3JB9H

Cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
76
structure length
76
Chain Sequence
b'MIPPINFIFKLLQQHTPVSIWLFEQTDIRLQGQIRGFDEFMNIVLDDAVQVDAKNNKRELGRILLKGDNITLIQAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor spp42
publication title Structure of a yeast spliceosome at 3.6-angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
total genus 8
structure length 76
sequence length 76
chains with identical sequence m
ec nomenclature
pdb deposition date 2015-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jb9H00
1Y96A 2DKGA 1U1TA 4NOYA 5GMKj 3RIRA 5GAMd 5GANh 3QHSA 4MMKA 4XTUA 5GAOn 1TH7A 1U1SA 4M75D 3QUIA 5GAOm 4PJOE 4XU3A 3SWNC 2DXUA 4XU0A 2DTOA 4XU1A 5GANg 4M7DC 4PJOB 1H641 2CGHA 2DVEA 4C8QG 4C8QA 3JCMc 4C8QC 1N9RA 2VXEA 3HFOA 2EWNA 3FB9A 2RA2A 4C92G 4C92A 4C92D 3FIFA 4RCCA 4PJOF 3V8KA 4M77G 5LJ5g 4M77C 1BIBA 2RD1A 2ZGWA 1BIAA 1LJOA 2Y90A 5GAOr 5LJ5f 3JB9G 1YCYA 3V7SA 2DEQA 5GMKm 4M7AA 4M7AG 3RKYA 1B34A 2HNIA 4M7AD 2E10A 3EFRA 3BDUA 4M78G 4M78A 1D3BA 4M78C 2K57A 3BY7A 3V8JA 5GAMj 2YLCA 3BFMA 4JLIA 4XTVA 4JUVA 3JCMh 3AHUA 5LJ3g 3SWNA 1HXDA 1M5Q1 4JRKA 3L1AA 4M7DA 1Y96B 4M7DG 5LJ3f 4M7DD 4M75E 5GAOl 4HT9A 1KQ1A 5LJ5h 5GAMg 1JBMA 1JRIA 1WPYA 4QVDA 3JCMg 4C8QD 3RKWA 5GAMf 2E1HA 4F7UG 4F7UA 4M75B 4OP0A 5GAN3 3JCMf 4C8QE 4M77A 1WQ7A 4X9DA 3JB9J 4M77D 4PJOG 5GMKi 4XTYA 4C92E 4M75F 2DZ9A 5GANd 4PJOC 3JB9D 3INZA 2EJFA 4N0AA 3RUXA 4M7AC 2VC8A 4N0AC 4C92B 2DXTA 3FJPA 3GIBA 4QVCA 5LJ3d 1LNXA 5LJ3h 3QSUA 5GAN8 4J6YA 4M78D 5GANe 5GMKl 3RERA 3RKXA 4M7AE 5GMKh 5GAMh 5GAOp 4C92F 4EMKA 4M78E 4EMKC 5CAIA 5GAOq 4M7AB 1I4K1 2RB6A 1B34B 1I5LA 4HA8A 2YHTA 4XTWA 3HFNA 2YLBA 4XTXA 5LJ5e 1D3BB 2E41A 2EJGA 1KQ2A 2RM4A 1M8VA 2VXFA 1X01A 3JCMJ 2FYKA 4M7DE 2I2LA 4EMGA 4M7AF 3L2ZA 4JRIA 1N9SA 5GAN7 4V2SA 4X9CA 1MGQA 3SB2A 4XU2A 4Y91A 3SWNB 4NL3A 4XTZA 3JCMX 4M7DB 4DQ2A 2E64A 2DZCA 3QO3A 4F7UE 5GANj 4PJOA 1HK9A 5GAN5 4PJOD 2EJ9A 4C8QB 4RCBA 4M77E 5GAN6 3JB9H 3JCMd 2JN0A 1LOJA 4M75G 4M75A 4F7UB 5I21A 4M75C 3JCMQ 3HSBA 3RESA 5LJ3e 4M7DF 1I81A 1WNLA 3JB9I 4MMLA 4M77B 3VU3C 5LJ5j 4C8QF 3M4GA 5LJ5d 4J6WA 3V7CA 5GMKe 2E65A 5GAMe 3BW1A 4EMHA 4F7UF 4HT8A 3JCMe 5GANf 5GAN4 4M77F 2EAYA 2QTXA 4XQ3A 4C92C 4M78B 2DJZA 4WF2A 2DTIA 4A54A 4J6XA 1WQWA 3V8LA 3JB9F 2FB7A 4NL2A 4J5YA 2DTHA 4A53A 3JCMV 3JCMP 4PNOA 3PGGA 4EMKB 3JCMb 1I8FA 5DY9A 4M78F 5LJ3j 3EFSA 3V7RA 5GAN2 3JCMW
chains in the Genus database with same CATH superfamily
1Y96A 2K5LA 2R5AA 3Q1JA 4AMCA 3CCQA 2KEAA 2QK0A 1X6BA 1IREB 3I35A 3UF4A 1X75C 1SHFA 2V1QA 2DVEA 1K9AA 2P4TA 5CQYA 1M1KC 4AFSC 1WJQA 4ZTFA 2VYTA 5A0GA 2D8JA 2O31A 4M77G 1YI2T 2HZYA 4LN2A 1QKXA 5GAOr 3HP9A 3OYYA 2KRNA 3M0RA 2OTLT 4M7AD 2B86A 2BKDN 3EG1A 4AG2C 1GFCA 3EGDA 2BTTA 3V8JA 3NTKA 3VS1A 2CP7A 4DBRA 3MP6A 4J9HA 2DVJA 4M7DG 1Y96B 1BCOA 2LMJA 1YITT 5GAMg 1JBMA 2F2WA 4QW2A 4R0KA 1BBZA 4OMOA 5D6XA 3CCRQ 1IXDA 2KXCA 5HKCA 1WQ7A 1VYTA 1QKWA 2WSFE 3G71A 2O9VA 1YCSB 3M0TA 1VQ5Q 2XIDA 3OS0A 1OX9A 1UHFA 1G83A 3R6OA 5J39A 4Z88A 4CC3A 1PC0A 4C0DC 1Q82C 2EYZA 1G2BA 3OBWA 3HFNA 2YSQA 2E41A 3EGDB 1KD1R 5CIUA 1WLPB 3C0CA 4RKUE 1ZA1B 3EH2A 4EIKA 2D9TA 1UJ0A 2RK1A 1AVZC 2QGFB 2OTJQ 2JS0A 4HVWA 4M77E 1PM3A 1G3TA 2HSPA 2DAQA 1T3SA 4R55A 1PD0A 5I2SA 5GAMe 3HRSA 2OAWA 4NL2A 1ZUYA 1RAHB 2IIMA 1Q86C 4CC7A 4PNOA 2R5MA 3JCMb 5FWBA 4M7AC 1WHJA 1D1AA 2QQ9A 2CS7A 3FC3A 3LH0A 2JMAA 3EH1A 1IRXA 1B7TA 2K3BA 2O01E 2DA9A 2A37A 4AFQC 3JCMc 2MMPA 4OB0B 2WSEE 4RG2A 4RCCA 3CXCS 3E1SA 1M4ZA 4KH1B 5FU7B 2BZYA 4TVRA 1D1BA 2LP5A 2ZGWA 2GNCA 3G7ZA 2DL4A 1RAIB 1VIFA 3RKYA 2DNUA 1E6GA 2YDLA 3VS4A 4JLIA 2X35A 2JTEA 1TS9A 3AHUA 4PLIA 2O88A 2NLUA 1M90C 3T9NA 2CZ6B 3E9FA 1ZUUA 5FWCA 2E1HA 3JCMf 1WHLA 2K7AA 4F17A 3HRTA 5D6YA 3M56A 3BDLA 1VUBA 4AFZC 4OGEA 1I5OB 3NMZC 1VQ6T 2OI3A 3CCVA 1Z9QA 1UEBA 4N0AC 3GIBA 1LNXA 5GAN8 3OYGA 4AFUC 3H9NA 1G3YA 2LRQA 1YHQT 2QEXA 3VS5A 4XTXA 2DPPB 5DM7R 2RM4A 4P5NA 2FYKA 1SRLA 4JJNK 1Z9ZA 2AKLA 2IPOB 4EMGA 4M7AF 1N9SA 2ZCFB 3G6EA 4JRQA 3REAB 3VYHB 2FZCB 3EG9A 2E64A 2MWOA 4IUVA 4PJOD 4BE0A 1YI2Q 3JCMQ 2YRCA 4M75A 3C4SA 3HSBA 2F5KA 3C95A 2OTLQ 4AT1B 3UT1A 1HSQA 5GAN4 5HY6A 4QT7A 4IIMA 3CCEA 2LNHB 2RQRA 1ZBXA 1QVGS 5AYFA 4A53A 1YIJA 1YITQ 4LUDA 3P8HA 4E7KA 3M9QA 3I55T 1PHTA 4E47A 2MF2A 3OSSC 3SWNC 1M2OA 2LJ3A 3QXEB 3EG9B 2LVMA 5D7UA 2E4HA 1VIEA 4E7LA 1JB0E 1VQNA 3V8KA 3LH5A 2HAXA 4LDWA 1Q86U 1RAGB 3C94A 5GJVB 4M7AA 4LXCA 3M4YA 2E10A 5GAMj 1M9SA 2EGEA 3BY7A 3OYKA 1IHWA 2NYSA 2O2OA 2PVGB 4KGXB 5DLQE 4J9CA 1M5Q1 5LL6S 1AWOA 2MCNA 8ATCB 4OP0A 2K3YA 5EG2A 3NFCA 3NTIA 2QG9B 1KK7A 4X9DA 3CCSA 1W6XA 1DJ7B 3UDCA 1S72A 4PJOC 3LWIA 3OYEA 2R58A 4BE1A 3JB9D 2JNGA 3M59A 1VQ9A 1YJNA 2EGAA 2LX7A 1UUEA 4ME7A 4PJJA 4M78D 1K8AC 3SD4A 1VQKA 5GAOp 1NLPC 5EC7A 5CKEA 1Q7YC 4M7AB 1QP2A 5IAYA 2L89A 1NLOC 4EPCA 1PWTA 2DIQA 1W4SA 2KAFA 5GAN7 3CC7A 4ZTJA 3THKA 4NL3A 3CCMT 4FSSA 4OMPA 1KFZA 1M3BA 2LT4A 3JV3A 1N8RC 3CCJT 3VYGA 4EMHA 3VV0A 2C0TA 3I5RA 1KQSA 2DJZA 2K2MA 2KT1A 3V8LA 1VQPA 4FYWB 5LJ3d 3O5ZA 2E3IA 5I11A 4Z8AA 2E5QA 3CCUT 5GAOn 2CP2A 2YRVA 3EHQA 1NEGA 5GAOm 3CCRA 2FRWA 4HVVA 1MUZA 2KK4A 1VQ6Q 4HCCA 3EAEA 3H0FA 1QCNA 1VQ5A 2XDPA 1YJ9A 1SG5A 3OYDA 1KQSP 4PJOF 2MPXC 3MEAA 2LQNA 2D1XA 2VGMA 1WGSA 2KT8A 1YHQQ 3ZBDA 5D6WA 3WXMB 4CC4B 3VS2A 3EFRA 1V1CA 4M78C 5KYYA 1IO6A 3SWNA 2LT1A 2DERA 4J7FA 3PE0A 4FT2A 2RJEA 4QVDA 3JCMg 3RKWA 1SSHA 1X27A 3MP1A 1LCKA 3OYHA 4RTUA 4XTYA 3A1PA 2EQIA 4A4GA 1UDLA 1NJIU 2X51A 2X3XD 2DRMA 2EJFA 1R0BG 2RJFA 1BKBA 1PSEA 3TCJA 5DLOA 4CC2A 4M78E 4EMKC 2COYA 2M0OA 4EDUA 1IGQA 1MV0B 2X4YA 2E5KA 2X9HA 1ZA2B 1VQOT 3SWNB 2Y4XA 1K0SA 1FYNA 2PU9B 2DZCA 1JXMA 2GTJA 4PJOA 2JUFA 1UGVA 2VKNA 1R8OB 1VQ4T 4ZGJB 2K2VA 5LJ5d 2E3HA 4F7UF 5CCAA 3X20B 3JCMe 1BU1A 3EG2A 2VB6A 1XOVA 1ZSZC 2RJDA 3EHRA 3OBYA 3JB9F 2EQJA 3DB3A 1D0XA 4HCKA 4M78F 5LJ3j 2JTFA 3V7RA 3I56T 1U1TA 1N6AA 1M3CA 4Z02A 1ZSGA 4E7ZA 5GMKj 3VS0A 5FROA 3WVEB 3M0SA 5I22A 3N5BB 3CD6A 1UGQB 4XU1A 3OYJA 4LDXA 4PJOB 4MDWA 5L23A 3OYBA 1M8MA 4OB2B 4C92D 1NM7A 4E7SA 4ZGEB 2ED0A 2PUKB 1H92A 3QPHA 5GMKm 2QI2A 4FM4B 4J9DA 4R56A 2RQWA 3QZ9B 2KNBB 1OEBA 2X4WA 3CCMQ 2DETA 1RACB 2P4RA 1TXQA 2C0IA 2A08A 2JM8A 3QZ5B 4O6JA 4HVUA 2LQKA 5GAOl 1VQLA 1GCPA 2C0OA 4F7UA 1SKUB 2QXFA 3PIPA 2J05A 4KGVB 3CCJQ 2I0NA 1WIEA 2QA4A 2LCLA 3QYGB 3M53A 2CP6A 2LNVA 3CMEA 5GMKi 2GBQA 2PQWA 2HBWA 1TSFA 1B3QA 2VC8A 3E19A 3KXTA 2DBKA 4MZMA 1QWEA 4FL6A 4BY6C 3RKXA 3QWXX 1WFWA 4MZPA 4OB3B 2M51A 2H8HA 4JRPA 1AEYA 1W2BA 3VUBA 1BK2A 3CCUQ 3CPFA 2EJGA 1QVFS 3MP8A 1M30A 3QIIA 4C5IA 2HBPA 2LCSA 1PCXA 4RTVA 2KI7A 1ARKA 4F7UB 4E2FB 1BI1A 5LJ5j 1AD5A 4CRIA 1X6OA 2HQXA 1W2BP 3A8GB 2OJ2A 3OYNA 4C92C 1UE9A 4M78B 1CKAA 2VUBA 2GFAA 2EYQA 4KBMB 2FB7A 4J5YA 2AK5A 1NJIR 2AHJB 4II1A 3JCMW 2LCCA 1PRLC 4PL6A 3WVDB 3CC4T 1GBQA 4C0FA 4M75D 1C0MA 1FMWA 4C0ZA 1JXOA 1H641 2QQSA 9ATCB 4QVZA 5CQXA 3L2UA 2NWMA 3OYMA 2RPNA 4FIBA 2NUTA 4GY5A 3VJPA 1VQOQ 2XD0A 1J3TA 3X28B 1XTDA 1OZ2A 3UPUA 3PFSA 2KQWA 1IZ6A 1D09B 5LJ3f 4PJNA 4M7DD 2P0PA 1WPYA 3RDVA 1VQ4Q 1NG2A 2JVVA 1UG1A 4FSXA 1QVFA 1IGUA 5GANd 3SEMA 3FRNA 1ZSZB 3OW2S 1QP3A 5AT1B 3TREA 1VA7A 3I5SA 5GMKl 2F5TX 4J9GA 4OVAA 3I56Q 1HJDA 1K0XA 4C92F 2DXBA 3PTAA 4Y28E 4LD9K 4JPBW 4QQ6A 1RUWA 4HKEA 4JJCA 1WXTA 1SSFA 2YUNA 4DBFA 2CT3A 1K73U 1VQ7T 1Q81U 2RMOA 3D7SB 4Y91A 3P8DA 2O9SA 4F14A 4RTTA 3JCMX 1K9MU 2VASA 1YWPA 4WCIA 5GAN6 3CEYA 2KGTA 2CP3A 4X34A 4M75C 2EQKA 4OGCA 2L3RA 1U8RA 2QDLA 4J6WA 3CCLA 3OYFA 1ZUKA 1YHQA 3CPWS 2EAYA 3PIOA 1I0CA 1N27A 2E12A 2RI2A 3QDFA 3G1JA 4C5HA 4WTOB 3CMAT 1SHGA 5IXFA 3CC2A 4BB7A 1XNIA 4M7DC 1LVKA 2DE0X 2CGHA 4C8QA 1U5SA 4ZN3A 1UGSB 4C92A 2M16A 2XG8D 2CP5A 2ZPBB 4BY6B 1FX7A 1BIBA 2DK3A 1LJOA 4JZ4A 5LJ5f 2ESWA 1FXXA 1C1AA 2QDYB 1Y7XA 2RHIA 3OYIA 2PNIA 3I55A 1D0ZA 2CP0A 2HCKA 2IG0A 2V26A 4PFOA 1AHJB 2AKKA 2DL3A 1JRIA 2ZPEB 2JJ9A 4HCZA 4IIOA 4B6MA 4GLMA 3L2VA 2J6OA 3DB4A 4M75F 4C92B 3HL8A 5LJ3h 2ZAEA 1KJWA 1JEGA 1KC8C 4PFZA 3QYHB 2A28A 4M7AE 5GMKh 2KVQG 4L6V5 3CC4Q 1U3OA 5CAIA 4J9EA 4XTWA 4BDZA 3HRUA 3PNWC 4IUPA 3JRZA 3CPWA 1KG1A 1M1KU 4X9CA 4LD6A 4C0GA 4DQ2A 1XQHA 1HK9A 5GAN5 4QQDA 1LOJA 5I21A 4M7DF 3RMSA 3VUZA 4Q5WA 3FDRA 3NPFA 4OMMA 3PGGA 1I8FA 1ZBJA 3RNJA 2DKGA 4NOYA 3RIRA 4XTUA 2GTOA 1AWWA 2KMTA 1Q81R 4A4FA 3H0HA 1Q82U 1UTIA 2GF7A 1QLYA 2EYYA 1R0CB 2M02A 2C06A 1G8XA 5FU6C 1K9MR 4E7IA 2Y90A 3VKIA 3CXCA 1VQ7Q 2DEQA 4GBQA 2H3EB 4J7IA 4E6RA 4ELYC 2K57A 1G5VA 1ABQA 2J6KA 4KUDK 2YXYA 2WACA 5LJ3g 4XK8E 1RLQC 4M7DA 5LJ5h 2HQEA 4M75B 1JJ2S 1YJWA 4LDVA 5L8RE 1D0YA 4AG1C 3JB9J 1OULA 1PSFA 4PJOG 4LUEA 1PRMC 1SRMA 2L5QA 2DZ9A 2FVUA 2K6DA 3CXCP 1ABOA 4QVCA 3PMTA 3FJ5A 3ZEHA 3CMAQ 1QCFA 5IHIA 1T0HA 1TUCA 3M0UA 4B9WA 3VS7A 1EX4A 3SB2A 4XU2A 4M7DB 3PT9A 3A98A 3OYLA 1JQQA 2PVDB 1QW1A 2EYWA 5LJ3e 3MHXA 2XI9A 3C12A 5GMKe 1M2VA 2RQUA 5GANf 2LX9A 3GF5A 2QTXA 1M90U 3L2RA 4A54A 3UATA 2KSSA 3RBBB 2GGRA 3S3OA 1I1JA 2EW3A 3GOXA 1QVGA 4NS5A 1RADB 3NTHA 3QHSA 2K3XA 4PJOE 4OF1A 4PLLA 2ROLA 1MMGA 1KHIA 2LQ8A 1VYUA 1M1KR 1N9RA 2QEXT 1X2KA 2CDTA 2HSEB 4RMOA 1RI9A 5LJ5g 3G6ET 1M2VB 3JB9G 1JJ2A 4JJBA 1O75A 2CYZB 2XHCA 2HKQB 1GRIA 1IB8A 1QVGP 2KRMA 3BDUA 4M78G 2DIGA 2VV5A 3BFMA 1E7OA 4FYYB 3M5AA 2ED1A 4ORZA 4ZN1A 3CCET 4RTWA 4KULA 3EG3A 3NGPA 1AT1B 5KCOA 4F16A 1W1FA 1OZ3A 2JXBA 1YIJT 2RF0A 1SF9A 3M0QA 1RL2A 2SRCA 5GJWB 1KIKA 2ZPIB 1IHVA 2M9UA 4J6YA 2RQTA 4Y92A 2QAZA 2VGNA 4L59A 2MOXA 2YLBA 5LJ5e 2OTJA 4J9BA 1VQNT 2XICA 2JMCA 1KD1C 3A8LB 4V2SA 2FEIA 4BI3A 2SEMA 1VQ8T 2X4JA 5KYUA 4F7UE 1BCMA 2FG0A 2W10A 1Y0MA 2RJCA 5FU6B 3CBMA 3M4GA 2BE9B 2J6FA 3MPUB 3MO8A 4C5EA 5KYYB 4WF2A 4MZTA 1GL5A 1Q86R 1YP5A 3HPWA 2FL7A 1UB4A 2F2XA 3CCST 1S72T 3EFSA 4RTYA 5GANh 1YJNT 4RG8A 4J83A 1VQKT 4ATOA 1K8AU 5KYUB 2PZ1A 2DTOA 1NPRA 2JZ2A 2LTOA 2MIOA 1OPKA 1X43A 2VXEA 1Q7YU 4DEYA 1D1CA 1NPPA 1TWBA 4D8KA 1K1ZA 2FHDA 4N4GA 2EQUA 1QVPA 1X2QA 3CC7T 2DL5A 2E70A 4DBHA 3KFVA 1K4US 3M0PA 4HXJA 3OS5A 4FW1A 2GFUA 4YTLA 2FRYA 2ECZA 2GQVA 2L0AA 1N8RU 1M90R 4HT9A 1KQ1A 1SPKA 4C8QD 2DFUA 1VQMT 1I07A 3X25B 3M55A 1VQPT 3MCAB 2OAUA 2MK5A 3OY9A 3QSUA 1OX8A 1O9SA 2DD5A 3CCVQ 1OYXA 1PD1A 1PG5B 2MAMA 3OMCA 2DYIA 1YJ9T 1QQJA 1YI2A 2EVRA 4ANJA 2FPFA 2QEXQ 3TSWA 2RO0A 2OTLA 2A7YA 1OI1A 2EJ9A 4RCBA 3JCMd 5IXBA 3G6EQ 1WNLA 3JB9I 1YN8A 2CKKA 1QWFA 1OPLA 1NBEB 1YITA 1BYMA 2A0FB 2JOYA 1ZX6A 1VQ7A 2W0ZA 2DRKA 1ZHIA 4DA4A 2BZXA 3JCMP 3MEVA 2EPDA 2F1LA 3CCEQ 3AT1B 2B8AA 2JTMA 2AIRB 3PVLA 3TU4K 1YIJQ 3LLRA 4A4KA 1U1SA 4XU0A 4IUUA 1KHCA 6AT1B 2HKNA 2L3SA 2MYSA 4QKUA 2YRDA 4J8OA 4C8QC 1S1NA 3UA7A 3J81E 8AT1B 1UHCA 3J80E 4N4HA 5HK0A 2Z0WA 3J7AF 1FMKA 3LWHA 3EFOA 1VQNQ 3CMAA 2EYXA 4FYVB 1MHNA 1WJSA 1B07A 1D3BA 5CKHA 1N5ZA 4JS4A 5CK9A 1VQ8Q 2K5IA 2YLCA 3VS6A 2RHUA 1YNZA 3L2QA 2HDAA 2CZ1B 2RQVA 2KE9A 2AT1B 4C8QE 4M77D 1VYVA 5KH6A 4C92E 2VWFA 1TOVA 3ZL7C 1RAEB 1K8AR 1G3SA 2QQAA 3CCSQ 1S72Q 3CD6T 3S3MA 2GCXA 2DLPA 3URGA 4LE9A 3EFOB 1YJNQ 1G3WA 1MNDA 1Y07A 1VQKQ 1D3BB 1M8VA 1EZZB 5HCKA 1OOTA 4KRTA 1GCQC 1JO8A 4M75G 2Y4YA 4PK4A 3CC7Q 3RESA 1N8RR 3VU3C 2CH4A 4C8QF 1TUDA 2AZVA 2X4XA 4VUBA 2CUDA 2KRSA 2R57A 5C0MA 2NUTB 4OMLA 2DEUA 1H3HA 1VQLT 4KH0B 4IUTA 4J6XA 2FZGB 2QA4T 2YT6A 1T3LA 3CMET 5IH2A 3GPLA 1QVFP 1VQMQ 1VQ6A 3JAME 3UWNA 1VQPQ 3OSVA 1TH7A 3VS3A 1BI3A 3QUIA 3VRZA 1H3ZA 4D6WA 2L3PA 2KR3A 2K79A 2DF6A 3GNFB 2EWNA 2V8JA 1SEMA 4M77C 1AZEA 1W70A 1WHMA 3GP8A 1YJ9Q 3G4ST 2D6FA 4M7AG 1OV3A 2XK0A 1NE8A 4IUQA 4ZNXA 2LDMA 4XAXB 2FPEA 3R6NA 1BI2A 1V76A 4XTVA 2RHXA 3L1AA 2ROTA 4M75E 1UECA 2CH4W 2KROA 1GBRA 3FLGA 3OMGA 3A8MB 2BUDA 3LGFA 1WZOA 4RTZA 4CI0C 3GLXA 3OW2A 3GNGA 3I9QA 1I4K1 1I5LA 2PTKA 2RI3A 2YWWA 2E6ZA 1XJWB 2GQIA 4ESRA 2VXFA 4M7DE 2CUBA 2BZ8A 2KXDA 2EKOA 3TEEA 3IQLA 5GANj 2KBTA 1YBYA 2NUZA 3SDZA 4C8QB 2HL3A 4RUGA 3CCQT 4LDUA 2EIFA 4N4IA 1I81A 2E6NA 3LGLA 2COWA 3V7CA 3OW2P 1WXUA 3QJYA 3U23A 4M77F 3OQ5A 4XQ3A 1V29B 2QQBA 2V8IA 3F70A 1GCQA 3M58A 4IKFA 2EQMA 2RH2A 1ZQ1A 5GAMd 5HK3A 1NEBA 3M57A 3SFMA 1BB9A 5KYWA 2J7IA 1WDXA 2COZA 3CD6Q 3HFOA 1HYOA 3FB9A 1AOJA 4FCYA 3ULRB 4D8DA 2RD1A 3CPWP 1BIAA 3S6WA 3ME9A 3META 3CCMA 3G71T 1X69A 2F69A 1F1BB 3MKDA 1TG0A 2DMOA 4FU6A 2X3WD 4JUVA 3CCJA 1X6GA 4PFPA 3CCLT 2LJ0A 2YUOA 3MEWA 4BI4A 1K73R 2O4XA 4E7HA 1EFNA 2L8DA 1PKSA 4OMQA 4BACA 5KYWB 4M77A 3HTRA 4BUGA 3QDRB 1RAFB 4JLGA 1VQLQ 1LPLA 3RUXA 2ATCB 2QA4Q 3CCUA 4FW2A 3OS1A 3CMEQ 3A8OB 1M3AA 2FZKB 3CC2T 2PVOB 2P84A 5KYNA 5GAOq 4K11A 1YWOA 2JS2A 3JCMJ 2I2LA 3OYAA 2NUPA 3QO3A 2EKHA 2O4XB 2CSQA 2DYBA 1UGRB 3CQTA 1TUGB 3G4SQ 1Y71A 4MMLA 4IURA 4M77B 4JDSA 1WHGA 2E65A 5IT9E 1KQSS 2EBPA 2JM9A 3O8VA 3DLMA 1WXBA 5I2MA 1Q95G 3QKJA 2QGGA 1FMVA 2D8HA 2DTIA 1ZLMA 3REBB 3CBOA 2DTHA 4J9IA 4KT0E 3VRYA 1VQ8A 1UJYA 3LYIA 5FLXE 1NJIC 4C0DB 5DY9A 4OMNA 4ZGDB 4DEXA 1TU0B 2D0QB 3P8BB 1RI0A 3OA6A 4BE2A 2QTVA 1KC8U 2DXUA 2NUPB 5ECAA 1RLPC 1WX6A 3TSZA 3QBYA 3X26B 1MV3A 3ZFJA 2JW4A 1AWXA 2RA2A 4UC4A 1VQOA 2M0YA 3QWYA 3H41A 2LZ6B 1OQKA 5KE2A 1YCYA 4J9FA 2P0KA 1B34A 1PKTA 2P0QA 3H0IA 3CCVT 1VQ4A 1FWZA 2ZZDA 3JCMh 5CKFA 3H6ZA 5KYXA 1HXDA 3CCQQ 3E9GA 2DX1A 4ELZC 5IN1A 1P92A 4F7UG 1R77A 1TTHB 1MMNA 3OYCA 1CSKA 1QMCA 2MI6A 1M27C 1VOMA 3I56A 2CREA 4OB1B 3GBQA 3INZA 4N0AA 1NYFA 3FJPA 4A4EA 2K5FA 5A0DA 2YUQA 1Y57A 3CBPA 3PMIA 2KYBA 3KUFA 1B34B 2V8KA 2ENMA 1VQMA 1QCOA 4JJDA 4M4ZA 2HL5C 3L2ZA 4JRIA 1MMAA 5J26A 5KYXB 4XTZA 2FPDA 2JT4A 5M9OA 1JJ2P 2XU8A 2H3JA 3JB9H 3QJ6A 4DOVA 1AWJA 4F04B 1RABB 2ZPGB 3G71Q 5FRMA 4KGZB 1Q82R 2EFIA 3S3NA 5FRNA 4A4HA 3LX7A 4BDYA 2LQWA 1MMDA 1U06A 3CCLQ 1YJWT 2PUOB 5A2QE 3MEUA 4PKCC 1WYXA 1AZGB 3BE3A 2DL7A 3M54A 2XDDA 3E2UA 2DL8A 3ASKA 4JS5A 3MJXA 4XU3A 1CKBA 2DM1A 2L2PA 4A63B 2LJ1A 3KBGA 5CKBA 3CC2Q 4HCBA 4Z89A 1MNEA 3V7SA 2LC4A 4E7JA 2HMAA 2HNIA 2OX7A 2RN8A 1VQ9T 2XKOC 4FT4A 3RR6A 3RMQA 4C5GA 4JRKA 2DD4A 5CVIA 3I55Q 2QQRA 2HEQA 1KSWA 4OMFB 3UA6A 3LW5E 5GAMf 2J06A 2ABLA 3PVQA 1HD3A 2K9GA 1WI7A 4BI8B 3CC4A 5CR2A 1KC8R 3X24B 1W2BS 4GLKA 3RERA 2V1RA 4RTXA 2RB6A 4HA8A 5CO7A 5A0LA 2CSIA 1X01A 4LDYA 4QQGA 2M1HA 2CZ0B 2XMFA 2RI5A 4PJMA 4LNPA 3NHNA 1T0JA 2DBMA 2CZ7B 2G3RA 2JN0A 2QASA 3FEOA 3A8HB 3ER0A 5KCHA 3OS2A 2DJQA 3CCRT 3BW1A 3SHWA 4HT8A 4JZ3A 2YUPA 5IHNA 2CT4A 4MDXA 1RAAB 3DKMA 3L42A 1VQ5T 1WQWA 3JCMV 3EGXA 2EGCA 1E6HA 2DO3A 2FO0A 1GFDA 4BD3A 1PNJA 3A5ZB 4MMKA 2KY9A 2F2VA 4KUIA 2RK2A 2KDSA 2BE7D 5GANg 3DLLA 2A36A 2HQHA 4C8QG 1K73C 1ACMB 1Q81C 2VVKA 2OTJT 4C92G 3FIFA 4O5VA 3JSCA 1K9MC 2K4YA 1KD1U 2BIVA 2HD0A 2MWPA 2L3QA 4L5GA 4DBQA 5C6SA 4M78A 2XDBA 2KYMA 2WSCE 1BI0A 3EGXB 3EG0A 1GXIE 1K76A 1WHKA 1M1FA 3TQ7P 2DILA 1NYGA 1YFNA 3L2WA 2ZPFB 7AT1B 3HKSA 5GAN3 1M1GA 3OB9A 5KE3A 1A0NB 2IVWA 2D0NA 3G4SA 1NZ9A 1UGPB 1H8KA 3HHTB 1YJWQ 2DXTA 4DOWA 2G6FX 3EGUA 2AZSA 4FYXB 5FU7C 5GANe 5GAMh 4EMKA 2A3LA 2YHTA 1KQ2A 1EIFA 1JU5C 4PJLA 2ZPHB 4B9XA 1WJRA 2QYZA 2RHYA 1MGQA 2RHZA 1OU8A 1UFFA 5CKDA 3QG1A 3TVTA 1OU9A 1WA7A 4X1VA 1Q7YR 1VQ9Q 1ZSZA 3H8ZA 5FW9A 2DXCA 1WHHA 2RNAA 5J3BA 4EMKB 5IHKA 1C6VX 5GAN2
chains in the Genus database with same CATH topology
1Y96A 2K5LA 2R5AA 1U1TA 3Q1JA 4NS5A 1N6AA 3I56T 3CCQA 4Z02A 5GMKj 3NTHA 5GAMd 5FROA 5HK3A 3QHSA 3WVEB 3M57A 1IREB 3N5BB 2K3XA 1UGQB 3CD6A 3SFMA 4PJOE 4OF1A 4PLLA 1X75C 4XU1A 3OYJA 4LDXA 4PJOB 4MDWA 2DVEA 1KHIA 2LQ8A 2P4TA 5CQYA 3OYBA 1N9RA 2QEXT 1M1KC 3HFOA 3FB9A 4OB2B 1WJQA 4ZTFA 2VYTA 4C92D 5A0GA 4RMOA 1YI2T 4M77G 5LJ5g 2RD1A 4ZGEB 1BIAA 3G6ET 5GAOr 3S6WA 3JB9G 3ME9A 1JJ2A 3HP9A 3META 3CCMA 2PUKB 1O75A 2CYZB 2XHCA 3OYYA 3QPHA 3G71T 5GMKm 2F69A 2QI2A 4FM4B 2OTLT 4M7AD 2BKDN 3BDUA 4M78G 4R56A 3V8JA 3NTKA 3QZ9B 2DIGA 2VV5A 3BFMA 4FU6A 2X4WA 4JUVA 2RH2A 3MP6A 3CCJA 3CCLT 4M7DG 1Y96B 3MEWA 3QZ5B 3M5AA 4O6JA 4BI4A 2LQKA 5GAOl 1YITT 5GAMg 1JBMA 2O4XA 4E7HA 4ZN1A 1VQLA 4QW2A 3CCET 4F7UA 4KULA 2L8DA 2QXFA 5D6XA 3PIPA 5KCOA 4BACA 2QA4A 2LCLA 1OZ3A 3M53A 3QYGB 4M77A 1WQ7A 5HKCA 2LNVA 1YIJT 2WSFE 4BUGA 3QDRB 4JLGA 3G71A 3CMEA 5GMKi 2PQWA 1RL2A 2XIDA 3RUXA 2VC8A 3E19A 2ZPIB 3KXTA 2M9UA 3OS0A 3CCUA 4MZMA 3OS1A 4J6YA 4FL6A 4BY6C 3A8OB 3R6OA 3RKXA 4OB3B 4MZPA 3V7RA 5J39A 4JRPA 3CC2T 4C0DC 2PVOB 1Q82C 1W2BA 3VUBA 5GAOq 3OBWA 4L59A 2VGNA 3CPFA 3HFNA 2YLBA 5LJ5e 2OTJA 2E41A 2EJGA 5CIUA 1VQNT 3JCMJ 2XICA 1QVFS 1KD1C 3MP8A 4RKUE 3A8LB 2I2LA 3QIIA 3OYAA 2D9TA 4V2SA 2RK1A 4BI3A 4C5IA 1VQ8T 2X4JA 4F7UE 2HBPA 3QO3A 2O4XB 4M77E 2RJCA 1G3TA 4F7UB 1UGRB 5FU6B 1BI1A 2DAQA 3CBMA 1Y71A 4MMLA 4IURA 4M77B 5LJ5j 5I2SA 3M4GA 4R55A 4JDSA 2E65A 5GAMe 5IT9E 1KQSS 4CRIA 1X6OA 2HQXA 3HRSA 3O8VA 3DLMA 3MO8A 3A8GB 5I2MA 3OYNA 3QKJA 4C92C 4M78B 4C5EA 2VUBA 4WF2A 2DTIA 2GFAA 2EYQA 4MZTA 4KBMB 2FB7A 4NL2A 4J5YA 3CBOA 3HPWA 2DTHA 4KT0E 1VQ8A 2AHJB 4II1A 3LYIA 5FLXE 1Q86C 1NJIC 2FL7A 1UB4A 2R5MA 4PNOA 5DY9A 4C0DB 3JCMb 3CCST 1S72T 4ZGDB 3EFSA 3JCMW 4M7AC 2LCCA 2QQ9A 2CS7A 4PL6A 3WVDB 3CC4T 5GANh 1YJNT 4RG8A 3FC3A 3LH0A 2D0QB 3P8BB 4C0FA 4J83A 4M75D 1RI0A 1VQKT 3OA6A 4BE2A 4ATOA 1KC8U 1K8AU 2DXUA 4C0ZA 2DTOA 2O01E 1NPRA 1H641 2JZ2A 3X26B 2LTOA 2MMPA 3QBYA 3JCMc 3ZFJA 2QQSA 2VXEA 4OB0B 1Q7YU 1NPPA 2RA2A 2WSEE 4UC4A 4RG2A 4QVZA 4RCCA 5CQXA 3E1SA 1M4ZA 5FU7B 2FHDA 4N4GA 4TVRA 3L2UA 3CXCS 2EQUA 1QVPA 2ZGWA 5KE2A 3OYMA 3CC7T 1YCYA 3G7ZA 2E70A 4FIBA 1VIFA 2P0KA 4GY5A 3RKYA 3VJPA 1B34A 3OS5A 2XD0A 2P0QA 3CCVT 2GFUA 4YTLA 3X28B 1VQ4A 1FWZA 2ZZDA 4JLIA 1XTDA 2X35A 1OZ2A 1ZQ1A 3JCMh 5CKFA 2GQVA 3H6ZA 3AHUA 3UPUA 1HXDA 4PLIA 3PFSA 2KQWA 1IZ6A 2NLUA 1N8RU 5LJ3f 4M7DD 2P0PA 3E9GA 1M90C 4ELZC 4HT9A 1KQ1A 3T9NA 1WPYA 5IN1A 2CZ6B 3E9FA 1P92A 4C8QD 2E1HA 4F7UG 1VQMT 3JCMf 2JVVA 3OYCA 2MI6A 3HRTA 5D6YA 3M56A 3BDLA 1VUBA 4FSXA 3X25B 3M55A 4OGEA 1VQPT 1QVFA 5GANd 3I56A 4OB1B 3FRNA 3INZA 3MCAB 1VQ6T 3CCVA 4N0AA 3OW2S 1QP3A 1UEBA 2OAUA 4N0AC 3OY9A 3FJPA 3GIBA 3TREA 3QSUA 1LNXA 5GAN8 4A4EA 2K5FA 3OYGA 5GMKl 5A0DA 2F5TX 4OVAA 1O9SA 3CBPA 3PMIA 4C92F 2DXBA 3PTAA 2DD5A 4Y28E 4LD9K 1OYXA 1G3YA 3KUFA 4QQ6A 2LRQA 1B34B 2V8KA 1YHQT 2QEXA 2MAMA 3OMCA 4HKEA 4XTXA 2DPPB 1YJ9T 5DM7R 2RM4A 1VQMA 1SSFA 1VQ7T 4P5NA 1K73U 2FYKA 4JJNK 1Q81U 1YI2A 4EMGA 4M7AF 3L2ZA 4JRIA 1N9SA 2ZCFB 3G6EA 4Y91A 4JRQA 3P8DA 5J26A 3VYHB 4XTZA 3JCMX 1K9MU 2E64A 2MWOA 4IUVA 2RO0A 5M9OA 2OTLA 2A7YA 1OI1A 2EJ9A 2XU8A 4BE0A 4PJOD 4RCBA 2H3JA 5GAN6 3JB9H 3CEYA 3QJ6A 3JCMd 3JCMQ 4DOVA 4M75A 4X34A 4M75C 3C4SA 1VQOA 3HSBA 2EQKA 1WNLA 2L3RA 4OGCA 2ZPGB 3JB9I 1U8RA 5FRMA 2F5KA 2CKKA 3C95A 4J6WA 3CCLA 3OYFA 3UT1A 2EFIA 1YHQA 5GAN4 3S3NA 3CPWS 1YITA 1BYMA 5FRNA 5HY6A 4A4HA 2JOYA 2EAYA 3PIOA 3LX7A 1VQ7A 3CCEA 1N27A 4BDYA 2E12A 1ZHIA 1ZBXA 4DA4A 1YJWT 5AYFA 2PUOB 4A53A 5A2QE 1QVGS 1YIJA 3MEUA 3JCMP 3MEVA 2RI2A 4PKCC 2B8AA 4C5HA 3M54A 2JTMA 3CMAT 3P8HA 2XDDA 3TU4K 4E7KA 3M9QA 3LLRA 4A4KA 3I55T 3ASKA 1U1SA 4E47A 2MF2A 4JS5A 3CC2A 4XU3A 3OSSC 3SWNC 4BB7A 4XU0A 4IUUA 3QXEB 1KHCA 1XNIA 4M7DC 2LVMA 2CGHA 4J8OA 4C8QA 1VIEA 4C8QC 4ZN3A 3J81E 1UGSB 4E7LA 1JB0E 3KBGA 5CKBA 4C92A 3J80E 2M16A 2XG8D 1VQNA 2ZPBB 3V8KA 4HCBA 4N4HA 5HK0A 3J7AF 4BY6B 1FX7A 1BIBA 2DK3A 1LJOA 3LWHA 5LJ5f 2HAXA 4LDWA 3V7SA 1Q86U 3C94A 2LC4A 1FXXA 2QDYB 4E7JA 3CMAA 1Y7XA 2RHIA 4M7AA 2HNIA 3M4YA 2E10A 1MHNA 3OYIA 1WJSA 1D3BA 3I55A 5GAMj 1M9SA 3BY7A 5CKHA 3OYKA 4JS4A 1VQ9T 5CK9A 2K5IA 2YLCA 2XKOC 2IG0A 2PVGB 4FT4A 5DLQE 3RMQA 4C5GA 1M5Q1 2DD4A 4JRKA 5CVIA 5LL6S 1AHJB 2RHUA 2QQRA 1JRIA 4OMFB 3L2QA 3LW5E 2ZPEB 5GAMf 4OP0A 2K3YA 2CZ1B 5EG2A 3NFCA 4HCZA 3NTIA 4C8QE 4X9DA 4M77D 3CCSA 1S72A 1DJ7B 3UDCA 5KH6A 3L2VA 4C92E 3DB4A 4M75F 4PJOC 3LWIA 3OYEA 2R58A 4BE1A 3JB9D 4BI8B 2JNGA 3M59A 1VQ9A 3CC4A 4C92B 5CR2A 1YJNA 3HL8A 4ME7A 5LJ3h 1G3SA 2QQAA 3X24B 1KC8C 4M78D 1K8AC 3SD4A 1W2BS 3QYHB 4GLKA 2GCXA 3S3MA 1VQKA 3CD6T 3RERA 4M7AE 5GMKh 2KVQG 5GAOp 4L6V5 3URGA 5CKEA 5CAIA 1Q7YC 4M7AB 1QP2A 1G3WA 2RB6A 5IAYA 4HA8A 4XTWA 3HRUA 2L89A 5CO7A 4BDZA 1Y07A 3PNWC 5A0LA 1D3BB 1M8VA 4IUPA 3JRZA 4EPCA 1X01A 3CPWA 2DIQA 1KG1A 1M1KU 4LDYA 4QQGA 1W4SA 2KAFA 2M1HA 2CZ0B 5GAN7 4X9CA 4LD6A 4C0GA 3CC7A 4ZTJA 2RI5A 4NL3A 4DQ2A 3CCMT 1XQHA 1HK9A 5GAN5 2CZ7B 4QQDA 2G3RA 1LOJA 2JN0A 3FEOA 4M75G 2Y4YA 3A8HB 3ER0A 5I21A 3RESA 5KCHA 3OS2A 4M7DF 2LT4A 3RMSA 3VUZA 3VU3C 4C8QF 1N8RC 2X4XA 4VUBA 3VYGA 3BW1A 3CCJT 4Q5WA 3FDRA 4EMHA 3CCRT 2R57A 4HT8A 3VV0A 5C0MA 4MDXA 1VQLT 1KQSA 3DKMA 3L42A 1VQ5T 4IUTA 2DJZA 4J6XA 1WQWA 3V8LA 2QA4T 3JCMV 1VQPA 3PGGA 3CMET 1I8FA 2DO3A 3GPLA 5LJ3d 2DKGA 1VQ6A 4BD3A 3JAME 4NOYA 4IKFA 3RIRA 3A5ZB 3UWNA 2E5QA 4MMKA 3OSVA 4XTUA 5GAOn 1TH7A 2YRVA 3CCUT 1BI3A 2KY9A 3QUIA 5GAOm 3CCRA 4KUIA 2RK2A 1H3ZA 2KK4A 2KDSA 4D6WA 5GANg 3DLLA 2KMTA 4HCCA 3EAEA 4C8QG 4A4FA 1K73C 1Q81C 2XDPA 1Q82U 1VQ5A 2GF7A 3GNFB 2EWNA 2V8JA 3OYDA 4C92G 1YJ9A 2OTJT 2C06A 3FIFA 4PJOF 5FU6C 3MEAA 4O5VA 2VGMA 3JSCA 4M77C 4E7IA 1K9MC 2K4YA 1WGSA 2Y90A 3GOXA 1KD1U 3VKIA 3GP8A 3ZBDA 3CXCA 3G4ST 5D6WA 2D6FA 2BIVA 2DEQA 2HD0A 4M7AG 2MWPA 3WXMB 2XK0A 1NE8A 3EFRA 4IUQA 2LDMA 4L5GA 5C6SA 4M78A 4J7IA 4XAXB 4M78C 2K57A 1BI2A 4ELYC 2XDBA 2WSCE 1G5VA 4XTVA 4KUDK 1BI0A 2WACA 2RHXA 3SWNA 5LJ3g 2LT1A 1GXIE 4XK8E 3L1AA 4M7DA 1M1FA 4M75E 5LJ5h 4J7FA 3L2WA 4FT2A 2RJEA 2ZPFB 3JCMg 4QVDA 2HQEA 3RKWA 4M75B 3HKSA 5GAN3 3FLGA 1M1GA 3OB9A 3OMGA 4LDVA 3A8MB 5KE3A 1YJWA 1JJ2S 3MP1A 2BUDA 2IVWA 5L8RE 3OYHA 3JB9J 3G4SA 1NZ9A 1PSFA 1UGPB 4PJOG 2L5QA 4XTYA 3LGFA 2DZ9A 2FVUA 4A4GA 1NJIU 3HHTB 2EJFA 2RJFA 1BKBA 2DXTA 1PSEA 4QVCA 4DOWA 3PMTA 4CI0C 3TCJA 5FU7C 3GLXA 5GANe 5DLOA 3ZEHA 3OW2A 5GAMh 3GNGA 4EMKA 4M78E 4EMKC 2A3LA 1I4K1 1I5LA 2RI3A 2M0OA 2YHTA 4EDUA 2E6ZA 1KQ2A 1EIFA 2X4YA 2VXFA 4B9WA 2ZPHB 4B9XA 1VQOT 1WJRA 4M7DE 2RHYA 3SB2A 1MGQA 2EKOA 2RHZA 4XU2A 3SWNB 2Y4XA 3TEEA 2PU9B 4M7DB 5GANj 2DZCA 4PJOA 5CKDA 3PT9A 1YBYA 3QG1A 3SDZA 4C8QB 3OYLA 2JUFA 2PVDB 3CCQT 4LDUA 1QW1A 2EIFA 4N4IA 5LJ3e 1R8OB 1I81A 3MHXA 2E6NA 1VQ4T 4ZGJB 2K2VA 3LGLA 5LJ5d 2XI9A 3C12A 3V7CA 5GMKe 4F7UF 5CCAA 3X20B 3JCMe 5GANf 1XOVA 2LX9A 3GF5A 3H8ZA 3QJYA 2RJDA 4M77F 3OQ5A 2QTXA 4XQ3A 2DXCA 3OBYA 1M90U 3L2RA 4A54A 3JB9F 2EQJA 1V29B 3DB3A 2KSSA 5J3BA 2QQBA 2V8IA 3S3OA 4EMKB 3F70A 3M58A 4M78F 5LJ3j 2EQMA 2JTFA 5GAN2 1QVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y96 A;  2DKG A;  1U1T A;  4NOY A;  5GMK j;  3RIR A;  5GAM d;  5GAN h;  3QHS A;  4MMK A;  4XTU A;  5GAO n;  1TH7 A;  1U1S A;  4M75 D;  3QUI A;  5GAO m;  4PJO E;  4XU3 A;  3SWN C;  2DXU A;  4XU0 A;  2DTO A;  4XU1 A;  5GAN g;  4M7D C;  4PJO B;  1H64 1;  2CGH A;  2DVE A;  4C8Q G;  4C8Q A;  3JCM c;  4C8Q C;  1N9R A;  2VXE A;  3HFO A;  2EWN A;  3FB9 A;  2RA2 A;  4C92 G;  4C92 A;  4C92 D;  3FIF A;  4RCC A;  4PJO F;  3V8K A;  4M77 G;  5LJ5 g;  4M77 C;  1BIB A;  2RD1 A;  2ZGW A;  1BIA A;  1LJO A;  2Y90 A;  5GAO r;  5LJ5 f;  3JB9 G;  1YCY A;  3V7S A;  2DEQ A;  5GMK m;  4M7A A;  4M7A G;  3RKY A;  1B34 A;  2HNI A;  4M7A D;  2E10 A;  3EFR A;  3BDU A;  4M78 G;  4M78 A;  1D3B A;  4M78 C;  2K57 A;  3BY7 A;  3V8J A;  5GAM j;  2YLC A;  3BFM A;  4JLI A;  4XTV A;  4JUV A;  3JCM h;  3AHU A;  5LJ3 g;  3SWN A;  1HXD A;  1M5Q 1;  4JRK A;  3L1A A;  4M7D A;  1Y96 B;  4M7D G;  5LJ3 f;  4M7D D;  4M75 E;  5GAO l;  4HT9 A;  1KQ1 A;  5LJ5 h;  5GAM g;  1JBM A;  1JRI A;  1WPY A;  4QVD A;  3JCM g;  4C8Q D;  3RKW A;  5GAM f;  2E1H A;  4F7U G;  4F7U A;  4M75 B;  4OP0 A;  5GAN 3;  3JCM f;  4C8Q E;  4M77 A;  1WQ7 A;  4X9D A;  3JB9 J;  4M77 D;  4PJO G;  5GMK i;  4XTY A;  4C92 E;  4M75 F;  2DZ9 A;  5GAN d;  4PJO C;  3JB9 D;  3INZ A;  2EJF A;  4N0A A;  3RUX A;  4M7A C;  2VC8 A;  4N0A C;  4C92 B;  2DXT A;  3FJP A;  3GIB A;  4QVC A;  5LJ3 d;  1LNX A;  5LJ3 h;  3QSU A;  5GAN 8;  4J6Y A;  4M78 D;  5GAN e;  5GMK l;  3RER A;  3RKX A;  4M7A E;  5GMK h;  5GAM h;  5GAO p;  4C92 F;  4EMK A;  4M78 E;  4EMK C;  5CAI A;  5GAO q;  4M7A B;  1I4K 1;  2RB6 A;  1B34 B;  1I5L A;  4HA8 A;  2YHT A;  4XTW A;  3HFN A;  2YLB A;  4XTX A;  5LJ5 e;  1D3B B;  2E41 A;  2EJG A;  1KQ2 A;  2RM4 A;  1M8V A;  2VXF A;  1X01 A;  3JCM J;  2FYK A;  4M7D E;  2I2L A;  4EMG A;  4M7A F;  3L2Z A;  4JRI A;  1N9S A;  5GAN 7;  4V2S A;  4X9C A;  1MGQ A;  3SB2 A;  4XU2 A;  4Y91 A;  3SWN B;  4NL3 A;  4XTZ A;  3JCM X;  4M7D B;  4DQ2 A;  2E64 A;  2DZC A;  3QO3 A;  4F7U E;  5GAN j;  4PJO A;  1HK9 A;  5GAN 5;  4PJO D;  2EJ9 A;  4C8Q B;  4RCB A;  4M77 E;  5GAN 6;  3JB9 H;  3JCM d;  2JN0 A;  1LOJ A;  4M75 G;  4M75 A;  4F7U B;  5I21 A;  4M75 C;  3JCM Q;  3HSB A;  3RES A;  5LJ3 e;  4M7D F;  1I81 A;  1WNL A;  3JB9 I;  4MML A;  4M77 B;  3VU3 C;  5LJ5 j;  4C8Q F;  3M4G A;  5LJ5 d;  4J6W A;  3V7C A;  5GMK e;  2E65 A;  5GAM e;  3BW1 A;  4EMH A;  4F7U F;  4HT8 A;  3JCM e;  5GAN f;  5GAN 4;  4M77 F;  2EAY A;  2QTX A;  4XQ3 A;  4C92 C;  4M78 B;  2DJZ A;  4WF2 A;  2DTI A;  4A54 A;  4J6X A;  1WQW A;  3V8L A;  3JB9 F;  2FB7 A;  4NL2 A;  4J5Y A;  2DTH A;  4A53 A;  3JCM V;  3JCM P;  4PNO A;  3PGG A;  4EMK B;  3JCM b;  1I8F A;  5DY9 A;  4M78 F;  5LJ3 j;  3EFS A;  3V7R A;  5GAN 2;  3JCM W; 
#chains in the Genus database with same CATH topology
 1Y96 A;  2K5L A;  2R5A A;  3Q1J A;  4AMC A;  3CCQ A;  2KEA A;  2QK0 A;  1X6B A;  1IRE B;  3I35 A;  3UF4 A;  1X75 C;  1SHF A;  2V1Q A;  2DVE A;  1K9A A;  2P4T A;  5CQY A;  1M1K C;  4AFS C;  1WJQ A;  4ZTF A;  2VYT A;  5A0G A;  2D8J A;  2O31 A;  4M77 G;  1YI2 T;  2HZY A;  4LN2 A;  1QKX A;  5GAO r;  3HP9 A;  3OYY A;  2KRN A;  3M0R A;  2OTL T;  4M7A D;  2B86 A;  2BKD N;  3EG1 A;  4AG2 C;  1GFC A;  3EGD A;  2BTT A;  3V8J A;  3NTK A;  3VS1 A;  2CP7 A;  4DBR A;  3MP6 A;  4J9H A;  2DVJ A;  4M7D G;  1Y96 B;  1BCO A;  2LMJ A;  1YIT T;  5GAM g;  1JBM A;  2F2W A;  4QW2 A;  4R0K A;  1BBZ A;  4OMO A;  5D6X A;  3CCR Q;  1IXD A;  2KXC A;  5HKC A;  1WQ7 A;  1VYT A;  1QKW A;  2WSF E;  3G71 A;  2O9V A;  1YCS B;  3M0T A;  1VQ5 Q;  2XID A;  3OS0 A;  1OX9 A;  1UHF A;  1G83 A;  3R6O A;  5J39 A;  4Z88 A;  4CC3 A;  1PC0 A;  4C0D C;  1Q82 C;  2EYZ A;  1G2B A;  3OBW A;  3HFN A;  2YSQ A;  2E41 A;  3EGD B;  1KD1 R;  5CIU A;  1WLP B;  3C0C A;  4RKU E;  1ZA1 B;  3EH2 A;  4EIK A;  2D9T A;  1UJ0 A;  2RK1 A;  1AVZ C;  2QGF B;  2OTJ Q;  2JS0 A;  4HVW A;  4M77 E;  1PM3 A;  1G3T A;  2HSP A;  2DAQ A;  1T3S A;  4R55 A;  1PD0 A;  5I2S A;  5GAM e;  3HRS A;  2OAW A;  4NL2 A;  1ZUY A;  1RAH B;  2IIM A;  1Q86 C;  4CC7 A;  4PNO A;  2R5M A;  3JCM b;  5FWB A;  4M7A C;  1WHJ A;  1D1A A;  2QQ9 A;  2CS7 A;  3FC3 A;  3LH0 A;  2JMA A;  3EH1 A;  1IRX A;  1B7T A;  2K3B A;  2O01 E;  2DA9 A;  2A37 A;  4AFQ C;  3JCM c;  2MMP A;  4OB0 B;  2WSE E;  4RG2 A;  4RCC A;  3CXC S;  3E1S A;  1M4Z A;  4KH1 B;  5FU7 B;  2BZY A;  4TVR A;  1D1B A;  2LP5 A;  2ZGW A;  2GNC A;  3G7Z A;  2DL4 A;  1RAI B;  1VIF A;  3RKY A;  2DNU A;  1E6G A;  2YDL A;  3VS4 A;  4JLI A;  2X35 A;  2JTE A;  1TS9 A;  3AHU A;  4PLI A;  2O88 A;  2NLU A;  1M90 C;  3T9N A;  2CZ6 B;  3E9F A;  1ZUU A;  5FWC A;  2E1H A;  3JCM f;  1WHL A;  2K7A A;  4F17 A;  3HRT A;  5D6Y A;  3M56 A;  3BDL A;  1VUB A;  4AFZ C;  4OGE A;  1I5O B;  3NMZ C;  1VQ6 T;  2OI3 A;  3CCV A;  1Z9Q A;  1UEB A;  4N0A C;  3GIB A;  1LNX A;  5GAN 8;  3OYG A;  4AFU C;  3H9N A;  1G3Y A;  2LRQ A;  1YHQ T;  2QEX A;  3VS5 A;  4XTX A;  2DPP B;  5DM7 R;  2RM4 A;  4P5N A;  2FYK A;  1SRL A;  4JJN K;  1Z9Z A;  2AKL A;  2IPO B;  4EMG A;  4M7A F;  1N9S A;  2ZCF B;  3G6E A;  4JRQ A;  3REA B;  3VYH B;  2FZC B;  3EG9 A;  2E64 A;  2MWO A;  4IUV A;  4PJO D;  4BE0 A;  1YI2 Q;  3JCM Q;  2YRC A;  4M75 A;  3C4S A;  3HSB A;  2F5K A;  3C95 A;  2OTL Q;  4AT1 B;  3UT1 A;  1HSQ A;  5GAN 4;  5HY6 A;  4QT7 A;  4IIM A;  3CCE A;  2LNH B;  2RQR A;  1ZBX A;  1QVG S;  5AYF A;  4A53 A;  1YIJ A;  1YIT Q;  4LUD A;  3P8H A;  4E7K A;  3M9Q A;  3I55 T;  1PHT A;  4E47 A;  2MF2 A;  3OSS C;  3SWN C;  1M2O A;  2LJ3 A;  3QXE B;  3EG9 B;  2LVM A;  5D7U A;  2E4H A;  1VIE A;  4E7L A;  1JB0 E;  1VQN A;  3V8K A;  3LH5 A;  2HAX A;  4LDW A;  1Q86 U;  1RAG B;  3C94 A;  5GJV B;  4M7A A;  4LXC A;  3M4Y A;  2E10 A;  5GAM j;  1M9S A;  2EGE A;  3BY7 A;  3OYK A;  1IHW A;  2NYS A;  2O2O A;  2PVG B;  4KGX B;  5DLQ E;  4J9C A;  1M5Q 1;  5LL6 S;  1AWO A;  2MCN A;  8ATC B;  4OP0 A;  2K3Y A;  5EG2 A;  3NFC A;  3NTI A;  2QG9 B;  1KK7 A;  4X9D A;  3CCS A;  1W6X A;  1DJ7 B;  3UDC A;  1S72 A;  4PJO C;  3LWI A;  3OYE A;  2R58 A;  4BE1 A;  3JB9 D;  2JNG A;  3M59 A;  1VQ9 A;  1YJN A;  2EGA A;  2LX7 A;  1UUE A;  4ME7 A;  4PJJ A;  4M78 D;  1K8A C;  3SD4 A;  1VQK A;  5GAO p;  1NLP C;  5EC7 A;  5CKE A;  1Q7Y C;  4M7A B;  1QP2 A;  5IAY A;  2L89 A;  1NLO C;  4EPC A;  1PWT A;  2DIQ A;  1W4S A;  2KAF A;  5GAN 7;  3CC7 A;  4ZTJ A;  3THK A;  4NL3 A;  3CCM T;  4FSS A;  4OMP A;  1KFZ A;  1M3B A;  2LT4 A;  3JV3 A;  1N8R C;  3CCJ T;  3VYG A;  4EMH A;  3VV0 A;  2C0T A;  3I5R A;  1KQS A;  2DJZ A;  2K2M A;  2KT1 A;  3V8L A;  1VQP A;  4FYW B;  5LJ3 d;  3O5Z A;  2E3I A;  5I11 A;  4Z8A A;  2E5Q A;  3CCU T;  5GAO n;  2CP2 A;  2YRV A;  3EHQ A;  1NEG A;  5GAO m;  3CCR A;  2FRW A;  4HVV A;  1MUZ A;  2KK4 A;  1VQ6 Q;  4HCC A;  3EAE A;  3H0F A;  1QCN A;  1VQ5 A;  2XDP A;  1YJ9 A;  1SG5 A;  3OYD A;  1KQS P;  4PJO F;  2MPX C;  3MEA A;  2LQN A;  2D1X A;  2VGM A;  1WGS A;  2KT8 A;  1YHQ Q;  3ZBD A;  5D6W A;  3WXM B;  4CC4 B;  3VS2 A;  3EFR A;  1V1C A;  4M78 C;  5KYY A;  1IO6 A;  3SWN A;  2LT1 A;  2DER A;  4J7F A;  3PE0 A;  4FT2 A;  2RJE A;  4QVD A;  3JCM g;  3RKW A;  1SSH A;  1X27 A;  3MP1 A;  1LCK A;  3OYH A;  4RTU A;  4XTY A;  3A1P A;  2EQI A;  4A4G A;  1UDL A;  1NJI U;  2X51 A;  2X3X D;  2DRM A;  2EJF A;  1R0B G;  2RJF A;  1BKB A;  1PSE A;  3TCJ A;  5DLO A;  4CC2 A;  4M78 E;  4EMK C;  2COY A;  2M0O A;  4EDU A;  1IGQ A;  1MV0 B;  2X4Y A;  2E5K A;  2X9H A;  1ZA2 B;  1VQO T;  3SWN B;  2Y4X A;  1K0S A;  1FYN A;  2PU9 B;  2DZC A;  1JXM A;  2GTJ A;  4PJO A;  2JUF A;  1UGV A;  2VKN A;  1R8O B;  1VQ4 T;  4ZGJ B;  2K2V A;  5LJ5 d;  2E3H A;  4F7U F;  5CCA A;  3X20 B;  3JCM e;  1BU1 A;  3EG2 A;  2VB6 A;  1XOV A;  1ZSZ C;  2RJD A;  3EHR A;  3OBY A;  3JB9 F;  2EQJ A;  3DB3 A;  1D0X A;  4HCK A;  4M78 F;  5LJ3 j;  2JTF A;  3V7R A;  3I56 T;  1U1T A;  1N6A A;  1M3C A;  4Z02 A;  1ZSG A;  4E7Z A;  5GMK j;  3VS0 A;  5FRO A;  3WVE B;  3M0S A;  5I22 A;  3N5B B;  3CD6 A;  1UGQ B;  4XU1 A;  3OYJ A;  4LDX A;  4PJO B;  4MDW A;  5L23 A;  3OYB A;  1M8M A;  4OB2 B;  4C92 D;  1NM7 A;  4E7S A;  4ZGE B;  2ED0 A;  2PUK B;  1H92 A;  3QPH A;  5GMK m;  2QI2 A;  4FM4 B;  4J9D A;  4R56 A;  2RQW A;  3QZ9 B;  2KNB B;  1OEB A;  2X4W A;  3CCM Q;  2DET A;  1RAC B;  2P4R A;  1TXQ A;  2C0I A;  2A08 A;  2JM8 A;  3QZ5 B;  4O6J A;  4HVU A;  2LQK A;  5GAO l;  1VQL A;  1GCP A;  2C0O A;  4F7U A;  1SKU B;  2QXF A;  3PIP A;  2J05 A;  4KGV B;  3CCJ Q;  2I0N A;  1WIE A;  2QA4 A;  2LCL A;  3QYG B;  3M53 A;  2CP6 A;  2LNV A;  3CME A;  5GMK i;  2GBQ A;  2PQW A;  2HBW A;  1TSF A;  1B3Q A;  2VC8 A;  3E19 A;  3KXT A;  2DBK A;  4MZM A;  1QWE A;  4FL6 A;  4BY6 C;  3RKX A;  3QWX X;  1WFW A;  4MZP A;  4OB3 B;  2M51 A;  2H8H A;  4JRP A;  1AEY A;  1W2B A;  3VUB A;  1BK2 A;  3CCU Q;  3CPF A;  2EJG A;  1QVF S;  3MP8 A;  1M30 A;  3QII A;  4C5I A;  2HBP A;  2LCS A;  1PCX A;  4RTV A;  2KI7 A;  1ARK A;  4F7U B;  4E2F B;  1BI1 A;  5LJ5 j;  1AD5 A;  4CRI A;  1X6O A;  2HQX A;  1W2B P;  3A8G B;  2OJ2 A;  3OYN A;  4C92 C;  1UE9 A;  4M78 B;  1CKA A;  2VUB A;  2GFA A;  2EYQ A;  4KBM B;  2FB7 A;  4J5Y A;  2AK5 A;  1NJI R;  2AHJ B;  4II1 A;  3JCM W;  2LCC A;  1PRL C;  4PL6 A;  3WVD B;  3CC4 T;  1GBQ A;  4C0F A;  4M75 D;  1C0M A;  1FMW A;  4C0Z A;  1JXO A;  1H64 1;  2QQS A;  9ATC B;  4QVZ A;  5CQX A;  3L2U A;  2NWM A;  3OYM A;  2RPN A;  4FIB A;  2NUT A;  4GY5 A;  3VJP A;  1VQO Q;  2XD0 A;  1J3T A;  3X28 B;  1XTD A;  1OZ2 A;  3UPU A;  3PFS A;  2KQW A;  1IZ6 A;  1D09 B;  5LJ3 f;  4PJN A;  4M7D D;  2P0P A;  1WPY A;  3RDV A;  1VQ4 Q;  1NG2 A;  2JVV A;  1UG1 A;  4FSX A;  1QVF A;  1IGU A;  5GAN d;  3SEM A;  3FRN A;  1ZSZ B;  3OW2 S;  1QP3 A;  5AT1 B;  3TRE A;  1VA7 A;  3I5S A;  5GMK l;  2F5T X;  4J9G A;  4OVA A;  3I56 Q;  1HJD A;  1K0X A;  4C92 F;  2DXB A;  3PTA A;  4Y28 E;  4LD9 K;  4JPB W;  4QQ6 A;  1RUW A;  4HKE A;  4JJC A;  1WXT A;  1SSF A;  2YUN A;  4DBF A;  2CT3 A;  1K73 U;  1VQ7 T;  1Q81 U;  2RMO A;  3D7S B;  4Y91 A;  3P8D A;  2O9S A;  4F14 A;  4RTT A;  3JCM X;  1K9M U;  2VAS A;  1YWP A;  4WCI A;  5GAN 6;  3CEY A;  2KGT A;  2CP3 A;  4X34 A;  4M75 C;  2EQK A;  4OGC A;  2L3R A;  1U8R A;  2QDL A;  4J6W A;  3CCL A;  3OYF A;  1ZUK A;  1YHQ A;  3CPW S;  2EAY A;  3PIO A;  1I0C A;  1N27 A;  2E12 A;  2RI2 A;  3QDF A;  3G1J A;  4C5H A;  4WTO B;  3CMA T;  1SHG A;  5IXF A;  3CC2 A;  4BB7 A;  1XNI A;  4M7D C;  1LVK A;  2DE0 X;  2CGH A;  4C8Q A;  1U5S A;  4ZN3 A;  1UGS B;  4C92 A;  2M16 A;  2XG8 D;  2CP5 A;  2ZPB B;  4BY6 B;  1FX7 A;  1BIB A;  2DK3 A;  1LJO A;  4JZ4 A;  5LJ5 f;  2ESW A;  1FXX A;  1C1A A;  2QDY B;  1Y7X A;  2RHI A;  3OYI A;  2PNI A;  3I55 A;  1D0Z A;  2CP0 A;  2HCK A;  2IG0 A;  2V26 A;  4PFO A;  1AHJ B;  2AKK A;  2DL3 A;  1JRI A;  2ZPE B;  2JJ9 A;  4HCZ A;  4IIO A;  4B6M A;  4GLM A;  3L2V A;  2J6O A;  3DB4 A;  4M75 F;  4C92 B;  3HL8 A;  5LJ3 h;  2ZAE A;  1KJW A;  1JEG A;  1KC8 C;  4PFZ A;  3QYH B;  2A28 A;  4M7A E;  5GMK h;  2KVQ G;  4L6V 5;  3CC4 Q;  1U3O A;  5CAI A;  4J9E A;  4XTW A;  4BDZ A;  3HRU A;  3PNW C;  4IUP A;  3JRZ A;  3CPW A;  1KG1 A;  1M1K U;  4X9C A;  4LD6 A;  4C0G A;  4DQ2 A;  1XQH A;  1HK9 A;  5GAN 5;  4QQD A;  1LOJ A;  5I21 A;  4M7D F;  3RMS A;  3VUZ A;  4Q5W A;  3FDR A;  3NPF A;  4OMM A;  3PGG A;  1I8F A;  1ZBJ A;  3RNJ A;  2DKG A;  4NOY A;  3RIR A;  4XTU A;  2GTO A;  1AWW A;  2KMT A;  1Q81 R;  4A4F A;  3H0H A;  1Q82 U;  1UTI A;  2GF7 A;  1QLY A;  2EYY A;  1R0C B;  2M02 A;  2C06 A;  1G8X A;  5FU6 C;  1K9M R;  4E7I A;  2Y90 A;  3VKI A;  3CXC A;  1VQ7 Q;  2DEQ A;  4GBQ A;  2H3E B;  4J7I A;  4E6R A;  4ELY C;  2K57 A;  1G5V A;  1ABQ A;  2J6K A;  4KUD K;  2YXY A;  2WAC A;  5LJ3 g;  4XK8 E;  1RLQ C;  4M7D A;  5LJ5 h;  2HQE A;  4M75 B;  1JJ2 S;  1YJW A;  4LDV A;  5L8R E;  1D0Y A;  4AG1 C;  3JB9 J;  1OUL A;  1PSF A;  4PJO G;  4LUE A;  1PRM C;  1SRM A;  2L5Q A;  2DZ9 A;  2FVU A;  2K6D A;  3CXC P;  1ABO A;  4QVC A;  3PMT A;  3FJ5 A;  3ZEH A;  3CMA Q;  1QCF A;  5IHI A;  1T0H A;  1TUC A;  3M0U A;  4B9W A;  3VS7 A;  1EX4 A;  3SB2 A;  4XU2 A;  4M7D B;  3PT9 A;  3A98 A;  3OYL A;  1JQQ A;  2PVD B;  1QW1 A;  2EYW A;  5LJ3 e;  3MHX A;  2XI9 A;  3C12 A;  5GMK e;  1M2V A;  2RQU A;  5GAN f;  2LX9 A;  3GF5 A;  2QTX A;  1M90 U;  3L2R A;  4A54 A;  3UAT A;  2KSS A;  3RBB B;  2GGR A;  3S3O A;  1I1J A;  2EW3 A;  3GOX A;  1QVG A;  4NS5 A;  1RAD B;  3NTH A;  3QHS A;  2K3X A;  4PJO E;  4OF1 A;  4PLL A;  2ROL A;  1MMG A;  1KHI A;  2LQ8 A;  1VYU A;  1M1K R;  1N9R A;  2QEX T;  1X2K A;  2CDT A;  2HSE B;  4RMO A;  1RI9 A;  5LJ5 g;  3G6E T;  1M2V B;  3JB9 G;  1JJ2 A;  4JJB A;  1O75 A;  2CYZ B;  2XHC A;  2HKQ B;  1GRI A;  1IB8 A;  1QVG P;  2KRM A;  3BDU A;  4M78 G;  2DIG A;  2VV5 A;  3BFM A;  1E7O A;  4FYY B;  3M5A A;  2ED1 A;  4ORZ A;  4ZN1 A;  3CCE T;  4RTW A;  4KUL A;  3EG3 A;  3NGP A;  1AT1 B;  5KCO A;  4F16 A;  1W1F A;  1OZ3 A;  2JXB A;  1YIJ T;  2RF0 A;  1SF9 A;  3M0Q A;  1RL2 A;  2SRC A;  5GJW B;  1KIK A;  2ZPI B;  1IHV A;  2M9U A;  4J6Y A;  2RQT A;  4Y92 A;  2QAZ A;  2VGN A;  4L59 A;  2MOX A;  2YLB A;  5LJ5 e;  2OTJ A;  4J9B A;  1VQN T;  2XIC A;  2JMC A;  1KD1 C;  3A8L B;  4V2S A;  2FEI A;  4BI3 A;  2SEM A;  1VQ8 T;  2X4J A;  5KYU A;  4F7U E;  1BCM A;  2FG0 A;  2W10 A;  1Y0M A;  2RJC A;  5FU6 B;  3CBM A;  3M4G A;  2BE9 B;  2J6F A;  3MPU B;  3MO8 A;  4C5E A;  5KYY B;  4WF2 A;  4MZT A;  1GL5 A;  1Q86 R;  1YP5 A;  3HPW A;  2FL7 A;  1UB4 A;  2F2X A;  3CCS T;  1S72 T;  3EFS A;  4RTY A;  5GAN h;  1YJN T;  4RG8 A;  4J83 A;  1VQK T;  4ATO A;  1K8A U;  5KYU B;  2PZ1 A;  2DTO A;  1NPR A;  2JZ2 A;  2LTO A;  2MIO A;  1OPK A;  1X43 A;  2VXE A;  1Q7Y U;  4DEY A;  1D1C A;  1NPP A;  1TWB A;  4D8K A;  1K1Z A;  2FHD A;  4N4G A;  2EQU A;  1QVP A;  1X2Q A;  3CC7 T;  2DL5 A;  2E70 A;  4DBH A;  3KFV A;  1K4U S;  3M0P A;  4HXJ A;  3OS5 A;  4FW1 A;  2GFU A;  4YTL A;  2FRY A;  2ECZ A;  2GQV A;  2L0A A;  1N8R U;  1M90 R;  4HT9 A;  1KQ1 A;  1SPK A;  4C8Q D;  2DFU A;  1VQM T;  1I07 A;  3X25 B;  3M55 A;  1VQP T;  3MCA B;  2OAU A;  2MK5 A;  3OY9 A;  3QSU A;  1OX8 A;  1O9S A;  2DD5 A;  3CCV Q;  1OYX A;  1PD1 A;  1PG5 B;  2MAM A;  3OMC A;  2DYI A;  1YJ9 T;  1QQJ A;  1YI2 A;  2EVR A;  4ANJ A;  2FPF A;  2QEX Q;  3TSW A;  2RO0 A;  2OTL A;  2A7Y A;  1OI1 A;  2EJ9 A;  4RCB A;  3JCM d;  5IXB A;  3G6E Q;  1WNL A;  3JB9 I;  1YN8 A;  2CKK A;  1QWF A;  1OPL A;  1NBE B;  1YIT A;  1BYM A;  2A0F B;  2JOY A;  1ZX6 A;  1VQ7 A;  2W0Z A;  2DRK A;  1ZHI A;  4DA4 A;  2BZX A;  3JCM P;  3MEV A;  2EPD A;  2F1L A;  3CCE Q;  3AT1 B;  2B8A A;  2JTM A;  2AIR B;  3PVL A;  3TU4 K;  1YIJ Q;  3LLR A;  4A4K A;  1U1S A;  4XU0 A;  4IUU A;  1KHC A;  6AT1 B;  2HKN A;  2L3S A;  2MYS A;  4QKU A;  2YRD A;  4J8O A;  4C8Q C;  1S1N A;  3UA7 A;  3J81 E;  8AT1 B;  1UHC A;  3J80 E;  4N4H A;  5HK0 A;  2Z0W A;  3J7A F;  1FMK A;  3LWH A;  3EFO A;  1VQN Q;  3CMA A;  2EYX A;  4FYV B;  1MHN A;  1WJS A;  1B07 A;  1D3B A;  5CKH A;  1N5Z A;  4JS4 A;  5CK9 A;  1VQ8 Q;  2K5I A;  2YLC A;  3VS6 A;  2RHU A;  1YNZ A;  3L2Q A;  2HDA A;  2CZ1 B;  2RQV A;  2KE9 A;  2AT1 B;  4C8Q E;  4M77 D;  1VYV A;  5KH6 A;  4C92 E;  2VWF A;  1TOV A;  3ZL7 C;  1RAE B;  1K8A R;  1G3S A;  2QQA A;  3CCS Q;  1S72 Q;  3CD6 T;  3S3M A;  2GCX A;  2DLP A;  3URG A;  4LE9 A;  3EFO B;  1YJN Q;  1G3W A;  1MND A;  1Y07 A;  1VQK Q;  1D3B B;  1M8V A;  1EZZ B;  5HCK A;  1OOT A;  4KRT A;  1GCQ C;  1JO8 A;  4M75 G;  2Y4Y A;  4PK4 A;  3CC7 Q;  3RES A;  1N8R R;  3VU3 C;  2CH4 A;  4C8Q F;  1TUD A;  2AZV A;  2X4X A;  4VUB A;  2CUD A;  2KRS A;  2R57 A;  5C0M A;  2NUT B;  4OML A;  2DEU A;  1H3H A;  1VQL T;  4KH0 B;  4IUT A;  4J6X A;  2FZG B;  2QA4 T;  2YT6 A;  1T3L A;  3CME T;  5IH2 A;  3GPL A;  1QVF P;  1VQM Q;  1VQ6 A;  3JAM E;  3UWN A;  1VQP Q;  3OSV A;  1TH7 A;  3VS3 A;  1BI3 A;  3QUI A;  3VRZ A;  1H3Z A;  4D6W A;  2L3P A;  2KR3 A;  2K79 A;  2DF6 A;  3GNF B;  2EWN A;  2V8J A;  1SEM A;  4M77 C;  1AZE A;  1W70 A;  1WHM A;  3GP8 A;  1YJ9 Q;  3G4S T;  2D6F A;  4M7A G;  1OV3 A;  2XK0 A;  1NE8 A;  4IUQ A;  4ZNX A;  2LDM A;  4XAX B;  2FPE A;  3R6N A;  1BI2 A;  1V76 A;  4XTV A;  2RHX A;  3L1A A;  2ROT A;  4M75 E;  1UEC A;  2CH4 W;  2KRO A;  1GBR A;  3FLG A;  3OMG A;  3A8M B;  2BUD A;  3LGF A;  1WZO A;  4RTZ A;  4CI0 C;  3GLX A;  3OW2 A;  3GNG A;  3I9Q A;  1I4K 1;  1I5L A;  2PTK A;  2RI3 A;  2YWW A;  2E6Z A;  1XJW B;  2GQI A;  4ESR A;  2VXF A;  4M7D E;  2CUB A;  2BZ8 A;  2KXD A;  2EKO A;  3TEE A;  3IQL A;  5GAN j;  2KBT A;  1YBY A;  2NUZ A;  3SDZ A;  4C8Q B;  2HL3 A;  4RUG A;  3CCQ T;  4LDU A;  2EIF A;  4N4I A;  1I81 A;  2E6N A;  3LGL A;  2COW A;  3V7C A;  3OW2 P;  1WXU A;  3QJY A;  3U23 A;  4M77 F;  3OQ5 A;  4XQ3 A;  1V29 B;  2QQB A;  2V8I A;  3F70 A;  1GCQ A;  3M58 A;  4IKF A;  2EQM A;  2RH2 A;  1ZQ1 A;  5GAM d;  5HK3 A;  1NEB A;  3M57 A;  3SFM A;  1BB9 A;  5KYW A;  2J7I A;  1WDX A;  2COZ A;  3CD6 Q;  3HFO A;  1HYO A;  3FB9 A;  1AOJ A;  4FCY A;  3ULR B;  4D8D A;  2RD1 A;  3CPW P;  1BIA A;  3S6W A;  3ME9 A;  3MET A;  3CCM A;  3G71 T;  1X69 A;  2F69 A;  1F1B B;  3MKD A;  1TG0 A;  2DMO A;  4FU6 A;  2X3W D;  4JUV A;  3CCJ A;  1X6G A;  4PFP A;  3CCL T;  2LJ0 A;  2YUO A;  3MEW A;  4BI4 A;  1K73 R;  2O4X A;  4E7H A;  1EFN A;  2L8D A;  1PKS A;  4OMQ A;  4BAC A;  5KYW B;  4M77 A;  3HTR A;  4BUG A;  3QDR B;  1RAF B;  4JLG A;  1VQL Q;  1LPL A;  3RUX A;  2ATC B;  2QA4 Q;  3CCU A;  4FW2 A;  3OS1 A;  3CME Q;  3A8O B;  1M3A A;  2FZK B;  3CC2 T;  2PVO B;  2P84 A;  5KYN A;  5GAO q;  4K11 A;  1YWO A;  2JS2 A;  3JCM J;  2I2L A;  3OYA A;  2NUP A;  3QO3 A;  2EKH A;  2O4X B;  2CSQ A;  2DYB A;  1UGR B;  3CQT A;  1TUG B;  3G4S Q;  1Y71 A;  4MML A;  4IUR A;  4M77 B;  4JDS A;  1WHG A;  2E65 A;  5IT9 E;  1KQS S;  2EBP A;  2JM9 A;  3O8V A;  3DLM A;  1WXB A;  5I2M A;  1Q95 G;  3QKJ A;  2QGG A;  1FMV A;  2D8H A;  2DTI A;  1ZLM A;  3REB B;  3CBO A;  2DTH A;  4J9I A;  4KT0 E;  3VRY A;  1VQ8 A;  1UJY A;  3LYI A;  5FLX E;  1NJI C;  4C0D B;  5DY9 A;  4OMN A;  4ZGD B;  4DEX A;  1TU0 B;  2D0Q B;  3P8B B;  1RI0 A;  3OA6 A;  4BE2 A;  2QTV A;  1KC8 U;  2DXU A;  2NUP B;  5ECA A;  1RLP C;  1WX6 A;  3TSZ A;  3QBY A;  3X26 B;  1MV3 A;  3ZFJ A;  2JW4 A;  1AWX A;  2RA2 A;  4UC4 A;  1VQO A;  2M0Y A;  3QWY A;  3H41 A;  2LZ6 B;  1OQK A;  5KE2 A;  1YCY A;  4J9F A;  2P0K A;  1B34 A;  1PKT A;  2P0Q A;  3H0I A;  3CCV T;  1VQ4 A;  1FWZ A;  2ZZD A;  3JCM h;  5CKF A;  3H6Z A;  5KYX A;  1HXD A;  3CCQ Q;  3E9G A;  2DX1 A;  4ELZ C;  5IN1 A;  1P92 A;  4F7U G;  1R77 A;  1TTH B;  1MMN A;  3OYC A;  1CSK A;  1QMC A;  2MI6 A;  1M27 C;  1VOM A;  3I56 A;  2CRE A;  4OB1 B;  3GBQ A;  3INZ A;  4N0A A;  1NYF A;  3FJP A;  4A4E A;  2K5F A;  5A0D A;  2YUQ A;  1Y57 A;  3CBP A;  3PMI A;  2KYB A;  3KUF A;  1B34 B;  2V8K A;  2ENM A;  1VQM A;  1QCO A;  4JJD A;  4M4Z A;  2HL5 C;  3L2Z A;  4JRI A;  1MMA A;  5J26 A;  5KYX B;  4XTZ A;  2FPD A;  2JT4 A;  5M9O A;  1JJ2 P;  2XU8 A;  2H3J A;  3JB9 H;  3QJ6 A;  4DOV A;  1AWJ A;  4F04 B;  1RAB B;  2ZPG B;  3G71 Q;  5FRM A;  4KGZ B;  1Q82 R;  2EFI A;  3S3N A;  5FRN A;  4A4H A;  3LX7 A;  4BDY A;  2LQW A;  1MMD A;  1U06 A;  3CCL Q;  1YJW T;  2PUO B;  5A2Q E;  3MEU A;  4PKC C;  1WYX A;  1AZG B;  3BE3 A;  2DL7 A;  3M54 A;  2XDD A;  3E2U A;  2DL8 A;  3ASK A;  4JS5 A;  3MJX A;  4XU3 A;  1CKB A;  2DM1 A;  2L2P A;  4A63 B;  2LJ1 A;  3KBG A;  5CKB A;  3CC2 Q;  4HCB A;  4Z89 A;  1MNE A;  3V7S A;  2LC4 A;  4E7J A;  2HMA A;  2HNI A;  2OX7 A;  2RN8 A;  1VQ9 T;  2XKO C;  4FT4 A;  3RR6 A;  3RMQ A;  4C5G A;  4JRK A;  2DD4 A;  5CVI A;  3I55 Q;  2QQR A;  2HEQ A;  1KSW A;  4OMF B;  3UA6 A;  3LW5 E;  5GAM f;  2J06 A;  2ABL A;  3PVQ A;  1HD3 A;  2K9G A;  1WI7 A;  4BI8 B;  3CC4 A;  5CR2 A;  1KC8 R;  3X24 B;  1W2B S;  4GLK A;  3RER A;  2V1R A;  4RTX A;  2RB6 A;  4HA8 A;  5CO7 A;  5A0L A;  2CSI A;  1X01 A;  4LDY A;  4QQG A;  2M1H A;  2CZ0 B;  2XMF A;  2RI5 A;  4PJM A;  4LNP A;  3NHN A;  1T0J A;  2DBM A;  2CZ7 B;  2G3R A;  2JN0 A;  2QAS A;  3FEO A;  3A8H B;  3ER0 A;  5KCH A;  3OS2 A;  2DJQ A;  3CCR T;  3BW1 A;  3SHW A;  4HT8 A;  4JZ3 A;  2YUP A;  5IHN A;  2CT4 A;  4MDX A;  1RAA B;  3DKM A;  3L42 A;  1VQ5 T;  1WQW A;  3JCM V;  3EGX A;  2EGC A;  1E6H A;  2DO3 A;  2FO0 A;  1GFD A;  4BD3 A;  1PNJ A;  3A5Z B;  4MMK A;  2KY9 A;  2F2V A;  4KUI A;  2RK2 A;  2KDS A;  2BE7 D;  5GAN g;  3DLL A;  2A36 A;  2HQH A;  4C8Q G;  1K73 C;  1ACM B;  1Q81 C;  2VVK A;  2OTJ T;  4C92 G;  3FIF A;  4O5V A;  3JSC A;  1K9M C;  2K4Y A;  1KD1 U;  2BIV A;  2HD0 A;  2MWP A;  2L3Q A;  4L5G A;  4DBQ A;  5C6S A;  4M78 A;  2XDB A;  2KYM A;  2WSC E;  1BI0 A;  3EGX B;  3EG0 A;  1GXI E;  1K76 A;  1WHK A;  1M1F A;  3TQ7 P;  2DIL A;  1NYG A;  1YFN A;  3L2W A;  2ZPF B;  7AT1 B;  3HKS A;  5GAN 3;  1M1G A;  3OB9 A;  5KE3 A;  1A0N B;  2IVW A;  2D0N A;  3G4S A;  1NZ9 A;  1UGP B;  1H8K A;  3HHT B;  1YJW Q;  2DXT A;  4DOW A;  2G6F X;  3EGU A;  2AZS A;  4FYX B;  5FU7 C;  5GAN e;  5GAM h;  4EMK A;  2A3L A;  2YHT A;  1KQ2 A;  1EIF A;  1JU5 C;  4PJL A;  2ZPH B;  4B9X A;  1WJR A;  2QYZ A;  2RHY A;  1MGQ A;  2RHZ A;  1OU8 A;  1UFF A;  5CKD A;  3QG1 A;  3TVT A;  1OU9 A;  1WA7 A;  4X1V A;  1Q7Y R;  1VQ9 Q;  1ZSZ A;  3H8Z A;  5FW9 A;  2DXC A;  1WHH A;  2RNA A;  5J3B A;  4EMK B;  5IHK A;  1C6V X;  5GAN 2; 
#chains in the Genus database with same CATH homology
 1Y96 A;  2K5L A;  2R5A A;  1U1T A;  3Q1J A;  4NS5 A;  1N6A A;  3I56 T;  3CCQ A;  4Z02 A;  5GMK j;  3NTH A;  5GAM d;  5FRO A;  5HK3 A;  3QHS A;  3WVE B;  3M57 A;  1IRE B;  3N5B B;  2K3X A;  1UGQ B;  3CD6 A;  3SFM A;  4PJO E;  4OF1 A;  4PLL A;  1X75 C;  4XU1 A;  3OYJ A;  4LDX A;  4PJO B;  4MDW A;  2DVE A;  1KHI A;  2LQ8 A;  2P4T A;  5CQY A;  3OYB A;  1N9R A;  2QEX T;  1M1K C;  3HFO A;  3FB9 A;  4OB2 B;  1WJQ A;  4ZTF A;  2VYT A;  4C92 D;  5A0G A;  4RMO A;  1YI2 T;  4M77 G;  5LJ5 g;  2RD1 A;  4ZGE B;  1BIA A;  3G6E T;  5GAO r;  3S6W A;  3JB9 G;  3ME9 A;  1JJ2 A;  3HP9 A;  3MET A;  3CCM A;  2PUK B;  1O75 A;  2CYZ B;  2XHC A;  3OYY A;  3QPH A;  3G71 T;  5GMK m;  2F69 A;  2QI2 A;  4FM4 B;  2OTL T;  4M7A D;  2BKD N;  3BDU A;  4M78 G;  4R56 A;  3V8J A;  3NTK A;  3QZ9 B;  2DIG A;  2VV5 A;  3BFM A;  4FU6 A;  2X4W A;  4JUV A;  2RH2 A;  3MP6 A;  3CCJ A;  3CCL T;  4M7D G;  1Y96 B;  3MEW A;  3QZ5 B;  3M5A A;  4O6J A;  4BI4 A;  2LQK A;  5GAO l;  1YIT T;  5GAM g;  1JBM A;  2O4X A;  4E7H A;  4ZN1 A;  1VQL A;  4QW2 A;  3CCE T;  4F7U A;  4KUL A;  2L8D A;  2QXF A;  5D6X A;  3PIP A;  5KCO A;  4BAC A;  2QA4 A;  2LCL A;  1OZ3 A;  3M53 A;  3QYG B;  4M77 A;  1WQ7 A;  5HKC A;  2LNV A;  1YIJ T;  2WSF E;  4BUG A;  3QDR B;  4JLG A;  3G71 A;  3CME A;  5GMK i;  2PQW A;  1RL2 A;  2XID A;  3RUX A;  2VC8 A;  3E19 A;  2ZPI B;  3KXT A;  2M9U A;  3OS0 A;  3CCU A;  4MZM A;  3OS1 A;  4J6Y A;  4FL6 A;  4BY6 C;  3A8O B;  3R6O A;  3RKX A;  4OB3 B;  4MZP A;  3V7R A;  5J39 A;  4JRP A;  3CC2 T;  4C0D C;  2PVO B;  1Q82 C;  1W2B A;  3VUB A;  5GAO q;  3OBW A;  4L59 A;  2VGN A;  3CPF A;  3HFN A;  2YLB A;  5LJ5 e;  2OTJ A;  2E41 A;  2EJG A;  5CIU A;  1VQN T;  3JCM J;  2XIC A;  1QVF S;  1KD1 C;  3MP8 A;  4RKU E;  3A8L B;  2I2L A;  3QII A;  3OYA A;  2D9T A;  4V2S A;  2RK1 A;  4BI3 A;  4C5I A;  1VQ8 T;  2X4J A;  4F7U E;  2HBP A;  3QO3 A;  2O4X B;  4M77 E;  2RJC A;  1G3T A;  4F7U B;  1UGR B;  5FU6 B;  1BI1 A;  2DAQ A;  3CBM A;  1Y71 A;  4MML A;  4IUR A;  4M77 B;  5LJ5 j;  5I2S A;  3M4G A;  4R55 A;  4JDS A;  2E65 A;  5GAM e;  5IT9 E;  1KQS S;  4CRI A;  1X6O A;  2HQX A;  3HRS A;  3O8V A;  3DLM A;  3MO8 A;  3A8G B;  5I2M A;  3OYN A;  3QKJ A;  4C92 C;  4M78 B;  4C5E A;  2VUB A;  4WF2 A;  2DTI A;  2GFA A;  2EYQ A;  4MZT A;  4KBM B;  2FB7 A;  4NL2 A;  4J5Y A;  3CBO A;  3HPW A;  2DTH A;  4KT0 E;  1VQ8 A;  2AHJ B;  4II1 A;  3LYI A;  5FLX E;  1Q86 C;  1NJI C;  2FL7 A;  1UB4 A;  2R5M A;  4PNO A;  5DY9 A;  4C0D B;  3JCM b;  3CCS T;  1S72 T;  4ZGD B;  3EFS A;  3JCM W;  4M7A C;  2LCC A;  2QQ9 A;  2CS7 A;  4PL6 A;  3WVD B;  3CC4 T;  5GAN h;  1YJN T;  4RG8 A;  3FC3 A;  3LH0 A;  2D0Q B;  3P8B B;  4C0F A;  4J83 A;  4M75 D;  1RI0 A;  1VQK T;  3OA6 A;  4BE2 A;  4ATO A;  1KC8 U;  1K8A U;  2DXU A;  4C0Z A;  2DTO A;  2O01 E;  1NPR A;  1H64 1;  2JZ2 A;  3X26 B;  2LTO A;  2MMP A;  3QBY A;  3JCM c;  3ZFJ A;  2QQS A;  2VXE A;  4OB0 B;  1Q7Y U;  1NPP A;  2RA2 A;  2WSE E;  4UC4 A;  4RG2 A;  4QVZ A;  4RCC A;  5CQX A;  3E1S A;  1M4Z A;  5FU7 B;  2FHD A;  4N4G A;  4TVR A;  3L2U A;  3CXC S;  2EQU A;  1QVP A;  2ZGW A;  5KE2 A;  3OYM A;  3CC7 T;  1YCY A;  3G7Z A;  2E70 A;  4FIB A;  1VIF A;  2P0K A;  4GY5 A;  3RKY A;  3VJP A;  1B34 A;  3OS5 A;  2XD0 A;  2P0Q A;  3CCV T;  2GFU A;  4YTL A;  3X28 B;  1VQ4 A;  1FWZ A;  2ZZD A;  4JLI A;  1XTD A;  2X35 A;  1OZ2 A;  1ZQ1 A;  3JCM h;  5CKF A;  2GQV A;  3H6Z A;  3AHU A;  3UPU A;  1HXD A;  4PLI A;  3PFS A;  2KQW A;  1IZ6 A;  2NLU A;  1N8R U;  5LJ3 f;  4M7D D;  2P0P A;  3E9G A;  1M90 C;  4ELZ C;  4HT9 A;  1KQ1 A;  3T9N A;  1WPY A;  5IN1 A;  2CZ6 B;  3E9F A;  1P92 A;  4C8Q D;  2E1H A;  4F7U G;  1VQM T;  3JCM f;  2JVV A;  3OYC A;  2MI6 A;  3HRT A;  5D6Y A;  3M56 A;  3BDL A;  1VUB A;  4FSX A;  3X25 B;  3M55 A;  4OGE A;  1VQP T;  1QVF A;  5GAN d;  3I56 A;  4OB1 B;  3FRN A;  3INZ A;  3MCA B;  1VQ6 T;  3CCV A;  4N0A A;  3OW2 S;  1QP3 A;  1UEB A;  2OAU A;  4N0A C;  3OY9 A;  3FJP A;  3GIB A;  3TRE A;  3QSU A;  1LNX A;  5GAN 8;  4A4E A;  2K5F A;  3OYG A;  5GMK l;  5A0D A;  2F5T X;  4OVA A;  1O9S A;  3CBP A;  3PMI A;  4C92 F;  2DXB A;  3PTA A;  2DD5 A;  4Y28 E;  4LD9 K;  1OYX A;  1G3Y A;  3KUF A;  4QQ6 A;  2LRQ A;  1B34 B;  2V8K A;  1YHQ T;  2QEX A;  2MAM A;  3OMC A;  4HKE A;  4XTX A;  2DPP B;  1YJ9 T;  5DM7 R;  2RM4 A;  1VQM A;  1SSF A;  1VQ7 T;  4P5N A;  1K73 U;  2FYK A;  4JJN K;  1Q81 U;  1YI2 A;  4EMG A;  4M7A F;  3L2Z A;  4JRI A;  1N9S A;  2ZCF B;  3G6E A;  4Y91 A;  4JRQ A;  3P8D A;  5J26 A;  3VYH B;  4XTZ A;  3JCM X;  1K9M U;  2E64 A;  2MWO A;  4IUV A;  2RO0 A;  5M9O A;  2OTL A;  2A7Y A;  1OI1 A;  2EJ9 A;  2XU8 A;  4BE0 A;  4PJO D;  4RCB A;  2H3J A;  5GAN 6;  3JB9 H;  3CEY A;  3QJ6 A;  3JCM d;  3JCM Q;  4DOV A;  4M75 A;  4X34 A;  4M75 C;  3C4S A;  1VQO A;  3HSB A;  2EQK A;  1WNL A;  2L3R A;  4OGC A;  2ZPG B;  3JB9 I;  1U8R A;  5FRM A;  2F5K A;  2CKK A;  3C95 A;  4J6W A;  3CCL A;  3OYF A;  3UT1 A;  2EFI A;  1YHQ A;  5GAN 4;  3S3N A;  3CPW S;  1YIT A;  1BYM A;  5FRN A;  5HY6 A;  4A4H A;  2JOY A;  2EAY A;  3PIO A;  3LX7 A;  1VQ7 A;  3CCE A;  1N27 A;  4BDY A;  2E12 A;  1ZHI A;  1ZBX A;  4DA4 A;  1YJW T;  5AYF A;  2PUO B;  4A53 A;  5A2Q E;  1QVG S;  1YIJ A;  3MEU A;  3JCM P;  3MEV A;  2RI2 A;  4PKC C;  2B8A A;  4C5H A;  3M54 A;  2JTM A;  3CMA T;  3P8H A;  2XDD A;  3TU4 K;  4E7K A;  3M9Q A;  3LLR A;  4A4K A;  3I55 T;  3ASK A;  1U1S A;  4E47 A;  2MF2 A;  4JS5 A;  3CC2 A;  4XU3 A;  3OSS C;  3SWN C;  4BB7 A;  4XU0 A;  4IUU A;  3QXE B;  1KHC A;  1XNI A;  4M7D C;  2LVM A;  2CGH A;  4J8O A;  4C8Q A;  1VIE A;  4C8Q C;  4ZN3 A;  3J81 E;  1UGS B;  4E7L A;  1JB0 E;  3KBG A;  5CKB A;  4C92 A;  3J80 E;  2M16 A;  2XG8 D;  1VQN A;  2ZPB B;  3V8K A;  4HCB A;  4N4H A;  5HK0 A;  3J7A F;  4BY6 B;  1FX7 A;  1BIB A;  2DK3 A;  1LJO A;  3LWH A;  5LJ5 f;  2HAX A;  4LDW A;  3V7S A;  1Q86 U;  3C94 A;  2LC4 A;  1FXX A;  2QDY B;  4E7J A;  3CMA A;  1Y7X A;  2RHI A;  4M7A A;  2HNI A;  3M4Y A;  2E10 A;  1MHN A;  3OYI A;  1WJS A;  1D3B A;  3I55 A;  5GAM j;  1M9S A;  3BY7 A;  5CKH A;  3OYK A;  4JS4 A;  1VQ9 T;  5CK9 A;  2K5I A;  2YLC A;  2XKO C;  2IG0 A;  2PVG B;  4FT4 A;  5DLQ E;  3RMQ A;  4C5G A;  1M5Q 1;  2DD4 A;  4JRK A;  5CVI A;  5LL6 S;  1AHJ B;  2RHU A;  2QQR A;  1JRI A;  4OMF B;  3L2Q A;  3LW5 E;  2ZPE B;  5GAM f;  4OP0 A;  2K3Y A;  2CZ1 B;  5EG2 A;  3NFC A;  4HCZ A;  3NTI A;  4C8Q E;  4X9D A;  4M77 D;  3CCS A;  1S72 A;  1DJ7 B;  3UDC A;  5KH6 A;  3L2V A;  4C92 E;  3DB4 A;  4M75 F;  4PJO C;  3LWI A;  3OYE A;  2R58 A;  4BE1 A;  3JB9 D;  4BI8 B;  2JNG A;  3M59 A;  1VQ9 A;  3CC4 A;  4C92 B;  5CR2 A;  1YJN A;  3HL8 A;  4ME7 A;  5LJ3 h;  1G3S A;  2QQA A;  3X24 B;  1KC8 C;  4M78 D;  1K8A C;  3SD4 A;  1W2B S;  3QYH B;  4GLK A;  2GCX A;  3S3M A;  1VQK A;  3CD6 T;  3RER A;  4M7A E;  5GMK h;  2KVQ G;  5GAO p;  4L6V 5;  3URG A;  5CKE A;  5CAI A;  1Q7Y C;  4M7A B;  1QP2 A;  1G3W A;  2RB6 A;  5IAY A;  4HA8 A;  4XTW A;  3HRU A;  2L89 A;  5CO7 A;  4BDZ A;  1Y07 A;  3PNW C;  5A0L A;  1D3B B;  1M8V A;  4IUP A;  3JRZ A;  4EPC A;  1X01 A;  3CPW A;  2DIQ A;  1KG1 A;  1M1K U;  4LDY A;  4QQG A;  1W4S A;  2KAF A;  2M1H A;  2CZ0 B;  5GAN 7;  4X9C A;  4LD6 A;  4C0G A;  3CC7 A;  4ZTJ A;  2RI5 A;  4NL3 A;  4DQ2 A;  3CCM T;  1XQH A;  1HK9 A;  5GAN 5;  2CZ7 B;  4QQD A;  2G3R A;  1LOJ A;  2JN0 A;  3FEO A;  4M75 G;  2Y4Y A;  3A8H B;  3ER0 A;  5I21 A;  3RES A;  5KCH A;  3OS2 A;  4M7D F;  2LT4 A;  3RMS A;  3VUZ A;  3VU3 C;  4C8Q F;  1N8R C;  2X4X A;  4VUB A;  3VYG A;  3BW1 A;  3CCJ T;  4Q5W A;  3FDR A;  4EMH A;  3CCR T;  2R57 A;  4HT8 A;  3VV0 A;  5C0M A;  4MDX A;  1VQL T;  1KQS A;  3DKM A;  3L42 A;  1VQ5 T;  4IUT A;  2DJZ A;  4J6X A;  1WQW A;  3V8L A;  2QA4 T;  3JCM V;  1VQP A;  3PGG A;  3CME T;  1I8F A;  2DO3 A;  3GPL A;  5LJ3 d;  2DKG A;  1VQ6 A;  4BD3 A;  3JAM E;  4NOY A;  4IKF A;  3RIR A;  3A5Z B;  3UWN A;  2E5Q A;  4MMK A;  3OSV A;  4XTU A;  5GAO n;  1TH7 A;  2YRV A;  3CCU T;  1BI3 A;  2KY9 A;  3QUI A;  5GAO m;  3CCR A;  4KUI A;  2RK2 A;  1H3Z A;  2KK4 A;  2KDS A;  4D6W A;  5GAN g;  3DLL A;  2KMT A;  4HCC A;  3EAE A;  4C8Q G;  4A4F A;  1K73 C;  1Q81 C;  2XDP A;  1Q82 U;  1VQ5 A;  2GF7 A;  3GNF B;  2EWN A;  2V8J A;  3OYD A;  4C92 G;  1YJ9 A;  2OTJ T;  2C06 A;  3FIF A;  4PJO F;  5FU6 C;  3MEA A;  4O5V A;  2VGM A;  3JSC A;  4M77 C;  4E7I A;  1K9M C;  2K4Y A;  1WGS A;  2Y90 A;  3GOX A;  1KD1 U;  3VKI A;  3GP8 A;  3ZBD A;  3CXC A;  3G4S T;  5D6W A;  2D6F A;  2BIV A;  2DEQ A;  2HD0 A;  4M7A G;  2MWP A;  3WXM B;  2XK0 A;  1NE8 A;  3EFR A;  4IUQ A;  2LDM A;  4L5G A;  5C6S A;  4M78 A;  4J7I A;  4XAX B;  4M78 C;  2K57 A;  1BI2 A;  4ELY C;  2XDB A;  2WSC E;  1G5V A;  4XTV A;  4KUD K;  1BI0 A;  2WAC A;  2RHX A;  3SWN A;  5LJ3 g;  2LT1 A;  1GXI E;  4XK8 E;  3L1A A;  4M7D A;  1M1F A;  4M75 E;  5LJ5 h;  4J7F A;  3L2W A;  4FT2 A;  2RJE A;  2ZPF B;  3JCM g;  4QVD A;  2HQE A;  3RKW A;  4M75 B;  3HKS A;  5GAN 3;  3FLG A;  1M1G A;  3OB9 A;  3OMG A;  4LDV A;  3A8M B;  5KE3 A;  1YJW A;  1JJ2 S;  3MP1 A;  2BUD A;  2IVW A;  5L8R E;  3OYH A;  3JB9 J;  3G4S A;  1NZ9 A;  1PSF A;  1UGP B;  4PJO G;  2L5Q A;  4XTY A;  3LGF A;  2DZ9 A;  2FVU A;  4A4G A;  1NJI U;  3HHT B;  2EJF A;  2RJF A;  1BKB A;  2DXT A;  1PSE A;  4QVC A;  4DOW A;  3PMT A;  4CI0 C;  3TCJ A;  5FU7 C;  3GLX A;  5GAN e;  5DLO A;  3ZEH A;  3OW2 A;  5GAM h;  3GNG A;  4EMK A;  4M78 E;  4EMK C;  2A3L A;  1I4K 1;  1I5L A;  2RI3 A;  2M0O A;  2YHT A;  4EDU A;  2E6Z A;  1KQ2 A;  1EIF A;  2X4Y A;  2VXF A;  4B9W A;  2ZPH B;  4B9X A;  1VQO T;  1WJR A;  4M7D E;  2RHY A;  3SB2 A;  1MGQ A;  2EKO A;  2RHZ A;  4XU2 A;  3SWN B;  2Y4X A;  3TEE A;  2PU9 B;  4M7D B;  5GAN j;  2DZC A;  4PJO A;  5CKD A;  3PT9 A;  1YBY A;  3QG1 A;  3SDZ A;  4C8Q B;  3OYL A;  2JUF A;  2PVD B;  3CCQ T;  4LDU A;  1QW1 A;  2EIF A;  4N4I A;  5LJ3 e;  1R8O B;  1I81 A;  3MHX A;  2E6N A;  1VQ4 T;  4ZGJ B;  2K2V A;  3LGL A;  5LJ5 d;  2XI9 A;  3C12 A;  3V7C A;  5GMK e;  4F7U F;  5CCA A;  3X20 B;  3JCM e;  5GAN f;  1XOV A;  2LX9 A;  3GF5 A;  3H8Z A;  3QJY A;  2RJD A;  4M77 F;  3OQ5 A;  2QTX A;  4XQ3 A;  2DXC A;  3OBY A;  1M90 U;  3L2R A;  4A54 A;  3JB9 F;  2EQJ A;  1V29 B;  3DB3 A;  2KSS A;  5J3B A;  2QQB A;  2V8I A;  3S3O A;  4EMK B;  3F70 A;  3M58 A;  4M78 F;  5LJ3 j;  2EQM A;  2JTF A;  5GAN 2;  1QVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...