3JB9H

Cryo-em structure of the yeast spliceosome at 3.6 angstrom resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
76
structure length
76
Chain Sequence
MIPPINFIFKLLQQHTPVSIWLFEQTDIRLQGQIRGFDEFMNIVLDDAVQVDAKNNKRELGRILLKGDNITLIQAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords Pre-mRNA-splicing factor spp42
publication title Structure of a yeast spliceosome at 3.6-angstrom resolution
pubmed doi rcsb
total genus 8
structure length 76
sequence length 76
chains with identical sequence m
ec nomenclature
pdb deposition date 2015-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3jb9H00
4HT8A 3RKXA 1JBMA 1I81A 2YHTA 4PJOG 5DY9A 5GANg 1I5LA 4PJOC 5LJ5j 4EMKB 4HT9A 4EMHA 5LJ5e 4C92E 4M75E 1LJOA 1MGQA 4M78E 3HSBA 1N9SA 4XU3A 4C8QD 5LJ3h 4M7DC 3JCMf 4M7AE 3BY7A 4Y91A 3RESA 3HFOA 4F7UA 2I2LA 2DXTA 3RIRA 4XU0A 4XTZA 3RUXA 4A53A 4XTYA 5GAMd 4N0AC 1WQWA 3INZA 2CGHA 4M77B 5GANh 1B34A 5GAOr 3JB9H 2FB7A 5GMKh 1WQ7A 5GAMf 4PJOE 4X9DA 4C8QF 4M75D 1LOJA 5GAOp 2VXFA 2DTHA 3RKYA 2DTOA 4M7AD 4QVDA 2RB6A 5LJ3g 2ZGWA 2DXUA 1M5Q1 3V8JA 4JRKA 1Y96B 5GAN3 4F7UG 2DKGA 3JCMd 2EJ9A 3VU3C 4C92F 3JB9J 4M78F 3QSUA 4PJOD 4X9CA 2E65A 4J6XA 3EFSA 4M77A 4M7AF 3JCMJ 5GAN2 2HNIA 4M7DD 4M7DG 2E64A 3SB2A 1D3BA 1HXDA 4C92B 2Y90A 2RA2A 3M4GA 4JUVA 3HFNA 5LJ3f 1U1SA 4F7UE 5GAN7 4EMKC 4PJOF 4C8QA 3JCMe 4XTUA 1YCYA 1Y96A 3V8LA 1D3BB 5GANf 4XU1A 4XTVA 2QTXA 4M7DE 5GAOq 4M77G 1JRIA 3L2ZA 1U1TA 4M77C 5I21A 3JCMQ 2E41A 4WF2A 4C8QB 3JB9I 5GANe 3QUIA 5GMKj 5GANj 4C92A 5GMKe 4M78A 3JCMP 4J6WA 5GAMg 4M7AA 3JB9D 4XU2A 4NL3A 3JB9G 2E10A 2VXEA 1KQ2A 3RERA 4M75F 5LJ3d 5GAN5 1KQ1A 3SWNA 4A54A 2YLBA 2YLCA 5LJ5g 4V2SA 4JRIA 1LNXA 3JCMb 4M77E 2DVEA 4M75B 4M78B 3V7CA 3BW1A 4XTWA 4MMKA 2RD1A 1I8FA 4NOYA 4M7AB 4F7UF 5GANd 1M8VA 5GAMh 3RKWA 1X01A 5GAN8 2DJZA 5GMKl 4C92D 4J6YA 3SWNB 4OP0A 5GMKm 3BDUA 4C92C 3JCMg 4M78C 2RM4A 4NL2A 4N0AA 5LJ3j 4M7DF 5GAOm 3PGGA 5LJ3e 5LJ5h 5CAIA 5GAN4 4PJOB 3JCMX 1WPYA 4JLIA 4M77D 5LJ5f 3EFRA 5GAN6 5GAOl 4DQ2A 3JCMW 4M7DB 1I4K1 3FB9A 3V8KA 4M75A 1H641 3L1AA 4J5YA 2DZCA 3JCMh 4RCBA 3JCMV 4QVCA 4C8QG 4M77F 3GIBA 4C8QC 4XTXA 2K57A 4MMLA 3FIFA 2E1HA 2DZ9A 2EJFA 2FYKA 4PNOA 4PJOA 2DTIA 2DEQA 3JB9F 4HA8A 3AHUA 4M7DA 5LJ5d 4EMGA 1TH7A 3BFMA 1WNLA 1HK9A 1BIAA 2JN0A 3FJPA 4M75G 4M78D 4M78G 4XQ3A 3V7SA 4C92G 4M75C 4F7UB 4RCCA 4M7AG 4C8QE 2EAYA 2EWNA 4EMKA 4M7AC 1N9RA 3QO3A 3V7RA 1B34B 1BIBA 2VC8A 3QHSA 3JCMc 5GAMj 5GMKi 5GAMe 5GAOn 3SWNC 2EJGA
chains in the Genus database with same CATH superfamily
1MHNA 2DBMA 3X20B 1I5LA 3OSSC 2KI7A 4EMHA 1YHQQ 2E4HA 2RNAA 3OYGA 3CCEA 4XTYA 4PFPA 4C0ZA 2RHUA 4DOVA 1WQ7A 4RMOA 4M75D 3PE0A 3RKYA 3EG9A 4A4KA 1VQPT 1AWXA 1RI9A 1QVFP 2J06A 3C94A 5IAYA 2KAFA 1LPLA 1M27C 4M78F 2R58A 3EG9B 1VOMA 2J6FA 3JCMJ 4M7DD 1QMCA 2KE9A 1TWBA 2LQKA 5CQXA 1BYMA 5KYXB 4PJOF 1WZOA 4PL6A 5A2QE 5GANf 2FPDA 5HK3A 2D0QB 1K9MU 1G3SA 2DL5A 3NTKA 1M30A 3LX7A 5CK9A 2ZPIB 1YBYA 2HAXA 2KR3A 2F69A 4M75B 5GANd 1WA7A 4JJDA 2YRCA 5D6YA 4F14A 5CIUA 2QEXA 3PVQA 5CKBA 2HL5C 5CR2A 5FU6C 2BE9B 4E7KA 4M7DB 1JXOA 2DL3A 3M53A 2O31A 4EDUA 2AHJB 3REBB 3I55T 4JRPA 1ZHIA 1TSFA 3ER0A 5DLQE 1YJ9A 1MNDA 3JB9F 3VJPA 1TH7A 2K2MA 2JN0A 4F7UB 4M75G 2J6KA 2L3SA 1SF9A 1RAAB 4BDYA 1W2BP 4JJNK 3OYEA 3TSWA 2XIDA 5GANg 4J9IA 1AD5A 4HT9A 4PJOC 1T0JA 2AT1B 5FROA 1GXIE 1QKXA 4A4HA 2I2LA 2E70A 4XTZA 3PIOA 4ZTFA 5IT9E 4F04B 4AT1B 3QG1A 2NWMA 2DXCA 2P0KA 2RB6A 2ZGWA 1K1ZA 4JRKA 4F7UG 3CC7T 2V8KA 1OPLA 5KE2A 4J9DA 2K2VA 4Q5WA 1M1KU 3OY9A 3EGDA 2GTJA 4YTLA 4EMKC 3M57A 3CCUQ 4A4EA 2CH4W 4J9BA 2AIRB 3C0CA 2X9HA 1RACB 2KRNA 4IUVA 1QVGP 2W10A 1UE9A 1VQ7T 1C6VX 1N6AA 4E47A 2FRWA 2F5TX 3UATA 5GAN5 2VKNA 4LUEA 4OF1A 1FYNA 2QA4T 2KBTA 3V7CA 4MMKA 2RD1A 1Q7YR 5DM7R 1NM7A 3OYNA 5CKFA 2FL7A 1VQNA 3CCJA 2GQIA 2DAQA 5EG2A 4BACA 2RPNA 2CZ1B 4OMNA 2KDSA 4QQGA 4KBMB 4XTXA 4HCCA 4FSXA 4HVWA 1BK2A 2MCNA 4MDXA 2J6OA 1G3YA 1VA7A 1IREB 2M02A 4NL3A 4M78D 4BI8B 2KGTA 4KH1B 2M0YA 1K8AU 1IB8A 1MNEA 2PVDB 1I81A 1M1FA 1EZZB 3CCRQ 3FDRA 2QYZA 4C92E 1LJOA 1VQNT 4KUIA 2YSQA 2DXTA 1PSFA 2RJFA 4JZ3A 5IN1A 4J8OA 5CKHA 1WJRA 2FB7A 2CZ0B 3EG1A 1NYGA 3CXCA 3G6EA 5KYNA 3CCST 1D1BA 3A8LB 4ANJA 1SHGA 1YJWT 2EJ9A 4E6RA 2RI5A 1AEYA 2PZ1A 2HSEB 2X4JA 4L6V5 3I56Q 2ZPGB 1VQOT 1T3SA 3CCQQ 3QXEB 2OTJT 1QP2A 2XDPA 2FHDA 1EX4A 2DD4A 1M3CA 4JDSA 5GANj 1KHCA 2FPFA 2DXBA 3LGLA 3H9NA 3JB9D 3CCLT 2LCLA 2RH2A 1BB9A 2LT4A 1M1KC 4V2SA 4CC3A 2P84A 1MMDA 4AFZC 2FZKB 1PC0A 3RKWA 4OP0A 2X4XA 2D9TA 2M51A 1W1FA 1Q82U 5LJ3e 4E7JA 1PCXA 1AOJA 3LH5A 3N5BB 1Y7XA 3SHWA 1BU1A 2EQIA 1WHHA 3PVLA 2JUFA 1OZ2A 2KYMA 4C5IA 2RN8A 1HJDA 1YHQT 4LDUA 3QYGB 2YT6A 4WCIA 3VS6A 2RQVA 4J7IA 3OYJA 1BCOA 5GAOn 2CP6A 1WHMA 1GCPA 1VQ6T 1RLPC 4DBRA 1HSQA 4N0AC 3GBQA 1ZUYA 2RK2A 2QQSA 5IHIA 1VQ5A 1AHJB 3NFCA 1YI2A 1EIFA 5A0DA 2LDMA 1I07A 4QQ6A 1K8AC 1Q95G 5KE3A 1YIJA 4XAXB 4FYVB 2DETA 2V8JA 4CC2A 3GPLA 3VU3C 4C92F 5FW9A 1LVKA 4X9CA 2KSSA 2K5IA 2BZYA 1AT1B 2X35A 3A1PA 2CDTA 3X26B 3H41A 1E6HA 4OB3B 1NYFA 5IHNA 1H8KA 1TOVA 1R77A 2FVUA 2GQVA 4KGVB 3X24B 3JCMQ 3JB9I 3CMEA 1SEMA 4BI3A 3CMAA 3LWIA 4J6WA 3E2UA 2DD5A 1IXDA 2XDBA 2HQEA 1TU0B 3FLGA 2CP5A 2F2XA 1M90U 4GY5A 4JJBA 1I1JA 2K9GA 2W0ZA 1BI0A 1I0CA 5KYWA 1M3AA 2KNBB 3G4SA 5GAN4 5CQYA 2LQNA 4B9WA 2QEXQ 1G2BA 5KYWB 2KQWA 4LN2A 4KGXB 4J5YA 1KHIA 4OMQA 3OBWA 1RABB 2A36A 4L5GA 2A3LA 1AWOA 2D1XA 1YJ9Q 2XHCA 4EMGA 2COZA 4FW2A 1BIAA 5GAMf 3CD6A 2WACA 1JJ2S 3DB3A 5J3BA 1VQKT 1QCFA 1WJSA 3A8HB 2PUKB 3OS2A 3UT1A 3U23A 1VQLT 2XMFA 3EHRA 1MGQA 3UA7A 1N9SA 2HMAA 3UWNA 1ZBXA 1K4US 4Z88A 1J3TA 5GAMd 3RUXA 1K9MR 2CREA 2NUPB 1B7TA 3EFOA 5GANh 1B34A 5GAOr 2M1HA 3OYLA 3Q1JA 1M8MA 3T9NA 3NPFA 1GFDA 2CUDA 2ABLA 1Q81U 3CC2Q 1B3QA 2JMCA 3S3NA 2GNCA 4IUPA 3CCMQ 1SG5A 2EYWA 2EGEA 1JRIA 1VQ9Q 4CC4B 2M9UA 5GAMg 2EGCA 2K7AA 3LGFA 3CXCP 2R57A 1KQSS 4A54A 1OOTA 2YLBA 1ZA2B 1LNXA 2QI2A 3JCMb 4J7FA 3BW1A 3QJYA 2DJZA 1SHFA 3GOXA 3EG2A 5KYUB 3URGA 4M77D 1R8OB 3MEUA 3G71Q 1M2OA 3EFRA 5FLXE 3M54A 4JZ4A 3CCJQ 1CKAA 1VQ4A 1ZUUA 4AG2C 5I11A 1OU9A 2MWPA 4RTXA 1M90C 3VS7A 2KXCA 1JO8A 2DL4A 5DLOA 4DEXA 2DERA 2DNUA 2EJFA 3EG0A 2K3YA 2RJDA 1W4SA 3FJPA 4C92D 1PM3A 2BUDA 1N9RA 2DVJA 1KC8C 1T3LA 3SWNC 1M1KR 5FU7B 5A0GA 3HKSA 3CCVT 4BE0A 3QZ5B 3RMSA 2JXBA 1VQPA 2KY9A 4FT4A 3RESA 5L23A 2DFUA 4HXJA 2LZ6B 1T0HA 4M77B 3QWXX 2RQWA 1VIFA 3JB9H 3UPUA 5D6WA 3PMIA 3FRNA 5HK0A 1WHGA 2LJ3A 2DYBA 4C5HA 3CCQT 3LLRA 4RTUA 5GAN3 4OGEA 2MPXC 2RMOA 3G6EQ 1YITA 1NEBA 3J81E 1VYVA 2JNGA 2QQRA 4GLKA 3OW2S 4RTYA 2CS7A 3SB2A 1D3BA 4C92B 1H3ZA 4E7SA 1OU8A 5FWBA 2RJCA 5IXFA 1KJWA 4F17A 2RHZA 1OYXA 3CC4Q 1D3BB 3I35A 1PD1A 2ZCFB 4M77G 1D09B 3KUFA 5GMKj 1PWTA 4HCBA 5HY6A 1Q81C 3CPWA 3HHTB 1KQ2A 2KRMA 5KYXA 1KQ1A 1VYTA 3QPHA 3HP9A 2KRSA 2VASA 5C6SA 5LJ5g 1WGSA 1QP3A 1UGVA 2OI3A 3CBOA 1K8AR 1UJ0A 1M8VA 1K0XA 3L2UA 3I55A 2BZXA 4JS4A 3A5ZB 2NLUA 1YITT 5IH2A 1SRLA 2FPEA 5CVIA 1M9SA 4LNPA 4M75A 2HSPA 3L1AA 2DK3A 2F1LA 3NTHA 3O5ZA 1D0XA 3MJXA 4A63B 2B86A 2K57A 1TUDA 4FL6A 1ACMB 1HYOA 4M7DA 3HRUA 3KXTA 4DOWA 2D0NA 1AZGB 2GGRA 3CQTA 3JCMc 5GAMj 1GCQA 2MYSA 1Y71A 3RBBB 4C8QD 1QVFS 2E3HA 2GBQA 4F7UA 3CC7A 1RAIB 2MWOA 2LTOA 4J9FA 4QVZA 1BCMA 2C06A 4M7AD 1Q86C 1VQ5Q 2DXUA 1M5Q1 1X69A 3ZEHA 3PIPA 4PFOA 2RO0A 3QZ9B 1MMAA 1BI2A 1YIJQ 3P8DA 2X4YA 2O01E 4M7DG 2COWA 1Q82R 1MUZA 4OB0B 1VQ7A 2RA2A 2QTVA 1H92A 3E19A 3MHXA 2CP3A 2L2PA 4PFZA 3E9GA 3R6OA 4C8QA 2QDLA 1KD1U 2QA4A 2AZVA 2QTXA 4DBHA 2SRCA 5GAOq 1JJ2A 1UDLA 4KULA 1VUBA 4C8QB 2IPOB 1UG1A 1UJYA 3TREA 5GANe 2RQRA 2RHXA 4M7AA 3FC3A 4ELZC 4BY6B 4OMOA 3WXMB 3CMEQ 1FXXA 1VIEA 4A4GA 2O4XA 1M4ZA 3CMAQ 2DVEA 4XTWA 8ATCB 2COYA 4DA4A 4M7AB 2JS0A 5GMKl 4KRTA 2O4XB 1A0NB 1SPKA 2CYZB 3A8GB 3QWYA 3VUZA 5GAN6 2DF6A 3CBMA 3MEAA 4IUTA 1ZSGA 3G4SQ 1YWOA 3BDLA 4C8QG 1W2BS 4C0FA 3GNFB 1W70A 4AFUC 2CZ6B 3BFMA 1WNLA 4J83A 4J9HA 4M7AG 4TVRA 1XTDA 2EPDA 1YFNA 2ZPBB 3M4YA 4JJCA 3MPUB 3CD6Q 5GAOm 3RKXA 2EYXA 2YHTA 6AT1B 3L2RA 2QK0A 1GRIA 5LJ5j 2M16A 4LDYA 4A4FA 3CCSA 3I5RA 4Z89A 3OYFA 1S72A 4RTZA 3MP1A 2P0QA 3CC2T 1YJWA 1MMGA 2A08A 2J7IA 1RI0A 5GMKh 4X9DA 2Y4YA 5AT1B 4AFQC 1WJQA 3L2VA 4QVDA 3CCMT 1M90R 3M56A 1VQOA 4JS5A 2X3XD 2OJ2A 2OAUA 1PNJA 2OTJA 3OYIA 4PJOD 1VQ9T 1KSWA 2ED1A 1VQMT 4B9XA 4E7IA 1QVGS 5FU6B 1TTHB 2JM8A 5LJ3f 1U1SA 3CCLA 1F1BB 3JCMe 2ROLA 2Z0WA 1C1AA 3OYDA 1K9AA 4M4ZA 1S72T 2B8AA 2C0OA 4M78A 4WTOB 1WFWA 2JW4A 1SKUB 3G71T 1EFNA 2PVGB 5LJ3d 4X1VA 2LP5A 4RG2A 2JS2A 2XK0A 2EYQA 2YLCA 2KMTA 5ECAA 2FZGB 4M78B 4PJMA 2XICA 5GAMh 1KD1C 1GBQA 4UC4A 4J6YA 2X4WA 2YWWA 1YJNQ 3BDUA 2OAWA 2RM4A 4PJOB 3VV0A 2HL3A 1YHQA 1K0SA 3QDRB 4LDVA 3OYCA 1I4K1 1VQ8T 1QKWA 1X6GA 3VYGA 2L5QA 4ZGEB 2ZPHB 1TS9A 1VQ6A 3LH0A 3CPWP 4OB1B 5I22A 3V7SA 1X2KA 1Q81R 4M78G 3VS0A 4EMKA 3QO3A 5GMKi 1IGUA 2OTLQ 2EW3A 2L89A 4HT8A 4PJOG 4EMKB 4M75E 4J9EA 4OMLA 4BD3A 1WX6A 1UGRB 4AMCA 2YUOA 3TCJA 2MOXA 2YRDA 4FCYA 1V76A 2RQUA 2IVWA 2M0OA 2QG9B 4II1A 1FWZA 3OB9A 4C0DC 3QSUA 2VUBA 3OYYA 2BZ8A 2DM1A 1D1CA 1RUWA 1NZ9A 2LQ8A 1CSKA 2BKDN 1HXDA 2X51A 3PNWC 3PFSA 2ZPFB 4AFSC 1BI1A 4F7UE 2BTTA 4MDWA 3PTAA 2RK1A 2E5KA 4XU1A 3CCEQ 2CZ7B 3F70A 1RAHB 2D8HA 9ATCB 1YP5A 3JB9G 3VUBA 3IQLA 3RNJA 5GAN8 4OMPA 3NHNA 3G7ZA 5IXBA 2E12A 1UHCA 4C5EA 5LJ5h 2ZAEA 1QCOA 2DL8A 1IRXA 2CSQA 3HPWA 3JCMX 1WYXA 3I55Q 2E5QA 1K73U 2HKQB 1RAEB 1P92A 1PSEA 3C12A 4HVUA 2EYZA 3M59A 4RCBA 2CUBA 2EQUA 1YNZA 1VQKA 4E7ZA 2FYKA 2KT1A 3OYHA 2L3RA 3VKIA 1VQLA 4ZN3A 3MP6A 1O9SA 1NJIU 3ZFJA 3EAEA 1WXBA 2VVKA 8AT1B 3P8BB 3DB4A 3SD4A 2EAYA 3M55A 2VC8A 1RADB 3VYHB 2HQXA 1KC8U 2CSIA 2DRKA 5CKDA 1MV0B 2KXDA 4FW1A 4PJNA 3QBYA 1IHWA 4XU3A 4Y91A 3HFOA 3WVDB 2DPPB 3J7AF 1Y0MA 2VV5A 3CEYA 4HCKA 3CC7Q 5I2SA 4BDZA 4E7LA 2O9SA 1Y96B 2NUPA 1QW1A 2EBPA 3THKA 2JT4A 5CCAA 3VRYA 1XQHA 5KYYA 2FRYA 2LQWA 1VQ7Q 4Z8AA 3CPFA 5GJWB 1G3TA 4DEYA 3TVTA 5KYYB 3UA6A 3CCUT 2P0PA 5J39A 5GMKe 1WIEA 1YN8A 2YRVA 4FIBA 2HZYA 3C4SA 2X3WD 4F7UF 4L59A 1FMKA 2K3BA 4HCZA 3ME9A 3JSCA 2C0IA 2L0AA 4N0AA 2DRMA 3QJ6A 3CCRA 5KCHA 2PNIA 4ZTJA 3GNGA 2BIVA 1PD0A 3OS5A 2CP0A 2HKNA 2V1RA 2L8DA 2E1HA 2WSEE 5KYUA 3M0UA 3CCVA 4FYWB 2RQTA 1FMWA 1HK9A 1JXMA 4ESRA 1NPRA 4M75C 4OMFB 2A37A 2GCXA 1ABQA 3V7RA 2QQAA 1ZA1B 1K73C 4Y92A 2QQBA 7AT1B 5GAMe 2D8JA 1VQNQ 2EJGA 3TEEA 2F2WA 1KD1R 4PJJA 3H6ZA 3G1JA 4M7DC 3CCQA 1Y57A 2DIQA 2LJ1A 2EQKA 2DE0X 2GTOA 3CCRT 4JPBW 3VRZA 3CCSQ 1JB0E 1NJIC 1QWEA 4IUUA 2V26A 1GCQC 1U5SA 1YJWQ 4O5VA 2DTOA 2L3QA 1Q86U 5IHKA 4O6JA 3AT1B 2E65A 2R5MA 4M77A 2LC4A 1VQOQ 4KUDK 2A7YA 2Y90A 2QGFB 2OTJQ 2BE7D 3A8MB 2RHIA 3GF5A 5GAN7 2V8IA 4QT7A 2LRQA 1ZBJA 3CXCS 4XTUA 3I56T 1N8RU 2E3IA 1ZX6A 3CCLQ 1YJNT 5I21A 2CT3A 2WSCE 4C92A 3MEWA 2H8HA 2MK5A 1BBZA 2QASA 1PRLC 1RAFB 3UDCA 2KROA 3L2WA 2F2VA 1IO6A 4XK8E 4NOYA 2EQJA 1AWWA 4KH0B 2QGGA 5GMKm 5CO7A 4DBFA 1NBEB 2XDDA 3PGGA 1JU5C 4JLIA 4J9GA 1QLYA 1ZLMA 5J26A 2OTLT 3VS2A 1GBRA 2CT4A 3VS5A 2FZCB 2DTIA 4HA8A 5GAN2 2VGNA 4C92G 3LWHA 1VQ6Q 1OX8A 4PK4A 3QHSA 1ABOA 1NPPA 5LL6S 4BI4A 3OYKA 1SSFA 1UGPB 2SEMA 2DEUA 4ATOA 1SRMA 2YUNA 5LJ5e 2QQ9A 2HD0A 1OZ3A 3KBGA 4ZNXA 5LJ3h 1WDXA 1KK7A 1X27A 3ASKA 3TQ7P 3LW5E 2NUTA 1OX9A 1PKSA 4D8DA 2JTEA 2NUTB 1OULA 3MEVA 3CCET 2HBPA 2FO0A 4RTWA 2JVVA 2MAMA 2DIGA 3M0TA 5AYFA 5CKEA 4BB7A 3L2QA 3JAME 3P8HA 3V8LA 1TG0A 2H3JA 3UF4A 3META 4NS5A 2A28A 5D6XA 3M0PA 2E41A 4X34A 2EVRA 3EHQA 1YI2Q 2LCSA 3OMGA 4N4HA 4XU2A 4FYYB 1RL2A 3SWNA 1XJWB 4DBQA 4N4IA 1UGQB 4JRIA 1ZSZA 2K5FA 4BE1A 2NYSA 1X01A 1G5VA 1N8RC 3SWNB 2VWFA 4M78C 2LJ0A 1ZSZB 2KK4A 1IHVA 2ROTA 1O75A 3FEOA 2EKHA 2EKOA 4LDWA 1XOVA 1YWPA 1H641 3NTIA 3E1SA 3EH1A 2QEXT 4BE2A 3QYHB 5EC7A 4PKCC 2PU9B 2DO3A 4IURA 4PLIA 1VQKQ 1QQJA 2ECZA 1SSHA 3HL8A 2G6FX 2EWNA 3CC2A 2H3EB 1VQLQ 5FRMA 1YJ9T 2DJQA 2E6NA 3TSZA 1G83A 2VB6A 2WSFE 2RI3A 5DY9A 2ED0A 4OMMA 1FMVA 1UB4A 4LXCA 3JCMf 3CCMA 4PLLA 4XU0A 4B6MA 1PHTA 1WQWA 2CGHA 5HCKA 3A98A 1VQ9A 2D6FA 2FEIA 1VQMA 5GAOp 3HRSA 3EGDB 3JCMd 4RUGA 3X28B 3OYAA 4ZGJB 2VGMA 1NLPC 3S6WA 3EFSA 2AK5A 3FJ5A 1KQSA 2AZSA 2LX9A 4K11A 1QVPA 3M4GA 5FWCA 3JV3A 1K73R 1AZEA 3G71A 2CKKA 2LCCA 4LE9A 2C0TA 1K9MC 1UUEA 3QIIA 4XTVA 4RTTA 1DJ7B 2L3PA 2AKLA 3L2ZA 2MI6A 1UTIA 1ZQ1A 2GFAA 2YDLA 1V1CA 4WF2A 2I0NA 3VS4A 3QUIA 2P4TA 4GBQA 1PG5B 1V29B 1MV3A 1OEBA 2V1QA 2YXYA 1NJIR 1Z9QA 4M77E 3J80E 1VQ8A 2KT8A 1I8FA 3R6NA 2ENMA 1KC8R 1AWJA 2DL7A 4RTVA 1OQKA 3MP8A 3JCMg 2LX7A 4IUQA 3L42A 2PVOB 3VS1A 2QAZA 3RDVA 1WLPB 3SEMA 2ZPEB 4DQ2A 1I5OB 1Y07A 3M5AA 3WVEB 4EPCA 1OPKA 3DKMA 3S3OA 3JCMV 2O9VA 2G3RA 1ZUKA 3DLLA 2K4YA 3CCJT 1RLQC 3FIFA 1KFZA 2DZ9A 2XD0A 5I2MA 4PJOA 1UFFA 2DEQA 3ZL7C 4KGZB 2EIFA 4HKEA 1UGSB 2O88A 2PQWA 3NGPA 3LYIA 3CCVQ 3OSVA 4VUBA 1TXQA 1WHKA 2DA9A 2RF0A 3ULRB 1JBMA 1E7OA 3MO8A 1PRMC 5FRNA 3S3MA 2IIMA 2OX7A 5KH6A 3KFVA 3OW2A 5A0LA 3CC4A 4E2FB 2DLPA 3RIRA 2YUPA 1VQ4Q 3EH2A 3INZA 4ZN1A 2XU8A 2ESWA 2IG0A 4HVVA 1LOJA 2VXFA 3DLMA 4R55A 1X43A 2JJ9A 5LJ3g 1WXTA 2J05A 2DBKA 2DKGA 2K5LA 2HDAA 3JB9J 1G8XA 2E64A 3G6ET 3GLXA 1WHJA 4IIMA 4JUVA 3OBYA 2DILA 3HFNA 4KT0E 2R5AA 4MZMA 1VQPQ 1K76A 1N27A 4PJLA 1B07A 3OYMA 1JQQA 3PMTA 2LMJA 4M7DE 2E6ZA 3CC4T 4P5NA 2LT1A 3JCMP 1AVZC 1D1AA 3X25B 4MZPA 2VXEA 1PKTA 3ZBDA 2Y4XA 1YITQ 2KEAA 4Y28E 2FG0A 5L8RE 5GAOl 3EGUA 3JCMW 4C5GA 4QQDA 4MZTA 3CPWS 4M77F 2VYTA 3RMQA 5KCOA 4CRIA 1U8RA 1QVFA 2EGAA 2GF7A 4JLGA 1Q86R 1S1NA 1QWFA 3H0HA 1BI3A 3OS0A 4XQ3A 1D0YA 1E6GA 1G3WA 1YCSB 3REAB 1MMNA 4C8QE 5M9OA 2LNVA 1Q7YU 1UEBA 4LD6A 4R0KA 3O8VA 1X75C 2KYBA 3A8OB 3HSBA 3RR6A 1N8RR 1NEGA 1D0ZA 2RI2A 4M7AE 1KG1A 1JJ2P 3C95A 4CC7A 2XI9A 3M0SA 1LCKA 3M0RA 2CP7A 2EFIA 2DTHA 3OYBA 1ARKA 1UHFA 4FYXB 3M58A 1X2QA 1IGQA 4N4GA 4IIOA 4J6XA 4ZGDB 1VQ5T 1N5ZA 4D8KA 2EYYA 3CCUA 1YI2T 2XG8D 5FU7C 2CP2A 1YIJT 1HD3A 4LUDA 2KVQG 4EIKA 1Y96A 2NUZA 2RHYA 2JMAA 3VS3A 1X6BA 1JEGA 4M77C 3HTRA 2HEQA 4RKUE 4QW2A 3RERA 4M75F 1NLOC 2HQHA 4R56A 4D6WA 1NG2A 1W2BA 5HKCA 2XKOC 3CMET 1Q82C 2AKKA 3CMAT 1OI1A 1R0CB 3GP8A 4C92C 4M7DF 3I5SA 4NL2A 5LJ3j 2GFUA 1KQSP 5CAIA 2ZZDA 1GL5A 1TUCA 2EQMA 1M1GA 3FB9A 2QA4Q 3V8KA 3PT9A 4FSSA 4QVCA 2CH4A 4LDXA 2O2OA 1VYUA 4MMLA 2JM9A 3G4ST 2HCKA 4FT2A 2HBWA 1WHLA 3AHUA 2QDYB 3I9QA 2LNHB 4FU6A 4C0DB 4RCCA 3EFOB 3MCAB 1B34B 1BIBA 4QKUA 1KIKA 2PTKA 4ELYC 4E7HA 1IZ6A 2JZ2A 1WXUA 2K79A 4Z02A 4M78E 2K3XA 3TU4K 2A0FB 3CD6T 1C0MA 3BY7A 1QVGA 4A53A 3EG3A 5D7UA 3H0FA 1U3OA 4ME7A 4C0GA 1U06A 4PJOE 4OVAA 4C8QF 2JTMA 1Q7YC 1NE8A 2QXFA 1CKBA 3V8JA 1VQMQ 1OV3A 3OS1A 4IKFA 3I56A 1QCNA 4M7AF 3NMZC 4J9CA 2HNIA 1YJNA 1H3HA 2F5KA 3HRTA 2K6DA 4ORZA 1M3BA 1YCYA 2DYIA 4AG1C 4JRQA 1S72Q 3OW2P 2JOYA 2ATCB 1UECA 1Z9ZA 1U1TA 4CI0C 2JTFA 2MF2A 2RJEA 2YUQA 2E10A 1GFCA 3QDFA 4FM4B 4OB2B 1W6XA 1X6OA 5C0MA 3M9QA 3OMCA 3OA6A 3QKJA 2OTLA 3EGXA 1VQ8Q 3H0IA 3M0QA 1RAGB 4RG8A 3CBPA 2P4RA 3MKDA 1WPYA 4OGCA 5LJ5f 4BUGA 4LD9K 3EGXB 1ZSZC 3H8ZA 3SDZA 2DZCA 2MMPA 3JCMh 4F16A 1M2VA 3JRZA 1BKBA 1R0BG 3GIBA 4C8QC 1WI7A 2LVMA 3SFMA 4PNOA 3E9FA 4BY6C 1M2VB 4GLMA 2DX1A 5LJ5d 1VQ4T 1TUGB 3OQ5A 1XNIA 2DMOA 4M7AC 2PUOB 1FX7A 3D7SB 2MIOA 5GJVB 3BE3A
chains in the Genus database with same CATH topology
2L89A 1MHNA 2RI3A 4HT8A 4PJOG 3X20B 5DY9A 1I5LA 1VQLT 3OSSC 4EMKB 4EMHA 4M75E 1MGQA 1UB4A 1N9SA 3UWNA 1ZBXA 3CCMA 3JCMf 4BD3A 3OYGA 4PLLA 3CCEA 1UGRB 4XU0A 5GAMd 3RUXA 4XTYA 1WQWA 2CGHA 4C0ZA 5GANh 1B34A 2RHUA 5GAOr 1VQ9A 4DOVA 2M1HA 3TCJA 1WQ7A 2D6FA 3OYLA 3Q1JA 1VQMA 4RMOA 4M75D 5GAOp 3RKYA 3T9NA 3HRSA 4A4KA 1VQPT 3C94A 5IAYA 2IVWA 2M0OA 2KAFA 4II1A 3JCMd 1FWZA 3OB9A 4C0DC 3X28B 4M78F 3OYAA 2R58A 1Q81U 2VUBA 2VGMA 3OYYA 3S6WA 4ZGJB 2LQ8A 3EFSA 1NZ9A 3JCMJ 4M7DD 2BKDN 1KQSA 1HXDA 3PNWC 2LX9A 1QVPA 3M4GA 2LQKA 3PFSA 5CQXA 1BYMA 2ZPFB 3S3NA 1BI1A 4F7UE 3G71A 2CKKA 4PJOF 4PL6A 4MDWA 2LCCA 5A2QE 4IUPA 3PTAA 2RK1A 5GANf 1K9MC 4XU1A 2CZ7B 3QIIA 4XTVA 5HK3A 2D0QB 3F70A 1DJ7B 1K9MU 1G3SA 1JRIA 3L2ZA 2MI6A 1ZQ1A 2GFAA 4WF2A 3NTKA 3QUIA 2P4TA 3LX7A 2M9UA 5GAMg 3LGFA 5CK9A 2ZPIB 3VUBA 3JB9G 1YBYA 2R57A 1V29B 1KQSS 3OS2A 4A54A 2HAXA 2YLBA 1LNXA 2QI2A 2F69A 4M75B 4M77E 3JCMb 3J80E 4J7FA 3BW1A 1VQ8A 1I8FA 5GANd 3QSUA 3QJYA 5D6YA 5GAN8 2DJZA 5CIUA 3GOXA 2QEXA 5CKBA 3G7ZA 3MP8A 5CR2A 3JCMg 5FU6C 4IUQA 2E12A 3L42A 4C5EA 2PVOB 4E7KA 5LJ5h 3URGA 3JCMX 2ZPEB 1R8OB 3HPWA 3MEUA 4M77D 2E5QA 3EFRA 5FLXE 4DQ2A 3M54A 3M53A 1K73U 1Y07A 3M5AA 3C12A 1P92A 1PSEA 3WVEB 4EPCA 3DKMA 4EDUA 2AHJB 1VQ4A 3M59A 3S3OA 4RCBA 3I55T 3JCMV 4JRPA 2G3RA 1ZHIA 2MWPA 1M90C 2EQUA 2K4YA 3ER0A 5DLQE 3DLLA 3CCJT 1YJ9A 1VQKA 5DLOA 3FIFA 2DZ9A 2XD0A 2EJFA 2FYKA 5I2MA 3OYHA 2L3RA 3VKIA 4PJOA 1VQLA 2DEQA 4ZN3A 2K3YA 2RJDA 3JB9F 1W4SA 2EIFA 3MP6A 1TH7A 4HKEA 3FJPA 1O9SA 3VJPA 2JN0A 4C92D 4M75G 2BUDA 1UGSB 3EAEA 3ZFJA 4F7UB 1NJIU 3P8BB 2PQWA 3DB4A 3SD4A 2EAYA 3LYIA 4BDYA 1N9RA 3M55A 1KC8C 2VC8A 3OSVA 4VUBA 4JJNK 3VYHB 3SWNC 2HQXA 3OYEA 1KC8U 5FU7B 5A0GA 2XIDA 3HKSA 1JBMA 5GANg 5CKDA 3MO8A 3CCVT 4BE0A 5FRNA 3QZ5B 4HT9A 3RMSA 3S3MA 4PJOC 3QBYA 5KH6A 1VQPA 3OW2A 2KY9A 4XU3A 5A0LA 3CC4A 5FROA 1GXIE 4FT4A 4Y91A 3RESA 4A4HA 3HFOA 2I2LA 3WVDB 3RIRA 2E70A 4XTZA 3PIOA 4ZTFA 5IT9E 2DPPB 3INZA 4ZN1A 3J7AF 4M77B 2XU8A 1VIFA 3JB9H 3QG1A 2VV5A 3UPUA 3CEYA 2IG0A 5D6WA 3PMIA 3FRNA 1LOJA 5HK0A 2VXFA 5I2SA 4BDZA 2DXCA 4E7LA 3DLMA 4R55A 2P0KA 4C5HA 2RB6A 5LJ3g 3CCQT 3LLRA 2ZGWA 4JRKA 1Y96B 5GAN3 4F7UG 4OGEA 2DKGA 3CC7T 1YITA 2K5LA 3J81E 3JB9J 2JNGA 2QQRA 1QW1A 2V8KA 4GLKA 3OW2S 2CS7A 5KE2A 2E64A 3SB2A 1D3BA 4C92B 3G6ET 2K2VA 4Q5WA 3GLXA 1H3ZA 4JUVA 3OBYA 5CCAA 1XQHA 1M1KU 3HFNA 4KT0E 3OY9A 2RJCA 4YTLA 4EMKC 2R5AA 3M57A 4MZMA 4A4EA 1N27A 1OYXA 2RHZA 3CPFA 1D3BB 3OYMA 1G3TA 3PMTA 4IUVA 4M7DE 2ZCFB 4M77G 2E6ZA 3CCUT 2P0PA 5J39A 3CC4T 1VQ7T 3KUFA 4P5NA 5GMKj 2LT1A 4HCBA 5GMKe 1N6AA 3JCMP 5HY6A 1Q81C 3X25B 4E47A 2YRVA 4MZPA 3CPWA 2F5TX 2VXEA 3HHTB 1KQ2A 4FIBA 5GAN5 1KQ1A 3QPHA 3C4SA 3HP9A 4OF1A 2QA4T 5LJ5g 5C6SA 3ZBDA 2Y4XA 1WGSA 1QP3A 3V7CA 4F7UF 4MMKA 2RD1A 3CBOA 4L59A 5DM7R 1M8VA 3L2UA 3OYNA 3I55A 4HCZA 4Y28E 4JS4A 5CKFA 2FL7A 3A5ZB 1VQNA 3ME9A 3CCJA 2NLUA 3JSCA 4N0AA 1YITT 5L8RE 3QJ6A 2DAQA 3CCRA 5EG2A 5KCHA 4BACA 5GAOl 3JCMW 4C5GA 5CVIA 4QQDA 4ZTJA 3GNGA 1M9SA 2CZ1B 4M75A 4MZTA 3L1AA 3CPWS 2BIVA 2DK3A 3OS5A 3NTHA 2L8DA 2KDSA 4QQGA 4M77F 2VYTA 3RMQA 5KCOA 4KBMB 4XTXA 2K57A 4CRIA 4HCCA 4FL6A 1U8RA 1QVFA 2E1HA 2WSEE 2GF7A 4JLGA 4FSXA 3CCVA 4MDXA 1G3YA 1IREB 4M7DA 1BI3A 3HRUA 4NL3A 3OS0A 3KXTA 1HK9A 4M78D 4BI8B 1NPRA 4XQ3A 4DOWA 4M75C 1G3WA 4OMFB 2GCXA 4C8QE 5M9OA 1K73C 3V7RA 2QQAA 2LNVA 3JCMc 1Q7YU 1K8AU 5GAMj 1UEBA 2QQBA 5GAMe 4LD6A 2PVDB 2EJGA 3O8VA 1I81A 3TEEA 1M1FA 1X75C 1Y71A 3A8OB 3FDRA 4C92E 3HSBA 1LJOA 3H6ZA 4C8QD 4M7DC 3CCQA 2RI2A 1VQNT 2DIQA 4KUIA 1QVFS 4M7AE 2EQKA 4F7UA 1KG1A 2DXTA 1PSFA 2RJFA 5IN1A 4J8OA 3CC7A 5CKHA 3CCRT 2MWOA 1WJRA 1JB0E 3C95A 2XI9A 2FB7A 4IUUA 2CZ0B 2LTOA 1NJIC 4QVZA 3CXCA 2EFIA 3G6EA 4O5VA 2DTHA 2C06A 2DTOA 4M7AD 3OYBA 3CCST 1Q86C 2DXUA 1M5Q1 3A8LB 3M58A 1Q86U 1YJWT 3ZEHA 2EJ9A 3PIPA 4O6JA 2RO0A 3QZ9B 4N4GA 2RI5A 1BI2A 2E65A 2R5MA 4J6XA 3P8DA 4M77A 4ZGDB 1VQ5T 2LC4A 2X4YA 2O01E 3CCUA 1YI2T 4KUDK 4M7DG 2XG8D 4OB0B 1VQ7A 2A7YA 2RA2A 2Y90A 2X4JA 4L6V5 5FU7C 3E19A 3A8MB 3MHXA 2RHIA 1YIJT 2ZPGB 3E9GA 3GF5A 5GAN7 2V8IA 1VQOT 2LRQA 3R6OA 4C8QA 3CXCS 2KVQG 4XTUA 1KD1U 1Y96A 3I56T 2QA4A 1N8RU 3QXEB 2OTJT 1QP2A 2XDPA 2RHYA 2FHDA 2QTXA 5GAOq 1JJ2A 2DD4A 1YJNT 4JDSA 4M77C 4KULA 1VUBA 5I21A 4C8QB 5GANj 1KHCA 5GANe 2WSCE 3TREA 4C92A 3MEWA 3LGLA 2DXBA 2RHXA 4RKUE 4M7AA 4QW2A 3FC3A 4ELZC 3JB9D 3CCLT 3RERA 4BY6B 4M75F 2LCLA 3WXMB 2RH2A 4R56A 1FXXA 4D6WA 1VIEA 3UDCA 2LT4A 4A4GA 2O4XA 1M4ZA 1M1KC 3L2WA 4V2SA 1W2BA 2DVEA 5HKCA 4XTWA 4DA4A 4XK8E 4NOYA 4M7AB 2EQJA 2XKOC 3RKWA 3CMET 5GMKl 1Q82C 5GMKm 4OP0A 5CO7A 1OI1A 2X4XA 3GP8A 3CMAT 2O4XB 2D9TA 4C92C 4M7DF 4NL2A 5LJ3j 2GFUA 2XDDA 3PGGA 5LJ3e 4E7JA 5CAIA 1Q82U 2CYZB 3A8GB 4JLIA 2ZZDA 3VUZA 3N5BB 5GAN6 3CBMA 2EQMA 1Y7XA 1M1GA 3FB9A 3MEAA 4IUTA 5J26A 3V8KA 3PT9A 4QVCA 2JUFA 2OTLT 1OZ2A 3BDLA 4C8QG 4C5IA 4LDXA 1W2BS 4C0FA 4MMLA 3GNFB 3G4ST 1YHQT 4FT2A 4LDUA 2DTIA 4HA8A 3AHUA 2QDYB 2CZ6B 3BFMA 1WNLA 2VGNA 5GAN2 4C92G 4FU6A 3QYGB 4C0DB 4J83A 4RCCA 3LWHA 4M7AG 4J7IA 4TVRA 1XTDA 1B34B 1BIBA 3MCAB 3QHSA 3OYJA 2ZPBB 3M4YA 1NPPA 5GAOn 5LL6S 4BI4A 4ELYC 3OYKA 4E7HA 1IZ6A 2JZ2A 5GAOm 1VQ6T 1SSFA 1UGPB 3RKXA 2YHTA 4ATOA 3L2RA 5LJ5j 2M16A 4Z02A 4LDYA 5LJ5e 2QQ9A 4A4FA 2HD0A 4M78E 3CCSA 1OZ3A 2K3XA 3KBGA 5LJ3h 3OYFA 3TU4K 1S72A 3CD6T 3BY7A 3MP1A 2P0QA 1QVGA 3CC2T 4A53A 1YJWA 4N0AC 3ASKA 4ME7A 2RK2A 2QQSA 3LW5E 1RI0A 4C0GA 5GMKh 1VQ5A 1AHJB 4PJOE 3NFCA 1YI2A 4X9DA 1EIFA 4OVAA 4C8QF 5A0DA 2Y4YA 2LDMA 2JTMA 4QQ6A 1Q7YC 1NE8A 2QXFA 1K8AC 5KE3A 1WJQA 3L2VA 4QVDA 1YIJA 3CCMT 4XAXB 3M56A 3V8JA 1VQOA 4JS5A 3CCET 3MEVA 2HBPA 3OS1A 4IKFA 2OAUA 2V8JA 3I56A 3GPLA 3VU3C 4C92F 2OTJA 3OYIA 4PJOD 2JVVA 2MAMA 1VQ9T 4X9CA 2KSSA 4M7AF 2K5IA 2HNIA 1YJNA 1VQMT 4B9XA 4E7IA 1QVGS 2X35A 5FU6B 2F5KA 3HRTA 3X26B 5LJ3f 2DIGA 1U1SA 5AYFA 5CKEA 4BB7A 4OB3B 3L2QA 3JAME 3CCLA 3JCMe 1YCYA 3P8HA 4JRQA 3V8LA 2H3JA 2JOYA 3META 4NS5A 3OYDA 5D6XA 1U1TA 2FVUA 2GQVA 3X24B 4CI0C 2E41A 4X34A 3JCMQ 3JB9I 2B8AA 3CMEA 1S72T 2JTFA 2MF2A 4M78A 4BI3A 3CMAA 2RJEA 4J6WA 3LWIA 3OMGA 4N4HA 2DD5A 4XU2A 3G71T 2E10A 2PVGB 2XDBA 5LJ3d 2HQEA 1RL2A 3SWNA 4RG2A 2XK0A 4N4IA 3FLGA 2EYQA 2YLCA 1UGQB 2KMTA 4FM4B 4JRIA 4GY5A 1M90U 4M7DB 4M78B 4OB2B 1X6OA 2K5FA 5C0MA 3M9QA 4BE1A 2XICA 5GAMh 3OMCA 1X01A 3OA6A 1KD1C 3QKJA 4UC4A 4J6YA 2X4WA 1N8RC 2OTLA 3SWNB 1G5VA 1BI0A 3BDUA 4M78C 2RM4A 4RG8A 3G4SA 3CBPA 5GAN4 3VV0A 2KK4A 5CQYA 4B9WA 1YHQA 4PJOB 1WPYA 4OGCA 3QDRB 5LJ5f 4BUGA 1O75A 4LDVA 3OYCA 3FEOA 1I4K1 2EKOA 4LDWA 1XOVA 1VQ8T 2KQWA 4LD9K 1H641 3H8ZA 1KHIA 4J5YA 2DZCA 2MMPA 3SDZA 3JCMh 3NTIA 3VYGA 3E1SA 3JRZA 2QEXT 2L5QA 4ZGEB 1BKBA 3OBWA 4BE2A 3GIBA 4C8QC 2ZPHB 2LVMA 4L5GA 3QYHB 4PKCC 2A3LA 1VQ6A 2PU9B 3LH0A 2DO3A 4PNOA 3SFMA 3E9FA 4IURA 4BY6C 4PLIA 2XHCA 5LJ5d 4EMGA 4OB1B 1BIAA 3V7SA 5GAMf 1VQ4T 4M78G 3CD6A 3HL8A 3OQ5A 2EWNA 1XNIA 4EMKA 2WACA 3CC2A 3QO3A 1JJ2S 5FRMA 3DB3A 1YJ9T 2PUOB 4M7AC 2E6NA 5J3BA 1FX7A 5GMKi 1VQKT 1WJSA 3A8HB 2PUKB 3UT1A 2WSFE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HT8 A;  3RKX A;  1JBM A;  1I81 A;  2YHT A;  4PJO G;  5DY9 A;  5GAN g;  1I5L A;  4PJO C;  5LJ5 j;  4EMK B;  4HT9 A;  4EMH A;  5LJ5 e;  4C92 E;  4M75 E;  1LJO A;  1MGQ A;  4M78 E;  3HSB A;  1N9S A;  4XU3 A;  4C8Q D;  5LJ3 h;  4M7D C;  3JCM f;  4M7A E;  3BY7 A;  4Y91 A;  3RES A;  3HFO A;  4F7U A;  2I2L A;  2DXT A;  3RIR A;  4XU0 A;  4XTZ A;  3RUX A;  4A53 A;  4XTY A;  5GAM d;  4N0A C;  1WQW A;  3INZ A;  2CGH A;  4M77 B;  5GAN h;  1B34 A;  5GAO r;  3JB9 H;  2FB7 A;  5GMK h;  1WQ7 A;  5GAM f;  4PJO E;  4X9D A;  4C8Q F;  4M75 D;  1LOJ A;  5GAO p;  2VXF A;  2DTH A;  3RKY A;  2DTO A;  4M7A D;  4QVD A;  2RB6 A;  5LJ3 g;  2ZGW A;  2DXU A;  1M5Q 1;  3V8J A;  4JRK A;  1Y96 B;  5GAN 3;  4F7U G;  2DKG A;  3JCM d;  2EJ9 A;  3VU3 C;  4C92 F;  3JB9 J;  4M78 F;  3QSU A;  4PJO D;  4X9C A;  2E65 A;  4J6X A;  3EFS A;  4M77 A;  4M7A F;  3JCM J;  5GAN 2;  2HNI A;  4M7D D;  4M7D G;  2E64 A;  3SB2 A;  1D3B A;  1HXD A;  4C92 B;  2Y90 A;  2RA2 A;  3M4G A;  4JUV A;  3HFN A;  5LJ3 f;  1U1S A;  4F7U E;  5GAN 7;  4EMK C;  4PJO F;  4C8Q A;  3JCM e;  4XTU A;  1YCY A;  1Y96 A;  3V8L A;  1D3B B;  5GAN f;  4XU1 A;  4XTV A;  2QTX A;  4M7D E;  5GAO q;  4M77 G;  1JRI A;  3L2Z A;  1U1T A;  4M77 C;  5I21 A;  3JCM Q;  2E41 A;  4WF2 A;  4C8Q B;  3JB9 I;  5GAN e;  3QUI A;  5GMK j;  5GAN j;  4C92 A;  5GMK e;  4M78 A;  3JCM P;  4J6W A;  5GAM g;  4M7A A;  3JB9 D;  4XU2 A;  4NL3 A;  3JB9 G;  2E10 A;  2VXE A;  1KQ2 A;  3RER A;  4M75 F;  5LJ3 d;  5GAN 5;  1KQ1 A;  3SWN A;  4A54 A;  2YLB A;  2YLC A;  5LJ5 g;  4V2S A;  4JRI A;  1LNX A;  3JCM b;  4M77 E;  2DVE A;  4M75 B;  4M78 B;  3V7C A;  3BW1 A;  4XTW A;  4MMK A;  2RD1 A;  1I8F A;  4NOY A;  4M7A B;  4F7U F;  5GAN d;  1M8V A;  5GAM h;  3RKW A;  1X01 A;  5GAN 8;  2DJZ A;  5GMK l;  4C92 D;  4J6Y A;  3SWN B;  4OP0 A;  5GMK m;  3BDU A;  4C92 C;  3JCM g;  4M78 C;  2RM4 A;  4NL2 A;  4N0A A;  5LJ3 j;  4M7D F;  5GAO m;  3PGG A;  5LJ3 e;  5LJ5 h;  5CAI A;  5GAN 4;  4PJO B;  3JCM X;  1WPY A;  4JLI A;  4M77 D;  5LJ5 f;  3EFR A;  5GAN 6;  5GAO l;  4DQ2 A;  3JCM W;  4M7D B;  1I4K 1;  3FB9 A;  3V8K A;  4M75 A;  1H64 1;  3L1A A;  4J5Y A;  2DZC A;  3JCM h;  4RCB A;  3JCM V;  4QVC A;  4C8Q G;  4M77 F;  3GIB A;  4C8Q C;  4XTX A;  2K57 A;  4MML A;  3FIF A;  2E1H A;  2DZ9 A;  2EJF A;  2FYK A;  4PNO A;  4PJO A;  2DTI A;  2DEQ A;  3JB9 F;  4HA8 A;  3AHU A;  4M7D A;  5LJ5 d;  4EMG A;  1TH7 A;  3BFM A;  1WNL A;  1HK9 A;  1BIA A;  2JN0 A;  3FJP A;  4M75 G;  4M78 D;  4M78 G;  4XQ3 A;  3V7S A;  4C92 G;  4M75 C;  4F7U B;  4RCC A;  4M7A G;  4C8Q E;  2EAY A;  2EWN A;  4EMK A;  4M7A C;  1N9R A;  3QO3 A;  3V7R A;  1B34 B;  1BIB A;  2VC8 A;  3QHS A;  3JCM c;  5GAM j;  5GMK i;  5GAM e;  5GAO n;  3SWN C;  2EJG A; 
#chains in the Genus database with same CATH topology
 1MHN A;  2DBM A;  3X20 B;  1I5L A;  3OSS C;  2KI7 A;  4EMH A;  1YHQ Q;  2E4H A;  2RNA A;  3OYG A;  3CCE A;  4XTY A;  4PFP A;  4C0Z A;  2RHU A;  4DOV A;  1WQ7 A;  4RMO A;  4M75 D;  3PE0 A;  3RKY A;  3EG9 A;  4A4K A;  1VQP T;  1AWX A;  1RI9 A;  1QVF P;  2J06 A;  3C94 A;  5IAY A;  2KAF A;  1LPL A;  1M27 C;  4M78 F;  2R58 A;  3EG9 B;  1VOM A;  2J6F A;  3JCM J;  4M7D D;  1QMC A;  2KE9 A;  1TWB A;  2LQK A;  5CQX A;  1BYM A;  5KYX B;  4PJO F;  1WZO A;  4PL6 A;  5A2Q E;  5GAN f;  2FPD A;  5HK3 A;  2D0Q B;  1K9M U;  1G3S A;  2DL5 A;  3NTK A;  1M30 A;  3LX7 A;  5CK9 A;  2ZPI B;  1YBY A;  2HAX A;  2KR3 A;  2F69 A;  4M75 B;  5GAN d;  1WA7 A;  4JJD A;  2YRC A;  5D6Y A;  4F14 A;  5CIU A;  2QEX A;  3PVQ A;  5CKB A;  2HL5 C;  5CR2 A;  5FU6 C;  2BE9 B;  4E7K A;  4M7D B;  1JXO A;  2DL3 A;  3M53 A;  2O31 A;  4EDU A;  2AHJ B;  3REB B;  3I55 T;  4JRP A;  1ZHI A;  1TSF A;  3ER0 A;  5DLQ E;  1YJ9 A;  1MND A;  3JB9 F;  3VJP A;  1TH7 A;  2K2M A;  2JN0 A;  4F7U B;  4M75 G;  2J6K A;  2L3S A;  1SF9 A;  1RAA B;  4BDY A;  1W2B P;  4JJN K;  3OYE A;  3TSW A;  2XID A;  5GAN g;  4J9I A;  1AD5 A;  4HT9 A;  4PJO C;  1T0J A;  2AT1 B;  5FRO A;  1GXI E;  1QKX A;  4A4H A;  2I2L A;  2E70 A;  4XTZ A;  3PIO A;  4ZTF A;  5IT9 E;  4F04 B;  4AT1 B;  3QG1 A;  2NWM A;  2DXC A;  2P0K A;  2RB6 A;  2ZGW A;  1K1Z A;  4JRK A;  4F7U G;  3CC7 T;  2V8K A;  1OPL A;  5KE2 A;  4J9D A;  2K2V A;  4Q5W A;  1M1K U;  3OY9 A;  3EGD A;  2GTJ A;  4YTL A;  4EMK C;  3M57 A;  3CCU Q;  4A4E A;  2CH4 W;  4J9B A;  2AIR B;  3C0C A;  2X9H A;  1RAC B;  2KRN A;  4IUV A;  1QVG P;  2W10 A;  1UE9 A;  1VQ7 T;  1C6V X;  1N6A A;  4E47 A;  2FRW A;  2F5T X;  3UAT A;  5GAN 5;  2VKN A;  4LUE A;  4OF1 A;  1FYN A;  2QA4 T;  2KBT A;  3V7C A;  4MMK A;  2RD1 A;  1Q7Y R;  5DM7 R;  1NM7 A;  3OYN A;  5CKF A;  2FL7 A;  1VQN A;  3CCJ A;  2GQI A;  2DAQ A;  5EG2 A;  4BAC A;  2RPN A;  2CZ1 B;  4OMN A;  2KDS A;  4QQG A;  4KBM B;  4XTX A;  4HCC A;  4FSX A;  4HVW A;  1BK2 A;  2MCN A;  4MDX A;  2J6O A;  1G3Y A;  1VA7 A;  1IRE B;  2M02 A;  4NL3 A;  4M78 D;  4BI8 B;  2KGT A;  4KH1 B;  2M0Y A;  1K8A U;  1IB8 A;  1MNE A;  2PVD B;  1I81 A;  1M1F A;  1EZZ B;  3CCR Q;  3FDR A;  2QYZ A;  4C92 E;  1LJO A;  1VQN T;  4KUI A;  2YSQ A;  2DXT A;  1PSF A;  2RJF A;  4JZ3 A;  5IN1 A;  4J8O A;  5CKH A;  1WJR A;  2FB7 A;  2CZ0 B;  3EG1 A;  1NYG A;  3CXC A;  3G6E A;  5KYN A;  3CCS T;  1D1B A;  3A8L B;  4ANJ A;  1SHG A;  1YJW T;  2EJ9 A;  4E6R A;  2RI5 A;  1AEY A;  2PZ1 A;  2HSE B;  2X4J A;  4L6V 5;  3I56 Q;  2ZPG B;  1VQO T;  1T3S A;  3CCQ Q;  3QXE B;  2OTJ T;  1QP2 A;  2XDP A;  2FHD A;  1EX4 A;  2DD4 A;  1M3C A;  4JDS A;  5GAN j;  1KHC A;  2FPF A;  2DXB A;  3LGL A;  3H9N A;  3JB9 D;  3CCL T;  2LCL A;  2RH2 A;  1BB9 A;  2LT4 A;  1M1K C;  4V2S A;  4CC3 A;  2P84 A;  1MMD A;  4AFZ C;  2FZK B;  1PC0 A;  3RKW A;  4OP0 A;  2X4X A;  2D9T A;  2M51 A;  1W1F A;  1Q82 U;  5LJ3 e;  4E7J A;  1PCX A;  1AOJ A;  3LH5 A;  3N5B B;  1Y7X A;  3SHW A;  1BU1 A;  2EQI A;  1WHH A;  3PVL A;  2JUF A;  1OZ2 A;  2KYM A;  4C5I A;  2RN8 A;  1HJD A;  1YHQ T;  4LDU A;  3QYG B;  2YT6 A;  4WCI A;  3VS6 A;  2RQV A;  4J7I A;  3OYJ A;  1BCO A;  5GAO n;  2CP6 A;  1WHM A;  1GCP A;  1VQ6 T;  1RLP C;  4DBR A;  1HSQ A;  4N0A C;  3GBQ A;  1ZUY A;  2RK2 A;  2QQS A;  5IHI A;  1VQ5 A;  1AHJ B;  3NFC A;  1YI2 A;  1EIF A;  5A0D A;  2LDM A;  1I07 A;  4QQ6 A;  1K8A C;  1Q95 G;  5KE3 A;  1YIJ A;  4XAX B;  4FYV B;  2DET A;  2V8J A;  4CC2 A;  3GPL A;  3VU3 C;  4C92 F;  5FW9 A;  1LVK A;  4X9C A;  2KSS A;  2K5I A;  2BZY A;  1AT1 B;  2X35 A;  3A1P A;  2CDT A;  3X26 B;  3H41 A;  1E6H A;  4OB3 B;  1NYF A;  5IHN A;  1H8K A;  1TOV A;  1R77 A;  2FVU A;  2GQV A;  4KGV B;  3X24 B;  3JCM Q;  3JB9 I;  3CME A;  1SEM A;  4BI3 A;  3CMA A;  3LWI A;  4J6W A;  3E2U A;  2DD5 A;  1IXD A;  2XDB A;  2HQE A;  1TU0 B;  3FLG A;  2CP5 A;  2F2X A;  1M90 U;  4GY5 A;  4JJB A;  1I1J A;  2K9G A;  2W0Z A;  1BI0 A;  1I0C A;  5KYW A;  1M3A A;  2KNB B;  3G4S A;  5GAN 4;  5CQY A;  2LQN A;  4B9W A;  2QEX Q;  1G2B A;  5KYW B;  2KQW A;  4LN2 A;  4KGX B;  4J5Y A;  1KHI A;  4OMQ A;  3OBW A;  1RAB B;  2A36 A;  4L5G A;  2A3L A;  1AWO A;  2D1X A;  1YJ9 Q;  2XHC A;  4EMG A;  2COZ A;  4FW2 A;  1BIA A;  5GAM f;  3CD6 A;  2WAC A;  1JJ2 S;  3DB3 A;  5J3B A;  1VQK T;  1QCF A;  1WJS A;  3A8H B;  2PUK B;  3OS2 A;  3UT1 A;  3U23 A;  1VQL T;  2XMF A;  3EHR A;  1MGQ A;  3UA7 A;  1N9S A;  2HMA A;  3UWN A;  1ZBX A;  1K4U S;  4Z88 A;  1J3T A;  5GAM d;  3RUX A;  1K9M R;  2CRE A;  2NUP B;  1B7T A;  3EFO A;  5GAN h;  1B34 A;  5GAO r;  2M1H A;  3OYL A;  3Q1J A;  1M8M A;  3T9N A;  3NPF A;  1GFD A;  2CUD A;  2ABL A;  1Q81 U;  3CC2 Q;  1B3Q A;  2JMC A;  3S3N A;  2GNC A;  4IUP A;  3CCM Q;  1SG5 A;  2EYW A;  2EGE A;  1JRI A;  1VQ9 Q;  4CC4 B;  2M9U A;  5GAM g;  2EGC A;  2K7A A;  3LGF A;  3CXC P;  2R57 A;  1KQS S;  4A54 A;  1OOT A;  2YLB A;  1ZA2 B;  1LNX A;  2QI2 A;  3JCM b;  4J7F A;  3BW1 A;  3QJY A;  2DJZ A;  1SHF A;  3GOX A;  3EG2 A;  5KYU B;  3URG A;  4M77 D;  1R8O B;  3MEU A;  3G71 Q;  1M2O A;  3EFR A;  5FLX E;  3M54 A;  4JZ4 A;  3CCJ Q;  1CKA A;  1VQ4 A;  1ZUU A;  4AG2 C;  5I11 A;  1OU9 A;  2MWP A;  4RTX A;  1M90 C;  3VS7 A;  2KXC A;  1JO8 A;  2DL4 A;  5DLO A;  4DEX A;  2DER A;  2DNU A;  2EJF A;  3EG0 A;  2K3Y A;  2RJD A;  1W4S A;  3FJP A;  4C92 D;  1PM3 A;  2BUD A;  1N9R A;  2DVJ A;  1KC8 C;  1T3L A;  3SWN C;  1M1K R;  5FU7 B;  5A0G A;  3HKS A;  3CCV T;  4BE0 A;  3QZ5 B;  3RMS A;  2JXB A;  1VQP A;  2KY9 A;  4FT4 A;  3RES A;  5L23 A;  2DFU A;  4HXJ A;  2LZ6 B;  1T0H A;  4M77 B;  3QWX X;  2RQW A;  1VIF A;  3JB9 H;  3UPU A;  5D6W A;  3PMI A;  3FRN A;  5HK0 A;  1WHG A;  2LJ3 A;  2DYB A;  4C5H A;  3CCQ T;  3LLR A;  4RTU A;  5GAN 3;  4OGE A;  2MPX C;  2RMO A;  3G6E Q;  1YIT A;  1NEB A;  3J81 E;  1VYV A;  2JNG A;  2QQR A;  4GLK A;  3OW2 S;  4RTY A;  2CS7 A;  3SB2 A;  1D3B A;  4C92 B;  1H3Z A;  4E7S A;  1OU8 A;  5FWB A;  2RJC A;  5IXF A;  1KJW A;  4F17 A;  2RHZ A;  1OYX A;  3CC4 Q;  1D3B B;  3I35 A;  1PD1 A;  2ZCF B;  4M77 G;  1D09 B;  3KUF A;  5GMK j;  1PWT A;  4HCB A;  5HY6 A;  1Q81 C;  3CPW A;  3HHT B;  1KQ2 A;  2KRM A;  5KYX A;  1KQ1 A;  1VYT A;  3QPH A;  3HP9 A;  2KRS A;  2VAS A;  5C6S A;  5LJ5 g;  1WGS A;  1QP3 A;  1UGV A;  2OI3 A;  3CBO A;  1K8A R;  1UJ0 A;  1M8V A;  1K0X A;  3L2U A;  3I55 A;  2BZX A;  4JS4 A;  3A5Z B;  2NLU A;  1YIT T;  5IH2 A;  1SRL A;  2FPE A;  5CVI A;  1M9S A;  4LNP A;  4M75 A;  2HSP A;  3L1A A;  2DK3 A;  2F1L A;  3NTH A;  3O5Z A;  1D0X A;  3MJX A;  4A63 B;  2B86 A;  2K57 A;  1TUD A;  4FL6 A;  1ACM B;  1HYO A;  4M7D A;  3HRU A;  3KXT A;  4DOW A;  2D0N A;  1AZG B;  2GGR A;  3CQT A;  3JCM c;  5GAM j;  1GCQ A;  2MYS A;  1Y71 A;  3RBB B;  4C8Q D;  1QVF S;  2E3H A;  2GBQ A;  4F7U A;  3CC7 A;  1RAI B;  2MWO A;  2LTO A;  4J9F A;  4QVZ A;  1BCM A;  2C06 A;  4M7A D;  1Q86 C;  1VQ5 Q;  2DXU A;  1M5Q 1;  1X69 A;  3ZEH A;  3PIP A;  4PFO A;  2RO0 A;  3QZ9 B;  1MMA A;  1BI2 A;  1YIJ Q;  3P8D A;  2X4Y A;  2O01 E;  4M7D G;  2COW A;  1Q82 R;  1MUZ A;  4OB0 B;  1VQ7 A;  2RA2 A;  2QTV A;  1H92 A;  3E19 A;  3MHX A;  2CP3 A;  2L2P A;  4PFZ A;  3E9G A;  3R6O A;  4C8Q A;  2QDL A;  1KD1 U;  2QA4 A;  2AZV A;  2QTX A;  4DBH A;  2SRC A;  5GAO q;  1JJ2 A;  1UDL A;  4KUL A;  1VUB A;  4C8Q B;  2IPO B;  1UG1 A;  1UJY A;  3TRE A;  5GAN e;  2RQR A;  2RHX A;  4M7A A;  3FC3 A;  4ELZ C;  4BY6 B;  4OMO A;  3WXM B;  3CME Q;  1FXX A;  1VIE A;  4A4G A;  2O4X A;  1M4Z A;  3CMA Q;  2DVE A;  4XTW A;  8ATC B;  2COY A;  4DA4 A;  4M7A B;  2JS0 A;  5GMK l;  4KRT A;  2O4X B;  1A0N B;  1SPK A;  2CYZ B;  3A8G B;  3QWY A;  3VUZ A;  5GAN 6;  2DF6 A;  3CBM A;  3MEA A;  4IUT A;  1ZSG A;  3G4S Q;  1YWO A;  3BDL A;  4C8Q G;  1W2B S;  4C0F A;  3GNF B;  1W70 A;  4AFU C;  2CZ6 B;  3BFM A;  1WNL A;  4J83 A;  4J9H A;  4M7A G;  4TVR A;  1XTD A;  2EPD A;  1YFN A;  2ZPB B;  3M4Y A;  4JJC A;  3MPU B;  3CD6 Q;  5GAO m;  3RKX A;  2EYX A;  2YHT A;  6AT1 B;  3L2R A;  2QK0 A;  1GRI A;  5LJ5 j;  2M16 A;  4LDY A;  4A4F A;  3CCS A;  3I5R A;  4Z89 A;  3OYF A;  1S72 A;  4RTZ A;  3MP1 A;  2P0Q A;  3CC2 T;  1YJW A;  1MMG A;  2A08 A;  2J7I A;  1RI0 A;  5GMK h;  4X9D A;  2Y4Y A;  5AT1 B;  4AFQ C;  1WJQ A;  3L2V A;  4QVD A;  3CCM T;  1M90 R;  3M56 A;  1VQO A;  4JS5 A;  2X3X D;  2OJ2 A;  2OAU A;  1PNJ A;  2OTJ A;  3OYI A;  4PJO D;  1VQ9 T;  1KSW A;  2ED1 A;  1VQM T;  4B9X A;  4E7I A;  1QVG S;  5FU6 B;  1TTH B;  2JM8 A;  5LJ3 f;  1U1S A;  3CCL A;  1F1B B;  3JCM e;  2ROL A;  2Z0W A;  1C1A A;  3OYD A;  1K9A A;  4M4Z A;  1S72 T;  2B8A A;  2C0O A;  4M78 A;  4WTO B;  1WFW A;  2JW4 A;  1SKU B;  3G71 T;  1EFN A;  2PVG B;  5LJ3 d;  4X1V A;  2LP5 A;  4RG2 A;  2JS2 A;  2XK0 A;  2EYQ A;  2YLC A;  2KMT A;  5ECA A;  2FZG B;  4M78 B;  4PJM A;  2XIC A;  5GAM h;  1KD1 C;  1GBQ A;  4UC4 A;  4J6Y A;  2X4W A;  2YWW A;  1YJN Q;  3BDU A;  2OAW A;  2RM4 A;  4PJO B;  3VV0 A;  2HL3 A;  1YHQ A;  1K0S A;  3QDR B;  4LDV A;  3OYC A;  1I4K 1;  1VQ8 T;  1QKW A;  1X6G A;  3VYG A;  2L5Q A;  4ZGE B;  2ZPH B;  1TS9 A;  1VQ6 A;  3LH0 A;  3CPW P;  4OB1 B;  5I22 A;  3V7S A;  1X2K A;  1Q81 R;  4M78 G;  3VS0 A;  4EMK A;  3QO3 A;  5GMK i;  1IGU A;  2OTL Q;  2EW3 A;  2L89 A;  4HT8 A;  4PJO G;  4EMK B;  4M75 E;  4J9E A;  4OML A;  4BD3 A;  1WX6 A;  1UGR B;  4AMC A;  2YUO A;  3TCJ A;  2MOX A;  2YRD A;  4FCY A;  1V76 A;  2RQU A;  2IVW A;  2M0O A;  2QG9 B;  4II1 A;  1FWZ A;  3OB9 A;  4C0D C;  3QSU A;  2VUB A;  3OYY A;  2BZ8 A;  2DM1 A;  1D1C A;  1RUW A;  1NZ9 A;  2LQ8 A;  1CSK A;  2BKD N;  1HXD A;  2X51 A;  3PNW C;  3PFS A;  2ZPF B;  4AFS C;  1BI1 A;  4F7U E;  2BTT A;  4MDW A;  3PTA A;  2RK1 A;  2E5K A;  4XU1 A;  3CCE Q;  2CZ7 B;  3F70 A;  1RAH B;  2D8H A;  9ATC B;  1YP5 A;  3JB9 G;  3VUB A;  3IQL A;  3RNJ A;  5GAN 8;  4OMP A;  3NHN A;  3G7Z A;  5IXB A;  2E12 A;  1UHC A;  4C5E A;  5LJ5 h;  2ZAE A;  1QCO A;  2DL8 A;  1IRX A;  2CSQ A;  3HPW A;  3JCM X;  1WYX A;  3I55 Q;  2E5Q A;  1K73 U;  2HKQ B;  1RAE B;  1P92 A;  1PSE A;  3C12 A;  4HVU A;  2EYZ A;  3M59 A;  4RCB A;  2CUB A;  2EQU A;  1YNZ A;  1VQK A;  4E7Z A;  2FYK A;  2KT1 A;  3OYH A;  2L3R A;  3VKI A;  1VQL A;  4ZN3 A;  3MP6 A;  1O9S A;  1NJI U;  3ZFJ A;  3EAE A;  1WXB A;  2VVK A;  8AT1 B;  3P8B B;  3DB4 A;  3SD4 A;  2EAY A;  3M55 A;  2VC8 A;  1RAD B;  3VYH B;  2HQX A;  1KC8 U;  2CSI A;  2DRK A;  5CKD A;  1MV0 B;  2KXD A;  4FW1 A;  4PJN A;  3QBY A;  1IHW A;  4XU3 A;  4Y91 A;  3HFO A;  3WVD B;  2DPP B;  3J7A F;  1Y0M A;  2VV5 A;  3CEY A;  4HCK A;  3CC7 Q;  5I2S A;  4BDZ A;  4E7L A;  2O9S A;  1Y96 B;  2NUP A;  1QW1 A;  2EBP A;  3THK A;  2JT4 A;  5CCA A;  3VRY A;  1XQH A;  5KYY A;  2FRY A;  2LQW A;  1VQ7 Q;  4Z8A A;  3CPF A;  5GJW B;  1G3T A;  4DEY A;  3TVT A;  5KYY B;  3UA6 A;  3CCU T;  2P0P A;  5J39 A;  5GMK e;  1WIE A;  1YN8 A;  2YRV A;  4FIB A;  2HZY A;  3C4S A;  2X3W D;  4F7U F;  4L59 A;  1FMK A;  2K3B A;  4HCZ A;  3ME9 A;  3JSC A;  2C0I A;  2L0A A;  4N0A A;  2DRM A;  3QJ6 A;  3CCR A;  5KCH A;  2PNI A;  4ZTJ A;  3GNG A;  2BIV A;  1PD0 A;  3OS5 A;  2CP0 A;  2HKN A;  2V1R A;  2L8D A;  2E1H A;  2WSE E;  5KYU A;  3M0U A;  3CCV A;  4FYW B;  2RQT A;  1FMW A;  1HK9 A;  1JXM A;  4ESR A;  1NPR A;  4M75 C;  4OMF B;  2A37 A;  2GCX A;  1ABQ A;  3V7R A;  2QQA A;  1ZA1 B;  1K73 C;  4Y92 A;  2QQB A;  7AT1 B;  5GAM e;  2D8J A;  1VQN Q;  2EJG A;  3TEE A;  2F2W A;  1KD1 R;  4PJJ A;  3H6Z A;  3G1J A;  4M7D C;  3CCQ A;  1Y57 A;  2DIQ A;  2LJ1 A;  2EQK A;  2DE0 X;  2GTO A;  3CCR T;  4JPB W;  3VRZ A;  3CCS Q;  1JB0 E;  1NJI C;  1QWE A;  4IUU A;  2V26 A;  1GCQ C;  1U5S A;  1YJW Q;  4O5V A;  2DTO A;  2L3Q A;  1Q86 U;  5IHK A;  4O6J A;  3AT1 B;  2E65 A;  2R5M A;  4M77 A;  2LC4 A;  1VQO Q;  4KUD K;  2A7Y A;  2Y90 A;  2QGF B;  2OTJ Q;  2BE7 D;  3A8M B;  2RHI A;  3GF5 A;  5GAN 7;  2V8I A;  4QT7 A;  2LRQ A;  1ZBJ A;  3CXC S;  4XTU A;  3I56 T;  1N8R U;  2E3I A;  1ZX6 A;  3CCL Q;  1YJN T;  5I21 A;  2CT3 A;  2WSC E;  4C92 A;  3MEW A;  2H8H A;  2MK5 A;  1BBZ A;  2QAS A;  1PRL C;  1RAF B;  3UDC A;  2KRO A;  3L2W A;  2F2V A;  1IO6 A;  4XK8 E;  4NOY A;  2EQJ A;  1AWW A;  4KH0 B;  2QGG A;  5GMK m;  5CO7 A;  4DBF A;  1NBE B;  2XDD A;  3PGG A;  1JU5 C;  4JLI A;  4J9G A;  1QLY A;  1ZLM A;  5J26 A;  2OTL T;  3VS2 A;  1GBR A;  2CT4 A;  3VS5 A;  2FZC B;  2DTI A;  4HA8 A;  5GAN 2;  2VGN A;  4C92 G;  3LWH A;  1VQ6 Q;  1OX8 A;  4PK4 A;  3QHS A;  1ABO A;  1NPP A;  5LL6 S;  4BI4 A;  3OYK A;  1SSF A;  1UGP B;  2SEM A;  2DEU A;  4ATO A;  1SRM A;  2YUN A;  5LJ5 e;  2QQ9 A;  2HD0 A;  1OZ3 A;  3KBG A;  4ZNX A;  5LJ3 h;  1WDX A;  1KK7 A;  1X27 A;  3ASK A;  3TQ7 P;  3LW5 E;  2NUT A;  1OX9 A;  1PKS A;  4D8D A;  2JTE A;  2NUT B;  1OUL A;  3MEV A;  3CCE T;  2HBP A;  2FO0 A;  4RTW A;  2JVV A;  2MAM A;  2DIG A;  3M0T A;  5AYF A;  5CKE A;  4BB7 A;  3L2Q A;  3JAM E;  3P8H A;  3V8L A;  1TG0 A;  2H3J A;  3UF4 A;  3MET A;  4NS5 A;  2A28 A;  5D6X A;  3M0P A;  2E41 A;  4X34 A;  2EVR A;  3EHQ A;  1YI2 Q;  2LCS A;  3OMG A;  4N4H A;  4XU2 A;  4FYY B;  1RL2 A;  3SWN A;  1XJW B;  4DBQ A;  4N4I A;  1UGQ B;  4JRI A;  1ZSZ A;  2K5F A;  4BE1 A;  2NYS A;  1X01 A;  1G5V A;  1N8R C;  3SWN B;  2VWF A;  4M78 C;  2LJ0 A;  1ZSZ B;  2KK4 A;  1IHV A;  2ROT A;  1O75 A;  3FEO A;  2EKH A;  2EKO A;  4LDW A;  1XOV A;  1YWP A;  1H64 1;  3NTI A;  3E1S A;  3EH1 A;  2QEX T;  4BE2 A;  3QYH B;  5EC7 A;  4PKC C;  2PU9 B;  2DO3 A;  4IUR A;  4PLI A;  1VQK Q;  1QQJ A;  2ECZ A;  1SSH A;  3HL8 A;  2G6F X;  2EWN A;  3CC2 A;  2H3E B;  1VQL Q;  5FRM A;  1YJ9 T;  2DJQ A;  2E6N A;  3TSZ A;  1G83 A;  2VB6 A;  2WSF E;  2RI3 A;  5DY9 A;  2ED0 A;  4OMM A;  1FMV A;  1UB4 A;  4LXC A;  3JCM f;  3CCM A;  4PLL A;  4XU0 A;  4B6M A;  1PHT A;  1WQW A;  2CGH A;  5HCK A;  3A98 A;  1VQ9 A;  2D6F A;  2FEI A;  1VQM A;  5GAO p;  3HRS A;  3EGD B;  3JCM d;  4RUG A;  3X28 B;  3OYA A;  4ZGJ B;  2VGM A;  1NLP C;  3S6W A;  3EFS A;  2AK5 A;  3FJ5 A;  1KQS A;  2AZS A;  2LX9 A;  4K11 A;  1QVP A;  3M4G A;  5FWC A;  3JV3 A;  1K73 R;  1AZE A;  3G71 A;  2CKK A;  2LCC A;  4LE9 A;  2C0T A;  1K9M C;  1UUE A;  3QII A;  4XTV A;  4RTT A;  1DJ7 B;  2L3P A;  2AKL A;  3L2Z A;  2MI6 A;  1UTI A;  1ZQ1 A;  2GFA A;  2YDL A;  1V1C A;  4WF2 A;  2I0N A;  3VS4 A;  3QUI A;  2P4T A;  4GBQ A;  1PG5 B;  1V29 B;  1MV3 A;  1OEB A;  2V1Q A;  2YXY A;  1NJI R;  1Z9Q A;  4M77 E;  3J80 E;  1VQ8 A;  2KT8 A;  1I8F A;  3R6N A;  2ENM A;  1KC8 R;  1AWJ A;  2DL7 A;  4RTV A;  1OQK A;  3MP8 A;  3JCM g;  2LX7 A;  4IUQ A;  3L42 A;  2PVO B;  3VS1 A;  2QAZ A;  3RDV A;  1WLP B;  3SEM A;  2ZPE B;  4DQ2 A;  1I5O B;  1Y07 A;  3M5A A;  3WVE B;  4EPC A;  1OPK A;  3DKM A;  3S3O A;  3JCM V;  2O9V A;  2G3R A;  1ZUK A;  3DLL A;  2K4Y A;  3CCJ T;  1RLQ C;  3FIF A;  1KFZ A;  2DZ9 A;  2XD0 A;  5I2M A;  4PJO A;  1UFF A;  2DEQ A;  3ZL7 C;  4KGZ B;  2EIF A;  4HKE A;  1UGS B;  2O88 A;  2PQW A;  3NGP A;  3LYI A;  3CCV Q;  3OSV A;  4VUB A;  1TXQ A;  1WHK A;  2DA9 A;  2RF0 A;  3ULR B;  1JBM A;  1E7O A;  3MO8 A;  1PRM C;  5FRN A;  3S3M A;  2IIM A;  2OX7 A;  5KH6 A;  3KFV A;  3OW2 A;  5A0L A;  3CC4 A;  4E2F B;  2DLP A;  3RIR A;  2YUP A;  1VQ4 Q;  3EH2 A;  3INZ A;  4ZN1 A;  2XU8 A;  2ESW A;  2IG0 A;  4HVV A;  1LOJ A;  2VXF A;  3DLM A;  4R55 A;  1X43 A;  2JJ9 A;  5LJ3 g;  1WXT A;  2J05 A;  2DBK A;  2DKG A;  2K5L A;  2HDA A;  3JB9 J;  1G8X A;  2E64 A;  3G6E T;  3GLX A;  1WHJ A;  4IIM A;  4JUV A;  3OBY A;  2DIL A;  3HFN A;  4KT0 E;  2R5A A;  4MZM A;  1VQP Q;  1K76 A;  1N27 A;  4PJL A;  1B07 A;  3OYM A;  1JQQ A;  3PMT A;  2LMJ A;  4M7D E;  2E6Z A;  3CC4 T;  4P5N A;  2LT1 A;  3JCM P;  1AVZ C;  1D1A A;  3X25 B;  4MZP A;  2VXE A;  1PKT A;  3ZBD A;  2Y4X A;  1YIT Q;  2KEA A;  4Y28 E;  2FG0 A;  5L8R E;  5GAO l;  3EGU A;  3JCM W;  4C5G A;  4QQD A;  4MZT A;  3CPW S;  4M77 F;  2VYT A;  3RMQ A;  5KCO A;  4CRI A;  1U8R A;  1QVF A;  2EGA A;  2GF7 A;  4JLG A;  1Q86 R;  1S1N A;  1QWF A;  3H0H A;  1BI3 A;  3OS0 A;  4XQ3 A;  1D0Y A;  1E6G A;  1G3W A;  1YCS B;  3REA B;  1MMN A;  4C8Q E;  5M9O A;  2LNV A;  1Q7Y U;  1UEB A;  4LD6 A;  4R0K A;  3O8V A;  1X75 C;  2KYB A;  3A8O B;  3HSB A;  3RR6 A;  1N8R R;  1NEG A;  1D0Z A;  2RI2 A;  4M7A E;  1KG1 A;  1JJ2 P;  3C95 A;  4CC7 A;  2XI9 A;  3M0S A;  1LCK A;  3M0R A;  2CP7 A;  2EFI A;  2DTH A;  3OYB A;  1ARK A;  1UHF A;  4FYX B;  3M58 A;  1X2Q A;  1IGQ A;  4N4G A;  4IIO A;  4J6X A;  4ZGD B;  1VQ5 T;  1N5Z A;  4D8K A;  2EYY A;  3CCU A;  1YI2 T;  2XG8 D;  5FU7 C;  2CP2 A;  1YIJ T;  1HD3 A;  4LUD A;  2KVQ G;  4EIK A;  1Y96 A;  2NUZ A;  2RHY A;  2JMA A;  3VS3 A;  1X6B A;  1JEG A;  4M77 C;  3HTR A;  2HEQ A;  4RKU E;  4QW2 A;  3RER A;  4M75 F;  1NLO C;  2HQH A;  4R56 A;  4D6W A;  1NG2 A;  1W2B A;  5HKC A;  2XKO C;  3CME T;  1Q82 C;  2AKK A;  3CMA T;  1OI1 A;  1R0C B;  3GP8 A;  4C92 C;  4M7D F;  3I5S A;  4NL2 A;  5LJ3 j;  2GFU A;  1KQS P;  5CAI A;  2ZZD A;  1GL5 A;  1TUC A;  2EQM A;  1M1G A;  3FB9 A;  2QA4 Q;  3V8K A;  3PT9 A;  4FSS A;  4QVC A;  2CH4 A;  4LDX A;  2O2O A;  1VYU A;  4MML A;  2JM9 A;  3G4S T;  2HCK A;  4FT2 A;  2HBW A;  1WHL A;  3AHU A;  2QDY B;  3I9Q A;  2LNH B;  4FU6 A;  4C0D B;  4RCC A;  3EFO B;  3MCA B;  1B34 B;  1BIB A;  4QKU A;  1KIK A;  2PTK A;  4ELY C;  4E7H A;  1IZ6 A;  2JZ2 A;  1WXU A;  2K79 A;  4Z02 A;  4M78 E;  2K3X A;  3TU4 K;  2A0F B;  3CD6 T;  1C0M A;  3BY7 A;  1QVG A;  4A53 A;  3EG3 A;  5D7U A;  3H0F A;  1U3O A;  4ME7 A;  4C0G A;  1U06 A;  4PJO E;  4OVA A;  4C8Q F;  2JTM A;  1Q7Y C;  1NE8 A;  2QXF A;  1CKB A;  3V8J A;  1VQM Q;  1OV3 A;  3OS1 A;  4IKF A;  3I56 A;  1QCN A;  4M7A F;  3NMZ C;  4J9C A;  2HNI A;  1YJN A;  1H3H A;  2F5K A;  3HRT A;  2K6D A;  4ORZ A;  1M3B A;  1YCY A;  2DYI A;  4AG1 C;  4JRQ A;  1S72 Q;  3OW2 P;  2JOY A;  2ATC B;  1UEC A;  1Z9Z A;  1U1T A;  4CI0 C;  2JTF A;  2MF2 A;  2RJE A;  2YUQ A;  2E10 A;  1GFC A;  3QDF A;  4FM4 B;  4OB2 B;  1W6X A;  1X6O A;  5C0M A;  3M9Q A;  3OMC A;  3OA6 A;  3QKJ A;  2OTL A;  3EGX A;  1VQ8 Q;  3H0I A;  3M0Q A;  1RAG B;  4RG8 A;  3CBP A;  2P4R A;  3MKD A;  1WPY A;  4OGC A;  5LJ5 f;  4BUG A;  4LD9 K;  3EGX B;  1ZSZ C;  3H8Z A;  3SDZ A;  2DZC A;  2MMP A;  3JCM h;  4F16 A;  1M2V A;  3JRZ A;  1BKB A;  1R0B G;  3GIB A;  4C8Q C;  1WI7 A;  2LVM A;  3SFM A;  4PNO A;  3E9F A;  4BY6 C;  1M2V B;  4GLM A;  2DX1 A;  5LJ5 d;  1VQ4 T;  1TUG B;  3OQ5 A;  1XNI A;  2DMO A;  4M7A C;  2PUO B;  1FX7 A;  3D7S B;  2MIO A;  5GJV B;  3BE3 A; 
#chains in the Genus database with same CATH homology
 2L89 A;  1MHN A;  2RI3 A;  4HT8 A;  4PJO G;  3X20 B;  5DY9 A;  1I5L A;  1VQL T;  3OSS C;  4EMK B;  4EMH A;  4M75 E;  1MGQ A;  1UB4 A;  1N9S A;  3UWN A;  1ZBX A;  3CCM A;  3JCM f;  4BD3 A;  3OYG A;  4PLL A;  3CCE A;  1UGR B;  4XU0 A;  5GAM d;  3RUX A;  4XTY A;  1WQW A;  2CGH A;  4C0Z A;  5GAN h;  1B34 A;  2RHU A;  5GAO r;  1VQ9 A;  4DOV A;  2M1H A;  3TCJ A;  1WQ7 A;  2D6F A;  3OYL A;  3Q1J A;  1VQM A;  4RMO A;  4M75 D;  5GAO p;  3RKY A;  3T9N A;  3HRS A;  4A4K A;  1VQP T;  3C94 A;  5IAY A;  2IVW A;  2M0O A;  2KAF A;  4II1 A;  3JCM d;  1FWZ A;  3OB9 A;  4C0D C;  3X28 B;  4M78 F;  3OYA A;  2R58 A;  1Q81 U;  2VUB A;  2VGM A;  3OYY A;  3S6W A;  4ZGJ B;  2LQ8 A;  3EFS A;  1NZ9 A;  3JCM J;  4M7D D;  2BKD N;  1KQS A;  1HXD A;  3PNW C;  2LX9 A;  1QVP A;  3M4G A;  2LQK A;  3PFS A;  5CQX A;  1BYM A;  2ZPF B;  3S3N A;  1BI1 A;  4F7U E;  3G71 A;  2CKK A;  4PJO F;  4PL6 A;  4MDW A;  2LCC A;  5A2Q E;  4IUP A;  3PTA A;  2RK1 A;  5GAN f;  1K9M C;  4XU1 A;  2CZ7 B;  3QII A;  4XTV A;  5HK3 A;  2D0Q B;  3F70 A;  1DJ7 B;  1K9M U;  1G3S A;  1JRI A;  3L2Z A;  2MI6 A;  1ZQ1 A;  2GFA A;  4WF2 A;  3NTK A;  3QUI A;  2P4T A;  3LX7 A;  2M9U A;  5GAM g;  3LGF A;  5CK9 A;  2ZPI B;  3VUB A;  3JB9 G;  1YBY A;  2R57 A;  1V29 B;  1KQS S;  3OS2 A;  4A54 A;  2HAX A;  2YLB A;  1LNX A;  2QI2 A;  2F69 A;  4M75 B;  4M77 E;  3JCM b;  3J80 E;  4J7F A;  3BW1 A;  1VQ8 A;  1I8F A;  5GAN d;  3QSU A;  3QJY A;  5D6Y A;  5GAN 8;  2DJZ A;  5CIU A;  3GOX A;  2QEX A;  5CKB A;  3G7Z A;  3MP8 A;  5CR2 A;  3JCM g;  5FU6 C;  4IUQ A;  2E12 A;  3L42 A;  4C5E A;  2PVO B;  4E7K A;  5LJ5 h;  3URG A;  3JCM X;  2ZPE B;  1R8O B;  3HPW A;  3MEU A;  4M77 D;  2E5Q A;  3EFR A;  5FLX E;  4DQ2 A;  3M54 A;  3M53 A;  1K73 U;  1Y07 A;  3M5A A;  3C12 A;  1P92 A;  1PSE A;  3WVE B;  4EPC A;  3DKM A;  4EDU A;  2AHJ B;  1VQ4 A;  3M59 A;  3S3O A;  4RCB A;  3I55 T;  3JCM V;  4JRP A;  2G3R A;  1ZHI A;  2MWP A;  1M90 C;  2EQU A;  2K4Y A;  3ER0 A;  5DLQ E;  3DLL A;  3CCJ T;  1YJ9 A;  1VQK A;  5DLO A;  3FIF A;  2DZ9 A;  2XD0 A;  2EJF A;  2FYK A;  5I2M A;  3OYH A;  2L3R A;  3VKI A;  4PJO A;  1VQL A;  2DEQ A;  4ZN3 A;  2K3Y A;  2RJD A;  3JB9 F;  1W4S A;  2EIF A;  3MP6 A;  1TH7 A;  4HKE A;  3FJP A;  1O9S A;  3VJP A;  2JN0 A;  4C92 D;  4M75 G;  2BUD A;  1UGS B;  3EAE A;  3ZFJ A;  4F7U B;  1NJI U;  3P8B B;  2PQW A;  3DB4 A;  3SD4 A;  2EAY A;  3LYI A;  4BDY A;  1N9R A;  3M55 A;  1KC8 C;  2VC8 A;  3OSV A;  4VUB A;  4JJN K;  3VYH B;  3SWN C;  2HQX A;  3OYE A;  1KC8 U;  5FU7 B;  5A0G A;  2XID A;  3HKS A;  1JBM A;  5GAN g;  5CKD A;  3MO8 A;  3CCV T;  4BE0 A;  5FRN A;  3QZ5 B;  4HT9 A;  3RMS A;  3S3M A;  4PJO C;  3QBY A;  5KH6 A;  1VQP A;  3OW2 A;  2KY9 A;  4XU3 A;  5A0L A;  3CC4 A;  5FRO A;  1GXI E;  4FT4 A;  4Y91 A;  3RES A;  4A4H A;  3HFO A;  2I2L A;  3WVD B;  3RIR A;  2E70 A;  4XTZ A;  3PIO A;  4ZTF A;  5IT9 E;  2DPP B;  3INZ A;  4ZN1 A;  3J7A F;  4M77 B;  2XU8 A;  1VIF A;  3JB9 H;  3QG1 A;  2VV5 A;  3UPU A;  3CEY A;  2IG0 A;  5D6W A;  3PMI A;  3FRN A;  1LOJ A;  5HK0 A;  2VXF A;  5I2S A;  4BDZ A;  2DXC A;  4E7L A;  3DLM A;  4R55 A;  2P0K A;  4C5H A;  2RB6 A;  5LJ3 g;  3CCQ T;  3LLR A;  2ZGW A;  4JRK A;  1Y96 B;  5GAN 3;  4F7U G;  4OGE A;  2DKG A;  3CC7 T;  1YIT A;  2K5L A;  3J81 E;  3JB9 J;  2JNG A;  2QQR A;  1QW1 A;  2V8K A;  4GLK A;  3OW2 S;  2CS7 A;  5KE2 A;  2E64 A;  3SB2 A;  1D3B A;  4C92 B;  3G6E T;  2K2V A;  4Q5W A;  3GLX A;  1H3Z A;  4JUV A;  3OBY A;  5CCA A;  1XQH A;  1M1K U;  3HFN A;  4KT0 E;  3OY9 A;  2RJC A;  4YTL A;  4EMK C;  2R5A A;  3M57 A;  4MZM A;  4A4E A;  1N27 A;  1OYX A;  2RHZ A;  3CPF A;  1D3B B;  3OYM A;  1G3T A;  3PMT A;  4IUV A;  4M7D E;  2ZCF B;  4M77 G;  2E6Z A;  3CCU T;  2P0P A;  5J39 A;  3CC4 T;  1VQ7 T;  3KUF A;  4P5N A;  5GMK j;  2LT1 A;  4HCB A;  5GMK e;  1N6A A;  3JCM P;  5HY6 A;  1Q81 C;  3X25 B;  4E47 A;  2YRV A;  4MZP A;  3CPW A;  2F5T X;  2VXE A;  3HHT B;  1KQ2 A;  4FIB A;  5GAN 5;  1KQ1 A;  3QPH A;  3C4S A;  3HP9 A;  4OF1 A;  2QA4 T;  5LJ5 g;  5C6S A;  3ZBD A;  2Y4X A;  1WGS A;  1QP3 A;  3V7C A;  4F7U F;  4MMK A;  2RD1 A;  3CBO A;  4L59 A;  5DM7 R;  1M8V A;  3L2U A;  3OYN A;  3I55 A;  4HCZ A;  4Y28 E;  4JS4 A;  5CKF A;  2FL7 A;  3A5Z B;  1VQN A;  3ME9 A;  3CCJ A;  2NLU A;  3JSC A;  4N0A A;  1YIT T;  5L8R E;  3QJ6 A;  2DAQ A;  3CCR A;  5EG2 A;  5KCH A;  4BAC A;  5GAO l;  3JCM W;  4C5G A;  5CVI A;  4QQD A;  4ZTJ A;  3GNG A;  1M9S A;  2CZ1 B;  4M75 A;  4MZT A;  3L1A A;  3CPW S;  2BIV A;  2DK3 A;  3OS5 A;  3NTH A;  2L8D A;  2KDS A;  4QQG A;  4M77 F;  2VYT A;  3RMQ A;  5KCO A;  4KBM B;  4XTX A;  2K57 A;  4CRI A;  4HCC A;  4FL6 A;  1U8R A;  1QVF A;  2E1H A;  2WSE E;  2GF7 A;  4JLG A;  4FSX A;  3CCV A;  4MDX A;  1G3Y A;  1IRE B;  4M7D A;  1BI3 A;  3HRU A;  4NL3 A;  3OS0 A;  3KXT A;  1HK9 A;  4M78 D;  4BI8 B;  1NPR A;  4XQ3 A;  4DOW A;  4M75 C;  1G3W A;  4OMF B;  2GCX A;  4C8Q E;  5M9O A;  1K73 C;  3V7R A;  2QQA A;  2LNV A;  3JCM c;  1Q7Y U;  1K8A U;  5GAM j;  1UEB A;  2QQB A;  5GAM e;  4LD6 A;  2PVD B;  2EJG A;  3O8V A;  1I81 A;  3TEE A;  1M1F A;  1X75 C;  1Y71 A;  3A8O B;  3FDR A;  4C92 E;  3HSB A;  1LJO A;  3H6Z A;  4C8Q D;  4M7D C;  3CCQ A;  2RI2 A;  1VQN T;  2DIQ A;  4KUI A;  1QVF S;  4M7A E;  2EQK A;  4F7U A;  1KG1 A;  2DXT A;  1PSF A;  2RJF A;  5IN1 A;  4J8O A;  3CC7 A;  5CKH A;  3CCR T;  2MWO A;  1WJR A;  1JB0 E;  3C95 A;  2XI9 A;  2FB7 A;  4IUU A;  2CZ0 B;  2LTO A;  1NJI C;  4QVZ A;  3CXC A;  2EFI A;  3G6E A;  4O5V A;  2DTH A;  2C06 A;  2DTO A;  4M7A D;  3OYB A;  3CCS T;  1Q86 C;  2DXU A;  1M5Q 1;  3A8L B;  3M58 A;  1Q86 U;  1YJW T;  3ZEH A;  2EJ9 A;  3PIP A;  4O6J A;  2RO0 A;  3QZ9 B;  4N4G A;  2RI5 A;  1BI2 A;  2E65 A;  2R5M A;  4J6X A;  3P8D A;  4M77 A;  4ZGD B;  1VQ5 T;  2LC4 A;  2X4Y A;  2O01 E;  3CCU A;  1YI2 T;  4KUD K;  4M7D G;  2XG8 D;  4OB0 B;  1VQ7 A;  2A7Y A;  2RA2 A;  2Y90 A;  2X4J A;  4L6V 5;  5FU7 C;  3E19 A;  3A8M B;  3MHX A;  2RHI A;  1YIJ T;  2ZPG B;  3E9G A;  3GF5 A;  5GAN 7;  2V8I A;  1VQO T;  2LRQ A;  3R6O A;  4C8Q A;  3CXC S;  2KVQ G;  4XTU A;  1KD1 U;  1Y96 A;  3I56 T;  2QA4 A;  1N8R U;  3QXE B;  2OTJ T;  1QP2 A;  2XDP A;  2RHY A;  2FHD A;  2QTX A;  5GAO q;  1JJ2 A;  2DD4 A;  1YJN T;  4JDS A;  4M77 C;  4KUL A;  1VUB A;  5I21 A;  4C8Q B;  5GAN j;  1KHC A;  5GAN e;  2WSC E;  3TRE A;  4C92 A;  3MEW A;  3LGL A;  2DXB A;  2RHX A;  4RKU E;  4M7A A;  4QW2 A;  3FC3 A;  4ELZ C;  3JB9 D;  3CCL T;  3RER A;  4BY6 B;  4M75 F;  2LCL A;  3WXM B;  2RH2 A;  4R56 A;  1FXX A;  4D6W A;  1VIE A;  3UDC A;  2LT4 A;  4A4G A;  2O4X A;  1M4Z A;  1M1K C;  3L2W A;  4V2S A;  1W2B A;  2DVE A;  5HKC A;  4XTW A;  4DA4 A;  4XK8 E;  4NOY A;  4M7A B;  2EQJ A;  2XKO C;  3RKW A;  3CME T;  5GMK l;  1Q82 C;  5GMK m;  4OP0 A;  5CO7 A;  1OI1 A;  2X4X A;  3GP8 A;  3CMA T;  2O4X B;  2D9T A;  4C92 C;  4M7D F;  4NL2 A;  5LJ3 j;  2GFU A;  2XDD A;  3PGG A;  5LJ3 e;  4E7J A;  5CAI A;  1Q82 U;  2CYZ B;  3A8G B;  4JLI A;  2ZZD A;  3VUZ A;  3N5B B;  5GAN 6;  3CBM A;  2EQM A;  1Y7X A;  1M1G A;  3FB9 A;  3MEA A;  4IUT A;  5J26 A;  3V8K A;  3PT9 A;  4QVC A;  2JUF A;  2OTL T;  1OZ2 A;  3BDL A;  4C8Q G;  4C5I A;  4LDX A;  1W2B S;  4C0F A;  4MML A;  3GNF B;  3G4S T;  1YHQ T;  4FT2 A;  4LDU A;  2DTI A;  4HA8 A;  3AHU A;  2QDY B;  2CZ6 B;  3BFM A;  1WNL A;  2VGN A;  5GAN 2;  4C92 G;  4FU6 A;  3QYG B;  4C0D B;  4J83 A;  4RCC A;  3LWH A;  4M7A G;  4J7I A;  4TVR A;  1XTD A;  1B34 B;  1BIB A;  3MCA B;  3QHS A;  3OYJ A;  2ZPB B;  3M4Y A;  1NPP A;  5GAO n;  5LL6 S;  4BI4 A;  4ELY C;  3OYK A;  4E7H A;  1IZ6 A;  2JZ2 A;  5GAO m;  1VQ6 T;  1SSF A;  1UGP B;  3RKX A;  2YHT A;  4ATO A;  3L2R A;  5LJ5 j;  2M16 A;  4Z02 A;  4LDY A;  5LJ5 e;  2QQ9 A;  4A4F A;  2HD0 A;  4M78 E;  3CCS A;  1OZ3 A;  2K3X A;  3KBG A;  5LJ3 h;  3OYF A;  3TU4 K;  1S72 A;  3CD6 T;  3BY7 A;  3MP1 A;  2P0Q A;  1QVG A;  3CC2 T;  4A53 A;  1YJW A;  4N0A C;  3ASK A;  4ME7 A;  2RK2 A;  2QQS A;  3LW5 E;  1RI0 A;  4C0G A;  5GMK h;  1VQ5 A;  1AHJ B;  4PJO E;  3NFC A;  1YI2 A;  4X9D A;  1EIF A;  4OVA A;  4C8Q F;  5A0D A;  2Y4Y A;  2LDM A;  2JTM A;  4QQ6 A;  1Q7Y C;  1NE8 A;  2QXF A;  1K8A C;  5KE3 A;  1WJQ A;  3L2V A;  4QVD A;  1YIJ A;  3CCM T;  4XAX B;  3M56 A;  3V8J A;  1VQO A;  4JS5 A;  3CCE T;  3MEV A;  2HBP A;  3OS1 A;  4IKF A;  2OAU A;  2V8J A;  3I56 A;  3GPL A;  3VU3 C;  4C92 F;  2OTJ A;  3OYI A;  4PJO D;  2JVV A;  2MAM A;  1VQ9 T;  4X9C A;  2KSS A;  4M7A F;  2K5I A;  2HNI A;  1YJN A;  1VQM T;  4B9X A;  4E7I A;  1QVG S;  2X35 A;  5FU6 B;  2F5K A;  3HRT A;  3X26 B;  5LJ3 f;  2DIG A;  1U1S A;  5AYF A;  5CKE A;  4BB7 A;  4OB3 B;  3L2Q A;  3JAM E;  3CCL A;  3JCM e;  1YCY A;  3P8H A;  4JRQ A;  3V8L A;  2H3J A;  2JOY A;  3MET A;  4NS5 A;  3OYD A;  5D6X A;  1U1T A;  2FVU A;  2GQV A;  3X24 B;  4CI0 C;  2E41 A;  4X34 A;  3JCM Q;  3JB9 I;  2B8A A;  3CME A;  1S72 T;  2JTF A;  2MF2 A;  4M78 A;  4BI3 A;  3CMA A;  2RJE A;  4J6W A;  3LWI A;  3OMG A;  4N4H A;  2DD5 A;  4XU2 A;  3G71 T;  2E10 A;  2PVG B;  2XDB A;  5LJ3 d;  2HQE A;  1RL2 A;  3SWN A;  4RG2 A;  2XK0 A;  4N4I A;  3FLG A;  2EYQ A;  2YLC A;  1UGQ B;  2KMT A;  4FM4 B;  4JRI A;  4GY5 A;  1M90 U;  4M7D B;  4M78 B;  4OB2 B;  1X6O A;  2K5F A;  5C0M A;  3M9Q A;  4BE1 A;  2XIC A;  5GAM h;  3OMC A;  1X01 A;  3OA6 A;  1KD1 C;  3QKJ A;  4UC4 A;  4J6Y A;  2X4W A;  1N8R C;  2OTL A;  3SWN B;  1G5V A;  1BI0 A;  3BDU A;  4M78 C;  2RM4 A;  4RG8 A;  3G4S A;  3CBP A;  5GAN 4;  3VV0 A;  2KK4 A;  5CQY A;  4B9W A;  1YHQ A;  4PJO B;  1WPY A;  4OGC A;  3QDR B;  5LJ5 f;  4BUG A;  1O75 A;  4LDV A;  3OYC A;  3FEO A;  1I4K 1;  2EKO A;  4LDW A;  1XOV A;  1VQ8 T;  2KQW A;  4LD9 K;  1H64 1;  3H8Z A;  1KHI A;  4J5Y A;  2DZC A;  2MMP A;  3SDZ A;  3JCM h;  3NTI A;  3VYG A;  3E1S A;  3JRZ A;  2QEX T;  2L5Q A;  4ZGE B;  1BKB A;  3OBW A;  4BE2 A;  3GIB A;  4C8Q C;  2ZPH B;  2LVM A;  4L5G A;  3QYH B;  4PKC C;  2A3L A;  1VQ6 A;  2PU9 B;  3LH0 A;  2DO3 A;  4PNO A;  3SFM A;  3E9F A;  4IUR A;  4BY6 C;  4PLI A;  2XHC A;  5LJ5 d;  4EMG A;  4OB1 B;  1BIA A;  3V7S A;  5GAM f;  1VQ4 T;  4M78 G;  3CD6 A;  3HL8 A;  3OQ5 A;  2EWN A;  1XNI A;  4EMK A;  2WAC A;  3CC2 A;  3QO3 A;  1JJ2 S;  5FRM A;  3DB3 A;  1YJ9 T;  2PUO B;  4M7A C;  2E6N A;  5J3B A;  1FX7 A;  5GMK i;  1VQK T;  1WJS A;  3A8H B;  2PUK B;  3UT1 A;  2WSF E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...