4C92A

Crystal structure of the yeast lsm1-7 complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
130
structure length
130
Chain Sequence
TAAIVSSVDRKIFVLLRDGRMLFGVLRTFDQYANLILQDCVERIYFSEENKYAEEDRGIFMIRGENVVMLGEVDIDKEDQPLEAMERIPFKEAWLTKQKNDEKRFKEETHKGKKMARHGIVYDFHKSDMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 36
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c92A00
4F7UB 4DQ2A 3JB9G 4M7AG 2RM4A 5LJ5d 3INZA 3JB9H 4C8QF 3FB9A 2DZ9A 4M77G 4N0AC 3SWNB 5GANg 2DJZA 2VC8A 4C8QA 3L1AA 4C92E 1LJOA 1X01A 1B34A 4EMKC 1U1TA 1WNLA 2YHTA 4RCCA 4XU2A 4M7DE 4PJOE 1Y96B 4X9CA 4M77B 2DXTA 1I4K1 2JN0A 3GIBA 1I81A 3RKWA 4NOYA 2DTOA 5GAN2 3SB2A 4C92C 4PJOG 1JRIA 3JCMf 1WQWA 5GMKi 2E65A 3BDUA 1KQ1A 3BW1A 3QHSA 4M7DG 5LJ3f 5GAOr 5GAN7 5GAMj 4M75C 3QUIA 3PGGA 5LJ5f 4F7UA 4PJOB 4XTXA 3JCMd 1I5LA 4M7AF 3JCMV 1I8FA 4JRIA 2ZGWA 1U1SA 3SWNA 5CAIA 5GAMf 3RESA 4EMHA 4Y91A 4V2SA 1HXDA 4M77F 3V8JA 2YLBA 3HFNA 4JLIA 3RIRA 3JB9D 1Y96A 5GAN3 4M7AD 5GAOn 2RA2A 1LOJA 2FB7A 4M7AB 4M77D 3JCMg 4J6YA 5GAMd 2DZCA 3JB9J 5GMKm 1TH7A 5GMKl 5LJ3g 5GAN8 4PJOF 1WPYA 4M75E 4J5YA 3V8LA 4EMKB 4X9DA 4EMGA 5LJ5g 3HSBA 4M7DF 4PJOA 3V7SA 2DKGA 2DTIA 2QTXA 4RCBA 4C92G 5GANe 3RERA 4PJOD 2DEQA 4C92D 2EWNA 4M78C 4M7DD 5GAMg 4M75G 1BIBA 3SWNC 4C92B 4XTUA 1M8VA 2HNIA 1HK9A 3JCMP 3FIFA 1KQ2A 4M7DB 4NL2A 4WF2A 4XU0A 1H641 3JB9F 4JUVA 2YLCA 3M4GA 5DY9A 4XTWA 4M7AA 2I2LA 5GANh 4C8QC 4HA8A 3BFMA 3JCMQ 2CGHA 5GAOp 4M77A 3L2ZA 4N0AA 2RD1A 4J6WA 1N9RA 4EMKA 5GAN4 2E10A 1N9SA 4F7UE 2RB6A 2DVEA 2EJGA 2VXFA 2DTHA 3V8KA 4M78E 1JBMA 3RKYA 4C92F 3EFRA 3AHUA 4HT9A 1D3BB 2EJFA 2DXUA 3JCMc 4C92A 4QVCA 2FYKA 3JCMW 4M7DA 4M75F 4F7UG 1MGQA 3VU3C 3V7RA 2EJ9A 3EFSA 4XU1A 3JCMe 4NL3A 4M78G 5LJ3e 1YCYA 2VXEA 4A53A 4C8QE 4M7AC 4M75D 2Y90A 4XTYA 2E41A 5LJ5e 5GMKe 4XU3A 1BIAA 4M78B 4HT8A 3QO3A 4M75B 4M77C 4JRKA 5GANj 3BY7A 3JCMX 4OP0A 4A54A 4C8QG 5GAMe 4XQ3A 3RKXA 1LNXA 3JCMh 5LJ3j 4XTZA 4C8QD 2EAYA 5LJ3h 1D3BA 4J6XA 1WQ7A 5GAN6 5LJ5j 5GANf 5GMKj 4C8QB 3JCMJ 3JCMb 4PJOC 1B34B 4PNOA 5I21A 5LJ5h 3RUXA 5GMKh 2E64A 1M5Q1 5GAN5 4M7DC 5GAOm 4MMKA 5GAOl 3JB9I 4F7UF 3V7CA 3QSUA 4M7AE 3HFOA 4M78F 4XTVA 4QVDA 5GAMh 5GANd 4MMLA 4M78A 4M77E 2K57A 4M75A 2E1HA 5LJ3d 5GAOq 4M78D 3FJPA
chains in the Genus database with same CATH superfamily
1D0ZA 4GLMA 3CCEQ 1UGRB 2PVDB 2A28A 3EG2A 1BB9A 3OBWA 1NBEB 2RN8A 2CUBA 5GMKi 1BCMA 2VYTA 2M1HA 4F17A 1VQMT 5FRMA 4PJOB 5AT1B 1MHNA 4N4IA 2VASA 3M0RA 1UHCA 1VUBA 3V8JA 1KG1A 1NEGA 3A8LB 3RIRA 4M7AD 1ABOA 1QP2A 1WXTA 2DZCA 1FXXA 2HKQB 1DJ7B 5IHIA 3J7AF 4PJOA 2EGAA 3V7SA 2QTXA 2ZCFB 4M7DD 4M75G 1WI7A 3CMAT 1WX6A 2D1XA 2J6KA 4HXJA 2ATCB 4FYYB 3G7ZA 1I0CA 1QVPA 4C0FA 1IREB 4BD3A 5GANh 3UPUA 5CKBA 1PM3A 1PRMC 1FYNA 3PVQA 2EQJA 3ZBDA 2E10A 3OYJA 4ZTFA 3D7SB 1QCNA 1S72A 1VQ6T 2DD4A 1MGQA 4XU1A 3EFSA 1JU5C 1RAAB 4C8QE 1VQPQ 2MOXA 3H8ZA 5KYUB 1RLQC 3JAME 1QVGS 2SRCA 4XQ3A 3M59A 2LRQA 3QYHB 1AWJA 5DM7R 3TVTA 2JS2A 1Q86U 2J7IA 1VQKQ 1W70A 2KYBA 3P8HA 4XTVA 4DOWA 2CP3A 4GLKA 4OMMA 1V1CA 1ZA2B 7AT1B 1QCOA 5KYUA 5LJ3d 3PMTA 1PHTA 3FB9A 1OZ3A 2J05A 3CCVT 2OTLQ 1CSKA 2VKNA 3UWNA 4II1A 1QVFA 2LX9A 4DOVA 1WQWA 2HAXA 2CYZB 1QVGA 3JCMd 3DLLA 2FEIA 4Q5WA 5CAIA 4LDXA 2RPNA 4EMHA 5HK3A 1YHQA 2L3RA 4BB7A 4IUQA 4JJCA 4DBFA 2FB7A 3JCMg 3TREA 2GTJA 1VIEA 2AZSA 4M75E 4FCYA 3META 3KFVA 3OYGA 2DKGA 2GBQA 1JJ2P 3CMAA 3I5SA 2MYSA 1K0XA 1M3AA 2K7AA 3FIFA 4Z89A 4HVVA 2KXDA 3M0QA 4KBMB 3CD6Q 2E4HA 4HA8A 3CMEA 1YJ9T 4M77A 1VOMA 1BI3A 5EG2A 4BUGA 1QWEA 3UT1A 4B9WA 1Q82C 2DL8A 4CC3A 1VQ6A 3RDVA 2EJ9A 1O75A 1VQ8Q 5IN1A 4IKFA 1D1CA 1E6HA 2CZ0B 3QWYA 4MZPA 2G6FX 5CR2A 1PD0A 1YI2Q 1OYXA 1AWXA 2JJ9A 1VQ5Q 2QA4T 4LDUA 3E9GA 1WFWA 2RI5A 5GANf 2FVUA 1BKBA 1RABB 2YRCA 2COWA 4F7UF 4E7ZA 1H92A 3X26B 2EQKA 3CQTA 4AT1B 4M78D 4BI4A 2M02A 3MEAA 2F2VA 1WHKA 2CZ6B 3LW5E 2O4XB 3CCVA 4XU2A 2JMAA 3E1SA 4FM4B 2V1QA 4QT7A 5GAOr 1UECA 2EYYA 3PNWC 4OGCA 4IUVA 3HRTA 1UGVA 4PLIA 2HL5C 2QQRA 4FIBA 1UE9A 2O4XA 2R58A 4V2SA 2RK1A 2YLBA 1TWBA 1QKXA 3CCUA 2K2VA 3GLXA 2YUOA 4JZ3A 4VUBA 1BK2A 2F5KA 2L3QA 5GAN8 1YJWT 2RHZA 4RTXA 3THKA 4EMGA 3EGXB 4C92G 2W0ZA 2RJEA 4C92D 3OSVA 1LPLA 1YITT 5FWCA 1KQ2A 4NL2A 1H641 4C0DC 2YLCA 2I2LA 3JSCA 1YJ9A 1FWZA 2PVOB 3H41A 4PFPA 2X4JA 2X9HA 3EGXA 4KGZB 2VXFA 1D0YA 2P84A 2RJCA 3AHUA 2L5QA 2COYA 4JJDA 2RI2A 2RJFA 3CCJT 3EG0A 3H6ZA 3U23A 1WGSA 1YCYA 4AMCA 4M7AC 3VYHB 1I5OB 4HCZA 3BY7A 1XQHA 1YJNQ 1RAEB 2BZ8A 3F70A 1GFDA 2QK0A 1T3SA 1QKWA 4C0DB 1M4ZA 5GAN6 3EG9B 3HHTB 2K5LA 4M7DC 3M4YA 5GAOl 3CCQT 4ATOA 1QP3A 4IUPA 3V7CA 1M9SA 1SKUB 1RI0A 5GAMh 1Q82U 3NHNA 4RTVA 1K9AA 5EC7A 3URGA 2DIQA 1Q86R 3HRSA 1KQSS 2WSEE 3EG9A 4RTTA 3EGUA 4RCCA 1E7OA 9ATCB 4OMNA 1OOTA 2CH4A 4A4GA 4JPBW 2K6DA 5I2MA 4B9XA 5FU6C 1HD3A 3PGGA 1KC8R 3PIOA 5CK9A 3T9NA 3JCMV 3X24B 1OI1A 5FWBA 5IT9E 3CC4Q 3I56T 2A36A 3QBYA 3G71Q 4C5GA 4ZGJB 3MP8A 2KMTA 5GAOn 1YJWA 1X2QA 4PJOF 1WPYA 3V8LA 1VYTA 4MDXA 4PFOA 5LJ5g 1XTDA 2OI3A 4O6JA 2KNBB 1AOJA 2CZ1B 2RQUA 3CCMT 5IXFA 1KQSA 2DM1A 2V1RA 3VS7A 1PC0A 3G6EA 2XDDA 4C5HA 2LQKA 2JUFA 3LGLA 1X43A 3L2ZA 5A2QE 1LVKA 4KULA 2PZ1A 2DTHA 3E9FA 2EQIA 3RKYA 3RMSA 1ZUKA 3CCJA 1K8AC 5I2SA 2BE7D 3SD4A 1X27A 1M3CA 2E41A 1PWTA 3MPUB 1GL5A 5GANj 3M57A 3ME9A 4J9DA 4L5GA 1GCQC 3S3OA 1UUEA 2XG8D 4ESRA 4JZ4A 1LNXA 2M16A 1WZOA 4JJBA 1WIEA 4FW2A 4FL6A 3J80E 3DB3A 5I21A 4BE1A 3WVEB 1JO8A 2DMOA 3QSUA 2P0PA 1KJWA 3TSZA 1WHHA 2L3SA 3CC7Q 1RAFB 2YT6A 2E1HA 3CPWP 4F7UB 3L2QA 2A37A 4M77G 1ZSZC 1WXBA 3SWNB 3OW2S 1Q95G 3I55Q 4E7IA 2LDMA 1RUWA 3EG1A 4NOYA 1PRLC 2QEXT 3DB4A 1RAGB 1Y07A 3G1JA 5IH2A 4F7UA 4XTXA 1A0NB 3GF5A 3SWNA 5GAMf 1VQ9T 1GBQA 4ZGDB 2CP2A 2QI2A 4JS4A 1LOJA 1KHCA 1BBZA 5FW9A 1ZSZB 2A3LA 1X6OA 2DLPA 3OYYA 2KBTA 4M78C 2JNGA 4BI8B 2E3IA 3CBPA 3HKSA 4IIMA 3OW2A 2V8JA 3M4GA 1I07A 1VQNA 1VQLQ 1C6VX 2MPXC 3FC3A 2EGEA 1R0BG 3A98A 4WCIA 4AFZC 4E7LA 5GAOp 2K3YA 4DBQA 1ZSZA 1MMDA 2YUPA 1M1GA 3REAB 2WACA 2HBWA 3QDFA 4F14A 3A8OB 2DXUA 3NTIA 3CXCP 3A5ZB 1JXOA 1TG0A 2HQHA 4XTYA 2PQWA 4M78B 1G5VA 4QQDA 1XOVA 3JCMh 4OB0B 3PIPA 1XNIA 4GY5A 1WQ7A 1Q86C 2B86A 5LJ5j 1AWWA 3CBMA 2D8HA 2IPOB 1IO6A 1MMAA 3OS2A 1S72T 1VQOA 4M78A 4M77E 2LNHB 3FJPA 3TSWA 2LQNA 1Q7YU 5FLXE 2EQUA 1KC8C 3INZA 3JB9H 2QGFB 4DEXA 2E5KA 2MIOA 2IIMA 4EMKC 2DL4A 4R56A 1QWFA 2JN0A 4Y92A 2QEXA 3RMQA 2DTOA 4MZMA 3REBB 3QIIA 1X6GA 2P0QA 2DRKA 3CC2Q 2PUKB 1YCSB 2OAWA 3G4SA 4M4ZA 3MJXA 3OYFA 1U1SA 2CT3A 5IXBA 1M27C 4OMLA 3EAEA 2JT4A 1WHGA 1W2BA 5GMKl 2OTJA 4EMKB 1VQMQ 1BCOA 1TXQA 2J06A 5GANe 2XD0A 2RQRA 1C0MA 2KR3A 2ABLA 2MI6A 4LDYA 2ESWA 1QCFA 4HCCA 4OMQA 4WTOB 4XTWA 3CCET 2KY9A 4JRPA 2KT1A 4K11A 1YHQT 2CGHA 1AZEA 1OZ2A 4KGXB 4EMKA 1Y71A 2DVEA 2FO0A 1UFFA 2JOYA 3TEEA 4Z88A 4KUDK 1QLYA 1OU8A 4ZN3A 4M75D 3CCST 2QAZA 3NGPA 5J3BA 3CCLA 1TUDA 2JM8A 3CMET 1R8OB 4N4HA 1RI9A 3JCMJ 3JCMb 1ZUUA 2HQXA 2ZPEB 3RNJA 3L2RA 2HKNA 2DVJA 4BACA 1TSFA 5HKCA 1XJWB 2DYBA 2D0NA 2K5IA 3MP6A 2XIDA 1Y96B 1G3YA 2LVMA 2A08A 2NUPB 2DNUA 2BKDN 3JCMf 1JRIA 2RJDA 3I5RA 3PFSA 5GAMj 1YIJQ 1VQ4T 1PG5B 2QDYB 4M7AF 1ZHIA 2WSFE 1KD1R 1N5ZA 1N8RR 3CCRQ 1Y96A 2LTOA 1JJ2S 2RHIA 2RA2A 3QZ9B 2HQEA 4KGVB 3OYHA 2DAQA 1KC8U 2XDPA 1Z9QA 4LDWA 4BDZA 5LJ3g 3NPFA 1VQ7Q 2BUDA 4M7DF 2KSSA 3OYBA 2KGTA 2DEQA 2EWNA 2RHXA 4FU6A 1WHJA 5KCHA 3KBGA 5A0LA 4PFZA 3GNFB 3CCEA 3DKMA 2HMAA 2GQIA 5CKFA 2D9TA 4J7IA 1ZBXA 1QVFP 2BE9B 4BDYA 2QQSA 3CCUT 2NUZA 2OTLT 3X25B 3QKJA 1IHVA 4PJLA 5FROA 3FRNA 4F7UG 3V7RA 2AK5A 4F16A 2KXCA 3CCSA 2DXCA 2KQWA 4DA4A 1VYVA 3QWXX 2EBPA 4JDSA 4QKUA 1X2KA 5I22A 2YRVA 3R6NA 5LJ5h 4PNOA 2EPDA 3M0TA 3OY9A 2KVQG 3OYCA 2HDAA 2RNAA 3M53A 4MMKA 5GAOm 1NLPC 1CKBA 4J9EA 3JB9I 5CO7A 3UATA 1FMKA 3QJYA 2VUBA 4O5VA 1HYOA 1NJIR 1GBRA 2GFUA 2NLUA 3M54A 1TS9A 2QA4Q 4N0AC 2O2OA 1G8XA 3OQ5A 2OX7A 2LZ6B 1JXMA 1Q7YR 2AKLA 1TU0B 4J8OA 1KQ1A 4LUDA 2NYSA 5GAN7 4TVRA 4D6WA 3OYNA 1WXUA 1VQ4A 2KYMA 3OS0A 2F2XA 2GF7A 2JTFA 2L2PA 1I8FA 1VQPA 4JRIA 1E6GA 1UTIA 5GAN3 2CDTA 2P4TA 4AG2C 2RO0A 2NWMA 2KI7A 2RMOA 1U5SA 1WHLA 4E7KA 1ZLMA 2KROA 3FEOA 3OMGA 4MZTA 2JTEA 4J5YA 2CP6A 1VQKA 1MUZA 1NLOC 2J6OA 2LCLA 1U3OA 1HSQA 1UGSB 2HZYA 4JUVA 4J9HA 1W4SA 3LX7A 1OX8A 4C8QC 2RI3A 4XK8E 3EFOB 4N0AA 2OTLA 3HP9A 4F7UE 2RB6A 3QXEB 2D0QB 2LJ3A 4PJNA 4RG8A 2X51A 5HK0A 1AWOA 4PLLA 2QG9B 1YITQ 4A4FA 1OV3A 2C0IA 5CKDA 2VV5A 1U06A 5I11A 3EFOA 1KHIA 4Z8AA 2DD5A 2ZPFB 3HRUA 2LMJA 2ZZDA 5GAMe 3JV3A 3G6ET 5LJ3j 1K76A 3UA6A 3A8GB 3M55A 4C8QB 5DLOA 1M5Q1 3OYDA 2EKHA 3BDLA 4FYWB 4M78F 2JTMA 4LE9A 2ENMA 3HL8A 3S6WA 5A0DA 1WJSA 3CD6A 5D6WA 2DERA 4DBHA 3QYGB 4D8KA 4C8QA 2V8IA 2YHTA 4X9CA 1N8RC 1M2OA 1I81A 5GJWB 3CCQQ 4HCBA 4PJOG 2E65A 4OMFB 2V8KA 1F1BB 1EX4A 1VQ8A 4M75C 5LJ5f 2EKOA 2XK0A 4XAXB 2KT8A 2NUTB 2CUDA 4IUTA 2ED1A 1YNZA 4ZN1A 1YI2A 1VQ5A 1TUCA 4FW1A 2RK2A 1CKAA 1ZX6A 1IHWA 1VIFA 3LWHA 4M7AB 1M2VB 1KK7A 4Z02A 4J7FA 2F2WA 2XICA 4BE2A 3QJ6A 1M1FA 4CC4B 4J9CA 2NUTA 4E7SA 4N4GA 2DPPB 2E5QA 4KUIA 1HK9A 3JCMP 4M7DB 4IUUA 3SDZA 3I56Q 3OYLA 1RACB 1UJYA 4M7AA 3OYKA 1M2VA 4J83A 1TOVA 1PSEA 2X3XD 5KYNA 3FDRA 3EHRA 3WXMB 4AFUC 2AHJB 1BU1A 3M56A 2Z0WA 2PNIA 1UHFA 3CCMQ 4M7DA 2FG0A 2CKKA 2DFUA 2FZKB 1H8KA 1RLPC 2LCSA 5FU6B 4FSXA 2F5TX 1NJIC 2J6FA 1VQNT 4PL6A 3OYIA 1MMGA 2X4XA 4C0GA 2EW3A 3M5AA 2DL7A 5LL6S 4GBQA 5GMKj 1B34B 3CEYA 2HCKA 2G3RA 1KQSP 1WLPB 3SEMA 3CBOA 2HSPA 2XKOC 3C12A 1Q7YC 2L89A 2AIRB 3VS5A 2XMFA 3OA6A 2DL5A 1IZ6A 2K4YA 3LGFA 1WHMA 3OYEA 3NTKA 4PJOE 3L1AA 4HKEA 1B34A 2OJ2A 2C06A 2MK5A 3VS0A 3VS1A 2HBPA 2GQVA 1I4K1 3CPFA 4J9GA 2KAFA 1NG2A 1P92A 2EIFA 1YWOA 1PCXA 2X4WA 4AG1C 2O88A 3DLMA 1VQOT 2ZGWA 1YWPA 5CVIA 3LH0A 1YJNA 3HFNA 1PNJA 4JLIA 5CQYA 4LD9K 4QQGA 3L2VA 4E6RA 4RG2A 1ZSGA 4DEYA 6AT1B 4M77D 2QASA 2RQVA 4J6YA 2LNVA 4ELZC 5GMKm 4ORZA 3QDRB 2R5AA 3A8HB 1KD1U 2DTIA 4RCBA 1K0SA 1B7TA 1N8RU 2JXBA 3OYAA 2ECZA 2QXFA 2K5FA 2CH4W 1VQ9Q 1BI1A 4XU0A 4RMOA 3G4ST 4UC4A 5FRNA 1GCQA 5GAN4 3I55T 1NYFA 3A8MB 4E47A 3L2WA 2EJGA 4AFQC 2MMPA 2PU9B 3VUZA 2OTJT 2HSEB 2CT4A 4CC7A 3OBYA 3JCMe 2LC4A 1M90U 5A0GA 1KSWA 5L23A 3CC4A 3G71A 1UGPB 1BIAA 1TTHB 2XDBA 3RR6A 2XU8A 4FSSA 3H0IA 3Q1JA 2JM9A 1M8MA 5LJ3h 1JEGA 2K3BA 4E7HA 1M1KR 3P8DA 2LQWA 4ANJA 3OW2P 1IXDA 3ULRB 3PTAA 4J9IA 1Q81R 1RADB 2QGGA 3JB9G 2GGRA 4OB3B 3L2UA 4JLGA 2DJZA 3ZFJA 1X01A 4A63B 3CCLT 1NZ9A 4C5IA 1NJIU 3H9NA 4C92C 2VGMA 4OGEA 3BW1A 3EHQA 2LT1A 1S72Q 3VJPA 1EZZB 4Y28E 4LD6A 3PT9A 5C0MA 4LN2A 2QQAA 3OS5A 1SRLA 2M9UA 2ROLA 2DYIA 3OSSC 3S3NA 5CKHA 3JB9J 2JW4A 1TH7A 1FX7A 2LCCA 2H3EB 1B3QA 1FMVA 3S3MA 1K1ZA 1K73R 2BZYA 3CC7A 4C92B 2H3JA 2X4YA 1GRIA 3JB9F 3UDCA 4JS5A 4RUGA 3I55A 8ATCB 2RQTA 3X28B 1N9SA 1N27A 2X35A 5HCKA 1ZA1B 2EJFA 2K3XA 4CRIA 4C92A 2FYKA 5KCOA 1AEYA 4PK4A 3PMIA 2ROTA 2VXEA 3H0FA 2E3HA 2Y90A 4LNPA 4LDVA 1K9MR 2EFIA 2JS0A 3LWIA 1W2BP 2CSIA 2P4RA 1YHQQ 2LX7A 2DBKA 3RKXA 2LJ1A 4FYXB 4XTZA 1X75C 1I1JA 2A7YA 2VVKA 1PKSA 3NFCA 1UB4A 1AD5A 5GMKh 1BYMA 1EIFA 4E2FB 2PUOB 1PKTA 1T0HA 3FLGA 2E12A 2GFAA 1PSFA 3CMAQ 2K57A 5CQXA 3CCSQ 1J3TA 2R5MA 4RTUA 1VQLA 4M7AG 1NM7A 2L8DA 2DIGA 3L42A 4C8QF 2AZVA 1BI2A 2CREA 1ARKA 3CMEQ 1WNLA 2KRNA 2MWOA 5D6YA 2FRWA 3GIBA 2C0OA 1OEBA 4D8DA 1MNEA 5GAN2 2QYZA 1SEMA 1G3TA 2V26A 4CI0C 2JVVA 3QHSA 2X3WD 4A4EA 1VQ6Q 5LJ3f 4M7DG 5D7UA 2DK3A 2K2MA 3QUIA 2I0NA 3P8BB 2QQ9A 5L8RE 1IRXA 1HXDA 4OVAA 1W1FA 2AKKA 2FRYA 2RQWA 3MEVA 2MAMA 1UEBA 4X1VA 4X9DA 1X6BA 5J26A 3RERA 3O8VA 1RL2A 2DA9A 4FYVB 1VQ4Q 3TQ7P 1QVFS 5FU7C 2FZCB 3NMZC 4OB2B 2L0AA 1R0CB 1VQPT 4BI3A 3I9QA 3RBBB 2LQ8A 1OPLA 3E19A 4MDWA 3CCVQ 2NUPA 1ACMB 4KRTA 1QQJA 1JBMA 3EFRA 4HT9A 3JCMc 2M0OA 4M75F 4J9FA 2O31A 2YWWA 4F04B 1M1KC 3MCAB 1VQKT 4E7JA 2O9SA 1YIJT 1WYXA 3GBQA 5LJ5e 1WJQA 2DL3A 3QZ5B 1Q81C 4M77C 4OMOA 5FU7B 3CCRT 2QQBA 1OULA 3CCUQ 1SPKA 2F69A 3EG3A 1M90R 2XHCA 1S1NA 1WDXA 1VQ7T 1VQMA 1AZGB 1VYUA 4J9BA 4M7AE 3HFOA 1QVGP 1C1AA 1D09B 4ZTJA 1H3HA 1LCKA 3C0CA 1JJ2A 2FL7A 3IQLA 1YJ9Q 2VC8A 3LYIA 1SHGA 1U1TA 4M7DE 4L59A 1Y0MA 2DJQA 4M77B 4EIKA 2HEQA 2PVGB 2KRMA 3RKWA 3VRZA 3M0PA 4CC2A 1X69A 3OS1A 2CP5A 3MO8A 2M0YA 1KFZA 1GXIE 3EGDB 3HPWA 2FHDA 1WA7A 1K73C 3CD6T 2KE9A 2EYZA 4RKUE 1WJRA 4BY6C 3VS4A 1UDLA 4IURA 1ZBJA 2DBMA 3EGDA 1OPKA 4FT2A 2VWFA 1M8VA 1VQ8T 2HNIA 4QQ6A 2KK4A 2ZPBB 4L6V5 3BFMA 1BI0A 3VS6A 3JCMQ 1YI2T 2YUNA 1VQ5T 1K9MC 1YP5A 4J6WA 1K8AR 3VKIA 2YRDA 2O9VA 1RAIB 3QG1A 2YUQA 2LP5A 1V29B 2GTOA 3O5ZA 4QVCA 2L3PA 1Z9ZA 1D1AA 4JJNK 1YIJA 4KH0B 5IHKA 2LT4A 4M78G 5J39A 1ZQ1A 4BY6B 3TU4K 2WSCE 4KH1B 1AHJB 3UA7A 3ER0A 3CCRA 3JCMX 3OB9A 2EVRA 1YJWQ 1VQ7A 5GJVB 8AT1B 2YXYA 2E64A 5HY6A 2DILA 2RF0A 4QVDA 5GANd 1YBYA 3TCJA 3LLRA 2LJ0A 2HD0A 5KYXB 3MEWA 1M1KU 3G6EQ 5GANg 2PTKA 1EFNA 1Q81U 2DXTA 3BE3A 1FMWA 3UF4A 3BDUA 5KYXA 1K4US 1GCPA 3CCJQ 3MP1A 1Y57A 2BZXA 2D8JA 4NS5A 3OMCA 4ELYC 1M30A 1YFNA 2ZAEA 2KEAA 1MNDA 3VYGA 1OQKA 5KE3A 1UG1A 1KD1C 2KDSA 4LUEA 1N6AA 5ECAA 4PJOD 4AFSC 2DE0X 4XTUA 1SRMA 2M51A 1RAHB 4WF2A 1SSFA 2QA4A 5DY9A 4IIOA 3C95A 2YDLA 5M9OA 1YJNT 1MV3A 4ZGEB 2RD1A 5CCAA 1K73U 2FPFA 4QVZA 3AT1B 4M78E 2DX1A 4C92F 3N5BB 4EDUA 1M90C 4DBRA 2ZPHB 1D0XA 4HVUA 3EH1A 3M9QA 2AT1B 4M75B 1KIKA 4JRKA 3KXTA 2EQMA 3QPHA 2GNCA 2ED0A 3A1PA 3C94A 3RUXA 5GAN5 1K9MU 2E6ZA 1G2BA 2F1LA 1UGQB 4M75A 3ZL7C 1TUGB 1YN8A 4DQ2A 5LJ5d 1Y7XA 1VQNQ 3CC4T 3G71T 2DZ9A 2QTVA 1HJDA 2B8AA 1NPRA 4KT0E 4C92E 1LJOA 2JZ2A 2RHUA 3CPWS 3OYMA 3SB2A 5AYFA 4RTWA 3JRZA 1YITA 1NYGA 3I35A 1I5LA 4ME7A 2JMCA 2CS7A 1U8RA 2HL3A 2D6FA 2C0TA 4C0ZA 2VGNA 3E2UA 4YTLA 5CKEA 5IHNA 1UJ0A 2FPDA 2SEMA 1W6XA 3M0SA 4EPCA 4RTZA 3WVDB 4B6MA 1IGQA 1MV0B 2O01E 2RHYA 3VUBA 1B07A 1AT1B 1BIBA 3SWNC 1VQOQ 1R77A 1JQQA 1GFCA 4OMPA 1SSHA 2CSQA 2QDLA 2FZGB 3J81E 2DEUA 4A4HA 5KH6A 1V76A 3CPWA 3VV0A 1N9RA 1OX9A 2H8HA 3H0HA 3CCQA 2RH2A 2W10A 2QEXQ 2BIVA 5D6XA 3GPLA 1ABQA 1QMCA 1SHFA 2IG0A 3JCMW 4OF1A 2VB6A 4OB1B 3VS2A 5LJ3e 1NE8A 2YSQA 3G4SQ 3CC7T 3NTHA 3CC2A 4HT8A 2K9GA 5KE2A 3R6OA 3ZEHA 3CXCS 1VA7A 1NPPA 2EAYA 4X34A 5KYYB 4J6XA 2ZPIB 1O9SA 2OTJQ 3LH5A 2E70A 1G3SA 3VRYA 5IAYA 3M0UA 2MCNA 3VS3A 3I56A 3X20B 4P5NA 1QW1A 1ZUYA 2RM4A 5C6SA 5KYYA 2BTTA 5KYWB 2XI9A 2CP0A 4PJMA 3KUFA 2Y4YA 2A0FB 1NEBA 4JRQA 3CCMA 4C5EA 3SHWA 2OAUA 3MKDA 3SFMA 1SF9A 3CXCA 5KYWA 3EH2A 3RESA 4Y91A 4QW2A 4M77F 4BE0A 2EYXA 1VQLT 2DRMA 3FJ5A 3JB9D 3CCLQ 3M58A 4LXCA 3GP8A 2GCXA 5GAMd 2MWPA 2FPEA 3HSBA 2COZA 1G83A 4PJJA 2EYWA 5GAMg 4A4KA 4ZNXA 2KRSA 1M3BA 1T0JA 1PD1A 1IGUA 4RTYA 1MMNA 2Y4XA 3GOXA 3V8KA 1W2BS 4R0KA 1H3ZA 1D3BB 1AVZC 2IVWA 2DXBA 2EYQA 4HVWA 3VU3C 2DO3A 2ZPGB 4NL3A 3MEUA 1G3WA 1OU9A 4A53A 2K79A 1D1BA 1K8AU 2MF2A 2DETA 2EGCA 5GMKe 4XU3A 3QO3A 1IB8A 2CP7A 4OP0A 3GNGA 3HTRA 1Q82R 4A54A 2E6NA 4C8QG 1SG5A 4PKCC 4C8QD 1D3BA 3MHXA 4FT4A 4PJOC 1T3LA 3PVLA 4R55A 3ASKA 2DF6A 3C4SA 3PE0A 1JB0E 4HCKA 5CIUA 5DLQE 4MMLA 2R57A 3CC2T 1VQ9A 2CZ7B 5GAOq 2P0KA
chains in the Genus database with same CATH topology
3S6WA 4F7UB 1WJSA 5A0DA 3CD6A 3L2QA 5D6WA 1UGRB 2PVDB 4M77G 3SWNB 3QYGB 2VC8A 4C8QA 3LYIA 3OW2S 2V8IA 1U1TA 4E7IA 2YHTA 4M7DE 4L59A 2LDMA 3OBWA 4X9CA 1N8RC 4M77B 4ATOA 1I81A 2PVGB 3RKWA 4NOYA 4HCBA 2QEXT 4PJOG 3DB4A 5GMKi 2E65A 4OMFB 2V8KA 2VYTA 4M7DB 1Y07A 2M1HA 1VQMT 3OS1A 1VQ8A 5FRMA 4M75C 5LJ5f 2EKOA 4F7UA 4PJOB 2XK0A 4XAXB 3MO8A 4XTXA 1GXIE 3GF5A 1MHNA 4IUTA 3HPWA 3SWNA 4N4IA 4ZN1A 5GAMf 2FHDA 1VQ9T 1YI2A 1VUBA 3V8JA 1K73C 1VQ5A 1KG1A 2RK2A 3A8LB 3RIRA 3CD6T 4ZGDB 4M7AD 2QI2A 4JS4A 1VIFA 3LWHA 1QP2A 1LOJA 4M7AB 1KHCA 2DZCA 1FXXA 4Z02A 4RKUE 1DJ7B 4J7FA 2A3LA 2XICA 1WJRA 1X6OA 3OYYA 3V7SA 4BY6C 2QTXA 4BE2A 3QJ6A 1M1FA 4PJOA 2ZCFB 4IURA 4N4GA 4M78C 2DPPB 4M7DD 2JNGA 2E5QA 4FT2A 4M75G 1M8VA 1VQ8T 3CMAT 4BI8B 3HKSA 3CBPA 2HNIA 1HK9A 4KUIA 3OW2A 4IUUA 3SDZA 3JCMP 4QQ6A 2V8JA 3OYLA 3M4GA 1VQNA 3G7ZA 2KK4A 1QVPA 2ZPBB 4L6V5 1IREB 4BD3A 4C0FA 5GANh 4J83A 5CKBA 3OYKA 3FC3A 3UPUA 1PSEA 3BFMA 1BI0A 3JCMQ 4E7LA 1YI2T 5GAOp 2EQJA 3FDRA 2K3YA 1VQ5T 1K9MC 4J6WA 3VKIA 3ZBDA 2E10A 1M1GA 3OYJA 3WXMB 2WACA 2AHJB 3M56A 4ZTFA 3QG1A 1V29B 3A8OB 2DXUA 3NTIA 1S72A 4QVCA 1VQ6T 4M7DA 4JJNK 2DD4A 1MGQA 3A5ZB 4XU1A 3EFSA 2CKKA 1YIJA 2LT4A 4M78G 5J39A 1ZQ1A 4BY6B 3TU4K 2WSCE 4C8QE 4XTYA 2PQWA 4M78B 1AHJB 5FU6B 3ER0A 3CCRA 3H8ZA 4FSXA 1G5VA 2F5TX 3JCMX 1NJIC 4QQDA 3JAME 3OB9A 1VQNT 1QVGS 4PL6A 3OYIA 1XOVA 2X4XA 4XQ3A 4OB0B 3JCMh 3PIPA 3M59A 4C0GA 2LRQA 1XNIA 3M5AA 4GY5A 1WQ7A 1Q86C 3QYHB 5LJ5j 1VQ7A 5LL6S 5GMKj 5DM7R 1B34B 3CEYA 3CBMA 2E64A 2G3RA 5HY6A 1Q86U 3CBOA 2XKOC 3P8HA 3C12A 1YBYA 4XTVA 3TCJA 3LLRA 4DOWA 4QVDA 2L89A 5GANd 2HD0A 4GLKA 4M78A 1VQOA 4M77E 1Q7YC 3MEWA 5LJ3d 3FJPA 3OA6A 1Q7YU 5FLXE 2EQUA 1M1KU 1KC8C 3INZA 3PMTA 1IZ6A 2K4YA 3LGFA 3JB9H 3FB9A 5GANg 3OYEA 3NTKA 1OZ3A 4EMKC 4PJOE 3L1AA 4HKEA 1B34A 4R56A 2C06A 3CCVT 2HBPA 1Q81U 2GQVA 2DXTA 1I4K1 2JN0A 2QEXA 3CPFA 3UWNA 3RMQA 2DTOA 4II1A 4MZMA 1QVFA 2LX9A 2KAFA 4DOVA 1WQWA 3QIIA 3BDUA 2CYZB 2HAXA 1P92A 2EIFA 3MP1A 2P0QA 2X4WA 2PUKB 3G4SA 3JCMd 3DLLA 4Q5WA 1QVGA 3DLMA 1VQOT 4NS5A 3OMCA 4ELYC 3OYFA 2ZGWA 1U1SA 5CAIA 4LDXA 4EMHA 5CVIA 5HK3A 1YHQA 3LH0A 1YJNA 3HFNA 2L3RA 4JLIA 3VYGA 5KE3A 3EAEA 5CQYA 4BB7A 4IUQA 4LD9K 4QQGA 3L2VA 4RG2A 2FB7A 2KDSA 4M77D 3JCMg 4J6YA 1W2BA 1KD1C 2LNVA 3TREA 1VIEA 4ELZC 5GMKm 5GMKl 3QDRB 2R5AA 2OTJA 4M75E 3A8HB 3META 4EMKB 1KD1U 3OYGA 2DKGA 2DTIA 4RCBA 5GANe 2XD0A 1N6AA 1N8RU 4PJOD 2MI6A 4LDYA 3OYAA 3CMAA 4XTUA 2QXFA 2K5FA 3FIFA 1BI1A 1SSFA 4WF2A 4XU0A 4RMOA 4HCCA 3G4ST 2QA4A 4KBMB 4XTWA 5DY9A 4UC4A 2KY9A 4JRPA 4HA8A 3C95A 3CCET 3CMEA 5M9OA 1YHQT 1YJ9T 2CGHA 1YJNT 4M77A 5FRNA 1OZ2A 1BI3A 2RD1A 5EG2A 4EMKA 4ZGEB 5GAN4 1Y71A 4BUGA 5CCAA 3I55T 3A8MB 1K73U 4E47A 3L2WA 3UT1A 2DVEA 2EJGA 4B9WA 1Q82C 2MMPA 2PU9B 4M78E 4QVZA 2JOYA 4C92F 3VUZA 3N5BB 1VQ6A 3TEEA 4EDUA 2OTJT 3HL8A 1M90C 3OBYA 2ZPHB 2EJ9A 1O75A 3JCMe 2LC4A 5IN1A 4IKFA 4KUDK 1M90U 2CZ0B 5A0GA 4MZPA 4ZN3A 4M75D 3M9QA 3CCST 3CC4A 3G71A 1UGPB 1BIAA 5CR2A 4M75B 2XDBA 4JRKA 5J3BA 2XU8A 1OYXA 3CCLA 2QA4T 3Q1JA 4LDUA 3KXTA 3E9GA 2EQMA 3QPHA 3OS2A 3CMET 1R8OB 5LJ3h 4N4HA 2RI5A 3C94A 5GANf 4E7HA 3JCMJ 2FVUA 3JCMb 1S72T 1BKBA 3RUXA 5GAN5 3P8DA 1K9MU 2HQXA 2ZPEB 4F7UF 2E6ZA 3X26B 3L2RA 3PTAA 2EQKA 1UGQB 4M75A 4M78D 4BI4A 4DQ2A 3JB9G 3MEAA 5LJ5d 4BACA 1Y7XA 5HKCA 3CC4T 4OB3B 3G71T 2DZ9A 2CZ6B 2B8AA 3L2UA 4JLGA 2DJZA 3ZFJA 1NPRA 3LW5E 2O4XB 1LJOA 1X01A 4KT0E 4C92E 3CCVA 2K5IA 3MP6A 4XU2A 2XIDA 3CCLT 2JZ2A 1Y96B 1G3YA 1NZ9A 2LVMA 4C5IA 1NJIU 2RHUA 3CPWS 3E1SA 3OYMA 3SB2A 2VGMA 2BKDN 5AYFA 1JRIA 4FM4B 3JCMf 4C92C 2RJDA 3BW1A 4OGEA 2LT1A 5GAOr 3PFSA 3JRZA 5GAMj 1YITA 3VJPA 3PNWC 4OGCA 4LD6A 4Y28E 4IUVA 3PT9A 1VQ4T 2QDYB 3HRTA 1I5LA 4ME7A 4M7AF 1ZHIA 2WSFE 4PLIA 2QQRA 5C0MA 4FIBA 2CS7A 2O4XA 2R58A 2QQAA 1U8RA 4V2SA 2RK1A 2YLBA 2D6FA 3OS5A 2M9UA 1Y96A 2LTOA 4C0ZA 1JJ2S 2RHIA 3CCUA 2RA2A 2VGNA 2HQEA 3QZ9B 2K2VA 3OSSC 3GLXA 3OYHA 4VUBA 5CKEA 4YTLA 2DAQA 3S3NA 2XDPA 5CKHA 4LDWA 2F5KA 1TH7A 1FX7A 2LCCA 5LJ3g 5GAN8 4BDZA 3JB9J 1YJWT 2RHZA 2BUDA 4EMGA 4M7DF 2KSSA 4M7AA 4EPCA 3OYBA 4C92G 2RJEA 3WVDB 3S3MA 2DEQA 4C92D 3OSVA 2EWNA 2RHYA 2O01E 2RHXA 3VUBA 4FU6A 3CC7A 1BIBA 3SWNC 4C92B 2H3JA 5KCHA 2X4YA 3KBGA 1YITT 5A0LA 1KQ2A 4NL2A 3JB9F 1H641 3UDCA 4C0DC 2YLCA 3GNFB 3J81E 3DKMA 3CCEA 4A4HA 4JS5A 2I2LA 5KH6A 3JSCA 3S3OA 1YJ9A 3CPWA 5CKFA 3I55A 1FWZA 2PVOB 3VV0A 2D9TA 4J7IA 1ZBXA 2X4JA 1N9RA 4BDYA 3X28B 2QQSA 3CCUT 1N9SA 2OTLT 2VXFA 1N27A 3X25B 2X35A 3QKJA 3CCQA 2RH2A 2BIVA 2RJCA 5D6XA 2L5QA 3GPLA 3AHUA 2EJFA 2K3XA 4CRIA 2RI2A 2IG0A 4C92A 2FYKA 5KCOA 3JCMW 4OF1A 5FROA 3FRNA 2RJFA 4F7UG 3CCJT 3V7RA 4OB1B 3PMIA 3H6ZA 3CCSA 5LJ3e 1WGSA 1YCYA 2VXEA 2DXCA 1NE8A 2KQWA 4M7AC 2Y90A 3VYHB 3CC7T 4LDVA 4DA4A 2EFIA 4HCZA 3NTHA 3LWIA 3CC2A 4HT8A 3BY7A 1XQHA 5KE2A 3F70A 3R6OA 3ZEHA 3CXCS 4JDSA 3RKXA 4XTZA 1NPPA 2EAYA 4X34A 4C0DB 1M4ZA 1X75C 5GAN6 4J6XA 2YRVA 2ZPIB 3HHTB 2A7YA 1O9SA 2K5LA 4PNOA 3NFCA 1UB4A 5GMKh 5LJ5h 3OY9A 2KVQG 3OYCA 4M7DC 2E70A 3M53A 3M4YA 4MMKA 1G3SA 5GAOl 1QP3A 5GAOm 3JB9I 4IUPA 3V7CA 1M9SA 1EIFA 5CO7A 5IAYA 1BYMA 2PUOB 1RI0A 3QJYA 5GAMh 2VUBA 1Q82U 3FLGA 2E12A 2GFAA 1PSFA 4O5VA 2K57A 5CQXA 2GFUA 3I56A 3X20B 4P5NA 2R5MA 2NLUA 3M54A 1VQLA 3URGA 1QW1A 4M7AG 2DIQA 2RM4A 2L8DA 5C6SA 3HRSA 2DIGA 3L42A 4C8QF 1KQSS 2WSEE 2XI9A 4N0AC 1BI2A 1WNLA 2MWOA 4RCCA 5D6YA 3OQ5A 3KUFA 3GIBA 2Y4YA 4A4GA 5GAN2 4J8OA 4JRQA 1G3TA 4CI0C 3CCMA 1KQ1A 2JVVA 3QHSA 4M7DG 4A4EA 5I2MA 5LJ3f 4B9XA 4C5EA 5GAN7 4TVRA 5FU6C 2DK3A 4D6WA 3OYNA 3QUIA 1VQ4A 3PGGA 2OAUA 3SFMA 3PIOA 5CK9A 3OS0A 2GF7A 2JTFA 2QQ9A 3P8BB 3T9NA 1I8FA 5L8RE 4JRIA 3JCMV 3CXCA 1VQPA 3X24B 1OI1A 3RESA 5IT9E 4Y91A 3QBYA 4QW2A 1HXDA 4M77F 4OVAA 4C5GA 4ZGJB 3I56T 4BE0A 1VQLT 3MP8A 3JB9D 5GAN3 2KMTA 5GAOn 2P4TA 3M58A 2RO0A 3GP8A 2GCXA 1YJWA 5GAMd 4E7KA 3MEVA 2MAMA 3OMGA 1UEBA 3FEOA 4MZTA 4PJOF 1WPYA 2MWPA 4J5YA 3V8LA 4MDXA 4X9DA 5LJ5g 3HSBA 1XTDA 5J26A 3RERA 1VQKA 4O6JA 3O8VA 1RL2A 1KC8U 2CZ1B 2LCLA 3CCMT 5GAMg 1KQSA 1QVFS 1UGSB 5FU7C 3J7AF 4A4KA 4JUVA 4OB2B 1W4SA 3LX7A 3G6EA 2XDDA 1VQPT 4BI3A 4C5HA 4C8QC 2LQKA 2RI3A 2JUFA 4XK8E 3LGLA 2LQ8A 2Y4XA 3L2ZA 4N0AA 3E19A 4KULA 4MDWA 5A2QE 2OTLA 3HP9A 3GOXA 4F7UE 3CCQT 2RB6A 3V8KA 2DTHA 3QXEB 3E9FA 2D0QB 1JBMA 3RKYA 3RMSA 3EFRA 1W2BS 4RG8A 1D3BB 4HT9A 1H3ZA 3JCMc 2IVWA 3CCJA 1K8AC 2DXBA 2EYQA 2M0OA 4M75F 5I2SA 5HK0A 3SD4A 2DO3A 2ZPGB 3MCAB 4PLLA 3VU3C 4E7JA 4NL3A 3MEUA 4A4FA 1M1KC 1VQKT 1G3WA 1YIJT 4A53A 1K8AU 5CKDA 2MF2A 2VV5A 2E41A 5LJ5e 5GMKe 1WJQA 4XU3A 1KHIA 3QO3A 3QZ5B 2DD5A 1Q81C 4M77C 5GANj 2ZPFB 3M57A 3GNGA 3ME9A 4L5GA 4OP0A 5FU7B 2XG8D 4A54A 3CCRT 3HRUA 2ZZDA 2E6NA 4C8QG 2QQBA 4PKCC 5GAMe 3G6ET 1LNXA 2F69A 5LJ3j 2M16A 4C8QD 2FL7A 2XHCA 1D3BA 3MHXA 4FT4A 3A8GB 3M55A 4C8QB 4FL6A 3J80E 3DB3A 4PJOC 5I21A 4R55A 5DLOA 1VQ7T 1M5Q1 3OYDA 1VQMA 3ASKA 3C4SA 4BE1A 3BDLA 3WVEB 3QSUA 1JB0E 4M7AE 3HFOA 5CIUA 4M78F 2P0PA 5DLQE 2JTMA 4MMLA 4ZTJA 2R57A 3CC2T 1JJ2A 2CZ7B 2E1HA 1VQ9A 5GAOq 2P0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7U B;  4DQ2 A;  3JB9 G;  4M7A G;  2RM4 A;  5LJ5 d;  3INZ A;  3JB9 H;  4C8Q F;  3FB9 A;  2DZ9 A;  4M77 G;  4N0A C;  3SWN B;  5GAN g;  2DJZ A;  2VC8 A;  4C8Q A;  3L1A A;  4C92 E;  1LJO A;  1X01 A;  1B34 A;  4EMK C;  1U1T A;  1WNL A;  2YHT A;  4RCC A;  4XU2 A;  4M7D E;  4PJO E;  1Y96 B;  4X9C A;  4M77 B;  2DXT A;  1I4K 1;  2JN0 A;  3GIB A;  1I81 A;  3RKW A;  4NOY A;  2DTO A;  5GAN 2;  3SB2 A;  4C92 C;  4PJO G;  1JRI A;  3JCM f;  1WQW A;  5GMK i;  2E65 A;  3BDU A;  1KQ1 A;  3BW1 A;  3QHS A;  4M7D G;  5LJ3 f;  5GAO r;  5GAN 7;  5GAM j;  4M75 C;  3QUI A;  3PGG A;  5LJ5 f;  4F7U A;  4PJO B;  4XTX A;  3JCM d;  1I5L A;  4M7A F;  3JCM V;  1I8F A;  4JRI A;  2ZGW A;  1U1S A;  3SWN A;  5CAI A;  5GAM f;  3RES A;  4EMH A;  4Y91 A;  4V2S A;  1HXD A;  4M77 F;  3V8J A;  2YLB A;  3HFN A;  4JLI A;  3RIR A;  3JB9 D;  1Y96 A;  5GAN 3;  4M7A D;  5GAO n;  2RA2 A;  1LOJ A;  2FB7 A;  4M7A B;  4M77 D;  3JCM g;  4J6Y A;  5GAM d;  2DZC A;  3JB9 J;  5GMK m;  1TH7 A;  5GMK l;  5LJ3 g;  5GAN 8;  4PJO F;  1WPY A;  4M75 E;  4J5Y A;  3V8L A;  4EMK B;  4X9D A;  4EMG A;  5LJ5 g;  3HSB A;  4M7D F;  4PJO A;  3V7S A;  2DKG A;  2DTI A;  2QTX A;  4RCB A;  4C92 G;  5GAN e;  3RER A;  4PJO D;  2DEQ A;  4C92 D;  2EWN A;  4M78 C;  4M7D D;  5GAM g;  4M75 G;  1BIB A;  3SWN C;  4C92 B;  4XTU A;  1M8V A;  2HNI A;  1HK9 A;  3JCM P;  3FIF A;  1KQ2 A;  4M7D B;  4NL2 A;  4WF2 A;  4XU0 A;  1H64 1;  3JB9 F;  4JUV A;  2YLC A;  3M4G A;  5DY9 A;  4XTW A;  4M7A A;  2I2L A;  5GAN h;  4C8Q C;  4HA8 A;  3BFM A;  3JCM Q;  2CGH A;  5GAO p;  4M77 A;  3L2Z A;  4N0A A;  2RD1 A;  4J6W A;  1N9R A;  4EMK A;  5GAN 4;  2E10 A;  1N9S A;  4F7U E;  2RB6 A;  2DVE A;  2EJG A;  2VXF A;  2DTH A;  3V8K A;  4M78 E;  1JBM A;  3RKY A;  4C92 F;  3EFR A;  3AHU A;  4HT9 A;  1D3B B;  2EJF A;  2DXU A;  3JCM c;  4C92 A;  4QVC A;  2FYK A;  3JCM W;  4M7D A;  4M75 F;  4F7U G;  1MGQ A;  3VU3 C;  3V7R A;  2EJ9 A;  3EFS A;  4XU1 A;  3JCM e;  4NL3 A;  4M78 G;  5LJ3 e;  1YCY A;  2VXE A;  4A53 A;  4C8Q E;  4M7A C;  4M75 D;  2Y90 A;  4XTY A;  2E41 A;  5LJ5 e;  5GMK e;  4XU3 A;  1BIA A;  4M78 B;  4HT8 A;  3QO3 A;  4M75 B;  4M77 C;  4JRK A;  5GAN j;  3BY7 A;  3JCM X;  4OP0 A;  4A54 A;  4C8Q G;  5GAM e;  4XQ3 A;  3RKX A;  1LNX A;  3JCM h;  5LJ3 j;  4XTZ A;  4C8Q D;  2EAY A;  5LJ3 h;  1D3B A;  4J6X A;  1WQ7 A;  5GAN 6;  5LJ5 j;  5GAN f;  5GMK j;  4C8Q B;  3JCM J;  3JCM b;  4PJO C;  1B34 B;  4PNO A;  5I21 A;  5LJ5 h;  3RUX A;  5GMK h;  2E64 A;  1M5Q 1;  5GAN 5;  4M7D C;  5GAO m;  4MMK A;  5GAO l;  3JB9 I;  4F7U F;  3V7C A;  3QSU A;  4M7A E;  3HFO A;  4M78 F;  4XTV A;  4QVD A;  5GAM h;  5GAN d;  4MML A;  4M78 A;  4M77 E;  2K57 A;  4M75 A;  2E1H A;  5LJ3 d;  5GAO q;  4M78 D;  3FJP A; 
#chains in the Genus database with same CATH topology
 1D0Z A;  4GLM A;  3CCE Q;  1UGR B;  2PVD B;  2A28 A;  3EG2 A;  1BB9 A;  3OBW A;  1NBE B;  2RN8 A;  2CUB A;  5GMK i;  1BCM A;  2VYT A;  2M1H A;  4F17 A;  1VQM T;  5FRM A;  4PJO B;  5AT1 B;  1MHN A;  4N4I A;  2VAS A;  3M0R A;  1UHC A;  1VUB A;  3V8J A;  1KG1 A;  1NEG A;  3A8L B;  3RIR A;  4M7A D;  1ABO A;  1QP2 A;  1WXT A;  2DZC A;  1FXX A;  2HKQ B;  1DJ7 B;  5IHI A;  3J7A F;  4PJO A;  2EGA A;  3V7S A;  2QTX A;  2ZCF B;  4M7D D;  4M75 G;  1WI7 A;  3CMA T;  1WX6 A;  2D1X A;  2J6K A;  4HXJ A;  2ATC B;  4FYY B;  3G7Z A;  1I0C A;  1QVP A;  4C0F A;  1IRE B;  4BD3 A;  5GAN h;  3UPU A;  5CKB A;  1PM3 A;  1PRM C;  1FYN A;  3PVQ A;  2EQJ A;  3ZBD A;  2E10 A;  3OYJ A;  4ZTF A;  3D7S B;  1QCN A;  1S72 A;  1VQ6 T;  2DD4 A;  1MGQ A;  4XU1 A;  3EFS A;  1JU5 C;  1RAA B;  4C8Q E;  1VQP Q;  2MOX A;  3H8Z A;  5KYU B;  1RLQ C;  3JAM E;  1QVG S;  2SRC A;  4XQ3 A;  3M59 A;  2LRQ A;  3QYH B;  1AWJ A;  5DM7 R;  3TVT A;  2JS2 A;  1Q86 U;  2J7I A;  1VQK Q;  1W70 A;  2KYB A;  3P8H A;  4XTV A;  4DOW A;  2CP3 A;  4GLK A;  4OMM A;  1V1C A;  1ZA2 B;  7AT1 B;  1QCO A;  5KYU A;  5LJ3 d;  3PMT A;  1PHT A;  3FB9 A;  1OZ3 A;  2J05 A;  3CCV T;  2OTL Q;  1CSK A;  2VKN A;  3UWN A;  4II1 A;  1QVF A;  2LX9 A;  4DOV A;  1WQW A;  2HAX A;  2CYZ B;  1QVG A;  3JCM d;  3DLL A;  2FEI A;  4Q5W A;  5CAI A;  4LDX A;  2RPN A;  4EMH A;  5HK3 A;  1YHQ A;  2L3R A;  4BB7 A;  4IUQ A;  4JJC A;  4DBF A;  2FB7 A;  3JCM g;  3TRE A;  2GTJ A;  1VIE A;  2AZS A;  4M75 E;  4FCY A;  3MET A;  3KFV A;  3OYG A;  2DKG A;  2GBQ A;  1JJ2 P;  3CMA A;  3I5S A;  2MYS A;  1K0X A;  1M3A A;  2K7A A;  3FIF A;  4Z89 A;  4HVV A;  2KXD A;  3M0Q A;  4KBM B;  3CD6 Q;  2E4H A;  4HA8 A;  3CME A;  1YJ9 T;  4M77 A;  1VOM A;  1BI3 A;  5EG2 A;  4BUG A;  1QWE A;  3UT1 A;  4B9W A;  1Q82 C;  2DL8 A;  4CC3 A;  1VQ6 A;  3RDV A;  2EJ9 A;  1O75 A;  1VQ8 Q;  5IN1 A;  4IKF A;  1D1C A;  1E6H A;  2CZ0 B;  3QWY A;  4MZP A;  2G6F X;  5CR2 A;  1PD0 A;  1YI2 Q;  1OYX A;  1AWX A;  2JJ9 A;  1VQ5 Q;  2QA4 T;  4LDU A;  3E9G A;  1WFW A;  2RI5 A;  5GAN f;  2FVU A;  1BKB A;  1RAB B;  2YRC A;  2COW A;  4F7U F;  4E7Z A;  1H92 A;  3X26 B;  2EQK A;  3CQT A;  4AT1 B;  4M78 D;  4BI4 A;  2M02 A;  3MEA A;  2F2V A;  1WHK A;  2CZ6 B;  3LW5 E;  2O4X B;  3CCV A;  4XU2 A;  2JMA A;  3E1S A;  4FM4 B;  2V1Q A;  4QT7 A;  5GAO r;  1UEC A;  2EYY A;  3PNW C;  4OGC A;  4IUV A;  3HRT A;  1UGV A;  4PLI A;  2HL5 C;  2QQR A;  4FIB A;  1UE9 A;  2O4X A;  2R58 A;  4V2S A;  2RK1 A;  2YLB A;  1TWB A;  1QKX A;  3CCU A;  2K2V A;  3GLX A;  2YUO A;  4JZ3 A;  4VUB A;  1BK2 A;  2F5K A;  2L3Q A;  5GAN 8;  1YJW T;  2RHZ A;  4RTX A;  3THK A;  4EMG A;  3EGX B;  4C92 G;  2W0Z A;  2RJE A;  4C92 D;  3OSV A;  1LPL A;  1YIT T;  5FWC A;  1KQ2 A;  4NL2 A;  1H64 1;  4C0D C;  2YLC A;  2I2L A;  3JSC A;  1YJ9 A;  1FWZ A;  2PVO B;  3H41 A;  4PFP A;  2X4J A;  2X9H A;  3EGX A;  4KGZ B;  2VXF A;  1D0Y A;  2P84 A;  2RJC A;  3AHU A;  2L5Q A;  2COY A;  4JJD A;  2RI2 A;  2RJF A;  3CCJ T;  3EG0 A;  3H6Z A;  3U23 A;  1WGS A;  1YCY A;  4AMC A;  4M7A C;  3VYH B;  1I5O B;  4HCZ A;  3BY7 A;  1XQH A;  1YJN Q;  1RAE B;  2BZ8 A;  3F70 A;  1GFD A;  2QK0 A;  1T3S A;  1QKW A;  4C0D B;  1M4Z A;  5GAN 6;  3EG9 B;  3HHT B;  2K5L A;  4M7D C;  3M4Y A;  5GAO l;  3CCQ T;  4ATO A;  1QP3 A;  4IUP A;  3V7C A;  1M9S A;  1SKU B;  1RI0 A;  5GAM h;  1Q82 U;  3NHN A;  4RTV A;  1K9A A;  5EC7 A;  3URG A;  2DIQ A;  1Q86 R;  3HRS A;  1KQS S;  2WSE E;  3EG9 A;  4RTT A;  3EGU A;  4RCC A;  1E7O A;  9ATC B;  4OMN A;  1OOT A;  2CH4 A;  4A4G A;  4JPB W;  2K6D A;  5I2M A;  4B9X A;  5FU6 C;  1HD3 A;  3PGG A;  1KC8 R;  3PIO A;  5CK9 A;  3T9N A;  3JCM V;  3X24 B;  1OI1 A;  5FWB A;  5IT9 E;  3CC4 Q;  3I56 T;  2A36 A;  3QBY A;  3G71 Q;  4C5G A;  4ZGJ B;  3MP8 A;  2KMT A;  5GAO n;  1YJW A;  1X2Q A;  4PJO F;  1WPY A;  3V8L A;  1VYT A;  4MDX A;  4PFO A;  5LJ5 g;  1XTD A;  2OI3 A;  4O6J A;  2KNB B;  1AOJ A;  2CZ1 B;  2RQU A;  3CCM T;  5IXF A;  1KQS A;  2DM1 A;  2V1R A;  3VS7 A;  1PC0 A;  3G6E A;  2XDD A;  4C5H A;  2LQK A;  2JUF A;  3LGL A;  1X43 A;  3L2Z A;  5A2Q E;  1LVK A;  4KUL A;  2PZ1 A;  2DTH A;  3E9F A;  2EQI A;  3RKY A;  3RMS A;  1ZUK A;  3CCJ A;  1K8A C;  5I2S A;  2BE7 D;  3SD4 A;  1X27 A;  1M3C A;  2E41 A;  1PWT A;  3MPU B;  1GL5 A;  5GAN j;  3M57 A;  3ME9 A;  4J9D A;  4L5G A;  1GCQ C;  3S3O A;  1UUE A;  2XG8 D;  4ESR A;  4JZ4 A;  1LNX A;  2M16 A;  1WZO A;  4JJB A;  1WIE A;  4FW2 A;  4FL6 A;  3J80 E;  3DB3 A;  5I21 A;  4BE1 A;  3WVE B;  1JO8 A;  2DMO A;  3QSU A;  2P0P A;  1KJW A;  3TSZ A;  1WHH A;  2L3S A;  3CC7 Q;  1RAF B;  2YT6 A;  2E1H A;  3CPW P;  4F7U B;  3L2Q A;  2A37 A;  4M77 G;  1ZSZ C;  1WXB A;  3SWN B;  3OW2 S;  1Q95 G;  3I55 Q;  4E7I A;  2LDM A;  1RUW A;  3EG1 A;  4NOY A;  1PRL C;  2QEX T;  3DB4 A;  1RAG B;  1Y07 A;  3G1J A;  5IH2 A;  4F7U A;  4XTX A;  1A0N B;  3GF5 A;  3SWN A;  5GAM f;  1VQ9 T;  1GBQ A;  4ZGD B;  2CP2 A;  2QI2 A;  4JS4 A;  1LOJ A;  1KHC A;  1BBZ A;  5FW9 A;  1ZSZ B;  2A3L A;  1X6O A;  2DLP A;  3OYY A;  2KBT A;  4M78 C;  2JNG A;  4BI8 B;  2E3I A;  3CBP A;  3HKS A;  4IIM A;  3OW2 A;  2V8J A;  3M4G A;  1I07 A;  1VQN A;  1VQL Q;  1C6V X;  2MPX C;  3FC3 A;  2EGE A;  1R0B G;  3A98 A;  4WCI A;  4AFZ C;  4E7L A;  5GAO p;  2K3Y A;  4DBQ A;  1ZSZ A;  1MMD A;  2YUP A;  1M1G A;  3REA B;  2WAC A;  2HBW A;  3QDF A;  4F14 A;  3A8O B;  2DXU A;  3NTI A;  3CXC P;  3A5Z B;  1JXO A;  1TG0 A;  2HQH A;  4XTY A;  2PQW A;  4M78 B;  1G5V A;  4QQD A;  1XOV A;  3JCM h;  4OB0 B;  3PIP A;  1XNI A;  4GY5 A;  1WQ7 A;  1Q86 C;  2B86 A;  5LJ5 j;  1AWW A;  3CBM A;  2D8H A;  2IPO B;  1IO6 A;  1MMA A;  3OS2 A;  1S72 T;  1VQO A;  4M78 A;  4M77 E;  2LNH B;  3FJP A;  3TSW A;  2LQN A;  1Q7Y U;  5FLX E;  2EQU A;  1KC8 C;  3INZ A;  3JB9 H;  2QGF B;  4DEX A;  2E5K A;  2MIO A;  2IIM A;  4EMK C;  2DL4 A;  4R56 A;  1QWF A;  2JN0 A;  4Y92 A;  2QEX A;  3RMQ A;  2DTO A;  4MZM A;  3REB B;  3QII A;  1X6G A;  2P0Q A;  2DRK A;  3CC2 Q;  2PUK B;  1YCS B;  2OAW A;  3G4S A;  4M4Z A;  3MJX A;  3OYF A;  1U1S A;  2CT3 A;  5IXB A;  1M27 C;  4OML A;  3EAE A;  2JT4 A;  1WHG A;  1W2B A;  5GMK l;  2OTJ A;  4EMK B;  1VQM Q;  1BCO A;  1TXQ A;  2J06 A;  5GAN e;  2XD0 A;  2RQR A;  1C0M A;  2KR3 A;  2ABL A;  2MI6 A;  4LDY A;  2ESW A;  1QCF A;  4HCC A;  4OMQ A;  4WTO B;  4XTW A;  3CCE T;  2KY9 A;  4JRP A;  2KT1 A;  4K11 A;  1YHQ T;  2CGH A;  1AZE A;  1OZ2 A;  4KGX B;  4EMK A;  1Y71 A;  2DVE A;  2FO0 A;  1UFF A;  2JOY A;  3TEE A;  4Z88 A;  4KUD K;  1QLY A;  1OU8 A;  4ZN3 A;  4M75 D;  3CCS T;  2QAZ A;  3NGP A;  5J3B A;  3CCL A;  1TUD A;  2JM8 A;  3CME T;  1R8O B;  4N4H A;  1RI9 A;  3JCM J;  3JCM b;  1ZUU A;  2HQX A;  2ZPE B;  3RNJ A;  3L2R A;  2HKN A;  2DVJ A;  4BAC A;  1TSF A;  5HKC A;  1XJW B;  2DYB A;  2D0N A;  2K5I A;  3MP6 A;  2XID A;  1Y96 B;  1G3Y A;  2LVM A;  2A08 A;  2NUP B;  2DNU A;  2BKD N;  3JCM f;  1JRI A;  2RJD A;  3I5R A;  3PFS A;  5GAM j;  1YIJ Q;  1VQ4 T;  1PG5 B;  2QDY B;  4M7A F;  1ZHI A;  2WSF E;  1KD1 R;  1N5Z A;  1N8R R;  3CCR Q;  1Y96 A;  2LTO A;  1JJ2 S;  2RHI A;  2RA2 A;  3QZ9 B;  2HQE A;  4KGV B;  3OYH A;  2DAQ A;  1KC8 U;  2XDP A;  1Z9Q A;  4LDW A;  4BDZ A;  5LJ3 g;  3NPF A;  1VQ7 Q;  2BUD A;  4M7D F;  2KSS A;  3OYB A;  2KGT A;  2DEQ A;  2EWN A;  2RHX A;  4FU6 A;  1WHJ A;  5KCH A;  3KBG A;  5A0L A;  4PFZ A;  3GNF B;  3CCE A;  3DKM A;  2HMA A;  2GQI A;  5CKF A;  2D9T A;  4J7I A;  1ZBX A;  1QVF P;  2BE9 B;  4BDY A;  2QQS A;  3CCU T;  2NUZ A;  2OTL T;  3X25 B;  3QKJ A;  1IHV A;  4PJL A;  5FRO A;  3FRN A;  4F7U G;  3V7R A;  2AK5 A;  4F16 A;  2KXC A;  3CCS A;  2DXC A;  2KQW A;  4DA4 A;  1VYV A;  3QWX X;  2EBP A;  4JDS A;  4QKU A;  1X2K A;  5I22 A;  2YRV A;  3R6N A;  5LJ5 h;  4PNO A;  2EPD A;  3M0T A;  3OY9 A;  2KVQ G;  3OYC A;  2HDA A;  2RNA A;  3M53 A;  4MMK A;  5GAO m;  1NLP C;  1CKB A;  4J9E A;  3JB9 I;  5CO7 A;  3UAT A;  1FMK A;  3QJY A;  2VUB A;  4O5V A;  1HYO A;  1NJI R;  1GBR A;  2GFU A;  2NLU A;  3M54 A;  1TS9 A;  2QA4 Q;  4N0A C;  2O2O A;  1G8X A;  3OQ5 A;  2OX7 A;  2LZ6 B;  1JXM A;  1Q7Y R;  2AKL A;  1TU0 B;  4J8O A;  1KQ1 A;  4LUD A;  2NYS A;  5GAN 7;  4TVR A;  4D6W A;  3OYN A;  1WXU A;  1VQ4 A;  2KYM A;  3OS0 A;  2F2X A;  2GF7 A;  2JTF A;  2L2P A;  1I8F A;  1VQP A;  4JRI A;  1E6G A;  1UTI A;  5GAN 3;  2CDT A;  2P4T A;  4AG2 C;  2RO0 A;  2NWM A;  2KI7 A;  2RMO A;  1U5S A;  1WHL A;  4E7K A;  1ZLM A;  2KRO A;  3FEO A;  3OMG A;  4MZT A;  2JTE A;  4J5Y A;  2CP6 A;  1VQK A;  1MUZ A;  1NLO C;  2J6O A;  2LCL A;  1U3O A;  1HSQ A;  1UGS B;  2HZY A;  4JUV A;  4J9H A;  1W4S A;  3LX7 A;  1OX8 A;  4C8Q C;  2RI3 A;  4XK8 E;  3EFO B;  4N0A A;  2OTL A;  3HP9 A;  4F7U E;  2RB6 A;  3QXE B;  2D0Q B;  2LJ3 A;  4PJN A;  4RG8 A;  2X51 A;  5HK0 A;  1AWO A;  4PLL A;  2QG9 B;  1YIT Q;  4A4F A;  1OV3 A;  2C0I A;  5CKD A;  2VV5 A;  1U06 A;  5I11 A;  3EFO A;  1KHI A;  4Z8A A;  2DD5 A;  2ZPF B;  3HRU A;  2LMJ A;  2ZZD A;  5GAM e;  3JV3 A;  3G6E T;  5LJ3 j;  1K76 A;  3UA6 A;  3A8G B;  3M55 A;  4C8Q B;  5DLO A;  1M5Q 1;  3OYD A;  2EKH A;  3BDL A;  4FYW B;  4M78 F;  2JTM A;  4LE9 A;  2ENM A;  3HL8 A;  3S6W A;  5A0D A;  1WJS A;  3CD6 A;  5D6W A;  2DER A;  4DBH A;  3QYG B;  4D8K A;  4C8Q A;  2V8I A;  2YHT A;  4X9C A;  1N8R C;  1M2O A;  1I81 A;  5GJW B;  3CCQ Q;  4HCB A;  4PJO G;  2E65 A;  4OMF B;  2V8K A;  1F1B B;  1EX4 A;  1VQ8 A;  4M75 C;  5LJ5 f;  2EKO A;  2XK0 A;  4XAX B;  2KT8 A;  2NUT B;  2CUD A;  4IUT A;  2ED1 A;  1YNZ A;  4ZN1 A;  1YI2 A;  1VQ5 A;  1TUC A;  4FW1 A;  2RK2 A;  1CKA A;  1ZX6 A;  1IHW A;  1VIF A;  3LWH A;  4M7A B;  1M2V B;  1KK7 A;  4Z02 A;  4J7F A;  2F2W A;  2XIC A;  4BE2 A;  3QJ6 A;  1M1F A;  4CC4 B;  4J9C A;  2NUT A;  4E7S A;  4N4G A;  2DPP B;  2E5Q A;  4KUI A;  1HK9 A;  3JCM P;  4M7D B;  4IUU A;  3SDZ A;  3I56 Q;  3OYL A;  1RAC B;  1UJY A;  4M7A A;  3OYK A;  1M2V A;  4J83 A;  1TOV A;  1PSE A;  2X3X D;  5KYN A;  3FDR A;  3EHR A;  3WXM B;  4AFU C;  2AHJ B;  1BU1 A;  3M56 A;  2Z0W A;  2PNI A;  1UHF A;  3CCM Q;  4M7D A;  2FG0 A;  2CKK A;  2DFU A;  2FZK B;  1H8K A;  1RLP C;  2LCS A;  5FU6 B;  4FSX A;  2F5T X;  1NJI C;  2J6F A;  1VQN T;  4PL6 A;  3OYI A;  1MMG A;  2X4X A;  4C0G A;  2EW3 A;  3M5A A;  2DL7 A;  5LL6 S;  4GBQ A;  5GMK j;  1B34 B;  3CEY A;  2HCK A;  2G3R A;  1KQS P;  1WLP B;  3SEM A;  3CBO A;  2HSP A;  2XKO C;  3C12 A;  1Q7Y C;  2L89 A;  2AIR B;  3VS5 A;  2XMF A;  3OA6 A;  2DL5 A;  1IZ6 A;  2K4Y A;  3LGF A;  1WHM A;  3OYE A;  3NTK A;  4PJO E;  3L1A A;  4HKE A;  1B34 A;  2OJ2 A;  2C06 A;  2MK5 A;  3VS0 A;  3VS1 A;  2HBP A;  2GQV A;  1I4K 1;  3CPF A;  4J9G A;  2KAF A;  1NG2 A;  1P92 A;  2EIF A;  1YWO A;  1PCX A;  2X4W A;  4AG1 C;  2O88 A;  3DLM A;  1VQO T;  2ZGW A;  1YWP A;  5CVI A;  3LH0 A;  1YJN A;  3HFN A;  1PNJ A;  4JLI A;  5CQY A;  4LD9 K;  4QQG A;  3L2V A;  4E6R A;  4RG2 A;  1ZSG A;  4DEY A;  6AT1 B;  4M77 D;  2QAS A;  2RQV A;  4J6Y A;  2LNV A;  4ELZ C;  5GMK m;  4ORZ A;  3QDR B;  2R5A A;  3A8H B;  1KD1 U;  2DTI A;  4RCB A;  1K0S A;  1B7T A;  1N8R U;  2JXB A;  3OYA A;  2ECZ A;  2QXF A;  2K5F A;  2CH4 W;  1VQ9 Q;  1BI1 A;  4XU0 A;  4RMO A;  3G4S T;  4UC4 A;  5FRN A;  1GCQ A;  5GAN 4;  3I55 T;  1NYF A;  3A8M B;  4E47 A;  3L2W A;  2EJG A;  4AFQ C;  2MMP A;  2PU9 B;  3VUZ A;  2OTJ T;  2HSE B;  2CT4 A;  4CC7 A;  3OBY A;  3JCM e;  2LC4 A;  1M90 U;  5A0G A;  1KSW A;  5L23 A;  3CC4 A;  3G71 A;  1UGP B;  1BIA A;  1TTH B;  2XDB A;  3RR6 A;  2XU8 A;  4FSS A;  3H0I A;  3Q1J A;  2JM9 A;  1M8M A;  5LJ3 h;  1JEG A;  2K3B A;  4E7H A;  1M1K R;  3P8D A;  2LQW A;  4ANJ A;  3OW2 P;  1IXD A;  3ULR B;  3PTA A;  4J9I A;  1Q81 R;  1RAD B;  2QGG A;  3JB9 G;  2GGR A;  4OB3 B;  3L2U A;  4JLG A;  2DJZ A;  3ZFJ A;  1X01 A;  4A63 B;  3CCL T;  1NZ9 A;  4C5I A;  1NJI U;  3H9N A;  4C92 C;  2VGM A;  4OGE A;  3BW1 A;  3EHQ A;  2LT1 A;  1S72 Q;  3VJP A;  1EZZ B;  4Y28 E;  4LD6 A;  3PT9 A;  5C0M A;  4LN2 A;  2QQA A;  3OS5 A;  1SRL A;  2M9U A;  2ROL A;  2DYI A;  3OSS C;  3S3N A;  5CKH A;  3JB9 J;  2JW4 A;  1TH7 A;  1FX7 A;  2LCC A;  2H3E B;  1B3Q A;  1FMV A;  3S3M A;  1K1Z A;  1K73 R;  2BZY A;  3CC7 A;  4C92 B;  2H3J A;  2X4Y A;  1GRI A;  3JB9 F;  3UDC A;  4JS5 A;  4RUG A;  3I55 A;  8ATC B;  2RQT A;  3X28 B;  1N9S A;  1N27 A;  2X35 A;  5HCK A;  1ZA1 B;  2EJF A;  2K3X A;  4CRI A;  4C92 A;  2FYK A;  5KCO A;  1AEY A;  4PK4 A;  3PMI A;  2ROT A;  2VXE A;  3H0F A;  2E3H A;  2Y90 A;  4LNP A;  4LDV A;  1K9M R;  2EFI A;  2JS0 A;  3LWI A;  1W2B P;  2CSI A;  2P4R A;  1YHQ Q;  2LX7 A;  2DBK A;  3RKX A;  2LJ1 A;  4FYX B;  4XTZ A;  1X75 C;  1I1J A;  2A7Y A;  2VVK A;  1PKS A;  3NFC A;  1UB4 A;  1AD5 A;  5GMK h;  1BYM A;  1EIF A;  4E2F B;  2PUO B;  1PKT A;  1T0H A;  3FLG A;  2E12 A;  2GFA A;  1PSF A;  3CMA Q;  2K57 A;  5CQX A;  3CCS Q;  1J3T A;  2R5M A;  4RTU A;  1VQL A;  4M7A G;  1NM7 A;  2L8D A;  2DIG A;  3L42 A;  4C8Q F;  2AZV A;  1BI2 A;  2CRE A;  1ARK A;  3CME Q;  1WNL A;  2KRN A;  2MWO A;  5D6Y A;  2FRW A;  3GIB A;  2C0O A;  1OEB A;  4D8D A;  1MNE A;  5GAN 2;  2QYZ A;  1SEM A;  1G3T A;  2V26 A;  4CI0 C;  2JVV A;  3QHS A;  2X3W D;  4A4E A;  1VQ6 Q;  5LJ3 f;  4M7D G;  5D7U A;  2DK3 A;  2K2M A;  3QUI A;  2I0N A;  3P8B B;  2QQ9 A;  5L8R E;  1IRX A;  1HXD A;  4OVA A;  1W1F A;  2AKK A;  2FRY A;  2RQW A;  3MEV A;  2MAM A;  1UEB A;  4X1V A;  4X9D A;  1X6B A;  5J26 A;  3RER A;  3O8V A;  1RL2 A;  2DA9 A;  4FYV B;  1VQ4 Q;  3TQ7 P;  1QVF S;  5FU7 C;  2FZC B;  3NMZ C;  4OB2 B;  2L0A A;  1R0C B;  1VQP T;  4BI3 A;  3I9Q A;  3RBB B;  2LQ8 A;  1OPL A;  3E19 A;  4MDW A;  3CCV Q;  2NUP A;  1ACM B;  4KRT A;  1QQJ A;  1JBM A;  3EFR A;  4HT9 A;  3JCM c;  2M0O A;  4M75 F;  4J9F A;  2O31 A;  2YWW A;  4F04 B;  1M1K C;  3MCA B;  1VQK T;  4E7J A;  2O9S A;  1YIJ T;  1WYX A;  3GBQ A;  5LJ5 e;  1WJQ A;  2DL3 A;  3QZ5 B;  1Q81 C;  4M77 C;  4OMO A;  5FU7 B;  3CCR T;  2QQB A;  1OUL A;  3CCU Q;  1SPK A;  2F69 A;  3EG3 A;  1M90 R;  2XHC A;  1S1N A;  1WDX A;  1VQ7 T;  1VQM A;  1AZG B;  1VYU A;  4J9B A;  4M7A E;  3HFO A;  1QVG P;  1C1A A;  1D09 B;  4ZTJ A;  1H3H A;  1LCK A;  3C0C A;  1JJ2 A;  2FL7 A;  3IQL A;  1YJ9 Q;  2VC8 A;  3LYI A;  1SHG A;  1U1T A;  4M7D E;  4L59 A;  1Y0M A;  2DJQ A;  4M77 B;  4EIK A;  2HEQ A;  2PVG B;  2KRM A;  3RKW A;  3VRZ A;  3M0P A;  4CC2 A;  1X69 A;  3OS1 A;  2CP5 A;  3MO8 A;  2M0Y A;  1KFZ A;  1GXI E;  3EGD B;  3HPW A;  2FHD A;  1WA7 A;  1K73 C;  3CD6 T;  2KE9 A;  2EYZ A;  4RKU E;  1WJR A;  4BY6 C;  3VS4 A;  1UDL A;  4IUR A;  1ZBJ A;  2DBM A;  3EGD A;  1OPK A;  4FT2 A;  2VWF A;  1M8V A;  1VQ8 T;  2HNI A;  4QQ6 A;  2KK4 A;  2ZPB B;  4L6V 5;  3BFM A;  1BI0 A;  3VS6 A;  3JCM Q;  1YI2 T;  2YUN A;  1VQ5 T;  1K9M C;  1YP5 A;  4J6W A;  1K8A R;  3VKI A;  2YRD A;  2O9V A;  1RAI B;  3QG1 A;  2YUQ A;  2LP5 A;  1V29 B;  2GTO A;  3O5Z A;  4QVC A;  2L3P A;  1Z9Z A;  1D1A A;  4JJN K;  1YIJ A;  4KH0 B;  5IHK A;  2LT4 A;  4M78 G;  5J39 A;  1ZQ1 A;  4BY6 B;  3TU4 K;  2WSC E;  4KH1 B;  1AHJ B;  3UA7 A;  3ER0 A;  3CCR A;  3JCM X;  3OB9 A;  2EVR A;  1YJW Q;  1VQ7 A;  5GJV B;  8AT1 B;  2YXY A;  2E64 A;  5HY6 A;  2DIL A;  2RF0 A;  4QVD A;  5GAN d;  1YBY A;  3TCJ A;  3LLR A;  2LJ0 A;  2HD0 A;  5KYX B;  3MEW A;  1M1K U;  3G6E Q;  5GAN g;  2PTK A;  1EFN A;  1Q81 U;  2DXT A;  3BE3 A;  1FMW A;  3UF4 A;  3BDU A;  5KYX A;  1K4U S;  1GCP A;  3CCJ Q;  3MP1 A;  1Y57 A;  2BZX A;  2D8J A;  4NS5 A;  3OMC A;  4ELY C;  1M30 A;  1YFN A;  2ZAE A;  2KEA A;  1MND A;  3VYG A;  1OQK A;  5KE3 A;  1UG1 A;  1KD1 C;  2KDS A;  4LUE A;  1N6A A;  5ECA A;  4PJO D;  4AFS C;  2DE0 X;  4XTU A;  1SRM A;  2M51 A;  1RAH B;  4WF2 A;  1SSF A;  2QA4 A;  5DY9 A;  4IIO A;  3C95 A;  2YDL A;  5M9O A;  1YJN T;  1MV3 A;  4ZGE B;  2RD1 A;  5CCA A;  1K73 U;  2FPF A;  4QVZ A;  3AT1 B;  4M78 E;  2DX1 A;  4C92 F;  3N5B B;  4EDU A;  1M90 C;  4DBR A;  2ZPH B;  1D0X A;  4HVU A;  3EH1 A;  3M9Q A;  2AT1 B;  4M75 B;  1KIK A;  4JRK A;  3KXT A;  2EQM A;  3QPH A;  2GNC A;  2ED0 A;  3A1P A;  3C94 A;  3RUX A;  5GAN 5;  1K9M U;  2E6Z A;  1G2B A;  2F1L A;  1UGQ B;  4M75 A;  3ZL7 C;  1TUG B;  1YN8 A;  4DQ2 A;  5LJ5 d;  1Y7X A;  1VQN Q;  3CC4 T;  3G71 T;  2DZ9 A;  2QTV A;  1HJD A;  2B8A A;  1NPR A;  4KT0 E;  4C92 E;  1LJO A;  2JZ2 A;  2RHU A;  3CPW S;  3OYM A;  3SB2 A;  5AYF A;  4RTW A;  3JRZ A;  1YIT A;  1NYG A;  3I35 A;  1I5L A;  4ME7 A;  2JMC A;  2CS7 A;  1U8R A;  2HL3 A;  2D6F A;  2C0T A;  4C0Z A;  2VGN A;  3E2U A;  4YTL A;  5CKE A;  5IHN A;  1UJ0 A;  2FPD A;  2SEM A;  1W6X A;  3M0S A;  4EPC A;  4RTZ A;  3WVD B;  4B6M A;  1IGQ A;  1MV0 B;  2O01 E;  2RHY A;  3VUB A;  1B07 A;  1AT1 B;  1BIB A;  3SWN C;  1VQO Q;  1R77 A;  1JQQ A;  1GFC A;  4OMP A;  1SSH A;  2CSQ A;  2QDL A;  2FZG B;  3J81 E;  2DEU A;  4A4H A;  5KH6 A;  1V76 A;  3CPW A;  3VV0 A;  1N9R A;  1OX9 A;  2H8H A;  3H0H A;  3CCQ A;  2RH2 A;  2W10 A;  2QEX Q;  2BIV A;  5D6X A;  3GPL A;  1ABQ A;  1QMC A;  1SHF A;  2IG0 A;  3JCM W;  4OF1 A;  2VB6 A;  4OB1 B;  3VS2 A;  5LJ3 e;  1NE8 A;  2YSQ A;  3G4S Q;  3CC7 T;  3NTH A;  3CC2 A;  4HT8 A;  2K9G A;  5KE2 A;  3R6O A;  3ZEH A;  3CXC S;  1VA7 A;  1NPP A;  2EAY A;  4X34 A;  5KYY B;  4J6X A;  2ZPI B;  1O9S A;  2OTJ Q;  3LH5 A;  2E70 A;  1G3S A;  3VRY A;  5IAY A;  3M0U A;  2MCN A;  3VS3 A;  3I56 A;  3X20 B;  4P5N A;  1QW1 A;  1ZUY A;  2RM4 A;  5C6S A;  5KYY A;  2BTT A;  5KYW B;  2XI9 A;  2CP0 A;  4PJM A;  3KUF A;  2Y4Y A;  2A0F B;  1NEB A;  4JRQ A;  3CCM A;  4C5E A;  3SHW A;  2OAU A;  3MKD A;  3SFM A;  1SF9 A;  3CXC A;  5KYW A;  3EH2 A;  3RES A;  4Y91 A;  4QW2 A;  4M77 F;  4BE0 A;  2EYX A;  1VQL T;  2DRM A;  3FJ5 A;  3JB9 D;  3CCL Q;  3M58 A;  4LXC A;  3GP8 A;  2GCX A;  5GAM d;  2MWP A;  2FPE A;  3HSB A;  2COZ A;  1G83 A;  4PJJ A;  2EYW A;  5GAM g;  4A4K A;  4ZNX A;  2KRS A;  1M3B A;  1T0J A;  1PD1 A;  1IGU A;  4RTY A;  1MMN A;  2Y4X A;  3GOX A;  3V8K A;  1W2B S;  4R0K A;  1H3Z A;  1D3B B;  1AVZ C;  2IVW A;  2DXB A;  2EYQ A;  4HVW A;  3VU3 C;  2DO3 A;  2ZPG B;  4NL3 A;  3MEU A;  1G3W A;  1OU9 A;  4A53 A;  2K79 A;  1D1B A;  1K8A U;  2MF2 A;  2DET A;  2EGC A;  5GMK e;  4XU3 A;  3QO3 A;  1IB8 A;  2CP7 A;  4OP0 A;  3GNG A;  3HTR A;  1Q82 R;  4A54 A;  2E6N A;  4C8Q G;  1SG5 A;  4PKC C;  4C8Q D;  1D3B A;  3MHX A;  4FT4 A;  4PJO C;  1T3L A;  3PVL A;  4R55 A;  3ASK A;  2DF6 A;  3C4S A;  3PE0 A;  1JB0 E;  4HCK A;  5CIU A;  5DLQ E;  4MML A;  2R57 A;  3CC2 T;  1VQ9 A;  2CZ7 B;  5GAO q;  2P0K A; 
#chains in the Genus database with same CATH homology
 3S6W A;  4F7U B;  1WJS A;  5A0D A;  3CD6 A;  3L2Q A;  5D6W A;  1UGR B;  2PVD B;  4M77 G;  3SWN B;  3QYG B;  2VC8 A;  4C8Q A;  3LYI A;  3OW2 S;  2V8I A;  1U1T A;  4E7I A;  2YHT A;  4M7D E;  4L59 A;  2LDM A;  3OBW A;  4X9C A;  1N8R C;  4M77 B;  4ATO A;  1I81 A;  2PVG B;  3RKW A;  4NOY A;  4HCB A;  2QEX T;  4PJO G;  3DB4 A;  5GMK i;  2E65 A;  4OMF B;  2V8K A;  2VYT A;  4M7D B;  1Y07 A;  2M1H A;  1VQM T;  3OS1 A;  1VQ8 A;  5FRM A;  4M75 C;  5LJ5 f;  2EKO A;  4F7U A;  4PJO B;  2XK0 A;  4XAX B;  3MO8 A;  4XTX A;  1GXI E;  3GF5 A;  1MHN A;  4IUT A;  3HPW A;  3SWN A;  4N4I A;  4ZN1 A;  5GAM f;  2FHD A;  1VQ9 T;  1YI2 A;  1VUB A;  3V8J A;  1K73 C;  1VQ5 A;  1KG1 A;  2RK2 A;  3A8L B;  3RIR A;  3CD6 T;  4ZGD B;  4M7A D;  2QI2 A;  4JS4 A;  1VIF A;  3LWH A;  1QP2 A;  1LOJ A;  4M7A B;  1KHC A;  2DZC A;  1FXX A;  4Z02 A;  4RKU E;  1DJ7 B;  4J7F A;  2A3L A;  2XIC A;  1WJR A;  1X6O A;  3OYY A;  3V7S A;  4BY6 C;  2QTX A;  4BE2 A;  3QJ6 A;  1M1F A;  4PJO A;  2ZCF B;  4IUR A;  4N4G A;  4M78 C;  2DPP B;  4M7D D;  2JNG A;  2E5Q A;  4FT2 A;  4M75 G;  1M8V A;  1VQ8 T;  3CMA T;  4BI8 B;  3HKS A;  3CBP A;  2HNI A;  1HK9 A;  4KUI A;  3OW2 A;  4IUU A;  3SDZ A;  3JCM P;  4QQ6 A;  2V8J A;  3OYL A;  3M4G A;  1VQN A;  3G7Z A;  2KK4 A;  1QVP A;  2ZPB B;  4L6V 5;  1IRE B;  4BD3 A;  4C0F A;  5GAN h;  4J83 A;  5CKB A;  3OYK A;  3FC3 A;  3UPU A;  1PSE A;  3BFM A;  1BI0 A;  3JCM Q;  4E7L A;  1YI2 T;  5GAO p;  2EQJ A;  3FDR A;  2K3Y A;  1VQ5 T;  1K9M C;  4J6W A;  3VKI A;  3ZBD A;  2E10 A;  1M1G A;  3OYJ A;  3WXM B;  2WAC A;  2AHJ B;  3M56 A;  4ZTF A;  3QG1 A;  1V29 B;  3A8O B;  2DXU A;  3NTI A;  1S72 A;  4QVC A;  1VQ6 T;  4M7D A;  4JJN K;  2DD4 A;  1MGQ A;  3A5Z B;  4XU1 A;  3EFS A;  2CKK A;  1YIJ A;  2LT4 A;  4M78 G;  5J39 A;  1ZQ1 A;  4BY6 B;  3TU4 K;  2WSC E;  4C8Q E;  4XTY A;  2PQW A;  4M78 B;  1AHJ B;  5FU6 B;  3ER0 A;  3CCR A;  3H8Z A;  4FSX A;  1G5V A;  2F5T X;  3JCM X;  1NJI C;  4QQD A;  3JAM E;  3OB9 A;  1VQN T;  1QVG S;  4PL6 A;  3OYI A;  1XOV A;  2X4X A;  4XQ3 A;  4OB0 B;  3JCM h;  3PIP A;  3M59 A;  4C0G A;  2LRQ A;  1XNI A;  3M5A A;  4GY5 A;  1WQ7 A;  1Q86 C;  3QYH B;  5LJ5 j;  1VQ7 A;  5LL6 S;  5GMK j;  5DM7 R;  1B34 B;  3CEY A;  3CBM A;  2E64 A;  2G3R A;  5HY6 A;  1Q86 U;  3CBO A;  2XKO C;  3P8H A;  3C12 A;  1YBY A;  4XTV A;  3TCJ A;  3LLR A;  4DOW A;  4QVD A;  2L89 A;  5GAN d;  2HD0 A;  4GLK A;  4M78 A;  1VQO A;  4M77 E;  1Q7Y C;  3MEW A;  5LJ3 d;  3FJP A;  3OA6 A;  1Q7Y U;  5FLX E;  2EQU A;  1M1K U;  1KC8 C;  3INZ A;  3PMT A;  1IZ6 A;  2K4Y A;  3LGF A;  3JB9 H;  3FB9 A;  5GAN g;  3OYE A;  3NTK A;  1OZ3 A;  4EMK C;  4PJO E;  3L1A A;  4HKE A;  1B34 A;  4R56 A;  2C06 A;  3CCV T;  2HBP A;  1Q81 U;  2GQV A;  2DXT A;  1I4K 1;  2JN0 A;  2QEX A;  3CPF A;  3UWN A;  3RMQ A;  2DTO A;  4II1 A;  4MZM A;  1QVF A;  2LX9 A;  2KAF A;  4DOV A;  1WQW A;  3QII A;  3BDU A;  2CYZ B;  2HAX A;  1P92 A;  2EIF A;  3MP1 A;  2P0Q A;  2X4W A;  2PUK B;  3G4S A;  3JCM d;  3DLL A;  4Q5W A;  1QVG A;  3DLM A;  1VQO T;  4NS5 A;  3OMC A;  4ELY C;  3OYF A;  2ZGW A;  1U1S A;  5CAI A;  4LDX A;  4EMH A;  5CVI A;  5HK3 A;  1YHQ A;  3LH0 A;  1YJN A;  3HFN A;  2L3R A;  4JLI A;  3VYG A;  5KE3 A;  3EAE A;  5CQY A;  4BB7 A;  4IUQ A;  4LD9 K;  4QQG A;  3L2V A;  4RG2 A;  2FB7 A;  2KDS A;  4M77 D;  3JCM g;  4J6Y A;  1W2B A;  1KD1 C;  2LNV A;  3TRE A;  1VIE A;  4ELZ C;  5GMK m;  5GMK l;  3QDR B;  2R5A A;  2OTJ A;  4M75 E;  3A8H B;  3MET A;  4EMK B;  1KD1 U;  3OYG A;  2DKG A;  2DTI A;  4RCB A;  5GAN e;  2XD0 A;  1N6A A;  1N8R U;  4PJO D;  2MI6 A;  4LDY A;  3OYA A;  3CMA A;  4XTU A;  2QXF A;  2K5F A;  3FIF A;  1BI1 A;  1SSF A;  4WF2 A;  4XU0 A;  4RMO A;  4HCC A;  3G4S T;  2QA4 A;  4KBM B;  4XTW A;  5DY9 A;  4UC4 A;  2KY9 A;  4JRP A;  4HA8 A;  3C95 A;  3CCE T;  3CME A;  5M9O A;  1YHQ T;  1YJ9 T;  2CGH A;  1YJN T;  4M77 A;  5FRN A;  1OZ2 A;  1BI3 A;  2RD1 A;  5EG2 A;  4EMK A;  4ZGE B;  5GAN 4;  1Y71 A;  4BUG A;  5CCA A;  3I55 T;  3A8M B;  1K73 U;  4E47 A;  3L2W A;  3UT1 A;  2DVE A;  2EJG A;  4B9W A;  1Q82 C;  2MMP A;  2PU9 B;  4M78 E;  4QVZ A;  2JOY A;  4C92 F;  3VUZ A;  3N5B B;  1VQ6 A;  3TEE A;  4EDU A;  2OTJ T;  3HL8 A;  1M90 C;  3OBY A;  2ZPH B;  2EJ9 A;  1O75 A;  3JCM e;  2LC4 A;  5IN1 A;  4IKF A;  4KUD K;  1M90 U;  2CZ0 B;  5A0G A;  4MZP A;  4ZN3 A;  4M75 D;  3M9Q A;  3CCS T;  3CC4 A;  3G71 A;  1UGP B;  1BIA A;  5CR2 A;  4M75 B;  2XDB A;  4JRK A;  5J3B A;  2XU8 A;  1OYX A;  3CCL A;  2QA4 T;  3Q1J A;  4LDU A;  3KXT A;  3E9G A;  2EQM A;  3QPH A;  3OS2 A;  3CME T;  1R8O B;  5LJ3 h;  4N4H A;  2RI5 A;  3C94 A;  5GAN f;  4E7H A;  3JCM J;  2FVU A;  3JCM b;  1S72 T;  1BKB A;  3RUX A;  5GAN 5;  3P8D A;  1K9M U;  2HQX A;  2ZPE B;  4F7U F;  2E6Z A;  3X26 B;  3L2R A;  3PTA A;  2EQK A;  1UGQ B;  4M75 A;  4M78 D;  4BI4 A;  4DQ2 A;  3JB9 G;  3MEA A;  5LJ5 d;  4BAC A;  1Y7X A;  5HKC A;  3CC4 T;  4OB3 B;  3G71 T;  2DZ9 A;  2CZ6 B;  2B8A A;  3L2U A;  4JLG A;  2DJZ A;  3ZFJ A;  1NPR A;  3LW5 E;  2O4X B;  1LJO A;  1X01 A;  4KT0 E;  4C92 E;  3CCV A;  2K5I A;  3MP6 A;  4XU2 A;  2XID A;  3CCL T;  2JZ2 A;  1Y96 B;  1G3Y A;  1NZ9 A;  2LVM A;  4C5I A;  1NJI U;  2RHU A;  3CPW S;  3E1S A;  3OYM A;  3SB2 A;  2VGM A;  2BKD N;  5AYF A;  1JRI A;  4FM4 B;  3JCM f;  4C92 C;  2RJD A;  3BW1 A;  4OGE A;  2LT1 A;  5GAO r;  3PFS A;  3JRZ A;  5GAM j;  1YIT A;  3VJP A;  3PNW C;  4OGC A;  4LD6 A;  4Y28 E;  4IUV A;  3PT9 A;  1VQ4 T;  2QDY B;  3HRT A;  1I5L A;  4ME7 A;  4M7A F;  1ZHI A;  2WSF E;  4PLI A;  2QQR A;  5C0M A;  4FIB A;  2CS7 A;  2O4X A;  2R58 A;  2QQA A;  1U8R A;  4V2S A;  2RK1 A;  2YLB A;  2D6F A;  3OS5 A;  2M9U A;  1Y96 A;  2LTO A;  4C0Z A;  1JJ2 S;  2RHI A;  3CCU A;  2RA2 A;  2VGN A;  2HQE A;  3QZ9 B;  2K2V A;  3OSS C;  3GLX A;  3OYH A;  4VUB A;  5CKE A;  4YTL A;  2DAQ A;  3S3N A;  2XDP A;  5CKH A;  4LDW A;  2F5K A;  1TH7 A;  1FX7 A;  2LCC A;  5LJ3 g;  5GAN 8;  4BDZ A;  3JB9 J;  1YJW T;  2RHZ A;  2BUD A;  4EMG A;  4M7D F;  2KSS A;  4M7A A;  4EPC A;  3OYB A;  4C92 G;  2RJE A;  3WVD B;  3S3M A;  2DEQ A;  4C92 D;  3OSV A;  2EWN A;  2RHY A;  2O01 E;  2RHX A;  3VUB A;  4FU6 A;  3CC7 A;  1BIB A;  3SWN C;  4C92 B;  2H3J A;  5KCH A;  2X4Y A;  3KBG A;  1YIT T;  5A0L A;  1KQ2 A;  4NL2 A;  3JB9 F;  1H64 1;  3UDC A;  4C0D C;  2YLC A;  3GNF B;  3J81 E;  3DKM A;  3CCE A;  4A4H A;  4JS5 A;  2I2L A;  5KH6 A;  3JSC A;  3S3O A;  1YJ9 A;  3CPW A;  5CKF A;  3I55 A;  1FWZ A;  2PVO B;  3VV0 A;  2D9T A;  4J7I A;  1ZBX A;  2X4J A;  1N9R A;  4BDY A;  3X28 B;  2QQS A;  3CCU T;  1N9S A;  2OTL T;  2VXF A;  1N27 A;  3X25 B;  2X35 A;  3QKJ A;  3CCQ A;  2RH2 A;  2BIV A;  2RJC A;  5D6X A;  2L5Q A;  3GPL A;  3AHU A;  2EJF A;  2K3X A;  4CRI A;  2RI2 A;  2IG0 A;  4C92 A;  2FYK A;  5KCO A;  3JCM W;  4OF1 A;  5FRO A;  3FRN A;  2RJF A;  4F7U G;  3CCJ T;  3V7R A;  4OB1 B;  3PMI A;  3H6Z A;  3CCS A;  5LJ3 e;  1WGS A;  1YCY A;  2VXE A;  2DXC A;  1NE8 A;  2KQW A;  4M7A C;  2Y90 A;  3VYH B;  3CC7 T;  4LDV A;  4DA4 A;  2EFI A;  4HCZ A;  3NTH A;  3LWI A;  3CC2 A;  4HT8 A;  3BY7 A;  1XQH A;  5KE2 A;  3F70 A;  3R6O A;  3ZEH A;  3CXC S;  4JDS A;  3RKX A;  4XTZ A;  1NPP A;  2EAY A;  4X34 A;  4C0D B;  1M4Z A;  1X75 C;  5GAN 6;  4J6X A;  2YRV A;  2ZPI B;  3HHT B;  2A7Y A;  1O9S A;  2K5L A;  4PNO A;  3NFC A;  1UB4 A;  5GMK h;  5LJ5 h;  3OY9 A;  2KVQ G;  3OYC A;  4M7D C;  2E70 A;  3M53 A;  3M4Y A;  4MMK A;  1G3S A;  5GAO l;  1QP3 A;  5GAO m;  3JB9 I;  4IUP A;  3V7C A;  1M9S A;  1EIF A;  5CO7 A;  5IAY A;  1BYM A;  2PUO B;  1RI0 A;  3QJY A;  5GAM h;  2VUB A;  1Q82 U;  3FLG A;  2E12 A;  2GFA A;  1PSF A;  4O5V A;  2K57 A;  5CQX A;  2GFU A;  3I56 A;  3X20 B;  4P5N A;  2R5M A;  2NLU A;  3M54 A;  1VQL A;  3URG A;  1QW1 A;  4M7A G;  2DIQ A;  2RM4 A;  2L8D A;  5C6S A;  3HRS A;  2DIG A;  3L42 A;  4C8Q F;  1KQS S;  2WSE E;  2XI9 A;  4N0A C;  1BI2 A;  1WNL A;  2MWO A;  4RCC A;  5D6Y A;  3OQ5 A;  3KUF A;  3GIB A;  2Y4Y A;  4A4G A;  5GAN 2;  4J8O A;  4JRQ A;  1G3T A;  4CI0 C;  3CCM A;  1KQ1 A;  2JVV A;  3QHS A;  4M7D G;  4A4E A;  5I2M A;  5LJ3 f;  4B9X A;  4C5E A;  5GAN 7;  4TVR A;  5FU6 C;  2DK3 A;  4D6W A;  3OYN A;  3QUI A;  1VQ4 A;  3PGG A;  2OAU A;  3SFM A;  3PIO A;  5CK9 A;  3OS0 A;  2GF7 A;  2JTF A;  2QQ9 A;  3P8B B;  3T9N A;  1I8F A;  5L8R E;  4JRI A;  3JCM V;  3CXC A;  1VQP A;  3X24 B;  1OI1 A;  3RES A;  5IT9 E;  4Y91 A;  3QBY A;  4QW2 A;  1HXD A;  4M77 F;  4OVA A;  4C5G A;  4ZGJ B;  3I56 T;  4BE0 A;  1VQL T;  3MP8 A;  3JB9 D;  5GAN 3;  2KMT A;  5GAO n;  2P4T A;  3M58 A;  2RO0 A;  3GP8 A;  2GCX A;  1YJW A;  5GAM d;  4E7K A;  3MEV A;  2MAM A;  3OMG A;  1UEB A;  3FEO A;  4MZT A;  4PJO F;  1WPY A;  2MWP A;  4J5Y A;  3V8L A;  4MDX A;  4X9D A;  5LJ5 g;  3HSB A;  1XTD A;  5J26 A;  3RER A;  1VQK A;  4O6J A;  3O8V A;  1RL2 A;  1KC8 U;  2CZ1 B;  2LCL A;  3CCM T;  5GAM g;  1KQS A;  1QVF S;  1UGS B;  5FU7 C;  3J7A F;  4A4K A;  4JUV A;  4OB2 B;  1W4S A;  3LX7 A;  3G6E A;  2XDD A;  1VQP T;  4BI3 A;  4C5H A;  4C8Q C;  2LQK A;  2RI3 A;  2JUF A;  4XK8 E;  3LGL A;  2LQ8 A;  2Y4X A;  3L2Z A;  4N0A A;  3E19 A;  4KUL A;  4MDW A;  5A2Q E;  2OTL A;  3HP9 A;  3GOX A;  4F7U E;  3CCQ T;  2RB6 A;  3V8K A;  2DTH A;  3QXE B;  3E9F A;  2D0Q B;  1JBM A;  3RKY A;  3RMS A;  3EFR A;  1W2B S;  4RG8 A;  1D3B B;  4HT9 A;  1H3Z A;  3JCM c;  2IVW A;  3CCJ A;  1K8A C;  2DXB A;  2EYQ A;  2M0O A;  4M75 F;  5I2S A;  5HK0 A;  3SD4 A;  2DO3 A;  2ZPG B;  3MCA B;  4PLL A;  3VU3 C;  4E7J A;  4NL3 A;  3MEU A;  4A4F A;  1M1K C;  1VQK T;  1G3W A;  1YIJ T;  4A53 A;  1K8A U;  5CKD A;  2MF2 A;  2VV5 A;  2E41 A;  5LJ5 e;  5GMK e;  1WJQ A;  4XU3 A;  1KHI A;  3QO3 A;  3QZ5 B;  2DD5 A;  1Q81 C;  4M77 C;  5GAN j;  2ZPF B;  3M57 A;  3GNG A;  3ME9 A;  4L5G A;  4OP0 A;  5FU7 B;  2XG8 D;  4A54 A;  3CCR T;  3HRU A;  2ZZD A;  2E6N A;  4C8Q G;  2QQB A;  4PKC C;  5GAM e;  3G6E T;  1LNX A;  2F69 A;  5LJ3 j;  2M16 A;  4C8Q D;  2FL7 A;  2XHC A;  1D3B A;  3MHX A;  4FT4 A;  3A8G B;  3M55 A;  4C8Q B;  4FL6 A;  3J80 E;  3DB3 A;  4PJO C;  5I21 A;  4R55 A;  5DLO A;  1VQ7 T;  1M5Q 1;  3OYD A;  1VQM A;  3ASK A;  3C4S A;  4BE1 A;  3BDL A;  3WVE B;  3QSU A;  1JB0 E;  4M7A E;  3HFO A;  5CIU A;  4M78 F;  2P0P A;  5DLQ E;  2JTM A;  4MML A;  4ZTJ A;  2R57 A;  3CC2 T;  1JJ2 A;  2CZ7 B;  2E1H A;  1VQ9 A;  5GAO q;  2P0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...