4C92A

Crystal structure of the yeast lsm1-7 complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
130
structure length
130
Chain Sequence
TAAIVSSVDRKIFVLLRDGRMLFGVLRTFDQYANLILQDCVERIYFSEENKYAEEDRGIFMIRGENVVMLGEVDIDKEDQPLEAMERIPFKEAWLTKQKNDEKRFKEETHKGKKMARHGIVYDFHKSDMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SM-LIKE PROTEIN LSM1
publication title Architecture of the Lsm1-7-Pat1 Complex: A Conserved Assembly in Eukaryotic Mrna Turnover
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 36
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2013-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4c92A00
2CGHA 4N0AC 4M77A 2DTOA 1JRIA 4M75D 1D3BA 2VC8A 4NL2A 4M7DD 3EFRA 2RD1A 3JCMe 3BFMA 3V7RA 1U1TA 4M75G 2EWNA 4M7DG 3RIRA 2JN0A 2DXTA 3JCMf 4C92F 2E10A 4J6WA 2EAYA 4M7AD 1BIAA 3GIBA 4XTZA 1X01A 4M78A 3JCMJ 4XTWA 4PJOE 4C92E 1YCYA 1TH7A 3HFNA 4M7AG 3RKYA 4X9CA 3JB9H 4C92B 5LJ3j 4F7UF 2ZGWA 4A53A 4XQ3A 3V8KA 5GAN4 4PJOB 1HXDA 3BY7A 5GAMj 5LJ3e 3JCMP 1I81A 5GAMe 2QTXA 3RERA 4QVDA 3JCMQ 4F7UE 3JCMh 3FIFA 4M78G 4XTXA 4Y91A 4F7UB 1HK9A 5LJ5j 3JB9J 4EMKB 4C8QC 5GAMf 5GAMd 5GANf 5GANd 1U1SA 3INZA 3QO3A 5LJ5e 5GAOl 2YLBA 4NL3A 4C92A 3JB9G 5CAIA 3VU3C 1Y96B 4JUVA 1WQWA 4N0AA 4XTVA 3JCMc 5DY9A 4PJOF 5GMKj 1I5LA 4M77D 3JCMd 4M75C 2VXEA 5GAOm 5LJ3h 4F7UA 4M7DC 4C8QF 2YLCA 4JRIA 4EMKA 5GAMh 5GANh 4M77G 4XU2A 3HSBA 1KQ2A 2EJGA 2RA2A 3L1AA 2DTHA 4A54A 4C8QE 3EFSA 4J5YA 4NOYA 1M5Q1 1Y96A 2DZCA 2YHTA 3QHSA 4MMLA 4C8QB 5LJ5h 5GAN8 4JRKA 4M7AC 4M78D 4XU0A 5GAN2 3M4GA 3V7CA 4JLIA 5LJ3f 5LJ3d 4RCBA 3SWNC 3BDUA 5GAOq 2EJFA 4M75E 4EMHA 3JB9D 4M7DE 4V2SA 3HFOA 3RUXA 5GAOr 3AHUA 4PJOA 4M75B 1WQ7A 4M7DB 4M7AF 3JB9I 4C8QA 5GAN6 4HT8A 5LJ5f 5LJ5d 2DKGA 3FJPA 3JCMg 2E1HA 4M7AE 2FB7A 2DZ9A 4C92D 4PJOD 5GMKe 4M7AB 3RESA 4RCCA 2DJZA 4XTYA 4PJOG 4C92G 5GMKl 2FYKA 3RKXA 3L2ZA 4M77C 2E64A 3JCMX 1LNXA 3SWNB 1B34B 1WNLA 2DEQA 1H641 5GAOn 3JCMW 4QVCA 3QSUA 2K57A 2EJ9A 1N9SA 3V7SA 4M75F 4F7UG 5LJ3g 1N9RA 4PNOA 4DQ2A 4M7DF 5GAMg 1MGQA 2Y90A 3RKWA 4MMKA 5GMKm 5GANg 3V8JA 5GAN5 4M7AA 2VXFA 4EMKC 3V8LA 5GAN7 4M78C 1LOJA 1I8FA 3QUIA 4M77F 5GMKh 4OP0A 1JBMA 4WF2A 4XU1A 3SB2A 5LJ5g 2DTIA 2I2LA 2E41A 3SWNA 1B34A 4J6YA 1LJOA 2RM4A 3JCMV 4HT9A 1BIBA 1WPYA 4EMGA 4J6XA 1KQ1A 4M77E 5GAN3 2DVEA 3PGGA 2DXUA 4XTUA 5GAOp 4M77B 1D3BB 4HA8A 2RB6A 4C8QD 5I21A 3FB9A 4M78F 2E65A 5GANj 1I4K1 4M75A 5GANe 3JCMb 4M7DA 4C8QG 4X9DA 2HNIA 1M8VA 4PJOC 4C92C 4M78E 4XU3A 3BW1A 3JB9F 5GMKi 4M78B
chains in the Genus database with same CATH superfamily
3CXCP 3VRYA 2CKKA 3BFMA 4J9HA 2RJCA 4M75G 1NYGA 2DLPA 2JTMA 3QWYA 4J6WA 2HL3A 1M2OA 3ULRB 2YUNA 1NLPC 1OU8A 4ZNXA 3TU4K 4PLLA 1VQ7A 4PJOB 3L2RA 1I81A 2JTEA 3JCMh 2GQIA 1E7OA 3CCSQ 1MMDA 1K0SA 5GANd 1RAGB 1M2VB 1YIJA 3VS6A 2HAXA 3M55A 1KD1U 3REBB 1U06A 3M5AA 2DRMA 1NJIC 1SRMA 3M57A 2CT3A 5KYUB 3H6ZA 1KIKA 4R56A 3OS2A 4M78D 4XU0A 3L2WA 4DEYA 5GAN2 1SSHA 9ATCB 3QDFA 5HY6A 3S3MA 4OMPA 4M7DE 2CZ0B 2FO0A 2HKNA 3RUXA 1UEBA 3PVQA 1YIJQ 1AVZC 4FYWB 4D8DA 2BUDA 3TVTA 4HT8A 5LJ5f 2DKGA 3FJPA 1PRLC 2CSQA 3OYHA 4R0KA 1T0HA 3JV3A 1VIEA 1K9MR 4JZ4A 1ZBXA 3R6NA 1OYXA 2EYQA 2LQNA 8ATCB 3MO8A 2R5AA 2DEQA 2JOYA 1H641 4C0DC 1YI2A 1F1BB 2RI2A 3OYMA 2EJ9A 3CC2Q 1OV3A 2I0NA 1KC8R 1VQ4Q 2FZKB 2QTVA 3SB2A 5LJ5g 4J9CA 2R5MA 4A63B 4J6YA 1VQNQ 4E7KA 5KH6A 1KQSP 3MP6A 1D1CA 5C6SA 2JMCA 4QQGA 5CO7A 1SHFA 1WIEA 2CREA 3OS5A 3ASKA 2E6ZA 2BIVA 3P8BB 2P0QA 4M78B 3A98A 3GNFB 1YI2Q 1N6AA 4IUQA 2HQHA 2MOXA 4LD9K 2L89A 2C06A 2YUQA 4PJJA 3J7AF 1A0NB 1SF9A 3TQ7P 1UG1A 4MZTA 2HCKA 3QWXX 4MDWA 3CBPA 2V1RA 5LJ3j 4F7UF 2ZGWA 3BY7A 4LN2A 3JCMP 1K76A 2LQKA 5GAMe 5I22A 2J05A 2KI7A 2BZXA 4X34A 3GLXA 4Y91A 2D9TA 1VQ6Q 1PNJA 1ZQ1A 1Q82C 1TWBA 3JB9G 1NBEB 2KT8A 2HDAA 1TXQA 2DK3A 1I5LA 3FEOA 3RMSA 1YP5A 1YITT 1W70A 2R57A 2DEUA 2K7AA 3QKJA 2LX7A 1RACB 4J5YA 1AHJB 1OPLA 4XK8E 4M7AC 3RDVA 2NUTA 3M4YA 3S6WA 3M4GA 2XDDA 2FPDA 2ED0A 2X3XD 4M75E 3HHTB 4ZN3A 4Z88A 4DBFA 1KQSS 1RLPC 4LUDA 1M90U 1YWPA 3OSSC 3CC4Q 3JCMX 2K5FA 1QVPA 2RK1A 2KROA 4M4ZA 2XICA 5KE2A 1MNDA 1BI0A 2RN8A 2FPFA 1H92A 1VYVA 3KXTA 3CCET 4M77F 2YWWA 1ZUKA 2K5IA 4J6XA 4AG1C 1G83A 4B9WA 1YJWQ 3PGGA 3I35A 4AFQC 1WGSA 5A0LA 1D3BB 1N5ZA 2F2VA 3HPWA 2KGTA 2RJDA 3OYLA 2Z0WA 3OQ5A 3QG1A 2X4YA 3PE0A 4FU6A 2IVWA 3DB4A 1B7TA 5IHIA 4C92F 2HBWA 4R55A 1AD5A 2COYA 3EG2A 1ABOA 1BI3A 2D0QB 4KGXB 3OYYA 1YITA 4F7UB 4C8QC 3ZEHA 2EW3A 4AT1B 1VIFA 1WQWA 2NUPB 4XTVA 2XIDA 2RQRA 4M77D 2K3XA 4RTZA 3G71T 1C1AA 1OX8A 5CK9A 2O9SA 3I55Q 1X43A 2XG8D 2HQXA 1Y96A 3QHSA 2O01E 1NPRA 4DOWA 1K9MU 1NM7A 3AT1B 1PM3A 3EG9B 2K3BA 1RAEB 2ZZDA 5LJ5d 3OYGA 1OU9A 5D6WA 1KC8U 2DZ9A 2E70A 4C92D 1JO8A 2AKLA 3X28B 4XTYA 3CCEA 5LL6S 2DL3A 2QEXA 2K57A 3QJYA 4A4HA 1KJWA 2DRKA 4Y28E 2L3QA 3V8LA 5GAN7 3QUIA 3VS1A 1TUCA 3EGDB 3JCMV 2QA4T 4EMGA 2V1QA 2KK4A 1FMWA 4M77B 5J3BA 2XMFA 2GTOA 1M8MA 3CCEQ 5GANe 2M0OA 1ZHIA 4XU3A 2QEXQ 3OYDA 4BI3A 4KRTA 4FIBA 3NGPA 1WHMA 3OYNA 1GRIA 3PTAA 5DM7R 3CCQQ 3A8MB 3L2QA 2KVQG 2JS0A 1OZ3A 3CD6T 4C92B 2EVRA 3RERA 3G71A 2LVMA 4KUIA 1K8AC 4C5IA 1Z9ZA 3QYHB 5CKBA 1M1FA 3CCLT 1VQMQ 2VUBA 1ZSZA 2M51A 2ZPEB 1WHGA 1Z9QA 2LQ8A 2Y4XA 2WSEE 5GAMh 3L2VA 1AWJA 2DL7A 2LRQA 2OJ2A 1N8RC 2JM8A 2LCLA 5D6XA 4ME7A 4MMLA 2QQSA 1ZBJA 1WHHA 5GAOr 4E7SA 1T0JA 4CC4B 5FWBA 2Y4YA 3VYHB 2XDPA 3OYCA 2VASA 2K2VA 4C5GA 4HCCA 3QPHA 1KQSA 1R8OB 4L6V5 1LVKA 1ZUYA 3CCVT 1IO6A 2EQJA 4BD3A 4C5EA 2QA4A 1TOVA 1V1CA 2ZCFB 1VQPT 1QP2A 4D8KA 1UFFA 4FCYA 1N9RA 3TSZA 5GANg 3WXMB 1JB0E 1QCFA 2CUBA 2ZPBB 4N4GA 1R0CB 2O2OA 4OMNA 1VQLT 2KSSA 2FRWA 3NTHA 3CC7Q 1FXXA 2W10A 1QWFA 1Q95G 2E3IA 1Q81U 1QQJA 2HNIA 2QA4Q 3BW1A 3CD6A 4BE2A 2VC8A 1XNIA 2HSPA 2HD0A 2AT1B 1FWZA 5L8RE 3JCMf 3MP1A 1VQ5A 3CCLA 1QKXA 3VS2A 2WSCE 4JJDA 4M7AG 4A53A 1ZX6A 3SDZA 4E6RA 3JCMQ 2DETA 4OMMA 4M78G 3A8OB 2RHXA 4JJBA 4CRIA 3INZA 4NL3A 2YLBA 4X1VA 3CD6Q 2PQWA 2M02A 1Y7XA 2JJ9A 1Q82R 4JUVA 2MCNA 1TUGB 4PJOF 1HYOA 1T3SA 1P92A 4J9BA 1VQ5Q 1PG5B 1KQ2A 4FM4B 3EFSA 1UJYA 1M5Q1 2RMOA 5FU6B 1TS9A 2VYTA 4BACA 1PCXA 2KYMA 3QZ5B 4JJNK 3M0UA 3VS5A 1VQPA 1YHQA 2DBKA 1MMGA 1K1ZA 3GF5A 5I2SA 3BDLA 4L59A 3HTRA 1WJSA 2KT1A 1YBYA 3RESA 1VQ8T 4AG2C 5GMKl 2O4XB 2FYKA 1Q7YC 2GCXA 1YIJT 2GQVA 1RUWA 1VQLA 3SWNB 5KYWA 2L2PA 4LUEA 5EC7A 2MYSA 2PTKA 2RQWA 4FYYB 2X51A 4MZPA 2PUKB 3X26B 1EIFA 4JZ3A 2GF7A 1JBMA 1IB8A 2FZGB 3UA6A 3WVDB 1JXMA 1YHQQ 1BCOA 3CC2T 5GAOp 4J7IA 4IIMA 4ANJA 2FPEA 2RHIA 4HA8A 4K11A 2BE9B 1VQ4T 4C8QG 1ZLMA 2ED1A 1V29B 1VQNT 1VQLQ 2KRMA 4NL2A 4TVRA 2QGFB 1WZOA 4PFPA 2A3LA 1J3TA 2DVJA 1MMAA 1VUBA 3D7SB 2QQ9A 3RKYA 1GCQA 1IZ6A 4LD6A 2J6KA 1OEBA 4DOVA 4OF1A 2A0FB 2MWOA 3VS4A 2B86A 1U8RA 5LJ5e 3CCJT 2D1XA 1W6XA 4ZTJA 3CPWP 3OYIA 1VQ6T 4P5NA 3NHNA 3RNJA 2LJ0A 3F70A 1VQ8A 3SHWA 2RQUA 3MEWA 1UB4A 3FRNA 2MK5A 4JS5A 3M58A 3REAB 4M7AE 1Q86C 2AHJB 1PHTA 2DL8A 3OW2P 2XKOC 2YXYA 4IKFA 3DKMA 3L2ZA 2MI6A 1EFNA 3EHQA 4EPCA 3CC2A 1M27C 2M16A 2P4TA 3M0RA 4M7AA 1VQ4A 1VQ8Q 3I5RA 4N4HA 4OP0A 5DLQE 3UA7A 1VQNA 1QVGS 2E41A 3N5BB 3CC4T 2WACA 3NFCA 1ZA1B 1XQHA 2EGEA 3CPFA 2C0OA 4M7DA 2LZ6B 1QMCA 4PJOC 4KUDK 3VS7A 2CGHA 1YJWT 4M7DD 5AT1B 3CXCS 3I56Q 1O9SA 4KH0B 3GIBA 4XTZA 3CPWS 2LC4A 2AZSA 2NWMA 3CCJA 1XTDA 1TH7A 2JNGA 3VYGA 3G6ET 4XQ3A 1Q82U 5GAMj 5M9OA 2DM1A 5C0MA 1QCNA 1VQ6A 5GAOl 5A0DA 1K8AR 2YSQA 2X9HA 4UC4A 1AOJA 2P4RA 1R0BG 1X6BA 3S3OA 4BUGA 1W1FA 3LH5A 4BDZA 4II1A 2CH4A 2QYZA 1FMVA 1MV0B 3CCJQ 1SSFA 3H0IA 4C8QE 3PIPA 2SEMA 1WA7A 3EGXA 1N8RR 4J7FA 2KR3A 5FRNA 2CZ6B 2ROTA 2KBTA 4JLIA 3ZL7C 4CC7A 1ZUUA 4EMHA 2QAZA 2FVUA 4M7DB 2FHDA 3I55T 2E12A 2MF2A 4C8QA 2LJ3A 2GGRA 1UGVA 1QKWA 5FRMA 1VQKT 3UDCA 2DE0X 3CC4A 1N9SA 5FW9A 3QZ9B 1KFZA 3A1PA 2QQRA 2Y90A 2KMTA 4MZMA 2DYBA 4KT0E 4M78C 4A4EA 1I8FA 4LE9A 4E7JA 3LGLA 2K3YA 1B34A 2EYZA 4BI4A 1YJWA 1WX6A 4OVAA 5CKFA 4XTUA 3JAME 3GPLA 4Y92A 2E65A 4M75A 1AZGB 4OB3B 1H3HA 1G5VA 3EFOA 4Q5WA 3G6EA 3GOXA 4IURA 1IREB 2GBQA 2DTOA 1JRIA 4M75D 4RKUE 1UECA 2JUFA 5HCKA 2ROLA 5FU7B 1JU5C 2B8AA 4ELYC 3M9QA 2QEXT 1RAIB 2RHUA 3NMZC 5CKDA 2O31A 1UTIA 4QVDA 2RI3A 3QDRB 3CCQT 4E7IA 5GAMf 6AT1B 3QO3A 3G6EQ 1QWEA 4RTUA 1YN8A 4IUPA 3H41A 2NUTB 2OX7A 1QVFP 3M53A 2X4JA 4BI8B 4YTLA 4HCZA 1Q81R 4EMKA 3H9NA 1TSFA 2EJGA 3FDRA 2DTHA 3I55A 1VQMT 1IXDA 3QBYA 2YHTA 5LJ5h 2EQMA 2BKDN 5LJ3f 2LNHB 1M1GA 1VQKA 1WJQA 2D8JA 2EJFA 3EGUA 4C0GA 5FLXE 4M75B 3CMEA 3JB9I 2AKKA 2E1HA 1IGUA 5FU7C 1ACMB 1GFCA 3VUZA 5A2QE 2RH2A 2VKNA 2BZ8A 1K73C 2DL5A 1NEGA 1LNXA 1Q7YR 2CP5A 5LJ3g 1I5OB 2QGGA 1UUEA 1W4SA 1VQKQ 4OMLA 2R58A 2MMPA 5CCAA 1QVGA 2RM4A 1MHNA 2J6OA 3CMEQ 2O88A 1VYTA 4ZGDB 1NEBA 2EKHA 4ORZA 4C5HA 1ARKA 2RB6A 3FB9A 5GANj 2KDSA 2RK2A 4RTWA 3JCMb 4X9DA 4BE0A 4RTTA 2NUZA 3CCRT 1M1KC 1MUZA 3OMGA 3CXCA 1RI9A 3CC7T 3EFRA 2CP7A 5A0GA 1AEYA 3UPUA 3IQLA 2RF0A 5KYYA 2JN0A 1QVFS 3CCQA 1BU1A 3CPWA 1K8AU 5IHNA 1YCYA 2KQWA 4X9CA 3JB9H 2KRNA 5CVIA 4ZN1A 5GAN4 2QXFA 1YJNQ 4LDVA 2OTLT 3WVEB 2GFAA 4J9GA 2E6NA 1HK9A 2X35A 2EYYA 1U1SA 1VQMA 1B07A 5IT9E 1G3TA 4JS4A 4IUUA 4PJLA 3UT1A 5I2MA 1N8RU 1KK7A 1Y96B 1K9MC 3JCMc 3EH1A 2VXEA 1EX4A 2C0TA 3SD4A 2KAFA 2H3EB 2QK0A 3LWHA 2EQIA 5GJWB 1YJ9T 4JRKA 2RQTA 1RLQC 2JTFA 3TCJA 2RNAA 3P8DA 3OYFA 4QQDA 3MKDA 1VQ5T 1RI0A 3RMQA 3AHUA 1M3BA 2LNVA 5GAN6 3NTKA 4OB2B 1HD3A 2K2MA 3H8ZA 2DBMA 3E2UA 1Q86R 4PJOG 1X6GA 1FX7A 4M77C 5KYYB 1NJIR 2RHZA 3MEAA 4QVCA 2XHCA 2LX9A 4J9EA 2CP2A 3RKWA 4BY6B 3V8JA 2VWFA 2G6FX 2VXFA 4FL6A 2YUOA 4JDSA 3VKIA 2QQAA 1NPPA 1OPKA 2QDYB 3CCRA 2HSEB 5IH2A 2DVEA 2L3PA 3CBMA 2EQKA 3CC7A 3CCUA 4BB7A 1JXOA 1X2QA 1TUDA 2F69A 5KE3A 3OS1A 2EGCA 1NG2A 1JJ2P 4C92C 3MEVA 4PFZA 4HCBA 2JS2A 1YHQT 2DERA 1WJRA 2ESWA 4RTYA 2RD1A 2OTLA 2JW4A 2EWNA 3C0CA 3U23A 2JM9A 4IIOA 3LH0A 3RIRA 5J26A 4A4FA 1GFDA 3CCRQ 2LCSA 3A8LB 4F14A 2VV5A 1WHKA 2ZPFB 1VQ9T 3CCUQ 1ZSZB 5KCOA 2ZPIB 1D1BA 3TEEA 2LT4A 1X6OA 3PFSA 2DA9A 1WFWA 5GAMd 4KBMB 1PC0A 5DLOA 1PD1A 3LX7A 2MIOA 4AFSC 2CP0A 1YJ9A 7AT1B 4KGZB 2OTLQ 3CQTA 5DY9A 4JJCA 2FEIA 4MDXA 4JRIA 3HSBA 4DEXA 3E19A 2XK0A 5HK3A 4DBRA 3T9NA 3THKA 2YT6A 5LJ3d 1QLYA 3BDUA 2K5LA 1Q7YU 1YJ9Q 3JCMg 2PVOB 1ZSZC 4LDWA 1JJ2S 1UGQB 3QSUA 1ABQA 3V7SA 4DQ2A 3I5SA 1AZEA 1LCKA 2I2LA 3G1JA 2COWA 2GTJA 5KYNA 4HT9A 1NE8A 1WPYA 2A37A 1C6VX 2KXDA 3GP8A 1BKBA 1LPLA 1WHLA 1BB9A 5D6YA 1VQ9A 4N0AC 3VS0A 2HKQB 3V7RA 4J8OA 2RPNA 5KYXA 3QIIA 2VGMA 1QVFA 2PVDB 3MEUA 2EAYA 4PJOE 4RG2A 3I56T 1RAFB 2KE9A 3GBQA 1EZZB 2DFUA 3META 3HRTA 5LJ5j 1AWWA 1SRLA 3JB9J 2ABLA 5FU6C 4E7LA 4CI0C 1VQ9Q 3KUFA 1SEMA 1D0XA 3C94A 3VRZA 4LDYA 1SG5A 4PJMA 1K9AA 3O8VA 1RABB 2PZ1A 4RG8A 3ZFJA 5GANh 1M2VA 2RA2A 4B6MA 4A54A 3J81E 4FT2A 2K79A 2DILA 3UATA 3X20B 4FYXB 4E47A 3UWNA 4OGEA 2KNBB 1Q86U 4HVWA 3SWNC 3MP8A 4O5VA 1NJIU 1IGQA 5KYUA 4FSSA 3CCMT 4M7AF 3FLGA 5KYWB 4PL6A 1V76A 1M3CA 2FB7A 1UE9A 2A28A 3C95A 1PWTA 2IG0A 1VQOT 2ECZA 1M9SA 2V8KA 4OMFB 4F16A 2E64A 1WNLA 1U3OA 5KCHA 1K73R 2AK5A 4F7UG 4M7DF 2F1LA 4FW1A 3MHXA 3TREA 1B3QA 1YFNA 2DD4A 4HKEA 3Q1JA 4WF2A 1UGRB 3A5ZB 5FROA 1BIBA 2L8DA 1KQ1A 4Z02A 5GAN3 4ZTFA 2GFUA 1OQKA 5CKEA 4C0DB 2KY9A 2LP5A 4CC3A 1JQQA 2JXBA 3DLLA 4M78E 4ZGEB 4N4IA 5GMKi 1WXUA 2WSFE 3I56A 1M1KR 1TTHB 3RBBB 3E9GA 4BE1A 2EQUA 2E10A 4M7AD 3OBYA 2LTOA 1NLOC 2XI9A 4M78A 3HFNA 1CKBA 1SPKA 2SRCA 1VQ7Q 2LQWA 4JPBW 3MCAB 4XTXA 3OYEA 3PT9A 4RMOA 2NLUA 3JCMJ 2RQVA 1MNEA 2BZYA 3CMAT 2EIFA 2LCCA 2A7YA 1IHWA 5ECAA 3JCMd 2G3RA 1R77A 4C8QF 5CQXA 4GLKA 4M77G 2CS7A 3CCMA 1OULA 3J80E 2QDLA 5AYFA 1QCOA 4NOYA 4JRPA 1TU0B 1G3SA 2DZCA 3LWIA 1KD1C 1WXTA 1VQOA 4AFZC 2DJQA 3X25B 2CDTA 4QVZA 2ATCB 1X27A 1H8KA 1WQ7A 3ZBDA 1AT1B 1GCQC 3M0SA 1N27A 2JT4A 1E6GA 4M7AB 3HL8A 1HJDA 4C92G 2EKOA 3OW2S 2RI5A 3X24B 4J9DA 3KFVA 4E2FB 3CCMQ 1NYFA 1JJ2A 3JCMW 4M75F 2L0AA 3QXEB 1PKTA 5IN1A 4MMKA 5GMKm 1VQOQ 2DXCA 3H0FA 2F5KA 1TG0A 1UGSB 2IPOB 4FYVB 5IHKA 3JRZA 1W2BP 4C0FA 4OMOA 4C8QD 3E9FA 1YCSB 1FMKA 3DB3A 2KYBA 1M8VA 3CMET 4ESRA 1D3BA 5HKCA 1K0XA 2PNIA 4AMCA 3O5ZA 3VUBA 1X01A 2CP6A 3OS0A 4LXCA 4Z89A 3CMAA 1XOVA 3V8KA 1M3AA 5LJ3e 2AZVA 2CZ1B 4F7UE 2DYIA 2E5KA 1AWOA 2DAQA 1OZ2A 2NYSA 2EYXA 3ME9A 3L42A 2JVVA 4LDXA 3VU3C 2V26A 3EGXB 4FT4A 1VA7A 1YJNT 3EHRA 1UHFA 1QP3A 4IUTA 1XJWB 4M7DC 4F7UA 3OYKA 2YLCA 4CC2A 1U5SA 4DBQA 1HSQA 3P8HA 3CMAQ 5GAN8 4RTXA 2IIMA 4C8QB 2NUPA 2XDBA 2E5QA 4F17A 1FYNA 3EG0A 2M0YA 1BBZA 4V2SA 3LLRA 3VV0A 3C4SA 2OAUA 4KH1B 1K73U 1PD0A 2DIGA 1K4US 4B9XA 2EBPA 4HVVA 2DNUA 3M0PA 4KGVB 4QKUA 2FRYA 4PLIA 1JEGA 4QT7A 1W2BS 1VOMA 3EG9A 2CYZB 2BE7D 2KXCA 2VB6A 2OAWA 2K4YA 5HK0A 1B34B 2DPPB 1KG1A 2A36A 4ELZC 1UGPB 5CKHA 2RJEA 1Y57A 2KRSA 5GAMg 1M30A 2D8HA 1M90C 2CUDA 2OI3A 3R6OA 3BE3A 4LNPA 3EFOB 3OY9A 4M77E 2DXUA 2PUOB 4WCIA 1M1KU 3EG3A 1YWOA 3I9QA 1AWXA 2P0PA 1I4K1 3G4ST 2OTJT 2ZAEA 3OYBA 2JZ2A 1KHIA 2YRDA 3EGDA 1ZSGA 2X4XA 4L5GA 3JB9F 2CT4A 2QG9B 4M77A 3G7ZA 4A4GA 3QJ6A 4FW2A 1U1TA 3URGA 1D0YA 2X4WA 1BIAA 4XTWA 2DF6A 4C92E 3M54A 3FJ5A 1IRXA 1OOTA 1YJNA 1HXDA 2DXBA 2EYWA 2DL4A 4F04B 2A08A 2D0NA 1PSFA 3HRUA 2MWPA 1YITQ 4EMKB 2AIRB 1X69A 4C92A 3NTIA 3CCUT 4EDUA 3EG1A 2J6FA 3KBGA 5GMKj 1M4ZA 4M75C 5GAOm 1PSEA 1C0MA 2P0KA 1CSKA 3SFMA 1SKUB 8AT1B 3LGFA 1GCPA 3PMIA 2MPXC 5I11A 5J39A 4GY5A 5GAOq 3JB9D 2YRVA 1UHCA 1KSWA 2LT1A 1BI1A 4EIKA 4E7ZA 2VGNA 2LDMA 3OYJA 2ZPGB 2XD0A 3HP9A 4QQ6A 5GMKe 3OW2A 2QQBA 3L2UA 5EG2A 1H3ZA 4PK4A 3QYGB 1KC8C 4PNOA 1MGQA 3G4SA 2OTJA 3FC3A 4EMKC 1X75C 2ZPHB 3OA6A 2F2WA 1GBQA 2VVKA 1QW1A 1VYUA 2J7IA 2D6FA 4J83A 2HZYA 3OSVA 2FL7A 1BI2A 3PVLA 3UF4A 2ENMA 1CKAA 3JCMe 2V8JA 2PVGB 4KULA 3G4SQ 2OTJQ 2PU9B 3M59A 1E6HA 2QASA 2LJ1A 4NS5A 4VUBA 1PRMC 2RHYA 1UJ0A 3PMTA 1D0ZA 2CH4W 4Z8AA 2EFIA 4DA4A 1RADB 3MJXA 1S72T 1Y0MA 3RR6A 3SEMA 2QTXA 5IAYA 3FIFA 4J9IA 3G71Q 3LYIA 1X2KA 5GANf 1I07A 2E4HA 3NPFA 5CIUA 1Y07A 1T3LA 3HKSA 2DIQA 2YUPA 1NZ9A 2F5TX 4LDUA 4N0AA 2KEAA 2HL5C 5LJ3h 4ATOA 4XU2A 2P84A 1UDLA 1MMNA 4E7HA 1G3WA 4JRQA 4HCKA 1WI7A 1BK2A 4RTVA 3V7CA 2FZCB 3M0QA 1S1NA 1KD1R 4RCBA 3PIOA 3HFOA 2XU8A 1PKSA 3H0HA 4BY6C 2COZA 2W0ZA 2K9GA 5CR2A 3M0TA 1W2BA 2YRCA 3S3NA 4O6JA 2DJZA 5L23A 2L3SA 5GAOn 3A8GB 2O9VA 3OB9A 4ZGJB 4AFUC 4OGCA 2GNCA 3OMCA 1MV3A 1G3YA 2RJFA 2O4XA 3A8HB 4PJNA 2QI2A 1LOJA 1I1JA 2DO3A 2HQEA 4XU1A 1SHGA 2JMAA 3VS3A 2DTIA 3E1SA 3SWNA 1LJOA 1I0CA 3MPUB 3CBOA 1WXBA 1WDXA 4PFOA 4PKCC 2M1HA 5I21A 2LMJA 4HVUA 2F2XA 4WTOB 1RAAB 1G8XA 3OYAA 1GL5A 3M56A 4D6WA 1OX9A 4XAXB 1S72A 2L5QA 1O75A 4M7DG 1Q81C 2DX1A 2DXTA 2EGAA 2M9UA 3CCST 2FG0A 1D1AA 2C0IA 3CCLQ 2H3JA 4OB1B 2X3WD 1Y71A 1YNZA 1RAHB 3JSCA 3CCVA 2J06A 1D09B 1IHVA 5CAIA 1VQ7T 1S72Q 2RO0A 1ZA2B 5D7UA 2MAMA 5CQYA 2K6DA 2E3HA 3L1AA 4JLGA 4GLMA 2YDLA 2HBPA 4IUVA 1GBRA 3GNGA 4DBHA 2DD5A 3LW5E 3CCVQ 2V8IA 2H8HA 2L3RA 3ER0A 4PJOA 5IXFA 1WLPB 4QW2A 1VQPQ 2CZ7B 4FSXA 4PJOD 4A4KA 4RCCA 2CSIA 5GJVB 1RL2A 3RKXA 1DJ7B 1OI1A 5IXBA 2HEQA 2BTTA 3PNWC 1BCMA 4J9FA 4RUGA 1G2BA 3VJPA 5GAN5 3EAEA 2DMOA 1BYMA 1KHCA 3C12A 3EH2A 4BDYA 5GMKh 3DLMA 1QVGP 1M90R 4GBQA 4OMQA 5FWCA 3HRSA 2HMAA 3CEYA 3TSWA 1YI2T 4HXJA 3OBWA 4M78F 1WYXA 1GXIE 5KYXB 4OB0B 2CP3A 1WHJA 4C0ZA 3CCSA 2EPDA
chains in the Genus database with same CATH topology
3CD6A 1M1KC 3OMGA 1D3BA 2VC8A 3CXCA 4BE2A 2CKKA 3CC7T 3EFRA 5A0GA 3BFMA 2RJCA 1XNIA 4M75G 3UPUA 2HD0A 5HKCA 1FWZA 5L8RE 2JTMA 1QVFS 2JN0A 3JCMf 3CCQA 3MP1A 4J6WA 3CPWA 1VQ5A 3VUBA 1K8AU 1X01A 3OS0A 3CCLA 2WSCE 3TU4K 1YI2A 1YCYA 4M7AG 2KQWA 4PLLA 1XOVA 3CMAA 4X9CA 1VQ7A 3JB9H 4PJOB 5CVIA 4A53A 3V8KA 4ZN1A 5GAN4 3L2RA 5LJ3e 2QXFA 4LDVA 2OTLT 2CZ1B 1I81A 3SDZA 3WVEB 2GFAA 3JCMQ 4F7UE 3JCMh 4M78G 2E6NA 1HK9A 3A8OB 2RHXA 2X35A 4CRIA 2DAQA 1OZ2A 5GANd 1U1SA 3INZA 1VQMA 4NL3A 1YIJA 2YLBA 3ME9A 1G3TA 5IT9E 4JS4A 4IUUA 3L42A 2JVVA 2PQWA 5I2MA 3UT1A 4LDXA 3VU3C 1N8RU 1Y7XA 1Y96B 4FT4A 4JUVA 2HAXA 1YJNT 1K9MC 3JCMc 1QP3A 4PJOF 3M55A 4IUTA 1KD1U 2VXEA 4M7DC 1P92A 3SD4A 4F7UA 3OYKA 2YLCA 3M5AA 2KAFA 1KQ2A 1NJIC 4FM4B 3M57A 3EFSA 3P8HA 3LWHA 1M5Q1 5GAN8 3H6ZA 4C8QB 4R56A 5FU6B 3OS2A 4JRKA 1YJ9T 4M78D 4XU0A 2E5QA 3L2WA 2XDBA 5GAN2 2JTFA 3TCJA 2VYTA 3P8DA 3OYFA 4BACA 4QQDA 3S3MA 5HY6A 1VQ5T 4V2SA 1RI0A 2CZ0B 3RMQA 3QZ5B 3LLRA 3RUXA 1UEBA 3VV0A 4JJNK 3AHUA 3C4SA 2OAUA 1VQPA 1K73U 2LNVA 2BUDA 5GAN6 1YHQA 2DIGA 3NTKA 5LJ5f 2DKGA 3FJPA 4B9XA 4OB2B 4HT8A 3OYHA 3GF5A 5I2SA 3BDLA 4L59A 3H8ZA 1WJSA 1VIEA 4PLIA 1YBYA 1ZBXA 3RESA 1W2BS 1VQ8T 2CYZB 1OYXA 4PJOG 5GMKl 2O4XB 2FYKA 1Q7YC 2GCXA 2EYQA 1YIJT 2GQVA 1FX7A 2K4YA 3MO8A 4M77C 2R5AA 5HK0A 1VQLA 2RHZA 1B34B 2DEQA 2DPPB 1H641 2JOYA 3MEAA 3SWNB 4C0DC 2XHCA 2RI2A 2LX9A 2EJ9A 1UGPB 5CKHA 2RJEA 4ELZC 4QVCA 3OYMA 5GAMg 3RKWA 4BY6B 3V8JA 4MZPA 1M90C 2VXFA 2PUKB 4FL6A 3X26B 1EIFA 2GF7A 1JBMA 4JDSA 3SB2A 3R6OA 2QQAA 3VKIA 1NPPA 2R5MA 2QDYB 3WVDB 4J6YA 3CCRA 4E7KA 5KH6A 3OY9A 4M77E 2DVEA 3CBMA 3MP6A 3CC2T 2DXUA 2EQKA 2PUOB 5GAOp 4J7IA 4BB7A 3CC7A 5C6SA 3CCUA 1M1KU 2RHIA 4HA8A 4QQGA 2P0PA 1VQ4T 5CO7A 1I4K1 3G4ST 2OTJT 2F69A 5KE3A 3OS1A 4C8QG 2JZ2A 3OS5A 3OYBA 1KHIA 2E6ZA 3ASKA 2BIVA 4C92C 1V29B 1VQNT 3MEVA 2X4XA 1KG1A 3P8BB 4L5GA 4HCBA 1YHQT 2P0QA 4M78B 3JB9F 3GNFB 1N6AA 1WJRA 4IUQA 4M77A 4NL2A 2L89A 4TVRA 4LD9K 3G7ZA 2C06A 2RD1A 4A4GA 2OTLA 2A3LA 3QJ6A 3J7AF 1U1TA 2EWNA 3URGA 3LH0A 3RIRA 1VUBA 2X4WA 5J26A 4MZTA 1BIAA 4A4FA 4XTWA 4C92E 2QQ9A 3A8LB 4MDWA 2VV5A 3M54A 2ZPFB 3CBPA 3RKYA 1VQ9T 5LJ3j 4F7UF 2ZGWA 5KCOA 1IZ6A 2ZPIB 1YJNA 1HXDA 3BY7A 4LD6A 3JCMP 2DXBA 4DOVA 2LQKA 5GAMe 4OF1A 3TEEA 2LT4A 4A4EA 1PSFA 1X6OA 3PFSA 2MWOA 3GLXA 3HRUA 2MWPA 4X34A 4Y91A 4E7JA 4EMKB 2D9TA 5GAMd 1U8RA 4KBMB 5LJ5e 1ZQ1A 5DLOA 4C92A 1Q82C 3NTIA 3CCJT 3LX7A 3CCUT 3JB9G 4EDUA 1YJ9A 4ZTJA 2DK3A 3KBGA 5DY9A 5GMKj 1I5LA 1M4ZA 4M75C 3FEOA 5GAOm 3RMSA 4MDXA 4JRIA 1YITT 2R57A 3OYIA 1VQ6T 3HSBA 4P5NA 3E19A 1PSEA 2P0KA 2XK0A 3QKJA 3SFMA 4J5YA 5HK3A 1AHJB 4XK8E 4M7AC 3T9NA 3LGFA 3M4YA 3PMIA 3S6WA 5J39A 3M4GA 3F70A 2XDDA 1VQ8A 4GY5A 5LJ3d 3BDUA 3MEWA 5GAOq 4M75E 3JB9D 2YRVA 3HHTB 2K5LA 1UB4A 3FRNA 4JS5A 1Q7YU 2LT1A 1BI1A 4ZN3A 2VGNA 2LDMA 3M58A 2ZPGB 3JCMg 3OYJA 2XD0A 3HP9A 4M7AE 1Q86C 1KQSS 4QQ6A 2AHJB 5GMKe 2XKOC 3OW2A 4IKFA 1M90U 2QQBA 3L2UA 3DKMA 5EG2A 3L2ZA 1H3ZA 2MI6A 2PVOB 3OSSC 3JCMX 4LDWA 2K5FA 1QVPA 2RK1A 1UGQB 4EPCA 1JJ2S 3CC2A 3QYGB 3QSUA 3V7SA 2XICA 2M16A 5KE2A 1KC8C 4DQ2A 4PNOA 1BI0A 2P4TA 1MGQA 4M7AA 1VQ4A 3G4SA 2OTJA 3FC3A 4EMKC 1X75C 2ZPHB 3KXTA 3CCET 4M77F 4N4HA 4OP0A 5DLQE 3OA6A 1VQNA 2I2LA 1QVGS 2E41A 1QW1A 3N5BB 3CC4T 2D6FA 2WACA 1NE8A 4HT9A 4J83A 1WPYA 3OSVA 2K5IA 3NFCA 4J6XA 2FL7A 4B9WA 3PGGA 1BI2A 1WGSA 5A0LA 1D3BB 1XQHA 3GP8A 1BKBA 3CPFA 4M7DA 3HPWA 4PJOC 4KUDK 2RJDA 3OYLA 3OQ5A 3QG1A 5D6YA 1VQ9A 2CGHA 1YJWT 4N0AC 2X4YA 4M7DD 4FU6A 3CXCS 3JCMe 2IVWA 2V8JA 2PVGB 3V7RA 4KULA 4J8OA 3DB4A 1O9SA 3QIIA 2VGMA 1QVFA 2PVDB 4C92F 2PU9B 3MEUA 2EAYA 3M59A 3GIBA 4XTZA 4R55A 3CPWS 2LC4A 4NS5A 4PJOE 4VUBA 3CCJA 1XTDA 1TH7A 2JNGA 2RHYA 3VYGA 3PMTA 3G6ET 4DA4A 2EFIA 4XQ3A 4RG2A 1Q82U 5GAMj 3I56T 1BI3A 5M9OA 1S72T 2D0QB 5C0MA 2QTXA 5IAYA 3OYYA 3FIFA 1YITA 3META 1VQ6A 3HRTA 4F7UB 5LJ5j 3LYIA 3JB9J 4C8QC 5FU6C 5GANf 5A0DA 5GAOl 4E7LA 3ZEHA 4CI0C 3KUFA 5CIUA 1Y07A 3HKSA 1VIFA 2DIQA 3C94A 4UC4A 1NZ9A 2F5TX 1WQWA 4LDUA 4N0AA 4XTVA 3S3OA 2XIDA 4LDYA 4BUGA 4M77D 3O8VA 2K3XA 5LJ3h 4BDZA 4II1A 4ATOA 4RG8A 3ZFJA 5GANh 4XU2A 3G71T 2RA2A 4A54A 3J81E 5CK9A 4E7HA 1SSFA 4FT2A 4C8QE 3PIPA 1G3WA 2XG8D 2HQXA 1Y96A 3QHSA 3X20B 4E47A 4JRQA 4J7FA 2O01E 3UWNA 1NPRA 5FRNA 2CZ6B 4OGEA 4DOWA 1K9MU 3V7CA 4JLIA 1Q86U 4RCBA 3SWNC 4EMHA 3PIOA 3HFOA 2XU8A 3MP8A 2FVUA 4O5VA 1NJIU 4M7DB 2FHDA 2ZZDA 2E12A 4BY6C 3FLGA 3I55T 2MF2A 4C8QA 3CCMT 4M7AF 5LJ5d 3OYGA 5D6WA 4PL6A 5CR2A 5LJ5g 2FB7A 1KC8U 2DZ9A 2E70A 3C95A 4C92D 1W2BA 3S3NA 4O6JA 2IG0A 3X28B 2DJZA 1VQOT 4XTYA 3CCEA 2V8KA 1M9SA 5FRMA 1VQKT 5LL6S 3UDCA 3CC4A 4OMFB 2E64A 2QEXA 1WNLA 5KCHA 5GAOn 2K57A 3A8GB 3QJYA 1N9SA 4A4HA 4F7UG 3QZ9B 4M7DF 3OB9A 3MHXA 2QQRA 2Y90A 4OGCA 3OMCA 4ZGJB 2KMTA 3TREA 4Y28E 4MZMA 1G3YA 2RJFA 2DD4A 2O4XA 3A8HB 4KT0E 3V8LA 5GAN7 2QI2A 4HKEA 1LOJA 1I8FA 3QUIA 4M78C 2DO3A 3LGLA 2HQEA 3Q1JA 4WF2A 4XU1A 1UGRB 2DTIA 2K3YA 3E1SA 1B34A 3SWNA 1LJOA 3A5ZB 3JCMV 5FROA 2QA4T 1BIBA 2L8DA 4BI4A 4EMGA 1YJWA 1KQ1A 4OVAA 5CKFA 4Z02A 5GAN3 3CBOA 2KK4A 4XTUA 3JAME 4M77B 5J3BA 4ZTFA 2GFUA 4PKCC 2M1HA 3GPLA 5CKEA 5I21A 4C0DB 2E65A 2KY9A 4M75A 5GANe 3DLLA 2M0OA 4OB3B 1ZHIA 4M78E 4XU3A 3OYAA 1G5VA 3M56A 4ZGEB 4Q5WA 4N4IA 4D6WA 5GMKi 3OYDA 4IURA 1IREB 3G6EA 3GOXA 4BI3A 2DTOA 1JRIA 2WSFE 4M75D 4RKUE 4XAXB 3I56A 4FIBA 1S72A 2L5QA 1O75A 4M7DG 2JUFA 1Q81C 3E9GA 5FU7B 3OYNA 2DXTA 2B8AA 4ELYC 4BE1A 2EQUA 3PTAA 2E10A 2M9UA 3M9QA 5DM7R 4M7AD 3OBYA 3CCST 2QEXT 3A8MB 2LTOA 2KVQG 2XI9A 4M78A 3L2QA 1OZ3A 3HFNA 2H3JA 3CD6T 2RHUA 4C92B 4M7DE 4OB1B 1Y71A 5CKDA 3MCAB 3RERA 4QVDA 2RI3A 3JSCA 3QDRB 3G71A 4XTXA 2LVMA 4KUIA 1K8AC 3OYEA 3CCQT 3CCVA 4C5IA 5GAMf 3PT9A 4RMOA 2NLUA 4E7IA 3JCMJ 3QO3A 3QYHB 5CKBA 1M1FA 3CCLT 2VUBA 5CAIA 1VQ7T 3CMAT 4IUPA 2ZPEB 2EIFA 2LCCA 2A7YA 3M53A 2RO0A 2X4JA 4BI8B 4YTLA 4HCZA 3JCMd 2LQ8A 2G3RA 2Y4XA 4C8QF 4EMKA 2MAMA 2WSEE 4GLKA 5CQYA 5CQXA 4M77G 5GAMh 3L2VA 2EJGA 2CS7A 3FDRA 3L1AA 2LRQA 2DTHA 4JLGA 3I55A 3CCMA 1VQMT 3J80E 3QBYA 5AYFA 1N8RC 2HBPA 4NOYA 2LCLA 5D6XA 4JRPA 2DZCA 1G3SA 2EQMA 2YHTA 4ME7A 4MMLA 4IUVA 5LJ5h 3LWIA 1KD1C 2QQSA 3GNGA 1VQOA 2BKDN 5LJ3f 1M1GA 2DD5A 1WJQA 1VQKA 3X25B 2EJFA 3LW5E 4C0GA 4QVZA 5GAOr 2V8IA 3ER0A 2L3RA 5FLXE 4M75B 4PJOA 1WQ7A 3ZBDA 2Y4YA 3VYHB 3CMEA 2XDPA 3JB9I 4QW2A 3OYCA 2K2VA 4C5GA 4HCCA 1N27A 2E1HA 2CZ7B 3QPHA 1KQSA 1R8OB 4FSXA 5FU7C 4L6V5 4PJOD 4A4KA 4M7AB 4RCCA 3HL8A 3VUZA 4C92G 3CCVT 2EKOA 3OW2S 2RI5A 2EQJA 2RH2A 3X24B 1RL2A 4BD3A 5A2QE 3RKXA 1DJ7B 1OI1A 4C5EA 1K73C 2QA4A 1LNXA 1JJ2A 3PNWC 2ZCFB 1VQPT 1QP2A 3JCMW 4M75F 5LJ3g 1N9RA 3VJPA 3QXEB 5GANg 1W4SA 4MMKA 3EAEA 5IN1A 5GMKm 5GAN5 1BYMA 3WXMB 1JB0E 1KHCA 2DXCA 2MMPA 2R58A 2F5KA 3C12A 5CCAA 4BDYA 5GMKh 2ZPBB 3DLMA 1QVGA 4N4GA 2RM4A 1MHNA 1UGSB 1VQLT 4ZGDB 3HRSA 3CEYA 1YI2T 4C5HA 2KSSA 3JRZA 3NTHA 4C0FA 1FXXA 2RB6A 3OBWA 4C8QD 3FB9A 4M78F 5GANj 2KDSA 2RK2A 3E9FA 1GXIE 4OB0B 3JCMb 4X9DA 1Q81U 3DB3A 4C0ZA 2HNIA 3CCSA 4BE0A 1M8VA 3CMET 3BW1A 3CCRT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CGH A;  4N0A C;  4M77 A;  2DTO A;  1JRI A;  4M75 D;  1D3B A;  2VC8 A;  4NL2 A;  4M7D D;  3EFR A;  2RD1 A;  3JCM e;  3BFM A;  3V7R A;  1U1T A;  4M75 G;  2EWN A;  4M7D G;  3RIR A;  2JN0 A;  2DXT A;  3JCM f;  4C92 F;  2E10 A;  4J6W A;  2EAY A;  4M7A D;  1BIA A;  3GIB A;  4XTZ A;  1X01 A;  4M78 A;  3JCM J;  4XTW A;  4PJO E;  4C92 E;  1YCY A;  1TH7 A;  3HFN A;  4M7A G;  3RKY A;  4X9C A;  3JB9 H;  4C92 B;  5LJ3 j;  4F7U F;  2ZGW A;  4A53 A;  4XQ3 A;  3V8K A;  5GAN 4;  4PJO B;  1HXD A;  3BY7 A;  5GAM j;  5LJ3 e;  3JCM P;  1I81 A;  5GAM e;  2QTX A;  3RER A;  4QVD A;  3JCM Q;  4F7U E;  3JCM h;  3FIF A;  4M78 G;  4XTX A;  4Y91 A;  4F7U B;  1HK9 A;  5LJ5 j;  3JB9 J;  4EMK B;  4C8Q C;  5GAM f;  5GAM d;  5GAN f;  5GAN d;  1U1S A;  3INZ A;  3QO3 A;  5LJ5 e;  5GAO l;  2YLB A;  4NL3 A;  4C92 A;  3JB9 G;  5CAI A;  3VU3 C;  1Y96 B;  4JUV A;  1WQW A;  4N0A A;  4XTV A;  3JCM c;  5DY9 A;  4PJO F;  5GMK j;  1I5L A;  4M77 D;  3JCM d;  4M75 C;  2VXE A;  5GAO m;  5LJ3 h;  4F7U A;  4M7D C;  4C8Q F;  2YLC A;  4JRI A;  4EMK A;  5GAM h;  5GAN h;  4M77 G;  4XU2 A;  3HSB A;  1KQ2 A;  2EJG A;  2RA2 A;  3L1A A;  2DTH A;  4A54 A;  4C8Q E;  3EFS A;  4J5Y A;  4NOY A;  1M5Q 1;  1Y96 A;  2DZC A;  2YHT A;  3QHS A;  4MML A;  4C8Q B;  5LJ5 h;  5GAN 8;  4JRK A;  4M7A C;  4M78 D;  4XU0 A;  5GAN 2;  3M4G A;  3V7C A;  4JLI A;  5LJ3 f;  5LJ3 d;  4RCB A;  3SWN C;  3BDU A;  5GAO q;  2EJF A;  4M75 E;  4EMH A;  3JB9 D;  4M7D E;  4V2S A;  3HFO A;  3RUX A;  5GAO r;  3AHU A;  4PJO A;  4M75 B;  1WQ7 A;  4M7D B;  4M7A F;  3JB9 I;  4C8Q A;  5GAN 6;  4HT8 A;  5LJ5 f;  5LJ5 d;  2DKG A;  3FJP A;  3JCM g;  2E1H A;  4M7A E;  2FB7 A;  2DZ9 A;  4C92 D;  4PJO D;  5GMK e;  4M7A B;  3RES A;  4RCC A;  2DJZ A;  4XTY A;  4PJO G;  4C92 G;  5GMK l;  2FYK A;  3RKX A;  3L2Z A;  4M77 C;  2E64 A;  3JCM X;  1LNX A;  3SWN B;  1B34 B;  1WNL A;  2DEQ A;  1H64 1;  5GAO n;  3JCM W;  4QVC A;  3QSU A;  2K57 A;  2EJ9 A;  1N9S A;  3V7S A;  4M75 F;  4F7U G;  5LJ3 g;  1N9R A;  4PNO A;  4DQ2 A;  4M7D F;  5GAM g;  1MGQ A;  2Y90 A;  3RKW A;  4MMK A;  5GMK m;  5GAN g;  3V8J A;  5GAN 5;  4M7A A;  2VXF A;  4EMK C;  3V8L A;  5GAN 7;  4M78 C;  1LOJ A;  1I8F A;  3QUI A;  4M77 F;  5GMK h;  4OP0 A;  1JBM A;  4WF2 A;  4XU1 A;  3SB2 A;  5LJ5 g;  2DTI A;  2I2L A;  2E41 A;  3SWN A;  1B34 A;  4J6Y A;  1LJO A;  2RM4 A;  3JCM V;  4HT9 A;  1BIB A;  1WPY A;  4EMG A;  4J6X A;  1KQ1 A;  4M77 E;  5GAN 3;  2DVE A;  3PGG A;  2DXU A;  4XTU A;  5GAO p;  4M77 B;  1D3B B;  4HA8 A;  2RB6 A;  4C8Q D;  5I21 A;  3FB9 A;  4M78 F;  2E65 A;  5GAN j;  1I4K 1;  4M75 A;  5GAN e;  3JCM b;  4M7D A;  4C8Q G;  4X9D A;  2HNI A;  1M8V A;  4PJO C;  4C92 C;  4M78 E;  4XU3 A;  3BW1 A;  3JB9 F;  5GMK i;  4M78 B; 
#chains in the Genus database with same CATH topology
 3CXC P;  3VRY A;  2CKK A;  3BFM A;  4J9H A;  2RJC A;  4M75 G;  1NYG A;  2DLP A;  2JTM A;  3QWY A;  4J6W A;  2HL3 A;  1M2O A;  3ULR B;  2YUN A;  1NLP C;  1OU8 A;  4ZNX A;  3TU4 K;  4PLL A;  1VQ7 A;  4PJO B;  3L2R A;  1I81 A;  2JTE A;  3JCM h;  2GQI A;  1E7O A;  3CCS Q;  1MMD A;  1K0S A;  5GAN d;  1RAG B;  1M2V B;  1YIJ A;  3VS6 A;  2HAX A;  3M55 A;  1KD1 U;  3REB B;  1U06 A;  3M5A A;  2DRM A;  1NJI C;  1SRM A;  3M57 A;  2CT3 A;  5KYU B;  3H6Z A;  1KIK A;  4R56 A;  3OS2 A;  4M78 D;  4XU0 A;  3L2W A;  4DEY A;  5GAN 2;  1SSH A;  9ATC B;  3QDF A;  5HY6 A;  3S3M A;  4OMP A;  4M7D E;  2CZ0 B;  2FO0 A;  2HKN A;  3RUX A;  1UEB A;  3PVQ A;  1YIJ Q;  1AVZ C;  4FYW B;  4D8D A;  2BUD A;  3TVT A;  4HT8 A;  5LJ5 f;  2DKG A;  3FJP A;  1PRL C;  2CSQ A;  3OYH A;  4R0K A;  1T0H A;  3JV3 A;  1VIE A;  1K9M R;  4JZ4 A;  1ZBX A;  3R6N A;  1OYX A;  2EYQ A;  2LQN A;  8ATC B;  3MO8 A;  2R5A A;  2DEQ A;  2JOY A;  1H64 1;  4C0D C;  1YI2 A;  1F1B B;  2RI2 A;  3OYM A;  2EJ9 A;  3CC2 Q;  1OV3 A;  2I0N A;  1KC8 R;  1VQ4 Q;  2FZK B;  2QTV A;  3SB2 A;  5LJ5 g;  4J9C A;  2R5M A;  4A63 B;  4J6Y A;  1VQN Q;  4E7K A;  5KH6 A;  1KQS P;  3MP6 A;  1D1C A;  5C6S A;  2JMC A;  4QQG A;  5CO7 A;  1SHF A;  1WIE A;  2CRE A;  3OS5 A;  3ASK A;  2E6Z A;  2BIV A;  3P8B B;  2P0Q A;  4M78 B;  3A98 A;  3GNF B;  1YI2 Q;  1N6A A;  4IUQ A;  2HQH A;  2MOX A;  4LD9 K;  2L89 A;  2C06 A;  2YUQ A;  4PJJ A;  3J7A F;  1A0N B;  1SF9 A;  3TQ7 P;  1UG1 A;  4MZT A;  2HCK A;  3QWX X;  4MDW A;  3CBP A;  2V1R A;  5LJ3 j;  4F7U F;  2ZGW A;  3BY7 A;  4LN2 A;  3JCM P;  1K76 A;  2LQK A;  5GAM e;  5I22 A;  2J05 A;  2KI7 A;  2BZX A;  4X34 A;  3GLX A;  4Y91 A;  2D9T A;  1VQ6 Q;  1PNJ A;  1ZQ1 A;  1Q82 C;  1TWB A;  3JB9 G;  1NBE B;  2KT8 A;  2HDA A;  1TXQ A;  2DK3 A;  1I5L A;  3FEO A;  3RMS A;  1YP5 A;  1YIT T;  1W70 A;  2R57 A;  2DEU A;  2K7A A;  3QKJ A;  2LX7 A;  1RAC B;  4J5Y A;  1AHJ B;  1OPL A;  4XK8 E;  4M7A C;  3RDV A;  2NUT A;  3M4Y A;  3S6W A;  3M4G A;  2XDD A;  2FPD A;  2ED0 A;  2X3X D;  4M75 E;  3HHT B;  4ZN3 A;  4Z88 A;  4DBF A;  1KQS S;  1RLP C;  4LUD A;  1M90 U;  1YWP A;  3OSS C;  3CC4 Q;  3JCM X;  2K5F A;  1QVP A;  2RK1 A;  2KRO A;  4M4Z A;  2XIC A;  5KE2 A;  1MND A;  1BI0 A;  2RN8 A;  2FPF A;  1H92 A;  1VYV A;  3KXT A;  3CCE T;  4M77 F;  2YWW A;  1ZUK A;  2K5I A;  4J6X A;  4AG1 C;  1G83 A;  4B9W A;  1YJW Q;  3PGG A;  3I35 A;  4AFQ C;  1WGS A;  5A0L A;  1D3B B;  1N5Z A;  2F2V A;  3HPW A;  2KGT A;  2RJD A;  3OYL A;  2Z0W A;  3OQ5 A;  3QG1 A;  2X4Y A;  3PE0 A;  4FU6 A;  2IVW A;  3DB4 A;  1B7T A;  5IHI A;  4C92 F;  2HBW A;  4R55 A;  1AD5 A;  2COY A;  3EG2 A;  1ABO A;  1BI3 A;  2D0Q B;  4KGX B;  3OYY A;  1YIT A;  4F7U B;  4C8Q C;  3ZEH A;  2EW3 A;  4AT1 B;  1VIF A;  1WQW A;  2NUP B;  4XTV A;  2XID A;  2RQR A;  4M77 D;  2K3X A;  4RTZ A;  3G71 T;  1C1A A;  1OX8 A;  5CK9 A;  2O9S A;  3I55 Q;  1X43 A;  2XG8 D;  2HQX A;  1Y96 A;  3QHS A;  2O01 E;  1NPR A;  4DOW A;  1K9M U;  1NM7 A;  3AT1 B;  1PM3 A;  3EG9 B;  2K3B A;  1RAE B;  2ZZD A;  5LJ5 d;  3OYG A;  1OU9 A;  5D6W A;  1KC8 U;  2DZ9 A;  2E70 A;  4C92 D;  1JO8 A;  2AKL A;  3X28 B;  4XTY A;  3CCE A;  5LL6 S;  2DL3 A;  2QEX A;  2K57 A;  3QJY A;  4A4H A;  1KJW A;  2DRK A;  4Y28 E;  2L3Q A;  3V8L A;  5GAN 7;  3QUI A;  3VS1 A;  1TUC A;  3EGD B;  3JCM V;  2QA4 T;  4EMG A;  2V1Q A;  2KK4 A;  1FMW A;  4M77 B;  5J3B A;  2XMF A;  2GTO A;  1M8M A;  3CCE Q;  5GAN e;  2M0O A;  1ZHI A;  4XU3 A;  2QEX Q;  3OYD A;  4BI3 A;  4KRT A;  4FIB A;  3NGP A;  1WHM A;  3OYN A;  1GRI A;  3PTA A;  5DM7 R;  3CCQ Q;  3A8M B;  3L2Q A;  2KVQ G;  2JS0 A;  1OZ3 A;  3CD6 T;  4C92 B;  2EVR A;  3RER A;  3G71 A;  2LVM A;  4KUI A;  1K8A C;  4C5I A;  1Z9Z A;  3QYH B;  5CKB A;  1M1F A;  3CCL T;  1VQM Q;  2VUB A;  1ZSZ A;  2M51 A;  2ZPE B;  1WHG A;  1Z9Q A;  2LQ8 A;  2Y4X A;  2WSE E;  5GAM h;  3L2V A;  1AWJ A;  2DL7 A;  2LRQ A;  2OJ2 A;  1N8R C;  2JM8 A;  2LCL A;  5D6X A;  4ME7 A;  4MML A;  2QQS A;  1ZBJ A;  1WHH A;  5GAO r;  4E7S A;  1T0J A;  4CC4 B;  5FWB A;  2Y4Y A;  3VYH B;  2XDP A;  3OYC A;  2VAS A;  2K2V A;  4C5G A;  4HCC A;  3QPH A;  1KQS A;  1R8O B;  4L6V 5;  1LVK A;  1ZUY A;  3CCV T;  1IO6 A;  2EQJ A;  4BD3 A;  4C5E A;  2QA4 A;  1TOV A;  1V1C A;  2ZCF B;  1VQP T;  1QP2 A;  4D8K A;  1UFF A;  4FCY A;  1N9R A;  3TSZ A;  5GAN g;  3WXM B;  1JB0 E;  1QCF A;  2CUB A;  2ZPB B;  4N4G A;  1R0C B;  2O2O A;  4OMN A;  1VQL T;  2KSS A;  2FRW A;  3NTH A;  3CC7 Q;  1FXX A;  2W10 A;  1QWF A;  1Q95 G;  2E3I A;  1Q81 U;  1QQJ A;  2HNI A;  2QA4 Q;  3BW1 A;  3CD6 A;  4BE2 A;  2VC8 A;  1XNI A;  2HSP A;  2HD0 A;  2AT1 B;  1FWZ A;  5L8R E;  3JCM f;  3MP1 A;  1VQ5 A;  3CCL A;  1QKX A;  3VS2 A;  2WSC E;  4JJD A;  4M7A G;  4A53 A;  1ZX6 A;  3SDZ A;  4E6R A;  3JCM Q;  2DET A;  4OMM A;  4M78 G;  3A8O B;  2RHX A;  4JJB A;  4CRI A;  3INZ A;  4NL3 A;  2YLB A;  4X1V A;  3CD6 Q;  2PQW A;  2M02 A;  1Y7X A;  2JJ9 A;  1Q82 R;  4JUV A;  2MCN A;  1TUG B;  4PJO F;  1HYO A;  1T3S A;  1P92 A;  4J9B A;  1VQ5 Q;  1PG5 B;  1KQ2 A;  4FM4 B;  3EFS A;  1UJY A;  1M5Q 1;  2RMO A;  5FU6 B;  1TS9 A;  2VYT A;  4BAC A;  1PCX A;  2KYM A;  3QZ5 B;  4JJN K;  3M0U A;  3VS5 A;  1VQP A;  1YHQ A;  2DBK A;  1MMG A;  1K1Z A;  3GF5 A;  5I2S A;  3BDL A;  4L59 A;  3HTR A;  1WJS A;  2KT1 A;  1YBY A;  3RES A;  1VQ8 T;  4AG2 C;  5GMK l;  2O4X B;  2FYK A;  1Q7Y C;  2GCX A;  1YIJ T;  2GQV A;  1RUW A;  1VQL A;  3SWN B;  5KYW A;  2L2P A;  4LUE A;  5EC7 A;  2MYS A;  2PTK A;  2RQW A;  4FYY B;  2X51 A;  4MZP A;  2PUK B;  3X26 B;  1EIF A;  4JZ3 A;  2GF7 A;  1JBM A;  1IB8 A;  2FZG B;  3UA6 A;  3WVD B;  1JXM A;  1YHQ Q;  1BCO A;  3CC2 T;  5GAO p;  4J7I A;  4IIM A;  4ANJ A;  2FPE A;  2RHI A;  4HA8 A;  4K11 A;  2BE9 B;  1VQ4 T;  4C8Q G;  1ZLM A;  2ED1 A;  1V29 B;  1VQN T;  1VQL Q;  2KRM A;  4NL2 A;  4TVR A;  2QGF B;  1WZO A;  4PFP A;  2A3L A;  1J3T A;  2DVJ A;  1MMA A;  1VUB A;  3D7S B;  2QQ9 A;  3RKY A;  1GCQ A;  1IZ6 A;  4LD6 A;  2J6K A;  1OEB A;  4DOV A;  4OF1 A;  2A0F B;  2MWO A;  3VS4 A;  2B86 A;  1U8R A;  5LJ5 e;  3CCJ T;  2D1X A;  1W6X A;  4ZTJ A;  3CPW P;  3OYI A;  1VQ6 T;  4P5N A;  3NHN A;  3RNJ A;  2LJ0 A;  3F70 A;  1VQ8 A;  3SHW A;  2RQU A;  3MEW A;  1UB4 A;  3FRN A;  2MK5 A;  4JS5 A;  3M58 A;  3REA B;  4M7A E;  1Q86 C;  2AHJ B;  1PHT A;  2DL8 A;  3OW2 P;  2XKO C;  2YXY A;  4IKF A;  3DKM A;  3L2Z A;  2MI6 A;  1EFN A;  3EHQ A;  4EPC A;  3CC2 A;  1M27 C;  2M16 A;  2P4T A;  3M0R A;  4M7A A;  1VQ4 A;  1VQ8 Q;  3I5R A;  4N4H A;  4OP0 A;  5DLQ E;  3UA7 A;  1VQN A;  1QVG S;  2E41 A;  3N5B B;  3CC4 T;  2WAC A;  3NFC A;  1ZA1 B;  1XQH A;  2EGE A;  3CPF A;  2C0O A;  4M7D A;  2LZ6 B;  1QMC A;  4PJO C;  4KUD K;  3VS7 A;  2CGH A;  1YJW T;  4M7D D;  5AT1 B;  3CXC S;  3I56 Q;  1O9S A;  4KH0 B;  3GIB A;  4XTZ A;  3CPW S;  2LC4 A;  2AZS A;  2NWM A;  3CCJ A;  1XTD A;  1TH7 A;  2JNG A;  3VYG A;  3G6E T;  4XQ3 A;  1Q82 U;  5GAM j;  5M9O A;  2DM1 A;  5C0M A;  1QCN A;  1VQ6 A;  5GAO l;  5A0D A;  1K8A R;  2YSQ A;  2X9H A;  4UC4 A;  1AOJ A;  2P4R A;  1R0B G;  1X6B A;  3S3O A;  4BUG A;  1W1F A;  3LH5 A;  4BDZ A;  4II1 A;  2CH4 A;  2QYZ A;  1FMV A;  1MV0 B;  3CCJ Q;  1SSF A;  3H0I A;  4C8Q E;  3PIP A;  2SEM A;  1WA7 A;  3EGX A;  1N8R R;  4J7F A;  2KR3 A;  5FRN A;  2CZ6 B;  2ROT A;  2KBT A;  4JLI A;  3ZL7 C;  4CC7 A;  1ZUU A;  4EMH A;  2QAZ A;  2FVU A;  4M7D B;  2FHD A;  3I55 T;  2E12 A;  2MF2 A;  4C8Q A;  2LJ3 A;  2GGR A;  1UGV A;  1QKW A;  5FRM A;  1VQK T;  3UDC A;  2DE0 X;  3CC4 A;  1N9S A;  5FW9 A;  3QZ9 B;  1KFZ A;  3A1P A;  2QQR A;  2Y90 A;  2KMT A;  4MZM A;  2DYB A;  4KT0 E;  4M78 C;  4A4E A;  1I8F A;  4LE9 A;  4E7J A;  3LGL A;  2K3Y A;  1B34 A;  2EYZ A;  4BI4 A;  1YJW A;  1WX6 A;  4OVA A;  5CKF A;  4XTU A;  3JAM E;  3GPL A;  4Y92 A;  2E65 A;  4M75 A;  1AZG B;  4OB3 B;  1H3H A;  1G5V A;  3EFO A;  4Q5W A;  3G6E A;  3GOX A;  4IUR A;  1IRE B;  2GBQ A;  2DTO A;  1JRI A;  4M75 D;  4RKU E;  1UEC A;  2JUF A;  5HCK A;  2ROL A;  5FU7 B;  1JU5 C;  2B8A A;  4ELY C;  3M9Q A;  2QEX T;  1RAI B;  2RHU A;  3NMZ C;  5CKD A;  2O31 A;  1UTI A;  4QVD A;  2RI3 A;  3QDR B;  3CCQ T;  4E7I A;  5GAM f;  6AT1 B;  3QO3 A;  3G6E Q;  1QWE A;  4RTU A;  1YN8 A;  4IUP A;  3H41 A;  2NUT B;  2OX7 A;  1QVF P;  3M53 A;  2X4J A;  4BI8 B;  4YTL A;  4HCZ A;  1Q81 R;  4EMK A;  3H9N A;  1TSF A;  2EJG A;  3FDR A;  2DTH A;  3I55 A;  1VQM T;  1IXD A;  3QBY A;  2YHT A;  5LJ5 h;  2EQM A;  2BKD N;  5LJ3 f;  2LNH B;  1M1G A;  1VQK A;  1WJQ A;  2D8J A;  2EJF A;  3EGU A;  4C0G A;  5FLX E;  4M75 B;  3CME A;  3JB9 I;  2AKK A;  2E1H A;  1IGU A;  5FU7 C;  1ACM B;  1GFC A;  3VUZ A;  5A2Q E;  2RH2 A;  2VKN A;  2BZ8 A;  1K73 C;  2DL5 A;  1NEG A;  1LNX A;  1Q7Y R;  2CP5 A;  5LJ3 g;  1I5O B;  2QGG A;  1UUE A;  1W4S A;  1VQK Q;  4OML A;  2R58 A;  2MMP A;  5CCA A;  1QVG A;  2RM4 A;  1MHN A;  2J6O A;  3CME Q;  2O88 A;  1VYT A;  4ZGD B;  1NEB A;  2EKH A;  4ORZ A;  4C5H A;  1ARK A;  2RB6 A;  3FB9 A;  5GAN j;  2KDS A;  2RK2 A;  4RTW A;  3JCM b;  4X9D A;  4BE0 A;  4RTT A;  2NUZ A;  3CCR T;  1M1K C;  1MUZ A;  3OMG A;  3CXC A;  1RI9 A;  3CC7 T;  3EFR A;  2CP7 A;  5A0G A;  1AEY A;  3UPU A;  3IQL A;  2RF0 A;  5KYY A;  2JN0 A;  1QVF S;  3CCQ A;  1BU1 A;  3CPW A;  1K8A U;  5IHN A;  1YCY A;  2KQW A;  4X9C A;  3JB9 H;  2KRN A;  5CVI A;  4ZN1 A;  5GAN 4;  2QXF A;  1YJN Q;  4LDV A;  2OTL T;  3WVE B;  2GFA A;  4J9G A;  2E6N A;  1HK9 A;  2X35 A;  2EYY A;  1U1S A;  1VQM A;  1B07 A;  5IT9 E;  1G3T A;  4JS4 A;  4IUU A;  4PJL A;  3UT1 A;  5I2M A;  1N8R U;  1KK7 A;  1Y96 B;  1K9M C;  3JCM c;  3EH1 A;  2VXE A;  1EX4 A;  2C0T A;  3SD4 A;  2KAF A;  2H3E B;  2QK0 A;  3LWH A;  2EQI A;  5GJW B;  1YJ9 T;  4JRK A;  2RQT A;  1RLQ C;  2JTF A;  3TCJ A;  2RNA A;  3P8D A;  3OYF A;  4QQD A;  3MKD A;  1VQ5 T;  1RI0 A;  3RMQ A;  3AHU A;  1M3B A;  2LNV A;  5GAN 6;  3NTK A;  4OB2 B;  1HD3 A;  2K2M A;  3H8Z A;  2DBM A;  3E2U A;  1Q86 R;  4PJO G;  1X6G A;  1FX7 A;  4M77 C;  5KYY B;  1NJI R;  2RHZ A;  3MEA A;  4QVC A;  2XHC A;  2LX9 A;  4J9E A;  2CP2 A;  3RKW A;  4BY6 B;  3V8J A;  2VWF A;  2G6F X;  2VXF A;  4FL6 A;  2YUO A;  4JDS A;  3VKI A;  2QQA A;  1NPP A;  1OPK A;  2QDY B;  3CCR A;  2HSE B;  5IH2 A;  2DVE A;  2L3P A;  3CBM A;  2EQK A;  3CC7 A;  3CCU A;  4BB7 A;  1JXO A;  1X2Q A;  1TUD A;  2F69 A;  5KE3 A;  3OS1 A;  2EGC A;  1NG2 A;  1JJ2 P;  4C92 C;  3MEV A;  4PFZ A;  4HCB A;  2JS2 A;  1YHQ T;  2DER A;  1WJR A;  2ESW A;  4RTY A;  2RD1 A;  2OTL A;  2JW4 A;  2EWN A;  3C0C A;  3U23 A;  2JM9 A;  4IIO A;  3LH0 A;  3RIR A;  5J26 A;  4A4F A;  1GFD A;  3CCR Q;  2LCS A;  3A8L B;  4F14 A;  2VV5 A;  1WHK A;  2ZPF B;  1VQ9 T;  3CCU Q;  1ZSZ B;  5KCO A;  2ZPI B;  1D1B A;  3TEE A;  2LT4 A;  1X6O A;  3PFS A;  2DA9 A;  1WFW A;  5GAM d;  4KBM B;  1PC0 A;  5DLO A;  1PD1 A;  3LX7 A;  2MIO A;  4AFS C;  2CP0 A;  1YJ9 A;  7AT1 B;  4KGZ B;  2OTL Q;  3CQT A;  5DY9 A;  4JJC A;  2FEI A;  4MDX A;  4JRI A;  3HSB A;  4DEX A;  3E19 A;  2XK0 A;  5HK3 A;  4DBR A;  3T9N A;  3THK A;  2YT6 A;  5LJ3 d;  1QLY A;  3BDU A;  2K5L A;  1Q7Y U;  1YJ9 Q;  3JCM g;  2PVO B;  1ZSZ C;  4LDW A;  1JJ2 S;  1UGQ B;  3QSU A;  1ABQ A;  3V7S A;  4DQ2 A;  3I5S A;  1AZE A;  1LCK A;  2I2L A;  3G1J A;  2COW A;  2GTJ A;  5KYN A;  4HT9 A;  1NE8 A;  1WPY A;  2A37 A;  1C6V X;  2KXD A;  3GP8 A;  1BKB A;  1LPL A;  1WHL A;  1BB9 A;  5D6Y A;  1VQ9 A;  4N0A C;  3VS0 A;  2HKQ B;  3V7R A;  4J8O A;  2RPN A;  5KYX A;  3QII A;  2VGM A;  1QVF A;  2PVD B;  3MEU A;  2EAY A;  4PJO E;  4RG2 A;  3I56 T;  1RAF B;  2KE9 A;  3GBQ A;  1EZZ B;  2DFU A;  3MET A;  3HRT A;  5LJ5 j;  1AWW A;  1SRL A;  3JB9 J;  2ABL A;  5FU6 C;  4E7L A;  4CI0 C;  1VQ9 Q;  3KUF A;  1SEM A;  1D0X A;  3C94 A;  3VRZ A;  4LDY A;  1SG5 A;  4PJM A;  1K9A A;  3O8V A;  1RAB B;  2PZ1 A;  4RG8 A;  3ZFJ A;  5GAN h;  1M2V A;  2RA2 A;  4B6M A;  4A54 A;  3J81 E;  4FT2 A;  2K79 A;  2DIL A;  3UAT A;  3X20 B;  4FYX B;  4E47 A;  3UWN A;  4OGE A;  2KNB B;  1Q86 U;  4HVW A;  3SWN C;  3MP8 A;  4O5V A;  1NJI U;  1IGQ A;  5KYU A;  4FSS A;  3CCM T;  4M7A F;  3FLG A;  5KYW B;  4PL6 A;  1V76 A;  1M3C A;  2FB7 A;  1UE9 A;  2A28 A;  3C95 A;  1PWT A;  2IG0 A;  1VQO T;  2ECZ A;  1M9S A;  2V8K A;  4OMF B;  4F16 A;  2E64 A;  1WNL A;  1U3O A;  5KCH A;  1K73 R;  2AK5 A;  4F7U G;  4M7D F;  2F1L A;  4FW1 A;  3MHX A;  3TRE A;  1B3Q A;  1YFN A;  2DD4 A;  4HKE A;  3Q1J A;  4WF2 A;  1UGR B;  3A5Z B;  5FRO A;  1BIB A;  2L8D A;  1KQ1 A;  4Z02 A;  5GAN 3;  4ZTF A;  2GFU A;  1OQK A;  5CKE A;  4C0D B;  2KY9 A;  2LP5 A;  4CC3 A;  1JQQ A;  2JXB A;  3DLL A;  4M78 E;  4ZGE B;  4N4I A;  5GMK i;  1WXU A;  2WSF E;  3I56 A;  1M1K R;  1TTH B;  3RBB B;  3E9G A;  4BE1 A;  2EQU A;  2E10 A;  4M7A D;  3OBY A;  2LTO A;  1NLO C;  2XI9 A;  4M78 A;  3HFN A;  1CKB A;  1SPK A;  2SRC A;  1VQ7 Q;  2LQW A;  4JPB W;  3MCA B;  4XTX A;  3OYE A;  3PT9 A;  4RMO A;  2NLU A;  3JCM J;  2RQV A;  1MNE A;  2BZY A;  3CMA T;  2EIF A;  2LCC A;  2A7Y A;  1IHW A;  5ECA A;  3JCM d;  2G3R A;  1R77 A;  4C8Q F;  5CQX A;  4GLK A;  4M77 G;  2CS7 A;  3CCM A;  1OUL A;  3J80 E;  2QDL A;  5AYF A;  1QCO A;  4NOY A;  4JRP A;  1TU0 B;  1G3S A;  2DZC A;  3LWI A;  1KD1 C;  1WXT A;  1VQO A;  4AFZ C;  2DJQ A;  3X25 B;  2CDT A;  4QVZ A;  2ATC B;  1X27 A;  1H8K A;  1WQ7 A;  3ZBD A;  1AT1 B;  1GCQ C;  3M0S A;  1N27 A;  2JT4 A;  1E6G A;  4M7A B;  3HL8 A;  1HJD A;  4C92 G;  2EKO A;  3OW2 S;  2RI5 A;  3X24 B;  4J9D A;  3KFV A;  4E2F B;  3CCM Q;  1NYF A;  1JJ2 A;  3JCM W;  4M75 F;  2L0A A;  3QXE B;  1PKT A;  5IN1 A;  4MMK A;  5GMK m;  1VQO Q;  2DXC A;  3H0F A;  2F5K A;  1TG0 A;  1UGS B;  2IPO B;  4FYV B;  5IHK A;  3JRZ A;  1W2B P;  4C0F A;  4OMO A;  4C8Q D;  3E9F A;  1YCS B;  1FMK A;  3DB3 A;  2KYB A;  1M8V A;  3CME T;  4ESR A;  1D3B A;  5HKC A;  1K0X A;  2PNI A;  4AMC A;  3O5Z A;  3VUB A;  1X01 A;  2CP6 A;  3OS0 A;  4LXC A;  4Z89 A;  3CMA A;  1XOV A;  3V8K A;  1M3A A;  5LJ3 e;  2AZV A;  2CZ1 B;  4F7U E;  2DYI A;  2E5K A;  1AWO A;  2DAQ A;  1OZ2 A;  2NYS A;  2EYX A;  3ME9 A;  3L42 A;  2JVV A;  4LDX A;  3VU3 C;  2V26 A;  3EGX B;  4FT4 A;  1VA7 A;  1YJN T;  3EHR A;  1UHF A;  1QP3 A;  4IUT A;  1XJW B;  4M7D C;  4F7U A;  3OYK A;  2YLC A;  4CC2 A;  1U5S A;  4DBQ A;  1HSQ A;  3P8H A;  3CMA Q;  5GAN 8;  4RTX A;  2IIM A;  4C8Q B;  2NUP A;  2XDB A;  2E5Q A;  4F17 A;  1FYN A;  3EG0 A;  2M0Y A;  1BBZ A;  4V2S A;  3LLR A;  3VV0 A;  3C4S A;  2OAU A;  4KH1 B;  1K73 U;  1PD0 A;  2DIG A;  1K4U S;  4B9X A;  2EBP A;  4HVV A;  2DNU A;  3M0P A;  4KGV B;  4QKU A;  2FRY A;  4PLI A;  1JEG A;  4QT7 A;  1W2B S;  1VOM A;  3EG9 A;  2CYZ B;  2BE7 D;  2KXC A;  2VB6 A;  2OAW A;  2K4Y A;  5HK0 A;  1B34 B;  2DPP B;  1KG1 A;  2A36 A;  4ELZ C;  1UGP B;  5CKH A;  2RJE A;  1Y57 A;  2KRS A;  5GAM g;  1M30 A;  2D8H A;  1M90 C;  2CUD A;  2OI3 A;  3R6O A;  3BE3 A;  4LNP A;  3EFO B;  3OY9 A;  4M77 E;  2DXU A;  2PUO B;  4WCI A;  1M1K U;  3EG3 A;  1YWO A;  3I9Q A;  1AWX A;  2P0P A;  1I4K 1;  3G4S T;  2OTJ T;  2ZAE A;  3OYB A;  2JZ2 A;  1KHI A;  2YRD A;  3EGD A;  1ZSG A;  2X4X A;  4L5G A;  3JB9 F;  2CT4 A;  2QG9 B;  4M77 A;  3G7Z A;  4A4G A;  3QJ6 A;  4FW2 A;  1U1T A;  3URG A;  1D0Y A;  2X4W A;  1BIA A;  4XTW A;  2DF6 A;  4C92 E;  3M54 A;  3FJ5 A;  1IRX A;  1OOT A;  1YJN A;  1HXD A;  2DXB A;  2EYW A;  2DL4 A;  4F04 B;  2A08 A;  2D0N A;  1PSF A;  3HRU A;  2MWP A;  1YIT Q;  4EMK B;  2AIR B;  1X69 A;  4C92 A;  3NTI A;  3CCU T;  4EDU A;  3EG1 A;  2J6F A;  3KBG A;  5GMK j;  1M4Z A;  4M75 C;  5GAO m;  1PSE A;  1C0M A;  2P0K A;  1CSK A;  3SFM A;  1SKU B;  8AT1 B;  3LGF A;  1GCP A;  3PMI A;  2MPX C;  5I11 A;  5J39 A;  4GY5 A;  5GAO q;  3JB9 D;  2YRV A;  1UHC A;  1KSW A;  2LT1 A;  1BI1 A;  4EIK A;  4E7Z A;  2VGN A;  2LDM A;  3OYJ A;  2ZPG B;  2XD0 A;  3HP9 A;  4QQ6 A;  5GMK e;  3OW2 A;  2QQB A;  3L2U A;  5EG2 A;  1H3Z A;  4PK4 A;  3QYG B;  1KC8 C;  4PNO A;  1MGQ A;  3G4S A;  2OTJ A;  3FC3 A;  4EMK C;  1X75 C;  2ZPH B;  3OA6 A;  2F2W A;  1GBQ A;  2VVK A;  1QW1 A;  1VYU A;  2J7I A;  2D6F A;  4J83 A;  2HZY A;  3OSV A;  2FL7 A;  1BI2 A;  3PVL A;  3UF4 A;  2ENM A;  1CKA A;  3JCM e;  2V8J A;  2PVG B;  4KUL A;  3G4S Q;  2OTJ Q;  2PU9 B;  3M59 A;  1E6H A;  2QAS A;  2LJ1 A;  4NS5 A;  4VUB A;  1PRM C;  2RHY A;  1UJ0 A;  3PMT A;  1D0Z A;  2CH4 W;  4Z8A A;  2EFI A;  4DA4 A;  1RAD B;  3MJX A;  1S72 T;  1Y0M A;  3RR6 A;  3SEM A;  2QTX A;  5IAY A;  3FIF A;  4J9I A;  3G71 Q;  3LYI A;  1X2K A;  5GAN f;  1I07 A;  2E4H A;  3NPF A;  5CIU A;  1Y07 A;  1T3L A;  3HKS A;  2DIQ A;  2YUP A;  1NZ9 A;  2F5T X;  4LDU A;  4N0A A;  2KEA A;  2HL5 C;  5LJ3 h;  4ATO A;  4XU2 A;  2P84 A;  1UDL A;  1MMN A;  4E7H A;  1G3W A;  4JRQ A;  4HCK A;  1WI7 A;  1BK2 A;  4RTV A;  3V7C A;  2FZC B;  3M0Q A;  1S1N A;  1KD1 R;  4RCB A;  3PIO A;  3HFO A;  2XU8 A;  1PKS A;  3H0H A;  4BY6 C;  2COZ A;  2W0Z A;  2K9G A;  5CR2 A;  3M0T A;  1W2B A;  2YRC A;  3S3N A;  4O6J A;  2DJZ A;  5L23 A;  2L3S A;  5GAO n;  3A8G B;  2O9V A;  3OB9 A;  4ZGJ B;  4AFU C;  4OGC A;  2GNC A;  3OMC A;  1MV3 A;  1G3Y A;  2RJF A;  2O4X A;  3A8H B;  4PJN A;  2QI2 A;  1LOJ A;  1I1J A;  2DO3 A;  2HQE A;  4XU1 A;  1SHG A;  2JMA A;  3VS3 A;  2DTI A;  3E1S A;  3SWN A;  1LJO A;  1I0C A;  3MPU B;  3CBO A;  1WXB A;  1WDX A;  4PFO A;  4PKC C;  2M1H A;  5I21 A;  2LMJ A;  4HVU A;  2F2X A;  4WTO B;  1RAA B;  1G8X A;  3OYA A;  1GL5 A;  3M56 A;  4D6W A;  1OX9 A;  4XAX B;  1S72 A;  2L5Q A;  1O75 A;  4M7D G;  1Q81 C;  2DX1 A;  2DXT A;  2EGA A;  2M9U A;  3CCS T;  2FG0 A;  1D1A A;  2C0I A;  3CCL Q;  2H3J A;  4OB1 B;  2X3W D;  1Y71 A;  1YNZ A;  1RAH B;  3JSC A;  3CCV A;  2J06 A;  1D09 B;  1IHV A;  5CAI A;  1VQ7 T;  1S72 Q;  2RO0 A;  1ZA2 B;  5D7U A;  2MAM A;  5CQY A;  2K6D A;  2E3H A;  3L1A A;  4JLG A;  4GLM A;  2YDL A;  2HBP A;  4IUV A;  1GBR A;  3GNG A;  4DBH A;  2DD5 A;  3LW5 E;  3CCV Q;  2V8I A;  2H8H A;  2L3R A;  3ER0 A;  4PJO A;  5IXF A;  1WLP B;  4QW2 A;  1VQP Q;  2CZ7 B;  4FSX A;  4PJO D;  4A4K A;  4RCC A;  2CSI A;  5GJV B;  1RL2 A;  3RKX A;  1DJ7 B;  1OI1 A;  5IXB A;  2HEQ A;  2BTT A;  3PNW C;  1BCM A;  4J9F A;  4RUG A;  1G2B A;  3VJP A;  5GAN 5;  3EAE A;  2DMO A;  1BYM A;  1KHC A;  3C12 A;  3EH2 A;  4BDY A;  5GMK h;  3DLM A;  1QVG P;  1M90 R;  4GBQ A;  4OMQ A;  5FWC A;  3HRS A;  2HMA A;  3CEY A;  3TSW A;  1YI2 T;  4HXJ A;  3OBW A;  4M78 F;  1WYX A;  1GXI E;  5KYX B;  4OB0 B;  2CP3 A;  1WHJ A;  4C0Z A;  3CCS A;  2EPD A; 
#chains in the Genus database with same CATH homology
 3CD6 A;  1M1K C;  3OMG A;  1D3B A;  2VC8 A;  3CXC A;  4BE2 A;  2CKK A;  3CC7 T;  3EFR A;  5A0G A;  3BFM A;  2RJC A;  1XNI A;  4M75 G;  3UPU A;  2HD0 A;  5HKC A;  1FWZ A;  5L8R E;  2JTM A;  1QVF S;  2JN0 A;  3JCM f;  3CCQ A;  3MP1 A;  4J6W A;  3CPW A;  1VQ5 A;  3VUB A;  1K8A U;  1X01 A;  3OS0 A;  3CCL A;  2WSC E;  3TU4 K;  1YI2 A;  1YCY A;  4M7A G;  2KQW A;  4PLL A;  1XOV A;  3CMA A;  4X9C A;  1VQ7 A;  3JB9 H;  4PJO B;  5CVI A;  4A53 A;  3V8K A;  4ZN1 A;  5GAN 4;  3L2R A;  5LJ3 e;  2QXF A;  4LDV A;  2OTL T;  2CZ1 B;  1I81 A;  3SDZ A;  3WVE B;  2GFA A;  3JCM Q;  4F7U E;  3JCM h;  4M78 G;  2E6N A;  1HK9 A;  3A8O B;  2RHX A;  2X35 A;  4CRI A;  2DAQ A;  1OZ2 A;  5GAN d;  1U1S A;  3INZ A;  1VQM A;  4NL3 A;  1YIJ A;  2YLB A;  3ME9 A;  1G3T A;  5IT9 E;  4JS4 A;  4IUU A;  3L42 A;  2JVV A;  2PQW A;  5I2M A;  3UT1 A;  4LDX A;  3VU3 C;  1N8R U;  1Y7X A;  1Y96 B;  4FT4 A;  4JUV A;  2HAX A;  1YJN T;  1K9M C;  3JCM c;  1QP3 A;  4PJO F;  3M55 A;  4IUT A;  1KD1 U;  2VXE A;  4M7D C;  1P92 A;  3SD4 A;  4F7U A;  3OYK A;  2YLC A;  3M5A A;  2KAF A;  1KQ2 A;  1NJI C;  4FM4 B;  3M57 A;  3EFS A;  3P8H A;  3LWH A;  1M5Q 1;  5GAN 8;  3H6Z A;  4C8Q B;  4R56 A;  5FU6 B;  3OS2 A;  4JRK A;  1YJ9 T;  4M78 D;  4XU0 A;  2E5Q A;  3L2W A;  2XDB A;  5GAN 2;  2JTF A;  3TCJ A;  2VYT A;  3P8D A;  3OYF A;  4BAC A;  4QQD A;  3S3M A;  5HY6 A;  1VQ5 T;  4V2S A;  1RI0 A;  2CZ0 B;  3RMQ A;  3QZ5 B;  3LLR A;  3RUX A;  1UEB A;  3VV0 A;  4JJN K;  3AHU A;  3C4S A;  2OAU A;  1VQP A;  1K73 U;  2LNV A;  2BUD A;  5GAN 6;  1YHQ A;  2DIG A;  3NTK A;  5LJ5 f;  2DKG A;  3FJP A;  4B9X A;  4OB2 B;  4HT8 A;  3OYH A;  3GF5 A;  5I2S A;  3BDL A;  4L59 A;  3H8Z A;  1WJS A;  1VIE A;  4PLI A;  1YBY A;  1ZBX A;  3RES A;  1W2B S;  1VQ8 T;  2CYZ B;  1OYX A;  4PJO G;  5GMK l;  2O4X B;  2FYK A;  1Q7Y C;  2GCX A;  2EYQ A;  1YIJ T;  2GQV A;  1FX7 A;  2K4Y A;  3MO8 A;  4M77 C;  2R5A A;  5HK0 A;  1VQL A;  2RHZ A;  1B34 B;  2DEQ A;  2DPP B;  1H64 1;  2JOY A;  3MEA A;  3SWN B;  4C0D C;  2XHC A;  2RI2 A;  2LX9 A;  2EJ9 A;  1UGP B;  5CKH A;  2RJE A;  4ELZ C;  4QVC A;  3OYM A;  5GAM g;  3RKW A;  4BY6 B;  3V8J A;  4MZP A;  1M90 C;  2VXF A;  2PUK B;  4FL6 A;  3X26 B;  1EIF A;  2GF7 A;  1JBM A;  4JDS A;  3SB2 A;  3R6O A;  2QQA A;  3VKI A;  1NPP A;  2R5M A;  2QDY B;  3WVD B;  4J6Y A;  3CCR A;  4E7K A;  5KH6 A;  3OY9 A;  4M77 E;  2DVE A;  3CBM A;  3MP6 A;  3CC2 T;  2DXU A;  2EQK A;  2PUO B;  5GAO p;  4J7I A;  4BB7 A;  3CC7 A;  5C6S A;  3CCU A;  1M1K U;  2RHI A;  4HA8 A;  4QQG A;  2P0P A;  1VQ4 T;  5CO7 A;  1I4K 1;  3G4S T;  2OTJ T;  2F69 A;  5KE3 A;  3OS1 A;  4C8Q G;  2JZ2 A;  3OS5 A;  3OYB A;  1KHI A;  2E6Z A;  3ASK A;  2BIV A;  4C92 C;  1V29 B;  1VQN T;  3MEV A;  2X4X A;  1KG1 A;  3P8B B;  4L5G A;  4HCB A;  1YHQ T;  2P0Q A;  4M78 B;  3JB9 F;  3GNF B;  1N6A A;  1WJR A;  4IUQ A;  4M77 A;  4NL2 A;  2L89 A;  4TVR A;  4LD9 K;  3G7Z A;  2C06 A;  2RD1 A;  4A4G A;  2OTL A;  2A3L A;  3QJ6 A;  3J7A F;  1U1T A;  2EWN A;  3URG A;  3LH0 A;  3RIR A;  1VUB A;  2X4W A;  5J26 A;  4MZT A;  1BIA A;  4A4F A;  4XTW A;  4C92 E;  2QQ9 A;  3A8L B;  4MDW A;  2VV5 A;  3M54 A;  2ZPF B;  3CBP A;  3RKY A;  1VQ9 T;  5LJ3 j;  4F7U F;  2ZGW A;  5KCO A;  1IZ6 A;  2ZPI B;  1YJN A;  1HXD A;  3BY7 A;  4LD6 A;  3JCM P;  2DXB A;  4DOV A;  2LQK A;  5GAM e;  4OF1 A;  3TEE A;  2LT4 A;  4A4E A;  1PSF A;  1X6O A;  3PFS A;  2MWO A;  3GLX A;  3HRU A;  2MWP A;  4X34 A;  4Y91 A;  4E7J A;  4EMK B;  2D9T A;  5GAM d;  1U8R A;  4KBM B;  5LJ5 e;  1ZQ1 A;  5DLO A;  4C92 A;  1Q82 C;  3NTI A;  3CCJ T;  3LX7 A;  3CCU T;  3JB9 G;  4EDU A;  1YJ9 A;  4ZTJ A;  2DK3 A;  3KBG A;  5DY9 A;  5GMK j;  1I5L A;  1M4Z A;  4M75 C;  3FEO A;  5GAO m;  3RMS A;  4MDX A;  4JRI A;  1YIT T;  2R57 A;  3OYI A;  1VQ6 T;  3HSB A;  4P5N A;  3E19 A;  1PSE A;  2P0K A;  2XK0 A;  3QKJ A;  3SFM A;  4J5Y A;  5HK3 A;  1AHJ B;  4XK8 E;  4M7A C;  3T9N A;  3LGF A;  3M4Y A;  3PMI A;  3S6W A;  5J39 A;  3M4G A;  3F70 A;  2XDD A;  1VQ8 A;  4GY5 A;  5LJ3 d;  3BDU A;  3MEW A;  5GAO q;  4M75 E;  3JB9 D;  2YRV A;  3HHT B;  2K5L A;  1UB4 A;  3FRN A;  4JS5 A;  1Q7Y U;  2LT1 A;  1BI1 A;  4ZN3 A;  2VGN A;  2LDM A;  3M58 A;  2ZPG B;  3JCM g;  3OYJ A;  2XD0 A;  3HP9 A;  4M7A E;  1Q86 C;  1KQS S;  4QQ6 A;  2AHJ B;  5GMK e;  2XKO C;  3OW2 A;  4IKF A;  1M90 U;  2QQB A;  3L2U A;  3DKM A;  5EG2 A;  3L2Z A;  1H3Z A;  2MI6 A;  2PVO B;  3OSS C;  3JCM X;  4LDW A;  2K5F A;  1QVP A;  2RK1 A;  1UGQ B;  4EPC A;  1JJ2 S;  3CC2 A;  3QYG B;  3QSU A;  3V7S A;  2XIC A;  2M16 A;  5KE2 A;  1KC8 C;  4DQ2 A;  4PNO A;  1BI0 A;  2P4T A;  1MGQ A;  4M7A A;  1VQ4 A;  3G4S A;  2OTJ A;  3FC3 A;  4EMK C;  1X75 C;  2ZPH B;  3KXT A;  3CCE T;  4M77 F;  4N4H A;  4OP0 A;  5DLQ E;  3OA6 A;  1VQN A;  2I2L A;  1QVG S;  2E41 A;  1QW1 A;  3N5B B;  3CC4 T;  2D6F A;  2WAC A;  1NE8 A;  4HT9 A;  4J83 A;  1WPY A;  3OSV A;  2K5I A;  3NFC A;  4J6X A;  2FL7 A;  4B9W A;  3PGG A;  1BI2 A;  1WGS A;  5A0L A;  1D3B B;  1XQH A;  3GP8 A;  1BKB A;  3CPF A;  4M7D A;  3HPW A;  4PJO C;  4KUD K;  2RJD A;  3OYL A;  3OQ5 A;  3QG1 A;  5D6Y A;  1VQ9 A;  2CGH A;  1YJW T;  4N0A C;  2X4Y A;  4M7D D;  4FU6 A;  3CXC S;  3JCM e;  2IVW A;  2V8J A;  2PVG B;  3V7R A;  4KUL A;  4J8O A;  3DB4 A;  1O9S A;  3QII A;  2VGM A;  1QVF A;  2PVD B;  4C92 F;  2PU9 B;  3MEU A;  2EAY A;  3M59 A;  3GIB A;  4XTZ A;  4R55 A;  3CPW S;  2LC4 A;  4NS5 A;  4PJO E;  4VUB A;  3CCJ A;  1XTD A;  1TH7 A;  2JNG A;  2RHY A;  3VYG A;  3PMT A;  3G6E T;  4DA4 A;  2EFI A;  4XQ3 A;  4RG2 A;  1Q82 U;  5GAM j;  3I56 T;  1BI3 A;  5M9O A;  1S72 T;  2D0Q B;  5C0M A;  2QTX A;  5IAY A;  3OYY A;  3FIF A;  1YIT A;  3MET A;  1VQ6 A;  3HRT A;  4F7U B;  5LJ5 j;  3LYI A;  3JB9 J;  4C8Q C;  5FU6 C;  5GAN f;  5A0D A;  5GAO l;  4E7L A;  3ZEH A;  4CI0 C;  3KUF A;  5CIU A;  1Y07 A;  3HKS A;  1VIF A;  2DIQ A;  3C94 A;  4UC4 A;  1NZ9 A;  2F5T X;  1WQW A;  4LDU A;  4N0A A;  4XTV A;  3S3O A;  2XID A;  4LDY A;  4BUG A;  4M77 D;  3O8V A;  2K3X A;  5LJ3 h;  4BDZ A;  4II1 A;  4ATO A;  4RG8 A;  3ZFJ A;  5GAN h;  4XU2 A;  3G71 T;  2RA2 A;  4A54 A;  3J81 E;  5CK9 A;  4E7H A;  1SSF A;  4FT2 A;  4C8Q E;  3PIP A;  1G3W A;  2XG8 D;  2HQX A;  1Y96 A;  3QHS A;  3X20 B;  4E47 A;  4JRQ A;  4J7F A;  2O01 E;  3UWN A;  1NPR A;  5FRN A;  2CZ6 B;  4OGE A;  4DOW A;  1K9M U;  3V7C A;  4JLI A;  1Q86 U;  4RCB A;  3SWN C;  4EMH A;  3PIO A;  3HFO A;  2XU8 A;  3MP8 A;  2FVU A;  4O5V A;  1NJI U;  4M7D B;  2FHD A;  2ZZD A;  2E12 A;  4BY6 C;  3FLG A;  3I55 T;  2MF2 A;  4C8Q A;  3CCM T;  4M7A F;  5LJ5 d;  3OYG A;  5D6W A;  4PL6 A;  5CR2 A;  5LJ5 g;  2FB7 A;  1KC8 U;  2DZ9 A;  2E70 A;  3C95 A;  4C92 D;  1W2B A;  3S3N A;  4O6J A;  2IG0 A;  3X28 B;  2DJZ A;  1VQO T;  4XTY A;  3CCE A;  2V8K A;  1M9S A;  5FRM A;  1VQK T;  5LL6 S;  3UDC A;  3CC4 A;  4OMF B;  2E64 A;  2QEX A;  1WNL A;  5KCH A;  5GAO n;  2K57 A;  3A8G B;  3QJY A;  1N9S A;  4A4H A;  4F7U G;  3QZ9 B;  4M7D F;  3OB9 A;  3MHX A;  2QQR A;  2Y90 A;  4OGC A;  3OMC A;  4ZGJ B;  2KMT A;  3TRE A;  4Y28 E;  4MZM A;  1G3Y A;  2RJF A;  2DD4 A;  2O4X A;  3A8H B;  4KT0 E;  3V8L A;  5GAN 7;  2QI2 A;  4HKE A;  1LOJ A;  1I8F A;  3QUI A;  4M78 C;  2DO3 A;  3LGL A;  2HQE A;  3Q1J A;  4WF2 A;  4XU1 A;  1UGR B;  2DTI A;  2K3Y A;  3E1S A;  1B34 A;  3SWN A;  1LJO A;  3A5Z B;  3JCM V;  5FRO A;  2QA4 T;  1BIB A;  2L8D A;  4BI4 A;  4EMG A;  1YJW A;  1KQ1 A;  4OVA A;  5CKF A;  4Z02 A;  5GAN 3;  3CBO A;  2KK4 A;  4XTU A;  3JAM E;  4M77 B;  5J3B A;  4ZTF A;  2GFU A;  4PKC C;  2M1H A;  3GPL A;  5CKE A;  5I21 A;  4C0D B;  2E65 A;  2KY9 A;  4M75 A;  5GAN e;  3DLL A;  2M0O A;  4OB3 B;  1ZHI A;  4M78 E;  4XU3 A;  3OYA A;  1G5V A;  3M56 A;  4ZGE B;  4Q5W A;  4N4I A;  4D6W A;  5GMK i;  3OYD A;  4IUR A;  1IRE B;  3G6E A;  3GOX A;  4BI3 A;  2DTO A;  1JRI A;  2WSF E;  4M75 D;  4RKU E;  4XAX B;  3I56 A;  4FIB A;  1S72 A;  2L5Q A;  1O75 A;  4M7D G;  2JUF A;  1Q81 C;  3E9G A;  5FU7 B;  3OYN A;  2DXT A;  2B8A A;  4ELY C;  4BE1 A;  2EQU A;  3PTA A;  2E10 A;  2M9U A;  3M9Q A;  5DM7 R;  4M7A D;  3OBY A;  3CCS T;  2QEX T;  3A8M B;  2LTO A;  2KVQ G;  2XI9 A;  4M78 A;  3L2Q A;  1OZ3 A;  3HFN A;  2H3J A;  3CD6 T;  2RHU A;  4C92 B;  4M7D E;  4OB1 B;  1Y71 A;  5CKD A;  3MCA B;  3RER A;  4QVD A;  2RI3 A;  3JSC A;  3QDR B;  3G71 A;  4XTX A;  2LVM A;  4KUI A;  1K8A C;  3OYE A;  3CCQ T;  3CCV A;  4C5I A;  5GAM f;  3PT9 A;  4RMO A;  2NLU A;  4E7I A;  3JCM J;  3QO3 A;  3QYH B;  5CKB A;  1M1F A;  3CCL T;  2VUB A;  5CAI A;  1VQ7 T;  3CMA T;  4IUP A;  2ZPE B;  2EIF A;  2LCC A;  2A7Y A;  3M53 A;  2RO0 A;  2X4J A;  4BI8 B;  4YTL A;  4HCZ A;  3JCM d;  2LQ8 A;  2G3R A;  2Y4X A;  4C8Q F;  4EMK A;  2MAM A;  2WSE E;  4GLK A;  5CQY A;  5CQX A;  4M77 G;  5GAM h;  3L2V A;  2EJG A;  2CS7 A;  3FDR A;  3L1A A;  2LRQ A;  2DTH A;  4JLG A;  3I55 A;  3CCM A;  1VQM T;  3J80 E;  3QBY A;  5AYF A;  1N8R C;  2HBP A;  4NOY A;  2LCL A;  5D6X A;  4JRP A;  2DZC A;  1G3S A;  2EQM A;  2YHT A;  4ME7 A;  4MML A;  4IUV A;  5LJ5 h;  3LWI A;  1KD1 C;  2QQS A;  3GNG A;  1VQO A;  2BKD N;  5LJ3 f;  1M1G A;  2DD5 A;  1WJQ A;  1VQK A;  3X25 B;  2EJF A;  3LW5 E;  4C0G A;  4QVZ A;  5GAO r;  2V8I A;  3ER0 A;  2L3R A;  5FLX E;  4M75 B;  4PJO A;  1WQ7 A;  3ZBD A;  2Y4Y A;  3VYH B;  3CME A;  2XDP A;  3JB9 I;  4QW2 A;  3OYC A;  2K2V A;  4C5G A;  4HCC A;  1N27 A;  2E1H A;  2CZ7 B;  3QPH A;  1KQS A;  1R8O B;  4FSX A;  5FU7 C;  4L6V 5;  4PJO D;  4A4K A;  4M7A B;  4RCC A;  3HL8 A;  3VUZ A;  4C92 G;  3CCV T;  2EKO A;  3OW2 S;  2RI5 A;  2EQJ A;  2RH2 A;  3X24 B;  1RL2 A;  4BD3 A;  5A2Q E;  3RKX A;  1DJ7 B;  1OI1 A;  4C5E A;  1K73 C;  2QA4 A;  1LNX A;  1JJ2 A;  3PNW C;  2ZCF B;  1VQP T;  1QP2 A;  3JCM W;  4M75 F;  5LJ3 g;  1N9R A;  3VJP A;  3QXE B;  5GAN g;  1W4S A;  4MMK A;  3EAE A;  5IN1 A;  5GMK m;  5GAN 5;  1BYM A;  3WXM B;  1JB0 E;  1KHC A;  2DXC A;  2MMP A;  2R58 A;  2F5K A;  3C12 A;  5CCA A;  4BDY A;  5GMK h;  2ZPB B;  3DLM A;  1QVG A;  4N4G A;  2RM4 A;  1MHN A;  1UGS B;  1VQL T;  4ZGD B;  3HRS A;  3CEY A;  1YI2 T;  4C5H A;  2KSS A;  3JRZ A;  3NTH A;  4C0F A;  1FXX A;  2RB6 A;  3OBW A;  4C8Q D;  3FB9 A;  4M78 F;  5GAN j;  2KDS A;  2RK2 A;  3E9F A;  1GXI E;  4OB0 B;  3JCM b;  4X9D A;  1Q81 U;  3DB3 A;  4C0Z A;  2HNI A;  3CCS A;  4BE0 A;  1M8V A;  3CME T;  3BW1 A;  3CCR T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...