2RQRA

The solution structure of human dock2 sh3 domain - elmo1 peptide chimera complex
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
GSSGSSGRLLDLENIQIPDAPPPIPKEPSNYDFSGPSSGIEGRGSSGSSGSSGSSGDKERHGVAIYNFQGSGAPQLSLQIGDVVRIQETCGDWYRGYLIKHKMLQGIFPKSFIHIKEVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Engulfment and cell motility protein 1, linker, Dedicator of
publication title The solution structure of human DOCK2 SH3 domain - ELMO1 peptide chimera complex
rcsb
source organism Homo sapiens, synthetic, homo sapiens
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rqrA00
1W6XA 1HJDA 1NYGA 4RTWA 1UTIA 2JS2A 2JM8A 2RF0A 2DNUA 1X69A 2ROLA 2KRSA 1UHFA 2DL7A 4ESRA 1YP5A 2MCNA 2SEMA 3M0TA 1M3BA 1SSHA 2YSQA 1AWOA 2EYWA 2W10A 2PZ1A 3QWXX 4J9IA 2L0AA 2H8HA 4X1VA 5I11A 1WYXA 3VS3A 4RTXA 4D8KA 1PHTA 2ENMA 5FW9A 2JMCA 1JXMA 2DRKA 3VS7A 4F16A 2C0TA 1YWOA 2ABLA 2GGRA 1SPKA 2KROA 1YNZA 3UA7A 2K7AA 2LCSA 2F2VA 1NEBA 1AEYA 1GCQA 1ZSGA 3THKA 1NM7A 1WFWA 2RQVA 3EG3A 2AKKA 2M0YA 2SRCA 2RN8A 1G83A 2DE0X 2DF6A 2J05A 1KFZA 1NYFA 2JW4A 1QKXA 2J7IA 4IIMA 3A98A 2DL4A 1GRIA 2ED0A 1ZBJA 2CT3A 1JXOA 1NLPC 2HBWA 1V1CA 1X43A 2LP5A 3I35A 1PWTA 1VYTA 2J06A 2CUDA 5GJWB 2EKHA 3QWYA 4LUEA 3GBQA 2EGEA 4J9BA 3TVTA 2BTTA 1SEMA 1T3SA 3NGPA 1WA7A 3PE0A 2J6KA 1T0JA 4HVVA 4EIKA 2E5KA 1E6HA 2CT4A 2FEIA 1GCQC 4HXJA 4JJBA 4J9CA 2BZ8A 2W0ZA 2ESWA 1OEBA 3EHRA 2I0NA 4HVUA 1MV0B 1T3LA 2KXDA 2LMJA 2D0NA 2FPFA 1IO6A 1GBRA 4IIOA 2GNCA 1U3OA 2CSQA 3H0HA 2CH4W 4GBQA 2LX7A 1RUWA 1UUEA 1Z9ZA 5GJVB 1CSKA 3VS1A 1VA7A 4F17A 1BB9A 2HEQA 1TG0A 2CH4A 1KJWA 1CKAA 3M0UA 2L3PA 1ABQA 4J9GA 3ZL7C 2LQWA 4Z89A 2YUNA 1AZEA 1YWPA 2J6OA 1K9AA 3EG0A 3M0PA 2O31A 2FPDA 2YUQA 3SEMA 1K0SA 2GTJA 1ZLMA 5HCKA 4GLMA 2OJ2A 1Y57A 2LZ6B 4OMOA 4RTUA 2HDAA 2AZSA 2KT1A 1PNJA 4AFQC 1H3HA 3VS5A 4LE9A 2DYBA 2RQRA 2HCKA 1FMKA 4LUDA 2YT6A 1BBZA 1HD3A 1JO8A 1H8KA 1VYVA 1ZUYA 2CUBA 2MIOA 4DEXA 3PVQA 2YDLA 2YUPA 2X3WD 2O9SA 3M0RA 1AD5A 5IHNA 2L3SA 2EBPA 1ZUKA 5IHIA 3KFVA 2RNAA 2DMOA 4R0KA 3REAB 4Z88A 4Y92A 4KRTA 2FRYA 2GBQA 1UE9A 2NUZA 4WCIA 2JXBA 2RMOA 2LQNA 1WLPB 2P4RA 2K79A 2VVKA 4AFUC 2KYBA 2NWMA 2D1XA 1UECA 1E6GA 2DRMA 1WXBA 1K76A 3PVLA 1KSWA 3I5SA 3EHQA 4LNPA 1UJ0A 2B86A 1X6BA 4ORZA 1GCPA 1X2QA 1SHFA 3LH5A 2XMFA 2M51A 4JZ4A 5IXFA 1M30A 2JTEA 4FSSA 3VS0A 1GBQA 2YUOA 1G2BA 4J9DA 2V1RA 2KRNA 2AZVA 3IQLA 3UF4A 2DILA 1NEGA 2CREA 2ROTA 2EYZA 4OMMA 2G6FX 2DL5A 2BZXA 2JMAA 1B07A 5EC7A 3H41A 2EW3A 2KRMA 2RPNA 2VWFA 4D8DA 1WDXA 4CC3A 4M4ZA 2OI3A 4JPBW 3TSWA 2RQTA 1S1NA 1U5SA 2K2MA 2FRWA 1MV3A 4E6RA 1QCFA 1AVZC 2J6FA 5FWBA 1W70A 3JV3A 2EGAA 1OV3A 2IIMA 2RQWA 4K11A 1UFFA 2DX1A 1K0XA 1X2KA 2JM9A 2KNBB 1FYNA 2K6DA 2D8JA 3VS4A 1CKBA 2HSPA 2ECZA 1QLYA 1M3AA 2PTKA 2DLPA 2K3BA 4JJCA 3ULRB 2EGCA 3VS6A 4AG2C 2PNIA 1H92A 2BZYA 4OMQA 5IXBA 1KIKA 1XOVA 1OPLA 1I07A 1JQQA 2EVRA 1GL5A 4HVWA 1Y0MA 2C0OA 4OMLA 1NLOC 2EYXA 1OOTA 5FWCA 4HCKA 4RUGA 1RLQC 2C0IA 2DM1A 5I22A 1U06A 1QWFA 1W1FA 2KR3A 2KYMA 2OAWA 1SHGA 2EYYA 2D8HA 1NG2A 1UGVA 2FPEA 2VKNA 3I9QA 1PKTA 3VRZA 2DVJA 1QKWA 1E7OA 1ABOA 1YN8A 3NMZC 1LCKA 1ZUUA 1TUCA 2DJQA 2DL8A 4Z8AA 4CC7A 1I0CA 1RI9A 1SRLA 3RNJA 1UDLA 4F14A 2LNHB 4RTZA 2K9GA 3U23A 1TUDA 1QWEA 2DBMA 3REBB 3EGUA 2LJ1A 1PKSA 2FO0A 5IH2A 4CC4B 4AFSC 3M0QA 3SHWA 2KEAA 1M3CA 3UA6A 4DEYA 4AG1C 2L2PA 1BU1A 1JEGA 2ED1A 4LN2A 1WXUA 2LJ0A 2F2WA 3RBBB 1HSQA 1RLPC 2FG0A 1AZGB 1B3QA 1UG1A 1WXTA 2O9VA 1AWWA 3EG1A 2O2OA 3I5RA 4OMPA 2KE9A 4J9EA 3M0SA 1PRMC 1K1ZA 1T0HA 1OPKA 4JJDA 1AOJA 1WX6A 2V1QA 1Z9QA 2GQIA 4RTTA 2A08A 2AKLA 2KBTA 1BK2A 1WI7A 1UJYA 1N5ZA 4A63B 2LJ3A 4RTVA 4J9FA 5IHKA 2MOXA 3O5ZA 4CC2A 1X6GA 2QDLA 3C0CA 3VRYA 1ZX6A 2JT4A 2O88A 3R6NA 4AFZC 2EPDA 2A37A 4RTYA 4ZNXA 1AWXA 1M8MA 1X27A 2KT8A 4OMNA 2L3QA 3NPFA 1A0NB 1EFNA 1JU5C 1GFCA 1UHCA 3VS2A 1K4US 2EQIA 1PRLC 3H0IA 2X3XD 3NHNA 5L23A 5ECAA 2JS0A 2A36A 1YCSB 1M27C 2A28A 3H0FA 2DL3A 1WIEA 3TSZA 3FJ5A 2F2XA 2CSIA 3UATA 1J3TA 2DA9A 2AK5A 4J9HA 1MUZA 2CDTA 3CQTA 4JZ3A 2KXCA 2GTOA 1SRMA 4QT7A 2DBKA 2RQUA 2KGTA 1I1JA 1ARKA 1VYUA 3EG2A 1GFDA 1AWJA
chains in the Genus database with same CATH superfamily
1RI0A 1W6XA 2RK1A 3PNWC 3JCMb 2QA4T 2MWPA 5GAMe 4RTWA 2EQJA 2JS2A 2QQRA 2JM8A 4MDXA 2ROLA 4M7DA 1Y96B 3M56A 3CD6Q 4ESRA 1YP5A 4F7UB 4KGVB 4N4IA 2RHUA 4LDUA 5A2QE 2YSQA 1AWOA 2ZPIB 3VS3A 2H3JA 9ATCB 2CZ7B 1M2VB 2DRKA 4EMGA 3VS7A 4M78E 5M9OA 1YWOA 4PJOC 4JUVA 2P0QA 4PL6A 1G3TA 1Q86C 3OSVA 3M5AA 4ATOA 3CCLA 5GAN7 2MYSA 1NM7A 3JCMh 2AKKA 1K73R 2B8AA 5CK9A 1DJ7B 4BDYA 2DE0X 8AT1B 2DF6A 1B7TA 3R6OA 1NYFA 4BD3A 1UGSB 3OW2P 2E6NA 4M7DC 2CT3A 1JXOA 3E19A 1V1CA 2LP5A 1AHJB 3RDVA 3G71T 2J06A 3CBPA 2OTJA 5GJWB 5GAMg 2MI6A 3CBMA 5GAMd 1B34A 4LUEA 1VQPA 1R0BG 4MDWA 2BTTA 1SEMA 2BUDA 3TQ7P 1KD1R 2LTOA 1H641 4KGZB 3URGA 3CC7T 3LX7A 2E5KA 2L3RA 2DIQA 2CT4A 2FEIA 3QJ6A 3CCUT 4HXJA 4IUQA 4J9CA 2BZ8A 3EHRA 3EG9A 2DTIA 1MV0B 4FIBA 1HYOA 2LMJA 1SF9A 3CCJQ 1Q7YC 1GBRA 1IO6A 2GNCA 3SWNA 4BI8B 4PFOA 1M90R 1RAIB 4IKFA 2RJEA 1U1SA 2MF2A 2OTLA 3OSSC 3CPFA 4JLGA 3HRSA 1CSKA 1BB9A 1KK7A 2VXFA 2CH4A 3CCMQ 3GIBA 1CKAA 3M0UA 1FMWA 4Z89A 5A0LA 3GOXA 2WSCE 1AZEA 4XU0A 3EG0A 4FU6A 4ZGEB 1D3BA 3EH1A 3JB9H 2O31A 4M78B 2YUQA 2P0KA 3SEMA 4QVCA 5KYYA 2NYSA 3A8GB 1ZLMA 3WVEB 2OJ2A 2XK0A 4OMOA 3CCVA 4PFPA 2HDAA 3JCMP 3JCMQ 4GLKA 3OS0A 5GAN5 2HCKA 3SWNC 3QG1A 4OB3B 4II1A 1HD3A 2E65A 4WTOB 1VYVA 5L8RE 4LDWA 1K73U 4DBFA 2YHTA 3PVQA 1FWZA 1AD5A 2L3SA 3V8LA 5GAOn 1EIFA 3HRTA 5FLXE 4R0KA 3RERA 1M1FA 2JOYA 4Y92A 1BI3A 4KRTA 1ZA1B 5GMKj 3OA6A 1XJWB 3JCMc 3FC3A 4PJOD 1WLPB 2P4RA 2VVKA 1VQ9Q 1UECA 4IUUA 1E6GA 5CQXA 1K76A 5D6WA 5LJ5d 3CPWA 3WXMB 1Q81U 4OGCA 2WSFE 3EHQA 1PCXA 1UJ0A 4XU2A 2PVOB 5FU6C 4ZN3A 1X2QA 1RAEB 2HKNA 2XMFA 2PVGB 5DY9A 2P0PA 1N9RA 1G2BA 2KRNA 4BY6B 5FU6B 2NUPB 5GMKh 4XK8E 2KQWA 4QW2A 2CREA 1MNEA 3CEYA 1TWBA 3GLXA 2DL5A 3RIRA 1VQKQ 1TXQA 2JTFA 1M90U 2VWFA 1WDXA 4HKEA 4M4ZA 2OI3A 1OU9A 3N5BB 4JPBW 1Q82R 3Q1JA 4M7AG 1S1NA 3M54A 3CCST 1U5SA 4C8QG 1YJ9A 4E6RA 5C6SA 2DK3A 1N6AA 1QCFA 5FWBA 1IREB 2MAMA 4M75E 3JV3A 5GAOp 1D09B 2OAUA 3J7AF 2EGAA 2RJFA 2IIMA 2HQXA 3OMGA 1X2KA 1R8OB 2YXYA 2KNBB 1VQLA 4DBHA 2E4HA 1MHNA 4JDSA 3KXTA 2IVWA 1WZOA 3HP9A 3QIIA 1JBMA 5GMKm 4JS5A 2COWA 3L2WA 2EIFA 2RO0A 5LJ3f 2BZYA 4JRIA 3JB9G 5IXBA 2YWWA 3CCEA 1OPLA 3CMEA 3VYGA 3CC7Q 3P8DA 4ANJA 4OMLA 3RUXA 3HTRA 5LJ3j 3PIOA 2C0IA 1JB0E 2DM1A 3A8MB 3UWNA 3JCMe 4HA8A 4PJMA 1WJSA 2EYYA 1UGVA 2FPEA 1IHVA 3VRZA 2CP6A 3A8LB 5CCAA 4JRPA 2DFUA 2LC4A 1E7OA 1SG5A 1YN8A 5KCHA 2DJQA 1N27A 1UDLA 2RJCA 2CYZB 2DTOA 2LNHB 4RTZA 2K9GA 1TUDA 3CPWP 4M78G 3REBB 2LJ1A 1IB8A 4AT1B 4ZN1A 2KDSA 5LJ3h 4JS4A 3M0QA 4NOYA 1BCOA 5GAN4 2KEAA 3M4GA 4DEYA 4AG1C 1VIFA 1JEGA 3NFCA 2ZPGB 1FXXA 4LN2A 3OMCA 4KH0B 2F2WA 2K3YA 3ZBDA 1HSQA 3A1PA 2FG0A 1YIJQ 1B3QA 1WXTA 5HKCA 1AWWA 3I5RA 3PFSA 2KE9A 4J9EA 4OB2B 1YJWQ 2QQBA 5A0GA 1T0HA 1RAHB 3H8ZA 1Z9QA 4ZGJB 2GQIA 1RACB 3A5ZB 3GPLA 2AKLA 1NBEB 2KBTA 4RKUE 3MEWA 3QDRB 4C0DB 1VQMQ 1UJYA 3JCMd 3FIFA 2LX9A 4XTWA 3C0CA 2XDPA 2JT4A 2QAZA 2EYQA 4BDZA 2DD4A 4B9WA 2YRCA 4RTYA 1X27A 1M8MA 1X75C 3P8BB 1QVGP 5KCOA 2E12A 1EFNA 5LJ5f 4XU1A 3G6EQ 3CCQQ 2EQIA 5CO7A 2X3XD 3EGXA 5D6XA 2QTXA 3CC4Q 5L23A 5ECAA 5KE2A 2A28A 2EFIA 1YJNT 4XTXA 4BB7A 3FJ5A 4XAXB 2FZGB 2KK4A 2CSIA 3RKWA 4J9HA 3EH2A 1JRIA 5KYUB 3CQTA 4JZ3A 4CRIA 3BDUA 2F69A 3J81E 1VQ4A 5EG2A 3I55A 2KGTA 4J6XA 1VYUA 3EG2A 1I5OB 4M7AF 1LJOA 1VQ6A 4C8QF 2RF0A 2HQHA 4OB0B 4KGXB 3ME9A 2JJ9A 2EQKA 2MCNA 2BIVA 3QWXX 4J9IA 4X1VA 4R55A 2E5QA 1YHQT 2JTMA 1PHTA 2XI9A 4DA4A 1JXMA 2C0TA 1YFNA 2ABLA 3CC2Q 4F7UE 2X4WA 5LL6S 3CD6A 2FZCB 3J80E 3JB9F 1SPKA 2KROA 1YNZA 4Q5WA 2NLUA 2F2VA 1NEBA 5J39A 3THKA 2Z0WA 3S3NA 1WFWA 2Y4XA 3EG3A 1VOMA 3QSUA 1OZ3A 4N4GA 4QQ6A 1PD1A 3EGDA 2RB6A 4F04B 3PMTA 2J05A 1KFZA 2PUKB 1ZBXA 4BE2A 3MP6A 2A3LA 1PC0A 2JW4A 1QMCA 4PJOE 2LQ8A 2DL4A 3CCRQ 2BE7D 1ZBJA 2D0QB 1W4SA 2ZGWA 1U8RA 3OYLA 1WHLA 2M02A 4BI4A 1O9SA 2CUDA 2HMAA 2QG9B 2LT4A 2COYA 2ZPHB 3GBQA 3OW2A 2WSEE 2EGEA 3RMQA 4VUBA 2FVUA 3JB9I 4IUPA 4ZGDB 3NGPA 3C4SA 4HVVA 3ASKA 3WVDB 1E6HA 1N8RR 1X01A 3V8JA 5GAOq 4M7DE 4J83A 2HL3A 1OEBA 5I2SA 1KC8R 1T3LA 4KBMB 2KY9A 3JB9J 1QW1A 2QYZA 4LDVA 4DQ2A 1ZSZA 3CMAQ 3CXCA 2QTVA 1U3OA 3QDFA 3H0HA 4M75G 5CIUA 2BE9B 2CH4W 4LXCA 4GBQA 1RUWA 1PD0A 1UUEA 3VS1A 1VA7A 2RI3A 3HFOA 3CCJA 1VQ8Q 1M1KR 1KJWA 1Y07A 1LOJA 2EJGA 2PQWA 2L3PA 1ABQA 3ZL7C 2YUNA 4N4HA 4EMHA 1VQOQ 4C92G 2CP5A 2RHXA 1P92A 3META 4JJNK 2O4XA 3MEVA 5LJ3e 1UGRB 3CCMA 2E6ZA 2JVVA 4GLMA 2QDYB 4FYXB 1Y57A 2LZ6B 1MMDA 2E41A 1YCYA 4M7AA 1PNJA 4AFQC 2OTJT 4C8QA 4LE9A 2DYBA 4J7IA 4XQ3A 2ZPBB 2LCLA 1ZSZC 1VQPT 1BBZA 3V7RA 4DEXA 5D7UA 3E9GA 3LWHA 4EMKC 4PJOB 1RADB 1ZUKA 3ZFJA 2RH2A 2DMOA 3VJPA 1O75A 4OB1B 2FRYA 3OB9A 2GBQA 2K3XA 3OBYA 4A4GA 4B9XA 7AT1B 2Y4YA 2LQNA 4EMKB 1IGUA 2QXFA 2M16A 2KYBA 2NWMA 2OTLT 4IUTA 3PTAA 2DRMA 2R5MA 2CS7A 1WHGA 1NJIC 4DOVA 2CZ6B 1X6OA 4NS5A 1GCPA 1QCOA 3LH5A 4M7DB 2M51A 4C8QC 5CKBA 2E3HA 2JTEA 1VQ9A 4J9DA 4MZTA 2V1RA 3L1AA 5LJ3d 1YITQ 3IQLA 3LW5E 3UF4A 3CXCP 3M9QA 4XTUA 2OX7A 2EYZA 1VQNQ 4OMMA 2PU9B 5EC7A 1B07A 2IPOB 4XTZA 1M2OA 4J7FA 2EW3A 2DPPB 3PT9A 4BE1A 5GMKl 4V2SA 4CC3A 3CCVT 3OYFA 2RHZA 4RCCA 1R77A 2RQTA 2PVDB 1K9MC 4M77F 2FRWA 3C94A 3UDCA 1VQKA 1M1KU 1W70A 3HHTB 3QZ9B 3BDLA 1WPYA 2RQWA 2DXTA 1YI2Q 1PSEA 1K0XA 1ZQ1A 5LJ5e 3MHXA 5GAOr 4KUDK 1VQ5Q 2K6DA 1G8XA 2E64A 1CKBA 2HSPA 2D6FA 2YLCA 1WJQA 2DLPA 4JJCA 2QEXQ 2EGCA 4J5YA 2PNIA 2DJZA 4PFZA 3I56Q 1WJRA 2YRDA 3GF5A 1W2BS 1GL5A 1Y0MA 4BACA 1NLOC 4C0ZA 2EYXA 1QP3A 3QHSA 1VQ7T 1UGPB 1B34B 4O6JA 1RLQC 1Q86R 5DLQE 3G4ST 2DEQA 2K5IA 2VKNA 3CC7A 1KQ1A 3MPUB 1QKWA 1IRXA 3EG9B 1ZUUA 1TUCA 1KHCA 5CAIA 2MMPA 2MPXC 2DXBA 3SWNB 2DBMA 2RHYA 3BFMA 1GXIE 1PKSA 2FO0A 4F7UG 4C92F 2CP2A 4AFSC 2JNGA 1S72T 2QA4Q 4EPCA 1YJ9T 2YRVA 2LJ0A 1C1AA 3RBBB 2H3EB 5LJ5g 1RLPC 1PSFA 2FZKB 1UG1A 4OMPA 1C6VX 4XU3A 3EFOA 3DB3A 1VQLT 3MJXA 1PRMC 1D3BB 1KD1U 1OPKA 4PJOG 1WX6A 2L89A 5KYYB 1K8AC 2DKGA 1TH7A 1YIJA 2EWNA 4J6YA 4DBQA 3CCET 1BYMA 1M4ZA 2ZAEA 2A08A 3CMET 1IGQA 1BK2A 4M7DD 3LH0A 2RJDA 1BIAA 1YJWA 1Q7YR 3A8HB 2RK2A 1RL2A 3TEEA 1N5ZA 4A63B 5KYWA 5CVIA 2LJ3A 1Y7XA 2LRQA 5IHKA 4OMFB 1JJ2P 2DYIA 2JN0A 3LGLA 1AWXA 4OMNA 2L3QA 3NPFA 1VQMA 2R57A 1D0XA 1IXDA 2EQMA 1K4US 2DXUA 1UB4A 4X34A 5GMKi 3G71Q 3E2UA 8ATCB 1YCSB 1M27C 4M77A 2DL3A 1WIEA 4N0AA 3TSZA 1QVGA 1OQKA 2GCXA 2F2XA 2KVQG 3G6EA 3CCQA 2NUTA 3HL8A 3T9NA 1MUZA 3CC4A 1Q86U 4R56A 3CCUQ 4QT7A 1TUGB 3EAEA 5GANf 1AWJA 1D1AA 4A4FA 1D0ZA 2COZA 2A0FB 2DNUA 4C5GA 2KRSA 5GANj 2C06A 4OP0A 2LT1A 2SEMA 1WGSA 3M0TA 1SSHA 3MO8A 1UGQB 2W10A 3GP8A 1OZ2A 2PZ1A 2XG8D 2L0AA 2H8HA 4HT9A 1WYXA 2RA2A 3M57A 2RI2A 2ENMA 2JMCA 3VYHB 2QGFB 2GGRA 1D1CA 4M77C 1QP2A 2K2VA 3UA7A 3DB4A 2K7AA 2QGGA 2LCSA 4M77B 2SRCA 5GANh 3VV0A 3CC2A 2RN8A 1TS9A 3VU3C 3V7CA 3ZEHA 1VQ7Q 3S6WA 4C92A 5IT9E 2DTHA 3LYIA 2J7IA 4IIMA 3A98A 1GRIA 1Q7YU 2ED0A 2JZ2A 1QVFA 2LDMA 1NLPC 3QZ5B 1I4K1 1X43A 1D0YA 3I35A 3RMSA 1Q82U 3G1JA 3JCMg 4AMCA 1D1BA 4F7UF 1VQ4T 3I55T 3L2VA 3CCRA 3QWYA 4MMKA 2QQ9A 3X24B 2M1HA 1VQ6T 3TCJA 2J6KA 2HNIA 3L2UA 3CPWS 3FDRA 1NPPA 2WACA 4QVZA 2I0NA 2VGMA 4HVUA 1WQWA 2D0NA 3HPWA 2LQKA 1VUBA 2FPFA 4C92C 4IIOA 2ZPFB 3CD6T 1XQHA 4E7SA 1R0CB 4QKUA 1QQJA 3V8KA 2DVEA 2ATCB 1NPRA 3CMAA 3QYHB 4J9GA 2LQWA 2X51A 1BI1A 1G3WA 1H3ZA 4P5NA 2V26A 1K9AA 2ZZDA 2VGNA 3CCSQ 2P4TA 2FPDA 4RCBA 1VQ8A 2GTJA 4KULA 3OYDA 4ZTFA 1RABB 4X9DA 1VQOA 5KYXA 1TOVA 4E7IA 4MZMA 3SFMA 1H3HA 3MEUA 4LD6A 1QVGS 1NZ9A 2AT1B 2YT6A 2E10A 5GAN8 3SB2A 1JO8A 3JCMW 2CZ1B 2V8IA 4E47A 5KE3A 2RHIA 3EFSA 2CKKA 3EGXB 2MIOA 2HSEB 2X3WD 2YUPA 3M0RA 2EBPA 1QVFP 4FW2A 5IHIA 3KFVA 1M9SA 3REAB 4Z88A 3KUFA 5GMKe 3C95A 1YBYA 2DZCA 2F5KA 4WCIA 2JXBA 4FT2A 2AHJB 2IG0A 1V29B 4M77D 2QASA 3V7SA 2K79A 3QYGB 1OX9A 2D1XA 3RKXA 4YTLA 1WXBA 3PVLA 2E3IA 4C0FA 4LNPA 2B86A 3OYNA 1X6BA 4ORZA 4M78F 3MCAB 1SHFA 1K73C 2XU8A 5IXFA 1KQSP 1M30A 4FCYA 1GBQA 2YUOA 2DZ9A 5GAN2 2VUBA 1MMNA 5I2MA 4X9CA 2DILA 3X28B 5GAN3 2ROTA 5CKHA 2LCCA 2BZXA 2JMAA 1Y96A 1VIEA 5IN1A 2DD5A 5CR2A 3CCMT 4A4HA 4F7UA 2KRMA 3EFRA 5CKFA 2E70A 2I2LA 1QVPA 3TSWA 1YITA 1M2VA 2K2MA 4C8QE 1Q81C 5FU7C 1VQNA 1WHMA 2QI2A 2J6FA 3EGDB 4L6V5 3CCLT 1KD1C 4K11A 2DX1A 2K5LA 2JM9A 3QKJA 2DEUA 1ZHIA 3X26B 1FYNA 2GFUA 4ZTJA 2ECZA 1QLYA 1M3AA 2PTKA 1G3YA 5KH6A 3ULRB 1H92A 2M9UA 2VXEA 1KIKA 1V76A 1XOVA 1YI2A 1I07A 2XDDA 1ACMB 1M90C 2EVRA 4PJLA 2C0OA 5A0DA 1VQ5A 2AIRB 4HT8A 4WF2A 4JLIA 4E7ZA 5I22A 1U06A 2QEXA 1QWFA 1W1FA 2OAWA 2ZPEB 3I56A 3G7ZA 5GANe 2D8HA 1YJNQ 1VQ9T 3OYAA 2DVJA 1ABOA 1LCKA 3UPUA 4Z8AA 2DL8A 5DM7R 2HQEA 1I0CA 1PG5B 1UEBA 1SRLA 4F14A 4Z02A 2DETA 1BCMA 1ZSZB 3INZA 5IH2A 1XTDA 2MK5A 1M3CA 3UA6A 1WQ7A 2RI5A 4ELYC 2RM4A 1Y71A 1BU1A 2L2PA 2P84A 2HAXA 2ED1A 4E2FB 3OYKA 1WXUA 5GAN6 3FEOA 2DERA 5CKDA 1VQKT 3FRNA 3FB9A 2XD0A 3JAME 3OS2A 2CGHA 1I8FA 1AZGB 3M4YA 2O9VA 2MWOA 1YHQQ 3OBWA 2QA4A 4FW1A 2EJFA 2O4XB 4M7AC 3OYIA 4RG2A 4MMLA 3KBGA 4JJDA 1AOJA 3M59A 1N8RU 2V1QA 3S3OA 4PLIA 5LJ3g 2KMTA 2D9TA 3A8OB 1KC8U 4NL3A 4M7AB 5GAOm 4M78A 4C8QB 2M0OA 4XTVA 1PM3A 2K57A 1W2BP 1Q81R 4RTVA 1BI0A 5GANg 3OY9A 5GANd 2MOXA 4CC2A 4UC4A 1X6GA 2QDLA 5J3BA 3VRYA 1ZX6A 4HCCA 2K5FA 2EPDA 2A37A 4ZNXA 4EDUA 2YLBA 4OVAA 1A0NB 3VUZA 1JU5C 1GFCA 1UHCA 3VS2A 4PNOA 3H0IA 4PK4A 1KG1A 2JS0A 2A36A 5HY6A 1JJ2A 1M5Q1 3H0FA 3OW2S 2LNVA 4KUIA 5C0MA 2X4YA 3QPHA 2V8KA 3UATA 1J3TA 1Q82C 3MKDA 2DXCA 2AK5A 3G71A 2KXCA 4PJJA 4OF1A 3VUBA 4A54A 2VASA 4M78C 3LWIA 2RQUA 3HKSA 1I1JA 3F70A 4RMOA 5J26A 1GFDA 4EIKA 1HJDA 2HZYA 1WHKA 3CXCS 1NYGA 4L59A 1UTIA 1BIBA 1X69A 1MMAA 4M75F 1UHFA 2DL7A 3CCUA 2EAYA 3OYJA 1M3BA 1YIJT 3MEAA 2EYWA 5I11A 3CCLQ 1OYXA 3NTHA 2NUPA 4RTXA 2GF7A 3E9FA 4D8KA 1ZA2B 1YJWT 5FW9A 4F16A 2F1LA 3PIPA 2QQAA 3LLRA 4A4KA 2LVMA 1TU0B 2EKOA 2FHDA 1NJIR 1AEYA 1GCQA 1ZSGA 4PKCC 2RQVA 1G3SA 3M58A 2EJ9A 3OQ5A 1VQMT 2M0YA 3DLLA 2DO3A 1M8VA 2GFAA 1G83A 4IUVA 1G5VA 1C0MA 3OYHA 4TVRA 2OTJQ 3OYGA 4ME7A 1QKXA 3TREA 4M77E 1MMGA 4L5GA 1VQPQ 3G6ET 2HBWA 3O8VA 3CCQT 5FRMA 1VQ7A 3CC4T 1FMVA 1PWTA 1SSFA 1VYTA 2L8DA 3RR6A 4BY6C 3G4SA 2XKOC 1BKBA 1M1GA 4C5EA 3E1SA 1K9MR 2CZ0B 3M55A 2EKHA 1WNLA 4M7AD 4J9BA 2JUFA 3TVTA 4C8QD 2R5AA 1RAFB 1T3SA 1WA7A 2K4YA 3PE0A 4C5HA 1T0JA 2RD1A 4GY5A 2HBPA 3QJYA 3JRZA 1GCQC 3M53A 2OTLQ 4JJBA 3FLGA 4M7DG 3NTKA 2W0ZA 1FX7A 2ESWA 2X4JA 1LNXA 4MZPA 2X35A 2KXDA 2PUOB 1S72A 2X4XA 3QBYA 1IZ6A 5IAYA 3RESA 3UT1A 1OU8A 3JB9D 3JCMV 2CSQA 3SDZA 4BE0A 2LX7A 2XICA 3TU4K 1Z9ZA 3HFNA 4LDXA 5GJVB 1TTHB 4KT0E 4F17A 3EFOB 2HEQA 3OYYA 2X9HA 1TG0A 3L2QA 4QQDA 3L42A 5GAMf 3CC2T 2EQUA 3BE3A 2XDBA 3CCVQ 4C92E 4C5IA 1YWPA 2J6OA 3M0PA 2FB7A 5GAMj 3OS1A 1K0SA 3FJPA 1F1BB 5KYWB 5HCKA 5AT1B 2HD0A 4FYYB 4RTUA 1JJ2S 2AZSA 4M78D 2KT1A 3JCMX 3VS5A 3QO3A 1NE8A 4OGEA 3CCSA 1NJIU 2RQRA 5CKEA 3SD4A 3PMIA 1FMKA 4FYVB 4LUDA 4M75A 3CCRT 4N0AC 2DIGA 3NTIA 1H8KA 3OYBA 1BI2A 1ZUYA 4KH1B 2CUBA 2E1HA 1U1TA 2YDLA 2O9SA 5IHNA 1IHWA 5GAMh 3OYMA 3HSBA 2RNAA 3AT1B 1N9SA 4HCBA 2GQVA 1K8AR 3D7SB 3G4SQ 4Y28E 1UE9A 2HL5C 2NUZA 2RMOA 2NUTB 2VB6A 4AFUC 5FRNA 4O5VA 1K9MU 2G3RA 1KSWA 3I5SA 5KYUA 2O01E 3P8HA 3CMAT 4C0DC 4JZ4A 2KAFA 4FL6A 4FSSA 3VS0A 4JRQA 4M75C 1S72Q 2AZVA 5FROA 2XIDA 3JSCA 1NEGA 1YJ9Q 3S3MA 2G6FX 1VQ8T 4RG8A 3H41A 3OYEA 4FYWB 2A7YA 1I81A 4M75B 2RPNA 2VYTA 4D8DA 3OYCA 1KQSA 1VQOT 1VQLQ 3LGFA 2F5TX 4JRKA 4PJOF 4LD9K 1OULA 4J6WA 1MV3A 3MP8A 1AVZC 4C92B 3CCEQ 1OX8A 1OV3A 1UFFA 3CMEQ 3GNFB 1N8RC 2D8JA 3VS4A 2QQSA 5LJ5j 1KC8C 3BW1A 4LDYA 4E7KA 2K3BA 3VS6A 4AG2C 5I21A 4OMQA 1JQQA 4HVWA 5DLOA 3DLMA 1I5LA 4M7DF 4E7JA 1Q95G 1OOTA 2DAQA 5FWCA 4HCKA 4E7HA 4RUGA 2ZCFB 2KR3A 2KYMA 1SHGA 2L5QA 3L2ZA 5CQYA 1M1KC 2VV5A 1NG2A 3VKIA 4C0GA 3I9QA 1PKTA 3ER0A 5LJ5h 1XNIA 4DOWA 4ELZC 3NMZC 4FT4A 4CC7A 2BKDN 1RI9A 3RNJA 1K8AU 3U23A 3X20B 1QWEA 3H9NA 1HXDA 4CI0C 3EGUA 1YJNA 4CC4B 2R58A 4DBRA 3SHWA 1YITT 2FL7A 4PJNA 2VC8A 1WHJA 3L2RA 1VQNT 5GAOl 2HKQB 2XHCA 1RAAB 4HCZA 1AT1B 4FM4B 4BI3A 3AHUA 1EZZB 1LVKA 5HK3A 3EG1A 2O2OA 3CBOA 3CCJT 3M0SA 4FSXA 4D6WA 5HK0A 1K1ZA 1QCNA 4QVDA 4M77G 4QQGA 2CP7A 3HRUA 4RTTA 3OS5A 2KI7A 1YI2T 5KYXB 1YHQA 1WI7A 1MGQA 6AT1B 1VQ5T 4A53A 5D6YA 4B6MA 1EX4A 3QUIA 4J9FA 2QEXT 3O5ZA 2QK0A 1MNDA 2O88A 3I56T 3DKMA 3R6NA 4AFZC 4M7AE 1HK9A 4BUGA 5KYNA 3QXEB 4E7LA 2KT8A 1KHIA 1WHHA 4M75D 1QVFS 1TSFA 3RKYA 1W2BA 1LPLA 3JCMJ 4IURA 2CP3A 5AYFA 1SKUB 1PRLC 3NHNA 1OI1A 3X25B 2CP0A 5FU7B 4PJOA 1VQ4Q 3C12A 2Y90A 3I55Q 4C92D 4XTYA 4PLLA 4NL2A 1RAGB 2DA9A 3BY7A 1VQ6Q 4Y91A 2KSSA 1KQ2A 4EMKA 2CDTA 3H6ZA 3MP1A 3JCMf 2GTOA 1SRMA 2V8JA 2FYKA 1KQSS 2DBKA 3PGGA 4A4EA 1ARKA 4J8OA 3GNGA
chains in the Genus database with same CATH topology
1W6XA 1HJDA 1NYGA 4RTWA 1UTIA 2JS2A 2JM8A 2RF0A 2DNUA 1X69A 2ROLA 2KRSA 1UHFA 2DL7A 4ESRA 1YP5A 2MCNA 2SEMA 3M0TA 1M3BA 1SSHA 2YSQA 1AWOA 2EYWA 2W10A 2PZ1A 3QWXX 4J9IA 2L0AA 2H8HA 4X1VA 5I11A 1WYXA 3VS3A 4RTXA 4D8KA 1PHTA 2ENMA 5FW9A 2JMCA 1JXMA 2DRKA 3VS7A 4F16A 2C0TA 1YWOA 2ABLA 2GGRA 1SPKA 2KROA 1YNZA 3UA7A 2K7AA 2LCSA 2F2VA 1NEBA 1AEYA 1GCQA 1ZSGA 3THKA 1NM7A 1WFWA 2RQVA 3EG3A 2AKKA 2M0YA 2SRCA 2RN8A 1G83A 2DE0X 2DF6A 2J05A 1KFZA 1NYFA 2JW4A 1QKXA 2J7IA 4IIMA 3A98A 2DL4A 1GRIA 2ED0A 1ZBJA 2CT3A 1JXOA 1NLPC 2HBWA 1V1CA 1X43A 2LP5A 3I35A 1PWTA 1VYTA 2J06A 2CUDA 5GJWB 2EKHA 3QWYA 4LUEA 3GBQA 2EGEA 4J9BA 3TVTA 2BTTA 1SEMA 1T3SA 3NGPA 1WA7A 3PE0A 2J6KA 1T0JA 4HVVA 4EIKA 2E5KA 1E6HA 2CT4A 2FEIA 1GCQC 4HXJA 4JJBA 4J9CA 2BZ8A 2W0ZA 2ESWA 1OEBA 3EHRA 2I0NA 4HVUA 1MV0B 1T3LA 2KXDA 2LMJA 2D0NA 2FPFA 1IO6A 1GBRA 4IIOA 2GNCA 1U3OA 2CSQA 3H0HA 2CH4W 4GBQA 2LX7A 1RUWA 1UUEA 1Z9ZA 5GJVB 1CSKA 3VS1A 1VA7A 4F17A 1BB9A 2HEQA 1TG0A 2CH4A 1KJWA 1CKAA 3M0UA 2L3PA 1ABQA 4J9GA 3ZL7C 2LQWA 4Z89A 2YUNA 1AZEA 1YWPA 2J6OA 1K9AA 3EG0A 3M0PA 2O31A 2FPDA 2YUQA 3SEMA 1K0SA 2GTJA 1ZLMA 5HCKA 4GLMA 2OJ2A 1Y57A 2LZ6B 4OMOA 4RTUA 2HDAA 2AZSA 2KT1A 1PNJA 4AFQC 1H3HA 3VS5A 4LE9A 2DYBA 2RQRA 2HCKA 1FMKA 4LUDA 2YT6A 1BBZA 1HD3A 1JO8A 1H8KA 1VYVA 1ZUYA 2CUBA 2MIOA 4DEXA 3PVQA 2YDLA 2YUPA 2X3WD 2O9SA 3M0RA 1AD5A 5IHNA 2L3SA 2EBPA 1ZUKA 5IHIA 3KFVA 2RNAA 2DMOA 4R0KA 3REAB 4Z88A 4Y92A 4KRTA 2FRYA 2GBQA 1UE9A 2NUZA 4WCIA 2JXBA 2RMOA 2LQNA 1WLPB 2P4RA 2K79A 2VVKA 4AFUC 2KYBA 2NWMA 2D1XA 1UECA 1E6GA 2DRMA 1WXBA 1K76A 3PVLA 1KSWA 3I5SA 3EHQA 4LNPA 1UJ0A 2B86A 1X6BA 4ORZA 1GCPA 1X2QA 1SHFA 3LH5A 2XMFA 2M51A 4JZ4A 5IXFA 1M30A 2JTEA 4FSSA 3VS0A 1GBQA 2YUOA 1G2BA 4J9DA 2V1RA 2KRNA 2AZVA 3IQLA 3UF4A 2DILA 1NEGA 2CREA 2ROTA 2EYZA 4OMMA 2G6FX 2DL5A 2BZXA 2JMAA 1B07A 5EC7A 3H41A 2EW3A 2KRMA 2RPNA 2VWFA 4D8DA 1WDXA 4CC3A 4M4ZA 2OI3A 4JPBW 3TSWA 2RQTA 1S1NA 1U5SA 2K2MA 2FRWA 1MV3A 4E6RA 1QCFA 1AVZC 2J6FA 5FWBA 1W70A 3JV3A 2EGAA 1OV3A 2IIMA 2RQWA 4K11A 1UFFA 2DX1A 1K0XA 1X2KA 2JM9A 2KNBB 1FYNA 2K6DA 2D8JA 3VS4A 1CKBA 2HSPA 2ECZA 1QLYA 1M3AA 2PTKA 2DLPA 2K3BA 4JJCA 3ULRB 2EGCA 3VS6A 4AG2C 2PNIA 1H92A 2BZYA 4OMQA 5IXBA 1KIKA 1XOVA 1OPLA 1I07A 1JQQA 2EVRA 1GL5A 4HVWA 1Y0MA 2C0OA 4OMLA 1NLOC 2EYXA 1OOTA 5FWCA 4HCKA 4RUGA 1RLQC 2C0IA 2DM1A 5I22A 1U06A 1QWFA 1W1FA 2KR3A 2KYMA 2OAWA 1SHGA 2EYYA 2D8HA 1NG2A 1UGVA 2FPEA 2VKNA 3I9QA 1PKTA 3VRZA 2DVJA 1QKWA 1E7OA 1ABOA 1YN8A 3NMZC 1LCKA 1ZUUA 1TUCA 2DJQA 2DL8A 4Z8AA 4CC7A 1I0CA 1RI9A 1SRLA 3RNJA 1UDLA 4F14A 2LNHB 4RTZA 2K9GA 3U23A 1TUDA 1QWEA 2DBMA 3REBB 3EGUA 2LJ1A 1PKSA 2FO0A 5IH2A 4CC4B 4AFSC 3M0QA 3SHWA 2KEAA 1M3CA 3UA6A 4DEYA 4AG1C 2L2PA 1BU1A 1JEGA 2ED1A 4LN2A 1WXUA 2LJ0A 2F2WA 3RBBB 1HSQA 1RLPC 2FG0A 1AZGB 1B3QA 1UG1A 1WXTA 2O9VA 1AWWA 3EG1A 2O2OA 3I5RA 4OMPA 2KE9A 4J9EA 3M0SA 1PRMC 1K1ZA 1T0HA 1OPKA 4JJDA 1AOJA 1WX6A 2V1QA 1Z9QA 2GQIA 4RTTA 2A08A 2AKLA 2KBTA 1BK2A 1WI7A 1UJYA 1N5ZA 4A63B 2LJ3A 4RTVA 4J9FA 5IHKA 2MOXA 3O5ZA 4CC2A 1X6GA 2QDLA 3C0CA 3VRYA 1ZX6A 2JT4A 2O88A 3R6NA 4AFZC 2EPDA 2A37A 4RTYA 4ZNXA 1AWXA 1M8MA 1X27A 2KT8A 4OMNA 2L3QA 3NPFA 1A0NB 1EFNA 1JU5C 1GFCA 1UHCA 3VS2A 1K4US 2EQIA 1PRLC 3H0IA 2X3XD 3NHNA 5L23A 5ECAA 2JS0A 2A36A 1YCSB 1M27C 2A28A 3H0FA 2DL3A 1WIEA 3TSZA 3FJ5A 2F2XA 2CSIA 3UATA 1J3TA 2DA9A 2AK5A 4J9HA 1MUZA 2CDTA 3CQTA 4JZ3A 2KXCA 2GTOA 1SRMA 4QT7A 2DBKA 2RQUA 2KGTA 1I1JA 1ARKA 1VYUA 3EG2A 1GFDA 1AWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W6X A;  1HJD A;  1NYG A;  4RTW A;  1UTI A;  2JS2 A;  2JM8 A;  2RF0 A;  2DNU A;  1X69 A;  2ROL A;  2KRS A;  1UHF A;  2DL7 A;  4ESR A;  1YP5 A;  2MCN A;  2SEM A;  3M0T A;  1M3B A;  1SSH A;  2YSQ A;  1AWO A;  2EYW A;  2W10 A;  2PZ1 A;  3QWX X;  4J9I A;  2L0A A;  2H8H A;  4X1V A;  5I11 A;  1WYX A;  3VS3 A;  4RTX A;  4D8K A;  1PHT A;  2ENM A;  5FW9 A;  2JMC A;  1JXM A;  2DRK A;  3VS7 A;  4F16 A;  2C0T A;  1YWO A;  2ABL A;  2GGR A;  1SPK A;  2KRO A;  1YNZ A;  3UA7 A;  2K7A A;  2LCS A;  2F2V A;  1NEB A;  1AEY A;  1GCQ A;  1ZSG A;  3THK A;  1NM7 A;  1WFW A;  2RQV A;  3EG3 A;  2AKK A;  2M0Y A;  2SRC A;  2RN8 A;  1G83 A;  2DE0 X;  2DF6 A;  2J05 A;  1KFZ A;  1NYF A;  2JW4 A;  1QKX A;  2J7I A;  4IIM A;  3A98 A;  2DL4 A;  1GRI A;  2ED0 A;  1ZBJ A;  2CT3 A;  1JXO A;  1NLP C;  2HBW A;  1V1C A;  1X43 A;  2LP5 A;  3I35 A;  1PWT A;  1VYT A;  2J06 A;  2CUD A;  5GJW B;  2EKH A;  3QWY A;  4LUE A;  3GBQ A;  2EGE A;  4J9B A;  3TVT A;  2BTT A;  1SEM A;  1T3S A;  3NGP A;  1WA7 A;  3PE0 A;  2J6K A;  1T0J A;  4HVV A;  4EIK A;  2E5K A;  1E6H A;  2CT4 A;  2FEI A;  1GCQ C;  4HXJ A;  4JJB A;  4J9C A;  2BZ8 A;  2W0Z A;  2ESW A;  1OEB A;  3EHR A;  2I0N A;  4HVU A;  1MV0 B;  1T3L A;  2KXD A;  2LMJ A;  2D0N A;  2FPF A;  1IO6 A;  1GBR A;  4IIO A;  2GNC A;  1U3O A;  2CSQ A;  3H0H A;  2CH4 W;  4GBQ A;  2LX7 A;  1RUW A;  1UUE A;  1Z9Z A;  5GJV B;  1CSK A;  3VS1 A;  1VA7 A;  4F17 A;  1BB9 A;  2HEQ A;  1TG0 A;  2CH4 A;  1KJW A;  1CKA A;  3M0U A;  2L3P A;  1ABQ A;  4J9G A;  3ZL7 C;  2LQW A;  4Z89 A;  2YUN A;  1AZE A;  1YWP A;  2J6O A;  1K9A A;  3EG0 A;  3M0P A;  2O31 A;  2FPD A;  2YUQ A;  3SEM A;  1K0S A;  2GTJ A;  1ZLM A;  5HCK A;  4GLM A;  2OJ2 A;  1Y57 A;  2LZ6 B;  4OMO A;  4RTU A;  2HDA A;  2AZS A;  2KT1 A;  1PNJ A;  4AFQ C;  1H3H A;  3VS5 A;  4LE9 A;  2DYB A;  2RQR A;  2HCK A;  1FMK A;  4LUD A;  2YT6 A;  1BBZ A;  1HD3 A;  1JO8 A;  1H8K A;  1VYV A;  1ZUY A;  2CUB A;  2MIO A;  4DEX A;  3PVQ A;  2YDL A;  2YUP A;  2X3W D;  2O9S A;  3M0R A;  1AD5 A;  5IHN A;  2L3S A;  2EBP A;  1ZUK A;  5IHI A;  3KFV A;  2RNA A;  2DMO A;  4R0K A;  3REA B;  4Z88 A;  4Y92 A;  4KRT A;  2FRY A;  2GBQ A;  1UE9 A;  2NUZ A;  4WCI A;  2JXB A;  2RMO A;  2LQN A;  1WLP B;  2P4R A;  2K79 A;  2VVK A;  4AFU C;  2KYB A;  2NWM A;  2D1X A;  1UEC A;  1E6G A;  2DRM A;  1WXB A;  1K76 A;  3PVL A;  1KSW A;  3I5S A;  3EHQ A;  4LNP A;  1UJ0 A;  2B86 A;  1X6B A;  4ORZ A;  1GCP A;  1X2Q A;  1SHF A;  3LH5 A;  2XMF A;  2M51 A;  4JZ4 A;  5IXF A;  1M30 A;  2JTE A;  4FSS A;  3VS0 A;  1GBQ A;  2YUO A;  1G2B A;  4J9D A;  2V1R A;  2KRN A;  2AZV A;  3IQL A;  3UF4 A;  2DIL A;  1NEG A;  2CRE A;  2ROT A;  2EYZ A;  4OMM A;  2G6F X;  2DL5 A;  2BZX A;  2JMA A;  1B07 A;  5EC7 A;  3H41 A;  2EW3 A;  2KRM A;  2RPN A;  2VWF A;  4D8D A;  1WDX A;  4CC3 A;  4M4Z A;  2OI3 A;  4JPB W;  3TSW A;  2RQT A;  1S1N A;  1U5S A;  2K2M A;  2FRW A;  1MV3 A;  4E6R A;  1QCF A;  1AVZ C;  2J6F A;  5FWB A;  1W70 A;  3JV3 A;  2EGA A;  1OV3 A;  2IIM A;  2RQW A;  4K11 A;  1UFF A;  2DX1 A;  1K0X A;  1X2K A;  2JM9 A;  2KNB B;  1FYN A;  2K6D A;  2D8J A;  3VS4 A;  1CKB A;  2HSP A;  2ECZ A;  1QLY A;  1M3A A;  2PTK A;  2DLP A;  2K3B A;  4JJC A;  3ULR B;  2EGC A;  3VS6 A;  4AG2 C;  2PNI A;  1H92 A;  2BZY A;  4OMQ A;  5IXB A;  1KIK A;  1XOV A;  1OPL A;  1I07 A;  1JQQ A;  2EVR A;  1GL5 A;  4HVW A;  1Y0M A;  2C0O A;  4OML A;  1NLO C;  2EYX A;  1OOT A;  5FWC A;  4HCK A;  4RUG A;  1RLQ C;  2C0I A;  2DM1 A;  5I22 A;  1U06 A;  1QWF A;  1W1F A;  2KR3 A;  2KYM A;  2OAW A;  1SHG A;  2EYY A;  2D8H A;  1NG2 A;  1UGV A;  2FPE A;  2VKN A;  3I9Q A;  1PKT A;  3VRZ A;  2DVJ A;  1QKW A;  1E7O A;  1ABO A;  1YN8 A;  3NMZ C;  1LCK A;  1ZUU A;  1TUC A;  2DJQ A;  2DL8 A;  4Z8A A;  4CC7 A;  1I0C A;  1RI9 A;  1SRL A;  3RNJ A;  1UDL A;  4F14 A;  2LNH B;  4RTZ A;  2K9G A;  3U23 A;  1TUD A;  1QWE A;  2DBM A;  3REB B;  3EGU A;  2LJ1 A;  1PKS A;  2FO0 A;  5IH2 A;  4CC4 B;  4AFS C;  3M0Q A;  3SHW A;  2KEA A;  1M3C A;  3UA6 A;  4DEY A;  4AG1 C;  2L2P A;  1BU1 A;  1JEG A;  2ED1 A;  4LN2 A;  1WXU A;  2LJ0 A;  2F2W A;  3RBB B;  1HSQ A;  1RLP C;  2FG0 A;  1AZG B;  1B3Q A;  1UG1 A;  1WXT A;  2O9V A;  1AWW A;  3EG1 A;  2O2O A;  3I5R A;  4OMP A;  2KE9 A;  4J9E A;  3M0S A;  1PRM C;  1K1Z A;  1T0H A;  1OPK A;  4JJD A;  1AOJ A;  1WX6 A;  2V1Q A;  1Z9Q A;  2GQI A;  4RTT A;  2A08 A;  2AKL A;  2KBT A;  1BK2 A;  1WI7 A;  1UJY A;  1N5Z A;  4A63 B;  2LJ3 A;  4RTV A;  4J9F A;  5IHK A;  2MOX A;  3O5Z A;  4CC2 A;  1X6G A;  2QDL A;  3C0C A;  3VRY A;  1ZX6 A;  2JT4 A;  2O88 A;  3R6N A;  4AFZ C;  2EPD A;  2A37 A;  4RTY A;  4ZNX A;  1AWX A;  1M8M A;  1X27 A;  2KT8 A;  4OMN A;  2L3Q A;  3NPF A;  1A0N B;  1EFN A;  1JU5 C;  1GFC A;  1UHC A;  3VS2 A;  1K4U S;  2EQI A;  1PRL C;  3H0I A;  2X3X D;  3NHN A;  5L23 A;  5ECA A;  2JS0 A;  2A36 A;  1YCS B;  1M27 C;  2A28 A;  3H0F A;  2DL3 A;  1WIE A;  3TSZ A;  3FJ5 A;  2F2X A;  2CSI A;  3UAT A;  1J3T A;  2DA9 A;  2AK5 A;  4J9H A;  1MUZ A;  2CDT A;  3CQT A;  4JZ3 A;  2KXC A;  2GTO A;  1SRM A;  4QT7 A;  2DBK A;  2RQU A;  2KGT A;  1I1J A;  1ARK A;  1VYU A;  3EG2 A;  1GFD A;  1AWJ A; 
#chains in the Genus database with same CATH topology
 1RI0 A;  1W6X A;  2RK1 A;  3PNW C;  3JCM b;  2QA4 T;  2MWP A;  5GAM e;  4RTW A;  2EQJ A;  2JS2 A;  2QQR A;  2JM8 A;  4MDX A;  2ROL A;  4M7D A;  1Y96 B;  3M56 A;  3CD6 Q;  4ESR A;  1YP5 A;  4F7U B;  4KGV B;  4N4I A;  2RHU A;  4LDU A;  5A2Q E;  2YSQ A;  1AWO A;  2ZPI B;  3VS3 A;  2H3J A;  9ATC B;  2CZ7 B;  1M2V B;  2DRK A;  4EMG A;  3VS7 A;  4M78 E;  5M9O A;  1YWO A;  4PJO C;  4JUV A;  2P0Q A;  4PL6 A;  1G3T A;  1Q86 C;  3OSV A;  3M5A A;  4ATO A;  3CCL A;  5GAN 7;  2MYS A;  1NM7 A;  3JCM h;  2AKK A;  1K73 R;  2B8A A;  5CK9 A;  1DJ7 B;  4BDY A;  2DE0 X;  8AT1 B;  2DF6 A;  1B7T A;  3R6O A;  1NYF A;  4BD3 A;  1UGS B;  3OW2 P;  2E6N A;  4M7D C;  2CT3 A;  1JXO A;  3E19 A;  1V1C A;  2LP5 A;  1AHJ B;  3RDV A;  3G71 T;  2J06 A;  3CBP A;  2OTJ A;  5GJW B;  5GAM g;  2MI6 A;  3CBM A;  5GAM d;  1B34 A;  4LUE A;  1VQP A;  1R0B G;  4MDW A;  2BTT A;  1SEM A;  2BUD A;  3TQ7 P;  1KD1 R;  2LTO A;  1H64 1;  4KGZ B;  3URG A;  3CC7 T;  3LX7 A;  2E5K A;  2L3R A;  2DIQ A;  2CT4 A;  2FEI A;  3QJ6 A;  3CCU T;  4HXJ A;  4IUQ A;  4J9C A;  2BZ8 A;  3EHR A;  3EG9 A;  2DTI A;  1MV0 B;  4FIB A;  1HYO A;  2LMJ A;  1SF9 A;  3CCJ Q;  1Q7Y C;  1GBR A;  1IO6 A;  2GNC A;  3SWN A;  4BI8 B;  4PFO A;  1M90 R;  1RAI B;  4IKF A;  2RJE A;  1U1S A;  2MF2 A;  2OTL A;  3OSS C;  3CPF A;  4JLG A;  3HRS A;  1CSK A;  1BB9 A;  1KK7 A;  2VXF A;  2CH4 A;  3CCM Q;  3GIB A;  1CKA A;  3M0U A;  1FMW A;  4Z89 A;  5A0L A;  3GOX A;  2WSC E;  1AZE A;  4XU0 A;  3EG0 A;  4FU6 A;  4ZGE B;  1D3B A;  3EH1 A;  3JB9 H;  2O31 A;  4M78 B;  2YUQ A;  2P0K A;  3SEM A;  4QVC A;  5KYY A;  2NYS A;  3A8G B;  1ZLM A;  3WVE B;  2OJ2 A;  2XK0 A;  4OMO A;  3CCV A;  4PFP A;  2HDA A;  3JCM P;  3JCM Q;  4GLK A;  3OS0 A;  5GAN 5;  2HCK A;  3SWN C;  3QG1 A;  4OB3 B;  4II1 A;  1HD3 A;  2E65 A;  4WTO B;  1VYV A;  5L8R E;  4LDW A;  1K73 U;  4DBF A;  2YHT A;  3PVQ A;  1FWZ A;  1AD5 A;  2L3S A;  3V8L A;  5GAO n;  1EIF A;  3HRT A;  5FLX E;  4R0K A;  3RER A;  1M1F A;  2JOY A;  4Y92 A;  1BI3 A;  4KRT A;  1ZA1 B;  5GMK j;  3OA6 A;  1XJW B;  3JCM c;  3FC3 A;  4PJO D;  1WLP B;  2P4R A;  2VVK A;  1VQ9 Q;  1UEC A;  4IUU A;  1E6G A;  5CQX A;  1K76 A;  5D6W A;  5LJ5 d;  3CPW A;  3WXM B;  1Q81 U;  4OGC A;  2WSF E;  3EHQ A;  1PCX A;  1UJ0 A;  4XU2 A;  2PVO B;  5FU6 C;  4ZN3 A;  1X2Q A;  1RAE B;  2HKN A;  2XMF A;  2PVG B;  5DY9 A;  2P0P A;  1N9R A;  1G2B A;  2KRN A;  4BY6 B;  5FU6 B;  2NUP B;  5GMK h;  4XK8 E;  2KQW A;  4QW2 A;  2CRE A;  1MNE A;  3CEY A;  1TWB A;  3GLX A;  2DL5 A;  3RIR A;  1VQK Q;  1TXQ A;  2JTF A;  1M90 U;  2VWF A;  1WDX A;  4HKE A;  4M4Z A;  2OI3 A;  1OU9 A;  3N5B B;  4JPB W;  1Q82 R;  3Q1J A;  4M7A G;  1S1N A;  3M54 A;  3CCS T;  1U5S A;  4C8Q G;  1YJ9 A;  4E6R A;  5C6S A;  2DK3 A;  1N6A A;  1QCF A;  5FWB A;  1IRE B;  2MAM A;  4M75 E;  3JV3 A;  5GAO p;  1D09 B;  2OAU A;  3J7A F;  2EGA A;  2RJF A;  2IIM A;  2HQX A;  3OMG A;  1X2K A;  1R8O B;  2YXY A;  2KNB B;  1VQL A;  4DBH A;  2E4H A;  1MHN A;  4JDS A;  3KXT A;  2IVW A;  1WZO A;  3HP9 A;  3QII A;  1JBM A;  5GMK m;  4JS5 A;  2COW A;  3L2W A;  2EIF A;  2RO0 A;  5LJ3 f;  2BZY A;  4JRI A;  3JB9 G;  5IXB A;  2YWW A;  3CCE A;  1OPL A;  3CME A;  3VYG A;  3CC7 Q;  3P8D A;  4ANJ A;  4OML A;  3RUX A;  3HTR A;  5LJ3 j;  3PIO A;  2C0I A;  1JB0 E;  2DM1 A;  3A8M B;  3UWN A;  3JCM e;  4HA8 A;  4PJM A;  1WJS A;  2EYY A;  1UGV A;  2FPE A;  1IHV A;  3VRZ A;  2CP6 A;  3A8L B;  5CCA A;  4JRP A;  2DFU A;  2LC4 A;  1E7O A;  1SG5 A;  1YN8 A;  5KCH A;  2DJQ A;  1N27 A;  1UDL A;  2RJC A;  2CYZ B;  2DTO A;  2LNH B;  4RTZ A;  2K9G A;  1TUD A;  3CPW P;  4M78 G;  3REB B;  2LJ1 A;  1IB8 A;  4AT1 B;  4ZN1 A;  2KDS A;  5LJ3 h;  4JS4 A;  3M0Q A;  4NOY A;  1BCO A;  5GAN 4;  2KEA A;  3M4G A;  4DEY A;  4AG1 C;  1VIF A;  1JEG A;  3NFC A;  2ZPG B;  1FXX A;  4LN2 A;  3OMC A;  4KH0 B;  2F2W A;  2K3Y A;  3ZBD A;  1HSQ A;  3A1P A;  2FG0 A;  1YIJ Q;  1B3Q A;  1WXT A;  5HKC A;  1AWW A;  3I5R A;  3PFS A;  2KE9 A;  4J9E A;  4OB2 B;  1YJW Q;  2QQB A;  5A0G A;  1T0H A;  1RAH B;  3H8Z A;  1Z9Q A;  4ZGJ B;  2GQI A;  1RAC B;  3A5Z B;  3GPL A;  2AKL A;  1NBE B;  2KBT A;  4RKU E;  3MEW A;  3QDR B;  4C0D B;  1VQM Q;  1UJY A;  3JCM d;  3FIF A;  2LX9 A;  4XTW A;  3C0C A;  2XDP A;  2JT4 A;  2QAZ A;  2EYQ A;  4BDZ A;  2DD4 A;  4B9W A;  2YRC A;  4RTY A;  1X27 A;  1M8M A;  1X75 C;  3P8B B;  1QVG P;  5KCO A;  2E12 A;  1EFN A;  5LJ5 f;  4XU1 A;  3G6E Q;  3CCQ Q;  2EQI A;  5CO7 A;  2X3X D;  3EGX A;  5D6X A;  2QTX A;  3CC4 Q;  5L23 A;  5ECA A;  5KE2 A;  2A28 A;  2EFI A;  1YJN T;  4XTX A;  4BB7 A;  3FJ5 A;  4XAX B;  2FZG B;  2KK4 A;  2CSI A;  3RKW A;  4J9H A;  3EH2 A;  1JRI A;  5KYU B;  3CQT A;  4JZ3 A;  4CRI A;  3BDU A;  2F69 A;  3J81 E;  1VQ4 A;  5EG2 A;  3I55 A;  2KGT A;  4J6X A;  1VYU A;  3EG2 A;  1I5O B;  4M7A F;  1LJO A;  1VQ6 A;  4C8Q F;  2RF0 A;  2HQH A;  4OB0 B;  4KGX B;  3ME9 A;  2JJ9 A;  2EQK A;  2MCN A;  2BIV A;  3QWX X;  4J9I A;  4X1V A;  4R55 A;  2E5Q A;  1YHQ T;  2JTM A;  1PHT A;  2XI9 A;  4DA4 A;  1JXM A;  2C0T A;  1YFN A;  2ABL A;  3CC2 Q;  4F7U E;  2X4W A;  5LL6 S;  3CD6 A;  2FZC B;  3J80 E;  3JB9 F;  1SPK A;  2KRO A;  1YNZ A;  4Q5W A;  2NLU A;  2F2V A;  1NEB A;  5J39 A;  3THK A;  2Z0W A;  3S3N A;  1WFW A;  2Y4X A;  3EG3 A;  1VOM A;  3QSU A;  1OZ3 A;  4N4G A;  4QQ6 A;  1PD1 A;  3EGD A;  2RB6 A;  4F04 B;  3PMT A;  2J05 A;  1KFZ A;  2PUK B;  1ZBX A;  4BE2 A;  3MP6 A;  2A3L A;  1PC0 A;  2JW4 A;  1QMC A;  4PJO E;  2LQ8 A;  2DL4 A;  3CCR Q;  2BE7 D;  1ZBJ A;  2D0Q B;  1W4S A;  2ZGW A;  1U8R A;  3OYL A;  1WHL A;  2M02 A;  4BI4 A;  1O9S A;  2CUD A;  2HMA A;  2QG9 B;  2LT4 A;  2COY A;  2ZPH B;  3GBQ A;  3OW2 A;  2WSE E;  2EGE A;  3RMQ A;  4VUB A;  2FVU A;  3JB9 I;  4IUP A;  4ZGD B;  3NGP A;  3C4S A;  4HVV A;  3ASK A;  3WVD B;  1E6H A;  1N8R R;  1X01 A;  3V8J A;  5GAO q;  4M7D E;  4J83 A;  2HL3 A;  1OEB A;  5I2S A;  1KC8 R;  1T3L A;  4KBM B;  2KY9 A;  3JB9 J;  1QW1 A;  2QYZ A;  4LDV A;  4DQ2 A;  1ZSZ A;  3CMA Q;  3CXC A;  2QTV A;  1U3O A;  3QDF A;  3H0H A;  4M75 G;  5CIU A;  2BE9 B;  2CH4 W;  4LXC A;  4GBQ A;  1RUW A;  1PD0 A;  1UUE A;  3VS1 A;  1VA7 A;  2RI3 A;  3HFO A;  3CCJ A;  1VQ8 Q;  1M1K R;  1KJW A;  1Y07 A;  1LOJ A;  2EJG A;  2PQW A;  2L3P A;  1ABQ A;  3ZL7 C;  2YUN A;  4N4H A;  4EMH A;  1VQO Q;  4C92 G;  2CP5 A;  2RHX A;  1P92 A;  3MET A;  4JJN K;  2O4X A;  3MEV A;  5LJ3 e;  1UGR B;  3CCM A;  2E6Z A;  2JVV A;  4GLM A;  2QDY B;  4FYX B;  1Y57 A;  2LZ6 B;  1MMD A;  2E41 A;  1YCY A;  4M7A A;  1PNJ A;  4AFQ C;  2OTJ T;  4C8Q A;  4LE9 A;  2DYB A;  4J7I A;  4XQ3 A;  2ZPB B;  2LCL A;  1ZSZ C;  1VQP T;  1BBZ A;  3V7R A;  4DEX A;  5D7U A;  3E9G A;  3LWH A;  4EMK C;  4PJO B;  1RAD B;  1ZUK A;  3ZFJ A;  2RH2 A;  2DMO A;  3VJP A;  1O75 A;  4OB1 B;  2FRY A;  3OB9 A;  2GBQ A;  2K3X A;  3OBY A;  4A4G A;  4B9X A;  7AT1 B;  2Y4Y A;  2LQN A;  4EMK B;  1IGU A;  2QXF A;  2M16 A;  2KYB A;  2NWM A;  2OTL T;  4IUT A;  3PTA A;  2DRM A;  2R5M A;  2CS7 A;  1WHG A;  1NJI C;  4DOV A;  2CZ6 B;  1X6O A;  4NS5 A;  1GCP A;  1QCO A;  3LH5 A;  4M7D B;  2M51 A;  4C8Q C;  5CKB A;  2E3H A;  2JTE A;  1VQ9 A;  4J9D A;  4MZT A;  2V1R A;  3L1A A;  5LJ3 d;  1YIT Q;  3IQL A;  3LW5 E;  3UF4 A;  3CXC P;  3M9Q A;  4XTU A;  2OX7 A;  2EYZ A;  1VQN Q;  4OMM A;  2PU9 B;  5EC7 A;  1B07 A;  2IPO B;  4XTZ A;  1M2O A;  4J7F A;  2EW3 A;  2DPP B;  3PT9 A;  4BE1 A;  5GMK l;  4V2S A;  4CC3 A;  3CCV T;  3OYF A;  2RHZ A;  4RCC A;  1R77 A;  2RQT A;  2PVD B;  1K9M C;  4M77 F;  2FRW A;  3C94 A;  3UDC A;  1VQK A;  1M1K U;  1W70 A;  3HHT B;  3QZ9 B;  3BDL A;  1WPY A;  2RQW A;  2DXT A;  1YI2 Q;  1PSE A;  1K0X A;  1ZQ1 A;  5LJ5 e;  3MHX A;  5GAO r;  4KUD K;  1VQ5 Q;  2K6D A;  1G8X A;  2E64 A;  1CKB A;  2HSP A;  2D6F A;  2YLC A;  1WJQ A;  2DLP A;  4JJC A;  2QEX Q;  2EGC A;  4J5Y A;  2PNI A;  2DJZ A;  4PFZ A;  3I56 Q;  1WJR A;  2YRD A;  3GF5 A;  1W2B S;  1GL5 A;  1Y0M A;  4BAC A;  1NLO C;  4C0Z A;  2EYX A;  1QP3 A;  3QHS A;  1VQ7 T;  1UGP B;  1B34 B;  4O6J A;  1RLQ C;  1Q86 R;  5DLQ E;  3G4S T;  2DEQ A;  2K5I A;  2VKN A;  3CC7 A;  1KQ1 A;  3MPU B;  1QKW A;  1IRX A;  3EG9 B;  1ZUU A;  1TUC A;  1KHC A;  5CAI A;  2MMP A;  2MPX C;  2DXB A;  3SWN B;  2DBM A;  2RHY A;  3BFM A;  1GXI E;  1PKS A;  2FO0 A;  4F7U G;  4C92 F;  2CP2 A;  4AFS C;  2JNG A;  1S72 T;  2QA4 Q;  4EPC A;  1YJ9 T;  2YRV A;  2LJ0 A;  1C1A A;  3RBB B;  2H3E B;  5LJ5 g;  1RLP C;  1PSF A;  2FZK B;  1UG1 A;  4OMP A;  1C6V X;  4XU3 A;  3EFO A;  3DB3 A;  1VQL T;  3MJX A;  1PRM C;  1D3B B;  1KD1 U;  1OPK A;  4PJO G;  1WX6 A;  2L89 A;  5KYY B;  1K8A C;  2DKG A;  1TH7 A;  1YIJ A;  2EWN A;  4J6Y A;  4DBQ A;  3CCE T;  1BYM A;  1M4Z A;  2ZAE A;  2A08 A;  3CME T;  1IGQ A;  1BK2 A;  4M7D D;  3LH0 A;  2RJD A;  1BIA A;  1YJW A;  1Q7Y R;  3A8H B;  2RK2 A;  1RL2 A;  3TEE A;  1N5Z A;  4A63 B;  5KYW A;  5CVI A;  2LJ3 A;  1Y7X A;  2LRQ A;  5IHK A;  4OMF B;  1JJ2 P;  2DYI A;  2JN0 A;  3LGL A;  1AWX A;  4OMN A;  2L3Q A;  3NPF A;  1VQM A;  2R57 A;  1D0X A;  1IXD A;  2EQM A;  1K4U S;  2DXU A;  1UB4 A;  4X34 A;  5GMK i;  3G71 Q;  3E2U A;  8ATC B;  1YCS B;  1M27 C;  4M77 A;  2DL3 A;  1WIE A;  4N0A A;  3TSZ A;  1QVG A;  1OQK A;  2GCX A;  2F2X A;  2KVQ G;  3G6E A;  3CCQ A;  2NUT A;  3HL8 A;  3T9N A;  1MUZ A;  3CC4 A;  1Q86 U;  4R56 A;  3CCU Q;  4QT7 A;  1TUG B;  3EAE A;  5GAN f;  1AWJ A;  1D1A A;  4A4F A;  1D0Z A;  2COZ A;  2A0F B;  2DNU A;  4C5G A;  2KRS A;  5GAN j;  2C06 A;  4OP0 A;  2LT1 A;  2SEM A;  1WGS A;  3M0T A;  1SSH A;  3MO8 A;  1UGQ B;  2W10 A;  3GP8 A;  1OZ2 A;  2PZ1 A;  2XG8 D;  2L0A A;  2H8H A;  4HT9 A;  1WYX A;  2RA2 A;  3M57 A;  2RI2 A;  2ENM A;  2JMC A;  3VYH B;  2QGF B;  2GGR A;  1D1C A;  4M77 C;  1QP2 A;  2K2V A;  3UA7 A;  3DB4 A;  2K7A A;  2QGG A;  2LCS A;  4M77 B;  2SRC A;  5GAN h;  3VV0 A;  3CC2 A;  2RN8 A;  1TS9 A;  3VU3 C;  3V7C A;  3ZEH A;  1VQ7 Q;  3S6W A;  4C92 A;  5IT9 E;  2DTH A;  3LYI A;  2J7I A;  4IIM A;  3A98 A;  1GRI A;  1Q7Y U;  2ED0 A;  2JZ2 A;  1QVF A;  2LDM A;  1NLP C;  3QZ5 B;  1I4K 1;  1X43 A;  1D0Y A;  3I35 A;  3RMS A;  1Q82 U;  3G1J A;  3JCM g;  4AMC A;  1D1B A;  4F7U F;  1VQ4 T;  3I55 T;  3L2V A;  3CCR A;  3QWY A;  4MMK A;  2QQ9 A;  3X24 B;  2M1H A;  1VQ6 T;  3TCJ A;  2J6K A;  2HNI A;  3L2U A;  3CPW S;  3FDR A;  1NPP A;  2WAC A;  4QVZ A;  2I0N A;  2VGM A;  4HVU A;  1WQW A;  2D0N A;  3HPW A;  2LQK A;  1VUB A;  2FPF A;  4C92 C;  4IIO A;  2ZPF B;  3CD6 T;  1XQH A;  4E7S A;  1R0C B;  4QKU A;  1QQJ A;  3V8K A;  2DVE A;  2ATC B;  1NPR A;  3CMA A;  3QYH B;  4J9G A;  2LQW A;  2X51 A;  1BI1 A;  1G3W A;  1H3Z A;  4P5N A;  2V26 A;  1K9A A;  2ZZD A;  2VGN A;  3CCS Q;  2P4T A;  2FPD A;  4RCB A;  1VQ8 A;  2GTJ A;  4KUL A;  3OYD A;  4ZTF A;  1RAB B;  4X9D A;  1VQO A;  5KYX A;  1TOV A;  4E7I A;  4MZM A;  3SFM A;  1H3H A;  3MEU A;  4LD6 A;  1QVG S;  1NZ9 A;  2AT1 B;  2YT6 A;  2E10 A;  5GAN 8;  3SB2 A;  1JO8 A;  3JCM W;  2CZ1 B;  2V8I A;  4E47 A;  5KE3 A;  2RHI A;  3EFS A;  2CKK A;  3EGX B;  2MIO A;  2HSE B;  2X3W D;  2YUP A;  3M0R A;  2EBP A;  1QVF P;  4FW2 A;  5IHI A;  3KFV A;  1M9S A;  3REA B;  4Z88 A;  3KUF A;  5GMK e;  3C95 A;  1YBY A;  2DZC A;  2F5K A;  4WCI A;  2JXB A;  4FT2 A;  2AHJ B;  2IG0 A;  1V29 B;  4M77 D;  2QAS A;  3V7S A;  2K79 A;  3QYG B;  1OX9 A;  2D1X A;  3RKX A;  4YTL A;  1WXB A;  3PVL A;  2E3I A;  4C0F A;  4LNP A;  2B86 A;  3OYN A;  1X6B A;  4ORZ A;  4M78 F;  3MCA B;  1SHF A;  1K73 C;  2XU8 A;  5IXF A;  1KQS P;  1M30 A;  4FCY A;  1GBQ A;  2YUO A;  2DZ9 A;  5GAN 2;  2VUB A;  1MMN A;  5I2M A;  4X9C A;  2DIL A;  3X28 B;  5GAN 3;  2ROT A;  5CKH A;  2LCC A;  2BZX A;  2JMA A;  1Y96 A;  1VIE A;  5IN1 A;  2DD5 A;  5CR2 A;  3CCM T;  4A4H A;  4F7U A;  2KRM A;  3EFR A;  5CKF A;  2E70 A;  2I2L A;  1QVP A;  3TSW A;  1YIT A;  1M2V A;  2K2M A;  4C8Q E;  1Q81 C;  5FU7 C;  1VQN A;  1WHM A;  2QI2 A;  2J6F A;  3EGD B;  4L6V 5;  3CCL T;  1KD1 C;  4K11 A;  2DX1 A;  2K5L A;  2JM9 A;  3QKJ A;  2DEU A;  1ZHI A;  3X26 B;  1FYN A;  2GFU A;  4ZTJ A;  2ECZ A;  1QLY A;  1M3A A;  2PTK A;  1G3Y A;  5KH6 A;  3ULR B;  1H92 A;  2M9U A;  2VXE A;  1KIK A;  1V76 A;  1XOV A;  1YI2 A;  1I07 A;  2XDD A;  1ACM B;  1M90 C;  2EVR A;  4PJL A;  2C0O A;  5A0D A;  1VQ5 A;  2AIR B;  4HT8 A;  4WF2 A;  4JLI A;  4E7Z A;  5I22 A;  1U06 A;  2QEX A;  1QWF A;  1W1F A;  2OAW A;  2ZPE B;  3I56 A;  3G7Z A;  5GAN e;  2D8H A;  1YJN Q;  1VQ9 T;  3OYA A;  2DVJ A;  1ABO A;  1LCK A;  3UPU A;  4Z8A A;  2DL8 A;  5DM7 R;  2HQE A;  1I0C A;  1PG5 B;  1UEB A;  1SRL A;  4F14 A;  4Z02 A;  2DET A;  1BCM A;  1ZSZ B;  3INZ A;  5IH2 A;  1XTD A;  2MK5 A;  1M3C A;  3UA6 A;  1WQ7 A;  2RI5 A;  4ELY C;  2RM4 A;  1Y71 A;  1BU1 A;  2L2P A;  2P84 A;  2HAX A;  2ED1 A;  4E2F B;  3OYK A;  1WXU A;  5GAN 6;  3FEO A;  2DER A;  5CKD A;  1VQK T;  3FRN A;  3FB9 A;  2XD0 A;  3JAM E;  3OS2 A;  2CGH A;  1I8F A;  1AZG B;  3M4Y A;  2O9V A;  2MWO A;  1YHQ Q;  3OBW A;  2QA4 A;  4FW1 A;  2EJF A;  2O4X B;  4M7A C;  3OYI A;  4RG2 A;  4MML A;  3KBG A;  4JJD A;  1AOJ A;  3M59 A;  1N8R U;  2V1Q A;  3S3O A;  4PLI A;  5LJ3 g;  2KMT A;  2D9T A;  3A8O B;  1KC8 U;  4NL3 A;  4M7A B;  5GAO m;  4M78 A;  4C8Q B;  2M0O A;  4XTV A;  1PM3 A;  2K57 A;  1W2B P;  1Q81 R;  4RTV A;  1BI0 A;  5GAN g;  3OY9 A;  5GAN d;  2MOX A;  4CC2 A;  4UC4 A;  1X6G A;  2QDL A;  5J3B A;  3VRY A;  1ZX6 A;  4HCC A;  2K5F A;  2EPD A;  2A37 A;  4ZNX A;  4EDU A;  2YLB A;  4OVA A;  1A0N B;  3VUZ A;  1JU5 C;  1GFC A;  1UHC A;  3VS2 A;  4PNO A;  3H0I A;  4PK4 A;  1KG1 A;  2JS0 A;  2A36 A;  5HY6 A;  1JJ2 A;  1M5Q 1;  3H0F A;  3OW2 S;  2LNV A;  4KUI A;  5C0M A;  2X4Y A;  3QPH A;  2V8K A;  3UAT A;  1J3T A;  1Q82 C;  3MKD A;  2DXC A;  2AK5 A;  3G71 A;  2KXC A;  4PJJ A;  4OF1 A;  3VUB A;  4A54 A;  2VAS A;  4M78 C;  3LWI A;  2RQU A;  3HKS A;  1I1J A;  3F70 A;  4RMO A;  5J26 A;  1GFD A;  4EIK A;  1HJD A;  2HZY A;  1WHK A;  3CXC S;  1NYG A;  4L59 A;  1UTI A;  1BIB A;  1X69 A;  1MMA A;  4M75 F;  1UHF A;  2DL7 A;  3CCU A;  2EAY A;  3OYJ A;  1M3B A;  1YIJ T;  3MEA A;  2EYW A;  5I11 A;  3CCL Q;  1OYX A;  3NTH A;  2NUP A;  4RTX A;  2GF7 A;  3E9F A;  4D8K A;  1ZA2 B;  1YJW T;  5FW9 A;  4F16 A;  2F1L A;  3PIP A;  2QQA A;  3LLR A;  4A4K A;  2LVM A;  1TU0 B;  2EKO A;  2FHD A;  1NJI R;  1AEY A;  1GCQ A;  1ZSG A;  4PKC C;  2RQV A;  1G3S A;  3M58 A;  2EJ9 A;  3OQ5 A;  1VQM T;  2M0Y A;  3DLL A;  2DO3 A;  1M8V A;  2GFA A;  1G83 A;  4IUV A;  1G5V A;  1C0M A;  3OYH A;  4TVR A;  2OTJ Q;  3OYG A;  4ME7 A;  1QKX A;  3TRE A;  4M77 E;  1MMG A;  4L5G A;  1VQP Q;  3G6E T;  2HBW A;  3O8V A;  3CCQ T;  5FRM A;  1VQ7 A;  3CC4 T;  1FMV A;  1PWT A;  1SSF A;  1VYT A;  2L8D A;  3RR6 A;  4BY6 C;  3G4S A;  2XKO C;  1BKB A;  1M1G A;  4C5E A;  3E1S A;  1K9M R;  2CZ0 B;  3M55 A;  2EKH A;  1WNL A;  4M7A D;  4J9B A;  2JUF A;  3TVT A;  4C8Q D;  2R5A A;  1RAF B;  1T3S A;  1WA7 A;  2K4Y A;  3PE0 A;  4C5H A;  1T0J A;  2RD1 A;  4GY5 A;  2HBP A;  3QJY A;  3JRZ A;  1GCQ C;  3M53 A;  2OTL Q;  4JJB A;  3FLG A;  4M7D G;  3NTK A;  2W0Z A;  1FX7 A;  2ESW A;  2X4J A;  1LNX A;  4MZP A;  2X35 A;  2KXD A;  2PUO B;  1S72 A;  2X4X A;  3QBY A;  1IZ6 A;  5IAY A;  3RES A;  3UT1 A;  1OU8 A;  3JB9 D;  3JCM V;  2CSQ A;  3SDZ A;  4BE0 A;  2LX7 A;  2XIC A;  3TU4 K;  1Z9Z A;  3HFN A;  4LDX A;  5GJV B;  1TTH B;  4KT0 E;  4F17 A;  3EFO B;  2HEQ A;  3OYY A;  2X9H A;  1TG0 A;  3L2Q A;  4QQD A;  3L42 A;  5GAM f;  3CC2 T;  2EQU A;  3BE3 A;  2XDB A;  3CCV Q;  4C92 E;  4C5I A;  1YWP A;  2J6O A;  3M0P A;  2FB7 A;  5GAM j;  3OS1 A;  1K0S A;  3FJP A;  1F1B B;  5KYW B;  5HCK A;  5AT1 B;  2HD0 A;  4FYY B;  4RTU A;  1JJ2 S;  2AZS A;  4M78 D;  2KT1 A;  3JCM X;  3VS5 A;  3QO3 A;  1NE8 A;  4OGE A;  3CCS A;  1NJI U;  2RQR A;  5CKE A;  3SD4 A;  3PMI A;  1FMK A;  4FYV B;  4LUD A;  4M75 A;  3CCR T;  4N0A C;  2DIG A;  3NTI A;  1H8K A;  3OYB A;  1BI2 A;  1ZUY A;  4KH1 B;  2CUB A;  2E1H A;  1U1T A;  2YDL A;  2O9S A;  5IHN A;  1IHW A;  5GAM h;  3OYM A;  3HSB A;  2RNA A;  3AT1 B;  1N9S A;  4HCB A;  2GQV A;  1K8A R;  3D7S B;  3G4S Q;  4Y28 E;  1UE9 A;  2HL5 C;  2NUZ A;  2RMO A;  2NUT B;  2VB6 A;  4AFU C;  5FRN A;  4O5V A;  1K9M U;  2G3R A;  1KSW A;  3I5S A;  5KYU A;  2O01 E;  3P8H A;  3CMA T;  4C0D C;  4JZ4 A;  2KAF A;  4FL6 A;  4FSS A;  3VS0 A;  4JRQ A;  4M75 C;  1S72 Q;  2AZV A;  5FRO A;  2XID A;  3JSC A;  1NEG A;  1YJ9 Q;  3S3M A;  2G6F X;  1VQ8 T;  4RG8 A;  3H41 A;  3OYE A;  4FYW B;  2A7Y A;  1I81 A;  4M75 B;  2RPN A;  2VYT A;  4D8D A;  3OYC A;  1KQS A;  1VQO T;  1VQL Q;  3LGF A;  2F5T X;  4JRK A;  4PJO F;  4LD9 K;  1OUL A;  4J6W A;  1MV3 A;  3MP8 A;  1AVZ C;  4C92 B;  3CCE Q;  1OX8 A;  1OV3 A;  1UFF A;  3CME Q;  3GNF B;  1N8R C;  2D8J A;  3VS4 A;  2QQS A;  5LJ5 j;  1KC8 C;  3BW1 A;  4LDY A;  4E7K A;  2K3B A;  3VS6 A;  4AG2 C;  5I21 A;  4OMQ A;  1JQQ A;  4HVW A;  5DLO A;  3DLM A;  1I5L A;  4M7D F;  4E7J A;  1Q95 G;  1OOT A;  2DAQ A;  5FWC A;  4HCK A;  4E7H A;  4RUG A;  2ZCF B;  2KR3 A;  2KYM A;  1SHG A;  2L5Q A;  3L2Z A;  5CQY A;  1M1K C;  2VV5 A;  1NG2 A;  3VKI A;  4C0G A;  3I9Q A;  1PKT A;  3ER0 A;  5LJ5 h;  1XNI A;  4DOW A;  4ELZ C;  3NMZ C;  4FT4 A;  4CC7 A;  2BKD N;  1RI9 A;  3RNJ A;  1K8A U;  3U23 A;  3X20 B;  1QWE A;  3H9N A;  1HXD A;  4CI0 C;  3EGU A;  1YJN A;  4CC4 B;  2R58 A;  4DBR A;  3SHW A;  1YIT T;  2FL7 A;  4PJN A;  2VC8 A;  1WHJ A;  3L2R A;  1VQN T;  5GAO l;  2HKQ B;  2XHC A;  1RAA B;  4HCZ A;  1AT1 B;  4FM4 B;  4BI3 A;  3AHU A;  1EZZ B;  1LVK A;  5HK3 A;  3EG1 A;  2O2O A;  3CBO A;  3CCJ T;  3M0S A;  4FSX A;  4D6W A;  5HK0 A;  1K1Z A;  1QCN A;  4QVD A;  4M77 G;  4QQG A;  2CP7 A;  3HRU A;  4RTT A;  3OS5 A;  2KI7 A;  1YI2 T;  5KYX B;  1YHQ A;  1WI7 A;  1MGQ A;  6AT1 B;  1VQ5 T;  4A53 A;  5D6Y A;  4B6M A;  1EX4 A;  3QUI A;  4J9F A;  2QEX T;  3O5Z A;  2QK0 A;  1MND A;  2O88 A;  3I56 T;  3DKM A;  3R6N A;  4AFZ C;  4M7A E;  1HK9 A;  4BUG A;  5KYN A;  3QXE B;  4E7L A;  2KT8 A;  1KHI A;  1WHH A;  4M75 D;  1QVF S;  1TSF A;  3RKY A;  1W2B A;  1LPL A;  3JCM J;  4IUR A;  2CP3 A;  5AYF A;  1SKU B;  1PRL C;  3NHN A;  1OI1 A;  3X25 B;  2CP0 A;  5FU7 B;  4PJO A;  1VQ4 Q;  3C12 A;  2Y90 A;  3I55 Q;  4C92 D;  4XTY A;  4PLL A;  4NL2 A;  1RAG B;  2DA9 A;  3BY7 A;  1VQ6 Q;  4Y91 A;  2KSS A;  1KQ2 A;  4EMK A;  2CDT A;  3H6Z A;  3MP1 A;  3JCM f;  2GTO A;  1SRM A;  2V8J A;  2FYK A;  1KQS S;  2DBK A;  3PGG A;  4A4E A;  1ARK A;  4J8O A;  3GNG A; 
#chains in the Genus database with same CATH homology
 1W6X A;  1HJD A;  1NYG A;  4RTW A;  1UTI A;  2JS2 A;  2JM8 A;  2RF0 A;  2DNU A;  1X69 A;  2ROL A;  2KRS A;  1UHF A;  2DL7 A;  4ESR A;  1YP5 A;  2MCN A;  2SEM A;  3M0T A;  1M3B A;  1SSH A;  2YSQ A;  1AWO A;  2EYW A;  2W10 A;  2PZ1 A;  3QWX X;  4J9I A;  2L0A A;  2H8H A;  4X1V A;  5I11 A;  1WYX A;  3VS3 A;  4RTX A;  4D8K A;  1PHT A;  2ENM A;  5FW9 A;  2JMC A;  1JXM A;  2DRK A;  3VS7 A;  4F16 A;  2C0T A;  1YWO A;  2ABL A;  2GGR A;  1SPK A;  2KRO A;  1YNZ A;  3UA7 A;  2K7A A;  2LCS A;  2F2V A;  1NEB A;  1AEY A;  1GCQ A;  1ZSG A;  3THK A;  1NM7 A;  1WFW A;  2RQV A;  3EG3 A;  2AKK A;  2M0Y A;  2SRC A;  2RN8 A;  1G83 A;  2DE0 X;  2DF6 A;  2J05 A;  1KFZ A;  1NYF A;  2JW4 A;  1QKX A;  2J7I A;  4IIM A;  3A98 A;  2DL4 A;  1GRI A;  2ED0 A;  1ZBJ A;  2CT3 A;  1JXO A;  1NLP C;  2HBW A;  1V1C A;  1X43 A;  2LP5 A;  3I35 A;  1PWT A;  1VYT A;  2J06 A;  2CUD A;  5GJW B;  2EKH A;  3QWY A;  4LUE A;  3GBQ A;  2EGE A;  4J9B A;  3TVT A;  2BTT A;  1SEM A;  1T3S A;  3NGP A;  1WA7 A;  3PE0 A;  2J6K A;  1T0J A;  4HVV A;  4EIK A;  2E5K A;  1E6H A;  2CT4 A;  2FEI A;  1GCQ C;  4HXJ A;  4JJB A;  4J9C A;  2BZ8 A;  2W0Z A;  2ESW A;  1OEB A;  3EHR A;  2I0N A;  4HVU A;  1MV0 B;  1T3L A;  2KXD A;  2LMJ A;  2D0N A;  2FPF A;  1IO6 A;  1GBR A;  4IIO A;  2GNC A;  1U3O A;  2CSQ A;  3H0H A;  2CH4 W;  4GBQ A;  2LX7 A;  1RUW A;  1UUE A;  1Z9Z A;  5GJV B;  1CSK A;  3VS1 A;  1VA7 A;  4F17 A;  1BB9 A;  2HEQ A;  1TG0 A;  2CH4 A;  1KJW A;  1CKA A;  3M0U A;  2L3P A;  1ABQ A;  4J9G A;  3ZL7 C;  2LQW A;  4Z89 A;  2YUN A;  1AZE A;  1YWP A;  2J6O A;  1K9A A;  3EG0 A;  3M0P A;  2O31 A;  2FPD A;  2YUQ A;  3SEM A;  1K0S A;  2GTJ A;  1ZLM A;  5HCK A;  4GLM A;  2OJ2 A;  1Y57 A;  2LZ6 B;  4OMO A;  4RTU A;  2HDA A;  2AZS A;  2KT1 A;  1PNJ A;  4AFQ C;  1H3H A;  3VS5 A;  4LE9 A;  2DYB A;  2RQR A;  2HCK A;  1FMK A;  4LUD A;  2YT6 A;  1BBZ A;  1HD3 A;  1JO8 A;  1H8K A;  1VYV A;  1ZUY A;  2CUB A;  2MIO A;  4DEX A;  3PVQ A;  2YDL A;  2YUP A;  2X3W D;  2O9S A;  3M0R A;  1AD5 A;  5IHN A;  2L3S A;  2EBP A;  1ZUK A;  5IHI A;  3KFV A;  2RNA A;  2DMO A;  4R0K A;  3REA B;  4Z88 A;  4Y92 A;  4KRT A;  2FRY A;  2GBQ A;  1UE9 A;  2NUZ A;  4WCI A;  2JXB A;  2RMO A;  2LQN A;  1WLP B;  2P4R A;  2K79 A;  2VVK A;  4AFU C;  2KYB A;  2NWM A;  2D1X A;  1UEC A;  1E6G A;  2DRM A;  1WXB A;  1K76 A;  3PVL A;  1KSW A;  3I5S A;  3EHQ A;  4LNP A;  1UJ0 A;  2B86 A;  1X6B A;  4ORZ A;  1GCP A;  1X2Q A;  1SHF A;  3LH5 A;  2XMF A;  2M51 A;  4JZ4 A;  5IXF A;  1M30 A;  2JTE A;  4FSS A;  3VS0 A;  1GBQ A;  2YUO A;  1G2B A;  4J9D A;  2V1R A;  2KRN A;  2AZV A;  3IQL A;  3UF4 A;  2DIL A;  1NEG A;  2CRE A;  2ROT A;  2EYZ A;  4OMM A;  2G6F X;  2DL5 A;  2BZX A;  2JMA A;  1B07 A;  5EC7 A;  3H41 A;  2EW3 A;  2KRM A;  2RPN A;  2VWF A;  4D8D A;  1WDX A;  4CC3 A;  4M4Z A;  2OI3 A;  4JPB W;  3TSW A;  2RQT A;  1S1N A;  1U5S A;  2K2M A;  2FRW A;  1MV3 A;  4E6R A;  1QCF A;  1AVZ C;  2J6F A;  5FWB A;  1W70 A;  3JV3 A;  2EGA A;  1OV3 A;  2IIM A;  2RQW A;  4K11 A;  1UFF A;  2DX1 A;  1K0X A;  1X2K A;  2JM9 A;  2KNB B;  1FYN A;  2K6D A;  2D8J A;  3VS4 A;  1CKB A;  2HSP A;  2ECZ A;  1QLY A;  1M3A A;  2PTK A;  2DLP A;  2K3B A;  4JJC A;  3ULR B;  2EGC A;  3VS6 A;  4AG2 C;  2PNI A;  1H92 A;  2BZY A;  4OMQ A;  5IXB A;  1KIK A;  1XOV A;  1OPL A;  1I07 A;  1JQQ A;  2EVR A;  1GL5 A;  4HVW A;  1Y0M A;  2C0O A;  4OML A;  1NLO C;  2EYX A;  1OOT A;  5FWC A;  4HCK A;  4RUG A;  1RLQ C;  2C0I A;  2DM1 A;  5I22 A;  1U06 A;  1QWF A;  1W1F A;  2KR3 A;  2KYM A;  2OAW A;  1SHG A;  2EYY A;  2D8H A;  1NG2 A;  1UGV A;  2FPE A;  2VKN A;  3I9Q A;  1PKT A;  3VRZ A;  2DVJ A;  1QKW A;  1E7O A;  1ABO A;  1YN8 A;  3NMZ C;  1LCK A;  1ZUU A;  1TUC A;  2DJQ A;  2DL8 A;  4Z8A A;  4CC7 A;  1I0C A;  1RI9 A;  1SRL A;  3RNJ A;  1UDL A;  4F14 A;  2LNH B;  4RTZ A;  2K9G A;  3U23 A;  1TUD A;  1QWE A;  2DBM A;  3REB B;  3EGU A;  2LJ1 A;  1PKS A;  2FO0 A;  5IH2 A;  4CC4 B;  4AFS C;  3M0Q A;  3SHW A;  2KEA A;  1M3C A;  3UA6 A;  4DEY A;  4AG1 C;  2L2P A;  1BU1 A;  1JEG A;  2ED1 A;  4LN2 A;  1WXU A;  2LJ0 A;  2F2W A;  3RBB B;  1HSQ A;  1RLP C;  2FG0 A;  1AZG B;  1B3Q A;  1UG1 A;  1WXT A;  2O9V A;  1AWW A;  3EG1 A;  2O2O A;  3I5R A;  4OMP A;  2KE9 A;  4J9E A;  3M0S A;  1PRM C;  1K1Z A;  1T0H A;  1OPK A;  4JJD A;  1AOJ A;  1WX6 A;  2V1Q A;  1Z9Q A;  2GQI A;  4RTT A;  2A08 A;  2AKL A;  2KBT A;  1BK2 A;  1WI7 A;  1UJY A;  1N5Z A;  4A63 B;  2LJ3 A;  4RTV A;  4J9F A;  5IHK A;  2MOX A;  3O5Z A;  4CC2 A;  1X6G A;  2QDL A;  3C0C A;  3VRY A;  1ZX6 A;  2JT4 A;  2O88 A;  3R6N A;  4AFZ C;  2EPD A;  2A37 A;  4RTY A;  4ZNX A;  1AWX A;  1M8M A;  1X27 A;  2KT8 A;  4OMN A;  2L3Q A;  3NPF A;  1A0N B;  1EFN A;  1JU5 C;  1GFC A;  1UHC A;  3VS2 A;  1K4U S;  2EQI A;  1PRL C;  3H0I A;  2X3X D;  3NHN A;  5L23 A;  5ECA A;  2JS0 A;  2A36 A;  1YCS B;  1M27 C;  2A28 A;  3H0F A;  2DL3 A;  1WIE A;  3TSZ A;  3FJ5 A;  2F2X A;  2CSI A;  3UAT A;  1J3T A;  2DA9 A;  2AK5 A;  4J9H A;  1MUZ A;  2CDT A;  3CQT A;  4JZ3 A;  2KXC A;  2GTO A;  1SRM A;  4QT7 A;  2DBK A;  2RQU A;  2KGT A;  1I1J A;  1ARK A;  1VYU A;  3EG2 A;  1GFD A;  1AWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...