B74A 1E9EA 5KDLA 2FWRA 1RJ9B 1UEIA 3EASA 4AI6A 1IAQA 1L2TA 2Q9CA 1IN7A 1GZSA 1XD9A 5EUMA 1MRNA 3G0HA 1ANKA 4R9UC 4HZUA 2OI3A 1N0WA 1JALA 4EPTA 1U06A 1T5LA 4GPTA 2ZYTX 3TAUA 1FUUA 5JHHB 3FWYA 4CC7A 5FTNA 1Z6AA 1KY2A 1GKUB 2OFOA 4TTPA 1NG2A 3AVTA 4CGZA 2ZAOA 4Z8XA 3O8RA 1FTNA 3EW9A 5G40A 1XCPA 5JRJA 3ULRB 2F3TA 4Q01A 4U5XA 1OF1A 4CF7A 1Z9ZA 4DRZA 3W90A 3WNCA 3GLIE 3C16C 3QPUA 1OPKA 1MO3A 1DO0A 1WXQA 4JJKA 4ZDWA 3OIVA 4GDFA 1J99A 1K8RA 5HZHA 1U9IA 3GEHA 1U9IC 4PSAA 4TQAA 3RS7A 4PZYA 4FWTA 4RD3A 1GL7A 4IVPA 1DADA 1Q21A 2C95A 2VSOA 4IOKA 2W6ID 2X2EA 5KHOC 2FFQA 2GJSA 4RKEA 1QWEA 3UATA 1G17A 3RWMB 2NO6A 1JECA 2JS2A 3AVVA 1IN6A 4W5WA 1W5TA 4ASUD 3HJNA 2G1JA 3K0FA 1YR8A 4M1WA 4Q5IA 3TH5A 1NVVQ 5E7IA 2BJWA 1S4QA 2ZRPA 4TLCA 3UPUA 1AIPA 1TEXA 4PX9A 2GESA 3AGQA 5EP4A 3NEYA 4LJ5A 5CITA 5L3SB 4JJDA 3NH6A 4Q1CA 1SGWA 1WCV1 4TMWA 3R7WA 4FMDB 1H8HD 1XOVA 1FZQA 2ZRFA 4Y0VA 4GL2A 5KUTA 1TF2A 5H68A 1KHTA 4M4ZA 2F1IA 1ZYUA 3U6BA 1YZTA 2NO1A 4G5SA 5DI9A 1EWRA 5HCNA 1Z3IX 2HYIC 2A28A 2QGZA 1MT0A 2ZUDA 1QBKC 3ZDQA 4QHTA 2GNOA 3I3SR 1Y63A 2PJRA 1QKXA 1X2QA 1L4UA 2JIZA 4IDPA 4DLZA 5JLJA 2GAAA 3CBQA 4PC1A 1HH4A 1P7CA 3LQRA 3ND9A 5LB4A 1RLQC 2GZDA 4O0MA 4DUGA 3REBB 4DCNA 3DO6A 1BIFA 3VNUA 2Z6VA 3CRW1 4D0NA 2OFWA 1NY5A 3AVOA 4EPVA 3BH6A 3T5DA 4IDOA 4B6FA 4DC9A 1TL7C 3LVQE 1B0UA 2WICA 2ZJ8A 2WM9B 2JLXA 4GOKA 3RS4A 2H1LA 1XPUA 4U00A 5HPYB 2DMOA 2NGRA 3P4YA 2OAP1 2VP5A 3THXA 1S3GA 3D6TB 3RC8A 4OQNA 2KRNA 1TU4A 2QBYB 5CB8A 4TYQA 1XZQA 2ZI5A 3OE7A 3NGPA 1P9NA 3CONA 5BQ5A 4HLDA 4TN1A 4A0HA 1Q1QA 1T91A 2VEDA 2VF8A 3PIRA 4V0OA 2IEYA 2J0UB 4A82A 1I4LD 1O87A 1TQ6A 1ZJ6A 2WSSA 4LUEA 4OK6A 4LCBA 2XZOA 1IXRC 2QAJA 3ASZA 4LYAA 4XIGS 3UWOA 1KO1A 2QMUA 3RHFA 3RSLA 3MSXA 1ZM9A 2RQTA 5TVKA 1FW6A 3RS3A 2XMFA 1WLPB 3VS4A 2WBLC 1EFRA 2CSIA 2FEIA 5FBQB 1KKMA 2P4RA 4UNNA 3X1DA 4OHYA 1ZD8A 4JL8A 2F55A 2ZVPX 3P1JA 1U8YA 5JFGA 2XXAB 4IFEA 4P4SA 2GKSA 4CEHB 4EFLA 2HJVA 5DE3A 1COWA 1E2HA 1OIVA 3PEYA 3A4NA 1E98A 4IDHA 4P4TA 4GMDA 3EPJA 1TEVA 2CVFA 2JATA 3IGFA 1JAIA 1OXVA 1IJEA 4HDQB 3EG5A 4V02A 4FCTA 4E5UA 5EE9A 3X1XA 2X1VA 3V4RA 4O3MA 3LAWA 4RCZA 2ASEA 2VO1A 1XMJA 4ZKEA 5FTKA 1JR3D 2B21A 3LY5A 1X69A 4BFSA 4CYMA 3I61A 2EYUA 3NHAA 1D9ZA 4GOXA 4N0EA 4ABYA 1KI1A 4D6PA 1KK0A 2O8EB 2GF9A 3OEHA 2C99A 1QVAA 1ZC3A 4HCKA 4LYJA 1AS2A 1M6NA 2J7IA 1T9HA 2JAQA 4LHZA 2DRKA 4DT1B 3CO5A 1KMQA 4YQFA 1AZEA 2Z0MA 2OBNA 2OAQ1 5FR1A 1LS6A 2VQSA 3DHWC 4BLSA 1IM2A 3ZZ0A 5KNDA 3ND8A 5GJCA 4RZ3A 2F6RA 3CZQA 2ROLA 3ZD7A 3UMRA 2DBYA 4NCJA 4R98A 3U23A 2ZU0C 4C2TA 3H0FA 1T0HA 3TKLA 1WF3A 3PCRB 4B73A 2F2VA 2M51A 3SYKA 1N0UA 3VAAA 3BFKA 3AP3A 1J3TA 1KI8A 2FFBA 2XB2A 4ZIRB 4B2IA 4HVVA 4E09A 4ZCMA 4LDJA 3A6PC 1M7BA 3TR0A 1P61B 2ZS9A 1AN0A 4NYJR 1NEGA 1CJUC 5JS8A 1SVMA 1LVGA 1R10A 2HLDA 2VP6A 2WIBA 5TMPA 1W36B 3Q5EA 1E2EA 4JZ3A 1IOZA 1WXBA 2CK3A 3BB1A 2GCNA 4LX0A 4A15A 1G7CA 1SKQA 4QM6A 4NPHA 2ONKA 3ZQ6A 2WKRA 2GA8A 2VTKA 1A5TA 2BCGY 1E0KA 1G8GA 5BXQC 2IBMA 4FMCF 3LRPA 3U60B 1VMAA 1F6BA 5AJVB 4B3DA 2F1RA 4Y92A 3T61A 2FN4A 2L0AA 4F17A 3RBBB 1KI6A 4UXHA 5CLQA 1AZTA 2IXFA 4ZCLA 2ZJOA 5ELXA 1ZUNB 1X6VA 1N0VC 1NVWQ 2C77A 3QKSB 4I1SA 3THYB 2P6RA 4KO8A 1PJRA 1J90A 2CJWA 4YDHB 2CDTA 3DL0A 1VYVA 3W8RA 5J47A 3QOFA 1HURA 2ZSFA 4D26A 2BBOA 2QU8A 2R6FA 3PQCA 5CYPA 3MG9A 3EZ2A 5EE3A 1W0KD 2IYYA 4M21A 1OH5A 3ZVLA 3AGPA 1BO6A 3T12A 2OT3B 1YJ5A 3OFNA 3QG1A 1MH1A 3BIFA 3S1AB 4BUJA 1UJYA 2JM9A 2PZ1A 3AKYA 3D3QA 1YCSB 3WYGA 1A7JA 4K46A 3MWKA 3ZD6A 2ZJZA 5DYIA 1XCMA 3BB3A 2H8KA 3MWLA 4DHEA 4G0NA 5IT5A 2V1XA 1E2PA 4V0NA 4IEEA 1SRMA 1HQYE 2BZ8A 5FUYA 3GLIB 3KKPA 2LJ0A 4M1KA 5DYGA 1VYUA 2G6FX 2W00A 3OAAA 4NHOA 3U44B 5A5GA 3RRNA 1X6GA 1N5IA 5SZJA 2CUBA 1E1RA 1H8EA 2F9MA 3LLUA 1YE8A 3CWQA 5B64A 1N6RA 2BVNA 2RGNA 2RGNC 4CC2A 3H1TA 4TQUS 4B48A 3TQCA 2XB4A 2DL7A 3BFXA 4NDZA 3I8XA 1TUEA 1G5TA 2AHOA 3MJRA 2W2XA 2J1LA 3PUZA 3TE6A 1EFNA 2QM7A 4LOAA 2LJ1A 4NYMR 2VP4A 4XD7A 2O8DB 1KTVA 3A1TA 2H57A 1G3UA 1U99A 1Z47A 1WQ1R 1N6PA 1OH7A 2JLYA 5G3ZA 1GRNA 1FP7A 1G7RA 2VBCA 4L5BA 1M74A 4GNKA 1SEMA 1XEXA 4TLEA 4Q9HA 1J8YF 1S3SA 2DLPA 2NTYC 1LS1A 1NMXA 2PEZA 1HY3A 2KSQA 5FBLB 5JCPA 3DKVA 4Q4JB 5CIWA 2GVZC 1AQUA 2P0EA 1R5NA 2IL1A 4NTZA 1CR2A 3WNBA 4BE7B 4HLUA 4HLUC 3CLVA 1B23P 221PA 3RRYA 3X1WA 3GJ7A 1N5JA 1OPLA 2ZM5A 4RZ2A 2I1QA 1NVXQ 2DFNA 4OKSA 3LBHA 1OFUX 4ZKDA 2H8HA 1SVIA 2FPKA 2J05A 1F60A 3AH8A 4EKDA 4FN5A 1GIAA 3HU1A 1L8QA 4DLUA 4RTYA 2KBFA 2J45A 1I4DD 1MABA 4O2LA 5DLQC 1OXSC 1MV5A 1P2SA 4DEXA 1XEFA 1E2JA 2J7PA 2UZ3A 2VH5R 2ZJAA 3C41J 4KBFA 3R9XA 3QXSA 5KPJA 3SQXA 3B82A 1DAFA 4P0TA 2GJAA 1NSTA 5LB2A 2YUNA 4Q1AA 2FZLA 4AFUC 3QVVA 3SBDA 4YMTA 1W6XA 1LY1A 1KAOA 2OXCA 2H7VA 4JYCA 3THOA 4RTZA 4QBFA 2OBMA 1G3RA 3BFVA 2DA9A 3VU9B 2K6DA 3T34A 2WWWA 4P31A 4K81B 3L82B 4BLRA 4EIWA 3N2EA 2NMVA 4F7WA 5IHPA 2YOGA 3AM1A 2ZI9A 3F3YA 1II8A 1Z8FA 4LK2A 2VF7A 5GJWC 2WPDD 1B07A 4NBSA 4NU0A 4OMMA 1X8KA 3ZS9A 1XDBA 2F1JA 3Q7PA 1LCKA 2ECKA 1D6JA 1KI3A 1PZNA 1R0XA 2YC2C 2DWOA 2KT1A 5JBQA 2ZSAA 4OQLA 1E9CA 5CJPA 5H70A 2ERYA 5JECA 4CEIA 1T8UA 3KTAB 1TNDA 2EWWA 5IK2A 1VG9B 2YOHA 3OIYA 2FH5B 5C18A 1SVSA 1AKEA 2G88A 3PEVA 2ZSEA 3AV0B 4L16A 1RJ9A 4POAA 4AY2A 1IONA 4CC4B 3ICQB 5LDDC 2RQRA 2QPTA 1VCIA 1ZMXA 2R44A 2NZ8A 2BTTA 4M0LA 3KUDA 5KSPA 1ZX6A 4QJ4A 4JLMA 5JWRA 3ADBA 2J3EA 3CF2A 4GP6A 1NLFA 1TAGA 1IO6A 2FFHA 2EPDA 2B86A 1GRQA 4B44A 4YXWA 1KFZA 3O8BA 2G9NA 4LYHA 2QTFA 1UHFA 1W5SA 4B2LA 1V43A 2YUPA 3B1VA 3ZZTA 5AK0A 1GOTA 1E9RA 3E70C 3TUJC 1NN1A 3NTUA 4XWOA 1GNQA 1W2HA 2UZIR 4Q9JA 4Q03A 3SU8A 2LMJA 4ACAA 4JVMA 1DAKA 3NC1C 3PVQA 2ZROA 3EG3A 1V5WA 4WAUA 3W34A 1PNJA 1AOJA 1NBME 3L43A 2OG2A 1S8FA 3B78A 4Q4HB 4Z54A 3QEJA 2C03A 1D2EA 1GNRA 2WKPA 4TYPA 4V03A 3I5RA 4B3CA 3IO3A 3HP1A 3EGUA 1JPNA 3C14C 2HEQA 1F2TB 4RSGA 4RD0A 3M0TA 3BC1A 2LKDA 5DN6D 4LE9A 3VNVA 4URXR 2J59A 2J6FA 3REAB 4KYUA 2A9KA 2OAWA 1K0XA 4Q19A 2QAGB 1YWOA 5HKKD 3GQBA 1G5PA 1E0SA 5F9FA 4DEYA 2JMCA 4IVQA 2Q21A 2E1RA 2R65A 1G8FA 5G41A 1ZBDA 4TT3A 4J9FA 1NSFA 3RWOA 5E3HA 2CUDA 3K09A 5KNCA 3K09C 1NG9A 4BFVA 1XMIA 5GVRA 1FX0B 1W47A 3TVTA 3QBVA 3BERA 1KSJA 2DNUA 2FSIA 2ZE8A 3A1UA 3LQQA 5E95A 4GBMA 1BS1A 3M0UA 1SHZA 2ZRLA 3B7GA 4CW7A 4TMKA 4Z88A 3U3KA 2R9VA 3WXMA 3MD0A 2FMXA 4C0BA 2AK3A 4A0FA 1N6LA 1Q22A 3IUYA 1ZRHA 3WMFA 1E3MA 1GDDA 1UPTA 2KJQA 5EXXA 4PO8A 3SBEA 2QI9C 2ENMA 3JV3A 2MSEB 3AUXA 1WFWA 2CT3A 5AJWA 2C8VA 5IH2A 5FL7A 2D8HA 3ZQJA 3VS7A 1Z2AA 1UBEA 1U98A 5D3QA 2CXXA 4HZIA 1FOEB 2DL3A 1JJVA 1XF9A 2BBTA 4ITRC 5AWFC 3KJEA 3GFPA 3H41A 3B2EA 3P32A 4BRWA 2ATXA 3UMSA 1CP2A 1U0HC 2ZE5A 4P4UA 3WYFA 2EWVA 3IHWA 1XEWY 4BWYA 2K2MA 3WMGA 5CDFA 5I11A 2PT5A 2J46A 3DEFA 4JLAA 2QBYA 2C9YA 2CHVA 1KO7A 3NMZC 3U3MA 3EG0A 2LCSA 2IUSA 4M1YA 2CL7X 2ZI7A 2ZTSA 4MKIA 2C9OA 3TK1A 1AGPA 1JU5C 4NH0A 1ZLMA 1PLJA 2X2FA 1Z08A 1Q1BA 4TYWA 3QQ5A 2J0UA 2RGXA 3U6KA 1BBZA 1XWIA 1NYFA 1K5DA 2O8CB 2H92A 2PNIA 3LDAA 1E2DA 3N2IA 2JASA 1US8A 4Q1BA 4BLOA 2DJQA 1NRJB 5FOTA 2VRWA 1BMFD 4YMSA 3GLFE 1HE1C 2IC5A 4LUCA 4FMBB 5AR1A 1KDRA 1MV0B 1XJQA 1G3MA 2Q9AA 3SFZA 3CWZA 1NBMD 4XVUA 2CL0X 3KB1A 5FBVB 1N6IA 2W6JA 2XJ4A 3HU2A 3VKHA 2KI5A 4IXMA 1EG7A 2GJ9A 1MO6A 1MOZA 2J0VA 4CEHA 1OKKD 4EQ6B 3EC2A 1JQJC 3QKTA 1GM5A 3LX8A 1JXMA 4HATA 3E1SA 1I2DA 2AZVA 4JMPA 4JVLA 2KR3A 3H2YA 1VA7A 3DVLA 3A98A 1X8LA 2MSCB 3NVAA 4BFTA 1F48A 4Q4AB 1NIPA 1Z6YA 2G6BA 4X8MA 2O8BB 3CNOA 1X6BA 2GEDA 3EHRA 4JLJA 4PZZA 4BLPA 5BN4A 5L3VA 1YN8A 1CJVC 2J0SA 2W0SA 2O8EA 4D4LA 4GFDA 1KZ7B 2GCOB 3I9QA 3CX7A 3QXCA 2XX3A 3EA0A 3GJXC 4L9WA 3LH5A 4MKFA 2IWRA 1YHNA 1F5NA 3KB2A 3ICEA 1LF5A 2ORVA 3K8YA 421PA 1KOFA 5FPTA 4CC3A 1G4UR 4ASUA 1K6MA 1D5CA 2RCNA 2HJGA 2KBEA 3UMFA 1NJGA 1GCQA 1YR7A 1GCQC 2X77A 3RRZA 3O8CA 1EFCA 1G8PA 5L3QB 2SRCA 3KXLA 1JR6A 5FUXA 2ED1A 1E99A 1P4SA 2N46A 2QE7A 2ZSDA 3T06B 4NCKA 1OV3A 1W44A 2HEIA 3ZIAA 3TW4A 1OH6A 4ORZA 4TL7A 2XSZA 2YHSA 4I81A 3SQWA 1RKBA 3ASYA 1W4AA 3C5HA 1S1MA 4ZIRA 2CCGA 2QPOA 2K7AA 1E2FA 4PXAA 1KIKA 3W6PA 3VX4A 4W5JA 5GADl 1NY6A 1Z0IA 4LC1A 1K5GA 5DIFA 1AA9A 3DOEA 1H8HA 1WDTA 2ZE7A 1W36C 2O8FA 3ZH9B 2R8RA 1H3HA 1FP6A 2FE4A 1X1RA 4TWZA 1ZNWA 2ZR9A 5IF9A 1N5KA 3VR2A 2CVHA 4KCGA 1P5ZB 2QP4A 1AM4D 1D9XA 3EWAA 4G5QA 4JYBA 4A1FA 1YZQA 2JDID 4M9QA 5FI1B 3M1IA 3B1XA 3K9LA 5J4YA 1ZU4A 3WY9A 4JBXA 4TTQA 2VYFA 5F3WB 2ZJ2A 3H0KA 1QRAA 4NCNA 2RKOA 2PCJA 4M1TA 2FF7A 3IBGA 4MYTA 1MR3F 4JKYA 4OQFA 1OE0A 2WIAA 4HEJA 1C9KA 2DWPA 4LY6A 1TUDA 4JLNA 2SEMA 2QQEA 2EW1A 4M9SA 3C15C 2W58A 2WHXA 5GJVB 1EESA 1FMKA 4QHSA 4PQYA 1VIAA 1FL9A 1M8MA 1RI9A 2BIFA 3S1AA 3CF6R 2KXDA 4TYYA 4IIOA 4B3BA 4NP6A 4HB2A 4GOJA 2RGCA 2J41A 3I35A 2OM2A 4BFWA 2CLCX 2OJ2A 3Q72A 5DI3B 2GTOA 2QSZA 1OIXA 3MAAC 4IJMA 1VG0B 4OHWA 1CKAA 3FJ5A 3GLIA 6Q21A 2O9SA 1YZNA 2REXB 4NYIQ 4DCVA 4R71A 3U44A 3R9WA 1E1QD 4QGAA 1GL9B 1XFAA 1NN3A 1X27A 1A82A 3EARA 2N1BA 3H86A 3K9GA 1ODFA 1JBKA 2QTVB 1HQCA 5EJEA 1DE0A 2CREA 2DF6A 1N6NA 2W83A 4TSFD 1WA7A 2IEZA 4B3FX 2LNHB 1HE8B 3K70D 3VR3A 1E7OA 3M0QA 4C0KA 5JI3E 4RD2A 1QLYA 2QMHA 2EYYA 1JR3E 3NBXX 5DISB 3TNFA 1PVOA 2O8DA 1UE9A 2B92A 4HAXA 2YUOA 3C7KA 3ADCA 3QENA 2V1QA 3IIMA 3REFA 1UBFA 3U4QB 1UJ2A 2IYLD 4MRVA 4CT4B 2ZRGA 4GMXA 1OT3A 3D7MA 4HB3A 4URYR 2H17A 3AVQA 1Z6TA 4JSTA 2EYWA 1KJYA 1XD2A 2V9PA 4IOJA 5JJLA 4A2WA 5JS7A 1XX6A 4Q47A 1JPJA 1F2UA 3P20A 3UANA 3CF0A 4QHYA 3X1YA 1CR0A 1VCOA 1W49A 4QBGB 4Q4JA 5D3MB 4U02A 5FTMA 1GSIA 4PPFA 2MOXA 5FFMA 4BZPA 4RTXA 1W0JA 1IN5A 2GXAA 1HT1E 2A2ZA 2AFHE 4PAMA 1Z0FA 4C0SA 3LLMA 2BZXA 5EE0A 4Z1MD 1KDPA 4QG7A 1NJFA 2PT7A 4J9GA 4TTRA 5FTJA 2N42A 2VKNA 5FBRB 4LBYA 3P4XA 3VX3A 4ESHA 4MGYR 2AKKA 2Z5FA 1IY1A 2ODBA 3KL4A 1NNEA 2J87A 1TQ4A 1Z0JA 2P5SA 1FYNA 2AKAB 4FSSA 2JLWA 1SPKA 2IYSA 2ORIA 2ZVQX 2L3SA 1CJKC 1HT2E 3VFDA 4DXAA 2FOLA 1S96A 2D62A 1SQ5A 1VCMA 3DZ8A 1E9FA 4J9EA 1W1WA 1XJCA 3K0AB 1XMSA 4LJYA 3EAQA 1P60A 3A36A 4W9MC 2ANBA 3A37A 1CS4C 5K8LA 5G53C 2DFLA 1RRCA 2EYZA 3F5FA 1OB5A 2G83A 2A5FA 1T5IA 2AL7A 4XTRA 5TY0A 4S35A 4J9BA 2LZ6B 3ZL7C 3GLHB 4UNQA 4XTCS 3CM0A 4H1VA 2GILA 3GBQA 4V0ME 3SI7A 1ZM7A 2ZPTX 1UDXA 3TAHA 1GVNB 5ANRB 2VHJA 2IUUA 4BZQA 3ZYCA 3CUEF 2EFCB 5KTYA 1PKSA 5DSZA 2IUTA 3FKSD 3KKNA 3VHLB 4OQMA 2HSPA 3C5CA 1JXOA 4JBYA 5E7MA 1JEGA 3DKPA 2BKUA 2C0TA 4Z51A 3UG7A 1CIPA 3BJIC 3GLFB 5HTKA 4RCYA 1TPZA 2JXBA 1ZSGA 3KKQA 4R2IA 1DAGA 4F4IA 1ZM4A 3AP2A 3EIHA 3KJHA 3SYLA 3ZLJA 2YWFA 1DS6A 2YOFA 1U94A 2HDAA 1QHYA 4BPBA 1NLYA 2W2TA 4X8HA 1E2NA 1ESNA 2I3BA 4HDCA 3VQTA 2Q6TA 2WJVA 1ZUKA 3O47A 1W46A 2RPNA 3FOZA 2ZRBA 4JLDA 2FV8A 3F0TA 2QP3A 3U7GA 3PVLA 4IRUB 4M9ZA 1N6KA 1RIFA 2QRZA 2DL8A 3C4JA 1MRSA 4FINA 1E69A 1MO5A 1N5ZA 3LXXA 3B6EA 1OXUA 4Q21A 3NHBA 3OIUA 2O0KA 4IW3B 3VTKA 4C0HA 2RMOA 2SHKA 1EFTA 1VTKA 4KJZA 2KGTA 3RYTC 3WMEA 2YNMA 3SYNA 3N5CA 4XVQA 1I1JA 3WHKA 5JZVA 2PX0A 3QKUA 2EGAA 5AUNB 2REOA 4J9CA 2ZYUX 3FMFA 2FSGA 3TR5A 1M34E 1VPLA 1SKYE 1RYFA 2IYXA 3FB4A 2G3YA 1GFDA 4NYJQ 4DCUA 3K70B 1Q3HA 1Q12A 4Q1DA 2VPPA 1ZCAA 3RC3A 1GP2A 4Q4HA 3EPHA 1VKJA 1IQPA 3EZ6A 4OK3A 1EX6A 1KDOA 1C4OA 2EFDB 4QC2A 1XRJA 3W5IA 2W0MA 2JJ1D 2ZI6A 1DO2A 4A2PA 4Q7JB 4KVGA 4IFBA 2EGEA 4PC6A 3KQNA 3QNUA 2XAUA 3SEAA 1WP9A 4MYUA 2YT6A 1E96A 2C2HA 2V8OA 4E6RA 4Q1EA 5B58C 2P67A 4LBZA 1SHKA 4QM7A 1E0JA 1P2TA 1UBGA 1TUIA 3HYTA 4WZ6A 1KJWA 2EFEB 2OESA 3B1WA 4DLWA 3GJ4A 2QENA 1GITA 2F2XA 4DLSA 2HXSA 2AKLA 2AK2A 3BXZA 5HCKA 4OMQA 4DLVA 2OCPA 1PV4A 1R8SA 1B3QA 2QDLA 5AUOB 4Q7KA 5L8VA 1Q1EA 1FX0A 1UF9A 1Z63A 3U5ZB 5EC7A 1QF9A 2RHMA 1T8TA 2RGBA 1RFLA 3EZ7A 4QL3A 1QWFA 1UKVY 3ZJYA 1N6OA 2EVRA 4HXJA 3ADDA 1Y3AA 3OE7D 3I5XA 2G77B 3BWDD 1SSHA 1GBRA 2IHBA 4OHVA 4V0KA 3RS0A 5EZ5A 1WE2A 4WW0A 4F16A 2WSSD 1OHHD 1OXTA 2BBWA 4KSCA 5KSZA 3L0IB 1U2RA 3QKRB 1UKZA 2ZETA 4IEIA 4P3YA 2ZXUA 2DFKB 1AGRA 2CE2X 2H18A 2WOOA 2EKHA 2CSQA 2K5UA 2BM1A 4G5OA 1GG2A 4HUQA 4A9AA 2BV3A 3T1QA 4I1OA 4HZUB 2GXSA 3HR8A 4PO9A 4MDEA 4M1MA 2IYRA 2H16A 4F4CA 1LTQA 3TGPA 1ABOA 4ESVA 2V4ZA 1COWD 2QN6A 3KJIA 2FFAA 2R6CA 3GMTA 3QY0A 4IOMA 3CRRA 5FH9A 3NDPA 2O0HA 4QBHA 1RYHA 4E22A 3QG5A 1M2OB 2D2EA 2IS6A 1LB1B 3OZXA 3QXHA 1KNQA 2DILA 4A63B 2NO7A 2IXGA 5UKDA 3QXXA 2PZGA 3OEHD 3QUSA 4DSUA 3AF1A 2Y8EA 2YWEA 1KKLA 5JWHA 4UNSA 2AXPA 3GEIA 2CNWA 3PEUA 4X1VA 3CZPA 5IXFA 1YWPA 3VKWA 2FJUA 4WZAE 4RZXA 5EP2A 4PC2A 3R6NA 3LO5A 4F91B 2WJIA 2V1UA 4LNPA 4M8NE 3GEEA 1RRGA 4O25A 3AP1A 1KI2A 2BMJA 3K0FB 4R2HA 4DLYA 4EQ6A 1WBBA 3JZMA 5HCIA 3THWA 4JJCA 4RFVA 1UUEA 3R8CA 3AQ4A 1RC8A 4Q4LA 1DAEA 5CK4A 1E4YA 2O5VA 3CW2A 821PA 4ZPXA 3A1WA 2WWFA 1WYXA 1XTQA 2O0JA 3U3OA 2YZ2A 621PA 2O8BA 1P62B 5L3RA 5HR5A 5CB6A 4EJSA 1Z06A 1OIWA 4EJSC 1J70A 4Q66C 1EFHA 4WVFA 3W6OA 2AKYA 2F43B 2ATVA 2GCOA 2ZRDA 2CK3D 1GWNA 3QEOA 5SZIA 3CR7A 2DYKA 2Z4SA 5EE1A 1M27C 1QHNA 1YZKA 2GZHA 2V7QA 1U90A 2KWIA 4UJ5A 3VHXA 4BEJA 3O5ZA 4CRWB 1E94E 3PUXA 2HDNB 1ONBA 3NC0C 4UKDA 1FMLA 2IIMA 1G3QA 2I0NA 1KGDA 3QE0A 4QOSA 721PA 4LWZA 1QHXA 1FUKA 4C4PA 4OQXA 1JEDA 4B33A 1QHHB 4D4JA 1E79D 3TUZC 2ZS8A 2PCLA 2KE5A 3DOFA 4ILEA 3KX2A 4BQSA 1SRLA 1UEJA 3H84A 3T5GA 2I4IA 4HVUA 3K0EA 4OHZA 4I1VA 1AK2A 2FG0A 2RB4A 5KNBA 2XJ9A 3VS6A 3BD9A 3CRMA 3DM9B 1KYIA 1TG0A 3RNJA 1OJLA 4MDFA 1L7VC 2D2FA 1M7GA 3CRQA 4PANA 4TMXA 4QGFA 1FQJA 2WWGA 3THXB 2PLRA 4HB0A 4RKFA 1DAHA 4KFSA 1ELOA 2RH5A 2ZUBA 4LJ9A 1AQYA 3IDQA 1TQ2A 2EW3A 1SHFA 3M6AA 3VR5A 5F2EA 3KZ1E 1K9AA 1Z28A 2GCPA 2RNAA 3AKCA 2B7CA 2GGRA 2W0ZA 1DAMA 4PHHA 2VIIA 3FDIA 2XZPA 3U3JA 1DG3A 2JLVA 5L23A 4C7OA 4LV5B 2BEJA 4DIDA 1AWXA 4J9IA 3QF4A 1LV7A 5CJ2A 3RDPA 2WSMA 4AG5A 3OAAD 2CHGA 2REBA 2ZYVX 4LJ6A 5HE8A 5KSOA 4HAWA 3LX5A 1E1RD 4FMDF 1N25A 2GEUA 1H8ED 1X3SA 5LPNA 2GJKA 1AWWA 3HU3A 4MKGA 2XZLA 4JJBA 1E4VA 3CPJB 4H1UA 1E9AA 5GJVC 2CT4A 5FOSA 2EGCA 2XEXA 4C0JA 2JM8A 5F9HA 3WNDA 3BK7A 2OSBA 1KK2A 4CIDA 3VS5A 1T0JB 1AEYA 2JLSA 4IDQA 2VP9A 4UJ3A 2PMKA 1I0CA 1XEWX 2ZQ5A 4GT1A 1PHTA 2PMDA 2UKDA 4B43A 5C2JB 2R6DA 4RTTA 2JLQA 4B35A 2QNRA 2LQNA 1DAIA 2BEKA 3JZAA 4B6EA 2JGNA 5CK5A 3ZVRA 2DR3A 4PQRA 3GJ5A 4KI0A 2WWYA 1IN4A 1ZM3A 4DDWA 2ZRMA 3W5JA 1W7AA 3UIEA 1NLZA 1JO8A 1Z29A 5J40A 4C0LA 4MQBA 1RLPC 2K9GA 4NZYA 2MIOA 1JQLB 3G82C 4AFZC 2X3XD 1DG1G 1SKYB 1E2KA 3RVBA 2GJ8A 1R5OA 4A0GA 2DCUA 4AIIA 1NBMA 1G7SA 1DARA 1T3SA 1W4RA 2H5EA 3A8TA 2V3CC 5CIQA 3EHQA 3B60A 1F3OA 4D4MA 3NBYC 1YZLA 2LX7A 2JJ2D 4Z8YA 2EQBA 4MGKR 1OKKA 5AUPB 2ZRKA 3GJ3A 3NEJA 4JBWA 1KZGB 2KYMA 1KK1A 2DRMA 4JZ4A 1KNXA 1BK2A 1QDEA 1T0HB 1ZD9A 2FX3A 2QL6A 4RTVA 2UVQA 4RD1A 4BASA 1U5SA 2FRWA 1Z22A 5CM9C 4QXAA 1CBUA 1ZD1A 2BMDA 2BWJA 4M9XA 2ECZA 5FOVA 2A5JA 2ZRAA 1XD8A 1KY3A 2HCJB 2ZRCA 1G83A 3NHNA 4AKGA 5B57C 2A78A 3TUIC 3SHWA 3Q85A 4ZO4A 1A2BA 3M0SA 2CLDX 2GK7A 4JS0A 2XOKD 4AD8A 1WXTA 5FOXA 5DNYB 3I1FA 3QWYA 2RF0A 3VR1A 2YKGA 4BLTA 3PE0A 2QA5A 1NMZA 3JVUA 2IF2A 5FWCA 1RZ3A 2E5KA 2VHCA 4JL5A 4PPGA 4LGMA 1R0WA 3KKOA 5EP1A 3L8ZA 3V4FA 3QPVA 2QTHA 4Q9IA 3ZGXA 1UHCA 3A1VA 1K76A 3AUYA 4G01B 2DBMA 4DBLC 4EAQA 1KK3A 2QQ0A 2J6OA 1RW4A 2WOJA 3BORA 3X1ZA 5K8IA 4TZ6A 4AG2C 3IPYA 2ESWA 3CNNA 3AB3A 1Y57A 3ONWA 2QMEA 3U7EB 1WI7A 4FCVA 3Q3JB 3WBKA 1CTQA 4MRPA 3K0AA 4N1AA 4BRUA 5IK2D 3GLHE 1Q3TA 4WXPA 3TIFA 1QHIA 4NL4H 5SZKB 4C9BA 2HT1A 2XITA 4LHYA 2ZJYA 1ZINA 4KV9A 4LPKA 1OOTA 2RAPA 2VLIA 2JDIA 3UF4A 3ZVMA 1OFHA 2AFIE 1ZP6A 2V6IA 4M1OA 1ZNXA 2BJVA 2GHIA 1ABQA 4N3NA 5E4FA 4MKHA 3GLGE 1NP6A 3K9HA 5J4VA 1GFIA 3CKLA 4YXWD 2FNAA 4LBWA 2R6GA 1CJMA 4BFXA 1Q0UA 5EXTA 2VVKA 1LW7A 2V54A 3HPRA 1NL3A 2WTUA 2PLFA 4URWR 5IXBA 3TMKA 1ZUUA 2BBSA 2O9VA 2BOVA 4OJQA 2GQIA 4PSKA 5TARA 4B75A 5BW8A 2GXQA 4R0KA 1UECA 2FA9A 1VG8A 2PZFA 2TMKA 4JJZA 1QZXA 3GLFA 3EPKA 1X1SA 2ODNA 3PFIA 3TW8B 1AWOA 3UWKA 2IS2A 4C30A 4E03A 1IHUA 4FMCB 3V00A 5IRCD 3HR7A 4URVR 4DSOA 2KNBB 4LZZA 3BH7A 1U0LA 1W48A 4PTLA 4DB4A 2DHRA 5FBWB 3W9YA 2FPMA 4G5RA 1ZVQA 5FPHA 5FW9A 4BFZA 4QT7A 2ZUCA 2Q3FA 2WMOB 2K79A 1YKSA 2EFGA 1UTIA 4OL0A 4ZI2A 4K11A 2RGEA 2NO9A 5DGXA 2HV8A 4TLBA 4D0GA 4AKIA 2DL4A 1XEXB 3NG1A 2PBRA 1XJ0A 3AVPA 2ZANA 4URZR 3PXGA 4OMNA 1R2QA 1E1QA 1Z2CA 2BCJQ 2W6IA 3FHOA 1GTVA 4DT1A 1EWQA 5AJXA 1EX7A 2B8TA 1VYTA 1KI4A 1XXHE 2AN9A 1YRBA 3EXAA 1SXJE 3FMIA 1HYQA 1XU4A 5L3SA 3LA6A 2RGGA 1TQDA 3K0SA 1G5RA 4XVRA 2D0NA 2GBLA 2IA5A 2GBLC 4TSFA 3B85A 5JSZB 1ZNZA 4LBVA 3K70C 4MYHA 1KSHA 4Q7LA 3CH5A 2OV2A 4MH0R 2Z43A 5DHFA 3FVQA 1EXMA 5LD2B 4YMWA 2C96A 2GAOA 2P5TB 3EZ9A 1U81A 4Q48A 3HWSA 3I73A 1MABB 1HD3A 1XTKA 1KO8A 2A5DA 2C04A 3PV0A 1U0JA 4Q9LA 4UNPA 4KHZA 3WHLA 4AKHA 4A4DA 1J2JA 3ETLA 4KU4A 3GP8A 3W3AA 4EIKA 3NXSA 1G2BA 1KIMA 2DYBA 5K8TA 4E07A 5FL7D 4PQFA 3M0PA 2OEPA 2L3PA 1T3HA 1PRLC 2P6NA 4W7SA 1NMYA 2F3RA 3OESA 1CKEA 2CEAA 3A58B 1JJ7A 3NBZC 1DVRA 4AFQC 4L4UA 4AYWA 3GFOA 1OSNA 2D7CA 1G8HA 1II8B 5DH9A 1YU9A 4MITA 3QKSA 3SR0A 1X8JA 5GJWB 1G64A 3THYA 521PA 2KEAA 4MYCA 2A3RA 5FOWA 3THKA 1RUWA 2F9LA 1W4BA 2IK8A 1KSWA 4IVRA 3AKEA 4DVGA 3SS8A 4HLCA 4ZDJA 3U61B 5JRZA 2IF0A 4CEIB 3I5SA 3IO5A 1CR1A 2NO0A 4QJ5A 2BHRA 2ZRJA 1P2VA 1P9WA 2BKEA 3PEWA 4RFSB 3VRZA 4JLBA 2XGJA 5JMTA 3FE2A 2Q3HA 3B5JA 3FFBA 1U8ZA 2A30A 4EFNA 4HB4A 2DFTA 1AKYA 4EPYA 4MRNA 3IIJA 1PRMC 5HE9A 4J0QA 2YVUA 3PVSA 2FU5C 3K9NA 2CDNA 4RZUA 2W6JD 4P32A 2MMGA 2KXCA 4B32A 3TBKA 2ZIAA 4F4JA 1BH2A 2NZJA 4CEJB 3T15A 2AK5A 3L2OB 2G1KA 1R0ZA 2DE0X 3NBFA 3PG5A 1FQKA 5FPSA 2CH4W 2KROA 2JJ8A 2IYQA 1MO4A 1UDLA 3FKSA 4B76A 2OO7A 2RQUA 1A0NB 2ZSBA 1H8KA 2BMEA 3VS0A 1P73A 3A4LA 2X8AA 2WJJA 2LCFA 1PUJA 3HDTA 5EXPA 5C4MA 4K8OA 1G19A 3OEED 3SZRA 4HYYA 3UA7A 1Q20A 1E9SA 1AS0A 5B30A 2B8WA 3IPXA 3RNLA 2D8JA 3T1VA 4DZZA 1SXJD 4FI3C 3VS2A 4C0AC 4A36A 4HDOB 3B1YA 2NIPA 1UFFA 3X2SA 1NLPC 2IYTA 5P21A 4RTWA 2XNDD 1MV3A 3FPAA 4U7DA 1T6NA 4I99A 3FYHA 1JR3A 2BMFA 2GVDC 1O3YA 1IXZA 2FDCA 2O52A 4NYIR 2YYZA 3IQWA 4IDNA 2ZJ5A 1M3AA 1P6XA 1BYUA 4UNRA 4LJ8A 2FGKA 3GCGA 4OMLA 2DX1A 2QE7D 2A37A 4MA4A 1W70A 3ZIAD 5M04A 4QNRA 1W4CA 2XSZD 5J4KA 2QPAA 2C78A 4US0R 3SC3A 4ZDIA 1MKYA 3VR6A 4DLRA 5FUVA 4LUDA 3QXJA 3RAPR 1NVVR 4B47A 4FWIB 3GPLA 5TDHA 5F98A 1E6GA 4A6PA 3IILA 1ZCBA 4TYNA 3TRFA 4BFUA 4CT5A 1W36D 4LJAA 3AVXA 2AXNA 2DM1A 2F43A 1UM8A 4ZDKA 4TLDA 3IQXA 3PUVA 1E6HA 3SJAA 3R9IA 1JAHA 1YP5A 2D3WA 2F7SA 2GZAA 2P3SA 1DTSA 2FSFA 2OFXA 3CPEA 4US2R 1BOFA 1FFHA 1UFQA 1E6CA 4TLAA 2V55B 1S9DA 2JJ1A 2ZYWX 2ZRHA 4TMZA 5CM8B 4F14A 2ANCA 1AVZC 2DY1A 4DKXA 4NE2A 4H9GA 4LI0A 4TMTA 2OBLA 1OV4A 4OMPA 3TVDA 1VCNA 4BECA 2GRJA 2RN8A 1QHHA 3QIAA 4Q9KA 4AG6A 2ROTA 3ADKA 4HAUA 3MLEA 2OLJA 3EG2A 1CRQA 1R5BA 3QVUA 4D8DA 4Q7MB 3VU9A 4A92A 4DDUA 1NVUQ 5DO9A 1AZSC 2ONJA 2NPFA 1Z0DA 4AYXA 5FOUA 3CX8A 4IHQA 1Q57A 4QGHA 1G20E 4M2LA 3RS2A 1JEEA 2GEVA 1GUAA 2ZI4A 1NN0A 2YWHA 5CLLA 2JLRA 2ABLA 4C0QC 1NKSA 3KXKA 2OXRA 4V0MA 2EFHB 5BWMA 5G3YA 5C4GB 4GSYA 1NN5A 2XNSA 2PEYA 3EX7C 3U3RA 2L2PA 1CXZA 3GLGB 3SNHA 2PL3A 4EFMA 2CE7A 3SHFA 3KJGA 4KLNA 4M22A 1G18A 2I1VB 3B1ZA 2MMCA 4MGZR 3TJZA 2L3QA 3MJHA 1NYGA 1OPXA 3KDSE 3KTAA 4D4KA 4EPRA 1W0KA 3OHMA 1L4YA 1II9A 2ZR0A 4TL9A 1OHHA 1U3OA 4ZNXA 1HJDA 3CH4B 1QG2A 2R6AA 1US8B 1RRPA 3OF5A 1IBRA 4IXNA 4KVAA 4A2QA 1GBQA 4JZKA 2KRSA 2ZRNA 1E2QA 5JWOA 2CMKA 1XB2A 1UKYA 1UDWA 1E9DA 2WZQA 4US1R 3U2QA 3PENA 5KU1A 3EZFA 3CIOA 5TV2A 3Q5DA 4LC0A 3CR8A 8OHMA 1R8QA 4JVSB 5EXSA 2WJHA 2QORA 1TADA 1G1MA 4WCIA 1IY2A 1XP8A 4P33A 3UK6A 3KQUA 4ARZB 1Z0KA 2QROA 4AURA 1M30A 1N5LA 1T0JA 3T35A 1CF4A 2J9RA 3BE4A 2IHYA 2J0QA 1KAGA 4V0LA 2FG5A 2HT6A 1ZM2A 2ZS7A 4Q00A 5C46F 2IYWA 3O8DA 5FI0B 4EDHA 4KITB 2QM8A 4DB2A 1JQQA 1PLKA 3IIKA 2WWXA 2PTKA 1DEKA 3SEMA 2HYDA 5IHKA 3CX6A 4A8JB 4LHVA 1PUIA 2OCAA 4GZMA 3MWJA 1JI0A 2GK6A
chains in the Genus database with same CATH superfamily
4MMLA 1QE3A 4HAVA 3WRXA 5JG7A 4MUAA 5E6SB 4Q12A 1G7TA 2H1WA 1HA3A 1ONPA 1MNEA 4YAJA 3O8LA 2KQUA 2XT9A 4DMMA 2A7QA 5H5JA 2I3AA 1CZLA 2GBCA 2ZU6A 3AF6A 1Z4NA 3U49A 1NQUA 1N5DA 2RHIA 4LWPA 4ZMSA 3QJYA 1U8AA 3NOVA 4ZGWA 3I32A 3ER6A 2O1WA 3EIEA 1YC2A 4PX2A 3ZVNA 1P5RA 5K8UA 1HG1A 1PTJA 1Z4JA 3HPQA 3UKJA 3R20A 4NEHB 4KO1S 2OENG 4P58A 2AWNA 5H3LA 1RWXA 2GEFA 2WLSA 3EA5A 1AXRA 4YA6A 5B55A 3A0RB 1YJWQ 4Q3NA 1XUOA 1X7HA 4CR6A 1PV1A 4G0ZA 2X3WD 5FWYA 1ZH0A 3NUZA 1ZIYA 2FR8C 1H5QA 2HA6A 3F46A 2J5XA 2PL9A 1VQMQ 5CH3A 4RSHA 5JHGB 1WRBA 3CD6A 4RL6A 3EUEA 4II7A 2F3UA 2HL3A 1JIUA 5BURA 4FYVB 4RNDB 3AF2A 1MTOA 1BU5A 1ENYA 5K9ZA 3SJUA 1NBEB 3JTEA 5ADUS 3R7WB 4MV5A 3SJZA 2DMRA 3EEOA 4KSBA 2CNNA 1XF1A 1PX2A 4PTZA 3FMPB 4F7UG 3IPRA 2QQFA 4WDRA 3BH0A 3JVEA 2FPUA 2CYZB 1YS6A 1KO5A 3SEFA 4XOIA 3N8NA 5L3QA 3BGIA 2QG4A 5JSZA 3PCXA 1KAHA 1FMCA 4GLMA 4ETMA 2GTJA 2EEZA 1WIEA 1L4GA 1FFSA 2VRCA 3TQHA 1NXOA 1EA7A 4F38A 4JC0A 3VR4A 3QXGA 3A6FA 4OBEA 3AWDA 3YASA 4V0SA 1S02A 4OLHA 3UYLA 3CINA 2DLNA 5DNCA 1RKQA 2QVGA 3IEMA 4HYTA 3VVBA 3UXMA 4K6FA 2Q99A 3CXCS 2GJ4A 5T8KC 2NXJA 3AEQA 3C1UA 3E22A 1CJTC 1A7KA 4IG9A 4B2PA 1VQ9A 2PS9A 3S1SA 1RVDA 4R7ZA 1Y82A 3BL6A 1R4MB 4MW5A 2PO7A 1BIAA 3BWYA 4C6SA 4KWCA 3H2GA 3ABIA 3PUYA 1JJFA 4S1PA 3UKDA 4EKYA 4IMIB 4MQUA 1M8KA 1BA3A 1Z7GA 3F6RA 1H23A 3OMGA 5JQGF 2JCSA 1M1XB 5ICSA 2AS0A 2PSDA 1KBQA 1R4AA 4F9GA 3T7IA 4E5KA 4URUR 1TCBA 2VJPA 4LHWA 3IP7A 3SJBA 2AF4C 5ED4A 2ZULA 3K6JA 4NCIA 4HUQB 3N8IA 2GXUA 5K03A 2OFPA 4H7KA 4MSUA 4RD4A 2I8AA 1CY4A 1ZGHA 2VTBA 3GJZA 3VPHA 1E3LA 4WLVA 2R2GA 2XH8A 1Z13A 1HQDA 2D0DA 2FPFA 1GAJA 1Z7WA 1RXIA 5CYOA 1YHQT 1PP4A 2BRUC 4L9SA 3F90A 4AK9A 1NPYA 2PQ0A 1DINA 1SKUA 3RRMA 2DX7A 2LDMA 4IIMA 4G26A 4HHEA 5LBIA 4MS3B 3FTQA 4P5PA 1T9AA 1XPRA 2QZ4A 2I8LA 3R9XB 1LA2A 1XVLA 3F6YA 1P77A 4RVCA 4P7GA 5I3CA 3PPIA 1UGVA 1RQPA 2R7NA 4Z1MA 2ORYA 2ZPUA 1N3BA 1XQHA 3WLTA 3VU3A 4JUCA 1R6VA 2DUNA 3QI2A 3KR1A 3F4KA 2W9XA 3SE0A 1HSQA 3KR0A 3BRSA 2ZR8A 1ULBA 3IXLA 4BI4A 3O4FA 2VH2A 4C8QE 4HZUA 1JALA 4LCJA 2HW8A 1NT4A 4RTQA 3MJCA 3W5VA 3MBOA 2ZAOA 4NOYA 2RH8A 5J5AA 4DRZA 1DO0A 4DJEC 4GDFA 4U3JA 4RK7A 2H4HA 3GEHA 3PSAA 5IW8A 4PZYA 3L6EA 2PUKB 1EFLA 4BKRA 4Q5WA 2BGUA 1OY1A 3K2IA 1XA4A 2CSXA 4CQMA 5JPIA 3AVVA 1IN6A 1O6BA 1BJKA 4F9FA 2IHNA 1SXHA 5JCJD 3UPUA 3GBVA 1WCV1 4TMWA 2YRWA 5EA2A 3EIUA 2AFRA 1Z2NX 3DDUA 3HHEA 3EGXB 1KHTA 4M4ZA 4OJTA 5F2OA 1L3IA 5HCNA 3A8LB 1U5CA 4YAOA 3VNSA 5B2EA 1CQWA 2Q5JA 1ZJZA 1UKCA 2V5VA 1E9VA 5JNSA 3DVRX 3VNUA 3ILHA 3V7WA 3NFYA 4AUNA 2W2QA 1RRVA 3Q40A 2C5BA 1AX9A 2XMGA 3D7RA 3CT4A 4TYQA 1L5YA 3CONA 5BQ5A 2VEDA 1JMVA 5CVVA 1YOVB 3JATB 3UJNA 5BR8B 4UDNA 5P8WA 4CCYA 2CSIA 2YXDA 3RVOA 3RYCA 4UNNA 4YWJA 2F55A 3WLHA 4IFEA 3UT6A 2HJVA 2WF5A 3GDWA 5DE3A 4YLEA 4GMDA 4HDQB 4EI8A 1WUTA 3P2EA 1IJEA 4I5DA 3IOMA 4KMOA 4JGIA 2OTLA 2RGWA 4Y1GA 4U9IS 3AR3A 3ZEAA 1JR3D 4N0EA 1Y3CE 3OEHA 4QODA 2Z1NA 3QOWA 3WQHA 4LYJA 1AS2A 4XRRA 1SH7A 1QU3A 3RHSA 1C2TA 1QP0A 4RZ3A 4MVWA 4I6GA 1V71A 2M51A 2K5FA 2QL5A 4YPFA 1ZN7A 2EQKA 1M7BA 3UV3A 1A5BB 1VL1A 1E2EA 3IR5A 4REQB 1A8SA 3KLPX 2EGGA 1TZCA 3QNWA 5ITSA 3T7AA 2V8BA 3LE8A 3PF8A 3VPSA 2JHGA 1N2CB 1NVWQ 3CUVA 1ZR4A 4PZ9A 2FUG6 4KO8A 4B3RB 5J47A 1KOGA 1IDN1 2O2ZA 1JYFA 3EZ2A 3HRTA 3GGCA 4OBWA 2Z98A 1QNLA 1XCMA 1QR6A 2PT6A 2O19A 3O4RA 2APJA 2F9MA 3WJ2A 5EHZA 3BX1A 4MP3A 1J2YA 1JDBB 1IPEA 1JLSA 2H57A 1GPKA 1WB6A 3WYDA 5D6OA 5FNVA 2AKEA 4Q9HA 1M74A 2PL5A 2NXEA 4QEZA 5LXTA 4MI1A 2KSQA 1UCFA 3HKCB 4O4LF 2P0EA 1ZRMA 3UH0A 2RI0A 2PIDA 5KYXB 1SUEA 2H8HA 2E1HA 1H641 1E7QA 2RH9B 5AKZA 4RTYA 4NOJA 4R40A 1VQ7T 3I83A 2GJAA 1A04A 2CXUA 3QFTA 5I7EA 5C5CA 3WGVA 1LY1A 4GR9A 2YHIA 4F7WA 5CH5A 3AM1A 1T3GA 2WPDD 1DJNA 3S1LA 1F0NA 3AJRA 2GRUA 4KO4S 4K1XA 5L3ZA 2WNHA 1K7CA 2HY7A 2VDUE 3A3OA 3H5IA 2Q1YA 4JJ7A 3AV0B 3OT1A 3QQPA 2HM7A 2XMZA 1QJCA 2MINB 1ZX6A 3ADBA 4HY3A 4L4XA 2P9YA 1X7DA 3TOXA 4RC9A 1BS9A 1TK3A 3HMKA 5AK0A 4MRMB 1N2BA 4ACAA 2IHVA 3SB2A 3PVQA 3EG3A 4E12A 2EW2A 3D4LA 3R5JA 4K86A 5JV5A 1FEZA 4JOSA 3I5RA 4WOJA 3DAFA 5EG5A 5DM60 1IB0A 3TNLA 2LKDA 4UUBA 5FWNA 4PLTA 4M78F 5K3FB 2JMCA 4M1ZA 5LKRA 4G5YA 5E3HA 4HR7A 1XV5A 4HNVA 1F5SA 3H5VA 3ZNOA 4WX2B 1PYGA 3N58A 2R9VA 3WXMA 4CIAA 2P4QA 2QI9C 2ENMA 3MIIA 1FJGB 1ABEA 2DL3A 3OY9A 2BBTA 5AWFC 5HIIA 1IZ9A 2BW0A 1KYQA 1U0HC 3D3WB 4CM7A 2EWVA 3V8LA 1VPDA 3QYHB 1D4FA 1FA9A 1GUZA 3CZCA 3H4TA 3L0BA 3R0QA 1QYDA 3TXXA 3VMMA 1XWIA 2VDJA 5EEGA 1H42A 5B4VA 2O59A 4OCZA 2KI5A 4IXMA 4YREA 4AKTA 1GM5A 1TJ3A 4L2IA 3T41A 2MSCB 3H2HA 2XB8A 3CNOA 2ZYIA 2H1VA 1QRTA 3D5EA 2FYKA 5CAEA 3I9QA 3LP5A 2CP2A 4OGGA 3BSFA 4MCIA 3JCMf 2Z09A 5FPTA 3KQPA 4DQLA 3GUHA 2KBEA 3VDXA 3GN2A 1CETA 2SRCA 1JR6A 1NV8A 3SPXA 5KHOC 3U7JA 1OH6A 4TL7A 4I81A 2QPOA 4D8XA 4LC1A 2IY7A 2IXDA 1NC1A 3ZH9B 3VTAA 3CKYA 4RNCA 2FP3A 2GZ1A 1O6GA 5AICA 3LT1A 3D4BA 2EJ9A 1QZTA 2DPLA 3CW8X 1C3OA 3H0CA 4M1TA 4YRQA 3WXBA 5K2OA 3QYAA 1TUDA 5AKXA 2M16A 2VDKB 3MP8A 1VQLQ 1JG7A 1RI9A 1I9CA 1DC7A 4JRPA 4CL8A 4HB2A 4GOJA 3I0NA 4OXKA 1NDQA 3E35A 3H8VA 3IUJA 2XDQB 2REXB 4HADA 4QGAA 1XFAA 4DADA 3CPWP 3QVXA 2YDXA 1C3EA 3KAJA 5LP6C 2PKEA 1HE8B 1E7OA 4G4SO 2XYHA 3HHTB 3LG2A 4OLBA 1T6BY 5CCEA 1WSBA 4A2WA 3EMBA 1TJYA 3L49A 2PT9A 2PK3A 4XIFA 3FPBA 3VDNB 2Q50A 4C0SA 2BZXA 3E3AA 1L3BA 4NPAA 3SP1A 2ODBA 4UW9A 1SPKA 5JASA 3NNNA 1N2XA 4RBNA 4TLLB 5G53C 1RRCA 2H1HA 3CXCA 4B3TB 2OCXA 4XTCS 4BP9A 3ZWBA 3PX2A 2IUUA 5ILOA 2NVOA 2O8NA 2YRFA 5H59A 1A8QA 1X7WB 1WVMA 3KKQA 1KETA 1E3JA 3L7LA 2EZ4A 3JTMA 1DS6A 4XSVA 2VPTA 1GPAA 1RJFA 3I2JA 1YIOA 2XIQA 1M83A 4N5DA 4HDCA 3A5ZB 2CFIA 5IKXA 3VU0A 3Q7SA 4RCCA 2BSQA 2QRZA 2I3DA 3OIUA 3ZY4A 3EBOA 4G9EA 1VTKA 3RVJA 2EJUA 1WS6A 2YNMC 3H11B 5AUNB 5F5XA 1K3FA 4ZHQB 1R4MA 1GFDA 4BNDB 2HQHA 3RC3A 4QO8A 3N7TA 1ECBA 4ZQEA 3BQMB 4MYUA 1Y7TA 3ZU5A 1USUA 2NO5A 1EAMA 4I1YA 1P2TA 1Q0ZA 2R96A 5LU9A 4XVHA 3URGA 1ZSYA 3WSWA 5CURA 1OZHA 4Y2TA 1GAEO 4UZSA 5EC7A 1QF9A 1U3UA 1BFKA 1XLTC 3RS0A 4EZBA 4E51A 1VZ2A 5JATA 1PV2A 1RYZA 1LNSA 3A04A 2B1GA 1UKZA 2FB9A 2VDWB 4BO8A 1EWVA 4HUQA 3UMJA 3HR8A 1NJSA 3NRJA 2DKGA 2PRJA 2Q7OE 1GQ2A 1K86A 1JG3A 2JJ9A 1LB1B 1VL8A 2V6FA 2DILA 2HA3A 4D7AA 4RK1A 4JS5A 4AJ2A 3MCZA 1KKLA 1UP7A 1QIDA 4LW8A 3TE7A 4X1VA 2Y66A 1QWOA 3T7JA 4HCBA 4NARA 2G82A 5ALOA 2BMJA 3K0FB 4LZAA 3RJTA 4DLYA 3CPWA 4ZTBA 3IP8A 1RC8A 4PLYA 4C5BA 4ZPXA 2PO5A 3OCVA 4KX5A 4EX6A 2YZ2A 3G89A 1RC0A 3UFXB 4MS3A 2ATVA 1K7FB 4O4JF 1GWNA 3MUOA 1YR3A 2Q1TA 1YZKA 3B89A 4UJ5A 4KDFA 1CF2O 3ZU4A 1FMLA 1KP2A 3DZIA 4NBNA 4AJIA 4VUBA 4GOLD 1QHHB 3WK7A 3KX2A 2DFUA 3FUVA 2X4LA 4LYEA 4AROA 1O0BA 4PANA 2YBDA 3ILVA 5EIAA 1XTBA 1OFUA 5K3CA 5AI0A 1EDEA 3ABZA 4MUYA 5CJ2A 2H59A 1LSUA 1U3VA 3EQ8A 5KSOA 4E4YA 3LX5A 1JP7A 2HX1A 1AWWA 1I5EA 1RMTA 1KK2A 3ITKA 2P0KA 2P6PA 4LMPA 2ZQ5A 4B43A 1JBQA 3WLSA 2OOSA 3FVWA 4XWWA 5JJBA 1ZI6A 3S2FA 5A4MS 1ZR2A 3JQGB 1Z29A 4C0LA 3SWNA 4Y7DA 4F9TA 1M34B 4AFZC 2J6IA 4A0GA 1W4RA 3A8MB 1N92A 2BYTA 4YRZA 2JL1A 2Z95A 3KEQA 5KSWB 1BK2A 1T0HB 4RD1A 4GLKA 2I7DA 1WJRA 2HREA 5EKDA 4P9NA 5EKSA 3OYFA 4XLLA 1S72A 2Y77A 2R25B 5A3SA 3QWYA 1Z88A 1GARA 3OYHA 4X60A 1DRWA 5AIAA 3UHPA 1DKQA 4JL5A 2NV2B 1YT5A 2HTEA 1LRLA 1A1SA 3CNNA 1JUDA 1CTQA 2DERA 4N1AA 3HABA 2OAGA 3TIFA 5I7HA 2ZJYA 3TZCA 5FUBA 2FEKA 1NC3A 2V6IA 4QDJA 3JATA 1ABQA 1XZCA 4WLOA 3CKLA 1ECFA 3Q2OA 3MCUA 3HPRA 2OMEA 5I9LA 2WIDA 4MIOA 3OM9A 2BOVA 2TRSB 3I58A 5HF6A 9LDTA 2BEWA 3EPKA 4Z5XA 3K8ZA 2O3RA 1HTBA 3GOXA 4HNAB 4PTLA 3QVOA 4BZZA 3O2QB 4PLVA 3NVKI 4JHXA 4JBGA 4OXIA 4WD3A 3DEKA 2RGEA 4WXHA 4D0GA 4II3A 1EP3B 4OMNA 1OI1A 4EENA 2H3HA 4XVCA 3SC6A 4TSFA 1NP3A 2QUHA 2XT6A 4MYHA 4L08A 4ENRA 4OJNA 3VAYA 2BI7A 3TOZA 2VPWA 4YALA 1XDWA 4LXTA 4EIKA 1ZK0A 1SPXA 1NF9A 2GRAA 2I2CA 4KXYA 4XZ3A 3T5MA 2D7CA 1G8HA 1CNFA 5E0OA 1G64A 2HOQA 3HJGA 521PA 2F9LA 3PQ5A 3TXYA 2CNBA 3FPEA 5D6WA 5FPPA 2JH8A 4BKOA 3FA2A 1E61A 4BNHA 1EGQA 4X1OA 3FE2A 1XLWA 1LEHA 1U8ZA 4KOEC 2OSVA 3GOQA 3BPSA 1OQKA 1YGYA 4YAIA 3UUGA 4R9NA 3NBFA 3NKLA 2Y1WA 3SZRA 1Q20A 3HL0A 2B8WA 4CE6A 2NLOA 4IKPA 3W8EA 4C0AC 4FQ5A 2NIPA 1NLPC 3WGYA 2JK0A 1HXHA 3FROA 1UDCA 2XUDA 3JCMV 1E5DA 4KN8A 2BMFA 3SYRA 3VA7A 1LBIA 3HKCA 1M3AA 2O2IA 4LJ8A 1MMAA 4JDPA 3BBLA 5FUVA 4GPAA 1SCJA 1DKRA 3EQZA 1QCZA 1FJ2A 5KYXA 3BMNA 5JS2A 1FFHA 2WT9A 1S9DA 5L45A 4LI0A 2Q4EA 4ZN3A 1VQKA 3A8HB 3QIAA 3QVUA 4DDUA 3X26B 3R7AA 3SXUB 1V25A 2RFLA 3DFZA 2V6GA 4DREA 2PEYA 2G3RA 2B1RA 4BCDA 4JDSA 4KBMB 3BCHA 1J5PA 3G23A 4IXNA 3K1AB 4AT1B 3W2TA 2MINA 1GUYA 3FBWA 3N2NA 5TV2A 4C06A 2P90A 2QORA 3V46A 1XZHA 2D5IA 3FNEA 3T35A 2VNJA 4V0LA 3G49A 2HAEA 1ZM2A 1R8YA 2ZS7A 3REQB 4MRMA 3KWJA 5IHKA 2ENWA 4WLFA 4GZMA 2M0YA 4TQ9A 4N5MA 3OPNA 3Q1KA 5LDGA 1JEAA 2ZR7A 3USCS 1W0JD 2D2XA 2OD9A 3U9SA 2OBFA 3JRWA 1AMOA 1AS3A 3WLMA 1I2ZA 1GPYA 3STXA 2QAGC 5E2BA 2GTPA 2YINC 4L27A 4ON9A 2PZEA 5ARBA 2WTBA 3LP8A 3WLOA 3QV1A 1BGWA 2IUEA 3W6UA 2WYVA 3NFRA 2DVJA 1XHLA 1QG4A 4QQGA 2A88A 3BF7A 1EHIA 2NTVA 4C92C 1H0HA 3D3WA 2SKCA 4PE5B 2OKGA 5ICCA 3EC1A 1RAEA 4W6ZA 4BRZA 1IPFA 4HQFA 5GAN3 1U1IA 4GRAA 3T1OA 1KVSA 4BGDA 4FIDA 3PHHA 1CUDA 1UC8A 1PQPA 2QD4A 4XIYA 1I3KA 3ZDDA 3A9CA 3CRVA 2VUSA 2C0OA 3ECCA 3WAGA 3IP5A 2F9FA 1CULC 5K2MA 1WXEA 1J21A 1CUXA 7GPBA 2C4HA 1GL6A 2XVYA 3WHLA 5F2NA 4WJKB 3BFJA 4TPKA 1EJ2A 4F4UA 1GQYA 5AK4A 3OW2S 5GIPE 3C0CA 3KQWA 5DU2A 4MB2A 4ESRA 3NM5A 4PLWA 2ZPBB 4BE0A 2JJ2A 2ZBGA 3GPDG 1DKMA 3IA2A 4V2SA 4NFSA 3M4YA 1FPMA 1Z62A 5I22A 1KY4A 1OTYA 2QRNA 4L7VA 4AKEA 3MVEA 2NTEA 2NUPA 3N3AC 1Z37A 2AW5A 5DXAA 5EVCA 1ZXLA 4JLPA 3C6BA 1XAIA 4Q02A 4QUGA 3U40A 2X1MA 2VHTA 1FFBA 2GSWA 3BD7A 4F5DA 1LVHA 3ONNA 3O6VA 3H1PA 3R8FA 4O29A 4AXXA 3KTOA 2A5YB 2QYTA 1OFTA 3IQFA 5KOIA 4JKOA 1WHTB 1Y6QA 3VBCA 2YIDA 3S5JA 2LQ8A 1RBMA 1HNXB 5B6PA 5F73A 2BZYA 1HMPA 4M49A 4GQBA 4JLOA 3LL7A 4JJEA 2M0OA 2PH1A 4P5DA 3AEZA 3MCAA 1KH1A 3RK1A 2LNVA 1QUFA 3FJOA 1IEWA 5JROA 4OGEA 2HRQA 2OUKA 4JEHA 4IS3A 4D0SA 5U1PA 2VAVA 4OKNA 1ZBJA 3DMDA 4CKEA 4XPIA 2AX4A 3TRKA 4AYTA 4WV3A 4LF8B 5A04A 2PVGB 1PQWA 1FP4B 5C1BA 3PVCA 1Z5ZA 4C3ZA 2CJWB 2EJBA 4I9HA 5IDVA 5JH7A 3M9QA 4N18A 3FZEA 5IKOA 5H83A 3BGDA 3U7FB 4ZVQA 4XWAA 4IMRA 2B3TA 1RIIA 2VHUA 2ZIWB 3OCUA 2AUMA 4YUYA 4M7AD 1X7WA 4LOHA 5B3AA 3W2EA 3AYXB 5H8WA 2NXWA 2QUZA 2OHXA 5A3RA 3FJPA 1K8AC 1V3VA 2UZ4A 5A5VA 2M6KA 2C7OA 5TNXA 3P9PA 4I8DA 4W63A 2RH4A 2GTHA 1M1UA 4LZNA 2W71A 4ND5A 1WUIS 3OWXA 2JS0A 4GZLA 1SXJA 1CQJB 3I1YA 2ZWVA 4TTVA 1M90R 4EGSA 4H59A 5FWBA 3RIGA 5EEHA 3WV4A 4MIYA 2XNDA 4NI5A 1TZMA 4ZVTA 3VAZA 4ZRNA 1CNEA 2YICA 1X7GA 2V0GA 2GBPA 5LJ5e 2X7HA 2X76A 4Q1FA 3KHSA 1BDIA 1OT5A 1OEBA 3SIXA 3U62A 2Q3DA 2EG5A 1AWJA 3VYTB 5C0MA 4TRNA 3V4OA 2GD0A 5KDLA 5AVZA 3NP9A 2RK3A 2DHQA 3DONA 4LGYA 1T1IA 4FYHA 4CC7A 2JKVA 3L9WA 1ULUA 4LDZA 3EW9A 5JRJA 5IVHA 4CF7A 4BMDA 3H65A 4II1A 1H6AA 4ZDWA 1D5WA 2I4MA 3WOHA 2D7JA 1GSOA 3UWNA 1H4VB 4PG4A 3CCUQ 5JZBA 3UJ9A 2XUKA 3TRDA 3K0FA 2P77A 1YB7A 1DC3A 3FDXA 4G67A 5CB4A 3GQBB 1ECPA 3OLXA 1E4EA 5DCYA 1ONNA 3UFXA 3EEBA 2YV3A 3P9YA 3GXBA 3MRXA 3OC6A 4Y0VA 3E9QA 1EWRA 3QDFA 1Z3IX 2GNOA 3UCFA 5AVXA 1HZJA 1L4UA 2DBZA 3GLRA 5CM2Z 3ND9A 1QIJA 4BU0A 3DJFA 3DD1A 2Z6VA 1ECJA 2XVZA 3WZ2A 1Z16A 4GOKA 4L5AA 3GHHA 1AB5A 2COZA 3P4YA 4Q9NA 4CI0C 3KYBA 3RC8A 1FDUA 1VZ3A 2C9DA 2QBYB 1J0BA 3U4DA 1VQNA 4UDOA 3KOWA 5FLKA 5C7LO 4V0OA 2OV6A 4Y6RA 5A5FA 1TCAA 2DUUA 4OK6A 1KO1A 3BJMA 4U7FA 3U7RA 1T0BA 1JQ5A 1XVTA 4JL8A 4PYRA 3TZBA 2H2AA 3FSGD 4BQIA 2CVFA 4E5UA 4K9NA 1C8LA 1OD6A 1X69A 1KE2A 3JQGA 4GOXA 5JZSA 1H1TA 3K6KA 2C2GA 2HMUA 3NYRA 2GN2A 5FR1A 3UNXA 3HXTA 4RF2A 1T0HA 4ILKA 3VAAA 3BFKA 3QWFA 2PZKA 2WACA 1WV1A 4YGXB 3ZDCA 4NL2A 1LVGA 1DC5A 2CYBA 4YFYA 4UCXA 2ARKA 2ZPEB 3NIGB 1PUXA 1DWPA 1Y8CA 2A3NA 1NLUA 3PNYA 1G8GA 2CXQA 4J6WA 1JFFB 4B3DA 4XEHA 1X1QA 3OPVA 2FN4A 4L3WA 4ZCLA 4FC6A 4I1SA 2XXJA 1TVEA 3F74A 1P7WA 1J90A 2CDTA 1OI3A 1W4SA 2XUPA 1RKXA 4OGLA 3KAQA 1F51E 3MMNA 3DMTC 3W2HA 4WA8A 3NIDB 2J30A 2FPIB 3SAJA 1JIQA 1ADGA 5HRCA 4EARA 1HQYE 3GLIB 4W1PA 4NHOA 1SKAA 1X6GA 1M90U 1T5OA 4WL0A 4DNOA 5I7FA 2E6KA 3FNQA 3I01A 5BXYA 3H1TA 3UWPA 3TQCA 1EFNA 1Q0RA 1PD1A 4ONEA 1G3UA 1U99A 1OH7A 5KTPA 5KZMB 4LVOA 4F3TA 1G7RA 2I29A 1SEMA 1DJPA 3ER8A 4YO7A 4Q4JB 3JWGA 2WYIA 2GVZC 4DSZA 3A9RA 3WNBA 3LF1A 3PHCA 5AM2A 3OHSX 4AMVA 1N5JA 4E2FB 5AP9A 1NVXQ 3LBHA 2YYAA 4E13A 5THXA 1YQWA 4TROA 4O2LA 1P2SA 1V4VA 2HSGA 2B78A 5C1OA 2BUAA 3GDGA 2R1VB 4L0DA 4YMTA 3ESBA 2C57A 3SC4A 3QV2A 1GLNA 4C92D 4HEQA 4E3WA 3VUFA 2F1JA 4V1CB 3L7DA 4GH5A 4AO7A 1SOWA 4K5QA 5C18A 3RKRA 5B7PA 5KSPA 4IJQA 3M8KA 1ADYA 1KK7A 2XMQA 1RPAA 1EFPB 4QGSA 3OA6A 1RCFA 3CMMA 3TUJC 2GS9A 4I3FA 3DMHA 1A8PA 1I4K1 2UZIR 4TMYA 2LMJA 1T1SA 4LA4A 2VJNA 1LI7A 4D8YA 4N5IX 2H9AA 1SCNE 2AZXA 1Q82C 2OCDA 3K2BA 3NP7A 5E4YA 2H29A 3OUZA 1Z15A 3DTYA 3AW8A 5BPHA 3REAB 2ODQA 1K0XA 2V26A 4H1WA 1VJRA 5GVRA 2P3LA 3GVIA 2JCBA 1DX6A 4O2BB 4E5PA 4CW7A 5JSFA 4MVJP 2PU5A 2G72A 4C0BA 2AK3A 1Q22A 5HRAA 3SBEA 4FSHA 5HIAA 4ND4A 5FL7A 5TPWB 1J2EA 4ZJZA 3PX7A 5JY1A 1QIHA 2YVLA 4YJFB 1FBTA 1RT9A 2D8AA 2ZW9A 2K4MA 1K4MA 2ZI7A 4DBZA 2OD2A 3NHMA 3K1AA 2VYNA 3RO7A 2WSEE 4PZ0A 1V11A 5JC1A 4GE3A 4CF3A 3TIIA 1PRYA 5LQMA 5IARA 2IYOA 4TRMA 2I34A 3REQA 1LLCA 1USWA 2BKVA 1CJCA 3BXOA 2NP7A 3FEOA 2GEDA 2JAHA 7REQB 5GOTA 2GCOB 5FOQA 2UYYA 2COKA 5IASA 1YHNA 1MORA 4KQMA 3UV7A 4CC3A 3HBMA 1EFCA 4KXVA 3H3XA 4RKWA 1EJ0A 3EGOA 1AY0A 5FDFA 3MJSA 4X9XA 1NMQA 2JVVA 1LK7A 1A72A 1X1RA 4QWMA 1QU2A 4GBGA 4B6SA 2HMTA 5F78A 5EKTA 4JBXA 4MZPA 3TG2A 4UTNA 3PR3A 4MV0A 2FVXA 4MYTA 2R8XA 2PANA 5D01A 3F2VA 3RYFA 3N0WA 2GF2A 1ODTC 2CLCX 2OJ2A 2GTOA 2QSZA 1OLUB 1OIXA 4IJMA 5ICGA 4POOA 3K2QA 3Q0EA 4ARCA 3CW9A 1TIPA 3U44A 1GL9B 2FSUA 3O94A 2UUCB 3GV0A 4OFZA 2CZ1B 1JBKA 5LQRA 3OW2A 4J2HA 4P2BA 2IPOB 1NUAA 2N47A 4M7DF 4AZ3A 3PIDA 4RD2A 2QMHA 4MZTA 4HAXA 2V1QA 1GYPA 3REFA 1UBFA 3U4QB 2ZRGA 3DWEX 4URYR 2Z2KA 2W2LA 4N0PA 3W3AD 1JG4A 2DAQA 2OTCA 1DDIA 4CWAA 2JI6A 4MULA 4UUAA 4F11A 1HLDA 3SYTA 3W5DA 1LTHR 3N2KB 4MVJI 5FTJA 2N42A 2L3RA 2VKQA 4RCVA 4TVRA 4MRAA 1SQ5A 3ESXA 4XU2A 3UV6A 1QP4A 1OB5A 1VKOA 4YJGB 3CM0A 2KPOA 3L0ZA 4IICA 2VAMA 1YWGO 1ZZEA 1Z8NA 5KTYA 1PKSA 5CDTA 1MFPA 1KWKA 2PUVA 4IIUA 3UG7A 3KUFA 1YB4A 4M0KA 1YASA 1D0IA 5JQGB 3ZWWA 2Y0PA 3SYLA 4DARA 3S55A 1KPIA 1E6EA 4IAOA 3VQTA 1WHTA 2WJVA 3LLRA 3TPZA 3FOZA 3CUWA 5L4LA 2LQKA 3LQ4A 3LXXA 2FQQA 3NBMA 3NQ41 1HYBA 2FPGB 4XVQA 3PEFA 4Z4IA 3PQ4A 5JZVA 5A4IS 2ZYUX 4KMMA 1JEOA 3R6WA 4UMDA 4AF7A 3T95A 1RHRA 4S1TA 3DYBA 2YT6A 4J7UA 4WEQA 1E0JA 1TUIA 1JJAA 4IIDA 3FJ1A 3PWKA 3NVDA 5H16A 5HUHA 2YDYA 2AK2A 2DXTA 2OB2A 1Z2PX 3MWDA 4FE3A 4BQEA 4NQZA 5I6DA 5EZ5A 4LSMA 3SICE 1WHSB 4KSCA