3JB9H

Cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
76
structure length
76
Chain Sequence
MIPPINFIFKLLQQHTPVSIWLFEQTDIRLQGQIRGFDEFMNIVLDDAVQVDAKNNKRELGRILLKGDNITLIQAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a yeast spliceosome at 3.6-angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
molecule keywords Pre-mRNA-splicing factor spp42
total genus 8
structure length 76
sequence length 76
chains with identical sequence m
ec nomenclature
pdb deposition date 2015-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jb9H00
2VXFA 1D3BA 4NL2A 4HA8A 4EMKA 3FJPA 5LJ5d 4PJOF 2E65A 3QSUA 2EJ9A 3VU3C 4M78E 4C8QD 5I21A 4XU2A 5GMKe 3BFMA 4M77E 4M78C 3JB9F 4C92C 3HFNA 5GMKj 2QTXA 4MMKA 1KQ1A 4PJOA 3JCMX 4M78B 4C92G 4XTZA 3JCMV 1I5LA 1M5Q1 4PJOB 5GAOq 4C8QA 4C92A 5LJ5e 3JCMP 4PJOC 4Y91A 4C8QG 2DXUA 1LOJA 3BY7A 5GANh 1HXDA 4OP0A 2CGHA 4C8QC 2I2LA 5GAN2 1MGQA 2RB6A 1TH7A 5GAMh 4F7UE 4C92F 4EMKB 4F7UG 4C92D 1M8VA 4XTVA 3RIRA 4EMKC 3FB9A 3QHSA 4M77G 4XTYA 3SWNB 4EMHA 4M7AG 4M75C 3V7SA 5LJ5g 4M78G 4N0AA 4C92E 3JCMe 3JCMb 4RCCA 4M75B 3HSBA 5GAN3 4JRKA 2VXEA 2YLBA 3JCMh 1HK9A 4M75A 1B34A 3JCMg 4XTUA 3JB9H 4M7AF 5GANj 3FIFA 2EJFA 1U1TA 2FB7A 1Y96A 4M7DA 3JCMJ 4A54A 5LJ3d 5GAMg 3V8JA 2Y90A 4M7DD 1WNLA 4F7UB 5GANf 1KQ2A 4X9DA 4PJOE 4QVDA 4HT8A 3JB9D 2VC8A 3GIBA 1JBMA 4M78F 2FYKA 4M7DE 4M7AB 2YLCA 3V7RA 3JCMf 3INZA 3M4GA 3EFRA 3SWNA 3V7CA 4EMGA 5LJ5h 1WPYA 4M7AC 4PJOD 3SB2A 1LNXA 2JN0A 5GAN5 4M75E 4V2SA 3RUXA 5GMKi 5GAOn 3QO3A 2K57A 5GANg 1H641 5GAMe 5GMKh 2DXTA 2E10A 4A53A 2E1HA 4J5YA 5GANe 2RM4A 5GAN6 5GAOp 3JB9I 4RCBA 4C92B 5GAN4 4HT9A 5DY9A 4PJOG 1N9SA 1LJOA 5GAOl 3RKXA 5GANd 4MMLA 4N0AC 5LJ3f 3V8LA 5GAMd 4XU3A 3V8KA 3JCMQ 3JB9J 3PGGA 1I8FA 4M77F 4XU0A 2HNIA 5GAOr 4WF2A 1N9RA 5GAOm 3RERA 1JRIA 3L2ZA 4F7UA 2E41A 2ZGWA 4M7DC 4C8QB 1D3BB 3BDUA 3HFOA 3JCMW 4NOYA 1Y96B 3RESA 4J6XA 4M77A 3JCMc 4M7AE 4M77D 4M7DB 4DQ2A 3RKYA 5GMKl 5LJ5f 2DZ9A 4M78A 1I81A 1B34B 5GMKm 4M78D 4C8QE 5LJ3j 5GAMj 4F7UF 3QUIA 3SWNC 5LJ3e 4M7AD 2DVEA 4J6WA 2DTOA 4M7AA 2RA2A 3JB9G 2DZCA 4M7DF 2DKGA 4C8QF 4NL3A 4M75G 2DEQA 1WQWA 4JRIA 4M75F 4M77C 2E64A 3JCMd 1WQ7A 1YCYA 1BIBA 4M77B 5LJ5j 4M7DG 4PNOA 4JUVA 3RKWA 5GAN8 2YHTA 5GAMf 2EWNA 4XTWA 1BIAA 1X01A 4X9CA 4XQ3A 4JLIA 1U1SA 5LJ3g 5LJ3h 3EFSA 2EJGA 2DJZA 2DTHA 4M75D 2RD1A 5CAIA 2EAYA 3L1AA 2DTIA 4QVCA 5GAN7 4J6YA 1I4K1 3AHUA 3BW1A 4XU1A 4XTXA
chains in the Genus database with same CATH superfamily
1RABB 1PG5B 2E70A 1IHWA 1OV3A 2YDLA 4QT7A 1K0XA 1WJQA 3CQTA 4C8QD 1KD1R 1UEBA 3MP6A 8AT1B 3R6NA 3RNJA 3PT9A 4RG2A 4LNPA 5DLQE 4C92A 3CCJT 4CC2A 1HXDA 1ZBXA 1N6AA 1RL2A 1D1BA 4IUVA 2RHIA 3JAME 1XJWB 3FB9A 3G71T 2LNVA 5IXFA 5GAN3 1WHHA 4M75A 1U8RA 2QQRA 2HBPA 2MWOA 1GBQA 1PSEA 2JT4A 2K5LA 1UHCA 2QGFB 3SD4A 2EQIA 1VQ7T 1EIFA 3QO3A 5KYXA 1O9SA 4D6WA 2RM4A 1X69A 3P8HA 3M0UA 3ME9A 4XAXB 2FRYA 1GCPA 3MEUA 4QQ6A 1GCQC 5FROA 1K1ZA 3DLLA 2QASA 1PM3A 5DM7R 2HNIA 2DETA 1QCNA 4OB3B 3HRTA 1BKBA 3G4SQ 2KVQG 2M02A 3HTRA 2KT1A 4LDWA 4M78D 4LDVA 4IUQA 1QWFA 3A98A 4J6WA 4Y28E 2MWPA 1GBRA 4PFPA 3M53A 4EDUA 1WQ7A 1M3AA 5LJ5j 4BY6C 5GAN8 4GLKA 4CI0C 2XI9A 1JEGA 2MMPA 2VXFA 2RQTA 4NL2A 8ATCB 4HA8A 2JUFA 1MMDA 3QDFA 5CVIA 2ZCFB 4B6MA 3M58A 1YN8A 1N8RC 3QYGB 1SRLA 4OMQA 1VUBA 4MMKA 4K11A 1IREB 5GAOq 4C8QA 2MK5A 5FWCA 1Q82R 1VQ5Q 3G6EA 1XQHA 1ABQA 2FPFA 2KY9A 4C92F 3OB9A 1KHCA 1X6OA 5A0LA 1AWJA 4M78G 1YJWA 1Q86R 2PQWA 2DXBA 5GJVB 4XTUA 1KIKA 1IZ6A 1YJNA 1FMKA 3NPFA 4M7DD 2XG8D 3CBOA 1VQMQ 1TTHB 3VKIA 4AG1C 2FYKA 4M7AB 2CYZB 5LL6S 4LE9A 1FXXA 2OTLT 2M51A 2F5TX 2NUPB 5L8RE 1OULA 2ATCB 5GAN4 2O01E 4JJDA 3VS3A 2J6OA 5CKEA 5J26A 3PIOA 4DEXA 2RO0A 4Y92A 1I8FA 4C0GA 4BB7A 3CD6T 2D8HA 4M7DC 2YRVA 3CC4T 4RMOA 1GL5A 2E5KA 2XMFA 4M77D 3RKYA 2MIOA 4BUGA 1B34B 1NZ9A 3QUIA 2YRCA 3GOXA 2CZ6B 4M7DF 1X43A 4RTTA 2DKGA 2LT4A 3X25B 1BCOA 4C0FA 3OQ5A 2ZPIB 3OS0A 2ZPFB 4OMOA 3H0HA 1WHKA 4M7DG 1M9SA 4PNOA 1CKBA 4AFZC 1X01A 2KRNA 4A4GA 3CCLA 3L1AA 5EC7A 4AFQC 1M1KC 1T3LA 3QSUA 3QZ5B 3D7SB 3VU3C 2I0NA 3OYLA 5I21A 2DVJA 5FWBA 4L59A 1ACMB 3E9GA 2CSQA 1D0YA 1JQQA 2V1QA 5CQYA 2FVUA 1M5Q1 2HQEA 3CBPA 2B8AA 2RHZA 1V76A 5AYFA 5KYXB 4C8QC 2EQMA 2YUQA 2L3QA 2OJ2A 2EPDA 3NTKA 2LX9A 4OGCA 2VUBA 3X28B 3V7SA 4M75B 4A4KA 1ZX6A 2ZZDA 3G71A 1AVZC 4A54A 1K9MU 1D1AA 2EKOA 2QA4Q 4KGXB 1JO8A 3CC7Q 1M3BA 3HRSA 4E7ZA 3MPUB 2X4XA 1OX9A 2DF6A 4J9EA 3SFMA 1ABOA 2KR3A 4AFSC 3LX7A 1E6HA 4PJOG 3LW5E 2RK1A 3VS7A 4FM4B 5GAMd 2EFIA 1RI9A 1M2VB 4M77F 2E6NA 4LDYA 4E7KA 3G6ET 2XDBA 3HFOA 1ZSZA 3E19A 2V8JA 1TS9A 3MEVA 1SG5A 3H9NA 3QIIA 4OMMA 4ZN1A 1YJNT 2MAMA 4C8QF 1LPLA 1NJIC 5GJWB 1YHQA 3OY9A 1M90U 1ZQ1A 1VA7A 1I1JA 4X9CA 4JRPA 2KDSA 2LC4A 4J8OA 2DTIA 3A8MB 4RG8A 1QVPA 1I4K1 1YJWT 1NEGA 1NPRA 1Q86U 5LJ5d 2E65A 1G3YA 3BDLA 1PCXA 4C0ZA 3MCAB 3J81E 1K76A 3BFMA 2MF2A 1W6XA 1S1NA 1VQOA 1TUGB 3SDZA 3M4YA 1VQ6T 2K3BA 3EHQA 1N27A 1YJNQ 2ZPEB 1PWTA 3GF5A 4OP0A 2JMCA 3OYKA 4F7UE 2PUKB 4DBQA 2JXBA 3EGXA 3VRYA 1AZGB 1VQKQ 2OTJT 1VQPA 3H0FA 1JXMA 4QKUA 4RCCA 1PRMC 2CP5A 1WJSA 2GQIA 1G3TA 3GNFB 4JDSA 5GANj 2EJFA 1U1TA 4MZPA 2YRDA 1FWZA 5GANf 1VQOQ 1WZOA 2DJQA 2L2PA 2KMTA 1H8KA 2GCXA 3M4GA 2LMJA 1LNXA 5IHNA 2QG9B 1AWOA 3CCMT 3C4SA 2ED1A 2ROTA 5GANg 1ZSZB 2VWFA 5CKDA 2ESWA 4FU6A 4RCBA 1U06A 1QVFS 1S72T 5GANd 2BUDA 1BI1A 1QMCA 2GFUA 5CK9A 2GQVA 1M2OA 2KI7A 1JXOA 1RAFB 2PUOB 1VIEA 4E7HA 2LNHB 1R0CB 2M16A 1NYGA 3H0IA 3CXCS 1PKTA 1Y96B 4M7AE 3JV3A 1ZUKA 2AZSA 1UGVA 2CP3A 3NTHA 4F14A 3OYFA 4C5HA 3RR6A 4M77C 3I35A 3JCMd 3CCVA 3LYIA 1TUCA 1WFWA 1YWPA 1C6VX 2RJFA 5LJ3h 2CT4A 2X3XD 1WX6A 3CPWA 1VQ6A 3HKSA 1WXBA 3QG1A 2V8IA 2HQHA 2QTXA 5CR2A 1VQKT 2QAZA 4PL6A 4J9IA 2M0OA 2O9SA 2DXUA 4KULA 1Q7YC 1PSFA 3OW2A 2I2LA 4E7IA 1JJ2S 2LRQA 2LQKA 5GAMh 3VJPA 4Z88A 1M8VA 4E7SA 3M0PA 2DD5A 2HKQB 3RBBB 3V8JA 1WNLA 4II1A 2WSEE 1UG1A 4PJOE 1YBYA 2P0KA 2O4XB 4A4FA 2LQWA 1RAGB 2KRSA 2RQWA 3WXMB 3G1JA 3META 4FW2A 1PNJA 1BU1A 4HKEA 1VQOT 2QYZA 1Y07A 2CH4A 1HSQA 4C92B 1WGSA 3O5ZA 1WXTA 3M54A 3ULRB 4ZTJA 1KQSP 3V8LA 2P0QA 3UPUA 2KEAA 3JB9J 4XU0A 4BE2A 1OI1A 2NUPA 4ZGEB 4JJBA 2X4JA 2KRMA 4M77A 9ATCB 2LVMA 3VUZA 5HK3A 2HZYA 5LJ3j 2VGMA 4M7AD 2CP2A 2H8HA 4M75G 1R8OB 1VQ7Q 2CDTA 1BIBA 2JM9A 2YHTA 5GAMf 5LJ3g 3S6WA 2NUZA 4J7FA 4WTOB 2DL4A 2O88A 4HCKA 3CBMA 2KYMA 2AZVA 4M78E 3OYHA 1SKUB 2YSQA 3DKMA 1NG2A 2KK4A 3OS2A 3CPFA 1PKSA 3JB9F 1ZUYA 2X4WA 4M78B 2CUDA 2YUPA 1K4US 2X51A 3M0SA 2L3SA 4OB2B 2J6FA 3CMAT 1S72A 4Y91A 3I55A 5GANh 4C5GA 1VQ7A 1UGQB 2FZCB 2EW3A 1W2BA 2FG0A 4BD3A 1VQ6Q 2PVDB 1RAHB 3JSCA 4EMKC 1F1BB 1MMGA 3A8OB 4GLMA 3S3MA 3VS5A 3L2VA 4MZTA 4KUDK 2PVGB 1G8XA 4DOVA 1Y96A 2CS7A 4QVDA 3JB9D 2DM1A 3TREA 1M1GA 3V7RA 4ORZA 3SWNA 3QJYA 3C94A 3VS2A 4AT1B 4RTWA 2PU9B 2FZGB 3TSWA 5GMKi 4R0KA 2LJ1A 1AOJA 2XDDA 2L5QA 1YITA 4WCIA 1QCFA 3QBYA 3CCST 1Q81C 4HT9A 1UECA 3HRUA 4MMLA 2AK5A 4N0AC 1Q81R 3FJ5A 1WI7A 3V8KA 3X20B 1MV3A 1NE8A 2DNUA 3BDUA 3REBB 1SF9A 2FRWA 1YNZA 4M7DB 4C8QE 2KT8A 3SWNC 4MDWA 2DVEA 2DTOA 1D0XA 3IQLA 5FU7C 2DAQA 1GCQA 2K7AA 3UATA 2FEIA 4CRIA 1WQWA 1WLPB 1MV0B 3VUBA 4FYVB 2P0PA 1BB9A 4HCCA 1YIJA 2KQWA 2NUTB 1BIAA 3G7ZA 5GAN7 1QVFP 2EGEA 1TG0A 2AKLA 2DILA 4LD9K 2K2VA 1MMAA 3OS1A 3OMGA 3BE3A 4HCBA 2ZAEA 3ASKA 2EBPA 2A37A 3CCMQ 1AWWA 3QWXX 3I55Q 1OOTA 2YWWA 1A0NB 3DB3A 3PFSA 1BYMA 5D7UA 1W4SA 2O4XA 2RB6A 2LX7A 1Y7XA 4DBHA 4OMNA 2E6ZA 2IPOB 1G83A 3SWNB 4EMHA 2JTEA 3QWYA 4PLIA 1VQNA 1RLPC 2GTOA 2QGGA 3OYGA 3M56A 2Y90A 3SHWA 2KROA 2VC8A 3VYHB 3NGPA 1IB8A 3V7CA 3CCQT 4PK4A 3WVEB 2F1LA 1ZSGA 1K73U 1IHVA 3LWHA 1YITQ 2YUNA 2QQAA 3CCEA 3VS1A 1VQMT 2O9VA 1NJIU 4JS4A 5CCAA 2EYQA 1VQ4T 2KNBB 4OMFB 1QCOA 2EGCA 3OYYA 3CMEQ 3GBQA 3M9QA 1KK7A 2QDLA 2E41A 4R55A 4JJNK 1LCKA 4DQ2A 3FLGA 5GMKl 4M78A 1ZBJA 5GAMj 1VQLT 2RA2A 2AHJB 3DB4A 1OQKA 2CKKA 2DZCA 2L0AA 1N8RU 4LN2A 2DEQA 5IHKA 5KYUA 2PTKA 5I2MA 3EG0A 1UGPB 4GY5A 4ELYC 1OX8A 1QP2A 2DTHA 3A5ZB 1UTIA 2JZ2A 1T0JA 3BW1A 3QDRB 5J3BA 4JRQA 4EMKA 2R5MA 5AT1B 3I5SA 4Z8AA 4M77E 3VS4A 4C92G 3GLXA 3OYBA 1I07A 1LVKA 4NS5A 4IUUA 4PJNA 3KXTA 4OF1A 3P8BB 2VYTA 3EH2A 2RQRA 4XTYA 1QP3A 4HVUA 4FYYB 4DBFA 2L8DA 5KYYB 1WYXA 1S72Q 4M7DA 4PJMA 1YHQT 2RHXA 1K9MC 4HXJA 1VOMA 2K5FA 2YLCA 3JCMf 1EFNA 2PZ1A 1P92A 2WSCE 2XHCA 4E2FB 3QPHA 2CZ0B 1H92A 3M59A 3CPWS 4HVVA 1AWXA 5M9OA 2DL3A 3VRZA 3OYEA 2WSFE 4J9HA 1UDLA 2E3IA 1E6GA 1VQ9A 3E2UA 1K8AR 1HYOA 3RESA 4J6XA 4LD6A 4Z89A 4N4IA 4B9XA 1J3TA 1PHTA 4J83A 1K73R 1HJDA 2LJ0A 4D8DA 1JU5C 2RJDA 3OA6A 3REAB 4J9FA 3A8HB 1IGQA 1WIEA 3CCRT 4LDXA 5KYWB 3EFOA 4M75D 1KQSA 1YCSB 2HL5C 1QQJA 1WDXA 1ZSZC 2XU8A 4PLLA 2OTLQ 2L89A 5GMKj 1GRIA 3M5AA 3UWNA 3UA7A 1AHJB 5C6SA 3PE0A 5GAN2 1MGQA 4C5EA 3MJXA 2OI3A 2EYWA 3EG2A 4FIBA 1TSFA 3A8LB 1Y0MA 4M75C 2J7IA 2VXEA 3JCMh 3HHTB 2QEXA 2OTJQ 2JW4A 1MUZA 1ZA2B 2FB7A 3CPWP 5LJ3d 2EVRA 4X9DA 4HT8A 1JBMA 4X34A 2EIFA 3M0RA 2W0ZA 2COYA 1KC8C 1ARKA 2MPXC 4RTYA 1QLYA 4V2SA 5HKCA 2NYSA 2ZPBB 4ZNXA 1Q86C 2H3EB 2QXFA 5DLOA 3ZBDA 1PC0A 2E1HA 2JM8A 4FW1A 1QW1A 3QZ9B 1W70A 3FEOA 1UUEA 2DIGA 1K9MR 3EGXB 2ECZA 4XU3A 3L42A 3JCMQ 3PGGA 4PKCC 3CC4Q 1M27C 5GAOm 1JRIA 3L2ZA 2D9TA 1OZ2A 5KYWA 1PD0A 2EQKA 3EG9A 4IUPA 4ANJA 2A7YA 2MOXA 4ESRA 3CC2A 4JRIA 3CCUT 3QKJA 2HEQA 1M30A 3M57A 2XICA 3L2UA 1VQ8Q 5FW9A 2M0YA 3L2QA 4E7JA 2JJ9A 3H6ZA 2RI3A 4E7LA 1VQNQ 3CCQA 3ZL7C 4FYXB 2A36A 2DRKA 2LTOA 4TVRA 2HCKA 2M9UA 5KE2A 4IURA 1VYVA 4M78C 2X35A 3CCLT 3TU4K 1VQMA 2Z0WA 1NLOC 1Z9ZA 3JCMV 4QW2A 1UB4A 1UHFA 1WA7A 2FPDA 1UE9A 2NUTA 4A63B 2CP7A 4AFUC 1TH7A 2FHDA 2P84A 3NFCA 2SRCA 3UA6A 2CUBA 2FO0A 2DBMA 2MI6A 4N0AA 1UJYA 3OYMA 3OBYA 4RKUE 2HKNA 4O6JA 3JB9H 2LQ8A 4FL6A 4LUDA 1OEBA 1VQNT 3CCUA 1M1KR 2LDMA 2PNIA 3CCJQ 3FRNA 2KSSA 3CCVT 2YXYA 1YI2A 4IKFA 1RUWA 4M75E 1XTDA 2VVKA 1IO6A 4FSXA 3TQ7P 4J9GA 1GFDA 4KBMB 4OGEA 5GAN6 3JB9I 1VQ9Q 1YI2T 1AZEA 2C0TA 4HVWA 5KH6A 1X6GA 4ZN3A 2CSIA 3OW2S 1NM7A 5GAOr 2QDYB 1NEBA 5CKBA 4F7UA 3JCMW 4FT4A 1N5ZA 1EZZB 3LGFA 2GTJA 3URGA 5CKFA 2O31A 3EH1A 2LQNA 3CCSA 2R5AA 3TVTA 1ZLMA 2GF7A 1N8RR 1KG1A 2DXCA 1VQ8A 2C06A 4IIMA 4Q5WA 2K5IA 2EYZA 1ZA1B 1YJ9A 4XTWA 4XQ3A 4KGZB 1U1SA 3EFSA 2RD1A 4A4HA 2PVOB 2J05A 1YJWQ 3I56Q 4XU1A 1C0MA 1D3BA 2RJCA 2D8JA 5CQXA 3PTAA 3NHNA 3VYGA 3FDRA 2K6DA 4J7IA 4N4HA 1T3SA 2CZ1B 3HFNA 5I2SA 1TWBA 3JRZA 1SSHA 2CP0A 2EGAA 2R57A 4FSSA 4E47A 1VQ4A 3N5BB 3CMEA 1D09B 4C8QG 2OAUA 3CD6A 2B86A 4C0DC 1FX7A 4JZ4A 2KXDA 3KUFA 4C0DB 1K8AC 3CCET 3CMAA 2AKKA 1QVFA 2K2MA 2DYBA 4L6V5 3UT1A 3RIRA 4FYWB 2BE7D 4RTVA 4AG2C 2GBQA 5KYYA 3JCMe 1G3SA 4JRKA 4BE1A 4YTLA 2V1RA 3JCMg 1Q81U 2GNCA 1RI0A 1RACB 4HCZA 5C0MA 3C12A 2JTFA 4F7UB 1KQ2A 3CEYA 4M78F 2MYSA 3INZA 3KBGA 1FYNA 3NTIA 3I55T 3RUXA 2K57A 3PVLA 2BE9B 1H641 4JS5A 2DXTA 3GPLA 2JOYA 1UGSB 2AIRB 2SEMA 3EG1A 5GANe 5A0GA 2IVWA 1VQPT 3OBWA 2E12A 3UF4A 4KGVB 1RLQC 2ZGWA 1ZUUA 3M0TA 2ED0A 2J06A 3MEAA 2DPPB 1FMWA 1Y57A 5LJ5f 4KUIA 2IIMA 1M4ZA 1UFFA 2F2XA 3A8GB 4PJJA 1X27A 1M2VA 3X24B 4NL3A 5KCHA 2DIQA 2DFUA 2QA4T 3QJ6A 1JJ2P 2FZKB 3OYDA 2RI2A 3PNWC 3AHUA 4QQGA 2K79A 3FJPA 5D6WA 3CCSQ 1KHIA 3WVDB 2DL5A 1E7OA 1KC8R 1TOVA 1WJRA 2HQXA 4QVZA 2LCLA 4C92C 4KH0B 1KQ1A 2RF0A 3JCMX 1VQ4Q 3OYJA 4PJOB 5LJ5e 2RHUA 3BY7A 1RAIB 4L5GA 2XDPA 4EMKB 2LZ6B 4XTVA 1RAEB 1VQKA 5D6XA 4M7AG 1YP5A 2HDAA 3JCMb 3SEMA 3TEEA 3HPWA 1D0ZA 1YIJQ 1W2BP 2E4HA 4PFZA 3CC2T 3I5RA 1K0SA 2RJEA 1R0BG 3GIBA 4Z02A 3OS5A 1QKWA 4EMGA 2NWMA 1SHGA 3SB2A 2F2VA 2JN0A 3EHRA 3RMQA 2Y4YA 2DBKA 2RNAA 5GAOp 3EG3A 3MP1A 1NPPA 5DY9A 2BIVA 1N9SA 5GAOl 2KGTA 1IXDA 1XOVA 4EPCA 1O75A 3MKDA 1M3CA 3L2RA 1MNDA 3CMET 2JTMA 1K9AA 2RK2A 3JCMc 2OX7A 2YUOA 1PD1A 4IUTA 2DZ9A 4N4GA 4F16A 1OYXA 1WHGA 5LJ3e 1VQ8T 3THKA 1VQ5T 5KCOA 2EYYA 2D0NA 1B3QA 2QI2A 3CCUQ 3A1PA 4F17A 4JUVA 1MMNA 2FPEA 1BBZA 1SHFA 2KYBA 3S3NA 3CC2Q 4GBQA 2J6KA 3CCMA 4XTXA 1VQLA 3HP9A 3EGUA 3E9FA 2V8KA 5IHIA 1KJWA 1D1CA 2WACA 3EG9B 4XU2A 2KBTA 5GMKe 2DK3A 2QQ9A 4ATOA 1AD5A 2CP6A 3I9QA 3CCRA 2OAWA 3CC4A 2ZPGB 3MO8A 2DO3A 3ER0A 2BKDN 1JJ2A 2K3XA 1Y71A 4CC3A 2HSPA 3F70A 4IIOA 4ZGDB 4M4ZA 3QHSA 1WHJA 2EKHA 3MP8A 3HSBA 2X3WD 4OB1B 2ROLA 2X9HA 3FIFA 1EX4A 2EQJA 3CC7A 1QVGA 2D0QB 4MDXA 2GGRA 3JCMJ 1Q82C 1VQ9T 4BY6B 1Q82U 3EGDA 4M7DE 3M55A 3TSZA 1WXUA 2OTLA 4M7AC 3G71Q 2JS2A 1NYFA 1G2BA 1M8MA 1MHNA 4VUBA 5A0DA 2DL8A 7AT1B 1M90C 2DE0X 1M90R 1WHMA 2HL3A 5HCKA 1XNIA 3CXCP 4A4EA 4C8QB 1B7TA 2AT1B 1IRXA 3J7AF 1VQPQ 1OPLA 4PJLA 1NJIR 1W1FA 3RMSA 3JB9G 1VQLQ 4J9CA 1H3ZA 2DL7A 2GFAA 1YCYA 4M77B 2HAXA 3RKWA 1X75C 2JNGA 2LP5A 2DMOA 2JVVA 4P5NA 2EAYA 5IXBA 1BK2A 4LUEA 4FCYA 2KAFA 1M1KU 2E5QA 2VGNA 2K9GA 1TU0B 1UGRB 1BCMA 2QK0A 4AMCA 2ABLA 1U5SA 4PJOA 1U3OA 4ZTFA 1V1CA 3R6OA 2XK0A 2DERA 5IT9E 1YITT 4C92D 3G4ST 3S3OA 4O5VA 4ZGJB 2D1XA 2Y4XA 5FU7B 4KT0E 4KH1B 1B34A 2YT6A 1VYUA 3G4SA 3MEWA 2V26A 1VQ5A 2X4YA 2JMAA 3X26B 5GAMg 5EG2A 1X2KA 3QYHB 1BI0A 1YJ9T 3EFRA 1WPYA 3Q1JA 3J80E 3LWIA 1NLPC 1X6BA 2RQUA 4LDUA 1OU9A 1RAAB 2QEXT 4BE0A 4J5YA 4FT2A 4OMPA 2VB6A 1KQSS 4E6RA 1H3HA 3OYNA 1OPKA 1QKXA 4LXCA 3G6EQ 3EFOB 4RUGA 4WF2A 2DRMA 2K3YA 1AT1B 3E1SA 4JLGA 4PFOA 3PIPA 3C0CA 2QQBA 2A08A 2BZ8A 3PMIA 1ZHIA 2A28A 2DD4A 1YI2Q 4RTUA 2CH4W 5KE3A 3VS6A 1SPKA 2XIDA 2DYIA 3LLRA 1JB0E 1SSFA 4D8KA 2M1HA 2RN8A 1DJ7B 4RTXA 4C5IA 5IAYA 3CC7T 1Q7YU 2A0FB 2EWNA 3L2WA 4JLIA 2CZ7B 3LGLA 1OU8A 4F04B 2DJZA 5FU6B 4QVCA 2NLUA 4MZMA 1T0HA 3OW2P 2A3LA 3H8ZA 3GP8A 2EJ9A 1QWEA 3KFVA 2BTTA 4J9DA 1MNEA 1IGUA 2C0IA 2CT3A 1V29B 3OSSC 1I5LA 2RPNA 3JCMP 1YJ9Q 2D6FA 5IN1A 1BI2A 4R56A 2QEXQ 2VKNA 2OTJA 4CC4B 1QVGP 2BZXA 4F7UG 3OYAA 1YIJT 1KC8U 3CXCA 4UC4A 3GNGA 2DX1A 5LJ5g 4C92E 2YLBA 4XK8E 1HK9A 1TUDA 2H3JA 3LH0A 1KD1U 3VS0A 4M7AF 4CC7A 2IG0A 3I56T 2RI5A 3EGDB 1SRMA 2COZA 4ME7A 2KXCA 2P4TA 3OYCA 2XKOC 3RDVA 3MHXA 1NBEB 5GAMe 5GMKh 1C1AA 3P8DA 4A53A 2R58A 5CKHA 1LJOA 2ENMA 3NMZC 3CMAQ 2O2OA 4DOWA 2ZPHB 5LJ3f 2LT1A 4DA4A 3EAEA 3CCRQ 4BI4A 1N9RA 3RERA 5D6YA 3OSVA 3TCJA 3QXEB 2JS0A 4OVAA 2L3RA 1VYTA 4RTZA 1I81A 1VIFA 5GMKm 2CREA 4F7UF 3ZEHA 1FMVA 2K4YA 5CIUA 1GXIE 5CO7A 2BZYA 2VASA 5I22A 1KD1C 4ELZC 1M1FA 2MCNA 1R77A 5A2QE 3CCLQ 5HK0A 4M75F 5FLXE 2E64A 2DEUA 1BI3A 3CCVQ 2LCCA 2QTVA 5L23A 2G6FX 4BDZA 4X1VA 2RH2A 5HY6A 5I11A 5FRMA 1GFCA 4B9WA 4OMLA 4BI3A 4PJOF 3OYIA 2HBWA 1KSWA 3CCJA 1Q95G 2DLPA 2QQSA 1HD3A 4XTZA 3U23A 3HL8A 4PJOC 5IH2A 1TXQA 1LOJA 2CGHA 1YHQQ 3VV0A 1K73C 2HSEB 1K8AU 1Q7YR 4JZ3A 3ZFJA 4M77G 1CSKA 3O8VA 4BACA 3I56A 2EQUA 2DA9A 2W10A 1PRLC 1QVGS 2COWA 2FL7A 3H41A 4BI8B 1YWOA 1UJ0A 2HD0A 1SEMA 1G5VA 3DLMA 1WHLA 2F5KA 2LJ3A 2HMAA 5LJ5h 4PJOD 3C95A 6AT1B 2L3PA 5GAN5 5GAOn 2RHYA 3CCQQ 2F2WA 3CCEQ 2KE9A 2E10A 4KRTA 5J39A 1OZ3A 2XD0A 1X2QA 4EIKA 1B07A 3RKXA 2EYXA 1I5OB 2VV5A 2QA4A 3OMCA 4DBRA 1CKAA 2P4RA 5ECAA 2C0OA 2E3HA 1D3BB 4BDYA 4NOYA 1Z9QA 1W2BS 3UDCA 2LCSA 3PMTA 4JPBW 4OB0B 1KFZA 2RMOA 1RADB 4M7AA 2F69A 2G3RA 1YFNA 3FC3A 1I0CA 5KYNA 3PVQA 3CD6Q 3T9NA 2RQVA 5FRNA 3AT1B 5FU6C 2EJGA 4JJCA 5CAIA 4J9BA 1AEYA 4DEYA 1G3WA 3LH5A 4J6YA 4QQDA 3M0QA 5KYUB
chains in the Genus database with same CATH topology
1VQLA 2E70A 3CPWA 3HP9A 3E9FA 2V8KA 1WJQA 1VQ6A 3HKSA 2WACA 2XU8A 4PLLA 3QG1A 4C8QD 4XU2A 2V8IA 3OW2A 1UEBA 2L89A 3MP6A 5GMKe 2DK3A 5GMKj 2QTXA 5CR2A 1VQKT 3M5AA 4PL6A 2QQ9A 3PT9A 4ATOA 3UWNA 4RG2A 2M0OA 5DLQE 4C92A 3CCRA 3CC4A 1AHJB 5C6SA 3CCJT 2DXUA 1HXDA 1ZBXA 2ZPGB 3MO8A 1N6AA 1PSFA 1RL2A 2DO3A 1MGQA 2I2LA 2BKDN 2LRQA 3ER0A 2K3XA 2LQKA 4IUVA 4C5EA 1Y71A 5GAMh 3VJPA 1JJ2A 2RHIA 3F70A 3JAME 1M8VA 4ZGDB 4FIBA 3FB9A 3QHSA 3G71T 3A8LB 2DD5A 4M75C 3MP8A 2LNVA 3HSBA 5GAN3 2VXEA 3JCMh 3HHTB 4M75A 2QEXA 1U8RA 2QQRA 4OB1B 3FIFA 2EQJA 3CC7A 2FB7A 1QVGA 2D0QB 4MDXA 3JCMJ 5LJ3d 3V8JA 1Q82C 1VQ9T 1WNLA 2HBPA 4II1A 2MWOA 2WSEE 4X9DA 4PJOE 4HT8A 1YBYA 4BY6B 2P0KA 1Q82U 1JBMA 2O4XB 4X34A 1PSEA 4A4FA 3M55A 2EIFA 4M7DE 2OTLA 1KC8C 4M7AC 2K5LA 3WXMB 3META 3SD4A 1VQ7T 4V2SA 1EIFA 5HKCA 2ZPBB 3QO3A 1Q86C 2QXFA 5DLOA 1MHNA 1O9SA 3ZBDA 4HKEA 4D6WA 2E1HA 4VUBA 1VQOT 2RM4A 5A0DA 1Y07A 4C92B 1QW1A 1WGSA 3ME9A 3P8HA 3QZ9B 4XAXB 4QQ6A 3MEUA 3FEOA 5FROA 3M54A 4ZTJA 3DLLA 2DIGA 3V8LA 1M90C 2P0QA 3UPUA 4XU3A 3L42A 3JCMQ 3JB9J 3PGGA 4PKCC 4XU0A 5DM7R 2HNIA 4BE2A 5GAOm 4OB3B 1OI1A 1XNIA 4ZGEB 1JRIA 3HRTA 3L2ZA 1BKBA 2D9TA 2X4JA 4A4EA 4C8QB 1OZ2A 4M77A 2KVQG 2LVMA 3VUZA 5HK3A 5LJ3j 4LDWA 4M78D 2VGMA 4LDVA 2EQKA 4IUQA 3J7AF 4M7AD 4J6WA 4Y28E 2MWPA 4IUPA 3RMSA 3JB9G 3M53A 2A7YA 4EDUA 4M75G 1R8OB 1H3ZA 3CC2A 4JRIA 3CCUT 2GFAA 1WQ7A 1YCYA 1BIBA 4M77B 3QKJA 4BY6C 5LJ5j 2HAXA 3RKWA 5GAN8 2YHTA 5GAMf 1X75C 2JNGA 5LJ3g 3M57A 2XICA 3L2UA 2JVVA 4GLKA 3S6WA 4P5NA 4CI0C 4J7FA 2EAYA 3L2QA 2XI9A 4E7JA 2KAFA 3H6ZA 2RI3A 4E7LA 2MMPA 1M1KU 2VXFA 4NL2A 2E5QA 4HA8A 2VGNA 3CCQA 2JUFA 5CVIA 2LTOA 2ZCFB 3CBMA 3M58A 4M78E 4TVRA 3OYHA 5KE2A 2M9UA 3DKMA 3QYGB 3OS2A 2KK4A 1N8RC 4IURA 1UGRB 3CPFA 4M78C 2X35A 3JB9F 1VUBA 4MMKA 4PJOA 3CCLT 3TU4K 2X4WA 4M78B 1VQMA 3JCMV 4QW2A 1IREB 4OB2B 4C8QA 5GAOq 3CMAT 1UB4A 1S72A 3G6EA 4Y91A 4ZTFA 3I55A 5GANh 3R6OA 2XK0A 4C5GA 1XQHA 1VQ7A 1UGQB 1TH7A 5GAN2 5IT9E 1W2BA 2FHDA 2KY9A 3NFCA 4BD3A 4C92F 1YITT 4C92D 2PVDB 3JSCA 3G4ST 3S3OA 3OB9A 4EMKC 4O5VA 1KHCA 4ZGJB 2MI6A 1X6OA 3A8OB 5A0LA 2Y4XA 4M78G 4N0AA 3S3MA 5FU7B 1YJWA 4KT0E 3OYMA 3OBYA 2PQWA 2DXBA 3L2VA 4MZTA 4RKUE 4KUDK 1B34A 4O6JA 3G4SA 2PVGB 2LQ8A 4XTUA 3JB9H 1IZ6A 3MEWA 1YJNA 4FL6A 1VQ5A 2X4YA 4DOVA 1Y96A 3X26B 4M7DD 5GAMg 1VQNT 2XG8D 2CS7A 3CBOA 3CCUA 2LDMA 5EG2A 3VKIA 3QYHB 1BI0A 4QVDA 3JB9D 3TREA 1M1GA 2FYKA 4M7AB 3V7RA 1YJ9T 2CYZB 3SWNA 3EFRA 2KSSA 3FRNA 3C94A 3QJYA 1WPYA 5LL6S 3CCVT 1YI2A 3Q1JA 4IKFA 2PU9B 4M75E 3J80E 1XTDA 5GMKi 4FSXA 1FXXA 3LWIA 2OTLT 4LDUA 1Q7YU 2XDDA 4KBMB 2F5TX 2L5QA 2QEXT 4OGEA 4BE0A 5L8RE 4J5YA 5GAN6 1YITA 3QBYA 4FT2A 5GAN4 3JB9I 2O01E 3CCST 1Q81C 1YI2T 4HT9A 1KQSS 5CKEA 5KH6A 3HRUA 4MMLA 4N0AC 5J26A 3PIOA 4ZN3A 3OYNA 2RO0A 3V8KA 3X20B 3OW2S 1I8FA 5GAOr 2QDYB 4WF2A 4C0GA 4BB7A 5CKBA 3CD6T 4F7UA 1NE8A 2K3YA 2YRVA 3E1SA 3BDUA 4JLGA 3PIPA 3CC4T 3JCMW 4FT4A 4RMOA 4M7DB 2QQBA 4M77D 3LGFA 3PMIA 3RKYA 1ZHIA 2DD4A 5CKFA 3URGA 4BUGA 1B34B 4C8QE 1NZ9A 3QUIA 3SWNC 4MDWA 2DVEA 3CCSA 2DTOA 3GOXA 2CZ6B 2R5AA 5FU7C 4M7DF 2DKGA 5KE3A 2GF7A 2DAQA 2LT4A 2XIDA 3X25B 3LLRA 1JB0E 1SSFA 3OQ5A 4C0FA 4CRIA 1KG1A 1WQWA 2M1HA 2DXCA 2ZPIB 1DJ7B 3VUBA 3OS0A 2ZPFB 4C5IA 1VQ8A 2K5IA 4Q5WA 2C06A 2P0PA 4M7DG 1M9SA 4PNOA 5IAYA 4HCCA 3CC7T 1YIJA 2EWNA 2KQWA 4XTWA 1BIAA 1X01A 4XQ3A 3L2WA 4JLIA 1U1SA 2CZ7B 3LGLA 4A4GA 3EFSA 2DJZA 3G7ZA 3CCLA 2RD1A 5FU6B 4A4HA 2NLUA 3L1AA 2PVOB 4QVCA 4MZMA 5GAN7 4XU1A 1D3BA 1M1KC 2A3LA 4LD9K 2RJCA 3H8ZA 3QZ5B 3GP8A 2K2VA 1Q7YC 2EJ9A 3VU3C 3QSUA 3OS1A 3OYLA 5I21A 3OMGA 5CQXA 3PTAA 3VYGA 3FDRA 4J7IA 4N4HA 4M7DC 4HCBA 4L59A 4E7IA 3ASKA 2CZ1B 3HFNA 5I2SA 3E9GA 3JRZA 5CQYA 1V29B 2FVUA 1M5Q1 2HQEA 2R57A 3CBPA 3OSSC 3JCMP 1I5LA 4E47A 1VQ4A 3N5BB 2B8AA 3CMEA 2RHZA 3DB3A 2OAUA 3PFSA 4C8QG 2D6FA 5IN1A 3CD6A 1BI2A 5AYFA 1BYMA 4C0DC 1W4SA 4C8QC 1FX7A 2O4XA 2RB6A 4R56A 2OTJA 2EQMA 3KUFA 4C0DB 1K8AC 3CCET 1Y7XA 3CMAA 4F7UG 2E6ZA 1QVFA 3OYAA 4L6V5 3UT1A 3RIRA 1YIJT 1KC8U 3CXCA 3NTKA 4UC4A 3SWNB 4EMHA 2LX9A 4OGCA 3GNGA 4PLIA 2VUBA 3X28B 3V7SA 5LJ5g 4C92E 3JCMe 1VQNA 4M75B 1G3SA 4A4KA 4JRKA 2YLBA 4XK8E 4BE1A 1HK9A 2ZZDA 4YTLA 2H3JA 3LH0A 3OYGA 3M56A 3JCMg 3G71A 1Q81U 1KD1U 4M7AF 1RI0A 2IG0A 4HCZA 5C0MA 3C12A 3I56T 2RI5A 4A54A 2Y90A 2JTFA 1K9MU 4F7UB 1KQ2A 3CEYA 2EKOA 4ME7A 2VC8A 4M78F 3VYHB 2P4TA 3OYCA 3INZA 3KBGA 2XKOC 3V7CA 3CCQT 3NTIA 3WVEB 3HRSA 2X4XA 3I55T 3MHXA 3RUXA 1K73U 2K57A 3LWHA 1H641 5GAMe 5GMKh 2QQAA 2DXTA 4JS5A 4KULA 3GPLA 3CCEA 3P8DA 2JOYA 3SFMA 4A53A 1UGSB 5GANe 5A0GA 1VQMT 2IVWA 2R58A 3LX7A 5CKHA 4PJOG 1VQPT 1NJIU 3OBWA 1LJOA 3LW5E 2E12A 5CCAA 4JS4A 4DOWA 2EYQA 2ZPHB 1VQ4T 5LJ3f 4OMFB 2RK1A 4FM4B 2LT1A 2EFIA 5GAMd 4DA4A 4M77F 3OYYA 3EAEA 4BI4A 3M9QA 2E6NA 1N9RA 4LDYA 3RERA 5D6YA 3OSVA 3TCJA 4E7KA 3QXEB 2E41A 2ZGWA 4OVAA 3G6ET 4R55A 2L3RA 3HFOA 2XDBA 3E19A 2V8JA 4JJNK 4DQ2A 3MEAA 2DPPB 3FLGA 5GMKl 5LJ5f 3MEVA 4M78A 1I81A 1VIFA 5GMKm 5GAMj 1VQLT 4F7UF 4KUIA 3ZEHA 3QIIA 1M4ZA 2K4YA 4ZN1A 2RA2A 2AHJB 3A8GB 3DB4A 1YJNT 2CKKA 2DZCA 2MAMA 5CIUA 3X24B 1GXIE 5CO7A 4C8QF 4NL3A 1N8RU 1NJIC 5KCHA 1KD1C 4ELZC 1M1FA 5A2QE 2DEQA 5HK0A 1YHQA 4M75F 5FLXE 2E64A 3OY9A 1BI3A 1ZQ1A 2DIQA 1M90U 5I2MA 2LCCA 1YJ9A 4X9CA 1UGPB 3QJ6A 4GY5A 4ELYC 2KDSA 2QA4T 4JRPA 1QP2A 2DTHA 2LC4A 4J8OA 4BDZA 3OYDA 3A5ZB 2DTIA 3A8MB 2RH2A 4RG8A 5HY6A 2JZ2A 1I4K1 2RI2A 1QVPA 3BW1A 3PNWC 1YJWT 5FRMA 3AHUA 4B9WA 3QDRB 5J3BA 4JRQA 4QQGA 4EMKA 1NPRA 4BI3A 3FJPA 1Q86U 5D6WA 5LJ5d 1KHIA 4PJOF 2E65A 1G3YA 2R5MA 3BDLA 3WVDB 4C0ZA 3MCAB 3J81E 3OYIA 1WJRA 3BFMA 4M77E 3CCJA 2HQXA 2LCLA 2MF2A 4QVZA 4C92C 2QQSA 1VQOA 1KQ1A 1JJ2S 3JCMX 3SDZA 4C92G 3M4YA 3GLXA 4XTZA 3OYJA 3OYBA 4PJOB 4NS5A 4IUUA 5LJ5e 1VQ6T 3HL8A 4PJOC 3KXTA 4OF1A 1N27A 2RHUA 2ZPEB 1LOJA 3BY7A 3GF5A 4OP0A 2CGHA 3P8BB 3OYKA 4L5GA 2VYTA 2XDPA 3VV0A 4F7UE 2PUKB 1K73C 1K8AU 4EMKB 4XTVA 4XTYA 3ZFJA 4M77G 1VQKA 1QP3A 5D6XA 4M7AG 2OTJT 3O8VA 4BACA 3I56A 1VQPA 3JCMb 4RCCA 2EQUA 2L8DA 1WJSA 1G3TA 3GNFB 4JDSA 3TEEA 3HPWA 5GANj 1QVGS 2EJFA 1U1TA 4MZPA 2FL7A 4BI8B 4M7DA 2HD0A 1FWZA 5GANf 1YHQT 2RHXA 1K9MC 3CC2T 2RJEA 3GIBA 4Z02A 1G5VA 3DLMA 2K5FA 2KMTA 2YLCA 2F5KA 3OS5A 2GCXA 3M4GA 3JCMf 4EMGA 5LJ5h 1P92A 3C95A 3SB2A 1LNXA 4PJOD 2JN0A 5GAN5 3CCMT 3C4SA 2WSCE 2XHCA 2RHYA 5GAOn 5GANg 3QPHA 3RMQA 2Y4YA 5CKDA 4FU6A 2E10A 2CZ0B 5GAOp 4RCBA 5J39A 5DY9A 3MP1A 1NPPA 1OZ3A 2BIVA 2XD0A 1N9SA 1QVFS 1S72T 5GAOl 3RKXA 5GANd 2BUDA 1BI1A 1XOVA 2GFUA 3M59A 2VV5A 2QA4A 5CK9A 2GQVA 4EPCA 3OMCA 3CPWS 1O75A 5M9OA 3OYEA 2WSFE 2PUOB 1VIEA 1VQ9A 4E7HA 3L2RA 2M16A 3CMET 2JTMA 1D3BB 3CXCS 4BDYA 4NOYA 1Y96B 2RK2A 4J6XA 3RESA 3JCMc 4M7AE 4LD6A 1W2BS 4N4IA 4IUTA 3UDCA 2DZ9A 3PMTA 4N4GA 4OB0B 1OYXA 5LJ3e 4B9XA 4M7AA 1VQ8T 4J83A 1VQ5T 2F69A 5KCOA 3NTHA 2G3RA 2RJDA 3OYFA 3OA6A 4C5HA 2QI2A 4M77C 3FC3A 3JCMd 4JUVA 3CCVA 3A8HB 3LYIA 3T9NA 5FRNA 3S3NA 3CCRT 5FU6C 2RJFA 5LJ3h 2EJGA 5CAIA 4LDXA 4M75D 1KQSA 1G3WA 3CCMA 4J6YA 4QQDA 4XTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VXF A;  1D3B A;  4NL2 A;  4HA8 A;  4EMK A;  3FJP A;  5LJ5 d;  4PJO F;  2E65 A;  3QSU A;  2EJ9 A;  3VU3 C;  4M78 E;  4C8Q D;  5I21 A;  4XU2 A;  5GMK e;  3BFM A;  4M77 E;  4M78 C;  3JB9 F;  4C92 C;  3HFN A;  5GMK j;  2QTX A;  4MMK A;  1KQ1 A;  4PJO A;  3JCM X;  4M78 B;  4C92 G;  4XTZ A;  3JCM V;  1I5L A;  1M5Q 1;  4PJO B;  5GAO q;  4C8Q A;  4C92 A;  5LJ5 e;  3JCM P;  4PJO C;  4Y91 A;  4C8Q G;  2DXU A;  1LOJ A;  3BY7 A;  5GAN h;  1HXD A;  4OP0 A;  2CGH A;  4C8Q C;  2I2L A;  5GAN 2;  1MGQ A;  2RB6 A;  1TH7 A;  5GAM h;  4F7U E;  4C92 F;  4EMK B;  4F7U G;  4C92 D;  1M8V A;  4XTV A;  3RIR A;  4EMK C;  3FB9 A;  3QHS A;  4M77 G;  4XTY A;  3SWN B;  4EMH A;  4M7A G;  4M75 C;  3V7S A;  5LJ5 g;  4M78 G;  4N0A A;  4C92 E;  3JCM e;  3JCM b;  4RCC A;  4M75 B;  3HSB A;  5GAN 3;  4JRK A;  2VXE A;  2YLB A;  3JCM h;  1HK9 A;  4M75 A;  1B34 A;  3JCM g;  4XTU A;  3JB9 H;  4M7A F;  5GAN j;  3FIF A;  2EJF A;  1U1T A;  2FB7 A;  1Y96 A;  4M7D A;  3JCM J;  4A54 A;  5LJ3 d;  5GAM g;  3V8J A;  2Y90 A;  4M7D D;  1WNL A;  4F7U B;  5GAN f;  1KQ2 A;  4X9D A;  4PJO E;  4QVD A;  4HT8 A;  3JB9 D;  2VC8 A;  3GIB A;  1JBM A;  4M78 F;  2FYK A;  4M7D E;  4M7A B;  2YLC A;  3V7R A;  3JCM f;  3INZ A;  3M4G A;  3EFR A;  3SWN A;  3V7C A;  4EMG A;  5LJ5 h;  1WPY A;  4M7A C;  4PJO D;  3SB2 A;  1LNX A;  2JN0 A;  5GAN 5;  4M75 E;  4V2S A;  3RUX A;  5GMK i;  5GAO n;  3QO3 A;  2K57 A;  5GAN g;  1H64 1;  5GAM e;  5GMK h;  2DXT A;  2E10 A;  4A53 A;  2E1H A;  4J5Y A;  5GAN e;  2RM4 A;  5GAN 6;  5GAO p;  3JB9 I;  4RCB A;  4C92 B;  5GAN 4;  4HT9 A;  5DY9 A;  4PJO G;  1N9S A;  1LJO A;  5GAO l;  3RKX A;  5GAN d;  4MML A;  4N0A C;  5LJ3 f;  3V8L A;  5GAM d;  4XU3 A;  3V8K A;  3JCM Q;  3JB9 J;  3PGG A;  1I8F A;  4M77 F;  4XU0 A;  2HNI A;  5GAO r;  4WF2 A;  1N9R A;  5GAO m;  3RER A;  1JRI A;  3L2Z A;  4F7U A;  2E41 A;  2ZGW A;  4M7D C;  4C8Q B;  1D3B B;  3BDU A;  3HFO A;  3JCM W;  4NOY A;  1Y96 B;  3RES A;  4J6X A;  4M77 A;  3JCM c;  4M7A E;  4M77 D;  4M7D B;  4DQ2 A;  3RKY A;  5GMK l;  5LJ5 f;  2DZ9 A;  4M78 A;  1I81 A;  1B34 B;  5GMK m;  4M78 D;  4C8Q E;  5LJ3 j;  5GAM j;  4F7U F;  3QUI A;  3SWN C;  5LJ3 e;  4M7A D;  2DVE A;  4J6W A;  2DTO A;  4M7A A;  2RA2 A;  3JB9 G;  2DZC A;  4M7D F;  2DKG A;  4C8Q F;  4NL3 A;  4M75 G;  2DEQ A;  1WQW A;  4JRI A;  4M75 F;  4M77 C;  2E64 A;  3JCM d;  1WQ7 A;  1YCY A;  1BIB A;  4M77 B;  5LJ5 j;  4M7D G;  4PNO A;  4JUV A;  3RKW A;  5GAN 8;  2YHT A;  5GAM f;  2EWN A;  4XTW A;  1BIA A;  1X01 A;  4X9C A;  4XQ3 A;  4JLI A;  1U1S A;  5LJ3 g;  5LJ3 h;  3EFS A;  2EJG A;  2DJZ A;  2DTH A;  4M75 D;  2RD1 A;  5CAI A;  2EAY A;  3L1A A;  2DTI A;  4QVC A;  5GAN 7;  4J6Y A;  1I4K 1;  3AHU A;  3BW1 A;  4XU1 A;  4XTX A; 
#chains in the Genus database with same CATH topology
 1RAB B;  1PG5 B;  2E70 A;  1IHW A;  1OV3 A;  2YDL A;  4QT7 A;  1K0X A;  1WJQ A;  3CQT A;  4C8Q D;  1KD1 R;  1UEB A;  3MP6 A;  8AT1 B;  3R6N A;  3RNJ A;  3PT9 A;  4RG2 A;  4LNP A;  5DLQ E;  4C92 A;  3CCJ T;  4CC2 A;  1HXD A;  1ZBX A;  1N6A A;  1RL2 A;  1D1B A;  4IUV A;  2RHI A;  3JAM E;  1XJW B;  3FB9 A;  3G71 T;  2LNV A;  5IXF A;  5GAN 3;  1WHH A;  4M75 A;  1U8R A;  2QQR A;  2HBP A;  2MWO A;  1GBQ A;  1PSE A;  2JT4 A;  2K5L A;  1UHC A;  2QGF B;  3SD4 A;  2EQI A;  1VQ7 T;  1EIF A;  3QO3 A;  5KYX A;  1O9S A;  4D6W A;  2RM4 A;  1X69 A;  3P8H A;  3M0U A;  3ME9 A;  4XAX B;  2FRY A;  1GCP A;  3MEU A;  4QQ6 A;  1GCQ C;  5FRO A;  1K1Z A;  3DLL A;  2QAS A;  1PM3 A;  5DM7 R;  2HNI A;  2DET A;  1QCN A;  4OB3 B;  3HRT A;  1BKB A;  3G4S Q;  2KVQ G;  2M02 A;  3HTR A;  2KT1 A;  4LDW A;  4M78 D;  4LDV A;  4IUQ A;  1QWF A;  3A98 A;  4J6W A;  4Y28 E;  2MWP A;  1GBR A;  4PFP A;  3M53 A;  4EDU A;  1WQ7 A;  1M3A A;  5LJ5 j;  4BY6 C;  5GAN 8;  4GLK A;  4CI0 C;  2XI9 A;  1JEG A;  2MMP A;  2VXF A;  2RQT A;  4NL2 A;  8ATC B;  4HA8 A;  2JUF A;  1MMD A;  3QDF A;  5CVI A;  2ZCF B;  4B6M A;  3M58 A;  1YN8 A;  1N8R C;  3QYG B;  1SRL A;  4OMQ A;  1VUB A;  4MMK A;  4K11 A;  1IRE B;  5GAO q;  4C8Q A;  2MK5 A;  5FWC A;  1Q82 R;  1VQ5 Q;  3G6E A;  1XQH A;  1ABQ A;  2FPF A;  2KY9 A;  4C92 F;  3OB9 A;  1KHC A;  1X6O A;  5A0L A;  1AWJ A;  4M78 G;  1YJW A;  1Q86 R;  2PQW A;  2DXB A;  5GJV B;  4XTU A;  1KIK A;  1IZ6 A;  1YJN A;  1FMK A;  3NPF A;  4M7D D;  2XG8 D;  3CBO A;  1VQM Q;  1TTH B;  3VKI A;  4AG1 C;  2FYK A;  4M7A B;  2CYZ B;  5LL6 S;  4LE9 A;  1FXX A;  2OTL T;  2M51 A;  2F5T X;  2NUP B;  5L8R E;  1OUL A;  2ATC B;  5GAN 4;  2O01 E;  4JJD A;  3VS3 A;  2J6O A;  5CKE A;  5J26 A;  3PIO A;  4DEX A;  2RO0 A;  4Y92 A;  1I8F A;  4C0G A;  4BB7 A;  3CD6 T;  2D8H A;  4M7D C;  2YRV A;  3CC4 T;  4RMO A;  1GL5 A;  2E5K A;  2XMF A;  4M77 D;  3RKY A;  2MIO A;  4BUG A;  1B34 B;  1NZ9 A;  3QUI A;  2YRC A;  3GOX A;  2CZ6 B;  4M7D F;  1X43 A;  4RTT A;  2DKG A;  2LT4 A;  3X25 B;  1BCO A;  4C0F A;  3OQ5 A;  2ZPI B;  3OS0 A;  2ZPF B;  4OMO A;  3H0H A;  1WHK A;  4M7D G;  1M9S A;  4PNO A;  1CKB A;  4AFZ C;  1X01 A;  2KRN A;  4A4G A;  3CCL A;  3L1A A;  5EC7 A;  4AFQ C;  1M1K C;  1T3L A;  3QSU A;  3QZ5 B;  3D7S B;  3VU3 C;  2I0N A;  3OYL A;  5I21 A;  2DVJ A;  5FWB A;  4L59 A;  1ACM B;  3E9G A;  2CSQ A;  1D0Y A;  1JQQ A;  2V1Q A;  5CQY A;  2FVU A;  1M5Q 1;  2HQE A;  3CBP A;  2B8A A;  2RHZ A;  1V76 A;  5AYF A;  5KYX B;  4C8Q C;  2EQM A;  2YUQ A;  2L3Q A;  2OJ2 A;  2EPD A;  3NTK A;  2LX9 A;  4OGC A;  2VUB A;  3X28 B;  3V7S A;  4M75 B;  4A4K A;  1ZX6 A;  2ZZD A;  3G71 A;  1AVZ C;  4A54 A;  1K9M U;  1D1A A;  2EKO A;  2QA4 Q;  4KGX B;  1JO8 A;  3CC7 Q;  1M3B A;  3HRS A;  4E7Z A;  3MPU B;  2X4X A;  1OX9 A;  2DF6 A;  4J9E A;  3SFM A;  1ABO A;  2KR3 A;  4AFS C;  3LX7 A;  1E6H A;  4PJO G;  3LW5 E;  2RK1 A;  3VS7 A;  4FM4 B;  5GAM d;  2EFI A;  1RI9 A;  1M2V B;  4M77 F;  2E6N A;  4LDY A;  4E7K A;  3G6E T;  2XDB A;  3HFO A;  1ZSZ A;  3E19 A;  2V8J A;  1TS9 A;  3MEV A;  1SG5 A;  3H9N A;  3QII A;  4OMM A;  4ZN1 A;  1YJN T;  2MAM A;  4C8Q F;  1LPL A;  1NJI C;  5GJW B;  1YHQ A;  3OY9 A;  1M90 U;  1ZQ1 A;  1VA7 A;  1I1J A;  4X9C A;  4JRP A;  2KDS A;  2LC4 A;  4J8O A;  2DTI A;  3A8M B;  4RG8 A;  1QVP A;  1I4K 1;  1YJW T;  1NEG A;  1NPR A;  1Q86 U;  5LJ5 d;  2E65 A;  1G3Y A;  3BDL A;  1PCX A;  4C0Z A;  3MCA B;  3J81 E;  1K76 A;  3BFM A;  2MF2 A;  1W6X A;  1S1N A;  1VQO A;  1TUG B;  3SDZ A;  3M4Y A;  1VQ6 T;  2K3B A;  3EHQ A;  1N27 A;  1YJN Q;  2ZPE B;  1PWT A;  3GF5 A;  4OP0 A;  2JMC A;  3OYK A;  4F7U E;  2PUK B;  4DBQ A;  2JXB A;  3EGX A;  3VRY A;  1AZG B;  1VQK Q;  2OTJ T;  1VQP A;  3H0F A;  1JXM A;  4QKU A;  4RCC A;  1PRM C;  2CP5 A;  1WJS A;  2GQI A;  1G3T A;  3GNF B;  4JDS A;  5GAN j;  2EJF A;  1U1T A;  4MZP A;  2YRD A;  1FWZ A;  5GAN f;  1VQO Q;  1WZO A;  2DJQ A;  2L2P A;  2KMT A;  1H8K A;  2GCX A;  3M4G A;  2LMJ A;  1LNX A;  5IHN A;  2QG9 B;  1AWO A;  3CCM T;  3C4S A;  2ED1 A;  2ROT A;  5GAN g;  1ZSZ B;  2VWF A;  5CKD A;  2ESW A;  4FU6 A;  4RCB A;  1U06 A;  1QVF S;  1S72 T;  5GAN d;  2BUD A;  1BI1 A;  1QMC A;  2GFU A;  5CK9 A;  2GQV A;  1M2O A;  2KI7 A;  1JXO A;  1RAF B;  2PUO B;  1VIE A;  4E7H A;  2LNH B;  1R0C B;  2M16 A;  1NYG A;  3H0I A;  3CXC S;  1PKT A;  1Y96 B;  4M7A E;  3JV3 A;  1ZUK A;  2AZS A;  1UGV A;  2CP3 A;  3NTH A;  4F14 A;  3OYF A;  4C5H A;  3RR6 A;  4M77 C;  3I35 A;  3JCM d;  3CCV A;  3LYI A;  1TUC A;  1WFW A;  1YWP A;  1C6V X;  2RJF A;  5LJ3 h;  2CT4 A;  2X3X D;  1WX6 A;  3CPW A;  1VQ6 A;  3HKS A;  1WXB A;  3QG1 A;  2V8I A;  2HQH A;  2QTX A;  5CR2 A;  1VQK T;  2QAZ A;  4PL6 A;  4J9I A;  2M0O A;  2O9S A;  2DXU A;  4KUL A;  1Q7Y C;  1PSF A;  3OW2 A;  2I2L A;  4E7I A;  1JJ2 S;  2LRQ A;  2LQK A;  5GAM h;  3VJP A;  4Z88 A;  1M8V A;  4E7S A;  3M0P A;  2DD5 A;  2HKQ B;  3RBB B;  3V8J A;  1WNL A;  4II1 A;  2WSE E;  1UG1 A;  4PJO E;  1YBY A;  2P0K A;  2O4X B;  4A4F A;  2LQW A;  1RAG B;  2KRS A;  2RQW A;  3WXM B;  3G1J A;  3MET A;  4FW2 A;  1PNJ A;  1BU1 A;  4HKE A;  1VQO T;  2QYZ A;  1Y07 A;  2CH4 A;  1HSQ A;  4C92 B;  1WGS A;  3O5Z A;  1WXT A;  3M54 A;  3ULR B;  4ZTJ A;  1KQS P;  3V8L A;  2P0Q A;  3UPU A;  2KEA A;  3JB9 J;  4XU0 A;  4BE2 A;  1OI1 A;  2NUP A;  4ZGE B;  4JJB A;  2X4J A;  2KRM A;  4M77 A;  9ATC B;  2LVM A;  3VUZ A;  5HK3 A;  2HZY A;  5LJ3 j;  2VGM A;  4M7A D;  2CP2 A;  2H8H A;  4M75 G;  1R8O B;  1VQ7 Q;  2CDT A;  1BIB A;  2JM9 A;  2YHT A;  5GAM f;  5LJ3 g;  3S6W A;  2NUZ A;  4J7F A;  4WTO B;  2DL4 A;  2O88 A;  4HCK A;  3CBM A;  2KYM A;  2AZV A;  4M78 E;  3OYH A;  1SKU B;  2YSQ A;  3DKM A;  1NG2 A;  2KK4 A;  3OS2 A;  3CPF A;  1PKS A;  3JB9 F;  1ZUY A;  2X4W A;  4M78 B;  2CUD A;  2YUP A;  1K4U S;  2X51 A;  3M0S A;  2L3S A;  4OB2 B;  2J6F A;  3CMA T;  1S72 A;  4Y91 A;  3I55 A;  5GAN h;  4C5G A;  1VQ7 A;  1UGQ B;  2FZC B;  2EW3 A;  1W2B A;  2FG0 A;  4BD3 A;  1VQ6 Q;  2PVD B;  1RAH B;  3JSC A;  4EMK C;  1F1B B;  1MMG A;  3A8O B;  4GLM A;  3S3M A;  3VS5 A;  3L2V A;  4MZT A;  4KUD K;  2PVG B;  1G8X A;  4DOV A;  1Y96 A;  2CS7 A;  4QVD A;  3JB9 D;  2DM1 A;  3TRE A;  1M1G A;  3V7R A;  4ORZ A;  3SWN A;  3QJY A;  3C94 A;  3VS2 A;  4AT1 B;  4RTW A;  2PU9 B;  2FZG B;  3TSW A;  5GMK i;  4R0K A;  2LJ1 A;  1AOJ A;  2XDD A;  2L5Q A;  1YIT A;  4WCI A;  1QCF A;  3QBY A;  3CCS T;  1Q81 C;  4HT9 A;  1UEC A;  3HRU A;  4MML A;  2AK5 A;  4N0A C;  1Q81 R;  3FJ5 A;  1WI7 A;  3V8K A;  3X20 B;  1MV3 A;  1NE8 A;  2DNU A;  3BDU A;  3REB B;  1SF9 A;  2FRW A;  1YNZ A;  4M7D B;  4C8Q E;  2KT8 A;  3SWN C;  4MDW A;  2DVE A;  2DTO A;  1D0X A;  3IQL A;  5FU7 C;  2DAQ A;  1GCQ A;  2K7A A;  3UAT A;  2FEI A;  4CRI A;  1WQW A;  1WLP B;  1MV0 B;  3VUB A;  4FYV B;  2P0P A;  1BB9 A;  4HCC A;  1YIJ A;  2KQW A;  2NUT B;  1BIA A;  3G7Z A;  5GAN 7;  1QVF P;  2EGE A;  1TG0 A;  2AKL A;  2DIL A;  4LD9 K;  2K2V A;  1MMA A;  3OS1 A;  3OMG A;  3BE3 A;  4HCB A;  2ZAE A;  3ASK A;  2EBP A;  2A37 A;  3CCM Q;  1AWW A;  3QWX X;  3I55 Q;  1OOT A;  2YWW A;  1A0N B;  3DB3 A;  3PFS A;  1BYM A;  5D7U A;  1W4S A;  2O4X A;  2RB6 A;  2LX7 A;  1Y7X A;  4DBH A;  4OMN A;  2E6Z A;  2IPO B;  1G83 A;  3SWN B;  4EMH A;  2JTE A;  3QWY A;  4PLI A;  1VQN A;  1RLP C;  2GTO A;  2QGG A;  3OYG A;  3M56 A;  2Y90 A;  3SHW A;  2KRO A;  2VC8 A;  3VYH B;  3NGP A;  1IB8 A;  3V7C A;  3CCQ T;  4PK4 A;  3WVE B;  2F1L A;  1ZSG A;  1K73 U;  1IHV A;  3LWH A;  1YIT Q;  2YUN A;  2QQA A;  3CCE A;  3VS1 A;  1VQM T;  2O9V A;  1NJI U;  4JS4 A;  5CCA A;  2EYQ A;  1VQ4 T;  2KNB B;  4OMF B;  1QCO A;  2EGC A;  3OYY A;  3CME Q;  3GBQ A;  3M9Q A;  1KK7 A;  2QDL A;  2E41 A;  4R55 A;  4JJN K;  1LCK A;  4DQ2 A;  3FLG A;  5GMK l;  4M78 A;  1ZBJ A;  5GAM j;  1VQL T;  2RA2 A;  2AHJ B;  3DB4 A;  1OQK A;  2CKK A;  2DZC A;  2L0A A;  1N8R U;  4LN2 A;  2DEQ A;  5IHK A;  5KYU A;  2PTK A;  5I2M A;  3EG0 A;  1UGP B;  4GY5 A;  4ELY C;  1OX8 A;  1QP2 A;  2DTH A;  3A5Z B;  1UTI A;  2JZ2 A;  1T0J A;  3BW1 A;  3QDR B;  5J3B A;  4JRQ A;  4EMK A;  2R5M A;  5AT1 B;  3I5S A;  4Z8A A;  4M77 E;  3VS4 A;  4C92 G;  3GLX A;  3OYB A;  1I07 A;  1LVK A;  4NS5 A;  4IUU A;  4PJN A;  3KXT A;  4OF1 A;  3P8B B;  2VYT A;  3EH2 A;  2RQR A;  4XTY A;  1QP3 A;  4HVU A;  4FYY B;  4DBF A;  2L8D A;  5KYY B;  1WYX A;  1S72 Q;  4M7D A;  4PJM A;  1YHQ T;  2RHX A;  1K9M C;  4HXJ A;  1VOM A;  2K5F A;  2YLC A;  3JCM f;  1EFN A;  2PZ1 A;  1P92 A;  2WSC E;  2XHC A;  4E2F B;  3QPH A;  2CZ0 B;  1H92 A;  3M59 A;  3CPW S;  4HVV A;  1AWX A;  5M9O A;  2DL3 A;  3VRZ A;  3OYE A;  2WSF E;  4J9H A;  1UDL A;  2E3I A;  1E6G A;  1VQ9 A;  3E2U A;  1K8A R;  1HYO A;  3RES A;  4J6X A;  4LD6 A;  4Z89 A;  4N4I A;  4B9X A;  1J3T A;  1PHT A;  4J83 A;  1K73 R;  1HJD A;  2LJ0 A;  4D8D A;  1JU5 C;  2RJD A;  3OA6 A;  3REA B;  4J9F A;  3A8H B;  1IGQ A;  1WIE A;  3CCR T;  4LDX A;  5KYW B;  3EFO A;  4M75 D;  1KQS A;  1YCS B;  2HL5 C;  1QQJ A;  1WDX A;  1ZSZ C;  2XU8 A;  4PLL A;  2OTL Q;  2L89 A;  5GMK j;  1GRI A;  3M5A A;  3UWN A;  3UA7 A;  1AHJ B;  5C6S A;  3PE0 A;  5GAN 2;  1MGQ A;  4C5E A;  3MJX A;  2OI3 A;  2EYW A;  3EG2 A;  4FIB A;  1TSF A;  3A8L B;  1Y0M A;  4M75 C;  2J7I A;  2VXE A;  3JCM h;  3HHT B;  2QEX A;  2OTJ Q;  2JW4 A;  1MUZ A;  1ZA2 B;  2FB7 A;  3CPW P;  5LJ3 d;  2EVR A;  4X9D A;  4HT8 A;  1JBM A;  4X34 A;  2EIF A;  3M0R A;  2W0Z A;  2COY A;  1KC8 C;  1ARK A;  2MPX C;  4RTY A;  1QLY A;  4V2S A;  5HKC A;  2NYS A;  2ZPB B;  4ZNX A;  1Q86 C;  2H3E B;  2QXF A;  5DLO A;  3ZBD A;  1PC0 A;  2E1H A;  2JM8 A;  4FW1 A;  1QW1 A;  3QZ9 B;  1W70 A;  3FEO A;  1UUE A;  2DIG A;  1K9M R;  3EGX B;  2ECZ A;  4XU3 A;  3L42 A;  3JCM Q;  3PGG A;  4PKC C;  3CC4 Q;  1M27 C;  5GAO m;  1JRI A;  3L2Z A;  2D9T A;  1OZ2 A;  5KYW A;  1PD0 A;  2EQK A;  3EG9 A;  4IUP A;  4ANJ A;  2A7Y A;  2MOX A;  4ESR A;  3CC2 A;  4JRI A;  3CCU T;  3QKJ A;  2HEQ A;  1M30 A;  3M57 A;  2XIC A;  3L2U A;  1VQ8 Q;  5FW9 A;  2M0Y A;  3L2Q A;  4E7J A;  2JJ9 A;  3H6Z A;  2RI3 A;  4E7L A;  1VQN Q;  3CCQ A;  3ZL7 C;  4FYX B;  2A36 A;  2DRK A;  2LTO A;  4TVR A;  2HCK A;  2M9U A;  5KE2 A;  4IUR A;  1VYV A;  4M78 C;  2X35 A;  3CCL T;  3TU4 K;  1VQM A;  2Z0W A;  1NLO C;  1Z9Z A;  3JCM V;  4QW2 A;  1UB4 A;  1UHF A;  1WA7 A;  2FPD A;  1UE9 A;  2NUT A;  4A63 B;  2CP7 A;  4AFU C;  1TH7 A;  2FHD A;  2P84 A;  3NFC A;  2SRC A;  3UA6 A;  2CUB A;  2FO0 A;  2DBM A;  2MI6 A;  4N0A A;  1UJY A;  3OYM A;  3OBY A;  4RKU E;  2HKN A;  4O6J A;  3JB9 H;  2LQ8 A;  4FL6 A;  4LUD A;  1OEB A;  1VQN T;  3CCU A;  1M1K R;  2LDM A;  2PNI A;  3CCJ Q;  3FRN A;  2KSS A;  3CCV T;  2YXY A;  1YI2 A;  4IKF A;  1RUW A;  4M75 E;  1XTD A;  2VVK A;  1IO6 A;  4FSX A;  3TQ7 P;  4J9G A;  1GFD A;  4KBM B;  4OGE A;  5GAN 6;  3JB9 I;  1VQ9 Q;  1YI2 T;  1AZE A;  2C0T A;  4HVW A;  5KH6 A;  1X6G A;  4ZN3 A;  2CSI A;  3OW2 S;  1NM7 A;  5GAO r;  2QDY B;  1NEB A;  5CKB A;  4F7U A;  3JCM W;  4FT4 A;  1N5Z A;  1EZZ B;  3LGF A;  2GTJ A;  3URG A;  5CKF A;  2O31 A;  3EH1 A;  2LQN A;  3CCS A;  2R5A A;  3TVT A;  1ZLM A;  2GF7 A;  1N8R R;  1KG1 A;  2DXC A;  1VQ8 A;  2C06 A;  4IIM A;  4Q5W A;  2K5I A;  2EYZ A;  1ZA1 B;  1YJ9 A;  4XTW A;  4XQ3 A;  4KGZ B;  1U1S A;  3EFS A;  2RD1 A;  4A4H A;  2PVO B;  2J05 A;  1YJW Q;  3I56 Q;  4XU1 A;  1C0M A;  1D3B A;  2RJC A;  2D8J A;  5CQX A;  3PTA A;  3NHN A;  3VYG A;  3FDR A;  2K6D A;  4J7I A;  4N4H A;  1T3S A;  2CZ1 B;  3HFN A;  5I2S A;  1TWB A;  3JRZ A;  1SSH A;  2CP0 A;  2EGA A;  2R57 A;  4FSS A;  4E47 A;  1VQ4 A;  3N5B B;  3CME A;  1D09 B;  4C8Q G;  2OAU A;  3CD6 A;  2B86 A;  4C0D C;  1FX7 A;  4JZ4 A;  2KXD A;  3KUF A;  4C0D B;  1K8A C;  3CCE T;  3CMA A;  2AKK A;  1QVF A;  2K2M A;  2DYB A;  4L6V 5;  3UT1 A;  3RIR A;  4FYW B;  2BE7 D;  4RTV A;  4AG2 C;  2GBQ A;  5KYY A;  3JCM e;  1G3S A;  4JRK A;  4BE1 A;  4YTL A;  2V1R A;  3JCM g;  1Q81 U;  2GNC A;  1RI0 A;  1RAC B;  4HCZ A;  5C0M A;  3C12 A;  2JTF A;  4F7U B;  1KQ2 A;  3CEY A;  4M78 F;  2MYS A;  3INZ A;  3KBG A;  1FYN A;  3NTI A;  3I55 T;  3RUX A;  2K57 A;  3PVL A;  2BE9 B;  1H64 1;  4JS5 A;  2DXT A;  3GPL A;  2JOY A;  1UGS B;  2AIR B;  2SEM A;  3EG1 A;  5GAN e;  5A0G A;  2IVW A;  1VQP T;  3OBW A;  2E12 A;  3UF4 A;  4KGV B;  1RLQ C;  2ZGW A;  1ZUU A;  3M0T A;  2ED0 A;  2J06 A;  3MEA A;  2DPP B;  1FMW A;  1Y57 A;  5LJ5 f;  4KUI A;  2IIM A;  1M4Z A;  1UFF A;  2F2X A;  3A8G B;  4PJJ A;  1X27 A;  1M2V A;  3X24 B;  4NL3 A;  5KCH A;  2DIQ A;  2DFU A;  2QA4 T;  3QJ6 A;  1JJ2 P;  2FZK B;  3OYD A;  2RI2 A;  3PNW C;  3AHU A;  4QQG A;  2K79 A;  3FJP A;  5D6W A;  3CCS Q;  1KHI A;  3WVD B;  2DL5 A;  1E7O A;  1KC8 R;  1TOV A;  1WJR A;  2HQX A;  4QVZ A;  2LCL A;  4C92 C;  4KH0 B;  1KQ1 A;  2RF0 A;  3JCM X;  1VQ4 Q;  3OYJ A;  4PJO B;  5LJ5 e;  2RHU A;  3BY7 A;  1RAI B;  4L5G A;  2XDP A;  4EMK B;  2LZ6 B;  4XTV A;  1RAE B;  1VQK A;  5D6X A;  4M7A G;  1YP5 A;  2HDA A;  3JCM b;  3SEM A;  3TEE A;  3HPW A;  1D0Z A;  1YIJ Q;  1W2B P;  2E4H A;  4PFZ A;  3CC2 T;  3I5R A;  1K0S A;  2RJE A;  1R0B G;  3GIB A;  4Z02 A;  3OS5 A;  1QKW A;  4EMG A;  2NWM A;  1SHG A;  3SB2 A;  2F2V A;  2JN0 A;  3EHR A;  3RMQ A;  2Y4Y A;  2DBK A;  2RNA A;  5GAO p;  3EG3 A;  3MP1 A;  1NPP A;  5DY9 A;  2BIV A;  1N9S A;  5GAO l;  2KGT A;  1IXD A;  1XOV A;  4EPC A;  1O75 A;  3MKD A;  1M3C A;  3L2R A;  1MND A;  3CME T;  2JTM A;  1K9A A;  2RK2 A;  3JCM c;  2OX7 A;  2YUO A;  1PD1 A;  4IUT A;  2DZ9 A;  4N4G A;  4F16 A;  1OYX A;  1WHG A;  5LJ3 e;  1VQ8 T;  3THK A;  1VQ5 T;  5KCO A;  2EYY A;  2D0N A;  1B3Q A;  2QI2 A;  3CCU Q;  3A1P A;  4F17 A;  4JUV A;  1MMN A;  2FPE A;  1BBZ A;  1SHF A;  2KYB A;  3S3N A;  3CC2 Q;  4GBQ A;  2J6K A;  3CCM A;  4XTX A;  1VQL A;  3HP9 A;  3EGU A;  3E9F A;  2V8K A;  5IHI A;  1KJW A;  1D1C A;  2WAC A;  3EG9 B;  4XU2 A;  2KBT A;  5GMK e;  2DK3 A;  2QQ9 A;  4ATO A;  1AD5 A;  2CP6 A;  3I9Q A;  3CCR A;  2OAW A;  3CC4 A;  2ZPG B;  3MO8 A;  2DO3 A;  3ER0 A;  2BKD N;  1JJ2 A;  2K3X A;  1Y71 A;  4CC3 A;  2HSP A;  3F70 A;  4IIO A;  4ZGD B;  4M4Z A;  3QHS A;  1WHJ A;  2EKH A;  3MP8 A;  3HSB A;  2X3W D;  4OB1 B;  2ROL A;  2X9H A;  3FIF A;  1EX4 A;  2EQJ A;  3CC7 A;  1QVG A;  2D0Q B;  4MDX A;  2GGR A;  3JCM J;  1Q82 C;  1VQ9 T;  4BY6 B;  1Q82 U;  3EGD A;  4M7D E;  3M55 A;  3TSZ A;  1WXU A;  2OTL A;  4M7A C;  3G71 Q;  2JS2 A;  1NYF A;  1G2B A;  1M8M A;  1MHN A;  4VUB A;  5A0D A;  2DL8 A;  7AT1 B;  1M90 C;  2DE0 X;  1M90 R;  1WHM A;  2HL3 A;  5HCK A;  1XNI A;  3CXC P;  4A4E A;  4C8Q B;  1B7T A;  2AT1 B;  1IRX A;  3J7A F;  1VQP Q;  1OPL A;  4PJL A;  1NJI R;  1W1F A;  3RMS A;  3JB9 G;  1VQL Q;  4J9C A;  1H3Z A;  2DL7 A;  2GFA A;  1YCY A;  4M77 B;  2HAX A;  3RKW A;  1X75 C;  2JNG A;  2LP5 A;  2DMO A;  2JVV A;  4P5N A;  2EAY A;  5IXB A;  1BK2 A;  4LUE A;  4FCY A;  2KAF A;  1M1K U;  2E5Q A;  2VGN A;  2K9G A;  1TU0 B;  1UGR B;  1BCM A;  2QK0 A;  4AMC A;  2ABL A;  1U5S A;  4PJO A;  1U3O A;  4ZTF A;  1V1C A;  3R6O A;  2XK0 A;  2DER A;  5IT9 E;  1YIT T;  4C92 D;  3G4S T;  3S3O A;  4O5V A;  4ZGJ B;  2D1X A;  2Y4X A;  5FU7 B;  4KT0 E;  4KH1 B;  1B34 A;  2YT6 A;  1VYU A;  3G4S A;  3MEW A;  2V26 A;  1VQ5 A;  2X4Y A;  2JMA A;  3X26 B;  5GAM g;  5EG2 A;  1X2K A;  3QYH B;  1BI0 A;  1YJ9 T;  3EFR A;  1WPY A;  3Q1J A;  3J80 E;  3LWI A;  1NLP C;  1X6B A;  2RQU A;  4LDU A;  1OU9 A;  1RAA B;  2QEX T;  4BE0 A;  4J5Y A;  4FT2 A;  4OMP A;  2VB6 A;  1KQS S;  4E6R A;  1H3H A;  3OYN A;  1OPK A;  1QKX A;  4LXC A;  3G6E Q;  3EFO B;  4RUG A;  4WF2 A;  2DRM A;  2K3Y A;  1AT1 B;  3E1S A;  4JLG A;  4PFO A;  3PIP A;  3C0C A;  2QQB A;  2A08 A;  2BZ8 A;  3PMI A;  1ZHI A;  2A28 A;  2DD4 A;  1YI2 Q;  4RTU A;  2CH4 W;  5KE3 A;  3VS6 A;  1SPK A;  2XID A;  2DYI A;  3LLR A;  1JB0 E;  1SSF A;  4D8K A;  2M1H A;  2RN8 A;  1DJ7 B;  4RTX A;  4C5I A;  5IAY A;  3CC7 T;  1Q7Y U;  2A0F B;  2EWN A;  3L2W A;  4JLI A;  2CZ7 B;  3LGL A;  1OU8 A;  4F04 B;  2DJZ A;  5FU6 B;  4QVC A;  2NLU A;  4MZM A;  1T0H A;  3OW2 P;  2A3L A;  3H8Z A;  3GP8 A;  2EJ9 A;  1QWE A;  3KFV A;  2BTT A;  4J9D A;  1MNE A;  1IGU A;  2C0I A;  2CT3 A;  1V29 B;  3OSS C;  1I5L A;  2RPN A;  3JCM P;  1YJ9 Q;  2D6F A;  5IN1 A;  1BI2 A;  4R56 A;  2QEX Q;  2VKN A;  2OTJ A;  4CC4 B;  1QVG P;  2BZX A;  4F7U G;  3OYA A;  1YIJ T;  1KC8 U;  3CXC A;  4UC4 A;  3GNG A;  2DX1 A;  5LJ5 g;  4C92 E;  2YLB A;  4XK8 E;  1HK9 A;  1TUD A;  2H3J A;  3LH0 A;  1KD1 U;  3VS0 A;  4M7A F;  4CC7 A;  2IG0 A;  3I56 T;  2RI5 A;  3EGD B;  1SRM A;  2COZ A;  4ME7 A;  2KXC A;  2P4T A;  3OYC A;  2XKO C;  3RDV A;  3MHX A;  1NBE B;  5GAM e;  5GMK h;  1C1A A;  3P8D A;  4A53 A;  2R58 A;  5CKH A;  1LJO A;  2ENM A;  3NMZ C;  3CMA Q;  2O2O A;  4DOW A;  2ZPH B;  5LJ3 f;  2LT1 A;  4DA4 A;  3EAE A;  3CCR Q;  4BI4 A;  1N9R A;  3RER A;  5D6Y A;  3OSV A;  3TCJ A;  3QXE B;  2JS0 A;  4OVA A;  2L3R A;  1VYT A;  4RTZ A;  1I81 A;  1VIF A;  5GMK m;  2CRE A;  4F7U F;  3ZEH A;  1FMV A;  2K4Y A;  5CIU A;  1GXI E;  5CO7 A;  2BZY A;  2VAS A;  5I22 A;  1KD1 C;  4ELZ C;  1M1F A;  2MCN A;  1R77 A;  5A2Q E;  3CCL Q;  5HK0 A;  4M75 F;  5FLX E;  2E64 A;  2DEU A;  1BI3 A;  3CCV Q;  2LCC A;  2QTV A;  5L23 A;  2G6F X;  4BDZ A;  4X1V A;  2RH2 A;  5HY6 A;  5I11 A;  5FRM A;  1GFC A;  4B9W A;  4OML A;  4BI3 A;  4PJO F;  3OYI A;  2HBW A;  1KSW A;  3CCJ A;  1Q95 G;  2DLP A;  2QQS A;  1HD3 A;  4XTZ A;  3U23 A;  3HL8 A;  4PJO C;  5IH2 A;  1TXQ A;  1LOJ A;  2CGH A;  1YHQ Q;  3VV0 A;  1K73 C;  2HSE B;  1K8A U;  1Q7Y R;  4JZ3 A;  3ZFJ A;  4M77 G;  1CSK A;  3O8V A;  4BAC A;  3I56 A;  2EQU A;  2DA9 A;  2W10 A;  1PRL C;  1QVG S;  2COW A;  2FL7 A;  3H41 A;  4BI8 B;  1YWO A;  1UJ0 A;  2HD0 A;  1SEM A;  1G5V A;  3DLM A;  1WHL A;  2F5K A;  2LJ3 A;  2HMA A;  5LJ5 h;  4PJO D;  3C95 A;  6AT1 B;  2L3P A;  5GAN 5;  5GAO n;  2RHY A;  3CCQ Q;  2F2W A;  3CCE Q;  2KE9 A;  2E10 A;  4KRT A;  5J39 A;  1OZ3 A;  2XD0 A;  1X2Q A;  4EIK A;  1B07 A;  3RKX A;  2EYX A;  1I5O B;  2VV5 A;  2QA4 A;  3OMC A;  4DBR A;  1CKA A;  2P4R A;  5ECA A;  2C0O A;  2E3H A;  1D3B B;  4BDY A;  4NOY A;  1Z9Q A;  1W2B S;  3UDC A;  2LCS A;  3PMT A;  4JPB W;  4OB0 B;  1KFZ A;  2RMO A;  1RAD B;  4M7A A;  2F69 A;  2G3R A;  1YFN A;  3FC3 A;  1I0C A;  5KYN A;  3PVQ A;  3CD6 Q;  3T9N A;  2RQV A;  5FRN A;  3AT1 B;  5FU6 C;  2EJG A;  4JJC A;  5CAI A;  4J9B A;  1AEY A;  4DEY A;  1G3W A;  3LH5 A;  4J6Y A;  4QQD A;  3M0Q A;  5KYU B; 
#chains in the Genus database with same CATH homology
 1VQL A;  2E70 A;  3CPW A;  3HP9 A;  3E9F A;  2V8K A;  1WJQ A;  1VQ6 A;  3HKS A;  2WAC A;  2XU8 A;  4PLL A;  3QG1 A;  4C8Q D;  4XU2 A;  2V8I A;  3OW2 A;  1UEB A;  2L89 A;  3MP6 A;  5GMK e;  2DK3 A;  5GMK j;  2QTX A;  5CR2 A;  1VQK T;  3M5A A;  4PL6 A;  2QQ9 A;  3PT9 A;  4ATO A;  3UWN A;  4RG2 A;  2M0O A;  5DLQ E;  4C92 A;  3CCR A;  3CC4 A;  1AHJ B;  5C6S A;  3CCJ T;  2DXU A;  1HXD A;  1ZBX A;  2ZPG B;  3MO8 A;  1N6A A;  1PSF A;  1RL2 A;  2DO3 A;  1MGQ A;  2I2L A;  2BKD N;  2LRQ A;  3ER0 A;  2K3X A;  2LQK A;  4IUV A;  4C5E A;  1Y71 A;  5GAM h;  3VJP A;  1JJ2 A;  2RHI A;  3F70 A;  3JAM E;  1M8V A;  4ZGD B;  4FIB A;  3FB9 A;  3QHS A;  3G71 T;  3A8L B;  2DD5 A;  4M75 C;  3MP8 A;  2LNV A;  3HSB A;  5GAN 3;  2VXE A;  3JCM h;  3HHT B;  4M75 A;  2QEX A;  1U8R A;  2QQR A;  4OB1 B;  3FIF A;  2EQJ A;  3CC7 A;  2FB7 A;  1QVG A;  2D0Q B;  4MDX A;  3JCM J;  5LJ3 d;  3V8J A;  1Q82 C;  1VQ9 T;  1WNL A;  2HBP A;  4II1 A;  2MWO A;  2WSE E;  4X9D A;  4PJO E;  4HT8 A;  1YBY A;  4BY6 B;  2P0K A;  1Q82 U;  1JBM A;  2O4X B;  4X34 A;  1PSE A;  4A4F A;  3M55 A;  2EIF A;  4M7D E;  2OTL A;  1KC8 C;  4M7A C;  2K5L A;  3WXM B;  3MET A;  3SD4 A;  1VQ7 T;  4V2S A;  1EIF A;  5HKC A;  2ZPB B;  3QO3 A;  1Q86 C;  2QXF A;  5DLO A;  1MHN A;  1O9S A;  3ZBD A;  4HKE A;  4D6W A;  2E1H A;  4VUB A;  1VQO T;  2RM4 A;  5A0D A;  1Y07 A;  4C92 B;  1QW1 A;  1WGS A;  3ME9 A;  3P8H A;  3QZ9 B;  4XAX B;  4QQ6 A;  3MEU A;  3FEO A;  5FRO A;  3M54 A;  4ZTJ A;  3DLL A;  2DIG A;  3V8L A;  1M90 C;  2P0Q A;  3UPU A;  4XU3 A;  3L42 A;  3JCM Q;  3JB9 J;  3PGG A;  4PKC C;  4XU0 A;  5DM7 R;  2HNI A;  4BE2 A;  5GAO m;  4OB3 B;  1OI1 A;  1XNI A;  4ZGE B;  1JRI A;  3HRT A;  3L2Z A;  1BKB A;  2D9T A;  2X4J A;  4A4E A;  4C8Q B;  1OZ2 A;  4M77 A;  2KVQ G;  2LVM A;  3VUZ A;  5HK3 A;  5LJ3 j;  4LDW A;  4M78 D;  2VGM A;  4LDV A;  2EQK A;  4IUQ A;  3J7A F;  4M7A D;  4J6W A;  4Y28 E;  2MWP A;  4IUP A;  3RMS A;  3JB9 G;  3M53 A;  2A7Y A;  4EDU A;  4M75 G;  1R8O B;  1H3Z A;  3CC2 A;  4JRI A;  3CCU T;  2GFA A;  1WQ7 A;  1YCY A;  1BIB A;  4M77 B;  3QKJ A;  4BY6 C;  5LJ5 j;  2HAX A;  3RKW A;  5GAN 8;  2YHT A;  5GAM f;  1X75 C;  2JNG A;  5LJ3 g;  3M57 A;  2XIC A;  3L2U A;  2JVV A;  4GLK A;  3S6W A;  4P5N A;  4CI0 C;  4J7F A;  2EAY A;  3L2Q A;  2XI9 A;  4E7J A;  2KAF A;  3H6Z A;  2RI3 A;  4E7L A;  2MMP A;  1M1K U;  2VXF A;  4NL2 A;  2E5Q A;  4HA8 A;  2VGN A;  3CCQ A;  2JUF A;  5CVI A;  2LTO A;  2ZCF B;  3CBM A;  3M58 A;  4M78 E;  4TVR A;  3OYH A;  5KE2 A;  2M9U A;  3DKM A;  3QYG B;  3OS2 A;  2KK4 A;  1N8R C;  4IUR A;  1UGR B;  3CPF A;  4M78 C;  2X35 A;  3JB9 F;  1VUB A;  4MMK A;  4PJO A;  3CCL T;  3TU4 K;  2X4W A;  4M78 B;  1VQM A;  3JCM V;  4QW2 A;  1IRE B;  4OB2 B;  4C8Q A;  5GAO q;  3CMA T;  1UB4 A;  1S72 A;  3G6E A;  4Y91 A;  4ZTF A;  3I55 A;  5GAN h;  3R6O A;  2XK0 A;  4C5G A;  1XQH A;  1VQ7 A;  1UGQ B;  1TH7 A;  5GAN 2;  5IT9 E;  1W2B A;  2FHD A;  2KY9 A;  3NFC A;  4BD3 A;  4C92 F;  1YIT T;  4C92 D;  2PVD B;  3JSC A;  3G4S T;  3S3O A;  3OB9 A;  4EMK C;  4O5V A;  1KHC A;  4ZGJ B;  2MI6 A;  1X6O A;  3A8O B;  5A0L A;  2Y4X A;  4M78 G;  4N0A A;  3S3M A;  5FU7 B;  1YJW A;  4KT0 E;  3OYM A;  3OBY A;  2PQW A;  2DXB A;  3L2V A;  4MZT A;  4RKU E;  4KUD K;  1B34 A;  4O6J A;  3G4S A;  2PVG B;  2LQ8 A;  4XTU A;  3JB9 H;  1IZ6 A;  3MEW A;  1YJN A;  4FL6 A;  1VQ5 A;  2X4Y A;  4DOV A;  1Y96 A;  3X26 B;  4M7D D;  5GAM g;  1VQN T;  2XG8 D;  2CS7 A;  3CBO A;  3CCU A;  2LDM A;  5EG2 A;  3VKI A;  3QYH B;  1BI0 A;  4QVD A;  3JB9 D;  3TRE A;  1M1G A;  2FYK A;  4M7A B;  3V7R A;  1YJ9 T;  2CYZ B;  3SWN A;  3EFR A;  2KSS A;  3FRN A;  3C94 A;  3QJY A;  1WPY A;  5LL6 S;  3CCV T;  1YI2 A;  3Q1J A;  4IKF A;  2PU9 B;  4M75 E;  3J80 E;  1XTD A;  5GMK i;  4FSX A;  1FXX A;  3LWI A;  2OTL T;  4LDU A;  1Q7Y U;  2XDD A;  4KBM B;  2F5T X;  2L5Q A;  2QEX T;  4OGE A;  4BE0 A;  5L8R E;  4J5Y A;  5GAN 6;  1YIT A;  3QBY A;  4FT2 A;  5GAN 4;  3JB9 I;  2O01 E;  3CCS T;  1Q81 C;  1YI2 T;  4HT9 A;  1KQS S;  5CKE A;  5KH6 A;  3HRU A;  4MML A;  4N0A C;  5J26 A;  3PIO A;  4ZN3 A;  3OYN A;  2RO0 A;  3V8K A;  3X20 B;  3OW2 S;  1I8F A;  5GAO r;  2QDY B;  4WF2 A;  4C0G A;  4BB7 A;  5CKB A;  3CD6 T;  4F7U A;  1NE8 A;  2K3Y A;  2YRV A;  3E1S A;  3BDU A;  4JLG A;  3PIP A;  3CC4 T;  3JCM W;  4FT4 A;  4RMO A;  4M7D B;  2QQB A;  4M77 D;  3LGF A;  3PMI A;  3RKY A;  1ZHI A;  2DD4 A;  5CKF A;  3URG A;  4BUG A;  1B34 B;  4C8Q E;  1NZ9 A;  3QUI A;  3SWN C;  4MDW A;  2DVE A;  3CCS A;  2DTO A;  3GOX A;  2CZ6 B;  2R5A A;  5FU7 C;  4M7D F;  2DKG A;  5KE3 A;  2GF7 A;  2DAQ A;  2LT4 A;  2XID A;  3X25 B;  3LLR A;  1JB0 E;  1SSF A;  3OQ5 A;  4C0F A;  4CRI A;  1KG1 A;  1WQW A;  2M1H A;  2DXC A;  2ZPI B;  1DJ7 B;  3VUB A;  3OS0 A;  2ZPF B;  4C5I A;  1VQ8 A;  2K5I A;  4Q5W A;  2C06 A;  2P0P A;  4M7D G;  1M9S A;  4PNO A;  5IAY A;  4HCC A;  3CC7 T;  1YIJ A;  2EWN A;  2KQW A;  4XTW A;  1BIA A;  1X01 A;  4XQ3 A;  3L2W A;  4JLI A;  1U1S A;  2CZ7 B;  3LGL A;  4A4G A;  3EFS A;  2DJZ A;  3G7Z A;  3CCL A;  2RD1 A;  5FU6 B;  4A4H A;  2NLU A;  3L1A A;  2PVO B;  4QVC A;  4MZM A;  5GAN 7;  4XU1 A;  1D3B A;  1M1K C;  2A3L A;  4LD9 K;  2RJC A;  3H8Z A;  3QZ5 B;  3GP8 A;  2K2V A;  1Q7Y C;  2EJ9 A;  3VU3 C;  3QSU A;  3OS1 A;  3OYL A;  5I21 A;  3OMG A;  5CQX A;  3PTA A;  3VYG A;  3FDR A;  4J7I A;  4N4H A;  4M7D C;  4HCB A;  4L59 A;  4E7I A;  3ASK A;  2CZ1 B;  3HFN A;  5I2S A;  3E9G A;  3JRZ A;  5CQY A;  1V29 B;  2FVU A;  1M5Q 1;  2HQE A;  2R57 A;  3CBP A;  3OSS C;  3JCM P;  1I5L A;  4E47 A;  1VQ4 A;  3N5B B;  2B8A A;  3CME A;  2RHZ A;  3DB3 A;  2OAU A;  3PFS A;  4C8Q G;  2D6F A;  5IN1 A;  3CD6 A;  1BI2 A;  5AYF A;  1BYM A;  4C0D C;  1W4S A;  4C8Q C;  1FX7 A;  2O4X A;  2RB6 A;  4R56 A;  2OTJ A;  2EQM A;  3KUF A;  4C0D B;  1K8A C;  3CCE T;  1Y7X A;  3CMA A;  4F7U G;  2E6Z A;  1QVF A;  3OYA A;  4L6V 5;  3UT1 A;  3RIR A;  1YIJ T;  1KC8 U;  3CXC A;  3NTK A;  4UC4 A;  3SWN B;  4EMH A;  2LX9 A;  4OGC A;  3GNG A;  4PLI A;  2VUB A;  3X28 B;  3V7S A;  5LJ5 g;  4C92 E;  3JCM e;  1VQN A;  4M75 B;  1G3S A;  4A4K A;  4JRK A;  2YLB A;  4XK8 E;  4BE1 A;  1HK9 A;  2ZZD A;  4YTL A;  2H3J A;  3LH0 A;  3OYG A;  3M56 A;  3JCM g;  3G71 A;  1Q81 U;  1KD1 U;  4M7A F;  1RI0 A;  2IG0 A;  4HCZ A;  5C0M A;  3C12 A;  3I56 T;  2RI5 A;  4A54 A;  2Y90 A;  2JTF A;  1K9M U;  4F7U B;  1KQ2 A;  3CEY A;  2EKO A;  4ME7 A;  2VC8 A;  4M78 F;  3VYH B;  2P4T A;  3OYC A;  3INZ A;  3KBG A;  2XKO C;  3V7C A;  3CCQ T;  3NTI A;  3WVE B;  3HRS A;  2X4X A;  3I55 T;  3MHX A;  3RUX A;  1K73 U;  2K57 A;  3LWH A;  1H64 1;  5GAM e;  5GMK h;  2QQA A;  2DXT A;  4JS5 A;  4KUL A;  3GPL A;  3CCE A;  3P8D A;  2JOY A;  3SFM A;  4A53 A;  1UGS B;  5GAN e;  5A0G A;  1VQM T;  2IVW A;  2R58 A;  3LX7 A;  5CKH A;  4PJO G;  1VQP T;  1NJI U;  3OBW A;  1LJO A;  3LW5 E;  2E12 A;  5CCA A;  4JS4 A;  4DOW A;  2EYQ A;  2ZPH B;  1VQ4 T;  5LJ3 f;  4OMF B;  2RK1 A;  4FM4 B;  2LT1 A;  2EFI A;  5GAM d;  4DA4 A;  4M77 F;  3OYY A;  3EAE A;  4BI4 A;  3M9Q A;  2E6N A;  1N9R A;  4LDY A;  3RER A;  5D6Y A;  3OSV A;  3TCJ A;  4E7K A;  3QXE B;  2E41 A;  2ZGW A;  4OVA A;  3G6E T;  4R55 A;  2L3R A;  3HFO A;  2XDB A;  3E19 A;  2V8J A;  4JJN K;  4DQ2 A;  3MEA A;  2DPP B;  3FLG A;  5GMK l;  5LJ5 f;  3MEV A;  4M78 A;  1I81 A;  1VIF A;  5GMK m;  5GAM j;  1VQL T;  4F7U F;  4KUI A;  3ZEH A;  3QII A;  1M4Z A;  2K4Y A;  4ZN1 A;  2RA2 A;  2AHJ B;  3A8G B;  3DB4 A;  1YJN T;  2CKK A;  2DZC A;  2MAM A;  5CIU A;  3X24 B;  1GXI E;  5CO7 A;  4C8Q F;  4NL3 A;  1N8R U;  1NJI C;  5KCH A;  1KD1 C;  4ELZ C;  1M1F A;  5A2Q E;  2DEQ A;  5HK0 A;  1YHQ A;  4M75 F;  5FLX E;  2E64 A;  3OY9 A;  1BI3 A;  1ZQ1 A;  2DIQ A;  1M90 U;  5I2M A;  2LCC A;  1YJ9 A;  4X9C A;  1UGP B;  3QJ6 A;  4GY5 A;  4ELY C;  2KDS A;  2QA4 T;  4JRP A;  1QP2 A;  2DTH A;  2LC4 A;  4J8O A;  4BDZ A;  3OYD A;  3A5Z B;  2DTI A;  3A8M B;  2RH2 A;  4RG8 A;  5HY6 A;  2JZ2 A;  1I4K 1;  2RI2 A;  1QVP A;  3BW1 A;  3PNW C;  1YJW T;  5FRM A;  3AHU A;  4B9W A;  3QDR B;  5J3B A;  4JRQ A;  4QQG A;  4EMK A;  1NPR A;  4BI3 A;  3FJP A;  1Q86 U;  5D6W A;  5LJ5 d;  1KHI A;  4PJO F;  2E65 A;  1G3Y A;  2R5M A;  3BDL A;  3WVD B;  4C0Z A;  3MCA B;  3J81 E;  3OYI A;  1WJR A;  3BFM A;  4M77 E;  3CCJ A;  2HQX A;  2LCL A;  2MF2 A;  4QVZ A;  4C92 C;  2QQS A;  1VQO A;  1KQ1 A;  1JJ2 S;  3JCM X;  3SDZ A;  4C92 G;  3M4Y A;  3GLX A;  4XTZ A;  3OYJ A;  3OYB A;  4PJO B;  4NS5 A;  4IUU A;  5LJ5 e;  1VQ6 T;  3HL8 A;  4PJO C;  3KXT A;  4OF1 A;  1N27 A;  2RHU A;  2ZPE B;  1LOJ A;  3BY7 A;  3GF5 A;  4OP0 A;  2CGH A;  3P8B B;  3OYK A;  4L5G A;  2VYT A;  2XDP A;  3VV0 A;  4F7U E;  2PUK B;  1K73 C;  1K8A U;  4EMK B;  4XTV A;  4XTY A;  3ZFJ A;  4M77 G;  1VQK A;  1QP3 A;  5D6X A;  4M7A G;  2OTJ T;  3O8V A;  4BAC A;  3I56 A;  1VQP A;  3JCM b;  4RCC A;  2EQU A;  2L8D A;  1WJS A;  1G3T A;  3GNF B;  4JDS A;  3TEE A;  3HPW A;  5GAN j;  1QVG S;  2EJF A;  1U1T A;  4MZP A;  2FL7 A;  4BI8 B;  4M7D A;  2HD0 A;  1FWZ A;  5GAN f;  1YHQ T;  2RHX A;  1K9M C;  3CC2 T;  2RJE A;  3GIB A;  4Z02 A;  1G5V A;  3DLM A;  2K5F A;  2KMT A;  2YLC A;  2F5K A;  3OS5 A;  2GCX A;  3M4G A;  3JCM f;  4EMG A;  5LJ5 h;  1P92 A;  3C95 A;  3SB2 A;  1LNX A;  4PJO D;  2JN0 A;  5GAN 5;  3CCM T;  3C4S A;  2WSC E;  2XHC A;  2RHY A;  5GAO n;  5GAN g;  3QPH A;  3RMQ A;  2Y4Y A;  5CKD A;  4FU6 A;  2E10 A;  2CZ0 B;  5GAO p;  4RCB A;  5J39 A;  5DY9 A;  3MP1 A;  1NPP A;  1OZ3 A;  2BIV A;  2XD0 A;  1N9S A;  1QVF S;  1S72 T;  5GAO l;  3RKX A;  5GAN d;  2BUD A;  1BI1 A;  1XOV A;  2GFU A;  3M59 A;  2VV5 A;  2QA4 A;  5CK9 A;  2GQV A;  4EPC A;  3OMC A;  3CPW S;  1O75 A;  5M9O A;  3OYE A;  2WSF E;  2PUO B;  1VIE A;  1VQ9 A;  4E7H A;  3L2R A;  2M16 A;  3CME T;  2JTM A;  1D3B B;  3CXC S;  4BDY A;  4NOY A;  1Y96 B;  2RK2 A;  4J6X A;  3RES A;  3JCM c;  4M7A E;  4LD6 A;  1W2B S;  4N4I A;  4IUT A;  3UDC A;  2DZ9 A;  3PMT A;  4N4G A;  4OB0 B;  1OYX A;  5LJ3 e;  4B9X A;  4M7A A;  1VQ8 T;  4J83 A;  1VQ5 T;  2F69 A;  5KCO A;  3NTH A;  2G3R A;  2RJD A;  3OYF A;  3OA6 A;  4C5H A;  2QI2 A;  4M77 C;  3FC3 A;  3JCM d;  4JUV A;  3CCV A;  3A8H B;  3LYI A;  3T9N A;  5FRN A;  3S3N A;  3CCR T;  5FU6 C;  2RJF A;  5LJ3 h;  2EJG A;  5CAI A;  4LDX A;  4M75 D;  1KQS A;  1G3W A;  3CCM A;  4J6Y A;  4QQD A;  4XTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...