3TVTA

Structural basis for discs large interaction with pins
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
282
structure length
255
Chain Sequence
SLYVRALFDYDPGLPFKHGDILHVTNASDDEWWQARRVLGIVPSKRRWERKMRAVLSYEAVQRLSINYTRPVIILGPLKDRINDDLISEYPDKFGSCVPHTTRPKREYEVDGRDYHFVSSREQMERDIQNHLFIEAGQYNDNLYGTSVASVREVAEKGKHCILDVSGNAIKRLQVAQLYPVAVFIKPKSVDSVMEMNRRMTEEQAKKTYERAIKMEQEFGEYFTGVVQGDTIEEIYSKVKSMIWSQSGPTIWVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Antitumor protein/protein binding
molecule keywords Disks large 1 tumor suppressor protein
publication title Structural basis for Discs Large interaction with Pins
rcsb
source organism Drosophila melanogaster
total genus 78
structure length 255
sequence length 282
ec nomenclature
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3tvtA01
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 3tvtA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3tvtA02
4N3NA 4F4JA 1ELOA 3I35A 2VP6A 3B1WA 4RD6A 4V0OA 2J05A 1MABA 3D7MA 2WIBA 1CJMA 2KRNA 5EE3A 2HEQA 2JLYA 4DCNA 4MUAA 2ZSAA 4BFWA 1Q0UA 4M9XA 4ASUA 1KHTA 2HV8A 4ZO4A 3OZXA 3W6NA 3AM1A 1E2FA 2A5DA 4OKSA 1X6GA 1JJ7A 3M1IA 1ARKA 4TSFA 4GSYA 4NP6A 4LBYA 4FN5A 5B2ZA 1G5RA 3LO5A 4PO8A 4LK2A 1AN0A 3U7EB 3KB2A 2DYBA 1M3BA 1NEGA 2Q3HA 3PUXA 4Q4JB 2P6RA 1XMSA 1W1FA 2P4RA 1COWA 1SXJC 1UADA 4OL0A 2O8EA 4W9MC 1MH1A 3B6EA 3FPAA 4Z8YA 2QT1A 3UMSA 2GEVA 4A0HA 4A36A 3ADCA 4D80A 2OHFA 3OFND 1KI4A 2WWXA 2Q3MA 5HKKA 2W00A 4C0BA 5F9FA 3DKPA 4JJBA 3C5HA 1F6BA 2GK6A 4R71A 5EC7A 2F7SA 4TZ6A 3HPRA 1G19A 5DHAA 4MA4A 5F3WB 1IN8A 2X2EA 4A2QA 1KIMA 1XD8A 2QQEA 3L0OA 1Q44A 2ZYUX 3EZ6A 4DUGD 2VP4A 4KJZA 3E70C 4M1SA 2N1BA 1H8ED 4HAWA 2QMUA 3SFVA 2XNDD 1G17A 2CNWA 4Q9KA 3WBJA 3PUZA 4TYWA 2GJSA 3B60A 3CRMA 4GOJA 5CB8A 4DBLC 1SVSA 1II8B 3WHLA 4LUCA 1UFQA 1IO6A 1Q1QA 4V0MA 1VECA 2FX3A 4AFZC 1XBTA 3RSOA 2F3TA 3RS2A 3LY5A 1JR6A 1TQ6A 3W5JA 4KBFA 4TLDA 3IHWA 1OPXA 1M7HA 1M6NA 2L0XA 2IC5A 2ZJ8A 3L0SA 1EG7A 4B74A 2PL3A 3CR8A 2FPEA 4MKHA 1ZUHA 1OIWA 1Z47A 2AKLA 2VO1A 3RBBB 4KVAA 4BLOA 1OXUA 1GNRA 1QKXA 2ONKA 1YVDA 4LSGA 2DFKB 3QF7A 2QTHA 1E2IA 4ZNXA 2BWJA 4NCNA 2J0UA 3AF3A 4TMZA 2AX4A 2NO7A 3NHNA 1XXHA 4DCVA 4KAXA 5FW9A 1MV0B 4OI0A 2BJWA 2W2XA 3A1UA 3DEFA 1KKLA 2OFWA 4AY2A 4RY2A 1VHLA 3U44A 2JLZA 4L8GA 4QBIA 4N0DA 2HJVA 4P4SB 2DFLA 5CIWA 5CM9C 2RGGA 3REBB 2YOFA 2PTKA 3C15C 3R9IA 3GLGE 2EBPA 3IQXA 4PPFA 2LKCA 2J7PA 3O8DA 1QWEA 3HR8A 1NBMA 4O2RA 4ABYA 3SQWA 2FSFA 2QBYA 1YNZA 2EYQA 4XSGA 2E1RA 1LS1A 3DM5A 4Q4HA 1K5GA 5JSZA 3SN6A 4QC2A 1G18A 1G64A 2VA8A 4FCTA 4RZ2A 5FI0B 4BFZA 4GMXA 2GRJA 1XTJA 1YR8A 2ZRAA 5AK0A 4TYNA 2HDAA 1ZUYA 2NZJA 4IHQA 2GXUA 2IXGA 3CPHA 1QHSA 4LHXA 3U6KA 3AP1A 4TYQA 5AJVB 1LTQA 1TF5A 2I1QA 2ODBA 3P26A 1J8YF 1HTWA 2YC2C 1NKTA 4A2WA 1R0YA 4M1YA 3OEEA 4PAMA 2BBWA 1HT2E 2D1XA 2QDLA 4DSUA 4HATA 2ZE7A 4RSGA 2HUPA 2OAQ1 2M0YA 2ZJOA 3BBPA 2VIIA 2WWFA 2HSPA 5J4YA 1G291 4ARZB 4LJ7A 5BN5A 4EFMA 1E0AA 2F43A 3GFTA 2GILA 2RQTA 1FX0A 1X86B 4GMDA 5FTJA 5TV2A 1GVNB 1GM5A 2I0NA 1XRJA 2GDJA 3KQUA 3BB3A 4URZR 2ZRCA 4J0QA 3ZGXA 4D4LA 1GRRA 1KDTA 4G3XA 1TUEA 2DPXA 4LHWA 1SHZA 1F3OA 3B1VA 1QRAA 1SXJB 4AG6A 1Q22A 1VYVA 4L9SA 2WMNB 1DG1G 2R44A 1ZUUA 4PPGA 2JLUA 2RGNA 3OF5A 2DX1A 1WA5A 4AIIA 1T3HA 2ZRNA 5IH2A 1NVWQ 1T0HA 2A37A 4LYHA 1MO6A 3H0KA 1MRNA 3U3JA 2IYUA 2FFQA 2VVKA 3C16C 4Q01A 1HE8B 1XB2A 4D6PA 3LBHA 4RFVA 1OSNA 4P31A 2NWMA 2ZE8A 3GJ5A 4V02A 5JS8A 1JXOA 2DRKA 1TF7A 2IEYA 5HE8A 1SHFA 4NKRA 3UANA 3CX8A 2J1LA 3LXRA 3A8TA 4YMVA 4JLPA 4BLRA 1D6JA 2DILA 4OBEA 2KYBA 3SHWA 4DLRA 2VF7A 4ZI2A 4K11A 2XOKD 1ZM3A 1QHNA 4TL7A 2ATVA 3BH0A 1AM4D 2I1VB 2QA5A 5P21A 4OI1A 2BVNA 5JHGB 4MGKR 3K70D 3SFZA 4FW9A 5AUOB 1NN0A 1CULC 2ZJAA 1E9RA 4HAYA 3T1QA 4ZDKA 1OE0A 2EGEA 3V9PA 2BC9A 3ASZA 4OQLA 1WRBA 1F5NA 3QVVA 4JIMA 5FBQB 5L23A 5JS7A 5KYKA 4CC4B 2L3SA 1FP7A 1Z9ZA 1IXSB 1YN8A 1N6OA 4NYMQ 4KU4A 1W4CA 4DDWA 3TK1A 1OXTA 1PUIA 2O8CB 2BMDA 1JQLB 4FSSA 5KNBA 1VCOA 3SHFA 1CRQA 1FQKA 3ADKA 3NMZC 1Z6GA 1DE0A 1EK0A 1VIAA 1XJCA 2HLDD 2OG2A 3ZS9A 1KI1A 2AK3A 1OJLA 3M0PA 1UBCA 1BMFA 1G8FA 2QGZA 4OHVA 2GJ9A 1XX6A 2C8VA 4ZPXA 4EQ6B 2H5EA 2IF0A 521PA 1E9DA 1HEIA 5JWHA 3I92A 3TBKA 3BFKA 2GF9A 4Q9LA 2X2FA 2GETA 2DA9A 4MITA 4NHOA 4QNRA 1W5SA 2RMKA 1HUQA 3IIJA 3IO3A 2J06A 3QPUA 1J2JA 1ZYUA 4QBFA 2A9KA 1TL7C 3VNUA 1P9WA 1RJ9A 1X69A 1E2DA 4IDNA 4AFUC 4KBGA 4BFUA 2CMKA 4MYHA 1R10A 5EE5B 4E09A 2RAPA 4B44A 4FCWA 1I07A 2GCOB 3WNDA 2K7AA 3VS5A 2KGTA 1E79A 1U90A 2VTKA 3B1ZA 4BFTA 3EA0A 3VRZA 3LA6A 2X1VA 2B86A 3CRQA 3U4QA 2EGCA 1FMLA 3CB4A 2CLCX 2LX7A 2G77B 4JL5A 2NTYC 3ZQJA 3T1TA 4LJAA 3MFYA 4JZ4A 3S1AA 4CF7A 5LDDC 4NCHA 4B33A 2G0NA 4KSCA 3U5ZB 1G7CA 4LRWA 1K9AA 2IYRA 2ECKA 2F1RA 4UNNA 3BB1A 1HYQA 4B32A 3GLFA 2LJ3A 1NY5A 4R9UC 1IOZA 1S1NA 3AF1A 4YMWA 1EFRA 1X2QA 3BC1A 4M0LA 4POAA 1VPLA 1D5CA 1LFDB 4QT7A 4M9ZA 5FOWA 3AF4A 2CREA 2WJJA 4J9CA 5KTYA 4M4SA 1KI9A 3Q3JB 5AWFC 4MH0R 2WAYA 2QI9C 1NRJB 2XNSA 3QKRA 3RC8A 1FUUA 1J3TA 2Z4RA 4US2R 3LQRA 1Q1EA 2DVJA 4DEXA 2O88A 1NN3A 2G1KA 3PEUA 5DH9A 4NPHA 2QM8A 1W1WA 3BFVA 1DOAA 4URUR 3TJZA 1WXQA 3QKSA 1E1QA 3G0HA 2DL3A 4I99A 4DJTA 3AVPA 1GUAA 1Z2AA 3H0FA 3H0HA 1LF5A 3KJHA 4MKIA 1KJZA 2J9RA 1W0KA 4D81A 1M74A 1S3GA 2W2TA 1W5TA 2G88A 1JR3E 2JJ2D 4U7DA 1ZRHA 3RC3A 1ZAKA 1W4AA 5ANRB 5FPSA 2AN9A 1GWNA 3BAFA 3PUWA 3IPXA 4RFSA 1UJ2A 4TLAA 3HWSA 1PZNA 5FOVA 4BFYA 4XVUA 3RS0A 2GXSA 3LQQA 1RLPC 2SEMA 1FTNA 3QXXA 4EJSA 3R6NA 1XJQA 3K0CC 3L8ZA 4PC2A 2ZSFA 4D4JA 5G3YA 5DI9A 4FCVA 4R2HA 1GNPA 2NIPA 1DAIA 1R4AA 2YKGA 3LAWA 1XTIA 4OK5A 2NGRA 1NKSA 3AV0B 4PZLA 3MD0A 4GL2A 1J8MF 2E5KA 2OJ2A 3FJ5A 4MRVA 2CVHA 1FNMA 2EGAA 3LXXA 2WJHA 1YR7A 4IXNA 4JKIA 5LB2A 1CEEA 3PXGA 1AZTA 1H8HA 3THOA 3BIFA 2XXAB 2OLKA 1EXMA 5G3ZA 3M0QA 3CF2A 4HUTA 4RTWA 4BZPA 4DC9A 1ETUA 2Q9CA 3F0TA 2IYVA 2XAUA 2ZJYA 4E22A 3VS6A 1VTKA 1KI3A 2H16A 4YC7A 1F2TA 2HCJB 3VS1A 4RCYA 4OHXA 1ZD9A 2DL7A 4JLJA 4DIDA 2O8BA 4HVVA 2KYMA 1N25A 3I8SA 3I73A 2VP5A 5H70A 3LW8A 5LBIA 1R6BX 3DKVA 2ZXUA 3EZFA 4URVR 1OH5A 1U0HC 3HP1A 4JJKA 4IVPA 4A6PA 4MRRA 3DZDA 4UXHA 2YUQA 2WM9B 4Y0VA 3WP0A 4LYJA 3B82A 3D8BA 1WE2A 1L8QA 4RZXA 1E9BA 4K8OA 5J4LA 3TSOA 4CEIA 2RNAA 3UATA 3NWJA 1QBKC 3PVLA 4J9FA 1VG9B 3X1YA 4AI6A 3G82C 3GEIA 1E9SA 2GGRA 2LMJA 1IAQA 2FFHA 3CM0A 1PRLC 2CL0X 2CUDA 4V03A 5FL3A 2IS2A 1W36C 1UHCA 3JVVA 2SRCA 2JJ8A 3SYKA 2L2PA 2A5GA 3Q9LA 5FR2A 1X27A 3THYB 4Q21A 2F3RA 1W2HA 2PZ1A 1RYFA 4HEJA 1CF4A 1Z6AA 2GF0A 1WXTA 1HJDA 3BGWA 4X8OA 3F5FA 1F48A 3T34A 3CUEF 3QXCA 3VU9A 4E07A 4KFRA 1CKAA 1E2KA 3W3ZB 1RIFA 1XEFA 3ZDQA 1XEWX 4MRSA 2WBLC 2VHCA 3HR7A 1D2EA 4BWYA 3Q5EA 2JM8A 2EYUA 4Q4LA 1D8TA 4P32A 1NLOC 1N6PA 5EZ6B 3RRNA 4IFEA 4KI0A 5DISB 5FI1B 2NO0A 3OAAD 5G40A 2EYYA 1GL9B 1PRMC 2VHJA 4DIEA 3I62A 3IUYA 1AWXA 2JAQA 3ZJYA 4C0AC 3KQHA 3GLHE 2J7KA 2ORVA 1V1CA 2F1JA 1DAMA 3GJ7A 3TLXA 4AURA 4LC0A 4DCTA 1US8A 3FKSA 4HDOB 4M8NE 5J4KA 4FWTA 2FE4A 2EQIA 4II7A 5E7MA 1H8HD 1FQJA 1T6NA 3B2EA 1PNJA 2C0IA 1E0JA 4WBSA 5J47A 1HY3A 5JJLA 2RPNA 1KO8A 1WX6A 2XMFA 2QZ4A 4KV9A 2QU8A 3MGCA 3FGNA 4B43A 4IEIA 3U44B 1KK0A 5KDLA 4LI0A 5SZJA 1SVKA 4TTPA 4JVSB 4QHYA 1E2NA 1QVRA 3CLVA 3GLGA 3CH5A 1EFUA 3OESA 4UNRA 2J0SA 1QHXA 3VR4A 2GBQA 2Z43A 3DL0A 3OIYA 2QAGA 1GKUB 1SVWA 2OAWA 1A0NB 2ZRGA 4MDFA 5GADl 3N2IA 3TUIC 5K8TA 2WWGA 4LJ4A 3DDCA 3OIUA 5TB5A 5E3HA 1UE9A 2RQWA 3R7WA 5KU1A 3E2IA 1NLYA 1OH7A 3CNLA 2GAAA 3RANA 1RRPA 2G1JA 2D2FA 5H1YA 4F4CA 4IEEA 1BH2A 1G3MA 1ZMXA 1BYUA 4NL4H 4LE9A 4B6EA 3CRVA 2J6FA 1K76A 1QHYA 2F2WA 1OFUX 4R2IA 4A6XA 1SKYB 2G83A 5TVKA 5FUWA 4WZBE 2ZRMA 3TVDA 1VYTA 1G9XA 5D3MB 3U7HB 1NG9A 1FOEB 5IXFA 4LZZA 5CYOA 3U3MA 1KKMA 4KFSA 3THWB 4A63B 1P2VA 2OFOA 2Q6TA 1R2QA 3QVUA 4MRPA 1ZC4A 3UMRA 4A0FA 4DSOA 2SHKA 3NBZC 1YZUA 4A4DA 2CLSA 1N3BA 4D8DA 2G3YA 4Q7MB 2JLRA 4PHTA 5BN4A 1W0JA 1E6CA 2IYLD 4G5OA 4QHTA 3TW4A 1XJ0A 2C04A 2BMFA 4TQ9A 3BERA 2ZM5A 1VMAA 4WZ6A 3QF4A 3VS3A 3O47A 4GOKA 2FSHA 4HCKA 3EASA 3GJXC 2FH5B 1G8GA 5EP2A 4F17A 1KK2A 2RH5A 4B3GA 2VWFA 1G7SA 5CK5A 3VR5A 3WMGA 1M8MA 4BEJA 1Q12A 1G5TA 4QM7A 2ZRFA 3FKSD 2IXFA 3KZ1E 5SZHB 4DLUA 5L3VA 1T3LA 4XWAA 5AR1A 1W36B 1X1SA 1ZUNB 2F9MA 4B2LA 3I5SA 2FN4A 3PR1A 4IVQA 2OEPA 1ZX6A 1C4OA 2CL7X 2BHRA 1AGRA 2Q0HA 2EYZA 1G3UA 2FPKA 3AKEA 1L4UA 2PLFA 3LD9A 5A0FA 1OKKA 1MO5A 1PLKA 2DE0X 1GL7A 1XF9A 2DHRA 1Z0FA 3AB3A 4EKDA 4BECA 4TMTA 1MT0A 1RZ3A 1M27C 1EGAA 2C95A 1P6XA 2CJWB 3O8CA 3DMDA 1MR3F 1KZGB 1OYYA 1GSIA 3SE0A 3CX6A 4B2IA 1SXJD 2V6JA 2ZI6A 1ZM4A 2JS2A 5IT5A 2Z83A 2HCKA 1N6NA 3ICQB 2QPAA 2ANCA 4Q02A 1HQCA 3TUZC 3NPFA 1T5LA 3VS4A 1OIVA 2ONJA 4DLWA 2KROA 4H1UA 3O5ZA 3TQFA 2IXEA 2FPDA 1SGWA 4OYHA 4YMSA 4TQAA 3ZZ0A 2ASEA 1E7OA 2N46A 1WCV1 2FEOA 2VHUA 3DVLA 3PIRA 2OESA 2OUKA 3OFNA 4M53A 1UKYA 1QVAA 4R98A 2BMEA 1TQ4A 1U9IC 1UDXA 3BWDD 4NTZA 3G5UA 1KDOA 1G6HA 4Q00A 4YMTA 2IYTA 4C7OB 1NMXA 1RJ9B 3TR0A 1OXSC 4LV8B 1LB1B 2QSZA 2D8HA 4Q1DA 3ZIAD 4DUGA 3CZPA 3BK7A 3PG5A 1XEXA 1IXRC 5EP1A 1H8KA 1H8EA 4D0LB 1BOFA 1G21E 2XNDA 4EUNA 4IW3B 2DBYA 3H84A 4GI7A 1DTSA 2BKEA 3QKTA 4LYFA 5KNCA 4I1SA 4BEBA 1UKZA 2JLQA 5KSYA 1Y3AA 2LCSA 1G7RA 721PA 1WBDA 2D4HA 5UKDA 1T91A 1UGVA 3WRXC 3SU8A 3IEVA 2QT0A 1HD3A 4UJ3A 4OQXA 3GEHA 2BM1A 5I22A 2RMOA 2ZS7A 4A0GA 1DARA 1K1ZA 1Q3HA 1G8YA 3REAB 2QP9X 1MRSA 4JJCA 4B2PA 3K8YA 4Q48A 1X3SA 2GEDA 1U06A 4P0TA 1FW6A 1ABOA 1CKBA 5HPYB 3TR5A 2PMDA 1UM8A 2YUOA 3P4YA 1OB2A 3ICEA 1EFHA 1U81A 3B9PA 1S8FA 2ZREA 3Q7PA 2K6DA 5AJYA 3KJGA 3Q8XB 2YV5A 3IILA 1I0CA 4LBVA 3BH6A 2ZRIA 3QEJA 1VIYA 2C0TA 3BE4A 5GJWB 4KLNA 2P65A 4MKFA 3KXIA 4I1VA 4CEHB 1G3RA 2EPDA 4RKFA 2IWRA 2PLRA 4XVQA 3QPWA 1TUDA 1KDPA 3X1WA 5JHHB 2XITA 4BRUA 1ZU4A 4D0NA 3EPLA 2AK2A 1YZNA 1D9XA 1X8LA 3T1VA 3W8NA 2REOA 2QPTA 1JQJC 1GBRA 4Q03A 4EPRA 4QBGB 4LYAA 3M0UA 5TXGA 4HXJA 4JYBA 3LLMA 2IBMA 2JJ1D 3QJYA 4IRUB 3AVQA 1G7TA 1ZC3A 4IDOA 2JA1A 3SS8A 2KNBB 1KFZA 1AA9A 4ESVA 3BXZA 4KITB 3L2OB 3ZVLA 2ZI9A 5H8WA 1IJEA 2PZFA 4LY6A 3ONWA 5HTKA 4D82A 2QUZA 2J41A 1R7RA 2Q3FA 2H18A 1R0ZA 1S3SA 2FZ4A 3KXLA 4L15A 5FPHA 2CUBA 4PQFA 2C99A 1EFCA 1P2UA 5FTNA 3AQ4A 1R8SA 1XTSA 3BORA 4NONA 1UEJA 1AS3A 2GESA 1P62B 1NSFA 4ESRA 1K5DA 3I9QA 2V9PA 2RGBA 3KDSE 2FRYA 4OQNA 4GDFA 1JAHA 3K09A 1F2TB 2RGXA 3ZD7A 5EXPA 5L3SB 3VMFA 2GHIA 3Q7QA 3QG5A 4NE2A 1GRIA 2DMOA 1DAGA 1KSFX 2FOLA 1G2BA 3Q85A 4GBMA 1RFLA 2WIAA 3SEMA 1VDZA 2PEYA 3B8HA 1QDEA 4HB3A 4PC1A 3MMPA 4OI4A 3F8TA 2KT8A 4O2LA 2O0KA 4FIDA 2ZAOA 4BLSA 4X8LA 3C4JA 1CR1A 1T8UA 1U8AA 2GZHA 3ADDA 1X2KA 2BZXA 4PC7A 4O0MA 2DL4A 1ZINA 2XOKA 2VP2A 2QSYA 5G41A 3NEJA 2JLSA 5I11A 2ZYWX 3SJAA 5TARA 3I8XA 1KO5A 1S9HA 4DLXA 1XD2B 1WP9A 1UHFA 4LC1A 1V5WA 3GQBA 2X77A 1GL6A 1XMIA 3AVVA 3EIEA 2YWFA 2QY9A 1JPJA 1SXJE 1OEBA 4XTRA 4LJ8A 4PAQA 2G9NA 5IHIA 1JR3D 4EPYA 2C78A 3KKMA 4M9QA 1OB5A 3VU9B 5J4VA 5AJXA 1NNEA 3NXSA 2YJTD 3MWLA 4V0NA 5KDDA 1Z08A 3IDQA 1KO7A 3VAAA 1KSWA 5JJIA 2RB4A 4XWKA 3EG0A 2GKSA 1HH4A 1YZQA 3C7KA 1IY0A 2YZ2A 4NH0A 2DWPA 3X1DA 4B47A 3M0RA 2HLDA 2V8OA 4EPVA 3KQNA 1KI6A 2ZYVX 4LPKA 3EX7C 1DAKA 1OV4A 1CJKC 2PH1A 5FWCA 2YWHA 3WMFA 2GBLA 4BFSA 2R6CA 1UUEA 1JPNA 1WLPB 3H1TA 2WWWA 2WOJA 3VRYA 1P7CA 2A5JA 3GLHA 4Q1AA 5FPTA 4Q7KA 4Q4AB 1AS2A 2V6IA 2FGKA 3EARA 4HUQA 4B3XA 4YXWD 2O8FB 2FF7A 2BKUA 3EPJA 1WDTA 1G4UR 1US8B 2VP9A 1ZW6A 2RGAA 2WPDD 4OK3A 1KMHA 5J5CA 4DKXA 1TNDA 1JEGA 3T5GA 3EGUA 2VBCA 4WAUA 2DFNA 2GCNA 2EYXA 4JL8A 1TEXA 1QG4A 2GNCA 3MJHA 4QGFA 4RD3A 5GJBA 5A5GA 1Z0KA 2IYZA 3IO5A 4JPBW 1N5IA 5H68A 4AYWA 3U7GA 1WXBA 3JZAA 3EW9A 2EWWA 4HZUA 2NUZA 3MSXA 1T0JA 3NHAA 4PSVA 5K8IA 1RPZA 4HLQB 3REFA 5K8UA 1ODFA 3GPLA 2O8DB 4I1UA 4X8HA 1XMVA 1IN6A 3D3QA 4P3YA 4PZYA 1KMQA 1NIJA 1E0KA 4A2PA 2A5FA 3SYLA 4QJ3A 4MGIR 1M30A 4KYIB 2BJVA 1FUKA 3R7WB 4URWR 1Z6XA 2ZRHA 3VKWA 2A08A 2R2AA 4Q1BA 4ZV4A 1X6BA 3EWSA 3PQCA 2XSZD 4D0GA 3I5XA 1QWFA 1H65A 1U99A 3HYTA 2JW4A 1GITA 4WXPA 2WICA 4I4LA 5C46F 1RC8A 3EHRA 1JEEA 2D3WA 5L3QA 4B3DA 2KR3A 2CH4A 1XFAA 2WWIA 5FTLA 1RUWA 4W7SA 4Q9JA 4A92A 1CSKA 2EKHA 1E0SA 3WP1B 2FPLA 2UKDA 3I3SR 4Q7JB 1M2OB 4LOAA 2HYIC 1MKYA 1ZIOA 2PBRA 1OXVA 2C9CA 4HB4A 1A5TA 2EQBA 2GTOA 4IOLA 1E2QA 3GP8A 1U0JA 2YWEA 3BJIC 1NG1A 1W70A 3JZMA 1E99A 4JBXA 1Z07A 2ZE6A 3AH8A 3TE6A 4DSNA 2N42A 3NH9A 3QPVA 1VKJA 3KKPA 3NC1C 2YUNA 5E7IA 3TAHA 4B48A 4HAVA 2VEDA 4ZIRB 2GA8A 2O0JA 3QWYA 3CH4B 3EZ2A 1BU1A 3AKDA 4KYUA 4X1VA 1D9ZA 4E03A 2JJ2A 3TMKA 2I3BA 3Q72A 4MUBA 2MSEB 4D4KA 4DLYA 5JECA 2F2XA 1NN1A 2ODWA 4BRWA 1DAFA 3PVQA 1KOFA 4Z8AA 1XWIA 4R7ZA 3EZ9A 2ZI5A 2CT3A 1QHIA 4QNMA 3CPEA 3H2YA 2AK5A 3IHLA 4A8JA 4F7WA 2PX0A 4I1OA 1QHHB 3GLIE 5CYPA 1Z0DA 2IUUA 3BS4A 3OE7D 3IIKA 3QE0A 4EFLA 1F2UA 5CLLA 5J40A 3WY9A 2OCPA 2GJAA 1OHHD 3H0IA 3AUYA 1JECA 1CJVC 2C2HA 3K0FA 3QXJA 4F91B 4MYCA 4Z1MD 4AKEA 2HF9A 2QROA 3A1VA 4J9IA 2WKRA 1B07A 2J7IA 4M1WA 3WMEA 4TTRA 3QENA 1LS6A 1SVMA 2O0HA 1LW7A 2ABLA 1IHUA 3H4MA 1J90A 4E5UA 1GKYA 2B7CA 3ZZUA 1DS6A 2R8RA 3SDZA 1XP8A 4B71A 4KO8A 4TLBA 3BRWD 1OH6A 3I61A 3THXA 3K0AA 2K9GA 5FTMA 2NOAA 2O9SA 3EG1A 2OSBA 2QMEA 3MCAA 5B64A 4CEJA 3NVAA 2AL7A 1G41A 2A2ZA 4NU0A 1P60A 2C98A 1E2GA 3V00A 3GLIB 1A7JA 1BIFA 1S1CA 3PCRB 1DELA 3ECCA 3FHOA 2OO7A 3E1SA 2K79A 4LWZA 5CITA 5TMPA 4EFNA 5JLJA 3QOFA 1MV3A 1XEWY 4IOMA 1TPZA 2Z4SA 3U6BA 2GVZC 1N6HA 4QJ4A 1PLJA 1W36D 4Q66C 4MGZR 1GKIA 4QJ5A 4CZ2A 3PV0A 1OFIA 3TGPA 1JB1A 4J9BA 4CC7A 5IHKA 3CQTA 2M51A 1A2KC 4JVNA 5FOTA 1W2GA 4AG5A 1XU4A 1ABQA 3AKCA 4JLAA 4NYIR 2XZPA 3DPUA 5BQ5A 1NSTA 5KSPA 3W6PA 4DLTA 2A36A 1QZXA 1KZ7B 4EAQA 4QGGA 1JU5C 2XB2A 2FMXA 2CSQA 1QKWA 3UG7A 4ZKDA 5C4MA 4JKYA 4ACBA 1J7KA 1YR6A 3GFPA 4BFXA 4DT1B 2ZIAA 2ZUDA 3TKLA 1E1RD 2WSMA 3FKQA 4OJKA 5E95A 2ZRJA 2ZR9A 2FNAA 2AWNA 3EC2A 2NPIA 3W34A 4CRWB 1SVOA 4NCIA 4LX0A 4Z54A 2IS4A 4G5RA 4DVGA 1UPTA 2GNOA 2W83A 4PPQA 3DOEA 2BV3A 2O5VA 2XX3A 5JI3E 4LCBA 3TH5A 2IS6A 3SOPA 3OAAA 5FR1A 4Q4JA 3SJCA 2Y8EA 5C2JB 5CDFE 1XZQA 2IYXA 4EDHA 1P9RA 1GP2A 1ZP6A 5AUPB 2WWYA 3KTAB 2VF8A 3QKRB 4Q18A 2H8KA 2WKPA 2GQIA 2FU5C 4FWIB 3JV3A 2ANBA 1MABB 1FZQA 2FZLA 2ENMA 3NHBA 5FBRB 4DZZA 3GJ6A 4IVRA 3WYGA 5KUTA 4H1VA 4TWZA 1T9HA 4XOIA 1PHTA 3GJ8A 2QEQA 1GRQA 1NVVR 4MRNA 4U5XA 5GVRA 1KJWA 3OEHD 4W5WA 5LB4A 1LF0A 3MAAC 2HT1A 1KI8A 3RLFA 3MWYW 2FFBA 2QAJA 3T35A 4JJDA 4ITRC 2CHQA 2WTUA 1G1MA 1II8A 4PR0A 1R5OA 3TSZA 3ZS8A 4V0ME 3FVQA 1WB9A 2CCKA 2ZI3A 4LJ9A 2O8EB 1EFTA 1XCPA 3ADBA 2NG1A 2OCAA 2J0QA 2DFTA 2C9OA 5JJKA 1ZBDA 3B9QA 2RGNC 2G6FX 2VKNA 1YRBA 1FMJA 1BK2A 4CC3A 3HDTA 1CS4C 2QMOA 4HLUA 4B3FX 2X3XD 3AVXA 2J46A 3GFOA 4RZ3A 1KDRA 5DHFA 1KSHA 1P72A 1UFFA 4ZKEA 2V1XA 1SPKA 4C0LA 3EHQA 5IHNA 2C5LA 3QXHA 4ON9A 3VX3A 1E96A 2MSCB 3RRZA 3EWAA 4C0KA 4F38A 4GP7A 4IDPA 1W49A 1YWPA 2Z5FA 4AFQC 1KAGA 1EFNA 3FTQA 4TMWA 1FP6A 2W2VA 4AKIA 1RLQC 2KE9A 1PVOA 2XJ9A 4P4SA 5FUYA 2CHGA 1SKQA 3IQLA 1Z3IX 3K0SA 3M4YA 3I32A 2VQSA 5CLQA 2YINC 4AK9A 4KLZA 2CK3D 4OQFA 1TADA 3TUJC 3X2SA 1D2MA 2DY1A 2ZEJA 3UWKA 3NDPA 4DB4A 4AKHA 1WFWA 2ZR0A 1W48A 5DI3A 4IDQA 3ZVRA 1AWOA 4F4IA 4KFTA 1MUZA 1XCGB 2OAP1 2ECZA 3A37A 2J59A 2JXBA 2P6NA 5B30A 1C1YA 1UG1A 2XTNA 3FFBA 3PITA 4NMMA 3VKHA 1M7GA 2J0UB 4F16A 1E9FA 4D2IA 1XXHB 4JLDA 1M34E 2LCFA 1E9EA 1GFIA 1SKYE 2HJGA 5CM8B 3U23A 2CE7A 3FMPB 4KSBA 4CVNA 3I72A 2GXQA 3GCGA 2YT6A 4ARZA 5FPKA 1Z28A 2W6JD 4TYYA 2WSSA 3FOZA 1E4VA 4A8JC 4HI0E 3IKJA 1ZM2A 2QQ0A 1HA3A 2QBYB 3ZH9B 1P73A 3SC3A 2EFEB 4L9WA 4Q4HB 5JSZB 1I4DD 1S1MA 4LHVA 5KSZA 5AUNB 4LHZA 1GTVA 1RW4A 4TMXA 3U2QA 1II9A 1N6IA 3VFDA 3RWMB 1M3AA 3W9YA 1SXJA 3FWYA 3SJBA 2IUTA 2RQVA 4LPSA 2AZVA 1ESNA 2R9VA 3CF0A 2WAXA 1OFHA 2CH4W 2LJ0A 3EG3A 1DO2A 1JEDA 2BDTA 3DZ8A 1G8PA 2GZDA 1WA7A 1NG2A 2V1RA 1AKYA 5JBQA 3PEYA 4NBSA 3V4RA 3AEZA 2PT5A 1K4US 2V54A 1JALA 1U2RA 2HXSA 2W0SA 1NM7A 4UXJA 2KXCA 3C14C 1IXZA 1FL9A 1T5IA 3AF2A 2F43B 4PSKA 2OILA 5IXBA 1A2BA 4WVFA 4GNKA 1FX0B 1MO3A 4V0LA 1I1JA 4TL8A 4JVMA 4C2UA 1QLYA 2HDNB 1B23P 4RTUA 1ZSGA 1BKDR 1WF3A 2NQ2C 1NLPC 1SRLA 1KMHB 2QM7A 3ND9A 2GZAA 2J5XA 4FMCB 5F2EA 2RQUA 1TEVA 5DN6D 1GG2A 4M1OA 1AQYA 3PEWA 1ESMA 4Q5IA 5FL7D 2BZ8A 4US1R 3QG1A 2LP5A 3ZIAA 2WHXA 3ZZTA 1CLUA 2IEZA 3C0CA 1KNQA 3VX4A 4ZDIA 4QGHA 1GBQA 1ZNYA 4FINA 1AK2A 2DYKA 1X1RA 1BYIA 2L0AA 2P3SA 3UWOA 4JLOA 4QBHA 2VSOA 5SZIA 5BXQC 1T0HB 4B3CA 4X8MA 2D7DA 3P20A 4BZXA 2O8CA 5GJWC 4HB2A 2OBMA 2VP0A 4FMCF 1XOVA 2FG0A 2ZJZA 5EXTA 1NI3A 1ZIPA 5FFMA 2ZTSA 1Z9QA 1GZSA 1N6KA 5EP4A 4G5QA 2RQRA 3M6AA 3A58B 3RSLA 2IHBA 2OCBA 4EQ6A 3BH7A 3CZQA 4AD8A 1XMJA 4F92B 3U7FB 1G3IA 1K6MA 4IJMA 1XPUA 2OXRA 1B3QA 1WIEA 2WSSD 4JZKA 5EZ5A 3KKQA 4UNQA 5L3QB 4HDQB 2ZPTX 3IGFA 5JWRA 1S2MA 3AVYA 5FTKA 2LZ6B 2Q21A 4EJSC 1CXZA 3CIOA 3MJRA 3MRSA 3CX7A 4BUJA 4GT1A 3EPKA 2CSIA 2Z6VA 3KKNA 1Y57A 3EPHA 4Z8XA 4OMNA 4CC2A 3ASYA 4OHZA 2KWIA 3JVUA 2GCOA 3VTKA 4PX9A 1Z06A 3FMFA 2CL6X 4DB2A 4J9HA 3AGPA 2BIFA 2FA9A 4Q1EA 3NBXX 3K1JA 2HXYA 3FDIA 2VLIA 1VG1A 4KFUA 4D26A 1MOZA 2D0NA 3KFVA 1YZLA 2JASA 2CDNA 2EVWX 1U3OA 3HU2A 1E98A 3KJEA 2FFAA 2R65A 2E9SA 2FRWA 4RJLA 4JS0A 3AVWA 3O8BA 3ZVMA 4JT4A 3UPUA 3RS7A 4Y92A 3PUYA 3NDBB 1ZCAA 1TAGA 1ZCBA 3QBVA 2YOHA 1N5JA 4OMOA 2JJ1A 3LNCA 2J45A 1R8QA 2QL6A 3B78A 1UKEA 4A8JB 5IHPA 4JJZA 3U3KA 3B1YA 2F2VA 1G4AE 2F55A 3RDPA 4EPWA 1YJ5A 4PQYA 4J9DA 2JLVA 4WXRA 2CCGA 1N0VC 5FUXA 5TDHA 1OFTA 4PQRA 3CONA 1G20E 3QSYA 3SQXA 2EW3A 3SZRA 3NBYC 1XDBA 3VS0A 3K0FB 3B7GA 2QORA 4RTYA 5K8LA 3NIBA 1ZD8A 2REXB 2AFHE 3R20A 3M0TA 1OIXA 3PE0A 1UF9A 4UKDA 4GOXA 1TUCA 1XTKA 3QEOA 4HLCA 3U4QB 1Z2CA 2YUPA 1VCMA 2ZE5A 4PHGA 2ZRLA 5B57C 3RS3A 2DRMA 2GEUA 2KE5A 4FI3C 3FB4A 2HBWA 2VSFA 3S1AB 5IRCD 2FWRA 1YZTA 3W8RA 2X3WD 2CEAA 3GLFB 3T15A 2ED0A 1AIPA 2JCSA 4M22A 3ZL7C 4OMPA 2HT6A 3GJ4A 1NYGA 2GVDC 4Y0AA 1CU1A 6Q21A 1UEIA 5C1BA 5IF9A 2IIMA 4B73A 2YOGA 4HDCA 1T8TA 2QE7D 4KRTA 3AGQA 1DG3A 1II0A 2B92A 1CBUA 4Q7LA 1LVGA 2FPFA 1NJFA 1HQYE 2CCJA 3UKDA 2WKQA 4LJ6A 1GAJA 4N1AA 3W90A 4IIOA 3TIFA 5BW8A 4HAUA 2VSXA 5KOYA 1GFCA 4HVUA 1WXUA 2AD5A 2ZJ5A 1W7AA 1NYFA 2FO0A 1XNJA 1KI7A 3WNBA 5KPJA 4C2TA 3SJZA 3A36A 5DYGA 1X8JA 3QKSB 3UXMA 3LH5A 4ZDJA 1AWJA 1ZVQA 2W6ID 2LNHB 1CKEA 2W0MA 1E3MA 1IQPA 2LWIA 4TL9A 2XXAA 1K0XA 3KJIA 1S0UA 2A7QA 3DMNA 4Q19A 1JR3A 3LLUA 1GCQA 3L82B 1LV7A 1ZM7A 2V7QD 3EAQA 1M3CA 4D4MA 1E9CA 2QTVB 4RFSB 3IQWA 5L8VA 2ERXA 4TLEA 2JM9A 1XPRA 3TSWA 2OI3A 2OV2A 2ZU0C 3TVTA 1KO1A 2ZSDA 1SHGA 2X19A 3PEVA 4ZCMA 4EJSB 2XTMA 4C0HA 1SVLA 1Z83A 2QAGC 3N2EA 1NL3A 4JLBA 2QN6A 3M0EA 5AJWA 2NPFA 4WA7A 4DHEA 1ZLMA 4WOPA 1NMYA 2BTTA 3P4XA 3SNHA 2O52A 4DWJA 1FMKA 2ZVQX 3RRYA 5FBLB 4QRHA 5CDFA 2K2MA 3CF6R 5DSZA 2IT1A 1AZSC 1Z0IA 2A78A 2MSDB 3DHWC 3PUVA 1Z5ZA 4YXWA 3RYTC 1Q1ZA 5BWMA 1JJVA 1UDWA 3VR2A 1YZKA 4AYTA 4KODA 2AXPA 1AGPA 2WPDA 2IYWA 1N6RA 3W5IA 2Q9AA 1HSQA 2IYQA 4O3MA 3NEYA 2KRMA 1RRCA 2CLDX 5B58C 5JCPA 3RNJA 2FJUA 2MMCA 5EJEA 4HB0A 3O8RA 4ERNA 4NCJA 3EC1A 3C41J 3KQKA 1PV4A 1RE0A 5HCKA 1W6XA 1Y0MA 1BS1A 2KRSA 3AP3A 4PC3A 4AFSC 3THYA 2AKKA 4IIMA 2W10A 1IY2A 1TQDA 5FOSA 4UXIA 1SSHA 2C96A 1M7BA 4EPXA 4D25A 8OHMA 2O8BB 2ZVPX 4QL3A 1P75A 1FPMA 1HV8A 4PPNA 4OHYA 3EG5A 3IPYA 4CGZA 4C0QC 2H17A 3A1TA 1CIPA 2IYSA 3T1OA 3T5DA 1VA7A 4JVLA 1MO4A 3AVOA 4MYTA 2XSZA 5JEDA 2JIZD 4XD7D 5LPNA 1SVIA 4PFSA 3U3OA 5KPDA 3K9LA 4LDJA 5LD2C 4CEIB 3LW7A 2B21A 2H57A 2CT4A 5EXSA 3VR6A 2L3QA 4BPBA 1UDLA 3VR1A 4ZDWA 4MKGA 1PWTA 4MDEA 2PCJA 1HT1E 1GFDA 1YU9A 1U8YA 3A4MA 2LKDA 4DSTA 1OT3A 3CRRA 2PX3A 4B35A 3B85A 5DO9A 1RRGA 2RGCA 1ZM9A 1DAHA 4JL6A 2P5TB 1TMKA 1NVXQ 2RKOA 2KXDA 3CW2A 2XZOA 3LVQE 1YRAA 3NKVA 4QOSA 4ASUD 4JLVA 4DDTA 3KB1A 1XTRA 1GDDA 4NYIQ 2MMGA 3NC0C 2JLXA 4L4UA 5HZKA 1W4BA 4TSFD 3EIHA 1W47A 2ZSBA 3BB4A 1XZPA 4U00A 2KBTA 3K0CA 4PANA 1EESA 1SEMA 4UNPA 2AXNA 4CYMA 2ODEA 2AWOA 5IDVA 5IK2A 4LJYA 1AZGB 1OW3B 2IYYA 2EFHB 5C4GB 4FMDB 4PO9A 2BCGY 2C9YA 3CNNA 4KCGA 1COWD 2PEZA 5TY0A 5DI3B 2J6OA 1K0SA 1KJYA 4JLMA 2UVQA 821PA 4YDHB 4NYJR 4UJ5A 1BB9A 1IN7A 2ZROA 1VG0B 2R6FA 1NJGA 2QRZA 2V55B 3OE7A 1XCMA 2EFCB 5HKKD 2O31A 4DCSA 3BD9A 1CR0A 1JO8A 3T12A 3VKGA 1OHHA 1YR9A 5JFGA 3BOSA 1AWWA 2ATXA 1EWQA 1Z29A 2E87A 4FMDF 4Z1MA 3P32A 5D3MA 5DE3A 3UF4A 3C8UA 3QQ5A 1OV3A 5GJCA 3THWA 3GLGB 1N6LA 2B8WA 2DF6A 2RGEA 4YDSA 3I5YA 4IXMA 1Z6YA 2CNWD 2BBTA 2OT3B 3VR3A 4URXR 5KSOA 1JAIA 2QAGB 1AVZC 4QFMA 5HCIA 4ESHA 1IN5A 2H92A 3RABA 1YWOA 2B7BA 1RI9A 1KK1A 4F14A 2XJ4A 4HAXA 4LV5B 1KYIA 4BQSA 1U0LA 5AUQA 1GNQA 2VRWA 5EE9A 2JMAA 2NO9A 1NVVQ 4JSYA 1LCKA 2GJ8A 2FSGA 5CJPA 1E6GA 1W46A 3GBQA 2D74A 1YKSA 3SBDA 3M0SA 2KBFA 2PJZA 4ZCIA 1RRFA 1KI2A 2PZGA 1N0UA 3T06B 3QY0A 1NVUQ 5E7JA 1DPFA 121PA 1KSJA 3UA6A 4US0R 3ETLA 1IONA 4PAOA 2OLJA 4M9SA 1YQTA 4AKGA 1MV5A 2RCNA 3CO5A 3B1XA 3FHCB 4LV6A 2CDTA 1AS0A 3D6TB 3WYFA 5JRJA 2P6UA 3LDAA 2OXCA 2YDLA 3E5HA 2B6HA 3EXAA 5A4JA 2G0TA 3ZQ6A 4LJ5A 4B6FA 1GILA 2D2EA 4ZCLA 4Z89A 1HE1C 2A28A 2GTJA 1WYXA 2EFGA 4C0JA 4CW7A 1DBSA 3CWZA 4TZ0A 3N70A 1U8ZA 1WI7A 4ZI3A 1ZNZA 2RHMA 1TTTA 2PJRA 4WCIA 5KO2A 2LJ1A 1NIPA 2IA5A 2J7PD 4C0SA 1NBMD 1U98A 4P4UA 4ILEA 5EUMA 4AG2C 4MQBA 5IK2D 2CJWA 1E2PA 3QF4B 1E1RA 4FD2A 5LD2B 2O9VA 4KVGA 4G5SA 1VHTA 2ZRPA 3CNOA 5D3QA 3RAPR 1M8PA 1OPKA 1J70A 1N0WA 1AZEA 3N5CA 1GL5A 4BE7B 2F1HA 1EX7A 5AJZA 4LHYA 2RN8A 2QENA 4QXAA 4AG1C 2ZS8A 3AVUA 4C3ZA 3RS5A 4R0KA 1SRMA 3OEED 3FFAA 4A15A 2JEOA 4NCKA 1YCSB 2X8AA 3FE2A 3L0PA 3AVTA 3CRW1 1W44A 2WJGA 1JXMA 2D8JA 3L8YA 3WHKA 2H7VA 5GJVC 2F6RA 2OFXA 1GCQC 2J6KA 1QHGA 2CE2X 4RD2A 1KO4A 2WOOA 3PFIA 1E94E 5FPYA 2WWHA 4QKQA 2ZI7A 1UECA 2K3BA 2F1IA 1IM2A 621PA 4IOJA 1IBRA 2JTEA 1PKSA 2QG6A 4C7OA 2UZIR 4XJXA 1ZBJA 1S96A 3VNVA 2XEXA 2RHDA 1ZNWA 3OIWA 3TQCA 5JWOA 1Z8FA 1VCIA 5FUVA 3OEHA 2BZYA 4DRZA 1NMZA 1D2NA 1TUIA 4RKEA 1B0UA 2JATA 1H92A 3I4LA 3LWNA 4QHSA 3R8CA 2HYDA 4DDUA 1P61B 5KHOC 1WDXA 2VHTA 5FWBA 5E4FA 1O87A 2A3RA 2WJYA 2EWVA 2CXXA 5F9HA 1E2JA 3A1SA 4C9BA 3R8FA 1AKEA 1Z6TA 4OMMA 2R6DA 2ZITA 3LX8A 4EPTA 4YQFA 5HZHA 5FBWB 4M1TA 1X8KA 3MLEA 1ZJ6A 4Q9HA 1E4YA 2AKYA 3MG9A 5KNDA 3TW8B 3WRYC 2CBZA 3REGA 3U60B 1F60A 3K09C 3KX2A 4DLSA 2ZRBA 1P5ZB 3GMTA 3FMOB 4P33A 2ZR7A 4EIWA 2QMHA 2GJKA 1YHNA 2MIOA 1A82A 2B8TA 3CR7A 3ND8A 4GLMA 4C30A 3DM9B 1U5SA 3HU3A 1A4RA 2RF0A 2EVRA 3PENA 4WW0A 1XPOA 2BCJQ 2VHQA 4DLVA 1PUJA 2R6AA 2WV9A 2ZU6A 3KL4A 3EA5A 4UNSA 3ZD6A 1Z0JA 2MCNA 1XEXB 3NG1A 4RCZA 4XH9B 2J0VA 4GFDA 2ED1A 1GRNA 2IW3A 4DXAA 2V1QA 2QPOA 3RHFA 5JEEA 2QNRA 2C0OA 3T61A 2H8HA 2P5SA 1NN5A 1OOTA 2ZYTX 1PKTA 2GXAA 3GEEA 3I5RA 1L4YA 1IY1A 1U94A 2AR7A 4M1MA 3K70C 4CEHA 3QNUA 1FYNA 3SYNA 2CK3A 4PZZA 1Q1BA 2ZRKA 3D31A 2QP3A 3OHMA 4QG7A 4HVWA 4BASA 1SULA 1ZUKA 1G8HA 4XVRA 1BMFD 5DIFA 5FOXA 2J87A 1WMSA 1WQ1R 2P2LA 3A1WA 5HCNA 2ZRDA 4TLCA 2DBKA 4V0KA 2KJQA 1P2SA 1SQ5A 4LBZA 4HZIA 2AHOA 1CJUC 1CJTC 3PVSA 1AEYA 1I2DA 5F98A 3LV8A 3VHLB 4GRAA 4L16A 2AKAB 4LUEA 1Z22A 2DCUA 2TMKA 4IOKA 3I1FA 5EP3A 1DO0A 2O2OA 2XB4A 1IN4A 2KBEA 1T4GA 2GBLC 1FNNA 3LBIA 3THKA 1R5NA 2OBNA 2W6JA 4G5GA 4S2EA 4B76A 1L2TA 3SEAA 2IHYA 4CDGA 4DEYA 1E79D 1Q21A 4S35A 1TU3A 4GBQA 4PTLA 3RVBA 1TQ2A 2IX3A 3UMFA 3HJNA 4PO1A 3NH6A 3P27A 4JBYA 1UJ0A 3K9GA 1CRPA 2GTPA 4W5HA 1WBBA 2ZANA 4RZUA 2YSQA 4HYYA 3CPJB 4ACAA 1Q20A 4N0EA 5SZKB 3LBNA 2CHVA 4OI2A 3NTUA 5GJVB 2ZAMA 1KY3A 4TT3A 2A30A 1A1VA 3NBFA 4RTTA 4JMPA 3X1XA 1NF3A 2I4IA 5EE1A 4BGDA 5L3SA 2OCYC 1KY2A 1U9IA 4G0NA 4WIAA 1CR4A 1EFRD 4RVCA 5GVSA 4MGYR 3KKOA 4NDZA 3H41A 1N5KA 3GJ0A 1S4QA 4PXAA 1E32A 1XXHE 2IUSA 5DNYB 4YMUA 2ZETA 4J9EA 4OQMA 5JRZA 3TAUA 3AUXA 4RD4A 2AZSA 3LFUA 1AOJA 3K9HA 1LY1A 4LGMA 5JZVA 3A4NA 4ORZA 2WZQA 4NYMR 1BO6A 2QRNA 2LQWA 4MYUA 5DN6A 1UAAA 2FV8A 4OHWA 1Q57A 1C9KA 1NBME 2PT7A 2AFIE 5FL7A 2VL7A 3X1ZA 1XD2A 4M1KA 1E1QD 2J3EA 1N5ZA 4M2LA 1TF2A 2BEKA 1XTQA 4OMQA 1TG0A 4YLGA 2ESWA 4B3BA 1ZD1A 1CTQA 3B13B 2DJQA 1W0KD 4AYXA 4AWXA 3FHTA 5CB6A 4BLPA 3TRFA 1YP5A 3CBQA 1E9AA 3RWOA 2EW1A 1VG8A 4RTZA 1AJEA 2YNMA 2ROLA 4TQUS 5EE0A 4D8KA 2EFDB 1J99A 2QGNA 3QBTA 1E69A 3LVRE 5DLQC 3IBYA 3W6OA 5ELXA 4DDVA 4C4PA 2DR3A 1GOTA 2KB0A 3P1JA 1S9DA 2C77A 3V4FA 1NEBA 4A1FA 2F9LA 2YC4C 2DB3A 4BLTA 5CJ2A 3IBGA 3VQTA 2JDIA 2KT1A 3RS4A 4IKEA 3R9WA 1N2CE 1W4RA 2FDCA 1IJFA 3A6PC 3EIQA 1UKVY 2G6BA 5C18A 3OIVA 4CIDA 5L3RA 4Q4AA 1JQQA 2O8FA 4K81B 1I2MA 3K70B 2D7CA 1JNYA 4HSEA 1JI0A 3U3RA 2WJIA 3MUFA 2IS1A 1KNXA 2RGDA 1ANKA 3QIAA 2V4ZA 1DVRA 3ZVNA 3A98A 5J4HA 3EG2A 4GPTA 2W58A 3ZLJA 2OM2A 4O25A 3QWXX 1ZU5A 2FEIA 4I81A 4TT3D 2IK8A 4TTQA 2KSQA 3BFXA 3HPQA 4FMBB 4LBWA 4PSAA 1TX4B 4RTXA 1Z0AA 3FYHA 4JLKA 1DAEA 2O8DA 4PC6A 2NO6A 4LN2A 2ODNA 3IIMA 3RRMA 4IFBA 4LNPA 3LX5A 1NP6A 4L5BA 1KI6B 1UBGA 3HYRA 3QI2A 4K46A 2PZEA 1AD5A 2BBSA 1ONBA 2JMCA 4AC9A 3FMIA 4M21A 2ZSEA 3DOFA 2JLWA 5EUQB 1SHKA 1G5PA 1NLZA 1O3YA 3GLHB 4FXPA 3UIEA 1HURA 4HUQB 4RUGA 3SI7A 1KK3A 5FBVB 1V43A 1P3JA 2ERYA 3GD7A 2ORIA 2ZUCA 3VS2A 2A5YB 2JT4A 2ZQ5A 3AP2A 3B5JA 4A82A 1DEKA 2FGJA 4W5JA 1KAOA 3WNCA 3K53A 5EQTA 1G16A 1GIAA 2VPPA 1Q3TA 1E2MA 3WXMA 3Q5DA 2OBLA 1G6OA 1OYWA 3KFXA 4Q1CA 4HZUB 3SBEA 2BM0A 1T0JB 2FG5A 3AF0A 4DLZA 4JT2A 4XIGS 5BN3A 2H1LA 2OZEA 3R9XA 2ZUBA 4OJQA 4QGAA 3U61B 2PNIA 2AD1A 4J9GA 4GP6A 4PHHA 1QG2A 1I4TD 4Q1FA 4IDHA 1P9NA 4HLDA 4TMKA 1KIKA 4UQOA 2IF2A 1SZPA 2BMJA 1YE8A 4G1UC 4Q47A 4YONB 1Z63A 3H86A 4RD1A 4ZIRA 1T3SA 2REBA 2DL5A 2ORWA 4OK6A 1G3QA 3A4LA 3K9NA 2K5UA 4TN1A 2JDID 2GAOA 5FH9A 3NGPA 3WYAA 2PMKA 4PHFA 2C03A 2P67A 4Q9IA 4QM6A 4B34A 1RVDA 3GJ3A 4BFVA 1OPLA 3TNFA 1RYHA 3QXSA 2ROTA 4TL6A 3UK6A 4KXFB 4BZQA 1R0XA 3KQLA 4H9GA 1VYUA 2FSIA 5CIQA 5BYKA 1QHHA 2QE7A 2ZI4A 1UBFA 4NZYA 3UG6A 1CP2A 2CVFA 1I4LD 2WMOB 4XTCS 4A9AA 3LRPA 2PCLA 2XGJA 3J81k 5DGXA 5JMTA 2UZ3A 2D62A 3RNLA 2DLPA 3SR0A 2Q9BA 1LNZA 1ZNXA 1DADA 3MWKA 3MWJA 2BBOA 1EX6A 2W6IA 221PA 3IEUA 1PLLA 2YHSA 1OF1A 3UA7A 1E2EA 1YZGA 3QUSA 4JZ3A 4JSTA 2HCBA 3QKUA 4HAZA 4JBWA 4WZAE 5HR5A 4G01B 5JCZA 3GLFE 5FOUA 2GCPA 2EYWA 2WJVA 2ZJBA 3VS7A 2EU8A 2V7QA 2FPMA 4BLQA 3W3AA 2DM1A 2NMVA 1H3HA 2BOVA 1X6VA 1NLFA 1L7VC 4GZMA 1QF9A 3L43A 3EZ7A 2WVJA 4JLNA 4CT4B 3GLIA 2V1UA 1R0WA 4A0RA 4RD0A 1E6HA 2XTZA 1P4SA 1P2TA 5EXXA 1F2UB 2KEAA 1M1YE 2MOXA 2BEJA 3KUDA 1QCFA 5KDOA 2DL8A 1FFHA 3K0EA 4OMLA 2ZJ2A 2IWHA 1UBEA 1Y63A 2D06A 2ZS9A 5CK4A 3C5CA 3L0IB 3CWQA 2HF8A 2YYZA 2L3PA 4NYJQ 4HLUC 5HE9A 4XSHA 1FTSA 1E2HA 5M04A 1X43A 2VH5R 1GCPA 3CKLA 1BBZA 2DNUA 2JGNA 3F3YA 4GZLA 3PJRA 4DCUA 2JS0A 1UJYA 3WBKA 5ECAA 1ZUIA 1W0JD 1N5LA 2IL1A 3VHXA 4LUDA 4M4ZA 4P4TA 1OH8A 2DWQA 2W0ZA 5BYJA 3THXB 2R6GA 2NO1A 3K0AB 3KXKA 2Z0MA 4TMVA 4Z51A 4Z88A 4CEJB 4DT1A 2KI5A 1RKBA 1JBKA 2DBMA 2P0EA 1KGDA 4CT5A 2LQNA 3ZYCA 1NY6A 1R5BA 2DWOA 2VYFA 2XZLA 1PJRA 1K8RA 2YVUA 4B75A 4RTVA 3KUCA 4EIKA 2OE2A 3ULRB 4XWOA 3AKYA 1E2LA 5DYIA 1TU4A 4KHZA 1G83A 1UTIA 1CR2A 3DO6A 4URYR 2FEMA 421PA 2QTFA 2JIZA 2YWGA 4U02A 4XD7A 2V3CC 1KSGA 2R62A 2HEIA 4E6RA 1KTVA 3HU1A 4F93B 1OLOA 4TYPA 2GWHA 1XD9A 2NZ8A 5G53C 1EWRA 1OKKD 1OXXK 1VCNA 3KTAA 1AQUA 2QP4A 5JI2E 2GK7A 4JYCA
chains in the Genus database with same CATH superfamily
3OOWA 1C3LA 1PT7A 2KRNA 4VUBA 1ZGHA 1UOQA 4HQNA 4RPLA 3M1LA 5ALGA 2OC4A 4OKSA 1T9BA 4KO2S 1M3BA 2PSHA 4AAYA 3PUXA 5DNVA 3CG0A 4GPEA 2YVQA 2GEVA 3WB1A 3ADCA 3OFND 2O7RA 4QUGA 5F9FA 1ICEA 3P0HA 5C8VA 4CDMA 1E7RA 2CLIB 4FX5A 3L0OA 3FUCA 1Q82U 1UPCA 4XDZA 2IHUA 3PUZA 3ZUGA 3NIWA 4LSMA 5GAN8 4JU8A 2R5NA 1FDRA 5KQSA 5IEJA 1M7HA 1A9XA 3BE8A 2QGGA 3U9SA 1Z47A 4KH1B 2ZWPA 3JQAA 1OU9A 3ILVA 1GNSA 1RAHA 3B20A 2HDOA 4XCQA 2BJWA 1E4EB 1OC2A 3NM5A 4LVOA 3C4VA 2BEWB 3REBB 3I30X 3UEOA 2EQAA 4EA9A 3AG6A 4XTXA 5LU9A 5JSZA 5H82A 1X15A 4TT8A 2C1XA 4Z0HO 2XWJI 5BSGA 2GI4A 1RAGA 3BRQA 5IBPA 1EXWA 1QVFA 2VF2A 1Q16A 2QDYB 2QDLA 1NNUA 3BBPA 5BN5A 4FQ5A 2GILA 3EQ8A 4CLEA 1Z12A 6AT1A 4AG6A 3V3KA 4BO5A 3KQMA 4CV1A 2PRIA 2HBYA 4PG6A 1E7WA 1QGUA 1GRCA 4HFNA 4E4RA 4MO9A 1NUHA 2A84A 4BP3A 1OULA 4ZN1A 4PLTA 4M77F 4COOA 3BH0A 3WWEA 4XUEA 4XR4A 3MQFA 4KN5A 3LDGA 3V9PA 2BC9A 5DHRA 2RA2A 3VZBA 1VQKQ 3EZGA 1G38A 3HI6A 2PZKA 1Z6GA 1XJCA 2AK3A 5DMHA 4XA8A 2X4GA 2FEPA 1HEIA 3KUUA 4D9BA 3I92A 5IP5A 2GETA 5FU7C 4PG4A 3BTSA 2J06A 4UM7A 1GU7A 2ZXEA 1JTEA 3ENZA 4UBNA 4RGBA 2K7AA 1JMKC 3ZHVA 3E0QA 5GV8A 3EXHB 3KLBA 5CHYA 1GARA 3U3ZA 1FFGA 5CNMA 2I4RA 5CT9A 3S1AA 5LDDC 4MQ4A 5KTOA 3GLFA 2N3ZA 1I32A 2BF7A 2H2AA 3CC4Q 2GF7A 1D5CA 1MNEA 2FPOA 3JATA 1D09B 1R4ZA 2NT3A 5B3AA 5EKXA 4DR6B 2WY2D 4IUDS 2FPXA 3R3WA 3RQSA 2BW0A 1DOAA 1WXQA 4I6GA 1J0EA 5B58T 3G9QA 1M74A 1Y8QA 4G0UA 1ZMRA 2HA4A 2QTVA 2FPIA 1AKNA 4BFYA 2SEMA 1V4VA 3MBOA 2ZSFA 4JZYA 1Z4OA 5KQMA 3LIIA 1HC7A 4RABA 1PJTA 2YASA 3DEIA 2RHBA 2A33A 4KREA 3VYUB 4RTWA 2DXBA 3KYDB 4FU6A 5KYTA 5CIYA 1VXOA 5CKHA 1EDZA 2YUQA 4RQUA 1L8QA 5BVHA 2DOKA 2GGRA 4EUHA 4IM7A 4QSHA 1QTRA 2GPBA 1Y5RA 1WM1A 2SRCA 1O94A 3Q9LA 3N8KA 1X27A 2NU8B 5CO7A 2ABWA 3BGWA 3F5FA 2VR1A 4ZAWA 1Y7XA 1YI1A 3JCZA 2HK6A 3OAAD 3CZ5A 4QPDA 3EQZA 1VHQA 5AH0A 2ONYA 5COBA 3GLHE 1V5FA 4E7ZA 2W2KB 2HFKA 4I46A 4R1TA 1EWVA 1RC0A 3DEKA 3MJ4A 2VJNA 1Q14A 4ZAXA 1DKLA 4TTPA 5DBOA 4MVJA 1C3OB 2PDAA 1JSLA 2IELA 2V98A 4ZRMA 1V1MB 3TBFA 1W1UA 2I6GA 2JBHA 3UWSA 1NLYA 1SUDA 4D41A 1RRVA 1M1KU 4K1LA 3T3EA 1NXWA 1ISRA 2IYFA 3N59A 1IQ0A 4L74A 3J80A 1M34B 1PCXA 4EKYA 4IMJB 2OMEA 5BN5B 2NQ8A 1P2VA 4MRPA 4I3GA 4PHTA 1CZKA 4H4EA 2IYLD 4L75A 6AT1B 1XR3A 2W42A 2RSLA 4RIIA 4IVQA 2HK7A 4C92D 2XI9A 5A0FA 2LUOA 3DLBA 5GANj 1Z0FA 2PZJA 1CUAA 4Q3KA 1AKQA 3IJEB 3T3OA 1G5VA 4N41A 3VKFA 1EKXA 4L5GA 3BXEA 4QUKA 1L3BA 4IGAA 4Q02A 4F7UF 2DR2A 5JNTA 4H16A 9ATCB 1VL0A 2VHUA 3EEQA 3H1EA 4CRIA 1Y9JA 3PE6A 1AO0A 1RLJA 4KQJA 4YMTA 4C7OB 2ZYHA 2O1WA 2ZAIA 3WOVA 4MR7A 2J3IA 1G6Q1 4O8CA 3H84A 4U7WA 4GI7A 5CDSA 2EW2A 5ER9A 3AKZA 4CIVA 3ISJA 1C1XB 4HN9A 3IEVA 5CXUA 3I55A 2UZ1A 4J3FA 4J6EA 4XU3A 1UWKA 3QFRA 3CN9A 3ETEA 3WYEA 4OQDA 1VIYA 5C8XA 2LQ8A 3VXKA 2E12A 3JCMc 4DV2B 3T9AA 5LYJA 4YPOA 1DRUA 4JYBA 2FG7C 1JJIA 3QJYA 4IDOA 3T94A 5GAMf 3ETCA 5BSHA 2R00A 1M2NA 3UJ6A 4EG0A 1R0ZA 5FPHA 3WTBA 2C99A 2LT1A 3V46A 3WLHA 2IV7A 4C6TB 2V9PA 4DFDA 3UT1A 3LY8A 3K09A 3U7QA 2RGXA 2YYAA 4NX2A 3Q7QA 3MS4A 3CC7A 3OBIA 2HPAA 4HN4B 3Q85A 2XIDA 4DM3A 1VDZA 3P8DA 2F3QA 1G63A 3DOIA 2MSWA 1T4CB 2ZTMA 2P78A 4YAOA 4MW9A 5T64A 2JLSA 2ZYWX 2XCLA 4ZI7F 2RGUA 2H1HA 1V5WA 4EHJA 4FC7A 5C52B 2XLCA 3ABIA 1SXJE 2KQUA 1QUEA 1BG6A 3NHPA 2DSNA 1U11A 3URGA 5K4AA 3OYNA 1IL0A 1PT8A 3KPYA 2WSFE 3OCCA 1ZA2A 4M0EA 4Q93A 2GBLA 3WMFA 1U9ZA 3IA7A 4A54A 5FPTA 3A27A 4B3XA 4WV3A 4X41A 3KZXA 4I36A 2NZWA 2O0MA 3EUWA 3IJPA 4JL8A 1OZAA 1UZAA 1WMDA 4C7VA 4II3A 3MSXA 3CCLQ 4HLQB 4OOFA 1RQGA 4D8WA 2R5WA 5SYNA 5TQVA 2A5FA 3RV4A 4QJ3A 2ESRA 2D7JA 1J22A 4IUBS 3EWSA 3PQCA 3I5XA 3G7UA 1CY1A 3VR6D 3B70A 4W7SA 2EKHA 2R8YA 2FB7A 1AX9A 4R84A 1Z0SA 4PYMA 3UJHA 3HUEA 2EQBA 3L7KA 2HTFA 4OV6B 1SHLA 2GYUA 4KYUA 4MGHA 3MXTA 2MSEB 2P90A 2ODWA 2M02A 1ZOLA 2CT3A 4QNMA 5A5DA 4P7JA 3DLPX 3U48A 4QYTA 2OK7A 3T5AA 1B7TA 3GDFA 3K0FA 4UC4A 3GJQA 4M37A 4DY4A 5HY6A 3ZZUA 4L4XA 3SDZA 4QXOA 5IKEA 4EWLA 3QEMB 3HMQA 3NZEA 3CJQA 2I4TA 3QOFA 2Z4SA 5JS1A 2PVCA 1W36D 5DM7R 4J3NA 1ECJA 4CZ2A 5U1PA 3K1AB 2HL6A 3WLAA 5JQGB 2XB2A 4IXDA 2JIOA 4JKYA 1ZK2A 4QPPA 1J7KA 4LGCA 2FNAA 2AWNA 4LX0A 4NEHB 3GH1A 1K68A 1JVNA 3SM9A 5BPHA 4Q4JA 2Y8EA 5IDWA 3OOEA 1KZ9A 2IKSA 4NZPA 3GO4A 3FOEC 5GMKh 1NVEA 2YDYA 2EEZA 2QHXA 4EBBA 1I94B 3CCVT 4BI8B 2X0KA 2Z08A 3SC6A 1P2BA 5AW7A 5KX5B 1ZJ5A 4Q6BA 2RGNC 4BZWA 1NMSA 1FMJA 1BK2A 4CC3A 4F21A 3AVXA 1DXHA 3LH0A 1UFFA 1U7WA 2OHGA 3E9DA 3NUGA 2GHTA 4L1KA 4IDPA 1D6SA 2BL4A 3FTQA 5EQDA 5HTOA 2FK8A 3LRXA 4N01A 1M0WA 4J6FA 4O2BB 1BHJA 1TADA 3W8FA 3LDUA 1NW3A 5LL6P 4TKVB 1EAYA 1FEZA 1U2EA 1MUZA 2JGLA 4ZOLB 1MZVA 3OCYA 1PNTA 5CM8B 4KE8A 1OXMA 2FWBA 2GXQA 1Z28A 3AFNA 4R2LA 2NYUA 4JT8A 3TSAA 1A9RA 4S1VA 1S1MA 3THSA 2CNLA 4IJKA 2R9VA 2CH4W 3OFJA 1Q0PA 5LBUA 2GZDA 2IXTA 1CZHA 1G5FA 1Y0BA 5A5EA 1BDMA 1U2RA 3NWEA 5I45A 1WAMA 2J6HA 3FYUA 2PUHA 3RKWA 2C57A 1NQOA 2GZAA 3LXMA 3QPAA 2HBZA 1RR6A 4M86A 4LOHA 1XTTA 5I6DA 2X35A 1XOVA 5FFMA 3VR5H 1P2DA 1FP4A 3GCXA 1WGSA 4WJZA 3M6AA 1AHNA 3LX4A 5EZ5A 3VVCA 2GEJA 4ROTA 5FTKA 1KFCB 1Z73A 4BUJA 1PM3A 1JE1A 4XIFA 2FRVA 3DVRX 3FMFA 1H4VB 3PKZA 2L18A 1M1XB 2ZPAA 3NHUA 4D26A 1Y4ZA 3A9VA 1F8UA 4ANJA 4CL8A 2AJ8A 1OOEA 1SCDA 5E4JA 1QS0B 3K31A 3B78A 4CUKA 4V3CA 2QL6A 4P4GA 1RPAA 4P5PA 3REQB 1K8AR 4EJ2A 4ZEOA 4PLHA 1C9EA 1F4VA 3SZRA 3K0FB 5HCUA 4RTYA 1OIXA 1ZI8A 1EAMA 3IUMA 2ZRLA 1SD1A 1SN7A 3KYIB 3GJ4A 3DQZA 3CCJQ 2IIMA 1I13A 1DG3A 4HY3A 1T9ZA 3EDYA 2HQHA 3I5AA 3S7ZA 3ZGLA 1H5NA 2ZJ5A 4C0XA 4NU5A 4ZDJA 3EDRA 4QGBA 2Z1NA 5D1NA 2K4MA 1FRQA 1FDOA 1LV7A 3KG2A 5A3SA 2C82A 1NL3A 3L1VA 2WJZB 1Y8ZA 3P4XA 2ZVQX 2GCEA 1H4TA 5FBLB 2K2MA 2PUFA 3SJ7A 1VPVA 4GPD1 4J0FA 2JOYA 3ZQUA 4KODA 4MW5A 4RULA 4D8UA 1JHVA 4CR8A 1N77A 1BS1A 1KJIA 1NXSA 4IIMA 4EW2A 1K9MU 1REQB 1P75A 2F8LA 1CE8A 2IYSA 2XLBA 4IICA 4JVLA 3RGGA 3OPVA 5LIRA 2H57A 3L1HA 4IS3A 3M9LA 1HT1E 3LECA 1CUJA 4B35A 1YRLA 5D01A 3BMOA 3R0VA 4ARSA 5HZKA 1H641 3EIHA 3D8RA 3PDCA 2C9BA 1EESA 3CSSA 1RWOA 2BSQA 1NR5A 1OW3B 4G8JA 5FUMA 7MDHA 1NJ6A 4YWHA 4QFBA 3KOZA 1O6FA 3EIWA 3AHJA 2V97A 4PYLA 1I1HA 4I8XA 1CR0A 1CVIA 1T2NA 4AZWA 5GANg 3IEKA 1HZZC 3C8UA 3ZHUA 3I83A 2ZBEA 4PZCA 2H2DA 3DYIA 4N6GA 2Z2IA 4K6GA 4BV9A 1I5RA 4R81A 5KHLB 1KR2A 2XMGA 2WI8A 5ED0A 2PJZA 4ROSA 2AI1A 5A3RA 1U0NA 1KI2A 3QX8A 3S0JA 1VJDA 4TV9B 3MT9A 4Q3DA 1VMKA 2O7QA 2I2WA 4X65B 5B7PA 4D57A 1LPBB 1PNQA 5CVEA 5A04A 4ZCLA 4J1SA 3IKTA 3HABA 1AMNA 2YMLA 4U2FA 4M3NA 1GAEO 4ILEA 2WINI 2QYHA 4MQBA 4ZA2A 1RVV1 1KP9A 4CLRB 4QLBA 3WB0A 1M8PA 1GL5A 2RN8A 4JDUA 4ZGEB 4PX3A 2C2XA 2O1EA 3L0PA 1CT9A 4HQOA 1GA1A 2F6RA 4N47A 2C54A 5I7RA 2YY5A 5AM2A 4PHCA 5AESA 1WHSA 3V1KA 2QL9A 4XTWA 2XEXA 1LJLA 1T2EA 3QVLA 4IP0A 5G0UA 4CTOA 4AWAA 2P9BA 3R8CA 4UZEA 3O91A 2BFCA 2AE2A 3PFCA 2GERA 5CDUA 4YQFA 3I05A 2W43A 3MNFA 2VPTA 4DV0B 5IAGA 2EZUA 1HMPA 2GJKA 1YHNA 3CR7A 4GLMA 3KHSA 5IM5A 1RYYA 2EVRA 1WKCA 4C4XA 1R0SA 1LQUA 1A5ZA 1Y7HA 3IE1A 1KYWA 1L4YA 1NZJA 4CEHA 3SYNA 3UJDA 2Y6UA 4AJ9A 2RD1A 2J87A 1KEEB 1WQ1R 1A71A 2DBKA 2OP1A 3G0IA 5J9FA 4YI3A 4BLVA 1AUVA 2I91A 2HMSA 3WS7A 4B76A 2W6JA 5AVXA 3CCET 4F46A 4GBQA 1FUYB 3D6NB 1SZJG 4IV5A 3GP3A 2FZGA 2GN9A 2CHVA 1Q0LA 5EE1A 3S2FA 4C0WA 1SPBS 4FGZA 1UBJS 4I5IA 1Z17A 2H5IA 3G0DA 4LS3A 5DNYB 4FZVA 1EXDA 1N2OA 3TAUA 1GQFA 4I5FA 1CNEA 2VPQA 3OZIA 1BO6A 3OPYI 2Q5HA 4QX6A 3FFTA 4OHWA 2H1CA 4ZQEA 1N27A 4ZAFA 4X1YA 2Q1TA 4RPGA 1JFSA 2EW1A 3KAKA 4TUYB 4C4PA 5JASA 2SKCA 3VQTA 4E47A 5ALWA 3D7SB 4BQNA 1ZRSA 3W5HA 4TKUA 3MBKA 3H3XA 3ABQB 3KEQA 4PC6A 1RHRA 3IIMA 4HGNA 4BJ6A 3CLHA 3PNKA 4L5BA 3OD5A 4WEQA 5FNVB 2I22A 1TMYA 2WF5A 4U7GA 3GNFB 3A4IA 5IKPA 4BP9A 4BBAA 1P3JA 2ZUCA 3MJXA 2JT4A 2H7XA 1DZIA 2JI7A 3HXPA 4GNRA 8ATCB 1E2MA 1VQPQ 2I7CA 3HFRA 1QE0A 5C34B 5G4KA 1Z63A 1RM4A 1KBOA 1K73C 1D03A 3OWHA 4G1VA 5DGHA 4BFVA 2FSIA 1JJ2S 4GOMD 3JQ6A 2Z30A 3JAME 1ZSYA 3TQ7P 2C0QA 1E20A 2H4YA 4WY5A 4KXLA 3K8ZA 3DLHA 2FFJA 1R0WA 2DP4E 1BA3A 3I9NA 5EXXA 2DHQA 3L4BC 3W2GA 5KDOA 4IDEA 3INGA 3K2QA 1FRFS 4FGLA 4ZTFA 4E0BA 3M1AA 1HSZA 2MU1A 2R6GA 2G25A 1NU6A 1G8AA 2DBMA 5BMOA 1TAHA 4AZ3A 3M8KA 4ADSG 2DWOA 2VYFA 4B75A 2QQBA 1K8YB 3PHGA 4H4CA 1XXLA 3VH1A 1H2RS 1CQPA 3HU1A 4ZO7A 1FS5A 2QIPA 4PGGA 3N0WA 3ED5A 3KVOA 5ADWA 2JLYA 4GYKA 1DIRA 4G5XA 2OO5C 2DUWA 2A5DA 3RT7A 4KO1S 4Y2SA 1G5RA 4ARCA 2WSIA 4YRDA 3VAYA 4MUEA 1XMSA 1W1FA 2AJDA 4W9MC 3B6EA 3KHTA 2ACVA 3VYGA 2OC9A 3UT5B 2IITA 1BKSB 2JAHA 3PQ3A 4CCAA 2QMUA 1G2PA 2XNDD 3SFVA 1XYYA 3PGA1 3CRZA 1Q1QA 5A9TA 3CU5A 2BGMA 4X20B 3RS2A 1XTPA 1EG7A 4BKRA 3TEFA 2VO1A 5DPMA 2AN5A 2FPGB 3EFRA 2J3QA 1L6IA 5E8RA 1PJ8A 4FYMA 3A1UA 3MJVA 2LZ0A 3H2SA 4OMFB 2GPJA 3F5DA 3BMQA 1PL8A 2HQBA 1G18A 4O4JA 4FCTA 1BCSA 1CQZA 4DMCA 1XPJA 3IR5A 1V7PC 3LO8A 2G7ZA 1U63A 4DSUA 1WPQA 2HUPA 2OAQ1 2EARA 2WWFA 2HSPA 1RZRD 3ZJTA 4D8TA 4KMRA 4DKJA 4MVXA 3ZGXA 3HBNA 4Q4CA 4N6NA 2QN3A 3MWDA 1YR3A 5IKMA 2PUKB 4OSPA 4MRAA 2D1QA 1Q0SA 1T3HA 1WZ2A 3I9LA 2A37A 3Q3EA 2IYUA 1U2GC 4OSEA 3O84A 1K7EB 5BNWA 4RFVA 4V02A 1JKMA 4UAUA 4YMVA 5K03A 1BVUA 3ORQA 2VF7A 1TMGE 3SFZA 4KH0B 3RKYA 2RHRA 4ZDKA 1NOIA 4OQLA 1WRBA 1JDJA 4MDHA 4ODIA 4JHLA 2XODA 6GPBA 3NMZC 4ALMA 4MUXA 4PBRA 5SICE 2H5EA 4QQFA 4EB8A 2JTFA 3MKDA 5AVWA 2OZPA 4JD5A 1GQYA 4PYQA 1J2JA 4M36A 3VNUA 1R10A 2EFYA 3VS5A 1KC8R 1EB8A 5LN1A 4Y7CA 2WLTA 3P71T 1SMKA 3E3NA 3DE0X 1Q0ZA 1G7CA 3AR3A 4B32A 2V0NA 2V6GA 1TTHA 3MD9A 4UEQA 3AEUB 3NTVA 3R3UA 2OHJA 3H5LA 4YQZA 1MO2A 1T2FA 1CUDA 3N8DA 2I34A 5D7BA 2XRYA 5HKAA 4Y6LA 4LFCB 1YFZA 4ZGGA 3BGOS 1PDVA 5HWSA 3VPGA 2IFTA 1O96B 1FXXA 4ZQFA 4MIOA 2BMVA 2AR9A 2HJ9A 3PGVA 3QTTA 1ETUA 5H9VA 3MRXA 1L5GB 2HCJB 1GA6A 1WR8A 4OHXA 2AG1A 4HEA6 4I2VA 3O3CA 4E32A 2EXXA 1DBIA 5F7JA 3CC2T 4AJNA 4IVPA 1OI1A 5KTMA 5MN6A 4BGIA 1Y6JA 1WE2A 4K8OA 4XYLA 3PCXA 4J9FA 4M7AE 2OORC 5FL3A 4PJLA 4CFZA 3CMAA 4WX2B 3HKBB 4QNNA 3D0KA 1RIFA 1GGMA 1WW2A 3HR7A 2BGNA 7YASA 4P32A 1WJRA 3C48A 2OSVA 4XU0A 2EZ9A 3KQHA 4J0KA 4AURA 2NADA 3JYOA 5CTAA 2FE4A 2EKOA 4ZYWA 3LWBA 4BAGA 4CLXA 4KV9A 3MGCA 4U3JA 4JVSB 1FQWA 3DCNA 1LI7A 2I7VA 3DL0A 3V55A 4LZLA 4MDFA 3D8TA 5KH6A 1WX1A 5D1HA 3UYKA 3IOYA 3UMJA 4IEEA 1BH2A 2YWRA 3BIOA 4MWSA 2G83A 4NE9A 5DTRA 1SOMA 3TVDA 2WAOA 1P1IA 5IARA 1M1KC 1TXGA 3THWB 1UXKA 4BB5A 2PWBA 4HOYA 4QQGA 1XT6A 4EG1A 4RF5A 1SUCA 4OXXA 2UYYA 3ZCQA 5TSDA 3BWBA 4FEAA 4WZ6A 3PD7A 1XRPA 4MPTA 5L3VA 4X1IB 1S3FA 3I5SA 2OEPA 2PXCA 1R18A 4KWTA 2BFAA 5I2SA 3AINA 1PEDA 3F67A 3AB3A 4DBQA 3RUXA 1RZ3A 2MK5A 5J23A 3AXSA 1GSIA 1BMQA 4DZRA 4FUTA 2V6JA 4AY3A 4OYYA 5AFSA 1RS0A 4R2MA 3G9ZA 1HQCA 4NBNA 1D1AA 4DR5B 4OYHA 1Z8NA 2ASEA 3PNMA 3CNBA 1U9IC 1XTUA 4RKUE 2HJWA 3NUZA 3ZNPA 2D8HA 1JDTA 2WD9A 3MP6A 3PG5A 4MWBA 1G21E 5F2NA 2FUG1 1CK4A 1GGEA 2Q07A 3QE9Y 2VFAA 1P7VA 3I9KA 3T1NA 3WQSB 4XPZA 1K9VF 2BM1A 3LFTA 2YNMC 3ED1A 1ENZA 4Q48A 1JSRA 2YUOA 4H31A 2BCEA 3EC7A 4U0KA 5ALLA 5JHHB 2FF5A 4BRUA 1IG3A 4HNQA 1OBOA 5TXGA 3IS3A 1MB3A 5K8VA 1FSGA 4CMEA 2IV2X 5I7FA 4KITB 3SR4A 4ECEA 4ARIA 3AFOA 4L15A 4MQMA 4LDWA 2CNKA 1L9XA 4NONA 3V8EA 5F35A 3IP7A 2FRYA 3WQRA 3L5OA 2RJDA 4J1QA 4M7DC 3OVMA 1EX9A 2IRWA 2X23A 3ZLUA 2XUJA 4UBIA 4HB3A 4LF9B 4J4BA 2GZ1A 2KPOA 1Y1RA 4DNQA 2GZHA 1MMAA 3TQSA 3K1TA 2ICAA 2VP2A 3CBMA 3B5EA 5G41A 1PR9A 2GD1O 1XD2B 3RU3A 4CMHA 4EMBA 4PR3A 4KUDK 1JR3D 3FIUA 2Q0SA 2CVQA 1B8OA 3EG0A 2VH1A 4BX0A 5DGIA 3X28B 1KZHA 3KQNA 3EX7C 1WSWA 4HT9A 1M6WA 2K5FA 3NYIA 2EF1A 4DNOA 1N57A 1CD5A 3G13A 3L7NA 1XNGA 1AS2A 2FGKA 1M83A 1WUYA 2J6CA 4EMKA 4LMRA 2VUTA 1T2AA 1CIVA 1DC8A 3JTEA 3KAJA 1PFYA 4BQFA 3H6HA 1Y81A 1O6BA 3JRNA 2LV8A 1M30A 2J33A 3WLOA 2DUJA 4ZV4A 4MMYB 4I4LA 4EGAA 4KC0A 3T3DA 3ZWXA 3D8NA 3WP1B 4H35A 2WUEA 4LDUA 3RVMA 1ACJA 3GP8A 1ZWLA 3CXCP 1INLA 2ZE6A 3P9PA 4G1FA 4ND1A 1VKJA 4PRZA 3LWZA 4B48A 3H8ZA 5AP9A 1BE6A 1EU1A 1YBYA 1F8YA 3TMKA 3GNGA 1QHIA 3CPEA 5GAJA 4N0AA 2IUUA 2Y0DA 1EHYA 2HMAA 4G8CA 3D4IA 2OCPA 1ZG3A 4OMDA 2Z8XA 1BW9A 3BD7A 4V39A 4C5BA 1UWLA 2E5QA 5BWBA 4JI4B 3EMDA 3STHA 2A0UA 4ZXFA 3VVMA 3FLGA 4EL5A 1JVSA 2AL7A 1SG0A 2FMFA 4FYHA 1P60A 3FETA 2WP8J 2YTZA 2YXBA 4P2GA 2GVZC 1M2VA 2NUBA 5A4FS 4XIIA 3CCVQ 5FOTA 1W2GA 5LJ3j 4H7IA 3SXPA 3W6PA 2PD3A 3Q3GE 1SC4A 2C4UA 2H4XA 3TQIA 4UTVA 3V1YA 2NPIA 2CVOA 4G5RA 4HNRA 2Z95A 4E2YA 4JXJA 1E3SA 5J2TB 3FWZA 3V34A 4FYWB 1PWXA 3I37X 1KK7A 4UPEA 5FBRB 5THQA 2N0SA 1T9HA 3C1UA 2PS3A 1KAEA 4N5MA 3PXAA 1L5WA 2HGSA 4DNPA 4UTRA 2V4MA 4JJDA 3VPHA 1ZBXA 4M8SA 2ZI3A 2XB9A 2H2WA 2OCAA 4CWAA 2JI6A 2X3XD 3LCUA 4KRGA 1RL2A 3KNZA 4KH1A 1C0KA 4JLSA 1CDZA 4ON9A 2MSCB 1E4EA 4BKUA 4HL6A 7ABPA 4AKIA 3GK3A 1RLQC 4ZMBA 3JQEA 2BEWA 3OE4A 4FE7A 3C8MA 3KLPX 1D2MA 1E3LA 5B12A 5GMOA 5DI3A 4C7BA 1XK6A 4F16A 4W8OA 3BK2A 2JBWA 4NZZA 1R5JA 2BFDB 4GKAA 4MQEB 1E4VA 1TO2E 1WEKA 1T25A 2HRRA 4L9WA 4Q4HB 4LHVA 1JS1X 1BYMA 4OAOA 1TIBA 1R6AA 2JJQA 4GR4A 5F4BA 5IAOA 3EUAA 3LT0A 1MXHA 1ESNA 4X6YA 1XCJA 4BVHA 4FFNA 2W0SA 2PQWA 1IXZA 4R2XA 2AN3A 5KYXA 1YZ3A 4BU0A 2RH4A 1P9OA 4WI1A 1WP4A 3HLKA 4RDXA 4ZYYA 4FINA 5AKEA 1CUYA 1J0BA 5SZIA 5GJWC 3PGJA 1JHMA 3WZLA 5JAUA 2R85A 5EXTA 3S1LA 3BH7A 4PLWA 2Y4NA 4U8HA 3IPLA 1XMOB 3LY9A 1XTDA 2YBEA 1U6IA 2JHCA 3IGFA 4JY7A 5ITWA 4AMUA 3SXJA 4ZZ1A 4L5CA 2Z56A 1V3TA 2X42A 3K6RA 3I56A 3L2UA 2HDWA 3K1JA 1BXKA 3EXHA 3W4KA 1JH9A 4KFUA 2JASA 2XA2A 4N5NA 2PTHA 1R8QA 4ND4A 1F6DA 5GONF 1CP3A 4EPWA 1FXUA 3TQRA 1D09A 3QSYA 2FX2A 4AMYA 2QF7A 1Y6RA 3G2HA 3QSGA 1MF7A 4XSVA 4KR3A 4PFKA 1VCMA 4PHGA 4MGEA 4E5SA 3JY6A 3S2UA 2JCSA 4X0EA 1D0SA 3FH0A 1CF9A 2OGUA 2P6MA 4W5NA 3DTTA 5I8PA 1W7AA 5JSYA 3WNBA 2MT9A 3SJZA 1Z7WA 1AWJA 1M1NB 1L5MA 3D6VA 3QNWA 8ADHA 3L82B 5M29A 3HRHA 1VQNA 3KYDA 3PDHA 3PA6A 3ZY3A 3TIXB 4H77A 3DL7A 2IY9A 4CM5A 5EIXA 3SNHA 1Z0IA 4BEWA 1Q1ZA 2IYWA 3NEYA 2NAPA 3ZWKA 5E3JA 3JQFC 1IHWA 2QX9A 2YWDA 5K0LA 2NU8A 4LECA 2D4AA 4LMPA 4OHYA 3SVZA 3IPYA 5D7UA 4G07A 5LPNA 3TPFA 5K0CA 3LW7A 1K9MC 4RZIA 3PX2A 4Z99A 3VR1A 2W2KA 2ZUWA 1JFRA 2PX3A 5DO9A 4L51A 2XAAA 4A4FA 5ALDA 1ZD4A 5KHAA 3D3WB 3T7KA 4DDTA 3N07A 5LP6C 2XYRA 1D0VA 1C3OA 1RMYA 1XZPA 2CXSA 4PANA 3F8SA 4UNPA 2P2YA 5IK2A 1V1MA 1AKWA 3JCMh 5DI3B 2CNDA 1A9OA 2GLUA 4FOTA 5FLKA 4JNCA 5EWLB 4B6OA 1M34A 3AL3A 2XICA 4KVZA 2VZLA 2VDKB 1C29B 1VXRA 2PS9A 2JRLA 4K9SA 5KSOA 1X94A 3QYHB 2B7BA 1KK1A 1JPUA 4BNKA 1C9YA 1E0DA 3M82A 2FSGA 3Q9SA 5GANd 4XOUA 2FQ1A 3M5DA 3TCJA 4NARA 3KVRA 4MLDA 2ZAYA 3ASVA 4WDRA 3GBVA 5DBIA 3COZA 2YDLA 4EJ6A 3M1YA 4GOOD 5KYXB 1DBSA 1V7QA 1WI7A 1WPRA 4BL5A 3NORA 3W9UA 2LJ1A 1APBA 1N2BA 4BP8A 1QNFA 4F84A 2EQJA 3ULKA 3QLUC 1DWOA 2EAYA 4DY6A 1ULHA 3R7LA 2ZYRA 2GBPA 2X8AA 3DOCA 1WUKS 1JXMA 3L8YA 9ATCA 3R0JA 1GCQC 3W8EA 3ZHZA 1S8OA 2QJWA 3UFBA 4C7OA 1NBWB 2DH5A 4ELYC 3I4LA 2HYDA 3G6ET 4P38A