3TVTA

Structural basis for discs large interaction with pins
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
282
structure length
255
Chain Sequence
b'SLYVRALFDYDPGLPFKHGDILHVTNASDDEWWQARRVLGIVPSKRRWERKMRAVLSYEAVQRLSINYTRPVIILGPLKDRINDDLISEYPDKFGSCVPHTTRPKREYEVDGRDYHFVSSREQMERDIQNHLFIEAGQYNDNLYGTSVASVREVAEKGKHCILDVSGNAIKRLQVAQLYPVAVFIKPKSVDSVMEMNRRMTEEQAKKTYERAIKMEQEFGEYFTGVVQGDTIEEIYSKVKSMIWSQSGPTIWVPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large 1 tumor suppressor protein
publication title Structural basis for Discs Large interaction with Pins
rcsb
source organism Drosophila melanogaster
molecule tags Antitumor protein/protein binding
total genus 78
structure length 255
sequence length 282
ec nomenclature
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3tvtA01
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 3tvtA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3tvtA02
4RTUA 2X3XD 1DADA 3LW8A 4Q47A 1W4CA 3AKDA 2FEOA 4LN2A 1DAIA 2WJYA 3REAB 3L2OB 2FSHA 4Q4AA 4ASUA 4C0JA 1UJYA 3EC2A 1QWFA 1UEIA 1Z6YA 4PX9A 4AC9A 1N6LA 5KO2A 3I9QA 3AVXA 1IY1A 1WIEA 4RTTA 2PJZA 5HZKA 1LY1A 5CM9C 3K0SA 3THYA 2L3SA 3K9NA 3IPXA 3LW7A 3ICQB 4AKIA 3K0AA 4Q9JA 4ASUD 3LLMA 3A1SA 1N6HA 4XSHA 1QF9A 3QF4B 5DNYB 4DIDA 4JMPA 1AWJA 2HDNB 2D8JA 2RGGA 5KDLA 1IOZA 2GJ9A 1G2BA 1X8LA 3RWMB 3FFBA 3RS0A 2D7CA 4OMQA 4HB2A 3MGCA 1PVOA 3KQNA 4J0QA 4AKEA 2FX3A 5C2JB 4WAUA 3QEJA 4LBWA 3CRQA 4JLBA 3DPUA 4KAXA 2I1VB 3EIEA 2CDNA 3LQQA 2J87A 4BFXA 2JIZA 2QMHA 2ZREA 3EG0A 2GDJA 1AS2A 4OHWA 5J4YA 3PFIA 2YC2C 2ZSBA 5AJVB 3V9PA 2J1LA 5TDHA 1N6RA 5CIWA 3KUDA 4RD6A 4OK3A 3VKWA 2K5UA 1MO4A 5G40A 2C0OA 3AQ4A 5L3QB 4TYYA 4B32A 1WA5A 1CLUA 1ZM3A 2WAYA 1ELOA 3KDSE 2VL7A 1GFDA 2KROA 1F6BA 1HEIA 4I99A 5FBLB 1PV4A 3GLGB 4XOIA 1JALA 1P9RA 2N42A 3RDPA 5JJIA 3REBB 3TGPA 3UPUA 3MCAA 1TF2A 4MH0R 4KSBA 1NLPC 4V03A 1D2NA 2IF0A 4LC0A 4RY2A 4YDSA 3LBIA 2NGRA 5EE0A 2CBZA 3GJ8A 4JLDA 1BU1A 1VPLA 4KBGA 1TQ4A 2B6HA 1CSKA 2ZR7A 1OXVA 1GKYA 3U6BA 3B5JA 4QNRA 1E2LA 2YDLA 3BE4A 1KSJA 3HU2A 4OI1A 3SI7A 1UBCA 2FSFA 2ZRHA 3ADBA 1TF7A 4K81B 2NUZA 4KLNA 2DLPA 1MO3A 1NY5A 1W0KA 4ZCIA 4UXJA 3OIVA 1Y0MA 2X77A 2X8AA 5CLQA 3KXKA 4JVMA 2CLDX 5FUVA 1XD2B 2BTTA 2ZRDA 3VS4A 2DFNA 3ZS9A 4NDZA 1FZQA 1Z08A 4DEYA 4RFSA 1H3HA 2AD1A 2ZEJA 5AWFC 4PQRA 4Q1BA 1HE1C 1KI4A 4Y0VA 5KPDA 3AVPA 4JSYA 5K8LA 3FMOB 4BFVA 4I1VA 1HUQA 1KI6A 4C30A 3P4YA 5P21A 1YQTA 2JCSA 3KJHA 3ZDQA 1M30A 1VHTA 3HYRA 5TV2A 3RS5A 2Z43A 4BLSA 2WWWA 3DOFA 2BJVA 3RRZA 1P61B 1E3MA 3QI2A 2ZANA 2ATVA 4DUGA 4F92B 1FMKA 1Z83A 2FPKA 5FTNA 4UXHA 3WNBA 2KT1A 2HEIA 2JLYA 5GJWB 2C0IA 2PX3A 4Q03A 2AZVA 2V7QD 1Z29A 1NLZA 4LJAA 2Q3HA 2Z83A 1W2HA 1UADA 4BLQA 2CNWD 2ZR0A 2C95A 4Y92A 1HTWA 4KRTA 5KSYA 1DO0A 2QSZA 4GOKA 5CJ2A 3U7GA 2F3TA 3DM9B 5FOSA 3O47A 4QBHA 4TLDA 2JLUA 4A36A 1TMKA 4Q9KA 3V00A 3SYLA 3AVQA 4JKIA 2ZRPA 4B3CA 2J46A 1SVSA 2ZJBA 4Q4LA 3QKRB 1FPMA 3I8XA 2QENA 3KUCA 2HF9A 4LHVA 4EDHA 2OAQ1 1ARKA 2CJWA 4CDGA 3AVWA 2HCKA 4TTQA 3QENA 5JCPA 4ABYA 1JR3E 3SEMA 3AF1A 4CVNA 1EXMA 2AXNA 3AF2A 3ECCA 2BDTA 2WKQA 3T1VA 4C4PA 2GXAA 3SS8A 3RRMA 1DAKA 1G41A 5HE8A 1A5TA 1JR3D 3UK6A 4KFTA 2VF8A 3J81k 4U02A 2WOOA 2D8HA 4RD4A 1YP5A 4XVRA 1NIPA 1GCPA 1ANKA 4D0GA 4AFUC 4TT3D 3H0FA 4QGAA 3VS5A 4TLBA 4AIIA 2E1RA 1AZSC 2FRYA 3DZDA 4NZYA 3U7HB 3K0EA 2ZTSA 4QC2A 4CZ2A 4BPBA 2Q6TA 3BERA 3ASZA 4BLPA 1T0HA 2CCGA 2UVQA 3UMSA 2GRJA 2GAAA 4IFEA 4AG6A 3CF6R 4D2IA 1XEXB 2AX4A 2FOLA 4B6EA 3CZPA 5IHIA 3EIHA 1EK0A 4HZIA 1Z07A 1KTVA 4P4UA 3AVOA 3O8CA 3LNCA 3IGFA 3VX4A 2FSGA 1SXJA 1KY2A 2ZSDA 4MQBA 2CLSA 4RZ3A 1GKIA 2VP2A 4TYPA 5FOWA 4ZO4A 4QBIA 1IY2A 4CGZA 2JLWA 2KRSA 1SXJE 3X1XA 4B47A 5KYKA 5L8VA 3EA5A 2CVHA 3JV3A 1NMZA 2R6AA 3MD0A 1K0XA 1SHFA 3E1SA 3BK7A 3GLFA 2WTUA 1SXJD 2J9RA 2FNAA 1KNXA 1QHHB 2J0VA 2WSSD 4MRPA 4A2PA 1KGDA 4Z1MD 1AOJA 1NKTA 1P75A 2DR3A 3AF0A 5HCNA 1SVOA 4LZZA 3GLFE 1CEEA 2PCJA 3H86A 4RD0A 2OCYC 5KTYA 2B8TA 3I5RA 2FN4A 3I4LA 4ITRC 2DRMA 4YLGA 4FI3C 1FMLA 2EFEB 3P27A 4M53A 1U0LA 2HSPA 1UDXA 2WJVA 4UNPA 4PO9A 3U7EB 4BFWA 2DMOA 4DSTA 2XTZA 2PZFA 1H92A 2J0UA 3M0PA 2EW1A 5EZ5A 3EX7C 1TG0A 1ZM9A 4US1R 3QXXA 4JLMA 1K8RA 1MO5A 2RMOA 4GL2A 2GCOA 4HI0E 3CKLA 2C2HA 3A1VA 5EXPA 2FGJA 4DXAA 4LE9A 2VHUA 2ZE5A 3VS3A 3GJ4A 3W6OA 4NKRA 2RQUA 3W5JA 3HDTA 2JATA 4QNMA 2J3EA 4NHOA 1JXMA 2H17A 4RKEA 2XB2A 2LJ0A 3W5IA 5JJLA 2IBMA 4O25A 3TBKA 4JLNA 1AK2A 3EHRA 4DCUA 1NSFA 2RGBA 5KDOA 1KIMA 4QHSA 2FEMA 4DKXA 1MOZA 1P2SA 1PLJA 2OILA 2VWFA 1SXJC 3Q9LA 3X1YA 4AKGA 2RF0A 2ZRAA 2DBMA 1TF5A 4PHTA 2BMJA 2CK3A 2RGDA 3LA6A 4R2HA 3W9YA 4YXWA 3U2QA 4CEJB 2XTNA 3B60A 4IDHA 3TAHA 1NP6A 1N5ZA 4PO1A 1H8HA 1HSQA 3TQFA 4HB4A 4CC2A 1GTVA 3JVUA 4B2LA 2ABLA 1E7OA 3FFAA 3I3SR 5BYJA 2Q9CA 1H8EA 1UKVY 4YXWD 2OV2A 4KVAA 4IDNA 5JS7A 5F9FA 4E07A 4URUR 1E79A 1KO8A 2WZQA 1HT1E 2AKAB 5GVRA 5TMPA 4LGMA 2CUDA 4LJ8A 3H41A 3LAWA 4Q48A 3QIAA 1R6BX 4WBSA 5CIQA 3ASYA 4HB0A 2QP4A 2JXBA 1SHZA 3T34A 3F5FA 2DFKB 1US8B 1Z0AA 1M27C 3DKVA 1XPUA 1E79D 4ESRA 1IHUA 4E09A 5D3QA 4CF7A 3N2IA 3R20A 1T0JB 5E7MA 4WZAE 2N46A 3DO6A 4GMDA 3AVYA 3I8SA 4V0LA 3GJ0A 4XD7A 5TARA 1G64A 5AJYA 5HKKA 3THXA 3K1JA 4DLUA 4FINA 3UMFA 2JJ2A 2PCLA 3CX8A 2C78A 3QVVA 1KK0A 5C4MA 5LD2C 1VIAA 2YHSA 1XXHB 5KHOC 2JJ2D 1GCQA 3IHLA 4Z89A 4V0NA 4DCSA 2QAJA 2WKPA 4M1OA 4NYIQ 2L0AA 3GLHE 5FPSA 1AVZC 2WKRA 1AS3A 4OI0A 3AKEA 4Q1EA 3U60B 1ZX6A 5BW8A 2F3RA 2O5VA 1UKZA 2ZITA 3PEUA 4D6PA 4NCNA 2G3YA 1ZUHA 1Z0DA 1FX0A 4GBMA 1K6MA 1CJMA 4FD2A 5UKDA 3KKNA 3TMKA 3QG1A 4UKDA 4G01B 2OLKA 5A5GA 2KT8A 2V6IA 3GBQA 1MABB 2JMCA 2MSCB 4U00A 2L3PA 2W00A 2A5FA 3KZ1E 1KI2A 5DYGA 1WMSA 1Z22A 4JT4A 1AGRA 2F43A 4Q9HA 2O8FA 4TMVA 2CH4W 4QRHA 1TNDA 3OE7A 2QN6A 2QM8A 2ZRLA 2W2XA 2ZROA 1XJ0A 1W46A 4IHQA 1U2RA 4P4SB 2Q9AA 1XB2A 1D8TA 2CXXA 1GSIA 4ERNA 1U8AA 3CW2A 1T3LA 2CCJA 5BWMA 4BLOA 4CEHB 3HPQA 5AUQA 3I72A 4MRVA 1SHGA 2HLDD 1GP2A 2J7PA 3B13B 4F7WA 1CJVC 3RLFA 2DBKA 2FPLA 2OE2A 4CYMA 1LVGA 4PZYA 3GLIA 4BE7B 4FW9A 2CDTA 1OE0A 4JYBA 3MMPA 3WNCA 4IVPA 1GDDA 1G7TA 4RCZA 4AFQC 2J7PD 4ARZA 4D80A 3GLIE 4ZPXA 4IDOA 1EGAA 2JS2A 4D8DA 4JBXA 1N0UA 2XZOA 1R2QA 1SGWA 1L4YA 1F2TB 1XU4A 2Z4RA 4G5GA 3L0IB 1E9DA 4J9FA 4IXNA 4B74A 1P73A 1UKYA 1E2DA 2BC9A 4B3FX 4PSVA 2H92A 2XZPA 1BKDR 2JS0A 2ZJAA 2ZETA 4B2PA 1NBMA 1B0UA 3A6PC 1II8B 4WZ6A 1KOFA 4PZZA 3Q7QA 4D4JA 2ORWA 2A37A 1G5PA 2ESWA 1XDBA 2DWQA 2K7AA 3VRYA 4A1FA 4EJSA 1NNEA 1JO8A 1CIPA 2AZSA 4ESHA 3BIFA 2O31A 2JDIA 2ZRJA 2SRCA 1UBEA 4BQSA 5LDDC 1LS6A 2ZYUX 1CR1A 2LCFA 3OIYA 1ZNZA 1J90A 1BBZA 2M51A 4WW0A 2VVKA 4EIKA 4LJYA 1NM7A 2ECKA 3GJ7A 4IIOA 4QM7A 1FW6A 4NYJQ 1AS0A 3JVVA 3M1IA 1YZUA 2YC4C 1PUIA 1PKSA 1A2BA 2ZE6A 1LNZA 2JDID 4XTRA 4NP6A 3EPHA 1E2EA 4PFSA 2FPFA 4RTYA 1YR9A 2HBWA 2OXRA 1GWNA 4PAOA 4OHZA 3RABA 5DN6D 3K0CA 3QWYA 2SHKA 1QKWA 2I0NA 4OHXA 1L7VC 3U3MA 2O8DB 2EVRA 4JZKA 3NHAA 4G5OA 2C9YA 3W34A 5JS8A 3U5ZB 3REFA 2EVWX 2R44A 3PENA 1OV4A 2OFOA 2BMEA 4X8MA 3VR5A 1CP2A 4F17A 1KDOA 1R7RA 2DL3A 2J0QA 5C18A 4IFBA 4TZ0A 3Q7PA 3SJCA 4EQ6A 2MSEB 2QGZA 3K0FA 3JZMA 1RRCA 5C46F 2NQ2C 3MUFA 5DYIA 3C8UA 2D2FA 4WXPA 1FP6A 2FWRA 4GSYA 4BWYA 3KXIA 2FZ4A 4HDQB 3Q8XB 2ENMA 1I1JA 4PQYA 4EPWA 1QRAA 4QFMA 2QAGB 2YWGA 2B8WA 1VCMA 1G8FA 3K09A 4Q5IA 1G9XA 4QJ3A 1P62B 1JJVA 4EJSC 2EU8A 4R71A 3T12A 1U94A 1C1YA 2P67A 3CF0A 4JIMA 4NCKA 1T5LA 2C98A 2AL7A 1IM2A 1ZJ6A 4Z51A 1YZQA 4RUGA 621PA 4Q4HB 3IEVA 4DRZA 4HLQB 5FR2A 2DYBA 3SHWA 4N1AA 1OEBA 3GQBA 5DIFA 1UDWA 2ERXA 2OESA 2QE7A 3N70A 1K5GA 4OK6A 2JAQA 4A0FA 4BZPA 1MV3A 3ZJYA 2VSOA 1D5CA 2QMOA 5M04A 3A1WA 1OF1A 1Q1EA 1K0SA 1OFIA 2VF7A 2O8EA 4TLEA 2ZJYA 2VQSA 3MWYW 1TX4B 1IJFA 2YWHA 5DISB 4D4LA 1G8YA 4MKGA 4RZUA 3T35A 2GK7A 4HYYA 4ZIRA 1E6HA 3K0CC 1BMFA 2BEKA 2WAXA 1E96A 4ZDIA 1MRSA 1OPKA 1X8JA 3ZZ0A 1E9FA 3IO3A 2FJUA 1RPZA 3DVLA 4D25A 4Q1AA 5FUWA 1JU5C 1UBGA 2B7BA 1WFWA 4M1WA 2ZXUA 3AF4A 2G1KA 5AK0A 4BRWA 5FUYA 1X3SA 2OG2A 3WRYC 2BEJA 4KSCA 1F3OA 1XCPA 1G4AE 3MSXA 1JPNA 3EPLA 1VDZA 2BKEA 2IK8A 3GFOA 1W0JD 3PCRB 3LFUA 1N6PA 2E9SA 4QGHA 1WXUA 2D4HA 2KI5A 5H70A 1P3JA 1Z0IA 1AM4D 1NLYA 2JJ1A 3QG5A 3TH5A 2AWNA 4URVR 1CR4A 1DAHA 1OB2A 4V02A 4A9AA 3K09C 1RLPC 1ESMA 1P2UA 2OCPA 3RS4A 3OIWA 4I4LA 3T15A 2V1XA 3PITA 1P9WA 4A4DA 4OHYA 1XWIA 2GZDA 3LD9A 1U8ZA 5K8UA 3U61B 1Z47A 1N0WA 3QKSB 4DLWA 2OCBA 3VRZA 3E70C 2RGEA 5EE3A 1E9SA 1NJGA 1M74A 3TNFA 2WWHA 1KSWA 5EJEA 1XX6A 2H5EA 4PHHA 2QDLA 4QBFA 1VYTA 2Q9BA 2LQWA 5FR1A 4CRWB 2MCNA 1FNNA 3LLUA 4IDQA 5FL7D 3CRRA 2BWJA 4HAZA 1R4AA 1CF4A 2EFCB 2P6UA 2VP5A 3NBXX 4M9XA 5JSZB 3R8FA 3CNOA 1GILA 4PO8A 1KAOA 5JI3E 1WRBA 3AV0B 2TMKA 4B35A 5E7IA 2KYMA 2ZUDA 3E2IA 2XMFA 2W2VA 3OIUA 2FV8A 3OAAD 1ETUA 1IY0A 2ATXA 1YRBA 3QPVA 4XWAA 5FOUA 5SZHB 1P7CA 5K8TA 2ZYVX 1E0AA 3M0TA 4C0BA 4WXRA 3LVRE 4XWOA 1T3HA 5HE9A 4C0LA 2GTPA 4JYCA 1G7SA 2RQWA 3TKLA 4A8JC 2JMAA 4PC2A 3RRYA 4GI7A 4TTRA 3S1AB 2DWOA 4NCJA 2XOKD 2A5YB 3CPHA 1X6BA 2WIAA 3GEHA 3NIBA 1UJ2A 4II7A 2WV9A 2EYZA 4JL5A 1II0A 2ZQ5A 4JLKA 1X1SA 1DS6A 1W7AA 3U44B 4WVFA 1KSFX 2GTJA 3U4QB 4BECA 1TADA 1UFQA 5DI3A 4V0OA 4LPSA 4C3ZA 3FPAA 2BBWA 4AD8A 2XSZA 4F4CA 4BZQA 721PA 2W6JA 3TRFA 1R10A 1WBDA 5IK2A 3AGQA 2D2EA 4RTVA 2FE4A 3KJIA 1RE0A 2KBTA 2DM1A 4HVVA 2A2ZA 2F7SA 3N2EA 4GZLA 4JBYA 4DIEA 3TVTA 1KI1A 2VO1A 1DOAA 3IQXA 3A8TA 4TMKA 2XB4A 5JRZA 2V54A 4GDFA 4XH9B 2IYWA 2W6JD 1RVDA 1DAFA 3VKGA 3PUZA 4TSFA 1EFHA 3DDCA 3L82B 2AR7A 1UDLA 1VCOA 5D3MB 5TY0A 3ZIAA 2V9PA 1E2NA 4Q1CA 4C2UA 4Q1FA 1M7BA 3H84A 1AJEA 1ZP6A 2P6RA 1W5SA 3QPWA 4B71A 1IXRC 5CK4A 2V1RA 3CIOA 2VTKA 1AZEA 1V43A 4DSUA 3GLGA 1W48A 2QP9X 4J9DA 4S35A 2OLJA 1SRMA 2BZYA 2ROLA 2FFAA 5HTKA 4PZLA 5FPKA 3C7KA 4BUJA 3GLGE 1W36B 1R0XA 2G0TA 1AWWA 4FMCB 3B9PA 3C5HA 4CEIB 1AKEA 2NO7A 3M0EA 3W90A 2EWVA 3K70B 1EWRA 4GBQA 2F9LA 2CHVA 1G18A 4LOAA 1LB1B 2A7QA 2PH1A 3FWYA 3RRNA 4BLTA 5E4FA 4Q02A 1KI3A 3GCGA 2CE7A 4DSNA 4PHFA 3AP3A 3CWZA 3THWB 1JEDA 1CXZA 1G21E 2XEXA 1G19A 5CYPA 1Q1BA 4IDPA 1T5IA 4EPXA 4OJKA 2ZVQX 3EGUA 1NVVR 3V4FA 2QBYB 4Q4JB 4LCBA 2ZRNA 3A4LA 5A0FA 4OMLA 3IIKA 3PVSA 4IOMA 4FIDA 4K46A 4EUNA 1XCMA 4QGGA 1IXSB 5EP3A 3LO5A 4B3BA 2IYUA 3IDQA 1UHCA 1KZ7B 5KPJA 1KMHB 3BH0A 3IIJA 4HCKA 3DKPA 1X2QA 1GITA 2QPOA 2ED0A 2GJSA 4E5UA 4P0TA 3GFTA 4M1MA 3VR1A 421PA 2V1QA 2HT1A 3BXZA 2L3QA 4MUAA 2JIZD 2EYXA 1EX7A 2H7VA 3RAPR 1IQPA 4IKEA 2XZLA 4TYNA 3WBKA 2QMEA 1WYXA 2QGNA 1RRGA 1GL5A 5FI1B 1XEFA 1VG9B 2ORVA 4ORZA 2YOGA 2IUUA 2EFHB 1BYUA 1JJ7A 3TUIC 4TMWA 4Z54A 4W5JA 2ZRFA 3I5SA 1U3OA 1ZYUA 2A28A 2BOVA 2EWWA 2QQ0A 2LJ3A 3CQTA 1Z8FA 1OOTA 1KKMA 2R6DA 3LQRA 4UNRA 1AWXA 3RWOA 4XVQA 4CW7A 2V4ZA 4NYJR 1NY6A 3FGNA 3K53A 3VX3A 2WJHA 5JHGB 3VS7A 2H57A 3QKRA 4JLJA 1GNQA 2KYBA 3C5CA 4I1UA 1OH8A 3QY0A 2LNHB 1DG1G 1Z6AA 3ZVLA 2DVJA 3CR7A 2VHTA 3BH6A 4JBWA 4QXAA 4P3YA 2KXDA 1XMIA 4NYMQ 3W3AA 4O0MA 1A4RA 3FMFA 3T5GA 3WP0A 2JLRA 1IONA 3UXMA 2GXSA 2K6DA 1W0KD 1CRPA 3HPRA 4RSGA 3QXSA 3X2SA 3KTAB 3ZD7A 2KJQA 1JPJA 4HVUA 3IEUA 1GFIA 1AGPA 3B1XA 2IYZA 2W0ZA 3M4YA 3PG5A 5GJBA 3BFKA 3ZVRA 4A6PA 1OLOA 1BIFA 2EQIA 521PA 1AA9A 1NVXQ 1XBTA 1N6KA 1FQKA 4W9MC 3PJRA 1ZM4A 1K9AA 3SNHA 1NRJB 5B64A 5GJWC 2CUBA 1XEXA 3KFXA 3LRPA 2EGEA 4HB3A 4AFZC 3QKTA 1EESA 1ZM7A 1I4DD 5J4KA 3W8RA 1VIYA 3NH6A 4I1OA 1K1ZA 4DUGD 5J4HA 1UG1A 1OFUX 2JGNA 3LVQE 4F4IA 1DAGA 1JBKA 4KV9A 4TYQA 2ECZA 4KHZA 4XIGS 4ZDKA 3NDBB 1SHKA 3FKSA 1N5JA 1W47A 1N2CE 3WYAA 1OHHA 1AKYA 2I4IA 3CPJB 4MYTA 1QHHA 2HYDA 1UGVA 4IRUB 3BBPA 2P3SA 2V3CC 1NL3A 1G83A 2LJ1A 1YVDA 1QWEA 3FKSD 4PC3A 5ANRB 2IA5A 3SQXA 1ZNWA 1OHHD 2OFWA 3L0OA 2IYTA 2ODEA 1RUWA 1C9KA 2G1JA 3PXGA 4ON9A 4LHWA 4Q18A 2IWRA 3ZZUA 2IS2A 1OPXA 2YT6A 1KJZA 2BCJQ 2GEUA 3T1TA 2HCJB 1ZUYA 1COWA 1LF5A 5CJPA 4D81A 4LC1A 1CULC 1GAJA 2BZXA 5BN3A 4R98A 2FPDA 3AM1A 2IUSA 1I0CA 1XTQA 1J3TA 3WMFA 5B57C 1E94E 3BWDD 4JLVA 4B3DA 2VA8A 1DEKA 1S96A 1AZTA 2BMFA 2O2OA 1MV5A 4RFSB 3H1TA 3R7WB 2W2TA 1G6HA 2VIIA 3A4MA 3R9XA 3IIMA 4TMXA 1ZUNB 1E9CA 1TUCA 4CEJA 2DWPA 2B21A 2R6GA 5EUQB 2LX7A 4OBEA 2VP9A 1R0YA 4Q00A 2J05A 1G3RA 2BVNA 3LXXA 4TL6A 1SKYE 1HJDA 5GVSA 3KKMA 2LZ6B 5F3WB 4X8LA 1M3CA 1Q44A 2REBA 2WMNB 1WQ1R 4P31A 2OBMA 2GXUA 1VYVA 3H0HA 1RLQC 2X1VA 4XSGA 3QXHA 1KI8A 2REXB 1U9IA 4Q19A 3IKJA 1RFLA 3H0KA 2J7IA 2XJ4A 4G5QA 5FTKA 4AG5A 2ZRGA 2GQIA 1GIAA 1BO6A 1AD5A 1NN3A 2BKUA 4PC6A 4YQFA 2WWYA 2F55A 4C7OB 4NE2A 5IH2A 3OF5A 2NZJA 4NCIA 1OIVA 5IDVA 2GA8A 2NO1A 4C0AC 3PQCA 1US8A 4CIDA 1GKUB 2R65A 3C14C 4Z88A 5CDFA 4DVGA 2QTFA 4URYR 2P0EA 2CSIA 2N1BA 3UWKA 1H8KA 2DRKA 5I22A 2A78A 1T0JA 2QRNA 5CDFE 4KVGA 1ZIOA 2IEZA 2LKCA 1IN6A 2QI9C 4PPNA 5EZ6B 4EAQA 1X43A 2CJWB 3CONA 1E0SA 1E9AA 4LHYA 2J41A 2GXQA 2WWIA 4BFYA 4H1VA 4NONA 5GJVC 5KSZA 2PTKA 5H68A 2C9OA 2MSDB 1UKEA 2HJVA 1IN4A 2QZ4A 4PC7A 3C15C 3KQHA 3IQLA 2IHYA 3FMIA 4OMMA 1OIWA 1XP8A 1P6XA 3B7GA 4MGZR 1ZW6A 4TL8A 3UKDA 3G0HA 2JA1A 2ODBA 4F93B 3IQWA 2K3BA 2WM9B 3FOZA 4J9BA 1LTQA 3QJYA 5JRJA 2GTOA 1HA3A 1TUIA 2OXCA 4JL6A 2P2LA 2QQEA 2W83A 4OI4A 3KJEA 1D9XA 5EUMA 2QP3A 4ZI2A 3VKHA 3K9GA 3CWQA 4ZI3A 1KJYA 2PEYA 2WBLC 4LRWA 3ZZTA 3A36A 5JZVA 3MLEA 1RKBA 1KAGA 4NU0A 1W70A 4I81A 2Y8EA 1MABA 4QKQA 4JZ4A 2IYSA 2CK3D 4KFSA 3REGA 2WICA 1I2DA 1X69A 1U9IC 3BB4A 3NXSA 4GNKA 3EAQA 4P4TA 3AUYA 4HXJA 1H8HD 2C99A 1FTSA 4KYUA 1YR6A 1TL7C 2DCUA 1DTSA 2PZEA 4TWZA 3M0QA 4LDJA 2VEDA 2AKYA 5LBIA 2ONKA 4P4SA 1H8ED 1FL9A 4HLCA 5JMTA 3ZGXA 3M6AA 4ZKDA 4UJ5A 5FPTA 3AVVA 3WNDA 1OT3A 1VKJA 1QHSA 2XJ9A 4CEHA 2YV5A 3FHTA 4RTXA 2AXPA 5E3HA 3U6KA 1N6OA 1E1QA 2VKNA 3RSOA 1S4QA 5EXXA 1ODFA 4GOJA 3SU8A 1NLFA 1QHIA 1SZPA 2L0XA 4L8GA 4BLRA 2ORIA 4KLZA 1OXSC 4ZKEA 5L3SA 2KNBB 2F9MA 1RRFA 5AJZA 1UPTA 2FF7A 2QSYA 2R9VA 4XD7D 5CB6A 1YKSA 5HKKD 1ZIPA 2AFHE 3EWSA 4HAVA 1NVWQ 3U3OA 2JT4A 1IXZA 1DELA 2O52A 1M34E 3MWJA 1UJ0A 2O0KA 3G5UA 3GP8A 2BCGY 2VHQA 1G8HA 4KO8A 4WIAA 3WMEA 2IT1A 4B33A 2JW4A 4FSSA 1CU1A 4M8NE 2ED1A 1GOTA 2OO7A 4H1UA 1ZNYA 1E2KA 4NMMA 4D4MA 1U06A 1II8A 3KQKA 4AI6A 1T4GA 2B86A 1NG2A 1UECA 1M6NA 1TQ2A 2A5JA 1XJCA 2IEYA 1CBUA 5LD2B 1GRIA 5EE5B 2ZI9A 3UG6A 4OJQA 4U7DA 2NO6A 2CVFA 4JJKA 1VHLA 4OQFA 1FQJA 2ZRKA 5FBQB 3P26A 3W3ZB 4PSKA 2O9SA 2AKKA 1I2MA 4UNNA 2JLSA 4HUQA 2DA9A 1KK2A 1RJ9B 4Q66C 3OZXA 2REOA 5EP4A 2RQTA 1W2GA 1XRJA 2OUKA 3WYGA 3JZAA 2Q0HA 3OE7D 1LW7A 4M4ZA 3PR1A 2IS6A 2P5SA 1D9ZA 2BBTA 4DDUA 1W6XA 3AB3A 1NN0A 3CM0A 2WMOB 4JPBW 4NPHA 4Z8XA 4X1VA 2PT5A 4HLUA 1GVNB 3QQ5A 4PANA 5H8WA 1E2PA 2ZSEA 2O8DA 1E2JA 5AUNB 3O8RA 2C04A 5ELXA 3LH5A 4NYMR 1J8MF 4O2LA 5BYKA 1S9HA 3DMDA 4L5BA 4HZUA 1Z0KA 1DG3A 1GCQC 1U0JA 5JFGA 3BB1A 1G6OA 4YMWA 2F2WA 1R0WA 1U98A 2BV3A 2YJTD 3VS1A 2KE5A 2YINC 3AP1A 1DAEA 2XITA 5IF9A 1G8GA 2QRZA 3EWAA 3D7MA 5G3ZA 1E9RA 1UBFA 4E22A 1WE2A 3IHWA 1RZ3A 3THXB 3I5XA 2QT0A 4AG2C 1EFRA 2KBEA 1QG2A 3EZ2A 3CZQA 1JAIA 1GG2A 1TUEA 3X1WA 4LX0A 2QAGA 1R5BA 1VTKA 1AN0A 1MRNA 3AKYA 3LX5A 4G5RA 3NC0C 4FMCF 4JVSB 1NBME 4KYIB 5J40A 3TVDA 4QM6A 3CX6A 1WDTA 4TQ9A 5DLQC 1IN5A 1JEEA 1KHTA 4LI0A 4IOJA 4W5WA 3RNLA 3T61A 4B44A 2IYVA 3GLHB 2OFXA 2R8RA 3HU1A 1NBMD 3VMFA 4HATA 4MA4A 4Q4HA 2QTHA 1F60A 2KBFA 1NSTA 1DO2A 5FOXA 2AD5A 1IO6A 1RI9A 4E03A 4DLZA 4JVLA 2YKGA 2Q3FA 3FYHA 2FFQA 4LHXA 2ANBA 3RS7A 1FX0B 5AUPB 1JNYA 3Q3JB 1X1RA 1NN5A 1WDXA 3EXAA 2BBOA 1UE9A 4KFUA 1KI7A 4ACAA 2CMKA 1Z0JA 4Q9LA 1P4SA 3I32A 2PZ1A 4UNSA 4MKHA 4HLUC 1G5TA 4J9EA 1QVRA 2X3WD 4ESVA 4KI0A 1M8PA 5HCIA 4L16A 4C2TA 2ZI7A 1FFHA 2A5DA 2DBYA 1RC8A 2OAP1 3QBVA 3EW9A 5KDDA 2CHQA 4BZXA 3BOSA 1NLOC 1E2QA 4AK9A 5FFMA 1J8YF 2R62A 3TSWA 3A37A 4JL8A 4Z8AA 4N3NA 4D8KA 4BRUA 3QUSA 3MRSA 4R9UC 3IBYA 1ZU5A 3TE6A 5FBWB 4B34A 5J4LA 2V1UA 1Q1ZA 3I35A 2GEVA 1F5NA 2G9NA 2V6JA 3VU9B 2EPDA 1ZINA 2EKHA 1QBKC 4UXIA 3AUXA 1XF9A 1ONBA 1XTKA 4EKDA 1GUAA 2GJAA 2FPEA 4BEJA 4LK2A 1ZNXA 2ZM5A 1S3GA 1NG9A 2QPAA 3KKPA 2ONJA 2GHIA 2ZE7A 3TR5A 1OKKA 3NBZC 4PPGA 1XD8A 2DILA 1JECA 1KO1A 3BB3A 3DMNA 3QKSA 3TUJC 1PHTA 1GRNA 4FCVA 4AKHA 3B2EA 4AURA 1N5IA 3VR3A 2G6FX 4MRSA 4PSAA 2GBQA 3THOA 4LHZA 4PPQA 1OKKD 2MOXA 3PUXA 2ZU0C 2ZI4A 4DC9A 2O8BB 4IVRA 1UF9A 2BBSA 2CHGA 2YUPA 2DYKA 4LUCA 1E9BA 5IHKA 2NIPA 2ZS7A 2VP4A 3R9WA 1YZKA 1F48A 1DPFA 1BOFA 3RS3A 1ZUIA 1L8QA 2QE7D 3SEAA 3SJAA 5CITA 1P2TA 3L0SA 1UEJA 1CKBA 5JWOA 2V8OA 4LJ6A 3PUVA 1ZD8A 4QG7A 1EFCA 1YWPA 1GNRA 3TK1A 3UANA 3EPJA 3CH4B 1SPKA 4Q7JB 4V0MA 2JLQA 5JHHB 1CKAA 2FA9A 4WA7A 1AQYA 3BD9A 4TMTA 2O9VA 2DL8A 3QE0A 4V0ME 1YR8A 4M0LA 4MRNA 3PIRA 2VSFA 3Q5DA 1BMFD 2D3WA 1EWQA 2QU8A 4CT4B 1F2UB 1Z3IX 3Q85A 3FMPB 2HXYA 2G88A 3KB1A 3ADCA 3I92A 3T06B 3NG1A 3U44A 3UG7A 3NHNA 5L23A 2VHCA 3BGWA 3ONWA 1NYGA 5LB4A 1HY3A 1MH1A 4DLYA 1YJ5A 3WHKA 2RGAA 2EFGA 5FWBA 3QPUA 4A15A 1E1RA 4RTZA 3CRW1 5DHAA 4Q9IA 2RGCA 2ZRCA 4PR0A 2MIOA 1AQUA 2J45A 3LDAA 1X27A 2FEIA 1X6VA 2ASEA 2QL6A 2GAOA 2GK6A 1G7RA 1Q1QA 1Z2CA 2PZGA 4DLTA 5KOYA 2G83A 5FTLA 3U3KA 1YHNA 4B2IA 2EYYA 5J4VA 3VNUA 4JJBA 2JJ1D 3NHBA 3GFPA 3OHMA 4BFZA 1KSHA 5IRCD 1FP7A 3OEHA 1TU3A 4JLPA 2RH5A 3K0FB 2H8KA 4LV8B 2GBLA 4TZ6A 3LX8A 2DFLA 5D3MA 3KXLA 1DAMA 4FXPA 2W10A 4GT1A 5BQ5A 4CC4B 1AEYA 3RYTC 3EC1A 2ZS9A 4FCWA 1Z6TA 2YSQA 2GWHA 2GZHA 4EPRA 3OEHD 4OL0A 4UJ3A 1HH4A 3MG9A 3ND9A 1HV8A 4OQMA 2A9KA 1SVLA 1NIJA 2PLRA 2WVJA 2IX3A 1Z0FA 4LY6A 4QHTA 5HR5A 2OSBA 1Z9ZA 1B3QA 2KWIA 1G291 5B58C 1QHGA 4QGFA 1ZBJA 2NO9A 3GEEA 2Q3MA 4DSOA 2C96A 4US0R 1UTIA 2IHBA 2KB0A 2XAUA 1KMQA 4OYHA 2BIFA 1WBBA 1TUDA 5JWHA 2R2AA 3TAUA 3B78A 3HYTA 1X6GA 3QF4A 2EGCA 3PUYA 2QORA 3THWA 2WJJA 4AG1C 3EZFA 1G17A 1Z5ZA 2GF0A 3GJ6A 3SN6A 4DDTA 1C4OA 3A1TA 2FZLA 4C0QC 4U5XA 4AYWA 1GL6A 1CJKC 4YMSA 2ZRIA 1TEXA 2ZJ2A 4DCVA 5SZJA 2CREA 3AGPA 4OI2A 1JB1A 4QOSA 1E6GA 4A8JB 1TQ6A 1N25A 4NCHA 2RQRA 4WOPA 2PMKA 1ZLMA 1ZVQA 3ZVMA 1DBSA 2XSZD 3N5CA 4KXFB 1YNZA 1SSHA 1KMHA 3C4JA 1CR0A 4PC1A 1KSGA 4NYIR 2B92A 1NVUQ 4HLDA 5IK2D 2FGKA 2GBLC 3G82C 4X8OA 3FDIA 2XXAB 3SE0A 4A0HA 2C0TA 3VR4A 2PMDA 4H9GA 1PJRA 1EG7A 4J9CA 2PT7A 4OQLA 2ZJ5A 2FH5B 3ZL7C 3B82A 1XTJA 2WSMA 3D8BA 4QJ5A 5L3QA 2RPNA 2VH5R 1ZSGA 2KGTA 1OB5A 4HAUA 2H18A 3EPKA 1GFCA 4TSFD 3R9IA 2OZEA 4MDFA 3QWXX 3ZIAD 2F6RA 2QTVB 1OW3B 4TLCA 2J5XA 5AUOB 5EQTA 2ZJOA 1M7GA 4RJLA 3AVUA 4JZ3A 2IYRA 4NBSA 2H8HA 3A98A 3RSLA 5DE3A 4A0RA 3SJBA 4F91B 3F8TA 1I4LD 2AN9A 1NYFA 1Q12A 2IYQA 2ZUCA 3NC1C 1NEBA 3D6TB 1P9NA 5EXSA 4HEJA 3HJNA 5G41A 3CLVA 3WRXC 5I11A 5JJKA 4M9ZA 3I61A 1ZUKA 4MYUA 3C0CA 1IN7A 4DDWA 5IXFA 2RN8A 2IXEA 1I07A 2GEDA 4RD2A 3PEVA 2ZUBA 3FE2A 1N3BA 1R5OA 1FTNA 3C41J 3CF2A 1NKSA 5FTMA 1XD2A 1YZGA 5AJWA 1OXUA 5FW9A 1IAQA 1NJFA 1XCGB 3NBYC 2FG5A 4C9BA 3KTAA 2HCBA 1AIPA 4EPYA 4IVQA 2ZSAA 2OBNA 2YNMA 2ZE8A 4QBGB 2NPFA 3AVTA 4O2RA 1H65A 2QY9A 1GNPA 1ZM2A 1P5ZB 2ZI3A 5JBQA 5LPNA 1T3SA 2LMJA 1KY3A 3L0PA 1SQ5A 4LUEA 4LYAA 1JI0A 1R8SA 3B9QA 5DI3B 3OEEA 1VECA 3SOPA 1M3BA 4LYJA 4URWR 1QLYA 4HAYA 1VG8A 2D74A 2JM9A 1E0JA 4LNPA 3MAAC 1MUZA 4AYXA 2X19A 4BGDA 4GPTA 2ZRBA 1P2VA 3QXJA 1K4US 5FOTA 1X2KA 3W6PA 2O8CB 5CB8A 3UA7A 3RNJA 3DL0A 3OEED 4KCGA 2ZYTX 3C16C 2JEOA 3TW4A 2AFIE 3B1VA 4PAMA 2IS4A 3FTQA 3U3RA 4DT1B 4MRRA 2ZJZA 2IIMA 4M4SA 3TLXA 3EIQA 1GL7A 1EFNA 3ZQJA 1N6NA 2EYQA 1HE8B 1ZCBA 1BK2A 1JQLB 1Q0UA 4FMDB 3FVQA 1G3UA 2QPTA 1NI3A 2Z6VA 3VHXA 5HZHA 4JJCA 1HURA 3WY9A 3D31A 2ZU6A 2CT3A 4Q4AB 2QA5A 5CYOA 5DO9A 5FH9A 2EBPA 3BJIC 4MKFA 4B76A 1A7JA 2HF8A 5EP1A 3RBBB 4E6RA 1UHFA 3U3JA 1IBRA 1R0ZA 2QUZA 2NOAA 3F3YA 3THYB 1W5TA 4URXR 3K0AB 2CH4A 1UAAA 2G6BA 2D0NA 1A82A 4C0SA 1AZGB 2UKDA 1CJTC 2ZAMA 1MKYA 3AKCA 3CRVA 2OI3A 1U99A 1XEWX 3TSOA 5F9HA 2CL0X 2PX0A 4DCNA 1W49A 4ZNXA 4OMPA 1KDTA 1KI9A 2WWFA 3GD7A 3SFVA 2FG0A 1E99A 2GGRA 2F1HA 2NG1A 2BMDA 1SEMA 2BM1A 1OV3A 4MYCA 4D0LB 1JEGA 1JQJC 2VBCA 1PNJA 1WXBA 1VMAA 4GFDA 4AWXA 1Q3TA 4MGKR 2CT4A 3A4NA 1LV7A 4P33A 4LYFA 3VS2A 1G1MA 4AFSC 2GCPA 2QMUA 4OK5A 3UA6A 2YOFA 2YWEA 4QL3A 1G3MA 3UMRA 2K79A 1TTTA 4TL7A 2F1JA 1G4UR 4WCIA 1Z6GA 1VA7A 1E98A 2RGNA 3R7WA 2E5KA 2HEQA 2O0HA 3LWNA 5A4JA 2AWOA 5G53C 3ZLJA 2H1LA 2ZS8A 3O8DA 1VG1A 4YMTA 2O88A 3CNLA 3EZ9A 4J9IA 1XD9A 2HV8A 2V7QA 3LBNA 1J7KA 4S2EA 3TR0A 4Y0AA 3VR2A 4G5SA 2CNWA 3BFXA 5KNDA 3L8YA 1TU4A 3MWKA 1OPLA 1UM8A 5BXQC 4A92A 2NMVA 1OYWA 3K9HA 2QG6A 4BASA 4A2WA 3EARA 4PTLA 1BS1A 1ZRHA 5JI2E 3X1DA 1SVKA 4A2QA 2RB4A 4IOKA 1HQCA 5JWRA 1RYHA 2ZRMA 1NEGA 4DCTA 1L4UA 2M0YA 4MITA 4C7OA 1W1FA 4OQNA 1U0HC 1Y57A 2A08A 2EQBA 2VSXA 3TSZA 4RCYA 5DHFA 5FBVB 4HVWA 4RFVA 3V4RA 1WB9A 1E32A 5F2EA 3ZS8A 4YONB 2WPDA 2IWHA 3VAAA 4WZBE 3VHLB 2XX3A 3WBJA 4BFTA 4PXAA 2NZ8A 4DLXA 1JR3A 1DVRA 2HT6A 2RHDA 1KDRA 4RD3A 1CR2A 4Q7LA 3QEOA 2WPDD 3P4XA 4M21A 4OKSA 3UWOA 4TT3A 1G16A 4LUDA 1OIXA 3O5ZA 221PA 3AF3A 3SBDA 1ZAKA 1YCSB 1II9A 2WJGA 3GMTA 4IJMA 4D0NA 2YYZA 1COWD 4LV6A 5BN4A 2RGNC 3K9LA 4XTCS 1S3SA 3PEWA 4ZDJA 3EHQA 2IF2A 5KUTA 3P1JA 4PAQA 3AH8A 1KI6B 1E2IA 3B6EA 1T8UA 2VRWA 1QHNA 3CPEA 2BHRA 2LQNA 2GVDC 1M8MA 4LJ5A 1IJEA 1ABOA 1KIKA 4KJZA 2PEZA 1V5WA 3DM5A 3IO5A 1S0UA 2DPXA 5JEEA 1EFTA 1MO6A 3W6NA 4TYWA 1PUJA 1Z63A 2A5GA 2ZR9A 1XPOA 3EA0A 3RHFA 2LCSA 4G1UC 3THKA 1R5NA 1U5SA 2SEMA 1T8TA 4UQOA 4AYTA 3QOFA 4NH0A 2IYXA 1MV0B 3X1ZA 3U23A 3NEJA 4KFRA 1UFFA 2ERYA 2ZAOA 1GM5A 4RZXA 3D3QA 1RIFA 4IEIA 3KQLA 1J2JA 1N5LA 1SVMA 1Q21A 2WSSA 3I73A 2J06A 2OCAA 1E2MA 4JS0A 1KKLA 4Z1MA 4P32A 2DB3A 3HWSA 2IUTA 2J6OA 2QEQA 3L8ZA 5SZIA 4DDVA 2EYUA 1UUEA 1XZPA 2JLVA 5C4GB 2EYWA 2GVZC 3W8NA 1MR3F 2ZVPX 4HDOB 5CK5A 2OHFA 2EFDB 1W1WA 3BORA 3K8YA 5DGXA 3KQUA 4CC3A 1HD3A 1PLKA 4IIMA 3T1QA 1S1NA 2F1IA 4PQFA 4KU4A 1CS4C 1YE8A 2NPIA 4A0GA 2IYYA 4Q1DA 1J99A 1WP9A 2D06A 3A1UA 4R7ZA 4F38A 2KRMA 2HUPA 1Z9QA 3DZ8A 1J70A 1XXHA 3VR6A 3EG1A 4EIWA 1XTIA 3RS2A 3IILA 1Q20A 2FDCA 1XXHE 2LP5A 4M1SA 2DJQA 3KX2A 4ZCLA 5IHNA 6Q21A 2CE2X 3LY5A 2KR3A 5L3VA 1TEVA 4GRAA 1XOVA 1MT0A 2WJIA 3CO5A 2G0NA 4RZ2A 2DL5A 3UF4A 4MUBA 2A3RA 1ZD1A 1KZGB 4FWIB 4Q7MB 3SZRA 3ND8A 5GJVB 3OESA 1S2MA 1T0HB 3SFZA 2RGXA 2HJGA 3O8BA 1LCKA 5FPYA 1T9HA 2JJ8A 2FFBA 2ODNA 3TUZC 2AK3A 2FFHA 2WHXA 2C8VA 2DX1A 4NTZA 1P72A 5AJXA 4JKYA 1BYIA 1GRQA 3NBFA 4DLRA 2QROA 4DZZA 1Q22A 2Z4SA 4MYHA 2ZI6A 4L4UA 1SXJB 1RJ9A 4J9HA 1SKYB 2FRWA 4LJ9A 4Q7KA 4N0EA 4OMOA 2ODWA 3NGPA 2AKLA 5JEDA 4FMBB 2QNRA 1OJLA 1A0NB 1HQYE 4R2IA 3NMZC 4LWZA 3GLFB 4BFSA 5K8IA 4ZV4A 1KFZA 4C0KA 1OH7A 1Q3HA 4JLAA 3TIFA 4DB4A 1QCFA 4M1KA 4B75A 2LWIA 4MDEA 4G0NA 1E69A 4GMXA 1YZNA 2J59A 121PA 3SR0A 1HT2E 4BFUA 3CB4A 3IBGA 4LV5B 2PJRA 1E1QD 4XWKA 4ILEA 2ZIAA 3TW8B 1E2HA 2IW3A 2ZYWX 3BFVA 2J0UB 3EZ7A 2P6NA 1WX6A 2BZ8A 1W44A 4Q21A 2D1XA 1F2TA 4V0KA 2VLIA 4RD1A 3PVQA 1D2EA 1YWOA 1XJQA 2GCOB 2I1QA 5BN5A 5JCZA 2RNAA 4M9SA 3NDPA 2F2VA 4IOLA 4F4JA 1NF3A 1N5KA 1KJWA 3AP2A 3PV0A 4B43A 2D7DA 1V1CA 2YUNA 2PL3A 4IW3B 1KK3A 1VYUA 3SDZA 1DE0A 3E5HA 2KEAA 4MGIR 2PNIA 2XNDA 3EG2A 3BC1A 4PHGA 1XTSA 5KSOA 4OQXA 2FPMA 3GLHA 2YVUA 4CC7A 4R0KA 3ZYCA 4EFNA 2EGAA 4GOXA 3ZQ6A 4US2R 1ZD9A 1E4VA 1E2GA 2XNDD 4ZCMA 2C5LA 2KXCA 2AHOA 2FU5C 3DOEA 2CL6X 3H4MA 4QJ4A 3WHLA 2J0SA 1G7CA 5FL3A 2K2MA 1E6CA 3IUYA 1XEWY 2DHRA 4HAWA 3WP1B 2FMXA 1RRPA 2FSIA 3VNVA 2WOJA 3ICEA 1NN1A 1Z2AA 5J5CA 2JLXA 1XTRA 1YZTA 2RHMA 1PZNA 4TMZA 1XMJA 2X2EA 2DY1A 1JR6A 3MWLA 4TL9A 1CRQA 1KNQA 3RVBA 3BAFA 4QT7A 5E95A 1Y63A 2OT3B 2R6CA 1LF0A 1VG0B 1A1VA 5B30A 2JTEA 2HLDA 2JM8A 2DNUA 1M2OB 3T1OA 2UZIR 4MKIA 5KU1A 3SJZA 3EZ6A 1OXTA 1QHXA 2ZSFA 4GLMA 1SKQA 4XJXA 2MMGA 1CTQA 3F0TA 2Z0MA 3KL4A 3RC3A 3WMGA 5B2ZA 5HPYB 1FNMA 4MGYR 3VU9A 1NVVQ 4GZMA 2J7KA 4TQUS 4B48A 2C77A 2HYIC 1X86B 2XNSA 1TQDA 2YUOA 2Z5FA 4LBYA 3QNUA 4KODA 1LS1A 1G8PA 1VCIA 5FI0B 5L3SB 3ZVNA 3GJ5A 1VCNA 3QXCA 1WI7A 2VP6A 3VS6A 1QZXA 3QBTA 1U8YA 2GESA 2OEPA 1XMVA 1EFRD 1JAHA 3VTKA 2GJKA 2P5TB 3FJ5A 1B07A 1U81A 1YR7A 5GADl 1L2TA 1SULA 3PUWA 3PE0A 3R8CA 4LSGA 4X8HA 4YC7A 2H16A 1E4YA 2GZAA 3CX7A 2IS1A 2O8BA 5IT5A 1Z06A 1N6IA 1RYFA 2XTMA 2ROTA 2WIBA 2PBRA 2L2PA 2W6IA 3RC8A 1O3YA 5EE1A 1HYQA 4YDHB 1QHYA 3KB2A 3MJHA 5G3YA 2HXSA 2NTYC 2GNCA 3H2YA 5J47A 5JECA 5FWCA 4JJDA 3MFYA 5FPHA 2JLZA 2CL7X 3NVAA 2YUQA 2F43B 2W6ID 2KE9A 1K76A 4OMNA 3ULRB 1QVAA 2GCNA 4N0DA 2O8FB 5CM8B 4I1SA 2P65A 2O0JA 2RCNA 2VYFA 3ZD6A 4B6FA 1T6NA 4HUQB 5FTJA 2ZI5A 3CBQA 3H0IA 5DN6A 1F2UA 3TJZA 4A82A 2CLCX 1PLLA 5CLLA 3GPLA 2KSQA 3WYFA 4RKFA 4ZDWA 2V55B 3Q5EA 4IEEA 1LFDB 1G20E 1XMSA 3SC3A 3SQWA 1SRLA 3QF7A 1W4AA 1GBRA 2P4RA 2QAGC 3SHFA 4XVUA 3GLIB 2JASA 3P20A 5TB5A 4A6XA 1YN8A 4RVCA 3RANA 2OBLA 3SYNA 3VQTA 2C03A 4ARZB 3B1ZA 5KNBA 4DWJA 4HZUB 1BH2A 3ETLA 5ECAA 2E87A 4JLOA 3LBHA 2KRNA 5EC7A 1K5DA 1W4RA 3GJXC 4K11A 5SZKB 3T5DA 5FUXA 8OHMA 1ZC4A 1GL9B 4D82A 3VS0A 4HDCA 1NMYA 2VP0A 3L43A 3CUEF 4FMDF 1G3IA 1ZU4A 1GZSA 1Q57A 2WWXA 4W5HA 1N0VC 4FWTA 5JSZA 1YU9A 4DHEA 2F1RA 4F14A 4NL4H 4POAA 3CRMA 1S9DA 3HU3A 2IL1A 1T91A 2IXGA 3I5YA 1KDPA 1I4TD 1OFTA 3CNNA 2DF6A 4JVNA 4Q01A 1PWTA 4PPFA 4EJSB 1OYYA 2GF9A 4JSTA 2GKSA 3HP1A 4HAXA 1FUKA 1GRRA 1P60A 3I62A 1YZLA 2IXFA 5TVKA 2DL4A 1YRAA 2Q21A 3GJ3A 3FHOA 1EX6A 1ABQA 4L15A 4J9GA 2GNOA 2EW3A 4LYHA 3NKVA 2WWGA 4C0HA 4M9QA 1OSNA 1ZCAA 3S1AA 4DLSA 1E2FA 4LBVA 5TXGA 4YMVA 1WCV1 2OM2A 3SBEA 4CT5A 4ACBA 1S1CA 3BRWD 1ZUUA 1GBQA 4B3GA 1D2MA 3U4QA 4TN1A 4EPTA 2D62A 2RAPA 2RKOA 1XFAA 3KKQA 1OH5A 5EE9A 4AY2A 3PVLA 1M7HA 5KSPA 3EASA 1O87A 3EG3A 3WXMA 1OFHA 2K9GA 1W4BA 2ANCA 3NTUA 5JLJA 2A30A 4JT2A 2F2XA 1XZQA 3NH9A 2RQVA 5AR1A 4D4KA 1FYNA 3PEYA 4M22A 5L3RA 1W0JA 5FOVA 1R8QA 4A8JA 1KK1A 1S8FA 1E1RD 5C1BA 2BM0A 3FB4A 3ZH9B 5F98A 3R6NA 2W0SA 2R6FA 1U90A 4DB2A 4EQ6B 3U7FB 1NG1A 1KYIA 1D6JA 2XXAA 1E0KA 1AWOA 3ADKA 3HR8A 2CCKA 3SYKA 1OH6A 3QKUA 2NO0A 2OAWA 4DLVA 4F16A 1M3AA 2ZPTX 4DJTA 1TPZA 3DEFA 2YZ2A 1QG4A 5EP2A 1SVWA 1JQQA 2J6FA 4M1TA 2ZJ8A 1OXXK 3EG5A 5FL7A 4BEBA 4B3XA 3P32A 1Z6XA 3IPYA 4FCTA 1FOEB 2RMKA 4UNQA 4DEXA 1S1MA 1FMJA 1KO5A 2X2FA 1KO4A 2IC5A 4LPKA 5IHPA 4HSEA 4CEIA 5DSZA 2OJ2A 2DL7A 3OAAA 2AK5A 2W0MA 3OFNA 3AEZA 1PKTA 4GP7A 2B7CA 3BH7A 3DHWC 3B8HA 4M2LA 3M0RA 3A58B 4G3XA 1E9EA 4EFMA 1W36D 4IXMA 2W58A 4TQAA 4L9WA 5LB2A 1Z28A 3B1YA 3VFDA 3Q72A 4DBLC 2QM7A 1XPRA 2O8EB 1SVIA 1WA7A 2YWFA 3K70D 3OFND 5EXTA 1RW4A 4Z8YA 1WLPB 4ZIRB 4RTWA 2UZ3A 2QBYA 4O3MA 4HUTA 5HCKA 4Q4JA 2XOKA 3CR8A 3KJGA 2CEAA 1G3QA 4W7SA 1TAGA 2QT1A 1CKEA 4URZR 5FBRB 1JXOA 5E7JA 2I3BA 3LXRA 2BJWA 1ESNA 1B23P 3HR7A 4GP6A 2GETA 1IN8A 3KKOA 3UATA 5DI9A 4EPVA 4JJZA 1PRMC 1FUUA 4K8OA 3NWJA 3UIEA 3QSYA 2A36A 2IYLD 1Y3AA 2C9CA 2PLFA 1ZMXA 2FO0A 3MJRA 2AK2A 2DFTA 5GJCA 1DARA 1M1YE 2CSQA 1X8KA 1ZC3A 1ZBDA 4KBFA 4EFLA 3M0UA 2J6KA 3B85A 4LJ4A 2LKDA 1A2KC 3QVUA 2GJ8A 1NMXA 4L9SA 1QDEA 1WF3A 2GILA 3LV8A 2DE0X 4FN5A 4LJ7A 4QHYA 5H1YA 3BS4A 3TQCA 2O8CA 1WXTA 3M0SA 1W36C 4M1YA 5IXBA 1G5RA 2HDAA 4KITB 1XNJA 3KFVA 2VPPA 1EFUA 1QKXA 4TLAA 4TTPA 1KO7A 3NPFA 3K70C 2XGJA 1WXQA 2G77B 3FKQA 4DT1A 2NWMA 1PRLC 4B73A 2YOHA 2VHJA 4A63B 3CH5A 4D26A 3ADDA 1CJUC 1BB9A 4OHVA 821PA 4YMUA 3B1WA 3I1FA 3NEYA 3GEIA 4LBZA 5KNCA 5DH9A 2MMCA 3FHCB
chains in the Genus database with same CATH superfamily
3AKDA 1QG0A 2WJYA 4W5OA 2A9OA 3K05A 1IK4A 2ZUFA 1Z6YA 4WKBA 4Y7DA 1WIEA 1R50A 3CCUA 4MLPA 1O97D 1QF9A 1AWJA 1EFVB 1YA6A 1LDEA 1V5FA 4L4RA 2XUPA 1SBHA 5BR1A 1RQRA 1EDDA 4PW0A 3GYGA 1MX1A 1UDAA 3EG0A 2GDJA 3E6AA 4YROA 3H2SA 3RUPA 5B4VA 4JBLA 1ZM3A 2B8AA 4TXNA 4DCOA 5KX5F 1W19A 5DYTA 1RXWA 2RE8A 3K6JA 5BQXA 1SCUB 4DOMA 4AJJA 5EE0A 2J3QA 1TQ4A 2QVCA 1QP3A 3UFXB 1KSJA 4ZVMA 1UBCA 5HDQA 1V2HE 2PBZA 1NJSA 3DLTA 1LSSA 3VSCA 1RXYA 1YMQA 2X8AA 3HR4A 4BP8A 4B80A 2B0JA 2XDYA 4RK0A 3DGFC 4RFSA 1EXNA 4FDTA 1EIWA 3GRKA 1HUQA 2FJPA 2JCSA 2OSVA 4YI3A 3T52A 1O95D 1Z83A 2HEIA 2JLYA 1K6JA 5IVIA 2AZVA 1YUBA 2CNWD 2ODQA 3OMGA 3GLKA 1OBCA 2KS6A 3AVQA 2ZRPA 4P2BA 2I5PO 3RERA 1V1RB 1WMBA 3EXG1 1R0CA 3ECCA 4FYYB 4Q9NA 2WOOA 4XWTA 2WSLA 1IATA 1KC8R 3VS5A 4TLBA 5CA0A 2FRYA 5HK3A 4GKBA 2ONZA 3WGKA 3BXOA 4ODIA 4IFEA 3AXSA 3KSAC 3HCAA 3D8UA 1U7TA 2OHJA 3EULA 1KY2A 3A1FA 4QBIA 1SXJE 1WV1A 3EA5A 3RS8A 1RAEB 2WSSD 2J0VA 4A2PA 2B9VA 3A6LA 2HJRA 4Y2HA 2PX2A 4GR4A 3IT3A 4XSVA 2JFOA 1WXDA 1D1CA 4IV0A 4EF6A 1YOVB 3GFRA 4MOWA 4FFRA 4A4FA 1AU9A 1ABEA 4OFWA 1IRXA 3TZLA 3TRKA 2D2IA 1Z5NA 4N5MA 5AD1A 3HLTA 5KDOA 3H1AA 2FEMA 3LPCA 4IGEA 1N8SA 5GMOA 4YXWA 5AK4A 5C32A 2FPIA 2XI4A 1HSQA 2QRVA 1Z12A 3DWFA 1ONOA 1G5IA 3WICA 2VYVD 3AU9A 3GIDA 4CKXA 1MVNA 5JC8A 3RTBA 3EQ6A 3PNMA 2DGDA 3B5EA 2PUDA 2CJYA 1N8RC 1VL0A 3W5VA 4C6SA 1Y6RA 4MICA 2C78A 5TF0A 4MV9A 5IT9E 3N0RA 1X6OA 1TCAA 1CS0A 2WKRA 4OI0A 3DW1X 2CKDA 4GBMA 4E7LA 5LJ5h 4I36A 3F5QA 4AZSA 3H13A 2RAVA 1RI1A 1XTUA 1M2KA 1TNDA 4XM2A 4FR2A 4GE0A 3JWPA 4EEXA 5IVKA 2Q46A 4EX7A 5LOVB 4IG9A 2E18A 4O4IA 4M88A 5E9QA 1MRZA 4LDZA 2C0PA 1SOAA 1EGAA 2H3HA 1R2QA 3UTCA 2G25A 2BC9A 2IPMA 3EGCA 2JW5A 4XB6B 2NUBA 1NBMA 2ESWA 3VRYA 4BMDA 4YT4A 2Y6UA 3B7WA 4J07A 3QZ5B 3PXUA 2EJWA 4WW0A 4EIKA 2BONA 3HBNA 2QG9B 2IU3A 1PUIA 3JD3A 1NWCA 1Z7BA 4LE1A 5AVRA 5JV5A 3NWEA 3RWBA 1L7VC 2ID4A 1Q0TA 4V0SA 5GAN6 5DSTA 2QQ9A 4HGNA 2R58A 2R0QC 5D6OA 2P68A 1RCTE 4J83A 2NQ2C 1YNSA 5DYIA 5U9CA 3WS7A 4WXPA 2XQIA 3HXMA 4HDQB 5J3BA 1W1UA 3TMYA 1G8FA 4U2CA 3B7PA 4EJSC 3A9UA 2V9ZA 2CNDA 1I81A 1ST3A 3VZPA 4YRRA 3D6NB 1IB6A 4A0FA 1QIFA 2VDVE 3GPCA 4CR7A 4KUHA 2QAIA 4MI1A 4P81A 3DC2A 2QYTA 3UQZA 2A0FB 3H1EA 3M1LA 3AI1A 1RADB 4ENPA 4H4EA 1UWVA 5AK0A 2OG2A 1CDZA 3CNQS 4YJHB 3GP5A 1QE3A 1P3JA 3OD5A 1Z0IA 5DT2A 1NNUA 5ITWA 2NP7A 3E22B 4JP8A 1KSWA 4MW4A 1FNNA 1ZH2A 2EFCB 2AW3A 1QIHA 4M0PA 4MS3A 4FDUA 5E7IA 1UGSB 2EGUA 4MB2A 2H2FA 3N0WA 1GN8A 2A35A 1ZNQO 4C0LA 1UM9A 3PR2B 3Q3IA 5F2KA 3TI9A 2RHRA 1QS0B 2IITA 1PJCA 2F67A 3IHKA 2GF7A 4V0OA 3PB3A 1R10A 3CW8X 4AS3A 1T2DA 5L7WA 1WNLA 2GOYA 4JBYA 1ZESA 3A8TA 1M6HA 4XJTA 4IV8A 3RV4A 3DDOA 4UAUA 1XTZA 1Y8QA 3OPVA 3CZAA 4D9GA 1OLUB 1Z73A 4NZMA 1ILEA 3RSFA 2ROLA 1GUDA 2OV4A 3K70B 2QI9F 3MOIA 1O58A 3DONA 2XNHA 2FL7A 2AC7A 1WHHA 1Q1BA 1YI8A 3V4OA 4X1KA 1ORVA 2YICA 2ZPUA 3OE5A 2RHLA 4OMLA 2YJ6A 3R3VA 2NT4A 2GTHA 5IFKA 2BUDA 3CX4A 2JVKA 5KPJA 3ZV7A 1UAGA 1SUIA 1BAPA 2ED0A 4PBSA 2HT1A 2Q5HA 3KJNA 2EYXA 2JL1A 2QMEA 5T8KA 2QGNA 2BCEA 1XEFA 4YA6A 3IBTA 3DT6A 4EHKA 4FQ8A 1EM8A 1AWXA 4O6VA 3G71T 1T9BA 1JSRA 4UD6A 1LH0A 3R3HA 3QKRA 4TVRA 4YUXA 1Z88A 2YJNA 1PVDA 10MHA 2ACVA 2DVJA 5DW3A 2QLBA 5THKA 3V2UA 1PJZA 5K20A 4E6PA 1N8RU 3RT1A 2V6FA 3KDAA 4RPGA 3WL5A 3DCJA 4I5IA 2JLCA 4HGRA 3IV7A 1X87A 2WTEA 5IBRA 4W9MC 4YRQA 3SNHA 1Q2UA 1UC8A 1X19A 1H5NA 4QAJA 1OLSB 1J39A 4RHUA 1Z8DA 3ROZA 3TEJA 3NRCA 4TKUA 5TC4A 3HDQA 1N5JA 4AY4A 4IRUB 1Y5IA 4O4LA 1QWEA 3CCJQ 2MYSA 3H0EA 5HM8A 1RUWA 1C9KA 2RJOA 2G1JA 4QYSA 5DMHA 4LAFA 2P69A 1Y7XA 2OL4A 2QTGA 1CULC 2DY0A 5E6RB 4L5AA 3GIWA 1Z2NX 3HZRA 5EIFA 2V8JA 1S96A 2IPLA 3OM8A 4J1TC 4A0QA 4LVCA 4LXUA 3R7DA 1TUCA 1WTAA 2VP9A 5AW2A 5IMSA 4MUYA 1G3RA 1KXZA 2GBPA 3JB9H 3V4PB 2REBA 2OBMA 5AVUA 4G5QA 4ZCRA 4C7OB 4DY6A 2EZ9A 2FKNA 1ZGBA 1PX0A 2R65A 3T1YB 2OAGA 2P0EA 4G5XA 4DLPA 2DFUA 5LZ2A 3JQPA 3COVA 3A6FA 3G5MA 1E9AA 4PJOD 2GXQA 4MQEA 5GJVC 5BMOA 1TK9A 5LJ3f 1Y33E 1RQNA 2OXTA 2LPMA 2R7NA 2FW9A 5EUMA 2OHHA 1A9PA 4JBHA 3ROEA 5T64A 3FJPA 4IIXA 4JZ4A 2CK3D 1GGFA 2WICA 4RF5A 2PJUA 5B1HA 2C99A 2DCUA 2AKYA 4RYLA 4OHCA 2FF5A 4PLFA 2OBBA 2FZGB 3NVKI 2Y68A 3NALA 1QHSA 4QODA 3S2ZA 4HNTA 1UBHS 1H2RS 4I9NA 4RTXA 1OXMA 2PZKA 3U6KA 5CLHA 4LHSA 4D6WA 1QHIA 4ZREA 3FCCA 5L3SA 2YASA 4XD7D 2SCUB 1FFBA 4RDIA 4DV3B 2JT4A 3FF1A 4JJ6A 4Z02A 1CC1S 4E11A 4RH0A 2CZQA 2FSVC 1GZ6A 2FUEA 1RI3A 1U06A 3KQKA 1C3LA 1UECA 4U7JA 4QDOA 4HVLA 3A1DA 3H8SA 4I6EA 4X3CA 3IXLA 1V47A 4UNNA 1BXGB 2R6JA 3BGSA 3OE7D 5DP1A 4H15A 1BHSA 3TNJA 1A8HA 4FHZA 2BRUA 3MTAA 5KJ6A 5A7FA 2KMTA 3GW8A 4K03A 4O63O 4F45A 1ZXBA 3QU9A 4BNJA 2FMUA 3KWMA 3MMXA 4LN1A 1DG3A 1GCQC 1JWBB 4KXMA 3PA6A 2Q6OA 1DKMA 1NFRA 3NI2A 4BO8A 1Q0LA 1J0CA 3BXPA 1GG2A 4LX0A 4BIIA 3U1TA 4KGVA 4YAGA 1U2QA 3GN2A 1Z68A 5LA6A 1NF9A 4MA4A 4P5EA 3UMCA 4Y9UA 2BZ1A 3RTCA 3FUUA 5DGTA 3Q3JB 1KE2A 3H5RA 1Z0JA 4N7MA 4PWYA 4UNSA 1PG0A 3BL6A 1I80A 3ER6A 4NENB 4KI0A 3I5UA 3PC8C 1ZGCA 4ZN3A 3R1IA 4TWJA 1KYTA 2I7XA 4JL8A 3X2FA 1CERA 4YX9A 1Z4PX 4AM8A 2V6JA 1NGSA 1Q91A 4MMYB 3BDAA 1V95A 1Y7HA 1SXQA 3TUJC 4B4OA 3VR3A 4WNAA 1RM0A 9ATCB 4I3GA 1D6NA 1JT2A 3O8VA 5C1OA 3DT9A 2V8OA 4R81A 1EFCA 1GNRA 1AK9A 3F6EX 3M6VA 3VYHB 2XZDA 1J5PA 5C4IA 1EWQA 1O6BA 3FMPB 4GBED 3NG1A 3AESA 3RTGA 5LB4A 3ONWA 1NBEA 1Q1NA 1L5OA 4KZKA 2E12A 3UC9A 3LT4A 4GLLA 3OLQA 3TQSA 1JIIA 2BFAA 3EFEA 5JH7B 5IXYA 4H7FA 3F6YA 2H8KA 1NBAA 3LX8A 2QR3A 1SC6A 1OC4A 3CUTA 3MWEA 4FDLA 1ZOSA 3PQ7A 4CL8A 1ZBJA 2YH2A 4B3SB 2JFUA 1HMYA 2IPXA 1THMA 5AIBA 3H7AA 3SN6A 5LKAA 2HFKA 4ZU1X 2B2NA 3TRJA 5BW4A 3TIGA 2Z1MA 2RC6A 4HDKB 1XVUA 1KMHA 1DZIA 5EWMB 1Y80A 2QD1A 4CQLA 2AT1A 3LOQA 2C0TA 1L7AA 3ZL7C 4X1YA 5JSUA 3LCJA 3DSRA 1Y81A 1EQUA 1T8PA 2AQHA 3QWXX 1NX9A 5F7OA 4BE0A 3RSLA 1TUBB 2OHIA 3I0NA 1YQUA 3D6TB 2AE1A 5EXSA 4LMRA 4M9CA 1IN7A 4AX8A 1J2TA 1U7WA 2HCBA 2EARA 5HUJA 4B40A 2ZI3A 2BGKA 1KY3A 3EGXA 1ZO8A 3AM4A 4X00A 2H4YA 2NTEA 1Y37A 5DM7R 2ZRBA 1P2VA 5IC6A 2MI6A 1UJNA 1ODIA 5EMNA 2FPGB 3FAZA 2ZPGB 1SZCA 4HFRA 1IY9A 3WNQA 3PD0A 1XGKA 3FVQA 1YITA 2I80A 2COEA 2CB0A 2JTMA 1D7AA 1L7QA 3G1JA 4QT4A 4B76A 2BL4A 4ZAXA 1YJCA 2VDNB 1G21B 5AYFA 1CJTC 1QVGA 1IOWA 4KIWA 4MPPA 1ECCA 1JQJC 3LP8A 3EXEA 1I3CA 4XX1A 3WLNA 1RDFA 4FYXA 4KUGA 2AOUA 1R4MB 3OLWA 5BXQC 4DM3A 5CT8A 3GNGA 2W98A 2M0YA 2VN8A 2B4QA 5JCOC 5DHFA 4J76A 4O6JA 4R83A 4IEFB 3OS0A 3WBJA 5TGTA 2LXNA 1QAMA 2ZWVA 3HGMA 4LNHA 3ER9A 3P4XA 4KMSA 1MNQA 2VDQB 1AKRA 2DBZA 4MDXA 3PEWA 1T43A 4QQDA 4HX2A 1KI6B 1V7QA 4N0QA 1QHNA 5AW6A 1EFTA 1CDEA 2JK1A 4AYTA 3BBLA 2FZCB 3KSDO 1KQ2A 5HKCA 2J06A 2L8DA 2ACWA 2IZ1A 4HDOB 1YS6A 4JYPA 4RHYA 4UU7A 5DGXA 4IIMA 4A0GA 3T5BA 2IPOA 5CK9A 1QRTA 3P9KA 4XW2A 2JIDA 1XTIA 1Q20A 5MFPA 4E51A 1XTBA 2G0NA 2OTLT 1RHKA 1T0HB 4C7BA 2QK4A 5BWCA 4UTZA 1TK2A 1Q22A 1PG2A 3ICOA 1YITT 3NGPA 1Q7EA 1GZDA 3OU6A 2BGRA 4E5PA 4RIIA 4LWZA 2JNWA 2EXXA 3WNVA 4C0KA 4RM2A 5J2TF 1YZNA 1TIPA 3GD5A 2O23A 2IJGX 4KUEA 1D1SA 2P0AA 3O31A 4YJ2A 3KT6A 3ULKA 3T3HA 5LJ3g 4IW3B 4A0SA 2ZBPA 1WUTA 1M1UA 1H3NA 4OQXA 2XYQA 3MTBA 4CC7A 5DVZA 3ME5A 1E2GA 1Z4OA 5E1BA 3I2YX 1DKUA 4LMBA 5AKXA 1RRPA 1HK7A 3AOGA 2RHMA 4F4UA 2QRMA 4O1IA 3CEJA 4BV3A 3IH5A 3C1OA 1EU1A 3K0KA 3LQYA 2WSIA 1YJXA 3A8GB 1TQDA 1A7UA 4LBYA 1CZKA 1O77A 1QZXA 1QIGA 1EVYA 3UTDA 2GJKA 1B07A 1GUZA 4IG4A 1TKBA 4D8XA 2J4DA 1E3IA 3MHTA 2QGFA 2L2PA 4LYYA 5G3YA 2VTDA 3PGJA 4Y2TA 2ENWA 2WNHA 5JMPA 2FWJA 4EHAA 2G8NA 4KR9A 4TKLA 4U3JA 4C92B 2V6BA 4DYVA 3GRUA 3WYFA 1P4JA 2PUJA 1WR8A 4HQLA 1I1HA 3WGJA 3K32A 3P20A 1M0SA 3FGOA 4UM5A 5B36A 1L5WA 2PWBA 4MV4A 2AG6A 4V38A 4MQFB 5HGJA 5FAXA 3Q9NA 5GAMg 2A86A 1S9DA 3GG2A 3I5YA 3OUZA 4R8MA 1GTSA 2SNIE 3PFNA 4BNGA 3REOA 5AT1B 2J6HA 2IXFA 3NYRA 1YRAA 4JEMA 4U8HA 3CMAQ 2OKGA 4BJ1A 4GH5A 3SBEA 4YCJA 1WZUA 3A6KA 1PGJA 4UEJA 1XCBA 5EE9A 3ZY6A 3EASA 1YUNA 4YTLA 3Q1KA 5BNFA 2X0RA 3V4LA 4D4KA 1SXHA 4E6EA 2HCTA 1IWPB 1D6JA 4QRDA 3GV0A 2NO0A 3UY4A 1KC8U 4DNFA 2WNIA 1F2VA 3P32A 1VQLA 1N9KA 5DSZA 2AK5A 1PJ3A 3B6JA 3NYIA 4BU1A 1DWPA 5LQAA 3S2EA 1U8CB 3B1YA 2ZPAA 1WA7A 2Q3BA 4JJ4A 5H9VA 3I9V6 4Q4JA 4NXMB 2C8JA 4I8XA 1K4KA 3ORRA 2E6ZA 4HQNA 3LXRA 1B23P 4HPJB 1MMFB 1DKPA 4A8TA 3UHAA 3WIDA 3CMEQ 5K09A 2RDMA 1JFTA 1DARA 3U4CA 4YQEA 3LV8A 2EW8A 4QHYA 3VPAA 3BS4A 4DR4B 1FEZA 3W8DA 1ITZA 3Q6NA 2R1TB 5GMKi 1HDYA 1PRLC 3Q7SA 2AMJA 1RTTA 1BEZA 5GAN3 3NEYA 1ST2A 2X3XD 2Q7DA 5CEFA 4Q4AA 4AC9A 4PX9A 1QIMA 1MFZA 4XTVA 3AVXA 3NGMA 4FKBA 3I6QA 3WADA 1GR1A 4YRCA 5BR7A 3KETA 2D8JA 2WDZA 5DBHX 1D3BA 4MI3A 4WAUA 1U1TA 1SC3A 2ZT7A 5LJ5d 4F84A 1NSYA 4TWAA 1A4XA 2YC2C 3R6GA 1REQA 3KUUA 1BYMA 1QWOA 2F59A 4TM8A 2G7ZA 3KDSE 3DPSA 4MR7A 1ESDA 2VUTA 2F3UA 2JGJA 1N75A 3CH7A 3CUUA 4BZZA 1NTOA 2XGSA 3OURA 2HFJA 2R751 2HREA 3K31A 5JDIA 1OT5A 4CMIA 4KBGA 4OTZA 1HQDA 1OXVA 3NCHA 4DAEA 3SLRA 4KDFA 2P4SA 2ZRHA 1GAEO 1U28A 4WASA 1B3BA 2ZBFA 1U8FO 1PI3A 4YRIA 4U8GA 2AD1A 2ZEJA 2DWCA 3RHZA 4PJOG 2GZ3A 2Y0CA 3Q4GA 3O9ZA 4R8KA 5LBTA 2Z43A 5FWAA 2P0YA 1YXMA 5JRDS 5HUHA 4G4SO 5CM2Z 2AFIB 5TMBA 4NU6A 2C95A 5AKGA 3WE7A 4BDYA 1IEWA 3MMZA 2CJWA 1IHVA 2HCKA 4ZVKA 3P9RA 4NR0A 1EXMA 1IPEA 3ZOZA 4JB8A 1HLGA 3ZDRA 4I4NA 1GCPA 1JN0A 1SF9A 5JBNA 2CS7A 1HDGO 1J9EA 3K9QO 3EC7A 3PT5A 3O3CA 2VDWA 1AHPA 3EN0A 3CF6R 4EGFA 4JP1A 1IHOA 3IUQA 1KAHA 3O8CA 2WDPA 1YQWA 4ZO4A 1IY2A 5L8VA 5EZYB 3JV3A 1EH5A 4Z1MD 1M5UA 4ITRC 2FN4A 1J0EA 3I56A 4TS3A 2EFEB 3P27A 2IGTA 3FJYA 3QI7A 2VG8A 1OVMA 3A6ZA 4GGPA 3CD6A 3FNRA 5CTJA 4UMVA 3OG9A 2F3QA 4GKJB 3U2QA 2WF7A 5H4HA 4LJLA 1NP6A 4PO1A 3ZE8A 1JL3A 4HB4A 4B2LA 4C6TB 3PUKA 1RAIA 1TM4E 2H51A 1U7DA 1KO8A 1G9TA 3WGVA 1KEWA 2YBDA 3RGWS 5H80A 4YV1A 1FVOA 2XBLA 4FINA 4JRQA 2C2WA 3AERB 4HS9A 4YP5A 2WPNA 4DA8A 1Y8RB 2R86A 2JD1A 4NYIQ 1J07A 1DJQA 2O5VA 3NM6B 3I30X 4B81A 1ZUHA 3PPXA 5HW0A 2PBFA 1LGYA 4O5OA 3K6SB 4TMVA 2D3TA 4FSDA 4JI1B 3ZW9A 3F2IA 1DQRA 2Q9AA 1GSIA 3FSRA 1Z7EA 2JJYA 4B83A 5KE2A 4CEHB 5AUQA 4LTNA 1NP3A 3BTUA 3FYUC 2HADA 3BGOS 3UOGA 1AKTA 4Y2UA 2BYTA 4LDUA 4AULA 4G0OA 3NAQA 5DNWA 1K7CA 3JCMf 2A0KA 5DLEA 1L4KA 1II8B 1WHTA 3UUEA 2HA3A 2Y1XA 3EXHB 4FFBA 5I5GA 4QJBA 3OW2A 4MDHA 1ZNZA 4E88A 3I1IA 1YRYE 3I2HA 3JVVA 4JB3A 2PVCA 1EZ4A 1NVKA 4G4JA 2IHJA 1A9RA 5J23A 3EAFA 3QM1A 5B7PA 1O7JA 3SHOA 3DO5A 3RSZA 3HY4A 3L7YA 3RUCA 1A7KA 1XQ9A 3GROA 2FWRA 1TSFA 1XDZA 4M55A 3OD1A 4U0KA 3T12A 4NCKA 4JIMA 2C98A 1C9DB 4FCCA 1YZQA 621PA 4WHMA 2JC3A 2HR1A 1K5GA 2WFAA 1VQOA 2YXNA 2W2OA 1OF1A 4H3VA 2CXTA 4TLEA 5JTUA 3T35A 5E9JA 3OEYA 1KYXA 3BDLA 4FC6A 2WV7A 3ZZ0A 4CCYB 1BGXT 3E0QA 3R3JA 4A7PA 3HJFA 1FXWA 3CLRD 4PNHA 4AU1A 2AWNA 1DBRA 3HJCA 4Q93A 3RS4A 2VJKA 3LD9A 3S8MA 4MIEA 1N0WA 1IMJA 1NJGA 5EQDA 4HWKA 4IQGA 3JCMc 2GAJA 3NBXX 2J3JA 1VRVA 1GILA 3GPBA 1EEXB 4LD9K 1PKXA 2QVYX 3M6FA 2VI5A 4MUJA 1UFRA 3S6WA 2YX1A 2WIAA 4JLKA 5IANA 2WV9A 2ZQ5A 4Z2AA 1UKBA 3RPEA 4BECA 1DWUA 2WG1A 4KXVA 3FPAA 1ZGJA 4JJEA 3AR8A 1XYYA 1PL8A 3ZWBA 2DM1A 1AXGA 2A2ZA 4MV0A 3TVTA 4HD8A 4CWAA 5KC9A 4J7AA 4JLIA 4L0DA 1KFBB 5EHIA 1KZ6A 1RVDA 2AOTB 1DAFA 3MUNA 3ZIAA 1VCOA 1GDHA 1LI5A 4OOFA 1VPDA 1AJEA 4B71A 2HBZA 5E9AA 1C6VX 1DWQA 4L3VA 4J9DA 5HTKA 3T0IA 4CLOA 4MVJA 2YN0A 3AHIA 3C1TA 2CHVA 3GAMA 3ZIUA 3SYMA 5CYPA 4EYOA 3T7EA 3M4NA 2ZRNA 5AVWA 3RYHB 2NSHA 2G1PA 3AETB 3W5CA 1DI0A 3HCBA 3JPWA 5EXDA 2GJSA 4IYJA 4NAVA 2EKDA 3EODA 3K6KA 2XOEA 2GNAA 1SCAA 1YHZA 3PDWA 4R2MA 3EGWA 1TS9A 1VQOT 4Z54A 3P71T 5KNCH 1DCTA 4OLFA 1EDBA 2VYTA 1NY6A 1YQQA 3OYKA 3GEGA 1GNQA 1I5OA 2LNHB 3PXXA 2VKQA 3ZVLA 1HX7A 5EC8A 5IASA 4JBWA 1QQ5A 1KRHA 4NYMQ 3FMFA 4DTCA 4B5LA 3K1AB 1Z18A 1W0KD 1X7YB 4YDQA 3B1XA 1KQOA 1UCFA 3MK31 2BKXA 4LI3X 4P3NA 2ZTLA 3M4ZA 3LRPA 3VM6A 5CKHA 4ZVVA 5T7BA 1FYDA 1I0IA 1VXRA 2HSEB 1EWVA 1N2CE 1OU4A 1AKYA 4FIBA 2EFJA 3WL7A 1M2VB 4WNYA 3GNQA 1P0QA 1NL3A 1PP4A 5CXUA 2FPSA 2GYUA 2PU9B 1ZNWA 3L49A 4OA8A 1WHSA 2P5UA 3CVXA 3E05A 4ON9A 5IXJA 2DIQA 2Q7XA 3ZZUA 3OZWA 2HLNA 5HCUA 4J6YA 2GEUA 5I7AA 2G3RA 3BICA 4B82A 5C52B 4OX9B 1I0CA 4QTTB 1CK4A 3GNTA 3BWDD 4OIFA 5GGYA 4HX5A 4YRMA 2GCGA 2R6GA 2UVDA 3ND5A 4Q00A 3CT4A 3KKMA 3OJ0A 1WCYA 3CC4A 2VNJA 4TXJA 1RLQC 3KVRA 5AICA 1XZDA 5F9MA 4QFDA 1I3OA 1P19A 2Y1LA 1EYZA 1BA3A 2N1BA 1MG0A 1LTHR 1SN7A 4L08A 4H1VA 5HDBB 2VDPB 3H2GA 2QTTA 3TSCA 3ZTWA 4JLSA 3CNEA 4TL8A 3ZJUA 2GTOA 3SNKA 2BT4A 2PK3A 4C8QG 2ZIVB 2FYKA 1DLJA 3ITEA 3REGA 3BJZA 3HYCA 5JASA 3EQZA 2D0PB 4XDYA 2GFIA 1OV6A 4M78A 3A6HA 3ZGXA 2AV6A 3SSNA 3OH8A 2AXPA 2WVGA 1NBHA 4K5QA 4DC1A 4C4TA 2KNBB 1XIVA 1RAHB 4ZOCA 5BQ3A 5CURA 2LT1A 3QVGA 2BCGY 4WIAA 1ZSZC 4RHFA 4M8NE 2ED1A 2DQYA 4N4GA 4D4MA 4RTNA 2XWQA 3BMNA 3D1JA 1F8UA 4OL9A 4K87A 1MNAA 3P26A 3W3ZB 2BEWB 4J0IA 1DT3A 2X35A 1W2GA 1QH0A 1W6XA 2X5OA 2CSXA 4IKFA 3A2MA 4JROA 3AK4A 4AAYA 4NYMR 5DHSA 3I2GA 3BULA 5LL6P 1DAEA 5BN5B 1V3UA 4MP8A 4QUKA 3QKJA 3M2PA 1KP3A 1MQ9A 1SQSA 1A8SA 4JVSB 4FMCF 2OUIA 4PKCC 3WNZA 3OYJA 4YHBA 4IOJA 2QN1A 2OFXA 1V7ZA 5DLYA 2AD5A 4NI5A 3H11B 4JVLA 1A96A 3FYHA 4B1FA 1OY1A 1P0FA 2C3UA 4KFUA 1KI7A 1AUOA 3N8IA 3JQDA 3ZJ5A 2A5DA 2ZJ7A 2Z8XA 4BRUA 1NW8A 5HY6A 1L5RA 3VYSB 2VDLB 4YAOA 1G8XA 1ZNXA 4F0JA 3G5AA 3KKPA 3U4GA 3ZDZB 2P2DA 4ZODA 3JQFC 1E1LA 4AURA 4PSAA 4PPQA 3PUXA 1YIJQ 4NBRA 3LC1O 5KH6A 2V7UA 3M3PA 1F48A 4N65A 1X1DA 3SEAA 3SJAA 1R6TA 3TK1A 3RODA 3TE7A 2CFCA 3HXTA 2J07A 4RIHA 3AT1A 4ECEA 4E2YA 1VQ9Q 1G20B 5AIAA 5CD9A 5L23A 3MHPA 1Y98A 5FWBA 3ZE6A 3VR5H 4CFZA 3NOXA 2AEMA 2MIOA 4K8RB 4M0KA 2P9FA 4QJIA 1SOMA 2H5IA 3DDZX 2V03A 3OEHA 3K0FB 1RI4A 1DAMA 4FXPA 4C5GA 5EINA 1Z0UA 3EC1A 3KTOA 4EPRA 2ZAIA 2WKWA 3EGEA 4QGFA 2G09A 2RJFA 4DIFA 4DSOA 1GU7A 3PYMA 2COYA 3K9BA 1TUDA 1FYEA 3BE5A 4OOEA 1F8XA 2AQIA 5AKIA 4F2DA 1V1MA 3KXTA 4DCVA 3QXEB 5FRDA 4RMHA 3M3DA 1TQ6A 4OMFG 1DRKA 1U5CA 3ORHA 1K66A 4B09A 4KXFB 4EITA 5H16A 3DWIA 1S2GA 3STXA 2PMDA 1PJRA 3DFMA 3GO4A 1G5HA 4KRGA 4KQKA 2XUHA 4RANA 2OZEA 5KOJB 1X7WB 4U6SA 3PGMA 5AI0A 1VMKA 1M7GA 4FEEA 1VPVA 2IYRA 5CA1A 1O08A 4S1VA 2B35A 2WZCA 4DA4A 3IAM1 1T1JA 3V34A 4EWLA 1FTNA 1YZGA 1JBQA 4ZZ3A 1QMGA 2XUIA 4C9BA 1AIPA 2YFQA 4QBGB 3CT6A 7GPBA 3B36A 1VECA 3SOPA 4QREA 2JM9A 1PN3A 3L6UA 1NW3A 2EEZA 3RBVA 1L4BA 2VV5A 2QU7A 1Y7TA 1U2GA 2AUNA 4BHTA 4R0NA 2W2LA 4B5KA 4HBZA 4HF7A 3ROMA 4P7FA 2WYOA 4Y98A 4K3UA 3OKFA 4QARA 1UFKA 1BCSA 4G9EA 4ZQIA 5F9HA 3ABQB 1RACB 1LZLA 1NJ2A 4R1UA 2MINA 1WCXA 2MU1A 2BM1A 1TCVA 3DMYA 4ZYXA 1QVPA 1Z6GA 1QJ4A 5AM1A 6ABPA 2Q4DA 3EPHA 2FRDC 2L42A 1JHOA 4A92A 2DXIA 3SHQA 1BS1A 5CCAA 3P52A 2AFRA 4GXTA 4RTQA 1MAWA 1WPRA 2AA3A 3MLBA 4O0LA 2GLTA 3IMCA 5FBVB 3V4RA 5FFFA 5BOVA 5CFMA 2X42A 2YXDA 4I4CA 4UUAA 2F2TA 3UWOA 1G16A 1V45E 1OIXA 3VNVA 3SBDA 4P3PA 4M7AD 4ZOLB 5ERGB 4PFZA 2G07A 3WIEA 1T8UA